4BXXH

Arrested rna polymerase ii-bye1 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxH00
4QY7A 1UE6A 1VQIA 2ZM6L 4LUZA 1IBKL 1TWAH 2JA5G 2VUMG 2R93G 3HKSA 3E9HA 4JI0L 1N8RC 4EX5A 5DLQE 1PV4A 3CCQA 2CQOA 4APVA 4YCVA 3M4QA 4HIKA 3UDGA 4LF6Q 1X3FA 1X56A 1Y1VH 4BY7H 4BA2I 4OX9Q 3BZKA 4PG3A 1IBML 3S1MH 1Q1BA 1K0RA 3AFQA 4DR6Q 5HY6A 4AYBG 1VQ5A 5M3FH 3CPFA 4UP8A 5IYCH 4A3IG 2F4VL 4IFDJ 2I5LX 2R7DA 2ZJQA 2VQEQ 3CW2C 5AJ3Q 2ZJRA 1E1OA 1CSQA 4BBRH 3H15A 3K80C 2HIXA 4B3SL 1NY4A 2I0QA 2CKZB 1XMQL 3CCJA 1LUZA 1OXSC 4AQYQ 2B63H 4X62L 3I4NH 4LNQA 3PO2H 3TS2A 4A3BH 2WAQG 2VQEL 1L0WA 4GOPC 4NXMQ 3G48A 3L7ZC 4GLVB 2QEXA 2VQFQ 4LFCQ 4B3ML 3OW2A 4DR6L 1VCIA 3K7UC 2IHEA 4QIWE 2YYZA 1ASZA 4ALPA 4R4TA 5E7NA 5FLMH 1Q12A 4YHHQ 3GTKH 4A93G 1PH6A 1N32Q 5FJ8G 5LMNQ 4AIMA 5IYDH 3D31A 2JA6G 3CMAA 2CWAA 2UUCL 2A19A 4JV5Q 3HOVG 1GO3E 3K7AH 3RNUA 4LF9Q 2MNAA 1YITA 1JMCA 3JAMi 4AYBE 3U4VA 4A3DH 2AKWB 5LMNW 1YNXA 5BR8Q 1V9PA 1XJVA 1MKHA 4R4QA 5IP9H 1A63A 1H95A 2K5VA 2JA7H 1AH9A 1YHAA 3ULLA 1HNZQ 2B3GA 2RHSB 3RN2A 2V1CC 4OWTB 4DR2Q 4OO1G 4GKKQ 4JI6L 2LXJA 2VY3A 3RLNA 1WI5A 2NVYH 3TQYA 2N49A 1SN8A 3U4ZA 4BBRG 4LF7L 1E22A 4KHPL 1IXRA 2A8VA 5M3FG 1PH1A 3VDYA 3FHWA 3M4PA 3RN5A 4A3IH 4BBSG 3W1GA 3S14H 4TVAB 4NXNQ 3EBEA 4A3MH 1NMGA 1JJ2A 4GKJQ 1RL2A 1Q8KA 3S1QH 4LF8Q 1UEBA 1G6PA 1I94Q 1VQ9A 2GVAA 4DAMA 4X64L 1YZ6A 2JA7G 3A5ZB 3S1RH 4JI2L 4OXPA 3Q8DA 4GNXB 4DR3L 1Q7YC 4JI4L 3HOUH 4DV5L 1N9WA 2F4VQ 5C4XG 3CC7A 3KJPA 3UE0A 1XNQL 2JA8G 1Q82C 4OWXB 2IT1A 4JBKA 2L15A 4OONA 1WCMH 4P72A 4NXNL 3I4MH 2PI2E 2KCTA 2RHQB 3PF5A 1JE5A 1I50H 5J3BA 3RR5A 3PUYA 2CFMA 5M5YH 4MTNA 4O0AA 2ZTDA 5IE8A 1VQAA 2IHFA 2OQKA 3KLWA 3MEFA 4IPCA 4JI5L 3ULJA 1X54A 2K14A 5C44H 2F3IA 2YTVA 4UP9A 1Z47A 1KD1C 2WFWA 5IP9G 1VQ4A 1PA6A 1EYGA 2JEBI 4DUYQ 4AH6A 3K0XA 3CMEA 3FKIG 1X65A 1ASYA 1N32L 2DUDA 3PCOB 3OTOQ 1VQEA 5GQOA 3CPWA 4A3JH 2OTLA 2UXCL 3RLOA 1K73C 2UUBL 1JT8A 4JYAL 3CP0A 1DGSA 1TWHH 5FJ8H 4YY3L 3L2PA 5BR8L 2E2JH 2Q2TA 1BVSA 1YIJA 1XPOA 2UUAQ 2B63G 4LF4Q 2D62A 3GD7A 1KC8C 2UXBL 4GLAC 4IPDA 4PMWA 4X66L 3UDXA 2CWPA 2N8NA 4JI2Q 1YI2A 4GOPA 3UE1A 1C7YA 2VL6A 1SMXA 3KJOA 4QL5A 5EAYA 3ZJYC 2Z6KC 1IL2A 3J7A5 4DK3C 1E3PA 4RMFA 3NENA 2MO1A 3I4OA 1AE2A 1IYJB 2EXDA 2NZOA 1HNWQ 3S24A 1UE1A 4DNIA 4YWMA 1OTCA 4LF5L 3RLFA 1XPUA 1EQRA 1LYLA 1W3SA 2D0OA 3I4MG 2JA5H 4A3FG 1YJNA 3I55A 3I4NG 3PO2G 1VQCA 1CSPA 5M3MG 1VQ6A 2HT1A 1GKHA 4BA1I 4X62Q 4DV0Q 1HZAA 4A3KH 1OXVA 5IYBH 4JI3Q 4K0KQ 4WJ4A 1E24A 4A3GH 1NBWA 1A8VA 2OQ0A 4LW1A 1K9MC 2JEAI 2R6GA 2VS1A 3HFZB 4DV3L 4XIGS 4IOCA 3RZDH 1EQQA 1VQMA 4DR3Q 1VQBA 4JBMA 4YCWA 3PIPA 1KRTA 2H5XA 4JYAQ 3W5OA 3T1HQ 3HOXH 1IBMQ 2YTXA 3U50C 3H0GH 1P16A 2XTIA 5IYBG 4JBWA 3PUXA 4JV5L 4DV2L 2NVXH 4DUYL 2Z0SA 3CCEA 1KXLA 2N78A 3TEHB 1D7QA 1VQGA 1PH8A 4DR1Q 1PH9A 3RZOH 3I56A 1B70B 5GROA 1J6QA 1PH4A 2KCMA 1SE8A 4TQUS 3S15H 1MIUA 2OWOA 3CCSA 3KF6A 2EQSA 2XGTA 4JI6Q 4DV5Q 1SRUA 3STBC 5M5XH 3ER0A 5JJKA 3CQZH 1Q1EA 4B3RQ 1MJEA 2R93H 4OO1I 1XMOQ 1HNZL 3BZCA 1LTLA 4X66Q 4B3TL 1Z9FA 3IRBA 3HOXG 3S2DH 3K8AA 2BA1A 1K8GA 4UY8C 2ID0A 1M1KC 2Q2UA 4LF4L 4MNOA 1GVPA 4YCUA 5IP7G 4WJ3M 5GAEC 3PIOA 2KHJA 3PO3H 4X6AH 3JC66 1Q81C 1HJPA 4GN4B 4A3LH 5C0XG 1PFSA 1VQ8A 3BJUA 2KHIA 1FL0A 5C4JH 1VQ7A 2UXCQ 2JA9A 3U58A 5FLXc 3M4OH 4DV1L 5K36G 4DV2Q 4GNXC 2HQLA 1VQPA 2AWOA 2WP8J 4IFDG 4IPHA 2LXKA 2E5LL 1OXTA 3F1ZA 1VQOA 1X3GA 1CUKA 4GLXA 4GKKL 1IBKQ 2R7ZH 1X9NA 2VW9A 4DR2L 4BY1H 4HJ5A 1Y1WG 2UU9L 4C3HH 1MJCA 4UP7A 2CCZA 3AEVA 1QZGA 1Y1VG 4A93H 4BXXH 3PV0A 1I5FA 1VQKA 3JAMc 2WB1G 1K3RA 1PH7A 3F2DA 2UUAL 2F52A 3A0JA 4LF9L 4B3SQ 2K52A 4BXXG 4DR7Q 2K5NA 4DV3Q 1BKBA 2UUCQ 5AJ3L 5C0XI 1XMOL 3PUWA 3SGIA 4B3RL 3DLLA 4LF8L 2ATWA 1SROA 4DPGA 1S72A 1I94L 4GKJL 1VS0A 4YWKA 1I3QH 2VUMH 3KFUA 4KLKA 1HNWL 4P71A 3TREA 4YWLA 4OX9L 3PUZA 1EWIA 1JB7A 2I5HA 1BBUA 1L1OA 1VQHA 2LSSA 3BU2A 4NPSA 4C2MH 4HIOA 3T1YL 4JI0Q 2GN5A 4KHPQ 3H3VH 2OCEA 3GTJH 3AYHB 1HZCA 1IBLL 3KYHC 4OWWB 3I7FA 2R7ZG 4LWCA 3NEMA 4A3KG 3F8TA 5LMUL 1VQDA 2UXBQ 1PYBA 4B3TQ 1XMQQ 3EN2A 2YU9H 1U5KA 1HZ9A 4NB3A 1Q86C 4JOIC 1M90C 2MQHA 4DR4Q 2RCNA 2KBNA 1KQSA 4L5RC 2NZHA 4POFA 3E9IA 4A3EH 1L1OC 1HH2P 4MZ9A 1SFOH 2ALYB 3KF8B 5GAGC 1I6HH 2K75A 3B6YA 4DK6C 1NE3A 2Q2HA 2N3SA 3OTOL 3HOYG 3M3YH 4A3CG 3CCRA 3ULPA 4JI8Q 1Y1WH 2BA0A 1QVCA 4ME3A 2JQOA 3S17H 3DM3A 1L2FA 1CKMA 1GM5A 4JBJA 4LF6L 3M7NA 1FJGL 1E1TA 4A3MG 1E7ZA 1YVCA 2KENA 5LMNL 4HJ9A 2ES2A 2BH8A 2JE6I 5IYDG 3G6EA 1X3EA 4GNXA 3L0OA 1HZBA 4JI1Q 1KAWA 1Q46A 3PUVA 4L5QA 3T1HL 1HNXQ 1G291 3CC2A 1PH2A 3GTLH 3CXCA 4QJFA 5IY0A 2R92H 1P8LA 5FLMG 4JI5Q 3CD6A 1PHJA 4NXML 3HOWH 4GN5A 3STBD 2HIVA 4LFCL 4BBSH 1VQFA 5IWAQ 1CKOA 4GN3B 2AMCB 1PH5A 2NVTH 4DV6Q 1K8AC 2ZTCA 3ICEA 3F2BA 1XNQQ 1UWVA 4A3BG 3J81j 2QGQA 3AQQA 1GD7A 1WOCA 4L5TA 2QA4A 1JJGA 5IWAL 1N34L 1KL9A 3HOZH 4IFDI 2VNUD 4R4OA 1YEZA 3KDFA 4QGUA 3CCMA 1KRSA 1EIFA 1HR0L 1YBYA 4DUZL 4GOPB 4H02A 5M5WH 4DV4Q 1YJWA 1WJJA 4LF7Q 1BBWA 1XNRL 3FP9A 2UXDL 4LUOA 3LGJA 1FGUA 3PF4A 4IJHA 1V1QA 4DR5Q 4B3MQ 4BY1G 3GTQH 1N34Q 2VQFL 2E2IH 1FJGQ 2ZM6Q 2IY5B 2PNHA 1FVIA 1X55A 3M85A 3F2CA 5IT9c 4A3JG 1D8LA 3W1BA 4JOIA 1NJIC 1AE3A 3HOYH 4A3CH 3FKIH 1VQNA 3J80i 5ELOA 1C0AA 1B8AA 2GVBA 5JEAG 1TWGH 1YHQA 1J5EQ 1EOVA 4YY3Q 3HOZG 1SR3A 2WAQE 1Y14B 5C44G 4R4IA 3CCUA 1QVGA 3A5UA 1NTGA 3S16H 4J15A 3PGZA 3OYYA 4DV7Q 4HJ8A 3KOJA 1QZHA 4JI7Q 4LFBQ 1W2BA 1KIXA 3GTMH 2E5LQ 1K83H 4JC0A 2JA8H 4FDBA 1OXUA 1EUJA 2ZTEA 4PZ7A 4C3JH 1CKNB 4LF5Q 1UE5A 2AHOB 4O2DA 4Y7NH 1VQLA 3UDFA 3NELA 1TWFH 3AFPA 5C4XH 4LFAL 2UXDQ 4QQBX 1C9OA 4A3GG 3H0GG 4YHHL 3EIVA 1HR0Q 3UDIA 4A3DG 2EIFA 4JI7L 1WYDA 2Q2IA 4A75A 4JI4Q 4DV6L 3GTOH 4PZ6A 4X65L 4DKAC 3J81c 1OXXK 1N33L 3HKZG 3J81i 4PZ8A 1TXYA 3CCVA 4A3FH 2HHHQ 1IZ6A 3HKZE 3CC4A 3KF6B 4HJAA 2Z6KA 4IOAA 2A1AA 1G51A 1CKNA 2YTYA 3H3VI 4JG2A 3CCLA 1IBLQ 1UE7A 3ERSX 1JJCB 1V43A 1XTDA 4IO9A 3CF5A 3T1YQ 4EQ5A 4Y52H 3D0FA 2ZJPA 1LM0A 2K5HA 2MFIA 4JI1L 1HNXL 2Y0SE 3CAMA 5C3EG 1PH3A 1EIYB 4XTCS 4JCVE 1O7IA 2Y0SG 4LFBL 4DV7L 1U0LA 4DV4L 3GTGH 2K50A 2E8GA 3PO3G 2R7FA 3TRZA 4POGA 2JA6H 1B7YB 4UPAA 2AWNA 3NBHB 4P73A 1S40A 4JI8L 4IPGA 1YJ9A 3A74A 1N36Q 2NVQH 4R4CA 3G4SA 4JI3L 3WWVA 4K0KL 2PI2A 1SLJA 3MXNB 2UU9Q 1T9HA 1A0IA 2C35B 5GADC 1VQJA 5M3MH 4P75A 3S1NH 1QUQB 2PQAA 4X64Q 4HJ7A 1X6OA 4KI0A 4P74A 1N33Q 3J7ZC 3GDEA 5JJLA 5C3EH 4RG1A 5C0XJ 4C3IH 2I5MX 2K4KA 1RIPA 3KDFB 4DAYB 4DR5L 1R9TH 2IX1A 2NN6G 2JK8A 4A4IA 4DUZQ 2PQAB 3K81C 1S3OA 1XNRQ 3HOWG 1QVFA 2E2HH 4A3LG 2OTJA 3G71A 4BY7G 2FXQA 3S2HH 1PVOA 5IP7H 1WFQA 2MO0A 4LFAQ 1XPRA 1TWCH 2PMZE 4DR1L 4HIDA 5JEAJ 4GS3A 2RF4A 5GAHC 1KHIA 1HR0W 1QUQA 2D0PA 5IYCG 2BH2A 4LUVA 4R1JA 4AQYL 4HIMA 5JJIA 1L1OB 5HGQA 5H1SE 4L5SA 2WB1E 3GO5A 1NMFA 4KHZA 5ELNA 2HHHL 2R92G 2DGYA 4X65Q 1J5EL 1PYSB 1YHBA 2IX0A 3PSIA 3TS0A 3GTPH 4DR7L 3HOUG 3E0EA 4DR4L 2NN6I 2VZAA 4IJLA 4A3EG 1EFWA 2UUBQ 1A62A 4A76A 3I2ZA 2B29A 3J80c 5LMUQ 1N36L 4DV0L 1WCMG 2ASBA 3HOVH 4DV1Q 2YV5A 3M9BA 2JJQA
chains in the Genus database with same CATH superfamily
2NUCA 1IBKL 1LTBD 4JI0L 5DLQE 4LF6Q 1K0SA 4HIKA 1X3FA 4BY7H 1F9RA 1ML0D 4OX9Q 3FRPB 2D2CC 1YNJC 2LMCB 2OF1A 3H6MA 3S1MH 5G3LF 3H94A 4C2MB 4CJ2C 1WTWA 1VQ5A 5IYCH 4IFDJ 4H13C 2NWGA 4BBRH 3H15A 1BXTA 3DHQA 1JQYD 2I0QA 1XMQL 2A69D 4AQYQ 1R9TB 3TS2A 1SNCA 3F2UA 1BBXC 3L7ZC 1UEAB 4G7OC 4A3DB 3D4WA 4B3ML 1B1ZA 3OW2A 2D9UA 1HTPA 2YYZA 3NTKA 5E7NA 4BBSB 4YHHQ 3GV6A 3DM1A 1JICA 4Q0FA 1PTOF 5FO8B 5LMNQ 1TR5A 2WACA 4C3IG 2F0WA 1RKNA 4R8NA 5I4DA 3RNUA 4LF9Q 4QIWB 4C3JB 4DU9A 5LMNW 4HN7A 2NVQB 2RVLA 1U4RA 1PMRA 4IURA 2JA7H 1AH9A 1YHAA 3ULLA 1HNZQ 4OO1G 1HXYD 2HQEA 3K5NA 2LXJA 3VR6A 2JXMB 3TQYA 4BBRG 1SN8A 4KHPL 1QG7A 3HRZC 3TP8A 2MP1A 5ISRA 1A2TA 4TVAB 3EBEA 2LY7A 3S1QH 2L9HA 4LF8Q 3GTMB 1EYCA 1KAAA 2GVAA 4DAMA 1DD2A 2KOLA 3S1RH 4GNXB 4DR3L 3HOUH 1Q7YC 4DV5L 1N9WA 4N8FA 3X3MA 4A3GB 2K7VA 2JA8G 2F0QA 5FO7B 4P72A 2H1EA 2KCTA 3KLSX 2CFMA 4MTNA 2ZTDA 1F77A 3MXUA 1VQAA 3MEFA 3OIPA 3KLWA 3QJYA 5IE8A 4JI5L 3ONAB 3ULJA 1X54A 1II3A 2F3IA 2YTVA 4UP9A 2WFWA 5T1IA 1VQ4A 1EYGA 2ZXPA 1EQTA 4DUYQ 3K0XA 2PMZB 2F0VA 3KLRA 2UXCL 1I4RA 1K73C 3EROA 3TMEA 3S2HB 2E2JH 1Y1WB 1PRTB 1KLGD 2XNAC 2HCCA 2B63G 1FGBD 1BO0A 2D62A 1IKMA 1O7YA 4PMWA 3UDXA 2TMPA 4FVMA 3KJOA 3MVVA 3PO2B 2NVYB 5EAYA 3ZJYC 3J7A5 3NENA 3MC0B 1IYJB 4K8IA 4IUVA 1UE1A 1TWHB 4HCEA 5EBCA 4LF5L 3A54A 4DAPA 1XPUA 3I72A 4ILWA 4DGZA 1R4PB 1YJNA 5AFWA 1TQOA 4IUUA 1D2BA 4BA1I 1GUWA 1OXVA 3KBGA 5IYBH 4K0KQ 1K9MC 3AU7A 2VS1A 4DV3L 3HFZB 4IOCA 1EQQA 1VQMA 1VQBA 1KRTA 4JYAQ 1AP0A 2G5DA 3DEOA 5T1GA 4XYOA 1NR2A 1P16A 3TSSA 3EVQA 4KY7A 1WTVA 4DUYL 2Z0SA 3IFTA 1D7QA 5C3EB 5DM73 3I3CA 1B70B 3H3VC 3ZYYX 4K8JA 4QMGA 3HGBA 4F87A 1MIUA 4FXKC 2XGTA 4JI6Q 1GUNA 1PLFA 3R3OA 4OO1I 1LTLA 2PNRC 1HRJA 1Z9FA 4ZKCB 2BA1A 1DOLA 4RCNA 2B2WC 1EEID 1STAA 2Q2UA 1GVPA 5I2YA 5IP7G 3PIOA 3OSOA 4XDXA 2KHIA 1VQ7A 5FLXc 5JPMC 1QJOA 1X3GA 5IGCA 1W6KA 2FINB 1X9NA 1BOSA 2EYHA 3TZUA 4GZYC 1I4XA 3T53B 2UU9L 1MJCA 1QZGA 1I5FA 1BCPD 5J1ZA 2WB1G 1K3RA 3JAMc 2UUAL 5DEHA 2DNEA 2K52A 5CC4A 5CV9A 4BXXG 2G9DA 2K5NA 1GOZA 1M8AA 2RA4A 3TBIB 3SK5A 5AJ3L 5C0XI 4B3RL 4LF8L 2B2TC 1S72A 1LTGD 1G6ZA 3LWEA 2VUMH 1I3QH 1TS4A 1YNND 3TREA 4YWLA 1V1PB 2MJ8A 2I5HA 1L1OA 1VQHA 4KHPQ 2OCEA 3AYHB 1MSHA 2PW7A 4O42A 4DF7A 5CORA 1S5BD 1ET6A 3NEMA 3F8TA 5LMUL 2L5TA 