4BXXH

Arrested rna polymerase ii-bye1 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxH00
3STBC 4LUVA 3M4QA 3GTKH 1XNQQ 1LTLA 3S1RH 1Q82C 4LUZA 2VUMG 2D62A 3EIVA 4BA1I 3RNUA 1IBLL 4GN4B 3H15A 3I2ZA 4JI8Q 3RLFA 4QL5A 2JA7G 3K81C 3HOYG 4KHPQ 2C35B 3PUYA 4P73A 4LF9Q 1G291 2UU9L 3KDFA 3CW2C 4MNOA 1XPUA 1VCIA 4P72A 1PH9A 1KAWA 2RHQB 3CP0A 4JI1Q 2PI2E 1MIUA 4NXNL 2IT1A 4JCVE 3I4OA 2IHEA 3HOVG 1S3OA 3J7ZC 4DAMA 1HR0W 3I55A 3S17H 1HNZQ 4AYBG 3F8TA 1MKHA 1B70B 5HGQA 3Q8DA 2Z0SA 5GAHC 4DV5Q 2BA0A 1X3EA 4XTCS 4DR2Q 2I0QA 2JA5G 1X56A 3U4ZA 4DKAC 1IXRA 1AE3A 2HT1A 1PH1A 2L15A 1L0WA 3CXCA 3PO3G 1TWAH 3TS2A 2ZTCA 1QUQB 3GTQH 3PF4A 4FDBA 1KC8C 2ES2A 3M3YH 4OO1G 2AWOA 3TS0A 2Q2UA 1L1OC 3A74A 1Q46A 1Z47A 4GS3A 3CCJA 2KHIA 4NXML 4HJ9A 1N36Q 5IWAL 3GTPH 3E9HA 4B3TQ 5IP7G 2QA4A 4LFCL 4BXXG 1PH2A 4JI6L 4DV3L 1YITA 2OWOA 1N33Q 1O7IA 3I4NG 3J81c 4A3GG 1SMXA 3GO5A 1BBUA 1PH4A 3K7UC 4JI6Q 4DUYQ 4NB3A 3HOXH 1XTDA 1IZ6A 4J15A 4R4TA 5IYCH 4ME3A 3CAMA 2FXQA 1YHAA 1NY4A 4MZ9A 1WCMG 4Y7NH 4DV2L 1PA6A 2EQSA 3KLWA 1QVCA 1K9MC 3CCUA 1A8VA 3BJUA 4BY1G 3HOUH 1I50H 4R1JA 4IFDJ 4A93G 1NBWA 3HOZH 3PCOB 4DR1Q 3CCSA 4BY7G 4A3FG 1CSPA 4DUZL 3S1MH 4A3BH 1JJ2A 2KCTA 1PH5A 2N49A 2NN6I 3H0GG 1EQQA 1M1KC 5IYBG 4OO1I 1KXLA 4LFAL 2MNAA 3G4SA 2IHFA 2K5HA 4LFBL 4X64L 1KL9A 3JAMc 4PZ8A 3U50C 2NVXH 2R92H 4JI2Q 4JOIC 2Z6KC 4JC0A 4A3MG 1XPRA 2N8NA 3GTGH 4GKJQ 2OTLA 1FJGL 4RG1A 1C0AA 4IOCA 2DUDA 5GROA 1X54A 4AQYL 1CKNB 2JE6I 1WOCA 4IJLA 1NE3A 3S16H 1SROA 4OXPA 3T1YL 4JI4L 4OWTB 2JA9A 4YY3L 4IJHA 1N34L 1VQPA 1IYJB 4LF4Q 3CC2A 4LF6L 2NVYH 4H02A 3J80c 2N78A 5DLQE 3GDEA 3L7ZC 3ULPA 1WI5A 3FKIG 1QUQA 3NENA 1K8AC 4JI7Q 4L5QA 4ALPA 2PI2A 1XMOQ 3I7FA 1Q81C 1TWFH 4JYAL 2I5HA 3RR5A 3KJOA 2YTXA 3CMAA 4DR5Q 4HIOA 3S14H 2AHOB 2IY5B 2YV5A 1VQ9A 3U4VA 1B7YB 4B3MQ 2PNHA 1KRSA 1V9PA 3S1NH 1EIFA 1VQDA 3A5ZB 4DR6L 2JA6G 1VQJA 1X55A 3OW2A 4QQBX 2Q2TA 3S2HH 1VQ6A 3CCQA 2BA1A 1Y1WH 4QJFA 3F2DA 4BBRG 4DR2L 2F4VL 4LF8Q 1VQFA 3KFUA 3KF6B 2R7FA 4B3SQ 4LNQA 4LUOA 4A3CG 3E0EA 4IPCA 2B63G 3T1HQ 2R7ZG 4LF5L 2R93H 1EYGA 2F4VQ 3JAMi 4NXNQ 4YWMA 1PFSA 2GN5A 1Z9FA 4JI8L 4A3EH 5M3MH 4R4QA 2R6GA 3NEMA 1OXXK 2GVBA 5FLMG 4YWKA 1I3QH 2JEBI 2E5LQ 4X66L 2PQAA 3G6EA 1N8RC 4JI5Q 2JA8G 4BBSG 2K75A 1YJNA 4C3IH 5BR8L 1VS0A 3GTJH 2UUCQ 4JG2A 3ZJYC 2E5LL 1N32Q 4UP8A 1RIPA 4PG3A 4GN3B 1Y1VG 5AJ3L 3K80C 4QIWE 3B6YA 1WJJA 4QY7A 2JJQA 4JBKA 1GD7A 2CWPA 3FHWA 1HR0Q 3I4MH 1TWCH 1U0LA 4R4IA 1UE6A 1VQNA 5M3FH 3CC4A 2NVQH 1R9TH 2UXDQ 2HHHQ 2VS1A 2CFMA 2UXBQ 1E1OA 2MO1A 2VL6A 1D8LA 2MQHA 2KBNA 1EWIA 4LFCQ 1VQMA 4HIKA 3PF5A 1KIXA 2XGTA 4XIGS 4JI3L 3KF8B 3AFQA 1PYSB 3CCRA 1Y14B 1IBMQ 1BVSA 5LMNL 2WAQG 4GLVB 1GO3E 2K4KA 4MTNA 1G6PA 1ASZA 4JI3Q 4JV5Q 4A3JH 4JI4Q 4KHZA 3CCMA 3PO2G 4APVA 1X6OA 4EQ5A 3CPFA 5FJ8H 4YY3Q 2QGQA 5GADC 1X3GA 1G51A 5IYDG 3D31A 5C44G 5C0XG 3UE1A 3OTOQ 4YWLA 4DV1L 3FP9A 4JI2L 1L1OA 4GKJL 1NMGA 3LGJA 1H95A 1XJVA 2E2HH 5E7NA 1GVPA 2DGYA 3S15H 3HKSA 2B3GA 4HJ8A 4DV0L 2ZTDA 4B3RQ 2VW9A 2WAQE 4OX9Q 4GKKL 1EFWA 2UXCL 3S2DH 2B29A 4JI0L 3GD7A 4GLXA 1E1TA 1YIJA 2VUMH 3PSIA 4LF6Q 3SGIA 1XNQL 2N3SA 1PV4A 1V1QA 2IX0A 1VQHA 1EQRA 3ER0A 2R7DA 2JA7H 3HOYH 4A3DG 3VDYA 4IFDG 1Q8KA 1VQ7A 1VQLA 5C3EG 4X62L 2EXDA 3UDGA 5JEAG 1YBYA 4YHHQ 4R4CA 1X3FA 5ELNA 2ZM6Q 4UPAA 3M7NA 3KYHC 1CSQA 3G71A 3CC7A 2ZJRA 5JJLA 4AH6A 3HOVH 1OTCA 2KHJA 4DK6C 1KQSA 3K7AH 1Q1BA 5JEAJ 2A19A 2VQEL 1LM0A 5C0XJ 1XMOL 5IP9H 4UY8C 3KDFB 4JYAQ 1PH8A 1QZGA 2NZHA 4JI1L 1YJ9A 5K36G 1FJGQ 3JC66 4OWXB 3J7A5 2D0PA 2MO0A 4IPGA 3HOWG 1UE7A 1B8AA 1HNZL 4X66Q 4DV7Q 1HNXL 2VZAA 4B3SL 1I94Q 4A3LG 1NJIC 1HZBA 1W3SA 3A0JA 5IP7H 1VQ5A 3CQZH 4L5RC 5C4XH 4BXXH 1WYDA 4LF5Q 1VQ8A 3S24A 4GLAC 5JJIA 4DV3Q 3I4NH 4A3GH 1JJGA 1HZCA 3TREA 4DNIA 3UDIA 3PV0A 2Y0SE 3AFPA 1PH3A 1E7ZA 1I5FA 4C3JH 2CCZA 4NXMQ 5IYCG 3MXNB 1WCMH 4HJ7A 4UP9A 4DPGA 4A3IG 5ELOA 3W5OA 4JOIA 3CMEA 3HOUG 1HNWL 4IOAA 3ULLA 4BY7H 2MFIA 1A0IA 1Q7YC 4WJ3M 2OCEA 2CKZB 1T9HA 1S72A 4A3KH 3K0XA 5LMNQ 1J6QA 1K8GA 1EUJA 3AYHB 1CKMA 1L2FA 4GN5A 4A75A 4B3TL 3EN2A 2F3IA 2Y0SG 4LFAQ 5M5XH 4DK3C 1YHQA 3CCEA 4A3MH 2NZOA 1VQKA 2ATWA 2YTYA 1N36L 1XPOA 4LF9L 3DLLA 4WJ4A 4GOPB 1SLJA 3S1QH 2ALYB 1E22A 5IT9c 4TQUS 1N33L 5HY6A 3J81i 4DV5L 1ASYA 4DAYB 3T1YQ 2NVTH 2K5VA 1Q1EA 3HFZB 3F2BA 1YHBA 2AKWB 4DR6Q 1HNWQ 2OQ0A 2K52A 1P8LA 1N34Q 2HIXA 1VQGA 2D0OA 2I5LX 5FLXc 1PH6A 4OX9L 2PMZE 1LUZA 3HKZG 1XNRL 3GTLH 1JB7A 1VQOA 1AH9A 2VNUD 4JI0Q 3PUXA 2JA5H 4O0AA 3OTOL 4HIMA 2LSSA 1OXVA 4KI0A 4GNXC 1XNRQ 3PO3H 1MJCA 5J3BA 4LFBQ 4DR3Q 1J5EQ 4DUZQ 3UE0A 5H1SE 3CD6A 4DR7Q 2A1AA 1FGUA 5M5YH 3KJPA 4A76A 1I6HH 2UUAL 4RMFA 1YI2A 2PQAB 2ASBA 2Q2HA 3RLOA 5C4JH 1VQ4A 1HH2P 4DV2Q 1K73C 5LMUL 3BU2A 1V43A 2JA6H 5JJKA 1D7QA 3RN5A 3H3VI 2UUAQ 4HJAA 1E3PA 3UDFA 1W2BA 1SN8A 4DUYL 1LYLA 5EAYA 4BBRH 5LMUQ 4BA2I 3HOXG 4JBWA 4PMWA 1JJCB 1K3RA 4A3CH 2B63H 1XMQL 2R7ZH 3G48A 1CKOA 1TWGH 2Q2IA 1M90C 4JV5L 1PVOA 4IO9A 4P75A 4BY1H 3NBHB 2Z6KA 4A93H 3HOZG 4IFDI 4YCVA 2F52A 1IBKQ 1BKBA 4A3FH 1EIYB 1BBWA 2VQFL 2ZTEA 3W1BA 2VQEQ 4A3BG 4YHHL 3ERSX 1IL2A 1PHJA 3AEVA 3H0GH 3F2CA 4BBSH 5IYBH 2NN6G 4LF7L 2R92G 3PIPA 1AE2A 1QZHA 1VQBA 5IE8A 2UUCL 1PYBA 4B3RL 1PH7A 4KLKA 2E2JH 4QGUA 1YEZA 3U58A 4X65L 3BZCA 2OQKA 4UP7A 1A62A 1QVFA 1NMFA 2XTIA 5BR8Q 1NTGA 1TWHH 4PZ7A 1KRTA 5IWAQ 1K0RA 3M85A 2CQOA 4K0KL 2EIFA 3L0OA 2OTJA 2UXDL 1IBLQ 1KD1C 2UXBL 4HIDA 3M4PA 4GNXA 4O2DA 4IPDA 4L5TA 1OXUA 4KHPL 2QEXA 2K5NA 2ZM6L 3FKIH 1CKNA 1SE8A 3ICEA 1FL0A 1UWVA 3ULJA 1Q86C 2LXKA 4P74A 3TEHB 3M4OH 1JE5A 4YCWA 2V1CC 5LMNW 4A3JG 4TVAB 3KF6A 1SRUA 1P16A 1UEBA 1VQEA 2ID0A 3NELA 4LF8L 1X9NA 3M9BA 5IYDH 5C0XI 3PGZA 1YZ6A 5C44H 2YYZA 3OYYA 3AQQA 1C7YA 2UU9Q 3TQYA 1HNXQ 3BZKA 4AIMA 3PUWA 3W1GA 3H3VH 1L1OB 1Y1WG 1C9OA 1GM5A 1JMCA 3RZDH 2HQLA 1YNXA 2HHHL 1UE1A 4HJ5A 2VY3A 1A63A 4Y52H 1JT8A 2GVAA 4POFA 3T1HL 1UE5A 4P71A 1OXSC 2BH8A 4GOPC 2R93G 3DM3A 2K14A 3PIOA 4LWCA 4DV6Q 4A3EG 5GQOA 1YJWA 5M3MG 4GOPA 4AYBE 1GKHA 3I56A 1X65A 4A3DH 5AJ3Q 1U5KA 4DR1L 5FLMH 5C3EH 5GAEC 5M5WH 4DV6L 1IBML 2UXCQ 2K50A 2JA8H 1EOVA 1RL2A 3GTMH 1N32L 2LXJA 3F1ZA 2CWAA 4DR3L 1J5EL 4OWWB 4DV1Q 4LW1A 4GNXB 1S40A 4X64Q 1K83H 3L2PA 1E24A 1MJEA 1SFOH 1Y1VH 2ZJQA 3RZOH 3RN2A 2YU9H 3UDXA 5IP9G 1HR0L 1CUKA 2H5XA 1Q12A 1OXTA 4JBMA 2KENA 4L5SA 3I4MG 3PUZA 3A5UA 3D0FA 3IRBA 1YVCA 1VQCA 2E8GA 1VQIA 4IPHA 5GAGC 5M3FG 1IBKL 2BH2A 3HOWH 4DR7L 1TXYA 3EBEA 2JEAI 4LF4L 3CCLA 4A3LH 4C2MH 1HJPA 4LF7Q 1N9WA 1I94L 5C4XG 3E9IA 2WFWA 4X62Q 4JBJA 1DGSA 4JI7L 4DV4L 2AMCB 1SR3A 2JK8A 4X65Q 4DV7L 3PUVA 2WB1G 3J80i 2VQFQ 2ZJPA 4R4OA 4EX5A 1QVGA 1XMQQ 3GTOH 4NPSA 4DV4Q 3WWVA 3PO2H 2UUBQ 4POGA 1FVIA 2WP8J 3KOJA 5FJ8G 4PZ6A 4A3IH 4K0KQ 4B3ML 2A8VA 4DR4L 2IX1A 4A4IA 1HZ9A 3HKZE 4AQYQ 4GKKQ 3CCVA 2UUBL 2JQOA 2RF4A 4JI5L 1HZAA 2RHSB 1KHIA 3CPWA 2YTVA 3J81j 4DR5L 4X6AH 3MEFA 2I5MX 4C3HH 4DR4Q 2RCNA 4DV0Q 1WFQA 2E2IH 3TRZA 4A3KG 5IY0A 2KCMA 4OONA 2HIVA 2WB1E 4YCUA 3CF5A 3K8AA 1VQAA 3STBD 2AWNA 3RLNA
chains in the Genus database with same CATH superfamily
4HCSA 1Z7TA 2D62A 2HD3A 1H9MA 3I2ZA 1B3QA 3M4YA 4JI8Q 4QL5A 2JA7G 4KHPQ 1SNOA 2C35B 4P73A 1G291 1M4VA 3VA5A 1VCIA 1PH9A 1ILPA 1KAWA 3CP0A 1MIUA 4NXNL 1WTPA 3I4OA 5C6AA 1E2WA 1Y8PB 4DAMA 4J6HA 3S2DB 3G6JB 4AYBG 4KMUC 4G57A 4DR2Q 2BA0A 3TN2A 1CHPD 1VMCA 1X56A 3S14B 1U4PA 1AE3A 4ILWA 1HNWL 1EY8A 1L0WA 2R92B 3CXCA 1LV9A 1QUQB 3CRLC 1CZGA 4MIUA 3S15B 1PRTD 3NWSA 1Q46A 2KHIA 4HJ9A 1PTOC 1N36Q 3GTPH 4ZUIA 1GUGA 3I90A 5IP7G 2VXWA 3Q6SA 3K5MA 4IQZA 1N33Q 1D5XC 3HOUB 1SMXA 1IKMA 3GO5A 1KNAA 2J0TD 2NBFA 2GA4B 3HOXH 1XTDA 2VB2X 5IGEA 4ME3A 1PA6A 1ET6A 3I4LA 1JORA 4H44C 4F7XA 1T5EA 1K9MC 3HOUH 3GTGB 3SK6A 3HOZH 3PCOB 2WAQB 3CCSA 4Q0FA 1TWGB 1EYDA 2C9OA 1QJOA 2KCTA 1SAPA 2EYFA 1EQQA 2F0HA 2RQXA 2IHFA 4BWGB 2Z8LA 4X64L 1UNSA 2B39A 4JI2Q 4A3MG 2OTLA 1K8OA 3ERQA 3VYUA 1Z6HA 1C0AA 5GROA 4A3BB 1B53A 4IJLA 1NE3A 1SROA 4OXPA 3A7AB 3OMGA 3E6ZX 1YNJD 4YY3L 1JOKA 1LT4D 1N34L 1VQPA 2F0NA 4LF4Q 3CC2A 4LF6L 2EXZA 2N78A 1XXGA 5JAVA 4X3TA 1QUQA 4LAAA 2EJMA 3NENA 4JI7Q 4ALPA 3BVZA 3MTSA 4XT3B 2I5HA 2YTXA 4DR5Q 2AHOB 3Q22A 2IY5B 4OIKA 2NVTB 5JJZA 2JA6G 4QQBX 3AMUA 3A8JE 1PYWD 3VA7A 1EU3A 2WINB 4RGTA 1VF7A 3HGBA 4RAUC 1VQFA 1CK1A 4LNQA 4LUOA 2R7ZG 3T1HQ 2F4VQ 2AQ3B 3HP3A 3JAMi 4NXNQ 2AQ2B 1PFSA 4I65A 2GN5A 1Z9FA 2D2CC 1OXXK 4YWKA 2JA8G 4JI5Q 2ZXOA 3OIPA 3TP5A 1S5CD 1HPCA 2N55A 4DAYA 2K75A 4C3IH 1R9TB 1ESFA 3ZJYC 2PCFB 4F88A 4UP8A 4PG3A 3MEHA 2EYHA 1Y1VG 5AJ3L 1W6KA 1WJJA 5KGUA 2R3ZA 4ZYSA 3I4MH 1DM0B 3TZDA 1VQNA 5M3FH 2UXDQ 4C3IB 1R9TH 3PQIA 4GZYC 2UXBQ 1D8LA 3NP8A 4HIKA 2E76C 4O42A 3VR5A 3KF8B 3AFQA 3CCRA 1Y14B 3O13A 1GO3E 1TVXA 3QIAA 1EWCA 4RA8A 4JI4Q 4FNFA 3H94A 4IALA 3CCMA 3D31A 5EJWA 3BYYB 1RCVD 4KKTA 4JI2L 1DCZA 5C4ZA 1ICFB 1H95A 1ML0D 3BVMA 2CW0C 5FO8B 3J81E 1AW7A 4B3RQ 2WAQE 3VYSA 2MJ8A 4QUCA 2KJXA 1CZWA 1STAA 4LF6Q 3SGIA 2BDOA 4DNRB 2IX0A 2R7DA 1A3UA 2JA7H 4A3DG 4IFDG 2ZT9C 4QMGA 4X62L 2EXDA 2BCOA 5JEAG 4B9XA 1Y1VB 4DNTB 2ZJRA 5D65A 1CA6A 1XX8A 1KQSA 1GUOA 1WTXA 2OT2A 2XWJB 3HKZB 3JC66 3J7A5 5BN3A 2MO0A 4OO1H 1WTHA 4HN7A 4DV7Q 1HNXL 4NKLA 2K05A 3MFYA 4A3LG 3NWTA 1NJIC 1HZBA 1W3SA 5IP7H 1PLFA 1VQ5A 5CYUA 5C4XH 1WYDA 3NK9A 1VQ8A 1HZCA 2AUJD 3QOLA 3PV0A 2Y0SE 1E7ZA 1M8AA 4DA2A 3MXNB 4HJ7A 4UP9A 5IGGA 1Q90A 3R93A 4DPGA 5JPMC 3HOUG 2K5QA 1SFOB 5CV4A 