4F7XA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/l25a at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f7xA00
2OEOA 3NUCA 4IUNA 5CV4A 4LAAA 2EYFA 3SK4A 5DEHA 3U9OA 5E3FA 1STYA 4B9XA 5C5LA 1SNPA 5C4ZA 5I6YA 2F0VA 1JOQA 4DGZA 1A2TA 1EZ6A 5CV7A 1SYCA 5EGTA 3HEJA 2F0OA 4J1MA 1SYGA 4QB4A 2EY2A 3ERQA 4HTHA 5JAVA 1EZ8A 2KQ3A 2EYHA 2PZUA 3V2TA 4HMJA 3H6MA 3BDLA 4ZQ3A 4EQOA 2F0NA 3EVQA 4KY5A 4OL7A 2F0UA 2PZWA 1U9RA 2NUCA 2OF1A 1EY0A 1KABA 1STHA 1RKNA 1STGA 5E1FA 3ITPA 1SYFA 3TMEA 4EQPA 3QB3A 4WRDA 4KD4A 5CR3A 3MZ5A 5ISRA 2F0SA 5KRUA 3NXWA 4KJOA 3D4DA 5CV5A 4KHVA 3HZXA 1STAA 2RBMA 3PMFA 4K5WA 3NHHA 1F2YA 4I65A 3SK8A 4F7XA 1TT2A 3DHQA 4K5XA 2F0WA 4IZ8A 4ODGA 2O4XA 2F0DA 4HMIA 4ID6A 1AEXA 4K2KA 1KDAA 5IIFA 2QDBA 4QF4A 2LKVA 3T16A 4DF7A 1EY7A 4IALA 4J6HA 4G57A 4ZUIA 4B9WA 3TP7A 2F0PA 1EYDA 3MEHA 3OSOA 3TP8A 5CV6A 3DMUA 2EYJA 2F0LA 5CC4A 4K2LA 3EROA 4TRDA 1II3A 5KYIA 1TQOA 2EY5A 2F0EA 4KV6A 3SHLA 1SNQA 4YIJA 4E6IA 1EQVA 3EJIA 1SYBA 1SNCA 2F0HA 3LX0A 2F0FA 1EY8A 4KY7A 1TR5A 4N9PA 5IGBA 5IOCA 3C1FA 2EXZA 4QMGA 2EYLA 4KTAA 4RKBA 4F8MA 3OMCA 1A3TA 2PW5A 5KGUA 4H7BA 1ENAA 1A3UA 2PW7A 3NK9A 4K8IA 5HGTA 1SYDA 3C1EA 1SYEA 1IHZA 4WORA 3TP5A 2F0KA 1EYAA 3VA5A 1SNOA 3QOJA 1STBA 1EY9A 5C6AA 3QOLA 2EYPA 5KYLA 3TP6A 5KEEA 1JOKA 1F2MA 3SK6A 1STNA 1EY6A 2F0TA 4NDXA 4R8NA 2WACA 4NP5A 4KY6A 5EKLA 4K8JA 4DU9A 4NMZA 5F2DA 4PMCA 5IGEA 3P1HA 2F0MA 1KDCA 5C5MA 1F2ZA 5IODA 4N9TA 4S3SA 1JORA 5CV8A 3MVVA 5C3WA 3NP8A 3RUZA 3SR1A 1NSNS 5CV9A 5CGKA 5IGGA 5K5PA 2PZTA 1EY5A 4ZUJA 5JOBA 2F0GA 2PYKA 4PNYA 5C4HA 3E5SA 3D8GA 1JOOA 2F0IA 2KHSA 3D6CA 3MHBA 1SNMA 3P75A 4ME5A 2F3VA 3SK5A 5M9OA 4PMBA 5I6WA 5I9OA 4MIUA 2EYMA 4K5VA 4NKLA 3OWFA 4DFAA 4EVOA 4K6DA 5HURA 1A3VA 3OMGA 3R3OA 5NUCA 1KAAA 2HQEA 3SXHA 4KD3A 5J1ZA 2RKSA 4KJNA 5C3XA 5IGDA 2F0JA 5J22A 2EY6A 5EKKA 1A2UA 3NQTA 5KIXA 1ENCA 1SNDA 3MXPA 2M00A 2F0QA 2F3WA 3BDCA 3S9WA 2PQEA 5J39A 2SNMA 1NUCA 2EYOA 1KDBA 3D4WA 4K14A 5IGFA 4EQNA 4RKLA 2EY1A 3T13A 2OXPA 2ENBA 2SOBA 5I9PA 1EY4A 2SNSA 5IGCA 2RDFA 1EYCA 5DAUA
chains in the Genus database with same CATH superfamily
1OXSC 1Z7TA 3X3NA 4A3BG 1EU4A 1ONLA 4DV5L 4H13C 3UDFA 4RGNA 1BQQT 1WTHA 1IL2A 4B3RQ 3J81i 2WAQB 2F52A 3UDXA 2A69D 2PZWA 1PFSA 1VQ9A 1K3RA 1LM0A 4FNFA 1UWVA 2VXWA 3ND9A 1SFOH 3AFQA 1R9TH 1YJ9A 1IZ6A 3HZXA 3QJYA 3GTLH 3VR2A 5C44G 4F7XA 2WP8J 1WTWA 3U58A 4HMIA 3VYSA 4DR5Q 4DF7A 3SE0A 1PTOH 1DXMA 3PUXA 3VDYA 1WTQA 2ICIA 2QGQA 5CC4A 4JK1C 4YY3Q 5D65A 3TRZA 1PVOA 3A8JE 4GKJL 5IOCA 5CYUA 1TXYA 1FD7D 1V43A 5KNDA 2EXZA 3KUPA 4RGOS 2CQOA 2RCNA 1DOKA 3BVZA 3RMHA 1XPOA 4OO1G 3SDZA 1K28A 5HGTA 1C4QA 1G291 4A3IB 4M1UB 1SYEA 2B2TA 5C4XB 2JN4A 3VA5A 4C3JB 1RCVD 1KNAA 2AHOB 4M8AA 5LMUL 3S2DB 4LUOA 4DU9A 1CHPD 4B3SL 3P1HA 2BA0A 2F0MA 1E3PA 2K28A 2V1CC 1N34L 1GOZA 2K5QA 5CGKA 2HCIA 4FO2A 1G91A 1TS4A 3EQLC 3J81c 1O7ZA 4P72A 1QZGA 4POGA 3RZOH 2F4VL 1W2BA 1L2FA 2QILA 4A3JH 4UHVA 1PH6A 3G7LA 4KJNA 4RG1A 3ULPA 3S1NH 3S14B 4P73A 4QUCA 3H09A 1VQKA 2B8GA 3TDQA 3EN2A 3BDCA 3D4RA 3PUWA 3S9WA 5FJ8G 4LFBQ 4X66Q 3F1ZA 2EXDA 2SNSA 2VB2X 2DJGC 5EPKA 4LF4Q 3J7A5 1CA6A 1RODA 1K83B 1VQ6A 5CV7A 3HP3A 1YNND 1PDQA 4GOPC 1A8VA 1PTOF 3F2DA 4EQOA 3HOWB 2F0NA 4LWCA 1U9RA 2IHEA 1D2BA 1STGA 1SSOA 4XT3B 1IYUA 5M3MG 3CPFA 3CKIB 4X64L 4ALPA 1OO9B 2XN9C 5CV5A 4BBSB 1CHQD 4OIKA 3RN2A 1I50H 4ID6A 4X3UA 1KDAA 2JA7G 1PYWD 4GN5A 4ZUIA 2UXDQ 3HKSA 2AUKA 3HOVB 1TQOA 4TSSA 3OW2A 1VQGA 3S16B 2VW9A 2VUMB 1L1OA 5D14A 3QO2A 4LF9Q 3OMCA 2HD3A 2J4XA 1UE7A 3NBHA 1ILQA 2OCEA 4YCWA 3G71A 4IPCA 1EL0A 3OW7A 4WORA 4GZYC 4Q0FA 1Q1BA 4DUZQ 5I4DA 1J8IA 1U4LA 3EBEA 5C0XJ 3QOLA 1OTCA 1D5MC 3C3LA 2OT2A 1WCMH 5C3EG 4K8JA 3RD4A 1SEBD 4PMCA 3E0JA 2I0QA 2Q2UA 2YTXA 5M5WH 1YZ6A 5C3WA 4OWWB 1D8LA 4DR3L 4X3TA 1M1KC 1EY5A 4RGTA 5JOBA 1Y8NB 5C4HA 2QKIC 5FLMG 1ESRA 1YHBA 2N3SA 3GTPB 4NKLA 4DAVA 1Q86C 4EVOA 3J80i 5HURA 3A0JA 1F9PA 1VQIA 2F4IA 3EIVA 4TKOB 1DM0B 4H0LC 4GNXA 3H3VI 2A69C 1J6QA 1X32A 4JV5L 4CDFC 1HPCA 5FK9C 1GKHA 2WB1G 5CBEE 4IPHA 1ICWA 3S17H 3T1YQ 1SNPA 1CKNA 1LUZA 1UUPA 5I6YA 3UI2A 3CC4A 3ERQA 4C3IG 3HOZB 4UAIA 2PZUA 2PPBC 5IP7H 3H6MA 5KNCA 1PYSB 3VR6A 1STHA 1VCIA 2J7ZA 1LO5D 5ISRA 4XQJA 1WFQA 1VQOA 1KXLA 2NVTH 4KHPL 1R4QB 3V05A 4IOAA 4A3JB 1SJHD 3VR4A 2EOTA 1CK1A 3QIAA 4R4TA 5IT9E 1ZKOA 1KRTA 2CWPA 3PIOA 3TS0A 4DR4Q 3AMUA 1QNKA 4FXGC 2F0LA 5FO8B 1CSPA 4DR2Q 3E0EA 2QF7A 4HJ8A 1Z9FA 3K8AA 1DJRD 2JA9A 1S5ED 5FLXL 4G7ZC 1S3OA 5G3LF 1XPUA 1SE8A 2PW7A 2D62A 1JMCA 1DGSA 1CT1D 3BJUA 2JK8A 3SVMA 2KHIA 3E9HA 2MHVA 3CCEA 4CDDC 3Q24A 3M4OB 2Y0SE 1I4GA 1YVCA 4JI3Q 3OIPA 4JCVE 2NWGA 3G6EA 1GUSA 1TWAB 1F2ZA 4DR5L 1DCZA 3STBD 3GTJH 2PZTA 4BXXH 4KN4C 1FL0A 4YY3L 1DZ1A 1XMOL 3A7LA 1TY2A 4R4CA 4DFAA 1W6KA 3SGIA 2F03A 5K36H 3MXUA 2HHHQ 3R2IA 3K58A 3NSWA 2JP1A 4PZ7A 1C48A 1YNNC 2F0JA 1B4OA 1XMQQ 2E76C 5FKAC 3K7AH 1AP0A 3GDEA 5C0XG 2QW7A 3CD6A 4A3GH 3CAMA 1YHQA 4I7AA 2OXPA 4GLVB 3GTOH 1IW7D 5JVG3 1EU3A 1V1PB 2UUCQ 5CMDA 4QCLA 4ZK9B 5C4ZA 4DN4M 2KCMA 4DGZA 1G2SA 1RTOA 5IT9L 1GUOA 2GN5A 4HTHA 2N49A 5IYCG 4A3DH 3IFDA 1E1OA 4JC0A 4FXDA 3HOXH 1SR3A 1X55A 2KECA 4AYBB 1DOLA 4HJ9A 4CBVA 1X3PA 2XNAC 1H9JA 4FDBA 1BO0A 2DNEA 3PO2G 3FVQA 2L1BA 4ZCKA 2XWJB 4KJOA 2MQHA 1H9MA 4HAEA 4GKJQ 2FJ2A 4XIGS 3I4NG 3ICEA 4HIDA 4QF4A 1A15A 2KEEA 4GN3B 2K75A 4J6HA 2IPKD 4R4QA 2IT1A 1PHJA 4LFBL 3M7GA 4X66L 3M9BA 2F0EA 1E2ZA 1E24A 1E2VA 1MJEA 1B50A 1Q8KA 4LF4L 4CKCA 4RKBA 2OTLA 3Q6SA 3GTQB 4A93H 1EOVA 1A3TA 1AW7A 2KEDA 4DR1Q 2A68D 1ENAA 4R1JA 1Y1WG 4ZKBB 4A3EH 2K5HA 3C1EA 4K0KL 2E2IB 1IKMA 1U4PA 1WTOA 4JBMA 1STBA 4BY7B 4WFN3 1ET6A 1T5EA 1X3GA 1RDPD 3U4VA 4GLXA 2NVYH 3HS0C 1IBMQ 2NN6G 2A6ED 3UDGA 5GQOA 1QUQB 2NZHA 2Z6KA 3M7NA 2N88A 2YU9H 5LMNW 4JI6L 2UXDL 3JC66 1LACA 5EBDA 5M9OA 3K7UC 3DUZA 2Q2TA 5DLQE 1KAAA 1TIID 3BZDB 4X3SA 1GHJA 2RKSA 1VQEA 4LF9L 4QY7A 1TS2A 5C0XH 3T4AC 1EIGA 1I6HH 1UE1A 5C0XI 4A3BH 1NR4A 2M00A 4EGVA 4DUZL 2RQXA 3D4WA 3DWQA 1ASZA 4RKLA 2Q8IB 5CORA 2P5ZX 3T13A 3H15A 2F3IA 1EYCA 5IYBG 3U9OA 3GTGH 4FF4A 4RCOA 1KRSA 4C3HB 4IUVA 2PI2A 3I70A 2F0OA 4BWGB 5IT9c 1CQVA 1EZ8A 4JG2A 2WV6D 4DK3C 5C44H 3GTJB 4BY1B 1B9MA 4OL7A 2FMMA 2UUBQ 3HOYG 1RKNA 3T53B 1SYFA 1PFMA 3K80C 3MZ5A 4U68A 1HZ9A 4X3KA 5M3FG 3S15B 5K36G 3QG1A 1TWCH 2NVXB 4KHVA 4DAYB 1GO3E 4OWXB 1H9SB 1I6VC 4JW0A 3K6OA 4JI4Q 2R92G 2DY8A 3OIQA 2V4DA 3KOJA 4NXML 3BVMA 2E8GA 4DV6L 1WYDA 5GAHC 4OO1H 2Q2IA 4OO1I 1EY8A 1KL9A 1GHKA 2K7VA 3OPOA 4QMGA 4KTAA 4A3MG 2R7ZB 3T1YL 2JJQA 4JI2Q 2LS01 4IUQA 1H9KA 2B2YA 2PW5A 3E6ZX 3STBC 4A3DB 4X65Q 1C9OA 2F0KA 1UAPA 1NJIC 1SNOA 3O13A 1TWFB 3ZYYX 3JAML 1SBBB 4DR3Q 1E7ZA 3WOEA 3GTKB 1C8CA 4B3TL 3S1MH 3S1QB 4LUZA 1MI2A 4B3ML 3L9AX 4U673 5JPMC 1WTVA 3I4MG 5JJZA 5IODA 1S4ZA 1CTMA 1VQFA 3GTMB 3BYTB 1VQCA 1D5ZC 4DR4L 1MSGA 3HOUG 1PFNA 1HNZQ 1M90C 1SNMA 4DR2L 1MD2D 1IW7C 2G9HD 1BKBA 2JA8B 4G4KA 5FJ8H 5NUCA 3TZDA 2D2CC 3CCQA 3RLNA 1HZBA 3CF5A 4A93B 5J22A 1A2UA 1Y8OB 4GOPA 4A3EB 2O5IC 1SE4A 1N33Q 2PQEA 2L0CA 2PO4A 1YNXA 3AYHB 1QILA 1B3AA 1B70B 1IBKQ 1JWUD 2B2VC 3KYHC 2DN8A 1PH1A 3PV0A 4JI3L 1GD7A 4KHPQ 1EWHA 5M3MH 2QDLA 1VQPA 4LFAQ 1NY4A 2YU9B 5IP9G 3EVQA 4KY5A 3A5UA 2LY7A 3K57A 1EY0A 1VF5C 1YHAA 4DKAC 4QUFA 1Y1VB 2L5TA 2JA7H 1F9RA 2Z6BA 2F0SA 2NYZD 5G3LD 1KAWA 1BBUA 2R7DA 2ZXPA 5T1GA 3SK8A 2ZM6Q 3M4PA 1EYGA 2HHHL 2A68C 2B39A 5C4JH 2O4XA 2OTJA 1X3EA 3OWEB 2NZ1D 1I6HB 1XMQL 3CQZB 3L3OC 1BCPF 4AIMA 2XIWA 4KN7C 5BN5A 1BXTA 3EJIA 2A6EC 1QVGA 2F0FA 3H0GG 3PO3B 4K6LA 2UUCL 3GTGB 1PRTF 2JE6I 1B2TA 2AMCB 3CRKC 3MAQA 1PV4A 3FKIB 4DK1A 4A3LG 1P8LA 1HXYD 1NR2A 3MTSA 5C3EH 5C44B 2IX3A 3M4QA 2WAQG 1VQ8A 3I72A 1JOKA 4TQUS 2GVBA 4R8NA 1JE4A 1HH2P 1KTKA 2WACA 1E2WA 2VQEQ 4BS9A 1HFGA 5EKLA 5LMNQ 4NMZA 5FLMH 1XMOQ 1PH9A 1S72A 2ZTEA 1CQFA 1PTOC 4JI7Q 5CV8A 1IBLL 2X69A 1JB7A 3I91A 1E1TA 3A55A 1FYCA 3EFXD 1O7YA 4RCNA 1BVSA 4OIJA 2E2HH 2EPBA 3MFYA 2RCFA 1SN8A 5ELNA 4O1NA 1HR0L 2DNCA 5IGDA 2EY6A 4DR1L 1A62A 2M2LA 4UY8C 2ATWA 2EDGA 2K04A 3MXPA 3LWUA 1VMPA 4FVMA 3A8IE 2QA4A 2R6GA 1XNQQ 1EIHA 2O2LD 1JJGA 3PSIA 5C4XG 3L7ZC 1Q82C 4C3IH 4C3JG 3FEWX 3TZUA 1QVCA 2E5LQ 2EYFA 1IXRA 3U50C 4X62Q 1SROA 1IBML 2JA5G 1D1KA 3K0XA 2R93B 4OXPA 4HMJA 4ZAIA 4A3FB 1D6EC 1MGSA 3FHWA 2LSSA 4DNTB 1XXGA 1KHIA 4GN4B 3A5ZB 4HIKA 2AWOA 3F2UA 2RSOA 1KD1C 4QL5A 3I4LA 1AEXA 2B8FA 4PZ6A 2PNRC 1CKMA 4LW1A 2JSOA 2CH4A 3OSOA 2Z8LA 3DMUA 2N78A 4K0KQ 3TEHB 3KLSX 2G5DA 1EQVA 5DM73 1SYBA 2WB1E 3BZCA 2RSNA 2WIIB 2EYLA 3PQIA 1B8AA 3U4ZA 5M3MB 3VYRA 4HSVA 1DONA 3PF5A 3C46A 4LF5Q 1Q12A 2UUBL 4JI6Q 