4F7XA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/l25a at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Pressure effects in proteins
rcsb
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f7xA00
5HGTA 5EKKA 3DMUA 1STAA 4KY5A 3RUZA 3SK4A 3QOLA 1II3A 1EY7A 1SYEA 4ZQ3A 5J22A 4J1MA 4EQPA 3QB3A 5I9PA 1JOOA 2OEOA 2F0VA 3C1FA 2EYHA 2F0WA 1STYA 4QMGA 2EYMA 1SNCA 3EROA 1NSNS 3D6CA 5EKLA 3SK6A 2EYPA 4IALA 3V2TA 4ZUIA 1STHA 4KTAA 4NDXA 3LX0A 3TP5A 2F0EA 2PZTA 3SK8A 5C6AA 4PNYA 4K14A 5IGGA 4LAAA 4KY7A 5JOBA 2QDBA 5KRUA 4H7BA 5CV5A 3D8GA 1EYDA 3EVQA 4NMZA 3SR1A 4KJNA 3SHLA 1F2MA 3HEJA 4DFAA 2LKVA 1F2ZA 2OXPA 1TQOA 4J6HA 4HMJA 5KGUA 2F0LA 3MVVA 2KQ3A 2EY2A 3OMCA 3P1HA 1EY8A 2PQEA 1EY9A 3P75A 1EY6A 5I9OA 3OMGA 5CV8A 5IGFA 2M00A 1JOKA 5IGDA 2KHSA 3NP8A 1SNMA 1SYFA 2F0PA 3MXPA 3PMFA 2F0TA 4N9PA 1A3TA 3MEHA 4F7XA 5JAVA 5C5MA 4DU9A 5K5PA 2EYFA 3SXHA 2EXZA 2F0QA 4TRDA 2F0DA 4K5WA 4K5VA 5J39A 3T16A 2F0JA 2HQEA 3ITPA 1EQVA 1NUCA 4I65A 4B9XA 1U9RA 3NUCA 3MHBA 4IZ8A 1A3UA 5CV4A 1A2UA 4QF4A 1EZ8A 3BDLA 5E3FA 1EY5A 1JOQA 3SK5A 4WORA 5CV9A 5IGEA 1STGA 1EYCA 3TP6A 5C4HA 4RKLA 4KY6A 5C4ZA 5IOCA 3D4DA 5IGCA 3OWFA 4YIJA 3EJIA 4S3SA 4EVOA 2F0OA 4E6IA 4OL7A 4K5XA 1JORA 2EYOA 2ENBA 2PW7A 2F0KA 2EY6A 2F0UA 1STNA 3TMEA 1KDAA 1SYBA 5CV7A 4ZUJA 4PMBA 5C3XA 4G57A 4PMCA 2PYKA 2RBMA 3HZXA 3QOJA 4K8IA 5ISRA 5CR3A 5DEHA 2EYLA 1IHZA 1A3VA 3BDCA 4ME5A 2SNMA 2NUCA 3NHHA 2F3VA 1KDBA 1EY4A 1SNOA 2RKSA 4ID6A 5IODA 2F0SA 2F0FA 5M9OA 3OSOA 1A2TA 4QB4A 4K2LA 3C1EA 2PZUA 3VA5A 5I6WA 3MZ5A 1AEXA 2F0GA 4EQOA 1SYCA 5E1FA 5IIFA 5F2DA 1EZ6A 4ODGA 2O4XA 3E5SA 3NXWA 4KD3A 5DAUA 4NKLA 5J1ZA 2PW5A 1ENAA 4K8JA 1SYDA 2EY5A 1SNQA 2F0NA 4IUNA 5KEEA 1STBA 4B9WA 3T13A 1F2YA 3D4WA 5IGBA 5NUCA 4EQNA 4KHVA 2PZWA 3DHQA 1TR5A 4K2KA 1EYAA 2SOBA 3NK9A 2SNSA 5CV6A 3U9OA 4KJOA 5KIXA 3ERQA 5HURA 2F0MA 1EY0A 1ENCA 1TT2A 1RKNA 4HTHA 4K6DA 5CGKA 3H6MA 4DGZA 1KAAA 3TP7A 4N9TA 5KYLA 2F3WA 4HMIA 4NP5A 5C3WA 5CC4A 5KYIA 5C5LA 3NQTA 2F0IA 2OF1A 4DF7A 2EY1A 2F0HA 1SYGA 1KABA 4KD4A 4KV6A 4MIUA 2EYJA 4R8NA 4RKBA 5EGTA 4F8MA 2RDFA 3R3OA 4WRDA 1SNDA 1KDCA 3S9WA 2WACA 1SNPA 5I6YA 3TP8A
chains in the Genus database with same CATH superfamily
4FXDA 1STAA 3QOLA 1II3A 3ZYYX 4Y7NB 1IW7C 4J1MA 1KC8C 1JOOA 1TIID 2CQAA 2NVYH 2F0WA 2NN6G 5IWAQ 3V2TA 1V1QA 3V96A 3U9SA 4HIDA 2DY8A 3HP3A 4JBWA 2B2VC 2C9OA 3OYYA 4LF9Q 3N52A 3J81i 1U5KA 1FD7D 1Z9FA 1VMPA 3HOXB 4GZYC 2K05A 1B3QA 4CGYB 2R93H 5C0XI 2M00A 1LABA 1UAPA 1G291 4KI0A 5FJ8H 5K5PA 2XIWA 1IKLA 3UDGA 4K5VA 2JEAI 5E4XA 4DV7L 5LL6X 2QA4A 4I65A 2E2IH 4XQQA 4RCOA 3A7LA 4JV5Q 4MN3A 5CV9A 5C4HA 5JAVA 1YIJA 3OWEB 3M4PA 1Q8IA 4EX5A 1UEBA 1C8CA 2F0KA 3BZKA 3J7AV 1PZID 2F1MA 5FK9C 2RBMA 4EGVA 1VQKA 3LGJA 4FDBA 1V1PB 2C35B 1HNXQ 4JBJA 2ATWA 4JI2Q 4X65Q 2F0FA 2KVMA 3HKSA 3KF6A 2ICEC 4JI8Q 4POFA 2L0CA 2F0GA 5E1FA 5IP9G 1ZYRC 4DV5Q 1B8AA 2BOSA 5DAUA 2XRQD 2Y0SG 3KBGA 1WYDA 2XRSD 3PIO3 3GTQB 4BBSB 3D4WA 5G3LF 3KOJA 4LF6Q 1X3FA 2UUCL 5BR8Q 1BR9A 1OXSC 5C4JH 1G91A 2CQOA 3A56A 1HXYD 3H3VI 5JJIA 2R6GA 4C56C 5CC4A 2LFNA 5ELNA 3P20A 4MIUA 3OPOA 4HIMA 1D6EC 3QJYA 1IBML 1H95A 3S9WA 4GN4B 4I7AA 4LFAQ 5HGTA 1KLUD 2QW7A 1AE3A 1KIXA 1G2SA 3S16B 1XMOL 3I4OA 1QUQA 1M1KC 2IY5B 2F0EA 1EWHA 3NWTA 3S14H 1G51A 1GKHA 4K14A 2A6HC 3T1YL 4LUZA 4J8QA 4H7BA 1Q12A 1CZWA 2UUBL 5M5YB 1FJGL 2LKVA 5JJKA 3HG9A 1IYJB 4A3GH 2UXCQ 2QEJC 4A3FH 4DV2L 2UXDL 4CKCA 1EY9A 4GOPC 3SEBA 3GV3A 3FKIB 4DK3C 2F0TA 1IBKL 4KK7A 5IP7G 5EQ0A 1AW7A 4PQXA 1E1TA 1CI3M 2AHOB 4DV5L 4B9XA 2AMCB 1D5ZC 4JYAL 4POGA 4OWWB 1B70B 1JJ2A 1QVFA 2O2LD 4JC0A 4CDFC 1HNXL 5HGQA 2IW3A 2AQ3B 3JAMc 4YWLA 4XYOA 5GADC 4A3JB 2V1CC 5CR3A 2JA8G 4PZ6A 1SFOH 2NVTB 5JPMC 1RF2D 2B2WA 3M4YA 2VZAA 4IFDI 2Z4HA 3NHHA 3JAMi 5I2YA 2WKCA 2D0OA 2OWOA 1ONLA 3STBC 4ODGA 2L12A 1KRSA 2I46A 1I50B 5J1ZA 3E3XA 3I8ZA 4LF7L 1NBWA 1LT5D 3CF5A 2UU9L 5BN4A 4DR4L 1JE4A 3DHQA 3KUPA 1D7QA 1YNXA 2XVSA 2XSCA 1HNWQ 3WOEA 1VQAA 1MKHA 1H9SA 1JB3A 2F3WA 1KD1C 2JA7B 1Q46A 1SLJA 4A3BB 2D62A 4R8NA 4GS3A 2WAQE 3W5OA 3J7AF 5FO9B 4C3JB 1QZGA 3HOUG 2JA5H 4YHHL 4IPGA 4EQPA 1M8AA 4ABNA 1O7ZA 2PMZE 4UPAA 3HOUH 4Y7NH 1SNCA 2ZJRA 2N8NA 4X62Q 3J7ZC 3J80L 5C6AA 2Q8TA 3SDZA 2O5JC 1I3QB 4GLVB 1E22A 1ICFB 1CHPD 1F2ZA 1HR0L 1BOSA 3URYA 1LTID 1S5FD 3G48A 4AQYL 2K1BA 1IBMQ 3HOXG 5CV8A 2NVQH 4DAYA 1E1OA 5C44G 5TSSA 2AWOA 4YY3L 2IX3A 5IT9c 1JB7A 1V1PA 3K5NA 4OX9Q 1OXTA 3SXHA 2AKWB 1WOCA 2WINB 5J39A 2Y0SB 1CQVA 1SBBB 1DXMA 4JOIC 2Z1CA 1B50A 1DOKA 1JC7A 3RZOB 1K8OA 4UDUC 4RKLA 4N8X1 3CPFA 3TS2A 4OL7A 2O5IC 3H0GB 1VMCA 2WIIB 2ZXRA 2PW7A 1R4QB 2IJ0A 3R8BA 1B2TA 5JEAG 1VQPA 1V1OA 4RCNA 3NELA 3C3LA 3QOJA 1QVGA 1VQIA 1J6QA 3K58A 1A3VA 1GJXA 3HOYB 2IX0A 1NCVA 1SE2A 2PZUA 4C3HB 3H3VC 1WCMH 4WFN3 1ZYRD 3Q24A 1S4ZA 4KD3A 2Q8RE 2RCFA 4OO1H 1G6PA 5BN3A 5D3IB 2OQ0A 2V4DA 4K2KA 2I5MX 1GHKA 1STEA 3DEOA 1CA5A 1PRTC 1VQOA 4HJAA 1XTDA 2DUDA 4V190 1XMQQ 2L4NA 1JICA 1BO0A 1K8MA 1I94L 4A3LG 2VQEQ 2EY1A 4DV1L 4DV6Q 5L37A 1I3QH 2R93B 3P7JA 1SMXA 2B63H 2QILA 1MHWC 3OHXC 2K03A 5FLMG 4IFDH 2A6ED 1EY7A 2E75C 1JT8A 4C3IB 2JA8H 1QOHA 1E3PA 4YY3Q 4QMGA 1K9MC 3KLSX 1L0YB 1W6JA 4ALPA 3QG1A 4QGUA 1XNRL 2OQKA 1RD9D 1TS5A 1CFMA 2QDBA 2YTXA 3EIVA 3EVQA 1PA6A 3H0GH 3PUVA 2NZOA 1ZEQX 2ZTCA 3S1NB 1U0LA 2KCMA 1SROA 1LTAD 1TQOA 1BCPB 3S1NH 3K5OA 1EY6A 5I9OA 4IO9A 2GVAA 2A1AA 1EIGA 3HOWG 1SYFA 3TN2A 2G5DA 3UDXA 3O13A 3BJUA 4PMWA 1UEAB 2Q8IB 2L11A 1Q1BA 5T1GA 1QUQB 4RMFA 4ZK9B 3GTMB 5CV4A 4EQ5A 4B3SL 1Y8PB 3I90A 3K59A 5C4ZA 4TQUS 4IQZA 4RGMA 4E6IA 1TU2B 3BYYB 1ESRA 1WD1A 1Q3LA 4PMBA 3PIP3 4A3DB 2E5LL 5I4DA 4R4IA 4DR4Q 1X3QA 1YZ6A 3CCJA 3AQQA 5EAYA 3HOUB 2EYLA 1HFGA 5M3FB 1IHZA 5IYBG 1TWAH 3HOZB 1VQFA 1KDBA 4YCWA 1OO9B 3MXUA 4BY7H 3C2PA 1NAPA 1HQRD 3MWYW 5H1SE 3J81c 1PYBA 1JMCA 3CCLA 4C1NK 1H9MA 4BY1G 3CPWA 4UHVA 3H3VH 4A3BH 2PI2E 4K8JA 4A76A 3ULJA 4R4QA 5KEEA 4B9WA 4DV1Q 4DV6L 4UP9A 5CV6A 2K6AA 3K7UC 2B39A 3ERQA 2CWAA 3OIQA 4GNXC 4DUYQ 3BG3A 2EIFA 3TP7A 2BDOA 4QCLA 1EEID 4J15A 4LFCL 3W3AA 4DUZL 3CCMA 1U4RA 2EVBA 3D3RA 4X66L 4QL5A 3E0EA 5IYDG 1E2WA 1FL0A 2NTSA 1GUNA 1L0XB 2DJGC 1PTOF 3CU7A 4XYQA 1UUPA 4LJZC 3BZDB 3LNNA 3BVZA 4XIGS 4AYBB 5KNBA 1SJED 1SFOB 4JBMA 5C3EH 5K36G 3TP5A 4R4CA 2HDMA 1K83H 3CCEA 3FPUB 3BDOA 2BH2A 4LAAA 4FVMA 5JOBA 3CCVA 5A35A 4JI3L 4UY8C 2GN5A 1WD0A 4LWCA 4OIJA 3RN2A 4X3UA 4FXKC 3FRPB 4GOPB 5C4JB 3I55A 5C44B 5I2XA 4A3FG 1E2VA 2B2TA 3ULLA 4F7XA 3PGZA 3PUZA 1MJCA 1EFID 2R92B 3PV0A 3T53B 1CZGA 1VQGA 2M2LA 1JWUD 4IUVA 1I6VC 3Q8DA 2ZXPA 1VQHA 3GO5A 3TP6A 4A3EG 1PVOA 5IGCA 5GROA 4RGOS 3IRBA 4DR7Q 2JA7H 4M1UB 2A6HD 4R4TA 2QGQA 1EFWA 3KK7A 5LL6S 1Q86C 2UUCQ 2J0TD 3DM1A 3VR3A 3HZXA 2R7ZH 1I4PA 1CSPA 3PSIA 3K57A 1B44D 1P16A 1LLRD 2R7ZG 4QB4A 3S1MB 1EU4A 1G6ZA 4B08A 3PO2B 3GTPH 3WDNA 4HIOA 1D5XC 1HA5A 2E76C 1TWGH 3K8AA 3PO2H 5CORA 2A68C 4IUNA 2NVTH 4UP8A 1PH8A 4IPDA 2PPBC 1D5MC 2F52A 4HEDA 3NSWA 4HSPA 3UDFA 1P8LA 4JI7Q 1RJTA 1KAAA 3CCSA 1LTBD 1S40A 3J81L 1AP0A 3JAML 2F0HA 5DNFA 4QUFA 3AEVA 2VXWA 1J5EL 2UU9Q 3RZDB 5C0XJ 2D0PA 1TWFB 1EIHA 1ET6A 2ZTDA 5EKKA 2XTIA 2HD3A 2NVXH 1SEBD 4ZCKA 3HOZG 4L5SA 4C3IG 1QG7A 2CW0D 3M9BA 4HCEA 4QUCA 4HSVA 3CC7A 3K0YA 3NBIA 1NSNS 5FLMH 4IFDG 2JYOA 5IGGA 1O80A 4ZUIA 1N36Q 2B2YA 1YNJC 3LX0A 3FPPA 4RG1A 4KY7A 2NB0A 3S17H 1PRTF 2ICIA 4OONA 2Q2HA 4KKSA 1Z6HA 1F2MA 4A3DG 2MPMA 5FO7B 3EA6A 1DD2A 4BY7G 2EY2A 5M5YH 1TWHB 3P75A 1FGBD 3ZJYC 5C4XH 2HUGA 4MTKA 3KLRA 1Y8OB 3NP8A 1SNMA 3M4OB 1Z7TA 1X3EA 2CFMA 5C5MA 4XT3B 2EXZA 3MFYA 3UE1A 4F88A 1NMFA 3S16H 1WTOA 2HQEA 1JWSD 4A93B 1DONA 3RNUA 1EZ8A 1IKMA 2E2DC 1QZHA 4FXGC 1EYCA 1KAWA 1TY2A 3E0JA 3D4DA 4P72A 1FR3A 3UI2A 4DUYL 4LNQA 1HNWL 2EYOA 3Q22A 2A69D 4JW0A 1BQQT 3NBHB 1XNQL 1X3PA 4G57A 4I7ZC 4LF7Q 1CKNA 1S5ED 1U4LA 4BBSH 5M3FG 4ME5A 3TEHB 1B4OA 4HIKA 2L1BA 1K3RA 2DNEA 4A3KH 3VYUA 3H94A 1OXUA 2K28A 1EZ6A 5IT9L 1OXVA 3U50C 1ENAA 2ZM6Q 1Q8KA 1IBLQ 3OTOL 1EOVA 1STBA 2FJ2A 4EQNA 1S72A 1KL9A 2CVRA 1U4MA 1ASZA 4WJ4A 1PTOB 3TSSA 3IKJA 1SJHD 1C9OA 5IYCG 4MHEA 4N9TA 1X3GA 4ILWA 4R4OA 1H9JA 2OCEA 4A3IH 1EOTA 1F9RA 1L1OA 5AJ3Q 4CKBA 1LM0A 3U4VA 1BBXC 2DJFC 4X66Q 1PXUA 1IBKQ 2X6GA 1NJIC 4P75A 2FHTA 2UXBQ 1C48A 4OIKA 2B63G 3VR6A 1ICWA 4DV2Q 4CDEC 3T1HL 2PMZB 2E2HH 5KRUA 2UXCL 3F2DA 5FJ8G 2NN6H 5FKAC 4RFBA 2F4VQ 3SGIA 3HEJA 4OO1I 2UUBQ 2K50A 5GAGC 2OXPA 5IYCH 4JI0L 1WTHA 4DK6C 5FOBB 3MVVA 3I4MH 2WAQB 1EY8A 3I7FA 5IY0A 4GKJL 1ILPA 4DR6L 4XQNA 1E24A 2HQLA 2OT2A 3A0JA 4TSSA 4WJWA 4PZ8A 4DU9A 3PUYA 2WB1E 1K8GA 1DZ1A 3M7NA 3LWEA 4JG2A 1A0IA 2PNRC 