4K0KQ

Crystal structure of the thermus thermophilus 30s ribosomal subunit complexed with a serine-asl and mrna containing a stop codon
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4k0kQ00
4B3MQ 2N49A 4PZ8A 1WCMH 3TQYA 3HOYH 2K5NA 3WWVA 4DV0L 5IYDG 4HJAA 2HHHQ 3CQZH 4DUZL 1N34Q 4BXXH 5GAGC 2N8NA 5C3EG 1OXUA 2AHOB 3LGJA 1GD7A 5BR8Q 3ULLA 1N9WA 1LUZA 1EFWA 4LF6L 4JI8Q 3I4MG 1Z9FA 3EIVA 3F1ZA 1VQMA 4IFDG 4KHPQ 3J80c 1QVGA 2BA1A 1J5EQ 3HFZB 4NXMQ 4GKKQ 3BZKA 3K80C 1UE6A 1K83H 1YITA 3AQQA 1S40A 1X6OA 1NMFA 4P73A 2RCNA 4B3TQ 3FKIG 3CMEA 1GKHA 3CXCA 3KOJA 1T9HA 3HOXH 3GTKH 1VQ5A 3PSIA 2VQEL 3S1RH 3T1HQ 1GVPA 2N78A 1IYJB 2OQKA 1TWAH 3G4SA 4DV1Q 3K7UC 1D7QA 2OQ0A 1VQGA 2RF4A 4YY3L 4DV5Q 4JV5L 1GM5A 1YJWA 2OTJA 2YU9H 3PUZA 1PYSB 1EQRA 4A3DG 2PI2E 4PZ6A 1KRSA 3K7AH 2DGYA 1PVOA 1I5FA 1HNWQ 2CWPA 4OX9Q 2QGQA 2WB1G 4OO1G 3H3VH 2JK8A 4JI6Q 4JOIC 1EIYB 2R93H 3MEFA 2MNAA 2VQFL 4A3IH 2E5LQ 1CKNB 5FLMH 1O7IA 4IFDI 1VQAA 1YI2A 3PO3H 1M90C 3D0FA 4AH6A 4DR1L 1PH9A 2UXCL 3BU2A 5ELNA 4A76A 2YTVA 4DV3L 4DV0Q 1BBUA 2Q2IA 4GN3B 1FL0A 4DV6L 4DUZQ 4QY7A 1X65A 5IY0A 1LM0A 2R92H 1UWVA 4BBRG 4LF6Q 4A3CG 4HIOA 1VQNA 2VUMG 1CKOA 2A1AA 1DGSA 4MZ9A 5C0XI 1VQFA 5LMNL 2XGTA 1YHBA 3UDIA 5JJIA 1Y1VH 1BVSA 4XTCS 4BA1I 2K4KA 1LYLA 4GNXB 1XMQL 2EQSA 5IYBG 4A3FG 3I2ZA 3S1QH 2VQEQ 3RNUA 3F2BA 2JJQA 1K3RA 1M1KC 1HNZL 2B63G 3I4MH 2HQLA 2R7ZG 4L5RC 1JB7A 4LFCL 3CMAA 4YY3Q 3M7NA 5GROA 2NZHA 1XPUA 3S17H 4JV5Q 2AMCB 3RN2A 1EQQA 1I6HH 3KYHC 1YHQA 4X6AH 2ALYB 2NVTH 3L7ZC 3S24A 1N32L 5IT9c 3GTLH 3K81C 1X56A 2C35B 2CFMA 1PA6A 3M3YH 2D0OA 1CSPA 1MJCA 3KDFB 1HZCA 4UPAA 4A93G 3PF5A 1CKMA 4UY8C 4H02A 2WAQG 1PHJA 3FKIH 2VQFQ 4BY1G 3E9HA 5C44G 4GN4B 4DUYL 1NY4A 1WJJA 3TEHB 1I50H 4DR1Q 4DV2L 3G48A 1KAWA 1VQPA 1IBML 2WFWA 2BH2A 3G6EA 4QQBX 2BH8A 5M3MG 2UUBL 3CC4A 1YZ6A 4X66L 4DV3Q 1MKHA 2ZJQA 4DV6Q 2QA4A 4JI8L 4B3SL 2ES2A 4LF9L 4OWWB 4HIDA 1TWFH 1L1OB 3D31A 5JEAJ 2KCTA 4DK3C 4X64L 1Q86C 1PH7A 1N36L 3CCUA 1J5EL 3S2DH 4A3DH 4GKKL 4A3KG 1G291 1CUKA 1YHAA 3I7FA 4DR5L 4DR7L 1JT8A 1JMCA 4RMFA 5GAEC 5LMNQ 1SR3A 1KC8C 1U5KA 4B3TL 1A8VA 1NBWA 4R4CA 1XMQQ 1QUQB 2RHSB 1UE1A 5M5YH 1E3PA 1Q1EA 1HZ9A 3PUWA 2I5HA 5IWAL 3OW2A 4IJLA 2KBNA 3F2CA 3L0OA 3L2PA 1HNZQ 1TWCH 4JI3L 1PH8A 4BBRH 4A3CH 4GLXA 1KHIA 4LFCQ 4P72A 2VUMH 2PMZE 3W5OA 2B3GA 1QZHA 4GLAC 2K14A 2YV5A 4AIMA 3RZOH 1N32Q 3E9IA 5FLXc 4GOPC 4R4IA 4BY7G 1VQBA 4NPSA 1IXRA 1TWHH 1RIPA 3AFPA 3CAMA 4DR3L 3KJOA 1VQDA 1E24A 3CCQA 1N8RC 5IYBH 2OTLA 4IPCA 5IE8A 4A3JG 3HKZE 3F2DA 1QZGA 2HIVA 3PIOA 4AYBE 1PH3A 1X3EA 4DUYQ 3UE1A 3CD6A 1HR0W 2UUCL 4POFA 5M5WH 4DV2Q 1IBMQ 4X65Q 2MO1A 1XMOL 1VQLA 2R7ZH 2UUBQ 2IX0A 1B8AA 2K50A 4X66Q 2OCEA 4QL5A 4HIKA 1A63A 3AEVA 4LF9Q 4B3SQ 1OTCA 1YBYA 1QVFA 4X64Q 1N36Q 3HOZG 4DR7Q 4X62Q 3STBC 4HJ8A 4DR5Q 4L5TA 2H5XA 1KIXA 2E2HH 1KL9A 3HOUG 4A93H 1L2FA 2F3IA 4OWXB 3GO5A 3RZDH 1YNXA 2E2IH 3TS2A 5C44H 5C0XG 3PF4A 3HOWH 1V43A 3S14H 2PQAA 5M3MH 3G71A 5GAHC 3CCVA 1AE2A 2PNHA 4A3BH 2ASBA 5JJLA 4OONA 5IWAQ 1PH5A 2LXJA 4L5QA 3UDFA 3HOVH 4JBKA 3I55A 3CPFA 4JI3Q 3OTOL 1VQOA 4A3KH 4ALPA 2VW9A 1VQKA 4BBSG 1B7YB 2JEBI 4JYAL 1OXSC 2BA0A 2F4VL 1YJ9A 4TVAB 4DAMA 2KHJA 5M5XH 3PO2G 4DR3Q 3UE0A 3M9BA 3ULPA 4A3LG 2Z6KA 2IT1A 4JI5L 4AQYL 2UUCQ 1X9NA 1N33L 1X3GA 1XMOQ 1OXVA 1V9PA 1XPOA 1AH9A 3M4QA 3AFQA 3STBD 4EQ5A 1R9TH 1PYBA 1WYDA 1NTGA 2N3SA 1GO3E 1Q12A 4R1JA 4BY7H 1Q8KA 3PUVA 2XTIA 3EBEA 4A3EG 4A3JH 1BBWA 3B6YA 3DM3A 3CCLA 4GKJL 1KD1C 5GQOA 1CKNA 4C3IH 4JG2A 4YHHL 4IOCA 2EIFA 5IYDH 4DNIA 2VS1A 5C3EH 3EN2A 3CP0A 4A75A 1PH6A 1KQSA 1VQ9A 3E0EA 4P71A 2UUAL 4MTNA 2ZJPA 1IBKL 3PCOB 1A0IA 3HOZH 1Q46A 4OWTB 3OTOQ 4WJ4A 2NVXH 1C7YA 5JEAG 2GVAA 2I5MX 2JE6I 2Q2UA 5LMUL 3HOUH 4JYAQ 2EXDA 5GADC 4YCVA 3H15A 2F4VQ 2UXBL 1CSQA 1VQ4A 4GNXA 2K52A 4JC0A 4P74A 2RHQB 1ASZA 2ID0A 1ASYA 4R4OA 4YWLA 1EUJA 1VQEA 1TWGH 1WCMG 3KF6A 3NENA 4GN5A 1V1QA 1Q81C 1I94L 1Q7YC 3PIPA 1KXLA 3ER0A 4JI5Q 4AQYQ 2Y0SE 2JA8G 1N33Q 3S16H 5IYCG 2ZTDA 4IPDA 3DLLA 5M3FG 1E1TA 2NN6I 2DUDA 4BBSH 3K0XA 2VL6A 4X62L 3RLOA 4RG1A 2CWAA 5C4XG 1EIFA 4FDBA 1HR0L 3J81i 2YTXA 3HKZG 1K8AC 4JBMA 1WFQA 1QVCA 3KDFA 3TS0A 4AYBG 3A74A 3PO2H 4DR6L 3NBHB 5DLQE 3U4VA 1YVCA 4NB3A 4GKJQ 1G51A 4DV7L 4LF8L 4YHHQ 3NEMA 3CCRA 2A19A 2HIXA 3ZJYC 3T1YL 3U58A 5K36G 3KF8B 4NXNL 3ICEA 2JA5G 3CCSA 2ZJRA 2R7FA 4IPHA 1L1OA 4PZ7A 3GTJH 4PMWA 2UUAQ 3KJPA 1MJEA 1IBKQ 4HJ7A 3GTGH 1YEZA 4DPGA 2FXQA 2JA7G 3VDYA 4UP7A 4R4QA 5IP7G 4LFBL 5LMUQ 4O0AA 5FJ8G 3MXNB 4GOPB 4A3EH 4LF4L 4YWMA 2UXBQ 5ELOA 4A3IG 1Y1WG 4A3FH 1X3FA 1OXXK 5FLMG 1EYGA 3H0GG 3JAMi 1XNQL 4LUOA 3J81c 1I94Q 4BA2I 2B63H 3J7A5 3A5UA 4C3HH 1YIJA 1E7ZA 4LUVA 2E8GA 1PH4A 2VZAA 3K8AA 2K75A 2D0PA 1EWIA 5E7NA 4O2DA 3CW2C 1VCIA 4YCUA 4A3MG 2CKZB 4LF7L 1HJPA 2KENA 4JBJA 4KLKA 1E1OA 2V1CC 3BZCA 1HR0Q 4QIWE 4JI2L 3JC66 3KLWA 1JJGA 1BKBA 2GVBA 4DR4L 4UP9A 3AYHB 2AKWB 3U4ZA 1Q82C 3U50C 4BY1H 4DR6Q 4OXPA 1EOVA 2KHIA 4DV7Q 2L15A 4LF8Q 4GLVB 2UXDL 2PQAB 3I56A 2ZM6L 3T1YQ 2VNUD 5JJKA 3A0JA 1IBLL 2HT1A 2JA8H 1J6QA 5IYCH 4LWCA 4NXNQ 1X54A 1B70B 5M3FH 2K5VA 3GDEA 3H3VI 5J3BA 4K0KL 4DV4Q 2NVQH 3GTQH 3PV0A 3JAMc 5C4XH 1JE5A 1P16A 1NE3A 1H95A 2Z0SA 1VQHA 1SN8A 1C9OA 4YWKA 1VQJA 4LFBQ 1FJGL 1U0LA 5HGQA 4LF4Q 4HJ5A 4APVA 3CC7A 2Z6KC 2ZTEA 3PGZA 4IFDJ 1P8LA 1Z47A 4IJHA 4QJFA 4C3JH 2UU9L 1XNQQ 2IX1A 2LSSA 3J7ZC 2JA5H 4B3RL 3F8TA 1PH1A 4IOAA 2PI2A 3S1MH 1HH2P 2E2JH 2CCZA 1MIUA 2JA9A 4A3GG 2I0QA 4JI7Q 5AJ3L 2R6GA 2JA7H 2YTYA 1RL2A 2I5LX 1FGUA 5IP9G 1KRTA 2KCMA 5IP7H 4LF7Q 3S15H 2WP8J 2MO0A 4LFAQ 5FJ8H 1SFOH 1XNRL 1SRUA 5C0XJ 4DR2L 2NN6G 2GN5A 4ME3A 4JI2Q 4A4IA 1Y1WH 4JOIA 1UEBA 3CC2A 4DR4Q 4XIGS 1XJVA 2Q2TA 1UE7A 3KFUA 1E22A 2AWOA 2Y0SG 3ERSX 3H0GH 2A8VA 4J15A 4JI0L 3M4OH 1YJNA 1K9MC 2ZTCA 2UXDQ 1Q1BA 2ZM6Q 3UDGA 4LF5L 1IBLQ 3BJUA 1PV4A 1WOCA 4DK6C 3GTOH 1SLJA 1X55A 2LXKA 1AE3A 3RLFA 2NZOA 1FVIA 1PFSA 4LUZA 3ULJA 3CCMA 4A3MH 4K0KQ 1HNXL 3PUXA 1I3QH 1WI5A 1K0RA 3HKSA 1VS0A 4UP8A 3CCJA 1S72A 1FJGQ 4GNXC 1IL2A 3RLNA 4LNQA 2JQOA 2WB1E 2JA6G 4L5SA 3I4NG 3W1BA 2UXCQ 1G6PA 1VQ7A 2IY5B 3M4PA 3KF6B 4JI1L 2ATWA 3I4OA 3HOYG 4PG3A 5C4JH 2K5HA 2UU9Q 2CQOA 1K8GA 3IRBA 4BXXG 2IHFA 4B3RQ 3M85A 2YYZA 1VQCA 4OO1I 1XTDA 4Y7NH 3TRZA 2OWOA 3Q8DA 4LW1A 4JI4L 4POGA 3J81j 5AJ3Q 1VQ6A 3RR5A 1W3SA 4DAYB 1L0WA 1SMXA 3NELA 4KHZA 3PUYA 1XNRQ 4DR2Q 4X65L 3FP9A 3GTPH 1NJIC 4B3ML 2MFIA 1JJ2A 3FHWA 3S2HH 1JJCB 1OXTA 2MQHA 4JCVE 3GD7A 4R4TA 4A3LH 3HOXG 2HHHL 3HOWG 5LMNW 1Y14B 1N34L 4JI0Q 2R7DA 1SROA 4EX5A 5BR8L 4A3BG 4LF5Q 4KHPL 1L1OC 4P75A 4HIMA 4A3GH 1HZAA 3HOVG 2NVYH 4DV4L 4GS3A 4NXML 4YCWA 5EAYA 5IP9H 4C2MH 4DKAC 2IHEA 3A5ZB 5HY6A 1NMGA 2F52A 1IZ6A 1HNXQ 4WJ3M 2QEXA 4IO9A 1SE8A 3TREA 1LTLA 2R93G 3W1GA 5H1SE 4MNOA 1PH2A 4TQUS 2VY3A 1QUQA 1A62A 4IPGA 4JBWA 3J80i 2JEAI 3PO3G 4Y52H 3T1HL 2WAQE 1W2BA 2AWNA 3CPWA 2Q2HA 4DV1L 4JI1Q 3S1NH 1HZBA 4DV5L 3RN5A 1VQIA 3GTMH 1UE5A 1TXYA 1C0AA 3SGIA 3UDXA 1S3OA 2R92G 4JI7L 3OYYA 4JI4Q 4HJ9A 3CF5A 1XPRA 1VQ8A 1HNWL 4OX9L 4LFAL 1K73C 4JI6L 4QGUA 2B29A 4GOPA 4KI0A 2E5LL 1Y1VG 2JA6H 3I4NH 3CCEA 1D8LA 2D62A
chains in the Genus database with same CATH superfamily
4PZ8A 3TQYA 1TS4A 4DV0L 5IYDG 2HDLA 4HJAA 2F0KA 4DUZL 4BXXH 3LGJA 1AFPA 2R92B 1LUZA 2QILA 2F03A 2NUCA 2C9OA 3BZDB 3DUZA 5G3LF 1B50A 2RCFA 3BZKA 1K83H 4TRDA 1X6OA 4IZ8A 1Y1VB 1PZKD 5FLXL 4KY6A 3FKIG 4LAAA 3CXCA 1STGA 2A69C 3HOXH 3GTKH 1VQ5A 3S1RH 2OQKA 3K7UC 2LFNA 1V8QA 5EQ0A 3NP8A 1LT5D 2E2DC 4YY3L 4DV5Q 1GM5A 1I6HB 2OTJA 2EPBA 3P75A 2DY8A 1BR9A 1PYSB 2O5JC 4UDUC 1KRSA 3K7AH 4RH6A 2QGQA 2MHVA 1CT1D 4JOIC 2WV6D 3MEFA 1SYGA 3E6ZX 4YIJA 2M2LA 5FLMH 4IFDI 3PO3H 2EZVA 1I50B 3BU2A 3QG1A 4LMQD 5ELCA 2F0IA 4KJNA 1ET9A 2Q2IA 3S16B 2AQ3B 2EY5A 3M7GA 3S2DB 5D3IB 2KCCA 2VUMG 2HCCA 4MZ9A 1VQFA 5C5MA 5LMNL 3UDIA 1SSOA 2PYKA 5D3DA 3NBIA 3BVGA 2TMPA 2XRSD 2SNMA 3K57A 3A56A 2DJFC 4DXGA 2JJQA 3KLSA 1K3RA 3GTJB 2VUMB 2AMCB 3KYHC 1YHQA 3NWTA 5E1FA 4XDXA 2B2TC 1EZ8A 1MJCA 2QDBA 4LJZC 1ZXTA 2K04A 4H02A 2WAQG 3X3MA 2K5DA 2F4IA 4N8X1 1NY4A 1JCKB 4QQBX 2UXCQ 1PZJD 2C5CA 1H9KA 3CC4A 2ZJQA 4DV6Q 4LF9L 2OT2A 3D31A 1L1OB 3ITPA 1PH7A 2KCTA 2KECA 3LWEA 3RD4A 1N36L 2JXMB 1G291 4DR7L 4DR5L 2BCOA 1JMCA 3A55A 3DMUA 2WAQB 1GUWA 3SDZA 2QW7A 3V96A 4WFN3 2FMMA 3K5OA 1XMQQ 1XWEA 5M5YH 2Z4HA 1U4LA 3PUWA 5IWAL 1VMPA 3F2CA 4G57A 1HNZQ 4LFCQ 1KHIA 4P72A 5EBDA 3W5OA 2K14A 2YV5A 1N32Q 3E9IA 4JPBW 1PRTF 2GA4B 1G2TA 4AYBB 4R4IA 4BY7G 4NPSA 1RTNA 3CAMA 4IPCA 1IKMA 3F2DA 3GV3A 1PH3A 4DUYQ 1SXTA 5M5WH 1IBMQ 1PTOF 1UUPA 5FO9B 3QWNA 4HIKA 2OCEA 1F2LA 3HEJA 1HA5A 3AB9A 1YBYA 2CVRA 2OXPA 1QILA 5EPKA 2JA7B 3HOZG 3T4AC 5I4DA 5A2QE 4BY7B 4L5TA 1KABA 1HCZA 1KL9A 5C44H 1K0SA 3SXHA 5C4HA 1V43A 2PQAA 5M3MH 3CCVA 3ND8A 3J81L 4DK0A 4L5QA 3UDFA 2JP1A 3HOVH 4JI3Q 3HOZB 5CC4A 4K5VA 2B2YC 1PRTC 5E3FA 1FNWA 4BBSG 2EXZA 4FF3A 1LT3D 3FDTA 4ABNA 2BA0A 3DWAA 4DAMA 4DR3Q 1CA5A 2IJ0A 4XQQA 1BXTA 1PTOC 3D4DA 4OL7A 4AQYL 3R2IA 1D1IA 1XMOQ 3C3LA 1AH9A 4NW2A 4BBSB 1PYBA 2N3SA 3VYRA 1GO3E 2K5WA 2B2WC 3PUVA 2F0NA 1BBWA 3GTPB 3DM3A 3HZXA 4JG2A 4QUCA 2EIFA 1TY0A 2VS1A 1O7ZA 4IFDH 4ZAIA 3CP0A 1ONLA 1VQ9A 3CKIB 3E0EA 4P71A 2UUAL 2NVXH 1KAAA 2GVAA 4RGOS 5LMUL 3HOUH 1O80A 2PCFB 4G7OC 3EFXD 1JR0D 5A35A 4GNXA 1K8OA 1A3UA 4X3UA 4XXEA 2ID0A 3OMCA 5C3WA 2KEEA 2LY7A 1Q81C 3NENA 1KDAA 1SNDA 3KF6A 1WCMG 4ODGA 3PIPA 4JI5Q 5D65A 2Y0SE 