4K0KQ

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4k0kQ00
4DK6C 1QUQA 4BBRG 3J81i 1VQDA 1PH6A 3CPWA 1RL2A 1X9NA 4X62L 1MJEA 1Z9FA 1S3OA 3HOVH 3LGJA 5IP7H 1Q7YC 5IYDH 4YHHL 1JT8A 2Z0SA 3HOVG 3GTKH 4MTNA 5IP7G 5IYDG 1JJ2A 2I5LX 4LFBL 4GS3A 4QL5A 2KENA 5JEAJ 5BR8Q 2OQKA 1HJPA 1C0AA 3M4QA 1N33L 2LXJA 3EBEA 2Y0SG 4R4CA 1Y14B 4JCVE 1VQIA 2FXQA 4B3RL 4B3TQ 4R4OA 1BBWA 4DR4Q 1R9TH 4R4QA 2KHIA 2K50A 4A3JH 3KOJA 1J5EL 3F8TA 2UUAL 1PH2A 5C3EH 3L2PA 5FJ8H 5HGQA 1BBUA 1VQJA 4A75A 4EX5A 2PQAB 4DR1L 5C3EG 4ME3A 1G291 5FJ8G 1VQPA 1K83H 4R1JA 3I7FA 4DR5L 3PO2H 4DKAC 3PO3H 1I6HH 3BJUA 4A3DH 4JI5L 3PO3G 2UU9Q 4DUZL 3PO2G 1HNWL 4LF6L 4A3DG 2HIXA 1ASZA 1WI5A 1E3PA 5LMNQ 4JI6L 4C3HH 1IBKL 2R7DA 4JOIA 3AFPA 4WJ4A 1N34L 4YY3L 4R4IA 3KJOA 4LF5L 4OX9L 3A0JA 4JYAL 2NN6I 5J3BA 4X64L 4DUYL 3H3VH 2N78A 4UPAA 1XNRL 3JAMc 4POFA 2UXCL 5GAHC 2E5LQ 2D0PA 2RF4A 4C3IH 4DV1L 2I5HA 2Y0SE 4IPHA 1QUQB 3HOXH 1TWFH 2GN5A 2BA0A 4QIWE 4KHZA 4DV5L 1XNQQ 3HOWH 3HOXG 2KHJA 2LSSA 5GAGC 4JBKA 3HOWG 1BVSA 3T1YL 4DAYB 3CQZH 1TXYA 1EFWA 4YCVA 2YYZA 1PH4A 2JEBI 4PZ7A 4GOPC 5JJLA 1JB7A 1H95A 2CWAA 1K8AC 3S24A 3PUVA 4X62Q 3K0XA 4HIMA 4L5RC 3PUXA 4MNOA 2XTIA 2NVTH 1A8VA 4YHHQ 4A3KH 3PSIA 3STBD 4POGA 5C4XH 1CKNA 4A3KG 3GTOH 4LFBQ 1SN8A 4KI0A 4TQUS 3I56A 3F2DA 4OO1G 3M3YH 2K5HA 1EWIA 3J80i 1N33Q 2VL6A 3NEMA 1SE8A 4IOAA 1G6PA 5M5YH 4DV3L 5JJKA 1K0RA 1IXRA 1YJNA 1Q1EA 2EQSA 4IO9A 3TQYA 4P74A 1WOCA 3AYHB 1J5EQ 4BY7H 2UUAQ 2VQFL 1L2FA 4BY7G 2AWOA 4DR1Q 2QGQA 2ES2A 2JA8H 1C9OA 4DR5Q 3KJPA 4BA1I 1VQOA 3CP0A 2JA8G 1KQSA 5HY6A 4JI5Q 4DUZQ 4A4IA 1Q8KA 3PUWA 4RMFA 4OXPA 4AYBG 5GADC 3BZKA 3CPFA 1WCMH 5LMUL 3I4MH 4LFAL 3I4MG 1WCMG 1VQ4A 1N34Q 3G6EA 4YY3Q 1NJIC 3CD6A 1MIUA 3ZJYC 3GTQH 4KHPL 4OX9Q 1VQKA 4JYAQ 1FL0A 4X64Q 2CKZB 2RHSB 5M3FH 4DUYQ 1XNRQ 4A3CH 1N32L 3L7ZC 4A3JG 1IYJB 5M3FG 2YU9H 4A3CG 3I4NH 2UXCQ 2WFWA 4AH6A 2JQOA 1VQNA 2NZOA 4DV1Q 1HH2P 2E2HH 3I4NG 2HQLA 1EQRA 2N3SA 4A3IH 3CAMA 3JC66 4B3SL 4A3IG 4X66L 1N9WA 1YEZA 4LF4L 4DV5Q 2R7ZH 1SLJA 2NVXH 5ELOA 1E1TA 2R7ZG 1SROA 3T1YQ 1UEBA 2NN6G 2N8NA 4DV4L 1YI2A 1PH5A 4IFDJ 3GD7A 5JEAG 2Z6KC 3RR5A 1NE3A 4LWCA 1YVCA 3E9IA 1J6QA 4P72A 4DPGA 4HIDA 1K9MC 3TREA 1N8RC 3M85A 4JG2A 1Q86C 4A76A 1HZ9A 2OQ0A 4IJHA 5IYCH 3W5OA 3G4SA 4AYBE 1HZBA 5IYCG 1YITA 2K4KA 1P8LA 4JI0L 3GTMH 3HOYH 4P71A 1KIXA 3RLNA 3HOYG 1L1OA 1B8AA 4JBWA 1FJGL 3CCJA 4AQYL 2R7FA 1PA6A 1JE5A 1DGSA 1YNXA 3K7UC 5C0XJ 2VZAA 5ELNA 5LMNW 1HR0L 4LF8L 2OTJA 3S1MH 1CSPA 4A3BH 4H02A 4JI1L 1YHAA 4A3BG 2BA1A 3U58A 1CKMA 4IPGA 4IOCA 3I55A 2VQFQ 1YHQA 4GLVB 4RG1A 1PH3A 4QQBX 3GO5A 2OTLA 4IFDI 1KL9A 2PI2E 2EXDA 2IHEA 5IWAL 3S2DH 2ID0A 1K8GA 2V1CC 4PZ6A 3PCOB 1VQ9A 1NMGA 1QZGA 4JI7L 5LMUQ 4LFAQ 3UDGA 1RIPA 1VCIA 1Y1VH 4KHPQ 1Y1VG 1GVPA 5AJ3L 1YJWA 1JJCB 1N32Q 2RCNA 2UUBL 3KF8B 3H0GH 1XPOA 1L1OC 3ER0A 1HR0W 3H0GG 1AE2A 5C0XI 1GM5A 2PI2A 3KFUA 1NMFA 3HFZB 4DV0L 4B3SQ 1EQQA 4X66Q 1FVIA 4LUOA 4LF4Q 3S1QH 1PVOA 1NTGA 4HJ5A 1IZ6A 1G51A 3CCSA 1PFSA 1K73C 1LTLA 1VQLA 1MKHA 4DV4Q 3PIOA 3S15H 2IX0A 2E2JH 3STBC 1SMXA 1EIYB 5C4JH 5IE8A 2UXBL 1Y1WG 1L1OB 4C2MH 4IJLA 2ZTDA 2ZJPA 1PH7A 1X3EA 1W3SA 2EIFA 2CQOA 1HNXL 1A63A 4X6AH 1VQAA 4JV5L 1X65A 3E9HA 4DV7L 3CCVA 4YWMA 2BH2A 4JI0Q 4UP9A 4OWXB 2L15A 3U4VA 4DR6L 4WJ3M 2Q2TA 2GVBA 4P75A 1FJGQ 4AQYQ 2IY5B 2DGYA 4MZ9A 3ULLA 5GQOA 1O7IA 1HR0Q 4LF8Q 1YHBA 1A0IA 3OYYA 1E24A 2CWPA 3T1HL 2GVAA 3ICEA 3K7AH 1CUKA 4JOIC 3UDFA 4XIGS 3F2BA 2Q2IA 4A3MG 2JA6G 4DR2L 1D7QA 2F4VL 5C44H 2UUCL 2IHFA 2ALYB 3S16H 5C44G 3CC7A 4GN3B 2R93H 2R92H 5IT9c 3RZDH 1U5KA 3E0EA 2R93G 2R92G 3HOZH 4B3RQ 1X56A 4JI7Q 2ZM6L 3HOZG 4A93H 4DV2L 1UE6A 1X6OA 3TS0A 4A93G 3S1RH 1C7YA 4C3JH 5M3MH 5GAEC 2YTXA 4ALPA 4LFCL 1I50H 2AHOB 5M3MG 1PYSB 3F1ZA 2CFMA 1VQHA 1IL2A 4NB3A 5AJ3Q 4QJFA 2WP8J 3OW2A 5M5XH 1HZCA 2MO1A 1XMOL 2HHHL 2UUBQ 4BXXH 2ZTCA 2B63H 4IFDG 1EIFA 4BXXG 3A5ZB 3UDXA 2B63G 2JA9A 1HNWQ 1Q81C 1OTCA 2OWOA 4LF6Q 1TWCH 4IPCA 1EOVA 2F52A 4L5TA 4LUZA 1IBML 4JI6Q 4L5SA 1V43A 4DV0Q 1IBKQ 3GTJH 1OXUA 4TVAB 2E8GA 3WWVA 4LF5Q 4EQ5A 2ATWA 3D31A 4APVA 3D0FA 1B70B 2QEXA 2PMZE 4PMWA 4HJ9A 4GKKL 4YCWA 1KAWA 3EN2A 1Q46A 2A19A 4DNIA 3GTPH 4OO1I 4YWKA 5BR8L 3CF5A 4HJ8A 3CCMA 2UXBQ 1NY4A 1AE3A 5C0XG 4A3EH 2NVQH 2MQHA 4A3EG 1SR3A 4JV5Q 4DR3L 4UP7A 3JAMi 4DV7Q 1EUJA 5IYBH 4K0KL 4DR6Q 1VQ5A 2YTYA 1OXVA 2VY3A 1I5FA 2A1AA 4XTCS 5IYBG 1VQ7A 1Q1BA 3J81j 2AWNA 4GN4B 3CW2C 4IPDA 1KRTA 1PH1A 1M1KC 3PUZA 4O2DA 3AEVA 3ULJA 1VS0A 5IY0A 1E1OA 4NXML 3MXNB 2QA4A 4GNXB 3J7ZC 1XPUA 1XTDA 3SGIA 3VDYA 3T1HQ 2MO0A 4A3FH 1AH9A 2XGTA 2OCEA 4A3FG 3RLOA 3CMEA 5K36G 4DR2Q 3GTLH 1P16A 2F4VQ 2UUCQ 2AMCB 3S2HH 1Q12A 3PF4A 2LXKA 1CKOA 4OWTB 3RN2A 2H5XA 4DV3Q 4YWLA 3Q8DA 3TS2A 2ZM6Q 1OXXK 3I4OA 4DV2Q 3CXCA 4JBJA 4PZ8A 3UDIA 1VQGA 4GLAC 2I5MX 3DM3A 3PV0A 2IT1A 4UP8A 5M5WH 1OXSC 4O0AA 4DV6L 2D0OA 3RNUA 4BA2I 2HHHQ 1WJJA 2E2IH 1UE7A 2MNAA 1OXTA 2K75A 3EIVA 3B6YA 1VQ6A 2VNUD 2ZJQA 2HT1A 1X54A 1TWGH 2A8VA 1PYBA 1YIJA 1Q82C 2B29A 1IBMQ 2NVYH 3PIPA 2JE6I 3FP9A 2K5VA 2ZTEA 2PNHA 3J80c 2Q2UA 3PUYA 4AIMA 2NZHA 1IBLL 3W1GA 4GKKQ 4JI4L 3HKZG 2K14A 3RN5A 1VQMA 4HIOA 1E22A 2B3GA 3M7NA 4A3LH 1X3FA 4JI8L 4A3LG 3M4PA 2JA5H 3KLWA 1I94L 5JJIA 1YZ6A 2JA5G 1VQCA 1PH9A 3U50C 4BBSH 3A74A 4BBSG 3S17H 3AFQA 4DR3Q 3TRZA 2Q2HA 4K0KQ 3BU2A 1KXLA 3BZCA 3MEFA 5DLQE 3AQQA 3UE1A 1Y1WH 4LF9L 2KCTA 1VQFA 3M4OH 1TWHH 4DR7L 2C35B 4GOPA 1PHJA 4NXMQ 3CC4A 4X65L 4LNQA 2K5NA 1TWAH 1HNZL 2UXDL 1VQEA 2RHQB 4NXNL 1ASYA 4HJAA 3PF5A 1EYGA 2IX1A 2YV5A 3GTGH 4GKJL 1Z47A 2KBNA 3NELA 4LW1A 1K3RA 5GROA 3A5UA 1V1QA 3L0OA 2KCMA 1YJ9A 1LUZA 4JI2L 3CCRA 1M90C 3HKZE 1LYLA 1NBWA 3RZOH 3NENA 4JI3L 1QZHA 5H1SE 3H15A 1I3QH 3FKIH 4JI1Q 3CCEA 1S72A 3KF6A 2JA6H 3S1NH 4YCUA 3FKIG 4LF7L 1HZAA 4OWWB 2YTVA 2CCZA 4KLKA 4DV6Q 1BKBA 2I0QA 2VS1A 3KYHC 2VQEL 4GNXA 5IWAQ 5E7NA 1QVFA 1N36L 1B7YB 3OTOL 3ULPA 3GDEA 4BY1H 2VW9A 1T9HA 1D8LA 4LUVA 4B3ML 4BY1G 2R6GA 1GO3E 3HOUH 4JBMA 4QGUA 2JEAI 3HOUG 3J81c 1MJCA 2JJQA 4NPSA 2ASBA 3KDFA 3DLLA 1IBLQ 3J7A5 4JI4Q 1QVGA 3CC2A 4LFCQ 1LM0A 2AKWB 1XMQL 4PG3A 4JI8Q 2ZJRA 4DK3C 1KC8C 4FDBA 5C4XG 1GD7A 1I94Q 1VQ8A 1PV4A 3W1BA 1WYDA 2K52A 2WB1G 1WFQA 1KRSA 2JK8A 4P73A 1L0WA 4OONA 1GKHA 4GOPB 2F3IA 2N49A 5EAYA 1E7ZA 1UE1A 1UE5A 1KD1C 4QY7A 3HKSA 2WAQG 4LF9Q 2Z6KA 1QVCA 4GNXC 4DR7Q 1KHIA 2VUMH 1X55A 4A3GH 4X65Q 2DUDA 2VUMG 1HNXQ 4GLXA 1HNZQ 4A3GG 2UXDQ 3G71A 4NXNQ 3NBHB 3K81C 4DAMA 3CCQA 4B3TL 4UY8C 2JA7H 4Y52H 4GKJQ 4DR4L 4HJ7A 2JA7G 3FHWA 3KF6B 4JC0A 4L5QA 4JI2Q 5IP9H 3RLFA 3ERSX 3H3VI 5IP9G 3UE0A 2BH8A 1X3GA 4JI3Q 3F2CA 2UU9L 1A62A 1YBYA 3CCLA 3PGZA 2WB1E 5LMNL 4LF7Q 2PQAA 5FLMH 2HIVA 1W2BA 2VQEQ 5FLMG 1V9PA 4Y7NH 3CCUA 1JMCA 3KDFB 1N36Q 3CMAA 3OTOQ 1UWVA 1PH8A 3S14H 1CSQA 4J15A 5FLXc 2WAQE 2E5LL 1XJVA 1CKNB 3K80C 3M9BA 4GN5A 4B3MQ 3I2ZA 1FGUA 2MFIA 4R4TA 3K8AA 1U0LA 1JJGA 1XMOQ 1XNQL 4HIKA 2D62A 1XMQQ 1SRUA 3TEHB 1XPRA 4A3MH 1SFOH 3U4ZA 1S40A 4BBRH 3IRBA 1VQBA 3G48A
chains in the Genus database with same CATH superfamily
1QUQA 1RF2D 3MA2B 1SBBB 5IGGA 3J81i 3CPWA 3PO3B 2M2LA 4X62L 1MJEA 3VYUA 1Z9FA 3T53B 4RAUC 5IP7H 1JT8A 4O1NA 5IYDG 3J7AF 1S4ZA 2K04A 4GS3A 2EY1A 3HS0C 1HJPA 5IODA 1N33L 1EIGA 2FJ2A 4RFBA 4R4CA 4HMJA 1VQIA 5D14A 2KHSA 4X3UA 4KK7A 5BN4A 4KTAA 1J5EL 2K50A 1TWFB 4OO1H 3MXPA 3TMEA 1VQJA 4DR1L 3A54A 5FJ8G 1K83H 1JOKA 3I7FA 3PO2H 1F2MA 2DNCA 1B1ZA 4JI6L 5LMNQ 1VDZA 4C3HH 1KTKA 4MIUA 4WJ4A 4FXDA 4R4IA 4LF5L 4X64L 5C4XB 4UPAA 5CORA 3BYTB 3HP3A 1F9SA 3E5SA 5GAHC 2D0PA 4N9TA 4C3IH 2PYKA 5M5YB 1QUQB 5FOBB 1E2WA 2WAQB 1BVSA 4G7HC 3CQZH 3NK9A 1B3QA 3A56A 1PH4A 2JEBI 4JVZA 4PZ7A 1A15A 1HXYD 2FMMA 1K8AC 1JB7A 3S24A 5EKIA 3QIAA 3DM1A 2HD3A 4L5RC 3I4MB 2NVTH 3OWFA 1A8VA 5D65A 4A3KH 2XNAC 3BDCA 4J1MA 4POGA 2KECA 1CKNA 3OMCA 4IN3A 4TQUS 3I56A 2MP1A 2HUGA 2K5HA 3I3CA 3M3YH 2L4NA 1SDFA 2VL6A 2KEDA 3NEMA 5KEEA 5ISRA 4IOAA 4N9PA 3I4NB 2Q8TA 2E2HB 3R8BA 4A3IB 2LKVA 2UUAQ 1JE4A 5FK9C 4BY7G 2ES2A 1BNZA 2B2VC 3G6JB 1KQSA 4DUZQ 1DOKA 3CPFA 1WCMG 1EY4A 1VQ4A 2AUKA 1N34Q 3G6EA 1NJIC 1EU3A 5J39A 4R9WA 1N32L 1BCPF 5M3FH 1XNRQ 3L7ZC 2NBFA 1G91A 4A3CG 2UXCQ 4Z9CB 1VQNA 2NZOA 4DV1Q 2L1BA 1EQRA 1GUWA 4EQNA 4B3SL 1N9WA 2R7ZH 3X3NA 3E6ZX 1FGBD 5JPNC 4IFDJ 4K2LA 3RR5A 3PIO3 4EQOA 5I2XA 4DPGA 4CKEA 2QW7A 4IJHA 4AYBE 5IYCG 2K4KA 4EVOA 3GTMH 1Y1VB 1EY7A 3A7AB 1B8AA 1DONA 1PA6A 1YNXA 2VZAA 4XXEA 3S1MH 5C3WA 4RG1A 4QQBX 2K7VA 3GO5A 1TR5A 1STNA 2EXDA 2R3ZA 1HQRD 3S15B 1K8GA 1VQ9A 1TT2A 4JI7L 4HTHA 1X32A 4LFAQ 2KUMA 4H44C 3BZDB 1B2TA 1GVPA 1F9QA 3O13A 2UUBL 2RDFA 5L37A 1XX8A 1EWHA 1L1OC 1HR0W 1JC7A 2PI2A 1H9SA 2ICIA 3R2IA 2DN8A 1SE3A 4LF4Q 4LUOA 1VQLA 1PXUA 3A55A 2IX0A 5CBEE 3Q0AA 3STBC 1SMXA 5C44B 2DY7A 2PZWA 1E0BA 2ZJPA 1LTBD 1LTID 4IJLA 5CV6A 3HOZB 2QCPX 2EIFA 4JV5L 1X65A 3RUZA 4DV7L 3ERQA 3T51B 4JI0Q 4BY7B 1EYCA 2L15A 4MHEA 1G2SA 4LMQD 3NUCA 1FJGQ 2DGYA 1KAAA 1DXMA 1O7IA 4YIJA 1HR0Q 4LF8Q 4LAAA 3W3AA 3URYA 1GUNA 3ICEA 1CUKA 4KJOA 4CBVA 4DR2L 2KQ3A 4I7AA 2F4VL 2UUCL 2F0FA 2IHFA 2ALYB 2KEEA 2R92H 1LT3D 1NNXA 3E0EA 3Q24A 1X56A 1XXGA 2NUCA 4A93G 1HHVA 3S1RH 2PO4A 5M3MH 1IKLA 4LFCL 5EBCA 2CFMA 5AJ3Q 1GUOA 3MFYA 5KNBA 2B63H 2JA9A 1OTCA 1BCPD 1TWCH 4IPCA 2F52A 4L5TA 1V43A 5EGTA 1OXUA 2R61A 4B08A 2E8GA 3WWVA 4CJ2C 4APVA 1B70B 2QEXA 3D4WA 4WRDA 3GTLB 1KAWA 3EN2A 2B2TA 4FXGC 1Q46A 2A19A 5C0XH 5BR8L 3CCMA 