4BXXH

Arrested rna polymerase ii-bye1 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxH00
2D62A 4LFBQ 2XGTA 4LF6L 3UDIA 4BBSG 2JE6I 3GTJH 4OO1G 1I3QH 2FXQA 2VQFL 5FJ8G 3ULJA 2K50A 2OTJA 4DR3L 2E8GA 2C35B 2Z0SA 3BU2A 4R4IA 5GAGC 4AYBG 5C4XG 5IYBG 1X54A 3PO2G 4J15A 4DV5Q 3L7ZC 3S1NH 1WYDA 3CQZH 3U4VA 3T1YQ 3AYHB 1K73C 3G71A 2NVXH 2ATWA 2ZTEA 1FL0A 2PQAB 4JI7L 1Q86C 1I5FA 2PMZE 4NXMQ 1PHJA 2R7ZG 3S2DH 2NZHA 1TWGH 2IHFA 2VZAA 2Y0SE 2WB1E 3RLFA 5IYDG 2VQFQ 4GNXA 4LF4L 4LF7Q 2JA7G 2VS1A 1HH2P 4P75A 3GTMH 4B3RQ 4A3IH 4C3HH 1J6QA 1UE6A 4UP8A 2WFWA 2Q2TA 2YTVA 5C4XH 4DV7L 2NVTH 1PYBA 3ER0A 3PUVA 2R92H 4EQ5A 1XMQQ 1VQ9A 3HOUH 2JA6G 2EQSA 1UEBA 2BA0A 3CW2C 1VQLA 3DLLA 2L15A 1KRSA 3KF6B 2HIVA 2D0PA 1V9PA 2NN6I 4YCUA 4A3MH 4PZ8A 3M85A 2JJQA 1PH4A 3BZCA 1W3SA 2QA4A 3RN5A 1Z9FA 1Y1VG 1YHAA 4GN4B 1BBUA 2GVAA 1C7YA 3ERSX 3S14H 1YBYA 3FKIH 4XTCS 1WCMG 3E9IA 4C2MH 3EBEA 4DR3Q 1XNQQ 1MKHA 4DR4L 4YWKA 4DV6L 3K0XA 1Q7YC 1D8LA 1EYGA 5DLQE 1VQIA 1YJNA 2ES2A 2R92G 5EAYA 1WOCA 4A75A 1XPUA 2QGQA 5M3FH 5M5YH 2PQAA 3BZKA 5H1SE 1L0WA 4JI1Q 4JG2A 4A3MG 1SLJA 3WWVA 2F52A 4IPHA 3G4SA 1D7QA 4BY7G 3PV0A 2DUDA 2BH8A 5GROA 5IP7G 4R4TA 3KLWA 4LFAQ 5K36G 4MZ9A 1Y1WG 1CKMA 3FKIG 1AE2A 3I4MH 1U5KA 4X66Q 1YITA 4JI0L 4A76A 3RNUA 5AJ3Q 3J81c 1CKOA 2Q2IA 5LMUL 4PZ6A 3CXCA 5GADC 3HKZE 1PH6A 1NJIC 1EFWA 4AIMA 1HZ9A 1Q1BA 1GO3E 3K8AA 1JJ2A 1MIUA 2K5HA 4GLXA 2NZOA 4DKAC 4DV2Q 1PH2A 1ASYA 3CCUA 3H0GG 1CUKA 4GN5A 2HHHL 1SE8A 3S24A 1N34L 4TVAB 2K14A 4DV4L 2MFIA 1S72A 3GTPH 1GM5A 4DV7Q 4LF7L 2I5MX 2JA9A 1HZAA 3KF8B 5IYBH 4JBJA 2PNHA 3HOYH 1Q8KA 3HFZB 3Q8DA 4IJHA 4JI2Q 3HOZH 4Y7NH 4QIWE 4KHPQ 1WJJA 4A3KH 1I94L 4A3DH 1Q12A 4AH6A 2JA5H 1CSQA 3I56A 2UU9L 3J7A5 3M7NA 1X3FA 3IRBA 3PUZA 4DPGA 1UWVA 1IBKL 2OWOA 1HNWQ 2UUBL 4IFDJ 3L2PA 1C0AA 1VQHA 2IHEA 4BA1I 3H0GH 2E2IH 2DGYA 3NBHB 2YV5A 1N36L 3CCQA 1EUJA 2F4VQ 4UY8C 4YHHQ 3ULPA 3W5OA 4BY1H 4DV5L 1JJGA 1JJCB 1LTLA 4DUYL 2ASBA 1K0RA 4YY3L 4JI5L 3CCLA 3F2DA 1P8LA 1I6HH 4JI3L 3UE1A 1XMQL 1PH8A 1PH5A 3J80i 2JEBI 3GTGH 2CQOA 2VL6A 2ZM6L 1Q1EA 3PO3H 5ELOA 4JBMA 5JJIA 2A1AA 1YJ9A 1K8AC 4DV0L 5IYDH 2EXDA 1N34Q 2JA7H 2HHHQ 2I5HA 3HOVH 4KHZA 4PZ7A 1HNZQ 4JV5Q 1GKHA 4LUZA 1C9OA 1XNRL 3UDFA 4X62L 1EIYB 4OWWB 2HT1A 1XMOQ 5C0XI 2R6GA 2KENA 3L0OA 4A3EG 4A3JH 4IPDA 3HOUG 1KRTA 3STBD 4QL5A 1NBWA 1B7YB 1HR0L 3B6YA 4A93G 4FDBA 1PH1A 4ME3A 1L1OC 4LFAL 2AWNA 3CF5A 1VQBA 2UXDL 1YHBA 1OTCA 3E9HA 5M3MH 4OWTB 2YU9H 2UXCQ 1TXYA 4HJ8A 3FHWA 1X56A 4LF5L 4LF4Q 1ASZA 1PH7A 5C0XJ 2GN5A 5FLMH 4DR5L 3CC2A 4RG1A 2D0OA 1X3GA 3I7FA 3CCEA 4JI5Q 3PUYA 3I2ZA 1K9MC 1VS0A 2LXJA 1AE3A 4OX9Q 1FGUA 2MO0A 4A3EH 4PMWA 2UXBL 4L5RC 2ID0A 2YTXA 5C3EH 5ELNA 3J81i 4A3FG 2CKZB 3RR5A 5IWAL 1FJGQ 1QZHA 4QGUA 3I4NG 4HJAA 4IFDI 1I50H 3TEHB 1RIPA 3A74A 4P72A 4DV2L 1VQ7A 3S1QH 1IZ6A 1M1KC 3D0FA 5IE8A 3CCRA 4A3BH 5HGQA 3NENA 4DV3Q 4GOPC 3U50C 4P74A 2ZTCA 5GQOA 4AYBE 1X65A 1I94Q 4HJ5A 5M3MG 3KFUA 1K83H 1YNXA 2YTYA 4LW1A 4DR6Q 1TWFH 1Y1WH 3A5ZB 1JE5A 2HIXA 5C4JH 1L1OA 2MNAA 3M4OH 4K0KQ 2UUCL 1UE7A 4A3GG 4DNIA 3I55A 4A3CH 1VQEA 4GKJQ 1IXRA 1VQNA 4BBRH 3PCOB 1N33L 2VUMG 3PF4A 4GKKQ 4DR1Q 3F2BA 4LF5Q 4QJFA 1P16A 2KCTA 1FVIA 1Q81C 3UE0A 4HIDA 3M3YH 1AH9A 3HKZG 3KDFA 1KHIA 3H3VI 4DV6Q 1WI5A 1QVCA 2N8NA 1QUQA 4P73A 1OXTA 3NEMA 4DAYB 3UDGA 2AMCB 1VQ6A 1A62A 1HZBA 1NMFA 2OQKA 1X55A 2WAQE 5BR8L 2EIFA 4B3ML 4YCWA 5M5WH 3S1MH 4DK3C 4C3JH 1JB7A 4B3MQ 1T9HA 5IP9G 3KOJA 4DR2Q 4A4IA 1OXXK 1VQFA 1HNWL 4GLAC 4MTNA 3S15H 2VQEQ 4X65Q 4A3CG 1PVOA 1S3OA 2IT1A 4LNQA 2UUAL 1E1TA 1WFQA 3PSIA 5LMUQ 2VUMH 1BVSA 4MNOA 3PF5A 1L2FA 5IT9c 4B3SL 2CWPA 4BBSH 3M4QA 1CKNB 4UP7A 3SGIA 4DR7L 4BY1G 1N33Q 4JI2L 1SRUA 4DR4Q 4JBKA 2VW9A 4JI6Q 1SMXA 2HQLA 1N9WA 1IBLQ 2UUCQ 4TQUS 2GVBA 1JT8A 1YI2A 4QY7A 1B8AA 4JI4Q 2RHQB 1IBLL 4LUVA 4JI3Q 2A19A 3AFQA 1LYLA 3EIVA 1VQAA 2JA8H 5JEAJ 2R7ZH 2UUAQ 1X3EA 1VQCA 3RLNA 3PO3G 2IX0A 2E5LQ 4JI7Q 5JJKA 1RL2A 4GOPA 4DV3L 1O7IA 1A63A 3TS0A 1EOVA 3HOWH 1CSPA 4POFA 3D31A 1VQ5A 4X65L 2N3SA 3JAMc 4X66L 4JI0Q 3GTKH 5M5XH 2YYZA 4OONA 1MJCA 1Z47A 4L5SA 3S17H 4R4CA 2PI2E 1PA6A 4NXNL 1N32L 3RLOA 4JBWA 2UXBQ 5C3EG 4A3FH 1A0IA 3I4NH 4A3JG 1EIFA 1EQQA 1G6PA 4DR1L 4UPAA 4JI1L 2VNUD 4IPGA 4B3TQ 1KXLA 3W1BA 3KF6A 1Y1VH 1Y14B 2RF4A 3RN2A 2UXDQ 1X6OA 4DV1L 4C3IH 2NVQH 5IY0A 1CKNA 1TWCH 2PI2A 2Z6KC 1E7ZA 1NMGA 2K5NA 2ZM6Q 1VQ4A 1KD1C 3CCVA 3GD7A 2WB1G 1YZ6A 4Y52H 3CP0A 2K5VA 3VDYA 4A3LH 2VY3A 4WJ3M 3CC7A 1OXVA 4JC0A 3PGZA 1YEZA 2K52A 4OO1I 1W2BA 3CMAA 4LF6Q 3CCMA 1QVFA 2BH2A 1UE5A 5JEAG 4R1JA 1V1QA 1J5EL 4GNXB 4O2DA 3F1ZA 4OWXB 2K75A 4BXXG 2MQHA 4BY7H 3F8TA 4DV0Q 1LUZA 4HIMA 2E2HH 1HZCA 2OQ0A 3CAMA 4HIOA 3I4MG 1E3PA 3F2CA 2AHOB 4O0AA 2K4KA 4JI6L 1G51A 1OXUA 1SROA 2QEXA 2ZJQA 2B63G 2N78A 3GTQH 1TWAH 1HNXL 4IJLA 3PIOA 3FP9A 3H3VH 4WJ4A 1XTDA 1UE1A 2JK8A 4LWCA 2UXCL 3TREA 3CD6A 1HJPA 5IP9H 4B3TL 4XIGS 4X6AH 1K3RA 3GDEA 4JI8L 2R93G 5HY6A 1PV4A 4NXML 3U4ZA 4YWMA 4A3GH 1PH3A 1XPOA 4ALPA 3MEFA 3A5UA 4LF8Q 3NELA 4RMFA 1S40A 3JAMi 5C0XG 1B70B 2NN6G 3T1YL 1VQKA 4BXXH 1IYJB 3PIPA 5BR8Q 3M4PA 5C44G 3CCSA 3PUWA 1XMOL 2B63H 2Z6KA 4GS3A 4IFDG 3K7AH 3TQYA 5FLXc 2IX1A 3HOZG 2ZTDA 3RZOH 4GLVB 1HNZL 2JA5G 3GTLH 5AJ3L 4X64Q 4DK6C 2N49A 1JMCA 1BBWA 1K8GA 4A3KG 4A3DG 3M9BA 4R4QA 2JA8G 4JYAL 1QZGA 4GKKL 2CCZA 1VQ8A 4AQYQ 4GN3B 2KHJA 4LUOA 5IYCG 2ZJPA 3A0JA 5E7NA 1XPRA 2RHSB 4B3RL 2Q2UA 3J7ZC 3KJPA 1VCIA 4B3SQ 1NTGA 4DR5Q 3GTOH 1H95A 2XTIA 5C44H 4DUZQ 2A8VA 4DR7Q 1TWHH 1YVCA 3G48A 4YY3Q 4IOCA 3TRZA 4DUYQ 3OW2A 1IBML 2IY5B 2JQOA 1EWIA 4APVA 4DR2L 3AEVA 3S16H 3S1RH 3OTOL 1IL2A 4LFCL 1KAWA 3CMEA 1XNQL 4PG3A 2VQEL 1YIJA 3MXNB 3ULLA 1KL9A 3T1HL 2WAQG 3UDXA 1YJWA 1HR0Q 5LMNL 1E24A 4YHHL 5IWAQ 1N36Q 1E1OA 3HOVG 4JOIA 3K7UC 2BA1A 3AFPA 2OCEA 4LF8L 1Q82C 2E5LL 3U58A 3HOWG 3H15A 2AKWB 2I5LX 4GNXC 1SFOH 4LFBL 4IOAA 4OXPA 3I4OA 1OXSC 2UU9Q 5JJLA 4EX5A 4H02A 4JI4L 4A3LG 3OYYA 4YCVA 1R9TH 4KLKA 2ZJRA 4LF9Q 4JOIC 4A93H 4NXNQ 1VQMA 3CCJA 4GKJL 1PH9A 1X9NA 1HR0W 1GVPA 2Y0SG 4L5QA 3CC4A 3LGJA 1DGSA 2Q2HA 4DV4Q 2R7FA 1G291 3CPFA 1GD7A 1N8RC 3KDFB 2RCNA 1SN8A 1J5EQ 3ICEA 1WCMH 4A3IG 5FLMG 4DR6L 3J81j 4X62Q 2OTLA 1SR3A 4DUZL 1A8VA 2CFMA 1VQGA 5GAHC 5M3FG 2JA6H 2AWOA 4DAMA 2UUBQ 2R93H 4HJ9A 3HKSA 4UP9A 1VQJA 4LFCQ 4A3BG 3GO5A 1VQPA 2H5XA 3STBC 3G6EA 2MO1A 2KCMA 2V1CC 3CPWA 4DV1Q 1MJEA 4HIKA 1M90C 4IPCA 3HOXG 3DM3A 1EQRA 2LSSA 3RZDH 4X64L 1Q46A 1HNXQ 4NB3A 2JEAI 5GAEC 4QQBX 3AQQA 3BJUA 3JC66 1VQDA 2WP8J 1XJVA 1N32Q 4R4OA 1KIXA 4NPSA 2F4VL 1L1OB 5LMNQ 4JYAQ 2E2JH 4BBRG 1NE3A 2B3GA 2LXKA 3K80C 3W1GA 2NVYH 3T1HQ 1LM0A 2I0QA 4BA2I 1IBKQ 2F3IA 5IYCH 3OTOQ 4GOPB 4JI8Q 4IO9A 1VQOA 1V43A 4L5TA 3S2HH 5FJ8H 1E22A 4JV5L 3KJOA 1PFSA 1IBMQ 2B29A 3HOXH 1KQSA 4POGA 1KC8C 3E0EA 3EN2A 1NY4A 4KI0A 2KHIA 5IP7H 3HOYG 1XNRQ 4KHPL 4JCVE 3PUXA 3PO2H 3TS2A 2KBNA 4P71A 5J3BA 1FJGL 1QUQB 3KYHC 3ZJYC 1BKBA 1PYSB 4LF9L 4HJ7A 4K0KL 2ALYB 4OX9L 3J80c 5LMNW 2R7DA 4AQYL 1U0LA 3K81C 1YHQA 4YWLA 1QVGA 2CWAA
chains in the Genus database with same CATH superfamily
2D62A 1PTOH 2Q8RE 2XGTA 2X6LA 4OO1G 1I3QH 1PTOF 3ULJA 4E6IA 2R61A 2D2CC 1CQFA 5GAGC 5C4XG 3PO2G 4J15A 1HFNA 2HCIA 1WYDA 3CQZH 3U4VA 3S2DB 1K73C 2NVXH 4ZAIA 4A93B 1FL0A 3I90A 1I5FA 4XT3B 3M3YB 2PMZE 1PHJA 2IHFA 1GHKA 3RLFA 5IYDG 5C4XB 1K0SA 2IX3A 1UNSA 2DJFC 4B3RQ 2OF1A 2CW0C 4YIJA 2FMCA 2YTVA 2L9HA 2Q2TA 2NVTH 1GUSA 3HGBA 2R92H 3HOUH 1XMQQ 4ZUJA 1VQ9A 3CW2C 1HXYD 5C4HA 2RKSA 3OW7A 1V9PA 2JJQA 3V2TA 1Z9FA 3VA5A 3HOYB 2GVAA 4ABNA 3ERSX 5JJZA 3S14H 1KDCA 4OELB 1LO5D 1WCMG 3E9IA 4DR3Q 1SNDA 2NZ1D 3WOEA 3BDLA 4TKOB 2DN8A 2EXZA 1YJNA 2R92G 5M5XB 2BDNA 5M3FH 5H1SE 1L0WA 4HSPA 3GTLB 1EWHA 1HUNA 4A3MG 1SLJA 3NSWA 3G4SA 4BY7G 3BVMA 2RCFA 2X69A 1AFPA 3KLWA 1YNJD 1PMRA 4ZQ3A 4LFAQ 1F2YA 5A2QE 4PZ6A 1NJIC 2EJGC 1EY5A 2DNEA 1JJ2A 1SE4A 2FFKB 5IGGA 1A3VA 3CCUA 3TDQA 3C1EA 3PO3B 2K14A 4DV4L 2MFIA 3GTPH 3NBIA 3Q6SA 4K5WA 3QB3A 1HZAA 3HOYH 2JA5B 2PNHA 1Q8KA 4JI2Q 3K57A 1WJJA 3VR2A 1T5XD 1I94L 3AMUA 1STEA 1CSQA 2UU9L 3M7NA 2F0GA 3IRBA 1HNWQ 4LJZC 1VQHA 2DGYA 2F4VQ 3A56A 1VMCA 3ULPA 1HUMA 1TWCB 3W5OA 2L5TA 3WOFA 4YY3L 1ZEQX 2CH4A 1RDPD 4K6DA 3TN2A 1PTOD 4JI3L 1PH8A 1PH5A 3J80i 2JEBI 2VL6A 2ZM6L 3P1HA 1STNA 4V190 1TY0A 4JBMA 1LTGD 4DV0L 2RVLA 3P75A 5C5LA 4B08A 1N34Q 4TRDA 3K58A 2I5HA 5M5YB 1EY0A 1JOKA 2K32A 1C9OA 5D3IB 1LTAD 2DY7A 2O5IC 2R6GA 2KENA 3L0OA 1PFBA 3J80L 5IOCA 1B7YB 1PH1A 4KK7A 4LFAL 4BWGB 3MXUA 3NQTA 1YHBA 1BXTA 1S5DD 1TXYA 3FHWA 3I4NB 5C0XJ 1JWMD 4DR5L 3S2HB 3CC2A 4JI5Q 3H0GB 3MC0B 5EKKA 2UXBL 2YTXA 5C3EH 3J81i 3H91A 5IWAL 1I50H 3TEHB 3A74A 3S1QH 1TVXA 5IE8A 5CV4A 4A3BH 1QE6A 2M9VA 1AEXA 4P74A 1I94Q 1FNVA 2XWBB 1K83H 1Y8OB 2YTYA 1LT4D 3KFUA 4DR6Q 2F3VA 2QCPX 3HP3A 3VA7A 1Y1WH 5C4JH 3U9OA 2C5CA 3M4OH 4K0KQ 1A3TA 3X3NA 5E4XA 4A3GG 4MHEA 4GKKQ 1N33L 1HFGA 4DR1Q 1P16A 2KUMA 3UE0A 1AW7A 2E74C 1TT2A 1J9OA 1I4PA 2N8NA 3A8KE 1EZ8A 2WACA 2N55A 1EYCA 1A62A 3S1NB 3VYTA 2Z8LA 4DK3C 3C1FA 1T9HA 3I73A 4A4IA 2EY2A 4GLAC 3S15H 2F0EA 4X65Q 3BZDB 2VQEQ 1PVOA 1B44D 4CBVA 5LMUQ 3TZUA 1SYCA 4PQXA 1II3A 3M4QA 1G6ZA 2E2JB 3MVVA 3SGIA 4DR7L 1K28A 5ELFA 4DR4Q 2B2TA 5A35A 2VW9A 1SMXA 1JORA 4TQUS 2LMCB 1B8AA 2PPBC 4JI3Q 2A19A 2VB2X 3VYSA 1SBBB 1X3EA 5BN5A 4AYBB 2Z4IA 2B2UC 3JAMc 3MHBA 1IL8A 5M5XH 1W6KA 1DZ1A 1ET9A 4NXNL 1N32L 4JBWA 4K5XA 4A3FH 1A0IA 1PZID 