4BXXH

Arrested rna polymerase ii-bye1 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxH00
1L2FA 1NMGA 2ZTEA 4BBSG 4GKJQ 4KI0A 3ULJA 3A74A 3GTKH 1R9TH 1V1QA 1G6PA 2JA9A 5IYCG 5IY0A 3PSIA 1NY4A 3TQYA 4BA1I 2JEAI 5JJIA 3GTGH 4X6AH 1EYGA 1EWIA 1BBUA 4KHZA 4X65L 5IE8A 2VQFL 1JMCA 4KLKA 3TRZA 1PH2A 2Z0SA 1NJIC 2R6GA 2VY3A 1GM5A 3T1YL 1L1OC 1QZHA 1EUJA 1YHBA 4DV3Q 2UUCQ 4R4CA 4X62L 2Q2UA 2PQAA 1TWGH 5GADC 1W3SA 1JJCB 3SGIA 3CF5A 3LGJA 4R4IA 4DR2Q 1K8AC 4DUZQ 3CW2C 4YHHL 3KYHC 3PUYA 3HKSA 4DR3Q 3J81j 2OQ0A 2ZTDA 1P16A 2C35B 4GKKQ 3I55A 3GTQH 2YYZA 4IOAA 4GKJL 1GKHA 3HOZG 2F4VL 2EIFA 2R7ZG 1HNXQ 3D0FA 1PH8A 1G51A 1V9PA 1TXYA 3ULLA 3RN2A 1WJJA 1YITA 4JYAL 1CSPA 2AWOA 3ICEA 4GNXC 3S1MH 1E1OA 3AYHB 1PA6A 1IYJB 4OXPA 2B29A 2VZAA 1M90C 4B3SQ 2XGTA 4B3TQ 2LSSA 4A3LG 4AYBG 1VQFA 1YZ6A 4J15A 4DV3L 1XPRA 1JB7A 2KCTA 2MQHA 1KRTA 1C0AA 4IFDG 1KHIA 3EBEA 2K52A 5LMNQ 3OTOQ 4DUZL 2Q2HA 2WAQE 5JEAJ 5C44G 1L0WA 1D8LA 2E5LQ 4A3KH 2WB1G 4KHPQ 3FP9A 2YU9H 4GKKL 2JA7G 4C3JH 1VQ8A 3RN5A 4DR4L 4BBRH 1X6OA 4A3IH 1K83H 1Q82C 3PIPA 2MFIA 2CCZA 2R93H 1HNXL 1T9HA 2JA6G 1HZBA 5GROA 1B7YB 4QY7A 1J5EQ 2CWAA 1QUQB 4O0AA 2WFWA 1YVCA 1FVIA 4RG1A 2YTXA 2E2IH 1N8RC 4A3GH 2NVYH 3UDXA 4IJLA 4DR5Q 1VQKA 4PZ6A 1OXVA 2GVBA 3CPFA 3J80i 3JAMc 4OONA 1NE3A 1VQCA 4DR1Q 1KRSA 2OCEA 4DV5Q 1WCMG 4PZ8A 2MNAA 1X56A 4DAMA 3TS0A 1U0LA 2K14A 3FHWA 4IJHA 2UXDQ 3HKZG 3OTOL 5LMNL 3RZOH 3STBC 4JI0L 1OXTA 3AEVA 1FJGQ 3PO2G 4LFBQ 4A3MG 3W1GA 4PG3A 2BA1A 3GTMH 4P73A 1E22A 3CQZH 2A8VA 1IXRA 5FLMG 4A3FH 3J81c 3NELA 4HIKA 1C7YA 1PHJA 1WFQA 1I94Q 4JI5Q 3M3YH 1VQBA 5E7NA 4DV2Q 4DR5L 3S2DH 4APVA 4DV7Q 3J7ZC 1IBLL 3HOVG 2UUBQ 4BXXG 2HIVA 4BBSH 4DV0Q 3BZKA 2E2JH 2PNHA 2RHQB 2ZJPA 4POGA 2UXDL 1X3GA 2VQEL 1SN8A 3KFUA 2VS1A 5IYCH 2E2HH 2K4KA 1L1OA 2OQKA 1YHAA 2F52A 3PUVA 3PIOA 4C2MH 2JE6I 2EXDA 2I5HA 2R7DA 1J6QA 3GO5A 3PGZA 1FJGL 2A1AA 2RCNA 4MTNA 4HJ9A 4TVAB 2ES2A 3CC2A 5M5YH 4GOPB 4XTCS 4HJ5A 4IFDI 5M5WH 5C3EG 2I5MX 3RLNA 4A3BG 4DPGA 3GTJH 3STBD 5IWAL 1I6HH 4JI5L 1VQPA 4JI1Q 4QIWE 4IPHA 1Q7YC 1XNRL 2VQFQ 4HJAA 4JI2L 1VS0A 3RLFA 3S14H 3G6EA 2R7FA 1AE2A 4GNXA 1GO3E 1EFWA 3HOZH 2R7ZH 5FLXc 5EAYA 2N78A 4DKAC 2YV5A 2VL6A 1QVGA 3S1RH 3HOWG 4BY1G 4AQYQ 1Y1WG 4YHHQ 5GAHC 1MJCA 1CUKA 4MZ9A 2NVQH 3ZJYC 1HR0W 4BA2I 4A3LH 5JEAG 3K80C 4JI8Q 4DUYL 2AHOB 2F4VQ 3PUZA 2ZTCA 3CC4A 3G48A 4A75A 4JI4L 3PO3G 4JI1L 1TWAH 1VQ4A 4JYAQ 4DV6Q 1Q86C 5C44H 1PH1A 1HNZQ 1MIUA 3L7ZC 3MEFA 2AWNA 2GVAA 5K36G 2OTLA 4EX5A 2JA7H 2K5NA 4QL5A 3KF6B 1E3PA 2QEXA 1XPOA 3CC7A 2JA6H 2Q2TA 3M7NA 1OTCA 2FXQA 1XNQQ 2HT1A 1I3QH 3KF8B 1K9MC 4AQYL 3B6YA 1PH5A 4LFAQ 4WJ4A 1E24A 2HHHL 4A93G 1X55A 1XTDA 3H15A 1PVOA 4AYBE 4DR4Q 4OO1G 3HOXG 3RLOA 4B3ML 2KHJA 4JI8L 3OW2A 1WCMH 3KDFA 1N34Q 4YCUA 3U4ZA 4ME3A 1YI2A 2VUMG 3KJPA 3RNUA 5C0XJ 4DK3C 4DV6L 4QQBX 1VQMA 2ZM6Q 1HNZL 2WB1E 3PO2H 2QA4A 1LM0A 4JCVE 4A3MH 4UY8C 1IL2A 2UU9L 3E0EA 4C3IH 4X64L 1K0RA 1I50H 3A5ZB 3AQQA 1IZ6A 1C9OA 1XNQL 5FLMH 1PFSA 5M3MH 4WJ3M 4X66L 2D62A 2KHIA 3J81i 3U58A 4R4QA 3S2HH 4LFAL 2D0OA 4JI0Q 3CCRA 1CKNA 1ASZA 3HOVH 1PH3A 4BXXH 4UPAA 2OTJA 4IO9A 2ID0A 2UUAL 2PQAB 3M4OH 1WYDA 1N34L 3W1BA 1X9NA 3H0GG 1VQIA 1PH7A 3HKZE 3CCVA 1YHQA 1O7IA 1UWVA 3GTOH 1Y1VG 2ZM6L 1VQLA 4A3EG 1B8AA 2IX0A 2LXJA 4DK6C 4GLXA 2AKWB 2HIXA 5AJ3L 3K81C 3I4MG 1IBML 3HOYG 1KQSA 4DNIA 2MO0A 3CCMA 1IBLQ 2BA0A 4LW1A 3EIVA 4HIDA 5H1SE 2CQOA 2PI2A 3GD7A 4OWTB 2CKZB 2N8NA 4YCVA 5IYBG 5C3EH 4QGUA 2VQEQ 4A3BH 1G291 4HIMA 1TWHH 3A0JA 2V1CC 3NENA 4L5QA 4L5TA 1HR0Q 2K5VA 1VQ7A 4JOIC 3HOUG 1VQGA 4OWXB 2I5LX 3PV0A 4IPGA 1DGSA 1PYBA 2ATWA 1A0IA 1BKBA 3I4NG 1Z9FA 1OXSC 2NVTH 4QJFA 4R4OA 3CP0A 2K75A 4JBKA 3DLLA 1D7QA 2DUDA 4NXNL 4GN3B 4A3CG 1GVPA 1SFOH 5IWAQ 2YTVA 4K0KQ 4BY1H 1Y1WH 1N33Q 4OO1I 4A4IA 1XNRQ 5M3FG 3M4PA 1M1KC 4JI2Q 5IP9G 4BY7G 1V43A 1ASYA 2UXBQ 3U4VA 1P8LA 4LF5L 2ASBA 1Q1BA 4JC0A 4L5RC 1N9WA 2ZJRA 4YY3L 4LF7Q 1VCIA 3EN2A 3ERSX 4UP8A 1HR0L 3PO3H 2Y0SG 2B3GA 2WP8J 4LUVA 3VDYA 1HZCA 4YWMA 2E8GA 1I5FA 1KD1C 1XMOL 3CD6A 4A3DG 3MXNB 1WI5A 2B63G 3PUXA 5C4XG 4A3JG 4JV5L 3TS2A 1HNWQ 4DUYQ 3F8TA 1EQQA 4JI4Q 1WOCA 1Q46A 4GN4B 3PF5A 4K0KL 3CCUA 1N33L 3WWVA 5GQOA 3S17H 2IHEA 2K50A 4JI6L 4A93H 4JBWA 2UXBL 4AIMA 5C0XG 3M85A 1VQHA 1SR3A 3E9HA 3HOXH 4LF8Q 5IP7G 1K73C 1HZAA 3M4QA 5GAGC 4LF7L 1X65A 1VQEA 2VUMH 3U50C 2DGYA 2ZJQA 4RMFA 4Y7NH 2K5HA 3F2BA 2AMCB 5J3BA 2HHHQ 3CCSA 1UE1A 2EQSA 5JJLA 4P74A 5IYDG 2HQLA 4B3MQ 3UE1A 1YJNA 1HNWL 4JG2A 4POFA 3L2PA 2NZOA 1L1OB 1IBKL 1EOVA 4GOPC 2UXCQ 4XIGS 1PV4A 1KIXA 5BR8Q 4HJ8A 3NBHB 3F2DA 2MO1A 2OWOA 2IT1A 2IHFA 1AH9A 4LF8L 2UU9Q 4X64Q 1UE7A 3PF4A 1E1TA 1PH9A 4DAYB 4R1JA 3H0GH 4YWLA 1N32L 4JI7Q 3D31A 3FKIG 1U5KA 4X66Q 3UDIA 1SE8A 5ELOA 4L5SA 1Y1VH 3RR5A 4A3EH 1KC8C 2BH8A 1PH4A 4MNOA 4LUOA 3I4MH 1W2BA 3GDEA 3JAMi 4GNXB 3HOYH 1A8VA 1QZGA 4JOIA 1HJPA 4YWKA 2UUAQ 2IY5B 3NEMA 3K7AH 5IYBH 2UXCL 3PUWA 3UE0A 3KOJA 3W5OA 3CAMA 5BR8L 1VQ5A 3HOUH 2IX1A 2NN6G 3CPWA 3RZDH 3ER0A 4NPSA 1VQNA 4YCWA 4DR6Q 3I4NH 5AJ3Q 1OXUA 1Z47A 1IBMQ 3AFPA 3J7A5 3GTPH 3F1ZA 3E9IA 1JJGA 2RHSB 4DV1Q 1QUQA 3K7UC 2NZHA 4JI7L 5LMUL 1OXXK 3I2ZA 1BVSA 5FJ8G 4A3CH 1CKOA 2JA5G 1BBWA 3A5UA 4DV4Q 5C0XI 4P71A 1K3RA 2R92G 5M3FH 1NBWA 2JA8G 2L15A 5IP9H 4HIOA 4BY7H 3S1QH 1X54A 2N49A 1SRUA 4GN5A 3L0OA 5HGQA 2Z6KC 1KL9A 3CMAA 5JJKA 4FDBA 4LUZA 4NXNQ 2VW9A 1TWFH 4DR6L 1VQOA 1SLJA 2UUCL 4LF6Q 2Q2IA 1VQJA 3I4OA 1YEZA 1JT8A 2JK8A 3BJUA 4LF4Q 1JJ2A 4A3DH 3KDFB 4DV1L 4DR2L 1CKMA 4LF5Q 2B63H 5C4XH 4A3JH 1TWCH 4ALPA 1NTGA 1XMQQ 2I0QA 4UP7A 3CCEA 2KCMA 2RF4A 4DR3L 4YY3Q 1MJEA 1YIJA 1UE5A 1A63A 2VNUD 4DV4L 4AH6A 1XJVA 4IPDA 5M5XH 4LFCQ 1K8GA 2BH2A 1XMOQ 1VQ6A 2LXKA 5IP7H 4PZ7A 4JV5Q 2WAQG 2Y0SE 3CCLA 4B3SL 1YBYA 3G71A 1N36Q 4B3TL 1SROA 1CSQA 5HY6A 1CKNB 2QGQA 3HOWH 3S16H 4C3HH 4LF6L 4JBJA 3AFQA 4B3RQ 2H5XA 4EQ5A 3HFZB 2JQOA 1EIYB 4JI6Q 4GOPA 4LF4L 1S72A 1FL0A 3PCOB 3S15H 5IYDH 4P72A 1PYSB 1XMQL 3S1NH 3T1HQ 4JI3Q 1YNXA 2E5LL 1RIPA 4OWWB 4KHPL 2NN6I 2PMZE 2PI2E 1B70B 1A62A 3K0XA 3DM3A 3K8AA 2KBNA 3KLWA 5GAEC 1KXLA 4LFCL 2JJQA 1UEBA 5DLQE 4Y52H 1J5EL 2KENA 1Q8KA 2CWPA 5M3MG 1YJWA 4OX9Q 2ALYB 4LF9Q 3CCQA 4UP9A 1GD7A 1Y14B 4DR7Q 1X3EA 4A3KG 2A19A 3H3VI 3FKIH 2GN5A 1N36L 4NXMQ 1IBKQ 1VQAA 1AE3A 4DR1L 4IFDJ 4BBRG 4A76A 4A3IG 1VQDA 4DV5L 5IT9c 1LUZA 3I56A 4B3RL 1X3FA 3CXCA 2R93G 4TQUS 1EIFA 1LYLA 4P75A 3S24A 4LNQA 1KAWA 1NMFA 3JC66 4NB3A 4JI3L 3T1HL 1FGUA 2XTIA 4A3GG 4LFBL 4LWCA 4GLAC 3J80c 1N32Q 3ULPA 5ELNA 3I7FA 3F2CA 4IOCA 3BZCA 1S3OA 4GLVB 5LMNW 2CFMA 4PMWA 1HH2P 1VQ9A 4OX9L 3KF6A 4LF9L 1MKHA 3TEHB 1UE6A 1I94L 1Q1EA 4DV2L 1S40A 2JEBI 4DR7L 4H02A 2D0PA 3TREA 3CCJA 1LTLA 4DV7L 4R4TA 4X65Q 2F3IA 4O2DA 3UDGA 1PH6A 5FJ8H 2UUBL 4NXML 4GS3A 2YTYA 3G4SA 1SMXA 2JA5H 1RL2A 4DV0L 3H3VH 3T1YQ 1YJ9A 4IPCA 3KJOA 2R92H 1Q81C 4A3FG 2Z6KA 2JA8H 4X62Q 3CMEA 3UDFA 1XPUA 4HJ7A 3Q8DA 2NVXH 2N3SA 1QVCA 3BU2A 3IRBA 3GTLH 4JBMA 1HZ9A 1Q12A 1QVFA 1JE5A 1E7ZA 1EQRA 5LMUQ 1H95A 3OYYA 5C4JH 3M9BA
chains in the Genus database with same CATH superfamily
1L2FA 1TY2A 4BBSG 1YNND 4C1NK 4KI0A 3ULJA 1ZKOA 3G6JB 5IY0A 5IYCG 3EQLC 4M1UB 2HDLA 3A8JE 4X65L 4KLKA 1ILPA 1A2UA 2EVBA 1QZHA 1EUJA 1YHBA 1ESRA 2UUCQ 1HFNA 1ML0D 1SYEA 2BE5D 1JJCB 2EYMA 4R4IA 4DR2Q 1UNSA 1G2SA 3HKSA 1PYWD 2OQ0A 1FR3A 2NVXB 3GTQH 4GKJL 2RQXA 2EIFA 2RBMA 3HP3A 3MZ5A 3NBIA 4HAEA 1G51A 3ULLA 3RN2A 2KJXA 1F9QA 1R9TB 2DJFC 1E1OA 1IYJB 1HA5A 3OPOA 3EVQA 1WTXA 4B3TQ 4A3LG 1YZ6A 1JQYD 2AQ3B 1XPRA 1BO0A 2XVSA 1KRTA 5LMNQ 4DUZL 1GXDC 1TWGB 3MA2B 3NQTA 1L0WA 2JA7G 1VQ8A 4A3IH 1Q82C 1AZPA 2MFIA 2WAQB 2CCZA 1HNXL 2JA6G 1HZBA 1QILA 1B7YB 4QY7A 2WKCA 2CWAA 1QUQB 4O0AA 2WFWA 1LTRD 2H1EA 2E2IH 2D5DA 4A3GH 2NVYH 4CJ0B 3J80i 4C1NI 1VQCA 4DR1Q 3S1MB 1D6EC 2MNAA 1UEAB 5I4DA 3QWNA 3VR4A 2UXDQ 1F2ZA 5FO8B 1C4QA 1RTOA 1B2TA 4A3MG 3GTMH 4C3IG 1FGBD 3CQZH 2A8VA 5JPMC 2YU9B 3FRPB 3J81c 1IL8A 4DGZA 1IYUA 2R93B 4JI5Q 5E7NA 1JR0D 1TKWB 4LMQD 1V8QA 1AN8A 1QCBD 4TSSA 4DV0Q 3BZKA 3MFGA 3P75A 2RHQB 1NUCA 1SN8A 3KFUA 1W6KA 3TDQA 1L1OA 2NTSA 2I5HA 3RZOB 2RCNA 4TVAB 4IURA 3BVZA 5M5YH 5M5WH 1CM9A 5J1ZA 1A3UA 4DAYA 2QEJC 3NE5B 2Z8LA 3SE0A 1GO3E 4B9XA 3HEJA 2R7ZH 4NMZA 3SR1A 1LABA 4BBSB 4RAUC 2E2JB 2VL6A 3DWQA 2F0HA 1STHA 4YHHQ 1MJCA 1CUKA 2E2HB 4C2MB 4MZ9A 4RH6A 2NVQH 2FMMA 3ZJYC 1G6ZA 5JEAG 5KNDA 4DUYL 3EJIA 2XN9C 2VB2X 1Q86C 2K28A 3GTJB 2HCCA 3L7ZC 2AWNA 2B2TA 3S17B 2QEXA 1QNUA 3CC7A 2Q2TA 3S14B 1OTCA 2FXQA 5DNFA 2L4NA 4RHSA 3B6YA 1K8OA 1IHZA 1PVOA 3HOXG 2DNCA 2NUCA 1G91A 5COYA 4ME3A 2F0DA 4N8X1 2E74C 4DV6L 2PO4A 2ZM6Q 4UDUC 4JCVE 3DWPA 4UY8C 1QE6A 2G5DA 4X64L 1G2TA 4RWSC 2VXWA 3LWUA 2JA7B 4WJ3M 1E2VA 1TVXA 2ICIA 4X3SA 2DNEA 3S2HH 2JA6B 2D0OA 2A6HC 3H3VC 3CCRA 1CKNA 1ASZA 1EY5A 3HOVH 4ZUJA 1PH3A 4BXXH 1Y8NB 2CH4A 4OELB 3M4OH 5IOCA 1WYDA 4MIUA 4KHVA 3CCVA 1ENFA 1UWVA 1Y1VG 4K8IA 4DK6C 2B2VA 3C2PA 3HS0C 3T13A 2QILA 4NW2A 3I4MG 1LT6D 3CCMA 4JVZA 2BA0A 4LW1A 4DN4M 4HIDA 2JP1A 2PI2A 4A3MB 3GD7A 3ND8A 5C3EH 4K6LA 4C3IB 2F0WA 1VQ7A 1PLFA 1HR0Q 2K5VA 2ATWA 1PYBA 1O7ZA 3W2DA 1XTCD 2J4XA 3P1HA 1MHWC 5IODA 2ICEC 2WINB 1PFBA 2DUDA 5CV8A 1GVPA 1SFOH 2A6HD 4NDXA 4ZRZA 4L6TB 5JVH3 1XX8A 2LY7A 1XNRQ 5JOBA 4BY7G 1V43A 1ASYA 2UXBQ 3U4VA 2R61A 1Q1BA 4RGMA 4EQNA 1N9WA 4C56C 4LF7Q 1EIHA 1VCIA 3ERSX 1DJRD 5CR3A 3PO3H 3SK5A 5HGTA 3MVVA 3VYRA 3H94A 4LUVA 1TWHB 4A3DG 