4DV1L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1L00
5GADC 4DR7L 1N32L 1HNWL 3CPWA 1D8LA 3TS2A 2A8VA 2HIXA 1VQ8A 3AYHB 2K5NA 1E1TA 2CKZB 5JEAJ 3CMEA 5IP9H 3STBD 1BBWA 3H0GH 2N3SA 4A3JH 3AFQA 4GN5A 4GNXB 4UY8C 3S2DH 4DR4L 2UUBQ 1ASZA 4JI2L 1YVCA 1PH8A 4R4CA 2FXQA 5M5XH 4A3GG 1PH2A 3EIVA 1J6QA 1X65A 1Y1WG 4JBKA 4J15A 1XNQL 1S3OA 5M5YH 4DV4Q 1B7YB 4LF8Q 2UU9Q 4QQBX 2PQAA 3FHWA 3S2HH 1LM0A 5ELOA 3H3VI 1KIXA 1Y1VH 2IHEA 4YHHQ 2JEAI 3HOUG 2K50A 1EQQA 1C0AA 5AJ3L 5LMNQ 2OQKA 5HGQA 1PYSB 4KI0A 1SR3A 1O7IA 3IRBA 1OTCA 4BA2I 3I2ZA 4B3TQ 1WFQA 3F2BA 4POGA 3RZOH 2Q2HA 3PV0A 3ULLA 4DV7Q 2HHHL 3KJPA 2VL6A 3HOVG 3M4OH 4UP8A 2UXBL 5IYDG 5H1SE 4GOPA 4K0KQ 4LW1A 4A75A 2AKWB 3M4PA 4YCWA 2OQ0A 1VQIA 2AHOB 3CC4A 1VCIA 4LFAL 1XNRL 3CP0A 3CCEA 2JJQA 4Y7NH 4DR7Q 1N32Q 1HNWQ 5IT9c 1GD7A 3JAMc 1KHIA 2KHJA 4DV6L 2CWPA 3UDXA 2IHFA 2NN6G 2XTIA 3RR5A 1PH7A 4JBJA 4KLKA 4A3MG 5M3FH 1GO3E 2I5MX 4YY3Q 3K8AA 1J5EL 3I56A 4DR4Q 3I4NG 4FDBA 2JA9A 2VW9A 2F4VL 2RHQB 2JK8A 4AIMA 2LXJA 4X66Q 2A1AA 1CKMA 3G71A 4MNOA 3WWVA 2R93G 2B3GA 1XPRA 2E2IH 3HOYG 4TQUS 4A3EG 1UE5A 2MO1A 4QY7A 3ULJA 1QUQA 1VQ7A 1PYBA 4HIKA 2Q2TA 4DKAC 2NVXH 1OXTA 4LF4L 1L2FA 1NBWA 1Y1WH 1M90C 1PH4A 4YCUA 2BH8A 4BBRG 2ZJRA 4IFDJ 2IX1A 4MTNA 1K83H 2K4KA 1FL0A 4DUYQ 5C4XG 2E8GA 1PHJA 2HT1A 1KQSA 3K81C 5K36G 3E0EA 1OXUA 1WI5A 3KYHC 1L1OA 3HOXG 1QZHA 4X64L 2HHHQ 2EXDA 4NXML 1JT8A 1N34L 4R4QA 1SE8A 3B6YA 3GD7A 3I55A 2KENA 2UXBQ 1IBKL 4DR1L 1GKHA 3OTOL 1VQMA 1X54A 2EIFA 4OX9L 1VQ5A 2YTVA 1FVIA 1NE3A 4NXNL 1XNRQ 4GLVB 4LUOA 1TWFH 3CCSA 1VQFA 1PH3A 1A0IA 1IZ6A 1NJIC 3HOWG 1K8AC 1WJJA 1X9NA 4A3IG 3HOVH 4DV6Q 3S1NH 1QVGA 3UDGA 5IYDH 2Z6KA 4RG1A 1MJEA 2PI2A 1Y14B 4NPSA 4OWTB 4IFDI 2UUBL 1I94L 2R7ZG 1J5EQ 1Q12A 1VQBA 2VY3A 2F4VQ 4GOPB 3J81c 4A3LG 1E22A 4AQYL 1QZGA 4IPHA 4DV4L 2VQEL 1B70B 2UU9L 1RL2A 4YWMA 4A3MH 3HKZG 1YNXA 2ZJPA 4YHHL 1JJ2A 1G291 2LXKA 3RNUA 2RHSB 2BA1A 3UDFA 3J80c 4X62L 1Q86C 4LF4Q 3D31A 4KHPL 1KRSA 1UWVA 3CAMA 3JC66 1PH1A 4BXXG 3MXNB 1XPOA 4DR5L 4JI1L 1CKNA 1VQNA 1LTLA 2JA5H 1KL9A 1I50H 4PZ8A 1IBLL 1UE6A 2WAQG 4A3CH 3F2DA 2MQHA 3FKIG 1D7QA 2GVBA 4JI4L 1VQKA 1JJGA 4B3SL 4LF6L 1KC8C 4BBRH 2KCTA 4IO9A 4NXMQ 2VUMG 1B8AA 4OWXB 1I5FA 3G6EA 1N34Q 3ER0A 3NEMA 1LUZA 3GTMH 1IBKQ 1BVSA 4BBSH 2WB1G 3I4MG 1WCMH 3ULPA 3G4SA 1I3QH 1HNZL 3HKZE 5LMNW 2H5XA 4IJHA 3S15H 1HZCA 2MO0A 4IPGA 2OWOA 2HIVA 2D62A 4DV3L 4YY3L 1DGSA 1L0WA 5GAGC 1I94Q 4DV2L 1Q82C 1BBUA 2B63H 3J7ZC 4X66L 4L5TA 1PFSA 4R1JA 4A3IH 4YWKA 2YU9H 4DNIA 3GO5A 2UUCL 4R4TA 4AQYQ 2VQEQ 1Q81C 2VZAA 1YIJA 3GTOH 3CCVA 4WJ3M 2JA6G 3PUYA 2RCNA 2R7ZH 1XMQL 1W2BA 3L0OA 2GVAA 5HY6A 4X62Q 2ES2A 3KF8B 1FJGL 1XMOL 1C7YA 4KHPQ 3S1RH 5IWAQ 1XTDA 3KF6A 4Y52H 3ERSX 3PUZA 4DR5Q 4JI1Q 4LUZA 3U4ZA 4JI3L 3T1YL 4QL5A 4DUYL 4QIWE 4A76A 4DR2L 4R4IA 1HR0Q 5GAHC 1IBLQ 4JOIC 5GROA 5FLMH 4JI4Q 1IXRA 1SMXA 3OYYA 5JJKA 4B3SQ 3HOZH 1P16A 2EQSA 4X6AH 1K0RA 4LF6Q 1X3EA 4L5QA 2YTXA 4GLXA 2ZJQA 3JAMi 3CCLA 1VS0A 4JI6L 2K75A 1E3PA 4DR6L 1VQCA 2BA0A 2N49A 1YJ9A 4JV5L 2NVTH 4DR3L 3M9BA 3S1QH 1HNZQ 3A0JA 3S14H 3CD6A 2ID0A 4K0KL 2Q2IA 3K80C 2JA8G 1PVOA 3KDFA 1A63A 1JE5A 1R9TH 5E7NA 3PUXA 5C0XJ 4DV3Q 3T1HL 4C3HH 3RLOA 1CKOA 4DPGA 3PIOA 1OXVA 4JI0L 4LFBQ 4DV2Q 1EFWA 1VQ4A 3D0FA 3F8TA 4HJ9A 2UUCQ 3J81j 2ATWA 3TRZA 1VQLA 2K52A 1UEBA 2VQFL 5GAEC 1XMQQ 1Q7YC 1SLJA 2Z0SA 4A3GH 1BKBA 3GDEA 2F52A 5M5WH 1FJGQ 1XMOQ 5IYBG 2JEBI 4LUVA 1EYGA 1CSPA 2E5LL 3T1YQ 2UUAL 4JI3Q 1AE2A 3GTPH 2JA6H 1S72A 5IP7G 3S24A 5FJ8G 4JBMA 3PUWA 4DR2Q 1YBYA 4GN4B 4MZ9A 4A3KG 3HOUH 4LF7L 2R6GA 5C0XI 4POFA 2PQAB 4LWCA 4DK3C 3TEHB 1PH9A 3CCRA 3NBHB 4JI6Q 1HZ9A 4DR6Q 1PH5A 2JA7G 1KXLA 4BY7G 5JEAG 4JV5Q 4A3DG 4DR3Q 4GOPC 1E7ZA 1OXXK 3BZCA 1RIPA 2PMZE 3CCJA 1TWHH 1X6OA 3CW2C 4GS3A 1E24A 1SN8A 4OXPA 1VQOA 1TWAH 3J81i 4BY1G 2A19A 2ZTCA 4A3BG 1VQJA 4A4IA 1CUKA 2BH2A 1IBML 1PH6A 1HZBA 2I5LX 1NY4A 3T1HQ 2JQOA 4WJ4A 1K73C 3W5OA 3BU2A 4A3FG 4JI0Q 2IT1A 3CMAA 4GNXA 4AYBG 2K5HA 1A62A 1U5KA 3J80i 3RN5A 2D0PA 2KBNA 4XTCS 1K3RA 1HNXL 1XJVA 4UPAA 1GM5A 2I0QA 5IP9G 3I4OA 4A3JG 1YEZA 3VDYA 2MFIA 2VQFQ 3I4NH 1MIUA 4A93G 3RLNA 2DGYA 1FGUA 4UP7A 2CCZA 3U4VA 3G48A 2WP8J 5IWAL 2R93H 3HOYH 2OTJA 1WYDA 4A3EH 2JE6I 2E5LQ 1Q1EA 2UUAQ 1IL2A 3KFUA 1HR0L 4PZ6A 3PGZA 5IY0A 3GTQH 1CSQA 1QVCA 1V9PA 2KCMA 3SGIA 4XIGS 2QEXA 4LF7Q 3GTJH 1NTGA 2CQOA 5IYBH 4DUZQ 2QGQA 4JI7L 1QUQB 1X55A 3A5ZB 4UP9A 5LMUL 4HIMA 3F1ZA 3M7NA 5FJ8H 1HH2P 5C4XH 5IP7H 1EIYB 1SROA 3GTKH 3PO2G 4AYBE 3H3VH 2NZHA 4JI5Q 5C44G 1G6PA 3HOXH 1YJWA 3BJUA 4JOIA 2B29A 5IE8A 1XPUA 3F2CA 4OONA 1IYJB 1TWGH 4AH6A 1VQ9A 1HR0W 1L1OB 4L5RC 1IBMQ 1KRTA 3HOWH 4LFBL 3K7AH 5C3EG 3M85A 2YYZA 2Z6KC 2PNHA 3NELA 1Q1BA 4YWLA 1GVPA 2C35B 2NN6I 2WAQE 3HKSA 1LYLA 3PSIA 3BZKA 3DLLA 4O0AA 4HJ7A 1HNXQ 3M3YH 4BY1H 1C9OA 1VQEA 3PIPA 2N8NA 2Q2UA 1YHBA 4IFDG 4A3FH 2L15A 3TS0A 3S16H 4L5SA 4A3LH 3PO3G 4JI8L 2K14A 4PZ7A 2WB1E 3RN2A 3AEVA 4ME3A 5BR8Q 4JCVE 4IJLA 3W1GA 3CCMA 1YITA 1Q46A 4GN3B 2OTLA 1Z9FA 4OO1I 3KOJA 1N8RC 5ELNA 4A93H 1NMFA 4LNQA 4ALPA 3PF4A 4B3RL 2UXCL 4BXXH 3KLWA 1Q8KA 2QA4A 3CC2A 4JI7Q 3CCQA 3W1BA 5LMUQ 2R7DA 1E1OA 3FKIH 1OXSC 3K7UC 1UE7A 1I6HH 1K8GA 4EX5A 2ALYB 2DUDA 2XGTA 3S1MH 1CKNB 1N33L 3CQZH 3AFPA 3E9HA 4HJAA 2VUMH 1Z47A 2K5VA 3TQYA 3PCOB 5GQOA 3UDIA 1G51A 1N36L 2PI2E 4DV1L 4R4OA 4TVAB 4BA1I 1PV4A 4B3ML 4GKJL 3PO2H 3KJOA 4JBWA 4JC0A 3I4MH 5C44H 1YZ6A 2R92G 5M3MG 3EN2A 4P72A 4HIOA 1SFOH 4DV5L 1K9MC 3PF5A 3U58A 4EQ5A 3RZDH 1P8LA 4LF5L 5FLXc 4GLAC 1VQDA 3PUVA 1X3FA 2MNAA 1A8VA 1U0LA 1V1QA 1N9WA 4KHZA 1QVFA 4IPDA 5JJLA 2IX0A 4H02A 4RMFA 5C3EH 1MKHA 5IYCG 2VNUD 1VQPA 4HJ5A 4APVA 4JI8Q 3UE1A 1UE1A 2HQLA 1TWCH 4C3JH 4X65L 2NVQH 3DM3A 4YCVA 1JB7A 4QJFA 1MJCA 3E9IA 2CWAA 3RLFA 4IOAA 4JI2Q 4QGUA 3CCUA 2UXDL 2GN5A 4DV0L 3PO3H 4DUZL 4B3RQ 2UXCQ 4JYAL 3L2PA 1XNQQ 1VQ6A 2OCEA 4IPCA 2JA5G 3AQQA 4A3CG 4JI5L 3FP9A 1S40A 5JJIA 4OO1G 3MEFA 1V43A 3KF6B 3CC7A 3ZJYC 1T9HA 2AWOA 4LFCL 2ASBA 1N33Q 5AJ3Q 1AH9A 3K0XA 1EWIA 2R7FA 3M4QA 2ZM6L 3CF5A 4HJ8A 1KD1C 1N36Q 2F3IA 4DV1Q 5C4JH 2NZOA 3UE0A 4GKKL 4B3MQ 1EOVA 2I5HA 4LF9L 4GKJQ 1HJPA 1NMGA 4BBSG 3GTGH 1SRUA 4PG3A 1WCMG 1W3SA 4HIDA 4OX9Q 2VS1A 1YHAA 4DV5Q 4LF9Q 2KHIA 4LF5Q 4PMWA 2JA8H 2Y0SG 3A74A 2LSSA 3ICEA 4OWWB 1VQHA 3H0GG 1YI2A 1HZAA 1VQAA 2E2HH 4LFAQ 2AWNA 2CFMA 3EBEA 3HFZB 5M3MH 2R92H 1X3GA 3TREA 5EAYA 3A5UA 2B63G 1H95A 2WFWA 3KDFB 5J3BA 1PA6A 3H15A 3OW2A 1EIFA 1YJNA 2ZTEA 5BR8L 1WOCA 1AE3A 1X56A 2YTYA 3Q8DA 4X65Q 1JMCA 4P75A 2E2JH 1JJCB 1Y1VG 3L7ZC 5IYCH 1KAWA 3I7FA 1M1KC 2UXDQ 4DV0Q 4IOCA 4LF8L 4JYAQ 4C3IH 3U50C 3LGJA 4O2DA 3CXCA 1EQRA 1L1OC 4DAMA 4NB3A 1TXYA 2YV5A 4A3KH 2RF4A 4C2MH 5FLMG 1ASYA 4JG2A 2Y0SE 4P74A 2V1CC 5LMNL 1YHQA 4LFCQ 3J7A5 5C0XG 3HOZG 2AMCB 2ZM6Q 2NVYH 4P73A 4B3TL 3S17H 3GTLH 1VQGA 3NENA 1EUJA 4GKKQ 2JA7H 2D0OA 4BY7H 4P71A 4A3DH 4DV7L 2ZTDA 4X64Q 4DAYB 4DK6C 3CPFA 4A3BH 4DR1Q 3OTOQ 2IY5B 2N78A 5M3FG 3STBC 4GNXC 5DLQE 4NXNQ
chains in the Genus database with same CATH superfamily
5GADC 1HNWL 3C3LA 3CPWA 5M3FB 3VR2A 1SE2A 4IALA 1A2TA 2K5NA 3CMEA 1BBWA 3H0GH 2HQEA 3ND9A 3S2DH 1STHA 2E2IB 3EIVA 5KYLA 5HURA 1SEBD 3OHXC 2NTSA 3K57A 4J15A 1B7YB 2PQAA 3FHWA 4PQXA 4PV1C 2JEAI 2IHEA 5KNDA 5CBEE 1C0AA 1EU4A 4KI0A 4RGTA 5ELCA 2F0OA 1WFQA 3RZOH 2VB3X 1TS3A 3HOVG 5IYDG 4NMZA 5H1SE 1VQIA 3HOVB 3CC4A 4RGNA 1DZ1A 2F0KA 2K7VA 4LFAL 3CP0A 2LMCB 3CCEA 1NUCA 4RFBA 4Y7NH 4DR7Q 5I2XA 1PRTC 4ZRZA 1PH7A 3J81E 4KLKA 2QDBA 3I3CA 2I5MX 4S3SA 4DXFA 1TS2A 1CZWA 3I8ZA 2Z9HA 4FDBA 2VW9A 2HCCA 4AIMA 2LXJA 3URYA 2A1AA 3G71A 3WWVA 1PRTD 1U4LA 3J80E 2R93G 2B3GA 1UE5A 4QY7A 3ULJA 1QUQA 3LX0A 1VQ7A 2R93B 4HIKA 2Q2TA 3K5OA 3A54A 2NVXH 1Y1WH 1CK1A 4YCUA 5IODA 3K5MA 4IFDJ 1K83H 2F0MA 1Y8NB 1ZEQX 3K81C 1OXUA 1PZKD 1QZHA 4NXML 3GD7A 3B6YA 2UXBQ 4F87A 1IBKL 3OTOL 1I3QB 2YTVA 1XNRQ 3HOWG 4LUOA 1LTTD 1K8AC 5C5LA 1WJJA 4A3IG 3QWNA 1QVGA 4KKTA 4RG1A 2PI2A 1Y14B 4JK1C 4A3IB 4OWTB 3T4AC 1Q12A 4GOPB 3J81c 1E22A 2NN6H 1QZGA 2VQEL 1B70B 4CDEC 2ZJPA 3RNUA 2RHSB 3J80c 2EY1A 1O7YA 1Q86C 3FDTA 4N8X1 5BN4A 1KRSA 2J4XA 2XVSA 3JC66 1WTOA 1CKNA 2FFKB 2JA5H 3D3RA 1KL9A 1S5BD 1UE6A 2EVBA 2IPKD 5I4DA 3FKIG 4A3CH 1D7QA 5CYUA 1G2TA 5I2YA 4B3SL 3FKIB 1KC8C 2VUMG 1AZPA 5IGCA 1B8AA 4OWXB 1I5FA 3I73A 3GTMH 1X32A 2VUMB 4C3HG 2N55A 3QR8A 1R9TB 5LMNW 1L0XB 1GUSA 3S15H 4HEDA 4C3HB 4QIWB 5FLXE 4M1UB 1L0WA 1I94Q 5F2DA 1PFSA 4DNIA 3GO5A 2UUCL 1Q81C 3MFGA 3GTOH 3CCVA 2JA6G 3PUYA 4DAPA 1XMQL 2GVAA 5HY6A 2SDFA 3CU7A 1VMPA 2JA6B 1H9JA 1C7YA 4IUQA 4Y52H 3ERSX 3PUZA 4DR5Q 4LUZA 2B2VA 2EYLA 2F0QA 4XYQA 1HR0Q 5FLMH 3HOZH 1K0RA 4LF6Q 2YTXA 2ZJQA 1TY0A 2Z8LA 1VMCA 1U4PA 1GUOA 1MBYA 1G6ZA 1TWHB 1QJOA 5KEEA 3S14H 3R8BA 1EY9A 2Q2IA 2JA8G 1C48A 4X3TA 5E7NA 4DV3Q 1BOSA 1IKLA 1CKOA 3OWEB 4LFBQ 1CHPD 1WTWA 2MGSA 3F8TA 3EFXD 4G57A 2ATWA 2X6LA 4ZKCB 1UEBA 3N52A 3HOYB 1HPCA 3GDEA 2F52A 2PMZB 1FJGQ 4Q5VA 3MFYA 1CSPA 3T1YQ 4JI3Q 4KN4C 3GTPH 1T5EA 1ENCA 4DR2Q 1BCPF 4A3KG 2RDFA 5JPMC 2R6GA 3GTKB 4LWCA 4DK3C 1B1ZA 3TEHB 3CCRA 1KXLA 1SNMA 4DR3Q 1OXXK 3CW2C 1SYDA 2IWHA 4K0KQ 1SN8A 4RA8A 1IBML 3T1HQ 2QCPX 4JI0Q 1I4QA 4AYBG 3RN5A 2F3WA 1GM5A 1DOKA 3DHQA 2DY8A 1YEZA 4AYBB 4A93G 2DGYA 4UP7A 2CCZA 2EY5A 2Z1CA 3KLSA 4A93B 3HZXA 2UUAQ 5BN5A 3KFUA 1HR0L 4PZ6A 3PGZA 5IY0A 1QVCA 2KCMA 3E5SA 5C4HA 1K8OA 4LF7Q 1CQVA 2F0EA 2E76C 1NTGA 5IYBH 