1X3QA

3d solution structure of the chromo-2 domain of cpsrp43
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
57
structure length
57
Chain Sequence
GSQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords cpSRP43
publication title 3D Solution Structure of the Chromo-2 domain of cpSRP43
rcsb
source organism Arabidopsis thaliana
total genus 3
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2005-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1x3qA00
1PFBA 3GV3A 4CJ1B 1NR2A 1ILPA 1JE4A 1HA6A 5D14A 1EQTA 5EJWA 1KNEA 2MGSA 1LV9A 3D6WA 1HUNA 3IFDA 1J9OA 1WTWA 2B2UA 1WTXA 4IURA 5CORA 1WTPA 1VMPA 3I8ZA 2CVRA 1QE6A 2B2YC 3TZDA 1G2TA 1X3QA 3MTSA 2HUGA 4IUUA 1B3AA 1AZQA 2DY7A 1BNZA 2NWGA 3HP3A 4X3KA 2RSOA 2B2VA 1RTNA 1U4LA 1E0BA 5T1GA 2MP1A 3I91A 4ZK9B 2NZ1D 2RSNA 2B2TA 1U4RA 1AP0A 3G7LA 5EKIA 3I90A 1ILQA 4ZAIA 5DNFA 1EIGA 4UAIA 1B53A 1TVXA 4X3TA 4QUFA 1IKMA 2L4NA 1G2SA 2NYZD 2JP1A 2K1BA 2KUMA 4HSVA 2Q8RE 1PFMA 1G91A 3KBXA 1QNKA 4XT3B 1B4OA 1XX8A 1DONA 1SSOA 1Q3LA 1ZXTA 2KECA 1NCVA 1PDQA 2Q8TA 4CJ2C 1WTRA 1X3PA 4RA8A 2RVLA 1RODA 1X32A 4X3SA 2K04A 3F2UA 3KUPA 5EQ0A 2HCIA 2HDLA 3N52A 2X69A 4QUCA 5CMDA 1ESRA 4RWSC 2KEDA 5D65A 1SDFA 1F9QA 3P7JA 2B2WC 2FFKB 4HEDA 3FPUB 3GV6A 1B2TA 1CM9A 1F9SA 1RHPA 5COYA 1G6ZA 3UI2A 4R9WA 3DEOA 4CJ0B 2K05A 1U4MA 5E4WC 3FDTA 1WD1A 1HUMA 2B2YA 2M2LA 3Q6SA 1BO0A 3MWYW 3TN2A 4R8IA 1BF4A 5T1IA 2EE1A 3LWEA 2MJ8A 4U68A 4ZKCB 1DOMA 2DY8A 4X3UA 5EPLA 3DEPA 3QO2A 1SAPA 1GUWA 5CBEE 2SDFA 2XIWA 1C8CA 1CA5A 1BBXC 1XYIA 1B50A 3I3CA 2FJ2A 2L12A 4O42A 2FMMA 2B2UC 1RTOA 2X6LA 1ML0D 2X6GA 4HCSA 1EIHA 1M8AA 2KOLA 1O7YA 1PLFA 1O7ZA 3R93A 4MN3A 5AFWA 1MI2A 1NAPA 4XDXA 1HHVA 4ZLTF 3IL8A 2K03A 2VXWA 2KEEA 3DM1A 2L11A 1WVLA 1DOLA 2J7ZA 4RAUC 1MSGA 1AZPA 1QG7A 4DN4M 2JYOA 3ONAB 5EPKA 1IKLA 1J8IA 2R3ZA 1PFNA 2B2TC 1U4PA 2IL8A 2RA4A 4XT1B 1JICA 4IUQA 4LMQD 2D9UA 1EL0A 5EPJA 1S4ZA 1RJTA 5JJZA 4MHEA 4ZKBB 5CBAE 3H91A 2N88A 4OIJA 2B2WA 2FINB 1HFNA 2K01A 5E4XA 1F9PA 1MSHA 1EOTA 2MPMA 2HDMA 4HAEA 4IUTA 1CA6A 1VMCA 1A15A 4NW2A 1HFGA 1F2LA 2EOTA 1NR4A 2FHTA 1HRJA 1IL8A 2H1EA 3SVMA 1DOKA 2L1BA 2L9HA 1WD0A 2HCCA 2N55A 1KNAA 2BDNA 1ICWA 1WTQA 2B2VC 2KVMA 1F9RA 1WTVA 4IUPA 4OIKA 2K28A 1MGSA 1WTOA 1O80A 2EPBA 4IUVA 1DZ1A
chains in the Genus database with same CATH superfamily
5JAVA 4X62L 2PNRC 4LF7Q 3T16A 5C3EG 1J9OA 2C9OA 1STBA 4PNYA 5LMUQ 1VMPA 1ENAA 1TS3A 5H1SE 3T1HL 2Q2HA 2MO0A 5EGTA 3UDFA 2JA7B 3X3MA 2B2VA 1U4LA 2PMZE 4MTKA 4L8JA 1YBYA 4UHVA 1U4RA 1ZYRD 4JI2Q 2NTSA 4HIOA 5KGUA 1NSNS 4Y7NH 3LWUA 3W3AA 4XT3B 1PH1A 2NVTH 1A3TA 4CJ2C 4OO1I 5GAHC 1L0XB 2CQOA 2XRQD 2PCFB 3Q24A 4GKJL 3K0YA 2K5VA 1S40A 1X3FA 4TVAB 2R61A 2ZT9C 3CAMA 4QIWE 2JA7H 1CSPA 5IWAQ 2I0QA 2F4IA 3DEOA 3CRKC 2DGYA 1SE2A 3FDTA 3L7ZC 4IPGA 2OQ0A 4M1UB 2VS1A 3SGIA 4DK6C 4DGZA 3HKZB 4C3HB 3HOWB 3PIOA 1L1OC 2PYKA 1SYCA 4R4QA 2L12A 4GNXB 1PRTC 1QZHA 2N78A 2F0DA 5JVG3 1EIYB 3KLRA 4BY7G 2PI2E 2DJGC 2H5XA 1AZPA 1UE5A 3LX0A 2F4VQ 2LMCB 1KABA 3NELA 1TY0A 1VQBA 2F0JA 1EY4A 4RGNA 1FGBD 2WB1G 3QIAA 4QL5A 2AUJD 1F2ZA 2B2WA 4RKBA 1Y8NB 1ENCA 1HCZA 3M4YA 1PH4A 4C3HH 4DR5Q 3HOWH 1TWHB 4DV1Q 3BDLA 3H0GB 1ET6A 2R7ZB 3BZKA 3SXHA 2ZXOA 1PH2A 3HOZH 2YTVA 4IO9A 4JOIC 4HCEA 4DR3L 4RH6A 2SOBA 5E4WC 3GV3A 4DV5Q 2F3VA 5D14A 3KBGA 4CDFC 4IURA 4A3IG 4B3ML 1QCBD 4IFDI 1A6XA 1QE6A 2B2YC 4V190 1TS2A 3HG9A 4K5WA 2RSOA 1IW7D 3WOEA 1CI3M 3MZ5A 2L55A 1TWHH 3VR6A 4X6AH 1STAA 3H0GH 4B3SQ 2R7ZH 1SFOB 5BR8Q 2IY5B 4QIWB 2JP1A 4HIDA 2SNSA 3S2HB 3G4SA 1FJGL 4DV3L 4MZ9A 4DV0Q 3M9BA 1X3EA 5C0XH 3CF5A 5FO7B 4A3LH 2PQEA 1JWUD 3EN2A 5I9PA 2BA0A 3K7AH 4B3RL 4A3BH 4PQXA 1GD7A 1QVCA 2Z4HA 1STEA 2DUDA 2AWNA 2M00A 4HEDA 2DNEA 1D5MC 2E2JB 3PUWA 4GKKQ 4JW0A 4A3KB 4H13C 1Q1BA 1TWCB 3MWYW 1BF4A 1X56A 1KDBA 4L5RC 5ELBA 2WACA 3IKJA 3CCSA 1VQNA 4JI5L 4LFCL 1XNRQ 2EXZA 2OWOA 1SLJA 2BCOA 1B50A 1K3BC 3I3CA 4LF4L 1I50B 2FJ2A 3VYSA 4JI3Q 2X6LA 4HCSA 4DUYQ 1SR3A 2ZXRA 2VUMG 4CBVA 2RF4A 2OCEA 1U4PA 2RA4A 4JBWA 3J7AV 4BY1B 2I07B 4ZKBB 1ZEQX 2OEOA 5HY6A 4KY7A 2EY1A 2MFIA 1SNMA 4LNQA 1TKWB 2OXPA 5C3EB 1XMQQ 3WWVA 4LK1C 2D5DA 4BBRG 4QCLA 4OHJA 4G7ZC 1CZWA 5IGCA 1I50H 1DOKA 2F0MA 2XWJB 5ISRA 1UAPA 5LMUL 5JEAG 1DJRD 4XIGS 4KHVA 2L0CA 3D8GA 1Y8OB 2NZHA 4BY1H 3M7NA 2LY7A 1EYAA 5LL6X 4N9TA 4HJ5A 3GTQH 5BN5A 5C3EH 4OX9Q 1I4RA 1CK1A 3G7LA 3HOYH 3FKIH 4L5QA 1YEZA 5TSSA 2F0WA 4LF8L 5HGQA 3NEMA 4JC0A 5IWAL 1YNJD 1KLGD 2E2DC 3GDEA 1GXDC 3T1YQ 1V43A 1TS4A 4QF4A 2ZTCA 4KKTA 4PZ8A 4LFAL 2ICIA 3K5LA 1I4GA 1B7YB 2FXQA 4RG1A 1UE6A 4GN3B 2K05A 4A3DG 1ZYRC 4TRDA 4A3CG 4BY7B 3VR5A 2KBNA 4G7HC 3F8TA 1DOMA 4UP9A 4A3EG 3PO2G 2E2IB 3S1MB 3T56B 4DR6Q 2QILA 2SDFA 4WJWA 2Z0SA 3TQYA 1MJCA 2EYOA 4JBKA 3R93A 4GLXA 4MN3A 4PMBA 5C4JB 1LM0A 1PA6A 3OWEB 3ERQA 2G5DA 2J7ZA 3OYYA 3JAMi 1H9SA 4A3FG 2E76C 3A5UA 1PFNA 4Z9CB 4XT1B 2IL8A 1ENFA 4IUQA 4LMQD 3OMGA 3L2PA 3FPPA 4DR5L 4E6IA 4DV1L 2F0EA 1C7YA 3JAML 5C4XG 1RIPA 2WFWA 1ET9A 1W6JA 3DLLA 4F7XA 4B9XA 1BKBA 4DPGA 2HDMA 2E2IH 1VMCA 3FRPB 3ICEA 4NW2A 1XMOQ 4DR7L 1STHA 4EQOA 2KQ3A 2LKVA 4IPHA 4CKBA 4DXGA 1TIID 5C4JH 3KF8B 1I4HA 2H4OA 2NZOA 1EQVA 4KD4A 2L5TA 3U9SA 4AYBG 1EWHA 2QW7A 4DR4L 1CHQD 3OTOQ 2WP8J 1IYUA 1KNEA 2HIXA 1R4PB 5M5YH 3OOCA 3QB3A 3NQTA 4LUZA 2VNUD 4EGVA 1XPRA 4B3SL 1D2BA 5BR8L 3KK7A 2CH4A 5IYCG 1Q81C 3I90A 4R8NA 4ZAIA 2EQSA 2EVBA 1WFQA 4DV2L 4K0KQ 1YZ6A 3PO3H 3VR3A 1JC7A 3I7FA 1L1OB 1II3A 4A93B 1KDAA 1X3PA 1PRTB 3FEWX 3Q22A 2JE6I 5EQ0A 2MQHA 5K5PA 4P72A 2EYMA 4FDBA 4DXFA 2RHSB 3AEVA 4ID6A 1E2ZA 1H9RA 1SDFA 1CKMA 1IW7C 4CHTB 4C1NI 4X66Q 1VQDA 2NBFA 2KCCA 3RLFA 1NY4A 2VUMB 3I4OA 2R6GA 1TU2B 1XNRL 1D8LA 3BZDB 1HR0Q 5J1ZA 2A74C 2E8GA 1G51A 1VS0A 4X3UA 3OHXC 2ZTEA 5EPLA 4DUYL 4L63B 3ERSX 2XIWA 3W1BA 2QKIC 4P74A 3O13A 4ABNA 1JE5A 1PRTD 4A93H 1BBWA 4CKCA 1AEXA 1ESFA 1O7ZA 1WCMH 1HHVA 4K6DA 1VQKA 2N3SA 5GAEC 4DV4L 2I5HA 4JV5Q 5ELFA 1M1KC 1GUNA 4DNTB 2B2TC 4LF5Q 5EAYA 4DV6L 2VUMH 1JWSD 4LF6L 1RJTA 4FP5D 3SK5A 4OIJA 3T13A 3U9OA 1VQ4A 5JJKA 2IPKD 3ND9A 3V2TA 2YTYA 1BVSA 4HAEA 4O1NA 1TXYA 4IPDA 3Q0AA 5M5WH 3IAYA 3NENA 5CV5A 5C6AA 1KHIA 1VQOA 3I8ZA 4DAYB 1EFID 1TWGH 3HOVH 3U4ZA 4KTAA 2K52A 2KENA 3R3OA 1IBLQ 3HOZG 1HZBA 1BNZA 4YHHQ 1FL0A 4R4OA 3PV0A 4DR7Q 4AQYL 2MP1A 1SYFA 1YJ9A 2KCNA 1XTDA 4KY5A 1QNUA 1D7QA 4DFAA 4NKLA 1LTRD 2K1BA 2AMCB 3H3VI 1G91A 1K8OA 2AHOB 4LW1A 1EQQA 4A3DB 1BUVT 1J5EL 4IJLA 1L2FA 2NN6H 1Q8IA 2XN9C 3G48A 1ONLA 3L9AX 1T9HA 3TP8A 2UUCL 3CW2C 2OF1A 2R7ZG 1HH2P 1SNCA 3PO2B 4RWSC 4A4IA 3RZOB 1F9QA 1PVOA 4NXML 3W1GA 4N8X1 2O5IC 2PZTA 3WOFA 4DR6L 2M2LA 1LTTD 2K33A 4HTHA 3U58A 1SNQA 4A3BG 3P1HA 4GLAC 3DXJC 4A3FB 2DY8A 3STBD 2Q2UA 3A5ZB 3DEPA 1EU3A 1FNVA 4HMIA 4A3DH 3A7AB 3CD6A 1UEAB 1BBXC 1STYA 1I4PA 5C4XB 4O2DA 1YVCA 3D4WA 2A8VA 4XDXA 3LGJA 1B9NA 2OT2A 4K8IA 2RKSA 3H6MA 3RZOH 3R2IA 2HHHQ 4JVZA 1GUOA 5IE8A 1BQQT 4G4KA 1GUTA 1UE7A 4WFN3 1PZID 2F52A 1XMOL 3RLNA 4AYBB 2QCPX 4LJZC 1H9MA 3S16H 5FK9C 4A3FH 4IUTA 2E2HH 4NMZA 5HGTA 4DV7Q 3F2DA 2H1EA 2F0FA 5IIFA 2PQAA 3EBEA 3J80i 5C4XH 2L1BA 3OTOL 2P5ZX 3GTOH 3TS2A 1NNXA 4OIKA 3VDYA 1A3VA 3JC66 1QWYA 5FLMH 4RCOA 1K73C 1A2UA 3UDIA 2HUGA 4DAMA 3OWFA 4RMFA 4ALPA 4X3KA 5KRUA 3SR1A 1HR0W 1FNWA 4V0BA 3RN2A 4K0KL 3G71A 2PZUA 1OXTA 1CQFA 4MTNA 2B63H 3D3RA 3EJIA 2VL6A 4X64Q 2OTLA 4Y7NB 1BBUA 2OTJA 1PH9A 1VQ7A 1G2SA 1SE3A 2WKDA 1PFMA 1XXGA 5IYCH 1QVGA 1GO3E 1SSOA 1ZXTA 1XJVA 1PV4A 1WJJA 3GTMB 2ASBA 3I70A 3HOYG 5C4HA 3FKIG 1VQIA 5CMDA 3QJYA 5D65A 1DCZA 2AUKA 5IP7G 2B2WC 2FFKB 2IHFA 2YV5A 1V9PA 1FR3A 2HD3A 3OIQA 1LT3D 1I94Q 1QZGA 3TBIB 1U4MA 1YHQA 1X65A 1WD1A 1J6QA 3LWEA 5M3MG 4ODGA 1CKOA 5CBEE 1S5ED 3SK6A 1C8CA 1JCKB 4FO2A 1PH8A 4XQQA 4YY3Q 4O42A 1KRSA 4JV5L 3GTMH 1PLFA 1NAPA 4OWXB 2JSOA 5ELOA 3S2DB 1VQFA 1NJIC 2N8NA 3DM1A 1JOOA 5JPNC 4JI7Q 5K36G 1PHJA 4QGUA 5F2DA 1KAAA 3TRZA 1I6VC 2YU9B 4KV6A 4IOCA 3H91A 1N36L 4QQBX 2UXBL 1EQRA 2RBMA 4PMWA 4FF2A 3L3OC 5C0XI 4JI4Q 3ULLA 3HOZB 2FHTA 1VQ9A 1NTGA 5LL6S 1WOCA 1EY7A 4HJ8A 4C3IG 3FHWA 2EYFA 4HSPA 3S2DH 3CPFA 1EY8A 1QILA 2K28A 2E75C 1IBLL 4OWWB 1DM0B 5M5XB 4YHHL 4UY8C 1MKHA 4WJ3M 1ILPA 3KDFB 1WTWA 2K5DA 4DNIA 3NBHB 4KJNA 2TSSA 1WTXA 5C4ZA 2EXDA 1LYLA 2IX0A 2CVRA 1CKNB 1G2TA 2F0VA 3RR5A 5CYUA 1JR0D 3GD7A 2YU9H 4L5SA 4Y52H 1E3PA 1ASYA 1XNQL 5C44G 1VQ5A 3W5OA 1B8AA 1KIXA 3NE5B 3AFPA 1V8QA 3NUCA 1W6KA 1Q90A 1SEBD 4GOPA 2CFMA 4X3TA 3UDGA 1K3RA 3J81i 1DD2A 2XRSD 3K81C 5LHY1 2PMZB 3CMEA 2KUMA 2K14A 4HN7A 2Q8RE 3TP6A 1B4OA 5JPMC 1QUQA 5CC4A 1VCIA 3ND8A 4XYOA 3J81L 4IUNA 5M5XH 1Q1EA 3K7AB 