2F0MA 2UXBQ 1HA6A 1MI2A 3I72A 2A6HD 4DR3L 4UP7A 3AU7A 3P20A 1S5ED 3MAQA 5M5WB 4HSPA 4XTCS 1Q1BA 1E2VA 2AWNA 4IPDA 3J81j 2E2IB 1M1KC 3ULJA 1VS0A 1E1OA 1PZID 3P1HA 2QA4A 4GNXB 3FEWX 1XPUA 3VDYA 3T1HQ 2MO0A 2JSOA 3CMEA 5FLXL 3K5MA 1Q12A 3PF4A 2PW5A 4OWTB 2CVRA 4G4KA 4XQJA 3GV3A 1QNKA 3I4OA 2ICEC 1JORA 4GLAC 2I5MX 3DM3A 3RNUA 5J22A 4O0AA 3VYTA 3TP7A 3BS1A 2HHHQ 2WKCA 2ZXOA 1OXTA 3EIVA 1VQ6A 4DA2A 2ZJQA 2VNUD 2B29A 1IBMQ 1IW7C 2P5ZX 2PNHA 3HKZG 1D5XC 2EYFA 3H94A 2B3GA 1STGA 2JA5H 1I94L 1VQCA 1CA5A 4BBSH 3A74A 2CH4W 1I3QB 3AFQA 3FKIB 3K0YA 2Q2HA 3BZCA 5DLQE 2NTSA 2I46A 1PZJD 1VQFA 1TWHH 2L11A 4G7ZC 3M4OH 1K0SA 4NXMQ 2EJGC 4X65L 1TQOA 4A93B 1VQEA 1Y8PB 2A68C 3PF5A 3Q23A 5ELEA 1H9MA 3I70A 3HOUB 4LW1A 5GROA 4F88A 2X6LA 2F0IA 1WD0A 3L0OA 1EYDA 1M90C 1LYLA 1TY0A 3BG3A 3NP8A 4JI1Q 2X69A 2KCNA 1GXDC 4LF7L 2A5HA 2YTVA 4KLKA 1EY6A 1BKBA 2CCZA 4XQQA 2EYJA 5IWAQ 5E7NA 2NB0A 2B2VA 1N36L 1D8LA 2ZXRA 4BY1G 2R6GA 4KV6A 1LTRD 4JBMA 4QGUA 1MJCA 2A74C 4UDUC 1IBLQ 1CM9A 4MN3A 1QVGA 4OL7A 1G2TA 2PZUA 1CQVA 5I9OA 3HGBA 3W1BA 1KDBA 2H1EA 2WB1G 1B3AA 4P73A 1DM0B 3NTHA 1L0WA 4TKOB 2PZTA 1U9RA 1PTOF 2N49A 5EAYA 2EJMA 4KMUC 4G7OC 4K5WA 1V8QA 1PLFA 1QOHA 4CJ0B 2VUMH 4A3GH 2HQEA 2MPMA 1II3A 1HNZQ 4S3SA 2UXDQ 1PTOH 3DWAA 3FRPB 3K81C 4DAMA 4B3TL 1R4PB 2K28A 1L0YB 4KKTA 4LK1C 3RLFA 1SJED 5IP9G 1HQMC 4JI3Q 3MZ5A 2B2WC 1A62A 1YBYA 4RKBA 5COYA 3OWEB 4KN4C 1IHZA 2HIVA 3HOVB 2VQEQ 4Y7NH 1XYIA 2Z8LA 3NXWA 1UWVA 1PH8A 5ELCA 2WAQE 4B3MQ 1K28A 4R4TA 1HRJA 2A6ED 4K2KA 1RCVD 1XMQQ 4A3MH 4A3JB 4NP5A 1DOMA 4RGTA 4DK6C 1VQDA 1I6HB 4A3DB 1X9NA 1H9KA 1S3OA 2F1MA 3EQLC 1Q7YC 5IYDH 4YHHL 3GTKH 1JWMD 1GHJA 1AFPA 4QL5A 5JEAJ 2FHTA 2Y0SG 1LT5D 2Q8IB 4IUPA 1Y14B 2FXQA 4B3RL 4RGOS 4DR4Q 2IW3A 1MGSA 4R4QA 2D2CC 2HDLA 3F8TA 3R2TA 3HOXB 5FJ8H 1BBUA 2ATWA 3HOWB 4DAVA 5JPMC 5C3EG 1VQPA 1GHKA 4DKAC 3PO3G 3IKJA 2K32A 1WI5A 1KNAA 3A7LA 1STYA 1SYDA 3KJOA 4DUYL 3GTOB 5IGBA 5D3IB 4POFA 4FF4A 3VR6A 1STAA 4DXGA 4IPHA 3VA5A 1WTOA 2O2LD 2BA0A 4QIWE 4DV5L 2LSSA 3KBXA 4JBKA 3T1YL 4DAYB 5BN5A 1TXYA 3EA6A 4IALA 1SMYD 3H6MA 4YCVA 2YYZA 2JA8B 3C2PA 1H95A 4X62Q 3PUXA 4DXFA 1Q90A 1BXTA 1VMCA 1PTOD 1AP0A 4F8MA 1EWIA 1HTPA 3J80i 1N33Q 1A2UA 1YNJD 3A8IE 1O7LA 4DV3L 1K0RA 1IXRA 2MHVA 1EZ6A 3TN2A 1J5EQ 4BY7H 4DR1Q 3OOCA 2VB3X 2NVXB 4QCLA 4BA1I 3CP0A 1U4PA 4ME5A 4A4IA 3PUWA 5GADC 3BZKA 1WCMH 1RODA 1S5DD 2HCCA 2J7ZA 3I4MG 4L6TB 5FLXE 1MIUA 4KHPL 3GTQH 1Q3LA 2K05A 3T13A 4X64Q 4A3CH 3TBIB 3HOYB 4R8IA 3CHBD 1IYJB 4AH6A 2JQOA 2KOLA 3I4NG 1QWYA 1A3TA 1HH2P 2N3SA 3R3OA 2A73B 2F0EA 4A3IG 1STHA 3KF8A 4N8X1 3LX0A 5ELOA 1E1TA 1UEBA 2NN6G 2N8NA 3D3RA 5KRUA 1YI2A 2RCFA 1ZYRC 4P72A 3S2DB 2NYZD 3M85A 5IOCA 1DJRD 3BVMA 2LS01 5IYCH 1R9TB 2RDHA 4QUCA 2F0SA 4U673 3SK4A 5E4WC 1KIXA 2AUJD 3RLNA 1OO9B 4AQYL 2R7FA 2RBMA 1JE5A 3DUZA 5LMNW 3H0GB 2WIIB 1CSPA 3LNNA 1JCKB 1RKNA 3NQIA 4H02A 2SNMA 1IL8A 1NR4A 4IPGA 5J1ZA 3S1QB 2PI2E 1QG7A 2PNRC 2V1CC 4PZ6A 2EE1A 3PCOB 1NMGA 3MEHA 3ND9A 5C4JB 3D6CA 3SK8A 4C2MB 3D4DA 4ZKCB 4IUTA 1Y1VG 1LO5D 1QNUA 5LL6X 1N32Q 2X6GA 3KF8B 3ER0A 3EJIA 1AE2A 5C0XI 1ILQA 4B3SQ 2PMZB 2F0JA 5KGUA 4KD3A 2E76C 3PIOA 5EPJA 2E2JH 1WTXA 3P7JA 1EIYB 2R93B 1G6ZA 2EYMA 1X3EA 2CQOA 1KDCA 1HNXL 4X6AH 1VQAA 3E9HA 4OIJA 4OHJA 3NSWA 1O7YA 4C3JB 4OWXB 1I50B 4WJ3M 4P75A 5DEHA 5GQOA 1YHBA 1E24A 2D5DA 1SAPA 1CZWA 3L9AX 2GVAA 3K7AH 3UDFA 2Q2IA 1D7QA 1SNDA 2BE5C 5EJWA 3S16H 5C44G 4GN3B 5IT9c 3QR8A 2EY5A 3SR1A 3RZDH 2YU9B 4JI7Q 1GOZA 2ZM6L 3HOZG 2B2YC 3GTPB 4A93H 2G5DA 3I91A 4A3EB 2NVQB 3QJYA 2XSCA 3WOFA 4NB3A 3OW2A 2WP8J 2MO1A 2UUBQ 2ZTCA 4IFDG 4BXXG 1HNWQ 4LF6Q 1VF7A 2ZXPA 2L12A 4CDFC 4L5SA 1IBKQ 4RA8A 3GTJH 4TVAB 4A3FB 4PMWA 2Z4IA 4GZYC 5ELDA 1GUTA 4YCWA 4KY7A 4B9WA 5KIXA 3S2HB 5E4XA 4YWKA 2RVLA 3CF5A 4HCSA 1SR3A 4JV5Q 4DV7Q 3JAMi 2KJXA 1EUJA 1PRTC 1VQ5A 4Y52H 1I5FA 2A1AA 4GN4B 1ONLA 2NWGA 3CW2C 3PUZA 1TWGB 3ND8A 3K58A 2J4XA 3DXJC 2WINB 3RLOA 1SNQA 4DR2Q 1WTVA 2F4VQ 2XVSA 2UUCQ 1MSGA 3RN2A 1ENAA 3KUPA 2JYOA 2QDBA 4PZ8A 3UDIA 4LFCQ 4V0BA 4Q5VA 1SYFA 3S17B 1TS3A 1Y8OB 3B6YA 2HT1A 1B9NA 1X54A 4DNRB 1PYBA 1C4QA 2NVYH 2JE6I 3FP9A 2ZT9C 3E0JA 3V2TA 1HA5A 1TWAB 3J80c 2A69D 3V05A 2K14A 1E22A 4JI8L 3M4PA 3T4AC 3KLWA 3SK5A 4DK0A 4DFAA 1PH9A 3U50C 4OIKA 4L8JA 4DR3Q 3TRZA 4BS9A 2Z1CA 3BU2A 4ZRZA 3MEFA 2MGSA 1F2ZA 2B2UC 5DNFA 4P2CB 1Y1WH 4KKSA 4R8NA 5C5LA 2C35B 2RQXA 4NXNL 4M1UB 4TSSA 3GTGH 1Z47A 1EIHA 3NELA 3SVMA 3NQTA 4V190 3A5UA 1ML0D 1YJ9A 2K1BA 3HKZE 2LY7A 2IJ0A 3NENA 3VR2A 1SYCA 3WDNA 5H1SE 3H15A 1QZHA 2F0QA 2CQAA 5FO7B 5E3FA 2JA6H 5KNDA 2KVMA 3FKIG 2VS1A 3DHQA 1YNND 2B39A 4GNXA 2CW0D 2N55A 5CV7A 1WTQA 3RD4A 1B7YB 3OTOL 1BUVT 3GDEA 4BY1H 2VW9A 2SNSA 3HOUG 3J7A5 3J81c 2EY2A 2ASBA 2EXZA 2JA7B 1A6XA 5IIFA 3CC2A 5IT9L 4NDXA 2KCCA 2ZJRA 4FDBA 1I94Q 2RSNA 2K52A 1FNVA 1WFQA 4U68A 2AQ3B 3FPPA 5LHY1 1E7ZA 1UE5A 1LTSD 5HURA 4QY7A 2M9VA 4KN7C 3HKSA 4ZCKA 3FPUB 3D8GA 4X65Q 3K5LA 4UY8C 1AZQA 1CT1D 5EKKA 1D5ZC 4JC0A 3MTSA 5IP9H 3UE0A 2E74C 4BBRB 3F2CA 3U9OA 2UU9L 2OXPA 1K8OA 3CCLA 4LF7Q 2WB1E 2WV6D 1A2TA 2H4OA 1V1PB 3OW7A 5FLMG 1V9PA 3CCUA 1JMCA 2F0LA 3C1FA 1N36Q 3S14H 5TSSA 2E5LL 1XJVA 3K5NA 4GN5A 3NTKA 4BWGB 1HTLD 4CHTB 3K8AA 4NMZA 2B8GA 1XMOQ 1CK1A 1XNQL 4HR7B 2CH4A 3OPOA 3BDLA 4DN4M 3NWSA 3T56B 3U4ZA 3BDOA 3G48A 1I4QA 1PH6A 1K83B 3PO2B 1RTNA 4HN7A 4L63B 3LGJA 4K5XA 4C3HB 3HOVG 4MTNA 2I5LX 4LFBL 1J8IA 1JOOA 1D6EC 2OQKA 1RD9D 2LXJA 3RZOB 1SYGA 1SYEA 3N52A 3J80L 1F77A 4B3TQ 4C3IB 1BBWA 1R9TH 3ONAB 1EL0A 3FDTA 4LJZC 2KHIA 2PCFB 1CHPD 3KOJA 4WJWA 5C3EH 3L2PA 4A3JG 5JOBA 4EX5A 4ME3A 1J9OA 4R1JA 1X3PA 3SK6A 4DR5L 3PO3H 3CQZB 4JI5L 4A3DG 2IPKD 2HIXA 2PW7A 1ASZA 4I65A 4ZK9B 2R7DA 3AFPA 4CGYB 4YY3L 2NVTB 4A3KB 4OX9L 4JYAL 5C4HA 4ZQ3A 1ZEQX 3H3VH 2N78A 1LT6D 3JAMc 3M3YB 1PTOC 2B2YA 2I5HA 1TS2A 3QOJA 2Y0SE 2BCOA 2EYOA 2NTTA 1CHQD 2PPBC 1TWFH 1YNJC 3HOXG 2KHJA 4NKLA 3HOWG 1BDOA 2F0GA 1EFWA 1K8MA 1H9RA 3TZDA 5JJLA 3L3OC 3R93A 2CWAA 4AYBB 4MNOA 2XTIA 4CKCA 4YHHQ 3PSIA 4G57A 3STBD 5C4XH 1D5MC 1EY8A 1SN8A 3F2DA 1FR3A 2DJFC 5JVH3 5M3FB 4RCOA 1LTTD 4ID6A 5M5YH 1Y8NB 5JJKA 1X3QA 1O78A 3J81L 1T5XD 1YJNA 3TZUA 4P74A 2GA4B 5EPKA 1WOCA 3AYHB 2VQFL 2AWOA 2R7ZB 1C9OA 2JA8G 1O80A 5HY6A 1Y69U 4OXPA 3I4MH 5LMUL 2F0KA 4OGQC 3H09A 2F0WA 3I4LA 1CTMA 3CD6A 2B8FA 1VQKA 1FL0A 4DUYQ 2RHSB 1SFOB 4K6DA 2IWHA 1JWSD 1NAPA 3GTMB 3EFXD 2YU9H 3I4NH 2DNEA 3VA7A 2F0HA 2E2HH 2HQLA 4A3IH 3CAMA 3JC66 3KLSX 1T5EA 3DEOA 4X66L 3S1MB 2F0UA 4DV5Q 1SLJA 3LWEA 3I8ZA 1B44D 2NN6H 1ZXTA 2K6AA 3T1YQ 4DV4L 3PQIA 1EQTA 2L0CA 5JEAG 1B9MA 2Z6KC 2F0OA 1NE3A 4K5VA 3M7GA 4K8JA 4CKBA 4HIDA 1K9MC 3TREA 4C56C 2EDGA 2G9HD 4JG2A 1Q86C 1N8RC 4JPBW 4A76A 1HZ9A 2OQ0A 3W5OA 3G4SA 1HZBA 1YITA 3A8JE 3HOYG 1ILPA 1L1OA 4JBWA 4K8IA 1PRTB 3CCJA 2F3VA 2WKDA 1DGSA 5C0XJ 3CKIB 2OTJA 3ITPA 4DAYA 4A3BG 4JI1L 2BA1A 1STEA 1CKMA 4C1NK 1SNPA 5CV9A 1MD2D 1YHQA 5I4DA 2IHEA 1C48A 5IWAL 1SE2A 2XIWA 1QZGA 4Q0FA 2OF1A 3UDGA 1TKWB 4KKUA 1RDPD 1Y1VH 5IGFA 1R4QB 4KHPQ 1JJCB 2RCNA 4HEDA 1E2ZA 1STBA 3H0GG 1F9PA 4IUQA 1ESRA 3DWPA 3QG1A 4DV0L 4QMGA 1FVIA 2SEBD 1PVOA 1IZ6A 1K73C 1PFSA 3SDZA 1QCBD 5NUCA 3S15H 4H13C 3C3LA 4ZKBB 1IW7D 5IE8A 2R92B 1L1OB 1PH7A 1L0XB 5EBDA 2K33A 3MXGA 1W3SA 1TS5A 4DU9A 3CCVA 3S1RB 5IT9E 2BH2A 5M3MB 3QO2A 5F2DA 1I4PA 5AFWA 1LACA 4DR6L 3JAML 1EYAA 2LFNA 2Q2TA 1KLUD 1RJTA 4AQYQ 4XYOA 4MZ9A 2B63B 5I6YA 3OYYA 4PV1C 3T16A 1TWCB 2CWPA 1JOQA 2Z4HA 1EY9A 4JOIC 3F2BA 4XIGS 1UNSA 1DZ1A 2L5TA 1EEID 2IX3A 5C44H 3MXNA 2M00A 2SDFA 1U5KA 2R93G 1TS4A 3HOZH 1I4XA 4WORA 4DV2L 1LLRD 1UE6A 1X6OA 3TDQA 1AW7A 4M8AA 3TS0A 2KA7A 2K5QA 2BDOA 2YTXA 3QB3A 4B9XA 2AHOB 4C3JG 1PYSB 1VQHA 4PNYA 2F0NA 4IFDH 4BXXH 1CA6A 1EIFA 2V4DA 1SJHD 3UDXA 1Q81C 2OWOA 1EY0A 1D1IA 1EOVA 4JI6Q 1SXTA 4HCEA 2XWJB 3PIP3 4LF5Q 2NZ1D 5JJZA 3KLSA 2DJGC 4GKKL 3C46A 3CU7A 3FMCA 4DNIA 1FNWA 3M4YA 4FP5D 1NY4A 1AE3A 1ICFB 1WVLA 1KDAA 1EWCA 1M8AA 4FNFA 1I4GA 4A3EG 4A3BB 2K5DA 2SOBA 1QB5D 4K0KL 5CV5A 2YTYA 1OXVA 5IYBG 4IURA 1ET9A 1KRTA 1CFMA 3MXNB 1PFNA 3J7ZC 1XTDA 3SGIA 1AH9A 4A3FG 3RMHA 5K36G 3GTLH 1SE4A 1P16A 1LV9A 1BR9A 1PDQA 2AMCB 2MJ8A 3K5OA 2A69C 2H5XA 4E6IA 3J80E 2B2TC 2ZM6Q 2JA5B 3TP5A 1FYCA 2QDLA 5CV4A 1B4OA 4JBJA 2HCIA 4BBSB 3PV0A 5M5WH 1RHPA 4PMBA 4DV6L 2D0OA 4RHRA 1D2BA 2E2IH 1UE7A 2MNAA 3G7LA 2K75A 2A8VA 1Q82C 1YIJA 4FF1A 3M4OB 3GV6A 2K5VA 2FFKB 5FO8B 1KNEA 2ZTEA 4OELB 3PUYA 2NZHA 3W1GA 4JI4L 4ZLTF 2L55A 1VQMA 3M7NA 4A3LG 1QE6A 5JJIA 1EY5A 4ABNA 2JXMB 2XWBB 2O4XA 3W2DA 4X3TA 3IFDA 1CZGA 5T1GA 5C3XA 1KXLA 5K5PA 4N8FA 5EKLA 3NWTA 4LF9L 2KCTA 4DR7L 5LL6S 1PHJA 1YNNC 4HMIA 3CC4A 4LNQA 2D9UA 2CW0C 4QB4A 5G3LF 1ASYA 1HCZA 4GKJL 2TSSA 1LABA 2KBNA 1K3RA 1G8ZD 5M9OA 1HFNA 2K5WA 1PYWD 3P75A 4XT3B 1NSNS 5M5XB 4JI2L 1D1KA 4JW0A 2XRQD 5CBAE 3RZOH 2RA4A 2F0TA 3J81E 1PZKD 1TU2B 1I3QH 3FKIH 3CCEA 3KF6A 1BCPC 3A8KE 4YCUA 1HZAA 4OWWB 2I0QA 1I6VC 1M4VA 2BDNA 1S5BD 4KJNA 3S9WA 5I6WA 4XT1B 3LWUA 1QVFA 1NR2A 3SE0A 4DNTB 2EPBA 3KK7A 5C5MA 2L9HA 1T9HA 2I07B 4LUVA 2VUMB 1JWUD 3HOUH 4A3GB 5IGEA 2JEAI 1PTOB 2JJQA 3HZXA 3KDFA 3DLLA 2A6HC 5A2QL 5IGCA 1LM0A 4K6LA 4PG3A 4UHVA 4JI8Q 4DK3C 1WTWA 1KC8C 1EOTA 2B2WA 4EGVA 1VQ8A 1PV4A 1WYDA 1KRSA 2JK8A 2E2DC 5ELBA 4OONA 3HG9A 1V1OA 3OSOA 2Z6KA 1QVCA 4X3KA 4Y7NB 1C8CA 1U4RA 2C9OA 1KHIA 3SHLA 3G71A 4NXNQ 3CCQA 4J8QA 3OHXC 4ZUIA 2JA7G 1MBYA 3FHWA 