4F7XA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/l25a at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f7xA00
1F2MA 1STNA 1A3TA 5ISRA 4ZQ3A 3C1EA 4KTAA 3RUZA 4K2LA 3BDCA 4HTHA 1ENCA 5I6WA 5IOCA 4WORA 1TR5A 1KDCA 2PZWA 2SOBA 4KHVA 5C5MA 1STBA 3C1FA 3R3OA 5CV9A 1EY6A 4NDXA 4OL7A 3T13A 2F0DA 5C6AA 2EYMA 4B9XA 5CV5A 4E6IA 5IGDA 2QDBA 2F0QA 2F0GA 1A3UA 2EYLA 5C5LA 2F0LA 4ODGA 5I6YA 5CR3A 3MVVA 4N9TA 5IGEA 4ID6A 2F0PA 3D4WA 4DGZA 1SNMA 3QOLA 5KIXA 1TQOA 2F3WA 1EZ8A 2EXZA 1KAAA 2F0SA 2RDFA 4KY7A 4KY6A 4R8NA 5EGTA 5JOBA 4DF7A 1NUCA 4RKLA 2F0VA 1KDBA 1JOKA 5C3XA 2F0TA 2EYPA 4KV6A 3S9WA 4EQOA 2F0IA 2F0WA 5C4HA 1EY8A 2PW5A 3OWFA 4QF4A 4K5XA 1AEXA 2OF1A 4ME5A 3SK5A 2EYJA 3TMEA 4KD3A 2WACA 1EY7A 1SNPA 4K5VA 4K8JA 1SYDA 4WRDA 4G57A 5IIFA 1EY0A 3MZ5A 5CV7A 2EYOA 4DU9A 4F8MA 3D6CA 1IHZA 4K2KA 1SNDA 4ZUJA 4K5WA 4EQNA 5I9OA 3V2TA 2F0OA 1F2YA 4MIUA 2F0KA 1KDAA 3QB3A 3NQTA 5HURA 4B9WA 2O4XA 4NMZA 5I9PA 2EY2A 1SNCA 2EYFA 2KQ3A 3PMFA 5C3WA 3TP6A 1JOOA 4IALA 5CC4A 5KYLA 5CV8A 4RKBA 1NSNS 2EY5A 3P75A 1A3VA 5J1ZA 4KD4A 5NUCA 5EKLA 1SYCA 1JOQA 5KEEA 5CV4A 3MXPA 1STGA 3MEHA 3NK9A 5K5PA 1SYGA 2PYKA 4N9PA 3NXWA 5IGFA 4K8IA 1STAA 1RKNA 1SYFA 3LX0A 3NP8A 5F2DA 1ENAA 2F0NA 2SNMA 2RBMA 2PZTA 5C4ZA 4NKLA 1II3A 3E5SA 2SNSA 3SHLA 1EYDA 1EYAA 1EQVA 3DMUA 3MHBA 5M9OA 2F0JA 3NUCA 4KJOA 1JORA 2OEOA 1SNQA 1SYEA 4HMIA 2KHSA 3HEJA 5CV6A 3OMCA 4QMGA 4ZUIA 4KY5A 1F2ZA 3EROA 5EKKA 4YIJA 2F0EA 4S3SA 3DHQA 3SK6A 4TRDA 1KABA 1EY5A 2OXPA 3NHHA 1A2TA 3BDLA 3U9OA 1TT2A 3SK4A 4EVOA 2EY6A 2PW7A 4IUNA 3SR1A 5IGBA 3SXHA 3SK8A 4J6HA 3TP7A 2PQEA 3OMGA 4H7BA 5DAUA 5CGKA 4F7XA 4KJNA 4IZ8A 4I65A 1SNOA 4LAAA 4DFAA 4EQPA 5J39A 4PMBA 3P1HA 5IGGA 2M00A 5DEHA 1SYBA 4PNYA 5J22A 2RKSA 1STHA 4K6DA 2HQEA 3T16A 4QB4A 1A2UA 5KGUA 5IGCA 4PMCA 5KYIA 2EYHA 2F0UA 3D8GA 2F0MA 2NUCA 1EY9A 2PZUA 3ERQA 1EY4A 3EVQA 4K14A 2F0FA 3D4DA 2F0HA 3TP8A 3H6MA 5HGTA 3EJIA 1EYCA 4HMJA 1STYA 2ENBA 3QOJA 5E1FA 3OSOA 2EY1A 4NP5A 5JAVA 5KRUA 4J1MA 3VA5A 5IODA 1EZ6A 2LKVA 3HZXA 1U9RA 5E3FA 2F3VA 3ITPA 3TP5A
chains in the Genus database with same CATH superfamily
1F2MA 1HFGA 4DR6L 1ML0D 4KI0A 3GTGB 3CCVA 2VUMH 4BY7B 4DPGA 2JXMB 1KDCA 2K75A 2PZWA 3J81i 3S14B 1STBA 3R3OA 4IURA 3C2PA 3L0OA 1EEFD 2XWBB 4LF6Q 2R93H 5M5YH 2WAQE 2JK8A 2K03A 1PFMA 3RR5A 3K57A 1X55A 2QEJC 5C5LA 5I6YA 3T51B 2A68C 3T56B 1X6OA 3P7JA 4FVMA 5IE8A 3TREA 2J7ZA 1KL9A 5EPJA 4B3TQ 1SR3A 3MXUA 5C4XG 2LXKA 3U58A 1CZGA 5CMDA 3QWNA 1EWCA 3CCJA 1BO0A 2Z0SA 1EU3A 3PIOA 4GN4B 2KEEA 2UXCQ 2JA6G 1SNPA 1HJPA 4F8MA 1ASYA 1IHZA 1WD1A 1SNDA 4AYBB 4IPCA 2JA8G 2F0KA 4XDXA 3NQTA 4B9WA 4JI6L 1FNVA 1E24A 2CQOA 4KHPL 1TS5A 1MHWC 1PH1A 1NCVA 3K0XA 2BH2A 4DV0Q 3K7UC 2BE5C 2R7FA 2ICEC 2XNAC 2R92G 2B2UA 2ZXPA 2Z6BA 1IBLL 1JJ2A 2UU9Q 1WFQA 1TWAB 2WAQB 3KF8B 1I4PA 4LUVA 1RDPD 2RBMA 3HOYG 4Y7NH 5M3FH 5BN5A 1K8OA 4K6LA 4QGUA 5M9OA 1ILPA 1QJOA 2F0JA 4L63B 1X54A 3KLRA 1GJXA 2F1MA 4ALPA 3FPPA 2IX1A 4RGTA 3HS0C 4APVA 3NHHA 3G48A 1A2TA 1S4ZA 5G3LF 1WTXA 4IUNA 1RODA 3B6YA 1WTWA 4X62L 4BBSG 2AQ3B 3J7A5 4DV2Q 4IZ8A 1B3QA 1SNOA 1I3QB 1V1PB 2MJ8A 3U9SA 3BJUA 2P5ZX 2RKSA 3FDTA 4K6DA 2NWGA 4LW1A 5IT9L 4C3IH 3KF8A 5BR8L 3S2HB 3OW7A 1EY4A 2K5NA 2N3SA 3EJIA 5E1FA 3K7AB 3TEHB 3VA5A 1WTQA 1IL8A 2E75C 3PO2G 2L9HA 4DUZL 1UE1A 1VQGA 3E3XA 1XTDA 4NDXA 1K0SA 1G6PA 1TXYA 1B7YB 2B63B 4ILWA 5IGDA 4ODGA 1V1PA 5CR3A 3MVVA 2K5VA 4A3JH 1JCKB 1HZ9A 3QOLA 3S16H 3GTQB 1EZ8A 5IP7H 4R8NA 3TSSA 1GXDC 2EJGC 2ZM6Q 3OHXC 1BBXC 5C4HA 2MP1A 1S5DD 3EIVA 2VQEQ 3SK5A 2BH8A 4C1NI 2A5HA 2VY3A 2UUAQ 3GTJH 4HIKA 1ET9A 1Z6HA 2ZTEA 1IYUA 1PFBA 1F2YA 5HURA 3CAMA 4JC0A 1CSPA 5JJLA 5C3WA 1J6QA 1P16A 5EQ0A 3H0GB 4A3FH 1STEA 1GHJA 3FRPB 1A3VA 4DR2L 2WKDA 3BG3A 1JR0D 1Y1VB 1VQAA 3A74A 5EKLA 5FK9C 3D0FA 2EDGA 1G51A 4POFA 2OT2A 3M7GA 1RCVD 3CC2A 3QJYA 1G291 4X3KA 2AWOA 1EFID 3OOCA 5IYDG 3RLFA 1EY5A 2I07B 2EY6A 4JYAQ 2C35B 1TWHB 3SXHA 2CWPA 3NWTA 2DNCA 4JBMA 4OO1H 2Z6KA 4DAMA 2NZHA 4H44C 1FL0A 1CA5A 1STHA 2VXWA 1GM5A 1N9WA 1HQMC 2LXJA 2F0MA 1IYJB 4AH6A 1HH2P 1RL2A 2F0FA 1G6ZA 2IY5B 1TVXA 4DR3Q 2CVRA 3DEOA 4LF5L 3M4OH 1GUOA 3M4PA 3HP3A 2NVYH 5FO7B 3UDGA 3QR8A 2JN4A 5C5MA 1GUWA 5KNDA 1WTVA 2N55A 3CD6A 2JA5G 1JICA 3HOWB 4YY3L 4YCVA 1IBMQ 3UDXA 2VL6A 5G3LD 3TZDA 1TWCB 1SLJA 2E8GA 4A3BB 3M85A 3HOVH 1CKNB 1WCMB 4BXXH 5GAGC 5JOBA 4ABNA 3GTKB 1VQ8A 2EIFA 3RN2A 4LFBQ 2EYPA 2K50A 3PF5A 1ASZA 5EJWA 1HUNA 3NTHA 2BDNA 3HOXB 4XYOA 1SN8A 3D6CA 5I9OA 4C56C 2KCCA 4LFBL 4DNIA 2EYFA 1VQJA 2Z9HA 3WDNA 4XQNA 4O0AA 2QGQA 2GA4B 5FO9B 5GQOA 1D5ZC 1CKNA 5NUCA 2O5IC 1HHVA 4WJ3M 2RCFA 3PUXA 3CCMA 5FLMG 1STAA 5ELNA 3T4AC 4DUYQ 1A8VA 1G2SA 3L7ZC 1GOZA 4P72A 4U68A 3BZCA 1GUNA 3DWPA 2L5TA 4A3IB 3I7FA 4LWCA 1Y1WB 2FMCA 2RQXA 2LY7A 2X69A 4YIJA 4QUFA 1L1OB 2AQ2B 2WB1E 3H3VC 2PW7A 1WD0A 3CQZB 4IUUA 2K5DA 1MJEA 3OMGA 2L1BA 4H7BA 3I4NH 2UXDQ 4Z9CB 4LAAA 1W6JA 3MXNB 5IGGA 1MGSA 4JBKA 2ZT9C 4Q5VA 3D8GA 3ERQA 3OYYA 5D65A 3HOYH 2IHEA 1B4OA 3H6MA 1Y1VH 2M2LA 2A69C 2LKVA 4POGA 4KTAA 4O42A 2BCOA 2H4OA 4A3DG 4ZQ3A 1T5EA 3S1MB 3BDCA 1XNQQ 5LL6X 1Q1BA 1PH6A 1JB3A 1HR0Q 4BBSH 2E76C 3T13A 2Q2TA 2Q8TA 5CBAE 1C48A 4OWWB 2AWNA 4E6IA 2B39A 1WI5A 2MQHA 2NZOA 2CH4A 2D0OA 2WB1B 4GLXA 1MSHA 2QDLA 2FXQA 4KY7A 4K0KQ 2N78A 2PI2E 1KDBA 2RA4A 3S9WA 2ZJRA 1O7ZA 5LHY1 1LV9A 1DOMA 2J4XA 3PO2H 5IY0A 1U4MA 4BY1B 3KJPA 1I50H 3Q23A 1K3RA 1QZHA 3HKZE 1XMQL 5I2XA 1VQEA 5M3MG 2TMPA 2B8FA 1KDAA 1Q81C 5LL6S 4OX9L 1LLRD 3D31A 4A3EH 2A1AA 4LF8L 1BCPF 1S5BD 1QUQA 1FYCA 1DD2A 3W1BA 4CDDC 3VR3A 1HZAA 4BWGB 1ENAA 2F0NA 5C4JB 5ELBA 5C44B 4NXML 2HIVA 4DK3C 5C0XJ 3HOZG 4JVZA 2BE5D 1KRTA 4RHSA 2OEOA 4GNXB 1PFNA 1GUTA 2KHSA 1NBWA 2ZXRA 2O2LD 3EROA 3I55A 3EA6A 3DHQA 3QIAA 4UP9A 3U9OA 2NYZD 2JQOA 1CSQA 1HXYD 4IUVA 2NVQB 1RTOA 4GKKL 2PQEA 5DAUA 1Z9FA 1F2LA 4IFDI 3HRZC 1VQ5A 1TWGB 4QIWE 1PRTD 4A3GB 4FXKC 1UE6A 4JI3L 3CPWA 4YHHL 4EGVA 3W1GA 3F1ZA 2VUMB 2K28A 4OIJA 3CMEA 1EFWA 4JI8L 3C46A 3S24A 3AB9A 2IPKD 2R93B 5M5YB 2KUMA 1K83H 1F9SA 3FKIB 5EBDA 5JAVA 1VMCA 5E3FA 1W6KA 3M4QA 5ISRA 4FXDA 3N6RA 1RHPA 5IYDH 1PLFA 4MTKA 3M4YA 4LFAL 3ONAB 3J7ZC 3GQBA 5CV9A 1EY6A 4M8AA 1ONLA 3W3AA 1Z7TA 3DUZA 1BCPB 3CKIB 3ICEA 1WTHA 2F0PA 4UDUC 1HNWQ 3IFDA 1AFPA 2MPMA 5D14A 4DR1Q 1QNUA 3W2DA 2I46A 4DF7A 5KNCA 1LTTD 1QZGA 2F0IA 2Y0SG 3CCEA 1QWYA 4LF7L 4IJLA 3RZOH 3NEMA 3MAQA 5EAYA 3OTOQ 3TMEA 1VQBA 1PV4A 4BA2I 2F52A 2EYOA 5ELDA 3EFXD 1K8MA 4JI2Q 3QB3A 3E9HA 4R4QA 5I9PA 2K1BA 4CGYB 2XRSD 3S1MH 4IFDG 5M5XH 3PMFA 3L9AX 4JBJA 4Y7NB 4XT1B 5AJ3Q 4ME3A 3I8ZA 2R3ZA 4C3JG 2HDMA 1SYCA 1VQOA 2A6HC 1YI2A 1N36Q 4DV5L 3S2DH 1FJGQ 1JJGA 5IP9G 4R9WA 5FLXL 2A19A 2EQSA 1S5CD 2JEAI 1T5XD 5C3EB 2FJ2A 3BU2A 1MSGA 4QJFA 5FJ8G 4XQQA 4C3IB 4GOPC 4DR7L 3IRBA 2KECA 3PO3H 4BBRG 2ZJQA 3NPPA 2VNUD 4JI7Q 1D7QA 2QA4A 4LFCQ 1YJWA 4G7ZC 2B2WC 3D6WA 3T1HL 1E2WA 1Z47A 4JK1C 4IQZA 1LTAD 5KGUA 2HCIA 1JMCA 2F0UA 3EVQA 2NUCA 1RF2D 5HY6A 3W5OA 4A3CH 3D4DA 3H09A 2B2VC 3TP8A 1AP0A 1EYCA 3VA7A 3DXJC 3KJOA 1OXUA 1EZ6A 3MWYW 1NR4A 3TP5A 1STNA 1G8ZD 5C44H 4CBVA 3STBC 2K01A 4A3JB 2F4VQ 3S16B 2EXDA 4AQYL 2A6ED 3JAML 2KHIA 1J5EL 3V96A 1EQRA 2DY7A 2MUYA 4PG3A 1B44D 2WAQG 2H1EA 5LMNL 3PIP3 4AYBE 2I5MX 1XX8A 1TS4A 2NVQH 3F8TA 1VF5C 1FGBD 3S1QH 5DLQE 1HNXQ 1J8IA 1TQOA 2F3WA 2EXZA 2D2CC 1KAAA 2F0SA 3CRKC 3Q22A 3GTJB 4JI5Q 5EGTA 3GTLB 3MEFA 4P2CB 1JOKA 1V43A 1HPCA 1JB7A 4A3FB 4G57A 1Q1EA 3FKIH 4KN4C 4CKCA 2ATWA 1QG7A 2WV6D 4F88A 3UE0A 5KNBA 3LWEA 1SRUA 2K6AA 3LWUA 5CC4A 1OXSC 4P74A 5CV8A 5HGQA 2JA9A 2EVBA 4HSVA 4DXGA 4B3MQ 4L5SA 3P75A 4LF6L 3WOEA 3HGBA 4A76A 1CQFA 2B29A 1WJJA 1I5FA 3CXCA 1YIJA 2UUBQ 4ZAIA 2BA1A 5K5PA 2YYZA 4QY7A 1R9TH 1UUPA 1A63A 1TS2A 4YCUA 4OEMB 1WTOA 1PH8A 1SROA 1O80A 2C5CA 4HSPA 2SNSA 3SE0A 1N33Q 1NR2A 1VQFA 2AMCB 4B3TL 1SYEA 4HMIA 2C9OA 2LSSA 2NBFA 2PCFB 2GN5A 4OWTB 1AW7A 4XTCS 2E2JH 1D5MC 2E2IH 4JOIC 2B63G 1D5XC 4O1NA 4N8FA 5IGBA 2UXCL 1A62A 3M3YH 2PMZB 2CKZB 5I4DA 2Q2IA 4IPDA 1XPOA 3I4LA 4EQPA 3NWSA 3M4OB 4YCWA 4WJ4A 2O5JC 1JWSD 2NVYB 2X6LA 4JCVE 4C3HB 3RMHA 3FEWX 4DV0L 2Q8IB 2K52A 1PH4A 2NTTA 3K58A 3UI2A 2ENBA 2ZTCA 3UDFA 4J1MA 5IODA 4IUPA 2UU9L 1PRTC 4V0BA 5K36G 2EPBA 2HCCA 1L2FA 3HOVB 1VF7A 2L4NA 3Q24A 5C3EH 1VQ4A 2JSOA 2QEXA 2ZJPA 2A69D 1AZPA 2EYMA 3KF6B 2CCZA 1E2ZA 1DOLA 2QDBA 2Q2HA 1O7YA 4PZ7A 4ID6A 1E0BA 1EIGA 1B3AA 1AH9A 4R4CA 4DV2L 2CH4W 1ZKOA 1JWUD 4IO9A 4B3SQ 1YHAA 1SAPA 1BOSA 1M4VA 3GTPB 4RG1A 3G7LA 3JAME 4GS3A 4R4OA 4U673 2LFNA 5C4XB 1KRSA 4H13C 1PTOC 3KF6A 3NBHA 3TP6A 1R4QB 2A74C 4RKBA 3M7NA 3OWEB 1WYDA 