2F4VL

30s ribosome + designer antibiotic
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Interactions of designer antibiotics and the bacterial ribosome aminoacyl-tRNA site
pubmed doi rcsb
total genus 12
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2f4vL00
3L0OA 3L7ZC 1SMXA 3CMAA 4DV0L 4RG1A 3T1YQ 2NZOA 1I50H 3T1HL 4BY1G 1PH4A 1Z47A 1JB7A 2UU9Q 5JJKA 1YITA 2FXQA 4R4OA 1TWGH 2A1AA 1VQ9A 1SE8A 4IPHA 3VDYA 4DNIA 4JI7Q 4DV4L 5IYCG 4JI0L 3B6YA 4DR7Q 4Y7NH 4JBJA 2DUDA 3HOYH 3KDFB 5M3FH 2F3IA 1XNRL 1HH2P 5EAYA 2KCTA 1V43A 4PZ6A 2OCEA 3I56A 1HNXQ 2YTVA 1UWVA 3S14H 2R6GA 1VQ4A 4HJAA 4YWKA 4A3GH 4A76A 1YHAA 1CSQA 4QIWE 2Y0SE 3H3VI 2VNUD 4J15A 1TWHH 3PO3G 3UDIA 1QUQB 2ZM6Q 1VQ5A 4KI0A 2F52A 1J5EL 1UE5A 4DV1Q 3EIVA 1S72A 4B3TQ 1D7QA 3W1GA 2RF4A 3NENA 5FLMH 4DV5L 1PH9A 4MNOA 1XNQL 3F2CA 4JC0A 4YWMA 2RHSB 4A3CG 1HR0L 3OTOL 1N32Q 1QVCA 3GO5A 4OONA 1X55A 3GTMH 3STBD 1HR0W 1VQBA 4JI6L 2KHJA 4L5TA 3KYHC 4A3EH 1X65A 3K7AH 4NXNL 1K8GA 4JI2L 3S15H 3CW2C 3PCOB 2QEXA 4GNXB 1B7YB 4BA1I 5GAHC 4DV0Q 4L5SA 3KLWA 3CXCA 3T1HQ 1Y1VH 2KCMA 1PH3A 2MQHA 4LWCA 1ASZA 4B3RL 3S2DH 1HNWL 1ASYA 2CCZA 1W3SA 1WCMG 2JE6I 1X3GA 4JI5L 4DV4Q 1CKNB 5IP9H 4JI0Q 3A74A 2WFWA 3FP9A 1NTGA 4LF7L 3TREA 1XNRQ 3I55A 1Q82C 4EX5A 2BA1A 4LW1A 4POFA 1R9TH 3GTPH 4IFDJ 2DGYA 3PUZA 3DM3A 3H15A 1CKMA 2K52A 4GN3B 5IWAL 5IYBG 1C0AA 5FLXc 1JMCA 2I5HA 4DPGA 4LFAL 1KL9A 4A3IG 1N36L 2BH2A 5C3EG 2AHOB 3FKIG 3PUYA 1J5EQ 4POGA 2N49A 1SN8A 3GTOH 3E9HA 1Y1WG 3GTJH 1Q81C 1OXUA 1V9PA 1LM0A 3GTQH 1IBKL 4GS3A 4HIKA 4JV5L 4DV7L 3U4VA 4DV5Q 3RZDH 1HNZL 4DR2L 3Q8DA 1XNQQ 1HR0Q 2JA9A 4QL5A 4C3HH 4AIMA 3PIOA 3OTOQ 4MTNA 1XTDA 5FJ8H 1GM5A 2VUMH 3I4OA 5JEAG 3TS0A 1N33Q 1N9WA 3D0FA 2YTYA 1M90C 4JI6Q 2YU9H 4LF5L 1PYBA 4GOPC 4NPSA 1Q1BA 4DAYB 2HT1A 4NXNQ 4JI2Q 3KFUA 1GD7A 3MEFA 4GLAC 4DR1L 4DR3L 3CD6A 4UP8A 3OW2A 2JA5H 4NB3A 2ID0A 5GAGC 1S40A 4RMFA 1XPOA 5HY6A 1NMFA 3S1NH 4JG2A 2QGQA 1KXLA 1EQRA 1U0LA 1E24A 3PGZA 4B3RQ 2PI2A 1HNWQ 2Q2TA 2PQAB 4A3KH 2OTLA 2JJQA 3CC4A 5K36G 2HIXA 1EFWA 1AH9A 4JI5Q 4X65L 1L1OA 1E7ZA 4P72A 4C3IH 3HKZG 2IHFA 4LF7Q 3I2ZA 3NEMA 1KRTA 4A3LH 5C0XJ 4PZ8A 1PHJA 4UY8C 3U58A 4HIDA 2D62A 1TXYA 4QGUA 5M3FG 4R4CA 4L5RC 2NZHA 1QZHA 2UUCL 4YY3L 3TQYA 3KF8B 1G51A 1G291 2LXJA 1N34L 4R4IA 1VQ6A 5IWAQ 5LMUL 3EN2A 4JBWA 2WAQG 4A3FH 4LFAQ 2UUAL 4A3GG 1N36Q 4AQYL 1A63A 3K80C 4LF8L 3ERSX 1YBYA 4DR4L 2KENA 5AJ3L 2R7FA 1MIUA 4APVA 1IBKQ 1XPUA 4JBMA 4JV5Q 3J7ZC 4DV7Q 4AYBG 1HNZQ 4DV6Q 5C44H 4DR2Q 2R92H 1AE3A 3S1MH 5IT9c 3I4NH 3K7UC 1EIFA 1OXSC 2EXDA 1E1OA 2Z0SA 4B3SL 4DK3C 1VQIA 1Z9FA 1YJ9A 2IX1A 1VCIA 2YV5A 4LF5Q 2VQEL 4IPDA 4OX9L 4DR3Q 1LUZA 4DR1Q 3HOUH 1AE2A 3IRBA 3OYYA 4A3DH 4KLKA 4A3EG 1XJVA 2JA8H 1PH6A 1JT8A 4BBSH 1PH5A 3HOVH 1Y14B 2UXDL 2ATWA 2VL6A 1Y1VG 3D31A 1OTCA 2K5NA 3I7FA 2AMCB 4QJFA 4X65Q 1K83H 3A0JA 4FDBA 2OQ0A 1A8VA 1VQEA 3A5ZB 2BH8A 5GROA 3UDGA 1XMOL 3LGJA 1OXVA 3GTLH 4LFBQ 1YNXA 1VS0A 2IT1A 2E2JH 4C3JH 5IYDH 1FL0A 3GTKH 2JK8A 2UUCQ 1KAWA 2VW9A 3U50C 4BBRG 4DKAC 4YY3Q 3ULPA 2XTIA 1W2BA 1N34Q 3CCMA 3RZOH 5LMUQ 3HOZG 2UUAQ 1N33L 4P74A 3F1ZA 4MZ9A 2B29A 2GVAA 2WB1G 4AQYQ 2QA4A 5IP7H 1NBWA 2Z6KC 1K73C 2LSSA 4GOPA 2UUBL 1B70B 2MNAA 1V1QA 4LF8Q 4DR4Q 2JA7H 3GTGH 1EYGA 5AJ3Q 3BZCA 2RCNA 1I6HH 3HFZB 4GN4B 4LF6L 3E0EA 1NE3A 3NBHB 1RL2A 1MJEA 2HHHL 3S24A 2ZJPA 3CCEA 1IL2A 3S17H 4IJHA 1H95A 5J3BA 4BY7G 1NJIC 4B3SQ 4YCVA 3G71A 3TEHB 3MXNB 1P8LA 3UE0A 3JAMc 1TWCH 4GKKL 1S3OA 2VUMG 1P16A 1RIPA 5IYCH 2CWAA 3DLLA 2VQEQ 4OX9Q 4DV2L 4H02A 1I94L 2I5MX 2VQFL 3UE1A 2CWPA 3RLFA 3GD7A 1L0WA 2UXDQ 5HGQA 1VQHA 4JI3L 4O0AA 4A3JG 3STBC 2A19A 5M3MH 1VQOA 4C2MH 3ICEA 2GVBA 3TRZA 2D0OA 5ELNA 2JEAI 4IPCA 2UXBL 1PH1A 4BA2I 3ULJA 2JEBI 3J81c 1HZCA 2AWNA 3RLNA 3NELA 4A4IA 4OO1G 1VQPA 4WJ3M 4YWLA 1XMOQ 4DR5L 4GKJL 1UEBA 1HJPA 3TS2A 4DAMA 4P73A 4LF4Q 4GNXC 4LFCQ 1FVIA 4DV6L 3AQQA 1EIYB 1FJGL 4A93H 3HOWH 4A3CH 1E22A 3KF6A 4HIMA 3FHWA 4A3FG 1A62A 4ME3A 3M7NA 1YIJA 1MKHA 3AEVA 2UUBQ 4A3BG 4YHHL 4JI8L 3CCVA 1QZGA 3PF4A 1FGUA 5GQOA 1PVOA 4X6AH 3F2BA 2JA6H 3GDEA 4DUYL 4LF6Q 1HZBA 2CQOA 2ZTEA 3ZJYC 4WJ4A 2N78A 2IX0A 2KHIA 2HHHQ 3CPFA 4OO1I 1X3EA 3CCLA 1E1TA 2EIFA 2WAQE 4LNQA 1C9OA 2NVTH 2K14A 4LUOA 3CCRA 2R93H 2E8GA 1YJWA 4GKKQ 4JI1L 3RN5A 1WCMH 4IJLA 1CUKA 1UE6A 4DV2Q 2OQKA 1I94Q 5BR8L 3HOYG 2VQFQ 4Y52H 5C4XH 1WI5A 2B3GA 3HKSA 2WP8J 3J7A5 2YYZA 4X64L 1BBUA 1WYDA 4JI3Q 2R7ZH 4BBSG 3AYHB 5LMNL 4DV3L 2PNHA 1J6QA 3BJUA 2UXCL 4NXML 3E9IA 3W5OA 4YCUA 5LMNW 3S2HH 2UXBQ 3SGIA 4LUVA 1E3PA 2YTXA 2MO0A 3AFQA 1MJCA 4TQUS 1K8AC 1WFQA 3RN2A 1JE5A 3CMEA 3S16H 2HQLA 4A3IH 2BA0A 1GVPA 5C3EH 4DR5Q 1PH7A 4GKJQ 1BBWA 4JOIC 4R4TA 1C7YA 2L15A 3JAMi 1Y1WH 4L5QA 4JBKA 2B63H 3UDFA 2I5LX 3RLOA 3U4ZA 2E2IH 3M4OH 2NVYH 5FLMG 4A3MH 2XGTA 4XTCS 3K81C 1FJGQ 2HIVA 1QVFA 3BZKA 4P71A 3BU2A 4UP7A 5C0XG 1KQSA 2LXKA 4DK6C 3JC66 2MFIA 3CAMA 5GADC 4P75A 1L1OB 4BXXH 3PO2H 1X54A 4JI4L 3CQZH 3ULLA 4JI8Q 4YHHQ 3HOXH 1QUQA 5IP7G 3CCUA 1Q1EA 3J81i 2CKZB 4DUYQ 1X56A 1CKOA 2JA7G 1VQCA 1U5KA 1QVGA 4KHPL 4O2DA 4PZ7A 4ALPA 1DGSA 2V1CC 1T9HA 1SR3A 1N8RC 2MO1A 1IBML 3PV0A 2KBNA 1IYJB 2WB1E 3M4PA 1LTLA 3PUWA 1Q46A 2K50A 1VQNA 2VS1A 4JI1Q 2OTJA 2K5VA 4OWTB 2K5HA 1EWIA 5IP9G 4IOCA 3G4SA 3HOWG 5BR8Q 1YHQA 1VQDA 5C0XI 1TWAH 1PA6A 3J80c 1HZ9A 3K8AA 1XMQL 2E5LL 2ZJQA 1VQAA 4X64Q 4LFCL 4LF4L 2E2HH 5LMNQ 2IHEA 4DV3Q 2NN6G 4GNXA 1PFSA 2N8NA 2ALYB 4OXPA 4NXMQ 3S1QH 2UXCQ 1PYSB 2R7DA 2RHQB 5M3MG 1VQMA 3I4MH 1PH2A 5M5YH 4R1JA 1SRUA 4QQBX 1K0RA 4DUZL 1L1OC 2ZJRA 2NVQH 2H5XA 1CKNA 5ELOA 1PV4A 3H0GH 3L2PA 1KHIA 4GLXA 2EQSA 3PUXA 1IBLL 3W1BA 3H3VH 2AKWB 2I0QA 4TVAB 3M85A 4UPAA 3CCQA 4R4QA 4BY1H 1IXRA 4LF9L 3KJOA 2D0PA 4GN5A 4A93G 1I3QH 1TWFH 1VQGA 1YHBA 3AFPA 5C4JH 2ZTCA 1NY4A 1IZ6A 1WJJA 1KRSA 5FJ8G 2NN6I 1OXXK 4JI4Q 4X62L 4JYAL 4OWXB 2K4KA 3UDXA 2Y0SG 4K0KL 2VY3A 1KC8C 1EUJA 3EBEA 4HJ9A 2JA5G 4KHPQ 1GKHA 2JA6G 1VQKA 2VZAA 2K75A 2ASBA 1GO3E 1IBMQ 1SFOH 3ER0A 3KJPA 3G6EA 4A3KG 1BVSA 1Q12A 1X9NA 1NMGA 3PO3H 2R93G 4JCVE 4GOPB 2ES2A 1JJ2A 2Q2IA 4UP9A 3KOJA 2F4VL 4A3LG 1XMQQ 2E5LQ 4JOIA 5M5WH 5C4XG 4HIOA 5JEAJ 4X66L 1Q7YC 2PI2E 2R7ZG 4XIGS 2OWOA 4BBRH 1L2FA 1Q8KA 3HKZE 3CF5A 1JJCB 1O7IA 5GAEC 4B3ML 3HOZH 1VQFA 1B8AA 2PQAA 4QY7A 4IOAA 4DUZQ 3PUVA 4IFDG 4PG3A 1YI2A 3CCJA 1YEZA 1IBLQ 1KIXA 2ZTDA 4LUZA 4DR6L 1I5FA 4LFBL 2C35B 3PIPA 1VQLA 2AWOA 2B63G 4GLVB 2Q2UA 5C44G 3T1YL 4A3MG 3K0XA 3J80i 4LF9Q 2R92G 1HZAA 3I4NG 1A0IA 2UU9L 1PH8A 4BY7H 3G48A 3F8TA 4IPGA 1JJGA 1K9MC 1LYLA 4X62Q 4JI7L 3CC7A 4BXXG 3PO2G 2PMZE 1YVCA 4JYAQ 4AYBE 3HOXG 4DR7L 4A3DG 3HOUG 5M5XH 4K0KQ 1UE1A 1X6OA 2JA8G 3CPWA 1XPRA 4IO9A 5DLQE 4PMWA 1KD1C 3CC2A 1Q86C 1CSPA 3HOVG 5JJIA 1YZ6A 4KHZA 3S1RH 4IFDI 4A3JH 3M4QA 5IY0A 1HNXL 2A8VA 3F2DA 5E7NA 3KF6B 5IYBH 5IE8A 4HJ5A 1OXTA 2Q2HA 1M1KC 4YCWA 3CP0A 1EQQA 1SLJA 3FKIH 3WWVA 2Z6KA 4HJ8A 2ZM6L 2F4VQ 3KDFA 1EOVA 2IY5B 2NVXH 3RNUA 2JQOA 4DV1L 3M3YH 4OWWB 2CFMA 4X66Q 2GN5A 5IYDG 4B3TL 1VQJA 1BKBA 4EQ5A 1UE7A 1YJNA 1VQ8A 1VQ7A 3PSIA 3PF5A 4B3MQ 1X3FA 3I4MG 3RR5A 5H1SE 1N32L 3A5UA 1WOCA 3M9BA 4A3BH 4HJ7A 3CCSA 5JJLA 4A75A 1K3RA 1SROA 2N3SA 4DR6Q 3J81j 3H0GG 4AH6A 1D8LA 1G6PA
chains in the Genus database with same CATH superfamily
4OIKA 4IALA 3T1HL 5IGDA 4BY1G 1JB7A 1MD2D 4K5WA 4R4OA 4DU9A 4DV4L 5IYCG 3B6YA 5CV5A 4Y7NH 2DUDA 2E2JB 4C3JB 3KDFB 3GTKB 4MIUA 5M3FH 2OCEA 2KOLA 2L11A 5FO8B 2R6GA 1VQ4A 1JWUD 5EGTA 4HJAA 4FF3A 4A76A 4LAAA 1UE5A 4DV1Q 4MTKA 3MAQA 3FDTA 3S17B 1SMYD 2HCCA 5FLMH 4DV5L 3GV3A 3F2CA 1HR0L 3GO5A 1D2BA 4ID6A 1JCKB 2KHJA 4A3EH 3K5OA 4K8IA 4JI2L 1K8GA 3S15H 1WTQA 1ICWA 5IGBA 5D3DA 4GNXB 4FF4A 1PXUA 2PZUA 4CJ2C 1Y1VH 2KCMA 4LWCA 1ASZA 4B3RL 1BCPC 3K59A 2OXPA 1EU4A 4QF4A 1WCMG 2CW0D 4JI5L 2IX3A 4JI0Q 2Z6BA 5IP9H 3A74A 5CORA 2VB3X 2R61A 4LF7L 1F2LA 3I55A 1Q82C 4C3HB 4EX5A 2BA1A 4QMGA 4LW1A 1R9TH 4KKUA 3DM3A 3N52A 5IWAL 3A55A 5FLXc 2JA5B 1KL9A 4A3IG 3T56B 2NB0A 3HGBA 3Q23A 2L4NA 3GTOH 3E9HA 1Y1WG 2KA7A 2EVBA 4A3KB 3GTQH 1IBKL 1EWHA 4JV5L 3SK5A 1HA5A 4NDXA 4QL5A 3OTOQ 3PIOA 1GUSA 4G7ZC 1N9WA 1BBXC 4LF5L 1JOOA 3KFUA 3CD6A 3VR5A 1O78A 3OW2A 1EY7A 4HCEA 1V1OA 1S40A 1F9QA 4M8AA 5HY6A 3V05A 3S1NH 3J7YW 2O5JC 2EYJA 3PGZA 1HNWQ 2PI2A 1NNXA 2Z1CA 5FKAC 4BS9A 1PRTD 2OTLA 1LT5D 1EFWA 1GJXA 3NTKA 4OO1H 1L1OA 4C3IH 3LX0A 4P72A 2IW3A 1CA6A 1SEBD 2B63B 1KRTA 3TP8A 5C44B 5C0XJ 2R92B 4PMCA 2B2UC 3DWPA 2D62A 4QGUA 4R4CA 4KY5A 1CT1D 1G2TA 1TR5A 1B3QA 3KF8B 4R9WA 1VQ6A 3CQZB 1SNOA 4R4IA 4A3GG 2L5TA 4IUVA 4EGVA 4AQYL 1SYEA 5J22A 3K80C 2K05A 4DR4L 1VF5C 2AQ3B 2JSOA 1W6KA 4QB4A 4JBMA 1JB3A 2M9VA 1HNZQ 1PTOH 1CI3M 3ND9A 3I4NH 1I4RA 4B3SL 3I90A 1VQIA 1Z9FA 3MTSA 2IX1A 1TWAB 5LHY1 2VQEL 1KDCA 4DR1Q 4A3DH 3HOUH 1AE2A 4KLKA 2JA8H 5BN4A 4C1NK 2QDLA 2C9OA 3KLRA 4M1UB 5JPMC 1WTPA 4QJFA 2QF7A 2JA7B 4FDBA 3A0JA 1KNAA 1I4GA 2BH8A 3UDGA 5G3LD 3LGJA 3C3LA 4IZ8A 2IT1A 1YNJD 1XXGA 2JK8A 2UUCQ 2VW9A 3VR4A 1EYAA 4B9WA 1EQTA 3D6CA 1F2ZA 4FVMA 4YY3Q 5A2QE 5LMUQ 2UUAQ 3F1ZA 3HZXA 2B29A 4RCNA 1K73C 2DY8A 2DJGC 5JVG3 3BZCA 1BCPD 4LF6L 1MJEA 2ZJPA 5E4WC 5J3BA 2Q8RE 3UE0A 4ZRZA 1S3OA 2VUMG 4H02A 2I5MX 1TS5A 1S5FD 1L0WA 1C4QA 4JI3L 3ICEA 3DWAA 1VQOA 4IPCA 3ULJA 5KYLA 2F0LA 1VQPA 5CBEE 1H9MA 4DR5L 3ERQA 1IW7D 2DNEA 4DAMA 1LT3D 4P73A 1FVIA 3BZDB 4H7BA 1FJGL 1ENFA 3HOWH 4A3CH 2H4OA 4OEMB 3KF6A 1VF7A 3SHLA 4MHEA 4ME3A 4QUFA 4A3BG 4H13C 1Y8NB 