1EIFA 1SAPA 2G9DA 3QIAA 4RGOS 1IYUA 2K05A 1WD0A 1LACA 4WJWA 3KF6A 2UXDQ 4UHVA 4DV1L 4C3IH 1TWCH 1VF5C 5J39A 4M1UB 2WB1G 1YZ6A 1NCVA 3CC7A 1D2BA 2EJMA 1QVFA 4PV1C 3CHBD 4KY6A 3FVQA 1SMYD 4BY7H 4DV0Q 1LUZA 3HOXB 2NWGA 5CV9A 3F2CA 2B63G 4JI6L 2K4KA 4Y52H 2ZJQA 2N78A 3GTQH 3FMCA 1HNXL 3PIOA 4WJ4A 2B8GA 1XTDA 1S5FD 1UE1A 3TREA 1E2VA 1MBYA 4FXKC 1K3BC 4XIGS 5EBCA 5M3FB 1J8IA 2DNCA 4YWMA 2EZVA 2QKIC 4HMIA 4OIKA 4RMFA 3T1YL 5EKIA 1RHPA 3PUWA 4C3IB 2L1BA 5FLXc 5CC4A 1BBWA 1K8GA 2JA8G 1WTQA 1WD1A 5EPJA 2CCZA 5IYCG 4K2LA 5CV6A 1PZJD 3KJPA 1H95A 2XTIA 4LMQD 2WINB 5E1FA 3S1MB 4DR7Q 3G48A 3DM1A 4FF2A 5G3LF 1EWIA 4EQNA 1XNQL 4LFCL 1KAWA 2CVRA 2R3ZA 4PG3A 4NW2A 3CMEA 3MXNB 4CKEA 1KL9A 3T1HL 2WAQG 4YHHL 1EWCA 2K28A 1JB3A 2OCEA 3U58A 1MD2D 2FHTA 4OXPA 3I4OA 1OXSC 1XXGA 2UU9Q 3A8IE 3LWEA 1R9TH 4KLKA 1ENFA 1PH9A 1KLGD 1GVPA 3JAME 1DGSA 5IGEA 1G291 3CPFA 4KD4A 4ZUIA 5C5MA 1DJRD 3T51B 4Y7NB 2XIWA 2J7ZA 4KV6A 4A3IG 1WTVA 4DR6L 4FVMA 4X62Q 1VDZA 1SR3A 3I70A 2CFMA 3PMFA 2QDLA 4KKTA 5GAHC 3BS1A 3KLSX 2UUBQ 3PIO3 1B53A 3GO5A 2XRQD 1RTNA 3STBC 5C4JB 1BNZA 3I4MB 2NN6H 5I9OA 1OO9B 3DM3A 1EQTA 1HCZA 1HNXQ 2HQEA 1W6JA 3BJUA 1CM9A 1PRTB 3PQIA 4WFN3 1XTCD 5EBDA 1TR5A 1JC7A 2E2JH 4BBRG 4LF6L 4IURA 3K80C 2NVYH 1LM0A 4BA2I 2F3IA 5IYCH 2L0CA 1R4QB 2Z1CA 1VQOA 4JV5L 3H94A 1PTOC 1PFSA 3KJOA 1GHJA 4B9XA 2K04A 1XX8A 3PUXA 3IFDA 5J3BA 4IN3A 5COYA 4GZYC 1BKBA 1PYSB 5KRUA 3C3LA 1KLUD 1JOQA 1QVGA 1YNJC 2RSNA 3HKZB 2OEOA 3J80c 5C3EB 3TP8A 2KECA 2JE6I 3GTJH 2FXQA 2F0OA 5FJ8G 2OTJA 4C3HB 3QG1A 2ZXOA 2E8GA 2C35B 2Z0SA 4R4IA 1E2ZA 4X3UA 4DV5Q 1JOOA 3S1NH 3G71A 2ATWA 4HMJA 2SNSA 4CKCA 5J1ZA 4JI7L 1Q86C 4FF3A 4ME5A 3S2DH 1TWGH 4EQPA 2KEDA 1H9MA 2PW7A 2JP1A 4P75A 4CGYB 1EOTA 2ZT9C 1LV9A 2WFWA 3EROA 5C4XH 4DV7L 4CDDC 3ER0A 3PUVA 3NUCA 4EQ5A 2EQSA 1GUWA 1VQLA 3BG3A 1KRSA 4DA2A 5KIXA 2HIVA 4A3MH 4PZ8A 4RKLA 3MWYW 4DU9A 1BBXC 3M85A 1PH4A 2F0NA 3BZCA 2QA4A 3RN5A 4A3MB 4GN4B 1C7YA 1HA5A 4XT1B 4N9PA 4X3SA 4KTAA 3G7LA 4C2MH 3MZ5A 2R92B 4RH6A 1Q7YC 1D8LA 2EY6A 1JICA 5EAYA 3W3AA 1WOCA 1XPUA 2KHSA 3NWSA 4FNFA 3X3MA 5D65A 2PQAA 4A3DB 5M5WB 3MA2B 2PQEA 2DUDA 5GROA 1B3AA 3OIPA 4MZ9A 1R4PB 2VB3X 1AE2A 4X66Q 1M4VA 3SK4A 3RNUA 4DNTB 1JWUD 3MXGA 3J81c 1EFWA 1KXLA 2R93B 4AIMA 1HZ9A 1EQVA 1MIUA 2K5HA 3SK5A 3QR8A 4OIJA 1ASYA 2HCCA 4MTKA 5C0XH 1SE8A 1TWFB 2KEEA 1N34L 5IGCA 3ERQA 2E75C 4Z9CB 2I5MX 2JA9A 1BDOA 3GV6A 3KF8B 4C3JB 4ZKCB 2YU9B 3HFZB 2NYZD 4KHPQ 2C9OA 1C48A 1PRTD 4A3KH 4AH6A 3PO2B 2JA5H 3QOJA 4XQQA 2PYKA 2PW5A 4ZK9B 2OWOA 2UUBL 4IFDJ 4R8NA 2E2IH 5DM63 2K03A 3CCQA 4UY8C 1ENCA 3EVQA 4DV5L 3VYRA 1X32A 1JJCB 3MEHA 2JSOA 4DUYL 4JI5L 3J80E 4XQNA 2PZUA 2JXMB 1U4LA 1P8LA 1VMPA 3GTQB 1I6HH 3UE1A 1XMQL 5EGTA 3CKIB 5I6YA 2E2HB 3PO3H 2NVXB 2A1AA 1K8AC 2EDGA 1CHQD 2WV6D 5IYDH 2EXDA 1SFOB 2JA7H 2BOSA 3HOVH 1NUCA 4JV5Q 4LUZA 4C1NI 2M00A 2SNMA 5FOBB 4X62L 3TP6A 4XYQA 4A3JH 4RCNA 3TP5A 3HOUG 1KRTA 4FO2A 1NBWA 1XYIA 4FDBA 1SJHD 4ME3A 2J0TD 3QOLA 3ZYYX 4F87A 5FLXL 1TWHB 3Q0AA 1SNMA 2RBMA 2H1EA 1VQBA 1OTCA 3E9HA 2UXCQ 4OWTB 1GUNA 4HJ8A 2F0PA 1ASZA 1PZKD 3I7FA 1X3GA 2IWHA 2HD3A 3I2ZA 1K9MC 1VS0A 2LXJA 4OX9Q 1FGUA 2MO0A 4PMWA 4NDXA 2ID0A 4DXFA 5DM73 5ELNA 4A3FG 5CORA 3D4RA 1BCPB 1O7ZA 4QGUA 2QILA 4HJAA 1RIPA 4KKUA 2IJ0A 4P72A 1M1KC 3D0FA 3CCRA 4H44C 2A73B 2F1MA 3NENA 4GOPC 5GQOA 4AYBE 1X65A 1YNXA 1BOSA 3HOUB 1H9JA 2O4XA 3A5ZB 2HIXA 2N88A 3S17B 1L1OA 2NBFA 1I50B 1QB5D 3SK6A 1UE7A 3SXHA 3I55A 2VXWA 1GUTA 4XDXA 4BBRH 3PF4A 2JYOA 4LF5Q 2B2WC 3ITPA 2L12A 3MXPA 4QUCA 1Q81C 2F0QA 3T4AC 4DF7A 4Q5VA 3E5SA 3T53B 1QUQA 1OXTA 1HQRD 3NEMA 2AMCB 1K8MA 1NMFA 2ICIA 2WAQE 5BR8L 4B3ML 3J7YW 1JB7A 3D3RA 5E3FA 5C4ZA 1HNWL 3OPOA 1Q3LA 1S3OA 4RWSC 1BVSA 2PO4A 3H6MA 1I4GA 1VF7A 4I7AA 4A3IB 2RDHA 1FNWA 4JI6Q 2UUCQ 3K7AB 2GVBA 1Z7TA 3D4DA 1Q90A 2WKDA 4QY7A 3URYA 2AQ3B 2RHQB 3AFQA 2PNRC 3EIVA 4O1NA 2R7ZH 2L55A 3ND9A 2IX0A 2E5LQ 4P2CB 4I65A 4DV3L 3D31A 1VQ5A 2F0JA 1NR2A 1TIID 5IT9E 2YYZA 4OONA 4L5SA 2H4OA 2HDMA 4R9WA 2PI2E 1PA6A 3RLOA 2UXBQ 5C3EG 2WAQB 3I4NH 2E76C 1PXUA 4UPAA 3VR4A 1WTRA 5IGBA 3W1BA 1Y14B 5LHY1 2P5ZX 1SYGA 4RAUC 3HZXA 2B2YA 3KLRA 3NK9A 1CKNA 2B2UA 1PLFA 2ZM6Q 3K6OA 2VUMB 1GUGA 1CZGA 1KD1C 3GD7A 4BBRB 3CP0A 4HSVA 1PFNA 2K6AA 4DAPA 4OO1I 3PGZA 3NWTA 4DFAA 2BE5D 4OGQC 4LF6Q 5ELDA 2BH2A 1EY6A 1UE5A 5JEAG 3CRKC 2F0UA 4C3IG 2A6EC 3QWNA 1HZCA 3K5OA 2XNAC 3I4MG 1E3PA 5K36H 3DXJC 3OWEB 4FP5D 2K5DA 1EY4A 5F2DA 1U4PA 2JK8A 3CD6A 4JK1C 1DD2A 3KUPA 5HY6A 1D5XC 3VYUA 3U9SA 1IW7C 4ALPA 3A8JE 4X3KA 4G4KA 3A5UA 1PTOB 1BCPC 1HA6A 5NUCA 2NN6G 3NTHA 4IUQA 5BR8Q 3M4PA 3R2TA 1F9PA 4FF1A 3W2DA 1ONLA 1XMOL 2B63H 4PNYA 1HNZL 3GTLH 2KVMA 4DK6C 1BO0A 1JMCA 3DMUA 1GXDC 3M9BA 2EVBA 2WB1B 1F2LA 2KHJA 4GN3B 4LUOA 2ZJPA 1V1PA 1I4XA 3S15B 5FO9B 4DR5Q 1B1ZA 1AZPA 4DUZQ 1BF4A 1JQYD 2XN9C 1IBML 2IY5B 1LLRD 2JQOA 1DM0B 5JVG3 4V0BA 3S1RH 2F0LA 1IL2A 1YIJA 3ULLA 1YJWA 5LMNL 1E24A 2F0HA 5EQ0A 2B39A 1O7YA 1FR3A 1E1OA 5BN4A 3RMHA 3GP7A 5LL6X 4G7OC 4F88A 5A2QL 1MSGA 3H15A 2XSCA 4LFBL 4IOAA 1SXTA 1SSOA 4A3LG 4ILWA 4CJ0B 3OYYA 4Q0FA 1WTXA 4LF9Q 4A93H 4GKJL 3R2IA 3R93A 3LGJA 3RZOB 4O42A 3O13A 1TY2A 2Z6BA 3ICEA 4DAYA 5FLMG 3OMGA 3J81j 2RSOA 2B2VA 1EIHA 1KDBA 2NVTB 1VQGA 1E0BA 5M3FG 2FJ2A 3R3OA 3GTKB 3BVZA 4LFCQ 2AQ2B 1VQPA 5EPKA 1UUPA 2B63B 1M90C 3HOXG 3CU7A 1EQRA 2LSSA 4WORA 5FO7B 3RZDH 1JE4A 2IPKD 1PRTC 2EYJA 3OIQA 1DYQA 1I4RA 2LXKA 3FDTA 2B8FA 2CH4W 1ILQA 2BE5C 4JI8Q 1SNOA 3I72A 4L5TA 1CT1D 1E22A 3S2HH 2EYLA 1ICFB 2B29A 1KQSA 1IBMQ 2KHIA 1WVLA 4DGZA 1SE3A 4JCVE 1SMYC 1LT6D 3KYHC 5IODA 1C8CA 3DEOA 2PMZB 2ALYB 1QCBD 2F0MA 5LMNW 1U0LA 3K81C 2B2VC 4LFBQ 3UDIA 3NPPA 4BBSG 1D1KA 2G5DA 2VQFL 4JW0A 4F7XA 1HHVA 4NKLA 3NXWA 3SR1A 4AYBG 5IYBG 1X54A 1HPCA 3L7ZC 3SK8A 4DK1A 3T1YQ 3DWAA 4H0LC 2PQAB 3GTPB 3HS0C 4NXMQ 4NMZA 2R7ZG 2VZAA 2Y0SE 4LF4L 4LK1C 2VQFQ 2JA7G 3SVMA 2VS1A 1KTKA 5CYUA 1QNKA 4A3IH 1J6QA 1YNNC 2CQAA 4KMUC 4FXDA 4UP8A 2A6ED 2QEJC 4KN7C 1O78A 1PYBA 1LABA 1SNQA 3T13A 2MJ8A 1UEBA 2BA0A 3MAQA 2L15A 3E0JA 4K5VA 2NN6I 3BYYB 4DAVA 4RHRA 1SNPA 3OHXC 1W3SA 4ID6A 5KEEA 1TS3A 1BBUA 4IUNA 1Y69U 1H9KA 3KF8A 1SEBD 3FKIH 4QIWB 4TSSA 4XTCS 3EBEA 1XNQQ 1MKHA 1IKMA 4YWKA 5EJWA 4DV6L 1EYGA 5DLQE 1VQIA 2ES2A 1FGBD 2HUGA 3TP7A 3Q22A 4CDCC 2QGQA 5M5YH 1Z6HA 3BZKA 1I4QA 1O80A 4JG2A 1MI2A 1LTRD 2F52A 5CGKA 1D7QA 1F2MA 3V96A 3ONAB 3K5NA 3CRLC 5IP7G 4R4TA 1S5ED 4KN4C 5K36G 1CKMA 3FKIG 3I4MH 1U5KA 4IZ8A 4JI0L 1F9QA 2Z4HA 2CHBD 4EVOA 5GADC 3HKZE 5JAVA 2XWJB 3M4OB 1NR4A 2F4IA 4CHTB 4GLXA 4DV2Q 1DXMA 3H0GG 1CUKA 2HHHL 3S24A 4TVAB 5FK9C 1PDQA 4OL7A 5IYBH 4JBJA 3BDCA 3Q8DA 4IJHA 1L0XB 4QIWE 4IFDH 3S1QB 4A3DH 1Q12A 3NE5B 4KJNA 3J7A5 4K6LA 1IHZA 1IBKL 1DOMA 2GA4B 3L2PA 1WTPA 2IHEA 4BA1I 3H0GH 3NBHB 2YV5A 1HQMC 4YHHQ 2G9HD 1WCMB 1JJGA 1NSNS 3NBHA 1LTLA 2ASBA 1F9RA 3SE0A 2K5QA 3CCLA 3F2DA 2M2LA 2RQXA 3LX0A 5FLXE 3GTGH 1SYFA 2QDBA 1Q1EA 4KJOA 3QO2A 3EJIA 4N8FA 4CJ2C 1YJ9A 1S4ZA 4RGTA 5FO8B 5KGUA 3EQLC 5J22A 1SYDA 1IYVA 4KHZA 4PZ7A 1HNZQ 3C46A 5JVH3 1XNRL 3UDFA 5DNFA 4OWWB 5C0XI 1BUVT 5I9PA 2F0WA 4IPDA 3STBD 5BN3A 1HR0L 4A93G 4K2KA 2BCOA 1HRJA 2EOTA 3CF5A 1SJED 1QILA 2YU9H 1ENAA 4BY1B 4LF5L 1X56A 4XQJA 1PH7A 5FLMH 4RG1A 3CCEA 3NHHA 2B2YC 3T16A 1AE3A 1U9RA 1DOKA 4K8IA 2EYFA 2EJFC 4FXGC 3A7LA 4IUTA 3I4NG 3RR5A 4IFDI 2V4DA 1QZHA 4QMGA 1FJGQ 2JA7B 3J7AF 2LKVA 2Y0SB 4DV3Q 3T56B 2ZTCA 3DWQA 4HJ5A 5M3MG 4K14A 4LW1A 5FKAC 4BY7B 4F8MA 1TWFH 1I6HB 4HAEA 4HCEA 3WDNA 2UUCL 1NNXA 1VQEA 4BBSB 3Q24A 1U4MA 2VUMG 4IUUA 4QJFA 5CBAE 1FVIA 3M3YH 3RZDB 3H3VI 3S1RB 1QVCA 5M3MB 4P73A 3UDGA 4DAYB 1Q8IA 4HR7B 1A6XA 1JR0D 4DNRB 3NQIA 2EIFA 5M5WH 3HEJA 4C3JH 5IP9G 3KOJA 2AUJD 4CDFC 2UUAL 4ZLTF 1E1TA 1WFQA 1EIGA 4MNOA 1L2FA 5IT9c 4BBSH 1CKNB 2NTSA 4UP7A 4BY1G 1N33Q 3DUZA 1ESFA 1SRUA 4A3KB 1JT8A 2IW3A 1YI2A 1IBLL 4LUVA 1VQAA 2JA8H 3I8ZA 5JEAJ 3UI2A 2UUAQ 1VQCA 3KBXA 1MGSA 4HTHA 4M8AA 1EY7A 3PO3G 4JI7Q 2XVSA 4IUVA 1EOVA 4POFA 4RHSA 4X65L 1SYBA 4X66L 3GTKH 4RFBA 4R4CA 3S17H 1CK1A 2K7VA 4N9TA 3FPPA 1K83B 4A3JG 1EQQA 1AZQA 4DR1L 2NVQB 3MFGA 2DJGC 1FD7D 1DCZA 1Y1VH 4DXGA 1A2UA 5IY0A 3N52A 1D5ZC 2Z6KC 1KAAA 1EY8A 1VQ4A 1ZXTA 3VDYA 3EFXD 1CA6A 1D5MC 2K52A 1W2BA 3A7AB 3CMAA 4G57A 1V1PB 1HTLD 1V1QA 2EPBA 2RA4A 4O2DA 3F1ZA 2K75A 2SEBD 2MQHA 3F8TA 4HIMA 3H3VC 4QCLA 4HIOA 2AUKA 2NTTA 4A3JB 1OXUA 2QEXA 2RDGA 1EY9A 3H3VH 5D14A 3SDZA 2UXCL 4LWCA 4IQZA 5IP9H 4B3TL 4ULLA 4X6AH 1K3RA 3GDEA 3U4ZA 1XPOA 3MEFA 1QWYA 4LF8Q 1S40A 2PZWA 3JAMi 5C0XG 4BXXH 1IYJB 3GTGB 1S5CD 5C44G 3OWFA 3CCSA 3K0YA 2Z6KA 4GS3A 3TQYA 1PYWD 1X3PA 3HOZG 2JA5G 1STAA 4X64Q 5AJ3L 2N49A 3D8GA 4A3KG 4R4QA 2BDOA 4JYAL 1B2TA 1VQ8A 3A0JA 3HG9A 1DOLA 2RHSB 2Q2UA 3J7ZC 2F0KA 1VCIA 1EU3A 1ET6A 3GTOH 1B9MA 5KNCA 5C44H 2A8VA 1YVCA 3S9WA 3TRZA 4IOCA 2CW0D 4DUYQ 1TWAB 4DR2L 4APVA 3I4LA 3OTOL 1I6VC 3P7JA 2MUYA 1BCPF 1FNUA 3UDXA 4FF4A 1N36Q 1QG7A 4JOIA 3K7UC 2BA1A 1Q82C 3EA6A 3HOWG 4ZCKA 2AKWB 5IT9L 5L37A 4GNXC 3IFTA 1QNUA 1SFOH 1CFMA 1EZ6A 4EX5A 4JI4L 2R7ZB 4YCVA 2A6HC 4JOIC 5IGFA 4NXNQ 1VQMA 2Y0SG 3CC4A 2L4NA 2Q2HA 2R7FA 1GD7A 5IIFA 3KDFB 1N8RC 1SN8A 1J5EQ 3DEPA 1WCMH 2F0SA 1F77A 1SNCA 2OTLA 4DUZL 4C2MB 4L6TB 4J8QA 4KY5A 5K5PA 2JA6H 4LAAA 2R93H 1CHPD 3HKSA 1VQJA 4A3BG 1G2SA 4KKSA 2H5XA 5ELCA 2MO1A 2KCMA 2V1CC 5JEAH 3K5MA 4HIKA 4IPCA 2QW7A 5CV8A 4X64L 2KJXA 4NB3A 2JEAI 4IUPA 3J81E 