1Q7YC 4WJ3M 1T9HA 3K0XA 5LMNQ 1UEAB 1SDFA 4GN5A 1L2FA 1STHA 2VB3X 3BDOA 1T5XD 4DK3C 2F0EA 2FHTA 2YTYA 1FGBD 1XPOA 2WB1B 4LF9L 1I6HB 4CBVA 5C3WA 3S1QH 4G7OC 1LTAD 1G2TA 2B2WA 4Z9CB 4DAYB 1LTRD 2NVTH 3HFZB 2OQ0A 4U68A 1VQGA 2F0FA 5FLXc 2LMCB 2RCFA 1PH6A 4KY6A 2B8FA 3J7AV 4KY5A 2JA5H 1R4PB 4O0AA 4ZK9B 4HIMA 3K5NA 4KI0A 1EY9A 2G9HD 2KHSA 1MJCA 5J3BA 5IGBA 1K83B 2BE5C 5CV6A 2BDNA 3TDQA 4KY7A 4DR7Q 5BN5A 4XYQA 5M5YH 3KJPA 4A76A 2UUAL 1B9NA 4RMFA 1EQTA 2ASBA 1HH2P 4DV2Q 1K73C 5LMUL 2JA6H 3DWQA 4RCOA 1BUVT 3RN5A 2UUAQ 4HJAA 3IAYA 1I4RA 3FPPA 3MWYW 5EAYA 3D6CA 4A3IB 4BA2I 4FXGC 1F2MA 3IL8A 4JBWA 4PMWA 3KLSA 2RA4A 4A3CH 2B63H 1TWGH 1PVOA 4UDUC 4BY1H 1HTPA 1I4PA 4K6LA 4YCVA 4IFDI 1IBKQ 1EIYB 5EPLA 4A3FH 5I2XA 2NVQB 3J7YW 1ONLA 5FOBB 1PHJA 3AEVA 3H0GH 2B63B 2NN6G 1SYGA 5IGFA 1QZHA 2UUCL 1EY6A 3NBIA 1FD7D 2E2JH 2E2IB 1TT2A 1YEZA 4S3SA 3BZCA 4UP7A 2FINB 1EWHA 1QVFA 5BR8Q 1TWHH 1PFMA 3M85A 3S17B 4FF3A 4A3GB 2EYPA 5LHY1 4HIDA 3RZOB 1OXUA 2ZM6L 3HOYB 2KCCA 1CKNA 1SE8A 1FL0A 3ULJA 2CW0D 1TU2B 1JE5A 2QDLA 3HEJA 4X3UA 1ENFA 2F1MA 1HUMA 1EZ6A 3S9WA 1SE4A 3TQYA 2F0SA 1ICWA 3PUWA 3W1GA 4XQNA 1Y1WG 1GM5A 2K7VA 1YNXA 3BYTB 2R61A 1HFNA 3FRPB 4Y52H 1JT8A 3T1HL 3K58A 4GOPC 2BH8A 4RGMA 2HCCA 4K5VA 1KLUD 1JWUD 5GQOA 1YJWA 1EYCA 5M3MG 4NMZA 4AYBE 5I6WA 4GOPA 3I56A 1H9JA 1X65A 4IFDH 5M5XB 2DJGC 5M5WH 2K50A 1S5ED 5LL6X 4LW1A 1QE6A 2ZJQA 1PZID 3DWPA 1SE3A 5IP9G 1CUKA 4TSSA 1Q12A 3PUZA 3A5UA 3IRBA 2RSOA 4IURA 2E8GA 1VQIA 3HS0C 2I46A 4LF4L 2RDHA 3CCLA 4FP5D 4A3LH 1GUWA 1HJPA 1A15A 3K6OA 3Q23A 4LF7Q 3E5SA 5C4XG 1V1PB 2WFWA 4V190 5EQ0A 1AEXA 2A73B 2AMCB 4X65Q 4K6DA 4DV7L 1MSHA 3BDLA 1O7ZA 1XMQQ 1F9QA 2M2LA 3VR2A 5FJ8G 3T16A 4K0KQ 2HDLA 3HOZB 4A4IA 3HKZE 1PFNA 5CV8A 1U4MA 2JQOA 1S5DD 5L37A 3J81j 4R9WA 4X3SA 3HRZC 3TRZA 2KCMA 2L4NA 2HIVA 4BBRB 2WB1E 3I72A 2Z6BA 3EIVA 5I2YA 3MA2B 4GN4B 2K01A 3RLFA 3HOYG 3PUYA 1LLRD 4A3MB 3KDFA 2UU9L 3SEBA 4MNOA 2RHQB 2H4OA 4JCVE 2B8GA 3HOVG 1S3OA 3J7ZC 2O2LD 1MKHA 3F8TA 2I0QA 2JA5G 2EVBA 3U4ZA 2HT1A 5K36H 1PH1A 4R8NA 2IW3A 3AB9A 3GTQH 1SMYD 3TS0A 1L1OC 3FMCA 4NXML 4CKEA 5IWAL 5D14A 2QF7A 2XWBB 3X3NA 5I6YA 2QA4A 4DV3L 1YITA 3Q24A 1O7IA 4KJOA 2IJ0A 1U4RA 1BBUA 2PW5A 3WOFA 1PH4A 3K7UC 1ZYRD 4KKUA 3QG1A 1NY4A 4EQNA 4DV2L 4DK0A 3CCUA 1A8VA 3BJUA 4BY1G 1I50H 1EY7A 4KV6A 1EZ8A 1FYCA 4BY7G 4A3FG 1H9RA 1CSPA 4A3BH 2TMPA 1LO5D 4OELB 1BO0A 1PH5A 1ENAA 1SBBB 3G4SA 3SK8A 1KL9A 4L6TB 2NVXH 1XPRA 4JC0A 4CKBA 3CRKC 4C56C 1EFID 3Q0AA 4RG1A 2DUDA 1EL0A 4RWSC 2EE1A 4Y7NB 1CKNB 1X32A 1JCKB 2RDFA 3T1YL 1Y69U 4OWTB 4H7BA 2JA9A 4IJHA 5A35A 2NVYH 4R8IA 5DLQE 4IUVA 2CH4W 3GDEA 4G4KA 2SDFA 3A8KE 4DN4M 5LL6S 1CFMA 3DMUA 1XMOQ 3I7FA 4JW0A 1HUNA 3WOEA 2G9DA 1CA5A 4IUPA 2JN4A 2YV5A 2SNMA 2BOSA 1VQ9A 1V9PA 4C3HB 1VQDA 3A5ZB 3OW2A 2SNSA 3S2HH 1Y1WH 3OSOA 2N88A 4IUNA 2F4VL 4B3SQ 4OEMB 2WKCA 4IPCA 1EYGA 4UAIA 1LTBD 3JAME 3AU7A 4YWMA 5EKIA 2X69A 4R4QA 1EYAA 2R6GA 3NEMA 5FK9C 3KUPA 1VS0A 3NPPA 4HAEA 4JG2A 5ELDA 3GTJH 2UUCQ 1PZKD 5KNDA 2JSOA 4GN3B 5KIXA 4QIWE 5JOBA 4JBKA 4QY7A 3SVMA 2CWPA 2BE5D 2PW7A 3CC4A 2HHHQ 2CFMA 3FKIB 3T4AC 1EWIA 3J7AF 1KIXA 2XGTA 4XIGS 4JI3L 3I91A 1ESRA 1BVSA 2P5ZX 4DK1A 2K4KA 1QILA 4JI3Q 4JV5Q 2A6HD 3T53B 4K8IA 4EQ5A 1X6OA 1SMYC 3CPFA 4YY3Q 2QGQA 4FYDA 3W2DA 1G51A 5IYDG 3ZYYX 3EA6A 3IFDA 3FP9A 4EGVA 1J8IA 5BN4A 2E2HH 3EQLC 4PQXA 3SHLA 2B3GA 4DV0L 2F0TA 2VW9A 1EFWA 3S2DH 3J81L 2B29A 4HSPA 2M9VA 1G2SA 4GLXA 1LT3D 2K5WA 1DOLA 1XNQL 1S5FD 2N3SA 1VQHA 4K8JA 3VDYA 3BG3A 3GP7A 3MAQA 1VDZA 4FVMA 3LWUA 3I70A 3G71A 3C2PA 5DNFA 3HOVH 2KHJA 4JYAQ 1IW7D 1U9RA 2WACA 3R8BA 2TSSA 4A3DB 1BR9A 3DWAA 3GTOB 4C2MB 2D0PA 4IPGA 3HOWG 1UE7A 1B8AA 1EY0A 1MBYA 2E2JB 4X66Q 2XRSD 1QCBD 4B3SL 4L5RC 3NQTA 3URYA 3S24A 1SNMA 3I4NH 1JJGA 3DEOA 1LABA 3D4WA 3UDIA 4DNIA 3QOJA 1V1OA 3AFPA 3OOCA 1I5FA 5CV7A 1PH3A 3H09A 1LACA 4BBSB 1WTRA 4RHRA 1K28A 5ELOA 5J1ZA 2A69D 1MGSA 3ULLA 4BY7H 2MFIA 3TBIB 2DNCA 4I7ZC 1WTVA 4DXGA 4I7AA 1J6QA 3TP6A 3AYHB 2Y0SG 1YHQA 2F0QA 3FEWX 1VMPA 1VQKA 2K33A 5M5YB 4GOPB 1E22A 5JPNC 3P75A 1TS4A 1JWMD 5HY6A 4DXFA 4DV5L 1BXTA 3J80E 3F2BA 4CJ2C 1HXYD 4DR6Q 3LX0A 4E6IA 2K52A 2K6AA 2D0OA 3VYRA 4F87A 2PMZE 1AH9A 4LK1C 1DOKA 4JI0Q 1NR4A 1BF4A 1STBA 2EJGC 1AFPA 1X3PA 3PO3H 4EQPA 1SJHD 1J5EQ 5J22A 1D5ZC 4IUTA 3UE0A 5H1SE 4YIJA 3CD6A 5C44B 2KUMA 1YI2A 5C4JH 2KOLA 1BCPF 2L9HA 3BU2A 2LY7A 5JJKA 2NUCA 1EY5A 3E0JA 3UDFA 1W2BA 1QB5D 1NNXA 3HOXG 5CGKA 1XWEA 1WD0A 2A6HC 3S1RB 4MHEA 2O4XA 3G48A 2Q2IA 1KNEA 1TS3A 2Z6KA 4A93H 3HOZG 2Z4HA 2F0IA 1BBWA 4QCLA 2ZTEA 2B2WC 2AUKA 2XRQD 4YHHL 4ZKCB 3CKIB 4CJ1B 4BBSH 4CJ0B 2NZ1D 4XQJA 2R92G 4XQQA 1AE2A 1VQBA 2F0VA 2A69C 1D6EC 2OQKA 3G7LA 2XTIA 3S1MB 4PZ7A 1KRTA 2EZVA 1K0RA 1A2UA 2I07B 5E1FA 1IBLQ 3V96A 3DUZA 4L5TA 3IFTA 4TKOB 2JA7B 2F3WA 2DJFC 3M3YB 2SEBD 3TP8A 1ZYRC 5KYIA 3ICEA 1UWVA 2CQAA 3SK5A 2A5HA 3H91A 2LXKA 1MD2D 4P74A 1NUCA 1TY0A 4TVAB 3KF6A 1UEBA 1VQEA 2ID0A 5IYDH 1GUTA 3PGZA 1YZ6A 5C44H 1FR3A 1KDCA 2YYZA 3HOXB 1C7YA 3AQQA 5CBEE 1I4HA 3TMEA 4AIMA 4HR7B 1L1OB 2WKDA 1JMCA 3LNNA 2F0MA 2HHHL 2EYLA 4HJ5A 4OIJA 5ELBA 4POFA 1UE5A 4P71A 1OXSC 3K59A 2R93G 1EY4A 4IZ8A 3D3RA 2IPKD 2K14A 1JB3A 2JXMB 1HQRD 1PTOH 1U5KA 5TSSA 2NYZD 3U9SA 1EU4A 1YNJC 5C3EH 3J80L 4DF7A 1ZXTA 4AYBB 2KEDA 3GTMH 2LXJA 3F1ZA 4HTHA 4CHTB 2CWAA 1J5EL 4DV1Q 1OO9B 4GNXB 4X64Q 3L2PA 3RZOH 3RN2A 4ODGA 3C46A 1OXTA 2X6LA 2E74C 3DM1A 1IYVA 1IBKL 5M3FG 1CHQD 1YNNC 1D1KA 1N9WA 1I94L 2F0WA 4JVZA 3E9IA 1WTQA 5C4HA 1WTWA 4JBJA 5T1IA 4JI7L 2FMCA 4RGNA 2NB0A 1SR3A 5IODA 2PQEA 4R4OA 2OXPA 1QVGA 2YU9B 4LJZC 2Q8TA 1H9SB 2UUBQ 4POGA 4A3IH 4FF4A 2A8VA 2IX1A 5J39A 2UUBL 4WORA 1KHIA 2PNRC 2I5MX 3SE0A 4DR4Q 2B2UA 3FVQA 5D3IB 4DV0Q 1A2TA 4OONA 5G3LD 3BS1A 1X3QA 1VQAA 1TS5A 3STBD 5M3MB 1LTGD 1WTOA 2CVRA 3STBC 3M4QA 2H1EA 2PPBC 1Q82C 1XNQQ 2JA6B 2VUMG 3RNUA 4BA1I 1IBLL 3W3AA 1JOQA 3K81C 4ABNA 1I4QA 1XPUA 4P72A 3NTIA 2IT1A 5AFWA 4OHJA 2EYOA 4DU9A 3S17H 4XTCS 3PMFA 3NHHA 4DR6L 3TS2A 1AZPA 2L15A 2XIWA 1HFGA 3K7AB 1TWAH 4A3JB 1JE4A 3PO3G 3F2UA 5IGDA 4FDBA 2ES2A 4OO1G 1TWHB 5G3LF 3A74A 4FXDA 1Z47A 4ID6A 2JP1A 3E9HA 5JVH3 4FF2A 2EYJA 2B2TA 3J81c 4A3GG 5FKAC 4JPBW 1D5MC 3LWEA 4JI6Q 4DUYQ 1UUPA 4K2LA 5CV9A 1ZKOA 4ZCKA 1IZ6A 4R4TA 4Y7NH 1YHAA 4MZ9A 3KBXA 1EEID 1QVCA 2NVXB 4RFBA 4A93G 1NBWA 4HMJA 1BQQT 2ZXPA 4DUZL 3S1MH 1JWSD 2NN6I 4BS9A 1CM9A 1M1KC 3D6WA 5IYBG 4OO1I 2K5HA 4LFBL 2F0LA 2R92H 4PZ8A 3U50C 2XN9C 4HMIA 4GKJQ 2Z6KC 1IHZA 3K5OA 1FJGL 1KLGD 2B2VA 1X54A 4AQYL 1E2VA 2JE6I 3S16H 1HA6A 1IYUA 4JI4L 4QB4A 3PIO3 1K8MA 1HA5A 5C3EB 1S4ZA 2IL8A 4A3EB 4HCEA 3V05A 3QB3A 1PRTC 4FF1A 3L7ZC 3ULPA 3FKIG 2EYMA 2F4IA 3DXJC 2QDBA 2PZWA 2PYKA 4L5QA 4JYAL 4EVOA 4NDXA 3RR5A 3CMAA 3BDCA 4HIOA 4Q5VA 2MUYA 3V2TA 1B7YB 3PO3B 4ZUJA 2PNHA 3MXPA 3S1NH 1EIFA 2K28A 2Q2TA 2BA1A 1STYA 3F2DA 1HTLD 4DR2L 1AZQA 4IN3A 3EJIA 4A3CG 3E0EA 3RZDB 2B63G 3S1NB 2R93H 1G91A 4RH6A 2L0CA 4MN3A 3JAML 4XXEA 4PMCA 3VR3A 1EOTA 1I3QH 2ENBA 1N8RC 2NN6H 1YJNA 1N32Q 2QEJC 1RIPA 5CORA 5DEHA 2FFKB 5I9PA 3HG9A 3K80C 3B6YA 5ELFA 2JJQA 4RCNA 3FHWA 1HR0Q 4K14A 3I73A 1TWCH 1U0LA 3OHXC 1PXUA 2VS1A 3RMHA 1E1OA 1NR2A 1FNWA 2MO1A 2VL6A 2MQHA 4ZLTF 3MHBA 4LFCQ 1VQMA 4A3KB 1A3VA 1JQYD 1PYSB 1IBMQ 4RGOS 4GLVB 2KVMA 1C48A 2B2VC 1I4GA 1SNPA 4KHZA 2DN8A 3KLSX 1X3GA 3QJYA 5C0XG 4QUFA 3BZDB 3OPOA 3UE1A 4DV1L 4GKJL 3R3OA 4XYOA 1NMGA 3LGJA 4IUUA 5HGTA 3NTHA 5EPJA 1RTNA 5E7NA 1GVPA 3KF8A 3S15H 1JC7A 2PMZB 3HKSA 3OIQA 2ZTDA 1J9OA 4OX9Q 2UXCL 1SYFA 3GD7A 1E1TA 2VUMH 2RSNA 3PSIA 1V1QA 1TKWB 3ER0A 5FO7B 1Q8KA 3GTKB 1VQ7A 1VQLA 1YBYA 1DJRD 5E4XA 5ELNA 2ZM6Q 1STGA 4UPAA 5DAUA 1CSQA 4FXKC 3CC7A 5JJLA 2O5JC 4AH6A 3I3CA 2O5IC 2DY8A 1QWYA 3NXWA 3K7AH 1H9SA 2NWGA 5JEAJ 2EJFC 4UHVA 5C0XJ 2VQEL 5IP9H 3KDFB 4J1MA 4OGQC 1DZ1A 5KNBA 1YJ9A 4FO2A 4OWXB 1XYIA 1LT5D 4NW2A 2OF1A 2A74C 2VZAA 2E2DC 1F9SA 4A3GH 2JYOA 5DM73 1SXTA 2DNEA 1BNZA 4C3JH 4KN4C 2CCZA 4NXMQ 1Q8IA 3GTQB 2ICEC 2F0GA 5EPKA 1F2LA 3FDTA 4G7ZC 2KA7A 1GUSA 4IOAA 2EY6A 2B2UC 2EOTA 2CKZB 5M9OA 1S72A 1I4XA 1FNUA 3A56A 1BCPB 4LFAQ 5M5XH 2MPMA 3CCEA 4A3MH 2R93B 2NZOA 4MTKA 3VYTA 4WJ4A 3DLLA 2ALYB 1B4OA 4TQUS 1MSGA 5IT9c 1GJXA 2L55A 3J81i 1ASYA 1RDPD 5IGCA 5IT9E 1NAPA 1PMRA 1V1PA 1N34Q 2HIXA 2XNAC 2L11A 1PDQA 1F2YA 2E2HB 4DAPA 3P20A 3GTLH 1VQOA 2VNUD 2LSSA 1OXVA 3NE5B 4GNXC 4QF4A 3KK7A 1XNRQ 5ELEA 2F0UA 4ULLA 5FLXE 4LFBQ 4DR3Q 4DUZQ 1HHVA 2QW7A 1ET9A 2A1AA 4M1UB 1CTMA 2PQAB 1VQ4A 3GTLB 2JA8B 4KTAA 3SK4A 3GV3A 1D7QA 3FPUB 1F9RA 3H3VI 1SN8A 3QWNA 1TIID 3KBGA 1LT6D 2Z4IA 2HCIA 1B1ZA 1Y8OB 3UI2A 2R7ZH 1XMQL 4P75A 3NBHB 3MFGA 5E3FA 2F52A 3QO2A 4RKLA 4A3BG 2VQEQ 1HCZA 3ERSX 1IL2A 4CDCC 2R7ZB 1ILQA 4L8JA 3HOWB 1TQOA 1PTOF 1DOMA 5IE8A 1PYBA 3A55A 4B3RL 1PH7A 5JVG3 5C5LA 2MHVA 4KJNA 4QGUA 3U58A 4X65L 2SOBA 2ZXRA 1NMFA 1F2ZA 2CQOA 4K0KL 2CH4A 1KD1C 3I4MB 2UXBL 3GTJB 4KHPL 2HUGA 2K5NA 3T13A 1W6JA 3WDNA 3C1EA 1V8QA 1Q86C 1H9KA 3TEHB 3TP7A 2K03A 5LMNW 1I6VC 5CR3A 4LF8L 1SRUA 1P16A 5FO9B 2PZUA 3P7JA 2FMMA 2V4DA 5KNCA 3OYYA 2EDGA 1HNXQ 3BZKA 3H3VH 2A68C 3RZDH 2HQLA 3I4NB 1PTOB 1UE1A 4PMBA 1A63A 2X6GA 1RF2D 2FJ2A 3D8GA 4TRDA 4DV6Q 4A3EG 4KK7A 1GKHA 4A3DH 5FLMH 4U673 5GAEC 4DV6L 1IBML 2UXCQ 4EQOA 5JEAH 4KN7C 1RL2A 1N32L 1LTSD 1A3TA 1SNCA 4DR3L 3EVQA 1S40A 1SFOH 2YU9H 3UDXA 1SJED 2H5XA 5FLXL 2PO4A 2KENA 3D0FA 4IPHA 1VQCA 2BH2A 4DR7L 5HURA 