3HOWG 2E2JB 2F0TA 1EY6A 1V8QA 2BA1A 4FF2A 2D0PA 2VY3A 1SDFA 2L15A 1PH8A 3RUZA 4JI4L 4ME3A 4A3CG 1BNZA 1H9SA 4FP5D 1VMCA 1FGUA 3CMEA 1N32Q 2YV5A 2UU9L 1CM9A 2F3VA 2Z1CA 4PMBA 1HR0W 1A63A 3HOVG 4KKTA 4O0AA 1NBWA 1QCBD 2VUMG 5ELDA 3RN5A 1SFOB 5IE8A 4JI2L 1JB3A 2IL8A 1R9TB 2H4OA 1AH9A 3GTLB 4MNOA 4X65L 3QR8A 5FOBB 1JC7A 5FLXE 1HA6A 5J39A 1S5FD 2XVSA 5IGFA 1YNJD 1WTRA 1TWGH 5IYCH 1PTOB 1M4VA 2SOBA 4FXKC 1RJTA 4HJAA 1F9QA 4BBRG 2BDOA 2UUAL 1SYCA 3PO2H 1B53A 1XNRQ 2LMCB 3HKZE 3BDLA 3I4NH 4EQPA 3H3VH 4CDEC 5M5XH 1HNZL 4NXMQ 4DV6Q 3TREA 1GM5A 3A8KE 1JR0D 4OONA 4IPDA 4KMUC 1DOMA 3IFTA 3MFGA 4C1NI 1EQQA 5IIFA 2IX1A 4XQNA 3FDTA 4V0BA 1F2LA 4Z9CB 3KF8B 4YWKA 3RNUA 1N33L 1LV9A 2KOLA 2PQAA 1QG7A 3GV3A 1II3A 5KYIA 3K81C 1Y1WH 3GQBA 4C3IB 3SHLA 1F9SA 4YWMA 2AWNA 4N9PA 1PFBA 4EX5A 3PCOB 3H91A 4CJ1B 2PCFB 1PA6A 1IBKL 1JICA 3K5MA 4IUPA 3OTOQ 4B3TQ 4JI5L 3RZOB 1FGBD 2B2TC 4KLKA 1Q3LA 4B3MQ 3N6RA 3NWSA 3BU2A 1VQ4A 4K8IA 4LFAL 1ET9A 1MJCA 4LMQD 2NN6H 3CU7A 2NN6I 5GADC 3HOZG 4RWSC 1I4HA 3S1NB 3OYYA 1EEFD 3OOCA 5AJ3Q 3F8TA 1CUKA 3KF6B 3R93A 3BG3A 4NP5A 2SEBD 1PMRA 1H95A 3G6JB 4RGMA 1AZQA 1EIYB 2ZM6L 3IL8A 5EJWA 1LYLA 3A7AB 4N9TA 3MXNA 3VYTA 2CWAA 3RLOA 5K5PA 2BE5D 3SEBA 5ELEA 1MHWC 3D8GA 3I73A 4JI0L 5DNFA 4F88A 3K5LA 1A3VA 3URYA 3OMGA 3R3OA 2VNUD 2CVRA 1X6OA 5IYDG 5ELFA 2FMCA 1K9MC 2M9VA 3NTIA 1VQHA 2UXBL 1UEAB 2EE1A 4IJLA 5IYBH 4WJ4A 1ENCA 1YEZA 5T1IA 3L2PA 1I50B 1FNUA 1KDBA 4JI8L 1SMXA 1YIJA 4JBKA 3HKZB 5EKIA 4DV3L 4PG3A 3CCSA 1XYIA 1O7LA 2KHJA 5CV4A 1NMFA 2IX0A 2KCNA 3ONAB 4OELB 2VQEL 1QVFA 4DK0A 5LMNL 1X9NA 3HOYH 2QCPX 2ASBA 1EIFA 5M3FH 3TBIB 4J1MA 1SYGA 1HZCA 3R2TA 5CBAE 4JI7L 2NTTA 1LLRD 4HIOA 2CW0D 3HG9A 3E3XA 1UE6A 2ALYB 1S5CD 3ITPA 5CR3A 2R92H 1SE2A 3NXWA 1ZXTA 5JJIA 2O5JC 3DHQA 4PV1C 1EWCA 3G48A 1NE3A 1WCMB 3T16A 1Y14B 3KDFB 2DGYA 2A19A 4TVAB 4A3MH 2NVQH 5ELOA 2K4KA 1L0WA 2XTIA 5M5WB 1RTNA 4WJ3M 1XNQL 3UE1A 3S1RH 2FFKB 4OX9Q 1BF4A 2D5DA 5L37A 1CI3M 1SNQA 3DWAA 4YIJA 3LX0A 2E5LL 1A0IA 5E4XA 4X62L 1K73C 1GUNA 5JJKA 4JOIC 2MO0A 4NXNQ 2EJGC 1XJVA 1I4XA 4CJ2C 1VS0A 2I07B 2OQKA 2WKDA 3I4OA 3RR5A 4UP9A 3TP5A 3GP7A 4R4IA 4Q5VA 2K01A 1IBLQ 3I4MH 2EYPA 4AYBG 5KYLA 3TP6A 2KBNA 3PIP3 1T5XD 4AH6A 3D31A 5IGEA 3HOUH 5EBCA 2L55A 2XWBB 3S17B 2Y0SB 2WINB 4HCEA 1HR0Q 2C5CA 2F0GA 5FLXc 2BH2A 1HZAA 2PYKA 1YNJC 4AQYQ 1PZKD 3T1HQ 1JJ2A 2F0IA 2IW3A 3P75A 1PH5A 1EFWA 3SK5A 4YWLA 2G9DA 3KBXA 4H44C 1Y1WB 1LTID 2EYMA 3OWFA 2DY7A 2B2VA 4K6DA 4UP8A 4GNXC 3HFZB 1MKHA 5J3BA 4IO9A 2AUJD 2KCCA 5J1ZA 4P74A 2NVTB 1WOCA 3M3YH 2JA6G 4KI0A 2AQ3B 3D6WA 3ULJA 1NAPA 1TWHH 3Q8DA 2AKWB 2N8NA 1QB5D 4LF5L 1A6XA 1IYVA 4MTNA 4BY7G 1QNUA 1PH4A 5I9PA 5JVH3 1WI5A 2Q8RE 5IGCA 2YTVA 5IP9H 4IUNA 1G6ZA 3S2HH 1J9OA 4L5RC 1SJED 3JAME 1GVPA 4Y7NH 4WJWA 2EQSA 4RA8A 1EZ6A 1RHPA 2D0OA 2EY2A 4RFBA 4G7OC 5JAVA 1N36Q 4ZQ3A 1EOTA 2F0UA 5KGUA 5E1FA 3VYUA 1PTOD 3QB3A 1N32L 1Q81C 5GROA 4A3KG 3FP9A 3NTKA 2JQOA 4HIMA 4O42A 2IWHA 4K5XA 1O78A 1MBYA 3NELA 1DYQA 4G57A 3H0GH 3CXCA 2XRSD 4ZYSA 5JEAG 1EYDA 2SDFA 1EUJA 1VQ5A 2A5HA 2DJFC 2EYJA 4LF7Q 2NB0A 3E9IA 4A3LH 4LK1C 2PMZE 5TSSA 4ULLA 4DV0Q 3DM3A 3HOYB 1QOHA 1QWYA 3FPPA 1Z6HA 2ZXOA 2KVMA 2XGTA 2BE5C 1A3UA 2A1AA 4C3HG 1XNRL 3F2BA 3S24A 4LF8Q 1BOSA 1LT3D 2E74C 2I5HA 3AFPA 3ND8A 4BY1G 5KEEA 1PH2A 3K7AB 4HN7A 2BCOA 4ILWA 2K52A 1CA5A 1FJGQ 1BBXC 4MN3A 2UU9Q 3CPWA 1HNXQ 1CSQA 4A3GB 1KDCA 3W3AA 2R7FA 3GTOB 1L1OB 2WFWA 4S3SA 3J81E 2RHSB 2RF4A 2XSCA 3NBHB 1Q90A 3VA7A 4P75A 3C2PA 4DUYQ 3HOXB 4DK6C 3CCJA 2ID0A 5I6WA 4K5VA 1X54A 3IRBA 4N8X1 1PXUA 4MTKA 2VZAA 4KD3A 3SXHA 1V1QA 5C4XH 2TMPA 4KKSA 3OTOL 4C3JH 2R7ZG 2CW0C 2UUAQ 3CC2A 1SNDA 3MEFA 2JA5H 3S2DH 2XRQD 1NUCA 2BH8A 1ZEQX 2QEJC 3I4MB 4KK7A 4GLAC 4LFCQ 2D9UA 4QGUA 3AEVA 4XYOA 5AJ3L 3LNNA 1OXTA 1YBYA 3NUCA 3LGJA 5LHY1 2KA7A 4DXGA 4DR6L 5EGTA 4XQQA 3KF6A 3Q23A 2L9HA 4OEMB 3V2TA 1OXVA 4F8MA 1SAPA 1XTCD 4GNXB 1WTXA 4C56C 2CH4W 1LT5D 3BS1A 4WRDA 1UNSA 4KD4A 4UDUC 3CRLC 2UXCQ 5FO7B 4IURA 1YJNA 3D4DA 3PUZA 1YJWA 1KIXA 4I65A 2PMZB 3BDOA 4QJFA 3K5OA 1EEID 2RDHA 3WOFA 2NVYB 1CKNB 1EY7A 2K32A 2OWOA 4JI5Q 1Y69U 3VR5A 1HTPA 3TP8A 2L12A 1PZID 3EROA 3MXGA 1K8GA 1K83H 1K3BC 1J5EL 2F0HA 4DNIA 5IGBA 3J7ZC 1TR5A 3DXJC 1ENFA 2CHBD 2BOSA 3F2CA 4EQ5A 4LNQA 1HQMC 3U9SA 3HOWH 4Y7NB 5LL6S 3J81L 1AN8A 1B7YB 2HDMA 4JYAL 1HJPA 3QOJA 2B63G 3NPPA 2B2WC 2B2UC 4A3BB 1K8MA 4A3CH 2VQFQ 1Y1VG 4JI0Q 4N8FA 1KLGD 4BA2I 4J15A 3KBGA 4BA1I 1XTDA 1SLJA 3HOVH 2RDGA 4IUTA 3TQYA 5IY0A 4DR7Q 3S16H 2RVLA 4ZUJA 2VUMH 2UXBQ 4G7HC 2E2DC 2KHSA 1PLFA 1V1PA 3G4SA 3KDFA 1LTAD 1JQYD 3AU7A 1IKLA 4OX9L 2VS1A 1Q1EA 3N52A 4JI8Q 3CC7A 1I3QH 4HR7B 3QWNA 2C9OA 2CKZB 3GO5A 4YCVA 4DV3Q 3JAMc 3PO3G 5C3XA 1S40A 1HRJA 2E75C 1TWCB 5JEAJ 4NXNL 3NQTA 5KIXA 1FNWA 2CFMA 3FKIG 3B6YA 1VQNA 1P16A 2SNMA 4BBRH 4K14A 1O80A 2ZXRA 1I4PA 3V96A 1D1IA 4Y52H 2C35B 4IFDG 3H94A 5IWAQ 4B9XA 3ZJYC 4FYDA 3UE0A 1JOQA 5H1SE 1GXDC 3K59A 4IQZA 5E7NA 2L4NA 2K03A 5D3DA 3GTPH 5KNBA 4CKEA 4AQYL 2K05A 3T1HL 1NNXA 3HRZC 2A8VA 4A3IG 1BCPB 2K6AA 4K5WA 4R9WA 4HEDA 4ODGA 4P2CB 4L8JA 4NPSA 1BDOA 2QEXA 2QDBA 3S1MB 1QZHA 2LKVA 4CDCC 5BN4A 4IALA 1PRTB 1S5BD 1WTPA 2PNHA 2JA5B 2LXJA 3W1GA 2IJ0A 3PUYA 4DXFA 1QUQA 1QE6A 2B2YC 3J80E 3HOZH 3KK7A 2PI2E 1B9NA 1TVXA 2B3GA 3NBIA 3I56A 2K1BA 4X6AH 1N36L 2R93G 4RHRA 3RZDH 2GA4B 1KC8C 2ZT9C 1BUVT 1TU2B 4A3FG 2MFIA 3DEPA 3SK6A 5EQ0A 1STNA 4NDXA 1IYJB 4L5SA 2ICEC 2MUYA 3AB9A 4KKUA 4LJZC 1STEA 2NTSA 1NSNS 3HGBA 2B29A 2A74C 3FPUB 4PNYA 1UEBA 2LFNA 3E5SA 4A75A 2Z0SA 1YI2A 2MP1A 1Q7YC 1ASYA 4POFA 4LF7L 4QQBX 5IYDH 1WVLA 1I94Q 2X6GA 1CZGA 3NQIA 4DV0L 1LTSD 3R8BA 2EIFA 2JA7B 4DV4Q 2Q8TA 4JVZA 3NENA 1HUMA 4HCSA 1OXXK 3M4OH 1GUWA 4BBSG 1E0BA 3I2ZA 1U4RA 5C4JB 4LF8L 2GVAA 1ESFA 1GUTA 5D3IB 4EQNA 4FF1A 4DAYA 1TWAH 2AQ1B 2ENBA 1IL8A 2OEOA 3SK4A 1JE5A 5C5LA 1FJGL 1HNXL 4YHHQ 1NTGA 4C1NK 5BR8L 2JYOA 1LTRD 2K5WA 3HEJA 4QB4A 3W5OA 4XTCS 5A2QE 3T51B 2KQ3A 2EYHA 2MJ8A 4DV7Q 3T56B 5GAEC 3GV6A 3TMEA 5EAYA 3FRPB 5BN3A 5C3EB 3J7YW 4DUYL 3J80L 2I5LX 1I3QB 3NEMA 5DM63 1LT4D 2RBMA 3PMFA 1TT2A 2JEBI 4GS3A 2F0WA 1QJOA 4JOIA 3J7AF 4GKKQ 4DV2Q 4CJ0B 4APVA 1OXUA 2F0PA 3A56A 4DAPA 3LWEA 4PZ8A 4BBRB 4KV6A 4LFCL 1SNCA 4R8IA 1VQLA 3CW2C 4CGYB 3DM1A 4XT1B 2MNAA 2E2HB 2RA4A 4LF6Q 1EQTA 4A4IA 3H3VC 1XPRA 3J7AV 2WB1B 3CCMA 1EY9A 1FVIA 2ZJPA 4IFDJ 4LUVA 2F1MA 3I3CA 1F2MA 1RL2A 4H02A 2UXCL 1LABA 2CCZA 1Q46A 4PMWA 1MSHA 2J0TD 2K14A 1XWEA 4L5TA 4DV1L 3PIPA 1JOOA 1PZJD 3D6CA 1I5FA 1E22A 3MHBA 3GTQH 1B3QA 4RHSA 1LTGD 4YCUA 2Z9HA 1M8AA 3J81j 2JA6H 1DD2A 1LT6D 2VB3X 3Q22A 2E2IH 5HY6A 1JWMD 5A2QL 4BY7H 2R61A 3K0YA 1HCZA 2IHFA 3CCLA 4DR6Q 3TSSA 4A3JG 1C0AA 3RZDB 4OGQC 1X56A 3NE5B 1ZYRD 1V9PA 2EY1A 3PGZA 2ES2A 3M85A 4DPGA 4AYBE 1ILPA 1HNWL 1X3FA 2VQFL 3BVGA 1SRUA 3CCUA 5DEHA 1WD1A 5E3FA 4CKBA 1STYA 1AZPA 1BR9A 2YYZA 1A2TA 1BBWA 2A6HD 3TS2A 5M5YH 1AE3A 5JJLA 4A3KH 1VQMA 4DR7L 1LTTD 5I2XA 4GOPB 5JPNC 4KHZA 4PQXA 1Q8IA 1X65A 3CP0A 5JEAH 3J80c 3FMCA 1J5EQ 4IPGA 1B1ZA 2A73B 4UPAA 1TY0A 4B3RL 4JI1Q 1L0YB 2Z4IA 2MO1A 1Y8PB 2CQAA 2L11A 4JYAQ 2EY5A 1RD9D 4C3HH 1BCPD 4E6IA 3HKZG 4F87A 1H9RA 4HSPA 1O7IA 3ERSX 4L5QA 3C1FA 3W1BA 5IWAL 4CHTB 4BY1H 4L6TB 1CZWA 5A35A 1PRTD 1GJXA 5EPLA 3MA2B 4UP7A 1SYDA 1SMYD 3S15H 1EYAA 1HHVA 2NVXH 5C6AA 3D0FA 4B08A 2WKCA 2ZTDA 4FF3A 4IJHA 4KY6A 4DV5Q 1L1OC 3CMAA 1VQJA 1TWGB 3WWVA 1K8OA 3MVVA 3NP8A 1Z47A 2HDLA 3SR1A 1VDZA 5CV9A 1WCMG 2BDNA 1FR3A 2ZTCA 2DUDA 3PO2B 4IUUA 4O2DA 1N8RC 2R7ZH 4ME5A 4V190 1L0XB 1VQDA 3I4NB 3DEOA 4QIWE 3KJPA 4JBWA 2Z4HA 2HQEA 5M5XB 2TSSA 1JWSD 4J8QA 1T9HA 2RHQB 1TWFH 1NCVA 4DA2A 3GTKH 2NZOA 3IKJA 4JPBW 4R4OA 2H5XA 3S1QH 5FO9B 1JCKB 1U5KA 2AQ2B 3A74A 1EFID 2HIXA 3X3MA 3GTMH 3NWTA 2F0VA 1CKOA 1W3SA 2FXQA 3MWYW 3CCVA 2HQLA 3PIO3 1EQRA 2JA8H 2Y0SG 1KABA 1VQ7A 1AFPA 2EVBA 5LMUQ 1HQRD 5KRUA 1I94L 1ICFB 4A76A 4B3SQ 5IP7G 2JA6B 1YITA 2HIVA 1K0RA 1N34Q 5I2YA 4DV4L 4K2KA 1G2TA 1NMGA 1K8AC 5GAGC 1U0LA 3KLSA 3MEHA 1V1OA 2B2WA 2B2UA 2K5DA 3KLRA 3K5NA 2F4VQ 3DWPA 1N9WA 3I7FA 4ZLTF 1AE2A 3P20A 2B63H 1JJCB 1SE3A 2ZJQA 2YTYA 4C2MH 4YHHL 4H7BA 1Y1VH 3NK9A 5M5YB 4A3KB 1G6PA 1MIUA 4IN3A 3WDNA 4DAMA 4DV7L 1WD0A 2ZJRA 5ELBA 1X3QA 3IAYA 4XXEA 4JBJA 4L63B 1JT8A 1S5DD 3CQZH 4OHJA 5C5MA 1RF2D 4QIWB 1JORA 2KUMA 4GKKL 4DV2L 5IGGA 3AQQA 4RH6A 4ABNA 1KLUD 3ULLA 5M3FB 1ZYRC 3PO3H 2NBFA 1HUNA 4X64Q 1LTLA 4XYQA 1F77A 4I7ZC 3FKIH 1G8ZD 2I5MX 4BXXG 3I90A 2A6HC 2R92B 1HA5A 2K5NA 3PF4A 5ELCA 4IFDH 2MGSA 1U4MA 4IFDI 4LF6L 5BR8Q 2F0QA 1W6JA 4XDXA 5EPJA 1ML0D 2EYOA 1HTLD 1B44D 1EY4A 4A3MB 2NVQB 4LAAA 2K33A 3D3RA 3S1RB 1I4RA 3KFUA 5AFWA 1KQSA 4ZKCB 3L0OA 2LXKA 1VQBA 2EJMA 3M4YA 5HGQA 3KF8A 4A3GG 3DLLA 3I8ZA 4A3IH 3BZKA 3ER0A 4MZ9A 1CFMA 2NUCA 2OF1A 1TS3A 2KENA 1BCPC 3Q0AA 3PUVA 1VQAA 3P7JA 2H1EA 4A3DG 3HOXG 1UE5A 3UDIA 1STAA 3NHHA 1F2YA 3I55A 2MPMA 1PRTC 4IZ8A 2WAQE 2F0DA 5COYA 4P71A 1SMYC 2VL6A 1LTBD 4RAUC 3HOUB 4B9WA 2EJFC 3TP7A 2K50A 5CV6A 4K2LA 1PYBA 2HUGA 2Q2HA 2K5VA 4TRDA 1D7QA 2N55A 1GUGA 3KLWA 2FHTA 1XX8A 4KY7A 2R93H 4HJ7A 3CCRA 4NB3A 5LL6X 2KCTA 4MHEA 3JAMi 4A3FH 2EZVA 4HJ5A 3S14H 1RIPA 2FINB 2JA8G 4JV5Q 2OQ0A 1IHZA 4ZRZA 3EA6A 1TKWB 2KJXA 4A93G 4IOCA 2X6LA 3RLFA 4DV1Q 1G51A 3M3YB 2PQAB 3W2DA 4A3EG 2JEAI 1D5XC 1TWHB 5F2DA 1VF7A 3OHXC 3A54A 2R3ZA 3VR3A 4RMFA 3GD7A 4JI1L 1HFNA 3S2HB 1PH7A 1TS5A 1KNEA 1PH3A 1I4QA 4DNRB 2JXMB 2IY5B 5E4WC 5I9OA 4MIUA 1C7YA 4BBSH 4OWTB 2B63B 1HNWQ 1FNVA 3CHBD 2HT1A 2Z6KC 4C2MB 1EWIA 5EKKA 1K0SA 2E2JH 1WJJA 2F3WA 1SXTA 3MXNB 3BYYB 1R4PB 4NW2A 2HCCA 3TN2A 3KJOA 3H0GB 3MC0B 2I46A 2RDFA 3NTHA 5DAUA