3I91A 2WP8J 1XJVA 1N32Q 4R4OA 4G7ZC 1KIXA 4NPSA 1I4HA 2F4VL 1H9RA 1L1OB 4XXEA 2I0QA 1NE3A 3W1GA 2MGSA 1IBKQ 5EPLA 4GOPB 3OTOQ 1BR9A 4OO1H 4I7ZC 1V43A 5FJ8H 5KYLA 3HOXH 1KC8C 3E0EA 3EN2A 5IP7H 4KHPL 5CV5A 1LTBD 2KBNA 3DHQA 1FJGL 1QUQB 3VR3A 5KYIA 5CMDA 4K0KL 5ELBA 3J81L 2EE1A 3MFYA 1VQNA 1BCPD 4YWLA 1RF2D 2MP1A 4MIUA 1QOHA 2K50A 2K01A 4DR3L 3BU2A 1GJXA 1GUOA 2LY7A 2XRSD 3AYHB 4JVZA 3I3CA 2ZTEA 2DY8A 3K59A 1STYA 1U4RA 1RTOA 3IKJA 2SDFA 5DAUA 2NZHA 2WB1E 4N8X1 4GNXA 4LF7Q 5CBEE 1B9NA 1HH2P 1S5BD 3GTMH 3C2PA 4C3HH 3SHLA 1UE6A 4JPBW 3GTMB 5IGDA 2A68C 1M8AA 2JA6G 3FKIB 1EL0A 5CR3A 3DLLA 3KF6B 3VR6A 3OOCA 2D0PA 4YCUA 4S3SA 1EYDA 1Y1VG 1YHAA 4OEMB 1WTWA 1YBYA 4RGMA 1CZWA 2TSSA 4DR4L 3K0XA 2LFNA 4B9WA 2L11A 4A75A 1STBA 4CKBA 4EQOA 3HOVB 2OT2A 4JI1Q 1KDAA 3WWVA 1D1IA 4IPHA 2A69C 5TSSA 3PV0A 3TBIB 2BH8A 2A6HD 2TMPA 1IKLA 1Y1WG 1YITA 4A76A 1TQOA 5AJ3Q 4L8JA 5LMUL 1CKOA 2Q2IA 3L9AX 3CXCA 1PH6A 1Q1BA 3K8AA 1GO3E 4CJ1B 4UDUC 3KBGA 2NZOA 3DWPA 4DKAC 3J7AV 1PH2A 5C3XA 4GN5A 2FMMA 1SYEA 1GOZA 1S72A 1UAPA 1GM5A 4DV7Q 1STGA 4WRDA 4LF7L 4QUFA 1XWEA 3HOZH 4Y7NH 2KA7A 2EYOA 4C3JG 1AP0A 4U68A 1RD9D 3A55A 3I56A 2A69D 1X3FA 3D6WA 3M7GA 3PUZA 1UWVA 4DPGA 3PIP3 4A3EB 1C0AA 1KABA 1N36L 1EUJA 1F9SA 1ZKOA 4H7BA 4H13C 5JPMC 2EYPA 4BY1H 1G91A 4EGVA 3BVGA 3RD4A 1K0RA 4DN4M 2F0DA 1YNND 3IAYA 1KNAA 1ZYRD 2CQOA 1LTSD 3KLSA 5ELOA 5I2XA 3FEWX 5JJIA 4KHVA 3A54A 2HHHQ 4NP5A 1GKHA 3V05A 1EIYB 2HT1A 1XMOQ 3LWUA 4QB4A 2B2WA 1FYCA 4A3EG 5ISRA 2KQ3A 4RCOA 2OXPA 2JA8B 1JWSD 4QL5A 2X6GA 2ZXPA 5LL6S 5E4WC 5KNDA 3B6YA 1L1OC 3FPUB 2AWNA 4ZKBB 2O5JC 2B2TC 2KCNA 2PCFB 1B50A 2UXDL 2EY5A 5M3MH 4MN3A 5I4DA 4LF4Q 2GN5A 2D0OA 2E2IB 3PUYA 4A3EH 4L5RC 2CKZB 3S14B 5KNBA 1CQVA 3GV3A 1CI3M 4ZYSA 4DV2L 4X3TA 1VQ7A 1IZ6A 4UAIA 1TS2A 5HGQA 3Q23A 1CA5A 4PMCA 5M9OA 1Y1WB 1EU4A 1CTMA 2F0TA 3RUZA 3U50C 1TS4A 1PFMA 1Y8PB 2LS01 3AU7A 1STHA 1JE5A 1B3QA 3F2UA 2MNAA 4KY7A 4DNIA 4A3CH 4GKJQ 4KD3A 1IXRA 3PCOB 3F2BA 2HDLA 2KCTA 2WKCA 2F03A 4HIDA 1AH9A 3HKZG 3KDFA 1KHIA 4DV6Q 1WI5A 1T5EA 1VQ6A 1SE2A 2A74C 1HZBA 2OQKA 1X55A 1Y8NB 5EKLA 3S1MH 4YCWA 3OMCA 4B3MQ 4RKBA 4DR2Q 3R8BA 2JA6B 1OXXK 1VQFA 2F0FA 1HTPA 4MTNA 4A3FB 3GTJB 4QF4A 4A3CG 1MSHA 1ESRA 4L63B 2IT1A 4LNQA 1BQQT 4FYDA 1NAPA 3PSIA 2VUMH 5JOBA 3PF5A 5G3LD 4B3SL 2CWPA 3HRZC 4PMBA 1ML0D 2KCCA 4HEDA 5HGTA 4JI2L 4JBKA 2HQLA 1N9WA 1IBLQ 2Q8TA 4JI4Q 3IL8A 1LYLA 1A2TA 3H09A 1DONA 3SEBA 3RLNA 3CQZB 5JJKA 1RL2A 2JN4A 4GOPA 2NB0A 1A63A 1O7IA 3TS0A 3HOWH 2WIIB 1CSPA 2F3WA 4G7HC 2N3SA 4JI0Q 3HOWB 2O2LD 1A15A 1MJCA 1Z47A 3K5LA 1X3QA 4HN7A 1G6PA 3G6JB 4CDEC 4C1NK 4JI1L 2VNUD 1LT3D 4XYOA 3BDOA 4IPGA 4B3TQ 2ICEC 1G8ZD 3VR5A 2RF4A 3RN2A 1X6OA 2NVQH 5C6AA 4U673 5HURA 4J6HA 2PI2A 1E7ZA 1NMGA 2K5NA 1LT5D 1EFID 1PRTF 2Z9HA 1ILPA 2I46A 3CCVA 4A3GB 4A3LH 2K5VA 2VY3A 4WJ3M 1OXVA 4JC0A 1YEZA 1RCVD 1UEAB 1Y1VB 3CCMA 3NTKA 3HOZB 4R1JA 1J5EL 4GNXB 4OWXB 4BXXG 2E2HH 2IL8A 2OQ0A 3CAMA 3M4YA 2AHOB 4O0AA 1G51A 1SROA 2A68D 1TWAH 4IJLA 3FP9A 4A3BB 4OHJA 5D3DA 2ENBA 3FRPB 1HJPA 4JI8L 2R93G 1V8QA 1PV4A 4NXML 4BS9A 4A3GH 1PH3A 1G2TA 3NELA 1B70B 2F0VA 1VQKA 4J1MA 3PIPA 4RGNA 3N6RA 4IFDG 3K7AH 2IX1A 3RZOH 2ZTDA 4GLVB 1H9SB 1A3UA 3GTOB 4HCSA 2QF7A 4A3DG 2SOBA 3D6CA 3TMEA 5I6WA 1H9SA 1QZGA 4GKKL 3NTIA 1MHWC 2D5DA 5ELEA 5I2YA 1D6EC 4AQYQ 5E7NA 1XPRA 4B3RL 1QJOA 4B3SQ 1NTGA 5AFWA 2RDFA 1O7LA 1TWHH 1K8OA 4YY3Q 3OW2A 1TKWB 1V1OA 3D4WA 3S16H 3AEVA 3QJYA 2NUCA 1RJTA 2A5HA 1LTTD 2VQEL 1R9TB 1B4OA 4R8IA 2EY1A 1WTOA 1HR0Q 5C3WA 2EYHA 2KOLA 5IWAQ 4ZRZA 1EEID 1SDFA 5JPNC 3HOVG 3AFPA 4LF8L 2E5LL 3TSSA 3E3XA 5CV7A 2I5LX 1L0YB 5DEHA 2D9UA 2E2DC 5JJLA 5T1GA 1F2ZA 4H02A 3KK7A 3P20A 1WTHA 2ZJRA 3CCJA 1X9NA 1HR0W 2K33A 3E6ZX 4L5QA 4RA8A 4DV4Q 2PZTA 4DK0A 2RCNA 5C44B 1RKNA 2F0IA 1ZYRC 3MTSA 1C4QA 3TZDA 4C3HG 1I3QB 1RODA 2K1BA 3AB9A 1A8VA 2MHVA 2Q8IB 1AN8A 4C56C 3LNNA 2AWOA 4DAMA 4HJ9A 4UP9A 3MXNA 1IW7D 1TS5A 1E2WA 2K5WA 3G6EA 1ICWA 3CPWA 4DV1Q 1TWGB 1MJEA 1Q46A 3JAML 5GAEC 4QQBX 3AQQA 2J4XA 1LTID 3JC66 3BYTB 1VQDA 2NVYB 3ND8A 1JCKB 1EYAA 1KNEA 2AQ1B 5LMNQ 4JYAQ 3T1HQ 2B3GA 2MPMA 4K8JA 2ZXRA 2EYMA 4IO9A 4ODGA 1EEFD 4POGA 4KI0A 4IALA 1NY4A 3GQBA 3HOYG 1XNRQ 3S16B 3PO2H 3TS2A 4P71A 3ZJYC 2FINB 4LF9L 4HJ7A 5T1IA 4OX9L 2I07B 4AQYL 2R7DA 3L3OC 3OSOA 1YHQA 1TU2B 3NP8A 2CWAA
chains in the Genus database with same CATH topology
2D62A 4LFBQ 2XGTA 4LF6L 3UDIA 4BBSG 2JE6I 3GTJH 4OO1G 1I3QH 2FXQA 2VQFL 5FJ8G 3ULJA 2K50A 2OTJA 4DR3L 2E8GA 2C35B 2Z0SA 3BU2A 4R4IA 5GAGC 4AYBG 5C4XG 5IYBG 1X54A 3PO2G 4J15A 4DV5Q 3L7ZC 3S1NH 1WYDA 3CQZH 3U4VA 3T1YQ 3AYHB 1K73C 3G71A 2NVXH 2ATWA 2ZTEA 1FL0A 2PQAB 4JI7L 1Q86C 1I5FA 2PMZE 4NXMQ 1PHJA 2R7ZG 3S2DH 2NZHA 1TWGH 2IHFA 2VZAA 2Y0SE 2WB1E 3RLFA 5IYDG 2VQFQ 4GNXA 4LF4L 4LF7Q 2JA7G 2VS1A 1HH2P 4P75A 3GTMH 4B3RQ 4A3IH 4C3HH 1J6QA 1UE6A 4UP8A 2WFWA 2Q2TA 2YTVA 5C4XH 4DV7L 2NVTH 1PYBA 3ER0A 3PUVA 2R92H 4EQ5A 1XMQQ 1VQ9A 3HOUH 2JA6G 2EQSA 1UEBA 2BA0A 3CW2C 1VQLA 3DLLA 2L15A 1KRSA 3KF6B 2HIVA 2D0PA 1V9PA 2NN6I 4YCUA 4A3MH 4PZ8A 3M85A 2JJQA 1PH4A 3BZCA 1W3SA 2QA4A 3RN5A 1Z9FA 1Y1VG 1YHAA 4GN4B 1BBUA 2GVAA 1C7YA 3ERSX 3S14H 1YBYA 3FKIH 4XTCS 1WCMG 3E9IA 4C2MH 3EBEA 4DR3Q 1XNQQ 1MKHA 4DR4L 4YWKA 4DV6L 3K0XA 1Q7YC 1D8LA 1EYGA 5DLQE 1VQIA 1YJNA 2ES2A 2R92G 5EAYA 1WOCA 4A75A 1XPUA 2QGQA 5M3FH 5M5YH 2PQAA 3BZKA 5H1SE 1L0WA 4JI1Q 4JG2A 4A3MG 1SLJA 3WWVA 2F52A 4IPHA 3G4SA 1D7QA 4BY7G 3PV0A 2DUDA 2BH8A 5GROA 5IP7G 4R4TA 3KLWA 4LFAQ 5K36G 4MZ9A 1Y1WG 1CKMA 3FKIG 1AE2A 3I4MH 1U5KA 4X66Q 1YITA 4JI0L 4A76A 3RNUA 5AJ3Q 3J81c 1CKOA 2Q2IA 5LMUL 4PZ6A 3CXCA 5GADC 3HKZE 1PH6A 1NJIC 1EFWA 4AIMA 1HZ9A 1Q1BA 1GO3E 3K8AA 1JJ2A 1MIUA 2K5HA 4GLXA 2NZOA 4DKAC 4DV2Q 1PH2A 1ASYA 3CCUA 3H0GG 1CUKA 4GN5A 2HHHL 1SE8A 3S24A 1N34L 4TVAB 2K14A 4DV4L 2MFIA 1S72A 3GTPH 1GM5A 4DV7Q 4LF7L 2I5MX 2JA9A 1HZAA 3KF8B 5IYBH 4JBJA 2PNHA 3HOYH 1Q8KA 3HFZB 3Q8DA 4IJHA 4JI2Q 3HOZH 4Y7NH 4QIWE 4KHPQ 1WJJA 4A3KH 1I94L 4A3DH 1Q12A 4AH6A 2JA5H 1CSQA 3I56A 2UU9L 3J7A5 3M7NA 1X3FA 3IRBA 3PUZA 4DPGA 1UWVA 1IBKL 2OWOA 1HNWQ 2UUBL 4IFDJ 3L2PA 1C0AA 1VQHA 2IHEA 4BA1I 3H0GH 2E2IH 2DGYA 3NBHB 2YV5A 1N36L 3CCQA 1EUJA 2F4VQ 4UY8C 4YHHQ 3ULPA 3W5OA 4BY1H 4DV5L 1JJGA 1JJCB 1LTLA 4DUYL 2ASBA 1K0RA 4YY3L 4JI5L 3CCLA 3F2DA 1P8LA 1I6HH 4JI3L 3UE1A 1XMQL 1PH8A 1PH5A 3J80i 2JEBI 3GTGH 2CQOA 2VL6A 2ZM6L 1Q1EA 3PO3H 5ELOA 4JBMA 5JJIA 2A1AA 1YJ9A 1K8AC 4DV0L 5IYDH 2EXDA 1N34Q 2JA7H 2HHHQ 2I5HA 3HOVH 4KHZA 4PZ7A 1HNZQ 4JV5Q 1GKHA 4LUZA 1C9OA 1XNRL 3UDFA 4X62L 1EIYB 4OWWB 2HT1A 1XMOQ 5C0XI 2R6GA 2KENA 3L0OA 4A3EG 4A3JH 4IPDA 3HOUG 1KRTA 3STBD 4QL5A 1NBWA 1B7YB 1HR0L 3B6YA 4A93G 4FDBA 1PH1A 4ME3A 1L1OC 4LFAL 2AWNA 3CF5A 1VQBA 2UXDL 1YHBA 1OTCA 3E9HA 5M3MH 4OWTB 2YU9H 2UXCQ 1TXYA 4HJ8A 3FHWA 1X56A 4LF5L 4LF4Q 1ASZA 1PH7A 5C0XJ 2GN5A 5FLMH 4DR5L 3CC2A 4RG1A 2D0OA 1X3GA 3I7FA 3CCEA 4JI5Q 3PUYA 3I2ZA 1K9MC 1VS0A 2LXJA 1AE3A 4OX9Q 1FGUA 2MO0A 4A3EH 4PMWA 2UXBL 4L5RC 2ID0A 2YTXA 5C3EH 5ELNA 3J81i 4A3FG 2CKZB 3RR5A 5IWAL 1FJGQ 1QZHA 4QGUA 3I4NG 4HJAA 4IFDI 1I50H 3TEHB 1RIPA 3A74A 4P72A 4DV2L 1VQ7A 3S1QH 1IZ6A 1M1KC 3D0FA 5IE8A 3CCRA 4A3BH 5HGQA 3NENA 4DV3Q 4GOPC 3U50C 4P74A 2ZTCA 5GQOA 4AYBE 1X65A 1I94Q 4HJ5A 5M3MG 3KFUA 1K83H 1YNXA 2YTYA 4LW1A 4DR6Q 1TWFH 1Y1WH 3A5ZB 1JE5A 2HIXA 5C4JH 1L1OA 2MNAA 3M4OH 4K0KQ 2UUCL 1UE7A 4A3GG 4DNIA 3I55A 4A3CH 1VQEA 4GKJQ 1IXRA 1VQNA 4BBRH 3PCOB 1N33L 2VUMG 3PF4A 4GKKQ 4DR1Q 3F2BA 4LF5Q 4QJFA 1P16A 2KCTA 1FVIA 1Q81C 3UE0A 4HIDA 3M3YH 1AH9A 3HKZG 3KDFA 1KHIA 3H3VI 4DV6Q 1WI5A 1QVCA 2N8NA 1QUQA 4P73A 1OXTA 3NEMA 4DAYB 3UDGA 2AMCB 1VQ6A 1A62A 1HZBA 1NMFA 2OQKA 1X55A 2WAQE 5BR8L 2EIFA 4B3ML 4YCWA 5M5WH 3S1MH 4DK3C 4C3JH 1JB7A 4B3MQ 1T9HA 5IP9G 3KOJA 4DR2Q 4A4IA 1OXXK 1VQFA 1HNWL 4GLAC 4MTNA 3S15H 2VQEQ 4X65Q 4A3CG 1PVOA 1S3OA 2IT1A 4LNQA 2UUAL 1E1TA 1WFQA 3PSIA 5LMUQ 2VUMH 1BVSA 4MNOA 3PF5A 1L2FA 5IT9c 4B3SL 2CWPA 4BBSH 3M4QA 1CKNB 4UP7A 3SGIA 4DR7L 4BY1G 1N33Q 4JI2L 1SRUA 4DR4Q 4JBKA 2VW9A 4JI6Q 1SMXA 2HQLA 1N9WA 1IBLQ 2UUCQ 4TQUS 2GVBA 1JT8A 1YI2A 4QY7A 1B8AA 4JI4Q 2RHQB 1IBLL 4LUVA 4JI3Q 2A19A 3AFQA 1LYLA 3EIVA 1VQAA 2JA8H 5JEAJ 2R7ZH 2UUAQ 1X3EA 1VQCA 3RLNA 3PO3G 2IX0A 2E5LQ 4JI7Q 5JJKA 1RL2A 4GOPA 4DV3L 1O7IA 1A63A 3TS0A 1EOVA 3HOWH 1CSPA 4POFA 3D31A 1VQ5A 4X65L 2N3SA 3JAMc 4X66L 4JI0Q 3GTKH 5M5XH 2YYZA 4OONA 1MJCA 1Z47A 4L5SA 3S17H 4R4CA 2PI2E 1PA6A 4NXNL 1N32L 3RLOA 4JBWA 2UXBQ 5C3EG 4A3FH 1A0IA 3I4NH 4A3JG 1EIFA 1EQQA 1G6PA 4DR1L 4UPAA 4JI1L 2VNUD 4IPGA 4B3TQ 1KXLA 3W1BA 3KF6A 1Y1VH 1Y14B 2RF4A 3RN2A 2UXDQ 1X6OA 4DV1L 4C3IH 2NVQH 5IY0A 1CKNA 1TWCH 2PI2A 2Z6KC 1E7ZA 1NMGA 2K5NA 2ZM6Q 1VQ4A 1KD1C 3CCVA 3GD7A 2WB1G 1YZ6A 4Y52H 3CP0A 2K5VA 3VDYA 4A3LH 2VY3A 4WJ3M 3CC7A 1OXVA 4JC0A 3PGZA 1YEZA 2K52A 4OO1I 1W2BA 3CMAA 4LF6Q 3CCMA 1QVFA 2BH2A 1UE5A 5JEAG 4R1JA 1V1QA 1J5EL 4GNXB 4O2DA 3F1ZA 4OWXB 2K75A 4BXXG 2MQHA 4BY7H 3F8TA 4DV0Q 1LUZA 4HIMA 2E2HH 1HZCA 2OQ0A 3CAMA 4HIOA 3I4MG 1E3PA 3F2CA 2AHOB 4O0AA 2K4KA 4JI6L 1G51A 1OXUA 1SROA 2QEXA 2ZJQA 2B63G 2N78A 3GTQH 1TWAH 1HNXL 4IJLA 3PIOA 3FP9A 3H3VH 4WJ4A 1XTDA 1UE1A 2JK8A 4LWCA 2UXCL 3TREA 3CD6A 1HJPA 5IP9H 4B3TL 4XIGS 4X6AH 1K3RA 3GDEA 4JI8L 2R93G 5HY6A 1PV4A 4NXML 3U4ZA 4YWMA 4A3GH 1PH3A 1XPOA 4ALPA 3MEFA 3A5UA 4LF8Q 3NELA 4RMFA 1S40A 3JAMi 5C0XG 1B70B 2NN6G 3T1YL 1VQKA 4BXXH 1IYJB 3PIPA 