4A3BB 1Y1VB 1PZKD 1SYDA 1VF5C 3BYYB 3KLWA 3TP5A 3DM3A 1O78A 4JI1Q 1C4QA 1XPUA 2XWBB 2AWOA 3J7AF 3PO3G 1WTHA 4KK7A 1EYDA 1LT6D 3EROA 1EUJA 4JPBW 5AJ3Q 5IGBA 2OQKA 3FP9A 1QVFA 1HUMA 5I6YA 3KF6A 2RDGA 3TMEA 2MJ8A 2HQLA 4BBSG 1AE3A 3QOJA 1I6HH 2G9HD 1B9MA 4EQNA 1GUWA 4BWGB 3P20A 2B8FA 2F0HA 1KLUD 2HHHL 1Y1VH 4KY6A 1H95A 4F88A 1SBBB 4KKSA 2BH2A 3RNUA 2LXKA 1MIUA 1QOHA 1TY2A 4MNOA 3V05A 4GN5A 4A93G 3HS0C 4DV7L 1WCMG 3VYRA 5CV4A 1RCVD 3OMCA 3AMUA 1LTID 4LUOA 3STBC 2VQFQ 1Y1WH 3NQIA 1BCPF 1X54A 5J22A 3MXNA 4LUVA 2KHJA 5CV9A 4FXKC 3PCOB 2EJGC 1XTCD 4J1MA 5EJWA 2R7DA 4QMGA 4LF9L 1SE8A 5CORA 1X3QA 1KAWA 4YWKA 3GTQB 1MD2D 5IOCA 1EWCA 5EKLA 4ZK9B 2NZ1D 3KYHC 1BOSA 3HOYB 3FKIB 4YWMA 3HOVG 4LF7L 3D6CA 1VQGA 4IPCA 3MEFA 3M3YH 3CCVA 1K28A 1TS5A 2JEBI 5J3BA 3UE1A 1PH7A 1PDQA 3JAME 2A69C 2RVLA 5FKAC 3PIP3 1HJPA 4P73A 5M3MB 1I94L 1MHWC 1U5KA 1D5ZC 4JI2L 4YCUA 4R1JA 4JI8Q 2ICEC 4DR1Q 1PH3A 2ZJPA 3UI2A 1S3OA 1I3QH 2NN6G 3ER0A 1OO9B 5FJ8G 2XNAC 1EY6A 1Q86C 3GTGB 3M7GA 4KJOA 5IP7H 3OW2A 1EYGA 4P71A 1X3GA 4ZKCB 3IFTA 4FYDA 3I4MH 5CV6A 2KCTA 3A56A 2K5NA 3MXUA 3T51B 3BVGA 3S1NH 1IBMQ 3MFYA 4UPAA 2FMMA 2B8GA 1C0AA 5IGEA 4JI7L 5M3MH 1MI2A 1SMXA 3AB9A 1UUPA 4K2KA 3KFUA 3JAMc 4K6LA 1OXUA 3PUYA 4C3IB 2EJMA 2RCFA 4KN7C 1YITA 4B08A 1JICA 2JA6H 1EL0A 1SE4A 1R9TH 4JI6Q 2F0TA 3GTGH 3PQIA 2EYLA 4DK1A 2ZJQA 4GN4B 1EZ8A 1VQLA 1N33Q 5K36H 3CCEA 1BCPC 4RHSA 1EY5A 2Z6KC 1HRJA 3P75A 2F4VL 1DGSA 3SVMA 2RHQB 2NVTB 2L9HA 5C44B 2HCCA 3CCRA 2GVBA 3E3XA 4IUPA 2Q2TA 2NB0A 2Y0SE 5CV8A 1NR2A 5JJLA 5M5YB 1HQMC 2V1CC 2MGSA 3QWNA 4C3IH 2A6HD 4IUUA 1IZ6A 1N9WA 2C5CA 1K0RA 1S5FD 1VQJA 2NVQH 3I4NH 4GS3A 5FLMG 5KNBA 1ZKOA 4DV5L 4ZQ3A 5DNFA 2RCNA 2CWPA 3PO3B 1SXTA 3PUZA 3ZJYC 5C44H 5FLXL 2SEBD 2D2CC 2KECA 3EFXD 1LLRD 3BYTB 4X3SA 2B63G 4BBSB 3NXWA 4JYAQ 3N52A 3K57A 2KEDA 5ELCA 3N6RA 4A3MG 2R92H 2A73B 3SK8A 5M3FG 1X6OA 1K9MC 4DV0L 1RHPA 2WAQE 4IFDJ 3CQZB 1TQOA 2A6EC 1F77A 4FXGC 1P16A 2YTXA 3AYHB 3UDXA 1BO0A 3GTLH 5T1IA 1H9JA 1HNZQ 1P8LA 4HJ9A 2F0OA 2EDGA 4KHZA 4BA1I 1M90C 2BE5D 2K50A 3K59A 4GKKL 1WCMB 2UXCQ 4BBSH 4IN3A 2UUBQ 1LO5D 4OEMB 4IALA 1HNXQ 2YYZA 5LMNQ 4HJAA 1FYCA 3HOXH 3CQZH 1TT2A 1KTKA 3W2DA 2ZTDA 3NWSA 1A0IA 4JI3L 1JJCB 2M9VA 2FINB 3VA7A 4X62Q 4NP5A 4RKLA 2Q8IB 2DNCA 3DUZA 1EOTA 1Z7TA 1KD1C 5M5WB 1PYBA 1F2LA 5E1FA 2WIIB 1D6EC 2NN6I 3T1HQ 3K5MA 1WD0A 1GVPA 3J7ZC 2IWHA 2R93B 1TWGB 2GVAA 3HOVB 1WTOA 1U0LA 1UE1A 3OPOA 2EPBA 4QUFA 4IOAA 4FF1A 2JJQA 3VYUA 3DHQA 1XMQL 5D3IB 2F1MA 4QY7A 1SROA 2B2UA 1PTOB 5J39A 1E2WA 1RD9D 2A68D 2F0SA 3MVVA 4JI0Q 1BXTA 1PH6A 1LTGD 1Y14B 4K14A 4KMUC 3SK4A 2KJXA 2PW5A 1EIFA 1D1IA 1FNUA 1PYWD 4FF3A 4RGMA 2VZAA 4WRDA 3J7YW 2R93H 2CWAA 4NB3A 1IYJB 1QNKA 4PV1C 2CHBD 1TWFB 4AIMA 1EOVA 1XWEA 2Q8TA 1Y8PB 5DM63 4B9WA 2XVSA 4RA8A 1PTOD 5IP9H 3CRLC 4OX9L 4DR1L 3KUPA 4GNXA 1PTOH 4DAVA 4TSSA 4QUCA 5D3DA 2HIVA 3TEHB 3I73A 2JA8G 3CMAA 3MAQA 1B2TA 3CC7A 5COYA 4A75A 2EYPA 4CDCC 1SJHD 2GN5A 5ELNA 4JG2A 4DK0A 3OSOA 4H44C 4ZUJA 2I5LX 2JEAI 4YCVA 1CTMA 2K75A 3J80E 1PYSB 1IBML 2CKZB 3T1YL 5FJ8H 1X55A 2NVYB 2PZWA 1TWFH 4OO1G 4KD3A 4CGYB 2X6GA 1LTLA 2UXDQ 1SJED 5CGKA 2KEEA 1L0WA 1KC8C 1NMFA 1T5EA 4JI6L 4CDDC 1DOLA 1STNA 1O7LA 2Z1CA 1GUSA 3GQBA 4PZ7A 5EPKA 2LXJA 3EA6A 4I7ZC 3B6YA 4RCNA 2VQEQ 4ZCKA 4DR3Q 1Y1VG 3H09A 3S16B 2XGTA 4BS9A 2B39A 2E2HB 4ZRZA 5KNCA 3J80c 1SYGA 3K5OA 1G8ZD 2NVYH 2EOTA 4B3MQ 5G3LD 1DYQA 4P2CB 3GTOB 1EZ6A 1OXVA 2AQ3B 1K8GA 1W2BA 1KNAA 3CKIB 5C5MA 2NUCA 3URYA 4CDEC 1GUGA 2B2VC 3BVZA 3NPPA 2V4DA 3CC2A 3BJUA 1Y1WG 1H9SB 3WDNA 4KKUA 2WKCA 3D6WA 3DMUA 5CR3A 3TZDA 1FJGQ 3MTSA 4DV3Q 2VW9A 2CW0D 2NWGA 3PIO3 1VQMA 1GM5A 1EEFD 2A5HA 3PGZA 1E0BA 2BDOA 3I91A 2B63B 1LTAD 1W3SA 2Z6BA 1AP0A 3HGBA 1C9OA 1LACA 1B53A 1X9NA 4A3MB 3S1RH 5M3FB 4CKEA 5IGDA 3J80L 4IQZA 4JYAL 1DONA 3AQQA 2A69D 3DWAA 2PNHA 5LMNW 3PSIA 4F8MA 4R4IA 2A6HC 4JI5Q 2XSCA 1TWAB 3SDZA 1GKHA 3FPUB 2K32A 1VQ6A 1VF7A 2JN4A 3KOJA 3RD4A 5M9OA 3CCJA 4BA2I 4R8IA 3HOUG 4J8QA 3HZXA 4JK1C 5KNDA 4A3MH 3NBIA 5M3FH 4U68A 1JQYD 4OGQC 2IHEA 2UXCL 3F2BA 1BCPB 1C48A 4XQNA 1HNXL 4QB4A 1RKNA 5LMNL 4X66L 3E6ZX 1PTOF 2EYJA 3L0OA 1ML0D 4EX5A 1QJOA 4PG3A 1A63A 3QG1A 2EY6A 1JORA 1HR0L 4C56C 5BN4A 4A3GH 1TWAH 3I4MG 4RAUC 4AH6A 1ICFB 3NTIA 3HKSA 5IT9L 2D9UA 1AW7A 4O0AA 2F0UA 5A2QL 3MA2B 3NTHA 1EWIA 3A8KE 4GOPC 2UU9Q 5JEAJ 4L5TA 5CBAE 3J81E 5EBCA 3UE0A 1BCPD 1CA6A 4KHPQ 2N49A 2BE5C 1A15A 1LT4D 3V96A 1IL8A 3E0EA 4LF5L 4NXNQ 2JA6G 2Q2IA 2BDNA 4KI0A 2QGQA 2ZJRA 1EY9A 4J6HA 3TREA 2O5JC 1E24A 4Q5VA 4U673 2J0TD 4JI0L 3CCUA 4CJ1B 1HA6A 5FO8B 1YNXA 3BS1A 1G291 1WTPA 4LF8Q 3I2ZA 1B3AA 4HR7B 2DY7A 4I65A 3A8JE 3K58A 2QEJC 3I4LA 5ELDA 3CXCA 3H94A 2A1AA 2Z9HA 3VYTA 5I6WA 1KRTA 3J81c 5G3LF 4UAIA 4EVOA 2JA8B 1KXLA 1JMCA 4R4TA 1FGUA 2L4NA 3FVQA 4LFAQ 4XQJA 3BDCA 4K5XA 1XPOA 4P75A 5JJIA 3K8AA 4R4CA 3S1QB 2EYHA 3C1EA 5IY0A 1K8MA 4JBMA 3I4NG 5KYIA 4DF7A 2EIFA 2K04A 4UP8A 2CCZA 4OELB 1B3QA 2HDLA 4MIUA 3R8BA 1ESRA 2A68C 1HZCA 1SRUA 1TR5A 3KJPA 1WI5A 1YJNA 2A6ED 3NP8A 1NBWA 3OW7A 5JOBA 3TSSA 2EZVA 4H0LC 4LWCA 4EQPA 3PUVA 2AQ2B 1E7ZA 2Z4IA 5C3WA 3DWQA 1JOQA 3RMHA 2JA8H 1I6HB 3S9WA 1ASZA 3IRBA 3FMCA 2QF7A 5HURA 2R92G 5GAGC 2UXDL 1B44D 3S1QH 3SEBA 5C3XA 1PTOC 3BDOA 1SNPA 2E5LQ 1M8AA 3RLOA 2BOSA 2F0IA 4ZLTF 2K03A 2VQEL 2VXWA 1SNDA 2KCMA 4NPSA 3KF8A 2L11A 4OO1H 1H9KA 1CHPD 3F1ZA 3NWTA 4POFA 3EVQA 2HQEA 3GP7A 5IYDG 1S4ZA 4IJHA 3K5NA 3MHBA 1NMGA 1T5XD 1Y1WB 2JXMB 3T4AC 4DR4Q 1MSHA 4M8AA 1HA5A 4UDUC 1AFPA 1HFGA 1NR4A 3HOXG 2A19A 1Z6HA 1Q12A 4QJFA 5DAUA 4C2MB 3RZDB 3LNNA 3CPWA 1HTPA 1VQ8A 2KVMA 3CC4A 2JQOA 2C35B 1O80A 4IUVA 5EBDA 1GJXA 4IZ8A 1PFBA 1Q46A 1L1OA 3CHBD 1JE4A 1UWVA 1EY0A 4DV2Q 1PZJD 4HJ7A 5IYBH 1N32Q 3ULJA 2VB2X 1VQHA 2I5MX 4DR2Q 5T1GA 3J81j 2MHVA 3TDQA 1JOKA 1YJWA 1ILQA 2PQAB 3GTPB 1DXMA 3M3YB 1IKMA 3PUXA 3S15B 4C2MH 3RZDH 1V1QA 4DUZQ 4HSVA 3Q23A 1NE3A 1SFOH 4WORA 1F2MA 3KBXA 1PMRA 1SNOA 3D4DA 4N9PA 5E7NA 3S2HH 2Y0SG 3NHHA 3HOUB 3TS0A 1RODA 3CCQA 1GHJA 3F2UA 1LTSD 1SYEA 4JOIA 4X64L 2KHIA 5NUCA 1Q82C 2CW0C 1M4VA 2R93G 1I3QB 1CT1D 1S5CD 5KYLA 4IFDH 2E2JH 1HNWQ 1AH9A 5IP9G 1O7IA 4A3KH 1EEID 3GTPH 2B2YA 3Q6SA 5I9OA 1YHAA 1VQAA 1IBKQ 3HEJA 1TWCH 3I4MB 1Z9FA 2WB1E 3S15H 2F0GA 5I2XA 4DV4Q 3S1NB 2LSSA 4DV6Q 1MJEA 4LF6Q 1PH5A 1HTLD 3HOUH 4OWTB 1RTOA 2WINB 2KOLA 4I7AA 3H3VC 5AFWA 2AQ1B 2JK8A 4ZYSA 2J4XA 1WVLA 2UU9L 2PPBC 1V1PA 1MSGA 4DAYA 2MNAA 2F3IA 3M4QA 2WAQG 2JA6B 1IKLA 5FLXE 1R9TB 4RFBA 3D0FA 3K80C 3CCLA 5KEEA 4KHPL 5BN3A 2MO1A 4YY3L 4L6TB 5JVH3 3KLSA 3HRZC 4NXNL 4F87A 3VR4A 5DLQE 4XYQA 1N34Q 2IX3A 1D5XC 1STGA 1GHKA 3VA5A 4BXXG 1EYCA 1KDCA 1SMYC 5IGFA 1A8VA 3CP0A 4AQYQ 3R2TA 1OTCA 2O2LD 4TKOB 1E1OA 3G6JB 3EIVA 3G6EA 3IFDA 2ES2A 1AE2A 2ZM6Q 4A3JG 1AN8A 3F2CA 1J5EQ 2B3GA 5FLXc 4HIKA 1RTNA 3QR8A 3I4NB 1Q8KA 2NVQB 1B70B 1FVIA 4ME3A 4NDXA 2UUCQ 1JWMD 3QOLA 2GA4B 2D62A 4JI4L 4LFBQ 4NXMQ 2NYZD 3A54A 1S5DD 1R4QB 1XX8A 5C0XJ 1HQRD 2BA1A 1NCVA 1HZ9A 2UUAQ 4LAAA 3K6OA 1BDOA 2VB3X 2WB1B 1D1KA 2R92B 4K2LA 5I4DA 3EQLC 2JA5G 4PZ6A 2IX1A 3P7JA 4X65Q 3I56A 3AFQA 3GTLB 1CUKA 5DM73 2PO4A 4GOPB 3BVMA 3GTJB 1QB5D 2QEXA 2PW7A 4BY7H 4C3JG 2ATWA 4WJ4A 4JI1L 1YNND 1N8RC 2E5LL 2NVXB 3D31A 1QUQB 1SAPA 4ULLA 1CA5A 2ZXPA 4J15A 4A3IB 4FF4A 3S1MH 2Z8LA 5AJ3L 2B2UC 1EIHA 3BZCA 2JA9A 3IL8A 4POGA 3HOXB 1MBYA 1QG7A 4DN4M 2JYOA 1J8IA 2ID0A 3M85A 3T53B 1Q7YC 3KF6B 5EPJA 2CQAA 2B29A 5JJZA 4MHEA 2EY2A 5GQOA 1CZGA 3PIPA 3GTJH 2N88A 1VDZA 3ITPA 1HFNA 1A3UA 4Q0FA 4GLVB 3A7LA 2NVXH 4A3GG 3E9HA 4EQ5A 2F03A 1IHZA 1PFSA 5IYDH 4A3IH 4B3TQ 3CCMA 2QDLA 3I72A 4GNXC 1CQVA 2R7FA 4OXPA 4DKAC 1F9RA 3SHLA 1N32L 2G9DA 4HIMA 1OXSC 4TQUS 1DZ1A 4K8JA 2RQXA 2FMCA 3BU2A 2K4KA 5CV7A 2F0LA 2VQFL 3U50C 2Z6KA 4DR2L 1S5BD 4G7OC 1CFMA 3A55A 3GO5A 3A0JA 1AZQA 3CU7A 4ME5A 2VY3A 2Y0SB 3Q8DA 1JT8A 1FD7D 1CSQA 4DUZL 4RGOS 3RN5A 2RSNA 2ENBA 3NSWA 2AKWB 1UNSA 2F0NA 3MXNB 2KHSA 5ELEA 1SN8A 1Y69U 1V1OA 3PF5A 4FVMA 2QDBA 3SE0A 3MXGA 1K8AC 2JA7G 1PXUA 3GTKB 4RHRA 2EJFC 3C1FA 4OL7A 2HCIA 2X69A 1JB7A 1L0YB 2F3WA 1HNWL 2D0OA 1IBKL 3GV6A 1E1TA 4ZUIA 4GKJQ 1LTBD 4BBRB 3C3LA 4C1NK 2TMPA 4CJ0B 3U4VA 1I5FA 3A74A 4S3SA 1UEBA 1YIJA 2EE1A 1VQEA 3E5SA 3E9IA 2WAQB 4DNRB 3QO2A 4JI8L 1GOZA 3MEHA 4K5VA 1KL9A 3DWPA 4JBJA 2L15A 4G57A 4H7BA 4KLKA 3GTKH 3M4OB 1HZAA 2DJFC 5E3FA 1N36Q 2LS01 1O7YA 2WV6D 2UXBQ 4AYBE 4H02A 2F0KA 1I4QA 1V1PB 3ONAB 4BBRH 5IGGA 1IYVA 3HKZG 1RL2A 4C3HG 1RF2D 3KDFA 3HOWG 1EU4A 3NBHA 5C5LA 3I55A 1N34L 1CKNA 1F2YA 4DK3C 1NUCA 3C46A 2IJ0A 1K0SA 1B1ZA 5I2YA 4XXEA 5JEAH 2I46A 2K01A 4DA2A 5E4XA 3HFZB 2K5HA 3A8IE 4A3JB 3S24A 3AU7A 5DEHA 3M4OH 4FXDA 4RGTA 1XNQQ 2RDFA 2HT1A 2MUYA 2ZM6L 5A35A 1N33L 4BXXH 4UP7A 1EQTA 2E74C 1HUNA 1LV9A 3E0JA 2BH8A 4YCWA 1LT5D 3VR2A 4YWLA 4A76A 3H0GG 3HP3A 4A3EB 1OXXK 3ZYYX 1JB3A 3ULPA 4LFBL 4FNFA 3S17B 3M4PA 3NTKA 2B2TA 3MFGA 4HMJA 5EKIA 1A62A 1LUZA 5C0XG 1VQCA 4A3JH 4PMCA 3S1RB 1EIGA 2JA5B 4A3LG 1TVXA 5IYBG 3C2PA 1JJGA 2UUAL 2K5WA 2IT1A 2DN8A 5IT9E 1HPCA 5FOBB 5A2QE 1Q3LA 1YHBA 1WTRA 2IW3A 3OIPA 1X32A 4A3CH 4XTCS 4C3JB 4X65L 3NK9A 3RUZA 4GZYC 1YNJC 1YI2A 1K83B 1I4XA 2O4XA 3S14B 1G6PA 4A3EH 3PO2H 1HXYD 2F0PA 2K6AA 2RDHA 1CM9A 1F9SA 4B3RQ 1A2TA 4N8FA 3S17H 2KA7A 4R9WA 5GROA 1G6ZA 3J7A5 1JJ2A 3TN2A 2JA5H 5EKKA 3TP7A 2PI2A 3K0XA 1EFWA 2EY5A 3X3NA 2CH4W 1S72A 5KIXA 1XYIA 4IFDG 2ALYB 4KN4C 3PF4A 1PRTF 1BR9A 3KLSX 4C3JH 3TZUA 5IT9c 4A3KG 4LFCQ 3H3VH 2K7VA 4A3GB 3PMFA 1LABA 2NTTA 4OONA 1K83H 4APVA 3S14H 1HNZL 5FO9B 3D4RA 2F0QA 4LF4Q 1IXRA 2LFNA 3HKZE 2XTIA 2QA4A 2SNMA 2R3ZA 4YIJA 1KQSA 2K5QA 4DAPA 3KJOA 4B3TL 4JCVE 1U9RA 4DU9A 5L37A 2UUBL 1YNNC 4ILWA 3BG3A 1VQPA 1F9PA 2MPMA 4LF9Q 1WYDA 2D0PA 1RDPD 1SMYD 3MXPA 3H15A 2N55A 1E2VA 1Z47A 3K7UC 5GADC 1IL2A 1WTQA 1ICWA 5IODA 4BY1G 3MC0B 1WTVA 1E22A 1SYBA 1MGSA