3VA5A 1N33Q 2QEJC 2ZXOA 4IPDA 2F0FA 4K2LA 2F0OA 2EYMA 1K3BC 3K0XA 2A74C 4DAYA 1HR0L 2YTXA 3HKZG 4JBMA 1WFQA 1PFMA 1VMCA 3PO2H 5DLQE 2WACA 3WOEA 1HA6A 4GKJQ 3ERQA 1WCMB 3S9WA 4LF8L 4V0BA 4YHHQ 1HFGA 3NEMA 4NKLA 4CDDC 2A19A 5JPMC 2HIXA 3CQZB 3URYA 4RKBA 4B08A 3KF8B 4NXNL 4R8IA 1B1ZA 4NP5A 1HXYD 4PMWA 2F0JA 1MJEA 4HJ7A 2J0TD 2H4OA 2WINB 3HKZB 4UP7A 1DM0B 2PPBC 3BYYB 4NMZA 5FJ8G 4LF4L 2E74C 1S4ZA 4ZRZA 2UXBQ 5ELOA 1Y1WG 4A3FH 4FF4A 3I70A 3JAMi 1I94Q 4N8FA 3MAQA 3J7A5 3A5UA 2F0VA 1YIJA 4LUVA 2E8GA 4K5WA 2K75A 2YU9B 3QR8A 3D6WA 1HJPA 2R3ZA 1E1OA 4JI2L 1Y1WB 3KLWA 5TSSA 3BDLA 4BY1H 2Z8LA 4OXPA 4CBVA 1RTOA 1W6KA 2KHIA 2M9VA 2PQAB 1C8CA 2VNUD 1IBLL 1J6QA 2E75C 3VYTA 2RA4A 3I3CA 5M3FH 2WKCA 2K5VA 1EU3A 4JK1C 1S5CD 3GDEA 5J3BA 4K0KL 4DV4Q 1HPCA 1Y8OB 5LL6X 3V05A 1JE5A 1P16A 1VQHA 4F87A 1C9OA 4YWKA 5C3XA 4LFBQ 1FJGL 1EZ6A 5HGQA 3G7LA 4APVA 4C1NK 2ZTEA 4CDCC 4DK1A 3Q23A 3AMUA 1P8LA 3MXPA 4IFDJ 4QJFA 4S3SA 2UU9L 1MI2A 3A8JE 3F8TA 1PH1A 4K2KA 1WD0A 2PI2A 1DCZA 3S17B 1H9JA 1G2SA 3CU7A 4A3GG 1BQQT 1IW7C 1NUCA 5AJ3L 2YTYA 1RL2A 5IP9G 1KRTA 3J80L 2I46A 1R4QB 2NN6G 4ME3A 4A4IA 2A5HA 1XJVA 1E22A 3H0GH 2A8VA 4J15A 3M4OH 1Q90A 2ZTCA 1F77A 2ZM6Q 1WOCA 4A3GB 4WJWA 3I73A 1O78A 3T13A 3RLFA 3CCMA 2F0SA 3ULJA 4A3MH 3HRZC 2HQEA 4C1NI 1HNXL 2KOLA 3EA6A 3PUXA 1I3QH 1HUNA 3CCJA 1B44D 1F9PA 1VS0A 2F0MA 4UP8A 5J22A 2HUGA 3MTSA 2KUMA 1VQ7A 3KF6B 1HFNA 5C4JH 3IRBA 5CV7A 2QF7A 1TWCB 2IHFA 1J8IA 1SE4A 1RJTA 1ZYRC 3TZDA 2IL8A 3Q8DA 4POGA 3BS1A 3RZOB 3OSOA 3QJYA 2DJGC 1L0WA 4DAYB 1SMXA 4KHZA 3PUYA 1B3QA 3TDQA 4IUPA 4QCLA 1E2VA 1D6EC 4Q5VA 1JJ2A 3KBXA 2OEOA 2DN8A 2RSOA 1Y14B 5E4XA 5LMNW 3HOWG 1SROA 3OIPA 2HCIA 1PLFA 2E2HB 2IHEA 1VF7A 2L55A 1ZKOA 5IT9L 4A93B 2QEXA 3RZDB 1V1PA 1WTVA 2R93G 1SEBD 1SE2A 2F0TA 4IPGA 1A62A 3VA7A 1WTQA 3HOWB 4Y52H 1W2BA 2WAQE 2AWNA 2Q2HA 4JI1Q 3S1NH 1D1KA 4DV5L 1EYCA 4DF7A 1VQIA 3RN5A 2D9UA 3NHHA 1EOTA 1M8AA 1S3OA 4KD4A 2EYOA 1SYEA 1QCBD 2K5QA 4QGUA 1DXMA 2R93B 4GOPA 2JA6H 3I4NH 3J7AV 3CCEA 1JICA 4B3MQ 3HOYH 5L37A 3WWVA 1GUTA 1EL0A 1EQTA 1X3QA 4MTKA 2ZT9C 1OXUA 5IOCA 3VR3A 1GD7A 5BR8Q 3ULLA 1N9WA 3GTGH 3I4MG 4JI8Q 3F1ZA 2VB3X 3EIVA 4RKLA 4TKOB 1L0YB 1J5EQ 4IUNA 4V190 4XQJA 4GKKQ 1X32A 3ND9A 3MA2B 3E0JA 1S40A 3N6RA 3KLRA 4P73A 1LTAD 1SBBB 4F7XA 4B3TQ 4C3IB 3CMEA 3VR5A 1T9HA 2K05A 1Q8IA 1A6XA 5J39A 3T1HQ 1IYJB 1BUVT 1TWAH 3G4SA 4DV1Q 3I4MB 1DONA 1D7QA 1LTTD 3MXGA 2RF4A 3OMGA 3GTLB 3BDOA 4PZ6A 1HNWQ 4OX9Q 3RUZA 2WB1G 2JK8A 1PZID 2J4XA 1EIYB 4JI6Q 2MNAA 3GP7A 2E5LQ 1CKNB 2SOBA 1O7IA 5I6WA 1PH9A 2UXCL 5ELNA 2N55A 4HEDA 2YTVA 1DOMA 3FVQA 4OELB 4GN3B 4DV6L 4QY7A 1X65A 1LM0A 2R92H 4RGNA 1UWVA 4LF6Q 4HIOA 1CKOA 3SK8A 5M9OA 4EGVA 1DGSA 2XIWA 2EJGC 2XGTA 4XT1B 2A68D 1Y1VH 1BVSA 4K14A 2K4KA 3TZUA 1XMQL 5IYBG 3K59A 1NSNS 2WIIB 3S1QH 2VQEQ 3RNUA 3F2BA 1M1KC 1HNZL 2HQLA 2R7ZG 4LFCL 1M4VA 3CMAA 3OWEB 4JV5Q 1I6HH 3RN2A 1EQQA 5IGDA 5ISRA 2NVTH 1N32L 1X56A 2C35B 2NTTA 1IKLA 2CFMA 1PA6A 2D0OA 1CSPA 3KDFB 4A3EB 4UY8C 1EYAA 1PHJA 4ZK9B 3FKIH 2VQFQ 2RDHA 2KEDA 4DUYL 2KVMA 2LMCB 3TEHB 1I50H 4PQXA 4DR1Q 1KAWA 1VQPA 1IBML 2BH2A 1ET6A 2BH8A 3NK9A 4C3HB 4DV3Q 4BS9A 4KN7C 2ES2A 1LTID 5C6AA 1TWFH 4DK3C 2MPMA 1S5DD 2NBFA 3DWPA 3CCUA 3S2DH 1U9RA 1SE3A 1BF4A 1D2BA 3PMFA 5T1IA 4RMFA 1MHWC 3QIAA 1BCPD 1KC8C 1U5KA 2EYLA 1A8VA 2HD3A 1SNOA 2M00A 2RHSB 4X3KA 1HZ9A 2I5HA 2Z1CA 3L0OA 5I9OA 4QMGA 4JI3L 1PH8A 2NVQB 5ELDA 2VUMH 5C4XB 4AIMA 2B2UC 5FLXc 4DR3L 3AFPA 4FNFA 3KJOA 3CCQA 2OTLA 4A3JG 1C48A 3HKZE 1TIID 3PIOA 3QOJA 1X3EA 4C3JB 3UE1A 3CD6A 1HR0W 3OIQA 4DV2Q 2JA5B 1XMOL 2UUBQ 2JSOA 3S1MB 3RMHA 1A63A 1A2TA 4K6LA 4ZKBB 1OTCA 1QVFA 3H09A 3L3OC 3S15B 4X62Q 4F8MA 4HJ8A 1SFOB 3T16A 4ZKCB 3NTHA 2K32A 1L2FA 4OWXB 4A3JB 3GO5A 4G7ZC 5IT9E 5HURA 1YNXA 3TS2A 3LWUA 5C0XG 1NR2A 3PF4A 3PIP3 2N88A 3G71A 2D5DA 5GAHC 1AE2A 2PNHA 3T53B 2ASBA 4A3BH 4OONA 1PH5A 5JJLA 3NUCA 4JBKA 3IKJA 4MN3A 4DA2A 5M5XH 5JPNC 5JAVA 1ICWA 4IUVA 1Y8NB 4MIUA 2Z6KA 4A3LG 4JI5L 2UUCQ 1N33L 1T5XD 1XPOA 3M4QA 3KK7A 3BG3A 4X3TA 1R9TH 1LV9A 1CZWA 4BY7H 2XTIA 1X3PA 4DGZA 1CHPD 4RGMA 4GKJL 1KD1C 4YHHL 4F88A 1EY7A 4OHJA 4DNIA 4HTHA 3GV6A 5C3EH 1CK1A 4A75A 1KQSA 5CV5A 4MTNA 1E2ZA 3HOZH 2NYZD 4KD3A 1C7YA 3EROA 4JYAQ 5DM73 5GADC 4YCVA 2F0DA 1IHZA 2UXBL 1VQ4A 4JC0A 1ASYA 4PMCA 4RGTA 1VQEA 1TWGH 1I94L 1STAA 4GN5A 1MBYA 1V1QA 1QB5D 1S5BD 4CDFC 4EQNA 1WVLA 4DXFA 2JA8G 2NN6I 3R8BA 4BBSH 2F0PA 1TT2A 3RLOA 3FPPA 1TY2A 1EIFA 1K8AC 4AYBG 3JAME 3NBHB 3ZYYX 1YVCA 2EE1A 1DYQA 3IFDA 2JA8B 2EVBA 3ICEA 1FNUA 3GTQB 3TBIB 3KJPA 1IBKQ 2JA7G 1K83B 1AZQA 3NXWA 4LFBL 3D3RA 5IODA 2FINB 4CKEA 1WTXA 5IGEA 3NQIA 1X3FA 2ICEC 1OXXK 5FLMG 4QUFA 3S1RB 3R2TA 4H0LC 3J81c 4HAEA 2B63H 5C5LA 3IL8A 2F0LA 3K8AA 2D0PA 5E7NA 4QIWB 4O2DA 1D5ZC 1VCIA 2DNEA 1C4QA 1RODA 2KENA 4FXDA 3H3VC 1NCVA 2F1MA 4KLKA 3JC66 3MFGA 4RHRA 3NWSA 4IUTA 2AKWB 3U4ZA 1Q82C 1EOVA 3PO3B 4CJ2C 1S5FD 4DV7Q 2Q8RE 2ZM6L 1QWYA 5JJKA 3BVMA 4LWCA 1X54A 2FMCA 3K6OA 1B70B 1JWSD 3T56B 1STNA 1STBA 5IIFA 1LT4D 1SN8A 4IURA 4EVOA 3A7LA 4KY5A 3PGZA 5J1ZA 1Z47A 4UHVA 1XNQQ 3J7ZC 1LABA 4IOAA 1JE4A 3NQTA 3D4RA 1MIUA 2JA9A 1Q3LA 1DJRD 2R6GA 4MHEA 1W6JA 2I5LX 4EQOA 2F0QA 5FJ8H 1G91A 5JVH3 2GN5A 1Y1WH 1BNZA 3CC2A 4DR4Q 2F3WA 1G8ZD 2AWOA 1QOHA 4IUQA 3ERSX 3TP6A 5JOBA 1KNAA 3UDGA 3NSWA 3BJUA 1PV4A 1SLJA 1NNXA 4CJ1B 4WJ4A 1PFSA 4C2MB 2EY2A 2JYOA 5DNFA 1WI5A 4FYDA 3HKSA 1TQOA 4GNXC 1EEFD 1VF5C 1IL2A 4LNQA 2WB1E 2QKIC 2V4DA 4Z9CB 5M5YB 3W1BA 3M4PA 3CHBD 4JI1L 2ATWA 3I4OA 1EFID 1PTOH 2CQOA 1K8GA 4B3RQ 2YYZA 1XTDA 1S5ED 4XYQA 4Y7NH 4LW1A 1A3TA 1VQ6A 3RR5A 1PFBA 3NELA 3OOCA 2K7VA 4RCOA 2IWHA 1XNRQ 4DR2Q 5BN4A 1NJIC 4B3ML 2MFIA 3H6MA 1F9SA 3AU7A 5M5WB 4IALA 1KTKA 4JI0Q 2R7DA 1JWUD 4EX5A 5BR8L 4CKBA 1YNND 4P75A 1UNSA 4A3GH 1HZAA 3HOVG 2BDOA 5EAYA 5IP9H 1UEAB 4B9XA 1ESRA 5FO8B 1IZ6A 1JB3A 2DNCA 2NN6H 1OO9B 3EJIA 1ENFA 3W1GA 5C44B 1QUQA 4JBWA 2KHSA 3T1HL 5M3MB 4DV1L 3IAYA 3NPPA 3GTMH 3EVQA 3HOVB 2F3VA 2KCNA 1C0AA 3SK6A 4JI7L 4JI4Q 2F0WA 5JEAH 3CF5A 1HNWL 4OX9L 4LFAL 1K73C 4JI6L 3TP5A 3HGBA 3A8KE 2E5LL 1F2ZA 3VYSA 2Q8TA 1H9RA 2K5NA 2CQAA 2AQ2B 2HHHQ 5LL6S 4XQNA 1CI3M 2Q2UA 2N8NA 2AHOB 4BA2I 4IFDG 1EFWA 2XWBB 3VYUA 4LF6L 1VQMA 3J80c 2BA1A 1KNEA 4NXMQ 2EYPA 2PZWA 3K80C 1YITA 3TSSA 3AQQA 1RDPD 2K28A 1GKHA 2A68C 1HRJA 1BCPF 3PSIA 2VQEL 4FP5D 1GVPA 2N78A 4EQPA 5NUCA 4JVZA 1VQGA 4JV5L 1F2MA 3SK5A 1YJWA 5EGTA 3DEPA 2NVXB 1EQRA 4A3DG 3M3YB 1Z7TA 2CWPA 4OO1G 2A6ED 1EWHA 2R93H 2VQFL 4A3IH 3C1FA 1VQAA 1YI2A 1M90C 3D0FA 4AH6A 4DR1L 3HG9A 1A15A 4HMIA 4DV3L 2Z4IA 3O13A 1FL0A 4QB4A 3W2DA 1FYCA 2IW3A 4BBRG 4A3CG 4A3DB 1II3A 4X3SA 5C0XI 1YHBA 3PO2B 3NTIA 4RCNA 5FKAC 5EPJA 4J1MA 1RKNA 3PIO3 4GNXB 1BCPC 4A3FG 1V1OA 1H9SA 1F9RA 2BOSA 3I4MH 3FRPB 4GZYC 4BBRB 4L5RC 1PRTD 1JB7A 2NZHA 2X6GA 1XPUA 2ALYB 1TKWB 3L7ZC 4M1UB 3S24A 5IT9c 3GTLH 1B9MA 1HQRD 3K81C 3NTKA 1CZGA 2F0HA 1HZCA 4TSSA 4A93G 3PF5A 1PXUA 3DEOA 4A3FB 4BY1G 1CHQD 2L11A 3WOFA 1H9MA 3G48A 4DV2L 3G6EA 2K33A 2UUBL 1YZ6A 1T5EA 5JEAJ 1Q86C 4HSVA 4U673 3R3OA 3ONAB 4A3KG 1CUKA 3I7FA 1JT8A 1A2UA 1LTBD 5GAEC 1PMRA 4BY1B 1B4OA 3H91A 5D14A 1U4PA 1NBWA 4R4CA 1QJOA 1QUQB 1STYA 1WTPA 2K6AA 3S14B 3J7YW 1QNKA 1E3PA 1Q1EA 3KBGA 1JC7A 2TSSA 4OIKA 4RHSA 1LTRD 4A3KB 1KDCA 4Q0FA 2B3GA 1Z6HA 1JOKA 2BE5D 4L6TB 4WRDA 5I6YA 4GOPC 1IXRA 1TWHH 1E24A 5IYBH 5IE8A 4FO2A 4AYBE 1SJED 2XN9C 4C3IG 3P7JA 2UUCL 4POFA 2MO1A 1VQLA 2O4XA 2R7ZH 2IX0A 4X66Q 4QL5A 5EBCA 3AEVA 4B3SQ 4X64Q 1QE6A 3Q22A 1MGSA 1F2YA 3L9AX 3X3NA 2F3IA 1JORA 2E2IH 3G6JB 1I4PA 2RSNA 3H0GB 1E0BA 3M4OB 4H7BA 3TP7A 1GUOA 2RKSA 3CPFA 1U4MA 1VQOA 4ALPA 1VQKA 5BN3A 1B7YB 1EY9A 2JEBI 4DAPA 4JYAL 1I3QB 2DY7A 2KHJA 2Z9HA 4KJOA 5CV6A 1DZ1A 3M9BA 2P5ZX 3SE0A 2MGSA 3ULPA 1ESFA 5FK9C 3TN2A 2FFKB 1X3GA 1EY6A 1OXVA 1V9PA 1XX8A 2F0GA 4DU9A 1EY0A 4IQZA 1TS5A 2LS01 3STBD 3DXJC 1WYDA 3JAML 4R1JA 1Q8KA 3K5NA 3EBEA 4A3EG 4A3JH 3B6YA 5GQOA 1BCPB 1H9SB 4IOCA 1SYBA 5IYDH 4DAVA 1I4XA 3MZ5A 1A3VA 5C4ZA 4C3HG 1IBKL 1A0IA 1Q46A 4OWTB 3OTOQ 3FPUB 4I65A 2I5MX 1PYWD 3K58A 3U9SA 2F4VQ 1SMYD 1EU4A 4P74A 2RHQB 5C0XH 1IYUA 4R4OA 4YWLA 5I9PA 2AUKA 3CRKC 4ILWA 1O7LA 3S1NB 1Q7YC 1KXLA 1GXDC 3ER0A 3P20A 4OIJA 1DOKA 3S16H 5IYCG 1YNJD 2QDLA 4ZCKA 1ICFB 1SYDA 1BO0A 4RG1A 2CWAA 5C4XG 3J81i 4B9WA 1QVCA 1WD1A 1GOZA 1U4RA 1GHKA 1V1PB 2JA6B 2I07B 1SNCA 4DV7L 3BVZA 3HOYB 4UAIA 4DN4M 3U58A 2PMZB 4C3JG 5K36G 2JA5G 3CCSA 2ZJRA 2R7FA 4OEMB 1L1OA 4PZ7A 3GTJH 3Q6SA 4ZUIA 1YEZA 4DFAA 5IP7G 4FXGC 4O0AA 4GOPB 1BBXC 1ML0D 4YWMA 3D6CA 2RVLA 3C46A 1AZPA 1XNQL 4LUOA 1TWAB 5CORA 1JQYD 1XXGA 2X6LA 2B2VA 4R8NA 1E7ZA 2E2JB 1K8MA 4N9PA 5I2XA 3CW2C 4YCUA 2F0EA 3E5SA 4JBJA 1DD2A 2V1CC 4CDEC 4DR4L 4UP9A 4DR6Q 4NDXA 2L15A 4GLVB 2FHTA 3T1YQ 3A0JA 2JA8H 5CBAE 3GTOB 1J9OA 1GUGA 5CGKA 3H3VI 3GTQH 4HCSA 1NE3A 2NZ1D 2ICIA 2CW0D 2Q8IB 1IL8A 4HJ5A 4PNYA 1EIHA 3CC7A 2Z6KC 1K28A 3S1QB 2IX1A 4CKCA 2LSSA 4B3RL 4PMBA 3I72A 1HH2P 3TP8A 2CCZA 2NVTB 2I0QA 2JA7H 1FGUA 4LF7Q 2AQ1B 1XNRL 1SRUA 5C0XJ 4KTAA 4DR2L 2E76C 2WKDA 3FKIB 4JOIA 3S2HB 1UE7A 3KFUA 1PDQA 4JI0L 1YJNA 1K9MC 2UXDQ 1Q1BA 3SVMA 5K5PA 1Y69U 1TWFB 4DK6C 4KMUC 2NVYB 2LXKA 1YJ9A 1YNNC 2NZOA 4LUZA 3VR4A 4CJ0B 1PFNA 5CBEE 3U9OA 4K6DA 2JQOA 1EY4A 1G6PA 2IY5B 4IN3A 4PG3A 2K5HA 4DNTB 4L63B 4WORA 4BXXG 1L0XB 1VQCA 4OO1I 2XNAC 1ILQA 1LLRD 3TRZA 2MJ8A 4JI4L 1B53A 1KLUD 4FF1A 3J81j 5ELFA 4KHVA 