4BXXH

Arrested rna polymerase ii-bye1 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 23
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bxxH00
4OWWB 2YTXA 2MNAA 5GQOA 1X9NA 4X64Q 5GAGC 1HNXL 1E1TA 3SGIA 3GTQH 4AH6A 3IRBA 3RR5A 1XNRL 2JA7G 3I2ZA 1G51A 1J6QA 1UE6A 3FKIG 5IP7G 3CW2C 3PUXA 1KQSA 1K3RA 3PF4A 2PQAA 3KF6A 4DAMA 3D0FA 1EWIA 4YY3Q 3K7AH 4GNXB 3HOYG 3PO2G 1U0LA 1WJJA 1N34L 3PUZA 5BR8Q 2QEXA 1P16A 3CCJA 1ASZA 4NXMQ 2NZOA 4B3RQ 1I6HH 1GO3E 3HOUG 4BBRG 3ULJA 1VQNA 3HOVH 2JE6I 4A3IH 4YWMA 1QVGA 1Q86C 4PZ7A 3CPWA 5DLQE 4LF7L 4IPGA 4LF9Q 3HKSA 1UEBA 4X6AH 4LFCL 4HIDA 4POFA 4LF4Q 4JYAL 3GO5A 1TWGH 1VQOA 4DUZQ 4LF5L 3CMEA 4JI8Q 1XJVA 4BBSH 2VZAA 1L2FA 2KCMA 2JA8H 1FVIA 4P72A 2R6GA 1YI2A 2B63G 1Y14B 3RLOA 4JI3L 5IYBG 2VW9A 1KD1C 1MIUA 3NBHB 1QVCA 3CCUA 3S1MH 3PUWA 1HNXQ 1T9HA 4GNXC 3ICEA 3H3VH 3S1NH 5JJKA 2LXJA 1TWCH 2R93G 2B29A 1VQFA 1VQEA 4MZ9A 3ULPA 4GOPA 4OONA 1YHBA 3CQZH 2ZTEA 3A5ZB 3RLFA 5FLMG 4DR6L 2Q2IA 1AE2A 3UE0A 1A8VA 1Q8KA 5C3EH 3LGJA 1N34Q 4A3CH 2RF4A 1TXYA 1YITA 2JA5H 1Q12A 1S3OA 1VQBA 2V1CC 4GOPC 1SLJA 3D31A 4TVAB 2NN6I 1TWFH 3CCRA 4A3LG 1CKNB 2YTYA 1V43A 1X56A 4PZ8A 4DV7L 3CCLA 4A3KG 4JI2L 4LF7Q 3B6YA 5IT9c 4X62L 1PYBA 4LF6L 4QY7A 4LFCQ 4P71A 5FLXc 1IBLL 3HFZB 2YTVA 4JYAQ 1EQRA 2AKWB 1PVOA 1PH3A 5C4JH 3J7ZC 4LF5Q 3S15H 1JT8A 1Z47A 2VQFL 2UUCL 3J80c 3KJPA 4DR2L 1VQCA 5JEAJ 1X54A 5C0XJ 3E0EA 2UXDL 2PMZE 3F1ZA 2MQHA 1B70B 3STBD 4JI3Q 1PYSB 1CKMA 1YEZA 2NVQH 1M1KC 2RHQB 1PH1A 2CCZA 3ER0A 2D0OA 4L5TA 4JI1L 1KC8C 4IPCA 3PIOA 4GLXA 2R7ZH 4UP9A 4BXXG 1D7QA 1G291 3CC7A 4YWLA 4A3FG 4DPGA 1BBWA 2K5HA 5M3MH 2UUAL 2VUMG 3PO3H 4DR6Q 4DR5L 2HIXA 4IFDI 4H02A 1PV4A 3E9IA 1K83H 1KRTA 1YJNA 4A3BH 2DGYA 1MKHA 1PH9A 1W2BA 5M5WH 1VQGA 4MTNA 2HT1A 3EBEA 5M3FH 4A93G 4K0KQ 3RN5A 4QGUA 4DV7Q 3PV0A 2Z0SA 4DK6C 1CUKA 4DR1L 1A0IA 4JI2Q 4X62Q 4DV6L 2UXBL 4NB3A 4LF6Q 1IXRA 1OTCA 1NE3A 4L5SA 2QGQA 5C44H 2GVBA 5IYCH 4DV0L 3HOZG 3KYHC 4BA1I 1IYJB 3CF5A 2VQFQ 2UUCQ 3BJUA 1L1OB 1D8LA 3CPFA 1SROA 4J15A 4DR2Q 3CC2A 2UXCL 1A63A 1A62A 2UXDQ 4AIMA 2E8GA 1VQIA 1S72A 1GD7A 3J81i 1I5FA 3NELA 3ZJYC 3HOXH 1IBKL 3GTMH 3M7NA 3H3VI 3TRZA 4WJ4A 4JI1Q 2ZTCA 5M5XH 3M4QA 1YJ9A 2K14A 1OXVA 1UWVA 3BZKA 1EQQA 4A3GG 5FJ8H 5IY0A 5IYDG 2UUAQ 1QUQA 2YYZA 4DR5Q 2JA6G 1QVFA 1XMQL 5H1SE 2CQOA 2YV5A 2NVTH 1EIFA 5HGQA 4GLAC 1VQDA 1JE5A 4JG2A 1HH2P 4DV5L 3TS0A 3PUVA 2R92H 3M4OH 1Q1BA 2A8VA 4KI0A 1WCMG 4UP7A 5ELNA 2MO1A 5C4XH 4JOIC 3A5UA 2N49A 4QJFA 4WJ3M 1HR0W 4O0AA 4YHHQ 3G6EA 4DR1Q 1L1OC 4A3MG 2E2JH 4FDBA 1HNWL 2IHEA 1SMXA 4DV6Q 2UXBQ 4C2MH 5JJLA 2JA7H 4A3DH 4DV0Q 3UDGA 3FKIH 5IP7H 5LMNL 4BY7H 3G48A 3JAMc 4HJAA 3GTJH 2ZTDA 4GLVB 4A75A 3HOVG 4BA2I 1VQJA 1Y1WG 2UXCQ 4RMFA 4LNQA 2A19A 2Q2TA 3PO2H 2AWOA 4GNXA 1WYDA 2K52A 2FXQA 4YCUA 1EOVA 3KF8B 3FHWA 4JBJA 1SFOH 1IBKQ 2IX0A 2VY3A 1ASYA 4B3ML 5JEAG 3L2PA 1X3FA 5C0XG 3HOUH 4BBRH 2AHOB 1UE7A 2JA9A 4AYBG 4BBSG 1XTDA 2IY5B 2KENA 4NPSA 2EIFA 4JV5L 4HJ7A 1VQ7A 2WP8J 4DR3L 1XMQQ 1E22A 4A3JG 4LFAL 1UE1A 4BY1H 4DV5Q 3AFPA 4QIWE 1VCIA 3U4VA 4O2DA 4GN5A 1M90C 2HHHQ 2PI2A 1XPUA 2E5LL 2Z6KC 3BZCA 1VQ8A 3GTGH 1RIPA 1PH4A 3KJOA 4UP8A 3CCEA 1CSPA 4R4CA 5ELOA 1PH5A 2I0QA 2ASBA 1AH9A 1HNWQ 3EIVA 1HNZL 3GD7A 1U5KA 5C3EG 1XMOL 4IFDJ 2BH2A 2R93H 1YJWA 5LMNQ 2JA5G 3JC66 4ALPA 3F2DA 4K0KL 1VQ4A 5FLMH 4R4QA 2N3SA 4P73A 3U4ZA 3OTOL 4JI0Q 3I4MG 2K4KA 3S1RH 4QQBX 4LW1A 3CXCA 3KDFB 5IP9H 2JEAI 4ME3A 5GAHC 3KOJA 1LYLA 1RL2A 3PGZA 2GVAA 4B3MQ 1JJ2A 4R1JA 3S2HH 3J7A5 2RCNA 4X65L 1CKOA 2B3GA 1WFQA 4A3LH 1CKNA 1TWHH 4YCVA 4JV5Q 1VQPA 4A3KH 4DR3Q 4HIMA 4LFAQ 4OO1I 3MEFA 3CCVA 3M3YH 3CCSA 2C35B 2E5LQ 4GS3A 3NEMA 4AYBE 4IJLA 2OQKA 1HJPA 2KBNA 1JMCA 1N36L 4JBWA 4A76A 1N8RC 4LFBL 1JJCB 1KHIA 3I4OA 3OYYA 1CSQA 1HNZQ 1Y1VG 2BA0A 3CP0A 3KLWA 1QZHA 2GN5A 3G4SA 3VDYA 1K8GA 1XMOQ 1Q7YC 3TQYA 3K7UC 2L15A 5J3BA 2E2IH 3GTOH 4C3IH 1LUZA 4X66L 5M5YH 1B7YB 3GDEA 1VQAA 2NVYH 2ZJPA 1YVCA 2JEBI 4A3FH 4YHHL 1IBML 3I4NG 4XIGS 4DV3L 1NY4A 1R9TH 1KAWA 3OTOQ 1VQMA 5GAEC 2IX1A 4QL5A 4JI5L 1DGSA 4HIOA 3K80C 4EQ5A 4A3EG 4EX5A 4IO9A 2XGTA 3L7ZC 4LUOA 2K50A 1Q82C 2ATWA 3HOWH 1K9MC 3M85A 3UDIA 3CCMA 2WB1G 1SN8A 2NN6G 2OCEA 5IYCG 4X65Q 5C44G 2UUBL 1PA6A 2MFIA 3L0OA 3PIPA 3CAMA 1KL9A 3E9HA 4IOAA 5E7NA 2CWAA 2D62A 3RNUA 1QZGA 1NTGA 4R4IA 2F3IA 1TWAH 4JOIA 1L0WA 4IPHA 1PH7A 1MJEA 3UDFA 2LSSA 3DM3A 4HJ5A 4UPAA 4B3TL 1L1OA 2NVXH 2NZHA 1W3SA 1N36Q 5FJ8G 1FJGL 2Q2UA 4LFBQ 2ZM6L 4JCVE 1PH8A 5K36G 1FL0A 3PUYA 4APVA 2BA1A 1EUJA 3F2CA 2CFMA 3M4PA 2HHHL 1YBYA 2JQOA 4OO1G 3T1HL 1X55A 3BU2A 3J80i 4C3HH 4YCWA 2PQAB 3H0GH 3KF6B 1K0RA 3AYHB 4NXNL 1V1QA 3RLNA 3U50C 4X66Q 1XNQL 1IBMQ 4A3GH 5IYDH 4DV3Q 5C4XG 3S14H 2E2HH 3ULLA 3S1QH 4IFDG 2JA6H 4JI5Q 2IHFA 3RN2A 4KHZA 1SR3A 2XTIA 2MO0A 1BBUA 4DUYL 5IWAL 2UU9L 1I3QH 1WCMH 2WFWA 2ES2A 2KCTA 3CD6A 4A3DG 1P8LA 4AQYL 4A3IG 1XPRA 2UUBQ 1O7IA 1E7ZA 3CMAA 4JI0L 3U58A 3HOYH 4BY7G 1KIXA 1PFSA 3I55A 4A3MH 1WI5A 4DV1L 1NBWA 1K73C 5LMUL 1N33L 1HZCA 1E1OA 3STBC 1EYGA 3PCOB 2Z6KA 3CC4A 4JBKA 4LUZA 4DV2L 2WB1E 5AJ3L 2JA8G 4KHPL 4B3TQ 1GKHA 2K75A 5JJIA 1Y1WH 1FJGQ 4P75A 2KHIA 2VQEL 2OQ0A 2ZM6Q 1C0AA 3K0XA 1HZAA 3T1YL 3J81j 1E24A 3K8AA 1I50H 4DR4L 2IT1A 1VQKA 1I94L 3G71A 3T1HQ 4PG3A 4BY1G 4GOPB 4OX9L 2B63H 3AQQA 4NXNQ 1XNQQ 2Q2HA 4GKJL 1VQHA 2ALYB 5IYBH 3I56A 4C3JH 2Y0SE 1X3EA 4IPDA 3TS2A 4GKKL 4A3JH 1YZ6A 1VQ9A 2I5HA 4DUYQ 4JI7L 4A3CG 1KRSA 1OXSC 2LXKA 2WAQE 5EAYA 4L5QA 5IWAQ 4Y7NH 2UU9Q 2YU9H 4IJHA 1XNRQ 1PH2A 3A0JA 3KFUA 2N8NA 4AQYQ 3PF5A 2QA4A 4UY8C 1JB7A 3DLLA 1G6PA 1XPOA 1X65A 1Q1EA 1BKBA 4DV1Q 1N32L 5LMUQ 4JC0A 1N33Q 4R4OA 1BVSA 3Q8DA 1C9OA 1Z9FA 5IP9G 2PNHA 3H15A 3S24A 3J81c 3RZOH 3FP9A 1E3PA 4DV2Q 1HZ9A 4JI6L 5AJ3Q 5GADC 3S16H 1PHJA 1K8AC 2D0PA 2RHSB 3NENA 4KHPQ 3K81C 1GM5A 4POGA 1H95A 1WOCA 2DUDA 2HIVA 4B3SL 3I4MH 4LWCA 2VQEQ 3TREA 1HR0L 3T1YQ 4DR7L 3UDXA 4DR4Q 3KDFA 2JK8A 2VS1A 2F4VL 1VQ6A 1EFWA 1OXTA 5HY6A 3JAMi 1I94Q 1YHAA 2R7ZG 1LTLA 4OX9Q 1S40A 1NJIC 4LF8L 1EIYB 1VQLA 2ZJQA 2OWOA 3HKZG 5M3MG 3S17H 1GVPA 4GKJQ 2H5XA 3PO3G 1JJGA 4P74A 5GROA 3W1GA 3CCQA 2K5VA 4HIKA 1J5EL 3AFQA 3WWVA 1VQ5A 4GKKQ 4A3BG 3GTPH 2CWPA 2EXDA 4OXPA 4JI7Q 1VS0A 4LUVA 5LMNW 1Q46A 4BXXH 2A1AA 4HJ9A 4Y52H 1NMFA 4DV4L 3F2BA 2VUMH 1PH6A 4R4TA 4JI4L 1OXUA 5M3FG 2R7FA 2AMCB 4OWTB 2JJQA 2VNUD 2I5MX 4DK3C 4MNOA 1B8AA 4X64L 1N32Q 1Y1VH 2EQSA 2KHJA 4XTCS 1Q81C 1LM0A 4L5RC 1FGUA 1V9PA 3HOWG 4A93H 1OXXK 3I7FA 2VL6A 3M9BA 4JBMA 4JI6Q 1YNXA 1UE5A 3I4NH 1IZ6A 4YY3L 3GTKH 4B3SQ 1MJCA 2ZJRA 3TEHB 3UE1A 4GN3B 4DNIA 1HR0Q 1SE8A 4DR7Q 5BR8L 2F4VQ 3HOXG 4DAYB 2CKZB 2F52A 4A3EH 4NXML 3AEVA 2BH8A 3PSIA 1X3GA 3HOZH 4B3RL 1KXLA 4A4IA 1IBLQ 1N9WA 4LF8Q 3W5OA 5C0XI 3OW2A 3W1BA 2ID0A 1IL2A 4GN4B 2Y0SG 1QUQB 4TQUS 2AWNA 2HQLA 3A74A 4DKAC 1HZBA 2I5LX 3F8TA 1SRUA 1YHQA 2N78A 4HJ8A 3EN2A 1J5EQ 1AE3A 4IOCA 4LF9L 3S2DH 2WAQG 2OTLA 4LF4L 2R92G 3ERSX 4PZ6A 4YWKA 1NMGA 4OWXB 4DUZL 3MXNB 1YIJA 4JI8L 5IE8A 4DV4Q 2PI2E 1C7YA 3GTLH 2R7DA 3HKZE 1X6OA 2K5NA 4PMWA 4KLKA 3H0GG 4JI4Q 4RG1A 3RZDH 2OTJA
chains in the Genus database with same CATH superfamily
2CQAA 4QF4A 2MNAA 5GQOA 4HMIA 5GAGC 4LAAA 1E1TA 4JW0A 4K8JA 4AH6A 3IRBA 1G51A 2KA7A 4ULLA 1TWFB 1K3RA 3KF6A 2N88A 3D0FA 1EWIA 3CRLC 1SNOA 1WJJA 1RKNA 1STEA 1DCZA 1P16A 4DU9A 2J0TD 3ULJA 1WVLA 4YWMA 1Q90A 4PZ7A 4TRDA 4CJ1B 1H9KA 4IPGA 1UEBA 4X6AH 1KLGD 2A73B 1SXTA 5C0XH 3M3YB 4G7HC 3OMCA 4JI8Q 3K5OA 3PO3B 2JA8H 1PDQA 4P72A 4DXGA 1F9QA 1TR5A 3S1MH 1MIUA 1QVCA 1CHQD 1V1PB 3PUWA 4IALA 1EQTA 5IGFA 1K3BC 4GOPA 1CA6A 2B2WC 3CQZH 1Z6HA 2B8FA 5EPKA 3UE0A 1R9TB 1Q8KA 4R8NA 2WKDA 2RF4A 1TXYA 2JA5H 3J81L 1Q12A 2P5ZX 1S3OA 1VQBA 4K5WA 2OT2A 5LL6X 2O2LD 3R2TA 2Q8TA 3CCRA 4A3LG 2YTYA 1V43A 4N8X1 4A3KG 3B6YA 1S5ED 4LMQD 4QY7A 4LFCQ 4P71A 2M2LA 1TS3A 1JWUD 3S15H 4DAPA 4F87A 1EZ6A 1ZYRC 2F0LA 3K5MA 3DM1A 1SYEA 1KDCA 2PMZE 3E3XA 4JI3Q 3STBD 3LNNA 2NVQH 2B2UC 2B2TA 3ER0A 2XRQD 4IPCA 3PIOA 4BXXG 3H0GB 4C1NK 2H1EA 1G291 1IL8A 2E2JB 1DOMA 1Y8OB 3S1QB 2RSOA 3RD4A 4ZKCB 3E9IA 1K83H 1WTPA 5CC4A 1F2YA 2LKVA 1EIHA 1I3QB 4MTNA 2RCFA 3HOYB 1GUNA 4DR1L 1R4QB 3FMCA 3H09A 1A0IA 4X62Q 5I9OA 4LF6Q 1IXRA 1TIID 2QGQA 3KYHC 4KY5A 2LFNA 2F0UA 5ELDA 1D8LA 4DR2Q 2UXCL 2AUJD 1TU2B 4AIMA 3TP6A 4HCSA 2NUCA 3NELA 3D3RA 4DAYA 1MBYA 3TRZA 2WIIB 5M5XH 1YJ9A 2K14A 4CDFC 3ZYYX 4FXKC 5IY0A 4DR5Q 1XMQL 4OO1H 1EIFA 5HGQA 4GLAC 2B39A 1JE5A 3M4OH 1HH2P 2A8VA 3HZXA 2YU9B 1XX8A 4JVZA 1K28A 1LV9A 4JOIC 3A5UA 3AU7A 4O0AA 1HNWL 1FNUA 4FDBA 4DV6Q 1B2TA 3T56B 4A3DH 2KOLA 4HJAA 3IFDA 4OELB 4A75A 1VQJA 2Z8LA 3SR1A 2Q2TA 3PO2H 4GNXA 1A3TA 2CVRA 3TN2A 5FO8B 1WYDA 2K52A 2FXQA 3MVVA 3FHWA 2IX0A 3P75A 3NUCA 1EIGA 3ITPA 4CHTB 2KVMA 4B3ML 3MC0B 4AYBG 2KJXA 1EY4A 4Q0FA 1PZKD 4JV5L 2EJGC 4HJ7A 4DR3L 1AFPA 3V96A 3OHXC 4QIWE 2XN9C 1AZQA 1JOQA 4ZKBB 4O2DA 1XPUA 4A3FB 2E5LL 4X3SA 3BZCA 4CDCC 1EY0A 1MGSA 3CCEA 1CSPA 2ASBA 2AQ3B 5ELOA 1WD0A 3NSWA 1AH9A 3NBHA 2MHVA 4KMUC 5JVH3 1T5EA 4IFDJ 4K14A 3ONAB 5LL6S 4A93B 3F2DA 5FLMH 2E75C 1EY5A 1S5DD 4KKSA 2JEAI 1LYLA 2BDOA 2F3VA 3HG9A 5CBAE 1GUWA 1GHJA 2RCNA 4GZYC 5JPMC 2QILA 4KD4A 1VQPA 2G9DA 5CGKA 4HIMA 4LFAQ 4OO1I 1L0XB 3M3YH 4GS3A 3NEMA 4X3TA 2OQKA 1HJPA 1JMCA 2JA6B 3RZDB 4A76A 2XRSD 1Y1VG 3KLWA 1SBBB 2GN5A 4X3UA 3VYUA 4H44C 3AMUA 1CM9A 1MI2A 5I2YA 3GDEA 1HA6A 3I4NG 4XIGS 2K03A 1R9TH 4F8MA 1VQMA 1AP0A 1DGSA 