4DV1L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1L00
3I55A 3GD7A 1N9WA 4DR7Q 4LF5Q 3UDXA 5E7NA 4DV4L 1KAWA 3CP0A 5M5XH 4R4TA 1QZHA 3E0EA 4HJ5A 3CMEA 1IBLQ 1N8RC 4BXXG 1HH2P 1YJWA 3J81c 3RLOA 1XJVA 4ME3A 4A75A 3PV0A 4BBRG 3L0OA 4JCVE 4LUVA 1VQKA 3H0GG 2XGTA 4GNXA 1VS0A 3TRZA 1Q12A 1D7QA 4A3CG 1W2BA 1KQSA 1WI5A 4YCWA 3HKZE 3HOXH 3NBHB 2PQAA 3GTMH 1A62A 3TEHB 1C9OA 1Q8KA 3ERSX 4DUZQ 1TWHH 2Q2HA 3K7AH 1WOCA 4P73A 1X3FA 1NMFA 5FJ8H 1Y1VG 4LF4L 4LF9L 3L2PA 4POGA 1YNXA 1PH8A 3AEVA 5C3EG 2ZTEA 2I5MX 3E9HA 1TXYA 1VQAA 3GTJH 2UXDQ 1HNXL 1HZ9A 1XTDA 5LMNW 3UDGA 4L5RC 4LF7Q 3I4MH 4BBSH 4PZ6A 1VQNA 4IFDI 2JQOA 5AJ3Q 3U4VA 4QQBX 4MTNA 2N3SA 5ELNA 3G4SA 1AH9A 1KRTA 3HOZG 4LF8L 1YHBA 1HZCA 1ASYA 2YTVA 1D8LA 4LFCQ 4QY7A 3K8AA 3EN2A 1JE5A 4C2MH 1YJNA 4JV5L 2RCNA 5H1SE 4DR1Q 3K81C 3GTGH 4L5TA 3U58A 3H3VI 2E2JH 4A3KH 1IBLL 4GLXA 2UXDL 5JJLA 4UPAA 4JI8Q 4DV1L 2JA7G 4HIOA 4DV0L 3KF6B 1HR0Q 1CKNA 3F8TA 4DV6Q 1WFQA 2UXBL 1XNRQ 4DR5L 1Q46A 1QVCA 3S16H 3M4OH 4H02A 3I4NH 3F2BA 4A3EG 1OXVA 4UP8A 1YI2A 2VUMG 2E5LQ 3H15A 1Q82C 1PH6A 1XMQQ 1GKHA 5EAYA 1NE3A 5K36G 1A8VA 4C3HH 2R7DA 5M3MH 1HR0W 1J5EQ 1G51A 3CCEA 1VQHA 1CSPA 1LM0A 2Z0SA 5FJ8G 2B63G 1XPRA 2R7ZH 1SE8A 2WAQE 4YWMA 1G291 5BR8Q 4NXNQ 4DK3C 2ALYB 1GD7A 1X3EA 3KDFB 3PIPA 3JAMc 4GKKQ 4DR5Q 2H5XA 3I4MG 2PMZE 4POFA 3CC7A 2F52A 1DGSA 3F2CA 4WJ4A 2NVQH 1Y14B 2K50A 4IFDG 1A0IA 4JI5L 3PO2H 5JJKA 5IWAQ 2WB1E 4DV3L 3KJPA 3CW2C 3RN2A 4LNQA 3T1HQ 2VQEQ 1YHAA 2ASBA 4A3BH 1Y1WH 3PO3G 3E9IA 1KD1C 1I5FA 4KI0A 2CCZA 1BBUA 5C0XI 5IP7H 1FVIA 3UDFA 4DV5L 1P8LA 2K5VA 2Q2IA 3S1NH 1PHJA 3J7A5 1TWFH 4R4OA 4GN4B 1G6PA 3AQQA 4DV7Q 4AYBG 4B3TQ 2JA5H 3CCSA 2PQAB 1SN8A 4A3DH 1EIYB 2YTYA 2UXCQ 3VDYA 4JC0A 4DR3L 1E3PA 3J81i 4X66L 2VUMH 4A3LG 4PMWA 2IX0A 1VQMA 1K3RA 1FL0A 1SROA 4B3MQ 2IT1A 2MQHA 3PUWA 4LF5L 3K80C 2HQLA 1PH5A 1VQFA 4OX9L 3T1YL 1VQ9A 3M4PA 3M9BA 4BXXH 3S1QH 1X65A 1CKMA 4DK6C 2WAQG 1UE6A 4JV5Q 4BBRH 2YU9H 2R7FA 4GS3A 4JI2Q 1N33Q 5JJIA 1FJGQ 1Q1BA 3TQYA 4A3CH 2OQKA 1J6QA 2VZAA 1PYSB 3CAMA 3HOXG 1N32Q 5HY6A 3SGIA 4X66Q 1X54A 1Q81C 4IO9A 4DAYB 1VQ6A 1AE2A 2ZJPA 1PH2A 1HR0L 2VW9A 3K7UC 1I6HH 4GKJL 2UXBQ 3BZKA 2I0QA 5C0XJ 3RZOH 4HIKA 4JBKA 3TS0A 4LFAQ 4GOPA 1Q7YC 1HNWL 3DM3A 4MNOA 1Y1VH 2K5HA 3DLLA 3LGJA 4OO1G 2A8VA 4HIDA 1UWVA 1Y1WG 5C3EH 4YHHL 1JT8A 5C44G 2N78A 4BA1I 2WFWA 4JOIA 4LF6Q 2UUBQ 1SR3A 2AHOB 2DUDA 3HKZG 4HJ7A 2PI2E 1VQDA 2B3GA 4KLKA 1SFOH 4K0KL 4A93G 1FJGL 2UU9Q 3S1RH 2K4KA 2ZJQA 5C4JH 1E1OA 5LMNQ 2HIXA 1Q86C 1IYJB 2GVAA 4JI1Q 5AJ3L 4MZ9A 1K83H 1BKBA 5GAGC 2NVXH 3CPWA 2BH8A 2CWPA 3JC66 5IYDG 2KHIA 4DR2L 1EFWA 1ASZA 3HOVH 1KHIA 4FDBA 2L15A 1YEZA 4DUYQ 1HNXQ 2N8NA 1Z9FA 3KDFA 1U5KA 4JBJA 3UE0A 1CKOA 2LXKA 2PNHA 2E2HH 1S72A 5GROA 1QUQA 1L1OC 4JI7L 4LFBL 3FHWA 3S2HH 4OWTB 4JI3Q 1S3OA 2JA7H 2C35B 1NJIC 4WJ3M 1UE7A 4JI1L 1HNZL 4QL5A 2F4VQ 4EQ5A 1X56A 3CCJA 2VS1A 1RL2A 4AYBE 4A3FG 3I4NG 4A3EH 2EIFA 4PZ7A 3PF5A 1V43A 2AWNA 2GVBA 2K52A 4DV2L 3GTQH 3ICEA 4JI6Q 1B8AA 2B29A 2QGQA 3ULPA 3KOJA 1HNWQ 1H95A 1EWIA 4ALPA 1TWGH 2LSSA 3M7NA 2B63H 1MJCA 2ZM6Q 4TVAB 2R7ZG 2VY3A 1N33L 2KENA 1T9HA 1TWAH 5IYBH 1JJGA 1PV4A 3D31A 2RF4A 2D62A 1B70B 2VNUD 2ZJRA 4A93H 5FLMH 3U50C 4LFCL 2Z6KA 5JEAJ 1CSQA 1X6OA 4UP7A 4APVA 1BBWA 3CCUA 2MO0A 1M90C 1IL2A 1WCMH 1A63A 2A19A 2JA9A 2EXDA 4GLAC 4IPGA 3W1BA 4UY8C 2JEAI 3S1MH 5IYDH 3L7ZC 4A3MH 3G6EA 3HOVG 1PH4A 3PO3H 3HOUG 5M5WH 1IZ6A 1JB7A 2VQEL 2VQFQ 1IBMQ 3CF5A 4QGUA 4A3JH 1RIPA 4X64L 4HJ8A 1L1OB 3I7FA 2OTJA 3PGZA 4O0AA 2ES2A 2EQSA 5JEAG 1XMOL 4JI5Q 4R4IA 1QZGA 3HOWH 5IY0A 1PH7A 4A3GG 1VQLA 1N36Q 1I94Q 1EOVA 4GKKL 2MNAA 4A3FH 3HOYH 2KHJA 1K73C 4JBWA 1YITA 4GNXB 4AH6A 2R92H 2RHSB 2Q2UA 4HJAA 4DUZL 2ZTCA 3S15H 1VQCA 2D0PA 4NPSA 2HHHQ 4JBMA 4KHPQ 4NB3A 4L5QA 3T1HL 1KC8C 4DV3Q 2Q2TA 2NZOA 3ULLA 3OTOL 1HJPA 3PIOA 4AQYQ 5C4XG 2UU9L 4JOIC 1AE3A 1GM5A 3PCOB 3ER0A 4O2DA 4X65Q 3UDIA 1IBKL 1PH9A 5IYBG 4DR7L 1K0RA 5IT9c 1GO3E 2AMCB 4HIMA 3M3YH 4DR6Q 2NZHA 3FKIG 2JEBI 1XPUA 4DUYL 4R4CA 4XTCS 1VQOA 4YY3Q 4DR4L 3F1ZA 4B3RL 4LF4Q 1JJ2A 1WCMG 4DV4Q 1J5EL 4YCUA 2IY5B 3PF4A 4A3MG 2JA6G 4IPCA 1HZBA 2GN5A 3PUZA 2E8GA 1SLJA 4IJLA 2D0OA 4IOCA 1KL9A 2PI2A 5GAEC 4YCVA 5C44H 1XMQL 1N32L 4A3JG 1BVSA 4NXNL 4B3SL 4YWLA 4BY7H 4HJ9A 1M1KC 4DAMA 4X62L 4OX9Q 2K14A 5M5YH 3KF6A 4L5SA 3HOWG 1X3GA 3GTOH 3KYHC 1LYLA 3RN5A 3GTPH 3W1GA 2OCEA 3I2ZA 2CQOA 4YY3L 1XNQQ 1IXRA 4DR4Q 5J3BA 2JJQA 1VQIA 5LMUQ 4DR1L 5IE8A 4OWWB 2KBNA 3CPFA 4LF9Q 3W5OA 2HT1A 2R92G 1OXSC 1VQ8A 3J80i 4GLVB 5DLQE 1VQEA 1FGUA 1WYDA 4IJHA 5IP9G 2ZTDA 4X65L 2NN6G 3MEFA 5C4XH 4B3TL 4JI4L 2NVTH 3F2DA 1CUKA 1NTGA 3NENA 4DV7L 2R93H 1YBYA 3KF8B 3PUVA 1VQ5A 2MFIA 3A0JA 5M3FG 3PUXA 3A5UA 4DV5Q 1K8AC 4OONA 4DPGA 2UUAL 4YWKA 1OXXK 1V9PA 4JYAL 1K9MC 2IHFA 1E22A 1PFSA 3K0XA 1UE1A 3BZCA 3HFZB 3OYYA 4X6AH 3M4QA 4Y7NH 2DGYA 1YJ9A 2YV5A 3CD6A 1YHQA 1E1TA 1XNRL 1EQRA 1W3SA 3S24A 4GOPC 2JK8A 1YZ6A 1PH3A 4DR2Q 1O7IA 2UXCL 1UEBA 2JA6H 4DV1Q 1L0WA 4P74A 2E2IH 1OTCA 2WP8J 1VQ7A 4JI7Q 2ID0A 4LFBQ 3NEMA 4EX5A 1SMXA 4DV2Q 1N34Q 4KHPL 2AKWB 3OW2A 4R1JA 4JI6L 3GTKH 2UUAQ 5GQOA 3RLFA 5FLMG 3B6YA 1Z47A 1VQPA 4DNIA 1HZAA 2V1CC 4P72A 4PZ8A 3WWVA 1IBKQ 3T1YQ 1JMCA 2FXQA 1VQBA 3D0FA 2K5NA 2CFMA 4BY1G 4B3ML 3H3VH 3HOUH 3M85A 4OWXB 2N49A 3CXCA 3PUYA 2YTXA 3AFQA 4JI0L 4LF7L 1C0AA 2Y0SG 4YHHQ 1VCIA 2BH2A 4TQUS 2OWOA 2I5HA 4X64Q 3I56A 4DR6L 1OXUA 2QEXA 1QVGA 2ZM6L 1EYGA 4LFAL 3IRBA 4GOPB 4A3GH 1P16A 4JI8L 2Y0SE 1S40A 2R93G 5GADC 2NN6I 1K8GA 2JE6I 3U4ZA 4DKAC 5IYCG 3J80c 3HOYG 4A76A 3AFPA 2BA0A 1MKHA 1YVCA 2YYZA 4X62Q 4A3IH 1LUZA 4LWCA 3RR5A 3G71A 4K0KQ 2E5LL 2IHEA 1PH1A 4QIWE 2OTLA 3BJUA 3A74A 1E24A 1MJEA 2KCMA 4DV0Q 2JA8G 1MIUA 1X55A 1QVFA 1NBWA 5FLXc 1PYBA 5HGQA 4JI3L 4P71A 1OXTA 2IX1A 1VQ4A 3J81j 3TS2A 3J7ZC 1XMOQ 4LUZA 4C3IH 3FKIH 3HOZH 2Z6KC 5C0XG 3S14H 2ATWA 3EBEA 3NELA 1IBML 3RLNA 1SRUA 3STBD 1HNZQ 3GO5A 3CC2A 2QA4A 1VQJA 2XTIA 3CC4A 2K75A 4BY1H 3PSIA 4A3KG 1Q1EA 4IOAA 4IPDA 5GAHC 1GVPA 2OQ0A 2HHHL 3AYHB 2UUCQ 4PG3A 3HKSA 4GN3B 4BY7G 3CCQA 4A4IA 4IPHA 1I50H 2VL6A 1TWCH 3GDEA 5IWAL 4JYAQ 4B3RQ 3KLWA 3JAMi 5BR8L 4JG2A 4GKJQ 3STBC 3FP9A 3TREA 1UE5A 5IYCH 2KCTA 1PA6A 1C7YA 3OTOQ 4AQYL 5M3MG 4A3IG 1QUQB 1EIFA 3RZDH 3Q8DA 3BU2A 3UE1A 4LW1A 2UUBL 4LF6L 2MO1A 2VQFL 3CCRA 4XIGS 1VQGA 1EQQA 2UUCL 1XPOA 5IP9H 1EUJA 3H0GH 3ZJYC 3CCVA 2JA8H 2HIVA 4Y52H 2NVYH 2F4VL 4GN5A 5LMNL 4JI4Q 4LUOA 1N36L 1NY4A 1JJCB 4RMFA 5M3FH 1L2FA 3MXNB 4UP9A 3CCMA 2A1AA 1X9NA 1I94L 1NMGA 3S2DH 3GTLH 1E7ZA 3PO2G 1I3QH 4QJFA 1L1OA 1LTLA 2R6GA 1PVOA 4NXML 4JI0Q 1U0LA 2RHQB 3ULJA 1KXLA 3S17H 3CQZH 4A3BG 4KHZA 3RNUA 4J15A 4DR3Q 4R4QA 4B3SQ 4DV6L 1B7YB 5LMUL 1XNQL 2CKZB 1CKNB 2AWOA 3A5ZB 5IP7G 3CCLA 4JI2L 4P75A 3KFUA 4BBSG 1WJJA 2CWAA 2I5LX 3I4OA 2JA5G 3CMAA 3EIVA 4AIMA 2WB1G 4GNXC 4OXPA 4BA2I 4A3DG 4OO1I 1KRSA 1N34L 1R9TH 2BA1A 2F3IA 4IFDJ 4C3JH 3G48A 4LF8Q 3KJOA 4NXMQ 4A3LH 2LXJA 5ELOA 4RG1A 1YIJA 1KIXA 1V1QA
chains in the Genus database with same CATH superfamily
3GTLB 3GD7A 4DR7Q 4RWSC 4DV4L 3I4MB 4PMBA 1Y1VB 5M5XH 4R8NA 4XQQA 3OPOA 4DK1A 5EBDA 1K28A 3FPUB 3J81c 4ME3A 3PV0A 4WRDA 2JXMB 4LUVA 1JR0D 2WV6D 4GNXA 1VS0A 3OSOA 2O4XA 3QJYA 1O7LA 2B2TA 4YCWA 4G7ZC 2L0CA 3NBHB 2A6ED 3TEHB 1C9OA 4DUZQ 3LX0A 3HKZB 4POGA 4EGVA 1YNXA 2ZTEA 3E9HA 4IUQA 4RGOS 1VF7A 1NR2A 1HNXL 3FRPB 5LMNW 3UDGA 4L5RC 4LF7Q 4KY7A 4UDUC 4QQBX 3C2PA 2NTSA 1AH9A 4LF8L 3LWUA 1ASYA 3A54A 1WTRA 2NYZD 2RDFA 1I3QB 1JE5A 2QILA 3K81C 1ONLA 2E2JH 1EZ6A 2UXDL 1EQTA 5CMDA 2JA7G 4DAVA 4XYOA 1WFQA 1DCZA 1XNRQ 4A3EG 4C3JB 3PO2B 3H15A 3C3LA 2E2IB 1GKHA 2B2UA 5K36G 1EU3A 3PMFA 2L4NA 3CCEA 4DK0A 1CT1D 1CSPA 2R7ZH 4PNYA 1G291 1UAPA 5BR8Q 3CHBD 3UI2A 1X3EA 1JORA 4GKKQ 1TS2A 2PMZE 2NVXB 1DGSA 3F2CA 2PW7A 2K50A 1NSNS 1GUOA 3MWYW 4TSSA 3P7JA 2WB1E 3KJPA 3CW2C 1TWGB 4NDXA 1SDFA 1KDCA 1Y1WH 5F2DA 1BR9A 3EROA 4DV5L 1FVIA 3S1NH 3KBXA 2K5VA 5JVG3 4R4OA 4GN4B 4KY5A 5M3MB 4AYBG 1AZQA 1IKMA 4A3DH 1FNWA 1EIYB 2YTYA 4XYQA 2UXCQ 3VDYA 1E3PA 2O5IC 2SNSA 2EZVA 4FXGC 3S9WA 2F3WA 1RTNA 1SROA 4B3MQ 2EOTA 2PZWA 2XN9C 1IYUA 4KTAA 1OO9B 1VQ9A 4BXXH 1DOLA 2PW5A 4JV5Q 2R7FA 3TQYA 1O78A 3GP7A 3HP3A 3HOXG 1Q81C 4DAYB 2UXBQ 2EYLA 5ELFA 3E5SA 4CDEC 1ICWA 1RCVD 4OO1G 3EFXD 2H1EA 4HIDA 1UWVA 5C3EH 4BA1I 2FINB 1G2TA 2AHOB 2DUDA 3HKZG 3V2TA 3HOWB 1VQDA 1SFOH 3VYSA 4A93G 1MI2A 2ZJQA 4JI1Q 5GAGC 2NVXH 1JICA 4DFAA 2KHIA 3OW7A 1FR3A 2L15A 1YEZA 4DUYQ 2BOSA 3UE0A 1U5KA 1CKOA 2PNHA 1F2MA 3Q6SA 1BNZA 1F2YA 4OWTB 4JI3Q 2SEBD 4N9TA 4JI1L 1HNZL 4QUCA 3VR3A 4QCLA 5IODA 2F4VQ 4A3FG 1RL2A 3T13A 2F0UA 4PQXA 2XRQD 4PZ7A 4X3SA 2HCCA 4DV2L 3GTQH 1PTOC 1H95A 1I50B 2SOBA 1SYCA 5DM73 5BN5A 4BS9A 2J4XA 2ZM6Q 4O42A 4ZKBB 1QJOA 1T9HA 2JSOA 5IYBH 5IGEA 5HURA 1PV4A 5A2QE 2VNUD 2OT2A 3S16B 5FLMH 1M90C 4UP7A 4FF1A 1IL2A 1D1KA 4KKSA 2F0PA 1PH4A 2XWBB 3A56A 1JB7A 1IZ6A 3HOUG 3CF5A 4KHVA 2B8FA 3SXHA 1CTMA 4J6HA 2ES2A 5ELBA 4R4IA 1PH7A 4RAUC 1VQLA 1I94Q 4HCEA 4C1NI 1T5EA 4RFBA 1STAA 3HOYH 4F7XA 2B39A 1EY4A 1YITA 2R92H 4HJAA 4DUZL 2ZTCA 1K3BC 2D0PA 4MN3A 2NZOA 3OTOL 2JA6B 5C4XG 4HR7B 2A6HD 2UU9L 4A3JB 3QG1A 3ER0A 3UDIA 2Z8LA 4DR7L 1KNEA 5IT9c 2A6EC 4FNFA 1LT3D 1ILPA 2NZHA 3PIP3 5ISRA 4RGNA 1DZ1A 1E2WA 2E2JB 3K57A 4LF4Q 4DV4Q 2D5DA 2DNEA 1Y8PB 3PF4A 2JA6G 4HSVA 4KY6A 4K8JA 2PZUA 2V4DA 2PI2A 1A3VA 1LTID 1XMQL 4N8X1 1BVSA 3I91A 