4JI7L 2QGQA 1X55A 3A5ZB 1HRJA 3CQZB 1HH2P 5FJ8H 5IP7H 2MPMA 4ZQ3A 1G6PA 1YJWA 3SK5A 2SOBA 2O5IC 3I4MB 1XPUA 1WTXA 3NPPA 1BNZA 4OONA 1IYJB 1VQ9A 2A6EC 4LFBL 3ZYYX 2PNHA 3NELA 2WAQE 4ZCKA 1EL0A 3JAME 2N8NA 2GA4B 2A6ED 3AU7A 2Q2UA 5G3LD 3S16H 3PO3G 2NYZD 4PZ7A 2WB1E 5BR8Q 3PO3B 2E75C 2FJ2A 1PMRA 3HRZC 1BBXC 1NMFA 3CC2A 3VYRA 1LT4D 2L12A 4FP5D 3CCQA 3W1BA 1FNWA 1OXSC 2G9DA 5DEHA 1UE7A 2EE1A 5JVH3 1C8CA 4EX5A 3S1MH 5C4JB 4NKLA 3TQYA 1S4ZA 3PCOB 1G51A 1V1OA 4DNTB 1N36L 4DV1L 1FNVA 3D4DA 3MXUA 2P5ZX 4TVAB 4CKBA 1V1PB 4GKJL 1AFPA 4JC0A 1IKMA 5C44H 4MIUA 1YZ6A 2R92G 3GV3A 5M3MG 4HIOA 2BDOA 5EBCA 3TZUA 3PF5A 4LF9L 4EQ5A 3RZDH 1P8LA 1VQDA 4JW0A 2R92B 3PUVA 5M3MB 1V1QA 2K33A 1N9WA 3NHHA 4KHZA 1QVFA 5JJLA 1H9SB 2WIIB 2QDLA 2FMMA 2NTTA 5C3EH 1IYVA 3MWYW 4HJ5A 4JI8Q 5HGTA 1OO9B 1TWCH 1HQMC 5LHY1 4QJFA 1MJCA 2CWAA 2F0LA 3A7AB 4C3IB 3P7JA 3UI2A 2B2VC 4B3RQ 5KNBA 3VA7A 5CV4A 1VQ6A 4FXDA 5CBAE 2JA5G 4A3CG 1IL8A 1NR2A 1S40A 5TSSA 2ASBA 1T9HA 2AWOA 2RQXA 3GTLB 1N33Q 4GZYC 5AJ3Q 4CJ0B 3BDOA 2TMPA 4RHRA 4HJ8A 1ESRA 4KKSA 3QO2A 3UE0A 3VR5A 5D65A 2I5HA 3EJIA 3WDNA 1SRUA 2L11A 4A3BB 2B2TA 4HIDA 4OX9Q 1F9QA 2C5CA 4G7HC 4LF5Q 2CW0C 2LSSA 2VXWA 2X69A 5D3IB 3E3XA 5KNCA 2E2HH 3TREA 2B8FA 3KDFB 3OW2A 2CW0D 1BCPB 2ZTEA 4LMQD 5BR8L 1AE3A 4X65Q 4P75A 1RD9D 2E2JH 3EQLC 3L7ZC 4OHJA 5M5YB 2F0NA 4DK0A 1S5DD 3EVQA 2J7ZA 4LF8L 1UEAB 5CV9A 1L1OC 1TXYA 3TP7A 5FLMG 4C56C 5LMNL 3HOZG 2N88A 1UNSA 4QUCA 1B44D 4P73A 3S17H 1VQGA 4GKKQ 4NP5A 2JA7H 4BY7H 4FF1A 4CDFC 4A3DH 4DV7L 2QKIC 1F2ZA 2XSCA 4DAYB 3BG3A 3U9OA 4RKBA 2N78A 1LTID 3S14B 1N32L 2D5DA 1EY0A 4I7ZC 1VQ8A 4WORA 1PFMA 1WTRA 3AFQA 3TP5A 1MHWC 4ME5A 4R4CA 2FXQA 3A56A 5M5XH 1J6QA 2AQ3B 4JBKA 1F9PA 2UU9Q 4RCNA 3H3VI 1KIXA 1Y1VH 1ZKOA 3J7AF 5AJ3L 5ELFA 4J8QA 2F0JA 4V190 3DEPA 2EY2A 1O7IA 3I2ZA 1JWSD 1HUMA 5I6YA 4HR7B 1JOOA 3PV0A 3FPPA 3M4YA 3M4OH 4UP8A 2XNAC 1HXYD 2L4NA 4LW1A 2XIWA 1CHQD 2AHOB 2WINB 1HNWQ 3BYYB 2KHJA 2CWPA 4G7OC 1JICA 1SNOA 1LT5D 5DAUA 4B9XA 5IGEA 4A3MG 3K58A 4RGMA 1ZXTA 1J5EL 4ABNA 3P75A 2F4VL 4A3MB 5CC4A 2Z4IA 2IX3A 5EPJA 1EFID 3R2TA 1K3BC 4FXKC 4DKAC 1I50B 2DY7A 2ZJRA 4B9WA 4MTNA 2K01A 2K4KA 4DUYQ 1D2BA 2E8GA 1KQSA 2KEEA 5K36G 1RJTA 1SNQA 2EXDA 1JT8A 1SE8A 1GKHA 4IUUA 1VQ5A 1NE3A 2A69C 3RD4A 1TWFH 1Z6HA 1IZ6A 1TY2A 3S1NH 3UDGA 2I07B 4KKUA 1ENAA 4PMCA 4UHVA 2A69D 4IFDI 2R7ZG 5C6AA 2R7ZB 2UU9L 3GV6A 3HKZG 1YNXA 1TQOA 1STEA 1KDBA 1JJ2A 1G291 3S1RB 3OIPA 4X62L 1SE4A 4K5VA 3HKZB 4KHPL 1UWVA 3MXNB 1WVLA 4JI1L 4U68A 1VQNA 2B2WC 3R3OA 4PZ8A 2WAQG 1MSHA 2MQHA 2F0GA 1KDAA 1YNND 1RKNA 1VQKA 4OO1H 1V1PA 5JPNC 1JJGA 3NUCA 5A35A 4BBRH 4NXMQ 1IBKQ 1STNA 1BVSA 2B2TC 4TSSA 2WB1G 4MTKA 5L37A 1WCMH 3G4SA 2F0HA 4IJHA 2WB1B 3KLRA 2MO0A 3GQBA 5T1GA 1NAPA 3Q22A 1SBBB 1BBUA 1TT2A 3J7ZC 2B63H 4R1JA 3MXGA 2YU9H 5T1IA 4R4TA 2R3ZA 4C1NK 2VQEQ 2KEDA 2RKSA 2RCNA 3L0OA 3P20A 5KYIA 1TWCB 2TSSA 3U4ZA 2XWBB 4DUYL 1ILQA 4R4IA 1F9RA 5GAHC 4JOIC 3H6MA 5GROA 4OEMB 1IXRA 1SMXA 3OYYA 3K59A 5JJKA 4B3SQ 1P16A 3BVGA 1X3EA 4L5QA 4LJZC 4EQPA 1VS0A 1AZQA 4KY7A 1PRTF 4DGZA 1RTNA 1VQCA 3OMGA 1YJ9A 4JV5L 1ET9A 4DXGA 3FMCA 1PVOA 1IHZA 3L9AX 4IURA 3KDFA 4N9TA 4FF3A 1A63A 1TS4A 2B2YA 3TSSA 3NWSA 2R61A 3NBIA 4RAUC 3D0FA 1FR3A 2UUCQ 3J81j 3ND8A 1VQLA 4X3SA 5GAEC 1XMQQ 2Z0SA 2WKDA 5EJWA 2L1BA 4H13C 1EYGA 3GTJB 4XDXA 3S24A 3PUWA 4GN4B 3NE5B 4MZ9A 3HOUH 1SJED 3CHBD 5ISRA 3P1HA 1PYWD 1FYCA 5FO7B 4LK1C 1PH9A 3NBHB 3NTIA 3C1FA 4DAYA 1WD0A 3J7YW 1F2MA 4K2KA 3S9WA 1STYA 1PH5A 2JA7G 4BY7G 4A3DG 1TWGB 3S17B 3BZCA 2WV6D 3HOWB 3KLSX 4CKCA 1TWAH 4O1NA 3J81i 3J81L 1CUKA 1PH6A 1HZBA 2F0TA 2H1EA 2JQOA 3W5OA 3BU2A 1M4VA 2IT1A 5FOBB 3CMAA 1AEXA 2K5HA 2OEOA 1A62A 3J80i 5I9OA 3J80L 3F2UA 1HNXL 4K6DA 3EROA 1LTBD 3BS1A 3QB3A 2MFIA 4R9WA 3J7AV 3I4NH 2F0PA 1EQVA 3FEWX 5CR3A 5CV6A 4K5XA 2WP8J 3U4VA 3FPUB 3OIQA 2OTJA 1WYDA 2G5DA 4A3EH 2KQ3A 1IL2A 5D14A 1CSQA 2HD3A 3SGIA 3GTQH 1T5XD 4XIGS 4I7AA 2PZTA 2CQAA 4DUZQ 1C4QA 2A74C 3C1EA 3R93A 4K8JA 5LMUL 4HIMA 3M7NA 5C4XH 1EIYB 1PDQA 1QG7A 5EKKA 2NZHA 2SNMA 3RUZA 3HOXH 2PCFB 3BJUA 3G6JB 1SFOB 5EQ0A 4AH6A 4L5RC 4G4KA 1IBMQ 3M4OB 3K7AH 3M85A 2NN6I 1O80A 1LYLA 1LT6D 3BZKA 5IT9E 4O0AA 3M3YH 4BY1H 1VQEA 5EKLA 1QNKA 2DJGC 4OL7A 3PIO3 4IFDG 1JWUD 3HG9A 4OELB 4A3FH 2RDHA 1SNDA 3TS0A 2RCFA 4L5SA 4A3LH 4XYOA 2K14A 1KLUD 1KLGD 1JOQA 1XXGA 4IJLA 3W1GA 4GN3B 1Z9FA 3KOJA 4HN7A 5A2QE 1Q3LA 2UXCL 4BXXH 4XT1B 1Q8KA 4JI7Q 1CTMA 2PZUA 1I6HH 1GUWA 4DFAA 2DUDA 3AMUA 1XX8A 1CI3M 2RVLA 3AFPA 2BOSA 2Q8TA 2M2LA 4BWGB 2PI2E 4R4OA 3BVMA 3D4WA 4KD4A 5FLXL 4B3ML 3PO2H 3KJOA 2IW3A 2JA8B 4I65A 4DV5L 3U58A 5FLXc 4K2LA 1TWFB 1X3FA 1SYEA 2IX0A 5EPLA 4B08A 1JB3A 1L0YB 4HMIA 1MKHA 5CGKA 5IYCG 1SNCA 4APVA 2E2DC 2MJ8A 2HQLA 4C3JH 1KNAA 2NVQH 3DM3A 4YCVA 5KGUA 3MXNA 1VDZA 4JI2Q 4K6LA 4QGUA 3CCUA 2UXDL 2F0DA 4DV0L 4DUZL 1B9MA 3DEOA 3E6ZX 4A3KB 4JYAL 1PRTB 4C2MB 2K5QA 3G7LA 2JP1A 5JJIA 4OO1G 3MEFA 1V43A 4KHVA 2PPBC 1AH9A 3K0XA 2R7FA 1N36Q 1PTOH 4BS9A 3NXWA 4DV1Q 2NZOA 1EOVA 4GKJQ 2LKVA 1RHPA 3GTGH 1HHVA 4PG3A 1WCMG 1DYQA 4LF9Q 3MHBA 5I9PA 4PMWA 3OOCA 2Y0SG 1CA6A 4ODGA 4OWWB 3H0GG 4FNFA 1HZAA 1WTHA 3TDQA 2Y0SB 1ZYRC 2B63G 1H95A 2WFWA 3H0GB 4IUNA 4N9PA 3S2DB 1EIFA 1O78A 4QUFA 3PIP3 1X56A 2EPBA 1JMCA 1LV9A 3U9SA 4EVOA 1ZYRD 1F2LA 4IOCA 1WD1A 3A8IE 3LGJA 1A6XA 3CXCA 2JSOA 2L5TA 2YV5A 2J0TD 2EYMA 3OSOA 1ASYA 1YHQA 1A15A 2V1CC 1JQYD 4FO2A 5G3LF 3RZOB 2NVYH 4B3TL 1KABA 1AW7A 4P71A 3MVVA 4X64Q 1GHJA 1I6VC 2F1MA 1TU2B 3CPFA 4Y7NB 4DR1Q 2IY5B 5ELOA 4NXNQ 5DM63 1EZ6A 3TS2A 2QEJC 1DM0B 4CHTB 2CKZB 5JEAJ 4A3JH 2N3SA 1HTPA 1TVXA 4GN5A 4GNXB 4DR4L 2UUBQ 4JI2L 1PTOC 2RA4A 2JXMB 1Y1WG 1LABA 1S3OA 4LF8Q 3D6CA 4QQBX 2NVXB 1Y1WB 5J1ZA 4YHHQ 3SE0A 4G7ZC 3IFTA 1DOMA 1PTOD 2F0WA 3HOUG 1K83B 2O4XA 3T16A 1SE3A 1EQQA 5LMNQ 5HGQA 1EIHA 1SR3A 3HOUB 1K28A 1OTCA 1RF2D 4X3UA 3W3AA 3F2BA 4POGA 1F9SA 3VYTA 4DV7Q 3ULLA 2HHHL 3KJPA 5C0XH 4ZK9B 2RSNA 4GOPA 2AKWB 4YCWA 1NNXA 1EYCA 2OQ0A 4J6HA 1VCIA 5JVG3 4L8JA 2FMCA 1N32Q 3JAMc 4N8FA 1R4PB 5DNFA 4DV6L 1STBA 2NN6G 1ILPA 2XTIA 2F0UA 2L55A 5M3FH 1GO3E 4YY3Q 4C1NI 3I4NG 2KHSA 2EYPA 4RH6A 2JK8A 4KV6A 4X66Q 1CKMA 3DWQA 3OW7A 2E2IH 1QNUA 4TQUS 4A3EG 4PNYA 2HDLA 1PYBA 2Q8IB 4LF4L 2JA5B 1TS5A 1NBWA 2Z4HA 2HCIA 1DCZA 4EGVA 1PH4A 1M90C 2BH8A 1B9NA 2IJ0A 5C4XG 4NDXA 2HT1A 2QW7A 3GTMB 3KYHC 3HOXG 5C4XB 1JCKB 1PZJD 5EBDA 4X64L 1N34L 4R4QA 4E6IA 2KENA 5AFWA 4DR1L 1VQMA 4J1MA 3HOXB 4KTAA 3MTSA 2EIFA 5D3DA 3S15B 4NXNL 4ZUIA 3BVZA 3CCSA 1NJIC 2PQEA 1X9NA 3HOVH 3SK4A 2F0VA 5IYDH 2Z6KA 1HFNA 3NP8A 4NPSA 2EJMA 3X3MA 3VR4A 2UUBL 1J5EQ 1VQBA 5K5PA 3GTOB 3C46A 2F4VQ 1Q8IA 3SK6A 4A3LG 2CHBD 1D1IA 4AQYL 1B50A 4HSVA 1SNPA 2RBMA 4YHHL 2LXKA 3UDFA 4BXXG 3CAMA 5CMDA 2ZXPA 1XTCD 1IBLL 3HOZB 3F2DA 2GVBA 4JI4L 1BO0A 3BDCA 2M9VA 4ZUJA 4IO9A 3SEBA 3G6EA 2F03A 3NEMA 1S5ED 3QOJA 1I4HA 4BBSH 3OWFA 1I3QH 1HNZL 4FVMA 1LTRD 2H5XA 1NCVA 1HZCA 1IW7C 2OWOA 2HIVA 4TKOB 3D4RA 4YY3L 5GAGC 2F0SA 4DV2L 1Q82C 4X66L 4L5TA 4A3IH 4YWKA 2KECA 1IW7D 1YIJA 4WJ3M 1Z7TA 1D5MC 1CFMA 2EYHA 1W2BA 1BXTA 4X62Q 1WTVA 3GTPB 1XMOL 2KCNA 4KHPQ 5IWAQ 1XTDA 1NSNS 4JI1Q 1BDOA 3TP8A 4QL5A 4QIWE 2D9UA 4UDUC 1U4RA 4RWSC 1EIGA 3SK8A 4GLXA 4JI6L 1LLRD 3CCLA 2K75A 3NK9A 3HGBA 4DR6L 4O42A 2N49A 2KJXA 3CKIB 3DUZA 3S1QH 3T53B 3CD6A 1KAAA 1YNJC 2G9HD 4TRDA 5IOCA 2XRSD 1JE5A 1JOKA 1R9TH 5C0XJ 4C3HH 4IUVA 3RLOA 3PIOA 1OXVA 1H9RA 1EFWA 3HEJA 1YNJD 3OPOA 4HJ9A 5ELDA 2X6GA 2VQFL 1LT3D 4A3GH 1BKBA 3SR1A 5M5WH 1A3TA 2ZXRA 5COYA 1EEFD 5IYBG 4LUVA 2E5LL 3AB9A 2JA6H 1S72A 5IP7G 5FJ8G 4JBMA 1YBYA 5LL6S 2KVMA 2JYOA 4POFA 3Q24A 3M7GA 4QMGA 2PZWA 1HQRD 1V8QA 1U4MA 2AQ2B 2H4OA 1EU3A 3NTKA 1E2WA 2NVYB 4JV5Q 1R4QB 4GOPC 3DMUA 2PMZE 1BF4A 1TWHH 4UY8C 4GS3A 2EYFA 1VQOA 4MN3A 2A19A 4NW2A 1VQJA 2I5LX 1NY4A 1K73C 1F2YA 4GNXA 1AP0A 2D0PA 2KBNA 4XTCS 1K3RA 3I4OA 3S16B 4A3JG 4IUPA 2D2CC 3VDYA 2CH4W 1MIUA 3SDZA 1YNNC 1FGUA 3DM1A 1FD7D 1TKWB 3G48A 5FK9C 4CJ1B 1SYFA 5IWAL 3TBIB 3KK7A 3HOYH 1QILA 1Q1EA 3LNNA 2A6HC 4OIJA 1V9PA 1HFGA 3KUPA 1CQFA 2WAQB 4XQJA 2A73B 2A6HD 3S1MB 3F1ZA 1HA6A 3GTKH 3HP3A 4AYBE 4JI5Q 5C44G 2NZ1D 4L63B 1H9SA 5IE8A 2NBFA 5M9OA 5C44B 4U673 3F2CA 1B4OA 1SDFA 3TMEA 1Y69U 3RZDB 1L1OB 5ELBA 1HR0W 1KRTA 4RGOS 4DNRB 2K28A 2EYJA 4ID6A 5C3EG 1II3A 2YYZA 2C9OA 2Z6KC 2C35B 4DF7A 4WJWA 5C3EB 4HJ7A 1HNXQ 2EOTA 1C9OA 1RODA 3PIPA 2AQ1B 1YHBA 2BE5C 1SSOA 2MHVA 1ICWA 2L0CA 1EY7A 1PXUA 2Q8RE 1KTKA 3RN2A 4JCVE 2LY7A 4H7BA 3T13A 1Q46A 2BE5D 2OTLA 4OO1I 1N8RC 3HS0C 4A93H 4ALPA 3PF4A 5ELEA 1CT1D 3I70A 3SHLA 5LMUQ 1E1OA 5JAVA 3K7UC 3DWPA 1K8GA 2ALYB 2FINB 2XGTA 3CQZH 3QOLA 2B2UA 2MUYA 2K5VA 2K05A 3UDIA 1PV4A 4JBWA 4DU9A 3I4MH 1G2SA 1K9MC 3PQIA 3L3OC 2E2HB 1JWMD 2MNAA 1U0LA 4H02A 3A55A 1VQPA 3OMCA 3A7LA 1FGBD 5EPKA 2E2JB 2EXZA 4JVZA 3TP6A 1JB7A 4QCLA 3RLFA 4IOAA 1B3AA 2GN5A 3PO3H 2I46A 2UXCQ 3L2PA 3FRPB 1XNQQ 4ZYSA 4MHEA 4JI5L 3FP9A 2SNSA 3KF6B 3CC7A 4LFCL 1EEID 1LTAD 3GP7A 2KA7A 1DOLA 4IUTA 1EOTA 2JA7B 1EWIA 3M4QA 2ZM6L 1KD1C 4BY7B 4A3DB 5C4JH 2VB2X 3ERQA 5CV7A 4B3MQ 3VA5A 1HJPA 4BBSG 4EQOA 4H0LC 1W3SA 4OGQC 1I4RA 5E4XA 3K5NA 2VS1A 1YHAA 5IGGA 4DV5Q 3VYUA 4BBSB 1Q90A 2ENBA 3A74A 3K6OA 3ICEA 3T56B 1YI2A 1K0SA 1VQAA 2AWNA 2R92H 5M3MH 2A5HA 5EAYA 3A5UA 1PA6A 1SYCA 3D6WA 3Q8DA 5M5XB 2PNRC 2PW7A 4K8IA 1JJCB 1Y1VG 1RTOA 1M1KC 3H94A 2UXDQ 3ONAB 1G8ZD 4DV0Q 4KY6A 1Y1VB 