3NQIA 4A3EG 5JOBA 4LUOA 2K50A 2ATWA 2HCIA 1I6HB 1GOZA 3VR2A 1OO9B 1S5BD 3CCMA 5C44G 1E2VA 1PA6A 4EVOA 1XWEA 2TMPA 3PIPA 1TVXA 4CKEA 3URYA 1QG7A 1SNDA 2L0CA 4IOAA 3VA7A 4IUVA 5E7NA 2D62A 1QZGA 3T53B 2F0NA 3FEWX 2EY6A 1PH7A 2LSSA 3DM3A 1EOTA 1EWCA 2NZHA 1W3SA 1N36Q 4KY7A 4LFBQ 1FL0A 3FPPA 2JQOA 1ZYRD 2EYJA 3J80i 1CHPD 4CJ0B 3H0GH 3KF6B 4NXNL 4X66Q 1XNQL 4WJ3M 1LLRD 4A3GH 1IBMQ 1EFID 4OIJA 1HHVA 2M00A 3S1QH 4IFDG 4JI5Q 1I6VC 3X3NA 2XTIA 1IKLA 4DUYL 3R8BA 5G3LD 5IWAL 1ET6A 1I3QH 5EBDA 1WCMH 2ES2A 4AQYL 4M1UB 1MSGA 2SEBD 3U58A 3HOYH 4I7ZC 3MHBA 4L8JA 4A3MH 1E1OA 3VYSA 1NR4A 1EYGA 1PTOH 2O4XA 4WFN3 4JBKA 3S17B 2EY1A 3DXJC 5AJ3L 2X6LA 4KHPL 4G7ZC 3BDOA 4K8IA 1F9PA 2ZM6Q 3K0XA 3DEPA 1U4PA 3K8AA 1I50H 3ND9A 4GOPB 1J8IA 3AQQA 3EJIA 5KYIA 1VQHA 5KNBA 5IYBH 2RQXA 2AQ2B 1II3A 4IPDA 1Y69U 3I70A 4A3JH 4UAIA 1OXSC 5EAYA 2LXKA 2UU9Q 3CRKC 1BOSA 2YU9H 1XNRQ 2KQ3A 1IW7C 1BUVT 2N8NA 5CMDA 3PF5A 4HAEA 4I65A 1WTXA 1XPOA 3IAYA 2BOSA 1CA5A 4DV1Q 3I72A 1N32L 3DUZA 4JC0A 4R4OA 3H15A 2WB1B 4XYOA 1GJXA 1QCBD 4DV2Q 1HZ9A 5GADC 1PHJA 2RHSB 1GM5A 1ICFB 3DMUA 4LWCA 3NTIA 2VQEQ 1HR0L 4DR7L 3UDXA 2VS1A 2HD3A 2K5DA 3GTLB 4OX9Q 4PQXA 1EIYB 2OWOA 3VR5A 4GKJQ 1FNVA 4P74A 4YIJA 5GROA 3W1GA 2MUYA 3CCQA 2NVTB 3OPOA 4GKKQ 1BQQT 5J39A 3GTPH 2R92B 1SNCA 4ZRZA 3QJYA 1SSOA 4DAVA 4JI4L 5C4XB 1DOKA 4EQNA 3V2TA 4KKTA 2KCCA 2VNUD 1QWYA 1Q81C 1SJED 1NUCA 1LM0A 3Q23A 4FVMA 3M9BA 4JI6Q 4A93H 3N52A 1BXTA 1HA5A 2GA4B 3A55A 1B9MA 3TEHB 5CV8A 4GN3B 1JOOA 5BN3A 1SFOB 1RHPA 1V1OA 4DAYB 2CKZB 4NXML 2BH8A 4B3RL 2K28A 2JA8B 4KJOA 1IBLQ 1N9WA 4I7AA 1UUPA 4LF8Q 3W5OA 4XT3B 1IL2A 2NYZD 5K5PA 1Z7TA 1E0BA 2F3WA 3D4WA 1CK1A 2I5LX 1SRUA 1YHQA 1YNJC 4IOCA 4BY1B 2WAQG 4IUQA 2WACA 3ERSX 2PZWA 4RA8A 5IE8A 3CQZB 2PI2E 4PMWA 4C3HG 1X6OA 2K5NA 4FF2A 3RZDH 2OTJA 1ZKOA 1KTKA 1TQOA 2QCPX 3MFGA 3X3MA 4X64Q 1HNXL 3BYYB 3GTQH 3LWUA 1XNRL 2JA7G 3GV6A 3FKIG 1UE6A 4IUPA 1KQSA 1JOKA 3PUXA 2PQAA 4DAMA 2L1BA 2PYKA 1AN8A 1IHZA 4S3SA 4YY3Q 3PMFA 4ZUJA 4GNXB 3RMHA 1FNWA 2RBMA 5BR8Q 1SYCA 2NZOA 1I6HH 1LT5D 4BBRG 1VQNA 1SNMA 3C1FA 4LF7L 4LF9Q 4JYAL 2DJFC 3GO5A 4DUZQ 2LS01 2VZAA 1L2FA 4HN7A 1FVIA 2B63G 1D1IA 2R6GA 2RDFA 1Y14B 3RLOA 2VW9A 3NBHB 2EY2A 4GNXC 3ICEA 5JJKA 5BN5A 3S1NH 2LXJA 2R93G 2B29A 3I4LA 4OONA 1STGA 2RDGA 3LGJA 4IZ8A 4MTKA 5E4WC 4CGYB 4ZCKA 1YITA 3HOWB 4N8FA 2B2YA 5D3DA 4DV7L 1X56A 4JI2L 4J8QA 5IT9L 1IBLL 1A3UA 2JP1A 3TP7A 2FINB 1ML0D 3NE5B 1BNZA 2IWHA 1PH3A 3J7ZC 1Q3LA 5T1IA 1JT8A 4K2KA 2A6EC 1EU3A 4B9XA 5C0XJ 4DGZA 1H9JA 1I4QA 1L0YB 2UXDL 3F1ZA 3K6OA 1PYSB 1ZXTA 3EROA 1M1KC 2QF7A 2D0OA 4JI1L 4GLXA 2R7ZH 4C3IG 5EGTA 2PPBC 1D7QA 5M3MH 1BO0A 3MZ5A 4HTHA 3DWPA 4ODGA 4H02A 4A3BH 1YJNA 5EJWA 1XXGA 2HT1A 4HSVA 3EBEA 3PO2B 4K0KQ 3RN5A 4X3KA 4CKCA 2Z0SA 1CUKA 4ZAIA 4ZUIA 4XYQA 2UXBL 4NB3A 1FGBD 5CV7A 1IW7D 1NE3A 4L5SA 3HOZG 2QDLA 1IYJB 2KEDA 4J15A 1A62A 5FKAC 4O1NA 4FNFA 1KNEA 4MIUA 1K8MA 2E8GA 1G6ZA 1S72A 3HS0C 1GD7A 1NCVA 3VR4A 3J81i 1I5FA 3HOXH 1IBKL 1EY8A 4WJ4A 4K6LA 1OXVA 1UAPA 5FJ8H 5IYDG 5K36H 1NR2A 3EFXD 2YYZA 2NVTH 4DV5L 3TMEA 2R92H 3PUVA 1IYUA 4KI0A 4Y7NB 2E76C 4OEMB 1HFNA 2RDHA 2LY7A 3K58A 4UDUC 5C4XH 1X3QA 2N49A 4YHHQ 4DR1Q 3A54A 1M8AA 1SMYC 4DNRB 3PIO3 5LMNL 3S16B 4HMJA 4C1NI 1ENFA 2ZTDA 2UXCQ 3BVZA 4LNQA 2AWOA 3A56A 4XDXA 1SFOH 4Y52H 5FOBB 2VY3A 5G3LF 5C0XG 1HUMA 1STNA 5FO9B 2KENA 1JC7A 4C3JG 1EWHA 1VQ7A 1XMQQ 2XVSA 3VR3A 1TS4A 1UE1A 4BY1H 3J81E 3AFPA 1M90C 5D3IB 2NWGA 1F77A 1HFGA 2VUMB 4ME5A 4IQZA 2F0PA 1YNJD 4R4CA 3I3CA 1QILA 1HNWQ 1WTOA 1QJOA 1HNZL 3GD7A 1X32A 5FK9C 2K1BA 4HCEA 1YJWA 2JA5G 3JC66 4ALPA 4K0KL 2RA4A 1VQ4A 1S5CD 3I4MG 2RVLA 1J9OA 1V8QA 3OTOL 4LW1A 2K5WA 2K01A 1G2TA 2L4NA 2GVAA 4B3MQ 1SEBD 4CJ2C 3J7A5 1CKOA 1ESFA 4A3LH 1A15A 5CBEE 1TWHH 4RGTA 4JV5Q 3NPPA 4A3KH 3CHBD 3CU7A 4HEDA 4DR3Q 3S2DB 4RAUC 1JR0D 2N55A 3MEFA 1LTBD 3KLSA 4RGNA 4A3GB 1PTOF 4L6TB 2E5LQ 3KK7A 4HR7B 2KBNA 1NAPA 3WDNA 1EZ8A 2Z6BA 4C56C 3G4SA 1WCMB 4Z9CB 2L11A 2L15A 5EKKA 3P1HA 5M5YH 1NSNS 1SNQA 1YVCA 2JEBI 2X69A 2MP1A 3KUPA 4YHHL 4A3MB 4DV3L 1KAWA 1PZJD 4FF1A 1TY2A 5GAEC 4QL5A 1PTOB 4EX5A 4IO9A 3HOWH 2CH4A 3M85A 1LT4D 1O7YA 3K59A 3HOVB 1SN8A 2NN6G 2UUBL 3BVGA 2F0DA 1I50B 4U68A 3HGBA 2JSOA 2NTSA 2CWAA 3RNUA 1TWGB 1AEXA 4QMGA 2F3IA 4BBSB 1MJEA 3UDFA 2EYPA 2ICEC 4UPAA 3VYRA 2NVXH 1PYWD 4JCVE 4A3JB 3PUYA 1CZGA 2BA1A 1YBYA 1EYCA 4OO1G 3BU2A 2A6ED 1PTOC 4TKOB 2PQAB 2DJGC 4YCWA 1K0RA 4RHSA 2IX3A 1LTGD 2NZ1D 1TT2A 3S14H 3FVQA 1D6EC 3S9WA 1PFBA 5C3EB 4KN7C 1BBUA 5JJZA 3SHLA 3HEJA 4A3DG 1P8LA 2OXPA 3F2UA 4A3IG 1O7IA 3FRPB 2WKCA 5LMUL 5ELFA 1HZCA 2EYLA 1EU4A 2K33A 2RSNA 3CC4A 4LUZA 2WB1E 3GQBA 4J1MA 3GTPB 3T1YL 1HZAA 4DR4L 1SJHD 3N6RA 2IT1A 1VQKA 4EGVA 3D6WA 4NXNQ 1XNQQ 2Q2HA 3MFYA 2ALYB 2WINB 1X3EA 2C5CA 2I5HA 4DUYQ 4A3CG 1KRSA 3D4RA 5IWAQ 4Y7NH 5M5WB 1H9MA 3D6CA 4IJHA 3KFUA 4AQYQ 2QA4A 4UY8C 5LHY1 1JB7A 1KAAA 1JB3A 3VR6A 1G6PA 1X65A 2IPKD 1XTCD 3T4AC 3FDTA 1GUTA 2VB2X 1YNNC 1C9OA 3D8GA 3NP8A 3RZOH 3DWQA 4FXDA 3S16H 1TS5A 5AJ3Q 4N9TA 1K8AC 2D0PA 4KHPQ 1SMYD 1H95A 1SYGA 2DUDA 4B3SL 5KNDA 1QE6A 1UEAB 3BDCA 4ABNA 3NWTA 4Q5VA 2F4VL 1VQ6A 5HY6A 1MD2D 1LTLA 1TKWB 1NJIC 1XYIA 4DA2A 2B2YC 3PO3G 2F0IA 5CV6A 1FYCA 1J5EL 3GTQB 1VQ5A 3EVQA 4RH6A 2WAQB 1B4OA 1VS0A 2JXMB 4KTAA 5DEHA 3R3OA 1NMFA 2VUMH 2EJMA 1ENAA 3TZDA 5M3FG 2R7FA 2AMCB 4OWTB 5KGUA 5EPLA 2JJQA 2I5MX 3A7LA 4MNOA 1N32Q 1Y1VH 4C2MB 1ENCA 4XTCS 5CORA 2JA7B 4L5RC 3FKIB 1FGUA 1V9PA 1AZPA 4BY7B 1OXXK 3I7FA 2VL6A 3GTJB 4JBMA 5EQ0A 3I4NH 1IZ6A 3GTKH 1Y8NB 2ZJRA 1RCVD 4G7OC 1HR0Q 4DNIA 1SE8A 4DR7Q 3AEVA 4A3EH 3QOJA 3PSIA 1KXLA 5EKIA 1ESRA 3OW2A 3W1BA 4GN4B 2Y0SG 1SNPA 3A74A 5HURA 1HZBA 3S1NB 4IUNA 1O7ZA 4HJ8A 3S2DH 4LF4L 4B9WA 5KYLA 4PZ6A 1HCZA 4YWKA 1SE2A 3C2PA 3D4DA 3GV3A 1BCPF 2BE5C 4KLKA 3H0GG 4JI4Q 1I4RA 3MWYW 2YTXA 1R4PB 1X9NA 4FXGC 2F0KA 5EPJA 3RR5A 5KNCA 2SOBA 1J6QA 5IP7G 2EXZA 3CW2C 3PF4A 1WD1A 1DONA 3K7AH 3HOYG 4ZYSA 2EVBA 4IFDH 1N34L 2QEXA 2BDNA 3HP3A 1BCPB 4NXMQ 4B3RQ 3OIQA 1GO3E 5C6AA 3HOUG 4DK1A 1SAPA 3HOVH 1QVGA 2DY8A 3CPWA 5DLQE 3A8KE 1KNAA 1MHWC 4EQPA 4POFA 4HIDA 2R7ZB 1TWGH 1PZID 1VQOA 4LF5L 3HKZB 4BBSH 5M3MB 2AQ1B 2A69C 4PV1C 2B2WA 2CW0C 1HPCA 4QUFA 2V4DA 1VF7A 2Z4IA 1O7LA 4A3BB 5IYBG 1KD1C 1LTTD 3TSSA 2F0VA 1HNXQ 5F2DA 3H3VH 3IL8A 1TWCH 1VQFA 1VQEA 4MZ9A 3ULPA 2E2IB 1BCPC 1YHBA 3A5ZB 4DR6L 3P20A 2XWJB 3G7LA 5C3EH 1PTOD 3H94A 2SNSA 3C1EA 4GOPC 2V1CC 4DXFA 1SLJA 4DFAA 3DEOA 1LABA 2LMCB 2A5HA 4PZ8A 1D5XC 3HOXB 4LF7Q 1NNXA 5IT9c 5FLXc 4JYAQ 3HFZB 2YTVA 5I6WA 1EQRA 2AKWB 3FPUB 1CT1D 5C4JH 1H9RA 2F0WA 2NTTA 2VQFL 2UUCL 4ID6A 3KJPA 1VQCA 5JEAJ 1DOLA 4NMZA 3J80L 2Z9HA 2MQHA 1U4RA 3I91A 2RHQB 1PH1A 2CCZA 4BWGB 4A3FG 2UUAL 1K8OA 4DPGA 2K5HA 2E2HB 2A74C 2HIXA 4IFDI 2B2TC 3WOFA 5M5WH 5A2QL 1VQGA 4PMBA 4XQNA 2F0QA 2NBFA 1VMPA 4A93G 3MTSA 5DNFA 4QGUA 4DV7Q 2PQEA 1SYDA 3SDZA 3BDLA 4JI2Q 1K0SA 4F7XA 2QW7A 2EYHA 1OTCA 1HUNA 2GVBA 5IYCH 4NKLA 4DV0L 4BA1I 3CF5A 3OMGA 3CC2A 3WOEA 1SROA 2UXDQ 2L9HA 2IL8A 4G57A 4J6HA 1VQIA 2ICIA 3QOLA 2ZXRA 3M7NA 3H3VI 4JI1Q 1JWSD 1UWVA 1EQQA 1A3VA 3NTHA 3OWFA 2VXWA 2JA6G 1GXDC 1QVFA 2YV5A 1B3QA 3SK8A 2HDLA 2FJ2A 2PW5A 3EA6A 3CKIB 4RGOS 3O13A 1EY9A 1AW7A 3MAQA 1HR0W 5DM73 3G6EA 1SMXA 2UXBQ 3E6ZX 4C2MH 3MXPA 2JA7H 5T1GA 2F03A 3UDGA 3FKIH 4BY7H 3G48A 1U4MA 1S5FD 3JAMc 3GTJH 1TWHB 4GLVB 2E74C 4A3KB 1Y1WG 4RMFA 2A19A 3BG3A 4RFBA 4H13C 1LT3D 1IBKQ 1GUGA 4BS9A 4DNTB 5JEAG 5J1ZA 1X3FA 4BBRH 1T5XD 2D5DA 1XTDA 3QR8A 4NPSA 3BS1A 2EPBA 3SK6A 4DV5Q 3SVMA 3BZDB 5M5YB 3U4VA 3QO2A 2HHHQ 3KJOA 3NK9A 1PH5A 5C5MA 2I0QA 3OWEB 5E3FA 3SK5A 5IGBA 3EIVA 4KV6A 1U5KA 5IT9E 1B3AA 1XMOL 2BE5D 2R93H 5LMNQ 4PMCA 3Q6SA 4RGMA 5TSSA 4R4QA 1M4VA 4P73A 4QQBX 3CXCA 5IP9H 1LTSD 4ME3A 5FLXL 3KOJA 1RL2A 1JJ2A 4R1JA 1CZWA 2NVXB 2FMMA 1H9SA 4X65L 2F0SA 1HQRD 1CKNA 4YCVA 4KKUA 3J7AV 4XQQA 3CCSA 5IOCA 1ILPA 3NBIA 4IJLA 4U673 3S14B 1F2MA 1JE4A 2K5QA 1N8RC 1JJCB 3IKJA 2C9OA 1HNZQ 1DM0B 1QOHA 1O80A 3R93A 1QZHA 3VDYA 5CYUA 4QCLA 1QNUA 1K8GA 2A69D 4CBVA 2EYFA 1STAA 2CW0D 2E2IH 4C3IH 1LUZA 2G9HD 1D5ZC 1B7YB 1VMCA 1VQAA 2NVYH 1NY4A 3OTOQ 2KCNA 4HIOA 4MHEA 3K80C 1BCPD 2TSSA 2XGTA 4KHVA 1Q82C 1LT6D 3SXHA 2WB1G 2OCEA 2B8GA 2HUGA 2MFIA 3L0OA 3AB9A 3OSOA 1A2UA 3M4YA 1KL9A 3E9HA 1FD7D 4WJWA 1NTGA 4R4IA 1QNKA 4AYBB 4IPHA 2F0OA 1F2ZA 3GP7A 3M7GA 4HJ5A 4B3TL 1L1OA 1WTQA 1FJGL 5FJ8G 2Q2UA 5K36G 5D65A 4APVA 3F2CA 1EUJA 2CFMA 2HHHL 1DZ1A 2M9VA 3T1HL 3BYTB 1LO5D 3RLNA 1V1QA 1RTNA 3EQLC 4OIKA 5IYDH 1PFNA 4DV3Q 5C4XG 2E2HH 2F4IA 3I8ZA 2IHFA 2WV6D 4RCOA 1GUSA 2D9UA 2MO0A 2XNAC 3RZOB 3TDQA 3CD6A 3JAML 2UUBQ 2L55A 1PFSA 3I55A 1N33L 1I4HA 1SE3A 3V05A 2Z6KA 1SE4A 2JA8G 2L12A 1CFMA 5A35A 1GKHA 2K75A 2EOTA 4P75A 1BR9A 1STYA 2KHIA 2F0JA 1E24A 5ELEA 3KF8A 1I94L 3G71A 4BY1G 1IYVA 1CI3M 2EYMA 4IURA 1BDOA 2F0MA 3Q24A 2A68C 2QEJC 4C3JH 1Y1VB 4P2CB 5C4ZA 3OW7A 2Q8RE 3NWSA 1YZ6A 4JI7L 1WTRA 3K57A 2WAQE 3I4NB 3MEHA 3GTKB 4XT1B 3SK4A 5M3FB 1I4PA 3DLLA 4JPBW 4A3EB 3W2DA 5EBCA 5LMUQ 1Z9FA 5C44B 3S24A 3MA2B 3RUZA 1LACA 1IKMA 3K0YA 4DF7A 4POGA 1WOCA 2HIVA 1DYQA 3I4MH 3QIAA 3NXWA 3T1YQ 4DR4Q 3KDFA 3K5LA 2JK8A 5CV4A 1EFWA 3GTMB 1BBXC 1ILQA 2J7ZA 1S40A 2Z1CA 1G8ZD 1VQLA 2Y0SB 1JJGA 1RF2D 2K5VA 3IFTA 1Y8PB 3AFQA 2KUMA 2CWPA 2EXDA 4MN3A 3A8JE 4BXXH 4LUVA 5LMNW 2KHSA 4HJ9A 4DV4L 5C5LA 2PW7A 3BVMA 3F2BA 1ET9A 3K7AB 1OXUA 4DK0A 5J22A 2E2DC 