3FDTA 1XMOL 1TS2A 1WI5A 2NYZD 3PIO3 5C4XG 4KKSA 5KIXA 4GN4B 1CTMA 1N33L 3WWVA 5GQOA 4A93H 1SNOA 4JBWA 4CDCC 4IUVA 4K5VA 1SR3A 3E9HA 4OO1H 2EOTA 2QCPX 4OGQC 5IP7G 5GAGC 1TU2B 4Y7NH 2KA7A 3F2BA 2KEEA 3EROA 4C3HG 1DOKA 3HZXA 5EQ0A 5G3LF 4P74A 2EY1A 4JG2A 3X3NA 2NZOA 1S5BD 1L1OB 4LAAA 2K1BA 1IBKL 2UXCQ 5F2DA 5IGBA 1PZJD 5NUCA 2MO1A 3SVMA 2AQ2B 4LF8L 2UU9Q 5E4XA 3PF4A 3D4RA 3MXGA 4DAYB 4R1JA 4OEMB 3F2UA 4DAPA 4L5SA 3RR5A 5C5MA 2BH8A 1PH4A 1CHQD 3HOYH 2Z4HA 4JOIA 2BCOA 2IY5B 2A74C 2EXZA 1EZ8A 2WV6D 5BR8L 1VQ5A 1KNAA 1WVLA 3HOUH 4H0LC 2NN6G 2K05A 3RZDH 4DR6Q 3I4NH 1OXUA 3BDLA 1PTOH 3E9IA 4YIJA 1EFID 1GUWA 4JI7L 5IGEA 5FJ8G 4A3CH 1CKOA 4BS9A 3NPPA 5C0XI 3SDZA 4P71A 1K3RA 1Q3LA 5DAUA 1Y1VB 1NBWA 2JA8G 1GOZA 5IP9H 2A6EC 2EJFC 1FNVA 3I4MB 1EY7A 5A2QE 1EZ6A 5KGUA 2M9VA 5HGQA 1KL9A 3CKIB 4LUZA 1STAA 2F03A 1F9RA 4LF6Q 4IQZA 3I4OA 4DFAA 4DV1L 1I4GA 1PFNA 2RKSA 2XSCA 4LF5Q 2B63H 4IUPA 4A3JH 1NTGA 4UP7A 4ZKCB 2KCMA 2RF4A 2WACA 1MJEA 1KDBA 1SYDA 1A63A 1WTQA 4DV4L 5M5XH 1SJED 1SXTA 4G7HC 4LFCQ 1K8GA 2SDFA 1GHKA 4DU9A 4FYDA 1QOHA 1D5MC 4BY7B 5D65A 4GZYC 1E0BA 1DXMA 1CKNB 2QGQA 1SDFA 4KN7C 4B3RQ 3KLRA 2H5XA 1EIYB 2SEBD 2A6ED 1MI2A 1S72A 3J81L 1CQFA 1JWSD 2E5LL 1JWMD 2RA4A 2M00A 3Q0AA 4IALA 3NQIA 4K2LA 3OWEB 4Y52H 2Z6BA 2CWPA 4OX9Q 2ALYB 4U673 4UP9A 1GD7A 3SHLA 3QG1A 4QCLA 2O2LD 2A19A 2CVRA 2KQ3A 2IPKD 1VQAA 2F0KA 1VQDA 5IT9c 3I56A 1S5FD 4XQJA 5EKLA 1LTAD 1AEXA 2F0VA 3MTSA 5FOBB 1TT2A 3ULPA 2F0EA 1I4PA 1S3OA 3D4DA 4GLVB 3K59A 5LMNW 4ZYSA 3VYUA 4CGYB 1UE6A 3CQZB 4RFBA 3S9WA 4PMCA 1S5CD 1HFGA 1SE2A 2KCCA 4X65Q 4UHVA 2YTYA 3G4SA 4RGNA 1II3A 3V96A 3KJOA 2R92H 1Q81C 4A3FG 3A56A 3K57A 4HJ7A 4FXDA 2NZ1D 1BQQT 1NSNS 5LMUQ 1H95A 5C4JH 1STNA 1NMGA 4GKJQ 4CBVA 1FD7D 2EYHA 3I90A 3PSIA 1KDCA 3GTGH 4KHZA 2VQFL 1CI3M 1KDAA 2Z0SA 1D5ZC 4ILWA 2B2UA 2A73B 3Q23A 3T1YL 1GUSA 1L1OC 1DD2A 3KUPA 4JW0A 4DUZQ 2NB0A 3CW2C 4O42A 2JA8B 4XT1B 4FVMA 5KYLA 1D1KA 1P16A 3SXHA 1HNXQ 3K58A 1WJJA 4RKBA 4JYAL 3GTKB 1CSPA 3T4AC 1SSOA 3AYHB 1M90C 2XGTA 4H13C 4DV3L 2MQHA 4DK1A 5JAVA 1C0AA 3OHXC 1DYQA 1KHIA 2EY6A 2WIIB 5EBCA 3C1EA 5JEAJ 4A3KH 2WB1G 4KHPQ 2L12A 4DR4L 3RN5A 4I7ZC 2N55A 4BBRH 1SNMA 1K83H 5GROA 3D4WA 4HCEA 1HQRD 1N8RC 2P5ZX 3UDXA 2SOBA 2HCIA 1OXVA 1BCPB 3JAMc 4K14A 4OONA 4ZCKA 2HUGA 1WCMG 4PZ8A 1X56A 2N88A 3FHWA 2K14A 3MXNA 2IX3A 2K33A 1JWUD 1OXTA 4LFBQ 1NCVA 1SNDA 2Q8IB 1MSGA 1STBA 1TY0A 4PG3A 3O13A 1U4PA 1IXRA 1BNZA 4R8IA 1I4XA 1PRTB 1A3TA 1BBXC 3C3LA 1I94Q 4DV2Q 2WKDA 3OIPA 3R8BA 4DV7Q 1LTSD 1IBLL 1SYGA 2UUBQ 4J6HA 3OOCA 2F4IA 2PNHA 2EJMA 1CFMA 2CH4W 3KBXA 2ZJPA 2VS1A 3W3AA 3PIOA 2OQKA 5KRUA 3PGZA 2A1AA 2Z9HA 3NBHA 1Q90A 4MTNA 2KEDA 4HJ9A 2ES2A 3CC2A 4CKEA 2B2VC 4XTCS 1JC7A 4A3BG 2PZTA 3D3RA 3T56B 4A3FB 1DONA 4HJAA 1B50A 4JI2L 1SFOB 1VS0A 1SYCA 3RLFA 3K5NA 3M3YB 2R7FA 3S2DB 1AE2A 4QIWB 2FFKB 1EFWA 4HMIA 2MUYA 3VA5A 1Z7TA 3HOZH 5FLXc 5EAYA 2N78A 4DKAC 3E5SA 1QVGA 1Y1WG 3BYTB 2O4XA 4EGVA 3ZYYX 1SYBA 5FLXE 1EY9A 2F0NA 1HR0W 2CW0C 2F4VQ 3PUZA 3QJYA 4IFDH 4A75A 4JI4L 4JI1L 1TWAH 1VQ4A 1EU4A 4DV6Q 2RSNA 5C44H 1PH1A 2MGSA 1I6HB 3MEFA 5K36G 2OTLA 4EX5A 2K5NA 2Z1CA 4QL5A 5FK9C 3M7NA 4TKOB 5M9OA 2A68C 1I3QH 1LACA 4KY5A 5KNBA 3NHHA 1I6VC 5JVG3 1X55A 1XTDA 3H15A 1K28A 5HURA 4AYBE 3S1RB 1X3PA 4B3ML 4TRDA 3OW2A 2VUMG 1GJXA 3TSSA 5A2QL 2VB3X 4QQBX 5I9PA 1AP0A 4IUTA 3PO2H 2QA4A 3SK4A 5KNCA 1IL2A 1K0RA 1I50H 2CW0D 3A5ZB 3AQQA 2ZXOA 2WB1B 1C9OA 1XNQL 5FLMH 1PFSA 2D62A 2KHIA 3J81i 5BN5A 1PMRA 1T5XD 4LFAL 4XXEA 4JI0Q 2F1MA 4UPAA 2OTJA 1N34L 3W1BA 1VQIA 2A68D 3HKZE 1WCMB 4N8FA 1O7LA 3GV3A 2HIXA 2L5TA 5ELEA 1KQSA 3RZDB 4JK1C 1GUOA 5IYBG 2CKZB 4G4KA 4QGUA 2VQEQ 1G291 3QOJA 1PTOB 3NENA 4L5TA 2CHBD 4L5QA 4HIMA 4JOIC 1TIID 2PPBC 1Z9FA 3DWAA 2NVTH 3DEOA 4QJFA 4R4OA 2J7ZA 3DLLA 2IWHA 4ABNA 5IWAQ 2YTVA 4KKTA 4BY1H 1N33Q 4OO1I 3BZDB 3K6OA 3GTOB 3T51B 5M3FG 4F87A 3R2IA 1EYCA 1EEFD 2K03A 1EWCA 1BCPC 5I2XA 3EN2A 3DXJC 3QO2A 5C4HA 4A3BB 5IT9L 2F0QA 1KD1C 3TN2A 3MXNB 4JV5L 3E3XA 2BDNA 3TS2A 5FO7B 1Y8OB 1EQQA 1NR2A 1WOCA 3KLSA 3CCUA 3MEHA 1PRTC 1EY6A 2IHEA 1TQOA 3V2TA 5C0XG 3M85A 1GUTA 1Y1WB 4LF8Q 4K6DA 2XWJB 3M4QA 3R93A 1HPCA 4RMFA 2K5HA 1PZKD 4WORA 3OMGA 2HHHQ 1EL0A 3DUZA 4HR7B 5I6YA 5JJLA 5IYDG 1BCPD 1JE4A 1A15A 3UE1A 3P20A 3J80E 3L2PA 4OHJA 1EOVA 4XIGS 3RMHA 5BR8Q 3NBHB 2OWOA 1O80A 2L55A 1HRJA 3SEBA 1E1TA 1ICWA 4YWLA 3H0GH 1PFMA 1I4HA 1WTWA 4OIKA 4JI7Q 1U5KA 4X66Q 1SE8A 1JOKA 4A3EH 1PRTD 2I07B 2VUMB 3TBIB 1TS5A 2J0TD 2OT2A 4MNOA 1W2BA 4YWKA 2UUAQ 3E0JA 3K7AH 3Q6SA 3PUWA 4ZUIA 3DM1A 4YCWA 2RDHA 2ZXRA 5AJ3Q 1MBYA 1Z47A 1IBMQ 5IGCA 3J7A5 1JJGA 4L63B 2E2DC 1RD9D 4DV1Q 2KUMA 1OXXK 4LK1C 1BVSA 1V1OA 1X32A 2TSSA 2JA5G 3A5UA 4DV4Q 3N52A 3C1FA 4DNRB 3CHBD 1XYIA 3P7JA 5CV9A 3FVQA 3TMEA 3S1QH 2EY2A 3NTHA 2F3VA 3C46A 4KD4A 4NXNQ 2V4DA 2VW9A 1MGSA 3OMCA 4J1MA 4ZK9B 2UUCL 2Q2IA 1JT8A 3BJUA 1JJ2A 4CHTB 5DEHA 4DR2L 1CKMA 5KYIA 1EY4A 2I0QA 2RVLA 3GTPB 4YY3Q 4IUNA 3JAML 2OF1A 2F0GA 4G7ZC 2EDGA 4IPDA 1SAPA 5IIFA 4Z9CB 2BH2A 1VQ6A 2B2UC 2GA4B 1W6JA 2K01A 3IFDA 5M3FB 3BDCA 2Y0SE 3NWTA 3CCLA 4B3TL 1CSQA 1F2MA 1CK1A 3HOWH 3S16H 3AFQA 4JI6Q 4GOPA 1TWFB 3PCOB 1ET9A 1SEBD 3A7AB 2EYLA 1J8IA 1B70B 5GAEC 3G7LA 1TWCB 1KXLA 4I65A 1PTOC 1UEBA 1R4QB 2KENA 2PMZB 4BBRB 4FO2A 2K5DA 4ME5A 2MPMA 1S5DD 3H6MA 2QKIC 3FKIH 1N36L 4DR1L 4A76A 4H7BA 4A3IG 2PYKA 3TZUA 3M4YA 4PQXA 3JC66 4JI3L 3D6CA 4A3GG 3S15B 4GLAC 1N32Q 3BYYB 1RDPD 3S1NB 2K6AA 3VR6A 4IOCA 4PMWA 1HH2P 1VQ9A 5FLXL 4LF9L 4DR7L 2H4OA 5E1FA 3TREA 5TSSA 4R4TA 4CKCA 2OEOA 4DV0L 3H3VH 3T1YQ 2FJ2A 2AUJD 3MHBA 2Z6KA 2EYFA 3UDFA 1B53A 2NVXH 2N3SA 1QVCA 3IRBA 3GTLH 1HZ9A 1JE5A 1E7ZA 4HSVA 4KJOA 1LTID 1EU3A 3A74A 3UI2A 1V1QA 3OWFA 3MC0B 1R9TH 1WD1A 1SNCA 4PNYA 1NY4A 4UAIA 2JEAI 4Q5VA 4X6AH 3T53B 1EYGA 2BDOA 1JMCA 1PH2A 4ODGA 4HEDA 2R6GA 3U9SA 2KCNA 4QUFA 1A3VA 1UAPA 5EPLA 4DV3Q 4X62L 4G7OC 2Q2UA 2PQAA 1BR9A 4KN4C 1H9RA 1TWGH 5GADC 1B1ZA 2JA5B 1RODA 3LGJA 4YHHL 5T1IA 4ZLTF 4DF7A 4DR3Q 1EY0A 1HXYD 2ZTDA 5EPKA 1QWYA 2K5QA 4IOAA 5BN3A 2B39A 1SNQA 2R7ZG 3D0FA 1LV9A 2Q8RE 1C48A 3D6WA 1V9PA 1PH8A 2KECA 4CDFC 2JXMB 3KBGA 3S1MH 3VYTA 2NWGA 4B3SQ 1WTPA 2SNSA 4HN7A 1U4MA 1E2ZA 1JB7A 2KCTA 4XYQA 1U9RA 1STEA 2DN8A 3EBEA 4ZQ3A 1QG7A 2WAQE 3A54A 3BDOA 1BF4A 1D8LA 3NTIA 3V05A 1I3QB 3FP9A 2YU9H 2L0CA 4GKKL 4C3JH 4X3KA 2R93H 1SMYC 1J5EQ 3GTQB 1FVIA 2L9HA 4IUQA 1VQKA 4PZ6A 2GVBA 3CPFA 1NE3A 1KRSA 2OCEA 4DV5Q 3TS0A 5ISRA 1U0LA 1RKNA 2IW3A 5C5LA 3NTKA 3OTOL 3RZOH 2ENBA 2BOSA 5IGFA 2C5CA 4J8QA 3GV6A 3RUZA 4IZ8A 4A3IB 4HIKA 1PHJA 4DR5L 3J7ZC 3HOVG 3QR8A 4BXXG 2E2IB 2HIVA 2NVYB 4A3GB 4BBSH 2E2JH 1YNJC 4POGA 4ZAIA 5IYCH 1DCZA 1B9MA 2E2HH 2K4KA 1EWHA 3PUVA 4C2MH 2EXDA 2JE6I 2R7DA 5ELFA 1FJGL 3FMCA 5LHY1 2KHSA 4KTAA 4GOPB 5DM73 4IFDI 3AU7A 2B8GA 2LS01 5C3EG 3GTMB 2I5MX 3RLNA 4K2KA 4XQNA 4DPGA 3GTJH 1ICFB 1KABA 5J22A 4JI1Q 4HMJA 1Q7YC 1L0XB 3BG3A 1XNRL 1H9SA 4ULLA 1Q8IA 4KY6A 3S14H 3G6EA 5DM63 4FF4A 1SJHD 3A8IE 3NXWA 2ZT9C 4GNXA 2NBFA 3HOWG 2EYOA 3BVGA 3DEPA 2F0IA 1M4VA 1FYCA 4BA2I 4A3LH 1YNJD 3MAQA 4DNTB 1EYAA 3CC4A 3PO3G 5M5YB 1HUNA 1H9MA 4H44C 5M5WB 1F9SA 1MIUA 1QJOA 5ELCA 1RHPA 2GVAA 2F3WA 2JA7H 5EKIA 3HGBA 1XPOA 2JA6H 1D5XC 4V190 1XNQQ 3SK8A 4B08A 2KOLA 2R7ZB 4AQYL 2KVMA 4LFAQ 1E24A 4A93G 3MXPA 4OO1G 1CT1D 1ENAA 2RDGA 2KHJA 3RLOA 4JI8L 3KDFA 1N34Q 4K5WA 4YCUA 3U4ZA 3RNUA 2NVQB 5C0XJ 4CDDC 1BUVT 1HNZL 1BCPF 1LM0A 4A3MH 1K0SA 2ZXPA 1EIGA 2UU9L 3E0EA 3E6ZX 4C3IH 2DY7A 2F0UA 1JORA 1IZ6A 4FNFA 5M3MH 1Z6HA 5CYUA 1L0YB 1PDQA 3VYSA 4NKLA 4IO9A 2ID0A 2PQAB 2FMCA 4MN3A 1PH7A 1JICA 3LNNA 1PRTF 1YHQA 1JCKB 1O7IA 1VQLA 5LL6S 1B8AA 2LXJA 3DHQA 4GLXA 3PIP3 3TZDA 4X3UA 3K81C 3HOYG 2MO0A 5H1SE 1T5EA 4OWTB 4YCVA 5CBEE 4I7AA 3I4LA 5JJIA 1TWHH 3A0JA 2V1CC 3HOUG 1VQGA 2IL8A 3L9AX 4QUCA 4OWXB 1DGSA 3I4NG 3S2HB 1OXSC 4LJZC 2PW5A 3HOVB 2K75A 2EY5A 3S1QB 3RD4A 1O7YA 3K5LA 3M4OB 5L37A 4A3CG 3WDNA 3A55A 4A4IA 4EQOA 3J7YW 5IP9G 5CORA 1HHVA 1P8LA 4LF5L 3ERQA 2IJ0A 5JEAH 4L5RC 2XWBB 4UP8A 2B3GA 5C3EB 1ESFA 3VDYA 1HZCA 4YWMA 5T1GA 2B63G 3PUXA 4A3JG 4DUYQ 1VMCA 3F8TA 4K0KL 3PF5A 2EYPA 2PQEA 1DOMA 3PQIA 4E6IA 5A35A 2K50A 4AIMA 2D2CC 3HOWB 3HOXH 1SYFA 1K73C 1HZAA 1SBBB 1X65A 1CA5A 2ZJQA 3NSWA 2AMCB 5J3BA 3PO3B 1B44D 3CCSA 1UE1A 4RA8A 3IAYA 2HQLA 1HNWL 4RHRA 2G9HD 4GOPC 1LO5D 1PV4A 1EQVA 4HJ8A 1TR5A 2IHFA 1AH9A 2XRSD 4EVOA 4X64Q 1EQTA 1UE7A 3I8ZA 1RF2D 4A93B 3UDIA 5ELOA 1Y1VH 5EJWA 1H9SB 5I9OA 5J39A 1KC8C 2XNAC 4Y7NB 3CRLC 4LUOA 3I4MH 4GNXB 1QZGA 2MHVA 4OIJA 3GP7A 3W5OA 3CAMA 2AUKA 2IX1A 3H09A 3CPWA 4KY7A 3F1ZA 2RHSB 1PTOF 5LMUL 2O5JC 1KTKA 2LKVA 2F0JA 3GTLB 1BBWA 1DM0B 3I73A 2R92G 2F0MA 4BY7H 4HIOA 1X54A 2N49A 3X3MA 1SRUA 3HOYB 1GHJA 3L0OA 2Z6KC 3CMAA 5JJKA 2LFNA 2L1BA 1VQOA 1SLJA 1JOOA 1VQJA 1YEZA 3HOUB 2JK8A 4A3DH 3KDFB 1G8ZD 5EBDA 3I4NB 3AB9A 5C4XH 5C3WA 1YIJA 1UE5A 2QW7A 4KKUA 4AH6A 5FO9B 1XJVA 2C9OA 3NP8A 2B2YA 4XQQA 1XMOQ 5I2YA 5IP7H 4PZ7A 1N36Q 1ZEQX 3A8KE 4C3HH 4JBJA 4EQ5A 4LF4L 2JQOA 1FL0A 4P72A 1XMQL 2EPBA 3VR3A 1H9JA 4JI3Q 1YNXA 4KHPL 2B63B 2PI2E 1JOQA 3K8AA 3KLWA 1A62A 3DM3A 2JYOA 2KBNA 1LT4D 5CBAE 4A3JB 2DJGC 2JJQA 1RJTA 3T16A 1Q8KA 4C3JB 5M3MG 1YJWA 1ZXTA 5M5XB 4LF9Q 4XT3B 2TMPA 5D14A 4DR7Q 1X3EA 4A3KG 4XYOA 3H3VI 2B8FA 2GN5A 3TP8A 1IBKQ 1AE3A 1J9OA 2LMCB 2RDFA 3A7LA 4BBRG 3M7GA 1LUZA 3J81E 5CV5A 1EIFA 1LYLA 2QF7A 3D8GA 4P75A 