2B63B 3ND9A 4B3SL 5TSSA 2RCFA 2CH4A 1M1KC 3NPPA 4Y7NB 2HUGA 3HOWG 2KUMA 1PYWD 4YY3L 4DR4Q 5J3BA 2MJ8A 4DR1L 3T16A 3H3VC 2Q8IB 2RKSA 2IJ0A 4ID6A 4RA8A 5J1ZA 1VQ8A 4IUPA 5DLQE 2ZTDA 1XX8A 1GUSA 3MFGA 3J7YW 3PUVA 3MVVA 1WD1A 3PUXA 5CV6A 3A5UA 4DV5Q 3E3XA 3MFYA 1K8AC 1OXXK 1SNOA 1CZWA 4A3FB 3BZCA 2CW0C 1DD2A 4Y7NH 1E1TA 3A8JE 4F87A 2JK8A 1UEBA 1I4XA 4ABNA 1HTLD 3DWQA 3FEWX 4L8JA 1OTCA 3BS1A 5M3FB 4KHPL 1YNNC 4JI6L 3GTKH 1UUPA 2KVMA 3B6YA 1Z47A 1HZAA 2V1CC 1IBKQ 3T1YQ 1GUTA 3D0FA 1EQVA 4BY1G 4BBRB 1BF4A 1HRJA 1HQMC 2HDMA 4YHHQ 2I5HA 1RD9D 3DUZA 1EYGA 5A35A 4FF2A 1CZGA 2R93G 5GADC 3GTKB 3M3YB 4A76A 3E0JA 2BA0A 2D9UA 2HDLA 1YVCA 2YYZA 4A3IH 5FO7B 2IHEA 2OF1A 4RKBA 3TMEA 2KCMA 4DV0Q 1MIUA 1PTOD 3S1RB 2EY6A 2HQEA 5FLXc 5HGQA 2F0EA 4P71A 1VQ4A 4Q5VA 3J81j 1A3TA 1XMOQ 4LUZA 4LMQD 3FKIH 3S14H 1IBML 3STBD 1HNZQ 3GO5A 1SSOA 2QA4A 2EJGC 3D6WA 3CC4A 1STNA 1KTKA 2K75A 1QNUA 3D4WA 1Q1EA 4IOAA 1EWCA 2DNCA 1Q90A 2HHHL 3J81E 3I73A 4OEMB 3CCQA 4IPHA 1I50H 2VL6A 1A3UA 2J0TD 4JYAQ 1RODA 3OHXC 3FP9A 3TREA 1GUNA 1LTGD 1SNQA 1YNND 3GTGB 5J39A 1PZKD 3ONAB 1C7YA 4AQYL 1K83B 1C48A 1QUQB 1EIFA 5I2YA 5C4JB 1EZ8A 2A69D 3Q8DA 4EQNA 3NBIA 2VQFL 2UUCL 1G91A 2CHBD 1ZXTA 2B2UC 3H0GH 4Y52H 5D65A 2CW0D 4BBSB 1D5ZC 1I6VC 1VMCA 3D6CA 1EIHA 3CCMA 4UP9A 4IFDH 1HXYD 1E7ZA 2VUMB 4QJFA 1L1OA 2F0VA 2FMCA 1EU4A 1PVOA 4IUVA 3CQZH 3AU7A 2AUKA 4DR3Q 4R4QA 1BCPC 1B1ZA 2CKZB 4JI2L 5G3LD 1FNUA 3HZXA 3CCLA 4KN7C 4BBSG 2R93B 4AIMA 4A3DG 2IPKD 1KRSA 2B2WC 1N34L 1R9TH 5KRUA 3MTSA 3G48A 4QB4A 4A3LH 1BCPF 4RG1A 4C3HB 5E4XA 1V1QA 3EQLC 4LF5Q 3UDXA 3CP0A 2R7ZB 3BVGA 4OGQC 3QIAA 1N8RC 1XXGA 1XJVA 4BBRG 1J9OA 2XGTA 4BWGB 1D5XC 1DONA 1KQSA 1HUMA 2NWGA 3A55A 1IYVA 3HOXH 1CQFA 1CK1A 2ICIA 3I90A 1VF5C 2PPBC 3WOEA 3G6JB 3ERSX 4P73A 4LF4L 5FJ8H 2RSNA 1PH8A 5C4HA 3N6RA 1TXYA 2K05A 2UXDQ 4HCSA 1BO0A 3U4VA 5ELNA 5DEHA 3HOZG 1KDAA 5C0XH 5IOCA 1GUGA 4L63B 4C2MH 4HMIA 5H1SE 1BBXC 3U58A 1ZKOA 1H9SA 4A3KH 4ODGA 4CJ2C 2IL8A 4UPAA 1FD7D 1MSHA 3HG9A 1HR0Q 1CKNA 3HS0C 1QVCA 4DR5L 3S16H 3M4OH 4U673 3F2BA 4N8FA 1Q82C 1PH6A 4G4KA 2K1BA 3QWNA 3TP6A 1NE3A 1A8VA 2KCCA 1G51A 4G7OC 1GUWA 3C46A 2B63G 1SE8A 4NXNQ 4DK3C 1STHA 2ALYB 5G3LF 3KDFB 3PIPA 4KJNA 4DR5Q 3I4MG 3O13A 4POFA 2L12A 5L37A 3KLSX 4HEDA 1JOKA 1A0IA 5EQ0A 1F77A 3SE0A 5E1FA 5IWAQ 2ASBA 4A3BH 5CV5A 1ENCA 4K5VA 1I4RA 1O7ZA 2Q2IA 3J7A5 3P1HA 1G6PA 1X3PA 3R93A 4DV7Q 3MXUA 5BN3A 3KF8A 4B3TQ 1KAAA 3WDNA 2PQAB 3J80L 3K6OA 2FHTA 1I4HA 4JC0A 3J81i 2LMCB 3D4DA 4C3JG 2VUMH 1LV9A 2IX0A 4HAEA 4LJZC 1EWHA 4C3HG 3PUWA 4LF5L 2K33A 2HQLA 1STYA 4OX9L 2B2VC 3S1QH 1X65A 1CKMA 4AYBB 2WAQG 1UE6A 4DK6C 3K59A 3AB9A 4GS3A 4JI2Q 1QILA 1Q1BA 2RBMA 4CKCA 2OQKA 1J6QA 3CAMA 1N32Q 4K2LA 3SGIA 4X66Q 1HFGA 3NP8A 5LL6X 2EY5A 1HR0L 2VW9A 3QO2A 1I6HH 2Z4IA 1ET6A 3BZKA 3U9SA 2I0QA 1B2TA 4LFAQ 4GOPA 1Q7YC 1EY6A 1QG7A 2EE1A 4MNOA 4A3GB 2Y0SB 3DLLA 3OMGA 4CHTB 1ILQA 2WFWA 4FO2A 2PI2E 4RGMA 5C4JH 2YU9B 1E1OA 2HIXA 5I6WA 1BUVT 3H6MA 4GZYC 1K83H 3T4AC 2K5QA 2BH8A 3I4NB 1ASZA 3HOVH 1SE2A 4JBJA 4CKBA 2E2HH 5GROA 1QUQA 1L1OC 4JI7L 5ELDA 1LTBD 4F88A 1S3OA 1CA5A 2M2LA 1HCZA 4QL5A 4OELB 4AYBE 3I4NG 1XWEA 1STBA 5I2XA 2VB3X 1O80A 1TS4A 1V43A 1I4PA 2AWNA 2K52A 3ZYYX 2Q8RE 5M5WB 2KECA 3ULPA 1QNKA 1EOTA 1GHJA 3SHLA 2LSSA 2AQ1B 2LFNA 1Y1WB 1Y69U 1N33L 2KENA 4KKTA 2L11A 2RF4A 2D62A 1D1IA 2ZJRA 4A93H 2Z6KA 3S2HB 3MAQA 4APVA 1WCMH 4EVOA 3RZOB 2EXDA 3CRLC 4UY8C 3S1MH 4A3MH 2F0NA 1D5MC 1G6ZA 3PO3H 3J7AV 2VQEL 2VQFQ 1IBMQ 1TY0A 1W6KA 2MPMA 4HJ8A 4NP5A 3MZ5A 4X3TA 5ELEA 1XMOL 4JI5Q 1G2SA 5KNBA 5IY0A 1VDZA 1EL0A 1WTQA 2MNAA 3FKIB 4C1NK 4A3FH 1TQOA 1L0YB 4AH6A 3TBIB 2RHSB 3H09A 1F2ZA 1VQCA 2HHHQ 1LT4D 4KHPQ 3T1HL 2Q2TA 4KD4A 3PIOA 1QCBD 4JOIC 1AE3A 4ZKCB 1GM5A 4X65Q 1IBKL 3R8BA 3M3YH 4K8IA 2ZT9C 3F1ZA 4CKEA 2GN5A 2K01A 1SLJA 4IOCA 5C44H 3GTMB 4YCVA 1EY7A 2E2DC 4A3JG 5LHY1 3FVQA 1F9SA 3GTJB 4OX9Q 2F0GA 3GTOH 3RN5A 1NNXA 1AP0A 3W1GA 2OCEA 1WCMB 2CQOA 1B9NA 1XNQQ 1IXRA 2JJQA 1CA6A 1SNCA 4BY1B 4OWWB 4LF9Q 3W5OA 2R92G 2QW7A 5IGBA 1OXSC 2EXZA 4GLVB 5FKAC 1WYDA 1R4PB 4X65L 2NN6G 4NW2A 4B3TL 3GV3A 1CUKA 4FVMA 3TP5A 2MFIA 2N55A 1ENFA 4ZUJA 4DPGA 3BYYB 4YWKA 3MEHA 1E22A 1PFSA 2R3ZA 1UE1A 3HFZB 3OYYA 4X6AH 1MSGA 1TIID 2YV5A 3URYA 1YJ9A 4KV6A 1W3SA 2F0DA 1YZ6A 4XT1B 1J8IA 3ND8A 2JA6H 2C9OA 4DV1Q 3K5MA 2PNRC 2E2IH 1JWUD 3QR8A 2NUCA 2WP8J 1VQ7A 4LFBQ 2ID0A 3NEMA 4DV2Q 1SNDA 2UUAQ 2GA4B 5GQOA 1II3A 2QCPX 2G9HD 3RLFA 1VQPA 1GOZA 5E3FA 4F8MA 4P72A 2N88A 1WTHA 4J8QA 5C4XB 1JMCA 3S17B 3K5NA 3KLRA 3WOFA 3EJIA 1VQBA 5C5LA 2X6GA 2K5NA 5KNDA 3SVMA 3HOYB 4X3UA 2CFMA 1M4VA 4OWXB 4DU9A 4JI0L 2YTXA 2Z9HA 4YIJA 1C0AA 2BH2A 1JQYD 3OIPA 5JEAH 2IX3A 3CRKC 2Q8TA 4LFAL 4B08A 3DHQA 4GOPB 4A3GH 1P16A 1I6HB 5M5YB 2Y0SE 1SYDA 3C1FA 2NN6I 5IYCG 1WTPA 3NTHA 3RR5A 1HHVA 2ZXRA 4QIWB 4QIWE 4KMUC 3A74A 2JA8G 3EA6A 1QVFA 1DM0B 1PRTC 1PYBA 1DYQA 1T5XD 1OXTA 2IX1A 3V05A 3J7ZC 2RQXA 1NR4A 3VR2A 4BY7B 4C3IH 3HOZH 5C0XG 4HTHA 2ATWA 2O2LD 3EBEA 3NSWA 1MBYA 2ICEC 3RLNA 1SRUA 2PQEA 4BY1H 2B2YA 5IT9L 1W6JA 3VA5A 5GAHC 2ZXOA 5EPLA 2OQ0A 3DEPA 3KUPA 4QMGA 4PG3A 4BY7G 2EYJA 2PYKA 3DEOA 4M1UB 5IWAL 2NVTB 3KLWA 3SK6A 3JAMi 3OIQA 4JG2A 2PCFB 5FLXE 3K7AB 5JVH3 1TWHB 3BU2A 2MO1A 3CCRA 4OIKA 1EQQA 1X3QA 3NTIA 5IP9H 1XPOA 1SMYD 3ZJYC 1JOQA 2HIVA 2LS01 3H94A 5IGCA 4I7ZC 2NVYH 2WKCA 2F4VL 4GN5A 4JI4Q 1N36L 4RMFA 5M3FH 1I94L 1X9NA 1NMGA 3K5LA 5C4ZA 3GTLH 1LABA 1I3QH 1SJHD 4JI0Q 2RHQB 1KXLA 3S17H 2OEOA 3DWAA 4J15A 5KGUA 4DV6L 3C1EA 2AWOA 1RDPD 1ZYRD 3HOXB 4P75A 1H9RA 4E6IA 1WJJA 2CWAA 2I5LX 3I4OA 2DJFC 3EIVA 4BA2I 2F0TA 1PRTB 2F0IA 2C5CA 3SR1A 2F3IA 4CDDC 4C3JH 2F1MA 5ELOA 1YIJA 1KABA 1K9MC 3I55A 4I7AA 1LO5D 5E7NA 3OOCA 4IALA 1HTPA 4R4TA 2DN8A 4JW0A 3NQIA 3CMEA 1IBLQ 4BXXG 1HH2P 1M8AA 3RLOA 2XVSA 1AEXA 3H91A 4JCVE 1VQKA 3IAYA 2B2YC 3TRZA 1D7QA 3X3NA 1W2BA 4CJ1B 5DM63 4H7BA 3HKZE 2PQAA 2IW3A 1HPCA 1PXUA 2Q2HA 3K7AH 5JPNC 1X3FA 1NMFA 3F2UA 1S5CD 1B9MA 2O5JC 4LF9L 1STGA 5C3EG 3GTJH 4IUNA 1HZ9A 2SNMA 4DXGA 4BBSH 3SK8A 4PZ6A 4RCNA 5AJ3Q 1LTTD 1WD0A 4DAPA 4A3DB 3G4SA 1EY0A 3VYRA 1HZCA 3KK7A 4IUUA 2YTVA 4LFCQ 2F0SA 3NK9A 1YJNA 5FLXL 4JV5L 3GTGH 4DR1Q 2CH4W 4L5TA 3H3VI 1IW7D 3MXNA 4RH6A 1IBLL 4GLXA 4M8AA 1HA6A 4JI8Q 1QB5D 4EQOA 4DV1L 4HIOA 4DV0L 3KF6B 2UXBL 3F8TA 4DV6Q 1LTSD 1Q46A 4IUTA 5CORA 4UP8A 4N9PA 3TP7A 1XMQQ 2F0LA 2L55A 5EAYA 3VR5A 3DM1A 2R7DA 1YNJC 2E76C 3MA2B 4ZYSA 1LM0A 2Z0SA 5FJ8G 1B3QA 2BE5C 2A6HC 1ICFB 3L9AX 3JAMc 1BOSA 4A3EB 3V96A 4G7HC 3CC7A 2F52A 2NVQH 1Y14B 3ERQA 3BVMA 4K5XA 4L6TB 4FF3A 3HOUB 5DNFA 2P5ZX 2F0JA 1CI3M 2EY1A 4DV3L 3RN2A 4LNQA 4CJ0B 1PTOF 2VQEQ 1D2BA 3PO3G 1RKNA 1MHWC 2CCZA 1BBUA 5C0XI 5IP7H 1PHJA 3BDOA 3P20A 3R3OA 2EYFA 1TWFH 2SDFA 2JA5H 1KLGD 3CCSA 2K32A 1JC7A 4DR3L 2MGSA 1ZEQX 2TSSA 3MXGA 4RHRA 1WTOA 1VQMA 3SEBA 4KKUA 2IT1A 5C3EB 3K80C 1VQFA 3T1YL 3M4PA 5C3XA 3JAML 4A3KB 5FK9C 5JJIA 4A3CH 4A93B 1PYSB 1X54A 5JAVA 1VQ6A 2ZJPA 2KEEA 1PH2A 1CFMA 3K7UC 4GKJL 1Q8IA 1H9SB 5C0XJ 4JBKA 1Y1VH 2A69C 2K5HA 3L3OC 3LGJA 2VB2X 3RD4A 3JAME 1Y1WG 4CDFC 4YHHL 1JT8A 4JOIA 5CR3A 4LF6Q 1STEA 2EYPA 1SR3A 2UUBQ 4KLKA 3VR6A 2RVLA 4K0KL 1FJGL 2UU9Q 3J81L 1S5FD 3RZDB 5LMNQ 2GVAA 5AJ3L 4QUFA 1BKBA 1PZJD 1UNSA 2Z4HA 2CWPA 3JC66 3I3CA 5ELCA 5IYDG 1KHIA 4FDBA 1HNXQ 2XNAC 2N8NA 1Z9FA 3S14B 2BCOA 2QKIC 2LXKA 1S72A 4K6LA 4LFBL 4HMJA 3FHWA 3S2HH 3NQTA 5CBAE 3AMUA 1UEAB 2C35B 4V0BA 3CQZB 3CCJA 1X56A 2M9VA 4C56C 2JA5B 2EIFA 3PF5A 2L1BA 4OIJA 3ICEA 5IGFA 1ET9A 2BE5D 1B8AA 1F2LA 2B29A 2QGQA 3J7AF 5K36H 4WJWA 1EWIA 3M4YA 4ALPA 1TWGH 5EPJA 4OO1H 2R7ZG 1YNJD 2VY3A 3CU7A 5C44B 1XYIA 1JJGA 2CVRA 3FMCA 3MXPA 4LFCL 4FXKC 3Q22A 1CSQA 1PLFA 1D6EC 1X6OA 2EYHA 2MO0A 1RTOA 2WAQB 2JA9A 4GLAC 1SNMA 3G6EA 3A7AB 3HOVG 2K03A 3DXJC 1EY9A 1L1OB 3I7FA 5NUCA 5CC4A 2OTJA 1MGSA 2A5HA 5JEAG 3NWTA 4TKOB 1QZGA 4A3GG 4S3SA 1N36Q 2AQ2B 1EOVA 2EYMA 1CHQD 1KNAA 5CYUA 2EVBA 1EIGA 1Y8OB 4JBWA 4K14A 2A68D 2LKVA 1FGBD 3G7LA 5E4WC 4JBMA 4NPSA 1TR5A 4KD3A 4L5QA 4NB3A 4DV3Q 2KA7A 3ULLA 1HJPA 1FYCA 4H13C 2K5WA 4LAAA 3PCOB 3T56B 1PH9A 2ZXPA 5IYBG 3PO3B 5D3DA 1K0RA 3GTPB 2AMCB 4HIMA 4DR6Q 3FKIG 2JEBI 4DUYL 4MHEA 4XTCS 4JVZA 1VQOA 5D3IB 4YY3Q 4DR4L 4B3RL 4YCUA 3I72A 2IY5B 1HZBA 2BDNA 2D0OA 1U4RA 1KL9A 1F9RA 5GAEC 1PZID 4BY7H 4HJ9A 4FXDA 2K14A 5LL6S 5M5YH 3KF6A 4L5SA 5EKKA 2PZTA 3GTPH 3I2ZA 3CKIB 2JN4A 4DAYA 1PMRA 5KEEA 5LMUQ 5IE8A 2B2TC 2KBNA 3CPFA 2HT1A 1AN8A 2DJGC 1FGUA 2EDGA 5IP9G 5C4XH 4JI4L 1H9KA 1JB3A 2WIIB 3F2DA 1YBYA 2K6AA 1VQ5A 1LT6D 5M3FG 2F0FA 4OONA 3D4RA 4A3BB 5EJWA 1V9PA 2IHFA 2XRSD 5I4DA 3N52A 2DGYA 1SXTA 1SMYC 3CD6A 1YHQA 1A6XA 1EQRA 4XDXA 3VYUA 4GOPC 2AUJD 2HD3A 2HCIA 1K8MA 4JI7Q 4EX5A 1N34Q 5FLMG 4DNIA 2QDLA 3A8KE 1I4GA 5I6YA 4X3KA 1NUCA 4NMZA 1TT2A 4B3ML 3H3VH 3HOUH 4RCOA 4IN3A 3M85A 2N49A 3AFQA 2Y0SG 1VCIA 4DNTB 4X64Q 1R9TB 1QVGA 1BXTA 2ZM6L 5KYIA 4JI8L 1K8GA 2F3VA 1SYEA 3U4ZA 3J80c 5I9PA 1KDBA 4ME5A 3AFPA 5DAUA 4X62Q 4LWCA 3G71A 4J1MA 2OTLA 2QF7A 3BJUA 3A7LA 3TSSA 1X55A 1FNVA 1NBWA 1ESFA 4JK1C 3FDTA 4JI3L 1TWCB 5KIXA 1SYGA 3NE5B 1QWYA 1S5DD 2Z6KC 1F9PA 4DXFA 1LTRD 4DN4M 3CC2A 1VQJA 3PSIA 4A3KG 1JWSD 4IPDA 2ENBA 1GVPA 1LT5D 4B9XA 2X69A 5EBCA 3HKSA 3GTQB 1B44D 4A4IA 1SE3A 3GDEA 5BR8L 4CBVA 4GKJQ 3STBC 1JE4A 1PA6A 4JPBW 4Q0FA 1PTOH 4A3IG 1TWAB 4ZCKA 2QDBA 2UUBL 2Z6BA 4LF6L 3R2IA 4KK7A 1AZPA 4XIGS 1VQGA 3LNNA 