2L5TA 1TXYA 3EBEA 1RODA 2K1BA 2A68D 4P2CB 4C3JG 2WB1G 3J80i 5IIFA 4EX5A 3SDZA 3PO2H 1FVIA 2F0KA 3KOJA 3MXNA 4PZ6A 4ME5A 4DR4L 4GKKQ 1WD1A 1II3A 1L0XB 4XDXA 3CCVA 2J7ZA 2RF4A 4JI5L 1HZAA 3K57A 4DR5L 4X6AH 4C3HH 2RCNA 1WFQA 2E2IH 4A93B 5IY0A 3S2HB 2AWNA 3RLNA 1O7LA 4LUVA 3R2TA 3GTKH 1LTLA 3S1RH 1BBXC 4LUZA 2RKSA 2K5DA 3H15A 1QNUA 1SNQA 4N8FA 4LF9Q 3CW2C 1O7YA 3L3OC 5D3DA 4CGYB 1K3BC 1TWAB 2PI2E 4JI1Q 5C4JB 1WVLA 2IHEA 3A54A 1HR0W 2IX3A 3I55A 4C1NK 4NP5A 1HNZQ 1B70B 3NTKA 5HGQA 3Q8DA 2F0PA 2Z0SA 5GAHC 4DV5Q 1X3EA 3H6MA 3M7GA 2ICIA 4DKAC 1IXRA 1RHPA 4N9TA 1RJTA 4V0BA 3OMCA 2ZTCA 1CT1D 3PF4A 1K0SA 2WIIB 1KC8C 3M3YH 2AWOA 2Q2UA 1XTCD 3CCJA 4GS3A 4RHSA 4B3TQ 4LFCL 4BXXG 1PH2A 4JI6L 2OWOA 4BY7B 3I8ZA 3ONAB 1ENCA 3I4NG 2B2YC 4WRDA 3K5LA 1GUNA 3DEPA 2JA5B 4NB3A 5IYCH 4J15A 3CAMA 2FXQA 1WCMG 4DGZA 2EQSA 1LTID 3KLWA 2Y0SB 4IFDJ 4R1JA 5I9OA 4DR1Q 2IWHA 1TR5A 4WJWA 1JJ2A 4CKCA 2OEOA 2N49A 1F77A 3H0GG 3K0YA 5KYLA 1KXLA 4LFAL 2MNAA 3BVGA 2NTSA 3JAMc 4PNYA 3OWFA 1WCMB 4JOIC 3GTGH 2N8NA 3X3MA 3ND8A 1SNDA 2A6EC 4IOCA 4BY1B 1WOCA 4B9WA 2VUMB 1SYCA 2Z1CA 3HOVB 1L0YB 3ITPA 1IYJB 1SSOA 3MXUA 1BDOA 2NTTA 4H02A 3J80c 3MVVA 3P1HA 2LKVA 1BCPD 1WI5A 1CQVA 1EIGA 2M00A 3MZ5A 1Q81C 1K8AC 2PI2A 1O78A 1TWFH 2F03A 1PZJD 4N9PA 3KJOA 2Q8RE 3GTMB 4IUQA 3S14H 2F0JA 3GV6A 2EPBA 1GHJA 3U4VA 1R4QB 3MXGA 4B3MQ 1KRSA 2WV6D 1VQJA 1X55A 2J4XA 1VQ6A 3CCQA 2F0OA 4QJFA 1DONA 3SR1A 1C4QA 4BBRG 4LF8Q 3KFUA 2KQ3A 2R7FA 3KF6B 4O1NA 4LF5L 1TWCB 1TWFB 4JI8L 4A3EH 5M3MH 3RUZA 3SXHA 2GVBA 5FLMG 2JEBI 3CQZB 3EROA 2E5LQ 4X66L 3S16B 2PQAA 3G6EA 4BBSG 5I4DA 1HRJA 4ZQ3A 1G6ZA 5BR8L 3CHBD 2E5LL 4RKBA 1VF5C 1B3AA 1BCPC 2L1BA 1GD7A 1JOOA 2K04A 4R4IA 1UE6A 3GTPB 2NVQH 2KBNA 2RDGA 3PF5A 1F9PA 2A6ED 5EBCA 4OL7A 1E2ZA 5LMNL 2WAQG 5T1GA 1TY2A 4WFN3 4MTNA 1G6PA 2LS01 3TSSA 1ASZA 3HZXA 4A3JH 1I50B 3PO2G 4APVA 5GADC 4L63B 5FJ8H 1KDBA 1QG7A 3QR8A 1B2TA 2AQ1B 5NUCA 1HQMC 5C44G 3OTOQ 4YWLA 3OWEB 1L1OA 3CU7A 4C3HG 1XJVA 4DFAA 3N52A 2DGYA 1KABA 1JICA 4HJ8A 2RVLA 1DYQA 4GKKL 2HDMA 5ISRA 4JI0L 1YIJA 1S5BD 2QCPX 3E3XA 4CDEC 5CBAE 2KEEA 1EQRA 1PV4A 3OW7A 1A6XA 3U9OA 3HOYH 1EIHA 1PRTB 4X3KA 4KKSA 5C3EG 4CDDC 1CI3M 3UDGA 4YHHQ 4R4CA 1X3FA 3M7NA 5EBDA 1Q3LA 3A7LA 3KYHC 2EY1A 3NSWA 1OTCA 4DK6C 1GHKA 1Q1BA 1XMOL 2A19A 3RD4A 1LM0A 4KD4A 4UY8C 2NVYB 4KHVA 1O80A 1PH8A 1QZGA 4M8AA 3M4OB 2NZHA 4JI1L 5CMDA 5K36G 1FJGQ 1DD2A 4G7HC 4PV1C 4N8X1 2C5CA 1B44D 2CHBD 5K5PA 1HNZL 1RD9D 1B50A 5DM63 1I94Q 5F2DA 3A0JA 4BXXH 3CQZH 1LTTD 4LF5Q 5EGTA 5JJIA 4GLAC 4DV3Q 2QILA 3TREA 3KLRA 4DAVA 1SYDA 3NUCA 5IYCG 2F0DA 5EKKA 1WCMH 5KRUA 4A3IG 1PRTF 3W5OA 4JOIA 1MI2A 3CMEA 1A0IA 4F8MA 3PIP3 2OCEA 1IKLA 4A3KH 1K8GA 1ZEQX 1Y8NB 1EUJA 5C4XB 1CKMA 4A75A 4B3TL 1KTKA 2F3IA 2XSCA 3EN2A 4XT1B 3T51B 2ATWA 1QNKA 3NBHA 1N36L 2DY7A 1SLJA 4KD3A 1N33L 3T1YQ 2K5VA 2B2YA 4QIWB 1Q1EA 3VR4A 1HNWQ 1YHBA 2AKWB 4J8QA 1P8LA 2I5LX 3IKJA 3EFXD 5IT9L 4OX9L 1LUZA 3HKZG 1XNRL 1JB7A 2F3VA 4HSVA 3PUXA 2D5DA 3OTOL 3R2IA 1EEFD 1MHWC 1TS2A 1SYEA 1FGUA 1I6HH 3NQIA 1KDAA 5COYA 5CV5A 2Q2HA 3RLOA 4ZAIA 1U4LA 1NCVA 1V43A 2MP1A 1E3PA 2EY2A 4DUYL 1LYLA 5LMUQ 1KAAA 4BBRH 2D9UA 4ZKBB 1SEBD 1JJCB 3D4RA 1K3RA 4JK1C 1M90C 1CKOA 1RTOA 4JV5L 4IO9A 4K5XA 2B2TC 1BKBA 3DHQA 3PO2B 4C3JB 3W1BA 2VQFL 1GXDC 5A2QE 1BOSA 3F2CA 1RKNA 5IYBH 1G8ZD 4LF7L 2QKIC 1STNA 3ND9A 1YNND 3PIPA 1PFBA 4KLKA 3L9AX 5M3FB 3S1QB 1A62A 4ZRZA 1NTGA 5IWAQ 1I3QB 1B9MA 2EIFA 3L0OA 2OTJA 2UXDL 1E0BA 3M4PA 4A3FB 4GNXA 4O2DA 4IPDA 1D2BA 1NSNS 2QEXA 5C3XA 3FKIH 4C1NI 2EY5A 1AP0A 3H0GB 4CDFC 1C8CA 3M4OH 4YCWA 2V1CC 4H13C 4A3JG 3NELA 1SE2A 1X9NA 3M9BA 5C0XI 2G5DA 1QOHA 2UU9Q 3C1FA 3H3VC 4K5WA 1C9OA 2Z9HA 1STEA 4HEDA 2VY3A 3TZUA 2GVAA 1GOZA 2MGSA 3T56B 3C3LA 3DM3A 4B08A 2XVSA 3PIOA 4LWCA 3GQBA 5AJ3Q 4DR1L 1Y1WB 2JA8H 1EOVA 2PZTA 1EQVA 2KCNA 4C3IG 5IOCA 4OWWB 2K32A 3MC0B 3A8IE 1K83H 1E24A 1SYBA 1MJEA 1Y1VH 2KECA 1UAPA 1PTOD 3N6RA 1HR0L 2E75C 4JBMA 3I4MG 4L5SA 1AN8A 5ELCA 1YVCA 5GAGC 3HOWH 2JEAI 4K2KA 4C2MH 1D1IA 1JR0D 5M5WB 3D4DA 4X62Q 4H0LC 2LFNA 5CC4A 1DGSA 4DV4L 2JK8A 1IL8A 2RBMA 3PUVA 3VR6A 2VQFQ 2ZJPA 3GTOH 5EKLA 4NPSA 5C5MA 4LMQD 3WWVA 2HQEA 4DV4Q 5KEEA 2WP8J 4B3ML 1CQFA 5C0XH 1HZ9A 4AQYQ 1IW7C 2RHSB 3CPWA 2YTVA 5A2QL 3MEFA 1DXMA 4A3KG 2Q8IB 3CF5A 4YCUA 3K8AA 2L12A 1FNVA 5E4WC
chains in the Genus database with same CATH topology
3STBC 4LUVA 3M4QA 3GTKH 1XNQQ 1LTLA 3S1RH 1Q82C 4LUZA 2VUMG 2D62A 3EIVA 4BA1I 3RNUA 1IBLL 4GN4B 3H15A 3I2ZA 4JI8Q 3RLFA 4QL5A 2JA7G 3K81C 3HOYG 4KHPQ 2C35B 3PUYA 4P73A 4LF9Q 1G291 2UU9L 3KDFA 3CW2C 4MNOA 1XPUA 1VCIA 4P72A 1PH9A 1KAWA 2RHQB 3CP0A 4JI1Q 2PI2E 1MIUA 4NXNL 2IT1A 4JCVE 3I4OA 2IHEA 3HOVG 1S3OA 3J7ZC 4DAMA 1HR0W 3I55A 3S17H 1HNZQ 4AYBG 3F8TA 1MKHA 1B70B 5HGQA 3Q8DA 2Z0SA 5GAHC 4DV5Q 2BA0A 1X3EA 4XTCS 4DR2Q 2I0QA 2JA5G 1X56A 3U4ZA 4DKAC 1IXRA 1AE3A 2HT1A 1PH1A 2L15A 1L0WA 3CXCA 3PO3G 1TWAH 3TS2A 2ZTCA 1QUQB 3GTQH 3PF4A 4FDBA 1KC8C 2ES2A 3M3YH 4OO1G 2AWOA 3TS0A 2Q2UA 1L1OC 3A74A 1Q46A 1Z47A 4GS3A 3CCJA 2KHIA 4NXML 4HJ9A 1N36Q 5IWAL 3GTPH 3E9HA 4B3TQ 5IP7G 2QA4A 4LFCL 4BXXG 1PH2A 4JI6L 4DV3L 1YITA 2OWOA 1N33Q 1O7IA 3I4NG 3J81c 4A3GG 1SMXA 3GO5A 1BBUA 1PH4A 3K7UC 4JI6Q 4DUYQ 4NB3A 3HOXH 1XTDA 1IZ6A 4J15A 4R4TA 5IYCH 4ME3A 3CAMA 2FXQA 1YHAA 1NY4A 4MZ9A 1WCMG 4Y7NH 4DV2L 1PA6A 2EQSA 3KLWA 1QVCA 1K9MC 3CCUA 1A8VA 3BJUA 4BY1G 3HOUH 1I50H 4R1JA 4IFDJ 4A93G 1NBWA 3HOZH 3PCOB 4DR1Q 3CCSA 4BY7G 4A3FG 1CSPA 4DUZL 3S1MH 4A3BH 1JJ2A 2KCTA 1PH5A 2N49A 2NN6I 3H0GG 1EQQA 1M1KC 5IYBG 4OO1I 1KXLA 4LFAL 2MNAA 3G4SA 2IHFA 2K5HA 4LFBL 4X64L 1KL9A 3JAMc 4PZ8A 3U50C 2NVXH 2R92H 4JI2Q 4JOIC 2Z6KC 4JC0A 4A3MG 1XPRA 2N8NA 3GTGH 4GKJQ 2OTLA 1FJGL 4RG1A 1C0AA 4IOCA 2DUDA 5GROA 1X54A 4AQYL 1CKNB 2JE6I 1WOCA 4IJLA 1NE3A 3S16H 1SROA 4OXPA 3T1YL 4JI4L 4OWTB 2JA9A 4YY3L 4IJHA 1N34L 1VQPA 1IYJB 4LF4Q 3CC2A 4LF6L 2NVYH 4H02A 3J80c 2N78A 5DLQE 3GDEA 3L7ZC 3ULPA 1WI5A 3FKIG 1QUQA 3NENA 1K8AC 4JI7Q 4L5QA 4ALPA 2PI2A 1XMOQ 3I7FA 1Q81C 1TWFH 4JYAL 2I5HA 3RR5A 3KJOA 2YTXA 3CMAA 4DR5Q 4HIOA 3S14H 2AHOB 2IY5B 2YV5A 1VQ9A 3U4VA 1B7YB 4B3MQ 2PNHA 1KRSA 1V9PA 3S1NH 1EIFA 1VQDA 3A5ZB 4DR6L 2JA6G 1VQJA 1X55A 3OW2A 4QQBX 2Q2TA 3S2HH 1VQ6A 3CCQA 2BA1A 1Y1WH 4QJFA 3F2DA 4BBRG 4DR2L 2F4VL 4LF8Q 1VQFA 3KFUA 3KF6B 2R7FA 4B3SQ 4LNQA 4LUOA 4A3CG 3E0EA 4IPCA 2B63G 3T1HQ 2R7ZG 4LF5L 2R93H 1EYGA 2F4VQ 3JAMi 4NXNQ 4YWMA 1PFSA 2GN5A 1Z9FA 4JI8L 4A3EH 5M3MH 4R4QA 2R6GA 3NEMA 1OXXK 2GVBA 5FLMG 4YWKA 1I3QH 2JEBI 2E5LQ 4X66L 2PQAA 3G6EA 1N8RC 4JI5Q 2JA8G 4BBSG 2K75A 1YJNA 4C3IH 5BR8L 1VS0A 3GTJH 2UUCQ 4JG2A 3ZJYC 2E5LL 1N32Q 4UP8A 1RIPA 4PG3A 4GN3B 1Y1VG 5AJ3L 3K80C 4QIWE 3B6YA 1WJJA 4QY7A 2JJQA 4JBKA 1GD7A 2CWPA 3FHWA 1HR0Q 3I4MH 1TWCH 1U0LA 4R4IA 1UE6A 1VQNA 5M3FH 3CC4A 2NVQH 1R9TH 2UXDQ 2HHHQ 2VS1A 2CFMA 2UXBQ 1E1OA 2MO1A 2VL6A 1D8LA 2MQHA 2KBNA 1EWIA 4LFCQ 1VQMA 4HIKA 3PF5A 1KIXA 2XGTA 4XIGS 4JI3L 3KF8B 3AFQA 1PYSB 3CCRA 1Y14B 1IBMQ 1BVSA 5LMNL 2WAQG 4GLVB 1GO3E 2K4KA 4MTNA 1G6PA 1ASZA 4JI3Q 4JV5Q 4A3JH 4JI4Q 4KHZA 3CCMA 3PO2G 4APVA 1X6OA 4EQ5A 3CPFA 5FJ8H 4YY3Q 2QGQA 5GADC 1X3GA 1G51A 5IYDG 3D31A 5C44G 5C0XG 3UE1A 3OTOQ 4YWLA 4DV1L 3FP9A 4JI2L 1L1OA 4GKJL 1NMGA 3LGJA 1H95A 1XJVA 2E2HH 5E7NA 1GVPA 2DGYA 3S15H 3HKSA 2B3GA 4HJ8A 4DV0L 2ZTDA 4B3RQ 2VW9A 2WAQE 4OX9Q 4GKKL 1EFWA 2UXCL 3S2DH 2B29A 4JI0L 3GD7A 4GLXA 1E1TA 1YIJA 2VUMH 3PSIA 4LF6Q 3SGIA 1XNQL 2N3SA 1PV4A 1V1QA 2IX0A 1VQHA 1EQRA 3ER0A 2R7DA 2JA7H 3HOYH 4A3DG 3VDYA 4IFDG 1Q8KA 1VQ7A 1VQLA 5C3EG 4X62L 2EXDA 3UDGA 5JEAG 1YBYA 4YHHQ 4R4CA 1X3FA 5ELNA 2ZM6Q 4UPAA 3M7NA 3KYHC 1CSQA 3G71A 3CC7A 2ZJRA 5JJLA 4AH6A 3HOVH 1OTCA 2KHJA 4DK6C 1KQSA 3K7AH 1Q1BA 5JEAJ 2A19A 2VQEL 1LM0A 5C0XJ 1XMOL 5IP9H 4UY8C 3KDFB 4JYAQ 1PH8A 1QZGA 2NZHA 4JI1L 1YJ9A 5K36G 1FJGQ 3JC66 4OWXB 3J7A5 2D0PA 2MO0A 4IPGA 3HOWG 1UE7A 1B8AA 1HNZL 4X66Q 4DV7Q 1HNXL 2VZAA 4B3SL 1I94Q 4A3LG 1NJIC 1HZBA 1W3SA 3A0JA 5IP7H 1VQ5A 3CQZH 4L5RC 5C4XH 4BXXH 1WYDA 4LF5Q 1VQ8A 3S24A 4GLAC 5JJIA 4DV3Q 3I4NH 4A3GH 1JJGA 1HZCA 3TREA 4DNIA 3UDIA 3PV0A 2Y0SE 3AFPA 1PH3A 1E7ZA 1I5FA 4C3JH 2CCZA 4NXMQ 5IYCG 3MXNB 1WCMH 4HJ7A 4UP9A 4DPGA 4A3IG 5ELOA 3W5OA 4JOIA 3CMEA 3HOUG 1HNWL 4IOAA 3ULLA 4BY7H 2MFIA 1A0IA 1Q7YC 4WJ3M 2OCEA 2CKZB 1T9HA 1S72A 4A3KH 3K0XA 5LMNQ 1J6QA 1K8GA 1EUJA 3AYHB 1CKMA 1L2FA 4GN5A 4A75A 4B3TL 3EN2A 2F3IA 2Y0SG 4LFAQ 5M5XH 4DK3C 1YHQA 3CCEA 4A3MH 2NZOA 1VQKA 2ATWA 2YTYA 1N36L 1XPOA 4LF9L 3DLLA 4WJ4A 4GOPB 1SLJA 3S1QH 2ALYB 1E22A 5IT9c 4TQUS 1N33L 5HY6A 3J81i 4DV5L 1ASYA 4DAYB 3T1YQ 2NVTH 2K5VA 1Q1EA 3HFZB 3F2BA 1YHBA 2AKWB 4DR6Q 1HNWQ 2OQ0A 2K52A 1P8LA 1N34Q 2HIXA 1VQGA 2D0OA 2I5LX 5FLXc 1PH6A 4OX9L 2PMZE 1LUZA 3HKZG 1XNRL 3GTLH 1JB7A 1VQOA 1AH9A 2VNUD 4JI0Q 3PUXA 2JA5H 4O0AA 3OTOL 4HIMA 2LSSA 1OXVA 4KI0A 4GNXC 1XNRQ 3PO3H 1MJCA 5J3BA 4LFBQ 4DR3Q 1J5EQ 4DUZQ 3UE0A 5H1SE 3CD6A 4DR7Q 2A1AA 1FGUA 5M5YH 3KJPA 4A76A 1I6HH 2UUAL 4RMFA 1YI2A 2PQAB 2ASBA 2Q2HA 3RLOA 5C4JH 1VQ4A 1HH2P 4DV2Q 1K73C 5LMUL 3BU2A 1V43A 2JA6H 5JJKA 1D7QA 3RN5A 3H3VI 2UUAQ 4HJAA 1E3PA 3UDFA 1W2BA 1SN8A 4DUYL 1LYLA 5EAYA 4BBRH 5LMUQ 4BA2I 3HOXG 4JBWA 4PMWA 1JJCB 1K3RA 4A3CH 2B63H 1XMQL 2R7ZH 3G48A 1CKOA 1TWGH 2Q2IA 1M90C 4JV5L 1PVOA 4IO9A 4P75A 4BY1H 3NBHB 2Z6KA 4A93H 3HOZG 4IFDI 4YCVA 2F52A 1IBKQ 1BKBA 4A3FH 1EIYB 1BBWA 2VQFL 2ZTEA 3W1BA 2VQEQ 4A3BG 4YHHL 