3S24A 4N9PA 4LNQA 4RCOA 3T1HL 2A5HA 1FGUA 2XTIA 3IL8A 4LFBL 1RCVD 4LWCA 3J80c 3I7FA 1FNUA 3TP5A 2NN6H 4FF2A 1KNEA 2CFMA 4XDXA 3KF6A 3TEHB 1I94L 1HTPA 3BVMA 4DV2L 2JEBI 4H02A 3CCJA 4DV7L 3KF8A 1ONLA 4NXML 2F3IA 3QIAA 4O2DA 3UDGA 5FJ8H 2UUBL 3GQBA 1SMXA 1RL2A 3Q24A 5CV7A 4KMUC 2JA8H 1SNPA 4X62Q 1XPUA 4KK7A 3Q8DA 4JBMA 1AFPA 1Q12A 3QOLA 1EQRA 2AQ1B 1LT5D 4R9WA 3EFXD 3M9BA 4CKBA 1TS3A 2ZTEA 1XWEA 3I3CA 1GUGA 4WRDA 1WTRA 3GTKH 1G6PA 2JA9A 2RCFA 4WFN3 3LWEA 3TQYA 4BA1I 4QF4A 5ELDA 1EWIA 1BBUA 5CV4A 3TRZA 4CJ2C 5IE8A 4EQPA 1DOLA 1NJIC 2VY3A 1GM5A 4R4CA 1ZYRC 5ELBA 1W3SA 3HRZC 5JPNC 3SGIA 3CF5A 2R92B 1HCZA 1K8AC 5E4WC 3KYHC 3PUYA 2PW7A 3OW7A 3J81j 2C35B 4GKKQ 3I55A 2YYZA 2A69C 1GKHA 3R2TA 3HOZG 2F4VL 3BS1A 5C4JB 1CQVA 1TXYA 1EEID 1K8MA 2FHTA 1YITA 2AWOA 4X3TA 3ICEA 4GNXC 1PA6A 1O78A 5EPJA 4OXPA 2B29A 2VZAA 3GTGB 4RCNA 1S4ZA 2LSSA 4AYBG 1VQFA 3DMUA 4J15A 2QDBA 1E2WA 4OL7A 1F9PA 1NR4A 2Q8TA 2G9DA 4IFDG 2K52A 3OTOQ 2Q2HA 5CV6A 5C44G 3HG9A 2E5LQ 5CMDA 3KLSX 1ET6A 1X6OA 1K3BC 3PIPA 2O5IC 1R4PB 1CA6A 1SE4A 1T9HA 2B2WA 1ZYRD 1MD2D 1YVCA 4RG1A 4QMGA 2YTXA 1SE3A 4DR5Q 4IJLA 2HQEA 2A69D 2K7VA 1KAAA 4ZKBB 3PMFA 4DAMA 4IJHA 3HKZG 5LMNL 2EE1A 3STBC 4RKLA 4JI0L 3R3OA 3MWYW 5M3MB 3AEVA 1FJGQ 1VMPA 1FNWA 3PO2G 3W1GA 4V0BA 2BA1A 2HD3A 1IKLA 4P73A 1E22A 2M2LA 3TP7A 4A3KB 5FLMG 1UUPA 2X6GA 4A3FH 3NELA 1K83B 2Z4IA 1C7YA 1WFQA 1JB3A 3M3YH 1B3AA 1VQBA 2PNRC 4F88A 3S2DH 4APVA 2XIWA 4B9WA 3LX0A 2PZUA 3TP6A 1HTLD 2UXDL 1X3GA 2VQEL 1WTOA 1YHAA 2F52A 4O1NA 1I4QA 3GO5A 1J6QA 5FKAC 5JJZA 3Q22A 5KEEA 1VF5C 4HJ5A 4DXGA 1I6HH 3STBD 5IWAL 4JI5L 1VQPA 4Q0FA 4QIWE 4IPHA 3ND9A 2VQFQ 1EY8A 1PTOD 1OO9B 2OXPA 2YV5A 3S1RH 4BY1G 4AQYQ 5GAHC 2EJGC 4DK0A 5C6AA 2D9UA 3KK7A 5IGGA 5EGTA 3K80C 4JI8Q 1B3QA 2AHOB 2ZTCA 3OSOA 4FP5D 3J7AV 1HUMA 3G48A 4JYAQ 2MP1A 1V1PA 1HNZQ 4FF1A 1STYA 3KF6B 1E3PA 4L8JA 3NUCA 4F7XA 2HT1A 3HOXB 1GUNA 3HOZB 3KF8B 1K9MC 1PH5A 4WJ4A 2HHHL 4DR4Q 3I91A 2JN4A 1EYDA 1LTTD 1WCMH 2F0TA 4IUUA 1YI2A 4CJ1B 3KJPA 4AYBB 4DXFA 4DK3C 2E75C 2EZVA 1VQMA 2I46A 3U9OA 4F8MA 2WB1E 4M8AA 1TWAB 1B9NA 5C44B 4N9TA 3MFYA 4X66L 5I6WA 4R4QA 3U58A 1LTBD 1M8AA 1LLRD 3J7AF 1F2LA 4PV1C 1H9KA 2PCFB 2UUAL 4RGTA 3H0GG 1X9NA 4MTKA 1C8CA 3GTOH 2QDLA 3NWSA 3I70A 2ZM6L 4A3EG 2IX0A 4CDEC 1IW7C 2AKWB 1IYVA 5AJ3L 1CZGA 3HKZB 2F0PA 1IBML 1IBLQ 4DNIA 3N6RA 3EIVA 3PO2B 1NNXA 1X3QA 2CQOA 2N8NA 1F77A 4A3BH 1I50B 5C3XA 2X69A 2I5LX 3PV0A 1CHPD 4IPGA 2E76C 1A0IA 1A2TA 1BKBA 4HTHA 3CP0A 4JBKA 1D7QA 4NXNL 4GN3B 3K5MA 4K0KQ 1Y1WH 4R8NA 3M4PA 1M1KC 4JI2Q 4QB4A 1I4RA 4S3SA 1ENCA 2K5WA 2ASBA 1SMYD 4JC0A 4A3DB 1PXUA 2ZJRA 4YY3L 4FXGC 1HR0L 1HQMC 2Y0SG 5C4XB 1IW7D 4KD3A 2WP8J 2CQAA 3IKJA 2E8GA 1I5FA 5K36H 1TS4A 3CD6A 3URYA 1HNWQ 1VF7A 2NVTB 3WOFA 3AMUA 3J80L 4JI4Q 1Q46A 3H91A 3S17H 3K0YA 4JI6L 1WD0A 2UXBL 1VQHA 4BY1B 4C3HB 3VA7A 4LF7L 1QNKA 1VQEA 2VUMH 3U50C 2DGYA 2FINB 4DAVA 1WTHA 2B2YC 5IT9E 2L11A 1D2BA 2F0SA 1D1IA 2EQSA 2K32A 1EOTA 2R3ZA 4B3MQ 1YJNA 4POFA 1STGA 1KIXA 1BDOA 3F2DA 4KV6A 2IT1A 3EA6A 2JSOA 4ID6A 2X6LA 1XXGA 1PH9A 1N32L 3CU7A 4MHEA 3D31A 3FKIG 2F0FA 2RSOA 3FPPA 1BXTA 4WJWA 4U68A 4PMBA 3GDEA 5AFWA 3JAMi 1A8VA 1VDZA 4FXKC 1HJPA 3CRKC 1AW7A 1LT3D 1U4RA 3NEMA 4RGOS 1NAPA 5IYBH 2UXCL 3UE0A 3KOJA 4K8JA 3ER0A 4NPSA 1VQNA 4JPBW 3AFPA 3GTPH 4P2CB 1KLGD 3QB3A 1QUQA 5IGDA 3K7UC 2NZHA 2K04A 1S5ED 3I2ZA 3L3OC 1V1PB 3H0GB 2XRQD 1Y69U 5BN4A 1HA6A 5M3FH 1DZ1A 4A3EB 2L15A 1MSHA 3VR5A 5K5PA 3FEWX 4GN5A 3WOEA 1CZWA 4KJNA 5CC4A 1A6XA 4FDBA 1TWFH 3K7AB 4DR6L 1Y8PB 1ILQA 4LF4Q 5D3IB 1TWCH 3MXUA 4ALPA 1XMQQ 3CCEA 4DR3L 5D3DA 2VNUD 1PZID 4HCSA 3IFTA 1BOSA 1IKMA 3I72A 5C0XH 3ONAB 2LXKA 3OIQA 4K5XA 2B2TC 5CGKA 4JV5Q 2WAQG 2F0LA 4B3SL 1YBYA 3G71A 5LL6X 1SROA 1KLUD 2F0OA 5HY6A 1AZQA 4LF6L 2NTTA 3HFZB 2Y0SB 3S15H 4FF3A 5IYDH 5G3LD 1PYSB 3VR2A 3S1NH 3JAME 3T1HQ 1RIPA 4OWWB 2NN6I 2PZWA 2PMZE 3NK9A 3K0XA 4DA2A 3SK6A 1LTGD 4LFCL 2HDMA 1F2YA 5DLQE 1J5EL 2DY8A 3CCQA 1Y14B 4NP5A 1RTNA 4NXMQ 3ITPA 4C3JG 4IFDJ 3K5OA 3FPUB 4DV5L 4B3RL 2R93G 1X3FA 3CXCA 1YNNC 4TQUS 1B4OA 5EKKA 1QB5D 1KAWA 3S16B 4BWGB 1NMFA 4NB3A 2SNMA 1U4LA 2B2WC 2EYJA 5ELNA 3F2CA 5C4ZA 3BZCA 4OX9L 1MKHA 4IN3A 1WTVA 1Q1EA 2BE5C 1S40A 2MJ8A 2D0PA 1LTLA 1PH6A 4GS3A 4G57A 4HSPA 2JA5H 1YJ9A 3FKIB 4IPCA 5E3FA 3CMEA 3BU2A 1QVFA 3OYYA
chains in the Genus database with same CATH topology
1L2FA 1NMGA 2ZTEA 4BBSG 4GKJQ 4KI0A 3ULJA 3A74A 3GTKH 1R9TH 1V1QA 1G6PA 2JA9A 5IYCG 5IY0A 3PSIA 1NY4A 3TQYA 4BA1I 2JEAI 5JJIA 3GTGH 4X6AH 1EYGA 1EWIA 1BBUA 4KHZA 4X65L 5IE8A 2VQFL 1JMCA 4KLKA 3TRZA 1PH2A 2Z0SA 1NJIC 2R6GA 2VY3A 1GM5A 3T1YL 1L1OC 1QZHA 1EUJA 1YHBA 4DV3Q 2UUCQ 4R4CA 4X62L 2Q2UA 2PQAA 1TWGH 5GADC 1W3SA 1JJCB 3SGIA 3CF5A 3LGJA 4R4IA 4DR2Q 1K8AC 4DUZQ 3CW2C 4YHHL 3KYHC 3PUYA 3HKSA 4DR3Q 3J81j 2OQ0A 2ZTDA 1P16A 2C35B 4GKKQ 3I55A 3GTQH 2YYZA 4IOAA 4GKJL 1GKHA 3HOZG 2F4VL 2EIFA 2R7ZG 1HNXQ 3D0FA 1PH8A 1G51A 1V9PA 1TXYA 3ULLA 3RN2A 1WJJA 1YITA 4JYAL 1CSPA 2AWOA 3ICEA 4GNXC 3S1MH 1E1OA 3AYHB 1PA6A 1IYJB 4OXPA 2B29A 2VZAA 1M90C 4B3SQ 2XGTA 4B3TQ 2LSSA 4A3LG 4AYBG 1VQFA 1YZ6A 4J15A 4DV3L 1XPRA 1JB7A 2KCTA 2MQHA 1KRTA 1C0AA 4IFDG 1KHIA 3EBEA 2K52A 5LMNQ 3OTOQ 4DUZL 2Q2HA 2WAQE 5JEAJ 5C44G 1L0WA 1D8LA 2E5LQ 4A3KH 2WB1G 4KHPQ 3FP9A 2YU9H 4GKKL 2JA7G 4C3JH 1VQ8A 3RN5A 4DR4L 4BBRH 1X6OA 4A3IH 1K83H 1Q82C 3PIPA 2MFIA 2CCZA 2R93H 1HNXL 1T9HA 2JA6G 1HZBA 5GROA 1B7YB 4QY7A 1J5EQ 2CWAA 1QUQB 4O0AA 2WFWA 1YVCA 1FVIA 4RG1A 2YTXA 2E2IH 1N8RC 4A3GH 2NVYH 3UDXA 4IJLA 4DR5Q 1VQKA 4PZ6A 1OXVA 2GVBA 3CPFA 3J80i 3JAMc 4OONA 1NE3A 1VQCA 4DR1Q 1KRSA 2OCEA 4DV5Q 1WCMG 4PZ8A 2MNAA 1X56A 4DAMA 3TS0A 1U0LA 2K14A 3FHWA 4IJHA 2UXDQ 3HKZG 3OTOL 5LMNL 3RZOH 3STBC 4JI0L 1OXTA 3AEVA 1FJGQ 3PO2G 4LFBQ 4A3MG 3W1GA 4PG3A 2BA1A 3GTMH 4P73A 1E22A 3CQZH 2A8VA 1IXRA 5FLMG 4A3FH 3J81c 3NELA 4HIKA 1C7YA 1PHJA 1WFQA 1I94Q 4JI5Q 3M3YH 1VQBA 5E7NA 4DV2Q 4DR5L 3S2DH 4APVA 4DV7Q 3J7ZC 1IBLL 3HOVG 2UUBQ 4BXXG 2HIVA 4BBSH 4DV0Q 3BZKA 2E2JH 2PNHA 2RHQB 2ZJPA 4POGA 2UXDL 1X3GA 2VQEL 1SN8A 3KFUA 2VS1A 5IYCH 2E2HH 2K4KA 1L1OA 2OQKA 1YHAA 2F52A 3PUVA 3PIOA 4C2MH 2JE6I 2EXDA 2I5HA 2R7DA 1J6QA 3GO5A 3PGZA 1FJGL 2A1AA 2RCNA 4MTNA 4HJ9A 4TVAB 2ES2A 3CC2A 5M5YH 4GOPB 4XTCS 4HJ5A 4IFDI 5M5WH 5C3EG 2I5MX 3RLNA 4A3BG 4DPGA 3GTJH 3STBD 5IWAL 1I6HH 4JI5L 1VQPA 4JI1Q 4QIWE 4IPHA 1Q7YC 1XNRL 2VQFQ 4HJAA 4JI2L 1VS0A 3RLFA 3S14H 3G6EA 2R7FA 1AE2A 4GNXA 1GO3E 1EFWA 3HOZH 2R7ZH 5FLXc 5EAYA 2N78A 4DKAC 2YV5A 2VL6A 1QVGA 3S1RH 3HOWG 4BY1G 4AQYQ 1Y1WG 4YHHQ 5GAHC 1MJCA 1CUKA 4MZ9A 2NVQH 3ZJYC 1HR0W 4BA2I 4A3LH 5JEAG 3K80C 4JI8Q 4DUYL 2AHOB 2F4VQ 3PUZA 2ZTCA 3CC4A 3G48A 4A75A 4JI4L 3PO3G 4JI1L 1TWAH 1VQ4A 4JYAQ 4DV6Q 1Q86C 5C44H 1PH1A 1HNZQ 1MIUA 3L7ZC 3MEFA 2AWNA 2GVAA 5K36G 2OTLA 4EX5A 2JA7H 2K5NA 4QL5A 3KF6B 1E3PA 2QEXA 1XPOA 3CC7A 2JA6H 2Q2TA 3M7NA 1OTCA 2FXQA 1XNQQ 2HT1A 1I3QH 3KF8B 1K9MC 4AQYL 3B6YA 1PH5A 4LFAQ 4WJ4A 1E24A 2HHHL 4A93G 1X55A 1XTDA 3H15A 1PVOA 4AYBE 4DR4Q 4OO1G 3HOXG 3RLOA 4B3ML 2KHJA 4JI8L 3OW2A 1WCMH 3KDFA 1N34Q 4YCUA 3U4ZA 4ME3A 1YI2A 2VUMG 3KJPA 3RNUA 5C0XJ 4DK3C 4DV6L 4QQBX 1VQMA 2ZM6Q 1HNZL 2WB1E 3PO2H 2QA4A 1LM0A 4JCVE 4A3MH 4UY8C 1IL2A 2UU9L 3E0EA 4C3IH 4X64L 1K0RA 1I50H 3A5ZB 3AQQA 1IZ6A 1C9OA 1XNQL 5FLMH 1PFSA 5M3MH 4WJ3M 4X66L 2D62A 2KHIA 3J81i 3U58A 4R4QA 3S2HH 4LFAL 2D0OA 4JI0Q 3CCRA 1CKNA 1ASZA 3HOVH 1PH3A 4BXXH 4UPAA 2OTJA 4IO9A 2ID0A 2UUAL 2PQAB 3M4OH 1WYDA 1N34L 3W1BA 1X9NA 3H0GG 1VQIA 1PH7A 3HKZE 3CCVA 1YHQA 1O7IA 1UWVA 3GTOH 1Y1VG 2ZM6L 1VQLA 4A3EG 1B8AA 2IX0A 2LXJA 4DK6C 4GLXA 2AKWB 2HIXA 5AJ3L 3K81C 3I4MG 1IBML 3HOYG 1KQSA 4DNIA 2MO0A 3CCMA 1IBLQ 2BA0A 4LW1A 3EIVA 4HIDA 5H1SE 2CQOA 2PI2A 3GD7A 4OWTB 2CKZB 2N8NA 4YCVA 5IYBG 5C3EH 4QGUA 2VQEQ 4A3BH 1G291 4HIMA 1TWHH 3A0JA 2V1CC 3NENA 4L5QA 4L5TA 1HR0Q 2K5VA 1VQ7A 4JOIC 3HOUG 1VQGA 4OWXB 2I5LX 3PV0A 4IPGA 1DGSA 1PYBA 2ATWA 1A0IA 1BKBA 3I4NG 1Z9FA 1OXSC 2NVTH 4QJFA 4R4OA 3CP0A 2K75A 4JBKA 3DLLA 1D7QA 2DUDA 4NXNL 4GN3B 4A3CG 1GVPA 1SFOH 5IWAQ 2YTVA 4K0KQ 4BY1H 1Y1WH 1N33Q 4OO1I 4A4IA 1XNRQ 5M3FG 3M4PA 1M1KC 4JI2Q 5IP9G 4BY7G 1V43A 1ASYA 2UXBQ 3U4VA 1P8LA 4LF5L 2ASBA 1Q1BA 4JC0A 4L5RC 1N9WA 2ZJRA 4YY3L 4LF7Q 1VCIA 3EN2A 3ERSX 4UP8A 1HR0L 3PO3H 2Y0SG 2B3GA 2WP8J 4LUVA 3VDYA 1HZCA 4YWMA 2E8GA 1I5FA 1KD1C 1XMOL 3CD6A 4A3DG 3MXNB 1WI5A 2B63G 3PUXA 5C4XG 4A3JG 4JV5L 3TS2A 1HNWQ 4DUYQ 3F8TA 1EQQA 4JI4Q 1WOCA 1Q46A 4GN4B 3PF5A 4K0KL 3CCUA 1N33L 3WWVA 5GQOA 3S17H 2IHEA 2K50A 4JI6L 4A93H 4JBWA 2UXBL 4AIMA 5C0XG 3M85A 1VQHA 1SR3A 3E9HA 3HOXH 4LF8Q 5IP7G 1K73C 1HZAA 3M4QA 5GAGC 4LF7L 1X65A 1VQEA 2VUMH 3U50C 2DGYA 2ZJQA 4RMFA 4Y7NH 2K5HA 3F2BA 2AMCB 5J3BA 2HHHQ 3CCSA 1UE1A 2EQSA 5JJLA 4P74A 5IYDG 2HQLA 4B3MQ 3UE1A 1YJNA 1HNWL 4JG2A 4POFA 3L2PA 2NZOA 1L1OB 1IBKL 1EOVA 4GOPC 2UXCQ 4XIGS 1PV4A 1KIXA 5BR8Q 4HJ8A 3NBHB 3F2DA 2MO1A 2OWOA 2IT1A 2IHFA 1AH9A 4LF8L 2UU9Q 4X64Q 1UE7A 3PF4A 1E1TA 1PH9A 4DAYB 4R1JA 3H0GH 4YWLA 1N32L 4JI7Q 3D31A 3FKIG 1U5KA 4X66Q 3UDIA 1SE8A 5ELOA 4L5SA 1Y1VH 3RR5A 4A3EH 1KC8C 2BH8A 1PH4A 4MNOA 4LUOA 3I4MH 1W2BA 3GDEA 3JAMi 4GNXB 3HOYH 1A8VA 1QZGA 4JOIA 1HJPA 4YWKA 2UUAQ 2IY5B 3NEMA 3K7AH 5IYBH 2UXCL 3PUWA 3UE0A 3KOJA 3W5OA 3CAMA 5BR8L 1VQ5A 3HOUH 2IX1A 2NN6G 3CPWA 3RZDH 3ER0A 4NPSA 1VQNA 4YCWA 4DR6Q 3I4NH 5AJ3Q 1OXUA 1Z47A 1IBMQ 3AFPA 3J7A5 3GTPH 3F1ZA 