3EJIA 5KRUA 2QDLA 2XRSD 2RBMA 2MQHA 4L5RC 5IGBA 2F03A 2KVMA 2N88A 5E4WC 1SFOH 3KF8B 1WTHA 2A73B 3A8KE 3HOYG 3B6YA 4DK6C 1NE3A 3PO3B 4ULLA 3CCRA 3ULPA 1Y1WH 3Q6SA 3DM3A 1ET9A 4LF6L 3M7NA 2BDNA 1FJGL 1LT5D 2KEDA 1WTRA 3KK7A 1YVCA 2KENA 3T56B 4BY1B 3ND8A 3FDTA 1X3EA 4C3HB 1KAWA 1KDCA 1RODA 4L5QA 3GTLH 1G291 1WCMB 1PH2A 2ZXOA 5IY0A 4KHVA 4GN5A 4BBSH 2HIVA 3DWPA 5IWAQ 1EEFD 2DN8A 1EY7A 4F7XA 1LT6D 4A3BG 3J81j 1JJGA 1A6XA 1XX8A 1LTTD 3DXJC 4R4OA 4HSPA 4O1NA 4H02A 5CYUA 4KJNA 3K6OA 1FGUA 3PF4A 3HOWB 2F0HA 1V1QA 4OEMB 4BY1G 3GTQH 2PNHA 5IGFA 1FVIA 3IFDA 1IW7D 3M85A 1AE3A 3J80i 1C0AA 5JEAG 5C0XH 3SK8A 4YY3Q 1GJXA 3L3OC 3S17B 1KABA 1SYGA 5LL6X 3GTMH 2E5LQ 1VDZA 3CU7A 1K83H 2JA8H 3BDOA 2X69A 4FF2A 2AQ3B 4Y7NH 5EKKA 4LFAL 3TP6A 3AFPA 2F1MA 5C4XH 1J8IA 3EIVA 4A3DG 1HCZA 2K03A 2XSCA 1WYDA 4FNFA 4DV6L 3CKIB 4X65L 4DKAC 1DM0B 1OXXK 2F0EA 1N33L 2JA8B 4FP5D 1EY9A 5FKAC 3HKZE 4CKEA 3CC4A 3KF6B 2QILA 1G51A 1BCPF 1IBLQ 3MXPA 5FLXL 1JJCB 3CF5A 3CRLC 4E6IA 4Y52H 1KDAA 3G6JB 3J7YW 4JI1L 3CAMA 1PH3A 1O7IA 2TSSA 1ZXTA 4V0BA 2AUJD 1U0LA 3SHLA 3GTGH 4HAEA 5KNBA 1I3QB 4H7BA 2XWJB 5IGEA 3PO3G 1BNZA 3V05A 3HOYB 4UPAA 2EYMA 4IPGA 5IGDA 2EYFA 3G4SA 3HOXB 4K0KL 2E74C 2PI2A 3MXNB 3RUZA 1A0IA 2C35B 5J39A 5M3MH 4ID6A 1SE3A 1QUQB 4HJ7A 4CHTB 1N33Q 4KI0A 4P74A 4DA2A 4LAAA 5JJLA 2LFNA 4DR5L 2I5MX 1R9TH 1AZQA 2IX1A 1JORA 2JK8A 3K81C 1DONA 1S3OA 1XNRQ 3HOWG 2QDBA 4BY7G 1WFQA 2PMZE 1CM9A 1NUCA 4GS3A 1NSNS 4QUCA 3TN2A 1KHIA 3NBHA 2FMCA 3W2DA 4LUVA 5JJIA 5JAVA 3MHBA 2WB1E 1NMFA 5ELNA 1S5ED 2R92G 2WB1B 5C6AA 1J5EL 2IX0A 1TVXA 5FK9C 5A35A 4A3EG 2B2VC 4F88A 3J80c 4CJ0B 1G8ZD 1WCMG 1Q3LA 4DV1Q 3CXCA 4QY7A 2JA5G 1KTKA 1VQIA 1Z6HA 1TWAH 1N8RC 4EX5A 4RAUC 4DXGA 3CCQA 3WOFA 4BA2I 1PFBA 3SEBA 1Y8OB 1Q1BA 1E2VA 1K0RA 3AFQA 4DR6Q 3IAYA 1JWMD 4UP8A 2L11A 2I5LX 3C1EA 1B2TA 2VQEQ 5AJ3Q 1SDFA 1E1OA 1CSQA 3AMUA 2CKZB 4OGQC 3CCJA 4A3FB 2KJXA 4X62L 3I4NH 1JWSD 4A3BH 2WAQG 2VQEL 1L0WA 4GOPC 5JEAH 4NXMQ 5EPJA 2A5HA 2QEXA 4GLVB 3MTSA 2ZXRA 3K7UC 4QIWE 1EU3A 3E6ZX 1TY2A 4ALPA 1STEA 4A93G 1Q12A 5ELFA 2JA5B 2RDHA 3NK9A 4ZYSA 4G57A 1QB5D 2CVRA 3CMAA 2CWAA 1FD7D 1GO3E 4CGYB 3K7AH 1X3QA 4TKOB 2MNAA 4MN3A 4AYBE 3U4VA 5C4XB 4DK0A 4FF3A 1YNXA 1V9PA 1MKHA 2L0CA 2L1BA 3VA5A 4RWSC 4WJWA 2RHSB 4OWTB 3MZ5A 2VY3A 1DZ1A 3K7AB 3V2TA 2N49A 2F3WA 1VMCA 3HG9A 2KCNA 4TRDA 1D5MC 2A8VA 5M3FG 4A93B 1WD1A 1EYDA 1EY4A 2PYKA 2C5CA 2WKDA 3P7JA 4XQQA 1NMGA 1JJ2A 1LT4D 1XTCD 1UEBA 1SE4A 3C3LA 5C5MA 3TDQA 4X64L 1CFMA 3Q8DA 5COYA 2F4VQ 1ICWA 4OONA 1WCMH 3PIP3 2RHQB 3PF5A 3PUYA 1O78A 1U9RA 5ELDA 2IHFA 4EQPA 1J9OA 1Z47A 5IP9G 2EYPA 2JEBI 2K05A 3FKIG 1X65A 1ASYA 4X3UA 3PCOB 1VQEA 2OTLA 3KLSA 1JT8A 3HZXA 1TWHH 4UAIA 3NHHA 1EY5A 2A68D 1HUNA 2Q2TA 2B8GA 1A3UA 1YIJA 2MUYA 2UUAQ 3GD7A 2UXBL 4X66L 4LJZC 1Y69U 3UE1A 1C7YA 5ELBA 1RDPD 4I65A 4DK3C 1PYWD 4NP5A 2B2YC 2EXDA 1ILQA 2NZOA 4YWMA 3R2IA 2BE5D 1NCVA 1PTOD 1W3SA 1K8OA 3I4MG 3S1NB 4A3FG 1CQVA 1GUTA 3I55A 3PO2G 1GUOA 1CSPA 5CGKA 1GKHA 2O5JC 2WIIB 2SDFA 4DV0Q 4A3KH 2BE5C 4WJ4A 1E24A 1NBWA 2OQ0A 2JEAI 4M1UB 2DY7A 4JBMA 3RZDH 4DR3Q 2AUKA 1CTMA 3W5OA 1WTOA 3H0GH 1A2UA 3D6WA 2XTIA 5IYBG 3I70A 3D3RA 3PUXA 3CCEA 1NNXA 1PH8A 1PFNA 4H0LC 1PH9A 1H9KA 2VUMB 2KCMA 3HEJA 4HMJA 4TQUS 4Q5VA 3S15H 2OWOA 2OT2A 3KF6A 1C4QA 5M5XH 1Q1EA 1HNZL 1U4PA 4X66Q 4B3TL 3L9AX 1M1KC 2B2TA 3BDLA 4MNOA 1ENAA 4OIJA 5GAEC 1HHVA 4A3LH 4RGTA 1U4MA 1EY6A 2EY2A 5C0XG 1B53A 5C4JH 4X3KA 1O7ZA 3M4OH 4GNXC 1VQPA 2HQLA 2F0MA 2WP8J 4IFDG 5KYLA 3Q23A 1VQOA 5C3XA 1CUKA 3VR2A 3LWUA 4BY1H 4HJ5A 1Y1WG 4C3HH 1CHQD 4UP7A 4A93H 4BXXH 1I4HA 3ND9A 1SMYC 1PH7A 3A0JA 5EBDA 4LF9L 2C9OA 2KECA 1BKBA 1D5XC 3DLLA 1PZKD 4ZQ3A 2F0OA 1I94L 2X6GA 5DAUA 2M2LA 3KFUA 1FYCA 3KUPA 4P71A 4OX9L 4DK1A 1UAPA 3VYSA 1EWIA 1BBUA 4FXGC 1RTOA 4HIOA 2VXWA 1B3QA 3U9SA 2A6HD 2F0JA 1IBLL 3KYHC 1UNSA 1DXMA 4LWCA 1DJRD 4DXFA 1VQDA 3MXGA 4B3TQ 3EN2A 5K36H 4B9XA 4JOIC 4DR4Q 2KBNA 3I4LA 1KQSA 2A6HC 2NZHA 2ICIA 1L1OC 1B44D 2PZUA 4MZ9A 4A3CG 2D5DA 2Q2HA 3OTOL 2BA0A 1QVCA 4ME3A 3S17H 2L4NA 2B39A 2LKVA 1E1TA 4IQZA 4KKSA 5D14A 2CW0C 4HJ9A 2ES2A 3D6CA 3L0OA 1HZBA 1Q46A 3T1HL 3EQLC 1P8LA 3PQIA 1PHJA 5BN3A 3HOWH 2F0TA 1CKOA 3MA2B 3AB9A 3Q22A 1PH5A 2NVTH 3F2BA 1LTRD 3NTIA 1EFID 3AQQA 2WV6D 1GD7A 4L5TA 5IIFA 1STBA 1N34L 2J0TD 1RCVD 1KL9A 4IFDI 2VNUD 1YEZA 2A6EC 5BN5A 1V1PA 4A3IB 1EIFA 1HR0L 1MSGA 3FEWX 5J22A 5M5WH 1XNRL 3FP9A 1SYEA 2XIWA 3H0GB 4L6TB 4KV6A 4B3MQ 5JVG3 2VQFL 1Y8NB 1FJGQ 1KDBA 2CQAA 2IY5B 1H9MA 1X55A 4A3JG 5EPLA 4RHRA 2RDFA 1F2ZA 4A3CH 2A74C 1JE4A 5M5WB 2F0PA 2SEBD 1QCBD 1J5EQ 1EOVA 3HOZG 1SR3A 1C48A 1Y14B 5C44G 1EOTA 2KHSA 1ZYRD 2VB2X 1YNNC 5A2QE 1JC7A 3OYYA 4DV7Q 1XXGA 1KIXA 3C46A 2FJ2A 4JC0A 2E2IB 4FDBA 1E2WA 1EUJA 4DNRB 4G4KA 3M7GA 4PZ7A 1UE5A 4O2DA 1BCPC 3H09A 1TIID 3H0GG 1HR0Q 1SJHD 2QF7A 2EIFA 2EY1A 4JI7L 2PZWA 4H44C 4A75A 4PZ6A 2QCPX 4L63B 2B63B 2HHHQ 1B9MA 3ERQA 1F2LA 4IOAA 1CKNA 2PPBC 3HOZB 1TS5A 1CI3M 3CCLA 2HDMA 4KD4A 2EY6A 4B9WA 3S14B 2IPKD 1EL0A 1XTDA 1LM0A 1WTQA 2K5HA 2MFIA 1HNXL 5C3EG 2O4XA 2Y0SG 2K33A 4IUTA 2E8GA 1K28A 2R7FA 4POGA 3SR1A 1TKWB 3BS1A 3NBHB 3A74A 4JK1C 3S16B 1GHJA 1SLJA 2DJFC 2UU9Q 1BDOA 1STNA 4F8MA 3S1NH 1VQJA 4U673 1F9PA 4P2CB 2B2UC 4RG1A 4C3IH 2K4KA 3KDFB 4A4IA 4J8QA 2PQAB 4ZLTF 1QVFA 1F9SA 2OTJA 1PVOA 5IP7H 2MO0A 1XPRA 4DR1L 4HIDA 4DFAA 5JEAJ 5IOCA 2OXPA 5IGGA 3JAME 1I4QA 3D4DA 2MGSA 1L1OB 4OHJA 4FF4A 3VYUA 5ELEA 4WRDA 1DOKA 4OO1H 3A56A 1L0YB 2DGYA 4WFN3 1PYSB 1YHBA 5IT9E 5D65A 2K04A 3HOUG 3G7LA 4DR4L 3S15B 2E2HB 1A62A 1CZGA 4A76A 3I2ZA 3MWYW 3GP7A 2ASBA 4QCLA 5KGUA 1JB7A 4IALA 3V96A 3K57A 2ZM6L 4LUZA 2R93G 1DYQA 3HKSA 1AEXA 1GUGA 3DWQA 2JA6B 2CQOA 1D6EC 3UDGA 1DOMA 2F0IA 1Y1VH 5FOBB 2KCCA 3BZKA 4PG3A 5I6WA 5C5LA 2EYJA 2B8FA 4RHSA 5HY6A 4AYBG 3NQIA 2F0FA 1FR3A 2F4VL 2XWBB 3BYTB 2FMMA 2ZJQA 3S1QB 2ZJRA 3CW2C 1EIHA 1A3VA 3MFGA 4B3SL 1NY4A 1STYA 1OXSC 4LNQA 1CZWA 2VQFQ 1PTOB 2FHTA 1HTLD 1T5EA 1VCIA 1GHKA 3A7LA 4R4TA 5FLMH 3GTKH 1N32Q 1JCKB 1PH6A 3MXNA 1MBYA 1VF5C 3ITPA 5IYDH 2JA6G 4KKTA 2UUCL 3K0YA 4PMCA 3HOVG 1HFNA 1YITA 1JMCA 1VMPA 4MTKA 2B2UA 3DMUA 1XJVA 3N52A 3DWAA 3I73A 1H95A 3DEPA 1D1KA 3RN2A 1EYAA 1SXTA 4DR2Q 3HOVB 1SNOA 4XQNA 3RLNA 1WI5A 2NVYH 3T16A 1H9RA 4CKBA 1SAPA 1PRTC 4LF7L 1E22A 2RCFA 1IXRA 4BY7B 2EE1A 3MFYA 4MIUA 1PH1A 3VDYA 3FHWA 4UHVA 3RN5A 3W1GA 3S14H 3QG1A 2A69C 3I4MB 4NXNQ 2HUGA 4A3MH 4GKJQ 1Q8KA 1G6PA 1U4LA 3BYYB 4BBRB 1I94Q 1M4VA 1YZ6A 4CDCC 4K5VA 4JI2L 1ESRA 2CW0D 5BN4A 1I6VC 3CC7A 4IN3A 1ENFA 3UE0A 1XNQL 2NZ1D 2RSNA 4OWXB 2IT1A 2B2VA 1WTXA 2F3VA 4KN7C 4NXNL 3I4MH 2PI2E 1G91A 1JE5A 3OIQA 3RR5A 1LV9A 4O0AA 4A3MB 1I4GA 4EQNA 4IPCA 4UDUC 2ENBA 1XWEA 3NUCA 1QE6A 3CMEA 1B3AA 1N32L 1IW7C 2DUDA 3OTOQ 3CPWA 1ZKOA 2Y0SB 4ZUJA 2UUBL 2O2LD 4JYAL 3CP0A 1DGSA 5FJ8H 4YY3L 3M3YB 3L2PA 4JPBW 4M8AA 2HDLA 2IJ0A 4ZRZA 1H9SA 2EYOA 1IYUA 4PNYA 3S9WA 2JA7B 4GLAC 5M5XB 2CWPA 2RSOA 3TP5A 3FMCA 5E3FA 4A3KB 2VL6A 3I4NB 5CMDA 3NPPA 1IL2A 2NYZD 1AE2A 2Q8TA 2SNMA 4DNIA 3VA7A 3M4YA 1EQRA 1LYLA 2D0OA 2JA5H 4K5WA 2L55A 1LTSD 1R4QB 1VQCA 1MGSA 5M3MG 1VQ6A 2HT1A 2EXZA 1HZAA 4A3GH 1A8VA 1SE2A 4LW1A 2R6GA 2IWHA 5EKIA 1HUMA 4YCWA 3URYA 5I2XA 3HOXH 2YTXA 1EZ6A 3U50C 3JAML 4EVOA 3R8BA 4ABNA 3J80L 2JP1A 4JV5L 4DV2L 2NVXH 1KXLA 2N78A 3C2PA 1D1IA 1SNQA 4CDDC 4DR1Q 1A3TA 3BVMA 3I56A 3E0JA 4RH6A 1J6QA 4U68A 3IKJA 2EY5A 3U9OA 1PH4A 4CDFC 2K32A 1SE8A 2F4IA 4BWGB 3LNNA 2EQSA 2E2JB 3HKZB 3I90A 1SRUA 3STBC 4LK1C 3CQZH 4B3RQ 4FYDA 1MJEA 1D5ZC 1SYDA 3BZCA 3IRBA 3S2DH 1JOKA 4HSVA 4LF4L 4RCOA 1IL8A 1X32A 4CDEC 3SVMA 3T13A 2KHJA 3PO3H 4X6AH 1Q81C 4PQXA 1HJPA 3W3AA 4GN4B 5ELCA 1PFSA 4ZAIA 2AQ2B 2HD3A 3U58A 4QB4A 1BUVT 3O13A 2LXKA 2Z4HA 2E5LL 1OXTA 3F1ZA 2EJMA 4ZCKA 2R7ZH 2VW9A 4DR2L 3RD4A 2ICEC 2RDGA 2CCZA 3AEVA 1VQKA 2AQ1B 3F2DA 5DNFA 2R61A 3J80E 1ZEQX 1PRTD 4DV3Q 5KYIA 5NUCA 2K5QA 2R7ZB 3SGIA 4N9TA 2NVTB 4DPGA 2QEJC 3NBIA 5FO9B 4GKJL 2WINB 4YWKA 1HNWL 1HFGA 3OOCA 3BG3A 1JB3A 2NTSA 2LSSA 4C2MH 3H3VH 4KTAA 3GTJH 3I7FA 2R7ZG 2N55A 1Z7TA 4JVZA 4A3KG 3GTQB 4PMBA 2UXBQ 1PYBA 3KBXA 1XMQQ 1GXDC 2WKCA 5D3DA 2M00A 1RTNA 1HZ9A 1Q86C 2NTTA 3NXWA 1IYVA 1Y1VB 1HQRD 4V190 1HH2P 2ALYB 5CV6A 3I8ZA 3RMHA 2NBFA 1CA5A 3M3YH 1HA6A 2N3SA 4BS9A 2I46A 2JQOA 2A6ED 1GM5A 1MI2A 4HR7B 5C3WA 2QKIC 2K6AA 5LMNL 5FLXE 4QUFA 2BH8A 2JE6I 3P20A 4GNXA 1VF7A 4JI1Q 4NDXA 1PTOH 4CJ1B 1PFMA 3Q0AA 1TS2A 1STHA 4JI5Q 2R92H 1I50B 2WAQB 3QOJA 3STBD 4LFCL 2PW5A 4GN3B 2KQ3A 1BQQT 2AMCB 5C44B 2ZTCA 3OHXC 1TT2A 2X6LA 1UWVA 1XNQQ 2QGQA 2QW7A 4CKCA 1WOCA 3VYTA 5DM63 3P1HA 4A3JB 4B08A 1AZPA 1SSOA 3KDFA 3CCMA 5EGTA 1KRSA 1AFPA 1YBYA 1YJWA 4DV4Q 1H9JA 1BBWA 5G3LD 5M3FB 2UXDL 5CBEE 3OMCA 3M4OB 4ZUIA 1N34Q 1NR4A 2E2IH 1SMYD 2FFKB 5IT9c 3VR4A 1NJIC 3HOYH 3OW7A 1I6HB 1LO5D 3DUZA 2GVBA 2R3ZA 1EWHA 2WAQE 3K5LA 3CCUA 4R4IA 1PRTF 5D3IB 3A5UA 5KNCA 1NTGA 3S16H 5M3MB 2SOBA 1JOQA 4KY6A 4XT1B 3PGZA 1W2BA 2XRQD 4RFBA 4K5XA 1B4OA 1K3BC 1OXUA 3GV3A 2B2YA 3NSWA 2JSOA 1Y8PB 2AHOB 1VQLA 3OWFA 4LMQD 4IUPA 1TWFH 5K5PA 2UXDQ 1C9OA 4A3GG 4YHHL 1TWGB 3UDIA 3SE0A 1TU2B 3K5MA 1LT3D 2Q2IA 3GTOH 4KMUC 3HKZG 3CCVA 4PZ8A 1TXYA 1IZ6A 1KNAA 4HJAA 1S5DD 2A1AA 3K58A 3QR8A 3SXHA 2Z8LA 4JG2A 5KNDA 3ERSX 1V43A 4IO9A 3T1YQ 2ZJPA 4RKBA 2MPMA 3BDCA 1EIYB 5CV5A 3E3XA 5IT9L 4JCVE 4K6DA 2IL8A 2Z9HA 4DV4L 4C3IB 2EJGC 4J6HA 2JA6H 4ME5A 1S40A 2BCOA 