chains in the Genus database with same CATH topology
1OXSC 1Z7TA 3X3NA 1EU4A 1ONLA 4H13C 4RGNA 1BQQT 2WAQB 2A69D 2PZWA 4FNFA 2VXWA 3ND9A 3HZXA 3QJYA 3VR2A 4F7XA 2WP8J 1WTWA 4HMIA 3VYSA 4DF7A 3SE0A 1PTOH 1DXMA 3PUXA 1WTQA 2ICIA 5CC4A 4JK1C 5D65A 3A8JE 5IOCA 5CYUA 1FD7D 1V43A 5KNDA 2EXZA 3KUPA 4RGOS 1DOKA 3BVZA 3RMHA 4OO1G 3SDZA 5HGTA 1C4QA 1G291 4A3IB 4M1UB 1SYEA 2B2TA 5C4XB 3VA5A 4C3JB 1RCVD 1KNAA 4M8AA 3S2DB 4DU9A 1CHPD 3P1HA 2BA0A 2F0MA 2K28A 1GOZA 2K5QA 5CGKA 2HCIA 4FO2A 1G91A 1TS4A 3EQLC 1O7ZA 2QILA 3G7LA 4KJNA 3S14B 4QUCA 3H09A 2B8GA 3TDQA 3BDCA 3D4RA 3PUWA 3S9WA 2SNSA 2VB2X 5EPKA 1CA6A 1RODA 1K83B 5CV7A 3HP3A 1YNND 1PDQA 1PTOF 3HOWB 4EQOA 2F0NA 1U9RA 1D2BA 1STGA 1SSOA 4XT3B 1IYUA 3CKIB 1OO9B 2XN9C 5CV5A 4BBSB 1CHQD 4OIKA 4ID6A 4X3UA 1KDAA 1PYWD 4ZUIA 2AUKA 3HOVB 1TQOA 4TSSA 3S16B 2VUMB 5D14A 3QO2A 3OMCA 2J4XA 3NBHA 1ILQA 1EL0A 3OW7A 4WORA 4GZYC 4Q0FA 1Q1BA 5I4DA 1J8IA 1U4LA 5C0XJ 3QOLA 1D5MC 3C3LA 2OT2A 4K8JA 3RD4A 1SEBD 4PMCA 3E0JA 5C3WA 4X3TA 1EY5A 4RGTA 5JOBA 1Y8NB 5C4HA 2QKIC 1ESRA 3GTPB 4NKLA 4DAVA 4EVOA 5HURA 1F9PA 2F4IA 4TKOB 1DM0B 4H0LC 2A69C 1X32A 1HPCA 5FK9C 5CBEE 1ICWA 1SNPA 1UUPA 5I6YA 3UI2A 3ERQA 4C3IG 3HOZB 4UAIA 2PZUA 2PPBC 3H6MA 5KNCA 3VR6A 1STHA 1VCIA 2J7ZA 1LO5D 5ISRA 4XQJA 1R4QB 3V05A 4A3JB 1SJHD 3VR4A 2EOTA 1CK1A 3QIAA 5IT9E 1ZKOA 3AMUA 1QNKA 4FXGC 2F0LA 5FO8B 2QF7A 1DJRD 1S5ED 5FLXL 4G7ZC 5G3LF 2PW7A 2D62A 1CT1D 3SVMA 2MHVA 3Q24A 3M4OB 1I4GA 3OIPA 2NWGA 1GUSA 1TWAB 1F2ZA 1DCZA 2PZTA 4KN4C 1DZ1A 3A7LA 1TY2A 4DFAA 1W6KA 2F03A 5K36H 3MXUA 3R2IA 3K58A 3NSWA 2JP1A 1C48A 1YNNC 2F0JA 1B4OA 2E76C 5FKAC 1AP0A 5C0XG 2OXPA 1IW7D 5JVG3 1EU3A 1V1PB 5CMDA 4QCLA 4ZK9B 5C4ZA 4DN4M 4DGZA 1G2SA 1RTOA 5IT9L 1GUOA 4HTHA 3IFDA 4FXDA 2KECA 4AYBB 1DOLA 4CBVA 1X3PA 2XNAC 1H9JA 1BO0A 2DNEA 3FVQA 2L1BA 2XWJB 4KJOA 1H9MA 4HAEA 2FJ2A 4XIGS 4QF4A 1A15A 2KEEA 4J6HA 2IPKD 2IT1A 3M7GA 2F0EA 1E2ZA 1E2VA 1B50A 4CKCA 4RKBA 3Q6SA 3GTQB 1A3TA 1AW7A 2KEDA 2A68D 1ENAA 4ZKBB 3C1EA 2E2IB 1IKMA 1U4PA 1WTOA 1STBA 4BY7B 4WFN3 1ET6A 1T5EA 1RDPD 3HS0C 2NN6G 2A6ED 3M7NA 2N88A 1LACA 5EBDA 5M9OA 3DUZA 1KAAA 1TIID 3BZDB 4X3SA 1GHJA 2RKSA 1TS2A 5C0XH 3T4AC 1EIGA 5C0XI 1NR4A 2M00A 4EGVA 2RQXA 3D4WA 3DWQA 4RKLA 2Q8IB 5CORA 3T13A 1EYCA 3U9OA 4FF4A 4RCOA 4C3HB 4IUVA 3I70A 2F0OA 4BWGB 1CQVA 1EZ8A 2WV6D 3GTJB 4BY1B 1B9MA 4OL7A 2FMMA 1RKNA 3T53B 1SYFA 1PFMA 3MZ5A 4U68A 4X3KA 3S15B 5K36G 3QG1A 2NVXB 4KHVA 1H9SB 1I6VC 3K6OA 2DY8A 3OIQA 2V4DA 3BVMA 4OO1H 4OO1I 1EY8A 1GHKA 2K7VA 3OPOA 4QMGA 4KTAA 2R7ZB 2LS01 4IUQA 1H9KA 2B2YA 2PW5A 3E6ZX 4A3DB 2F0KA 1UAPA 1SNOA 3O13A 1TWFB 3ZYYX 3JAML 1SBBB 3GTKB 3WOEA 1C8CA 3S1QB 1MI2A 3L9AX 4U673 5JPMC 1WTVA 5JJZA 5IODA 1S4ZA 1CTMA 3GTMB 3BYTB 1D5ZC 1MSGA 1PFNA 1SNMA 1MD2D 1IW7C 2G9HD 2JA8B 4G4KA 5NUCA 3TZDA 2D2CC 4A93B 5J22A 1A2UA 1Y8OB 4A3EB 2O5IC 1SE4A 2PQEA 2L0CA 2PO4A 1QILA 1B3AA 1JWUD 2B2VC 2DN8A 3PV0A 1EWHA 2YU9B 3EVQA 4KY5A 2LY7A 3K57A 1EY0A 1VF5C 4QUFA 1Y1VB 2L5TA 1F9RA 2F0SA 2NYZD 5G3LD 5T1GA 2ZXPA 3SK8A 2A68C 2B39A 2O4XA 3OWEB 2NZ1D 1I6HB 3CQZB 3L3OC 1BCPF 2XIWA 4KN7C 5BN5A 1BXTA 3EJIA 2A6EC 2F0FA 3PO3B 4K6LA 3GTGB 1PRTF 2JE6I 1B2TA 3CRKC 3MAQA 3FKIB 4DK1A 1HXYD 1NR2A 3MTSA 5C44B 2IX3A 3I72A 1JOKA 4TQUS 4R8NA 1JE4A 1KTKA 2WACA 1E2WA 4BS9A 1HFGA 5EKLA 4NMZA 1CQFA 1PTOC 5CV8A 2X69A 3I91A 3A55A 1FYCA 3EFXD 1O7YA 4RCNA 4OIJA 2EPBA 3MFYA 4O1NA 2DNCA 5IGDA 2EY6A 2M2LA 2EDGA 2K04A 3MXPA 3LWUA 1VMPA 4FVMA 3A8IE 2R6GA 1EIHA 2O2LD 3L7ZC 4C3JG 3FEWX 3TZUA 2EYFA 1D1KA 2R93B 4HMJA 4ZAIA 4A3FB 1D6EC 1MGSA 4DNTB 1XXGA 2AWOA 3F2UA 2RSOA 3I4LA 1AEXA 2B8FA 2PNRC 2JSOA 3OSOA 2Z8LA 3DMUA 3KLSX 1EQVA 5DM73 1SYBA 2RSNA 2WIIB 2EYLA 5M3MB 3VYRA 4HSVA 1DONA 3C46A 1Q12A 2E2JB 2F0TA 1EY6A 1V8QA 2BA1A 4FF2A 1SDFA 3RUZA 1BNZA 1H9SA 4FP5D 1VMCA 1CM9A 2F3VA 2Z1CA 4PMBA 4KKTA 1QCBD 5ELDA 1SFOB 1JB3A 2IL8A 1R9TB 2H4OA 3GTLB 5FOBB 1JC7A 5FLXE 1HA6A 5J39A 1S5FD 2XVSA 5IGFA 1YNJD 1WTRA 1PTOB 1M4VA 2SOBA 4FXKC 1RJTA 1F9QA 2BDOA 1SYCA 1B53A 2LMCB 3BDLA 4EQPA 3A8KE 1JR0D 4KMUC 1DOMA 3IFTA 3MFGA 4C1NI 5IIFA 2IX1A 4XQNA 3FDTA 4V0BA 1F2LA 4Z9CB 1LV9A 2KOLA 3GV3A 1QG7A 1II3A 5KYIA 3GQBA 4C3IB 3SHLA 1F9SA 2AWNA 4N9PA 1PFBA 4CJ1B 3H91A 2PCFB 1JICA 3K5MA 4IUPA 3RZOB 1FGBD 2B2TC 1Q3LA 3N6RA 3NWSA 4K8IA 1ET9A 4LMQD 2NN6H 3CU7A 2NN6I 4RWSC 1I4HA 3S1NB 1EEFD 3OOCA 3R93A 3BG3A 4NP5A 2SEBD 1PMRA 3G6JB 4RGMA 1AZQA 3IL8A 5EJWA 3A7AB 4N9TA 3MXNA 3VYTA 5K5PA 2BE5D 3SEBA 5ELEA 3D8GA 3I73A 5DNFA 4F88A 3K5LA 1A3VA 3URYA 3OMGA 3R3OA 2VNUD 2CVRA 5ELFA 2FMCA 2M9VA 3NTIA 1UEAB 2EE1A 1ENCA 5T1IA 1I50B 1FNUA 1KDBA 3HKZB 5EKIA 1XYIA 1O7LA 5CV4A 2IX0A 2KCNA 3ONAB 4DK0A 2QCPX 3TBIB 4J1MA 1SYGA 3R2TA 5CBAE 2NTTA 1LLRD 2CW0D 3HG9A 1S5CD 3ITPA 5CR3A 1SE2A 3NXWA 1ZXTA 2O5JC 3DHQA 4PV1C 1EWCA 1WCMB 3T16A 5M5WB 1RTNA 2FFKB 1BF4A 2D5DA 1CI3M 1SNQA 3DWAA 4YIJA 3LX0A 5E4XA 1GUNA 2EJGC 1I4XA 4CJ2C 2I07B 2WKDA 3TP5A 3GP7A 4Q5VA 2K01A 2EYPA 5KYLA 3TP6A 3PIP3 1T5XD 3D31A 5IGEA 5EBCA 2L55A 2XWBB 3S17B 2Y0SB 2WINB 4HCEA 2C5CA 2F0GA 2PYKA 1YNJC 1PZKD 2F0IA 2IW3A 3P75A 3SK5A 2G9DA 3KBXA 4H44C 1Y1WB 1LTID 2EYMA 3OWFA 2DY7A 2B2VA 4K6DA 2AUJD 2KCCA 5J1ZA 2NVTB 4KI0A 2AQ3B 3D6WA 1NAPA 1QB5D 1A6XA 1IYVA 1QNUA 5I9PA 5JVH3 2Q8RE 5IGCA 4IUNA 1G6ZA 1J9OA 1SJED 3JAME 4WJWA 4RA8A 1EZ6A 1RHPA 2EY2A 4RFBA 4G7OC 5JAVA 4ZQ3A 1EOTA 2F0UA 5KGUA 5E1FA 3VYUA 1PTOD 3QB3A 3NTKA 4O42A 2IWHA 4K5XA 1O78A 1MBYA 1DYQA 4G57A 2XRSD 4ZYSA 5JEAG 1EYDA 2SDFA 2A5HA 2EYJA 2NB0A 4LK1C 5TSSA 4ULLA 3HOYB 1QOHA 1QWYA 3FPPA 1Z6HA 2ZXOA 2KVMA 2BE5C 1A3UA 4C3HG 1BOSA 1LT3D 2E74C 3ND8A 5KEEA 3K7AB 4HN7A 2BCOA 4ILWA 1CA5A 1BBXC 4MN3A 4A3GB 1KDCA 3W3AA 3GTOB 4S3SA 3J81E 2XSCA 1Q90A 3VA7A 3C2PA 3HOXB 2ID0A 5I6WA 4K5VA 1PXUA 3SXHA 4KD3A 2TMPA 4KKSA 2CW0C 1SNDA 2XRQD 1NUCA 1ZEQX 2QEJC 3I4MB 4KK7A 2D9UA 4XYOA 3LNNA 1OXTA 3NUCA 5LHY1 2KA7A 4DXGA 5EGTA 4XQQA 3Q23A 2L9HA 3V2TA 1OXVA 4F8MA 1SAPA 1XTCD 1WTXA 4C56C 1LT5D 3BS1A 4WRDA 1UNSA 4KD4A 4UDUC 3CRLC 5FO7B 4IURA 3D4DA 3PUZA 4I65A 2PMZB 3BDOA 3K5OA 1EEID 2RDHA 3WOFA 2NVYB 1EY7A 2K32A 1Y69U 3VR5A 1HTPA 3TP8A 2L12A 1PZID 3EROA 3MXGA 2F0HA 5IGBA 1TR5A 3DXJC 1ENFA 2CHBD 2BOSA 1HQMC 3U9SA 4Y7NB 5LL6S 3J81L 1AN8A 2HDMA 3QOJA 3NPPA 2B2WC 2B2UC 4A3BB 1K8MA 1KLGD 4BA2I 3KBGA 4BA1I 2RDGA 4IUTA 2RVLA 4ZUJA 4G7HC 2E2DC 2KHSA 1PLFA 1V1PA 1LTAD 1JQYD 3AU7A 1IKLA 1Q1EA 3N52A 4HR7B 3QWNA 2C9OA 3GO5A 5C3XA 1HRJA 2E75C 1TWCB 5JEAJ 3NQTA 5KIXA 1FNWA 2SNMA 4K14A 1O80A 2ZXRA 1I4PA 3V96A 1D1IA 4IFDG 3H94A 4B9XA 4FYDA 1JOQA 1GXDC 3K59A 4IQZA 2L4NA 2K03A 5D3DA 5KNBA 4CKEA 2K05A 3HRZC 1BCPB 2K6AA 4K5WA 4R9WA 4HEDA 4ODGA 4P2CB 4L8JA 1BDOA 2QDBA 3S1MB 2LKVA 5BN4A 4IALA 1PRTB 1S5BD 1WTPA 2JA5B 2IJ0A 3PUYA 4DXFA 1QE6A 2B2YC 3J80E 3KK7A 1B9NA 1TVXA 3NBIA 2K1BA 4RHRA 2GA4B 2ZT9C 1BUVT 1TU2B 3DEPA 3SK6A 5EQ0A 1STNA 4NDXA 2ICEC 2MUYA 3AB9A 4KKUA 4LJZC 1STEA 2NTSA 1NSNS 3HGBA 2A74C 3FPUB 4PNYA 3E5SA 2LFNA 2MP1A 1WVLA 2X6GA 1CZGA 3NQIA 1LTSD 3R8BA 2JA7B 2Q8TA 1HUMA 4HCSA 1OXXK 1GUWA 1E0BA 1U4RA 5C4JB 1ESFA 1GUTA 5D3IB 4EQNA 4FF1A 4DAYA 2AQ1B 2ENBA 1IL8A 2OEOA 3SK4A 5C5LA 4C1NK 2JYOA 1LTRD 2K5WA 3HEJA 4QB4A 4XTCS 5A2QE 3T51B 2KQ3A 2EYHA 2MJ8A 3T56B 3GV6A 3TMEA 3FRPB 5BN3A 5C3EB 3J7YW 3J80L 1I3QB 5DM63 1LT4D 2RBMA 3PMFA 1TT2A 2JEBI 2F0WA 1QJOA 3J7AF 4CJ0B 1OXUA 2F0PA 3A56A 4DAPA 3LWEA 4BBRB 4KV6A 1SNCA 4R8IA 4CGYB 3DM1A 4XT1B 2E2HB 2RA4A 1EQTA 3H3VC 3J7AV 2WB1B 1EY9A 4IFDJ 2F1MA 3I3CA 1F2MA 1LABA 4PMWA 1MSHA 2J0TD 1XWEA 1JOOA 1PZJD 3D6CA 