4TRDA 3T16A 3DUZA 5LMNL 4LF6L 1PMRA 4JI4Q 2KENA 4F87A 4LF5L 5C4XG 1STGA 1UWVA 3A5UA 1MIUA 2E8GA 2RDHA 1PH5A 2K5QA 3G4SA 4EVOA 2MJ8A 2F0OA 5D65A 4LF4Q 2ES2A 2L9HA 2LS01 2MO0A 5ELFA 2AUJD 1MI2A 4PMCA 1CUKA 1VQLA 1LTRD 5FLXE 4OWTB 5DEHA 2HDLA 4A3KG 3F2UA 2IHEA 4NXMQ 2EOTA 1SNOA 1BBWA 1VQJA 1S5DD 2KCNA 2GVBA 1VQ8A 3CD6A 4EQOA 3G71A 1XXGA 5JEAH 1M90C 3H09A 4NKLA 1R9TH 4B3RQ 1SNQA 2VUMH 1C0AA 4BBSG 3MC0B 2Z8LA 1PH1A 4KHVA 4K6LA 2PZWA 2PQAA 3GDEA 5KIXA 1B9NA 4KJOA 1EY0A 4JPBW 5DLQE 2VUMG 5C0XH 1XNRQ 2AQ2B 3I72A 1YITA 2JA7G 1B9MA 3IL8A 1YJ9A 1SYGA 4KV6A 2IT1A 4JI1Q 1KDCA 2KBNA 5E4WC 1CK1A 3L2PA 3F8TA 4DAPA 1EQRA 3S1QH 3ERSX 1GUWA 3QB3A 3RN5A 1JJGA 3MXNB 1K73C 3AU7A 1I94Q 1SDFA 3R93A 1GM5A 1V8QA 2EYPA 4KTAA 2AUKA 3S2DH 3MFGA 1Q7YC 1WTWA 2A19A 3I4NH 3SR1A 1EYDA 1PTOD 3GTPB 2CCZA 3SHLA 1DYQA 1W2BA 1HZ9A 2M9VA 1PFNA 1MSGA 5EKIA 1BUVT 1F9PA 4CKEA 3NEMA 3F2BA 1SRUA 2MHVA 2ZTEA 4FP5D 4A3JH 2NBFA 1JOKA 4X6AH 4AH6A 3A8JE 2R61A 2Z6KC 5M3MB 2K4KA 4OHJA 4ZAIA 4DV4Q 4K5WA 1XPOA 1SMYC 1J8IA 4HCSA 1EQVA 2EJGC 4NB3A 3MHBA 4A93G 1EQTA 1QILA 4QIWE 5JJLA 5LMNW 1Y1WH 1HA6A 3S2HB 4TKOB 1JORA 2BE5C 2JSOA 1G8ZD 4IN3A 1SXTA 4JI4L 2TSSA 3KLWA 3S15H 4LFBQ 2Z6BA 2FMCA 1PH4A 3A8IE 2MO1A 1T5EA 4A3GB 1F9SA 2F0SA 4BY1H 3VA5A 2HIVA 3MZ5A 2HT1A 3HRZC 4G7OC 1LO5D 2H5XA 3WOFA 5T1IA 1KLGD 4IUTA 5ELCA 1HR0Q 1HFNA 1F2YA 3S2DB 2K5NA 3BVGA 3K80C 3U58A 1UNSA 1A15A 3B6YA 1TT2A 3FP9A 2WFWA 3CMEA 2A68D 1HPCA 4APVA 2K32A 3ND8A 5KYLA 3CCRA 2VQFQ 4XDXA 4JI0Q 4H02A 2CW0C 2EQSA 3GTKH 3KLSA 4NXML 2X69A 4MZ9A 3TP8A 5JPNC 3GTLB 3LWUA 3RUZA 3SK4A 1Q82C 2EZVA 1EIFA 2JQOA 1GD7A 4KN4C 1TWCB 4IOCA 5J22A 3A74A 1AZPA 2JXMB 1RODA 3C1FA 2YYZA 2KOLA 3CQZB 3SK8A 5CYUA 2MP1A 1SN8A 3NTHA 1XWEA 1Y1WB 3CW2C 4DNIA 1VQCA 3PUWA 1W6KA 1IBLL 3HOVB 1DOLA 3STBD 1ZXTA 3OMCA 1YNND 4OELB 2WAQG 4RA8A 4GNXB 3S24A 4BS9A 1BDOA 4ZYSA 3T4AC 2WP8J 4DR6Q 3K7AH 1PH7A 2X6LA 4R9WA 4XXEA 1N34L 4L5RC 3PO3H 4O2DA 4DAYB 1X32A 3CC2A 1Y1VH 4IZ8A 2DN8A 3BDLA 1JWMD 3PF4A 1QB5D 3UE0A 2B2UC 2QDLA 4A3MG 3T1HQ 3CXCA 4S3SA 1HR0W 1GO3E 3Q23A 3MXNA 1HHVA 3K5LA 2QF7A 5IE8A 1MSHA 4BWGB 1XNQQ 2YU9B 4C2MH 4IPHA 1HUNA 4ZUJA 5COYA 2N88A 1WTXA 4IUUA 1PFMA 2LXJA 2IWHA 3GTQH 1BVSA 1SMYD 1E7ZA 2SNMA 4FO2A 4ID6A 2ZT9C 3I4MB 3PO3G 4K2LA 3QIAA 1VQ6A 3RLOA 3VYTA 5E7NA 1F2LA 1BBUA 3TS0A 4KHZA 3E9HA 1YNNC 4RWSC 2EY5A 2F0NA 1RCVD 2EPBA 1GUTA 5NUCA 3M4QA 3BYTB 1TR5A 2ZM6L 1SE3A 5HURA 3FDTA 1RKNA 2VUMB 3UDIA 4O42A 5CGKA 2BH8A 5IP9H 3PF5A 1IYUA 3GP7A 1NR2A 4DR5L 5C5LA 1I4RA 1C7YA 4FF3A 1CQFA 4DF7A 3R3OA 4JI6L 3MTSA 1XTCD 1FNUA 4V0BA 2F03A 4JI1L 3DMUA 1U4PA 1Y14B 3J80i 2RF4A 3FHWA 2VNUD 2K01A 1WVLA 4UAIA 4NPSA 1N36L 1J5EQ 2R3ZA 4A3GG 1GUGA 2PO4A 1LTTD 2JEBI 4IOAA 3EROA 3A54A 4AYBE 3I4NB 1S3OA 2EXDA 4CJ1B 4JCVE 4A3CH 4GLAC 4OEMB 5CBEE 2LSSA 1MBYA 2AQ1B 3HOXH 1X56A 3E6ZX 2K33A 3FVQA 1KNAA 3VA7A 2B8GA 3RLFA 4A4IA 2WB1B 2KQ3A 3HOYG 4X62L 2PQEA 2RDGA 2BA0A 2LMCB 1IL8A 4DN4M 3DM3A 1K3BC 3I3CA 3A7AB 5M3MG 1PYSB 5G3LD 4RAUC 2VW9A 1YHBA 2B3GA 2F0JA 4P2CB 2NVYB 3CCUA 3RZOH 1E2ZA 3QR8A 4P71A 3DLLA 1UE6A 5CBAE 1RHPA 3FEWX 3NPPA 4LMQD 4A3EB 4DV3L 1D1IA 4DR1L 2JK8A 1VF7A 1WJJA 1FVIA 1Y1WG 1I4XA 1CKMA 4P73A 5ELBA 2MFIA 1J9OA 1VF5C 1Z47A 2VB3X 2YTYA 2HHHQ 2JJQA 5EPLA 1VQEA 2A73B 1LTLA 2RKSA 1EQQA 2EE1A 1EWIA 1LV9A 1A2TA 2A74C 3OSOA 4DR5Q 2K04A 2L15A 1IL2A 4XT1B 5A2QE 3RD4A 4B3TQ 4O1NA 3NXWA 5HY6A 2RCNA 1RTOA 2F4VL 2N49A 1RIPA 4GOPA 4JI3Q 3U4ZA 3HOYH 3HOVH 4C3JH 2K5VA 5IWAL 4NP5A 1XPRA 1EUJA 2JA5B 1O78A 3D4RA 3SVMA 1D1KA 2JE6I 5FLXL 2EYJA 4X3SA 3PQIA 3VDYA 2IX1A 3K6OA 3VR4A 3KF6B 4IUPA 4CJ2C 3M85A 3M3YB 1HQMC 4AIMA 4A3MH 3QWNA 2UUAQ 2I07B 1CSQA 1BCPD 1SSOA 4IALA 4C2MB 2PCFB 4NDXA 4PNYA 4OGQC 4BA1I 1EWCA 2Q2UA 2KECA 4YWMA 3J81j 1N33Q 4X64Q 5KGUA 5EBCA 1QCBD 1PH2A 1N34Q 3OMGA 1X6OA 3PO3B 3PMFA 4ZKBB 2IPKD 1YI2A 4HJ5A 5EPJA 1TXYA 2HIXA 3M4OH 1HNZL 1H9SB 4GKKQ 4BBRB 1VS0A 2KHJA 2E5LQ 3RMHA 3K81C 1HRJA 4WORA 2RSOA 1GHJA 4RHSA 3I4LA 3I4NG 4DXFA 3TDQA 2WV6D 4K5XA 2R92H 5CV7A 2RSNA 3ULPA 2B29A 1K28A 4IURA 3FKIH 2EDGA 1PLFA 5M5WB 3BDCA 1B53A 4DUZQ 4LF8Q 2F3VA 4LFCQ 1EY4A 3GTLH 1YJNA 4L8JA 3GTJH 3GTGH 2AWNA 3FKIG 4X65L 4JI2L 2VQFL 3A55A 5I6WA 1AN8A 2EJMA 4BBRH 2RVLA 3X3NA 3A8KE 3D31A 1HTLD 1AH9A 2LY7A 1V43A 5GAEC 1BCPC 3T1YQ 2SNSA 5J3BA 2F0MA 5KNCA 1N32L 5LMUL 1FGUA 1K0SA 3H6MA 4CHTB 3I2ZA 1X54A 4FF1A 1TWGB 5C3WA 1LUZA 3D6WA 2BE5D 1SAPA 2F0IA 1WFQA 2NWGA 5C3XA 2KEDA 4RKBA 1NNXA 4WRDA 3S1MH 4B3MQ 2QCPX 2WACA 3AB9A 3NQIA 5I6YA 4RH6A 4DV0Q 3GTJB 3GTGB 1TKWB 5C3EG 1SYEA 1YBYA 2R7ZB 4DPGA 5M5WH 4Y52H 4RHRA 5M5XB 1STYA 2BCOA 3G7LA 3MAQA 4JI7L 1KQSA 3CCQA 2Z4IA 4DNRB 1D8LA 2H4OA 3Q6SA 5CV5A 4NMZA 2RQXA 1HUMA 3RR5A 1TWCH 1A6XA 1RTNA 2NVXB 4HMJA 1XMQL 4L63B 4BY7B 1LT4D 1VQ7A 3P1HA 1IXRA 1NTGA 1XPUA 3GTKB 2A8VA 1PTOC 5M3FH 1D2BA 2C5CA 1QJOA 4N9PA 3MEHA 1Q81C 3KJPA 5M5XH 2PNHA 4PV1C 5C44H 2D2CC 1QVCA 4DA2A 4LK1C 1NUCA 3MA2B 5ELDA 1RDPD 5E3FA 1JOQA 5IGEA 3R2TA 1CKOA 1LYLA 4JI5L 4DR3L 1O7LA 3KJOA 4YWKA 2ENBA 2EY6A 1STNA 3F1ZA 4KMUC 1KDAA 1SYBA 2K75A 3I73A 4DV7Q 2PYKA 5ISRA 3J81E 3T56B 4DXGA 4A3EH 1LTGD 2NUCA 4OX9L 4L6TB 2J4XA 1CA6A 1IW7D 2E2JB 5EJWA 4DNTB 2JA6G 3I4MG 2Q2TA 3DEPA 1HCZA 1I4GA 4DR3Q 1SYCA 4IJLA 4L5TA 5F2DA 5LMNQ 4DV0L 3CP0A 3VR5A 1WI5A 2PW5A 4ZKCB 1X55A 1OXXK 5CMDA 3T13A 1E0BA 5IGBA 1JR0D 5IYDH 3K5MA 1KXLA 4DV4L 4JOIA 3H91A 4G7ZC 2NYZD 1WTVA 1YVCA 1I5FA 4A3BG 1DOMA 2K5DA 4KD4A 1A63A 1GUOA 1JQYD 4F8MA 1JJCB 5AFWA 3ONAB 3HKZB 1MD2D 1UE5A 2KUMA 5BN5A 4M8AA 2A69C 2OEOA 2F0VA 2ZJPA 2EYMA 1T9HA 3R2IA 1FYCA 5JVH3 3S1RB 4FYDA 4NW2A 1VQ4A 2JP1A 2DY7A 2QKIC 3NTIA 2R7DA 2KEEA 5AJ3L 1SE8A 3HKZE 4OWXB 4ME3A 1HZCA 4J6HA 1SE4A 3EBEA 1PRTD 3MEFA 4DK1A 2QEXA 2B2YC 4LUOA 5IGFA 1PH3A 3EN2A 2MNAA 2B2TC 1VQMA 4LF5Q 2KHSA 2NZHA 4CDDC 1L1OC 4RGTA 4C3HG 2ALYB 1KRTA 1VQ9A 2H1EA 4HJ8A 1GVPA 4AQYQ 3EFXD 3DWQA 3I91A 2F0DA 1HNZQ 3GD7A 1WCMG 1ENFA 2A6EC 5DM73 2P5ZX 2K5HA 4QF4A 1LACA 1T5XD 3VYRA 2DNCA 3F2CA 3JAME 5IYBH 4GKJQ 1R9TB 1I6HH 3V05A 2CH4A 4NXNL 4DAVA 1H9KA 4JYAQ 1O7IA 2E2HB 2UXBL 4L5QA 4N8FA 1F9QA 2I0QA 2VS1A 4YHHQ 5GQOA 3HOZH 2JA8B 4Q5VA 2KJXA 2K52A 2D5DA 5IODA 3CRKC 5M9OA 2SDFA 4CBVA 1RL2A 4DAMA 1K0RA 3H15A 4P74A 4GLXA 1PFSA 1Y1VB 1PV4A 4LF4L 4BA2I 4QIWB 1TY0A 5JEAJ 3I70A 4FF2A 3E9IA 1Y8NB 3NBHA 1PH6A 1PTOH 5C4XB 2N78A 4GKKL 4KKTA 4IFDJ 1HTPA 1IYVA 4PZ7A 2UXDQ 3CKIB 1GOZA 1HH2P 3KF8B 4KKUA 2B2UA 5KYIA 3DXJC 1XMOQ 2IHFA 2N55A 2SEBD 2VY3A 1FJGQ 4BXXH 1KABA 3OTOQ 2R93G 4C3JG 1EIYB 3EQLC 2K14A 4A3KB 2XWBB 1N33L 4DK0A 2NZ1D 1WTRA 2L5TA 4B3TL 4ZQ3A 3BS1A 1YEZA 3M7GA 4WJ3M 1KNEA 2DGYA 2EYHA 1N9WA 3D6CA 5EKLA 1STHA 2KCTA 3FMCA 1DCZA 2PZTA 1ET9A 3NENA 2E74C 1EU3A 2HHHL 3RZDH 2YU9H 4KLKA 2RHSB 1JE5A 1I50H 2UUAL 1HJPA 4KJNA 4DKAC 1Y69U 5K36H 5C0XG 1BF4A 2B2VA 1PDQA 1VQBA 2E2JH 3HOVG 5GAHC 4U68A 1GUSA 3AFPA 4ZRZA 2ZJQA 4DV3Q 1NR4A 2G9DA 3IFTA 4DR1Q 4A93H 5LHY1 1NMGA 1PYWD 2Z6KA 3IFDA 3CHBD 4JI8L 2JA6B 2XNAC 3X3MA 5IGDA 4KN7C 4LUVA 1ASYA 3WWVA 2PQAB 2ZXOA 1CKNB 3CRLC 3J7YW 4BBRG 1ILQA 3ITPA 1PZJD 4R1JA 1IZ6A 5DM63 1A3UA 3KYHC 1A2UA 1EY5A 1A8VA 2GA4B 3ER0A 4YIJA 4GNXA 3S17B 2VB2X 1VCIA 1QE6A 3H0GG 3S15B 4A3IG 1YHAA 2VL6A 3TMEA 4JV5L 1NE3A 3C46A 3ICEA 4QJFA 3W2DA 2YV5A 1LT3D 3HOWH 4X3TA 1CTMA 4DR7L 4H0LC 3NE5B 1TWFH 4AYBG 4A3FB 3QO2A 1WTQA 1NY4A 4HN7A 3TRZA 3PCOB 4HR7B 1TVXA 1AE2A 3L7ZC 4HAEA 5IIFA 3TZUA 2O4XA 5M3MH 5BR8L 4LFBL 4JI6Q 1QNKA 1SYDA 3J80E 3KF8A 4JVZA 1R4PB 1TS3A 5KNDA 1CHQD 3S14B 2I5HA 2KCCA 3VR2A 1ZKOA 2MUYA 3L3OC 1SR3A 1B3AA 4DGZA 1YHQA 1M4VA 3L9AX 2KA7A 1DM0B 2EJFC 3NQTA 4LF9L 2Z0SA 2NVQB 1XYIA 2RDFA 3AMUA 4QQBX 3OIPA 4IUQA 3KFUA 2RHQB 2NTTA 5C3EB 2HCIA 3HKZG 4X3KA 1QNUA 3Q0AA 3L0OA 4IJHA 3S1QB 3SK6A 2JA9A 2D9UA 4TVAB 3PO2G 1F77A 4KHPQ 3K7AB 4RGNA 3NTKA 5JJZA 4MNOA 3OOCA 3BU2A 4H13C 2FINB 1S5BD 1AZQA 3S2HH 2F4IA 2I5LX 3NWSA 4A75A 4PG3A 1ML0D 3TBIB 2Q2IA 1CM9A 1H9RA 5A2QL 1AFPA 5D3DA 1DGSA 3JC66 4YCVA 1A62A 2FXQA 3W1GA 4HJ9A 4FF4A 3J7A5 3HOWB 4LW1A 3PUXA 3MXPA 2F0PA 1PZKD 2YTVA 3CQZH 1B1ZA 3I56A 1L2FA 1Q90A 1YNJD 1QWYA 1VQDA 1PFBA 4B3ML 1U9RA 3HFZB 3NUCA 2N3SA 2A5HA 3KDFA 1BKBA 5D14A 1TS4A 5IOCA 3EJIA 1L0WA 5EPKA 1L1OB 4CJ0B 1N32Q 2J7ZA 2MQHA 2RA4A 1MJEA 2BDNA 2F0UA 4JBKA 2NN6I 2ASBA 1K83B 2G9HD 3HGBA 3W1BA 2JA6H 4K8IA 5FO8B 4A3JG 3SE0A 4C1NI 5JVG3 1BCPF 1N8RC 3ND9A 1Q1EA 1I4HA 3G6EA 3CAMA 2OTJA 3A5ZB 5IT9E 5IP7H 1I4QA 3C1EA 1Y1VG 5FLXc 4LF8L 3TZDA 3GV6A 4HJ7A 4BY1B 1X9NA 2K7VA 3PIPA 3AFQA 1EEFD 4O0AA 1VDZA 1OTCA 3D0FA 4A3MB 4NXNQ 4OO1G 4K0KL 1ENCA 2XWJB 4HTHA 4GN3B 1JCKB 3DWPA 2PI2A 2Z9HA 3TREA 4HMIA 3BVMA 2B8FA 2JA5G 4A3CG 2KHIA 4IPCA 5EGTA 1B7YB 1XX8A 3AYHB 4R8IA 1SNDA 4LFAL 4DR2Q 3TQYA 1LT6D 1S5CD 4A3LH 2LXKA 4KY5A 4GN5A 2WKDA 1UE7A 5I9PA 2XN9C 1TWAB 3MXGA 1FNWA 4XTCS 1ESFA 4CDCC 5LMUQ 4A3DH 1V9PA 5ELEA 2XGTA 4X64L 4A3IB 1BNZA 3D8GA 3GQBA 4B3SQ 1BXTA 2FMMA 4DFAA 2VQEL 2CH4W 3RLNA 1PHJA 2F0LA 1GXDC 3IAYA 1HZAA 3GTOB 2E2IB 4ULLA 4Z9CB 4K0KQ 2JN4A 4MTNA 2HCCA 3K0XA 1C4QA 1EYGA 1A3TA 3G6JB 4OXPA 3KDFB 1PH9A 4H44C 1DJRD 2EYFA 2Y0SE 4BXXG 2F0QA 2R92G 1O7YA 1WCMB 4C3HH 1I6HB 2TMPA 1TS2A 1YJWA 3DWAA 1VQ5A 4XQJA 3N6RA 3SK5A 3M3YH 2ID0A 4KY6A 3OWFA 1K8AC 2L55A 1UE1A 4ZLTF 4FNFA 1CT1D 1G2TA 2CWPA 4U673 1PRTB 4JK1C 2CKZB 2CHBD 4C3IH 2OTLA 4DR2L 2MGSA 3PIOA 3T51B 4UP7A 3BZCA 3OW7A 3OW2A 4QY7A 2F3IA 4YCUA 2B63B 1XJVA 3GTOH 1VQNA 1LTSD 3CMAA 1AEXA 4G4KA 2IL8A 2B2WC 3E5SA 1X65A 5EBDA 1MGSA 2R7FA 3J80c 1KHIA 3KBXA 1FNVA 5ELOA 3S1RH 1EYAA 2SOBA 3NK9A 1W3SA 1KTKA 3U9OA 3GTMH 1TWHH 2BA1A 4JI5Q 2WB1G 4Q0FA 4K6DA 3VYSA 2FFKB 3HS0C 4KHPL 1WTPA 2OF1A 4G7HC 1HZBA 2K5WA 4B3RL 1EL0A 1SNPA 3CC4A
