4DV1L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1L00
1LM0A 4B3TQ 2YYZA 2VQEL 1PA6A 4JBKA 3HOYG 4B3SL 1VQ6A 2ASBA 2Q2UA 3RR5A 3PIOA 1X6OA 3KFUA 2AWOA 1IZ6A 4DUYQ 2WB1G 3I4MH 2V1CC 5GQOA 3S1NH 3STBD 5BR8Q 2E5LL 1N9WA 3F2CA 1EWIA 1PFSA 2L15A 3E9HA 2VQEQ 2HT1A 2F4VL 4B3SQ 3H0GG 3PUXA 1NMFA 3U4ZA 1VQOA 1YJ9A 4GNXC 1WI5A 4GOPC 4R4OA 2ATWA 5IYDH 2RHSB 4JI1L 4YCWA 3NEMA 1V1QA 4DR7Q 1B7YB 3EN2A 3RN5A 4MZ9A 1C9OA 2ID0A 4L5QA 4AQYL 2E5LQ 4LF8L 5M3FH 2WAQE 4IPHA 1BBUA 3S15H 1GO3E 4DV2L 2ZTEA 1XMQQ 1HR0W 2K14A 1Y1WH 3GO5A 2KCMA 2IHEA 4TQUS 4AYBE 4DR4L 2KHJA 4QIWE 2PQAB 4YWMA 4X62Q 1PH7A 4JI7L 3S14H 3PV0A 1JT8A 1JB7A 1C7YA 2UXCL 4LF8Q 4EX5A 1VQJA 4DAMA 4BBRG 4DV2Q 1QZHA 1KHIA 1N36L 4JI8L 1QVFA 1V43A 2Q2HA 2JA6G 4NXNL 4DR4Q 2R92G 3A5ZB 2JA5H 4O2DA 4NPSA 2AMCB 4C3JH 4JBWA 4OO1I 4X64L 3CC7A 1X56A 1YJNA 1R9TH 1GKHA 3M85A 3HOVH 3HOXH 3AQQA 4K0KL 3UDXA 1N36Q 4DNIA 1IL2A 5M3MG 4AH6A 4NXNQ 3PIPA 4WJ3M 4LW1A 4LFAQ 3L7ZC 4MTNA 5J3BA 4LFCL 3FHWA 1AH9A 4X64Q 2R7ZH 1WCMH 2JA9A 1FJGQ 5FJ8G 1XJVA 3CCVA 5IP7G 4NXMQ 1KD1C 4HJ8A 1CSPA 1OXTA 4L5SA 3HOYH 2Q2IA 3A0JA 1VQ5A 4A93G 4DV5Q 3CQZH 4HJ9A 3GTLH 3S2DH 2OTJA 3PUVA 2Y0SE 3K8AA 2A1AA 4JBJA 3F2DA 4L5RC 1XNRQ 3PO3G 5K36G 4A3IG 1EOVA 4A3MH 4P74A 3K0XA 4DAYB 3TRZA 1NY4A 3GTMH 1MJEA 4P73A 4QJFA 3H0GH 5GAGC 2NVTH 3UDGA 3A74A 2ZTDA 2UUBQ 2WFWA 1CKNB 1O7IA 2RF4A 1S3OA 2VS1A 5IP9G 2D0OA 2GVAA 5IT9c 4BY1G 1SRUA 5GROA 4C3IH 2N49A 3CC2A 4DK6C 2JA7G 1C0AA 1SMXA 3TEHB 3I7FA 3CMAA 1E7ZA 1VQLA 3CCJA 4IPDA 1EQQA 3S17H 3M4OH 4DV7Q 2ZJQA 3GDEA 4A4IA 2UXDQ 5IYBG 2ES2A 1G51A 3CAMA 1QUQB 3W1BA 1HNWL 4BA1I 2MNAA 4BBRH 1E24A 1OXUA 2K5NA 3UDIA 2IX1A 4LFBQ 4DUZL 2JA6H 2R92H 3HKZG 4PZ8A 1XMOL 1PH4A 3I55A 3KDFB 4IJHA 2JQOA 5H1SE 4YWLA 1HNWQ 4DV3L 