3MHBA 4RHSA 1LTGD 1M8AA 1DD2A 1LT6D 2VB3X 3Q22A 1JWMD 5A2QL 2R61A 3K0YA 1HCZA 3TSSA 3RZDB 4OGQC 3NE5B 1ZYRD 2EY1A 3M85A 1ILPA 3BVGA 1WD1A 5DEHA 5E3FA 4CKBA 1STYA 1AZPA 1BR9A 2YYZA 1A2TA 2A6HD 1LTTD 5I2XA 5JPNC 4KHZA 4PQXA 1Q8IA 5JEAH 3FMCA 1B1ZA 2A73B 1TY0A 1L0YB 2Z4IA 1Y8PB 2CQAA 2L11A 2EY5A 1RD9D 1BCPD 4E6IA 4F87A 1H9RA 4HSPA 3C1FA 4CHTB 4L6TB 1CZWA 5A35A 1PRTD 1GJXA 5EPLA 3MA2B 1SYDA 1SMYD 1EYAA 1HHVA 5C6AA 4B08A 2WKCA 4FF3A 4KY6A 1TWGB 1K8OA 3MVVA 3NP8A 1Z47A 2HDLA 3SR1A 1VDZA 5CV9A 2BDNA 1FR3A 3PO2B 4IUUA 4ME5A 4V190 1L0XB 3I4NB 3DEOA 4JBWA 2Z4HA 2HQEA 5M5XB 2TSSA 1JWSD 4J8QA 1NCVA 4DA2A 3IKJA 5FO9B 1JCKB 2AQ2B 1EFID 3X3MA 3NWTA 2F0VA 3MWYW 3PIO3 1KABA 1AFPA 2EVBA 1HQRD 5KRUA 2JA6B 5I2YA 4K2KA 1G2TA 3KLSA 3MEHA 1V1OA 2B2WA 2B2UA 2K5DA 3KLRA 3K5NA 3DWPA 4ZLTF 3P20A 1SE3A 4H7BA 3NK9A 5M5YB 4A3KB 3WDNA 4IN3A 1WD0A 5ELBA 1X3QA 3IAYA 4XXEA 4L63B 1S5DD 4OHJA 5C5MA 1RF2D 4QIWB 1JORA 2KUMA 5IGGA 4RH6A 4ABNA 1KLUD 5M3FB 1ZYRC 2NBFA 1HUNA 4XYQA 1F77A 4I7ZC 1G8ZD 3I90A 2A6HC 2R92B 1HA5A 5ELCA 4IFDH 2MGSA 1U4MA 4IFDI 2F0QA 1W6JA 4XDXA 5EPJA 1ML0D 2EYOA 1HTLD 1B44D 1EY4A 4A3MB 2NVQB 4LAAA 2K33A 3D3RA 3S1RB 1I4RA 5AFWA 4ZKCB 2EJMA 3M4YA 3KF8A 3I8ZA 1CFMA 2NUCA 2OF1A 1TS3A 1BCPC 3Q0AA 3PUVA 3P7JA 2H1EA 1STAA 3NHHA 1F2YA 2MPMA 1PRTC 4IZ8A 2F0DA 5COYA 1SMYC 1LTBD 4RAUC 3HOUB 4B9WA 2EJFC 3TP7A 5CV6A 4K2LA 2HUGA 4TRDA 2N55A 1GUGA 2FHTA 1XX8A 4KY7A 5LL6X 4MHEA 2EZVA 2FINB 1IHZA 4ZRZA 3EA6A 1TKWB 2KJXA 2X6LA 3RLFA 3M3YB 3W2DA 2JEAI 1D5XC 1TWHB 5F2DA 1VF7A 3OHXC 3A54A 2R3ZA 3VR3A 1HFNA 3GD7A 3S2HB 1TS5A 1KNEA 1I4QA 4DNRB 2JXMB 5E4WC 5I9OA 4MIUA 2B63B 1FNVA 3CHBD 4C2MB 5EKKA 2F3WA 1SXTA 3BYYB 1R4PB 4NW2A 2HCCA 3TN2A 3H0GB 3MC0B 2I46A 2RDFA 3NTHA 5DAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEO A;  3NUC A;  4IUN A;  5CV4 A;  4LAA A;  2EYF A;  3SK4 A;  5DEH A;  3U9O A;  5E3F A;  1STY A;  4B9X A;  5C5L A;  1SNP A;  5C4Z A;  5I6Y A;  2F0V A;  1JOQ A;  4DGZ A;  1A2T A;  1EZ6 A;  5CV7 A;  1SYC A;  5EGT A;  3HEJ A;  2F0O A;  4J1M A;  1SYG A;  4QB4 A;  2EY2 A;  3ERQ A;  4HTH A;  5JAV A;  1EZ8 A;  2KQ3 A;  2EYH A;  2PZU A;  3V2T A;  4HMJ A;  3H6M A;  3BDL A;  4ZQ3 A;  4EQO A;  2F0N A;  3EVQ A;  4KY5 A;  4OL7 A;  2F0U A;  2PZW A;  1U9R A;  2NUC A;  2OF1 A;  1EY0 A;  1KAB A;  1STH A;  1RKN A;  1STG A;  5E1F A;  3ITP A;  1SYF A;  3TME A;  4EQP A;  3QB3 A;  4WRD A;  4KD4 A;  5CR3 A;  3MZ5 A;  5ISR A;  2F0S A;  5KRU A;  3NXW A;  4KJO A;  3D4D A;  5CV5 A;  4KHV A;  3HZX A;  1STA A;  2RBM A;  3PMF A;  4K5W A;  3NHH A;  1F2Y A;  4I65 A;  3SK8 A;  4F7X A;  1TT2 A;  3DHQ A;  4K5X A;  2F0W A;  4IZ8 A;  4ODG A;  2O4X A;  2F0D A;  4HMI A;  4ID6 A;  1AEX A;  4K2K A;  1KDA A;  5IIF A;  2QDB A;  4QF4 A;  2LKV A;  3T16 A;  4DF7 A;  1EY7 A;  4IAL A;  4J6H A;  4G57 A;  4ZUI A;  4B9W A;  3TP7 A;  2F0P A;  1EYD A;  3MEH A;  3OSO A;  3TP8 A;  5CV6 A;  3DMU A;  2EYJ A;  2F0L A;  5CC4 A;  4K2L A;  3ERO A;  4TRD A;  1II3 A;  5KYI A;  1TQO A;  2EY5 A;  2F0E A;  4KV6 A;  3SHL A;  1SNQ A;  4YIJ A;  4E6I A;  1EQV A;  3EJI A;  1SYB A;  1SNC A;  2F0H A;  3LX0 A;  2F0F A;  1EY8 A;  4KY7 A;  1TR5 A;  4N9P A;  5IGB A;  5IOC A;  3C1F A;  2EXZ A;  4QMG A;  2EYL A;  4KTA A;  4RKB A;  4F8M A;  3OMC A;  1A3T A;  2PW5 A;  5KGU A;  4H7B A;  1ENA A;  1A3U A;  2PW7 A;  3NK9 A;  4K8I A;  5HGT A;  1SYD A;  3C1E A;  1SYE A;  1IHZ A;  4WOR A;  3TP5 A;  2F0K A;  1EYA A;  3VA5 A;  1SNO A;  3QOJ A;  1STB A;  1EY9 A;  5C6A A;  3QOL A;  2EYP A;  5KYL A;  3TP6 A;  5KEE A;  1JOK A;  1F2M A;  3SK6 A;  1STN A;  1EY6 A;  2F0T A;  4NDX A;  4R8N A;  2WAC A;  4NP5 A;  4KY6 A;  5EKL A;  4K8J A;  4DU9 A;  4NMZ A;  5F2D A;  4PMC A;  5IGE A;  3P1H A;  2F0M A;  1KDC A;  5C5M A;  1F2Z A;  5IOD A;  4N9T A;  4S3S A;  1JOR A;  5CV8 A;  3MVV A;  5C3W A;  3NP8 A;  3RUZ A;  3SR1 A;  1NSN S;  5CV9 A;  5CGK A;  5IGG A;  5K5P A;  2PZT A;  1EY5 A;  4ZUJ A;  5JOB A;  2F0G A;  2PYK A;  4PNY A;  5C4H A;  3E5S A;  3D8G A;  1JOO A;  2F0I A;  2KHS A;  3D6C A;  3MHB A;  1SNM A;  3P75 A;  4ME5 A;  2F3V A;  3SK5 A;  5M9O A;  4PMB A;  5I6W A;  5I9O A;  4MIU A;  2EYM A;  4K5V A;  4NKL A;  3OWF A;  4DFA A;  4EVO A;  4K6D A;  5HUR A;  1A3V A;  3OMG A;  3R3O A;  5NUC A;  1KAA A;  2HQE A;  3SXH A;  4KD3 A;  5J1Z A;  2RKS A;  4KJN A;  5C3X A;  5IGD A;  2F0J A;  5J22 A;  2EY6 A;  5EKK A;  1A2U A;  3NQT A;  5KIX A;  1ENC A;  1SND A;  3MXP A;  2M00 A;  2F0Q A;  2F3W A;  3BDC A;  3S9W A;  2PQE A;  5J39 A;  2SNM A;  1NUC A;  2EYO A;  1KDB A;  3D4W A;  4K14 A;  5IGF A;  4EQN A;  4RKL A;  2EY1 A;  3T13 A;  2OXP A;  2ENB A;  2SOB A;  5I9P A;  1EY4 A;  2SNS A;  5IGC A;  2RDF A;  1EYC A;  5DAU A; 
#chains in the Genus database with same CATH topology
 1OXS C;  1Z7T A;  3X3N A;  4A3B G;  1EU4 A;  1ONL A;  4DV5 L;  4H13 C;  3UDF A;  4RGN A;  1BQQ T;  1WTH A;  1IL2 A;  4B3R Q;  3J81 i;  2WAQ B;  2F52 A;  3UDX A;  2A69 D;  2PZW A;  1PFS A;  1VQ9 A;  1K3R A;  1LM0 A;  4FNF A;  1UWV A;  2VXW A;  3ND9 A;  1SFO H;  3AFQ A;  1R9T H;  1YJ9 A;  1IZ6 A;  3HZX A;  3QJY A;  3GTL H;  3VR2 A;  5C44 G;  4F7X A;  2WP8 J;  1WTW A;  3U58 A;  4HMI A;  3VYS A;  4DR5 Q;  4DF7 A;  3SE0 A;  1PTO H;  1DXM A;  3PUX A;  3VDY A;  1WTQ A;  2ICI A;  2QGQ A;  5CC4 A;  4JK1 C;  4YY3 Q;  5D65 A;  3TRZ A;  1PVO A;  3A8J E;  4GKJ L;  5IOC A;  5CYU A;  1TXY A;  1FD7 D;  1V43 A;  5KND A;  2EXZ A;  3KUP A;  4RGO S;  2CQO A;  2RCN A;  1DOK A;  3BVZ A;  3RMH A;  1XPO A;  4OO1 G;  3SDZ A;  1K28 A;  5HGT A;  1C4Q A;  1G29 1;  4A3I B;  4M1U B;  1SYE A;  2B2T A;  5C4X B;  2JN4 A;  3VA5 A;  4C3J B;  1RCV D;  1KNA A;  2AHO B;  4M8A A;  5LMU L;  3S2D B;  4LUO A;  4DU9 A;  1CHP D;  4B3S L;  3P1H A;  2BA0 A;  2F0M A;  1E3P A;  2K28 A;  2V1C C;  1N34 L;  1GOZ A;  2K5Q A;  5CGK A;  2HCI A;  4FO2 A;  1G91 A;  1TS4 A;  3EQL C;  3J81 c;  1O7Z A;  4P72 A;  1QZG A;  4POG A;  3RZO H;  2F4V L;  1W2B A;  1L2F A;  2QIL A;  4A3J H;  4UHV A;  1PH6 A;  3G7L A;  4KJN A;  4RG1 A;  3ULP A;  3S1N H;  3S14 B;  4P73 A;  4QUC A;  3H09 A;  1VQK A;  2B8G A;  3TDQ A;  3EN2 A;  3BDC A;  3D4R A;  3PUW A;  3S9W A;  5FJ8 G;  4LFB Q;  4X66 Q;  3F1Z A;  2EXD A;  2SNS A;  2VB2 X;  2DJG C;  5EPK A;  4LF4 Q;  3J7A 5;  1CA6 A;  1ROD A;  1K83 B;  1VQ6 A;  5CV7 A;  3HP3 A;  1YNN D;  1PDQ A;  4GOP C;  1A8V A;  1PTO F;  3F2D A;  4EQO A;  3HOW B;  2F0N A;  4LWC A;  1U9R A;  2IHE A;  1D2B A;  1STG A;  1SSO A;  4XT3 B;  1IYU A;  5M3M G;  3CPF A;  3CKI B;  4X64 L;  4ALP A;  1OO9 B;  2XN9 C;  5CV5 A;  4BBS B;  1CHQ D;  4OIK A;  3RN2 A;  1I50 H;  4ID6 A;  4X3U A;  1KDA A;  2JA7 G;  1PYW D;  4GN5 A;  4ZUI A;  2UXD Q;  3HKS A;  2AUK A;  3HOV B;  1TQO A;  4TSS A;  3OW2 A;  1VQG A;  3S16 B;  2VW9 A;  2VUM B;  1L1O A;  5D14 A;  3QO2 A;  4LF9 Q;  3OMC A;  2HD3 A;  2J4X A;  1UE7 A;  3NBH A;  1ILQ A;  2OCE A;  4YCW A;  3G71 A;  4IPC A;  1EL0 A;  3OW7 A;  4WOR A;  4GZY C;  4Q0F A;  1Q1B A;  4DUZ Q;  5I4D A;  1J8I A;  1U4L A;  3EBE A;  5C0X J;  3QOL A;  1OTC A;  1D5M C;  3C3L A;  2OT2 A;  1WCM H;  5C3E G;  4K8J A;  3RD4 A;  1SEB D;  4PMC A;  3E0J A;  2I0Q A;  2Q2U A;  2YTX A;  5M5W H;  1YZ6 A;  5C3W A;  4OWW B;  1D8L A;  4DR3 L;  4X3T A;  1M1K C;  1EY5 A;  4RGT A;  5JOB A;  1Y8N B;  5C4H A;  2QKI C;  5FLM G;  1ESR A;  1YHB A;  2N3S A;  3GTP B;  4NKL A;  4DAV A;  1Q86 C;  4EVO A;  3J80 i;  5HUR A;  3A0J A;  1F9P A;  1VQI A;  2F4I A;  3EIV A;  4TKO B;  1DM0 B;  4H0L C;  4GNX A;  3H3V I;  2A69 C;  1J6Q A;  1X32 A;  4JV5 L;  4CDF C;  1HPC A;  5FK9 C;  1GKH A;  2WB1 G;  5CBE E;  4IPH A;  1ICW A;  3S17 H;  3T1Y Q;  1SNP A;  1CKN A;  1LUZ A;  1UUP A;  5I6Y A;  3UI2 A;  3CC4 A;  3ERQ A;  4C3I G;  3HOZ B;  4UAI A;  2PZU A;  2PPB C;  5IP7 H;  3H6M A;  5KNC A;  1PYS B;  3VR6 A;  1STH A;  1VCI A;  2J7Z A;  1LO5 D;  5ISR A;  4XQJ A;  1WFQ A;  1VQO A;  1KXL A;  2NVT H;  4KHP L;  1R4Q B;  3V05 A;  4IOA A;  4A3J B;  1SJH D;  3VR4 A;  2EOT A;  1CK1 A;  3QIA A;  4R4T A;  5IT9 E;  1ZKO A;  1KRT A;  2CWP A;  3PIO A;  3TS0 A;  4DR4 Q;  3AMU A;  1QNK A;  4FXG C;  2F0L A;  5FO8 B;  1CSP A;  4DR2 Q;  3E0E A;  2QF7 A;  4HJ8 A;  1Z9F A;  3K8A A;  1DJR D;  2JA9 A;  1S5E D;  5FLX L;  4G7Z C;  1S3O A;  5G3L F;  1XPU A;  1SE8 A;  2PW7 A;  2D62 A;  1JMC A;  1DGS A;  1CT1 D;  3BJU A;  2JK8 A;  3SVM A;  2KHI A;  3E9H A;  2MHV A;  3CCE A;  4CDD C;  3Q24 A;  3M4O B;  2Y0S E;  1I4G A;  1YVC A;  4JI3 Q;  3OIP A;  4JCV E;  2NWG A;  