3E9IA 1JJGA 2RHSB 4DV1Q 1QUQA 3K7UC 2NZHA 4JI7L 5LMUL 1OXXK 3I2ZA 1BVSA 5FJ8G 4A3CH 1CKOA 2JA5G 1BBWA 3A5UA 4DV4Q 5C0XI 4P71A 1K3RA 2R92G 5M3FH 1NBWA 2JA8G 2L15A 5IP9H 4HIOA 4BY7H 3S1QH 1X54A 2N49A 1SRUA 4GN5A 3L0OA 5HGQA 2Z6KC 1KL9A 3CMAA 5JJKA 4FDBA 4LUZA 4NXNQ 2VW9A 1TWFH 4DR6L 1VQOA 1SLJA 2UUCL 4LF6Q 2Q2IA 1VQJA 3I4OA 1YEZA 1JT8A 2JK8A 3BJUA 4LF4Q 1JJ2A 4A3DH 3KDFB 4DV1L 4DR2L 1CKMA 4LF5Q 2B63H 5C4XH 4A3JH 1TWCH 4ALPA 1NTGA 1XMQQ 2I0QA 4UP7A 3CCEA 2KCMA 2RF4A 4DR3L 4YY3Q 1MJEA 1YIJA 1UE5A 1A63A 2VNUD 4DV4L 4AH6A 1XJVA 4IPDA 5M5XH 4LFCQ 1K8GA 2BH2A 1XMOQ 1VQ6A 2LXKA 5IP7H 4PZ7A 4JV5Q 2WAQG 2Y0SE 3CCLA 4B3SL 1YBYA 3G71A 1N36Q 4B3TL 1SROA 1CSQA 5HY6A 1CKNB 2QGQA 3HOWH 3S16H 4C3HH 4LF6L 4JBJA 3AFQA 4B3RQ 2H5XA 4EQ5A 3HFZB 2JQOA 1EIYB 4JI6Q 4GOPA 4LF4L 1S72A 1FL0A 3PCOB 3S15H 5IYDH 4P72A 1PYSB 1XMQL 3S1NH 3T1HQ 4JI3Q 1YNXA 2E5LL 1RIPA 4OWWB 4KHPL 2NN6I 2PMZE 2PI2E 1B70B 1A62A 3K0XA 3DM3A 3K8AA 2KBNA 3KLWA 5GAEC 1KXLA 4LFCL 2JJQA 1UEBA 5DLQE 4Y52H 1J5EL 2KENA 1Q8KA 2CWPA 5M3MG 1YJWA 4OX9Q 2ALYB 4LF9Q 3CCQA 4UP9A 1GD7A 1Y14B 4DR7Q 1X3EA 4A3KG 2A19A 3H3VI 3FKIH 2GN5A 1N36L 4NXMQ 1IBKQ 1VQAA 1AE3A 4DR1L 4IFDJ 4BBRG 4A76A 4A3IG 1VQDA 4DV5L 5IT9c 1LUZA 3I56A 4B3RL 1X3FA 3CXCA 2R93G 4TQUS 1EIFA 1LYLA 4P75A 3S24A 4LNQA 1KAWA 1NMFA 3JC66 4NB3A 4JI3L 3T1HL 1FGUA 2XTIA 4A3GG 4LFBL 4LWCA 4GLAC 3J80c 1N32Q 3ULPA 5ELNA 3I7FA 3F2CA 4IOCA 3BZCA 1S3OA 4GLVB 5LMNW 2CFMA 4PMWA 1HH2P 1VQ9A 4OX9L 3KF6A 4LF9L 1MKHA 3TEHB 1UE6A 1I94L 1Q1EA 4DV2L 1S40A 2JEBI 4DR7L 4H02A 2D0PA 3TREA 3CCJA 1LTLA 4DV7L 4R4TA 4X65Q 2F3IA 4O2DA 3UDGA 1PH6A 5FJ8H 2UUBL 4NXML 4GS3A 2YTYA 3G4SA 1SMXA 2JA5H 1RL2A 4DV0L 3H3VH 3T1YQ 1YJ9A 4IPCA 3KJOA 2R92H 1Q81C 4A3FG 2Z6KA 2JA8H 4X62Q 3CMEA 3UDFA 1XPUA 4HJ7A 3Q8DA 2NVXH 2N3SA 1QVCA 3BU2A 3IRBA 3GTLH 4JBMA 1HZ9A 1Q12A 1QVFA 1JE5A 1E7ZA 1EQRA 5LMUQ 1H95A 3OYYA 5C4JH 3M9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2F A;  1NMG A;  2ZTE A;  4BBS G;  4GKJ Q;  4KI0 A;  3ULJ A;  3A74 A;  3GTK H;  1R9T H;  1V1Q A;  1G6P A;  2JA9 A;  5IYC G;  5IY0 A;  3PSI A;  1NY4 A;  3TQY A;  4BA1 I;  2JEA I;  5JJI A;  3GTG H;  4X6A H;  1EYG A;  1EWI A;  1BBU A;  4KHZ A;  4X65 L;  5IE8 A;  2VQF L;  1JMC A;  4KLK A;  3TRZ A;  1PH2 A;  2Z0S A;  1NJI C;  2R6G A;  2VY3 A;  1GM5 A;  3T1Y L;  1L1O C;  1QZH A;  1EUJ A;  1YHB A;  4DV3 Q;  2UUC Q;  4R4C A;  4X62 L;  2Q2U A;  2PQA A;  1TWG H;  5GAD C;  1W3S A;  1JJC B;  3SGI A;  3CF5 A;  3LGJ A;  4R4I A;  4DR2 Q;  1K8A C;  4DUZ Q;  3CW2 C;  4YHH L;  3KYH C;  3PUY A;  3HKS A;  4DR3 Q;  3J81 j;  2OQ0 A;  2ZTD A;  1P16 A;  2C35 B;  4GKK Q;  3I55 A;  3GTQ H;  2YYZ A;  4IOA A;  4GKJ L;  1GKH A;  3HOZ G;  2F4V L;  2EIF A;  2R7Z G;  1HNX Q;  3D0F A;  1PH8 A;  1G51 A;  1V9P A;  1TXY A;  3ULL A;  3RN2 A;  1WJJ A;  1YIT A;  4JYA L;  1CSP A;  2AWO A;  3ICE A;  4GNX C;  3S1M H;  1E1O A;  3AYH B;  1PA6 A;  1IYJ B;  4OXP A;  2B29 A;  2VZA A;  1M90 C;  4B3S Q;  2XGT A;  4B3T Q;  2LSS A;  4A3L G;  4AYB G;  1VQF A;  1YZ6 A;  4J15 A;  4DV3 L;  1XPR A;  1JB7 A;  2KCT A;  2MQH A;  1KRT A;  1C0A A;  4IFD G;  1KHI A;  3EBE A;  2K52 A;  5LMN Q;  3OTO Q;  4DUZ L;  2Q2H A;  2WAQ E;  5JEA J;  5C44 G;  1L0W A;  1D8L A;  2E5L Q;  4A3K H;  2WB1 G;  4KHP Q;  3FP9 A;  2YU9 H;  4GKK L;  2JA7 G;  4C3J H;  1VQ8 A;  3RN5 A;  4DR4 L;  4BBR H;  1X6O A;  4A3I H;  1K83 H;  1Q82 C;  3PIP A;  2MFI A;  2CCZ A;  2R93 H;  1HNX L;  1T9H A;  2JA6 G;  1HZB A;  5GRO A;  1B7Y B;  4QY7 A;  1J5E Q;  2CWA A;  1QUQ B;  4O0A A;  2WFW A;  1YVC A;  1FVI A;  4RG1 A;  2YTX A;  2E2I H;  1N8R C;  4A3G H;  2NVY H;  3UDX A;  4IJL A;  4DR5 Q;  1VQK A;  4PZ6 A;  1OXV A;  2GVB A;  3CPF A;  3J80 i;  3JAM c;  4OON A;  1NE3 A;  1VQC A;  4DR1 Q;  1KRS A;  2OCE A;  4DV5 Q;  1WCM G;  4PZ8 A;  2MNA A;  1X56 A;  4DAM A;  3TS0 A;  1U0L A;  2K14 A;  3FHW A;  4IJH A;  2UXD Q;  3HKZ G;  3OTO L;  5LMN L;  3RZO H;  3STB C;  4JI0 L;  1OXT A;  3AEV A;  1FJG Q;  3PO2 G;  4LFB Q;  4A3M G;  3W1G A;  4PG3 A;  2BA1 A;  3GTM H;  4P73 A;  1E22 A;  3CQZ H;  2A8V A;  1IXR A;  5FLM G;  4A3F H;  3J81 c;  3NEL A;  4HIK A;  1C7Y A;  1PHJ A;  1WFQ A;  1I94 Q;  4JI5 Q;  3M3Y H;  1VQB A;  5E7N A;  4DV2 Q;  4DR5 L;  3S2D H;  4APV A;  4DV7 Q;  3J7Z C;  1IBL L;  3HOV G;  2UUB Q;  4BXX G;  2HIV A;  4BBS H;  4DV0 Q;  3BZK A;  2E2J H;  2PNH A;  2RHQ B;  2ZJP A;  4POG A;  2UXD L;  1X3G A;  2VQE L;  1SN8 A;  3KFU A;  2VS1 A;  5IYC H;  2E2H H;  2K4K A;  1L1O A;  2OQK A;  1YHA A;  2F52 A;  3PUV A;  3PIO A;  4C2M H;  2JE6 I;  2EXD A;  2I5H A;  2R7D A;  1J6Q A;  3GO5 A;  3PGZ A;  1FJG L;  2A1A A;  2RCN A;  4MTN A;  4HJ9 A;  4TVA B;  2ES2 A;  3CC2 A;  5M5Y H;  4GOP B;  4XTC S;  4HJ5 A;  4IFD I;  5M5W H;  5C3E G;  2I5M X;  3RLN A;  4A3B G;  4DPG A;  3GTJ H;  3STB D;  5IWA L;  1I6H H;  4JI5 L;  1VQP A;  4JI1 Q;  4QIW E;  4IPH A;  1Q7Y C;  1XNR L;  2VQF Q;  4HJA A;  4JI2 L;  1VS0 A;  3RLF A;  3S14 H;  3G6E A;  2R7F A;  1AE2 A;  4GNX A;  1GO3 E;  1EFW A;  3HOZ H;  2R7Z H;  5FLX c;  5EAY A;  2N78 A;  4DKA C;  2YV5 A;  2VL6 A;  1QVG A;  3S1R H;  3HOW G;  4BY1 G;  4AQY Q;  1Y1W G;  4YHH Q;  5GAH C;  1MJC A;  1CUK A;  4MZ9 A;  2NVQ H;  3ZJY C;  1HR0 W;  4BA2 I;  4A3L H;  5JEA G;  3K80 C;  4JI8 Q;  4DUY L;  2AHO B;  2F4V Q;  3PUZ A;  2ZTC A;  3CC4 A;  3G48 A;  4A75 A;  4JI4 L;  3PO3 G;  4JI1 L;  1TWA H;  1VQ4 A;  4JYA Q;  4DV6 Q;  1Q86 C;  5C44 H;  1PH1 A;  1HNZ Q;  1MIU A;  3L7Z C;  3MEF A;  2AWN A;  2GVA A;  5K36 G;  2OTL A;  4EX5 A;  2JA7 H;  2K5N A;  4QL5 A;  3KF6 B;  1E3P A;  2QEX A;  1XPO A;  3CC7 A;  2JA6 H;  2Q2T A;  3M7N A;  1OTC A;  2FXQ A;  1XNQ Q;  2HT1 A;  1I3Q H;  3KF8 B;  1K9M C;  4AQY L;  3B6Y A;  1PH5 A;  4LFA Q;  4WJ4 A;  1E24 A;  2HHH L;  4A93 G;  1X55 A;  1XTD A;  3H15 A;  1PVO A;  4AYB E;  4DR4 Q;  4OO1 G;  3HOX G;  3RLO A;  4B3M L;  2KHJ A;  4JI8 L;  3OW2 A;  1WCM H;  3KDF A;  1N34 Q;  4YCU A;  3U4Z A;  4ME3 A;  1YI2 A;  2VUM G;  3KJP A;  3RNU A;  5C0X J;  4DK3 C;  4DV6 L;  4QQB X;  1VQM A;  2ZM6 Q;  1HNZ L;  2WB1 E;  3PO2 H;  2QA4 A;  1LM0 A;  4JCV E;  4A3M H;  4UY8 C;  1IL2 A;  2UU9 L;  3E0E A;  4C3I H;  4X64 L;  1K0R A;  1I50 H;  3A5Z B;  3AQQ A;  1IZ6 A;  1C9O A;  1XNQ L;  5FLM H;  1PFS A;  5M3M H;  4WJ3 M;  4X66 L;  2D62 A;  2KHI A;  3J81 i;  3U58 A;  4R4Q A;  3S2H H;  4LFA L;  2D0O A;  4JI0 Q;  3CCR A;  1CKN A;  1ASZ A;  3HOV H;  1PH3 A;  4BXX H;  4UPA A;  2OTJ A;  4IO9 A;  2ID0 A;  2UUA L;  2PQA B;  3M4O H;  1WYD A;  1N34 L;  3W1B A;  1X9N A;  3H0G G;  1VQI A;  1PH7 A;  3HKZ E;  3CCV A;  1YHQ A;  1O7I A;  1UWV A;  3GTO H;  1Y1V G;  2ZM6 L;  1VQL A;  4A3E G;  1B8A A;  2IX0 A;  2LXJ A;  4DK6 C;  4GLX A;  2AKW B;  2HIX A;  5AJ3 L;  3K81 C;  3I4M G;  1IBM L;  3HOY G;  1KQS A;  4DNI A;  2MO0 A;  3CCM A;  1IBL Q;  2BA0 A;  4LW1 A;  3EIV A;  4HID A;  5H1S E;  2CQO A;  2PI2 A;  3GD7 A;  4OWT B;  2CKZ B;  2N8N A;  4YCV A;  5IYB G;  5C3E H;  4QGU A;  2VQE Q;  4A3B H;  1G29 1;  4HIM A;  1TWH H;  3A0J A;  2V1C C;  3NEN A;  4L5Q A;  4L5T A;  1HR0 Q;  2K5V A;  1VQ7 A;  4JOI C;  3HOU G;  1VQG A;  4OWX B;  2I5L X;  3PV0 A;  4IPG A;  1DGS A;  1PYB A;  2ATW A;  1A0I A;  1BKB A;  3I4N G;  1Z9F A;  1OXS C;  2NVT H;  4QJF A;  4R4O A;  3CP0 A;  2K75 A;  4JBK A;  3DLL A;  1D7Q A;  2DUD A;  4NXN L;  4GN3 B;  4A3C G;  1GVP A;  1SFO H;  5IWA Q;  2YTV A;  4K0K Q;  4BY1 H;  1Y1W H;  1N33 Q;  4OO1 I;  4A4I A;  1XNR Q;  5M3F G;  3M4P A;  1M1K C;  4JI2 Q;  5IP9 G;  4BY7 G;  1V43 A;  1ASY A;  2UXB Q;  3U4V A;  1P8L A;  4LF5 L;  2ASB A;  1Q1B A;  4JC0 A;  4L5R C;  1N9W A;  2ZJR A;  4YY3 L;  4LF7 Q;  1VCI A;  3EN2 A;  3ERS X;  4UP8 A;  1HR0 L;  3PO3 H;  2Y0S G;  2B3G A;  2WP8 J;  4LUV A;  3VDY A;  1HZC A;  4YWM A;  2E8G A;  1I5F A;  1KD1 C;  1XMO L;  3CD6 A;  4A3D G;  3MXN B;  1WI5 A;  2B63 G;  3PUX A;  5C4X G;  4A3J G;  4JV5 L;  3TS2 A;  1HNW Q;  4DUY Q;  3F8T A;  1EQQ A;  4JI4 Q;  1WOC A;  1Q46 A;  4GN4 B;  3PF5 A;  4K0K L;  3CCU A;  1N33 L;  3WWV A;  5GQO A;  3S17 H;  2IHE A;  2K50 A;  4JI6 L;  4A93 H;  4JBW A;  2UXB L;  4AIM A;  5C0X G;  3M85 A;  1VQH A;  1SR3 A;  3E9H A;  3HOX H;  4LF8 Q;  5IP7 G;  1K73 C;  1HZA A;  3M4Q A;  5GAG C;  4LF7 L;  1X65 A;  1VQE A;  2VUM H;  3U50 C;  2DGY A;  2ZJQ A;  4RMF A;  4Y7N H;  2K5H A;  3F2B A;  2AMC B;  5J3B A;  2HHH Q;  3CCS A;  1UE1 A;  2EQS A;  5JJL A;  4P74 A;  5IYD G;  2HQL A;  4B3M Q;  3UE1 A;  1YJN A;  1HNW L;  4JG2 A;  4POF A;  3L2P A;  2NZO A;  1L1O B;  1IBK L;  1EOV A;  4GOP C;  2UXC Q;  4XIG S;  1PV4 A;  1KIX A;  5BR8 Q;  4HJ8 A;  3NBH B;  3F2D A;  2MO1 A;  2OWO A;  2IT1 A;  2IHF A;  1AH9 A;  4LF8 L;  2UU9 Q;  4X64 Q;  1UE7 A;  3PF4 A;  1E1T A;  1PH9 A;  4DAY B;  4R1J A;  3H0G H;  4YWL A;  1N32 L;  4JI7 Q;  3D31 A;  3FKI G;  1U5K A;  4X66 Q;  3UDI A;  1SE8 A;  5ELO A;  4L5S A;  1Y1V H;  3RR5 A;  4A3E H;  1KC8 C;  2BH8 A;  1PH4 A;  4MNO A;  4LUO A;  3I4M H;  1W2B A;  3GDE A;  3JAM i;  4GNX B;  3HOY H;  1A8V A;  1QZG A;  4JOI A;  1HJP A;  4YWK A;  2UUA Q;  2IY5 B;  3NEM A;  3K7A H;  5IYB H;  2UXC L;  3PUW A;  3UE0 A;  3KOJ A;  3W5O A;  3CAM A;  5BR8 L;  1VQ5 A;  3HOU H;  2IX1 A;  2NN6 G;  3CPW A;  3RZD H;  3ER0 A;  4NPS A;  1VQN A;  4YCW A;  4DR6 Q;  3I4N H;  5AJ3 Q;  