chains in the Genus database with same CATH topology
4FXDA 1STAA 3QOLA 1II3A 3ZYYX 4Y7NB 1IW7C 4J1MA 1JOOA 1TIID 2CQAA 2F0WA 2NN6G 3V2TA 3V96A 3U9SA 2DY8A 3HP3A 4JBWA 2B2VC 2C9OA 3N52A 1FD7D 1VMPA 3HOXB 4GZYC 2K05A 4CGYB 5C0XI 2M00A 1LABA 1UAPA 1G291 4KI0A 5K5PA 2XIWA 1IKLA 4K5VA 2JEAI 5E4XA 5LL6X 4I65A 4XQQA 4RCOA 3A7LA 4MN3A 5CV9A 5C4HA 5JAVA 3OWEB 1Q8IA 1C8CA 2F0KA 3J7AV 1PZID 2F1MA 5FK9C 2RBMA 4EGVA 1V1PB 2F0FA 2KVMA 2ICEC 2L0CA 2F0GA 5E1FA 1ZYRC 2BOSA 5DAUA 2XRQD 3KBGA 2XRSD 3PIO3 3GTQB 4BBSB 3D4WA 5G3LF 1BR9A 1OXSC 1G91A 3A56A 1HXYD 2R6GA 4C56C 5CC4A 2LFNA 3P20A 4MIUA 3OPOA 1D6EC 3QJYA 3S9WA 5HGTA 1KLUD 1G2SA 3S16B 2F0EA 1EWHA 3NWTA 4K14A 2A6HC 4J8QA 4H7BA 1Q12A 1CZWA 5M5YB 2LKVA 3HG9A 2QEJC 4CKCA 1EY9A 3SEBA 3GV3A 3FKIB 2F0TA 4KK7A 5EQ0A 1AW7A 4PQXA 1CI3M 4B9XA 1D5ZC 2O2LD 2IW3A 2AQ3B 4XYOA 4A3JB 5CR3A 2NVTB 5JPMC 1RF2D 2B2WA 3M4YA 4IFDI 2Z4HA 3NHHA 5I2YA 2WKCA 1ONLA 2L12A 4ODGA 2I46A 1I50B 5J1ZA 3I8ZA 1LT5D 5BN4A 1JE4A 3DHQA 3KUPA 2XVSA 2XSCA 3WOEA 1H9SA 1JB3A 2F3WA 2JA7B 4A3BB 2D62A 4R8NA 3J7AF 5FO9B 4C3JB 4EQPA 1M8AA 4ABNA 1O7ZA 1SNCA 3J80L 5C6AA 2Q8TA 3SDZA 2O5JC 1I3QB 1CHPD 1F2ZA 1BOSA 3URYA 1LTID 1S5FD 2K1BA 5CV8A 4DAYA 5TSSA 2AWOA 2IX3A 1V1PA 3K5NA 1OXTA 3SXHA 2WINB 5J39A 2Y0SB 1CQVA 1SBBB 1DXMA 2Z1CA 1B50A 1DOKA 1JC7A 3RZOB 1K8OA 4UDUC 4RKLA 4OL7A 2O5IC 3H0GB 1VMCA 2WIIB 2ZXRA 2PW7A 1R4QB 2IJ0A 3R8BA 1B2TA 5JEAG 1V1OA 4RCNA 3C3LA 3QOJA 3K58A 1A3VA 1GJXA 3HOYB 2IX0A 1NCVA 1SE2A 2PZUA 4C3HB 3H3VC 4WFN3 1ZYRD 3Q24A 1S4ZA 4KD3A 2Q8RE 4OO1H 5BN3A 5D3IB 2V4DA 4K2KA 1GHKA 1STEA 3DEOA 1CA5A 1PRTC 4V190 2L4NA 1JICA 1BO0A 1SNPA 2EY1A 2R93B 3P7JA 2QILA 3OHXC 2K03A 4IFDH 2A6ED 1EY7A 2E75C 4C3IB 1QOHA 4QMGA 3KLSX 1L0YB 1W6JA 3QG1A 1RD9D 1TS5A 1CFMA 2QDBA 3EVQA 3PUVA 1ZEQX 3S1NB 1LTAD 1TQOA 1BCPB 3K5OA 1EY6A 5I9OA 1EIGA 1SYFA 3TN2A 3O13A 4PMWA 1UEAB 2Q8IB 2L11A 1Q1BA 5T1GA 4ZK9B 3GTMB 5CV4A 1Y8PB 3I90A 3K59A 5C4ZA 4TQUS 4IQZA 4RGMA 4E6IA 1TU2B 3BYYB 1ESRA 1WD1A 1Q3LA 4PMBA 3PIP3 4A3DB 5I4DA 1X3QA 3HOUB 2EYLA 1HFGA 5M3FB 1IHZA 3HOZB 1KDBA 1OO9B 3MXUA 3C2PA 1NAPA 1HQRD 3MWYW 4C1NK 1H9MA 4K8JA 5KEEA 4B9WA 5CV6A 2K6AA 2B39A 3ERQA 3OIQA 3BG3A 3TP7A 2BDOA 4QCLA 1EEID 3W3AA 1U4RA 2EVBA 3D3RA 1E2WA 2NTSA 1GUNA 1L0XB 1PTOF 3CU7A 4XYQA 1UUPA 4LJZC 3BZDB 3LNNA 3BVZA 4XIGS 4AYBB 5KNBA 1SJED 1SFOB 5K36G 3TP5A 2HDMA 3FPUB 3BDOA 4LAAA 4FVMA 5JOBA 5A35A 1WD0A 4OIJA 4X3UA 4FXKC 3FRPB 5C4JB 5C44B 5I2XA 1E2VA 2B2TA 4F7XA 3PUZA 1EFID 2R92B 3PV0A 3T53B 1CZGA 2M2LA 1JWUD 4IUVA 1I6VC 2ZXPA 3GO5A 3TP6A 5IGCA 4RGOS 4M1UB 2A6HD 3KK7A 5LL6S 2J0TD 3DM1A 3VR3A 3HZXA 1I4PA 3K57A 1B44D 1LLRD 4QB4A 3S1MB 1EU4A 1G6ZA 4B08A 3PO2B 3WDNA 1D5XC 1HA5A 2E76C 5CORA 2A68C 4IUNA 2PPBC 1D5MC 4HEDA 3NSWA 4HSPA 1RJTA 1KAAA 1LTBD 3J81L 1AP0A 3JAML 2F0HA 5DNFA 4QUFA 2VXWA 3RZDB 5C0XJ 1TWFB 1EIHA 1ET6A 5EKKA 1SEBD 4C3IG 1QG7A 2CW0D 4QUCA 4HCEA 4HSVA 3K0YA 3NBIA 1NSNS 4IFDG 2JYOA 5IGGA 1O80A 4ZUIA 2B2YA 1YNJC 3LX0A 3FPPA 4KY7A 2NB0A 1PRTF 2ICIA 4KKSA 1Z6HA 1F2MA 2MPMA 5FO7B 3EA6A 1DD2A 2EY2A 1TWHB 3P75A 1FGBD 2HUGA 3KLRA 1Y8OB 3NP8A 1SNMA 3M4OB 1Z7TA 5C5MA 4XT3B 2EXZA 3MFYA 4F88A 1WTOA 2HQEA 1JWSD 4A93B 1DONA 1EZ8A 1IKMA 2E2DC 4FXGC 1EYCA 1TY2A 3E0JA 3D4DA 1FR3A 3UI2A 2EYOA 3Q22A 2A69D 1BQQT 1X3PA 4G57A 4I7ZC 1S5ED 1U4LA 4ME5A 1B4OA 2L1BA 2DNEA 3VYUA 3H94A 1OXUA 2K28A 1EZ6A 5IT9L 1OXVA 1ENAA 1STBA 2FJ2A 4EQNA 2CVRA 1U4MA 1PTOB 3TSSA 3IKJA 1SJHD 4MHEA 4N9TA 4ILWA 1H9JA 1EOTA 1F9RA 4CKBA 1BBXC 1PXUA 2X6GA 2FHTA 1C48A 4OIKA 3VR6A 1ICWA 2PMZB 5KRUA 2NN6H 5FKAC 4RFBA 3HEJA 4OO1I 2OXPA 5FOBB 3MVVA 2WAQB 1EY8A 1ILPA 4XQNA 2OT2A 4TSSA 4WJWA 4DU9A 3PUYA 1DZ1A 3M7NA 3LWEA 4TRDA 2PNRC 3T16A 3DUZA 1PMRA 4F87A 1STGA 2RDHA 2K5QA 4EVOA 2MJ8A 2F0OA 5D65A 2L9HA 2LS01 5ELFA 2AUJD 1MI2A 4PMCA 1LTRD 5FLXE 5DEHA 2HDLA 3F2UA 2EOTA 1SNOA 1S5DD 2KCNA 4EQOA 1XXGA 5JEAH 3H09A 4NKLA 1SNQA 3MC0B 2Z8LA 4KHVA 2PZWA 4K6LA 5KIXA 1B9NA 4KJOA 1EY0A 5C0XH 2AQ2B 3I72A 1B9MA 3IL8A 1SYGA 4KV6A 2IT1A 1KDCA 5E4WC 1CK1A 4DAPA 1GUWA 3QB3A 3AU7A 3R93A 1SDFA 1V8QA 2EYPA 4KTAA 2AUKA 3MFGA 1WTWA 3SR1A 1EYDA 1PTOD 3GTPB 3SHLA 1DYQA 2M9VA 1PFNA 1MSGA 5EKIA 1BUVT 1F9PA 4CKEA 2MHVA 4FP5D 2NBFA 1JOKA 3A8JE 2R61A 5M3MB 4OHJA 4ZAIA 4K5WA 1SMYC 1J8IA 4HCSA 1EQVA 2EJGC 3MHBA 1EQTA 1QILA 1HA6A 3S2HB 4TKOB 1JORA 2BE5C 2JSOA 1G8ZD 4IN3A 1SXTA 2TSSA 2FMCA 3A8IE 1T5EA 4A3GB 1F9SA 2F0SA 3VA5A 3MZ5A 3HRZC 4G7OC 1LO5D 3WOFA 5T1IA 1KLGD 4IUTA 5ELCA 1HFNA 1F2YA 3S2DB 3BVGA 1UNSA 1A15A 1TT2A 2A68D 1HPCA 2K32A 3ND8A 5KYLA 4XDXA 2CW0C 3KLSA 2X69A 5JPNC 3TP8A 3GTLB 3LWUA 3RUZA 3SK4A 2EZVA 4KN4C 1TWCB 5J22A 1AZPA 2JXMB 1RODA 3C1FA 2YYZA 2KOLA 3CQZB 3SK8A 5CYUA 2MP1A 3NTHA 1XWEA 1Y1WB 3PUWA 1W6KA 3HOVB 1DOLA 1ZXTA 3OMCA 1YNND 4RA8A 4BS9A 1BDOA 4ZYSA 3T4AC 2WP8J 2X6LA 4R9WA 4XXEA 1X32A 4IZ8A 2DN8A 3BDLA 1JWMD 1QB5D 2B2UC 4S3SA 3Q23A 3MXNA 1HHVA 3K5LA 2QF7A 1MSHA 4BWGB 2YU9B 1HUNA 4ZUJA 5COYA 2N88A 1WTXA 4IUUA 1PFMA 2IWHA 1SMYD 2SNMA 4FO2A 4ID6A 2ZT9C 3I4MB 4K2LA 3QIAA 3VYTA 1F2LA 4KHZA 1YNNC 4RWSC 2EY5A 2F0NA 1RCVD 2EPBA 1GUTA 5NUCA 3BYTB 1TR5A 1SE3A 5HURA 3FDTA 1RKNA 2VUMB 4O42A 5CGKA 1IYUA 3GP7A 1NR2A 5C5LA 1I4RA 4FF3A 1CQFA 4DF7A 3R3OA 3MTSA 1XTCD 1FNUA 4V0BA 2F03A 3DMUA 1U4PA 2VNUD 2K01A 1WVLA 4UAIA 2R3ZA 1GUGA 2PO4A 1LTTD 2JEBI 3EROA 3A54A 3I4NB 4CJ1B 5CBEE 1MBYA 2AQ1B 3E6ZX 2K33A 3FVQA 1KNAA 3VA7A 2B8GA 3RLFA 2WB1B 2KQ3A 2PQEA 2RDGA 2BA0A 2LMCB 1IL8A 4DN4M 3I3CA 3A7AB 5G3LD 4RAUC 2F0JA 4P2CB 2NVYB 1E2ZA 5CBAE 1RHPA 3FEWX 3NPPA 4LMQD 4A3EB 1D1IA 1VF7A 1I4XA 5ELBA 1J9OA 1VF5C 1Z47A 2VB3X 5EPLA 2A73B 2RKSA 2EE1A 1LV9A 3OSOA 1A2TA 2A74C 2K04A 4XT1B 5A2QE 3RD4A 4O1NA 3NXWA 1RTOA 4NP5A 2JA5B 1O78A 3D4RA 3SVMA 1D1KA 2JE6I 5FLXL 2EYJA 4X3SA 2IX1A 3K6OA 3VR4A 4IUPA 4CJ2C 3M85A 3M3YB 1HQMC 3QWNA 2I07B 1BCPD 1SSOA 4IALA 4C2MB 2PCFB 4NDXA 4PNYA 4OGQC 4BA1I 1EWCA 2KECA 5KGUA 5EBCA 1QCBD 3OMGA 3PO3B 3PMFA 4ZKBB 2IPKD 5EPJA 1H9SB 4BBRB 3RMHA 1HRJA 4WORA 2RSOA 1GHJA 4RHSA 3I4LA 4DXFA 3TDQA 2WV6D 4K5XA 5CV7A 2RSNA 4IURA 2EDGA 1PLFA 5M5WB 3BDCA 1B53A 2F3VA 1EY4A 4L8JA 2AWNA 3A55A 5I6WA 1AN8A 2EJMA 2RVLA 3X3NA 3A8KE 3D31A 1HTLD 2LY7A 1V43A 1BCPC 2SNSA 2F0MA 5KNCA 3H6MA 4CHTB 4FF1A 1TWGB 5C3WA 3D6WA 2BE5D 1SAPA 2F0IA 2NWGA 5C3XA 2KEDA 4RKBA 4WRDA 2QCPX 2WACA 3AB9A 3NQIA 5I6YA 4RH6A 3GTJB 3GTGB 1TKWB 1SYEA 2R7ZB 4RHRA 5M5XB 1STYA 3MAQA 2BCOA 3G7LA 2Z4IA 4DNRB 2H4OA 3Q6SA 5CV5A 4NMZA 2RQXA 1HUMA 1A6XA 1RTNA 2NVXB 4HMJA 4L63B 4BY7B 1LT4D 3P1HA 3GTKB 1PTOC 1D2BA 2C5CA 1QJOA 4N9PA 3MEHA 4PV1C 2D2CC 4DA2A 4LK1C 1NUCA 3MA2B 5ELDA 1RDPD 5E3FA 1JOQA 5IGEA 3R2TA 1O7LA 2ENBA 2EY6A 1STNA 4KMUC 1KDAA 1SYBA 3I73A 2PYKA 5ISRA 3J81E 3T56B 4DXGA 1LTGD 2NUCA 4L6TB 2J4XA 1CA6A 1IW7D 2E2JB 5EJWA 4DNTB 3DEPA 1HCZA 1I4GA 1SYCA 5F2DA 3VR5A 2PW5A 4ZKCB 1OXXK 5CMDA 3T13A 1E0BA 5IGBA 1JR0D 3K5MA 3H91A 4G7ZC 2NYZD 1WTVA 1DOMA 2K5DA 4KD4A 1GUOA 1JQYD 4F8MA 5AFWA 3ONAB 3HKZB 1MD2D 2KUMA 5BN5A 4M8AA 2A69C 2OEOA 2F0VA 2EYMA 3R2IA 1FYCA 5JVH3 3S1RB 4FYDA 4NW2A 2JP1A 2DY7A 2QKIC 3NTIA 2KEEA 4J6HA 1SE4A 1PRTD 4DK1A 2B2YC 5IGFA 2B2TC 2KHSA 4RGTA 4C3HG 2H1EA 3EFXD 3DWQA 3I91A 2F0DA 3GD7A 1ENFA 2A6EC 5DM73 4QF4A 1LACA 1T5XD 3VYRA 2DNCA 3JAME 1R9TB 3V05A 4DAVA 1H9KA 2E2HB 1F9QA 2JA8B 4Q5VA 2KJXA 2D5DA 5IODA 3CRKC 5M9OA 2SDFA 4CBVA 1Y1VB 4BA2I 4QIWB 1TY0A 5JEAJ 3I70A 4FF2A 1Y8NB 3NBHA 1PTOH 5C4XB 4KKTA 4IFDJ 1HTPA 1IYVA 3CKIB 1GOZA 4KKUA 2B2UA 5KYIA 