2DNCA 3CRKC 2NVQH 3VR5A 4R4CA 2Q8RE 1T9HA 1WD0A 4X64Q 4DAVA 1X6OA 3J7AF 3J7ZC 3A55A 1K83B 5C3EH 2J4XA 3IL8A 1F9QA 1SBBB 4FXDA 2I07B 2E2HH 4A3LG 3Q24A 2Z1CA 5LL6S 4LFAQ 1O80A 1XYIA 4KY5A 3MAQA 2RF4A 2H4OA 5GAHC 3NE5B 1QUQA 1UUPA 2D0PA 4AQYL 4R1JA 4HIMA 1IHZA 1SNMA 5HGQA 4ZK9B 3P75A 1QWYA 2VB3X 5CV4A 4X65Q 3PSIA 2E76C 3NTHA 2NN6I 4CBVA 1SNDA 2VZAA 2UUBQ 4Z9CB 4AYBB 5LMUQ 1N36L 4DV0L 1TWCB 1HPCA 1X3PA 3M9BA 1S5CD 3I91A 2F0UA 2ZT9C 1UE6A 2VUMG 3E9HA 4S3SA 1PV4A 4APVA 4YCVA 3M4QA 1V8QA 4OIKA 1FNVA 1X56A 4ODGA 2EJFC 2F0KA 2SNSA 1IBML 4HCSA 1I4PA 1TY0A 4TSSA 4I7ZC 5C4ZA 1HA5A 5M3FH 3CPFA 4A3IG 2R7DA 1V1OA 1DCZA 3K80C 2M9VA 2HIXA 4N9PA 1LUZA 2B63H 1LACA 3PO2H 2F0DA 3G48A 3RZOB 4LFCQ 1EWCA 4MHEA 4DR6L 1NAPA 2IHEA 4OL7A 1ASZA 2GA4B 3QWNA 2KA7A 2R93B 5FJ8G 1B9NA 1SYCA 1JWUD 4AIMA 2A68C 3D31A 2A19A 3FPUB 4JV5Q 4RGNA 3E5SA 4NKLA 3X3NA 3JAMi 1PZID 2K5DA 4A3DH 2F0LA 2AKWB 1IKLA 5BR8Q 1A63A 4R4QA 5IP9H 2V4DA 2K5VA 1RHPA 2OEOA 2B3GA 3N6RA 1QNUA 2V1CC 2EYLA 3QO2A 2RKSA 3UI2A 2JYOA 4GKKQ 4JI6L 1ICFB 2F0GA 3PMFA 3HP3A 3FVQA 3U4ZA 3FKIB 1KNEA 1EU4A 3M4PA 4A3IH 4BBSG 4RKLA 2Q8IB 2NB0A 5A2QL 1RL2A 1ONLA 4EGVA 1VQ9A 3H91A 5M9OA 2EPBA 2JA7G 3A5ZB 4OXPA 1PXUA 4IUQA 4JI4L 5C4XG 3KJPA 1Q82C 3T4AC 4JBKA 2L15A 4FF1A 3PIO3 1I50H 2P5ZX 5J3BA 5M5YH 2OQKA 1RJTA 2K14A 5C44H 1KD1C 3EFXD 1PA6A 1CA6A 3QIAA 4AH6A 3D8GA 1QNKA 3HOUB 5GQOA 4A3JH 3KF8A 3RLOA 3NQTA 4JW0A 4X3SA 2Z4IA 5M5YB 5BR8L 1BVSA 1XPOA 1ENCA 4LF4Q 1KC8C 2F0NA 1AW7A 4IPDA 3TZDA 2G9HD 2N8NA 3J81E 4JI2Q 1ESFA 1YI2A 4GOPA 4XXEA 1SMXA 4KJOA 4QL5A 4DN4M 2Z6KC 4FO2A 1S4ZA 1E3PA 4RMFA 2MO1A 3I4OA 1O7LA 3WDNA 3VR3A 1HNWQ 3S24A 2EZVA 1OTCA 3RLFA 3GTKB 2F0SA 2BOSA 3S1RB 3I4NG 5EQ0A 4X62Q 1CHPD 4XYQA 3SDZA 4JI3Q 2LS01 4HTHA 1SFOB 4XIGS 1LTID 1MD2D 3PIPA 2H5XA 1EIGA 1ILPA 3T1HQ 4KN4C 1IBMQ 3SK4A 4KKUA 5JVH3 4JBWA 5CV8A 3LX0A 3TP7A 3NWSA 1SEBD 4C3JG 4N8X1 1LLRD 3TEHB 1AN8A 1VQGA 5HURA 3RZOH 1YNJD 2BDOA 5GROA 2K28A 2CH4W 4K2KA 3FPPA 2NN6H 2KUMA 2E75C 3CCSA 4DV5Q 5JJKA 3ER0A 3OMGA 2R93H 1XMOQ 4C1NK 3VYRA 3SK6A 2L12A 2HCIA 4K14A 3HOXG 3K8AA 1K8GA 4RGOS 4UY8C 2ID0A 1EY0A 3HS0C 4YCUA 3D4RA 4WJ3M 5TSSA 5IODA 3JC66 1QOHA 1VQ8A 3BJUA 1FL0A 2UXCQ 2JA9A 4K6LA 4DV1L 5K36G 4DV2Q 2AWOA 3EA6A 4IPHA 3R93A 1Q8IA 1QILA 1T5XD 2J7ZA 2PZTA 4C3HG 4QF4A 4GLXA 4GKKL 1IBKQ 2JN4A 1Y1VG 1SYBA 5L37A 3PV0A 4R8IA 3RZDB 2F52A 2R92B 1E2ZA 4B3SQ 4DR7Q 1EY8A 4NMZA 3CHBD 2UUCQ 5I9OA 1XMOL 3PUWA 5EKLA 1TWAB 2ATWA 2Z6BA 1SROA 5I9PA 3NWTA 1VS0A 3WOEA 4KLKA 2YU9B 3PUZA 4I7AA 1WTPA 1KLUD 4NPSA 4JI0Q 3BU2A 3T1YL 2GN5A 1HZCA 1W6JA 4OWWB 4C56C 1S5FD 2PQEA 1C8CA 2YU9H 1U5KA 4A3BB 4NB3A 1M90C 3GQBA 2RCNA 5C4HA 2B2WA 4L8JA 4DAYA 4POFA 3E9IA 4A3EH 4J1MA 4IZ8A 5GAGC 1I6HH 2K75A 4JI8Q 4ZKBB 1L2FA 1CKMA 2IW3A 3K59A 4JBJA 3A7AB 2XVSA 2PO4A 4A3MG 3BVGA 1E7ZA 2NVXB 5IYDG 3G6EA 4A3EB 1BF4A 2K5WA 1HNXQ 3PUVA 3CC2A 1JOOA 1STGA 4QJFA 4KD3A 5FLMG 3CD6A 1TWFB 1SYFA 1F2MA 4NXML 1VQFA 1PDQA 1GUSA 2CH4A 3CQZB 4DV6Q 1K8AC 3ICEA 1MHWC 1G2SA 1SNPA 3QB3A 3S2DB 1ZYRC 3A8JE 2QA4A 5IWAL 4HMIA 2RQXA 3HOZH 2CHBD 4QGUA 4R9WA 4LF7Q 4DUZL 4GOPB 1EZ8A 3OPOA 1WJJA 1WVLA 1L0XB 4LUOA 3LGJA 4XQJA 4IJHA 4C1NI 4DR5Q 3BVZA 5JPNC 4YIJA 5EJWA 2ZM6Q 1B50A 3NP8A 3F2CA 5E4XA 1D8LA 3W1BA 4JOIA 3FKIH 1VQNA 5ELOA 1FNWA 1K8MA 1B8AA 1TWGH 1YHQA 3OWEB 1QVGA 5JOBA 3GTOB 4J15A 1A15A 2K01A 4HJ8A 3KOJA 1TS3A 1QZHA 4JI7Q 2EOTA 4LFBQ 4IUNA 1RD9D 3GTLB 5CV7A 2ZTEA 5KIXA 4C3JH 1CKNB 4LF5Q 3T51B 3UDFA 3NELA 4QQBX 2KEEA 3MEHA 1EQVA 1PTOC 3GTJB 3J81L 4RA8A 2DJGC 4JI4Q 1BCPB 3J81c 5KEEA 3J81i 4A3FH 4G7ZC 2Z6KA 5EPKA 5HGTA 2IX3A 2YTYA 3H3VI 1CT1D 1RF2D 4Y7NB 1UE7A 5JJZA 4EQ5A 1OO9B 3D0FA 2EVBA 4RGMA 1F2YA 5CR3A 2Y0SE 2DY8A 2EDGA 4XTCS 4LFBL 4DV7L 2K50A 4NW2A 2E2DC 1LTAD 5CBAE 3TRZA 1E0BA 1B7YB 2AWNA 4P73A 5F2DA 3C1FA 4JI8L 1YJ9A 1N36Q 2O5IC 4X3TA 4JI3L 3WWVA 1FNUA 3R2TA 5E1FA 1Q90A 5GADC 4P75A 4DNTB 2PQAA 1CQFA 1CK1A 2MHVA 3J7AV 3GDEA 5C0XJ 3A8IE 4DAYB 1RIPA 2NN6G 4DUZQ 3QOLA 4G7HC 1SJED 3GTPB 3G71A 2FXQA 3S2HH 4HEDA 1TWCH 4WORA 3K5OA 5I6YA 1HR0W 4OELB 2BH2A 5IYCG 1PZJD 2K1BA 1HQMC 4IFDH 1LABA 5H1SE 1H9SB 3BZDB 4L5SA 4EQOA 3GO5A 4KHZA 2HHHL 4DR7L 3GTPH 3TS0A 1JR0D 4PV1C 3E0EA 4K2LA 5LHY1 4IJLA 1EFWA 4XT3B 3S1MB 2XN9C 4KK7A 2B29A 5C4JB 1G2TA 2PCFB 1BR9A 3HOVH 2YV5A 2JJQA 3GTGB
chains in the Genus database with same CATH topology
4QY7A 1UE6A 1VQIA 2ZM6L 4LUZA 1IBKL 1TWAH 2JA5G 2VUMG 2R93G 3HKSA 3E9HA 4JI0L 1N8RC 4EX5A 5DLQE 1PV4A 3CCQA 2CQOA 4APVA 4YCVA 3M4QA 4HIKA 3UDGA 4LF6Q 1X3FA 1X56A 1Y1VH 4BY7H 4BA2I 4OX9Q 3BZKA 4PG3A 1IBML 3S1MH 1Q1BA 1K0RA 3AFQA 4DR6Q 5HY6A 4AYBG 1VQ5A 5M3FH 3CPFA 4UP8A 5IYCH 4A3IG 2F4VL 4IFDJ 2I5LX 2R7DA 2ZJQA 2VQEQ 3CW2C 5AJ3Q 2ZJRA 1E1OA 1CSQA 4BBRH 3H15A 3K80C 2HIXA 4B3SL 1NY4A 2I0QA 2CKZB 1XMQL 3CCJA 1LUZA 1OXSC 4AQYQ 2B63H 4X62L 3I4NH 4LNQA 3PO2H 3TS2A 4A3BH 2WAQG 2VQEL 1L0WA 4GOPC 4NXMQ 3G48A 3L7ZC 4GLVB 2QEXA 2VQFQ 4LFCQ 4B3ML 3OW2A 4DR6L 1VCIA 3K7UC 2IHEA 4QIWE 2YYZA 1ASZA 4ALPA 4R4TA 5E7NA 5FLMH 1Q12A 4YHHQ 3GTKH 4A93G 1PH6A 1N32Q 5FJ8G 5LMNQ 4AIMA 5IYDH 3D31A 2JA6G 3CMAA 2CWAA 2UUCL 2A19A 4JV5Q 3HOVG 1GO3E 3K7AH 3RNUA 4LF9Q 2MNAA 1YITA 1JMCA 3JAMi 4AYBE 3U4VA 4A3DH 2AKWB 5LMNW 1YNXA 5BR8Q 1V9PA 1XJVA 1MKHA 4R4QA 5IP9H 1A63A 1H95A 2K5VA 2JA7H 1AH9A 1YHAA 3ULLA 1HNZQ 2B3GA 2RHSB 3RN2A 2V1CC 4OWTB 4DR2Q 4OO1G 4GKKQ 4JI6L 2LXJA 2VY3A 3RLNA 1WI5A 2NVYH 3TQYA 2N49A 1SN8A 3U4ZA 4BBRG 4LF7L 1E22A 4KHPL 1IXRA 2A8VA 5M3FG 1PH1A 3VDYA 3FHWA 3M4PA 3RN5A 4A3IH 4BBSG 3W1GA 3S14H 4TVAB 4NXNQ 3EBEA 4A3MH 1NMGA 1JJ2A 4GKJQ 1RL2A 1Q8KA 3S1QH 4LF8Q 1UEBA 1G6PA 1I94Q 1VQ9A 2GVAA 4DAMA 4X64L 1YZ6A 2JA7G 3A5ZB 3S1RH 4JI2L 4OXPA 3Q8DA 4GNXB 4DR3L 1Q7YC 4JI4L 3HOUH 4DV5L 1N9WA 2F4VQ 5C4XG 3CC7A 3KJPA 3UE0A 1XNQL 2JA8G 1Q82C 4OWXB 2IT1A 4JBKA 2L15A 4OONA 1WCMH 4P72A 4NXNL 3I4MH 2PI2E 2KCTA 2RHQB 3PF5A 1JE5A 1I50H 5J3BA 3RR5A 3PUYA 2CFMA 5M5YH 4MTNA 4O0AA 2ZTDA 5IE8A 1VQAA 2IHFA 2OQKA 3KLWA 3MEFA 4IPCA 4JI5L 3ULJA 1X54A 2K14A 5C44H 2F3IA 2YTVA 4UP9A 1Z47A 1KD1C 2WFWA 5IP9G 1VQ4A 1PA6A 1EYGA 2JEBI 4DUYQ 4AH6A 3K0XA 3CMEA 3FKIG 1X65A 1ASYA 1N32L 2DUDA 3PCOB 3OTOQ 1VQEA 5GQOA 3CPWA 4A3JH 2OTLA 2UXCL 3RLOA 1K73C 2UUBL 1JT8A 4JYAL 3CP0A 1DGSA 1TWHH 5FJ8H 4YY3L 3L2PA 5BR8L 2E2JH 2Q2TA 1BVSA 1YIJA 1XPOA 2UUAQ 2B63G 4LF4Q 2D62A 3GD7A 1KC8C 2UXBL 4GLAC 4IPDA 4PMWA 4X66L 3UDXA 2CWPA 2N8NA 4JI2Q 1YI2A 4GOPA 3UE1A 1C7YA 2VL6A 1SMXA 3KJOA 4QL5A 5EAYA 3ZJYC 2Z6KC 1IL2A 3J7A5 4DK3C 1E3PA 4RMFA 3NENA 2MO1A 3I4OA 1AE2A 1IYJB 2EXDA 2NZOA 1HNWQ 3S24A 1UE1A 4DNIA 4YWMA 1OTCA 4LF5L 3RLFA 1XPUA 1EQRA 1LYLA 1W3SA 2D0OA 3I4MG 2JA5H 4A3FG 1YJNA 3I55A 3I4NG 3PO2G 1VQCA 1CSPA 5M3MG 1VQ6A 2HT1A 1GKHA 4BA1I 4X62Q 4DV0Q 1HZAA 4A3KH 1OXVA 5IYBH 4JI3Q 4K0KQ 4WJ4A 1E24A 4A3GH 1NBWA 1A8VA 2OQ0A 4LW1A 1K9MC 2JEAI 2R6GA 2VS1A 3HFZB 4DV3L 4XIGS 4IOCA 3RZDH 1EQQA 1VQMA 4DR3Q 1VQBA 4JBMA 4YCWA 3PIPA 1KRTA 2H5XA 4JYAQ 3W5OA 3T1HQ 3HOXH 1IBMQ 2YTXA 3U50C 3H0GH 1P16A 2XTIA 5IYBG 4JBWA 3PUXA 4JV5L 4DV2L 2NVXH 4DUYL 2Z0SA 3CCEA 1KXLA 2N78A 3TEHB 1D7QA 1VQGA 1PH8A 4DR1Q 1PH9A 3RZOH 3I56A 1B70B 5GROA 1J6QA 1PH4A 2KCMA 1SE8A 4TQUS 3S15H 1MIUA 2OWOA 3CCSA 3KF6A 2EQSA 2XGTA 4JI6Q 4DV5Q 1SRUA 3STBC 5M5XH 3ER0A 5JJKA 3CQZH 1Q1EA 4B3RQ 1MJEA 2R93H 4OO1I 1XMOQ 1HNZL 3BZCA 1LTLA 4X66Q 4B3TL 1Z9FA 3IRBA 3HOXG 3S2DH 3K8AA 2BA1A 1K8GA 4UY8C 2ID0A 1M1KC 2Q2UA 4LF4L 4MNOA 1GVPA 4YCUA 5IP7G 4WJ3M 5GAEC 3PIOA 2KHJA 3PO3H 4X6AH 3JC66 1Q81C 1HJPA 4GN4B 4A3LH 5C0XG 1PFSA 1VQ8A 3BJUA 2KHIA 1FL0A 5C4JH 1VQ7A 2UXCQ 2JA9A 3U58A 5FLXc 3M4OH 4DV1L 5K36G 4DV2Q 4GNXC 2HQLA 1VQPA 2AWOA 2WP8J 4IFDG 4IPHA 2LXKA 2E5LL 1OXTA 3F1ZA 1VQOA 1X3GA 1CUKA 4GLXA 4GKKL 1IBKQ 2R7ZH 1X9NA 2VW9A 4DR2L 4BY1H 4HJ5A 1Y1WG 2UU9L 4C3HH 1MJCA 4UP7A 2CCZA 3AEVA 1QZGA 1Y1VG 4A93H 4BXXH 3PV0A 1I5FA 1VQKA 3JAMc 2WB1G 1K3RA 1PH7A 3F2DA 2UUAL 2F52A 3A0JA 4LF9L 4B3SQ 2K52A 4BXXG 4DR7Q 2K5NA 4DV3Q 1BKBA 2UUCQ 5AJ3L 5C0XI 1XMOL 3PUWA 3SGIA 4B3RL 3DLLA 4LF8L 2ATWA 1SROA 4DPGA 1S72A 1I94L 4GKJL 1VS0A 4YWKA 1I3QH 2VUMH 3KFUA 4KLKA 1HNWL 4P71A 3TREA 4YWLA 4OX9L 3PUZA 1EWIA 1JB7A 2I5HA 1BBUA 1L1OA 1VQHA 2LSSA 3BU2A 4NPSA 4C2MH 4HIOA 3T1YL 4JI0Q 2GN5A 4KHPQ 3H3VH 2OCEA 3GTJH 3AYHB 1HZCA 1IBLL 3KYHC 4OWWB 3I7FA 2R7ZG 4LWCA 3NEMA 4A3KG 3F8TA 5LMUL 1VQDA 2UXBQ 1PYBA 4B3TQ 1XMQQ 3EN2A 2YU9H 1U5KA 1HZ9A 4NB3A 1Q86C 4JOIC 1M90C 2MQHA 4DR4Q 2RCNA 2KBNA 1KQSA 4L5RC 2NZHA 4POFA 3E9IA 4A3EH 1L1OC 1HH2P 4MZ9A 1SFOH 2ALYB 3KF8B 5GAGC 1I6HH 2K75A 3B6YA 4DK6C 1NE3A 2Q2HA 2N3SA 3OTOL 3HOYG 3M3YH 4A3CG 3CCRA 3ULPA 4JI8Q 1Y1WH 2BA0A 1QVCA 4ME3A 2JQOA 3S17H 3DM3A 1L2FA 1CKMA 1GM5A 4JBJA 4LF6L 3M7NA 1FJGL 1E1TA 4A3MG 1E7ZA 1YVCA 2KENA 5LMNL 4HJ9A 2ES2A 2BH8A 2JE6I 5IYDG 3G6EA 1X3EA 4GNXA 3L0OA 1HZBA 4JI1Q 1KAWA 1Q46A 3PUVA 4L5QA 3T1HL 1HNXQ 1G291 3CC2A 1PH2A 3GTLH 3CXCA 4QJFA 5IY0A 2R92H 1P8LA 5FLMG 4JI5Q 3CD6A 1PHJA 4NXML 3HOWH 4GN5A 3STBD 2HIVA 4LFCL 4BBSH 1VQFA 5IWAQ 1CKOA 4GN3B 2AMCB 1PH5A 2NVTH 4DV6Q 1K8AC 2ZTCA 3ICEA 3F2BA 1XNQQ 1UWVA 4A3BG 3J81j 2QGQA 3AQQA 1GD7A 1WOCA 4L5TA 2QA4A 1JJGA 5IWAL 1N34L 1KL9A 3HOZH 4IFDI 2VNUD 4R4OA 1YEZA 3KDFA 4QGUA 3CCMA 1KRSA 1EIFA 1HR0L 1YBYA 4DUZL 4GOPB 4H02A 5M5WH 4DV4Q 1YJWA 1WJJA 4LF7Q 1BBWA 1XNRL 3FP9A 2UXDL 4LUOA 3LGJA 1FGUA 3PF4A 4IJHA 1V1QA 4DR5Q 4B3MQ 4BY1G 3GTQH 1N34Q 2VQFL 2E2IH 