1OXU A;  1Z47 A;  1IBM Q;  3AFP A;  3J7A 5;  3GTP H;  3F1Z A;  3E9I A;  1JJG A;  2RHS B;  4DV1 Q;  1QUQ A;  3K7U C;  2NZH A;  4JI7 L;  5LMU L;  1OXX K;  3I2Z A;  1BVS A;  5FJ8 G;  4A3C H;  1CKO A;  2JA5 G;  1BBW A;  3A5U A;  4DV4 Q;  5C0X I;  4P71 A;  1K3R A;  2R92 G;  5M3F H;  1NBW A;  2JA8 G;  2L15 A;  5IP9 H;  4HIO A;  4BY7 H;  3S1Q H;  1X54 A;  2N49 A;  1SRU A;  4GN5 A;  3L0O A;  5HGQ A;  2Z6K C;  1KL9 A;  3CMA A;  5JJK A;  4FDB A;  4LUZ A;  4NXN Q;  2VW9 A;  1TWF H;  4DR6 L;  1VQO A;  1SLJ A;  2UUC L;  4LF6 Q;  2Q2I A;  1VQJ A;  3I4O A;  1YEZ A;  1JT8 A;  2JK8 A;  3BJU A;  4LF4 Q;  1JJ2 A;  4A3D H;  3KDF B;  4DV1 L;  4DR2 L;  1CKM A;  4LF5 Q;  2B63 H;  5C4X H;  4A3J H;  1TWC H;  4ALP A;  1NTG A;  1XMQ Q;  2I0Q A;  4UP7 A;  3CCE A;  2KCM A;  2RF4 A;  4DR3 L;  4YY3 Q;  1MJE A;  1YIJ A;  1UE5 A;  1A63 A;  2VNU D;  4DV4 L;  4AH6 A;  1XJV A;  4IPD A;  5M5X H;  4LFC Q;  1K8G A;  2BH2 A;  1XMO Q;  1VQ6 A;  2LXK A;  5IP7 H;  4PZ7 A;  4JV5 Q;  2WAQ G;  2Y0S E;  3CCL A;  4B3S L;  1YBY A;  3G71 A;  1N36 Q;  4B3T L;  1SRO A;  1CSQ A;  5HY6 A;  1CKN B;  2QGQ A;  3HOW H;  3S16 H;  4C3H H;  4LF6 L;  4JBJ A;  3AFQ A;  4B3R Q;  2H5X A;  4EQ5 A;  3HFZ B;  2JQO A;  1EIY B;  4JI6 Q;  4GOP A;  4LF4 L;  1S72 A;  1FL0 A;  3PCO B;  3S15 H;  5IYD H;  4P72 A;  1PYS B;  1XMQ L;  3S1N H;  3T1H Q;  4JI3 Q;  1YNX A;  2E5L L;  1RIP A;  4OWW B;  4KHP L;  2NN6 I;  2PMZ E;  2PI2 E;  1B70 B;  1A62 A;  3K0X A;  3DM3 A;  3K8A A;  2KBN A;  3KLW A;  5GAE C;  1KXL A;  4LFC L;  2JJQ A;  1UEB A;  5DLQ E;  4Y52 H;  1J5E L;  2KEN A;  1Q8K A;  2CWP A;  5M3M G;  1YJW A;  4OX9 Q;  2ALY B;  4LF9 Q;  3CCQ A;  4UP9 A;  1GD7 A;  1Y14 B;  4DR7 Q;  1X3E A;  4A3K G;  2A19 A;  3H3V I;  3FKI H;  2GN5 A;  1N36 L;  4NXM Q;  1IBK Q;  1VQA A;  1AE3 A;  4DR1 L;  4IFD J;  4BBR G;  4A76 A;  4A3I G;  1VQD A;  4DV5 L;  5IT9 c;  1LUZ A;  3I56 A;  4B3R L;  1X3F A;  3CXC A;  2R93 G;  4TQU S;  1EIF A;  1LYL A;  4P75 A;  3S24 A;  4LNQ A;  1KAW A;  1NMF A;  3JC6 6;  4NB3 A;  4JI3 L;  3T1H L;  1FGU A;  2XTI A;  4A3G G;  4LFB L;  4LWC A;  4GLA C;  3J80 c;  1N32 Q;  3ULP A;  5ELN A;  3I7F A;  3F2C A;  4IOC A;  3BZC A;  1S3O A;  4GLV B;  5LMN W;  2CFM A;  4PMW A;  1HH2 P;  1VQ9 A;  4OX9 L;  3KF6 A;  4LF9 L;  1MKH A;  3TEH B;  1UE6 A;  1I94 L;  1Q1E A;  4DV2 L;  1S40 A;  2JEB I;  4DR7 L;  4H02 A;  2D0P A;  3TRE A;  3CCJ A;  1LTL A;  4DV7 L;  4R4T A;  4X65 Q;  2F3I A;  4O2D A;  3UDG A;  1PH6 A;  5FJ8 H;  2UUB L;  4NXM L;  4GS3 A;  2YTY A;  3G4S A;  1SMX A;  2JA5 H;  1RL2 A;  4DV0 L;  3H3V H;  3T1Y Q;  1YJ9 A;  4IPC A;  3KJO A;  2R92 H;  1Q81 C;  4A3F G;  2Z6K A;  2JA8 H;  4X62 Q;  3CME A;  3UDF A;  1XPU A;  4HJ7 A;  3Q8D A;  2NVX H;  2N3S A;  1QVC A;  3BU2 A;  3IRB A;  3GTL H;  4JBM A;  1HZ9 A;  1Q12 A;  1QVF A;  1JE5 A;  1E7Z A;  1EQR A;  5LMU Q;  1H95 A;  3OYY A;  5C4J H;  3M9B A; 
#chains in the Genus database with same CATH topology
 1L2F A;  1TY2 A;  4BBS G;  1YNN D;  4C1N K;  4KI0 A;  3ULJ A;  1ZKO A;  3G6J B;  5IY0 A;  5IYC G;  3EQL C;  4M1U B;  2HDL A;  3A8J E;  4X65 L;  4KLK A;  1ILP A;  1A2U A;  2EVB A;  1QZH A;  1EUJ A;  1YHB A;  1ESR A;  2UUC Q;  1HFN A;  1ML0 D;  1SYE A;  2BE5 D;  1JJC B;  2EYM A;  4R4I A;  4DR2 Q;  1UNS A;  1G2S A;  3HKS A;  1PYW D;  2OQ0 A;  1FR3 A;  2NVX B;  3GTQ H;  4GKJ L;  2RQX A;  2EIF A;  2RBM A;  3HP3 A;  3MZ5 A;  3NBI A;  4HAE A;  1G51 A;  3ULL A;  3RN2 A;  2KJX A;  1F9Q A;  1R9T B;  2DJF C;  1E1O A;  1IYJ B;  1HA5 A;  3OPO A;  3EVQ A;  1WTX A;  4B3T Q;  4A3L G;  1YZ6 A;  1JQY D;  2AQ3 B;  1XPR A;  1BO0 A;  2XVS A;  1KRT A;  5LMN Q;  4DUZ L;  1GXD C;  1TWG B;  3MA2 B;  3NQT A;  1L0W A;  2JA7 G;  1VQ8 A;  4A3I H;  1Q82 C;  1AZP A;  2MFI A;  2WAQ B;  2CCZ A;  1HNX L;  2JA6 G;  1HZB A;  1QIL A;  1B7Y B;  4QY7 A;  2WKC A;  2CWA A;  1QUQ B;  4O0A A;  2WFW A;  1LTR D;  2H1E A;  2E2I H;  2D5D A;  4A3G H;  2NVY H;  4CJ0 B;  3J80 i;  4C1N I;  1VQC A;  4DR1 Q;  3S1M B;  1D6E C;  2MNA A;  1UEA B;  5I4D A;  3QWN A;  3VR4 A;  2UXD Q;  1F2Z A;  5FO8 B;  1C4Q A;  1RTO A;  1B2T A;  4A3M G;  3GTM H;  4C3I G;  1FGB D;  3CQZ H;  2A8V A;  5JPM C;  2YU9 B;  3FRP B;  3J81 c;  1IL8 A;  4DGZ A;  1IYU A;  2R93 B;  4JI5 Q;  5E7N A;  1JR0 D;  1TKW B;  4LMQ D;  1V8Q A;  1AN8 A;  1QCB D;  4TSS A;  4DV0 Q;  3BZK A;  3MFG A;  3P75 A;  2RHQ B;  1NUC A;  1SN8 A;  3KFU A;  1W6K A;  3TDQ A;  1L1O A;  2NTS A;  2I5H A;  3RZO B;  2RCN A;  4TVA B;  4IUR A;  3BVZ A;  5M5Y H;  5M5W H;  1CM9 A;  5J1Z A;  1A3U A;  4DAY A;  2QEJ C;  3NE5 B;  2Z8L A;  3SE0 A;  1GO3 E;  4B9X A;  3HEJ A;  2R7Z H;  4NMZ A;  3SR1 A;  1LAB A;  4BBS B;  4RAU C;  2E2J B;  2VL6 A;  3DWQ A;  2F0H A;  1STH A;  4YHH Q;  1MJC A;  1CUK A;  2E2H B;  4C2M B;  4MZ9 A;  4RH6 A;  2NVQ H;  2FMM A;  3ZJY C;  1G6Z A;  5JEA G;  5KND A;  4DUY L;  3EJI A;  2XN9 C;  2VB2 X;  1Q86 C;  2K28 A;  3GTJ B;  2HCC A;  3L7Z C;  2AWN A;  2B2T A;  3S17 B;  2QEX A;  1QNU A;  3CC7 A;  2Q2T A;  3S14 B;  1OTC A;  2FXQ A;  5DNF A;  2L4N A;  4RHS A;  3B6Y A;  1K8O A;  1IHZ A;  1PVO A;  3HOX G;  2DNC A;  2NUC A;  1G91 A;  5COY A;  4ME3 A;  2F0D A;  4N8X 1;  2E74 C;  4DV6 L;  2PO4 A;  2ZM6 Q;  4UDU C;  4JCV E;  3DWP A;  4UY8 C;  1QE6 A;  2G5D A;  4X64 L;  1G2T A;  4RWS C;  2VXW A;  3LWU A;  2JA7 B;  4WJ3 M;  1E2V A;  1TVX A;  2ICI A;  4X3S A;  2DNE A;  3S2H H;  2JA6 B;  2D0O A;  2A6H C;  3H3V C;  3CCR A;  1CKN A;  1ASZ A;  1EY5 A;  3HOV H;  4ZUJ A;  1PH3 A;  4BXX H;  1Y8N B;  2CH4 A;  4OEL B;  3M4O H;  5IOC A;  1WYD A;  4MIU A;  4KHV A;  3CCV A;  1ENF A;  1UWV A;  1Y1V G;  4K8I A;  4DK6 C;  2B2V A;  3C2P A;  3HS0 C;  3T13 A;  2QIL A;  4NW2 A;  3I4M G;  1LT6 D;  3CCM A;  4JVZ A;  2BA0 A;  4LW1 A;  4DN4 M;  4HID A;  2JP1 A;  2PI2 A;  4A3M B;  3GD7 A;  3ND8 A;  5C3E H;  4K6L A;  4C3I B;  2F0W A;  1VQ7 A;  1PLF A;  1HR0 Q;  2K5V A;  2ATW A;  1PYB A;  1O7Z A;  3W2D A;  1XTC D;  2J4X A;  3P1H A;  1MHW C;  5IOD A;  2ICE C;  2WIN B;  1PFB A;  2DUD A;  5CV8 A;  1GVP A;  1SFO H;  2A6H D;  4NDX A;  4ZRZ A;  4L6T B;  5JVH 3;  1XX8 A;  2LY7 A;  1XNR Q;  5JOB A;  4BY7 G;  1V43 A;  1ASY A;  2UXB Q;  3U4V A;  2R61 A;  1Q1B A;  4RGM A;  4EQN A;  1N9W A;  4C56 C;  4LF7 Q;  1EIH A;  1VCI A;  3ERS X;  1DJR D;  5CR3 A;  3PO3 H;  3SK5 A;  5HGT A;  3MVV A;  3VYR A;  3H94 A;  4LUV A;  1TWH B;  4A3D G;  3FDT A;  1XMO L;  1TS2 A;  1WI5 A;  2NYZ D;  3PIO 3;  5C4X G;  4KKS A;  5KIX A;  4GN4 B;  1CTM A;  1N33 L;  3WWV A;  5GQO A;  4A93 H;  1SNO A;  4JBW A;  4CDC C;  4IUV A;  4K5V A;  1SR3 A;  3E9H A;  4OO1 H;  2EOT A;  2QCP X;  4OGQ C;  5IP7 G;  5GAG C;  1TU2 B;  4Y7N H;  2KA7 A;  3F2B A;  2KEE A;  3ERO A;  4C3H G;  1DOK A;  3HZX A;  5EQ0 A;  5G3L F;  4P74 A;  2EY1 A;  4JG2 A;  3X3N A;  2NZO A;  1S5B D;  1L1O B;  4LAA A;  2K1B A;  1IBK L;  2UXC Q;  5F2D A;  5IGB A;  1PZJ D;  5NUC A;  2MO1 A;  3SVM A;  2AQ2 B;  4LF8 L;  2UU9 Q;  5E4X A;  3PF4 A;  3D4R A;  3MXG A;  4DAY B;  4R1J A;  4OEM B;  3F2U A;  4DAP A;  4L5S A;  3RR5 A;  5C5M A;  2BH8 A;  1PH4 A;  1CHQ D;  3HOY H;  2Z4H A;  4JOI A;  2BCO A;  2IY5 B;  2A74 C;  2EXZ A;  1EZ8 A;  2WV6 D;  5BR8 L;  1VQ5 A;  1KNA A;  1WVL A;  3HOU H;  4H0L C;  2NN6 G;  2K05 A;  3RZD H;  4DR6 Q;  3I4N H;  1OXU A;  3BDL A;  1PTO H;  3E9I A;  4YIJ A;  1EFI D;  1GUW A;  4JI7 L;  5IGE A;  5FJ8 G;  4A3C H;  1CKO A;  4BS9 A;  3NPP A;  5C0X I;  3SDZ A;  4P71 A;  1K3R A;  1Q3L A;  5DAU A;  1Y1V B;  1NBW A;  2JA8 G;  1GOZ A;  5IP9 H;  2A6E C;  2EJF C;  1FNV A;  3I4M B;  1EY7 A;  5A2Q E;  1EZ6 A;  5KGU A;  2M9V A;  5HGQ A;  1KL9 A;  3CKI B;  4LUZ A;  1STA A;  2F03 A;  1F9R A;  4LF6 Q;  4IQZ A;  3I4O A;  4DFA A;  4DV1 L;  1I4G A;  1PFN A;  2RKS A;  2XSC A;  4LF5 Q;  2B63 H;  4IUP A;  4A3J H;  1NTG A;  4UP7 A;  4ZKC B;  2KCM A;  2RF4 A;  2WAC A;  1MJE A;  1KDB A;  1SYD A;  1A63 A;  1WTQ A;  4DV4 L;  5M5X H;  1SJE D;  1SXT A;  4G7H C;  4LFC Q;  1K8G A;  2SDF A;  1GHK A;  4DU9 A;  4FYD A;  1QOH A;  1D5M C;  4BY7 B;  5D65 A;  4GZY C;  1E0B A;  1DXM A;  1CKN B;  2QGQ A;  1SDF A;  4KN7 C;  4B3R Q;  3KLR A;  2H5X A;  1EIY B;  2SEB D;  2A6E D;  1MI2 A;  1S72 A;  3J81 L;  1CQF A;  1JWS D;  2E5L L;  1JWM D;  2RA4 A;  2M00 A;  3Q0A A;  4IAL A;  3NQI A;  4K2L A;  3OWE B;  4Y52 H;  2Z6B A;  2CWP A;  4OX9 Q;  2ALY B;  4U67 3;  4UP9 A;  1GD7 A;  3SHL A;  3QG1 A;  4QCL A;  2O2L D;  2A19 A;  2CVR A;  2KQ3 A;  2IPK D;  1VQA A;  2F0K A;  1VQD A;  5IT9 c;  3I56 A;  1S5F D;  4XQJ A;  5EKL A;  1LTA D;  1AEX A;  2F0V A;  3MTS A;  5FOB B;  1TT2 A;  3ULP A;  2F0E A;  1I4P A;  1S3O A;  3D4D A;  4GLV B;  3K59 A;  5LMN W;  4ZYS A;  3VYU A;  4CGY B;  1UE6 A;  3CQZ B;  4RFB A;  3S9W A;  4PMC A;  1S5C D;  1HFG A;  1SE2 A;  2KCC A;  4X65 Q;  4UHV A;  2YTY A;  3G4S A;  4RGN A;  1II3 A;  3V96 A;  3KJO A;  2R92 H;  1Q81 C;  4A3F G;  3A56 A;  3K57 A;  4HJ7 A;  4FXD A;  2NZ1 D;  1BQQ T;  1NSN S;  5LMU Q;  1H95 A;  5C4J H;  1STN A;  1NMG A;  4GKJ Q;  4CBV A;  1FD7 D;  2EYH A;  3I90 A;  3PSI A;  1KDC A;  3GTG H;  4KHZ A;  2VQF L;  1CI3 M;  1KDA A;  2Z0S A;  1D5Z C;  4ILW A;  2B2U A;  2A73 B;  3Q23 A;  3T1Y L;  1GUS A;  1L1O C;  1DD2 A;  3KUP A;  4JW0 A;  4DUZ Q;  2NB0 A;  3CW2 C;  4O42 A;  2JA8 B;  