1K83H 1BVSA 4A3KG 4B3ML 4LUOA 4YY3Q 1PYSB 2LXKA 1V9PA 1NJIC 5M3MH 1CSQA 4FDBA 3J81i 2QA4A 3GTGH 1XMOQ 1Y1VG 4X66L 2YV5A 4DK3C 4DV6Q 2IT1A 1A63A 5JJKA 2MO0A 1N33Q 4LF6L 2CWPA 4UP9A 5FJ8H 1YIJA 5ELNA 3J81c 5IP7H 4DR2L 1K3RA 3BZCA 1IBML 4B3MQ 4JYAL 1YBYA 5LMUL 1PVOA 1UE6A 4A93H 1CKOA 4DR3L 2UU9L 4GKJQ 3CCSA 1CKNA 3K7AH 4X66Q 5C44G 4B3RL 1A0IA 4A3EG 1P8LA 4JBMA 3I4OA 1X55A 3OTOQ 3PO3H 1YNXA 1EYGA 4JV5Q 1XTDA 3CF5A 4HIKA 1KQSA 3AYHB 3E0EA 4DR2Q 4DR5L 3KF6A 3U50C 2QGQA 1XNQQ 4JYAQ 3MEFA 2DGYA 4IJLA 4R4QA 2UXBL 3CCEA 4HJAA 4PG3A 3HKSA 1VQ9A 2HQLA 4JOIC 3D31A 3GTKH 4LF7Q 4JI5L 4B3RQ 4P71A 3PF5A 1Q7YC 1WOCA 1LUZA 4AYBG 3ULLA 1YVCA 2VW9A 3DLLA 4A3MG 2MO1A 1QUQA 2WP8J 5IP9H 5C0XJ 4BY1H 3CPWA 1YITA 4H02A 2JA7H 2BH2A 1HZAA 4IPCA 1VQPA 2GVBA 1PH3A 4XIGS 2HIVA 1Q12A 1KIXA 4NB3A 3HOUG 3UDFA 4UP8A 5C4JH 5LMNL 3KDFA 2CQOA 1X54A 3NELA 1D8LA 3PGZA 5IYCG 1S72A 2C35B 1HZBA 1I50H 5IYBH 2F4VQ 2MFIA 3H15A 1S40A 4QL5A 3STBC 1ASZA 3HOZH 3CP0A 2R93G 3AEVA 1Z47A 2I5HA 4OWWB 1VQEA 3F8TA 4JI1Q 4A3FG 5LMNQ 3Q8DA 3K80C 4AQYQ 4JCVE 2E2HH 2ZJPA 2B63G 2I0QA 4GN3B 4PMWA 4A3KH 1I3QH 3S24A 4LUVA 2A8VA 3TQYA 4YHHL 1VS0A 3CCLA 3JAMi 4KHZA 4A75A 1IBKL 4JI7Q 1G291 2I5MX 1RIPA 3PUZA 4JI0L 1Y1VH 2JK8A 4L5TA 4R1JA 4OONA 2DUDA 4APVA 1Q81C 1N34L 2VUMG 1VQFA 4JC0A 2UXCQ 1E1TA 4OX9L 3JAMc 1WJJA 2OQKA 2WB1E 4JI8Q 3NENA 4EQ5A 4IFDJ 3MXNB 1Q46A 4QY7A 3S16H 1PH9A 4GLVB 1EFWA 1TWGH 3GTJH 5E7NA 3F2BA 3L2PA 5C44H 2CFMA 4YWKA 4A3EH 1N34Q 5JJLA 3S2HH 1BKBA 4A3BG 4BBSG 4K0KQ 2ZM6L 3W5OA 1ASYA 3BU2A 1MIUA 4HJ7A 4MNOA 4LFCQ 2YTYA 1L2FA 1YEZA 3CCQA 2EXDA 4DV0L 1IBLL 3J7A5 5LMNW 4JG2A 2E2IH 4IO9A 2NN6G 3ULPA 2ZM6Q 1J5EL 2EQSA 4A3JG 3F1ZA 5GAEC 2IY5B 2PQAA 2JJQA 3HFZB 2BA0A 1KRSA 3HOUH 2AHOB 4C3HH 2RHQB 4ALPA 