1FJGQ 2ZM6Q 2IY5B 2PNHA 1FVIA 1X55A 3M85A 3F2CA 5IT9c 4A3JG 1D8LA 3W1BA 4JOIA 1NJIC 1AE3A 3HOYH 4A3CH 3FKIH 1VQNA 3J80i 5ELOA 1C0AA 1B8AA 2GVBA 5JEAG 1TWGH 1YHQA 1J5EQ 1EOVA 4YY3Q 3HOZG 1SR3A 2WAQE 1Y14B 5C44G 4R4IA 3CCUA 1QVGA 3A5UA 1NTGA 3S16H 4J15A 3PGZA 3OYYA 4DV7Q 4HJ8A 3KOJA 1QZHA 4JI7Q 4LFBQ 1W2BA 1KIXA 3GTMH 2E5LQ 1K83H 4JC0A 2JA8H 4FDBA 1OXUA 1EUJA 2ZTEA 4PZ7A 4C3JH 1CKNB 4LF5Q 1UE5A 2AHOB 4O2DA 4Y7NH 1VQLA 3UDFA 3NELA 1TWFH 3AFPA 5C4XH 4LFAL 2UXDQ 4QQBX 1C9OA 4A3GG 3H0GG 4YHHL 3EIVA 1HR0Q 3UDIA 4A3DG 2EIFA 4JI7L 1WYDA 2Q2IA 4A75A 4JI4Q 4DV6L 3GTOH 4PZ6A 4X65L 4DKAC 3J81c 1OXXK 1N33L 3HKZG 3J81i 4PZ8A 1TXYA 3CCVA 4A3FH 2HHHQ 1IZ6A 3HKZE 3CC4A 3KF6B 4HJAA 2Z6KA 4IOAA 2A1AA 1G51A 1CKNA 2YTYA 3H3VI 4JG2A 3CCLA 1IBLQ 1UE7A 3ERSX 1JJCB 1V43A 1XTDA 4IO9A 3CF5A 3T1YQ 4EQ5A 4Y52H 3D0FA 2ZJPA 1LM0A 2K5HA 2MFIA 4JI1L 1HNXL 2Y0SE 3CAMA 5C3EG 1PH3A 1EIYB 4XTCS 4JCVE 1O7IA 2Y0SG 4LFBL 4DV7L 1U0LA 4DV4L 3GTGH 2K50A 2E8GA 3PO3G 2R7FA 3TRZA 4POGA 2JA6H 1B7YB 4UPAA 2AWNA 3NBHB 4P73A 1S40A 4JI8L 4IPGA 1YJ9A 3A74A 1N36Q 2NVQH 4R4CA 3G4SA 4JI3L 3WWVA 4K0KL 2PI2A 1SLJA 3MXNB 2UU9Q 1T9HA 1A0IA 2C35B 5GADC 1VQJA 5M3MH 4P75A 3S1NH 1QUQB 2PQAA 4X64Q 4HJ7A 1X6OA 4KI0A 4P74A 1N33Q 3J7ZC 3GDEA 5JJLA 5C3EH 4RG1A 5C0XJ 4C3IH 2I5MX 2K4KA 1RIPA 3KDFB 4DAYB 4DR5L 1R9TH 2IX1A 2NN6G 2JK8A 4A4IA 4DUZQ 2PQAB 3K81C 1S3OA 1XNRQ 3HOWG 1QVFA 2E2HH 4A3LG 2OTJA 3G71A 4BY7G 2FXQA 3S2HH 1PVOA 5IP7H 1WFQA 2MO0A 4LFAQ 1XPRA 1TWCH 2PMZE 4DR1L 4HIDA 5JEAJ 4GS3A 2RF4A 5GAHC 1KHIA 1HR0W 1QUQA 2D0PA 5IYCG 2BH2A 4LUVA 4R1JA 4AQYL 4HIMA 5JJIA 1L1OB 5HGQA 5H1SE 4L5SA 2WB1E 3GO5A 1NMFA 4KHZA 5ELNA 2HHHL 2R92G 2DGYA 4X65Q 1J5EL 1PYSB 1YHBA 2IX0A 3PSIA 3TS0A 3GTPH 4DR7L 3HOUG 3E0EA 4DR4L 2NN6I 2VZAA 4IJLA 4A3EG 1EFWA 2UUBQ 1A62A 4A76A 3I2ZA 2B29A 3J80c 5LMUQ 1N36L 4DV0L 1WCMG 2ASBA 3HOVH 4DV1Q 2YV5A 3M9BA 2JJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QY7 A;  1UE6 A;  1VQI A;  2ZM6 L;  4LUZ A;  1IBK L;  1TWA H;  2JA5 G;  2VUM G;  2R93 G;  3HKS A;  3E9H A;  4JI0 L;  1N8R C;  4EX5 A;  5DLQ E;  1PV4 A;  3CCQ A;  2CQO A;  4APV A;  4YCV A;  3M4Q A;  4HIK A;  3UDG A;  4LF6 Q;  1X3F A;  1X56 A;  1Y1V H;  4BY7 H;  4BA2 I;  4OX9 Q;  3BZK A;  4PG3 A;  1IBM L;  3S1M H;  1Q1B A;  1K0R A;  3AFQ A;  4DR6 Q;  5HY6 A;  4AYB G;  1VQ5 A;  5M3F H;  3CPF A;  4UP8 A;  5IYC H;  4A3I G;  2F4V L;  4IFD J;  2I5L X;  2R7D A;  2ZJQ A;  2VQE Q;  3CW2 C;  5AJ3 Q;  2ZJR A;  1E1O A;  1CSQ A;  4BBR H;  3H15 A;  3K80 C;  2HIX A;  4B3S L;  1NY4 A;  2I0Q A;  2CKZ B;  1XMQ L;  3CCJ A;  1LUZ A;  1OXS C;  4AQY Q;  2B63 H;  4X62 L;  3I4N H;  4LNQ A;  3PO2 H;  3TS2 A;  4A3B H;  2WAQ G;  2VQE L;  1L0W A;  4GOP C;  4NXM Q;  3G48 A;  3L7Z C;  4GLV B;  2QEX A;  2VQF Q;  4LFC Q;  4B3M L;  3OW2 A;  4DR6 L;  1VCI A;  3K7U C;  2IHE A;  4QIW E;  2YYZ A;  1ASZ A;  4ALP A;  4R4T A;  5E7N A;  5FLM H;  1Q12 A;  4YHH Q;  3GTK H;  4A93 G;  1PH6 A;  1N32 Q;  5FJ8 G;  5LMN Q;  4AIM A;  5IYD H;  3D31 A;  2JA6 G;  3CMA A;  2CWA A;  2UUC L;  2A19 A;  4JV5 Q;  3HOV G;  1GO3 E;  3K7A H;  3RNU A;  4LF9 Q;  2MNA A;  1YIT A;  1JMC A;  3JAM i;  4AYB E;  3U4V A;  4A3D H;  2AKW B;  5LMN W;  1YNX A;  5BR8 Q;  1V9P A;  1XJV A;  1MKH A;  4R4Q A;  5IP9 H;  1A63 A;  1H95 A;  2K5V A;  2JA7 H;  1AH9 A;  1YHA A;  3ULL A;  1HNZ Q;  2B3G A;  2RHS B;  3RN2 A;  2V1C C;  4OWT B;  4DR2 Q;  4OO1 G;  4GKK Q;  4JI6 L;  2LXJ A;  2VY3 A;  3RLN A;  1WI5 A;  2NVY H;  3TQY A;  2N49 A;  1SN8 A;  3U4Z A;  4BBR G;  4LF7 L;  1E22 A;  4KHP L;  1IXR A;  2A8V A;  5M3F G;  1PH1 A;  3VDY A;  3FHW A;  3M4P A;  3RN5 A;  4A3I H;  4BBS G;  3W1G A;  3S14 H;  4TVA B;  4NXN Q;  3EBE A;  4A3M H;  1NMG A;  1JJ2 A;  4GKJ Q;  1RL2 A;  1Q8K A;  3S1Q H;  4LF8 Q;  1UEB A;  1G6P A;  1I94 Q;  1VQ9 A;  2GVA A;  4DAM A;  4X64 L;  1YZ6 A;  2JA7 G;  3A5Z B;  3S1R H;  4JI2 L;  4OXP A;  3Q8D A;  4GNX B;  4DR3 L;  1Q7Y C;  4JI4 L;  3HOU H;  4DV5 L;  1N9W A;  2F4V Q;  5C4X G;  3CC7 A;  3KJP A;  3UE0 A;  1XNQ L;  2JA8 G;  1Q82 C;  4OWX B;  2IT1 A;  4JBK A;  2L15 A;  4OON A;  1WCM H;  4P72 A;  4NXN L;  3I4M H;  2PI2 E;  2KCT A;  2RHQ B;  3PF5 A;  1JE5 A;  1I50 H;  5J3B A;  3RR5 A;  3PUY A;  2CFM A;  5M5Y H;  4MTN A;  4O0A A;  2ZTD A;  5IE8 A;  1VQA A;  2IHF A;  2OQK A;  3KLW A;  3MEF A;  4IPC A;  4JI5 L;  3ULJ A;  1X54 A;  2K14 A;  5C44 H;  2F3I A;  2YTV A;  4UP9 A;  1Z47 A;  1KD1 C;  2WFW A;  5IP9 G;  1VQ4 A;  1PA6 A;  1EYG A;  2JEB I;  4DUY Q;  4AH6 A;  3K0X A;  3CME A;  3FKI G;  1X65 A;  1ASY A;  1N32 L;  2DUD A;  3PCO B;  3OTO Q;  1VQE A;  5GQO A;  3CPW A;  4A3J H;  2OTL A;  2UXC L;  3RLO A;  1K73 C;  2UUB L;  1JT8 A;  4JYA L;  3CP0 A;  1DGS A;  1TWH H;  5FJ8 H;  4YY3 L;  3L2P A;  5BR8 L;  2E2J H;  2Q2T A;  1BVS A;  1YIJ A;  1XPO A;  2UUA Q;  2B63 G;  4LF4 Q;  2D62 A;  3GD7 A;  1KC8 C;  2UXB L;  4GLA C;  4IPD A;  4PMW A;  4X66 L;  3UDX A;  2CWP A;  2N8N A;  4JI2 Q;  1YI2 A;  4GOP A;  3UE1 A;  1C7Y A;  2VL6 A;  1SMX A;  3KJO A;  4QL5 A;  5EAY A;  3ZJY C;  2Z6K C;  1IL2 A;  3J7A 5;  4DK3 C;  1E3P A;  4RMF A;  3NEN A;  2MO1 A;  3I4O A;  1AE2 A;  1IYJ B;  2EXD A;  2NZO A;  1HNW Q;  3S24 A;  1UE1 A;  4DNI A;  4YWM A;  1OTC A;  4LF5 L;  3RLF A;  1XPU A;  1EQR A;  1LYL A;  1W3S A;  2D0O A;  3I4M G;  2JA5 H;  4A3F G;  1YJN A;  3I55 A;  3I4N G;  3PO2 G;  1VQC A;  1CSP A;  5M3M G;  1VQ6 A;  2HT1 A;  1GKH A;  4BA1 I;  4X62 Q;  4DV0 Q;  1HZA A;  4A3K H;  1OXV A;  5IYB H;  4JI3 Q;  4K0K Q;  4WJ4 A;  1E24 A;  4A3G H;  1NBW A;  1A8V A;  2OQ0 A;  4LW1 A;  1K9M C;  2JEA I;  2R6G A;  2VS1 A;  3HFZ B;  4DV3 L;  4XIG S;  4IOC A;  3RZD H;  1EQQ A;  1VQM A;  4DR3 Q;  1VQB A;  4JBM A;  4YCW A;  3PIP A;  1KRT A;  2H5X A;  4JYA Q;  3W5O A;  3T1H Q;  3HOX H;  1IBM Q;  2YTX A;  3U50 C;  3H0G H;  1P16 A;  2XTI A;  5IYB G;  4JBW A;  3PUX A;  4JV5 L;  4DV2 L;  2NVX H;  4DUY L;  2Z0S A;  3CCE A;  1KXL A;  2N78 A;  3TEH B;  1D7Q A;  1VQG A;  1PH8 A;  4DR1 Q;  1PH9 A;  3RZO H;  3I56 A;  1B70 B;  5GRO A;  1J6Q A;  1PH4 A;  2KCM A;  1SE8 A;  4TQU S;  3S15 H;  1MIU A;  2OWO A;  3CCS A;  3KF6 A;  2EQS A;  2XGT A;  4JI6 Q;  4DV5 Q;  1SRU A;  3STB C;  5M5X H;  3ER0 A;  5JJK A;  3CQZ H;  1Q1E A;  4B3R Q;  1MJE A;  2R93 H;  4OO1 I;  1XMO Q;  1HNZ L;  3BZC A;  1LTL A;  4X66 Q;  4B3T L;  1Z9F A;  3IRB A;  3HOX G;  3S2D H;  3K8A A;  2BA1 A;  1K8G A;  4UY8 C;  2ID0 A;  1M1K C;  2Q2U A;  4LF4 L;  4MNO A;  1GVP A;  4YCU A;  5IP7 G;  4WJ3 M;  5GAE C;  3PIO A;  2KHJ A;  3PO3 H;  4X6A H;  3JC6 6;  1Q81 C;  1HJP A;  4GN4 B;  4A3L H;  5C0X G;  1PFS A;  1VQ8 A;  3BJU A;  2KHI A;  1FL0 A;  5C4J H;  1VQ7 A;  2UXC Q;  2JA9 A;  3U58 A;  5FLX c;  3M4O H;  4DV1 L;  5K36 G;  4DV2 Q;  4GNX C;  2HQL A;  1VQP A;  2AWO A;  2WP8 J;  4IFD G;  4IPH A;  2LXK A;  2E5L L;  1OXT A;  3F1Z A;  1VQO A;  1X3G A;  1CUK A;  4GLX A;  4GKK L;  1IBK Q;  2R7Z H;  1X9N A;  2VW9 A;  4DR2 L;  4BY1 H;  4HJ5 A;  1Y1W G;  2UU9 L;  4C3H H;  1MJC A;  4UP7 A;  2CCZ A;  3AEV A;  1QZG A;  1Y1V G;  4A93 H;  4BXX H;  3PV0 A;  1I5F A;  1VQK A;  3JAM c;  2WB1 G;  1K3R A;  1PH7 A;  3F2D A;  2UUA L;  2F52 A;  3A0J A;  4LF9 L;  4B3S Q;  2K52 A;  4BXX G;  4DR7 Q;  2K5N A;  4DV3 Q;  1BKB A;  2UUC Q;  5AJ3 L;  5C0X I;  1XMO L;  3PUW A;  3SGI A;  4B3R L;  3DLL A;  4LF8 L;  2ATW A;  1SRO A;  4DPG A;  1S72 A;  1I94 L;  4GKJ L;  1VS0 A;  4YWK A;  1I3Q H;  2VUM H;  3KFU A;  4KLK A;  1HNW L;  4P71 A;  3TRE A;  4YWL A;  4OX9 L;  3PUZ A;  1EWI A;  1JB7 A;  2I5H A;  1BBU A;  1L1O A;  1VQH A;  2LSS A;  3BU2 A;  4NPS A;  4C2M H;  4HIO A;  3T1Y L;  4JI0 Q;  2GN5 A;  4KHP Q;  3H3V H;  2OCE A;  3GTJ H;  3AYH B;  1HZC A;  1IBL L;  3KYH C;  4OWW B;  3I7F A;  2R7Z G;  4LWC A;  3NEM A;  4A3K G;  3F8T A;  5LMU L;  1VQD A;  2UXB Q;  1PYB A;  4B3T Q;  1XMQ Q;  3EN2 A;  2YU9 H;  1U5K A;  1HZ9 A;  4NB3 A;  1Q86 C;  4JOI C;  1M90 C;  2MQH A;  4DR4 Q;  2RCN A;  2KBN A;  1KQS A;  4L5R C;  2NZH A;  4POF A;  3E9I A;  4A3E H;  1L1O C;  1HH2 P;  4MZ9 A;  1SFO H;  2ALY B;  3KF8 B;  5GAG C;  1I6H H;  2K75 A;  3B6Y A;  4DK6 C;  1NE3 A;  2Q2H A;  2N3S A;  3OTO L;  3HOY G;  3M3Y H;  4A3C G;  3CCR A;  3ULP A;  4JI8 Q;  1Y1W H;  2BA0 A;  1QVC A;  4ME3 A;  2JQO A;  3S17 H;  3DM3 A;  1L2F A;  1CKM A;  1GM5 A;  4JBJ A;  4LF6 L;  3M7N A;  1FJG L;  1E1T A;  4A3M G;  1E7Z A;  1YVC A;  2KEN A;  5LMN L;  4HJ9 A;  2ES2 A;  2BH8 A;  2JE6 I;  5IYD G;  3G6E A;  1X3E A;  4GNX A;  3L0O A;  1HZB A;  4JI1 Q;  1KAW A;  1Q46 A;  3PUV A;  4L5Q A;  3T1H L;  1HNX Q;  1G29 1;  3CC2 A;  1PH2 A;  3GTL H;  3CXC A;  4QJF A;  5IY0 A;  2R92 H;  1P8L A;  5FLM G;  4JI5 Q;  3CD6 A;  1PHJ A;  4NXM L;  3HOW H;  4GN5 A;  3STB D;  2HIV A;  4LFC L;  4BBS H;  1VQF A;  5IWA Q;  1CKO A;  4GN3 B;  2AMC B;  1PH5 A;  2NVT H;  4DV6 Q;  1K8A C;  2ZTC A;  3ICE A;  3F2B A;  1XNQ Q;  1UWV A;  4A3B G;  3J81 j;  2QGQ A;  3AQQ A;  1GD7 A;  1WOC A;  4L5T A;  2QA4 A;  1JJG A;  5IWA L;  1N34 L;  1KL9 A;  3HOZ H;  4IFD I;  2VNU D;  4R4O A;  1YEZ A;  3KDF A;  4QGU A;  3CCM A;  1KRS A;  1EIF A;  1HR0 L;  1YBY A;  4DUZ L;  4GOP B;  4H02 A;  5M5W H;  4DV4 Q;  1YJW A;  1WJJ A;  4LF7 Q;  1BBW A;  1XNR L;  3FP9 A;  2UXD L;  4LUO A;  3LGJ A;  1FGU A;  3PF4 A;  4IJH A;  