3ERSX 1IL2A 1PHJA 3AEVA 3H0GH 3F2CA 4BBSH 5IYBH 2NN6G 4LF7L 2R92G 3PIPA 1AE2A 1QZHA 1VQBA 5IE8A 2UUCL 1PYBA 4B3RL 1PH7A 4KLKA 2E2JH 4QGUA 1YEZA 3U58A 4X65L 3BZCA 2OQKA 4UP7A 1A62A 1QVFA 1NMFA 2XTIA 5BR8Q 1NTGA 1TWHH 4PZ7A 1KRTA 5IWAQ 1K0RA 3M85A 2CQOA 4K0KL 2EIFA 3L0OA 2OTJA 2UXDL 1IBLQ 1KD1C 2UXBL 4HIDA 3M4PA 4GNXA 4O2DA 4IPDA 4L5TA 1OXUA 4KHPL 2QEXA 2K5NA 2ZM6L 3FKIH 1CKNA 1SE8A 3ICEA 1FL0A 1UWVA 3ULJA 1Q86C 2LXKA 4P74A 3TEHB 3M4OH 1JE5A 4YCWA 2V1CC 5LMNW 4A3JG 4TVAB 3KF6A 1SRUA 1P16A 1UEBA 1VQEA 2ID0A 3NELA 4LF8L 1X9NA 3M9BA 5IYDH 5C0XI 3PGZA 1YZ6A 5C44H 2YYZA 3OYYA 3AQQA 1C7YA 2UU9Q 3TQYA 1HNXQ 3BZKA 4AIMA 3PUWA 3W1GA 3H3VH 1L1OB 1Y1WG 1C9OA 1GM5A 1JMCA 3RZDH 2HQLA 1YNXA 2HHHL 1UE1A 4HJ5A 2VY3A 1A63A 4Y52H 1JT8A 2GVAA 4POFA 3T1HL 1UE5A 4P71A 1OXSC 2BH8A 4GOPC 2R93G 3DM3A 2K14A 3PIOA 4LWCA 4DV6Q 4A3EG 5GQOA 1YJWA 5M3MG 4GOPA 4AYBE 1GKHA 3I56A 1X65A 4A3DH 5AJ3Q 1U5KA 4DR1L 5FLMH 5C3EH 5GAEC 5M5WH 4DV6L 1IBML 2UXCQ 2K50A 2JA8H 1EOVA 1RL2A 3GTMH 1N32L 2LXJA 3F1ZA 2CWAA 4DR3L 1J5EL 4OWWB 4DV1Q 4LW1A 4GNXB 1S40A 4X64Q 1K83H 3L2PA 1E24A 1MJEA 1SFOH 1Y1VH 2ZJQA 3RZOH 3RN2A 2YU9H 3UDXA 5IP9G 1HR0L 1CUKA 2H5XA 1Q12A 1OXTA 4JBMA 2KENA 4L5SA 3I4MG 3PUZA 3A5UA 3D0FA 3IRBA 1YVCA 1VQCA 2E8GA 1VQIA 4IPHA 5GAGC 5M3FG 1IBKL 2BH2A 3HOWH 4DR7L 1TXYA 3EBEA 2JEAI 4LF4L 3CCLA 4A3LH 4C2MH 1HJPA 4LF7Q 1N9WA 1I94L 5C4XG 3E9IA 2WFWA 4X62Q 4JBJA 1DGSA 4JI7L 4DV4L 2AMCB 1SR3A 2JK8A 4X65Q 4DV7L 3PUVA 2WB1G 3J80i 2VQFQ 2ZJPA 4R4OA 4EX5A 1QVGA 1XMQQ 3GTOH 4NPSA 4DV4Q 3WWVA 3PO2H 2UUBQ 4POGA 1FVIA 2WP8J 3KOJA 5FJ8G 4PZ6A 4A3IH 4K0KQ 4B3ML 2A8VA 4DR4L 2IX1A 4A4IA 1HZ9A 3HKZE 4AQYQ 4GKKQ 3CCVA 2UUBL 2JQOA 2RF4A 4JI5L 1HZAA 2RHSB 1KHIA 3CPWA 2YTVA 3J81j 4DR5L 4X6AH 3MEFA 2I5MX 4C3HH 4DR4Q 2RCNA 4DV0Q 1WFQA 2E2IH 3TRZA 4A3KG 5IY0A 2KCMA 4OONA 2HIVA 2WB1E 4YCUA 3CF5A 3K8AA 1VQAA 3STBD 2AWNA 3RLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STB C;  4LUV A;  3M4Q A;  3GTK H;  1XNQ Q;  1LTL A;  3S1R H;  1Q82 C;  4LUZ A;  2VUM G;  2D62 A;  3EIV A;  4BA1 I;  3RNU A;  1IBL L;  4GN4 B;  3H15 A;  3I2Z A;  4JI8 Q;  3RLF A;  4QL5 A;  2JA7 G;  3K81 C;  3HOY G;  4KHP Q;  2C35 B;  3PUY A;  4P73 A;  4LF9 Q;  1G29 1;  2UU9 L;  3KDF A;  3CW2 C;  4MNO A;  1XPU A;  1VCI A;  4P72 A;  1PH9 A;  1KAW A;  2RHQ B;  3CP0 A;  4JI1 Q;  2PI2 E;  1MIU A;  4NXN L;  2IT1 A;  4JCV E;  3I4O A;  2IHE A;  3HOV G;  1S3O A;  3J7Z C;  4DAM A;  1HR0 W;  3I55 A;  3S17 H;  1HNZ Q;  4AYB G;  3F8T A;  1MKH A;  1B70 B;  5HGQ A;  3Q8D A;  2Z0S A;  5GAH C;  4DV5 Q;  2BA0 A;  1X3E A;  4XTC S;  4DR2 Q;  2I0Q A;  2JA5 G;  1X56 A;  3U4Z A;  4DKA C;  1IXR A;  1AE3 A;  2HT1 A;  1PH1 A;  2L15 A;  1L0W A;  3CXC A;  3PO3 G;  1TWA H;  3TS2 A;  2ZTC A;  1QUQ B;  3GTQ H;  3PF4 A;  4FDB A;  1KC8 C;  2ES2 A;  3M3Y H;  4OO1 G;  2AWO A;  3TS0 A;  2Q2U A;  1L1O C;  3A74 A;  1Q46 A;  1Z47 A;  4GS3 A;  3CCJ A;  2KHI A;  4NXM L;  4HJ9 A;  1N36 Q;  5IWA L;  3GTP H;  3E9H A;  4B3T Q;  5IP7 G;  2QA4 A;  4LFC L;  4BXX G;  1PH2 A;  4JI6 L;  4DV3 L;  1YIT A;  2OWO A;  1N33 Q;  1O7I A;  3I4N G;  3J81 c;  4A3G G;  1SMX A;  3GO5 A;  1BBU A;  1PH4 A;  3K7U C;  4JI6 Q;  4DUY Q;  4NB3 A;  3HOX H;  1XTD A;  1IZ6 A;  4J15 A;  4R4T A;  5IYC H;  4ME3 A;  3CAM A;  2FXQ A;  1YHA A;  1NY4 A;  4MZ9 A;  1WCM G;  4Y7N H;  4DV2 L;  1PA6 A;  2EQS A;  3KLW A;  1QVC A;  1K9M C;  3CCU A;  1A8V A;  3BJU A;  4BY1 G;  3HOU H;  1I50 H;  4R1J A;  4IFD J;  4A93 G;  1NBW A;  3HOZ H;  3PCO B;  4DR1 Q;  3CCS A;  4BY7 G;  4A3F G;  1CSP A;  4DUZ L;  3S1M H;  4A3B H;  1JJ2 A;  2KCT A;  1PH5 A;  2N49 A;  2NN6 I;  3H0G G;  1EQQ A;  1M1K C;  5IYB G;  4OO1 I;  1KXL A;  4LFA L;  2MNA A;  3G4S A;  2IHF A;  2K5H A;  4LFB L;  4X64 L;  1KL9 A;  3JAM c;  4PZ8 A;  3U50 C;  2NVX H;  2R92 H;  4JI2 Q;  4JOI C;  2Z6K C;  4JC0 A;  4A3M G;  1XPR A;  2N8N A;  3GTG H;  4GKJ Q;  2OTL A;  1FJG L;  4RG1 A;  1C0A A;  4IOC A;  2DUD A;  5GRO A;  1X54 A;  4AQY L;  1CKN B;  2JE6 I;  1WOC A;  4IJL A;  1NE3 A;  3S16 H;  1SRO A;  4OXP A;  3T1Y L;  4JI4 L;  4OWT B;  2JA9 A;  4YY3 L;  4IJH A;  1N34 L;  1VQP A;  1IYJ B;  4LF4 Q;  3CC2 A;  4LF6 L;  2NVY H;  4H02 A;  3J80 c;  2N78 A;  5DLQ E;  3GDE A;  3L7Z C;  3ULP A;  1WI5 A;  3FKI G;  1QUQ A;  3NEN A;  1K8A C;  4JI7 Q;  4L5Q A;  4ALP A;  2PI2 A;  1XMO Q;  3I7F A;  1Q81 C;  1TWF H;  4JYA L;  2I5H A;  3RR5 A;  3KJO A;  2YTX A;  3CMA A;  4DR5 Q;  4HIO A;  3S14 H;  2AHO B;  2IY5 B;  2YV5 A;  1VQ9 A;  3U4V A;  1B7Y B;  4B3M Q;  2PNH A;  1KRS A;  1V9P A;  3S1N H;  1EIF A;  1VQD A;  3A5Z B;  4DR6 L;  2JA6 G;  1VQJ A;  1X55 A;  3OW2 A;  4QQB X;  2Q2T A;  3S2H H;  1VQ6 A;  3CCQ A;  2BA1 A;  1Y1W H;  4QJF A;  3F2D A;  4BBR G;  4DR2 L;  2F4V L;  4LF8 Q;  1VQF A;  3KFU A;  3KF6 B;  2R7F A;  4B3S Q;  4LNQ A;  4LUO A;  4A3C G;  3E0E A;  4IPC A;  2B63 G;  3T1H Q;  2R7Z G;  4LF5 L;  2R93 H;  1EYG A;  2F4V Q;  3JAM i;  4NXN Q;  4YWM A;  1PFS A;  2GN5 A;  1Z9F A;  4JI8 L;  4A3E H;  5M3M H;  4R4Q A;  2R6G A;  3NEM A;  1OXX K;  2GVB A;  5FLM G;  4YWK A;  1I3Q H;  2JEB I;  2E5L Q;  4X66 L;  2PQA A;  3G6E A;  1N8R C;  4JI5 Q;  2JA8 G;  4BBS G;  2K75 A;  1YJN A;  4C3I H;  5BR8 L;  1VS0 A;  3GTJ H;  2UUC Q;  4JG2 A;  3ZJY C;  2E5L L;  1N32 Q;  4UP8 A;  1RIP A;  4PG3 A;  4GN3 B;  1Y1V G;  5AJ3 L;  3K80 C;  4QIW E;  3B6Y A;  1WJJ A;  4QY7 A;  2JJQ A;  4JBK A;  1GD7 A;  2CWP A;  3FHW A;  1HR0 Q;  3I4M H;  1TWC H;  1U0L A;  4R4I A;  1UE6 A;  1VQN A;  5M3F H;  3CC4 A;  2NVQ H;  1R9T H;  2UXD Q;  2HHH Q;  2VS1 A;  2CFM A;  2UXB Q;  1E1O A;  2MO1 A;  2VL6 A;  1D8L A;  2MQH A;  2KBN A;  1EWI A;  4LFC Q;  1VQM A;  4HIK A;  3PF5 A;  1KIX A;  2XGT A;  4XIG S;  4JI3 L;  3KF8 B;  3AFQ A;  1PYS B;  3CCR A;  1Y14 B;  1IBM Q;  1BVS A;  5LMN L;  2WAQ G;  4GLV B;  1GO3 E;  2K4K A;  4MTN A;  1G6P A;  1ASZ A;  4JI3 Q;  4JV5 Q;  4A3J H;  4JI4 Q;  4KHZ A;  3CCM A;  3PO2 G;  4APV A;  1X6O A;  4EQ5 A;  3CPF A;  5FJ8 H;  4YY3 Q;  2QGQ A;  5GAD C;  1X3G A;  1G51 A;  5IYD G;  3D31 A;  5C44 G;  5C0X G;  3UE1 A;  3OTO Q;  4YWL A;  4DV1 L;  3FP9 A;  4JI2 L;  1L1O A;  4GKJ L;  1NMG A;  3LGJ A;  1H95 A;  1XJV A;  2E2H H;  5E7N A;  1GVP A;  2DGY A;  3S15 H;  3HKS A;  2B3G A;  4HJ8 A;  4DV0 L;  2ZTD A;  4B3R Q;  2VW9 A;  2WAQ E;  4OX9 Q;  4GKK L;  1EFW A;  2UXC L;  3S2D H;  2B29 A;  4JI0 L;  3GD7 A;  4GLX A;  1E1T A;  1YIJ A;  2VUM H;  3PSI A;  4LF6 Q;  3SGI A;  1XNQ L;  2N3S A;  1PV4 A;  1V1Q A;  2IX0 A;  1VQH A;  1EQR A;  3ER0 A;  2R7D A;  2JA7 H;  3HOY H;  4A3D G;  3VDY A;  4IFD G;  1Q8K A;  1VQ7 A;  1VQL A;  5C3E G;  4X62 L;  2EXD A;  3UDG A;  5JEA G;  1YBY A;  4YHH Q;  4R4C A;  1X3F A;  5ELN A;  2ZM6 Q;  4UPA A;  3M7N A;  3KYH C;  1CSQ A;  3G71 A;  3CC7 A;  2ZJR A;  5JJL A;  4AH6 A;  3HOV H;  1OTC A;  2KHJ A;  4DK6 C;  1KQS A;  3K7A H;  1Q1B A;  5JEA J;  2A19 A;  2VQE L;  1LM0 A;  5C0X J;  1XMO L;  5IP9 H;  4UY8 C;  3KDF B;  4JYA Q;  1PH8 A;  1QZG A;  2NZH A;  4JI1 L;  1YJ9 A;  5K36 G;  1FJG Q;  3JC6 6;  4OWX B;  3J7A 5;  2D0P A;  2MO0 A;  4IPG A;  3HOW G;  1UE7 A;  1B8A A;  1HNZ L;  4X66 Q;  4DV7 Q;  1HNX L;  2VZA A;  4B3S L;  1I94 Q;  4A3L G;  1NJI C;  1HZB A;  1W3S A;  3A0J A;  5IP7 H;  1VQ5 A;  3CQZ H;  4L5R C;  5C4X H;  4BXX H;  1WYD A;  4LF5 Q;  1VQ8 A;  3S24 A;  4GLA C;  5JJI A;  4DV3 Q;  3I4N H;  4A3G H;  1JJG A;  1HZC A;  3TRE A;  4DNI A;  3UDI A;  3PV0 A;  2Y0S E;  3AFP A;  1PH3 A;  1E7Z A;  1I5F A;  4C3J H;  2CCZ A;  4NXM Q;  5IYC G;  3MXN B;  1WCM H;  4HJ7 A;  4UP9 A;  4DPG A;  4A3I G;  5ELO A;  3W5O A;  4JOI A;  3CME A;  3HOU G;  1HNW L;  4IOA A;  3ULL A;  4BY7 H;  2MFI A;  1A0I A;  1Q7Y C;  4WJ3 M;  2OCE A;  2CKZ B;  1T9H A;  1S72 A;  4A3K H;  3K0X A;  5LMN Q;  1J6Q A;  1K8G A;  1EUJ A;  3AYH B;  1CKM A;  1L2F A;  4GN5 A;  4A75 A;  4B3T L;  3EN2 A;  2F3I A;  2Y0S G;  4LFA Q;  5M5X H;  4DK3 C;  1YHQ A;  3CCE A;  4A3M H;  2NZO A;  1VQK A;  2ATW A;  2YTY A;  1N36 L;  1XPO A;  4LF9 L;  3DLL A;  4WJ4 A;  4GOP B;  1SLJ A;  3S1Q H;  2ALY B;  1E22 A;  5IT9 c;  4TQU S;  1N33 L;  5HY6 A;  3J81 i;  4DV5 L;  1ASY A;  4DAY B;  3T1Y Q;  2NVT H;  2K5V A;  1Q1E A;  3HFZ B;  3F2B A;  1YHB A;  2AKW B;  4DR6 Q;  1HNW Q;  2OQ0 A;  2K52 A;  1P8L A;  1N34 Q;  2HIX A;  1VQG A;  2D0O A;  2I5L X;  5FLX c;  1PH6 A;  4OX9 L;  2PMZ E;  1LUZ A;  3HKZ G;  1XNR L;  3GTL H;  1JB7 A;  1VQO A;  1AH9 A;  2VNU D;  4JI0 Q;  3PUX A;  2JA5 H;  4O0A A;  3OTO L;  4HIM A;  2LSS A;  1OXV A;  4KI0 A;  4GNX C;  1XNR Q;  3PO3 H;  1MJC A;  5J3B A;  4LFB Q;  4DR3 Q;  1J5E Q;  4DUZ Q;  3UE0 A;  5H1S E;  3CD6 A;  4DR7 Q;  2A1A A;  1FGU A;  5M5Y H;  3KJP A;  4A76 A;  1I6H H;  2UUA L;  4RMF A;  1YI2 A;  2PQA B;  2ASB A;  2Q2H A;  3RLO A;  5C4J H;  1VQ4 A;  1HH2 P;  4DV2 Q;  1K73 C;  5LMU L;  3BU2 A;  1V43 A;  2JA6 H;  5JJK A;  1D7Q A;  3RN5 A;  3H3V I;  2UUA Q;  4HJA A;  1E3P A;  3UDF A;  1W2B A;  1SN8 A;  4DUY L;  1LYL A;  5EAY A;  4BBR H;  5LMU Q;  4BA2 I;  3HOX G;  4JBW A;  4PMW A;  1JJC B;  1K3R A;  4A3C H;  2B63 H;  1XMQ L;  2R7Z H;  3G48 A;  1CKO A;  1TWG H;  2Q2I A;  1M90 C;  4JV5 L;  1PVO A;  4IO9 A;  4P75 A;  4BY1 H;  3NBH B;  2Z6K A;  4A93 H;  3HOZ G;  4IFD I;  4YCV A;  2F52 A;  1IBK Q;  1BKB A;  4A3F H;  