chains in the Genus database with same CATH topology
5JAVA 2PNRC 3T16A 1J9OA 2C9OA 1STBA 4PNYA 1VMPA 1ENAA 1TS3A 5EGTA 2JA7B 3X3MA 2B2VA 1U4LA 4L8JA 1U4RA 1ZYRD 2NTSA 5KGUA 1NSNS 3LWUA 3W3AA 4XT3B 1A3TA 4CJ2C 4OO1I 1L0XB 3Q24A 2XRQD 2PCFB 3K0YA 2R61A 2ZT9C 2F4IA 3DEOA 3CRKC 1SE2A 3FDTA 3L7ZC 4M1UB 4DGZA 3HKZB 4C3HB 3HOWB 2PYKA 1SYCA 2L12A 1PRTC 2F0DA 5JVG3 3KLRA 1AZPA 3LX0A 2LMCB 1KABA 1TY0A 2F0JA 1EY4A 4RGNA 1FGBD 3QIAA 2AUJD 1F2ZA 2B2WA 4RKBA 1Y8NB 1ENCA 1HCZA 3M4YA 1TWHB 3BDLA 3H0GB 1ET6A 2R7ZB 3SXHA 2ZXOA 4HCEA 4RH6A 2SOBA 5E4WC 3GV3A 2F3VA 5D14A 3KBGA 4IURA 4IFDI 1QCBD 1A6XA 1QE6A 2B2YC 4V190 1TS2A 3HG9A 4K5WA 2RSOA 1IW7D 3WOEA 1CI3M 3MZ5A 2L55A 3VR6A 1STAA 1SFOB 4QIWB 2JP1A 2SNSA 3S2HB 5C0XH 5FO7B 2PQEA 1JWUD 5I9PA 2BA0A 4PQXA 2Z4HA 1STEA 2AWNA 2M00A 4HEDA 2DNEA 1D5MC 2E2JB 3PUWA 4A3KB 4H13C 1Q1BA 1TWCB 3MWYW 1BF4A 1KDBA 5ELBA 2WACA 3IKJA 2EXZA 2BCOA 1B50A 3I3CA 1I50B 2FJ2A 3VYSA 2X6LA 4HCSA 2ZXRA 4CBVA 1U4PA 2RA4A 4JBWA 3J7AV 4BY1B 2I07B 4ZKBB 1ZEQX 2OEOA 4KY7A 2EY1A 1SNMA 1TKWB 2OXPA 5C3EB 4LK1C 2D5DA 4QCLA 4OHJA 4G7ZC 1CZWA 5IGCA 1DOKA 2F0MA 2XWJB 5ISRA 1UAPA 5JEAG 1DJRD 4XIGS 4KHVA 2L0CA 3D8GA 1Y8OB 3M7NA 2LY7A 1EYAA 5LL6X 4N9TA 5BN5A 1I4RA 1CK1A 3G7LA 5TSSA 2F0WA 1YNJD 1KLGD 2E2DC 1GXDC 1V43A 1TS4A 4QF4A 4KKTA 2ICIA 3K5LA 1I4GA 2K05A 1ZYRC 4TRDA 4BY7B 3VR5A 4G7HC 1DOMA 2E2IB 3S1MB 3T56B 2QILA 2SDFA 4WJWA 2EYOA 3R93A 4MN3A 4PMBA 5C4JB 3OWEB 3ERQA 2J7ZA 1H9SA 2E76C 1PFNA 4Z9CB 4XT1B 2IL8A 1ENFA 4IUQA 4LMQD 3OMGA 3FPPA 4E6IA 2F0EA 3JAML 1ET9A 1W6JA 4F7XA 4B9XA 2HDMA 1VMCA 3FRPB 4NW2A 1STHA 4EQOA 2KQ3A 2LKVA 4CKBA 4DXGA 1TIID 1I4HA 2H4OA 1EQVA 4KD4A 2L5TA 3U9SA 1EWHA 1CHQD 2WP8J 1IYUA 1KNEA 1R4PB 3OOCA 3QB3A 3NQTA 2VNUD 4EGVA 1D2BA 3KK7A 3I90A 4R8NA 4ZAIA 2EVBA 3VR3A 1JC7A 1II3A 4A93B 1KDAA 1X3PA 1PRTB 3FEWX 3Q22A 2JE6I 5EQ0A 5K5PA 2EYMA 4DXFA 4ID6A 1E2ZA 1H9RA 1SDFA 1IW7C 4CHTB 4C1NI 2NBFA 2KCCA 3RLFA 2VUMB 2R6GA 1TU2B 3BZDB 5J1ZA 2A74C 4X3UA 3OHXC 5EPLA 4L63B 2XIWA 2QKIC 3O13A 4ABNA 1PRTD 4CKCA 1AEXA 1ESFA 1O7ZA 1HHVA 4K6DA 5ELFA 1GUNA 4DNTB 2B2TC 1JWSD 1RJTA 4FP5D 3SK5A 4OIJA 3T13A 3U9OA 2IPKD 3ND9A 3V2TA 4HAEA 4O1NA 3Q0AA 3IAYA 5CV5A 5C6AA 3I8ZA 1EFID 4KTAA 3R3OA 1BNZA 3PV0A 2MP1A 1SYFA 2KCNA 4KY5A 1QNUA 4DFAA 4NKLA 1LTRD 2K1BA 1G91A 1K8OA 4A3DB 1BUVT 2NN6H 1Q8IA 2XN9C 1ONLA 3L9AX 3TP8A 2OF1A 3PO2B 1SNCA 4RWSC 3RZOB 1F9QA 2O5IC 2PZTA 3WOFA 2M2LA 1LTTD 2K33A 4HTHA 1SNQA 3P1HA 3DXJC 4A3FB 2DY8A 3DEPA 1EU3A 1FNVA 4HMIA 3A7AB 1UEAB 1BBXC 1STYA 1I4PA 5C4XB 3D4WA 4XDXA 1B9NA 2OT2A 4K8IA 2RKSA 3H6MA 3R2IA 1GUOA 1BQQT 4G4KA 1GUTA 4WFN3 1PZID 4AYBB 2QCPX 4LJZC 1H9MA 5FK9C 4IUTA 4NMZA 5HGTA 2H1EA 2F0FA 5IIFA 2L1BA 4OIKA 1A3VA 1QWYA 4RCOA 1A2UA 2HUGA 3OWFA 4X3KA 5KRUA 3SR1A 1FNWA 4V0BA 2PZUA 1OXTA 1CQFA 3D3RA 3EJIA 4Y7NB 1G2SA 1SE3A 2WKDA 1PFMA 1XXGA 1SSOA 1ZXTA 3GTMB 3I70A 5C4HA 5CMDA 3QJYA 5D65A 1DCZA 2AUKA 2B2WC 2FFKB 1FR3A 3OIQA 1LT3D 3TBIB 1U4MA 1WD1A 3LWEA 4ODGA 5CBEE 1S5ED 3SK6A 1C8CA 1JCKB 4FO2A 4XQQA 4O42A 1PLFA 1NAPA 2JSOA 3S2DB 3DM1A 1JOOA 5JPNC 5K36G 5F2DA 1KAAA 1I6VC 2YU9B 4KV6A 3H91A 2RBMA 4PMWA 4FF2A 3L3OC 5C0XI 3HOZB 2FHTA 5LL6S 1EY7A 4C3IG 2EYFA 4HSPA 1EY8A 1QILA 2K28A 2E75C 1DM0B 5M5XB 1ILPA 1WTWA 2K5DA 1WTXA 4KJNA 2TSSA 5C4ZA 2IX0A 2CVRA 1G2TA 2F0VA 5CYUA 1JR0D 3GD7A 3NE5B 1V8QA 3NUCA 1W6KA 1Q90A 1SEBD 4X3TA 1DD2A 2XRSD 5LHY1 2PMZB 2KUMA 4HN7A 2Q8RE 3TP6A 1B4OA 5JPMC 5CC4A 1VCIA 3ND8A 4XYOA 3J81L 4IUNA 1Q1EA 3K7AB 4A3BB 1Y1VB 1PZKD 1SYDA 1VF5C 3BYYB 3TP5A 1O78A 1C4QA 2XWBB 2AWOA 3J7AF 4KK7A 1EYDA 1LT6D 3EROA 5IGBA 1HUMA 5I6YA 2RDGA 3TMEA 2MJ8A 3QOJA 2G9HD 1B9MA 4EQNA 1GUWA 4BWGB 3P20A 2B8FA 2F0HA 1KLUD 4KY6A 4F88A 1SBBB 4KKSA 1QOHA 1TY2A 3V05A 3HS0C 3VYRA 5CV4A 1RCVD 3OMCA 3AMUA 1LTID 3NQIA 1BCPF 5J22A 3MXNA 5CV9A 4FXKC 2EJGC 1XTCD 4J1MA 5EJWA 4QMGA 5CORA 1X3QA 3GTQB 1MD2D 5IOCA 1EWCA 5EKLA 4ZK9B 2NZ1D 3HOYB 1BOSA 3FKIB 3D6CA 1TS5A 2JEBI 1PDQA 3JAME 2A69C 2RVLA 5FKAC 3PIP3 5M3MB 1D5ZC 2ICEC 3UI2A 2NN6G 1OO9B 2XNAC 1EY6A 3GTGB 3M7GA 4KJOA 4ZKCB 3IFTA 4FYDA 5CV6A 3A56A 3MXUA 3T51B 3BVGA 3MFYA 2FMMA 2B8GA 5IGEA 1MI2A 3AB9A 1UUPA 4K2KA 4K6LA 1OXUA 3PUYA 4C3IB 2EJMA 4KN7C 4B08A 1JICA 1EL0A 1SE4A 2F0TA 2EYLA 4DK1A 1EZ8A 5K36H 1BCPC 4RHSA 1EY5A 1HRJA 3P75A 3SVMA 2NVTB 2L9HA 5C44B 2HCCA 4IUPA 2NB0A 5CV8A 1NR2A 5M5YB 1HQMC 2MGSA 3QWNA 2A6HD 4IUUA 2C5CA 1S5FD 5KNBA 1ZKOA 4ZQ3A 5DNFA 3PO3B 1SXTA 3PUZA 5FLXL 2SEBD 2D2CC 2KECA 3EFXD 1LLRD 3BYTB 4X3SA 4BBSB 3NXWA 3N52A 3K57A 2KEDA 5ELCA 3N6RA 2A73B 3SK8A 1RHPA 4IFDJ 3CQZB 1TQOA 2A6EC 1F77A 4FXGC 1BO0A 5T1IA 1H9JA 2F0OA 2EDGA 4KHZA 4BA1I 2BE5D 3K59A 1WCMB 4IN3A 1LO5D 4IALA 2YYZA 1FYCA 1TT2A 1KTKA 3W2DA 3NWSA 2M9VA 2FINB 3VA7A 4NP5A 4RKLA 2Q8IB 2DNCA 3DUZA 1EOTA 1Z7TA 5M5WB 1F2LA 5E1FA 2WIIB 1D6EC 2NN6I 3K5MA 1WD0A 2IWHA 2R93B 1TWGB 3HOVB 1WTOA 3OPOA 4QUFA 2EPBA 4FF1A 3VYUA 3DHQA 5D3IB 2F1MA 2B2UA 1PTOB 5J39A 1E2WA 1RD9D 2A68D 2F0SA 3MVVA 1BXTA 1LTGD 4KMUC 4K14A 3SK4A 2KJXA 2PW5A 1D1IA 1FNUA 1PYWD 4FF3A 4RGMA 4WRDA 3J7YW 1QNKA 4PV1C 2CHBD 1TWFB 1XWEA 5DM63 2Q8TA 1Y8PB 4B9WA 2XVSA 4RA8A 1PTOD 3CRLC 3KUPA 1PTOH 4DAVA 4TSSA 4QUCA 5D3DA 3I73A 3MAQA 1B2TA 5COYA 2EYPA 1SJHD 4DK0A 3OSOA 4H44C 4ZUJA 2JEAI 1CTMA 3J80E 2NVYB 2PZWA 4OO1G 4KD3A 4CGYB 2X6GA 1SJED 5CGKA 2KEEA 1T5EA 1DOLA 1STNA 1O7LA 2Z1CA 1GUSA 3GQBA 5EPKA 3EA6A 4I7ZC 4RCNA 3H09A 3S16B 4BS9A 2B39A 2E2HB 4ZRZA 5KNCA 1SYGA 3K5OA 1G8ZD 2EOTA 5G3LD 1DYQA 4P2CB 3GTOB 1EZ6A 1OXVA 2AQ3B 1KNAA 3CKIB 5C5MA 2NUCA 3URYA 1GUGA 2B2VC 3BVZA 3NPPA 2V4DA 1H9SB 3WDNA 4KKUA 2WKCA 3D6WA 3DMUA 5CR3A 3TZDA 3MTSA 2CW0D 2NWGA 3PIO3 1EEFD 2A5HA 1E0BA 2BDOA 3I91A 2B63B 1LTAD 1AP0A 3HGBA 1LACA 1B53A 4A3MB 5M3FB 4CKEA 5IGDA 3J80L 4IQZA 1DONA 2A69D 3DWAA 4F8MA 2A6HC 2XSCA 1TWAB 3SDZA 3FPUB 2K32A 1VF7A 3RD4A 5M9OA 4BA2I 4R8IA 4J8QA 3HZXA 4JK1C 5KNDA 3NBIA 4U68A 1JQYD 4OGQC 1BCPB 1C48A 4XQNA 4QB4A 1RKNA 3E6ZX 1PTOF 2EYJA 1ML0D 1QJOA 3QG1A 2EY6A 1JORA 4C56C 5BN4A 4RAUC 3NTIA 5IT9L 2D9UA 1AW7A 2F0UA 5A2QL 3MA2B 3NTHA 3A8KE 5JEAJ 5CBAE 3J81E 5EBCA 1BCPD 1CA6A 2BE5C 1A15A 1LT4D 3V96A 1IL8A 2BDNA 4KI0A 1EY9A 4J6HA 2O5JC 4Q5VA 4U673 2J0TD 4CJ1B 1HA6A 5FO8B 3BS1A 1G291 1WTPA 1B3AA 4HR7B 2DY7A 4I65A 3A8JE 3K58A 2QEJC 3I4LA 5ELDA 3H94A 3VYTA 5I6WA 5G3LF 4UAIA 4EVOA 2JA8B 2L4NA 3FVQA 4XQJA 3BDCA 4K5XA 3S1QB 2EYHA 3C1EA 1K8MA 5KYIA 4DF7A 2K04A 2HDLA 4MIUA 3R8BA 1ESRA 2A68C 1TR5A 2A6ED 3NP8A 3OW7A 5JOBA 3TSSA 2EZVA 4EQPA 4H0LC 3PUVA 2AQ2B 2Z4IA 5C3WA 3DWQA 1JOQA 3RMHA 1I6HB 3S9WA 3FMCA 2QF7A 5HURA 1B44D 3SEBA 5C3XA 1PTOC 3BDOA 1SNPA 1M8AA 2BOSA 4ZLTF 2F0IA 2K03A 2VXWA 1SNDA 3KF8A 2L11A 4OO1H 1H9KA 1CHPD 3NWTA 3EVQA 2HQEA 3GP7A 1S4ZA 3K5NA 3MHBA 1T5XD 1Y1WB 2JXMB 3T4AC 1MSHA 4M8AA 1HA5A 4UDUC 1AFPA 1HFGA 1NR4A 1Z6HA 1Q12A 5DAUA 4C2MB 3RZDB 3LNNA 1HTPA 2KVMA 1O80A 4IUVA 5EBDA 1GJXA 4IZ8A 1PFBA 3CHBD 1JE4A 1EY0A 1PZJD 2VB2X 5T1GA 2MHVA 3TDQA 1JOKA 1ILQA 3GTPB 1DXMA 3M3YB 1IKMA 3PUXA 3S15B 4HSVA 3Q23A 4WORA 1F2MA 3KBXA 1PMRA 1SNOA 3D4DA 4N9PA 3NHHA 3HOUB 1RODA 1GHJA 3F2UA 1LTSD 1SYEA 5NUCA 2CW0C 1M4VA 1I3QB 1CT1D 1S5CD 5KYLA 4IFDH 1EEID 2B2YA 3Q6SA 5I9OA 3HEJA 3I4MB 2F0GA 5I2XA 3S1NB 1HTLD 1RTOA 2WINB 2KOLA 3H3VC 5AFWA 2AQ1B 4ZYSA 2J4XA 1WVLA 2PPBC 1V1PA 1MSGA 4DAYA 