4JI8L 1XTCD 1FGUA 5GQOA 1JOQA 4FF1A 4ILWA 3ITPA 3Q0AA 2A6EC 2KHIA 1PFNA 3MHBA 3RUZA 2EIFA 2NVTH 3BS1A 4FXDA 3FKIB 3CCRA 1YJWA 4JI1L 3X3NA 5EPKA 2KCCA 3R93A 4DV2Q 4Y52H 4C56C 1WI5A 2XWBB 2WP8J 2D2CC 2R7ZH 4BBSG 3AYHB 4DV3L 1J6QA 2AQ2B 1EY0A 4NXML 3S2HH 5LMNW 2UXBQ 4ZLTF 4QCLA 4KN4C 2MO0A 3U9SA 3EFXD 3S16H 2HQLA 3IL8A 1K3BC 3N6RA 4GKJQ 1PFBA 4R4TA 1II3A 2G5DA 2L15A 2ENBA 3I73A 2KECA 4OGQC 2E2IH 3M4OH 2NVYH 4C3JG 2XGTA 4UAIA 2CQAA 1EZ6A 1F77A 3HKZB 5C0XG 2LXKA 1BUVT 4Y7NB 4BXXH 2EPBA 3ULLA 5HGTA 4DAPA 2BCOA 3I4MB 2E2DC 1LTSD 1WD1A 4CKCA 3KK7A 2A69D 4ALPA 2V1CC 1DOLA 1SNQA 1SR3A 4CJ1B 2KBNA 5JAVA 3M4PA 1TKWB 3PUWA 3NP8A 2K5VA 1EWIA 3G4SA 1YHQA 5C0XI 1PA6A 3K8AA 3OOCA 1XMQL 4X64Q 3WOEA 2E2HH 2F03A 1I3QB 1PFSA 2N8NA 2ALYB 5I4DA 1PYSB 1PH2A 4R1JA 4FP5D 2K5DA 4QQBX 2Z8LA 5IGCA 1K0RA 5KNBA 4DUZL 3OWFA 1CKNA 5ELOA 2EYOA 4WORA 3D4WA 3L2PA 2EQSA 3PUXA 4JPBW 2AKWB 3M85A 3QIAA 1HRJA 4GN5A 2B39A 4C3HG 3CCMA 1BDOA 3AFPA 4IUNA 5C4JH 3AEVA 1WJJA 3P20A 1EYCA 3EROA 4BBRB 2VY3A 2JA5G 4HJ9A 4PV1C 4G4KA 1SFOH 2ZXRA 3ER0A 4A3KG 3PO3H 4GOPB 2F0GA 1ZYRC 3BVGA 4NKLA 4UP9A 3GTQB 5IGFA 3VYTA 2E5LQ 5FOBB 1STGA 1Q7YC 4L63B 2PI2E 1IKMA 1PZJD 3CF5A 2EY5A 3HOZH 4QY7A 4JK1C 3H6MA 1HUNA 2A6ED 1F2MA 1YI2A 3CCJA 5C4ZA 1IBLQ 3S1NB 3NWTA 4N9TA 1I5FA 3PIPA 2AWOA 2B63G 4GLVB 2I07B 5C44G 4A3MG 2R92G 3D4RA 1HZAA 4BY7H 2UU9L 1PH8A 2EYMA 4IPGA 1K9MC 1LYLA 3WOFA 2PMZE 1YVCA 4JYAQ 4K5XA 5KIXA 1XPRA 5DLQE 1F9PA 1CHQD 1CSPA 3VYUA 4KHZA 3TP5A 3S1RH 2H1EA 3M4QA 5IY0A 5ISRA 3F2DA 1FR3A 4TSSA 5IYBH 1HTLD 1JICA 4YCWA 1Q8IA 2EDGA 4RKLA 2Z6KA 1J9OA 2ZM6L 1RD9D 1HQRD 2NVXH 1I50B 3RNUA 1PTOB 4Z9CB 4X66Q 2F1MA 2GN5A 1BKBA 2D9UA 1YJNA 4CDDC 1VQ7A 5JEAH 3HOYB 1WOCA 4HJ7A 5ELBA 3CCSA 4KD4A 5JJLA 2ICIA 4Q0FA 3S9WA 1A6XA 1HFNA 4DR6Q 5GROA 4LFBQ 4IPHA 1AN8A 3VDYA 3Q22A 4EQNA 1SMXA 1R4PB 4HSPA 2RDHA 3C46A 1Z47A 2JN4A 3MA2B 4EQOA 2FXQA 1TWGH 2R3ZA 1SE8A 4KY7A 2BDNA 1D1KA 3OWEB 1HFGA 3SK6A 3JAML 4JBJA 2XIWA 3V2TA 1XNRL 1CQFA 4FNFA 3I56A 2A68C 2KCTA 5CV4A 5EKLA 3NBHA 3GTMB 1V1PB 1FNVA 2HCIA 4YWKA 4QIWE 1BNZA 2OF1A 2Y0SE 4J15A 3MXNA 1CM9A 1TWHH 3UDIA 3VR6A 3TMEA 1DM0B 2K01A 1TQOA 3ONAB 1TY2A 1D7QA 3S2DB 1RODA 4KKTA 2EYLA 4JC0A 4YWMA 5A35A 4OONA 3J7AF 3STBD 2HUGA 1ML0D 1QCBD 4L5TA 3CRLC 1X65A 5CGKA 3MFYA 3GTPB 3PCOB 1ZXTA 3DEOA 2QEXA 3J81E 4BA1I 4L5SA 3DUZA 3KLWA 4X3TA 4JW0A 3T1HQ 2ICEC 1H9RA 2IL8A 5EKKA 5J39A 4DV4Q 2F0HA 3PQIA 1S5BD 1QE6A 4KMUC 3P7JA 2NN6H 3HOWB 2VUMB 2F0WA 5FO9B 2OT2A 1UAPA 2YU9B 3H15A 3F2UA 4GN3B 1JMCA 1N36L 3FKIG 3OIQA 4POGA 2N49A 3GTJH 2O2LD 2G9DA 3R2TA 2NVTB 4HIKA 2E75C 4DV7L 4DV5Q 4I7AA 2O5IC 1HPCA 1HR0Q 4AIMA 1TT2A 3I4OA 3D0FA 3QOJA 3UI2A 3VYSA 1Q1BA 1C48A 4JI2Q 5E3FA 2R7ZB 1XPOA 3PMFA 3C2PA 1NMFA 4CJ0B 1U0LA 1E24A 2K5QA 4B3RQ 2PQAB 2KQ3A 3CC4A 1KTKA 3FPUB 4JI5Q 2MJ8A 1E7ZA 3HKZG 2IHFA 4LF7Q 3M4OB 2NVYB 3U58A 5M3FG 4L5RC 3J80L 1IKLA 1QZHA 3QG1A 1VDZA 4FXKC 2LXJA 5IODA 1N34L 1G6ZA 5L37A 5IWAQ 1R4QB 4A3FH 1ZKOA 4O1NA 4IFDH 3HOVB 3IAYA 4LF8L 2R7FA 1IBKQ 1XPUA 4JV5Q 3J7ZC 4AYBG 1ONLA 2XVSA 5CV8A 3S1MH 1EY5A 2EXDA 1RKNA 1E1OA 4DK3C 2QKIC 2YV5A 4LF5Q 5EBCA 1LTGD 4IPDA 3OYYA 3BDLA 4A3EG 2J4XA 4OELB 4K5VA 1JT8A 3RZOB 3U9OA 2BE5C 1WTWA 2UXDL 5KNDA 2ATWA 2VL6A 1Y1VG 3D31A 3SEBA 3TDQA 1Y69U 2K5NA 1OTCA 3I7FA 2AMCB 1XWEA 3MXPA 3GTGB 1K83H 1I6HB 5G3LF 2OQ0A 1VQEA 2BDOA 1OXVA 3GTLH 1YNXA 1VS0A 1A3TA 2FINB 2EE1A 4X3UA 4BBRG 4DA2A 2F0OA 3R3OA 1SNCA 4AQYQ 2RSNA 2QA4A 1NBWA 1I4QA 1B2TA 2LSSA 1BCPF 1B70B 1H9SA 2KJXA 2AQ1B 4DR4Q 2QDBA 2RCNA 3MVVA 4GN4B 4GZYC 5EQ0A 3E0EA 1SSOA 2HHHL 3DWQA 4RFBA 1IL2A 4I7ZC 3PO3B 3A8JE 4B3SQ 4YCVA 3G71A 3JAMc 1TWCH 4GKKL 2WINB 4RGNA 1P16A 1RIPA 3DXJC 5IYCH 2VQEQ 3UE1A 1MGSA 3RLFA 2B2UA 2A19A 4C2MH 2GVBA 4ZK9B 2FFKB 3BG3A 4EQPA 1KAAA 3NELA 4OO1G 3NBIA 3I72A 4IUUA 1D5MC 2LKVA 1HJPA 5E1FA 4GNXC 5IGGA 4RA8A 1EWCA 4A93H 1H9KA 2F0JA 1V8QA 4V190 1FYCA 4HIMA 1ET9A 3WDNA 1A62A 1YIJA 3CCVA 3AMUA 3OMGA 3S1RB 3H09A 2JA6H 4DUYL 2E74C 4LF6Q 2ZTEA 4WJ4A 2K6AA 2N78A 2IX0A 4OO1I 2XWJB 1D5ZC 2MP1A 3CCLA 2LS01 2BOSA 5C3EB 1DD2A 1HHVA 2PZTA 2R93H 1SE3A 2E8GA 3R8BA 4KK7A 1WCMH 1EU3A 2FMMA 3VYRA 1EY4A 4A3MB 3HEJA 3HOYG 1U9RA 3EJIA 1BBUA 1RTNA 1WYDA 4JI3Q 2KVMA 3RMHA 5LMNL 1SYDA 3R2IA 3DM1A 3MFGA 1PZKD 4LUVA 1E3PA 1QWYA 2F0PA 1K8AC 5DEHA 1DJRD 1WFQA 4A3IH 2BA0A 2AUJD 4DR5Q 1PH7A 4DFAA 1BBWA 4JOIC 1Y1WH 4L5QA 4JBKA 2HQEA 1DXMA 2K03A 1FJGQ 2EJGC 1TWGB 2DY7A 4UP7A 2RVLA 1KQSA 3JC66 2NZ1D 2MFIA 5GADC 4P75A 1L1OB 4JI4L 4JI8Q 1DOMA 1QUQA 4ME5A 3J81i 1X56A 5AFWA 1QNUA 1QOHA 4O2DA 2F0EA 4HMIA 4PZ7A 5I6WA 2WAQB 1IBML 1E2ZA 1LT6D 2NVQB 4RKBA 2K50A 5KRUA 4JI1Q 1K28A 2F0NA 4RAUC 2F4IA 4ABNA 4IOCA 1VQDA 4X3KA 3J80c 4FXGC 4DV3Q 2IHEA 2A74C 3OPOA 4OXPA 1RDPD 4NXMQ 3S1QH 2R7DA 2F3WA 4RWSC 2WIIB 4K8JA 1L1OC 5J1ZA 2H5XA 1PV4A 3H0GH 4GLXA 4Q5VA 1IYVA 5JPNC 3H3VH 1HUMA 1O7LA 2I0QA 5EPJA 3GP7A 3E3XA 3OW7A 3CCQA 4R4QA 4LF9L 2J7ZA 2PZWA 3KJOA 1TWFH 1YHBA 1Q81C 3HOWG 2ZTCA 1NY4A 3MEHA 5FJ8G 1OXXK 4X62L 2KEEA 2D5DA 3UDXA 2K1BA 5CYUA 2L55A 4G7OC 2K7VA 1EUJA 3EBEA 1A3UA 1VQKA 5FLXE 5JJZA 4K2KA 4KY6A 2K75A 1GO3E 4K6DA 2MGSA 2B8GA 2WB1B 4OL7A 3TP7A 1SYGA 3DHQA 3P1HA 2WACA 3GTJB 4XXEA 2ES2A 5D3IB 4DAYA 1CQVA 2F0FA 1XMQQ 5DNFA 4A3LG 5M5WH 1PLFA 1B9NA 4HIOA 5JEAJ 5JVH3 1A15A 1Y8PB 2R7ZG 3QOLA 4XIGS 1NAPA 3W3AA 1KDAA 3OMCA 1E2VA 3KBGA 4HSVA 4DUZQ 4N9PA 1SJHD 4ZQ3A 4A3JB 1KIXA 4XQJA 2NYZD 4IURA 1VQLA 5CBAE 2Q2UA 3T1YL 1FNWA 1TS3A 1XYIA 4JI7L 3CC7A 3M3YB 4BXXG 4DK0A 5I2XA 3NUCA 4DR7L 5CV7A 1QILA 5M5XH 3MZ5A 4XYQA 3EQLC 3CPWA 4IO9A 3HOVG 1BXTA 1ILPA 1HNXL 2A8VA 4A3FB 1CFMA 2FMCA 3G6JB 3KF6B 1OXTA 3PIP3 3LWEA 3CP0A 1EQQA 3NE5B 4HJ8A 1MHWC 3K5MA 4KKSA 2SDFA 4RH6A 2JQOA 4B3TL 5IYDG 1NUCA 4G7HC 1QB5D 3HRZC 1VQ8A 2LMCB 3PSIA 3RR5A 3K0YA 5H1SE 5CV6A 1N32L 5M3FB 1AFPA 4CDEC 4A3BH 4A75A 1K3RA 4IN3A 4KD3A 3J81j 4AH6A 1D8LA 5COYA 3L0OA 3L7ZC 3CMAA 3M7GA 4DV0L 5K5PA 2NZOA 3NTIA 1LLRD 3IKJA 2UU9Q 5K36H 5FK9C 1I4HA 3EA6A 3I3CA 1VQ9A 1PDQA 4DNIA 1F2YA 4AYBB 1O7ZA 3TSSA 5CV9A 3NWSA 1HH2P 5C3WA 1HA6A 2QW7A 2A73B 4PZ6A 5EAYA 1UWVA 5E4XA 3W2DA 3S14H 1JR0D 4J1MA 5C4HA 2Z4IA 4NMZA 5CC4A 4A3EB 2EJFC 3S15B 1UUPA 2JXMB 2VNUD 2X69A 1B3AA 3PO3G 1VQ5A 2ZM6Q 2F0DA 1J5EL 2IJ0A 1Y1VB 2B2VA 3EIVA 1S72A 3QR8A 5ELEA 3W1GA 1SDFA 3L9AX 3URYA 1PH9A 4KHVA 1XNQL 4QUCA 2RA4A 3A8KE 1QVCA 1VMPA 4JI6L 1SAPA 3KYHC 2K5WA 4NXNL 3K7AH 1R9TB 1G91A 5LL6X 1B7YB 5GAHC 5NUCA 1IL8A 3CXCA 4FF2A 3NQIA 2MQHA 2DN8A 1G2SA 1ASYA 2CCZA 3GTOB 1D6EC 1X3GA 1CKNB 5IIFA 1JORA 3FP9A 1NTGA 3MC0B 1XNRQ 2IPKD 3SR1A 5I9OA 4A93B 1GXDC 1DZ1A 3BDCA 2SNMA 4CDCC 4IFDJ 3PUZA 5I6YA 1BF4A 2K52A 5IYBG 1C0AA 3TN2A 4LFAL 2JA6B 5C3EG 1JC7A 3PUYA 1KLGD 1SN8A 1OXUA 1LM0A 3T16A 2HD3A 3RZDH 2R93B 4DR2L 3Q8DA 4C3IB 2JA9A 4C3HH 4MTNA 1XTDA 5JEAG 3TS0A 1N33Q 2YTYA 4GOPC 2RSOA 2HT1A 2MHVA 4GLAC 4S3SA 4DR3L 2SEBD 4XQQA 2JA5H 5GAGC 4RMFA 1K0SA 1BQQT 3A8IE 1MI2A 3T13A 1AH9A 4A3KH 2JJQA 2RDGA 2HIXA 1SJED 2NBFA 4X65L 4KJNA 2EYPA 4B08A 1EL0A 1SE4A 1PHJA 4UY8C 3I4NB 4ZUIA 2NUCA 2NZHA 3C1FA 2XRQD 3D3RA 2HDLA 2EXZA 4H0LC 1G291 4A3DB 1E2WA 3HOUB 3EN2A 4JBWA 2WAQG 4CKBA 2FHTA 2JA8B 1N36Q 1QNKA 1GUNA 1A63A 1Z7TA 4DXGA 2PNRC 1LTRD 4YIJA 5AJ3L 1MIUA 4DV7Q 5C44H 1SXTA 3VA5A 2R92H 1AE3A 5IT9c 3K7UC 1EIFA 1OXSC 1HQMC 2XN9C 1STHA 1YJ9A 4XT1B 3T4AC 4XYOA 4OX9L 4XDXA 3IRBA 1XJVA 1NSNS 1PTOC 1CA5A 1U4PA 1JE4A 1MSHA 4ZAIA 3CHBD 2K04A 3H0GB 4CHTB 1MSGA 2ZXPA 1A8VA 1TVXA 1XMOL 3MWYW 3V96A 1BR9A 1KAWA 1TS2A 3U50C 4DKAC 3HG9A 1N34Q 3K5NA 3SK4A 1N33L 4P74A 3MXGA 1ET6A 2WB1G 3ND8A 2ZXOA 2Z6KC 5IP7H 2UUBL 4LF8Q 4RGOS 2MNAA 2JA7H 3K58A 4H44C 1JQYD 1EZ8A 3NBHB 1RL2A 2E76C 1ZYRD 1SNDA 3M4YA 4CBVA 1LTID 1NCVA 4IJHA 1S5DD 1M8AA 2F0IA 1NJIC 3MXNB 1P8LA 1RF2D 1CHPD 3Q24A 2CWAA 2K28A 1I94L 2MPMA 4EVOA 2VQFL 2CWPA 3GD7A 2UXDQ 5HGQA 4O0AA 2PYKA 4A3JG 1Z6HA 4PMBA 5M3MH 2D0OA 4ZKBB 4R8NA 2V4DA 4BA2I 2JEBI 1HZCA 2AWNA 4RGTA 4WJ3M 1HXYD 1UEBA 2B2TC 4DGZA 3TS2A 3I4LA 2EYFA 4LF4Q 2OEOA 3AQQA 1EIYB 2QCPX 3IFTA 1AZQA 2KEDA 1U4MA 4OIJA 3FHWA 2Q8IB 4A3FG 3GQBA 3M7NA 1MKHA 4YHHL 1PVOA 4CGYB 3PF4A 4X6AH 1PRTB 1U4RA 3F2BA 1HZBA 3S2HB 1DONA 3GV6A 3ZJYC 2HHHQ 3CPFA 1X3EA 4LNQA 1E1TA 1C9OA 3S16B 1JWSD 1EIHA 4GKKQ 3RN5A 4IJLA 4IQZA 1CUKA 2B2WC 2XNAC 2E2IB 3PIO3 5BR8L 1C8CA 5C4XH 2B3GA 2RKSA 3J7A5 2YYZA 2G9HD 2PNHA 2UXCL 2RBMA 4DK1A 3CKIB 3E9IA 3W5OA 4YCUA 3AFQA 3CU7A 4TQUS 2LFNA 2Z4HA 1JE5A 3CMEA 2B8FA 5EJWA 3BYTB 1SNMA 1TIID 4L6TB 1C7YA 1PRTC 2L0CA 1WTHA 2I5LX 3RLOA 3U4ZA 5FLMG 1B4OA 3K81C 1T5EA 3BU2A 4DK6C 3CAMA 2A68D 4OHJA 3PO2H 3FMCA 1PTOD 4HMJA 1RTOA 3HOXH 4PNYA 2E2HB 3CCUA 1KABA 4DUYQ 1VQCA 1QVGA 4KHPL 3S14B 5ELFA 1DGSA 2QILA 1T9HA 1RCVD 1LTBD 1STAA 1STNA 3PV0A 5TSSA 1IYJB 5LL6S 3QJYA 1VQNA 2VS1A 2OTJA 4HCSA 4OWTB 2K5HA 2WKCA 5IP9G 5T1GA 1EIGA 3K57A 1HZ9A 3I70A 4LF4L 1Q3LA 5LMNQ 5C4JB 4DNRB 1PZID 4GNXA 1D5XC 1U4LA 2RHQB 3I4MH 1BCPB 4XT3B 5M5YH 3K7AB 4LMQD 4MN3A 3NHHA 4WJWA 2ZJRA 1K8OA 4J8QA 2EY1A 1SFOB 1EY6A 4HTHA 4NW2A 4TVAB 3E6ZX 2M00A 4IUPA 2B2YC 4BY1H 1IXRA 2D0PA 4A93G 1I3QH 1FGBD 4TRDA 2RCFA 1KRSA 4PQXA 4JI4Q 1YNJC 2K4KA 2QEJC 3TBIB 4XQNA 4K0KL 1KC8C 1EYDA 2JA6G 1ENCA 2DNCA 3HOZB 1JWMD 1IBMQ 4ZUJA 3KJPA 1NMGA 2R93G 4C3IG 1H9SB 2Q2IA 2F4VL 3KOJA 4JOIA 3RZDB 4BY7B 2VXWA 1X32A 5I2YA 2OWOA 4BBRH 1Q8KA 1WTOA 1JJCB 1O7IA 5GAEC 3K6OA 4B3ML 1EEFD 1LV9A 3PUVA 5F2DA 1B9MA 