5BR8Q 3M4PA 5C44G 3CCSA 3PUWA 1XMOL 2B63H 2Z6KA 4GS3A 4IFDG 3K7AH 3TQYA 5FLXc 2IX1A 3HOZG 2ZTDA 3RZOH 4GLVB 1HNZL 2JA5G 3GTLH 5AJ3L 4X64Q 4DK6C 2N49A 1JMCA 1BBWA 1K8GA 4A3KG 4A3DG 3M9BA 4R4QA 2JA8G 4JYAL 1QZGA 4GKKL 2CCZA 1VQ8A 4AQYQ 4GN3B 2KHJA 4LUOA 5IYCG 2ZJPA 3A0JA 5E7NA 1XPRA 2RHSB 4B3RL 2Q2UA 3J7ZC 3KJPA 1VCIA 4B3SQ 1NTGA 4DR5Q 3GTOH 1H95A 2XTIA 5C44H 4DUZQ 2A8VA 4DR7Q 1TWHH 1YVCA 3G48A 4YY3Q 4IOCA 3TRZA 4DUYQ 3OW2A 1IBML 2IY5B 2JQOA 1EWIA 4APVA 4DR2L 3AEVA 3S16H 3S1RH 3OTOL 1IL2A 4LFCL 1KAWA 3CMEA 1XNQL 4PG3A 2VQEL 1YIJA 3MXNB 3ULLA 1KL9A 3T1HL 2WAQG 3UDXA 1YJWA 1HR0Q 5LMNL 1E24A 4YHHL 5IWAQ 1N36Q 1E1OA 3HOVG 4JOIA 3K7UC 2BA1A 3AFPA 2OCEA 4LF8L 1Q82C 2E5LL 3U58A 3HOWG 3H15A 2AKWB 2I5LX 4GNXC 1SFOH 4LFBL 4IOAA 4OXPA 3I4OA 1OXSC 2UU9Q 5JJLA 4EX5A 4H02A 4JI4L 4A3LG 3OYYA 4YCVA 1R9TH 4KLKA 2ZJRA 4LF9Q 4JOIC 4A93H 4NXNQ 1VQMA 3CCJA 4GKJL 1PH9A 1X9NA 1HR0W 1GVPA 2Y0SG 4L5QA 3CC4A 3LGJA 1DGSA 2Q2HA 4DV4Q 2R7FA 1G291 3CPFA 1GD7A 1N8RC 3KDFB 2RCNA 1SN8A 1J5EQ 3ICEA 1WCMH 4A3IG 5FLMG 4DR6L 3J81j 4X62Q 2OTLA 1SR3A 4DUZL 1A8VA 2CFMA 1VQGA 5GAHC 5M3FG 2JA6H 2AWOA 4DAMA 2UUBQ 2R93H 4HJ9A 3HKSA 4UP9A 1VQJA 4LFCQ 4A3BG 3GO5A 1VQPA 2H5XA 3STBC 3G6EA 2MO1A 2KCMA 2V1CC 3CPWA 4DV1Q 1MJEA 4HIKA 1M90C 4IPCA 3HOXG 3DM3A 1EQRA 2LSSA 3RZDH 4X64L 1Q46A 1HNXQ 4NB3A 2JEAI 5GAEC 4QQBX 3AQQA 3BJUA 3JC66 1VQDA 2WP8J 1XJVA 1N32Q 4R4OA 1KIXA 4NPSA 2F4VL 1L1OB 5LMNQ 4JYAQ 2E2JH 4BBRG 1NE3A 2B3GA 2LXKA 3K80C 3W1GA 2NVYH 3T1HQ 1LM0A 2I0QA 4BA2I 1IBKQ 2F3IA 5IYCH 3OTOQ 4GOPB 4JI8Q 4IO9A 1VQOA 1V43A 4L5TA 3S2HH 5FJ8H 1E22A 4JV5L 3KJOA 1PFSA 1IBMQ 2B29A 3HOXH 1KQSA 4POGA 1KC8C 3E0EA 3EN2A 1NY4A 4KI0A 2KHIA 5IP7H 3HOYG 1XNRQ 4KHPL 4JCVE 3PUXA 3PO2H 3TS2A 2KBNA 4P71A 5J3BA 1FJGL 1QUQB 3KYHC 3ZJYC 1BKBA 1PYSB 4LF9L 4HJ7A 4K0KL 2ALYB 4OX9L 3J80c 5LMNW 2R7DA 4AQYL 1U0LA 3K81C 1YHQA 4YWLA 1QVGA 2CWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D62 A;  4LFB Q;  2XGT A;  4LF6 L;  3UDI A;  4BBS G;  2JE6 I;  3GTJ H;  4OO1 G;  1I3Q H;  2FXQ A;  2VQF L;  5FJ8 G;  3ULJ A;  2K50 A;  2OTJ A;  4DR3 L;  2E8G A;  2C35 B;  2Z0S A;  3BU2 A;  4R4I A;  5GAG C;  4AYB G;  5C4X G;  5IYB G;  1X54 A;  3PO2 G;  4J15 A;  4DV5 Q;  3L7Z C;  3S1N H;  1WYD A;  3CQZ H;  3U4V A;  3T1Y Q;  3AYH B;  1K73 C;  3G71 A;  2NVX H;  2ATW A;  2ZTE A;  1FL0 A;  2PQA B;  4JI7 L;  1Q86 C;  1I5F A;  2PMZ E;  4NXM Q;  1PHJ A;  2R7Z G;  3S2D H;  2NZH A;  1TWG H;  2IHF A;  2VZA A;  2Y0S E;  2WB1 E;  3RLF A;  5IYD G;  2VQF Q;  4GNX A;  4LF4 L;  4LF7 Q;  2JA7 G;  2VS1 A;  1HH2 P;  4P75 A;  3GTM H;  4B3R Q;  4A3I H;  4C3H H;  1J6Q A;  1UE6 A;  4UP8 A;  2WFW A;  2Q2T A;  2YTV A;  5C4X H;  4DV7 L;  2NVT H;  1PYB A;  3ER0 A;  3PUV A;  2R92 H;  4EQ5 A;  1XMQ Q;  1VQ9 A;  3HOU H;  2JA6 G;  2EQS A;  1UEB A;  2BA0 A;  3CW2 C;  1VQL A;  3DLL A;  2L15 A;  1KRS A;  3KF6 B;  2HIV A;  2D0P A;  1V9P A;  2NN6 I;  4YCU A;  4A3M H;  4PZ8 A;  3M85 A;  2JJQ A;  1PH4 A;  3BZC A;  1W3S A;  2QA4 A;  3RN5 A;  1Z9F A;  1Y1V G;  1YHA A;  4GN4 B;  1BBU A;  2GVA A;  1C7Y A;  3ERS X;  3S14 H;  1YBY A;  3FKI H;  4XTC S;  1WCM G;  3E9I A;  4C2M H;  3EBE A;  4DR3 Q;  1XNQ Q;  1MKH A;  4DR4 L;  4YWK A;  4DV6 L;  3K0X A;  1Q7Y C;  1D8L A;  1EYG A;  5DLQ E;  1VQI A;  1YJN A;  2ES2 A;  2R92 G;  5EAY A;  1WOC A;  4A75 A;  1XPU A;  2QGQ A;  5M3F H;  5M5Y H;  2PQA A;  3BZK A;  5H1S E;  1L0W A;  4JI1 Q;  4JG2 A;  4A3M G;  1SLJ A;  3WWV A;  2F52 A;  4IPH A;  3G4S A;  1D7Q A;  4BY7 G;  3PV0 A;  2DUD A;  2BH8 A;  5GRO A;  5IP7 G;  4R4T A;  3KLW A;  4LFA Q;  5K36 G;  4MZ9 A;  1Y1W G;  1CKM A;  3FKI G;  1AE2 A;  3I4M H;  1U5K A;  4X66 Q;  1YIT A;  4JI0 L;  4A76 A;  3RNU A;  5AJ3 Q;  3J81 c;  1CKO A;  2Q2I A;  5LMU L;  4PZ6 A;  3CXC A;  5GAD C;  3HKZ E;  1PH6 A;  1NJI C;  1EFW A;  4AIM A;  1HZ9 A;  1Q1B A;  1GO3 E;  3K8A A;  1JJ2 A;  1MIU A;  2K5H A;  4GLX A;  2NZO A;  4DKA C;  4DV2 Q;  1PH2 A;  1ASY A;  3CCU A;  3H0G G;  1CUK A;  4GN5 A;  2HHH L;  1SE8 A;  3S24 A;  1N34 L;  4TVA B;  2K14 A;  4DV4 L;  2MFI A;  1S72 A;  3GTP H;  1GM5 A;  4DV7 Q;  4LF7 L;  2I5M X;  2JA9 A;  1HZA A;  3KF8 B;  5IYB H;  4JBJ A;  2PNH A;  3HOY H;  1Q8K A;  3HFZ B;  3Q8D A;  4IJH A;  4JI2 Q;  3HOZ H;  4Y7N H;  4QIW E;  4KHP Q;  1WJJ A;  4A3K H;  1I94 L;  4A3D H;  1Q12 A;  4AH6 A;  2JA5 H;  1CSQ A;  3I56 A;  2UU9 L;  3J7A 5;  3M7N A;  1X3F A;  3IRB A;  3PUZ A;  4DPG A;  1UWV A;  1IBK L;  2OWO A;  1HNW Q;  2UUB L;  4IFD J;  3L2P A;  1C0A A;  1VQH A;  2IHE A;  4BA1 I;  3H0G H;  2E2I H;  2DGY A;  3NBH B;  2YV5 A;  1N36 L;  3CCQ A;  1EUJ A;  2F4V Q;  4UY8 C;  4YHH Q;  3ULP A;  3W5O A;  4BY1 H;  4DV5 L;  1JJG A;  1JJC B;  1LTL A;  4DUY L;  2ASB A;  1K0R A;  4YY3 L;  4JI5 L;  3CCL A;  3F2D A;  1P8L A;  1I6H H;  4JI3 L;  3UE1 A;  1XMQ L;  1PH8 A;  1PH5 A;  3J80 i;  2JEB I;  3GTG H;  2CQO A;  2VL6 A;  2ZM6 L;  1Q1E A;  3PO3 H;  5ELO A;  4JBM A;  5JJI A;  2A1A A;  1YJ9 A;  1K8A C;  4DV0 L;  5IYD H;  2EXD A;  1N34 Q;  2JA7 H;  2HHH Q;  2I5H A;  3HOV H;  4KHZ A;  4PZ7 A;  1HNZ Q;  4JV5 Q;  1GKH A;  4LUZ A;  1C9O A;  1XNR L;  3UDF A;  4X62 L;  1EIY B;  4OWW B;  2HT1 A;  1XMO Q;  5C0X I;  2R6G A;  2KEN A;  3L0O A;  4A3E G;  4A3J H;  4IPD A;  3HOU G;  1KRT A;  3STB D;  4QL5 A;  1NBW A;  1B7Y B;  1HR0 L;  3B6Y A;  4A93 G;  4FDB A;  1PH1 A;  4ME3 A;  1L1O C;  4LFA L;  2AWN A;  3CF5 A;  1VQB A;  2UXD L;  1YHB A;  1OTC A;  3E9H A;  5M3M H;  4OWT B;  2YU9 H;  2UXC Q;  1TXY A;  4HJ8 A;  3FHW A;  1X56 A;  4LF5 L;  4LF4 Q;  1ASZ A;  1PH7 A;  5C0X J;  2GN5 A;  5FLM H;  4DR5 L;  3CC2 A;  4RG1 A;  2D0O A;  1X3G A;  3I7F A;  3CCE A;  4JI5 Q;  3PUY A;  3I2Z A;  1K9M C;  1VS0 A;  2LXJ A;  1AE3 A;  4OX9 Q;  1FGU A;  2MO0 A;  4A3E H;  4PMW A;  2UXB L;  4L5R C;  2ID0 A;  2YTX A;  5C3E H;  5ELN A;  3J81 i;  4A3F G;  2CKZ B;  3RR5 A;  5IWA L;  1FJG Q;  1QZH A;  4QGU A;  3I4N G;  4HJA A;  4IFD I;  1I50 H;  3TEH B;  1RIP A;  3A74 A;  4P72 A;  4DV2 L;  1VQ7 A;  3S1Q H;  1IZ6 A;  1M1K C;  3D0F A;  5IE8 A;  3CCR A;  4A3B H;  5HGQ A;  3NEN A;  4DV3 Q;  4GOP C;  3U50 C;  4P74 A;  2ZTC A;  5GQO A;  4AYB E;  1X65 A;  1I94 Q;  4HJ5 A;  5M3M G;  3KFU A;  1K83 H;  1YNX A;  2YTY A;  4LW1 A;  4DR6 Q;  1TWF H;  1Y1W H;  3A5Z B;  1JE5 A;  2HIX A;  5C4J H;  1L1O A;  2MNA A;  3M4O H;  4K0K Q;  2UUC L;  1UE7 A;  4A3G G;  4DNI A;  3I55 A;  4A3C H;  1VQE A;  4GKJ Q;  1IXR A;  1VQN A;  4BBR H;  3PCO B;  1N33 L;  2VUM G;  3PF4 A;  4GKK Q;  4DR1 Q;  3F2B A;  4LF5 Q;  4QJF A;  1P16 A;  2KCT A;  1FVI A;  1Q81 C;  3UE0 A;  4HID A;  3M3Y H;  1AH9 A;  3HKZ G;  3KDF A;  1KHI A;  3H3V I;  4DV6 Q;  1WI5 A;  1QVC A;  2N8N A;  1QUQ A;  4P73 A;  1OXT A;  3NEM A;  4DAY B;  3UDG A;  2AMC B;  1VQ6 A;  1A62 A;  1HZB A;  1NMF A;  2OQK A;  1X55 A;  2WAQ E;  5BR8 L;  2EIF A;  4B3M L;  4YCW A;  5M5W H;  3S1M H;  4DK3 C;  4C3J H;  1JB7 A;  4B3M Q;  1T9H A;  5IP9 G;  3KOJ A;  4DR2 Q;  4A4I A;  1OXX K;  1VQF A;  1HNW L;  4GLA C;  4MTN A;  3S15 H;  2VQE Q;  4X65 Q;  4A3C G;  1PVO A;  1S3O A;  2IT1 A;  4LNQ A;  2UUA L;  1E1T A;  1WFQ A;  3PSI A;  5LMU Q;  2VUM H;  1BVS A;  4MNO A;  3PF5 A;  1L2F A;  5IT9 c;  4B3S L;  2CWP A;  4BBS H;  3M4Q A;  1CKN B;  4UP7 A;  3SGI A;  4DR7 L;  4BY1 G;  1N33 Q;  4JI2 L;  1SRU A;  4DR4 Q;  4JBK A;  2VW9 A;  4JI6 Q;  1SMX A;  2HQL A;  1N9W A;  1IBL Q;  2UUC Q;  4TQU S;  2GVB A;  1JT8 A;  1YI2 A;  4QY7 A;  1B8A A;  4JI4 Q;  2RHQ B;  1IBL L;  4LUV A;  4JI3 Q;  2A19 A;  3AFQ A;  1LYL A;  3EIV A;  1VQA A;  2JA8 H;  5JEA J;  2R7Z H;  2UUA Q;  1X3E A;  1VQC A;  3RLN A;  3PO3 G;  2IX0 A;  2E5L Q;  4JI7 Q;  5JJK A;  1RL2 A;  4GOP A;  4DV3 L;  1O7I A;  1A63 A;  3TS0 A;  1EOV A;  3HOW H;  1CSP A;  4POF A;  3D31 A;  1VQ5 A;  4X65 L;  2N3S A;  3JAM c;  4X66 L;  4JI0 Q;  3GTK H;  5M5X H;  2YYZ A;  4OON A;  1MJC A;  1Z47 A;  4L5S A;  3S17 H;  4R4C A;  2PI2 E;  1PA6 A;  4NXN L;  1N32 L;  3RLO A;  4JBW A;  2UXB Q;  5C3E G;  4A3F H;  1A0I A;  3I4N H;  4A3J G;  1EIF A;  1EQQ A;  1G6P A;  4DR1 L;  4UPA A;  4JI1 L;  2VNU D;  4IPG A;  4B3T Q;  1KXL A;  3W1B A;  3KF6 A;  1Y1V H;  1Y14 B;  2RF4 A;  3RN2 A;  2UXD Q;  1X6O A;  4DV1 L;  4C3I H;  2NVQ H;  5IY0 A;  1CKN A;  1TWC H;  2PI2 A;  2Z6K C;  1E7Z A;  1NMG A;  2K5N A;  2ZM6 Q;  1VQ4 A;  1KD1 C;  3CCV A;  3GD7 A;  2WB1 G;  1YZ6 A;  4Y52 H;  3CP0 A;  2K5V A;  3VDY A;  4A3L H;  2VY3 A;  4WJ3 M;  3CC7 A;  1OXV A;  4JC0 A;  3PGZ A;  1YEZ A;  2K52 A;  4OO1 I;  1W2B A;  3CMA A;  4LF6 Q;  3CCM A;  1QVF A;  2BH2 A;  1UE5 A;  5JEA G;  4R1J A;  1V1Q A;  1J5E L;  4GNX B;  4O2D A;  3F1Z A;  4OWX B;  2K75 A;  4BXX G;  2MQH A;  4BY7 H;  3F8T A;  4DV0 Q;  1LUZ A;  4HIM A;  2E2H H;  1HZC A;  2OQ0 A;  3CAM A;  4HIO A;  3I4M G;  1E3P A;  3F2C A;  2AHO B;  4O0A A;  2K4K A;  4JI6 L;  1G51 A;  1OXU A;  1SRO A;  2QEX A;  2ZJQ A;  2B63 G;  2N78 A;  3GTQ H;  1TWA H;  1HNX L;  4IJL A;  3PIO A;  3FP9 A;  3H3V H;  4WJ4 A;  1XTD A;  1UE1 A;  2JK8 A;  4LWC A;  2UXC L;  3TRE A;  3CD6 A;  1HJP A;  5IP9 H;  4B3T L;  4XIG S;  4X6A H;  1K3R A;  3GDE A;  4JI8 L;  2R93 G;  5HY6 A;  1PV4 A;  4NXM L;  3U4Z A;  4YWM A;  4A3G H;  1PH3 A;  1XPO A;  4ALP A;  3MEF A;  3A5U A;  4LF8 Q;  3NEL A;  4RMF A;  1S40 A;  3JAM i;  