4BXXH

Arrested rna polymerase ii-bye1 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxH00
1UE1A 5LMNL 5AJ3L 2UXBQ 1SE8A 3GD7A 2Z6KA 4QL5A 4OX9L 4L5RC 3S1NH 2WB1G 2I5MX 4EX5A 1N33L 3PUVA 1IBLQ 4YWMA 4YCWA 4DK3C 3EIVA 4A93H 1E3PA 1Q46A 1I3QH 3S24A 1UEBA 4DR5Q 1N36L 2ALYB 1TWCH 3J80i 4DUYQ 5C44H 3ERSX 1XMQQ 4AIMA 3M4OH 3UDXA 1J5EQ 2YTYA 1A8VA 3T1YQ 1X9NA 5IYDG 1HNZQ 1PH8A 2JEAI 1PH2A 2HHHQ 2OQ0A 4P75A 1K8AC 2VW9A 2BA0A 3GTMH 1P8LA 4GKKQ 4X65Q 5JJKA 4R1JA 4YY3Q 3M85A 1JMCA 1EIYB 3PF4A 3UDGA 2IX0A 4PMWA 1JJCB 2R6GA 4YWLA 1SROA 3HOVG 2N49A 3K81C 4HJ9A 3S14H 3S2DH 1VQDA 4DUZL 3U58A 4PG3A 2JEBI 3CF5A 2HIVA 3NELA 3TEHB 2CCZA 4HJ5A 4JI7L 5IYDH 3FP9A 2JK8A 4KHPQ 2ZJQA 5E7NA 4DV3L 3RLFA 5HY6A 1Z47A 3RN5A 4KHZA 2PI2A 4DR2L 4GKJL 1HNXL 3HOVH 2PI2E 3AQQA 2YTXA 3J81j 2RHSB 3K80C 3MEFA 1XPOA 4DV1Q 2F4VQ 2BA1A 3HOXG 3ULPA 4L5SA 3GTOH 5K36G 4R4IA 3W1GA 1CUKA 3NBHB 4JI1Q 1L1OA 3CQZH 2A8VA 1G51A 1R9TH 4A3DG 1HNWQ 3GTJH 3BZKA 5BR8Q 1OXSC 1Z9FA 4K0KQ 4DV5L 3TRZA 5M5XH 2D0PA 1GM5A 3BJUA 2ZM6Q 4GNXA 4HJ7A 2OQKA 3WWVA 1HZCA 4Y52H 5M3FG 1Q86C 3I56A 2AWOA 4JI6Q 4BBRG 1HJPA 3HOXH 4LF8L 1Y1VG 2VL6A 2Z6KC 4LF6Q 1FJGL 3KDFA 1SR3A 1FVIA 1KAWA 3EBEA 2GVBA 4LUZA 4IO9A 1KIXA 3CD6A 2PNHA 4A3DH 1G6PA 2XTIA 1HZBA 4O2DA 2LXJA 3FKIG 5C0XI 2WB1E 1OXTA 1OXUA 4QY7A 3PO2G 1E7ZA 3OTOL 2GVAA 4WJ3M 4TVAB 5LMNW 1QVFA 2HT1A 5M3FH 4AYBG 4JYAQ 4BBRH 1BBWA 1E1OA 3CCSA 4OO1I 2HQLA 1WJJA 3GTPH 4GLXA 1Y1VH 4GLAC 4JI4Q 4O0AA 1Y14B 3F2DA 1VQ5A 2ES2A 4X6AH 1K73C 3I7FA 1WYDA 1X55A 4XTCS 1OXVA 3KF6B 1PHJA 3FKIH 1U5KA 4R4CA 5M3MG 4LFCQ 4DV4L 1K0RA 3GTGH 1CSPA 3I4NG 3PO2H 1YIJA 1TWAH 2CWAA 4C3JH 4DR1L 2E5LQ 3RR5A 3STBC 4A3CH 1AE3A 1VQPA 4UP8A 1PH5A 4DR3L 4LF4L 3PV0A 4JI0Q 4BY7G 2KENA 1LUZA 3IRBA 1HR0L 3AYHB 1CKNA 1VQ9A 4C3HH 4A3FG 1EFWA 2OTJA 1C9OA 3CMEA 1KRSA 4AQYQ 4LF5Q 1XNRQ 4X62L 4DR6Q 2EXDA 5M3MH 2UXDQ 1VQNA 2NN6I 1W2BA 1VQCA 3I4NH 4LFBQ 2UU9L 2QGQA 2ID0A 4IJLA 1OTCA 1H95A 3T1HQ 1V43A 1YEZA 2OCEA 3CW2C 4B3MQ 1X56A 5IYBG 1A63A 4BY7H 1EQQA 4LF9Q 1CSQA 1L1OC 4A3FH 3LGJA 4UPAA 1Q81C 1MKHA 1IBKQ 4IPHA 1IBLL 2F3IA 2N3SA 4IOCA 2UXCQ 3AFQA 1CKNB 4R4OA 4GNXC 1K8GA 3F8TA 2KCMA 3PO3G 4BBSG 2YU9H 1XMQL 4L5TA 2VZAA 2ZTCA 4OWWB 5IYBH 1NE3A 3CC2A 1J5EL 1XNQQ 2NZOA 2MQHA 1M90C 3T1YL 1QUQA 3CCUA 3S2HH 2K52A 1HNZL 1E24A 3CCRA 4HJAA 1PYBA 3HKZG 1I94Q 2I0QA 1IZ6A 1UE7A 4B3RQ 4TQUS 4GKKL 1G291 1S3OA 2JQOA 4X65L 4YY3L 4ALPA 1X65A 4BBSH 1HZ9A 3I55A 3PO3H 1N32L 4DV0Q 3I2ZA 1TXYA 3CPWA 1V1QA 2YV5A 4AYBE 3UDFA 5FLMG 3OYYA 1JT8A 4QIWE 3TREA 2MNAA 3TS0A 1C7YA 3CXCA 4KHPL 3J7A5 1QZGA 2A19A 1QUQB 2K14A 2NZHA 5LMUQ 1S72A 2CKZB 5J3BA 3U4VA 1RIPA 2UUCQ 1QZHA 4DV1L 2F4VL 3HOYG 2Q2TA 3CP0A 5FLMH 4DV7Q 2E2HH 2VUMG 4RMFA 4IFDG 1JJGA 3H0GG 4JI1L 1Q1EA 4JI3Q 2KCTA 1HNWL 2CWPA 3W5OA 4DPGA 3GTLH 3KOJA 1MJCA 1HZAA 2WFWA 3FHWA 5GAHC 4YHHQ 5ELOA 4NXMQ 2JA5G 5BR8L 4K0KL 4POGA 4IJHA 5HGQA 2ZM6L 1GVPA 5LMNQ 3HOUG 2RF4A 1SFOH 1RL2A 2JA6G 1YHAA 3HOZG 3HOYH 4A3LG 5IE8A 4LFAQ 4X66L 1NTGA 2VUMH 2Q2HA 5IYCG 3H0GH 4A76A 4POFA 2PQAA 2GN5A 1I6HH 1X3EA 2UUAQ 2VQEQ 1K3RA 3J7ZC 2JA5H 2MO0A 2Y0SG 3ER0A 1TWGH 4JBWA 4A3MG 2F52A 2NVQH 3HOUH 3CCJA 4PZ8A 2JA6H 3S17H 3HOZH 1SRUA 2WAQG 1KL9A 5IWAQ 2JJQA 4B3TQ 4JI4L 3ULLA 1VQIA 2MFIA 1VQKA 3KF6A 5IYCH 1Q82C 2NVTH 3S1QH 1WFQA 3CAMA 3PUZA 2R7ZG 4JI5Q 2I5HA 1Q8KA 3HKZE 1PVOA 1HH2P 1U0LA 1VQAA 1B70B 1D8LA 3I4OA 3E9HA 3HFZB 4JBJA 2VQFL 2PQAB 4DUZQ 4A3MH 2NVYH 1Q7YC 1MJEA 1VQ8A 2E5LL 1UE6A 3U50C 2YYZA 3DM3A 4PZ6A 2RCNA 3A5UA 1IL2A 4JI0L 1N34Q 1IYJB 1SMXA 4WJ4A 1K83H 3EN2A 1EYGA 1KHIA 4LUOA 4AQYL 1PH3A 4LF5L 2R7ZH 1BKBA 1B7YB 2ATWA 3S16H 4DR6L 1IXRA 2UXDL 3I4MG 3CMAA 4MTNA 3AFPA 4LFBL 1Q12A 3L2PA 4P74A 4GS3A 1OXXK 2K5VA 4BA1I 3T1HL 4B3ML 1VQMA 1NJIC 5M5YH 5FLXc 4NXNQ 1BBUA 1SN8A 2KHJA 4DV2L 4JI8Q 3GTQH 4BA2I 1YNXA 2CFMA 3K7UC 3G71A 3RN2A 4OXPA 1JB7A 5C3EG 4LF9L 1XPUA 3H3VH 4JV5Q 2AKWB 1LYLA 1PH4A 4B3SQ 3KYHC 4YCVA 2UXCL 1IBKL 3I4MH 4IPCA 3UE1A 3PUXA 5GAEC 4DV6Q 5EAYA 4X64Q 3KJPA 4A3JG 1I50H 1SLJA 2MO1A 4P72A 4LUVA 2A1AA 1YJWA 1VQGA 2NVXH 1NBWA 2LXKA 3STBD 3Q8DA 1VS0A 3D0FA 5GAGC 5C3EH 2UXBL 1PYSB 2XGTA 3JAMc 1I94L 2AWNA 4XIGS 3KFUA 4B3RL 2QEXA 3TQYA 2YTVA 3UDIA 1K9MC 4A3JH 4UP7A 1EUJA 1YITA 1GD7A 3H3VI 1JE5A 3M4QA 2Y0SE 4A4IA 2BH8A 4DV0L 1QVCA 1VQJA 5IP7G 4LWCA 1ASYA 4J15A 2R93G 4DUYL 3A0JA 2PMZE 3VDYA 1M1KC 3S1RH 1WCMG 4H02A 4NB3A 4AH6A 1QVGA 1N8RC 2WAQE 3W1BA 3RLOA 5IY0A 2UUBQ 3F1ZA 2HHHL 3G6EA 2D62A 1VQ4A 1PH7A 3CPFA 4JBKA 3CCLA 4DR3Q 3RNUA 2Q2UA 5IP7H 5LMUL 4A75A 3M7NA 2R93H 1EWIA 2DGYA 2RHQB 2QA4A 2UUCL 1JJ2A 3RZOH 4IPGA 1L0WA 4A93G 1WCMH 4DV7L 3L7ZC 4C3IH 1YBYA 3K0XA 1N9WA 2FXQA 2B29A 3B6YA 4FDBA 5GADC 4JI3L 3PF5A 1C0AA 2VS1A 4UP9A 3G4SA 5ELNA 1VQOA 4DR7Q 2KHIA 1E1TA 4NXML 5JEAG 4YHHL 1XPRA 3E0EA 2K5NA 3L0OA 2K50A 3M4PA 4DR4Q 2N78A 4JI2Q 3H15A 4RG1A 3U4ZA 1PH9A 3CC4A 4A3BG 1WOCA 4LF7Q 4LFAL 2V1CC 2WP8J 4R4QA 1PFSA 5C4JH 3F2BA 3CC7A 1Y1WG 4QQBX 1EIFA 3S1MH 2UUAL 3JAMi 3SGIA 3E9IA 1XMOQ 2VQEL 3CCEA 1IBMQ 2VNUD 3HOWG 4HIMA 3GDEA 4KLKA 5AJ3Q 4BY1G 3J81c 3CCQA 2ZTDA 5IWAL 1KD1C 4A3IG 4B3TL 3BZCA 2EQSA 1HR0W 4JI6L 4JBMA 4OX9Q 1FL0A 3ZJYC 1S40A 4L5QA 3M3YH 1N33Q 4LF6L 1Y1WH 2DUDA 3CCVA 4HIDA 3HKSA 4JI5L 2B63G 1N36Q 1N32Q 1YVCA 3BU2A 1GO3E 3JC66 3NENA 3PUWA 3HOWH 1MIUA 4LW1A 2ASBA 3KF8B 5C0XG 4A3EG 4DNIA 3S15H 3MXNB 1Q1BA 4BY1H 4A3LH 1CKMA 4HIOA 4JYAL 3NEMA 4A3IH 3ICEA 4NPSA 3F2CA 5C4XG 1N34L 2KBNA 4A3GG 4PZ7A 1T9HA 1VQ7A 4OO1G 3D31A 3PIOA 2Z0SA 1ASZA 1NY4A 1PH6A 2B63H 5IT9c 2JA8G 4YCUA 4DAYB 3AEVA 2IHFA 2AHOB 3A5ZB 3PCOB 2EIFA 4A3EH 4LFCL 4IFDI 1PA6A 1CKOA 1W3SA 4C2MH 1YHQA 1X3FA 4IOAA 2N8NA 1WI5A 3K7AH 4NXNL 4JI7Q 1AH9A 4JI8L 2R92G 4GOPA 5C4XH 1FGUA 4A3GH 2K5HA 1TWHH 2C35B 2I5LX 1BVSA 2IT1A 4JV5L 2OWOA 2VY3A 4IPDA 4GN5A 5GROA 5JEAJ 4DV3Q 1PV4A 5H1SE 4B3SL 2JA8H 4JOIA 4DR2Q 1XNRL 4GKJQ 1HNXQ 1X6OA 4ME3A 3PSIA 4DV6L 4X64L 2E2IH 4X66Q 1VQFA 2L15A 2NN6G 1PH1A 3KJOA 3A74A 2JA9A 5M5WH 1YJNA 3UE0A 3J81i 4QJFA 2R92H 4IFDJ 4HJ8A 1L2FA 1LTLA 1YI2A 5JJIA 1KC8C 4OWTB 1L1OB 2AMCB 3G48A 4OONA 4DV5Q 2HIXA 4MZ9A 4A3KG 4JC0A 4GOPB 4JG2A 4DAMA 2OTLA 4A3CG 1NMGA 1V9PA 2E8GA 3K8AA 2ZJRA 2R7FA 1TWFH 1VQHA 2ZJPA 4GNXB 3RZDH 4LF8Q 2D0OA 1A62A 3PUYA 1FJGQ 1O7IA 5IP9G 4APVA 5DLQE 1P16A 4Y7NH 1XNQL 3KDFB 1D7QA 2UUBL 4HIKA 1B8AA 2VQFQ 1EQRA 1YHBA 5C0XJ 4A3KH 1KQSA 3J80c 3OTOQ 1VQLA 4P73A 1VQ6A 2E2JH 1GKHA 1UWVA 4P71A 1E22A 3PIPA 3OW2A 5FJ8G 4JCVE 3RLNA 4GN3B 5IP9H 4GN4B 2CQOA 4DK6C 2K4KA 1VQBA 1XTDA 1UE5A 4GLVB 4DR5L 3TS2A 4BXXG 1X54A 3GO5A 4KI0A 1AE2A 2Q2IA 2LSSA 4EQ5A 3PGZA 1VQEA 4DV4Q 4DR7L 2JA7G 4DR1Q 4MNOA 3GTKH 4A3BH 2IY5B 5JJLA 5GQOA 1A0IA 1VCIA 4YWKA 4DV2Q 2ZTEA 4DR4L 4JI2L 1DGSA 4LF4Q 2R7DA 5FJ8H 1YJ9A 3M9BA 4QGUA 1HR0Q 4GOPC 4LF7L 3KLWA 1YZ6A 4LNQA 1X3GA 2BH2A 1J6QA 4BXXH 1I5FA 1LM0A 3ULJA 4X62Q 3DLLA 1XJVA 1EOVA 2B3GA 2IHEA 2K75A 3CCMA 4JOIC 2H5XA 1XMOL 1IBML 4UY8C 2JA7H 1KXLA 4OWXB 4DKAC 2IX1A 2UU9Q 1KRTA 4R4TA 5C44G 1NMFA 2JE6I
chains in the Genus database with same CATH superfamily
1RF2D 1BCPF 2BE5C 3TMEA 2DJGC 3GD7A 2UXBQ 2Z6KA 4QL5A 2A68C 4ZLTF 3S1NH 2I5MX 1TR5A 1I3QH 3S24A 1UEBA 2F1MA 2AUJD 1STHA 4FF1A 4AIMA 1E2WA 2FHTA 3A56A 2PQEA 2F3VA 4QB4A 3T1YQ 1ZYRD 3L9AX 1PH2A 1MI2A 1K8AC 5EBDA 2KEEA 3GV6A 4GKKQ 3PF4A 3M85A 3KLSA 4PMWA 2R6GA 4BS9A 2N49A 1XWEA 4G4KA 3PO2B 1VQDA 4DUZL 2WKDA 5FO8B 2PW5A 3TEHB 3FPPA 4HJ5A 4JI7L 3GTQB 4DGZA 5E7NA 2K33A 5HY6A 2R61A 3OIQA 4OELB 3ND8A 2PI2E 3AQQA 3J81j 1XPOA 2BA1A 2B2WA 1JQYD 3BVMA 3HOXG 3ULPA 4R4IA 3FVQA 1ILQA 3NBHB 1BNZA 2RA4A 4OO1H 1BUVT 3CU7A 4K0KQ 4DV5L 3TRZA 5C4ZA 5LL6X 3WWVA 4Y52H 2WV6D 2SOBA 4X3SA 1Q86C 3I56A 2K1BA 4BBRG 1HJPA 3K5MA 4LF6Q 3KDFA 4LUZA 1FVIA 1G2SA 5FO7B 1S5DD 1SBBB 1I4XA 1NAPA 4A3DH 1PFMA 2WB1E 1OXTA 1OXUA 1E2VA 1ZXTA 2F0WA 1EWHA 4WJ3M 3OTOL 4TVAB 3T4AC 5M3FH 3CCSA 4BBSB 2HQLA 2QF7A 3PO3B 1EYAA 1Y1VH 2MHVA 1VQ5A 3I7FA 5EQ0A 1TT2A 1WYDA 2I46A 1PHJA 3FKIH 2Q8IB 4V190 3DM1A 1K0RA 1QG7A 5ELCA 1SYBA 2A6HC 1TS3A 2NZ1D 3STBC 1AE3A 1IKMA 3HZXA 4RWSC 4DR3L 1ONLA 1SSOA 4BY7G 1HR0L 3AYHB 1CKNA 4C3HH 2OTJA 2EPBA 3CMEA 1XNRQ 1G6ZA 4X62L 3P1HA 2EXDA 3R2TA 2ID0A 3T16A 1JB3A 1H95A 2OCEA 3FPUB 4O1NA 4ZQ3A 1A63A 3SR1A 4IUNA 5CV4A 3K0YA 3DWAA 1CSQA 3HOYB 4A3FH 2HUGA 1CHQD 2UXCQ 2N3SA 3H0GB 1Y69U 4GNXC 2EE1A 1H9SB 3NXWA 4EVOA 5IYBH 1NE3A 3R8BA 1J5EL 2NZOA 1UNSA 2MQHA 4XQQA 1QUQA 5A35A 3CCUA 2F0QA 4A3IB 2JA6B 3S17B 1E24A 5C3XA 3CCRA 1PRTF 3TDQA 1K8MA 1IZ6A 2ZXOA 3ITPA 4YY3L 4ALPA 1HZ9A 2Z9HA 1RTNA 3WDNA 4AYBE 2CVRA 2EDGA 3OYYA 3J7AF 3TREA 1EY4A 5J39A 2WAQB 2F0MA 2TMPA 3R93A 2BE5D 3CXCA 1QZGA 3L3OC 2A68D 3H6MA 2K14A 2R7ZB 5LMUQ 1TS5A 1QZHA 4LK1C 1JJGA 4JI1L 3QG1A 5FKAC 3W5OA 3WOFA 3GTLH 1I4HA 1HZAA 2EJGC 3FHWA 4YHHQ 4IUUA 4X3UA 2OEOA 2ZM6L 5LMNQ 2RF4A 3I4MB 2NBFA 1RL2A 1YHAA 2KJXA 5A2QE 4S3SA 3HOZG 1I50B 4A3LG 1NTGA 2PW7A 2NVXB 5IGFA 2Q2HA 4R8NA 2PQAA 1EWCA 2PNRC 1HQRD 2JA5H 3M7GA 1HA5A 4A3MG 2F52A 2NVQH 3HOUH 3J81L 2E75C 5G3LD 1SRUA 5IWAQ 2JJQA 4JI4L 3ULLA 3I72A 3KF6A 1IYUA 3NBIA 1U9RA 1DOLA 1A2TA 2A6EC 1NSNS 1T5EA 3HKZE 1PVOA 1B70B 1YNNC 3E9HA 3A55A 4FXGC 1G8ZD 1D5XC 2YYZA 3DM3A 2RVLA 3H3VC 1Z6HA 3I4LA 1N34Q 1IYJB 1CTMA 1DOKA 2R93B 1K83H 1MSGA 1EYGA 2M9VA 4LUOA 5DM73 1EOTA 3MTSA 4C3IB 3L2PA 4P74A 1A6XA 1OXXK 1TIID 2LKVA 2O5IC 1PTOC 4BA1I 3T1HL 4B3ML 1VQMA 5FLXc 