1I6VC 1YEZA 2ZTDA 1EY8A 4LUZA 1GHJA 3FEWX 4HAEA 4N8X1 4LF9Q 2PW5A 3K0XA 1DCZA 3L3OC 3NTHA 3I4NG 1A0IA 1GUWA 2KUMA 1IW7C 3KF8A 4CDFC 3DEPA 4X62Q 2NVXB 2A6HC 1A2UA 4P2CB 1UEAB 3D8GA 5C5LA 4A3DG 3HOUG 1K8MA 3FRPB 2JA8G 3BVZA 4PMWA 3NSWA 1LO5D 3SE0A 5E7NA 1M1KC 1IHZA 3NQTA 1SLJA 2EOTA 3WWVA 2IY5B 4DV1L 4OWWB 2CFMA 4BWGB 2WKDA 1UE7A 3A7AB 5C3XA 2PW7A 3PF5A 1X3FA 5FO7B 3A5UA 2BE5D 5BN3A 4O42A 5M9OA 1SROA 1TY0A 4KTAA 1TS4A 2EYHA 3H0GG 1G6PA 4RG1A 2M2LA 1S4ZA 3T1YQ 1I50H 1TWHB 1PH4A 3HP3A 5JJKA 4B9XA 1YITA 4RHRA 3X3MA 2A1AA 4JI7Q 4KV6A 3VR3A 2PMZB 1STYA 2L9HA 1EEID 2PQEA 3O13A 4JI0L 4DR7Q 3HOYH 2F3IA 3OIPA 1V43A 2SOBA 1HNXQ 1WVLA 3A54A 2YTVA 5IOCA 1CZWA 4A3GH 1YHAA 1CSQA 4FYDA 5I9PA 3H3VI 2A5HA 1LTAD 1S5CD 1QUQB 3J81L 2A69C 2X6GA 4KI0A 2F52A 5KGUA 2N55A 4B3TQ 2DJFC 3JAME 2RF4A 3E5SA 3NENA 1SYBA 3SXHA 4DNTB 2XSCA 4MNOA 4DAVA 2RHSB 3SK8A 2GA4B 4A3CG 2K33A 3OTOL 1N32Q 4DF7A 1X55A 3GTMH 3QO2A 4UDUC 1VQBA 1HR0W 2VB2X 4K6LA 4ODGA 2NTSA 3CW2C 5M3MB 4DV0Q 2CH4A 2F0KA 1PH3A 1HNWL 3S2DH 2F0VA 4G57A 1W3SA 2JE6I 3H94A 2SNSA 1YNNC 4WFN3 2WFWA 1FNUA 5KYIA 3TREA 3A7LA 4R8IA 2TMPA 1F9RA 2NWGA 2FJ2A 4POFA 3GTPH 2DGYA 1BOSA 1CTMA 4QIWB 1CKMA 2Y0SB 3T51B 2F0TA 2I5HA 4DPGA 2BH2A 1A3VA 1B1ZA 2AHOB 4N8FA 1J5EQ 1OO9B 1BO0A 1V9PA 2RQXA 3CRKC 4F87A 4GS3A 2A6HD 3U4VA 1HNZL 1XNQQ 4JVZA 1GM5A 5IT9L 5FJ8H 2VUMH 5EPLA 1M90C 4JI6Q 3LWUA 2YU9H 5C4XB 1F9SA 1PYBA 4NPSA 4DAYB 4NXNQ 1QJOA 1ESRA 1GD7A 3MEFA 4DR1L 4UP8A 4NB3A 2ID0A 2X6LA 4JG2A 1PFMA 2QGQA 1KXLA 1GUTA 1EQRA 1SYFA 2Q2TA 1GUGA 5K36G 3Q6SA 1EY9A 1O7YA 2EZVA 3TZUA 3I2ZA 3NEMA 2RDFA 4A3LH 4PZ8A 3S1MB 4HIDA 1TXYA 1QG7A 2UUCL 3PO2B 4YY3L 1B44D 3TQYA 1EQVA 1G51A 4FO2A 3HOXB 2PO4A 4F88A 5LMUL 2UUAL 4LFAQ 3ERSX 1YBYA 4I65A 2KENA 1Q90A 3BYYB 4APVA 1CK1A 4L8JA 4IUQA 4DV6Q 4DR2Q 1K83B 1SYCA 2IWHA 2KHSA 3J80E 2F0QA 2Z0SA 3GTLB 1GUOA 1VCIA 4HN7A 4DR3Q 1LUZA 1GOZA 5CMDA 1PH6A 2LY7A 4BBSH 5D65A 1PH5A 3HOVH 1Y14B 3I91A 2CH4W 4RHSA 2JYOA 1GHKA 3KUPA 5M5YB 2Q8TA 1NR4A 1I4XA 4X65Q 3A5ZB 2F0MA 1AP0A 1AZPA 4ULLA 4BY1B 3AU7A 2E2JH 4C3JH 5IYDH 1FL0A 3GTKH 1WTRA 1TWCB 5C0XH 3ULPA 2XTIA 1W2BA 1G8ZD 3RZOH 3HOZG 4E6IA 2C5CA 3FVQA 1L0YB 4HEDA 4DXFA 4MZ9A 2GVAA 1NR2A 4GOPA 5ELDA 1V1QA 3GTGH 1EYGA 5AJ3Q 4C2MB 1I6HH 3HFZB 1PMRA 1NE3A 1LTTD 1EOTA 3S24A 3CCEA 3S17H 1H95A 1YNND 1MBYA 4BY7G 1ESFA 3TEHB 2HDMA 3DLLA 4ZCKA 3P75A 4OX9Q 4DV2L 1LACA 1RJTA 1VMCA 4C1NI 3FPPA 1EFID 3KBXA 3OSOA 1VQHA 1LT4D 3STBC 4F7XA 2F0UA 3TRZA 2MUYA 5HURA 1FD7D 5ELNA 2JEAI 2UXBL 1PH1A 5DAUA 3J81c 4DN4M 4A4IA 3RLNA 1IYUA 4U68A 5DM73 4YWLA 1XMOQ 4GKJL 1STEA 5KNCA 4LFCQ 1PYWD 4DV6L 1S5ED 3HS0C 1WCMB 5EBDA 1E22A 3NK9A 4RCOA 5JOBA 2UUBQ 4K14A 1QZGA 4J6HA 4ZKCB 1E0BA 3GDEA 5D14A 2B2VC 3KLSA 2CQOA 2AUKA 2WAQE 2EY6A 4A3IB 2EJMA 4F8MA 2K14A 2F0SA 4LUOA 1STBA 1Y1WB 1D1IA 1UE6A 2OQKA 2P5ZX 1I94Q 2VQFQ 4LJZC 3HKSA 1KLUD 4X64L 3C1EA 2PCFB 1ZEQX 3BJUA 2NTTA 5CR3A 3SGIA 4U673 2EY2A 2YTXA 1JOKA 1MJCA 3RN2A 4TKOB 1GVPA 5C3EH 2F3VA 1AW7A 3JAMi 3TP6A 2B63H 3UDFA 2PPBC 4A3MH 1ENAA 3KLSX 4XTCS 2HIVA 1QVFA 3BZKA 4P71A 1V1PA 1PTOF 5KEEA 3BDOA 5BN5A 1X54A 3CQZH 4YHHQ 1ICFB 5IP7G 2Z9HA 1Q1EA 5A2QL 2CKZB 3S1QB 1CKOA 2TSSA 2JA7G 1U5KA 1I4PA 4RGMA 2N88A 3E0JA 4A3GB 3IFDA 1N8RC 2MO1A 1A2TA 1DOKA 2WB1E 1LTLA 1Q46A 3RD4A 4WRDA 4KN7C 4NP5A 1TU2B 5BR8Q 4UHVA 1TWAH 2B2TA 2E5LL 2ZJQA 1VQAA 2CHBD 4LFCL 2KCNA 1TWFB 3D4DA 2CVRA 2NN6G 3EVQA 3I8ZA 2ZT9C 2UXCQ 5M3MG 3NXWA 1RHPA 1VQMA 1ILQA 1LABA 2O4XA 1SRUA 1O80A 2NVQH 5C5MA 3TZDA 5FLXL 1KHIA 1IBLL 3W1BA 3T53B 1Y8OB 4UPAA 2J0TD 1T5XD 5ELCA 3SDZA 1VQGA 1SNPA 1SMYC 1IZ6A 2NN6I 5M5WB 1HTPA 1M4VA 4JYAL 4OWXB 2B2WA 3H3VC 2Y0SG 4KHPQ 5C6AA 1GKHA 1WTXA 4V0BA 1UNSA 2JP1A 2VZAA 3VR2A 4K2LA 2ASBA 2I46A 1WTVA 5EKIA 3G6EA 3AB9A 1BVSA 1Q12A 1X9NA 3VA7A 1B50A 4JCVE 4X3SA 1KNEA 3J7AV 1JJ2A 2WV6D 4CKEA 4IUTA 3QWNA 5C4XG 2CW0C 4X66L 3LNNA 1L2FA 3HKZE 3OHXC 5M5XB 1VQFA 1B8AA 2PQAA 4IOAA 1X3QA 4IFDG 4PG3A 1H9JA 3DMUA 4DR6L 1KDBA 4LFBL 2C35B 1DYQA 1B53A 3J80i 1X3PA 3SVMA 3G48A 3F8TA 1HCZA 1JJGA 1CZGA 5IGEA 3PO2G 5DM63 4AYBE 3HOXG 1XX8A 4KJOA 4K0KQ 3A56A 1UE1A 1X6OA 3ZYYX 2XRSD 2L1BA 3CC2A 3NPPA 1KD1C 1Q86C 5JJIA 1YZ6A 4IFDI 4A3JH 4A3BB 1PRTF 4HJ5A 5IE8A 2Q2HA 4HR7B 1L0XB 2L12A 3QB3A 3FKIH 1SE2A 3H91A 3G7LA 2F4VQ 1W6JA 3K5LA 3KDFA 1EOVA 5IT9E 3M3YH 5T1IA 1VQJA 4EQ5A 2B2YA 1J8IA 4B3MQ 3D6WA 3BVMA 3I4MG 4ZYSA 1SBBB 3M9BA 3MXUA 1WD0A 1AEXA 2K32A 4BBSB 2N3SA 4LK1C
chains in the Genus database with same CATH topology
3L0OA 3L7ZC 1SMXA 3CMAA 4DV0L 4RG1A 3T1YQ 2NZOA 1I50H 3T1HL 4BY1G 1PH4A 1Z47A 1JB7A 2UU9Q 5JJKA 1YITA 2FXQA 4R4OA 1TWGH 2A1AA 1VQ9A 1SE8A 4IPHA 3VDYA 4DNIA 4JI7Q 4DV4L 5IYCG 4JI0L 3B6YA 4DR7Q 4Y7NH 4JBJA 2DUDA 3HOYH 3KDFB 5M3FH 2F3IA 1XNRL 1HH2P 5EAYA 2KCTA 1V43A 4PZ6A 2OCEA 3I56A 1HNXQ 2YTVA 1UWVA 3S14H 2R6GA 1VQ4A 4HJAA 4YWKA 4A3GH 4A76A 1YHAA 1CSQA 4QIWE 2Y0SE 3H3VI 2VNUD 4J15A 1TWHH 3PO3G 3UDIA 1QUQB 2ZM6Q 1VQ5A 4KI0A 2F52A 1J5EL 1UE5A 4DV1Q 3EIVA 1S72A 4B3TQ 1D7QA 3W1GA 2RF4A 3NENA 5FLMH 4DV5L 1PH9A 4MNOA 1XNQL 3F2CA 4JC0A 4YWMA 2RHSB 4A3CG 1HR0L 3OTOL 1N32Q 1QVCA 3GO5A 4OONA 1X55A 3GTMH 3STBD 1HR0W 1VQBA 4JI6L 2KHJA 4L5TA 3KYHC 4A3EH 1X65A 3K7AH 4NXNL 1K8GA 4JI2L 3S15H 3CW2C 3PCOB 2QEXA 4GNXB 1B7YB 4BA1I 5GAHC 4DV0Q 4L5SA 3KLWA 3CXCA 3T1HQ 1Y1VH 2KCMA 1PH3A 2MQHA 4LWCA 1ASZA 4B3RL 3S2DH 1HNWL 1ASYA 2CCZA 1W3SA 1WCMG 2JE6I 1X3GA 4JI5L 4DV4Q 1CKNB 5IP9H 4JI0Q 3A74A 2WFWA 3FP9A 1NTGA 4LF7L 3TREA 1XNRQ 3I55A 1Q82C 4EX5A 2BA1A 4LW1A 4POFA 1R9TH 3GTPH 4IFDJ 2DGYA 3PUZA 3DM3A 3H15A 1CKMA 2K52A 4GN3B 5IWAL 5IYBG 1C0AA 5FLXc 1JMCA 2I5HA 4DPGA 4LFAL 1KL9A 4A3IG 1N36L 2BH2A 5C3EG 2AHOB 3FKIG 3PUYA 1J5EQ 4POGA 2N49A 1SN8A 3GTOH 3E9HA 1Y1WG 3GTJH 1Q81C 1OXUA 1V9PA 1LM0A 3GTQH 1IBKL 4GS3A 4HIKA 4JV5L 4DV7L 3U4VA 4DV5Q 3RZDH 1HNZL 4DR2L 3Q8DA 1XNQQ 1HR0Q 2JA9A 4QL5A 4C3HH 4AIMA 3PIOA 3OTOQ 4MTNA 1XTDA 5FJ8H 1GM5A 2VUMH 3I4OA 5JEAG 3TS0A 1N33Q 1N9WA 3D0FA 2YTYA 1M90C 4JI6Q 2YU9H 4LF5L 1PYBA 4GOPC 4NPSA 1Q1BA 4DAYB 2HT1A 4NXNQ 4JI2Q 3KFUA 1GD7A 3MEFA 4GLAC 4DR1L 4DR3L 3CD6A 4UP8A 3OW2A 2JA5H 4NB3A 2ID0A 5GAGC 1S40A 4RMFA 1XPOA 5HY6A 1NMFA 3S1NH 4JG2A 2QGQA 1KXLA 1EQRA 1U0LA 1E24A 3PGZA 4B3RQ 2PI2A 1HNWQ 2Q2TA 2PQAB 4A3KH 2OTLA 2JJQA 3CC4A 5K36G 2HIXA 1EFWA 1AH9A 4JI5Q 4X65L 1L1OA 1E7ZA 4P72A 4C3IH 3HKZG 2IHFA 4LF7Q 3I2ZA 3NEMA 1KRTA 4A3LH 5C0XJ 4PZ8A 1PHJA 4UY8C 3U58A 4HIDA 2D62A 1TXYA 4QGUA 5M3FG 4R4CA 4L5RC 2NZHA 1QZHA 2UUCL 4YY3L 3TQYA 3KF8B 1G51A 1G291 2LXJA 1N34L 4R4IA 1VQ6A 5IWAQ 5LMUL 3EN2A 4JBWA 2WAQG 4A3FH 4LFAQ 2UUAL 4A3GG 1N36Q 4AQYL 1A63A 3K80C 4LF8L 3ERSX 1YBYA 4DR4L 2KENA 5AJ3L 2R7FA 1MIUA 4APVA 1IBKQ 1XPUA 4JBMA 4JV5Q 3J7ZC 4DV7Q 4AYBG 1HNZQ 4DV6Q 5C44H 4DR2Q 2R92H 1AE3A 3S1MH 5IT9c 3I4NH 3K7UC 1EIFA 1OXSC 2EXDA 1E1OA 2Z0SA 4B3SL 4DK3C 1VQIA 1Z9FA 1YJ9A 2IX1A 1VCIA 2YV5A 4LF5Q 2VQEL 4IPDA 4OX9L 4DR3Q 1LUZA 4DR1Q 3HOUH 1AE2A 3IRBA 3OYYA 4A3DH 4KLKA 4A3EG 1XJVA 2JA8H 1PH6A 1JT8A 4BBSH 1PH5A 3HOVH 1Y14B 2UXDL 2ATWA 2VL6A 1Y1VG 3D31A 1OTCA 2K5NA 3I7FA 2AMCB 4QJFA 4X65Q 1K83H 3A0JA 4FDBA 2OQ0A 1A8VA 1VQEA 3A5ZB 2BH8A 5GROA 3UDGA 1XMOL 3LGJA 1OXVA 3GTLH 4LFBQ 1YNXA 1VS0A 2IT1A 2E2JH 4C3JH 5IYDH 1FL0A 3GTKH 2JK8A 2UUCQ 1KAWA 2VW9A 3U50C 4BBRG 4DKAC 4YY3Q 3ULPA 2XTIA 1W2BA 1N34Q 3CCMA 3RZOH 5LMUQ 3HOZG 2UUAQ 1N33L 4P74A 3F1ZA 4MZ9A 2B29A 2GVAA 2WB1G 4AQYQ 2QA4A 5IP7H 1NBWA 2Z6KC 1K73C 2LSSA 4GOPA 2UUBL 1B70B 2MNAA 1V1QA 4LF8Q 4DR4Q 2JA7H 3GTGH 1EYGA 5AJ3Q 3BZCA 2RCNA 1I6HH 3HFZB 4GN4B 4LF6L 3E0EA 1NE3A 3NBHB 1RL2A 1MJEA 2HHHL 3S24A 2ZJPA 3CCEA 1IL2A 3S17H 4IJHA 1H95A 5J3BA 4BY7G 1NJIC 4B3SQ 4YCVA 3G71A 3TEHB 3MXNB 1P8LA 3UE0A 3JAMc 1TWCH 4GKKL 1S3OA 2VUMG 1P16A 1RIPA 5IYCH 2CWAA 3DLLA 2VQEQ 4OX9Q 4DV2L 4H02A 1I94L 2I5MX 2VQFL 3UE1A 2CWPA 3RLFA 3GD7A 1L0WA 2UXDQ 5HGQA 1VQHA 4JI3L 4O0AA 4A3JG 3STBC 2A19A 5M3MH 1VQOA 4C2MH 3ICEA 2GVBA 3TRZA 2D0OA 5ELNA 2JEAI 4IPCA 2UXBL 1PH1A 4BA2I 3ULJA 2JEBI 3J81c 1HZCA 2AWNA 3RLNA 3NELA 4A4IA 4OO1G 1VQPA 4WJ3M 4YWLA 1XMOQ 4DR5L 4GKJL 1UEBA 1HJPA 3TS2A 4DAMA 4P73A 4LF4Q 4GNXC 4LFCQ 1FVIA 4DV6L 3AQQA 1EIYB 1FJGL 4A93H 3HOWH 4A3CH 1E22A 3KF6A 4HIMA 3FHWA 4A3FG 1A62A 4ME3A 3M7NA 1YIJA 1MKHA 3AEVA 2UUBQ 4A3BG 4YHHL 4JI8L 3CCVA 1QZGA 3PF4A 1FGUA 5GQOA 1PVOA 4X6AH 3F2BA 2JA6H 3GDEA 4DUYL 4LF6Q 1HZBA 2CQOA 2ZTEA 3ZJYC 4WJ4A 2N78A 2IX0A 2KHIA 2HHHQ 3CPFA 4OO1I 1X3EA 3CCLA 1E1TA 2EIFA 2WAQE 4LNQA 1C9OA 2NVTH 2K14A 4LUOA 3CCRA 2R93H 2E8GA 1YJWA 4GKKQ 4JI1L 3RN5A 1WCMH 4IJLA 1CUKA 1UE6A 4DV2Q 2OQKA 1I94Q 5BR8L 3HOYG 2VQFQ 4Y52H 5C4XH 1WI5A 2B3GA 3HKSA 2WP8J 3J7A5 2YYZA 4X64L 1BBUA 1WYDA 4JI3Q 2R7ZH 4BBSG 3AYHB 5LMNL 4DV3L 2PNHA 1J6QA 3BJUA 2UXCL 4NXML 3E9IA 3W5OA 4YCUA 5LMNW 3S2HH 2UXBQ 3SGIA 4LUVA 1E3PA 2YTXA 2MO0A 3AFQA 1MJCA 4TQUS 1K8AC 1WFQA 3RN2A 1JE5A 3CMEA 3S16H 2HQLA 4A3IH 2BA0A 1GVPA 5C3EH 4DR5Q 1PH7A 4GKJQ 1BBWA 4JOIC 4R4TA 1C7YA 2L15A 3JAMi 1Y1WH 4L5QA 4JBKA 2B63H 3UDFA 2I5LX 3RLOA 3U4ZA 2E2IH 3M4OH 2NVYH 5FLMG 4A3MH 2XGTA 4XTCS 3K81C 1FJGQ 2HIVA 1QVFA 3BZKA 4P71A 3BU2A 4UP7A 5C0XG 1KQSA 2LXKA 4DK6C 3JC66 2MFIA 3CAMA 5GADC 4P75A 1L1OB 4BXXH 3PO2H 1X54A 4JI4L 3CQZH 3ULLA 4JI8Q 4YHHQ 3HOXH 1QUQA 5IP7G 3CCUA 1Q1EA 3J81i 2CKZB 4DUYQ 1X56A 1CKOA 2JA7G 1VQCA 1U5KA 1QVGA 4KHPL 4O2DA 4PZ7A 4ALPA 1DGSA 2V1CC 1T9HA 1SR3A 1N8RC 2MO1A 1IBML 3PV0A 2KBNA 1IYJB 