4FYDA 1E2VA 4IZ8A 4JYAQ 1EWCA 3U50C 4C3IH 5IGFA 1VF7A 4DAMA 3K0YA 4ULLA 2RF4A 2CH4A 1STAA 1D6EC 3J7A5 5IGBA 4QF4A 3QIAA 1ML0D 1GUGA 1EYAA 4KN7C 3GTLH 3FVQA 2D0OA 5EKIA 5JEAH 3T51B 2QILA 1X3QA 2XN9C 4CGYB 4DK6C 5NUCA 4A3BH 3S1QB 3STBC 4GNXC 4DR7L 4WRDA 3MC0B 1D8LA 3ITPA 2A8VA 2HIXA 3AYHB 1E1TA 2CVRA 1MI2A 5IP9H 4DA2A 4XXEA 3STBD 1ASZA 1YVCA 1PH8A 1D5ZC 4A3GG 1PH2A 1X65A 4H44C 4LAAA 4FF2A 2F0FA 4KMUC 1XNQL 5M5YH 4IN3A 4DV4Q 1RCVD 1JORA 4A3GB 5M5WB 3S2HH 1LM0A 2B39A 2E74C 1SAPA 2HDMA 1QWYA 2K50A 4CDCC 1HA5A 4KD3A 5CV8A 1TR5A 2OQKA 1PYSB 5BN3A 3IRBA 2EZVA 4BA2I 4ZAIA 4B3TQ 3MA2B 3KBXA 4HMJA 1J9OA 1LTGD 2Q2HA 2VL6A 4R8NA 2UXBL 2F0IA 5IT9L 1E0BA 3M4PA 4A75A 1KNEA 3S1NB 1XNRL 3MAQA 3IL8A 1DD2A 1EZ8A 2JJQA 3BYTB 1EY8A 1GD7A 1I4GA 3KBGA 1KHIA 4UAIA 5IT9c 4L6TB 4FF4A 3UDXA 2IHFA 5E3FA 1O7LA 3RR5A 2K1BA 4JBJA 1ICFB 2F4IA 1EWHA 2EYOA 1VF5C 3K8AA 4OIKA 3I56A 4DR4Q 1MSGA 2KCCA 2JA9A 2RHQB 3BDLA 5A2QL 1BR9A 4KJNA 4MNOA 1O7ZA 1W6KA 4HSPA 3H91A 5I6WA 1XPRA 2DN8A 3HOYG 2NWGA 2K6AA 2MO1A 4CKEA 5LL6X 1OXTA 1GUNA 1L2FA 2O5JC 4BBRG 5DM73 2RSOA 2IX1A 1FL0A 1D5XC 4BBRB 1PHJA 2B2UC 2NB0A 3E0EA 2DJFC 1WI5A 3I91A 1L1OA 1RDPD 2HHHQ 2BCOA 1A3VA 2B2YC 3I55A 4CBVA 1BCPC 1WCMB 3D8GA 1X54A 1FVIA 1MGSA 1QCBD 4GLVB 5KIXA 1VQFA 1PH3A 1A0IA 3Q23A 2K5DA 2XRQD 4DV6Q 1XYIA 1BCPD 3BZDB 3WOEA 2B63B 1MJEA 2YU9B 1I94L 2VY3A 2A68C 1CM9A 4IPHA 4DV4L 1RL2A 4DN4M 2QF7A 4YWMA 4A3MH 3DWAA 3VYSA 2BA1A 3O13A 4LF4Q 3D31A 1PH1A 2A68D 1XPOA 4DR5L 1LTLA 1EY5A 4WFN3 1I50H 2PYKA 3DXJC 4RCOA 5E4WC 3MZ5A 2LFNA 1J8IA 4LF6L 2KCTA 2AUJD 1N34Q 4X3KA 3ER0A 1LUZA 1B53A 2L9HA 4RKLA 5C3WA 1EY4A 1UAPA 3I4MG 5K36H 3ULPA 3LWUA 1WTPA 3HKZE 4PMBA 1PTOF 1GOZA 4IPGA 2D62A 4YIJA 4DV3L 2WKCA 1DGSA 4K5WA 3VR3A 1GHKA 1IYUA 1DXMA 5J22A 2SEBD 4AQYQ 2KUMA 2XWJB 2VZAA 4FXGC 1LO5D 2R7ZH 3NBHA 2ES2A 2ZT9C 3NTHA 1UUPA 3KF8B 1FJGL 3S1RH 3KF6A 3W2DA 2NUCA 3V2TA 1BUVT 3T1YL 4JI3L 4A76A 1IBLQ 4DR2L 3CRKC 4JI4Q 1ENFA 5C5MA 3H09A 1GUTA 5IGDA 2EQSA 3SXHA 4X6AH 1PFNA 3JAMi 3JAML 1E3PA 1ONLA 1ET6A 2BA0A 4Q0FA 2NVTH 1B2TA 4DR3L 1TWAB 3M9BA 1Y8OB 1HNZQ 3A0JA 1D1KA 2ID0A 4K0KL 3K80C 2LS01 2B8GA 2RDGA 4M8AA 3PUXA 3T1HL 4DPGA 4JI0L 4DV2Q 4KY5A 4F8MA 1VQ4A 3I4NB 3A8KE 2MP1A 3RMHA 3TRZA 4HTHA 2EY6A 2K52A 4XQNA 1Q7YC 1SLJA 1TIID 4A3EB 4HCSA 1STGA 1XMOQ 3GTQB 1SYBA 2JEBI 4C3IG 2UUAL 1AE2A 1X3PA 4HAEA 1EY6A 4LF7L 1SXTA 5C0XI 4KK7A 2PQAB 5FO9B 1F77A 1SMYC 4JI6Q 1HZ9A 3A8JE 1I4XA 1I4PA 4DR6Q 2B2WA 5JEAG 1CA5A 1EQTA 4XQQA 1E7ZA 1RIPA 1HTLD 4ZLTF 3CCJA 1SMYD 1X6OA 4OXPA 1E24A 3K7AB 1QB5D 1H9MA 5FKAC 5IIFA 4BY1G 4A3BG 2ZTCA 4A4IA 2BH2A 2O2LD 2M00A 4WJ4A 1JR0D 3MEHA 4A3FG 4BY1B 3M3YB 1B3QA 4RHSA 1U5KA 2I0QA 1XJVA 4UPAA 4A3FB 3K5LA 5IP9G 2VQFQ 3RLNA 3N6RA 3TZDA 3VR6A 3R2IA 2R93H 1G91A 2E5LQ 2JE6I 3NWTA 5E1FA 2QEXA 3GTJH 3S2HB 2CQOA 1I6HB 1QUQB 1FNUA 4UP9A 2DNCA 1SROA 3PO2G 3H3VH 1K8MA 2K32A 4JOIA 2B29A 3PO2B 1PZID 1DONA 3CRLC 1TWGH 4KJOA 3HOWH 4QB4A 1U9RA 3QJYA 1Q1BA 4YWLA 1GVPA 2EJGC 2OXPA 3HKSA 3PSIA 1PLFA 3DLLA 4C3JG 2FHTA 3EA6A 1Y8PB 4C3JB 2NVQB 2L15A 1H9KA 2PO4A 4JI8L 5C3XA 3AEVA 4V0BA 4ME3A 1S5FD 2HUGA 1DJRD 2JN4A 3CCMA 1YITA 3PMFA 4P2CB 5ELNA 4LNQA 5CORA 4B3RL 3KLWA 2QA4A 3QG1A 2R7DA 3NSWA 3FKIH 3NQIA 4CJ2C 1SJHD 5KRUA 1PTOB 1CKNB 1SYGA 2ZXOA 3I4LA 1N33L 3E9HA 4HJAA 2VUMH 1Z47A 2ICEC 5GQOA 1LTSD 3GTGB 1KDCA 1HUNA 3V96A 3I90A 4BA1I 5FO8B 5EGTA 1NR4A 1AN8A 3EN2A 4P72A 1SFOH 4OX9L 2V4DA 4LF5L 3I72A 4GLAC 1A8VA 4ZKBB 4IPDA 3SVMA 3MXPA 1JE4A 4RMFA 2AUKA 4CDDC 2VNUD 2K04A 4XT3B 3H3VC 3UE1A 1UE1A 3TN2A 4X65L 1CZGA 1EYDA 1W6JA 3E9IA 4IFDH 3Q0AA 4F88A 2F3VA 1MD2D 2OCEA 4IPCA 2PW5A 3AQQA 1M8AA 4Z9CB 1GJXA 3ZJYC 3Q6SA 3CF5A 5JOBA 2F3IA 4IQZA 4GKKL 1WTQA 1NMGA 4K14A 1XWEA 2OF1A 1PFBA 2DNEA 2KHIA 2JA8H 3IFDA 3LWEA 1VQHA 2ICIA 2K03A 2WACA 4EQNA 2EDGA 4LFAQ 2CFMA 3EBEA 3HFZB 5CV5A 3X3NA 1X3GA 4A3JB 5J3BA 3H15A 1QOHA 1YJNA 4DK1A 1LACA 3KF8A 1WOCA 3V05A 2YTYA 1BQQT 5C4ZA 1S5CD 5JJZA 5IYCH 1KAWA 1HCZA 1A2UA 3I7FA 3WOFA 4JPBW 1A3UA 2K5WA 4O2DA 4DAVA 1EQRA 4NB3A 4A3KH 1GXDC 4C2MH 3E0JA 4JG2A 2Y0SE 4P74A 4LFCQ 5C0XG 2AMCB 2EJFC 1ESFA 2ZM6Q 4R8IA 3IKJA 4ILWA 2OT2A 1E2ZA 3NENA 1EUJA 1JC7A 1QE6A 3NQTA 4HCEA 2IL8A 2KOLA 2Z6BA 2ZTDA 5J39A 2BDNA 3C2PA 2NVTB 4F7XA 3OTOQ 3IAYA 5M3FG 5DLQE
chains in the Genus database with same CATH topology
5GADC 4DR7L 1N32L 1HNWL 3CPWA 1D8LA 3TS2A 2A8VA 2HIXA 1VQ8A 3AYHB 2K5NA 1E1TA 2CKZB 5JEAJ 3CMEA 5IP9H 3STBD 1BBWA 3H0GH 2N3SA 4A3JH 3AFQA 4GN5A 4GNXB 4UY8C 3S2DH 4DR4L 2UUBQ 1ASZA 4JI2L 1YVCA 1PH8A 4R4CA 2FXQA 5M5XH 4A3GG 1PH2A 3EIVA 1J6QA 1X65A 1Y1WG 4JBKA 4J15A 1XNQL 1S3OA 5M5YH 4DV4Q 1B7YB 4LF8Q 2UU9Q 4QQBX 2PQAA 3FHWA 3S2HH 1LM0A 5ELOA 3H3VI 1KIXA 1Y1VH 2IHEA 4YHHQ 2JEAI 3HOUG 2K50A 1EQQA 1C0AA 5AJ3L 5LMNQ 2OQKA 5HGQA 1PYSB 4KI0A 1SR3A 1O7IA 3IRBA 1OTCA 4BA2I 3I2ZA 4B3TQ 1WFQA 3F2BA 4POGA 3RZOH 2Q2HA 3PV0A 3ULLA 4DV7Q 2HHHL 3KJPA 2VL6A 3HOVG 3M4OH 4UP8A 2UXBL 5IYDG 5H1SE 4GOPA 4K0KQ 4LW1A 4A75A 2AKWB 3M4PA 4YCWA 2OQ0A 1VQIA 2AHOB 3CC4A 1VCIA 4LFAL 1XNRL 3CP0A 3CCEA 2JJQA 4Y7NH 4DR7Q 1N32Q 1HNWQ 5IT9c 1GD7A 3JAMc 1KHIA 2KHJA 4DV6L 2CWPA 3UDXA 2IHFA 2NN6G 2XTIA 3RR5A 1PH7A 4JBJA 4KLKA 4A3MG 5M3FH 1GO3E 2I5MX 4YY3Q 3K8AA 1J5EL 3I56A 4DR4Q 3I4NG 4FDBA 2JA9A 2VW9A 2F4VL 2RHQB 2JK8A 4AIMA 2LXJA 4X66Q 2A1AA 1CKMA 3G71A 4MNOA 3WWVA 2R93G 2B3GA 1XPRA 2E2IH 3HOYG 4TQUS 4A3EG 1UE5A 2MO1A 4QY7A 3ULJA 1QUQA 1VQ7A 1PYBA 4HIKA 2Q2TA 4DKAC 2NVXH 1OXTA 4LF4L 1L2FA 1NBWA 1Y1WH 1M90C 1PH4A 4YCUA 2BH8A 4BBRG 2ZJRA 4IFDJ 2IX1A 4MTNA 1K83H 2K4KA 1FL0A 4DUYQ 5C4XG 2E8GA 1PHJA 2HT1A 1KQSA 3K81C 5K36G 3E0EA 1OXUA 1WI5A 3KYHC 1L1OA 3HOXG 1QZHA 4X64L 2HHHQ 2EXDA 4NXML 1JT8A 1N34L 4R4QA 1SE8A 3B6YA 3GD7A 3I55A 2KENA 2UXBQ 1IBKL 4DR1L 1GKHA 3OTOL 1VQMA 1X54A 2EIFA 4OX9L 1VQ5A 2YTVA 1FVIA 1NE3A 4NXNL 1XNRQ 4GLVB 4LUOA 1TWFH 3CCSA 1VQFA 1PH3A 1A0IA 1IZ6A 1NJIC 3HOWG 1K8AC 1WJJA 1X9NA 4A3IG 3HOVH 4DV6Q 3S1NH 1QVGA 3UDGA 5IYDH 2Z6KA 4RG1A 1MJEA 2PI2A 1Y14B 4NPSA 4OWTB 4IFDI 2UUBL 1I94L 2R7ZG 1J5EQ 1Q12A 1VQBA 2VY3A 2F4VQ 4GOPB 3J81c 4A3LG 1E22A 4AQYL 1QZGA 4IPHA 4DV4L 2VQEL 1B70B 2UU9L 1RL2A 4YWMA 4A3MH 3HKZG 1YNXA 2ZJPA 4YHHL 1JJ2A 1G291 2LXKA 3RNUA 2RHSB 2BA1A 3UDFA 3J80c 4X62L 1Q86C 4LF4Q 3D31A 4KHPL 1KRSA 1UWVA 3CAMA 3JC66 1PH1A 4BXXG 3MXNB 1XPOA 4DR5L 4JI1L 1CKNA 1VQNA 1LTLA 2JA5H 1KL9A 1I50H 4PZ8A 1IBLL 1UE6A 2WAQG 4A3CH 3F2DA 2MQHA 3FKIG 1D7QA 2GVBA 4JI4L 1VQKA 1JJGA 4B3SL 4LF6L 1KC8C 4BBRH 2KCTA 4IO9A 4NXMQ 2VUMG 1B8AA 4OWXB 1I5FA 3G6EA 1N34Q 3ER0A 3NEMA 1LUZA 3GTMH 1IBKQ 1BVSA 4BBSH 2WB1G 3I4MG 1WCMH 3ULPA 3G4SA 1I3QH 1HNZL 3HKZE 5LMNW 2H5XA 4IJHA 3S15H 1HZCA 2MO0A 4IPGA 2OWOA 2HIVA 2D62A 4DV3L 4YY3L 1DGSA 1L0WA 5GAGC 1I94Q 4DV2L 1Q82C 1BBUA 2B63H 3J7ZC 4X66L 4L5TA 1PFSA 4R1JA 4A3IH 4YWKA 2YU9H 4DNIA 3GO5A 2UUCL 4R4TA 4AQYQ 2VQEQ 1Q81C 2VZAA 1YIJA 3GTOH 3CCVA 4WJ3M 2JA6G 3PUYA 2RCNA 2R7ZH 1XMQL 1W2BA 3L0OA 2GVAA 5HY6A 4X62Q 2ES2A 3KF8B 1FJGL 1XMOL 1C7YA 4KHPQ 3S1RH 5IWAQ 1XTDA 3KF6A 4Y52H 3ERSX 3PUZA 4DR5Q 4JI1Q 4LUZA 3U4ZA 4JI3L 3T1YL 4QL5A 4DUYL 4QIWE 4A76A 4DR2L 4R4IA 1HR0Q 5GAHC 1IBLQ 4JOIC 5GROA 5FLMH 4JI4Q 1IXRA 1SMXA 3OYYA 5JJKA 4B3SQ 3HOZH 1P16A 2EQSA 4X6AH 1K0RA 4LF6Q 1X3EA 4L5QA 2YTXA 4GLXA 2ZJQA 3JAMi 3CCLA 1VS0A 4JI6L 2K75A 1E3PA 4DR6L 1VQCA 2BA0A 2N49A 1YJ9A 4JV5L 2NVTH 4DR3L 3M9BA 3S1QH 1HNZQ 3A0JA 3S14H 3CD6A 2ID0A 4K0KL 2Q2IA 3K80C 2JA8G 1PVOA 3KDFA 1A63A 1JE5A 1R9TH 5E7NA 3PUXA 5C0XJ 4DV3Q 3T1HL 4C3HH 3RLOA 1CKOA 4DPGA 3PIOA 1OXVA 4JI0L 4LFBQ 4DV2Q 1EFWA 1VQ4A 3D0FA 3F8TA 4HJ9A 2UUCQ 3J81j 2ATWA 3TRZA 1VQLA 2K52A 1UEBA 2VQFL 5GAEC 1XMQQ 1Q7YC 1SLJA 2Z0SA 4A3GH 1BKBA 3GDEA 2F52A 5M5WH 1FJGQ 1XMOQ 5IYBG 2JEBI 4LUVA 1EYGA 1CSPA 2E5LL 3T1YQ 2UUAL 4JI3Q 1AE2A 3GTPH 2JA6H 1S72A 5IP7G 3S24A 5FJ8G 4JBMA 3PUWA 4DR2Q 1YBYA 4GN4B 4MZ9A 4A3KG 3HOUH 4LF7L 2R6GA 5C0XI 4POFA 2PQAB 4LWCA 4DK3C 3TEHB 1PH9A 3CCRA 3NBHB 4JI6Q 1HZ9A 4DR6Q 1PH5A 2JA7G 1KXLA 4BY7G 5JEAG 4JV5Q 4A3DG 4DR3Q 4GOPC 1E7ZA 1OXXK 3BZCA 1RIPA 2PMZE 3CCJA 1TWHH 1X6OA 3CW2C 4GS3A 1E24A 1SN8A 4OXPA 1VQOA 1TWAH 3J81i 4BY1G 2A19A 2ZTCA 4A3BG 1VQJA 4A4IA 1CUKA 2BH2A 1IBML 1PH6A 1HZBA 2I5LX 1NY4A 3T1HQ 2JQOA 4WJ4A 1K73C 3W5OA 3BU2A 4A3FG 4JI0Q 2IT1A 3CMAA 4GNXA 4AYBG 2K5HA 1A62A 1U5KA 3J80i 3RN5A 2D0PA 2KBNA 4XTCS 1K3RA 1HNXL 1XJVA 4UPAA 1GM5A 2I0QA 5IP9G 3I4OA 4A3JG 1YEZA 3VDYA 2MFIA 2VQFQ 3I4NH 1MIUA 4A93G 3RLNA 2DGYA 1FGUA 4UP7A 2CCZA 3U4VA 3G48A 2WP8J 5IWAL 2R93H 3HOYH 2OTJA 1WYDA 4A3EH 2JE6I 2E5LQ 1Q1EA 2UUAQ 1IL2A 3KFUA 1HR0L 4PZ6A 3PGZA 5IY0A 3GTQH 1CSQA 1QVCA 1V9PA 2KCMA 3SGIA 4XIGS 2QEXA 4LF7Q 3GTJH 1NTGA 2CQOA 5IYBH 4DUZQ 2QGQA 4JI7L 1QUQB 1X55A 3A5ZB 4UP9A 5LMUL 4HIMA 3F1ZA 3M7NA 5FJ8H 1HH2P 5C4XH 5IP7H 1EIYB 1SROA 3GTKH 3PO2G 4AYBE 3H3VH 2NZHA 4JI5Q 5C44G 1G6PA 3HOXH 1YJWA 3BJUA 4JOIA 2B29A 5IE8A 1XPUA 3F2CA 4OONA 1IYJB 1TWGH 4AH6A 1VQ9A 1HR0W 1L1OB 4L5RC 1IBMQ 1KRTA 3HOWH 4LFBL 3K7AH 5C3EG 3M85A 2YYZA 2Z6KC 2PNHA 3NELA 1Q1BA 4YWLA 1GVPA 2C35B 2NN6I 2WAQE 3HKSA 1LYLA 3PSIA 3BZKA 3DLLA 4O0AA 4HJ7A 1HNXQ 3M3YH 4BY1H 1C9OA 1VQEA 3PIPA 2N8NA 2Q2UA 1YHBA 4IFDG 4A3FH 2L15A 3TS0A 3S16H 4L5SA 4A3LH 3PO3G 4JI8L 2K14A 4PZ7A 2WB1E 3RN2A 3AEVA 4ME3A 5BR8Q 4JCVE 4IJLA 3W1GA 3CCMA 1YITA 1Q46A 4GN3B 2OTLA 1Z9FA 4OO1I 3KOJA 1N8RC 5ELNA 4A93H 1NMFA 4LNQA 4ALPA 3PF4A 