2B2TA 3HS0C 1LTGD 3GTPH 3NE5B 1OXTA 2MQHA 4R4TA 3HOXG 5CYUA 2HHHL 5BN5A 2RDFA 1XTCD 2PNRC 1IYVA 4A3BG 1Y8PB 4LF5Q 3VR6A 4HIMA 4DV4L 4GS3A 4NXML 4YCWA 3QOLA 4C2MH 3A5ZB 4QF4A 1NMGA 5HY6A 2F52A 3WDNA 4WJ3M 2PZTA 1SE8A 3MEHA 3TREA 1LTLA 3QB3A 2CHBD 4MNOA 1PH2A 3CRLC 3HOXB 4N9TA 3GTKB 3J80i 2JEAI 3PO3G 4J8QA 3CPWA 4A3BB 2PQEA 1HZBA 3SK4A 3KF8A 2L4NA 1SJHD 2A6HD 1EEID 2L5TA 3UDXA 1EWCA 2OF1A 1SAPA 1WTHA 1MD2D 3K7AB 1FR3A 5CV8A 3SEBA 2VB2X 5M5XB 2B29A 4KI0A 4G4KA 2JN4A 2A6EC 4X65Q 3OW7A 2N49A 1WCMH 2KJXA 1HHVA 3CQZH 1KDBA 2XWJB 1N34Q 5GAGC 1XYIA 5C3EG 3SHLA 1DOLA 4KHPQ 1Z9FA 3MHBA 1ENCA 1R9TB 1QVGA 3HFZB 2O2LD 4ZYSA 3MC0B 1UE6A 3D4WA 1NMFA 3A7AB 3K5MA 2RCNA 5IGFA 1SNPA 2J7ZA 3KOJA 1EYDA 2XRQD 2PW5A 3F2UA 5C3EB 2OQ0A 2FJ2A 5JVG3 4H44C 2YU9H 3PUZA 3DWQA 2B2YA 2XSCA 3QO2A 2PI2E 2L9HA 2DGYA 1PVOA 1I5FA 1AW7A 3H3VH 2B8GA 3P1HA 3I90A 2EJFC 1EY8A 1TWGB 3K5LA 4J6HA 3OHXC 4A76A 1O7YA 1BBUA 4DV0Q 4DUZQ 5IY0A 1RF2D 1VQNA 2EYFA 2A1AA 3IFTA 3BDCA 5JJIA 2G5DA 4XTCS 2B2WA 2A69D 4BA1I 1LYLA 2EQSA 5FLXE 4M8AA 1EIGA 2MUYA 3I2ZA 4R9WA 2B8FA 2R61A 4JW0A 2B63G 3M7NA 4YY3Q 3UI2A 5GROA 4RA8A 3S17H 3MFYA 4X6AH 4CGYB 3BYTB 3KLSX 3M3YH 4K8IA 2PO4A 1TS2A 4UPAA 2BE5C 1CKMA 2EJMA 3E9HA 5C44G 4GN4B 5KYLA 2NB0A 1WJJA 4HR7B 2WFWA 2B63B 5G3LD 5M3MG 4X66L 5LHY1 1MKHA 4C56C 4JI8L 2QA4A 4B3SL 4OWWB 1R4PB 5CR3A 4HIDA 4KN4C 4G7HC 2RDGA 4X64L 1J5EL 4A3DH 4GKKL 4KKTA 1YHAA 4OO1H 1SYCA 5LMNQ 1SR3A 1I4QA 4B3TL 1KLGD 1D5XC 2NWGA 4E6IA 2EDGA 5F2DA 2SNSA 1UE1A 4XT3B 4P2CB 5T1GA 3OW2A 4IJLA 2KBNA 4BWGB 3L2PA 1TWCH 4BBRH 4A3CH 3W3AA 4I7ZC 5EKLA 4GLXA 3N52A 2PMZE 2Z6BA 4LK1C 4ZQ3A 5KGUA 2IPKD 1QZHA 4GLAC 3RZOH 2EY6A 1CFMA 3OWFA 1VQBA 3MXNA 1RIPA 1N8RC 1MSHA 1VQDA 4RWSC 1QZGA 3DHQA 4HN7A 5KEEA 2HIVA 1STEA 4ZUJA 1B8AA 2K50A 4LF9Q 1SNQA 1N36Q 1VDZA 2RBMA 4DR7Q 4DR5Q 3STBC 2E2HH 2H5XA 2ZXPA 3HOUG 4A93H 1UAPA 2HDMA 4KV6A 3EQLC 3RZDH 1FD7D 1GHJA 2G9DA 4ZLTF 3MWYW 3HOWH 3S14H 3MXUA 4HSPA 5IWAQ 2LXJA 3I91A 3C1EA 1AN8A 3I55A 3OTOL 4A3KH 2VW9A 1PRTB 4DNRB 1GUSA 3HOUB 1OXSC 4HMJA 2F4VL 4TVAB 4L8JA 1FNVA 3PO2G 4O42A 3UE0A 1SDFA 1SMYC 2IT1A 1PTOB 3I8ZA 1X9NA 2L0CA 4Y7NB 3AFQA 3LX0A 1EQVA 4EQ5A 1TU2B 3A8IE 3R93A 1YNJC 1NTGA 3I4LA 1Q12A 5KIXA 1RHPA 2ZXRA 3CCLA 3Q24A 1CKNA 4C3IH 5JJZA 3K0YA 1CM9A 4O1NA 2KA7A 3H94A 2K01A 3OPOA 5IGGA 3EN2A 3M4YA 1PH6A 4FF2A 3J81E 2ZJPA 3PCOB 2EYJA 1RCVD 5JEAG 2JE6I 2PW7A 1BOSA 1WTOA 2EXDA 3H15A 1CSQA 2F0UA 1PTOD 2K52A 1ASZA 1GJXA 1EUJA 1QG7A 1JOQA 5EKIA 4K8JA 3GTMB 3MVVA 4AQYQ 4KKUA 2ZTDA 3DLLA 5M3FG 1E1TA 2DUDA 2VL6A 1G6ZA 4X62L 1AEXA 4FDBA 4XYOA 3KDFA 3TS0A 3A74A 4DR6L 3U4VA 4NB3A 1G51A 1SNMA 1STHA 2CH4W 3CCRA 3ZJYC 3T1YL 3LNNA 1ENAA 2BDNA 5IGBA 2RQXA 5M3FB 2ENBA 4IPHA 2AUJD 2CH4A 5AFWA 4CHTB 2UUAQ 4DPGA 2FXQA 3VDYA 4R4QA 5LMUQ 2QCPX 3MXNB 4A3EH 1JWMD 2CW0C 4A3IG 4PV1C 5I2YA 1EYGA 3H0GG 4FXKC 1CQVA 5ELBA 4KKSA 5KYIA 2EOTA 4C3HH 5KNCA 1D5MC 1PH4A 4FVMA 2VZAA 1EWIA 3HP3A 1LACA 2NTSA 4A3MG 2CKZB 5KNDA 4LF7L 2MP1A 1I4RA 1HR0Q 3BZCA 1I4HA 4QIWE 4A3IB 1JJGA 1BKBA 2GVBA 3FMCA 3AYHB 2D2CC 3U50C 3E3XA 4LF8Q 3KUPA 2UXDL 3I56A 2HT1A 5IYCH 5E4WC 4NXNQ 1B9NA 1E2WA 1WTRA 4A3MB 1TS3A 2NVQH 3PV0A 3JAMc 5C4XH 1CQFA 1H95A 2Z0SA 4U68A 1VQJA 1ZEQX 5IGCA 1U0LA 2KQ3A 4LF4Q 1LT6D 1LTSD 4IJHA 4C3JH 5C4JB 5ELEA 5K36H 2SDFA 2JA5H 3S1MH 1JOOA 4OGQC 2E2JH 4RFBA 1RD9D 4JI7Q 3TMEA 5IP7H 2KCMA 2EYHA 3S15H 2WP8J 2MO0A 3DM1A 4HCEA 5FO7B 4LFAQ 1HTLD 1SFOH 1EY5A 2PZUA 4JI2Q 3V2TA 1UEBA 4XIGS 2Q2TA 2A73B 2Y0SG 1TR5A 3PQIA 5EPLA 2K03A 4LF5L 1IBLQ 1FGBD 3GTOH 1X55A 1AE3A 1BDOA 1FVIA 1GUNA 4K0KQ 3T51B 4K5XA 2WB1B 5CV4A 1QNUA 2XVSA 1K0RA 1S72A 3C2PA 1FJGQ 2G9HD 5EJWA 3RLNA 2Y0SB 2JA6G 3I4NG 4L5SA 1B3AA 2VXWA 3HOYG 2O5IC 1HQMC 2UU9Q 2B39A 1B2TA 1IW7D 3M85A 3A54A 1HTPA 4RAUC 2OWOA 5CMDA 2X69A 4ID6A 2IX3A 2A6HC 5AJ3Q 1NAPA 1W3SA 2L1BA 4KK7A 1TWHB 3J80E 3VR2A 3I4NB 1HUMA 4X65L 5CV9A 5FOBB 3FP9A 3SR1A 2LKVA 1F9QA 1I4GA 3FHWA 1MSGA 1JJCB 4JCVE 3S2HH 5EKKA 3GD7A 4A3LH 1ILPA 5DM63 2L12A 1CTMA 1N34L 2R7ZB 4I7AA 3GTGB 1I6VC 2K1BA 2SEBD 4KHPL 1L1OC 5DEHA 5KNBA 2NVYH 5A2QL 2EY1A 5DAUA 4ME5A 1AP0A 4DKAC 1TVXA 1WTWA 1HNXQ 4IO9A 2H1EA 2E2IB 3NBHA 5H1SE 5HGTA 3GQBA 1CA6A 5KRUA 5COYA 3J7AF 4TQUS 2VY3A 1NR4A 4IUUA 3D8GA 3Q0AA 1SYFA 2B2VC 1ZYRD 1LO5D 1UE5A 4H13C 1TXYA 3SGIA 2R92G 4ULLA 3OYYA 4HJ9A 1XPRA 1VQ8A 3FEWX 2B2UA 1Y1VG 1KIXA 1D8LA 2D62A 4KY7A
chains in the Genus database with same CATH topology
4B3MQ 2N49A 4PZ8A 1WCMH 3TQYA 3HOYH 2K5NA 3WWVA 4DV0L 5IYDG 4HJAA 2HHHQ 3CQZH 4DUZL 1N34Q 4BXXH 5GAGC 2N8NA 5C3EG 1OXUA 2AHOB 3LGJA 1GD7A 5BR8Q 3ULLA 1N9WA 1LUZA 1EFWA 4LF6L 4JI8Q 3I4MG 1Z9FA 3EIVA 3F1ZA 1VQMA 4IFDG 4KHPQ 3J80c 1QVGA 2BA1A 1J5EQ 3HFZB 4NXMQ 4GKKQ 3BZKA 3K80C 1UE6A 1K83H 1YITA 3AQQA 1S40A 1X6OA 1NMFA 4P73A 2RCNA 4B3TQ 3FKIG 3CMEA 1GKHA 3CXCA 3KOJA 1T9HA 3HOXH 3GTKH 1VQ5A 3PSIA 2VQEL 3S1RH 3T1HQ 1GVPA 2N78A 1IYJB 2OQKA 1TWAH 3G4SA 4DV1Q 3K7UC 1D7QA 2OQ0A 1VQGA 2RF4A 4YY3L 4DV5Q 4JV5L 1GM5A 1YJWA 2OTJA 2YU9H 3PUZA 1PYSB 1EQRA 4A3DG 2PI2E 4PZ6A 1KRSA 3K7AH 2DGYA 1PVOA 1I5FA 1HNWQ 2CWPA 4OX9Q 2QGQA 2WB1G 4OO1G 3H3VH 2JK8A 4JI6Q 4JOIC 1EIYB 2R93H 3MEFA 2MNAA 2VQFL 4A3IH 2E5LQ 1CKNB 5FLMH 1O7IA 4IFDI 1VQAA 1YI2A 3PO3H 1M90C 3D0FA 4AH6A 4DR1L 1PH9A 2UXCL 3BU2A 5ELNA 4A76A 2YTVA 4DV3L 4DV0Q 1BBUA 2Q2IA 4GN3B 1FL0A 4DV6L 4DUZQ 4QY7A 1X65A 5IY0A 1LM0A 2R92H 1UWVA 4BBRG 4LF6Q 4A3CG 4HIOA 1VQNA 2VUMG 1CKOA 2A1AA 1DGSA 4MZ9A 5C0XI 1VQFA 5LMNL 2XGTA 1YHBA 3UDIA 5JJIA 1Y1VH 1BVSA 4XTCS 4BA1I 2K4KA 1LYLA 4GNXB 1XMQL 2EQSA 5IYBG 4A3FG 3I2ZA 3S1QH 2VQEQ 3RNUA 3F2BA 2JJQA 1K3RA 1M1KC 1HNZL 2B63G 3I4MH 2HQLA 2R7ZG 4L5RC 1JB7A 4LFCL 3CMAA 4YY3Q 3M7NA 5GROA 2NZHA 1XPUA 3S17H 4JV5Q 2AMCB 3RN2A 1EQQA 1I6HH 3KYHC 1YHQA 4X6AH 2ALYB 2NVTH 3L7ZC 3S24A 1N32L 5IT9c 3GTLH 3K81C 1X56A 2C35B 2CFMA 1PA6A 3M3YH 2D0OA 1CSPA 1MJCA 3KDFB 1HZCA 4UPAA 4A93G 3PF5A 1CKMA 4UY8C 4H02A 2WAQG 1PHJA 3FKIH 2VQFQ 4BY1G 3E9HA 5C44G 4GN4B 4DUYL 1NY4A 1WJJA 3TEHB 1I50H 4DR1Q 4DV2L 3G48A 1KAWA 1VQPA 1IBML 2WFWA 2BH2A 3G6EA 4QQBX 2BH8A 5M3MG 2UUBL 3CC4A 1YZ6A 4X66L 4DV3Q 1MKHA 2ZJQA 4DV6Q 2QA4A 4JI8L 4B3SL 2ES2A 4LF9L 4OWWB 4HIDA 1TWFH 1L1OB 3D31A 5JEAJ 2KCTA 4DK3C 4X64L 1Q86C 1PH7A 1N36L 3CCUA 1J5EL 3S2DH 4A3DH 4GKKL 4A3KG 1G291 1CUKA 1YHAA 3I7FA 4DR5L 4DR7L 1JT8A 1JMCA 4RMFA 5GAEC 5LMNQ 1SR3A 1KC8C 1U5KA 4B3TL 1A8VA 1NBWA 4R4CA 1XMQQ 1QUQB 2RHSB 1UE1A 5M5YH 1E3PA 1Q1EA 1HZ9A 3PUWA 2I5HA 5IWAL 3OW2A 4IJLA 2KBNA 3F2CA 3L0OA 3L2PA 1HNZQ 1TWCH 4JI3L 1PH8A 4BBRH 4A3CH 4GLXA 1KHIA 4LFCQ 4P72A 2VUMH 2PMZE 3W5OA 2B3GA 1QZHA 4GLAC 2K14A 2YV5A 4AIMA 3RZOH 1N32Q 3E9IA 5FLXc 4GOPC 4R4IA 4BY7G 1VQBA 4NPSA 1IXRA 1TWHH 1RIPA 3AFPA 3CAMA 4DR3L 3KJOA 1VQDA 1E24A 3CCQA 1N8RC 5IYBH 2OTLA 4IPCA 5IE8A 4A3JG 3HKZE 3F2DA 1QZGA 2HIVA 3PIOA 4AYBE 1PH3A 1X3EA 4DUYQ 3UE1A 3CD6A 1HR0W 2UUCL 4POFA 5M5WH 4DV2Q 1IBMQ 4X65Q 2MO1A 1XMOL 1VQLA 2R7ZH 2UUBQ 2IX0A 1B8AA 2K50A 4X66Q 2OCEA 4QL5A 4HIKA 1A63A 3AEVA 4LF9Q 4B3SQ 1OTCA 1YBYA 1QVFA 4X64Q 1N36Q 3HOZG 4DR7Q 4X62Q 3STBC 4HJ8A 4DR5Q 4L5TA 2H5XA 1KIXA 2E2HH 1KL9A 3HOUG 4A93H 1L2FA 2F3IA 4OWXB 3GO5A 3RZDH 1YNXA 2E2IH 3TS2A 5C44H 5C0XG 3PF4A 3HOWH 1V43A 3S14H 2PQAA 5M3MH 3G71A 5GAHC 3CCVA 1AE2A 2PNHA 4A3BH 2ASBA 5JJLA 4OONA 5IWAQ 1PH5A 2LXJA 4L5QA 3UDFA 3HOVH 4JBKA 3I55A 3CPFA 4JI3Q 3OTOL 1VQOA 4A3KH 4ALPA 2VW9A 1VQKA 4BBSG 1B7YB 2JEBI 4JYAL 1OXSC 2BA0A 2F4VL 1YJ9A 4TVAB 4DAMA 2KHJA 5M5XH 3PO2G 4DR3Q 3UE0A 3M9BA 3ULPA 4A3LG 2Z6KA 2IT1A 4JI5L 4AQYL 2UUCQ 1X9NA 1N33L 1X3GA 1XMOQ 1OXVA 1V9PA 1XPOA 1AH9A 3M4QA 3AFQA 3STBD 4EQ5A 1R9TH 1PYBA 1WYDA 1NTGA 2N3SA 1GO3E 1Q12A 4R1JA 4BY7H 1Q8KA 3PUVA 2XTIA 3EBEA 4A3EG 4A3JH 1BBWA 3B6YA 3DM3A 3CCLA 4GKJL 1KD1C 5GQOA 1CKNA 4C3IH 4JG2A 4YHHL 4IOCA 2EIFA 5IYDH 4DNIA 2VS1A 5C3EH 3EN2A 3CP0A 4A75A 1PH6A 1KQSA 1VQ9A 3E0EA 4P71A 2UUAL 4MTNA 2ZJPA 1IBKL 3PCOB 1A0IA 3HOZH 1Q46A 4OWTB 3OTOQ 4WJ4A 2NVXH 1C7YA 5JEAG 2GVAA 2I5MX 2JE6I 2Q2UA 5LMUL 3HOUH 4JYAQ 2EXDA 5GADC 4YCVA 3H15A 2F4VQ 2UXBL 1CSQA 1VQ4A 4GNXA 2K52A 4JC0A 4P74A 2RHQB 1ASZA 2ID0A 1ASYA 4R4OA 4YWLA 1EUJA 1VQEA 1TWGH 1WCMG 3KF6A 3NENA 4GN5A 1V1QA 1Q81C 1I94L 1Q7YC 3PIPA 1KXLA 3ER0A 4JI5Q 4AQYQ 2Y0SE 2JA8G 1N33Q 3S16H 5IYCG 2ZTDA 4IPDA 3DLLA 5M3FG 1E1TA 2NN6I 2DUDA 4BBSH 3K0XA 2VL6A 4X62L 3RLOA 4RG1A 2CWAA 5C4XG 1EIFA 4FDBA 1HR0L 3J81i 2YTXA 3HKZG 1K8AC 4JBMA 1WFQA 1QVCA 3KDFA 3TS0A 4AYBG 3A74A 3PO2H 4DR6L 3NBHB 5DLQE 3U4VA 1YVCA 4NB3A 4GKJQ 1G51A 4DV7L 4LF8L 4YHHQ 3NEMA 3CCRA 2A19A 2HIXA 3ZJYC 3T1YL 3U58A 5K36G 3KF8B 4NXNL 3ICEA 2JA5G 3CCSA 2ZJRA 2R7FA 4IPHA 1L1OA 4PZ7A 3GTJH 4PMWA 2UUAQ 3KJPA 1MJEA 1IBKQ 4HJ7A 3GTGH 1YEZA 4DPGA 2FXQA 2JA7G 3VDYA 4UP7A 4R4QA 5IP7G 4LFBL 5LMUQ 4O0AA 5FJ8G 3MXNB 4GOPB 4A3EH 4LF4L 4YWMA 2UXBQ 5ELOA 4A3IG 1Y1WG 4A3FH 1X3FA 1OXXK 5FLMG 1EYGA 3H0GG 3JAMi 1XNQL 4LUOA 3J81c 1I94Q 4BA2I 2B63H 3J7A5 3A5UA 4C3HH 1YIJA 1E7ZA 4LUVA 2E8GA 1PH4A 2VZAA 3K8AA 2K75A 2D0PA 1EWIA 5E7NA 4O2DA 3CW2C 1VCIA 4YCUA 4A3MG 2CKZB 4LF7L 1HJPA 2KENA 4JBJA 4KLKA 1E1OA 2V1CC 3BZCA 1HR0Q 4QIWE 4JI2L 3JC66 3KLWA 1JJGA 1BKBA 2GVBA 4DR4L 4UP9A 3AYHB 2AKWB 3U4ZA 1Q82C 3U50C 4BY1H 4DR6Q 4OXPA 1EOVA 2KHIA 4DV7Q 2L15A 4LF8Q 4GLVB 2UXDL 2PQAB 3I56A 2ZM6L 3T1YQ 2VNUD 5JJKA 3A0JA 1IBLL 2HT1A 2JA8H 1J6QA 5IYCH 4LWCA 4NXNQ 1X54A 1B70B 5M3FH 2K5VA 3GDEA 3H3VI 5J3BA 