4DV1L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1L00
4MNOA 2IX0A 3L7ZC 4DAMA 1K8AC 5C44H 3CCSA 1S72A 1K8GA 4DR3Q 1KAWA 2PI2E 3TS2A 1B8AA 1QVFA 3I7FA 4LF9Q 3RLFA 3NEMA 1SR3A 2PMZE 5M3MG 1PA6A 1JB7A 2R92H 3PGZA 1FJGQ 4IO9A 3H3VI 2IT1A 4GLXA 4KI0A 3F2CA 4A3IH 3S17H 1VQHA 1HZAA 1RIPA 2AWOA 3H0GG 1K83H 3RZOH 1Z9FA 2AWNA 1VS0A 1TWCH 4DR7L 3FKIH 2ZTEA 1E1OA 2WB1E 4AH6A 1M1KC 1OTCA 1X3FA 4K0KL 2MO1A 4PZ8A 3KJPA 1XPUA 2A19A 4LFCQ 4A3MH 4A3GH 1WYDA 1VQFA 1JE5A 4EX5A 2ZM6Q 4A3EH 3FP9A 1UE1A 1XPOA 1IBKL 3CAMA 1XNRL 4DR6L 4X6AH 2KCMA 1XPRA 1YHQA 3RLNA 1N33Q 1X65A 3CCRA 4GLAC 4JOIA 2ASBA 3I4NG 4Y7NH 4JI3L 3BJUA 2WFWA 1I94L 2UXBL 2WB1G 2BA1A 1JT8A 1HZ9A 1Q8KA 3L0OA 2F4VL 2JJQA 3CW2C 2CKZB 3PUYA 1X54A 3GTPH 1VQPA 4B3TL 4IPGA 1KC8C 4NXNL 2YV5A 2K50A 3AEVA 2HHHQ 3AYHB 3BU2A 5LMNQ 1X56A 4DV0L 2RHSB 1IBLL 4QQBX 1V43A 1X3GA 2JA7G 1HNZQ 3F2DA 3J7ZC 4LF5Q 1VCIA 3CCUA 1C0AA 3H0GH 2V1CC 4R4IA 5GQOA 4LFAL 2B63H 2UUCL 3T1HL 1HJPA 4HIOA 3F1ZA 4JBKA 3CCVA 1YHBA 4KHPL 1Q7YC 3PIOA 3UDFA 1AE3A 2F52A 1VQGA 4JI4L 3M3YH 1H95A 1B70B 1NY4A 3J81i 4IFDG 3E0EA 4LF8L 4WJ4A 4MZ9A 4DK6C 4JI5L 1PH6A 3I4NH 4GOPC 2JA8H 3TRZA 4A3CH 3GDEA 2R7ZG 2NVQH 5BR8Q 2CWPA 3ER0A 1SFOH 4L5SA 1Y1VH 4A3DG 2I5MX 3TQYA 3D0FA 3W1GA 1YZ6A 4DUZL 3JAMc 1BBUA 2JA9A 4DK3C 4H02A 5IYDG 2GN5A 4R4CA 4GN3B 4KHZA 3UDXA 3STBC 4JI0L 3M4OH 3NELA 2RHQB 1B7YB 1EQRA 2ALYB 2R6GA 3UE1A 3HOXG 1W3SA 3K0XA 5IYBH 3RN2A 5IWAL 4A75A 3ICEA 4IOAA 1VQDA 4UP8A 1BBWA 4XTCS 3PUXA 2NN6G 4JI1L 3UE0A 3GTGH 2Z6KC 5C4XH 5HGQA 1HR0Q 4QL5A 1L1OA 4X66L 3DM3A 1PH7A 4AYBE 4JI2L 1NTGA 3HOUH 1N36Q 5IE8A 1VQ6A 1CUKA 3MXNB 2RF4A 2YTVA 4NB3A 1PH5A 1IXRA 1O7IA 2CFMA 4JV5Q 1LM0A 1NMFA 1XMOQ 2GVAA 3Q8DA 4X62Q 1WOCA 4GKJL 1NBWA 1JJCB 1TWAH 1UE7A 2YU9H 1A0IA 4B3ML 4MTNA 4GOPB 2IHEA 3LGJA 4P71A 4IPHA 1GVPA 4AYBG 4BBRH 1R9TH 1X9NA 1N34Q 1VQLA 4UPAA 1PH2A 1ASZA 3U4ZA 3HOYH 3I4OA 1PH8A 2ZJRA 5C0XI 4HIKA 4IJLA 2YTYA 3PO2H 3S2DH 3S15H 3OW2A 1N32Q 5AJ3Q 2K14A 4YCWA 5LMNW 1E24A 1KRSA 4BY1H 1EYGA 1FGUA 1YIJA 4IPDA 4KLKA 1I50H 4AQYL 2OCEA 1XNQL 1E22A 1I5FA 3K81C 4DV7Q 1PYBA 4JCVE 2E8GA 3RR5A 1I3QH 2K5VA 4OWXB 4JBMA 2VQFL 1L2FA 4A3GG 5LMUL 1YBYA 3AFPA 4JI6L 1L0WA 4YWLA 2E5LQ 2K75A 2BH8A 1QUQB 1SLJA 4HJ7A 1VQ5A 4YY3Q 4DR5L 4BBSG 5M5XH 3A74A 1YITA 3A5UA 2E2JH 1OXSC 1OXVA 1Q86C 4POGA 4GKKQ 1P16A 2DGYA 5IY0A 4X65L 3UDGA 1P8LA 2VW9A 5HY6A 2R93H 4JI8L 4DV1L 4DV4Q 1HNXQ 3S1MH 4C3JH 4A76A 1N9WA 2JK8A 1TWFH 2OQKA 1VQ8A 4YHHQ 1EOVA 1QZHA 4EQ5A 1T9HA 1GO3E 2B63G 4L5RC 4NPSA 1V1QA 2CWAA 1XMQQ 3S1NH 4BXXG 3JAMi 4LF7L 2OTJA 1NJIC 1HR0W 1UEBA 1TWGH 5ELOA 1EWIA 1OXTA 4Y52H 1Q46A 4NXMQ 4DUYL 3CCQA 1SROA 3GO5A 3KF6A 2VY3A 2JA8G 4QY7A 4HJAA 4QJFA 3TEHB 4BBSH 4DV6Q 1CKMA 1RL2A 1EFWA 2AKWB 1MKHA 2UUAQ 3OTOQ 1Y1VG 4A4IA 4O0AA 4LF4L 4B3RL 4B3SL 5C4JH 5GROA 4LW1A 3G71A 4GN4B 2LXKA 4R4TA 5IT9c 4R4OA 4HIMA 3S16H 3ULLA 4A3BH 4JYAL 4A93G 1KL9A 1TXYA 1MJCA 4QIWE 4DV2L 1KD1C 5E7NA 1Q1EA 2ZJPA 2UXCL 2Z0SA 4DV3L 1CKNB 4C3HH 3HOVG 5IYBG 3KF8B 4JBJA 1HZCA 3PIPA 1YNXA 2FXQA 3PF4A 3CC7A 4BXXH 2HQLA 3CCLA 5C4XG 4DNIA 2LXJA 3J7A5 4LF6Q 5JEAJ 1VQNA 4P75A 4OWTB 1KIXA 3HOUG 4DR4Q 5M5YH 2F3IA 3JC66 3G4SA 4HJ9A 4LFBQ 2PQAB 2VZAA 3KJOA 1HNWQ 3U50C 1X6OA 2N49A 1X55A 1J5EQ 4OX9Q 1UWVA 2EXDA 4DR3L 4LF9L 1WCMG 2VL6A 1YI2A 4IFDI 4BBRG 3ULJA 1FJGL 1VQMA 4B3RQ 3M7NA 4DR1Q 3PUWA 3HOYG 3T1YQ 3PO3H 4GOPA 4A93H 2NN6I 3CPWA 2A1AA 4JI7Q 1YJNA 3B6YA 1UE5A 4DAYB 4X64Q 2JEAI 3PO2G 2Y0SE 2NVXH 3HOVH 2D62A 1MJEA 4DR2Q 2UUBQ 3E9IA 2JQOA 4A3FH 4LFCL 3K7AH 4R1JA 4BY1G 3I55A 2H5XA 4DV5Q 2ID0A 2UXDQ 4PG3A 2MO0A 2ZM6L 1VQCA 1G6PA 3J81j 1PH1A 1PH4A 1N33L 1TWHH 1K3RA 3AQQA 3PSIA 4PZ6A 3S24A 1XJVA 1JJGA 4ME3A 4ALPA 3M85A 2Y0SG 3EBEA 4A3LG 4LWCA 4OONA 1C9OA 2CQOA 4RG1A 3K7UC 1CKOA 3TS0A 1GM5A 4XIGS 3CC4A 2Z6KA 3HFZB 5IP9H 1WCMH 3NBHB 1QUQA 3GTOH 1M90C 5GADC 2HHHL 1PVOA 4WJ3M 1FL0A 5LMNL 5FLMH 2JA6H 1YHAA 3K80C 2JEBI 1J6QA 4IJHA 1HNZL 4LF5L 2R7DA 4IOCA 4YCUA 2R93G 1OXUA 4DR7Q 1WI5A 2XTIA 1PH9A 4K0KQ 2HIXA 1Y14B 1JJ2A 1CSPA 3MEFA 3EN2A 4JG2A 3KOJA 2VNUD 1XNRQ 2OQ0A 4GNXC 1IBKQ 2XGTA 4DR6Q 1VQJA 1K9MC 2QEXA 1X3EA 1PFSA 2MFIA 2E2IH 3KFUA 4HIDA 4A3LH 4JI3Q 1I94Q 1SN8A 2UXBQ 5BR8L 1QZGA 2DUDA 2F4VQ 3CF5A 4O2DA 1VQAA 4PZ7A 3VDYA 1Q82C 5M5WH 3KDFB 5EAYA 4B3TQ 2EIFA 4NXNQ 4J15A 3HOWG 2OTLA 2ES2A 1L1OB 2PI2A 3EIVA 1E7ZA 1IBLQ 4DV0Q 3RN5A 4A3KG 4AIMA 4YWMA 4POFA 2OWOA 3STBD 1KRTA 2VS1A 1U5KA 1VQKA 4OXPA 4UY8C 4DKAC 4A3BG 4LFAQ 2IY5B 2UUCQ 3T1HQ 2WAQE 4LUZA 5JEAG 3J80c 5IP7G 1EIYB 5FLXc 1HR0L 4KHPQ 1NMGA 2K5NA 4BY7G 3CPFA 1KHIA 2NZOA 1EIFA 4APVA 2UU9Q 3GTLH 5H1SE 4JI4Q 1N36L 3W1BA 4RMFA 4LF8Q 1CKNA 2MNAA 4JI5Q 3H15A 3ZJYC 4JV5L 2VQEQ 4BA1I 5M3FH 3WWVA 1XMOL 2BA0A 4X62L 5JJKA 2WAQG 4L5TA 5GAGC 1AH9A 2K5HA 2KENA 3HKZG 4GN5A 4C2MH 4GNXB 1VQ4A 1GD7A 4A3JH 1E3PA 1EUJA 4DPGA 1N34L 1HH2P 2IX1A 5JJIA 3GD7A 4A3CG 3BZKA 4UP7A 2Q2IA 4C3IH 2JA5G 4DUZQ 3HOWH 2PQAA 2K4KA 2GVBA 2IHFA 3L2PA 1HZBA 3NENA 4PMWA 4IPCA 4A3KH 4JI0Q 4JOIC 2VUMH 2QGQA 3PUVA 3UDIA 1N32L 1LTLA 3G48A 5AJ3L 1VQIA 1Y1WH 3TREA 1VQOA 1W2BA 3PO3G 1YJ9A 3U4VA 1WJJA 5IWAQ 5IP7H 1YVCA 2BH2A 3M4QA 4JI1Q 3S1QH 3S2HH 1ASYA 4BY7H 5K36G 3HKSA 1G291 4DV7L 4X66Q 3A0JA 3S1RH 1A8VA 2N8NA 4JI2Q 3CCMA 4LNQA 2B29A 5C0XJ 4A3FG 3CD6A 3HOZG 2K52A 2E5LL 1K0RA 3A5ZB 2JE6I 3I56A 3AFQA 4GKJQ 1DGSA 4YY3L 2D0PA 5GAEC 2AMCB 2B3GA 2ZTCA 1QVGA 4B3MQ 1C7YA 3PCOB 5M3MH 3CC2A 2JA5H 1IYJB 3BZCA 1PV4A 2C35B 5GAHC 3GTMH 1I6HH 4GLVB 2CCZA 1Z47A 4GKKL 3KYHC 1JMCA 1E1TA 5IP9G 4P73A 3KLWA 1SMXA 1HNXL 1FVIA 4DV4L 1IBMQ 2JA6G 5FLMG 2KHJA 5C3EG 5FJ8G 3U58A 1IZ6A 4YHHL 3H3VH 2UU9L 1BKBA 3KF6B 1BVSA 3SGIA 4AQYQ 2Q2UA 4GS3A 1XNQQ 1XMQL 3FHWA 4TQUS 3F8TA 4JC0A 2HT1A 5IYCG 3ULPA 2VQEL 3RZDH 3HOZH 3CXCA 3M9BA 4P74A 2VQFQ 1Q1BA 5LMUQ 3IRBA 4JI6Q 4NXML 3I4MG 1SRUA 2YTXA 2EQSA 1EQQA 4HJ5A 1A63A 1VQ9A 4OO1I 4DV6L 4DR5Q 1AE2A 1S3OA 2Q2TA 1YEZA 3CQZH 1L1OC 5ELNA 3J80i 1SE8A 3OTOL 1YJWA 2UUAL 4HJ8A 2ATWA 5J3BA 2JA7H 3GTJH 2E2HH 2RCNA 1GKHA 4X65Q 2YYZA 4YCVA 4BA2I 4OO1G 2MQHA 3CP0A 1U0LA 4JI8Q 3KDFA 5FJ8H 5C3EH 4DV1Q 1V9PA 3I2ZA 2HIVA 4JBWA 1XTDA 4YWKA 1A62A 3OYYA 3K8AA 1VQBA 4LUVA 1S40A 1OXXK 5IYCH 1PHJA 2NVYH 1WFQA 3E9HA 1LUZA 1IL2A 4LF7Q 2Q2HA 2AHOB 3CCEA 4LF6L 5DLQE 2R7ZH 4DR4L 3I4MH 3GTKH 3CMEA 2N78A 3CCJA 4LFBL 4A3DH 4FDBA 4DUYQ 2PNHA 2WP8J 1HNWL 4OWWB 2NVTH 1VQEA 4R4QA 3D31A 1D8LA 5M3FG 3G6EA 1J5EL 3F2BA 2I5LX 4OX9L 3M4PA 3CMAA 2KCTA 5C44G 5IYDH 2I5HA 2L15A 1Q12A 1QVCA 4P72A 3J81c 1VQ7A 1LYLA 3RLOA 3PF5A 4A3JG 4LF4Q 3W5OA 4LUOA 4TVAB 4GNXA 2QA4A 3RNUA 1IBML 4UP9A 4DR1L 4B3SQ 4QGUA 3T1YL 2R92G 3HOXH 4JI7L 4JYAQ 1G51A 2I0QA 2NZHA 4X64L 1N8RC 4A3IG 1KQSA 4DV2Q 2VUMG 5C0XG 2R7FA 2UXCQ 4DV3Q 4DR2L 2UUBL 3FKIG 2KBNA 1NE3A 2D0OA 1Y1WG 2UXDL 4DV5L 2ZJQA 3PUZA 3HKZE 4A3MG 4IFDJ 1D7QA 2KHIA 5JJLA 4A3EG 1K73C 3GTQH 3S14H 1UE6A 2ZTDA 1KXLA 1MIUA 4L5QA 1Q81C 2N3SA 3ERSX 3PV0A 2A8VA 1CSQA 2LSSA 1PH3A 3DLLA 1PYSB
chains in the Genus database with same CATH superfamily
4MNOA 4E6IA 2PQEA 4KJNA 1K8GA 1HFGA 1LTGD 3TS2A 1MSGA 2K1BA 3NEMA 1SR3A 2PMZE 3TBIB 1JB7A 1S5FD 3PGZA 1FJGQ 2OXPA 4IO9A 1TS5A 4ZQ3A 3H3VI 3F2CA 4A3IH 1Z9FA 1DYQA 5J1ZA 2ZTEA 1F9RA 1STBA 2MO1A 3NTHA 4IQZA 2JA5B 2A19A 4LFCQ 4A3MH 4J8QA 4X6AH 1XPOA 4DR6L 3CAMA 2KCMA 1XPRA 3RLNA 1EFID 1BOSA 4DF7A 1I94L 2WB1G 5KYLA 1JT8A 1Q8KA 2AUJD 2DJGC 1HQRD 1KC8C 4NXNL 5D3IB 2AQ3B 4XQNA 2NB0A 1I4XA 3AYHB 1V43A 1X3GA 1SMYD 1AN8A 3K5NA 3H0GH 3NWSA 4R4IA 3J81E 3DUZA 4DN4M 3NBHA 2ICIA 2F0EA 2A6HC 4K2LA 1VQGA 4JI4L 3SVMA 3J81i 2E2HB 4WJ4A 5CGKA 1PTOC 2K01A 4JI5L 3TSSA 3I4NH 4O42A 5C3EB 4C1NK 2L12A 4IUPA 4KKUA 1EOTA 2F0VA 1B44D 1S5BD 3QG1A 2JA9A 1SNPA 1O80A 3BG3A 3VYTA 4GN3B 4DAVA 2HD3A 3M4OH 3IAYA 4R8NA 1B7YB 1EQRA 3UE1A 1PDQA 3HOXG 1W3SA 3D6CA 5IWAL 4RHSA 1VQDA 4UP8A 3PUXA 2IX3A 2R3ZA 4X66L 1PH7A 1V1PB 1B9NA 1SJED 1LO5D 3HOXB 3MXNB 1CM9A 5IGEA 4NB3A 5FO7B 1IXRA 5EBCA 2K5QA 1Q90A 4MTNA 1R9TH 2IHEA 1X9NA 4A3CG 4IPHA 1GVPA 4DK0A 4UPAA 2EYFA 3V2TA 1PH2A 1ASZA 3I4OA 1PH8A 3OMGA 1QE6A 2QILA 3PO2H 4ZRZA 2NTTA 3QJYA 3TP6A 4IFDH 3A8KE 1CQVA 1EYGA 1I50H 2L5TA 2OCEA 4U673 3T56B 1I5FA 3K81C 4HTHA 4JCVE 4DV7Q 1S5DD 2E8GA 2EJGC 2K5DA 1G91A 2VQFL 1L2FA 4A3GG 5TSSA 1YBYA 1IL8A 4JI6L 5C4HA 1TWCB 3KBGA 2DY8A 1Q86C 4A3EB 3T53B 1P8LA 1LTSD 2R93H 4Y7NB 1VF7A 5E4WC 2JK8A 1TWFH 3JAME 1VQ8A 4YHHQ 1EOVA 3SK5A 1T9HA 1GO3E 4L5RC 4NPSA 2QW7A 3OWEB 1PTOF 3JAMi 4PMBA 4EQNA 1UEBA 3HS0C 1DM0B 4NXMQ 1SROA 4NMZA 1MGSA 4K6DA 2JA8G 3EFXD 4QY7A 3TEHB 4BBSH 1CKMA 1EFWA 2UUAQ 3HZXA 5FK9C 4GN4B 4HIMA 4JYAL 3PQIA 3ULLA 1EWHA 2JA8B 4A93G 4OIKA 2F0UA 2F0JA 3SE0A 1KD1C 1A3UA 2UXCL 2NVQB 1SFOB 4C3HH 4Q5VA 5IYBG 4QUFA 2L4NA 4L63B 1EYCA 2FXQA 5CV7A 1TY0A 2F0HA 1TS3A 4LF6Q 1VQNA 2JA7B 1A6XA 4OWTB 5ISRA 1G6ZA 2F3IA 3AMUA 2SOBA 3G4SA 2BDNA 2NZ1D 3KJOA 1HNWQ 1Y8PB 1X55A 2CH4W 4OX9Q 3GTGB 1EL0A 2NYZD 2FFKB 1EIGA 2VL6A 1YI2A 1CZWA 3M7NA 3PUWA 1B2TA 4PQXA 1W6JA 1ZYRC 1YJNA 1UE5A 3C1EA 4DAYB 4LMQD 2YU9B 2NVXH 2IPKD 1ML0D 4DR2Q 2CH4A 3T13A 1EEFD 4R1JA 1EYAA 2DJFC 1G6PA 1CHPD 2X69A 3DHQA 1K3RA 3AQQA 4PZ6A 4ME3A 5IGBA 4LWCA 3K7UC 4JW0A 1CKOA 2Z6BA 1GM5A 3TP7A 3CC4A 2G5DA 1SE4A 2F0IA 1PZJD 3A7LA 3GTOH 1K3BC 5LMNL 2JA6H 5FLMH 1J6QA 4IJHA 1HNZL 5CMDA 5CV5A 3VYSA 4YCUA 1STAA 1WI5A 2L0CA 5M5XB 2XTIA 1RTOA 3KUPA 1JJ2A 1CSPA 3MEFA 3EN2A 