4B3RL 2UXCL 4BXXH 3KLWA 1Q8KA 2QA4A 3CC2A 4JI7Q 3CCQA 3W1BA 5LMUQ 2R7DA 1E1OA 3FKIH 1OXSC 3K7UC 1UE7A 1I6HH 1K8GA 4EX5A 2ALYB 2DUDA 2XGTA 3S1MH 1CKNB 1N33L 3CQZH 3AFPA 3E9HA 4HJAA 2VUMH 1Z47A 2K5VA 3TQYA 3PCOB 5GQOA 3UDIA 1G51A 1N36L 2PI2E 4DV1L 4R4OA 4TVAB 4BA1I 1PV4A 4B3ML 4GKJL 3PO2H 3KJOA 4JBWA 4JC0A 3I4MH 5C44H 1YZ6A 2R92G 5M3MG 3EN2A 4P72A 4HIOA 1SFOH 4DV5L 1K9MC 3PF5A 3U58A 4EQ5A 3RZDH 1P8LA 4LF5L 5FLXc 4GLAC 1VQDA 3PUVA 1X3FA 2MNAA 1A8VA 1U0LA 1V1QA 1N9WA 4KHZA 1QVFA 4IPDA 5JJLA 2IX0A 4H02A 4RMFA 5C3EH 1MKHA 5IYCG 2VNUD 1VQPA 4HJ5A 4APVA 4JI8Q 3UE1A 1UE1A 2HQLA 1TWCH 4C3JH 4X65L 2NVQH 3DM3A 4YCVA 1JB7A 4QJFA 1MJCA 3E9IA 2CWAA 3RLFA 4IOAA 4JI2Q 4QGUA 3CCUA 2UXDL 2GN5A 4DV0L 3PO3H 4DUZL 4B3RQ 2UXCQ 4JYAL 3L2PA 1XNQQ 1VQ6A 2OCEA 4IPCA 2JA5G 3AQQA 4A3CG 4JI5L 3FP9A 1S40A 5JJIA 4OO1G 3MEFA 1V43A 3KF6B 3CC7A 3ZJYC 1T9HA 2AWOA 4LFCL 2ASBA 1N33Q 5AJ3Q 1AH9A 3K0XA 1EWIA 2R7FA 3M4QA 2ZM6L 3CF5A 4HJ8A 1KD1C 1N36Q 2F3IA 4DV1Q 5C4JH 2NZOA 3UE0A 4GKKL 4B3MQ 1EOVA 2I5HA 4LF9L 4GKJQ 1HJPA 1NMGA 4BBSG 3GTGH 1SRUA 4PG3A 1WCMG 1W3SA 4HIDA 4OX9Q 2VS1A 1YHAA 4DV5Q 4LF9Q 2KHIA 4LF5Q 4PMWA 2JA8H 2Y0SG 3A74A 2LSSA 3ICEA 4OWWB 1VQHA 3H0GG 1YI2A 1HZAA 1VQAA 2E2HH 4LFAQ 2AWNA 2CFMA 3EBEA 3HFZB 5M3MH 2R92H 1X3GA 3TREA 5EAYA 3A5UA 2B63G 1H95A 2WFWA 3KDFB 5J3BA 1PA6A 3H15A 3OW2A 1EIFA 1YJNA 2ZTEA 5BR8L 1WOCA 1AE3A 1X56A 2YTYA 3Q8DA 4X65Q 1JMCA 4P75A 2E2JH 1JJCB 1Y1VG 3L7ZC 5IYCH 1KAWA 3I7FA 1M1KC 2UXDQ 4DV0Q 4IOCA 4LF8L 4JYAQ 4C3IH 3U50C 3LGJA 4O2DA 3CXCA 1EQRA 1L1OC 4DAMA 4NB3A 1TXYA 2YV5A 4A3KH 2RF4A 4C2MH 5FLMG 1ASYA 4JG2A 2Y0SE 4P74A 2V1CC 5LMNL 1YHQA 4LFCQ 3J7A5 5C0XG 3HOZG 2AMCB 2ZM6Q 2NVYH 4P73A 4B3TL 3S17H 3GTLH 1VQGA 3NENA 1EUJA 4GKKQ 2JA7H 2D0OA 4BY7H 4P71A 4A3DH 4DV7L 2ZTDA 4X64Q 4DAYB 4DK6C 3CPFA 4A3BH 4DR1Q 3OTOQ 2IY5B 2N78A 5M3FG 3STBC 4GNXC 5DLQE 4NXNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAD C;  4DR7 L;  1N32 L;  1HNW L;  3CPW A;  1D8L A;  3TS2 A;  2A8V A;  2HIX A;  1VQ8 A;  3AYH B;  2K5N A;  1E1T A;  2CKZ B;  5JEA J;  3CME A;  5IP9 H;  3STB D;  1BBW A;  3H0G H;  2N3S A;  4A3J H;  3AFQ A;  4GN5 A;  4GNX B;  4UY8 C;  3S2D H;  4DR4 L;  2UUB Q;  1ASZ A;  4JI2 L;  1YVC A;  1PH8 A;  4R4C A;  2FXQ A;  5M5X H;  4A3G G;  1PH2 A;  3EIV A;  1J6Q A;  1X65 A;  1Y1W G;  4JBK A;  4J15 A;  1XNQ L;  1S3O A;  5M5Y H;  4DV4 Q;  1B7Y B;  4LF8 Q;  2UU9 Q;  4QQB X;  2PQA A;  3FHW A;  3S2H H;  1LM0 A;  5ELO A;  3H3V I;  1KIX A;  1Y1V H;  2IHE A;  4YHH Q;  2JEA I;  3HOU G;  2K50 A;  1EQQ A;  1C0A A;  5AJ3 L;  5LMN Q;  2OQK A;  5HGQ A;  1PYS B;  4KI0 A;  1SR3 A;  1O7I A;  3IRB A;  1OTC A;  4BA2 I;  3I2Z A;  4B3T Q;  1WFQ A;  3F2B A;  4POG A;  3RZO H;  2Q2H A;  3PV0 A;  3ULL A;  4DV7 Q;  2HHH L;  3KJP A;  2VL6 A;  3HOV G;  3M4O H;  4UP8 A;  2UXB L;  5IYD G;  5H1S E;  4GOP A;  4K0K Q;  4LW1 A;  4A75 A;  2AKW B;  3M4P A;  4YCW A;  2OQ0 A;  1VQI A;  2AHO B;  3CC4 A;  1VCI A;  4LFA L;  1XNR L;  3CP0 A;  3CCE A;  2JJQ A;  4Y7N H;  4DR7 Q;  1N32 Q;  1HNW Q;  5IT9 c;  1GD7 A;  3JAM c;  1KHI A;  2KHJ A;  4DV6 L;  2CWP A;  3UDX A;  2IHF A;  2NN6 G;  2XTI A;  3RR5 A;  1PH7 A;  4JBJ A;  4KLK A;  4A3M G;  5M3F H;  1GO3 E;  2I5M X;  4YY3 Q;  3K8A A;  1J5E L;  3I56 A;  4DR4 Q;  3I4N G;  4FDB A;  2JA9 A;  2VW9 A;  2F4V L;  2RHQ B;  2JK8 A;  4AIM A;  2LXJ A;  4X66 Q;  2A1A A;  1CKM A;  3G71 A;  4MNO A;  3WWV A;  2R93 G;  2B3G A;  1XPR A;  2E2I H;  3HOY G;  4TQU S;  4A3E G;  1UE5 A;  2MO1 A;  4QY7 A;  3ULJ A;  1QUQ A;  1VQ7 A;  1PYB A;  4HIK A;  2Q2T A;  4DKA C;  2NVX H;  1OXT A;  4LF4 L;  1L2F A;  1NBW A;  1Y1W H;  1M90 C;  1PH4 A;  4YCU A;  2BH8 A;  4BBR G;  2ZJR A;  4IFD J;  2IX1 A;  4MTN A;  1K83 H;  2K4K A;  1FL0 A;  4DUY Q;  5C4X G;  2E8G A;  1PHJ A;  2HT1 A;  1KQS A;  3K81 C;  5K36 G;  3E0E A;  1OXU A;  1WI5 A;  3KYH C;  1L1O A;  3HOX G;  1QZH A;  4X64 L;  2HHH Q;  2EXD A;  4NXM L;  1JT8 A;  1N34 L;  4R4Q A;  1SE8 A;  3B6Y A;  3GD7 A;  3I55 A;  2KEN A;  2UXB Q;  1IBK L;  4DR1 L;  1GKH A;  3OTO L;  1VQM A;  1X54 A;  2EIF A;  4OX9 L;  1VQ5 A;  2YTV A;  1FVI A;  1NE3 A;  4NXN L;  1XNR Q;  4GLV B;  4LUO A;  1TWF H;  3CCS A;  1VQF A;  1PH3 A;  1A0I A;  1IZ6 A;  1NJI C;  3HOW G;  1K8A C;  1WJJ A;  1X9N A;  4A3I G;  3HOV H;  4DV6 Q;  3S1N H;  1QVG A;  3UDG A;  5IYD H;  2Z6K A;  4RG1 A;  1MJE A;  2PI2 A;  1Y14 B;  4NPS A;  4OWT B;  4IFD I;  2UUB L;  1I94 L;  2R7Z G;  1J5E Q;  1Q12 A;  1VQB A;  2VY3 A;  2F4V Q;  4GOP B;  3J81 c;  4A3L G;  1E22 A;  4AQY L;  1QZG A;  4IPH A;  4DV4 L;  2VQE L;  1B70 B;  2UU9 L;  1RL2 A;  4YWM A;  4A3M H;  3HKZ G;  1YNX A;  2ZJP A;  4YHH L;  1JJ2 A;  1G29 1;  2LXK A;  3RNU A;  2RHS B;  2BA1 A;  3UDF A;  3J80 c;  4X62 L;  1Q86 C;  4LF4 Q;  3D31 A;  4KHP L;  1KRS A;  1UWV A;  3CAM A;  3JC6 6;  1PH1 A;  4BXX G;  3MXN B;  1XPO A;  4DR5 L;  4JI1 L;  1CKN A;  1VQN A;  1LTL A;  2JA5 H;  1KL9 A;  1I50 H;  4PZ8 A;  1IBL L;  1UE6 A;  2WAQ G;  4A3C H;  3F2D A;  2MQH A;  3FKI G;  1D7Q A;  2GVB A;  4JI4 L;  1VQK A;  1JJG A;  4B3S L;  4LF6 L;  1KC8 C;  4BBR H;  2KCT A;  4IO9 A;  4NXM Q;  2VUM G;  1B8A A;  4OWX B;  1I5F A;  3G6E A;  1N34 Q;  3ER0 A;  3NEM A;  1LUZ A;  3GTM H;  1IBK Q;  1BVS A;  4BBS H;  2WB1 G;  3I4M G;  1WCM H;  3ULP A;  3G4S A;  1I3Q H;  1HNZ L;  3HKZ E;  5LMN W;  2H5X A;  4IJH A;  3S15 H;  1HZC A;  2MO0 A;  4IPG A;  2OWO A;  2HIV A;  2D62 A;  4DV3 L;  4YY3 L;  1DGS A;  1L0W A;  5GAG C;  1I94 Q;  4DV2 L;  1Q82 C;  1BBU A;  2B63 H;  3J7Z C;  4X66 L;  4L5T A;  1PFS A;  4R1J A;  4A3I H;  4YWK A;  2YU9 H;  4DNI A;  3GO5 A;  2UUC L;  4R4T A;  4AQY Q;  2VQE Q;  1Q81 C;  2VZA A;  1YIJ A;  3GTO H;  3CCV A;  4WJ3 M;  2JA6 G;  3PUY A;  2RCN A;  2R7Z H;  1XMQ L;  1W2B A;  3L0O A;  2GVA A;  5HY6 A;  4X62 Q;  2ES2 A;  3KF8 B;  1FJG L;  1XMO L;  1C7Y A;  4KHP Q;  3S1R H;  5IWA Q;  1XTD A;  3KF6 A;  4Y52 H;  3ERS X;  3PUZ A;  4DR5 Q;  4JI1 Q;  4LUZ A;  3U4Z A;  4JI3 L;  3T1Y L;  4QL5 A;  4DUY L;  4QIW E;  4A76 A;  4DR2 L;  4R4I A;  1HR0 Q;  5GAH C;  1IBL Q;  4JOI C;  5GRO A;  5FLM H;  4JI4 Q;  1IXR A;  1SMX A;  3OYY A;  5JJK A;  4B3S Q;  3HOZ H;  1P16 A;  2EQS A;  4X6A H;  1K0R A;  4LF6 Q;  1X3E A;  4L5Q A;  2YTX A;  4GLX A;  2ZJQ A;  3JAM i;  3CCL A;  1VS0 A;  4JI6 L;  2K75 A;  1E3P A;  4DR6 L;  1VQC A;  2BA0 A;  2N49 A;  1YJ9 A;  4JV5 L;  2NVT H;  4DR3 L;  3M9B A;  3S1Q H;  1HNZ Q;  3A0J A;  3S14 H;  3CD6 A;  2ID0 A;  4K0K L;  2Q2I A;  3K80 C;  2JA8 G;  1PVO A;  3KDF A;  1A63 A;  1JE5 A;  1R9T H;  5E7N A;  3PUX A;  5C0X J;  4DV3 Q;  3T1H L;  4C3H H;  3RLO A;  1CKO A;  4DPG A;  3PIO A;  1OXV A;  4JI0 L;  4LFB Q;  4DV2 Q;  1EFW A;  1VQ4 A;  3D0F A;  3F8T A;  4HJ9 A;  2UUC Q;  3J81 j;  2ATW A;  3TRZ A;  1VQL A;  2K52 A;  1UEB A;  2VQF L;  5GAE C;  1XMQ Q;  1Q7Y C;  1SLJ A;  2Z0S A;  4A3G H;  1BKB A;  3GDE A;  2F52 A;  5M5W H;  1FJG Q;  1XMO Q;  5IYB G;  2JEB I;  4LUV A;  1EYG A;  1CSP A;  2E5L L;  3T1Y Q;  2UUA L;  4JI3 Q;  1AE2 A;  3GTP H;  2JA6 H;  1S72 A;  5IP7 G;  3S24 A;  5FJ8 G;  4JBM A;  3PUW A;  4DR2 Q;  1YBY A;  4GN4 B;  4MZ9 A;  4A3K G;  3HOU H;  4LF7 L;  2R6G A;  5C0X I;  4POF A;  2PQA B;  4LWC A;  4DK3 C;  3TEH B;  1PH9 A;  3CCR A;  3NBH B;  4JI6 Q;  1HZ9 A;  4DR6 Q;  1PH5 A;  2JA7 G;  1KXL A;  4BY7 G;  5JEA G;  4JV5 Q;  4A3D G;  4DR3 Q;  4GOP C;  1E7Z A;  1OXX K;  3BZC A;  1RIP A;  2PMZ E;  3CCJ A;  1TWH H;  1X6O A;  3CW2 C;  4GS3 A;  1E24 A;  1SN8 A;  4OXP A;  1VQO A;  1TWA H;  3J81 i;  4BY1 G;  2A19 A;  2ZTC A;  4A3B G;  1VQJ A;  4A4I A;  1CUK A;  2BH2 A;  1IBM L;  1PH6 A;  1HZB A;  2I5L X;  1NY4 A;  3T1H Q;  2JQO A;  4WJ4 A;  1K73 C;  3W5O A;  3BU2 A;  4A3F G;  4JI0 Q;  2IT1 A;  3CMA A;  4GNX A;  4AYB G;  2K5H A;  1A62 A;  1U5K A;  3J80 i;  3RN5 A;  2D0P A;  2KBN A;  4XTC S;  1K3R A;  1HNX L;  1XJV A;  4UPA A;  1GM5 A;  2I0Q A;  5IP9 G;  3I4O A;  4A3J G;  1YEZ A;  3VDY A;  2MFI A;  2VQF Q;  3I4N H;  1MIU A;  4A93 G;  3RLN A;  2DGY A;  1FGU A;  4UP7 A;  2CCZ A;  3U4V A;  3G48 A;  2WP8 J;  5IWA L;  2R93 H;  3HOY H;  2OTJ A;  1WYD A;  4A3E H;  2JE6 I;  2E5L Q;  1Q1E A;  2UUA Q;  1IL2 A;  3KFU A;  1HR0 L;  4PZ6 A;  3PGZ A;  5IY0 A;  3GTQ H;  1CSQ A;  1QVC A;  1V9P A;  2KCM A;  3SGI A;  4XIG S;  2QEX A;  4LF7 Q;  3GTJ H;  1NTG A;  2CQO A;  5IYB H;  4DUZ Q;  2QGQ A;  4JI7 L;  1QUQ B;  1X55 A;  3A5Z B;  4UP9 A;  5LMU L;  4HIM A;  3F1Z A;  3M7N A;  5FJ8 H;  1HH2 P;  5C4X H;  5IP7 H;  1EIY B;  1SRO A;  3GTK H;  3PO2 G;  4AYB E;  3H3V H;  2NZH A;  4JI5 Q;  5C44 G;  1G6P A;  3HOX H;  1YJW A;  3BJU A;  4JOI A;  2B29 A;  5IE8 A;  1XPU A;  3F2C A;  4OON A;  1IYJ B;  1TWG H;  4AH6 A;  1VQ9 A;  1HR0 W;  1L1O B;  4L5R C;  1IBM Q;  1KRT A;  3HOW H;  4LFB L;  3K7A H;  5C3E G;  3M85 A;  2YYZ A;  2Z6K C;  2PNH A;  3NEL A;  1Q1B A;  4YWL A;  1GVP A;  2C35 B;  2NN6 I;  2WAQ E;  3HKS A;  1LYL A;  3PSI A;  3BZK A;  3DLL A;  4O0A A;  4HJ7 A;  1HNX Q;  3M3Y H;  4BY1 H;  1C9O A;  1VQE A;  3PIP A;  2N8N A;  2Q2U A;  1YHB A;  4IFD G;  4A3F H;  2L15 A;  3TS0 A;  3S16 H;  4L5S A;  4A3L H;  3PO3 G;  4JI8 L;  2K14 A;  4PZ7 A;  2WB1 E;  3RN2 A;  3AEV A;  4ME3 A;  5BR8 Q;  4JCV E;  4IJL A;  3W1G A;  3CCM A;  1YIT A;  1Q46 A;  4GN3 B;  2OTL A;  1Z9F A;  