2WB1E 3M4PA 1LTLA 3PUWA 1Q46A 2K50A 1VQNA 2VS1A 4JI1Q 2OTJA 2K5VA 4OWTB 2K5HA 1EWIA 5IP9G 4IOCA 3G4SA 3HOWG 5BR8Q 1YHQA 1VQDA 5C0XI 1TWAH 1PA6A 3J80c 1HZ9A 3K8AA 1XMQL 2E5LL 2ZJQA 1VQAA 4X64Q 4LFCL 4LF4L 2E2HH 5LMNQ 2IHEA 4DV3Q 2NN6G 4GNXA 1PFSA 2N8NA 2ALYB 4OXPA 4NXMQ 3S1QH 2UXCQ 1PYSB 2R7DA 2RHQB 5M3MG 1VQMA 3I4MH 1PH2A 5M5YH 4R1JA 1SRUA 4QQBX 1K0RA 4DUZL 1L1OC 2ZJRA 2NVQH 2H5XA 1CKNA 5ELOA 1PV4A 3H0GH 3L2PA 1KHIA 4GLXA 2EQSA 3PUXA 1IBLL 3W1BA 3H3VH 2AKWB 2I0QA 4TVAB 3M85A 4UPAA 3CCQA 4R4QA 4BY1H 1IXRA 4LF9L 3KJOA 2D0PA 4GN5A 4A93G 1I3QH 1TWFH 1VQGA 1YHBA 3AFPA 5C4JH 2ZTCA 1NY4A 1IZ6A 1WJJA 1KRSA 5FJ8G 2NN6I 1OXXK 4JI4Q 4X62L 4JYAL 4OWXB 2K4KA 3UDXA 2Y0SG 4K0KL 2VY3A 1KC8C 1EUJA 3EBEA 4HJ9A 2JA5G 4KHPQ 1GKHA 2JA6G 1VQKA 2VZAA 2K75A 2ASBA 1GO3E 1IBMQ 1SFOH 3ER0A 3KJPA 3G6EA 4A3KG 1BVSA 1Q12A 1X9NA 1NMGA 3PO3H 2R93G 4JCVE 4GOPB 2ES2A 1JJ2A 2Q2IA 4UP9A 3KOJA 2F4VL 4A3LG 1XMQQ 2E5LQ 4JOIA 5M5WH 5C4XG 4HIOA 5JEAJ 4X66L 1Q7YC 2PI2E 2R7ZG 4XIGS 2OWOA 4BBRH 1L2FA 1Q8KA 3HKZE 3CF5A 1JJCB 1O7IA 5GAEC 4B3ML 3HOZH 1VQFA 1B8AA 2PQAA 4QY7A 4IOAA 4DUZQ 3PUVA 4IFDG 4PG3A 1YI2A 3CCJA 1YEZA 1IBLQ 1KIXA 2ZTDA 4LUZA 4DR6L 1I5FA 4LFBL 2C35B 3PIPA 1VQLA 2AWOA 2B63G 4GLVB 2Q2UA 5C44G 3T1YL 4A3MG 3K0XA 3J80i 4LF9Q 2R92G 1HZAA 3I4NG 1A0IA 2UU9L 1PH8A 4BY7H 3G48A 3F8TA 4IPGA 1JJGA 1K9MC 1LYLA 4X62Q 4JI7L 3CC7A 4BXXG 3PO2G 2PMZE 1YVCA 4JYAQ 4AYBE 3HOXG 4DR7L 4A3DG 3HOUG 5M5XH 4K0KQ 1UE1A 1X6OA 2JA8G 3CPWA 1XPRA 4IO9A 5DLQE 4PMWA 1KD1C 3CC2A 1Q86C 1CSPA 3HOVG 5JJIA 1YZ6A 4KHZA 3S1RH 4IFDI 4A3JH 3M4QA 5IY0A 1HNXL 2A8VA 3F2DA 5E7NA 3KF6B 5IYBH 5IE8A 4HJ5A 1OXTA 2Q2HA 1M1KC 4YCWA 3CP0A 1EQQA 1SLJA 3FKIH 3WWVA 2Z6KA 4HJ8A 2ZM6L 2F4VQ 3KDFA 1EOVA 2IY5B 2NVXH 3RNUA 2JQOA 4DV1L 3M3YH 4OWWB 2CFMA 4X66Q 2GN5A 5IYDG 4B3TL 1VQJA 1BKBA 4EQ5A 1UE7A 1YJNA 1VQ8A 1VQ7A 3PSIA 3PF5A 4B3MQ 1X3FA 3I4MG 3RR5A 5H1SE 1N32L 3A5UA 1WOCA 3M9BA 4A3BH 4HJ7A 3CCSA 5JJLA 4A75A 1K3RA 1SROA 2N3SA 4DR6Q 3J81j 3H0GG 4AH6A 1D8LA 1G6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0O A;  3L7Z C;  1SMX A;  3CMA A;  4DV0 L;  4RG1 A;  3T1Y Q;  2NZO A;  1I50 H;  3T1H L;  4BY1 G;  1PH4 A;  1Z47 A;  1JB7 A;  2UU9 Q;  5JJK A;  1YIT A;  2FXQ A;  4R4O A;  1TWG H;  2A1A A;  1VQ9 A;  1SE8 A;  4IPH A;  3VDY A;  4DNI A;  4JI7 Q;  4DV4 L;  5IYC G;  4JI0 L;  3B6Y A;  4DR7 Q;  4Y7N H;  4JBJ A;  2DUD A;  3HOY H;  3KDF B;  5M3F H;  2F3I A;  1XNR L;  1HH2 P;  5EAY A;  2KCT A;  1V43 A;  4PZ6 A;  2OCE A;  3I56 A;  1HNX Q;  2YTV A;  1UWV A;  3S14 H;  2R6G A;  1VQ4 A;  4HJA A;  4YWK A;  4A3G H;  4A76 A;  1YHA A;  1CSQ A;  4QIW E;  2Y0S E;  3H3V I;  2VNU D;  4J15 A;  1TWH H;  3PO3 G;  3UDI A;  1QUQ B;  2ZM6 Q;  1VQ5 A;  4KI0 A;  2F52 A;  1J5E L;  1UE5 A;  4DV1 Q;  3EIV A;  1S72 A;  4B3T Q;  1D7Q A;  3W1G A;  2RF4 A;  3NEN A;  5FLM H;  4DV5 L;  1PH9 A;  4MNO A;  1XNQ L;  3F2C A;  4JC0 A;  4YWM A;  2RHS B;  4A3C G;  1HR0 L;  3OTO L;  1N32 Q;  1QVC A;  3GO5 A;  4OON A;  1X55 A;  3GTM H;  3STB D;  1HR0 W;  1VQB A;  4JI6 L;  2KHJ A;  4L5T A;  3KYH C;  4A3E H;  1X65 A;  3K7A H;  4NXN L;  1K8G A;  4JI2 L;  3S15 H;  3CW2 C;  3PCO B;  2QEX A;  4GNX B;  1B7Y B;  4BA1 I;  5GAH C;  4DV0 Q;  4L5S A;  3KLW A;  3CXC A;  3T1H Q;  1Y1V H;  2KCM A;  1PH3 A;  2MQH A;  4LWC A;  1ASZ A;  4B3R L;  3S2D H;  1HNW L;  1ASY A;  2CCZ A;  1W3S A;  1WCM G;  2JE6 I;  1X3G A;  4JI5 L;  4DV4 Q;  1CKN B;  5IP9 H;  4JI0 Q;  3A74 A;  2WFW A;  3FP9 A;  1NTG A;  4LF7 L;  3TRE A;  1XNR Q;  3I55 A;  1Q82 C;  4EX5 A;  2BA1 A;  4LW1 A;  4POF A;  1R9T H;  3GTP H;  4IFD J;  2DGY A;  3PUZ A;  3DM3 A;  3H15 A;  1CKM A;  2K52 A;  4GN3 B;  5IWA L;  5IYB G;  1C0A A;  5FLX c;  1JMC A;  2I5H A;  4DPG A;  4LFA L;  1KL9 A;  4A3I G;  1N36 L;  2BH2 A;  5C3E G;  2AHO B;  3FKI G;  3PUY A;  1J5E Q;  4POG A;  2N49 A;  1SN8 A;  3GTO H;  3E9H A;  1Y1W G;  3GTJ H;  1Q81 C;  1OXU A;  1V9P A;  1LM0 A;  3GTQ H;  1IBK L;  4GS3 A;  4HIK A;  4JV5 L;  4DV7 L;  3U4V A;  4DV5 Q;  3RZD H;  1HNZ L;  4DR2 L;  3Q8D A;  1XNQ Q;  1HR0 Q;  2JA9 A;  4QL5 A;  4C3H H;  4AIM A;  3PIO A;  3OTO Q;  4MTN A;  1XTD A;  5FJ8 H;  1GM5 A;  2VUM H;  3I4O A;  5JEA G;  3TS0 A;  1N33 Q;  1N9W A;  3D0F A;  2YTY A;  1M90 C;  4JI6 Q;  2YU9 H;  4LF5 L;  1PYB A;  4GOP C;  4NPS A;  1Q1B A;  4DAY B;  2HT1 A;  4NXN Q;  4JI2 Q;  3KFU A;  1GD7 A;  3MEF A;  4GLA C;  4DR1 L;  4DR3 L;  3CD6 A;  4UP8 A;  3OW2 A;  2JA5 H;  4NB3 A;  2ID0 A;  5GAG C;  1S40 A;  4RMF A;  1XPO A;  5HY6 A;  1NMF A;  3S1N H;  4JG2 A;  2QGQ A;  1KXL A;  1EQR A;  1U0L A;  1E24 A;  3PGZ A;  4B3R Q;  2PI2 A;  1HNW Q;  2Q2T A;  2PQA B;  4A3K H;  2OTL A;  2JJQ A;  3CC4 A;  5K36 G;  2HIX A;  1EFW A;  1AH9 A;  4JI5 Q;  4X65 L;  1L1O A;  1E7Z A;  4P72 A;  4C3I H;  3HKZ G;  2IHF A;  4LF7 Q;  3I2Z A;  3NEM A;  1KRT A;  4A3L H;  5C0X J;  4PZ8 A;  1PHJ A;  4UY8 C;  3U58 A;  4HID A;  2D62 A;  1TXY A;  4QGU A;  5M3F G;  4R4C A;  4L5R C;  2NZH A;  1QZH A;  2UUC L;  4YY3 L;  3TQY A;  3KF8 B;  1G51 A;  1G29 1;  2LXJ A;  1N34 L;  4R4I A;  1VQ6 A;  5IWA Q;  5LMU L;  3EN2 A;  4JBW A;  2WAQ G;  4A3F H;  4LFA Q;  2UUA L;  4A3G G;  1N36 Q;  4AQY L;  1A63 A;  3K80 C;  4LF8 L;  3ERS X;  1YBY A;  4DR4 L;  2KEN A;  5AJ3 L;  2R7F A;  1MIU A;  4APV A;  1IBK Q;  1XPU A;  4JBM A;  4JV5 Q;  3J7Z C;  4DV7 Q;  4AYB G;  1HNZ Q;  4DV6 Q;  5C44 H;  4DR2 Q;  2R92 H;  1AE3 A;  3S1M H;  5IT9 c;  3I4N H;  3K7U C;  1EIF A;  1OXS C;  2EXD A;  1E1O A;  2Z0S A;  4B3S L;  4DK3 C;  1VQI A;  1Z9F A;  1YJ9 A;  2IX1 A;  1VCI A;  2YV5 A;  4LF5 Q;  2VQE L;  4IPD A;  4OX9 L;  4DR3 Q;  1LUZ A;  4DR1 Q;  3HOU H;  1AE2 A;  3IRB A;  3OYY A;  4A3D H;  4KLK A;  4A3E G;  1XJV A;  2JA8 H;  1PH6 A;  1JT8 A;  4BBS H;  1PH5 A;  3HOV H;  1Y14 B;  2UXD L;  2ATW A;  2VL6 A;  1Y1V G;  3D31 A;  1OTC A;  2K5N A;  3I7F A;  2AMC B;  4QJF A;  4X65 Q;  1K83 H;  3A0J A;  4FDB A;  2OQ0 A;  1A8V A;  1VQE A;  3A5Z B;  2BH8 A;  5GRO A;  3UDG A;  1XMO L;  3LGJ A;  1OXV A;  3GTL H;  4LFB Q;  1YNX A;  1VS0 A;  2IT1 A;  2E2J H;  4C3J H;  5IYD H;  1FL0 A;  3GTK H;  2JK8 A;  2UUC Q;  1KAW A;  2VW9 A;  3U50 C;  4BBR G;  4DKA C;  4YY3 Q;  3ULP A;  2XTI A;  1W2B A;  1N34 Q;  3CCM A;  3RZO H;  5LMU Q;  3HOZ G;  2UUA Q;  1N33 L;  4P74 A;  3F1Z A;  4MZ9 A;  2B29 A;  2GVA A;  2WB1 G;  4AQY Q;  2QA4 A;  5IP7 H;  1NBW A;  2Z6K C;  1K73 C;  2LSS A;  4GOP A;  2UUB L;  1B70 B;  2MNA A;  1V1Q A;  4LF8 Q;  4DR4 Q;  2JA7 H;  3GTG H;  1EYG A;  5AJ3 Q;  3BZC A;  2RCN A;  1I6H H;  3HFZ B;  4GN4 B;  4LF6 L;  3E0E A;  1NE3 A;  3NBH B;  1RL2 A;  1MJE A;  2HHH L;  3S24 A;  2ZJP A;  3CCE A;  1IL2 A;  3S17 H;  4IJH A;  1H95 A;  5J3B A;  4BY7 G;  1NJI C;  4B3S Q;  4YCV A;  3G71 A;  3TEH B;  3MXN B;  1P8L A;  3UE0 A;  3JAM c;  1TWC H;  4GKK L;  1S3O A;  2VUM G;  1P16 A;  1RIP A;  5IYC H;  2CWA A;  3DLL A;  2VQE Q;  4OX9 Q;  4DV2 L;  4H02 A;  1I94 L;  2I5M X;  2VQF L;  3UE1 A;  2CWP A;  3RLF A;  3GD7 A;  1L0W A;  2UXD Q;  5HGQ A;  1VQH A;  4JI3 L;  4O0A A;  4A3J G;  3STB C;  2A19 A;  5M3M H;  1VQO A;  4C2M H;  3ICE A;  2GVB A;  3TRZ A;  2D0O A;  5ELN A;  2JEA I;  4IPC A;  2UXB L;  1PH1 A;  4BA2 I;  3ULJ A;  2JEB I;  3J81 c;  1HZC A;  2AWN A;  3RLN A;  3NEL A;  4A4I A;  4OO1 G;  1VQP A;  4WJ3 M;  4YWL A;  1XMO Q;  4DR5 L;  4GKJ L;  1UEB A;  1HJP A;  3TS2 A;  4DAM A;  4P73 A;  4LF4 Q;  4GNX C;  4LFC Q;  1FVI A;  4DV6 L;  3AQQ A;  1EIY B;  1FJG L;  4A93 H;  3HOW H;  4A3C H;  1E22 A;  3KF6 A;  4HIM A;  3FHW A;  4A3F G;  1A62 A;  4ME3 A;  3M7N A;  1YIJ A;  1MKH A;  3AEV A;  2UUB Q;  4A3B G;  4YHH L;  4JI8 L;  3CCV A;  1QZG A;  3PF4 A;  1FGU A;  5GQO A;  1PVO A;  4X6A H;  3F2B A;  2JA6 H;  3GDE A;  4DUY L;  4LF6 Q;  1HZB A;  2CQO A;  2ZTE A;  3ZJY C;  4WJ4 A;  2N78 A;  2IX0 A;  2KHI A;  2HHH Q;  3CPF A;  4OO1 I;  1X3E A;  3CCL A;  1E1T A;  2EIF A;  2WAQ E;  4LNQ A;  1C9O A;  2NVT H;  2K14 A;  4LUO A;  3CCR A;  2R93 H;  2E8G A;  1YJW A;  4GKK Q;  4JI1 L;  3RN5 A;  1WCM H;  4IJL A;  1CUK A;  1UE6 A;  4DV2 Q;  2OQK A;  1I94 Q;  5BR8 L;  3HOY G;  2VQF Q;  4Y52 H;  5C4X H;  1WI5 A;  2B3G A;  3HKS A;  2WP8 J;  3J7A 5;  2YYZ A;  4X64 L;  1BBU A;  1WYD A;  4JI3 Q;  2R7Z H;  4BBS G;  3AYH B;  5LMN L;  4DV3 L;  2PNH A;  1J6Q A;  3BJU A;  2UXC L;  4NXM L;  3E9I A;  3W5O A;  4YCU A;  5LMN W;  3S2H H;  2UXB Q;  3SGI A;  4LUV A;  1E3P A;  2YTX A;  2MO0 A;  3AFQ A;  1MJC A;  4TQU S;  1K8A C;  1WFQ A;  3RN2 A;  1JE5 A;  3CME A;  3S16 H;  2HQL A;  4A3I H;  2BA0 A;  1GVP A;  5C3E H;  4DR5 Q;  1PH7 A;  4GKJ Q;  1BBW A;  4JOI C;  4R4T A;  1C7Y A;  2L15 A;  3JAM i;  1Y1W H;  4L5Q A;  4JBK A;  2B63 H;  3UDF A;  2I5L X;  3RLO A;  3U4Z A;  2E2I H;  3M4O H;  2NVY H;  5FLM G;  4A3M H;  2XGT A;  4XTC S;  3K81 C;  1FJG Q;  2HIV A;  1QVF A;  3BZK A;  4P71 A;  3BU2 A;  4UP7 A;  5C0X G;  1KQS A;  2LXK A;  4DK6 C;  3JC6 6;  2MFI A;  3CAM A;  5GAD C;  4P75 A;  1L1O B;  4BXX H;  3PO2 H;  1X54 A;  4JI4 L;  3CQZ H;  3ULL A;  4JI8 Q;  4YHH Q;  3HOX H;  1QUQ A;  5IP7 G;  3CCU A;  1Q1E A;  3J81 i;  2CKZ B;  4DUY Q;  1X56 A;  1CKO A;  2JA7 G;  1VQC A;  1U5K A;  1QVG A;  4KHP L;  4O2D A;  4PZ7 A;  4ALP A;  1DGS A;  2V1C C;  1T9H A;  1SR3 A;  1N8R C;  2MO1 A;  1IBM L;  3PV0 A;  2KBN A;  1IYJ B;  2WB1 E;  