4JG2A 3KOJA 2RBMA 2Z4IA 2OQ0A 4H0LC 4DR6Q 3W3AA 1I94Q 1SN8A 5BR8L 1QZGA 2DUDA 1ONLA 2MGSA 3S1NB 4NXNQ 4OO1H 1JICA 1L1OB 3EIVA 1E7ZA 1TWGB 2KQ3A 4POFA 2OWOA 1U5KA 4TKOB 1EYDA 4A3BG 2F4IA 5FLXc 1HR0L 1KHIA 5K5PA 4KY5A 1N36L 4JI4Q 4RMFA 1RJTA 4JI5Q 3H15A 1C4QA 3ZJYC 2KCCA 5FO8B 4A3BB 5M3FH 1XMOL 2BA0A 2WAQG 4L5TA 1AH9A 3HKZG 1WTRA 4FF3A 1GD7A 4A3JH 1E3PA 1EUJA 3GD7A 3BZKA 3CU7A 4C3IH 1TR5A 2F0FA 3BVMA 1SYBA 4V190 1QG7A 1QCBD 5FLXL 3NENA 1SAPA 4IPCA 3MAQA 4A3KH 5M5YB 4JOIC 5DEHA 1RDPD 5AJ3L 1VQIA 3TREA 3PO3G 2RCFA 2L55A 1YJ9A 3U4VA 5IGFA 5IWAQ 5IP7H 3S2HH 1F9SA 2J0TD 1XYIA 2DNEA 5K36G 1G291 4X66Q 2DNCA 4LNQA 5LL6S 4A3FG 3PO3B 2E5LL 3A5ZB 2SEBD 4XYQA 4C1NI 3AFQA 4YY3L 2IWHA 2ZTCA 1QVGA 4A3FB 3CC2A 2JA5H 1IYJB 2MHVA 3KYHC 4P73A 3KLWA 1HNXL 3BS1A 1EQTA 2KHJA 2LY7A 3I73A 1GUOA 2PZUA 2WINB 1BKBA 3KF6B 1BVSA 5D3DA 3SGIA 5IYCG 3Q0AA 4FF4A 1YNJD 1FYCA 2VQFQ 4JI6Q 3IRBA 3L3OC 4HJ5A 1A63A 2R61A 1TVXA 3I72A 2BE5C 1S3OA 4R9WA 3SEBA 2EVBA 3J80i 1I4HA 2ATWA 1EQVA 4MTKA 4PV1C 1TT2A 1FGBD 5DM63 3QR8A 2E2HH 4ABNA 1RKNA 3KLRA 5C3EH 2HIVA 4IUQA 1Z6HA 3K8AA 1CQFA 3QO2A 1PHJA 4QF4A 1HPCA 1QB5D 2O2LD 4DR4L 4DK1A 4RH6A 1SYFA 2XRQD 3ITPA 1VQEA 2XVSA 5C44G 1IKMA 1TY2A 1D1KA 4QCLA 2MJ8A 4GNXA 4EQOA 3HOXH 4JYAQ 1G51A 2JP1A 3VYRA 2UXCQ 1RF2D 2UUBL 1NE3A 2D0OA 1Y1WG 2UXDL 4DV5L 4NP5A 1WD1A 3HOWB 1Y69U 2BOSA 5KYIA 4IFDJ 5I9PA 1D7QA 5ELFA 3H3VC 3S14H 2ZTDA 1MIUA 1MSHA 3VR4A 1SE3A 2A8VA 2LSSA 1Y1WB 3BVGA 4A3CH 1QOHA 2IX0A 1PRTD 2EY1A 3A55A 3I90A 1TU2B 1S72A 5D14A 1XTCD 1CTMA 1KAWA 1B8AA 1QVFA 3KLSX 2B2WA 5M3MG 1PA6A 2O4XA 2Z8LA 4N8FA 4PNYA 1E0BA 5C0XH 1HTLD 5EGTA 1IKLA 2AWNA 1TWCH 4IALA 4AH6A 4DR7L 1E1OA 4DAPA 5M3MB 1OTCA 1XPUA 2B2YA 1H9JA 1D6EC 1I6HB 4A3GH 1WYDA 4HSVA 4HSPA 4U68A 4EX5A 4A3EH 1IBKL 1UE1A 2FINB 1AZPA 3FEWX 1YHQA 4RKLA 4Y7NH 2UXBL 1U4PA 2CW0C 1TS4A 1HZ9A 2A5HA 3L0OA 3CW2C 1A3VA 5JOBA 4OEMB 3RZDB 5LMNQ 2RHSB 4KY7A 1HNZQ 1B1ZA 2V1CC 2UUCL 1HJPA 4HIOA 3F1ZA 3CCVA 3NUCA 3OIPA 4UHVA 4DNRB 4KHVA 3PIOA 2F52A 1H95A 3P75A 3E0EA 2B2UC 3VR2A 4GOPC 2JA8H 3TRZA 5G3LF 1QWYA 3GDEA 2NVQH 5BR8Q 2CWPA 1SFOH 4L5SA 2I5MX 4G7OC 5EBDA 3D0FA 2XRSD 2NWGA 1YZ6A 4X3KA 3W1GA 5CC4A 1LTRD 4H02A 1LLRD 4G7ZC 3T4AC 3STBC 3I4MB 3GTKB 3NPPA 2Q8IB 3NELA 5IYBH 5KRUA 1BBXC 1JOKA 3GTGH 4ZK9B 2F0PA 5CORA 1HR0Q 2DY7A 1EZ6A 4JI2L 1CI3M 5T1GA 1WTPA 1N36Q 1SYDA 1WTWA 4F7XA 1PH5A 4FF1A 2F3WA 2F0KA 1NMFA 1XMOQ 2GVAA 5JPNC 4GKJL 3EJIA 4RKBA 4DGZA 5CV9A 2YU9H 2KVMA 1A0IA 2B39A 4GOPB 1WVLA 3FRPB 4AYBG 3U4ZA 1M4VA 1ET6A 1V1OA 2ZJRA 3OW2A 5AJ3Q 2K14A 4AYBB 5M3FB 2NN6H 1FGUA 1XNQL 3FPPA 4JBMA 2K5VA 5ELDA 2R92B 2HCCA 4WORA 1GUWA 1K0SA 3C3LA 1X32A 4YWLA 2EYPA 2E5LQ 4FYDA 3S17B 3RZOB 1K83B 4HJ7A 1VQ5A 4YY3Q 1AZQA 3FKIB 1PRTB 5M5XH 5FO9B 2KEDA 3S2HB 1OXSC 1OXVA 1JR0D 2KCNA 2WIIB 1UNSA 1P16A 2DGYA 1XWEA 2VW9A 1Q3LA 4JI8L 4DV1L 1HNXQ 5I6YA 3V96A 3GTPB 4G7HC 3S1NH 1WTXA 4BXXG 1IW7C 1EY6A 1HUMA 3HEJA 3UI2A 1TWGH 1EWIA 5DM73 3TZUA 4F87A 1YNNC 2A69C 4RHRA 5HGTA 2N55A 2CVRA 1ENAA 1XXGA 3DEPA 4B3SL 5C4JH 4LW1A 1LTTD 1I6VC 1QNUA 2J4XA 5IT9c 4DA2A 4A3BH 5T1IA 5EPLA 1Z7TA 4EQPA 5EKLA 2WB1B 4H13C 1CKNB 3NWTA 3HOVG 1KNEA 2RDHA 1RTNA 2SNSA 1EY0A 4BWGB 3U9OA 3PF4A 2HDLA 2XWBB 1PRTF 5JEAJ 4DR4Q 3HOUG 5M5YH 1F9PA 1BQQT 2PQAB 3L9AX 2VZAA 4B9XA 4HMIA 5IT9L 3MTSA 1UWVA 4TSSA 3MXNA 1CT1D 1VMPA 1LTBD 1PLFA 5JVG3 3HOUB 1WCMG 4CBVA 3K57A 4BBRG 2RDGA 3HOYG 3PO3H 3CPWA 3K5MA 2JEAI 5K36H 2Y0SE 1SNOA 2D62A 2UUBQ 2XWJB 3E9IA 4BBRB 4A3FH 4DV5Q 2UXDQ 3I55A 5CV4A 2C9OA 1JC7A 3HOYB 4PG3A 2ZM6L 2FMCA 4F88A 3S2DB 3S15B 1H9SA 2VXWA 5CR3A 1XJVA 4B08A 2F0MA 1C9OA 2JSOA 3DXJC 3NHHA 2E74C 4XIGS 2TMPA 3HFZB 1NR4A 3NBHB 1PVOA 1M90C 3D4WA 3NSWA 3MXPA 4LF5L 3S14B 3TP8A 1VMCA 3R3OA 1OXUA 4ZAIA 4DR7Q 3SK4A 4IUTA 4C3JG 2F1MA 4WRDA 2E2JB 1Y14B 2F0QA 3OWFA 4RCNA 4EGVA 1LT5D 1IBKQ 2SNMA 1VQJA 2DN8A 2QEXA 4NW2A 4ODGA 1PFSA 3S1MB 2RDFA 4C3JB 2IJ0A 2A73B 4A3LH 2UXBQ 4CDDC 1Y8OB 3CF5A 1VQAA 4PZ7A 1Q82C 3KDFB 1JWMD 1SMYC 4A3GB 1ENFA 2BDOA 1B3AA 1WTHA 2KHSA 1ICWA 1ESRA 1VQKA 4OXPA 4UY8C 2UUCQ 4CDEC 3TDQA 1T5EA 4BY7G 1EIFA 1JOOA 3W1BA 2RQXA 4OELB 3WOEA 1BR9A 2MNAA 3S16B 1MBYA 4JV5L 2VQEQ 4BA1I 3WWVA 2K5HA 3AB9A 1N34L 3MHBA 3ERQA 1EEID 4UP7A 3HOWH 3E5SA 4CHTB 4KTAA 3X3NA 1H9KA 1TKWB 3Q22A 2EYJA 3UDIA 1N32L 1Y1WH 1W2BA 1WJJA 2K04A 2BH2A 3M4QA 1ASYA 3HKSA 2H4OA 3A8JE 3A0JA 3BDCA 2N8NA 4JI2Q 4DAYA 3CCMA 1LABA 3CD6A 1SNQA 5C0XJ 4X3SA 3HOZG 2K52A 4A93B 3D6WA 2NUCA 1CK1A 4GKJQ 2E76C 2D0PA 5GAEC 1TIID 3FDTA 2AMCB 4CKEA 1C7YA 3PCOB 5M3MH 5KEEA 3K7AB 3BZCA 1I6HH 1DONA 2AQ2B 4B9WA 3FMCA 1E1TA 5IP9G 1SMXA 3R2IA 4DV4L 1IBMQ 5A35A 2I07B 2EYLA 5CBAE 3H3VH 2UU9L 1FNVA 4OL7A 2Q2UA 1NUCA 1XX8A 3IL8A 1FNWA 4GS3A 1XMQL 1XNQQ 1LACA 3F8TA 4JC0A 3RZDH 1Q1BA 5JJZA 2MPMA 2YTXA 5FLXE 3MEHA 1I4QA 1PFBA 4ZLTF 2LMCB 4DV6L 1BF4A 1AE2A 1S5CD 2MP1A 1YEZA 1L1OC 3OTOL 2E75C 5J3BA 1Q8IA 2FMMA 2RCNA 1GKHA 4BA2I 4YCVA 3CP0A 4JI8Q 2F3VA 5FJ8H 4DV1Q 1BNZA 1V9PA 4YWKA 1TS2A 4K14A 2KOLA 1SSOA 1JCKB 2F03A 5IOCA 1D2BA 3O13A 1WFQA 1LUZA 1IL2A 4L8JA 3N6RA 2AHOB 4KN4C 5C6AA 3I4MH 3GTKH 3CMEA 3I91A 2PNHA 2WP8J 1E2ZA 1CA6A 4XYOA 1SBBB 3F2BA 2KCTA 2L15A 3GTLB 2I46A 4FO2A 1STGA 1JB3A 1ZKOA 1L0YB 3W5OA 2QKIC 3A7AB 4TVAB 2QA4A 4B3SQ 4B3RL 4DR1L 4KMUC 1SYEA 5IODA 3T1YL 2B8FA 3K5LA 2I0QA 4A3IG 1JORA 3DWQA 2JN4A 5ELBA 1HFNA 2ZJQA 1F2ZA 4A3MG 2A6ED 1ET9A 1I4GA 3NK9A 4LJZC 5C4JB 2N3SA 3ERSX 2F0LA 3PV0A 1LT4D 1CSQA 1PH3A 1KLGD 1PYSB 4DAMA 1K8AC 3S1QB 3CCSA 2PI2E 3S1RB 5EQ0A 1T5XD 2RSOA 4HR7B 2R92H 1DOKA 4ZCKA 1EY5A 2IT1A 1AW7A 2WAQB 4KI0A 4GLXA 2PW7A 3HKZB 3S17H 1HZAA 2QDBA 2AWOA 3H0GG 3RZOH 1K83H 2K5WA 3FKIH 2WB1E 4KY6A 1BCPD 3CKIB 4PZ8A 3GTMB 1XNRL 2Q8RE 2ZM6Q 1KAAA 1JWUD 1X65A 3CCRA 4GLAC 4JOIA 2ASBA 3I4NG 4JI3L 2PMZB 2F4VL 2JJQA 2CKZB 3PUYA 1X54A 2RA4A 4X3UA 3GTPH 1VQPA 4B3TL 2NBFA 4IPGA 2K50A 3AEVA 2EY6A 3BU2A 3K6OA 1X56A 1IBLL 1FR3A 4QQBX 5FKAC 1QNKA 1RODA 3F2DA 4LF5Q 1VCIA 3CCUA 1C0AA 1HA6A 1SE2A 5GQOA 4LFAL 1U4LA 3I4LA 1S5ED 1LV9A 4KHPL 1Q7YC 3CQZB 1BXTA 1AE3A 1NY4A 3GTJB 3WDNA 2B2VC 4LF8L 2EPBA 4MZ9A 4DK6C 1PH6A 2KUMA 2PPBC 5D65A 3M4YA 4PMCA 2R7ZG 4IUVA 1SXTA 2EOTA 3NTIA 3ER0A 2QDLA 4A3DG 1G2TA 4ID6A 3TQYA 4DUZL 2K6AA 1D1IA 2NVYB 4RCOA 2L11A 2GN5A 5IYDG 2R7ZB 5J22A 2FJ2A 4A3DB 4IFDG 2R6GA 3K0XA 1GUNA 1BO0A 3ICEA 4IOAA 1BBWA 3BYTB 3UE0A 2Z6KC 5HGQA 4QL5A 1KLUD 3K0YA 5E3FA 3LWUA 1NTGA 3HOUH 1CUKA 1F9QA 1O7IA 2CFMA 3NQTA 3F2UA 4JV5Q 5I9OA 1CZGA 1NBWA 3GP7A 4QMGA 1JE4A 1F2MA 1UE7A 2XIWA 4K6LA 2EYHA 1HQMC 5F2DA 3LGJA 5FOBB 1N34Q 1VQLA 5EPKA 1EY7A 4BBRH 2A68D 3HOYH 3MC0B 3GTQB 5C5LA 4HIKA 3S2DH 3S15H 4IUUA 1N32Q 3A56A 1HA5A 1HTPA 4YCWA 5BN4A 1E24A 1KRSA 5LMNW 1DD2A 5C44B 4UDUC 4KLKA 3DMUA 3ONAB 4OHJA 4OWXB 4RAUC 3AFPA 4X3TA 1L0WA 1EU3A 1SEBD 2K75A 3QB3A 1E2VA 2O5JC 1QUQB 4CKBA 4DNTB 1SLJA 4P2CB 4DR5L 4BBSG 3QWNA 2E2JH 1K8OA 3R93A 4G4KA 3HGBA 5IY0A 1NCVA 4KN7C 3CHBD 3MZ5A 4X65L 2G9HD 3LX0A 4DV4Q 3S1MH 4C3JH 2AQ1B 1QZHA 4EQ5A 2F0NA 5KGUA 4C3HG 4KKTA 5BN5A 2B63G 2EJMA 1YNJC 1XMQQ 3IFTA 4LF7L 2OTJA 1HR0W 5ELOA 3OMCA 1OXTA 3CCQA 3GO5A 2HDMA 2B63B 5LL6X 1NNXA 2VY3A 1SNCA 1STHA 1RL2A 3D4DA 4DV6Q 2O5IC 2WACA 1MKHA 3OTOQ 3M3YB 1Y1VG 4KD3A 4A4IA 4LF4L 2F0TA 3BDOA 4FNFA 5GROA 3G71A 3HRZC 3S16H 2IW3A 1KL9A 1TXYA 2WKCA 3HG9A 4DXGA 3SHLA 4DV2L 5E7NA 2RVLA 2WV6D 2Z0SA 1II3A 1Y1VB 4RGOS 3KF8B 4JBJA 3PIPA 3DWPA 4ZKBB 3CC7A 2HQLA 3IFDA 5C4XG 4DNIA 4P75A 4HJ9A 2WKDA 4K5VA 3U50C 1X6OA 3OSOA 3VA5A 2QEJC 5C4XB 4DR3L 1D5XC 2XNAC 4LF9L 4IFDI 2P5ZX 4B3RQ 1M8AA 1VQMA 1O7YA 4DR1Q 3T1YQ 3SDZA 2B2UA 4GOPA 3SK6A 4A93H 3B6YA 3MXUA 1TWAB 1LT6D 4FF2A 1MJEA 4KKSA 3K7AH 4BY1G 2H5XA 5JVH3 2ID0A 3J7AF 1LT3D 5M9OA 4KJOA 2B2TC 1IYVA 4ZYSA 1PH1A 1PH4A 2EJFC 1N33L 2K7VA 3PSIA 3S24A 1JJGA 5NUCA 4ALPA 1PRTC 3QIAA 4OONA 4BY1B 2CQOA 3TS0A 5IP9H 1I3QB 3NBIA 2HHHL 1DJRD 3K5OA 3VYUA 2JEBI 1GJXA 4ME5A 4JK1C 1ESFA 1SNDA 2CQAA 3TN2A 3R8BA 1PH9A 4ILWA 5IT9E 4N9PA 1SYCA 2JXMB 1XNRQ 2A6HD 1K9MC 5IGGA 4ZUJA 1PTOD 2MFIA 3KFUA 4HIDA 1B50A 4JI3Q 1MHWC 2F4VQ 4O2DA 3VDYA 5EAYA 1RHPA 5L37A 4B3TQ 2EIFA 2OTLA 2VB3X 2PI2A 1H9MA 1IBLQ 3RN5A 3NP8A 4A3KG 4ZUIA 2VS1A 1SYGA 4DKAC 4LFAQ 2ZT9C 2IY5B 2WAQE 5JEAG 4UAIA 5IP7G 2EZVA 1EIYB 3D4RA 1B9MA 4KHPQ 2K5NA 3GTLH 2NZOA 3H6MA 5H1SE 1PZID 2F0SA 4LF8Q 1CKNA 4RFBA 4IUNA 4X62L 4G57A 5JJKA 2HCIA 2KENA 5BN3A 1VQ4A 5JJIA 1J9OA 4DPGA 1HH2P 1KDBA 2IX1A 2CHBD 5DAUA 2JA5G 2EYOA 5KNCA 4DUZQ 2PQAA 3KK7A 2GVBA 3A8IE 3L2PA 1HZBA 4LK1C 4PMWA 3K59A 1D5MC 2EYMA 5JAVA 3G48A 4K5XA 1YVCA 3S1QH 3DLLA 1AEXA 1KTKA 1PYWD 3S1RH 1A8VA 5CYUA 2J7ZA 3D8GA 3D3RA 4EVOA 2JE6I 3S9WA 1G8ZD 2ICEC 3HOVB 3Q24A 1V1PA 5KIXA 2AUKA 1PV4A 2C35B 4MIUA 3A54A 5I2YA 4TRDA 4GLVB 3SK8A 3GTMH 4GKKL 4I65A 1JMCA 4HCSA 1TWHB 4QIWB 3J7YW 1FVIA 1WTQA 5I2XA 1B4OA 4O1NA 5C3EG 1S4ZA 3OOCA 2KJXA 1PFNA 2K32A 2OEOA 1GHJA 4J1MA 3GV3A 1WCMB 4WJWA 2HT1A 1VDZA 3ULPA 3CXCA 3M9BA 3EVQA 1SRUA 3BDLA 1EQQA 1ICFB 1VQ9A 4OO1I 4DR5Q 2Q2TA 3CQZH 4LAAA 5ELNA 4HJ8A 3MXGA 2EE1A 3QOLA 3GTJH 3NTKA 3G6JB 5COYA 4X65Q 1WD0A 2PO4A 1U0LA 1R4QB 2B8GA 3KDFA 1KABA 2E2IB 3H09A 1XTDA 3OYYA 4K2KA 5M5WB 3P20A 2HQEA 4LUVA 1S40A 1OXXK 3KBXA 5IYCH 4F8MA 2NVYH 4LF7Q 1EZ8A 3CCEA 5DLQE 2R7ZH 1JOQA 2Q8TA 2M9VA 3VR5A 4LFBL 4RA8A 4A3DH 4FDBA 1PTOB 4FXKC 2NVTH 2Z1CA 1F2YA 1J5EL 3G6EA 1C48A 2I5LX 2NTSA 3CMAA 1I4RA 3NXWA 