1V1Q A;  4DR5 Q;  4B3M Q;  4BY1 G;  3GTQ H;  1N34 Q;  2VQF L;  2E2I H;  1FJG Q;  2ZM6 Q;  2IY5 B;  2PNH A;  1FVI A;  1X55 A;  3M85 A;  3F2C A;  5IT9 c;  4A3J G;  1D8L A;  3W1B A;  4JOI A;  1NJI C;  1AE3 A;  3HOY H;  4A3C H;  3FKI H;  1VQN A;  3J80 i;  5ELO A;  1C0A A;  1B8A A;  2GVB A;  5JEA G;  1TWG H;  1YHQ A;  1J5E Q;  1EOV A;  4YY3 Q;  3HOZ G;  1SR3 A;  2WAQ E;  1Y14 B;  5C44 G;  4R4I A;  3CCU A;  1QVG A;  3A5U A;  1NTG A;  3S16 H;  4J15 A;  3PGZ A;  3OYY A;  4DV7 Q;  4HJ8 A;  3KOJ A;  1QZH A;  4JI7 Q;  4LFB Q;  1W2B A;  1KIX A;  3GTM H;  2E5L Q;  1K83 H;  4JC0 A;  2JA8 H;  4FDB A;  1OXU A;  1EUJ A;  2ZTE A;  4PZ7 A;  4C3J H;  1CKN B;  4LF5 Q;  1UE5 A;  2AHO B;  4O2D A;  4Y7N H;  1VQL A;  3UDF A;  3NEL A;  1TWF H;  3AFP A;  5C4X H;  4LFA L;  2UXD Q;  4QQB X;  1C9O A;  4A3G G;  3H0G G;  4YHH L;  3EIV A;  1HR0 Q;  3UDI A;  4A3D G;  2EIF A;  4JI7 L;  1WYD A;  2Q2I A;  4A75 A;  4JI4 Q;  4DV6 L;  3GTO H;  4PZ6 A;  4X65 L;  4DKA C;  3J81 c;  1OXX K;  1N33 L;  3HKZ G;  3J81 i;  4PZ8 A;  1TXY A;  3CCV A;  4A3F H;  2HHH Q;  1IZ6 A;  3HKZ E;  3CC4 A;  3KF6 B;  4HJA A;  2Z6K A;  4IOA A;  2A1A A;  1G51 A;  1CKN A;  2YTY A;  3H3V I;  4JG2 A;  3CCL A;  1IBL Q;  1UE7 A;  3ERS X;  1JJC B;  1V43 A;  1XTD A;  4IO9 A;  3CF5 A;  3T1Y Q;  4EQ5 A;  4Y52 H;  3D0F A;  2ZJP A;  1LM0 A;  2K5H A;  2MFI A;  4JI1 L;  1HNX L;  2Y0S E;  3CAM A;  5C3E G;  1PH3 A;  1EIY B;  4XTC S;  4JCV E;  1O7I A;  2Y0S G;  4LFB L;  4DV7 L;  1U0L A;  4DV4 L;  3GTG H;  2K50 A;  2E8G A;  3PO3 G;  2R7F A;  3TRZ A;  4POG A;  2JA6 H;  1B7Y B;  4UPA A;  2AWN A;  3NBH B;  4P73 A;  1S40 A;  4JI8 L;  4IPG A;  1YJ9 A;  3A74 A;  1N36 Q;  2NVQ H;  4R4C A;  3G4S A;  4JI3 L;  3WWV A;  4K0K L;  2PI2 A;  1SLJ A;  3MXN B;  2UU9 Q;  1T9H A;  1A0I A;  2C35 B;  5GAD C;  1VQJ A;  5M3M H;  4P75 A;  3S1N H;  1QUQ B;  2PQA A;  4X64 Q;  4HJ7 A;  1X6O A;  4KI0 A;  4P74 A;  1N33 Q;  3J7Z C;  3GDE A;  5JJL A;  5C3E H;  4RG1 A;  5C0X J;  4C3I H;  2I5M X;  2K4K A;  1RIP A;  3KDF B;  4DAY B;  4DR5 L;  1R9T H;  2IX1 A;  2NN6 G;  2JK8 A;  4A4I A;  4DUZ Q;  2PQA B;  3K81 C;  1S3O A;  1XNR Q;  3HOW G;  1QVF A;  2E2H H;  4A3L G;  2OTJ A;  3G71 A;  4BY7 G;  2FXQ A;  3S2H H;  1PVO A;  5IP7 H;  1WFQ A;  2MO0 A;  4LFA Q;  1XPR A;  1TWC H;  2PMZ E;  4DR1 L;  4HID A;  5JEA J;  4GS3 A;  2RF4 A;  5GAH C;  1KHI A;  1HR0 W;  1QUQ A;  2D0P A;  5IYC G;  2BH2 A;  4LUV A;  4R1J A;  4AQY L;  4HIM A;  5JJI A;  1L1O B;  5HGQ A;  5H1S E;  4L5S A;  2WB1 E;  3GO5 A;  1NMF A;  4KHZ A;  5ELN A;  2HHH L;  2R92 G;  2DGY A;  4X65 Q;  1J5E L;  1PYS B;  1YHB A;  2IX0 A;  3PSI A;  3TS0 A;  3GTP H;  4DR7 L;  3HOU G;  3E0E A;  4DR4 L;  2NN6 I;  2VZA A;  4IJL A;  4A3E G;  1EFW A;  2UUB Q;  1A62 A;  4A76 A;  3I2Z A;  2B29 A;  3J80 c;  5LMU Q;  1N36 L;  4DV0 L;  1WCM G;  2ASB A;  3HOV H;  4DV1 Q;  2YV5 A;  3M9B A;  2JJQ A; 
#chains in the Genus database with same CATH topology
 2NUC A;  1IBK L;  1LTB D;  4JI0 L;  5DLQ E;  4LF6 Q;  1K0S A;  4HIK A;  1X3F A;  4BY7 H;  1F9R A;  1ML0 D;  4OX9 Q;  3FRP B;  2D2C C;  1YNJ C;  2LMC B;  2OF1 A;  3H6M A;  3S1M H;  5G3L F;  3H94 A;  4C2M B;  4CJ2 C;  1WTW A;  1VQ5 A;  5IYC H;  4IFD J;  4H13 C;  2NWG A;  4BBR H;  3H15 A;  1BXT A;  3DHQ A;  1JQY D;  2I0Q A;  1XMQ L;  2A69 D;  4AQY Q;  1R9T B;  3TS2 A;  1SNC A;  3F2U A;  1BBX C;  3L7Z C;  1UEA B;  4G7O C;  4A3D B;  3D4W A;  4B3M L;  1B1Z A;  3OW2 A;  2D9U A;  1HTP A;  2YYZ A;  3NTK A;  5E7N A;  4BBS B;  4YHH Q;  3GV6 A;  3DM1 A;  1JIC A;  4Q0F A;  1PTO F;  5FO8 B;  5LMN Q;  1TR5 A;  2WAC A;  4C3I G;  2F0W A;  1RKN A;  4R8N A;  5I4D A;  3RNU A;  4LF9 Q;  4QIW B;  4C3J B;  4DU9 A;  5LMN W;  4HN7 A;  2NVQ B;  2RVL A;  1U4R A;  1PMR A;  4IUR A;  2JA7 H;  1AH9 A;  1YHA A;  3ULL A;  1HNZ Q;  4OO1 G;  1HXY D;  2HQE A;  3K5N A;  2LXJ A;  3VR6 A;  2JXM B;  3TQY A;  4BBR G;  1SN8 A;  4KHP L;  1QG7 A;  3HRZ C;  3TP8 A;  2MP1 A;  5ISR A;  1A2T A;  4TVA B;  3EBE A;  2LY7 A;  3S1Q H;  2L9H A;  4LF8 Q;  3GTM B;  1EYC A;  1KAA A;  2GVA A;  4DAM A;  1DD2 A;  2KOL A;  3S1R H;  4GNX B;  4DR3 L;  3HOU H;  1Q7Y C;  4DV5 L;  1N9W A;  4N8F A;  3X3M A;  4A3G B;  2K7V A;  2JA8 G;  2F0Q A;  5FO7 B;  4P72 A;  2H1E A;  2KCT A;  3KLS X;  2CFM A;  4MTN A;  2ZTD A;  1F77 A;  3MXU A;  1VQA A;  3MEF A;  3OIP A;  3KLW A;  3QJY A;  5IE8 A;  4JI5 L;  3ONA B;  3ULJ A;  1X54 A;  1II3 A;  2F3I A;  2YTV A;  4UP9 A;  2WFW A;  5T1I A;  1VQ4 A;  1EYG A;  2ZXP A;  1EQT A;  4DUY Q;  3K0X A;  2PMZ B;  2F0V A;  3KLR A;  2UXC L;  1I4R A;  1K73 C;  3ERO A;  3TME A;  3S2H B;  2E2J H;  1Y1W B;  1PRT B;  1KLG D;  2XNA C;  2HCC A;  2B63 G;  1FGB D;  1BO0 A;  2D62 A;  1IKM A;  1O7Y A;  4PMW A;  3UDX A;  2TMP A;  4FVM A;  3KJO A;  3MVV A;  3PO2 B;  2NVY B;  5EAY A;  3ZJY C;  3J7A 5;  3NEN A;  3MC0 B;  1IYJ B;  4K8I A;  4IUV A;  1UE1 A;  1TWH B;  4HCE A;  5EBC A;  4LF5 L;  3A54 A;  4DAP A;  1XPU A;  3I72 A;  4ILW A;  4DGZ A;  1R4P B;  1YJN A;  5AFW A;  1TQO A;  4IUU A;  1D2B A;  4BA1 I;  1GUW A;  1OXV A;  3KBG A;  5IYB H;  4K0K Q;  1K9M C;  3AU7 A;  2VS1 A;  4DV3 L;  3HFZ B;  4IOC A;  1EQQ A;  1VQM A;  1VQB A;  1KRT A;  4JYA Q;  1AP0 A;  2G5D A;  3DEO A;  5T1G A;  4XYO A;  1NR2 A;  1P16 A;  3TSS A;  3EVQ A;  4KY7 A;  1WTV A;  4DUY L;  2Z0S A;  3IFT A;  1D7Q A;  5C3E B;  5DM7 3;  3I3C A;  1B70 B;  3H3V C;  3ZYY X;  4K8J A;  4QMG A;  3HGB A;  4F87 A;  1MIU A;  4FXK C;  2XGT A;  4JI6 Q;  1GUN A;  1PLF A;  3R3O A;  4OO1 I;  1LTL A;  2PNR C;  1HRJ A;  1Z9F A;  4ZKC B;  2BA1 A;  1DOL A;  4RCN A;  2B2W C;  1EEI D;  1STA A;  2Q2U A;  1GVP A;  5I2Y A;  5IP7 G;  3PIO A;  3OSO A;  4XDX A;  2KHI A;  1VQ7 A;  5FLX c;  5JPM C;  1QJO A;  1X3G A;  5IGC A;  1W6K A;  2FIN B;  1X9N A;  1BOS A;  2EYH A;  3TZU A;  4GZY C;  1I4X A;  3T53 B;  2UU9 L;  1MJC A;  1QZG A;  1I5F A;  1BCP D;  5J1Z A;  2WB1 G;  1K3R A;  3JAM c;  2UUA L;  5DEH A;  2DNE A;  2K52 A;  5CC4 A;  5CV9 A;  4BXX G;  2G9D A;  2K5N A;  1GOZ A;  1M8A A;  2RA4 A;  3TBI B;  3SK5 A;  5AJ3 L;  5C0X I;  4B3R L;  4LF8 L;  2B2T C;  1S72 A;  1LTG D;  1G6Z A;  3LWE A;  2VUM H;  1I3Q H;  1TS4 A;  1YNN D;  3TRE A;  4YWL A;  1V1P B;  2MJ8 A;  2I5H A;  1L1O A;  1VQH A;  4KHP Q;  2OCE A;  3AYH B;  1MSH A;  2PW7 A;  4O42 A;  4DF7 A;  5COR A;  1S5B D;  1ET6 A;  3NEM A;  3F8T A;  5LMU L;  2L5T A;  3EJI A;  5KRU A;  2QDL A;  2XRS D;  2RBM A;  2MQH A;  4L5R C;  5IGB A;  2F03 A;  2KVM A;  2N88 A;  5E4W C;  1SFO H;  3KF8 B;  1WTH A;  2A73 B;  3A8K E;  3HOY G;  3B6Y A;  4DK6 C;  1NE3 A;  3PO3 B;  4ULL A;  3CCR A;  3ULP A;  1Y1W H;  3Q6S A;  3DM3 A;  1ET9 A;  4LF6 L;  3M7N A;  2BDN A;  1FJG L;  1LT5 D;  2KED A;  1WTR A;  3KK7 A;  1YVC A;  2KEN A;  3T56 B;  4BY1 B;  3ND8 A;  3FDT A;  1X3E A;  4C3H B;  1KAW A;  1KDC A;  1ROD A;  4L5Q A;  3GTL H;  1G29 1;  1WCM B;  1PH2 A;  2ZXO A;  5IY0 A;  4KHV A;  4GN5 A;  4BBS H;  2HIV A;  3DWP A;  5IWA Q;  1EEF D;  2DN8 A;  1EY7 A;  4F7X A;  1LT6 D;  4A3B G;  3J81 j;  1JJG A;  1A6X A;  1XX8 A;  1LTT D;  3DXJ C;  4R4O A;  4HSP A;  4O1N A;  4H02 A;  5CYU A;  4KJN A;  3K6O A;  1FGU A;  3PF4 A;  3HOW B;  2F0H A;  1V1Q A;  4OEM B;  4BY1 G;  3GTQ H;  2PNH A;  5IGF A;  1FVI A;  3IFD A;  1IW7 D;  3M85 A;  1AE3 A;  3J80 i;  1C0A A;  5JEA G;  5C0X H;  3SK8 A;  4YY3 Q;  1GJX A;  3L3O C;  3S17 B;  1KAB A;  1SYG A;  5LL6 X;  3GTM H;  2E5L Q;  1VDZ A;  3CU7 A;  1K83 H;  2JA8 H;  3BDO A;  2X69 A;  4FF2 A;  2AQ3 B;  4Y7N H;  5EKK A;  4LFA L;  3TP6 A;  3AFP A;  2F1M A;  5C4X H;  1J8I A;  3EIV A;  4A3D G;  1HCZ A;  2K03 A;  2XSC A;  1WYD A;  4FNF A;  4DV6 L;  3CKI B;  4X65 L;  4DKA C;  1DM0 B;  1OXX K;  2F0E A;  1N33 L;  2JA8 B;  4FP5 D;  1EY9 A;  5FKA C;  3HKZ E;  4CKE A;  3CC4 A;  3KF6 B;  2QIL A;  1G51 A;  1BCP F;  1IBL Q;  3MXP A;  5FLX L;  1JJC B;  3CF5 A;  3CRL C;  4E6I A;  4Y52 H;  1KDA A;  3G6J B;  3J7Y W;  4JI1 L;  3CAM A;  1PH3 A;  1O7I A;  2TSS A;  1ZXT A;  4V0B A;  2AUJ D;  1U0L A;  3SHL A;  3GTG H;  4HAE A;  5KNB A;  1I3Q B;  4H7B A;  2XWJ B;  5IGE A;  3PO3 G;  1BNZ A;  3V05 A;  3HOY B;  4UPA A;  2EYM A;  4IPG A;  5IGD A;  2EYF A;  3G4S A;  3HOX B;  4K0K L;  2E74 C;  2PI2 A;  3MXN B;  3RUZ A;  1A0I A;  2C35 B;  5J39 A;  5M3M H;  4ID6 A;  1SE3 A;  1QUQ B;  4HJ7 A;  4CHT B;  1N33 Q;  4KI0 A;  4P74 A;  4DA2 A;  4LAA A;  5JJL A;  2LFN A;  4DR5 L;  2I5M X;  1R9T H;  1AZQ A;  2IX1 A;  1JOR A;  2JK8 A;  3K81 C;  1DON A;  1S3O A;  1XNR Q;  3HOW G;  2QDB A;  4BY7 G;  1WFQ A;  2PMZ E;  1CM9 A;  1NUC A;  4GS3 A;  1NSN S;  4QUC A;  3TN2 A;  1KHI A;  3NBH A;  2FMC A;  3W2D A;  4LUV A;  5JJI A;  5JAV A;  3MHB A;  2WB1 E;  1NMF A;  5ELN A;  1S5E D;  2R92 G;  2WB1 B;  5C6A A;  1J5E L;  2IX0 A;  1TVX A;  5FK9 C;  5A35 A;  4A3E G;  2B2V C;  4F88 A;  3J80 c;  4CJ0 B;  1G8Z D;  1WCM G;  1Q3L A;  4DV1 Q;  3CXC A;  4QY7 A;  2JA5 G;  1KTK A;  1VQI A;  1Z6H A;  1TWA H;  1N8R C;  4EX5 A;  4RAU C;  4DXG A;  3CCQ A;  3WOF A;  4BA2 I;  1PFB A;  3SEB A;  1Y8O B;  1Q1B A;  1E2V A;  1K0R A;  3AFQ A;  4DR6 Q;  3IAY A;  1JWM D;  4UP8 A;  2L11 A;  2I5L X;  3C1E A;  1B2T A;  2VQE Q;  5AJ3 Q;  1SDF A;  1E1O A;  1CSQ A;  3AMU A;  2CKZ B;  4OGQ C;  3CCJ A;  4A3F B;  2KJX A;  4X62 