1EIY B;  1BBW A;  2VQF L;  2ZTE A;  3W1B A;  2VQE Q;  4A3B G;  4YHH L;  3ERS X;  1IL2 A;  1PHJ A;  3AEV A;  3H0G H;  3F2C A;  4BBS H;  5IYB H;  2NN6 G;  4LF7 L;  2R92 G;  3PIP A;  1AE2 A;  1QZH A;  1VQB A;  5IE8 A;  2UUC L;  1PYB A;  4B3R L;  1PH7 A;  4KLK A;  2E2J H;  4QGU A;  1YEZ A;  3U58 A;  4X65 L;  3BZC A;  2OQK A;  4UP7 A;  1A62 A;  1QVF A;  1NMF A;  2XTI A;  5BR8 Q;  1NTG A;  1TWH H;  4PZ7 A;  1KRT A;  5IWA Q;  1K0R A;  3M85 A;  2CQO A;  4K0K L;  2EIF A;  3L0O A;  2OTJ A;  2UXD L;  1IBL Q;  1KD1 C;  2UXB L;  4HID A;  3M4P A;  4GNX A;  4O2D A;  4IPD A;  4L5T A;  1OXU A;  4KHP L;  2QEX A;  2K5N A;  2ZM6 L;  3FKI H;  1CKN A;  1SE8 A;  3ICE A;  1FL0 A;  1UWV A;  3ULJ A;  1Q86 C;  2LXK A;  4P74 A;  3TEH B;  3M4O H;  1JE5 A;  4YCW A;  2V1C C;  5LMN W;  4A3J G;  4TVA B;  3KF6 A;  1SRU A;  1P16 A;  1UEB A;  1VQE A;  2ID0 A;  3NEL A;  4LF8 L;  1X9N A;  3M9B A;  5IYD H;  5C0X I;  3PGZ A;  1YZ6 A;  5C44 H;  2YYZ A;  3OYY A;  3AQQ A;  1C7Y A;  2UU9 Q;  3TQY A;  1HNX Q;  3BZK A;  4AIM A;  3PUW A;  3W1G A;  3H3V H;  1L1O B;  1Y1W G;  1C9O A;  1GM5 A;  1JMC A;  3RZD H;  2HQL A;  1YNX A;  2HHH L;  1UE1 A;  4HJ5 A;  2VY3 A;  1A63 A;  4Y52 H;  1JT8 A;  2GVA A;  4POF A;  3T1H L;  1UE5 A;  4P71 A;  1OXS C;  2BH8 A;  4GOP C;  2R93 G;  3DM3 A;  2K14 A;  3PIO A;  4LWC A;  4DV6 Q;  4A3E G;  5GQO A;  1YJW A;  5M3M G;  4GOP A;  4AYB E;  1GKH A;  3I56 A;  1X65 A;  4A3D H;  5AJ3 Q;  1U5K A;  4DR1 L;  5FLM H;  5C3E H;  5GAE C;  5M5W H;  4DV6 L;  1IBM L;  2UXC Q;  2K50 A;  2JA8 H;  1EOV A;  1RL2 A;  3GTM H;  1N32 L;  2LXJ A;  3F1Z A;  2CWA A;  4DR3 L;  1J5E L;  4OWW B;  4DV1 Q;  4LW1 A;  4GNX B;  1S40 A;  4X64 Q;  1K83 H;  3L2P A;  1E24 A;  1MJE A;  1SFO H;  1Y1V H;  2ZJQ A;  3RZO H;  3RN2 A;  2YU9 H;  3UDX A;  5IP9 G;  1HR0 L;  1CUK A;  2H5X A;  1Q12 A;  1OXT A;  4JBM A;  2KEN A;  4L5S A;  3I4M G;  3PUZ A;  3A5U A;  3D0F A;  3IRB A;  1YVC A;  1VQC A;  2E8G A;  1VQI A;  4IPH A;  5GAG C;  5M3F G;  1IBK L;  2BH2 A;  3HOW H;  4DR7 L;  1TXY A;  3EBE A;  2JEA I;  4LF4 L;  3CCL A;  4A3L H;  4C2M H;  1HJP A;  4LF7 Q;  1N9W A;  1I94 L;  5C4X G;  3E9I A;  2WFW A;  4X62 Q;  4JBJ A;  1DGS A;  4JI7 L;  4DV4 L;  2AMC B;  1SR3 A;  2JK8 A;  4X65 Q;  4DV7 L;  3PUV A;  2WB1 G;  3J80 i;  2VQF Q;  2ZJP A;  4R4O A;  4EX5 A;  1QVG A;  1XMQ Q;  3GTO H;  4NPS A;  4DV4 Q;  3WWV A;  3PO2 H;  2UUB Q;  4POG A;  1FVI A;  2WP8 J;  3KOJ A;  5FJ8 G;  4PZ6 A;  4A3I H;  4K0K Q;  4B3M L;  2A8V A;  4DR4 L;  2IX1 A;  4A4I A;  1HZ9 A;  3HKZ E;  4AQY Q;  4GKK Q;  3CCV A;  2UUB L;  2JQO A;  2RF4 A;  4JI5 L;  1HZA A;  2RHS B;  1KHI A;  3CPW A;  2YTV A;  3J81 j;  4DR5 L;  4X6A H;  3MEF A;  2I5M X;  4C3H H;  4DR4 Q;  2RCN A;  4DV0 Q;  1WFQ A;  2E2I H;  3TRZ A;  4A3K G;  5IY0 A;  2KCM A;  4OON A;  2HIV A;  2WB1 E;  4YCU A;  3CF5 A;  3K8A A;  1VQA A;  3STB D;  2AWN A;  3RLN A; 
#chains in the Genus database with same CATH topology
 4HCS A;  1Z7T A;  2D62 A;  2HD3 A;  1H9M A;  3I2Z A;  1B3Q A;  3M4Y A;  4JI8 Q;  4QL5 A;  2JA7 G;  4KHP Q;  1SNO A;  2C35 B;  4P73 A;  1G29 1;  1M4V A;  3VA5 A;  1VCI A;  1PH9 A;  1ILP A;  1KAW A;  3CP0 A;  1MIU A;  4NXN L;  1WTP A;  3I4O A;  5C6A A;  1E2W A;  1Y8P B;  4DAM A;  4J6H A;  3S2D B;  3G6J B;  4AYB G;  4KMU C;  4G57 A;  4DR2 Q;  2BA0 A;  3TN2 A;  1CHP D;  1VMC A;  1X56 A;  3S14 B;  1U4P A;  1AE3 A;  4ILW A;  1HNW L;  1EY8 A;  1L0W A;  2R92 B;  3CXC A;  1LV9 A;  1QUQ B;  3CRL C;  1CZG A;  4MIU A;  3S15 B;  1PRT D;  3NWS A;  1Q46 A;  2KHI A;  4HJ9 A;  1PTO C;  1N36 Q;  3GTP H;  4ZUI A;  1GUG A;  3I90 A;  5IP7 G;  2VXW A;  3Q6S A;  3K5M A;  4IQZ A;  1N33 Q;  1D5X C;  3HOU B;  1SMX A;  1IKM A;  3GO5 A;  1KNA A;  2J0T D;  2NBF A;  2GA4 B;  3HOX H;  1XTD A;  2VB2 X;  5IGE A;  4ME3 A;  1PA6 A;  1ET6 A;  3I4L A;  1JOR A;  4H44 C;  4F7X A;  1T5E A;  1K9M C;  3HOU H;  3GTG B;  3SK6 A;  3HOZ H;  3PCO B;  2WAQ B;  3CCS A;  4Q0F A;  1TWG B;  1EYD A;  2C9O A;  1QJO A;  2KCT A;  1SAP A;  2EYF A;  1EQQ A;  2F0H A;  2RQX A;  2IHF A;  4BWG B;  2Z8L A;  4X64 L;  1UNS A;  2B39 A;  4JI2 Q;  4A3M G;  2OTL A;  1K8O A;  3ERQ A;  3VYU A;  1Z6H A;  1C0A A;  5GRO A;  4A3B B;  1B53 A;  4IJL A;  1NE3 A;  1SRO A;  4OXP A;  3A7A B;  3OMG A;  3E6Z X;  1YNJ D;  4YY3 L;  1JOK A;  1LT4 D;  1N34 L;  1VQP A;  2F0N A;  4LF4 Q;  3CC2 A;  4LF6 L;  2EXZ A;  2N78 A;  1XXG A;  5JAV A;  4X3T A;  1QUQ A;  4LAA A;  2EJM A;  3NEN A;  4JI7 Q;  4ALP A;  3BVZ A;  3MTS A;  4XT3 B;  2I5H A;  2YTX A;  4DR5 Q;  2AHO B;  3Q22 A;  2IY5 B;  4OIK A;  2NVT B;  5JJZ A;  2JA6 G;  4QQB X;  3AMU A;  3A8J E;  1PYW D;  3VA7 A;  1EU3 A;  2WIN B;  4RGT A;  1VF7 A;  3HGB A;  4RAU C;  1VQF A;  1CK1 A;  4LNQ A;  4LUO A;  2R7Z G;  3T1H Q;  2F4V Q;  2AQ3 B;  3HP3 A;  3JAM i;  4NXN Q;  2AQ2 B;  1PFS A;  4I65 A;  2GN5 A;  1Z9F A;  2D2C C;  1OXX K;  4YWK A;  2JA8 G;  4JI5 Q;  2ZXO A;  3OIP A;  3TP5 A;  1S5C D;  1HPC A;  2N55 A;  4DAY A;  2K75 A;  4C3I H;  1R9T B;  1ESF A;  3ZJY C;  2PCF B;  4F88 A;  4UP8 A;  4PG3 A;  3MEH A;  2EYH A;  1Y1V G;  5AJ3 L;  1W6K A;  1WJJ A;  5KGU A;  2R3Z A;  4ZYS A;  3I4M H;  1DM0 B;  3TZD A;  1VQN A;  5M3F H;  2UXD Q;  4C3I B;  1R9T H;  3PQI A;  4GZY C;  2UXB Q;  1D8L A;  3NP8 A;  4HIK A;  2E76 C;  4O42 A;  3VR5 A;  3KF8 B;  3AFQ A;  3CCR A;  1Y14 B;  3O13 A;  1GO3 E;  1TVX A;  3QIA A;  1EWC A;  4RA8 A;  4JI4 Q;  4FNF A;  3H94 A;  4IAL A;  3CCM A;  3D31 A;  5EJW A;  3BYY B;  1RCV D;  4KKT A;  4JI2 L;  1DCZ A;  5C4Z A;  1ICF B;  1H95 A;  1ML0 D;  3BVM A;  2CW0 C;  5FO8 B;  3J81 E;  1AW7 A;  4B3R Q;  2WAQ E;  3VYS A;  2MJ8 A;  4QUC A;  2KJX A;  1CZW A;  1STA A;  4LF6 Q;  3SGI A;  2BDO A;  4DNR B;  2IX0 A;  2R7D A;  1A3U A;  2JA7 H;  4A3D G;  4IFD G;  2ZT9 C;  4QMG A;  4X62 L;  2EXD A;  2BCO A;  5JEA G;  4B9X A;  1Y1V B;  4DNT B;  2ZJR A;  5D65 A;  1CA6 A;  1XX8 A;  1KQS A;  1GUO A;  1WTX A;  2OT2 A;  2XWJ B;  3HKZ B;  3JC6 6;  3J7A 5;  5BN3 A;  2MO0 A;  4OO1 H;  1WTH A;  4HN7 A;  4DV7 Q;  1HNX L;  4NKL A;  2K05 A;  3MFY A;  4A3L G;  3NWT A;  1NJI C;  1HZB A;  1W3S A;  5IP7 H;  1PLF A;  1VQ5 A;  5CYU A;  5C4X H;  1WYD A;  3NK9 A;  1VQ8 A;  1HZC A;  2AUJ D;  3QOL A;  3PV0 A;  2Y0S E;  1E7Z A;  1M8A A;  4DA2 A;  3MXN B;  4HJ7 A;  4UP9 A;  5IGG A;  1Q90 A;  3R93 A;  4DPG A;  5JPM C;  3HOU G;  2K5Q A;  1SFO B;  5CV4 A;  1Q7Y C;  4WJ3 M;  1T9H A;  3K0X A;  5LMN Q;  1UEA B;  1SDF A;  4GN5 A;  1L2F A;  1STH A;  2VB3 X;  3BDO A;  1T5X D;  4DK3 C;  2F0E A;  2FHT A;  2YTY A;  1FGB D;  1XPO A;  2WB1 B;  4LF9 L;  1I6H B;  4CBV A;  5C3W A;  3S1Q H;  4G7O C;  1LTA D;  1G2T A;  2B2W A;  4Z9C B;  4DAY B;  1LTR D;  2NVT H;  3HFZ B;  2OQ0 A;  4U68 A;  1VQG A;  2F0F A;  5FLX c;  2LMC B;  2RCF A;  1PH6 A;  4KY6 A;  2B8F A;  3J7A V;  4KY5 A;  2JA5 H;  1R4P B;  4O0A A;  4ZK9 B;  4HIM A;  3K5N A;  4KI0 A;  1EY9 A;  2G9H D;  2KHS A;  1MJC A;  5J3B A;  5IGB A;  1K83 B;  2BE5 C;  5CV6 A;  2BDN A;  3TDQ A;  4KY7 A;  4DR7 Q;  5BN5 A;  4XYQ A;  5M5Y H;  3KJP A;  4A76 A;  2UUA L;  1B9N A;  4RMF A;  1EQT A;  2ASB A;  1HH2 P;  4DV2 Q;  1K73 C;  5LMU L;  2JA6 H;  3DWQ A;  4RCO A;  1BUV T;  3RN5 A;  2UUA Q;  4HJA A;  3IAY A;  1I4R A;  3FPP A;  3MWY W;  5EAY A;  3D6C A;  4A3I B;  4BA2 I;  4FXG C;  1F2M A;  3IL8 A;  4JBW A;  4PMW A;  3KLS A;  2RA4 A;  4A3C H;  2B63 H;  1TWG H;  1PVO A;  4UDU C;  4BY1 H;  1HTP A;  1I4P A;  4K6L A;  4YCV A;  4IFD I;  1IBK Q;  1EIY B;  5EPL A;  4A3F H;  5I2X A;  2NVQ B;  3J7Y W;  1ONL A;  5FOB B;  1PHJ A;  3AEV A;  3H0G H;  2B63 B;  2NN6 G;  1SYG A;  5IGF A;  1QZH A;  2UUC L;  1EY6 A;  3NBI A;  1FD7 D;  2E2J H;  2E2I B;  1TT2 A;  1YEZ A;  4S3S A;  3BZC A;  4UP7 A;  2FIN B;  1EWH A;  1QVF A;  5BR8 Q;  1TWH H;  1PFM A;  3M85 A;  3S17 B;  4FF3 A;  4A3G B;  2EYP A;  5LHY 1;  4HID A;  3RZO B;  1OXU A;  2ZM6 L;  3HOY B;  2KCC A;  1CKN A;  1SE8 A;  1FL0 A;  3ULJ A;  2CW0 D;  1TU2 B;  1JE5 A;  2QDL A;  3HEJ A;  4X3U A;  1ENF A;  2F1M A;  1HUM A;  1EZ6 A;  3S9W A;  1SE4 A;  3TQY A;  2F0S A;  1ICW A;  3PUW A;  3W1G A;  4XQN A;  1Y1W G;  1GM5 A;  2K7V A;  1YNX A;  3BYT B;  2R61 A;  1HFN A;  3FRP B;  4Y52 H;  1JT8 A;  3T1H L;  3K58 A;  4GOP C;  2BH8 A;  4RGM A;  2HCC A;  4K5V A;  1KLU D;  1JWU D;  5GQO A;  1YJW A;  1EYC A;  5M3M G;  4NMZ A;  4AYB E;  5I6W A;  4GOP A;  3I56 A;  1H9J A;  1X65 A;  4IFD H;  5M5X B;  2DJG C;  5M5W H;  2K50 A;  1S5E D;  5LL6 X;  4LW1 A;  1QE6 A;  2ZJQ A;  1PZI D;  3DWP A;  1SE3 A;  5IP9 G;  1CUK A;  4TSS A;  1Q12 A;  3PUZ A;  3A5U A;  3IRB A;  2RSO A;  4IUR A;  2E8G A;  1VQI A;  3HS0 C;  2I46 A;  4LF4 L;  2RDH A;  3CCL A;  4FP5 D;  4A3L H;  1GUW A;  1HJP A;  1A15 A;  3K6O A;  3Q23 A;  4LF7 Q;  3E5S A;  5C4X G;  1V1P B;  2WFW A;  4V19 0;  5EQ0 A;  1AEX A;  2A73 B;  2AMC B;  4X65 Q;  4K6D A;  4DV7 L;  1MSH A;  3BDL A;  1O7Z A;  1XMQ Q;  1F9Q A;  2M2L A;  3VR2 A;  5FJ8 G;  3T16 A;  4K0K Q;  2HDL A;  3HOZ B;  4A4I A;  3HKZ E;  1PFN A;  5CV8 A;  1U4M A;  2JQO A;  1S5D D;  5L37 A;  3J81 j;  4R9W A;  4X3S A;  3HRZ C;  3TRZ A;  2KCM A;  2L4N A;  2HIV A;  4BBR B;  2WB1 E;  3I72 A;  2Z6B A;  3EIV A;  5I2Y A;  3MA2 B;  4GN4 B;  2K01 A;  3RLF A;  3HOY G;  3PUY A;  1LLR D;  4A3M B;  3KDF