1O78A 5IYDH 1Q12A 2JYOA 4P72A 3J81c 3RLOA 4LF4Q 3RNUA 1JWSD 1B53A 4QGUA 1EWCA 4JI7L 5I4DA 1K8MA 1GOZA 2NZHA 4X64L 1KQSA 4C2MB 4DV2Q 4M1UB 1DCZA 1H9SB 1ZYRD 5C0XG 3BVZA 3C1FA 2VUMG 1KDCA 1MI2A 3V05A 1AP0A 1U4MA 2KHIA 4A3EG 1K73C 3GTQH 1KXLA 1ENCA 4WFN3 3J81L 1Q81C 2VUMB 5C5MA 4XTCS 1VF5C 3L7ZC 5C44H 3IKJA 1HCZA 4BY7B 4DR3Q 4XT3B 1QJOA 3I7FA 4LF9Q 3RLFA 4FXGC 1HUNA 2X6GA 4RWSC 1K28A 4RGNA 1CHQD 2RSNA 5I6WA 1VQHA 1RIPA 3I70A 1VS0A 1BDOA 1M1KC 4K0KL 1X3FA 3OPOA 2D2CC 3KJPA 4HEDA 1VQFA 1JE5A 3FP9A 5JPMC 1SDFA 1PXUA 1N33Q 4K8JA 2FHTA 3BJUA 2WFWA 2BA1A 1X3PA 3VR3A 2K05A 1AFPA 3AU7A 2YV5A 3OIQA 3MFGA 4NDXA 2HHHQ 1DZ1A 3HOZB 4DV0L 2OF1A 2JA7G 1FD7D 2L1BA 3MFYA 3J7ZC 3NQIA 2B63H 3T1HL 4JBKA 3M7GA 1YHBA 1EY4A 1R4PB 3UDFA 1OO9B 3E6ZX 3M3YH 1B70B 3G7LA 3C46A 3OHXC 2OT2A 5IGDA 2EY2A 1NAPA 5IGCA 4H7BA 1BUVT 3DM1A 1Y1VH 2XN9C 1EIHA 5IIFA 3JAMc 1BBUA 2EXZA 4DK3C 4I7ZC 1UEAB 4R4CA 4KHZA 3J7AV 3UDXA 1KNAA 5EKKA 4JI0L 2PW5A 2RHQB 2ALYB 3RN2A 3I3CA 1GUSA 4A75A 3ND9A 4JI1L 4HMJA 2NN6G 5C4XH 1DXMA 4XQQA 2Z9HA 1L1OA 2PZWA 3DM3A 3EQLC 4AYBE 4BS9A 4MN3A 5IE8A 1VQ6A 1FNUA 2RF4A 2YTVA 3JAML 1LM0A 3Q8DA 3P7JA 1WOCA 4X62Q 3SXHA 1JJCB 3URYA 1TWAH 3TMEA 4B3ML 4CGYB 2TSSA 4P71A 1WTVA 5C0XI 3MA2B 4IJLA 2YTYA 3LNNA 5C3WA 3RUZA 4J6HA 4BY1H 5ELEA 1YIJA 4IPDA 4AQYL 1E22A 4CDFC 1QILA 4MHEA 4OGQC 1PYBA 4DXFA 3RR5A 1I3QH 1NR2A 1ZXTA 2KA7A 3PIP3 5LMUL 3PIO3 5EJWA 4A3IB 2BH8A 4RGMA 5LHY1 1PMRA 4K5WA 2ENBA 1YITA 3A74A 3A5UA 1SNMA 4A3MB 2BE5D 4POGA 4GKKQ 5J39A 3UDGA 2PZTA 3DWAA 5HY6A 2PCFB 2ZXOA 5CBEE 4A76A 1N9WA 2OQKA 2LFNA 2KECA 4C56C 1V1QA 2CWAA 3MWYW 1MD2D 1RD9D 1NJIC 4NKLA 1Q46A 4Y52H 4ULLA 4DUYL 2PNRC 2G9DA 3H0GB 3KF6A 3ND8A 4YIJA 4HJAA 4QJFA 2V4DA 3CRKC 5G3LD 3BZDB 5KNDA 2AKWB 4O0AA 1EY9A 1J8IA 3SR1A 5C3XA 3I4NB 2LXKA 4R4TA 3I8ZA 4R4OA 5E4XA 5JEAH 1MJCA 4S3SA 1G2SA 4I7AA 4QIWE 1Q1EA 2ZJPA 3C2PA 3BYYB 4DV3L 4IN3A 3Q6SA 4CJ2C 1HZCA 1YNXA 4BXXH 1ILQA 3CCLA 3MVVA 2HUGA 2LXJA 2F0WA 3J7A5 1U9RA 4R8IA 1KIXA 2H1EA 3M4OB 1IYUA 3JC66 4LFBQ 1ZEQX 2Z4HA 5E1FA 4QB4A 1LTID 2N49A 1J5EQ 2EXDA 3LWEA 1PFMA 4N9TA 1WTOA 3X3MA 2B2VA 3ULJA 1FJGL 4JPBW 2K33A 5A2QE 2NN6I 4JI7Q 2A1AA 1TQOA 3HP3A 4X64Q 3PO2G 3T51B 3HOVH 1R9TB 2NVTB 2JQOA 4LFCL 2A6EC 3EA6A 1RCVD 2MO0A 1PZKD 1VQCA 3J80E 2C5CA 2D5DA 3J81j 1TWHH 4M8AA 3PO2B 4FVMA 3M85A 2Y0SG 3EBEA 4A3LG 4RG1A 2VB2X 1GHKA 1B3QA 2CW0D 2Z6KA 1I50B 1CA5A 1ILPA 1HXYD 1WCMH 1QUQA 5GADC 4WJ3M 1FL0A 4CDCC 2Y0SB 1YHAA 3K80C 4IZ8A 1SJHD 4DFAA 1GUGA 2R7DA 3VA7A 4IOCA 4XT1B 3R2TA 1BCPC 2R93G 3Q23A 3GQBA 4K0KQ 4HAEA 2HIXA 1F2LA 4XXEA 5ELCA 2VNUD 4GNXC 2XGTA 2SDFA 1X3EA 2R93B 1D5ZC 3P1HA 4CKCA 2E2IH 1TWFB 2ZXRA 1CFMA 5M5WH 1HRJA 4J15A 4RGTA 3HOWG 2ES2A 3FPUB 4L6TB 4DV0Q 1KDAA 4Q0FA 4AIMA 4YWMA 3FVQA 1PTOH 3STBD 1KRTA 3H91A 2EY5A 3T1HQ 4BBSB 2IL8A 4LUZA 3J80c 1A2UA 1F77A 4FXDA 3WOFA 1NMGA 2F0GA 3CPFA 4APVA 2UU9Q 3U9SA 2B2WC 1BCPB 4OIJA 4HN7A 5A2QL 4CJ1B 1C8CA 3KF8A 3CRLC 5GAGC 1STYA 4GN5A 4C2MH 4GNXB 4C3HB 3OW7A 1U4RA 2B2YC 2M2LA 2Q2IA 3EROA 5CV8A 2K4KA 3J80L 1EY8A 2IHFA 4Z9CB 1HHVA 3DEOA 2M00A 4JI0Q 2VUMH 2QGQA 3PUVA 1LTLA 1O7ZA 4KK7A 3ZYYX 5EKIA 1VQOA 2E2DC 4JI1Q 1H9RA 4BY7H 4DV7L 2EDGA 3RMHA 2L9HA 1X3QA 2K03A 2B29A 4FP5D 2X6LA 1K0RA 3I56A 2LKVA 1DGSA 1UAPA 2KEEA 3TZDA 2NVXB 2K28A 4IURA 2B3GA 2A68C 4B3MQ 1STEA 5GAHC 2CCZA 1Z47A 2N88A 4XQJA 1O7LA 1DOMA 5EPJA 1BCPF 2F0OA 1GXDC 4ZKCB 5FLMG 3U58A 5FJ8G 2JA6G 2QCPX 1IZ6A 4DU9A 1GUTA 4YHHL 4AQYQ 3PMFA 4HCEA 1E2WA 2XSCA 3FHWA 4TQUS 3GTOB 4GZYC 1UUPA 2VQEL 2JA6B 3HOZH 5KNBA 4KV6A 1IW7D 4P74A 3GV6A 2LS01 5LMUQ 4NXML 3I4MG 2A74C 5C4ZA 2EQSA 4QUCA 1A15A 1YNND 2A69D 3RD4A 2PYKA 2UUAL 1YJWA 1SE8A 3N52A 2JA7H 4N8X1 4JVZA 2B2TA 1STNA 2YYZA 4OO1G 5AFWA 2MQHA 1V8QA 4K8IA 2D9UA 3I2ZA 3NE5B 4JBWA 1W6KA 2RKSA 1A62A 4H44C 1VQBA 1EU4A 3K58A 5CV6A 2GA4B 3E9HA 1LTAD 2Q2HA 4LF6L 1JQYD 3CCJA 2N78A 4DUYQ 3TP5A 1HNWL 4OWWB 3T16A 4R4QA 3D31A 1D8LA 1Y8NB 5M3FG 4OX9L 3M4PA 1DOLA 2I5HA 1QVCA 3VR6A 1VQ7A 1LYLA 3PF5A 1L0XB 4A3JG 4XDXA 4KD4A 2BCOA 4LUOA 1IBML 2R92G 4UP9A 4C3IG 5DNFA 5HURA 1A2TA 3E3XA 1NSNS 3H94A 1N8RC 2R7FA 4DV3Q 2ZXPA 2F0DA 2MUYA 4DR2L 3FKIG 2KBNA 4A3JB 3PUZA 4C3IB 3HKZE 4CJ0B 1A3TA 5JJLA 3W2DA 1UE6A 1I4PA 3QOJA 4L5QA 4V0BA 4A3KB 2QF7A 1IHZA 3E0JA 3KLSA
chains in the Genus database with same CATH topology
4MNOA 2IX0A 3L7ZC 4DAMA 1K8AC 5C44H 3CCSA 1S72A 1K8GA 4DR3Q 1KAWA 2PI2E 3TS2A 1B8AA 1QVFA 3I7FA 4LF9Q 3RLFA 3NEMA 1SR3A 2PMZE 5M3MG 1PA6A 1JB7A 2R92H 3PGZA 1FJGQ 4IO9A 3H3VI 2IT1A 4GLXA 4KI0A 3F2CA 4A3IH 3S17H 1VQHA 1HZAA 1RIPA 2AWOA 3H0GG 1K83H 3RZOH 1Z9FA 2AWNA 1VS0A 1TWCH 4DR7L 3FKIH 2ZTEA 1E1OA 2WB1E 4AH6A 1M1KC 1OTCA 1X3FA 4K0KL 2MO1A 4PZ8A 3KJPA 1XPUA 2A19A 4LFCQ 4A3MH 4A3GH 1WYDA 1VQFA 1JE5A 4EX5A 2ZM6Q 4A3EH 3FP9A 1UE1A 1XPOA 1IBKL 3CAMA 1XNRL 4DR6L 4X6AH 2KCMA 1XPRA 1YHQA 3RLNA 1N33Q 1X65A 3CCRA 4GLAC 4JOIA 2ASBA 3I4NG 4Y7NH 4JI3L 3BJUA 2WFWA 1I94L 2UXBL 2WB1G 2BA1A 1JT8A 1HZ9A 1Q8KA 3L0OA 2F4VL 2JJQA 3CW2C 2CKZB 3PUYA 1X54A 3GTPH 1VQPA 4B3TL 4IPGA 1KC8C 4NXNL 2YV5A 2K50A 3AEVA 2HHHQ 3AYHB 3BU2A 5LMNQ 1X56A 4DV0L 2RHSB 1IBLL 4QQBX 1V43A 1X3GA 2JA7G 1HNZQ 3F2DA 3J7ZC 4LF5Q 1VCIA 3CCUA 1C0AA 3H0GH 2V1CC 4R4IA 5GQOA 4LFAL 2B63H 2UUCL 3T1HL 1HJPA 4HIOA 3F1ZA 4JBKA 3CCVA 1YHBA 4KHPL 1Q7YC 3PIOA 3UDFA 1AE3A 2F52A 1VQGA 4JI4L 3M3YH 1H95A 1B70B 1NY4A 3J81i 4IFDG 3E0EA 4LF8L 4WJ4A 4MZ9A 4DK6C 4JI5L 1PH6A 3I4NH 4GOPC 2JA8H 3TRZA 4A3CH 3GDEA 2R7ZG 2NVQH 5BR8Q 2CWPA 3ER0A 1SFOH 4L5SA 1Y1VH 4A3DG 2I5MX 3TQYA 3D0FA 3W1GA 1YZ6A 4DUZL 3JAMc 1BBUA 2JA9A 4DK3C 4H02A 5IYDG 2GN5A 4R4CA 4GN3B 4KHZA 3UDXA 3STBC 4JI0L 3M4OH 3NELA 2RHQB 1B7YB 1EQRA 2ALYB 2R6GA 3UE1A 3HOXG 1W3SA 3K0XA 5IYBH 3RN2A 5IWAL 4A75A 3ICEA 4IOAA 1VQDA 4UP8A 1BBWA 4XTCS 3PUXA 2NN6G 4JI1L 3UE0A 3GTGH 2Z6KC 5C4XH 5HGQA 1HR0Q 4QL5A 1L1OA 4X66L 3DM3A 1PH7A 4AYBE 4JI2L 1NTGA 3HOUH 1N36Q 5IE8A 1VQ6A 1CUKA 3MXNB 2RF4A 2YTVA 4NB3A 1PH5A 1IXRA 1O7IA 2CFMA 4JV5Q 1LM0A 1NMFA 1XMOQ 2GVAA 3Q8DA 4X62Q 1WOCA 4GKJL 1NBWA 1JJCB 1TWAH 1UE7A 2YU9H 1A0IA 4B3ML 4MTNA 4GOPB 2IHEA 3LGJA 4P71A 4IPHA 1GVPA 4AYBG 4BBRH 1R9TH 1X9NA 1N34Q 1VQLA 4UPAA 1PH2A 1ASZA 3U4ZA 3HOYH 3I4OA 1PH8A 2ZJRA 5C0XI 4HIKA 4IJLA 2YTYA 3PO2H 3S2DH 3S15H 3OW2A 1N32Q 5AJ3Q 2K14A 4YCWA 5LMNW 1E24A 1KRSA 4BY1H 1EYGA 1FGUA 1YIJA 4IPDA 4KLKA 1I50H 4AQYL 2OCEA 1XNQL 1E22A 1I5FA 3K81C 4DV7Q 1PYBA 4JCVE 2E8GA 3RR5A 1I3QH 2K5VA 4OWXB 4JBMA 2VQFL 1L2FA 4A3GG 5LMUL 1YBYA 3AFPA 4JI6L 1L0WA 4YWLA 2E5LQ 2K75A 2BH8A 1QUQB 1SLJA 4HJ7A 1VQ5A 4YY3Q 4DR5L 4BBSG 5M5XH 3A74A 1YITA 3A5UA 2E2JH 1OXSC 1OXVA 1Q86C 4POGA 4GKKQ 1P16A 2DGYA 5IY0A 4X65L 3UDGA 1P8LA 2VW9A 5HY6A 2R93H 4JI8L 4DV1L 4DV4Q 1HNXQ 3S1MH 4C3JH 4A76A 1N9WA 2JK8A 1TWFH 2OQKA 1VQ8A 4YHHQ 1EOVA 1QZHA 4EQ5A 1T9HA 1GO3E 2B63G 4L5RC 4NPSA 1V1QA 2CWAA 1XMQQ 3S1NH 4BXXG 3JAMi 4LF7L 2OTJA 1NJIC 1HR0W 1UEBA 1TWGH 5ELOA 1EWIA 1OXTA 4Y52H 1Q46A 4NXMQ 4DUYL 3CCQA 1SROA 3GO5A 3KF6A 2VY3A 2JA8G 4QY7A 4HJAA 4QJFA 3TEHB 4BBSH 4DV6Q 1CKMA 1RL2A 1EFWA 2AKWB 1MKHA 2UUAQ 3OTOQ 1Y1VG 4A4IA 4O0AA 4LF4L 4B3RL 4B3SL 5C4JH 5GROA 4LW1A 3G71A 4GN4B 2LXKA 4R4TA 5IT9c 4R4OA 4HIMA 3S16H 3ULLA 4A3BH 4JYAL 4A93G 1KL9A 1TXYA 1MJCA 4QIWE 4DV2L 1KD1C 5E7NA 1Q1EA 2ZJPA 2UXCL 2Z0SA 4DV3L 1CKNB 4C3HH 3HOVG 5IYBG 3KF8B 4JBJA 1HZCA 3PIPA 1YNXA 2FXQA 3PF4A 3CC7A 4BXXH 2HQLA 3CCLA 5C4XG 4DNIA 2LXJA 3J7A5 4LF6Q 5JEAJ 1VQNA 4P75A 4OWTB 1KIXA 3HOUG 4DR4Q 5M5YH 2F3IA 3JC66 3G4SA 4HJ9A 4LFBQ 2PQAB 2VZAA 3KJOA 1HNWQ 3U50C 1X6OA 2N49A 1X55A 1J5EQ 4OX9Q 1UWVA 2EXDA 4DR3L 4LF9L 1WCMG 2VL6A 1YI2A 4IFDI 4BBRG 3ULJA 1FJGL 1VQMA 4B3RQ 3M7NA 4DR1Q 3PUWA 3HOYG 3T1YQ 3PO3H 4GOPA 4A93H 2NN6I 3CPWA 2A1AA 4JI7Q 1YJNA 3B6YA 1UE5A 4DAYB 4X64Q 2JEAI 3PO2G 2Y0SE 2NVXH 3HOVH 2D62A 1MJEA 4DR2Q 2UUBQ 3E9IA 2JQOA 4A3FH 4LFCL 3K7AH 4R1JA 4BY1G 3I55A 2H5XA 4DV5Q 2ID0A 2UXDQ 4PG3A 2MO0A 2ZM6L 1VQCA 1G6PA 3J81j 1PH1A 1PH4A 1N33L 1TWHH 1K3RA 3AQQA 3PSIA 4PZ6A 3S24A 1XJVA 1JJGA 4ME3A 4ALPA 3M85A 2Y0SG 3EBEA 4A3LG 4LWCA 4OONA 1C9OA 2CQOA 4RG1A 3K7UC 1CKOA 3TS0A 1GM5A 4XIGS 3CC4A 2Z6KA 3HFZB 5IP9H 1WCMH 3NBHB 1QUQA 3GTOH 1M90C 5GADC 2HHHL 1PVOA 4WJ3M 1FL0A 5LMNL 5FLMH 2JA6H 1YHAA 3K80C 2JEBI 1J6QA 4IJHA 1HNZL 4LF5L 2R7DA 4IOCA 4YCUA 2R93G 1OXUA 4DR7Q 1WI5A 2XTIA 1PH9A 4K0KQ 2HIXA 1Y14B 1JJ2A 1CSPA 3MEFA 3EN2A 4JG2A 3KOJA 2VNUD 1XNRQ 2OQ0A 4GNXC 1IBKQ 2XGTA 4DR6Q 1VQJA 1K9MC 2QEXA 1X3EA 1PFSA 2MFIA 2E2IH 3KFUA 4HIDA 4A3LH 4JI3Q 1I94Q 1SN8A 2UXBQ 5BR8L 1QZGA 2DUDA 2F4VQ 3CF5A 4O2DA 1VQAA 4PZ7A 3VDYA 1Q82C 5M5WH 3KDFB 5EAYA 4B3TQ 2EIFA 4NXNQ 4J15A 3HOWG 2OTLA 2ES2A 1L1OB 2PI2A 3EIVA 1E7ZA 1IBLQ 4DV0Q 3RN5A 4A3KG 4AIMA 4YWMA 4POFA 2OWOA 3STBD 1KRTA 2VS1A 1U5KA 1VQKA 4OXPA 4UY8C 4DKAC 4A3BG 4LFAQ 2IY5B 2UUCQ 3T1HQ 2WAQE 4LUZA 5JEAG 3J80c 5IP7G 1EIYB 5FLXc 1HR0L 4KHPQ 1NMGA 2K5NA 4BY7G 3CPFA 1KHIA 2NZOA 1EIFA 4APVA 2UU9Q 3GTLH 5H1SE 4JI4Q 1N36L 3W1BA 4RMFA 4LF8Q 1CKNA 2MNAA 4JI5Q 3H15A 3ZJYC 4JV5L 2VQEQ 4BA1I 5M3FH 3WWVA 1XMOL 2BA0A 4X62L 5JJKA 2WAQG 4L5TA 5GAGC 1AH9A 2K5HA 2KENA 3HKZG 4GN5A 4C2MH 4GNXB 1VQ4A 1GD7A 4A3JH 1E3PA 1EUJA 4DPGA 1N34L 1HH2P 2IX1A 5JJIA 3GD7A 4A3CG 3BZKA 4UP7A 2Q2IA 4C3IH 2JA5G 4DUZQ 3HOWH 2PQAA 2K4KA 2GVBA 2IHFA 3L2PA 1HZBA 3NENA 4PMWA 4IPCA 4A3KH 4JI0Q 4JOIC 2VUMH 2QGQA 3PUVA 3UDIA 1N32L 1LTLA 3G48A 5AJ3L 