4K0KL 4DV4Q 2NVQH 3GTQH 3PV0A 3JAMc 5C4XH 1JE5A 1P16A 1NE3A 1H95A 2Z0SA 1VQHA 1SN8A 1C9OA 4YWKA 1VQJA 4LFBQ 1FJGL 1U0LA 5HGQA 4LF4Q 4HJ5A 4APVA 3CC7A 2Z6KC 2ZTEA 3PGZA 4IFDJ 1P8LA 1Z47A 4IJHA 4QJFA 4C3JH 2UU9L 1XNQQ 2IX1A 2LSSA 3J7ZC 2JA5H 4B3RL 3F8TA 1PH1A 4IOAA 2PI2A 3S1MH 1HH2P 2E2JH 2CCZA 1MIUA 2JA9A 4A3GG 2I0QA 4JI7Q 5AJ3L 2R6GA 2JA7H 2YTYA 1RL2A 2I5LX 1FGUA 5IP9G 1KRTA 2KCMA 5IP7H 4LF7Q 3S15H 2WP8J 2MO0A 4LFAQ 5FJ8H 1SFOH 1XNRL 1SRUA 5C0XJ 4DR2L 2NN6G 2GN5A 4ME3A 4JI2Q 4A4IA 1Y1WH 4JOIA 1UEBA 3CC2A 4DR4Q 4XIGS 1XJVA 2Q2TA 1UE7A 3KFUA 1E22A 2AWOA 2Y0SG 3ERSX 3H0GH 2A8VA 4J15A 4JI0L 3M4OH 1YJNA 1K9MC 2ZTCA 2UXDQ 1Q1BA 2ZM6Q 3UDGA 4LF5L 1IBLQ 3BJUA 1PV4A 1WOCA 4DK6C 3GTOH 1SLJA 1X55A 2LXKA 1AE3A 3RLFA 2NZOA 1FVIA 1PFSA 4LUZA 3ULJA 3CCMA 4A3MH 4K0KQ 1HNXL 3PUXA 1I3QH 1WI5A 1K0RA 3HKSA 1VS0A 4UP8A 3CCJA 1S72A 1FJGQ 4GNXC 1IL2A 3RLNA 4LNQA 2JQOA 2WB1E 2JA6G 4L5SA 3I4NG 3W1BA 2UXCQ 1G6PA 1VQ7A 2IY5B 3M4PA 3KF6B 4JI1L 2ATWA 3I4OA 3HOYG 4PG3A 5C4JH 2K5HA 2UU9Q 2CQOA 1K8GA 3IRBA 4BXXG 2IHFA 4B3RQ 3M85A 2YYZA 1VQCA 4OO1I 1XTDA 4Y7NH 3TRZA 2OWOA 3Q8DA 4LW1A 4JI4L 4POGA 3J81j 5AJ3Q 1VQ6A 3RR5A 1W3SA 4DAYB 1L0WA 1SMXA 3NELA 4KHZA 3PUYA 1XNRQ 4DR2Q 4X65L 3FP9A 3GTPH 1NJIC 4B3ML 2MFIA 1JJ2A 3FHWA 3S2HH 1JJCB 1OXTA 2MQHA 4JCVE 3GD7A 4R4TA 4A3LH 3HOXG 2HHHL 3HOWG 5LMNW 1Y14B 1N34L 4JI0Q 2R7DA 1SROA 4EX5A 5BR8L 4A3BG 4LF5Q 4KHPL 1L1OC 4P75A 4HIMA 4A3GH 1HZAA 3HOVG 2NVYH 4DV4L 4GS3A 4NXML 4YCWA 5EAYA 5IP9H 4C2MH 4DKAC 2IHEA 3A5ZB 5HY6A 1NMGA 2F52A 1IZ6A 1HNXQ 4WJ3M 2QEXA 4IO9A 1SE8A 3TREA 1LTLA 2R93G 3W1GA 5H1SE 4MNOA 1PH2A 4TQUS 2VY3A 1QUQA 1A62A 4IPGA 4JBWA 3J80i 2JEAI 3PO3G 4Y52H 3T1HL 2WAQE 1W2BA 2AWNA 3CPWA 2Q2HA 4DV1L 4JI1Q 3S1NH 1HZBA 4DV5L 3RN5A 1VQIA 3GTMH 1UE5A 1TXYA 1C0AA 3SGIA 3UDXA 1S3OA 2R92G 4JI7L 3OYYA 4JI4Q 4HJ9A 3CF5A 1XPRA 1VQ8A 1HNWL 4OX9L 4LFAL 1K73C 4JI6L 4QGUA 2B29A 4GOPA 4KI0A 2E5LL 1Y1VG 2JA6H 3I4NH 3CCEA 1D8LA 2D62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M Q;  2N49 A;  4PZ8 A;  1WCM H;  3TQY A;  3HOY H;  2K5N A;  3WWV A;  4DV0 L;  5IYD G;  4HJA A;  2HHH Q;  3CQZ H;  4DUZ L;  1N34 Q;  4BXX H;  5GAG C;  2N8N A;  5C3E G;  1OXU A;  2AHO B;  3LGJ A;  1GD7 A;  5BR8 Q;  3ULL A;  1N9W A;  1LUZ A;  1EFW A;  4LF6 L;  4JI8 Q;  3I4M G;  1Z9F A;  3EIV A;  3F1Z A;  1VQM A;  4IFD G;  4KHP Q;  3J80 c;  1QVG A;  2BA1 A;  1J5E Q;  3HFZ B;  4NXM Q;  4GKK Q;  3BZK A;  3K80 C;  1UE6 A;  1K83 H;  1YIT A;  3AQQ A;  1S40 A;  1X6O A;  1NMF A;  4P73 A;  2RCN A;  4B3T Q;  3FKI G;  3CME A;  1GKH A;  3CXC A;  3KOJ A;  1T9H A;  3HOX H;  3GTK H;  1VQ5 A;  3PSI A;  2VQE L;  3S1R H;  3T1H Q;  1GVP A;  2N78 A;  1IYJ B;  2OQK A;  1TWA H;  3G4S A;  4DV1 Q;  3K7U C;  1D7Q A;  2OQ0 A;  1VQG A;  2RF4 A;  4YY3 L;  4DV5 Q;  4JV5 L;  1GM5 A;  1YJW A;  2OTJ A;  2YU9 H;  3PUZ A;  1PYS B;  1EQR A;  4A3D G;  2PI2 E;  4PZ6 A;  1KRS A;  3K7A H;  2DGY A;  1PVO A;  1I5F A;  1HNW Q;  2CWP A;  4OX9 Q;  2QGQ A;  2WB1 G;  4OO1 G;  3H3V H;  2JK8 A;  4JI6 Q;  4JOI C;  1EIY B;  2R93 H;  3MEF A;  2MNA A;  2VQF L;  4A3I H;  2E5L Q;  1CKN B;  5FLM H;  1O7I A;  4IFD I;  1VQA A;  1YI2 A;  3PO3 H;  1M90 C;  3D0F A;  4AH6 A;  4DR1 L;  1PH9 A;  2UXC L;  3BU2 A;  5ELN A;  4A76 A;  2YTV A;  4DV3 L;  4DV0 Q;  1BBU A;  2Q2I A;  4GN3 B;  1FL0 A;  4DV6 L;  4DUZ Q;  4QY7 A;  1X65 A;  5IY0 A;  1LM0 A;  2R92 H;  1UWV A;  4BBR G;  4LF6 Q;  4A3C G;  4HIO A;  1VQN A;  2VUM G;  1CKO A;  2A1A A;  1DGS A;  4MZ9 A;  5C0X I;  1VQF A;  5LMN L;  2XGT A;  1YHB A;  3UDI A;  5JJI A;  1Y1V H;  1BVS A;  4XTC S;  4BA1 I;  2K4K A;  1LYL A;  4GNX B;  1XMQ L;  2EQS A;  5IYB G;  4A3F G;  3I2Z A;  3S1Q H;  2VQE Q;  3RNU A;  3F2B A;  2JJQ A;  1K3R A;  1M1K C;  1HNZ L;  2B63 G;  3I4M H;  2HQL A;  2R7Z G;  4L5R C;  1JB7 A;  4LFC L;  3CMA A;  4YY3 Q;  3M7N A;  5GRO A;  2NZH A;  1XPU A;  3S17 H;  4JV5 Q;  2AMC B;  3RN2 A;  1EQQ A;  1I6H H;  3KYH C;  1YHQ A;  4X6A H;  2ALY B;  2NVT H;  3L7Z C;  3S24 A;  1N32 L;  5IT9 c;  3GTL H;  3K81 C;  1X56 A;  2C35 B;  2CFM A;  1PA6 A;  3M3Y H;  2D0O A;  1CSP A;  1MJC A;  3KDF B;  1HZC A;  4UPA A;  4A93 G;  3PF5 A;  1CKM A;  4UY8 C;  4H02 A;  2WAQ G;  1PHJ A;  3FKI H;  2VQF Q;  4BY1 G;  3E9H A;  5C44 G;  4GN4 B;  4DUY L;  1NY4 A;  1WJJ A;  3TEH B;  1I50 H;  4DR1 Q;  4DV2 L;  3G48 A;  1KAW A;  1VQP A;  1IBM L;  2WFW A;  2BH2 A;  3G6E A;  4QQB X;  2BH8 A;  5M3M G;  2UUB L;  3CC4 A;  1YZ6 A;  4X66 L;  4DV3 Q;  1MKH A;  2ZJQ A;  4DV6 Q;  2QA4 A;  4JI8 L;  4B3S L;  2ES2 A;  4LF9 L;  4OWW B;  4HID A;  1TWF H;  1L1O B;  3D31 A;  5JEA J;  2KCT A;  4DK3 C;  4X64 L;  1Q86 C;  1PH7 A;  1N36 L;  3CCU A;  1J5E L;  3S2D H;  4A3D H;  4GKK L;  4A3K G;  1G29 1;  1CUK A;  1YHA A;  3I7F A;  4DR5 L;  4DR7 L;  1JT8 A;  1JMC A;  4RMF A;  5GAE C;  5LMN Q;  1SR3 A;  1KC8 C;  1U5K A;  4B3T L;  1A8V A;  1NBW A;  4R4C A;  1XMQ Q;  1QUQ B;  2RHS B;  1UE1 A;  5M5Y H;  1E3P A;  1Q1E A;  1HZ9 A;  3PUW A;  2I5H A;  5IWA L;  3OW2 A;  4IJL A;  2KBN A;  3F2C A;  3L0O A;  3L2P A;  1HNZ Q;  1TWC H;  4JI3 L;  1PH8 A;  4BBR H;  4A3C H;  4GLX A;  1KHI A;  4LFC Q;  4P72 A;  2VUM H;  2PMZ E;  3W5O A;  2B3G A;  1QZH A;  4GLA C;  2K14 A;  2YV5 A;  4AIM A;  3RZO H;  1N32 Q;  3E9I A;  5FLX c;  4GOP C;  4R4I A;  4BY7 G;  1VQB A;  4NPS A;  1IXR A;  1TWH H;  1RIP A;  3AFP A;  3CAM A;  4DR3 L;  3KJO A;  1VQD A;  1E24 A;  3CCQ A;  1N8R C;  5IYB H;  2OTL A;  4IPC A;  5IE8 A;  4A3J G;  3HKZ E;  3F2D A;  1QZG A;  2HIV A;  3PIO A;  4AYB E;  1PH3 A;  1X3E A;  4DUY Q;  3UE1 A;  3CD6 A;  1HR0 W;  2UUC L;  4POF A;  5M5W H;  4DV2 Q;  1IBM Q;  4X65 Q;  2MO1 A;  1XMO L;  1VQL A;  2R7Z H;  2UUB Q;  2IX0 A;  1B8A A;  2K50 A;  4X66 Q;  2OCE A;  4QL5 A;  4HIK A;  1A63 A;  3AEV A;  4LF9 Q;  4B3S Q;  1OTC A;  1YBY A;  1QVF A;  4X64 Q;  1N36 Q;  3HOZ G;  4DR7 Q;  4X62 Q;  3STB C;  4HJ8 A;  4DR5 Q;  4L5T A;  2H5X A;  1KIX A;  2E2H H;  1KL9 A;  3HOU G;  4A93 H;  1L2F A;  2F3I A;  4OWX B;  3GO5 A;  3RZD H;  1YNX A;  2E2I H;  3TS2 A;  5C44 H;  5C0X G;  3PF4 A;  3HOW H;  1V43 A;  3S14 H;  2PQA A;  5M3M H;  3G71 A;  5GAH C;  3CCV A;  1AE2 A;  2PNH A;  4A3B H;  2ASB A;  5JJL A;  4OON A;  5IWA Q;  1PH5 A;  2LXJ A;  4L5Q A;  3UDF A;  3HOV H;  4JBK A;  3I55 A;  3CPF A;  4JI3 Q;  3OTO L;  1VQO A;  4A3K H;  4ALP A;  2VW9 A;  1VQK A;  4BBS G;  1B7Y B;  2JEB I;  4JYA L;  1OXS C;  2BA0 A;  2F4V L;  1YJ9 A;  4TVA B;  4DAM A;  2KHJ A;  5M5X H;  3PO2 G;  4DR3 Q;  3UE0 A;  3M9B A;  3ULP A;  4A3L G;  2Z6K A;  2IT1 A;  4JI5 L;  4AQY L;  2UUC Q;  1X9N A;  1N33 L;  1X3G A;  1XMO Q;  1OXV A;  1V9P A;  1XPO A;  1AH9 A;  3M4Q A;  3AFQ A;  3STB D;  4EQ5 A;  1R9T H;  1PYB A;  1WYD A;  1NTG A;  2N3S A;  1GO3 E;  1Q12 A;  4R1J A;  4BY7 H;  1Q8K A;  3PUV A;  2XTI A;  3EBE A;  4A3E G;  4A3J H;  1BBW A;  3B6Y A;  3DM3 A;  3CCL A;  4GKJ L;  1KD1 C;  5GQO A;  1CKN A;  4C3I H;  4JG2 A;  4YHH L;  4IOC A;  2EIF A;  5IYD H;  4DNI A;  2VS1 A;  5C3E H;  3EN2 A;  3CP0 A;  4A75 A;  1PH6 A;  1KQS A;  1VQ9 A;  3E0E A;  4P71 A;  2UUA L;  4MTN A;  2ZJP A;  1IBK L;  3PCO B;  1A0I A;  3HOZ H;  1Q46 A;  4OWT B;  3OTO Q;  4WJ4 A;  2NVX H;  1C7Y A;  5JEA G;  2GVA A;  2I5M X;  2JE6 I;  2Q2U A;  5LMU L;  3HOU H;  4JYA Q;  2EXD A;  5GAD C;  4YCV A;  3H15 A;  2F4V Q;  2UXB L;  1CSQ A;  1VQ4 A;  4GNX A;  2K52 A;  4JC0 A;  4P74 A;  2RHQ B;  1ASZ A;  2ID0 A;  1ASY A;  4R4O A;  4YWL A;  1EUJ A;  1VQE A;  1TWG H;  1WCM G;  3KF6 A;  3NEN A;  4GN5 A;  1V1Q A;  1Q81 C;  1I94 L;  1Q7Y C;  3PIP A;  1KXL A;  3ER0 A;  4JI5 Q;  4AQY Q;  2Y0S E;  2JA8 G;  1N33 Q;  3S16 H;  5IYC G;  2ZTD A;  4IPD A;  3DLL A;  5M3F G;  1E1T A;  2NN6 I;  2DUD A;  4BBS H;  3K0X A;  2VL6 A;  4X62 L;  3RLO A;  4RG1 A;  2CWA A;  5C4X G;  1EIF A;  4FDB A;  1HR0 L;  3J81 i;  2YTX A;  3HKZ G;  1K8A C;  4JBM A;  1WFQ A;  1QVC A;  3KDF A;  3TS0 A;  4AYB G;  3A74 A;  3PO2 H;  4DR6 L;  3NBH B;  5DLQ E;  3U4V A;  1YVC A;  4NB3 A;  4GKJ Q;  1G51 A;  4DV7 L;  4LF8 L;  4YHH Q;  3NEM A;  3CCR A;  2A19 A;  2HIX A;  3ZJY C;  3T1Y L;  3U58 A;  5K36 G;  3KF8 B;  4NXN L;  3ICE A;  2JA5 G;  3CCS A;  2ZJR A;  2R7F A;  4IPH A;  1L1O A;  4PZ7 A;  3GTJ H;  4PMW A;  2UUA Q;  3KJP A;  1MJE A;  1IBK Q;  4HJ7 A;  3GTG H;  1YEZ A;  4DPG A;  2FXQ A;  2JA7 G;  3VDY A;  4UP7 A;  4R4Q A;  5IP7 G;  4LFB L;  5LMU Q;  4O0A A;  5FJ8 G;  3MXN B;  4GOP B;  4A3E H;  4LF4 L;  4YWM A;  2UXB Q;  5ELO A;  4A3I G;  1Y1W G;  4A3F H;  1X3F A;  1OXX K;  5FLM G;  1EYG A;  3H0G G;  3JAM i;  1XNQ L;  4LUO A;  3J81 c;  1I94 Q;  4BA2 I;  2B63 H;  3J7A 5;  3A5U A;  4C3H H;  1YIJ A;  1E7Z A;  4LUV A;  2E8G A;  1PH4 A;  2VZA A;  3K8A A;  2K75 A;  2D0P A;  1EWI A;  5E7N A;  4O2D A;  3CW2 C;  1VCI A;  4YCU A;  4A3M G;  2CKZ B;  4LF7 L;  1HJP A;  2KEN A;  4JBJ A;  4KLK A;  1E1O A;  2V1C C;  3BZC A;  1HR0 Q;  4QIW E;  4JI2 L;  3JC6 6;  3KLW A;  1JJG A;  1BKB A;  2GVB A;  4DR4 L;  4UP9 A;  3AYH B;  2AKW B;  3U4Z A;  1Q82 C;  3U50 C;  4BY1 H;  4DR6 Q;  4OXP A;  1EOV A;  2KHI A;  4DV7 Q;  2L15 A;  4LF8 Q;  4GLV B;  2UXD L;  2PQA B;  3I56 A;  2ZM6 L;  3T1Y Q;  2VNU D;  5JJK A;  3A0J A;  1IBL L;  2HT1 A;  2JA8 H;  1J6Q A;  5IYC H;  4LWC A;  4NXN Q;  1X54 A;  1B70 B;  5M3F H;  2K5V A;  3GDE