A;  2UU9 L;  3SEB A;  4MNO A;  2RHQ B;  2H4O A;  4JCV E;  2B8G A;  3HOV G;  1S3O A;  3J7Z C;  2O2L D;  1MKH A;  3F8T A;  2I0Q A;  2JA5 G;  2EVB A;  3U4Z A;  2HT1 A;  5K36 H;  1PH1 A;  4R8N A;  2IW3 A;  3AB9 A;  3GTQ H;  1SMY D;  3TS0 A;  1L1O C;  3FMC A;  4NXM L;  4CKE A;  5IWA L;  5D14 A;  2QF7 A;  2XWB B;  3X3N A;  5I6Y A;  2QA4 A;  4DV3 L;  1YIT A;  3Q24 A;  1O7I A;  4KJO A;  2IJ0 A;  1U4R A;  1BBU A;  2PW5 A;  3WOF A;  1PH4 A;  3K7U C;  1ZYR D;  4KKU A;  3QG1 A;  1NY4 A;  4EQN A;  4DV2 L;  4DK0 A;  3CCU A;  1A8V A;  3BJU A;  4BY1 G;  1I50 H;  1EY7 A;  4KV6 A;  1EZ8 A;  1FYC A;  4BY7 G;  4A3F G;  1H9R A;  1CSP A;  4A3B H;  2TMP A;  1LO5 D;  4OEL B;  1BO0 A;  1PH5 A;  1ENA A;  1SBB B;  3G4S A;  3SK8 A;  1KL9 A;  4L6T B;  2NVX H;  1XPR A;  4JC0 A;  4CKB A;  3CRK C;  4C56 C;  1EFI D;  3Q0A A;  4RG1 A;  2DUD A;  1EL0 A;  4RWS C;  2EE1 A;  4Y7N B;  1CKN B;  1X32 A;  1JCK B;  2RDF A;  3T1Y L;  1Y69 U;  4OWT B;  4H7B A;  2JA9 A;  4IJH A;  5A35 A;  2NVY H;  4R8I A;  5DLQ E;  4IUV A;  2CH4 W;  3GDE A;  4G4K A;  2SDF A;  3A8K E;  4DN4 M;  5LL6 S;  1CFM A;  3DMU A;  1XMO Q;  3I7F A;  4JW0 A;  1HUN A;  3WOE A;  2G9D A;  1CA5 A;  4IUP A;  2JN4 A;  2YV5 A;  2SNM A;  2BOS A;  1VQ9 A;  1V9P A;  4C3H B;  1VQD A;  3A5Z B;  3OW2 A;  2SNS A;  3S2H H;  1Y1W H;  3OSO A;  2N88 A;  4IUN A;  2F4V L;  4B3S Q;  4OEM B;  2WKC A;  4IPC A;  1EYG A;  4UAI A;  1LTB D;  3JAM E;  3AU7 A;  4YWM A;  5EKI A;  2X69 A;  4R4Q A;  1EYA A;  2R6G A;  3NEM A;  5FK9 C;  3KUP A;  1VS0 A;  3NPP A;  4HAE A;  4JG2 A;  5ELD A;  3GTJ H;  2UUC Q;  1PZK D;  5KND A;  2JSO A;  4GN3 B;  5KIX A;  4QIW E;  5JOB A;  4JBK A;  4QY7 A;  3SVM A;  2CWP A;  2BE5 D;  2PW7 A;  3CC4 A;  2HHH Q;  2CFM A;  3FKI B;  3T4A C;  1EWI A;  3J7A F;  1KIX A;  2XGT A;  4XIG S;  4JI3 L;  3I91 A;  1ESR A;  1BVS A;  2P5Z X;  4DK1 A;  2K4K A;  1QIL A;  4JI3 Q;  4JV5 Q;  2A6H D;  3T53 B;  4K8I A;  4EQ5 A;  1X6O A;  1SMY C;  3CPF A;  4YY3 Q;  2QGQ A;  4FYD A;  3W2D A;  1G51 A;  5IYD G;  3ZYY X;  3EA6 A;  3IFD A;  3FP9 A;  4EGV A;  1J8I A;  5BN4 A;  2E2H H;  3EQL C;  4PQX A;  3SHL A;  2B3G A;  4DV0 L;  2F0T A;  2VW9 A;  1EFW A;  3S2D H;  3J81 L;  2B29 A;  4HSP A;  2M9V A;  1G2S A;  4GLX A;  1LT3 D;  2K5W A;  1DOL A;  1XNQ L;  1S5F D;  2N3S A;  1VQH A;  4K8J A;  3VDY A;  3BG3 A;  3GP7 A;  3MAQ A;  1VDZ A;  4FVM A;  3LWU A;  3I70 A;  3G71 A;  3C2P A;  5DNF A;  3HOV H;  2KHJ A;  4JYA Q;  1IW7 D;  1U9R A;  2WAC A;  3R8B A;  2TSS A;  4A3D B;  1BR9 A;  3DWA A;  3GTO B;  4C2M B;  2D0P A;  4IPG A;  3HOW G;  1UE7 A;  1B8A A;  1EY0 A;  1MBY A;  2E2J B;  4X66 Q;  2XRS D;  1QCB D;  4B3S L;  4L5R C;  3NQT A;  3URY A;  3S24 A;  1SNM A;  3I4N H;  1JJG A;  3DEO A;  1LAB A;  3D4W A;  3UDI A;  4DNI A;  3QOJ A;  1V1O A;  3AFP A;  3OOC A;  1I5F A;  5CV7 A;  1PH3 A;  3H09 A;  1LAC A;  4BBS B;  1WTR A;  4RHR A;  1K28 A;  5ELO A;  5J1Z A;  2A69 D;  1MGS A;  3ULL A;  4BY7 H;  2MFI A;  3TBI B;  2DNC A;  4I7Z C;  1WTV A;  4DXG A;  4I7A A;  1J6Q A;  3TP6 A;  3AYH B;  2Y0S G;  1YHQ A;  2F0Q A;  3FEW X;  1VMP A;  1VQK A;  2K33 A;  5M5Y B;  4GOP B;  1E22 A;  5JPN C;  3P75 A;  1TS4 A;  1JWM D;  5HY6 A;  4DXF A;  4DV5 L;  1BXT A;  3J80 E;  3F2B A;  4CJ2 C;  1HXY D;  4DR6 Q;  3LX0 A;  4E6I A;  2K52 A;  2K6A A;  2D0O A;  3VYR A;  4F87 A;  2PMZ E;  1AH9 A;  4LK1 C;  1DOK A;  4JI0 Q;  1NR4 A;  1BF4 A;  1STB A;  2EJG C;  1AFP A;  1X3P A;  3PO3 H;  4EQP A;  1SJH D;  1J5E Q;  5J22 A;  1D5Z C;  4IUT A;  3UE0 A;  5H1S E;  4YIJ A;  3CD6 A;  5C44 B;  2KUM A;  1YI2 A;  5C4J H;  2KOL A;  1BCP F;  2L9H A;  3BU2 A;  2LY7 A;  5JJK A;  2NUC A;  1EY5 A;  3E0J A;  3UDF A;  1W2B A;  1QB5 D;  1NNX A;  3HOX G;  5CGK A;  1XWE A;  1WD0 A;  2A6H C;  3S1R B;  4MHE A;  2O4X A;  3G48 A;  2Q2I A;  1KNE A;  1TS3 A;  2Z6K A;  4A93 H;  3HOZ G;  2Z4H A;  2F0I A;  1BBW A;  4QCL A;  2ZTE A;  2B2W C;  2AUK A;  2XRQ D;  4YHH L;  4ZKC B;  3CKI B;  4CJ1 B;  4BBS H;  4CJ0 B;  2NZ1 D;  4XQJ A;  2R92 G;  4XQQ A;  1AE2 A;  1VQB A;  2F0V A;  2A69 C;  1D6E C;  2OQK A;  3G7L A;  2XTI A;  3S1M B;  4PZ7 A;  1KRT A;  2EZV A;  1K0R A;  1A2U A;  2I07 B;  5E1F A;  1IBL Q;  3V96 A;  3DUZ A;  4L5T A;  3IFT A;  4TKO B;  2JA7 B;  2F3W A;  2DJF C;  3M3Y B;  2SEB D;  3TP8 A;  1ZYR C;  5KYI A;  3ICE A;  1UWV A;  2CQA A;  3SK5 A;  2A5H A;  3H91 A;  2LXK A;  1MD2 D;  4P74 A;  1NUC A;  1TY0 A;  4TVA B;  3KF6 A;  1UEB A;  1VQE A;  2ID0 A;  5IYD H;  1GUT A;  3PGZ A;  1YZ6 A;  5C44 H;  1FR3 A;  1KDC A;  2YYZ A;  3HOX B;  1C7Y A;  3AQQ A;  5CBE E;  1I4H A;  3TME A;  4AIM A;  4HR7 B;  1L1O B;  2WKD A;  1JMC A;  3LNN A;  2F0M A;  2HHH L;  2EYL A;  4HJ5 A;  4OIJ A;  5ELB A;  4POF A;  1UE5 A;  4P71 A;  1OXS C;  3K59 A;  2R93 G;  1EY4 A;  4IZ8 A;  3D3R A;  2IPK D;  2K14 A;  1JB3 A;  2JXM B;  1HQR D;  1PTO H;  1U5K A;  5TSS A;  2NYZ D;  3U9S A;  1EU4 A;  1YNJ C;  5C3E H;  3J80 L;  4DF7 A;  1ZXT A;  4AYB B;  2KED A;  3GTM H;  2LXJ A;  3F1Z A;  4HTH A;  4CHT B;  2CWA A;  1J5E L;  4DV1 Q;  1OO9 B;  4GNX B;  4X64 Q;  3L2P A;  3RZO H;  3RN2 A;  4ODG A;  3C46 A;  1OXT A;  2X6L A;  2E74 C;  3DM1 A;  1IYV A;  1IBK L;  5M3F G;  1CHQ D;  1YNN C;  1D1K A;  1N9W A;  1I94 L;  2F0W A;  4JVZ A;  3E9I A;  1WTQ A;  5C4H A;  1WTW A;  4JBJ A;  5T1I A;  4JI7 L;  2FMC A;  4RGN A;  2NB0 A;  1SR3 A;  5IOD A;  2PQE A;  4R4O A;  2OXP A;  1QVG A;  2YU9 B;  4LJZ C;  2Q8T A;  1H9S B;  2UUB Q;  4POG A;  4A3I H;  4FF4 A;  2A8V A;  2IX1 A;  5J39 A;  2UUB L;  4WOR A;  1KHI A;  2PNR C;  2I5M X;  3SE0 A;  4DR4 Q;  2B2U A;  3FVQ A;  5D3I B;  4DV0 Q;  1A2T A;  4OON A;  5G3L D;  3BS1 A;  1X3Q A;  1VQA A;  1TS5 A;  3STB D;  5M3M B;  1LTG D;  1WTO A;  2CVR A;  3STB C;  3M4Q A;  2H1E A;  2PPB C;  1Q82 C;  1XNQ Q;  2JA6 B;  2VUM G;  3RNU A;  4BA1 I;  1IBL L;  3W3A A;  1JOQ A;  3K81 C;  4ABN A;  1I4Q A;  1XPU A;  4P72 A;  3NTI A;  2IT1 A;  5AFW A;  4OHJ A;  2EYO A;  4DU9 A;  3S17 H;  4XTC S;  3PMF A;  3NHH A;  4DR6 L;  3TS2 A;  1AZP A;  2L15 A;  2XIW A;  1HFG A;  3K7A B;  1TWA H;  4A3J B;  1JE4 A;  3PO3 G;  3F2U A;  5IGD A;  4FDB A;  2ES2 A;  4OO1 G;  1TWH B;  5G3L F;  3A74 A;  4FXD A;  1Z47 A;  4ID6 A;  2JP1 A;  3E9H A;  5JVH 3;  4FF2 A;  2EYJ A;  2B2T A;  3J81 c;  4A3G G;  5FKA C;  4JPB W;  1D5M C;  3LWE A;  4JI6 Q;  4DUY Q;  1UUP A;  4K2L A;  5CV9 A;  1ZKO A;  4ZCK A;  1IZ6 A;  4R4T A;  4Y7N H;  1YHA A;  4MZ9 A;  3KBX A;  1EEI D;  1QVC A;  2NVX B;  4RFB A;  4A93 G;  1NBW A;  4HMJ A;  1BQQ T;  2ZXP A;  4DUZ L;  3S1M H;  1JWS D;  2NN6 I;  4BS9 A;  1CM9 A;  1M1K C;  3D6W A;  5IYB G;  4OO1 I;  2K5H A;  4LFB L;  2F0L A;  2R92 H;  4PZ8 A;  3U50 C;  2XN9 C;  4HMI A;  4GKJ Q;  2Z6K C;  1IHZ A;  3K5O A;  1FJG L;  1KLG D;  2B2V A;  1X54 A;  4AQY L;  1E2V A;  2JE6 I;  3S16 H;  1HA6 A;  1IYU A;  4JI4 L;  4QB4 A;  3PIO 3;  1K8M A;  1HA5 A;  5C3E B;  1S4Z A;  2IL8 A;  4A3E B;  4HCE A;  3V05 A;  3QB3 A;  1PRT C;  4FF1 A;  3L7Z C;  3ULP A;  3FKI G;  2EYM A;  2F4I A;  3DXJ C;  2QDB A;  2PZW A;  2PYK A;  4L5Q A;  4JYA L;  4EVO A;  4NDX A;  3RR5 A;  3CMA A;  3BDC A;  4HIO A;  4Q5V A;  2MUY A;  3V2T A;  1B7Y B;  3PO3 B;  4ZUJ A;  2PNH A;  3MXP A;  3S1N H;  1EIF A;  2K28 A;  2Q2T A;  2BA1 A;  1STY A;  3F2D A;  1HTL D;  4DR2 L;  1AZQ A;  4IN3 A;  3EJI A;  4A3C G;  3E0E A;  3RZD B;  2B63 G;  3S1N B;  2R93 H;  1G91 A;  4RH6 A;  2L0C A;  4MN3 A;  3JAM L;  4XXE A;  4PMC A;  3VR3 A;  1EOT A;  1I3Q H;  2ENB A;  1N8R C;  2NN6 H;  1YJN A;  1N32 Q;  2QEJ C;  1RIP A;  5COR A;  5DEH A;  2FFK B;  5I9P A;  3HG9 A;  3K80 C;  3B6Y A;  5ELF A;  2JJQ A;  4RCN A;  3FHW A;  1HR0 Q;  4K14 A;  3I73 A;  1TWC H;  1U0L A;  3OHX C;  1PXU A;  2VS1 A;  3RMH A;  1E1O A;  1NR2 A;  1FNW A;  2MO1 A;  2VL6 A;  2MQH A;  4ZLT F;  3MHB A;  4LFC Q;  1VQM A;  4A3K B;  1A3V A;  1JQY D;  1PYS B;  1IBM Q;  4RGO S;  4GLV B;  2KVM A;  1C48 A;  2B2V C;  1I4G A;  1SNP A;  4KHZ A;  2DN8 A;  3KLS X;  1X3G A;  3QJY A;  5C0X G;  4QUF A;  3BZD B;  3OPO A;  3UE1 A;  4DV1 L;  4GKJ L;  3R3O A;  4XYO A;  1NMG A;  3LGJ A;  4IUU A;  5HGT A;  3NTH A;  5EPJ A;  1RTN A;  5E7N A;  1GVP A;  3KF8 A;  3S15 H;  1JC7 A;  2PMZ B;  3HKS A;  3OIQ A;  2ZTD A;  1J9O A;  4OX9 Q;  2UXC L;  1SYF A;  3GD7 A;  1E1T A;  2VUM H;  2RSN A;  3PSI A;  1V1Q A;  1TKW B;  3ER0 A;  5FO7 B;  1Q8K A;  3GTK B;  1VQ7 A;  1VQL A;  1YBY A;  1DJR D;  5E4X A;  5ELN A;  2ZM6 Q;  1STG A;  4UPA A;  5DAU A;  1CSQ A;  4FXK C;  3CC7 A;  5JJL A;  2O5J C;  4AH6 A;  3I3C A;  2O5I C;  2DY8 A;  1QWY A;  3NXW A;  3K7A H;  1H9S A;  2NWG A;  5JEA J;  2EJF C;  4UHV A;  5C0X J;  2VQE L;  5IP9 H;  3KDF B;  4J1M A;  4OGQ C;  1DZ1 A;  5KNB A;  1YJ9 A;  4FO2 A;  4OWX B;  1XYI A;  1LT5 D;  4NW2 A;  2OF1 A;  2A74 C;  2VZA A;  2E2D C;  1F9S A;  4A3G H;  2JYO A;  5DM7 3;  1SXT A;  2DNE A;  1BNZ A;  4C3J H;  4KN4 C;  2CCZ A;  4NXM Q;  1Q8I A;  3GTQ B;  2ICE C;  2F0G A;  5EPK A;  1F2L A;  3FDT A;  4G7Z C;  2KA7 A;  1GUS A;  4IOA A;  2EY6 A;  2B2U C;  2EOT A;  2CKZ B;  5M9O A;  1S72 A;  1I4X A;  1FNU A;  3A56 A;  1BCP B;  4LFA Q;  5M5X H;  2MPM A;  3CCE A;  4A3M H;  2R93 B;  2NZO A;  4MTK A;  3VYT A;  4WJ4 A;  3DLL A;  2ALY B;  1B4O A;  4TQU S;  1MSG A;  5IT9 c;  1GJX A;  2L55 