3G6E A;  1GUS A;  1TWA B;  1F2Z A;  4DR5 L;  1DCZ A;  3STB D;  3GTJ H;  2PZT A;  4BXX H;  4KN4 C;  1FL0 A;  4YY3 L;  1DZ1 A;  1XMO L;  3A7L A;  1TY2 A;  4R4C A;  4DFA A;  1W6K A;  3SGI A;  2F03 A;  5K36 H;  3MXU A;  2HHH Q;  3R2I A;  3K58 A;  3NSW A;  2JP1 A;  4PZ7 A;  1C48 A;  1YNN C;  2F0J A;  1B4O A;  1XMQ Q;  2E76 C;  5FKA C;  3K7A H;  1AP0 A;  3GDE A;  5C0X G;  2QW7 A;  3CD6 A;  4A3G H;  3CAM A;  1YHQ A;  4I7A A;  2OXP A;  4GLV B;  3GTO H;  1IW7 D;  5JVG 3;  1EU3 A;  1V1P B;  2UUC Q;  5CMD A;  4QCL A;  4ZK9 B;  5C4Z A;  4DN4 M;  2KCM A;  4DGZ A;  1G2S A;  1RTO A;  5IT9 L;  1GUO A;  2GN5 A;  4HTH A;  2N49 A;  5IYC G;  4A3D H;  3IFD A;  1E1O A;  4JC0 A;  4FXD A;  3HOX H;  1SR3 A;  1X55 A;  2KEC A;  4AYB B;  1DOL A;  4HJ9 A;  4CBV A;  1X3P A;  2XNA C;  1H9J A;  4FDB A;  1BO0 A;  2DNE A;  3PO2 G;  3FVQ A;  2L1B A;  4ZCK A;  2XWJ B;  4KJO A;  2MQH A;  1H9M A;  4HAE A;  4GKJ Q;  2FJ2 A;  4XIG S;  3I4N G;  3ICE A;  4HID A;  4QF4 A;  1A15 A;  2KEE A;  4GN3 B;  2K75 A;  4J6H A;  2IPK D;  4R4Q A;  2IT1 A;  1PHJ A;  4LFB L;  3M7G A;  4X66 L;  3M9B A;  2F0E A;  1E2Z A;  1E24 A;  1E2V A;  1MJE A;  1B50 A;  1Q8K A;  4LF4 L;  4CKC A;  4RKB A;  2OTL A;  3Q6S A;  3GTQ B;  4A93 H;  1EOV A;  1A3T A;  1AW7 A;  2KED A;  4DR1 Q;  2A68 D;  1ENA A;  4R1J A;  1Y1W G;  4ZKB B;  4A3E H;  2K5H A;  3C1E A;  4K0K L;  2E2I B;  1IKM A;  1U4P A;  1WTO A;  4JBM A;  1STB A;  4BY7 B;  4WFN 3;  1ET6 A;  1T5E A;  1X3G A;  1RDP D;  3U4V A;  4GLX A;  2NVY H;  3HS0 C;  1IBM Q;  2NN6 G;  2A6E D;  3UDG A;  5GQO A;  1QUQ B;  2NZH A;  2Z6K A;  3M7N A;  2N88 A;  2YU9 H;  5LMN W;  4JI6 L;  2UXD L;  3JC6 6;  1LAC A;  5EBD A;  5M9O A;  3K7U C;  3DUZ A;  2Q2T A;  5DLQ E;  1KAA A;  1TII D;  3BZD B;  4X3S A;  1GHJ A;  2RKS A;  1VQE A;  4LF9 L;  4QY7 A;  1TS2 A;  5C0X H;  3T4A C;  1EIG A;  1I6H H;  1UE1 A;  5C0X I;  4A3B H;  1NR4 A;  2M00 A;  4EGV A;  4DUZ L;  2RQX A;  3D4W A;  3DWQ A;  1ASZ A;  4RKL A;  2Q8I B;  5COR A;  2P5Z X;  3T13 A;  3H15 A;  2F3I A;  1EYC A;  5IYB G;  3U9O A;  3GTG H;  4FF4 A;  4RCO A;  1KRS A;  4C3H B;  4IUV A;  2PI2 A;  3I70 A;  2F0O A;  4BWG B;  5IT9 c;  1CQV A;  1EZ8 A;  4JG2 A;  2WV6 D;  4DK3 C;  5C44 H;  3GTJ B;  4BY1 B;  1B9M A;  4OL7 A;  2FMM A;  2UUB Q;  3HOY G;  1RKN A;  3T53 B;  1SYF A;  1PFM A;  3K80 C;  3MZ5 A;  4U68 A;  1HZ9 A;  4X3K A;  5M3F G;  3S15 B;  5K36 G;  3QG1 A;  1TWC H;  2NVX B;  4KHV A;  4DAY B;  1GO3 E;  4OWX B;  1H9S B;  1I6V C;  4JW0 A;  3K6O A;  4JI4 Q;  2R92 G;  2DY8 A;  3OIQ A;  2V4D A;  3KOJ A;  4NXM L;  3BVM A;  2E8G A;  4DV6 L;  1WYD A;  5GAH C;  4OO1 H;  2Q2I A;  4OO1 I;  1EY8 A;  1KL9 A;  1GHK A;  2K7V A;  3OPO A;  4QMG A;  4KTA A;  4A3M G;  2R7Z B;  3T1Y L;  2JJQ A;  4JI2 Q;  2LS0 1;  4IUQ A;  1H9K A;  2B2Y A;  2PW5 A;  3E6Z X;  3STB C;  4A3D B;  4X65 Q;  1C9O A;  2F0K A;  1UAP A;  1NJI C;  1SNO A;  3O13 A;  1TWF B;  3ZYY X;  3JAM L;  1SBB B;  4DR3 Q;  1E7Z A;  3WOE A;  3GTK B;  1C8C A;  4B3T L;  3S1M H;  3S1Q B;  4LUZ A;  1MI2 A;  4B3M L;  3L9A X;  4U67 3;  5JPM C;  1WTV A;  3I4M G;  5JJZ A;  5IOD A;  1S4Z A;  1CTM A;  1VQF A;  3GTM B;  3BYT B;  1VQC A;  1D5Z C;  4DR4 L;  1MSG A;  3HOU G;  1PFN A;  1HNZ Q;  1M90 C;  1SNM A;  4DR2 L;  1MD2 D;  1IW7 C;  2G9H D;  1BKB A;  2JA8 B;  4G4K A;  5FJ8 H;  5NUC A;  3TZD A;  2D2C C;  3CCQ A;  3RLN A;  1HZB A;  3CF5 A;  4A93 B;  5J22 A;  1A2U A;  1Y8O B;  4GOP A;  4A3E B;  2O5I C;  1SE4 A;  1N33 Q;  2PQE A;  2L0C A;  2PO4 A;  1YNX A;  3AYH B;  1QIL A;  1B3A A;  1B70 B;  1IBK Q;  1JWU D;  2B2V C;  3KYH C;  2DN8 A;  1PH1 A;  3PV0 A;  4JI3 L;  1GD7 A;  4KHP Q;  1EWH A;  5M3M H;  2QDL A;  1VQP A;  4LFA Q;  1NY4 A;  2YU9 B;  5IP9 G;  3EVQ A;  4KY5 A;  3A5U A;  2LY7 A;  3K57 A;  1EY0 A;  1VF5 C;  1YHA A;  4DKA C;  4QUF A;  1Y1V B;  2L5T A;  2JA7 H;  1F9R A;  2Z6B A;  2F0S A;  2NYZ D;  5G3L D;  1KAW A;  1BBU A;  2R7D A;  2ZXP A;  5T1G A;  3SK8 A;  2ZM6 Q;  3M4P A;  1EYG A;  2HHH L;  2A68 C;  2B39 A;  5C4J H;  2O4X A;  2OTJ A;  1X3E A;  3OWE B;  2NZ1 D;  1I6H B;  1XMQ L;  3CQZ B;  3L3O C;  1BCP F;  4AIM A;  2XIW A;  4KN7 C;  5BN5 A;  1BXT A;  3EJI A;  2A6E C;  1QVG A;  2F0F A;  3H0G G;  3PO3 B;  4K6L A;  2UUC L;  3GTG B;  1PRT F;  2JE6 I;  1B2T A;  2AMC B;  3CRK C;  3MAQ A;  1PV4 A;  3FKI B;  4DK1 A;  4A3L G;  1P8L A;  1HXY D;  1NR2 A;  3MTS A;  5C3E H;  5C44 B;  2IX3 A;  3M4Q A;  2WAQ G;  1VQ8 A;  3I72 A;  1JOK A;  4TQU S;  2GVB A;  4R8N A;  1JE4 A;  1HH2 P;  1KTK A;  2WAC A;  1E2W A;  2VQE Q;  4BS9 A;  1HFG A;  5EKL A;  5LMN Q;  4NMZ A;  5FLM H;  1XMO Q;  1PH9 A;  1S72 A;  2ZTE A;  1CQF A;  1PTO C;  4JI7 Q;  5CV8 A;  1IBL L;  2X69 A;  1JB7 A;  3I91 A;  1E1T A;  3A55 A;  1FYC A;  3EFX D;  1O7Y A;  4RCN A;  1BVS A;  4OIJ A;  2E2H H;  2EPB A;  3MFY A;  2RCF A;  1SN8 A;  5ELN A;  4O1N A;  1HR0 L;  2DNC A;  5IGD A;  2EY6 A;  4DR1 L;  1A62 A;  2M2L A;  4UY8 C;  2ATW A;  2EDG A;  2K04 A;  3MXP A;  3LWU A;  1VMP A;  4FVM A;  3A8I E;  2QA4 A;  2R6G A;  1XNQ Q;  1EIH A;  2O2L D;  1JJG A;  3PSI A;  5C4X G;  3L7Z C;  1Q82 C;  4C3I H;  4C3J G;  3FEW X;  3TZU A;  1QVC A;  2E5L Q;  2EYF A;  1IXR A;  3U50 C;  4X62 Q;  1SRO A;  1IBM L;  2JA5 G;  1D1K A;  3K0X A;  2R93 B;  4OXP A;  4HMJ A;  4ZAI A;  4A3F B;  1D6E C;  1MGS A;  3FHW A;  2LSS A;  4DNT B;  1XXG A;  1KHI A;  4GN4 B;  3A5Z B;  4HIK A;  2AWO A;  3F2U A;  2RSO A;  1KD1 C;  4QL5 A;  3I4L A;  1AEX A;  2B8F A;  4PZ6 A;  2PNR C;  1CKM A;  4LW1 A;  2JSO A;  2CH4 A;  3OSO A;  2Z8L A;  3DMU A;  2N78 A;  4K0K Q;  3TEH B;  3KLS X;  2G5D A;  1EQV A;  5DM7 3;  1SYB A;  2WB1 E;  3BZC A;  2RSN A;  2WII B;  2EYL A;  3PQI A;  1B8A A;  3U4Z A;  5M3M B;  3VYR A;  4HSV A;  1DON A;  3PF5 A;  3C46 A;  4LF5 Q;  1Q12 A;  2UUB L;  4JI6 Q;  3HOW G;  2E2J B;  2F0T A;  1EY6 A;  1V8Q A;  2BA1 A;  4FF2 A;  2D0P A;  2VY3 A;  1SDF A;  2L15 A;  1PH8 A;  3RUZ A;  4JI4 L;  4ME3 A;  4A3C G;  1BNZ A;  1H9S A;  4FP5 D;  1VMC A;  1FGU A;  3CME A;  1N32 Q;  2YV5 A;  2UU9 L;  1CM9 A;  2F3V A;  2Z1C A;  4PMB A;  1HR0 W;  1A63 A;  3HOV G;  4KKT A;  4O0A A;  1NBW A;  1QCB D;  2VUM G;  5ELD A;  3RN5 A;  1SFO B;  5IE8 A;  4JI2 L;  1JB3 A;  2IL8 A;  1R9T B;  2H4O A;  1AH9 A;  3GTL B;  4MNO A;  4X65 L;  3QR8 A;  5FOB B;  1JC7 A;  5FLX E;  1HA6 A;  5J39 A;  1S5F D;  2XVS A;  5IGF A;  1YNJ D;  1WTR A;  1TWG H;  5IYC H;  1PTO B;  1M4V A;  2SOB A;  4FXK C;  1RJT A;  4HJA A;  1F9Q A;  4BBR G;  2BDO A;  2UUA L;  1SYC A;  3PO2 H;  1B53 A;  1XNR Q;  2LMC B;  3HKZ E;  3BDL A;  3I4N H;  4EQP A;  3H3V H;  4CDE C;  5M5X H;  1HNZ L;  4NXM Q;  4DV6 Q;  3TRE A;  1GM5 A;  3A8K E;  1JR0 D;  4OON A;  4IPD A;  4KMU C;  1DOM A;  3IFT A;  3MFG A;  4C1N I;  1EQQ A;  5IIF A;  2IX1 A;  4XQN A;  3FDT A;  4V0B A;  1F2L A;  4Z9C B;  3KF8 B;  4YWK A;  3RNU A;  1N33 L;  1LV9 A;  2KOL A;  2PQA A;  1QG7 A;  3GV3 A;  1II3 A;  5KYI A;  3K81 C;  1Y1W H;  3GQB A;  4C3I B;  3SHL A;  1F9S A;  4YWM A;  2AWN A;  4N9P A;  1PFB A;  4EX5 A;  3PCO B;  3H91 A;  4CJ1 B;  2PCF B;  1PA6 A;  1IBK L;  1JIC A;  3K5M A;  4IUP A;  3OTO Q;  4B3T Q;  4JI5 L;  3RZO B;  1FGB D;  2B2T C;  4KLK A;  1Q3L A;  4B3M Q;  3N6R A;  3NWS A;  3BU2 A;  1VQ4 A;  4K8I A;  4LFA L;  1ET9 A;  1MJC A;  4LMQ D;  2NN6 H;  3CU7 A;  2NN6 I;  5GAD C;  3HOZ G;  4RWS C;  1I4H A;  3S1N B;  3OYY A;  1EEF D;  3OOC A;  5AJ3 Q;  3F8T A;  1CUK A;  3KF6 B;  3R93 A;  3BG3 A;  4NP5 A;  2SEB D;  1PMR A;  1H95 A;  3G6J B;  4RGM A;  1AZQ A;  1EIY B;  2ZM6 L;  3IL8 A;  5EJW A;  1LYL A;  3A7A B;  4N9T A;  3MXN A;  3VYT A;  2CWA A;  3RLO A;  5K5P A;  2BE5 D;  3SEB A;  5ELE A;  1MHW C;  3D8G A;  3I73 A;  4JI0 L;  5DNF A;  4F88 A;  3K5L A;  1A3V A;  3URY A;  3OMG A;  3R3O A;  2VNU D;  2CVR A;  1X6O A;  5IYD G;  5ELF A;  2FMC A;  1K9M C;  2M9V A;  3NTI A;  1VQH A;  2UXB L;  1UEA B;  2EE1 A;  4IJL A;  5IYB H;  4WJ4 A;  1ENC A;  1YEZ A;  5T1I A;  3L2P A;  1I50 B;  1FNU A;  1KDB A;  4JI8 L;  1SMX A;  1YIJ A;  4JBK A;  3HKZ B;  5EKI A;  4DV3 L;  4PG3 A;  3CCS A;  1XYI A;  1O7L A;  2KHJ A;  5CV4 A;  1NMF A;  2IX0 A;  2KCN A;  3ONA B;  4OEL B;  2VQE L;  1QVF A;  4DK0 A;  5LMN L;  1X9N A;  3HOY H;  2QCP X;  2ASB A;  1EIF A;  5M3F H;  3TBI B;  4J1M A;  1SYG A;  1HZC A;  3R2T A;  5CBA E;  4JI7 L;  2NTT A;  1LLR D;  4HIO A;  2CW0 D;  3HG9 A;  3E3X A;  1UE6 A;  2ALY B;  1S5C D;  3ITP A;  5CR3 A;  2R92 H;  1SE2 A;  3NXW A;  1ZXT A;  5JJI A;  