2JA6B 1IKLA 5FLXE 1R9TB 4RFBA 5KEEA 5BN3A 4L6TB 5JVH3 3KLSA 3HRZC 4F87A 3VR4A 4XYQA 2IX3A 1D5XC 1STGA 1GHKA 3VA5A 1EYCA 1KDCA 1SMYC 5IGFA 3R2TA 2O2LD 4TKOB 3G6JB 3IFDA 1AN8A 1RTNA 3I4NB 2NVQB 4NDXA 1JWMD 3QOLA 2GA4B 2D62A 2NYZD 3A54A 1S5DD 1R4QB 1XX8A 5C0XJ 1HQRD 2BA1A 1NCVA 4LAAA 3K6OA 1BDOA 2VB3X 2WB1B 1D1KA 2R92B 4K2LA 5I4DA 3EQLC 2IX1A 3P7JA 3GTLB 5DM73 2PO4A 3BVMA 3GTJB 1QB5D 2PW7A 4C3JG 1YNND 2NVXB 3D31A 1SAPA 4ULLA 1CA5A 2ZXPA 4A3IB 4FF4A 2Z8LA 2B2UC 1EIHA 3IL8A 3HOXB 1MBYA 1QG7A 4DN4M 2JYOA 1J8IA 2ID0A 3M85A 3T53B 5EPJA 2CQAA 5JJZA 4MHEA 2EY2A 1CZGA 2N88A 1VDZA 3ITPA 1HFNA 1A3UA 4Q0FA 3A7LA 2F03A 1IHZA 3I72A 1CQVA 1F9RA 3SHLA 2G9DA 1OXSC 4TQUS 1DZ1A 4K8JA 2RQXA 2FMCA 5CV7A 2F0LA 1S5BD 4G7OC 1CFMA 3A55A 3GO5A 1AZQA 3CU7A 4ME5A 2Y0SB 1FD7D 4RGOS 2RSNA 2ENBA 3NSWA 1UNSA 2F0NA 2KHSA 5ELEA 1Y69U 1V1OA 4FVMA 2QDBA 3SE0A 3MXGA 1PXUA 3GTKB 4RHRA 2EJFC 3C1FA 4OL7A 2HCIA 2X69A 1L0YB 2F3WA 3GV6A 4ZUIA 1LTBD 4BBRB 3C3LA 4C1NK 2TMPA 4CJ0B 4S3SA 2EE1A 3E5SA 2WAQB 4DNRB 3QO2A 1GOZA 3MEHA 4K5VA 3DWPA 4G57A 4H7BA 3M4OB 5E3FA 2LS01 1O7YA 2WV6D 2F0KA 1I4QA 1V1PB 3ONAB 5IGGA 1IYVA 4C3HG 1RF2D 1EU4A 3NBHA 5C5LA 1F2YA 1NUCA 3C46A 2IJ0A 1B1ZA 5I2YA 4XXEA 5JEAH 2I46A 2K01A 4DA2A 5E4XA 3A8IE 4A3JB 3AU7A 5DEHA 4FXDA 4RGTA 2RDFA 2MUYA 5A35A 1EQTA 2E74C 1HUNA 1LV9A 3E0JA 1LT5D 3VR2A 3HP3A 4A3EB 1OXXK 3ZYYX 1JB3A 4FNFA 3S17B 3NTKA 2B2TA 3MFGA 4HMJA 5EKIA 5C0XG 4PMCA 3S1RB 1EIGA 2JA5B 1TVXA 3C2PA 2K5WA 2IT1A 2DN8A 5IT9E 1HPCA 5FOBB 5A2QE 1Q3LA 1WTRA 2IW3A 3OIPA 1X32A 4XTCS 4C3JB 3NK9A 3RUZA 4GZYC 1YNJC 1K83B 1I4XA 2O4XA 3S14B 1HXYD 2F0PA 2K6AA 2RDHA 1CM9A 1F9SA 1A2TA 1G6ZA 2KA7A 4R9WA 3TN2A 5EKKA 3TP7A 2EY5A 3X3NA 5KIXA 1XYIA 4IFDG 4KN4C 1PRTF 1BR9A 3KLSX 3TZUA 2K7VA 4A3GB 3PMFA 1LABA 2NTTA 5FO9B 3D4RA 2F0QA 2LFNA 2SNMA 2R3ZA 4YIJA 2K5QA 4DAPA 1U9RA 4DU9A 1YNNC 4ILWA 3BG3A 1F9PA 2MPMA 1RDPD 1SMYD 3MXPA 2N55A 1E2VA 1Z47A 1WTQA 1ICWA 5IODA 3MC0B 1WTVA 1SYBA 1MGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFB A;  3GV3 A;  4CJ1 B;  1NR2 A;  1ILP A;  1JE4 A;  1HA6 A;  5D14 A;  1EQT A;  5EJW A;  1KNE A;  2MGS A;  1LV9 A;  3D6W A;  1HUN A;  3IFD A;  1J9O A;  1WTW A;  2B2U A;  1WTX A;  4IUR A;  5COR A;  1WTP A;  1VMP A;  3I8Z A;  2CVR A;  1QE6 A;  2B2Y C;  3TZD A;  1G2T A;  1X3Q A;  3MTS A;  2HUG A;  4IUU A;  1B3A A;  1AZQ A;  2DY7 A;  1BNZ A;  2NWG A;  3HP3 A;  4X3K A;  2RSO A;  2B2V A;  1RTN A;  1U4L A;  1E0B A;  5T1G A;  2MP1 A;  3I91 A;  4ZK9 B;  2NZ1 D;  2RSN A;  2B2T A;  1U4R A;  1AP0 A;  3G7L A;  5EKI A;  3I90 A;  1ILQ A;  4ZAI A;  5DNF A;  1EIG A;  4UAI A;  1B53 A;  1TVX A;  4X3T A;  4QUF A;  1IKM A;  2L4N A;  1G2S A;  2NYZ D;  2JP1 A;  2K1B A;  2KUM A;  4HSV A;  2Q8R E;  1PFM A;  1G91 A;  3KBX A;  1QNK A;  4XT3 B;  1B4O A;  1XX8 A;  1DON A;  1SSO A;  1Q3L A;  1ZXT A;  2KEC A;  1NCV A;  1PDQ A;  2Q8T A;  4CJ2 C;  1WTR A;  1X3P A;  4RA8 A;  2RVL A;  1ROD A;  1X32 A;  4X3S A;  2K04 A;  3F2U A;  3KUP A;  5EQ0 A;  2HCI A;  2HDL A;  3N52 A;  2X69 A;  4QUC A;  5CMD A;  1ESR A;  4RWS C;  2KED A;  5D65 A;  1SDF A;  1F9Q A;  3P7J A;  2B2W C;  2FFK B;  4HED A;  3FPU B;  3GV6 A;  1B2T A;  1CM9 A;  1F9S A;  1RHP A;  5COY A;  1G6Z A;  3UI2 A;  4R9W A;  3DEO A;  4CJ0 B;  2K05 A;  1U4M A;  5E4W C;  3FDT A;  1WD1 A;  1HUM A;  2B2Y A;  2M2L A;  3Q6S A;  1BO0 A;  3MWY W;  3TN2 A;  4R8I A;  1BF4 A;  5T1I A;  2EE1 A;  3LWE A;  2MJ8 A;  4U68 A;  4ZKC B;  1DOM A;  2DY8 A;  4X3U A;  5EPL A;  3DEP A;  3QO2 A;  1SAP A;  1GUW A;  5CBE E;  2SDF A;  2XIW A;  1C8C A;  1CA5 A;  1BBX C;  1XYI A;  1B50 A;  3I3C A;  2FJ2 A;  2L12 A;  4O42 A;  2FMM A;  2B2U C;  1RTO A;  2X6L A;  1ML0 D;  2X6G A;  4HCS A;  1EIH A;  1M8A A;  2KOL A;  1O7Y A;  1PLF A;  1O7Z A;  3R93 A;  4MN3 A;  5AFW A;  1MI2 A;  1NAP A;  4XDX A;  1HHV A;  4ZLT F;  3IL8 A;  2K03 A;  2VXW A;  2KEE A;  3DM1 A;  2L11 A;  1WVL A;  1DOL A;  2J7Z A;  4RAU C;  1MSG A;  1AZP A;  1QG7 A;  4DN4 M;  2JYO A;  3ONA B;  5EPK A;  1IKL A;  1J8I A;  2R3Z A;  1PFN A;  2B2T C;  1U4P A;  2IL8 A;  2RA4 A;  4XT1 B;  1JIC A;  4IUQ A;  4LMQ D;  2D9U A;  1EL0 A;  5EPJ A;  1S4Z A;  1RJT A;  5JJZ A;  4MHE A;  4ZKB B;  5CBA E;  3H91 A;  2N88 A;  4OIJ A;  2B2W A;  2FIN B;  1HFN A;  2K01 A;  5E4X A;  1F9P A;  1MSH A;  1EOT A;  2MPM A;  2HDM A;  4HAE A;  4IUT A;  1CA6 A;  1VMC A;  1A15 A;  4NW2 A;  1HFG A;  1F2L A;  2EOT A;  1NR4 A;  2FHT A;  1HRJ A;  1IL8 A;  2H1E A;  3SVM A;  1DOK A;  2L1B A;  2L9H A;  1WD0 A;  2HCC A;  2N55 A;  1KNA A;  2BDN A;  1ICW A;  1WTQ A;  2B2V C;  2KVM A;  1F9R A;  1WTV A;  4IUP A;  4OIK A;  2K28 A;  1MGS A;  1WTO A;  1O80 A;  2EPB A;  4IUV A;  1DZ1 A; 
#chains in the Genus database with same CATH topology
 5JAV A;  4X62 L;  2PNR C;  4LF7 Q;  3T16 A;  5C3E G;  1J9O A;  2C9O A;  1STB A;  4PNY A;  5LMU Q;  1VMP A;  1ENA A;  1TS3 A;  5H1S E;  3T1H L;  2Q2H A;  2MO0 A;  5EGT A;  3UDF A;  2JA7 B;  3X3M A;  2B2V A;  1U4L A;  2PMZ E;  4MTK A;  4L8J A;  1YBY A;  4UHV A;  1U4R A;  1ZYR D;  4JI2 Q;  2NTS A;  4HIO A;  5KGU A;  1NSN S;  4Y7N H;  3LWU A;  3W3A A;  4XT3 B;  1PH1 A;  2NVT H;  1A3T A;  4CJ2 C;  4OO1 I;  5GAH C;  1L0X B;  2CQO A;  2XRQ D;  2PCF B;  3Q24 A;  4GKJ L;  3K0Y A;  2K5V A;  1S40 A;  1X3F A;  4TVA B;  2R61 A;  2ZT9 C;  3CAM A;  4QIW E;  2JA7 H;  1CSP A;  5IWA Q;  2I0Q A;  2F4I A;  3DEO A;  3CRK C;  2DGY A;  1SE2 A;  3FDT A;  3L7Z C;  4IPG A;  2OQ0 A;  4M1U B;  2VS1 A;  3SGI A;  4DK6 C;  4DGZ A;  3HKZ B;  4C3H B;  3HOW B;  3PIO A;  1L1O C;  2PYK A;  1SYC A;  4R4Q A;  2L12 A;  4GNX B;  1PRT C;  1QZH A;  2N78 A;  2F0D A;  5JVG 3;  1EIY B;  3KLR A;  4BY7 G;  2PI2 E;  2DJG C;  2H5X A;  1AZP A;  1UE5 A;  3LX0 A;  2F4V Q;  2LMC B;  1KAB A;  3NEL A;  1TY0 A;  1VQB A;  2F0J A;  1EY4 A;  4RGN A;  1FGB D;  2WB1 G;  3QIA A;  4QL5 A;  2AUJ D;  1F2Z A;  2B2W A;  4RKB A;  1Y8N B;  1ENC A;  1HCZ A;  3M4Y A;  1PH4 A;  4C3H H;  4DR5 Q;  3HOW H;  1TWH B;  4DV1 Q;  3BDL A;  3H0G B;  1ET6 A;  2R7Z B;  3BZK A;  3SXH A;  2ZXO A;  1PH2 A;  3HOZ H;  2YTV A;  4IO9 A;  4JOI C;  4HCE A;  4DR3 L;  4RH6 A;  2SOB A;  5E4W C;  3GV3 A;  4DV5 Q;  2F3V A;  5D14 A;  3KBG A;  4CDF C;  4IUR A;  4A3I G;  4B3M L;  1QCB D;  4IFD I;  1A6X A;  1QE6 A;  2B2Y C;  4V19 0;  1TS2 A;  3HG9 A;  4K5W A;  2RSO A;  1IW7 D;  3WOE A;  1CI3 M;  3MZ5 A;  2L55 A;  1TWH H;  3VR6 A;  4X6A H;  1STA A;  3H0G H;  4B3S Q;  2R7Z H;  1SFO B;  5BR8 Q;  2IY5 B;  4QIW B;  2JP1 A;  4HID A;  2SNS A;  3S2H B;  3G4S A;  1FJG L;  4DV3 L;  4MZ9 A;  4DV0 Q;  3M9B A;  1X3E A;  5C0X H;  3CF5 A;  5FO7 B;  4A3L H;  2PQE A;  1JWU D;  3EN2 A;  5I9P A;  2BA0 A;  3K7A H;  4B3R L;  4A3B H;  4PQX A;  1GD7 A;  1QVC A;  2Z4H A;  1STE A;  2DUD A;  2AWN A;  2M00 A;  4HED A;  2DNE A;  1D5M C;  2E2J B;  3PUW A;  4GKK Q;  4JW0 A;  4A3K B;  4H13 C;  1Q1B A;  1TWC B;  3MWY W;  1BF4 A;  1X56 A;  1KDB A;  4L5R C;  5ELB A;  2WAC A;  3IKJ A;  3CCS A;  1VQN A;  4JI5 L;  4LFC L;  1XNR Q;  2EXZ A;  2OWO A;  1SLJ A;  2BCO A;  1B50 A;  1K3B C;  3I3C A;  4LF4 L;  1I50 B;  2FJ2 A;  3VYS A;  4JI3 Q;  2X6L A;  4HCS A;  4DUY Q;  1SR3 A;  2ZXR A;  2VUM G;  4CBV A;  2RF4 A;  2OCE A;  1U4P A;  2RA4 A;  4JBW A;  3J7A V;  4BY1 B;  2I07 B;  4ZKB B;  1ZEQ X;  2OEO A;  5HY6 A;  4KY7 A;  2EY1 A;  2MFI A;  1SNM A;  4LNQ A;  1TKW B;  2OXP A;  5C3E B;  1XMQ Q;  3WWV A;  4LK1 C;  2D5D A;  4BBR G;  4QCL A;  4OHJ A;  4G7Z C;  1CZW A;  5IGC A;  1I50 H;  1DOK A;  2F0M A;  2XWJ B;  5ISR A;  1UAP A;  5LMU L;  5JEA G;  1DJR D;  4XIG S;  4KHV A;  2L0C A;  3D8G A;  1Y8O B;  2NZH A;  4BY1 H;  3M7N A;  2LY7 A;  1EYA A;  5LL6 X;  4N9T A;  4HJ5 A;  3GTQ H;  5BN5 A;  5C3E H;  4OX9 Q;  1I4R A;  1CK1 A;  3G7L A;  3HOY H;  3FKI H;  4L5Q A;  1YEZ A;  5TSS A;  2F0W A;  4LF8 L;  5HGQ A;  3NEM A;  4JC0 A;  5IWA L;  1YNJ D;  1KLG D;  2E2D C;  3GDE A;  1GXD C;  3T1Y Q;  1V43 A;  1TS4 A;  4QF4 A;  2ZTC A;  4KKT A;  4PZ8 A;  4LFA L;  2ICI A;  3K5L A;  1I4G A;  1B7Y B;  2FXQ A;  4RG1 A;  1UE6 A;  4GN3 B;  2K05 A;  4A3D G;  1ZYR C;  4TRD A;  4A3C G;  4BY7 B;  3VR5 A;  2KBN A;  4G7H C;  3F8T A;  1DOM A;  4UP9 A;  4A3E G;  3PO2 G;  2E2I B;  3S1M B;  3T56 B;  4DR6 Q;  2QIL A;  2SDF A;  4WJW A;  2Z0S A;  3TQY A;  1MJC A;  2EYO A;  4JBK A;  3R93 A;  4GLX A;  4MN3 A;  4PMB A;  5C4J B;  1LM0 A;  1PA6 A;  3OWE B;  3ERQ A;  2G5D A;  2J7Z A;  3OYY A;  3JAM i;  1H9S A;  4A3F G;  2E76 C;  3A5U A;  1PFN A;  4Z9C