2L0CA 1BBUA 3GTQH 1YNXA 3K7UC 5IGDA 1JB7A 1LT3D 5C3EG 4LF9L 3H3VH 1PH4A 4CDCC 4HCEA 1SYCA 1EY0A 4HEDA 3PUXA 4IPCA 4DV6Q 4A3JG 5C4HA 4P72A 4H7BA 1YJWA 4C1NK 2A6HD 1PTOH 1CQVA 3STBD 3OMCA 3V96A 1PZKD 1GHJA 2FFKB 3D0FA 5GAGC 4KJOA 1PYSB 3ERQA 1I94L 2AWNA 4B3RL 1Y1WB 1K9MC 1YITA 1GD7A 3M4QA 1ASYA 2LS01 3IKJA 1VQJA 3R2IA 2PMZE 4ZK9B 3BZDB 1DD2A 2D62A 2F0OA 3DEPA 1AFPA 4JBKA 4FXKC 2E76C 4A75A 3MHBA 1EWIA 2DGYA 2RHQB 5G3LF 4ZKCB 2UUCL 2PPBC 2DN8A 4IPGA 2FXQA 1PRTB 2F0NA 4CGYB 1C0AA 2IX3A 2HD3A 5ELNA 1VQOA 5C4XB 2KHIA 1CZGA 2PZUA 5JEAG 5DM63 1WTXA 4JI2Q 4IZ8A 1LTBD 2K28A 4RG1A 2B2YC 4LF7Q 5FO9B 2WP8J 4J6HA 2OT2A 3MXNA 4F88A 2UUAL 1MBYA 3JAMi 3C46A 1IBMQ 3HOWG 2B2VC 3GDEA 2XN9C 4DAPA 4OX9Q 4A3BH 4DAYA 1HR0W 3RZDB 3M3YH 4L5QA 2DUDA 2CW0C 1GUSA 3CCVA 4HIDA 2B63G 3JC66 3KF8B 3ONAB 1BCPC 3VR3A 5EJWA 5KNBA 4JYAL 4A3IH 3ICEA 4ULLA 4OO1G 1VQ7A 2MP1A 3D31A 2EOTA 2Z0SA 2JA8G 4YCUA 1STYA 2EIFA 5CV5A 5FK9C 4MTKA 4IOAA 3E0JA 4JI8L 2R92G 3P7JA 4A3GH 4KV6A 1BVSA 4RGNA 4JV5L 4N9PA 1X6OA 4ME3A 4RH6A 1SYGA 2JA7B 2A6ED 3OHXC 3V05A 4X66Q 2NN6G 4DU9A 3A74A 1YNND 2JA9A 3J81i 4QJFA 5I9PA 4ZYSA 4I7AA 5L37A 1JICA 3K5LA 1B3AA 4HJ8A 1YI2A 1B4OA 1L1OB 2AMCB 4MIUA 4MZ9A 5CV6A 1I4QA 3OOCA 1I3QB 5CV7A 1J8IA 5NUCA 3K8AA 2D0OA 5DLQE 1HUNA 1PTOD 4B9WA 1BDOA 4DF7A 1WD1A 3K6OA 4DFAA 2WB1B 1YHBA 4DNTB 4A3KH 4KKSA 3J80c 4F7XA 3Q24A 5I6YA 1JOQA 1GKHA 4M8AA 5IP9H 4GN4B 4L63B 1UE5A 2B2TC 4LAAA 4J8QA 1KTKA 3PGZA 4DR7L 5ELEA 3VYSA 4RFBA 5FLXL 3PIO3 1FNWA 5EBCA 1VCIA 4DV2Q 3BVGA 4LF4Q 3GV3A 1YJ9A 4QGUA 3QWNA 2CQAA 2CH4W 2BH2A 4LNQA 3TZUA 1J6QA 3JAME 1I5FA 2K5DA 3X3MA 1M8AA 1XJVA 1EOVA 2K75A 3I70A 2QILA 4OWXB 2IX1A 2UU9Q 4CDEC 1TWGB 1KRTA 5C44G 1NMFA 2AUKA 4K2KA 3K5NA 1XXGA 5BN3A 1PZJD 4YCWA 3GP7A 4DK3C 4CDFC 1N36L 1QE6A 1SNMA 5I4DA 4A3DB 1AZPA 1SDFA 1KABA 2MGSA 4NMZA 2QEJC 4DUYQ 1YNJC 2NVYB 3SK4A 4CJ2C 1EL0A 4RA8A 4NDXA 5M3FB 1A8VA 1X9NA 5IYDG 1X32A 2HHHQ 1Y1VB 2OQ0A 4P75A 2BA0A 2X6GA 1Y8PB 4R1JA 1JMCA 3FKIB 3NBHA 3IFDA 4DNRB 1G2TA 4HJ9A 2L12A 4FP5D 2F4IA 1PRTC 4AYBB 2CCZA 2ZJQA 1SYFA 4C3HB 2MUYA 3MAQA 2IJ0A 1ICFB 4DR2L 4GKJL 3HOVH 2CW0D 3VR5A 2YTXA 1PZID 4N9TA 4DV1Q 3W1GA 1BCPD 1CUKA 2RBMA 1JWMD 3CQZH 1RCVD 3GTJH 1PXUA 4A3FB 1OXSC 1Z9FA 1HTPA 1Y8NB 1QWYA 3KK7A 4F8MA 1RKNA 5DAUA 5K36H 1LTTD 3VR2A 4XQNA 3EBEA 2GVBA 1LT4D 1Q90A 1KIXA 2JP1A 3CD6A 1G6PA 4FF2A 3PO2G 4KKUA 4TRDA 4IURA 3RD4A 1BBWA 4GLAC 4O0AA 3RZOB 2ES2A 2Q8RE 1B9NA 1IYVA 3SE0A 4KJNA 4XTCS 1OXVA 3SK5A 2LY7A 4R4CA 4RAUC 2QCPX 3HKZB 1LTAD 4K2LA 1YIJA 2CWAA 3NWTA 4C3JH 4DR1L 2E5LQ 4G7OC 1VQPA 1WTOA 4UP8A 1I4PA 2F0IA 4JI0Q 4UDUC 3IRBA 3FRPB 2XSCA 2OXPA 4AQYQ 3BS1A 3S1MB 1H9SA 5M3MH 2UXDQ 4QCLA 3NUCA 1TKWB 3I73A 1W2BA 3I4NH 3SXHA 2QGQA 4IJLA 4JK1C 1ENFA 3Q0AA 1YEZA 1SYDA 4ZCKA 4HTHA 1BO0A 2N88A 1L1OC 3LGJA 2K5QA 3W2DA 1IBKQ 4IPHA 2F3IA 1K8GA 4BBSG 3PO3G 4KD3A 4L5TA 3J7YW 2BDOA 5ELDA 4BY1B 3HOUB 3CC2A 3HRZC 2NVQB 1XNQQ 3T1YL 3S2HH 3A7LA 3J80L 4K14A 1LV9A 1PYBA 4B9XA 1CK1A 1ENCA 3MWYW 4TQUS 4GKKL 1G291 1S3OA 2JQOA 4DV0Q 3I2ZA 3CPWA 1UEAB 1V1QA 1SYEA 2PMZB 5DEHA 4QIWE 3TS0A 1NNXA 1C7YA 5C5LA 2A19A 3VA5A 1K83B 3QJYA 1EY5A 3OW7A 1SJED 4XDXA 2NZHA 3W3AA 1S72A 5J3BA 3D4RA 1RIPA 5LL6S 5T1IA 3HOYG 3CP0A 5FLMH 4IFDG 2HQEA 1YNJD 4CJ1B 2RDGA 3H0GG 1Q1EA 2XWBB 3A8KE 3NSWA 4DPGA 1OO9B 5CBAE 4K0KL 5HGQA 1GVPA 1WD0A 2H4OA 2KA7A 1SFOH 2JA6G 2L4NA 3MVVA 3DXJC 2KEDA 3TBIB 2VUMH 3VYTA 3DWPA 1PTOB 2GN5A 2CH4A 1PRTD 1SE2A 4R9WA 2L5TA 5C3WA 1TWGH 4IUQA 1XYIA 3CCJA 1H9MA 2EY1A 2WAQG 1VQIA 2L11A 5IYCH 1RD9D 1C4QA 1LABA 1SAPA 2R7ZG 2I5HA 1Q8KA 5ELBA 1U0LA 1F9RA 1S5FD 4KTAA 5IGEA 4DUZQ 1VQNA 1VQ8A 2NVYH 1STEA 2J7ZA 1TY0A 3U50C 1SNQA 4WORA 4XYQA 4CBVA 2RCNA 3AU7A 1DYQA 4WJ4A 3T13A 1KHIA 5IT9L 1PH3A 1KDCA 5AFWA 2ATWA 3I4MG 3CMAA 1Q12A 3C1EA 1FNUA 4G7ZC 1SEBD 4IUVA 4NXNQ 4BA2I 1EQTA 2CFMA 5KYLA 1XPUA 5ELFA 2NB0A 1HCZA 4B3SQ 2UXCL 4EQPA 3UE1A 5EAYA 3KJPA 2MO1A 1MHWC 4RKBA 5DNFA 1HFNA 1II3A 2WINB 1GJXA 4RGTA 5D3IB 2ZXRA 1A3TA 2NTTA 5CC4A 1V1PB 4A3BB 2XRQD 2DNCA 2KECA 3M3YB 2K32A 1IW7D 5JVH3 4UP7A 1EUJA 2Y0SE 1QVCA 5IP7G 1LACA 2R93G 4CKCA 1M1KC 4H02A 4NB3A 1F77A 1S5ED 4AH6A 4C3IG 1QVGA 1N8RC 2UUBQ 5E4WC 3A54A 2DY7A 3K57A 1PH7A 1KDAA 2HCIA 3CPFA 3OIPA 1TY2A 4DR3Q 3RNUA 3IL8A 4OHJA 4Z9CB 5LMUL 3M7NA 3RZOH 1H9KA 1L0WA 1WCMH 3L7ZC 1BCPB 3B6YA 4FDBA 4Q0FA 5LHY1 4L8JA 1SNPA 4A3GB 5I9OA 1E1TA 4YHHL 5M5XB 1EIHA 1FGBD 1VMCA 2H1EA 3KLRA 2K5NA 3M4YA 2K50A 3M4PA 4DR4Q 2AQ3B 3HOXB 3QR8A 3KF8A 2F0VA 5C4JH 1U4MA 1Y1WG 3S1MH 3E9IA 4UAIA 2VNUD 5F2DA 1K28A 4HIMA 4N8X1 1GOZA 5AJ3Q 1CQFA 1KD1C 2ZTDA 5IWAL 4JI6L 3BZCA 1PYWD 1N33Q 1I4GA 4QMGA 1WTHA 1MIUA 5HGTA 5C0XG 3CRKC 4DNIA 2Z1CA 4A3KB 3NQIA 1Q1BA 4BY1H 1CKMA 2GA4B 4NPSA 3CRLC 3F2CA 1N34L 5C4XG 1DOMA 3PIOA 3C2PA 4J1MA 3DUZA 2DY8A 4V0BA 1DXMA 5I6WA 4A3EH 4LFCL 4MHEA 1CKOA 3C3LA 1W3SA 1UUPA 1X3FA 1WI5A 3FMCA 1QOHA 1TWHH 2C35B 2I5LX 4KHVA 5ISRA 1O80A 4E6IA 2VY3A 5JEAJ 1PV4A 3E6ZX 5GROA 2RDHA 4DV3Q 5EKLA 3I3CA 1HNXQ 3PSIA 4DV6L 5D3DA 4FVMA 2M00A 1PDQA 2SDFA 1YJNA 1DCZA 4CHTB 1EYCA 2XVSA 3BVZA 4HSPA 3SK8A 4ID6A 3U9OA 1TS4A 2E8GA 2ZJRA 2R7FA 2ZJPA 4LF8Q 2K01A 1FJGQ 1O7IA 4APVA 4C1NI 1P16A 4Y7NH 3KDFB 1B8AA 4RKLA 2EYLA 1KQSA 1SE4A 1EEFD 1VQ6A 1DM0B 1RHPA 1UWVA 2F0UA 2F0DA 4P71A 3OW2A 5FJ8G 3MXPA 4JCVE 4GN3B 1U4PA 4GLVB 1VQBA 1KAAA 4BXXG 4KI0A 3GO5A 1EQVA 1AE2A 1RJTA 2Q2IA 4EQ5A 1VQEA 4H44C 1FR3A 4DV4Q 2JA7G 3GTKH 2IY5B 2RDFA 5I2YA 4YWKA 4JI2L 1DGSA 3HOVB 2R7DA 2RSNA 3M9BA 1F2YA 3Q6SA 4LF7L 4GOPC 3CQZB 4JOIC 4UY8C 1IBML 1B53A 3V2TA 4PV1C 3GTJB 4R4TA 1U4LA 1UE1A 4OIKA 3RUZA 3HOZB 1SE8A 2EYMA 4OX9L 4L5RC 4FF4A 2WB1G 2NVTB 3TZDA 1IBLQ 4YWMA 4CKBA 4A93H 1Q46A 3VR6A 2ALYB 1TWCH 1EFID 2NTSA 1XMQQ 3MEHA 1ZKOA 1HNZQ 3QOLA 1PH8A 2IPKD 4BWGB 2JEAI 3BYTB 5JAVA 2VW9A 1VDZA 3N52A 4X65Q 2MJ8A 4HN7A 1HXYD 1NCVA 1ZEQX 1EIYB 4XXEA 5EPJA 2IX0A 3CHBD 1SROA 1R4PB 3K81C 4C3JB 2FMMA 3U58A 4PG3A 2JEBI 2HIVA 3NELA 2A69D 1KDBA 4KHPQ 3RLFA 1Z47A 4KHZA 2XRSD 4K8IA 5M3MB 3I4NB 4H0LC 3K80C 3IAYA 2F4VQ 4L5SA 2KOLA 2F0HA 2A8VA 4JW0A 2L1BA 1R9TH 4A3DG 1HNWQ 3BZKA 5BR8Q 5M5XH 2D0PA 1GM5A 3BJUA 4GNXA 4HJ7A 5M3FG 2AWOA 3D6CA 3NP8A 5TSSA 5CORA 3HOXH 2JSOA 3A8JE 3SK6A 1F2MA 1Y1VG 2Z6KC 1SR3A 1KAWA 1BF4A 2PNHA 3S2HB 2XTIA 2LXJA 3FKIG 1MGSA 2F0EA 2NYZD 1E7ZA 2GVAA 5LMNW 1B50A 4AYBG 4JYAQ 3C1FA 1E1OA 4BBRH 1C8CA 4OO1I 1WJJA 3GTPH 4GLXA 2D5DA 1Y14B 4OIJA 1LTGD 3PQIA 3NTHA 4KK7A 4C3HG 4OGQC 1Q3LA 3KF6B 1D6EC 3GTGH 5KGUA 1B3QA 3KUPA 2ICIA 3SHLA 4KN7C 1M4VA 4A3CH 1XX8A 1EZ6A 4R8IA 1GUGA 4LF4L 3PV0A 2VB3X 3X3NA 4A3FG 1C9OA 4LF5Q 1KRSA 4DR6Q 4G7HC 4ZUJA 2NN6I 4GZYC 4LFBQ 4XYOA 2UU9L 4FXDA 1V43A 3CW2C 1X56A 2B2WC 5IYBG 1PLFA 3A8IE 1SFOB 4BY7H 4K8JA 1EQQA 4UPAA 1PFBA 3HEJA 2VUMB 3OPOA 1MKHA 2AQ1B 2FJ2A 4IOCA 1CT1D 2QDLA 3AFQA 4R4OA 3HOWB 3F8TA 5IIFA 2YU9H 2QW7A 2VZAA 3OMGA 1AEXA 1M90C 1ML0D 3HKZG 2I0QA 1ET9A 4QUFA 2IW3A 3I55A 1W6KA 1N32L 1L0YB 1Z7TA 2Y0SB 3LNNA 1E2ZA 1TXYA 5KNDA 5T1GA 2YV5A 4K6DA 5M9OA 2F3WA 2V4DA 3SDZA 1DZ1A 4DN4M 1O78A 1G91A 1D1IA 3J7A5 2K5WA 4LMQD 3TP8A 1HRJA 1RODA 4JVZA 2SNSA 4RCOA 3U4VA 4DV1L 2MPMA 2E2HH 5M5WB 4DV7Q 2EY6A 5BN5A 4NKLA 4DXGA 4JI3Q 1DJRD 1MJCA 2PZTA 2WFWA 4NXMQ 2D2CC 3NPPA 2JA5G 4POGA 4IJHA 4RHSA 2JYOA 3HOUG 1EZ8A 3NK9A 1U4RA 1TWFB 2Z4HA 3DMUA 3NWSA 4RGOS 3VR4A 5IE8A 1ENAA 4LFAQ 1S5CD 3EJIA 2JXMB 1EU4A 3J81E 1D5MC 3LX0A 4FF3A 4FNFA 3P20A 1I6HH 2EYOA 2VQEQ 1TVXA 2RSOA 1K3RA 3J7ZC 5A2QL 2MO0A 3ER0A 4JBWA 3KLSX 1JOKA 2AQ2B 1NR4A 3HOZH 4A3LH 1KL9A 4B3TQ 2MFIA 4KY6A 1Q82C 2NVTH 1HFGA 2Z4IA 1SXTA 3PUZA 4JI5Q 1JCKB 2F0TA 3I4OA 2VQFL 1STAA 4A3MH 1Q7YC 2QDBA 1F9SA 2E5LL 1UE6A 4PZ6A 3HS0C 4JI0L 1SMXA 5I2XA 1SJHD 3EN2A 2ZXPA 1LTID 1WCMB 4AQYL 1BKBA 1B7YB 3S16H 1IXRA 2EY5A 3MA2B 2UXDL 1KLUD 3MZ5A 1FYCA 3AFPA 5E3FA 1S5BD 2K5VA 3BDOA 4WFN3 5M5YH 1SN8A 2B2YA 2KHJA 4CJ0B 3LWEA 2VXWA 3G71A 3RN2A 1GUWA 4OXPA 2B2UC 1LYLA 1QCBD 3KYHC 1IW7C 4YCVA 1IHZA 1IBKL 5C4JB 1EEID 4X64Q 2B2VA 4OEMB 1SLJA 4DK1A 4LUVA 2KCCA 3WOEA 1X3QA 3M4OB 1VQGA 1O7ZA 4CDDC 1NBWA 2LXKA 3O13A 3VA7A 4DK0A 5C3EH 2UXBL 3JAMc 1QILA 2PCFB 2KHSA 3KFUA 2QEXA 3TQYA 5COYA 2N55A 4A3JH 3H3VI 1JE5A 4A4IA 4DV0L 4LWCA 4ZRZA 2F0SA 1JR0D 1K0SA 3S1RH 1KNAA 3RLOA 4HAEA 5EGTA 5IY0A 2DJFC 2F0LA 4DXFA 3G6EA 1VQ4A 1F9PA 4Q5VA 3J7AV 3CCLA 4HR7B 4L6TB 4A3EB 2EZVA 4XT1B 4XT3B 4DR5Q 2BOSA 2KUMA 2F0JA 2SNMA 4UP9A 4C56C 1TWHB 1XPRA 3E0EA 1BR9A 2B8FA 4IUTA 2TSSA 3L0OA 1CHPD 1SNOA 2A5HA 3U4ZA 3CC4A 4A3BG 1D5ZC 2V1CC 3BYYB 3CC7A 3F2BA 4QQBX 1JORA 1ICWA 1EIFA 4DAVA 3SGIA 1XMOQ 1F2ZA 3CCEA 5JEAH 4KD4A 3J81c 3NTIA 4A3IG 1QNKA 1T5XD 4JBMA 2PYKA 1S40A 1SNDA 3BDCA 4LF6L 4Y7NB 3BU2A 3HOWH 4LW1A 1TWAB 4ZAIA 3TSSA 4KKTA 4U68A 2K7VA 3U9SA 4HIOA 2PZWA 1RDPD 2ENBA 2LMCB 2OF1A 5BN4A 2KBNA 2B2TA 4PZ7A 1T9HA 4A3GG 4PMCA 1VF7A 1NY4A 1PH6A 2B63H 4ABNA 3AEVA 2XIWA 2IHFA 1LT5D 4IFDI 4C2MH 3GTKB 1YHQA 2G9DA 2N8NA 3K7AH 4NXNL 4JI7Q 5KIXA 5J22A 2K5HA 2IT1A 5JPMC 4GN5A 4B3SL 5H1SE 3T56B 2JA8H 2Q8TA 3OSOA 1TU2B 4P2CB 1XNRL 3SEBA 2EYFA 2E2IH 1VMPA 1PH1A 4CKEA 3KJOA 4NP5A 5M5WH 2R92H 3D3RA 1LTLA 5JJIA 1KC8C 1JWUD 3LWUA 4OWTB 4A3KG 2HCCA 3NE5B 4DV5Q 2OTLA 4O42A 4GOPB 4JG2A 4A3CG 1GHKA 4A93B 1HA6A 3MC0B 1NMGA 1V9PA 4I65A 2CHBD 1TWCB 2NN6H 5K5PA 1TWFH 1VQHA 2XNAC 3PUYA 5IP9G 3AMUA 1O7LA 1A3UA 2UUBL 1EQRA 2JN4A 4NW2A 5C0XJ 3OTOQ 1VQLA 1K3BC 4P73A 2E2JH 4QUCA 5FLXE 4IN3A 3RLNA 1W6JA 2CQOA 1STGA 1XTDA 1LTSD 1X54A 1X3PA 1IKLA 2L55A 5JJLA 1TQOA 5KYIA 5JJZA 2ZTEA 5C6AA 4DR4L 2K6AA 1HR0Q 3FEWX 2K04A 3KLWA 1LLRD 1QNUA 3ULJA 1LM0A 1GUNA 4X62Q 3CCMA 2H5XA 1R9TB 2M2LA 2JE6I 4LJZC 3JAML 5LMNL 5AJ3L 2XWJB 3S1QB 4EX5A 1N33L 3PUVA 3EIVA 1E3PA 2F0PA 1J9OA 3J80i 5C44H 3ERSX 3MFYA 3M4OH 3I8ZA 3UDXA 2A69C 1D1KA 1J5EQ 1JWSD 4X3TA 2YTYA 2C5CA 4BBRB 3GTPB 4K5XA 4JPBW 1BXTA 3GTMH 1P8LA 3D6WA 5JJKA 2J0TD 4YY3Q 2Z6BA 1PFNA 3RMHA 3UDGA 1DONA 1JJCB 1F2LA 2EYHA 4YWLA 3HOVG 3GTGB 3S14H 3S2DH 5IODA 3CF5A 1LO5D 1CA6A 3D4WA 2KCNA 5IYDH 3FP9A 2B2UA 4HMIA 1FD7D 5KEEA 2JK8A 2E74C 4IALA 1A2UA 3PIP3 3OWFA 2EJMA 4DV3L 1TS2A 2ZT9C 3RN5A 2PI2A 5CMDA 1HNXL 1I4RA 4TKOB 2RHSB 3MEFA 5K36G 1HQMC 3GTOH 4JI1Q 1L1OA 2EY2A 1G51A 4BY7B 3HP3A 2KVMA 2SEBD 2B39A 4QF4A 2ZM6Q 1AP0A 2OQKA 3EVQA 1HZCA 1SMYC 4JI6Q 2X6LA 3G7LA 1O7YA 4LF8L 2RCFA 2VL6A 2YU9B 5FOBB 1FJGL 4IO9A 1WVLA 1HZBA 4O2DA 5C0XI 4QY7A 1GUTA 1STBA 2IL8A 4C3JG 4HSVA 1QVFA 3EA6A 2HT1A 1V1OA 4KMUC 3T51B 4JI4Q 3F2DA 4X6AH 1K73C 1X55A 1U5KA 2F0GA 5M3MG 1EYDA 4DV4L 4LFCQ 1CSPA 3I4NG 3PO2H 2C9OA 1TWAH 3EROA 3KBXA 3RR5A 3Q22A 1STNA 1PH5A 2NWGA 1NUCA 2KENA 1LUZA 4IUPA 1VQ9A 1EFWA 1D2BA 2E2HB 3IFTA 1F9QA 5IGCA 1VQCA 3URYA 4EQOA 4PNYA 1OTCA 3T1HQ 1CA5A 4B3MQ 1JOOA 3ND9A 4LF9Q 1EY9A 3KBGA 1Q81C 1IBLL 1I6HB 3J80E 1CKNB 2KCMA 2EYPA 3OWEB 3S15B 4HMJA 1XMQL 2ZTCA 4OWWB 4ME5A 1MSHA 3H09A 5CGKA 2K52A 1HNZL 4HJAA 1ESRA 1WTWA 1I94Q 1UE7A 3SVMA 4B3RQ 4X65L 3A7AB 1X65A 4BBSH 3PO3H 4A3MB 4ODGA 1SNCA 1CZWA 2WIIB 2PO4A 3UDFA 5FLMG 2BDNA 1JT8A 2MNAA 3T53B 4KHPL 1QUQB 2EXZA 1H9RA 4WJWA 3S16B 1BQQT 2O4XA 3I91A 3K58A 2CKZB 1S4ZA 2E2DC 2UUCQ 2F4VL 2Q2TA 4X3KA 2VUMG 1AW7A 1C48A 4RMFA 4TSSA 5M5YB 2F0KA 2KCTA 1L0XB 1HNWL 2CWPA 4K6LA 4QIWB 3BDLA 3KOJA 4ZKBB 5GAHC 5C5MA 5ELOA 5BR8L 2FMCA 3K5OA 1FNVA 3TP6A 4K5WA 3HOYH 3TP7A 4XQJA 4X66L 4IFDH 5IYCG 4A76A 3H0GH 4POFA 1X3EA 2UUAQ 3VYRA 3E3XA 3F2UA 3TP5A 5C3EB 2Y0SG 1EIGA 1PMRA 2R3ZA 3EQLC 4PZ8A 3NHHA 2JA6H 2LFNA 3S17H 4A3JB 2DNEA 1VQKA 3S1QH 1A3VA 2A74C 1WFQA 4M1UB 5JPNC 1SE3A 3CAMA 3S1RB 4KY7A 2RQXA 3MXGA 1HH2P 1VQAA 4JBJA 1D8LA 1WTVA 3HFZB 1MJEA 2PQAB 5IT9E 5E1FA 2J4XA 3TN2A 1HHVA 2ICEC 3A5UA 1IL2A 1SMYD 5EKIA 2HDLA 3HGBA 2F0FA 1I6VC 1HPCA 4LF5L 2R7ZH 4DR6L 3CKIB 4MTNA 4LFBL 5CBEE 4GS3A 4ZUIA 1NJIC 4DV2L 4JI8Q 4H13C 3NTKA 3S1NB 1EY7A 4JV5Q 2AKWB 4KN4C 1V8QA 3I4MH 3H91A 5HURA 5GAEC 1WTRA 2RKSA 2EYJA 1I50H 2O5JC 1CM9A 2A1AA 5KRUA 2NVXH 2Z8LA 1EY8A 5CYUA 3BG3A 4K5VA 3Q8DA 1VS0A 4DA2A 3DWQA 1R4QB 2XGTA 2NUCA 4WRDA 1ESFA 3R3OA 4XIGS 2YTVA 3UDIA 3HG9A 4EQNA 1EU3A 1XTCD 2BH8A 4RCNA 2K05A 2P5ZX 4J15A 4DUYL 3A0JA 3VDYA 1WTQA 1WCMG 1Y8OB 3QOJA 2WAQE 3W1BA 4PMBA 3F1ZA 2EVBA 3VYUA 3Q23A 2A73B 2HHHL 5IOCA 3QB3A 2B63B 4HCSA 2Q2UA 3D4DA 5IP7H 2R93H 2G5DA 2QA4A 2QKIC 1JJ2A 4C2MB 4DV7L 4C3IH 5GADC 1YBYA 3K0XA 1N9WA 4I7ZC 2B29A 2VB2X 3K7AB 1A15A 4JI3L 3PF5A 1EY6A 2VS1A 3G4SA 4DR7Q 1KNEA 4NXML 3D8GA 1LTRD 4OL7A 2IWHA 1GXDC 1ZYRC 5CV9A 4N8FA 2JA8B 4U673 2F03A 2N78A 3H15A 5JVG3 2E2IB 1PH9A 1WOCA 4LFAL 4RHRA 2X69A 3I90A 4F87A 1NR2A 1PFSA 4R4QA 1B2TA 4IQZA 2R92B 2VQEL 1ET6A 5JOBA 5IGBA 1B44D 2L9HA 4ILWA 1K8OA 4KLKA 5KNCA 4FYDA 1JC7A 1QJOA 3MFGA 4BY1G 1B1ZA 4EGVA 3CCQA 4B3TL 4FO2A 2EQSA 5J1ZA 1FL0A 3ZJYC 1E0BA 1Y1WH 3HKSA 4JI5L 4B08A 1N36Q 1N32Q 1YVCA 1GO3E 3NENA 3PUWA 1HUMA 2ASBA 2D9UA 4A3EG 3S15H 1HTLD 3MXNB 5D65A 4G57A 4KY5A 2E2JB 1PTOF 3NEMA 3S9WA 5EPKA 1ASZA 5IT9c 1QB5D 4DAYB 2AHOB 3A5ZB 2KQ3A 3PCOB 5C0XH 1BBXC 3MXUA 1PA6A 3FDTA 3P75A 3K59A 1AH9A 1Q8IA 4GOPA 5C4XH 1FGUA 1CFMA 3EFXD 2OWOA 4IPDA 5E4XA 3H94A 2G9HD 3UI2A 4JOIA 4DR2Q 4GKJQ 4X64L 1VQFA 3G6JB 2L15A 2WACA 1AN8A 1ILPA 1V1PA 3UE0A 4IFDJ 5CV8A 2K03A 4RGMA 1JE4A 1L2FA 4MN3A 2HDMA 5IGGA 4OONA 3G48A 1WTPA 2HIXA 4JC0A 4DAMA 1H9JA 4GNXB 3RZDH 2I07B 1A62A 5C44B 5CR3A 3NQTA 3GQBA 3N6RA 1XNQL 1D7QA 1KLGD 4HIKA 3PMFA 3QIAA 2FINB 2VQFQ 1MD2D 3E5SA 3GTMB 2B8GA 4UHVA 1AZQA 1E22A 3PIPA 1GUOA 3S14B 3S2DB 4DK6C 2K4KA 4DR5L 3TS2A 2LSSA 4YIJA 3GTLB 1B9MA 2BCOA 2WKCA 4MNOA 4DR1Q 5EPLA 1BOSA 1A0IA 5D14A 5GQOA 1RTOA 5FJ8H 2O2LD 1YZ6A 1X3GA 1UAPA 3GTOB 4BXXH 1LT6D 1VF5C 3DLLA 3AB9A 5EKKA 2B3GA 2EJFC 2IHEA 4PQXA 1XMOL 4A93G 2JA7H 1KXLA 2JA5B 4DKAC 1IL8A 3QO2A 3ZYYX 3DEOA 3DHQA 1CI3M
chains in the Genus database with same CATH topology
1UE1A 5LMNL 5AJ3L 2UXBQ 1SE8A 3GD7A 2Z6KA 4QL5A 4OX9L 4L5RC 3S1NH 2WB1G 2I5MX 4EX5A 1N33L 3PUVA 1IBLQ 4YWMA 4YCWA 4DK3C 3EIVA 4A93H 1E3PA 1Q46A 1I3QH 3S24A 1UEBA 4DR5Q 1N36L 2ALYB 1TWCH 3J80i 4DUYQ 5C44H 3ERSX 1XMQQ 4AIMA 3M4OH 3UDXA 1J5EQ 2YTYA 1A8VA 3T1YQ 1X9NA 5IYDG 1HNZQ 1PH8A 2JEAI 1PH2A 2HHHQ 2OQ0A 4P75A 1K8AC 2VW9A 2BA0A 3GTMH 1P8LA 4GKKQ 4X65Q 5JJKA 4R1JA 4YY3Q 3M85A 1JMCA 1EIYB 3PF4A 3UDGA 2IX0A 4PMWA 1JJCB 2R6GA 4YWLA 1SROA 3HOVG 2N49A 3K81C 4HJ9A 3S14H 3S2DH 1VQDA 4DUZL 3U58A 4PG3A 2JEBI 3CF5A 2HIVA 3NELA 3TEHB 2CCZA 4HJ5A 4JI7L 5IYDH 3FP9A 2JK8A 4KHPQ 2ZJQA 5E7NA 4DV3L 3RLFA 5HY6A 1Z47A 3RN5A 4KHZA 2PI2A 4DR2L 4GKJL 1HNXL 3HOVH 2PI2E 3AQQA 2YTXA 3J81j 2RHSB 3K80C 3MEFA 1XPOA 4DV1Q 2F4VQ 2BA1A 3HOXG 3ULPA 4L5SA 3GTOH 5K36G 4R4IA 3W1GA 1CUKA 3NBHB 4JI1Q 1L1OA 3CQZH 2A8VA 1G51A 1R9TH 4A3DG 1HNWQ 3GTJH 3BZKA 5BR8Q 1OXSC 1Z9FA 4K0KQ 4DV5L 3TRZA 5M5XH 2D0PA 1GM5A 3BJUA 2ZM6Q 4GNXA 4HJ7A 2OQKA 3WWVA 1HZCA 4Y52H 5M3FG 1Q86C 3I56A 2AWOA 4JI6Q 4BBRG 1HJPA 3HOXH 4LF8L 1Y1VG 2VL6A 2Z6KC 4LF6Q 1FJGL 3KDFA 1SR3A 1FVIA 1KAWA 3EBEA 2GVBA 4LUZA 4IO9A 1KIXA 3CD6A 2PNHA 4A3DH 1G6PA 2XTIA 1HZBA 4O2DA 2LXJA 3FKIG 5C0XI 2WB1E 1OXTA 1OXUA 4QY7A 3PO2G 1E7ZA 3OTOL 2GVAA 4WJ3M 4TVAB 5LMNW 1QVFA 2HT1A 5M3FH 4AYBG 4JYAQ 4BBRH 1BBWA 1E1OA 3CCSA 4OO1I 2HQLA 1WJJA 3GTPH 4GLXA 1Y1VH 4GLAC 4JI4Q 4O0AA 1Y14B 3F2DA 1VQ5A 2ES2A 4X6AH 1K73C 3I7FA 1WYDA 1X55A 4XTCS 1OXVA 3KF6B 1PHJA 3FKIH 1U5KA 4R4CA 5M3MG 4LFCQ 4DV4L 1K0RA 3GTGH 1CSPA 3I4NG 3PO2H 1YIJA 1TWAH 2CWAA 4C3JH 4DR1L 2E5LQ 3RR5A 3STBC 4A3CH 1AE3A 1VQPA 4UP8A 1PH5A 4DR3L 4LF4L 3PV0A 4JI0Q 4BY7G 2KENA 1LUZA 3IRBA 1HR0L 3AYHB 1CKNA 1VQ9A 4C3HH 4A3FG 1EFWA 2OTJA 1C9OA 3CMEA 1KRSA 4AQYQ 4LF5Q 1XNRQ 4X62L 4DR6Q 2EXDA 5M3MH 2UXDQ 1VQNA 2NN6I 1W2BA 1VQCA 3I4NH 4LFBQ 2UU9L 2QGQA 2ID0A 4IJLA 1OTCA 1H95A 3T1HQ 1V43A 1YEZA 2OCEA 3CW2C 4B3MQ 1X56A 5IYBG 1A63A 4BY7H 1EQQA 4LF9Q 1CSQA 1L1OC 4A3FH 3LGJA 4UPAA 1Q81C 1MKHA 1IBKQ 4IPHA 1IBLL 2F3IA 2N3SA 4IOCA 2UXCQ 3AFQA 1CKNB 4R4OA 4GNXC 1K8GA 3F8TA 2KCMA 3PO3G 4BBSG 2YU9H 1XMQL 4L5TA 2VZAA 2ZTCA 4OWWB 5IYBH 1NE3A 3CC2A 1J5EL 1XNQQ 2NZOA 2MQHA 1M90C 3T1YL 1QUQA 3CCUA 3S2HH 2K52A 1HNZL 1E24A 3CCRA 4HJAA 1PYBA 3HKZG 1I94Q 2I0QA 1IZ6A 1UE7A 4B3RQ 4TQUS 4GKKL 1G291 1S3OA 2JQOA 4X65L 4YY3L 4ALPA 1X65A 4BBSH 1HZ9A 3I55A 3PO3H 1N32L 4DV0Q 3I2ZA 1TXYA 3CPWA 1V1QA 2YV5A 4AYBE 3UDFA 5FLMG 3OYYA 1JT8A 4QIWE 3TREA 2MNAA 3TS0A 1C7YA 3CXCA 4KHPL 3J7A5 1QZGA 2A19A 1QUQB 2K14A 2NZHA 5LMUQ 1S72A 2CKZB 5J3BA 3U4VA 1RIPA 2UUCQ 1QZHA 4DV1L 2F4VL 3HOYG 2Q2TA 3CP0A 5FLMH 4DV7Q 2E2HH 2VUMG 4RMFA 4IFDG 1JJGA 3H0GG 4JI1L 1Q1EA 4JI3Q 2KCTA 1HNWL 2CWPA 3W5OA 4DPGA 3GTLH 3KOJA 1MJCA 1HZAA 2WFWA 3FHWA 5GAHC 4YHHQ 5ELOA 4NXMQ 2JA5G 5BR8L 4K0KL 4POGA 4IJHA 5HGQA 2ZM6L 1GVPA 5LMNQ 3HOUG 2RF4A 1SFOH 1RL2A 2JA6G 1YHAA 3HOZG 3HOYH 4A3LG 5IE8A 4LFAQ 4X66L 1NTGA 2VUMH 2Q2HA 5IYCG 3H0GH 4A76A 4POFA 2PQAA 2GN5A 1I6HH 1X3EA 2UUAQ 2VQEQ 1K3RA 3J7ZC 2JA5H 2MO0A 2Y0SG 3ER0A 1TWGH 4JBWA 4A3MG 2F52A 2NVQH 3HOUH 3CCJA 4PZ8A 2JA6H 3S17H 3HOZH 1SRUA 2WAQG 1KL9A 5IWAQ 2JJQA 4B3TQ 4JI4L 3ULLA 1VQIA 2MFIA 1VQKA 3KF6A 5IYCH 1Q82C 2NVTH 3S1QH 1WFQA 3CAMA 3PUZA 2R7ZG 4JI5Q 2I5HA 1Q8KA 3HKZE 1PVOA 1HH2P 1U0LA 1VQAA 1B70B 1D8LA 3I4OA 3E9HA 3HFZB 4JBJA 2VQFL 2PQAB 4DUZQ 4A3MH 2NVYH 1Q7YC 1MJEA 1VQ8A 2E5LL 1UE6A 3U50C 2YYZA 3DM3A 4PZ6A 2RCNA 3A5UA 1IL2A 4JI0L 1N34Q 1IYJB 1SMXA 4WJ4A 1K83H 3EN2A 1EYGA 1KHIA 4LUOA 4AQYL 1PH3A 4LF5L 2R7ZH 1BKBA 1B7YB 2ATWA 3S16H 4DR6L 1IXRA 2UXDL 3I4MG 3CMAA 4MTNA 3AFPA 4LFBL 1Q12A 3L2PA 4P74A 4GS3A 1OXXK 2K5VA 4BA1I 3T1HL 4B3ML 1VQMA 1NJIC 5M5YH 5FLXc 4NXNQ 1BBUA 1SN8A 2KHJA 4DV2L 4JI8Q 3GTQH 4BA2I 1YNXA 2CFMA 3K7UC 3G71A 3RN2A 4OXPA 1JB7A 5C3EG 4LF9L 1XPUA 3H3VH 4JV5Q 2AKWB 1LYLA 1PH4A 4B3SQ 3KYHC 4YCVA 2UXCL 1IBKL 3I4MH 4IPCA 3UE1A 3PUXA 5GAEC 4DV6Q 5EAYA 4X64Q 3KJPA 4A3JG 1I50H 1SLJA 2MO1A 4P72A 4LUVA 2A1AA 1YJWA 1VQGA 2NVXH 1NBWA 2LXKA 3STBD 3Q8DA 1VS0A 3D0FA 5GAGC 5C3EH 2UXBL 1PYSB 2XGTA 3JAMc 1I94L 2AWNA 4XIGS 3KFUA 4B3RL 2QEXA 3TQYA 2YTVA 3UDIA 1K9MC 4A3JH 4UP7A 1EUJA 1YITA 1GD7A 3H3VI 1JE5A 3M4QA 2Y0SE 4A4IA 2BH8A 4DV0L 1QVCA 1VQJA 5IP7G 4LWCA 1ASYA 4J15A 2R93G 4DUYL 3A0JA 2PMZE 3VDYA 1M1KC 3S1RH 1WCMG 4H02A 4NB3A 4AH6A 1QVGA 1N8RC 2WAQE 3W1BA 3RLOA 5IY0A 2UUBQ 3F1ZA 2HHHL 3G6EA 2D62A 1VQ4A 1PH7A 3CPFA 4JBKA 3CCLA 4DR3Q 3RNUA 2Q2UA 5IP7H 5LMUL 4A75A 3M7NA 2R93H 1EWIA 2DGYA 2RHQB 2QA4A 2UUCL 1JJ2A 3RZOH 4IPGA 1L0WA 4A93G 1WCMH 4DV7L 3L7ZC 4C3IH 1YBYA 3K0XA 1N9WA 2FXQA 2B29A 3B6YA 4FDBA 5GADC 4JI3L 3PF5A 1C0AA 2VS1A 4UP9A 3G4SA 5ELNA 1VQOA 4DR7Q 2KHIA 1E1TA 4NXML 5JEAG 4YHHL 1XPRA 3E0EA 2K5NA 3L0OA 2K50A 3M4PA 4DR4Q 2N78A 4JI2Q 3H15A 4RG1A 3U4ZA 1PH9A 3CC4A 4A3BG 1WOCA 4LF7Q 4LFAL 2V1CC 2WP8J 4R4QA 1PFSA 5C4JH 3F2BA 3CC7A 1Y1WG 4QQBX 1EIFA 3S1MH 2UUAL 3JAMi 3SGIA 3E9IA 1XMOQ 2VQEL 3CCEA 1IBMQ 2VNUD 3HOWG 4HIMA 3GDEA 4KLKA 5AJ3Q 4BY1G 3J81c 