3M4P A;  1LTL A;  3PUW A;  1Q46 A;  2K50 A;  1VQN A;  2VS1 A;  4JI1 Q;  2OTJ A;  2K5V A;  4OWT B;  2K5H A;  1EWI A;  5IP9 G;  4IOC A;  3G4S A;  3HOW G;  5BR8 Q;  1YHQ A;  1VQD A;  5C0X I;  1TWA H;  1PA6 A;  3J80 c;  1HZ9 A;  3K8A A;  1XMQ L;  2E5L L;  2ZJQ A;  1VQA A;  4X64 Q;  4LFC L;  4LF4 L;  2E2H H;  5LMN Q;  2IHE A;  4DV3 Q;  2NN6 G;  4GNX A;  1PFS A;  2N8N A;  2ALY B;  4OXP A;  4NXM Q;  3S1Q H;  2UXC Q;  1PYS B;  2R7D A;  2RHQ B;  5M3M G;  1VQM A;  3I4M H;  1PH2 A;  5M5Y H;  4R1J A;  1SRU A;  4QQB X;  1K0R A;  4DUZ L;  1L1O C;  2ZJR A;  2NVQ H;  2H5X A;  1CKN A;  5ELO A;  1PV4 A;  3H0G H;  3L2P A;  1KHI A;  4GLX A;  2EQS A;  3PUX A;  1IBL L;  3W1B A;  3H3V H;  2AKW B;  2I0Q A;  4TVA B;  3M85 A;  4UPA A;  3CCQ A;  4R4Q A;  4BY1 H;  1IXR A;  4LF9 L;  3KJO A;  2D0P A;  4GN5 A;  4A93 G;  1I3Q H;  1TWF H;  1VQG A;  1YHB A;  3AFP A;  5C4J H;  2ZTC A;  1NY4 A;  1IZ6 A;  1WJJ A;  1KRS A;  5FJ8 G;  2NN6 I;  1OXX K;  4JI4 Q;  4X62 L;  4JYA L;  4OWX B;  2K4K A;  3UDX A;  2Y0S G;  4K0K L;  2VY3 A;  1KC8 C;  1EUJ A;  3EBE A;  4HJ9 A;  2JA5 G;  4KHP Q;  1GKH A;  2JA6 G;  1VQK A;  2VZA A;  2K75 A;  2ASB A;  1GO3 E;  1IBM Q;  1SFO H;  3ER0 A;  3KJP A;  3G6E A;  4A3K G;  1BVS A;  1Q12 A;  1X9N A;  1NMG A;  3PO3 H;  2R93 G;  4JCV E;  4GOP B;  2ES2 A;  1JJ2 A;  2Q2I A;  4UP9 A;  3KOJ A;  2F4V L;  4A3L G;  1XMQ Q;  2E5L Q;  4JOI A;  5M5W H;  5C4X G;  4HIO A;  5JEA J;  4X66 L;  1Q7Y C;  2PI2 E;  2R7Z G;  4XIG S;  2OWO A;  4BBR H;  1L2F A;  1Q8K A;  3HKZ E;  3CF5 A;  1JJC B;  1O7I A;  5GAE C;  4B3M L;  3HOZ H;  1VQF A;  1B8A A;  2PQA A;  4QY7 A;  4IOA A;  4DUZ Q;  3PUV A;  4IFD G;  4PG3 A;  1YI2 A;  3CCJ A;  1YEZ A;  1IBL Q;  1KIX A;  2ZTD A;  4LUZ A;  4DR6 L;  1I5F A;  4LFB L;  2C35 B;  3PIP A;  1VQL A;  2AWO A;  2B63 G;  4GLV B;  2Q2U A;  5C44 G;  3T1Y L;  4A3M G;  3K0X A;  3J80 i;  4LF9 Q;  2R92 G;  1HZA A;  3I4N G;  1A0I A;  2UU9 L;  1PH8 A;  4BY7 H;  3G48 A;  3F8T A;  4IPG A;  1JJG A;  1K9M C;  1LYL A;  4X62 Q;  4JI7 L;  3CC7 A;  4BXX G;  3PO2 G;  2PMZ E;  1YVC A;  4JYA Q;  4AYB E;  3HOX G;  4DR7 L;  4A3D G;  3HOU G;  5M5X H;  4K0K Q;  1UE1 A;  1X6O A;  2JA8 G;  3CPW A;  1XPR A;  4IO9 A;  5DLQ E;  4PMW A;  1KD1 C;  3CC2 A;  1Q86 C;  1CSP A;  3HOV G;  5JJI A;  1YZ6 A;  4KHZ A;  3S1R H;  4IFD I;  4A3J H;  3M4Q A;  5IY0 A;  1HNX L;  2A8V A;  3F2D A;  5E7N A;  3KF6 B;  5IYB H;  5IE8 A;  4HJ5 A;  1OXT A;  2Q2H A;  1M1K C;  4YCW A;  3CP0 A;  1EQQ A;  1SLJ A;  3FKI H;  3WWV A;  2Z6K A;  4HJ8 A;  2ZM6 L;  2F4V Q;  3KDF A;  1EOV A;  2IY5 B;  2NVX H;  3RNU A;  2JQO A;  4DV1 L;  3M3Y H;  4OWW B;  2CFM A;  4X66 Q;  2GN5 A;  5IYD G;  4B3T L;  1VQJ A;  1BKB A;  4EQ5 A;  1UE7 A;  1YJN A;  1VQ8 A;  1VQ7 A;  3PSI A;  3PF5 A;  4B3M Q;  1X3F A;  3I4M G;  3RR5 A;  5H1S E;  1N32 L;  3A5U A;  1WOC A;  3M9B A;  4A3B H;  4HJ7 A;  3CCS A;  5JJL A;  4A75 A;  1K3R A;  1SRO A;  2N3S A;  4DR6 Q;  3J81 j;  3H0G G;  4AH6 A;  1D8L A;  1G6P A; 
#chains in the Genus database with same CATH topology
 4OIK A;  4IAL A;  3T1H L;  5IGD A;  4BY1 G;  1JB7 A;  1MD2 D;  4K5W A;  4R4O A;  4DU9 A;  4DV4 L;  5IYC G;  3B6Y A;  5CV5 A;  4Y7N H;  2DUD A;  2E2J B;  4C3J B;  3KDF B;  3GTK B;  4MIU A;  5M3F H;  2OCE A;  2KOL A;  2L11 A;  5FO8 B;  2R6G A;  1VQ4 A;  1JWU D;  5EGT A;  4HJA A;  4FF3 A;  4A76 A;  4LAA A;  1UE5 A;  4DV1 Q;  4MTK A;  3MAQ A;  3FDT A;  3S17 B;  1SMY D;  2HCC A;  5FLM H;  4DV5 L;  3GV3 A;  3F2C A;  1HR0 L;  3GO5 A;  1D2B A;  4ID6 A;  1JCK B;  2KHJ A;  4A3E H;  3K5O A;  4K8I A;  4JI2 L;  1K8G A;  3S15 H;  1WTQ A;  1ICW A;  5IGB A;  5D3D A;  4GNX B;  4FF4 A;  1PXU A;  2PZU A;  4CJ2 C;  1Y1V H;  2KCM A;  4LWC A;  1ASZ A;  4B3R L;  1BCP C;  3K59 A;  2OXP A;  1EU4 A;  4QF4 A;  1WCM G;  2CW0 D;  4JI5 L;  2IX3 A;  4JI0 Q;  2Z6B A;  5IP9 H;  3A74 A;  5COR A;  2VB3 X;  2R61 A;  4LF7 L;  1F2L A;  3I55 A;  1Q82 C;  4C3H B;  4EX5 A;  2BA1 A;  4QMG A;  4LW1 A;  1R9T H;  4KKU A;  3DM3 A;  3N52 A;  5IWA L;  3A55 A;  5FLX c;  2JA5 B;  1KL9 A;  4A3I G;  3T56 B;  2NB0 A;  3HGB A;  3Q23 A;  2L4N A;  3GTO H;  3E9H A;  1Y1W G;  2KA7 A;  2EVB A;  4A3K B;  3GTQ H;  1IBK L;  1EWH A;  4JV5 L;  3SK5 A;  1HA5 A;  4NDX A;  4QL5 A;  3OTO Q;  3PIO A;  1GUS A;  4G7Z C;  1N9W A;  1BBX C;  4LF5 L;  1JOO A;  3KFU A;  3CD6 A;  3VR5 A;  1O78 A;  3OW2 A;  1EY7 A;  4HCE A;  1V1O A;  1S40 A;  1F9Q A;  4M8A A;  5HY6 A;  3V05 A;  3S1N H;  3J7Y W;  2O5J C;  2EYJ A;  3PGZ A;  1HNW Q;  2PI2 A;  1NNX A;  2Z1C A;  5FKA C;  4BS9 A;  1PRT D;  2OTL A;  1LT5 D;  1EFW A;  1GJX A;  3NTK A;  4OO1 H;  1L1O A;  4C3I H;  3LX0 A;  4P72 A;  2IW3 A;  1CA6 A;  1SEB D;  2B63 B;  1KRT A;  3TP8 A;  5C44 B;  5C0X J;  2R92 B;  4PMC A;  2B2U C;  3DWP A;  2D62 A;  4QGU A;  4R4C A;  4KY5 A;  1CT1 D;  1G2T A;  1TR5 A;  1B3Q A;  3KF8 B;  4R9W A;  1VQ6 A;  3CQZ B;  1SNO A;  4R4I A;  4A3G G;  2L5T A;  4IUV A;  4EGV A;  4AQY L;  1SYE A;  5J22 A;  3K80 C;  2K05 A;  4DR4 L;  1VF5 C;  2AQ3 B;  2JSO A;  1W6K A;  4QB4 A;  4JBM A;  1JB3 A;  2M9V A;  1HNZ Q;  1PTO H;  1CI3 M;  3ND9 A;  3I4N H;  1I4R A;  4B3S L;  3I90 A;  1VQI A;  1Z9F A;  3MTS A;  2IX1 A;  1TWA B;  5LHY 1;  2VQE L;  1KDC A;  4DR1 Q;  4A3D H;  3HOU H;  1AE2 A;  4KLK A;  2JA8 H;  5BN4 A;  4C1N K;  2QDL A;  2C9O A;  3KLR A;  4M1U B;  5JPM C;  1WTP A;  4QJF A;  2QF7 A;  2JA7 B;  4FDB A;  3A0J A;  1KNA A;  1I4G A;  2BH8 A;  3UDG A;  5G3L D;  3LGJ A;  3C3L A;  4IZ8 A;  2IT1 A;  1YNJ D;  1XXG A;  2JK8 A;  2UUC Q;  2VW9 A;  3VR4 A;  1EYA A;  4B9W A;  1EQT A;  3D6C A;  1F2Z A;  4FVM A;  4YY3 Q;  5A2Q E;  5LMU Q;  2UUA Q;  3F1Z A;  3HZX A;  2B29 A;  4RCN A;  1K73 C;  2DY8 A;  2DJG C;  5JVG 3;  3BZC A;  1BCP D;  4LF6 L;  1MJE A;  2ZJP A;  5E4W C;  5J3B A;  2Q8R E;  3UE0 A;  4ZRZ A;  1S3O A;  2VUM G;  4H02 A;  2I5M X;  1TS5 A;  1S5F D;  1L0W A;  1C4Q A;  4JI3 L;  3ICE A;  3DWA A;  1VQO A;  4IPC A;  3ULJ A;  5KYL A;  2F0L A;  1VQP A;  5CBE E;  1H9M A;  4DR5 L;  3ERQ A;  1IW7 D;  2DNE A;  4DAM A;  1LT3 D;  4P73 A;  1FVI A;  3BZD B;  4H7B A;  1FJG L;  1ENF A;  3HOW H;  4A3C H;  2H4O A;  4OEM B;  3KF6 A;  1VF7 A;  3SHL A;  4MHE A;  4ME3 A;  4QUF A;  4A3B G;  4H13 C;  1Y8N B;  4JI8 L;  1XTC D;  1FGU A;  5GQO A;  1JOQ A;  4FF1 A;  4ILW A;  3ITP A;  3Q0A A;  2A6E C;  2KHI A;  1PFN A;  3MHB A;  3RUZ A;  2EIF A;  2NVT H;  3BS1 A;  4FXD A;  3FKI B;  3CCR A;  1YJW A;  4JI1 L;  3X3N A;  5EPK A;  2KCC A;  3R93 A;  4DV2 Q;  4Y52 H;  4C56 C;  1WI5 A;  2XWB B;  2WP8 J;  2D2C C;  2R7Z H;  4BBS G;  3AYH B;  4DV3 L;  1J6Q A;  2AQ2 B;  1EY0 A;  4NXM L;  3S2H H;  5LMN W;  2UXB Q;  4ZLT F;  4QCL A;  4KN4 C;  2MO0 A;  3U9S A;  3EFX D;  3S16 H;  2HQL A;  3IL8 A;  1K3B C;  3N6R A;  4GKJ Q;  1PFB A;  4R4T A;  1II3 A;  2G5D A;  2L15 A;  2ENB A;  3I73 A;  2KEC A;  4OGQ C;  2E2I H;  3M4O H;  2NVY H;  4C3J G;  2XGT A;  4UAI A;  2CQA A;  1EZ6 A;  1F77 A;  3HKZ B;  5C0X G;  2LXK A;  1BUV T;  4Y7N B;  4BXX H;  2EPB A;  3ULL A;  5HGT A;  4DAP A;  2BCO A;  3I4M B;  2E2D C;  1LTS D;  1WD1 A;  4CKC A;  3KK7 A;  2A69 D;  4ALP A;  2V1C C;  1DOL A;  1SNQ A;  1SR3 A;  4CJ1 B;  2KBN A;  5JAV A;  3M4P A;  1TKW B;  3PUW A;  3NP8 A;  2K5V A;  1EWI A;  3G4S A;  1YHQ A;  5C0X I;  1PA6 A;  3K8A A;  3OOC A;  1XMQ L;  4X64 Q;  3WOE A;  2E2H H;  2F03 A;  1I3Q B;  1PFS A;  2N8N A;  2ALY B;  5I4D A;  1PYS B;  1PH2 A;  4R1J A;  4FP5 D;  2K5D A;  4QQB X;  2Z8L A;  5IGC A;  1K0R A;  5KNB A;  4DUZ L;  3OWF A;  1CKN A;  5ELO A;  2EYO A;  4WOR A;  3D4W A;  3L2P A;  2EQS A;  3PUX A;  4JPB W;  2AKW B;  3M85 A;  3QIA A;  1HRJ A;  4GN5 A;  2B39 A;  4C3H G;  3CCM A;  1BDO A;  3AFP A;  4IUN A;  5C4J H;  3AEV A;  1WJJ A;  3P20 A;  1EYC A;  3ERO A;  4BBR B;  2VY3 A;  2JA5 G;  4HJ9 A;  4PV1 C;  4G4K A;  1SFO H;  2ZXR A;  3ER0 A;  4A3K G;  3PO3 H;  4GOP B;  2F0G A;  1ZYR C;  3BVG A;  4NKL A;  4UP9 A;  3GTQ B;  5IGF A;  3VYT A;  2E5L Q;  5FOB B;  1STG A;  1Q7Y C;  4L63 B;  2PI2 E;  1IKM A;  1PZJ D;  3CF5 A;  2EY5 A;  3HOZ H;  4QY7 A;  4JK1 C;  3H6M A;  1HUN A;  2A6E D;  1F2M A;  1YI2 A;  3CCJ A;  5C4Z A;  1IBL Q;  3S1N B;  3NWT A;  4N9T A;  1I5F A;  3PIP A;  2AWO A;  2B63 G;  4GLV B;  2I07 B;  5C44 G;  4A3M G;  2R92 G;  3D4R A;  1HZA A;  4BY7 H;  2UU9 L;  1PH8 A;  2EYM A;  4IPG A;  1K9M C;  1LYL A;  3WOF A;  2PMZ E;  1YVC A;  4JYA Q;  4K5X A;  5KIX A;  1XPR A;  5DLQ E;  1F9P A;  1CHQ D;  1CSP A;  3VYU A;  4KHZ A;  3TP5 A;  3S1R H;  2H1E A;  3M4Q A;  5IY0 A;  5ISR A;  3F2D A;  1FR3 A;  4TSS A;  5IYB H;  1HTL D;  1JIC A;  4YCW A;  1Q8I A;  2EDG A;  4RKL A;  2Z6K A;  1J9O A;  2ZM6 L;  1RD9 D;  1HQR D;  2NVX H;  1I50 B;  3RNU A;  1PTO B;  4Z9C B;  4X66 Q;  2F1M A;  2GN5 A;  1BKB A;  2D9U A;  1YJN A;  4CDD C;  1VQ7 A;  5JEA H;  3HOY B;  1WOC A;  4HJ7 A;  5ELB A;  3CCS A;  4KD4 A;  5JJL A;  2ICI A;  4Q0F A;  3S9W A;  1A6X A;  1HFN A;  4DR6 Q;  5GRO A;  4LFB Q;  4IPH A;  1AN8 A;  3VDY A;  3Q22 A;  4EQN A;  1SMX A;  1R4P B;  4HSP A;  2RDH A;  3C46 A;  1Z47 A;  2JN4 A;  3MA2 B;  4EQO A;  2FXQ A;  1TWG H;  2R3Z A;  1SE8 A;  4KY7 A;  2BDN A;  1D1K A;  3OWE B;  1HFG A;  3SK6 A;  3JAM L;  4JBJ A;  2XIW A;  3V2T A;  1XNR L;  1CQF A;  4FNF A;  3I56 A;  2A68 C;  2KCT A;  5CV4 A;  5EKL