1PRTD 4KN4C 4IQZA 1S5BD 5HGTA 1NY4A 3K58A 3GTOB 1JJCB 4B3RQ 2R61A 1A15A 3S2DH 2JA7B 1LTLA 4NXML 1U0LA 3ULJA 1I4QA 1E0BA 4A3BG 3I8ZA 1B7YB 1XNQL 1IHZA 2MP1A 5IP7G 5EPKA 3NXWA 5CV4A 3ITPA 4NKLA 2JA5G 2WACA 2A73B 3CMAA 1U4LA 4GNXC 4OO1I 2NVYB 2F0MA 2BA1A 4U68A 3RUZA 2FJ2A 4XXEA 4IFDJ 1K0SA 4LF8Q 3KJOA 4FP5D 2LXJA 1KIXA 1N9WA 3KBGA 2F0KA 3DMUA 3LWEA 2NB0A 1KAWA 2QEJC 5J22A 1QZHA 4K6DA 3E0EA 2DY8A 3NWSA 4WORA 4HJ5A 2KQ3A 1YJWA 4A75A 3L0OA 1B50A 2WB1B 3H0GG 1TS5A 1Q12A 4A3CG 1WI5A 4I65A 3R2TA 4C2MB 1AFPA 3GTMH 1A62A 1U9RA 1Q8KA 5C3WA 1TWHH 1Z6HA 4P2CB 1WOCA 1Y1VG 3S1NB 3L2PA 3IL8A 3AEVA 2I5MX 2LY7A 2DY7A 1VQAA 1PRTF 1XTDA 3I4MH 4MIUA 1VQNA 5AFWA 2JQOA 4IFDI 4MTNA 2N3SA 3NHHA 3T51B 1RHPA 1KRTA 1YHBA 3M7GA 5JOBA 1PFNA 1D8LA 4A3IB 4QY7A 3K8AA 3EN2A 1V1OA 1LLRD 2RCNA 1DOKA 2I46A 4ZUIA 5JJLA 2XSCA 2F03A 2A74C 3HRZC 3QOLA 2VXWA 4H02A 1R4QB 3BG3A 3I4NH 1YI2A 1OXVA 1XTCD 2VUMG 2XWJB 2E5LQ 1A2UA 1QOHA 3BVZA 2MHVA 1BCPB 4C3HH 5M3MH 1HR0W 1J5EQ 4O1NA 2XIWA 1G8ZD 1VQHA 2K04A 1C4QA 1XPRA 2KEDA 2WAQE 1SNPA 4YWMA 4G57A 1EY8A 1GD7A 2H5XA 1IL8A 4WJ4A 5A2QL 4IFDG 3BDLA 4ZK9B 4JI5L 3PO2H 5JJKA 3MHBA 2K7VA 2CQAA 3T1HQ 1YHAA 3DWPA 3E9IA 1KD1C 1I5FA 1EEFD 4KI0A 1EFID 3UDFA 1P8LA 1GHKA 3OWFA 4FF4A 4XT3B 1A2TA 3PIO3 3AQQA 1ESRA 2JYOA 5IT9E 1SN8A 1SBBB 4PV1C 4X66L 2Z1CA 4A3LG 4PMWA 1JWMD 1K3RA 1FL0A 1TVXA 4K5WA 1ML0D 4LK1C 2MQHA 1SYBA 2RSOA 1PH5A 1U4PA 3M9BA 3VYTA 4BBRH 2YU9H 5IIFA 3M4OB 1RJTA 4H44C 1FJGQ 2B2VA 3TP8A 2VZAA 1F9QA 5HY6A 4R8IA 1TWFB 4IO9A 1AE2A 4B9WA 4A3MB 4OHJA 5KNCA 2WKDA 3RZOH 4K2KA 4HIKA 3TS0A 4PMCA 1HNWL 3DM3A 4EQPA 2A8VA 1B4OA 2N78A 5C44G 1TKWB 5EKLA 1N33Q 4HJ7A 3I4LA 2B3GA 3P75A 1PTOB 3S1RH 2K4KA 1Q86C 1IYJB 4MZ9A 3S1QB 1HUNA 3CPWA 5JPMC 1U4MA 4MTKA 1EFWA 4DR2L 2R92B 1WTVA 3OMCA 3KDFA 1NAPA 2K28A 3U9OA 1DXMA 4RHSA 2JA7H 4QF4A 3RMHA 4ZQ3A 4WJ3M 1NJIC 1UE7A 3S2DB 3IFDA 2F0HA 3TN2A 1V1PA 4EQ5A 2VS1A 3D3RA 4A3EH 1LACA 1SJED 4RKLA 1SFOB 2GVBA 2PO4A 2M00A 4JI6Q 2J7ZA 1HNWQ 3KOJA 5T1IA 5EGTA 2TMPA 3TZDA 2L5TA 3M7NA 2B63H 1MJCA 4TVAB 1HA5A 5CV8A 1NCVA 1TWAH 5JJZA 3D31A 1B70B 2RA4A 3U50C 1EY5A 5JEAJ 3CCUA 1KLUD 1BBWA 4UHVA 2F4IA 3K0YA 2EY2A 1A63A 2A19A 3W1BA 4IPGA 2JEAI 5IYDH 3L7ZC 5M5WH 2EPBA 3A8IE 4QGUA 4A3JH 1RIPA 4X64L 3PGZA 4O0AA 1Y8NB 2EQSA 2EJFC 3QOJA 1CHPD 3T53B 3HOWH 1WTXA 2NVQB 2H4OA 1DOMA 4GKKL 5C5MA 1C8CA 2KHJA 1K73C 4GNXB 3GV6A 1SAPA 2Q2UA 3NTKA 3S15H 1DJRD 1KC8C 4AQYQ 1S5ED 2NN6H 3FPPA 4O2DA 2F0OA 3W2DA 2KCNA 3NBHA 1GO3E 4C3IG 3VR4A 1XPUA 4R4CA 5K5PA 3E6ZX 4V190 1PFBA 1JJ2A 1WCMG 1J5EL 1IKLA 3HOVB 4A3MG 4UAIA 3PQIA 4IPCA 3PUZA 2E8GA 4IJLA 2BDOA 1JOOA 1N32L 1EYDA 4XQNA 4NXNL 4YWLA 1Q3LA 4CGYB 3EVQA 4DAMA 4ULLA 4X62L 1WTWA 3GQBA 5CV9A 1X3GA 5IGDA 3KYHC 1LYLA 1K8OA 2X6LA 1ENAA 2F0WA 4DGZA 1VQIA 4WFN3 3Q0AA 1ZYRC 3IFTA 3J80i 3W3AA 1VQEA 2RDGA 5T1GA 4IJHA 1Z7TA 1X32A 3MEFA 2IWHA 2NVTH 4Z9CB 1E2VA 5CGKA 1NTGA 3NENA 4DV7L 3HOZB 2B8GA 3BDCA 3KF8B 3OWEB 2R93H 2RDHA 3A0JA 1O7YA 1MD2D 2F0QA 4IZ8A 2UUAL 1PDQA 5D14A 1HFNA 5KYLA 4JYAL 3K0XA 3M4QA 5FO8B 1XNRL 3K5OA 3S24A 1PH3A 2WINB 4DR2Q 1O7IA 3TZUA 2UXCL 4ILWA 1L0WA 4P74A 1AW7A 2A68C 1GXDC 1H9MA 1SMXA 2L9HA 2AKWB 3OW2A 4R1JA 3NUCA 4PZ8A 3WWVA 3BZDB 5CV7A 5EKIA 2FXQA 3TDQA 4TRDA 1SE4A 5COYA 3VA7A 3Q23A 3CXCA 4LF7L 3PUYA 5FO9B 1B53A 3S15B 4TQUS 1BDOA 2OWOA 2OXPA 3I56A 2JA8B 4DR6L 2FMMA 1OXUA 4C3IB 2E74C 2QEXA 1LTAD 3Q24A 3IRBA 4HN7A 1S40A 1BCPD 2JE6I 1BQQT 4DKAC 5I9OA 3HOYG 4DF7A 2AQ3B 1JCKB 4DA2A 4DNRB 3X3MA 1MKHA 1LUZA 4K0KQ 2E5LL 1PH1A 4FYDA 4R9WA 1CM9A 1MJEA 1E24A 2I07B 5FOBB 3KLSA 1SYFA 2NBFA 1EYAA 1CQVA 3SK4A 3TS2A 1EYCA 5IGGA 1L0XB 3NELA 2E75C 4ZAIA 1V8QA 1S4ZA 5CBEE 2NZ1D 4OL7A 2KOLA 2XTIA 4KJOA 3J80E 3MC0B 1GJXA 4H0LC 3AYHB 2UUCQ 4IURA 4GN3B 3SDZA 5M9OA 1TWCH 2G5DA 2G9DA 1TU2B 1V1PB 1UE5A 5IYCH 1VMPA 2KCTA 3OTOQ 5M3MG 3RZDH 1PFMA 5BN4A 2PMZB 3UE1A 1TS3A 4LW1A 1E2ZA 3HGBA 1EUJA 3CCVA 4ZLTF 2JA8H 3S1MB 1H9JA 3D8GA 4HSPA 5C6AA 2E2HB 3QB3A 3IKJA 5LMNL 4LUOA 2B2WA 1SEBD 1L2FA 3MXNB 1QE6A 2A1AA 5M5XB 1B3AA 3PO2G 1EEID 2R6GA 1TY2A 4KHZA 3RNUA 4B3SQ 4ZRZA 3SK5A 5LMUL 3HEJA 1CKNB 3A5ZB 2D2CC 2K5DA 4XQJA 4CDCC 2EYOA 3KFUA 2NTTA 2KJXA 2FFKB 3I70A 1RF2D 2EJMA 2MUYA 1WVLA 2WB1G 3H0GB 3BYTB 4OXPA 1HQRD 1IW7C 2KHSA 4RGTA 4NXMQ 2JP1A
chains in the Genus database with same CATH topology
3I55A 3GD7A 1N9WA 4DR7Q 4LF5Q 3UDXA 5E7NA 4DV4L 1KAWA 3CP0A 5M5XH 4R4TA 1QZHA 3E0EA 4HJ5A 3CMEA 1IBLQ 1N8RC 4BXXG 1HH2P 1YJWA 3J81c 3RLOA 1XJVA 4ME3A 4A75A 3PV0A 4BBRG 3L0OA 4JCVE 4LUVA 1VQKA 3H0GG 2XGTA 4GNXA 1VS0A 3TRZA 1Q12A 1D7QA 4A3CG 1W2BA 1KQSA 1WI5A 4YCWA 3HKZE 3HOXH 3NBHB 2PQAA 3GTMH 1A62A 3TEHB 1C9OA 1Q8KA 3ERSX 4DUZQ 1TWHH 2Q2HA 3K7AH 1WOCA 4P73A 1X3FA 1NMFA 5FJ8H 1Y1VG 4LF4L 4LF9L 3L2PA 4POGA 1YNXA 1PH8A 3AEVA 5C3EG 2ZTEA 2I5MX 3E9HA 1TXYA 1VQAA 3GTJH 2UXDQ 1HNXL 1HZ9A 1XTDA 5LMNW 3UDGA 4L5RC 4LF7Q 3I4MH 4BBSH 4PZ6A 1VQNA 4IFDI 2JQOA 5AJ3Q 3U4VA 4QQBX 4MTNA 2N3SA 5ELNA 3G4SA 1AH9A 1KRTA 3HOZG 4LF8L 1YHBA 1HZCA 1ASYA 2YTVA 1D8LA 4LFCQ 4QY7A 3K8AA 3EN2A 1JE5A 4C2MH 1YJNA 4JV5L 2RCNA 5H1SE 4DR1Q 3K81C 3GTGH 4L5TA 3U58A 3H3VI 2E2JH 4A3KH 1IBLL 4GLXA 2UXDL 5JJLA 4UPAA 4JI8Q 4DV1L 2JA7G 4HIOA 4DV0L 3KF6B 1HR0Q 1CKNA 3F8TA 4DV6Q 1WFQA 2UXBL 1XNRQ 4DR5L 1Q46A 1QVCA 3S16H 3M4OH 4H02A 3I4NH 3F2BA 4A3EG 1OXVA 4UP8A 1YI2A 2VUMG 2E5LQ 3H15A 1Q82C 1PH6A 1XMQQ 1GKHA 5EAYA 1NE3A 5K36G 1A8VA 4C3HH 2R7DA 5M3MH 1HR0W 1J5EQ 1G51A 3CCEA 1VQHA 1CSPA 1LM0A 2Z0SA 5FJ8G 2B63G 1XPRA 2R7ZH 1SE8A 2WAQE 4YWMA 1G291 5BR8Q 4NXNQ 4DK3C 2ALYB 1GD7A 1X3EA 3KDFB 3PIPA 3JAMc 4GKKQ 4DR5Q 2H5XA 3I4MG 2PMZE 4POFA 3CC7A 2F52A 1DGSA 3F2CA 4WJ4A 2NVQH 1Y14B 2K50A 4IFDG 1A0IA 4JI5L 3PO2H 5JJKA 5IWAQ 2WB1E 4DV3L 3KJPA 3CW2C 3RN2A 4LNQA 3T1HQ 2VQEQ 1YHAA 2ASBA 4A3BH 1Y1WH 3PO3G 3E9IA 1KD1C 1I5FA 4KI0A 2CCZA 1BBUA 5C0XI 5IP7H 1FVIA 3UDFA 4DV5L 1P8LA 2K5VA 2Q2IA 3S1NH 1PHJA 3J7A5 1TWFH 4R4OA 4GN4B 1G6PA 3AQQA 4DV7Q 4AYBG 4B3TQ 2JA5H 3CCSA 2PQAB 1SN8A 4A3DH 1EIYB 2YTYA 2UXCQ 3VDYA 4JC0A 4DR3L 1E3PA 3J81i 4X66L 2VUMH 4A3LG 4PMWA 2IX0A 1VQMA 1K3RA 1FL0A 1SROA 4B3MQ 2IT1A 2MQHA 3PUWA 4LF5L 3K80C 2HQLA 1PH5A 1VQFA 4OX9L 3T1YL 1VQ9A 3M4PA 3M9BA 4BXXH 3S1QH 1X65A 1CKMA 4DK6C 2WAQG 1UE6A 4JV5Q 4BBRH 2YU9H 2R7FA 4GS3A 4JI2Q 1N33Q 5JJIA 1FJGQ 1Q1BA 3TQYA 4A3CH 2OQKA 1J6QA 2VZAA 1PYSB 3CAMA 3HOXG 1N32Q 5HY6A 3SGIA 4X66Q 1X54A 1Q81C 4IO9A 4DAYB 1VQ6A 1AE2A 2ZJPA 1PH2A 1HR0L 2VW9A 3K7UC 1I6HH 4GKJL 2UXBQ 3BZKA 2I0QA 5C0XJ 3RZOH 4HIKA 4JBKA 3TS0A 4LFAQ 4GOPA 1Q7YC 1HNWL 3DM3A 4MNOA 1Y1VH 2K5HA 3DLLA 3LGJA 4OO1G 2A8VA 4HIDA 1UWVA 1Y1WG 5C3EH 4YHHL 1JT8A 5C44G 2N78A 4BA1I 2WFWA 4JOIA 4LF6Q 2UUBQ 1SR3A 2AHOB 2DUDA 3HKZG 4HJ7A 2PI2E 1VQDA 2B3GA 4KLKA 1SFOH 4K0KL 4A93G 1FJGL 2UU9Q 3S1RH 2K4KA 2ZJQA 5C4JH 1E1OA 5LMNQ 2HIXA 1Q86C 1IYJB 2GVAA 4JI1Q 5AJ3L 4MZ9A 1K83H 1BKBA 5GAGC 2NVXH 3CPWA 2BH8A 2CWPA 3JC66 5IYDG 2KHIA 4DR2L 1EFWA 1ASZA 3HOVH 1KHIA 4FDBA 2L15A 1YEZA 4DUYQ 1HNXQ 2N8NA 1Z9FA 3KDFA 1U5KA 4JBJA 3UE0A 1CKOA 2LXKA 2PNHA 2E2HH 1S72A 5GROA 1QUQA 1L1OC 4JI7L 4LFBL 3FHWA 3S2HH 4OWTB 4JI3Q 1S3OA 2JA7H 2C35B 1NJIC 4WJ3M 1UE7A 4JI1L 1HNZL 4QL5A 2F4VQ 4EQ5A 1X56A 3CCJA 2VS1A 1RL2A 4AYBE 4A3FG 3I4NG 4A3EH 2EIFA 4PZ7A 3PF5A 1V43A 2AWNA 2GVBA 2K52A 4DV2L 3GTQH 3ICEA 4JI6Q 1B8AA 2B29A 2QGQA 3ULPA 3KOJA 1HNWQ 1H95A 1EWIA 4ALPA 1TWGH 2LSSA 3M7NA 2B63H 1MJCA 2ZM6Q 4TVAB 2R7ZG 2VY3A 1N33L 2KENA 1T9HA 1TWAH 5IYBH 1JJGA 1PV4A 3D31A 2RF4A 2D62A 1B70B 2VNUD 2ZJRA 4A93H 5FLMH 3U50C 4LFCL 2Z6KA 5JEAJ 1CSQA 1X6OA 4UP7A 4APVA 1BBWA 3CCUA 2MO0A 1M90C 1IL2A 1WCMH 1A63A 2A19A 2JA9A 2EXDA 4GLAC 4IPGA 3W1BA 4UY8C 2JEAI 3S1MH 5IYDH 3L7ZC 4A3MH 3G6EA 3HOVG 1PH4A 3PO3H 3HOUG 5M5WH 1IZ6A 1JB7A 2VQEL 2VQFQ 1IBMQ 3CF5A 4QGUA 4A3JH 1RIPA 4X64L 4HJ8A 1L1OB 3I7FA 2OTJA 3PGZA 4O0AA 2ES2A 2EQSA 5JEAG 1XMOL 4JI5Q 4R4IA 1QZGA 3HOWH 5IY0A 1PH7A 4A3GG 1VQLA 1N36Q 1I94Q 1EOVA 4GKKL 2MNAA 4A3FH 3HOYH 2KHJA 1K73C 4JBWA 1YITA 4GNXB 4AH6A 2R92H 2RHSB 2Q2UA 4HJAA 4DUZL 2ZTCA 3S15H 1VQCA 2D0PA 4NPSA 2HHHQ 4JBMA 4KHPQ 4NB3A 4L5QA 3T1HL 1KC8C 4DV3Q 2Q2TA 2NZOA 3ULLA 3OTOL 1HJPA 3PIOA 4AQYQ 5C4XG 2UU9L 4JOIC 1AE3A 1GM5A 3PCOB 3ER0A 4O2DA 4X65Q 3UDIA 1IBKL 1PH9A 5IYBG 4DR7L 1K0RA 5IT9c 1GO3E 2AMCB 4HIMA 3M3YH 4DR6Q 2NZHA 3FKIG 2JEBI 1XPUA 4DUYL 4R4CA 4XTCS 1VQOA 4YY3Q 4DR4L 3F1ZA 4B3RL 4LF4Q 1JJ2A 1WCMG 4DV4Q 1J5EL 4YCUA 2IY5B 3PF4A 4A3MG 2JA6G 4IPCA 1HZBA 2GN5A 3PUZA 2E8GA 1SLJA 4IJLA 2D0OA 4IOCA 1KL9A 2PI2A 5GAEC 4YCVA 5C44H 1XMQL 1N32L 4A3JG 1BVSA 4NXNL 4B3SL 4YWLA 4BY7H 4HJ9A 1M1KC 4DAMA 4X62L 4OX9Q 2K14A 5M5YH 3KF6A 4L5SA 3HOWG 1X3GA 3GTOH 3KYHC 1LYLA 3RN5A 3GTPH 3W1GA 2OCEA 3I2ZA 2CQOA 4YY3L 1XNQQ 1IXRA 4DR4Q 5J3BA 2JJQA 1VQIA 5LMUQ 4DR1L 5IE8A 4OWWB 2KBNA 3CPFA 4LF9Q 3W5OA 2HT1A 2R92G 1OXSC 1VQ8A 3J80i 4GLVB 5DLQE 1VQEA 1FGUA 1WYDA 4IJHA 5IP9G 2ZTDA 4X65L 2NN6G 3MEFA 5C4XH 4B3TL 4JI4L 2NVTH 3F2DA 1CUKA 1NTGA 3NENA 4DV7L 2R93H 1YBYA 3KF8B 3PUVA 1VQ5A 2MFIA 3A0JA 5M3FG 3PUXA 3A5UA 4DV5Q 1K8AC 4OONA 4DPGA 2UUAL 4YWKA 1OXXK 1V9PA 4JYAL 1K9MC 2IHFA 1E22A 1PFSA 3K0XA 1UE1A 3BZCA 3HFZB 3OYYA 4X6AH 3M4QA 4Y7NH 2DGYA 1YJ9A 2YV5A 3CD6A 1YHQA 1E1TA 1XNRL 1EQRA 1W3SA 3S24A 4GOPC 2JK8A 1YZ6A 1PH3A 4DR2Q 1O7IA 2UXCL 1UEBA 2JA6H 4DV1Q 1L0WA 4P74A 2E2IH 1OTCA 2WP8J 1VQ7A 4JI7Q 2ID0A 4LFBQ 3NEMA 4EX5A 1SMXA 4DV2Q 