2O5J C;  3DHQ A;  4PV1 C;  1EWC A;  3G48 A;  1NE3 A;  1WCM B;  3T16 A;  1Y14 B;  3KDF B;  2DGY A;  2A19 A;  4TVA B;  4A3M H;  2NVQ H;  5ELO A;  2K4K A;  1L0W A;  2XTI A;  5M5W B;  1RTN A;  4WJ3 M;  1XNQ L;  3UE1 A;  3S1R H;  2FFK B;  4OX9 Q;  1BF4 A;  2D5D A;  5L37 A;  1CI3 M;  1SNQ A;  3DWA A;  4YIJ A;  3LX0 A;  2E5L L;  1A0I A;  5E4X A;  4X62 L;  1K73 C;  1GUN A;  5JJK A;  4JOI C;  2MO0 A;  4NXN Q;  2EJG C;  1XJV A;  1I4X A;  4CJ2 C;  1VS0 A;  2I07 B;  2OQK A;  2WKD A;  3I4O A;  3RR5 A;  4UP9 A;  3TP5 A;  3GP7 A;  4R4I A;  4Q5V A;  2K01 A;  1IBL Q;  3I4M H;  2EYP A;  4AYB G;  5KYL A;  3TP6 A;  2KBN A;  3PIP 3;  1T5X D;  4AH6 A;  3D31 A;  5IGE A;  3HOU H;  5EBC A;  2L55 A;  2XWB B;  3S17 B;  2Y0S B;  2WIN B;  4HCE A;  1HR0 Q;  2C5C A;  2F0G A;  5FLX c;  2BH2 A;  1HZA A;  2PYK A;  1YNJ C;  4AQY Q;  1PZK D;  3T1H Q;  1JJ2 A;  2F0I A;  2IW3 A;  3P75 A;  1PH5 A;  1EFW A;  3SK5 A;  4YWL A;  2G9D A;  3KBX A;  4H44 C;  1Y1W B;  1LTI D;  2EYM A;  3OWF A;  2DY7 A;  2B2V A;  4K6D A;  4UP8 A;  4GNX C;  3HFZ B;  1MKH A;  5J3B A;  4IO9 A;  2AUJ D;  2KCC A;  5J1Z A;  4P74 A;  2NVT B;  1WOC A;  3M3Y H;  2JA6 G;  4KI0 A;  2AQ3 B;  3D6W A;  3ULJ A;  1NAP A;  1TWH H;  3Q8D A;  2AKW B;  2N8N A;  1QB5 D;  4LF5 L;  1A6X A;  1IYV A;  4MTN A;  4BY7 G;  1QNU A;  1PH4 A;  5I9P A;  5JVH 3;  1WI5 A;  2Q8R E;  5IGC A;  2YTV A;  5IP9 H;  4IUN A;  1G6Z A;  3S2H H;  1J9O A;  4L5R C;  1SJE D;  3JAM E;  1GVP A;  4Y7N H;  4WJW A;  2EQS A;  4RA8 A;  1EZ6 A;  1RHP A;  2D0O A;  2EY2 A;  4RFB A;  4G7O C;  5JAV A;  1N36 Q;  4ZQ3 A;  1EOT A;  2F0U A;  5KGU A;  5E1F A;  3VYU A;  1PTO D;  3QB3 A;  1N32 L;  1Q81 C;  5GRO A;  4A3K G;  3FP9 A;  3NTK A;  2JQO A;  4HIM A;  4O42 A;  2IWH A;  4K5X A;  1O78 A;  1MBY A;  3NEL A;  1DYQ A;  4G57 A;  3H0G H;  3CXC A;  2XRS D;  4ZYS A;  5JEA G;  1EYD A;  2SDF A;  1EUJ A;  1VQ5 A;  2A5H A;  2DJF C;  2EYJ A;  4LF7 Q;  2NB0 A;  3E9I A;  4A3L H;  4LK1 C;  2PMZ E;  5TSS A;  4ULL A;  4DV0 Q;  3DM3 A;  3HOY B;  1QOH A;  1QWY A;  3FPP A;  1Z6H A;  2ZXO A;  2KVM A;  2XGT A;  2BE5 C;  1A3U A;  2A1A A;  4C3H G;  1XNR L;  3F2B A;  3S24 A;  4LF8 Q;  1BOS A;  1LT3 D;  2E74 C;  2I5H A;  3AFP A;  3ND8 A;  4BY1 G;  5KEE A;  1PH2 A;  3K7A B;  4HN7 A;  2BCO A;  4ILW A;  2K52 A;  1CA5 A;  1FJG Q;  1BBX C;  4MN3 A;  2UU9 Q;  3CPW A;  1HNX Q;  1CSQ A;  4A3G B;  1KDC A;  3W3A A;  2R7F A;  3GTO B;  1L1O B;  2WFW A;  4S3S A;  3J81 E;  2RHS B;  2RF4 A;  2XSC A;  3NBH B;  1Q90 A;  3VA7 A;  4P75 A;  3C2P A;  4DUY Q;  3HOX B;  4DK6 C;  3CCJ A;  2ID0 A;  5I6W A;  4K5V A;  1X54 A;  3IRB A;  4N8X 1;  1PXU A;  4MTK A;  2VZA A;  4KD3 A;  3SXH A;  1V1Q A;  5C4X H;  2TMP A;  4KKS A;  3OTO L;  4C3J H;  2R7Z G;  2CW0 C;  2UUA Q;  3CC2 A;  1SND A;  3MEF A;  2JA5 H;  3S2D H;  2XRQ D;  1NUC A;  2BH8 A;  1ZEQ X;  2QEJ C;  3I4M B;  4KK7 A;  4GLA C;  4LFC Q;  2D9U A;  4QGU A;  3AEV A;  4XYO A;  5AJ3 L;  3LNN A;  1OXT A;  1YBY A;  3NUC A;  3LGJ A;  5LHY 1;  2KA7 A;  4DXG A;  4DR6 L;  5EGT A;  4XQQ A;  3KF6 A;  3Q23 A;  2L9H A;  4OEM B;  3V2T A;  1OXV A;  4F8M A;  1SAP A;  1XTC D;  4GNX B;  1WTX A;  4C56 C;  2CH4 W;  1LT5 D;  3BS1 A;  4WRD A;  1UNS A;  4KD4 A;  4UDU C;  3CRL C;  2UXC Q;  5FO7 B;  4IUR A;  1YJN A;  3D4D A;  3PUZ A;  1YJW A;  1KIX A;  4I65 A;  2PMZ B;  3BDO A;  4QJF A;  3K5O A;  1EEI D;  2RDH A;  3WOF A;  2NVY B;  1CKN B;  1EY7 A;  2K32 A;  2OWO A;  4JI5 Q;  1Y69 U;  3VR5 A;  1HTP A;  3TP8 A;  2L12 A;  1PZI D;  3ERO A;  3MXG A;  1K8G A;  1K83 H;  1K3B C;  1J5E L;  2F0H A;  4DNI A;  5IGB A;  3J7Z C;  1TR5 A;  3DXJ C;  1ENF A;  2CHB D;  2BOS A;  3F2C A;  4EQ5 A;  4LNQ A;  1HQM C;  3U9S A;  3HOW H;  4Y7N B;  5LL6 S;  3J81 L;  1AN8 A;  1B7Y B;  2HDM A;  4JYA L;  1HJP A;  3QOJ A;  2B63 G;  3NPP A;  2B2W C;  2B2U C;  4A3B B;  1K8M A;  4A3C H;  2VQF Q;  1Y1V G;  4JI0 Q;  4N8F A;  1KLG D;  4BA2 I;  4J15 A;  3KBG A;  4BA1 I;  1XTD A;  1SLJ A;  3HOV H;  2RDG A;  4IUT A;  3TQY A;  5IY0 A;  4DR7 Q;  3S16 H;  2RVL A;  4ZUJ A;  2VUM H;  2UXB Q;  4G7H C;  2E2D C;  2KHS A;  1PLF A;  1V1P A;  3G4S A;  3KDF A;  1LTA D;  1JQY D;  3AU7 A;  1IKL A;  4OX9 L;  2VS1 A;  1Q1E A;  3N52 A;  4JI8 Q;  3CC7 A;  1I3Q H;  4HR7 B;  3QWN A;  2C9O A;  2CKZ B;  3GO5 A;  4YCV A;  4DV3 Q;  3JAM c;  3PO3 G;  5C3X A;  1S40 A;  1HRJ A;  2E75 C;  1TWC B;  5JEA J;  4NXN L;  3NQT A;  5KIX A;  1FNW A;  2CFM A;  3FKI G;  3B6Y A;  1VQN A;  1P16 A;  2SNM A;  4BBR H;  4K14 A;  1O80 A;  2ZXR A;  1I4P A;  3V96 A;  1D1I A;  4Y52 H;  2C35 B;  4IFD G;  3H94 A;  5IWA Q;  4B9X A;  3ZJY C;  4FYD A;  3UE0 A;  1JOQ A;  5H1S E;  1GXD C;  3K59 A;  4IQZ A;  5E7N A;  2L4N A;  2K03 A;  5D3D A;  3GTP H;  5KNB A;  4CKE A;  4AQY L;  2K05 A;  3T1H L;  1NNX A;  3HRZ C;  2A8V A;  4A3I G;  1BCP B;  2K6A A;  4K5W A;  4R9W A;  4HED A;  4ODG A;  4P2C B;  4L8J A;  4NPS A;  1BDO A;  2QEX A;  2QDB A;  3S1M B;  1QZH A;  2LKV A;  4CDC C;  5BN4 A;  4IAL A;  1PRT B;  1S5B D;  1WTP A;  2PNH A;  2JA5 B;  2LXJ A;  3W1G A;  2IJ0 A;  3PUY A;  4DXF A;  1QUQ A;  1QE6 A;  2B2Y C;  3J80 E;  3HOZ H;  3KK7 A;  2PI2 E;  1B9N A;  1TVX A;  2B3G A;  3NBI A;  3I56 A;  2K1B A;  4X6A H;  1N36 L;  2R93 G;  4RHR A;  3RZD H;  2GA4 B;  1KC8 C;  2ZT9 C;  1BUV T;  1TU2 B;  4A3F G;  2MFI A;  3DEP A;  3SK6 A;  5EQ0 A;  1STN A;  4NDX A;  1IYJ B;  4L5S A;  2ICE C;  2MUY A;  3AB9 A;  4KKU A;  4LJZ C;  1STE A;  2NTS A;  1NSN S;  3HGB A;  2B29 A;  2A74 C;  3FPU B;  4PNY A;  1UEB A;  2LFN A;  3E5S A;  4A75 A;  2Z0S A;  1YI2 A;  2MP1 A;  1Q7Y C;  1ASY A;  4POF A;  4LF7 L;  4QQB X;  5IYD H;  1WVL A;  1I94 Q;  2X6G A;  1CZG A;  3NQI A;  4DV0 L;  1LTS D;  3R8B A;  2EIF A;  2JA7 B;  4DV4 Q;  2Q8T A;  4JVZ A;  3NEN A;  1HUM A;  4HCS A;  1OXX K;  3M4O H;  1GUW A;  4BBS G;  1E0B A;  3I2Z A;  1U4R A;  5C4J B;  4LF8 L;  2GVA A;  1ESF A;  1GUT A;  5D3I B;  4EQN A;  4FF1 A;  4DAY A;  1TWA H;  2AQ1 B;  2ENB A;  1IL8 A;  2OEO A;  3SK4 A;  1JE5 A;  5C5L A;  1FJG L;  1HNX L;  4YHH Q;  1NTG A;  4C1N K;  5BR8 L;  2JYO A;  1LTR D;  2K5W A;  3HEJ A;  4QB4 A;  3W5O A;  4XTC S;  5A2Q E;  3T51 B;  2KQ3 A;  2EYH A;  2MJ8 A;  4DV7 Q;  3T56 B;  5GAE C;  3GV6 A;  3TME A;  5EAY A;  3FRP B;  5BN3 A;  5C3E B;  3J7Y W;  4DUY L;  3J80 L;  2I5L X;  1I3Q B;  3NEM A;  5DM6 3;  1LT4 D;  2RBM A;  3PMF A;  1TT2 A;  2JEB I;  4GS3 A;  2F0W A;  1QJO A;  4JOI A;  3J7A F;  4GKK Q;  4DV2 Q;  4CJ0 B;  4APV A;  1OXU A;  2F0P A;  3A56 A;  4DAP A;  3LWE A;  4PZ8 A;  4BBR B;  4KV6 A;  4LFC L;  1SNC A;  4R8I A;  1VQL A;  3CW2 C;  4CGY B;  3DM1 A;  4XT1 B;  2MNA A;  2E2H B;  2RA4 A;  4LF6 Q;  1EQT A;  4A4I A;  3H3V C;  1XPR A;  3J7A V;  2WB1 B;  3CCM A;  1EY9 A;  1FVI A;  2ZJP A;  4IFD J;  4LUV A;  2F1M A;  3I3C A;  1F2M A;  1RL2 A;  4H02 A;  2UXC L;  1LAB A;  2CCZ A;  1Q46 A;  4PMW A;  1MSH A;  2J0T D;  2K14 A;  1XWE A;  4L5T A;  4DV1 L;  3PIP A;  1JOO A;  1PZJ D;  3D6C A;  1I5F A;  1E22 A;  3MHB A;  3GTQ H;  1B3Q A;  4RHS A;  1LTG D;  4YCU A;  2Z9H A;  1M8A A;  3J81 j;  2JA6 H;  1DD2 A;  1LT6 D;  2VB3 X;  3Q22 A;  2E2I H;  5HY6 A;  1JWM D;  5A2Q L;  4BY7 H;  2R61 A;  3K0Y A;  1HCZ A;  2IHF A;  3CCL A;  4DR6 Q;  3TSS A;  4A3J G;  1C0A A;  3RZD B;  4OGQ C;  1X56 A;  3NE5 B;  1ZYR D;  1V9P A;  2EY1 A;  3PGZ A;  2ES2 A;  3M85 A;  4DPG A;  4AYB E;  1ILP A;  1HNW L;  1X3F A;  2VQF L;  3BVG A;  1SRU A;  3CCU A;  5DEH A;  1WD1 A;  5E3F A;  4CKB A;  1STY A;  1AZP A;  1BR9 A;  2YYZ A;  1A2T A;  1BBW A;  2A6H D;  3TS2 A;  5M5Y H;  1AE3 A;  5JJL A;  4A3K H;  1VQM A;  4DR7 L;  1LTT D;  5I2X A;  4GOP B;  5JPN C;  4KHZ A;  4PQX A;  1Q8I A;  1X65 A;  3CP0 A;  5JEA H;  3J80 c;  3FMC A;  1J5E Q;  4IPG A;  1B1Z A;  2A73 B;  4UPA A;  1TY0 A;  4B3R L;  4JI1 Q;  1L0Y B;  2Z4I A;  2MO1 A;  1Y8P B;  2CQA A;  2L11 A;  4JYA Q;  2EY5 A;  1RD9 D;  4C3H H;  1BCP D;  4E6I A;  3HKZ G;  4F87 A;  1H9R A;  4HSP A;  1O7I A;  3ERS X;  4L5Q A;  3C1F A;  3W1B A;  5IWA L;  4CHT B;  4BY1 H;  4L6T B;  1CZW A;  5A35 A;  1PRT D;  1GJX A;  5EPL A;  3MA2 B;  4UP7 A;  1SYD A;  1SMY D;  3S15 H;  1EYA A;  1HHV A;  2NVX H;  5C6A A;  3D0F A;  4B08 A;  2WKC A;  2ZTD A;  4FF3 A;  4IJH A;  4KY6 A;  4DV5 Q;  1L1O C;  3CMA A;  1VQJ A;  1TWG B;  3WWV A;  1K8O A;  3MVV A;  3NP8 A;  1Z47 A;  2HDL A;  3SR1 A;  1VDZ A;  5CV9 A;  1WCM G;  2BDN A;  1FR3 A;  2ZTC A;  2DUD A;  3PO2 B;  4IUU A;  4O2D A;  1N8R C;  2R7Z H;  4ME5 A;  