L;  3I4N H;  1JWS D;  4A3B H;  2WAQ G;  2VQE L;  1L0W A;  4GOP C;  5JEA H;  4NXM Q;  5EPJ A;  2A5H A;  2QEX A;  4GLV B;  3MTS A;  2ZXR A;  3K7U C;  4QIW E;  1EU3 A;  3E6Z X;  1TY2 A;  4ALP A;  1STE A;  4A93 G;  1Q12 A;  5ELF A;  2JA5 B;  2RDH A;  3NK9 A;  4ZYS A;  4G57 A;  1QB5 D;  2CVR A;  3CMA A;  2CWA A;  1FD7 D;  1GO3 E;  4CGY B;  3K7A H;  1X3Q A;  4TKO B;  2MNA A;  4MN3 A;  4AYB E;  3U4V A;  5C4X B;  4DK0 A;  4FF3 A;  1YNX A;  1V9P A;  1MKH A;  2L0C A;  2L1B A;  3VA5 A;  4RWS C;  4WJW A;  2RHS B;  4OWT B;  3MZ5 A;  2VY3 A;  1DZ1 A;  3K7A B;  3V2T A;  2N49 A;  2F3W A;  1VMC A;  3HG9 A;  2KCN A;  4TRD A;  1D5M C;  2A8V A;  5M3F G;  4A93 B;  1WD1 A;  1EYD A;  1EY4 A;  2PYK A;  2C5C A;  2WKD A;  3P7J A;  4XQQ A;  1NMG A;  1JJ2 A;  1LT4 D;  1XTC D;  1UEB A;  1SE4 A;  3C3L A;  5C5M A;  3TDQ A;  4X64 L;  1CFM A;  3Q8D A;  5COY A;  2F4V Q;  1ICW A;  4OON A;  1WCM H;  3PIP 3;  2RHQ B;  3PF5 A;  3PUY A;  1O78 A;  1U9R A;  5ELD A;  2IHF A;  4EQP A;  1J9O A;  1Z47 A;  5IP9 G;  2EYP A;  2JEB I;  2K05 A;  3FKI G;  1X65 A;  1ASY A;  4X3U A;  3PCO B;  1VQE A;  2OTL A;  3KLS A;  1JT8 A;  3HZX A;  1TWH H;  4UAI A;  3NHH A;  1EY5 A;  2A68 D;  1HUN A;  2Q2T A;  2B8G A;  1A3U A;  1YIJ A;  2MUY A;  2UUA Q;  3GD7 A;  2UXB L;  4X66 L;  4LJZ C;  1Y69 U;  3UE1 A;  1C7Y A;  5ELB A;  1RDP D;  4I65 A;  4DK3 C;  1PYW D;  4NP5 A;  2B2Y C;  2EXD A;  1ILQ A;  2NZO A;  4YWM A;  3R2I A;  2BE5 D;  1NCV A;  1PTO D;  1W3S A;  1K8O A;  3I4M G;  3S1N B;  4A3F G;  1CQV A;  1GUT A;  3I55 A;  3PO2 G;  1GUO A;  1CSP A;  5CGK A;  1GKH A;  2O5J C;  2WII B;  2SDF A;  4DV0 Q;  4A3K H;  2BE5 C;  4WJ4 A;  1E24 A;  1NBW A;  2OQ0 A;  2JEA I;  4M1U B;  2DY7 A;  4JBM A;  3RZD H;  4DR3 Q;  2AUK A;  1CTM A;  3W5O A;  1WTO A;  3H0G H;  1A2U A;  3D6W A;  2XTI A;  5IYB G;  3I70 A;  3D3R A;  3PUX A;  3CCE A;  1NNX A;  1PH8 A;  1PFN A;  4H0L C;  1PH9 A;  1H9K A;  2VUM B;  2KCM A;  3HEJ A;  4HMJ A;  4TQU S;  4Q5V A;  3S15 H;  2OWO A;  2OT2 A;  3KF6 A;  1C4Q A;  5M5X H;  1Q1E A;  1HNZ L;  1U4P A;  4X66 Q;  4B3T L;  3L9A X;  1M1K C;  2B2T A;  3BDL A;  4MNO A;  1ENA A;  4OIJ A;  5GAE C;  1HHV A;  4A3L H;  4RGT A;  1U4M A;  1EY6 A;  2EY2 A;  5C0X G;  1B53 A;  5C4J H;  4X3K A;  1O7Z A;  3M4O H;  4GNX C;  1VQP A;  2HQL A;  2F0M A;  2WP8 J;  4IFD G;  5KYL A;  3Q23 A;  1VQO A;  5C3X A;  1CUK A;  3VR2 A;  3LWU A;  4BY1 H;  4HJ5 A;  1Y1W G;  4C3H H;  1CHQ D;  4UP7 A;  4A93 H;  4BXX H;  1I4H A;  3ND9 A;  1SMY C;  1PH7 A;  3A0J A;  5EBD A;  4LF9 L;  2C9O A;  2KEC A;  1BKB A;  1D5X C;  3DLL A;  1PZK D;  4ZQ3 A;  2F0O A;  1I94 L;  2X6G A;  5DAU A;  2M2L A;  3KFU A;  1FYC A;  3KUP A;  4P71 A;  4OX9 L;  4DK1 A;  1UAP A;  3VYS A;  1EWI A;  1BBU A;  4FXG C;  1RTO A;  4HIO A;  2VXW A;  1B3Q A;  3U9S A;  2A6H D;  2F0J A;  1IBL L;  3KYH C;  1UNS A;  1DXM A;  4LWC A;  1DJR D;  4DXF A;  1VQD A;  3MXG A;  4B3T Q;  3EN2 A;  5K36 H;  4B9X A;  4JOI C;  4DR4 Q;  2KBN A;  3I4L A;  1KQS A;  2A6H C;  2NZH A;  2ICI A;  1L1O C;  1B44 D;  2PZU A;  4MZ9 A;  4A3C G;  2D5D A;  2Q2H A;  3OTO L;  2BA0 A;  1QVC A;  4ME3 A;  3S17 H;  2L4N A;  2B39 A;  2LKV A;  1E1T A;  4IQZ A;  4KKS A;  5D14 A;  2CW0 C;  4HJ9 A;  2ES2 A;  3D6C A;  3L0O A;  1HZB A;  1Q46 A;  3T1H L;  3EQL C;  1P8L A;  3PQI A;  1PHJ A;  5BN3 A;  3HOW H;  2F0T A;  1CKO A;  3MA2 B;  3AB9 A;  3Q22 A;  1PH5 A;  2NVT H;  3F2B A;  1LTR D;  3NTI A;  1EFI D;  3AQQ A;  2WV6 D;  1GD7 A;  4L5T A;  5IIF A;  1STB A;  1N34 L;  2J0T D;  1RCV D;  1KL9 A;  4IFD I;  2VNU D;  1YEZ A;  2A6E C;  5BN5 A;  1V1P A;  4A3I B;  1EIF A;  1HR0 L;  1MSG A;  3FEW X;  5J22 A;  5M5W H;  1XNR L;  3FP9 A;  1SYE A;  2XIW A;  3H0G B;  4L6T B;  4KV6 A;  4B3M Q;  5JVG 3;  2VQF L;  1Y8N B;  1FJG Q;  1KDB A;  2CQA A;  2IY5 B;  1H9M A;  1X55 A;  4A3J G;  5EPL A;  4RHR A;  2RDF A;  1F2Z A;  4A3C H;  2A74 C;  1JE4 A;  5M5W B;  2F0P A;  2SEB D;  1QCB D;  1J5E Q;  1EOV A;  3HOZ G;  1SR3 A;  1C48 A;  1Y14 B;  5C44 G;  1EOT A;  2KHS A;  1ZYR D;  2VB2 X;  1YNN C;  5A2Q E;  1JC7 A;  3OYY A;  4DV7 Q;  1XXG A;  1KIX A;  3C46 A;  2FJ2 A;  4JC0 A;  2E2I B;  4FDB A;  1E2W A;  1EUJ A;  4DNR B;  4G4K A;  3M7G A;  4PZ7 A;  1UE5 A;  4O2D A;  1BCP C;  3H09 A;  1TII D;  3H0G G;  1HR0 Q;  1SJH D;  2QF7 A;  2EIF A;  2EY1 A;  4JI7 L;  2PZW A;  4H44 C;  4A75 A;  4PZ6 A;  2QCP X;  4L63 B;  2B63 B;  2HHH Q;  1B9M A;  3ERQ A;  1F2L A;  4IOA A;  1CKN A;  2PPB C;  3HOZ B;  1TS5 A;  1CI3 M;  3CCL A;  2HDM A;  4KD4 A;  2EY6 A;  4B9W A;  3S14 B;  2IPK D;  1EL0 A;  1XTD A;  1LM0 A;  1WTQ A;  2K5H A;  2MFI A;  1HNX L;  5C3E G;  2O4X A;  2Y0S G;  2K33 A;  4IUT A;  2E8G A;  1K28 A;  2R7F A;  4POG A;  3SR1 A;  1TKW B;  3BS1 A;  3NBH B;  3A74 A;  4JK1 C;  3S16 B;  1GHJ A;  1SLJ A;  2DJF C;  2UU9 Q;  1BDO A;  1STN A;  4F8M A;  3S1N H;  1VQJ A;  4U67 3;  1F9P A;  4P2C B;  2B2U C;  4RG1 A;  4C3I H;  2K4K A;  3KDF B;  4A4I A;  4J8Q A;  2PQA B;  4ZLT F;  1QVF A;  1F9S A;  2OTJ A;  1PVO A;  5IP7 H;  2MO0 A;  1XPR A;  4DR1 L;  4HID A;  4DFA A;  5JEA J;  5IOC A;  2OXP A;  5IGG A;  3JAM E;  1I4Q A;  3D4D A;  2MGS A;  1L1O B;  4OHJ A;  4FF4 A;  3VYU A;  5ELE A;  4WRD A;  1DOK A;  4OO1 H;  3A56 A;  1L0Y B;  2DGY A;  4WFN 3;  1PYS B;  1YHB A;  5IT9 E;  5D65 A;  2K04 A;  3HOU G;  3G7L A;  4DR4 L;  3S15 B;  2E2H B;  1A62 A;  1CZG A;  4A76 A;  3I2Z A;  3MWY W;  3GP7 A;  2ASB A;  4QCL A;  5KGU A;  1JB7 A;  4IAL A;  3V96 A;  3K57 A;  2ZM6 L;  4LUZ A;  2R93 G;  1DYQ A;  3HKS A;  1AEX A;  1GUG A;  3DWQ A;  2JA6 B;  2CQO A;  1D6E C;  3UDG A;  1DOM A;  2F0I A;  1Y1V H;  5FOB B;  2KCC A;  3BZK A;  4PG3 A;  5I6W A;  5C5L A;  2EYJ A;  2B8F A;  4RHS A;  5HY6 A;  4AYB G;  3NQI A;  2F0F A;  1FR3 A;  2F4V L;  2XWB B;  3BYT B;  2FMM A;  2ZJQ A;  3S1Q B;  2ZJR A;  3CW2 C;  1EIH A;  1A3V A;  3MFG A;  4B3S L;  1NY4 A;  1STY A;  1OXS C;  4LNQ A;  1CZW A;  2VQF Q;  1PTO B;  2FHT A;  1HTL D;  1T5E A;  1VCI A;  1GHK A;  3A7L A;  4R4T A;  5FLM H;  3GTK H;  1N32 Q;  1JCK B;  1PH6 A;  3MXN A;  1MBY A;  1VF5 C;  3ITP A;  5IYD H;  2JA6 G;  4KKT A;  2UUC L;  3K0Y A;  4PMC A;  3HOV G;  1HFN A;  1YIT A;  1JMC A;  1VMP A;  4MTK A;  2B2U A;  3DMU A;  1XJV A;  3N52 A;  3DWA A;  3I73 A;  1H95 A;  3DEP A;  1D1K A;  3RN2 A;  1EYA A;  1SXT A;  4DR2 Q;  3HOV B;  1SNO A;  4XQN A;  3RLN A;  1WI5 A;  2NVY H;  3T16 A;  1H9R A;  4CKB A;  1SAP A;  1PRT C;  4LF7 L;  1E22 A;  2RCF A;  1IXR A;  4BY7 B;  2EE1 A;  3MFY A;  4MIU A;  1PH1 A;  3VDY A;  3FHW A;  4UHV A;  3RN5 A;  3W1G A;  3S14 H;  3QG1 A;  2A69 C;  3I4M B;  4NXN Q;  2HUG A;  4A3M H;  4GKJ Q;  1Q8K A;  1G6P A;  1U4L A;  3BYY B;  4BBR B;  1I94 Q;  1M4V A;  1YZ6 A;  4CDC C;  4K5V A;  4JI2 L;  1ESR A;  2CW0 D;  5BN4 A;  1I6V C;  3CC7 A;  4IN3 A;  1ENF A;  3UE0 A;  1XNQ L;  2NZ1 D;  2RSN A;  4OWX B;  2IT1 A;  2B2V A;  1WTX A;  2F3V A;  4KN7 C;  4NXN L;  3I4M H;  2PI2 E;  1G91 A;  1JE5 A;  3OIQ A;  3RR5 A;  1LV9 A;  4O0A A;  4A3M B;  1I4G A;  4EQN A;  4IPC A;  4UDU C;  2ENB A;  1XWE A;  3NUC A;  1QE6 A;  3CME A;  1B3A A;  1N32 L;  1IW7 C;  2DUD A;  3OTO Q;  3CPW A;  1ZKO A;  2Y0S B;  4ZUJ A;  2UUB L;  2O2L D;  4JYA L;  3CP0 A;  1DGS A;  5FJ8 H;  4YY3 L;  3M3Y B;  3L2P A;  4JPB W;  4M8A A;  2HDL A;  2IJ0 A;  4ZRZ A;  1H9S A;  2EYO A;  1IYU A;  4PNY A;  3S9W A;  2JA7 B;  4GLA C;  5M5X B;  2CWP A;  2RSO A;  3TP5 A;  3FMC A;  5E3F A;  4A3K B;  2VL6 A;  3I4N B;  5CMD A;  3NPP A;  1IL2 A;  2NYZ D;  1AE2 A;  2Q8T A;  2SNM A;  4DNI A;  3VA7 A;  3M4Y A;  1EQR A;  1LYL A;  2D0O A;  2JA5 H;  4K5W A;  2L55 A;  1LTS D;  1R4Q B;  1VQC A;  1MGS A;  5M3M G;  1VQ6 A;  2HT1 A;  2EXZ A;  1HZA A;  4A3G H;  1A8V A;  1SE2 A;  4LW1 A;  2R6G A;  2IWH A;  5EKI A;  1HUM A;  4YCW A;  3URY A;  5I2X A;  3HOX H;  2YTX A;  1EZ6 A;  3U50 C;  3JAM L;  4EVO A;  3R8B A;  4ABN A;  3J80 L;  2JP1 A;  4JV5 L;  4DV2 L;  2NVX H;  1KXL A;  2N78 A;  3C2P A;  1D1I A;  1SNQ A;  4CDD C;  4DR1 Q;  1A3T A;  3BVM A;  3I56 A;  3E0J A;  4RH6 A;  1J6Q A;  4U68 A;  3IKJ A;  2EY5 A;  3U9O A;  1PH4 A;  4CDF C;  2K32 A;  1SE8 A;  2F4I A;  4BWG B;  3LNN A;  2EQS A;  2E2J B;  3HKZ B;  3I90 A;  1SRU A;  3STB C;  4LK1 C;  3CQZ H;  4B3R Q;  4FYD A;  1MJE A;  1D5Z C;  1SYD A;  3BZC A;  3IRB A;  3S2D H;  1JOK A;  4HSV A;  4LF4 L;  4RCO A;  1IL8 A;  1X32 A;  4CDE C;  3SVM A;  3T13 A;  2KHJ A;  3PO3 H;  4X6A H;  1Q81 C;  4PQX A;  1HJP A;  3W3A A;  4GN4 B;  5ELC A;  1PFS A;  4ZAI A;  2AQ2 B;  2HD3 A;  3U58 A;  4QB4 A;  1BUV T;  3O13 A;  2LXK A;  2Z4H A;  2E5L L;  1OXT A;  3F1Z A;  2EJM A;  4ZCK A;  2R7Z H;  2VW9 A;  4DR2 L;  3RD4 A;  2ICE C;  2RDG A;  2CCZ A;  3AEV A;  1VQK A;  2AQ1 B;  3F2D A;  5DNF A;  2R61 A;  3J80 E;  1ZEQ X;  1PRT D;  4DV3 Q;  5KYI A;  5NUC A;  2K5Q A;  2R7Z B;  3SGI A;  4N9T A;  2NVT B;  4DPG A;  2QEJ C;  3NBI A;  5FO9 B;  4GKJ L;  2WIN B;  4YWK A;  1HNW L;  1HFG A;  3OOC A;  3BG3 A;  1JB3 A;  2NTS A;  2LSS A;  4C2M H;  3H3V H;  4KTA A;  3GTJ H;  3I7F A;  2R7Z G;  2N55 A;  1Z7T A;  4JVZ A;  4A3K G;  3GTQ B;  4PMB A;  2UXB Q;  1PYB A;  3KBX A;  1XMQ Q;  1GXD C;  2WKC A;  5D3D A;  2M00 A;  1RTN A;  1HZ9 A;  1Q86 C;  2NTT A;  3NXW A;  1IYV A;  1Y1V B;  1HQR D;  4V19 0;  1HH2 