3CCQA 2ZTDA 5IWAL 1KD1C 4A3IG 4B3TL 3BZCA 2EQSA 1HR0W 4JI6L 4JBMA 4OX9Q 1FL0A 3ZJYC 1S40A 4L5QA 3M3YH 1N33Q 4LF6L 1Y1WH 2DUDA 3CCVA 4HIDA 3HKSA 4JI5L 2B63G 1N36Q 1N32Q 1YVCA 3BU2A 1GO3E 3JC66 3NENA 3PUWA 3HOWH 1MIUA 4LW1A 2ASBA 3KF8B 5C0XG 4A3EG 4DNIA 3S15H 3MXNB 1Q1BA 4BY1H 4A3LH 1CKMA 4HIOA 4JYAL 3NEMA 4A3IH 3ICEA 4NPSA 3F2CA 5C4XG 1N34L 2KBNA 4A3GG 4PZ7A 1T9HA 1VQ7A 4OO1G 3D31A 3PIOA 2Z0SA 1ASZA 1NY4A 1PH6A 2B63H 5IT9c 2JA8G 4YCUA 4DAYB 3AEVA 2IHFA 2AHOB 3A5ZB 3PCOB 2EIFA 4A3EH 4LFCL 4IFDI 1PA6A 1CKOA 1W3SA 4C2MH 1YHQA 1X3FA 4IOAA 2N8NA 1WI5A 3K7AH 4NXNL 4JI7Q 1AH9A 4JI8L 2R92G 4GOPA 5C4XH 1FGUA 4A3GH 2K5HA 1TWHH 2C35B 2I5LX 1BVSA 2IT1A 4JV5L 2OWOA 2VY3A 4IPDA 4GN5A 5GROA 5JEAJ 4DV3Q 1PV4A 5H1SE 4B3SL 2JA8H 4JOIA 4DR2Q 1XNRL 4GKJQ 1HNXQ 1X6OA 4ME3A 3PSIA 4DV6L 4X64L 2E2IH 4X66Q 1VQFA 2L15A 2NN6G 1PH1A 3KJOA 3A74A 2JA9A 5M5WH 1YJNA 3UE0A 3J81i 4QJFA 2R92H 4IFDJ 4HJ8A 1L2FA 1LTLA 1YI2A 5JJIA 1KC8C 4OWTB 1L1OB 2AMCB 3G48A 4OONA 4DV5Q 2HIXA 4MZ9A 4A3KG 4JC0A 4GOPB 4JG2A 4DAMA 2OTLA 4A3CG 1NMGA 1V9PA 2E8GA 3K8AA 2ZJRA 2R7FA 1TWFH 1VQHA 2ZJPA 4GNXB 3RZDH 4LF8Q 2D0OA 1A62A 3PUYA 1FJGQ 1O7IA 5IP9G 4APVA 5DLQE 1P16A 4Y7NH 1XNQL 3KDFB 1D7QA 2UUBL 4HIKA 1B8AA 2VQFQ 1EQRA 1YHBA 5C0XJ 4A3KH 1KQSA 3J80c 3OTOQ 1VQLA 4P73A 1VQ6A 2E2JH 1GKHA 1UWVA 4P71A 1E22A 3PIPA 3OW2A 5FJ8G 4JCVE 3RLNA 4GN3B 5IP9H 4GN4B 2CQOA 4DK6C 2K4KA 1VQBA 1XTDA 1UE5A 4GLVB 4DR5L 3TS2A 4BXXG 1X54A 3GO5A 4KI0A 1AE2A 2Q2IA 2LSSA 4EQ5A 3PGZA 1VQEA 4DV4Q 4DR7L 2JA7G 4DR1Q 4MNOA 3GTKH 4A3BH 2IY5B 5JJLA 5GQOA 1A0IA 1VCIA 4YWKA 4DV2Q 2ZTEA 4DR4L 4JI2L 1DGSA 4LF4Q 2R7DA 5FJ8H 1YJ9A 3M9BA 4QGUA 1HR0Q 4GOPC 4LF7L 3KLWA 1YZ6A 4LNQA 1X3GA 2BH2A 1J6QA 4BXXH 1I5FA 1LM0A 3ULJA 4X62Q 3DLLA 1XJVA 1EOVA 2B3GA 2IHEA 2K75A 3CCMA 4JOIC 2H5XA 1XMOL 1IBML 4UY8C 2JA7H 1KXLA 4OWXB 4DKAC 2IX1A 2UU9Q 1KRTA 4R4TA 5C44G 1NMFA 2JE6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE1 A;  5LMN L;  5AJ3 L;  2UXB Q;  1SE8 A;  3GD7 A;  2Z6K A;  4QL5 A;  4OX9 L;  4L5R C;  3S1N H;  2WB1 G;  2I5M X;  4EX5 A;  1N33 L;  3PUV A;  1IBL Q;  4YWM A;  4YCW A;  4DK3 C;  3EIV A;  4A93 H;  1E3P A;  1Q46 A;  1I3Q H;  3S24 A;  1UEB A;  4DR5 Q;  1N36 L;  2ALY B;  1TWC H;  3J80 i;  4DUY Q;  5C44 H;  3ERS X;  1XMQ Q;  4AIM A;  3M4O H;  3UDX A;  1J5E Q;  2YTY A;  1A8V A;  3T1Y Q;  1X9N A;  5IYD G;  1HNZ Q;  1PH8 A;  2JEA I;  1PH2 A;  2HHH Q;  2OQ0 A;  4P75 A;  1K8A C;  2VW9 A;  2BA0 A;  3GTM H;  1P8L A;  4GKK Q;  4X65 Q;  5JJK A;  4R1J A;  4YY3 Q;  3M85 A;  1JMC A;  1EIY B;  3PF4 A;  3UDG A;  2IX0 A;  4PMW A;  1JJC B;  2R6G A;  4YWL A;  1SRO A;  3HOV G;  2N49 A;  3K81 C;  4HJ9 A;  3S14 H;  3S2D H;  1VQD A;  4DUZ L;  3U58 A;  4PG3 A;  2JEB I;  3CF5 A;  2HIV A;  3NEL A;  3TEH B;  2CCZ A;  4HJ5 A;  4JI7 L;  5IYD H;  3FP9 A;  2JK8 A;  4KHP Q;  2ZJQ A;  5E7N A;  4DV3 L;  3RLF A;  5HY6 A;  1Z47 A;  3RN5 A;  4KHZ A;  2PI2 A;  4DR2 L;  4GKJ L;  1HNX L;  3HOV H;  2PI2 E;  3AQQ A;  2YTX A;  3J81 j;  2RHS B;  3K80 C;  3MEF A;  1XPO A;  4DV1 Q;  2F4V Q;  2BA1 A;  3HOX G;  3ULP A;  4L5S A;  3GTO H;  5K36 G;  4R4I A;  3W1G A;  1CUK A;  3NBH B;  4JI1 Q;  1L1O A;  3CQZ H;  2A8V A;  1G51 A;  1R9T H;  4A3D G;  1HNW Q;  3GTJ H;  3BZK A;  5BR8 Q;  1OXS C;  1Z9F A;  4K0K Q;  4DV5 L;  3TRZ A;  5M5X H;  2D0P A;  1GM5 A;  3BJU A;  2ZM6 Q;  4GNX A;  4HJ7 A;  2OQK A;  3WWV A;  1HZC A;  4Y52 H;  5M3F G;  1Q86 C;  3I56 A;  2AWO A;  4JI6 Q;  4BBR G;  1HJP A;  3HOX H;  4LF8 L;  1Y1V G;  2VL6 A;  2Z6K C;  4LF6 Q;  1FJG L;  3KDF A;  1SR3 A;  1FVI A;  1KAW A;  3EBE A;  2GVB A;  4LUZ A;  4IO9 A;  1KIX A;  3CD6 A;  2PNH A;  4A3D H;  1G6P A;  2XTI A;  1HZB A;  4O2D A;  2LXJ A;  3FKI G;  5C0X I;  2WB1 E;  1OXT A;  1OXU A;  4QY7 A;  3PO2 G;  1E7Z A;  3OTO L;  2GVA A;  4WJ3 M;  4TVA B;  5LMN W;  1QVF A;  2HT1 A;  5M3F H;  4AYB G;  4JYA Q;  4BBR H;  1BBW A;  1E1O A;  3CCS A;  4OO1 I;  2HQL A;  1WJJ A;  3GTP H;  4GLX A;  1Y1V H;  4GLA C;  4JI4 Q;  4O0A A;  1Y14 B;  3F2D A;  1VQ5 A;  2ES2 A;  4X6A H;  1K73 C;  3I7F A;  1WYD A;  1X55 A;  4XTC S;  1OXV A;  3KF6 B;  1PHJ A;  3FKI H;  1U5K A;  4R4C A;  5M3M G;  4LFC Q;  4DV4 L;  1K0R A;  3GTG H;  1CSP A;  3I4N G;  3PO2 H;  1YIJ A;  1TWA H;  2CWA A;  4C3J H;  4DR1 L;  2E5L Q;  3RR5 A;  3STB C;  4A3C H;  1AE3 A;  1VQP A;  4UP8 A;  1PH5 A;  4DR3 L;  4LF4 L;  3PV0 A;  4JI0 Q;  4BY7 G;  2KEN A;  1LUZ A;  3IRB A;  1HR0 L;  3AYH B;  1CKN A;  1VQ9 A;  4C3H H;  4A3F G;  1EFW A;  2OTJ A;  1C9O A;  3CME A;  1KRS A;  4AQY Q;  4LF5 Q;  1XNR Q;  4X62 L;  4DR6 Q;  2EXD A;  5M3M H;  2UXD Q;  1VQN A;  2NN6 I;  1W2B A;  1VQC A;  3I4N H;  4LFB Q;  2UU9 L;  2QGQ A;  2ID0 A;  4IJL A;  1OTC A;  1H95 A;  3T1H Q;  1V43 A;  1YEZ A;  2OCE A;  3CW2 C;  4B3M Q;  1X56 A;  5IYB G;  1A63 A;  4BY7 H;  1EQQ A;  4LF9 Q;  1CSQ A;  1L1O C;  4A3F H;  3LGJ A;  4UPA A;  1Q81 C;  1MKH A;  1IBK Q;  4IPH A;  1IBL L;  2F3I A;  2N3S A;  4IOC A;  2UXC Q;  3AFQ A;  1CKN B;  4R4O A;  4GNX C;  1K8G A;  3F8T A;  2KCM A;  3PO3 G;  4BBS G;  2YU9 H;  1XMQ L;  4L5T A;  2VZA A;  2ZTC A;  4OWW B;  5IYB H;  1NE3 A;  3CC2 A;  1J5E L;  1XNQ Q;  2NZO A;  2MQH A;  1M90 C;  3T1Y L;  1QUQ A;  3CCU A;  3S2H H;  2K52 A;  1HNZ L;  1E24 A;  3CCR A;  4HJA A;  1PYB A;  3HKZ G;  1I94 Q;  2I0Q A;  1IZ6 A;  1UE7 A;  4B3R Q;  4TQU S;  4GKK L;  1G29 1;  1S3O A;  2JQO A;  4X65 L;  4YY3 L;  4ALP A;  1X65 A;  4BBS H;  1HZ9 A;  3I55 A;  3PO3 H;  1N32 L;  4DV0 Q;  3I2Z A;  1TXY A;  3CPW A;  1V1Q A;  2YV5 A;  4AYB E;  3UDF A;  5FLM G;  3OYY A;  1JT8 A;  4QIW E;  3TRE A;  2MNA A;  3TS0 A;  1C7Y A;  3CXC A;  4KHP L;  3J7A 5;  1QZG A;  2A19 A;  1QUQ B;  2K14 A;  2NZH A;  5LMU Q;  1S72 A;  2CKZ B;  5J3B A;  3U4V A;  1RIP A;  2UUC Q;  1QZH A;  4DV1 L;  2F4V L;  3HOY G;  2Q2T A;  3CP0 A;  5FLM H;  4DV7 Q;  2E2H H;  2VUM G;  4RMF A;  4IFD G;  1JJG A;  3H0G G;  4JI1 L;  1Q1E A;  4JI3 Q;  2KCT A;  1HNW L;  2CWP A;  3W5O A;  4DPG A;  3GTL H;  3KOJ A;  1MJC A;  1HZA A;  2WFW A;  3FHW A;  5GAH C;  4YHH Q;  5ELO A;  4NXM Q;  2JA5 G;  5BR8 L;  4K0K L;  4POG A;  4IJH A;  5HGQ A;  2ZM6 L;  1GVP A;  5LMN Q;  3HOU G;  2RF4 A;  1SFO H;  1RL2 A;  2JA6 G;  1YHA A;  3HOZ G;  3HOY H;  4A3L G;  5IE8 A;  4LFA Q;  4X66 L;  1NTG A;  2VUM H;  2Q2H A;  5IYC G;  3H0G H;  4A76 A;  4POF A;  2PQA A;  2GN5 A;  1I6H H;  1X3E A;  2UUA Q;  2VQE Q;  1K3R A;  3J7Z C;  2JA5 H;  2MO0 A;  2Y0S G;  3ER0 A;  1TWG H;  4JBW A;  4A3M G;  2F52 A;  2NVQ H;  3HOU H;  3CCJ A;  4PZ8 A;  2JA6 H;  3S17 H;  3HOZ H;  1SRU A;  2WAQ G;  1KL9 A;  5IWA Q;  2JJQ A;  4B3T Q;  4JI4 L;  3ULL A;  1VQI A;  2MFI A;  1VQK A;  3KF6 A;  5IYC H;  1Q82 C;  2NVT H;  3S1Q H;  1WFQ A;  3CAM A;  3PUZ A;  2R7Z G;  4JI5 Q;  2I5H A;  1Q8K A;  3HKZ E;  1PVO A;  1HH2 P;  1U0L A;  1VQA A;  1B70 B;  1D8L A;  3I4O A;  3E9H A;  3HFZ B;  4JBJ A;  2VQF L;  2PQA B;  4DUZ Q;  4A3M H;  2NVY H;  1Q7Y C;  1MJE A;  1VQ8 A;  2E5L L;  1UE6 A;  3U50 C;  2YYZ A;  3DM3 A;  4PZ6 A;  2RCN A;  3A5U A;  1IL2 A;  4JI0 L;  1N34 Q;  1IYJ B;  1SMX A;  4WJ4 A;  1K83 H;  3EN2 A;  1EYG A;  1KHI A;  4LUO A;  4AQY L;  1PH3 A;  4LF5 L;  2R7Z H;  1BKB A;  1B7Y B;  2ATW A;  3S16 H;  4DR6 L;  1IXR A;  2UXD L;  3I4M G;  3CMA A;  4MTN A;  3AFP A;  4LFB L;  1Q12 A;  3L2P A;  4P74 A;  4GS3 A;  1OXX K;  2K5V A;  4BA1 I;  3T1H L;  4B3M L;  1VQM A;  1NJI C;  5M5Y H;  5FLX c;  4NXN Q;  1BBU A;  1SN8 A;  2KHJ A;  4DV2 L;  4JI8 Q;  3GTQ H;  4BA2 I;  1YNX A;  2CFM A;  3K7U C;  3G71 A;  3RN2 A;  4OXP A;  1JB7 A;  5C3E G;  4LF9 L;  1XPU A;  3H3V H;  4JV5 Q;  2AKW B;  1LYL A;  1PH4 A;  4B3S Q;  3KYH C;  4YCV A;  2UXC L;  1IBK L;  3I4M H;  4IPC A;  3UE1 A;  3PUX A;  5GAE C;  4DV6 Q;  5EAY A;  4X64 Q;  3KJP A;  4A3J G;  1I50 H;  1SLJ A;  2MO1 A;  4P72 A;  4LUV A;  2A1A A;  1YJW A;  1VQG A;  2NVX H;  1NBW A;  2LXK A;  3STB D;  3Q8D A;  1VS0 A;  3D0F A;  5GAG C;  5C3E H;  2UXB L;  1PYS B;  2XGT A;  3JAM c;  1I94 L;  2AWN A;  4XIG S;  3KFU A;  4B3R L;  2QEX A;  3TQY A;  2YTV A;  3UDI A;  1K9M C;  4A3J H;  4UP7 A;  1EUJ A;  1YIT A;  1GD7 A;  3H3V I;  1JE5 A;  3M4Q A;  2Y0S E;  4A4I A;  2BH8 A;  4DV0 L;  1QVC A;  1VQJ A;  5IP7 G;  4LWC A;  1ASY A;  4J15 A;  2R93 G;  4DUY L;  3A0J A;  2PMZ E;  3VDY A;  1M1K C;  3S1R H;  1WCM G;  4H02 A;  4NB3 A;  4AH6 A;  1QVG A;  1N8R C;  2WAQ E;  3W1B A;  3RLO A;  5IY0 A;  2UUB Q;  3F1Z A;  2HHH L;  3G6E A;  2D62 A;  1VQ4 A;  1PH7 A;  3CPF A;  4JBK A;  3CCL A;  4DR3 Q;  3RNU A;  2Q2U A;  5IP7 H;  5LMU L;  4A75 A;  3M7N A;  2R93 H;  1EWI A;  2DGY A;  2RHQ B;  2QA4 A;  2UUC L;  1JJ2 A;  3RZO H;  4IPG A;  1L0W A;  4A93 G;  1WCM H;  4DV7 L;  3L7Z C;  4C3I H;  1YBY A;  3K0X A;  1N9W A;  2FXQ A;  2B29 A;  3B6Y A;  4FDB A;  5GAD C;  4JI3 L;  3PF5 A;  1C0A A;  2VS1 A;  4UP9 A;  3G4S A;  5ELN A;  1VQO A;  4DR7 Q;  2KHI A;  1E1T A;  4NXM L;  5JEA G;  4YHH L;  1XPR A;  3E0E A;  2K5N A;  3L0O A;  2K50 A;  3M4P A;  4DR4 Q;  2N78 A;  4JI2 Q;  3H15 A;  4RG1 A;  3U4Z A;  1PH9 A;  3CC4 A;  4A3B G;  1WOC A;  4LF7 Q;  4LFA L;  2V1C C;  2WP8 J;  4R4Q A;  1PFS A;  5C4J H;  3F2B A;  3CC7 A;  1Y1W G;  4QQB X;  1EIF A;  3S1M H;  2UUA L;  3JAM i;  3SGI A;  3E9I A;  1XMO Q;  2VQE L;  3CCE A;  1IBM Q;  