A;  3NBH A;  3GTM B;  1V1P B;  1FNV A;  2HCI A;  4YWK A;  4QIW E;  1BNZ A;  2OF1 A;  2Y0S E;  4J15 A;  3MXN A;  1CM9 A;  1TWH H;  3UDI A;  3VR6 A;  3TME A;  1DM0 B;  2K01 A;  1TQO A;  3ONA B;  1TY2 A;  1D7Q A;  3S2D B;  1ROD A;  4KKT A;  2EYL A;  4JC0 A;  4YWM A;  5A35 A;  4OON A;  3J7A F;  3STB D;  2HUG A;  1ML0 D;  1QCB D;  4L5T A;  3CRL C;  1X65 A;  5CGK A;  3MFY A;  3GTP B;  3PCO B;  1ZXT A;  3DEO A;  2QEX A;  3J81 E;  4BA1 I;  4L5S A;  3DUZ A;  3KLW A;  4X3T A;  4JW0 A;  3T1H Q;  2ICE C;  1H9R A;  2IL8 A;  5EKK A;  5J39 A;  4DV4 Q;  2F0H A;  3PQI A;  1S5B D;  1QE6 A;  4KMU C;  3P7J A;  2NN6 H;  3HOW B;  2VUM B;  2F0W A;  5FO9 B;  2OT2 A;  1UAP A;  2YU9 B;  3H15 A;  3F2U A;  4GN3 B;  1JMC A;  1N36 L;  3FKI G;  3OIQ A;  4POG A;  2N49 A;  3GTJ H;  2O2L D;  2G9D A;  3R2T A;  2NVT B;  4HIK A;  2E75 C;  4DV7 L;  4DV5 Q;  4I7A A;  2O5I C;  1HPC A;  1HR0 Q;  4AIM A;  1TT2 A;  3I4O A;  3D0F A;  3QOJ A;  3UI2 A;  3VYS A;  1Q1B A;  1C48 A;  4JI2 Q;  5E3F A;  2R7Z B;  1XPO A;  3PMF A;  3C2P A;  1NMF A;  4CJ0 B;  1U0L A;  1E24 A;  2K5Q A;  4B3R Q;  2PQA B;  2KQ3 A;  3CC4 A;  1KTK A;  3FPU B;  4JI5 Q;  2MJ8 A;  1E7Z A;  3HKZ G;  2IHF A;  4LF7 Q;  3M4O B;  2NVY B;  3U58 A;  5M3F G;  4L5R C;  3J80 L;  1IKL A;  1QZH A;  3QG1 A;  1VDZ A;  4FXK C;  2LXJ A;  5IOD A;  1N34 L;  1G6Z A;  5L37 A;  5IWA Q;  1R4Q B;  4A3F H;  1ZKO A;  4O1N A;  4IFD H;  3HOV B;  3IAY A;  4LF8 L;  2R7F A;  1IBK Q;  1XPU A;  4JV5 Q;  3J7Z C;  4AYB G;  1ONL A;  2XVS A;  5CV8 A;  3S1M H;  1EY5 A;  2EXD A;  1RKN A;  1E1O A;  4DK3 C;  2QKI C;  2YV5 A;  4LF5 Q;  5EBC A;  1LTG D;  4IPD A;  3OYY A;  3BDL A;  4A3E G;  2J4X A;  4OEL B;  4K5V A;  1JT8 A;  3RZO B;  3U9O A;  2BE5 C;  1WTW A;  2UXD L;  5KND A;  2ATW A;  2VL6 A;  1Y1V G;  3D31 A;  3SEB A;  3TDQ A;  1Y69 U;  2K5N A;  1OTC A;  3I7F A;  2AMC B;  1XWE A;  3MXP A;  3GTG B;  1K83 H;  1I6H B;  5G3L F;  2OQ0 A;  1VQE A;  2BDO A;  1OXV A;  3GTL H;  1YNX A;  1VS0 A;  1A3T A;  2FIN B;  2EE1 A;  4X3U A;  4BBR G;  4DA2 A;  2F0O A;  3R3O A;  1SNC A;  4AQY Q;  2RSN A;  2QA4 A;  1NBW A;  1I4Q A;  1B2T A;  2LSS A;  1BCP F;  1B70 B;  1H9S A;  2KJX A;  2AQ1 B;  4DR4 Q;  2QDB A;  2RCN A;  3MVV A;  4GN4 B;  4GZY C;  5EQ0 A;  3E0E A;  1SSO A;  2HHH L;  3DWQ A;  4RFB A;  1IL2 A;  4I7Z C;  3PO3 B;  3A8J E;  4B3S Q;  4YCV A;  3G71 A;  3JAM c;  1TWC H;  4GKK L;  2WIN B;  4RGN A;  1P16 A;  1RIP A;  3DXJ C;  5IYC H;  2VQE Q;  3UE1 A;  1MGS A;  3RLF A;  2B2U A;  2A19 A;  4C2M H;  2GVB A;  4ZK9 B;  2FFK B;  3BG3 A;  4EQP A;  1KAA A;  3NEL A;  4OO1 G;  3NBI A;  3I72 A;  4IUU A;  1D5M C;  2LKV A;  1HJP A;  5E1F A;  4GNX C;  5IGG A;  4RA8 A;  1EWC A;  4A93 H;  1H9K A;  2F0J A;  1V8Q A;  4V19 0;  1FYC A;  4HIM A;  1ET9 A;  3WDN A;  1A62 A;  1YIJ A;  3CCV A;  3AMU A;  3OMG A;  3S1R B;  3H09 A;  2JA6 H;  4DUY L;  2E74 C;  4LF6 Q;  2ZTE A;  4WJ4 A;  2K6A A;  2N78 A;  2IX0 A;  4OO1 I;  2XWJ B;  1D5Z C;  2MP1 A;  3CCL A;  2LS0 1;  2BOS A;  5C3E B;  1DD2 A;  1HHV A;  2PZT A;  2R93 H;  1SE3 A;  2E8G A;  3R8B A;  4KK7 A;  1WCM H;  1EU3 A;  2FMM A;  3VYR A;  1EY4 A;  4A3M B;  3HEJ A;  3HOY G;  1U9R A;  3EJI A;  1BBU A;  1RTN A;  1WYD A;  4JI3 Q;  2KVM A;  3RMH A;  5LMN L;  1SYD A;  3R2I A;  3DM1 A;  3MFG A;  1PZK D;  4LUV A;  1E3P A;  1QWY A;  2F0P A;  1K8A C;  5DEH A;  1DJR D;  1WFQ A;  4A3I H;  2BA0 A;  2AUJ D;  4DR5 Q;  1PH7 A;  4DFA A;  1BBW A;  4JOI C;  1Y1W H;  4L5Q A;  4JBK A;  2HQE A;  1DXM A;  2K03 A;  1FJG Q;  2EJG C;  1TWG B;  2DY7 A;  4UP7 A;  2RVL A;  1KQS A;  3JC6 6;  2NZ1 D;  2MFI A;  5GAD C;  4P75 A;  1L1O B;  4JI4 L;  4JI8 Q;  1DOM A;  1QUQ A;  4ME5 A;  3J81 i;  1X56 A;  5AFW A;  1QNU A;  1QOH A;  4O2D A;  2F0E A;  4HMI A;  4PZ7 A;  5I6W A;  2WAQ B;  1IBM L;  1E2Z A;  1LT6 D;  2NVQ B;  4RKB A;  2K50 A;  5KRU A;  4JI1 Q;  1K28 A;  2F0N A;  4RAU C;  2F4I A;  4ABN A;  4IOC A;  1VQD A;  4X3K A;  3J80 c;  4FXG C;  4DV3 Q;  2IHE A;  2A74 C;  3OPO A;  4OXP A;  1RDP D;  4NXM Q;  3S1Q H;  2R7D A;  2F3W A;  4RWS C;  2WII B;  4K8J A;  1L1O C;  5J1Z A;  2H5X A;  1PV4 A;  3H0G H;  4GLX A;  4Q5V A;  1IYV A;  5JPN C;  3H3V H;  1HUM A;  1O7L A;  2I0Q A;  5EPJ A;  3GP7 A;  3E3X A;  3OW7 A;  3CCQ A;  4R4Q A;  4LF9 L;  2J7Z A;  2PZW A;  3KJO A;  1TWF H;  1YHB A;  1Q81 C;  3HOW G;  2ZTC A;  1NY4 A;  3MEH A;  5FJ8 G;  1OXX K;  4X62 L;  2KEE A;  2D5D A;  3UDX A;  2K1B A;  5CYU A;  2L55 A;  4G7O C;  2K7V A;  1EUJ A;  3EBE A;  1A3U A;  1VQK A;  5FLX E;  5JJZ A;  4K2K A;  4KY6 A;  2K75 A;  1GO3 E;  4K6D A;  2MGS A;  2B8G A;  2WB1 B;  4OL7 A;  3TP7 A;  1SYG A;  3DHQ A;  3P1H A;  2WAC A;  3GTJ B;  4XXE A;  2ES2 A;  5D3I B;  4DAY A;  1CQV A;  2F0F A;  1XMQ Q;  5DNF A;  4A3L G;  5M5W H;  1PLF A;  1B9N A;  4HIO A;  5JEA J;  5JVH 3;  1A15 A;  1Y8P B;  2R7Z G;  3QOL A;  4XIG S;  1NAP A;  3W3A A;  1KDA A;  3OMC A;  1E2V A;  3KBG A;  4HSV A;  4DUZ Q;  4N9P A;  1SJH D;  4ZQ3 A;  4A3J B;  1KIX A;  4XQJ A;  2NYZ D;  4IUR A;  1VQL A;  5CBA E;  2Q2U A;  3T1Y L;  1FNW A;  1TS3 A;  1XYI A;  4JI7 L;  3CC7 A;  3M3Y B;  4BXX G;  4DK0 A;  5I2X A;  3NUC A;  4DR7 L;  5CV7 A;  1QIL A;  5M5X H;  3MZ5 A;  4XYQ A;  3EQL C;  3CPW A;  4IO9 A;  3HOV G;  1BXT A;  1ILP A;  1HNX L;  2A8V A;  4A3F B;  1CFM A;  2FMC A;  3G6J B;  3KF6 B;  1OXT A;  3PIP 3;  3LWE A;  3CP0 A;  1EQQ A;  3NE5 B;  4HJ8 A;  1MHW C;  3K5M A;  4KKS A;  2SDF A;  4RH6 A;  2JQO A;  4B3T L;  5IYD G;  1NUC A;  4G7H C;  1QB5 D;  3HRZ C;  1VQ8 A;  2LMC B;  3PSI A;  3RR5 A;  3K0Y A;  5H1S E;  5CV6 A;  1N32 L;  5M3F B;  1AFP A;  4CDE C;  4A3B H;  4A75 A;  1K3R A;  4IN3 A;  4KD3 A;  3J81 j;  4AH6 A;  1D8L A;  5COY A;  3L0O A;  3L7Z C;  3CMA A;  3M7G A;  4DV0 L;  5K5P A;  2NZO A;  3NTI A;  1LLR D;  3IKJ A;  2UU9 Q;  5K36 H;  5FK9 C;  1I4H A;  3EA6 A;  3I3C A;  1VQ9 A;  1PDQ A;  4DNI A;  1F2Y A;  4AYB B;  1O7Z A;  3TSS A;  5CV9 A;  3NWS A;  1HH2 P;  5C3W A;  1HA6 A;  2QW7 A;  2A73 B;  4PZ6 A;  5EAY A;  1UWV A;  5E4X A;  3W2D A;  3S14 H;  1JR0 D;  4J1M A;  5C4H A;  2Z4I A;  4NMZ A;  5CC4 A;  4A3E B;  2EJF C;  3S15 B;  1UUP A;  2JXM B;  2VNU D;  2X69 A;  1B3A A;  3PO3 G;  1VQ5 A;  2ZM6 Q;  2F0D A;  1J5E L;  2IJ0 A;  1Y1V B;  2B2V A;  3EIV A;  1S72 A;  3QR8 A;  5ELE A;  3W1G A;  1SDF A;  3L9A X;  3URY A;  1PH9 A;  4KHV A;  1XNQ L;  4QUC A;  2RA4 A;  3A8K E;  1QVC A;  1VMP A;  4JI6 L;  1SAP A;  3KYH C;  2K5W A;  4NXN L;  3K7A H;  1R9T B;  1G91 A;  5LL6 X;  1B7Y B;  5GAH C;  5NUC A;  1IL8 A;  3CXC A;  4FF2 A;  3NQI A;  2MQH A;  2DN8 A;  1G2S A;  1ASY A;  2CCZ A;  3GTO B;  1D6E C;  1X3G A;  1CKN B;  5IIF A;  1JOR A;  3FP9 A;  1NTG A;  3MC0 B;  1XNR Q;  2IPK D;  3SR1 A;  5I9O A;  4A93 B;  1GXD C;  1DZ1 A;  3BDC A;  2SNM A;  4CDC C;  4IFD J;  3PUZ A;  5I6Y A;  1BF4 A;  2K52 A;  5IYB G;  1C0A A;  3TN2 A;  4LFA L;  2JA6 B;  5C3E G;  1JC7 A;  3PUY A;  1KLG D;  1SN8 A;  1OXU A;  1LM0 A;  3T16 A;  2HD3 A;  3RZD H;  2R93 B;  4DR2 L;  3Q8D A;  4C3I B;  2JA9 A;  4C3H H;  4MTN A;  1XTD A;  5JEA G;  3TS0 A;  1N33 Q;  2YTY A;  4GOP C;  2RSO A;  2HT1 A;  2MHV A;  4GLA C;  4S3S A;  4DR3 L;  2SEB D;  4XQQ A;  2JA5 H;  5GAG C;  4RMF A;  1K0S A;  1BQQ T;  3A8I E;  1MI2 A;  3T13 A;  1AH9 A;  4A3K H;  2JJQ A;  2RDG A;  2HIX A;  1SJE D;  2NBF A;  4X65 L;  4KJN A;  2EYP A;  4B08 A;  1EL0 A;  1SE4 A;  1PHJ A;  4UY8 C;  3I4N B;  4ZUI A;  2NUC A;  2NZH A;  3C1F A;  2XRQ D;  3D3R A;  2HDL A;  2EXZ A;  4H0L C;  1G29 1;  4A3D B;  1E2W A;  3HOU B;  3EN2 A;  4JBW A;  2WAQ G;  4CKB A;  2FHT A;  2JA8 B;  1N36 Q;  1QNK A;  1GUN A;  1A63 A;  1Z7T A;  4DXG A;  2PNR C;  1LTR D;  4YIJ A;  5AJ3 L;  1MIU A;  4DV7 Q;  5C44 H;  1SXT A;  3VA5 A;  2R92 H;  1AE3 A;  5IT9 c;  3K7U C;  1EIF A;  1OXS C;  1HQM C;  2XN9 C;  1STH A;  1YJ9 A;  4XT1 B;  3T4A C;  4XYO A;  4OX9 L;  4XDX A;  3IRB A;  1XJV A;  1NSN S;  1PTO C;  1CA5 A;  1U4P A;  1JE4 A;  1MSH A;  4ZAI A;  3CHB D;  2K04 A;  3H0G B;  4CHT B;  1MSG A;  2ZXP A;  1A8V A;  1TVX A;  1XMO L;  3MWY W;  3V96 A;  1BR9 A;  1KAW A;  1TS2 A;  3U50 C;  4DKA C;  3HG9 A;  1N34 Q;  3K5N A;  3SK4 A;  1N33 L;  4P74 A;  3MXG A;  1ET6 A;  2WB1 G;  3ND8 A;  2ZXO A;  2Z6K C;  5IP7 H;  2UUB L;  4LF8 Q;  4RGO S;  2MNA A;  2JA7 H;  3K58 A;  4H44 C;  1JQY D;  1EZ8 A;  3NBH B;  1RL2 A;  2E76 C;  1ZYR D;  1SND A;  3M4Y A;  4CBV A;  1LTI D;  1NCV A;  4IJH A;  1S5D D;  1M8A A;  2F0I A;  1NJI C;  3MXN B;  1P8L A;  1RF2 D;  1CHP D;  3Q24 A;  2CWA A;  2K28 A;  1I94 L;  2MPM A;  4EVO A;  2VQF L;  2CWP A;  3GD7 A;  2UXD Q;  5HGQ A;  4O0A A;  2PYK A;  4A3J G;  1Z6H A;  4PMB A;  5M3M H;  2D0O A;  4ZKB B;  4R8N A;  2V4D A;  4BA2 I;  2JEB I;  1HZC A;  2AWN A;  4RGT A;  4WJ3 M;  1HXY D;  1UEB A;  2B2T C;  4DGZ A;  3TS2 A;  3I4L A;  2EYF A;  4LF4 Q;  2OEO A;  3AQQ A;  1EIY B;  2QCP X;  3IFT A;  1AZQ A;  2KED A;  1U4M A;  4OIJ A;  3FHW A;  2Q8I B;  4A3F G;  3GQB A;  3M7N A;  1MKH A;  4YHH L;  1PVO A;  4CGY B;  3PF4 A;  4X6A H;  1PRT B;  1U4R A;  3F2B A;  1HZB A;  3S2H B;  1DON A;  3GV6 A;  3ZJY C;  2HHH Q;  3CPF A;  1X3E A;  4LNQ A;  1E1T A;  1C9O A;  3S16 B;  1JWS D;  1EIH A;  4GKK Q;  3RN5 A;  4IJL A;  4IQZ A;  1CUK A;  2B2W C;  2XNA C;  2E2I B;  3PIO 3;  5BR8 L;  1C8C A;  5C4X H;  