4OO1 I;  3KOJ A;  1N8R C;  5ELN A;  4A93 H;  1NMF A;  4LNQ A;  4ALP A;  3PF4 A;  4B3R L;  2UXC L;  4BXX H;  3KLW A;  1Q8K A;  2QA4 A;  3CC2 A;  4JI7 Q;  3CCQ A;  3W1B A;  5LMU Q;  2R7D A;  1E1O A;  3FKI H;  1OXS C;  3K7U C;  1UE7 A;  1I6H H;  1K8G A;  4EX5 A;  2ALY B;  2DUD A;  2XGT A;  3S1M H;  1CKN B;  1N33 L;  3CQZ H;  3AFP A;  3E9H A;  4HJA A;  2VUM H;  1Z47 A;  2K5V A;  3TQY A;  3PCO B;  5GQO A;  3UDI A;  1G51 A;  1N36 L;  2PI2 E;  4DV1 L;  4R4O A;  4TVA B;  4BA1 I;  1PV4 A;  4B3M L;  4GKJ L;  3PO2 H;  3KJO A;  4JBW A;  4JC0 A;  3I4M H;  5C44 H;  1YZ6 A;  2R92 G;  5M3M G;  3EN2 A;  4P72 A;  4HIO A;  1SFO H;  4DV5 L;  1K9M C;  3PF5 A;  3U58 A;  4EQ5 A;  3RZD H;  1P8L A;  4LF5 L;  5FLX c;  4GLA C;  1VQD A;  3PUV A;  1X3F A;  2MNA A;  1A8V A;  1U0L A;  1V1Q A;  1N9W A;  4KHZ A;  1QVF A;  4IPD A;  5JJL A;  2IX0 A;  4H02 A;  4RMF A;  5C3E H;  1MKH A;  5IYC G;  2VNU D;  1VQP A;  4HJ5 A;  4APV A;  4JI8 Q;  3UE1 A;  1UE1 A;  2HQL A;  1TWC H;  4C3J H;  4X65 L;  2NVQ H;  3DM3 A;  4YCV A;  1JB7 A;  4QJF A;  1MJC A;  3E9I A;  2CWA A;  3RLF A;  4IOA A;  4JI2 Q;  4QGU A;  3CCU A;  2UXD L;  2GN5 A;  4DV0 L;  3PO3 H;  4DUZ L;  4B3R Q;  2UXC Q;  4JYA L;  3L2P A;  1XNQ Q;  1VQ6 A;  2OCE A;  4IPC A;  2JA5 G;  3AQQ A;  4A3C G;  4JI5 L;  3FP9 A;  1S40 A;  5JJI A;  4OO1 G;  3MEF A;  1V43 A;  3KF6 B;  3CC7 A;  3ZJY C;  1T9H A;  2AWO A;  4LFC L;  2ASB A;  1N33 Q;  5AJ3 Q;  1AH9 A;  3K0X A;  1EWI A;  2R7F A;  3M4Q A;  2ZM6 L;  3CF5 A;  4HJ8 A;  1KD1 C;  1N36 Q;  2F3I A;  4DV1 Q;  5C4J H;  2NZO A;  3UE0 A;  4GKK L;  4B3M Q;  1EOV A;  2I5H A;  4LF9 L;  4GKJ Q;  1HJP A;  1NMG A;  4BBS G;  3GTG H;  1SRU A;  4PG3 A;  1WCM G;  1W3S A;  4HID A;  4OX9 Q;  2VS1 A;  1YHA A;  4DV5 Q;  4LF9 Q;  2KHI A;  4LF5 Q;  4PMW A;  2JA8 H;  2Y0S G;  3A74 A;  2LSS A;  3ICE A;  4OWW B;  1VQH A;  3H0G G;  1YI2 A;  1HZA A;  1VQA A;  2E2H H;  4LFA Q;  2AWN A;  2CFM A;  3EBE A;  3HFZ B;  5M3M H;  2R92 H;  1X3G A;  3TRE A;  5EAY A;  3A5U A;  2B63 G;  1H95 A;  2WFW A;  3KDF B;  5J3B A;  1PA6 A;  3H15 A;  3OW2 A;  1EIF A;  1YJN A;  2ZTE A;  5BR8 L;  1WOC A;  1AE3 A;  1X56 A;  2YTY A;  3Q8D A;  4X65 Q;  1JMC A;  4P75 A;  2E2J H;  1JJC B;  1Y1V G;  3L7Z C;  5IYC H;  1KAW A;  3I7F A;  1M1K C;  2UXD Q;  4DV0 Q;  4IOC A;  4LF8 L;  4JYA Q;  4C3I H;  3U50 C;  3LGJ A;  4O2D A;  3CXC A;  1EQR A;  1L1O C;  4DAM A;  4NB3 A;  1TXY A;  2YV5 A;  4A3K H;  2RF4 A;  4C2M H;  5FLM G;  1ASY A;  4JG2 A;  2Y0S E;  4P74 A;  2V1C C;  5LMN L;  1YHQ A;  4LFC Q;  3J7A 5;  5C0X G;  3HOZ G;  2AMC B;  2ZM6 Q;  2NVY H;  4P73 A;  4B3T L;  3S17 H;  3GTL H;  1VQG A;  3NEN A;  1EUJ A;  4GKK Q;  2JA7 H;  2D0O A;  4BY7 H;  4P71 A;  4A3D H;  4DV7 L;  2ZTD A;  4X64 Q;  4DAY B;  4DK6 C;  3CPF A;  4A3B H;  4DR1 Q;  3OTO Q;  2IY5 B;  2N78 A;  5M3F G;  3STB C;  4GNX C;  5DLQ E;  4NXN Q; 
#chains in the Genus database with same CATH topology
 5GAD C;  1HNW L;  3C3L A;  3CPW A;  5M3F B;  3VR2 A;  1SE2 A;  4IAL A;  1A2T A;  2K5N A;  3CME A;  1BBW A;  3H0G H;  2HQE A;  3ND9 A;  3S2D H;  1STH A;  2E2I B;  3EIV A;  5KYL A;  5HUR A;  1SEB D;  3OHX C;  2NTS A;  3K57 A;  4J15 A;  1B7Y B;  2PQA A;  3FHW A;  4PQX A;  4PV1 C;  2JEA I;  2IHE A;  5KND A;  5CBE E;  1C0A A;  1EU4 A;  4KI0 A;  4RGT A;  5ELC A;  2F0O A;  1WFQ A;  3RZO H;  2VB3 X;  1TS3 A;  3HOV G;  5IYD G;  4NMZ A;  5H1S E;  1VQI A;  3HOV B;  3CC4 A;  4RGN A;  1DZ1 A;  2F0K A;  2K7V A;  4LFA L;  3CP0 A;  2LMC B;  3CCE A;  1NUC A;  4RFB A;  4Y7N H;  4DR7 Q;  5I2X A;  1PRT C;  4ZRZ A;  1PH7 A;  3J81 E;  4KLK A;  2QDB A;  3I3C A;  2I5M X;  4S3S A;  4DXF A;  1TS2 A;  1CZW A;  3I8Z A;  2Z9H A;  4FDB A;  2VW9 A;  2HCC A;  4AIM A;  2LXJ A;  3URY A;  2A1A A;  3G71 A;  3WWV A;  1PRT D;  1U4L A;  3J80 E;  2R93 G;  2B3G A;  1UE5 A;  4QY7 A;  3ULJ A;  1QUQ A;  3LX0 A;  1VQ7 A;  2R93 B;  4HIK A;  2Q2T A;  3K5O A;  3A54 A;  2NVX H;  1Y1W H;  1CK1 A;  4YCU A;  5IOD A;  3K5M A;  4IFD J;  1K83 H;  2F0M A;  1Y8N B;  1ZEQ X;  3K81 C;  1OXU A;  1PZK D;  1QZH A;  4NXM L;  3GD7 A;  3B6Y A;  2UXB Q;  4F87 A;  1IBK L;  3OTO L;  1I3Q B;  2YTV A;  1XNR Q;  3HOW G;  4LUO A;  1LTT D;  1K8A C;  5C5L A;  1WJJ A;  4A3I G;  3QWN A;  1QVG A;  4KKT A;  4RG1 A;  2PI2 A;  1Y14 B;  4JK1 C;  4A3I B;  4OWT B;  3T4A C;  1Q12 A;  4GOP B;  3J81 c;  1E22 A;  2NN6 H;  1QZG A;  2VQE L;  1B70 B;  4CDE C;  2ZJP A;  3RNU A;  2RHS B;  3J80 c;  2EY1 A;  1O7Y A;  1Q86 C;  3FDT A;  4N8X 1;  5BN4 A;  1KRS A;  2J4X A;  2XVS A;  3JC6 6;  1WTO A;  1CKN A;  2FFK B;  2JA5 H;  3D3R A;  1KL9 A;  1S5B D;  1UE6 A;  2EVB A;  2IPK D;  5I4D A;  3FKI G;  4A3C H;  1D7Q A;  5CYU A;  1G2T A;  5I2Y A;  4B3S L;  3FKI B;  1KC8 C;  2VUM G;  1AZP A;  5IGC A;  1B8A A;  4OWX B;  1I5F A;  3I73 A;  3GTM H;  1X32 A;  2VUM B;  4C3H G;  2N55 A;  3QR8 A;  1R9T B;  5LMN W;  1L0X B;  1GUS A;  3S15 H;  4HED A;  4C3H B;  4QIW B;  5FLX E;  4M1U B;  1L0W A;  1I94 Q;  5F2D A;  1PFS A;  4DNI A;  3GO5 A;  2UUC L;  1Q81 C;  3MFG A;  3GTO H;  3CCV A;  2JA6 G;  3PUY A;  4DAP A;  1XMQ L;  2GVA A;  5HY6 A;  2SDF A;  3CU7 A;  1VMP A;  2JA6 B;  1H9J A;  1C7Y A;  4IUQ A;  4Y52 H;  3ERS X;  3PUZ A;  4DR5 Q;  4LUZ A;  2B2V A;  2EYL A;  2F0Q A;  4XYQ A;  1HR0 Q;  5FLM H;  3HOZ H;  1K0R A;  4LF6 Q;  2YTX A;  2ZJQ A;  1TY0 A;  2Z8L A;  1VMC A;  1U4P A;  1GUO A;  1MBY A;  1G6Z A;  1TWH B;  1QJO A;  5KEE A;  3S14 H;  3R8B A;  1EY9 A;  2Q2I A;  2JA8 G;  1C48 A;  4X3T A;  5E7N A;  4DV3 Q;  1BOS A;  1IKL A;  1CKO A;  3OWE B;  4LFB Q;  1CHP D;  1WTW A;  2MGS A;  3F8T A;  3EFX D;  4G57 A;  2ATW A;  2X6L A;  4ZKC B;  1UEB A;  3N52 A;  3HOY B;  1HPC A;  3GDE A;  2F52 A;  2PMZ B;  1FJG Q;  4Q5V A;  3MFY A;  1CSP A;  3T1Y Q;  4JI3 Q;  4KN4 C;  3GTP H;  1T5E A;  1ENC A;  4DR2 Q;  1BCP F;  4A3K G;  2RDF A;  5JPM C;  2R6G A;  3GTK B;  4LWC A;  4DK3 C;  1B1Z A;  3TEH B;  3CCR A;  1KXL A;  1SNM A;  4DR3 Q;  1OXX K;  3CW2 C;  1SYD A;  2IWH A;  4K0K Q;  1SN8 A;  4RA8 A;  1IBM L;  3T1H Q;  2QCP X;  4JI0 Q;  1I4Q A;  4AYB G;  3RN5 A;  2F3W A;  1GM5 A;  1DOK A;  3DHQ A;  2DY8 A;  1YEZ A;  4AYB B;  4A93 G;  2DGY A;  4UP7 A;  2CCZ A;  2EY5 A;  2Z1C A;  3KLS A;  4A93 B;  3HZX A;  2UUA Q;  5BN5 A;  3KFU A;  1HR0 L;  4PZ6 A;  3PGZ A;  5IY0 A;  1QVC A;  2KCM A;  3E5S A;  5C4H A;  1K8O A;  4LF7 Q;  1CQV A;  2F0E A;  2E76 C;  1NTG A;  5IYB H;  4JI7 L;  2QGQ A;  1X55 A;  3A5Z B;  1HRJ A;  3CQZ B;  1HH2 P;  5FJ8 H;  5IP7 H;  2MPM A;  4ZQ3 A;  1G6P A;  1YJW A;  3SK5 A;  2SOB A;  2O5I C;  3I4M B;  1XPU A;  1WTX A;  3NPP A;  1BNZ A;  4OON A;  1IYJ B;  1VQ9 A;  2A6E C;  4LFB L;  3ZYY X;  2PNH A;  3NEL A;  2WAQ E;  4ZCK A;  1EL0 A;  3JAM E;  2N8N A;  2GA4 B;  2A6E D;  3AU7 A;  2Q2U A;  5G3L D;  3S16 H;  3PO3 G;  2NYZ D;  4PZ7 A;  2WB1 E;  5BR8 Q;  3PO3 B;  2E75 C;  2FJ2 A;  1PMR A;  3HRZ C;  1BBX C;  1NMF A;  3CC2 A;  3VYR A;  1LT4 D;  2L12 A;  4FP5 D;  3CCQ A;  3W1B A;  1FNW A;  1OXS C;  2G9D A;  5DEH A;  1UE7 A;  2EE1 A;  5JVH 3;  1C8C A;  4EX5 A;  3S1M H;  5C4J B;  4NKL A;  3TQY A;  1S4Z A;  3PCO B;  1G51 A;  1V1O A;  4DNT B;  1N36 L;  4DV1 L;  1FNV A;  3D4D A;  3MXU A;  2P5Z X;  4TVA B;  4CKB A;  1V1P B;  4GKJ L;  1AFP A;  4JC0 A;  1IKM A;  5C44 H;  4MIU A;  1YZ6 A;  2R92 G;  3GV3 A;  5M3M G;  4HIO A;  2BDO A;  5EBC A;  3TZU A;  3PF5 A;  4LF9 L;  4EQ5 A;  3RZD H;  1P8L A;  1VQD A;  4JW0 A;  2R92 B;  3PUV A;  5M3M B;  1V1Q A;  2K33 A;  1N9W A;  3NHH A;  4KHZ A;  1QVF A;  5JJL A;  1H9S B;  2WII B;  2QDL A;  2FMM A;  2NTT A;  5C3E H;  1IYV A;  3MWY W;  4HJ5 A;  4JI8 Q;  5HGT A;  1OO9 B;  1TWC H;  1HQM C;  5LHY 1;  4QJF A;  1MJC A;  2CWA A;  2F0L A;  3A7A B;  4C3I B;  3P7J A;  3UI2 A;  2B2V C;  4B3R Q;  5KNB A;  3VA7 A;  5CV4 A;  1VQ6 A;  4FXD A;  5CBA E;  2JA5 G;  4A3C G;  1IL8 A;  1NR2 A;  1S40 A;  5TSS A;  2ASB A;  1T9H A;  2AWO A;  2RQX A;  3GTL B;  1N33 Q;  4GZY C;  5AJ3 Q;  4CJ0 B;  3BDO A;  2TMP A;  4RHR A;  4HJ8 A;  1ESR A;  4KKS A;  3QO2 A;  3UE0 A;  3VR5 A;  5D65 A;  2I5H A;  3EJI A;  3WDN A;  1SRU A;  2L11 A;  4A3B B;  2B2T A;  4HID A;  4OX9 Q;  1F9Q A;  2C5C A;  4G7H C;  4LF5 Q;  2CW0 C;  2LSS A;  2VXW A;  2X69 A;  5D3I B;  3E3X A;  5KNC A;  2E2H H;  3TRE A;  2B8F A;  3KDF B;  3OW2 A;  2CW0 D;  1BCP B;  2ZTE A;  4LMQ D;  5BR8 L;  1AE3 A;  4X65 Q;  4P75 A;  1RD9 D;  2E2J H;  3EQL C;  3L7Z C;  4OHJ A;  5M5Y B;  2F0N A;  4DK0 A;  1S5D D;  3EVQ A;  2J7Z A;  4LF8 L;  1UEA B;  5CV9 A;  1L1O C;  1TXY A;  3TP7 A;  5FLM G;  4C56 C;  5LMN L;  3HOZ G;  2N88 A;  1UNS A;  4QUC A;  1B44 D;  4P73 A;  3S17 H;  1VQG A;  4GKK Q;  4NP5 A;  2JA7 H;  4BY7 H;  4FF1 A;  4CDF C;  4A3D H;  4DV7 L;  2QKI C;  1F2Z A;  2XSC A;  4DAY B;  3BG3 A;  3U9O A;  4RKB A;  2N78 A;  1LTI D;  3S14 B;  1N32 L;  2D5D A;  1EY0 A;  4I7Z C;  1VQ8 A;  4WOR A;  1PFM A;  1WTR A;  3AFQ A;  3TP5 A;  1MHW C;  4ME5 A;  4R4C A;  2FXQ A;  3A56 A;  5M5X H;  1J6Q A;  2AQ3 B;  4JBK A;  1F9P A;  2UU9 Q;  4RCN A;  3H3V I;  1KIX A;  1Y1V H;  1ZKO A;  3J7A F;  5AJ3 L;  5ELF A;  4J8Q A;  2F0J A;  4V19 0;  3DEP A;  2EY2 A;  1O7I A;  3I2Z A;  1JWS D;  1HUM A;  5I6Y A;  4HR7 B;  1JOO A;  3PV0 A;  3FPP A;  3M4Y A;  3M4O H;  4UP8 A;  2XNA C;  