3X3MA 2ZXOA 4N9PA 1L0YB 3SEBA 1HCZA 2XWJB 5GADC 3H3VH 2DJFC 4GN5A 3DMUA 3T53B 1I94Q 3I4NB 3GTLH 2ZM6L 1GUSA 4DV6Q 3HOUG 4HJ7A 1SFOH 1QCBD 1VDZA 4MHEA 1KQSA 1XJVA 4IFDH 2VQEL 1PH3A 3A5ZB 1XYIA 1PHJA 3BDLA 1TWFB 4JG2A 4EVOA 3HOYB 1LT3D 2UUAL 3K81C 3TP7A 2D9UA 1VQHA 4HJAA 5M5WH 5J39A 3MFYA 5IYBH 4B3RQ 3TS0A 1QVFA 5DEHA 4PNYA 1EWIA 2R7DA 1X3EA 2RCNA 1WVLA 1PMRA 1YJ9A 5IP9H 1CTMA 2I5LX 4HAEA 4MTNA 4FYDA 5JEAH 4BBSB 1BKBA 2RHSB 3EQLC 4DNTB 3HOXG 4ZCKA 4FF3A 1U9RA 5T1GA 3GTOH 4WFN3 1NTGA 1SBBB 1QVCA 4A93H 1X56A 2JE6I 4A3KG 1GO3E 2R7ZH 4GLAC 1EOTA 4BBRH 1RIPA 1HTLD 1BUVT 3FMCA 1WTPA 4GOPB 4CKEA 2F0QA 4GKJQ 3PO2B 4WJWA 5FO8B 4JYAL 3F2DA 2JA7H 1DCZA 1I50B 3AEVA 1VS0A 1UNSA 2A6EC 2TSSA 4RKLA 1BVSA 4CJ0B 1A0IA 1Y1WG 3BZDB 2L15A 2PW5A 1CKMA 3VDYA 4A3EB 4C3HH 2K04A 3T1YQ 3CCUA 1VQDA 1EY7A 4K5VA 2YTYA 1TS3A 3BYYB 3VYUA 4DR3L 3MFGA 1IKLA 5IT9E 4IALA 3CMAA 4GOPA 1B1ZA 2HT1A 4CDEC 4X66Q 2GVBA 2EY5A 1NY4A 1IBML 1DONA 4M1UB 4A3LH 4HN7A 3K5LA 1RTNA 3E6ZX 3NP8A 4UP7A 1Q8KA 2B2WA 4NKLA 2KA7A 5A2QL 4N8X1 3CCLA 3JC66 1H9MA 1LTSD 2B2VA 2R6GA 2A6HD 1IBKQ 1F2ZA 3PGZA 1HRJA 2X6GA 4HJ5A 1PRTF 4G4KA 1S40A 2OXPA 1QOHA 3GTPH 2MNAA 1YNNC 4J6HA 4DR5Q 3AFPA 1K83B 1MKHA 3MXGA 2ICIA 4TVAB 4FF1A 1X3PA 1U4RA 3MTSA 4FNFA 3UE1A 5I2YA 5C4XH 4DR4Q 1DZ1A 2QKIC 4OELB 4JBWA 3TN2A 1S5FD 3I4MG 4RA8A 1EY9A 2JA6H 1HA5A 4BY1G 2IX3A 3SGIA 4JI1Q 3NELA 1LTLA 2JA8H 1Q8IA 3HZXA 4DUYL 1ESRA 3CCSA 4BA1I 5EKIA 4ZYSA 5ELCA 2CHBD 3RLNA 4JV5Q 4RGMA 3RUZA 2VQFQ 3A0JA 4Y52H 1TR5A 5FKAC 2R92H 2V4DA 5FLXc 4KKTA 1E1TA 4C2MH 2I0QA 3VYTA 2E5LQ 1H9RA 2A73B 1K8AC 1UEAB 1XNRQ 1PH9A 3STBD 1TWFH 2F0LA 4NXNQ 3RZOB 2JEBI 2PO4A 2JA5B 2UXDL 2MO1A 5LMUQ 2IJ0A 2UXBQ 1CK1A 3KUPA 1XTCD 4MZ9A 1D1KA 2KCMA 3EN2A 5M5XB 5K36H 1YITA 4DK0A 1E1OA 3CHBD 1D2BA 1EQQA 4A3MG 3KDFB 4KD3A 2Z1CA 4DV3Q 3MA2B 2XRQD 3PQIA 4K2KA 5LMUL 1PRTB 4EQNA 3HKZG 4XIGS 2O4XA 4NMZA 2OWOA 3S2DB 2OQKA 1QUQB 4UHVA 3E0EA 3F2BA 2HHHQ 5KYLA 1XNQL 3AYHB 4JOIA 3RZDH 2VB3X 1HR0L 4ZKBB 4RGNA 4DK1A 4O2DA 3K5MA 3JAMc 1CFMA 4HJ8A 5CV4A 1C9OA 2MFIA 5JPNC 1FR3A 4K8IA 4MN3A 2PZTA 3PO3B 1YBYA 1B8AA 1EQVA 4K0KL 3KDFA 1I4RA 4KLKA 1I4QA 4DAYA 1LT6D 3G4SA 3KFUA 2L12A 1PZKD 2F0EA 4OIKA 1TY0A 5BN3A 2ASBA 3QO2A 5DM63 3SK8A 3CCRA 2NN6I 1NE3A 2XN9C 2XGTA 2DY8A 4C1NK 4QB4A 1A2UA 4LUZA 2NVXH 3SR1A 2PZUA 4DV7Q 5A2QE 3A8IE 2Z4IA 3WWVA 4HMJA 5ELFA 1STYA 4HIDA 3BS1A 1X9NA 3BVGA 4ULLA 5GAEC 1CI3M 4JI4Q 3GD7A 3HOUH 3F2UA 3J81j 2VB2X 3CP0A 1V8QA 3S15H 1VQLA 4HTHA 5M3FG 2KENA 4CJ1B 3S1QB 2WIIB 4XYQA 1N32Q 2FFKB 1ZYRC 4A3DB 3BDOA 5IYCG 1HQRD 1L0WA 3AQQA 5CYUA 4X65Q 3VYRA 1SNMA 4DAVA 2FINB 4JW0A 4Q0FA 5DNFA 4DV4Q 3J7AF 3L2PA 1XMOQ 1U4LA 1P8LA 5C3XA 1I6VC 3V05A 2RSOA 4EQOA 5IWAQ 2KEDA 1C7YA 1EY8A 2HD3A 3VR6A 1QILA 1AEXA 4PZ6A 3ULPA 4JI0Q 5JJZA 1OTCA 4A3KH 4WRDA 3CU7A 4X6AH 2D0PA 5C0XI 4ZK9B 4ZUJA 2K7VA 1XMOL 5FOBB 1R9TB 2D5DA 1YNXA 2AUKA 2NN6G 1AE2A 3I91A 2VS1A 1OXTA 3WOFA 4R8IA 1LT4D 3IKJA 3AU7A 3ND8A 1Y8OB 4HIOA 1DM0B 1EQTA 1PYBA 2E2JB 3GP7A 3MEHA 2E2IB 3I4OA 1PZJD 3J80L 1PTOD 1LM0A 1U0LA 3LGJA 5IT9c 4UY8C 3H91A 5C4ZA 3D4RA 1X3QA 3M3YB 1HNWL 5EPLA 4DR1L 4KKSA 4A3JG 2JA5H 1VQCA 1SNQA 3KLSX 5IP7G 2R61A 3RNUA 1F9QA 3I3CA 3K80C 3OTOL 1EEID 1B2TA 3HOZB 2EJMA 1E7ZA 1XPUA 4F7XA 1EUJA 4JI2L 4R1JA 1JT8A 4DFAA 1PXUA 1LABA 3P1HA 4ZLTF 5J22A 3G71A 1OXVA 4UAIA 4BY7G 5AJ3L 1NMFA 4A3FG 3Q6SA 2E2HH 5GAHC 4L8JA 3ULJA 1BF4A 3FP9A 1N36L 5C0XG 1ET6A 1YNJC 2K05A 2ES2A 1FJGL 4DAPA 1HNZQ 1CUKA 1D6EC 5IOCA 5DM73 4CDCC 3R2IA 2F4IA 3C3LA 4DA2A 1DOKA 4OXPA 2AQ1B 4LF9Q 3S1RH 5FLMH 3SVMA 1B9MA 1GUGA 4LF4Q 1EL0A 4XXEA 1M8AA 1UAPA 1SE3A 1ICWA 5E4XA 4GLVB 2KBNA 4OONA 1KNEA 3D4WA 3I4MH 1JE5A 4JI7L 5KRUA 4LFCL 4DN4M 4AYBG 1NUCA 2F0VA 1KHIA 5LMNW 1PTOH 1B9NA 1WTRA 4RHRA 3K59A 4LNQA 3L3OC 2AKWB 1EU4A 4DU9A 1EWHA 2UUCQ 1BDOA 2HDLA 3G6JB 3VR2A 3S1NH 2Y0SB 2EY2A 2KQ3A 1V1OA 1VQ7A 1JOOA 2F4VL 2RVLA 1NNXA 1FVIA 2IL8A 5JVH3 1GHKA 2DGYA 2MGSA 1J9OA 2NB0A 1VQIA 2CW0C 2WKCA 4AIMA 5L37A 4DV1Q 1SFOB 3HKSA 1STGA 4A3DH 2PMZE 1VQKA 1YHQA 4X64Q 1KLUD 4RFBA 4FO2A 2SNMA 4DR6Q 5E7NA 1CZWA 3UDIA 1CHQD 1HNXL 3S17H 1VQ6A 4A3MH 4JI5L 4HIMA 5M5WB 3VR4A 4C3JB 3HEJA 4HJ9A 4IOCA 3OMCA 1S3OA 3OW2A 4IPHA 1SJHD 4LUOA 4CKBA 2B8GA 3U50C 1KC8C 3X3NA 3PUZA 5CGKA 4KJNA 1IKMA 3K6OA 3GTOB 4LK1C 3J80E 4A93B 2R7ZB 4B3ML 1YNND 1SDFA 2IX0A 2K33A 4BBRB 2F0HA 2UUBL 4NP5A 2EY1A 3MC0B 5M3MH 4A75A 2HQLA 2F3VA 3DM3A 1TY2A 2I5HA 5D3IB 4ZKCB 1PA6A 4JI6Q 4IN3A 2JA7B 4KHPQ 1N33L 1L1OC 1YHBA 2RF4A 4WORA 3C1FA 4IUQA 1E3PA 1IBLQ 5C6AA 4EX5A 1VCIA 5JPMC 3HOZH 2EOTA 5FLXE 3NQIA 1LACA 4RWSC 2WFWA 1LUZA 2JYOA 3I4NG 1C4QA 1KAWA 2JJQA 3P20A 1C8CA 2YTXA 1KD1C 1LO5D 4K5XA 2F03A 4GN3B 2EYJA 3H0GG 4L5RC 3ER0A 4K8JA 5ELEA 1I4HA 4X62Q 1Y1VG 1MD2D 2Z8LA 3NBHB 1HZBA 1BXTA 3Q8DA 3FPUB 2BOSA 3H15A 2IHFA 5IYCH 3PSIA 1Q46A 2F3IA 5AFWA 5BR8Q 2B2TC 1YJNA 4OHJA 2N49A 2QF7A 2L11A 2YU9H 1PYWD 3ULLA 1I6HH 5COYA 1ICFB 1EIFA 2XVSA 3MXPA 1SYGA 3KK7A 1JJCB 1ZEQX 4H02A 2VW9A 1RKNA 1ILQA 4DUZQ 3KOJA 2G5DA 1EYDA 1EYAA 3MHBA 1H95A 4B3SL 2MHVA 3BYTB 3K8AA 4LJZC 4KY5A 1CKOA 3N52A 2NN6H 3QG1A 3SK4A 2JA6B 3CF5A 1AE3A 1FGUA 2K5HA 4P75A 1KNAA 2JA8B 1QB5D 2OTLA 5E4WC 3I90A 3NE5B 3T16A 1X3FA 4PMCA 4A3EG 1CM9A 1LYLA 4X3TA 2R92B 2PQAB 1VQ9A 3HOWG 4C2MB 2NVTH 3GV3A 1N8RC 4F87A 4GNXC 3TZUA 4H0LC 1KIXA 2M9VA 3R8BA 1L0XB 1PYSB 4A3BG 3PIO3 1LTID 1ENCA 4I7ZC 1WCMG 1I94L 1PDQA 2SOBA 1IW7C 3DEPA 3TBIB 4C3JH 4DV6L 3CW2C 3Q0AA 4DR2Q 3KYHC 1QNKA 1UWVA 4IPGA 1B53A 3GDEA 2CFMA 3KBXA 3J81L 5CV5A 4FDBA 1S72A 2F0GA 2EYLA 4PZ8A 2CWAA 2K32A 3GTGH 3I56A 5IGEA 3NBIA 4BY7H 5ELOA 2E2DC 3S14H 4KY6A 2PQAA 3A7AB 4B3RL 3PV0A 1ZYRD 5FJ8H 2F0TA 1RD9D 1Q12A 5C0XH 2DUDA 4QCLA 1FNUA 1SXTA 3RD4A 3RZDB 3E0JA 5CV7A 4KN7C 1V9PA 3VYSA 4K5WA 1HUMA 4MIUA 3RN5A 1Q3LA 1GD7A 1BCPC 1GVPA 2RHQB 1H9JA 3KLWA 3OIPA 5J3BA 1G2TA 3NK9A 4A3IG 3GV6A 4GKJL 1H9SB 4LF5Q 1LT5D 1A15A 4G7OC 1II3A 3SHLA 2VZAA 1SE8A 2WINB 4P71A 4JPBW 4YY3Q 4IUTA 4NB3A 3SDZA 3CPFA 1SE4A 1Y14B 4QMGA 2B2YC 3E9IA 4X3SA 5CORA 5EKKA 2IWHA 4S3SA 1TWAH 3T1YL 2OCEA 2NVXB 2NZ1D 4J15A 1W2BA 4CHTB 1UE7A 3D3RA 3ND9A 3GTMB 3HOUB 4PMBA 1UE5A 2M00A 1ESFA 5BN4A 2K4KA 3U4ZA 5KYIA 1I4XA 3S15B 2RSNA 5H1SE 4X66L 1QE6A 4FXGC 1H9SA 1BBUA 2L55A 4BS9A 3NTIA 3QOJA 1U4PA 4G7HC 1FD7D 3CCQA 1HFNA 1K28A 1F77A 1JWMD 3DM1A 1I3QH 1MBYA 2CQAA 1O7LA 3OIQA 3J80c 3C1EA 2YTVA 4A4IA 4HEDA 4K2LA 5I6WA 1K9MC 3TQYA 2RDHA 3A7LA 3S2HH 4FF4A 2WB1G 3K0YA 3URYA 3AFQA 1K73C 1IBKL 3K7AH 2F0DA 3BZKA 1YNJD 3FHWA 1SE2A 2GVAA 2DNEA 2QCPX 2ID0A 1XPRA 1A3UA 1NJIC 4QQBX 3A56A 1F9RA 4N9TA 2LMCB 4A3KB 4DR5L 3PO3G 4DGZA 1HA6A 2RDFA 4DR4L 1ZXTA 2PNHA 1B70B 2G9HD 2RDGA 4DK6C 2B63H 2MO0A 3OWFA 1UEBA 2BA0A 4PV1C 2Z4HA 1PH2A 4A3CG 4JI1L 1FNWA 3GTQH 3NENA 3PUVA 4OWXB 1TIID 2LS01 2V1CC 3J81E 4RAUC 4JV5L 1AN8A 5C44G 2VQFL 1WOCA 1PTOF 1YVCA 1NSNS 3KBGA 4KHZA 3J80i 3LNNA 1IXRA 5J1ZA 3I70A 2E5LL 1JOQA 2Q8RE 4PMWA 3PUWA 4X3UA 4HCEA 4YWLA 1XNRL 1S5ED 5IGFA 1JE4A 1SYFA 4NXNL 2J0TD 1HR0W 4HCSA 1XXGA 2CW0D 4DAYB 3H0GH 2XSCA 4XQJA 2H5XA 4FF2A 4NPSA 1IYVA 2UXBL 4A3GG 1AZQA 1NAPA 1Q7YC 4ZUIA 1BQQT 2OQ0A 4HR7B 3ZYYX 1CA6A 1E22A 1SMYD 4TRDA 2K14A 2VUMG 4DV3L 2B2UC 4I7AA 3G6EA 2E2HB 2R93G 1L1OA 3M9BA 3FKIG 3FVQA 1N34Q 4OGQC 1SYBA 1MI2A 1OO9B 2HQEA 4P73A 2HHHL 2BDOA 3MXNA 4IOAA 1TWHH 2B3GA 2HUGA 4B08A 2N8NA 1XMQQ 3AMUA 4RCOA 1IL2A 3S1RB 1N34L 1QVGA 4J8QA 3NTKA 4L5TA 4OX9Q 2A8VA 1O7IA 2A68D 3I4MB 4IFDJ 4KHVA 4LF8Q 4R4IA 2JP1A 1KXLA 4OL7A 4YWMA 2FMMA 1JC7A 1SJED 3HG9A 4L6TB 3VR5A 2Q2UA 4B9XA 4V190 5CBEE 1PTOB 1DJRD 4KMUC 1B50A 2EE1A 4DNRB 2ZTDA 4KKUA 5TSSA 3NSWA 3BVMA 4NXMQ 3DWAA 4LMQD 3HOWH 2K5QA 3GTMH 2B2TA 4TKOB 5JEAJ 1SSOA 4FP5D 3JAMi 4KV6A 3S1NB 1SEBD 2F0WA 1TWCH 4QF4A 4DV7L 1H9KA 4A3BH 4TQUS 3RLOA 1G91A 1DGSA 1DXMA 1WCMH 1XWEA 3A8KE 3DWQA 3IL8A 2G9DA 1RJTA 3MZ5A 5EBCA 4GKKQ 4JI4L 1PH5A 3GTKH 2F0OA 3H3VI 2E74C 4JI3Q 1GKHA 2KHJA 4YHHQ 1SNCA 1HZCA 1D8LA 3S17B 1M90C 1T9HA 3KLSA 4XT3B 4A3MB 2K5WA 5EPKA 4JI8Q 1K8GA 1N32L 5C3EG 5JJIA 2D62A 3HOXH 2YV5A 3HFZB 2QILA 1Y8PB 3HKZB 4C3IG 3PCOB 3DLLA 5F2DA 1VQPA 4X65L 1R4PB 4QL5A 4RMFA 1CQVA 4LFAQ 1X65A 2QW7A 4DV4L 3I73A 1V1QA 1JORA 2PPBC 4CJ2C 1TU2B 4RGOS 3PF4A 1Y8NB 1Q90A 5CV6A 5IWAL 1PFSA 3PUYA 4QUCA 4GNXA 1Q82C 4JI0L 1KABA 3F2CA 1VQNA 3EBEA 3PIPA 2DN8A 3CRLC 2IW3A 1A6XA 2PI2A 3A8JE 1LTBD 5M3MB 1VMPA 1JQYD 1O78A 4A3IH 1Y1WH 1OXXK 1EYGA 1M1KC 3CC4A 1MIUA 4OO1I 1DYQA 1EOVA 2L0CA 4LF7Q 2EYHA 1CHPD 4K14A 1PVOA 1BR9A 3CQZH 2FHTA 2N88A 2WP8J 3OSOA 4KK7A 1NMGA 3ERSX 2PNRC 4YWKA 1A3TA 2OTJA 4ZRZA 2EZVA 3I72A 1BBWA 2AUJD 4QIWB 2KCNA 4TSSA 2KVMA 1E2VA 3BVZA 2Z6KC 1BNZA 1ENFA 1KLGD 1VQMA 3GO5A 5JJKA 4DV5Q 3R2TA 2ALYB 2KOLA 1I4GA 5M3FB 1IW7D 4MNOA 5KIXA 1F9PA 2Y0SE 3A5UA 1KTKA 4RH6A 5IYBG 1MJCA 1SMXA 3TS2A 1K3BC 4UPAA 1K0RA 3IAYA 4DR7Q 2OF1A 4R4TA 3ZJYC 4ME5A 4UP8A 3TRZA 3O13A 5T1IA 1CT1D 2WACA 5IIFA 1SYDA 2XIWA 1IZ6A 3A55A 1EY0A 2YU9B 5JEAG 1I6HB 3V2TA 4IJHA 4DXFA 1X3GA 1PH7A 3T1HQ 1HNZL 2B2YA 1LTRD 4DKAC 1PZID 4A93G 4BY1H 1YZ6A 2R7ZG 4OO1G 1Q86C 5JVG3 4LF9L 4KD4A 5KEEA 3TDQA 4LF4L 2PYKA 4RCNA 3NXWA 1EIHA 1BCPD 3J81c 3K5OA 3LX0A 1LTGD 5A35A 3I2ZA 3A54A 4PQXA 2JA7G 4GZYC 3E5SA 2AHOB 1W3SA 3R93A 3CC7A 2XTIA 1YEZA 3NUCA 4KJOA 3OPOA 4AQYQ 4EQ5A 2SEBD 1J5EQ 2HIXA 1Y69U 3SK6A 2KJXA 4C3HG 5C4JH 1TT2A 3H94A 5LMNQ 2SDFA 2KCTA 5D3DA 1U5KA 2DJGC 2EJFC 2NVTB 2UUCL 3IFTA 4L5QA 4I65A 1EIYB 3U4VA 1TKWB 1X32A 1SMYC 1HTPA 4CDFC 5IGCA 2NTSA 3HOVG 3J7YW 4BXXG 4DV1L 1C0AA 5GROA 1D1IA 3K5NA 3J7AV 4NW2A 4A3LG 1TWGH 4X64L 4A3GH 5HGTA 3ITPA 2IT1A