A;  3H3V I;  5J3B A;  4K0K L;  4DV4 Q;  2NVQ H;  3GTQ H;  3PV0 A;  3JAM c;  5C4X H;  1JE5 A;  1P16 A;  1NE3 A;  1H95 A;  2Z0S A;  1VQH A;  1SN8 A;  1C9O A;  4YWK A;  1VQJ A;  4LFB Q;  1FJG L;  1U0L A;  5HGQ A;  4LF4 Q;  4HJ5 A;  4APV A;  3CC7 A;  2Z6K C;  2ZTE A;  3PGZ A;  4IFD J;  1P8L A;  1Z47 A;  4IJH A;  4QJF A;  4C3J H;  2UU9 L;  1XNQ Q;  2IX1 A;  2LSS A;  3J7Z C;  2JA5 H;  4B3R L;  3F8T A;  1PH1 A;  4IOA A;  2PI2 A;  3S1M H;  1HH2 P;  2E2J H;  2CCZ A;  1MIU A;  2JA9 A;  4A3G G;  2I0Q A;  4JI7 Q;  5AJ3 L;  2R6G A;  2JA7 H;  2YTY A;  1RL2 A;  2I5L X;  1FGU A;  5IP9 G;  1KRT A;  2KCM A;  5IP7 H;  4LF7 Q;  3S15 H;  2WP8 J;  2MO0 A;  4LFA Q;  5FJ8 H;  1SFO H;  1XNR L;  1SRU A;  5C0X J;  4DR2 L;  2NN6 G;  2GN5 A;  4ME3 A;  4JI2 Q;  4A4I A;  1Y1W H;  4JOI A;  1UEB A;  3CC2 A;  4DR4 Q;  4XIG S;  1XJV A;  2Q2T A;  1UE7 A;  3KFU A;  1E22 A;  2AWO A;  2Y0S G;  3ERS X;  3H0G H;  2A8V A;  4J15 A;  4JI0 L;  3M4O H;  1YJN A;  1K9M C;  2ZTC A;  2UXD Q;  1Q1B A;  2ZM6 Q;  3UDG A;  4LF5 L;  1IBL Q;  3BJU A;  1PV4 A;  1WOC A;  4DK6 C;  3GTO H;  1SLJ A;  1X55 A;  2LXK A;  1AE3 A;  3RLF A;  2NZO A;  1FVI A;  1PFS A;  4LUZ A;  3ULJ A;  3CCM A;  4A3M H;  4K0K Q;  1HNX L;  3PUX A;  1I3Q H;  1WI5 A;  1K0R A;  3HKS A;  1VS0 A;  4UP8 A;  3CCJ A;  1S72 A;  1FJG Q;  4GNX C;  1IL2 A;  3RLN A;  4LNQ A;  2JQO A;  2WB1 E;  2JA6 G;  4L5S A;  3I4N G;  3W1B A;  2UXC Q;  1G6P A;  1VQ7 A;  2IY5 B;  3M4P A;  3KF6 B;  4JI1 L;  2ATW A;  3I4O A;  3HOY G;  4PG3 A;  5C4J H;  2K5H A;  2UU9 Q;  2CQO A;  1K8G A;  3IRB A;  4BXX G;  2IHF A;  4B3R Q;  3M85 A;  2YYZ A;  1VQC A;  4OO1 I;  1XTD A;  4Y7N H;  3TRZ A;  2OWO A;  3Q8D A;  4LW1 A;  4JI4 L;  4POG A;  3J81 j;  5AJ3 Q;  1VQ6 A;  3RR5 A;  1W3S A;  4DAY B;  1L0W A;  1SMX A;  3NEL A;  4KHZ A;  3PUY A;  1XNR Q;  4DR2 Q;  4X65 L;  3FP9 A;  3GTP H;  1NJI C;  4B3M L;  2MFI A;  1JJ2 A;  3FHW A;  3S2H H;  1JJC B;  1OXT A;  2MQH A;  4JCV E;  3GD7 A;  4R4T A;  4A3L H;  3HOX G;  2HHH L;  3HOW G;  5LMN W;  1Y14 B;  1N34 L;  4JI0 Q;  2R7D A;  1SRO A;  4EX5 A;  5BR8 L;  4A3B G;  4LF5 Q;  4KHP L;  1L1O C;  4P75 A;  4HIM A;  4A3G H;  1HZA A;  3HOV G;  2NVY H;  4DV4 L;  4GS3 A;  4NXM L;  4YCW A;  5EAY A;  5IP9 H;  4C2M H;  4DKA C;  2IHE A;  3A5Z B;  5HY6 A;  1NMG A;  2F52 A;  1IZ6 A;  1HNX Q;  4WJ3 M;  2QEX A;  4IO9 A;  1SE8 A;  3TRE A;  1LTL A;  2R93 G;  3W1G A;  5H1S E;  4MNO A;  1PH2 A;  4TQU S;  2VY3 A;  1QUQ A;  1A62 A;  4IPG A;  4JBW A;  3J80 i;  2JEA I;  3PO3 G;  4Y52 H;  3T1H L;  2WAQ E;  1W2B A;  2AWN A;  3CPW A;  2Q2H A;  4DV1 L;  4JI1 Q;  3S1N H;  1HZB A;  4DV5 L;  3RN5 A;  1VQI A;  3GTM H;  1UE5 A;  1TXY A;  1C0A A;  3SGI A;  3UDX A;  1S3O A;  2R92 G;  4JI7 L;  3OYY A;  4JI4 Q;  4HJ9 A;  3CF5 A;  1XPR A;  1VQ8 A;  1HNW L;  4OX9 L;  4LFA L;  1K73 C;  4JI6 L;  4QGU A;  2B29 A;  4GOP A;  4KI0 A;  2E5L L;  1Y1V G;  2JA6 H;  3I4N H;  3CCE A;  1D8L A;  2D62 A; 
#chains in the Genus database with same CATH topology
 4PZ8 A;  3TQY A;  1TS4 A;  4DV0 L;  5IYD G;  2HDL A;  4HJA A;  2F0K A;  4DUZ L;  4BXX H;  3LGJ A;  1AFP A;  2R92 B;  1LUZ A;  2QIL A;  2F03 A;  2NUC A;  2C9O A;  3BZD B;  3DUZ A;  5G3L F;  1B50 A;  2RCF A;  3BZK A;  1K83 H;  4TRD A;  1X6O A;  4IZ8 A;  1Y1V B;  1PZK D;  5FLX L;  4KY6 A;  3FKI G;  4LAA A;  3CXC A;  1STG A;  2A69 C;  3HOX H;  3GTK H;  1VQ5 A;  3S1R H;  2OQK A;  3K7U C;  2LFN A;  1V8Q A;  5EQ0 A;  3NP8 A;  1LT5 D;  2E2D C;  4YY3 L;  4DV5 Q;  1GM5 A;  1I6H B;  2OTJ A;  2EPB A;  3P75 A;  2DY8 A;  1BR9 A;  1PYS B;  2O5J C;  4UDU C;  1KRS A;  3K7A H;  4RH6 A;  2QGQ A;  2MHV A;  1CT1 D;  4JOI C;  2WV6 D;  3MEF A;  1SYG A;  3E6Z X;  4YIJ A;  2M2L A;  5FLM H;  4IFD I;  3PO3 H;  2EZV A;  1I50 B;  3BU2 A;  3QG1 A;  4LMQ D;  5ELC A;  2F0I A;  4KJN A;  1ET9 A;  2Q2I A;  3S16 B;  2AQ3 B;  2EY5 A;  3M7G A;  3S2D B;  5D3I B;  2KCC A;  2VUM G;  2HCC A;  4MZ9 A;  1VQF A;  5C5M A;  5LMN L;  3UDI A;  1SSO A;  2PYK A;  5D3D A;  3NBI A;  3BVG A;  2TMP A;  2XRS D;  2SNM A;  3K57 A;  3A56 A;  2DJF C;  4DXG A;  2JJQ A;  3KLS A;  1K3R A;  3GTJ B;  2VUM B;  2AMC B;  3KYH C;  1YHQ A;  3NWT A;  5E1F A;  4XDX A;  2B2T C;  1EZ8 A;  1MJC A;  2QDB A;  4LJZ C;  1ZXT A;  2K04 A;  4H02 A;  2WAQ G;  3X3M A;  2K5D A;  2F4I A;  4N8X 1;  1NY4 A;  1JCK B;  4QQB X;  2UXC Q;  1PZJ D;  2C5C A;  1H9K A;  3CC4 A;  2ZJQ A;  4DV6 Q;  4LF9 L;  2OT2 A;  3D31 A;  1L1O B;  3ITP A;  1PH7 A;  2KCT A;  2KEC A;  3LWE A;  3RD4 A;  1N36 L;  2JXM B;  1G29 1;  4DR7 L;  4DR5 L;  2BCO A;  1JMC A;  3A55 A;  3DMU A;  2WAQ B;  1GUW A;  3SDZ A;  2QW7 A;  3V96 A;  4WFN 3;  2FMM A;  3K5O A;  1XMQ Q;  1XWE A;  5M5Y H;  2Z4H A;  1U4L A;  3PUW A;  5IWA L;  1VMP A;  3F2C A;  4G57 A;  1HNZ Q;  4LFC Q;  1KHI A;  4P72 A;  5EBD A;  3W5O A;  2K14 A;  2YV5 A;  1N32 Q;  3E9I A;  4JPB W;  1PRT F;  2GA4 B;  1G2T A;  4AYB B;  4R4I A;  4BY7 G;  4NPS A;  1RTN A;  3CAM A;  4IPC A;  1IKM A;  3F2D A;  3GV3 A;  1PH3 A;  4DUY Q;  1SXT A;  5M5W H;  1IBM Q;  1PTO F;  1UUP A;  5FO9 B;  3QWN A;  4HIK A;  2OCE A;  1F2L A;  3HEJ A;  1HA5 A;  3AB9 A;  1YBY A;  2CVR A;  2OXP A;  1QIL A;  5EPK A;  2JA7 B;  3HOZ G;  3T4A C;  5I4D A;  5A2Q E;  4BY7 B;  4L5T A;  1KAB A;  1HCZ A;  1KL9 A;  5C44 H;  1K0S A;  3SXH A;  5C4H A;  1V43 A;  2PQA A;  5M3M H;  3CCV A;  3ND8 A;  3J81 L;  4DK0 A;  4L5Q A;  3UDF A;  2JP1 A;  3HOV H;  4JI3 Q;  3HOZ B;  5CC4 A;  4K5V A;  2B2Y C;  1PRT C;  5E3F A;  1FNW A;  4BBS G;  2EXZ A;  4FF3 A;  1LT3 D;  3FDT A;  4ABN A;  2BA0 A;  3DWA A;  4DAM A;  4DR3 Q;  1CA5 A;  2IJ0 A;  4XQQ A;  1BXT A;  1PTO C;  3D4D A;  4OL7 A;  4AQY L;  3R2I A;  1D1I A;  1XMO Q;  3C3L A;  1AH9 A;  4NW2 A;  4BBS B;  1PYB A;  2N3S A;  3VYR A;  1GO3 E;  2K5W A;  2B2W C;  3PUV A;  2F0N A;  1BBW A;  3GTP B;  3DM3 A;  3HZX A;  4JG2 A;  4QUC A;  2EIF A;  1TY0 A;  2VS1 A;  1O7Z A;  4IFD H;  4ZAI A;  3CP0 A;  1ONL A;  1VQ9 A;  3CKI B;  3E0E A;  4P71 A;  2UUA L;  2NVX H;  1KAA A;  2GVA A;  4RGO S;  5LMU L;  3HOU H;  1O80 A;  2PCF B;  4G7O C;  3EFX D;  1JR0 D;  5A35 A;  4GNX A;  1K8O A;  1A3U A;  4X3U A;  4XXE A;  2ID0 A;  3OMC A;  5C3W A;  2KEE A;  2LY7 A;  1Q81 C;  3NEN A;  1KDA A;  1SND A;  3KF6 A;  1WCM G;  4ODG A;  3PIP A;  4JI5 Q;  5D65 A;  2Y0S E;  3VA5 A;  1N33 Q;  2QEJ C;  2ZXO A;  4IPD A;  2F0F A;  4K2L A;  2F0O A;  2EYM A;  1K3B C;  3K0X A;  2A74 C;  4DAY A;  1HR0 L;  2YTX A;  3HKZ G;  4JBM A;  1WFQ A;  1PFM A;  1VMC A;  3PO2 H;  5DLQ E;  2WAC A;  3WOE A;  1HA6 A;  4GKJ Q;  3ERQ A;  1WCM B;  3S9W A;  4LF8 L;  4V0B A;  4YHH Q;  1HFG A;  3NEM A;  4NKL A;  4CDD C;  2A19 A;  5JPM C;  2HIX A;  3CQZ B;  3URY A;  4RKB A;  4B08 A;  3KF8 B;  4NXN L;  4R8I A;  1B1Z A;  4NP5 A;  1HXY D;  4PMW A;  2F0J A;  1MJE A;  4HJ7 A;  2J0T D;  2H4O A;  2WIN B;  3HKZ B;  4UP7 A;  1DM0 B;  2PPB C;  3BYY B;  4NMZ A;  5FJ8 G;  4LF4 L;  2E74 C;  1S4Z A;  4ZRZ A;  2UXB Q;  5ELO A;  1Y1W G;  4A3F H;  4FF4 A;  3I70 A;  3JAM i;  1I94 Q;  4N8F A;  3MAQ A;  3J7A 5;  3A5U A;  2F0V A;  1YIJ A;  4LUV A;  2E8G A;  4K5W A;  2K75 A;  2YU9 B;  3QR8 A;  3D6W A;  1HJP A;  2R3Z A;  1E1O A;  4JI2 L;  1Y1W B;  3KLW A;  5TSS A;  3BDL A;  4BY1 H;  2Z8L A;  4OXP A;  4CBV A;  1RTO A;  1W6K A;  2KHI A;  2M9V A;  2PQA B;  1C8C A;  2VNU D;  1IBL L;  1J6Q A;  2E75 C;  3VYT A;  2RA4 A;  3I3C A;  5M3F H;  2WKC A;  2K5V A;  1EU3 A;  4JK1 C;  1S5C D;  3GDE A;  5J3B A;  4K0K L;  4DV4 Q;  1HPC A;  1Y8O B;  5LL6 X;  3V05 A;  1JE5 A;  1P16 A;  1VQH A;  4F87 A;  1C9O A;  4YWK A;  5C3X A;  4LFB Q;  1FJG L;  1EZ6 A;  5HGQ A;  3G7L A;  4APV A;  4C1N K;  2ZTE A;  4CDC C;  4DK1 A;  3Q23 A;  3AMU A;  1P8L A;  3MXP A;  4IFD J;  4QJF A;  4S3S A;  2UU9 L;  1MI2 A;  3A8J E;  3F8T A;  1PH1 A;  4K2K A;  1WD0 A;  2PI2 A;  1DCZ A;  3S17 B;  1H9J A;  1G2S A;  3CU7 A;  4A3G G;  1BQQ T;  1IW7 C;  1NUC A;  5AJ3 L;  2YTY A;  1RL2 A;  5IP9 G;  1KRT A;  3J80 L;  2I46 A;  1R4Q B;  2NN6 G;  4ME3 A;  4A4I A;  2A5H A;  1XJV A;  1E22 A;  3H0G H;  2A8V A;  4J15 A;  3M4O H;  1Q90 A;  2ZTC A;  1F77 A;  2ZM6 Q;  1WOC A;  4A3G B;  4WJW A;  3I73 A;  1O78 A;  3T13 A;  3RLF A;  3CCM A;  2F0S A;  3ULJ A;  4A3M H;  3HRZ C;  2HQE A;  4C1N I;  1HNX L;  2KOL A;  3EA6 A;  3PUX A;  1I3Q H;  1HUN A;  3CCJ A;  1B44 D;  1F9P A;  1VS0 A;  2F0M A;  4UP8 A;  5J22 A;  2HUG A;  3MTS A;  2KUM A;  1VQ7 A;  3KF6 B;  1HFN A;  5C4J H;  3IRB A;  5CV7 A;  2QF7 A;  1TWC B;  2IHF A;  1J8I A;  1SE4 A;  1RJT A;  1ZYR C;  3TZD A;  2IL8 A;  3Q8D A;  4POG A;  3BS1 A;  3RZO B;  3OSO A;  3QJY A;  2DJG C;  1L0W A;  4DAY B;  1SMX A;  4KHZ A;  3PUY A;  1B3Q A;  3TDQ A;  4IUP A;  4QCL A;  1E2V A;  1D6E C;  4Q5V A;  1JJ2 A;  3KBX A;  2OEO A;  2DN8 A;  2RSO A;  1Y14 B;  5E4X A;  5LMN W;  3HOW G;  1SRO A;  3OIP A;  2HCI A;  1PLF A;  2E2H B;  2IHE A;  1VF7 A;  2L55 A;  1ZKO A;  5IT9 L;  4A93 B;  2QEX A;  3RZD B;  1V1P A;  1WTV A;  2R93 G;  1SEB D;  1SE2 A;  2F0T A;  4IPG A;  1A62 A;  3VA7 A;  1WTQ A;  3HOW B;  4Y52 H;  1W2B A;  2WAQ E;  2AWN A;  2Q2H A;  4JI1 Q;  3S1N H;  1D1K A;  4DV5 L;  1EYC A;  4DF7 A;  1VQI A;  3RN5 A;  2D9U A;  3NHH A;  1EOT A;  1M8A A;  1S3O A;  4KD4 A;  2EYO A;  1SYE A;  1QCB D;  2K5Q A;  4QGU A;  1DXM A;  2R93 