3KF6B 1WD1A 4L5QA 3FVQA 3ERSX 4F87A 3H3VI 4A3MB 1X3GA 1ENCA 1FNUA 5I2YA 5LMNL 4CJ1B 2BOSA 1LT4D 2PQAA 3QWNA 5FLMH 2IL8A 1W2BA 5A35A 3IAYA 3IL8A 4ULLA 3KDFB 3GTKB 2F4IA 3OTOQ 1CSQA 4J15A 5FLXc 1CKNB 3K80C 3M9BA 4CDCC 1IYUA 1FGUA 1S5FD 2MFIA 4QIWB 5ELFA 1U0LA 3AMUA 1JJGA 1W6JA 3OIPA 3E3XA 3SXHA 5DM73 4HIKA 3NBIA 1O7ZA 2D62A 1SRUA 3TEHB 1XPRA 1SFOH 3IRBA 2LMCB 1VQBA 4BBRG 1RL2A 4IUNA 3VR4A 3HOVH 2Z0SA 3D4RA 5IP7G 1JJ2A 1ZYRD 2KENA 5BR8Q 2RKSA 1C0AA 3M4QA 1Z7TA 3CRLC 3EBEA 3NE5B 1PRTF 4JCVE 3AB9A 4R4OA 3S1NB 4RHSA 1AEXA 5CYUA 4JK1C 5G3LD 1BBXC 1CQFA 3JAME 4A3JH 2UUAL 1PH2A 3KFUA 5HGQA 4A75A 2PQAB 4OO1G 1G291 1I6HH 3BJUA 4A3DH 2UU9Q 4DUZL 3PO2G 1HNWL 4LF6L 1E3PA 1AN8A 1IBKL 4IZ8A 4JOIA 4C3HG 2Z6BA 1N34L 3A0JA 2NN6I 3VYRA 5J3BA 1XNRL 4RGMA 1UUPA 2UXCL 2E5LQ 2K03A 2RF4A 4DV1L 4KY6A 1PFBA 4C3IG 3I90A 1WTHA 1DD2A 3HOXH 2GN5A 1XNQQ 4KHZA 3HOWH 3F2UA 5FKAC 5GAGC 1A3UA 2F0DA 1V1PA 2F3WA 3OMGA 4GOPC 4XYQA 2WACA 3PUVA 3K0XA 1BF4A 4HIMA 3VR5A 1WCMB 2DY8A 4A3KG 3GTOH 3H91A 1DOLA 4LFBQ 4KI0A 3GTQB 3Q6SA 3X3MA 1SE8A 4ZUJA 1G6PA 1IYVA 1I4RA 5KYIA 2EZVA 1BOSA 1Q1EA 5IGDA 2EQSA 4IO9A 3TQYA 3I73A 2MUYA 2E75C 3TSSA 4IUVA 1L2FA 5KYLA 1H9SB 2QGQA 3ZYYX 2JA8H 4DR5Q 3KJPA 2AQ1B 1VQOA 4JI5Q 1Q8KA 4RMFA 4AYBG 3J7AV 2FINB 3SEBA 4LFAL 2BE5D 4YY3Q 3TP8A 3ZJYC 1UEAB 4OX9Q 4JYAQ 1U4MA 2CKZB 1S5CD 1A3VA 2A6EC 5M3FG 2WFWA 3DMUA 1EFID 2EJFC 4FYDA 3HEJA 2J0TD 1YEZA 2QKIC 4PMCA 4LF4L 5T1IA 2NVXH 2R7ZG 1SROA 5JEAH 2QILA 1PH5A 3GD7A 4LWCA 1F2LA 4PQXA 1YVCA 2F0PA 3E9IA 1J6QA 4IQZA 3D6WA 3DWQA 1TIID 1QILA 4RGNA 1ESFA 3KLRA 5CR3A 1P8LA 4JI0L 3HOYH 1SSOA 3H3VC 4P71A 1F9RA 1FJGL 1PMRA 1FD7D 5DM63 3K7UC 1HR0L 4LF8L 5ELNA 3DEPA 4A3BH 1PRTD 1YHAA 3U58A 5CV8A 4IOCA 3I55A 2VQFQ 4XQNA 4GLVB 1PH3A 4ZYSA 2OTLA 4IFDI 1KL9A 2OEOA 3S2DH 2ID0A 3HRZC 2E2JB 2EYLA 1SYBA 5LMUQ 1RIPA 1VCIA 1GUSA 2C5CA 2OT2A 1KLGD 1LTAD 5AJ3L 1YJWA 1TY2A 4H0LC 1XWEA 3H0GH 1XPOA 1GM5A 1NMFA 3HFZB 1SMYC 1SNMA 3MC0B 4X66Q 1EQQA 2Q8RE 3S1QH 1NTGA 5JVG3 4HJ5A 1G51A 3CCSA 1LTLA 1MKHA 3K7AB 4DV4Q 4OEMB 1CI3M 1ZKOA 1JICA 2QEJC 2EVBA 3S16B 5C4JH 3RZDB 2UXBL 1XTCD 4HAEA 1Y1WG 2VXWA 4C2MH 2ZTDA 1GJXA 2F0VA 4X3SA 1QJOA 5A2QE 4ILWA 1ENFA 1A63A 4YWMA 4UP9A 3MVVA 3U4VA 1KABA 2CHBD 2GVBA 3TP6A 2IY5B 3ULLA 5CMDA 1A0IA 1U4LA 1RTOA 3T1HL 3GTJB 2JA6G 1SNCA 3MWYW 3NHHA 3CC7A 1VF5C 2R93H 1WTPA 2K01A 2R92G 4B3RQ 4MTKA 1NCVA 3VR3A 3OIQA 3N6RA 4RWSC 4C1NI 1C7YA 4C3JH 5GAEC 4ALPA 1I50H 5M3MG 3F1ZA 1IL2A 1BCPB 4H7BA 2HHHL 4QJFA 1UAPA 1HZCA 1W6KA 5M5XH 4RH6A 1XMOL 2VB2X 3K57A 3A5ZB 2B63G 4DK1A 4LUZA 4CDEC 1IBML 3K59A 1H9JA 4DV0Q 5I9PA 2G9DA 4EQ5A 3J7YW 3D31A 4KHVA 3D0FA 4HJ9A 2PMZE 4KD4A 3IFTA 5CC4A 2JN4A 3GTPH 2EY6A 4OO1I 4HJ8A 1JQYD 5C0XG 4A3EH 3QOLA 2NVQH 2AQ2B 3PMFA 2MQHA 4EQPA 1MSHA 1NUCA 5IYBH 4DR6Q 1VQ7A 2VY3A 4NW2A 1PH1A 4QUFA 3AEVA 4O2DA 5IY0A 4NXML 3UI2A 3MHBA 1GUGA 2NVYB 4A3FH 2XGTA 2OCEA 5K36H 3HKZB 1WTRA 3S2HH 2XN9C 3K6OA 5BN3A 2LXKA 1CKOA 3BYYB 4DV3Q 4YWLA 3Q8DA 1JB3A 3U9SA 3TS2A 1OXXK 4DV2Q 3CXCA 4J6HA 1VQGA 4UP8A 2IT1A 4BA2I 1OXSC 2B2UA 1WJJA 3NTIA 4FO2A 1TWGH 1Y1WB 1ET6A 1SEBD 3PIPA 1SNOA 1TVXA 1HUNA 2FMCA 4RKLA 2Q2UA 4AIMA 1IBLL 1BO0A 1PFMA 4GKKQ 4FXKC 2RSOA 3RN5A 4I7ZC 3GTGB 4HIOA 4QF4A 4A3LH 1X3FA 2EYHA 3GP7A 4O42A 1K3BC 1YZ6A 2JA5G 2QF7A 3KBGA 5CGKA 3WOEA 4BBSG 4XDXA 3Q22A 3S17H 2JA6B 1Q8IA 2TMPA 1B53A 4K0KQ 2XRSD 1F2YA 4IUUA 1HUMA 3AQQA 3UE1A 5C6AA 4GOPA 2K5NA 2EOTA 1TWAH 1HNZL 2UXDL 4BY1B 2EYPA 2RHQB 5C4ZA 4HJAA 2IX1A 1EYGA 2YV5A 3NPPA 2JP1A 1V1QA 2KCMA 1LUZA 3CCRA 2RDGA 3NBHA 1NBWA 3VYSA 4FF2A 4UAIA 4JI3L 2WB1B 1S72A 4TRDA 3S1NH 2PQEA 5KNCA 4DV6Q 1JR0D 3KYHC 2VQEL 5DAUA 2A68D 1Z6HA 1DCZA 3ULPA 4FVMA 1B50A 1EU4A 3GQBA 4B3ML 1GO3E 5EPLA 1EQVA 1BQQT 4NPSA 4JI4Q 4HSVA 2O5IC 2AKWB 1XMQL 5C4XG 5C3EB 1GD7A 4DAPA 1DYQA 2ENBA 5HGTA 5D3DA 1GKHA 4GOPB 2F3IA 1HFGA 1EEFD 1UE1A 1KD1C 2Z9HA 4DF7A 2WAQG 1IKMA 4F7XA 4K14A 4LF9Q 4ODGA 3BVGA 4GNXC 4DR7Q 3EVQA 1X55A 2DUDA 2VUMG 3S14B 1HNXQ 4GLXA 4A3GG 4WFN3 3NBHB 1AZPA 2JA7H 4GKJQ 4DR4L 4HJ7A 5EQ0A 3MFGA 3MXUA 4JI2Q 5FO9B 5JAVA 2BH8A 2O5JC 1EZ8A 1ICWA 1I4HA 1HPCA 3PGZA 3V96A 3BVZA 3CRKC 4FF3A 5E1FA 2HDMA 3CMAA 1VMPA 4RCNA 2Y0SB 1MHWC 2N88A 3C1EA 3I2ZA 4ZAIA 4CDDC 3EROA 1LTGD 2F03A 4KY5A 4DGZA 1S40A 4BBRH 4A3MG 1TWHB
chains in the Genus database with same CATH topology
4DK6C 1QUQA 4BBRG 3J81i 1VQDA 1PH6A 3CPWA 1RL2A 1X9NA 4X62L 1MJEA 1Z9FA 1S3OA 3HOVH 3LGJA 5IP7H 1Q7YC 5IYDH 4YHHL 1JT8A 2Z0SA 3HOVG 3GTKH 4MTNA 5IP7G 5IYDG 1JJ2A 2I5LX 4LFBL 4GS3A 4QL5A 2KENA 5JEAJ 5BR8Q 2OQKA 1HJPA 1C0AA 3M4QA 1N33L 2LXJA 3EBEA 2Y0SG 4R4CA 1Y14B 4JCVE 1VQIA 2FXQA 4B3RL 4B3TQ 4R4OA 1BBWA 4DR4Q 1R9TH 4R4QA 2KHIA 2K50A 4A3JH 3KOJA 1J5EL 3F8TA 2UUAL 1PH2A 5C3EH 3L2PA 5FJ8H 5HGQA 1BBUA 1VQJA 4A75A 4EX5A 2PQAB 4DR1L 5C3EG 4ME3A 1G291 5FJ8G 1VQPA 1K83H 4R1JA 3I7FA 4DR5L 3PO2H 4DKAC 3PO3H 1I6HH 3BJUA 4A3DH 4JI5L 3PO3G 2UU9Q 4DUZL 3PO2G 1HNWL 4LF6L 4A3DG 2HIXA 1ASZA 1WI5A 1E3PA 5LMNQ 4JI6L 4C3HH 1IBKL 2R7DA 4JOIA 3AFPA 4WJ4A 1N34L 4YY3L 4R4IA 3KJOA 4LF5L 4OX9L 3A0JA 4JYAL 2NN6I 5J3BA 4X64L 4DUYL 3H3VH 2N78A 4UPAA 1XNRL 3JAMc 4POFA 2UXCL 5GAHC 2E5LQ 2D0PA 2RF4A 4C3IH 4DV1L 2I5HA 2Y0SE 4IPHA 1QUQB 3HOXH 1TWFH 2GN5A 2BA0A 4QIWE 4KHZA 4DV5L 1XNQQ 3HOWH 3HOXG 2KHJA 2LSSA 5GAGC 4JBKA 3HOWG 1BVSA 3T1YL 4DAYB 3CQZH 1TXYA 1EFWA 4YCVA 2YYZA 1PH4A 2JEBI 4PZ7A 4GOPC 5JJLA 1JB7A 1H95A 2CWAA 1K8AC 3S24A 3PUVA 4X62Q 3K0XA 4HIMA 4L5RC 3PUXA 4MNOA 2XTIA 2NVTH 1A8VA 4YHHQ 4A3KH 3PSIA 3STBD 4POGA 5C4XH 1CKNA 4A3KG 3GTOH 4LFBQ 1SN8A 4KI0A 4TQUS 3I56A 3F2DA 4OO1G 3M3YH 2K5HA 1EWIA 3J80i 1N33Q 2VL6A 3NEMA 1SE8A 4IOAA 1G6PA 5M5YH 4DV3L 5JJKA 1K0RA 1IXRA 1YJNA 1Q1EA 2EQSA 4IO9A 3TQYA 4P74A 1WOCA 3AYHB 1J5EQ 4BY7H 2UUAQ 2VQFL 1L2FA 4BY7G 2AWOA 4DR1Q 2QGQA 2ES2A 2JA8H 1C9OA 4DR5Q 3KJPA 4BA1I 1VQOA 3CP0A 2JA8G 1KQSA 5HY6A 4JI5Q 4DUZQ 4A4IA 1Q8KA 3PUWA 4RMFA 4OXPA 4AYBG 5GADC 3BZKA 3CPFA 1WCMH 5LMUL 3I4MH 4LFAL 3I4MG 1WCMG 1VQ4A 1N34Q 3G6EA 4YY3Q 1NJIC 3CD6A 1MIUA 3ZJYC 3GTQH 4KHPL 4OX9Q 1VQKA 4JYAQ 1FL0A 4X64Q 2CKZB 2RHSB 5M3FH 4DUYQ 1XNRQ 4A3CH 1N32L 3L7ZC 4A3JG 1IYJB 5M3FG 2YU9H 4A3CG 3I4NH 2UXCQ 2WFWA 4AH6A 2JQOA 1VQNA 2NZOA 4DV1Q 1HH2P 2E2HH 3I4NG 2HQLA 1EQRA 2N3SA 4A3IH 3CAMA 3JC66 4B3SL 4A3IG 4X66L 1N9WA 1YEZA 4LF4L 4DV5Q 2R7ZH 1SLJA 2NVXH 5ELOA 1E1TA 2R7ZG 1SROA 3T1YQ 1UEBA 2NN6G 2N8NA 4DV4L 1YI2A 1PH5A 4IFDJ 3GD7A 5JEAG 2Z6KC 3RR5A 1NE3A 4LWCA 1YVCA 3E9IA 1J6QA 4P72A 4DPGA 4HIDA 1K9MC 3TREA 1N8RC 3M85A 4JG2A 1Q86C 4A76A 1HZ9A 2OQ0A 4IJHA 5IYCH 3W5OA 3G4SA 4AYBE 1HZBA 5IYCG 1YITA 2K4KA 1P8LA 4JI0L 3GTMH 3HOYH 4P71A 1KIXA 3RLNA 3HOYG 1L1OA 1B8AA 4JBWA 1FJGL 3CCJA 4AQYL 2R7FA 1PA6A 1JE5A 1DGSA 1YNXA 3K7UC 5C0XJ 2VZAA 5ELNA 5LMNW 1HR0L 4LF8L 2OTJA 3S1MH 1CSPA 4A3BH 4H02A 4JI1L 1YHAA 4A3BG 2BA1A 3U58A 1CKMA 4IPGA 4IOCA 3I55A 2VQFQ 1YHQA 4GLVB 4RG1A 1PH3A 4QQBX 3GO5A 2OTLA 4IFDI 1KL9A 2PI2E 2EXDA 2IHEA 5IWAL 3S2DH 2ID0A 1K8GA 2V1CC 4PZ6A 3PCOB 1VQ9A 1NMGA 1QZGA 4JI7L 5LMUQ 4LFAQ 3UDGA 1RIPA 1VCIA 1Y1VH 4KHPQ 1Y1VG 1GVPA 5AJ3L 1YJWA 1JJCB 1N32Q 2RCNA 2UUBL 3KF8B 3H0GH 1XPOA 1L1OC 3ER0A 1HR0W 3H0GG 1AE2A 5C0XI 1GM5A 2PI2A 3KFUA 1NMFA 3HFZB 4DV0L 4B3SQ 1EQQA 4X66Q 1FVIA 4LUOA 4LF4Q 3S1QH 1PVOA 1NTGA 4HJ5A 1IZ6A 1G51A 3CCSA 1PFSA 1K73C 1LTLA 1VQLA 1MKHA 4DV4Q 3PIOA 3S15H 2IX0A 2E2JH 3STBC 1SMXA 1EIYB 5C4JH 5IE8A 2UXBL 1Y1WG 1L1OB 4C2MH 4IJLA 2ZTDA 2ZJPA 1PH7A 1X3EA 1W3SA 2EIFA 2CQOA 1HNXL 1A63A 4X6AH 1VQAA 4JV5L 1X65A 3E9HA 4DV7L 3CCVA 4YWMA 2BH2A 4JI0Q 4UP9A 4OWXB 2L15A 3U4VA 4DR6L 4WJ3M 2Q2TA 2GVBA 4P75A 1FJGQ 4AQYQ 2IY5B 2DGYA 4MZ9A 3ULLA 5GQOA 1O7IA 1HR0Q 4LF8Q 1YHBA 1A0IA 3OYYA 1E24A 2CWPA 3T1HL 2GVAA 3ICEA 3K7AH 1CUKA 4JOIC 3UDFA 4XIGS 3F2BA 2Q2IA 4A3MG 2JA6G 4DR2L 1D7QA 2F4VL 5C44H 2UUCL 2IHFA 2ALYB 3S16H 5C44G 3CC7A 4GN3B 2R93H 2R92H 5IT9c 3RZDH 1U5KA 3E0EA 2R93G 2R92G 3HOZH 4B3RQ 1X56A 4JI7Q 2ZM6L 3HOZG 4A93H 4DV2L 1UE6A 1X6OA 3TS0A 4A93G 3S1RH 1C7YA 4C3JH 5M3MH 5GAEC 2YTXA 4ALPA 4LFCL 1I50H 2AHOB 5M3MG 1PYSB 3F1ZA 2CFMA 1VQHA 1IL2A 4NB3A 5AJ3Q 4QJFA 2WP8J 3OW2A 5M5XH 1HZCA 2MO1A 1XMOL 2HHHL 2UUBQ 4BXXH 2ZTCA 2B63H 4IFDG 1EIFA 4BXXG 3A5ZB 3UDXA 2B63G 2JA9A 1HNWQ 1Q81C 1OTCA 2OWOA 4LF6Q 1TWCH 4IPCA 1EOVA 2F52A 4L5TA 4LUZA 1IBML 4JI6Q 4L5SA 1V43A 4DV0Q 1IBKQ 3GTJH 1OXUA 4TVAB 2E8GA 3WWVA 4LF5Q 4EQ5A 2ATWA 3D31A 4APVA 3D0FA 1B70B 2QEXA 2PMZE 4PMWA 4HJ9A 4GKKL 4YCWA 1KAWA 3EN2A 1Q46A 2A19A 4DNIA 3GTPH 4OO1I 4YWKA 5BR8L 3CF5A 4HJ8A 3CCMA 2UXBQ 1NY4A 1AE3A 5C0XG 4A3EH 2NVQH 2MQHA 4A3EG 1SR3A 4JV5Q 4DR3L 4UP7A 3JAMi 4DV7Q 1EUJA 5IYBH 4K0KL 4DR6Q 1VQ5A 2YTYA 1OXVA 2VY3A 1I5FA 2A1AA 4XTCS 5IYBG 1VQ7A 1Q1BA 3J81j 2AWNA 4GN4B 3CW2C 4IPDA 1KRTA 1PH1A 1M1KC 3PUZA 4O2DA 3AEVA 3ULJA 1VS0A 5IY0A 1E1OA 4NXML 3MXNB 2QA4A 4GNXB 3J7ZC 1XPUA 1XTDA 3SGIA 3VDYA 3T1HQ 2MO0A 4A3FH 1AH9A 2XGTA 2OCEA 4A3FG 3RLOA 3CMEA 5K36G 4DR2Q 3GTLH 1P16A 2F4VQ 2UUCQ 2AMCB 3S2HH 1Q12A 3PF4A 2LXKA 1CKOA 4OWTB 3RN2A 2H5XA 4DV3Q 4YWLA 3Q8DA 3TS2A 2ZM6Q 1OXXK 3I4OA 4DV2Q 3CXCA 4JBJA 4PZ8A 3UDIA 1VQGA 4GLAC 2I5MX 3DM3A 3PV0A 2IT1A 4UP8A 5M5WH 1OXSC 4O0AA 4DV6L 2D0OA 3RNUA 4BA2I 2HHHQ 1WJJA 2E2IH 1UE7A 2MNAA 1OXTA 2K75A 3EIVA 3B6YA 1VQ6A 2VNUD 2ZJQA 2HT1A 1X54A 1TWGH 2A8VA 1PYBA 1YIJA 1Q82C 2B29A 1IBMQ 2NVYH 3PIPA 2JE6I 3FP9A 2K5VA 2ZTEA 2PNHA 3J80c 2Q2UA 3PUYA 