chains in the Genus database with same CATH topology
1F2MA 1HFGA 1ML0D 4KI0A 3GTGB 4BY7B 2JXMB 1KDCA 2PZWA 3S14B 1STBA 3R3OA 4IURA 3C2PA 1EEFD 2XWBB 2K03A 1PFMA 3K57A 2QEJC 5C5LA 5I6YA 3T51B 2A68C 3T56B 3P7JA 4FVMA 2J7ZA 5EPJA 3MXUA 1CZGA 5CMDA 3QWNA 1EWCA 1BO0A 1EU3A 2KEEA 1SNPA 4F8MA 1IHZA 1WD1A 1SNDA 4AYBB 2F0KA 4XDXA 3NQTA 4B9WA 1FNVA 1TS5A 1NCVA 2BE5C 2ICEC 2XNAC 2B2UA 2ZXPA 1TWAB 2WAQB 1I4PA 1RDPD 2RBMA 5BN5A 1K8OA 4K6LA 5M9OA 1ILPA 1QJOA 2F0JA 4L63B 3KLRA 1GJXA 2F1MA 3FPPA 2IX1A 4RGTA 3HS0C 3NHHA 1A2TA 1S4ZA 5G3LF 1WTXA 4IUNA 1RODA 1WTWA 2AQ3B 4IZ8A 1SNOA 1I3QB 1V1PB 2MJ8A 3U9SA 2RKSA 3FDTA 4K6DA 2NWGA 5IT9L 3KF8A 3S2HB 3OW7A 1EY4A 3EJIA 5E1FA 3K7AB 3VA5A 1WTQA 1IL8A 2E75C 2L9HA 4NDXA 2B63B 4ILWA 5IGDA 4ODGA 1V1PA 5CR3A 3MVVA 1JCKB 3QOLA 3GTQB 1EZ8A 4R8NA 3TSSA 1GXDC 2EJGC 3OHXC 1BBXC 5C4HA 2MP1A 1S5DD 3SK5A 4C1NI 2A5HA 1ET9A 1Z6HA 1IYUA 1PFBA 1F2YA 5HURA 5C3WA 5EQ0A 3H0GB 1STEA 1GHJA 3FRPB 1A3VA 2WKDA 3BG3A 1JR0D 1Y1VB 5EKLA 5FK9C 2EDGA 2OT2A 3M7GA 1RCVD 3QJYA 1G291 4X3KA 2AWOA 1EFID 3OOCA 3RLFA 1EY5A 2I07B 2EY6A 1TWHB 3SXHA 3NWTA 2DNCA 4OO1H 4H44C 1CA5A 1STHA 2VXWA 1HQMC 2F0MA 2F0FA 1G6ZA 1TVXA 2CVRA 3DEOA 1GUOA 3HP3A 5FO7B 5C5MA 1GUWA 5KNDA 1WTVA 2N55A 3HOWB 1JICA 5G3LD 3TZDA 1TWCB 4A3BB 3M85A 1WCMB 5JOBA 4ABNA 3GTKB 2EYPA 5EJWA 1HUNA 3NTHA 2BDNA 3HOXB 4XYOA 5I9OA 3D6CA 4C56C 2KCCA 2EYFA 3WDNA 4XQNA 2GA4B 5FO9B 1D5ZC 5NUCA 2O5IC 1HHVA 3PUXA 1STAA 3T4AC 1G2SA 3L7ZC 1GOZA 4U68A 1GUNA 3DWPA 2L5TA 4A3IB 1Y1WB 2FMCA 2RQXA 2LY7A 2X69A 4YIJA 4QUFA 2AQ2B 3H3VC 2PW7A 1WD0A 3CQZB 4IUUA 2K5DA 3OMGA 2L1BA 4H7BA 4Z9CB 4LAAA 1W6JA 5IGGA 1MGSA 2ZT9C 4Q5VA 3D8GA 3ERQA 5D65A 1B4OA 3H6MA 2M2LA 2A69C 2LKVA 4KTAA 4O42A 2BCOA 2H4OA 4ZQ3A 1T5EA 3S1MB 3BDCA 5LL6X 1Q1BA 1JB3A 2E76C 3T13A 2Q8TA 5CBAE 1C48A 2AWNA 4E6IA 2B39A 2WB1B 1MSHA 4KY7A 1KDBA 2RA4A 3S9WA 1O7ZA 5LHY1 1DOMA 1LV9A 2J4XA 1U4MA 4BY1B 3Q23A 5I2XA 2TMPA 2B8FA 1KDAA 5LL6S 1LLRD 3D31A 1BCPF 1S5BD 1FYCA 1DD2A 3VR3A 4BWGB 1ENAA 2F0NA 5C4JB 5ELBA 5C44B 5C0XJ 2BE5D 4RHSA 2OEOA 1PFNA 1GUTA 2KHSA 2ZXRA 2O2LD 3EROA 3EA6A 3DHQA 3QIAA 3U9OA 2NYZD 1HXYD 4IUVA 2NVQB 1RTOA 2PQEA 5DAUA 1F2LA 4IFDI 3HRZC 1TWGB 4A3GB 1PRTD 4FXKC 4EGVA 2VUMB 2K28A 4OIJA 3C46A 3AB9A 2IPKD 2R93B 5M5YB 2KUMA 1F9SA 3FKIB 5EBDA 5JAVA 1VMCA 5E3FA 1W6KA 5ISRA 4FXDA 3N6RA 1RHPA 1PLFA 3M4YA 3ONAB 3GQBA 5CV9A 1EY6A 4M8AA 1ONLA 3W3AA 1Z7TA 3DUZA 1BCPB 3CKIB 2F0PA 4UDUC 1AFPA 3IFDA 2MPMA 5D14A 1QNUA 3W2DA 2I46A 4DF7A 5KNCA 1LTTD 2F0IA 1QWYA 3MAQA 3TMEA 4BA2I 2EYOA 5ELDA 3EFXD 1K8MA 3QB3A 5I9PA 2K1BA 4CGYB 2XRSD 4IFDG 3PMFA 3L9AX 4Y7NB 4XT1B 3I8ZA 2R3ZA 4C3JG 2HDMA 1SYCA 2A6HC 4R9WA 5FLXL 1S5CD 2JEAI 1T5XD 5C3EB 2FJ2A 1MSGA 4XQQA 4C3IB 2KECA 3NPPA 2VNUD 4G7ZC 2B2WC 3D6WA 1E2WA 1Z47A 4JK1C 4IQZA 1LTAD 5KGUA 2HCIA 2F0UA 3EVQA 2NUCA 1RF2D 3D4DA 3H09A 2B2VC 3TP8A 1AP0A 1EYCA 3VA7A 3DXJC 1OXUA 1EZ6A 3MWYW 1NR4A 3TP5A 1STNA 1G8ZD 4CBVA 2K01A 4A3JB 3S16B 2A6ED 3JAML 3V96A 2DY7A 2MUYA 1B44D 2H1EA 3PIP3 1XX8A 1TS4A 1VF5C 1FGBD 1J8IA 1TQOA 2F3WA 2EXZA 2D2CC 1KAAA 2F0SA 3CRKC 3Q22A 3GTJB 5EGTA 3GTLB 4P2CB 1JOKA 1V43A 1HPCA 4A3FB 4G57A 1Q1EA 4KN4C 4CKCA 1QG7A 2WV6D 4F88A 5KNBA 3LWEA 2K6AA 3LWUA 5CC4A 1OXSC 5CV8A 2EVBA 4HSVA 4DXGA 3P75A 3WOEA 3HGBA 1CQFA 4ZAIA 2BA1A 5K5PA 2YYZA 1UUPA 1TS2A 1WTOA 1O80A 2C5CA 4HSPA 2SNSA 3SE0A 1NR2A 1SYEA 4HMIA 2C9OA 2PCFB 2NBFA 4XTCS 1AW7A 1D5MC 1D5XC 4O1NA 5IGBA 2PMZB 5I4DA 3I4LA 4EQPA 3NWSA 3M4OB 2O5JC 1JWSD 2NVYB 2X6LA 4C3HB 3RMHA 3FEWX 2Q8IB 2NTTA 3K58A 3UI2A 2ENBA 4J1MA 5IODA 4IUPA 1PRTC 4V0BA 5K36G 2EPBA 2HCCA 3HOVB 1VF7A 2L4NA 3Q24A 2JSOA 2A69D 1AZPA 2EYMA 1E2ZA 1DOLA 2QDBA 1O7YA 4ID6A 1E0BA 1EIGA 1B3AA 1ZKOA 1JWUD 1SAPA 1BOSA 1M4VA 3GTPB 3G7LA 3JAME 4U673 2LFNA 5C4XB 4H13C 1PTOC 3NBHA 3TP6A 1R4QB 2A74C 4RKBA 3M7NA 3OWEB 3X3MA 2ZXOA 4N9PA 1L0YB 3SEBA 1HCZA 2XWJB 3T53B 3DMUA 3I4NB 1GUSA 1QCBD 1VDZA 4MHEA 4IFDH 1XYIA 3BDLA 1TWFB 4EVOA 3HOYB 1LT3D 3TP7A 2D9UA 5J39A 3MFYA 5DEHA 4PNYA 1WVLA 1PMRA 1CTMA 4FYDA 4HAEA 5JEAH 4BBSB 3EQLC 4DNTB 4FF3A 1U9RA 5T1GA 4WFN3 1SBBB 2JE6I 1EOTA 1HTLD 1BUVT 3FMCA 1WTPA 4CKEA 2F0QA 3PO2B 4WJWA 5FO8B 1DCZA 1I50B 1UNSA 2A6EC 2TSSA 4RKLA 4CJ0B 3BZDB 2PW5A 4A3EB 2K04A 1EY7A 4K5VA 1TS3A 3BYYB 3VYUA 3MFGA 1IKLA 5IT9E 4IALA 1B1ZA 2EY5A 1DONA 4M1UB 4HN7A 3K5LA 1RTNA 3E6ZX 3NP8A 2B2WA 4NKLA 2KA7A 5A2QL 1H9MA 1LTSD 2B2VA 2R6GA 2A6HD 1F2ZA 1HRJA 2X6GA 1PRTF 4G4KA 2OXPA 1QOHA 1YNNC 4J6HA 1K83B 3MXGA 2ICIA 4FF1A 1X3PA 1U4RA 3MTSA 5I2YA 4FNFA 1DZ1A 2QKIC 4JBWA 3TN2A 1S5FD 4RA8A 1EY9A 1HA5A 2IX3A 1Q8IA 3HZXA 1ESRA 4BA1I 5EKIA 4ZYSA 5ELCA 2CHBD 4RGMA 3RUZA 1TR5A 5FKAC 2V4DA 4KKTA 3VYTA 1H9RA 2A73B 1UEAB 3RZOB 2F0LA 2JEBI 2PO4A 2JA5B 2IJ0A 1CK1A 3KUPA 1XTCD 1D1KA 5M5XB 5K36H 4DK0A 3CHBD 1D2BA 4KD3A 2Z1CA 3MA2B 2XRQD 4K2KA 1PRTB 4EQNA 4XIGS 3S2DB 2O4XA 4NMZA 5KYLA 2VB3X 4ZKBB 4RGNA 4DK1A 3K5MA 1CFMA 5CV4A 5JPNC 1FR3A 4K8IA 4MN3A 2PZTA 3PO3B 1EQVA 1I4RA 1I4QA 4DAYA 1LT6D 2L12A 1PZKD 2F0EA 4OIKA 1TY0A 5BN3A 3QO2A 5DM63 3SK8A 2NN6I 2XN9C 2DY8A 4C1NK 4QB4A 1A2UA 3SR1A 2PZUA 5A2QE 3A8IE 2Z4IA 4HMJA 5ELFA 1STYA 3BS1A 3BVGA 4ULLA 1CI3M 3GD7A 3F2UA 2VB2X 1V8QA 4HTHA 4CJ1B 3S1QB 2WIIB 4XYQA 2FFKB 1ZYRC 4A3DB 3BDOA 1HQRD 5CYUA 3VYRA 1SNMA 4DAVA 2FINB 4Q0FA 5DNFA 3J7AF 1U4LA 5C3XA 1I6VC 3V05A 2RSOA 4EQOA 2KEDA 1EY8A 3VR6A 1QILA 1AEXA 5JJZA 4WRDA 3CU7A 5C0XI 4ZK9B 4ZUJA 2K7VA 5FOBB 1R9TB 2D5DA 2AUKA 2NN6G 3I91A 1OXTA 3WOFA 4R8IA 1LT4D 3IKJA 3AU7A 3ND8A 1Y8OB 1DM0B 1EQTA 2E2JB 3GP7A 3MEHA 2E2IB 1PZJD 3J80L 1PTOD 3H91A 5C4ZA 3D4RA 1X3QA 3M3YB 5EPLA 4KKSA 1SNQA 3KLSX 2R61A 1F9QA 3I3CA 1EEID 1B2TA 3HOZB 2EJMA 4F7XA 4DFAA 1PXUA 1LABA 3P1HA 4ZLTF 5J22A 1OXVA 4UAIA 3Q6SA 4L8JA 1BF4A 5C0XG 1ET6A 1YNJC 2K05A 4DAPA 1D6EC 5IOCA 5DM73 3R2IA 2F4IA 3C3LA 4DA2A 1DOKA 2AQ1B 3SVMA 1B9MA 1GUGA 1EL0A 4XXEA 1M8AA 1UAPA 1SE3A 1ICWA 5E4XA 1KNEA 3D4WA 5KRUA 4DN4M 1NUCA 2F0VA 1PTOH 1B9NA 1WTRA 4RHRA 3K59A 3L3OC 1EU4A 4DU9A 1EWHA 1BDOA 2HDLA 3G6JB 3VR2A 2Y0SB 2EY2A 2KQ3A 1V1OA 1JOOA 2RVLA 2IL8A 5JVH3 1GHKA 2MGSA 2NB0A 1J9OA 2CW0C 2WKCA 1SFOB 1STGA 1KLUD 4RFBA 4FO2A 2SNMA 1CZWA 1CHQD 5M5WB 3VR4A 4C3JB 3HEJA 3OMCA 1SJHD 4CKBA 2B8GA 3X3NA 3PUZA 5CGKA 4KJNA 1IKMA 3K6OA 3GTOB 4LK1C 3J80E 4A93B 2R7ZB 1YNND 1SDFA 2IX0A 2K33A 4BBRB 2F0HA 4NP5A 2EY1A 3MC0B 2F3VA 1TY2A 5D3IB 4ZKCB 4IN3A 2JA7B 4WORA 3C1FA 4IUQA 5C6AA 1VCIA 5JPMC 2EOTA 5FLXE 3NQIA 1LACA 4RWSC 2JYOA 1C4QA 3P20A 1C8CA 1LO5D 4K5XA 2F03A 2EYJA 4K8JA 5ELEA 1I4HA 1MD2D 2Z8LA 1BXTA 3FPUB 2BOSA 5AFWA 2B2TC 4OHJA 2QF7A 2L11A 1PYWD 5COYA 2XVSA 3MXPA 1SYGA 3KK7A 1ZEQX 1RKNA 1ILQA 1EYDA 1EYAA 3MHBA 2MHVA 3BYTB 4LJZC 4KY5A 3N52A 2NN6H 3QG1A 3SK4A 2JA6B 1KNAA 2JA8B 1QB5D 5E4WC 3I90A 3NE5B 3T16A 4PMCA 1CM9A 4X3TA 2R92B 4C2MB 3GV3A 4F87A 3TZUA 4H0LC 2M9VA 3R8BA 1L0XB 3PIO3 1LTID 1ENCA 4I7ZC 1PDQA 2SOBA 1IW7C 3DEPA 3TBIB 3Q0AA 1QNKA 1B53A 3KBXA 3J81L 5CV5A 2F0GA 2EYLA 2K32A 5IGEA 3NBIA 2E2DC 4KY6A 3A7AB 3PV0A 1ZYRD 2F0TA 1RD9D 1Q12A 5C0XH 4QCLA 1FNUA 1SXTA 3RD4A 3RZDB 3E0JA 5CV7A 4KN7C 3VYSA 4K5WA 1HUMA 4MIUA 1Q3LA 1BCPC 1H9JA 3OIPA 1G2TA 3NK9A 3GV6A 1H9SB 1LT5D 1A15A 4G7OC 1II3A 3SHLA 2WINB 4IUTA 3SDZA 1SE4A 4QMGA 2B2YC 4X3SA 5CORA 5EKKA 2IWHA 4S3SA 2NVXB 2NZ1D 4CHTB 3D3RA 3ND9A 3GTMB 3HOUB 4PMBA 2M00A 1ESFA 5BN4A 5KYIA 1I4XA 3S15B 2RSNA 1QE6A 4FXGC 1H9SA 4BS9A 2L55A 3NTIA 3QOJA 1U4PA 4G7HC 1FD7D 1HFNA 1F77A 1JWMD 3DM1A 1MBYA 2CQAA 1O7LA 3OIQA 3C1EA 4HEDA 4K2LA 5I6WA 2RDHA 3A7LA 4FF4A 3K0YA 