B;  4XT1 B;  2IL8 A;  1ENF A;  4IUQ A;  4LMQ D;  3OMG A;  3L2P A;  3FPP A;  4DR5 L;  4E6I A;  4DV1 L;  2F0E A;  1C7Y A;  3JAM L;  5C4X G;  1RIP A;  2WFW A;  1ET9 A;  1W6J A;  3DLL A;  4F7X A;  4B9X A;  1BKB A;  4DPG A;  2HDM A;  2E2I H;  1VMC A;  3FRP B;  3ICE A;  4NW2 A;  1XMO Q;  4DR7 L;  1STH A;  4EQO A;  2KQ3 A;  2LKV A;  4IPH A;  4CKB A;  4DXG A;  1TII D;  5C4J H;  3KF8 B;  1I4H A;  2H4O A;  2NZO A;  1EQV A;  4KD4 A;  2L5T A;  3U9S A;  4AYB G;  1EWH A;  2QW7 A;  4DR4 L;  1CHQ D;  3OTO Q;  2WP8 J;  1IYU A;  1KNE A;  2HIX A;  1R4P B;  5M5Y H;  3OOC A;  3QB3 A;  3NQT A;  4LUZ A;  2VNU D;  4EGV A;  1XPR A;  4B3S L;  1D2B A;  5BR8 L;  3KK7 A;  2CH4 A;  5IYC G;  1Q81 C;  3I90 A;  4R8N A;  4ZAI A;  2EQS A;  2EVB A;  1WFQ A;  4DV2 L;  4K0K Q;  1YZ6 A;  3PO3 H;  3VR3 A;  1JC7 A;  3I7F A;  1L1O B;  1II3 A;  4A93 B;  1KDA A;  1X3P A;  1PRT B;  3FEW X;  3Q22 A;  2JE6 I;  5EQ0 A;  2MQH A;  5K5P A;  4P72 A;  2EYM A;  4FDB A;  4DXF A;  2RHS B;  3AEV A;  4ID6 A;  1E2Z A;  1H9R A;  1SDF A;  1CKM A;  1IW7 C;  4CHT B;  4C1N I;  4X66 Q;  1VQD A;  2NBF A;  2KCC A;  3RLF A;  1NY4 A;  2VUM B;  3I4O A;  2R6G A;  1TU2 B;  1XNR L;  1D8L A;  3BZD B;  1HR0 Q;  5J1Z A;  2A74 C;  2E8G A;  1G51 A;  1VS0 A;  4X3U A;  3OHX C;  2ZTE A;  5EPL A;  4DUY L;  4L63 B;  3ERS X;  2XIW A;  3W1B A;  2QKI C;  4P74 A;  3O13 A;  4ABN A;  1JE5 A;  1PRT D;  4A93 H;  1BBW A;  4CKC A;  1AEX A;  1ESF A;  1O7Z A;  1WCM H;  1HHV A;  4K6D A;  1VQK A;  2N3S A;  5GAE C;  4DV4 L;  2I5H A;  4JV5 Q;  5ELF A;  1M1K C;  1GUN A;  4DNT B;  2B2T C;  4LF5 Q;  5EAY A;  4DV6 L;  2VUM H;  1JWS D;  4LF6 L;  1RJT A;  4FP5 D;  3SK5 A;  4OIJ A;  3T13 A;  3U9O A;  1VQ4 A;  5JJK A;  2IPK D;  3ND9 A;  3V2T A;  2YTY A;  1BVS A;  4HAE A;  4O1N A;  1TXY A;  4IPD A;  3Q0A A;  5M5W H;  3IAY A;  3NEN A;  5CV5 A;  5C6A A;  1KHI A;  1VQO A;  3I8Z A;  4DAY B;  1EFI D;  1TWG H;  3HOV H;  3U4Z A;  4KTA A;  2K52 A;  2KEN A;  3R3O A;  1IBL Q;  3HOZ G;  1HZB A;  1BNZ A;  4YHH Q;  1FL0 A;  4R4O A;  3PV0 A;  4DR7 Q;  4AQY L;  2MP1 A;  1SYF A;  1YJ9 A;  2KCN A;  1XTD A;  4KY5 A;  1QNU A;  1D7Q A;  4DFA A;  4NKL A;  1LTR D;  2K1B A;  2AMC B;  3H3V I;  1G91 A;  1K8O A;  2AHO B;  4LW1 A;  1EQQ A;  4A3D B;  1BUV T;  1J5E L;  4IJL A;  1L2F A;  2NN6 H;  1Q8I A;  2XN9 C;  3G48 A;  1ONL A;  3L9A X;  1T9H A;  3TP8 A;  2UUC L;  3CW2 C;  2OF1 A;  2R7Z G;  1HH2 P;  1SNC A;  3PO2 B;  4RWS C;  4A4I A;  3RZO B;  1F9Q A;  1PVO A;  4NXM L;  3W1G A;  4N8X 1;  2O5I C;  2PZT A;  3WOF A;  4DR6 L;  2M2L A;  1LTT D;  2K33 A;  4HTH A;  3U58 A;  1SNQ A;  4A3B G;  3P1H A;  4GLA C;  3DXJ C;  4A3F B;  2DY8 A;  3STB D;  2Q2U A;  3A5Z B;  3DEP A;  1EU3 A;  1FNV A;  4HMI A;  4A3D H;  3A7A B;  3CD6 A;  1UEA B;  1BBX C;  1STY A;  1I4P A;  5C4X B;  4O2D A;  1YVC A;  3D4W A;  2A8V A;  4XDX A;  3LGJ A;  1B9N A;  2OT2 A;  4K8I A;  2RKS A;  3H6M A;  3RZO H;  3R2I A;  2HHH Q;  4JVZ A;  1GUO A;  5IE8 A;  1BQQ T;  4G4K A;  1GUT A;  1UE7 A;  4WFN 3;  1PZI D;  2F52 A;  1XMO L;  3RLN A;  4AYB B;  2QCP X;  4LJZ C;  1H9M A;  3S16 H;  5FK9 C;  4A3F H;  4IUT A;  2E2H H;  4NMZ A;  5HGT A;  4DV7 Q;  3F2D A;  2H1E A;  2F0F A;  5IIF A;  2PQA A;  3EBE A;  3J80 i;  5C4X H;  2L1B A;  3OTO L;  2P5Z X;  3GTO H;  3TS2 A;  1NNX A;  4OIK A;  3VDY A;  1A3V A;  3JC6 6;  1QWY A;  5FLM H;  4RCO A;  1K73 C;  1A2U A;  3UDI A;  2HUG A;  4DAM A;  3OWF A;  4RMF A;  4ALP A;  4X3K A;  5KRU A;  3SR1 A;  1HR0 W;  1FNW A;  4V0B A;  3RN2 A;  4K0K L;  3G71 A;  2PZU A;  1OXT A;  1CQF A;  4MTN A;  2B63 H;  3D3R A;  3EJI A;  2VL6 A;  4X64 Q;  2OTL A;  4Y7N B;  1BBU A;  2OTJ A;  1PH9 A;  1VQ7 A;  1G2S A;  1SE3 A;  2WKD A;  1PFM A;  1XXG A;  5IYC H;  1QVG A;  1GO3 E;  1SSO A;  1ZXT A;  1XJV A;  1PV4 A;  1WJJ A;  3GTM B;  2ASB A;  3I70 A;  3HOY G;  5C4H A;  3FKI G;  1VQI A;  5CMD A;  3QJY A;  5D65 A;  1DCZ A;  2AUK A;  5IP7 G;  2B2W C;  2FFK B;  2IHF A;  2YV5 A;  1V9P A;  1FR3 A;  2HD3 A;  3OIQ A;  1LT3 D;  1I94 Q;  1QZG A;  3TBI B;  1U4M A;  1YHQ A;  1X65 A;  1WD1 A;  1J6Q A;  3LWE A;  5M3M G;  4ODG A;  1CKO A;  5CBE E;  1S5E D;  3SK6 A;  1C8C A;  1JCK B;  4FO2 A;  1PH8 A;  4XQQ A;  4YY3 Q;  4O42 A;  1KRS A;  4JV5 L;  3GTM H;  1PLF A;  1NAP A;  4OWX B;  2JSO A;  5ELO A;  3S2D B;  1VQF A;  1NJI C;  2N8N A;  3DM1 A;  1JOO A;  5JPN C;  4JI7 Q;  5K36 G;  1PHJ A;  4QGU A;  5F2D A;  1KAA A;  3TRZ A;  1I6V C;  2YU9 B;  4KV6 A;  4IOC A;  3H91 A;  1N36 L;  4QQB X;  2UXB L;  1EQR A;  2RBM A;  4PMW A;  4FF2 A;  3L3O C;  5C0X I;  4JI4 Q;  3ULL A;  3HOZ B;  2FHT A;  1VQ9 A;  1NTG A;  5LL6 S;  1WOC A;  1EY7 A;  4HJ8 A;  4C3I G;  3FHW A;  2EYF A;  4HSP A;  3S2D H;  3CPF A;  1EY8 A;  1QIL A;  2K28 A;  2E75 C;  1IBL L;  4OWW B;  1DM0 B;  5M5X B;  4YHH L;  4UY8 C;  1MKH A;  4WJ3 M;  1ILP A;  3KDF B;  1WTW A;  2K5D A;  4DNI A;  3NBH B;  4KJN A;  2TSS A;  1WTX A;  5C4Z A;  2EXD A;  1LYL A;  2IX0 A;  2CVR A;  1CKN B;  1G2T A;  2F0V A;  3RR5 A;  5CYU A;  1JR0 D;  3GD7 A;  2YU9 H;  4L5S A;  4Y52 H;  1E3P A;  1ASY A;  1XNQ L;  5C44 G;  1VQ5 A;  3W5O A;  1B8A A;  1KIX A;  3NE5 B;  3AFP A;  1V8Q A;  3NUC A;  1W6K A;  1Q90 A;  1SEB D;  4GOP A;  2CFM A;  4X3T A;  3UDG A;  1K3R A;  3J81 i;  1DD2 A;  2XRS D;  3K81 C;  5LHY 1;  2PMZ B;  3CME A;  2KUM A;  2K14 A;  4HN7 A;  2Q8R E;  3TP6 A;  1B4O A;  5JPM C;  1QUQ A;  5CC4 A;  1VCI A;  3ND8 A;  4XYO A;  3J81 L;  4IUN A;  5M5X H;  1Q1E A;  3K7A B;  4A3B B;  1Y1V B;  1PZK D;  1SYD A;  1VF5 C;  3BYY B;  3KLW A;  3TP5 A;  3DM3 A;  1O78 A;  4JI1 Q;  1C4Q A;  1XPU A;  2XWB B;  2AWO A;  3J7A F;  3PO3 G;  1WTH A;  4KK7 A;  1EYD A;  1LT6 D;  3ERO A;  1EUJ A;  4JPB W;  5AJ3 Q;  5IGB A;  2OQK A;  3FP9 A;  1QVF A;  1HUM A;  5I6Y A;  3KF6 A;  2RDG A;  3TME A;  2MJ8 A;  2HQL A;  4BBS G;  1AE3 A;  3QOJ A;  1I6H H;  2G9H D;  1B9M A;  4EQN A;  1GUW A;  4BWG B;  3P20 A;  2B8F A;  2F0H A;  1KLU D;  2HHH L;  1Y1V H;  4KY6 A;  1H95 A;  4F88 A;  1SBB B;  4KKS A;  2BH2 A;  3RNU A;  2LXK A;  1MIU A;  1QOH A;  1TY2 A;  4MNO A;  3V05 A;  4GN5 A;  4A93 G;  3HS0 C;  4DV7 L;  1WCM G;  3VYR A;  5CV4 A;  1RCV D;  3OMC A;  3AMU A;  1LTI D;  4LUO A;  3STB C;  2VQF Q;  1Y1W H;  3NQI A;  1BCP F;  1X54 A;  5J22 A;  3MXN A;  4LUV A;  2KHJ A;  5CV9 A;  4FXK C;  3PCO B;  2EJG C;  1XTC D;  4J1M A;  5EJW A;  2R7D A;  4QMG A;  4LF9 L;  1SE8 A;  5COR A;  1X3Q A;  1KAW A;  4YWK A;  3GTQ B;  1MD2 D;  5IOC A;  1EWC A;  5EKL A;  4ZK9 B;  2NZ1 D;  3KYH C;  1BOS A;  3HOY B;  3FKI B;  4YWM A;  3HOV G;  4LF7 L;  3D6C A;  1VQG A;  4IPC A;  3MEF A;  3M3Y H;  3CCV A;  1K28 A;  1TS5 A;  2JEB I;  5J3B A;  3UE1 A;  1PH7 A;  1PDQ A;  3JAM E;  2A69 C;  2RVL A;  5FKA C;  3PIP 3;  1HJP A;  4P73 A;  5M3M B;  1I94 L;  1MHW C;  1U5K A;  1D5Z C;  4JI2 L;  4YCU A;  4R1J A;  4JI8 Q;  2ICE C;  4DR1 Q;  1PH3 A;  2ZJP A;  3UI2 A;  1S3O A;  1I3Q H;  2NN6 G;  3ER0 A;  1OO9 B;  5FJ8 G;  2XNA C;  1EY6 A;  1Q86 C;  3GTG B;  3M7G A;  4KJO A;  5IP7 H;  3OW2 A;  1EYG A;  4P71 A;  1X3G A;  4ZKC B;  3IFT A;  4FYD A;  3I4M H;  5CV6 A;  2KCT A;  3A56 A;  2K5N A;  3MXU A;  3T51 B;  3BVG A;  3S1N H;  1IBM Q;  3MFY A;  4UPA A;  2FMM A;  2B8G A;  1C0A A;  5IGE A;  4JI7 L;  5M3M H;  1MI2 A;  1SMX A;  3AB9 A;  1UUP A;  4K2K A;  3KFU A;  3JAM c;  4K6L A;  1OXU A;  3PUY A;  4C3I B;  2EJM A;  2RCF A;  4KN7 C;  1YIT A;  4B08 A;  1JIC A;  2JA6 H;  1EL0 A;  1SE4 A;  1R9T H;  4JI6 Q;  2F0T A;  3GTG H;  3PQI A;  2EYL A;  4DK1 A;  2ZJQ A;  4GN4 B;  1EZ8 A;  1VQL A;  1N33 Q;  5K36 H;  3CCE A;  1BCP C;  4RHS A;  1EY5 A;  2Z6K C;  1HRJ A;  3P75 A;  2F4V L;  1DGS A;  3SVM A;  2RHQ B;  2NVT B;  2L9H A;  5C44 B;  2HCC A;  3CCR A;  2GVB A;  3E3X A;  4IUP A;  2Q2T A;  2NB0 A;  2Y0S E;  5CV8 A;  1NR2 A;  5JJL A;  5M5Y B;  1HQM C;  2V1C C;  2MGS A;  3QWN A;  4C3I H;  2A6H D;  4IUU A;  1IZ6 A;  1N9W A;  2C5C A;  1K0R A;  1S5F D;  1VQJ A;  2NVQ H;  3I4N H;  4GS3 A;  5FLM G;  5KNB A;  1ZKO A;  4DV5 L;  4ZQ3 A;  5DNF A;  2RCN A;  2CWP A;  3PO3 B;  1SXT A;  3PUZ A;  3ZJY C;  5C44 H;  5FLX L;  2SEB D;  2D2C C;  2KEC A;  3EFX D;  1LLR D;  3BYT B;  4X3S A;  2B63 G;  4BBS B;  3NXW A;  4JYA Q;  3N52 A;  3K57 A;  2KED A;  5ELC A;  3N6R A;  4A3M G;  2R92 H;  2A73 B;  3SK8 A;  5M3F G;  1X6O A;  1K9M C;  4DV0 L;  1RHP A;  2WAQ E;  4IFD J;  3CQZ B;  1TQO A;  2A6E C;  1F77 A;  4FXG C;  1P16 A;  2YTX A;  3AYH B;  3UDX A;  1BO0 A;  3GTL H;  