3DXJC 2N55A 2SEBD 1KABA 4C3JG 3EQLC 4A3KB 2XWBB 4DK0A 2NZ1D 1WTRA 2L5TA 4ZQ3A 3BS1A 3M7GA 1KNEA 2EYHA 3D6CA 5EKLA 1STHA 3FMCA 1DCZA 2PZTA 1ET9A 2E74C 1EU3A 4KJNA 1Y69U 5K36H 5C0XG 1BF4A 2B2VA 1PDQA 4U68A 1GUSA 4ZRZA 1NR4A 2G9DA 3IFTA 5LHY1 1PYWD 3IFDA 3CHBD 2JA6B 2XNAC 3X3MA 5IGDA 4KN7C 2ZXOA 3CRLC 3J7YW 1ILQA 3ITPA 1PZJD 5DM63 1A3UA 1A2UA 1EY5A 2GA4B 4YIJA 3S17B 2VB2X 1VCIA 1QE6A 3S15B 3TMEA 3C46A 3W2DA 1LT3D 4X3TA 1CTMA 4H0LC 3NE5B 4A3FB 3QO2A 1WTQA 4HN7A 4HR7B 1TVXA 3L7ZC 4HAEA 5IIFA 3TZUA 2O4XA 1QNKA 1SYDA 3J80E 3KF8A 1R4PB 1TS3A 5KNDA 1CHQD 3S14B 2KCCA 3VR2A 1ZKOA 2MUYA 3L3OC 1B3AA 4DGZA 1M4VA 3L9AX 2KA7A 1DM0B 2EJFC 3NQTA 2NVQB 1XYIA 2RDFA 3AMUA 3OIPA 4IUQA 2NTTA 5C3EB 2HCIA 4X3KA 1QNUA 3Q0AA 3S1QB 3SK6A 2D9UA 1F77A 3K7AB 4RGNA 3NTKA 5JJZA 3OOCA 4H13C 2FINB 1S5BD 1AZQA 2F4IA 3NWSA 1ML0D 3TBIB 1CM9A 1H9RA 5A2QL 1AFPA 5D3DA 4FF4A 3HOWB 3PUXA 3MXPA 2F0PA 1PZKD 1B1ZA 1Q90A 1YNJD 1QWYA 1PFBA 1U9RA 3NUCA 2A5HA 5D14A 1TS4A 5IOCA 3EJIA 5EPKA 4CJ0B 2J7ZA 2RA4A 2BDNA 2F0UA 2NN6I 1K83B 2G9HD 3HGBA 4K8IA 5FO8B 3SE0A 4C1NI 5JVG3 1BCPF 3ND9A 1Q1EA 1I4HA 5IT9E 1I4QA 3C1EA 3TZDA 3GV6A 4BY1B 2K7VA 1EEFD 1VDZA 4A3MB 4OO1G 1ENCA 2XWJB 4HTHA 1JCKB 3DWPA 4HMIA 3BVMA 2B8FA 5EGTA 1XX8A 4R8IA 1SNDA 1LT6D 1S5CD 4KY5A 2WKDA 5I9PA 2XN9C 1TWAB 3MXGA 1FNWA 4XTCS 1ESFA 5ELEA 4A3IB 1BNZA 3D8GA 3GQBA 1BXTA 2FMMA 4DFAA 2F0LA 1GXDC 3IAYA 3GTOB 2E2IB 4ULLA 4Z9CB 2HCCA 1C4QA 1A3TA 3G6JB 4H44C 1DJRD 2EYFA 2F0QA 1O7YA 1WCMB 1I6HB 2TMPA 1TS2A 3DWAA 4XQJA 3N6RA 3SK5A 2ID0A 4KY6A 3OWFA 2L55A 4ZLTF 4FNFA 1CT1D 1G2TA 4U673 1PRTB 4JK1C 2CHBD 2MGSA 3T51B 3OW7A 2B63B 1LTSD 1AEXA 4G4KA 2IL8A 2B2WC 3E5SA 5EBDA 1MGSA 3KBXA 1FNVA 1EYAA 2SOBA 3NK9A 1KTKA 3U9OA 2BA1A 4Q0FA 4K6DA 3VYSA 2FFKB 3HS0C 1WTPA 2OF1A 4G7HC 2K5WA 1EL0A 1K8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGT A;  5EKK A;  3DMU A;  1STA A;  4KY5 A;  3RUZ A;  3SK4 A;  3QOL A;  1II3 A;  1EY7 A;  1SYE A;  4ZQ3 A;  5J22 A;  4J1M A;  4EQP A;  3QB3 A;  5I9P A;  1JOO A;  2OEO A;  2F0V A;  3C1F A;  2EYH A;  2F0W A;  1STY A;  4QMG A;  2EYM A;  1SNC A;  3ERO A;  1NSN S;  3D6C A;  5EKL A;  3SK6 A;  2EYP A;  4IAL A;  3V2T A;  4ZUI A;  1STH A;  4KTA A;  4NDX A;  3LX0 A;  3TP5 A;  2F0E A;  2PZT A;  3SK8 A;  5C6A A;  4PNY A;  4K14 A;  5IGG A;  4LAA A;  4KY7 A;  5JOB A;  2QDB A;  5KRU A;  4H7B A;  5CV5 A;  3D8G A;  1EYD A;  3EVQ A;  4NMZ A;  3SR1 A;  4KJN A;  3SHL A;  1F2M A;  3HEJ A;  4DFA A;  2LKV A;  1F2Z A;  2OXP A;  1TQO A;  4J6H A;  4HMJ A;  5KGU A;  2F0L A;  3MVV A;  2KQ3 A;  2EY2 A;  3OMC A;  3P1H A;  1EY8 A;  2PQE A;  1EY9 A;  3P75 A;  1EY6 A;  5I9O A;  3OMG A;  5CV8 A;  5IGF A;  2M00 A;  1JOK A;  5IGD A;  2KHS A;  3NP8 A;  1SNM A;  1SYF A;  2F0P A;  3MXP A;  3PMF A;  2F0T A;  4N9P A;  1A3T A;  3MEH A;  4F7X A;  5JAV A;  5C5M A;  4DU9 A;  5K5P A;  2EYF A;  3SXH A;  2EXZ A;  2F0Q A;  4TRD A;  2F0D A;  4K5W A;  4K5V A;  5J39 A;  3T16 A;  2F0J A;  2HQE A;  3ITP A;  1EQV A;  1NUC A;  4I65 A;  4B9X A;  1U9R A;  3NUC A;  3MHB A;  4IZ8 A;  1A3U A;  5CV4 A;  1A2U A;  4QF4 A;  1EZ8 A;  3BDL A;  5E3F A;  1EY5 A;  1JOQ A;  3SK5 A;  4WOR A;  5CV9 A;  5IGE A;  1STG A;  1EYC A;  3TP6 A;  5C4H A;  4RKL A;  4KY6 A;  5C4Z A;  5IOC A;  3D4D A;  5IGC A;  3OWF A;  4YIJ A;  3EJI A;  4S3S A;  4EVO A;  2F0O A;  4E6I A;  4OL7 A;  4K5X A;  1JOR A;  2EYO A;  2ENB A;  2PW7 A;  2F0K A;  2EY6 A;  2F0U A;  1STN A;  3TME A;  1KDA A;  1SYB A;  5CV7 A;  4ZUJ A;  4PMB A;  5C3X A;  4G57 A;  4PMC A;  2PYK A;  2RBM A;  3HZX A;  3QOJ A;  4K8I A;  5ISR A;  5CR3 A;  5DEH A;  2EYL A;  1IHZ A;  1A3V A;  3BDC A;  4ME5 A;  2SNM A;  2NUC A;  3NHH A;  2F3V A;  1KDB A;  1EY4 A;  1SNO A;  2RKS A;  4ID6 A;  5IOD A;  2F0S A;  2F0F A;  5M9O A;  3OSO A;  1A2T A;  4QB4 A;  4K2L A;  3C1E A;  2PZU A;  3VA5 A;  5I6W A;  3MZ5 A;  1AEX A;  2F0G A;  4EQO A;  1SYC A;  5E1F A;  5IIF A;  5F2D A;  1EZ6 A;  4ODG A;  2O4X A;  3E5S A;  3NXW A;  4KD3 A;  5DAU A;  4NKL A;  5J1Z A;  2PW5 A;  1ENA A;  4K8J A;  1SYD A;  2EY5 A;  1SNQ A;  2F0N A;  4IUN A;  5KEE A;  1STB A;  4B9W A;  3T13 A;  1F2Y A;  3D4W A;  5IGB A;  5NUC A;  4EQN A;  4KHV A;  2PZW A;  3DHQ A;  1TR5 A;  4K2K A;  1EYA A;  2SOB A;  3NK9 A;  2SNS A;  5CV6 A;  3U9O A;  4KJO A;  5KIX A;  3ERQ A;  5HUR A;  2F0M A;  1EY0 A;  1ENC A;  1TT2 A;  1RKN A;  4HTH A;  4K6D A;  5CGK A;  3H6M A;  4DGZ A;  1KAA A;  3TP7 A;  4N9T A;  5KYL A;  2F3W A;  4HMI A;  4NP5 A;  5C3W A;  5CC4 A;  5KYI A;  5C5L A;  3NQT A;  2F0I A;  2OF1 A;  4DF7 A;  2EY1 A;  2F0H A;  1SYG A;  1KAB A;  4KD4 A;  4KV6 A;  4MIU A;  2EYJ A;  4R8N A;  4RKB A;  5EGT A;  4F8M A;  2RDF A;  3R3O A;  4WRD A;  1SND A;  1KDC A;  3S9W A;  2WAC A;  1SNP A;  5I6Y A;  3TP8 A; 
#chains in the Genus database with same CATH topology
 4FXD A;  1STA A;  3QOL A;  1II3 A;  3ZYY X;  4Y7N B;  1IW7 C;  4J1M A;  1KC8 C;  1JOO A;  1TII D;  2CQA A;  2NVY H;  2F0W A;  2NN6 G;  5IWA Q;  3V2T A;  1V1Q A;  3V96 A;  3U9S A;  4HID A;  2DY8 A;  3HP3 A;  4JBW A;  2B2V C;  2C9O A;  3OYY A;  4LF9 Q;  3N52 A;  3J81 i;  1U5K A;  1FD7 D;  1Z9F A;  1VMP A;  3HOX B;  4GZY C;  2K05 A;  1B3Q A;  4CGY B;  2R93 H;  5C0X I;  2M00 A;  1LAB A;  1UAP A;  1G29 1;  4KI0 A;  5FJ8 H;  5K5P A;  2XIW A;  1IKL A;  3UDG A;  4K5V A;  2JEA I;  5E4X A;  4DV7 L;  5LL6 X;  2QA4 A;  4I65 A;  2E2I H;  4XQQ A;  4RCO A;  3A7L A;  4JV5 Q;  4MN3 A;  5CV9 A;  5C4H A;  5JAV A;  1YIJ A;  3OWE B;  3M4P A;  1Q8I A;  4EX5 A;  1UEB A;  1C8C A;  2F0K A;  3BZK A;  3J7A V;  1PZI D;  2F1M A;  5FK9 C;  2RBM A;  4EGV A;  1VQK A;  3LGJ A;  4FDB A;  1V1P B;  2C35 B;  1HNX Q;  4JBJ A;  2ATW A;  4JI2 Q;  4X65 Q;  2F0F A;  2KVM A;  3HKS A;  3KF6 A;  2ICE C;  4JI8 Q;  4POF A;  2L0C A;  2F0G A;  5E1F A;  5IP9 G;  1ZYR C;  4DV5 Q;  1B8A A;  2BOS A;  5DAU A;  2XRQ D;  2Y0S G;  3KBG A;  1WYD A;  2XRS D;  3PIO 3;  3GTQ B;  4BBS B;  3D4W A;  5G3L F;  3KOJ A;  4LF6 Q;  1X3F A;  2UUC L;  5BR8 Q;  1BR9 A;  1OXS C;  5C4J H;  1G91 A;  2CQO A;  3A56 A;  1HXY D;  3H3V I;  5JJI A;  2R6G A;  4C56 C;  5CC4 A;  2LFN A;  5ELN A;  3P20 A;  4MIU A;  3OPO A;  4HIM A;  1D6E C;  3QJY A;  1IBM L;  1H95 A;  3S9W A;  4GN4 B;  4I7A A;  4LFA Q;  5HGT A;  1KLU D;  2QW7 A;  1AE3 A;  1KIX A;  1G2S A;  3S16 B;  1XMO L;  3I4O A;  1QUQ A;  1M1K C;  2IY5 B;  2F0E A;  1EWH A;  3NWT A;  3S14 H;  1G51 A;  1GKH A;  4K14 A;  2A6H C;  3T1Y L;  4LUZ A;  4J8Q A;  4H7B A;  1Q12 A;  1CZW A;  2UUB L;  5M5Y B;  1FJG L;  2LKV A;  5JJK A;  3HG9 A;  1IYJ B;  4A3G H;  2UXC Q;  2QEJ C;  4A3F H;  4DV2 L;  2UXD L;  4CKC A;  1EY9 A;  4GOP C;  3SEB A;  3GV3 A;  3FKI B;  4DK3 C;  2F0T A;  1IBK L;  4KK7 A;  5IP7 G;  5EQ0 A;  1AW7 A;  4PQX A;  1E1T A;  1CI3 M;  2AHO B;  4DV5 L;  4B9X A;  2AMC B;  1D5Z C;  4JYA L;  4POG A;  4OWW B;  1B70 B;  1JJ2 A;  1QVF A;  2O2L D;  4JC0 A;  4CDF C;  1HNX L;  5HGQ A;  2IW3 A;  2AQ3 B;  3JAM c;  4YWL A;  4XYO A;  5GAD C;  4A3J B;  2V1C C;  5CR3 A;  2JA8 G;  4PZ6 A;  1SFO H;  2NVT B;  5JPM C;  1RF2 D;  2B2W A;  3M4Y A;  2VZA A;  4IFD I;  2Z4H A;  3NHH A;  3JAM i;  5I2Y A;  2WKC A;  2D0O A;  2OWO A;  1ONL A;  3STB C;  4ODG A;  2L12 A;  1KRS A;  2I46 A;  1I50 B;  5J1Z A;  3E3X A;  3I8Z A;  4LF7 L;  1NBW A;  1LT5 D;  3CF5 A;  2UU9 L;  5BN4 A;  4DR4 L;  1JE4 A;  3DHQ A;  3KUP A;  1D7Q A;  1YNX A;  2XVS A;  2XSC A;  1HNW Q;  3WOE A;  1VQA A;  1MKH A;  1H9S A;  1JB3 A;  2F3W A;  1KD1 C;  2JA7 B;  1Q46 A;  1SLJ A;  4A3B B;  2D62 A;  4R8N A;  4GS3 A;  2WAQ E;  3W5O A;  3J7A F;  5FO9 B;  4C3J B;  1QZG A;  3HOU G;  2JA5 H;  4YHH L;  4IPG A;  4EQP A;  1M8A A;  4ABN A;  1O7Z A;  2PMZ E;  4UPA A;  3HOU H;  4Y7N H;  1SNC A;  2ZJR A;  2N8N A;  4X62 Q;  3J7Z C;  3J80 L;  5C6A A;  2Q8T A;  3SDZ A;  2O5J C;  1I3Q B;  4GLV B;  1E22 A;  1ICF B;  1CHP D;  1F2Z A;  1HR0 L;  1BOS A;  3URY A;  1LTI D;  1S5F D;  3G48 A;  4AQY L;  2K1B A;  1IBM Q;  3HOX G;  5CV8 A;  2NVQ H;  4DAY A;  1E1O A;  5C44 G;  5TSS A;  2AWO A;  4YY3 L;  2IX3 A;  5IT9 c;  1JB7 A;  1V1P A;  3K5N A;  4OX9 Q;  1OXT A;  3SXH A;  2AKW B;  1WOC A;  2WIN B;  5J39 A;  2Y0S B;  1CQV A;  1SBB B;  1DXM A;  4JOI C;  2Z1C A;  1B50 A;  1DOK A;  1JC7 A;  3RZO B;  1K8O A;  4UDU C;  4RKL A;  4N8X 1;  3CPF A;  3TS2 A;  4OL7 A;  2O5I C;  3H0G B;  1VMC A;  2WII B;  2ZXR A;  2PW7 A;  1R4Q B;  2IJ0 A;  3R8B A;  1B2T A;  5JEA G;  1VQP A;  1V1O A;  4RCN A;  3NEL A;  3C3L A;  3QOJ A;  1QVG A;  1VQI A;  