3URYA 2F0DA 1YNJD 1SE2A 2DNEA 2QCPX 2ID0A 1A3UA 3A56A 1F9RA 4N9TA 2LMCB 4A3KB 4DGZA 1HA6A 2RDFA 1ZXTA 2G9HD 2RDGA 3OWFA 2BA0A 4PV1C 2Z4HA 1FNWA 3PUVA 1TIID 2LS01 3J81E 4RAUC 1AN8A 1PTOF 3KBGA 1NSNS 4KHZA 3LNNA 5J1ZA 3I70A 1JOQA 2Q8RE 4PMWA 3PUWA 4X3UA 4HCEA 1S5ED 5IGFA 1JE4A 1SYFA 2J0TD 4HCSA 1XXGA 2CW0D 4XQJA 2XSCA 4FF2A 1IYVA 1AZQA 1NAPA 4ZUIA 1BQQT 4HR7B 3ZYYX 1CA6A 1SMYD 4TRDA 2B2UC 2E2HB 3FVQA 4OGQC 1SYBA 1MI2A 1OO9B 2HQEA 2BDOA 3MXNA 2HUGA 4B08A 3AMUA 4RCOA 3S1RB 4J8QA 3NTKA 2A68D 3I4MB 4IFDJ 4KHVA 2JP1A 4OL7A 2FMMA 1JC7A 1SJED 3HG9A 4L6TB 3VR5A 4B9XA 4V190 5CBEE 1PTOB 1DJRD 4KMUC 1B50A 2EE1A 4DNRB 4KKUA 5TSSA 3NSWA 3BVMA 3DWAA 4LMQD 2K5QA 2B2TA 4TKOB 5JEAJ 1SSOA 4FP5D 4KV6A 3S1NB 1SEBD 2F0WA 4QF4A 1H9KA 4TQUS 1G91A 1DXMA 3DWQA 1XWEA 3A8KE 3IL8A 2G9DA 1RJTA 3MZ5A 5EBCA 2F0OA 2E74C 1SNCA 3S17B 3KLSA 4XT3B 4A3MB 2K5WA 5EPKA 2D62A 2QILA 1Y8PB 3HKZB 4C3IG 5F2DA 1R4PB 1CQVA 3I73A 1JORA 2PPBC 4CJ2C 1TU2B 4RGOS 1Y8NB 1Q90A 5CV6A 3PUYA 4QUCA 1KABA 2DN8A 3CRLC 2IW3A 1A6XA 3A8JE 1LTBD 5M3MB 1VMPA 1JQYD 1O78A 1OXXK 4OO1I 1DYQA 2L0CA 2EYHA 1CHPD 4K14A 1BR9A 2FHTA 2N88A 2WP8J 3OSOA 4KK7A 2PNRC 1A3TA 4ZRZA 2EZVA 3I72A 2AUJD 4QIWB 2KCNA 4TSSA 2KVMA 1E2VA 3BVZA 1BNZA 1ENFA 1KLGD 3GO5A 3R2TA 2KOLA 1I4GA 5M3FB 1IW7D 5KIXA 1F9PA 1KTKA 4RH6A 3IAYA 2OF1A 4ME5A 3O13A 5T1IA 1CT1D 2WACA 5IIFA 1SYDA 2XIWA 3A55A 1EY0A 2YU9B 5JEAG 1I6HB 3V2TA 4DXFA 2B2YA 1LTRD 1PZID 4OO1G 5JVG3 4KD4A 5KEEA 3TDQA 2PYKA 4RCNA 3NXWA 1EIHA 1BCPD 3K5OA 3LX0A 1LTGD 5A35A 3A54A 4PQXA 4GZYC 3E5SA 3R93A 3NUCA 4KJOA 3OPOA 2SEBD 1Y69U 3SK6A 2KJXA 4C3HG 1TT2A 3H94A 2SDFA 5D3DA 2EJFC 2NVTB 3IFTA 4I65A 1TKWB 1X32A 1SMYC 1HTPA 5IGCA 2NTSA 3J7YW 1D1IA 3K5NA 3J7AV 4NW2A 5HGTA 3ITPA 2IT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2M A;  1STN A;  1A3T A;  5ISR A;  4ZQ3 A;  3C1E A;  4KTA A;  3RUZ A;  4K2L A;  3BDC A;  4HTH A;  1ENC A;  5I6W A;  5IOC A;  4WOR A;  1TR5 A;  1KDC A;  2PZW A;  2SOB A;  4KHV A;  5C5M A;  1STB A;  3C1F A;  3R3O A;  5CV9 A;  1EY6 A;  4NDX A;  4OL7 A;  3T13 A;  2F0D A;  5C6A A;  2EYM A;  4B9X A;  5CV5 A;  4E6I A;  5IGD A;  2QDB A;  2F0Q A;  2F0G A;  1A3U A;  2EYL A;  5C5L A;  2F0L A;  4ODG A;  5I6Y A;  5CR3 A;  3MVV A;  4N9T A;  5IGE A;  4ID6 A;  2F0P A;  3D4W A;  4DGZ A;  1SNM A;  3QOL A;  5KIX A;  1TQO A;  2F3W A;  1EZ8 A;  2EXZ A;  1KAA A;  2F0S A;  2RDF A;  4KY7 A;  4KY6 A;  4R8N A;  5EGT A;  5JOB A;  4DF7 A;  1NUC A;  4RKL A;  2F0V A;  1KDB A;  1JOK A;  5C3X A;  2F0T A;  2EYP A;  4KV6 A;  3S9W A;  4EQO A;  2F0I A;  2F0W A;  5C4H A;  1EY8 A;  2PW5 A;  3OWF A;  4QF4 A;  4K5X A;  1AEX A;  2OF1 A;  4ME5 A;  3SK5 A;  2EYJ A;  3TME A;  4KD3 A;  2WAC A;  1EY7 A;  1SNP A;  4K5V A;  4K8J A;  1SYD A;  4WRD A;  4G57 A;  5IIF A;  1EY0 A;  3MZ5 A;  5CV7 A;  2EYO A;  4DU9 A;  4F8M A;  3D6C A;  1IHZ A;  4K2K A;  1SND A;  4ZUJ A;  4K5W A;  4EQN A;  5I9O A;  3V2T A;  2F0O A;  1F2Y A;  4MIU A;  2F0K A;  1KDA A;  3QB3 A;  3NQT A;  5HUR A;  4B9W A;  2O4X A;  4NMZ A;  5I9P A;  2EY2 A;  1SNC A;  2EYF A;  2KQ3 A;  3PMF A;  5C3W A;  3TP6 A;  1JOO A;  4IAL A;  5CC4 A;  5KYL A;  5CV8 A;  4RKB A;  1NSN S;  2EY5 A;  3P75 A;  1A3V A;  5J1Z A;  4KD4 A;  5NUC A;  5EKL A;  1SYC A;  1JOQ A;  5KEE A;  5CV4 A;  3MXP A;  1STG A;  3MEH A;  3NK9 A;  5K5P A;  1SYG A;  2PYK A;  4N9P A;  3NXW A;  5IGF A;  4K8I A;  1STA A;  1RKN A;  1SYF A;  3LX0 A;  3NP8 A;  5F2D A;  1ENA A;  2F0N A;  2SNM A;  2RBM A;  2PZT A;  5C4Z A;  4NKL A;  1II3 A;  3E5S A;  2SNS A;  3SHL A;  1EYD A;  1EYA A;  1EQV A;  3DMU A;  3MHB A;  5M9O A;  2F0J A;  3NUC A;  4KJO A;  1JOR A;  2OEO A;  1SNQ A;  1SYE A;  4HMI A;  2KHS A;  3HEJ A;  5CV6 A;  3OMC A;  4QMG A;  4ZUI A;  4KY5 A;  1F2Z A;  3ERO A;  5EKK A;  4YIJ A;  2F0E A;  4S3S A;  3DHQ A;  3SK6 A;  4TRD A;  1KAB A;  1EY5 A;  2OXP A;  3NHH A;  1A2T A;  3BDL A;  3U9O A;  1TT2 A;  3SK4 A;  4EVO A;  2EY6 A;  2PW7 A;  4IUN A;  3SR1 A;  5IGB A;  3SXH A;  3SK8 A;  4J6H A;  3TP7 A;  2PQE A;  3OMG A;  4H7B A;  5DAU A;  5CGK A;  4F7X A;  4KJN A;  4IZ8 A;  4I65 A;  1SNO A;  4LAA A;  4DFA A;  4EQP A;  5J39 A;  4PMB A;  3P1H A;  5IGG A;  2M00 A;  5DEH A;  1SYB A;  4PNY A;  5J22 A;  2RKS A;  1STH A;  4K6D A;  2HQE A;  3T16 A;  4QB4 A;  1A2U A;  5KGU A;  5IGC A;  4PMC A;  5KYI A;  2EYH A;  2F0U A;  3D8G A;  2F0M A;  2NUC A;  1EY9 A;  2PZU A;  3ERQ A;  1EY4 A;  3EVQ A;  4K14 A;  2F0F A;  3D4D A;  2F0H A;  3TP8 A;  3H6M A;  5HGT A;  3EJI A;  1EYC A;  4HMJ A;  1STY A;  2ENB A;  3QOJ A;  5E1F A;  3OSO A;  2EY1 A;  4NP5 A;  5JAV A;  5KRU A;  4J1M A;  3VA5 A;  5IOD A;  1EZ6 A;  2LKV A;  3HZX A;  1U9R A;  5E3F A;  2F3V A;  3ITP A;  3TP5 A; 
#chains in the Genus database with same CATH topology
 1F2M A;  1HFG A;  4DR6 L;  1ML0 D;  4KI0 A;  3GTG B;  3CCV A;  2VUM H;  4BY7 B;  4DPG A;  2JXM B;  1KDC A;  2K75 A;  2PZW A;  3J81 i;  3S14 B;  1STB A;  3R3O A;  4IUR A;  3C2P A;  3L0O A;  1EEF D;  2XWB B;  4LF6 Q;  2R93 H;  5M5Y H;  2WAQ E;  2JK8 A;  2K03 A;  1PFM A;  3RR5 A;  3K57 A;  1X55 A;  2QEJ C;  5C5L A;  5I6Y A;  3T51 B;  2A68 C;  3T56 B;  1X6O A;  3P7J A;  4FVM A;  5IE8 A;  3TRE A;  2J7Z A;  1KL9 A;  5EPJ A;  4B3T Q;  1SR3 A;  3MXU A;  5C4X G;  2LXK A;  3U58 A;  1CZG A;  5CMD A;  3QWN A;  1EWC A;  3CCJ A;  1BO0 A;  2Z0S A;  1EU3 A;  3PIO A;  4GN4 B;  2KEE A;  2UXC Q;  2JA6 G;  1SNP A;  1HJP A;  4F8M A;  1ASY A;  1IHZ A;  1WD1 A;  1SND A;  4AYB B;  4IPC A;  2JA8 G;  2F0K A;  4XDX A;  3NQT A;  4B9W A;  4JI6 L;  1FNV A;  1E24 A;  2CQO A;  4KHP L;  1TS5 A;  1MHW C;  1PH1 A;  1NCV A;  3K0X A;  2BH2 A;  4DV0 Q;  3K7U C;  2BE5 C;  2R7F A;  2ICE C;  2XNA C;  2R92 G;  2B2U A;  2ZXP A;  2Z6B A;  1IBL L;  1JJ2 A;  2UU9 Q;  1WFQ A;  1TWA B;  2WAQ B;  3KF8 B;  1I4P A;  4LUV A;  1RDP D;  2RBM A;  3HOY G;  4Y7N H;  5M3F H;  5BN5 A;  1K8O A;  4K6L A;  4QGU A;  5M9O A;  1ILP A;  1QJO A;  2F0J A;  4L63 B;  1X54 A;  3KLR A;  1GJX A;  2F1M A;  4ALP A;  3FPP A;  2IX1 A;  4RGT A;  3HS0 C;  4APV A;  3NHH A;  3G48 A;  1A2T A;  1S4Z A;  5G3L F;  1WTX A;  4IUN A;  1ROD A;  3B6Y A;  1WTW A;  4X62 L;  4BBS G;  2AQ3 B;  3J7A 5;  4DV2 Q;  4IZ8 A;  1B3Q A;  1SNO A;  1I3Q B;  1V1P B;  2MJ8 A;  3U9S A;  3BJU A;  2P5Z X;  2RKS A;  3FDT A;  4K6D A;  2NWG A;  4LW1 A;  5IT9 L;  4C3I H;  3KF8 A;  5BR8 L;  3S2H B;  3OW7 A;  1EY4 A;  2K5N A;  2N3S A;  3EJI A;  5E1F A;  3K7A B;  3TEH B;  3VA5 A;  1WTQ A;  1IL8 A;  2E75 C;  3PO2 G;  2L9H A;  4DUZ L;  1UE1 A;  1VQG A;  3E3X A;  1XTD A;  4NDX A;  1K0S A;  1G6P A;  1TXY A;  1B7Y B;  2B63 B;  4ILW A;  5IGD A;  4ODG A;  1V1P A;  5CR3 A;  3MVV A;  2K5V A;  4A3J H;  1JCK B;  1HZ9 A;  3QOL A;  3S16 H;  3GTQ B;  1EZ8 A;  5IP7 H;  4R8N A;  3TSS A;  1GXD C;  2EJG C;  2ZM6 Q;  3OHX C;  1BBX C;  5C4H A;  2MP1 A;  1S5D D;  3EIV A;  2VQE Q;  3SK5 A;  2BH8 A;  4C1N I;  2A5H A;  2VY3 A;  2UUA Q;  3GTJ H;  4HIK A;  1ET9 A;  1Z6H A;  2ZTE A;  1IYU A;  1PFB A;  1F2Y A;  5HUR A;  3CAM A;  4JC0 A;  1CSP A;  5JJL A;  5C3W A;  1J6Q A;  1P16 A;  5EQ0 A;  3H0G B;  4A3F H;  1STE A;  1GHJ A;  3FRP B;  1A3V A;  4DR2 L;  2WKD A;  3BG3 A;  1JR0 D;  1Y1V B;  1VQA A;  3A74 A;  5EKL A;  5FK9 C;  3D0F A;  2EDG A;  1G51 A;  4POF A;  2OT2 A;  3M7G A;  1RCV D;  3CC2 A;  3QJY A;  1G29 1;  4X3K A;  2AWO A;  1EFI D;  3OOC A;  5IYD G;  3RLF A;  1EY5 A;  2I07 B;  2EY6 A;  4JYA Q;  2C35 B;  1TWH B;  3SXH A;  2CWP A;  3NWT A;  2DNC A;  4JBM A;  4OO1 H;  2Z6K A;  4DAM A;  2NZH A;  4H44 C;  1FL0 A;  1CA5 A;  1STH A;  2VXW A;  1GM5 A;  1N9W A;  1HQM C;  2LXJ A;  2F0M A;  1IYJ B;  4AH6 A;  1HH2 P;  1RL2 A;  2F0F A;  1G6Z A;  2IY5 B;  1TVX A;  4DR3 Q;  2CVR A;  3DEO A;  4LF5 L;  3M4O H;  1GUO A;  3M4P A;  3HP3 A;  2NVY H;  5FO7 B;  3UDG A;  3QR8 A;  2JN4 A;  5C5M A;  1GUW A;  5KND A;  1WTV A;  2N55 A;  3CD6 A;  2JA5 G;  1JIC A;  3HOW B;  4YY3 L;  4YCV A;  1IBM Q;  3UDX A;  2VL6 A;  5G3L D;  3TZD A;  1TWC B;  1SLJ A;  2E8G A;  4A3B B;  3M85 A;  3HOV H;  1CKN B;  1WCM B;  4BXX H;  5GAG C;  5JOB A;  4ABN A;  3GTK B;  1VQ8 A;  2EIF A;  3RN2 A;  4LFB Q;  2EYP A;  2K50 A;  3PF5 A;  1ASZ A;  5EJW A;  1HUN A;  3NTH A;  2BDN A;  3HOX B;  4XYO A;  1SN8 A;  3D6C A;  5I9O A;  4C56 C;  2KCC A;  4LFB L;  4DNI A;  2EYF A;  1VQJ A;  2Z9H A;  3WDN A;  4XQN A;  4O0A A;  2QGQ A;  2GA4 B;  5FO9 B;  5GQO A;  1D5Z C;  1CKN A;  5NUC A;  2O5I C;  1HHV A;  4WJ3 M;  2RCF A;  3PUX A;  3CCM A;  5FLM G;  