4AIMA 2NZHA 1IBLL 3W1GA 4GKKQ 4JI4L 3HKZG 2K14A 3RN5A 1VQMA 4HIOA 1E22A 2B3GA 3M7NA 4A3LH 1X3FA 4JI8L 4A3LG 3M4PA 2JA5H 3KLWA 1I94L 5JJIA 1YZ6A 2JA5G 1VQCA 1PH9A 3U50C 4BBSH 3A74A 4BBSG 3S17H 3AFQA 4DR3Q 3TRZA 2Q2HA 4K0KQ 3BU2A 1KXLA 3BZCA 3MEFA 5DLQE 3AQQA 3UE1A 1Y1WH 4LF9L 2KCTA 1VQFA 3M4OH 1TWHH 4DR7L 2C35B 4GOPA 1PHJA 4NXMQ 3CC4A 4X65L 4LNQA 2K5NA 1TWAH 1HNZL 2UXDL 1VQEA 2RHQB 4NXNL 1ASYA 4HJAA 3PF5A 1EYGA 2IX1A 2YV5A 3GTGH 4GKJL 1Z47A 2KBNA 3NELA 4LW1A 1K3RA 5GROA 3A5UA 1V1QA 3L0OA 2KCMA 1YJ9A 1LUZA 4JI2L 3CCRA 1M90C 3HKZE 1LYLA 1NBWA 3RZOH 3NENA 4JI3L 1QZHA 5H1SE 3H15A 1I3QH 3FKIH 4JI1Q 3CCEA 1S72A 3KF6A 2JA6H 3S1NH 4YCUA 3FKIG 4LF7L 1HZAA 4OWWB 2YTVA 2CCZA 4KLKA 4DV6Q 1BKBA 2I0QA 2VS1A 3KYHC 2VQEL 4GNXA 5IWAQ 5E7NA 1QVFA 1N36L 1B7YB 3OTOL 3ULPA 3GDEA 4BY1H 2VW9A 1T9HA 1D8LA 4LUVA 4B3ML 4BY1G 2R6GA 1GO3E 3HOUH 4JBMA 4QGUA 2JEAI 3HOUG 3J81c 1MJCA 2JJQA 4NPSA 2ASBA 3KDFA 3DLLA 1IBLQ 3J7A5 4JI4Q 1QVGA 3CC2A 4LFCQ 1LM0A 2AKWB 1XMQL 4PG3A 4JI8Q 2ZJRA 4DK3C 1KC8C 4FDBA 5C4XG 1GD7A 1I94Q 1VQ8A 1PV4A 3W1BA 1WYDA 2K52A 2WB1G 1WFQA 1KRSA 2JK8A 4P73A 1L0WA 4OONA 1GKHA 4GOPB 2F3IA 2N49A 5EAYA 1E7ZA 1UE1A 1UE5A 1KD1C 4QY7A 3HKSA 2WAQG 4LF9Q 2Z6KA 1QVCA 4GNXC 4DR7Q 1KHIA 2VUMH 1X55A 4A3GH 4X65Q 2DUDA 2VUMG 1HNXQ 4GLXA 1HNZQ 4A3GG 2UXDQ 3G71A 4NXNQ 3NBHB 3K81C 4DAMA 3CCQA 4B3TL 4UY8C 2JA7H 4Y52H 4GKJQ 4DR4L 4HJ7A 2JA7G 3FHWA 3KF6B 4JC0A 4L5QA 4JI2Q 5IP9H 3RLFA 3ERSX 3H3VI 5IP9G 3UE0A 2BH8A 1X3GA 4JI3Q 3F2CA 2UU9L 1A62A 1YBYA 3CCLA 3PGZA 2WB1E 5LMNL 4LF7Q 2PQAA 5FLMH 2HIVA 1W2BA 2VQEQ 5FLMG 1V9PA 4Y7NH 3CCUA 1JMCA 3KDFB 1N36Q 3CMAA 3OTOQ 1UWVA 1PH8A 3S14H 1CSQA 4J15A 5FLXc 2WAQE 2E5LL 1XJVA 1CKNB 3K80C 3M9BA 4GN5A 4B3MQ 3I2ZA 1FGUA 2MFIA 4R4TA 3K8AA 1U0LA 1JJGA 1XMOQ 1XNQL 4HIKA 2D62A 1XMQQ 1SRUA 3TEHB 1XPRA 4A3MH 1SFOH 3U4ZA 1S40A 4BBRH 3IRBA 1VQBA 3G48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DK6 C;  1QUQ A;  4BBR G;  3J81 i;  1VQD A;  1PH6 A;  3CPW A;  1RL2 A;  1X9N A;  4X62 L;  1MJE A;  1Z9F A;  1S3O A;  3HOV H;  3LGJ A;  5IP7 H;  1Q7Y C;  5IYD H;  4YHH L;  1JT8 A;  2Z0S A;  3HOV G;  3GTK H;  4MTN A;  5IP7 G;  5IYD G;  1JJ2 A;  2I5L X;  4LFB L;  4GS3 A;  4QL5 A;  2KEN A;  5JEA J;  5BR8 Q;  2OQK A;  1HJP A;  1C0A A;  3M4Q A;  1N33 L;  2LXJ A;  3EBE A;  2Y0S G;  4R4C A;  1Y14 B;  4JCV E;  1VQI A;  2FXQ A;  4B3R L;  4B3T Q;  4R4O A;  1BBW A;  4DR4 Q;  1R9T H;  4R4Q A;  2KHI A;  2K50 A;  4A3J H;  3KOJ A;  1J5E L;  3F8T A;  2UUA L;  1PH2 A;  5C3E H;  3L2P A;  5FJ8 H;  5HGQ A;  1BBU A;  1VQJ A;  4A75 A;  4EX5 A;  2PQA B;  4DR1 L;  5C3E G;  4ME3 A;  1G29 1;  5FJ8 G;  1VQP A;  1K83 H;  4R1J A;  3I7F A;  4DR5 L;  3PO2 H;  4DKA C;  3PO3 H;  1I6H H;  3BJU A;  4A3D H;  4JI5 L;  3PO3 G;  2UU9 Q;  4DUZ L;  3PO2 G;  1HNW L;  4LF6 L;  4A3D G;  2HIX A;  1ASZ A;  1WI5 A;  1E3P A;  5LMN Q;  4JI6 L;  4C3H H;  1IBK L;  2R7D A;  4JOI A;  3AFP A;  4WJ4 A;  1N34 L;  4YY3 L;  4R4I A;  3KJO A;  4LF5 L;  4OX9 L;  3A0J A;  4JYA L;  2NN6 I;  5J3B A;  4X64 L;  4DUY L;  3H3V H;  2N78 A;  4UPA A;  1XNR L;  3JAM c;  4POF A;  2UXC L;  5GAH C;  2E5L Q;  2D0P A;  2RF4 A;  4C3I H;  4DV1 L;  2I5H A;  2Y0S E;  4IPH A;  1QUQ B;  3HOX H;  1TWF H;  2GN5 A;  2BA0 A;  4QIW E;  4KHZ A;  4DV5 L;  1XNQ Q;  3HOW H;  3HOX G;  2KHJ A;  2LSS A;  5GAG C;  4JBK A;  3HOW G;  1BVS A;  3T1Y L;  4DAY B;  3CQZ H;  1TXY A;  1EFW A;  4YCV A;  2YYZ A;  1PH4 A;  2JEB I;  4PZ7 A;  4GOP C;  5JJL A;  1JB7 A;  1H95 A;  2CWA A;  1K8A C;  3S24 A;  3PUV A;  4X62 Q;  3K0X A;  4HIM A;  4L5R C;  3PUX A;  4MNO A;  2XTI A;  2NVT H;  1A8V A;  4YHH Q;  4A3K H;  3PSI A;  3STB D;  4POG A;  5C4X H;  1CKN A;  4A3K G;  3GTO H;  4LFB Q;  1SN8 A;  4KI0 A;  4TQU S;  3I56 A;  3F2D A;  4OO1 G;  3M3Y H;  2K5H A;  1EWI A;  3J80 i;  1N33 Q;  2VL6 A;  3NEM A;  1SE8 A;  4IOA A;  1G6P A;  5M5Y H;  4DV3 L;  5JJK A;  1K0R A;  1IXR A;  1YJN A;  1Q1E A;  2EQS A;  4IO9 A;  3TQY A;  4P74 A;  1WOC A;  3AYH B;  1J5E Q;  4BY7 H;  2UUA Q;  2VQF L;  1L2F A;  4BY7 G;  2AWO A;  4DR1 Q;  2QGQ A;  2ES2 A;  2JA8 H;  1C9O A;  4DR5 Q;  3KJP A;  4BA1 I;  1VQO A;  3CP0 A;  2JA8 G;  1KQS A;  5HY6 A;  4JI5 Q;  4DUZ Q;  4A4I A;  1Q8K A;  3PUW A;  4RMF A;  4OXP A;  4AYB G;  5GAD C;  3BZK A;  3CPF A;  1WCM H;  5LMU L;  3I4M H;  4LFA L;  3I4M G;  1WCM G;  1VQ4 A;  1N34 Q;  3G6E A;  4YY3 Q;  1NJI C;  3CD6 A;  1MIU A;  3ZJY C;  3GTQ H;  4KHP L;  4OX9 Q;  1VQK A;  4JYA Q;  1FL0 A;  4X64 Q;  2CKZ B;  2RHS B;  5M3F H;  4DUY Q;  1XNR Q;  4A3C H;  1N32 L;  3L7Z C;  4A3J G;  1IYJ B;  5M3F G;  2YU9 H;  4A3C G;  3I4N H;  2UXC Q;  2WFW A;  4AH6 A;  2JQO A;  1VQN A;  2NZO A;  4DV1 Q;  1HH2 P;  2E2H H;  3I4N G;  2HQL A;  1EQR A;  2N3S A;  4A3I H;  3CAM A;  3JC6 6;  4B3S L;  4A3I G;  4X66 L;  1N9W A;  1YEZ A;  4LF4 L;  4DV5 Q;  2R7Z H;  1SLJ A;  2NVX H;  5ELO A;  1E1T A;  2R7Z G;  1SRO A;  3T1Y Q;  1UEB A;  2NN6 G;  2N8N A;  4DV4 L;  1YI2 A;  1PH5 A;  4IFD J;  3GD7 A;  5JEA G;  2Z6K C;  3RR5 A;  1NE3 A;  4LWC A;  1YVC A;  3E9I A;  1J6Q A;  4P72 A;  4DPG A;  4HID A;  1K9M C;  3TRE A;  1N8R C;  3M85 A;  4JG2 A;  1Q86 C;  4A76 A;  1HZ9 A;  2OQ0 A;  4IJH A;  5IYC H;  3W5O A;  3G4S A;  4AYB E;  1HZB A;  5IYC G;  1YIT A;  2K4K A;  1P8L A;  4JI0 L;  3GTM H;  3HOY H;  4P71 A;  1KIX A;  3RLN A;  3HOY G;  1L1O A;  1B8A A;  4JBW A;  1FJG L;  3CCJ A;  4AQY L;  2R7F A;  1PA6 A;  1JE5 A;  1DGS A;  1YNX A;  3K7U C;  5C0X J;  2VZA A;  5ELN A;  5LMN W;  1HR0 L;  4LF8 L;  2OTJ A;  3S1M H;  1CSP A;  4A3B H;  4H02 A;  4JI1 L;  1YHA A;  4A3B G;  2BA1 A;  3U58 A;  1CKM A;  4IPG A;  4IOC A;  3I55 A;  2VQF Q;  1YHQ A;  4GLV B;  4RG1 A;  1PH3 A;  4QQB X;  3GO5 A;  2OTL A;  4IFD I;  1KL9 A;  2PI2 E;  2EXD A;  2IHE A;  5IWA L;  3S2D H;  2ID0 A;  1K8G A;  2V1C C;  4PZ6 A;  3PCO B;  1VQ9 A;  1NMG A;  1QZG A;  4JI7 L;  5LMU Q;  4LFA Q;  3UDG A;  1RIP A;  1VCI A;  1Y1V H;  4KHP Q;  1Y1V G;  1GVP A;  5AJ3 L;  1YJW A;  1JJC B;  1N32 Q;  2RCN A;  2UUB L;  3KF8 B;  3H0G H;  1XPO A;  1L1O C;  3ER0 A;  1HR0 W;  3H0G G;  1AE2 A;  5C0X I;  1GM5 A;  2PI2 A;  3KFU A;  1NMF A;  3HFZ B;  4DV0 L;  4B3S Q;  1EQQ A;  4X66 Q;  1FVI A;  4LUO A;  4LF4 Q;  3S1Q H;  1PVO A;  1NTG A;  4HJ5 A;  1IZ6 A;  1G51 A;  3CCS A;  1PFS A;  1K73 C;  1LTL A;  1VQL A;  1MKH A;  4DV4 Q;  3PIO A;  3S15 H;  2IX0 A;  2E2J H;  3STB C;  1SMX A;  1EIY B;  5C4J H;  5IE8 A;  2UXB L;  1Y1W G;  1L1O B;  4C2M H;  4IJL A;  2ZTD A;  2ZJP A;  1PH7 A;  1X3E A;  1W3S A;  2EIF A;  2CQO A;  1HNX L;  1A63 A;  4X6A H;  1VQA A;  4JV5 L;  1X65 A;  3E9H A;  4DV7 L;  3CCV A;  4YWM A;  2BH2 A;  4JI0 Q;  4UP9 A;  4OWX B;  2L15 A;  3U4V A;  4DR6 L;  4WJ3 M;  2Q2T A;  2GVB A;  4P75 A;  1FJG Q;  4AQY Q;  2IY5 B;  2DGY A;  4MZ9 A;  3ULL A;  5GQO A;  1O7I A;  1HR0 Q;  4LF8 Q;  1YHB A;  1A0I A;  3OYY A;  1E24 A;  2CWP A;  3T1H L;  2GVA A;  3ICE A;  3K7A H;  1CUK A;  4JOI C;  3UDF A;  4XIG S;  3F2B A;  2Q2I A;  4A3M G;  2JA6 G;  4DR2 L;  1D7Q A;  2F4V L;  5C44 H;  2UUC L;  2IHF A;  2ALY B;  3S16 H;  5C44 G;  3CC7 A;  4GN3 B;  2R93 H;  2R92 H;  5IT9 c;  3RZD H;  1U5K A;  3E0E A;  2R93 G;  2R92 G;  3HOZ H;  4B3R Q;  1X56 A;  4JI7 Q;  2ZM6 L;  3HOZ G;  4A93 H;  4DV2 L;  1UE6 A;  1X6O A;  3TS0 A;  4A93 G;  3S1R H;  1C7Y A;  4C3J H;  5M3M H;  5GAE C;  2YTX A;  4ALP A;  4LFC L;  1I50 H;  2AHO B;  5M3M G;  1PYS B;  3F1Z A;  2CFM A;  1VQH A;  1IL2 A;  4NB3 A;  5AJ3 Q;  4QJF A;  2WP8 J;  3OW2 A;  5M5X H;  1HZC A;  2MO1 A;  1XMO L;  2HHH L;  2UUB Q;  4BXX H;  2ZTC A;  2B63 H;  4IFD G;  1EIF A;  4BXX G;  3A5Z B;  3UDX A;  2B63 G;  2JA9 A;  1HNW Q;  1Q81 C;  1OTC A;  2OWO A;  4LF6 Q;  1TWC H;  4IPC A;  1EOV A;  2F52 A;  4L5T A;  4LUZ A;  1IBM L;  4JI6 Q;  4L5S A;  1V43 A;  4DV0 Q;  1IBK Q;  3GTJ H;  1OXU A;  4TVA B;  2E8G A;  3WWV A;  4LF5 Q;  4EQ5 A;  2ATW A;  3D31 A;  4APV A;  3D0F A;  1B70 B;  2QEX A;  2PMZ E;  4PMW A;  4HJ9 A;  4GKK L;  4YCW A;  1KAW A;  3EN2 A;  1Q46 A;  2A19 A;  4DNI A;  3GTP H;  4OO1 I;  4YWK A;  5BR8 L;  3CF5 A;  4HJ8 A;  3CCM A;  2UXB Q;  1NY4 A;  1AE3 A;  5C0X G;  4A3E H;  2NVQ H;  2MQH A;  4A3E G;  1SR3 A;  4JV5 Q;  4DR3 L;  4UP7 A;  3JAM i;  4DV7 Q;  1EUJ A;  5IYB H;  4K0K L;  4DR6 Q;  1VQ5 A;  2YTY A;  1OXV A;  2VY3 A;  1I5F A;  2A1A A;  4XTC S;  5IYB G;  1VQ7 A;  1Q1B A;  3J81 j;  2AWN A;  4GN4 B;  3CW2 C;  4IPD A;  1KRT A;  1PH1 A;  1M1K C;  3PUZ A;  4O2D A;  3AEV A;  3ULJ A;  1VS0 A;  5IY0 A;  1E1O A;  4NXM L;  3MXN B;  2QA4 A;  4GNX B;  3J7Z C;  1XPU A;  1XTD A;  3SGI A;  3VDY A;  3T1H Q;  2MO0 A;  4A3F H;  1AH9 A;  2XGT A;  2OCE A;  4A3F G;  3RLO A;  3CME A;  5K36 G;  4DR2 Q;  3GTL H;  1P16 A;  2F4V Q;  2UUC Q;  2AMC B;  3S2H H;  1Q12 A;  3PF4 A;  2LXK A;  1CKO A;  4OWT B;  3RN2 A;  2H5X A;  4DV3 Q;  4YWL A;  3Q8D A;  3TS2 A;  2ZM6 Q;  1OXX K;  3I4O A;  4DV2 Q;  3CXC A;  4JBJ A;  4PZ8 A;  3UDI A;  1VQG A;  4GLA C;  2I5M X;  3DM3 A;  3PV0 A;  2IT1 A;  4UP8 A;  5M5W H;  1OXS C;  4O0A A;  4DV6 L;  2D0O A;  3RNU A;  4BA2 I;  2HHH Q;  1WJJ A;  2E2I H;  1UE7 A;  2MNA A;  1OXT A;  2K75 A;  3EIV A;  3B6Y A;  1VQ6 A;  2VNU D;  2ZJQ A;  2HT1 A;  1X54 A;  1TWG H;  2A8V A;  1PYB A;  1YIJ A;  1Q82 C;  2B29 A;  1IBM Q;  2NVY