P;  2ALY B;  5CV6 A;  3I8Z A;  3RMH A;  2NBF A;  1CA5 A;  3M3Y H;  1HA6 A;  2N3S A;  4BS9 A;  2I46 A;  2JQO A;  2A6E D;  1GM5 A;  1MI2 A;  4HR7 B;  5C3W A;  2QKI C;  2K6A A;  5LMN L;  5FLX E;  4QUF A;  2BH8 A;  2JE6 I;  3P20 A;  4GNX A;  1VF7 A;  4JI1 Q;  4NDX A;  1PTO H;  4CJ1 B;  1PFM A;  3Q0A A;  1TS2 A;  1STH A;  4JI5 Q;  2R92 H;  1I50 B;  2WAQ B;  3QOJ A;  3STB D;  4LFC L;  2PW5 A;  4GN3 B;  2KQ3 A;  1BQQ T;  2AMC B;  5C44 B;  2ZTC A;  3OHX C;  1TT2 A;  2X6L A;  1UWV A;  1XNQ Q;  2QGQ A;  2QW7 A;  4CKC A;  1WOC A;  3VYT A;  5DM6 3;  3P1H A;  4A3J B;  4B08 A;  1AZP A;  1SSO A;  3KDF A;  3CCM A;  5EGT A;  1KRS A;  1AFP A;  1YBY A;  1YJW A;  4DV4 Q;  1H9J A;  1BBW A;  5G3L D;  5M3F B;  2UXD L;  5CBE E;  3OMC A;  3M4O B;  4ZUI A;  1N34 Q;  1NR4 A;  2E2I H;  1SMY D;  2FFK B;  5IT9 c;  3VR4 A;  1NJI C;  3HOY H;  3OW7 A;  1I6H B;  1LO5 D;  3DUZ A;  2GVB A;  2R3Z A;  1EWH A;  2WAQ E;  3K5L A;  3CCU A;  4R4I A;  1PRT F;  5D3I B;  3A5U A;  5KNC A;  1NTG A;  3S16 H;  5M3M B;  2SOB A;  1JOQ A;  4KY6 A;  4XT1 B;  3PGZ A;  1W2B A;  2XRQ D;  4RFB A;  4K5X A;  1B4O A;  1K3B C;  1OXU A;  3GV3 A;  2B2Y A;  3NSW A;  2JSO A;  1Y8P B;  2AHO B;  1VQL A;  3OWF A;  4LMQ D;  4IUP A;  1TWF H;  5K5P A;  2UXD Q;  1C9O A;  4A3G G;  4YHH L;  1TWG B;  3UDI A;  3SE0 A;  1TU2 B;  3K5M A;  1LT3 D;  2Q2I A;  3GTO H;  4KMU C;  3HKZ G;  3CCV A;  4PZ8 A;  1TXY A;  1IZ6 A;  1KNA A;  4HJA A;  1S5D D;  2A1A A;  3K58 A;  3QR8 A;  3SXH A;  2Z8L A;  4JG2 A;  5KND A;  3ERS X;  1V43 A;  4IO9 A;  3T1Y Q;  2ZJP A;  4RKB A;  2MPM A;  3BDC A;  1EIY B;  5CV5 A;  3E3X A;  5IT9 L;  4JCV E;  4K6D A;  2IL8 A;  2Z9H A;  4DV4 L;  4C3I B;  2EJG C;  4J6H A;  2JA6 H;  4ME5 A;  1S40 A;  2BCO A;  2DNC A;  3CRK C;  2NVQ H;  3VR5 A;  4R4C A;  2Q8R E;  1T9H A;  1WD0 A;  4X64 Q;  4DAV A;  1X6O A;  3J7A F;  3J7Z C;  3A55 A;  1K83 B;  5C3E H;  2J4X A;  3IL8 A;  1F9Q A;  1SBB B;  4FXD A;  2I07 B;  2E2H H;  4A3L G;  3Q24 A;  2Z1C A;  5LL6 S;  4LFA Q;  1O80 A;  1XYI A;  4KY5 A;  3MAQ A;  2RF4 A;  2H4O A;  5GAH C;  3NE5 B;  1QUQ A;  1UUP A;  2D0P A;  4AQY L;  4R1J A;  4HIM A;  1IHZ A;  1SNM A;  5HGQ A;  4ZK9 B;  3P75 A;  1QWY A;  2VB3 X;  5CV4 A;  4X65 Q;  3PSI A;  2E76 C;  3NTH A;  2NN6 I;  4CBV A;  1SND A;  2VZA A;  2UUB Q;  4Z9C B;  4AYB B;  5LMU Q;  1N36 L;  4DV0 L;  1TWC B;  1HPC A;  1X3P A;  3M9B A;  1S5C D;  3I91 A;  2F0U A;  2ZT9 C;  1UE6 A;  2VUM G;  3E9H A;  4S3S A;  1PV4 A;  4APV A;  4YCV A;  3M4Q A;  1V8Q A;  4OIK A;  1FNV A;  1X56 A;  4ODG A;  2EJF C;  2F0K A;  2SNS A;  1IBM L;  4HCS A;  1I4P A;  1TY0 A;  4TSS A;  4I7Z C;  5C4Z A;  1HA5 A;  5M3F H;  3CPF A;  4A3I G;  2R7D A;  1V1O A;  1DCZ A;  3K80 C;  2M9V A;  2HIX A;  4N9P A;  1LUZ A;  2B63 H;  1LAC A;  3PO2 H;  2F0D A;  3G48 A;  3RZO B;  4LFC Q;  1EWC A;  4MHE A;  4DR6 L;  1NAP A;  2IHE A;  4OL7 A;  1ASZ A;  2GA4 B;  3QWN A;  2KA7 A;  2R93 B;  5FJ8 G;  1B9N A;  1SYC A;  1JWU D;  4AIM A;  2A68 C;  3D31 A;  2A19 A;  3FPU B;  4JV5 Q;  4RGN A;  3E5S A;  4NKL A;  3X3N A;  3JAM i;  1PZI D;  2K5D A;  4A3D H;  2F0L A;  2AKW B;  1IKL A;  5BR8 Q;  1A63 A;  4R4Q A;  5IP9 H;  2V4D A;  2K5V A;  1RHP A;  2OEO A;  2B3G A;  3N6R A;  1QNU A;  2V1C C;  2EYL A;  3QO2 A;  2RKS A;  3UI2 A;  2JYO A;  4GKK Q;  4JI6 L;  1ICF B;  2F0G A;  3PMF A;  3HP3 A;  3FVQ A;  3U4Z A;  3FKI B;  1KNE A;  1EU4 A;  3M4P A;  4A3I H;  4BBS G;  4RKL A;  2Q8I B;  2NB0 A;  5A2Q L;  1RL2 A;  1ONL A;  4EGV A;  1VQ9 A;  3H91 A;  5M9O A;  2EPB A;  2JA7 G;  3A5Z B;  4OXP A;  1PXU A;  4IUQ A;  4JI4 L;  5C4X G;  3KJP A;  1Q82 C;  3T4A C;  4JBK A;  2L15 A;  4FF1 A;  3PIO 3;  1I50 H;  2P5Z X;  5J3B A;  5M5Y H;  2OQK A;  1RJT A;  2K14 A;  5C44 H;  1KD1 C;  3EFX D;  1PA6 A;  1CA6 A;  3QIA A;  4AH6 A;  3D8G A;  1QNK A;  3HOU B;  5GQO A;  4A3J H;  3KF8 A;  3RLO A;  3NQT A;  4JW0 A;  4X3S A;  2Z4I A;  5M5Y B;  5BR8 L;  1BVS A;  1XPO A;  1ENC A;  4LF4 Q;  1KC8 C;  2F0N A;  1AW7 A;  4IPD A;  3TZD A;  2G9H D;  2N8N A;  3J81 E;  4JI2 Q;  1ESF A;  1YI2 A;  4GOP A;  4XXE A;  1SMX A;  4KJO A;  4QL5 A;  4DN4 M;  2Z6K C;  4FO2 A;  1S4Z A;  1E3P A;  4RMF A;  2MO1 A;  3I4O A;  1O7L A;  3WDN A;  3VR3 A;  1HNW Q;  3S24 A;  2EZV A;  1OTC A;  3RLF A;  3GTK B;  2F0S A;  2BOS A;  3S1R B;  3I4N G;  5EQ0 A;  4X62 Q;  1CHP D;  4XYQ A;  3SDZ A;  4JI3 Q;  2LS0 1;  4HTH A;  1SFO B;  4XIG S;  1LTI D;  1MD2 D;  3PIP A;  2H5X A;  1EIG A;  1ILP A;  3T1H Q;  4KN4 C;  1IBM Q;  3SK4 A;  4KKU A;  5JVH 3;  4JBW A;  5CV8 A;  3LX0 A;  3TP7 A;  3NWS A;  1SEB D;  4C3J G;  4N8X 1;  1LLR D;  3TEH B;  1AN8 A;  1VQG A;  5HUR A;  3RZO H;  1YNJ D;  2BDO A;  5GRO A;  2K28 A;  2CH4 W;  4K2K A;  3FPP A;  2NN6 H;  2KUM A;  2E75 C;  3CCS A;  4DV5 Q;  5JJK A;  3ER0 A;  3OMG A;  2R93 H;  1XMO Q;  4C1N K;  3VYR A;  3SK6 A;  2L12 A;  2HCI A;  4K14 A;  3HOX G;  3K8A A;  1K8G A;  4RGO S;  4UY8 C;  2ID0 A;  1EY0 A;  3HS0 C;  4YCU A;  3D4R A;  4WJ3 M;  5TSS A;  5IOD A;  3JC6 6;  1QOH A;  1VQ8 A;  3BJU A;  1FL0 A;  2UXC Q;  2JA9 A;  4K6L A;  4DV1 L;  5K36 G;  4DV2 Q;  2AWO A;  3EA6 A;  4IPH A;  3R93 A;  1Q8I A;  1QIL A;  1T5X D;  2J7Z A;  2PZT A;  4C3H G;  4QF4 A;  4GLX A;  4GKK L;  1IBK Q;  2JN4 A;  1Y1V G;  1SYB A;  5L37 A;  3PV0 A;  4R8I A;  3RZD B;  2F52 A;  2R92 B;  1E2Z A;  4B3S Q;  4DR7 Q;  1EY8 A;  4NMZ A;  3CHB D;  2UUC Q;  5I9O A;  1XMO L;  3PUW A;  5EKL A;  1TWA B;  2ATW A;  2Z6B A;  1SRO A;  5I9P A;  3NWT A;  1VS0 A;  3WOE A;  4KLK A;  2YU9 B;  3PUZ A;  4I7A A;  1WTP A;  1KLU D;  4NPS A;  4JI0 Q;  3BU2 A;  3T1Y L;  2GN5 A;  1HZC A;  1W6J A;  4OWW B;  4C56 C;  1S5F D;  2PQE A;  1C8C A;  2YU9 H;  1U5K A;  4A3B B;  4NB3 A;  1M90 C;  3GQB A;  2RCN A;  5C4H A;  2B2W A;  4L8J A;  4DAY A;  4POF A;  3E9I A;  4A3E H;  4J1M A;  4IZ8 A;  5GAG C;  1I6H H;  2K75 A;  4JI8 Q;  4ZKB B;  1L2F A;  1CKM A;  2IW3 A;  3K59 A;  4JBJ A;  3A7A B;  2XVS A;  2PO4 A;  4A3M G;  3BVG A;  1E7Z A;  2NVX B;  5IYD G;  3G6E A;  4A3E B;  1BF4 A;  2K5W A;  1HNX Q;  3PUV A;  3CC2 A;  1JOO A;  1STG A;  4QJF A;  4KD3 A;  5FLM G;  3CD6 A;  1TWF B;  1SYF A;  1F2M A;  4NXM L;  1VQF A;  1PDQ A;  1GUS A;  2CH4 A;  3CQZ B;  4DV6 Q;  1K8A C;  3ICE A;  1MHW C;  1G2S A;  1SNP A;  3QB3 A;  3S2D B;  1ZYR C;  3A8J E;  2QA4 A;  5IWA L;  4HMI A;  2RQX A;  3HOZ H;  2CHB D;  4QGU A;  4R9W A;  4LF7 Q;  4DUZ L;  4GOP B;  1EZ8 A;  3OPO A;  1WJJ A;  1WVL A;  1L0X B;  4LUO A;  3LGJ A;  4XQJ A;  4IJH A;  4C1N I;  4DR5 Q;  3BVZ A;  5JPN C;  4YIJ A;  5EJW A;  2ZM6 Q;  1B50 A;  3NP8 A;  3F2C A;  5E4X A;  1D8L A;  3W1B A;  4JOI A;  3FKI H;  1VQN A;  5ELO A;  1FNW A;  1K8M A;  1B8A A;  1TWG H;  1YHQ A;  3OWE B;  1QVG A;  5JOB A;  3GTO B;  4J15 A;  1A15 A;  2K01 A;  4HJ8 A;  3KOJ A;  1TS3 A;  1QZH A;  4JI7 Q;  2EOT A;  4LFB Q;  4IUN A;  1RD9 D;  3GTL B;  5CV7 A;  2ZTE A;  5KIX A;  4C3J H;  1CKN B;  4LF5 Q;  3T51 B;  3UDF A;  3NEL A;  4QQB X;  2KEE A;  3MEH A;  1EQV A;  1PTO C;  3GTJ B;  3J81 L;  4RA8 A;  2DJG C;  4JI4 Q;  1BCP B;  3J81 c;  5KEE A;  3J81 i;  4A3F H;  4G7Z C;  2Z6K A;  5EPK A;  5HGT A;  2IX3 A;  2YTY A;  3H3V I;  1CT1 D;  1RF2 D;  4Y7N B;  1UE7 A;  5JJZ A;  4EQ5 A;  1OO9 B;  3D0F A;  2EVB A;  4RGM A;  1F2Y A;  5CR3 A;  2Y0S E;  2DY8 A;  2EDG A;  4XTC S;  4LFB L;  4DV7 L;  2K50 A;  4NW2 A;  2E2D C;  1LTA D;  5CBA E;  3TRZ A;  1E0B A;  1B7Y B;  2AWN A;  4P73 A;  5F2D A;  3C1F A;  4JI8 L;  1YJ9 A;  1N36 Q;  2O5I C;  4X3T A;  4JI3 L;  3WWV A;  1FNU A;  3R2T A;  5E1F A;  1Q90 A;  5GAD C;  4P75 A;  4DNT B;  2PQA A;  1CQF A;  1CK1 A;  2MHV A;  3J7A V;  3GDE A;  5C0X J;  3A8I E;  4DAY B;  1RIP A;  2NN6 G;  4DUZ Q;  3QOL A;  4G7H C;  1SJE D;  3GTP B;  3G71 A;  2FXQ A;  3S2H H;  4HED A;  1TWC H;  4WOR A;  3K5O A;  5I6Y A;  1HR0 W;  4OEL B;  2BH2 A;  5IYC G;  1PZJ D;  2K1B A;  1HQM C;  4IFD H;  1LAB A;  5H1S E;  1H9S B;  3BZD B;  4L5S A;  4EQO A;  3GO5 A;  4KHZ A;  2HHH L;  4DR7 L;  3GTP H;  3TS0 A;  1JR0 D;  4PV1 C;  3E0E A;  4K2L A;  5LHY 1;  4IJL A;  1EFW A;  4XT3 B;  3S1M B;  2XN9 C;  4KK7 A;  2B29 A;  5C4J B;  1G2T A;  2PCF B;  1BR9 A;  3HOV H;  2YV5 A;  2JJQ A;  3GTG B; 
#chains in the Genus database with same CATH homology