4XT1 B;  4FVM A;  5KYL A;  1D1K A;  1P16 A;  3SXH A;  1HNX Q;  3K58 A;  1WJJ A;  4RKB A;  4JYA L;  3GTK B;  1CSP A;  3T4A C;  1SSO A;  3AYH B;  1M90 C;  2XGT A;  4H13 C;  4DV3 L;  2MQH A;  4DK1 A;  5JAV A;  1C0A A;  3OHX C;  1DYQ A;  1KHI A;  2EY6 A;  2WII B;  5EBC A;  3C1E A;  5JEA J;  4A3K H;  2WB1 G;  4KHP Q;  2L12 A;  4DR4 L;  3RN5 A;  4I7Z C;  2N55 A;  4BBR H;  1SNM A;  1K83 H;  5GRO A;  3D4W A;  4HCE A;  1HQR D;  1N8R C;  2P5Z X;  3UDX A;  2SOB A;  2HCI A;  1OXV A;  1BCP B;  3JAM c;  4K14 A;  4OON A;  4ZCK A;  2HUG A;  1WCM G;  4PZ8 A;  1X56 A;  2N88 A;  3FHW A;  2K14 A;  3MXN A;  2IX3 A;  2K33 A;  1JWU D;  1OXT A;  4LFB Q;  1NCV A;  1SND A;  2Q8I B;  1MSG A;  1STB A;  1TY0 A;  4PG3 A;  3O13 A;  1U4P A;  1IXR A;  1BNZ A;  4R8I A;  1I4X A;  1PRT B;  1A3T A;  1BBX C;  3C3L A;  1I94 Q;  4DV2 Q;  2WKD A;  3OIP A;  3R8B A;  4DV7 Q;  1LTS D;  1IBL L;  1SYG A;  2UUB Q;  4J6H A;  3OOC A;  2F4I A;  2PNH A;  2EJM A;  1CFM A;  2CH4 W;  3KBX A;  2ZJP A;  2VS1 A;  3W3A A;  3PIO A;  2OQK A;  5KRU A;  3PGZ A;  2A1A A;  2Z9H A;  3NBH A;  1Q90 A;  4MTN A;  2KED A;  4HJ9 A;  2ES2 A;  3CC2 A;  4CKE A;  2B2V C;  4XTC S;  1JC7 A;  4A3B G;  2PZT A;  3D3R A;  3T56 B;  4A3F B;  1DON A;  4HJA A;  1B50 A;  4JI2 L;  1SFO B;  1VS0 A;  1SYC A;  3RLF A;  3K5N A;  3M3Y B;  2R7F A;  3S2D B;  1AE2 A;  4QIW B;  2FFK B;  1EFW A;  4HMI A;  2MUY A;  3VA5 A;  1Z7T A;  3HOZ H;  5FLX c;  5EAY A;  2N78 A;  4DKA C;  3E5S A;  1QVG A;  1Y1W G;  3BYT B;  2O4X A;  4EGV A;  3ZYY X;  1SYB A;  5FLX E;  1EY9 A;  2F0N A;  1HR0 W;  2CW0 C;  2F4V Q;  3PUZ A;  3QJY A;  4IFD H;  4A75 A;  4JI4 L;  4JI1 L;  1TWA H;  1VQ4 A;  1EU4 A;  4DV6 Q;  2RSN A;  5C44 H;  1PH1 A;  2MGS A;  1I6H B;  3MEF A;  5K36 G;  2OTL A;  4EX5 A;  2K5N A;  2Z1C A;  4QL5 A;  5FK9 C;  3M7N A;  4TKO B;  5M9O A;  2A68 C;  1I3Q H;  1LAC A;  4KY5 A;  5KNB A;  3NHH A;  1I6V C;  5JVG 3;  1X55 A;  1XTD A;  3H15 A;  1K28 A;  5HUR A;  4AYB E;  3S1R B;  1X3P A;  4B3M L;  4TRD A;  3OW2 A;  2VUM G;  1GJX A;  3TSS A;  5A2Q L;  2VB3 X;  4QQB X;  5I9P A;  1AP0 A;  4IUT A;  3PO2 H;  2QA4 A;  3SK4 A;  5KNC A;  1IL2 A;  1K0R A;  1I50 H;  2CW0 D;  3A5Z B;  3AQQ A;  2ZXO A;  2WB1 B;  1C9O A;  1XNQ L;  5FLM H;  1PFS A;  2D62 A;  2KHI A;  3J81 i;  5BN5 A;  1PMR A;  1T5X D;  4LFA L;  4XXE A;  4JI0 Q;  2F1M A;  4UPA A;  2OTJ A;  1N34 L;  3W1B A;  1VQI A;  2A68 D;  3HKZ E;  1WCM B;  4N8F A;  1O7L A;  3GV3 A;  2HIX A;  2L5T A;  5ELE A;  1KQS A;  3RZD B;  4JK1 C;  1GUO A;  5IYB G;  2CKZ B;  4G4K A;  4QGU A;  2VQE Q;  1G29 1;  3QOJ A;  1PTO B;  3NEN A;  4L5T A;  2CHB D;  4L5Q A;  4HIM A;  4JOI C;  1TII D;  2PPB C;  1Z9F A;  3DWA A;  2NVT H;  3DEO A;  4QJF A;  4R4O A;  2J7Z A;  3DLL A;  2IWH A;  4ABN A;  5IWA Q;  2YTV A;  4KKT A;  4BY1 H;  1N33 Q;  4OO1 I;  3BZD B;  3K6O A;  3GTO B;  3T51 B;  5M3F G;  4F87 A;  3R2I A;  1EYC A;  1EEF D;  2K03 A;  1EWC A;  1BCP C;  5I2X A;  3EN2 A;  3DXJ C;  3QO2 A;  5C4H A;  4A3B B;  5IT9 L;  2F0Q A;  1KD1 C;  3TN2 A;  3MXN B;  4JV5 L;  3E3X A;  2BDN A;  3TS2 A;  5FO7 B;  1Y8O B;  1EQQ A;  1NR2 A;  1WOC A;  3KLS A;  3CCU A;  3MEH A;  1PRT C;  1EY6 A;  2IHE A;  1TQO A;  3V2T A;  5C0X G;  3M85 A;  1GUT A;  1Y1W B;  4LF8 Q;  4K6D A;  2XWJ B;  3M4Q A;  3R93 A;  1HPC A;  4RMF A;  2K5H A;  1PZK D;  4WOR A;  3OMG A;  2HHH Q;  1EL0 A;  3DUZ A;  4HR7 B;  5I6Y A;  5JJL A;  5IYD G;  1BCP D;  1JE4 A;  1A15 A;  3UE1 A;  3P20 A;  3J80 E;  3L2P A;  4OHJ A;  1EOV A;  4XIG S;  3RMH A;  5BR8 Q;  3NBH B;  2OWO A;  1O80 A;  2L55 A;  1HRJ A;  3SEB A;  1E1T A;  1ICW A;  4YWL A;  3H0G H;  1PFM A;  1I4H A;  1WTW A;  4OIK A;  4JI7 Q;  1U5K A;  4X66 Q;  1SE8 A;  1JOK A;  4A3E H;  1PRT D;  2I07 B;  2VUM B;  3TBI B;  1TS5 A;  2J0T D;  2OT2 A;  4MNO A;  1W2B A;  4YWK A;  2UUA Q;  3E0J A;  3K7A H;  3Q6S A;  3PUW A;  4ZUI A;  3DM1 A;  4YCW A;  2RDH A;  2ZXR A;  5AJ3 Q;  1MBY A;  1Z47 A;  1IBM Q;  5IGC A;  3J7A 5;  1JJG A;  4L63 B;  2E2D C;  1RD9 D;  4DV1 Q;  2KUM A;  1OXX K;  4LK1 C;  1BVS A;  1V1O A;  1X32 A;  2TSS A;  2JA5 G;  3A5U A;  4DV4 Q;  3N52 A;  3C1F A;  4DNR B;  3CHB D;  1XYI A;  3P7J A;  5CV9 A;  3FVQ A;  3TME A;  3S1Q H;  2EY2 A;  3NTH A;  2F3V A;  3C46 A;  4KD4 A;  4NXN Q;  2V4D A;  2VW9 A;  1MGS A;  3OMC A;  4J1M A;  4ZK9 B;  2UUC L;  2Q2I A;  1JT8 A;  3BJU A;  1JJ2 A;  4CHT B;  5DEH A;  4DR2 L;  1CKM A;  5KYI A;  1EY4 A;  2I0Q A;  2RVL A;  3GTP B;  4YY3 Q;  4IUN A;  3JAM L;  2OF1 A;  2F0G A;  4G7Z C;  2EDG A;  4IPD A;  1SAP A;  5IIF A;  4Z9C B;  2BH2 A;  1VQ6 A;  2B2U C;  2GA4 B;  1W6J A;  2K01 A;  3IFD A;  5M3F B;  3BDC A;  2Y0S E;  3NWT A;  3CCL A;  4B3T L;  1CSQ A;  1F2M A;  1CK1 A;  3HOW H;  3S16 H;  3AFQ A;  4JI6 Q;  4GOP A;  1TWF B;  3PCO B;  1ET9 A;  1SEB D;  3A7A B;  2EYL A;  1J8I A;  1B70 B;  5GAE C;  3G7L A;  1TWC B;  1KXL A;  4I65 A;  1PTO C;  1UEB A;  1R4Q B;  2KEN A;  2PMZ B;  4BBR B;  4FO2 A;  2K5D A;  4ME5 A;  2MPM A;  1S5D D;  3H6M A;  2QKI C;  3FKI H;  1N36 L;  4DR1 L;  4A76 A;  4H7B A;  4A3I G;  2PYK A;  3TZU A;  3M4Y A;  4PQX A;  3JC6 6;  4JI3 L;  3D6C A;  4A3G G;  3S15 B;  4GLA C;  1N32 Q;  3BYY B;  1RDP D;  3S1N B;  2K6A A;  3VR6 A;  4IOC A;  4PMW A;  1HH2 P;  1VQ9 A;  5FLX L;  4LF9 L;  4DR7 L;  2H4O A;  5E1F A;  3TRE A;  5TSS A;  4R4T A;  4CKC A;  2OEO A;  4DV0 L;  3H3V H;  3T1Y Q;  2FJ2 A;  2AUJ D;  3MHB A;  2Z6K A;  2EYF A;  3UDF A;  1B53 A;  2NVX H;  2N3S A;  1QVC A;  3IRB A;  3GTL H;  1HZ9 A;  1JE5 A;  1E7Z A;  4HSV A;  4KJO A;  1LTI D;  1EU3 A;  3A74 A;  3UI2 A;  1V1Q A;  3OWF A;  3MC0 B;  1R9T H;  1WD1 A;  1SNC A;  4PNY A;  1NY4 A;  4UAI A;  2JEA I;  4Q5V A;  4X6A H;  3T53 B;  1EYG A;  2BDO A;  1JMC A;  1PH2 A;  4ODG A;  4HED A;  2R6G A;  3U9S A;  2KCN A;  4QUF A;  1A3V A;  1UAP A;  5EPL A;  4DV3 Q;  4X62 L;  4G7O C;  2Q2U A;  2PQA A;  1BR9 A;  4KN4 C;  1H9R A;  1TWG H;  5GAD C;  1B1Z A;  2JA5 B;  1ROD A;  3LGJ A;  4YHH L;  5T1I A;  4ZLT F;  4DF7 A;  4DR3 Q;  1EY0 A;  1HXY D;  2ZTD A;  5EPK A;  1QWY A;  2K5Q A;  4IOA A;  5BN3 A;  2B39 A;  1SNQ A;  2R7Z G;  3D0F A;  1LV9 A;  2Q8R E;  1C48 A;  3D6W A;  1V9P A;  1PH8 A;  2KEC A;  4CDF C;  2JXM B;  3KBG A;  3S1M H;  3VYT A;  2NWG A;  4B3S Q;  1WTP A;  2SNS A;  4HN7 A;  1U4M A;  1E2Z A;  1JB7 A;  2KCT A;  4XYQ A;  1U9R A;  1STE A;  2DN8 A;  3EBE A;  4ZQ3 A;  1QG7 A;  2WAQ E;  3A54 A;  3BDO A;  1BF4 A;  1D8L A;  3NTI A;  3V05 A;  1I3Q B;  3FP9 A;  2YU9 H;  2L0C A;  4GKK L;  4C3J H;  4X3K A;  2R93 H;  1SMY C;  1J5E Q;  3GTQ B;  1FVI A;  2L9H A;  4IUQ A;  1VQK A;  4PZ6 A;  2GVB A;  3CPF A;  1NE3 A;  1KRS A;  2OCE A;  4DV5 Q;  3TS0 A;  5ISR A;  1U0L A;  1RKN A;  2IW3 A;  5C5L A;  3NTK A;  3OTO L;  3RZO H;  2ENB A;  2BOS A;  5IGF A;  2C5C A;  4J8Q A;  3GV6 A;  3RUZ A;  4IZ8 A;  4A3I B;  4HIK A;  1PHJ A;  4DR5 L;  3J7Z C;  3HOV G;  3QR8 A;  4BXX G;  2E2I B;  2HIV A;  2NVY B;  4A3G B;  4BBS H;  2E2J H;  1YNJ C;  4POG A;  4ZAI A;  5IYC H;  1DCZ A;  1B9M A;  2E2H H;  2K4K A;  1EWH A;  3PUV A;  4C2M H;  2EXD A;  2JE6 I;  2R7D A;  5ELF A;  1FJG L;  3FMC A;  5LHY 1;  2KHS A;  4KTA A;  4GOP B;  5DM7 3;  4IFD I;  3AU7 A;  2B8G A;  2LS0 1;  5C3E G;  3GTM B;  2I5M X;  3RLN A;  4K2K A;  4XQN A;  4DPG A;  3GTJ H;  1ICF B;  1KAB A;  5J22 A;  4JI1 Q;  4HMJ A;  1Q7Y C;  1L0X B;  3BG3 A;  1XNR L;  1H9S A;  4ULL A;  1Q8I A;  4KY6 A;  3S14 H;  3G6E A;  5DM6 3;  4FF4 A;  1SJH D;  3A8I E;  3NXW A;  2ZT9 C;  4GNX A;  2NBF A;  3HOW G;  2EYO A;  3BVG A;  3DEP A;  2F0I A;  1M4V A;  1FYC A;  4BA2 I;  4A3L H;  1YNJ D;  3MAQ A;  4DNT B;  1EYA A;  3CC4 A;  3PO3 G;  5M5Y B;  1HUN A;  1H9M A;  4H44 C;  5M5W B;  1F9S A;  1MIU A;  1QJO A;  5ELC A;  1RHP A;  2GVA A;  2F3W A;  2JA7 H;  5EKI A;  3HGB A;  1XPO A;  2JA6 H;  1D5X C;  4V19 0;  1XNQ Q;  3SK8 A;  4B08 A;  2KOL A;  2R7Z B;  4AQY L;  2KVM A;  4LFA Q;  1E24 A;  4A93 G;  3MXP A;  4OO1 G;  1CT1 D;  1ENA A;  2RDG A;  2KHJ A;  3RLO A;  4JI8 L;  3KDF A;  1N34 Q;  4K5W A;  4YCU A;  3U4Z A;  3RNU A;  2NVQ B;  5C0X J;  4CDD C;  1BUV T;  1HNZ L;  1BCP F;  1LM0 A;  4A3M H;  1K0S A;  2ZXP A;  1EIG A;  2UU9 L;  3E0E A;  3E6Z X;  4C3I H;  2DY7 A;  2F0U A;  1JOR A;  1IZ6 A;  4FNF A;  5M3M H;  1Z6H A;  5CYU A;  1L0Y B;  1PDQ A;  3VYS A;  4NKL A;  4IO9 A;  2ID0 A;  2PQA B;  2FMC A;  4MN3 A;  1PH7 A;  1JIC A;  3LNN A;  1PRT F;  1YHQ A;  1JCK B;  1O7I A;  1VQL A;  5LL6 S;  1B8A A;  2LXJ A;  3DHQ A;  4GLX A;  3PIP 3;  3TZD A;  4X3U A;  3K81 C;  3HOY G;  2MO0 A;  5H1S E;  1T5E A;  4OWT B;  4YCV A;  5CBE E;  4I7A A;  3I4L A;  5JJI A;  1TWH H;  3A0J A;  2V1C C;  3HOU G;  1VQG A;  2IL8 A;  3L9A X;  4QUC A;  4OWX B;  1DGS A;  3I4N G;  3S2H B;  1OXS C;  4LJZ C;  2PW5 A;  3HOV B;  2K75 A;  2EY5 A;  3S1Q B;  3RD4 A;  1O7Y A;  3K5L A;  3M4O B;  5L37 A;  4A3C G;  3WDN A;  3A55 A;  4A4I A;  4EQO A;  3J7Y W;  5IP9 G;  5COR A;  1HHV A;  1P8L A;  4LF5 L;  3ERQ A;  2IJ0 A;  5JEA H;  4L5R C;  2XWB B;  4UP8 A;  2B3G A;  5C3E B;  1ESF A;  3VDY A;  1HZC A;  4YWM A;  5T1G A;  2B63 G;  3PUX A;  4A3J G;  4DUY Q;  1VMC A;  3F8T A;  4K0K L;  3PF5 A;  2EYP A;  2PQE A;  1DOM A;  3PQI A;  4E6I A;  5A35 A;  2K50 A;  4AIM A;  2D2C C;  3HOW B;  3HOX H;  1SYF