1HXY D;  2L4N A;  4LW1 A;  2XIW A;  1CHQ D;  2AHO B;  2WIN B;  1HNW Q;  3BYY B;  2KHJ A;  2CWP A;  4G7O C;  1JIC A;  1SNO A;  1LT5 D;  5DAU A;  4B9X A;  5IGE A;  4A3M G;  3K58 A;  4RGM A;  1ZXT A;  1J5E L;  4ABN A;  3P75 A;  2F4V L;  4A3M B;  5CC4 A;  2Z4I A;  2IX3 A;  5EPJ A;  1EFI D;  3R2T A;  1K3B C;  4FXK C;  4DKA C;  1I50 B;  2DY7 A;  2ZJR A;  4B9W A;  4MTN A;  2K01 A;  2K4K A;  4DUY Q;  1D2B A;  2E8G A;  1KQS A;  2KEE A;  5K36 G;  1RJT A;  1SNQ A;  2EXD A;  1JT8 A;  1SE8 A;  1GKH A;  4IUU A;  1VQ5 A;  1NE3 A;  2A69 C;  3RD4 A;  1TWF H;  1Z6H A;  1IZ6 A;  1TY2 A;  3S1N H;  3UDG A;  2I07 B;  4KKU A;  1ENA A;  4PMC A;  4UHV A;  2A69 D;  4IFD I;  2R7Z G;  5C6A A;  2R7Z B;  2UU9 L;  3GV6 A;  3HKZ G;  1YNX A;  1TQO A;  1STE A;  1KDB A;  1JJ2 A;  1G29 1;  3S1R B;  3OIP A;  4X62 L;  1SE4 A;  4K5V A;  3HKZ B;  4KHP L;  1UWV A;  3MXN B;  1WVL A;  4JI1 L;  4U68 A;  1VQN A;  2B2W C;  3R3O A;  4PZ8 A;  2WAQ G;  1MSH A;  2MQH A;  2F0G A;  1KDA A;  1YNN D;  1RKN A;  1VQK A;  4OO1 H;  1V1P A;  5JPN C;  1JJG A;  3NUC A;  5A35 A;  4BBR H;  4NXM Q;  1IBK Q;  1STN A;  1BVS A;  2B2T C;  4TSS A;  2WB1 G;  4MTK A;  5L37 A;  1WCM H;  3G4S A;  2F0H A;  4IJH A;  2WB1 B;  3KLR A;  2MO0 A;  3GQB A;  5T1G A;  1NAP A;  3Q22 A;  1SBB B;  1BBU A;  1TT2 A;  3J7Z C;  2B63 H;  4R1J A;  3MXG A;  2YU9 H;  5T1I A;  4R4T A;  2R3Z A;  4C1N K;  2VQE Q;  2KED A;  2RKS A;  2RCN A;  3L0O A;  3P20 A;  5KYI A;  1TWC B;  2TSS A;  3U4Z A;  2XWB B;  4DUY L;  1ILQ A;  4R4I A;  1F9R A;  5GAH C;  4JOI C;  3H6M A;  5GRO A;  4OEM B;  1IXR A;  1SMX A;  3OYY A;  3K59 A;  5JJK A;  4B3S Q;  1P16 A;  3BVG A;  1X3E A;  4L5Q A;  4LJZ C;  4EQP A;  1VS0 A;  1AZQ A;  4KY7 A;  1PRT F;  4DGZ A;  1RTN A;  1VQC A;  3OMG A;  1YJ9 A;  4JV5 L;  1ET9 A;  4DXG A;  3FMC A;  1PVO A;  1IHZ A;  3L9A X;  4IUR A;  3KDF A;  4N9T A;  4FF3 A;  1A63 A;  1TS4 A;  2B2Y A;  3TSS A;  3NWS A;  2R61 A;  3NBI A;  4RAU C;  3D0F A;  1FR3 A;  2UUC Q;  3J81 j;  3ND8 A;  1VQL A;  4X3S A;  5GAE C;  1XMQ Q;  2Z0S A;  2WKD A;  5EJW A;  2L1B A;  4H13 C;  1EYG A;  3GTJ B;  4XDX A;  3S24 A;  3PUW A;  4GN4 B;  3NE5 B;  4MZ9 A;  3HOU H;  1SJE D;  3CHB D;  5ISR A;  3P1H A;  1PYW D;  1FYC A;  5FO7 B;  4LK1 C;  1PH9 A;  3NBH B;  3NTI A;  3C1F A;  4DAY A;  1WD0 A;  3J7Y W;  1F2M A;  4K2K A;  3S9W A;  1STY A;  1PH5 A;  2JA7 G;  4BY7 G;  4A3D G;  1TWG B;  3S17 B;  3BZC A;  2WV6 D;  3HOW B;  3KLS X;  4CKC A;  1TWA H;  4O1N A;  3J81 i;  3J81 L;  1CUK A;  1PH6 A;  1HZB A;  2F0T A;  2H1E A;  2JQO A;  3W5O A;  3BU2 A;  1M4V A;  2IT1 A;  5FOB B;  3CMA A;  1AEX A;  2K5H A;  2OEO A;  1A62 A;  3J80 i;  5I9O A;  3J80 L;  3F2U A;  1HNX L;  4K6D A;  3ERO A;  1LTB D;  3BS1 A;  3QB3 A;  2MFI A;  4R9W A;  3J7A V;  3I4N H;  2F0P A;  1EQV A;  3FEW X;  5CR3 A;  5CV6 A;  4K5X A;  2WP8 J;  3U4V A;  3FPU B;  3OIQ A;  2OTJ A;  1WYD A;  2G5D A;  4A3E H;  2KQ3 A;  1IL2 A;  5D14 A;  1CSQ A;  2HD3 A;  3SGI A;  3GTQ H;  1T5X D;  4XIG S;  4I7A A;  2PZT A;  2CQA A;  4DUZ Q;  1C4Q A;  2A74 C;  3C1E A;  3R93 A;  4K8J A;  5LMU L;  4HIM A;  3M7N A;  5C4X H;  1EIY B;  1PDQ A;  1QG7 A;  5EKK A;  2NZH A;  2SNM A;  3RUZ A;  3HOX H;  2PCF B;  3BJU A;  3G6J B;  1SFO B;  5EQ0 A;  4AH6 A;  4L5R C;  4G4K A;  1IBM Q;  3M4O B;  3K7A H;  3M85 A;  2NN6 I;  1O80 A;  1LYL A;  1LT6 D;  3BZK A;  5IT9 E;  4O0A A;  3M3Y H;  4BY1 H;  1VQE A;  5EKL A;  1QNK A;  2DJG C;  4OL7 A;  3PIO 3;  4IFD G;  1JWU D;  3HG9 A;  4OEL B;  4A3F H;  2RDH A;  1SND A;  3TS0 A;  2RCF A;  4L5S A;  4A3L H;  4XYO A;  2K14 A;  1KLU D;  1KLG D;  1JOQ A;  1XXG A;  4IJL A;  3W1G A;  4GN3 B;  1Z9F A;  3KOJ A;  4HN7 A;  5A2Q E;  1Q3L A;  2UXC L;  4BXX H;  4XT1 B;  1Q8K A;  4JI7 Q;  1CTM A;  2PZU A;  1I6H H;  1GUW A;  4DFA A;  2DUD A;  3AMU A;  1XX8 A;  1CI3 M;  2RVL A;  3AFP A;  2BOS A;  2Q8T A;  2M2L A;  4BWG B;  2PI2 E;  4R4O A;  3BVM A;  3D4W A;  4KD4 A;  5FLX L;  4B3M L;  3PO2 H;  3KJO A;  2IW3 A;  2JA8 B;  4I65 A;  4DV5 L;  3U58 A;  5FLX c;  4K2L A;  1TWF B;  1X3F A;  1SYE A;  2IX0 A;  5EPL A;  4B08 A;  1JB3 A;  1L0Y B;  4HMI A;  1MKH A;  5CGK A;  5IYC G;  1SNC A;  4APV A;  2E2D C;  2MJ8 A;  2HQL A;  4C3J H;  1KNA A;  2NVQ H;  3DM3 A;  4YCV A;  5KGU A;  3MXN A;  1VDZ A;  4JI2 Q;  4K6L A;  4QGU A;  3CCU A;  2UXD L;  2F0D A;  4DV0 L;  4DUZ L;  1B9M A;  3DEO A;  3E6Z X;  4A3K B;  4JYA L;  1PRT B;  4C2M B;  2K5Q A;  3G7L A;  2JP1 A;  5JJI A;  4OO1 G;  3MEF A;  1V43 A;  4KHV A;  2PPB C;  1AH9 A;  3K0X A;  2R7F A;  1N36 Q;  1PTO H;  4BS9 A;  3NXW A;  4DV1 Q;  2NZO A;  1EOV A;  4GKJ Q;  2LKV A;  1RHP A;  3GTG H;  1HHV A;  4PG3 A;  1WCM G;  1DYQ A;  4LF9 Q;  3MHB A;  5I9P A;  4PMW A;  3OOC A;  2Y0S G;  1CA6 A;  4ODG A;  4OWW B;  3H0G G;  4FNF A;  1HZA A;  1WTH A;  3TDQ A;  2Y0S B;  1ZYR C;  2B63 G;  1H95 A;  2WFW A;  3H0G B;  4IUN A;  4N9P A;  3S2D B;  1EIF A;  1O78 A;  4QUF A;  3PIP 3;  1X56 A;  2EPB A;  1JMC A;  1LV9 A;  3U9S A;  4EVO A;  1ZYR D;  1F2L A;  4IOC A;  1WD1 A;  3A8I E;  3LGJ A;  1A6X A;  3CXC A;  2JSO A;  2L5T A;  2YV5 A;  2J0T D;  2EYM A;  3OSO A;  1ASY A;  1YHQ A;  1A15 A;  2V1C C;  1JQY D;  4FO2 A;  5G3L F;  3RZO B;  2NVY H;  4B3T L;  1KAB A;  1AW7 A;  4P71 A;  3MVV A;  4X64 Q;  1GHJ A;  1I6V C;  2F1M A;  1TU2 B;  3CPF A;  4Y7N B;  4DR1 Q;  2IY5 B;  5ELO A;  4NXN Q;  5DM6 3;  1EZ6 A;  3TS2 A;  2QEJ C;  1DM0 B;  4CHT B;  2CKZ B;  5JEA J;  4A3J H;  2N3S A;  1HTP A;  1TVX A;  4GN5 A;  4GNX B;  4DR4 L;  2UUB Q;  4JI2 L;  1PTO C;  2RA4 A;  2JXM B;  1Y1W G;  1LAB A;  1S3O A;  4LF8 Q;  3D6C A;  4QQB X;  2NVX B;  1Y1W B;  5J1Z A;  4YHH Q;  3SE0 A;  4G7Z C;  3IFT A;  1DOM A;  1PTO D;  2F0W A;  3HOU G;  1K83 B;  2O4X A;  3T16 A;  1SE3 A;  1EQQ A;  5LMN Q;  5HGQ A;  1EIH A;  1SR3 A;  3HOU B;  1K28 A;  1OTC A;  1RF2 D;  4X3U A;  3W3A A;  3F2B A;  4POG A;  1F9S A;  3VYT A;  4DV7 Q;  3ULL A;  2HHH L;  3KJP A;  5C0X H;  4ZK9 B;  2RSN A;  4GOP A;  2AKW B;  4YCW A;  1NNX A;  1EYC A;  2OQ0 A;  4J6H A;  1VCI A;  5JVG 3;  4L8J A;  2FMC A;  1N32 Q;  3JAM c;  4N8F A;  1R4P B;  5DNF A;  4DV6 L;  1STB A;  2NN6 G;  1ILP A;  2XTI A;  2F0U A;  2L55 A;  5M3F H;  1GO3 E;  4YY3 Q;  4C1N I;  3I4N G;  2KHS A;  2EYP A;  4RH6 A;  2JK8 A;  4KV6 A;  4X66 Q;  1CKM A;  3DWQ A;  3OW7 A;  2E2I H;  1QNU A;  4TQU S;  4A3E G;  4PNY A;  2HDL A;  1PYB A;  2Q8I B;  4LF4 L;  2JA5 B;  1TS5 A;  1NBW A;  2Z4H A;  2HCI A;  1DCZ A;  4EGV A;  1PH4 A;  1M90 C;  2BH8 A;  1B9N A;  2IJ0 A;  5C4X G;  4NDX A;  2HT1 A;  2QW7 A;  3GTM B;  3KYH C;  3HOX G;  5C4X B;  1JCK B;  1PZJ D;  5EBD A;  4X64 L;  1N34 L;  4R4Q A;  4E6I A;  2KEN A;  5AFW A;  4DR1 L;  1VQM A;  4J1M A;  3HOX B;  4KTA A;  3MTS A;  2EIF A;  5D3D A;  3S15 B;  4NXN L;  4ZUI A;  3BVZ A;  3CCS A;  1NJI C;  2PQE A;  1X9N A;  3HOV H;  3SK4 A;  2F0V A;  5IYD H;  2Z6K A;  1HFN A;  3NP8 A;  4NPS A;  2EJM A;  3X3M A;  3VR4 A;  2UUB L;  1J5E Q;  1VQB A;  5K5P A;  3GTO B;  3C46 A;  2F4V Q;  1Q8I A;  3SK6 A;  4A3L G;  2CHB D;  1D1I A;  4AQY L;  1B50 A;  4HSV A;  1SNP A;  2RBM A;  4YHH L;  2LXK A;  3UDF A;  4BXX G;  3CAM A;  5CMD A;  2ZXP A;  1XTC D;  1IBL L;  3HOZ B;  3F2D A;  2GVB A;  4JI4 L;  1BO0 A;  3BDC A;  2M9V A;  4ZUJ A;  4IO9 A;  3SEB A;  3G6E A;  2F03 A;  3NEM A;  1S5E D;  3QOJ A;  1I4H A;  4BBS H;  3OWF A;  1I3Q H;  1HNZ L;  4FVM A;  1LTR D;  2H5X A;  1NCV A;  1HZC A;  1IW7 C;  2OWO A;  2HIV A;  4TKO B;  3D4R A;  4YY3 L;  5GAG C;  2F0S A;  4DV2 L;  1Q82 C;  4X66 L;  4L5T A;  4A3I H;  4YWK A;  2KEC A;  1IW7 D;  1YIJ A;  4WJ3 M;  1Z7T A;  1D5M C;  1CFM A;  2EYH A;  1W2B A;  1BXT A;  4X62 Q;  1WTV A;  3GTP B;  1XMO L;  2KCN A;  4KHP Q;  5IWA Q;  1XTD A;  1NSN S;  4JI1 Q;  1BDO A;  3TP8 A;  4QL5 A;  4QIW E;  2D9U A;  4UDU C;  1U4R A;  4RWS C;  1EIG A;  3SK8 A;  4GLX A;  4JI6 L;  1LLR D;  3CCL A;  2K75 A;  3NK9 A;  3HGB A;  4DR6 L;  4O42 A;  2N49 A;  2KJX A;  3CKI B;  3DUZ A;  3S1Q H;  3T53 B;  3CD6 A;  1KAA A;  1YNJ C;  2G9H D;  4TRD A;  5IOC A;  2XRS D;  1JE5 A;  1JOK A;  1R9T H;  5C0X J;  4C3H H;  4IUV A;  3RLO A;  3PIO A;  1OXV A;  1H9R A;  1EFW A;  3HEJ A;  1YNJ D;  3OPO A;  4HJ9 A;  5ELD A;  2X6G A;  2VQF L;  1LT3 D;  4A3G H;  1BKB A;  3SR1 A;  5M5W H;  1A3T A;  2ZXR A;  5COY A;  1EEF D;  5IYB G;  4LUV A;  2E5L L;  3AB9 A;  2JA6 H;  1S72 A;  5IP7 G;  5FJ8 G;  4JBM A;  1YBY A;  5LL6 S;  2KVM A;  2JYO A;  4POF A;  3Q24 A;  3M7G A;  4QMG A;  2PZW A;  1HQR D;  1V8Q A;  1U4M A;  2AQ2 B;  2H4O A;  1EU3 A;  3NTK A;  1E2W A;  2NVY B;  4JV5 Q;  1R4Q B;  4GOP C;  3DMU A;  2PMZ E;  1BF4 A;  1TWH H;  4UY8 C;  4GS3 A;  2EYF A;  1VQO A;  4MN3 A;  2A19 A;  4NW2 A;  1VQJ A;  2I5L X;  1NY4 A;  1K73 C;  1F2Y A;  4GNX A;  1AP0 A;  2D0P A;  2KBN A;  4XTC S;  1K3R A;  3I4O A;  3S16 B;  4A3J G;  4IUP A;  2D2C C;  3VDY A;  2CH4 W;  1MIU A;  3SDZ A;  1YNN C;  1FGU A;  3DM1 A;  1FD7 D;  1TKW B;  3G48 A;  5FK9 C;  4CJ1 B;  1SYF A;  5IWA L;  3TBI B;  3KK7 A;  3HOY H;  1QIL A;  1Q1E A;  3LNN A;  2A6H C;  4OIJ A;  1V9P A;  1HFG A;  3KUP A;  1CQF A;  2WAQ B;  4XQJ A;  2A73 B;  2A6H D;  3S1M B;  3F1Z A;  1HA6 A;  3GTK H;  3HP3 A;  4AYB E;  4JI5 Q;  5C44 G;  2NZ1 D;  4L63 B;  1H9S A;  5IE8 A;  2NBF A;  5M9O