1STA A;  5ELN A;  3T4A C;  4DUY Q;  1A8V A;  1G2S A;  3L7Z C;  1GOZ A;  4P72 A;  4U68 A;  3BZC A;  1GUN A;  3DWP A;  2L5T A;  4A3I B;  3I7F A;  4LWC A;  1Y1W B;  2FMC A;  2RQX A;  2LY7 A;  2X69 A;  4YIJ A;  4QUF A;  1L1O B;  2AQ2 B;  2WB1 E;  3H3V C;  2PW7 A;  1WD0 A;  3CQZ B;  4IUU A;  2K5D A;  1MJE A;  3OMG A;  2L1B A;  4H7B A;  3I4N H;  2UXD Q;  4Z9C B;  4LAA A;  1W6J A;  3MXN B;  5IGG A;  1MGS A;  4JBK A;  2ZT9 C;  4Q5V A;  3D8G A;  3ERQ A;  3OYY A;  5D65 A;  3HOY H;  2IHE A;  1B4O A;  3H6M A;  1Y1V H;  2M2L A;  2A69 C;  2LKV A;  4POG A;  4KTA A;  4O42 A;  2BCO A;  2H4O A;  4A3D G;  4ZQ3 A;  1T5E A;  3S1M B;  3BDC A;  1XNQ Q;  5LL6 X;  1Q1B A;  1PH6 A;  1JB3 A;  1HR0 Q;  4BBS H;  2E76 C;  3T13 A;  2Q2T A;  2Q8T A;  5CBA E;  1C48 A;  4OWW B;  2AWN A;  4E6I A;  2B39 A;  1WI5 A;  2MQH A;  2NZO A;  2CH4 A;  2D0O A;  2WB1 B;  4GLX A;  1MSH A;  2QDL A;  2FXQ A;  4KY7 A;  4K0K Q;  2N78 A;  2PI2 E;  1KDB A;  2RA4 A;  3S9W A;  2ZJR A;  1O7Z A;  5LHY 1;  1LV9 A;  1DOM A;  2J4X A;  3PO2 H;  5IY0 A;  1U4M A;  4BY1 B;  3KJP A;  1I50 H;  3Q23 A;  1K3R A;  1QZH A;  3HKZ E;  1XMQ L;  5I2X A;  1VQE A;  5M3M G;  2TMP A;  2B8F A;  1KDA A;  1Q81 C;  5LL6 S;  4OX9 L;  1LLR D;  3D31 A;  4A3E H;  2A1A A;  4LF8 L;  1BCP F;  1S5B D;  1QUQ A;  1FYC A;  1DD2 A;  3W1B A;  4CDD C;  3VR3 A;  1HZA A;  4BWG B;  1ENA A;  2F0N A;  5C4J B;  5ELB A;  5C44 B;  4NXM L;  2HIV A;  4DK3 C;  5C0X J;  3HOZ G;  4JVZ A;  2BE5 D;  1KRT A;  4RHS A;  2OEO A;  4GNX B;  1PFN A;  1GUT A;  2KHS A;  1NBW A;  2ZXR A;  2O2L D;  3ERO A;  3I55 A;  3EA6 A;  3DHQ A;  3QIA A;  4UP9 A;  3U9O A;  2NYZ D;  2JQO A;  1CSQ A;  1HXY D;  4IUV A;  2NVQ B;  1RTO A;  4GKK L;  2PQE A;  5DAU A;  1Z9F A;  1F2L A;  4IFD I;  3HRZ C;  1VQ5 A;  1TWG B;  4QIW E;  1PRT D;  4A3G B;  4FXK C;  1UE6 A;  4JI3 L;  3CPW A;  4YHH L;  4EGV A;  3W1G A;  3F1Z A;  2VUM B;  2K28 A;  4OIJ A;  3CME A;  1EFW A;  4JI8 L;  3C46 A;  3S24 A;  3AB9 A;  2IPK D;  2R93 B;  5M5Y B;  2KUM A;  1K83 H;  1F9S A;  3FKI B;  5EBD A;  5JAV A;  1VMC A;  5E3F A;  1W6K A;  3M4Q A;  5ISR A;  4FXD A;  3N6R A;  1RHP A;  5IYD H;  1PLF A;  4MTK A;  3M4Y A;  4LFA L;  3ONA B;  3J7Z C;  3GQB A;  5CV9 A;  1EY6 A;  4M8A A;  1ONL A;  3W3A A;  1Z7T A;  3DUZ A;  1BCP B;  3CKI B;  3ICE A;  1WTH A;  2F0P A;  4UDU C;  1HNW Q;  3IFD A;  1AFP A;  2MPM A;  5D14 A;  4DR1 Q;  1QNU A;  3W2D A;  2I46 A;  4DF7 A;  5KNC A;  1LTT D;  1QZG A;  2F0I A;  2Y0S G;  3CCE A;  1QWY A;  4LF7 L;  4IJL A;  3RZO H;  3NEM A;  3MAQ A;  5EAY A;  3OTO Q;  3TME A;  1VQB A;  1PV4 A;  4BA2 I;  2F52 A;  2EYO A;  5ELD A;  3EFX D;  1K8M A;  4JI2 Q;  3QB3 A;  3E9H A;  4R4Q A;  5I9P A;  2K1B A;  4CGY B;  2XRS D;  3S1M H;  4IFD G;  5M5X H;  3PMF A;  3L9A X;  4JBJ A;  4Y7N B;  4XT1 B;  5AJ3 Q;  4ME3 A;  3I8Z A;  2R3Z A;  4C3J G;  2HDM A;  1SYC A;  1VQO A;  2A6H C;  1YI2 A;  1N36 Q;  4DV5 L;  3S2D H;  1FJG Q;  1JJG A;  5IP9 G;  4R9W A;  5FLX L;  2A19 A;  2EQS A;  1S5C D;  2JEA I;  1T5X D;  5C3E B;  2FJ2 A;  3BU2 A;  1MSG A;  4QJF A;  5FJ8 G;  4XQQ A;  4C3I B;  4GOP C;  4DR7 L;  3IRB A;  2KEC A;  3PO3 H;  4BBR G;  2ZJQ A;  3NPP A;  2VNU D;  4JI7 Q;  1D7Q A;  2QA4 A;  4LFC Q;  1YJW A;  4G7Z C;  2B2W C;  3D6W A;  3T1H L;  1E2W A;  1Z47 A;  4JK1 C;  4IQZ A;  1LTA D;  5KGU A;  2HCI A;  1JMC A;  2F0U A;  3EVQ A;  2NUC A;  1RF2 D;  5HY6 A;  3W5O A;  4A3C H;  3D4D A;  3H09 A;  2B2V C;  3TP8 A;  1AP0 A;  1EYC A;  3VA7 A;  3DXJ C;  3KJO A;  1OXU A;  1EZ6 A;  3MWY W;  1NR4 A;  3TP5 A;  1STN A;  1G8Z D;  5C44 H;  4CBV A;  3STB C;  2K01 A;  4A3J B;  2F4V Q;  3S16 B;  2EXD A;  4AQY L;  2A6E D;  3JAM L;  2KHI A;  1J5E L;  3V96 A;  1EQR A;  2DY7 A;  2MUY A;  4PG3 A;  1B44 D;  2WAQ G;  2H1E A;  5LMN L;  3PIP 3;  4AYB E;  2I5M X;  1XX8 A;  1TS4 A;  2NVQ H;  3F8T A;  1VF5 C;  1FGB D;  3S1Q H;  5DLQ E;  1HNX Q;  1J8I A;  1TQO A;  2F3W A;  2EXZ A;  2D2C C;  1KAA A;  2F0S A;  3CRK C;  3Q22 A;  3GTJ B;  4JI5 Q;  5EGT A;  3GTL B;  3MEF A;  4P2C B;  1JOK A;  1V43 A;  1HPC A;  1JB7 A;  4A3F B;  4G57 A;  1Q1E A;  3FKI H;  4KN4 C;  4CKC A;  2ATW A;  1QG7 A;  2WV6 D;  4F88 A;  3UE0 A;  5KNB A;  3LWE A;  1SRU A;  2K6A A;  3LWU A;  5CC4 A;  1OXS C;  4P74 A;  5CV8 A;  5HGQ A;  2JA9 A;  2EVB A;  4HSV A;  4DXG A;  4B3M Q;  4L5S A;  3P75 A;  4LF6 L;  3WOE A;  3HGB A;  4A76 A;  1CQF A;  2B29 A;  1WJJ A;  1I5F A;  3CXC A;  1YIJ A;  2UUB Q;  4ZAI A;  2BA1 A;  5K5P A;  2YYZ A;  4QY7 A;  1R9T H;  1UUP A;  1A63 A;  1TS2 A;  4YCU A;  4OEM B;  1WTO A;  1PH8 A;  1SRO A;  1O80 A;  2C5C A;  4HSP A;  2SNS A;  3SE0 A;  1N33 Q;  1NR2 A;  1VQF A;  2AMC B;  4B3T L;  1SYE A;  4HMI A;  2C9O A;  2LSS A;  2NBF A;  2PCF B;  2GN5 A;  4OWT B;  1AW7 A;  4XTC S;  2E2J H;  1D5M C;  2E2I H;  4JOI C;  2B63 G;  1D5X C;  4O1N A;  4N8F A;  5IGB A;  2UXC L;  1A62 A;  3M3Y H;  2PMZ B;  2CKZ B;  5I4D A;  2Q2I A;  4IPD A;  1XPO A;  3I4L A;  4EQP A;  3NWS A;  3M4O B;  4YCW A;  4WJ4 A;  2O5J C;  1JWS D;  2NVY B;  2X6L A;  4JCV E;  4C3H B;  3RMH A;  3FEW X;  4DV0 L;  2Q8I B;  2K52 A;  1PH4 A;  2NTT A;  3K58 A;  3UI2 A;  2ENB A;  2ZTC A;  3UDF A;  4J1M A;  5IOD A;  4IUP A;  2UU9 L;  1PRT C;  4V0B A;  5K36 G;  2EPB A;  2HCC A;  1L2F A;  3HOV B;  1VF7 A;  2L4N A;  3Q24 A;  5C3E H;  1VQ4 A;  2JSO A;  2QEX A;  2ZJP A;  2A69 D;  1AZP A;  2EYM A;  3KF6 B;  2CCZ A;  1E2Z A;  1DOL A;  2QDB A;  2Q2H A;  1O7Y A;  4PZ7 A;  4ID6 A;  1E0B A;  1EIG A;  1B3A A;  1AH9 A;  4R4C A;  4DV2 L;  2CH4 W;  1ZKO A;  1JWU D;  4IO9 A;  4B3S Q;  1YHA A;  1SAP A;  1BOS A;  1M4V A;  3GTP B;  4RG1 A;  3G7L A;  3JAM E;  4GS3 A;  4R4O A;  4U67 3;  2LFN A;  5C4X B;  1KRS A;  4H13 C;  1PTO C;  3KF6 A;  3NBH A;  3TP6 A;  1R4Q B;  2A74 C;  4RKB A;  3M7N A;  3OWE B;  1WYD A;  3X3M A;  2ZXO A;  4N9P A;  1L0Y B;  3SEB A;  1HCZ A;  2XWJ B;  5GAD C;  3H3V H;  2DJF C;  4GN5 A;  3DMU A;  3T53 B;  1I94 Q;  3I4N B;  3GTL H;  2ZM6 L;  1GUS A;  4DV6 Q;  3HOU G;  4HJ7 A;  1SFO H;  1QCB D;  1VDZ A;  4MHE A;  1KQS A;  1XJV A;  4IFD H;  2VQE L;  1PH3 A;  3A5Z B;  1XYI A;  1PHJ A;  3BDL A;  1TWF B;  4JG2 A;  4EVO A;  3HOY B;  1LT3 D;  2UUA L;  3K81 C;  3TP7 A;  2D9U A;  1VQH A;  4HJA A;  5M5W H;  5J39 A;  3MFY A;  5IYB H;  4B3R Q;  3TS0 A;  1QVF A;  5DEH A;  4PNY A;  1EWI A;  2R7D A;  1X3E A;  2RCN A;  1WVL A;  1PMR A;  1YJ9 A;  5IP9 H;  1CTM A;  2I5L X;  4HAE A;  4MTN A;  4FYD A;  5JEA H;  4BBS B;  1BKB A;  2RHS B;  3EQL C;  4DNT B;  3HOX G;  4ZCK A;  4FF3 A;  1U9R A;  5T1G A;  3GTO H;  4WFN 3;  1NTG A;  1SBB B;  1QVC A;  4A93 H;  1X56 A;  2JE6 I;  4A3K G;  1GO3 E;  2R7Z H;  4GLA C;  1EOT A;  4BBR H;  1RIP A;  1HTL D;  1BUV T;  3FMC A;  1WTP A;  4GOP B;  4CKE A;  2F0Q A;  4GKJ Q;  3PO2 B;  4WJW A;  5FO8 B;  4JYA L;  3F2D A;  2JA7 H;  1DCZ A;  1I50 B;  3AEV A;  1VS0 A;  1UNS A;  2A6E C;  2TSS A;  4RKL A;  1BVS A;  4CJ0 B;  1A0I A;  1Y1W G;  3BZD B;  2L15 A;  2PW5 A;  1CKM A;  3VDY A;  4A3E B;  4C3H H;  2K04 A;  3T1Y Q;  3CCU A;  1VQD A;  1EY7 A;  4K5V A;  2YTY A;  1TS3 A;  3BYY B;  3VYU A;  4DR3 L;  3MFG A;  1IKL A;  5IT9 E;  4IAL A;  3CMA A;  4GOP A;  1B1Z A;  2HT1 A;  4CDE C;  4X66 Q;  2GVB A;  2EY5 A;  1NY4 A;  1IBM L;  1DON A;  4M1U B;  4A3L H;  4HN7 A;  3K5L A;  1RTN A;  3E6Z X;  3NP8 A;  4UP7 A;  1Q8K A;  2B2W A;  4NKL A;  2KA7 A;  5A2Q L;  4N8X 1;  3CCL A;  3JC6 6;  1H9M A;  1LTS D;  2B2V A;  2R6G A;  2A6H D;  1IBK Q;  1F2Z A;  3PGZ A;  1HRJ A;  2X6G A;  4HJ5 A;  1PRT F;  4G4K A;  1S40 A;  2OXP A;  1QOH A;  3GTP H;  2MNA A;  1YNN C;  4J6H A;  4DR5 Q;  3AFP A;  1K83 B;  1MKH A;  3MXG A;  2ICI A;  4TVA B;  4FF1 A;  1X3P A;  1U4R A;  3MTS A;  4FNF A;  3UE1 A;  5I2Y A;  5C4X H;  4DR4 Q;  1DZ1 A;  2QKI C;  4OEL B;  4JBW A;  3TN2 A;  1S5F D;  3I4M G;  4RA8 A;  1EY9 A;  2JA6 H;  1HA5 A;  4BY1 G;  2IX3 A;  3SGI A;  4JI1 Q;  3NEL A;  1LTL A;  2JA8 H;  1Q8I A;  3HZX A;  4DUY L;  1ESR A;  3CCS A;  4BA1 I;  5EKI A;  4ZYS A;  5ELC A;  2CHB D;  3RLN A;  4JV5 Q;  4RGM A;  3RUZ A;  2VQF Q;  3A0J A;  4Y52 H;  1TR5 A;  5FKA C;  2R92 H;  2V4D A;  5FLX c;  4KKT A;  1E1T A;  4C2M H;  2I0Q A;  3VYT A;  2E5L Q;  1H9R A;  2A73 B;  1K8A C;  1UEA B;  1XNR Q;  1PH9 A;  3STB D;  1TWF H;  2F0L A;  4NXN Q;  3RZO B;  2JEB I;  2PO4 A;  2JA5 B;  2UXD L;  2MO1 A;  5LMU Q;  2IJ0 A;  2UXB Q;  1CK1 A;  3KUP A;  1XTC D;  4MZ9 A;  1D1K A;  2KCM A;  3EN2 A;  5M5X B;  5K36 H;  1YIT A;  4DK0 A;  