1B50A 4HSPA 1SYBA 2HCCA 1VF5C 2KHJA 1TY0A 5ISRA 3LX0A 3HOWG 1G91A 1YNXA 1UE5A 4B3SQ 1MJCA 4R9WA 5I4DA 4FF3A 2F4VQ 2F52A 1X3GA 3G6JB 4A4IA 3HOUB 2DNCA 5C0XI 2NN6H 4TQUS 3T51B 2HQLA 1C48A 2D2CC 4K5VA 3OIPA 4DKAC 4K5XA 3E5SA 3F8TA 3Q22A 3HRZC 1J5EQ 2N78A 1AE3A 2AUKA 1TWCB 2XIWA 2Q8IB 4FF4A 1EYDA 1NMGA 2J4XA 4LK1C 4JI8L 4H7BA 1WTWA 1C7YA 2R7DA 3HKZE 2EY5A 3GTGB 4FO2A 4OWWB 1O78A 3SGIA 3I2ZA 1PRTF 4PNYA 3PO2G 5E4XA 3OOCA 3S1RB 1U0LA 3PUZA 1SYFA 5C4JB 3CCJA 1ASZA 3H3VC 4ZK9B 4B08A 3S2HB 4WRDA 3NTKA 4NW2A 4K2LA 5KRUA 2JE6I 4A3IH 3ERQA 1Q86C 1HTPA 3DHQA 2KEEA 2X6GA 3HKSA 4LFCL 4LF4Q 4K6DA 2A6HC 1KDAA 3CMEA 1XJVA 1PRTB 3PQIA 2KCMA 3TP8A 1YI2A 3NHHA 3PIP3 2IW3A 4JI3L 3CCUA 5IIFA 1T9HA 1PFMA 4G4KA 1HRJA 3GTOB 2OEOA 4RWSC 4OGQC 5IODA 3U9OA 3RLFA 2ZTEA 5FLMG 2BCOA 2Q2IA 1AE2A 5COYA 1A8VA 4FYDA 1JORA 1N34Q 1F2LA 5KIXA 2F0FA 4A3CH 1VDZA 4OHJA 1H9SB 3D31A 4TVAB 2NN6I 1TWFH 1CKNB 1PRTC 3CCLA 1EEID 4X62L 1PYBA 5E1FA 4LF6L 1Q8IA 1PVOA 4LF5Q 1TWAB 5C4HA 1Z47A 2F0EA 3J80c 4DR2L 5I9PA 1X54A 3E0EA 3C46A 1B70B 4EQOA 1D2BA 1CKMA 1YEZA 3C3LA 1CQFA 3TP5A 4F88A 1D5MC 3L3OC 2DN8A 2R61A 4L5TA 4CDEC 1KC8C 4C3HB 1C8CA 2SDFA 4UP9A 1STBA 5ELCA 5DM63 4KD3A 3UI2A 3CC7A 4YWLA 1BBWA 2VUMG 3PO3H 4DR6Q 5ELBA 4DR5L 4KN4C 1PV4A 1LTRD 2B2VA 3U9SA 1KRTA 3I73A 2DGYA 1MKHA 1PH9A 1W2BA 4UHVA 4QUCA 1F9SA 1RD9D 5JAVA 2A68D 5IGDA 5M3FH 4M8AA 3KLSX 3PV0A 4DK6C 1SDFA 3T16A 4ZLTF 4DV6L 3LWEA 1EEFD 4BBRB 5C44H 2F0GA 2VQFQ 2UUCQ 3BJUA 1L1OB 3CPFA 2PMZB 2QDBA 2Z4HA 1Y1WB 2O5JC 1A63A 4TSSA 2SNMA 3ZJYC 3GTMH 2ZTCA 3QG1A 3M4QA 1I4GA 2B63B 3BZKA 4A3GG 2K6AA 2UUAQ 1QUQA 5JVG3 4N9PA 3W3AA 4WORA 5H1SE 2CQOA 1VQDA 3TS0A 4JG2A 4RHRA 2R93B 1A6XA 1DXMA 1Q1BA 1UNSA 5C3WA 1WCMG 4UP7A 5ELNA 3KBGA 3MXNA 2MO1A 4QB4A 1EQVA 4QJFA 1HTLD 4A3MG 2E2JH 1L1OC 1KABA 2IHEA 4DN4M 5JJLA 1RTOA 2CHBD 4ZQ3A 1ZEQX 4DV0Q 2CH4W 5IP7H 1E2WA 1A2TA 4RKLA 1STHA 4BA2I 3HOVG 2F0TA 3J7YW 4V190 4YCUA 1EOVA 1W6JA 3KF8B 4JBJA 1ASYA 2R3ZA 3MXUA 3L2PA 3HOUH 2AHOB 1UE7A 2JA9A 2IY5B 4BBSG 5M9OA 2EIFA 3A7AB 1LTID 2WP8J 2G5DA 1BF4A 1E22A 4A3JG 4LFAL 3QWNA 1VCIA 4C3IB 2NVYB 4GN5A 2PI2A 3MXGA 1JICA 1D1KA 2Z6KC 1VQ8A 3GTGH 2EJFC 1RIPA 5JPNC 1PH4A 3L9AX 4UP8A 1I4XA 1V1PA 5C3EG 2BH2A 2F1MA 3J80E 5HGTA 1KDBA 4CKBA 2O5IC 1U4LA 1GHKA 1CTMA 3VA5A 2HQEA 2N3SA 2B2UA 3U4ZA 4JI0Q 2K4KA 1RJTA 3S1RH 3KDFB 2HDMA 4KJNA 5GAHC 3HOZB 3PGZA 3P7JA 4CDDC 2K04A 3S2HH 2B3GA 2OF1A 1WFQA 1B44D 1U9RA 3SE0A 4QIWB 5A2QE 3CCVA 5DAUA 1PXUA 2C35B 4AYBE 2MGSA 2K7VA 1B53A 2NB0A 1N36L 4RCNA 2PZTA 2ZT9C 4JBWA 4LFBL 1HXYD 1CQVA 1KHIA 3I4OA 3OYYA 1CSQA 2A6HD 2BA0A 1FR3A 3CP0A 5BN4A 1XMOQ 4NP5A 3TBIB 3SEBA 1Q7YC 2PNRC 4IUTA 3K7UC 1ICWA 4O42A 5J3BA 4XXEA 3TQYA 3GTOH 4X66L 2ZJPA 5NUCA 1IBML 4A3FH 2F0HA 2PO4A 4OL7A 1B9NA 2IX1A 4JI5L 4EQ5A 2DNEA 3L7ZC 3R2IA 1K9MC 3UDIA 5IYCG 4X65Q 5IGCA 1YNND 5I6YA 2EYOA 4NDXA 2QKIC 3CAMA 2VB3X 1JQYD 5FO7B 4RKBA 1TWAH 2I46A 4JOIA 1L0WA 1PRTD 1JWMD 4C3JB 4ILWA 5L37A 3H6MA 2FFKB 2ZM6L 1PH8A 5CV5A 3S1MB 1TS2A 3M4PA 2PZUA 1EY7A 1B1ZA 1X55A 1EYAA 4C3HH 2PCFB 3DWAA 5D14A 1EL0A 3AYHB 1PMRA 3U50C 3ULLA 2JA6H 3RN2A 4KHZA 1SR3A 2UU9L 2JA5B 2WFWA 2KCTA 3VYTA 1XPRA 1DD2A 2I07B 1E7ZA 3CMAA 4JI0L 3I4MB 4BY7G 1E2ZA 1KIXA 1LTAD 5EKLA 5KEEA 2L5TA 1K73C 1WI5A 4DV1L 1NBWA 2K32A 3STBC 1HQMC 1PLFA 4KK7A 3PCOB 3ND8A 3S15B 4KY6A 4DV2L 3E0JA 5AFWA 1RODA 2FHTA 4B3TQ 5JJIA 1Y1WH 4XQJA 1FJGQ 2VQEL 2OQ0A 1C0AA 1G2SA 2NVQB 4LJZC 3J81j 2EZVA 3T1HQ 4L63B 4PG3A 2ENBA 5JEAH 4OX9L 3T13A 2B63H 4FP5D 4GKJL 4V0BA 3I56A 2XSCA 2Y0SE 3QB3A 5FLXE 3TS2A 4GKKL 1K83B 1VQ9A 2H4OA 4L5QA 5IGEA 1PH2A 3A0JA 1F9RA 5I2XA 1S4ZA 2ZXOA 2DY7A 1Q1EA 1BKBA 2MJ8A 1QB5D 1N33Q 1BVSA 3Q8DA 5IGGA 5IP9G 3K5NA 2PNHA 3KBXA 3J81c 1W6KA 3FP9A 1E3PA 4JI6L 3NENA 2EE1A 3K81C 3TZUA 2FMCA 3TREA 4E6IA 1OXTA 3JAMi 1I94Q 1ONLA 5M5XB 1YHAA 2R7ZG 3Q0AA 4LF8L 2RKSA 2ZJQA 3HKZG 1JCKB 1GUOA 1GVPA 5M3MG 2H5XA 3S17H 4HIKA 3WWVA 4A3BG 3M4OB 2JYOA 4OXPA 1WTHA 4JI7Q 3H91A 1Q46A 2EDGA 2A1AA 4H0LC 3NQTA 1PH6A 4R4TA 2JN4A 3KLRA 4DK3C 1B8AA 4X64L 1C4QA 1DJRD 2EQSA 4JK1C 4A3DB 4A3IB 4YY3L 2XWBB 3UE1A 5BR8L 5C3XA 4R8IA 3HOXG 3HOZH 5CR3A 2B2VC 2ID0A 2K05A 1QUQB 2AWNA 3A8IE 3J7AF 2ZXPA 4LF9L 1KLUD 2KECA 3EN2A 5CV9A 2R92G 2OTLA 1MSHA 2IJ0A 4IUUA 1WTVA 4OWXB 3I90A 4DUZL 1X3PA 3MXNB 1EY6A 3JAME 1YIJA 4DV4Q 3GTLH 4IN3A 4RG1A 2MPMA 1RDPD
chains in the Genus database with same CATH topology
4OWWB 2YTXA 2MNAA 5GQOA 1X9NA 4X64Q 5GAGC 1HNXL 1E1TA 3SGIA 3GTQH 4AH6A 3IRBA 3RR5A 1XNRL 2JA7G 3I2ZA 1G51A 1J6QA 1UE6A 3FKIG 5IP7G 3CW2C 3PUXA 1KQSA 1K3RA 3PF4A 2PQAA 3KF6A 4DAMA 3D0FA 1EWIA 4YY3Q 3K7AH 4GNXB 3HOYG 3PO2G 1U0LA 1WJJA 1N34L 3PUZA 5BR8Q 2QEXA 1P16A 3CCJA 1ASZA 4NXMQ 2NZOA 4B3RQ 1I6HH 1GO3E 3HOUG 4BBRG 3ULJA 1VQNA 3HOVH 2JE6I 4A3IH 4YWMA 1QVGA 1Q86C 4PZ7A 3CPWA 5DLQE 4LF7L 4IPGA 4LF9Q 3HKSA 1UEBA 4X6AH 4LFCL 4HIDA 4POFA 4LF4Q 4JYAL 3GO5A 1TWGH 1VQOA 4DUZQ 4LF5L 3CMEA 4JI8Q 1XJVA 4BBSH 2VZAA 1L2FA 2KCMA 2JA8H 1FVIA 4P72A 2R6GA 1YI2A 2B63G 1Y14B 3RLOA 4JI3L 5IYBG 2VW9A 1KD1C 1MIUA 3NBHB 1QVCA 3CCUA 3S1MH 3PUWA 1HNXQ 1T9HA 4GNXC 3ICEA 3H3VH 3S1NH 5JJKA 2LXJA 1TWCH 2R93G 2B29A 1VQFA 1VQEA 4MZ9A 3ULPA 4GOPA 4OONA 1YHBA 3CQZH 2ZTEA 3A5ZB 3RLFA 5FLMG 4DR6L 2Q2IA 1AE2A 3UE0A 1A8VA 1Q8KA 5C3EH 3LGJA 1N34Q 4A3CH 2RF4A 1TXYA 1YITA 2JA5H 1Q12A 1S3OA 1VQBA 2V1CC 4GOPC 1SLJA 3D31A 4TVAB 2NN6I 1TWFH 3CCRA 4A3LG 1CKNB 2YTYA 1V43A 1X56A 4PZ8A 4DV7L 3CCLA 4A3KG 4JI2L 4LF7Q 3B6YA 5IT9c 4X62L 1PYBA 4LF6L 4QY7A 4LFCQ 4P71A 5FLXc 1IBLL 3HFZB 2YTVA 4JYAQ 1EQRA 2AKWB 1PVOA 1PH3A 5C4JH 3J7ZC 4LF5Q 3S15H 1JT8A 1Z47A 2VQFL 2UUCL 3J80c 3KJPA 4DR2L 1VQCA 5JEAJ 1X54A 5C0XJ 3E0EA 2UXDL 2PMZE 3F1ZA 2MQHA 1B70B 3STBD 4JI3Q 1PYSB 1CKMA 1YEZA 2NVQH 1M1KC 2RHQB 1PH1A 2CCZA 3ER0A 2D0OA 4L5TA 4JI1L 1KC8C 4IPCA 3PIOA 4GLXA 2R7ZH 4UP9A 4BXXG 1D7QA 1G291 3CC7A 4YWLA 4A3FG 4DPGA 1BBWA 2K5HA 5M3MH 2UUAL 2VUMG 3PO3H 4DR6Q 4DR5L 2HIXA 4IFDI 4H02A 1PV4A 3E9IA 1K83H 1KRTA 1YJNA 4A3BH 2DGYA 1MKHA 1PH9A 1W2BA 5M5WH 1VQGA 4MTNA 2HT1A 3EBEA 5M3FH 4A93G 4K0KQ 3RN5A 4QGUA 4DV7Q 3PV0A 2Z0SA 4DK6C 1CUKA 4DR1L 1A0IA 4JI2Q 4X62Q 4DV6L 2UXBL 4NB3A 4LF6Q 1IXRA 1OTCA 1NE3A 4L5SA 2QGQA 5C44H 2GVBA 5IYCH 4DV0L 3HOZG 3KYHC 4BA1I 1IYJB 3CF5A 2VQFQ 2UUCQ 3BJUA 1L1OB 1D8LA 3CPFA 1SROA 4J15A 4DR2Q 3CC2A 2UXCL 1A63A 1A62A 2UXDQ 4AIMA 2E8GA 1VQIA 1S72A 1GD7A 3J81i 1I5FA 3NELA 3ZJYC 3HOXH 1IBKL 3GTMH 3M7NA 3H3VI 3TRZA 4WJ4A 4JI1Q 2ZTCA 5M5XH 3M4QA 1YJ9A 2K14A 1OXVA 1UWVA 3BZKA 1EQQA 4A3GG 5FJ8H 5IY0A 5IYDG 2UUAQ 1QUQA 2YYZA 4DR5Q 2JA6G 1QVFA 1XMQL 5H1SE 2CQOA 2YV5A 2NVTH 1EIFA 5HGQA 4GLAC 1VQDA 1JE5A 4JG2A 1HH2P 4DV5L 3TS0A 3PUVA 2R92H 3M4OH 1Q1BA 2A8VA 4KI0A 1WCMG 4UP7A 5ELNA 2MO1A 5C4XH 4JOIC 3A5UA 2N49A 4QJFA 4WJ3M 1HR0W 4O0AA 4YHHQ 3G6EA 4DR1Q 1L1OC 4A3MG 2E2JH 4FDBA 1HNWL 2IHEA 1SMXA 4DV6Q 2UXBQ 4C2MH 5JJLA 2JA7H 4A3DH 4DV0Q 3UDGA 3FKIH 5IP7H 5LMNL 4BY7H 3G48A 3JAMc 4HJAA 3GTJH 2ZTDA 4GLVB 4A75A 3HOVG 4BA2I 1VQJA 1Y1WG 2UXCQ 4RMFA 4LNQA 2A19A 2Q2TA 3PO2H 2AWOA 4GNXA 1WYDA 2K52A 2FXQA 4YCUA 1EOVA 3KF8B 3FHWA 4JBJA 1SFOH 1IBKQ 2IX0A 2VY3A 1ASYA 4B3ML 5JEAG 3L2PA 1X3FA 5C0XG 3HOUH 4BBRH 2AHOB 1UE7A 2JA9A 4AYBG 4BBSG 1XTDA 2IY5B 2KENA 4NPSA 2EIFA 4JV5L 4HJ7A 1VQ7A 2WP8J 4DR3L 1XMQQ 1E22A 4A3JG 4LFAL 1UE1A 4BY1H 4DV5Q 3AFPA 4QIWE 1VCIA 3U4VA 4O2DA 4GN5A 1M90C 2HHHQ 2PI2A 1XPUA 2E5LL 2Z6KC 3BZCA 1VQ8A 3GTGH 1RIPA 1PH4A 3KJOA 4UP8A 3CCEA 1CSPA 4R4CA 5ELOA 1PH5A 2I0QA 2ASBA 1AH9A 1HNWQ 3EIVA 1HNZL 3GD7A 1U5KA 5C3EG 1XMOL 4IFDJ 2BH2A 2R93H 1YJWA 5LMNQ 2JA5G 3JC66 4ALPA 3F2DA 4K0KL 1VQ4A 5FLMH 4R4QA 2N3SA 4P73A 3U4ZA 3OTOL 4JI0Q 3I4MG 2K4KA 3S1RH 4QQBX 4LW1A 3CXCA 3KDFB 5IP9H 2JEAI 4ME3A 5GAHC 3KOJA 1LYLA 1RL2A 3PGZA 2GVAA 4B3MQ 1JJ2A 4R1JA 3S2HH 3J7A5 2RCNA 4X65L 1CKOA 2B3GA 1WFQA 4A3LH 1CKNA 1TWHH 4YCVA 4JV5Q 1VQPA 4A3KH 4DR3Q 4HIMA 4LFAQ 4OO1I 3MEFA 3CCVA 3M3YH 3CCSA 2C35B 2E5LQ 4GS3A 3NEMA 4AYBE 4IJLA 2OQKA 1HJPA 2KBNA 1JMCA 1N36L 4JBWA 4A76A 1N8RC 4LFBL 1JJCB 1KHIA 3I4OA 3OYYA 1CSQA 1HNZQ 1Y1VG 2BA0A 3CP0A 3KLWA 1QZHA 2GN5A 3G4SA 3VDYA 1K8GA 1XMOQ 1Q7YC 3TQYA 3K7UC 2L15A 5J3BA 2E2IH 3GTOH 4C3IH 1LUZA 4X66L 5M5YH 1B7YB 3GDEA 1VQAA 2NVYH 2ZJPA 1YVCA 2JEBI 4A3FH 4YHHL 1IBML 3I4NG 4XIGS 4DV3L 1NY4A 1R9TH 1KAWA 3OTOQ 1VQMA 5GAEC 2IX1A 4QL5A 4JI5L 1DGSA 4HIOA 3K80C 4EQ5A 4A3EG 4EX5A 4IO9A 2XGTA 3L7ZC 4LUOA 2K50A 1Q82C 2ATWA 3HOWH 1K9MC 3M85A 3UDIA 3CCMA 2WB1G 1SN8A 2NN6G 2OCEA 5IYCG 4X65Q 5C44G 2UUBL 1PA6A 2MFIA 3L0OA 3PIPA 3CAMA 1KL9A 3E9HA 4IOAA 5E7NA 2CWAA 2D62A 3RNUA 1QZGA 1NTGA 4R4IA 2F3IA 1TWAH 4JOIA 1L0WA 4IPHA 1PH7A 1MJEA 3UDFA 2LSSA 3DM3A 4HJ5A 4UPAA 4B3TL 1L1OA 2NVXH 2NZHA 1W3SA 1N36Q 5FJ8G 1FJGL 2Q2UA 4LFBQ 2ZM6L 4JCVE 1PH8A 5K36G 1FL0A 3PUYA 4APVA 2BA1A 1EUJA 3F2CA 2CFMA 3M4PA 2HHHL 1YBYA 2JQOA 4OO1G 3T1HL 1X55A 3BU2A 3J80i 4C3HH 4YCWA 2PQAB 3H0GH 3KF6B 1K0RA 3AYHB 4NXNL 1V1QA 3RLNA 3U50C 4X66Q 1XNQL 1IBMQ 4A3GH 5IYDH 4DV3Q 5C4XG 3S14H 2E2HH 3ULLA 3S1QH 4IFDG 2JA6H 4JI5Q 2IHFA 3RN2A 4KHZA 1SR3A 2XTIA 2MO0A 1BBUA 4DUYL 5IWAL 2UU9L 1I3QH 1WCMH 2WFWA 2ES2A 2KCTA 3CD6A 4A3DG 1P8LA 4AQYL 4A3IG 1XPRA 2UUBQ 1O7IA 1E7ZA 3CMAA 4JI0L 3U58A 3HOYH 4BY7G 1KIXA 1PFSA 3I55A 4A3MH 1WI5A 4DV1L 1NBWA 1K73C 5LMUL 1N33L 1HZCA 1E1OA 3STBC 1EYGA 3PCOB 2Z6KA 3CC4A 4JBKA 4LUZA 4DV2L 2WB1E 5AJ3L 2JA8G 4KHPL 4B3TQ 1GKHA 