2VNU D;  3HOW G;  4HIM A;  3GDE A;  4KLK A;  5AJ3 Q;  4BY1 G;  3J81 c;  3CCQ A;  2ZTD A;  5IWA L;  1KD1 C;  4A3I G;  4B3T L;  3BZC A;  2EQS A;  1HR0 W;  4JI6 L;  4JBM A;  4OX9 Q;  1FL0 A;  3ZJY C;  1S40 A;  4L5Q A;  3M3Y H;  1N33 Q;  4LF6 L;  1Y1W H;  2DUD A;  3CCV A;  4HID A;  3HKS A;  4JI5 L;  2B63 G;  1N36 Q;  1N32 Q;  1YVC A;  3BU2 A;  1GO3 E;  3JC6 6;  3NEN A;  3PUW A;  3HOW H;  1MIU A;  4LW1 A;  2ASB A;  3KF8 B;  5C0X G;  4A3E G;  4DNI A;  3S15 H;  3MXN B;  1Q1B A;  4BY1 H;  4A3L H;  1CKM A;  4HIO A;  4JYA L;  3NEM A;  4A3I H;  3ICE A;  4NPS A;  3F2C A;  5C4X G;  1N34 L;  2KBN A;  4A3G G;  4PZ7 A;  1T9H A;  1VQ7 A;  4OO1 G;  3D31 A;  3PIO A;  2Z0S A;  1ASZ A;  1NY4 A;  1PH6 A;  2B63 H;  5IT9 c;  2JA8 G;  4YCU A;  4DAY B;  3AEV A;  2IHF A;  2AHO B;  3A5Z B;  3PCO B;  2EIF A;  4A3E H;  4LFC L;  4IFD I;  1PA6 A;  1CKO A;  1W3S A;  4C2M H;  1YHQ A;  1X3F A;  4IOA A;  2N8N A;  1WI5 A;  3K7A H;  4NXN L;  4JI7 Q;  1AH9 A;  4JI8 L;  2R92 G;  4GOP A;  5C4X H;  1FGU A;  4A3G H;  2K5H A;  1TWH H;  2C35 B;  2I5L X;  1BVS A;  2IT1 A;  4JV5 L;  2OWO A;  2VY3 A;  4IPD A;  4GN5 A;  5GRO A;  5JEA J;  4DV3 Q;  1PV4 A;  5H1S E;  4B3S L;  2JA8 H;  4JOI A;  4DR2 Q;  1XNR L;  4GKJ Q;  1HNX Q;  1X6O A;  4ME3 A;  3PSI A;  4DV6 L;  4X64 L;  2E2I H;  4X66 Q;  1VQF A;  2L15 A;  2NN6 G;  1PH1 A;  3KJO A;  3A74 A;  2JA9 A;  5M5W H;  1YJN A;  3UE0 A;  3J81 i;  4QJF A;  2R92 H;  4IFD J;  4HJ8 A;  1L2F A;  1LTL A;  1YI2 A;  5JJI A;  1KC8 C;  4OWT B;  1L1O B;  2AMC B;  3G48 A;  4OON A;  4DV5 Q;  2HIX A;  4MZ9 A;  4A3K G;  4JC0 A;  4GOP B;  4JG2 A;  4DAM A;  2OTL A;  4A3C G;  1NMG A;  1V9P A;  2E8G A;  3K8A A;  2ZJR A;  2R7F A;  1TWF H;  1VQH A;  2ZJP A;  4GNX B;  3RZD H;  4LF8 Q;  2D0O A;  1A62 A;  3PUY A;  1FJG Q;  1O7I A;  5IP9 G;  4APV A;  5DLQ E;  1P16 A;  4Y7N H;  1XNQ L;  3KDF B;  1D7Q A;  2UUB L;  4HIK A;  1B8A A;  2VQF Q;  1EQR A;  1YHB A;  5C0X J;  4A3K H;  1KQS A;  3J80 c;  3OTO Q;  1VQL A;  4P73 A;  1VQ6 A;  2E2J H;  1GKH A;  1UWV A;  4P71 A;  1E22 A;  3PIP A;  3OW2 A;  5FJ8 G;  4JCV E;  3RLN A;  4GN3 B;  5IP9 H;  4GN4 B;  2CQO A;  4DK6 C;  2K4K A;  1VQB A;  1XTD A;  1UE5 A;  4GLV B;  4DR5 L;  3TS2 A;  4BXX G;  1X54 A;  3GO5 A;  4KI0 A;  1AE2 A;  2Q2I A;  2LSS A;  4EQ5 A;  3PGZ A;  1VQE A;  4DV4 Q;  4DR7 L;  2JA7 G;  4DR1 Q;  4MNO A;  3GTK H;  4A3B H;  2IY5 B;  5JJL A;  5GQO A;  1A0I A;  1VCI A;  4YWK A;  4DV2 Q;  2ZTE A;  4DR4 L;  4JI2 L;  1DGS A;  4LF4 Q;  2R7D A;  5FJ8 H;  1YJ9 A;  3M9B A;  4QGU A;  1HR0 Q;  4GOP C;  4LF7 L;  3KLW A;  1YZ6 A;  4LNQ A;  1X3G A;  2BH2 A;  1J6Q A;  4BXX H;  1I5F A;  1LM0 A;  3ULJ A;  4X62 Q;  3DLL A;  1XJV A;  1EOV A;  2B3G A;  2IHE A;  2K75 A;  3CCM A;  4JOI C;  2H5X A;  1XMO L;  1IBM L;  4UY8 C;  2JA7 H;  1KXL A;  4OWX B;  4DKA C;  2IX1 A;  2UU9 Q;  1KRT A;  4R4T A;  5C44 G;  1NMF A;  2JE6 I; 
#chains in the Genus database with same CATH topology
 1RF2 D;  1BCP F;  2BE5 C;  3TME A;  2DJG C;  3GD7 A;  2UXB Q;  2Z6K A;  4QL5 A;  2A68 C;  4ZLT F;  3S1N H;  2I5M X;  1TR5 A;  1I3Q H;  3S24 A;  1UEB A;  2F1M A;  2AUJ D;  1STH A;  4FF1 A;  4AIM A;  1E2W A;  2FHT A;  3A56 A;  2PQE A;  2F3V A;  4QB4 A;  3T1Y Q;  1ZYR D;  3L9A X;  1PH2 A;  1MI2 A;  1K8A C;  5EBD A;  2KEE A;  3GV6 A;  4GKK Q;  3PF4 A;  3M85 A;  3KLS A;  4PMW A;  2R6G A;  4BS9 A;  2N49 A;  1XWE A;  4G4K A;  3PO2 B;  1VQD A;  4DUZ L;  2WKD A;  5FO8 B;  2PW5 A;  3TEH B;  3FPP A;  4HJ5 A;  4JI7 L;  3GTQ B;  4DGZ A;  5E7N A;  2K33 A;  5HY6 A;  2R61 A;  3OIQ A;  4OEL B;  3ND8 A;  2PI2 E;  3AQQ A;  3J81 j;  1XPO A;  2BA1 A;  2B2W A;  1JQY D;  3BVM A;  3HOX G;  3ULP A;  4R4I A;  3FVQ A;  1ILQ A;  3NBH B;  1BNZ A;  2RA4 A;  4OO1 H;  1BUV T;  3CU7 A;  4K0K Q;  4DV5 L;  3TRZ A;  5C4Z A;  5LL6 X;  3WWV A;  4Y52 H;  2WV6 D;  2SOB A;  4X3S A;  1Q86 C;  3I56 A;  2K1B A;  4BBR G;  1HJP A;  3K5M A;  4LF6 Q;  3KDF A;  4LUZ A;  1FVI A;  1G2S A;  5FO7 B;  1S5D D;  1SBB B;  1I4X A;  1NAP A;  4A3D H;  1PFM A;  2WB1 E;  1OXT A;  1OXU A;  1E2V A;  1ZXT A;  2F0W A;  1EWH A;  4WJ3 M;  3OTO L;  4TVA B;  3T4A C;  5M3F H;  3CCS A;  4BBS B;  2HQL A;  2QF7 A;  3PO3 B;  1EYA A;  1Y1V H;  2MHV A;  1VQ5 A;  3I7F A;  5EQ0 A;  1TT2 A;  1WYD A;  2I46 A;  1PHJ A;  3FKI H;  2Q8I B;  4V19 0;  3DM1 A;  1K0R A;  1QG7 A;  5ELC A;  1SYB A;  2A6H C;  1TS3 A;  2NZ1 D;  3STB C;  1AE3 A;  1IKM A;  3HZX A;  4RWS C;  4DR3 L;  1ONL A;  1SSO A;  4BY7 G;  1HR0 L;  3AYH B;  1CKN A;  4C3H H;  2OTJ A;  2EPB A;  3CME A;  1XNR Q;  1G6Z A;  4X62 L;  3P1H A;  2EXD A;  3R2T A;  2ID0 A;  3T16 A;  1JB3 A;  1H95 A;  2OCE A;  3FPU B;  4O1N A;  4ZQ3 A;  1A63 A;  3SR1 A;  4IUN A;  5CV4 A;  3K0Y A;  3DWA A;  1CSQ A;  3HOY B;  4A3F H;  2HUG A;  1CHQ D;  2UXC Q;  2N3S A;  3H0G B;  1Y69 U;  4GNX C;  2EE1 A;  1H9S B;  3NXW A;  4EVO A;  5IYB H;  1NE3 A;  3R8B A;  1J5E L;  2NZO A;  1UNS A;  2MQH A;  4XQQ A;  1QUQ A;  5A35 A;  3CCU A;  2F0Q A;  4A3I B;  2JA6 B;  3S17 B;  1E24 A;  5C3X A;  3CCR A;  1PRT F;  3TDQ A;  1K8M A;  1IZ6 A;  2ZXO A;  3ITP A;  4YY3 L;  4ALP A;  1HZ9 A;  2Z9H A;  1RTN A;  3WDN A;  4AYB E;  2CVR A;  2EDG A;  3OYY A;  3J7A F;  3TRE A;  1EY4 A;  5J39 A;  2WAQ B;  2F0M A;  2TMP A;  3R93 A;  2BE5 D;  3CXC A;  1QZG A;  3L3O C;  2A68 D;  3H6M A;  2K14 A;  2R7Z B;  5LMU Q;  1TS5 A;  1QZH A;  4LK1 C;  1JJG A;  4JI1 L;  3QG1 A;  5FKA C;  3W5O A;  3WOF A;  3GTL H;  1I4H A;  1HZA A;  2EJG C;  3FHW A;  4YHH Q;  4IUU A;  4X3U A;  2OEO A;  2ZM6 L;  5LMN Q;  2RF4 A;  3I4M B;  2NBF A;  1RL2 A;  1YHA A;  2KJX A;  5A2Q E;  4S3S A;  3HOZ G;  1I50 B;  4A3L G;  1NTG A;  2PW7 A;  2NVX B;  5IGF A;  2Q2H A;  4R8N A;  2PQA A;  1EWC A;  2PNR C;  1HQR D;  2JA5 H;  3M7G A;  1HA5 A;  4A3M G;  2F52 A;  2NVQ H;  3HOU H;  3J81 L;  2E75 C;  5G3L D;  1SRU A;  5IWA Q;  2JJQ A;  4JI4 L;  3ULL A;  3I72 A;  3KF6 A;  1IYU A;  3NBI A;  1U9R A;  1DOL A;  1A2T A;  2A6E C;  1NSN S;  1T5E A;  3HKZ E;  1PVO A;  1B70 B;  1YNN C;  3E9H A;  3A55 A;  4FXG C;  1G8Z D;  1D5X C;  2YYZ A;  3DM3 A;  2RVL A;  3H3V C;  1Z6H A;  3I4L A;  1N34 Q;  1IYJ B;  1CTM A;  1DOK A;  2R93 B;  1K83 H;  1MSG A;  1EYG A;  2M9V A;  4LUO A;  5DM7 3;  1EOT A;  3MTS A;  4C3I B;  3L2P A;  4P74 A;  1A6X A;  1OXX K;  1TII D;  2LKV A;  2O5I C;  1PTO C;  4BA1 I;  3T1H L;  4B3M L;  1VQM A;  5FLX c;  2L0C A;  1BBU A;  3GTQ H;  1YNX A;  3K7U C;  5IGD A;  1JB7 A;  1LT3 D;  5C3E G;  4LF9 L;  3H3V H;  1PH4 A;  4CDC C;  4HCE A;  1SYC A;  1EY0 A;  4HED A;  3PUX A;  4IPC A;  4DV6 Q;  4A3J G;  5C4H A;  4P72 A;  4H7B A;  1YJW A;  4C1N K;  2A6H D;  1PTO H;  1CQV A;  3STB D;  3OMC A;  3V96 A;  1PZK D;  1GHJ A;  2FFK B;  3D0F A;  5GAG C;  4KJO A;  1PYS B;  3ERQ A;  1I94 L;  2AWN A;  4B3R L;  1Y1W B;  1K9M C;  1YIT A;  1GD7 A;  3M4Q A;  1ASY A;  2LS0 1;  3IKJ A;  1VQJ A;  3R2I A;  2PMZ E;  4ZK9 B;  3BZD B;  1DD2 A;  2D62 A;  2F0O A;  3DEP A;  1AFP A;  4JBK A;  4FXK C;  2E76 C;  4A75 A;  3MHB A;  1EWI A;  2DGY A;  2RHQ B;  5G3L F;  4ZKC B;  2UUC L;  2PPB C;  2DN8 A;  4IPG A;  2FXQ A;  1PRT B;  2F0N A;  4CGY B;  1C0A A;  2IX3 A;  2HD3 A;  5ELN A;  1VQO A;  5C4X B;  2KHI A;  1CZG A;  2PZU A;  5JEA G;  5DM6 3;  1WTX A;  4JI2 Q;  4IZ8 A;  1LTB D;  2K28 A;  4RG1 A;  2B2Y C;  4LF7 Q;  5FO9 B;  2WP8 J;  4J6H A;  2OT2 A;  3MXN A;  4F88 A;  2UUA L;  1MBY A;  3JAM i;  3C46 A;  1IBM Q;  3HOW G;  2B2V C;  3GDE A;  2XN9 C;  4DAP A;  4OX9 Q;  4A3B H;  4DAY A;  1HR0 W;  3RZD B;  3M3Y H;  4L5Q A;  2DUD A;  2CW0 C;  1GUS A;  3CCV A;  4HID A;  2B63 G;  3JC6 6;  3KF8 B;  3ONA B;  1BCP C;  3VR3 A;  5EJW A;  5KNB A;  4JYA L;  4A3I H;  3ICE A;  4ULL A;  4OO1 G;  1VQ7 A;  2MP1 A;  3D31 A;  2EOT A;  2Z0S A;  2JA8 G;  4YCU A;  1STY A;  2EIF A;  5CV5 A;  5FK9 C;  4MTK A;  4IOA A;  3E0J A;  4JI8 L;  2R92 G;  3P7J A;  4A3G H;  4KV6 A;  1BVS A;  4RGN A;  4JV5 L;  4N9P A;  1X6O A;  4ME3 A;  4RH6 A;  1SYG A;  2JA7 B;  2A6E D;  3OHX C;  3V05 A;  4X66 Q;  2NN6 G;  4DU9 A;  3A74 A;  1YNN D;  2JA9 A;  3J81 i;  4QJF A;  5I9P A;  4ZYS A;  4I7A A;  5L37 A;  1JIC A;  3K5L A;  1B3A A;  4HJ8 A;  1YI2 A;  1B4O A;  1L1O B;  2AMC B;  4MIU A;  4MZ9 A;  5CV6 A;  1I4Q A;  3OOC A;  1I3Q B;  5CV7 A;  1J8I A;  5NUC A;  3K8A A;  2D0O A;  5DLQ E;  1HUN A;  1PTO D;  4B9W A;  1BDO A;  4DF7 A;  1WD1 A;  3K6O A;  4DFA A;  2WB1 B;  1YHB A;  4DNT B;  4A3K H;  4KKS A;  3J80 c;  4F7X A;  3Q24 A;  5I6Y A;  1JOQ A;  1GKH A;  4M8A A;  5IP9 H;  4GN4 B;  4L63 B;  1UE5 A;  2B2T C;  4LAA A;  4J8Q A;  1KTK A;  3PGZ A;  4DR7 L;  5ELE A;  3VYS A;  4RFB A;  5FLX L;  3PIO 3;  1FNW A;  5EBC A;  1VCI A;  4DV2 Q;  3BVG A;  4LF4 Q;  3GV3 A;  1YJ9 A;  4QGU A;  3QWN A;  2CQA A;  2CH4 W;  2BH2 A;  4LNQ A;  3TZU A;  1J6Q A;  3JAM E;  1I5F A;  2K5D A;  3X3M A;  1M8A A;  1XJV A;  1EOV A;  2K75 A;  3I70 A;  2QIL A;  4OWX B;  2IX1 A;  2UU9 Q;  4CDE C;  1TWG B;  1KRT A;  5C44 G;  1NMF A;  2AUK A;  4K2K A;  3K5N A;  1XXG A;  5BN3 A;  1PZJ D;  4YCW A;  3GP7 A;  4DK3 C;  4CDF C;  1N36 L;  1QE6 A;  1SNM A;  5I4D A;  4A3D B;  1AZP A;  1SDF A;  1KAB A;  2MGS A;  4NMZ A;  2QEJ C;  4DUY Q;  1YNJ C;  2NVY B;  3SK4 A;  4CJ2 C;  1EL0 A;  4RA8 A;  4NDX A;  5M3F B;  1A8V A;  1X9N A;  