5C0X G;  1B70 B;  2NN6 G;  3T1Y L;  1VQK A;  4BXX H;  1IYJ B;  3PIP A;  5BR8 Q;  3M4P A;  5C44 G;  3CCS A;  3PUW A;  1XMO L;  2B63 H;  2Z6K A;  4GS3 A;  4IFD G;  3K7A H;  3TQY A;  5FLX c;  2IX1 A;  3HOZ G;  2ZTD A;  3RZO H;  4GLV B;  1HNZ L;  2JA5 G;  3GTL H;  5AJ3 L;  4X64 Q;  4DK6 C;  2N49 A;  1JMC A;  1BBW A;  1K8G A;  4A3K G;  4A3D G;  3M9B A;  4R4Q A;  2JA8 G;  4JYA L;  1QZG A;  4GKK L;  2CCZ A;  1VQ8 A;  4AQY Q;  4GN3 B;  2KHJ A;  4LUO A;  5IYC G;  2ZJP A;  3A0J A;  5E7N A;  1XPR A;  2RHS B;  4B3R L;  2Q2U A;  3J7Z C;  3KJP A;  1VCI A;  4B3S Q;  1NTG A;  4DR5 Q;  3GTO H;  1H95 A;  2XTI A;  5C44 H;  4DUZ Q;  2A8V A;  4DR7 Q;  1TWH H;  1YVC A;  3G48 A;  4YY3 Q;  4IOC A;  3TRZ A;  4DUY Q;  3OW2 A;  1IBM L;  2IY5 B;  2JQO A;  1EWI A;  4APV A;  4DR2 L;  3AEV A;  3S16 H;  3S1R H;  3OTO L;  1IL2 A;  4LFC L;  1KAW A;  3CME A;  1XNQ L;  4PG3 A;  2VQE L;  1YIJ A;  3MXN B;  3ULL A;  1KL9 A;  3T1H L;  2WAQ G;  3UDX A;  1YJW A;  1HR0 Q;  5LMN L;  1E24 A;  4YHH L;  5IWA Q;  1N36 Q;  1E1O A;  3HOV G;  4JOI A;  3K7U C;  2BA1 A;  3AFP A;  2OCE A;  4LF8 L;  1Q82 C;  2E5L L;  3U58 A;  3HOW G;  3H15 A;  2AKW B;  2I5L X;  4GNX C;  1SFO H;  4LFB L;  4IOA A;  4OXP A;  3I4O A;  1OXS C;  2UU9 Q;  5JJL A;  4EX5 A;  4H02 A;  4JI4 L;  4A3L G;  3OYY A;  4YCV A;  1R9T H;  4KLK A;  2ZJR A;  4LF9 Q;  4JOI C;  4A93 H;  4NXN Q;  1VQM A;  3CCJ A;  4GKJ L;  1PH9 A;  1X9N A;  1HR0 W;  1GVP A;  2Y0S G;  4L5Q A;  3CC4 A;  3LGJ A;  1DGS A;  2Q2H A;  4DV4 Q;  2R7F A;  1G29 1;  3CPF A;  1GD7 A;  1N8R C;  3KDF B;  2RCN A;  1SN8 A;  1J5E Q;  3ICE A;  1WCM H;  4A3I G;  5FLM G;  4DR6 L;  3J81 j;  4X62 Q;  2OTL A;  1SR3 A;  4DUZ L;  1A8V A;  2CFM A;  1VQG A;  5GAH C;  5M3F G;  2JA6 H;  2AWO A;  4DAM A;  2UUB Q;  2R93 H;  4HJ9 A;  3HKS A;  4UP9 A;  1VQJ A;  4LFC Q;  4A3B G;  3GO5 A;  1VQP A;  2H5X A;  3STB C;  3G6E A;  2MO1 A;  2KCM A;  2V1C C;  3CPW A;  4DV1 Q;  1MJE A;  4HIK A;  1M90 C;  4IPC A;  3HOX G;  3DM3 A;  1EQR A;  2LSS A;  3RZD H;  4X64 L;  1Q46 A;  1HNX Q;  4NB3 A;  2JEA I;  5GAE C;  4QQB X;  3AQQ A;  3BJU A;  3JC6 6;  1VQD A;  2WP8 J;  1XJV A;  1N32 Q;  4R4O A;  1KIX A;  4NPS A;  2F4V L;  1L1O B;  5LMN Q;  4JYA Q;  2E2J H;  4BBR G;  1NE3 A;  2B3G A;  2LXK A;  3K80 C;  3W1G A;  2NVY H;  3T1H Q;  1LM0 A;  2I0Q A;  4BA2 I;  1IBK Q;  2F3I A;  5IYC H;  3OTO Q;  4GOP B;  4JI8 Q;  4IO9 A;  1VQO A;  1V43 A;  4L5T A;  3S2H H;  5FJ8 H;  1E22 A;  4JV5 L;  3KJO A;  1PFS A;  1IBM Q;  2B29 A;  3HOX H;  1KQS A;  4POG A;  1KC8 C;  3E0E A;  3EN2 A;  1NY4 A;  4KI0 A;  2KHI A;  5IP7 H;  3HOY G;  1XNR Q;  4KHP L;  4JCV E;  3PUX A;  3PO2 H;  3TS2 A;  2KBN A;  4P71 A;  5J3B A;  1FJG L;  1QUQ B;  3KYH C;  3ZJY C;  1BKB A;  1PYS B;  4LF9 L;  4HJ7 A;  4K0K L;  2ALY B;  4OX9 L;  3J80 c;  5LMN W;  2R7D A;  4AQY L;  1U0L A;  3K81 C;  1YHQ A;  4YWL A;  1QVG A;  2CWA A; 
#chains in the Genus database with same CATH topology
 2D62 A;  1PTO H;  2Q8R E;  2XGT A;  2X6L A;  4OO1 G;  1I3Q H;  1PTO F;  3ULJ A;  4E6I A;  2R61 A;  2D2C C;  1CQF A;  5GAG C;  5C4X G;  3PO2 G;  4J15 A;  1HFN A;  2HCI A;  1WYD A;  3CQZ H;  3U4V A;  3S2D B;  1K73 C;  2NVX H;  4ZAI A;  4A93 B;  1FL0 A;  3I90 A;  1I5F A;  4XT3 B;  3M3Y B;  2PMZ E;  1PHJ A;  2IHF A;  1GHK A;  3RLF A;  5IYD G;  5C4X B;  1K0S A;  2IX3 A;  1UNS A;  2DJF C;  4B3R Q;  2OF1 A;  2CW0 C;  4YIJ A;  2FMC A;  2YTV A;  2L9H A;  2Q2T A;  2NVT H;  1GUS A;  3HGB A;  2R92 H;  3HOU H;  1XMQ Q;  4ZUJ A;  1VQ9 A;  3CW2 C;  1HXY D;  5C4H A;  2RKS A;  3OW7 A;  1V9P A;  2JJQ A;  3V2T A;  1Z9F A;  3VA5 A;  3HOY B;  2GVA A;  4ABN A;  3ERS X;  5JJZ A;  3S14 H;  1KDC A;  4OEL B;  1LO5 D;  1WCM G;  3E9I A;  4DR3 Q;  1SND A;  2NZ1 D;  3WOE A;  3BDL A;  4TKO B;  2DN8 A;  2EXZ A;  1YJN A;  2R92 G;  5M5X B;  2BDN A;  5M3F H;  5H1S E;  1L0W A;  4HSP A;  3GTL B;  1EWH A;  1HUN A;  4A3M G;  1SLJ A;  3NSW A;  3G4S A;  4BY7 G;  3BVM A;  2RCF A;  2X69 A;  1AFP A;  3KLW A;  1YNJ D;  1PMR A;  4ZQ3 A;  4LFA Q;  1F2Y A;  5A2Q E;  4PZ6 A;  1NJI C;  2EJG C;  1EY5 A;  2DNE A;  1JJ2 A;  1SE4 A;  2FFK B;  5IGG A;  1A3V A;  3CCU A;  3TDQ A;  3C1E A;  3PO3 B;  2K14 A;  4DV4 L;  2MFI A;  3GTP H;  3NBI A;  3Q6S A;  4K5W A;  3QB3 A;  1HZA A;  3HOY H;  2JA5 B;  2PNH A;  1Q8K A;  4JI2 Q;  3K57 A;  1WJJ A;  3VR2 A;  1T5X D;  1I94 L;  3AMU A;  1STE A;  1CSQ A;  2UU9 L;  3M7N A;  2F0G A;  3IRB A;  1HNW Q;  4LJZ C;  1VQH A;  2DGY A;  2F4V Q;  3A56 A;  1VMC A;  3ULP A;  1HUM A;  1TWC B;  3W5O A;  2L5T A;  3WOF A;  4YY3 L;  1ZEQ X;  2CH4 A;  1RDP D;  4K6D A;  3TN2 A;  1PTO D;  4JI3 L;  1PH8 A;  1PH5 A;  3J80 i;  2JEB I;  2VL6 A;  2ZM6 L;  3P1H A;  1STN A;  4V19 0;  1TY0 A;  4JBM A;  1LTG D;  4DV0 L;  2RVL A;  3P75 A;  5C5L A;  4B08 A;  1N34 Q;  4TRD A;  3K58 A;  2I5H A;  5M5Y B;  1EY0 A;  1JOK A;  2K32 A;  1C9O A;  5D3I B;  1LTA D;  2DY7 A;  2O5I C;  2R6G A;  2KEN A;  3L0O A;  1PFB A;  3J80 L;  5IOC A;  1B7Y B;  1PH1 A;  4KK7 A;  4LFA L;  4BWG B;  3MXU A;  3NQT A;  1YHB A;  1BXT A;  1S5D D;  1TXY A;  3FHW A;  3I4N B;  5C0X J;  1JWM D;  4DR5 L;  3S2H B;  3CC2 A;  4JI5 Q;  3H0G B;  3MC0 B;  5EKK A;  2UXB L;  2YTX A;  5C3E H;  3J81 i;  3H91 A;  5IWA L;  1I50 H;  3TEH B;  3A74 A;  3S1Q H;  1TVX A;  5IE8 A;  5CV4 A;  4A3B H;  1QE6 A;  2M9V A;  1AEX A;  4P74 A;  1I94 Q;  1FNV A;  2XWB B;  1K83 H;  1Y8O B;  2YTY A;  1LT4 D;  3KFU A;  4DR6 Q;  2F3V A;  2QCP X;  3HP3 A;  3VA7 A;  1Y1W H;  5C4J H;  3U9O A;  2C5C A;  3M4O H;  4K0K Q;  1A3T A;  3X3N A;  5E4X A;  4A3G G;  4MHE A;  4GKK Q;  1N33 L;  1HFG A;  4DR1 Q;  1P16 A;  2KUM A;  3UE0 A;  1AW7 A;  2E74 C;  1TT2 A;  1J9O A;  1I4P A;  2N8N A;  3A8K E;  1EZ8 A;  2WAC A;  2N55 A;  1EYC A;  1A62 A;  3S1N B;  3VYT A;  2Z8L A;  4DK3 C;  3C1F A;  1T9H A;  3I73 A;  4A4I A;  2EY2 A;  4GLA C;  3S15 H;  2F0E A;  4X65 Q;  3BZD B;  2VQE Q;  1PVO A;  1B44 D;  4CBV A;  5LMU Q;  3TZU A;  1SYC A;  4PQX A;  1II3 A;  3M4Q A;  1G6Z A;  2E2J B;  3MVV A;  3SGI A;  4DR7 L;  1K28 A;  5ELF A;  4DR4 Q;  2B2T A;  5A35 A;  2VW9 A;  1SMX A;  1JOR A;  4TQU S;  2LMC B;  1B8A A;  2PPB C;  4JI3 Q;  2A19 A;  2VB2 X;  3VYS A;  1SBB B;  1X3E A;  5BN5 A;  4AYB B;  2Z4I A;  2B2U C;  3JAM c;  3MHB A;  1IL8 A;  5M5X H;  1W6K A;  1DZ1 A;  1ET9 A;  4NXN L;  1N32 L;  4JBW A;  4K5X A;  4A3F H;  1A0I A;  1PZI D;  1EIF A;  1SAP A;  2G9D A;  3QIA A;  4RGO S;  1IYU A;  2K05 A;  1WD0 A;  1LAC A;  4WJW A;  3KF6 A;  2UXD Q;  4UHV A;  4DV1 L;  4C3I H;  1TWC H;  1VF5 C;  5J39 A;  4M1U B;  2WB1 G;  1YZ6 A;  1NCV A;  3CC7 A;  1D2B A;  2EJM A;  1QVF A;  4PV1 C;  3CHB D;  4KY6 A;  3FVQ A;  1SMY D;  4BY7 H;  4DV0 Q;  1LUZ A;  3HOX B;  2NWG A;  5CV9 A;  3F2C A;  2B63 G;  4JI6 L;  2K4K A;  4Y52 H;  2ZJQ A;  2N78 A;  3GTQ H;  3FMC A;  1HNX L;  3PIO A;  4WJ4 A;  2B8G A;  1XTD A;  1S5F D;  1UE1 A;  3TRE A;  1E2V A;  1MBY A;  4FXK C;  1K3B C;  4XIG S;  5EBC A;  5M3F B;  1J8I A;  2DNC A;  4YWM A;  2EZV A;  2QKI C;  4HMI A;  4OIK A;  4RMF A;  3T1Y L;  5EKI A;  1RHP A;  3PUW A;  4C3I B;  2L1B A;  5FLX c;  5CC4 A;  1BBW A;  1K8G A;  2JA8 G;  1WTQ A;  1WD1 A;  5EPJ A;  2CCZ A;  5IYC G;  4K2L A;  5CV6 A;  1PZJ D;  3KJP A;  1H95 A;  2XTI A;  4LMQ D;  2WIN B;  5E1F A;  3S1M B;  4DR7 Q;  3G48 A;  3DM1 A;  4FF2 A;  5G3L F;  1EWI A;  4EQN A;  1XNQ L;  4LFC L;  1KAW A;  2CVR A;  2R3Z A;  4PG3 A;  4NW2 A;  3CME A;  3MXN B;  4CKE A;  1KL9 A;  3T1H L;  2WAQ G;  4YHH L;  1EWC A;  2K28 A;  1JB3 A;  2OCE A;  3U58 A;  1MD2 D;  2FHT A;  4OXP A;  3I4O A;  1OXS C;  1XXG A;  2UU9 Q;  3A8I E;  3LWE A;  1R9T H;  4KLK A;  1ENF A;  1PH9 A;  1KLG D;  1GVP A;  3JAM E;  1DGS A;  5IGE A;  1G29 1;  3CPF A;  4KD4 A;  4ZUI A;  5C5M A;  1DJR D;  3T51 B;  4Y7N B;  2XIW A;  2J7Z A;  4KV6 A;  4A3I G;  1WTV A;  4DR6 L;  4FVM A;  4X62 Q;  1VDZ A;  1SR3 A;  3I70 A;  2CFM A;  3PMF A;  2QDL A;  4KKT A;  5GAH C;  3BS1 A;  3KLS X;  2UUB Q;  3PIO 3;  1B53 A;  3GO5 A;  2XRQ D;  1RTN A;  3STB C;  5C4J B;  1BNZ A;  3I4M B;  2NN6 H;  5I9O A;  1OO9 B;  3DM3 A;  1EQT A;  1HCZ A;  1HNX Q;  2HQE A;  1W6J A;  3BJU A;  1CM9 A;  1PRT B;  3PQI A;  4WFN 3;  1XTC D;  5EBD A;  1TR5 A;  1JC7 A;  2E2J H;  4BBR G;  4LF6 L;  4IUR A;  3K80 C;  2NVY H;  1LM0 A;  4BA2 I;  2F3I A;  5IYC H;  2L0C A;  1R4Q B;  2Z1C A;  1VQO A;  4JV5 L;  3H94 A;  1PTO C;  1PFS A;  3KJO A;  1GHJ A;  4B9X A;  2K04 A;  1XX8 A;  3PUX A;  3IFD A;  5J3B A;  4IN3 A;  5COY A;  4GZY C;  1BKB A;  1PYS B;  5KRU A;  3C3L A;  1KLU D;  1JOQ A;  1QVG A;  1YNJ C;  2RSN A;  3HKZ B;  2OEO A;  3J80 c;  5C3E B;  3TP8 A;  2KEC A;  2JE6 I;  3GTJ H;  2FXQ A;  2F0O A;  5FJ8 G;  2OTJ A;  4C3H B;  3QG1 A;  2ZXO A;  2E8G A;  2C35 B;  2Z0S A;  4R4I A;  1E2Z A;  4X3U A;  4DV5 Q;  1JOO A;  3S1N H;  3G71 A;  2ATW A;  4HMJ A;  2SNS A;  4CKC A;  5J1Z A;  4JI7 L;  1Q86 C;  4FF3 A;  4ME5 A;  3S2D H;  1TWG H;  4EQP A;  2KED A;  1H9M A;  2PW7 A;  2JP1 A;  4P75 A;  4CGY B;  1EOT A;  2ZT9 C;  1LV9 A;  2WFW A;  3ERO A;  5C4X H;  4DV7 L;  4CDD C;  3ER0 A;  3PUV A;  3NUC A;  4EQ5 A;  2EQS A;  1GUW A;  1VQL A;  3BG3 A;  1KRS A;  4DA2 A;  5KIX A;  2HIV A;  4A3M H;  4PZ8 A;  4RKL A;  3MWY W;  4DU9 A;  1BBX C;  3M85 A;  1PH4 A;  2F0N