1VQIA 1Y1WH 3TREA 1VQOA 1W2BA 3PO3G 1YJ9A 3U4VA 1WJJA 5IWAQ 5IP7H 1YVCA 2BH2A 3M4QA 4JI1Q 3S1QH 3S2HH 1ASYA 4BY7H 5K36G 3HKSA 1G291 4DV7L 4X66Q 3A0JA 3S1RH 1A8VA 2N8NA 4JI2Q 3CCMA 4LNQA 2B29A 5C0XJ 4A3FG 3CD6A 3HOZG 2K52A 2E5LL 1K0RA 3A5ZB 2JE6I 3I56A 3AFQA 4GKJQ 1DGSA 4YY3L 2D0PA 5GAEC 2AMCB 2B3GA 2ZTCA 1QVGA 4B3MQ 1C7YA 3PCOB 5M3MH 3CC2A 2JA5H 1IYJB 3BZCA 1PV4A 2C35B 5GAHC 3GTMH 1I6HH 4GLVB 2CCZA 1Z47A 4GKKL 3KYHC 1JMCA 1E1TA 5IP9G 4P73A 3KLWA 1SMXA 1HNXL 1FVIA 4DV4L 1IBMQ 2JA6G 5FLMG 2KHJA 5C3EG 5FJ8G 3U58A 1IZ6A 4YHHL 3H3VH 2UU9L 1BKBA 3KF6B 1BVSA 3SGIA 4AQYQ 2Q2UA 4GS3A 1XNQQ 1XMQL 3FHWA 4TQUS 3F8TA 4JC0A 2HT1A 5IYCG 3ULPA 2VQEL 3RZDH 3HOZH 3CXCA 3M9BA 4P74A 2VQFQ 1Q1BA 5LMUQ 3IRBA 4JI6Q 4NXML 3I4MG 1SRUA 2YTXA 2EQSA 1EQQA 4HJ5A 1A63A 1VQ9A 4OO1I 4DV6L 4DR5Q 1AE2A 1S3OA 2Q2TA 1YEZA 3CQZH 1L1OC 5ELNA 3J80i 1SE8A 3OTOL 1YJWA 2UUAL 4HJ8A 2ATWA 5J3BA 2JA7H 3GTJH 2E2HH 2RCNA 1GKHA 4X65Q 2YYZA 4YCVA 4BA2I 4OO1G 2MQHA 3CP0A 1U0LA 4JI8Q 3KDFA 5FJ8H 5C3EH 4DV1Q 1V9PA 3I2ZA 2HIVA 4JBWA 1XTDA 4YWKA 1A62A 3OYYA 3K8AA 1VQBA 4LUVA 1S40A 1OXXK 5IYCH 1PHJA 2NVYH 1WFQA 3E9HA 1LUZA 1IL2A 4LF7Q 2Q2HA 2AHOB 3CCEA 4LF6L 5DLQE 2R7ZH 4DR4L 3I4MH 3GTKH 3CMEA 2N78A 3CCJA 4LFBL 4A3DH 4FDBA 4DUYQ 2PNHA 2WP8J 1HNWL 4OWWB 2NVTH 1VQEA 4R4QA 3D31A 1D8LA 5M3FG 3G6EA 1J5EL 3F2BA 2I5LX 4OX9L 3M4PA 3CMAA 2KCTA 5C44G 5IYDH 2I5HA 2L15A 1Q12A 1QVCA 4P72A 3J81c 1VQ7A 1LYLA 3RLOA 3PF5A 4A3JG 4LF4Q 3W5OA 4LUOA 4TVAB 4GNXA 2QA4A 3RNUA 1IBML 4UP9A 4DR1L 4B3SQ 4QGUA 3T1YL 2R92G 3HOXH 4JI7L 4JYAQ 1G51A 2I0QA 2NZHA 4X64L 1N8RC 4A3IG 1KQSA 4DV2Q 2VUMG 5C0XG 2R7FA 2UXCQ 4DV3Q 4DR2L 2UUBL 3FKIG 2KBNA 1NE3A 2D0OA 1Y1WG 2UXDL 4DV5L 2ZJQA 3PUZA 3HKZE 4A3MG 4IFDJ 1D7QA 2KHIA 5JJLA 4A3EG 1K73C 3GTQH 3S14H 1UE6A 2ZTDA 1KXLA 1MIUA 4L5QA 1Q81C 2N3SA 3ERSX 3PV0A 2A8VA 1CSQA 2LSSA 1PH3A 3DLLA 1PYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MNO A;  2IX0 A;  3L7Z C;  4DAM A;  1K8A C;  5C44 H;  3CCS A;  1S72 A;  1K8G A;  4DR3 Q;  1KAW A;  2PI2 E;  3TS2 A;  1B8A A;  1QVF A;  3I7F A;  4LF9 Q;  3RLF A;  3NEM A;  1SR3 A;  2PMZ E;  5M3M G;  1PA6 A;  1JB7 A;  2R92 H;  3PGZ A;  1FJG Q;  4IO9 A;  3H3V I;  2IT1 A;  4GLX A;  4KI0 A;  3F2C A;  4A3I H;  3S17 H;  1VQH A;  1HZA A;  1RIP A;  2AWO A;  3H0G G;  1K83 H;  3RZO H;  1Z9F A;  2AWN A;  1VS0 A;  1TWC H;  4DR7 L;  3FKI H;  2ZTE A;  1E1O A;  2WB1 E;  4AH6 A;  1M1K C;  1OTC A;  1X3F A;  4K0K L;  2MO1 A;  4PZ8 A;  3KJP A;  1XPU A;  2A19 A;  4LFC Q;  4A3M H;  4A3G H;  1WYD A;  1VQF A;  1JE5 A;  4EX5 A;  2ZM6 Q;  4A3E H;  3FP9 A;  1UE1 A;  1XPO A;  1IBK L;  3CAM A;  1XNR L;  4DR6 L;  4X6A H;  2KCM A;  1XPR A;  1YHQ A;  3RLN A;  1N33 Q;  1X65 A;  3CCR A;  4GLA C;  4JOI A;  2ASB A;  3I4N G;  4Y7N H;  4JI3 L;  3BJU A;  2WFW A;  1I94 L;  2UXB L;  2WB1 G;  2BA1 A;  1JT8 A;  1HZ9 A;  1Q8K A;  3L0O A;  2F4V L;  2JJQ A;  3CW2 C;  2CKZ B;  3PUY A;  1X54 A;  3GTP H;  1VQP A;  4B3T L;  4IPG A;  1KC8 C;  4NXN L;  2YV5 A;  2K50 A;  3AEV A;  2HHH Q;  3AYH B;  3BU2 A;  5LMN Q;  1X56 A;  4DV0 L;  2RHS B;  1IBL L;  4QQB X;  1V43 A;  1X3G A;  2JA7 G;  1HNZ Q;  3F2D A;  3J7Z C;  4LF5 Q;  1VCI A;  3CCU A;  1C0A A;  3H0G H;  2V1C C;  4R4I A;  5GQO A;  4LFA L;  2B63 H;  2UUC L;  3T1H L;  1HJP A;  4HIO A;  3F1Z A;  4JBK A;  3CCV A;  1YHB A;  4KHP L;  1Q7Y C;  3PIO A;  3UDF A;  1AE3 A;  2F52 A;  1VQG A;  4JI4 L;  3M3Y H;  1H95 A;  1B70 B;  1NY4 A;  3J81 i;  4IFD G;  3E0E A;  4LF8 L;  4WJ4 A;  4MZ9 A;  4DK6 C;  4JI5 L;  1PH6 A;  3I4N H;  4GOP C;  2JA8 H;  3TRZ A;  4A3C H;  3GDE A;  2R7Z G;  2NVQ H;  5BR8 Q;  2CWP A;  3ER0 A;  1SFO H;  4L5S A;  1Y1V H;  4A3D G;  2I5M X;  3TQY A;  3D0F A;  3W1G A;  1YZ6 A;  4DUZ L;  3JAM c;  1BBU A;  2JA9 A;  4DK3 C;  4H02 A;  5IYD G;  2GN5 A;  4R4C A;  4GN3 B;  4KHZ A;  3UDX A;  3STB C;  4JI0 L;  3M4O H;  3NEL A;  2RHQ B;  1B7Y B;  1EQR A;  2ALY B;  2R6G A;  3UE1 A;  3HOX G;  1W3S A;  3K0X A;  5IYB H;  3RN2 A;  5IWA L;  4A75 A;  3ICE A;  4IOA A;  1VQD A;  4UP8 A;  1BBW A;  4XTC S;  3PUX A;  2NN6 G;  4JI1 L;  3UE0 A;  3GTG H;  2Z6K C;  5C4X H;  5HGQ A;  1HR0 Q;  4QL5 A;  1L1O A;  4X66 L;  3DM3 A;  1PH7 A;  4AYB E;  4JI2 L;  1NTG A;  3HOU H;  1N36 Q;  5IE8 A;  1VQ6 A;  1CUK A;  3MXN B;  2RF4 A;  2YTV A;  4NB3 A;  1PH5 A;  1IXR A;  1O7I A;  2CFM A;  4JV5 Q;  1LM0 A;  1NMF A;  1XMO Q;  2GVA A;  3Q8D A;  4X62 Q;  1WOC A;  4GKJ L;  1NBW A;  1JJC B;  1TWA H;  1UE7 A;  2YU9 H;  1A0I A;  4B3M L;  4MTN A;  4GOP B;  2IHE A;  3LGJ A;  4P71 A;  4IPH A;  1GVP A;  4AYB G;  4BBR H;  1R9T H;  1X9N A;  1N34 Q;  1VQL A;  4UPA A;  1PH2 A;  1ASZ A;  3U4Z A;  3HOY H;  3I4O A;  1PH8 A;  2ZJR A;  5C0X I;  4HIK A;  4IJL A;  2YTY A;  3PO2 H;  3S2D H;  3S15 H;  3OW2 A;  1N32 Q;  5AJ3 Q;  2K14 A;  4YCW A;  5LMN W;  1E24 A;  1KRS A;  4BY1 H;  1EYG A;  1FGU A;  1YIJ A;  4IPD A;  4KLK A;  1I50 H;  4AQY L;  2OCE A;  1XNQ L;  1E22 A;  1I5F A;  3K81 C;  4DV7 Q;  1PYB A;  4JCV E;  2E8G A;  3RR5 A;  1I3Q H;  2K5V A;  4OWX B;  4JBM A;  2VQF L;  1L2F A;  4A3G G;  5LMU L;  1YBY A;  3AFP A;  4JI6 L;  1L0W A;  4YWL A;  2E5L Q;  2K75 A;  2BH8 A;  1QUQ B;  1SLJ A;  4HJ7 A;  1VQ5 A;  4YY3 Q;  4DR5 L;  4BBS G;  5M5X H;  3A74 A;  1YIT A;  3A5U A;  2E2J H;  1OXS C;  1OXV A;  1Q86 C;  4POG A;  4GKK Q;  1P16 A;  2DGY A;  5IY0 A;  4X65 L;  3UDG A;  1P8L A;  2VW9 A;  5HY6 A;  2R93 H;  4JI8 L;  4DV1 L;  4DV4 Q;  1HNX Q;  3S1M H;  4C3J H;  4A76 A;  1N9W A;  2JK8 A;  1TWF H;  2OQK A;  1VQ8 A;  4YHH Q;  1EOV A;  1QZH A;  4EQ5 A;  1T9H A;  1GO3 E;  2B63 G;  4L5R C;  4NPS A;  1V1Q A;  2CWA A;  1XMQ Q;  3S1N H;  4BXX G;  3JAM i;  4LF7 L;  2OTJ A;  1NJI C;  1HR0 W;  1UEB A;  1TWG H;  5ELO A;  1EWI A;  1OXT A;  4Y52 H;  1Q46 A;  4NXM Q;  4DUY L;  3CCQ A;  1SRO A;  3GO5 A;  3KF6 A;  2VY3 A;  2JA8 G;  4QY7 A;  4HJA A;  4QJF A;  3TEH B;  4BBS H;  4DV6 Q;  1CKM A;  1RL2 A;  1EFW A;  2AKW B;  1MKH A;  2UUA Q;  3OTO Q;  1Y1V G;  4A4I A;  4O0A A;  4LF4 L;  4B3R L;  4B3S L;  5C4J H;  5GRO A;  4LW1 A;  3G71 A;  4GN4 B;  2LXK A;  4R4T A;  5IT9 c;  4R4O A;  4HIM A;  3S16 H;  3ULL A;  4A3B H;  4JYA L;  4A93 G;  1KL9 A;  1TXY A;  1MJC A;  4QIW E;  4DV2 L;  1KD1 C;  5E7N A;  1Q1E A;  2ZJP A;  2UXC L;  2Z0S A;  4DV3 L;  1CKN B;  4C3H H;  3HOV G;  5IYB G;  3KF8 B;  4JBJ A;  1HZC A;  3PIP A;  1YNX A;  2FXQ A;  3PF4 A;  3CC7 A;  4BXX H;  2HQL A;  3CCL A;  5C4X G;  4DNI A;  2LXJ A;  3J7A 5;  4LF6 Q;  5JEA J;  1VQN A;  4P75 A;  4OWT B;  1KIX A;  3HOU G;  4DR4 Q;  5M5Y H;  2F3I A;  3JC6 6;  3G4S A;  4HJ9 A;  4LFB Q;  2PQA B;  2VZA A;  3KJO A;  1HNW Q;  3U50 C;  1X6O A;  2N49 A;  1X55 A;  1J5E Q;  4OX9 Q;  1UWV A;  2EXD A;  4DR3 L;  4LF9 L;  1WCM G;  2VL6 A;  1YI2 A;  4IFD I;  4BBR G;  3ULJ A;  1FJG L;  1VQM A;  4B3R Q;  3M7N A;  4DR1 Q;  3PUW A;  3HOY G;  3T1Y Q;  3PO3 H;  4GOP A;  4A93 H;  2NN6 I;  3CPW A;  2A1A A;  4JI7 Q;  1YJN A;  3B6Y A;  1UE5 A;  4DAY B;  4X64 Q;  2JEA I;  3PO2 G;  2Y0S E;  2NVX H;  3HOV H;  2D62 A;  1MJE A;  4DR2 Q;  2UUB Q;  3E9I A;  2JQO A;  4A3F H;  4LFC L;  3K7A H;  4R1J A;  4BY1 G;  3I55 A;  2H5X A;  4DV5 Q;  2ID0 A;  2UXD Q;  4PG3 A;  2MO0 A;  2ZM6 L;  1VQC A;  1G6P A;  3J81 j;  1PH1 A;  1PH4 A;  1N33 L;  1TWH H;  1K3R A;  3AQQ A;  3PSI A;  4PZ6 A;  3S24 A;  1XJV A;  1JJG A;  4ME3 A;  4ALP A;  3M85 A;  2Y0S G;  3EBE A;  4A3L G;  4LWC A;  4OON A;  1C9O A;  2CQO A;  4RG1 A;  3K7U C;  1CKO A;  3TS0 A;  1GM5 A;  4XIG S;  3CC4 A;  2Z6K A;  3HFZ B;  5IP9 H;  1WCM H;  3NBH B;  1QUQ A;  3GTO H;  1M90 C;  5GAD C;  2HHH L;  1PVO A;  4WJ3 M;  1FL0 A;  5LMN L;  5FLM H;  2JA6 H;  1YHA A;  3K80 C;  2JEB I;  1J6Q A;  4IJH A;  1HNZ L;  4LF5 L;  2R7D A;  4IOC A;  4YCU A;  2R93 G;  1OXU A;  4DR7 Q;  1WI5 A;  2XTI A;  1PH9 A;  4K0K Q;  2HIX A;  1Y14 B;  1JJ2 A;  1CSP A;  3MEF A;  3EN2 A;  4JG2 A;  3KOJ A;  2VNU D;  1XNR Q;  2OQ0 A;  4GNX C;  1IBK Q;  2XGT A;  4DR6 Q;  1VQJ A;  1K9M C;  2QEX A;  1X3E A;  1PFS A;  2MFI A;  2E2I H;  3KFU A;  4HID A;  4A3L H;  4JI3 Q;  1I94 Q;  1SN8 A;  2UXB Q;  5BR8 L;  1QZG A;  2DUD A;  2F4V Q;  3CF5 A;  4O2D A;  1VQA A;  4PZ7 A;  3VDY A;  1Q82 C;  5M5W H;  3KDF B;  5EAY A;  4B3T Q;  2EIF A;  4NXN Q;  4J15 A;  3HOW G;  2OTL A;  2ES2 A;  1L1O B;  2PI2 A;  3EIV A;  1E7Z A;  1IBL Q;  4DV0 Q;  3RN5 A;  4A3K G;  4AIM A;  4YWM A;  4POF A;  2OWO A;  3STB D;  1KRT A;  2VS1 A;  1U5K A;  1VQK A;  4OXP A;  4UY8 C;  4DKA C;  4A3B G;  4LFA Q;  2IY5 B;  2UUC Q;  3T1H Q;  2WAQ E;  4LUZ A;  5JEA G;  3J80 c;  5IP7 G;  1EIY B;  5FLX c;  1HR0 L;  4KHP Q;  1NMG A;  2K5N A;  4BY7 G;  3CPF A;  1KHI A;  2NZO A;  1EIF A;  4APV A;  2UU9 Q;  3GTL H;  5H1S E;  4JI4 Q;  1N36 L;  3W1B A;  4RMF A;  4LF8 Q;  1CKN A;  2MNA A;  4JI5 Q;  3H15 A;  3ZJY C;  4JV5 L;  2VQE Q;  4BA1 I;  5M3F H;  3WWV A;  1XMO L;  2BA0 A;  4X62 L;  5JJK A;  2WAQ G;  4L5T A;  5GAG C;  1AH9 A;  2K5H A;  2KEN A;  3HKZ G;  4GN5 A;  4C2M H;  4GNX B;  1VQ4 A;  1GD7 A;  4A3J H;  1E3P A;  1EUJ A;  4DPG A;  1N34 L;  1HH2 P;  2IX1 A;  5JJI A;  3GD7 A;  4A3C G;  3BZK A;  4UP7 A;  2Q2I A;  4C3I H;  2JA5 G;  4DUZ Q;  3HOW H;  2PQA A;  2K4K A;  2GVB A;  2IHF A;  3L2P A;  1HZB A;  3NEN A;  4PMW A;  4IPC A;  4A3K H;  4JI0 