1J6Q A;  3K58 A;  1A3V A;  1GJX A;  3HOY B;  2IX0 A;  1NCV A;  1SE2 A;  2PZU A;  4C3H B;  3H3V C;  1WCM H;  4WFN 3;  1ZYR D;  3Q24 A;  1S4Z A;  4KD3 A;  2Q8R E;  2RCF A;  4OO1 H;  1G6P A;  5BN3 A;  5D3I B;  2OQ0 A;  2V4D A;  4K2K A;  2I5M X;  1GHK A;  1STE A;  3DEO A;  1CA5 A;  1PRT C;  1VQO A;  4HJA A;  1XTD A;  2DUD A;  4V19 0;  1XMQ Q;  2L4N A;  1JIC A;  1BO0 A;  1K8M A;  1I94 L;  4A3L G;  2VQE Q;  2EY1 A;  4DV1 L;  4DV6 Q;  5L37 A;  1I3Q H;  2R93 B;  3P7J A;  1SMX A;  2B63 H;  2QIL A;  1MHW C;  3OHX C;  2K03 A;  5FLM G;  4IFD H;  2A6E D;  1EY7 A;  2E75 C;  1JT8 A;  4C3I B;  2JA8 H;  1QOH A;  1E3P A;  4YY3 Q;  4QMG A;  1K9M C;  3KLS X;  1L0Y B;  1W6J A;  4ALP A;  3QG1 A;  4QGU A;  1XNR L;  2OQK A;  1RD9 D;  1TS5 A;  1CFM A;  2QDB A;  2YTX A;  3EIV A;  3EVQ A;  1PA6 A;  3H0G H;  3PUV A;  2NZO A;  1ZEQ X;  2ZTC A;  3S1N B;  1U0L A;  2KCM A;  1SRO A;  1LTA D;  1TQO A;  1BCP B;  3S1N H;  3K5O A;  1EY6 A;  5I9O A;  4IO9 A;  2GVA A;  2A1A A;  1EIG A;  3HOW G;  1SYF A;  3TN2 A;  2G5D A;  3UDX A;  3O13 A;  3BJU A;  4PMW A;  1UEA B;  2Q8I B;  2L11 A;  1Q1B A;  5T1G A;  1QUQ B;  4RMF A;  4ZK9 B;  3GTM B;  5CV4 A;  4EQ5 A;  4B3S L;  1Y8P B;  3I90 A;  3K59 A;  5C4Z A;  4TQU S;  4IQZ A;  4RGM A;  4E6I A;  1TU2 B;  3BYY B;  1ESR A;  1WD1 A;  1Q3L A;  4PMB A;  3PIP 3;  4A3D B;  2E5L L;  5I4D A;  4R4I A;  4DR4 Q;  1X3Q A;  1YZ6 A;  3CCJ A;  3AQQ A;  5EAY A;  3HOU B;  2EYL A;  1HFG A;  5M3F B;  1IHZ A;  5IYB G;  1TWA H;  3HOZ B;  1VQF A;  1KDB A;  4YCW A;  1OO9 B;  3MXU A;  4BY7 H;  3C2P A;  1NAP A;  1HQR D;  3MWY W;  5H1S E;  3J81 c;  1PYB A;  1JMC A;  3CCL A;  4C1N K;  1H9M A;  4BY1 G;  3CPW A;  4UHV A;  3H3V H;  4A3B H;  2PI2 E;  4K8J A;  4A76 A;  3ULJ A;  4R4Q A;  5KEE A;  4B9W A;  4DV1 Q;  4DV6 L;  4UP9 A;  5CV6 A;  2K6A A;  3K7U C;  2B39 A;  3ERQ A;  2CWA A;  3OIQ A;  4GNX C;  4DUY Q;  3BG3 A;  2EIF A;  3TP7 A;  2BDO A;  4QCL A;  1EEI D;  4J15 A;  4LFC L;  3W3A A;  4DUZ L;  3CCM A;  1U4R A;  2EVB A;  3D3R A;  4X66 L;  4QL5 A;  3E0E A;  5IYD G;  1E2W A;  1FL0 A;  2NTS A;  1GUN A;  1L0X B;  2DJG C;  1PTO F;  3CU7 A;  4XYQ A;  1UUP A;  4LJZ C;  3BZD B;  3LNN A;  3BVZ A;  4XIG S;  4AYB B;  5KNB A;  1SJE D;  1SFO B;  4JBM A;  5C3E H;  5K36 G;  3TP5 A;  4R4C A;  2HDM A;  1K83 H;  3CCE A;  3FPU B;  3BDO A;  2BH2 A;  4LAA A;  4FVM A;  5JOB A;  3CCV A;  5A35 A;  4JI3 L;  4UY8 C;  2GN5 A;  1WD0 A;  4LWC A;  4OIJ A;  3RN2 A;  4X3U A;  4FXK C;  3FRP B;  4GOP B;  5C4J B;  3I55 A;  5C44 B;  5I2X A;  4A3F G;  1E2V A;  2B2T A;  3ULL A;  4F7X A;  3PGZ A;  3PUZ A;  1MJC A;  1EFI D;  2R92 B;  3PV0 A;  3T53 B;  1CZG A;  1VQG A;  2M2L A;  1JWU D;  4IUV A;  1I6V C;  3Q8D A;  2ZXP A;  1VQH A;  3GO5 A;  3TP6 A;  4A3E G;  1PVO A;  5IGC A;  5GRO A;  4RGO S;  3IRB A;  4DR7 Q;  2JA7 H;  4M1U B;  2A6H D;  4R4T A;  2QGQ A;  1EFW A;  3KK7 A;  5LL6 S;  1Q86 C;  2UUC Q;  2J0T D;  3DM1 A;  3VR3 A;  3HZX A;  2R7Z H;  1I4P A;  1CSP A;  3PSI A;  3K57 A;  1B44 D;  1P16 A;  1LLR D;  2R7Z G;  4QB4 A;  3S1M B;  1EU4 A;  1G6Z A;  4B08 A;  3PO2 B;  3GTP H;  3WDN A;  4HIO A;  1D5X C;  1HA5 A;  2E76 C;  1TWG H;  3K8A A;  3PO2 H;  5COR A;  2A68 C;  4IUN A;  2NVT H;  4UP8 A;  1PH8 A;  4IPD A;  2PPB C;  1D5M C;  2F52 A;  4HED A;  3NSW A;  4HSP A;  3UDF A;  1P8L A;  4JI7 Q;  1RJT A;  1KAA A;  3CCS A;  1LTB D;  1S40 A;  3J81 L;  1AP0 A;  3JAM L;  2F0H A;  5DNF A;  4QUF A;  3AEV A;  2VXW A;  1J5E L;  2UU9 Q;  3RZD B;  5C0X J;  2D0P A;  1TWF B;  1EIH A;  1ET6 A;  2ZTD A;  5EKK A;  2XTI A;  2HD3 A;  2NVX H;  1SEB D;  4ZCK A;  3HOZ G;  4L5S A;  4C3I G;  1QG7 A;  2CW0 D;  3M9B A;  4HCE A;  4QUC A;  4HSV A;  3CC7 A;  3K0Y A;  3NBI A;  1NSN S;  5FLM H;  4IFD G;  2JYO A;  5IGG A;  1O80 A;  4ZUI A;  1N36 Q;  2B2Y A;  1YNJ C;  3LX0 A;  3FPP A;  4RG1 A;  4KY7 A;  2NB0 A;  3S17 H;  1PRT F;  2ICI A;  4OON A;  2Q2H A;  4KKS A;  1Z6H A;  1F2M A;  4A3D G;  2MPM A;  5FO7 B;  3EA6 A;  1DD2 A;  4BY7 G;  2EY2 A;  5M5Y H;  1TWH B;  3P75 A;  1FGB D;  3ZJY C;  5C4X H;  2HUG A;  4MTK A;  3KLR A;  1Y8O B;  3NP8 A;  1SNM A;  3M4O B;  1Z7T A;  1X3E A;  2CFM A;  5C5M A;  4XT3 B;  2EXZ A;  3MFY A;  3UE1 A;  4F88 A;  1NMF A;  3S16 H;  1WTO A;  2HQE A;  1JWS D;  4A93 B;  1DON A;  3RNU A;  1EZ8 A;  1IKM A;  2E2D C;  1QZH A;  4FXG C;  1EYC A;  1KAW A;  1TY2 A;  3E0J A;  3D4D A;  4P72 A;  1FR3 A;  3UI2 A;  4DUY L;  4LNQ A;  1HNW L;  2EYO A;  3Q22 A;  2A69 D;  4JW0 A;  1BQQ T;  3NBH B;  1XNQ L;  1X3P A;  4G57 A;  4I7Z C;  4LF7 Q;  1CKN A;  1S5E D;  1U4L A;  4BBS H;  5M3F G;  4ME5 A;  3TEH B;  1B4O A;  4HIK A;  2L1B A;  1K3R A;  2DNE A;  4A3K H;  3VYU A;  3H94 A;  1OXU A;  2K28 A;  1EZ6 A;  5IT9 L;  1OXV A;  3U50 C;  1ENA A;  2ZM6 Q;  1Q8K A;  1IBL Q;  3OTO L;  1EOV A;  1STB A;  2FJ2 A;  4EQN A;  1S72 A;  1KL9 A;  2CVR A;  1U4M A;  1ASZ A;  4WJ4 A;  1PTO B;  3TSS A;  3IKJ A;  1SJH D;  1C9O A;  5IYC G;  4MHE A;  4N9T A;  1X3G A;  4ILW A;  4R4O A;  1H9J A;  2OCE A;  4A3I H;  1EOT A;  1F9R A;  1L1O A;  5AJ3 Q;  4CKB A;  1LM0 A;  3U4V A;  1BBX C;  2DJF C;  4X66 Q;  1PXU A;  1IBK Q;  2X6G A;  1NJI C;  4P75 A;  2FHT A;  2UXB Q;  1C48 A;  4OIK A;  2B63 G;  3VR6 A;  1ICW A;  4DV2 Q;  4CDE C;  3T1H L;  2PMZ B;  2E2H H;  5KRU A;  2UXC L;  3F2D A;  5FJ8 G;  2NN6 H;  5FKA C;  4RFB A;  2F4V Q;  3SGI A;  3HEJ A;  4OO1 I;  2UUB Q;  2K50 A;  5GAG C;  2OXP A;  5IYC H;  4JI0 L;  1WTH A;  4DK6 C;  5FOB B;  3MVV A;  3I4M H;  2WAQ B;  1EY8 A;  3I7F A;  5IY0 A;  4GKJ L;  1ILP A;  4DR6 L;  4XQN A;  1E24 A;  2HQL A;  2OT2 A;  3A0J A;  4TSS A;  4WJW A;  4PZ8 A;  4DU9 A;  3PUY A;  2WB1 E;  1K8G A;  1DZ1 A;  3M7N A;  3LWE A;  4JG2 A;  1A0I A;  2PNR C;  4TRD A;  3T16 A;  3DUZ A;  5LMN L;  4LF6 L;  1PMR A;  4JI4 Q;  2KEN A;  4F87 A;  4LF5 L;  5C4X G;  1STG A;  1UWV A;  3A5U A;  1MIU A;  2E8G A;  2RDH A;  1PH5 A;  2K5Q A;  3G4S A;  4EVO A;  2MJ8 A;  2F0O A;  5D65 A;  4LF4 Q;  2ES2 A;  2L9H A;  2LS0 1;  2MO0 A;  5ELF A;  2AUJ D;  1MI2 A;  4PMC A;  1CUK A;  1VQL A;  1LTR D;  5FLX E;  4OWT B;  5DEH A;  2HDL A;  4A3K G;  3F2U A;  2IHE A;  4NXM Q;  2EOT A;  1SNO A;  1BBW A;  1VQJ A;  1S5D D;  2KCN A;  2GVB A;  1VQ8 A;  3CD6 A;  4EQO A;  3G71 A;  1XXG A;  5JEA H;  1M90 C;  3H09 A;  4NKL A;  1R9T H;  4B3R Q;  1SNQ A;  2VUM H;  1C0A A;  4BBS G;  3MC0 B;  2Z8L A;  1PH1 A;  4KHV A;  4K6L A;  2PZW A;  2PQA A;  3GDE A;  5KIX A;  1B9N A;  4KJO A;  1EY0 A;  4JPB W;  5DLQ E;  2VUM G;  5C0X H;  1XNR Q;  2AQ2 B;  3I72 A;  1YIT A;  2JA7 G;  1B9M A;  3IL8 A;  1YJ9 A;  1SYG A;  4KV6 A;  2IT1 A;  4JI1 Q;  1KDC A;  2KBN A;  5E4W C;  1CK1 A;  3L2P A;  3F8T A;  4DAP A;  1EQR A;  3S1Q H;  3ERS X;  1GUW A;  3QB3 A;  3RN5 A;  1JJG A;  3MXN B;  1K73 C;  3AU7 A;  1I94 Q;  1SDF A;  3R93 A;  1GM5 A;  1V8Q A;  2EYP A;  4KTA A;  2AUK A;  3S2D H;  3MFG A;  1Q7Y C;  1WTW A;  2A19 A;  3I4N H;  3SR1 A;  1EYD A;  1PTO D;  3GTP B;  2CCZ A;  3SHL A;  1DYQ A;  1W2B A;  1HZ9 A;  2M9V A;  1PFN A;  1MSG A;  5EKI A;  1BUV T;  1F9P A;  4CKE A;  3NEM A;  3F2B A;  1SRU A;  2MHV A;  2ZTE A;  4FP5 D;  4A3J H;  2NBF A;  1JOK A;  4X6A H;  4AH6 A;  3A8J E;  2R61 A;  2Z6K C;  5M3M B;  2K4K A;  4OHJ A;  4ZAI A;  4DV4 Q;  4K5W A;  1XPO A;  1SMY C;  1J8I A;  4HCS A;  1EQV A;  2EJG C;  4NB3 A;  3MHB A;  4A93 G;  1EQT A;  1QIL A;  4QIW E;  5JJL A;  5LMN W;  1Y1W H;  1HA6 A;  3S2H B;  4TKO B;  1JOR A;  2BE5 C;  2JSO A;  1G8Z D;  4IN3 A;  1SXT A;  4JI4 L;  2TSS A;  3KLW A;  3S15 H;  4LFB Q;  2Z6B A;  2FMC A;  1PH4 A;  3A8I E;  2MO1 A;  1T5E A;  4A3G B;  1F9S A;  2F0S A;  4BY1 H;  3VA5 A;  2HIV A;  3MZ5 A;  2HT1 A;  3HRZ C;  4G7O C;  1LO5 D;  2H5X A;  3WOF A;  5T1I A;  1KLG D;  4IUT A;  5ELC A;  1HR0 Q;  1HFN A;  1F2Y A;  3S2D B;  2K5N A;  3BVG A;  3K80 C;  3U58 A;  1UNS A;  1A15 A;  3B6Y A;  1TT2 A;  3FP9 A;  2WFW A;  3CME A;  2A68 D;  1HPC A;  4APV A;  2K32 A;  3ND8 A;  5KYL A;  3CCR A;  2VQF Q;  4XDX A;  4JI0 Q;  4H02 A;  2CW0 C;  2EQS A;  3GTK H;  3KLS A;  4NXM L;  2X69 A;  4MZ9 A;  3TP8 A;  5JPN C;  3GTL B;  3LWU A;  3RUZ A;  3SK4 A;  1Q82 C;  2EZV A;  1EIF A;  2JQO A;  1GD7 A;  4KN4 C;  1TWC B;  4IOC A;  5J22 A;  3A74 A;  1AZP A;  2JXM B;  1ROD A;  3C1F A;  2YYZ A;  2KOL A;  3CQZ B;  3SK8 A;  5CYU A;  2MP1 A;  1SN8 A;  3NTH A;  1XWE A;  1Y1W B;  3CW2 C;  4DNI A;  1VQC A;  3PUW A;  1W6K A;  1IBL L;  3HOV B;  1DOL A;  3STB D;  1ZXT A;  3OMC A;  1YNN D;  4OEL B;  2WAQ G;  4RA8 A;  4GNX B;  3S24 A;  4BS9 A;  1BDO A;  4ZYS A;  3T4A C;  2WP8 J;  4DR6 Q;  3K7A H;  1PH7 A;  2X6L A;  4R9W A;  4XXE A;  1N34 L;  4L5R C;  3PO3 H;  4O2D A;  4DAY B;  1X32 A;  3CC2 A;  1Y1V H;  4IZ8 A;  2DN8 A;  3BDL A;  1JWM D;  3PF4 A;  1QB5 D;  3UE0 A;  2B2U C;  2QDL A;  4A3M G;  3T1H Q;  3CXC A;  4S3S A;  1HR0 W;  1GO3 E;  3Q23 A;  3MXN A;  1HHV A;  3K5L A;  2QF7 A;  5IE8 A;  1MSH A;  4BWG B;  1XNQ Q;  2YU9 B;  4C2M H;  4IPH A;  1HUN A;  4ZUJ A;  5COY A;  2N88 A;  1WTX A;  4IUU A;  1PFM A;  2LXJ A;  2IWH A;  3GTQ H;  1BVS A;  1SMY D;  1E7Z A;  2SNM A;  4FO2 A;  4ID6 A;  2ZT9 C;  3I4M B;  3PO3 G;  4K2L A;  3QIA A;  1VQ6 A;  3RLO A;  3VYT A;  5E7N A;  1F2L A;  1BBU A;  3TS0 A;  4KHZ A;  3E9H A;  1YNN C;  4RWS C;  2EY5 A;  2F0N A;  1RCV D;  2EPB A;  1GUT A;  5NUC A;  3M4Q A;  3BYT B;  1TR5 A;  2ZM6 L;  1SE3 A;  5HUR A;  3FDT A;  1RKN A;  2VUM B;  3UDI A;  4O42 A;  5CGK A;  2BH8 A;  5IP9 H;  3PF5 A;  1IYU A;  3GP7 A;  1NR2 A;  4DR5 L;  5C5L A;  1I4R A;  1C7Y A;  4FF3 A;  1CQF A;  4DF7 A;  3R3O A;  4JI6 L;  3MTS A;  1XTC D;  1FNU A;  4V0B A;  2F03 A;  4JI1 L;  3DMU A;  1U4P A;  1Y14 B;  3J80 i;  2RF4 A;  3FHW A;  2VNU D;  2K01 A;  1WVL A;  4UAI A;  4NPS A;  1N36 L;  1J5E Q;  2R3Z A;  4A3G G;  1GUG A;  2PO4 A;  1LTT D;  2JEB I;  4IOA A;  3ERO A;  3A54 A;  4AYB E;  3I4N B;  1S3O A;  2EXD A;  4CJ1 B;  4JCV E;  4A3C H;  4GLA C;  4OEM B;  5CBE E;  2LSS A;  1MBY A;  2AQ1 B;  3HOX H;  1X56 A;  3E6Z X;  2K33 A;  3FVQ A;  1KNA A;  3VA7 A;  2B8G A;  3RLF A;  4A4I A;  2WB1 B;  2KQ3 A;  3HOY G;  4X62 L;  2PQE A;  2RDG A;  2BA0 A;  2LMC B;  1IL8 A;  4DN4 M;  3DM3 A;  1K3B C;  3I3C A;  3A7A B;  5M3M G;  1PYS B;  5G3L D;  4RAU C;  2VW9 A;  1YHB A;  2B3G A;  2F0J A;  4P2C B;  2NVY B;  3CCU A;  3RZO H;  1E2Z A;  3QR8 A;  4P71 A;  3DLL A;  1UE6 A;  5CBA E;  1RHP A;  3FEW X;  3NPP A;  4LMQ D;  4A3E B;  4DV3 L;  1D1I A;  4DR1 L;  2JK8 A;  1VF7 A;  1WJJ A;  1FVI A;  1Y1W G;  1I4X A;  1CKM A;  4P73 A;  5ELB A;  2MFI A;  1J9O A;  1VF5 C;  1Z47 A;  2VB3 X;  2YTY A;  2HHH Q;  2JJQ A;  5EPL A;  1VQE A;  2A73 B;  1LTL A;  2RKS A;  1EQQ A;  2EE1 A;  1EWI A;  1LV9 A;  1A2T A;  2A74 C;  3OSO A;  4DR5 Q;  2K04 A;  2L15 A;  1IL2 A;  4XT1 B;  5A2Q E;  3RD4 A;  4B3T Q;  4O1N A;  3NXW A;  5HY6 A;  2RCN A;  1RTO A;  2F4V L;  2N49 A;  1RIP A;  4GOP A;  4JI3 Q;  3U4Z A;  3HOY H;  3HOV H;  4C3J H;  2K5V A;  5IWA L;  4NP5 A;  1XPR A;  1EUJ A;  2JA5 B;  1O78 A;  3D4R A;  3SVM A;  1D1K A;  2JE6 I;  5FLX L;  2EYJ A;  4X3S A;  3PQI A;  3VDY A;  2IX1 A;  3K6O A;  3VR4 A;  3KF6 B;  4IUP A;  4CJ2 C;  3M85 A;  3M3Y B;  1HQM C;  4AIM A;  4A3M H;  3QWN A;  2UUA Q;  2I07 B;  1CSQ A;  1BCP D;  1SSO A;  4IAL A;  4C2M B;  2PCF B;  4NDX A;  4PNY A;  4OGQ C;  4BA1 I;  1EWC A;  2Q2U A;  2KEC A;  4YWM A;  3J81 j;  1N33 Q;  4X64 Q;  5KGU A;  5EBC A;  1QCB D;  1PH2 A;  1N34 Q;  3OMG A;  1X6O A;  3PO3 B;  3PMF A;  4ZKB B;  2IPK D;  1YI2 A;  4HJ5 A;  5EPJ A;  1TXY A;  2HIX A;  3M4O H;  1HNZ L;  1H9S B;  4GKK Q;  4BBR B;  1VS0 A;  2KHJ A;  2E5L Q;  3RMH A;  3K81 C;  1HRJ A;  4WOR A;  2RSO A;  1GHJ A;  4RHS A;  3I4L A;  3I4N G;  4DXF A;  3TDQ A;  2WV6 D;  4K5X A;  2R92 H;  5CV7 A;  2RSN A;  3ULP A;  2B29 A;  1K28 A;  4IUR A;  3FKI H;  2EDG A;  1PLF A;  5M5W B;  3BDC A;  1B53 A;  4DUZ Q;  4LF8 Q;  2F3V A;  4LFC Q;  1EY4 A;  3GTL H;  1YJN A;  4L8J A;  3GTJ H;  3GTG H;  2AWN A;  3FKI G;  4X65 L;  4JI2 L;  2VQF L;  3A55 A;  5I6W A;  1AN8 A;  2EJM A;  4BBR H;  2RVL A;  3X3N A;  3A8K E;  3D31 A;  1HTL D;  1AH9 A;  2LY7 A;  1V43 A;  5GAE C;  1BCP C;  3T1Y Q;  2SNS A;  5J3B A;  2F0M A;  5KNC A;  1N32 L;  5LMU L;  1FGU A;  1K0S A;  3H6M A;  4CHT B;  3I2Z A;  1X54 A;  4FF1 A;  1TWG B;  5C3W A;  1LUZ A;  3D6W A;  2BE5 D;  1SAP A;  2F0I A;  1WFQ A;  2NWG A;  5C3X A;  2KED A;  4RKB A;  1NNX A;  4WRD A;  3S1M H;  4B3M Q;  2QCP X;  2WAC A;  3AB9 A;  3NQI A;  5I6Y A;  4RH6 A;  4DV0 Q;  3GTJ B;  3GTG B;  1TKW B;  5C3E G;  1SYE A;  1YBY A;  2R7Z B;  4DPG A;  5M5W H;  4Y52 H;  4RHR A;  5M5X B;  1STY A;  2BCO A;  3G7L A;  3MAQ A;  4JI7 L;  1KQS A;  3CCQ A;  2Z4I A;  4DNR B;  1D8L A;  2H4O A;  3Q6S A;  5CV5 A;  4NMZ A;  2RQX A;  1HUM A;  3RR5 A;  1TWC H;  1A6X A;  1RTN A;  2NVX B;  4HMJ A;  1XMQ L;  4L63 B;  4BY7 B;  1LT4 D;  1VQ7 A;  3P1H A;  1IXR A;  1NTG A;  1XPU A;  3GTK B;  2A8V A;  1PTO C;  5M3F H;  1D2B A;  2C5C A;  1QJO A;  4N9P A;  3MEH A;  1Q81 C;  3KJP A;  5M5X H;  2PNH A;  4PV1 C;  5C44 H;  2D2C C;  1QVC A;  4DA2 A;  4LK1 C;  1NUC A;  3MA2 B;  5ELD A;  1RDP D;  5E3F A;  1JOQ A;  5IGE A;  3R2T A;  1CKO A;  1LYL A;  4JI5 L;  4DR3 L;  1O7L A;  3KJO A;  4YWK A;  2ENB A;  2EY6 A;  1STN A;  3F1Z A;  4KMU C;  1KDA A;  1SYB A;  2K75 A;  3I73 A;  4DV7 Q;  2PYK A;  5ISR A;  3J81 E;  3T56 B;  4DXG A;  4A3E H;  1LTG D;  2NUC A;  4OX9 L;  4L6T B;  2J4X A;  1CA6 A;  1IW7 D;  2E2J B;  5EJW A;  4DNT B;  2JA6 G;  3I4M G;  2Q2T A;  3DEP A;  1HCZ A;  1I4G A;  4DR3 Q;  1SYC A;  4IJL A;  4L5T A;  5F2D A;  5LMN Q;  4DV0 L;  3CP0 A;  3VR5 A;  1WI5 A;  2PW5 A;  4ZKC B;  1X55 A;  1OXX K;  5CMD A;  3T13 A;  1E0B A;  5IGB A;  1JR0 D;  5IYD H;  3K5M A;  1KXL A;  4DV4 L;  4JOI A;  3H91 A;  4G7Z C;  2NYZ D;  1WTV A;  1YVC A;  1I5F A;  4A3B G;  1DOM A;  2K5D A;  4KD4 A;  1A63 A;  1GUO A;  1JQY D;  4F8M A;  1JJC B;  5AFW A;  3ONA B;  3HKZ B;  1MD2 D;  1UE5 A;  2KUM A;  5BN5 A;  4M8A A;  2A69 C;  2OEO A;  2F0V A;  2ZJP A;  2EYM A;  1T9H A;  3R2I A;  1FYC A;  5JVH 3;  3S1R B;  4FYD A;  4NW2 A;  1VQ4 A;  2JP1 A;  2DY7 A;  2QKI C;  3NTI A;  2R7D A;  2KEE A;  5AJ3 L;  1SE8 A;  3HKZ E;  4OWX B;  4ME3 A;  1HZC A;  4J6H A;  1SE4 A;  3EBE A;  1PRT D;  3MEF A;  4DK1 A;  2QEX A;  2B2Y C;  4LUO A;  5IGF A;  1PH3 A;  3EN2 A;  2MNA A;  2B2T C;  1VQM A;  4LF5 Q;  2KHS A;  2NZH A;  4CDD C;  1L1O C;  4RGT A;  4C3H G;  2ALY B;  1KRT A;  1VQ9 A;  2H1E A;  4HJ8 A;  1GVP A;  4AQY Q;  3EFX D;  3DWQ A;  3I91 A;  2F0D A;  1HNZ Q;  3GD7 A;  1WCM G;  1ENF A;  2A6E C;  5DM7 3;  2P5Z X;  2K5H A;  4QF4 A;  1LAC A;  1T5X D;  3VYR A;  2DNC A;  3F2C A;  3JAM E;  5IYB H;  4GKJ Q;  1R9T B;  1I6H H;  3V05 A;  2CH4 A;  4NXN L;  4DAV A;  1H9K A;  4JYA Q;  1O7I A;  2E2H B;  2UXB L;  4L5Q A;  4N8F A;  1F9Q A;  2I0Q A;  2VS1 A;  4YHH Q;  5GQO A;  3HOZ H;  2JA8 B;  4Q5V A;  2KJX A;  2K52 A;  2D5D A;  5IOD A;  3CRK C;  5M9O A;  2SDF A;  4CBV A;  1RL2 A;  4DAM A;  1K0R A;  3H15 A;  4P74 A;  4GLX A;  1PFS A;  1Y1V B;  1PV4 A;  4LF4 L;  4BA2 I;  4QIW B;  1TY0 A;  5JEA J;  3I70 A;  4FF2 A;  3E9I A;  1Y8N B;  3NBH A;  1PH6 A;  1PTO H;  5C4X B;  2N78 A;  4GKK L;  4KKT A;  4IFD J;  1HTP A;  1IYV A;  4PZ7 A;  2UXD Q;  3CKI B;  1GOZ A;  1HH2 P;  3KF8 B;  4KKU A;  2B2U A;  5KYI A;  3DXJ C;  1XMO Q;  2IHF A;  2N55 A;  2SEB D;  2VY3 A;  1FJG Q;  4BXX H;  1KAB A;  3OTO Q;  2R93 G;  4C3J G;  1EIY B;  3EQL C;  2K14 A;  4A3K B;  2XWB B;  1N33 L;  4DK0 A;  2NZ1 D;  1WTR A;  2L5T A;  4B3T L;  4ZQ3 A;  3BS1 A;  1YEZ A;  3M7G A;  4WJ3 M;  1KNE A;  2DGY A;  2EYH A;  1N9W A;  3D6C A;  5EKL A;  1STH A;  2KCT A;  3FMC A;  1DCZ A;  2PZT A;  1ET9 A;  3NEN A;  2E74 C;  1EU3 A;  2HHH L;  3RZD H;  2YU9 H;  4KLK A;  2RHS B;  1JE5 A;  1I50 H;  2UUA L;  1HJP A;  4KJN A;  4DKA C;  1Y69 U;  5K36 H;  5C0X G;  1BF4 A;  2B2V A;  1PDQ A;  1VQB A;  2E2J H;  3HOV G;  5GAH C;  4U68 A;  1GUS A;  3AFP A;  4ZRZ A;  2ZJQ A;  4DV3 Q;  1NR4 A;  2G9D A;  3IFT A;  4DR1 Q;  4A93 H;  5LHY 1;  1NMG A;  1PYW D;  2Z6K A;  3IFD A;  3CHB D;  4JI8 L;  2JA6 B;  2XNA C;  3X3M A;  5IGD A;  4KN7 C;  4LUV A;  1ASY A;  3WWV A;  2PQA B;  2ZXO A;  1CKN B;  3CRL C;  3J7Y W;  4BBR G;  1ILQ A;  3ITP A;  1PZJ D;  4R1J A;  1IZ6 A;  5DM6 3;  1A3U A;  3KYH C;  1A2U A;  1EY5 A;  1A8V A;  2GA4 B;  3ER0 A;  4YIJ A;  4GNX A;  3S17 B;  2VB2 X;  1VCI A;  1QE6 A;  3H0G G;  3S15 B;  4A3I G;  1YHA A;  2VL6 A;  3TME A;  4JV5 L;  1NE3 A;  3C46 A;  3ICE A;  4QJF A;  3W2D A;  2YV5 A;  1LT3 D;  3HOW H;  4X3T A;  1CTM A;  4DR7 L;  4H0L C;  3NE5 B;  1TWF H;  4AYB G;  4A3F B;  3QO2 A;  1WTQ A;  1NY4 A;  4HN7 A;  3TRZ A;  3PCO B;  4HR7 B;  1TVX A;  1AE2 A;  3L7Z C;  4HAE A;  5IIF A;  3TZU A;  2O4X A;  5M3M H;  5BR8 L;  4LFB L;  4JI6 Q;  1QNK A;  1SYD A;  3J80 E;  3KF8 A;  4JVZ A;  1R4P B;  1TS3 A;  5KND A;  1CHQ D;  3S14 B;  2I5H A;  2KCC A;  3VR2 A;  1ZKO A;  2MUY A;  3L3O C;  1SR3 A;  1B3A A;  4DGZ A;  1YHQ A;  