5IYD G;  1X32 A;  2HHH Q;  1Y1V B;  2OQ0 A;  4P75 A;  2BA0 A;  2X6G A;  1Y8P B;  4R1J A;  1JMC A;  3FKI B;  3NBH A;  3IFD A;  4DNR B;  1G2T A;  4HJ9 A;  2L12 A;  4FP5 D;  2F4I A;  1PRT C;  4AYB B;  2CCZ A;  2ZJQ A;  1SYF A;  4C3H B;  2MUY A;  3MAQ A;  2IJ0 A;  1ICF B;  4DR2 L;  4GKJ L;  3HOV H;  2CW0 D;  3VR5 A;  2YTX A;  1PZI D;  4N9T A;  4DV1 Q;  3W1G A;  1BCP D;  1CUK A;  2RBM A;  1JWM D;  3CQZ H;  1RCV D;  3GTJ H;  1PXU A;  4A3F B;  1OXS C;  1Z9F A;  1HTP A;  1Y8N B;  1QWY A;  3KK7 A;  4F8M A;  1RKN A;  5DAU A;  5K36 H;  1LTT D;  3VR2 A;  4XQN A;  3EBE A;  2GVB A;  1LT4 D;  1Q90 A;  1KIX A;  2JP1 A;  3CD6 A;  1G6P A;  4FF2 A;  3PO2 G;  4KKU A;  4TRD A;  4IUR A;  3RD4 A;  1BBW A;  4GLA C;  4O0A A;  3RZO B;  2ES2 A;  2Q8R E;  1B9N A;  1IYV A;  3SE0 A;  4KJN A;  4XTC S;  1OXV A;  3SK5 A;  2LY7 A;  4R4C A;  4RAU C;  2QCP X;  3HKZ B;  1LTA D;  4K2L A;  1YIJ A;  2CWA A;  3NWT A;  4C3J H;  4DR1 L;  2E5L Q;  4G7O C;  1VQP A;  1WTO A;  4UP8 A;  1I4P A;  2F0I A;  4JI0 Q;  4UDU C;  3IRB A;  3FRP B;  2XSC A;  2OXP A;  4AQY Q;  3BS1 A;  3S1M B;  1H9S A;  5M3M H;  2UXD Q;  4QCL A;  3NUC A;  1TKW B;  3I73 A;  1W2B A;  3I4N H;  3SXH A;  2QGQ A;  4IJL A;  4JK1 C;  1ENF A;  3Q0A A;  1YEZ A;  1SYD A;  4ZCK A;  4HTH A;  1BO0 A;  2N88 A;  1L1O C;  3LGJ A;  2K5Q A;  3W2D A;  1IBK Q;  4IPH A;  2F3I A;  1K8G A;  4BBS G;  3PO3 G;  4KD3 A;  4L5T A;  3J7Y W;  2BDO A;  5ELD A;  4BY1 B;  3HOU B;  3CC2 A;  3HRZ C;  2NVQ B;  1XNQ Q;  3T1Y L;  3S2H H;  3A7L A;  3J80 L;  4K14 A;  1LV9 A;  1PYB A;  4B9X A;  1CK1 A;  1ENC A;  3MWY W;  4TQU S;  4GKK L;  1G29 1;  1S3O A;  2JQO A;  4DV0 Q;  3I2Z A;  3CPW A;  1UEA B;  1V1Q A;  1SYE A;  2PMZ B;  5DEH A;  4QIW E;  3TS0 A;  1NNX A;  1C7Y A;  5C5L A;  2A19 A;  3VA5 A;  1K83 B;  3QJY A;  1EY5 A;  3OW7 A;  1SJE D;  4XDX A;  2NZH A;  3W3A A;  1S72 A;  5J3B A;  3D4R A;  1RIP A;  5LL6 S;  5T1I A;  3HOY G;  3CP0 A;  5FLM H;  4IFD G;  2HQE A;  1YNJ D;  4CJ1 B;  2RDG A;  3H0G G;  1Q1E A;  2XWB B;  3A8K E;  3NSW A;  4DPG A;  1OO9 B;  5CBA E;  4K0K L;  5HGQ A;  1GVP A;  1WD0 A;  2H4O A;  2KA7 A;  1SFO H;  2JA6 G;  2L4N A;  3MVV A;  3DXJ C;  2KED A;  3TBI B;  2VUM H;  3VYT A;  3DWP A;  1PTO B;  2GN5 A;  2CH4 A;  1PRT D;  1SE2 A;  4R9W A;  2L5T A;  5C3W A;  1TWG H;  4IUQ A;  1XYI A;  3CCJ A;  1H9M A;  2EY1 A;  2WAQ G;  1VQI A;  2L11 A;  5IYC H;  1RD9 D;  1C4Q A;  1LAB A;  1SAP A;  2R7Z G;  2I5H A;  1Q8K A;  5ELB A;  1U0L A;  1F9R A;  1S5F D;  4KTA A;  5IGE A;  4DUZ Q;  1VQN A;  1VQ8 A;  2NVY H;  1STE A;  2J7Z A;  1TY0 A;  3U50 C;  1SNQ A;  4WOR A;  4XYQ A;  4CBV A;  2RCN A;  3AU7 A;  1DYQ A;  4WJ4 A;  3T13 A;  1KHI A;  5IT9 L;  1PH3 A;  1KDC A;  5AFW A;  2ATW A;  3I4M G;  3CMA A;  1Q12 A;  3C1E A;  1FNU A;  4G7Z C;  1SEB D;  4IUV A;  4NXN Q;  4BA2 I;  1EQT A;  2CFM A;  5KYL A;  1XPU A;  5ELF A;  2NB0 A;  1HCZ A;  4B3S Q;  2UXC L;  4EQP A;  3UE1 A;  5EAY A;  3KJP A;  2MO1 A;  1MHW C;  4RKB A;  5DNF A;  1HFN A;  1II3 A;  2WIN B;  1GJX A;  4RGT A;  5D3I B;  2ZXR A;  1A3T A;  2NTT A;  5CC4 A;  1V1P B;  4A3B B;  2XRQ D;  2DNC A;  2KEC A;  3M3Y B;  2K32 A;  1IW7 D;  5JVH 3;  4UP7 A;  1EUJ A;  2Y0S E;  1QVC A;  5IP7 G;  1LAC A;  2R93 G;  4CKC A;  1M1K C;  4H02 A;  4NB3 A;  1F77 A;  1S5E D;  4AH6 A;  4C3I G;  1QVG A;  1N8R C;  2UUB Q;  5E4W C;  3A54 A;  2DY7 A;  3K57 A;  1PH7 A;  1KDA A;  2HCI A;  3CPF A;  3OIP A;  1TY2 A;  4DR3 Q;  3RNU A;  3IL8 A;  4OHJ A;  4Z9C B;  5LMU L;  3M7N A;  3RZO H;  1H9K A;  1L0W A;  1WCM H;  3L7Z C;  1BCP B;  3B6Y A;  4FDB A;  4Q0F A;  5LHY 1;  4L8J A;  1SNP A;  4A3G B;  5I9O A;  1E1T A;  4YHH L;  5M5X B;  1EIH A;  1FGB D;  1VMC A;  2H1E A;  3KLR A;  2K5N A;  3M4Y A;  2K50 A;  3M4P A;  4DR4 Q;  2AQ3 B;  3HOX B;  3QR8 A;  3KF8 A;  2F0V A;  5C4J H;  1U4M A;  1Y1W G;  3S1M H;  3E9I A;  4UAI A;  2VNU D;  5F2D A;  1K28 A;  4HIM A;  4N8X 1;  1GOZ A;  5AJ3 Q;  1CQF A;  1KD1 C;  2ZTD A;  5IWA L;  4JI6 L;  3BZC A;  1PYW D;  1N33 Q;  1I4G A;  4QMG A;  1WTH A;  1MIU A;  5HGT A;  5C0X G;  3CRK C;  4DNI A;  2Z1C A;  4A3K B;  3NQI A;  1Q1B A;  4BY1 H;  1CKM A;  2GA4 B;  4NPS A;  3CRL C;  3F2C A;  1N34 L;  5C4X G;  1DOM A;  3PIO A;  3C2P A;  4J1M A;  3DUZ A;  2DY8 A;  4V0B A;  1DXM A;  5I6W A;  4A3E H;  4LFC L;  4MHE A;  1CKO A;  3C3L A;  1W3S A;  1UUP A;  1X3F A;  1WI5 A;  3FMC A;  1QOH A;  1TWH H;  2C35 B;  2I5L X;  4KHV A;  5ISR A;  1O80 A;  4E6I A;  2VY3 A;  5JEA J;  1PV4 A;  3E6Z X;  5GRO A;  2RDH A;  4DV3 Q;  5EKL A;  3I3C A;  1HNX Q;  3PSI A;  4DV6 L;  5D3D A;  4FVM A;  2M00 A;  1PDQ A;  2SDF A;  1YJN A;  1DCZ A;  4CHT B;  1EYC A;  2XVS A;  3BVZ A;  4HSP A;  3SK8 A;  4ID6 A;  3U9O A;  1TS4 A;  2E8G A;  2ZJR A;  2R7F A;  2ZJP A;  4LF8 Q;  2K01 A;  1FJG Q;  1O7I A;  4APV A;  4C1N I;  1P16 A;  4Y7N H;  3KDF B;  1B8A A;  4RKL A;  2EYL A;  1KQS A;  1SE4 A;  1EEF D;  1VQ6 A;  1DM0 B;  1RHP A;  1UWV A;  2F0U A;  2F0D A;  4P71 A;  3OW2 A;  5FJ8 G;  3MXP A;  4JCV E;  4GN3 B;  1U4P A;  4GLV B;  1VQB A;  1KAA A;  4BXX G;  4KI0 A;  3GO5 A;  1EQV A;  1AE2 A;  1RJT A;  2Q2I A;  4EQ5 A;  1VQE A;  4H44 C;  1FR3 A;  4DV4 Q;  2JA7 G;  3GTK H;  2IY5 B;  2RDF A;  5I2Y A;  4YWK A;  4JI2 L;  1DGS A;  3HOV B;  2R7D A;  2RSN A;  3M9B A;  1F2Y A;  3Q6S A;  4LF7 L;  4GOP C;  3CQZ B;  4JOI C;  4UY8 C;  1IBM L;  1B53 A;  3V2T A;  4PV1 C;  3GTJ B;  4R4T A;  1U4L A;  1UE1 A;  4OIK A;  3RUZ A;  3HOZ B;  1SE8 A;  2EYM A;  4OX9 L;  4L5R C;  4FF4 A;  2WB1 G;  2NVT B;  3TZD A;  1IBL Q;  4YWM A;  4CKB A;  4A93 H;  1Q46 A;  3VR6 A;  2ALY B;  1TWC H;  1EFI D;  2NTS A;  1XMQ Q;  3MEH A;  1ZKO A;  1HNZ Q;  3QOL A;  1PH8 A;  2IPK D;  4BWG B;  2JEA I;  3BYT B;  5JAV A;  2VW9 A;  1VDZ A;  3N52 A;  4X65 Q;  2MJ8 A;  4HN7 A;  1HXY D;  1NCV A;  1ZEQ X;  1EIY B;  4XXE A;  5EPJ A;  2IX0 A;  3CHB D;  1SRO A;  1R4P B;  3K81 C;  4C3J B;  2FMM A;  3U58 A;  4PG3 A;  2JEB I;  2HIV A;  3NEL A;  2A69 D;  1KDB A;  4KHP Q;  3RLF A;  1Z47 A;  4KHZ A;  2XRS D;  4K8I A;  5M3M B;  3I4N B;  4H0L C;  3K80 C;  3IAY A;  2F4V Q;  4L5S A;  2KOL A;  2F0H A;  2A8V A;  4JW0 A;  2L1B A;  1R9T H;  4A3D G;  1HNW Q;  3BZK A;  5BR8 Q;  5M5X H;  2D0P A;  1GM5 A;  3BJU A;  4GNX A;  4HJ7 A;  5M3F G;  2AWO A;  3D6C A;  3NP8 A;  5TSS A;  5COR A;  3HOX H;  2JSO A;  3A8J E;  3SK6 A;  1F2M A;  1Y1V G;  2Z6K C;  1SR3 A;  1KAW A;  1BF4 A;  2PNH A;  3S2H B;  2XTI A;  2LXJ A;  3FKI G;  1MGS A;  2F0E A;  2NYZ D;  1E7Z A;  2GVA A;  5LMN W;  1B50 A;  4AYB G;  4JYA Q;  3C1F A;  1E1O A;  4BBR H;  1C8C A;  4OO1 I;  1WJJ A;  3GTP H;  4GLX A;  2D5D A;  1Y14 B;  4OIJ A;  1LTG D;  3PQI A;  3NTH A;  4KK7 A;  4C3H G;  4OGQ C;  1Q3L A;  3KF6 B;  1D6E C;  3GTG H;  5KGU A;  1B3Q A;  3KUP A;  2ICI A;  3SHL A;  4KN7 C;  1M4V A;  4A3C H;  1XX8 A;  1EZ6 A;  4R8I A;  1GUG A;  4LF4 L;  3PV0 A;  2VB3 X;  3X3N A;  4A3F G;  1C9O A;  4LF5 Q;  1KRS A;  4DR6 Q;  4G7H C;  4ZUJ A;  2NN6 I;  4GZY C;  4LFB Q;  4XYO A;  2UU9 L;  4FXD A;  1V43 A;  3CW2 C;  1X56 A;  2B2W C;  5IYB G;  1PLF A;  3A8I E;  1SFO B;  4BY7 H;  4K8J A;  1EQQ A;  4UPA A;  1PFB A;  3HEJ A;  2VUM B;  3OPO A;  1MKH A;  2AQ1 B;  2FJ2 A;  4IOC A;  1CT1 D;  2QDL A;  3AFQ A;  4R4O A;  3HOW B;  3F8T A;  5IIF A;  2YU9 H;  2QW7 A;  2VZA A;  3OMG A;  1AEX A;  1M90 C;  1ML0 D;  3HKZ G;  2I0Q A;  1ET9 A;  4QUF A;  2IW3 A;  3I55 A;  1W6K A;  1N32 L;  1L0Y B;  1Z7T A;  2Y0S B;  3LNN A;  1E2Z A;  1TXY A;  5KND A;  5T1G A;  2YV5 A;  4K6D A;  5M9O A;  2F3W A;  2V4D A;  3SDZ A;  1DZ1 A;  4DN4 M;  1O78 A;  1G91 A;  1D1I A;  3J7A 5;  2K5W A;  4LMQ D;  3TP8 A;  1HRJ A;  1ROD A;  4JVZ A;  2SNS A;  4RCO A;  3U4V A;  4DV1 L;  2MPM A;  2E2H H;  5M5W B;  4DV7 Q;  2EY6 A;  5BN5 A;  4NKL A;  4DXG A;  4JI3 Q;  1DJR D;  1MJC A;  2PZT A;  2WFW A;  4NXM Q;  2D2C C;  3NPP A;  2JA5 G;  4POG A;  4IJH A;  4RHS A;  2JYO A;  3HOU G;  1EZ8 A;  3NK9 A;  1U4R A;  1TWF B;  2Z4H A;  3DMU A;  3NWS A;  4RGO S;  3VR4 A;  5IE8 A;  1ENA A;  4LFA Q;  1S5C D;  3EJI A;  2JXM B;  1EU4 A;  3J81 E;  1D5M C;  3LX0 A;  4FF3 A;  4FNF A;  3P20 A;  1I6H H;  2EYO A;  2VQE Q;  1TVX A;  2RSO A;  1K3R A;  3J7Z C;  5A2Q L;  2MO0 A;  3ER0 A;  4JBW A;  3KLS X;  1JOK A;  2AQ2 B;  1NR4 A;  3HOZ H;  4A3L H;  1KL9 A;  4B3T Q;  2MFI A;  4KY6 A;  1Q82 C;  2NVT H;  1HFG A;  2Z4I A;  1SXT A;  3PUZ A;  4JI5 Q;  1JCK B;  2F0T A;  3I4O A;  2VQF L;  1STA A;  4A3M H;  1Q7Y C;  2QDB A;  1F9S A;  2E5L L;  1UE6 A;  4PZ6 A;  3HS0 C;  4JI0 L;  1SMX A;  5I2X A;  1SJH D;  3EN2 A;  2ZXP A;  1LTI D;  1WCM B;  4AQY L;  1BKB A;  1B7Y B;  3S16 H;  1IXR A;  2EY5 A;  3MA2 B;  2UXD L;  1KLU D;  3MZ5 A;  1FYC A;  3AFP A;  5E3F A;  1S5B D;  2K5V A;  3BDO A;  4WFN 3;  5M5Y H;  1SN8 A;  2B2Y A;  2KHJ A;  4CJ0 B;  3LWE A;  2VXW A;  3G71 A;  3RN2 A;  1GUW A;  4OXP A;  2B2U C;  1LYL A;  1QCB D;  3KYH C;  1IW7 C;  4YCV A;  1IHZ A;  1IBK L;  5C4J B;  1EEI D;  4X64 Q;  2B2V A;  4OEM B;  1SLJ A;  4DK1 A;  4LUV A;  2KCC A;  3WOE A;  1X3Q A;  3M4O B;  1VQG A;  1O7Z A;  4CDD C;  1NBW A;  2LXK A;  3O13 A;  3VA7 A;  4DK0 A;  5C3E H;  2UXB L;  3JAM c;  1QIL A;  2PCF B;  2KHS A;  3KFU A;  2QEX A;  3TQY A;  5COY A;  2N55 A;  4A3J H;  3H3V I;  1JE5 A;  4A4I A;  