2K75A 5JJIA 1Y1WH 1FJGQ 4P75A 2KHIA 2VQEL 2OQ0A 2ZM6Q 1C0AA 3K0XA 1HZAA 3T1YL 3J81j 1E24A 3K8AA 1I50H 4DR4L 2IT1A 1VQKA 1I94L 3G71A 3T1HQ 4PG3A 4BY1G 4GOPB 4OX9L 2B63H 3AQQA 4NXNQ 1XNQQ 2Q2HA 4GKJL 1VQHA 2ALYB 5IYBH 3I56A 4C3JH 2Y0SE 1X3EA 4IPDA 3TS2A 4GKKL 4A3JH 1YZ6A 1VQ9A 2I5HA 4DUYQ 4JI7L 4A3CG 1KRSA 1OXSC 2LXKA 2WAQE 5EAYA 4L5QA 5IWAQ 4Y7NH 2UU9Q 2YU9H 4IJHA 1XNRQ 1PH2A 3A0JA 3KFUA 2N8NA 4AQYQ 3PF5A 2QA4A 4UY8C 1JB7A 3DLLA 1G6PA 1XPOA 1X65A 1Q1EA 1BKBA 4DV1Q 1N32L 5LMUQ 4JC0A 1N33Q 4R4OA 1BVSA 3Q8DA 1C9OA 1Z9FA 5IP9G 2PNHA 3H15A 3S24A 3J81c 3RZOH 3FP9A 1E3PA 4DV2Q 1HZ9A 4JI6L 5AJ3Q 5GADC 3S16H 1PHJA 1K8AC 2D0PA 2RHSB 3NENA 4KHPQ 3K81C 1GM5A 4POGA 1H95A 1WOCA 2DUDA 2HIVA 4B3SL 3I4MH 4LWCA 2VQEQ 3TREA 1HR0L 3T1YQ 4DR7L 3UDXA 4DR4Q 3KDFA 2JK8A 2VS1A 2F4VL 1VQ6A 1EFWA 1OXTA 5HY6A 3JAMi 1I94Q 1YHAA 2R7ZG 1LTLA 4OX9Q 1S40A 1NJIC 4LF8L 1EIYB 1VQLA 2ZJQA 2OWOA 3HKZG 5M3MG 3S17H 1GVPA 4GKJQ 2H5XA 3PO3G 1JJGA 4P74A 5GROA 3W1GA 3CCQA 2K5VA 4HIKA 1J5EL 3AFQA 3WWVA 1VQ5A 4GKKQ 4A3BG 3GTPH 2CWPA 2EXDA 4OXPA 4JI7Q 1VS0A 4LUVA 5LMNW 1Q46A 4BXXH 2A1AA 4HJ9A 4Y52H 1NMFA 4DV4L 3F2BA 2VUMH 1PH6A 4R4TA 4JI4L 1OXUA 5M3FG 2R7FA 2AMCB 4OWTB 2JJQA 2VNUD 2I5MX 4DK3C 4MNOA 1B8AA 4X64L 1N32Q 1Y1VH 2EQSA 2KHJA 4XTCS 1Q81C 1LM0A 4L5RC 1FGUA 1V9PA 3HOWG 4A93H 1OXXK 3I7FA 2VL6A 3M9BA 4JBMA 4JI6Q 1YNXA 1UE5A 3I4NH 1IZ6A 4YY3L 3GTKH 4B3SQ 1MJCA 2ZJRA 3TEHB 3UE1A 4GN3B 4DNIA 1HR0Q 1SE8A 4DR7Q 5BR8L 2F4VQ 3HOXG 4DAYB 2CKZB 2F52A 4A3EH 4NXML 3AEVA 2BH8A 3PSIA 1X3GA 3HOZH 4B3RL 1KXLA 4A4IA 1IBLQ 1N9WA 4LF8Q 3W5OA 5C0XI 3OW2A 3W1BA 2ID0A 1IL2A 4GN4B 2Y0SG 1QUQB 4TQUS 2AWNA 2HQLA 3A74A 4DKAC 1HZBA 2I5LX 3F8TA 1SRUA 1YHQA 2N78A 4HJ8A 3EN2A 1J5EQ 1AE3A 4IOCA 4LF9L 3S2DH 2WAQG 2OTLA 4LF4L 2R92G 3ERSX 4PZ6A 4YWKA 1NMGA 4OWXB 4DUZL 3MXNB 1YIJA 4JI8L 5IE8A 4DV4Q 2PI2E 1C7YA 3GTLH 2R7DA 3HKZE 1X6OA 2K5NA 4PMWA 4KLKA 3H0GG 4JI4Q 4RG1A 3RZDH 2OTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWW B;  2YTX A;  2MNA A;  5GQO A;  1X9N A;  4X64 Q;  5GAG C;  1HNX L;  1E1T A;  3SGI A;  3GTQ H;  4AH6 A;  3IRB A;  3RR5 A;  1XNR L;  2JA7 G;  3I2Z A;  1G51 A;  1J6Q A;  1UE6 A;  3FKI G;  5IP7 G;  3CW2 C;  3PUX A;  1KQS A;  1K3R A;  3PF4 A;  2PQA A;  3KF6 A;  4DAM A;  3D0F A;  1EWI A;  4YY3 Q;  3K7A H;  4GNX B;  3HOY G;  3PO2 G;  1U0L A;  1WJJ A;  1N34 L;  3PUZ A;  5BR8 Q;  2QEX A;  1P16 A;  3CCJ A;  1ASZ A;  4NXM Q;  2NZO A;  4B3R Q;  1I6H H;  1GO3 E;  3HOU G;  4BBR G;  3ULJ A;  1VQN A;  3HOV H;  2JE6 I;  4A3I H;  4YWM A;  1QVG A;  1Q86 C;  4PZ7 A;  3CPW A;  5DLQ E;  4LF7 L;  4IPG A;  4LF9 Q;  3HKS A;  1UEB A;  4X6A H;  4LFC L;  4HID A;  4POF A;  4LF4 Q;  4JYA L;  3GO5 A;  1TWG H;  1VQO A;  4DUZ Q;  4LF5 L;  3CME A;  4JI8 Q;  1XJV A;  4BBS H;  2VZA A;  1L2F A;  2KCM A;  2JA8 H;  1FVI A;  4P72 A;  2R6G A;  1YI2 A;  2B63 G;  1Y14 B;  3RLO A;  4JI3 L;  5IYB G;  2VW9 A;  1KD1 C;  1MIU A;  3NBH B;  1QVC A;  3CCU A;  3S1M H;  3PUW A;  1HNX Q;  1T9H A;  4GNX C;  3ICE A;  3H3V H;  3S1N H;  5JJK A;  2LXJ A;  1TWC H;  2R93 G;  2B29 A;  1VQF A;  1VQE A;  4MZ9 A;  3ULP A;  4GOP A;  4OON A;  1YHB A;  3CQZ H;  2ZTE A;  3A5Z B;  3RLF A;  5FLM G;  4DR6 L;  2Q2I A;  1AE2 A;  3UE0 A;  1A8V A;  1Q8K A;  5C3E H;  3LGJ A;  1N34 Q;  4A3C H;  2RF4 A;  1TXY A;  1YIT A;  2JA5 H;  1Q12 A;  1S3O A;  1VQB A;  2V1C C;  4GOP C;  1SLJ A;  3D31 A;  4TVA B;  2NN6 I;  1TWF H;  3CCR A;  4A3L G;  1CKN B;  2YTY A;  1V43 A;  1X56 A;  4PZ8 A;  4DV7 L;  3CCL A;  4A3K G;  4JI2 L;  4LF7 Q;  3B6Y A;  5IT9 c;  4X62 L;  1PYB A;  4LF6 L;  4QY7 A;  4LFC Q;  4P71 A;  5FLX c;  1IBL L;  3HFZ B;  2YTV A;  4JYA Q;  1EQR A;  2AKW B;  1PVO A;  1PH3 A;  5C4J H;  3J7Z C;  4LF5 Q;  3S15 H;  1JT8 A;  1Z47 A;  2VQF L;  2UUC L;  3J80 c;  3KJP A;  4DR2 L;  1VQC A;  5JEA J;  1X54 A;  5C0X J;  3E0E A;  2UXD L;  2PMZ E;  3F1Z A;  2MQH A;  1B70 B;  3STB D;  4JI3 Q;  1PYS B;  1CKM A;  1YEZ A;  2NVQ H;  1M1K C;  2RHQ B;  1PH1 A;  2CCZ A;  3ER0 A;  2D0O A;  4L5T A;  4JI1 L;  1KC8 C;  4IPC A;  3PIO A;  4GLX A;  2R7Z H;  4UP9 A;  4BXX G;  1D7Q A;  1G29 1;  3CC7 A;  4YWL A;  4A3F G;  4DPG A;  1BBW A;  2K5H A;  5M3M H;  2UUA L;  2VUM G;  3PO3 H;  4DR6 Q;  4DR5 L;  2HIX A;  4IFD I;  4H02 A;  1PV4 A;  3E9I A;  1K83 H;  1KRT A;  1YJN A;  4A3B H;  2DGY A;  1MKH A;  1PH9 A;  1W2B A;  5M5W H;  1VQG A;  4MTN A;  2HT1 A;  3EBE A;  5M3F H;  4A93 G;  4K0K Q;  3RN5 A;  4QGU A;  4DV7 Q;  3PV0 A;  2Z0S A;  4DK6 C;  1CUK A;  4DR1 L;  1A0I A;  4JI2 Q;  4X62 Q;  4DV6 L;  2UXB L;  4NB3 A;  4LF6 Q;  1IXR A;  1OTC A;  1NE3 A;  4L5S A;  2QGQ A;  5C44 H;  2GVB A;  5IYC H;  4DV0 L;  3HOZ G;  3KYH C;  4BA1 I;  1IYJ B;  3CF5 A;  2VQF Q;  2UUC Q;  3BJU A;  1L1O B;  1D8L A;  3CPF A;  1SRO A;  4J15 A;  4DR2 Q;  3CC2 A;  2UXC L;  1A63 A;  1A62 A;  2UXD Q;  4AIM A;  2E8G A;  1VQI A;  1S72 A;  1GD7 A;  3J81 i;  1I5F A;  3NEL A;  3ZJY C;  3HOX H;  1IBK L;  3GTM H;  3M7N A;  3H3V I;  3TRZ A;  4WJ4 A;  4JI1 Q;  2ZTC A;  5M5X H;  3M4Q A;  1YJ9 A;  2K14 A;  1OXV A;  1UWV A;  3BZK A;  1EQQ A;  4A3G G;  5FJ8 H;  5IY0 A;  5IYD G;  2UUA Q;  1QUQ A;  2YYZ A;  4DR5 Q;  2JA6 G;  1QVF A;  1XMQ L;  5H1S E;  2CQO A;  2YV5 A;  2NVT H;  1EIF A;  5HGQ A;  4GLA C;  1VQD A;  1JE5 A;  4JG2 A;  1HH2 P;  4DV5 L;  3TS0 A;  3PUV A;  2R92 H;  3M4O H;  1Q1B A;  2A8V A;  4KI0 A;  1WCM G;  4UP7 A;  5ELN A;  2MO1 A;  5C4X H;  4JOI C;  3A5U A;  2N49 A;  4QJF A;  4WJ3 M;  1HR0 W;  4O0A A;  4YHH Q;  3G6E A;  4DR1 Q;  1L1O C;  4A3M G;  2E2J H;  4FDB A;  1HNW L;  2IHE A;  1SMX A;  4DV6 Q;  2UXB Q;  4C2M H;  5JJL A;  2JA7 H;  4A3D H;  4DV0 Q;  3UDG A;  3FKI H;  5IP7 H;  5LMN L;  4BY7 H;  3G48 A;  3JAM c;  4HJA A;  3GTJ H;  2ZTD A;  4GLV B;  4A75 A;  3HOV G;  4BA2 I;  1VQJ A;  1Y1W G;  2UXC Q;  4RMF A;  4LNQ A;  2A19 A;  2Q2T A;  3PO2 H;  2AWO A;  4GNX A;  1WYD A;  2K52 A;  2FXQ A;  4YCU A;  1EOV A;  3KF8 B;  3FHW A;  4JBJ A;  1SFO H;  1IBK Q;  2IX0 A;  2VY3 A;  1ASY A;  4B3M L;  5JEA G;  3L2P A;  1X3F A;  5C0X G;  3HOU H;  4BBR H;  2AHO B;  1UE7 A;  2JA9 A;  4AYB G;  4BBS G;  1XTD A;  2IY5 B;  2KEN A;  4NPS A;  2EIF A;  4JV5 L;  4HJ7 A;  1VQ7 A;  2WP8 J;  4DR3 L;  1XMQ Q;  1E22 A;  4A3J G;  4LFA L;  1UE1 A;  4BY1 H;  4DV5 Q;  3AFP A;  4QIW E;  1VCI A;  3U4V A;  4O2D A;  4GN5 A;  1M90 C;  2HHH Q;  2PI2 A;  1XPU A;  2E5L L;  2Z6K C;  3BZC A;  1VQ8 A;  3GTG H;  1RIP A;  1PH4 A;  3KJO A;  4UP8 A;  3CCE A;  1CSP A;  4R4C A;  5ELO A;  1PH5 A;  2I0Q A;  2ASB A;  1AH9 A;  1HNW Q;  3EIV A;  1HNZ L;  3GD7 A;  1U5K A;  5C3E G;  1XMO L;  4IFD J;  2BH2 A;  2R93 H;  1YJW A;  5LMN Q;  2JA5 G;  3JC6 6;  4ALP A;  3F2D A;  4K0K L;  1VQ4 A;  5FLM H;  4R4Q A;  2N3S A;  4P73 A;  3U4Z A;  3OTO L;  4JI0 Q;  3I4M G;  2K4K A;  3S1R H;  4QQB X;  4LW1 A;  3CXC A;  3KDF B;  5IP9 H;  2JEA I;  4ME3 A;  5GAH C;  3KOJ A;  1LYL A;  1RL2 A;  3PGZ A;  2GVA A;  4B3M Q;  1JJ2 A;  4R1J A;  3S2H H;  3J7A 5;  2RCN A;  4X65 L;  1CKO A;  2B3G A;  1WFQ A;  4A3L H;  1CKN A;  1TWH H;  4YCV A;  4JV5 Q;  1VQP A;  4A3K H;  4DR3 Q;  4HIM A;  4LFA Q;  4OO1 I;  3MEF A;  3CCV A;  3M3Y H;  3CCS A;  2C35 B;  2E5L Q;  4GS3 A;  3NEM A;  4AYB E;  4IJL A;  2OQK A;  1HJP A;  2KBN A;  1JMC A;  1N36 L;  4JBW A;  4A76 A;  1N8R C;  4LFB L;  1JJC B;  1KHI A;  3I4O A;  3OYY A;  1CSQ A;  1HNZ Q;  1Y1V G;  2BA0 A;  3CP0 A;  3KLW A;  1QZH A;  2GN5 A;  3G4S A;  3VDY A;  1K8G A;  1XMO Q;  1Q7Y C;  3TQY A;  3K7U C;  2L15 A;  5J3B A;  2E2I H;  3GTO H;  4C3I H;  1LUZ A;  4X66 L;  5M5Y H;  1B7Y B;  3GDE A;  1VQA A;  2NVY H;  2ZJP A;  1YVC A;  2JEB I;  4A3F H;  4YHH L;  1IBM L;  3I4N G;  4XIG S;  4DV3 L;  1NY4 A;  1R9T H;  1KAW A;  3OTO Q;  1VQM A;  5GAE C;  2IX1 A;  4QL5 A;  4JI5 L;  1DGS A;  4HIO A;  3K80 C;  4EQ5 A;  4A3E G;  4EX5 A;  4IO9 A;  2XGT A;  3L7Z C;  4LUO A;  2K50 A;  1Q82 C;  2ATW A;  3HOW H;  1K9M C;  3M85 A;  3UDI A;  3CCM A;  2WB1 G;  1SN8 A;  2NN6 G;  2OCE A;  5IYC G;  4X65 Q;  5C44 G;  2UUB L;  1PA6 A;  2MFI A;  3L0O A;  3PIP A;  3CAM A;  1KL9 A;  3E9H A;  4IOA A;  5E7N A;  2CWA A;  2D62 A;  3RNU A;  1QZG A;  1NTG A;  4R4I A;  2F3I A;  1TWA H;  4JOI A;  1L0W A;  4IPH A;  1PH7 A;  1MJE A;  3UDF A;  2LSS A;  3DM3 A;  4HJ5 A;  4UPA A;  4B3T L;  1L1O A;  2NVX H;  2NZH A;  1W3S A;  1N36 Q;  5FJ8 G;  1FJG L;  2Q2U A;  4LFB Q;  2ZM6 L;  4JCV E;  1PH8 A;  5K36 G;  1FL0 A;  3PUY A;  4APV A;  2BA1 A;  1EUJ A;  3F2C A;  2CFM A;  3M4P A;  2HHH L;  1YBY A;  2JQO A;  4OO1 G;  3T1H L;  1X55 A;  3BU2 A;  3J80 i;  4C3H H;  4YCW A;  2PQA B;  3H0G H;  3KF6 B;  1K0R A;  3AYH B;  4NXN L;  1V1Q A;  3RLN A;  3U50 C;  4X66 Q;  1XNQ L;  1IBM Q;  4A3G H;  5IYD H;  4DV3 Q;  5C4X G;  3S14 H;  2E2H H;  3ULL A;  3S1Q H;  4IFD G;  2JA6 H;  4JI5 Q;  2IHF A;  3RN2 A;  4KHZ A;  1SR3 A;  2XTI A;  2MO0 A;  1BBU A;  4DUY L;  5IWA L;  2UU9 L;  1I3Q H;  1WCM H;  2WFW A;  2ES2 A;  2KCT A;  3CD6 A;  4A3D G;  1P8L A;  4AQY L;  4A3I G;  1XPR A;  2UUB Q;  1O7I A;  1E7Z A;  3CMA A;  4JI0 L;  3U58 A;  3HOY H;  4BY7 G;  1KIX A;  1PFS A;  3I55 A;  4A3M H;  1WI5 A;  4DV1 L;  1NBW A;  1K73 C;  5LMU L;  1N33 L;  1HZC A;  1E1O A;  3STB C;  1EYG A;  3PCO B;  2Z6K A;  3CC4 A;  4JBK A;  4LUZ A;  4DV2 L;  2WB1 E;  5AJ3 