A;  3BZC A;  2QA4 A;  3RN5 A;  4A3M B;  4GN4 B;  1C7Y A;  1HA5 A;  4XT1 B;  4N9P A;  4X3S A;  4KTA A;  3G7L A;  4C2M H;  3MZ5 A;  2R92 B;  4RH6 A;  1Q7Y C;  1D8L A;  2EY6 A;  1JIC A;  5EAY A;  3W3A A;  1WOC A;  1XPU A;  2KHS A;  3NWS A;  4FNF A;  3X3M A;  5D65 A;  2PQA A;  4A3D B;  5M5W B;  3MA2 B;  2PQE A;  2DUD A;  5GRO A;  1B3A A;  3OIP A;  4MZ9 A;  1R4P B;  2VB3 X;  1AE2 A;  4X66 Q;  1M4V A;  3SK4 A;  3RNU A;  4DNT B;  1JWU D;  3MXG A;  3J81 c;  1EFW A;  1KXL A;  2R93 B;  4AIM A;  1HZ9 A;  1EQV A;  1MIU A;  2K5H A;  3SK5 A;  3QR8 A;  4OIJ A;  1ASY A;  2HCC A;  4MTK A;  5C0X H;  1SE8 A;  1TWF B;  2KEE A;  1N34 L;  5IGC A;  3ERQ A;  2E75 C;  4Z9C B;  2I5M X;  2JA9 A;  1BDO A;  3GV6 A;  3KF8 B;  4C3J B;  4ZKC B;  2YU9 B;  3HFZ B;  2NYZ D;  4KHP Q;  2C9O A;  1C48 A;  1PRT D;  4A3K H;  4AH6 A;  3PO2 B;  2JA5 H;  3QOJ A;  4XQQ A;  2PYK A;  2PW5 A;  4ZK9 B;  2OWO A;  2UUB L;  4IFD J;  4R8N A;  2E2I H;  5DM6 3;  2K03 A;  3CCQ A;  4UY8 C;  1ENC A;  3EVQ A;  4DV5 L;  3VYR A;  1X32 A;  1JJC B;  3MEH A;  2JSO A;  4DUY L;  4JI5 L;  3J80 E;  4XQN A;  2PZU A;  2JXM B;  1U4L A;  1P8L A;  1VMP A;  3GTQ B;  1I6H H;  3UE1 A;  1XMQ L;  5EGT A;  3CKI B;  5I6Y A;  2E2H B;  3PO3 H;  2NVX B;  2A1A A;  1K8A C;  2EDG A;  1CHQ D;  2WV6 D;  5IYD H;  2EXD A;  1SFO B;  2JA7 H;  2BOS A;  3HOV H;  1NUC A;  4JV5 Q;  4LUZ A;  4C1N I;  2M00 A;  2SNM A;  5FOB B;  4X62 L;  3TP6 A;  4XYQ A;  4A3J H;  4RCN A;  3TP5 A;  3HOU G;  1KRT A;  4FO2 A;  1NBW A;  1XYI A;  4FDB A;  1SJH D;  4ME3 A;  2J0T D;  3QOL A;  3ZYY X;  4F87 A;  5FLX L;  1TWH B;  3Q0A A;  1SNM A;  2RBM A;  2H1E A;  1VQB A;  1OTC A;  3E9H A;  2UXC Q;  4OWT B;  1GUN A;  4HJ8 A;  2F0P A;  1ASZ A;  1PZK D;  3I7F A;  1X3G A;  2IWH A;  2HD3 A;  3I2Z A;  1K9M C;  1VS0 A;  2LXJ A;  4OX9 Q;  1FGU A;  2MO0 A;  4PMW A;  4NDX A;  2ID0 A;  4DXF A;  5DM7 3;  5ELN A;  4A3F G;  5COR A;  3D4R A;  1BCP B;  1O7Z A;  4QGU A;  2QIL A;  4HJA A;  1RIP A;  4KKU A;  2IJ0 A;  4P72 A;  1M1K C;  3D0F A;  3CCR A;  4H44 C;  2A73 B;  2F1M A;  3NEN A;  4GOP C;  5GQO A;  4AYB E;  1X65 A;  1YNX A;  1BOS A;  3HOU B;  1H9J A;  2O4X A;  3A5Z B;  2HIX A;  2N88 A;  3S17 B;  1L1O A;  2NBF A;  1I50 B;  1QB5 D;  3SK6 A;  1UE7 A;  3SXH A;  3I55 A;  2VXW A;  1GUT A;  4XDX A;  4BBR H;  3PF4 A;  2JYO A;  4LF5 Q;  2B2W C;  3ITP A;  2L12 A;  3MXP A;  4QUC A;  1Q81 C;  2F0Q A;  3T4A C;  4DF7 A;  4Q5V A;  3E5S A;  3T53 B;  1QUQ A;  1OXT A;  1HQR D;  3NEM A;  2AMC B;  1K8M A;  1NMF A;  2ICI A;  2WAQ E;  5BR8 L;  4B3M L;  3J7Y W;  1JB7 A;  3D3R A;  5E3F A;  5C4Z A;  1HNW L;  3OPO A;  1Q3L A;  1S3O A;  4RWS C;  1BVS A;  2PO4 A;  3H6M A;  1I4G A;  1VF7 A;  4I7A A;  4A3I B;  2RDH A;  1FNW A;  4JI6 Q;  2UUC Q;  3K7A B;  2GVB A;  1Z7T A;  3D4D A;  1Q90 A;  2WKD A;  4QY7 A;  3URY A;  2AQ3 B;  2RHQ B;  3AFQ A;  2PNR C;  3EIV A;  4O1N A;  2R7Z H;  2L55 A;  3ND9 A;  2IX0 A;  2E5L Q;  4P2C B;  4I65 A;  4DV3 L;  3D31 A;  1VQ5 A;  2F0J A;  1NR2 A;  1TII D;  5IT9 E;  2YYZ A;  4OON A;  4L5S A;  2H4O A;  2HDM A;  4R9W A;  2PI2 E;  1PA6 A;  3RLO A;  2UXB Q;  5C3E G;  2WAQ B;  3I4N H;  2E76 C;  1PXU A;  4UPA A;  3VR4 A;  1WTR A;  5IGB A;  3W1B A;  1Y14 B;  5LHY 1;  2P5Z X;  1SYG A;  4RAU C;  3HZX A;  2B2Y A;  3KLR A;  3NK9 A;  1CKN A;  2B2U A;  1PLF A;  2ZM6 Q;  3K6O A;  2VUM B;  1GUG A;  1CZG A;  1KD1 C;  3GD7 A;  4BBR B;  3CP0 A;  4HSV A;  1PFN A;  2K6A A;  4DAP A;  4OO1 I;  3PGZ A;  3NWT A;  4DFA A;  2BE5 D;  4OGQ C;  4LF6 Q;  5ELD A;  2BH2 A;  1EY6 A;  1UE5 A;  5JEA G;  3CRK C;  2F0U A;  4C3I G;  2A6E C;  3QWN A;  1HZC A;  3K5O A;  2XNA C;  3I4M G;  1E3P A;  5K36 H;  3DXJ C;  3OWE B;  4FP5 D;  2K5D A;  1EY4 A;  5F2D A;  1U4P A;  2JK8 A;  3CD6 A;  4JK1 C;  1DD2 A;  3KUP A;  5HY6 A;  1D5X C;  3VYU A;  3U9S A;  1IW7 C;  4ALP A;  3A8J E;  4X3K A;  4G4K A;  3A5U A;  1PTO B;  1BCP C;  1HA6 A;  5NUC A;  2NN6 G;  3NTH A;  4IUQ A;  5BR8 Q;  3M4P A;  3R2T A;  1F9P A;  4FF1 A;  3W2D A;  1ONL A;  1XMO L;  2B63 H;  4PNY A;  1HNZ L;  3GTL H;  2KVM A;  4DK6 C;  1BO0 A;  1JMC A;  3DMU A;  1GXD C;  3M9B A;  2EVB A;  2WB1 B;  1F2L A;  2KHJ A;  4GN3 B;  4LUO A;  2ZJP A;  1V1P A;  1I4X A;  3S15 B;  5FO9 B;  4DR5 Q;  1B1Z A;  1AZP A;  4DUZ Q;  1BF4 A;  1JQY D;  2XN9 C;  1IBM L;  2IY5 B;  1LLR D;  2JQO A;  1DM0 B;  5JVG 3;  4V0B A;  3S1R H;  2F0L A;  1IL2 A;  1YIJ A;  3ULL A;  1YJW A;  5LMN L;  1E24 A;  2F0H A;  5EQ0 A;  2B39 A;  1O7Y A;  1FR3 A;  1E1O A;  5BN4 A;  3RMH A;  3GP7 A;  5LL6 X;  4G7O C;  4F88 A;  5A2Q L;  1MSG A;  3H15 A;  2XSC A;  4LFB L;  4IOA A;  1SXT A;  1SSO A;  4A3L G;  4ILW A;  4CJ0 B;  3OYY A;  4Q0F A;  1WTX A;  4LF9 Q;  4A93 H;  4GKJ L;  3R2I A;  3R93 A;  3LGJ A;  3RZO B;  4O42 A;  3O13 A;  1TY2 A;  2Z6B A;  3ICE A;  4DAY A;  5FLM G;  3OMG A;  3J81 j;  2RSO A;  2B2V A;  1EIH A;  1KDB A;  2NVT B;  1VQG A;  1E0B A;  5M3F G;  2FJ2 A;  3R3O A;  3GTK B;  3BVZ A;  4LFC Q;  2AQ2 B;  1VQP A;  5EPK A;  1UUP A;  2B63 B;  1M90 C;  3HOX G;  3CU7 A;  1EQR A;  2LSS A;  4WOR A;  5FO7 B;  3RZD H;  1JE4 A;  2IPK D;  1PRT C;  2EYJ A;  3OIQ A;  1DYQ A;  1I4R A;  2LXK A;  3FDT A;  2B8F A;  2CH4 W;  1ILQ A;  2BE5 C;  4JI8 Q;  1SNO A;  3I72 A;  4L5T A;  1CT1 D;  1E22 A;  3S2H H;  2EYL A;  1ICF B;  2B29 A;  1KQS A;  1IBM Q;  2KHI A;  1WVL A;  4DGZ A;  1SE3 A;  4JCV E;  1SMY C;  1LT6 D;  3KYH C;  5IOD A;  1C8C A;  3DEO A;  2PMZ B;  2ALY B;  1QCB D;  2F0M A;  5LMN W;  1U0L A;  3K81 C;  2B2V C;  4LFB Q;  3UDI A;  3NPP A;  4BBS G;  1D1K A;  2G5D A;  2VQF L;  4JW0 A;  4F7X A;  1HHV A;  4NKL A;  3NXW A;  3SR1 A;  4AYB G;  5IYB G;  1X54 A;  1HPC A;  3L7Z C;  3SK8 A;  4DK1 A;  3T1Y Q;  3DWA A;  4H0L C;  2PQA B;  3GTP B;  3HS0 C;  4NXM Q;  4NMZ A;  2R7Z G;  2VZA A;  2Y0S E;  4LF4 L;  4LK1 C;  2VQF Q;  2JA7 G;  3SVM A;  2VS1 A;  1KTK A;  5CYU A;  1QNK A;  4A3I H;  1J6Q A;  1YNN C;  2CQA A;  4KMU C;  4FXD A;  4UP8 A;  2A6E D;  2QEJ C;  4KN7 C;  1O78 A;  1PYB A;  1LAB A;  1SNQ A;  3T13 A;  2MJ8 A;  1UEB A;  2BA0 A;  3MAQ A;  2L15 A;  3E0J A;  4K5V A;  2NN6 I;  3BYY B;  4DAV A;  4RHR A;  1SNP A;  3OHX C;  1W3S A;  4ID6 A;  5KEE A;  1TS3 A;  1BBU A;  4IUN A;  1Y69 U;  1H9K A;  3KF8 A;  1SEB D;  3FKI H;  4QIW B;  4TSS A;  4XTC S;  3EBE A;  1XNQ Q;  1MKH A;  1IKM A;  4YWK A;  5EJW A;  4DV6 L;  1EYG A;  5DLQ E;  1VQI A;  2ES2 A;  1FGB D;  2HUG A;  3TP7 A;  3Q22 A;  4CDC C;  2QGQ A;  5M5Y H;  1Z6H A;  3BZK A;  1I4Q A;  1O80 A;  4JG2 A;  1MI2 A;  1LTR D;  2F52 A;  5CGK A;  1D7Q A;  1F2M A;  3V96 A;  3ONA B;  3K5N A;  3CRL C;  5IP7 G;  4R4T A;  1S5E D;  4KN4 C;  5K36 G;  1CKM A;  3FKI G;  3I4M H;  1U5K A;  4IZ8 A;  4JI0 L;  1F9Q A;  2Z4H A;  2CHB D;  4EVO A;  5GAD C;  3HKZ E;  5JAV A;  2XWJ B;  3M4O B;  1NR4 A;  2F4I A;  4CHT B;  4GLX A;  4DV2 Q;  1DXM A;  3H0G G;  1CUK A;  2HHH L;  3S24 A;  4TVA B;  5FK9 C;  1PDQ A;  4OL7 A;  5IYB H;  4JBJ A;  3BDC A;  3Q8D A;  4IJH A;  1L0X B;  4QIW E;  4IFD H;  3S1Q B;  4A3D H;  1Q12 A;  3NE5 B;  4KJN A;  3J7A 5;  4K6L A;  1IHZ A;  1IBK L;  1DOM A;  2GA4 B;  3L2P A;  1WTP A;  2IHE A;  4BA1 I;  3H0G H;  3NBH B;  2YV5 A;  1HQM C;  4YHH Q;  2G9H D;  1WCM B;  1JJG A;  1NSN S;  3NBH A;  1LTL A;  2ASB A;  1F9R A;  3SE0 A;  2K5Q A;  3CCL A;  3F2D A;  2M2L A;  2RQX A;  3LX0 A;  5FLX E;  3GTG H;  1SYF A;  2QDB A;  1Q1E A;  4KJO A;  3QO2 A;  3EJI A;  4N8F A;  4CJ2 C;  1YJ9 A;  1S4Z A;  4RGT A;  5FO8 B;  5KGU A;  3EQL C;  5J22 A;  1SYD A;  1IYV A;  4KHZ A;  4PZ7 A;  1HNZ Q;  3C46 A;  5JVH 3;  1XNR L;  3UDF A;  5DNF A;  4OWW B;  5C0X I;  1BUV T;  5I9P A;  2F0W A;  4IPD A;  3STB D;  5BN3 A;  1HR0 L;  4A93 G;  4K2K A;  2BCO A;  1HRJ A;  2EOT A;  3CF5 A;  1SJE D;  1QIL A;  2YU9 H;  1ENA A;  4BY1 B;  4LF5 L;  1X56 A;  4XQJ A;  1PH7 A;  5FLM H;  4RG1 A;  3CCE A;  3NHH A;  2B2Y C;  3T16 A;  1AE3 A;  1U9R A;  1DOK A;  4K8I A;  2EYF A;  2EJF C;  4FXG C;  3A7L A;  4IUT A;  3I4N G;  3RR5 A;  4IFD I;  2V4D A;  1QZH A;  4QMG A;  1FJG Q;  2JA7 B;  3J7A F;  2LKV A;  2Y0S B;  4DV3 Q;  3T56 B;  2ZTC A;  3DWQ A;  4HJ5 A;  5M3M G;  4K14 A;  4LW1 A;  5FKA C;  4BY7 B;  4F8M A;  1TWF H;  1I6H B;  4HAE A;  4HCE A;  3WDN A;  2UUC L;  1NNX A;  1VQE A;  4BBS B;  3Q24 A;  1U4M A;  2VUM G;  4IUU A;  4QJF A;  5CBA E;  1FVI A;  3M3Y H;  3RZD B;  3H3V I;  3S1R B;  1QVC A;  5M3M B;  4P73 A;  3UDG A;  4DAY B;  1Q8I A;  4HR7 B;  1A6X A;  1JR0 D;  4DNR B;  3NQI A;  2EIF A;  5M5W H;  3HEJ A;  4C3J H;  5IP9 G;  3KOJ A;  2AUJ D;  4CDF C;  2UUA L;  4ZLT F;  1E1T A;  1WFQ A;  1EIG A;  4MNO A;  1L2F A;  5IT9 c;  4BBS H;  1CKN B;  2NTS A;  4UP7 A;  4BY1 G;  1N33 Q;  3DUZ A;  1ESF A;  1SRU A;  4A3K B;  1JT8 A;  2IW3 A;  1YI2 A;  1IBL L;  4LUV A;  1VQA A;  2JA8 H;  3I8Z A;  5JEA J;  3UI2 A;  2UUA Q;  1VQC A;  3KBX A;  1MGS A;  4HTH A;  4M8A A;  1EY7 A;  3PO3 G;  4JI7 Q;  2XVS A;  4IUV A;  1EOV A;  4POF A;  4RHS A;  4X65 L;  1SYB A;  4X66 L;  3GTK H;  4RFB A;  4R4C A;  3S17 H;  1CK1 A;  2K7V A;  4N9T A;  3FPP A;  1K83 B;  4A3J G;  1EQQ A;  1AZQ A;  4DR1 L;  2NVQ B;  3MFG A;  2DJG C;  1FD7 D;  1DCZ A;  1Y1V H;  4DXG A;  1A2U A;  5IY0 A;  3N52 A;  1D5Z C;  2Z6K C;  1KAA A;  1EY8 A;  1VQ4 A;  1ZXT A;  3VDY A;  3EFX