Q;  4JOI C;  2VUM H;  2QGQ A;  3PUV A;  3UDI A;  1N32 L;  1LTL A;  3G48 A;  5AJ3 L;  1VQI A;  1Y1W H;  3TRE A;  1VQO A;  1W2B A;  3PO3 G;  1YJ9 A;  3U4V A;  1WJJ A;  5IWA Q;  5IP7 H;  1YVC A;  2BH2 A;  3M4Q A;  4JI1 Q;  3S1Q H;  3S2H H;  1ASY A;  4BY7 H;  5K36 G;  3HKS A;  1G29 1;  4DV7 L;  4X66 Q;  3A0J A;  3S1R H;  1A8V A;  2N8N A;  4JI2 Q;  3CCM A;  4LNQ A;  2B29 A;  5C0X J;  4A3F G;  3CD6 A;  3HOZ G;  2K52 A;  2E5L L;  1K0R A;  3A5Z B;  2JE6 I;  3I56 A;  3AFQ A;  4GKJ Q;  1DGS A;  4YY3 L;  2D0P A;  5GAE C;  2AMC B;  2B3G A;  2ZTC A;  1QVG A;  4B3M Q;  1C7Y A;  3PCO B;  5M3M H;  3CC2 A;  2JA5 H;  1IYJ B;  3BZC A;  1PV4 A;  2C35 B;  5GAH C;  3GTM H;  1I6H H;  4GLV B;  2CCZ A;  1Z47 A;  4GKK L;  3KYH C;  1JMC A;  1E1T A;  5IP9 G;  4P73 A;  3KLW A;  1SMX A;  1HNX L;  1FVI A;  4DV4 L;  1IBM Q;  2JA6 G;  5FLM G;  2KHJ A;  5C3E G;  5FJ8 G;  3U58 A;  1IZ6 A;  4YHH L;  3H3V H;  2UU9 L;  1BKB A;  3KF6 B;  1BVS A;  3SGI A;  4AQY Q;  2Q2U A;  4GS3 A;  1XNQ Q;  1XMQ L;  3FHW A;  4TQU S;  3F8T A;  4JC0 A;  2HT1 A;  5IYC G;  3ULP A;  2VQE L;  3RZD H;  3HOZ H;  3CXC A;  3M9B A;  4P74 A;  2VQF Q;  1Q1B A;  5LMU Q;  3IRB A;  4JI6 Q;  4NXM L;  3I4M G;  1SRU A;  2YTX A;  2EQS A;  1EQQ A;  4HJ5 A;  1A63 A;  1VQ9 A;  4OO1 I;  4DV6 L;  4DR5 Q;  1AE2 A;  1S3O A;  2Q2T A;  1YEZ A;  3CQZ H;  1L1O C;  5ELN A;  3J80 i;  1SE8 A;  3OTO L;  1YJW A;  2UUA L;  4HJ8 A;  2ATW A;  5J3B A;  2JA7 H;  3GTJ H;  2E2H H;  2RCN A;  1GKH A;  4X65 Q;  2YYZ A;  4YCV A;  4BA2 I;  4OO1 G;  2MQH A;  3CP0 A;  1U0L A;  4JI8 Q;  3KDF A;  5FJ8 H;  5C3E H;  4DV1 Q;  1V9P A;  3I2Z A;  2HIV A;  4JBW A;  1XTD A;  4YWK A;  1A62 A;  3OYY A;  3K8A A;  1VQB A;  4LUV A;  1S40 A;  1OXX K;  5IYC H;  1PHJ A;  2NVY H;  1WFQ A;  3E9H A;  1LUZ A;  1IL2 A;  4LF7 Q;  2Q2H A;  2AHO B;  3CCE A;  4LF6 L;  5DLQ E;  2R7Z H;  4DR4 L;  3I4M H;  3GTK H;  3CME A;  2N78 A;  3CCJ A;  4LFB L;  4A3D H;  4FDB A;  4DUY Q;  2PNH A;  2WP8 J;  1HNW L;  4OWW B;  2NVT H;  1VQE A;  4R4Q A;  3D31 A;  1D8L A;  5M3F G;  3G6E A;  1J5E L;  3F2B A;  2I5L X;  4OX9 L;  3M4P A;  3CMA A;  2KCT A;  5C44 G;  5IYD H;  2I5H A;  2L15 A;  1Q12 A;  1QVC A;  4P72 A;  3J81 c;  1VQ7 A;  1LYL A;  3RLO A;  3PF5 A;  4A3J G;  4LF4 Q;  3W5O A;  4LUO A;  4TVA B;  4GNX A;  2QA4 A;  3RNU A;  1IBM L;  4UP9 A;  4DR1 L;  4B3S Q;  4QGU A;  3T1Y L;  2R92 G;  3HOX H;  4JI7 L;  4JYA Q;  1G51 A;  2I0Q A;  2NZH A;  4X64 L;  1N8R C;  4A3I G;  1KQS A;  4DV2 Q;  2VUM G;  5C0X G;  2R7F A;  2UXC Q;  4DV3 Q;  4DR2 L;  2UUB L;  3FKI G;  2KBN A;  1NE3 A;  2D0O A;  1Y1W G;  2UXD L;  4DV5 L;  2ZJQ A;  3PUZ A;  3HKZ E;  4A3M G;  4IFD J;  1D7Q A;  2KHI A;  5JJL A;  4A3E G;  1K73 C;  3GTQ H;  3S14 H;  1UE6 A;  2ZTD A;  1KXL A;  1MIU A;  4L5Q A;  1Q81 C;  2N3S A;  3ERS X;  3PV0 A;  2A8V A;  1CSQ A;  2LSS A;  1PH3 A;  3DLL A;  1PYS B; 
#chains in the Genus database with same CATH topology
 4MNO A;  4E6I A;  2PQE A;  4KJN A;  1K8G A;  1HFG A;  1LTG D;  3TS2 A;  1MSG A;  2K1B A;  3NEM A;  1SR3 A;  2PMZ E;  3TBI B;  1JB7 A;  1S5F D;  3PGZ A;  1FJG Q;  2OXP A;  4IO9 A;  1TS5 A;  4ZQ3 A;  3H3V I;  3F2C A;  4A3I H;  1Z9F A;  1DYQ A;  5J1Z A;  2ZTE A;  1F9R A;  1STB A;  2MO1 A;  3NTH A;  4IQZ A;  2JA5 B;  2A19 A;  4LFC Q;  4A3M H;  4J8Q A;  4X6A H;  1XPO A;  4DR6 L;  3CAM A;  2KCM A;  1XPR A;  3RLN A;  1EFI D;  1BOS A;  4DF7 A;  1I94 L;  2WB1 G;  5KYL A;  1JT8 A;  1Q8K A;  2AUJ D;  2DJG C;  1HQR D;  1KC8 C;  4NXN L;  5D3I B;  2AQ3 B;  4XQN A;  2NB0 A;  1I4X A;  3AYH B;  1V43 A;  1X3G A;  1SMY D;  1AN8 A;  3K5N A;  3H0G H;  3NWS A;  4R4I A;  3J81 E;  3DUZ A;  4DN4 M;  3NBH A;  2ICI A;  2F0E A;  2A6H C;  4K2L A;  1VQG A;  4JI4 L;  3SVM A;  3J81 i;  2E2H B;  4WJ4 A;  5CGK A;  1PTO C;  2K01 A;  4JI5 L;  3TSS A;  3I4N H;  4O42 A;  5C3E B;  4C1N K;  2L12 A;  4IUP A;  4KKU A;  1EOT A;  2F0V A;  1B44 D;  1S5B D;  3QG1 A;  2JA9 A;  1SNP A;  1O80 A;  3BG3 A;  3VYT A;  4GN3 B;  4DAV A;  2HD3 A;  3M4O H;  3IAY A;  4R8N A;  1B7Y B;  1EQR A;  3UE1 A;  1PDQ A;  3HOX G;  1W3S A;  3D6C A;  5IWA L;  4RHS A;  1VQD A;  4UP8 A;  3PUX A;  2IX3 A;  2R3Z A;  4X66 L;  1PH7 A;  1V1P B;  1B9N A;  1SJE D;  1LO5 D;  3HOX B;  3MXN B;  1CM9 A;  5IGE A;  4NB3 A;  5FO7 B;  1IXR A;  5EBC A;  2K5Q A;  1Q90 A;  4MTN A;  1R9T H;  2IHE A;  1X9N A;  4A3C G;  4IPH A;  1GVP A;  4DK0 A;  4UPA A;  2EYF A;  3V2T A;  1PH2 A;  1ASZ A;  3I4O A;  1PH8 A;  3OMG A;  1QE6 A;  2QIL A;  3PO2 H;  4ZRZ A;  2NTT A;  3QJY A;  3TP6 A;  4IFD H;  3A8K E;  1CQV A;  1EYG A;  1I50 H;  2L5T A;  2OCE A;  4U67 3;  3T56 B;  1I5F A;  3K81 C;  4HTH A;  4JCV E;  4DV7 Q;  1S5D D;  2E8G A;  2EJG C;  2K5D A;  1G91 A;  2VQF L;  1L2F A;  4A3G G;  5TSS A;  1YBY A;  1IL8 A;  4JI6 L;  5C4H A;  1TWC B;  3KBG A;  2DY8 A;  1Q86 C;  4A3E B;  3T53 B;  1P8L A;  1LTS D;  2R93 H;  4Y7N B;  1VF7 A;  5E4W C;  2JK8 A;  1TWF H;  3JAM E;  1VQ8 A;  4YHH Q;  1EOV A;  3SK5 A;  1T9H A;  1GO3 E;  4L5R C;  4NPS A;  2QW7 A;  3OWE B;  1PTO F;  3JAM i;  4PMB A;  4EQN A;  1UEB A;  3HS0 C;  1DM0 B;  4NXM Q;  1SRO A;  4NMZ A;  1MGS A;  4K6D A;  2JA8 G;  3EFX D;  4QY7 A;  3TEH B;  4BBS H;  1CKM A;  1EFW A;  2UUA Q;  3HZX A;  5FK9 C;  4GN4 B;  4HIM A;  4JYA L;  3PQI A;  3ULL A;  1EWH A;  2JA8 B;  4A93 G;  4OIK A;  2F0U A;  2F0J A;  3SE0 A;  1KD1 C;  1A3U A;  2UXC L;  2NVQ B;  1SFO B;  4C3H H;  4Q5V A;  5IYB G;  4QUF A;  2L4N A;  4L63 B;  1EYC A;  2FXQ A;  5CV7 A;  1TY0 A;  2F0H A;  1TS3 A;  4LF6 Q;  1VQN A;  2JA7 B;  1A6X A;  4OWT B;  5ISR A;  1G6Z A;  2F3I A;  3AMU A;  2SOB A;  3G4S A;  2BDN A;  2NZ1 D;  3KJO A;  1HNW Q;  1Y8P B;  1X55 A;  2CH4 W;  4OX9 Q;  3GTG B;  1EL0 A;  2NYZ D;  2FFK B;  1EIG A;  2VL6 A;  1YI2 A;  1CZW A;  3M7N A;  3PUW A;  1B2T A;  4PQX A;  1W6J A;  1ZYR C;  1YJN A;  1UE5 A;  3C1E A;  4DAY B;  4LMQ D;  2YU9 B;  2NVX H;  2IPK D;  1ML0 D;  4DR2 Q;  2CH4 A;  3T13 A;  1EEF D;  4R1J A;  1EYA A;  2DJF C;  1G6P A;  1CHP D;  2X69 A;  3DHQ A;  1K3R A;  3AQQ A;  4PZ6 A;  4ME3 A;  5IGB A;  4LWC A;  3K7U C;  4JW0 A;  1CKO A;  2Z6B A;  1GM5 A;  3TP7 A;  3CC4 A;  2G5D A;  1SE4 A;  2F0I A;  1PZJ D;  3A7L A;  3GTO H;  1K3B C;  5LMN L;  2JA6 H;  5FLM H;  1J6Q A;  4IJH A;  1HNZ L;  5CMD A;  5CV5 A;  3VYS A;  4YCU A;  1STA A;  1WI5 A;  2L0C A;  5M5X B;  2XTI A;  1RTO A;  3KUP A;  1JJ2 A;  1CSP A;  3MEF A;  3EN2 A;  4JG2 A;  3KOJ A;  2RBM A;  2Z4I A;  2OQ0 A;  4H0L C;  4DR6 Q;  3W3A A;  1I94 Q;  1SN8 A;  5BR8 L;  1QZG A;  2DUD A;  1ONL A;  2MGS A;  3S1N B;  4NXN Q;  4OO1 H;  1JIC A;  1L1O B;  3EIV A;  1E7Z A;  1TWG B;  2KQ3 A;  4POF A;  2OWO A;  1U5K A;  4TKO B;  1EYD A;  4A3B G;  2F4I A;  5FLX c;  1HR0 L;  1KHI A;  5K5P A;  4KY5 A;  1N36 L;  4JI4 Q;  4RMF A;  1RJT A;  4JI5 Q;  3H15 A;  1C4Q A;  3ZJY C;  2KCC A;  5FO8 B;  4A3B B;  5M3F H;  1XMO L;  2BA0 A;  2WAQ G;  4L5T A;  1AH9 A;  3HKZ G;  1WTR A;  4FF3 A;  1GD7 A;  4A3J H;  1E3P A;  1EUJ A;  3GD7 A;  3BZK A;  3CU7 A;  4C3I H;  1TR5 A;  2F0F A;  3BVM A;  1SYB A;  4V19 0;  1QG7 A;  1QCB D;  5FLX L;  3NEN A;  1SAP A;  4IPC A;  3MAQ A;  4A3K H;  5M5Y B;  4JOI C;  5DEH A;  1RDP D;  5AJ3 L;  1VQI A;  3TRE A;  3PO3 G;  2RCF A;  2L55 A;  1YJ9 A;  3U4V A;  5IGF A;  5IWA Q;  5IP7 H;  3S2H H;  1F9S A;  2J0T D;  1XYI A;  2DNE A;  5K36 G;  1G29 1;  4X66 Q;  2DNC A;  4LNQ A;  5LL6 S;  4A3F G;  3PO3 B;  2E5L L;  3A5Z B;  2SEB D;  4XYQ A;  4C1N I;  3AFQ A;  4YY3 L;  2IWH A;  2ZTC A;  1QVG A;  4A3F B;  3CC2 A;  2JA5 H;  1IYJ B;  2MHV A;  3KYH C;  4P73 A;  3KLW A;  1HNX L;  3BS1 A;  1EQT A;  2KHJ A;  2LY7 A;  3I73 A;  1GUO A;  2PZU A;  2WIN B;  1BKB A;  3KF6 B;  1BVS A;  5D3D A;  3SGI A;  5IYC G;  3Q0A A;  4FF4 A;  1YNJ D;  1FYC A;  2VQF Q;  4JI6 Q;  3IRB A;  3L3O C;  4HJ5 A;  1A63 A;  2R61 A;  1TVX A;  3I72 A;  2BE5 C;  1S3O A;  4R9W A;  3SEB A;  2EVB A;  3J80 i;  1I4H A;  2ATW A;  1EQV A;  4MTK A;  4PV1 C;  1TT2 A;  1FGB D;  5DM6 3;  3QR8 A;  2E2H H;  4ABN A;  1RKN A;  3KLR A;  5C3E H;  2HIV A;  4IUQ A;  1Z6H A;  3K8A A;  1CQF A;  3QO2 A;  1PHJ A;  4QF4 A;  1HPC A;  1QB5 D;  2O2L D;  4DR4 L;  4DK1 A;  4RH6 A;  1SYF A;  2XRQ D;  3ITP A;  1VQE A;  2XVS A;  5C44 G;  1IKM A;  1TY2 A;  1D1K A;  4QCL A;  2MJ8 A;  4GNX A;  4EQO A;  3HOX H;  4JYA Q;  1G51 A;  2JP1 A;  3VYR A;  2UXC Q;  1RF2 D;  2UUB L;  1NE3 A;  2D0O A;  1Y1W G;  2UXD L;  4DV5 L;  4NP5 A;  1WD1 A;  3HOW B;  1Y69 U;  2BOS A;  5KYI A;  4IFD J;  5I9P A;  1D7Q A;  5ELF A;  3H3V C;  3S14 H;  2ZTD A;  1MIU A;  1MSH A;  3VR4 A;  1SE3 A;  2A8V A;  2LSS A;  1Y1W B;  3BVG A;  4A3C H;  1QOH A;  2IX0 A;  1PRT D;  2EY1 A;  3A55 A;  3I90 A;  1TU2 B;  1S72 A;  5D14 A;  1XTC D;  1CTM A;  1KAW A;  1B8A A;  1QVF A;  3KLS X;  2B2W A;  5M3M G;  1PA6 A;  2O4X A;  2Z8L A;  4N8F A;  4PNY A;  1E0B A;  5C0X H;  1HTL D;  5EGT A;  1IKL A;  2AWN A;  1TWC H;  4IAL A;  4AH6 A;  4DR7 L;  1E1O A;  4DAP A;  5M3M B;  1OTC A;  1XPU A;  2B2Y A;  1H9J A;  1D6E C;  1I6H B;  4A3G H;  1WYD A;  4HSV A;  4HSP A;  4U68 A;  4EX5 A;  4A3E H;  1IBK L;  1UE1 A;  2FIN B;  1AZP A;  3FEW X;  1YHQ A;  4RKL A;  4Y7N H;  2UXB L;  1U4P A;  2CW0 C;  1TS4 A;  1HZ9 A;  2A5H A;  3L0O A;  3CW2 C;  1A3V A;  5JOB A;  