L;  2JA8 G;  4KHP L;  4B3T Q;  1GKH A;  2K75 A;  5JJI A;  1Y1W H;  1FJG Q;  4P75 A;  2KHI A;  2VQE L;  2OQ0 A;  2ZM6 Q;  1C0A A;  3K0X A;  1HZA A;  3T1Y L;  3J81 j;  1E24 A;  3K8A A;  1I50 H;  4DR4 L;  2IT1 A;  1VQK A;  1I94 L;  3G71 A;  3T1H Q;  4PG3 A;  4BY1 G;  4GOP B;  4OX9 L;  2B63 H;  3AQQ A;  4NXN Q;  1XNQ Q;  2Q2H A;  4GKJ L;  1VQH A;  2ALY B;  5IYB H;  3I56 A;  4C3J H;  2Y0S E;  1X3E A;  4IPD A;  3TS2 A;  4GKK L;  4A3J H;  1YZ6 A;  1VQ9 A;  2I5H A;  4DUY Q;  4JI7 L;  4A3C G;  1KRS A;  1OXS C;  2LXK A;  2WAQ E;  5EAY A;  4L5Q A;  5IWA Q;  4Y7N H;  2UU9 Q;  2YU9 H;  4IJH A;  1XNR Q;  1PH2 A;  3A0J A;  3KFU A;  2N8N A;  4AQY Q;  3PF5 A;  2QA4 A;  4UY8 C;  1JB7 A;  3DLL A;  1G6P A;  1XPO A;  1X65 A;  1Q1E A;  1BKB A;  4DV1 Q;  1N32 L;  5LMU Q;  4JC0 A;  1N33 Q;  4R4O A;  1BVS A;  3Q8D A;  1C9O A;  1Z9F A;  5IP9 G;  2PNH A;  3H15 A;  3S24 A;  3J81 c;  3RZO H;  3FP9 A;  1E3P A;  4DV2 Q;  1HZ9 A;  4JI6 L;  5AJ3 Q;  5GAD C;  3S16 H;  1PHJ A;  1K8A C;  2D0P A;  2RHS B;  3NEN A;  4KHP Q;  3K81 C;  1GM5 A;  4POG A;  1H95 A;  1WOC A;  2DUD A;  2HIV A;  4B3S L;  3I4M H;  4LWC A;  2VQE Q;  3TRE A;  1HR0 L;  3T1Y Q;  4DR7 L;  3UDX A;  4DR4 Q;  3KDF A;  2JK8 A;  2VS1 A;  2F4V L;  1VQ6 A;  1EFW A;  1OXT A;  5HY6 A;  3JAM i;  1I94 Q;  1YHA A;  2R7Z G;  1LTL A;  4OX9 Q;  1S40 A;  1NJI C;  4LF8 L;  1EIY B;  1VQL A;  2ZJQ A;  2OWO A;  3HKZ G;  5M3M G;  3S17 H;  1GVP A;  4GKJ Q;  2H5X A;  3PO3 G;  1JJG A;  4P74 A;  5GRO A;  3W1G A;  3CCQ A;  2K5V A;  4HIK A;  1J5E L;  3AFQ A;  3WWV A;  1VQ5 A;  4GKK Q;  4A3B G;  3GTP H;  2CWP A;  2EXD A;  4OXP A;  4JI7 Q;  1VS0 A;  4LUV A;  5LMN W;  1Q46 A;  4BXX H;  2A1A A;  4HJ9 A;  4Y52 H;  1NMF A;  4DV4 L;  3F2B A;  2VUM H;  1PH6 A;  4R4T A;  4JI4 L;  1OXU A;  5M3F G;  2R7F A;  2AMC B;  4OWT B;  2JJQ A;  2VNU D;  2I5M X;  4DK3 C;  4MNO A;  1B8A A;  4X64 L;  1N32 Q;  1Y1V H;  2EQS A;  2KHJ A;  4XTC S;  1Q81 C;  1LM0 A;  4L5R C;  1FGU A;  1V9P A;  3HOW G;  4A93 H;  1OXX K;  3I7F A;  2VL6 A;  3M9B A;  4JBM A;  4JI6 Q;  1YNX A;  1UE5 A;  3I4N H;  1IZ6 A;  4YY3 L;  3GTK H;  4B3S Q;  1MJC A;  2ZJR A;  3TEH B;  3UE1 A;  4GN3 B;  4DNI A;  1HR0 Q;  1SE8 A;  4DR7 Q;  5BR8 L;  2F4V Q;  3HOX G;  4DAY B;  2CKZ B;  2F52 A;  4A3E H;  4NXM L;  3AEV A;  2BH8 A;  3PSI A;  1X3G A;  3HOZ H;  4B3R L;  1KXL A;  4A4I A;  1IBL Q;  1N9W A;  4LF8 Q;  3W5O A;  5C0X I;  3OW2 A;  3W1B A;  2ID0 A;  1IL2 A;  4GN4 B;  2Y0S G;  1QUQ B;  4TQU S;  2AWN A;  2HQL A;  3A74 A;  4DKA C;  1HZB A;  2I5L X;  3F8T A;  1SRU A;  1YHQ A;  2N78 A;  4HJ8 A;  3EN2 A;  1J5E Q;  1AE3 A;  4IOC A;  4LF9 L;  3S2D H;  2WAQ G;  2OTL A;  4LF4 L;  2R92 G;  3ERS X;  4PZ6 A;  4YWK A;  1NMG A;  4OWX B;  4DUZ L;  3MXN B;  1YIJ A;  4JI8 L;  5IE8 A;  4DV4 Q;  2PI2 E;  1C7Y A;  3GTL H;  2R7D A;  3HKZ E;  1X6O A;  2K5N A;  4PMW A;  4KLK A;  3H0G G;  4JI4 Q;  4RG1 A;  3RZD H;  2OTJ A; 
#chains in the Genus database with same CATH topology
 2CQA A;  4QF4 A;  2MNA A;  5GQO A;  4HMI A;  5GAG C;  4LAA A;  1E1T A;  4JW0 A;  4K8J A;  4AH6 A;  3IRB A;  1G51 A;  2KA7 A;  4ULL A;  1TWF B;  1K3R A;  3KF6 A;  2N88 A;  3D0F A;  1EWI A;  3CRL C;  1SNO A;  1WJJ A;  1RKN A;  1STE A;  1DCZ A;  1P16 A;  4DU9 A;  2J0T D;  3ULJ A;  1WVL A;  4YWM A;  1Q90 A;  4PZ7 A;  4TRD A;  4CJ1 B;  1H9K A;  4IPG A;  1UEB A;  4X6A H;  1KLG D;  2A73 B;  1SXT A;  5C0X H;  3M3Y B;  4G7H C;  3OMC A;  4JI8 Q;  3K5O A;  3PO3 B;  2JA8 H;  1PDQ A;  4P72 A;  4DXG A;  1F9Q A;  1TR5 A;  3S1M H;  1MIU A;  1QVC A;  1CHQ D;  1V1P B;  3PUW A;  4IAL A;  1EQT A;  5IGF A;  1K3B C;  4GOP A;  1CA6 A;  2B2W C;  3CQZ H;  1Z6H A;  2B8F A;  5EPK A;  3UE0 A;  1R9T B;  1Q8K A;  4R8N A;  2WKD A;  2RF4 A;  1TXY A;  2JA5 H;  3J81 L;  1Q12 A;  2P5Z X;  1S3O A;  1VQB A;  4K5W A;  2OT2 A;  5LL6 X;  2O2L D;  3R2T A;  2Q8T A;  3CCR A;  4A3L G;  2YTY A;  1V43 A;  4N8X 1;  4A3K G;  3B6Y A;  1S5E D;  4LMQ D;  4QY7 A;  4LFC Q;  4P71 A;  2M2L A;  1TS3 A;  1JWU D;  3S15 H;  4DAP A;  4F87 A;  1EZ6 A;  1ZYR C;  2F0L A;  3K5M A;  3DM1 A;  1SYE A;  1KDC A;  2PMZ E;  3E3X A;  4JI3 Q;  3STB D;  3LNN A;  2NVQ H;  2B2U C;  2B2T A;  3ER0 A;  2XRQ D;  4IPC A;  3PIO A;  4BXX G;  3H0G B;  4C1N K;  2H1E A;  1G29 1;  1IL8 A;  2E2J B;  1DOM A;  1Y8O B;  3S1Q B;  2RSO A;  3RD4 A;  4ZKC B;  3E9I A;  1K83 H;  1WTP A;  5CC4 A;  1F2Y A;  2LKV A;  1EIH A;  1I3Q B;  4MTN A;  2RCF A;  3HOY B;  1GUN A;  4DR1 L;  1R4Q B;  3FMC A;  3H09 A;  1A0I A;  4X62 Q;  5I9O A;  4LF6 Q;  1IXR A;  1TII D;  2QGQ A;  3KYH C;  4KY5 A;  2LFN A;  2F0U A;  5ELD A;  1D8L A;  4DR2 Q;  2UXC L;  2AUJ D;  1TU2 B;  4AIM A;  3TP6 A;  4HCS A;  2NUC A;  3NEL A;  3D3R A;  4DAY A;  1MBY A;  3TRZ A;  2WII B;  5M5X H;  1YJ9 A;  2K14 A;  4CDF C;  3ZYY X;  4FXK C;  5IY0 A;  4DR5 Q;  1XMQ L;  4OO1 H;  1EIF A;  5HGQ A;  4GLA C;  2B39 A;  1JE5 A;  3M4O H;  1HH2 P;  2A8V A;  3HZX A;  2YU9 B;  1XX8 A;  4JVZ A;  1K28 A;  1LV9 A;  4JOI C;  3A5U A;  3AU7 A;  4O0A A;  1HNW L;  1FNU A;  4FDB A;  4DV6 Q;  1B2T A;  3T56 B;  4A3D H;  2KOL A;  4HJA A;  3IFD A;  4OEL B;  4A75 A;  1VQJ A;  2Z8L A;  3SR1 A;  2Q2T A;  3PO2 H;  4GNX A;  1A3T A;  2CVR A;  3TN2 A;  5FO8 B;  1WYD A;  2K52 A;  2FXQ A;  3MVV A;  3FHW A;  2IX0 A;  3P75 A;  3NUC A;  1EIG A;  3ITP A;  4CHT B;  2KVM A;  4B3M L;  3MC0 B;  4AYB G;  2KJX A;  1EY4 A;  4Q0F A;  1PZK D;  4JV5 L;  2EJG C;  4HJ7 A;  4DR3 L;  1AFP A;  3V96 A;  3OHX C;  4QIW E;  2XN9 C;  1AZQ A;  1JOQ A;  4ZKB B;  4O2D A;  1XPU A;  4A3F B;  2E5L L;  4X3S A;  3BZC A;  4CDC C;  1EY0 A;  1MGS A;  3CCE A;  1CSP A;  2ASB A;  2AQ3 B;  5ELO A;  1WD0 A;  3NSW A;  1AH9 A;  3NBH A;  2MHV A;  4KMU C;  5JVH 3;  1T5E A;  4IFD J;  4K14 A;  3ONA B;  5LL6 S;  4A93 B;  3F2D A;  5FLM H;  2E75 C;  1EY5 A;  1S5D D;  4KKS A;  2JEA I;  1LYL A;  2BDO A;  2F3V A;  3HG9 A;  5CBA E;  1GUW A;  1GHJ A;  2RCN A;  4GZY C;  5JPM C;  2QIL A;  4KD4 A;  1VQP A;  2G9D A;  5CGK A;  4HIM A;  4LFA Q;  4OO1 I;  1L0X B;  3M3Y H;  4GS3 A;  3NEM A;  4X3T A;  2OQK A;  1HJP A;  1JMC A;  2JA6 B;  3RZD B;  4A76 A;  2XRS D;  1Y1V G;  3KLW A;  1SBB B;  2GN5 A;  4X3U A;  3VYU A;  4H44 C;  3AMU A;  1CM9 A;  1MI2 A;  5I2Y A;  3GDE A;  1HA6 A;  3I4N G;  4XIG S;  2K03 A;  1R9T H;  4F8M A;  1VQM A;  1AP0 A;  1DGS A;  3NQI A;  4A3E G;  5JOB A;  4LUO A;  2K50 A;  2ATW A;  2HCI A;  1I6H B;  1GOZ A;  3VR2 A;  1OO9 B;  1S5B D;  3CCM A;  5C44 G;  1E2V A;  1PA6 A;  4EVO A;  1XWE A;  2TMP A;  3PIP A;  1TVX A;  4CKE A;  3URY A;  1QG7 A;  1SND A;  2L0C A;  4IOA A;  3VA7 A;  4IUV A;  5E7N A;  2D62 A;  1QZG A;  3T53 B;  2F0N A;  3FEW X;  2EY6 A;  1PH7 A;  2LSS A;  3DM3 A;  1EOT A;  1EWC A;  2NZH A;  1W3S A;  1N36 Q;  4KY7 A;  4LFB Q;  1FL0 A;  3FPP A;  2JQO A;  1ZYR D;  2EYJ A;  3J80 i;  1CHP D;  4CJ0 B;  3H0G H;  3KF6 B;  4NXN L;  4X66 Q;  1XNQ L;  4WJ3 M;  1LLR D;  4A3G H;  1IBM Q;  1EFI D;  4OIJ A;  1HHV A;  2M00 A;  3S1Q H;  4IFD G;  4JI5 Q;  1I6V C;  3X3N A;  2XTI A;  1IKL A;  4DUY L;  3R8B A;  5G3L D;  5IWA L;  1ET6 A;  1I3Q H;  5EBD A;  1WCM H;  2ES2 A;  4AQY L;  4M1U B;  1MSG A;  2SEB D;  3U58 A;  3HOY H;  4I7Z C;  3MHB A;  4L8J A;  4A3M H;  1E1O A;  3VYS A;  1NR4 A;  1EYG A;  1PTO H;  2O4X A;  4WFN 3;  4JBK A;  3S17 B;  2EY1 A;  3DXJ C;  5AJ3 L;  2X6L A;  4KHP L;  4G7Z C;  3BDO A;  4K8I A;  1F9P A;  2ZM6 Q;  3K0X A;  3DEP A;  1U4P A;  3K8A A;  1I50 H;  3ND9 A;  4GOP B;  1J8I A;  3AQQ A;  3EJI A;  5KYI A;  1VQH A;  5KNB A;  5IYB H;  2RQX A;  2AQ2 B;  1II3 A;  4IPD A;  1Y69 U;  3I70 A;  4A3J H;  4UAI A;  1OXS C;  5EAY A;  2LXK A;  2UU9 Q;  3CRK C;  1BOS A;  2YU9 H;  1XNR Q;  2KQ3 A;  1IW7 C;  1BUV T;  2N8N A;  5CMD A;  3PF5 A;  4HAE A;  4I65 A;  1WTX A;  1XPO A;  3IAY A;  2BOS A;  1CA5 A;  4DV1 Q;  3I72 A;  1N32 L;  3DUZ A;  4JC0 A;  4R4O A;  3H15 A;  2WB1 B;  4XYO A;  1GJX A;  1QCB D;  4DV2 Q;  1HZ9 A;  5GAD C;  1PHJ A;  2RHS B;  1GM5 A;  1ICF B;  3DMU A;  4LWC A;  3NTI A;  2VQE Q;  1HR0 L;  4DR7 L;  3UDX A;  2VS1 A;  2HD3 A;  2K5D A;  3GTL B;  4OX9 Q;  4PQX A;  1EIY B;  2OWO A;  3VR5 A;  4GKJ Q;  1FNV A;  4P74 A;  4YIJ A;  5GRO A;  3W1G A;  2MUY A;  3CCQ A;  2NVT B;  3OPO A;  4GKK Q;  1BQQ T;  5J39 A;  3GTP H;  2R92 B;  1SNC A;  4ZRZ A;  3QJY A;  1SSO A;  4DAV A;  4JI4 L;  5C4X B;  1DOK A;  4EQN A;  3V2T A;  4KKT A;  2KCC A;  2VNU D;  1QWY A;  1Q81 C;  1SJE D;  1NUC A;  1LM0 A;  3Q23 A;  4FVM A;  3M9B A;  4JI6 Q;  4A93 H;  3N52 A;  1BXT A;  1HA5 A;  2GA4 B;  3A55 A;  1B9M A;  3TEH B;  5CV8 A;  4GN3 B;  1JOO A;  5BN3 A;  1SFO B;  1RHP A;  1V1O A;  4DAY B;  2CKZ B;  4NXM L;  2BH8 A;  4B3R L;  2K28 A;  2JA8 B;  4KJO A;  1IBL Q;  1N9W A;  4I7A A;  1UUP A;  4LF8 Q;  3W5O A;  4XT3 B;  1IL2 A;  2NYZ D;  5K5P A;  1Z7T A;  1E0B A;  2F3W A;  3D4W A;  1CK1 A;  2I5L X;  1SRU A;  1YHQ A;  1YNJ C;  4IOC A;  4BY1 B;  2WAQ G;  4IUQ A;  2WAC A;  3ERS X;  2PZW A;  4RA8 A;  5IE8 A;  3CQZ B;  2PI2 E;  4PMW A;  4C3H G;  1X6O A;  2K5N A;  4FF2 A;  3RZD H;  2OTJ A;  1ZKO A;  1KTK A;  1TQO A;  2QCP X;  3MFG A;  3X3M A;  4X64 Q;  1HNX L;  3BYY B;  3GTQ H;  3LWU A;  1XNR L;  2JA7 G;  3GV6 A;  3FKI G;  1UE6 A;  4IUP A;  1KQS A;  1JOK A;  3PUX A;  2PQA A;  4DAM A;  2L1B