1N34Q 4KHPL 2AKWB 3OW2A 4R1JA 4JI6L 3GTKH 2UUAQ 5GQOA 3RLFA 5FLMG 3B6YA 1Z47A 1VQPA 4DNIA 1HZAA 2V1CC 4P72A 4PZ8A 3WWVA 1IBKQ 3T1YQ 1JMCA 2FXQA 1VQBA 3D0FA 2K5NA 2CFMA 4BY1G 4B3ML 3H3VH 3HOUH 3M85A 4OWXB 2N49A 3CXCA 3PUYA 2YTXA 3AFQA 4JI0L 4LF7L 1C0AA 2Y0SG 4YHHQ 1VCIA 2BH2A 4TQUS 2OWOA 2I5HA 4X64Q 3I56A 4DR6L 1OXUA 2QEXA 1QVGA 2ZM6L 1EYGA 4LFAL 3IRBA 4GOPB 4A3GH 1P16A 4JI8L 2Y0SE 1S40A 2R93G 5GADC 2NN6I 1K8GA 2JE6I 3U4ZA 4DKAC 5IYCG 3J80c 3HOYG 4A76A 3AFPA 2BA0A 1MKHA 1YVCA 2YYZA 4X62Q 4A3IH 1LUZA 4LWCA 3RR5A 3G71A 4K0KQ 2E5LL 2IHEA 1PH1A 4QIWE 2OTLA 3BJUA 3A74A 1E24A 1MJEA 2KCMA 4DV0Q 2JA8G 1MIUA 1X55A 1QVFA 1NBWA 5FLXc 1PYBA 5HGQA 4JI3L 4P71A 1OXTA 2IX1A 1VQ4A 3J81j 3TS2A 3J7ZC 1XMOQ 4LUZA 4C3IH 3FKIH 3HOZH 2Z6KC 5C0XG 3S14H 2ATWA 3EBEA 3NELA 1IBML 3RLNA 1SRUA 3STBD 1HNZQ 3GO5A 3CC2A 2QA4A 1VQJA 2XTIA 3CC4A 2K75A 4BY1H 3PSIA 4A3KG 1Q1EA 4IOAA 4IPDA 5GAHC 1GVPA 2OQ0A 2HHHL 3AYHB 2UUCQ 4PG3A 3HKSA 4GN3B 4BY7G 3CCQA 4A4IA 4IPHA 1I50H 2VL6A 1TWCH 3GDEA 5IWAL 4JYAQ 4B3RQ 3KLWA 3JAMi 5BR8L 4JG2A 4GKJQ 3STBC 3FP9A 3TREA 1UE5A 5IYCH 2KCTA 1PA6A 1C7YA 3OTOQ 4AQYL 5M3MG 4A3IG 1QUQB 1EIFA 3RZDH 3Q8DA 3BU2A 3UE1A 4LW1A 2UUBL 4LF6L 2MO1A 2VQFL 3CCRA 4XIGS 1VQGA 1EQQA 2UUCL 1XPOA 5IP9H 1EUJA 3H0GH 3ZJYC 3CCVA 2JA8H 2HIVA 4Y52H 2NVYH 2F4VL 4GN5A 5LMNL 4JI4Q 4LUOA 1N36L 1NY4A 1JJCB 4RMFA 5M3FH 1L2FA 3MXNB 4UP9A 3CCMA 2A1AA 1X9NA 1I94L 1NMGA 3S2DH 3GTLH 1E7ZA 3PO2G 1I3QH 4QJFA 1L1OA 1LTLA 2R6GA 1PVOA 4NXML 4JI0Q 1U0LA 2RHQB 3ULJA 1KXLA 3S17H 3CQZH 4A3BG 4KHZA 3RNUA 4J15A 4DR3Q 4R4QA 4B3SQ 4DV6L 1B7YB 5LMUL 1XNQL 2CKZB 1CKNB 2AWOA 3A5ZB 5IP7G 3CCLA 4JI2L 4P75A 3KFUA 4BBSG 1WJJA 2CWAA 2I5LX 3I4OA 2JA5G 3CMAA 3EIVA 4AIMA 2WB1G 4GNXC 4OXPA 4BA2I 4A3DG 4OO1I 1KRSA 1N34L 1R9TH 2BA1A 2F3IA 4IFDJ 4C3JH 3G48A 4LF8Q 3KJOA 4NXMQ 4A3LH 2LXJA 5ELOA 4RG1A 1YIJA 1KIXA 1V1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 A;  3GD7 A;  1N9W A;  4DR7 Q;  4LF5 Q;  3UDX A;  5E7N A;  4DV4 L;  1KAW A;  3CP0 A;  5M5X H;  4R4T A;  1QZH A;  3E0E A;  4HJ5 A;  3CME A;  1IBL Q;  1N8R C;  4BXX G;  1HH2 P;  1YJW A;  3J81 c;  3RLO A;  1XJV A;  4ME3 A;  4A75 A;  3PV0 A;  4BBR G;  3L0O A;  4JCV E;  4LUV A;  1VQK A;  3H0G G;  2XGT A;  4GNX A;  1VS0 A;  3TRZ A;  1Q12 A;  1D7Q A;  4A3C G;  1W2B A;  1KQS A;  1WI5 A;  4YCW A;  3HKZ E;  3HOX H;  3NBH B;  2PQA A;  3GTM H;  1A62 A;  3TEH B;  1C9O A;  1Q8K A;  3ERS X;  4DUZ Q;  1TWH H;  2Q2H A;  3K7A H;  1WOC A;  4P73 A;  1X3F A;  1NMF A;  5FJ8 H;  1Y1V G;  4LF4 L;  4LF9 L;  3L2P A;  4POG A;  1YNX A;  1PH8 A;  3AEV A;  5C3E G;  2ZTE A;  2I5M X;  3E9H A;  1TXY A;  1VQA A;  3GTJ H;  2UXD Q;  1HNX L;  1HZ9 A;  1XTD A;  5LMN W;  3UDG A;  4L5R C;  4LF7 Q;  3I4M H;  4BBS H;  4PZ6 A;  1VQN A;  4IFD I;  2JQO A;  5AJ3 Q;  3U4V A;  4QQB X;  4MTN A;  2N3S A;  5ELN A;  3G4S A;  1AH9 A;  1KRT A;  3HOZ G;  4LF8 L;  1YHB A;  1HZC A;  1ASY A;  2YTV A;  1D8L A;  4LFC Q;  4QY7 A;  3K8A A;  3EN2 A;  1JE5 A;  4C2M H;  1YJN A;  4JV5 L;  2RCN A;  5H1S E;  4DR1 Q;  3K81 C;  3GTG H;  4L5T A;  3U58 A;  3H3V I;  2E2J H;  4A3K H;  1IBL L;  4GLX A;  2UXD L;  5JJL A;  4UPA A;  4JI8 Q;  4DV1 L;  2JA7 G;  4HIO A;  4DV0 L;  3KF6 B;  1HR0 Q;  1CKN A;  3F8T A;  4DV6 Q;  1WFQ A;  2UXB L;  1XNR Q;  4DR5 L;  1Q46 A;  1QVC A;  3S16 H;  3M4O H;  4H02 A;  3I4N H;  3F2B A;  4A3E G;  1OXV A;  4UP8 A;  1YI2 A;  2VUM G;  2E5L Q;  3H15 A;  1Q82 C;  1PH6 A;  1XMQ Q;  1GKH A;  5EAY A;  1NE3 A;  5K36 G;  1A8V A;  4C3H H;  2R7D A;  5M3M H;  1HR0 W;  1J5E Q;  1G51 A;  3CCE A;  1VQH A;  1CSP A;  1LM0 A;  2Z0S A;  5FJ8 G;  2B63 G;  1XPR A;  2R7Z H;  1SE8 A;  2WAQ E;  4YWM A;  1G29 1;  5BR8 Q;  4NXN Q;  4DK3 C;  2ALY B;  1GD7 A;  1X3E A;  3KDF B;  3PIP A;  3JAM c;  4GKK Q;  4DR5 Q;  2H5X A;  3I4M G;  2PMZ E;  4POF A;  3CC7 A;  2F52 A;  1DGS A;  3F2C A;  4WJ4 A;  2NVQ H;  1Y14 B;  2K50 A;  4IFD G;  1A0I A;  4JI5 L;  3PO2 H;  5JJK A;  5IWA Q;  2WB1 E;  4DV3 L;  3KJP A;  3CW2 C;  3RN2 A;  4LNQ A;  3T1H Q;  2VQE Q;  1YHA A;  2ASB A;  4A3B H;  1Y1W H;  3PO3 G;  3E9I A;  1KD1 C;  1I5F A;  4KI0 A;  2CCZ A;  1BBU A;  5C0X I;  5IP7 H;  1FVI A;  3UDF A;  4DV5 L;  1P8L A;  2K5V A;  2Q2I A;  3S1N H;  1PHJ A;  3J7A 5;  1TWF H;  4R4O A;  4GN4 B;  1G6P A;  3AQQ A;  4DV7 Q;  4AYB G;  4B3T Q;  2JA5 H;  3CCS A;  2PQA B;  1SN8 A;  4A3D H;  1EIY B;  2YTY A;  2UXC Q;  3VDY A;  4JC0 A;  4DR3 L;  1E3P A;  3J81 i;  4X66 L;  2VUM H;  4A3L G;  4PMW A;  2IX0 A;  1VQM A;  1K3R A;  1FL0 A;  1SRO A;  4B3M Q;  2IT1 A;  2MQH A;  3PUW A;  4LF5 L;  3K80 C;  2HQL A;  1PH5 A;  1VQF A;  4OX9 L;  3T1Y L;  1VQ9 A;  3M4P A;  3M9B A;  4BXX H;  3S1Q H;  1X65 A;  1CKM A;  4DK6 C;  2WAQ G;  1UE6 A;  4JV5 Q;  4BBR H;  2YU9 H;  2R7F A;  4GS3 A;  4JI2 Q;  1N33 Q;  5JJI A;  1FJG Q;  1Q1B A;  3TQY A;  4A3C H;  2OQK A;  1J6Q A;  2VZA A;  1PYS B;  3CAM A;  3HOX G;  1N32 Q;  5HY6 A;  3SGI A;  4X66 Q;  1X54 A;  1Q81 C;  4IO9 A;  4DAY B;  1VQ6 A;  1AE2 A;  2ZJP A;  1PH2 A;  1HR0 L;  2VW9 A;  3K7U C;  1I6H H;  4GKJ L;  2UXB Q;  3BZK A;  2I0Q A;  5C0X J;  3RZO H;  4HIK A;  4JBK A;  3TS0 A;  4LFA Q;  4GOP A;  1Q7Y C;  1HNW L;  3DM3 A;  4MNO A;  1Y1V H;  2K5H A;  3DLL A;  3LGJ A;  4OO1 G;  2A8V A;  4HID A;  1UWV A;  1Y1W G;  5C3E H;  4YHH L;  1JT8 A;  5C44 G;  2N78 A;  4BA1 I;  2WFW A;  4JOI A;  4LF6 Q;  2UUB Q;  1SR3 A;  2AHO B;  2DUD A;  3HKZ G;  4HJ7 A;  2PI2 E;  1VQD A;  2B3G A;  4KLK A;  1SFO H;  4K0K L;  4A93 G;  1FJG L;  2UU9 Q;  3S1R H;  2K4K A;  2ZJQ A;  5C4J H;  1E1O A;  5LMN Q;  2HIX A;  1Q86 C;  1IYJ B;  2GVA A;  4JI1 Q;  5AJ3 L;  4MZ9 A;  1K83 H;  1BKB A;  5GAG C;  2NVX H;  3CPW A;  2BH8 A;  2CWP A;  3JC6 6;  5IYD G;  2KHI A;  4DR2 L;  1EFW A;  1ASZ A;  3HOV H;  1KHI A;  4FDB A;  2L15 A;  1YEZ A;  4DUY Q;  1HNX Q;  2N8N A;  1Z9F A;  3KDF A;  1U5K A;  4JBJ A;  3UE0 A;  1CKO A;  2LXK A;  2PNH A;  2E2H H;  1S72 A;  5GRO A;  1QUQ A;  1L1O C;  4JI7 L;  4LFB L;  3FHW A;  3S2H H;  4OWT B;  4JI3 Q;  1S3O A;  2JA7 H;  2C35 B;  1NJI C;  4WJ3 M;  1UE7 A;  4JI1 L;  1HNZ L;  4QL5 A;  2F4V Q;  4EQ5 A;  1X56 A;  3CCJ A;  2VS1 A;  1RL2 A;  4AYB E;  4A3F G;  3I4N G;  4A3E H;  2EIF A;  4PZ7 A;  3PF5 A;  1V43 A;  2AWN A;  2GVB A;  2K52 A;  4DV2 L;  3GTQ H;  3ICE A;  4JI6 Q;  1B8A A;  2B29 A;  2QGQ A;  3ULP A;  3KOJ A;  1HNW Q;  1H95 A;  1EWI A;  4ALP A;  1TWG H;  2LSS A;  3M7N A;  2B63 H;  1MJC A;  2ZM6 Q;  4TVA B;  2R7Z G;  2VY3 A;  1N33 L;  2KEN A;  1T9H A;  1TWA H;  5IYB H;  1JJG A;  1PV4 A;  3D31 A;  2RF4 A;  2D62 A;  1B70 B;  2VNU D;  2ZJR A;  4A93 H;  5FLM H;  3U50 C;  4LFC L;  2Z6K A;  5JEA J;  1CSQ A;  1X6O A;  4UP7 A;  4APV A;  1BBW A;  3CCU A;  2MO0 A;  1M90 C;  1IL2 A;  1WCM H;  1A63 A;  2A19 A;  2JA9 A;  2EXD A;  4GLA C;  4IPG A;  3W1B A;  4UY8 C;  2JEA I;  3S1M H;  5IYD H;  3L7Z C;  4A3M H;  3G6E A;  3HOV G;  1PH4 A;  3PO3 H;  3HOU G;  5M5W H;  1IZ6 A;  1JB7 A;  2VQE L;  2VQF Q;  1IBM Q;  3CF5 A;  4QGU A;  4A3J H;  1RIP A;  4X64 L;  4HJ8 A;  1L1O B;  3I7F A;  2OTJ A;  3PGZ A;  4O0A A;  2ES2 A;  2EQS A;  5JEA G;  1XMO L;  4JI5 Q;  4R4I A;  1QZG A;  3HOW H;  5IY0 A;  1PH7 A;  4A3G G;  1VQL A;  1N36 Q;  1I94 Q;  1EOV A;  4GKK L;  2MNA A;  4A3F H;  3HOY H;  2KHJ A;  1K73 C;  4JBW A;  1YIT A;  4GNX B;  4AH6 A;  2R92 H;  2RHS B;  2Q2U A;  4HJA A;  4DUZ L;  2ZTC A;  3S15 H;  1VQC A;  2D0P A;  4NPS A;  2HHH Q;  4JBM A;  4KHP Q;  4NB3 A;  4L5Q A;  3T1H L;  1KC8 C;  4DV3 Q;  2Q2T A;  2NZO A;  3ULL A;  3OTO L;  1HJP A;  3PIO A;  4AQY Q;  5C4X G;  2UU9 L;  4JOI C;  1AE3 A;  1GM5 A;  3PCO B;  3ER0 A;  4O2D A;  4X65 Q;  3UDI A;  1IBK L;  1PH9 A;  5IYB G;  4DR7 L;  1K0R A;  5IT9 c;  1GO3 E;  2AMC B;  4HIM A;  3M3Y H;  4DR6 Q;  2NZH A;  3FKI G;  2JEB I;  1XPU A;  4DUY L;  4R4C A;  4XTC S;  1VQO A;  4YY3 Q;  4DR4 L;  3F1Z A;  4B3R L;  4LF4 Q;  1JJ2 A;  1WCM G;  4DV4 Q;  1J5E L;  4YCU A;  2IY5 B;  3PF4 A;  4A3M G;  2JA6 G;  4IPC A;  1HZB A;  2GN5 A;  3PUZ A;  2E8G A;  1SLJ A;  4IJL A;  2D0O A;  4IOC A;  1KL9 A;  2PI2 A;  5GAE C;  4YCV A;  5C44 H;  1XMQ L;  1N32 L;  4A3J G;  1BVS A;  4NXN L;  4B3S L;  4YWL A;  4BY7 H;  4HJ9 A;  1M1K C;  4DAM A;  4X62 L;  4OX9 Q;  2K14 A;  5M5Y H;  3KF6 A;  4L5S A;  3HOW G;  1X3G A;  3GTO H;  3KYH C;  1LYL A;  3RN5 A;  3GTP H;  3W1G A;  2OCE A;  3I2Z A;  2CQO A;  4YY3 L;  1XNQ Q;  1IXR A;  4DR4 Q;  5J3B A;  2JJQ A;  1VQI A;  5LMU Q;  4DR1 L;  5IE8 A;  4OWW B;  2KBN A;  3CPF A;  4LF9 Q;  3W5O A;  2HT1 A;  2R92 G;  1OXS C;  1VQ8 A;  3J80 i;  4GLV B;  5DLQ E;  1VQE A;  1FGU A;  1WYD A;  4IJH A;  5IP9 G;  2ZTD A;  4X65 L;  2NN6 G;  3MEF A;  5C4X H;  4B3T L;  4JI4 L;  2NVT H;  3F2D A;  1CUK A;  1NTG A;  3NEN A;  4DV7 L;  2R93 H;  1YBY A;  3KF8 B;  3PUV A;  1VQ5 A;  2MFI A;  3A0J A;  5M3F G;  3PUX A;  3A5U A;  4DV5 Q;  1K8A C;  4OON A;  4DPG A;  2UUA L;  4YWK A;  1OXX K;  1V9P A;  4JYA L;  1K9M C;  2IHF A;  1E22 A;  1PFS A;  3K0X A;  1UE1 A;  3BZC A;  3HFZ B;  3OYY A;  4X6A H;  3M4Q A;  4Y7N H;  2DGY A;  1YJ9 A;  2YV5 A;  3CD6 A;  1YHQ A;  1E1T A;  1XNR L;  1EQR A;  1W3S A;  3S24 A;  4GOP C;  2JK8 A;  1YZ6 A;  1PH3 A;  4DR2 Q;  1O7I A;  2UXC L;  1UEB A;  2JA6 H;  4DV1 Q;  1L0W A;  4P74 A;  2E2I H;  1OTC A;  