B;  4GOP A;  2JA6 H;  3I4N H;  3J7A V;  3CCE A;  1JIC A;  4B3M Q;  3HOY H;  5L37 A;  3WWV A;  1GUT A;  1EL0 A;  1EQT A;  1X3Q A;  4MTK A;  2ZT9 C;  1OXU A;  5IOC A;  3VR3 A;  1GD7 A;  5BR8 Q;  3ULL A;  1N9W A;  3GTG H;  3I4M G;  4JI8 Q;  3F1Z A;  2VB3 X;  3EIV A;  4RKL A;  4TKO B;  1L0Y B;  1J5E Q;  4IUN A;  4V19 0;  4XQJ A;  4GKK Q;  1X32 A;  3ND9 A;  3MA2 B;  3E0J A;  1S40 A;  3N6R A;  3KLR A;  4P73 A;  1LTA D;  1SBB B;  4F7X A;  4B3T Q;  4C3I B;  3CME A;  3VR5 A;  1T9H A;  2K05 A;  1Q8I A;  1A6X A;  5J39 A;  3T1H Q;  1IYJ B;  1BUV T;  1TWA H;  3G4S A;  4DV1 Q;  3I4M B;  1DON A;  1D7Q A;  1LTT D;  3MXG A;  2RF4 A;  3OMG A;  3GTL B;  3BDO A;  4PZ6 A;  1HNW Q;  4OX9 Q;  3RUZ A;  2WB1 G;  2JK8 A;  1PZI D;  2J4X A;  1EIY B;  4JI6 Q;  2MNA A;  3GP7 A;  2E5L Q;  1CKN B;  2SOB A;  1O7I A;  5I6W A;  1PH9 A;  2UXC L;  5ELN A;  2N55 A;  4HED A;  2YTV A;  1DOM A;  3FVQ A;  4OEL B;  4GN3 B;  4DV6 L;  4QY7 A;  1X65 A;  1LM0 A;  2R92 H;  4RGN A;  1UWV A;  4LF6 Q;  4HIO A;  1CKO A;  3SK8 A;  5M9O A;  4EGV A;  1DGS A;  2XIW A;  2EJG C;  2XGT A;  4XT1 B;  2A68 D;  1Y1V H;  1BVS A;  4K14 A;  2K4K A;  3TZU A;  1XMQ L;  5IYB G;  3K59 A;  1NSN S;  2WII B;  3S1Q H;  2VQE Q;  3RNU A;  3F2B A;  1M1K C;  1HNZ L;  2HQL A;  2R7Z G;  4LFC L;  1M4V A;  3CMA A;  3OWE B;  4JV5 Q;  1I6H H;  3RN2 A;  1EQQ A;  5IGD A;  5ISR A;  2NVT H;  1N32 L;  1X56 A;  2C35 B;  2NTT A;  1IKL A;  2CFM A;  1PA6 A;  2D0O A;  1CSP A;  3KDF B;  4A3E B;  4UY8 C;  1EYA A;  1PHJ A;  4ZK9 B;  3FKI H;  2VQF Q;  2RDH A;  2KED A;  4DUY L;  2KVM A;  2LMC B;  3TEH B;  1I50 H;  4PQX A;  4DR1 Q;  1KAW A;  1VQP A;  1IBM L;  2BH2 A;  1ET6 A;  2BH8 A;  3NK9 A;  4C3H B;  4DV3 Q;  4BS9 A;  4KN7 C;  2ES2 A;  1LTI D;  5C6A A;  1TWF H;  4DK3 C;  2MPM A;  1S5D D;  2NBF A;  3DWP A;  3CCU A;  3S2D H;  1U9R A;  1SE3 A;  1BF4 A;  1D2B A;  3PMF A;  5T1I A;  4RMF A;  1MHW C;  3QIA A;  1BCP D;  1KC8 C;  1U5K A;  2EYL A;  1A8V A;  2HD3 A;  1SNO A;  2M00 A;  2RHS B;  4X3K A;  1HZ9 A;  2I5H A;  2Z1C A;  3L0O A;  5I9O A;  4QMG A;  4JI3 L;  1PH8 A;  2NVQ B;  5ELD A;  2VUM H;  5C4X B;  4AIM A;  2B2U C;  5FLX c;  4DR3 L;  3AFP A;  4FNF A;  3KJO A;  3CCQ A;  2OTL A;  4A3J G;  1C48 A;  3HKZ E;  1TII D;  3PIO A;  3QOJ A;  1X3E A;  4C3J B;  3UE1 A;  3CD6 A;  1HR0 W;  3OIQ A;  4DV2 Q;  2JA5 B;  1XMO L;  2UUB Q;  2JSO A;  3S1M B;  3RMH A;  1A63 A;  1A2T A;  4K6L A;  4ZKB B;  1OTC A;  1QVF A;  3H09 A;  3L3O C;  3S15 B;  4X62 Q;  4F8M A;  4HJ8 A;  1SFO B;  3T16 A;  4ZKC B;  3NTH A;  2K32 A;  1L2F A;  4OWX B;  4A3J B;  3GO5 A;  4G7Z C;  5IT9 E;  5HUR A;  1YNX A;  3TS2 A;  3LWU A;  5C0X G;  1NR2 A;  3PF4 A;  3PIP 3;  2N88 A;  3G71 A;  2D5D A;  5GAH C;  1AE2 A;  2PNH A;  3T53 B;  2ASB A;  4A3B H;  4OON A;  1PH5 A;  5JJL A;  3NUC A;  4JBK A;  3IKJ A;  4MN3 A;  4DA2 A;  5M5X H;  5JPN C;  5JAV A;  1ICW A;  4IUV A;  1Y8N B;  4MIU A;  2Z6K A;  4A3L G;  4JI5 L;  2UUC Q;  1N33 L;  1T5X D;  1XPO A;  3M4Q A;  3KK7 A;  3BG3 A;  4X3T A;  1R9T H;  1LV9 A;  1CZW A;  4BY7 H;  2XTI A;  1X3P A;  4DGZ A;  1CHP D;  4RGM A;  4GKJ L;  1KD1 C;  4YHH L;  4F88 A;  1EY7 A;  4OHJ A;  4DNI A;  4HTH A;  3GV6 A;  5C3E H;  1CK1 A;  4A75 A;  1KQS A;  5CV5 A;  4MTN A;  1E2Z A;  3HOZ H;  2NYZ D;  4KD3 A;  1C7Y A;  3ERO A;  4JYA Q;  5DM7 3;  5GAD C;  4YCV A;  2F0D A;  1IHZ A;  2UXB L;  1VQ4 A;  4JC0 A;  1ASY A;  4PMC A;  4RGT A;  1VQE A;  1TWG H;  1I94 L;  1STA A;  4GN5 A;  1MBY A;  1V1Q A;  1QB5 D;  1S5B D;  4CDF C;  4EQN A;  1WVL A;  4DXF A;  2JA8 G;  2NN6 I;  3R8B A;  4BBS H;  2F0P A;  1TT2 A;  3RLO A;  3FPP A;  1TY2 A;  1EIF A;  1K8A C;  4AYB G;  3JAM E;  3NBH B;  3ZYY X;  1YVC A;  2EE1 A;  1DYQ A;  3IFD A;  2JA8 B;  2EVB A;  3ICE A;  1FNU A;  3GTQ B;  3TBI B;  3KJP A;  1IBK Q;  2JA7 G;  1K83 B;  1AZQ A;  3NXW A;  4LFB L;  3D3R A;  5IOD A;  2FIN B;  4CKE A;  1WTX A;  5IGE A;  3NQI A;  1X3F A;  2ICE C;  1OXX K;  5FLM G;  4QUF A;  3S1R B;  3R2T A;  4H0L C;  3J81 c;  4HAE A;  2B63 H;  5C5L A;  3IL8 A;  2F0L A;  3K8A A;  2D0P A;  5E7N A;  4QIW B;  4O2D A;  1D5Z C;  1VCI A;  2DNE A;  1C4Q A;  1ROD A;  2KEN A;  4FXD A;  3H3V C;  1NCV A;  2F1M A;  4KLK A;  3JC6 6;  3MFG A;  4RHR A;  3NWS A;  4IUT A;  2AKW B;  3U4Z A;  1Q82 C;  1EOV A;  3PO3 B;  4CJ2 C;  1S5F D;  4DV7 Q;  2Q8R E;  2ZM6 L;  1QWY A;  5JJK A;  3BVM A;  4LWC A;  1X54 A;  2FMC A;  3K6O A;  1B70 B;  1JWS D;  3T56 B;  1STN A;  1STB A;  5IIF A;  1LT4 D;  1SN8 A;  4IUR A;  4EVO A;  3A7L A;  4KY5 A;  3PGZ A;  5J1Z A;  1Z47 A;  4UHV A;  1XNQ Q;  3J7Z C;  1LAB A;  4IOA A;  1JE4 A;  3NQT A;  3D4R A;  1MIU A;  2JA9 A;  1Q3L A;  1DJR D;  2R6G A;  4MHE A;  1W6J A;  2I5L X;  4EQO A;  2F0Q A;  5FJ8 H;  1G91 A;  5JVH 3;  2GN5 A;  1Y1W H;  1BNZ A;  3CC2 A;  4DR4 Q;  2F3W A;  1G8Z D;  2AWO A;  1QOH A;  4IUQ A;  3ERS X;  3TP6 A;  5JOB A;  1KNA A;  3UDG A;  3NSW A;  3BJU A;  1PV4 A;  1SLJ A;  1NNX A;  4CJ1 B;  4WJ4 A;  1PFS A;  4C2M B;  2EY2 A;  2JYO A;  5DNF A;  1WI5 A;  4FYD A;  3HKS A;  1TQO A;  4GNX C;  1EEF D;  1VF5 C;  1IL2 A;  4LNQ A;  2WB1 E;  2QKI C;  2V4D A;  4Z9C B;  5M5Y B;  3W1B A;  3M4P A;  3CHB D;  4JI1 L;  2ATW A;  3I4O A;  1EFI D;  1PTO H;  2CQO A;  1K8G A;  4B3R Q;  2YYZ A;  1XTD A;  1S5E D;  4XYQ A;  4Y7N H;  4LW1 A;  1A3T A;  1VQ6 A;  3RR5 A;  1PFB A;  3NEL A;  3OOC A;  2K7V A;  4RCO A;  2IWH A;  1XNR Q;  4DR2 Q;  5BN4 A;  1NJI C;  4B3M L;  2MFI A;  3H6M A;  1F9S A;  3AU7 A;  5M5W B;  4IAL A;  1KTK A;  4JI0 Q;  2R7D A;  1JWU D;  4EX5 A;  5BR8 L;  4CKB A;  1YNN D;  4P75 A;  1UNS A;  4A3G H;  1HZA A;  3HOV G;  2BDO A;  5EAY A;  5IP9 H;  1UEA B;  4B9X A;  1ESR A;  5FO8 B;  1IZ6 A;  1JB3 A;  2DNC A;  2NN6 H;  1OO9 B;  3EJI A;  1ENF A;  3W1G A;  5C44 B;  1QUQ A;  4JBW A;  2KHS A;  3T1H L;  5M3M B;  4DV1 L;  3IAY A;  3NPP A;  3GTM H;  3EVQ A;  3HOV B;  2F3V A;  2KCN A;  1C0A A;  3SK6 A;  4JI7 L;  4JI4 Q;  2F0W A;  5JEA H;  3CF5 A;  1HNW L;  4OX9 L;  4LFA L;  1K73 C;  4JI6 L;  3TP5 A;  3HGB A;  3A8K E;  2E5L L;  1F2Z A;  3VYS A;  2Q8T A;  1H9R A;  2K5N A;  2CQA A;  2AQ2 B;  2HHH Q;  5LL6 S;  4XQN A;  1CI3 M;  2Q2U A;  2N8N A;  2AHO B;  4BA2 I;  4IFD G;  1EFW A;  2XWB B;  3VYU A;  4LF6 L;  1VQM A;  3J80 c;  2BA1 A;  1KNE A;  4NXM Q;  2EYP A;  2PZW A;  3K80 C;  1YIT A;  3TSS A;  3AQQ A;  1RDP D;  2K28 A;  1GKH A;  2A68 C;  1HRJ A;  1BCP F;  3PSI A;  2VQE L;  4FP5 D;  1GVP A;  2N78 A;  4EQP A;  5NUC A;  4JVZ A;  1VQG A;  4JV5 L;  1F2M A;  3SK5 A;  1YJW A;  5EGT A;  3DEP A;  2NVX B;  1EQR A;  4A3D G;  3M3Y B;  1Z7T A;  2CWP A;  4OO1 G;  2A6E D;  1EWH A;  2R93 H;  2VQF L;  4A3I H;  3C1F A;  1VQA A;  1YI2 A;  1M90 C;  3D0F A;  4AH6 A;  4DR1 L;  3HG9 A;  1A15 A;  4HMI A;  4DV3 L;  2Z4I A;  3O13 A;  1FL0 A;  4QB4 A;  3W2D A;  1FYC A;  2IW3 A;  4BBR G;  4A3C G;  4A3D B;  1II3 A;  4X3S A;  5C0X I;  1YHB A;  3PO2 B;  3NTI A;  4RCN A;  5FKA C;  5EPJ A;  4J1M A;  1RKN A;  3PIO 3;  4GNX B;  1BCP C;  4A3F G;  1V1O A;  1H9S A;  1F9R A;  2BOS A;  3I4M H;  3FRP B;  4GZY C;  4BBR B;  4L5R C;  1PRT D;  1JB7 A;  2NZH A;  2X6G A;  1XPU A;  2ALY B;  1TKW B;  3L7Z C;  4M1U B;  3S24 A;  5IT9 c;  3GTL H;  1B9M A;  1HQR D;  3K81 C;  3NTK A;  1CZG A;  2F0H A;  1HZC A;  4TSS A;  4A93 G;  3PF5 A;  1PXU A;  3DEO A;  4A3F B;  4BY1 G;  1CHQ D;  2L11 A;  3WOF A;  1H9M A;  3G48 A;  4DV2 L;  3G6E A;  2K33 A;  2UUB L;  1YZ6 A;  1T5E A;  5JEA J;  1Q86 C;  4HSV A;  4U67 3;  3R3O A;  3ONA B;  4A3K G;  1CUK A;  3I7F A;  1JT8 A;  1A2U A;  1LTB D;  5GAE C;  1PMR A;  4BY1 B;  1B4O A;  3H91 A;  5D14 A;  1U4P A;  1NBW A;  4R4C A;  1QJO A;  1QUQ B;  1STY A;  1WTP A;  2K6A A;  3S14 B;  3J7Y W;  1QNK A;  1E3P A;  1Q1E A;  3KBG A;  1JC7 A;  2TSS A;  4OIK A;  4RHS A;  1LTR D;  4A3K B;  1KDC A;  4Q0F A;  2B3G A;  1Z6H A;  1JOK A;  2BE5 D;  4L6T B;  4WRD A;  5I6Y A;  4GOP C;  1IXR A;  1TWH H;  1E24 A;  5IYB H;  5IE8 A;  4FO2 A;  4AYB E;  1SJE D;  2XN9 C;  4C3I G;  3P7J A;  2UUC L;  4POF A;  2MO1 A;  1VQL A;  2O4X A;  2R7Z H;  2IX0 A;  4X66 Q;  4QL5 A;  5EBC A;  3AEV A;  4B3S Q;  4X64 Q;  1QE6 A;  3Q22 A;  1MGS A;  1F2Y A;  3L9A X;  3X3N A;  2F3I A;  1JOR A;  2E2I H;  3G6J B;  1I4P A;  2RSN A;  3H0G B;  1E0B A;  3M4O B;  4H7B A;  3TP7 A;  1GUO A;  2RKS A;  3CPF A;  1U4M A;  1VQO A;  4ALP A;  1VQK A;  5BN3 A;  1B7Y B;  1EY9 A;  2JEB I;  4DAP A;  4JYA L;  1I3Q B;  2DY7 A;  2KHJ A;  2Z9H A;  4KJO A;  5CV6 A;  1DZ1 A;  3M9B A;  2P5Z X;  3SE0 A;  2MGS A;  3ULP A;  1ESF A;  5FK9 C;  3TN2 A;  2FFK B;  1X3G A;  1EY6 A;  1OXV A;  1V9P A;  1XX8 A;  2F0G A;  4DU9 A;  1EY0 A;  4IQZ A;  1TS5 A;  2LS0 1;  3STB D;  3DXJ C;  1WYD A;  3JAM L;  4R1J A;  1Q8K A;  3K5N A;  3EBE A;  4A3E G;  4A3J H;  3B6Y A;  5GQO A;  1BCP B;  1H9S B;  4IOC A;  1SYB A;  5IYD H;  4DAV A;  1I4X A;  3MZ5 A;  1A3V A;  5C4Z A;  4C3H G;  1IBK L;  1A0I A;  1Q46 A;  4OWT B;  3OTO Q;  3FPU B;  4I65 A;  2I5M X;  1PYW D;  3K58 A;  3U9S A;  2F4V Q;  1SMY D;  1EU4 A;  4P74 A;  2RHQ B;  5C0X H;  1IYU A;  4R4O A;  4YWL A;  5I9P A;  2AUK A;  3CRK C;  4ILW A;  1O7L A;  3S1N B;  1Q7Y C;  1KXL A;  1GXD C;  3ER0 A;  3P20 A;  4OIJ A;  1DOK A;  3S16 H;  5IYC G;  1YNJ D;  2QDL A;  4ZCK A;  1ICF B;  1SYD A;  1BO0 A;  