 4QY7 A;  1UE6 A;  1VQI A;  2ZM6 L;  4LUZ A;  1IBK L;  1TWA H;  2JA5 G;  2VUM G;  2R93 G;  3HKS A;  3E9H A;  4JI0 L;  1N8R C;  4EX5 A;  5DLQ E;  1PV4 A;  3CCQ A;  2CQO A;  4APV A;  4YCV A;  3M4Q A;  4HIK A;  3UDG A;  4LF6 Q;  1X3F A;  1X56 A;  1Y1V H;  4BY7 H;  4BA2 I;  4OX9 Q;  3BZK A;  4PG3 A;  1IBM L;  3S1M H;  1Q1B A;  1K0R A;  3AFQ A;  4DR6 Q;  5HY6 A;  4AYB G;  1VQ5 A;  5M3F H;  3CPF A;  4UP8 A;  5IYC H;  4A3I G;  2F4V L;  4IFD J;  2I5L X;  2R7D A;  2ZJQ A;  2VQE Q;  3CW2 C;  5AJ3 Q;  2ZJR A;  1E1O A;  1CSQ A;  4BBR H;  3H15 A;  3K80 C;  2HIX A;  4B3S L;  1NY4 A;  2I0Q A;  2CKZ B;  1XMQ L;  3CCJ A;  1LUZ A;  1OXS C;  4AQY Q;  2B63 H;  4X62 L;  3I4N H;  4LNQ A;  3PO2 H;  3TS2 A;  4A3B H;  2WAQ G;  2VQE L;  1L0W A;  4GOP C;  4NXM Q;  3G48 A;  3L7Z C;  4GLV B;  2QEX A;  2VQF Q;  4LFC Q;  4B3M L;  3OW2 A;  4DR6 L;  1VCI A;  3K7U C;  2IHE A;  4QIW E;  2YYZ A;  1ASZ A;  4ALP A;  4R4T A;  5E7N A;  5FLM H;  1Q12 A;  4YHH Q;  3GTK H;  4A93 G;  1PH6 A;  1N32 Q;  5FJ8 G;  5LMN Q;  4AIM A;  5IYD H;  3D31 A;  2JA6 G;  3CMA A;  2CWA A;  2UUC L;  2A19 A;  4JV5 Q;  3HOV G;  1GO3 E;  3K7A H;  3RNU A;  4LF9 Q;  2MNA A;  1YIT A;  1JMC A;  3JAM i;  4AYB E;  3U4V A;  4A3D H;  2AKW B;  5LMN W;  1YNX A;  5BR8 Q;  1V9P A;  1XJV A;  1MKH A;  4R4Q A;  5IP9 H;  1A63 A;  1H95 A;  2K5V A;  2JA7 H;  1AH9 A;  1YHA A;  3ULL A;  1HNZ Q;  2B3G A;  2RHS B;  3RN2 A;  2V1C C;  4OWT B;  4DR2 Q;  4OO1 G;  4GKK Q;  4JI6 L;  2LXJ A;  2VY3 A;  3RLN A;  1WI5 A;  2NVY H;  3TQY A;  2N49 A;  1SN8 A;  3U4Z A;  4BBR G;  4LF7 L;  1E22 A;  4KHP L;  1IXR A;  2A8V A;  5M3F G;  1PH1 A;  3VDY A;  3FHW A;  3M4P A;  3RN5 A;  4A3I H;  4BBS G;  3W1G A;  3S14 H;  4TVA B;  4NXN Q;  3EBE A;  4A3M H;  1NMG A;  1JJ2 A;  4GKJ Q;  1RL2 A;  1Q8K A;  3S1Q H;  4LF8 Q;  1UEB A;  1G6P A;  1I94 Q;  1VQ9 A;  2GVA A;  4DAM A;  4X64 L;  1YZ6 A;  2JA7 G;  3A5Z B;  3S1R H;  4JI2 L;  4OXP A;  3Q8D A;  4GNX B;  4DR3 L;  1Q7Y C;  4JI4 L;  3HOU H;  4DV5 L;  1N9W A;  2F4V Q;  5C4X G;  3CC7 A;  3KJP A;  3UE0 A;  1XNQ L;  2JA8 G;  1Q82 C;  4OWX B;  2IT1 A;  4JBK A;  2L15 A;  4OON A;  1WCM H;  4P72 A;  4NXN L;  3I4M H;  2PI2 E;  2KCT A;  2RHQ B;  3PF5 A;  1JE5 A;  1I50 H;  5J3B A;  3RR5 A;  3PUY A;  2CFM A;  5M5Y H;  4MTN A;  4O0A A;  2ZTD A;  5IE8 A;  1VQA A;  2IHF A;  2OQK A;  3KLW A;  3MEF A;  4IPC A;  4JI5 L;  3ULJ A;  1X54 A;  2K14 A;  5C44 H;  2F3I A;  2YTV A;  4UP9 A;  1Z47 A;  1KD1 C;  2WFW A;  5IP9 G;  1VQ4 A;  1PA6 A;  1EYG A;  2JEB I;  4DUY Q;  4AH6 A;  3K0X A;  3CME A;  3FKI G;  1X65 A;  1ASY A;  1N32 L;  2DUD A;  3PCO B;  3OTO Q;  1VQE A;  5GQO A;  3CPW A;  4A3J H;  2OTL A;  2UXC L;  3RLO A;  1K73 C;  2UUB L;  1JT8 A;  4JYA L;  3CP0 A;  1DGS A;  1TWH H;  5FJ8 H;  4YY3 L;  3L2P A;  5BR8 L;  2E2J H;  2Q2T A;  1BVS A;  1YIJ A;  1XPO A;  2UUA Q;  2B63 G;  4LF4 Q;  2D62 A;  3GD7 A;  1KC8 C;  2UXB L;  4GLA C;  4IPD A;  4PMW A;  4X66 L;  3UDX A;  2CWP A;  2N8N A;  4JI2 Q;  1YI2 A;  4GOP A;  3UE1 A;  1C7Y A;  2VL6 A;  1SMX A;  3KJO A;  4QL5 A;  5EAY A;  3ZJY C;  2Z6K C;  1IL2 A;  3J7A 5;  4DK3 C;  1E3P A;  4RMF A;  3NEN A;  2MO1 A;  3I4O A;  1AE2 A;  1IYJ B;  2EXD A;  2NZO A;  1HNW Q;  3S24 A;  1UE1 A;  4DNI A;  4YWM A;  1OTC A;  4LF5 L;  3RLF A;  1XPU A;  1EQR A;  1LYL A;  1W3S A;  2D0O A;  3I4M G;  2JA5 H;  4A3F G;  1YJN A;  3I55 A;  3I4N G;  3PO2 G;  1VQC A;  1CSP A;  5M3M G;  1VQ6 A;  2HT1 A;  1GKH A;  4BA1 I;  4X62 Q;  4DV0 Q;  1HZA A;  4A3K H;  1OXV A;  5IYB H;  4JI3 Q;  4K0K Q;  4WJ4 A;  1E24 A;  4A3G H;  1NBW A;  1A8V A;  2OQ0 A;  4LW1 A;  1K9M C;  2JEA I;  2R6G A;  2VS1 A;  3HFZ B;  4DV3 L;  4XIG S;  4IOC A;  3RZD H;  1EQQ A;  1VQM A;  4DR3 Q;  1VQB A;  4JBM A;  4YCW A;  3PIP A;  1KRT A;  2H5X A;  4JYA Q;  3W5O A;  3T1H Q;  3HOX H;  1IBM Q;  2YTX A;  3U50 C;  3H0G H;  1P16 A;  2XTI A;  5IYB G;  4JBW A;  3PUX A;  4JV5 L;  4DV2 L;  2NVX H;  4DUY L;  2Z0S A;  3CCE A;  1KXL A;  2N78 A;  3TEH B;  1D7Q A;  1VQG A;  1PH8 A;  4DR1 Q;  1PH9 A;  3RZO H;  3I56 A;  1B70 B;  5GRO A;  1J6Q A;  1PH4 A;  2KCM A;  1SE8 A;  4TQU S;  3S15 H;  1MIU A;  2OWO A;  3CCS A;  3KF6 A;  2EQS A;  2XGT A;  4JI6 Q;  4DV5 Q;  1SRU A;  3STB C;  5M5X H;  3ER0 A;  5JJK A;  3CQZ H;  1Q1E A;  4B3R Q;  1MJE A;  2R93 H;  4OO1 I;  1XMO Q;  1HNZ L;  3BZC A;  1LTL A;  4X66 Q;  4B3T L;  1Z9F A;  3IRB A;  3HOX G;  3S2D H;  3K8A A;  2BA1 A;  1K8G A;  4UY8 C;  2ID0 A;  1M1K C;  2Q2U A;  4LF4 L;  4MNO A;  1GVP A;  4YCU A;  5IP7 G;  4WJ3 M;  5GAE C;  3PIO A;  2KHJ A;  3PO3 H;  4X6A H;  3JC6 6;  1Q81 C;  1HJP A;  4GN4 B;  4A3L H;  5C0X G;  1PFS A;  1VQ8 A;  3BJU A;  2KHI A;  1FL0 A;  5C4J H;  1VQ7 A;  2UXC Q;  2JA9 A;  3U58 A;  5FLX c;  3M4O H;  4DV1 L;  5K36 G;  4DV2 Q;  4GNX C;  2HQL A;  1VQP A;  2AWO A;  2WP8 J;  4IFD G;  4IPH A;  2LXK A;  2E5L L;  1OXT A;  3F1Z A;  1VQO A;  1X3G A;  1CUK A;  4GLX A;  4GKK L;  1IBK Q;  2R7Z H;  1X9N A;  2VW9 A;  4DR2 L;  4BY1 H;  4HJ5 A;  1Y1W G;  2UU9 L;  4C3H H;  1MJC A;  4UP7 A;  2CCZ A;  3AEV A;  1QZG A;  1Y1V G;  4A93 H;  4BXX H;  3PV0 A;  1I5F A;  1VQK A;  3JAM c;  2WB1 G;  1K3R A;  1PH7 A;  3F2D A;  2UUA L;  2F52 A;  3A0J A;  4LF9 L;  4B3S Q;  2K52 A;  4BXX G;  4DR7 Q;  2K5N A;  4DV3 Q;  1BKB A;  2UUC Q;  5AJ3 L;  5C0X I;  1XMO L;  3PUW A;  3SGI A;  4B3R L;  3DLL A;  4LF8 L;  2ATW A;  1SRO A;  4DPG A;  1S72 A;  1I94 L;  4GKJ L;  1VS0 A;  4YWK A;  1I3Q H;  2VUM H;  3KFU A;  4KLK A;  1HNW L;  4P71 A;  3TRE A;  4YWL A;  4OX9 L;  3PUZ A;  1EWI A;  1JB7 A;  2I5H A;  1BBU A;  1L1O A;  1VQH A;  2LSS A;  3BU2 A;  4NPS A;  4C2M H;  4HIO A;  3T1Y L;  4JI0 Q;  2GN5 A;  4KHP Q;  3H3V H;  2OCE A;  3GTJ H;  3AYH B;  1HZC A;  1IBL L;  3KYH C;  4OWW B;  3I7F A;  2R7Z G;  4LWC A;  3NEM A;  4A3K G;  3F8T A;  5LMU L;  1VQD A;  2UXB Q;  1PYB A;  4B3T Q;  1XMQ Q;  3EN2 A;  2YU9 H;  1U5K A;  1HZ9 A;  4NB3 A;  1Q86 C;  4JOI C;  1M90 C;  2MQH A;  4DR4 Q;  2RCN A;  2KBN A;  1KQS A;  4L5R C;  2NZH A;  4POF A;  3E9I A;  4A3E H;  1L1O C;  1HH2 P;  4MZ9 A;  1SFO H;  2ALY B;  3KF8 B;  5GAG C;  1I6H H;  2K75 A;  3B6Y A;  4DK6 C;  1NE3 A;  2Q2H A;  2N3S A;  3OTO L;  3HOY G;  3M3Y H;  4A3C G;  3CCR A;  3ULP A;  4JI8 Q;  1Y1W H;  2BA0 A;  1QVC A;  4ME3 A;  2JQO A;  3S17 H;  3DM3 A;  1L2F A;  1CKM A;  1GM5 A;  4JBJ A;  4LF6 L;  3M7N A;  1FJG L;  1E1T A;  4A3M G;  1E7Z A;  1YVC A;  2KEN A;  5LMN L;  4HJ9 A;  2ES2 A;  2BH8 A;  2JE6 I;  5IYD G;  3G6E A;  1X3E A;  4GNX A;  3L0O A;  1HZB A;  4JI1 Q;  1KAW A;  1Q46 A;  3PUV A;  4L5Q A;  3T1H L;  1HNX Q;  1G29 1;  3CC2 A;  1PH2 A;  3GTL H;  3CXC A;  4QJF A;  5IY0 A;  2R92 H;  1P8L A;  5FLM G;  4JI5 Q;  3CD6 A;  1PHJ A;  4NXM L;  3HOW H;  4GN5 A;  3STB D;  2HIV A;  4LFC L;  4BBS H;  1VQF A;  5IWA Q;  1CKO A;  4GN3 B;  2AMC B;  1PH5 A;  2NVT H;  4DV6 Q;  1K8A C;  2ZTC A;  3ICE A;  3F2B A;  1XNQ Q;  1UWV A;  4A3B G;  3J81 j;  2QGQ A;  3AQQ A;  1GD7 A;  1WOC A;  4L5T A;  2QA4 A;  1JJG A;  5IWA L;  1N34 L;  1KL9 A;  3HOZ H;  4IFD I;  2VNU D;  4R4O A;  1YEZ A;  3KDF A;  4QGU A;  3CCM A;  1KRS A;  1EIF A;  1HR0 L;  1YBY A;  4DUZ L;  4GOP B;  4H02 A;  5M5W H;  4DV4 Q;  1YJW A;  1WJJ A;  4LF7 Q;  1BBW A;  1XNR L;  3FP9 A;  2UXD L;  4LUO A;  3LGJ A;  1FGU A;  3PF4 A;  4IJH A;  1V1Q A;  4DR5 Q;  4B3M Q;  4BY1 G;  3GTQ H;  1N34 Q;  2VQF L;  2E2I H;  1FJG Q;  2ZM6 Q;  2IY5 B;  2PNH A;  1FVI A;  1X55 A;  3M85 A;  3F2C A;  5IT9 c;  4A3J G;  1D8L A;  3W1B A;  4JOI A;  1NJI C;  1AE3 A;  3HOY H;  4A3C H;  3FKI H;  1VQN A;  3J80 i;  5ELO A;  1C0A A;  1B8A A;  2GVB A;  5JEA G;  1TWG H;  1YHQ A;  1J5E Q;  1EOV A;  4YY3 Q;  3HOZ G;  1SR3 A;  2WAQ E;  1Y14 B;  5C44 G;  4R4I A;  3CCU A;  1QVG A;  3A5U A;  1NTG A;  3S16 H;  4J15 A;  3PGZ A;  3OYY A;  4DV7 Q;  4HJ8 A;  3KOJ A;  1QZH A;  4JI7 Q;  4LFB Q;  1W2B A;  1KIX A;  3GTM H;  2E5L Q;  1K83 H;  4JC0 A;  2JA8 H;  4FDB A;  1OXU A;  1EUJ A;  2ZTE A;  4PZ7 A;  4C3J H;  1CKN B;  4LF5 Q;  1UE5 A;  2AHO B;  4O2D A;  4Y7N H;  1VQL A;  3UDF A;  3NEL A;  1TWF H;  3AFP A;  5C4X H;  4LFA L;  2UXD Q;  4QQB X;  1C9O A;  4A3G G;  3H0G G;  4YHH L;  3EIV A;  1HR0 Q;  3UDI A;  4A3D G;  2EIF A;  4JI7 L;  1WYD A;  2Q2I A;  4A75 A;  4JI4 Q;  4DV6 L;  3GTO H;  4PZ6 A;  4X65 L;  4DKA C;  3J81 c;  1OXX K;  1N33 L;  3HKZ G;  3J81 i;  4PZ8 A;  1TXY A;  3CCV A;  4A3F H;  2HHH Q;  1IZ6 A;  3HKZ E;  3CC4 A;  3KF6 B;  4HJA A;  2Z6K A;  4IOA A;  2A1A A;  1G51 A;  1CKN A;  2YTY A;  3H3V I;  4JG2 A;  3CCL A;  1IBL Q;  1UE7 A;  3ERS X;  1JJC B;  1V43 A;  1XTD A;  4IO9 A;  3CF5 A;  3T1Y Q;  4EQ5 A;  4Y52 H;  3D0F A;  2ZJP A;  1LM0 A;  2K5H A;  2MFI A;  4JI1 L;  1HNX L;  2Y0S E;  3CAM A;  5C3E G;  1PH3 A;  1EIY B;  4XTC S;  4JCV E;  1O7I A;  2Y0S G;  4LFB L;  4DV7 L;  1U0L A;  4DV4 L;  3GTG H;  2K50 A;  2E8G A;  3PO3 G;  2R7F A;  3TRZ A;  4POG A;  2JA6 H;  1B7Y B;  4UPA A;  2AWN A;  3NBH B;  4P73 A;  1S40 A;  4JI8 L;  4IPG A;  1YJ9 A;  3A74 A;  1N36 Q;  2NVQ H;  4R4C A;  3G4S A;  4JI3 L;  3WWV A;  4K0K L;  2PI2 A;  1SLJ A;  3MXN B;  2UU9 Q;  1T9H A;  1A0I A;  2C35 B;  5GAD C;  1VQJ A;  5M3M H;  4P75 A;  3S1N H;  1QUQ B;  2PQA A;  4X64 Q;  4HJ7 A;  1X6O A;  4KI0 A;  4P74 A;  1N33 Q;  3J7Z C;  3GDE A;  5JJL A;  5C3E H;  4RG1 A;  5C0X J;  4C3I H;  2I5M X;  2K4K A;  1RIP A;  3KDF B;  4DAY B;  4DR5 L;  1R9T H;  2IX1 A;  2NN6 G;  2JK8 A;  4A4I A;  4DUZ Q;  2PQA B;  3K81 C;  1S3O A;  1XNR Q;  3HOW G;  1QVF A;  2E2H H;  4A3L G;  2OTJ A;  3G71 A;  4BY7 G;  2FXQ A;  3S2H H;  1PVO A;  5IP7 H;  1WFQ A;  2MO0 A;  4LFA Q;  1XPR A;  1TWC H;  2PMZ E;  4DR1 L;  4HID A;  5JEA J;  4GS3 A;  2RF4 A;  5GAH C;  1KHI A;  1HR0 W;  1QUQ A;  2D0P A;  5IYC G;  2BH2 A;  4LUV A;  4R1J A;  4AQY L;  4HIM A;  5JJI A;  1L1O B;  5HGQ A;  5H1S E;  4L5S A;  2WB1 E;  3GO5 A;  1NMF A;  4KHZ A;  5ELN A;  2HHH L;  2R92 G;  2DGY A;  4X65 Q;  1J5E L;  1PYS B;  1YHB A;  2IX0 A;  3PSI A;  3TS0 A;  3GTP H;  4DR7 L;  3HOU G;  3E0E A;  4DR4 L;  2NN6 I;  2VZA A;  4IJL A;  4A3E G;  1EFW A;  2UUB Q;  1A62 A;  4A76 A;  3I2Z A;  2B29 A;  3J80 c;  5LMU Q;  1N36 L;  4DV0 L;  1WCM G;  2ASB A;  3HOV H;  4DV1 Q;  2YV5 A;  3M9B A;  2JJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...