2WP8 J;  1VQ7 A;  4JI7 Q;  2ID0 A;  4LFB Q;  3NEM A;  4EX5 A;  1SMX A;  4DV2 Q;  1N34 Q;  4KHP L;  2AKW B;  3OW2 A;  4R1J A;  4JI6 L;  3GTK H;  2UUA Q;  5GQO A;  3RLF A;  5FLM G;  3B6Y A;  1Z47 A;  1VQP A;  4DNI A;  1HZA A;  2V1C C;  4P72 A;  4PZ8 A;  3WWV A;  1IBK Q;  3T1Y Q;  1JMC A;  2FXQ A;  1VQB A;  3D0F A;  2K5N A;  2CFM A;  4BY1 G;  4B3M L;  3H3V H;  3HOU H;  3M85 A;  4OWX B;  2N49 A;  3CXC A;  3PUY A;  2YTX A;  3AFQ A;  4JI0 L;  4LF7 L;  1C0A A;  2Y0S G;  4YHH Q;  1VCI A;  2BH2 A;  4TQU S;  2OWO A;  2I5H A;  4X64 Q;  3I56 A;  4DR6 L;  1OXU A;  2QEX A;  1QVG A;  2ZM6 L;  1EYG A;  4LFA L;  3IRB A;  4GOP B;  4A3G H;  1P16 A;  4JI8 L;  2Y0S E;  1S40 A;  2R93 G;  5GAD C;  2NN6 I;  1K8G A;  2JE6 I;  3U4Z A;  4DKA C;  5IYC G;  3J80 c;  3HOY G;  4A76 A;  3AFP A;  2BA0 A;  1MKH A;  1YVC A;  2YYZ A;  4X62 Q;  4A3I H;  1LUZ A;  4LWC A;  3RR5 A;  3G71 A;  4K0K Q;  2E5L L;  2IHE A;  1PH1 A;  4QIW E;  2OTL A;  3BJU A;  3A74 A;  1E24 A;  1MJE A;  2KCM A;  4DV0 Q;  2JA8 G;  1MIU A;  1X55 A;  1QVF A;  1NBW A;  5FLX c;  1PYB A;  5HGQ A;  4JI3 L;  4P71 A;  1OXT A;  2IX1 A;  1VQ4 A;  3J81 j;  3TS2 A;  3J7Z C;  1XMO Q;  4LUZ A;  4C3I H;  3FKI H;  3HOZ H;  2Z6K C;  5C0X G;  3S14 H;  2ATW A;  3EBE A;  3NEL A;  1IBM L;  3RLN A;  1SRU A;  3STB D;  1HNZ Q;  3GO5 A;  3CC2 A;  2QA4 A;  1VQJ A;  2XTI A;  3CC4 A;  2K75 A;  4BY1 H;  3PSI A;  4A3K G;  1Q1E A;  4IOA A;  4IPD A;  5GAH C;  1GVP A;  2OQ0 A;  2HHH L;  3AYH B;  2UUC Q;  4PG3 A;  3HKS A;  4GN3 B;  4BY7 G;  3CCQ A;  4A4I A;  4IPH A;  1I50 H;  2VL6 A;  1TWC H;  3GDE A;  5IWA L;  4JYA Q;  4B3R Q;  3KLW A;  3JAM i;  5BR8 L;  4JG2 A;  4GKJ Q;  3STB C;  3FP9 A;  3TRE A;  1UE5 A;  5IYC H;  2KCT A;  1PA6 A;  1C7Y A;  3OTO Q;  4AQY L;  5M3M G;  4A3I G;  1QUQ B;  1EIF A;  3RZD H;  3Q8D A;  3BU2 A;  3UE1 A;  4LW1 A;  2UUB L;  4LF6 L;  2MO1 A;  2VQF L;  3CCR A;  4XIG S;  1VQG A;  1EQQ A;  2UUC L;  1XPO A;  5IP9 H;  1EUJ A;  3H0G H;  3ZJY C;  3CCV A;  2JA8 H;  2HIV A;  4Y52 H;  2NVY H;  2F4V L;  4GN5 A;  5LMN L;  4JI4 Q;  4LUO A;  1N36 L;  1NY4 A;  1JJC B;  4RMF A;  5M3F H;  1L2F A;  3MXN B;  4UP9 A;  3CCM A;  2A1A A;  1X9N A;  1I94 L;  1NMG A;  3S2D H;  3GTL H;  1E7Z A;  3PO2 G;  1I3Q H;  4QJF A;  1L1O A;  1LTL A;  2R6G A;  1PVO A;  4NXM L;  4JI0 Q;  1U0L A;  2RHQ B;  3ULJ A;  1KXL A;  3S17 H;  3CQZ H;  4A3B G;  4KHZ A;  3RNU A;  4J15 A;  4DR3 Q;  4R4Q A;  4B3S Q;  4DV6 L;  1B7Y B;  5LMU L;  1XNQ L;  2CKZ B;  1CKN B;  2AWO A;  3A5Z B;  5IP7 G;  3CCL A;  4JI2 L;  4P75 A;  3KFU A;  4BBS G;  1WJJ A;  2CWA A;  2I5L X;  3I4O A;  2JA5 G;  3CMA A;  3EIV A;  4AIM A;  2WB1 G;  4GNX C;  4OXP A;  4BA2 I;  4A3D G;  4OO1 I;  1KRS A;  1N34 L;  1R9T H;  2BA1 A;  2F3I A;  4IFD J;  4C3J H;  3G48 A;  4LF8 Q;  3KJO A;  4NXM Q;  4A3L H;  2LXJ A;  5ELO A;  4RG1 A;  1YIJ A;  1KIX A;  1V1Q A; 
#chains in the Genus database with same CATH topology
 3GTL B;  3GD7 A;  4DR7 Q;  4RWS C;  4DV4 L;  3I4M B;  4PMB A;  1Y1V B;  5M5X H;  4R8N A;  4XQQ A;  3OPO A;  4DK1 A;  5EBD A;  1K28 A;  3FPU B;  3J81 c;  4ME3 A;  3PV0 A;  4WRD A;  2JXM B;  4LUV A;  1JR0 D;  2WV6 D;  4GNX A;  1VS0 A;  3OSO A;  2O4X A;  3QJY A;  1O7L A;  2B2T A;  4YCW A;  4G7Z C;  2L0C A;  3NBH B;  2A6E D;  3TEH B;  1C9O A;  4DUZ Q;  3LX0 A;  3HKZ B;  4POG A;  4EGV A;  1YNX A;  2ZTE A;  3E9H A;  4IUQ A;  4RGO S;  1VF7 A;  1NR2 A;  1HNX L;  3FRP B;  5LMN W;  3UDG A;  4L5R C;  4LF7 Q;  4KY7 A;  4UDU C;  4QQB X;  3C2P A;  2NTS A;  1AH9 A;  4LF8 L;  3LWU A;  1ASY A;  3A54 A;  1WTR A;  2NYZ D;  2RDF A;  1I3Q B;  1JE5 A;  2QIL A;  3K81 C;  1ONL A;  2E2J H;  1EZ6 A;  2UXD L;  1EQT A;  5CMD A;  2JA7 G;  4DAV A;  4XYO A;  1WFQ A;  1DCZ A;  1XNR Q;  4A3E G;  4C3J B;  3PO2 B;  3H15 A;  3C3L A;  2E2I B;  1GKH A;  2B2U A;  5K36 G;  1EU3 A;  3PMF A;  2L4N A;  3CCE A;  4DK0 A;  1CT1 D;  1CSP A;  2R7Z H;  4PNY A;  1G29 1;  1UAP A;  5BR8 Q;  3CHB D;  3UI2 A;  1X3E A;  1JOR A;  4GKK Q;  1TS2 A;  2PMZ E;  2NVX B;  1DGS A;  3F2C A;  2PW7 A;  2K50 A;  1NSN S;  1GUO A;  3MWY W;  4TSS A;  3P7J A;  2WB1 E;  3KJP A;  3CW2 C;  1TWG B;  4NDX A;  1SDF A;  1KDC A;  1Y1W H;  5F2D A;  1BR9 A;  3ERO A;  4DV5 L;  1FVI A;  3S1N H;  3KBX A;  2K5V A;  5JVG 3;  4R4O A;  4GN4 B;  4KY5 A;  5M3M B;  4AYB G;  1AZQ A;  1IKM A;  4A3D H;  1FNW A;  1EIY B;  2YTY A;  4XYQ A;  2UXC Q;  3VDY A;  1E3P A;  2O5I C;  2SNS A;  2EZV A;  4FXG C;  3S9W A;  2F3W A;  1RTN A;  1SRO A;  4B3M Q;  2EOT A;  2PZW A;  2XN9 C;  1IYU A;  4KTA A;  1OO9 B;  1VQ9 A;  4BXX H;  1DOL A;  2PW5 A;  4JV5 Q;  2R7F A;  3TQY A;  1O78 A;  3GP7 A;  3HP3 A;  3HOX G;  1Q81 C;  4DAY B;  2UXB Q;  2EYL A;  5ELF A;  3E5S A;  4CDE C;  1ICW A;  1RCV D;  4OO1 G;  3EFX D;  2H1E A;  4HID A;  1UWV A;  5C3E H;  4BA1 I;  2FIN B;  1G2T A;  2AHO B;  2DUD A;  3HKZ G;  3V2T A;  3HOW B;  1VQD A;  1SFO H;  3VYS A;  4A93 G;  1MI2 A;  2ZJQ A;  4JI1 Q;  5GAG C;  2NVX H;  1JIC A;  4DFA A;  2KHI A;  3OW7 A;  1FR3 A;  2L15 A;  1YEZ A;  4DUY Q;  2BOS A;  3UE0 A;  1U5K A;  1CKO A;  2PNH A;  1F2M A;  3Q6S A;  1BNZ A;  1F2Y A;  4OWT B;  4JI3 Q;  2SEB D;  4N9T A;  4JI1 L;  1HNZ L;  4QUC A;  3VR3 A;  4QCL A;  5IOD A;  2F4V Q;  4A3F G;  1RL2 A;  3T13 A;  2F0U A;  4PQX A;  2XRQ D;  4PZ7 A;  4X3S A;  2HCC A;  4DV2 L;  3GTQ H;  1PTO C;  1H95 A;  1I50 B;  2SOB A;  1SYC A;  5DM7 3;  5BN5 A;  4BS9 A;  2J4X A;  2ZM6 Q;  4O42 A;  4ZKB B;  1QJO A;  1T9H A;  2JSO A;  5IYB H;  5IGE A;  5HUR A;  1PV4 A;  5A2Q E;  2VNU D;  2OT2 A;  3S16 B;  5FLM H;  1M90 C;  4UP7 A;  4FF1 A;  1IL2 A;  1D1K A;  4KKS A;  2F0P A;  1PH4 A;  2XWB B;  3A56 A;  1JB7 A;  1IZ6 A;  3HOU G;  3CF5 A;  4KHV A;  2B8F A;  3SXH A;  1CTM A;  4J6H A;  2ES2 A;  5ELB A;  4R4I A;  1PH7 A;  4RAU C;  1VQL A;  1I94 Q;  4HCE A;  4C1N I;  1T5E A;  4RFB A;  1STA A;  3HOY H;  4F7X A;  2B39 A;  1EY4 A;  1YIT A;  2R92 H;  4HJA A;  4DUZ L;  2ZTC A;  1K3B C;  2D0P A;  4MN3 A;  2NZO A;  3OTO L;  2JA6 B;  5C4X G;  4HR7 B;  2A6H D;  2UU9 L;  4A3J B;  3QG1 A;  3ER0 A;  3UDI A;  2Z8L A;  4DR7 L;  1KNE A;  5IT9 c;  2A6E C;  4FNF A;  1LT3 D;  1ILP A;  2NZH A;  3PIP 3;  5ISR A;  4RGN A;  1DZ1 A;  1E2W A;  2E2J B;  3K57 A;  4LF4 Q;  4DV4 Q;  2D5D A;  2DNE A;  1Y8P B;  3PF4 A;  2JA6 G;  4HSV A;  4KY6 A;  4K8J A;  2PZU A;  2V4D A;  2PI2 A;  1A3V A;  1LTI D;  1XMQ L;  4N8X 1;  1BVS A;  3I91 A;  2B63 B;  3ND9 A;  4B3S L;  5TSS A;  2RCF A;  2CH4 A;  1M1K C;  3NPP A;  4Y7N B;  2HUG A;  3HOW G;  2KUM A;  1PYW D;  4YY3 L;  4DR4 Q;  5J3B A;  2MJ8 A;  4DR1 L;  3T16 A;  3H3V C;  2Q8I B;  2RKS A;  2IJ0 A;  4ID6 A;  4RA8 A;  5J1Z A;  1VQ8 A;  4IUP A;  5DLQ E;  2ZTD A;  1XX8 A;  1GUS A;  3MFG A;  3J7Y W;  3PUV A;  3MVV A;  1WD1 A;  3PUX A;  5CV6 A;  3A5U A;  4DV5 Q;  3E3X A;  3MFY A;  1K8A C;  1OXX K;  1SNO A;  1CZW A;  4A3F B;  3BZC A;  2CW0 C;  1DD2 A;  4Y7N H;  1E1T A;  3A8J E;  4F87 A;  2JK8 A;  1UEB A;  1I4X A;  4ABN A;  1HTL D;  3DWQ A;  3FEW X;  4L8J A;  1OTC A;  3BS1 A;  5M3F B;  4KHP L;  1YNN C;  4JI6 L;  3GTK H;  1UUP A;  2KVM A;  3B6Y A;  1Z47 A;  1HZA A;  2V1C C;  1IBK Q;  3T1Y Q;  1GUT A;  3D0F A;  1EQV A;  4BY1 G;  4BBR B;  1BF4 A;  1HRJ A;  1HQM C;  2HDM A;  4YHH Q;  2I5H A;  1RD9 D;  3DUZ A;  1EYG A;  5A35 A;  4FF2 A;  1CZG A;  2R93 G;  5GAD C;  3GTK B;  3M3Y B;  4A76 A;  3E0J A;  2BA0 A;  2D9U A;  2HDL A;  1YVC A;  2YYZ A;  4A3I H;  5FO7 B;  2IHE A;  2OF1 A;  4RKB A;  3TME A;  2KCM A;  4DV0 Q;  1MIU A;  1PTO D;  3S1R B;  2EY6 A;  2HQE A;  5FLX c;  5HGQ A;  2F0E A;  4P71 A;  1VQ4 A;  4Q5V A;  3J81 j;  1A3T A;  1XMO Q;  4LUZ A;  4LMQ D;  3FKI H;  3S14 H;  1IBM L;  3STB D;  1HNZ Q;  3GO5 A;  1SSO A;  2QA4 A;  2EJG C;  3D6W A;  3CC4 A;  1STN A;  1KTK A;  2K75 A;  1QNU A;  3D4W A;  1Q1E A;  4IOA A;  1EWC A;  2DNC A;  1Q90 A;  2HHH L;  3J81 E;  3I73 A;  4OEM B;  3CCQ A;  4IPH A;  1I50 H;  2VL6 A;  1A3U A;  2J0T D;  4JYA Q;  1ROD A;  3OHX C;  3FP9 A;  3TRE A;  1GUN A;  1LTG D;  1SNQ A;  1YNN D;  3GTG B;  5J39 A;  1PZK D;  3ONA B;  1C7Y A;  4AQY L;  1K83 B;  1C48 A;  1QUQ B;  1EIF A;  5I2Y A;  5C4J B;  1EZ8 A;  2A69 D;  3Q8D A;  4EQN A;  3NBI A;  2VQF L;  2UUC L;  1G91 A;  2CHB D;  1ZXT A;  2B2U C;  3H0G H;  4Y52 H;  5D65 A;  2CW0 D;  4BBS B;  1D5Z C;  1I6V C;  1VMC A;  3D6C A;  1EIH A;  3CCM A;  4UP9 A;  4IFD H;  1HXY D;  1E7Z A;  2VUM B;  4QJF A;  1L1O A;  2F0V A;  2FMC A;  1EU4 A;  1PVO A;  4IUV A;  3CQZ H;  3AU7 A;  2AUK A;  4DR3 Q;  4R4Q A;  1BCP C;  1B1Z A;  2CKZ B;  4JI2 L;  5G3L D;  1FNU A;  3HZX A;  3CCL A;  4KN7 C;  4BBS G;  2R93 B;  4AIM A;  4A3D G;  2IPK D;  1KRS A;  2B2W C;  1N34 L;  1R9T H;  5KRU A;  3MTS A;  3G48 A;  4QB4 A;  4A3L H;  1BCP F;  4RG1 A;  4C3H B;  5E4X A;  1V1Q A;  3EQL C;  4LF5 Q;  3UDX A;  3CP0 A;  2R7Z B;  3BVG A;  4OGQ C;  3QIA A;  1N8R C;  1XXG A;  1XJV A;  4BBR G;  1J9O A;  2XGT A;  4BWG B;  1D5X C;  1DON A;  1KQS A;  1HUM A;  2NWG A;  3A55 A;  1IYV A;  3HOX H;  1CQF A;  1CK1 A;  2ICI A;  3I90 A;  1VF5 C;  2PPB C;  3WOE A;  3G6J B;  3ERS X;  4P73 A;  4LF4 L;  5FJ8 H;  2RSN A;  1PH8 A;  5C4H A;  3N6R A;  1TXY A;  2K05 A;  2UXD Q;  4HCS A;  1BO0 A;  3U4V A;  5ELN A;  5DEH A;  3HOZ G;  1KDA A;  5C0X H;  5IOC