4OEM B;  3RZD B;  5LMN Q;  2RHS B;  4KY7 A;  1HNZ Q;  1B1Z A;  2V1C C;  2UUC L;  1HJP A;  4HIO A;  3F1Z A;  3CCV A;  3NUC A;  3OIP A;  4UHV A;  4DNR B;  4KHV A;  3PIO A;  2F52 A;  1H95 A;  3P75 A;  3E0E A;  2B2U C;  3VR2 A;  4GOP C;  2JA8 H;  3TRZ A;  5G3L F;  1QWY A;  3GDE A;  2NVQ H;  5BR8 Q;  2CWP A;  1SFO H;  4L5S A;  2I5M X;  4G7O C;  5EBD A;  3D0F A;  2XRS D;  2NWG A;  1YZ6 A;  4X3K A;  3W1G A;  5CC4 A;  1LTR D;  4H02 A;  1LLR D;  4G7Z C;  3T4A C;  3STB C;  3I4M B;  3GTK B;  3NPP A;  2Q8I B;  3NEL A;  5IYB H;  5KRU A;  1BBX C;  1JOK A;  3GTG H;  4ZK9 B;  2F0P A;  5COR A;  1HR0 Q;  2DY7 A;  1EZ6 A;  4JI2 L;  1CI3 M;  5T1G A;  1WTP A;  1N36 Q;  1SYD A;  1WTW A;  4F7X A;  1PH5 A;  4FF1 A;  2F3W A;  2F0K A;  1NMF A;  1XMO Q;  2GVA A;  5JPN C;  4GKJ L;  3EJI A;  4RKB A;  4DGZ A;  5CV9 A;  2YU9 H;  2KVM A;  1A0I A;  2B39 A;  4GOP B;  1WVL A;  3FRP B;  4AYB G;  3U4Z A;  1M4V A;  1ET6 A;  1V1O A;  2ZJR A;  3OW2 A;  5AJ3 Q;  2K14 A;  4AYB B;  5M3F B;  2NN6 H;  1FGU A;  1XNQ L;  3FPP A;  4JBM A;  2K5V A;  5ELD A;  2R92 B;  2HCC A;  4WOR A;  1GUW A;  1K0S A;  3C3L A;  1X32 A;  4YWL A;  2EYP A;  2E5L Q;  4FYD A;  3S17 B;  3RZO B;  1K83 B;  4HJ7 A;  1VQ5 A;  4YY3 Q;  1AZQ A;  3FKI B;  1PRT B;  5M5X H;  5FO9 B;  2KED A;  3S2H B;  1OXS C;  1OXV A;  1JR0 D;  2KCN A;  2WII B;  1UNS A;  1P16 A;  2DGY A;  1XWE A;  2VW9 A;  1Q3L A;  4JI8 L;  4DV1 L;  1HNX Q;  5I6Y A;  3V96 A;  3GTP B;  4G7H C;  3S1N H;  1WTX A;  4BXX G;  1IW7 C;  1EY6 A;  1HUM A;  3HEJ A;  3UI2 A;  1TWG H;  1EWI A;  5DM7 3;  3TZU A;  4F87 A;  1YNN C;  2A69 C;  4RHR A;  5HGT A;  2N55 A;  2CVR A;  1ENA A;  1XXG A;  3DEP A;  4B3S L;  5C4J H;  4LW1 A;  1LTT D;  1I6V C;  1QNU A;  2J4X A;  5IT9 c;  4DA2 A;  4A3B H;  5T1I A;  5EPL A;  1Z7T A;  4EQP A;  5EKL A;  2WB1 B;  4H13 C;  1CKN B;  3NWT A;  3HOV G;  1KNE A;  2RDH A;  1RTN A;  2SNS A;  1EY0 A;  4BWG B;  3U9O A;  3PF4 A;  2HDL A;  2XWB B;  1PRT F;  5JEA J;  4DR4 Q;  3HOU G;  5M5Y H;  1F9P A;  1BQQ T;  2PQA B;  3L9A X;  2VZA A;  4B9X A;  4HMI A;  5IT9 L;  3MTS A;  1UWV A;  4TSS A;  3MXN A;  1CT1 D;  1VMP A;  1LTB D;  1PLF A;  5JVG 3;  3HOU B;  1WCM G;  4CBV A;  3K57 A;  4BBR G;  2RDG A;  3HOY G;  3PO3 H;  3CPW A;  3K5M A;  2JEA I;  5K36 H;  2Y0S E;  1SNO A;  2D62 A;  2UUB Q;  2XWJ B;  3E9I A;  4BBR B;  4A3F H;  4DV5 Q;  2UXD Q;  3I55 A;  5CV4 A;  2C9O A;  1JC7 A;  3HOY B;  4PG3 A;  2ZM6 L;  2FMC A;  4F88 A;  3S2D B;  3S15 B;  1H9S A;  2VXW A;  5CR3 A;  1XJV A;  4B08 A;  2F0M A;  1C9O A;  2JSO A;  3DXJ C;  3NHH A;  2E74 C;  4XIG S;  2TMP A;  3HFZ B;  1NR4 A;  3NBH B;  1PVO A;  1M90 C;  3D4W A;  3NSW A;  3MXP A;  4LF5 L;  3S14 B;  3TP8 A;  1VMC A;  3R3O A;  1OXU A;  4ZAI A;  4DR7 Q;  3SK4 A;  4IUT A;  4C3J G;  2F1M A;  4WRD A;  2E2J B;  1Y14 B;  2F0Q A;  3OWF A;  4RCN A;  4EGV A;  1LT5 D;  1IBK Q;  2SNM A;  1VQJ A;  2DN8 A;  2QEX A;  4NW2 A;  4ODG A;  1PFS A;  3S1M B;  2RDF A;  4C3J B;  2IJ0 A;  2A73 B;  4A3L H;  2UXB Q;  4CDD C;  1Y8O B;  3CF5 A;  1VQA A;  4PZ7 A;  1Q82 C;  3KDF B;  1JWM D;  1SMY C;  4A3G B;  1ENF A;  2BDO A;  1B3A A;  1WTH A;  2KHS A;  1ICW A;  1ESR A;  1VQK A;  4OXP A;  4UY8 C;  2UUC Q;  4CDE C;  3TDQ A;  1T5E A;  4BY7 G;  1EIF A;  1JOO A;  3W1B A;  2RQX A;  4OEL B;  3WOE A;  1BR9 A;  2MNA A;  3S16 B;  1MBY A;  4JV5 L;  2VQE Q;  4BA1 I;  3WWV A;  2K5H A;  3AB9 A;  1N34 L;  3MHB A;  3ERQ A;  1EEI D;  4UP7 A;  3HOW H;  3E5S A;  4CHT B;  4KTA A;  3X3N A;  1H9K A;  1TKW B;  3Q22 A;  2EYJ A;  3UDI A;  1N32 L;  1Y1W H;  1W2B A;  1WJJ A;  2K04 A;  2BH2 A;  3M4Q A;  1ASY A;  3HKS A;  2H4O A;  3A8J E;  3A0J A;  3BDC A;  2N8N A;  4JI2 Q;  4DAY A;  3CCM A;  1LAB A;  3CD6 A;  1SNQ A;  5C0X J;  4X3S A;  3HOZ G;  2K52 A;  4A93 B;  3D6W A;  2NUC A;  1CK1 A;  4GKJ Q;  2E76 C;  2D0P A;  5GAE C;  1TII D;  3FDT A;  2AMC B;  4CKE A;  1C7Y A;  3PCO B;  5M3M H;  5KEE A;  3K7A B;  3BZC A;  1I6H H;  1DON A;  2AQ2 B;  4B9W A;  3FMC A;  1E1T A;  5IP9 G;  1SMX A;  3R2I A;  4DV4 L;  1IBM Q;  5A35 A;  2I07 B;  2EYL A;  5CBA E;  3H3V H;  2UU9 L;  1FNV A;  4OL7 A;  2Q2U A;  1NUC A;  1XX8 A;  3IL8 A;  1FNW A;  4GS3 A;  1XMQ L;  1XNQ Q;  1LAC A;  3F8T A;  4JC0 A;  3RZD H;  1Q1B A;  5JJZ A;  2MPM A;  2YTX A;  5FLX E;  3MEH A;  1I4Q A;  1PFB A;  4ZLT F;  2LMC B;  4DV6 L;  1BF4 A;  1AE2 A;  1S5C D;  2MP1 A;  1YEZ A;  1L1O C;  3OTO L;  2E75 C;  5J3B A;  1Q8I A;  2FMM A;  2RCN A;  1GKH A;  4BA2 I;  4YCV A;  3CP0 A;  4JI8 Q;  2F3V A;  5FJ8 H;  4DV1 Q;  1BNZ A;  1V9P A;  4YWK A;  1TS2 A;  4K14 A;  2KOL A;  1SSO A;  1JCK B;  2F03 A;  5IOC A;  1D2B A;  3O13 A;  1WFQ A;  1LUZ A;  1IL2 A;  4L8J A;  3N6R A;  2AHO B;  4KN4 C;  5C6A A;  3I4M H;  3GTK H;  3CME A;  3I91 A;  2PNH A;  2WP8 J;  1E2Z A;  1CA6 A;  4XYO A;  1SBB B;  3F2B A;  2KCT A;  2L15 A;  3GTL B;  2I46 A;  4FO2 A;  1STG A;  1JB3 A;  1ZKO A;  1L0Y B;  3W5O A;  2QKI C;  3A7A B;  4TVA B;  2QA4 A;  4B3S Q;  4B3R L;  4DR1 L;  4KMU C;  1SYE A;  5IOD A;  3T1Y L;  2B8F A;  3K5L A;  2I0Q A;  4A3I G;  1JOR A;  3DWQ A;  2JN4 A;  5ELB A;  1HFN A;  2ZJQ A;  1F2Z A;  4A3M G;  2A6E D;  1ET9 A;  1I4G A;  3NK9 A;  4LJZ C;  5C4J B;  2N3S A;  3ERS X;  2F0L A;  3PV0 A;  1LT4 D;  1CSQ A;  1PH3 A;  1KLG D;  1PYS B;  4DAM A;  1K8A C;  3S1Q B;  3CCS A;  2PI2 E;  3S1R B;  5EQ0 A;  1T5X D;  2RSO A;  4HR7 B;  2R92 H;  1DOK A;  4ZCK A;  1EY5 A;  2IT1 A;  1AW7 A;  2WAQ B;  4KI0 A;  4GLX A;  2PW7 A;  3HKZ B;  3S17 H;  1HZA A;  2QDB A;  2AWO A;  3H0G G;  3RZO H;  1K83 H;  2K5W A;  3FKI H;  2WB1 E;  4KY6 A;  1BCP D;  3CKI B;  4PZ8 A;  3GTM B;  1XNR L;  2Q8R E;  2ZM6 Q;  1KAA A;  1JWU D;  1X65 A;  3CCR A;  4GLA C;  4JOI A;  2ASB A;  3I4N G;  4JI3 L;  2PMZ B;  2F4V L;  2JJQ A;  2CKZ B;  3PUY A;  1X54 A;  2RA4 A;  4X3U A;  3GTP H;  1VQP A;  4B3T L;  2NBF A;  4IPG A;  2K50 A;  3AEV A;  2EY6 A;  3BU2 A;  3K6O A;  1X56 A;  1IBL L;  1FR3 A;  4QQB X;  5FKA C;  1QNK A;  1ROD A;  3F2D A;  4LF5 Q;  1VCI A;  3CCU A;  1C0A A;  1HA6 A;  1SE2 A;  5GQO A;  4LFA L;  1U4L A;  3I4L A;  1S5E D;  1LV9 A;  4KHP L;  1Q7Y C;  3CQZ B;  1BXT A;  1AE3 A;  1NY4 A;  3GTJ B;  3WDN A;  2B2V C;  4LF8 L;  2EPB A;  4MZ9 A;  4DK6 C;  1PH6 A;  2KUM A;  2PPB C;  5D65 A;  3M4Y A;  4PMC A;  2R7Z G;  4IUV A;  1SXT A;  2EOT A;  3NTI A;  3ER0 A;  2QDL A;  4A3D G;  1G2T A;  4ID6 A;  3TQY A;  4DUZ L;  2K6A A;  1D1I A;  2NVY B;  4RCO A;  2L11 A;  2GN5 A;  5IYD G;  2R7Z B;  5J22 A;  2FJ2 A;  4A3D B;  4IFD G;  2R6G A;  3K0X A;  1GUN A;  1BO0 A;  3ICE A;  4IOA A;  1BBW A;  3BYT B;  3UE0 A;  2Z6K C;  5HGQ A;  4QL5 A;  1KLU D;  3K0Y A;  5E3F A;  3LWU A;  1NTG A;  3HOU H;  1CUK A;  1F9Q A;  1O7I A;  2CFM A;  3NQT A;  3F2U A;  4JV5 Q;  5I9O A;  1CZG A;  1NBW A;  3GP7 A;  4QMG A;  1JE4 A;  1F2M A;  1UE7 A;  2XIW A;  4K6L A;  2EYH A;  1HQM C;  5F2D A;  3LGJ A;  5FOB B;  1N34 Q;  1VQL A;  5EPK A;  1EY7 A;  4BBR H;  2A68 D;  3HOY H;  3MC0 B;  3GTQ B;  5C5L A;  4HIK A;  3S2D H;  3S15 H;  4IUU A;  1N32 Q;  3A56 A;  1HA5 A;  1HTP A;  4YCW A;  5BN4 A;  1E24 A;  1KRS A;  5LMN W;  1DD2 A;  5C44 B;  4UDU C;  4KLK A;  3DMU A;  3ONA B;  4OHJ A;  4OWX B;  4RAU C;  3AFP A;  4X3T A;  1L0W A;  1EU3 A;  1SEB D;  2K75 A;  3QB3 A;  1E2V A;  2O5J C;  1QUQ B;  4CKB A;  4DNT B;  1SLJ A;  4P2C B;  4DR5 L;  4BBS G;  3QWN A;  2E2J H;  1K8O A;  3R93 A;  4G4K A;  3HGB A;  5IY0 A;  1NCV A;  4KN7 C;  3CHB D;  3MZ5 A;  4X65 L;  2G9H D;  3LX0 A;  4DV4 Q;  3S1M H;  4C3J H;  2AQ1 B;  1QZH A;  4EQ5 A;  2F0N A;  5KGU A;  4C3H G;  4KKT A;  5BN5 A;  2B63 G;  2EJM A;  1YNJ C;  1XMQ Q;  3IFT A;  4LF7 L;  2OTJ A;  1HR0 W;  5ELO A;  3OMC A;  1OXT A;  3CCQ A;  3GO5 A;  2HDM A;  2B63 B;  5LL6 X;  1NNX A;  2VY3 A;  1SNC A;  1STH A;  1RL2 A;  3D4D A;  4DV6 Q;  2O5I C;  2WAC A;  1MKH A;  3OTO Q;  3M3Y B;  1Y1V G;  4KD3 A;  4A4I A;  4LF4 L;  2F0T A;  3BDO A;  4FNF A;  5GRO A;  3G71 A;  3HRZ C;  3S16 H;  2IW3 A;  1KL9 A;  1TXY A;  2WKC A;  3HG9 A;  4DXG A;  3SHL A;  4DV2 L;  5E7N A;  2RVL A;  2WV6 D;  2Z0S A;  1II3 A;  1Y1V B;  4RGO S;  3KF8 B;  4JBJ A;  3PIP A;  3DWP A;  4ZKB B;  3CC7 A;  2HQL A;  3IFD A;  5C4X G;  4DNI A;  4P75 A;  4HJ9 A;  2WKD A;  4K5V A;  3U50 C;  1X6O A;  3OSO A;  3VA5 A;  2QEJ C;  5C4X B;  4DR3 L;  1D5X C;  2XNA C;  4LF9 L;  4IFD I;  2P5Z X;  4B3R Q;  1M8A A;  1VQM A;  1O7Y A;  4DR1 Q;  3T1Y Q;  3SDZ A;  2B2U A;  4GOP A;  3SK6 A;  4A93 H;  3B6Y A;  3MXU A;  1TWA B;  1LT6 D;  4FF2 A;  1MJE A;  4KKS A;  3K7A H;  4BY1 G;  2H5X A;  5JVH 3;  2ID0 A;  3J7A F;  1LT3 D;  5M9O A;  4KJO A;  2B2T C;  1IYV A;  4ZYS A;  1PH1 A;  1PH4 A;  2EJF C;  1N33 L;  2K7V A;  3PSI A;  3S24 A;  1JJG A;  5NUC A;  4ALP A;  1PRT C;  3QIA A;  4OON A;  4BY1 B;  2CQO A;  3TS0 A;  5IP9 H;  1I3Q B;  3NBI A;  2HHH L;  1DJR D;  3K5O A;  3VYU A;  2JEB I;  1GJX A;  4ME5 A;  4JK1 C;  1ESF A;  1SND A;  2CQA A;  3TN2 A;  3R8B A;  1PH9 A;  4ILW A;  5IT9 E;  4N9P A;  1SYC A;  2JXM B;  1XNR Q;  2A6H D;  1K9M C;  5IGG A;  4ZUJ A;  1PTO D;  2MFI A;  3KFU A;  4HID A;  1B50 A;  4JI3 Q;  1MHW C;  2F4V Q;  4O2D A;  3VDY A;  5EAY A;  1RHP A;  5L37 A;  4B3T Q;  2EIF A;  2OTL A;  2VB3 X;  2PI2 A;  1H9M A;  1IBL Q;  3RN5 A;  3NP8 A;  4A3K