A;  2PYK A;  1AN8 A;  1IHZ A;  4S3S A;  4YY3 Q;  3PMF A;  4ZUJ A;  4GNX B;  3RMH A;  1FNW A;  2RBM A;  5BR8 Q;  1SYC A;  2NZO A;  1I6H H;  1LT5 D;  4BBR G;  1VQN A;  1SNM A;  3C1F A;  4LF7 L;  4LF9 Q;  4JYA L;  2DJF C;  3GO5 A;  4DUZ Q;  2LS0 1;  2VZA A;  1L2F A;  4HN7 A;  1FVI A;  2B63 G;  1D1I A;  2R6G A;  2RDF A;  1Y14 B;  3RLO A;  2VW9 A;  3NBH B;  2EY2 A;  4GNX C;  3ICE A;  5JJK A;  5BN5 A;  3S1N H;  2LXJ A;  2R93 G;  2B29 A;  3I4L A;  4OON A;  1STG A;  2RDG A;  3LGJ A;  4IZ8 A;  4MTK A;  5E4W C;  4CGY B;  4ZCK A;  1YIT A;  3HOW B;  4N8F A;  2B2Y A;  5D3D A;  4DV7 L;  1X56 A;  4JI2 L;  4J8Q A;  5IT9 L;  1IBL L;  1A3U A;  2JP1 A;  3TP7 A;  2FIN B;  1ML0 D;  3NE5 B;  1BNZ A;  2IWH A;  1PH3 A;  3J7Z C;  1Q3L A;  5T1I A;  1JT8 A;  4K2K A;  2A6E C;  1EU3 A;  4B9X A;  5C0X J;  4DGZ A;  1H9J A;  1I4Q A;  1L0Y B;  2UXD L;  3F1Z A;  3K6O A;  1PYS B;  1ZXT A;  3ERO A;  1M1K C;  2QF7 A;  2D0O A;  4JI1 L;  4GLX A;  2R7Z H;  4C3I G;  5EGT A;  2PPB C;  1D7Q A;  5M3M H;  1BO0 A;  3MZ5 A;  4HTH A;  3DWP A;  4ODG A;  4H02 A;  4A3B H;  1YJN A;  5EJW A;  1XXG A;  2HT1 A;  4HSV A;  3EBE A;  3PO2 B;  4K0K Q;  3RN5 A;  4X3K A;  4CKC A;  2Z0S A;  1CUK A;  4ZAI A;  4ZUI A;  4XYQ A;  2UXB L;  4NB3 A;  1FGB D;  5CV7 A;  1IW7 D;  1NE3 A;  4L5S A;  3HOZ G;  2QDL A;  1IYJ B;  2KED A;  4J15 A;  1A62 A;  5FKA C;  4O1N A;  4FNF A;  1KNE A;  4MIU A;  1K8M A;  2E8G A;  1G6Z A;  1S72 A;  3HS0 C;  1GD7 A;  1NCV A;  3VR4 A;  3J81 i;  1I5F A;  3HOX H;  1IBK L;  1EY8 A;  4WJ4 A;  4K6L A;  1OXV A;  1UAP A;  5FJ8 H;  5IYD G;  5K36 H;  1NR2 A;  3EFX D;  2YYZ A;  2NVT H;  4DV5 L;  3TME A;  2R92 H;  3PUV A;  1IYU A;  4KI0 A;  4Y7N B;  2E76 C;  4OEM B;  1HFN A;  2RDH A;  2LY7 A;  3K58 A;  4UDU C;  5C4X H;  1X3Q A;  2N49 A;  4YHH Q;  4DR1 Q;  3A54 A;  1M8A A;  1SMY C;  4DNR B;  3PIO 3;  5LMN L;  3S16 B;  4HMJ A;  4C1N I;  1ENF A;  2ZTD A;  2UXC Q;  3BVZ A;  4LNQ A;  2AWO A;  3A56 A;  4XDX A;  1SFO H;  4Y52 H;  5FOB B;  2VY3 A;  5G3L F;  5C0X G;  1HUM A;  1STN A;  5FO9 B;  2KEN A;  1JC7 A;  4C3J G;  1EWH A;  1VQ7 A;  1XMQ Q;  2XVS A;  3VR3 A;  1TS4 A;  1UE1 A;  4BY1 H;  3J81 E;  3AFP A;  1M90 C;  5D3I B;  2NWG A;  1F77 A;  1HFG A;  2VUM B;  4ME5 A;  4IQZ A;  2F0P A;  1YNJ D;  4R4C A;  3I3C A;  1QIL A;  1HNW Q;  1WTO A;  1QJO A;  1HNZ L;  3GD7 A;  1X32 A;  5FK9 C;  2K1B A;  4HCE A;  1YJW A;  2JA5 G;  3JC6 6;  4ALP A;  4K0K L;  2RA4 A;  1VQ4 A;  1S5C D;  3I4M G;  2RVL A;  1J9O A;  1V8Q A;  3OTO L;  4LW1 A;  2K5W A;  2K01 A;  1G2T A;  2L4N A;  2GVA A;  4B3M Q;  1SEB D;  4CJ2 C;  3J7A 5;  1CKO A;  1ESF A;  4A3L H;  1A15 A;  5CBE E;  1TWH H;  4RGT A;  4JV5 Q;  3NPP A;  4A3K H;  3CHB D;  3CU7 A;  4HED A;  4DR3 Q;  3S2D B;  4RAU C;  1JR0 D;  2N55 A;  3MEF A;  1LTB D;  3KLS A;  4RGN A;  4A3G B;  1PTO F;  4L6T B;  2E5L Q;  3KK7 A;  4HR7 B;  2KBN A;  1NAP A;  3WDN A;  1EZ8 A;  2Z6B A;  4C56 C;  3G4S A;  1WCM B;  4Z9C B;  2L11 A;  2L15 A;  5EKK A;  3P1H A;  5M5Y H;  1NSN S;  1SNQ A;  1YVC A;  2JEB I;  2X69 A;  2MP1 A;  3KUP A;  4YHH L;  4A3M B;  4DV3 L;  1KAW A;  1PZJ D;  4FF1 A;  1TY2 A;  5GAE C;  4QL5 A;  1PTO B;  4EX5 A;  4IO9 A;  3HOW H;  2CH4 A;  3M85 A;  1LT4 D;  1O7Y A;  3K59 A;  3HOV B;  1SN8 A;  2NN6 G;  2UUB L;  3BVG A;  2F0D A;  1I50 B;  4U68 A;  3HGB A;  2JSO A;  2NTS A;  2CWA A;  3RNU A;  1TWG B;  1AEX A;  4QMG A;  2F3I A;  4BBS B;  1MJE A;  3UDF A;  2EYP A;  2ICE C;  4UPA A;  3VYR A;  2NVX H;  1PYW D;  4JCV E;  4A3J B;  3PUY A;  1CZG A;  2BA1 A;  1YBY A;  1EYC A;  4OO1 G;  3BU2 A;  2A6E D;  1PTO C;  4TKO B;  2PQA B;  2DJG C;  4YCW A;  1K0R A;  4RHS A;  2IX3 A;  1LTG D;  2NZ1 D;  1TT2 A;  3S14 H;  3FVQ A;  1D6E C;  3S9W A;  1PFB A;  5C3E B;  4KN7 C;  1BBU A;  5JJZ A;  3SHL A;  3HEJ A;  4A3D G;  1P8L A;  2OXP A;  3F2U A;  4A3I G;  1O7I A;  3FRP B;  2WKC A;  5LMU L;  5ELF A;  1HZC A;  2EYL A;  1EU4 A;  2K33 A;  2RSN A;  3CC4 A;  4LUZ A;  2WB1 E;  3GQB A;  4J1M A;  3GTP B;  3T1Y L;  1HZA A;  4DR4 L;  1SJH D;  3N6R A;  2IT1 A;  1VQK A;  4EGV A;  3D6W A;  4NXN Q;  1XNQ Q;  2Q2H A;  3MFY A;  2ALY B;  2WIN B;  1X3E A;  2C5C A;  2I5H A;  4DUY Q;  4A3C G;  1KRS A;  3D4R A;  5IWA Q;  4Y7N H;  5M5W B;  1H9M A;  3D6C A;  4IJH A;  3KFU A;  4AQY Q;  2QA4 A;  4UY8 C;  5LHY 1;  1JB7 A;  1KAA A;  1JB3 A;  3VR6 A;  1G6P A;  1X65 A;  2IPK D;  1XTC D;  3T4A C;  3FDT A;  1GUT A;  2VB2 X;  1YNN C;  1C9O A;  3D8G A;  3NP8 A;  3RZO H;  3DWQ A;  4FXD A;  3S16 H;  1TS5 A;  5AJ3 Q;  4N9T A;  1K8A C;  2D0P A;  4KHP Q;  1SMY D;  1H95 A;  1SYG A;  2DUD A;  4B3S L;  5KND A;  1QE6 A;  1UEA B;  3BDC A;  4ABN A;  3NWT A;  4Q5V A;  2F4V L;  1VQ6 A;  5HY6 A;  1MD2 D;  1LTL A;  1TKW B;  1NJI C;  1XYI A;  4DA2 A;  2B2Y C;  3PO3 G;  2F0I A;  5CV6 A;  1FYC A;  1J5E L;  3GTQ B;  1VQ5 A;  3EVQ A;  4RH6 A;  2WAQ B;  1B4O A;  1VS0 A;  2JXM B;  4KTA A;  5DEH A;  3R3O A;  1NMF A;  2VUM H;  2EJM A;  1ENA A;  3TZD A;  5M3F G;  2R7F A;  2AMC B;  4OWT B;  5KGU A;  5EPL A;  2JJQ A;  2I5M X;  3A7L A;  4MNO A;  1N32 Q;  1Y1V H;  4C2M B;  1ENC A;  4XTC S;  5COR A;  2JA7 B;  4L5R C;  3FKI B;  1FGU A;  1V9P A;  1AZP A;  4BY7 B;  1OXX K;  3I7F A;  2VL6 A;  3GTJ B;  4JBM A;  5EQ0 A;  3I4N H;  1IZ6 A;  3GTK H;  1Y8N B;  2ZJR A;  1RCV D;  4G7O C;  1HR0 Q;  4DNI A;  1SE8 A;  4DR7 Q;  3AEV A;  4A3E H;  3QOJ A;  3PSI A;  1KXL A;  5EKI A;  1ESR A;  3OW2 A;  3W1B A;  4GN4 B;  2Y0S G;  1SNP A;  3A74 A;  5HUR A;  1HZB A;  3S1N B;  4IUN A;  1O7Z A;  4HJ8 A;  3S2D H;  4LF4 L;  4B9W A;  5KYL A;  4PZ6 A;  1HCZ A;  4YWK A;  1SE2 A;  3C2P A;  3D4D A;  3GV3 A;  1BCP F;  2BE5 C;  4KLK A;  3H0G G;  4JI4 Q;  1I4R A;  3MWY W;  2YTX A;  1R4P B;  1X9N A;  4FXG C;  2F0K A;  5EPJ A;  3RR5 A;  5KNC A;  2SOB A;  1J6Q A;  5IP7 G;  2EXZ A;  3CW2 C;  3PF4 A;  1WD1 A;  1DON A;  3K7A H;  3HOY G;  4ZYS A;  2EVB A;  4IFD H;  1N34 L;  2QEX A;  2BDN A;  3HP3 A;  1BCP B;  4NXM Q;  4B3R Q;  3OIQ A;  1GO3 E;  5C6A A;  3HOU G;  4DK1 A;  1SAP A;  3HOV H;  1QVG A;  2DY8 A;  3CPW A;  5DLQ E;  3A8K E;  1KNA A;  1MHW C;  4EQP A;  4POF A;  4HID A;  2R7Z B;  1TWG H;  1PZI D;  1VQO A;  4LF5 L;  3HKZ B;  4BBS H;  5M3M B;  2AQ1 B;  2A69 C;  4PV1 C;  2B2W A;  2CW0 C;  1HPC A;  4QUF A;  2V4D A;  1VF7 A;  2Z4I A;  1O7L A;  4A3B B;  5IYB G;  1KD1 C;  1LTT D;  3TSS A;  2F0V A;  1HNX Q;  5F2D A;  3H3V H;  3IL8 A;  1TWC H;  1VQF A;  1VQE A;  4MZ9 A;  3ULP A;  2E2I B;  1BCP C;  1YHB A;  3A5Z B;  4DR6 L;  3P20 A;  2XWJ B;  3G7L A;  5C3E H;  1PTO D;  3H94 A;  2SNS A;  3C1E A;  4GOP C;  2V1C C;  4DXF A;  1SLJ A;  4DFA A;  3DEO A;  1LAB A;  2LMC B;  2A5H A;  4PZ8 A;  1D5X C;  3HOX B;  4LF7 Q;  1NNX A;  5IT9 c;  5FLX c;  4JYA Q;  3HFZ B;  2YTV A;  5I6W A;  1EQR A;  2AKW B;  3FPU B;  1CT1 D;  5C4J H;  1H9R A;  2F0W A;  2NTT A;  2VQF L;  2UUC L;  4ID6 A;  3KJP A;  1VQC A;  5JEA J;  1DOL A;  4NMZ A;  3J80 L;  2Z9H A;  2MQH A;  1U4R A;  3I91 A;  2RHQ B;  1PH1 A;  2CCZ A;  4BWG B;  4A3F G;  2UUA L;  1K8O A;  4DPG A;  2K5H A;  2E2H B;  2A74 C;  2HIX A;  4IFD I;  2B2T C;  3WOF A;  5M5W H;  5A2Q L;  1VQG A;  4PMB A;  4XQN A;  2F0Q A;  2NBF A;  1VMP A;  4A93 G;  3MTS A;  5DNF A;  4QGU A;  4DV7 Q;  2PQE A;  1SYD A;  3SDZ A;  3BDL A;  4JI2 Q;  1K0S A;  4F7X A;  2QW7 A;  2EYH A;  1OTC A;  1HUN A;  2GVB A;  5IYC H;  4NKL A;  4DV0 L;  4BA1 I;  3CF5 A;  3OMG A;  3CC2 A;  3WOE A;  1SRO A;  2UXD Q;  2L9H A;  2IL8 A;  4G57 A;  4J6H A;  1VQI A;  2ICI A;  3QOL A;  2ZXR A;  3M7N A;  3H3V I;  4JI1 Q;  1JWS D;  1UWV A;  1EQQ A;  1A3V A;  3NTH A;  3OWF A;  2VXW A;  2JA6 G;  1GXD C;  1QVF A;  2YV5 A;  1B3Q A;  3SK8 A;  2HDL A;  2FJ2 A;  2PW5 A;  3EA6 A;  3CKI B;  4RGO S;  3O13 A;  1EY9 A;  1AW7 A;  3MAQ A;  1HR0 W;  5DM7 3;  3G6E A;  1SMX A;  2UXB Q;  3E6Z X;  4C2M H;  3MXP A;  2JA7 H;  5T1G A;  2F03 A;  3UDG A;  3FKI H;  4BY7 H;  3G48 A;  1U4M A;  1S5F D;  3JAM c;  3GTJ H;  1TWH B;  4GLV B;  2E74 C;  4A3K B;  1Y1W G;  4RMF A;  2A19 A;  3BG3 A;  4RFB A;  4H13 C;  1LT3 D;  1IBK Q;  1GUG A;  4BS9 A;  4DNT B;  5JEA G;  5J1Z A;  1X3F A;  4BBR H;  1T5X D;  2D5D A;  1XTD A;  3QR8 A;  4NPS A;  3BS1 A;  2EPB A;  3SK6 A;  4DV5 Q;  3SVM A;  3BZD B;  5M5Y B;  3U4V A;  3QO2 A;  2HHH Q;  3KJO A;  3NK9 A;  1PH5 A;  5C5M A;  2I0Q A;  3OWE B;  5E3F A;  3SK5 A;  5IGB A;  3EIV A;  4KV6 A;  1U5K A;  5IT9 E;  1B3A A;  1XMO L;  2BE5 D;  2R93 H;  5LMN Q;  4PMC A;  3Q6S A;  4RGM A;  5TSS A;  4R4Q A;  1M4V A;  4P73 A;  4QQB X;  3CXC A;  5IP9 H;  1LTS D;  4ME3 A;  5FLX L;  3KOJ A;  1RL2 A;  1JJ2 A;  4R1J A;  1CZW A;  2NVX B;  2FMM A;  1H9S A;  4X65 L;  2F0S A;  1HQR D;  1CKN A;  4YCV A;  4KKU A;  3J7A V;  4XQQ A;  3CCS A;  5IOC A;  1ILP A;  3NBI A;  4IJL A;  4U67 3;  3S14 B;  1F2M A;  1JE4 A;  2K5Q A;  1N8R C;  1JJC B;  3IKJ A;  2C9O A;  1HNZ Q;  1DM0 B;  1QOH A;  1O80 A;  3R93 A;  1QZH A;  3VDY A;  5CYU A;  4QCL A;  1QNU A;  1K8G A;  2A69 D;  4CBV A;  2EYF A;  1STA A;  2CW0 D;  2E2I H;  4C3I H;  1LUZ A;  2G9H D;  1D5Z C;  1B7Y B;  1VMC A;  1VQA A;  2NVY H;  1NY4 A;  3OTO Q;  2KCN A;  4HIO A;  4MHE A;  3K80 C;  1BCP D;  2TSS A;  2XGT A;  4KHV A;  1Q82 C;  1LT6 D;  3SXH A;  2WB1 G;  2OCE A;  2B8G A;  2HUG A;  2MFI A;  3L0O A;  