A;  1GUG A;  4L63 B;  4C2M H;  4HMI A;  5H1S E;  1BBX C;  3U58 A;  1ZKO A;  1H9S A;  4A3K H;  4ODG A;  4CJ2 C;  2IL8 A;  4UPA A;  1FD7 D;  1MSH A;  3HG9 A;  1HR0 Q;  1CKN A;  3HS0 C;  1QVC A;  4DR5 L;  3S16 H;  3M4O H;  4U67 3;  3F2B A;  4N8F A;  1Q82 C;  1PH6 A;  4G4K A;  2K1B A;  3QWN A;  3TP6 A;  1NE3 A;  1A8V A;  2KCC A;  1G51 A;  4G7O C;  1GUW A;  3C46 A;  2B63 G;  1SE8 A;  4NXN Q;  4DK3 C;  1STH A;  2ALY B;  5G3L F;  3KDF B;  3PIP A;  4KJN A;  4DR5 Q;  3I4M G;  3O13 A;  4POF A;  2L12 A;  5L37 A;  3KLS X;  4HED A;  1JOK A;  1A0I A;  5EQ0 A;  1F77 A;  3SE0 A;  5E1F A;  5IWA Q;  2ASB A;  4A3B H;  5CV5 A;  1ENC A;  4K5V A;  1I4R A;  1O7Z A;  2Q2I A;  3J7A 5;  3P1H A;  1G6P A;  1X3P A;  3R93 A;  4DV7 Q;  3MXU A;  5BN3 A;  3KF8 A;  4B3T Q;  1KAA A;  3WDN A;  2PQA B;  3J80 L;  3K6O A;  2FHT A;  1I4H A;  4JC0 A;  3J81 i;  2LMC B;  3D4D A;  4C3J G;  2VUM H;  1LV9 A;  2IX0 A;  4HAE A;  4LJZ C;  1EWH A;  4C3H G;  3PUW A;  4LF5 L;  2K33 A;  2HQL A;  1STY A;  4OX9 L;  2B2V C;  3S1Q H;  1X65 A;  1CKM A;  4AYB B;  2WAQ G;  1UE6 A;  4DK6 C;  3K59 A;  3AB9 A;  4GS3 A;  4JI2 Q;  1QIL A;  1Q1B A;  2RBM A;  4CKC A;  2OQK A;  1J6Q A;  3CAM A;  1N32 Q;  4K2L A;  3SGI A;  4X66 Q;  1HFG A;  3NP8 A;  5LL6 X;  2EY5 A;  1HR0 L;  2VW9 A;  3QO2 A;  1I6H H;  2Z4I A;  1ET6 A;  3BZK A;  3U9S A;  2I0Q A;  1B2T A;  4LFA Q;  4GOP A;  1Q7Y C;  1EY6 A;  1QG7 A;  2EE1 A;  4MNO A;  4A3G B;  2Y0S B;  3DLL A;  3OMG A;  4CHT B;  1ILQ A;  2WFW A;  4FO2 A;  2PI2 E;  4RGM A;  5C4J H;  2YU9 B;  1E1O A;  2HIX A;  5I6W A;  1BUV T;  3H6M A;  4GZY C;  1K83 H;  3T4A C;  2K5Q A;  2BH8 A;  3I4N B;  1ASZ A;  3HOV H;  1SE2 A;  4JBJ A;  4CKB A;  2E2H H;  5GRO A;  1QUQ A;  1L1O C;  4JI7 L;  5ELD A;  1LTB D;  4F88 A;  1S3O A;  1CA5 A;  2M2L A;  1HCZ A;  4QL5 A;  4OEL B;  4AYB E;  3I4N G;  1XWE A;  1STB A;  5I2X A;  2VB3 X;  1O80 A;  1TS4 A;  1V43 A;  1I4P A;  2AWN A;  2K52 A;  3ZYY X;  2Q8R E;  5M5W B;  2KEC A;  3ULP A;  1QNK A;  1EOT A;  1GHJ A;  3SHL A;  2LSS A;  2AQ1 B;  2LFN A;  1Y1W B;  1Y69 U;  1N33 L;  2KEN A;  4KKT A;  2L11 A;  2RF4 A;  2D62 A;  1D1I A;  2ZJR A;  4A93 H;  2Z6K A;  3S2H B;  3MAQ A;  4APV A;  1WCM H;  4EVO A;  3RZO B;  2EXD A;  3CRL C;  4UY8 C;  3S1M H;  4A3M H;  2F0N A;  1D5M C;  1G6Z A;  3PO3 H;  3J7A V;  2VQE L;  2VQF Q;  1IBM Q;  1TY0 A;  1W6K A;  2MPM A;  4HJ8 A;  4NP5 A;  3MZ5 A;  4X3T A;  5ELE A;  1XMO L;  4JI5 Q;  1G2S A;  5KNB A;  5IY0 A;  1VDZ A;  1EL0 A;  1WTQ A;  2MNA A;  3FKI B;  4C1N K;  4A3F H;  1TQO A;  1L0Y B;  4AH6 A;  3TBI B;  2RHS B;  3H09 A;  1F2Z A;  1VQC A;  2HHH Q;  1LT4 D;  4KHP Q;  3T1H L;  2Q2T A;  4KD4 A;  3PIO A;  1QCB D;  4JOI C;  1AE3 A;  4ZKC B;  1GM5 A;  4X65 Q;  1IBK L;  3R8B A;  3M3Y H;  4K8I A;  2ZT9 C;  3F1Z A;  4CKE A;  2GN5 A;  2K01 A;  1SLJ A;  4IOC A;  5C44 H;  3GTM B;  4YCV A;  1EY7 A;  2E2D C;  4A3J G;  5LHY 1;  3FVQ A;  1F9S A;  3GTJ B;  4OX9 Q;  2F0G A;  3GTO H;  3RN5 A;  1NNX A;  1AP0 A;  3W1G A;  2OCE A;  1WCM B;  2CQO A;  1B9N A;  1XNQ Q;  1IXR A;  2JJQ A;  1CA6 A;  1SNC A;  4BY1 B;  4OWW B;  4LF9 Q;  3W5O A;  2R92 G;  2QW7 A;  5IGB A;  1OXS C;  2EXZ A;  4GLV B;  5FKA C;  1WYD A;  1R4P B;  4X65 L;  2NN6 G;  4NW2 A;  4B3T L;  3GV3 A;  1CUK A;  4FVM A;  3TP5 A;  2MFI A;  2N55 A;  1ENF A;  4ZUJ A;  4DPG A;  3BYY B;  4YWK A;  3MEH A;  1E22 A;  1PFS A;  2R3Z A;  1UE1 A;  3HFZ B;  3OYY A;  4X6A H;  1MSG A;  1TII D;  2YV5 A;  3URY A;  1YJ9 A;  4KV6 A;  1W3S A;  2F0D A;  1YZ6 A;  4XT1 B;  1J8I A;  3ND8 A;  2JA6 H;  2C9O A;  4DV1 Q;  3K5M A;  2PNR C;  2E2I H;  1JWU D;  3QR8 A;  2NUC A;  2WP8 J;  1VQ7 A;  4LFB Q;  2ID0 A;  3NEM A;  4DV2 Q;  1SND A;  2UUA Q;  2GA4 B;  5GQO A;  1II3 A;  2QCP X;  2G9H D;  3RLF A;  1VQP A;  1GOZ A;  5E3F A;  4F8M A;  4P72 A;  2N88 A;  1WTH A;  4J8Q A;  5C4X B;  1JMC A;  3S17 B;  3K5N A;  3KLR A;  3WOF A;  3EJI A;  1VQB A;  5C5L A;  2X6G A;  2K5N A;  5KND A;  3SVM A;  3HOY B;  4X3U A;  2CFM A;  1M4V A;  4OWX B;  4DU9 A;  4JI0 L;  2YTX A;  2Z9H A;  4YIJ A;  1C0A A;  2BH2 A;  1JQY D;  3OIP A;  5JEA H;  2IX3 A;  3CRK C;  2Q8T A;  4LFA L;  4B08 A;  3DHQ A;  4GOP B;  4A3G H;  1P16 A;  1I6H B;  5M5Y B;  2Y0S E;  1SYD A;  3C1F A;  2NN6 I;  5IYC G;  1WTP A;  3NTH A;  3RR5 A;  1HHV A;  2ZXR A;  4QIW B;  4QIW E;  4KMU C;  3A74 A;  2JA8 G;  3EA6 A;  1QVF A;  1DM0 B;  1PRT C;  1PYB A;  1DYQ A;  1T5X D;  1OXT A;  2IX1 A;  3V05 A;  3J7Z C;  2RQX A;  1NR4 A;  3VR2 A;  4BY7 B;  4C3I H;  3HOZ H;  5C0X G;  4HTH A;  2ATW A;  2O2L D;  3EBE A;  3NSW A;  1MBY A;  2ICE C;  3RLN A;  1SRU A;  2PQE A;  4BY1 H;  2B2Y A;  5IT9 L;  1W6J A;  3VA5 A;  5GAH C;  2ZXO A;  5EPL A;  2OQ0 A;  3DEP A;  3KUP A;  4QMG A;  4PG3 A;  4BY7 G;  2EYJ A;  2PYK A;  3DEO A;  4M1U B;  5IWA L;  2NVT B;  3KLW A;  3SK6 A;  3JAM i;  3OIQ A;  4JG2 A;  2PCF B;  5FLX E;  3K7A B;  5JVH 3;  1TWH B;  3BU2 A;  2MO1 A;  3CCR A;  4OIK A;  1EQQ A;  1X3Q A;  3NTI A;  5IP9 H;  1XPO A;  1SMY D;  3ZJY C;  1JOQ A;  2HIV A;  2LS0 1;  3H94 A;  5IGC A;  4I7Z C;  2NVY H;  2WKC A;  2F4V L;  4GN5 A;  4JI4 Q;  1N36 L;  4RMF A;  5M3F H;  1I94 L;  1X9N A;  1NMG A;  3K5L A;  5C4Z A;  3GTL H;  1LAB A;  1I3Q H;  1SJH D;  4JI0 Q;  2RHQ B;  1KXL A;  3S17 H;  2OEO A;  3DWA A;  4J15 A;  5KGU A;  4DV6 L;  3C1E A;  2AWO A;  1RDP D;  1ZYR D;  3HOX B;  4P75 A;  1H9R A;  4E6I A;  1WJJ A;  2CWA A;  2I5L X;  3I4O A;  2DJF C;  3EIV A;  4BA2 I;  2F0T A;  1PRT B;  2F0I A;  2C5C A;  3SR1 A;  2F3I A;  4CDD C;  4C3J H;  2F1M A;  5ELO A;  1YIJ A;  1KAB A;  1K9M C;  3I55 A;  4I7A A;  1LO5 D;  5E7N A;  3OOC A;  4IAL A;  1HTP A;  4R4T A;  2DN8 A;  4JW0 A;  3NQI A;  3CME A;  1IBL Q;  4BXX G;  1HH2 P;  1M8A A;  3RLO A;  2XVS A;  1AEX A;  3H91 A;  4JCV E;  1VQK A;  3IAY A;  2B2Y C;  3TRZ A;  1D7Q A;  3X3N A;  1W2B A;  4CJ1 B;  5DM6 3;  4H7B A;  3HKZ E;  2PQA A;  2IW3 A;  1HPC A;  1PXU A;  2Q2H A;  3K7A H;  5JPN C;  1X3F A;  1NMF A;  3F2U A;  1S5C D;  1B9M A;  2O5J C;  4LF9 L;  1STG A;  5C3E G;  3GTJ H;  4IUN A;  1HZ9 A;  2SNM A;  4DXG A;  4BBS H;  3SK8 A;  4PZ6 A;  4RCN A;  5AJ3 Q;  1LTT D;  1WD0 A;  4DAP A;  4A3D B;  3G4S A;  1EY0 A;  3VYR A;  1HZC A;  3KK7 A;  4IUU A;  2YTV A;  4LFC Q;  2F0S A;  3NK9 A;  1YJN A;  5FLX L;  4JV5 L;  3GTG H;  4DR1 Q;  2CH4 W;  4L5T A;  3H3V I;  1IW7 D;  3MXN A;  4RH6 A;  1IBL L;  4GLX A;  4M8A A;  1HA6 A;  4JI8 Q;  1QB5 D;  4EQO A;  4DV1 L;  4HIO A;  4DV0 L;  3KF6 B;  2UXB L;  3F8T A;  4DV6 Q;  1LTS D;  1Q46 A;  4IUT A;  5COR A;  4UP8 A;  4N9P A;  3TP7 A;  1XMQ Q;  2F0L A;  2L55 A;  5EAY A;  3VR5 A;  3DM1 A;  2R7D A;  1YNJ C;  2E76 C;  3MA2 B;  4ZYS A;  1LM0 A;  2Z0S A;  5FJ8 G;  1B3Q A;  2BE5 C;  2A6H C;  1ICF B;  3L9A X;  3JAM c;  1BOS A;  4A3E B;  3V96 A;  4G7H C;  3CC7 A;  2F52 A;  2NVQ H;  1Y14 B;  3ERQ A;  3BVM A;  4K5X A;  4L6T B;  4FF3 A;  3HOU B;  5DNF A;  2P5Z X;  2F0J A;  1CI3 M;  2EY1 A;  4DV3 L;  3RN2 A;  4LNQ A;  4CJ0 B;  1PTO F;  2VQE Q;  1D2B A;  3PO3 G;  1RKN A;  1MHW C;  2CCZ A;  1BBU A;  5C0X I;  5IP7 H;  1PHJ A;  3BDO A;  3P20 A;  3R3O A;  2EYF A;  1TWF H;  2SDF A;  2JA5 H;  1KLG D;  3CCS A;  2K32 A;  1JC7 A;  4DR3 L;  2MGS A;  1ZEQ X;  2TSS A;  3MXG A;  4RHR A;  1WTO A;  1VQM A;  3SEB A;  4KKU A;  2IT1 A;  5C3E B;  3K80 C;  1VQF A;  3T1Y L;  3M4P A;  5C3X A;  3JAM L;  4A3K B;  5FK9 C;  5JJI A;  4A3C H;  4A93 B;  1PYS B;  1X54 A;  5JAV A;  1VQ6 A;  2ZJP A;  2KEE A;  1PH2 A;  1CFM A;  3K7U C;  4GKJ L;  1Q8I A;  1H9S B;  5C0X J;  4JBK A;  1Y1V H;  2A69 C;  2K5H A;  3L3O C;  3LGJ A;  2VB2 X;  3RD4 A;  3JAM E;  1Y1W G;  4CDF C;  4YHH L;  1JT8 A;  4JOI A;  5CR3 A;  4LF6 Q;  1STE A;  2EYP A;  1SR3 A;  2UUB Q;  4KLK A;  3VR6 A;  2RVL A;  4K0K L;  1FJG L;  2UU9 Q;  3J81 L;  1S5F D;  3RZD B;  5LMN Q;  2GVA A;  5AJ3 L;  4QUF A;  1BKB A;  1PZJ D;  1UNS A;  2Z4H A;  2CWP A;  3JC6 6;  3I3C A;  5ELC A;  5IYD G;  1KHI A;  4FDB A;  1HNX Q;  2XNA C;  2N8N A;  1Z9F A;  3S14 B;  2BCO A;  2QKI C;  2LXK A;  1S72 A;  4K6L A;  4LFB L;  4HMJ A;  3FHW A;  3S2H H;  3NQT A;  5CBA E;  3AMU A;  1UEA B;  2C35 B;  4V0B A;  3CQZ B;  3CCJ A;  1X56 A;  2M9V A;  4C56 C;  2JA5 B;  2EIF A;  3PF5 A;  2L1B A;  4OIJ A;  3ICE A;  5IGF A;  1ET9 A;  2BE5 D;  1B8A A;  1F2L A;  2B29 A;  2QGQ A;  3J7A F;  5K36 H;  4WJW A;  1EWI A;  3M4Y A;  4ALP A;  1TWG H;  5EPJ A;  4OO1 H;  2R7Z G;  1YNJ D;  2VY3 A;  3CU7 A;  5C44 B;  1XYI A;  1JJG A;  2CVR A;  3FMC A;  3MXP A;  4LFC L;  4FXK C;  3Q22 A;  1CSQ A;  1PLF A;  1D6E C;  1X6O A;  2EYH A;  2MO0 A;  1RTO A;  2WAQ B;  2JA9 A;  4GLA C;  1SNM A;  3G6E A;  3A7A B;  3HOV G;  2K03 A;  3DXJ C;  1EY9 A;  1L1O B;  3I7F A;  5NUC A;  5CC4 A;  2OTJ A;  1MGS A;  2A5H A;  5JEA G;  3NWT A;  4TKO B;  1QZG A;  4A3G G;  4S3S A;  1N36 Q;  2AQ2 B;  1EOV A;  2EYM A;  1CHQ D;  1KNA A;  5CYU A;  2EVB A;  1EIG A;  1Y8O B;  4JBW A;  4K14 A;  2A68 D;  2LKV A;  1FGB D;  3G7L A;  5E4W C;  4JBM A;  4NPS A;  1TR5 A;  4KD3 A;  4L5Q A;  4NB3 A;  4DV3 Q;  2KA7 A;  3ULL A;  1HJP A;  1FYC A;  4H13 C;  2K5W A;  4LAA A;  3PCO B;  3T56 B;  1PH9 A;  2ZXP A;  5IYB G;  3PO3 B;  5D3D A;  1K0R A;  3GTP B;  2AMC B;  4HIM A;  4DR6 Q;  3FKI G;  2JEB I;  4DUY L;  4MHE