4DV0 L;  4LWC A;  4ZRZ A;  2F0S A;  1JR0 D;  1K0S A;  3S1R H;  1KNA A;  3RLO A;  4HAE A;  5EGT A;  5IY0 A;  2DJF C;  2F0L A;  4DXF A;  3G6E A;  1VQ4 A;  1F9P A;  4Q5V A;  3J7A V;  3CCL A;  4HR7 B;  4L6T B;  4A3E B;  2EZV A;  4XT1 B;  4XT3 B;  4DR5 Q;  2BOS A;  2KUM A;  2F0J A;  2SNM A;  4UP9 A;  4C56 C;  1TWH B;  1XPR A;  3E0E A;  1BR9 A;  2B8F A;  4IUT A;  2TSS A;  3L0O A;  1CHP D;  1SNO A;  2A5H A;  3U4Z A;  3CC4 A;  4A3B G;  1D5Z C;  2V1C C;  3BYY B;  3CC7 A;  3F2B A;  4QQB X;  1JOR A;  1ICW A;  1EIF A;  4DAV A;  3SGI A;  1XMO Q;  1F2Z A;  3CCE A;  5JEA H;  4KD4 A;  3J81 c;  3NTI A;  4A3I G;  1QNK A;  1T5X D;  4JBM A;  2PYK A;  1S40 A;  1SND A;  3BDC A;  4LF6 L;  4Y7N B;  3BU2 A;  3HOW H;  4LW1 A;  1TWA B;  4ZAI A;  3TSS A;  4KKT A;  4U68 A;  2K7V A;  3U9S A;  4HIO A;  2PZW A;  1RDP D;  2ENB A;  2LMC B;  2OF1 A;  5BN4 A;  2KBN A;  2B2T A;  4PZ7 A;  1T9H A;  4A3G G;  4PMC A;  1VF7 A;  1NY4 A;  1PH6 A;  2B63 H;  4ABN A;  3AEV A;  2XIW A;  2IHF A;  1LT5 D;  4IFD I;  4C2M H;  3GTK B;  1YHQ A;  2G9D A;  2N8N A;  3K7A H;  4NXN L;  4JI7 Q;  5KIX A;  5J22 A;  2K5H A;  2IT1 A;  5JPM C;  4GN5 A;  4B3S L;  5H1S E;  3T56 B;  2JA8 H;  2Q8T A;  3OSO A;  1TU2 B;  4P2C B;  1XNR L;  3SEB A;  2EYF A;  2E2I H;  1VMP A;  1PH1 A;  4CKE A;  3KJO A;  4NP5 A;  5M5W H;  2R92 H;  3D3R A;  1LTL A;  5JJI A;  1KC8 C;  1JWU D;  3LWU A;  4OWT B;  4A3K G;  2HCC A;  3NE5 B;  4DV5 Q;  2OTL A;  4O42 A;  4GOP B;  4JG2 A;  4A3C G;  1GHK A;  4A93 B;  1HA6 A;  3MC0 B;  1NMG A;  1V9P A;  4I65 A;  2CHB D;  1TWC B;  2NN6 H;  5K5P A;  1TWF H;  1VQH A;  2XNA C;  3PUY A;  5IP9 G;  3AMU A;  1O7L A;  1A3U A;  2UUB L;  1EQR A;  2JN4 A;  4NW2 A;  5C0X J;  3OTO Q;  1VQL A;  1K3B C;  4P73 A;  2E2J H;  4QUC A;  5FLX E;  4IN3 A;  3RLN A;  1W6J A;  2CQO A;  1STG A;  1XTD A;  1LTS D;  1X54 A;  1X3P A;  1IKL A;  2L55 A;  5JJL A;  1TQO A;  5KYI A;  5JJZ A;  2ZTE A;  5C6A A;  4DR4 L;  2K6A A;  1HR0 Q;  3FEW X;  2K04 A;  3KLW A;  1LLR D;  1QNU A;  3ULJ A;  1LM0 A;  1GUN A;  4X62 Q;  3CCM A;  2H5X A;  1R9T B;  2M2L A;  2JE6 I;  4LJZ C;  3JAM L;  5LMN L;  5AJ3 L;  2XWJ B;  3S1Q B;  4EX5 A;  1N33 L;  3PUV A;  3EIV A;  1E3P A;  2F0P A;  1J9O A;  3J80 i;  5C44 H;  3ERS X;  3MFY A;  3M4O H;  3I8Z A;  3UDX A;  2A69 C;  1D1K A;  1J5E Q;  1JWS D;  4X3T A;  2YTY A;  2C5C A;  4BBR B;  3GTP B;  4K5X A;  4JPB W;  1BXT A;  3GTM H;  1P8L A;  3D6W A;  5JJK A;  2J0T D;  4YY3 Q;  2Z6B A;  1PFN A;  3RMH A;  3UDG A;  1DON A;  1JJC B;  1F2L A;  2EYH A;  4YWL A;  3HOV G;  3GTG B;  3S14 H;  3S2D H;  5IOD A;  3CF5 A;  1LO5 D;  1CA6 A;  3D4W A;  2KCN A;  5IYD H;  3FP9 A;  2B2U A;  4HMI A;  1FD7 D;  5KEE A;  2JK8 A;  2E74 C;  4IAL A;  1A2U A;  3PIP 3;  3OWF A;  2EJM A;  4DV3 L;  1TS2 A;  2ZT9 C;  3RN5 A;  2PI2 A;  5CMD A;  1HNX L;  1I4R A;  4TKO B;  2RHS B;  3MEF A;  5K36 G;  1HQM C;  3GTO H;  4JI1 Q;  1L1O A;  2EY2 A;  1G51 A;  4BY7 B;  3HP3 A;  2KVM A;  2SEB D;  2B39 A;  4QF4 A;  2ZM6 Q;  1AP0 A;  2OQK A;  3EVQ A;  1HZC A;  1SMY C;  4JI6 Q;  2X6L A;  3G7L A;  1O7Y A;  4LF8 L;  2RCF A;  2VL6 A;  2YU9 B;  5FOB B;  1FJG L;  4IO9 A;  1WVL A;  1HZB A;  4O2D A;  5C0X I;  4QY7 A;  1GUT A;  1STB A;  2IL8 A;  4C3J G;  4HSV A;  1QVF A;  3EA6 A;  2HT1 A;  1V1O A;  4KMU C;  3T51 B;  4JI4 Q;  3F2D A;  4X6A H;  1K73 C;  1X55 A;  1U5K A;  2F0G A;  5M3M G;  1EYD A;  4DV4 L;  4LFC Q;  1CSP A;  3I4N G;  3PO2 H;  2C9O A;  1TWA H;  3ERO A;  3KBX A;  3RR5 A;  3Q22 A;  1STN A;  1PH5 A;  2NWG A;  1NUC A;  2KEN A;  1LUZ A;  4IUP A;  1VQ9 A;  1EFW A;  1D2B A;  2E2H B;  3IFT A;  1F9Q A;  5IGC A;  1VQC A;  3URY A;  4EQO A;  4PNY A;  1OTC A;  3T1H Q;  1CA5 A;  4B3M Q;  1JOO A;  3ND9 A;  4LF9 Q;  1EY9 A;  3KBG A;  1Q81 C;  1IBL L;  1I6H B;  3J80 E;  1CKN B;  2KCM A;  2EYP A;  3OWE B;  3S15 B;  4HMJ A;  1XMQ L;  2ZTC A;  4OWW B;  4ME5 A;  1MSH A;  3H09 A;  5CGK A;  2K52 A;  1HNZ L;  4HJA A;  1ESR A;  1WTW A;  1I94 Q;  1UE7 A;  3SVM A;  4B3R Q;  4X65 L;  3A7A B;  1X65 A;  4BBS H;  3PO3 H;  4A3M B;  4ODG A;  1SNC A;  1CZW A;  2WII B;  2PO4 A;  3UDF A;  5FLM G;  2BDN A;  1JT8 A;  2MNA A;  3T53 B;  4KHP L;  1QUQ B;  2EXZ A;  1H9R A;  4WJW A;  3S16 B;  1BQQ T;  2O4X A;  3I91 A;  3K58 A;  2CKZ B;  1S4Z A;  2E2D C;  2UUC Q;  2F4V L;  2Q2T A;  4X3K A;  2VUM G;  1AW7 A;  1C48 A;  4RMF A;  4TSS A;  5M5Y B;  2F0K A;  2KCT A;  1L0X B;  1HNW L;  2CWP A;  4K6L A;  4QIW B;  3BDL A;  3KOJ A;  4ZKB B;  5GAH C;  5C5M A;  5ELO A;  5BR8 L;  2FMC A;  3K5O A;  1FNV A;  3TP6 A;  4K5W A;  3HOY H;  3TP7 A;  4XQJ A;  4X66 L;  4IFD H;  5IYC G;  4A76 A;  3H0G H;  4POF A;  1X3E A;  2UUA Q;  3VYR A;  3E3X A;  3F2U A;  3TP5 A;  5C3E B;  2Y0S G;  1EIG A;  1PMR A;  2R3Z A;  3EQL C;  4PZ8 A;  3NHH A;  2JA6 H;  2LFN A;  3S17 H;  4A3J B;  2DNE A;  1VQK A;  3S1Q H;  1A3V A;  2A74 C;  1WFQ A;  4M1U B;  5JPN C;  1SE3 A;  3CAM A;  3S1R B;  4KY7 A;  2RQX A;  3MXG A;  1HH2 P;  1VQA A;  4JBJ A;  1D8L A;  1WTV A;  3HFZ B;  1MJE A;  2PQA B;  5IT9 E;  5E1F A;  2J4X A;  3TN2 A;  1HHV A;  2ICE C;  3A5U A;  1IL2 A;  1SMY D;  5EKI A;  2HDL A;  3HGB A;  2F0F A;  1I6V C;  1HPC A;  4LF5 L;  2R7Z H;  4DR6 L;  3CKI B;  4MTN A;  4LFB L;  5CBE E;  4GS3 A;  4ZUI A;  1NJI C;  4DV2 L;  4JI8 Q;  4H13 C;  3NTK A;  3S1N B;  1EY7 A;  4JV5 Q;  2AKW B;  4KN4 C;  1V8Q A;  3I4M H;  3H91 A;  5HUR A;  5GAE C;  1WTR A;  2RKS A;  2EYJ A;  1I50 H;  2O5J C;  1CM9 A;  2A1A A;  5KRU A;  2NVX H;  2Z8L A;  1EY8 A;  5CYU A;  3BG3 A;  4K5V A;  3Q8D A;  1VS0 A;  4DA2 A;  3DWQ A;  1R4Q B;  2XGT A;  2NUC A;  4WRD A;  1ESF A;  3R3O A;  4XIG S;  2YTV A;  3UDI A;  3HG9 A;  4EQN A;  1EU3 A;  1XTC D;  2BH8 A;  4RCN A;  2K05 A;  2P5Z X;  4J15 A;  4DUY L;  3A0J A;  3VDY A;  1WTQ A;  1WCM G;  1Y8O B;  3QOJ A;  2WAQ E;  3W1B A;  4PMB A;  3F1Z A;  2EVB A;  3VYU A;  3Q23 A;  2A73 B;  2HHH L;  5IOC A;  3QB3 A;  2B63 B;  4HCS A;  2Q2U A;  3D4D A;  5IP7 H;  2R93 H;  2G5D A;  2QA4 A;  2QKI C;  1JJ2 A;  4C2M B;  4DV7 L;  4C3I H;  5GAD C;  1YBY A;  3K0X A;  1N9W A;  4I7Z C;  2B29 A;  2VB2 X;  3K7A B;  1A15 A;  4JI3 L;  3PF5 A;  1EY6 A;  2VS1 A;  3G4S A;  4DR7 Q;  1KNE A;  4NXM L;  3D8G A;  1LTR D;  4OL7 A;  2IWH A;  1GXD C;  1ZYR C;  5CV9 A;  4N8F A;  2JA8 B;  4U67 3;  2F03 A;  2N78 A;  3H15 A;  5JVG 3;  2E2I B;  1PH9 A;  1WOC A;  4LFA L;  4RHR A;  2X69 A;  3I90 A;  4F87 A;  1NR2 A;  1PFS A;  4R4Q A;  1B2T A;  4IQZ A;  2R92 B;  2VQE L;  1ET6 A;  5JOB A;  5IGB A;  1B44 D;  2L9H A;  4ILW A;  1K8O A;  4KLK A;  5KNC A;  4FYD A;  1JC7 A;  1QJO A;  3MFG A;  4BY1 G;  1B1Z A;  4EGV A;  3CCQ A;  4B3T L;  4FO2 A;  2EQS A;  5J1Z A;  1FL0 A;  3ZJY C;  1E0B A;  1Y1W H;  3HKS A;  4JI5 L;  4B08 A;  1N36 Q;  1N32 Q;  1YVC A;  1GO3 E;  3NEN A;  3PUW A;  1HUM A;  2ASB A;  2D9U A;  4A3E G;  3S15 H;  1HTL D;  3MXN B;  5D65 A;  4G57 A;  4KY5 A;  2E2J B;  1PTO F;  3NEM A;  3S9W A;  5EPK A;  1ASZ A;  5IT9 c;  1QB5 D;  4DAY B;  2AHO B;  3A5Z B;  2KQ3 A;  3PCO B;  5C0X H;  1BBX C;  3MXU A;  1PA6 A;  3FDT A;  3P75 A;  3K59 A;  1AH9 A;  1Q8I A;  4GOP A;  5C4X H;  1FGU A;  1CFM A;  3EFX D;  2OWO A;  4IPD A;  5E4X A;  3H94 A;  2G9H D;  3UI2 A;  4JOI A;  4DR2 Q;  4GKJ Q;  4X64 L;  1VQF A;  3G6J B;  2L15 A;  2WAC A;  1AN8 A;  1ILP A;  1V1P A;  3UE0 A;  4IFD J;  5CV8 A;  2K03 A;  4RGM A;  1JE4 A;  1L2F A;  4MN3 A;  2HDM A;  5IGG A;  4OON A;  3G48 A;  1WTP A;  2HIX A;  4JC0 A;  4DAM A;  1H9J A;  4GNX B;  3RZD H;  2I07 B;  1A62 A;  5C44 B;  5CR3 A;  3NQT A;  3GQB A;  3N6R A;  1XNQ L;  1D7Q A;  1KLG D;  4HIK A;  3PMF A;  3QIA A;  2FIN B;  2VQF Q;  1MD2 D;  3E5S A;  3GTM B;  2B8G A;  4UHV A;  1AZQ A;  1E22 A;  3PIP A;  1GUO A;  3S14 B;  3S2D B;  4DK6 C;  2K4K A;  4DR5 L;  3TS2 A;  2LSS A;  4YIJ A;  3GTL B;  1B9M A;  2BCO A;  2WKC A;  4MNO A;  4DR1 Q;  5EPL A;  1BOS A;  1A0I A;  5D14 A;  5GQO A;  1RTO A;  5FJ8 H;  2O2L D;  1YZ6 A;  1X3G A;  1UAP A;  3GTO B;  4BXX H;  1LT6 D;  1VF5 C;  3DLL A;  3AB9 A;  5EKK A;  2B3G A;  2EJF C;  2IHE A;  4PQX A;  1XMO L;  4A93 G;  2JA7 H;  1KXL A;  2JA5 B;  4DKA C;  1IL8 A;  3QO2 A;  3ZYY X;  3DEO A;  3DHQ A;  1CI3 M; 
#chains in the Genus database with same CATH homology