1E1O A;  3CHB D;  1D2B A;  1EQQ A;  4A3M G;  3KDF B;  4KD3 A;  2Z1C A;  4DV3 Q;  3MA2 B;  2XRQ D;  3PQI A;  4K2K A;  5LMU L;  1PRT B;  4EQN A;  3HKZ G;  4XIG S;  2O4X A;  4NMZ A;  2OWO A;  3S2D B;  2OQK A;  1QUQ B;  4UHV A;  3E0E A;  3F2B A;  2HHH Q;  5KYL A;  1XNQ L;  3AYH B;  4JOI A;  3RZD H;  2VB3 X;  1HR0 L;  4ZKB B;  4RGN A;  4DK1 A;  4O2D A;  3K5M A;  3JAM c;  1CFM A;  4HJ8 A;  5CV4 A;  1C9O A;  2MFI A;  5JPN C;  1FR3 A;  4K8I A;  4MN3 A;  2PZT A;  3PO3 B;  1YBY A;  1B8A A;  1EQV A;  4K0K L;  3KDF A;  1I4R A;  4KLK A;  1I4Q A;  4DAY A;  1LT6 D;  3G4S A;  3KFU A;  2L12 A;  1PZK D;  2F0E A;  4OIK A;  1TY0 A;  5BN3 A;  2ASB A;  3QO2 A;  5DM6 3;  3SK8 A;  3CCR A;  2NN6 I;  1NE3 A;  2XN9 C;  2XGT A;  2DY8 A;  4C1N K;  4QB4 A;  1A2U A;  4LUZ A;  2NVX H;  3SR1 A;  2PZU A;  4DV7 Q;  5A2Q E;  3A8I E;  2Z4I A;  3WWV A;  4HMJ A;  5ELF A;  1STY A;  4HID A;  3BS1 A;  1X9N A;  3BVG A;  4ULL A;  5GAE C;  1CI3 M;  4JI4 Q;  3GD7 A;  3HOU H;  3F2U A;  3J81 j;  2VB2 X;  3CP0 A;  1V8Q A;  3S15 H;  1VQL A;  4HTH A;  5M3F G;  2KEN A;  4CJ1 B;  3S1Q B;  2WII B;  4XYQ A;  1N32 Q;  2FFK B;  1ZYR C;  4A3D B;  3BDO A;  5IYC G;  1HQR D;  1L0W A;  3AQQ A;  5CYU A;  4X65 Q;  3VYR A;  1SNM A;  4DAV A;  2FIN B;  4JW0 A;  4Q0F A;  5DNF A;  4DV4 Q;  3J7A F;  3L2P A;  1XMO Q;  1U4L A;  1P8L A;  5C3X A;  1I6V C;  3V05 A;  2RSO A;  4EQO A;  5IWA Q;  2KED A;  1C7Y A;  1EY8 A;  2HD3 A;  3VR6 A;  1QIL A;  1AEX A;  4PZ6 A;  3ULP A;  4JI0 Q;  5JJZ A;  1OTC A;  4A3K H;  4WRD A;  3CU7 A;  4X6A H;  2D0P A;  5C0X I;  4ZK9 B;  4ZUJ A;  2K7V A;  1XMO L;  5FOB B;  1R9T B;  2D5D A;  1YNX A;  2AUK A;  2NN6 G;  1AE2 A;  3I91 A;  2VS1 A;  1OXT A;  3WOF A;  4R8I A;  1LT4 D;  3IKJ A;  3AU7 A;  3ND8 A;  1Y8O B;  4HIO A;  1DM0 B;  1EQT A;  1PYB A;  2E2J B;  3GP7 A;  3MEH A;  2E2I B;  3I4O A;  1PZJ D;  3J80 L;  1PTO D;  1LM0 A;  1U0L A;  3LGJ A;  5IT9 c;  4UY8 C;  3H91 A;  5C4Z A;  3D4R A;  1X3Q A;  3M3Y B;  1HNW L;  5EPL A;  4DR1 L;  4KKS A;  4A3J G;  2JA5 H;  1VQC A;  1SNQ A;  3KLS X;  5IP7 G;  2R61 A;  3RNU A;  1F9Q A;  3I3C A;  3K80 C;  3OTO L;  1EEI D;  1B2T A;  3HOZ B;  2EJM A;  1E7Z A;  1XPU A;  4F7X A;  1EUJ A;  4JI2 L;  4R1J A;  1JT8 A;  4DFA A;  1PXU A;  1LAB A;  3P1H A;  4ZLT F;  5J22 A;  3G71 A;  1OXV A;  4UAI A;  4BY7 G;  5AJ3 L;  1NMF A;  4A3F G;  3Q6S A;  2E2H H;  5GAH C;  4L8J A;  3ULJ A;  1BF4 A;  3FP9 A;  1N36 L;  5C0X G;  1ET6 A;  1YNJ C;  2K05 A;  2ES2 A;  1FJG L;  4DAP A;  1HNZ Q;  1CUK A;  1D6E C;  5IOC A;  5DM7 3;  4CDC C;  3R2I A;  2F4I A;  3C3L A;  4DA2 A;  1DOK A;  4OXP A;  2AQ1 B;  4LF9 Q;  3S1R H;  5FLM H;  3SVM A;  1B9M A;  1GUG A;  4LF4 Q;  1EL0 A;  4XXE A;  1M8A A;  1UAP A;  1SE3 A;  1ICW A;  5E4X A;  4GLV B;  2KBN A;  4OON A;  1KNE A;  3D4W A;  3I4M H;  1JE5 A;  4JI7 L;  5KRU A;  4LFC L;  4DN4 M;  4AYB G;  1NUC A;  2F0V A;  1KHI A;  5LMN W;  1PTO H;  1B9N A;  1WTR A;  4RHR A;  3K59 A;  4LNQ A;  3L3O C;  2AKW B;  1EU4 A;  4DU9 A;  1EWH A;  2UUC Q;  1BDO A;  2HDL A;  3G6J B;  3VR2 A;  3S1N H;  2Y0S B;  2EY2 A;  2KQ3 A;  1V1O A;  1VQ7 A;  1JOO A;  2F4V L;  2RVL A;  1NNX A;  1FVI A;  2IL8 A;  5JVH 3;  1GHK A;  2DGY A;  2MGS A;  1J9O A;  2NB0 A;  1VQI A;  2CW0 C;  2WKC A;  4AIM A;  5L37 A;  4DV1 Q;  1SFO B;  3HKS A;  1STG A;  4A3D H;  2PMZ E;  1VQK A;  1YHQ A;  4X64 Q;  1KLU D;  4RFB A;  4FO2 A;  2SNM A;  4DR6 Q;  5E7N A;  1CZW A;  3UDI A;  1CHQ D;  1HNX L;  3S17 H;  1VQ6 A;  4A3M H;  4JI5 L;  4HIM A;  5M5W B;  3VR4 A;  4C3J B;  3HEJ A;  4HJ9 A;  4IOC A;  3OMC A;  1S3O A;  3OW2 A;  4IPH A;  1SJH D;  4LUO A;  4CKB A;  2B8G A;  3U50 C;  1KC8 C;  3X3N A;  3PUZ A;  5CGK A;  4KJN A;  1IKM A;  3K6O A;  3GTO B;  4LK1 C;  3J80 E;  4A93 B;  2R7Z B;  4B3M L;  1YNN D;  1SDF A;  2IX0 A;  2K33 A;  4BBR B;  2F0H A;  2UUB L;  4NP5 A;  2EY1 A;  3MC0 B;  5M3M H;  4A75 A;  2HQL A;  2F3V A;  3DM3 A;  1TY2 A;  2I5H A;  5D3I B;  4ZKC B;  1PA6 A;  4JI6 Q;  4IN3 A;  2JA7 B;  4KHP Q;  1N33 L;  1L1O C;  1YHB A;  2RF4 A;  4WOR A;  3C1F A;  4IUQ A;  1E3P A;  1IBL Q;  5C6A A;  4EX5 A;  1VCI A;  5JPM C;  3HOZ H;  2EOT A;  5FLX E;  3NQI A;  1LAC A;  4RWS C;  2WFW A;  1LUZ A;  2JYO A;  3I4N G;  1C4Q A;  1KAW A;  2JJQ A;  3P20 A;  1C8C A;  2YTX A;  1KD1 C;  1LO5 D;  4K5X A;  2F03 A;  4GN3 B;  2EYJ A;  3H0G G;  4L5R C;  3ER0 A;  4K8J A;  5ELE A;  1I4H A;  4X62 Q;  1Y1V G;  1MD2 D;  2Z8L A;  3NBH B;  1HZB A;  1BXT A;  3Q8D A;  3FPU B;  2BOS A;  3H15 A;  2IHF A;  5IYC H;  3PSI A;  1Q46 A;  2F3I A;  5AFW A;  5BR8 Q;  2B2T C;  1YJN A;  4OHJ A;  2N49 A;  2QF7 A;  2L11 A;  2YU9 H;  1PYW D;  3ULL A;  1I6H H;  5COY A;  1ICF B;  1EIF A;  2XVS A;  3MXP A;  1SYG A;  3KK7 A;  1JJC B;  1ZEQ X;  4H02 A;  2VW9 A;  1RKN A;  1ILQ A;  4DUZ Q;  3KOJ A;  2G5D A;  1EYD A;  1EYA A;  3MHB A;  1H95 A;  4B3S L;  2MHV A;  3BYT B;  3K8A A;  4LJZ C;  4KY5 A;  1CKO A;  3N52 A;  2NN6 H;  3QG1 A;  3SK4 A;  2JA6 B;  3CF5 A;  1AE3 A;  1FGU A;  2K5H A;  4P75 A;  1KNA A;  2JA8 B;  1QB5 D;  2OTL A;  5E4W C;  3I90 A;  3NE5 B;  3T16 A;  1X3F A;  4PMC A;  4A3E G;  1CM9 A;  1LYL A;  4X3T A;  2R92 B;  2PQA B;  1VQ9 A;  3HOW G;  4C2M B;  2NVT H;  3GV3 A;  1N8R C;  4F87 A;  4GNX C;  3TZU A;  4H0L C;  1KIX A;  2M9V A;  3R8B A;  1L0X B;  1PYS B;  4A3B G;  3PIO 3;  1LTI D;  1ENC A;  4I7Z C;  1WCM G;  1I94 L;  1PDQ A;  2SOB A;  1IW7 C;  3DEP A;  3TBI B;  4C3J H;  4DV6 L;  3CW2 C;  3Q0A A;  4DR2 Q;  3KYH C;  1QNK A;  1UWV A;  4IPG A;  1B53 A;  3GDE A;  2CFM A;  3KBX A;  3J81 L;  5CV5 A;  4FDB A;  1S72 A;  2F0G A;  2EYL A;  4PZ8 A;  2CWA A;  2K32 A;  3GTG H;  3I56 A;  5IGE A;  3NBI A;  4BY7 H;  5ELO A;  2E2D C;  3S14 H;  4KY6 A;  2PQA A;  3A7A B;  4B3R L;  3PV0 A;  1ZYR D;  5FJ8 H;  2F0T A;  1RD9 D;  1Q12 A;  5C0X H;  2DUD A;  4QCL A;  1FNU A;  1SXT A;  3RD4 A;  3RZD B;  3E0J A;  5CV7 A;  4KN7 C;  1V9P A;  3VYS A;  4K5W A;  1HUM A;  4MIU A;  3RN5 A;  1Q3L A;  1GD7 A;  1BCP C;  1GVP A;  2RHQ B;  1H9J A;  3KLW A;  3OIP A;  5J3B A;  1G2T A;  3NK9 A;  4A3I G;  3GV6 A;  4GKJ L;  1H9S B;  4LF5 Q;  1LT5 D;  1A15 A;  4G7O C;  1II3 A;  3SHL A;  2VZA A;  1SE8 A;  2WIN B;  4P71 A;  4JPB W;  4YY3 Q;  4IUT A;  4NB3 A;  3SDZ A;  3CPF A;  1SE4 A;  1Y14 B;  4QMG A;  2B2Y C;  3E9I A;  4X3S A;  5COR A;  5EKK A;  2IWH A;  4S3S A;  1TWA H;  3T1Y L;  2OCE A;  2NVX B;  2NZ1 D;  4J15 A;  1W2B A;  4CHT B;  1UE7 A;  3D3R A;  3ND9 A;  3GTM B;  3HOU B;  4PMB A;  1UE5 A;  2M00 A;  1ESF A;  5BN4 A;  2K4K A;  3U4Z A;  5KYI A;  1I4X A;  3S15 B;  2RSN A;  5H1S E;  4X66 L;  1QE6 A;  4FXG C;  1H9S A;  1BBU A;  2L55 A;  4BS9 A;  3NTI A;  3QOJ A;  1U4P A;  4G7H C;  1FD7 D;  3CCQ A;  1HFN A;  1K28 A;  1F77 A;  1JWM D;  3DM1 A;  1I3Q H;  1MBY A;  2CQA A;  1O7L A;  3OIQ A;  3J80 c;  3C1E A;  2YTV A;  4A4I A;  4HED A;  4K2L A;  5I6W A;  1K9M C;  3TQY A;  2RDH A;  3A7L A;  3S2H H;  4FF4 A;  2WB1 G;  3K0Y A;  3URY A;  3AFQ A;  1K73 C;  1IBK L;  3K7A H;  2F0D A;  3BZK A;  1YNJ D;  3FHW A;  1SE2 A;  2GVA A;  2DNE A;  2QCP X;  2ID0 A;  1XPR A;  1A3U A;  1NJI C;  4QQB X;  3A56 A;  1F9R A;  4N9T A;  2LMC B;  4A3K B;  4DR5 L;  3PO3 G;  4DGZ A;  1HA6 A;  2RDF A;  4DR4 L;  1ZXT A;  2PNH A;  1B70 B;  2G9H D;  2RDG A;  4DK6 C;  2B63 H;  2MO0 A;  3OWF A;  1UEB A;  2BA0 A;  4PV1 C;  2Z4H A;  1PH2 A;  4A3C G;  4JI1 L;  1FNW A;  3GTQ H;  3NEN A;  3PUV A;  4OWX B;  1TII D;  2LS0 1;  2V1C C;  3J81 E;  4RAU C;  4JV5 L;  1AN8 A;  5C44 G;  2VQF L;  1WOC A;  1PTO F;  1YVC A;  1NSN S;  3KBG A;  4KHZ A;  3J80 i;  3LNN A;  1IXR A;  5J1Z A;  3I70 A;  2E5L L;  1JOQ A;  2Q8R E;  4PMW A;  3PUW A;  4X3U A;  4HCE A;  4YWL A;  1XNR L;  1S5E D;  5IGF A;  1JE4 A;  1SYF A;  4NXN L;  2J0T D;  1HR0 W;  4HCS A;  1XXG A;  2CW0 D;  4DAY B;  3H0G H;  2XSC A;  4XQJ A;  2H5X A;  4FF2 A;  4NPS A;  1IYV A;  2UXB L;  4A3G G;  1AZQ A;  1NAP A;  1Q7Y C;  4ZUI A;  1BQQ T;  2OQ0 A;  4HR7 B;  3ZYY X;  1CA6 A;  1E22 A;  1SMY D;  4TRD A;  2K14 A;  2VUM G;  4DV3 L;  2B2U C;  4I7A A;  3G6E A;  2E2H B;  2R93 G;  1L1O A;  3M9B A;  3FKI G;  3FVQ A;  1N34 Q;  4OGQ C;  1SYB A;  1MI2 A;  1OO9 B;  2HQE A;  4P73 A;  2HHH L;  2BDO A;  3MXN A;  4IOA A;  1TWH H;  2B3G A;  2HUG A;  4B08 A;  2N8N A;  1XMQ Q;  3AMU A;  4RCO A;  1IL2 A;  3S1R B;  1N34 L;  1QVG A;  4J8Q A;  3NTK A;  4L5T A;  4OX9 Q;  2A8V A;  1O7I A;  2A68 D;  3I4M B;  4IFD J;  4KHV A;  4LF8 Q;  4R4I A;  2JP1 A;  1KXL A;  