A;  5C44 B;  4U67 3;  3F2C A;  1B4O A;  1SDF A;  3TME A;  1Y69 U;  3RZD B;  1L1O B;  5ELB A;  1HR0 W;  1KRT A;  4RGO S;  4DNR B;  2K28 A;  2EYJ A;  4ID6 A;  5C3E G;  1II3 A;  2YYZ A;  2C9O A;  2Z6K C;  2C35 B;  4DF7 A;  4WJW A;  5C3E B;  4HJ7 A;  1HNX Q;  2EOT A;  1C9O A;  1ROD A;  3PIP A;  2AQ1 B;  1YHB A;  2BE5 C;  1SSO A;  2MHV A;  1ICW A;  2L0C A;  1EY7 A;  1PXU A;  2Q8R E;  1KTK A;  3RN2 A;  4JCV E;  2LY7 A;  4H7B A;  3T13 A;  1Q46 A;  2BE5 D;  2OTL A;  4OO1 I;  1N8R C;  3HS0 C;  4A93 H;  4ALP A;  3PF4 A;  5ELE A;  1CT1 D;  3I70 A;  3SHL A;  5LMU Q;  1E1O A;  5JAV A;  3K7U C;  3DWP A;  1K8G A;  2ALY B;  2FIN B;  2XGT A;  3CQZ H;  3QOL A;  2B2U A;  2MUY A;  2K5V A;  2K05 A;  3UDI A;  1PV4 A;  4JBW A;  4DU9 A;  3I4M H;  1G2S A;  1K9M C;  3PQI A;  3L3O C;  2E2H B;  1JWM D;  2MNA A;  1U0L A;  4H02 A;  3A55 A;  1VQP A;  3OMC A;  3A7L A;  1FGB D;  5EPK A;  2E2J B;  2EXZ A;  4JVZ A;  3TP6 A;  1JB7 A;  4QCL A;  3RLF A;  4IOA A;  1B3A A;  2GN5 A;  3PO3 H;  2I46 A;  2UXC Q;  3L2P A;  3FRP B;  1XNQ Q;  4ZYS A;  4MHE A;  4JI5 L;  3FP9 A;  2SNS A;  3KF6 B;  3CC7 A;  4LFC L;  1EEI D;  1LTA D;  3GP7 A;  2KA7 A;  1DOL A;  4IUT A;  1EOT A;  2JA7 B;  1EWI A;  3M4Q A;  2ZM6 L;  1KD1 C;  4BY7 B;  4A3D B;  5C4J H;  2VB2 X;  3ERQ A;  5CV7 A;  4B3M Q;  3VA5 A;  1HJP A;  4BBS G;  4EQO A;  4H0L C;  1W3S A;  4OGQ C;  1I4R A;  5E4X A;  3K5N A;  2VS1 A;  1YHA A;  5IGG A;  4DV5 Q;  3VYU A;  4BBS B;  1Q90 A;  2ENB A;  3A74 A;  3K6O A;  3ICE A;  3T56 B;  1YI2 A;  1K0S A;  1VQA A;  2AWN A;  2R92 H;  5M3M H;  2A5H A;  5EAY A;  3A5U A;  1PA6 A;  1SYC A;  3D6W A;  3Q8D A;  5M5X B;  2PNR C;  2PW7 A;  4K8I A;  1JJC B;  1Y1V G;  1RTO A;  1M1K C;  3H94 A;  2UXD Q;  3ONA B;  1G8Z D;  4DV0 Q;  4KY6 A;  1Y1V B;  4FYD A;  1E2V A;  4IZ8 A;  4JYA Q;  1EWC A;  3U50 C;  4C3I H;  5IGF A;  1VF7 A;  4DAM A;  3K0Y A;  4ULL A;  2RF4 A;  2CH4 A;  1STA A;  1D6E C;  3J7A 5;  5IGB A;  4QF4 A;  3QIA A;  1ML0 D;  1GUG A;  1EYA A;  4KN7 C;  3GTL H;  3FVQ A;  2D0O A;  5EKI A;  5JEA H;  3T51 B;  2QIL A;  1X3Q A;  2XN9 C;  4CGY B;  4DK6 C;  5NUC A;  4A3B H;  3S1Q B;  3STB C;  4GNX C;  4DR7 L;  4WRD A;  3MC0 B;  1D8L A;  3ITP A;  2A8V A;  2HIX A;  3AYH B;  1E1T A;  2CVR A;  1MI2 A;  5IP9 H;  4DA2 A;  4XXE A;  3STB D;  1ASZ A;  1YVC A;  1PH8 A;  1D5Z C;  4A3G G;  1PH2 A;  1X65 A;  4H44 C;  4LAA A;  4FF2 A;  2F0F A;  4KMU C;  1XNQ L;  5M5Y H;  4IN3 A;  4DV4 Q;  1RCV D;  1JOR A;  4A3G B;  5M5W B;  3S2H H;  1LM0 A;  2B39 A;  2E74 C;  1SAP A;  2HDM A;  1QWY A;  2K50 A;  4CDC C;  1HA5 A;  4KD3 A;  5CV8 A;  1TR5 A;  2OQK A;  1PYS B;  5BN3 A;  3IRB A;  2EZV A;  4BA2 I;  4ZAI A;  4B3T Q;  3MA2 B;  3KBX A;  4HMJ A;  1J9O A;  1LTG D;  2Q2H A;  2VL6 A;  4R8N A;  2UXB L;  2F0I A;  5IT9 L;  1E0B A;  3M4P A;  4A75 A;  1KNE A;  3S1N B;  1XNR L;  3MAQ A;  3IL8 A;  1DD2 A;  1EZ8 A;  2JJQ A;  3BYT B;  1EY8 A;  1GD7 A;  1I4G A;  3KBG A;  1KHI A;  4UAI A;  5IT9 c;  4L6T B;  4FF4 A;  3UDX A;  2IHF A;  5E3F A;  1O7L A;  3RR5 A;  2K1B A;  4JBJ A;  1ICF B;  2F4I A;  1EWH A;  2EYO A;  1VF5 C;  3K8A A;  4OIK A;  3I56 A;  4DR4 Q;  1MSG A;  2KCC A;  2JA9 A;  2RHQ B;  3BDL A;  5A2Q L;  1BR9 A;  4KJN A;  4MNO A;  1O7Z A;  1W6K A;  4HSP A;  3H91 A;  5I6W A;  1XPR A;  2DN8 A;  3HOY G;  2NWG A;  2K6A A;  2MO1 A;  4CKE A;  5LL6 X;  1OXT A;  1GUN A;  1L2F A;  2O5J C;  4BBR G;  5DM7 3;  2RSO A;  2IX1 A;  1FL0 A;  1D5X C;  4BBR B;  1PHJ A;  2B2U C;  2NB0 A;  3E0E A;  2DJF C;  1WI5 A;  3I91 A;  1L1O A;  1RDP D;  2HHH Q;  2BCO A;  1A3V A;  2B2Y C;  3I55 A;  4CBV A;  1BCP C;  1WCM B;  3D8G A;  1X54 A;  1FVI A;  1MGS A;  1QCB D;  4GLV B;  5KIX A;  1VQF A;  1PH3 A;  1A0I A;  3Q23 A;  2K5D A;  2XRQ D;  4DV6 Q;  1XYI A;  1BCP D;  3BZD B;  3WOE A;  2B63 B;  1MJE A;  2YU9 B;  1I94 L;  2VY3 A;  2A68 C;  1CM9 A;  4IPH A;  4DV4 L;  1RL2 A;  4DN4 M;  2QF7 A;  4YWM A;  4A3M H;  3DWA A;  3VYS A;  2BA1 A;  3O13 A;  4LF4 Q;  3D31 A;  1PH1 A;  2A68 D;  1XPO A;  4DR5 L;  1LTL A;  1EY5 A;  4WFN 3;  1I50 H;  2PYK A;  3DXJ C;  4RCO A;  5E4W C;  3MZ5 A;  2LFN A;  1J8I A;  4LF6 L;  2KCT A;  2AUJ D;  1N34 Q;  4X3K A;  3ER0 A;  1LUZ A;  1B53 A;  2L9H A;  4RKL A;  5C3W A;  1EY4 A;  1UAP A;  3I4M G;  5K36 H;  3ULP A;  3LWU A;  1WTP A;  3HKZ E;  4PMB A;  1PTO F;  1GOZ A;  4IPG A;  2D62 A;  4YIJ A;  4DV3 L;  2WKC A;  1DGS A;  4K5W A;  3VR3 A;  1GHK A;  1IYU A;  1DXM A;  5J22 A;  2SEB D;  4AQY Q;  2KUM A;  2XWJ B;  2VZA A;  4FXG C;  1LO5 D;  2R7Z H;  3NBH A;  2ES2 A;  2ZT9 C;  3NTH A;  1UUP A;  3KF8 B;  1FJG L;  3S1R H;  3KF6 A;  3W2D A;  2NUC A;  3V2T A;  1BUV T;  3T1Y L;  4JI3 L;  4A76 A;  1IBL Q;  4DR2 L;  3CRK C;  4JI4 Q;  1ENF A;  5C5M A;  3H09 A;  1GUT A;  5IGD A;  2EQS A;  3SXH A;  4X6A H;  1PFN A;  3JAM i;  3JAM L;  1E3P A;  1ONL A;  1ET6 A;  2BA0 A;  4Q0F A;  2NVT H;  1B2T A;  4DR3 L;  1TWA B;  3M9B A;  1Y8O B;  1HNZ Q;  3A0J A;  1D1K A;  2ID0 A;  4K0K L;  3K80 C;  2LS0 1;  2B8G A;  2RDG A;  4M8A A;  3PUX A;  3T1H L;  4DPG A;  4JI0 L;  4DV2 Q;  4KY5 A;  4F8M A;  1VQ4 A;  3I4N B;  3A8K E;  2MP1 A;  3RMH A;  3TRZ A;  4HTH A;  2EY6 A;  2K52 A;  4XQN A;  1Q7Y C;  1SLJ A;  1TII D;  4A3E B;  4HCS A;  1STG A;  1XMO Q;  3GTQ B;  1SYB A;  2JEB I;  4C3I G;  2UUA L;  1AE2 A;  1X3P A;  4HAE A;  1EY6 A;  4LF7 L;  1SXT A;  5C0X I;  4KK7 A;  2PQA B;  5FO9 B;  1F77 A;  1SMY C;  4JI6 Q;  1HZ9 A;  3A8J E;  1I4X A;  1I4P A;  4DR6 Q;  2B2W A;  5JEA G;  1CA5 A;  1EQT A;  4XQQ A;  1E7Z A;  1RIP A;  1HTL D;  4ZLT F;  3CCJ A;  1SMY D;  1X6O A;  4OXP A;  1E24 A;  3K7A B;  1QB5 D;  1H9M A;  5FKA C;  5IIF A;  4BY1 G;  4A3B G;  2ZTC A;  4A4I A;  2BH2 A;  2O2L D;  2M00 A;  4WJ4 A;  1JR0 D;  3MEH A;  4A3F G;  4BY1 B;  3M3Y B;  1B3Q A;  4RHS A;  1U5K A;  2I0Q A;  1XJV A;  4UPA A;  4A3F B;  3K5L A;  5IP9 G;  2VQF Q;  3RLN A;  3N6R A;  3TZD A;  3VR6 A;  3R2I A;  2R93 H;  1G91 A;  2E5L Q;  2JE6 I;  3NWT A;  5E1F A;  2QEX A;  3GTJ H;  3S2H B;  2CQO A;  1I6H B;  1QUQ B;  1FNU A;  4UP9 A;  2DNC A;  1SRO A;  3PO2 G;  3H3V H;  1K8M A;  2K32 A;  4JOI A;  2B29 A;  3PO2 B;  1PZI D;  1DON A;  3CRL C;  1TWG H;  4KJO A;  3HOW H;  4QB4 A;  1U9R A;  3QJY A;  1Q1B A;  4YWL A;  1GVP A;  2EJG C;  2OXP A;  3HKS A;  3PSI A;  1PLF A;  3DLL A;  4C3J G;  2FHT A;  3EA6 A;  1Y8P B;  4C3J B;  2NVQ B;  2L15 A;  1H9K A;  2PO4 A;  4JI8 L;  5C3X A;  3AEV A;  4V0B A;  4ME3 A;  1S5F D;  2HUG A;  1DJR D;  2JN4 A;  3CCM A;  1YIT A;  3PMF A;  4P2C B;  5ELN A;  4LNQ A;  5COR A;  4B3R L;  3KLW A;  2QA4 A;  3QG1 A;  2R7D A;  3NSW A;  3FKI H;  3NQI A;  4CJ2 C;  1SJH D;  5KRU A;  1PTO B;  1CKN B;  1SYG A;  2ZXO A;  3I4L A;  1N33 L;  3E9H A;  4HJA A;  2VUM H;  1Z47 A;  2ICE C;  5GQO A;  1LTS D;  3GTG B;  1KDC A;  1HUN A;  3V96 A;  3I90 A;  4BA1 I;  5FO8 B;  5EGT A;  1NR4 A;  1AN8 A;  3EN2 A;  4P72 A;  1SFO H;  4OX9 L;  2V4D A;  4LF5 L;  3I72 A;  4GLA C;  1A8V A;  4ZKB B;  4IPD A;  3SVM A;  3MXP A;  1JE4 A;  4RMF A;  2AUK A;  4CDD C;  2VNU D;  2K04 A;  4XT3 B;  3H3V C;  3UE1 A;  1UE1 A;  3TN2 A;  4X65 L;  1CZG A;  1EYD A;  1W6J A;  3E9I A;  4IFD H;  3Q0A A;  4F88 A;  2F3V A;  1MD2 D;  2OCE A;  4IPC A;  2PW5 A;  3AQQ A;  1M8A A;  4Z9C B;  1GJX A;  3ZJY C;  3Q6S A;  3CF5 A;  5JOB A;  2F3I A;  4IQZ A;  4GKK L;  1WTQ A;  1NMG A;  4K14 A;  1XWE A;  2OF1 A;  1PFB A;  2DNE A;  2KHI A;  2JA8 H;  3IFD A;  3LWE A;  1VQH A;  2ICI A;  2K03 A;  2WAC A;  4EQN A;  2EDG A;  4LFA Q;  2CFM A;  3EBE A;  3HFZ B;  5CV5 A;  3X3N A;  1X3G A;  4A3J B;  5J3B A;  3H15 A;  1QOH A;  1YJN A;  4DK1 A;  1LAC A;  3KF8 A;  1WOC A;  3V05 A;  2YTY A;  1BQQ T;  5C4Z A;  1S5C D;  5JJZ A;  5IYC H;  1KAW A;  1HCZ A;  1A2U A;  3I7F A;  3WOF A;  4JPB W;  1A3U A;  2K5W A;  4O2D A;  4DAV A;  1EQR A;  4NB3 A;  4A3K H;  1GXD C;  4C2M H;  3E0J A;  4JG2 A;  2Y0S E;  4P74 A;  4LFC Q;  5C0X G;  2AMC B;  2EJF C;  1ESF A;  2ZM6 Q;  4R8I A;  3IKJ A;  4ILW A;  2OT2 A;  1E2Z A;  3NEN A;  1EUJ A;  1JC7 A;  1QE6 A;  3NQT A;  4HCE A;  2IL8 A;  2KOL A;  2Z6B A;  2ZTD A;  5J39 A;  2BDN A;  3C2P A;  2NVT B;  4F7X A;  3OTO Q;  3IAY A;  5M3F G;  5DLQ E; 
#chains in the Genus database with same CATH homology