A;  3J81 i;  1ASY A;  1RDP D;  5IGC A;  5IT9 E;  1NAP A;  1PMR A;  1V1P A;  1N34 Q;  2HIX A;  2XNA C;  2L11 A;  1PDQ A;  1F2Y A;  2E2H B;  4DAP A;  3P20 A;  3GTL H;  1VQO A;  2VNU D;  2LSS A;  1OXV A;  3NE5 B;  4GNX C;  4QF4 A;  3KK7 A;  1XNR Q;  5ELE A;  2F0U A;  4ULL A;  5FLX E;  4LFB Q;  4DR3 Q;  4DUZ Q;  1HHV A;  2QW7 A;  1ET9 A;  2A1A A;  4M1U B;  1CTM A;  2PQA B;  1VQ4 A;  3GTL B;  2JA8 B;  4KTA A;  3SK4 A;  3GV3 A;  1D7Q A;  3FPU B;  1F9R A;  3H3V I;  1SN8 A;  3QWN A;  1TII D;  3KBG A;  1LT6 D;  2Z4I A;  2HCI A;  1B1Z A;  1Y8O B;  3UI2 A;  2R7Z H;  1XMQ L;  4P75 A;  3NBH B;  3MFG A;  5E3F A;  2F52 A;  3QO2 A;  4RKL A;  4A3B G;  2VQE Q;  1HCZ A;  3ERS X;  1IL2 A;  4CDC C;  2R7Z B;  1ILQ A;  4L8J A;  3HOW B;  1TQO A;  1PTO F;  1DOM A;  5IE8 A;  1PYB A;  3A55 A;  4B3R L;  1PH7 A;  5JVG 3;  5C5L A;  2MHV A;  4KJN A;  4QGU A;  3U58 A;  4X65 L;  2SOB A;  2ZXR A;  1NMF A;  1F2Z A;  2CQO A;  4K0K L;  2CH4 A;  1KD1 C;  3I4M B;  2UXB L;  3GTJ B;  4KHP L;  2HUG A;  2K5N A;  3T13 A;  1W6J A;  3WDN A;  3C1E A;  1V8Q A;  1Q86 C;  1H9K A;  3TEH B;  3TP7 A;  2K03 A;  5LMN W;  1I6V C;  5CR3 A;  4LF8 L;  1SRU A;  1P16 A;  5FO9 B;  2PZU A;  3P7J A;  2FMM A;  2V4D A;  5KNC A;  3OYY A;  2EDG A;  1HNX Q;  3BZK A;  3H3V H;  2A68 C;  3RZD H;  2HQL A;  3I4N B;  1PTO B;  1UE1 A;  4PMB A;  1A63 A;  2X6G A;  1RF2 D;  2FJ2 A;  3D8G A;  4TRD A;  4DV6 Q;  4A3E G;  4KK7 A;  1GKH A;  4A3D H;  5FLM H;  4U67 3;  5GAE C;  4DV6 L;  1IBM L;  2UXC Q;  4EQO A;  5JEA H;  4KN7 C;  1RL2 A;  1N32 L;  1LTS D;  1A3T A;  1SNC A;  4DR3 L;  3EVQ A;  1S40 A;  1SFO H;  2YU9 H;  3UDX A;  1SJE D;  2H5X A;  5FLX L;  2PO4 A;  2KEN A;  3D0F A;  4IPH A;  1VQC A;  2BH2 A;  4DR7 L;  5HUR A;  2L5T A;  1TXY A;  3EBE A;  1ROD A;  2K1B A;  2A68 D;  4P2C B;  4C3J G;  2WB1 G;  3J80 i;  5IIF A;  4EX5 A;  3SDZ A;  3PO2 H;  1FVI A;  2F0K A;  3KOJ A;  3MXN A;  4PZ6 A;  4ME5 A;  4DR4 L;  4GKK Q;  1WD1 A;  1II3 A;  1L0X B;  4XDX A;  3CCV A;  2J7Z A;  2RF4 A;  4JI5 L;  1HZA A;  3K57 A;  4DR5 L;  4X6A H;  4C3H H;  2RCN A;  1WFQ A;  2E2I H;  4A93 B;  5IY0 A;  3S2H B;  2AWN A;  3RLN A;  1O7L A;  4LUV A;  3R2T A;  3GTK H;  1LTL A;  3S1R H;  1BBX C;  4LUZ A;  2RKS A;  2K5D A;  3H15 A;  1QNU A;  1SNQ A;  4N8F A;  4LF9 Q;  3CW2 C;  1O7Y A;  3L3O C;  5D3D A;  4CGY B;  1K3B C;  1TWA B;  2PI2 E;  4JI1 Q;  5C4J B;  1WVL A;  2IHE A;  3A54 A;  1HR0 W;  2IX3 A;  3I55 A;  4C1N K;  4NP5 A;  1HNZ Q;  1B70 B;  3NTK A;  5HGQ A;  3Q8D A;  2F0P A;  2Z0S A;  5GAH C;  4DV5 Q;  1X3E A;  3H6M A;  3M7G A;  2ICI A;  4DKA C;  1IXR A;  1RHP A;  4N9T A;  1RJT A;  4V0B A;  3OMC A;  2ZTC A;  1CT1 D;  3PF4 A;  1K0S A;  2WII B;  1KC8 C;  3M3Y H;  2AWO A;  2Q2U A;  1XTC D;  3CCJ A;  4GS3 A;  4RHS A;  4B3T Q;  4LFC L;  4BXX G;  1PH2 A;  4JI6 L;  2OWO A;  4BY7 B;  3I8Z A;  3ONA B;  1ENC A;  3I4N G;  2B2Y C;  4WRD A;  3K5L A;  1GUN A;  3DEP A;  2JA5 B;  4NB3 A;  5IYC H;  4J15 A;  3CAM A;  2FXQ A;  1WCM G;  4DGZ A;  2EQS A;  1LTI D;  3KLW A;  2Y0S B;  4IFD J;  4R1J A;  5I9O A;  4DR1 Q;  2IWH A;  1TR5 A;  4WJW A;  1JJ2 A;  4CKC A;  2OEO A;  2N49 A;  1F77 A;  3H0G G;  3K0Y A;  5KYL A;  1KXL A;  4LFA L;  2MNA A;  3BVG A;  2NTS A;  3JAM c;  4PNY A;  3OWF A;  1WCM B;  4JOI C;  3GTG H;  2N8N A;  3X3M A;  3ND8 A;  1SND A;  2A6E C;  4IOC A;  4BY1 B;  1WOC A;  4B9W A;  2VUM B;  1SYC A;  2Z1C A;  3HOV B;  1L0Y B;  3ITP A;  1IYJ B;  1SSO A;  3MXU A;  1BDO A;  2NTT A;  4H02 A;  3J80 c;  3MVV A;  3P1H A;  2LKV A;  1BCP D;  1WI5 A;  1CQV A;  1EIG A;  2M00 A;  3MZ5 A;  1Q81 C;  1K8A C;  2PI2 A;  1O78 A;  1TWF H;  2F03 A;  1PZJ D;  4N9P A;  3KJO A;  2Q8R E;  3GTM B;  4IUQ A;  3S14 H;  2F0J A;  3GV6 A;  2EPB A;  1GHJ A;  3U4V A;  1R4Q B;  3MXG A;  4B3M Q;  1KRS A;  2WV6 D;  1VQJ A;  1X55 A;  2J4X A;  1VQ6 A;  3CCQ A;  2F0O A;  4QJF A;  1DON A;  3SR1 A;  1C4Q A;  4BBR G;  4LF8 Q;  3KFU A;  2KQ3 A;  2R7F A;  3KF6 B;  4O1N A;  4LF5 L;  1TWC B;  1TWF B;  4JI8 L;  4A3E H;  5M3M H;  3RUZ A;  3SXH A;  2GVB A;  5FLM G;  2JEB I;  3CQZ B;  3ERO A;  2E5L Q;  4X66 L;  3S16 B;  2PQA A;  3G6E A;  4BBS G;  5I4D A;  1HRJ A;  4ZQ3 A;  1G6Z A;  5BR8 L;  3CHB D;  2E5L L;  4RKB A;  1VF5 C;  1B3A A;  1BCP C;  2L1B A;  1GD7 A;  1JOO A;  2K04 A;  4R4I A;  1UE6 A;  3GTP B;  2NVQ H;  2KBN A;  2RDG A;  3PF5 A;  1F9P A;  2A6E D;  5EBC A;  4OL7 A;  1E2Z A;  5LMN L;  2WAQ G;  5T1G A;  1TY2 A;  4WFN 3;  4MTN A;  1G6P A;  2LS0 1;  3TSS A;  1ASZ A;  3HZX A;  4A3J H;  1I50 B;  3PO2 G;  4APV A;  5GAD C;  4L63 B;  5FJ8 H;  1KDB A;  1QG7 A;  3QR8 A;  1B2T A;  2AQ1 B;  5NUC A;  1HQM C;  5C44 G;  3OTO Q;  4YWL A;  3OWE B;  1L1O A;  3CU7 A;  4C3H G;  1XJV A;  4DFA A;  3N52 A;  2DGY A;  1KAB A;  1JIC A;  4HJ8 A;  2RVL A;  1DYQ A;  4GKK L;  2HDM A;  5ISR A;  4JI0 L;  1YIJ A;  1S5B D;  2QCP X;  3E3X A;  4CDE C;  5CBA E;  2KEE A;  1EQR A;  1PV4 A;  3OW7 A;  1A6X A;  3U9O A;  3HOY H;  1EIH A;  1PRT B;  4X3K A;  4KKS A;  5C3E G;  4CDD C;  1CI3 M;  3UDG A;  4YHH Q;  4R4C A;  1X3F A;  3M7N A;  5EBD A;  1Q3L A;  3A7L A;  3KYH C;  2EY1 A;  3NSW A;  1OTC A;  4DK6 C;  1GHK A;  1Q1B A;  1XMO L;  2A19 A;  3RD4 A;  1LM0 A;  4KD4 A;  4UY8 C;  2NVY B;  4KHV A;  1O80 A;  1PH8 A;  1QZG A;  4M8A A;  3M4O B;  2NZH A;  4JI1 L;  5CMD A;  5K36 G;  1FJG Q;  1DD2 A;  4G7H C;  4PV1 C;  4N8X 1;  2C5C A;  1B44 D;  2CHB D;  5K5P A;  1HNZ L;  1RD9 D;  1B50 A;  5DM6 3;  1I94 Q;  5F2D A;  3A0J A;  4BXX H;  3CQZ H;  1LTT D;  4LF5 Q;  5EGT A;  5JJI A;  4GLA C;  4DV3 Q;  2QIL A;  3TRE A;  3KLR A;  4DAV A;  1SYD A;  3NUC A;  5IYC G;  2F0D A;  5EKK A;  1WCM H;  5KRU A;  4A3I G;  1PRT F;  3W5O A;  4JOI A;  1MI2 A;  3CME A;  1A0I A;  4F8M A;  3PIP 3;  2OCE A;  1IKL A;  4A3K H;  1K8G A;  1ZEQ X;  1Y8N B;  1EUJ A;  5C4X B;  1CKM A;  4A75 A;  4B3T L;  1KTK A;  2F3I A;  2XSC A;  3EN2 A;  4XT1 B;  3T51 B;  2ATW A;  1QNK A;  3NBH A;  1N36 L;  2DY7 A;  1SLJ A;  4KD3 A;  1N33 L;  3T1Y Q;  2K5V A;  2B2Y A;  4QIW B;  1Q1E A;  3VR4 A;  1HNW Q;  1YHB A;  2AKW B;  4J8Q A;  1P8L A;  2I5L X;  3IKJ A;  3EFX D;  5IT9 L;  4OX9 L;  1LUZ A;  3HKZ G;  1XNR L;  1JB7 A;  2F3V A;  4HSV A;  3PUX A;  2D5D A;  3OTO L;  3R2I A;  1EEF D;  1MHW C;  1TS2 A;  1SYE A;  1FGU A;  1I6H H;  3NQI A;  1KDA A;  5COY A;  5CV5 A;  2Q2H A;  3RLO A;  4ZAI A;  1U4L A;  1NCV A;  1V43 A;  2MP1 A;  1E3P A;  2EY2 A;  4DUY L;  1LYL A;  5LMU Q;  1KAA A;  4BBR H;  2D9U A;  4ZKB B;  1SEB D;  1JJC B;  3D4R A;  1K3R A;  4JK1 C;  1M90 C;  1CKO A;  1RTO A;  4JV5 L;  4IO9 A;  4K5X A;  2B2T C;  1BKB A;  3DHQ A;  3PO2 B;  4C3J B;  3W1B A;  2VQF L;  1GXD C;  5A2Q E;  1BOS A;  3F2C A;  1RKN A;  5IYB H;  1G8Z D;  4LF7 L;  2QKI C;  1STN A;  3ND9 A;  1YNN D;  3PIP A;  1PFB A;  4KLK A;  3L9A X;  5M3F B;  3S1Q B;  1A62 A;  4ZRZ A;  1NTG A;  5IWA Q;  1I3Q B;  1B9M A;  2EIF A;  3L0O A;  2OTJ A;  2UXD L;  1E0B A;  3M4P A;  4A3F B;  4GNX A;  4O2D A;  4IPD A;  1D2B A;  1NSN S;  2QEX A;  5C3X A;  3FKI H;  4C1N I;  2EY5 A;  1AP0 A;  3H0G B;  4CDF C;  1C8C A;  3M4O H;  4YCW A;  2V1C C;  4H13 C;  4A3J G;  3NEL A;  1SE2 A;  1X9N A;  3M9B A;  5C0X I;  2G5D A;  1QOH A;  2UU9 Q;  3C1F A;  3H3V C;  4K5W A;  1C9O A;  2Z9H A;  1STE A;  4HED A;  2VY3 A;  3TZU A;  2GVA A;  1GOZ A;  2MGS A;  3T56 B;  3C3L A;  3DM3 A;  4B08 A;  2XVS A;  3PIO A;  4LWC A;  3GQB A;  5AJ3 Q;  4DR1 L;  1Y1W B;  2JA8 H;  1EOV A;  2PZT A;  1EQV A;  2KCN A;  4C3I G;  5IOC A;  4OWW B;  2K32 A;  3MC0 B;  3A8I E;  1K83 H;  1E24 A;  1SYB A;  1MJE A;  1Y1V H;  2KEC A;  1UAP A;  1PTO D;  3N6R A;  1HR0 L;  2E75 C;  4JBM A;  3I4M G;  4L5S A;  1AN8 A;  5ELC A;  1YVC A;  5GAG C;  3HOW H;  2JEA I;  4K2K A;  4C2M H;  1D1I A;  1JR0 D;  5M5W B;  3D4D A;  4X62 Q;  4H0L C;  2LFN A;  5CC4 A;  1DGS A;  4DV4 L;  2JK8 A;  1IL8 A;  2RBM A;  3PUV A;  3VR6 A;  2VQF Q;  2ZJP A;  3GTO H;  5EKL A;  4NPS A;  5C5M A;  4LMQ D;  3WWV A;  2HQE A;  4DV4 Q;  5KEE A;  2WP8 J;  4B3M L;  1CQF A;  5C0X H;  1HZ9 A;  4AQY Q;  1IW7 C;  2RHS B;  3CPW A;  2YTV A;  5A2Q L;  3MEF A;  1DXM A;  4A3K G;  2Q8I B;  3CF5 A;  4YCU A;  3K8A A;  2L12 A;  1FNV A;  5E4W C; 
#chains in the Genus database with same CATH homology