A;  1K73 C;  1HZA A;  1SBB B;  1X65 A;  1CA5 A;  2ZJQ A;  3NSW A;  2AMC B;  5J3B A;  3PO3 B;  1B44 D;  3CCS A;  1UE1 A;  4RA8 A;  3IAY A;  2HQL A;  1HNW L;  4RHR A;  2G9H D;  4GOP C;  1LO5 D;  1PV4 A;  1EQV A;  4HJ8 A;  1TR5 A;  2IHF A;  1AH9 A;  2XRS D;  4EVO A;  4X64 Q;  1EQT A;  1UE7 A;  3I8Z A;  1RF2 D;  4A93 B;  3UDI A;  5ELO A;  1Y1V H;  5EJW A;  1H9S B;  5I9O A;  5J39 A;  1KC8 C;  2XNA C;  4Y7N B;  3CRL C;  4LUO A;  3I4M H;  4GNX B;  1QZG A;  2MHV A;  4OIJ A;  3GP7 A;  3W5O A;  3CAM A;  2AUK A;  2IX1 A;  3H09 A;  3CPW A;  4KY7 A;  3F1Z A;  2RHS B;  1PTO F;  5LMU L;  2O5J C;  1KTK A;  2LKV A;  2F0J A;  3GTL B;  1BBW A;  1DM0 B;  3I73 A;  2R92 G;  2F0M A;  4BY7 H;  4HIO A;  1X54 A;  2N49 A;  3X3M A;  1SRU A;  3HOY B;  1GHJ A;  3L0O A;  2Z6K C;  3CMA A;  5JJK A;  2LFN A;  2L1B A;  1VQO A;  1SLJ A;  1JOO A;  1VQJ A;  1YEZ A;  3HOU B;  2JK8 A;  4A3D H;  3KDF B;  1G8Z D;  5EBD A;  3I4N B;  3AB9 A;  5C4X H;  5C3W A;  1YIJ A;  1UE5 A;  2QW7 A;  4KKU A;  4AH6 A;  5FO9 B;  1XJV A;  2C9O A;  3NP8 A;  2B2Y A;  4XQQ A;  1XMO Q;  5I2Y A;  5IP7 H;  4PZ7 A;  1N36 Q;  1ZEQ X;  3A8K E;  4C3H H;  4JBJ A;  4EQ5 A;  4LF4 L;  2JQO A;  1FL0 A;  4P72 A;  1XMQ L;  2EPB A;  3VR3 A;  1H9J A;  4JI3 Q;  1YNX A;  4KHP L;  2B63 B;  2PI2 E;  1JOQ A;  3K8A A;  3KLW A;  1A62 A;  3DM3 A;  2JYO A;  2KBN A;  1LT4 D;  5CBA E;  4A3J B;  2DJG C;  2JJQ A;  1RJT A;  3T16 A;  1Q8K A;  4C3J B;  5M3M G;  1YJW A;  1ZXT A;  5M5X B;  4LF9 Q;  4XT3 B;  2TMP A;  5D14 A;  4DR7 Q;  1X3E A;  4A3K G;  4XYO A;  3H3V I;  2B8F A;  2GN5 A;  3TP8 A;  1IBK Q;  1AE3 A;  1J9O A;  2LMC B;  2RDF A;  3A7L A;  4BBR G;  3M7G A;  1LUZ A;  3J81 E;  5CV5 A;  1EIF A;  1LYL A;  2QF7 A;  3D8G A;  4P75 A;  3S24 A;  4N9P A;  4LNQ A;  4RCO A;  3T1H L;  2A5H A;  1FGU A;  2XTI A;  3IL8 A;  4LFB L;  1RCV D;  4LWC A;  3J80 c;  3I7F A;  1FNU A;  3TP5 A;  2NN6 H;  4FF2 A;  1KNE A;  2CFM A;  4XDX A;  3KF6 A;  3TEH B;  1I94 L;  1HTP A;  3BVM A;  4DV2 L;  2JEB I;  4H02 A;  3CCJ A;  4DV7 L;  3KF8 A;  1ONL A;  4NXM L;  2F3I A;  3QIA A;  4O2D A;  3UDG A;  5FJ8 H;  2UUB L;  3GQB A;  1SMX A;  1RL2 A;  3Q24 A;  5CV7 A;  4KMU C;  2JA8 H;  1SNP A;  4X62 Q;  1XPU A;  4KK7 A;  3Q8D A;  4JBM A;  1AFP A;  1Q12 A;  3QOL A;  1EQR A;  2AQ1 B;  1LT5 D;  4R9W A;  3EFX D;  3M9B A;  4CKB A;  1TS3 A;  2ZTE A;  1XWE A;  3I3C A;  1GUG A;  4WRD A;  1WTR A;  3GTK H;  1G6P A;  2JA9 A;  2RCF A;  4WFN 3;  3LWE A;  3TQY A;  4BA1 I;  4QF4 A;  5ELD A;  1EWI A;  1BBU A;  5CV4 A;  3TRZ A;  4CJ2 C;  5IE8 A;  4EQP A;  1DOL A;  1NJI C;  2VY3 A;  1GM5 A;  4R4C A;  1ZYR C;  5ELB A;  1W3S A;  3HRZ C;  5JPN C;  3SGI A;  3CF5 A;  2R92 B;  1HCZ A;  1K8A C;  5E4W C;  3KYH C;  3PUY A;  2PW7 A;  3OW7 A;  3J81 j;  2C35 B;  4GKK Q;  3I55 A;  2YYZ A;  2A69 C;  1GKH A;  3R2T A;  3HOZ G;  2F4V L;  3BS1 A;  5C4J B;  1CQV A;  1TXY A;  1EEI D;  1K8M A;  2FHT A;  1YIT A;  2AWO A;  4X3T A;  3ICE A;  4GNX C;  1PA6 A;  1O78 A;  5EPJ A;  4OXP A;  2B29 A;  2VZA A;  3GTG B;  4RCN A;  1S4Z A;  2LSS A;  4AYB G;  1VQF A;  3DMU A;  4J15 A;  2QDB A;  1E2W A;  4OL7 A;  1F9P A;  1NR4 A;  2Q8T A;  2G9D A;  4IFD G;  2K52 A;  3OTO Q;  2Q2H A;  5CV6 A;  5C44 G;  3HG9 A;  2E5L Q;  5CMD A;  3KLS X;  1ET6 A;  1X6O A;  1K3B C;  3PIP A;  2O5I C;  1R4P B;  1CA6 A;  1SE4 A;  1T9H A;  2B2W A;  1ZYR D;  1MD2 D;  1YVC A;  4RG1 A;  4QMG A;  2YTX A;  1SE3 A;  4DR5 Q;  4IJL A;  2HQE A;  2A69 D;  2K7V A;  1KAA A;  4ZKB B;  3PMF A;  4DAM A;  4IJH A;  3HKZ G;  5LMN L;  2EE1 A;  3STB C;  4RKL A;  4JI0 L;  3R3O A;  3MWY W;  5M3M B;  3AEV A;  1FJG Q;  1VMP A;  1FNW A;  3PO2 G;  3W1G A;  4V0B A;  2BA1 A;  2HD3 A;  1IKL A;  4P73 A;  1E22 A;  2M2L A;  3TP7 A;  4A3K B;  5FLM G;  1UUP A;  2X6G A;  4A3F H;  3NEL A;  1K83 B;  2Z4I A;  1C7Y A;  1WFQ A;  1JB3 A;  3M3Y H;  1B3A A;  1VQB A;  2PNR C;  4F88 A;  3S2D H;  4APV A;  2XIW A;  4B9W A;  3LX0 A;  2PZU A;  3TP6 A;  1HTL D;  2UXD L;  1X3G A;  2VQE L;  1WTO A;  1YHA A;  2F52 A;  4O1N A;  1I4Q A;  3GO5 A;  1J6Q A;  5FKA C;  5JJZ A;  3Q22 A;  5KEE A;  1VF5 C;  4HJ5 A;  4DXG A;  1I6H H;  3STB D;  5IWA L;  4JI5 L;  1VQP A;  4Q0F A;  4QIW E;  4IPH A;  3ND9 A;  2VQF Q;  1EY8 A;  1PTO D;  1OO9 B;  2OXP A;  2YV5 A;  3S1R H;  4BY1 G;  4AQY Q;  5GAH C;  2EJG C;  4DK0 A;  5C6A A;  2D9U A;  3KK7 A;  5IGG A;  5EGT A;  3K80 C;  4JI8 Q;  1B3Q A;  2AHO B;  2ZTC A;  3OSO A;  4FP5 D;  3J7A V;  1HUM A;  3G48 A;  4JYA Q;  2MP1 A;  1V1P A;  1HNZ Q;  4FF1 A;  1STY A;  3KF6 B;  1E3P A;  4L8J A;  3NUC A;  4F7X A;  2HT1 A;  3HOX B;  1GUN A;  3HOZ B;  3KF8 B;  1K9M C;  1PH5 A;  4WJ4 A;  2HHH L;  4DR4 Q;  3I91 A;  2JN4 A;  1EYD A;  1LTT D;  1WCM H;  2F0T A;  4IUU A;  1YI2 A;  4CJ1 B;  3KJP A;  4AYB B;  4DXF A;  4DK3 C;  2E75 C;  2EZV A;  1VQM A;  2I46 A;  3U9O A;  4F8M A;  2WB1 E;  4M8A A;  1TWA B;  1B9N A;  5C44 B;  4N9T A;  3MFY A;  4X66 L;  5I6W A;  4R4Q A;  3U58 A;  1LTB D;  1M8A A;  1LLR D;  3J7A F;  1F2L A;  4PV1 C;  1H9K A;  2PCF B;  2UUA L;  4RGT A;  3H0G G;  1X9N A;  4MTK A;  1C8C A;  3GTO H;  2QDL A;  3NWS A;  3I70 A;  2ZM6 L;  4A3E G;  2IX0 A;  4CDE C;  1IW7 C;  2AKW B;  1IYV A;  5AJ3 L;  1CZG A;  3HKZ B;  2F0P A;  1IBM L;  1IBL Q;  4DNI A;  3N6R A;  3EIV A;  3PO2 B;  1NNX A;  1X3Q A;  2CQO A;  2N8N A;  1F77 A;  4A3B H;  1I50 B;  5C3X A;  2X69 A;  2I5L X;  3PV0 A;  1CHP D;  4IPG A;  2E76 C;  1A0I A;  1A2T A;  1BKB A;  4HTH A;  3CP0 A;  4JBK A;  1D7Q A;  4NXN L;  4GN3 B;  3K5M A;  4K0K Q;  1Y1W H;  4R8N A;  3M4P A;  1M1K C;  4JI2 Q;  4QB4 A;  1I4R A;  4S3S A;  1ENC A;  2K5W A;  2ASB A;  1SMY D;  4JC0 A;  4A3D B;  1PXU A;  2ZJR A;  4YY3 L;  4FXG C;  1HR0 L;  1HQM C;  2Y0S G;  5C4X B;  1IW7 D;  4KD3 A;  2WP8 J;  2CQA A;  3IKJ A;  2E8G A;  1I5F A;  5K36 H;  1TS4 A;  3CD6 A;  3URY A;  1HNW Q;  1VF7 A;  2NVT B;  3WOF A;  3AMU A;  3J80 L;  4JI4 Q;  1Q46 A;  3H91 A;  3S17 H;  3K0Y A;  4JI6 L;  1WD0 A;  2UXB L;  1VQH A;  4BY1 B;  4C3H B;  3VA7 A;  4LF7 L;  1QNK A;  1VQE A;  2VUM H;  3U50 C;  2DGY A;  2FIN B;  4DAV A;  1WTH A;  2B2Y C;  5IT9 E;  2L11 A;  1D2B A;  2F0S A;  1D1I A;  2EQS A;  2K32 A;  1EOT A;  2R3Z A;  4B3M Q;  1YJN A;  4POF A;  1STG A;  1KIX A;  1BDO A;  3F2D A;  4KV6 A;  2IT1 A;  3EA6 A;  2JSO A;  4ID6 A;  2X6L A;  1XXG A;  1PH9 A;  1N32 L;  3CU7 A;  4MHE A;  3D31 A;  3FKI G;  2F0F A;  2RSO A;  3FPP A;  1BXT A;  4WJW A;  4U68 A;  4PMB A;  3GDE A;  5AFW A;  3JAM i;  1A8V A;  1VDZ A;  4FXK C;  1HJP A;  3CRK C;  1AW7 A;  1LT3 D;  1U4R A;  3NEM A;  4RGO S;  1NAP A;  5IYB H;  2UXC L;  3UE0 A;  3KOJ A;  4K8J A;  3ER0 A;  4NPS A;  1VQN A;  4JPB W;  3AFP A;  3GTP H;  4P2C B;  1KLG D;  3QB3 A;  1QUQ A;  5IGD A;  3K7U C;  2NZH A;  2K04 A;  1S5E D;  3I2Z A;  3L3O C;  1V1P B;  3H0G B;  2XRQ D;  1Y69 U;  5BN4 A;  1HA6 A;  5M3F H;  1DZ1 A;  4A3E B;  2L15 A;  1MSH A;  3VR5 A;  5K5P A;  3FEW X;  4GN5 A;  3WOE A;  1CZW A;  4KJN A;  5CC4 A;  1A6X A;  4FDB A;  1TWF H;  3K7A B;  4DR6 L;  1Y8P B;  1ILQ A;  4LF4 Q;  5D3I B;  1TWC H;  3MXU A;  4ALP A;  1XMQ Q;  3CCE A;  4DR3 L;  5D3D A;  2VNU D;  1PZI D;  4HCS A;  3IFT A;  1BOS A;  1IKM A;  3I72 A;  5C0X H;  3ONA B;  2LXK A;  3OIQ A;  4K5X A;  2B2T C;  5CGK A;  4JV5 Q;  2WAQ G;  2F0L A;  4B3S L;  1YBY A;  3G71 A;  5LL6 X;  1SRO A;  1KLU D;  2F0O A;  5HY6 A;  1AZQ A;  4LF6 L;  2NTT A;  3HFZ B;  2Y0S B;  3S15 H;  4FF3 A;  5IYD H;  5G3L D;  1PYS B;  3VR2 A;  3S1N H;  3JAM E;  3T1H Q;  1RIP A;  4OWW B;  2NN6 I;  2PZW A;  2PMZ E;  3NK9 A;  3K0X A;  4DA2 A;  3SK6 A;  1LTG D;  4LFC L;  2HDM A;  1F2Y A;  5DLQ E;  1J5E L;  2DY8 A;  3CCQ A;  1Y14 B;  4NP5 A;  1RTN A;  4NXM Q;  3ITP A;  4C3J G;  4IFD J;  3K5O A;  3FPU B;  4DV5 L;  4B3R L;  2R93 G;  1X3F A;  3CXC A;  1YNN C;  4TQU S;  1B4O A;  5EKK A;  1QB5 D;  1KAW A;  3S16 B;  4BWG B;  1NMF A;  4NB3 A;  2SNM A;  1U4L A;  2B2W C;  2EYJ A;  5ELN A;  3F2C A;  5C4Z A;  3BZC A;  4OX9 L;  1MKH A;  4IN3 A;  1WTV A;  1Q1E A;  2BE5 C;  1S40 A;  2MJ8 A;  2D0P A;  1LTL A;  1PH6 A;  4GS3 A;  4G57 A;  4HSP A;  2JA5 H;  1YJ9 A;  3FKI B;  4IPC A;  5E3F A;  3CME A;  3BU2 A;  1QVF A;  3OYY A; 
#chains in the Genus database with same CATH homology