4V19 0;  1L0X B;  1VQD A;  3I4N B;  3DEO A;  4QIW E;  3KJP A;  4JBW A;  2Z4H A;  2HQE A;  5M5X B;  2TSS A;  1JWS D;  4J8Q A;  1T9H A;  2RHQ B;  1TWF H;  1NCV A;  4DA2 A;  3GTK H;  2NZO A;  3IKJ A;  4JPB W;  4R4O A;  2H5X A;  3S1Q H;  5FO9 B;  1JCK B;  1U5K A;  2AQ2 B;  3A74 A;  1EFI D;  2HIX A;  3X3M A;  3GTM H;  3NWT A;  2F0V A;  1CKO A;  1W3S A;  2FXQ A;  3MWY W;  3CCV A;  2HQL A;  3PIO 3;  1EQR A;  2JA8 H;  2Y0S G;  1KAB A;  1VQ7 A;  1AFP A;  2EVB A;  5LMU Q;  1HQR D;  5KRU A;  1I94 L;  1ICF B;  4A76 A;  4B3S Q;  5IP7 G;  2JA6 B;  1YIT A;  2HIV A;  1K0R A;  1N34 Q;  5I2Y A;  4DV4 L;  4K2K A;  1G2T A;  1NMG A;  1K8A C;  5GAG C;  1U0L A;  3KLS A;  3MEH A;  1V1O A;  2B2W A;  2B2U A;  2K5D A;  3KLR A;  3K5N A;  2F4V Q;  3DWP A;  1N9W A;  3I7F A;  4ZLT F;  1AE2 A;  3P20 A;  2B63 H;  1JJC B;  1SE3 A;  2ZJQ A;  2YTY A;  4C2M H;  4YHH L;  4H7B A;  1Y1V H;  3NK9 A;  5M5Y B;  4A3K B;  1G6P A;  1MIU A;  4IN3 A;  3WDN A;  4DAM A;  4DV7 L;  1WD0 A;  2ZJR A;  5ELB A;  1X3Q A;  3IAY A;  4XXE A;  4JBJ A;  4L63 B;  1JT8 A;  1S5D D;  3CQZ H;  4OHJ A;  5C5M A;  1RF2 D;  4QIW B;  1JOR A;  2KUM A;  4GKK L;  4DV2 L;  5IGG A;  3AQQ A;  4RH6 A;  4ABN A;  1KLU D;  3ULL A;  5M3F B;  1ZYR C;  3PO3 H;  2NBF A;  1HUN A;  4X64 Q;  1LTL A;  4XYQ A;  1F77 A;  4I7Z C;  3FKI H;  1G8Z D;  2I5M X;  4BXX G;  3I90 A;  2A6H C;  2R92 B;  1HA5 A;  2K5N A;  3PF4 A;  5ELC A;  4IFD H;  2MGS A;  1U4M A;  4IFD I;  4LF6 L;  5BR8 Q;  2F0Q A;  1W6J A;  4XDX A;  5EPJ A;  1ML0 D;  2EYO A;  1HTL D;  1B44 D;  1EY4 A;  4A3M B;  2NVQ B;  4LAA A;  2K33 A;  3D3R A;  3S1R B;  1I4R A;  3KFU A;  5AFW A;  1KQS A;  4ZKC B;  3L0O A;  2LXK A;  1VQB A;  2EJM A;  3M4Y A;  5HGQ A;  3KF8 A;  4A3G G;  3DLL A;  3I8Z A;  4A3I H;  3BZK A;  3ER0 A;  4MZ9 A;  1CFM A;  2NUC A;  2OF1 A;  1TS3 A;  2KEN A;  1BCP C;  3Q0A A;  3PUV A;  1VQA A;  3P7J A;  2H1E A;  4A3D G;  3HOX G;  1UE5 A;  3UDI A;  1STA A;  3NHH A;  1F2Y A;  3I55 A;  2MPM A;  1PRT C;  4IZ8 A;  2WAQ E;  2F0D A;  5COY A;  4P71 A;  1SMY C;  2VL6 A;  1LTB D;  4RAU C;  3HOU B;  4B9W A;  2EJF C;  3TP7 A;  2K50 A;  5CV6 A;  4K2L A;  1PYB A;  2HUG A;  2Q2H A;  2K5V A;  4TRD A;  1D7Q A;  2N55 A;  1GUG A;  3KLW A;  2FHT A;  1XX8 A;  4KY7 A;  2R93 H;  4HJ7 A;  3CCR A;  4NB3 A;  5LL6 X;  2KCT A;  4MHE A;  3JAM i;  4A3F H;  2EZV A;  4HJ5 A;  3S14 H;  1RIP A;  2FIN B;  2JA8 G;  4JV5 Q;  2OQ0 A;  1IHZ A;  4ZRZ A;  3EA6 A;  1TKW B;  2KJX A;  4A93 G;  4IOC A;  2X6L A;  3RLF A;  4DV1 Q;  1G51 A;  3M3Y B;  2PQA B;  3W2D A;  4A3E G;  2JEA I;  1D5X C;  1TWH B;  5F2D A;  1VF7 A;  3OHX C;  3A54 A;  2R3Z A;  3VR3 A;  4RMF A;  3GD7 A;  4JI1 L;  1HFN A;  3S2H B;  1PH7 A;  1TS5 A;  1KNE A;  1PH3 A;  1I4Q A;  4DNR B;  2JXM B;  2IY5 B;  5E4W C;  5I9O A;  4MIU A;  1C7Y A;  4BBS H;  4OWT B;  2B63 B;  1HNW Q;  1FNV A;  3CHB D;  2HT1 A;  2Z6K C;  4C2M B;  1EWI A;  5EKK A;  1K0S A;  2E2J H;  1WJJ A;  2F3W A;  1SXT A;  3MXN B;  3BYY B;  1R4P B;  4NW2 A;  2HCC A;  3TN2 A;  3KJO A;  3H0G B;  3MC0 B;  2I46 A;  2RDF A;  3NTH A;  5DAU A; 
#chains in the Genus database with same CATH homology
 1OXS C;  1Z7T A;  3X3N A;  1EU4 A;  1ONL A;  4H13 C;  4RGN A;  1BQQ T;  2WAQ B;  2A69 D;  2PZW A;  4FNF A;  2VXW A;  3ND9 A;  3HZX A;  3QJY A;  3VR2 A;  4F7X A;  2WP8 J;  1WTW A;  4HMI A;  3VYS A;  4DF7 A;  3SE0 A;  1PTO H;  1DXM A;  3PUX A;  1WTQ A;  2ICI A;  5CC4 A;  4JK1 C;  5D65 A;  3A8J E;  5IOC A;  5CYU A;  1FD7 D;  1V43 A;  5KND A;  2EXZ A;  3KUP A;  4RGO S;  1DOK A;  3BVZ A;  3RMH A;  4OO1 G;  3SDZ A;  5HGT A;  1C4Q A;  1G29 1;  4A3I B;  4M1U B;  1SYE A;  2B2T A;  5C4X B;  3VA5 A;  4C3J B;  1RCV D;  1KNA A;  4M8A A;  3S2D B;  4DU9 A;  1CHP D;  3P1H A;  2BA0 A;  2F0M A;  2K28 A;  1GOZ A;  2K5Q A;  5CGK A;  2HCI A;  4FO2 A;  1G91 A;  1TS4 A;  3EQL C;  1O7Z A;  2QIL A;  3G7L A;  4KJN A;  3S14 B;  4QUC A;  3H09 A;  2B8G A;  3TDQ A;  3BDC A;  3D4R A;  3PUW A;  3S9W A;  2SNS A;  2VB2 X;  5EPK A;  1CA6 A;  1ROD A;  1K83 B;  5CV7 A;  3HP3 A;  1YNN D;  1PDQ A;  1PTO F;  3HOW B;  4EQO A;  2F0N A;  1U9R A;  1D2B A;  1STG A;  1SSO A;  4XT3 B;  1IYU A;  3CKI B;  1OO9 B;  2XN9 C;  5CV5 A;  4BBS B;  1CHQ D;  4OIK A;  4ID6 A;  4X3U A;  1KDA A;  1PYW D;  4ZUI A;  2AUK A;  3HOV B;  1TQO A;  4TSS A;  3S16 B;  2VUM B;  5D14 A;  3QO2 A;  3OMC A;  2J4X A;  3NBH A;  1ILQ A;  1EL0 A;  3OW7 A;  4WOR A;  4GZY C;  4Q0F A;  1Q1B A;  5I4D A;  1J8I A;  1U4L A;  5C0X J;  3QOL A;  1D5M C;  3C3L A;  2OT2 A;  4K8J A;  3RD4 A;  1SEB D;  4PMC A;  3E0J A;  5C3W A;  4X3T A;  1EY5 A;  4RGT A;  5JOB A;  1Y8N B;  5C4H A;  2QKI C;  1ESR A;  3GTP B;  4NKL A;  4DAV A;  4EVO A;  5HUR A;  1F9P A;  2F4I A;  4TKO B;  1DM0 B;  4H0L C;  2A69 C;  1X32 A;  1HPC A;  5FK9 C;  5CBE E;  1ICW A;  1SNP A;  1UUP A;  5I6Y A;  3UI2 A;  3ERQ A;  4C3I G;  3HOZ B;  4UAI A;  2PZU A;  2PPB C;  3H6M A;  5KNC A;  3VR6 A;  1STH A;  1VCI A;  2J7Z A;  1LO5 D;  5ISR A;  4XQJ A;  1R4Q B;  3V05 A;  4A3J B;  1SJH D;  3VR4 A;  2EOT A;  1CK1 A;  3QIA A;  5IT9 E;  1ZKO A;  3AMU A;  1QNK A;  4FXG C;  2F0L A;  5FO8 B;  2QF7 A;  1DJR D;  1S5E D;  5FLX L;  4G7Z C;  5G3L F;  2PW7 A;  2D62 A;  1CT1 D;  3SVM A;  2MHV A;  3Q24 A;  3M4O B;  1I4G A;  3OIP A;  2NWG A;  1GUS A;  1TWA B;  1F2Z A;  1DCZ A;  2PZT A;  4KN4 C;  1DZ1 A;  3A7L A;  1TY2 A;  4DFA A;  1W6K A;  2F03 A;  5K36 H;  3MXU A;  3R2I A;  3K58 A;  3NSW A;  2JP1 A;  1C48 A;  1YNN C;  2F0J A;  1B4O A;  2E76 C;  5FKA C;  1AP0 A;  5C0X G;  2OXP A;  1IW7 D;  5JVG 3;  1EU3 A;  1V1P B;  5CMD A;  4QCL A;  4ZK9 B;  5C4Z A;  4DN4 M;  4DGZ A;  1G2S A;  1RTO A;  5IT9 L;  1GUO A;  4HTH A;  3IFD A;  4FXD A;  2KEC A;  4AYB B;  1DOL A;  4CBV A;  1X3P A;  2XNA C;  1H9J A;  1BO0 A;  2DNE A;  3FVQ A;  2L1B A;  2XWJ B;  4KJO A;  1H9M A;  4HAE A;  2FJ2 A;  4XIG S;  4QF4 A;  1A15 A;  2KEE A;  4J6H A;  2IPK D;  2IT1 A;  3M7G A;  2F0E A;  1E2Z A;  1E2V A;  1B50 A;  4CKC A;  4RKB A;  3Q6S A;  3GTQ B;  1A3T A;  1AW7 A;  2KED A;  2A68 D;  1ENA A;  4ZKB B;  3C1E A;  2E2I B;  1IKM A;  1U4P A;  1WTO A;  1STB A;  4BY7 B;  4WFN 3;  1ET6 A;  1T5E A;  1RDP D;  3HS0 C;  2NN6 G;  2A6E D;  3M7N A;  2N88 A;  1LAC A;  5EBD A;  5M9O A;  3DUZ A;  1KAA A;  1TII D;  3BZD B;  4X3S A;  1GHJ A;  2RKS A;  1TS2 A;  5C0X H;  3T4A C;  1EIG A;  5C0X I;  1NR4 A;  2M00 A;  4EGV A;  2RQX A;  3D4W A;  3DWQ A;  4RKL A;  2Q8I B;  5COR A;  3T13 A;  1EYC A;  3U9O A;  4FF4 A;  4RCO A;  4C3H B;  4IUV A;  3I70 A;  2F0O A;  4BWG B;  1CQV A;  1EZ8 A;  2WV6 D;  3GTJ B;  4BY1 B;  1B9M A;  4OL7 A;  2FMM A;  1RKN A;  3T53 B;  1SYF A;  1PFM A;  3MZ5 A;  4U68 A;  4X3K A;  3S15 B;  5K36 G;  3QG1 A;  2NVX B;  4KHV A;  1H9S B;  1I6V C;  3K6O A;  2DY8 A;  3OIQ A;  2V4D A;  3BVM A;  4OO1 H;  4OO1 I;  1EY8 A;  1GHK A;  2K7V A;  3OPO A;  4QMG A;  4KTA A;  2R7Z B;  2LS0 1;  4IUQ A;  1H9K A;  2B2Y A;  2PW5 A;  3E6Z X;  4A3D B;  2F0K A;  1UAP A;  1SNO A;  3O13 A;  1TWF B;  3ZYY X;  3JAM L;  1SBB B;  3GTK B;  3WOE A;  1C8C A;  3S1Q B;  1MI2 A;  3L9A X;  4U67 3;  5JPM C;  1WTV A;  5JJZ A;  5IOD A;  1S4Z A;  1CTM A;  3GTM B;  3BYT B;  1D5Z C;  1MSG A;  1PFN A;  1SNM A;  1MD2 D;  1IW7 C;  2G9H D;  2JA8 B;  4G4K A;  5NUC A;  3TZD A;  2D2C C;  4A93 B;  5J22 A;  1A2U A;  1Y8O B;  4A3E B;  2O5I C;  1SE4 A;  2PQE A;  2L0C A;  2PO4 A;  1QIL A;  1B3A A;  1JWU D;  2B2V C;  2DN8 A;  3PV0 A;  1EWH A;  2YU9 B;  3EVQ A;  4KY5 A;  2LY7 A;  3K57 A;  1EY0 A;  1VF5 C;  4QUF A;  1Y1V B;  2L5T A;  1F9R A;  2F0S A;  2NYZ D;  5G3L D;  5T1G A;  2ZXP A;  3SK8 A;  2A68 C;  2B39 A;  2O4X A;  3OWE B;  2NZ1 D;  1I6H B;  3CQZ B;  3L3O C;  1BCP F;  2XIW A;  4KN7 C;  5BN5 A;  1BXT A;  3EJI A;  2A6E C;  2F0F A;  3PO3 B;  4K6L A;  3GTG B;  1PRT F;  2JE6 I;  1B2T A;  3CRK C;  3MAQ A;  3FKI B;  4DK1 A;  1HXY D;  1NR2 A;  3MTS A;  5C44 B;  2IX3 A;  3I72 A;  1JOK A;  4TQU S;  4R8N A;  1JE4 A;  1KTK A;  2WAC A;  1E2W A;  4BS9 A;  1HFG A;  5EKL A;  4NMZ A;  1CQF A;  1PTO C;  5CV8 A;  2X69 A;  3I91 A;  3A55 A;  1FYC A;  3EFX D;  1O7Y A;  4RCN A;  4OIJ A;  2EPB A;  3MFY A;  4O1N A;  2DNC A;  5IGD A;  2EY6 A;  2M2L A;  2EDG A;  2K04 A;  3MXP A;  3LWU A;  1VMP A;  4FVM A;  3A8I E;  2R6G A;  1EIH A;  2O2L D;  3L7Z C;  4C3J G;  3FEW X;  3TZU A;  2EYF A;  1D1K A;  2R93 B;  4HMJ A;  4ZAI A;  4A3F B;  1D6E C;  1MGS A;  4DNT B;  1XXG A;  2AWO A;  3F2U A;  2RSO A;  3I4L A;  1AEX A;  2B8F