4OL7 A;  4YWM A;  2FMM A;  1JC7 A;  1SJE D;  3HG9 A;  4L6T B;  3VR5 A;  2Q2U A;  4B9X A;  4V19 0;  5CBE E;  1PTO B;  1DJR D;  4KMU C;  1B50 A;  2EE1 A;  4DNR B;  2ZTD A;  4KKU A;  5TSS A;  3NSW A;  3BVM A;  4NXM Q;  3DWA A;  4LMQ D;  3HOW H;  2K5Q A;  3GTM H;  2B2T A;  4TKO B;  5JEA J;  1SSO A;  4FP5 D;  3JAM i;  4KV6 A;  3S1N B;  1SEB D;  2F0W A;  1TWC H;  4QF4 A;  4DV7 L;  1H9K A;  4A3B H;  4TQU S;  3RLO A;  1G91 A;  1DGS A;  1DXM A;  1WCM H;  1XWE A;  3A8K E;  3DWQ A;  3IL8 A;  2G9D A;  1RJT A;  3MZ5 A;  5EBC A;  4GKK Q;  4JI4 L;  1PH5 A;  3GTK H;  2F0O A;  3H3V I;  2E74 C;  4JI3 Q;  1GKH A;  2KHJ A;  4YHH Q;  1SNC A;  1HZC A;  1D8L A;  3S17 B;  1M90 C;  1T9H A;  3KLS A;  4XT3 B;  4A3M B;  2K5W A;  5EPK A;  4JI8 Q;  1K8G A;  1N32 L;  5C3E G;  5JJI A;  2D62 A;  3HOX H;  2YV5 A;  3HFZ B;  2QIL A;  1Y8P B;  3HKZ B;  4C3I G;  3PCO B;  3DLL A;  5F2D A;  1VQP A;  4X65 L;  1R4P B;  4QL5 A;  4RMF A;  1CQV A;  4LFA Q;  1X65 A;  2QW7 A;  4DV4 L;  3I73 A;  1V1Q A;  1JOR A;  2PPB C;  4CJ2 C;  1TU2 B;  4RGO S;  3PF4 A;  1Y8N B;  1Q90 A;  5CV6 A;  5IWA L;  1PFS A;  3PUY A;  4QUC A;  4GNX A;  1Q82 C;  4JI0 L;  1KAB A;  3F2C A;  1VQN A;  3EBE A;  3PIP A;  2DN8 A;  3CRL C;  2IW3 A;  1A6X A;  2PI2 A;  3A8J E;  1LTB D;  5M3M B;  1VMP A;  1JQY D;  1O78 A;  4A3I H;  1Y1W H;  1OXX K;  1EYG A;  1M1K C;  3CC4 A;  1MIU A;  4OO1 I;  1DYQ A;  1EOV A;  2L0C A;  4LF7 Q;  2EYH A;  1CHP D;  4K14 A;  1PVO A;  1BR9 A;  3CQZ H;  2FHT A;  2N88 A;  2WP8 J;  3OSO A;  4KK7 A;  1NMG A;  3ERS X;  2PNR C;  4YWK A;  1A3T A;  2OTJ A;  4ZRZ A;  2EZV A;  3I72 A;  1BBW A;  2AUJ D;  4QIW B;  2KCN A;  4TSS A;  2KVM A;  1E2V A;  3BVZ A;  2Z6K C;  1BNZ A;  1ENF A;  1KLG D;  1VQM A;  3GO5 A;  5JJK A;  4DV5 Q;  3R2T A;  2ALY B;  2KOL A;  1I4G A;  5M3F B;  1IW7 D;  4MNO A;  5KIX A;  1F9P A;  2Y0S E;  3A5U A;  1KTK A;  4RH6 A;  5IYB G;  1MJC A;  1SMX A;  3TS2 A;  1K3B C;  4UPA A;  1K0R A;  3IAY A;  4DR7 Q;  2OF1 A;  4R4T A;  3ZJY C;  4ME5 A;  4UP8 A;  3TRZ A;  3O13 A;  5T1I A;  1CT1 D;  2WAC A;  5IIF A;  1SYD A;  2XIW A;  1IZ6 A;  3A55 A;  1EY0 A;  2YU9 B;  5JEA G;  1I6H B;  3V2T A;  4IJH A;  4DXF A;  1X3G A;  1PH7 A;  3T1H Q;  1HNZ L;  2B2Y A;  1LTR D;  4DKA C;  1PZI D;  4A93 G;  4BY1 H;  1YZ6 A;  2R7Z G;  4OO1 G;  1Q86 C;  5JVG 3;  4LF9 L;  4KD4 A;  5KEE A;  3TDQ A;  4LF4 L;  2PYK A;  4RCN A;  3NXW A;  1EIH A;  1BCP D;  3J81 c;  3K5O A;  3LX0 A;  1LTG D;  5A35 A;  3I2Z A;  3A54 A;  4PQX A;  2JA7 G;  4GZY C;  3E5S A;  2AHO B;  1W3S A;  3R93 A;  3CC7 A;  2XTI A;  1YEZ A;  3NUC A;  4KJO A;  3OPO A;  4AQY Q;  4EQ5 A;  2SEB D;  1J5E Q;  2HIX A;  1Y69 U;  3SK6 A;  2KJX A;  4C3H G;  5C4J H;  1TT2 A;  3H94 A;  5LMN Q;  2SDF A;  2KCT A;  5D3D A;  1U5K A;  2DJG C;  2EJF C;  2NVT B;  2UUC L;  3IFT A;  4L5Q A;  4I65 A;  1EIY B;  3U4V A;  1TKW B;  1X32 A;  1SMY C;  1HTP A;  4CDF C;  5IGC A;  2NTS A;  3HOV G;  3J7Y W;  4BXX G;  4DV1 L;  1C0A A;  5GRO A;  1D1I A;  3K5N A;  3J7A V;  4NW2 A;  4A3L G;  1TWG H;  4X64 L;  4A3G H;  5HGT A;  3ITP A;  2IT1 A; 
#chains in the Genus database with same CATH homology
 1F2M A;  1HFG A;  1ML0 D;  4KI0 A;  3GTG B;  4BY7 B;  2JXM B;  1KDC A;  2PZW A;  3S14 B;  1STB A;  3R3O A;  4IUR A;  3C2P A;  1EEF D;  2XWB B;  2K03 A;  1PFM A;  3K57 A;  2QEJ C;  5C5L A;  5I6Y A;  3T51 B;  2A68 C;  3T56 B;  3P7J A;  4FVM A;  2J7Z A;  5EPJ A;  3MXU A;  1CZG A;  5CMD A;  3QWN A;  1EWC A;  1BO0 A;  1EU3 A;  2KEE A;  1SNP A;  4F8M A;  1IHZ A;  1WD1 A;  1SND A;  4AYB B;  2F0K A;  4XDX A;  3NQT A;  4B9W A;  1FNV A;  1TS5 A;  1NCV A;  2BE5 C;  2ICE C;  2XNA C;  2B2U A;  2ZXP A;  1TWA B;  2WAQ B;  1I4P A;  1RDP D;  2RBM A;  5BN5 A;  1K8O A;  4K6L A;  5M9O A;  1ILP A;  1QJO A;  2F0J A;  4L63 B;  3KLR A;  1GJX A;  2F1M A;  3FPP A;  2IX1 A;  4RGT A;  3HS0 C;  3NHH A;  1A2T A;  1S4Z A;  5G3L F;  1WTX A;  4IUN A;  1ROD A;  1WTW A;  2AQ3 B;  4IZ8 A;  1SNO A;  1I3Q B;  1V1P B;  2MJ8 A;  3U9S A;  2RKS A;  3FDT A;  4K6D A;  2NWG A;  5IT9 L;  3KF8 A;  3S2H B;  3OW7 A;  1EY4 A;  3EJI A;  5E1F A;  3K7A B;  3VA5 A;  1WTQ A;  1IL8 A;  2E75 C;  2L9H A;  4NDX A;  2B63 B;  4ILW A;  5IGD A;  4ODG A;  1V1P A;  5CR3 A;  3MVV A;  1JCK B;  3QOL A;  3GTQ B;  1EZ8 A;  4R8N A;  3TSS A;  1GXD C;  2EJG C;  3OHX C;  1BBX C;  5C4H A;  2MP1 A;  1S5D D;  3SK5 A;  4C1N I;  2A5H A;  1ET9 A;  1Z6H A;  1IYU A;  1PFB A;  1F2Y A;  5HUR A;  5C3W A;  5EQ0 A;  3H0G B;  1STE A;  1GHJ A;  3FRP B;  1A3V A;  2WKD A;  3BG3 A;  1JR0 D;  1Y1V B;  5EKL A;  5FK9 C;  2EDG A;  2OT2 A;  3M7G A;  1RCV D;  3QJY A;  1G29 1;  4X3K A;  2AWO A;  1EFI D;  3OOC A;  3RLF A;  1EY5 A;  2I07 B;  2EY6 A;  1TWH B;  3SXH A;  3NWT A;  2DNC A;  4OO1 H;  4H44 C;  1CA5 A;  1STH A;  2VXW A;  1HQM C;  2F0M A;  2F0F A;  1G6Z A;  1TVX A;  2CVR A;  3DEO A;  1GUO A;  3HP3 A;  5FO7 B;  5C5M A;  1GUW A;  5KND A;  1WTV A;  2N55 A;  3HOW B;  1JIC A;  5G3L D;  3TZD A;  1TWC B;  4A3B B;  3M85 A;  1WCM B;  5JOB A;  4ABN A;  3GTK B;  2EYP A;  5EJW A;  1HUN A;  3NTH A;  2BDN A;  3HOX B;  4XYO A;  5I9O A;  3D6C A;  4C56 C;  2KCC A;  2EYF A;  3WDN A;  4XQN A;  2GA4 B;  5FO9 B;  1D5Z C;  5NUC A;  2O5I C;  1HHV A;  3PUX A;  1STA A;  3T4A C;  1G2S A;  3L7Z C;  1GOZ A;  4U68 A;  1GUN A;  3DWP A;  2L5T A;  4A3I B;  1Y1W B;  2FMC A;  2RQX A;  2LY7 A;  2X69 A;  4YIJ A;  4QUF A;  2AQ2 B;  3H3V C;  2PW7 A;  1WD0 A;  3CQZ B;  4IUU A;  2K5D A;  3OMG A;  2L1B A;  4H7B A;  4Z9C B;  4LAA A;  1W6J A;  5IGG A;  1MGS A;  2ZT9 C;  4Q5V A;  3D8G A;  3ERQ A;  5D65 A;  1B4O A;  3H6M A;  2M2L A;  2A69 C;  2LKV A;  4KTA A;  4O42 A;  2BCO A;  2H4O A;  4ZQ3 A;  1T5E A;  3S1M B;  3BDC A;  5LL6 X;  1Q1B A;  1JB3 A;  2E76 C;  3T13 A;  2Q8T A;  5CBA E;  1C48 A;  2AWN A;  4E6I A;  2B39 A;  2WB1 B;  1MSH A;  4KY7 A;  1KDB A;  2RA4 A;  3S9W A;  1O7Z A;  5LHY 1;  1DOM A;  1LV9 A;  2J4X A;  1U4M A;  4BY1 B;  3Q23 A;  5I2X A;  2TMP A;  2B8F A;  1KDA A;  5LL6 S;  1LLR D;  3D31 A;  1BCP F;  1S5B D;  1FYC A;  1DD2 A;  3VR3 A;  4BWG B;  1ENA A;  2F0N A;  5C4J B;  5ELB A;  5C44 B;  5C0X J;  2BE5 D;  4RHS A;  2OEO A;  1PFN A;  1GUT A;  2KHS A;  2ZXR A;  2O2L D;  3ERO A;  3EA6 A;  3DHQ A;  3QIA A;  3U9O A;  2NYZ D;  1HXY D;  4IUV A;  2NVQ B;  1RTO A;  2PQE A;  5DAU A;  1F2L A;  4IFD I;  3HRZ C;  1TWG B;  4A3G B;  1PRT D;  4FXK C;  4EGV A;  2VUM B;  2K28 A;  4OIJ A;  3C46 A;  3AB9 A;  2IPK D;  2R93 B;  5M5Y B;  2KUM A;  1F9S A;  3FKI B;  5EBD A;  5JAV A;  1VMC A;  5E3F A;  1W6K A;  5ISR A;  4FXD A;  3N6R A;  1RHP A;  1PLF A;  3M4Y A;  3ONA B;  3GQB A;  5CV9 A;  1EY6 A;  4M8A A;  1ONL A;  3W3A A;  1Z7T A;  3DUZ A;  1BCP B;  3CKI B;  2F0P A;  4UDU C;  1AFP A;  3IFD A;  2MPM A;  5D14 A;  1QNU A;  3W2D A;  2I46 A;  4DF7 A;  5KNC A;  1LTT D;  2F0I A;  1QWY A;  3MAQ A;  3TME A;  4BA2 I;  2EYO A;  5ELD A;  3EFX D;  1K8M A;  3QB3 A;  5I9P A;  2K1B A;  4CGY B;  2XRS D;  4IFD G;  3PMF A;  3L9A X;  4Y7N B;  4XT1 B;  3I8Z A;  2R3Z A;  4C3J G;  2HDM A;  1SYC A;  2A6H C;  4R9W A;  5FLX L;  1S5C D;  2JEA I;  1T5X D;  5C3E B;  2FJ2 A;  1MSG A;  4XQQ A;  4C3I B;  2KEC A;  3NPP A;  2VNU D;  4G7Z C;  2B2W C;  3D6W A;  1E2W A;  1Z47 A;  4JK1 C;  4IQZ A;  1LTA D;  5KGU A;  2HCI A;  2F0U A;  3EVQ A;  2NUC A;  1RF2 D;  3D4D A;  3H09 A;  2B2V C;  3TP8 A;  1AP0 A;  1EYC A;  3VA7 A;  3DXJ C;  1OXU A;  1EZ6 A;  3MWY W;  1NR4 A;  3TP5 A;  1STN A;  1G8Z D;  4CBV A;  2K01 A;  4A3J B;  3S16 B;  2A6E D;  3JAM L;  3V96 A;  2DY7 A;  2MUY A;  1B44 D;  2H1E A;  3PIP 3;  1XX8 A;  1TS4 A;  1VF5 C;  1FGB D;  1J8I A;  1TQO A;  2F3W A;  2EXZ A;  2D2C C;  1KAA A;  2F0S A;  3CRK C;  3Q22 A;  3GTJ B;  5EGT A;  3GTL B;  4P2C B;  1JOK A;  1V43 A;  1HPC A;  4A3F B;  4G57 A;  1Q1E A;  4KN4 C;  4CKC A;  1QG7 A;  2WV6 D;  4F88 A;  5KNB A;  3LWE A;  2K6A A;  3LWU A;  5CC4 A;  1OXS C;  5CV8 A;  2EVB A;  4HSV A;  4DXG A;  3P75 A;  3WOE A;  3HGB A;  1CQF A;  4ZAI A;  2BA1 A;  5K5P A;  2YYZ A;  1UUP A;  1TS2 A;  1WTO A;  1O80 A;  2C5C A;  4HSP A;  2SNS A;  3SE0 A;  1NR2 A;  1SYE A;  4HMI A;  2C9O A;  2PCF B;  2NBF A;  4XTC S;  1AW7 A;  1D5M C;  1D5X C;  4O1N A;  5IGB A;  2PMZ B;  5I4D A;  3I4L A;  4EQP A;  3NWS A;  3M4O B;  2O5J C;  1JWS D;  2NVY B;  2X6L A;  4C3H B;  3RMH A;  3FEW X;  2Q8I B;  2NTT A;  3K58 A;  3UI2 A;  2ENB A;  4J1M A;  5IOD A;  4IUP A;  1PRT C;  4V0B A;  5K36 G;  2EPB A;  2HCC A;  3HOV B;  1VF7 