 5GAD C;  4DR7 L;  1N32 L;  1HNW L;  3CPW A;  1D8L A;  3TS2 A;  2A8V A;  2HIX A;  1VQ8 A;  3AYH B;  2K5N A;  1E1T A;  2CKZ B;  5JEA J;  3CME A;  5IP9 H;  3STB D;  1BBW A;  3H0G H;  2N3S A;  4A3J H;  3AFQ A;  4GN5 A;  4GNX B;  4UY8 C;  3S2D H;  4DR4 L;  2UUB Q;  1ASZ A;  4JI2 L;  1YVC A;  1PH8 A;  4R4C A;  2FXQ A;  5M5X H;  4A3G G;  1PH2 A;  3EIV A;  1J6Q A;  1X65 A;  1Y1W G;  4JBK A;  4J15 A;  1XNQ L;  1S3O A;  5M5Y H;  4DV4 Q;  1B7Y B;  4LF8 Q;  2UU9 Q;  4QQB X;  2PQA A;  3FHW A;  3S2H H;  1LM0 A;  5ELO A;  3H3V I;  1KIX A;  1Y1V H;  2IHE A;  4YHH Q;  2JEA I;  3HOU G;  2K50 A;  1EQQ A;  1C0A A;  5AJ3 L;  5LMN Q;  2OQK A;  5HGQ A;  1PYS B;  4KI0 A;  1SR3 A;  1O7I A;  3IRB A;  1OTC A;  4BA2 I;  3I2Z A;  4B3T Q;  1WFQ A;  3F2B A;  4POG A;  3RZO H;  2Q2H A;  3PV0 A;  3ULL A;  4DV7 Q;  2HHH L;  3KJP A;  2VL6 A;  3HOV G;  3M4O H;  4UP8 A;  2UXB L;  5IYD G;  5H1S E;  4GOP A;  4K0K Q;  4LW1 A;  4A75 A;  2AKW B;  3M4P A;  4YCW A;  2OQ0 A;  1VQI A;  2AHO B;  3CC4 A;  1VCI A;  4LFA L;  1XNR L;  3CP0 A;  3CCE A;  2JJQ A;  4Y7N H;  4DR7 Q;  1N32 Q;  1HNW Q;  5IT9 c;  1GD7 A;  3JAM c;  1KHI A;  2KHJ A;  4DV6 L;  2CWP A;  3UDX A;  2IHF A;  2NN6 G;  2XTI A;  3RR5 A;  1PH7 A;  4JBJ A;  4KLK A;  4A3M G;  5M3F H;  1GO3 E;  2I5M X;  4YY3 Q;  3K8A A;  1J5E L;  3I56 A;  4DR4 Q;  3I4N G;  4FDB A;  2JA9 A;  2VW9 A;  2F4V L;  2RHQ B;  2JK8 A;  4AIM A;  2LXJ A;  4X66 Q;  2A1A A;  1CKM A;  3G71 A;  4MNO A;  3WWV A;  2R93 G;  2B3G A;  1XPR A;  2E2I H;  3HOY G;  4TQU S;  4A3E G;  1UE5 A;  2MO1 A;  4QY7 A;  3ULJ A;  1QUQ A;  1VQ7 A;  1PYB A;  4HIK A;  2Q2T A;  4DKA C;  2NVX H;  1OXT A;  4LF4 L;  1L2F A;  1NBW A;  1Y1W H;  1M90 C;  1PH4 A;  4YCU A;  2BH8 A;  4BBR G;  2ZJR A;  4IFD J;  2IX1 A;  4MTN A;  1K83 H;  2K4K A;  1FL0 A;  4DUY Q;  5C4X G;  2E8G A;  1PHJ A;  2HT1 A;  1KQS A;  3K81 C;  5K36 G;  3E0E A;  1OXU A;  1WI5 A;  3KYH C;  1L1O A;  3HOX G;  1QZH A;  4X64 L;  2HHH Q;  2EXD A;  4NXM L;  1JT8 A;  1N34 L;  4R4Q A;  1SE8 A;  3B6Y A;  3GD7 A;  3I55 A;  2KEN A;  2UXB Q;  1IBK L;  4DR1 L;  1GKH A;  3OTO L;  1VQM A;  1X54 A;  2EIF A;  4OX9 L;  1VQ5 A;  2YTV A;  1FVI A;  1NE3 A;  4NXN L;  1XNR Q;  4GLV B;  4LUO A;  1TWF H;  3CCS A;  1VQF A;  1PH3 A;  1A0I A;  1IZ6 A;  1NJI C;  3HOW G;  1K8A C;  1WJJ A;  1X9N A;  4A3I G;  3HOV H;  4DV6 Q;  3S1N H;  1QVG A;  3UDG A;  5IYD H;  2Z6K A;  4RG1 A;  1MJE A;  2PI2 A;  1Y14 B;  4NPS A;  4OWT B;  4IFD I;  2UUB L;  1I94 L;  2R7Z G;  1J5E Q;  1Q12 A;  1VQB A;  2VY3 A;  2F4V Q;  4GOP B;  3J81 c;  4A3L G;  1E22 A;  4AQY L;  1QZG A;  4IPH A;  4DV4 L;  2VQE L;  1B70 B;  2UU9 L;  1RL2 A;  4YWM A;  4A3M H;  3HKZ G;  1YNX A;  2ZJP A;  4YHH L;  1JJ2 A;  1G29 1;  2LXK A;  3RNU A;  2RHS B;  2BA1 A;  3UDF A;  3J80 c;  4X62 L;  1Q86 C;  4LF4 Q;  3D31 A;  4KHP L;  1KRS A;  1UWV A;  3CAM A;  3JC6 6;  1PH1 A;  4BXX G;  3MXN B;  1XPO A;  4DR5 L;  4JI1 L;  1CKN A;  1VQN A;  1LTL A;  2JA5 H;  1KL9 A;  1I50 H;  4PZ8 A;  1IBL L;  1UE6 A;  2WAQ G;  4A3C H;  3F2D A;  2MQH A;  3FKI G;  1D7Q A;  2GVB A;  4JI4 L;  1VQK A;  1JJG A;  4B3S L;  4LF6 L;  1KC8 C;  4BBR H;  2KCT A;  4IO9 A;  4NXM Q;  2VUM G;  1B8A A;  4OWX B;  1I5F A;  3G6E A;  1N34 Q;  3ER0 A;  3NEM A;  1LUZ A;  3GTM H;  1IBK Q;  1BVS A;  4BBS H;  2WB1 G;  3I4M G;  1WCM H;  3ULP A;  3G4S A;  1I3Q H;  1HNZ L;  3HKZ E;  5LMN W;  2H5X A;  4IJH A;  3S15 H;  1HZC A;  2MO0 A;  4IPG A;  2OWO A;  2HIV A;  2D62 A;  4DV3 L;  4YY3 L;  1DGS A;  1L0W A;  5GAG C;  1I94 Q;  4DV2 L;  1Q82 C;  1BBU A;  2B63 H;  3J7Z C;  4X66 L;  4L5T A;  1PFS A;  4R1J A;  4A3I H;  4YWK A;  2YU9 H;  4DNI A;  3GO5 A;  2UUC L;  4R4T A;  4AQY Q;  2VQE Q;  1Q81 C;  2VZA A;  1YIJ A;  3GTO H;  3CCV A;  4WJ3 M;  2JA6 G;  3PUY A;  2RCN A;  2R7Z H;  1XMQ L;  1W2B A;  3L0O A;  2GVA A;  5HY6 A;  4X62 Q;  2ES2 A;  3KF8 B;  1FJG L;  1XMO L;  1C7Y A;  4KHP Q;  3S1R H;  5IWA Q;  1XTD A;  3KF6 A;  4Y52 H;  3ERS X;  3PUZ A;  4DR5 Q;  4JI1 Q;  4LUZ A;  3U4Z A;  4JI3 L;  3T1Y L;  4QL5 A;  4DUY L;  4QIW E;  4A76 A;  4DR2 L;  4R4I A;  1HR0 Q;  5GAH C;  1IBL Q;  4JOI C;  5GRO A;  5FLM H;  4JI4 Q;  1IXR A;  1SMX A;  3OYY A;  5JJK A;  4B3S Q;  3HOZ H;  1P16 A;  2EQS A;  4X6A H;  1K0R A;  4LF6 Q;  1X3E A;  4L5Q A;  2YTX A;  4GLX A;  2ZJQ A;  3JAM i;  3CCL A;  1VS0 A;  4JI6 L;  2K75 A;  1E3P A;  4DR6 L;  1VQC A;  2BA0 A;  2N49 A;  1YJ9 A;  4JV5 L;  2NVT H;  4DR3 L;  3M9B A;  3S1Q H;  1HNZ Q;  3A0J A;  3S14 H;  3CD6 A;  2ID0 A;  4K0K L;  2Q2I A;  3K80 C;  2JA8 G;  1PVO A;  3KDF A;  1A63 A;  1JE5 A;  1R9T H;  5E7N A;  3PUX A;  5C0X J;  4DV3 Q;  3T1H L;  4C3H H;  3RLO A;  1CKO A;  4DPG A;  3PIO A;  1OXV A;  4JI0 L;  4LFB Q;  4DV2 Q;  1EFW A;  1VQ4 A;  3D0F A;  3F8T A;  4HJ9 A;  2UUC Q;  3J81 j;  2ATW A;  3TRZ A;  1VQL A;  2K52 A;  1UEB A;  2VQF L;  5GAE C;  1XMQ Q;  1Q7Y C;  1SLJ A;  2Z0S A;  4A3G H;  1BKB A;  3GDE A;  2F52 A;  5M5W H;  1FJG Q;  1XMO Q;  5IYB G;  2JEB I;  4LUV A;  1EYG A;  1CSP A;  2E5L L;  3T1Y Q;  2UUA L;  4JI3 Q;  1AE2 A;  3GTP H;  2JA6 H;  1S72 A;  5IP7 G;  3S24 A;  5FJ8 G;  4JBM A;  3PUW A;  4DR2 Q;  1YBY A;  4GN4 B;  4MZ9 A;  4A3K G;  3HOU H;  4LF7 L;  2R6G A;  5C0X I;  4POF A;  2PQA B;  4LWC A;  4DK3 C;  3TEH B;  1PH9 A;  3CCR A;  3NBH B;  4JI6 Q;  1HZ9 A;  4DR6 Q;  1PH5 A;  2JA7 G;  1KXL A;  4BY7 G;  5JEA G;  4JV5 Q;  4A3D G;  4DR3 Q;  4GOP C;  1E7Z A;  1OXX K;  3BZC A;  1RIP A;  2PMZ E;  3CCJ A;  1TWH H;  1X6O A;  3CW2 C;  4GS3 A;  1E24 A;  1SN8 A;  4OXP A;  1VQO A;  1TWA H;  3J81 i;  4BY1 G;  2A19 A;  2ZTC A;  4A3B G;  1VQJ A;  4A4I A;  1CUK A;  2BH2 A;  1IBM L;  1PH6 A;  1HZB A;  2I5L X;  1NY4 A;  3T1H Q;  2JQO A;  4WJ4 A;  1K73 C;  3W5O A;  3BU2 A;  4A3F G;  4JI0 Q;  2IT1 A;  3CMA A;  4GNX A;  4AYB G;  2K5H A;  1A62 A;  1U5K A;  3J80 i;  3RN5 A;  2D0P A;  2KBN A;  4XTC S;  1K3R A;  1HNX L;  1XJV A;  4UPA A;  1GM5 A;  2I0Q A;  5IP9 G;  3I4O A;  4A3J G;  1YEZ A;  3VDY A;  2MFI A;  2VQF Q;  3I4N H;  1MIU A;  4A93 G;  3RLN A;  2DGY A;  1FGU A;  4UP7 A;  2CCZ A;  3U4V A;  3G48 A;  2WP8 J;  5IWA L;  2R93 H;  3HOY H;  2OTJ A;  1WYD A;  4A3E H;  2JE6 I;  2E5L Q;  1Q1E A;  2UUA Q;  1IL2 A;  3KFU A;  1HR0 L;  4PZ6 A;  3PGZ A;  5IY0 A;  3GTQ H;  1CSQ A;  1QVC A;  1V9P A;  2KCM A;  3SGI A;  4XIG S;  2QEX A;  4LF7 Q;  3GTJ H;  1NTG A;  2CQO A;  5IYB H;  4DUZ Q;  2QGQ A;  4JI7 L;  1QUQ B;  1X55 A;  3A5Z B;  4UP9 A;  5LMU L;  4HIM A;  3F1Z A;  3M7N A;  5FJ8 H;  1HH2 P;  5C4X H;  5IP7 H;  1EIY B;  1SRO A;  3GTK H;  3PO2 G;  4AYB E;  3H3V H;  2NZH A;  4JI5 Q;  5C44 G;  1G6P A;  3HOX H;  1YJW A;  3BJU A;  4JOI A;  2B29 A;  5IE8 A;  1XPU A;  3F2C A;  4OON A;  1IYJ B;  1TWG H;  4AH6 A;  1VQ9 A;  1HR0 W;  1L1O B;  4L5R C;  1IBM Q;  1KRT A;  3HOW H;  4LFB L;  3K7A H;  5C3E G;  3M85 A;  2YYZ A;  2Z6K C;  2PNH A;  3NEL A;  1Q1B A;  4YWL A;  1GVP A;  2C35 B;  2NN6 I;  2WAQ E;  3HKS A;  1LYL A;  3PSI A;  3BZK A;  3DLL A;  4O0A A;  4HJ7 A;  1HNX Q;  3M3Y H;  4BY1 H;  1C9O A;  1VQE A;  3PIP A;  2N8N A;  2Q2U A;  1YHB A;  4IFD G;  4A3F H;  2L15 A;  3TS0 A;  3S16 H;  4L5S A;  4A3L H;  3PO3 G;  4JI8 L;  2K14 A;  4PZ7 A;  2WB1 E;  3RN2 A;  3AEV A;  4ME3 A;  5BR8 Q;  4JCV E;  4IJL A;  3W1G A;  3CCM A;  1YIT A;  1Q46 A;  4GN3 B;  2OTL A;  1Z9F A;  4OO1 I;  3KOJ A;  1N8R C;  5ELN A;  4A93 H;  1NMF A;  4LNQ A;  4ALP A;  3PF4 A;  4B3R L;  2UXC L;  4BXX H;  3KLW A;  1Q8K A;  2QA4 A;  3CC2 A;  4JI7 Q;  3CCQ A;  3W1B A;  5LMU Q;  2R7D A;  1E1O A;  3FKI H;  1OXS C;  3K7U C;  1UE7 A;  1I6H H;  1K8G A;  4EX5 A;  2ALY B;  2DUD A;  2XGT A;  3S1M H;  1CKN B;  1N33 L;  3CQZ H;  3AFP A;  3E9H A;  4HJA A;  2VUM H;  1Z47 A;  2K5V A;  3TQY A;  3PCO B;  5GQO A;  3UDI A;  1G51 A;  1N36 L;  2PI2 E;  4DV1 L;  4R4O A;  4TVA B;  4BA1 I;  1PV4 A;  4B3M L;  4GKJ L;  3PO2 H;  3KJO A;  4JBW A;  4JC0 A;  3I4M H;  5C44 H;  1YZ6 A;  2R92 G;  5M3M G;  3EN2 A;  4P72 A;  4HIO A;  1SFO H;  4DV5 L;  1K9M C;  3PF5 A;  3U58 A;  4EQ5 A;  3RZD H;  1P8L A;  4LF5 L;  5FLX c;  4GLA C;  1VQD A;  3PUV A;  1X3F A;  2MNA A;  1A8V A;  1U0L A;  1V1Q A;  1N9W A;  4KHZ A;  1QVF A;  4IPD A;  5JJL A;  2IX0 A;  4H02 A;  4RMF A;  5C3E H;  1MKH A;  5IYC G;  2VNU D;  1VQP A;  4HJ5 A;  4APV A;  4JI8 Q;  3UE1 A;  1UE1 A;  2HQL A;  1TWC H;  4C3J H;  4X65 L;  2NVQ H;  3DM3 A;  4YCV A;  1JB7 A;  4QJF A;  1MJC A;  3E9I A;  2CWA A;  3RLF A;  4IOA A;  4JI2 Q;  4QGU A;  3CCU A;  2UXD L;  2GN5 A;  4DV0 L;  3PO3 H;  4DUZ L;  4B3R Q;  2UXC Q;  4JYA L;  3L2P A;  1XNQ Q;  1VQ6 A;  2OCE A;  4IPC A;  2JA5 G;  3AQQ A;  4A3C G;  4JI5 L;  3FP9 A;  1S40 A;  5JJI A;  4OO1 G;  3MEF A;  1V43 A;  3KF6 B;  3CC7 A;  3ZJY C;  1T9H A;  2AWO A;  4LFC L;  2ASB A;  1N33 Q;  5AJ3 Q;  1AH9 A;  3K0X A;  1EWI A;  2R7F A;  3M4Q A;  2ZM6 L;  3CF5 A;  4HJ8 A;  1KD1 C;  1N36 Q;  2F3I A;  4DV1 Q;  5C4J H;  2NZO A;  3UE0 A;  4GKK L;  4B3M Q;  1EOV A;  2I5H A;  4LF9 L;  4GKJ Q;  1HJP A;  1NMG A;  4BBS G;  3GTG H;  1SRU A;  4PG3 A;  1WCM G;  1W3S A;  4HID A;  4OX9 Q;  2VS1 A;  1YHA A;  4DV5 Q;  4LF9 Q;  2KHI A;  4LF5 Q;  4PMW A;  2JA8 H;  2Y0S G;  3A74 A;  2LSS A;  3ICE A;  4OWW B;  1VQH A;  3H0G G;  1YI2 A;  1HZA A;  1VQA A;  2E2H H;  4LFA Q;  2AWN A;  2CFM A;  3EBE A;  3HFZ B;  5M3M H;  2R92 H;  1X3G A;  3TRE A;  5EAY A;  3A5U A;  2B63 G;  1H95 A;  2WFW A;  3KDF B;  5J3B A;  1PA6 A;  3H15 A;  3OW2 A;  1EIF A;  1YJN A;  2ZTE A;  5BR8 L;  1WOC A;  1AE3 A;  1X56 A;  2YTY A;  3Q8D A;  4X65 Q;  1JMC A;  4P75 A;  2E2J H;  1JJC B;  1Y1V G;  3L7Z C;  5IYC H;  1KAW A;  3I7F A;  1M1K C;  2UXD Q;  4DV0 Q;  4IOC A;  4LF8 L;  4JYA Q;  4C3I H;  3U50 C;  3LGJ A;  4O2D A;  3CXC A;  1EQR A;  1L1O C;  4DAM A;  4NB3 A;  1TXY A;  2YV5 A;  4A3K H;  2RF4 A;  4C2M H;  5FLM G;  1ASY A;  4JG2 A;  2Y0S E;  4P74 A;  2V1C C;  5LMN L;  1YHQ A;  4LFC Q;  3J7A 5;  5C0X G;  3HOZ G;  2AMC B;  2ZM6 Q;  2NVY H;  4P73 A;  4B3T L;  3S17 H;  3GTL H;  1VQG A;  3NEN A;  1EUJ A;  4GKK Q;  2JA7 H;  2D0O A;  4BY7 H;  4P71 A;  4A3D H;  4DV7 L;  2ZTD A;  4X64 Q;  4DAY B;  4DK6 C;  3CPF A;  4A3B H;  4DR1 Q;  3OTO Q;  2IY5 B;  2N78 A;  5M3F G;  3STB C;  4GNX C;  5DLQ E;  4NXN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...