2B3G A;  2RKS A;  3J7A 5;  2YYZ A;  2G9H D;  2PNH A;  2UXC L;  2RBM A;  4DK1 A;  3CKI B;  3E9I A;  3W5O A;  4YCU A;  3AFQ A;  3CU7 A;  4TQU S;  2LFN A;  2Z4H A;  1JE5 A;  3CME A;  2B8F A;  5EJW A;  3BYT B;  1SNM A;  1TII D;  4L6T B;  1C7Y A;  1PRT C;  2L0C A;  1WTH A;  2I5L X;  3RLO A;  3U4Z A;  5FLM G;  1B4O A;  3K81 C;  1T5E A;  3BU2 A;  4DK6 C;  3CAM A;  2A68 D;  4OHJ A;  3PO2 H;  3FMC A;  1PTO D;  4HMJ A;  1RTO A;  3HOX H;  4PNY A;  2E2H B;  3CCU A;  1KAB A;  4DUY Q;  1VQC A;  1QVG A;  4KHP L;  3S14 B;  5ELF A;  1DGS A;  2QIL A;  1T9H A;  1RCV D;  1LTB D;  1STA A;  1STN A;  3PV0 A;  5TSS A;  1IYJ B;  5LL6 S;  3QJY A;  1VQN A;  2VS1 A;  2OTJ A;  4HCS A;  4OWT B;  2K5H A;  2WKC A;  5IP9 G;  5T1G A;  1EIG A;  3K57 A;  1HZ9 A;  3I70 A;  4LF4 L;  1Q3L A;  5LMN Q;  5C4J B;  4DNR B;  1PZI D;  4GNX A;  1D5X C;  1U4L A;  2RHQ B;  3I4M H;  1BCP B;  4XT3 B;  5M5Y H;  3K7A B;  4LMQ D;  4MN3 A;  3NHH A;  4WJW A;  2ZJR A;  1K8O A;  4J8Q A;  2EY1 A;  1SFO B;  1EY6 A;  4HTH A;  4NW2 A;  4TVA B;  3E6Z X;  2M00 A;  4IUP A;  2B2Y C;  4BY1 H;  1IXR A;  2D0P A;  4A93 G;  1I3Q H;  1FGB D;  4TRD A;  2RCF A;  1KRS A;  4PQX A;  4JI4 Q;  1YNJ C;  2K4K A;  2QEJ C;  3TBI B;  4XQN A;  4K0K L;  1KC8 C;  1EYD A;  2JA6 G;  1ENC A;  2DNC A;  3HOZ B;  1JWM D;  1IBM Q;  4ZUJ A;  3KJP A;  1NMG A;  2R93 G;  4C3I G;  1H9S B;  2Q2I A;  2F4V L;  3KOJ A;  4JOI A;  3RZD B;  4BY7 B;  2VXW A;  1X32 A;  5I2Y A;  2OWO A;  4BBR H;  1Q8K A;  1WTO A;  1JJC B;  1O7I A;  5GAE C;  3K6O A;  4B3M L;  1EEF D;  1LV9 A;  3PUV A;  5F2D A;  1B9M A;  1I6V C;  1YEZ A;  2ZTD A;  1EY8 A;  4LUZ A;  1GHJ A;  3FEW X;  4HAE A;  4N8X 1;  4LF9 Q;  2PW5 A;  3K0X A;  1DCZ A;  3L3O C;  3NTH A;  3I4N G;  1A0I A;  1GUW A;  2KUM A;  1IW7 C;  3KF8 A;  4CDF C;  3DEP A;  4X62 Q;  2NVX B;  2A6H C;  1A2U A;  4P2C B;  1UEA B;  3D8G A;  5C5L A;  4A3D G;  3HOU G;  1K8M A;  3FRP B;  2JA8 G;  3BVZ A;  4PMW A;  3NSW A;  1LO5 D;  3SE0 A;  5E7N A;  1M1K C;  1IHZ A;  3NQT A;  1SLJ A;  2EOT A;  3WWV A;  2IY5 B;  4DV1 L;  4OWW B;  2CFM A;  4BWG B;  2WKD A;  1UE7 A;  3A7A B;  5C3X A;  2PW7 A;  3PF5 A;  1X3F A;  5FO7 B;  3A5U A;  2BE5 D;  5BN3 A;  4O42 A;  5M9O A;  1SRO A;  1TY0 A;  4KTA A;  1TS4 A;  2EYH A;  3H0G G;  1G6P A;  4RG1 A;  2M2L A;  1S4Z A;  3T1Y Q;  1I50 H;  1TWH B;  1PH4 A;  3HP3 A;  5JJK A;  4B9X A;  1YIT A;  4RHR A;  3X3M A;  2A1A A;  4JI7 Q;  4KV6 A;  3VR3 A;  2PMZ B;  1STY A;  2L9H A;  1EEI D;  2PQE A;  3O13 A;  4JI0 L;  4DR7 Q;  3HOY H;  2F3I A;  3OIP A;  1V43 A;  2SOB A;  1HNX Q;  1WVL A;  3A54 A;  2YTV A;  5IOC A;  1CZW A;  4A3G H;  1YHA A;  1CSQ A;  4FYD A;  5I9P A;  3H3V I;  2A5H A;  1LTA D;  1S5C D;  1QUQ B;  3J81 L;  2A69 C;  2X6G A;  4KI0 A;  2F52 A;  5KGU A;  2N55 A;  4B3T Q;  2DJF C;  3JAM E;  2RF4 A;  3E5S A;  3NEN A;  1SYB A;  3SXH A;  4DNT B;  2XSC A;  4MNO A;  4DAV A;  2RHS B;  3SK8 A;  2GA4 B;  4A3C G;  2K33 A;  3OTO L;  1N32 Q;  4DF7 A;  1X55 A;  3GTM H;  3QO2 A;  4UDU C;  1VQB A;  1HR0 W;  2VB2 X;  4K6L A;  4ODG A;  2NTS A;  3CW2 C;  5M3M B;  4DV0 Q;  2CH4 A;  2F0K A;  1PH3 A;  1HNW L;  3S2D H;  2F0V A;  4G57 A;  1W3S A;  2JE6 I;  3H94 A;  2SNS A;  1YNN C;  4WFN 3;  2WFW A;  1FNU A;  5KYI A;  3TRE A;  3A7L A;  4R8I A;  2TMP A;  1F9R A;  2NWG A;  2FJ2 A;  4POF A;  3GTP H;  2DGY A;  1BOS A;  1CTM A;  4QIW B;  1CKM A;  2Y0S B;  3T51 B;  2F0T A;  2I5H A;  4DPG A;  2BH2 A;  1A3V A;  1B1Z A;  2AHO B;  4N8F A;  1J5E Q;  1OO9 B;  1BO0 A;  1V9P A;  2RQX A;  3CRK C;  4F87 A;  4GS3 A;  2A6H D;  3U4V A;  1HNZ L;  1XNQ Q;  4JVZ A;  1GM5 A;  5IT9 L;  5FJ8 H;  2VUM H;  5EPL A;  1M90 C;  4JI6 Q;  3LWU A;  2YU9 H;  5C4X B;  1F9S A;  1PYB A;  4NPS A;  4DAY B;  4NXN Q;  1QJO A;  1ESR A;  1GD7 A;  3MEF A;  4DR1 L;  4UP8 A;  4NB3 A;  2ID0 A;  2X6L A;  4JG2 A;  1PFM A;  2QGQ A;  1KXL A;  1GUT A;  1EQR A;  1SYF A;  2Q2T A;  1GUG A;  5K36 G;  3Q6S A;  1EY9 A;  1O7Y A;  2EZV A;  3TZU A;  3I2Z A;  3NEM A;  2RDF A;  4A3L H;  4PZ8 A;  3S1M B;  4HID A;  1TXY A;  1QG7 A;  2UUC L;  3PO2 B;  4YY3 L;  1B44 D;  3TQY A;  1EQV A;  1G51 A;  4FO2 A;  3HOX B;  2PO4 A;  4F88 A;  5LMU L;  2UUA L;  4LFA Q;  3ERS X;  1YBY A;  4I65 A;  2KEN A;  1Q90 A;  3BYY B;  4APV A;  1CK1 A;  4L8J A;  4IUQ A;  4DV6 Q;  4DR2 Q;  1K83 B;  1SYC A;  2IWH A;  2KHS A;  3J80 E;  2F0Q A;  2Z0S A;  3GTL B;  1GUO A;  1VCI A;  4HN7 A;  4DR3 Q;  1LUZ A;  1GOZ A;  5CMD A;  1PH6 A;  2LY7 A;  4BBS H;  5D65 A;  1PH5 A;  3HOV H;  1Y14 B;  3I91 A;  2CH4 W;  4RHS A;  2JYO A;  1GHK A;  3KUP A;  5M5Y B;  2Q8T A;  1NR4 A;  1I4X A;  4X65 Q;  3A5Z B;  2F0M A;  1AP0 A;  1AZP A;  4ULL A;  4BY1 B;  3AU7 A;  2E2J H;  4C3J H;  5IYD H;  1FL0 A;  3GTK H;  1WTR A;  1TWC B;  5C0X H;  3ULP A;  2XTI A;  1W2B A;  1G8Z D;  3RZO H;  3HOZ G;  4E6I A;  2C5C A;  3FVQ A;  1L0Y B;  4HED A;  4DXF A;  4MZ9 A;  2GVA A;  1NR2 A;  4GOP A;  5ELD A;  1V1Q A;  3GTG H;  1EYG A;  5AJ3 Q;  4C2M B;  1I6H H;  3HFZ B;  1PMR A;  1NE3 A;  1LTT D;  1EOT A;  3S24 A;  3CCE A;  3S17 H;  1H95 A;  1YNN D;  1MBY A;  4BY7 G;  1ESF A;  3TEH B;  2HDM A;  3DLL A;  4ZCK A;  3P75 A;  4OX9 Q;  4DV2 L;  1LAC A;  1RJT A;  1VMC A;  4C1N I;  3FPP A;  1EFI D;  3KBX A;  3OSO A;  1VQH A;  1LT4 D;  3STB C;  4F7X A;  2F0U A;  3TRZ A;  2MUY A;  5HUR A;  1FD7 D;  5ELN A;  2JEA I;  2UXB L;  1PH1 A;  5DAU A;  3J81 c;  4DN4 M;  4A4I A;  3RLN A;  1IYU A;  4U68 A;  5DM7 3;  4YWL A;  1XMO Q;  4GKJ L;  1STE A;  5KNC A;  4LFC Q;  1PYW D;  4DV6 L;  1S5E D;  3HS0 C;  1WCM B;  5EBD A;  1E22 A;  3NK9 A;  4RCO A;  5JOB A;  2UUB Q;  4K14 A;  1QZG A;  4J6H A;  4ZKC B;  1E0B A;  3GDE A;  5D14 A;  2B2V C;  3KLS A;  2CQO A;  2AUK A;  2WAQ E;  2EY6 A;  4A3I B;  2EJM A;  4F8M A;  2K14 A;  2F0S A;  4LUO A;  1STB A;  1Y1W B;  1D1I A;  1UE6 A;  2OQK A;  2P5Z X;  1I94 Q;  2VQF Q;  4LJZ C;  3HKS A;  1KLU D;  4X64 L;  3C1E A;  2PCF B;  1ZEQ X;  3BJU A;  2NTT A;  5CR3 A;  3SGI A;  4U67 3;  2EY2 A;  2YTX A;  1JOK A;  1MJC A;  3RN2 A;  4TKO B;  1GVP A;  5C3E H;  2F3V A;  1AW7 A;  3JAM i;  3TP6 A;  2B63 H;  3UDF A;  2PPB C;  4A3M H;  1ENA A;  3KLS X;  4XTC S;  2HIV A;  1QVF A;  3BZK A;  4P71 A;  1V1P A;  1PTO F;  5KEE A;  3BDO A;  5BN5 A;  1X54 A;  3CQZ H;  4YHH Q;  1ICF B;  5IP7 G;  2Z9H A;  1Q1E A;  5A2Q L;  2CKZ B;  3S1Q B;  1CKO A;  2TSS A;  2JA7 G;  1U5K A;  1I4P A;  4RGM A;  2N88 A;  3E0J A;  4A3G B;  3IFD A;  1N8R C;  2MO1 A;  1A2T A;  1DOK A;  2WB1 E;  1LTL A;  1Q46 A;  3RD4 A;  4WRD A;  4KN7 C;  4NP5 A;  1TU2 B;  5BR8 Q;  4UHV A;  1TWA H;  2B2T A;  2E5L L;  2ZJQ A;  1VQA A;  2CHB D;  4LFC L;  2KCN A;  1TWF B;  3D4D A;  2CVR A;  2NN6 G;  3EVQ A;  3I8Z A;  2ZT9 C;  2UXC Q;  5M3M G;  3NXW A;  1RHP A;  1VQM A;  1ILQ A;  1LAB A;  2O4X A;  1SRU A;  1O80 A;  2NVQ H;  5C5M A;  3TZD A;  5FLX L;  1KHI A;  1IBL L;  3W1B A;  3T53 B;  1Y8O B;  4UPA A;  2J0T D;  1T5X D;  5ELC A;  3SDZ A;  1VQG A;  1SNP A;  1SMY C;  1IZ6 A;  2NN6 I;  5M5W B;  1HTP A;  1M4V A;  4JYA L;  4OWX B;  2B2W A;  3H3V C;  2Y0S G;  4KHP Q;  5C6A A;  1GKH A;  1WTX A;  4V0B A;  1UNS A;  2JP1 A;  2VZA A;  3VR2 A;  4K2L A;  2ASB A;  2I46 A;  1WTV A;  5EKI A;  3G6E A;  3AB9 A;  1BVS A;  1Q12 A;  1X9N A;  3VA7 A;  1B50 A;  4JCV E;  4X3S A;  1KNE A;  3J7A V;  1JJ2 A;  2WV6 D;  4CKE A;  4IUT A;  3QWN A;  5C4X G;  2CW0 C;  4X66 L;  3LNN A;  1L2F A;  3HKZ E;  3OHX C;  5M5X B;  1VQF A;  1B8A A;  2PQA A;  4IOA A;  1X3Q A;  4IFD G;  4PG3 A;  1H9J A;  3DMU A;  4DR6 L;  1KDB A;  4LFB L;  2C35 B;  1DYQ A;  1B53 A;  3J80 i;  1X3P A;  3SVM A;  3G48 A;  3F8T A;  1HCZ A;  1JJG A;  1CZG A;  5IGE A;  3PO2 G;  5DM6 3;  4AYB E;  3HOX G;  1XX8 A;  4KJO A;  4K0K Q;  3A56 A;  1UE1 A;  1X6O A;  3ZYY X;  2XRS D;  2L1B A;  3CC2 A;  3NPP A;  1KD1 C;  1Q86 C;  5JJI A;  1YZ6 A;  4IFD I;  4A3J H;  4A3B B;  1PRT F;  4HJ5 A;  5IE8 A;  2Q2H A;  4HR7 B;  1L0X B;  2L12 A;  3QB3 A;  3FKI H;  1SE2 A;  3H91 A;  3G7L A;  2F4V Q;  1W6J A;  3K5L A;  3KDF A;  1EOV A;  5IT9 E;  3M3Y H;  5T1I A;  1VQJ A;  4EQ5 A;  2B2Y A;  1J8I A;  4B3M Q;  3D6W A;  3BVM A;  3I4M G;  4ZYS A;  1SBB B;  3M9B A;  3MXU A;  1WD0 A;  1AEX A;  2K32 A;  4BBS B;  2N3S A;  4LK1 C; 
#chains in the Genus database with same CATH homology