 1L2F A;  1NMG A;  2ZTE A;  4BBS G;  4GKJ Q;  4KI0 A;  3ULJ A;  3A74 A;  3GTK H;  1R9T H;  1V1Q A;  1G6P A;  2JA9 A;  5IYC G;  5IY0 A;  3PSI A;  1NY4 A;  3TQY A;  4BA1 I;  2JEA I;  5JJI A;  3GTG H;  4X6A H;  1EYG A;  1EWI A;  1BBU A;  4KHZ A;  4X65 L;  5IE8 A;  2VQF L;  1JMC A;  4KLK A;  3TRZ A;  1PH2 A;  2Z0S A;  1NJI C;  2R6G A;  2VY3 A;  1GM5 A;  3T1Y L;  1L1O C;  1QZH A;  1EUJ A;  1YHB A;  4DV3 Q;  2UUC Q;  4R4C A;  4X62 L;  2Q2U A;  2PQA A;  1TWG H;  5GAD C;  1W3S A;  1JJC B;  3SGI A;  3CF5 A;  3LGJ A;  4R4I A;  4DR2 Q;  1K8A C;  4DUZ Q;  3CW2 C;  4YHH L;  3KYH C;  3PUY A;  3HKS A;  4DR3 Q;  3J81 j;  2OQ0 A;  2ZTD A;  1P16 A;  2C35 B;  4GKK Q;  3I55 A;  3GTQ H;  2YYZ A;  4IOA A;  4GKJ L;  1GKH A;  3HOZ G;  2F4V L;  2EIF A;  2R7Z G;  1HNX Q;  3D0F A;  1PH8 A;  1G51 A;  1V9P A;  1TXY A;  3ULL A;  3RN2 A;  1WJJ A;  1YIT A;  4JYA L;  1CSP A;  2AWO A;  3ICE A;  4GNX C;  3S1M H;  1E1O A;  3AYH B;  1PA6 A;  1IYJ B;  4OXP A;  2B29 A;  2VZA A;  1M90 C;  4B3S Q;  2XGT A;  4B3T Q;  2LSS A;  4A3L G;  4AYB G;  1VQF A;  1YZ6 A;  4J15 A;  4DV3 L;  1XPR A;  1JB7 A;  2KCT A;  2MQH A;  1KRT A;  1C0A A;  4IFD G;  1KHI A;  3EBE A;  2K52 A;  5LMN Q;  3OTO Q;  4DUZ L;  2Q2H A;  2WAQ E;  5JEA J;  5C44 G;  1L0W A;  1D8L A;  2E5L Q;  4A3K H;  2WB1 G;  4KHP Q;  3FP9 A;  2YU9 H;  4GKK L;  2JA7 G;  4C3J H;  1VQ8 A;  3RN5 A;  4DR4 L;  4BBR H;  1X6O A;  4A3I H;  1K83 H;  1Q82 C;  3PIP A;  2MFI A;  2CCZ A;  2R93 H;  1HNX L;  1T9H A;  2JA6 G;  1HZB A;  5GRO A;  1B7Y B;  4QY7 A;  1J5E Q;  2CWA A;  1QUQ B;  4O0A A;  2WFW A;  1YVC A;  1FVI A;  4RG1 A;  2YTX A;  2E2I H;  1N8R C;  4A3G H;  2NVY H;  3UDX A;  4IJL A;  4DR5 Q;  1VQK A;  4PZ6 A;  1OXV A;  2GVB A;  3CPF A;  3J80 i;  3JAM c;  4OON A;  1NE3 A;  1VQC A;  4DR1 Q;  1KRS A;  2OCE A;  4DV5 Q;  1WCM G;  4PZ8 A;  2MNA A;  1X56 A;  4DAM A;  3TS0 A;  1U0L A;  2K14 A;  3FHW A;  4IJH A;  2UXD Q;  3HKZ G;  3OTO L;  5LMN L;  3RZO H;  3STB C;  4JI0 L;  1OXT A;  3AEV A;  1FJG Q;  3PO2 G;  4LFB Q;  4A3M G;  3W1G A;  4PG3 A;  2BA1 A;  3GTM H;  4P73 A;  1E22 A;  3CQZ H;  2A8V A;  1IXR A;  5FLM G;  4A3F H;  3J81 c;  3NEL A;  4HIK A;  1C7Y A;  1PHJ A;  1WFQ A;  1I94 Q;  4JI5 Q;  3M3Y H;  1VQB A;  5E7N A;  4DV2 Q;  4DR5 L;  3S2D H;  4APV A;  4DV7 Q;  3J7Z C;  1IBL L;  3HOV G;  2UUB Q;  4BXX G;  2HIV A;  4BBS H;  4DV0 Q;  3BZK A;  2E2J H;  2PNH A;  2RHQ B;  2ZJP A;  4POG A;  2UXD L;  1X3G A;  2VQE L;  1SN8 A;  3KFU A;  2VS1 A;  5IYC H;  2E2H H;  2K4K A;  1L1O A;  2OQK A;  1YHA A;  2F52 A;  3PUV A;  3PIO A;  4C2M H;  2JE6 I;  2EXD A;  2I5H A;  2R7D A;  1J6Q A;  3GO5 A;  3PGZ A;  1FJG L;  2A1A A;  2RCN A;  4MTN A;  4HJ9 A;  4TVA B;  2ES2 A;  3CC2 A;  5M5Y H;  4GOP B;  4XTC S;  4HJ5 A;  4IFD I;  5M5W H;  5C3E G;  2I5M X;  3RLN A;  4A3B G;  4DPG A;  3GTJ H;  3STB D;  5IWA L;  1I6H H;  4JI5 L;  1VQP A;  4JI1 Q;  4QIW E;  4IPH A;  1Q7Y C;  1XNR L;  2VQF Q;  4HJA A;  4JI2 L;  1VS0 A;  3RLF A;  3S14 H;  3G6E A;  2R7F A;  1AE2 A;  4GNX A;  1GO3 E;  1EFW A;  3HOZ H;  2R7Z H;  5FLX c;  5EAY A;  2N78 A;  4DKA C;  2YV5 A;  2VL6 A;  1QVG A;  3S1R H;  3HOW G;  4BY1 G;  4AQY Q;  1Y1W G;  4YHH Q;  5GAH C;  1MJC A;  1CUK A;  4MZ9 A;  2NVQ H;  3ZJY C;  1HR0 W;  4BA2 I;  4A3L H;  5JEA G;  3K80 C;  4JI8 Q;  4DUY L;  2AHO B;  2F4V Q;  3PUZ A;  2ZTC A;  3CC4 A;  3G48 A;  4A75 A;  4JI4 L;  3PO3 G;  4JI1 L;  1TWA H;  1VQ4 A;  4JYA Q;  4DV6 Q;  1Q86 C;  5C44 H;  1PH1 A;  1HNZ Q;  1MIU A;  3L7Z C;  3MEF A;  2AWN A;  2GVA A;  5K36 G;  2OTL A;  4EX5 A;  2JA7 H;  2K5N A;  4QL5 A;  3KF6 B;  1E3P A;  2QEX A;  1XPO A;  3CC7 A;  2JA6 H;  2Q2T A;  3M7N A;  1OTC A;  2FXQ A;  1XNQ Q;  2HT1 A;  1I3Q H;  3KF8 B;  1K9M C;  4AQY L;  3B6Y A;  1PH5 A;  4LFA Q;  4WJ4 A;  1E24 A;  2HHH L;  4A93 G;  1X55 A;  1XTD A;  3H15 A;  1PVO A;  4AYB E;  4DR4 Q;  4OO1 G;  3HOX G;  3RLO A;  4B3M L;  2KHJ A;  4JI8 L;  3OW2 A;  1WCM H;  3KDF A;  1N34 Q;  4YCU A;  3U4Z A;  4ME3 A;  1YI2 A;  2VUM G;  3KJP A;  3RNU A;  5C0X J;  4DK3 C;  4DV6 L;  4QQB X;  1VQM A;  2ZM6 Q;  1HNZ L;  2WB1 E;  3PO2 H;  2QA4 A;  1LM0 A;  4JCV E;  4A3M H;  4UY8 C;  1IL2 A;  2UU9 L;  3E0E A;  4C3I H;  4X64 L;  1K0R A;  1I50 H;  3A5Z B;  3AQQ A;  1IZ6 A;  1C9O A;  1XNQ L;  5FLM H;  1PFS A;  5M3M H;  4WJ3 M;  4X66 L;  2D62 A;  2KHI A;  3J81 i;  3U58 A;  4R4Q A;  3S2H H;  4LFA L;  2D0O A;  4JI0 Q;  3CCR A;  1CKN A;  1ASZ A;  3HOV H;  1PH3 A;  4BXX H;  4UPA A;  2OTJ A;  4IO9 A;  2ID0 A;  2UUA L;  2PQA B;  3M4O H;  1WYD A;  1N34 L;  3W1B A;  1X9N A;  3H0G G;  1VQI A;  1PH7 A;  3HKZ E;  3CCV A;  1YHQ A;  1O7I A;  1UWV A;  3GTO H;  1Y1V G;  2ZM6 L;  1VQL A;  4A3E G;  1B8A A;  2IX0 A;  2LXJ A;  4DK6 C;  4GLX A;  2AKW B;  2HIX A;  5AJ3 L;  3K81 C;  3I4M G;  1IBM L;  3HOY G;  1KQS A;  4DNI A;  2MO0 A;  3CCM A;  1IBL Q;  2BA0 A;  4LW1 A;  3EIV A;  4HID A;  5H1S E;  2CQO A;  2PI2 A;  3GD7 A;  4OWT B;  2CKZ B;  2N8N A;  4YCV A;  5IYB G;  5C3E H;  4QGU A;  2VQE Q;  4A3B H;  1G29 1;  4HIM A;  1TWH H;  3A0J A;  2V1C C;  3NEN A;  4L5Q A;  4L5T A;  1HR0 Q;  2K5V A;  1VQ7 A;  4JOI C;  3HOU G;  1VQG A;  4OWX B;  2I5L X;  3PV0 A;  4IPG A;  1DGS A;  1PYB A;  2ATW A;  1A0I A;  1BKB A;  3I4N G;  1Z9F A;  1OXS C;  2NVT H;  4QJF A;  4R4O A;  3CP0 A;  2K75 A;  4JBK A;  3DLL A;  1D7Q A;  2DUD A;  4NXN L;  4GN3 B;  4A3C G;  1GVP A;  1SFO H;  5IWA Q;  2YTV A;  4K0K Q;  4BY1 H;  1Y1W H;  1N33 Q;  4OO1 I;  4A4I A;  1XNR Q;  5M3F G;  3M4P A;  1M1K C;  4JI2 Q;  5IP9 G;  4BY7 G;  1V43 A;  1ASY A;  2UXB Q;  3U4V A;  1P8L A;  4LF5 L;  2ASB A;  1Q1B A;  4JC0 A;  4L5R C;  1N9W A;  2ZJR A;  4YY3 L;  4LF7 Q;  1VCI A;  3EN2 A;  3ERS X;  4UP8 A;  1HR0 L;  3PO3 H;  2Y0S G;  2B3G A;  2WP8 J;  4LUV A;  3VDY A;  1HZC A;  4YWM A;  2E8G A;  1I5F A;  1KD1 C;  1XMO L;  3CD6 A;  4A3D G;  3MXN B;  1WI5 A;  2B63 G;  3PUX A;  5C4X G;  4A3J G;  4JV5 L;  3TS2 A;  1HNW Q;  4DUY Q;  3F8T A;  1EQQ A;  4JI4 Q;  1WOC A;  1Q46 A;  4GN4 B;  3PF5 A;  4K0K L;  3CCU A;  1N33 L;  3WWV A;  5GQO A;  3S17 H;  2IHE A;  2K50 A;  4JI6 L;  4A93 H;  4JBW A;  2UXB L;  4AIM A;  5C0X G;  3M85 A;  1VQH A;  1SR3 A;  3E9H A;  3HOX H;  4LF8 Q;  5IP7 G;  1K73 C;  1HZA A;  3M4Q A;  5GAG C;  4LF7 L;  1X65 A;  1VQE A;  2VUM H;  3U50 C;  2DGY A;  2ZJQ A;  4RMF A;  4Y7N H;  2K5H A;  3F2B A;  2AMC B;  5J3B A;  2HHH Q;  3CCS A;  1UE1 A;  2EQS A;  5JJL A;  4P74 A;  5IYD G;  2HQL A;  4B3M Q;  3UE1 A;  1YJN A;  1HNW L;  4JG2 A;  4POF A;  3L2P A;  2NZO A;  1L1O B;  1IBK L;  1EOV A;  4GOP C;  2UXC Q;  4XIG S;  1PV4 A;  1KIX A;  5BR8 Q;  4HJ8 A;  3NBH B;  3F2D A;  2MO1 A;  2OWO A;  2IT1 A;  2IHF A;  1AH9 A;  4LF8 L;  2UU9 Q;  4X64 Q;  1UE7 A;  3PF4 A;  1E1T A;  1PH9 A;  4DAY B;  4R1J A;  3H0G H;  4YWL A;  1N32 L;  4JI7 Q;  3D31 A;  3FKI G;  1U5K A;  4X66 Q;  3UDI A;  1SE8 A;  5ELO A;  4L5S A;  1Y1V H;  3RR5 A;  4A3E H;  1KC8 C;  2BH8 A;  1PH4 A;  4MNO A;  4LUO A;  3I4M H;  1W2B A;  3GDE A;  3JAM i;  4GNX B;  3HOY H;  1A8V A;  1QZG A;  4JOI A;  1HJP A;  4YWK A;  2UUA Q;  2IY5 B;  3NEM A;  3K7A H;  5IYB H;  2UXC L;  3PUW A;  3UE0 A;  3KOJ A;  3W5O A;  3CAM A;  5BR8 L;  1VQ5 A;  3HOU H;  2IX1 A;  2NN6 G;  3CPW A;  3RZD H;  3ER0 A;  4NPS A;  1VQN A;  4YCW A;  4DR6 Q;  3I4N H;  5AJ3 Q;  1OXU A;  1Z47 A;  1IBM Q;  3AFP A;  3J7A 5;  3GTP H;  3F1Z A;  3E9I A;  1JJG A;  2RHS B;  4DV1 Q;  1QUQ A;  3K7U C;  2NZH A;  4JI7 L;  5LMU L;  1OXX K;  3I2Z A;  1BVS A;  5FJ8 G;  4A3C H;  1CKO A;  2JA5 G;  1BBW A;  3A5U A;  4DV4 Q;  5C0X I;  4P71 A;  1K3R A;  2R92 G;  5M3F H;  1NBW A;  2JA8 G;  2L15 A;  5IP9 H;  4HIO A;  4BY7 H;  3S1Q H;  1X54 A;  2N49 A;  1SRU A;  4GN5 A;  3L0O A;  5HGQ A;  2Z6K C;  1KL9 A;  3CMA A;  5JJK A;  4FDB A;  4LUZ A;  4NXN Q;  2VW9 A;  1TWF H;  4DR6 L;  1VQO A;  1SLJ A;  2UUC L;  4LF6 Q;  2Q2I A;  1VQJ A;  3I4O A;  1YEZ A;  1JT8 A;  2JK8 A;  3BJU A;  4LF4 Q;  1JJ2 A;  4A3D H;  3KDF B;  4DV1 L;  4DR2 L;  1CKM A;  4LF5 Q;  2B63 H;  5C4X H;  4A3J H;  1TWC H;  4ALP A;  1NTG A;  1XMQ Q;  2I0Q A;  4UP7 A;  3CCE A;  2KCM A;  2RF4 A;  4DR3 L;  4YY3 Q;  1MJE A;  1YIJ A;  1UE5 A;  1A63 A;  2VNU D;  4DV4 L;  4AH6 A;  1XJV A;  4IPD A;  5M5X H;  4LFC Q;  1K8G A;  2BH2 A;  1XMO Q;  1VQ6 A;  2LXK A;  5IP7 H;  4PZ7 A;  4JV5 Q;  2WAQ G;  2Y0S E;  3CCL A;  4B3S L;  1YBY A;  3G71 A;  1N36 Q;  4B3T L;  1SRO A;  1CSQ A;  5HY6 A;  1CKN B;  2QGQ A;  3HOW H;  3S16 H;  4C3H H;  4LF6 L;  4JBJ A;  3AFQ A;  4B3R Q;  2H5X A;  4EQ5 A;  3HFZ B;  2JQO A;  1EIY B;  4JI6 Q;  4GOP A;  4LF4 L;  1S72 A;  1FL0 A;  3PCO B;  3S15 H;  5IYD H;  4P72 A;  1PYS B;  1XMQ L;  3S1N H;  3T1H Q;  4JI3 Q;  1YNX A;  2E5L L;  1RIP A;  4OWW B;  4KHP L;  2NN6 I;  2PMZ E;  2PI2 E;  1B70 B;  1A62 A;  3K0X A;  3DM3 A;  3K8A A;  2KBN A;  3KLW A;  5GAE C;  1KXL A;  4LFC L;  2JJQ A;  1UEB A;  5DLQ E;  4Y52 H;  1J5E L;  2KEN A;  1Q8K A;  2CWP A;  5M3M G;  1YJW A;  4OX9 Q;  2ALY B;  4LF9 Q;  3CCQ A;  4UP9 A;  1GD7 A;  1Y14 B;  4DR7 Q;  1X3E A;  4A3K G;  2A19 A;  3H3V I;  3FKI H;  2GN5 A;  1N36 L;  4NXM Q;  1IBK Q;  1VQA A;  1AE3 A;  4DR1 L;  4IFD J;  4BBR G;  4A76 A;  4A3I G;  1VQD A;  4DV5 L;  5IT9 c;  1LUZ A;  3I56 A;  4B3R L;  1X3F A;  3CXC A;  2R93 G;  4TQU S;  1EIF A;  1LYL A;  4P75 A;  3S24 A;  4LNQ A;  1KAW A;  1NMF A;  3JC6 6;  4NB3 A;  4JI3 L;  3T1H L;  1FGU A;  2XTI A;  4A3G G;  4LFB L;  4LWC A;  4GLA C;  3J80 c;  1N32 Q;  3ULP A;  5ELN A;  3I7F A;  3F2C A;  4IOC A;  3BZC A;  1S3O A;  4GLV B;  5LMN W;  2CFM A;  4PMW A;  1HH2 P;  1VQ9 A;  4OX9 L;  3KF6 A;  4LF9 L;  1MKH A;  3TEH B;  1UE6 A;  1I94 L;  1Q1E A;  4DV2 L;  1S40 A;  2JEB I;  4DR7 L;  4H02 A;  2D0P A;  3TRE A;  3CCJ A;  1LTL A;  4DV7 L;  4R4T A;  4X65 Q;  2F3I A;  4O2D A;  3UDG A;  1PH6 A;  5FJ8 H;  2UUB L;  4NXM L;  4GS3 A;  2YTY A;  3G4S A;  1SMX A;  2JA5 H;  1RL2 A;  4DV0 L;  3H3V H;  3T1Y Q;  1YJ9 A;  4IPC A;  3KJO A;  2R92 H;  1Q81 C;  4A3F G;  2Z6K A;  2JA8 H;  4X62 Q;  3CME A;  3UDF A;  1XPU A;  4HJ7 A;  3Q8D A;  2NVX H;  2N3S A;  1QVC A;  3BU2 A;  3IRB A;  3GTL H;  4JBM A;  1HZ9 A;  1Q12 A;  1QVF A;  1JE5 A;  1E7Z A;  1EQR A;  5LMU Q;  1H95 A;  3OYY A;  5C4J H;  3M9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...