H;  3PIP A;  2JE6 I;  3FP9 A;  2K5V A;  2ZTE A;  2PNH A;  3J80 c;  2Q2U A;  3PUY A;  4AIM A;  2NZH A;  1IBL L;  3W1G A;  4GKK Q;  4JI4 L;  3HKZ G;  2K14 A;  3RN5 A;  1VQM A;  4HIO A;  1E22 A;  2B3G A;  3M7N A;  4A3L H;  1X3F A;  4JI8 L;  4A3L G;  3M4P A;  2JA5 H;  3KLW A;  1I94 L;  5JJI A;  1YZ6 A;  2JA5 G;  1VQC A;  1PH9 A;  3U50 C;  4BBS H;  3A74 A;  4BBS G;  3S17 H;  3AFQ A;  4DR3 Q;  3TRZ A;  2Q2H A;  4K0K Q;  3BU2 A;  1KXL A;  3BZC A;  3MEF A;  5DLQ E;  3AQQ A;  3UE1 A;  1Y1W H;  4LF9 L;  2KCT A;  1VQF A;  3M4O H;  1TWH H;  4DR7 L;  2C35 B;  4GOP A;  1PHJ A;  4NXM Q;  3CC4 A;  4X65 L;  4LNQ A;  2K5N A;  1TWA H;  1HNZ L;  2UXD L;  1VQE A;  2RHQ B;  4NXN L;  1ASY A;  4HJA A;  3PF5 A;  1EYG A;  2IX1 A;  2YV5 A;  3GTG H;  4GKJ L;  1Z47 A;  2KBN A;  3NEL A;  4LW1 A;  1K3R A;  5GRO A;  3A5U A;  1V1Q A;  3L0O A;  2KCM A;  1YJ9 A;  1LUZ A;  4JI2 L;  3CCR A;  1M90 C;  3HKZ E;  1LYL A;  1NBW A;  3RZO H;  3NEN A;  4JI3 L;  1QZH A;  5H1S E;  3H15 A;  1I3Q H;  3FKI H;  4JI1 Q;  3CCE A;  1S72 A;  3KF6 A;  2JA6 H;  3S1N H;  4YCU A;  3FKI G;  4LF7 L;  1HZA A;  4OWW B;  2YTV A;  2CCZ A;  4KLK A;  4DV6 Q;  1BKB A;  2I0Q A;  2VS1 A;  3KYH C;  2VQE L;  4GNX A;  5IWA Q;  5E7N A;  1QVF A;  1N36 L;  1B7Y B;  3OTO L;  3ULP A;  3GDE A;  4BY1 H;  2VW9 A;  1T9H A;  1D8L A;  4LUV A;  4B3M L;  4BY1 G;  2R6G A;  1GO3 E;  3HOU H;  4JBM A;  4QGU A;  2JEA I;  3HOU G;  3J81 c;  1MJC A;  2JJQ A;  4NPS A;  2ASB A;  3KDF A;  3DLL A;  1IBL Q;  3J7A 5;  4JI4 Q;  1QVG A;  3CC2 A;  4LFC Q;  1LM0 A;  2AKW B;  1XMQ L;  4PG3 A;  4JI8 Q;  2ZJR A;  4DK3 C;  1KC8 C;  4FDB A;  5C4X G;  1GD7 A;  1I94 Q;  1VQ8 A;  1PV4 A;  3W1B A;  1WYD A;  2K52 A;  2WB1 G;  1WFQ A;  1KRS A;  2JK8 A;  4P73 A;  1L0W A;  4OON A;  1GKH A;  4GOP B;  2F3I A;  2N49 A;  5EAY A;  1E7Z A;  1UE1 A;  1UE5 A;  1KD1 C;  4QY7 A;  3HKS A;  2WAQ G;  4LF9 Q;  2Z6K A;  1QVC A;  4GNX C;  4DR7 Q;  1KHI A;  2VUM H;  1X55 A;  4A3G H;  4X65 Q;  2DUD A;  2VUM G;  1HNX Q;  4GLX A;  1HNZ Q;  4A3G G;  2UXD Q;  3G71 A;  4NXN Q;  3NBH B;  3K81 C;  4DAM A;  3CCQ A;  4B3T L;  4UY8 C;  2JA7 H;  4Y52 H;  4GKJ Q;  4DR4 L;  4HJ7 A;  2JA7 G;  3FHW A;  3KF6 B;  4JC0 A;  4L5Q A;  4JI2 Q;  5IP9 H;  3RLF A;  3ERS X;  3H3V I;  5IP9 G;  3UE0 A;  2BH8 A;  1X3G A;  4JI3 Q;  3F2C A;  2UU9 L;  1A62 A;  1YBY A;  3CCL A;  3PGZ A;  2WB1 E;  5LMN L;  4LF7 Q;  2PQA A;  5FLM H;  2HIV A;  1W2B A;  2VQE Q;  5FLM G;  1V9P A;  4Y7N H;  3CCU A;  1JMC A;  3KDF B;  1N36 Q;  3CMA A;  3OTO Q;  1UWV A;  1PH8 A;  3S14 H;  1CSQ A;  4J15 A;  5FLX c;  2WAQ E;  2E5L L;  1XJV A;  1CKN B;  3K80 C;  3M9B A;  4GN5 A;  4B3M Q;  3I2Z A;  1FGU A;  2MFI A;  4R4T A;  3K8A A;  1U0L A;  1JJG A;  1XMO Q;  1XNQ L;  4HIK A;  2D62 A;  1XMQ Q;  1SRU A;  3TEH B;  1XPR A;  4A3M H;  1SFO H;  3U4Z A;  1S40 A;  4BBR H;  3IRB A;  1VQB A;  3G48 A; 
#chains in the Genus database with same CATH topology
 1QUQ A;  1RF2 D;  3MA2 B;  1SBB B;  5IGG A;  3J81 i;  3CPW A;  3PO3 B;  2M2L A;  4X62 L;  1MJE A;  3VYU A;  1Z9F A;  3T53 B;  4RAU C;  5IP7 H;  1JT8 A;  4O1N A;  5IYD G;  3J7A F;  1S4Z A;  2K04 A;  4GS3 A;  2EY1 A;  3HS0 C;  1HJP A;  5IOD A;  1N33 L;  1EIG A;  2FJ2 A;  4RFB A;  4R4C A;  4HMJ A;  1VQI A;  5D14 A;  2KHS A;  4X3U A;  4KK7 A;  5BN4 A;  4KTA A;  1J5E L;  2K50 A;  1TWF B;  4OO1 H;  3MXP A;  3TME A;  1VQJ A;  4DR1 L;  3A54 A;  5FJ8 G;  1K83 H;  1JOK A;  3I7F A;  3PO2 H;  1F2M A;  2DNC A;  1B1Z A;  4JI6 L;  5LMN Q;  1VDZ A;  4C3H H;  1KTK A;  4MIU A;  4WJ4 A;  4FXD A;  4R4I A;  4LF5 L;  4X64 L;  5C4X B;  4UPA A;  5COR A;  3BYT B;  3HP3 A;  1F9S A;  3E5S A;  5GAH C;  2D0P A;  4N9T A;  4C3I H;  2PYK A;  5M5Y B;  1QUQ B;  5FOB B;  1E2W A;  2WAQ B;  1BVS A;  4G7H C;  3CQZ H;  3NK9 A;  1B3Q A;  3A56 A;  1PH4 A;  2JEB I;  4JVZ A;  4PZ7 A;  1A15 A;  1HXY D;  2FMM A;  1K8A C;  1JB7 A;  3S24 A;  5EKI A;  3QIA A;  3DM1 A;  2HD3 A;  4L5R C;  3I4M B;  2NVT H;  3OWF A;  1A8V A;  5D65 A;  4A3K H;  2XNA C;  3BDC A;  4J1M A;  4POG A;  2KEC A;  1CKN A;  3OMC A;  4IN3 A;  4TQU S;  3I56 A;  2MP1 A;  2HUG A;  2K5H A;  3I3C A;  3M3Y H;  2L4N A;  1SDF A;  2VL6 A;  2KED A;  3NEM A;  5KEE A;  5ISR A;  4IOA A;  4N9P A;  3I4N B;  2Q8T A;  2E2H B;  3R8B A;  4A3I B;  2LKV A;  2UUA Q;  1JE4 A;  5FK9 C;  4BY7 G;  2ES2 A;  1BNZ A;  2B2V C;  3G6J B;  1KQS A;  4DUZ Q;  1DOK A;  3CPF A;  1WCM G;  1EY4 A;  1VQ4 A;  2AUK A;  1N34 Q;  3G6E A;  1NJI C;  1EU3 A;  5J39 A;  4R9W A;  1N32 L;  1BCP F;  5M3F H;  1XNR Q;  3L7Z C;  2NBF A;  1G91 A;  4A3C G;  2UXC Q;  4Z9C B;  1VQN A;  2NZO A;  4DV1 Q;  2L1B A;  1EQR A;  1GUW A;  4EQN A;  4B3S L;  1N9W A;  2R7Z H;  3X3N A;  3E6Z X;  1FGB D;  5JPN C;  4IFD J;  4K2L A;  3RR5 A;  3PIO 3;  4EQO A;  5I2X A;  4DPG A;  4CKE A;  2QW7 A;  4IJH A;  4AYB E;  5IYC G;  2K4K A;  4EVO A;  3GTM H;  1Y1V B;  1EY7 A;  3A7A B;  1B8A A;  1DON A;  1PA6 A;  1YNX A;  2VZA A;  4XXE A;  3S1M H;  5C3W A;  4RG1 A;  4QQB X;  2K7V A;  3GO5 A;  1TR5 A;  1STN A;  2EXD A;  2R3Z A;  1HQR D;  3S15 B;  1K8G A;  1VQ9 A;  1TT2 A;  4JI7 L;  4HTH A;  1X32 A;  4LFA Q;  2KUM A;  4H44 C;  3BZD B;  1B2T A;  1GVP A;  1F9Q A;  3O13 A;  2UUB L;  2RDF A;  5L37 A;  1XX8 A;  1EWH A;  1L1O C;  1HR0 W;  1JC7 A;  2PI2 A;  1H9S A;  2ICI A;  3R2I A;  2DN8 A;  1SE3 A;  4LF4 Q;  4LUO A;  1VQL A;  1PXU A;  3A55 A;  2IX0 A;  5CBE E;  3Q0A A;  3STB C;  1SMX A;  5C44 B;  2DY7 A;  2PZW A;  1E0B A;  2ZJP A;  1LTB D;  1LTI D;  4IJL A;  5CV6 A;  3HOZ B;  2QCP X;  2EIF A;  4JV5 L;  1X65 A;  3RUZ A;  4DV7 L;  3ERQ A;  3T51 B;  4JI0 Q;  4BY7 B;  1EYC A;  2L15 A;  4MHE A;  1G2S A;  4LMQ D;  3NUC A;  1FJG Q;  2DGY A;  1KAA A;  1DXM A;  1O7I A;  4YIJ A;  1HR0 Q;  4LF8 Q;  4LAA A;  3W3A A;  3URY A;  1GUN A;  3ICE A;  1CUK A;  4KJO A;  4CBV A;  4DR2 L;  2KQ3 A;  4I7A A;  2F4V L;  2UUC L;  2F0F A;  2IHF A;  2ALY B;  2KEE A;  2R92 H;  1LT3 D;  1NNX A;  3E0E A;  3Q24 A;  1X56 A;  1XXG A;  2NUC A;  4A93 G;  1HHV A;  3S1R H;  2PO4 A;  5M3M H;  1IKL A;  4LFC L;  5EBC A;  2CFM A;  5AJ3 Q;  1GUO A;  3MFY A;  5KNB A;  2B63 H;  2JA9 A;  1OTC A;  1BCP D;  1TWC H;  4IPC A;  2F52 A;  4L5T A;  1V43 A;  5EGT A;  1OXU A;  2R61 A;  4B08 A;  2E8G A;  3WWV A;  4CJ2 C;  4APV A;  1B70 B;  2QEX A;  3D4W A;  4WRD A;  3GTL B;  1KAW A;  3EN2 A;  2B2T A;  4FXG C;  1Q46 A;  2A19 A;  5C0X H;  5BR8 L;  3CCM A;  2F0M A;  2UXB Q;  1HA6 A;  1MI2 A;  3I72 A;  2A6H D;  4DR3 L;  4UP7 A;  3AU7 A;  3P20 A;  1S5E D;  3MAQ A;  5M5W B;  4HSP A;  4XTC S;  1Q1B A;  1E2V A;  2AWN A;  4IPD A;  3J81 j;  2E2I B;  1M1K C;  3ULJ A;  1VS0 A;  1E1O A;  1PZI D;  3P1H A;  2QA4 A;  4GNX B;  3FEW X;  1XPU A;  3VDY A;  3T1H Q;  2MO0 A;  2JSO A;  3CME A;  5FLX L;  3K5M A;  1Q12 A;  3PF4 A;  2PW5 A;  4OWT B;  2CVR A;  4G4K A;  4XQJ A;  3GV3 A;  1QNK A;  3I4O A;  2ICE C;  1JOR A;  4GLA C;  2I5M X;  3DM3 A;  3RNU A;  5J22 A;  4O0A A;  3VYT A;  3TP7 A;  3BS1 A;  2HHH Q;  2WKC A;  2ZXO A;  1OXT A;  3EIV A;  1VQ6 A;  4DA2 A;  2ZJQ A;  2VNU D;  2B29 A;  1IBM Q;  1IW7 C;  2P5Z X;  2PNH A;  3HKZ G;  1D5X C;  2EYF A;  3H94 A;  2B3G A;  1STG A;  2JA5 H;  1I94 L;  1VQC A;  1CA5 A;  4BBS H;  3A74 A;  2CH4 W;  1I3Q B;  3AFQ A;  3FKI B;  3K0Y A;  2Q2H A;  3BZC A;  5DLQ E;  2NTS A;  2I46 A;  1PZJ D;  1VQF A;  1TWH H;  2L11 A;  4G7Z C;  3M4O H;  1K0S A;  4NXM Q;  2EJG C;  4X65 L;  1TQO A;  4A93 B;  1VQE A;  1Y8P B;  2A68 C;  3PF5 A;  3Q23 A;  5ELE A;  1H9M A;  3I70 A;  3HOU B;  4LW1 A;  5GRO A;  4F88 A;  2X6L A;  2F0I A;  1WD0 A;  3L0O A;  1EYD A;  1M90 C;  1LYL A;  1TY0 A;  3BG3 A;  3NP8 A;  4JI1 Q;  2X69 A;  2KCN A;  1GXD C;  4LF7 L;  2A5H A;  2YTV A;  4KLK A;  1EY6 A;  1BKB A;  2CCZ A;  4XQQ A;  2EYJ A;  5IWA Q;  5E7N A;  2NB0 A;  2B2V A;  1N36 L;  1D8L A;  2ZXR A;  4BY1 G;  2R6G A;  4KV6 A;  1LTR D;  4JBM A;  4QGU A;  1MJC A;  2A74 C;  4UDU C;  1IBL Q;  1CM9 A;  4MN3 A;  1QVG A;  4OL7 A;  1G2T A;  2PZU A;  1CQV A;  5I9O A;  3HGB A;  3W1B A;  1KDB A;  2H1E A;  2WB1 G;  1B3A A;  4P73 A;  1DM0 B;  3NTH A;  1L0W A;  4TKO B;  2PZT A;  1U9R A;  1PTO F;  2N49 A;  5EAY A;  2EJM A;  4KMU C;  4G7O C;  4K5W A;  1V8Q A;  1PLF A;  1QOH A;  4CJ0 B;  2VUM H;  4A3G H;  2HQE A;  2MPM A;  1II3 A;  1HNZ Q;  4S3S A;  2UXD Q;  1PTO H;  3DWA A;  3FRP B;  3K81 C;  4DAM A;  4B3T L;  1R4P B;  2K28 A;  1L0Y B;  4KKT A;  4LK1 C;  3RLF A;  1SJE D;  5IP9 G;  1HQM C;  4JI3 Q;  3MZ5 A;  2B2W C;  1A62 A;  1YBY A;  4RKB A;  5COY A;  3OWE B;  4KN4 C;  1IHZ A;  2HIV A;  3HOV B;  2VQE Q;  4Y7N H;  1XYI A;  2Z8L A;  3NXW A;  1UWV A;  1PH8 A;  5ELC A;  2WAQ E;  4B3M Q;  1K28 A;  4R4T A;  1HRJ A;  2A6E D;  4K2K A;  1RCV D;  1XMQ Q;  4A3M H;  4A3J B;  4NP5 A;  1DOM A;  4RGT A;  4DK6 C;  1VQD A;  1I6H B;  4A3D B;  1X9N A;  1H9K A;  1S3O A;  2F1M A;  3EQL C;  1Q7Y C;  5IYD H;  4YHH L;  3GTK H;  1JWM D;  1GHJ A;  1AFP A;  4QL5 A;  5JEA J;  2FHT A;  2Y0S G;  1LT5 D;  2Q8I B;  4IUP A;  1Y14 B;  2FXQ A;  4B3R L;  4RGO S;  4DR4 Q;  2IW3 A;  1MGS A;  4R4Q A;  2D2C C;  2HDL A;  3F8T A;  3R2T A;  3HOX B;  5FJ8 H;  1BBU A;  2ATW A;  3HOW B;  4DAV A;  5JPM C;  5C3E G;  1VQP A;  1GHK A;  4DKA C;  3PO3 G;  3IKJ A;  2K32 A;  1WI5 A;  1KNA A;  