3AB9 A;  3OSO A;  1A2U A;  3M4Y A;  1KL9 A;  3E9H A;  1FD7 D;  4WJW A;  1NTG A;  4R4I A;  1QNK A;  4AYB B;  4IPH A;  2F0O A;  1F2Z A;  3GP7 A;  3M7G A;  4HJ5 A;  4B3T L;  1L1O A;  1WTQ A;  1FJG L;  5FJ8 G;  2Q2U A;  5K36 G;  5D65 A;  4APV A;  3F2C A;  1EUJ A;  2CFM A;  2HHH L;  1DZ1 A;  2M9V A;  3T1H L;  3BYT B;  1LO5 D;  3RLN A;  1V1Q A;  1RTN A;  3EQL C;  4OIK A;  5IYD H;  1PFN A;  4DV3 Q;  5C4X G;  2E2H H;  2F4I A;  3I8Z A;  2IHF A;  2WV6 D;  4RCO A;  1GUS A;  2D9U A;  2MO0 A;  2XNA C;  3RZO B;  3TDQ A;  3CD6 A;  3JAM L;  2UUB Q;  2L55 A;  1PFS A;  3I55 A;  1N33 L;  1I4H A;  1SE3 A;  3V05 A;  2Z6K A;  1SE4 A;  2JA8 G;  2L12 A;  1CFM A;  5A35 A;  1GKH A;  2K75 A;  2EOT A;  4P75 A;  1BR9 A;  1STY A;  2KHI A;  2F0J A;  1E24 A;  5ELE A;  3KF8 A;  1I94 L;  3G71 A;  4BY1 G;  1IYV A;  1CI3 M;  2EYM A;  4IUR A;  1BDO A;  2F0M A;  3Q24 A;  2A68 C;  2QEJ C;  4C3J H;  1Y1V B;  4P2C B;  5C4Z A;  3OW7 A;  2Q8R E;  3NWS A;  1YZ6 A;  4JI7 L;  1WTR A;  3K57 A;  2WAQ E;  3I4N B;  3MEH A;  3GTK B;  4XT1 B;  3SK4 A;  5M3F B;  1I4P A;  3DLL A;  4JPB W;  4A3E B;  3W2D A;  5EBC A;  5LMU Q;  1Z9F A;  5C44 B;  3S24 A;  3MA2 B;  3RUZ A;  1LAC A;  1IKM A;  3K0Y A;  4DF7 A;  4POG A;  1WOC A;  2HIV A;  1DYQ A;  3I4M H;  3QIA A;  3NXW A;  3T1Y Q;  4DR4 Q;  3KDF A;  3K5L A;  2JK8 A;  5CV4 A;  1EFW A;  3GTM B;  1BBX C;  1ILQ A;  2J7Z A;  1S40 A;  2Z1C A;  1G8Z D;  1VQL A;  2Y0S B;  1JJG A;  1RF2 D;  2K5V A;  3IFT A;  1Y8P B;  3AFQ A;  2KUM A;  2CWP A;  2EXD A;  4MN3 A;  3A8J E;  4BXX H;  4LUV A;  5LMN W;  2KHS A;  4HJ9 A;  4DV4 L;  5C5L A;  2PW7 A;  3BVM A;  3F2B A;  1ET9 A;  3K7A B;  1OXU A;  4DK0 A;  5J22 A;  2E2D C;  1B50 A;  4HSP A;  1SYB A;  2HCC A;  1VF5 C;  2KHJ A;  1TY0 A;  5ISR A;  3LX0 A;  3HOW G;  1G91 A;  1YNX A;  1UE5 A;  4B3S Q;  1MJC A;  4R9W A;  5I4D A;  4FF3 A;  2F4V Q;  2F52 A;  1X3G A;  3G6J B;  4A4I A;  3HOU B;  2DNC A;  5C0X I;  2NN6 H;  4TQU S;  3T51 B;  2HQL A;  1C48 A;  2D2C C;  4K5V A;  3OIP A;  4DKA C;  4K5X A;  3E5S A;  3F8T A;  3Q22 A;  3HRZ C;  1J5E Q;  2N78 A;  1AE3 A;  2AUK A;  1TWC B;  2XIW A;  2Q8I B;  4FF4 A;  1EYD A;  1NMG A;  2J4X A;  4LK1 C;  4JI8 L;  4H7B A;  1WTW A;  1C7Y A;  2R7D A;  3HKZ E;  2EY5 A;  3GTG B;  4FO2 A;  4OWW B;  1O78 A;  3SGI A;  3I2Z A;  1PRT F;  4PNY A;  3PO2 G;  5E4X A;  3OOC A;  3S1R B;  1U0L A;  3PUZ A;  1SYF A;  5C4J B;  3CCJ A;  1ASZ A;  3H3V C;  4ZK9 B;  4B08 A;  3S2H B;  4WRD A;  3NTK A;  4NW2 A;  4K2L A;  5KRU A;  2JE6 I;  4A3I H;  3ERQ A;  1Q86 C;  1HTP A;  3DHQ A;  2KEE A;  2X6G A;  3HKS A;  4LFC L;  4LF4 Q;  4K6D A;  2A6H C;  1KDA A;  3CME A;  1XJV A;  1PRT B;  3PQI A;  2KCM A;  3TP8 A;  1YI2 A;  3NHH A;  3PIP 3;  2IW3 A;  4JI3 L;  3CCU A;  5IIF A;  1T9H A;  1PFM A;  4G4K A;  1HRJ A;  3GTO B;  2OEO A;  4RWS C;  4OGQ C;  5IOD A;  3U9O A;  3RLF A;  2ZTE A;  5FLM G;  2BCO A;  2Q2I A;  1AE2 A;  5COY A;  1A8V A;  4FYD A;  1JOR A;  1N34 Q;  1F2L A;  5KIX A;  2F0F A;  4A3C H;  1VDZ A;  4OHJ A;  1H9S B;  3D31 A;  4TVA B;  2NN6 I;  1TWF H;  1CKN B;  1PRT C;  3CCL A;  1EEI D;  4X62 L;  1PYB A;  5E1F A;  4LF6 L;  1Q8I A;  1PVO A;  4LF5 Q;  1TWA B;  5C4H A;  1Z47 A;  2F0E A;  3J80 c;  4DR2 L;  5I9P A;  1X54 A;  3E0E A;  3C46 A;  1B70 B;  4EQO A;  1D2B A;  1CKM A;  1YEZ A;  3C3L A;  1CQF A;  3TP5 A;  4F88 A;  1D5M C;  3L3O C;  2DN8 A;  2R61 A;  4L5T A;  4CDE C;  1KC8 C;  4C3H B;  1C8C A;  2SDF A;  4UP9 A;  1STB A;  5ELC A;  5DM6 3;  4KD3 A;  3UI2 A;  3CC7 A;  4YWL A;  1BBW A;  2VUM G;  3PO3 H;  4DR6 Q;  5ELB A;  4DR5 L;  4KN4 C;  1PV4 A;  1LTR D;  2B2V A;  3U9S A;  1KRT A;  3I73 A;  2DGY A;  1MKH A;  1PH9 A;  1W2B A;  4UHV A;  4QUC A;  1F9S A;  1RD9 D;  5JAV A;  2A68 D;  5IGD A;  5M3F H;  4M8A A;  3KLS X;  3PV0 A;  4DK6 C;  1SDF A;  3T16 A;  4ZLT F;  4DV6 L;  3LWE A;  1EEF D;  4BBR B;  5C44 H;  2F0G A;  2VQF Q;  2UUC Q;  3BJU A;  1L1O B;  3CPF A;  2PMZ B;  2QDB A;  2Z4H A;  1Y1W B;  2O5J C;  1A63 A;  4TSS A;  2SNM A;  3ZJY C;  3GTM H;  2ZTC A;  3QG1 A;  3M4Q A;  1I4G A;  2B63 B;  3BZK A;  4A3G G;  2K6A A;  2UUA Q;  1QUQ A;  5JVG 3;  4N9P A;  3W3A A;  4WOR A;  5H1S E;  2CQO A;  1VQD A;  3TS0 A;  4JG2 A;  4RHR A;  2R93 B;  1A6X A;  1DXM A;  1Q1B A;  1UNS A;  5C3W A;  1WCM G;  4UP7 A;  5ELN A;  3KBG A;  3MXN A;  2MO1 A;  4QB4 A;  1EQV A;  4QJF A;  1HTL D;  4A3M G;  2E2J H;  1L1O C;  1KAB A;  2IHE A;  4DN4 M;  5JJL A;  1RTO A;  2CHB D;  4ZQ3 A;  1ZEQ X;  4DV0 Q;  2CH4 W;  5IP7 H;  1E2W A;  1A2T A;  4RKL A;  1STH A;  4BA2 I;  3HOV G;  2F0T A;  3J7Y W;  4V19 0;  4YCU A;  1EOV A;  1W6J A;  3KF8 B;  4JBJ A;  1ASY A;  2R3Z A;  3MXU A;  3L2P A;  3HOU H;  2AHO B;  1UE7 A;  2JA9 A;  2IY5 B;  4BBS G;  5M9O A;  2EIF A;  3A7A B;  1LTI D;  2WP8 J;  2G5D A;  1BF4 A;  1E22 A;  4A3J G;  4LFA L;  3QWN A;  1VCI A;  4C3I B;  2NVY B;  4GN5 A;  2PI2 A;  3MXG A;  1JIC A;  1D1K A;  2Z6K C;  1VQ8 A;  3GTG H;  2EJF C;  1RIP A;  5JPN C;  1PH4 A;  3L9A X;  4UP8 A;  1I4X A;  1V1P A;  5C3E G;  2BH2 A;  2F1M A;  3J80 E;  5HGT A;  1KDB A;  4CKB A;  2O5I C;  1U4L A;  1GHK A;  1CTM A;  3VA5 A;  2HQE A;  2N3S A;  2B2U A;  3U4Z A;  4JI0 Q;  2K4K A;  1RJT A;  3S1R H;  3KDF B;  2HDM A;  4KJN A;  5GAH C;  3HOZ B;  3PGZ A;  3P7J A;  4CDD C;  2K04 A;  3S2H H;  2B3G A;  2OF1 A;  1WFQ A;  1B44 D;  1U9R A;  3SE0 A;  4QIW B;  5A2Q E;  3CCV A;  5DAU A;  1PXU A;  2C35 B;  4AYB E;  2MGS A;  2K7V A;  1B53 A;  2NB0 A;  1N36 L;  4RCN A;  2PZT A;  2ZT9 C;  4JBW A;  4LFB L;  1HXY D;  1CQV A;  1KHI A;  3I4O A;  3OYY A;  1CSQ A;  2A6H D;  2BA0 A;  1FR3 A;  3CP0 A;  5BN4 A;  1XMO Q;  4NP5 A;  3TBI B;  3SEB A;  1Q7Y C;  2PNR C;  4IUT A;  3K7U C;  1ICW A;  4O42 A;  5J3B A;  4XXE A;  3TQY A;  3GTO H;  4X66 L;  2ZJP A;  5NUC A;  1IBM L;  4A3F H;  2F0H A;  2PO4 A;  4OL7 A;  1B9N A;  2IX1 A;  4JI5 L;  4EQ5 A;  2DNE A;  3L7Z C;  3R2I A;  1K9M C;  3UDI A;  5IYC G;  4X65 Q;  5IGC A;  1YNN D;  5I6Y A;  2EYO A;  4NDX A;  2QKI C;  3CAM A;  2VB3 X;  1JQY D;  5FO7 B;  4RKB A;  1TWA H;  2I46 A;  4JOI A;  1L0W A;  1PRT D;  1JWM D;  4C3J B;  4ILW A;  5L37 A;  3H6M A;  2FFK B;  2ZM6 L;  1PH8 A;  5CV5 A;  3S1M B;  1TS2 A;  3M4P A;  2PZU A;  1EY7 A;  1B1Z A;  1X55 A;  1EYA A;  4C3H H;  2PCF B;  3DWA A;  5D14 A;  1EL0 A;  3AYH B;  1PMR A;  3U50 C;  3ULL A;  2JA6 H;  3RN2 A;  4KHZ A;  1SR3 A;  2UU9 L;  2JA5 B;  2WFW A;  2KCT A;  3VYT A;  1XPR A;  1DD2 A;  2I07 B;  1E7Z A;  3CMA A;  4JI0 L;  3I4M B;  4BY7 G;  1E2Z A;  1KIX A;  1LTA D;  5EKL A;  5KEE A;  2L5T A;  1K73 C;  1WI5 A;  4DV1 L;  1NBW A;  2K32 A;  3STB C;  1HQM C;  1PLF A;  4KK7 A;  3PCO B;  3ND8 A;  3S15 B;  4KY6 A;  4DV2 L;  3E0J A;  5AFW A;  1ROD A;  2FHT A;  4B3T Q;  5JJI A;  1Y1W H;  4XQJ A;  1FJG Q;  2VQE L;  2OQ0 A;  1C0A A;  1G2S A;  2NVQ B;  4LJZ C;  3J81 j;  2EZV A;  3T1H Q;  4L63 B;  4PG3 A;  2ENB A;  5JEA H;  4OX9 L;  3T13 A;  2B63 H;  4FP5 D;  4GKJ L;  4V0B A;  3I56 A;  2XSC A;  2Y0S E;  3QB3 A;  5FLX E;  3TS2 A;  4GKK L;  1K83 B;  1VQ9 A;  2H4O A;  4L5Q A;  5IGE A;  1PH2 A;  3A0J A;  1F9R A;  5I2X A;  1S4Z A;  2ZXO A;  2DY7 A;  1Q1E A;  1BKB A;  2MJ8 A;  1QB5 D;  1N33 Q;  1BVS A;  3Q8D A;  5IGG A;  5IP9 G;  3K5N A;  2PNH A;  3KBX A;  3J81 c;  1W6K A;  3FP9 A;  1E3P A;  4JI6 L;  3NEN A;  2EE1 A;  3K81 C;  3TZU A;  2FMC A;  3TRE A;  4E6I A;  1OXT A;  3JAM i;  1I94 Q;  1ONL A;  5M5X B;  1YHA A;  2R7Z G;  3Q0A A;  4LF8 L;  2RKS A;  2ZJQ A;  3HKZ G;  1JCK B;  1GUO A;  1GVP A;  5M3M G;  2H5X A;  3S17 H;  4HIK A;  3WWV A;  4A3B G;  3M4O B;  2JYO A;  4OXP A;  1WTH A;  4JI7 Q;  3H91 A;  1Q46 A;  2EDG A;  2A1A A;  4H0L C;  3NQT A;  1PH6 A;  4R4T A;  2JN4 A;  3KLR A;  4DK3 C;  1B8A A;  4X64 L;  1C4Q A;  1DJR D;  2EQS A;  4JK1 C;  4A3D B;  4A3I B;  4YY3 L;  2XWB B;  3UE1 A;  5BR8 L;  5C3X A;  4R8I A;  3HOX G;  3HOZ H;  5CR3 A;  2B2V C;  2ID0 A;  2K05 A;  1QUQ B;  2AWN A;  3A8I E;  3J7A F;  2ZXP A;  4LF9 L;  1KLU D;  2KEC A;  3EN2 A;  5CV9 A;  2R92 G;  2OTL A;  1MSH A;  2IJ0 A;  4IUU A;  1WTV A;  4OWX B;  3I90 A;  4DUZ L;  1X3P A;  3MXN B;  1EY6 A;  3JAM E;  1YIJ A;  4DV4 Q;  3GTL H;  4IN3 A;  4RG1 A;  2MPM A;  1RDP D; 
#chains in the Genus database with same CATH homology