 3L0O A;  3L7Z C;  1SMX A;  3CMA A;  4DV0 L;  4RG1 A;  3T1Y Q;  2NZO A;  1I50 H;  3T1H L;  4BY1 G;  1PH4 A;  1Z47 A;  1JB7 A;  2UU9 Q;  5JJK A;  1YIT A;  2FXQ A;  4R4O A;  1TWG H;  2A1A A;  1VQ9 A;  1SE8 A;  4IPH A;  3VDY A;  4DNI A;  4JI7 Q;  4DV4 L;  5IYC G;  4JI0 L;  3B6Y A;  4DR7 Q;  4Y7N H;  4JBJ A;  2DUD A;  3HOY H;  3KDF B;  5M3F H;  2F3I A;  1XNR L;  1HH2 P;  5EAY A;  2KCT A;  1V43 A;  4PZ6 A;  2OCE A;  3I56 A;  1HNX Q;  2YTV A;  1UWV A;  3S14 H;  2R6G A;  1VQ4 A;  4HJA A;  4YWK A;  4A3G H;  4A76 A;  1YHA A;  1CSQ A;  4QIW E;  2Y0S E;  3H3V I;  2VNU D;  4J15 A;  1TWH H;  3PO3 G;  3UDI A;  1QUQ B;  2ZM6 Q;  1VQ5 A;  4KI0 A;  2F52 A;  1J5E L;  1UE5 A;  4DV1 Q;  3EIV A;  1S72 A;  4B3T Q;  1D7Q A;  3W1G A;  2RF4 A;  3NEN A;  5FLM H;  4DV5 L;  1PH9 A;  4MNO A;  1XNQ L;  3F2C A;  4JC0 A;  4YWM A;  2RHS B;  4A3C G;  1HR0 L;  3OTO L;  1N32 Q;  1QVC A;  3GO5 A;  4OON A;  1X55 A;  3GTM H;  3STB D;  1HR0 W;  1VQB A;  4JI6 L;  2KHJ A;  4L5T A;  3KYH C;  4A3E H;  1X65 A;  3K7A H;  4NXN L;  1K8G A;  4JI2 L;  3S15 H;  3CW2 C;  3PCO B;  2QEX A;  4GNX B;  1B7Y B;  4BA1 I;  5GAH C;  4DV0 Q;  4L5S A;  3KLW A;  3CXC A;  3T1H Q;  1Y1V H;  2KCM A;  1PH3 A;  2MQH A;  4LWC A;  1ASZ A;  4B3R L;  3S2D H;  1HNW L;  1ASY A;  2CCZ A;  1W3S A;  1WCM G;  2JE6 I;  1X3G A;  4JI5 L;  4DV4 Q;  1CKN B;  5IP9 H;  4JI0 Q;  3A74 A;  2WFW A;  3FP9 A;  1NTG A;  4LF7 L;  3TRE A;  1XNR Q;  3I55 A;  1Q82 C;  4EX5 A;  2BA1 A;  4LW1 A;  4POF A;  1R9T H;  3GTP H;  4IFD J;  2DGY A;  3PUZ A;  3DM3 A;  3H15 A;  1CKM A;  2K52 A;  4GN3 B;  5IWA L;  5IYB G;  1C0A A;  5FLX c;  1JMC A;  2I5H A;  4DPG A;  4LFA L;  1KL9 A;  4A3I G;  1N36 L;  2BH2 A;  5C3E G;  2AHO B;  3FKI G;  3PUY A;  1J5E Q;  4POG A;  2N49 A;  1SN8 A;  3GTO H;  3E9H A;  1Y1W G;  3GTJ H;  1Q81 C;  1OXU A;  1V9P A;  1LM0 A;  3GTQ H;  1IBK L;  4GS3 A;  4HIK A;  4JV5 L;  4DV7 L;  3U4V A;  4DV5 Q;  3RZD H;  1HNZ L;  4DR2 L;  3Q8D A;  1XNQ Q;  1HR0 Q;  2JA9 A;  4QL5 A;  4C3H H;  4AIM A;  3PIO A;  3OTO Q;  4MTN A;  1XTD A;  5FJ8 H;  1GM5 A;  2VUM H;  3I4O A;  5JEA G;  3TS0 A;  1N33 Q;  1N9W A;  3D0F A;  2YTY A;  1M90 C;  4JI6 Q;  2YU9 H;  4LF5 L;  1PYB A;  4GOP C;  4NPS A;  1Q1B A;  4DAY B;  2HT1 A;  4NXN Q;  4JI2 Q;  3KFU A;  1GD7 A;  3MEF A;  4GLA C;  4DR1 L;  4DR3 L;  3CD6 A;  4UP8 A;  3OW2 A;  2JA5 H;  4NB3 A;  2ID0 A;  5GAG C;  1S40 A;  4RMF A;  1XPO A;  5HY6 A;  1NMF A;  3S1N H;  4JG2 A;  2QGQ A;  1KXL A;  1EQR A;  1U0L A;  1E24 A;  3PGZ A;  4B3R Q;  2PI2 A;  1HNW Q;  2Q2T A;  2PQA B;  4A3K H;  2OTL A;  2JJQ A;  3CC4 A;  5K36 G;  2HIX A;  1EFW A;  1AH9 A;  4JI5 Q;  4X65 L;  1L1O A;  1E7Z A;  4P72 A;  4C3I H;  3HKZ G;  2IHF A;  4LF7 Q;  3I2Z A;  3NEM A;  1KRT A;  4A3L H;  5C0X J;  4PZ8 A;  1PHJ A;  4UY8 C;  3U58 A;  4HID A;  2D62 A;  1TXY A;  4QGU A;  5M3F G;  4R4C A;  4L5R C;  2NZH A;  1QZH A;  2UUC L;  4YY3 L;  3TQY A;  3KF8 B;  1G51 A;  1G29 1;  2LXJ A;  1N34 L;  4R4I A;  1VQ6 A;  5IWA Q;  5LMU L;  3EN2 A;  4JBW A;  2WAQ G;  4A3F H;  4LFA Q;  2UUA L;  4A3G G;  1N36 Q;  4AQY L;  1A63 A;  3K80 C;  4LF8 L;  3ERS X;  1YBY A;  4DR4 L;  2KEN A;  5AJ3 L;  2R7F A;  1MIU A;  4APV A;  1IBK Q;  1XPU A;  4JBM A;  4JV5 Q;  3J7Z C;  4DV7 Q;  4AYB G;  1HNZ Q;  4DV6 Q;  5C44 H;  4DR2 Q;  2R92 H;  1AE3 A;  3S1M H;  5IT9 c;  3I4N H;  3K7U C;  1EIF A;  1OXS C;  2EXD A;  1E1O A;  2Z0S A;  4B3S L;  4DK3 C;  1VQI A;  1Z9F A;  1YJ9 A;  2IX1 A;  1VCI A;  2YV5 A;  4LF5 Q;  2VQE L;  4IPD A;  4OX9 L;  4DR3 Q;  1LUZ A;  4DR1 Q;  3HOU H;  1AE2 A;  3IRB A;  3OYY A;  4A3D H;  4KLK A;  4A3E G;  1XJV A;  2JA8 H;  1PH6 A;  1JT8 A;  4BBS H;  1PH5 A;  3HOV H;  1Y14 B;  2UXD L;  2ATW A;  2VL6 A;  1Y1V G;  3D31 A;  1OTC A;  2K5N A;  3I7F A;  2AMC B;  4QJF A;  4X65 Q;  1K83 H;  3A0J A;  4FDB A;  2OQ0 A;  1A8V A;  1VQE A;  3A5Z B;  2BH8 A;  5GRO A;  3UDG A;  1XMO L;  3LGJ A;  1OXV A;  3GTL H;  4LFB Q;  1YNX A;  1VS0 A;  2IT1 A;  2E2J H;  4C3J H;  5IYD H;  1FL0 A;  3GTK H;  2JK8 A;  2UUC Q;  1KAW A;  2VW9 A;  3U50 C;  4BBR G;  4DKA C;  4YY3 Q;  3ULP A;  2XTI A;  1W2B A;  1N34 Q;  3CCM A;  3RZO H;  5LMU Q;  3HOZ G;  2UUA Q;  1N33 L;  4P74 A;  3F1Z A;  4MZ9 A;  2B29 A;  2GVA A;  2WB1 G;  4AQY Q;  2QA4 A;  5IP7 H;  1NBW A;  2Z6K C;  1K73 C;  2LSS A;  4GOP A;  2UUB L;  1B70 B;  2MNA A;  1V1Q A;  4LF8 Q;  4DR4 Q;  2JA7 H;  3GTG H;  1EYG A;  5AJ3 Q;  3BZC A;  2RCN A;  1I6H H;  3HFZ B;  4GN4 B;  4LF6 L;  3E0E A;  1NE3 A;  3NBH B;  1RL2 A;  1MJE A;  2HHH L;  3S24 A;  2ZJP A;  3CCE A;  1IL2 A;  3S17 H;  4IJH A;  1H95 A;  5J3B A;  4BY7 G;  1NJI C;  4B3S Q;  4YCV A;  3G71 A;  3TEH B;  3MXN B;  1P8L A;  3UE0 A;  3JAM c;  1TWC H;  4GKK L;  1S3O A;  2VUM G;  1P16 A;  1RIP A;  5IYC H;  2CWA A;  3DLL A;  2VQE Q;  4OX9 Q;  4DV2 L;  4H02 A;  1I94 L;  2I5M X;  2VQF L;  3UE1 A;  2CWP A;  3RLF A;  3GD7 A;  1L0W A;  2UXD Q;  5HGQ A;  1VQH A;  4JI3 L;  4O0A A;  4A3J G;  3STB C;  2A19 A;  5M3M H;  1VQO A;  4C2M H;  3ICE A;  2GVB A;  3TRZ A;  2D0O A;  5ELN A;  2JEA I;  4IPC A;  2UXB L;  1PH1 A;  4BA2 I;  3ULJ A;  2JEB I;  3J81 c;  1HZC A;  2AWN A;  3RLN A;  3NEL A;  4A4I A;  4OO1 G;  1VQP A;  4WJ3 M;  4YWL A;  1XMO Q;  4DR5 L;  4GKJ L;  1UEB A;  1HJP A;  3TS2 A;  4DAM A;  4P73 A;  4LF4 Q;  4GNX C;  4LFC Q;  1FVI A;  4DV6 L;  3AQQ A;  1EIY B;  1FJG L;  4A93 H;  3HOW H;  4A3C H;  1E22 A;  3KF6 A;  4HIM A;  3FHW A;  4A3F G;  1A62 A;  4ME3 A;  3M7N A;  1YIJ A;  1MKH A;  3AEV A;  2UUB Q;  4A3B G;  4YHH L;  4JI8 L;  3CCV A;  1QZG A;  3PF4 A;  1FGU A;  5GQO A;  1PVO A;  4X6A H;  3F2B A;  2JA6 H;  3GDE A;  4DUY L;  4LF6 Q;  1HZB A;  2CQO A;  2ZTE A;  3ZJY C;  4WJ4 A;  2N78 A;  2IX0 A;  2KHI A;  2HHH Q;  3CPF A;  4OO1 I;  1X3E A;  3CCL A;  1E1T A;  2EIF A;  2WAQ E;  4LNQ A;  1C9O A;  2NVT H;  2K14 A;  4LUO A;  3CCR A;  2R93 H;  2E8G A;  1YJW A;  4GKK Q;  4JI1 L;  3RN5 A;  1WCM H;  4IJL A;  1CUK A;  1UE6 A;  4DV2 Q;  2OQK A;  1I94 Q;  5BR8 L;  3HOY G;  2VQF Q;  4Y52 H;  5C4X H;  1WI5 A;  2B3G A;  3HKS A;  2WP8 J;  3J7A 5;  2YYZ A;  4X64 L;  1BBU A;  1WYD A;  4JI3 Q;  2R7Z H;  4BBS G;  3AYH B;  5LMN L;  4DV3 L;  2PNH A;  1J6Q A;  3BJU A;  2UXC L;  4NXM L;  3E9I A;  3W5O A;  4YCU A;  5LMN W;  3S2H H;  2UXB Q;  3SGI A;  4LUV A;  1E3P A;  2YTX A;  2MO0 A;  3AFQ A;  1MJC A;  4TQU S;  1K8A C;  1WFQ A;  3RN2 A;  1JE5 A;  3CME A;  3S16 H;  2HQL A;  4A3I H;  2BA0 A;  1GVP A;  5C3E H;  4DR5 Q;  1PH7 A;  4GKJ Q;  1BBW A;  4JOI C;  4R4T A;  1C7Y A;  2L15 A;  3JAM i;  1Y1W H;  4L5Q A;  4JBK A;  2B63 H;  3UDF A;  2I5L X;  3RLO A;  3U4Z A;  2E2I H;  3M4O H;  2NVY H;  5FLM G;  4A3M H;  2XGT A;  4XTC S;  3K81 C;  1FJG Q;  2HIV A;  1QVF A;  3BZK A;  4P71 A;  3BU2 A;  4UP7 A;  5C0X G;  1KQS A;  2LXK A;  4DK6 C;  3JC6 6;  2MFI A;  3CAM A;  5GAD C;  4P75 A;  1L1O B;  4BXX H;  3PO2 H;  1X54 A;  4JI4 L;  3CQZ H;  3ULL A;  4JI8 Q;  4YHH Q;  3HOX H;  1QUQ A;  5IP7 G;  3CCU A;  1Q1E A;  3J81 i;  2CKZ B;  4DUY Q;  1X56 A;  1CKO A;  2JA7 G;  1VQC A;  1U5K A;  1QVG A;  4KHP L;  4O2D A;  4PZ7 A;  4ALP A;  1DGS A;  2V1C C;  1T9H A;  1SR3 A;  1N8R C;  2MO1 A;  1IBM L;  3PV0 A;  2KBN A;  1IYJ B;  2WB1 E;  3M4P A;  1LTL A;  3PUW A;  1Q46 A;  2K50 A;  1VQN A;  2VS1 A;  4JI1 Q;  2OTJ A;  2K5V A;  4OWT B;  2K5H A;  1EWI A;  5IP9 G;  4IOC A;  3G4S A;  3HOW G;  5BR8 Q;  1YHQ A;  1VQD A;  5C0X I;  1TWA H;  1PA6 A;  3J80 c;  1HZ9 A;  3K8A A;  1XMQ L;  2E5L L;  2ZJQ A;  1VQA A;  4X64 Q;  4LFC L;  4LF4 L;  2E2H H;  5LMN Q;  2IHE A;  4DV3 Q;  2NN6 G;  4GNX A;  1PFS A;  2N8N A;  2ALY B;  4OXP A;  4NXM Q;  3S1Q H;  2UXC Q;  1PYS B;  2R7D A;  2RHQ B;  5M3M G;  1VQM A;  3I4M H;  1PH2 A;  5M5Y H;  4R1J A;  1SRU A;  4QQB X;  1K0R A;  4DUZ L;  1L1O C;  2ZJR A;  2NVQ H;  2H5X A;  1CKN A;  5ELO A;  1PV4 A;  3H0G H;  3L2P A;  1KHI A;  4GLX A;  2EQS A;  3PUX A;  1IBL L;  3W1B A;  3H3V H;  2AKW B;  2I0Q A;  4TVA B;  3M85 A;  4UPA A;  3CCQ A;  4R4Q A;  4BY1 H;  1IXR A;  4LF9 L;  3KJO A;  2D0P A;  4GN5 A;  4A93 G;  1I3Q H;  1TWF H;  1VQG A;  1YHB A;  3AFP A;  5C4J H;  2ZTC A;  1NY4 A;  1IZ6 A;  1WJJ A;  1KRS A;  5FJ8 G;  2NN6 I;  1OXX K;  4JI4 Q;  4X62 L;  4JYA L;  4OWX B;  2K4K A;  3UDX A;  2Y0S G;  4K0K L;  2VY3 A;  1KC8 C;  1EUJ A;  3EBE A;  4HJ9 A;  2JA5 G;  4KHP Q;  1GKH A;  2JA6 G;  1VQK A;  2VZA A;  2K75 A;  2ASB A;  1GO3 E;  1IBM Q;  1SFO H;  3ER0 A;  3KJP A;  3G6E A;  4A3K G;  1BVS A;  1Q12 A;  1X9N A;  1NMG A;  3PO3 H;  2R93 G;  4JCV E;  4GOP B;  2ES2 A;  1JJ2 A;  2Q2I A;  4UP9 A;  3KOJ A;  2F4V L;  4A3L G;  1XMQ Q;  2E5L Q;  4JOI A;  5M5W H;  5C4X G;  4HIO A;  5JEA J;  4X66 L;  1Q7Y C;  2PI2 E;  2R7Z G;  4XIG S;  2OWO A;  4BBR H;  1L2F A;  1Q8K A;  3HKZ E;  3CF5 A;  1JJC B;  1O7I A;  5GAE C;  4B3M L;  3HOZ H;  1VQF A;  1B8A A;  2PQA A;  4QY7 A;  4IOA A;  4DUZ Q;  3PUV A;  4IFD G;  4PG3 A;  1YI2 A;  3CCJ A;  1YEZ A;  1IBL Q;  1KIX A;  2ZTD A;  4LUZ A;  4DR6 L;  1I5F A;  4LFB L;  2C35 B;  3PIP A;  1VQL A;  2AWO A;  2B63 G;  4GLV B;  2Q2U A;  5C44 G;  3T1Y L;  4A3M G;  3K0X A;  3J80 i;  4LF9 Q;  2R92 G;  1HZA A;  3I4N G;  1A0I A;  2UU9 L;  1PH8 A;  4BY7 H;  3G48 A;  3F8T A;  4IPG A;  1JJG A;  1K9M C;  1LYL A;  4X62 Q;  4JI7 L;  3CC7 A;  4BXX G;  3PO2 G;  2PMZ E;  1YVC A;  4JYA Q;  4AYB E;  3HOX G;  4DR7 L;  4A3D G;  3HOU G;  5M5X H;  4K0K Q;  1UE1 A;  1X6O A;  2JA8 G;  3CPW A;  1XPR A;  4IO9 A;  5DLQ E;  4PMW A;  1KD1 C;  3CC2 A;  1Q86 C;  1CSP A;  3HOV G;  5JJI A;  1YZ6 A;  4KHZ A;  3S1R H;  4IFD I;  4A3J H;  3M4Q A;  5IY0 A;  1HNX L;  2A8V A;  3F2D A;  5E7N A;  3KF6 B;  5IYB H;  5IE8 A;  4HJ5 A;  1OXT A;  2Q2H A;  1M1K C;  4YCW A;  3CP0 A;  1EQQ A;  1SLJ A;  3FKI H;  3WWV A;  2Z6K A;  4HJ8 A;  2ZM6 L;  2F4V Q;  3KDF A;  1EOV A;  2IY5 B;  2NVX H;  3RNU A;  2JQO A;  4DV1 L;  3M3Y H;  4OWW B;  2CFM A;  4X66 Q;  2GN5 A;  5IYD G;  4B3T L;  1VQJ A;  1BKB A;  4EQ5 A;  1UE7 A;  1YJN A;  1VQ8 A;  1VQ7 A;  3PSI A;  3PF5 A;  4B3M Q;  1X3F A;  3I4M G;  3RR5 A;  5H1S E;  1N32 L;  3A5U A;  1WOC A;  3M9B A;  4A3B H;  4HJ7 A;  3CCS A;  5JJL A;  4A75 A;  1K3R A;  1SRO A;  2N3S A;  4DR6 Q;  3J81 j;  3H0G G;  4AH6 A;  1D8L A;  1G6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...