3A7L A;  1STY A;  1SYD A;  3KJO A;  4DUY L;  3GTO B;  5IGB A;  5D3I B;  4POF A;  4FF4 A;  3VR6 A;  1STA A;  4DXG A;  4IPH A;  3VA5 A;  1WTO A;  2O2L D;  2BA0 A;  4QIW E;  4DV5 L;  2LSS A;  3KBX A;  4JBK A;  3T1Y L;  4DAY B;  5BN5 A;  1TXY A;  3EA6 A;  4IAL A;  1SMY D;  3H6M A;  4YCV A;  2YYZ A;  2JA8 B;  3C2P A;  1H95 A;  4X62 Q;  3PUX A;  4DXF A;  1Q90 A;  1BXT A;  1VMC A;  1PTO D;  1AP0 A;  4F8M A;  1EWI A;  1HTP A;  3J80 i;  1N33 Q;  1A2U A;  1YNJ D;  3A8I E;  1O7L A;  4DV3 L;  1K0R A;  1IXR A;  2MHV A;  1EZ6 A;  3TN2 A;  1J5E Q;  4BY7 H;  4DR1 Q;  3OOC A;  2VB3 X;  2NVX B;  4QCL A;  4BA1 I;  3CP0 A;  1U4P A;  4ME5 A;  4A4I A;  3PUW A;  5GAD C;  3BZK A;  1WCM H;  1ROD A;  1S5D D;  2HCC A;  2J7Z A;  3I4M G;  4L6T B;  5FLX E;  1MIU A;  4KHP L;  3GTQ H;  1Q3L A;  2K05 A;  3T13 A;  4X64 Q;  4A3C H;  3TBI B;  3HOY B;  4R8I A;  3CHB D;  1IYJ B;  4AH6 A;  2JQO A;  2KOL A;  3I4N G;  1QWY A;  1A3T A;  1HH2 P;  2N3S A;  3R3O A;  2A73 B;  2F0E A;  4A3I G;  1STH A;  3KF8 A;  4N8X 1;  3LX0 A;  5ELO A;  1E1T A;  1UEB A;  2NN6 G;  2N8N A;  3D3R A;  5KRU A;  1YI2 A;  2RCF A;  1ZYR C;  4P72 A;  3S2D B;  2NYZ D;  3M85 A;  5IOC A;  1DJR D;  3BVM A;  2LS0 1;  5IYC H;  1R9T B;  2RDH A;  4QUC A;  2F0S A;  4U67 3;  3SK4 A;  5E4W C;  1KIX A;  2AUJ D;  3RLN A;  1OO9 B;  4AQY L;  2R7F A;  2RBM A;  1JE5 A;  3DUZ A;  5LMN W;  3H0G B;  2WII B;  1CSP A;  3LNN A;  1JCK B;  1RKN A;  3NQI A;  4H02 A;  2SNM A;  1IL8 A;  1NR4 A;  4IPG A;  5J1Z A;  3S1Q B;  2PI2 E;  1QG7 A;  2PNR C;  2V1C C;  4PZ6 A;  2EE1 A;  3PCO B;  1NMG A;  3MEH A;  3ND9 A;  5C4J B;  3D6C A;  3SK8 A;  4C2M B;  3D4D A;  4ZKC B;  4IUT A;  1Y1V G;  1LO5 D;  1QNU A;  5LL6 X;  1N32 Q;  2X6G A;  3KF8 B;  3ER0 A;  3EJI A;  1AE2 A;  5C0X I;  1ILQ A;  4B3S Q;  2PMZ B;  2F0J A;  5KGU A;  4KD3 A;  2E76 C;  3PIO A;  5EPJ A;  2E2J H;  1WTX A;  3P7J A;  1EIY B;  2R93 B;  1G6Z A;  2EYM A;  1X3E A;  2CQO A;  1KDC A;  1HNX L;  4X6A H;  1VQA A;  3E9H A;  4OIJ A;  4OHJ A;  3NSW A;  1O7Y A;  4C3J B;  4OWX B;  1I50 B;  4WJ3 M;  4P75 A;  5DEH A;  5GQO A;  1YHB A;  1E24 A;  2D5D A;  1SAP A;  1CZW A;  3L9A X;  2GVA A;  3K7A H;  3UDF A;  2Q2I A;  1D7Q A;  1SND A;  2BE5 C;  5EJW A;  3S16 H;  5C44 G;  4GN3 B;  5IT9 c;  3QR8 A;  2EY5 A;  3SR1 A;  3RZD H;  2YU9 B;  4JI7 Q;  1GOZ A;  2ZM6 L;  3HOZ G;  2B2Y C;  3GTP B;  4A93 H;  2G5D A;  3I91 A;  4A3E B;  2NVQ B;  3QJY A;  2XSC A;  3WOF A;  4NB3 A;  3OW2 A;  2WP8 J;  2MO1 A;  2UUB Q;  2ZTC A;  4IFD G;  4BXX G;  1HNW Q;  4LF6 Q;  1VF7 A;  2ZXP A;  2L12 A;  4CDF C;  4L5S A;  1IBK Q;  4RA8 A;  3GTJ H;  4TVA B;  4A3F B;  4PMW A;  2Z4I A;  4GZY C;  5ELD A;  1GUT A;  4YCW A;  4KY7 A;  4B9W A;  5KIX A;  3S2H B;  5E4X A;  4YWK A;  2RVL A;  3CF5 A;  4HCS A;  1SR3 A;  4JV5 Q;  4DV7 Q;  3JAM i;  2KJX A;  1EUJ A;  1PRT C;  1VQ5 A;  4Y52 H;  1I5F A;  2A1A A;  4GN4 B;  1ONL A;  2NWG A;  3CW2 C;  3PUZ A;  1TWG B;  3ND8 A;  3K58 A;  2J4X A;  3DXJ C;  2WIN B;  3RLO A;  1SNQ A;  4DR2 Q;  1WTV A;  2F4V Q;  2XVS A;  2UUC Q;  1MSG A;  3RN2 A;  1ENA A;  3KUP A;  2JYO A;  2QDB A;  4PZ8 A;  3UDI A;  4LFC Q;  4V0B A;  4Q5V A;  1SYF A;  3S17 B;  1TS3 A;  1Y8O B;  3B6Y A;  2HT1 A;  1B9N A;  1X54 A;  4DNR B;  1PYB A;  1C4Q A;  2NVY H;  2JE6 I;  3FP9 A;  2ZT9 C;  3E0J A;  3V2T A;  1HA5 A;  1TWA B;  3J80 c;  2A69 D;  3V05 A;  2K14 A;  1E22 A;  4JI8 L;  3M4P A;  3T4A C;  3KLW A;  3SK5 A;  4DK0 A;  4DFA A;  1PH9 A;  3U50 C;  4OIK A;  4L8J A;  4DR3 Q;  3TRZ A;  4BS9 A;  2Z1C A;  3BU2 A;  4ZRZ A;  3MEF A;  2MGS A;  1F2Z A;  2B2U C;  5DNF A;  4P2C B;  1Y1W H;  4KKS A;  4R8N A;  5C5L A;  2C35 B;  2RQX A;  4NXN L;  4M1U B;  4TSS A;  3GTG H;  1Z47 A;  1EIH A;  3NEL A;  3SVM A;  3NQT A;  4V19 0;  3A5U A;  1ML0 D;  1YJ9 A;  2K1B A;  3HKZ E;  2LY7 A;  2IJ0 A;  3NEN A;  3VR2 A;  1SYC A;  3WDN A;  5H1S E;  3H15 A;  1QZH A;  2F0Q A;  2CQA A;  5FO7 B;  5E3F A;  2JA6 H;  5KND A;  2KVM A;  3FKI G;  2VS1 A;  3DHQ A;  1YNN D;  2B39 A;  4GNX A;  2CW0 D;  2N55 A;  5CV7 A;  1WTQ A;  3RD4 A;  1B7Y B;  3OTO L;  1BUV T;  3GDE A;  4BY1 H;  2VW9 A;  2SNS A;  3HOU G;  3J7A 5;  3J81 c;  2EY2 A;  2ASB A;  2EXZ A;  2JA7 B;  1A6X A;  5IIF A;  3CC2 A;  5IT9 L;  4NDX A;  2KCC A;  2ZJR A;  4FDB A;  1I94 Q;  2RSN A;  2K52 A;  1FNV A;  1WFQ A;  4U68 A;  2AQ3 B;  3FPP A;  5LHY 1;  1E7Z A;  1UE5 A;  1LTS D;  5HUR A;  4QY7 A;  2M9V A;  4KN7 C;  3HKS A;  4ZCK A;  3FPU B;  3D8G A;  4X65 Q;  3K5L A;  4UY8 C;  1AZQ A;  1CT1 D;  5EKK A;  1D5Z C;  4JC0 A;  3MTS A;  5IP9 H;  3UE0 A;  2E74 C;  4BBR B;  3F2C A;  3U9O A;  2UU9 L;  2OXP A;  1K8O A;  3CCL A;  4LF7 Q;  2WB1 E;  2WV6 D;  1A2T A;  2H4O A;  1V1P B;  3OW7 A;  5FLM G;  1V9P A;  3CCU A;  1JMC A;  2F0L A;  3C1F A;  1N36 Q;  3S14 H;  5TSS A;  2E5L L;  1XJV A;  3K5N A;  4GN5 A;  3NTK A;  4BWG B;  1HTL D;  4CHT B;  3K8A A;  4NMZ A;  2B8G A;  1XMO Q;  1CK1 A;  1XNQ L;  4HR7 B;  2CH4 A;  3OPO A;  3BDL A;  4DN4 M;  3NWS A;  3T56 B;  3U4Z A;  3BDO A;  3G48 A;  1I4Q A;  1PH6 A;  1K83 B;  3PO2 B;  1RTN A;  4HN7 A;  4L63 B;  3LGJ A;  4K5X A;  4C3H B;  3HOV G;  4MTN A;  2I5L X;  4LFB L;  1J8I A;  1JOO A;  1D6E C;  2OQK A;  1RD9 D;  2LXJ A;  3RZO B;  1SYG A;  1SYE A;  3N52 A;  3J80 L;  1F77 A;  4B3T Q;  4C3I B;  1BBW A;  1R9T H;  3ONA B;  1EL0 A;  3FDT A;  4LJZ C;  2KHI A;  2PCF B;  1CHP D;  3KOJ A;  4WJW A;  5C3E H;  3L2P A;  4A3J G;  5JOB A;  4EX5 A;  4ME3 A;  1J9O A;  4R1J A;  1X3P A;  3SK6 A;  4DR5 L;  3PO3 H;  3CQZ B;  4JI5 L;  4A3D G;  2IPK D;  2HIX A;  2PW7 A;  1ASZ A;  4I65 A;  4ZK9 B;  2R7D A;  3AFP A;  4CGY B;  4YY3 L;  2NVT B;  4A3K B;  4OX9 L;  4JYA L;  5C4H A;  4ZQ3 A;  1ZEQ X;  3H3V H;  2N78 A;  1LT6 D;  3JAM c;  3M3Y B;  1PTO C;  2B2Y A;  2I5H A;  1TS2 A;  3QOJ A;  2Y0S E;  2BCO A;  2EYO A;  2NTT A;  1CHQ D;  2PPB C;  1TWF H;  1YNJ C;  3HOX G;  2KHJ A;  4NKL A;  3HOW G;  1BDO A;  2F0G A;  1EFW A;  1K8M A;  1H9R A;  3TZD A;  5JJL A;  3L3O C;  3R93 A;  2CWA A;  4AYB B;  4MNO A;  2XTI A;  4CKC A;  4YHH Q;  3PSI A;  4G57 A;  3STB D;  5C4X H;  1D5M C;  1EY8 A;  1SN8 A;  3F2D A;  1FR3 A;  2DJF C;  5JVH 3;  5M3F B;  4RCO A;  1LTT D;  4ID6 A;  5M5Y H;  1Y8N B;  5JJK A;  1X3Q A;  1O78 A;  3J81 L;  1T5X D;  1YJN A;  3TZU A;  4P74 A;  2GA4 B;  5EPK A;  1WOC A;  3AYH B;  2VQF L;  2AWO A;  2R7Z B;  1C9O A;  2JA8 G;  1O80 A;  5HY6 A;  1Y69 U;  4OXP A;  3I4M H;  5LMU L;  2F0K A;  4OGQ C;  3H09 A;  2F0W A;  3I4L A;  1CTM A;  3CD6 A;  2B8F A;  1VQK A;  1FL0 A;  4DUY Q;  2RHS B;  1SFO B;  4K6D A;  2IWH A;  1JWS D;  1NAP A;  3GTM B;  3EFX D;  2YU9 H;  3I4N H;  2DNE A;  3VA7 A;  2F0H A;  2E2H H;  2HQL A;  4A3I H;  3CAM A;  3JC6 6;  3KLS X;  1T5E A;  3DEO A;  4X66 L;  3S1M B;  2F0U A;  4DV5 Q;  1SLJ A;  3LWE A;  3I8Z A;  1B44 D;  2NN6 H;  1ZXT A;  2K6A A;  3T1Y Q;  4DV4 L;  3PQI A;  1EQT A;  2L0C A;  5JEA G;  1B9M A;  2Z6K C;  2F0O A;  1NE3 A;  4K5V A;  3M7G A;  4K8J A;  4CKB A;  4HID A;  1K9M C;  3TRE A;  4C56 C;  2EDG A;  2G9H D;  4JG2 A;  1Q86 C;  1N8R C;  4JPB W;  4A76 A;  1HZ9 A;  2OQ0 A;  3W5O A;  3G4S A;  1HZB A;  1YIT A;  3A8J E;  3HOY G;  1ILP A;  1L1O A;  4JBW A;  4K8I A;  1PRT B;  3CCJ A;  2F3V A;  2WKD A;  1DGS A;  5C0X J;  3CKI B;  2OTJ A;  3ITP A;  4DAY A;  4A3B G;  4JI1 L;  2BA1 A;  1STE A;  1CKM A;  4C1N K;  1SNP A;  5CV9 A;  1MD2 D;  1YHQ A;  5I4D A;  2IHE A;  1C48 A;  5IWA L;  1SE2 A;  2XIW A;  1QZG A;  4Q0F A;  2OF1 A;  3UDG A;  1TKW B;  4KKU A;  1RDP D;  1Y1V H;  5IGF A;  1R4Q B;  4KHP Q;  1JJC B;  2RCN A;  4HED A;  1E2Z A;  1STB A;  3H0G G;  1F9P A;  4IUQ A;  1ESR A;  3DWP A;  3QG1 A;  4DV0 L;  4QMG A;  1FVI A;  2SEB D;  1PVO A;  1IZ6 A;  1K73 C;  1PFS A;  3SDZ A;  1QCB D;  5NUC A;  3S15 H;  4H13 C;  3C3L A;  4ZKB B;  1IW7 D;  5IE8 A;  2R92 B;  1L1O B;  1PH7 A;  1L0X B;  5EBD A;  2K33 A;  3MXG A;  1W3S A;  1TS5 A;  4DU9 A;  3CCV A;  3S1R B;  5IT9 E;  2BH2 A;  5M3M B;  3QO2 A;  5F2D A;  1I4P A;  5AFW A;  1LAC A;  4DR6 L;  3JAM L;  1EYA A;  2LFN A;  2Q2T A;  1KLU D;  1RJT A;  4AQY Q;  4XYO A;  4MZ9 A;  2B63 B;  5I6Y A;  3OYY A;  4PV1 C;  3T16 A;  1TWC B;  2CWP A;  1JOQ A;  2Z4H A;  1EY9 A;  4JOI C;  3F2B A;  4XIG S;  1UNS A;  1DZ1 A;  2L5T A;  1EEI D;  2IX3 A;  5C44 H;  3MXN A;  2M00 A;  2SDF A;  1U5K A;  2R93 G;  1TS4 A;  3HOZ H;  1I4X A;  4WOR A;  4DV2 L;  1LLR D;  1UE6 A;  1X6O A;  3TDQ A;  1AW7 A;  4M8A A;  3TS0 A;  2KA7 A;  2K5Q A;  2BDO A;  2YTX A;  3QB3 A;  4B9X A;  2AHO B;  4C3J G;  1PYS B;  1VQH A;  4PNY A;  2F0N A;  4IFD H;  4BXX H;  1CA6 A;  1EIF A;  2V4D A;  1SJH D;  3UDX A;  1Q81 C;  2OWO A;  1EY0 A;  1D1I A;  1EOV A;  4JI6 Q;  1SXT A;  4HCE A;  2XWJ B;  3PIP 3;  4LF5 Q;  2NZ1 D;  5JJZ A;  3KLS A;  2DJG C;  4GKK L;  3C46 A;  3CU7 A;  3FMC A;  4DNI A;  1FNW A;  3M4Y A;  4FP5 D;  1NY4 A;  1AE3 A;  1ICF B;  1WVL A;  1KDA A;  1EWC A;  1M8A A;  4FNF A;  1I4G A;  4A3E G;  4A3B B;  2K5D A;  2SOB A;  1QB5 D;  4K0K L;  5CV5 A;  2YTY A;  1OXV A;  5IYB G;  4IUR A;  1ET9 A;  1KRT A;  1CFM A;  3MXN B;  1PFN A;  3J7Z C;  1XTD A;  3SGI A;  1AH9 A;  4A3F G;  3RMH A;  5K36 G;  3GTL H;  1SE4 A;  1P16 A;  1LV9 A;  1BR9 A;  1PDQ A;  2AMC B;  2MJ8 A;  3K5O A;  2A69 C;  2H5X A;  4E6I