G;  4ZUI A;  2VS1 A;  1SYG A;  4DKA C;  4LFA Q;  2ZT9 C;  2IY5 B;  2WAQ E;  5JEA G;  4UAI A;  5IP7 G;  2EZV A;  1EIY B;  3D4R A;  1B9M A;  4KHP Q;  2K5N A;  3GTL H;  2NZO A;  3H6M A;  5H1S E;  1PZI D;  2F0S A;  4LF8 Q;  1CKN A;  4RFB A;  4IUN A;  4X62 L;  4G57 A;  5JJK A;  2HCI A;  2KEN A;  5BN3 A;  1VQ4 A;  5JJI A;  1J9O A;  4DPG A;  1HH2 P;  1KDB A;  2IX1 A;  2CHB D;  5DAU A;  2JA5 G;  2EYO A;  5KNC A;  4DUZ Q;  2PQA A;  3KK7 A;  2GVB A;  3A8I E;  3L2P A;  1HZB A;  4LK1 C;  4PMW A;  3K59 A;  1D5M C;  2EYM A;  5JAV A;  3G48 A;  4K5X A;  1YVC A;  3S1Q H;  3DLL A;  1AEX A;  1KTK A;  1PYW D;  3S1R H;  1A8V A;  5CYU A;  2J7Z A;  3D8G A;  3D3R A;  4EVO A;  2JE6 I;  3S9W A;  1G8Z D;  2ICE C;  3HOV B;  3Q24 A;  1V1P A;  5KIX A;  2AUK A;  1PV4 A;  2C35 B;  4MIU A;  3A54 A;  5I2Y A;  4TRD A;  4GLV B;  3SK8 A;  3GTM H;  4GKK L;  4I65 A;  1JMC A;  4HCS A;  1TWH B;  4QIW B;  3J7Y W;  1FVI A;  1WTQ A;  5I2X A;  1B4O A;  4O1N A;  5C3E G;  1S4Z A;  3OOC A;  2KJX A;  1PFN A;  2K32 A;  2OEO A;  1GHJ A;  4J1M A;  3GV3 A;  1WCM B;  4WJW A;  2HT1 A;  1VDZ A;  3ULP A;  3CXC A;  3M9B A;  3EVQ A;  1SRU A;  3BDL A;  1EQQ A;  1ICF B;  1VQ9 A;  4OO1 I;  4DR5 Q;  2Q2T A;  3CQZ H;  4LAA A;  5ELN A;  4HJ8 A;  3MXG A;  2EE1 A;  3QOL A;  3GTJ H;  3NTK A;  3G6J B;  5COY A;  4X65 Q;  1WD0 A;  2PO4 A;  1U0L A;  1R4Q B;  2B8G A;  3KDF A;  1KAB A;  2E2I B;  3H09 A;  1XTD A;  3OYY A;  4K2K A;  5M5W B;  3P20 A;  2HQE A;  4LUV A;  1S40 A;  1OXX K;  3KBX A;  5IYC H;  4F8M A;  2NVY H;  4LF7 Q;  1EZ8 A;  3CCE A;  5DLQ E;  2R7Z H;  1JOQ A;  2Q8T A;  2M9V A;  3VR5 A;  4LFB L;  4RA8 A;  4A3D H;  4FDB A;  1PTO B;  4FXK C;  2NVT H;  2Z1C A;  1F2Y A;  1J5E L;  3G6E A;  1C48 A;  2I5L X;  2NTS A;  3CMA A;  1I4R A;  3NXW A;  1O78 A;  5IYD H;  1Q12 A;  2JYO A;  4P72 A;  3J81 c;  3RLO A;  4LF4 Q;  3RNU A;  1JWS D;  1B53 A;  4QGU A;  1EWC A;  4JI7 L;  5I4D A;  1K8M A;  1GOZ A;  2NZH A;  4X64 L;  1KQS A;  4C2M B;  4DV2 Q;  4M1U B;  1DCZ A;  1H9S B;  1ZYR D;  5C0X G;  3BVZ A;  3C1F A;  2VUM G;  1KDC A;  1MI2 A;  3V05 A;  1AP0 A;  1U4M A;  2KHI A;  4A3E G;  1K73 C;  3GTQ H;  1KXL A;  1ENC A;  4WFN 3;  3J81 L;  1Q81 C;  2VUM B;  5C5M A;  4XTC S;  1VF5 C;  3L7Z C;  5C44 H;  3IKJ A;  1HCZ A;  4BY7 B;  4DR3 Q;  4XT3 B;  1QJO A;  3I7F A;  4LF9 Q;  3RLF A;  4FXG C;  1HUN A;  2X6G A;  4RWS C;  1K28 A;  4RGN A;  1CHQ D;  2RSN A;  5I6W A;  1VQH A;  1RIP A;  3I70 A;  1VS0 A;  1BDO A;  1M1K C;  4K0K L;  1X3F A;  3OPO A;  2D2C C;  3KJP A;  4HED A;  1VQF A;  1JE5 A;  3FP9 A;  5JPM C;  1SDF A;  1PXU A;  1N33 Q;  4K8J A;  2FHT A;  3BJU A;  2WFW A;  2BA1 A;  1X3P A;  3VR3 A;  2K05 A;  1AFP A;  3AU7 A;  2YV5 A;  3OIQ A;  3MFG A;  4NDX A;  2HHH Q;  1DZ1 A;  3HOZ B;  4DV0 L;  2OF1 A;  2JA7 G;  1FD7 D;  2L1B A;  3MFY A;  3J7Z C;  3NQI A;  2B63 H;  3T1H L;  4JBK A;  3M7G A;  1YHB A;  1EY4 A;  1R4P B;  3UDF A;  1OO9 B;  3E6Z X;  3M3Y H;  1B70 B;  3G7L A;  3C46 A;  3OHX C;  2OT2 A;  5IGD A;  2EY2 A;  1NAP A;  5IGC A;  4H7B A;  1BUV T;  3DM1 A;  1Y1V H;  2XN9 C;  1EIH A;  5IIF A;  3JAM c;  1BBU A;  2EXZ A;  4DK3 C;  4I7Z C;  1UEA B;  4R4C A;  4KHZ A;  3J7A V;  3UDX A;  1KNA A;  5EKK A;  4JI0 L;  2PW5 A;  2RHQ B;  2ALY B;  3RN2 A;  3I3C A;  1GUS A;  4A75 A;  3ND9 A;  4JI1 L;  4HMJ A;  2NN6 G;  5C4X H;  1DXM A;  4XQQ A;  2Z9H A;  1L1O A;  2PZW A;  3DM3 A;  3EQL C;  4AYB E;  4BS9 A;  4MN3 A;  5IE8 A;  1VQ6 A;  1FNU A;  2RF4 A;  2YTV A;  3JAM L;  1LM0 A;  3Q8D A;  3P7J A;  1WOC A;  4X62 Q;  3SXH A;  1JJC B;  3URY A;  1TWA H;  3TME A;  4B3M L;  4CGY B;  2TSS A;  4P71 A;  1WTV A;  5C0X I;  3MA2 B;  4IJL A;  2YTY A;  3LNN A;  5C3W A;  3RUZ A;  4J6H A;  4BY1 H;  5ELE A;  1YIJ A;  4IPD A;  4AQY L;  1E22 A;  4CDF C;  1QIL A;  4MHE A;  4OGQ C;  1PYB A;  4DXF A;  3RR5 A;  1I3Q H;  1NR2 A;  1ZXT A;  2KA7 A;  3PIP 3;  5LMU L;  3PIO 3;  5EJW A;  4A3I B;  2BH8 A;  4RGM A;  5LHY 1;  1PMR A;  4K5W A;  2ENB A;  1YIT A;  3A74 A;  3A5U A;  1SNM A;  4A3M B;  2BE5 D;  4POG A;  4GKK Q;  5J39 A;  3UDG A;  2PZT A;  3DWA A;  5HY6 A;  2PCF B;  2ZXO A;  5CBE E;  4A76 A;  1N9W A;  2OQK A;  2LFN A;  2KEC A;  4C56 C;  1V1Q A;  2CWA A;  3MWY W;  1MD2 D;  1RD9 D;  1NJI C;  4NKL A;  1Q46 A;  4Y52 H;  4ULL A;  4DUY L;  2PNR C;  2G9D A;  3H0G B;  3KF6 A;  3ND8 A;  4YIJ A;  4HJA A;  4QJF A;  2V4D A;  3CRK C;  5G3L D;  3BZD B;  5KND A;  2AKW B;  4O0A A;  1EY9 A;  1J8I A;  3SR1 A;  5C3X A;  3I4N B;  2LXK A;  4R4T A;  3I8Z A;  4R4O A;  5E4X A;  5JEA H;  1MJC A;  4S3S A;  1G2S A;  4I7A A;  4QIW E;  1Q1E A;  2ZJP A;  3C2P A;  3BYY B;  4DV3 L;  4IN3 A;  3Q6S A;  4CJ2 C;  1HZC A;  1YNX A;  4BXX H;  1ILQ A;  3CCL A;  3MVV A;  2HUG A;  2LXJ A;  2F0W A;  3J7A 5;  1U9R A;  4R8I A;  1KIX A;  2H1E A;  3M4O B;  1IYU A;  3JC6 6;  4LFB Q;  1ZEQ X;  2Z4H A;  5E1F A;  4QB4 A;  1LTI D;  2N49 A;  1J5E Q;  2EXD A;  3LWE A;  1PFM A;  4N9T A;  1WTO A;  3X3M A;  2B2V A;  3ULJ A;  1FJG L;  4JPB W;  2K33 A;  5A2Q E;  2NN6 I;  4JI7 Q;  2A1A A;  1TQO A;  3HP3 A;  4X64 Q;  3PO2 G;  3T51 B;  3HOV H;  1R9T B;  2NVT B;  2JQO A;  4LFC L;  2A6E C;  3EA6 A;  1RCV D;  2MO0 A;  1PZK D;  1VQC A;  3J80 E;  2C5C A;  2D5D A;  3J81 j;  1TWH H;  4M8A A;  3PO2 B;  4FVM A;  3M85 A;  2Y0S G;  3EBE A;  4A3L G;  4RG1 A;  2VB2 X;  1GHK A;  1B3Q A;  2CW0 D;  2Z6K A;  1I50 B;  1CA5 A;  1ILP A;  1HXY D;  1WCM H;  1QUQ A;  5GAD C;  4WJ3 M;  1FL0 A;  4CDC C;  2Y0S B;  1YHA A;  3K80 C;  4IZ8 A;  1SJH D;  4DFA A;  1GUG A;  2R7D A;  3VA7 A;  4IOC A;  4XT1 B;  3R2T A;  1BCP C;  2R93 G;  3Q23 A;  3GQB A;  4K0K Q;  4HAE A;  2HIX A;  1F2L A;  4XXE A;  5ELC A;  2VNU D;  4GNX C;  2XGT A;  2SDF A;  1X3E A;  2R93 B;  1D5Z C;  3P1H A;  4CKC A;  2E2I H;  1TWF B;  2ZXR A;  1CFM A;  5M5W H;  1HRJ A;  4J15 A;  4RGT A;  3HOW G;  2ES2 A;  3FPU B;  4L6T B;  4DV0 Q;  1KDA A;  4Q0F A;  4AIM A;  4YWM A;  3FVQ A;  1PTO H;  3STB D;  1KRT A;  3H91 A;  2EY5 A;  3T1H Q;  4BBS B;  2IL8 A;  4LUZ A;  3J80 c;  1A2U A;  1F77 A;  4FXD A;  3WOF A;  1NMG A;  2F0G A;  3CPF A;  4APV A;  2UU9 Q;  3U9S A;  2B2W C;  1BCP B;  4OIJ A;  4HN7 A;  5A2Q L;  4CJ1 B;  1C8C A;  3KF8 A;  3CRL C;  5GAG C;  1STY A;  4GN5 A;  4C2M H;  4GNX B;  4C3H B;  3OW7 A;  1U4R A;  2B2Y C;  2M2L A;  2Q2I A;  3ERO A;  5CV8 A;  2K4K A;  3J80 L;  1EY8 A;  2IHF A;  4Z9C B;  1HHV A;  3DEO A;  2M00 A;  4JI0 Q;  2VUM H;  2QGQ A;  3PUV A;  1LTL A;  1O7Z A;  4KK7 A;  3ZYY X;  5EKI A;  1VQO A;  2E2D C;  4JI1 Q;  1H9R A;  4BY7 H;  4DV7 L;  2EDG A;  3RMH A;  2L9H A;  1X3Q A;  2K03 A;  2B29 A;  4FP5 D;  2X6L A;  1K0R A;  3I56 A;  2LKV A;  1DGS A;  1UAP A;  2KEE A;  3TZD A;  2NVX B;  2K28 A;  4IUR A;  2B3G A;  2A68 C;  4B3M Q;  1STE A;  5GAH C;  2CCZ A;  1Z47 A;  2N88 A;  4XQJ A;  1O7L A;  1DOM A;  5EPJ A;  1BCP F;  2F0O A;  1GXD C;  4ZKC B;  5FLM G;  3U58 A;  5FJ8 G;  2JA6 G;  2QCP X;  1IZ6 A;  4DU9 A;  1GUT A;  4YHH L;  4AQY Q;  3PMF A;  4HCE A;  1E2W A;  2XSC A;  3FHW A;  4TQU S;  3GTO B;  4GZY C;  1UUP A;  2VQE L;  2JA6 B;  3HOZ H;  5KNB A;  4KV6 A;  1IW7 D;  4P74 A;  3GV6 A;  2LS0 1;  5LMU Q;  4NXM L;  3I4M G;  2A74 C;  5C4Z A;  2EQS A;  4QUC A;  1A15 A;  1YNN D;  2A69 D;  3RD4 A;  2PYK A;  2UUA L;  1YJW A;  1SE8 A;  3N52 A;  2JA7 H;  4N8X 1;  4JVZ A;  2B2T A;  1STN A;  2YYZ A;  4OO1 G;  5AFW A;  2MQH A;  1V8Q A;  4K8I A;  2D9U A;  3I2Z A;  3NE5 B;  4JBW A;  1W6K A;  2RKS A;  1A62 A;  4H44 C;  1VQB A;  1EU4 A;  3K58 A;  5CV6 A;  2GA4 B;  3E9H A;  1LTA D;  2Q2H A;  4LF6 L;  1JQY D;  3CCJ A;  2N78 A;  4DUY Q;  3TP5 A;  1HNW L;  4OWW B;  3T16 A;  4R4Q A;  3D31 A;  1D8L A;  1Y8N B;  5M3F G;  4OX9 L;  3M4P A;  1DOL A;  2I5H A;  1QVC A;  3VR6 A;  1VQ7 A;  1LYL A;  3PF5 A;  1L0X B;  4A3J G;  4XDX A;  4KD4 A;  2BCO A;  4LUO A;  1IBM L;  2R92 G;  4UP9 A;  4C3I G;  5DNF A;  5HUR A;  1A2T A;  3E3X A;  1NSN S;  3H94 A;  1N8R C;  2R7F A;  4DV3 Q;  2ZXP A;  2F0D A;  2MUY A;  4DR2 L;  3FKI G;  2KBN A;  4A3J B;  3PUZ A;  4C3I B;  3HKZ E;  4CJ0 B;  1A3T A;  5JJL A;  3W2D A;  1UE6 A;  1I4P A;  3QOJ A;  4L5Q A;  4V0B A;  4A3K B;  2QF7 A;  1IHZ A;  3E0J A;  3KLS A; 
#chains in the Genus database with same CATH homology