D;  1CA6 A;  1D5M C;  2K52 A;  1W2B A;  3A7A B;  3CMA A;  4G57 A;  1V1P B;  1HTL D;  1V1Q A;  2EPB A;  2RA4 A;  4O2D A;  3F1Z A;  2K75 A;  2SEB D;  2MQH A;  3F8T A;  4HIM A;  3H3V C;  4QCL A;  4HIO A;  2AUK A;  2NTT A;  4A3J B;  1OXU A;  2QEX A;  2RDG A;  1EY9 A;  3H3V H;  5D14 A;  3SDZ A;  2UXC L;  4LWC A;  4IQZ A;  5IP9 H;  4B3T L;  4ULL A;  4X6A H;  1K3R A;  3GDE A;  3U4Z A;  1XPO A;  3MEF A;  1QWY A;  4LF8 Q;  1S40 A;  2PZW A;  3JAM i;  5C0X G;  4BXX H;  1IYJ B;  3GTG B;  1S5C D;  5C44 G;  3OWF A;  3CCS A;  3K0Y A;  2Z6K A;  4GS3 A;  3TQY A;  1PYW D;  1X3P A;  3HOZ G;  2JA5 G;  1STA A;  4X64 Q;  5AJ3 L;  2N49 A;  3D8G A;  4A3K G;  4R4Q A;  2BDO A;  4JYA L;  1B2T A;  1VQ8 A;  3A0J A;  3HG9 A;  1DOL A;  2RHS B;  2Q2U A;  3J7Z C;  2F0K A;  1VCI A;  1EU3 A;  1ET6 A;  3GTO H;  1B9M A;  5KNC A;  5C44 H;  2A8V A;  1YVC A;  3S9W A;  3TRZ A;  4IOC A;  2CW0 D;  4DUY Q;  1TWA B;  4DR2 L;  4APV A;  3I4L A;  3OTO L;  1I6V C;  3P7J A;  2MUY A;  1BCP F;  1FNU A;  3UDX A;  4FF4 A;  1N36 Q;  1QG7 A;  4JOI A;  3K7U C;  2BA1 A;  1Q82 C;  3EA6 A;  3HOW G;  4ZCK A;  2AKW B;  5IT9 L;  5L37 A;  4GNX C;  3IFT A;  1QNU A;  1SFO H;  1CFM A;  1EZ6 A;  4EX5 A;  4JI4 L;  2R7Z B;  4YCV A;  2A6H C;  4JOI C;  5IGF A;  4NXN Q;  1VQM A;  2Y0S G;  3CC4 A;  2L4N A;  2Q2H A;  2R7F A;  1GD7 A;  5IIF A;  3KDF B;  1N8R C;  1SN8 A;  1J5E Q;  3DEP A;  1WCM H;  2F0S A;  1F77 A;  1SNC A;  2OTL A;  4DUZ L;  4C2M B;  4L6T B;  4J8Q A;  4KY5 A;  5K5P A;  2JA6 H;  4LAA A;  2R93 H;  1CHP D;  3HKS A;  1VQJ A;  4A3B G;  1G2S A;  4KKS A;  2H5X A;  5ELC A;  2MO1 A;  2KCM A;  2V1C C;  5JEA H;  3K5M A;  4HIK A;  4IPC A;  2QW7 A;  5CV8 A;  4X64 L;  2KJX A;  4NB3 A;  2JEA I;  4IUP A;  3J81 E;  3I91 A;  2WP8 J;  1XJV A;  1N32 Q;  4R4O A;  4G7Z C;  1KIX A;  4NPS A;  1I4H A;  2F4V L;  1H9R A;  1L1O B;  4XXE A;  2I0Q A;  1NE3 A;  3W1G A;  2MGS A;  1IBK Q;  5EPL A;  4GOP B;  3OTO Q;  1BR9 A;  4OO1 H;  4I7Z C;  1V43 A;  5FJ8 H;  5KYL A;  3HOX H;  1KC8 C;  3E0E A;  3EN2 A;  5IP7 H;  4KHP L;  5CV5 A;  1LTB D;  2KBN A;  3DHQ A;  1FJG L;  1QUQ B;  3VR3 A;  5KYI A;  5CMD A;  4K0K L;  5ELB A;  3J81 L;  2EE1 A;  3MFY A;  1VQN A;  1BCP D;  4YWL A;  1RF2 D;  2MP1 A;  4MIU A;  1QOH A;  2K50 A;  2K01 A;  4DR3 L;  3BU2 A;  1GJX A;  1GUO A;  2LY7 A;  2XRS D;  3AYH B;  4JVZ A;  3I3C A;  2ZTE A;  2DY8 A;  3K59 A;  1STY A;  1U4R A;  1RTO A;  3IKJ A;  2SDF A;  5DAU A;  2NZH A;  2WB1 E;  4N8X 1;  4GNX A;  4LF7 Q;  5CBE E;  1B9N A;  1HH2 P;  1S5B D;  3GTM H;  3C2P A;  4C3H H;  3SHL A;  1UE6 A;  4JPB W;  3GTM B;  5IGD A;  2A68 C;  1M8A A;  2JA6 G;  3FKI B;  1EL0 A;  5CR3 A;  3DLL A;  3KF6 B;  3VR6 A;  3OOC A;  2D0P A;  4YCU A;  4S3S A;  1EYD A;  1Y1V G;  1YHA A;  4OEM B;  1WTW A;  1YBY A;  4RGM A;  1CZW A;  2TSS A;  4DR4 L;  3K0X A;  2LFN A;  4B9W A;  2L11 A;  4A75 A;  1STB A;  4CKB A;  4EQO A;  3HOV B;  2OT2 A;  4JI1 Q;  1KDA A;  3WWV A;  1D1I A;  4IPH A;  2A69 C;  5TSS A;  3PV0 A;  3TBI B;  2BH8 A;  2A6H D;  2TMP A;  1IKL A;  1Y1W G;  1YIT A;  4A76 A;  1TQO A;  5AJ3 Q;  4L8J A;  5LMU L;  1CKO A;  2Q2I A;  3L9A X;  3CXC A;  1PH6 A;  1Q1B A;  3K8A A;  1GO3 E;  4CJ1 B;  4UDU C;  3KBG A;  2NZO A;  3DWP A;  4DKA C;  3J7A V;  1PH2 A;  5C3X A;  4GN5 A;  2FMM A;  1SYE A;  1GOZ A;  1S72 A;  1UAP A;  1GM5 A;  4DV7 Q;  1STG A;  4WRD A;  4LF7 L;  4QUF A;  1XWE A;  3HOZ H;  4Y7N H;  2KA7 A;  2EYO A;  4C3J G;  1AP0 A;  4U68 A;  1RD9 D;  3A55 A;  3I56 A;  2A69 D;  1X3F A;  3D6W A;  3M7G A;  3PUZ A;  1UWV A;  4DPG A;  3PIP 3;  4A3E B;  1C0A A;  1KAB A;  1N36 L;  1EUJ A;  1F9S A;  1ZKO A;  4H7B A;  4H13 C;  5JPM C;  2EYP A;  4BY1 H;  1G91 A;  4EGV A;  3BVG A;  3RD4 A;  1K0R A;  4DN4 M;  2F0D A;  1YNN D;  3IAY A;  1KNA A;  1ZYR D;  2CQO A;  1LTS D;  3KLS A;  5ELO A;  5I2X A;  3FEW X;  5JJI A;  4KHV A;  3A54 A;  2HHH Q;  4NP5 A;  1GKH A;  3V05 A;  1EIY B;  2HT1 A;  1XMO Q;  3LWU A;  4QB4 A;  2B2W A;  1FYC A;  4A3E G;  5ISR A;  2KQ3 A;  4RCO A;  2OXP A;  2JA8 B;  1JWS D;  4QL5 A;  2X6G A;  2ZXP A;  5LL6 S;  5E4W C;  5KND A;  3B6Y A;  1L1O C;  3FPU B;  2AWN A;  4ZKB B;  2O5J C;  2B2T C;  2KCN A;  2PCF B;  1B50 A;  2UXD L;  2EY5 A;  5M3M H;  4MN3 A;  5I4D A;  4LF4 Q;  2GN5 A;  2D0O A;  2E2I B;  3PUY A;  4A3E H;  4L5R C;  2CKZ B;  3S14 B;  5KNB A;  1CQV A;  3GV3 A;  1CI3 M;  4ZYS A;  4DV2 L;  4X3T A;  1VQ7 A;  1IZ6 A;  4UAI A;  1TS2 A;  5HGQ A;  3Q23 A;  1CA5 A;  4PMC A;  5M9O A;  1Y1W B;  1EU4 A;  1CTM A;  2F0T A;  3RUZ A;  3U50 C;  1TS4 A;  1PFM A;  1Y8P B;  2LS0 1;  3AU7 A;  1STH A;  1JE5 A;  1B3Q A;  3F2U A;  2MNA A;  4KY7 A;  4DNI A;  4A3C H;  4GKJ Q;  4KD3 A;  1IXR A;  3PCO B;  3F2B A;  2HDL A;  2KCT A;  2WKC A;  2F03 A;  4HID A;  1AH9 A;  3HKZ G;  3KDF A;  1KHI A;  4DV6 Q;  1WI5 A;  1T5E A;  1VQ6 A;  1SE2 A;  2A74 C;  1HZB A;  2OQK A;  1X55 A;  1Y8N B;  5EKL A;  3S1M H;  4YCW A;  3OMC A;  4B3M Q;  4RKB A;  4DR2 Q;  3R8B A;  2JA6 B;  1OXX K;  1VQF A;  2F0F A;  1HTP A;  4MTN A;  4A3F B;  3GTJ B;  4QF4 A;  4A3C G;  1MSH A;  1ESR A;  4L63 B;  2IT1 A;  4LNQ A;  1BQQ T;  4FYD A;  1NAP A;  3PSI A;  2VUM H;  5JOB A;  3PF5 A;  5G3L D;  4B3S L;  2CWP A;  3HRZ C;  4PMB A;  1ML0 D;  2KCC A;  4HED A;  5HGT A;  4JI2 L;  4JBK A;  2HQL A;  1N9W A;  1IBL Q;  2Q8T A;  4JI4 Q;  3IL8 A;  1LYL A;  1A2T A;  3H09 A;  1DON A;  3SEB A;  3RLN A;  3CQZ B;  5JJK A;  1RL2 A;  2JN4 A;  4GOP A;  2NB0 A;  1A63 A;  1O7I A;  3TS0 A;  3HOW H;  2WII B;  1CSP A;  2F3W A;  4G7H C;  2N3S A;  4JI0 Q;  3HOW B;  2O2L D;  1A15 A;  1MJC A;  1Z47 A;  3K5L A;  1X3Q A;  4HN7 A;  1G6P A;  3G6J B;  4CDE C;  4C1N K;  4JI1 L;  2VNU D;  1LT3 D;  4XYO A;  3BDO A;  4IPG A;  4B3T Q;  2ICE C;  1G8Z D;  3VR5 A;  2RF4 A;  3RN2 A;  1X6O A;  2NVQ H;  5C6A A;  4U67 3;  5HUR A;  4J6H A;  2PI2 A;  1E7Z A;  1NMG A;  2K5N A;  1LT5 D;  1EFI D;  1PRT F;  2Z9H A;  1ILP A;  2I46 A;  3CCV A;  4A3G B;  4A3L H;  2K5V A;  2VY3 A;  4WJ3 M;  1OXV A;  4JC0 A;  1YEZ A;  1RCV D;  1UEA B;  1Y1V B;  3CCM A;  3NTK A;  3HOZ B;  4R1J A;  1J5E L;  4GNX B;  4OWX B;  4BXX G;  2E2H H;  2IL8 A;  2OQ0 A;  3CAM A;  3M4Y A;  2AHO B;  4O0A A;  1G51 A;  1SRO A;  2A68 D;  1TWA H;  4IJL A;  3FP9 A;  4A3B B;  4OHJ A;  5D3D A;  2ENB A;  3FRP B;  1HJP A;  4JI8 L;  2R93 G;  1V8Q A;  1PV4 A;  4NXM L;  4BS9 A;  4A3G H;  1PH3 A;  1G2T A;  3NEL A;  1B70 B;  2F0V A;  1VQK A;  4J1M A;  3PIP A;  4RGN A;  3N6R A;  4IFD G;  3K7A H;  2IX1 A;  3RZO H;  2ZTD A;  4GLV B;  1H9S B;  1A3U A;  3GTO B;  4HCS A;  2QF7 A;  4A3D G;  2SOB A;  3D6C A;  3TME A;  5I6W A;  1H9S A;  1QZG A;  4GKK L;  3NTI A;  1MHW C;  2D5D A;  5ELE A;  5I2Y A;  1D6E C;  4AQY Q;  5E7N A;  1XPR A;  4B3R L;  1QJO A;  4B3S Q;  1NTG A;  5AFW A;  2RDF A;  1O7L A;  1TWH H;  1K8O A;  4YY3 Q;  3OW2 A;  1TKW B;  1V1O A;  3D4W A;  3S16 H;  3AEV A;  3QJY A;  2NUC A;  1RJT A;  2A5H A;  1LTT D;  2VQE L;  1R9T B;  1B4O A;  4R8I A;  2EY1 A;  1WTO A;  1HR0 Q;  5C3W A;  2EYH A;  2KOL A;  5IWA Q;  4ZRZ A;  1EEI D;  1SDF A;  5JPN C;  3HOV G;  3AFP A;  4LF8 L;  2E5L L;  3TSS A;  3E3X A;  5CV7 A;  2I5L X;  1L0Y B;  5DEH A;  2D9U A;  2E2D C;  5JJL A;  5T1G A;  1F2Z A;  4H02 A;  3KK7 A;  3P20 A;  1WTH A;  2ZJR A;  3CCJ A;  1X9N A;  1HR0 W;  2K33 A;  3E6Z X;  4L5Q A;  4RA8 A;  4DV4 Q;  2PZT A;  4DK0 A;  2RCN A;  5C44 B;  1RKN A;  2F0I A;  1ZYR C;  3MTS A;  1C4Q A;  3TZD A;  4C3H G;  1I3Q B;  1ROD A;  2K1B A;  3AB9 A;  1A8V A;  2MHV A;  2Q8I B;  1AN8 A;  4C56 C;  3LNN A;  2AWO A;  4DAM A;  4HJ9 A;  4UP9 A;  3MXN A;  1IW7 D;  1TS5 A;  1E2W A;  2K5W A;  3G6E A;  1ICW A;  3CPW A;  4DV1 Q;  1TWG B;  1MJE A;  1Q46 A;  3JAM L;  5GAE C;  4QQB X;  3AQQ A;  2J4X A;  1LTI D;  3JC6 6;  3BYT B;  1VQD A;  2NVY B;  3ND8 A;  1JCK B;  1EYA A;  1KNE A;  2AQ1 B;  5LMN Q;  4JYA Q;  3T1H Q;  2B3G A;  2MPM A;  4K8J A;  2ZXR A;  2EYM A;  4IO9 A;  4ODG A;  1EEF D;  4POG A;  4KI0 A;  4IAL A;  1NY4 A;  3GQB A;  3HOY G;  1XNR Q;  3S16 B;  3PO2 H;  3TS2 A;  4P71 A;  3ZJY C;  2FIN B;  4LF9 L;  4HJ7 A;  5T1I A;  4OX9 L;  2I07 B;  4AQY L;  2R7D A;  3L3O C;  3OSO A;  1YHQ A;  1TU2 B;  3NP8 A;  2CWA A; 
#chains in the Genus database with same CATH homology