1M4V A;  3L9A X;  2KA7 A;  1DM0 B;  2EJF C;  3NQT A;  4LF9 L;  2Z0S A;  2NVQ B;  1XYI A;  2RDF A;  3AMU A;  4QQB X;  3OIP A;  4IUQ A;  3KFU A;  2RHQ B;  2NTT A;  5C3E B;  2HCI A;  3HKZ G;  4X3K A;  1QNU A;  3Q0A A;  3L0O A;  4IJH A;  3S1Q B;  3SK6 A;  2JA9 A;  2D9U A;  4TVA B;  3PO2 G;  1F77 A;  4KHP Q;  3K7A B;  4RGN A;  3NTK A;  5JJZ A;  4MNO A;  3OOC A;  3BU2 A;  4H13 C;  2FIN B;  1S5B D;  1AZQ A;  3S2H H;  2F4I A;  2I5L X;  3NWS A;  4A75 A;  4PG3 A;  1ML0 D;  3TBI B;  2Q2I A;  1CM9 A;  1H9R A;  5A2Q L;  1AFP A;  5D3D A;  1DGS A;  3JC6 6;  4YCV A;  1A62 A;  2FXQ A;  3W1G A;  4HJ9 A;  4FF4 A;  3J7A 5;  3HOW B;  4LW1 A;  3PUX A;  3MXP A;  2F0P A;  1PZK D;  2YTV A;  3CQZ H;  1B1Z A;  3I56 A;  1L2F A;  1Q90 A;  1YNJ D;  1QWY A;  1VQD A;  1PFB A;  4B3M L;  1U9R A;  3HFZ B;  3NUC A;  2N3S A;  2A5H A;  3KDF A;  1BKB A;  5D14 A;  1TS4 A;  5IOC A;  3EJI A;  1L0W A;  5EPK A;  1L1O B;  4CJ0 B;  1N32 Q;  2J7Z A;  2MQH A;  2RA4 A;  1MJE A;  2BDN A;  2F0U A;  4JBK A;  2NN6 I;  2ASB A;  1K83 B;  2G9H D;  3HGB A;  3W1B A;  2JA6 H;  4K8I A;  5FO8 B;  4A3J G;  3SE0 A;  4C1N I;  5JVG 3;  1BCP F;  1N8R C;  3ND9 A;  1Q1E A;  1I4H A;  3G6E A;  3CAM A;  2OTJ A;  3A5Z B;  5IT9 E;  5IP7 H;  1I4Q A;  3C1E A;  1Y1V G;  5FLX c;  4LF8 L;  3TZD A;  3GV6 A;  4HJ7 A;  4BY1 B;  1X9N A;  2K7V A;  3PIP A;  3AFQ A;  1EEF D;  4O0A A;  1VDZ A;  1OTC A;  3D0F A;  4A3M B;  4NXN Q;  4OO1 G;  4K0K L;  1ENC A;  2XWJ B;  4HTH A;  4GN3 B;  1JCK B;  3DWP A;  2PI2 A;  2Z9H A;  3TRE A;  4HMI A;  3BVM A;  2B8F A;  2JA5 G;  4A3C G;  2KHI A;  4IPC A;  5EGT A;  1B7Y B;  1XX8 A;  3AYH B;  4R8I A;  1SND A;  4LFA L;  4DR2 Q;  3TQY A;  1LT6 D;  1S5C D;  4A3L H;  2LXK A;  4KY5 A;  4GN5 A;  2WKD A;  1UE7 A;  5I9P A;  2XN9 C;  1TWA B;  3MXG A;  1FNW A;  4XTC S;  1ESF A;  4CDC C;  5LMU Q;  4A3D H;  1V9P A;  5ELE A;  2XGT A;  4X64 L;  4A3I B;  1BNZ A;  3D8G A;  3GQB A;  4B3S Q;  1BXT A;  2FMM A;  4DFA A;  2VQE L;  2CH4 W;  3RLN A;  1PHJ A;  2F0L A;  1GXD C;  3IAY A;  1HZA A;  3GTO B;  2E2I B;  4ULL A;  4Z9C B;  4K0K Q;  2JN4 A;  4MTN A;  2HCC A;  3K0X A;  1C4Q A;  1EYG A;  1A3T A;  3G6J B;  4OXP A;  3KDF B;  1PH9 A;  4H44 C;  1DJR D;  2EYF A;  2Y0S E;  4BXX G;  2F0Q A;  2R92 G;  1O7Y A;  1WCM B;  4C3H H;  1I6H B;  2TMP A;  1TS2 A;  1YJW A;  3DWA A;  1VQ5 A;  4XQJ A;  3N6R A;  3SK5 A;  3M3Y H;  2ID0 A;  4KY6 A;  3OWF A;  1K8A C;  2L55 A;  1UE1 A;  4ZLT F;  4FNF A;  1CT1 D;  1G2T A;  2CWP A;  4U67 3;  1PRT B;  4JK1 C;  2CKZ B;  2CHB D;  4C3I H;  2OTL A;  4DR2 L;  2MGS A;  3PIO A;  3T51 B;  4UP7 A;  3BZC A;  3OW7 A;  3OW2 A;  4QY7 A;  2F3I A;  4YCU A;  2B63 B;  1XJV A;  3GTO H;  1VQN A;  1LTS D;  3CMA A;  1AEX A;  4G4K A;  2IL8 A;  2B2W C;  3E5S A;  1X65 A;  5EBD A;  1MGS A;  2R7F A;  3J80 c;  1KHI A;  3KBX A;  1FNV A;  5ELO A;  3S1R H;  1EYA A;  2SOB A;  3NK9 A;  1W3S A;  1KTK A;  3U9O A;  3GTM H;  1TWH H;  2BA1 A;  4JI5 Q;  2WB1 G;  4Q0F A;  4K6D A;  3VYS A;  2FFK B;  3HS0 C;  4KHP L;  1WTP A;  2OF1 A;  4G7H C;  1HZB A;  2K5W A;  4B3R L;  1EL0 A;  1SNP A;  3CC4 A; 
#chains in the Genus database with same CATH homology
 4FXD A;  1STA A;  3QOL A;  1II3 A;  3ZYY X;  4Y7N B;  1IW7 C;  4J1M A;  1JOO A;  1TII D;  2CQA A;  2F0W A;  2NN6 G;  3V2T A;  3V96 A;  3U9S A;  2DY8 A;  3HP3 A;  4JBW A;  2B2V C;  2C9O A;  3N52 A;  1FD7 D;  1VMP A;  3HOX B;  4GZY C;  2K05 A;  4CGY B;  5C0X I;  2M00 A;  1LAB A;  1UAP A;  1G29 1;  4KI0 A;  5K5P A;  2XIW A;  1IKL A;  4K5V A;  2JEA I;  5E4X A;  5LL6 X;  4I65 A;  4XQQ A;  4RCO A;  3A7L A;  4MN3 A;  5CV9 A;  5C4H A;  5JAV A;  3OWE B;  1Q8I A;  1C8C A;  2F0K A;  3J7A V;  1PZI D;  2F1M A;  5FK9 C;  2RBM A;  4EGV A;  1V1P B;  2F0F A;  2KVM A;  2ICE C;  2L0C A;  2F0G A;  5E1F A;  1ZYR C;  2BOS A;  5DAU A;  2XRQ D;  3KBG A;  2XRS D;  3PIO 3;  3GTQ B;  4BBS B;  3D4W A;  5G3L F;  1BR9 A;  1OXS C;  1G91 A;  3A56 A;  1HXY D;  2R6G A;  4C56 C;  5CC4 A;  2LFN A;  3P20 A;  4MIU A;  3OPO A;  1D6E C;  3QJY A;  3S9W A;  5HGT A;  1KLU D;  1G2S A;  3S16 B;  2F0E A;  1EWH A;  3NWT A;  4K14 A;  2A6H C;  4J8Q A;  4H7B A;  1Q12 A;  1CZW A;  5M5Y B;  2LKV A;  3HG9 A;  2QEJ C;  4CKC A;  1EY9 A;  3SEB A;  3GV3 A;  3FKI B;  2F0T A;  4KK7 A;  5EQ0 A;  1AW7 A;  4PQX A;  1CI3 M;  4B9X A;  1D5Z C;  2O2L D;  2IW3 A;  2AQ3 B;  4XYO A;  4A3J B;  5CR3 A;  2NVT B;  5JPM C;  1RF2 D;  2B2W A;  3M4Y A;  4IFD I;  2Z4H A;  3NHH A;  5I2Y A;  2WKC A;  1ONL A;  2L12 A;  4ODG A;  2I46 A;  1I50 B;  5J1Z A;  3I8Z A;  1LT5 D;  5BN4 A;  1JE4 A;  3DHQ A;  3KUP A;  2XVS A;  2XSC A;  3WOE A;  1H9S A;  1JB3 A;  2F3W A;  2JA7 B;  4A3B B;  2D62 A;  4R8N A;  3J7A F;  5FO9 B;  4C3J B;  4EQP A;  1M8A A;  4ABN A;  1O7Z A;  1SNC A;  3J80 L;  5C6A A;  2Q8T A;  3SDZ A;  2O5J C;  1I3Q B;  1CHP D;  1F2Z A;  1BOS A;  3URY A;  1LTI D;  1S5F D;  2K1B A;  5CV8 A;  4DAY A;  5TSS A;  2AWO A;  2IX3 A;  1V1P A;  3K5N A;  1OXT A;  3SXH A;  2WIN B;  5J39 A;  2Y0S B;  1CQV A;  1SBB B;  1DXM A;  2Z1C A;  1B50 A;  1DOK A;  1JC7 A;  3RZO B;  1K8O A;  4UDU C;  4RKL A;  4OL7 A;  2O5I C;  3H0G B;  1VMC A;  2WII B;  2ZXR A;  2PW7 A;  1R4Q B;  2IJ0 A;  3R8B A;  1B2T A;  5JEA G;  1V1O A;  4RCN A;  3C3L A;  3QOJ A;  3K58 A;  1A3V A;  1GJX A;  3HOY B;  2IX0 A;  1NCV A;  1SE2 A;  2PZU A;  4C3H B;  3H3V C;  4WFN 3;  1ZYR D;  3Q24 A;  1S4Z A;  4KD3 A;  2Q8R E;  4OO1 H;  5BN3 A;  5D3I B;  2V4D A;  4K2K A;  1GHK A;  1STE A;  3DEO A;  1CA5 A;  1PRT C;  4V19 0;  2L4N A;  1JIC A;  1BO0 A;  1SNP A;  2EY1 A;  2R93 B;  3P7J A;  2QIL A;  3OHX C;  2K03 A;  4IFD H;  2A6E D;  1EY7 A;  2E75 C;  4C3I B;  1QOH A;  4QMG A;  3KLS X;  1L0Y B;  1W6J A;  3QG1 A;  1RD9 D;  1TS5 A;  1CFM A;  2QDB A;  3EVQ A;  3PUV A;  1ZEQ X;  3S1N B;  1LTA D;  1TQO A;  1BCP B;  3K5O A;  1EY6 A;  5I9O A;  1EIG A;  1SYF A;  3TN2 A;  3O13 A;  4PMW A;  1UEA B;  2Q8I B;  2L11 A;  1Q1B A;  5T1G A;  4ZK9 B;  3GTM B;  5CV4 A;  1Y8P B;  3I90 A;  3K59 A;  5C4Z A;  4TQU S;  4IQZ A;  4RGM A;  4E6I A;  1TU2 B;  3BYY B;  1ESR A;  1WD1 A;  1Q3L A;  4PMB A;  3PIP 3;  4A3D B;  5I4D A;  1X3Q A;  3HOU B;  2EYL A;  1HFG A;  5M3F B;  1IHZ A;  3HOZ B;  1KDB A;  1OO9 B;  3MXU A;  3C2P A;  1NAP A;  1HQR D;  3MWY W;  4C1N K;  1H9M A;  4K8J A;  5KEE A;  4B9W A;  5CV6 A;  2K6A A;  2B39 A;  3ERQ A;  3OIQ A;  3BG3 A;  3TP7 A;  2BDO A;  4QCL A;  1EEI D;  3W3A A;  1U4R A;  2EVB A;  3D3R A;  1E2W A;  2NTS A;  1GUN A;  1L0X B;  1PTO F;  3CU7 A;  4XYQ A;  1UUP A;  4LJZ C;  3BZD B;  3LNN A;  3BVZ A;  4XIG S;  4AYB B;  5KNB A;  1SJE D;  1SFO B;  5K36 G;  3TP5 A;  2HDM A;  3FPU B;  3BDO A;  4LAA A;  4FVM A;  5JOB A;  5A35 A;  1WD0 A;  4OIJ A;  4X3U A;  4FXK C;  3FRP B;  5C4J B;  5C44 B;  5I2X A;  1E2V A;  2B2T A;  4F7X A;  3PUZ A;  1EFI D;  2R92 B;  3PV0 A;  3T53 B;  1CZG A;  2M2L A;  1JWU D;  4IUV A;  1I6V C;  2ZXP A;  3GO5 A;  3TP6 A;  5IGC A;  4RGO S;  4M1U B;  2A6H D;  3KK7 A;  5LL6 S;  2J0T D;  3DM1 A;  3VR3 A;  3HZX A;  1I4P A;  3K57 A;  1B44 D;  1LLR D;  4QB4 A;  3S1M B;  1EU4 A;  1G6Z A;  4B08 A;  3PO2 B;  3WDN A;  1D5X C;  1HA5 A;  2E76 C;  5COR A;  2A68 C;  4IUN A;  2PPB C;  1D5M C;  4HED A;  3NSW A;  4HSP A;  1RJT A;  1KAA A;  1LTB D;  3J81 L;  1AP0 A;  3JAM L;  2F0H A;  5DNF A;  4QUF A;  2VXW A;  3RZD B;  5C0X J;  1TWF B;  1EIH A;  1ET6 A;  5EKK A;  1SEB D;  4C3I G;  1QG7 A;  2CW0 D;  4QUC A;  4HCE A;  4HSV A;  3K0Y A;  3NBI A;  1NSN S;  4IFD G;  2JYO A;  5IGG A;  1O80 A;  4ZUI A;  2B2Y A;  1YNJ C;  3LX0 A;  3FPP A;  4KY7 A;  2NB0 A;  1PRT F;  2ICI A;  4KKS A;  1Z6H A;  1F2M A;  2MPM A;  5FO7 B;  3EA6 A;  1DD2 A;  2EY2 A;  1TWH B;  3P75 A;  1FGB D;  2HUG A;  3KLR A;  1Y8O B;  3NP8 A;  1SNM A;  3M4O B;  1Z7T A;  5C5M A;  4XT3 B;  2EXZ A;  3MFY A;  4F88 A;  1WTO A;  2HQE A;  1JWS D;  4A93 B;  1DON A;  1EZ8 A;  1IKM A;  2E2D C;  4FXG C;  1EYC A;  1TY2 A;  3E0J A;  3D4D A;  1FR3 A;  3UI2 A;  2EYO A;  3Q22 A;  2A69 D;  1BQQ T;  1X3P A;  4G57 A;  4I7Z C;  1S5E D;  1U4L A;  4ME5 A;  1B4O A;  2L1B A;  2DNE A;  3VYU A;  3H94 A;  1OXU A;  2K28 A;  1EZ6 A;  5IT9 L;  1OXV A;  1ENA A;  1STB A;  2FJ2 A;  4EQN A;  2CVR A;  1U4M A;  1PTO B;  3TSS A;  3IKJ A;  1SJH D;  4MHE A;  4N9T A;  4ILW A;  1H9J A;  1EOT A;  1F9R A;  4CKB A;  1BBX C;  1PXU A;  2X6G A;  2FHT A;  1C48 A;  4OIK A;  3VR6 A;  1ICW A;  2PMZ B;  5KRU A;  2NN6 H;  5FKA C;  4RFB A;  3HEJ A;  4OO1 I;  2OXP A;  5FOB B;  