A;  2L4N A;  3Q24 A;  2JSO A;  2A69 D;  1AZP A;  2EYM A;  1E2Z A;  1DOL A;  2QDB A;  1O7Y A;  4ID6 A;  1E0B A;  1EIG A;  1B3A A;  1ZKO A;  1JWU D;  1SAP A;  1BOS A;  1M4V A;  3GTP B;  3G7L A;  3JAM E;  4U67 3;  2LFN A;  5C4X B;  4H13 C;  1PTO C;  3NBH A;  3TP6 A;  1R4Q B;  2A74 C;  4RKB A;  3M7N A;  3OWE B;  3X3M A;  2ZXO A;  4N9P A;  1L0Y B;  3SEB A;  1HCZ A;  2XWJ B;  3T53 B;  3DMU A;  3I4N B;  1GUS A;  1QCB D;  1VDZ A;  4MHE A;  4IFD H;  1XYI A;  3BDL A;  1TWF B;  4EVO A;  3HOY B;  1LT3 D;  3TP7 A;  2D9U A;  5J39 A;  3MFY A;  5DEH A;  4PNY A;  1WVL A;  1PMR A;  1CTM A;  4FYD A;  4HAE A;  5JEA H;  4BBS B;  3EQL C;  4DNT B;  4FF3 A;  1U9R A;  5T1G A;  4WFN 3;  1SBB B;  2JE6 I;  1EOT A;  1HTL D;  1BUV T;  3FMC A;  1WTP A;  4CKE A;  2F0Q A;  3PO2 B;  4WJW A;  5FO8 B;  1DCZ A;  1I50 B;  1UNS A;  2A6E C;  2TSS A;  4RKL A;  4CJ0 B;  3BZD B;  2PW5 A;  4A3E B;  2K04 A;  1EY7 A;  4K5V A;  1TS3 A;  3BYY B;  3VYU A;  3MFG A;  1IKL A;  5IT9 E;  4IAL A;  1B1Z A;  2EY5 A;  1DON A;  4M1U B;  4HN7 A;  3K5L A;  1RTN A;  3E6Z X;  3NP8 A;  2B2W A;  4NKL A;  2KA7 A;  5A2Q L;  1H9M A;  1LTS D;  2B2V A;  2R6G A;  2A6H D;  1F2Z A;  1HRJ A;  2X6G A;  1PRT F;  4G4K A;  2OXP A;  1QOH A;  1YNN C;  4J6H A;  1K83 B;  3MXG A;  2ICI A;  4FF1 A;  1X3P A;  1U4R A;  3MTS A;  5I2Y A;  4FNF A;  1DZ1 A;  2QKI C;  4JBW A;  3TN2 A;  1S5F D;  4RA8 A;  1EY9 A;  1HA5 A;  2IX3 A;  1Q8I A;  3HZX A;  1ESR A;  4BA1 I;  5EKI A;  4ZYS A;  5ELC A;  2CHB D;  4RGM A;  3RUZ A;  1TR5 A;  5FKA C;  2V4D A;  4KKT A;  3VYT A;  1H9R A;  2A73 B;  1UEA B;  3RZO B;  2F0L A;  2JEB I;  2PO4 A;  2JA5 B;  2IJ0 A;  1CK1 A;  3KUP A;  1XTC D;  1D1K A;  5M5X B;  5K36 H;  4DK0 A;  3CHB D;  1D2B A;  4KD3 A;  2Z1C A;  3MA2 B;  2XRQ D;  4K2K A;  1PRT B;  4EQN A;  4XIG S;  3S2D B;  2O4X A;  4NMZ A;  5KYL A;  2VB3 X;  4ZKB B;  4RGN A;  4DK1 A;  3K5M A;  1CFM A;  5CV4 A;  5JPN C;  1FR3 A;  4K8I A;  4MN3 A;  2PZT A;  3PO3 B;  1EQV A;  1I4R A;  1I4Q A;  4DAY A;  1LT6 D;  2L12 A;  1PZK D;  2F0E A;  4OIK A;  1TY0 A;  5BN3 A;  3QO2 A;  5DM6 3;  3SK8 A;  2NN6 I;  2XN9 C;  2DY8 A;  4C1N K;  4QB4 A;  1A2U A;  3SR1 A;  2PZU A;  5A2Q E;  3A8I E;  2Z4I A;  4HMJ A;  5ELF A;  1STY A;  3BS1 A;  3BVG A;  4ULL A;  1CI3 M;  3GD7 A;  3F2U A;  2VB2 X;  1V8Q A;  4HTH A;  4CJ1 B;  3S1Q B;  2WII B;  4XYQ A;  2FFK B;  1ZYR C;  4A3D B;  3BDO A;  1HQR D;  5CYU A;  3VYR A;  1SNM A;  4DAV A;  2FIN B;  4Q0F A;  5DNF A;  3J7A F;  1U4L A;  5C3X A;  1I6V C;  3V05 A;  2RSO A;  4EQO A;  2KED A;  1EY8 A;  3VR6 A;  1QIL A;  1AEX A;  5JJZ A;  4WRD A;  3CU7 A;  5C0X I;  4ZK9 B;  4ZUJ A;  2K7V A;  5FOB B;  1R9T B;  2D5D A;  2AUK A;  2NN6 G;  3I91 A;  1OXT A;  3WOF A;  4R8I A;  1LT4 D;  3IKJ A;  3AU7 A;  3ND8 A;  1Y8O B;  1DM0 B;  1EQT A;  2E2J B;  3GP7 A;  3MEH A;  2E2I B;  1PZJ D;  3J80 L;  1PTO D;  3H91 A;  5C4Z A;  3D4R A;  1X3Q A;  3M3Y B;  5EPL A;  4KKS A;  1SNQ A;  3KLS X;  2R61 A;  1F9Q A;  3I3C A;  1EEI D;  1B2T A;  3HOZ B;  2EJM A;  4F7X A;  4DFA A;  1PXU A;  1LAB A;  3P1H A;  4ZLT F;  5J22 A;  1OXV A;  4UAI A;  3Q6S A;  4L8J A;  1BF4 A;  5C0X G;  1ET6 A;  1YNJ C;  2K05 A;  4DAP A;  1D6E C;  5IOC A;  5DM7 3;  3R2I A;  2F4I A;  3C3L A;  4DA2 A;  1DOK A;  2AQ1 B;  3SVM A;  1B9M A;  1GUG A;  1EL0 A;  4XXE A;  1M8A A;  1UAP A;  1SE3 A;  1ICW A;  5E4X A;  1KNE A;  3D4W A;  5KRU A;  4DN4 M;  1NUC A;  2F0V A;  1PTO H;  1B9N A;  1WTR A;  4RHR A;  3K59 A;  3L3O C;  1EU4 A;  4DU9 A;  1EWH A;  1BDO A;  2HDL A;  3G6J B;  3VR2 A;  2Y0S B;  2EY2 A;  2KQ3 A;  1V1O A;  1JOO A;  2RVL A;  2IL8 A;  5JVH 3;  1GHK A;  2MGS A;  2NB0 A;  1J9O A;  2CW0 C;  2WKC A;  1SFO B;  1STG A;  1KLU D;  4RFB A;  4FO2 A;  2SNM A;  1CZW A;  1CHQ D;  5M5W B;  3VR4 A;  4C3J B;  3HEJ A;  3OMC A;  1SJH D;  4CKB A;  2B8G A;  3X3N A;  3PUZ A;  5CGK A;  4KJN A;  1IKM A;  3K6O A;  3GTO B;  4LK1 C;  3J80 E;  4A93 B;  2R7Z B;  1YNN D;  1SDF A;  2IX0 A;  2K33 A;  4BBR B;  2F0H A;  4NP5 A;  2EY1 A;  3MC0 B;  2F3V A;  1TY2 A;  5D3I B;  4ZKC B;  4IN3 A;  2JA7 B;  4WOR A;  3C1F A;  4IUQ A;  5C6A A;  1VCI A;  5JPM C;  2EOT A;  5FLX E;  3NQI A;  1LAC A;  4RWS C;  2JYO A;  1C4Q A;  3P20 A;  1C8C A;  1LO5 D;  4K5X A;  2F03 A;  2EYJ A;  4K8J A;  5ELE A;  1I4H A;  1MD2 D;  2Z8L A;  1BXT A;  3FPU B;  2BOS A;  5AFW A;  2B2T C;  4OHJ A;  2QF7 A;  2L11 A;  1PYW D;  5COY A;  2XVS A;  3MXP A;  1SYG A;  3KK7 A;  1ZEQ X;  1RKN A;  1ILQ A;  1EYD A;  1EYA A;  3MHB A;  2MHV A;  3BYT B;  4LJZ C;  4KY5 A;  3N52 A;  2NN6 H;  3QG1 A;  3SK4 A;  2JA6 B;  1KNA A;  2JA8 B;  1QB5 D;  5E4W C;  3I90 A;  3NE5 B;  3T16 A;  4PMC A;  1CM9 A;  4X3T A;  2R92 B;  4C2M B;  3GV3 A;  4F87 A;  3TZU A;  4H0L C;  2M9V A;  3R8B A;  1L0X B;  3PIO 3;  1LTI D;  1ENC A;  4I7Z C;  1PDQ A;  2SOB A;  1IW7 C;  3DEP A;  3TBI B;  3Q0A A;  1QNK A;  1B53 A;  3KBX A;  3J81 L;  5CV5 A;  2F0G A;  2EYL A;  2K32 A;  5IGE A;  3NBI A;  2E2D C;  4KY6 A;  3A7A B;  3PV0 A;  1ZYR D;  2F0T A;  1RD9 D;  1Q12 A;  5C0X H;  4QCL A;  1FNU A;  1SXT A;  3RD4 A;  3RZD B;  3E0J A;  5CV7 A;  4KN7 C;  3VYS A;  4K5W A;  1HUM A;  4MIU A;  1Q3L A;  1BCP C;  1H9J A;  3OIP A;  1G2T A;  3NK9 A;  3GV6 A;  1H9S B;  1LT5 D;  1A15 A;  4G7O C;  1II3 A;  3SHL A;  2WIN B;  4IUT A;  3SDZ A;  1SE4 A;  4QMG A;  2B2Y C;  4X3S A;  5COR A;  5EKK A;  2IWH A;  4S3S A;  2NVX B;  2NZ1 D;  4CHT B;  3D3R A;  3ND9 A;  3GTM B;  3HOU B;  4PMB A;  2M00 A;  1ESF A;  5BN4 A;  5KYI A;  1I4X A;  3S15 B;  2RSN A;  1QE6 A;  4FXG C;  1H9S A;  4BS9 A;  2L55 A;  3NTI A;  3QOJ A;  1U4P A;  4G7H C;  1FD7 D;  1HFN A;  1F77 A;  1JWM D;  3DM1 A;  1MBY A;  2CQA A;  1O7L A;  3OIQ A;  3C1E A;  4HED A;  4K2L A;  5I6W A;  2RDH A;  3A7L A;  4FF4 A;  3K0Y A;  3URY A;  2F0D A;  1YNJ D;  1SE2 A;  2DNE A;  2QCP X;  2ID0 A;  1A3U A;  3A56 A;  1F9R A;  4N9T A;  2LMC B;  4A3K B;  4DGZ A;  1HA6 A;  2RDF A;  1ZXT A;  2G9H D;  2RDG A;  3OWF A;  2BA0 A;  4PV1 C;  2Z4H A;  1FNW A;  3PUV A;  1TII D;  2LS0 1;  3J81 E;  4RAU C;  1AN8 A;  1PTO F;  3KBG A;  1NSN S;  4KHZ A;  3LNN A;  5J1Z A;  3I70 A;  1JOQ A;  2Q8R E;  4PMW A;  3PUW A;  4X3U A;  4HCE A;  1S5E D;  5IGF A;  1JE4 A;  1SYF A;  2J0T D;  4HCS A;  1XXG A;  2CW0 D;  4XQJ A;  2XSC A;  4FF2 A;  1IYV A;  1AZQ A;  1NAP A;  4ZUI A;  1BQQ T;  4HR7 B;  3ZYY X;  1CA6 A;  1SMY D;  4TRD A;  2B2U C;  2E2H B;  3FVQ A;  4OGQ C;  1SYB A;  1MI2 A;  1OO9 B;  2HQE A;  2BDO A;  3MXN A;  2HUG A;  4B08 A;  3AMU A;  4RCO A;  3S1R B;  4J8Q A;  3NTK A;  2A68 D;  3I4M B;  4IFD J;  4KHV A;  2JP1 A;  4OL7 A;  2FMM A;  1JC7 A;  1SJE D;  3HG9 A;  4L6T B;  3VR5 A;  4B9X A;  4V19 0;  5CBE E;  1PTO B;  1DJR D;  4KMU C;  1B50 A;  2EE1 A;  4DNR B;  4KKU A;  5TSS A;  3NSW A;  3BVM A;  3DWA A;  4LMQ D;  2K5Q A;  2B2T A;  4TKO B;  5JEA J;  1SSO A;  4FP5 D;  4KV6 A;  3S1N B;  1SEB D;  2F0W A;  4QF4 A;  1H9K A;  4TQU S;  1G91 A;  1DXM A;  3DWQ A;  1XWE A;  3A8K E;  3IL8 A;  2G9D A;  1RJT A;  3MZ5 A;  5EBC A;  2F0O A;  2E74 C;  1SNC A;  3S17 B;  3KLS A;  4XT3 B;  4A3M B;  2K5W A;  5EPK A;  2D62 A;  2QIL A;  1Y8P B;  3HKZ B;  4C3I G;  5F2D A;  1R4P B;  1CQV A;  3I73 A;  1JOR A;  2PPB C;  4CJ2 C;  1TU2 B;  4RGO S;  1Y8N B;  1Q90 A;  5CV6 A;  3PUY A;  4QUC A;  1KAB A;  2DN8 A;  3CRL C;  2IW3 A;  1A6X A;  3A8J E;  1LTB D;  5M3M B;  1VMP A;  1JQY D;  1O78 A;  1OXX K;  4OO1 I;  1DYQ A;  2L0C A;  2EYH A;  1CHP D;  4K14 A;  1BR9 A;  2FHT A;  2N88 A;  2WP8 J;  3OSO A;  4KK7 A;  2PNR C;  1A3T A;  4ZRZ A;  2EZV A;  3I72 A;  2AUJ D;  4QIW B;  2KCN A;  4TSS A;  2KVM A;  1E2V A;  3BVZ A;  1BNZ A;  1ENF A;  1KLG D;  3GO5 A;  3R2T A;  2KOL A;  1I4G A;  5M3F B;  1IW7 D;  5KIX A;  1F9P A;  1KTK A;  4RH6 A;  3IAY A;  2OF1 A;  4ME5 A;  3O13 A;  5T1I A;  1CT1 D;  2WAC A;  5IIF A;  1SYD A;  2XIW A;  3A55 A;  1EY0 A;  2YU9 B;  5JEA G;  1I6H B;  3V2T A;  4DXF A;  2B2Y A;  1LTR D;  1PZI D;  4OO1 G;  5JVG 3;  4KD4 A;  5KEE A;  3TDQ A;  2PYK A;  4RCN A;  3NXW A;  1EIH A;  1BCP D;  3K5O A;  3LX0 A;  1LTG D;  5A35 A;  3A54 A;  4PQX A;  4GZY C;  3E5S A;  3R93 A;  3NUC A;  4KJO A;  3OPO A;  2SEB D;  1Y69 U;  3SK6 A;  2KJX A;  4C3H G;  1TT2 A;  3H94 A;  2SDF A;  5D3D A;  2EJF C;  2NVT B;  3IFT A;  4I65 A;  1TKW B;  1X32 A;  1SMY C;  1HTP A;  5IGC A;  2NTS A;  3J7Y W;  1D1I A;  3K5N A;  3J7A V;  4NW2 A;  5HGT A;  3ITP A;  2IT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...