 2D62 A;  4LFB Q;  2XGT A;  4LF6 L;  3UDI A;  4BBS G;  2JE6 I;  3GTJ H;  4OO1 G;  1I3Q H;  2FXQ A;  2VQF L;  5FJ8 G;  3ULJ A;  2K50 A;  2OTJ A;  4DR3 L;  2E8G A;  2C35 B;  2Z0S A;  3BU2 A;  4R4I A;  5GAG C;  4AYB G;  5C4X G;  5IYB G;  1X54 A;  3PO2 G;  4J15 A;  4DV5 Q;  3L7Z C;  3S1N H;  1WYD A;  3CQZ H;  3U4V A;  3T1Y Q;  3AYH B;  1K73 C;  3G71 A;  2NVX H;  2ATW A;  2ZTE A;  1FL0 A;  2PQA B;  4JI7 L;  1Q86 C;  1I5F A;  2PMZ E;  4NXM Q;  1PHJ A;  2R7Z G;  3S2D H;  2NZH A;  1TWG H;  2IHF A;  2VZA A;  2Y0S E;  2WB1 E;  3RLF A;  5IYD G;  2VQF Q;  4GNX A;  4LF4 L;  4LF7 Q;  2JA7 G;  2VS1 A;  1HH2 P;  4P75 A;  3GTM H;  4B3R Q;  4A3I H;  4C3H H;  1J6Q A;  1UE6 A;  4UP8 A;  2WFW A;  2Q2T A;  2YTV A;  5C4X H;  4DV7 L;  2NVT H;  1PYB A;  3ER0 A;  3PUV A;  2R92 H;  4EQ5 A;  1XMQ Q;  1VQ9 A;  3HOU H;  2JA6 G;  2EQS A;  1UEB A;  2BA0 A;  3CW2 C;  1VQL A;  3DLL A;  2L15 A;  1KRS A;  3KF6 B;  2HIV A;  2D0P A;  1V9P A;  2NN6 I;  4YCU A;  4A3M H;  4PZ8 A;  3M85 A;  2JJQ A;  1PH4 A;  3BZC A;  1W3S A;  2QA4 A;  3RN5 A;  1Z9F A;  1Y1V G;  1YHA A;  4GN4 B;  1BBU A;  2GVA A;  1C7Y A;  3ERS X;  3S14 H;  1YBY A;  3FKI H;  4XTC S;  1WCM G;  3E9I A;  4C2M H;  3EBE A;  4DR3 Q;  1XNQ Q;  1MKH A;  4DR4 L;  4YWK A;  4DV6 L;  3K0X A;  1Q7Y C;  1D8L A;  1EYG A;  5DLQ E;  1VQI A;  1YJN A;  2ES2 A;  2R92 G;  5EAY A;  1WOC A;  4A75 A;  1XPU A;  2QGQ A;  5M3F H;  5M5Y H;  2PQA A;  3BZK A;  5H1S E;  1L0W A;  4JI1 Q;  4JG2 A;  4A3M G;  1SLJ A;  3WWV A;  2F52 A;  4IPH A;  3G4S A;  1D7Q A;  4BY7 G;  3PV0 A;  2DUD A;  2BH8 A;  5GRO A;  5IP7 G;  4R4T A;  3KLW A;  4LFA Q;  5K36 G;  4MZ9 A;  1Y1W G;  1CKM A;  3FKI G;  1AE2 A;  3I4M H;  1U5K A;  4X66 Q;  1YIT A;  4JI0 L;  4A76 A;  3RNU A;  5AJ3 Q;  3J81 c;  1CKO A;  2Q2I A;  5LMU L;  4PZ6 A;  3CXC A;  5GAD C;  3HKZ E;  1PH6 A;  1NJI C;  1EFW A;  4AIM A;  1HZ9 A;  1Q1B A;  1GO3 E;  3K8A A;  1JJ2 A;  1MIU A;  2K5H A;  4GLX A;  2NZO A;  4DKA C;  4DV2 Q;  1PH2 A;  1ASY A;  3CCU A;  3H0G G;  1CUK A;  4GN5 A;  2HHH L;  1SE8 A;  3S24 A;  1N34 L;  4TVA B;  2K14 A;  4DV4 L;  2MFI A;  1S72 A;  3GTP H;  1GM5 A;  4DV7 Q;  4LF7 L;  2I5M X;  2JA9 A;  1HZA A;  3KF8 B;  5IYB H;  4JBJ A;  2PNH A;  3HOY H;  1Q8K A;  3HFZ B;  3Q8D A;  4IJH A;  4JI2 Q;  3HOZ H;  4Y7N H;  4QIW E;  4KHP Q;  1WJJ A;  4A3K H;  1I94 L;  4A3D H;  1Q12 A;  4AH6 A;  2JA5 H;  1CSQ A;  3I56 A;  2UU9 L;  3J7A 5;  3M7N A;  1X3F A;  3IRB A;  3PUZ A;  4DPG A;  1UWV A;  1IBK L;  2OWO A;  1HNW Q;  2UUB L;  4IFD J;  3L2P A;  1C0A A;  1VQH A;  2IHE A;  4BA1 I;  3H0G H;  2E2I H;  2DGY A;  3NBH B;  2YV5 A;  1N36 L;  3CCQ A;  1EUJ A;  2F4V Q;  4UY8 C;  4YHH Q;  3ULP A;  3W5O A;  4BY1 H;  4DV5 L;  1JJG A;  1JJC B;  1LTL A;  4DUY L;  2ASB A;  1K0R A;  4YY3 L;  4JI5 L;  3CCL A;  3F2D A;  1P8L A;  1I6H H;  4JI3 L;  3UE1 A;  1XMQ L;  1PH8 A;  1PH5 A;  3J80 i;  2JEB I;  3GTG H;  2CQO A;  2VL6 A;  2ZM6 L;  1Q1E A;  3PO3 H;  5ELO A;  4JBM A;  5JJI A;  2A1A A;  1YJ9 A;  1K8A C;  4DV0 L;  5IYD H;  2EXD A;  1N34 Q;  2JA7 H;  2HHH Q;  2I5H A;  3HOV H;  4KHZ A;  4PZ7 A;  1HNZ Q;  4JV5 Q;  1GKH A;  4LUZ A;  1C9O A;  1XNR L;  3UDF A;  4X62 L;  1EIY B;  4OWW B;  2HT1 A;  1XMO Q;  5C0X I;  2R6G A;  2KEN A;  3L0O A;  4A3E G;  4A3J H;  4IPD A;  3HOU G;  1KRT A;  3STB D;  4QL5 A;  1NBW A;  1B7Y B;  1HR0 L;  3B6Y A;  4A93 G;  4FDB A;  1PH1 A;  4ME3 A;  1L1O C;  4LFA L;  2AWN A;  3CF5 A;  1VQB A;  2UXD L;  1YHB A;  1OTC A;  3E9H A;  5M3M H;  4OWT B;  2YU9 H;  2UXC Q;  1TXY A;  4HJ8 A;  3FHW A;  1X56 A;  4LF5 L;  4LF4 Q;  1ASZ A;  1PH7 A;  5C0X J;  2GN5 A;  5FLM H;  4DR5 L;  3CC2 A;  4RG1 A;  2D0O A;  1X3G A;  3I7F A;  3CCE A;  4JI5 Q;  3PUY A;  3I2Z A;  1K9M C;  1VS0 A;  2LXJ A;  1AE3 A;  4OX9 Q;  1FGU A;  2MO0 A;  4A3E H;  4PMW A;  2UXB L;  4L5R C;  2ID0 A;  2YTX A;  5C3E H;  5ELN A;  3J81 i;  4A3F G;  2CKZ B;  3RR5 A;  5IWA L;  1FJG Q;  1QZH A;  4QGU A;  3I4N G;  4HJA A;  4IFD I;  1I50 H;  3TEH B;  1RIP A;  3A74 A;  4P72 A;  4DV2 L;  1VQ7 A;  3S1Q H;  1IZ6 A;  1M1K C;  3D0F A;  5IE8 A;  3CCR A;  4A3B H;  5HGQ A;  3NEN A;  4DV3 Q;  4GOP C;  3U50 C;  4P74 A;  2ZTC A;  5GQO A;  4AYB E;  1X65 A;  1I94 Q;  4HJ5 A;  5M3M G;  3KFU A;  1K83 H;  1YNX A;  2YTY A;  4LW1 A;  4DR6 Q;  1TWF H;  1Y1W H;  3A5Z B;  1JE5 A;  2HIX A;  5C4J H;  1L1O A;  2MNA A;  3M4O H;  4K0K Q;  2UUC L;  1UE7 A;  4A3G G;  4DNI A;  3I55 A;  4A3C H;  1VQE A;  4GKJ Q;  1IXR A;  1VQN A;  4BBR H;  3PCO B;  1N33 L;  2VUM G;  3PF4 A;  4GKK Q;  4DR1 Q;  3F2B A;  4LF5 Q;  4QJF A;  1P16 A;  2KCT A;  1FVI A;  1Q81 C;  3UE0 A;  4HID A;  3M3Y H;  1AH9 A;  3HKZ G;  3KDF A;  1KHI A;  3H3V I;  4DV6 Q;  1WI5 A;  1QVC A;  2N8N A;  1QUQ A;  4P73 A;  1OXT A;  3NEM A;  4DAY B;  3UDG A;  2AMC B;  1VQ6 A;  1A62 A;  1HZB A;  1NMF A;  2OQK A;  1X55 A;  2WAQ E;  5BR8 L;  2EIF A;  4B3M L;  4YCW A;  5M5W H;  3S1M H;  4DK3 C;  4C3J H;  1JB7 A;  4B3M Q;  1T9H A;  5IP9 G;  3KOJ A;  4DR2 Q;  4A4I A;  1OXX K;  1VQF A;  1HNW L;  4GLA C;  4MTN A;  3S15 H;  2VQE Q;  4X65 Q;  4A3C G;  1PVO A;  1S3O A;  2IT1 A;  4LNQ A;  2UUA L;  1E1T A;  1WFQ A;  3PSI A;  5LMU Q;  2VUM H;  1BVS A;  4MNO A;  3PF5 A;  1L2F A;  5IT9 c;  4B3S L;  2CWP A;  4BBS H;  3M4Q A;  1CKN B;  4UP7 A;  3SGI A;  4DR7 L;  4BY1 G;  1N33 Q;  4JI2 L;  1SRU A;  4DR4 Q;  4JBK A;  2VW9 A;  4JI6 Q;  1SMX A;  2HQL A;  1N9W A;  1IBL Q;  2UUC Q;  4TQU S;  2GVB A;  1JT8 A;  1YI2 A;  4QY7 A;  1B8A A;  4JI4 Q;  2RHQ B;  1IBL L;  4LUV A;  4JI3 Q;  2A19 A;  3AFQ A;  1LYL A;  3EIV A;  1VQA A;  2JA8 H;  5JEA J;  2R7Z H;  2UUA Q;  1X3E A;  1VQC A;  3RLN A;  3PO3 G;  2IX0 A;  2E5L Q;  4JI7 Q;  5JJK A;  1RL2 A;  4GOP A;  4DV3 L;  1O7I A;  1A63 A;  3TS0 A;  1EOV A;  3HOW H;  1CSP A;  4POF A;  3D31 A;  1VQ5 A;  4X65 L;  2N3S A;  3JAM c;  4X66 L;  4JI0 Q;  3GTK H;  5M5X H;  2YYZ A;  4OON A;  1MJC A;  1Z47 A;  4L5S A;  3S17 H;  4R4C A;  2PI2 E;  1PA6 A;  4NXN L;  1N32 L;  3RLO A;  4JBW A;  2UXB Q;  5C3E G;  4A3F H;  1A0I A;  3I4N H;  4A3J G;  1EIF A;  1EQQ A;  1G6P A;  4DR1 L;  4UPA A;  4JI1 L;  2VNU D;  4IPG A;  4B3T Q;  1KXL A;  3W1B A;  3KF6 A;  1Y1V H;  1Y14 B;  2RF4 A;  3RN2 A;  2UXD Q;  1X6O A;  4DV1 L;  4C3I H;  2NVQ H;  5IY0 A;  1CKN A;  1TWC H;  2PI2 A;  2Z6K C;  1E7Z A;  1NMG A;  2K5N A;  2ZM6 Q;  1VQ4 A;  1KD1 C;  3CCV A;  3GD7 A;  2WB1 G;  1YZ6 A;  4Y52 H;  3CP0 A;  2K5V A;  3VDY A;  4A3L H;  2VY3 A;  4WJ3 M;  3CC7 A;  1OXV A;  4JC0 A;  3PGZ A;  1YEZ A;  2K52 A;  4OO1 I;  1W2B A;  3CMA A;  4LF6 Q;  3CCM A;  1QVF A;  2BH2 A;  1UE5 A;  5JEA G;  4R1J A;  1V1Q A;  1J5E L;  4GNX B;  4O2D A;  3F1Z A;  4OWX B;  2K75 A;  4BXX G;  2MQH A;  4BY7 H;  3F8T A;  4DV0 Q;  1LUZ A;  4HIM A;  2E2H H;  1HZC A;  2OQ0 A;  3CAM A;  4HIO A;  3I4M G;  1E3P A;  3F2C A;  2AHO B;  4O0A A;  2K4K A;  4JI6 L;  1G51 A;  1OXU A;  1SRO A;  2QEX A;  2ZJQ A;  2B63 G;  2N78 A;  3GTQ H;  1TWA H;  1HNX L;  4IJL A;  3PIO A;  3FP9 A;  3H3V H;  4WJ4 A;  1XTD A;  1UE1 A;  2JK8 A;  4LWC A;  2UXC L;  3TRE A;  3CD6 A;  1HJP A;  5IP9 H;  4B3T L;  4XIG S;  4X6A H;  1K3R A;  3GDE A;  4JI8 L;  2R93 G;  5HY6 A;  1PV4 A;  4NXM L;  3U4Z A;  4YWM A;  4A3G H;  1PH3 A;  1XPO A;  4ALP A;  3MEF A;  3A5U A;  4LF8 Q;  3NEL A;  4RMF A;  1S40 A;  3JAM i;  5C0X G;  1B70 B;  2NN6 G;  3T1Y L;  1VQK A;  4BXX H;  1IYJ B;  3PIP A;  5BR8 Q;  3M4P A;  5C44 G;  3CCS A;  3PUW A;  1XMO L;  2B63 H;  2Z6K A;  4GS3 A;  4IFD G;  3K7A H;  3TQY A;  5FLX c;  2IX1 A;  3HOZ G;  2ZTD A;  3RZO H;  4GLV B;  1HNZ L;  2JA5 G;  3GTL H;  5AJ3 L;  4X64 Q;  4DK6 C;  2N49 A;  1JMC A;  1BBW A;  1K8G A;  4A3K G;  4A3D G;  3M9B A;  4R4Q A;  2JA8 G;  4JYA L;  1QZG A;  4GKK L;  2CCZ A;  1VQ8 A;  4AQY Q;  4GN3 B;  2KHJ A;  4LUO A;  5IYC G;  2ZJP A;  3A0J A;  5E7N A;  1XPR A;  2RHS B;  4B3R L;  2Q2U A;  3J7Z C;  3KJP A;  1VCI A;  4B3S Q;  1NTG A;  4DR5 Q;  3GTO H;  1H95 A;  2XTI A;  5C44 H;  4DUZ Q;  2A8V A;  4DR7 Q;  1TWH H;  1YVC A;  3G48 A;  4YY3 Q;  4IOC A;  3TRZ A;  4DUY Q;  3OW2 A;  1IBM L;  2IY5 B;  2JQO A;  1EWI A;  4APV A;  4DR2 L;  3AEV A;  3S16 H;  3S1R H;  3OTO L;  1IL2 A;  4LFC L;  1KAW A;  3CME A;  1XNQ L;  4PG3 A;  2VQE L;  1YIJ A;  3MXN B;  3ULL A;  1KL9 A;  3T1H L;  2WAQ G;  3UDX A;  1YJW A;  1HR0 Q;  5LMN L;  1E24 A;  4YHH L;  5IWA Q;  1N36 Q;  1E1O A;  3HOV G;  4JOI A;  3K7U C;  2BA1 A;  3AFP A;  2OCE A;  4LF8 L;  1Q82 C;  2E5L L;  3U58 A;  3HOW G;  3H15 A;  2AKW B;  2I5L X;  4GNX C;  1SFO H;  4LFB L;  4IOA A;  4OXP A;  3I4O A;  1OXS C;  2UU9 Q;  5JJL A;  4EX5 A;  4H02 A;  4JI4 L;  4A3L G;  3OYY A;  4YCV A;  1R9T H;  4KLK A;  2ZJR A;  4LF9 Q;  4JOI C;  4A93 H;  4NXN Q;  1VQM A;  3CCJ A;  4GKJ L;  1PH9 A;  1X9N A;  1HR0 W;  1GVP A;  2Y0S G;  4L5Q A;  3CC4 A;  3LGJ A;  1DGS A;  2Q2H A;  4DV4 Q;  2R7F A;  1G29 1;  3CPF A;  1GD7 A;  1N8R C;  3KDF B;  2RCN A;  1SN8 A;  1J5E Q;  3ICE A;  1WCM H;  4A3I G;  5FLM G;  4DR6 L;  3J81 j;  4X62 Q;  2OTL A;  1SR3 A;  4DUZ L;  1A8V A;  2CFM A;  1VQG A;  5GAH C;  5M3F G;  2JA6 H;  2AWO A;  4DAM A;  2UUB Q;  2R93 H;  4HJ9 A;  3HKS A;  4UP9 A;  1VQJ A;  4LFC Q;  4A3B G;  3GO5 A;  1VQP A;  2H5X A;  3STB C;  3G6E A;  2MO1 A;  2KCM A;  2V1C C;  3CPW A;  4DV1 Q;  1MJE A;  4HIK A;  1M90 C;  4IPC A;  3HOX G;  3DM3 A;  1EQR A;  2LSS A;  3RZD H;  4X64 L;  1Q46 A;  1HNX Q;  4NB3 A;  2JEA I;  5GAE C;  4QQB X;  3AQQ A;  3BJU A;  3JC6 6;  1VQD A;  2WP8 J;  1XJV A;  1N32 Q;  4R4O A;  1KIX A;  4NPS A;  2F4V L;  1L1O B;  5LMN Q;  4JYA Q;  2E2J H;  4BBR G;  1NE3 A;  2B3G A;  2LXK A;  3K80 C;  3W1G A;  2NVY H;  3T1H Q;  1LM0 A;  2I0Q A;  4BA2 I;  1IBK Q;  2F3I A;  5IYC H;  3OTO Q;  4GOP B;  4JI8 Q;  4IO9 A;  1VQO A;  1V43 A;  4L5T A;  3S2H H;  5FJ8 H;  1E22 A;  4JV5 L;  3KJO A;  1PFS A;  1IBM Q;  2B29 A;  3HOX H;  1KQS A;  4POG A;  1KC8 C;  3E0E A;  3EN2 A;  1NY4 A;  4KI0 A;  2KHI A;  5IP7 H;  3HOY G;  1XNR Q;  4KHP L;  4JCV E;  3PUX A;  3PO2 H;  3TS2 A;  2KBN A;  4P71 A;  5J3B A;  1FJG L;  1QUQ B;  3KYH C;  3ZJY C;  1BKB A;  1PYS B;  4LF9 L;  4HJ7 A;  4K0K L;  2ALY B;  4OX9 L;  3J80 c;  5LMN W;  2R7D A;  4AQY L;  1U0L A;  3K81 C;  1YHQ A;  4YWL A;  1QVG A;  2CWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...