 3STB C;  4LUV A;  3M4Q A;  3GTK H;  1XNQ Q;  1LTL A;  3S1R H;  1Q82 C;  4LUZ A;  2VUM G;  2D62 A;  3EIV A;  4BA1 I;  3RNU A;  1IBL L;  4GN4 B;  3H15 A;  3I2Z A;  4JI8 Q;  3RLF A;  4QL5 A;  2JA7 G;  3K81 C;  3HOY G;  4KHP Q;  2C35 B;  3PUY A;  4P73 A;  4LF9 Q;  1G29 1;  2UU9 L;  3KDF A;  3CW2 C;  4MNO A;  1XPU A;  1VCI A;  4P72 A;  1PH9 A;  1KAW A;  2RHQ B;  3CP0 A;  4JI1 Q;  2PI2 E;  1MIU A;  4NXN L;  2IT1 A;  4JCV E;  3I4O A;  2IHE A;  3HOV G;  1S3O A;  3J7Z C;  4DAM A;  1HR0 W;  3I55 A;  3S17 H;  1HNZ Q;  4AYB G;  3F8T A;  1MKH A;  1B70 B;  5HGQ A;  3Q8D A;  2Z0S A;  5GAH C;  4DV5 Q;  2BA0 A;  1X3E A;  4XTC S;  4DR2 Q;  2I0Q A;  2JA5 G;  1X56 A;  3U4Z A;  4DKA C;  1IXR A;  1AE3 A;  2HT1 A;  1PH1 A;  2L15 A;  1L0W A;  3CXC A;  3PO3 G;  1TWA H;  3TS2 A;  2ZTC A;  1QUQ B;  3GTQ H;  3PF4 A;  4FDB A;  1KC8 C;  2ES2 A;  3M3Y H;  4OO1 G;  2AWO A;  3TS0 A;  2Q2U A;  1L1O C;  3A74 A;  1Q46 A;  1Z47 A;  4GS3 A;  3CCJ A;  2KHI A;  4NXM L;  4HJ9 A;  1N36 Q;  5IWA L;  3GTP H;  3E9H A;  4B3T Q;  5IP7 G;  2QA4 A;  4LFC L;  4BXX G;  1PH2 A;  4JI6 L;  4DV3 L;  1YIT A;  2OWO A;  1N33 Q;  1O7I A;  3I4N G;  3J81 c;  4A3G G;  1SMX A;  3GO5 A;  1BBU A;  1PH4 A;  3K7U C;  4JI6 Q;  4DUY Q;  4NB3 A;  3HOX H;  1XTD A;  1IZ6 A;  4J15 A;  4R4T A;  5IYC H;  4ME3 A;  3CAM A;  2FXQ A;  1YHA A;  1NY4 A;  4MZ9 A;  1WCM G;  4Y7N H;  4DV2 L;  1PA6 A;  2EQS A;  3KLW A;  1QVC A;  1K9M C;  3CCU A;  1A8V A;  3BJU A;  4BY1 G;  3HOU H;  1I50 H;  4R1J A;  4IFD J;  4A93 G;  1NBW A;  3HOZ H;  3PCO B;  4DR1 Q;  3CCS A;  4BY7 G;  4A3F G;  1CSP A;  4DUZ L;  3S1M H;  4A3B H;  1JJ2 A;  2KCT A;  1PH5 A;  2N49 A;  2NN6 I;  3H0G G;  1EQQ A;  1M1K C;  5IYB G;  4OO1 I;  1KXL A;  4LFA L;  2MNA A;  3G4S A;  2IHF A;  2K5H A;  4LFB L;  4X64 L;  1KL9 A;  3JAM c;  4PZ8 A;  3U50 C;  2NVX H;  2R92 H;  4JI2 Q;  4JOI C;  2Z6K C;  4JC0 A;  4A3M G;  1XPR A;  2N8N A;  3GTG H;  4GKJ Q;  2OTL A;  1FJG L;  4RG1 A;  1C0A A;  4IOC A;  2DUD A;  5GRO A;  1X54 A;  4AQY L;  1CKN B;  2JE6 I;  1WOC A;  4IJL A;  1NE3 A;  3S16 H;  1SRO A;  4OXP A;  3T1Y L;  4JI4 L;  4OWT B;  2JA9 A;  4YY3 L;  4IJH A;  1N34 L;  1VQP A;  1IYJ B;  4LF4 Q;  3CC2 A;  4LF6 L;  2NVY H;  4H02 A;  3J80 c;  2N78 A;  5DLQ E;  3GDE A;  3L7Z C;  3ULP A;  1WI5 A;  3FKI G;  1QUQ A;  3NEN A;  1K8A C;  4JI7 Q;  4L5Q A;  4ALP A;  2PI2 A;  1XMO Q;  3I7F A;  1Q81 C;  1TWF H;  4JYA L;  2I5H A;  3RR5 A;  3KJO A;  2YTX A;  3CMA A;  4DR5 Q;  4HIO A;  3S14 H;  2AHO B;  2IY5 B;  2YV5 A;  1VQ9 A;  3U4V A;  1B7Y B;  4B3M Q;  2PNH A;  1KRS A;  1V9P A;  3S1N H;  1EIF A;  1VQD A;  3A5Z B;  4DR6 L;  2JA6 G;  1VQJ A;  1X55 A;  3OW2 A;  4QQB X;  2Q2T A;  3S2H H;  1VQ6 A;  3CCQ A;  2BA1 A;  1Y1W H;  4QJF A;  3F2D A;  4BBR G;  4DR2 L;  2F4V L;  4LF8 Q;  1VQF A;  3KFU A;  3KF6 B;  2R7F A;  4B3S Q;  4LNQ A;  4LUO A;  4A3C G;  3E0E A;  4IPC A;  2B63 G;  3T1H Q;  2R7Z G;  4LF5 L;  2R93 H;  1EYG A;  2F4V Q;  3JAM i;  4NXN Q;  4YWM A;  1PFS A;  2GN5 A;  1Z9F A;  4JI8 L;  4A3E H;  5M3M H;  4R4Q A;  2R6G A;  3NEM A;  1OXX K;  2GVB A;  5FLM G;  4YWK A;  1I3Q H;  2JEB I;  2E5L Q;  4X66 L;  2PQA A;  3G6E A;  1N8R C;  4JI5 Q;  2JA8 G;  4BBS G;  2K75 A;  1YJN A;  4C3I H;  5BR8 L;  1VS0 A;  3GTJ H;  2UUC Q;  4JG2 A;  3ZJY C;  2E5L L;  1N32 Q;  4UP8 A;  1RIP A;  4PG3 A;  4GN3 B;  1Y1V G;  5AJ3 L;  3K80 C;  4QIW E;  3B6Y A;  1WJJ A;  4QY7 A;  2JJQ A;  4JBK A;  1GD7 A;  2CWP A;  3FHW A;  1HR0 Q;  3I4M H;  1TWC H;  1U0L A;  4R4I A;  1UE6 A;  1VQN A;  5M3F H;  3CC4 A;  2NVQ H;  1R9T H;  2UXD Q;  2HHH Q;  2VS1 A;  2CFM A;  2UXB Q;  1E1O A;  2MO1 A;  2VL6 A;  1D8L A;  2MQH A;  2KBN A;  1EWI A;  4LFC Q;  1VQM A;  4HIK A;  3PF5 A;  1KIX A;  2XGT A;  4XIG S;  4JI3 L;  3KF8 B;  3AFQ A;  1PYS B;  3CCR A;  1Y14 B;  1IBM Q;  1BVS A;  5LMN L;  2WAQ G;  4GLV B;  1GO3 E;  2K4K A;  4MTN A;  1G6P A;  1ASZ A;  4JI3 Q;  4JV5 Q;  4A3J H;  4JI4 Q;  4KHZ A;  3CCM A;  3PO2 G;  4APV A;  1X6O A;  4EQ5 A;  3CPF A;  5FJ8 H;  4YY3 Q;  2QGQ A;  5GAD C;  1X3G A;  1G51 A;  5IYD G;  3D31 A;  5C44 G;  5C0X G;  3UE1 A;  3OTO Q;  4YWL A;  4DV1 L;  3FP9 A;  4JI2 L;  1L1O A;  4GKJ L;  1NMG A;  3LGJ A;  1H95 A;  1XJV A;  2E2H H;  5E7N A;  1GVP A;  2DGY A;  3S15 H;  3HKS A;  2B3G A;  4HJ8 A;  4DV0 L;  2ZTD A;  4B3R Q;  2VW9 A;  2WAQ E;  4OX9 Q;  4GKK L;  1EFW A;  2UXC L;  3S2D H;  2B29 A;  4JI0 L;  3GD7 A;  4GLX A;  1E1T A;  1YIJ A;  2VUM H;  3PSI A;  4LF6 Q;  3SGI A;  1XNQ L;  2N3S A;  1PV4 A;  1V1Q A;  2IX0 A;  1VQH A;  1EQR A;  3ER0 A;  2R7D A;  2JA7 H;  3HOY H;  4A3D G;  3VDY A;  4IFD G;  1Q8K A;  1VQ7 A;  1VQL A;  5C3E G;  4X62 L;  2EXD A;  3UDG A;  5JEA G;  1YBY A;  4YHH Q;  4R4C A;  1X3F A;  5ELN A;  2ZM6 Q;  4UPA A;  3M7N A;  3KYH C;  1CSQ A;  3G71 A;  3CC7 A;  2ZJR A;  5JJL A;  4AH6 A;  3HOV H;  1OTC A;  2KHJ A;  4DK6 C;  1KQS A;  3K7A H;  1Q1B A;  5JEA J;  2A19 A;  2VQE L;  1LM0 A;  5C0X J;  1XMO L;  5IP9 H;  4UY8 C;  3KDF B;  4JYA Q;  1PH8 A;  1QZG A;  2NZH A;  4JI1 L;  1YJ9 A;  5K36 G;  1FJG Q;  3JC6 6;  4OWX B;  3J7A 5;  2D0P A;  2MO0 A;  4IPG A;  3HOW G;  1UE7 A;  1B8A A;  1HNZ L;  4X66 Q;  4DV7 Q;  1HNX L;  2VZA A;  4B3S L;  1I94 Q;  4A3L G;  1NJI C;  1HZB A;  1W3S A;  3A0J A;  5IP7 H;  1VQ5 A;  3CQZ H;  4L5R C;  5C4X H;  4BXX H;  1WYD A;  4LF5 Q;  1VQ8 A;  3S24 A;  4GLA C;  5JJI A;  4DV3 Q;  3I4N H;  4A3G H;  1JJG A;  1HZC A;  3TRE A;  4DNI A;  3UDI A;  3PV0 A;  2Y0S E;  3AFP A;  1PH3 A;  1E7Z A;  1I5F A;  4C3J H;  2CCZ A;  4NXM Q;  5IYC G;  3MXN B;  1WCM H;  4HJ7 A;  4UP9 A;  4DPG A;  4A3I G;  5ELO A;  3W5O A;  4JOI A;  3CME A;  3HOU G;  1HNW L;  4IOA A;  3ULL A;  4BY7 H;  2MFI A;  1A0I A;  1Q7Y C;  4WJ3 M;  2OCE A;  2CKZ B;  1T9H A;  1S72 A;  4A3K H;  3K0X A;  5LMN Q;  1J6Q A;  1K8G A;  1EUJ A;  3AYH B;  1CKM A;  1L2F A;  4GN5 A;  4A75 A;  4B3T L;  3EN2 A;  2F3I A;  2Y0S G;  4LFA Q;  5M5X H;  4DK3 C;  1YHQ A;  3CCE A;  4A3M H;  2NZO A;  1VQK A;  2ATW A;  2YTY A;  1N36 L;  1XPO A;  4LF9 L;  3DLL A;  4WJ4 A;  4GOP B;  1SLJ A;  3S1Q H;  2ALY B;  1E22 A;  5IT9 c;  4TQU S;  1N33 L;  5HY6 A;  3J81 i;  4DV5 L;  1ASY A;  4DAY B;  3T1Y Q;  2NVT H;  2K5V A;  1Q1E A;  3HFZ B;  3F2B A;  1YHB A;  2AKW B;  4DR6 Q;  1HNW Q;  2OQ0 A;  2K52 A;  1P8L A;  1N34 Q;  2HIX A;  1VQG A;  2D0O A;  2I5L X;  5FLX c;  1PH6 A;  4OX9 L;  2PMZ E;  1LUZ A;  3HKZ G;  1XNR L;  3GTL H;  1JB7 A;  1VQO A;  1AH9 A;  2VNU D;  4JI0 Q;  3PUX A;  2JA5 H;  4O0A A;  3OTO L;  4HIM A;  2LSS A;  1OXV A;  4KI0 A;  4GNX C;  1XNR Q;  3PO3 H;  1MJC A;  5J3B A;  4LFB Q;  4DR3 Q;  1J5E Q;  4DUZ Q;  3UE0 A;  5H1S E;  3CD6 A;  4DR7 Q;  2A1A A;  1FGU A;  5M5Y H;  3KJP A;  4A76 A;  1I6H H;  2UUA L;  4RMF A;  1YI2 A;  2PQA B;  2ASB A;  2Q2H A;  3RLO A;  5C4J H;  1VQ4 A;  1HH2 P;  4DV2 Q;  1K73 C;  5LMU L;  3BU2 A;  1V43 A;  2JA6 H;  5JJK A;  1D7Q A;  3RN5 A;  3H3V I;  2UUA Q;  4HJA A;  1E3P A;  3UDF A;  1W2B A;  1SN8 A;  4DUY L;  1LYL A;  5EAY A;  4BBR H;  5LMU Q;  4BA2 I;  3HOX G;  4JBW A;  4PMW A;  1JJC B;  1K3R A;  4A3C H;  2B63 H;  1XMQ L;  2R7Z H;  3G48 A;  1CKO A;  1TWG H;  2Q2I A;  1M90 C;  4JV5 L;  1PVO A;  4IO9 A;  4P75 A;  4BY1 H;  3NBH B;  2Z6K A;  4A93 H;  3HOZ G;  4IFD I;  4YCV A;  2F52 A;  1IBK Q;  1BKB A;  4A3F H;  1EIY B;  1BBW A;  2VQF L;  2ZTE A;  3W1B A;  2VQE Q;  4A3B G;  4YHH L;  3ERS X;  1IL2 A;  1PHJ A;  3AEV A;  3H0G H;  3F2C A;  4BBS H;  5IYB H;  2NN6 G;  4LF7 L;  2R92 G;  3PIP A;  1AE2 A;  1QZH A;  1VQB A;  5IE8 A;  2UUC L;  1PYB A;  4B3R L;  1PH7 A;  4KLK A;  2E2J H;  4QGU A;  1YEZ A;  3U58 A;  4X65 L;  3BZC A;  2OQK A;  4UP7 A;  1A62 A;  1QVF A;  1NMF A;  2XTI A;  5BR8 Q;  1NTG A;  1TWH H;  4PZ7 A;  1KRT A;  5IWA Q;  1K0R A;  3M85 A;  2CQO A;  4K0K L;  2EIF A;  3L0O A;  2OTJ A;  2UXD L;  1IBL Q;  1KD1 C;  2UXB L;  4HID A;  3M4P A;  4GNX A;  4O2D A;  4IPD A;  4L5T A;  1OXU A;  4KHP L;  2QEX A;  2K5N A;  2ZM6 L;  3FKI H;  1CKN A;  1SE8 A;  3ICE A;  1FL0 A;  1UWV A;  3ULJ A;  1Q86 C;  2LXK A;  4P74 A;  3TEH B;  3M4O H;  1JE5 A;  4YCW A;  2V1C C;  5LMN W;  4A3J G;  4TVA B;  3KF6 A;  1SRU A;  1P16 A;  1UEB A;  1VQE A;  2ID0 A;  3NEL A;  4LF8 L;  1X9N A;  3M9B A;  5IYD H;  5C0X I;  3PGZ A;  1YZ6 A;  5C44 H;  2YYZ A;  3OYY A;  3AQQ A;  1C7Y A;  2UU9 Q;  3TQY A;  1HNX Q;  3BZK A;  4AIM A;  3PUW A;  3W1G A;  3H3V H;  1L1O B;  1Y1W G;  1C9O A;  1GM5 A;  1JMC A;  3RZD H;  2HQL A;  1YNX A;  2HHH L;  1UE1 A;  4HJ5 A;  2VY3 A;  1A63 A;  4Y52 H;  1JT8 A;  2GVA A;  4POF A;  3T1H L;  1UE5 A;  4P71 A;  1OXS C;  2BH8 A;  4GOP C;  2R93 G;  3DM3 A;  2K14 A;  3PIO A;  4LWC A;  4DV6 Q;  4A3E G;  5GQO A;  1YJW A;  5M3M G;  4GOP A;  4AYB E;  1GKH A;  3I56 A;  1X65 A;  4A3D H;  5AJ3 Q;  1U5K A;  4DR1 L;  5FLM H;  5C3E H;  5GAE C;  5M5W H;  4DV6 L;  1IBM L;  2UXC Q;  2K50 A;  2JA8 H;  1EOV A;  1RL2 A;  3GTM H;  1N32 L;  2LXJ A;  3F1Z A;  2CWA A;  4DR3 L;  1J5E L;  4OWW B;  4DV1 Q;  4LW1 A;  4GNX B;  1S40 A;  4X64 Q;  1K83 H;  3L2P A;  1E24 A;  1MJE A;  1SFO H;  1Y1V H;  2ZJQ A;  3RZO H;  3RN2 A;  2YU9 H;  3UDX A;  5IP9 G;  1HR0 L;  1CUK A;  2H5X A;  1Q12 A;  1OXT A;  4JBM A;  2KEN A;  4L5S A;  3I4M G;  3PUZ A;  3A5U A;  3D0F A;  3IRB A;  1YVC A;  1VQC A;  2E8G A;  1VQI A;  4IPH A;  5GAG C;  5M3F G;  1IBK L;  2BH2 A;  3HOW H;  4DR7 L;  1TXY A;  3EBE A;  2JEA I;  4LF4 L;  3CCL A;  4A3L H;  4C2M H;  1HJP A;  4LF7 Q;  1N9W A;  1I94 L;  5C4X G;  3E9I A;  2WFW A;  4X62 Q;  4JBJ A;  1DGS A;  4JI7 L;  4DV4 L;  2AMC B;  1SR3 A;  2JK8 A;  4X65 Q;  4DV7 L;  3PUV A;  2WB1 G;  3J80 i;  2VQF Q;  2ZJP A;  4R4O A;  4EX5 A;  1QVG A;  1XMQ Q;  3GTO H;  4NPS A;  4DV4 Q;  3WWV A;  3PO2 H;  2UUB Q;  4POG A;  1FVI A;  2WP8 J;  3KOJ A;  5FJ8 G;  4PZ6 A;  4A3I H;  4K0K Q;  4B3M L;  2A8V A;  4DR4 L;  2IX1 A;  4A4I A;  1HZ9 A;  3HKZ E;  4AQY Q;  4GKK Q;  3CCV A;  2UUB L;  2JQO A;  2RF4 A;  4JI5 L;  1HZA A;  2RHS B;  1KHI A;  3CPW A;  2YTV A;  3J81 j;  4DR5 L;  4X6A H;  3MEF A;  2I5M X;  4C3H H;  4DR4 Q;  2RCN A;  4DV0 Q;  1WFQ A;  2E2I H;  3TRZ A;  4A3K G;  5IY0 A;  2KCM A;  4OON A;  2HIV A;  2WB1 E;  4YCU A;  3CF5 A;  3K8A A;  1VQA A;  3STB D;  2AWN A;  3RLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...