5T1I A;  1H9J A;  1HNZ Q;  1P8L A;  4HJ9 A;  2F0O A;  2EDG A;  4KHZ A;  4BA1 I;  1M90 C;  2BE5 D;  2K50 A;  3K59 A;  4GKK L;  1WCM B;  2UXC Q;  4BBS H;  4IN3 A;  2UUB Q;  1LO5 D;  4OEM B;  4IAL A;  1HNX Q;  2YYZ A;  5LMN Q;  4HJA A;  1FYC A;  3HOX H;  3CQZ H;  1TT2 A;  1KTK A;  3W2D A;  2ZTD A;  3NWS A;  1A0I A;  4JI3 L;  1JJC B;  2M9V A;  2FIN B;  3VA7 A;  4X62 Q;  4NP5 A;  4RKL A;  2Q8I B;  2DNC A;  3DUZ A;  1EOT A;  1Z7T A;  1KD1 C;  5M5W B;  1PYB A;  1F2L A;  5E1F A;  2WII B;  1D6E C;  2NN6 I;  3T1H Q;  3K5M A;  1WD0 A;  1GVP A;  3J7Z C;  2IWH A;  2R93 B;  1TWG B;  2GVA A;  3HOV B;  1WTO A;  1U0L A;  1UE1 A;  3OPO A;  2EPB A;  4QUF A;  4IOA A;  4FF1 A;  2JJQ A;  3VYU A;  3DHQ A;  1XMQ L;  5D3I B;  2F1M A;  4QY7 A;  1SRO A;  2B2U A;  1PTO B;  5J39 A;  1E2W A;  1RD9 D;  2A68 D;  2F0S A;  3MVV A;  4JI0 Q;  1BXT A;  1PH6 A;  1LTG D;  1Y14 B;  4K14 A;  4KMU C;  3SK4 A;  2KJX A;  2PW5 A;  1EIF A;  1D1I A;  1FNU A;  1PYW D;  4FF3 A;  4RGM A;  2VZA A;  4WRD A;  3J7Y W;  2R93 H;  2CWA A;  4NB3 A;  1IYJ B;  1QNK A;  4PV1 C;  2CHB D;  1TWF B;  4AIM A;  1EOV A;  1XWE A;  2Q8T A;  1Y8P B;  5DM6 3;  4B9W A;  2XVS A;  4RA8 A;  1PTO D;  5IP9 H;  3CRL C;  4OX9 L;  4DR1 L;  3KUP A;  4GNX A;  1PTO H;  4DAV A;  4TSS A;  4QUC A;  5D3D A;  2HIV A;  3TEH B;  3I73 A;  2JA8 G;  3CMA A;  3MAQ A;  1B2T A;  3CC7 A;  5COY A;  4A75 A;  2EYP A;  4CDC C;  1SJH D;  2GN5 A;  5ELN A;  4JG2 A;  4DK0 A;  3OSO A;  4H44 C;  4ZUJ A;  2I5L X;  2JEA I;  4YCV A;  1CTM A;  2K75 A;  3J80 E;  1PYS B;  1IBM L;  2CKZ B;  3T1Y L;  5FJ8 H;  1X55 A;  2NVY B;  2PZW A;  1TWF H;  4OO1 G;  4KD3 A;  4CGY B;  2X6G A;  1LTL A;  2UXD Q;  1SJE D;  5CGK A;  2KEE A;  1L0W A;  1KC8 C;  1NMF A;  1T5E A;  4JI6 L;  4CDD C;  1DOL A;  1STN A;  1O7L A;  2Z1C A;  1GUS A;  3GQB A;  4PZ7 A;  5EPK A;  2LXJ A;  3EA6 A;  4I7Z C;  3B6Y A;  4RCN A;  2VQE Q;  4ZCK A;  4DR3 Q;  1Y1V G;  3H09 A;  3S16 B;  2XGT A;  4BS9 A;  2B39 A;  2E2H B;  4ZRZ A;  5KNC A;  3J80 c;  1SYG A;  3K5O A;  1G8Z D;  2NVY H;  2EOT A;  4B3M Q;  5G3L D;  1DYQ A;  4P2C B;  3GTO B;  1EZ6 A;  1OXV A;  2AQ3 B;  1K8G A;  1W2B A;  1KNA A;  3CKI B;  5C5M A;  2NUC A;  3URY A;  4CDE C;  1GUG A;  2B2V C;  3BVZ A;  3NPP A;  2V4D A;  3CC2 A;  3BJU A;  1Y1W G;  1H9S B;  3WDN A;  4KKU A;  2WKC A;  3D6W A;  3DMU A;  5CR3 A;  3TZD A;  1FJG Q;  3MTS A;  4DV3 Q;  2VW9 A;  2CW0 D;  2NWG A;  3PIO 3;  1VQM A;  1GM5 A;  1EEF D;  2A5H A;  3PGZ A;  1E0B A;  2BDO A;  3I91 A;  2B63 B;  1LTA D;  1W3S A;  2Z6B A;  1AP0 A;  3HGB A;  1C9O A;  1LAC A;  1B53 A;  1X9N A;  4A3M B;  3S1R H;  5M3F B;  4CKE A;  5IGD A;  3J80 L;  4IQZ A;  4JYA L;  1DON A;  3AQQ A;  2A69 D;  3DWA A;  2PNH A;  5LMN W;  3PSI A;  4F8M A;  4R4I A;  2A6H C;  4JI5 Q;  2XSC A;  1TWA B;  3SDZ A;  1GKH A;  3FPU B;  2K32 A;  1VQ6 A;  1VF7 A;  2JN4 A;  3KOJ A;  3RD4 A;  5M9O A;  3CCJ A;  4BA2 I;  4R8I A;  3HOU G;  4J8Q A;  3HZX A;  4JK1 C;  5KND A;  4A3M H;  3NBI A;  5M3F H;  4U68 A;  1JQY D;  4OGQ C;  2IHE A;  2UXC L;  3F2B A;  1BCP B;  1C48 A;  4XQN A;  1HNX L;  4QB4 A;  1RKN A;  5LMN L;  4X66 L;  3E6Z X;  1PTO F;  2EYJ A;  3L0O A;  1ML0 D;  4EX5 A;  1QJO A;  4PG3 A;  1A63 A;  3QG1 A;  2EY6 A;  1JOR A;  1HR0 L;  4C56 C;  5BN4 A;  4A3G H;  1TWA H;  3I4M G;  4RAU C;  4AH6 A;  1ICF B;  3NTI A;  3HKS A;  5IT9 L;  2D9U A;  1AW7 A;  4O0A A;  2F0U A;  5A2Q L;  3MA2 B;  3NTH A;  1EWI A;  3A8K E;  4GOP C;  2UU9 Q;  5JEA J;  4L5T A;  5CBA E;  3J81 E;  5EBC A;  3UE0 A;  1BCP D;  1CA6 A;  4KHP Q;  2N49 A;  2BE5 C;  1A15 A;  1LT4 D;  3V96 A;  1IL8 A;  3E0E A;  4LF5 L;  4NXN Q;  2JA6 G;  2Q2I A;  2BDN A;  4KI0 A;  2QGQ A;  2ZJR A;  1EY9 A;  4J6H A;  3TRE A;  2O5J C;  1E24 A;  4Q5V A;  4U67 3;  2J0T D;  4JI0 L;  3CCU A;  4CJ1 B;  1HA6 A;  5FO8 B;  1YNX A;  3BS1 A;  1G29 1;  1WTP A;  4LF8 Q;  3I2Z A;  1B3A A;  4HR7 B;  2DY7 A;  4I65 A;  3A8J E;  3K58 A;  2QEJ C;  3I4L A;  5ELD A;  3CXC A;  3H94 A;  2A1A A;  2Z9H A;  3VYT A;  5I6W A;  1KRT A;  3J81 c;  5G3L F;  4UAI A;  4EVO A;  2JA8 B;  1KXL A;  1JMC A;  4R4T A;  1FGU A;  2L4N A;  3FVQ A;  4LFA Q;  4XQJ A;  3BDC A;  4K5X A;  1XPO A;  4P75 A;  5JJI A;  3K8A A;  4R4C A;  3S1Q B;  2EYH A;  3C1E A;  5IY0 A;  1K8M A;  4JBM A;  3I4N G;  5KYI A;  4DF7 A;  2EIF A;  2K04 A;  4UP8 A;  2CCZ A;  4OEL B;  1B3Q A;  2HDL A;  4MIU A;  3R8B A;  1ESR A;  2A68 C;  1HZC A;  1SRU A;  1TR5 A;  3KJP A;  1WI5 A;  1YJN A;  2A6E D;  3NP8 A;  1NBW A;  3OW7 A;  5JOB A;  3TSS A;  2EZV A;  4H0L C;  4LWC A;  4EQP A;  3PUV A;  2AQ2 B;  1E7Z A;  2Z4I A;  5C3W A;  3DWQ A;  1JOQ A;  3RMH A;  2JA8 H;  1I6H B;  3S9W A;  1ASZ A;  3IRB A;  3FMC A;  2QF7 A;  5HUR A;  2R92 G;  5GAG C;  2UXD L;  1B44 D;  3S1Q H;  3SEB A;  5C3X A;  1PTO C;  3BDO A;  1SNP A;  2E5L Q;  1M8A A;  3RLO A;  2BOS A;  2F0I A;  4ZLT F;  2K03 A;  2VQE L;  2VXW A;  1SND A;  2KCM A;  4NPS A;  3KF8 A;  2L11 A;  4OO1 H;  1H9K A;  1CHP D;  3F1Z A;  3NWT A;  4POF A;  3EVQ A;  2HQE A;  3GP7 A;  5IYD G;  1S4Z A;  4IJH A;  3K5N A;  3MHB A;  1NMG A;  1T5X D;  1Y1W B;  2JXM B;  3T4A C;  4DR4 Q;  1MSH A;  4M8A A;  1HA5 A;  4UDU C;  1AFP A;  1HFG A;  1NR4 A;  3HOX G;  2A19 A;  1Z6H A;  1Q12 A;  4QJF A;  5DAU A;  4C2M B;  3RZD B;  3LNN A;  3CPW A;  1HTP A;  1VQ8 A;  2KVM A;  3CC4 A;  2JQO A;  2C35 B;  1O80 A;  4IUV A;  5EBD A;  1GJX A;  4IZ8 A;  1PFB A;  1Q46 A;  1L1O A;  3CHB D;  1JE4 A;  1UWV A;  1EY0 A;  4DV2 Q;  1PZJ D;  4HJ7 A;  5IYB H;  1N32 Q;  3ULJ A;  2VB2 X;  1VQH A;  2I5M X;  4DR2 Q;  5T1G A;  3J81 j;  2MHV A;  3TDQ A;  1JOK A;  1YJW A;  1ILQ A;  2PQA B;  3GTP B;  1DXM A;  3M3Y B;  1IKM A;  3PUX A;  3S15 B;  4C2M H;  3RZD H;  1V1Q A;  4DUZ Q;  4HSV A;  3Q23 A;  1NE3 A;  1SFO H;  4WOR A;  1F2M A;  3KBX A;  1PMR A;  1SNO A;  3D4D A;  4N9P A;  5E7N A;  3S2H H;  2Y0S G;  3NHH A;  3HOU B;  3TS0 A;  1ROD A;  3CCQ A;  1GHJ A;  3F2U A;  1LTS D;  1SYE A;  4JOI A;  4X64 L;  2KHI A;  5NUC A;  1Q82 C;  2CW0 C;  1M4V A;  2R93 G;  1I3Q B;  1CT1 D;  1S5C D;  5KYL A;  4IFD H;  2E2J H;  1HNW Q;  1AH9 A;  5IP9 G;  1O7I A;  4A3K H;  1EEI D;  3GTP H;  2B2Y A;  3Q6S A;  5I9O A;  1YHA A;  1VQA A;  1IBK Q;  3HEJ A;  1TWC H;  3I4M B;  1Z9F A;  2WB1 E;  3S15 H;  2F0G A;  5I2X A;  4DV4 Q;  3S1N B;  2LSS A;  4DV6 Q;  1MJE A;  4LF6 Q;  1PH5 A;  1HTL D;  3HOU H;  4OWT B;  1RTO A;  2WIN B;  2KOL A;  4I7A A;  3H3V C;  5AFW A;  2AQ1 B;  2JK8 A;  4ZYS A;  2J4X A;  1WVL A;  2UU9 L;  2PPB C;  1V1P A;  1MSG A;  4DAY A;  2MNA A;  2F3I A;  3M4Q A;  2WAQ G;  2JA6 B;  1IKL A;  5FLX E;  1R9T B;  4RFB A;  3D0F A;  3K80 C;  3CCL A;  5KEE A;  4KHP L;  5BN3 A;  2MO1 A;  4YY3 L;  4L6T B;  5JVH 3;  3KLS A;  3HRZ C;  4NXN L;  4F87 A;  3VR4 A;  5DLQ E;  4XYQ A;  1N34 Q;  2IX3 A;  1D5X C;  1STG A;  1GHK A;  3VA5 A;  4BXX G;  1EYC A;  1KDC A;  1SMY C;  5IGF A;  1A8V A;  3CP0 A;  4AQY Q;  3R2T A;  1OTC A;  2O2L D;  4TKO B;  1E1O A;  3G6J B;  3EIV A;  3G6E A;  3IFD A;  2ES2 A;  1AE2 A;  2ZM6 Q;  4A3J G;  1AN8 A;  3F2C A;  1J5E Q;  2B3G A;  5FLX c;  4HIK A;  1RTN A;  3QR8 A;  3I4N B;  1Q8K A;  2NVQ B;  1B70 B;  1FVI A;  4ME3 A;  4NDX A;  2UUC Q;  1JWM D;  3QOL A;  2GA4 B;  2D62 A;  4JI4 L;  4LFB Q;  4NXM Q;  2NYZ D;  3A54 A;  1S5D D;  1R4Q B;  1XX8 A;  5C0X J;  1HQR D;  2BA1 A;  1NCV A;  1HZ9 A;  2UUA Q;  4LAA A;  3K6O A;  1BDO A;  2VB3 X;  2WB1 B;  1D1K A;  2R92 B;  4K2L A;  5I4D A;  3EQL C;  2JA5 G;  4PZ6 A;  2IX1 A;  3P7J A;  4X65 Q;  3I56 A;  3AFQ A;  3GTL B;  1CUK A;  5DM7 3;  2PO4 A;  4GOP B;  3BVM A;  3GTJ B;  1QB5 D;  2QEX A;  2PW7 A;  4BY7 H;  4C3J G;  2ATW A;  4WJ4 A;  4JI1 L;  1YNN D;  1N8R C;  2E5L L;  2NVX B;  3D31 A;  1QUQ B;  1SAP A;  4ULL A;  1CA5 A;  2ZXP A;  4J15 A;  4A3I B;  4FF4 A;  3S1M H;  2Z8L A;  5AJ3 L;  2B2U C;  1EIH A;  3BZC A;  2JA9 A;  3IL8 A;  4POG A;  3HOX B;  1MBY A;  1QG7 A;  4DN4 M;  2JYO A;  1J8I A;  2ID0 A;  3M85 A;  3T53 B;  1Q7Y C;  3KF6 B;  5EPJ A;  2CQA A;  2B29 A;  5JJZ A;  4MHE A;  2EY2 A;  5GQO A;  1CZG A;  3PIP A;  3GTJ H;  2N88 A;  1VDZ A;  3ITP A;  1HFN A;  1A3U A;  4Q0F A;  4GLV B;  3A7L A;  2NVX H;  4A3G G;  3E9H A;  4EQ5 A;  2F03 A;  1IHZ A;  1PFS A;  5IYD H;  4A3I H;  4B3T Q;  3CCM A;  2QDL A;  3I72 A;  4GNX C;  1CQV A;  2R7F A;  4OXP A;  4DKA C;  1F9R A;  3SHL A;  1N32 L;  2G9D A;  4HIM A;  1OXS C;  4TQU S;  1DZ1 A;  4K8J A;  2RQX A;  2FMC A;  3BU2 A;  2K4K A;  5CV7 A;  2F0L A;  