 1UE1 A;  5LMN L;  5AJ3 L;  2UXB Q;  1SE8 A;  3GD7 A;  2Z6K A;  4QL5 A;  4OX9 L;  4L5R C;  3S1N H;  2WB1 G;  2I5M X;  4EX5 A;  1N33 L;  3PUV A;  1IBL Q;  4YWM A;  4YCW A;  4DK3 C;  3EIV A;  4A93 H;  1E3P A;  1Q46 A;  1I3Q H;  3S24 A;  1UEB A;  4DR5 Q;  1N36 L;  2ALY B;  1TWC H;  3J80 i;  4DUY Q;  5C44 H;  3ERS X;  1XMQ Q;  4AIM A;  3M4O H;  3UDX A;  1J5E Q;  2YTY A;  1A8V A;  3T1Y Q;  1X9N A;  5IYD G;  1HNZ Q;  1PH8 A;  2JEA I;  1PH2 A;  2HHH Q;  2OQ0 A;  4P75 A;  1K8A C;  2VW9 A;  2BA0 A;  3GTM H;  1P8L A;  4GKK Q;  4X65 Q;  5JJK A;  4R1J A;  4YY3 Q;  3M85 A;  1JMC A;  1EIY B;  3PF4 A;  3UDG A;  2IX0 A;  4PMW A;  1JJC B;  2R6G A;  4YWL A;  1SRO A;  3HOV G;  2N49 A;  3K81 C;  4HJ9 A;  3S14 H;  3S2D H;  1VQD A;  4DUZ L;  3U58 A;  4PG3 A;  2JEB I;  3CF5 A;  2HIV A;  3NEL A;  3TEH B;  2CCZ A;  4HJ5 A;  4JI7 L;  5IYD H;  3FP9 A;  2JK8 A;  4KHP Q;  2ZJQ A;  5E7N A;  4DV3 L;  3RLF A;  5HY6 A;  1Z47 A;  3RN5 A;  4KHZ A;  2PI2 A;  4DR2 L;  4GKJ L;  1HNX L;  3HOV H;  2PI2 E;  3AQQ A;  2YTX A;  3J81 j;  2RHS B;  3K80 C;  3MEF A;  1XPO A;  4DV1 Q;  2F4V Q;  2BA1 A;  3HOX G;  3ULP A;  4L5S A;  3GTO H;  5K36 G;  4R4I A;  3W1G A;  1CUK A;  3NBH B;  4JI1 Q;  1L1O A;  3CQZ H;  2A8V A;  1G51 A;  1R9T H;  4A3D G;  1HNW Q;  3GTJ H;  3BZK A;  5BR8 Q;  1OXS C;  1Z9F A;  4K0K Q;  4DV5 L;  3TRZ A;  5M5X H;  2D0P A;  1GM5 A;  3BJU A;  2ZM6 Q;  4GNX A;  4HJ7 A;  2OQK A;  3WWV A;  1HZC A;  4Y52 H;  5M3F G;  1Q86 C;  3I56 A;  2AWO A;  4JI6 Q;  4BBR G;  1HJP A;  3HOX H;  4LF8 L;  1Y1V G;  2VL6 A;  2Z6K C;  4LF6 Q;  1FJG L;  3KDF A;  1SR3 A;  1FVI A;  1KAW A;  3EBE A;  2GVB A;  4LUZ A;  4IO9 A;  1KIX A;  3CD6 A;  2PNH A;  4A3D H;  1G6P A;  2XTI A;  1HZB A;  4O2D A;  2LXJ A;  3FKI G;  5C0X I;  2WB1 E;  1OXT A;  1OXU A;  4QY7 A;  3PO2 G;  1E7Z A;  3OTO L;  2GVA A;  4WJ3 M;  4TVA B;  5LMN W;  1QVF A;  2HT1 A;  5M3F H;  4AYB G;  4JYA Q;  4BBR H;  1BBW A;  1E1O A;  3CCS A;  4OO1 I;  2HQL A;  1WJJ A;  3GTP H;  4GLX A;  1Y1V H;  4GLA C;  4JI4 Q;  4O0A A;  1Y14 B;  3F2D A;  1VQ5 A;  2ES2 A;  4X6A H;  1K73 C;  3I7F A;  1WYD A;  1X55 A;  4XTC S;  1OXV A;  3KF6 B;  1PHJ A;  3FKI H;  1U5K A;  4R4C A;  5M3M G;  4LFC Q;  4DV4 L;  1K0R A;  3GTG H;  1CSP A;  3I4N G;  3PO2 H;  1YIJ A;  1TWA H;  2CWA A;  4C3J H;  4DR1 L;  2E5L Q;  3RR5 A;  3STB C;  4A3C H;  1AE3 A;  1VQP A;  4UP8 A;  1PH5 A;  4DR3 L;  4LF4 L;  3PV0 A;  4JI0 Q;  4BY7 G;  2KEN A;  1LUZ A;  3IRB A;  1HR0 L;  3AYH B;  1CKN A;  1VQ9 A;  4C3H H;  4A3F G;  1EFW A;  2OTJ A;  1C9O A;  3CME A;  1KRS A;  4AQY Q;  4LF5 Q;  1XNR Q;  4X62 L;  4DR6 Q;  2EXD A;  5M3M H;  2UXD Q;  1VQN A;  2NN6 I;  1W2B A;  1VQC A;  3I4N H;  4LFB Q;  2UU9 L;  2QGQ A;  2ID0 A;  4IJL A;  1OTC A;  1H95 A;  3T1H Q;  1V43 A;  1YEZ A;  2OCE A;  3CW2 C;  4B3M Q;  1X56 A;  5IYB G;  1A63 A;  4BY7 H;  1EQQ A;  4LF9 Q;  1CSQ A;  1L1O C;  4A3F H;  3LGJ A;  4UPA A;  1Q81 C;  1MKH A;  1IBK Q;  4IPH A;  1IBL L;  2F3I A;  2N3S A;  4IOC A;  2UXC Q;  3AFQ A;  1CKN B;  4R4O A;  4GNX C;  1K8G A;  3F8T A;  2KCM A;  3PO3 G;  4BBS G;  2YU9 H;  1XMQ L;  4L5T A;  2VZA A;  2ZTC A;  4OWW B;  5IYB H;  1NE3 A;  3CC2 A;  1J5E L;  1XNQ Q;  2NZO A;  2MQH A;  1M90 C;  3T1Y L;  1QUQ A;  3CCU A;  3S2H H;  2K52 A;  1HNZ L;  1E24 A;  3CCR A;  4HJA A;  1PYB A;  3HKZ G;  1I94 Q;  2I0Q A;  1IZ6 A;  1UE7 A;  4B3R Q;  4TQU S;  4GKK L;  1G29 1;  1S3O A;  2JQO A;  4X65 L;  4YY3 L;  4ALP A;  1X65 A;  4BBS H;  1HZ9 A;  3I55 A;  3PO3 H;  1N32 L;  4DV0 Q;  3I2Z A;  1TXY A;  3CPW A;  1V1Q A;  2YV5 A;  4AYB E;  3UDF A;  5FLM G;  3OYY A;  1JT8 A;  4QIW E;  3TRE A;  2MNA A;  3TS0 A;  1C7Y A;  3CXC A;  4KHP L;  3J7A 5;  1QZG A;  2A19 A;  1QUQ B;  2K14 A;  2NZH A;  5LMU Q;  1S72 A;  2CKZ B;  5J3B A;  3U4V A;  1RIP A;  2UUC Q;  1QZH A;  4DV1 L;  2F4V L;  3HOY G;  2Q2T A;  3CP0 A;  5FLM H;  4DV7 Q;  2E2H H;  2VUM G;  4RMF A;  4IFD G;  1JJG A;  3H0G G;  4JI1 L;  1Q1E A;  4JI3 Q;  2KCT A;  1HNW L;  2CWP A;  3W5O A;  4DPG A;  3GTL H;  3KOJ A;  1MJC A;  1HZA A;  2WFW A;  3FHW A;  5GAH C;  4YHH Q;  5ELO A;  4NXM Q;  2JA5 G;  5BR8 L;  4K0K L;  4POG A;  4IJH A;  5HGQ A;  2ZM6 L;  1GVP A;  5LMN Q;  3HOU G;  2RF4 A;  1SFO H;  1RL2 A;  2JA6 G;  1YHA A;  3HOZ G;  3HOY H;  4A3L G;  5IE8 A;  4LFA Q;  4X66 L;  1NTG A;  2VUM H;  2Q2H A;  5IYC G;  3H0G H;  4A76 A;  4POF A;  2PQA A;  2GN5 A;  1I6H H;  1X3E A;  2UUA Q;  2VQE Q;  1K3R A;  3J7Z C;  2JA5 H;  2MO0 A;  2Y0S G;  3ER0 A;  1TWG H;  4JBW A;  4A3M G;  2F52 A;  2NVQ H;  3HOU H;  3CCJ A;  4PZ8 A;  2JA6 H;  3S17 H;  3HOZ H;  1SRU A;  2WAQ G;  1KL9 A;  5IWA Q;  2JJQ A;  4B3T Q;  4JI4 L;  3ULL A;  1VQI A;  2MFI A;  1VQK A;  3KF6 A;  5IYC H;  1Q82 C;  2NVT H;  3S1Q H;  1WFQ A;  3CAM A;  3PUZ A;  2R7Z G;  4JI5 Q;  2I5H A;  1Q8K A;  3HKZ E;  1PVO A;  1HH2 P;  1U0L A;  1VQA A;  1B70 B;  1D8L A;  3I4O A;  3E9H A;  3HFZ B;  4JBJ A;  2VQF L;  2PQA B;  4DUZ Q;  4A3M H;  2NVY H;  1Q7Y C;  1MJE A;  1VQ8 A;  2E5L L;  1UE6 A;  3U50 C;  2YYZ A;  3DM3 A;  4PZ6 A;  2RCN A;  3A5U A;  1IL2 A;  4JI0 L;  1N34 Q;  1IYJ B;  1SMX A;  4WJ4 A;  1K83 H;  3EN2 A;  1EYG A;  1KHI A;  4LUO A;  4AQY L;  1PH3 A;  4LF5 L;  2R7Z H;  1BKB A;  1B7Y B;  2ATW A;  3S16 H;  4DR6 L;  1IXR A;  2UXD L;  3I4M G;  3CMA A;  4MTN A;  3AFP A;  4LFB L;  1Q12 A;  3L2P A;  4P74 A;  4GS3 A;  1OXX K;  2K5V A;  4BA1 I;  3T1H L;  4B3M L;  1VQM A;  1NJI C;  5M5Y H;  5FLX c;  4NXN Q;  1BBU A;  1SN8 A;  2KHJ A;  4DV2 L;  4JI8 Q;  3GTQ H;  4BA2 I;  1YNX A;  2CFM A;  3K7U C;  3G71 A;  3RN2 A;  4OXP A;  1JB7 A;  5C3E G;  4LF9 L;  1XPU A;  3H3V H;  4JV5 Q;  2AKW B;  1LYL A;  1PH4 A;  4B3S Q;  3KYH C;  4YCV A;  2UXC L;  1IBK L;  3I4M H;  4IPC A;  3UE1 A;  3PUX A;  5GAE C;  4DV6 Q;  5EAY A;  4X64 Q;  3KJP A;  4A3J G;  1I50 H;  1SLJ A;  2MO1 A;  4P72 A;  4LUV A;  2A1A A;  1YJW A;  1VQG A;  2NVX H;  1NBW A;  2LXK A;  3STB D;  3Q8D A;  1VS0 A;  3D0F A;  5GAG C;  5C3E H;  2UXB L;  1PYS B;  2XGT A;  3JAM c;  1I94 L;  2AWN A;  4XIG S;  3KFU A;  4B3R L;  2QEX A;  3TQY A;  2YTV A;  3UDI A;  1K9M C;  4A3J H;  4UP7 A;  1EUJ A;  1YIT A;  1GD7 A;  3H3V I;  1JE5 A;  3M4Q A;  2Y0S E;  4A4I A;  2BH8 A;  4DV0 L;  1QVC A;  1VQJ A;  5IP7 G;  4LWC A;  1ASY A;  4J15 A;  2R93 G;  4DUY L;  3A0J A;  2PMZ E;  3VDY A;  1M1K C;  3S1R H;  1WCM G;  4H02 A;  4NB3 A;  4AH6 A;  1QVG A;  1N8R C;  2WAQ E;  3W1B A;  3RLO A;  5IY0 A;  2UUB Q;  3F1Z A;  2HHH L;  3G6E A;  2D62 A;  1VQ4 A;  1PH7 A;  3CPF A;  4JBK A;  3CCL A;  4DR3 Q;  3RNU A;  2Q2U A;  5IP7 H;  5LMU L;  4A75 A;  3M7N A;  2R93 H;  1EWI A;  2DGY A;  2RHQ B;  2QA4 A;  2UUC L;  1JJ2 A;  3RZO H;  4IPG A;  1L0W A;  4A93 G;  1WCM H;  4DV7 L;  3L7Z C;  4C3I H;  1YBY A;  3K0X A;  1N9W A;  2FXQ A;  2B29 A;  3B6Y A;  4FDB A;  5GAD C;  4JI3 L;  3PF5 A;  1C0A A;  2VS1 A;  4UP9 A;  3G4S A;  5ELN A;  1VQO A;  4DR7 Q;  2KHI A;  1E1T A;  4NXM L;  5JEA G;  4YHH L;  1XPR A;  3E0E A;  2K5N A;  3L0O A;  2K50 A;  3M4P A;  4DR4 Q;  2N78 A;  4JI2 Q;  3H15 A;  4RG1 A;  3U4Z A;  1PH9 A;  3CC4 A;  4A3B G;  1WOC A;  4LF7 Q;  4LFA L;  2V1C C;  2WP8 J;  4R4Q A;  1PFS A;  5C4J H;  3F2B A;  3CC7 A;  1Y1W G;  4QQB X;  1EIF A;  3S1M H;  2UUA L;  3JAM i;  3SGI A;  3E9I A;  1XMO Q;  2VQE L;  3CCE A;  1IBM Q;  2VNU D;  3HOW G;  4HIM A;  3GDE A;  4KLK A;  5AJ3 Q;  4BY1 G;  3J81 c;  3CCQ A;  2ZTD A;  5IWA L;  1KD1 C;  4A3I G;  4B3T L;  3BZC A;  2EQS A;  1HR0 W;  4JI6 L;  4JBM A;  4OX9 Q;  1FL0 A;  3ZJY C;  1S40 A;  4L5Q A;  3M3Y H;  1N33 Q;  4LF6 L;  1Y1W H;  2DUD A;  3CCV A;  4HID A;  3HKS A;  4JI5 L;  2B63 G;  1N36 Q;  1N32 Q;  1YVC A;  3BU2 A;  1GO3 E;  3JC6 6;  3NEN A;  3PUW A;  3HOW H;  1MIU A;  4LW1 A;  2ASB A;  3KF8 B;  5C0X G;  4A3E G;  4DNI A;  3S15 H;  3MXN B;  1Q1B A;  4BY1 H;  4A3L H;  1CKM A;  4HIO A;  4JYA L;  3NEM A;  4A3I H;  3ICE A;  4NPS A;  3F2C A;  5C4X G;  1N34 L;  2KBN A;  4A3G G;  4PZ7 A;  1T9H A;  1VQ7 A;  4OO1 G;  3D31 A;  3PIO A;  2Z0S A;  1ASZ A;  1NY4 A;  1PH6 A;  2B63 H;  5IT9 c;  2JA8 G;  4YCU A;  4DAY B;  3AEV A;  2IHF A;  2AHO B;  3A5Z B;  3PCO B;  2EIF A;  4A3E H;  4LFC L;  4IFD I;  1PA6 A;  1CKO A;  1W3S A;  4C2M H;  1YHQ A;  1X3F A;  4IOA A;  2N8N A;  1WI5 A;  3K7A H;  4NXN L;  4JI7 Q;  1AH9 A;  4JI8 L;  2R92 G;  4GOP A;  5C4X H;  1FGU A;  4A3G H;  2K5H A;  1TWH H;  2C35 B;  2I5L X;  1BVS A;  2IT1 A;  4JV5 L;  2OWO A;  2VY3 A;  4IPD A;  4GN5 A;  5GRO A;  5JEA J;  4DV3 Q;  1PV4 A;  5H1S E;  4B3S L;  2JA8 H;  4JOI A;  4DR2 Q;  1XNR L;  4GKJ Q;  1HNX Q;  1X6O A;  4ME3 A;  3PSI A;  4DV6 L;  4X64 L;  2E2I H;  4X66 Q;  1VQF A;  2L15 A;  2NN6 G;  1PH1 A;  3KJO A;  3A74 A;  2JA9 A;  5M5W H;  1YJN A;  3UE0 A;  3J81 i;  4QJF A;  2R92 H;  4IFD J;  4HJ8 A;  1L2F A;  1LTL A;  1YI2 A;  5JJI A;  1KC8 C;  4OWT B;  1L1O B;  2AMC B;  3G48 A;  4OON A;  4DV5 Q;  2HIX A;  4MZ9 A;  4A3K G;  4JC0 A;  4GOP B;  4JG2 A;  4DAM A;  2OTL A;  4A3C G;  1NMG A;  1V9P A;  2E8G A;  3K8A A;  2ZJR A;  2R7F A;  1TWF H;  1VQH A;  2ZJP A;  4GNX B;  3RZD H;  4LF8 Q;  2D0O A;  1A62 A;  3PUY A;  1FJG Q;  1O7I A;  5IP9 G;  4APV A;  5DLQ E;  1P16 A;  4Y7N H;  1XNQ L;  3KDF B;  1D7Q A;  2UUB L;  4HIK A;  1B8A A;  2VQF Q;  1EQR A;  1YHB A;  5C0X J;  4A3K H;  1KQS A;  3J80 c;  3OTO Q;  1VQL A;  4P73 A;  1VQ6 A;  2E2J H;  1GKH A;  1UWV A;  4P71 A;  1E22 A;  3PIP A;  3OW2 A;  5FJ8 G;  4JCV E;  3RLN A;  4GN3 B;  5IP9 H;  4GN4 B;  2CQO A;  4DK6 C;  2K4K A;  1VQB A;  1XTD A;  1UE5 A;  4GLV B;  4DR5 L;  3TS2 A;  4BXX G;  1X54 A;  3GO5 A;  4KI0 A;  1AE2 A;  2Q2I A;  2LSS A;  4EQ5 A;  3PGZ A;  1VQE A;  4DV4 Q;  4DR7 L;  2JA7 G;  4DR1 Q;  4MNO A;  3GTK H;  4A3B H;  2IY5 B;  5JJL A;  5GQO A;  1A0I A;  1VCI A;  4YWK A;  4DV2 Q;  2ZTE A;  4DR4 L;  4JI2 L;  1DGS A;  4LF4 Q;  2R7D A;  5FJ8 H;  1YJ9 A;  3M9B A;  4QGU A;  1HR0 Q;  4GOP C;  4LF7 L;  3KLW A;  1YZ6 A;  4LNQ A;  1X3G A;  2BH2 A;  1J6Q A;  4BXX H;  1I5F A;  1LM0 A;  3ULJ A;  4X62 Q;  3DLL A;  1XJV A;  1EOV A;  2B3G A;  2IHE A;  2K75 A;  3CCM A;  4JOI C;  2H5X A;  1XMO L;  1IBM L;  4UY8 C;  2JA7 H;  1KXL A;  4OWX B;  4DKA C;  2IX1 A;  2UU9 Q;  1KRT A;  4R4T A;  5C44 G;  1NMF A;  2JE6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...