A;  3J80 E;  2B2T C;  2ZM6 Q;  2JA5 B;  3TP5 A;  1FYC A;  2QDL A;  5CV4 A;  1B4O A;  4JBJ A;  2HCI A;  4BBS B;  3PV0 A;  5M5W H;  1RHP A;  4PMB A;  4DV6 L;  2D0O A;  4RHR A;  1D2B A;  2E2I H;  1UE7 A;  2MNA A;  3G7L A;  2K75 A;  2A8V A;  1Q82 C;  1YIJ A;  4FF1 A;  3M4O B;  3GV6 A;  2K5V A;  2FFK B;  5FO8 B;  1KNE A;  2ZTE A;  4OEL B;  3PUY A;  2NZH A;  3W1G A;  4JI4 L;  4ZLT F;  2L55 A;  1VQM A;  3M7N A;  4A3L G;  1QE6 A;  5JJI A;  1EY5 A;  4ABN A;  2JXM B;  2XWB B;  2O4X A;  3W2D A;  4X3T A;  3IFD A;  1CZG A;  5T1G A;  5C3X A;  1KXL A;  5K5P A;  4N8F A;  5EKL A;  3NWT A;  4LF9 L;  2KCT A;  4DR7 L;  5LL6 S;  1PHJ A;  1YNN C;  4HMI A;  3CC4 A;  4LNQ A;  2D9U A;  2CW0 C;  4QB4 A;  5G3L F;  1ASY A;  1HCZ A;  4GKJ L;  2TSS A;  1LAB A;  2KBN A;  1K3R A;  1G8Z D;  5M9O A;  1HFN A;  2K5W A;  1PYW D;  3P75 A;  4XT3 B;  1NSN S;  5M5X B;  4JI2 L;  1D1K A;  4JW0 A;  2XRQ D;  5CBA E;  3RZO H;  2RA4 A;  2F0T A;  3J81 E;  1PZK D;  1TU2 B;  1I3Q H;  3FKI H;  3CCE A;  3KF6 A;  1BCP C;  3A8K E;  4YCU A;  1HZA A;  4OWW B;  2I0Q A;  1I6V C;  1M4V A;  2BDN A;  1S5B D;  4KJN A;  3S9W A;  5I6W A;  4XT1 B;  3LWU A;  1QVF A;  1NR2 A;  3SE0 A;  4DNT B;  2EPB A;  3KK7 A;  5C5M A;  2L9H A;  1T9H A;  2I07 B;  4LUV A;  2VUM B;  1JWU D;  3HOU H;  4A3G B;  5IGE A;  2JEA I;  1PTO B;  2JJQ A;  3HZX A;  3KDF A;  3DLL A;  2A6H C;  5A2Q L;  5IGC A;  1LM0 A;  4K6L A;  4PG3 A;  4UHV A;  4JI8 Q;  4DK3 C;  1WTW A;  1KC8 C;  1EOT A;  2B2W A;  4EGV A;  1VQ8 A;  1PV4 A;  1WYD A;  1KRS A;  2JK8 A;  2E2D C;  5ELB A;  4OON A;  3HG9 A;  1V1O A;  3OSO A;  2Z6K A;  1QVC A;  4X3K A;  4Y7N B;  1C8C A;  1U4R A;  2C9O A;  1KHI A;  3SHL A;  3G71 A;  4NXN Q;  3CCQ A;  4J8Q A;  3OHX C;  4ZUI A;  2JA7 G;  1MBY A;  3FHW A;  3KF6 B;  1WD1 A;  4L5Q A;  3FVQ A;  3ERS X;  4F87 A;  3H3V I;  4A3M B;  1X3G A;  1ENC A;  1FNU A;  5I2Y A;  5LMN L;  4CJ1 B;  2BOS A;  1LT4 D;  2PQA A;  3QWN A;  5FLM H;  2IL8 A;  1W2B A;  5A35 A;  3IAY A;  3IL8 A;  4ULL A;  3KDF B;  3GTK B;  2F4I A;  3OTO Q;  1CSQ A;  4J15 A;  5FLX c;  1CKN B;  3K80 C;  3M9B A;  4CDC C;  1IYU A;  1FGU A;  1S5F D;  2MFI A;  4QIW B;  5ELF A;  1U0L A;  3AMU A;  1JJG A;  1W6J A;  3OIP A;  3E3X A;  3SXH A;  5DM7 3;  4HIK A;  3NBI A;  1O7Z A;  2D62 A;  1SRU A;  3TEH B;  1XPR A;  1SFO H;  3IRB A;  2LMC B;  1VQB A;  4BBR G;  1RL2 A;  4IUN A;  3VR4 A;  3HOV H;  2Z0S A;  3D4R A;  5IP7 G;  1JJ2 A;  1ZYR D;  2KEN A;  5BR8 Q;  2RKS A;  1C0A A;  3M4Q A;  1Z7T A;  3CRL C;  3EBE A;  3NE5 B;  1PRT F;  4JCV E;  3AB9 A;  4R4O A;  3S1N B;  4RHS A;  1AEX A;  5CYU A;  4JK1 C;  5G3L D;  1BBX C;  1CQF A;  3JAM E;  4A3J H;  2UUA L;  1PH2 A;  3KFU A;  5HGQ A;  4A75 A;  2PQA B;  4OO1 G;  1G29 1;  1I6H H;  3BJU A;  4A3D H;  2UU9 Q;  4DUZ L;  3PO2 G;  1HNW L;  4LF6 L;  1E3P A;  1AN8 A;  1IBK L;  4IZ8 A;  4JOI A;  4C3H G;  2Z6B A;  1N34 L;  3A0J A;  2NN6 I;  3VYR A;  5J3B A;  1XNR L;  4RGM A;  1UUP A;  2UXC L;  2E5L Q;  2K03 A;  2RF4 A;  4DV1 L;  4KY6 A;  1PFB A;  4C3I G;  3I90 A;  1WTH A;  1DD2 A;  3HOX H;  2GN5 A;  1XNQ Q;  4KHZ A;  3HOW H;  3F2U A;  5FKA C;  5GAG C;  1A3U A;  2F0D A;  1V1P A;  2F3W A;  3OMG A;  4GOP C;  4XYQ A;  2WAC A;  3PUV A;  3K0X A;  1BF4 A;  4HIM A;  3VR5 A;  1WCM B;  2DY8 A;  4A3K G;  3GTO H;  3H91 A;  1DOL A;  4LFB Q;  4KI0 A;  3GTQ B;  3Q6S A;  3X3M A;  1SE8 A;  4ZUJ A;  1G6P A;  1IYV A;  1I4R A;  5KYI A;  2EZV A;  1BOS A;  1Q1E A;  5IGD A;  2EQS A;  4IO9 A;  3TQY A;  3I73 A;  2MUY A;  2E75 C;  3TSS A;  4IUV A;  1L2F A;  5KYL A;  1H9S B;  2QGQ A;  3ZYY X;  2JA8 H;  4DR5 Q;  3KJP A;  2AQ1 B;  1VQO A;  4JI5 Q;  1Q8K A;  4RMF A;  4AYB G;  3J7A V;  2FIN B;  3SEB A;  4LFA L;  2BE5 D;  4YY3 Q;  3TP8 A;  3ZJY C;  1UEA B;  4OX9 Q;  4JYA Q;  1U4M A;  2CKZ B;  1S5C D;  1A3V A;  2A6E C;  5M3F G;  2WFW A;  3DMU A;  1EFI D;  2EJF C;  4FYD A;  3HEJ A;  2J0T D;  1YEZ A;  2QKI C;  4PMC A;  4LF4 L;  5T1I A;  2NVX H;  2R7Z G;  1SRO A;  5JEA H;  2QIL A;  1PH5 A;  3GD7 A;  4LWC A;  1F2L A;  4PQX A;  1YVC A;  2F0P A;  3E9I A;  1J6Q A;  4IQZ A;  3D6W A;  3DWQ A;  1TII D;  1QIL A;  4RGN A;  1ESF A;  3KLR A;  5CR3 A;  1P8L A;  4JI0 L;  3HOY H;  1SSO A;  3H3V C;  4P71 A;  1F9R A;  1FJG L;  1PMR A;  1FD7 D;  5DM6 3;  3K7U C;  1HR0 L;  4LF8 L;  5ELN A;  3DEP A;  4A3B H;  1PRT D;  1YHA A;  3U58 A;  5CV8 A;  4IOC A;  3I55 A;  2VQF Q;  4XQN A;  4GLV B;  1PH3 A;  4ZYS A;  2OTL A;  4IFD I;  1KL9 A;  2OEO A;  3S2D H;  2ID0 A;  3HRZ C;  2E2J B;  2EYL A;  1SYB A;  5LMU Q;  1RIP A;  1VCI A;  1GUS A;  2C5C A;  2OT2 A;  1KLG D;  1LTA D;  5AJ3 L;  1YJW A;  1TY2 A;  4H0L C;  1XWE A;  3H0G H;  1XPO A;  1GM5 A;  1NMF A;  3HFZ B;  1SMY C;  1SNM A;  3MC0 B;  4X66 Q;  1EQQ A;  2Q8R E;  3S1Q H;  1NTG A;  5JVG 3;  4HJ5 A;  1G51 A;  3CCS A;  1LTL A;  1MKH A;  3K7A B;  4DV4 Q;  4OEM B;  1CI3 M;  1ZKO A;  1JIC A;  2QEJ C;  2EVB A;  3S16 B;  5C4J H;  3RZD B;  2UXB L;  1XTC D;  4HAE A;  1Y1W G;  2VXW A;  4C2M H;  2ZTD A;  1GJX A;  2F0V A;  4X3S A;  1QJO A;  5A2Q E;  4ILW A;  1ENF A;  1A63 A;  4YWM A;  4UP9 A;  3MVV A;  3U4V A;  1KAB A;  2CHB D;  2GVB A;  3TP6 A;  2IY5 B;  3ULL A;  5CMD A;  1A0I A;  1U4L A;  1RTO A;  3T1H L;  3GTJ B;  2JA6 G;  1SNC A;  3MWY W;  3NHH A;  3CC7 A;  1VF5 C;  2R93 H;  1WTP A;  2K01 A;  2R92 G;  4B3R Q;  4MTK A;  1NCV A;  3VR3 A;  3OIQ A;  3N6R A;  4RWS C;  4C1N I;  1C7Y A;  4C3J H;  5GAE C;  4ALP A;  1I50 H;  5M3M G;  3F1Z A;  1IL2 A;  1BCP B;  4H7B A;  2HHH L;  4QJF A;  1UAP A;  1HZC A;  1W6K A;  5M5X H;  4RH6 A;  1XMO L;  2VB2 X;  3K57 A;  3A5Z B;  2B63 G;  4DK1 A;  4LUZ A;  4CDE C;  1IBM L;  3K59 A;  1H9J A;  4DV0 Q;  5I9P A;  2G9D A;  4EQ5 A;  3J7Y W;  3D31 A;  4KHV A;  3D0F A;  4HJ9 A;  2PMZ E;  4KD4 A;  3IFT A;  5CC4 A;  2JN4 A;  3GTP H;  2EY6 A;  4OO1 I;  4HJ8 A;  1JQY D;  5C0X G;  4A3E H;  3QOL A;  2NVQ H;  2AQ2 B;  3PMF A;  2MQH A;  4EQP A;  1MSH A;  1NUC A;  5IYB H;  4DR6 Q;  1VQ7 A;  2VY3 A;  4NW2 A;  1PH1 A;  4QUF A;  3AEV A;  4O2D A;  5IY0 A;  4NXM L;  3UI2 A;  3MHB A;  1GUG A;  2NVY B;  4A3F H;  2XGT A;  2OCE A;  5K36 H;  3HKZ B;  1WTR A;  3S2H H;  2XN9 C;  3K6O A;  5BN3 A;  2LXK A;  1CKO A;  3BYY B;  4DV3 Q;  4YWL A;  3Q8D A;  1JB3 A;  3U9S A;  3TS2 A;  1OXX K;  4DV2 Q;  3CXC A;  4J6H A;  1VQG A;  4UP8 A;  2IT1 A;  4BA2 I;  1OXS C;  2B2U A;  1WJJ A;  3NTI A;  4FO2 A;  1TWG H;  1Y1W B;  1ET6 A;  1SEB D;  3PIP A;  1SNO A;  1TVX A;  1HUN A;  2FMC A;  4RKL A;  2Q2U A;  4AIM A;  1IBL L;  1BO0 A;  1PFM A;  4GKK Q;  4FXK C;  2RSO A;  3RN5 A;  4I7Z C;  3GTG B;  4HIO A;  4QF4 A;  4A3L H;  1X3F A;  2EYH A;  3GP7 A;  4O42 A;  1K3B C;  1YZ6 A;  2JA5 G;  2QF7 A;  3KBG A;  5CGK A;  3WOE A;  4BBS G;  4XDX A;  3Q22 A;  3S17 H;  2JA6 B;  1Q8I A;  2TMP A;  1B53 A;  4K0K Q;  2XRS D;  1F2Y A;  4IUU A;  1HUM A;  3AQQ A;  3UE1 A;  5C6A A;  4GOP A;  2K5N A;  2EOT A;  1TWA H;  1HNZ L;  2UXD L;  4BY1 B;  2EYP A;  2RHQ B;  5C4Z A;  4HJA A;  2IX1 A;  1EYG A;  2YV5 A;  3NPP A;  2JP1 A;  1V1Q A;  2KCM A;  1LUZ A;  3CCR A;  2RDG A;  3NBH A;  1NBW A;  3VYS A;  4FF2 A;  4UAI A;  4JI3 L;  2WB1 B;  1S72 A;  4TRD A;  3S1N H;  2PQE A;  5KNC A;  4DV6 Q;  1JR0 D;  3KYH C;  2VQE L;  5DAU A;  2A68 D;  1Z6H A;  1DCZ A;  3ULP A;  4FVM A;  1B50 A;  1EU4 A;  3GQB A;  4B3M L;  1GO3 E;  5EPL A;  1EQV A;  1BQQ T;  4NPS A;  4JI4 Q;  4HSV A;  2O5I C;  2AKW B;  1XMQ L;  5C4X G;  5C3E B;  1GD7 A;  4DAP A;  1DYQ A;  2ENB A;  5HGT A;  5D3D A;  1GKH A;  4GOP B;  2F3I A;  1HFG A;  1EEF D;  1UE1 A;  1KD1 C;  2Z9H A;  4DF7 A;  2WAQ G;  1IKM A;  4F7X A;  4K14 A;  4LF9 Q;  4ODG A;  3BVG A;  4GNX C;  4DR7 Q;  3EVQ A;  1X55 A;  2DUD A;  2VUM G;  3S14 B;  1HNX Q;  4GLX A;  4A3G G;  4WFN 3;  3NBH B;  1AZP A;  2JA7 H;  4GKJ Q;  4DR4 L;  4HJ7 A;  5EQ0 A;  3MFG A;  3MXU A;  4JI2 Q;  5FO9 B;  5JAV A;  2BH8 A;  2O5J C;  1EZ8 A;  1ICW A;  1I4H A;  1HPC A;  3PGZ A;  3V96 A;  3BVZ A;  3CRK C;  4FF3 A;  5E1F A;  2HDM A;  3CMA A;  1VMP A;  4RCN A;  2Y0S B;  1MHW C;  2N88 A;  3C1E A;  3I2Z A;  4ZAI A;  4CDD C;  3ERO A;  1LTG D;  2F03 A;  4KY5 A;  4DGZ A;  1S40 A;  4BBR H;  4A3M G;  1TWH B; 
#chains in the Genus database with same CATH homology