2VQF L;  3U50 C;  2Z6K A;  4DR2 L;  1S5B D;  4G7O C;  1CFM A;  3A55 A;  3GO5 A;  3A0J A;  1AZQ A;  3CU7 A;  4ME5 A;  2VY3 A;  2Y0S B;  3Q8D A;  1JT8 A;  1FD7 D;  1CSQ A;  4DUZ L;  4RGO S;  3RN5 A;  2RSN A;  2ENB A;  3NSW A;  2AKW B;  1UNS A;  2F0N A;  3MXN B;  2KHS A;  5ELE A;  1SN8 A;  1Y69 U;  1V1O A;  3PF5 A;  4FVM A;  2QDB A;  3SE0 A;  3MXG A;  1K8A C;  2JA7 G;  1PXU A;  3GTK B;  4RHR A;  2EJF C;  3C1F A;  4OL7 A;  2HCI A;  2X69 A;  1JB7 A;  1L0Y B;  2F3W A;  1HNW L;  2D0O A;  1IBK L;  3GV6 A;  1E1T A;  4ZUI A;  4GKJ Q;  1LTB D;  4BBR B;  3C3L A;  4C1N K;  2TMP A;  4CJ0 B;  3U4V A;  1I5F A;  3A74 A;  4S3S A;  1UEB A;  1YIJ A;  2EE1 A;  1VQE A;  3E5S A;  3E9I A;  2WAQ B;  4DNR B;  3QO2 A;  4JI8 L;  1GOZ A;  3MEH A;  4K5V A;  1KL9 A;  3DWP A;  4JBJ A;  2L15 A;  4G57 A;  4H7B A;  4KLK A;  3GTK H;  3M4O B;  1HZA A;  2DJF C;  5E3F A;  1N36 Q;  2LS0 1;  1O7Y A;  2WV6 D;  2UXB Q;  4AYB E;  4H02 A;  2F0K A;  1I4Q A;  1V1P B;  3ONA B;  4BBR H;  5IGG A;  1IYV A;  3HKZ G;  1RL2 A;  4C3H G;  1RF2 D;  3KDF A;  3HOW G;  1EU4 A;  3NBH A;  5C5L A;  3I55 A;  1N34 L;  1CKN A;  1F2Y A;  4DK3 C;  1NUC A;  3C46 A;  2IJ0 A;  1K0S A;  1B1Z A;  5I2Y A;  4XXE A;  5JEA H;  2I46 A;  2K01 A;  4DA2 A;  5E4X A;  3HFZ B;  2K5H A;  3A8I E;  4A3J B;  3S24 A;  3AU7 A;  5DEH A;  3M4O H;  4FXD A;  4RGT A;  1XNQ Q;  2RDF A;  2HT1 A;  2MUY A;  2ZM6 L;  5A35 A;  1N33 L;  4BXX H;  4UP7 A;  1EQT A;  2E74 C;  1HUN A;  1LV9 A;  3E0J A;  2BH8 A;  4YCW A;  1LT5 D;  3VR2 A;  4YWL A;  4A76 A;  3H0G G;  3HP3 A;  4A3E B;  1OXX K;  3ZYY X;  1JB3 A;  3ULP A;  4LFB L;  4FNF A;  3S17 B;  3M4P A;  3NTK A;  2B2T A;  3MFG A;  4HMJ A;  5EKI A;  1A62 A;  1LUZ A;  5C0X G;  1VQC A;  4A3J H;  4PMC A;  3S1R B;  1EIG A;  2JA5 B;  4A3L G;  1TVX A;  5IYB G;  3C2P A;  1JJG A;  2UUA L;  2K5W A;  2IT1 A;  2DN8 A;  5IT9 E;  1HPC A;  5FOB B;  5A2Q E;  1Q3L A;  1YHB A;  1WTR A;  2IW3 A;  3OIP A;  1X32 A;  4A3C H;  4XTC S;  4C3J B;  4X65 L;  3NK9 A;  3RUZ A;  4GZY C;  1YNJ C;  1YI2 A;  1K83 B;  1I4X A;  2O4X A;  3S14 B;  1G6P A;  4A3E H;  3PO2 H;  1HXY D;  2F0P A;  2K6A A;  2RDH A;  1CM9 A;  1F9S A;  4B3R Q;  1A2T A;  4N8F A;  3S17 H;  2KA7 A;  4R9W A;  5GRO A;  1G6Z A;  3J7A 5;  1JJ2 A;  3TN2 A;  2JA5 H;  5EKK A;  3TP7 A;  2PI2 A;  3K0X A;  1EFW A;  2EY5 A;  3X3N A;  2CH4 W;  1S72 A;  5KIX A;  1XYI A;  4IFD G;  2ALY B;  4KN4 C;  3PF4 A;  1PRT F;  1BR9 A;  3KLS X;  4C3J H;  3TZU A;  5IT9 c;  4A3K G;  4LFC Q;  3H3V H;  2K7V A;  4A3G B;  3PMF A;  1LAB A;  2NTT A;  4OON A;  1K83 H;  4APV A;  3S14 H;  1HNZ L;  5FO9 B;  3D4R A;  2F0Q A;  4LF4 Q;  1IXR A;  2LFN A;  3HKZ E;  2XTI A;  2QA4 A;  2SNM A;  2R3Z A;  4YIJ A;  1KQS A;  2K5Q A;  4DAP A;  3KJO A;  4B3T L;  4JCV E;  1U9R A;  4DU9 A;  5L37 A;  2UUB L;  1YNN C;  4ILW A;  3BG3 A;  1VQP A;  1F9P A;  2MPM A;  4LF9 Q;  1WYD A;  2D0P A;  1RDP D;  1SMY D;  3MXP A;  3H15 A;  2N55 A;  1E2V A;  1Z47 A;  3K7U C;  5GAD C;  1IL2 A;  1WTQ A;  1ICW A;  5IOD A;  4BY1 G;  3MC0 B;  1WTV A;  1E22 A;  1SYB A;  1MGS A; 
#chains in the Genus database with same CATH homology
 5JAV A;  2PNR C;  3T16 A;  1J9O A;  2C9O A;  1STB A;  4PNY A;  1VMP A;  1ENA A;  1TS3 A;  5EGT A;  2JA7 B;  3X3M A;  2B2V A;  1U4L A;  4L8J A;  1U4R A;  1ZYR D;  2NTS A;  5KGU A;  1NSN S;  3LWU A;  3W3A A;  4XT3 B;  1A3T A;  4CJ2 C;  4OO1 I;  1L0X B;  3Q24 A;  2XRQ D;  2PCF B;  3K0Y A;  2R61 A;  2ZT9 C;  2F4I A;  3DEO A;  3CRK C;  1SE2 A;  3FDT A;  3L7Z C;  4M1U B;  4DGZ A;  3HKZ B;  4C3H B;  3HOW B;  2PYK A;  1SYC A;  2L12 A;  1PRT C;  2F0D A;  5JVG 3;  3KLR A;  1AZP A;  3LX0 A;  2LMC B;  1KAB A;  1TY0 A;  2F0J A;  1EY4 A;  4RGN A;  1FGB D;  3QIA A;  2AUJ D;  1F2Z A;  2B2W A;  4RKB A;  1Y8N B;  1ENC A;  1HCZ A;  3M4Y A;  1TWH B;  3BDL A;  3H0G B;  1ET6 A;  2R7Z B;  3SXH A;  2ZXO A;  4HCE A;  4RH6 A;  2SOB A;  5E4W C;  3GV3 A;  2F3V A;  5D14 A;  3KBG A;  4IUR A;  4IFD I;  1QCB D;  1A6X A;  1QE6 A;  2B2Y C;  4V19 0;  1TS2 A;  3HG9 A;  4K5W A;  2RSO A;  1IW7 D;  3WOE A;  1CI3 M;  3MZ5 A;  2L55 A;  3VR6 A;  1STA A;  1SFO B;  4QIW B;  2JP1 A;  2SNS A;  3S2H B;  5C0X H;  5FO7 B;  2PQE A;  1JWU D;  5I9P A;  2BA0 A;  4PQX A;  2Z4H A;  1STE A;  2AWN A;  2M00 A;  4HED A;  2DNE A;  1D5M C;  2E2J B;  3PUW A;  4A3K B;  4H13 C;  1Q1B A;  1TWC B;  3MWY W;  1BF4 A;  1KDB A;  5ELB A;  2WAC A;  3IKJ A;  2EXZ A;  2BCO A;  1B50 A;  3I3C A;  1I50 B;  2FJ2 A;  3VYS A;  2X6L A;  4HCS A;  2ZXR A;  4CBV A;  1U4P A;  2RA4 A;  4JBW A;  3J7A V;  4BY1 B;  2I07 B;  4ZKB B;  1ZEQ X;  2OEO A;  4KY7 A;  2EY1 A;  1SNM A;  1TKW B;  2OXP A;  5C3E B;  4LK1 C;  2D5D A;  4QCL A;  4OHJ A;  4G7Z C;  1CZW A;  5IGC A;  1DOK A;  2F0M A;  2XWJ B;  5ISR A;  1UAP A;  5JEA G;  1DJR D;  4XIG S;  4KHV A;  2L0C A;  3D8G A;  1Y8O B;  3M7N A;  2LY7 A;  1EYA A;  5LL6 X;  4N9T A;  5BN5 A;  1I4R A;  1CK1 A;  3G7L A;  5TSS A;  2F0W A;  1YNJ D;  1KLG D;  2E2D C;  1GXD C;  1V43 A;  1TS4 A;  4QF4 A;  4KKT A;  2ICI A;  3K5L A;  1I4G A;  2K05 A;  1ZYR C;  4TRD A;  4BY7 B;  3VR5 A;  4G7H C;  1DOM A;  2E2I B;  3S1M B;  3T56 B;  2QIL A;  2SDF A;  4WJW A;  2EYO A;  3R93 A;  4MN3 A;  4PMB A;  5C4J B;  3OWE B;  3ERQ A;  2J7Z A;  1H9S A;  2E76 C;  1PFN A;  4Z9C B;  4XT1 B;  2IL8 A;  1ENF A;  4IUQ A;  4LMQ D;  3OMG A;  3FPP A;  4E6I A;  2F0E A;  3JAM L;  1ET9 A;  1W6J A;  4F7X A;  4B9X A;  2HDM A;  1VMC A;  3FRP B;  4NW2 A;  1STH A;  4EQO A;  2KQ3 A;  2LKV A;  4CKB A;  4DXG A;  1TII D;  1I4H A;  2H4O A;  1EQV A;  4KD4 A;  2L5T A;  3U9S A;  1EWH A;  1CHQ D;  2WP8 J;  1IYU A;  1KNE A;  1R4P B;  3OOC A;  3QB3 A;  3NQT A;  2VNU D;  4EGV A;  1D2B A;  3KK7 A;  3I90 A;  4R8N A;  4ZAI A;  2EVB A;  3VR3 A;  1JC7 A;  1II3 A;  4A93 B;  1KDA A;  1X3P A;  1PRT B;  3FEW X;  3Q22 A;  2JE6 I;  5EQ0 A;  5K5P A;  2EYM A;  4DXF A;  4ID6 A;  1E2Z A;  1H9R A;  1SDF A;  1IW7 C;  4CHT B;  4C1N I;  2NBF A;  2KCC A;  3RLF A;  2VUM B;  2R6G A;  1TU2 B;  3BZD B;  5J1Z A;  2A74 C;  4X3U A;  3OHX C;  5EPL A;  4L63 B;  2XIW A;  2QKI C;  3O13 A;  4ABN A;  1PRT D;  4CKC A;  1AEX A;  1ESF A;  1O7Z A;  1HHV A;  4K6D A;  5ELF A;  1GUN A;  4DNT B;  2B2T C;  1JWS D;  1RJT A;  4FP5 D;  3SK5 A;  4OIJ A;  3T13 A;  3U9O A;  2IPK D;  3ND9 A;  3V2T A;  4HAE A;  4O1N A;  3Q0A A;  3IAY A;  5CV5 A;  5C6A A;  3I8Z A;  1EFI D;  4KTA A;  3R3O A;  1BNZ A;  3PV0 A;  2MP1 A;  1SYF A;  2KCN A;  4KY5 A;  1QNU A;  4DFA A;  4NKL A;  1LTR D;  2K1B A;  1G91 A;  1K8O A;  4A3D B;  1BUV T;  2NN6 H;  1Q8I A;  2XN9 C;  1ONL A;  3L9A X;  3TP8 A;  2OF1 A;  3PO2 B;  1SNC A;  4RWS C;  3RZO B;  1F9Q A;  2O5I C;  2PZT A;  3WOF A;  2M2L A;  1LTT D;  2K33 A;  4HTH A;  1SNQ A;  3P1H A;  3DXJ C;  4A3F B;  2DY8 A;  3DEP A;  1EU3 A;  1FNV A;  4HMI A;  3A7A B;  1UEA B;  1BBX C;  1STY A;  1I4P A;  5C4X B;  3D4W A;  4XDX A;  1B9N A;  2OT2 A;  4K8I A;  2RKS A;  3H6M A;  3R2I A;  1GUO A;  1BQQ T;  4G4K A;  1GUT A;  4WFN 3;  1PZI D;  4AYB B;  2QCP X;  4LJZ C;  1H9M A;  5FK9 C;  4IUT A;  4NMZ A;  5HGT A;  2H1E A;  2F0F A;  5IIF A;  2L1B A;  4OIK A;  1A3V A;  1QWY A;  4RCO A;  1A2U A;  2HUG A;  3OWF A;  4X3K A;  5KRU A;  3SR1 A;  1FNW A;  4V0B A;  2PZU A;  1OXT A;  1CQF A;  3D3R A;  3EJI A;  4Y7N B;  1G2S A;  1SE3 A;  2WKD A;  1PFM A;  1XXG A;  1SSO A;  1ZXT A;  3GTM B;  3I70 A;  5C4H A;  5CMD A;  3QJY A;  5D65 A;  1DCZ A;  2AUK A;  2B2W C;  2FFK B;  1FR3 A;  3OIQ A;  1LT3 D;  3TBI B;  1U4M A;  1WD1 A;  3LWE A;  4ODG A;  5CBE E;  1S5E D;  3SK6 A;  1C8C A;  1JCK B;  4FO2 A;  4XQQ A;  4O42 A;  1PLF A;  1NAP A;  2JSO A;  3S2D B;  3DM1 A;  1JOO A;  5JPN C;  5K36 G;  5F2D A;  1KAA A;  1I6V C;  2YU9 B;  4KV6 A;  3H91 A;  2RBM A;  4PMW A;  4FF2 A;  3L3O C;  5C0X I;  3HOZ B;  2FHT A;  5LL6 S;  1EY7 A;  4C3I G;  2EYF A;  4HSP A;  1EY8 A;  1QIL A;  2K28 A;  2E75 C;  1DM0 B;  5M5X B;  1ILP A;  1WTW A;  2K5D A;  1WTX A;  4KJN A;  2TSS A;  5C4Z A;  2IX0 A;  2CVR A;  1G2T A;  2F0V A;  5CYU A;  1JR0 D;  3GD7 A;  3NE5 B;  1V8Q A;  3NUC A;  1W6K A;  1Q90 A;  1SEB D;  4X3T A;  1DD2 A;  2XRS D;  5LHY 1;  2PMZ B;  2KUM A;  4HN7 A;  2Q8R E;  3TP6 A;  1B4O A;  5JPM C;  5CC4 A;  1VCI A;  3ND8 A;  4XYO A;  3J81 L;  4IUN A;  1Q1E A;  3K7A B;  4A3B B;  1Y1V B;  1PZK D;  1SYD A;  1VF5 C;  3BYY B;  3TP5 A;  1O78 A;  1C4Q A;  2XWB B;  2AWO A;  3J7A F;  4KK7 A;  1EYD A;  1LT6 D;  3ERO A;  5IGB A;  1HUM A;  5I6Y A;  2RDG