 4MNO A;  2IX0 A;  3L7Z C;  4DAM A;  1K8A C;  5C44 H;  3CCS A;  1S72 A;  1K8G A;  4DR3 Q;  1KAW A;  2PI2 E;  3TS2 A;  1B8A A;  1QVF A;  3I7F A;  4LF9 Q;  3RLF A;  3NEM A;  1SR3 A;  2PMZ E;  5M3M G;  1PA6 A;  1JB7 A;  2R92 H;  3PGZ A;  1FJG Q;  4IO9 A;  3H3V I;  2IT1 A;  4GLX A;  4KI0 A;  3F2C A;  4A3I H;  3S17 H;  1VQH A;  1HZA A;  1RIP A;  2AWO A;  3H0G G;  1K83 H;  3RZO H;  1Z9F A;  2AWN A;  1VS0 A;  1TWC H;  4DR7 L;  3FKI H;  2ZTE A;  1E1O A;  2WB1 E;  4AH6 A;  1M1K C;  1OTC A;  1X3F A;  4K0K L;  2MO1 A;  4PZ8 A;  3KJP A;  1XPU A;  2A19 A;  4LFC Q;  4A3M H;  4A3G H;  1WYD A;  1VQF A;  1JE5 A;  4EX5 A;  2ZM6 Q;  4A3E H;  3FP9 A;  1UE1 A;  1XPO A;  1IBK L;  3CAM A;  1XNR L;  4DR6 L;  4X6A H;  2KCM A;  1XPR A;  1YHQ A;  3RLN A;  1N33 Q;  1X65 A;  3CCR A;  4GLA C;  4JOI A;  2ASB A;  3I4N G;  4Y7N H;  4JI3 L;  3BJU A;  2WFW A;  1I94 L;  2UXB L;  2WB1 G;  2BA1 A;  1JT8 A;  1HZ9 A;  1Q8K A;  3L0O A;  2F4V L;  2JJQ A;  3CW2 C;  2CKZ B;  3PUY A;  1X54 A;  3GTP H;  1VQP A;  4B3T L;  4IPG A;  1KC8 C;  4NXN L;  2YV5 A;  2K50 A;  3AEV A;  2HHH Q;  3AYH B;  3BU2 A;  5LMN Q;  1X56 A;  4DV0 L;  2RHS B;  1IBL L;  4QQB X;  1V43 A;  1X3G A;  2JA7 G;  1HNZ Q;  3F2D A;  3J7Z C;  4LF5 Q;  1VCI A;  3CCU A;  1C0A A;  3H0G H;  2V1C C;  4R4I A;  5GQO A;  4LFA L;  2B63 H;  2UUC L;  3T1H L;  1HJP A;  4HIO A;  3F1Z A;  4JBK A;  3CCV A;  1YHB A;  4KHP L;  1Q7Y C;  3PIO A;  3UDF A;  1AE3 A;  2F52 A;  1VQG A;  4JI4 L;  3M3Y H;  1H95 A;  1B70 B;  1NY4 A;  3J81 i;  4IFD G;  3E0E A;  4LF8 L;  4WJ4 A;  4MZ9 A;  4DK6 C;  4JI5 L;  1PH6 A;  3I4N H;  4GOP C;  2JA8 H;  3TRZ A;  4A3C H;  3GDE A;  2R7Z G;  2NVQ H;  5BR8 Q;  2CWP A;  3ER0 A;  1SFO H;  4L5S A;  1Y1V H;  4A3D G;  2I5M X;  3TQY A;  3D0F A;  3W1G A;  1YZ6 A;  4DUZ L;  3JAM c;  1BBU A;  2JA9 A;  4DK3 C;  4H02 A;  5IYD G;  2GN5 A;  4R4C A;  4GN3 B;  4KHZ A;  3UDX A;  3STB C;  4JI0 L;  3M4O H;  3NEL A;  2RHQ B;  1B7Y B;  1EQR A;  2ALY B;  2R6G A;  3UE1 A;  3HOX G;  1W3S A;  3K0X A;  5IYB H;  3RN2 A;  5IWA L;  4A75 A;  3ICE A;  4IOA A;  1VQD A;  4UP8 A;  1BBW A;  4XTC S;  3PUX A;  2NN6 G;  4JI1 L;  3UE0 A;  3GTG H;  2Z6K C;  5C4X H;  5HGQ A;  1HR0 Q;  4QL5 A;  1L1O A;  4X66 L;  3DM3 A;  1PH7 A;  4AYB E;  4JI2 L;  1NTG A;  3HOU H;  1N36 Q;  5IE8 A;  1VQ6 A;  1CUK A;  3MXN B;  2RF4 A;  2YTV A;  4NB3 A;  1PH5 A;  1IXR A;  1O7I A;  2CFM A;  4JV5 Q;  1LM0 A;  1NMF A;  1XMO Q;  2GVA A;  3Q8D A;  4X62 Q;  1WOC A;  4GKJ L;  1NBW A;  1JJC B;  1TWA H;  1UE7 A;  2YU9 H;  1A0I A;  4B3M L;  4MTN A;  4GOP B;  2IHE A;  3LGJ A;  4P71 A;  4IPH A;  1GVP A;  4AYB G;  4BBR H;  1R9T H;  1X9N A;  1N34 Q;  1VQL A;  4UPA A;  1PH2 A;  1ASZ A;  3U4Z A;  3HOY H;  3I4O A;  1PH8 A;  2ZJR A;  5C0X I;  4HIK A;  4IJL A;  2YTY A;  3PO2 H;  3S2D H;  3S15 H;  3OW2 A;  1N32 Q;  5AJ3 Q;  2K14 A;  4YCW A;  5LMN W;  1E24 A;  1KRS A;  4BY1 H;  1EYG A;  1FGU A;  1YIJ A;  4IPD A;  4KLK A;  1I50 H;  4AQY L;  2OCE A;  1XNQ L;  1E22 A;  1I5F A;  3K81 C;  4DV7 Q;  1PYB A;  4JCV E;  2E8G A;  3RR5 A;  1I3Q H;  2K5V A;  4OWX B;  4JBM A;  2VQF L;  1L2F A;  4A3G G;  5LMU L;  1YBY A;  3AFP A;  4JI6 L;  1L0W A;  4YWL A;  2E5L Q;  2K75 A;  2BH8 A;  1QUQ B;  1SLJ A;  4HJ7 A;  1VQ5 A;  4YY3 Q;  4DR5 L;  4BBS G;  5M5X H;  3A74 A;  1YIT A;  3A5U A;  2E2J H;  1OXS C;  1OXV A;  1Q86 C;  4POG A;  4GKK Q;  1P16 A;  2DGY A;  5IY0 A;  4X65 L;  3UDG A;  1P8L A;  2VW9 A;  5HY6 A;  2R93 H;  4JI8 L;  4DV1 L;  4DV4 Q;  1HNX Q;  3S1M H;  4C3J H;  4A76 A;  1N9W A;  2JK8 A;  1TWF H;  2OQK A;  1VQ8 A;  4YHH Q;  1EOV A;  1QZH A;  4EQ5 A;  1T9H A;  1GO3 E;  2B63 G;  4L5R C;  4NPS A;  1V1Q A;  2CWA A;  1XMQ Q;  3S1N H;  4BXX G;  3JAM i;  4LF7 L;  2OTJ A;  1NJI C;  1HR0 W;  1UEB A;  1TWG H;  5ELO A;  1EWI A;  1OXT A;  4Y52 H;  1Q46 A;  4NXM Q;  4DUY L;  3CCQ A;  1SRO A;  3GO5 A;  3KF6 A;  2VY3 A;  2JA8 G;  4QY7 A;  4HJA A;  4QJF A;  3TEH B;  4BBS H;  4DV6 Q;  1CKM A;  1RL2 A;  1EFW A;  2AKW B;  1MKH A;  2UUA Q;  3OTO Q;  1Y1V G;  4A4I A;  4O0A A;  4LF4 L;  4B3R L;  4B3S L;  5C4J H;  5GRO A;  4LW1 A;  3G71 A;  4GN4 B;  2LXK A;  4R4T A;  5IT9 c;  4R4O A;  4HIM A;  3S16 H;  3ULL A;  4A3B H;  4JYA L;  4A93 G;  1KL9 A;  1TXY A;  1MJC A;  4QIW E;  4DV2 L;  1KD1 C;  5E7N A;  1Q1E A;  2ZJP A;  2UXC L;  2Z0S A;  4DV3 L;  1CKN B;  4C3H H;  3HOV G;  5IYB G;  3KF8 B;  4JBJ A;  1HZC A;  3PIP A;  1YNX A;  2FXQ A;  3PF4 A;  3CC7 A;  4BXX H;  2HQL A;  3CCL A;  5C4X G;  4DNI A;  2LXJ A;  3J7A 5;  4LF6 Q;  5JEA J;  1VQN A;  4P75 A;  4OWT B;  1KIX A;  3HOU G;  4DR4 Q;  5M5Y H;  2F3I A;  3JC6 6;  3G4S A;  4HJ9 A;  4LFB Q;  2PQA B;  2VZA A;  3KJO A;  1HNW Q;  3U50 C;  1X6O A;  2N49 A;  1X55 A;  1J5E Q;  4OX9 Q;  1UWV A;  2EXD A;  4DR3 L;  4LF9 L;  1WCM G;  2VL6 A;  1YI2 A;  4IFD I;  4BBR G;  3ULJ A;  1FJG L;  1VQM A;  4B3R Q;  3M7N A;  4DR1 Q;  3PUW A;  3HOY G;  3T1Y Q;  3PO3 H;  4GOP A;  4A93 H;  2NN6 I;  3CPW A;  2A1A A;  4JI7 Q;  1YJN A;  3B6Y A;  1UE5 A;  4DAY B;  4X64 Q;  2JEA I;  3PO2 G;  2Y0S E;  2NVX H;  3HOV H;  2D62 A;  1MJE A;  4DR2 Q;  2UUB Q;  3E9I A;  2JQO A;  4A3F H;  4LFC L;  3K7A H;  4R1J A;  4BY1 G;  3I55 A;  2H5X A;  4DV5 Q;  2ID0 A;  2UXD Q;  4PG3 A;  2MO0 A;  2ZM6 L;  1VQC A;  1G6P A;  3J81 j;  1PH1 A;  1PH4 A;  1N33 L;  1TWH H;  1K3R A;  3AQQ A;  3PSI A;  4PZ6 A;  3S24 A;  1XJV A;  1JJG A;  4ME3 A;  4ALP A;  3M85 A;  2Y0S G;  3EBE A;  4A3L G;  4LWC A;  4OON A;  1C9O A;  2CQO A;  4RG1 A;  3K7U C;  1CKO A;  3TS0 A;  1GM5 A;  4XIG S;  3CC4 A;  2Z6K A;  3HFZ B;  5IP9 H;  1WCM H;  3NBH B;  1QUQ A;  3GTO H;  1M90 C;  5GAD C;  2HHH L;  1PVO A;  4WJ3 M;  1FL0 A;  5LMN L;  5FLM H;  2JA6 H;  1YHA A;  3K80 C;  2JEB I;  1J6Q A;  4IJH A;  1HNZ L;  4LF5 L;  2R7D A;  4IOC A;  4YCU A;  2R93 G;  1OXU A;  4DR7 Q;  1WI5 A;  2XTI A;  1PH9 A;  4K0K Q;  2HIX A;  1Y14 B;  1JJ2 A;  1CSP A;  3MEF A;  3EN2 A;  4JG2 A;  3KOJ A;  2VNU D;  1XNR Q;  2OQ0 A;  4GNX C;  1IBK Q;  2XGT A;  4DR6 Q;  1VQJ A;  1K9M C;  2QEX A;  1X3E A;  1PFS A;  2MFI A;  2E2I H;  3KFU A;  4HID A;  4A3L H;  4JI3 Q;  1I94 Q;  1SN8 A;  2UXB Q;  5BR8 L;  1QZG A;  2DUD A;  2F4V Q;  3CF5 A;  4O2D A;  1VQA A;  4PZ7 A;  3VDY A;  1Q82 C;  5M5W H;  3KDF B;  5EAY A;  4B3T Q;  2EIF A;  4NXN Q;  4J15 A;  3HOW G;  2OTL A;  2ES2 A;  1L1O B;  2PI2 A;  3EIV A;  1E7Z A;  1IBL Q;  4DV0 Q;  3RN5 A;  4A3K G;  4AIM A;  4YWM A;  4POF A;  2OWO A;  3STB D;  1KRT A;  2VS1 A;  1U5K A;  1VQK A;  4OXP A;  4UY8 C;  4DKA C;  4A3B G;  4LFA Q;  2IY5 B;  2UUC Q;  3T1H Q;  2WAQ E;  4LUZ A;  5JEA G;  3J80 c;  5IP7 G;  1EIY B;  5FLX c;  1HR0 L;  4KHP Q;  1NMG A;  2K5N A;  4BY7 G;  3CPF A;  1KHI A;  2NZO A;  1EIF A;  4APV A;  2UU9 Q;  3GTL H;  5H1S E;  4JI4 Q;  1N36 L;  3W1B A;  4RMF A;  4LF8 Q;  1CKN A;  2MNA A;  4JI5 Q;  3H15 A;  3ZJY C;  4JV5 L;  2VQE Q;  4BA1 I;  5M3F H;  3WWV A;  1XMO L;  2BA0 A;  4X62 L;  5JJK A;  2WAQ G;  4L5T A;  5GAG C;  1AH9 A;  2K5H A;  2KEN A;  3HKZ G;  4GN5 A;  4C2M H;  4GNX B;  1VQ4 A;  1GD7 A;  4A3J H;  1E3P A;  1EUJ A;  4DPG A;  1N34 L;  1HH2 P;  2IX1 A;  5JJI A;  3GD7 A;  4A3C G;  3BZK A;  4UP7 A;  2Q2I A;  4C3I H;  2JA5 G;  4DUZ Q;  3HOW H;  2PQA A;  2K4K A;  2GVB A;  2IHF A;  3L2P A;  1HZB A;  3NEN A;  4PMW A;  4IPC A;  4A3K H;  4JI0 Q;  4JOI C;  2VUM H;  2QGQ A;  3PUV A;  3UDI A;  1N32 L;  1LTL A;  3G48 A;  5AJ3 L;  1VQI A;  1Y1W H;  3TRE A;  1VQO A;  1W2B A;  3PO3 G;  1YJ9 A;  3U4V A;  1WJJ A;  5IWA Q;  5IP7 H;  1YVC A;  2BH2 A;  3M4Q A;  4JI1 Q;  3S1Q H;  3S2H H;  1ASY A;  4BY7 H;  5K36 G;  3HKS A;  1G29 1;  4DV7 L;  4X66 Q;  3A0J A;  3S1R H;  1A8V A;  2N8N A;  4JI2 Q;  3CCM A;  4LNQ A;  2B29 A;  5C0X J;  4A3F G;  3CD6 A;  3HOZ G;  2K52 A;  2E5L L;  1K0R A;  3A5Z B;  2JE6 I;  3I56 A;  3AFQ A;  4GKJ Q;  1DGS A;  4YY3 L;  2D0P A;  5GAE C;  2AMC B;  2B3G A;  2ZTC A;  1QVG A;  4B3M Q;  1C7Y A;  3PCO B;  5M3M H;  3CC2 A;  2JA5 H;  1IYJ B;  3BZC A;  1PV4 A;  2C35 B;  5GAH C;  3GTM H;  1I6H H;  4GLV B;  2CCZ A;  1Z47 A;  4GKK L;  3KYH C;  1JMC A;  1E1T A;  5IP9 G;  4P73 A;  3KLW A;  1SMX A;  1HNX L;  1FVI A;  4DV4 L;  1IBM Q;  2JA6 G;  5FLM G;  2KHJ A;  5C3E G;  5FJ8 G;  3U58 A;  1IZ6 A;  4YHH L;  3H3V H;  2UU9 L;  1BKB A;  3KF6 B;  1BVS A;  3SGI A;  4AQY Q;  2Q2U A;  4GS3 A;  1XNQ Q;  1XMQ L;  3FHW A;  4TQU S;  3F8T A;  4JC0 A;  2HT1 A;  5IYC G;  3ULP A;  2VQE L;  3RZD H;  3HOZ H;  3CXC A;  3M9B A;  4P74 A;  2VQF Q;  1Q1B A;  5LMU Q;  3IRB A;  4JI6 Q;  4NXM L;  3I4M G;  1SRU A;  2YTX A;  2EQS A;  1EQQ A;  4HJ5 A;  1A63 A;  1VQ9 A;  4OO1 I;  4DV6 L;  4DR5 Q;  1AE2 A;  1S3O A;  2Q2T A;  1YEZ A;  3CQZ H;  1L1O C;  5ELN A;  3J80 i;  1SE8 A;  3OTO L;  1YJW A;  2UUA L;  4HJ8 A;  2ATW A;  5J3B A;  2JA7 H;  3GTJ H;  2E2H H;  2RCN A;  1GKH A;  4X65 Q;  2YYZ A;  4YCV A;  4BA2 I;  4OO1 G;  2MQH A;  3CP0 A;  1U0L A;  4JI8 Q;  3KDF A;  5FJ8 H;  5C3E H;  4DV1 Q;  1V9P A;  3I2Z A;  2HIV A;  4JBW A;  1XTD A;  4YWK A;  1A62 A;  3OYY A;  3K8A A;  1VQB A;  4LUV A;  1S40 A;  1OXX K;  5IYC H;  1PHJ A;  2NVY H;  1WFQ A;  3E9H A;  1LUZ A;  1IL2 A;  4LF7 Q;  2Q2H A;  2AHO B;  3CCE A;  4LF6 L;  5DLQ E;  2R7Z H;  4DR4 L;  3I4M H;  3GTK H;  3CME A;  2N78 A;  3CCJ A;  4LFB L;  4A3D H;  4FDB A;  4DUY Q;  2PNH A;  2WP8 J;  1HNW L;  4OWW B;  2NVT H;  1VQE A;  4R4Q A;  3D31 A;  1D8L A;  5M3F G;  3G6E A;  1J5E L;  3F2B A;  2I5L X;  4OX9 L;  3M4P A;  3CMA A;  2KCT A;  5C44 G;  5IYD H;  2I5H A;  2L15 A;  1Q12 A;  1QVC A;  4P72 A;  3J81 c;  1VQ7 A;  1LYL A;  3RLO A;  3PF5 A;  4A3J G;  4LF4 Q;  3W5O A;  4LUO A;  4TVA B;  4GNX A;  2QA4 A;  3RNU A;  1IBM L;  4UP9 A;  4DR1 L;  4B3S Q;  4QGU A;  3T1Y L;  2R92 G;  3HOX H;  4JI7 L;  4JYA Q;  1G51 A;  2I0Q A;  2NZH A;  4X64 L;  1N8R C;  4A3I G;  1KQS A;  4DV2 Q;  2VUM G;  5C0X G;  2R7F A;  2UXC Q;  4DV3 Q;  4DR2 L;  2UUB L;  3FKI G;  2KBN A;  1NE3 A;  2D0O A;  1Y1W G;  2UXD L;  4DV5 L;  2ZJQ A;  3PUZ A;  3HKZ E;  4A3M G;  4IFD J;  1D7Q A;  2KHI A;  5JJL A;  4A3E G;  1K73 C;  3GTQ H;  3S14 H;  1UE6 A;  2ZTD A;  1KXL A;  1MIU A;  4L5Q A;  1Q81 C;  2N3S A;  3ERS X;  3PV0 A;  2A8V A;  1CSQ A;  2LSS A;  1PH3 A;  3DLL A;  1PYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...