 4DK6 C;  1QUQ A;  4BBR G;  3J81 i;  1VQD A;  1PH6 A;  3CPW A;  1RL2 A;  1X9N A;  4X62 L;  1MJE A;  1Z9F A;  1S3O A;  3HOV H;  3LGJ A;  5IP7 H;  1Q7Y C;  5IYD H;  4YHH L;  1JT8 A;  2Z0S A;  3HOV G;  3GTK H;  4MTN A;  5IP7 G;  5IYD G;  1JJ2 A;  2I5L X;  4LFB L;  4GS3 A;  4QL5 A;  2KEN A;  5JEA J;  5BR8 Q;  2OQK A;  1HJP A;  1C0A A;  3M4Q A;  1N33 L;  2LXJ A;  3EBE A;  2Y0S G;  4R4C A;  1Y14 B;  4JCV E;  1VQI A;  2FXQ A;  4B3R L;  4B3T Q;  4R4O A;  1BBW A;  4DR4 Q;  1R9T H;  4R4Q A;  2KHI A;  2K50 A;  4A3J H;  3KOJ A;  1J5E L;  3F8T A;  2UUA L;  1PH2 A;  5C3E H;  3L2P A;  5FJ8 H;  5HGQ A;  1BBU A;  1VQJ A;  4A75 A;  4EX5 A;  2PQA B;  4DR1 L;  5C3E G;  4ME3 A;  1G29 1;  5FJ8 G;  1VQP A;  1K83 H;  4R1J A;  3I7F A;  4DR5 L;  3PO2 H;  4DKA C;  3PO3 H;  1I6H H;  3BJU A;  4A3D H;  4JI5 L;  3PO3 G;  2UU9 Q;  4DUZ L;  3PO2 G;  1HNW L;  4LF6 L;  4A3D G;  2HIX A;  1ASZ A;  1WI5 A;  1E3P A;  5LMN Q;  4JI6 L;  4C3H H;  1IBK L;  2R7D A;  4JOI A;  3AFP A;  4WJ4 A;  1N34 L;  4YY3 L;  4R4I A;  3KJO A;  4LF5 L;  4OX9 L;  3A0J A;  4JYA L;  2NN6 I;  5J3B A;  4X64 L;  4DUY L;  3H3V H;  2N78 A;  4UPA A;  1XNR L;  3JAM c;  4POF A;  2UXC L;  5GAH C;  2E5L Q;  2D0P A;  2RF4 A;  4C3I H;  4DV1 L;  2I5H A;  2Y0S E;  4IPH A;  1QUQ B;  3HOX H;  1TWF H;  2GN5 A;  2BA0 A;  4QIW E;  4KHZ A;  4DV5 L;  1XNQ Q;  3HOW H;  3HOX G;  2KHJ A;  2LSS A;  5GAG C;  4JBK A;  3HOW G;  1BVS A;  3T1Y L;  4DAY B;  3CQZ H;  1TXY A;  1EFW A;  4YCV A;  2YYZ A;  1PH4 A;  2JEB I;  4PZ7 A;  4GOP C;  5JJL A;  1JB7 A;  1H95 A;  2CWA A;  1K8A C;  3S24 A;  3PUV A;  4X62 Q;  3K0X A;  4HIM A;  4L5R C;  3PUX A;  4MNO A;  2XTI A;  2NVT H;  1A8V A;  4YHH Q;  4A3K H;  3PSI A;  3STB D;  4POG A;  5C4X H;  1CKN A;  4A3K G;  3GTO H;  4LFB Q;  1SN8 A;  4KI0 A;  4TQU S;  3I56 A;  3F2D A;  4OO1 G;  3M3Y H;  2K5H A;  1EWI A;  3J80 i;  1N33 Q;  2VL6 A;  3NEM A;  1SE8 A;  4IOA A;  1G6P A;  5M5Y H;  4DV3 L;  5JJK A;  1K0R A;  1IXR A;  1YJN A;  1Q1E A;  2EQS A;  4IO9 A;  3TQY A;  4P74 A;  1WOC A;  3AYH B;  1J5E Q;  4BY7 H;  2UUA Q;  2VQF L;  1L2F A;  4BY7 G;  2AWO A;  4DR1 Q;  2QGQ A;  2ES2 A;  2JA8 H;  1C9O A;  4DR5 Q;  3KJP A;  4BA1 I;  1VQO A;  3CP0 A;  2JA8 G;  1KQS A;  5HY6 A;  4JI5 Q;  4DUZ Q;  4A4I A;  1Q8K A;  3PUW A;  4RMF A;  4OXP A;  4AYB G;  5GAD C;  3BZK A;  3CPF A;  1WCM H;  5LMU L;  3I4M H;  4LFA L;  3I4M G;  1WCM G;  1VQ4 A;  1N34 Q;  3G6E A;  4YY3 Q;  1NJI C;  3CD6 A;  1MIU A;  3ZJY C;  3GTQ H;  4KHP L;  4OX9 Q;  1VQK A;  4JYA Q;  1FL0 A;  4X64 Q;  2CKZ B;  2RHS B;  5M3F H;  4DUY Q;  1XNR Q;  4A3C H;  1N32 L;  3L7Z C;  4A3J G;  1IYJ B;  5M3F G;  2YU9 H;  4A3C G;  3I4N H;  2UXC Q;  2WFW A;  4AH6 A;  2JQO A;  1VQN A;  2NZO A;  4DV1 Q;  1HH2 P;  2E2H H;  3I4N G;  2HQL A;  1EQR A;  2N3S A;  4A3I H;  3CAM A;  3JC6 6;  4B3S L;  4A3I G;  4X66 L;  1N9W A;  1YEZ A;  4LF4 L;  4DV5 Q;  2R7Z H;  1SLJ A;  2NVX H;  5ELO A;  1E1T A;  2R7Z G;  1SRO A;  3T1Y Q;  1UEB A;  2NN6 G;  2N8N A;  4DV4 L;  1YI2 A;  1PH5 A;  4IFD J;  3GD7 A;  5JEA G;  2Z6K C;  3RR5 A;  1NE3 A;  4LWC A;  1YVC A;  3E9I A;  1J6Q A;  4P72 A;  4DPG A;  4HID A;  1K9M C;  3TRE A;  1N8R C;  3M85 A;  4JG2 A;  1Q86 C;  4A76 A;  1HZ9 A;  2OQ0 A;  4IJH A;  5IYC H;  3W5O A;  3G4S A;  4AYB E;  1HZB A;  5IYC G;  1YIT A;  2K4K A;  1P8L A;  4JI0 L;  3GTM H;  3HOY H;  4P71 A;  1KIX A;  3RLN A;  3HOY G;  1L1O A;  1B8A A;  4JBW A;  1FJG L;  3CCJ A;  4AQY L;  2R7F A;  1PA6 A;  1JE5 A;  1DGS A;  1YNX A;  3K7U C;  5C0X J;  2VZA A;  5ELN A;  5LMN W;  1HR0 L;  4LF8 L;  2OTJ A;  3S1M H;  1CSP A;  4A3B H;  4H02 A;  4JI1 L;  1YHA A;  4A3B G;  2BA1 A;  3U58 A;  1CKM A;  4IPG A;  4IOC A;  3I55 A;  2VQF Q;  1YHQ A;  4GLV B;  4RG1 A;  1PH3 A;  4QQB X;  3GO5 A;  2OTL A;  4IFD I;  1KL9 A;  2PI2 E;  2EXD A;  2IHE A;  5IWA L;  3S2D H;  2ID0 A;  1K8G A;  2V1C C;  4PZ6 A;  3PCO B;  1VQ9 A;  1NMG A;  1QZG A;  4JI7 L;  5LMU Q;  4LFA Q;  3UDG A;  1RIP A;  1VCI A;  1Y1V H;  4KHP Q;  1Y1V G;  1GVP A;  5AJ3 L;  1YJW A;  1JJC B;  1N32 Q;  2RCN A;  2UUB L;  3KF8 B;  3H0G H;  1XPO A;  1L1O C;  3ER0 A;  1HR0 W;  3H0G G;  1AE2 A;  5C0X I;  1GM5 A;  2PI2 A;  3KFU A;  1NMF A;  3HFZ B;  4DV0 L;  4B3S Q;  1EQQ A;  4X66 Q;  1FVI A;  4LUO A;  4LF4 Q;  3S1Q H;  1PVO A;  1NTG A;  4HJ5 A;  1IZ6 A;  1G51 A;  3CCS A;  1PFS A;  1K73 C;  1LTL A;  1VQL A;  1MKH A;  4DV4 Q;  3PIO A;  3S15 H;  2IX0 A;  2E2J H;  3STB C;  1SMX A;  1EIY B;  5C4J H;  5IE8 A;  2UXB L;  1Y1W G;  1L1O B;  4C2M H;  4IJL A;  2ZTD A;  2ZJP A;  1PH7 A;  1X3E A;  1W3S A;  2EIF A;  2CQO A;  1HNX L;  1A63 A;  4X6A H;  1VQA A;  4JV5 L;  1X65 A;  3E9H A;  4DV7 L;  3CCV A;  4YWM A;  2BH2 A;  4JI0 Q;  4UP9 A;  4OWX B;  2L15 A;  3U4V A;  4DR6 L;  4WJ3 M;  2Q2T A;  2GVB A;  4P75 A;  1FJG Q;  4AQY Q;  2IY5 B;  2DGY A;  4MZ9 A;  3ULL A;  5GQO A;  1O7I A;  1HR0 Q;  4LF8 Q;  1YHB A;  1A0I A;  3OYY A;  1E24 A;  2CWP A;  3T1H L;  2GVA A;  3ICE A;  3K7A H;  1CUK A;  4JOI C;  3UDF A;  4XIG S;  3F2B A;  2Q2I A;  4A3M G;  2JA6 G;  4DR2 L;  1D7Q A;  2F4V L;  5C44 H;  2UUC L;  2IHF A;  2ALY B;  3S16 H;  5C44 G;  3CC7 A;  4GN3 B;  2R93 H;  2R92 H;  5IT9 c;  3RZD H;  1U5K A;  3E0E A;  2R93 G;  2R92 G;  3HOZ H;  4B3R Q;  1X56 A;  4JI7 Q;  2ZM6 L;  3HOZ G;  4A93 H;  4DV2 L;  1UE6 A;  1X6O A;  3TS0 A;  4A93 G;  3S1R H;  1C7Y A;  4C3J H;  5M3M H;  5GAE C;  2YTX A;  4ALP A;  4LFC L;  1I50 H;  2AHO B;  5M3M G;  1PYS B;  3F1Z A;  2CFM A;  1VQH A;  1IL2 A;  4NB3 A;  5AJ3 Q;  4QJF A;  2WP8 J;  3OW2 A;  5M5X H;  1HZC A;  2MO1 A;  1XMO L;  2HHH L;  2UUB Q;  4BXX H;  2ZTC A;  2B63 H;  4IFD G;  1EIF A;  4BXX G;  3A5Z B;  3UDX A;  2B63 G;  2JA9 A;  1HNW Q;  1Q81 C;  1OTC A;  2OWO A;  4LF6 Q;  1TWC H;  4IPC A;  1EOV A;  2F52 A;  4L5T A;  4LUZ A;  1IBM L;  4JI6 Q;  4L5S A;  1V43 A;  4DV0 Q;  1IBK Q;  3GTJ H;  1OXU A;  4TVA B;  2E8G A;  3WWV A;  4LF5 Q;  4EQ5 A;  2ATW A;  3D31 A;  4APV A;  3D0F A;  1B70 B;  2QEX A;  2PMZ E;  4PMW A;  4HJ9 A;  4GKK L;  4YCW A;  1KAW A;  3EN2 A;  1Q46 A;  2A19 A;  4DNI A;  3GTP H;  4OO1 I;  4YWK A;  5BR8 L;  3CF5 A;  4HJ8 A;  3CCM A;  2UXB Q;  1NY4 A;  1AE3 A;  5C0X G;  4A3E H;  2NVQ H;  2MQH A;  4A3E G;  1SR3 A;  4JV5 Q;  4DR3 L;  4UP7 A;  3JAM i;  4DV7 Q;  1EUJ A;  5IYB H;  4K0K L;  4DR6 Q;  1VQ5 A;  2YTY A;  1OXV A;  2VY3 A;  1I5F A;  2A1A A;  4XTC S;  5IYB G;  1VQ7 A;  1Q1B A;  3J81 j;  2AWN A;  4GN4 B;  3CW2 C;  4IPD A;  1KRT A;  1PH1 A;  1M1K C;  3PUZ A;  4O2D A;  3AEV A;  3ULJ A;  1VS0 A;  5IY0 A;  1E1O A;  4NXM L;  3MXN B;  2QA4 A;  4GNX B;  3J7Z C;  1XPU A;  1XTD A;  3SGI A;  3VDY A;  3T1H Q;  2MO0 A;  4A3F H;  1AH9 A;  2XGT A;  2OCE A;  4A3F G;  3RLO A;  3CME A;  5K36 G;  4DR2 Q;  3GTL H;  1P16 A;  2F4V Q;  2UUC Q;  2AMC B;  3S2H H;  1Q12 A;  3PF4 A;  2LXK A;  1CKO A;  4OWT B;  3RN2 A;  2H5X A;  4DV3 Q;  4YWL A;  3Q8D A;  3TS2 A;  2ZM6 Q;  1OXX K;  3I4O A;  4DV2 Q;  3CXC A;  4JBJ A;  4PZ8 A;  3UDI A;  1VQG A;  4GLA C;  2I5M X;  3DM3 A;  3PV0 A;  2IT1 A;  4UP8 A;  5M5W H;  1OXS C;  4O0A A;  4DV6 L;  2D0O A;  3RNU A;  4BA2 I;  2HHH Q;  1WJJ A;  2E2I H;  1UE7 A;  2MNA A;  1OXT A;  2K75 A;  3EIV A;  3B6Y A;  1VQ6 A;  2VNU D;  2ZJQ A;  2HT1 A;  1X54 A;  1TWG H;  2A8V A;  1PYB A;  1YIJ A;  1Q82 C;  2B29 A;  1IBM Q;  2NVY H;  3PIP A;  2JE6 I;  3FP9 A;  2K5V A;  2ZTE A;  2PNH A;  3J80 c;  2Q2U A;  3PUY A;  4AIM A;  2NZH A;  1IBL L;  3W1G A;  4GKK Q;  4JI4 L;  3HKZ G;  2K14 A;  3RN5 A;  1VQM A;  4HIO A;  1E22 A;  2B3G A;  3M7N A;  4A3L H;  1X3F A;  4JI8 L;  4A3L G;  3M4P A;  2JA5 H;  3KLW A;  1I94 L;  5JJI A;  1YZ6 A;  2JA5 G;  1VQC A;  1PH9 A;  3U50 C;  4BBS H;  3A74 A;  4BBS G;  3S17 H;  3AFQ A;  4DR3 Q;  3TRZ A;  2Q2H A;  4K0K Q;  3BU2 A;  1KXL A;  3BZC A;  3MEF A;  5DLQ E;  3AQQ A;  3UE1 A;  1Y1W H;  4LF9 L;  2KCT A;  1VQF A;  3M4O H;  1TWH H;  4DR7 L;  2C35 B;  4GOP A;  1PHJ A;  4NXM Q;  3CC4 A;  4X65 L;  4LNQ A;  2K5N A;  1TWA H;  1HNZ L;  2UXD L;  1VQE A;  2RHQ B;  4NXN L;  1ASY A;  4HJA A;  3PF5 A;  1EYG A;  2IX1 A;  2YV5 A;  3GTG H;  4GKJ L;  1Z47 A;  2KBN A;  3NEL A;  4LW1 A;  1K3R A;  5GRO A;  3A5U A;  1V1Q A;  3L0O A;  2KCM A;  1YJ9 A;  1LUZ A;  4JI2 L;  3CCR A;  1M90 C;  3HKZ E;  1LYL A;  1NBW A;  3RZO H;  3NEN A;  4JI3 L;  1QZH A;  5H1S E;  3H15 A;  1I3Q H;  3FKI H;  4JI1 Q;  3CCE A;  1S72 A;  3KF6 A;  2JA6 H;  3S1N H;  4YCU A;  3FKI G;  4LF7 L;  1HZA A;  4OWW B;  2YTV A;  2CCZ A;  4KLK A;  4DV6 Q;  1BKB A;  2I0Q A;  2VS1 A;  3KYH C;  2VQE L;  4GNX A;  5IWA Q;  5E7N A;  1QVF A;  1N36 L;  1B7Y B;  3OTO L;  3ULP A;  3GDE A;  4BY1 H;  2VW9 A;  1T9H A;  1D8L A;  4LUV A;  4B3M L;  4BY1 G;  2R6G A;  1GO3 E;  3HOU H;  4JBM A;  4QGU A;  2JEA I;  3HOU G;  3J81 c;  1MJC A;  2JJQ A;  4NPS A;  2ASB A;  3KDF A;  3DLL A;  1IBL Q;  3J7A 5;  4JI4 Q;  1QVG A;  3CC2 A;  4LFC Q;  1LM0 A;  2AKW B;  1XMQ L;  4PG3 A;  4JI8 Q;  2ZJR A;  4DK3 C;  1KC8 C;  4FDB A;  5C4X G;  1GD7 A;  1I94 Q;  1VQ8 A;  1PV4 A;  3W1B A;  1WYD A;  2K52 A;  2WB1 G;  1WFQ A;  1KRS A;  2JK8 A;  4P73 A;  1L0W A;  4OON A;  1GKH A;  4GOP B;  2F3I A;  2N49 A;  5EAY A;  1E7Z A;  1UE1 A;  1UE5 A;  1KD1 C;  4QY7 A;  3HKS A;  2WAQ G;  4LF9 Q;  2Z6K A;  1QVC A;  4GNX C;  4DR7 Q;  1KHI A;  2VUM H;  1X55 A;  4A3G H;  4X65 Q;  2DUD A;  2VUM G;  1HNX Q;  4GLX A;  1HNZ Q;  4A3G G;  2UXD Q;  3G71 A;  4NXN Q;  3NBH B;  3K81 C;  4DAM A;  3CCQ A;  4B3T L;  4UY8 C;  2JA7 H;  4Y52 H;  4GKJ Q;  4DR4 L;  4HJ7 A;  2JA7 G;  3FHW A;  3KF6 B;  4JC0 A;  4L5Q A;  4JI2 Q;  5IP9 H;  3RLF A;  3ERS X;  3H3V I;  5IP9 G;  3UE0 A;  2BH8 A;  1X3G A;  4JI3 Q;  3F2C A;  2UU9 L;  1A62 A;  1YBY A;  3CCL A;  3PGZ A;  2WB1 E;  5LMN L;  4LF7 Q;  2PQA A;  5FLM H;  2HIV A;  1W2B A;  2VQE Q;  5FLM G;  1V9P A;  4Y7N H;  3CCU A;  1JMC A;  3KDF B;  1N36 Q;  3CMA A;  3OTO Q;  1UWV A;  1PH8 A;  3S14 H;  1CSQ A;  4J15 A;  5FLX c;  2WAQ E;  2E5L L;  1XJV A;  1CKN B;  3K80 C;  3M9B A;  4GN5 A;  4B3M Q;  3I2Z A;  1FGU A;  2MFI A;  4R4T A;  3K8A A;  1U0L A;  1JJG A;  1XMO Q;  1XNQ L;  4HIK A;  2D62 A;  1XMQ Q;  1SRU A;  3TEH B;  1XPR A;  4A3M H;  1SFO H;  3U4Z A;  1S40 A;  4BBR H;  3IRB A;  1VQB A;  3G48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...