A;  3TME A;  2MJ8 A;  3QOJ A;  2G9H D;  1B9M A;  4EQN A;  1GUW A;  4BWG B;  3P20 A;  2B8F A;  2F0H A;  1KLU D;  4KY6 A;  4F88 A;  1SBB B;  4KKS A;  1QOH A;  1TY2 A;  3V05 A;  3HS0 C;  3VYR A;  5CV4 A;  1RCV D;  3OMC A;  3AMU A;  1LTI D;  3NQI A;  1BCP F;  5J22 A;  3MXN A;  5CV9 A;  4FXK C;  2EJG C;  1XTC D;  4J1M A;  5EJW A;  4QMG A;  5COR A;  1X3Q A;  3GTQ B;  1MD2 D;  5IOC A;  1EWC A;  5EKL A;  4ZK9 B;  2NZ1 D;  3HOY B;  1BOS A;  3FKI B;  3D6C A;  1TS5 A;  2JEB I;  1PDQ A;  3JAM E;  2A69 C;  2RVL A;  5FKA C;  3PIP 3;  5M3M B;  1D5Z C;  2ICE C;  3UI2 A;  2NN6 G;  1OO9 B;  2XNA C;  1EY6 A;  3GTG B;  3M7G A;  4KJO A;  4ZKC B;  3IFT A;  4FYD A;  5CV6 A;  3A56 A;  3MXU A;  3T51 B;  3BVG A;  3MFY A;  2FMM A;  2B8G A;  5IGE A;  1MI2 A;  3AB9 A;  1UUP A;  4K2K A;  4K6L A;  1OXU A;  3PUY A;  4C3I B;  2EJM A;  4KN7 C;  4B08 A;  1JIC A;  1EL0 A;  1SE4 A;  2F0T A;  2EYL A;  4DK1 A;  1EZ8 A;  5K36 H;  1BCP C;  4RHS A;  1EY5 A;  1HRJ A;  3P75 A;  3SVM A;  2NVT B;  2L9H A;  5C44 B;  2HCC A;  4IUP A;  2NB0 A;  5CV8 A;  1NR2 A;  5M5Y B;  1HQM C;  2MGS A;  3QWN A;  2A6H D;  4IUU A;  2C5C A;  1S5F D;  5KNB A;  1ZKO A;  4ZQ3 A;  5DNF A;  3PO3 B;  1SXT A;  3PUZ A;  5FLX L;  2SEB D;  2D2C C;  2KEC A;  3EFX D;  1LLR D;  3BYT B;  4X3S A;  4BBS B;  3NXW A;  3N52 A;  3K57 A;  2KED A;  5ELC A;  3N6R A;  2A73 B;  3SK8 A;  1RHP A;  4IFD J;  3CQZ B;  1TQO A;  2A6E C;  1F77 A;  4FXG C;  1BO0 A;  5T1I A;  1H9J A;  2F0O A;  2EDG A;  4KHZ A;  4BA1 I;  2BE5 D;  3K59 A;  1WCM B;  4IN3 A;  1LO5 D;  4IAL A;  2YYZ A;  1FYC A;  1TT2 A;  1KTK A;  3W2D A;  3NWS A;  2M9V A;  2FIN B;  3VA7 A;  4NP5 A;  4RKL A;  2Q8I B;  2DNC A;  3DUZ A;  1EOT A;  1Z7T A;  5M5W B;  1F2L A;  5E1F A;  2WII B;  1D6E C;  2NN6 I;  3K5M A;  1WD0 A;  2IWH A;  2R93 B;  1TWG B;  3HOV B;  1WTO A;  3OPO A;  4QUF A;  2EPB A;  4FF1 A;  3VYU A;  3DHQ A;  5D3I B;  2F1M A;  2B2U A;  1PTO B;  5J39 A;  1E2W A;  1RD9 D;  2A68 D;  2F0S A;  3MVV A;  1BXT A;  1LTG D;  4KMU C;  4K14 A;  3SK4 A;  2KJX A;  2PW5 A;  1D1I A;  1FNU A;  1PYW D;  4FF3 A;  4RGM A;  4WRD A;  3J7Y W;  1QNK A;  4PV1 C;  2CHB D;  1TWF B;  1XWE A;  5DM6 3;  2Q8T A;  1Y8P B;  4B9W A;  2XVS A;  4RA8 A;  1PTO D;  3CRL C;  3KUP A;  1PTO H;  4DAV A;  4TSS A;  4QUC A;  5D3D A;  3I73 A;  3MAQ A;  1B2T A;  5COY A;  2EYP A;  1SJH D;  4DK0 A;  3OSO A;  4H44 C;  4ZUJ A;  2JEA I;  1CTM A;  3J80 E;  2NVY B;  2PZW A;  4OO1 G;  4KD3 A;  4CGY B;  2X6G A;  1SJE D;  5CGK A;  2KEE A;  1T5E A;  1DOL A;  1STN A;  1O7L A;  2Z1C A;  1GUS A;  3GQB A;  5EPK A;  3EA6 A;  4I7Z C;  4RCN A;  3H09 A;  3S16 B;  4BS9 A;  2B39 A;  2E2H B;  4ZRZ A;  5KNC A;  1SYG A;  3K5O A;  1G8Z D;  2EOT A;  5G3L D;  1DYQ A;  4P2C B;  3GTO B;  1EZ6 A;  1OXV A;  2AQ3 B;  1KNA A;  3CKI B;  5C5M A;  2NUC A;  3URY A;  1GUG A;  2B2V C;  3BVZ A;  3NPP A;  2V4D A;  1H9S B;  3WDN A;  4KKU A;  2WKC A;  3D6W A;  3DMU A;  5CR3 A;  3TZD A;  3MTS A;  2CW0 D;  2NWG A;  3PIO 3;  1EEF D;  2A5H A;  1E0B A;  2BDO A;  3I91 A;  2B63 B;  1LTA D;  1AP0 A;  3HGB A;  1LAC A;  1B53 A;  4A3M B;  5M3F B;  4CKE A;  5IGD A;  3J80 L;  4IQZ A;  1DON A;  2A69 D;  3DWA A;  4F8M A;  2A6H C;  2XSC A;  1TWA B;  3SDZ A;  3FPU B;  2K32 A;  1VF7 A;  3RD4 A;  5M9O A;  4BA2 I;  4R8I A;  4J8Q A;  3HZX A;  4JK1 C;  5KND A;  3NBI A;  4U68 A;  1JQY D;  4OGQ C;  1BCP B;  1C48 A;  4XQN A;  4QB4 A;  1RKN A;  3E6Z X;  1PTO F;  2EYJ A;  1ML0 D;  1QJO A;  3QG1 A;  2EY6 A;  1JOR A;  4C56 C;  5BN4 A;  4RAU C;  3NTI A;  5IT9 L;  2D9U A;  1AW7 A;  2F0U A;  5A2Q L;  3MA2 B;  3NTH A;  3A8K E;  5JEA J;  5CBA E;  3J81 E;  5EBC A;  1BCP D;  1CA6 A;  2BE5 C;  1A15 A;  1LT4 D;  3V96 A;  1IL8 A;  2BDN A;  4KI0 A;  1EY9 A;  4J6H A;  2O5J C;  4Q5V A;  4U67 3;  2J0T D;  4CJ1 B;  1HA6 A;  5FO8 B;  3BS1 A;  1G29 1;  1WTP A;  1B3A A;  4HR7 B;  2DY7 A;  4I65 A;  3A8J E;  3K58 A;  2QEJ C;  3I4L A;  5ELD A;  3H94 A;  3VYT A;  5I6W A;  5G3L F;  4UAI A;  4EVO A;  2JA8 B;  2L4N A;  3FVQ A;  4XQJ A;  3BDC A;  4K5X A;  3S1Q B;  2EYH A;  3C1E A;  1K8M A;  5KYI A;  4DF7 A;  2K04 A;  2HDL A;  4MIU A;  3R8B A;  1ESR A;  2A68 C;  1TR5 A;  2A6E D;  3NP8 A;  3OW7 A;  5JOB A;  3TSS A;  2EZV A;  4EQP A;  4H0L C;  3PUV A;  2AQ2 B;  2Z4I A;  5C3W A;  3DWQ A;  1JOQ A;  3RMH A;  1I6H B;  3S9W A;  3FMC A;  2QF7 A;  5HUR A;  1B44 D;  3SEB A;  5C3X A;  1PTO C;  3BDO A;  1SNP A;  1M8A A;  2BOS A;  4ZLT F;  2F0I A;  2K03 A;  2VXW A;  1SND A;  3KF8 A;  2L11 A;  4OO1 H;  1H9K A;  1CHP D;  3NWT A;  3EVQ A;  2HQE A;  3GP7 A;  1S4Z A;  3K5N A;  3MHB A;  1T5X D;  1Y1W B;  2JXM B;  3T4A C;  1MSH A;  4M8A A;  1HA5 A;  4UDU C;  1AFP A;  1HFG A;  1NR4 A;  1Z6H A;  1Q12 A;  5DAU A;  4C2M B;  3RZD B;  3LNN A;  1HTP A;  2KVM A;  1O80 A;  4IUV A;  5EBD A;  1GJX A;  4IZ8 A;  1PFB A;  3CHB D;  1JE4 A;  1EY0 A;  1PZJ D;  2VB2 X;  5T1G A;  2MHV A;  3TDQ A;  1JOK A;  1ILQ A;  3GTP B;  1DXM A;  3M3Y B;  1IKM A;  3PUX A;  3S15 B;  4HSV A;  3Q23 A;  4WOR A;  1F2M A;  3KBX A;  1PMR A;  1SNO A;  3D4D A;  4N9P A;  3NHH A;  3HOU B;  1ROD A;  1GHJ A;  3F2U A;  1LTS D;  1SYE A;  5NUC A;  2CW0 C;  1M4V A;  1I3Q B;  1CT1 D;  1S5C D;  5KYL A;  4IFD H;  1EEI D;  2B2Y A;  3Q6S A;  5I9O A;  3HEJ A;  3I4M B;  2F0G A;  5I2X A;  3S1N B;  1HTL D;  1RTO A;  2WIN B;  2KOL A;  3H3V C;  5AFW A;  2AQ1 B;  4ZYS A;  2J4X A;  1WVL A;  2PPB C;  1V1P A;  1MSG A;  4DAY A;  2JA6 B;  1IKL A;  5FLX E;  1R9T B;  4RFB A;  5KEE A;  5BN3 A;  4L6T B;  5JVH 3;  3KLS A;  3HRZ C;  4F87 A;  3VR4 A;  4XYQ A;  2IX3 A;  1D5X C;  1STG A;  1GHK A;  3VA5 A;  1EYC A;  1KDC A;  1SMY C;  5IGF A;  3R2T A;  2O2L D;  4TKO B;  3G6J B;  3IFD A;  1AN8 A;  1RTN A;  3I4N B;  2NVQ B;  4NDX A;  1JWM D;  3QOL A;  2GA4 B;  2D62 A;  2NYZ D;  3A54 A;  1S5D D;  1R4Q B;  1XX8 A;  5C0X J;  1HQR D;  2BA1 A;  1NCV A;  4LAA A;  3K6O A;  1BDO A;  2VB3 X;  2WB1 B;  1D1K A;  2R92 B;  4K2L A;  5I4D A;  3EQL C;  2IX1 A;  3P7J A;  3GTL B;  5DM7 3;  2PO4 A;  3BVM A;  3GTJ B;  1QB5 D;  2PW7 A;  4C3J G;  1YNN D;  2NVX B;  3D31 A;  1SAP A;  4ULL A;  1CA5 A;  2ZXP A;  4A3I B;  4FF4 A;  2Z8L A;  2B2U C;  1EIH A;  3IL8 A;  3HOX B;  1MBY A;  1QG7 A;  4DN4 M;  2JYO A;  1J8I A;  2ID0 A;  3M85 A;  3T53 B;  5EPJ A;  2CQA A;  5JJZ A;  4MHE A;  2EY2 A;  1CZG A;  2N88 A;  1VDZ A;  3ITP A;  1HFN A;  1A3U A;  4Q0F A;  3A7L A;  2F03 A;  1IHZ A;  3I72 A;  1CQV A;  1F9R A;  3SHL A;  2G9D A;  1OXS C;  4TQU S;  1DZ1 A;  4K8J A;  2RQX A;  2FMC A;  5CV7 A;  2F0L A;  1S5B D;  4G7O C;  1CFM A;  3A55 A;  3GO5 A;  1AZQ A;  3CU7 A;  4ME5 A;  2Y0S B;  1FD7 D;  4RGO S;  2RSN A;  2ENB A;  3NSW A;  1UNS A;  2F0N A;  2KHS A;  5ELE A;  1Y69 U;  1V1O A;  4FVM A;  2QDB A;  3SE0 A;  3MXG A;  1PXU A;  3GTK B;  4RHR A;  2EJF C;  3C1F A;  4OL7 A;  2HCI A;  2X69 A;  1L0Y B;  2F3W A;  3GV6 A;  4ZUI A;  1LTB D;  4BBR B;  3C3L A;  4C1N K;  2TMP A;  4CJ0 B;  4S3S A;  2EE1 A;  3E5S A;  2WAQ B;  4DNR B;  3QO2 A;  1GOZ A;  3MEH A;  4K5V A;  3DWP A;  4G57 A;  4H7B A;  3M4O B;  5E3F A;  2LS0 1;  1O7Y A;  2WV6 D;  2F0K A;  1I4Q A;  1V1P B;  3ONA B;  5IGG A;  1IYV A;  4C3H G;  1RF2 D;  1EU4 A;  3NBH A;  5C5L A;  1F2Y A;  1NUC A;  3C46 A;  2IJ0 A;  1B1Z A;  5I2Y A;  4XXE A;  5JEA H;  2I46 A;  2K01 A;  4DA2 A;  5E4X A;  3A8I E;  4A3J B;  3AU7 A;  5DEH A;  4FXD A;  4RGT A;  2RDF A;  2MUY A;  5A35 A;  1EQT A;  2E74 C;  1HUN A;  1LV9 A;  3E0J A;  1LT5 D;  3VR2 A;  3HP3 A;  4A3E B;  1OXX K;  3ZYY X;  1JB3 A;  4FNF A;  3S17 B;  3NTK A;  2B2T A;  3MFG A;  4HMJ A;  5EKI A;  5C0X G;  4PMC A;  3S1R B;  1EIG A;  2JA5 B;  1TVX A;  3C2P A;  2K5W A;  2IT1 A;  2DN8 A;  5IT9 E;  1HPC A;  5FOB B;  5A2Q E;  1Q3L A;  1WTR A;  2IW3 A;  3OIP A;  1X32 A;  4XTC S;  4C3J B;  3NK9 A;  3RUZ A;  4GZY C;  1YNJ C;  1K83 B;  1I4X A;  2O4X A;  3S14 B;  1HXY D;  2F0P A;  2K6A A;  2RDH A;  1CM9 A;  1F9S A;  1A2T A;  1G6Z A;  2KA7 A;  4R9W A;  3TN2 A;  5EKK A;  3TP7 A;  2EY5 A;  3X3N A;  5KIX A;  1XYI A;  4IFD G;  4KN4 C;  1PRT F;  1BR9 A;  3KLS X;  3TZU A;  2K7V A;  4A3G B;  3PMF A;  1LAB A;  2NTT A;  5FO9 B;  3D4R A;  2F0Q A;  2LFN A;  2SNM A;  2R3Z A;  4YIJ A;  2K5Q A;  4DAP A;  1U9R A;  4DU9 A;  1YNN C;  4ILW A;  3BG3 A;  1F9P A;  2MPM A;  1RDP D;  1SMY D;  3MXP A;  2N55 A;  1E2V A;  1Z47 A;  1WTQ A;  1ICW A;  5IOD A;  3MC0 B;  1WTV A;  1SYB A;  1MGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...