 4OWW B;  2YTX A;  2MNA A;  5GQO A;  1X9N A;  4X64 Q;  5GAG C;  1HNX L;  1E1T A;  3SGI A;  3GTQ H;  4AH6 A;  3IRB A;  3RR5 A;  1XNR L;  2JA7 G;  3I2Z A;  1G51 A;  1J6Q A;  1UE6 A;  3FKI G;  5IP7 G;  3CW2 C;  3PUX A;  1KQS A;  1K3R A;  3PF4 A;  2PQA A;  3KF6 A;  4DAM A;  3D0F A;  1EWI A;  4YY3 Q;  3K7A H;  4GNX B;  3HOY G;  3PO2 G;  1U0L A;  1WJJ A;  1N34 L;  3PUZ A;  5BR8 Q;  2QEX A;  1P16 A;  3CCJ A;  1ASZ A;  4NXM Q;  2NZO A;  4B3R Q;  1I6H H;  1GO3 E;  3HOU G;  4BBR G;  3ULJ A;  1VQN A;  3HOV H;  2JE6 I;  4A3I H;  4YWM A;  1QVG A;  1Q86 C;  4PZ7 A;  3CPW A;  5DLQ E;  4LF7 L;  4IPG A;  4LF9 Q;  3HKS A;  1UEB A;  4X6A H;  4LFC L;  4HID A;  4POF A;  4LF4 Q;  4JYA L;  3GO5 A;  1TWG H;  1VQO A;  4DUZ Q;  4LF5 L;  3CME A;  4JI8 Q;  1XJV A;  4BBS H;  2VZA A;  1L2F A;  2KCM A;  2JA8 H;  1FVI A;  4P72 A;  2R6G A;  1YI2 A;  2B63 G;  1Y14 B;  3RLO A;  4JI3 L;  5IYB G;  2VW9 A;  1KD1 C;  1MIU A;  3NBH B;  1QVC A;  3CCU A;  3S1M H;  3PUW A;  1HNX Q;  1T9H A;  4GNX C;  3ICE A;  3H3V H;  3S1N H;  5JJK A;  2LXJ A;  1TWC H;  2R93 G;  2B29 A;  1VQF A;  1VQE A;  4MZ9 A;  3ULP A;  4GOP A;  4OON A;  1YHB A;  3CQZ H;  2ZTE A;  3A5Z B;  3RLF A;  5FLM G;  4DR6 L;  2Q2I A;  1AE2 A;  3UE0 A;  1A8V A;  1Q8K A;  5C3E H;  3LGJ A;  1N34 Q;  4A3C H;  2RF4 A;  1TXY A;  1YIT A;  2JA5 H;  1Q12 A;  1S3O A;  1VQB A;  2V1C C;  4GOP C;  1SLJ A;  3D31 A;  4TVA B;  2NN6 I;  1TWF H;  3CCR A;  4A3L G;  1CKN B;  2YTY A;  1V43 A;  1X56 A;  4PZ8 A;  4DV7 L;  3CCL A;  4A3K G;  4JI2 L;  4LF7 Q;  3B6Y A;  5IT9 c;  4X62 L;  1PYB A;  4LF6 L;  4QY7 A;  4LFC Q;  4P71 A;  5FLX c;  1IBL L;  3HFZ B;  2YTV A;  4JYA Q;  1EQR A;  2AKW B;  1PVO A;  1PH3 A;  5C4J H;  3J7Z C;  4LF5 Q;  3S15 H;  1JT8 A;  1Z47 A;  2VQF L;  2UUC L;  3J80 c;  3KJP A;  4DR2 L;  1VQC A;  5JEA J;  1X54 A;  5C0X J;  3E0E A;  2UXD L;  2PMZ E;  3F1Z A;  2MQH A;  1B70 B;  3STB D;  4JI3 Q;  1PYS B;  1CKM A;  1YEZ A;  2NVQ H;  1M1K C;  2RHQ B;  1PH1 A;  2CCZ A;  3ER0 A;  2D0O A;  4L5T A;  4JI1 L;  1KC8 C;  4IPC A;  3PIO A;  4GLX A;  2R7Z H;  4UP9 A;  4BXX G;  1D7Q A;  1G29 1;  3CC7 A;  4YWL A;  4A3F G;  4DPG A;  1BBW A;  2K5H A;  5M3M H;  2UUA L;  2VUM G;  3PO3 H;  4DR6 Q;  4DR5 L;  2HIX A;  4IFD I;  4H02 A;  1PV4 A;  3E9I A;  1K83 H;  1KRT A;  1YJN A;  4A3B H;  2DGY A;  1MKH A;  1PH9 A;  1W2B A;  5M5W H;  1VQG A;  4MTN A;  2HT1 A;  3EBE A;  5M3F H;  4A93 G;  4K0K Q;  3RN5 A;  4QGU A;  4DV7 Q;  3PV0 A;  2Z0S A;  4DK6 C;  1CUK A;  4DR1 L;  1A0I A;  4JI2 Q;  4X62 Q;  4DV6 L;  2UXB L;  4NB3 A;  4LF6 Q;  1IXR A;  1OTC A;  1NE3 A;  4L5S A;  2QGQ A;  5C44 H;  2GVB A;  5IYC H;  4DV0 L;  3HOZ G;  3KYH C;  4BA1 I;  1IYJ B;  3CF5 A;  2VQF Q;  2UUC Q;  3BJU A;  1L1O B;  1D8L A;  3CPF A;  1SRO A;  4J15 A;  4DR2 Q;  3CC2 A;  2UXC L;  1A63 A;  1A62 A;  2UXD Q;  4AIM A;  2E8G A;  1VQI A;  1S72 A;  1GD7 A;  3J81 i;  1I5F A;  3NEL A;  3ZJY C;  3HOX H;  1IBK L;  3GTM H;  3M7N A;  3H3V I;  3TRZ A;  4WJ4 A;  4JI1 Q;  2ZTC A;  5M5X H;  3M4Q A;  1YJ9 A;  2K14 A;  1OXV A;  1UWV A;  3BZK A;  1EQQ A;  4A3G G;  5FJ8 H;  5IY0 A;  5IYD G;  2UUA Q;  1QUQ A;  2YYZ A;  4DR5 Q;  2JA6 G;  1QVF A;  1XMQ L;  5H1S E;  2CQO A;  2YV5 A;  2NVT H;  1EIF A;  5HGQ A;  4GLA C;  1VQD A;  1JE5 A;  4JG2 A;  1HH2 P;  4DV5 L;  3TS0 A;  3PUV A;  2R92 H;  3M4O H;  1Q1B A;  2A8V A;  4KI0 A;  1WCM G;  4UP7 A;  5ELN A;  2MO1 A;  5C4X H;  4JOI C;  3A5U A;  2N49 A;  4QJF A;  4WJ3 M;  1HR0 W;  4O0A A;  4YHH Q;  3G6E A;  4DR1 Q;  1L1O C;  4A3M G;  2E2J H;  4FDB A;  1HNW L;  2IHE A;  1SMX A;  4DV6 Q;  2UXB Q;  4C2M H;  5JJL A;  2JA7 H;  4A3D H;  4DV0 Q;  3UDG A;  3FKI H;  5IP7 H;  5LMN L;  4BY7 H;  3G48 A;  3JAM c;  4HJA A;  3GTJ H;  2ZTD A;  4GLV B;  4A75 A;  3HOV G;  4BA2 I;  1VQJ A;  1Y1W G;  2UXC Q;  4RMF A;  4LNQ A;  2A19 A;  2Q2T A;  3PO2 H;  2AWO A;  4GNX A;  1WYD A;  2K52 A;  2FXQ A;  4YCU A;  1EOV A;  3KF8 B;  3FHW A;  4JBJ A;  1SFO H;  1IBK Q;  2IX0 A;  2VY3 A;  1ASY A;  4B3M L;  5JEA G;  3L2P A;  1X3F A;  5C0X G;  3HOU H;  4BBR H;  2AHO B;  1UE7 A;  2JA9 A;  4AYB G;  4BBS G;  1XTD A;  2IY5 B;  2KEN A;  4NPS A;  2EIF A;  4JV5 L;  4HJ7 A;  1VQ7 A;  2WP8 J;  4DR3 L;  1XMQ Q;  1E22 A;  4A3J G;  4LFA L;  1UE1 A;  4BY1 H;  4DV5 Q;  3AFP A;  4QIW E;  1VCI A;  3U4V A;  4O2D A;  4GN5 A;  1M90 C;  2HHH Q;  2PI2 A;  1XPU A;  2E5L L;  2Z6K C;  3BZC A;  1VQ8 A;  3GTG H;  1RIP A;  1PH4 A;  3KJO A;  4UP8 A;  3CCE A;  1CSP A;  4R4C A;  5ELO A;  1PH5 A;  2I0Q A;  2ASB A;  1AH9 A;  1HNW Q;  3EIV A;  1HNZ L;  3GD7 A;  1U5K A;  5C3E G;  1XMO L;  4IFD J;  2BH2 A;  2R93 H;  1YJW A;  5LMN Q;  2JA5 G;  3JC6 6;  4ALP A;  3F2D A;  4K0K L;  1VQ4 A;  5FLM H;  4R4Q A;  2N3S A;  4P73 A;  3U4Z A;  3OTO L;  4JI0 Q;  3I4M G;  2K4K A;  3S1R H;  4QQB X;  4LW1 A;  3CXC A;  3KDF B;  5IP9 H;  2JEA I;  4ME3 A;  5GAH C;  3KOJ A;  1LYL A;  1RL2 A;  3PGZ A;  2GVA A;  4B3M Q;  1JJ2 A;  4R1J A;  3S2H H;  3J7A 5;  2RCN A;  4X65 L;  1CKO A;  2B3G A;  1WFQ A;  4A3L H;  1CKN A;  1TWH H;  4YCV A;  4JV5 Q;  1VQP A;  4A3K H;  4DR3 Q;  4HIM A;  4LFA Q;  4OO1 I;  3MEF A;  3CCV A;  3M3Y H;  3CCS A;  2C35 B;  2E5L Q;  4GS3 A;  3NEM A;  4AYB E;  4IJL A;  2OQK A;  1HJP A;  2KBN A;  1JMC A;  1N36 L;  4JBW A;  4A76 A;  1N8R C;  4LFB L;  1JJC B;  1KHI A;  3I4O A;  3OYY A;  1CSQ A;  1HNZ Q;  1Y1V G;  2BA0 A;  3CP0 A;  3KLW A;  1QZH A;  2GN5 A;  3G4S A;  3VDY A;  1K8G A;  1XMO Q;  1Q7Y C;  3TQY A;  3K7U C;  2L15 A;  5J3B A;  2E2I H;  3GTO H;  4C3I H;  1LUZ A;  4X66 L;  5M5Y H;  1B7Y B;  3GDE A;  1VQA A;  2NVY H;  2ZJP A;  1YVC A;  2JEB I;  4A3F H;  4YHH L;  1IBM L;  3I4N G;  4XIG S;  4DV3 L;  1NY4 A;  1R9T H;  1KAW A;  3OTO Q;  1VQM A;  5GAE C;  2IX1 A;  4QL5 A;  4JI5 L;  1DGS A;  4HIO A;  3K80 C;  4EQ5 A;  4A3E G;  4EX5 A;  4IO9 A;  2XGT A;  3L7Z C;  4LUO A;  2K50 A;  1Q82 C;  2ATW A;  3HOW H;  1K9M C;  3M85 A;  3UDI A;  3CCM A;  2WB1 G;  1SN8 A;  2NN6 G;  2OCE A;  5IYC G;  4X65 Q;  5C44 G;  2UUB L;  1PA6 A;  2MFI A;  3L0O A;  3PIP A;  3CAM A;  1KL9 A;  3E9H A;  4IOA A;  5E7N A;  2CWA A;  2D62 A;  3RNU A;  1QZG A;  1NTG A;  4R4I A;  2F3I A;  1TWA H;  4JOI A;  1L0W A;  4IPH A;  1PH7 A;  1MJE A;  3UDF A;  2LSS A;  3DM3 A;  4HJ5 A;  4UPA A;  4B3T L;  1L1O A;  2NVX H;  2NZH A;  1W3S A;  1N36 Q;  5FJ8 G;  1FJG L;  2Q2U A;  4LFB Q;  2ZM6 L;  4JCV E;  1PH8 A;  5K36 G;  1FL0 A;  3PUY A;  4APV A;  2BA1 A;  1EUJ A;  3F2C A;  2CFM A;  3M4P A;  2HHH L;  1YBY A;  2JQO A;  4OO1 G;  3T1H L;  1X55 A;  3BU2 A;  3J80 i;  4C3H H;  4YCW A;  2PQA B;  3H0G H;  3KF6 B;  1K0R A;  3AYH B;  4NXN L;  1V1Q A;  3RLN A;  3U50 C;  4X66 Q;  1XNQ L;  1IBM Q;  4A3G H;  5IYD H;  4DV3 Q;  5C4X G;  3S14 H;  2E2H H;  3ULL A;  3S1Q H;  4IFD G;  2JA6 H;  4JI5 Q;  2IHF A;  3RN2 A;  4KHZ A;  1SR3 A;  2XTI A;  2MO0 A;  1BBU A;  4DUY L;  5IWA L;  2UU9 L;  1I3Q H;  1WCM H;  2WFW A;  2ES2 A;  2KCT A;  3CD6 A;  4A3D G;  1P8L A;  4AQY L;  4A3I G;  1XPR A;  2UUB Q;  1O7I A;  1E7Z A;  3CMA A;  4JI0 L;  3U58 A;  3HOY H;  4BY7 G;  1KIX A;  1PFS A;  3I55 A;  4A3M H;  1WI5 A;  4DV1 L;  1NBW A;  1K73 C;  5LMU L;  1N33 L;  1HZC A;  1E1O A;  3STB C;  1EYG A;  3PCO B;  2Z6K A;  3CC4 A;  4JBK A;  4LUZ A;  4DV2 L;  2WB1 E;  5AJ3 L;  2JA8 G;  4KHP L;  4B3T Q;  1GKH A;  2K75 A;  5JJI A;  1Y1W H;  1FJG Q;  4P75 A;  2KHI A;  2VQE L;  2OQ0 A;  2ZM6 Q;  1C0A A;  3K0X A;  1HZA A;  3T1Y L;  3J81 j;  1E24 A;  3K8A A;  1I50 H;  4DR4 L;  2IT1 A;  1VQK A;  1I94 L;  3G71 A;  3T1H Q;  4PG3 A;  4BY1 G;  4GOP B;  4OX9 L;  2B63 H;  3AQQ A;  4NXN Q;  1XNQ Q;  2Q2H A;  4GKJ L;  1VQH A;  2ALY B;  5IYB H;  3I56 A;  4C3J H;  2Y0S E;  1X3E A;  4IPD A;  3TS2 A;  4GKK L;  4A3J H;  1YZ6 A;  1VQ9 A;  2I5H A;  4DUY Q;  4JI7 L;  4A3C G;  1KRS A;  1OXS C;  2LXK A;  2WAQ E;  5EAY A;  4L5Q A;  5IWA Q;  4Y7N H;  2UU9 Q;  2YU9 H;  4IJH A;  1XNR Q;  1PH2 A;  3A0J A;  3KFU A;  2N8N A;  4AQY Q;  3PF5 A;  2QA4 A;  4UY8 C;  1JB7 A;  3DLL A;  1G6P A;  1XPO A;  1X65 A;  1Q1E A;  1BKB A;  4DV1 Q;  1N32 L;  5LMU Q;  4JC0 A;  1N33 Q;  4R4O A;  1BVS A;  3Q8D A;  1C9O A;  1Z9F A;  5IP9 G;  2PNH A;  3H15 A;  3S24 A;  3J81 c;  3RZO H;  3FP9 A;  1E3P A;  4DV2 Q;  1HZ9 A;  4JI6 L;  5AJ3 Q;  5GAD C;  3S16 H;  1PHJ A;  1K8A C;  2D0P A;  2RHS B;  3NEN A;  4KHP Q;  3K81 C;  1GM5 A;  4POG A;  1H95 A;  1WOC A;  2DUD A;  2HIV A;  4B3S L;  3I4M H;  4LWC A;  2VQE Q;  3TRE A;  1HR0 L;  3T1Y Q;  4DR7 L;  3UDX A;  4DR4 Q;  3KDF A;  2JK8 A;  2VS1 A;  2F4V L;  1VQ6 A;  1EFW A;  1OXT A;  5HY6 A;  3JAM i;  1I94 Q;  1YHA A;  2R7Z G;  1LTL A;  4OX9 Q;  1S40 A;  1NJI C;  4LF8 L;  1EIY B;  1VQL A;  2ZJQ A;  2OWO A;  3HKZ G;  5M3M G;  3S17 H;  1GVP A;  4GKJ Q;  2H5X A;  3PO3 G;  1JJG A;  4P74 A;  5GRO A;  3W1G A;  3CCQ A;  2K5V A;  4HIK A;  1J5E L;  3AFQ A;  3WWV A;  1VQ5 A;  4GKK Q;  4A3B G;  3GTP H;  2CWP A;  2EXD A;  4OXP A;  4JI7 Q;  1VS0 A;  4LUV A;  5LMN W;  1Q46 A;  4BXX H;  2A1A A;  4HJ9 A;  4Y52 H;  1NMF A;  4DV4 L;  3F2B A;  2VUM H;  1PH6 A;  4R4T A;  4JI4 L;  1OXU A;  5M3F G;  2R7F A;  2AMC B;  4OWT B;  2JJQ A;  2VNU D;  2I5M X;  4DK3 C;  4MNO A;  1B8A A;  4X64 L;  1N32 Q;  1Y1V H;  2EQS A;  2KHJ A;  4XTC S;  1Q81 C;  1LM0 A;  4L5R C;  1FGU A;  1V9P A;  3HOW G;  4A93 H;  1OXX K;  3I7F A;  2VL6 A;  3M9B A;  4JBM A;  4JI6 Q;  1YNX A;  1UE5 A;  3I4N H;  1IZ6 A;  4YY3 L;  3GTK H;  4B3S Q;  1MJC A;  2ZJR A;  3TEH B;  3UE1 A;  4GN3 B;  4DNI A;  1HR0 Q;  1SE8 A;  4DR7 Q;  5BR8 L;  2F4V Q;  3HOX G;  4DAY B;  2CKZ B;  2F52 A;  4A3E H;  4NXM L;  3AEV A;  2BH8 A;  3PSI A;  1X3G A;  3HOZ H;  4B3R L;  1KXL A;  4A4I A;  1IBL Q;  1N9W A;  4LF8 Q;  3W5O A;  5C0X I;  3OW2 A;  3W1B A;  2ID0 A;  1IL2 A;  4GN4 B;  2Y0S G;  1QUQ B;  4TQU S;  2AWN A;  2HQL A;  3A74 A;  4DKA C;  1HZB A;  2I5L X;  3F8T A;  1SRU A;  1YHQ A;  2N78 A;  4HJ8 A;  3EN2 A;  1J5E Q;  1AE3 A;  4IOC A;  4LF9 L;  3S2D H;  2WAQ G;  2OTL A;  4LF4 L;  2R92 G;  3ERS X;  4PZ6 A;  4YWK A;  1NMG A;  4OWX B;  4DUZ L;  3MXN B;  1YIJ A;  4JI8 L;  5IE8 A;  4DV4 Q;  2PI2 E;  1C7Y A;  3GTL H;  2R7D A;  3HKZ E;  1X6O A;  2K5N A;  4PMW A;  4KLK A;  3H0G G;  4JI4 Q;  4RG1 A;  3RZD H;  2OTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...