A;  4XTC S;  4JVZ A;  1VQO A;  5D3I B;  4YY3 Q;  4DR4 L;  4B3R L;  4YCU A;  3I72 A;  2IY5 B;  1HZB A;  2BDN A;  2D0O A;  1U4R A;  1KL9 A;  1F9R A;  5GAE C;  1PZI D;  4BY7 H;  4HJ9 A;  4FXD A;  2K14 A;  5LL6 S;  5M5Y H;  3KF6 A;  4L5S A;  5EKK A;  2PZT A;  3GTP H;  3I2Z A;  3CKI B;  2JN4 A;  4DAY A;  1PMR A;  5KEE A;  5LMU Q;  5IE8 A;  2B2T C;  2KBN A;  3CPF A;  2HT1 A;  1AN8 A;  2DJG C;  1FGU A;  2EDG A;  5IP9 G;  5C4X H;  4JI4 L;  1H9K A;  1JB3 A;  2WII B;  3F2D A;  1YBY A;  2K6A A;  1VQ5 A;  1LT6 D;  5M3F G;  2F0F A;  4OON A;  3D4R A;  4A3B B;  5EJW A;  1V9P A;  2IHF A;  2XRS D;  5I4D A;  3N52 A;  2DGY A;  1SXT A;  1SMY C;  3CD6 A;  1YHQ A;  1A6X A;  1EQR A;  4XDX A;  3VYU A;  4GOP C;  2AUJ D;  2HD3 A;  2HCI A;  1K8M A;  4JI7 Q;  4EX5 A;  1N34 Q;  5FLM G;  4DNI A;  2QDL A;  3A8K E;  1I4G A;  5I6Y A;  4X3K A;  1NUC A;  4NMZ A;  1TT2 A;  4B3M L;  3H3V H;  3HOU H;  4RCO A;  4IN3 A;  3M85 A;  2N49 A;  3AFQ A;  2Y0S G;  1VCI A;  4DNT B;  4X64 Q;  1R9T B;  1QVG A;  1BXT A;  2ZM6 L;  5KYI A;  4JI8 L;  1K8G A;  2F3V A;  1SYE A;  3U4Z A;  3J80 c;  5I9P A;  1KDB A;  4ME5 A;  3AFP A;  5DAU A;  4X62 Q;  4LWC A;  3G71 A;  4J1M A;  2OTL A;  2QF7 A;  3BJU A;  3A7L A;  3TSS A;  1X55 A;  1FNV A;  1NBW A;  1ESF A;  4JK1 C;  3FDT A;  4JI3 L;  1TWC B;  5KIX A;  1SYG A;  3NE5 B;  1QWY A;  1S5D D;  2Z6K C;  1F9P A;  4DXF A;  1LTR D;  4DN4 M;  3CC2 A;  1VQJ A;  3PSI A;  4A3K G;  1JWS D;  4IPD A;  2ENB A;  1GVP A;  1LT5 D;  4B9X A;  2X69 A;  5EBC A;  3HKS A;  3GTQ B;  1B44 D;  4A4I A;  1SE3 A;  3GDE A;  5BR8 L;  4CBV A;  4GKJ Q;  3STB C;  1JE4 A;  1PA6 A;  4JPB W;  4Q0F A;  1PTO H;  4A3I G;  1TWA B;  4ZCK A;  2QDB A;  2UUB L;  2Z6B A;  4LF6 L;  3R2I A;  4KK7 A;  1AZP A;  4XIG S;  1VQG A;  3LNN A;  1PRT D;  4KN4 C;  4IQZ A;  1S5B D;  5HGT A;  1NY4 A;  3K58 A;  3GTO B;  1JJC B;  4B3R Q;  2R61 A;  1A15 A;  3S2D H;  2JA7 B;  1LTL A;  4NXM L;  1U0L A;  3ULJ A;  1I4Q A;  1E0B A;  4A3B G;  3I8Z A;  1B7Y B;  1XNQ L;  1IHZ A;  2MP1 A;  5IP7 G;  5EPK A;  3NXW A;  5CV4 A;  3ITP A;  4NKL A;  2JA5 G;  2WAC A;  2A73 B;  3CMA A;  1U4L A;  4GNX C;  4OO1 I;  2NVY B;  2F0M A;  2BA1 A;  4U68 A;  3RUZ A;  2FJ2 A;  4XXE A;  4IFD J;  1K0S A;  4LF8 Q;  3KJO A;  4FP5 D;  2LXJ A;  1KIX A;  1N9W A;  3KBG A;  2F0K A;  3DMU A;  3LWE A;  2NB0 A;  1KAW A;  2QEJ C;  5J22 A;  1QZH A;  4K6D A;  3E0E A;  2DY8 A;  3NWS A;  4WOR A;  4HJ5 A;  2KQ3 A;  1YJW A;  4A75 A;  3L0O A;  1B50 A;  2WB1 B;  3H0G G;  1TS5 A;  1Q12 A;  4A3C G;  1WI5 A;  4I65 A;  3R2T A;  4C2M B;  1AFP A;  3GTM H;  1A62 A;  1U9R A;  1Q8K A;  5C3W A;  1TWH H;  1Z6H A;  4P2C B;  1WOC A;  1Y1V G;  3S1N B;  3L2P A;  3IL8 A;  3AEV A;  2I5M X;  2LY7 A;  2DY7 A;  1VQA A;  1PRT F;  1XTD A;  3I4M H;  4MIU A;  1VQN A;  5AFW A;  2JQO A;  4IFD I;  4MTN A;  2N3S A;  3NHH A;  3T51 B;  1RHP A;  1KRT A;  1YHB A;  3M7G A;  5JOB A;  1PFN A;  1D8L A;  4A3I B;  4QY7 A;  3K8A A;  3EN2 A;  1V1O A;  1LLR D;  2RCN A;  1DOK A;  2I46 A;  4ZUI A;  5JJL A;  2XSC A;  2F03 A;  2A74 C;  3HRZ C;  3QOL A;  2VXW A;  4H02 A;  1R4Q B;  3BG3 A;  3I4N H;  1YI2 A;  1OXV A;  1XTC D;  2VUM G;  2XWJ B;  2E5L Q;  1A2U A;  1QOH A;  3BVZ A;  2MHV A;  1BCP B;  4C3H H;  5M3M H;  1HR0 W;  1J5E Q;  4O1N A;  2XIW A;  1G8Z D;  1VQH A;  2K04 A;  1C4Q A;  1XPR A;  2KED A;  2WAQ E;  1SNP A;  4YWM A;  4G57 A;  1EY8 A;  1GD7 A;  2H5X A;  1IL8 A;  4WJ4 A;  5A2Q L;  4IFD G;  3BDL A;  4ZK9 B;  4JI5 L;  3PO2 H;  5JJK A;  3MHB A;  2K7V A;  2CQA A;  3T1H Q;  1YHA A;  3DWP A;  3E9I A;  1KD1 C;  1I5F A;  1EEF D;  4KI0 A;  1EFI D;  3UDF A;  1P8L A;  1GHK A;  3OWF A;  4FF4 A;  4XT3 B;  1A2T A;  3PIO 3;  3AQQ A;  1ESR A;  2JYO A;  5IT9 E;  1SN8 A;  1SBB B;  4PV1 C;  4X66 L;  2Z1C A;  4A3L G;  4PMW A;  1JWM D;  1K3R A;  1FL0 A;  1TVX A;  4K5W A;  1ML0 D;  4LK1 C;  2MQH A;  1SYB A;  2RSO A;  1PH5 A;  1U4P A;  3M9B A;  3VYT A;  4BBR H;  2YU9 H;  5IIF A;  3M4O B;  1RJT A;  4H44 C;  1FJG Q;  2B2V A;  3TP8 A;  2VZA A;  1F9Q A;  5HY6 A;  4R8I A;  1TWF B;  4IO9 A;  1AE2 A;  4B9W A;  4A3M B;  4OHJ A;  5KNC A;  2WKD A;  3RZO H;  4K2K A;  4HIK A;  3TS0 A;  4PMC A;  1HNW L;  3DM3 A;  4EQP A;  2A8V A;  1B4O A;  2N78 A;  5C44 G;  1TKW B;  5EKL A;  1N33 Q;  4HJ7 A;  3I4L A;  2B3G A;  3P75 A;  1PTO B;  3S1R H;  2K4K A;  1Q86 C;  1IYJ B;  4MZ9 A;  3S1Q B;  1HUN A;  3CPW A;  5JPM C;  1U4M A;  4MTK A;  1EFW A;  4DR2 L;  2R92 B;  1WTV A;  3OMC A;  3KDF A;  1NAP A;  2K28 A;  3U9O A;  1DXM A;  4RHS A;  2JA7 H;  4QF4 A;  3RMH A;  4ZQ3 A;  4WJ3 M;  1NJI C;  1UE7 A;  3S2D B;  3IFD A;  2F0H A;  3TN2 A;  1V1P A;  4EQ5 A;  2VS1 A;  3D3R A;  4A3E H;  1LAC A;  1SJE D;  4RKL A;  1SFO B;  2GVB A;  2PO4 A;  2M00 A;  4JI6 Q;  2J7Z A;  1HNW Q;  3KOJ A;  5T1I A;  5EGT A;  2TMP A;  3TZD A;  2L5T A;  3M7N A;  2B63 H;  1MJC A;  4TVA B;  1HA5 A;  5CV8 A;  1NCV A;  1TWA H;  5JJZ A;  3D31 A;  1B70 B;  2RA4 A;  3U50 C;  1EY5 A;  5JEA J;  3CCU A;  1KLU D;  1BBW A;  4UHV A;  2F4I A;  3K0Y A;  2EY2 A;  1A63 A;  2A19 A;  3W1B A;  4IPG A;  2JEA I;  5IYD H;  3L7Z C;  5M5W H;  2EPB A;  3A8I E;  4QGU A;  4A3J H;  1RIP A;  4X64 L;  3PGZ A;  4O0A A;  1Y8N B;  2EQS A;  2EJF C;  3QOJ A;  1CHP D;  3T53 B;  3HOW H;  1WTX A;  2NVQ B;  2H4O A;  1DOM A;  4GKK L;  5C5M A;  1C8C A;  2KHJ A;  1K73 C;  4GNX B;  3GV6 A;  1SAP A;  2Q2U A;  3NTK A;  3S15 H;  1DJR D;  1KC8 C;  4AQY Q;  1S5E D;  2NN6 H;  3FPP A;  4O2D A;  2F0O A;  3W2D A;  2KCN A;  3NBH A;  1GO3 E;  4C3I G;  3VR4 A;  1XPU A;  4R4C A;  5K5P A;  3E6Z X;  4V19 0;  1PFB A;  1JJ2 A;  1WCM G;  1J5E L;  1IKL A;  3HOV B;  4A3M G;  4UAI A;  3PQI A;  4IPC A;  3PUZ A;  2E8G A;  4IJL A;  2BDO A;  1JOO A;  1N32 L;  1EYD A;  4XQN A;  4NXN L;  4YWL A;  1Q3L A;  4CGY B;  3EVQ A;  4DAM A;  4ULL A;  4X62 L;  1WTW A;  3GQB A;  5CV9 A;  1X3G A;  5IGD A;  3KYH C;  1LYL A;  1K8O A;  2X6L A;  1ENA A;  2F0W A;  4DGZ A;  1VQI A;  4WFN 3;  3Q0A A;  1ZYR C;  3IFT A;  3J80 i;  3W3A A;  1VQE A;  2RDG A;  5T1G A;  4IJH A;  1Z7T A;  1X32 A;  3MEF A;  2IWH A;  2NVT H;  4Z9C B;  1E2V A;  5CGK A;  1NTG A;  3NEN A;  4DV7 L;  3HOZ B;  2B8G A;  3BDC A;  3KF8 B;  3OWE B;  2R93 H;  2RDH A;  3A0J A;  1O7Y A;  1MD2 D;  2F0Q A;  4IZ8 A;  2UUA L;  1PDQ A;  5D14 A;  1HFN A;  5KYL A;  4JYA L;  3K0X A;  3M4Q A;  5FO8 B;  1XNR L;  3K5O A;  3S24 A;  1PH3 A;  2WIN B;  4DR2 Q;  1O7I A;  3TZU A;  2UXC L;  4ILW A;  1L0W A;  4P74 A;  1AW7 A;  2A68 C;  1GXD C;  1H9M A;  1SMX A;  2L9H A;  2AKW B;  3OW2 A;  4R1J A;  3NUC A;  4PZ8 A;  3WWV A;  3BZD B;  5CV7 A;  5EKI A;  2FXQ A;  3TDQ A;  4TRD A;  1SE4 A;  5COY A;  3VA7 A;  3Q23 A;  3CXC A;  4LF7 L;  3PUY A;  5FO9 B;  1B53 A;  3S15 B;  4TQU S;  1BDO A;  2OWO A;  2OXP A;  3I56 A;  2JA8 B;  4DR6 L;  2FMM A;  1OXU A;  4C3I B;  2E74 C;  2QEX A;  1LTA D;  3Q24 A;  3IRB A;  4HN7 A;  1S40 A;  1BCP D;  2JE6 I;  1BQQ T;  4DKA C;  5I9O A;  3HOY G;  4DF7 A;  2AQ3 B;  1JCK B;  4DA2 A;  4DNR B;  3X3M A;  1MKH A;  1LUZ A;  4K0K Q;  2E5L L;  1PH1 A;  4FYD A;  4R9W A;  1CM9 A;  1MJE A;  1E24 A;  2I07 B;  5FOB B;  3KLS A;  1SYF A;  2NBF A;  1EYA A;  1CQV A;  3SK4 A;  3TS2 A;  1EYC A;  5IGG A;  1L0X B;  3NEL A;  2E75 C;  4ZAI A;  1V8Q A;  1S4Z A;  5CBE E;  2NZ1 D;  4OL7 A;  2KOL A;  2XTI A;  4KJO A;  3J80 E;  3MC0 B;  1GJX A;  4H0L C;  3AYH B;  2UUC Q;  4IUR A;  4GN3 B;  3SDZ A;  5M9O A;  1TWC H;  2G5D A;  2G9D A;  1TU2 B;  1V1P B;  1UE5 A;  5IYC H;  1VMP A;  2KCT A;  3OTO Q;  5M3M G;  3RZD H;  1PFM A;  5BN4 A;  2PMZ B;  3UE1 A;  1TS3 A;  4LW1 A;  1E2Z A;  3HGB A;  1EUJ A;  3CCV A;  4ZLT F;  2JA8 H;  3S1M B;  1H9J A;  3D8G A;  4HSP A;  5C6A A;  2E2H B;  3QB3 A;  3IKJ A;  5LMN L;  4LUO A;  2B2W A;  1SEB D;  1L2F A;  3MXN B;  1QE6 A;  2A1A A;  5M5X B;  1B3A A;  3PO2 G;  1EEI D;  2R6G A;  1TY2 A;  4KHZ A;  3RNU A;  4B3S Q;  4ZRZ A;  3SK5 A;  5LMU L;  3HEJ A;  1CKN B;  3A5Z B;  2D2C C;  2K5D A;  4XQJ A;  4CDC C;  2EYO A;  3KFU A;  2NTT A;  2KJX A;  2FFK B;  3I70 A;  1RF2 D;  2EJM A;  2MUY A;  1WVL A;  2WB1 G;  3H0G B;  3BYT B;  4OXP A;  1HQR D;  1IW7 C;  2KHS A;  4RGT A;  4NXM Q;  2JP1 A; 
#chains in the Genus database with same CATH homology