3MVV A;  2WAQ B;  1EY8 A;  1ILP A;  4XQN A;  2OT2 A;  4TSS A;  4WJW A;  4DU9 A;  3PUY A;  1DZ1 A;  3M7N A;  3LWE A;  4TRD A;  2PNR C;  3T16 A;  3DUZ A;  1PMR A;  4F87 A;  1STG A;  2RDH A;  2K5Q A;  4EVO A;  2MJ8 A;  2F0O A;  5D65 A;  2L9H A;  2LS0 1;  5ELF A;  2AUJ D;  1MI2 A;  4PMC A;  1LTR D;  5FLX E;  5DEH A;  2HDL A;  3F2U A;  2EOT A;  1SNO A;  1S5D D;  2KCN A;  4EQO A;  1XXG A;  5JEA H;  3H09 A;  4NKL A;  1SNQ A;  3MC0 B;  2Z8L A;  4KHV A;  2PZW A;  4K6L A;  5KIX A;  1B9N A;  4KJO A;  1EY0 A;  5C0X H;  2AQ2 B;  3I72 A;  1B9M A;  3IL8 A;  1SYG A;  4KV6 A;  2IT1 A;  1KDC A;  5E4W C;  1CK1 A;  4DAP A;  1GUW A;  3QB3 A;  3AU7 A;  3R93 A;  1SDF A;  1V8Q A;  2EYP A;  4KTA A;  2AUK A;  3MFG A;  1WTW A;  3SR1 A;  1EYD A;  1PTO D;  3GTP B;  3SHL A;  1DYQ A;  2M9V A;  1PFN A;  1MSG A;  5EKI A;  1BUV T;  1F9P A;  4CKE A;  2MHV A;  4FP5 D;  2NBF A;  1JOK A;  3A8J E;  2R61 A;  5M3M B;  4OHJ A;  4ZAI A;  4K5W A;  1SMY C;  1J8I A;  4HCS A;  1EQV A;  2EJG C;  3MHB A;  1EQT A;  1QIL A;  1HA6 A;  3S2H B;  4TKO B;  1JOR A;  2BE5 C;  2JSO A;  1G8Z D;  4IN3 A;  1SXT A;  2TSS A;  2FMC A;  3A8I E;  1T5E A;  4A3G B;  1F9S A;  2F0S A;  3VA5 A;  3MZ5 A;  3HRZ C;  4G7O C;  1LO5 D;  3WOF A;  5T1I A;  1KLG D;  4IUT A;  5ELC A;  1HFN A;  1F2Y A;  3S2D B;  3BVG A;  1UNS A;  1A15 A;  1TT2 A;  2A68 D;  1HPC A;  2K32 A;  3ND8 A;  5KYL A;  4XDX A;  2CW0 C;  3KLS A;  2X69 A;  5JPN C;  3TP8 A;  3GTL B;  3LWU A;  3RUZ A;  3SK4 A;  2EZV A;  4KN4 C;  1TWC B;  5J22 A;  1AZP A;  2JXM B;  1ROD A;  3C1F A;  2YYZ A;  2KOL A;  3CQZ B;  3SK8 A;  5CYU A;  2MP1 A;  3NTH A;  1XWE A;  1Y1W B;  3PUW A;  1W6K A;  3HOV B;  1DOL A;  1ZXT A;  3OMC A;  1YNN D;  4RA8 A;  4BS9 A;  1BDO A;  4ZYS A;  3T4A C;  2WP8 J;  2X6L A;  4R9W A;  4XXE A;  1X32 A;  4IZ8 A;  2DN8 A;  3BDL A;  1JWM D;  1QB5 D;  2B2U C;  4S3S A;  3Q23 A;  3MXN A;  1HHV A;  3K5L A;  2QF7 A;  1MSH A;  4BWG B;  2YU9 B;  1HUN A;  4ZUJ A;  5COY A;  2N88 A;  1WTX A;  4IUU A;  1PFM A;  2IWH A;  1SMY D;  2SNM A;  4FO2 A;  4ID6 A;  2ZT9 C;  3I4M B;  4K2L A;  3QIA A;  3VYT A;  1F2L A;  4KHZ A;  1YNN C;  4RWS C;  2EY5 A;  2F0N A;  1RCV D;  2EPB A;  1GUT A;  5NUC A;  3BYT B;  1TR5 A;  1SE3 A;  5HUR A;  3FDT A;  1RKN A;  2VUM B;  4O42 A;  5CGK A;  1IYU A;  3GP7 A;  1NR2 A;  5C5L A;  1I4R A;  4FF3 A;  1CQF A;  4DF7 A;  3R3O A;  3MTS A;  1XTC D;  1FNU A;  4V0B A;  2F03 A;  3DMU A;  1U4P A;  2VNU D;  2K01 A;  1WVL A;  4UAI A;  2R3Z A;  1GUG A;  2PO4 A;  1LTT D;  2JEB I;  3ERO A;  3A54 A;  3I4N B;  4CJ1 B;  5CBE E;  1MBY A;  2AQ1 B;  3E6Z X;  2K33 A;  3FVQ A;  1KNA A;  3VA7 A;  2B8G A;  3RLF A;  2WB1 B;  2KQ3 A;  2PQE A;  2RDG A;  2BA0 A;  2LMC B;  1IL8 A;  4DN4 M;  3I3C A;  3A7A B;  5G3L D;  4RAU C;  2F0J A;  4P2C B;  2NVY B;  1E2Z A;  5CBA E;  1RHP A;  3FEW X;  3NPP A;  4LMQ D;  4A3E B;  1D1I A;  1VF7 A;  1I4X A;  5ELB A;  1J9O A;  1VF5 C;  1Z47 A;  2VB3 X;  5EPL A;  2A73 B;  2RKS A;  2EE1 A;  1LV9 A;  3OSO A;  1A2T A;  2A74 C;  2K04 A;  4XT1 B;  5A2Q E;  3RD4 A;  4O1N A;  3NXW A;  1RTO A;  4NP5 A;  2JA5 B;  1O78 A;  3D4R A;  3SVM A;  1D1K A;  2JE6 I;  5FLX L;  2EYJ A;  4X3S A;  2IX1 A;  3K6O A;  3VR4 A;  4IUP A;  4CJ2 C;  3M85 A;  3M3Y B;  1HQM C;  3QWN A;  2I07 B;  1BCP D;  1SSO A;  4IAL A;  4C2M B;  2PCF B;  4NDX A;  4PNY A;  4OGQ C;  4BA1 I;  1EWC A;  2KEC A;  5KGU A;  5EBC A;  1QCB D;  3OMG A;  3PO3 B;  3PMF A;  4ZKB B;  2IPK D;  5EPJ A;  1H9S B;  4BBR B;  3RMH A;  1HRJ A;  4WOR A;  2RSO A;  1GHJ A;  4RHS A;  3I4L A;  4DXF A;  3TDQ A;  2WV6 D;  4K5X A;  5CV7 A;  2RSN A;  4IUR A;  2EDG A;  1PLF A;  5M5W B;  3BDC A;  1B53 A;  2F3V A;  1EY4 A;  4L8J A;  2AWN A;  3A55 A;  5I6W A;  1AN8 A;  2EJM A;  2RVL A;  3X3N A;  3A8K E;  3D31 A;  1HTL D;  2LY7 A;  1V43 A;  1BCP C;  2SNS A;  2F0M A;  5KNC A;  3H6M A;  4CHT B;  4FF1 A;  1TWG B;  5C3W A;  3D6W A;  2BE5 D;  1SAP A;  2F0I A;  2NWG A;  5C3X A;  2KED A;  4RKB A;  4WRD A;  2QCP X;  2WAC A;  3AB9 A;  3NQI A;  5I6Y A;  4RH6 A;  3GTJ B;  3GTG B;  1TKW B;  1SYE A;  2R7Z B;  4RHR A;  5M5X B;  1STY A;  3MAQ A;  2BCO A;  3G7L A;  2Z4I A;  4DNR B;  2H4O A;  3Q6S A;  5CV5 A;  4NMZ A;  2RQX A;  1HUM A;  1A6X A;  1RTN A;  2NVX B;  4HMJ A;  4L63 B;  4BY7 B;  1LT4 D;  3P1H A;  3GTK B;  1PTO C;  1D2B A;  2C5C A;  1QJO A;  4N9P A;  3MEH A;  4PV1 C;  2D2C C;  4DA2 A;  4LK1 C;  1NUC A;  3MA2 B;  5ELD A;  1RDP D;  5E3F A;  1JOQ A;  5IGE A;  3R2T A;  1O7L A;  2ENB A;  2EY6 A;  1STN A;  4KMU C;  1KDA A;  1SYB A;  3I73 A;  2PYK A;  5ISR A;  3J81 E;  3T56 B;  4DXG A;  1LTG D;  2NUC A;  4L6T B;  2J4X A;  1CA6 A;  1IW7 D;  2E2J B;  5EJW A;  4DNT B;  3DEP A;  1HCZ A;  1I4G A;  1SYC A;  5F2D A;  3VR5 A;  2PW5 A;  4ZKC B;  1OXX K;  5CMD A;  3T13 A;  1E0B A;  5IGB A;  1JR0 D;  3K5M A;  3H91 A;  4G7Z C;  2NYZ D;  1WTV A;  1DOM A;  2K5D A;  4KD4 A;  1GUO A;  1JQY D;  4F8M A;  5AFW A;  3ONA B;  3HKZ B;  1MD2 D;  2KUM A;  5BN5 A;  4M8A A;  2A69 C;  2OEO A;  2F0V A;  2EYM A;  3R2I A;  1FYC A;  5JVH 3;  3S1R B;  4FYD A;  4NW2 A;  2JP1 A;  2DY7 A;  2QKI C;  3NTI A;  2KEE A;  4J6H A;  1SE4 A;  1PRT D;  4DK1 A;  2B2Y C;  5IGF A;  2B2T C;  2KHS A;  4RGT A;  4C3H G;  2H1E A;  3EFX D;  3DWQ A;  3I91 A;  2F0D A;  3GD7 A;  1ENF A;  2A6E C;  5DM7 3;  4QF4 A;  1LAC A;  1T5X D;  3VYR A;  2DNC A;  3JAM E;  1R9T B;  3V05 A;  4DAV A;  1H9K A;  2E2H B;  1F9Q A;  2JA8 B;  4Q5V A;  2KJX A;  2D5D A;  5IOD A;  3CRK C;  5M9O A;  2SDF A;  4CBV A;  1Y1V B;  4BA2 I;  4QIW B;  1TY0 A;  5JEA J;  3I70 A;  4FF2 A;  1Y8N B;  3NBH A;  1PTO H;  5C4X B;  4KKT A;  4IFD J;  1HTP A;  1IYV A;  3CKI B;  1GOZ A;  4KKU A;  2B2U A;  5KYI A;  3DXJ C;  2N55 A;  2SEB D;  1KAB A;  4C3J G;  3EQL C;  4A3K B;  2XWB B;  4DK0 A;  2NZ1 D;  1WTR A;  2L5T A;  4ZQ3 A;  3BS1 A;  3M7G A;  1KNE A;  2EYH A;  3D6C A;  5EKL A;  1STH A;  3FMC A;  1DCZ A;  2PZT A;  1ET9 A;  2E74 C;  1EU3 A;  4KJN A;  1Y69 U;  5K36 H;  5C0X G;  1BF4 A;  2B2V A;  1PDQ A;  4U68 A;  1GUS A;  4ZRZ A;  1NR4 A;  2G9D A;  3IFT A;  5LHY 1;  1PYW D;  3IFD A;  3CHB D;  2JA6 B;  2XNA C;  3X3M A;  5IGD A;  4KN7 C;  2ZXO A;  3CRL C;  3J7Y W;  1ILQ A;  3ITP A;  1PZJ D;  5DM6 3;  1A3U A;  1A2U A;  1EY5 A;  2GA4 B;  4YIJ A;  3S17 B;  2VB2 X;  1VCI A;  1QE6 A;  3S15 B;  3TME A;  3C46 A;  3W2D A;  1LT3 D;  4X3T A;  1CTM A;  4H0L C;  3NE5 B;  4A3F B;  3QO2 A;  1WTQ A;  4HN7 A;  4HR7 B;  1TVX A;  3L7Z C;  4HAE A;  5IIF A;  3TZU A;  2O4X A;  1QNK A;  1SYD A;  3J80 E;  3KF8 A;  1R4P B;  1TS3 A;  5KND A;  1CHQ D;  3S14 B;  2KCC A;  3VR2 A;  1ZKO A;  2MUY A;  3L3O C;  1B3A A;  4DGZ A;  1M4V A;  3L9A X;  2KA7 A;  1DM0 B;  2EJF C;  3NQT A;  2NVQ B;  1XYI A;  2RDF A;  3AMU A;  3OIP A;  4IUQ A;  2NTT A;  5C3E B;  2HCI A;  4X3K A;  1QNU A;  3Q0A A;  3S1Q B;  3SK6 A;  2D9U A;  1F77 A;  3K7A B;  4RGN A;  3NTK A;  5JJZ A;  3OOC A;  4H13 C;  2FIN B;  1S5B D;  1AZQ A;  2F4I A;  3NWS A;  1ML0 D;  3TBI B;  1CM9 A;  1H9R A;  5A2Q L;  1AFP A;  5D3D A;  4FF4 A;  3HOW B;  3PUX A;  3MXP A;  2F0P A;  1PZK D;  1B1Z A;  1Q90 A;  1YNJ D;  1QWY A;  1PFB A;  1U9R A;  3NUC A;  2A5H A;  5D14 A;  1TS4 A;  5IOC A;  3EJI A;  5EPK A;  4CJ0 B;  2J7Z A;  2RA4 A;  2BDN A;  2F0U A;  2NN6 I;  1K83 B;  2G9H D;  3HGB A;  4K8I A;  5FO8 B;  3SE0 A;  4C1N I;  5JVG 3;  1BCP F;  3ND9 A;  1Q1E A;  1I4H A;  5IT9 E;  1I4Q A;  3C1E A;  3TZD A;  3GV6 A;  4BY1 B;  2K7V A;  1EEF D;  1VDZ A;  4A3M B;  4OO1 G;  1ENC A;  2XWJ B;  4HTH A;  1JCK B;  3DWP A;  4HMI A;  3BVM A;  2B8F A;  5EGT A;  1XX8 A;  4R8I A;  1SND A;  1LT6 D;  1S5C D;  4KY5 A;  2WKD A;  5I9P A;  2XN9 C;  1TWA B;  3MXG A;  1FNW A;  4XTC S;  1ESF A;  5ELE A;  4A3I B;  1BNZ A;  3D8G A;  3GQB A;  1BXT A;  2FMM A;  4DFA A;  2F0L A;  1GXD C;  3IAY A;  3GTO B;  2E2I B;  4ULL A;  4Z9C B;  2HCC A;  1C4Q A;  1A3T A;  3G6J B;  4H44 C;  1DJR D;  2EYF A;  2F0Q A;  1O7Y A;  1WCM B;  1I6H B;  2TMP A;  1TS2 A;  3DWA A;  4XQJ A;  3N6R A;  3SK5 A;  2ID0 A;  4KY6 A;  3OWF A;  2L55 A;  4ZLT F;  4FNF A;  1CT1 D;  1G2T A;  4U67 3;  1PRT B;  4JK1 C;  2CHB D;  2MGS A;  3T51 B;  3OW7 A;  2B63 B;  1LTS D;  1AEX A;  4G4K A;  2IL8 A;  2B2W C;  3E5S A;  5EBD A;  1MGS A;  3KBX A;  1FNV A;  1EYA A;  2SOB A;  3NK9 A;  1KTK A;  3U9O A;  2BA1 A;  4Q0F A;  4K6D A;  3VYS A;  2FFK B;  3HS0 C;  1WTP A;  2OF1 A;  4G7H C;  2K5W A;  1EL0 A;  1K8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...