A;  2PNR C;  2JSO A;  3OSO A;  2Z8L A;  3DMU A;  3KLS X;  1EQV A;  5DM7 3;  1SYB A;  2RSN A;  2WII B;  2EYL A;  5M3M B;  3VYR A;  4HSV A;  1DON A;  3C46 A;  1Q12 A;  2E2J B;  2F0T A;  1EY6 A;  1V8Q A;  2BA1 A;  4FF2 A;  1SDF A;  3RUZ A;  1BNZ A;  1H9S A;  4FP5 D;  1VMC A;  1CM9 A;  2F3V A;  2Z1C A;  4PMB A;  4KKT A;  1QCB D;  5ELD A;  1SFO B;  1JB3 A;  2IL8 A;  1R9T B;  2H4O A;  3GTL B;  5FOB B;  1JC7 A;  5FLX E;  1HA6 A;  5J39 A;  1S5F D;  2XVS A;  5IGF A;  1YNJ D;  1WTR A;  1PTO B;  1M4V A;  2SOB A;  4FXK C;  1RJT A;  1F9Q A;  2BDO A;  1SYC A;  1B53 A;  2LMC B;  3BDL A;  4EQP A;  3A8K E;  1JR0 D;  4KMU C;  1DOM A;  3IFT A;  3MFG A;  4C1N I;  5IIF A;  2IX1 A;  4XQN A;  3FDT A;  4V0B A;  1F2L A;  4Z9C B;  1LV9 A;  2KOL A;  3GV3 A;  1QG7 A;  1II3 A;  5KYI A;  3GQB A;  4C3I B;  3SHL A;  1F9S A;  2AWN A;  4N9P A;  1PFB A;  4CJ1 B;  3H91 A;  2PCF B;  1JIC A;  3K5M A;  4IUP A;  3RZO B;  1FGB D;  2B2T C;  1Q3L A;  3N6R A;  3NWS A;  4K8I A;  1ET9 A;  4LMQ D;  2NN6 H;  3CU7 A;  2NN6 I;  4RWS C;  1I4H A;  3S1N B;  1EEF D;  3OOC A;  3R93 A;  3BG3 A;  4NP5 A;  2SEB D;  1PMR A;  3G6J B;  4RGM A;  1AZQ A;  3IL8 A;  5EJW A;  3A7A B;  4N9T A;  3MXN A;  3VYT A;  5K5P A;  2BE5 D;  3SEB A;  5ELE A;  3D8G A;  3I73 A;  5DNF A;  4F88 A;  3K5L A;  1A3V A;  3URY A;  3OMG A;  3R3O A;  2VNU D;  2CVR A;  5ELF A;  2FMC A;  2M9V A;  3NTI A;  1UEA B;  2EE1 A;  1ENC A;  5T1I A;  1I50 B;  1FNU A;  1KDB A;  3HKZ B;  5EKI A;  1XYI A;  1O7L A;  5CV4 A;  2IX0 A;  2KCN A;  3ONA B;  4DK0 A;  2QCP X;  3TBI B;  4J1M A;  1SYG A;  3R2T A;  5CBA E;  2NTT A;  1LLR D;  2CW0 D;  3HG9 A;  1S5C D;  3ITP A;  5CR3 A;  1SE2 A;  3NXW A;  1ZXT A;  2O5J C;  3DHQ A;  4PV1 C;  1EWC A;  1WCM B;  3T16 A;  5M5W B;  1RTN A;  2FFK B;  1BF4 A;  2D5D A;  1CI3 M;  1SNQ A;  3DWA A;  4YIJ A;  3LX0 A;  5E4X A;  1GUN A;  2EJG C;  1I4X A;  4CJ2 C;  2I07 B;  2WKD A;  3TP5 A;  3GP7 A;  4Q5V A;  2K01 A;  2EYP A;  5KYL A;  3TP6 A;  3PIP 3;  1T5X D;  3D31 A;  5IGE A;  5EBC A;  2L55 A;  2XWB B;  3S17 B;  2Y0S B;  2WIN B;  4HCE A;  2C5C A;  2F0G A;  2PYK A;  1YNJ C;  1PZK D;  2F0I A;  2IW3 A;  3P75 A;  3SK5 A;  2G9D A;  3KBX A;  4H44 C;  1Y1W B;  1LTI D;  2EYM A;  3OWF A;  2DY7 A;  2B2V A;  4K6D A;  2AUJ D;  2KCC A;  5J1Z A;  2NVT B;  4KI0 A;  2AQ3 B;  3D6W A;  1NAP A;  1QB5 D;  1A6X A;  1IYV A;  1QNU A;  5I9P A;  5JVH 3;  2Q8R E;  5IGC A;  4IUN A;  1G6Z A;  1J9O A;  1SJE D;  3JAM E;  4WJW A;  4RA8 A;  1EZ6 A;  1RHP A;  2EY2 A;  4RFB A;  4G7O C;  5JAV A;  4ZQ3 A;  1EOT A;  2F0U A;  5KGU A;  5E1F A;  3VYU A;  1PTO D;  3QB3 A;  3NTK A;  4O42 A;  2IWH A;  4K5X A;  1O78 A;  1MBY A;  1DYQ A;  4G57 A;  2XRS D;  4ZYS A;  5JEA G;  1EYD A;  2SDF A;  2A5H A;  2EYJ A;  2NB0 A;  4LK1 C;  5TSS A;  4ULL A;  3HOY B;  1QOH A;  1QWY A;  3FPP A;  1Z6H A;  2ZXO A;  2KVM A;  2BE5 C;  1A3U A;  4C3H G;  1BOS A;  1LT3 D;  2E74 C;  3ND8 A;  5KEE A;  3K7A B;  4HN7 A;  2BCO A;  4ILW A;  1CA5 A;  1BBX C;  4MN3 A;  4A3G B;  1KDC A;  3W3A A;  3GTO B;  4S3S A;  3J81 E;  2XSC A;  1Q90 A;  3VA7 A;  3C2P A;  3HOX B;  2ID0 A;  5I6W A;  4K5V A;  1PXU A;  3SXH A;  4KD3 A;  2TMP A;  4KKS A;  2CW0 C;  1SND A;  2XRQ D;  1NUC A;  1ZEQ X;  2QEJ C;  3I4M B;  4KK7 A;  2D9U A;  4XYO A;  3LNN A;  1OXT A;  3NUC A;  5LHY 1;  2KA7 A;  4DXG A;  5EGT A;  4XQQ A;  3Q23 A;  2L9H A;  3V2T A;  1OXV A;  4F8M A;  1SAP A;  1XTC D;  1WTX A;  4C56 C;  1LT5 D;  3BS1 A;  4WRD A;  1UNS A;  4KD4 A;  4UDU C;  3CRL C;  5FO7 B;  4IUR A;  3D4D A;  3PUZ A;  4I65 A;  2PMZ B;  3BDO A;  3K5O A;  1EEI D;  2RDH A;  3WOF A;  2NVY B;  1EY7 A;  2K32 A;  1Y69 U;  3VR5 A;  1HTP A;  3TP8 A;  2L12 A;  1PZI D;  3ERO A;  3MXG A;  2F0H A;  5IGB A;  1TR5 A;  3DXJ C;  1ENF A;  2CHB D;  2BOS A;  1HQM C;  3U9S A;  4Y7N B;  5LL6 S;  3J81 L;  1AN8 A;  2HDM A;  3QOJ A;  3NPP A;  2B2W C;  2B2U C;  4A3B B;  1K8M A;  1KLG D;  4BA2 I;  3KBG A;  4BA1 I;  2RDG A;  4IUT A;  2RVL A;  4ZUJ A;  4G7H C;  2E2D C;  2KHS A;  1PLF A;  1V1P A;  1LTA D;  1JQY D;  3AU7 A;  1IKL A;  1Q1E A;  3N52 A;  4HR7 B;  3QWN A;  2C9O A;  3GO5 A;  5C3X A;  1HRJ A;  2E75 C;  1TWC B;  5JEA J;  3NQT A;  5KIX A;  1FNW A;  2SNM A;  4K14 A;  1O80 A;  2ZXR A;  1I4P A;  3V96 A;  1D1I A;  4IFD G;  3H94 A;  4B9X A;  4FYD A;  1JOQ A;  1GXD C;  3K59 A;  4IQZ A;  2L4N A;  2K03 A;  5D3D A;  5KNB A;  4CKE A;  2K05 A;  3HRZ C;  1BCP B;  2K6A A;  4K5W A;  4R9W A;  4HED A;  4ODG A;  4P2C B;  4L8J A;  1BDO A;  2QDB A;  3S1M B;  2LKV A;  5BN4 A;  4IAL A;  1PRT B;  1S5B D;  1WTP A;  2JA5 B;  2IJ0 A;  3PUY A;  4DXF A;  1QE6 A;  2B2Y C;  3J80 E;  3KK7 A;  1B9N A;  1TVX A;  3NBI A;  2K1B A;  4RHR A;  2GA4 B;  2ZT9 C;  1BUV T;  1TU2 B;  3DEP A;  3SK6 A;  5EQ0 A;  1STN A;  4NDX A;  2ICE C;  2MUY A;  3AB9 A;  4KKU A;  4LJZ C;  1STE A;  2NTS A;  1NSN S;  3HGB A;  2A74 C;  3FPU B;  4PNY A;  3E5S A;  2LFN A;  2MP1 A;  1WVL A;  2X6G A;  1CZG A;  3NQI A;  1LTS D;  3R8B A;  2JA7 B;  2Q8T A;  1HUM A;  4HCS A;  1OXX K;  1GUW A;  1E0B A;  1U4R A;  5C4J B;  1ESF A;  1GUT A;  5D3I B;  4EQN A;  4FF1 A;  4DAY A;  2AQ1 B;  2ENB A;  1IL8 A;  2OEO A;  3SK4 A;  5C5L A;  4C1N K;  2JYO A;  1LTR D;  2K5W A;  3HEJ A;  4QB4 A;  4XTC S;  5A2Q E;  3T51 B;  2KQ3 A;  2EYH A;  2MJ8 A;  3T56 B;  3GV6 A;  3TME A;  3FRP B;  5BN3 A;  5C3E B;  3J7Y W;  3J80 L;  1I3Q B;  5DM6 3;  1LT4 D;  2RBM A;  3PMF A;  1TT2 A;  2JEB I;  2F0W A;  1QJO A;  3J7A F;  4CJ0 B;  1OXU A;  2F0P A;  3A56 A;  4DAP A;  3LWE A;  4BBR B;  4KV6 A;  1SNC A;  4R8I A;  4CGY B;  3DM1 A;  4XT1 B;  2E2H B;  2RA4 A;  1EQT A;  3H3V C;  3J7A V;  2WB1 B;  1EY9 A;  4IFD J;  2F1M A;  3I3C A;  1F2M A;  1LAB A;  4PMW A;  1MSH A;  2J0T D;  1XWE A;  1JOO A;  1PZJ D;  3D6C A;  3MHB A;  4RHS A;  1LTG D;  1M8A A;  1DD2 A;  1LT6 D;  2VB3 X;  3Q22 A;  1JWM D;  5A2Q L;  2R61 A;  3K0Y A;  1HCZ A;  3TSS A;  3RZD B;  4OGQ C;  3NE5 B;  1ZYR D;  2EY1 A;  3M85 A;  1ILP A;  3BVG A;  1WD1 A;  5DEH A;  5E3F A;  4CKB A;  1STY A;  1AZP A;  1BR9 A;  2YYZ A;  1A2T A;  2A6H D;  1LTT D;  5I2X A;  5JPN C;  4KHZ A;  4PQX A;  1Q8I A;  5JEA H;  3FMC A;  1B1Z A;  2A73 B;  1TY0 A;  1L0Y B;  2Z4I A;  1Y8P B;  2CQA A;  2L11 A;  2EY5 A;  1RD9 D;  1BCP D;  4E6I A;  4F87 A;  1H9R A;  4HSP A;  3C1F A;  4CHT B;  4L6T B;  1CZW A;  5A35 A;  1PRT D;  1GJX A;  5EPL A;  3MA2 B;  1SYD A;  1SMY D;  1EYA A;  1HHV A;  5C6A A;  4B08 A;  2WKC A;  4FF3 A;  4KY6 A;  1TWG B;  1K8O A;  3MVV A;  3NP8 A;  1Z47 A;  2HDL A;  3SR1 A;  1VDZ A;  5CV9 A;  2BDN A;  1FR3 A;  3PO2 B;  4IUU A;  4ME5 A;  4V19 0;  1L0X B;  3I4N B;  3DEO A;  4JBW A;  2Z4H A;  2HQE A;  5M5X B;  2TSS A;  1JWS D;  4J8Q A;  1NCV A;  4DA2 A;  3IKJ A;  5FO9 B;  1JCK B;  2AQ2 B;  1EFI D;  3X3M A;  3NWT A;  2F0V A;  3MWY W;  3PIO 3;  1KAB A;  1AFP A;  2EVB A;  1HQR D;  5KRU A;  2JA6 B;  5I2Y A;  4K2K A;  1G2T A;  3KLS A;  3MEH A;  1V1O A;  2B2W A;  2B2U A;  2K5D A;  3KLR A;  3K5N A;  3DWP A;  4ZLT F;  3P20 A;  1SE3 A;  4H7B A;  3NK9 A;  5M5Y B;  4A3K B;  3WDN A;  4IN3 A;  1WD0 A;  5ELB A;  1X3Q A;  3IAY A;  4XXE A;  4L63 B;  1S5D D;  4OHJ A;  5C5M A;  1RF2 D;  4QIW B;  1JOR A;  2KUM A;  5IGG A;  4RH6 A;  4ABN A;  1KLU D;  5M3F B;  1ZYR C;  2NBF A;  1HUN A;  4XYQ A;  1F77 A;  4I7Z C;  1G8Z D;  3I90 A;  2A6H C;  2R92 B;  1HA5 A;  5ELC A;  4IFD H;  2MGS A;  1U4M A;  4IFD I;  2F0Q A;  1W6J A;  4XDX A;  5EPJ A;  1ML0 D;  2EYO A;  1HTL D;  1B44 D;  1EY4 A;  4A3M B;  2NVQ B;  4LAA A;  2K33 A;  3D3R A;  3S1R B;  1I4R A;  5AFW A;  4ZKC B;  2EJM A;  3M4Y A;  3KF8 A;  3I8Z A;  1CFM A;  2NUC A;  2OF1 A;  1TS3 A;  1BCP C;  3Q0A A;  3PUV A;  3P7J A;  2H1E A;  1STA A;  3NHH A;  1F2Y A;  2MPM A;  1PRT C;  4IZ8 A;  2F0D A;  5COY A;  1SMY C;  1LTB D;  4RAU C;  3HOU B;  4B9W A;  2EJF C;  3TP7 A;  5CV6 A;  4K2L A;  2HUG A;  4TRD A;  2N55 A;  1GUG A;  2FHT A;  1XX8 A;  4KY7 A;  5LL6 X;  4MHE A;  2EZV A;  2FIN B;  1IHZ A;  4ZRZ A;  3EA6 A;  1TKW B;  2KJX A;  2X6L A;  3RLF A;  3M3Y B;  3W2D A;  2JEA I;  1D5X C;  1TWH B;  5F2D A;  1VF7 A;  3OHX C;  3A54 A;  2R3Z A;  3VR3 A;  1HFN A;  3GD7 A;  3S2H B;  1TS5 A;  1KNE A;  1I4Q A;  4DNR B;  2JXM B;  5E4W C;  5I9O A;  4MIU A;  2B63 B;  1FNV A;  3CHB D;  4C2M B;  5EKK A;  2F3W A;  1SXT A;  3BYY B;  1R4P B;  4NW2 A;  2HCC A;  3TN2 A;  3H0G B;  3MC0 B;  2I46 A;  2RDF A;  3NTH A;  5DAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...