 3I55 A;  3GD7 A;  1N9W A;  4DR7 Q;  4LF5 Q;  3UDX A;  5E7N A;  4DV4 L;  1KAW A;  3CP0 A;  5M5X H;  4R4T A;  1QZH A;  3E0E A;  4HJ5 A;  3CME A;  1IBL Q;  1N8R C;  4BXX G;  1HH2 P;  1YJW A;  3J81 c;  3RLO A;  1XJV A;  4ME3 A;  4A75 A;  3PV0 A;  4BBR G;  3L0O A;  4JCV E;  4LUV A;  1VQK A;  3H0G G;  2XGT A;  4GNX A;  1VS0 A;  3TRZ A;  1Q12 A;  1D7Q A;  4A3C G;  1W2B A;  1KQS A;  1WI5 A;  4YCW A;  3HKZ E;  3HOX H;  3NBH B;  2PQA A;  3GTM H;  1A62 A;  3TEH B;  1C9O A;  1Q8K A;  3ERS X;  4DUZ Q;  1TWH H;  2Q2H A;  3K7A H;  1WOC A;  4P73 A;  1X3F A;  1NMF A;  5FJ8 H;  1Y1V G;  4LF4 L;  4LF9 L;  3L2P A;  4POG A;  1YNX A;  1PH8 A;  3AEV A;  5C3E G;  2ZTE A;  2I5M X;  3E9H A;  1TXY A;  1VQA A;  3GTJ H;  2UXD Q;  1HNX L;  1HZ9 A;  1XTD A;  5LMN W;  3UDG A;  4L5R C;  4LF7 Q;  3I4M H;  4BBS H;  4PZ6 A;  1VQN A;  4IFD I;  2JQO A;  5AJ3 Q;  3U4V A;  4QQB X;  4MTN A;  2N3S A;  5ELN A;  3G4S A;  1AH9 A;  1KRT A;  3HOZ G;  4LF8 L;  1YHB A;  1HZC A;  1ASY A;  2YTV A;  1D8L A;  4LFC Q;  4QY7 A;  3K8A A;  3EN2 A;  1JE5 A;  4C2M H;  1YJN A;  4JV5 L;  2RCN A;  5H1S E;  4DR1 Q;  3K81 C;  3GTG H;  4L5T A;  3U58 A;  3H3V I;  2E2J H;  4A3K H;  1IBL L;  4GLX A;  2UXD L;  5JJL A;  4UPA A;  4JI8 Q;  4DV1 L;  2JA7 G;  4HIO A;  4DV0 L;  3KF6 B;  1HR0 Q;  1CKN A;  3F8T A;  4DV6 Q;  1WFQ A;  2UXB L;  1XNR Q;  4DR5 L;  1Q46 A;  1QVC A;  3S16 H;  3M4O H;  4H02 A;  3I4N H;  3F2B A;  4A3E G;  1OXV A;  4UP8 A;  1YI2 A;  2VUM G;  2E5L Q;  3H15 A;  1Q82 C;  1PH6 A;  1XMQ Q;  1GKH A;  5EAY A;  1NE3 A;  5K36 G;  1A8V A;  4C3H H;  2R7D A;  5M3M H;  1HR0 W;  1J5E Q;  1G51 A;  3CCE A;  1VQH A;  1CSP A;  1LM0 A;  2Z0S A;  5FJ8 G;  2B63 G;  1XPR A;  2R7Z H;  1SE8 A;  2WAQ E;  4YWM A;  1G29 1;  5BR8 Q;  4NXN Q;  4DK3 C;  2ALY B;  1GD7 A;  1X3E A;  3KDF B;  3PIP A;  3JAM c;  4GKK Q;  4DR5 Q;  2H5X A;  3I4M G;  2PMZ E;  4POF A;  3CC7 A;  2F52 A;  1DGS A;  3F2C A;  4WJ4 A;  2NVQ H;  1Y14 B;  2K50 A;  4IFD G;  1A0I A;  4JI5 L;  3PO2 H;  5JJK A;  5IWA Q;  2WB1 E;  4DV3 L;  3KJP A;  3CW2 C;  3RN2 A;  4LNQ A;  3T1H Q;  2VQE Q;  1YHA A;  2ASB A;  4A3B H;  1Y1W H;  3PO3 G;  3E9I A;  1KD1 C;  1I5F A;  4KI0 A;  2CCZ A;  1BBU A;  5C0X I;  5IP7 H;  1FVI A;  3UDF A;  4DV5 L;  1P8L A;  2K5V A;  2Q2I A;  3S1N H;  1PHJ A;  3J7A 5;  1TWF H;  4R4O A;  4GN4 B;  1G6P A;  3AQQ A;  4DV7 Q;  4AYB G;  4B3T Q;  2JA5 H;  3CCS A;  2PQA B;  1SN8 A;  4A3D H;  1EIY B;  2YTY A;  2UXC Q;  3VDY A;  4JC0 A;  4DR3 L;  1E3P A;  3J81 i;  4X66 L;  2VUM H;  4A3L G;  4PMW A;  2IX0 A;  1VQM A;  1K3R A;  1FL0 A;  1SRO A;  4B3M Q;  2IT1 A;  2MQH A;  3PUW A;  4LF5 L;  3K80 C;  2HQL A;  1PH5 A;  1VQF A;  4OX9 L;  3T1Y L;  1VQ9 A;  3M4P A;  3M9B A;  4BXX H;  3S1Q H;  1X65 A;  1CKM A;  4DK6 C;  2WAQ G;  1UE6 A;  4JV5 Q;  4BBR H;  2YU9 H;  2R7F A;  4GS3 A;  4JI2 Q;  1N33 Q;  5JJI A;  1FJG Q;  1Q1B A;  3TQY A;  4A3C H;  2OQK A;  1J6Q A;  2VZA A;  1PYS B;  3CAM A;  3HOX G;  1N32 Q;  5HY6 A;  3SGI A;  4X66 Q;  1X54 A;  1Q81 C;  4IO9 A;  4DAY B;  1VQ6 A;  1AE2 A;  2ZJP A;  1PH2 A;  1HR0 L;  2VW9 A;  3K7U C;  1I6H H;  4GKJ L;  2UXB Q;  3BZK A;  2I0Q A;  5C0X J;  3RZO H;  4HIK A;  4JBK A;  3TS0 A;  4LFA Q;  4GOP A;  1Q7Y C;  1HNW L;  3DM3 A;  4MNO A;  1Y1V H;  2K5H A;  3DLL A;  3LGJ A;  4OO1 G;  2A8V A;  4HID A;  1UWV A;  1Y1W G;  5C3E H;  4YHH L;  1JT8 A;  5C44 G;  2N78 A;  4BA1 I;  2WFW A;  4JOI A;  4LF6 Q;  2UUB Q;  1SR3 A;  2AHO B;  2DUD A;  3HKZ G;  4HJ7 A;  2PI2 E;  1VQD A;  2B3G A;  4KLK A;  1SFO H;  4K0K L;  4A93 G;  1FJG L;  2UU9 Q;  3S1R H;  2K4K A;  2ZJQ A;  5C4J H;  1E1O A;  5LMN Q;  2HIX A;  1Q86 C;  1IYJ B;  2GVA A;  4JI1 Q;  5AJ3 L;  4MZ9 A;  1K83 H;  1BKB A;  5GAG C;  2NVX H;  3CPW A;  2BH8 A;  2CWP A;  3JC6 6;  5IYD G;  2KHI A;  4DR2 L;  1EFW A;  1ASZ A;  3HOV H;  1KHI A;  4FDB A;  2L15 A;  1YEZ A;  4DUY Q;  1HNX Q;  2N8N A;  1Z9F A;  3KDF A;  1U5K A;  4JBJ A;  3UE0 A;  1CKO A;  2LXK A;  2PNH A;  2E2H H;  1S72 A;  5GRO A;  1QUQ A;  1L1O C;  4JI7 L;  4LFB L;  3FHW A;  3S2H H;  4OWT B;  4JI3 Q;  1S3O A;  2JA7 H;  2C35 B;  1NJI C;  4WJ3 M;  1UE7 A;  4JI1 L;  1HNZ L;  4QL5 A;  2F4V Q;  4EQ5 A;  1X56 A;  3CCJ A;  2VS1 A;  1RL2 A;  4AYB E;  4A3F G;  3I4N G;  4A3E H;  2EIF A;  4PZ7 A;  3PF5 A;  1V43 A;  2AWN A;  2GVB A;  2K52 A;  4DV2 L;  3GTQ H;  3ICE A;  4JI6 Q;  1B8A A;  2B29 A;  2QGQ A;  3ULP A;  3KOJ A;  1HNW Q;  1H95 A;  1EWI A;  4ALP A;  1TWG H;  2LSS A;  3M7N A;  2B63 H;  1MJC A;  2ZM6 Q;  4TVA B;  2R7Z G;  2VY3 A;  1N33 L;  2KEN A;  1T9H A;  1TWA H;  5IYB H;  1JJG A;  1PV4 A;  3D31 A;  2RF4 A;  2D62 A;  1B70 B;  2VNU D;  2ZJR A;  4A93 H;  5FLM H;  3U50 C;  4LFC L;  2Z6K A;  5JEA J;  1CSQ A;  1X6O A;  4UP7 A;  4APV A;  1BBW A;  3CCU A;  2MO0 A;  1M90 C;  1IL2 A;  1WCM H;  1A63 A;  2A19 A;  2JA9 A;  2EXD A;  4GLA C;  4IPG A;  3W1B A;  4UY8 C;  2JEA I;  3S1M H;  5IYD H;  3L7Z C;  4A3M H;  3G6E A;  3HOV G;  1PH4 A;  3PO3 H;  3HOU G;  5M5W H;  1IZ6 A;  1JB7 A;  2VQE L;  2VQF Q;  1IBM Q;  3CF5 A;  4QGU A;  4A3J H;  1RIP A;  4X64 L;  4HJ8 A;  1L1O B;  3I7F A;  2OTJ A;  3PGZ A;  4O0A A;  2ES2 A;  2EQS A;  5JEA G;  1XMO L;  4JI5 Q;  4R4I A;  1QZG A;  3HOW H;  5IY0 A;  1PH7 A;  4A3G G;  1VQL A;  1N36 Q;  1I94 Q;  1EOV A;  4GKK L;  2MNA A;  4A3F H;  3HOY H;  2KHJ A;  1K73 C;  4JBW A;  1YIT A;  4GNX B;  4AH6 A;  2R92 H;  2RHS B;  2Q2U A;  4HJA A;  4DUZ L;  2ZTC A;  3S15 H;  1VQC A;  2D0P A;  4NPS A;  2HHH Q;  4JBM A;  4KHP Q;  4NB3 A;  4L5Q A;  3T1H L;  1KC8 C;  4DV3 Q;  2Q2T A;  2NZO A;  3ULL A;  3OTO L;  1HJP A;  3PIO A;  4AQY Q;  5C4X G;  2UU9 L;  4JOI C;  1AE3 A;  1GM5 A;  3PCO B;  3ER0 A;  4O2D A;  4X65 Q;  3UDI A;  1IBK L;  1PH9 A;  5IYB G;  4DR7 L;  1K0R A;  5IT9 c;  1GO3 E;  2AMC B;  4HIM A;  3M3Y H;  4DR6 Q;  2NZH A;  3FKI G;  2JEB I;  1XPU A;  4DUY L;  4R4C A;  4XTC S;  1VQO A;  4YY3 Q;  4DR4 L;  3F1Z A;  4B3R L;  4LF4 Q;  1JJ2 A;  1WCM G;  4DV4 Q;  1J5E L;  4YCU A;  2IY5 B;  3PF4 A;  4A3M G;  2JA6 G;  4IPC A;  1HZB A;  2GN5 A;  3PUZ A;  2E8G A;  1SLJ A;  4IJL A;  2D0O A;  4IOC A;  1KL9 A;  2PI2 A;  5GAE C;  4YCV A;  5C44 H;  1XMQ L;  1N32 L;  4A3J G;  1BVS A;  4NXN L;  4B3S L;  4YWL A;  4BY7 H;  4HJ9 A;  1M1K C;  4DAM A;  4X62 L;  4OX9 Q;  2K14 A;  5M5Y H;  3KF6 A;  4L5S A;  3HOW G;  1X3G A;  3GTO H;  3KYH C;  1LYL A;  3RN5 A;  3GTP H;  3W1G A;  2OCE A;  3I2Z A;  2CQO A;  4YY3 L;  1XNQ Q;  1IXR A;  4DR4 Q;  5J3B A;  2JJQ A;  1VQI A;  5LMU Q;  4DR1 L;  5IE8 A;  4OWW B;  2KBN A;  3CPF A;  4LF9 Q;  3W5O A;  2HT1 A;  2R92 G;  1OXS C;  1VQ8 A;  3J80 i;  4GLV B;  5DLQ E;  1VQE A;  1FGU A;  1WYD A;  4IJH A;  5IP9 G;  2ZTD A;  4X65 L;  2NN6 G;  3MEF A;  5C4X H;  4B3T L;  4JI4 L;  2NVT H;  3F2D A;  1CUK A;  1NTG A;  3NEN A;  4DV7 L;  2R93 H;  1YBY A;  3KF8 B;  3PUV A;  1VQ5 A;  2MFI A;  3A0J A;  5M3F G;  3PUX A;  3A5U A;  4DV5 Q;  1K8A C;  4OON A;  4DPG A;  2UUA L;  4YWK A;  1OXX K;  1V9P A;  4JYA L;  1K9M C;  2IHF A;  1E22 A;  1PFS A;  3K0X A;  1UE1 A;  3BZC A;  3HFZ B;  3OYY A;  4X6A H;  3M4Q A;  4Y7N H;  2DGY A;  1YJ9 A;  2YV5 A;  3CD6 A;  1YHQ A;  1E1T A;  1XNR L;  1EQR A;  1W3S A;  3S24 A;  4GOP C;  2JK8 A;  1YZ6 A;  1PH3 A;  4DR2 Q;  1O7I A;  2UXC L;  1UEB A;  2JA6 H;  4DV1 Q;  1L0W A;  4P74 A;  2E2I H;  1OTC A;  2WP8 J;  1VQ7 A;  4JI7 Q;  2ID0 A;  4LFB Q;  3NEM A;  4EX5 A;  1SMX A;  4DV2 Q;  1N34 Q;  4KHP L;  2AKW B;  3OW2 A;  4R1J A;  4JI6 L;  3GTK H;  2UUA Q;  5GQO A;  3RLF A;  5FLM G;  3B6Y A;  1Z47 A;  1VQP A;  4DNI A;  1HZA A;  2V1C C;  4P72 A;  4PZ8 A;  3WWV A;  1IBK Q;  3T1Y Q;  1JMC A;  2FXQ A;  1VQB A;  3D0F A;  2K5N A;  2CFM A;  4BY1 G;  4B3M L;  3H3V H;  3HOU H;  3M85 A;  4OWX B;  2N49 A;  3CXC A;  3PUY A;  2YTX A;  3AFQ A;  4JI0 L;  4LF7 L;  1C0A A;  2Y0S G;  4YHH Q;  1VCI A;  2BH2 A;  4TQU S;  2OWO A;  2I5H A;  4X64 Q;  3I56 A;  4DR6 L;  1OXU A;  2QEX A;  1QVG A;  2ZM6 L;  1EYG A;  4LFA L;  3IRB A;  4GOP B;  4A3G H;  1P16 A;  4JI8 L;  2Y0S E;  1S40 A;  2R93 G;  5GAD C;  2NN6 I;  1K8G A;  2JE6 I;  3U4Z A;  4DKA C;  5IYC G;  3J80 c;  3HOY G;  4A76 A;  3AFP A;  2BA0 A;  1MKH A;  1YVC A;  2YYZ A;  4X62 Q;  4A3I H;  1LUZ A;  4LWC A;  3RR5 A;  3G71 A;  4K0K Q;  2E5L L;  2IHE A;  1PH1 A;  4QIW E;  2OTL A;  3BJU A;  3A74 A;  1E24 A;  1MJE A;  2KCM A;  4DV0 Q;  2JA8 G;  1MIU A;  1X55 A;  1QVF A;  1NBW A;  5FLX c;  1PYB A;  5HGQ A;  4JI3 L;  4P71 A;  1OXT A;  2IX1 A;  1VQ4 A;  3J81 j;  3TS2 A;  3J7Z C;  1XMO Q;  4LUZ A;  4C3I H;  3FKI H;  3HOZ H;  2Z6K C;  5C0X G;  3S14 H;  2ATW A;  3EBE A;  3NEL A;  1IBM L;  3RLN A;  1SRU A;  3STB D;  1HNZ Q;  3GO5 A;  3CC2 A;  2QA4 A;  1VQJ A;  2XTI A;  3CC4 A;  2K75 A;  4BY1 H;  3PSI A;  4A3K G;  1Q1E A;  4IOA A;  4IPD A;  5GAH C;  1GVP A;  2OQ0 A;  2HHH L;  3AYH B;  2UUC Q;  4PG3 A;  3HKS A;  4GN3 B;  4BY7 G;  3CCQ A;  4A4I A;  4IPH A;  1I50 H;  2VL6 A;  1TWC H;  3GDE A;  5IWA L;  4JYA Q;  4B3R Q;  3KLW A;  3JAM i;  5BR8 L;  4JG2 A;  4GKJ Q;  3STB C;  3FP9 A;  3TRE A;  1UE5 A;  5IYC H;  2KCT A;  1PA6 A;  1C7Y A;  3OTO Q;  4AQY L;  5M3M G;  4A3I G;  1QUQ B;  1EIF A;  3RZD H;  3Q8D A;  3BU2 A;  3UE1 A;  4LW1 A;  2UUB L;  4LF6 L;  2MO1 A;  2VQF L;  3CCR A;  4XIG S;  1VQG A;  1EQQ A;  2UUC L;  1XPO A;  5IP9 H;  1EUJ A;  3H0G H;  3ZJY C;  3CCV A;  2JA8 H;  2HIV A;  4Y52 H;  2NVY H;  2F4V L;  4GN5 A;  5LMN L;  4JI4 Q;  4LUO A;  1N36 L;  1NY4 A;  1JJC B;  4RMF A;  5M3F H;  1L2F A;  3MXN B;  4UP9 A;  3CCM A;  2A1A A;  1X9N A;  1I94 L;  1NMG A;  3S2D H;  3GTL H;  1E7Z A;  3PO2 G;  1I3Q H;  4QJF A;  1L1O A;  1LTL A;  2R6G A;  1PVO A;  4NXM L;  4JI0 Q;  1U0L A;  2RHQ B;  3ULJ A;  1KXL A;  3S17 H;  3CQZ H;  4A3B G;  4KHZ A;  3RNU A;  4J15 A;  4DR3 Q;  4R4Q A;  4B3S Q;  4DV6 L;  1B7Y B;  5LMU L;  1XNQ L;  2CKZ B;  1CKN B;  2AWO A;  3A5Z B;  5IP7 G;  3CCL A;  4JI2 L;  4P75 A;  3KFU A;  4BBS G;  1WJJ A;  2CWA A;  2I5L X;  3I4O A;  2JA5 G;  3CMA A;  3EIV A;  4AIM A;  2WB1 G;  4GNX C;  4OXP A;  4BA2 I;  4A3D G;  4OO1 I;  1KRS A;  1N34 L;  1R9T H;  2BA1 A;  2F3I A;  4IFD J;  4C3J H;  3G48 A;  4LF8 Q;  3KJO A;  4NXM Q;  4A3L H;  2LXJ A;  5ELO A;  4RG1 A;  1YIJ A;  1KIX A;  1V1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...