4RG1 A;  2CWA A;  5C4X G;  3J81 i;  4B9W A;  1QVC A;  1WD1 A;  1GOZ A;  1U4R A;  1GHK A;  1V1P B;  2JA6 B;  2I07 B;  1SNC A;  4DV7 L;  3BVZ A;  3HOY B;  4UAI A;  4DN4 M;  3U58 A;  2PMZ B;  4C3J G;  5K36 G;  2JA5 G;  3CCS A;  2ZJR A;  2R7F A;  4OEM B;  1L1O A;  4PZ7 A;  3GTJ H;  3Q6S A;  4ZUI A;  1YEZ A;  4DFA A;  5IP7 G;  4FXG C;  4O0A A;  4GOP B;  1BBX C;  1ML0 D;  4YWM A;  3D6C A;  2RVL A;  3C46 A;  1AZP A;  1XNQ L;  4LUO A;  1TWA B;  5COR A;  1JQY D;  1XXG A;  2X6L A;  2B2V A;  4R8N A;  1E7Z A;  2E2J B;  1K8M A;  4N9P A;  5I2X A;  3CW2 C;  4YCU A;  2F0E A;  3E5S A;  4JBJ A;  1DD2 A;  2V1C C;  4CDE C;  4DR4 L;  4UP9 A;  4DR6 Q;  4NDX A;  2L15 A;  4GLV B;  2FHT A;  3T1Y Q;  3A0J A;  2JA8 H;  5CBA E;  3GTO B;  1J9O A;  1GUG A;  5CGK A;  3H3V I;  3GTQ H;  4HCS A;  1NE3 A;  2NZ1 D;  2ICI A;  2CW0 D;  2Q8I B;  1IL8 A;  4HJ5 A;  4PNY A;  1EIH A;  3CC7 A;  2Z6K C;  1K28 A;  3S1Q B;  2IX1 A;  4CKC A;  2LSS A;  4B3R L;  4PMB A;  3I72 A;  1HH2 P;  3TP8 A;  2CCZ A;  2NVT B;  2I0Q A;  2JA7 H;  1FGU A;  4LF7 Q;  2AQ1 B;  1XNR L;  1SRU A;  5C0X J;  4KTA A;  4DR2 L;  2E76 C;  2WKD A;  3FKI B;  4JOI A;  3S2H B;  1UE7 A;  3KFU A;  1PDQ A;  4JI0 L;  1YJN A;  1K9M C;  2UXD Q;  1Q1B A;  3SVM A;  5K5P A;  1Y69 U;  1TWF B;  4DK6 C;  4KMU C;  2NVY B;  2LXK A;  1YJ9 A;  1YNN C;  2NZO A;  4LUZ A;  3VR4 A;  4CJ0 B;  1PFN A;  5CBE E;  3U9O A;  4K6D A;  2JQO A;  1EY4 A;  1G6P A;  2IY5 B;  4IN3 A;  4PG3 A;  2K5H A;  4DNT B;  4L63 B;  4WOR A;  4BXX G;  1L0X B;  1VQC A;  4OO1 I;  2XNA C;  1ILQ A;  1LLR D;  3TRZ A;  2MJ8 A;  4JI4 L;  1B53 A;  1KLU D;  4FF1 A;  3J81 j;  5ELF A;  4KHV A;  2B2T A;  3HS0 C;  1LTG D;  3GTP H;  3NE5 B;  1OXT A;  2MQH A;  4R4T A;  3HOX G;  5CYU A;  2HHH L;  5BN5 A;  2RDF A;  1XTC D;  2PNR C;  1IYV A;  4A3B G;  1Y8P B;  4LF5 Q;  3VR6 A;  4HIM A;  4DV4 L;  4GS3 A;  4NXM L;  4YCW A;  3QOL A;  4C2M H;  3A5Z B;  4QF4 A;  1NMG A;  5HY6 A;  2F52 A;  3WDN A;  4WJ3 M;  2PZT A;  1SE8 A;  3MEH A;  3TRE A;  1LTL A;  3QB3 A;  2CHB D;  4MNO A;  1PH2 A;  3CRL C;  3HOX B;  4N9T A;  3GTK B;  3J80 i;  2JEA I;  3PO3 G;  4J8Q A;  3CPW A;  4A3B B;  2PQE A;  1HZB A;  3SK4 A;  3KF8 A;  2L4N A;  1SJH D;  2A6H D;  1EEI D;  2L5T A;  3UDX A;  1EWC A;  2OF1 A;  1SAP A;  1WTH A;  1MD2 D;  3K7A B;  1FR3 A;  5CV8 A;  3SEB A;  2VB2 X;  5M5X B;  2B29 A;  4KI0 A;  4G4K A;  2JN4 A;  2A6E C;  4X65 Q;  3OW7 A;  2N49 A;  1WCM H;  2KJX A;  1HHV A;  3CQZ H;  1KDB A;  2XWJ B;  1N34 Q;  5GAG C;  1XYI A;  5C3E G;  3SHL A;  1DOL A;  4KHP Q;  1Z9F A;  3MHB A;  1ENC A;  1R9T B;  1QVG A;  3HFZ B;  2O2L D;  4ZYS A;  3MC0 B;  1UE6 A;  3D4W A;  1NMF A;  3A7A B;  3K5M A;  2RCN A;  5IGF A;  1SNP A;  2J7Z A;  3KOJ A;  1EYD A;  2XRQ D;  2PW5 A;  3F2U A;  5C3E B;  2OQ0 A;  2FJ2 A;  5JVG 3;  4H44 C;  2YU9 H;  3PUZ A;  3DWQ A;  2B2Y A;  2XSC A;  3QO2 A;  2PI2 E;  2L9H A;  2DGY A;  1PVO A;  1I5F A;  1AW7 A;  3H3V H;  2B8G A;  3P1H A;  3I90 A;  2EJF C;  1EY8 A;  1TWG B;  3K5L A;  4J6H A;  3OHX C;  4A76 A;  1O7Y A;  1BBU A;  4DV0 Q;  4DUZ Q;  5IY0 A;  1RF2 D;  1VQN A;  2EYF A;  2A1A A;  3IFT A;  3BDC A;  5JJI A;  2G5D A;  4XTC S;  2B2W A;  2A69 D;  4BA1 I;  1LYL A;  2EQS A;  5FLX E;  4M8A A;  1EIG A;  2MUY A;  3I2Z A;  4R9W A;  2B8F A;  2R61 A;  4JW0 A;  2B63 G;  3M7N A;  4YY3 Q;  3UI2 A;  5GRO A;  4RA8 A;  3S17 H;  3MFY A;  4X6A H;  4CGY B;  3BYT B;  3KLS X;  3M3Y H;  4K8I A;  2PO4 A;  1TS2 A;  4UPA A;  2BE5 C;  1CKM A;  2EJM A;  3E9H A;  5C44 G;  4GN4 B;  5KYL A;  2NB0 A;  1WJJ A;  4HR7 B;  2WFW A;  2B63 B;  5G3L D;  5M3M G;  4X66 L;  5LHY 1;  1MKH A;  4C56 C;  4JI8 L;  2QA4 A;  4B3S L;  4OWW B;  1R4P B;  5CR3 A;  4HID A;  4KN4 C;  4G7H C;  2RDG A;  4X64 L;  1J5E L;  4A3D H;  4GKK L;  4KKT A;  1YHA A;  4OO1 H;  1SYC A;  5LMN Q;  1SR3 A;  1I4Q A;  4B3T L;  1KLG D;  1D5X C;  2NWG A;  4E6I A;  2EDG A;  5F2D A;  2SNS A;  1UE1 A;  4XT3 B;  4P2C B;  5T1G A;  3OW2 A;  4IJL A;  2KBN A;  4BWG B;  3L2P A;  1TWC H;  4BBR H;  4A3C H;  3W3A A;  4I7Z C;  5EKL A;  4GLX A;  3N52 A;  2PMZ E;  2Z6B A;  4LK1 C;  4ZQ3 A;  5KGU A;  2IPK D;  1QZH A;  4GLA C;  3RZO H;  2EY6 A;  1CFM A;  3OWF A;  1VQB A;  3MXN A;  1RIP A;  1N8R C;  1MSH A;  1VQD A;  4RWS C;  1QZG A;  3DHQ A;  4HN7 A;  5KEE A;  2HIV A;  1STE A;  4ZUJ A;  1B8A A;  2K50 A;  4LF9 Q;  1SNQ A;  1N36 Q;  1VDZ A;  2RBM A;  4DR7 Q;  4DR5 Q;  3STB C;  2E2H H;  2H5X A;  2ZXP A;  3HOU G;  4A93 H;  1UAP A;  2HDM A;  4KV6 A;  3EQL C;  3RZD H;  1FD7 D;  1GHJ A;  2G9D A;  4ZLT F;  3MWY W;  3HOW H;  3S14 H;  3MXU A;  4HSP A;  5IWA Q;  2LXJ A;  3I91 A;  3C1E A;  1AN8 A;  3I55 A;  3OTO L;  4A3K H;  2VW9 A;  1PRT B;  4DNR B;  1GUS A;  3HOU B;  1OXS C;  4HMJ A;  2F4V L;  4TVA B;  4L8J A;  1FNV A;  3PO2 G;  4O42 A;  3UE0 A;  1SDF A;  1SMY C;  2IT1 A;  1PTO B;  3I8Z A;  1X9N A;  2L0C A;  4Y7N B;  3AFQ A;  3LX0 A;  1EQV A;  4EQ5 A;  1TU2 B;  3A8I E;  3R93 A;  1YNJ C;  1NTG A;  3I4L A;  1Q12 A;  5KIX A;  1RHP A;  2ZXR A;  3CCL A;  3Q24 A;  1CKN A;  4C3I H;  5JJZ A;  3K0Y A;  1CM9 A;  4O1N A;  2KA7 A;  3H94 A;  2K01 A;  3OPO A;  5IGG A;  3EN2 A;  3M4Y A;  1PH6 A;  4FF2 A;  3J81 E;  2ZJP A;  3PCO B;  2EYJ A;  1RCV D;  5JEA G;  2JE6 I;  2PW7 A;  1BOS A;  1WTO A;  2EXD A;  3H15 A;  1CSQ A;  2F0U A;  1PTO D;  2K52 A;  1ASZ A;  1GJX A;  1EUJ A;  1QG7 A;  1JOQ A;  5EKI A;  4K8J A;  3GTM B;  3MVV A;  4AQY Q;  4KKU A;  2ZTD A;  3DLL A;  5M3F G;  1E1T A;  2DUD A;  2VL6 A;  1G6Z A;  4X62 L;  1AEX A;  4FDB A;  4XYO A;  3KDF A;  3TS0 A;  3A74 A;  4DR6 L;  3U4V A;  4NB3 A;  1G51 A;  1SNM A;  1STH A;  2CH4 W;  3CCR A;  3ZJY C;  3T1Y L;  3LNN A;  1ENA A;  2BDN A;  5IGB A;  2RQX A;  5M3F B;  2ENB A;  4IPH A;  2AUJ D;  2CH4 A;  5AFW A;  4CHT B;  2UUA Q;  4DPG A;  2FXQ A;  3VDY A;  4R4Q A;  5LMU Q;  2QCP X;  3MXN B;  4A3E H;  1JWM D;  2CW0 C;  4A3I G;  4PV1 C;  5I2Y A;  1EYG A;  3H0G G;  4FXK C;  1CQV A;  5ELB A;  4KKS A;  5KYI A;  2EOT A;  4C3H H;  5KNC A;  1D5M C;  1PH4 A;  4FVM A;  2VZA A;  1EWI A;  3HP3 A;  1LAC A;  2NTS A;  4A3M G;  2CKZ B;  5KND A;  4LF7 L;  2MP1 A;  1I4R A;  1HR0 Q;  3BZC A;  1I4H A;  4QIW E;  4A3I B;  1JJG A;  1BKB A;  2GVB A;  3FMC A;  3AYH B;  2D2C C;  3U50 C;  3E3X A;  4LF8 Q;  3KUP A;  2UXD L;  3I56 A;  2HT1 A;  5IYC H;  5E4W C;  4NXN Q;  1B9N A;  1E2W A;  1WTR A;  4A3M B;  1TS3 A;  2NVQ H;  3PV0 A;  3JAM c;  5C4X H;  1CQF A;  1H95 A;  2Z0S A;  4U68 A;  1VQJ A;  1ZEQ X;  5IGC A;  1U0L A;  2KQ3 A;  4LF4 Q;  1LT6 D;  1LTS D;  4IJH A;  4C3J H;  5C4J B;  5ELE A;  5K36 H;  2SDF A;  2JA5 H;  3S1M H;  1JOO A;  4OGQ C;  2E2J H;  4RFB A;  1RD9 D;  4JI7 Q;  3TME A;  5IP7 H;  2KCM A;  2EYH A;  3S15 H;  2WP8 J;  2MO0 A;  3DM1 A;  4HCE A;  5FO7 B;  4LFA Q;  1HTL D;  1SFO H;  1EY5 A;  2PZU A;  4JI2 Q;  3V2T A;  1UEB A;  4XIG S;  2Q2T A;  2A73 B;  2Y0S G;  1TR5 A;  3PQI A;  5EPL A;  2K03 A;  4LF5 L;  1IBL Q;  1FGB D;  3GTO H;  1X55 A;  1AE3 A;  1BDO A;  1FVI A;  1GUN A;  4K0K Q;  3T51 B;  4K5X A;  2WB1 B;  5CV4 A;  1QNU A;  2XVS A;  1K0R A;  1S72 A;  3C2P A;  1FJG Q;  2G9H D;  5EJW A;  3RLN A;  2Y0S B;  2JA6 G;  3I4N G;  4L5S A;  1B3A A;  2VXW A;  3HOY G;  2O5I C;  1HQM C;  2UU9 Q;  2B39 A;  1B2T A;  1IW7 D;  3M85 A;  3A54 A;  1HTP A;  4RAU C;  2OWO A;  5CMD A;  2X69 A;  4ID6 A;  2IX3 A;  2A6H C;  5AJ3 Q;  1NAP A;  1W3S A;  2L1B A;  4KK7 A;  1TWH B;  3J80 E;  3VR2 A;  3I4N B;  1HUM A;  4X65 L;  5CV9 A;  5FOB B;  3FP9 A;  3SR1 A;  2LKV A;  1F9Q A;  1I4G A;  3FHW A;  1MSG A;  1JJC B;  4JCV E;  3S2H H;  5EKK A;  3GD7 A;  4A3L H;  1ILP A;  5DM6 3;  2L12 A;  1CTM A;  1N34 L;  2R7Z B;  4I7A A;  3GTG B;  1I6V C;  2K1B A;  2SEB D;  4KHP L;  1L1O C;  5DEH A;  5KNB A;  2NVY H;  5A2Q L;  2EY1 A;  5DAU A;  4ME5 A;  1AP0 A;  4DKA C;  1TVX A;  1WTW A;  1HNX Q;  4IO9 A;  2H1E A;  2E2I B;  3NBH A;  5H1S E;  5HGT A;  3GQB A;  1CA6 A;  5KRU A;  5COY A;  3J7A F;  4TQU S;  2VY3 A;  1NR4 A;  4IUU A;  3D8G A;  3Q0A A;  1SYF A;  2B2V C;  1ZYR D;  1LO5 D;  1UE5 A;  4H13 C;  1TXY A;  3SGI A;  2R92 G;  4ULL A;  3OYY A;  4HJ9 A;  1XPR A;  1VQ8 A;  3FEW X;  2B2U A;  1Y1V G;  1KIX A;  1D8L A;  2D62 A;  4KY7 A; 
#chains in the Genus database with same CATH homology
 4B3M Q;  2N49 A;  4PZ8 A;  1WCM H;  3TQY A;  3HOY H;  2K5N A;  3WWV A;  4DV0 L;  5IYD G;  4HJA A;  2HHH Q;  3CQZ H;  4DUZ L;  1N34 Q;  4BXX H;  5GAG C;  2N8N A;  5C3E G;  1OXU A;  2AHO B;  3LGJ A;  1GD7 A;  5BR8 Q;  3ULL A;  1N9W A;  1LUZ A;  1EFW A;  4LF6 L;  4JI8 Q;  3I4M G;  1Z9F A;  3EIV A;  3F1Z A;  1VQM A;  4IFD G;  4KHP Q;  3J80 c;  1QVG A;  2BA1 A;  1J5E Q;  3HFZ B;  4NXM Q;  4GKK Q;  3BZK A;  3K80 C;  1UE6 A;  1K83 H;  1YIT A;  3AQQ A;  1S40 A;  1X6O A;  1NMF A;  4P73 A;  2RCN A;  4B3T Q;  3FKI G;  3CME A;  1GKH A;  3CXC A;  3KOJ A;  1T9H A;  3HOX H;  3GTK H;  1VQ5 A;  3PSI A;  2VQE L;  3S1R H;  3T1H Q;  1GVP A;  2N78 A;  1IYJ B;  2OQK A;  1TWA H;  3G4S A;  4DV1 Q;  3K7U C;  1D7Q A;  2OQ0 A;  1VQG A;  2RF4 A;  4YY3 L;  4DV5 Q;  4JV5 L;  1GM5 A;  1YJW A;  2OTJ A;  2YU9 H;  3PUZ A;  1PYS B;  1EQR A;  4A3D G;  2PI2 E;  4PZ6 A;  1KRS A;  3K7A H;  2DGY A;  1PVO A;  1I5F A;  1HNW Q;  2CWP A;  4OX9 Q;  2QGQ A;  2WB1 G;  4OO1 G;  3H3V H;  2JK8 A;  4JI6 Q;  4JOI C;  1EIY B;  2R93 H;  3MEF A;  2MNA A;  2VQF L;  4A3I H;  2E5L Q;  1CKN B;  5FLM H;  1O7I A;  4IFD I;  1VQA A;  1YI2 A;  3PO3 H;  1M90 C;  3D0F A;  4AH6 A;  4DR1 L;  1PH9 A;  2UXC L;  3BU2 A;  5ELN A;  4A76 A;  2YTV A;  4DV3 L;  4DV0 Q;  1BBU A;  2Q2I A;  4GN3 B;  1FL0 A;  4DV6 L;  4DUZ Q;  4QY7 A;  1X65 A;  5IY0 A;  1LM0 A;  2R92 H;  1UWV A;  4BBR G;  4LF6 Q;  4A3C G;  4HIO A;  1VQN A;  2VUM G;  1CKO A;  2A1A A;  1DGS A;  4MZ9 A;  5C0X I;  1VQF A;  5LMN L;  2XGT A;  1YHB A;  3UDI A;  5JJI A;  1Y1V H;  1BVS A;  4XTC S;  4BA1 I;  2K4K A;  1LYL A;  4GNX B;  1XMQ L;  2EQS A;  5IYB G;  4A3F G;  3I2Z A;  3S1Q H;  2VQE Q;  3RNU A;  3F2B A;  2JJQ A;  1K3R A;  1M1K C;  1HNZ L;  2B63 G;  3I4M H;  2HQL A;  2R7Z G;  4L5R C;  1JB7 A;  4LFC L;  3CMA A;  4YY3 Q;  3M7N A;  5GRO A;  2NZH A;  1XPU A;  3S17 H;  4JV5 Q;  2AMC B;  3RN2 A;  1EQQ A;  1I6H H;  3KYH C;  1YHQ A;  4X6A H;  2ALY B;  2NVT H;  3L7Z C;  3S24 A;  1N32 L;  5IT9 c;  3GTL H;  3K81 C;  1X56 A;  2C35 B;  2CFM A;  1PA6 A;  3M3Y H;  2D0O A;  1CSP A;  1MJC A;  3KDF B;  1HZC A;  4UPA A;  4A93 G;  3PF5 A;  1CKM A;  4UY8 C;  4H02 A;  2WAQ G;  1PHJ A;  3FKI H;  2VQF Q;  4BY1 G;  3E9H A;  5C44 G;  4GN4 B;  4DUY L;  1NY4 A;  1WJJ A;  3TEH B;  1I50 H;  4DR1 Q;  4DV2 L;  3G48 A;  1KAW A;  1VQP A;  1IBM L;  2WFW A;  2BH2 A;  3G6E A;  4QQB X;  2BH8 A;  5M3M G;  2UUB L;  3CC4 A;  1YZ6 A;  4X66 L;  4DV3 Q;  1MKH A;  2ZJQ A;  4DV6 Q;  2QA4 A;  4JI8 L;  4B3S L;  2ES2 A;  4LF9 L;  4OWW B;  4HID A;  1TWF H;  1L1O B;  3D31 A;  5JEA J;  2KCT A;  4DK3 C;  4X64 L;  1Q86 C;  1PH7 A;  1N36 L;  3CCU A;  1J5E L;  3S2D H;  4A3D H;  4GKK L;  4A3K G;  1G29 1;  1CUK A;  1YHA A;  3I7F A;  4DR5 L;  4DR7 L;  1JT8 A;  1JMC A;  4RMF A;  5GAE C;  5LMN Q;  1SR3 A;  1KC8 C;  1U5K A;  4B3T L;  1A8V A;  1NBW A;  4R4C A;  1XMQ Q;  1QUQ B;  2RHS B;  1UE1 A;  5M5Y H;  1E3P A;  1Q1E A;  1HZ9 A;  3PUW A;  2I5H A;  5IWA L;  3OW2 A;  4IJL A;  2KBN A;  3F2C A;  3L0O A;  3L2P A;  1HNZ Q;  1TWC H;  4JI3 L;  1PH8 A;  4BBR H;  4A3C H;  4GLX A;  1KHI A;  4LFC Q;  4P72 A;  2VUM H;  2PMZ E;  3W5O A;  2B3G A;  1QZH A;  4GLA C;  2K14 A;  2YV5 A;  4AIM A;  3RZO H;  1N32 Q;  3E9I A;  5FLX c;  4GOP C;  4R4I A;  4BY7 G;  1VQB A;  4NPS A;  1IXR A;  1TWH H;  1RIP A;  3AFP A;  3CAM A;  4DR3 L;  3KJO A;  1VQD A;  1E24 A;  3CCQ A;  1N8R C;  5IYB H;  2OTL A;  4IPC A;  5IE8 A;  4A3J G;  3HKZ E;  3F2D A;  1QZG A;  2HIV A;  3PIO A;  4AYB E;  1PH3 A;  1X3E A;  4DUY Q;  3UE1 A;  3CD6 A;  1HR0 W;  2UUC L;  4POF A;  5M5W H;  4DV2 Q;  1IBM Q;  4X65 Q;  2MO1 A;  1XMO L;  1VQL A;  2R7Z H;  2UUB Q;  2IX0 A;  1B8A A;  2K50 A;  4X66 Q;  2OCE A;  4QL5 A;  4HIK A;  1A63 A;  3AEV A;  4LF9 Q;  4B3S Q;  1OTC A;  1YBY A;  1QVF A;  4X64 Q;  1N36 Q;  3HOZ G;  4DR7 Q;  4X62 Q;  3STB C;  4HJ8 A;  4DR5 Q;  4L5T A;  2H5X A;  1KIX A;  2E2H H;  1KL9 A;  3HOU G;  4A93 H;  1L2F A;  2F3I A;  4OWX B;  3GO5 A;  3RZD H;  1YNX A;  2E2I H;  3TS2 A;  5C44 H;  5C0X G;  3PF4 A;  3HOW H;  1V43 A;  3S14 H;  2PQA A;  5M3M H;  3G71 A;  5GAH C;  3CCV A;  1AE2 A;  2PNH A;  4A3B H;  2ASB A;  5JJL A;  4OON A;  5IWA Q;  1PH5 A;  2LXJ A;  4L5Q A;  3UDF A;  3HOV H;  4JBK A;  3I55 A;  3CPF A;  4JI3 Q;  3OTO L;  1VQO A;  4A3K H;  4ALP A;  2VW9 A;  1VQK A;  4BBS G;  1B7Y B;  2JEB I;  4JYA L;  1OXS C;  2BA0 A;  2F4V L;  1YJ9 A;  4TVA B;  4DAM A;  2KHJ A;  5M5X H;  3PO2 G;  4DR3 Q;  3UE0 A;  3M9B A;  3ULP A;  4A3L G;  2Z6K A;  2IT1 A;  4JI5 L;  4AQY L;  2UUC Q;  1X9N A;  1N33 L;  1X3G A;  1XMO Q;  1OXV A;  1V9P A;  1XPO A;  1AH9 A;  3M4Q A;  3AFQ A;  3STB D;  4EQ5 A;  1R9T H;  1PYB A;  1WYD A;  1NTG A;  2N3S A;  1GO3 E;  1Q12 A;  4R1J A;  4BY7 H;  1Q8K A;  3PUV A;  2XTI A;  3EBE A;  4A3E G;  4A3J H;  1BBW A;  3B6Y A;  3DM3 A;  3CCL A;  4GKJ L;  1KD1 C;  5GQO A;  1CKN A;  4C3I H;  4JG2 A;  4YHH L;  4IOC A;  2EIF A;  5IYD H;  4DNI A;  2VS1 A;  5C3E H;  3EN2 A;  3CP0 A;  4A75 A;  1PH6 A;  1KQS A;  1VQ9 A;  3E0E A;  4P71 A;  2UUA L;  4MTN A;  2ZJP A;  1IBK L;  3PCO B;  1A0I A;  3HOZ H;  1Q46 A;  4OWT B;  3OTO Q;  4WJ4 A;  2NVX H;  1C7Y A;  5JEA G;  2GVA A;  2I5M X;  2JE6 I;  2Q2U A;  5LMU L;  3HOU H;  4JYA Q;  2EXD A;  5GAD C;  4YCV A;  3H15 A;  2F4V Q;  2UXB L;  1CSQ A;  1VQ4 A;  4GNX A;  2K52 A;  4JC0 A;  4P74 A;  2RHQ B;  1ASZ A;  2ID0 A;  1ASY A;  4R4O A;  4YWL A;  1EUJ A;  1VQE A;  1TWG H;  1WCM G;  3KF6 A;  3NEN A;  4GN5 A;  1V1Q A;  1Q81 C;  1I94 L;  1Q7Y C;  3PIP A;  1KXL A;  3ER0 A;  4JI5 Q;  4AQY Q;  2Y0S E;  2JA8 G;  1N33 Q;  3S16 H;  5IYC G;  2ZTD A;  4IPD A;  3DLL A;  5M3F G;  1E1T A;  2NN6 I;  2DUD A;  4BBS H;  3K0X A;  2VL6 A;  4X62 L;  3RLO A;  4RG1 A;  2CWA A;  5C4X G;  1EIF A;  4FDB A;  1HR0 L;  3J81 i;  2YTX A;  3HKZ G;  1K8A C;  4JBM A;  1WFQ A;  1QVC A;  3KDF A;  3TS0 A;  4AYB G;  3A74 A;  3PO2 H;  4DR6 L;  3NBH B;  5DLQ E;  3U4V A;  1YVC A;  4NB3 A;  4GKJ Q;  1G51 A;  4DV7 L;  4LF8 L;  4YHH Q;  3NEM A;  3CCR A;  2A19 A;  2HIX A;  3ZJY C;  3T1Y L;  3U58 A;  5K36 G;  3KF8 B;  4NXN L;  3ICE A;  2JA5 G;  3CCS A;  2ZJR A;  2R7F A;  4IPH A;  1L1O A;  4PZ7 A;  3GTJ H;  4PMW A;  2UUA Q;  3KJP A;  1MJE A;  1IBK Q;  4HJ7 A;  3GTG H;  1YEZ A;  4DPG A;  2FXQ A;  2JA7 G;  3VDY A;  4UP7 A;  4R4Q A;  5IP7 G;  4LFB L;  5LMU Q;  4O0A A;  5FJ8 G;  3MXN B;  4GOP B;  4A3E H;  4LF4 L;  4YWM A;  2UXB Q;  5ELO A;  4A3I G;  1Y1W G;  4A3F H;  1X3F A;  1OXX K;  5FLM G;  1EYG A;  3H0G G;  3JAM i;  1XNQ L;  4LUO A;  3J81 c;  1I94 Q;  4BA2 I;  2B63 H;  3J7A 5;  3A5U A;  4C3H H;  1YIJ A;  1E7Z A;  4LUV A;  2E8G A;  1PH4 A;  2VZA A;  3K8A A;  2K75 A;  2D0P A;  1EWI A;  5E7N A;  4O2D A;  3CW2 C;  1VCI A;  4YCU A;  4A3M G;  2CKZ B;  4LF7 L;  1HJP A;  2KEN A;  4JBJ A;  4KLK A;  1E1O A;  2V1C C;  3BZC A;  1HR0 Q;  4QIW E;  4JI2 L;  3JC6 6;  3KLW A;  1JJG A;  1BKB A;  2GVB A;  4DR4 L;  4UP9 A;  3AYH B;  2AKW B;  3U4Z A;  1Q82 C;  3U50 C;  4BY1 H;  4DR6 Q;  4OXP A;  1EOV A;  2KHI A;  4DV7 Q;  2L15 A;  4LF8 Q;  4GLV B;  2UXD L;  2PQA B;  3I56 A;  2ZM6 L;  3T1Y Q;  2VNU D;  5JJK A;  3A0J A;  1IBL L;  2HT1 A;  2JA8 H;  1J6Q A;  5IYC H;  4LWC A;  4NXN Q;  1X54 A;  1B70 B;  5M3F H;  2K5V A;  3GDE A;  3H3V I;  5J3B A;  4K0K L;  4DV4 Q;  2NVQ H;  3GTQ H;  3PV0 A;  3JAM c;  5C4X H;  1JE5 A;  1P16 A;  1NE3 A;  1H95 A;  2Z0S A;  1VQH A;  1SN8 A;  1C9O A;  4YWK A;  1VQJ A;  4LFB Q;  1FJG L;  1U0L A;  5HGQ A;  4LF4 Q;  4HJ5 A;  4APV A;  3CC7 A;  2Z6K C;  2ZTE A;  3PGZ A;  4IFD J;  1P8L A;  1Z47 A;  4IJH A;  4QJF A;  4C3J H;  2UU9 L;  1XNQ Q;  2IX1 A;  2LSS A;  3J7Z C;  2JA5 H;  4B3R L;  3F8T A;  1PH1 A;  4IOA A;  2PI2 A;  3S1M H;  1HH2 P;  2E2J H;  2CCZ A;  1MIU A;  2JA9 A;  4A3G G;  2I0Q A;  4JI7 Q;  5AJ3 L;  2R6G A;  2JA7 H;  2YTY A;  1RL2 A;  2I5L X;  1FGU A;  5IP9 G;  1KRT A;  2KCM A;  5IP7 H;  4LF7 Q;  3S15 H;  2WP8 J;  2MO0 A;  4LFA Q;  5FJ8 H;  1SFO H;  1XNR L;  1SRU A;  5C0X J;  4DR2 L;  2NN6 G;  2GN5 A;  4ME3 A;  4JI2 Q;  4A4I A;  1Y1W H;  4JOI A;  1UEB A;  3CC2 A;  4DR4 Q;  4XIG S;  1XJV A;  2Q2T A;  1UE7 A;  3KFU A;  1E22 A;  2AWO A;  2Y0S G;  3ERS X;  3H0G H;  2A8V A;  4J15 A;  4JI0 L;  3M4O H;  1YJN A;  1K9M C;  2ZTC A;  2UXD Q;  1Q1B A;  2ZM6 Q;  3UDG A;  4LF5 L;  1IBL Q;  3BJU A;  1PV4 A;  1WOC A;  4DK6 C;  3GTO H;  1SLJ A;  1X55 A;  2LXK A;  1AE3 A;  3RLF A;  2NZO A;  1FVI A;  1PFS A;  4LUZ A;  3ULJ A;  3CCM A;  4A3M H;  4K0K Q;  1HNX L;  3PUX A;  1I3Q H;  1WI5 A;  1K0R A;  3HKS A;  1VS0 A;  4UP8 A;  3CCJ A;  1S72 A;  1FJG Q;  4GNX C;  1IL2 A;  3RLN A;  4LNQ A;  2JQO A;  2WB1 E;  2JA6 G;  4L5S A;  3I4N G;  3W1B A;  2UXC Q;  1G6P A;  1VQ7 A;  2IY5 B;  3M4P A;  3KF6 B;  4JI1 L;  2ATW A;  3I4O A;  3HOY G;  4PG3 A;  5C4J H;  2K5H A;  2UU9 Q;  2CQO A;  1K8G A;  3IRB A;  4BXX G;  2IHF A;  4B3R Q;  3M85 A;  2YYZ A;  1VQC A;  4OO1 I;  1XTD A;  4Y7N H;  3TRZ A;  2OWO A;  3Q8D A;  4LW1 A;  4JI4 L;  4POG A;  3J81 j;  5AJ3 Q;  1VQ6 A;  3RR5 A;  1W3S A;  4DAY B;  1L0W A;  1SMX A;  3NEL A;  4KHZ A;  3PUY A;  1XNR Q;  4DR2 Q;  4X65 L;  3FP9 A;  3GTP H;  1NJI C;  4B3M L;  2MFI A;  1JJ2 A;  3FHW A;  3S2H H;  1JJC B;  1OXT A;  2MQH A;  4JCV E;  3GD7 A;  4R4T A;  4A3L H;  3HOX G;  2HHH L;  3HOW G;  5LMN W;  1Y14 B;  1N34 L;  4JI0 Q;  2R7D A;  1SRO A;  4EX5 A;  5BR8 L;  4A3B G;  4LF5 Q;  4KHP L;  1L1O C;  4P75 A;  4HIM A;  4A3G H;  1HZA A;  3HOV G;  2NVY H;  4DV4 L;  4GS3 A;  4NXM L;  4YCW A;  5EAY A;  5IP9 H;  4C2M H;  4DKA C;  2IHE A;  3A5Z B;  5HY6 A;  1NMG A;  2F52 A;  1IZ6 A;  1HNX Q;  4WJ3 M;  2QEX A;  4IO9 A;  1SE8 A;  3TRE A;  1LTL A;  2R93 G;  3W1G A;  5H1S E;  4MNO A;  1PH2 A;  4TQU S;  2VY3 A;  1QUQ A;  1A62 A;  4IPG A;  4JBW A;  3J80 i;  2JEA I;  3PO3 G;  4Y52 H;  3T1H L;  2WAQ E;  1W2B A;  2AWN A;  3CPW A;  2Q2H A;  4DV1 L;  4JI1 Q;  3S1N H;  1HZB A;  4DV5 L;  3RN5 A;  1VQI A;  3GTM H;  1UE5 A;  1TXY A;  1C0A A;  3SGI A;  3UDX A;  1S3O A;  2R92 G;  4JI7 L;  3OYY A;  4JI4 Q;  4HJ9 A;  3CF5 A;  1XPR A;  1VQ8 A;  1HNW L;  4OX9 L;  4LFA L;  1K73 C;  4JI6 L;  4QGU A;  2B29 A;  4GOP A;  4KI0 A;  2E5L L;  1Y1V G;  2JA6 H;  3I4N H;  3CCE A;  1D8L A;  2D62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...