5JJIA 1T9HA 1VQMA 1EQRA 5IYCH 1E22A 1UE1A 2D62A 4JI3L 1CUKA 3ULJA 3CMEA 4DR1L 1PH8A 2OTLA 2BH8A 3KLWA 3CCMA 5HY6A 1J5EQ 4BA2I 2VY3A 2R93H 3S1RH 2VQFL 1E3PA 4LWCA 4A3FH 4DV4L 4AIMA 2I5LX 1PH2A 5JEAJ 2JEBI 1QVGA 4YCUA 1VQ8A 1AE2A 4PZ7A 5IY0A 4DV1L 3T1YL 1A62A 2B63H 1VQNA 3HOZG 1EIFA 2IHFA 1YHBA 4P72A 1RL2A 2VL6A 1PH1A 1VQ7A 3UE1A 3GTPH 1W2BA 3J80i 1KC8C 2AWNA 1GD7A 1UE7A 2VUMH 1Q82C 1UE5A 1X3GA 1XPRA 2MQHA 2R7DA 3T1YQ 1X3EA 1YHQA 1JMCA 3HOWG 1SROA 5ELOA 2LXJA 3J80c 2RCNA 4LF4L 3M9BA 4IPGA 2KCTA 2PNHA 4X65L 2ZJRA 1U5KA 3RN2A 4DUZQ 1KL9A 3TS0A 1SLJA 4JOIA 4LUZA 5IWAL 1OTCA 3PF4A 1IYJB 4LF9L 3G48A 1MJCA 3CPFA 5M5XH 2E8GA 3BJUA 4DV3Q 4R4IA 3ICEA 4A3BH 4BBSH 1VQGA 4LF4Q 1I6HH 1DGSA 3RLNA 4POFA 3RNUA 3I2ZA 4X65Q 3PO2G 5M5WH 4TVAB 2NVXH 1A8VA 3GD7A 4POGA 1M1KC 1QVCA 5FLMG 1FVIA 4JI6L 3M7NA 3S1MH 2HHHL 1VQIA 1L0WA 2D0PA 4LF6Q 3FKIG 1PH6A 1IBMQ 2NN6I 3T1HL 5LMUQ 1L1OB 4GS3A 4DR3Q 1P16A 3LGJA 1YHAA 2WAQG 4P75A 4A3JH 2UU9Q 2UUAL 4GKKL 4ME3A 4LF5L 3ZJYC 5M5YH 2XGTA 4B3TL 3G71A 4R4TA 3CCRA 4RG1A 4DR6L 3I4NG 3FP9A 2XTIA 4DR5Q 2JEAI 2NVYH 3HKZE 3T1HQ 3PUYA 4A3GG 2UXBQ 2R7FA 1JJCB 1E1OA 4LF5Q 3B6YA 2F3IA 4JI5Q 4GKKQ 3KJPA 1N8RC 2N8NA 3AFPA 1Q1BA 2Z0SA 4GN4B 5BR8L 4DR6Q 4PZ6A 4HIDA 3ER0A 2QEXA 3J81j 1G6PA 1TWCH 4Y52H 2A19A 4YCVA 4KHPL 2CCZA 1W3SA 4J15A 1OXSC 4C2MH 4A3DH 4OXPA 3WWVA 2YU9H 1K73C 4QGUA 1KXLA 3W1GA 4DR7L 1OXVA 4A3LG 5GAHC 4A3CG 1VQBA 2K4KA 3M3YH 3HOWH 1XMQL 2NZOA 4KHPQ 1LYLA 2K5VA 4DPGA 4IOCA 3OW2A 1Q8KA 4X62L 1VQCA 2VNUD 1YZ6A 2KENA 5C0XG 2KBNA 3G4SA 1Z9FA 3K81C 1HJPA 1HNZL 3S1QH 2Y0SG 3PUWA 3L0OA 5AJ3L 3UE0A 1L1OA 3PO2H 4XTCS 3NBHB 4YHHQ 1PV4A 1NMGA 3BZKA 1PYBA 1IBKQ 1EIYB 4JI0Q 4BY7G 2B29A 5FLMH 1K8GA 1HNZQ 2JA8G 1YJWA 2N78A 3KOJA 4O0AA 4HIMA 4UPAA 4OX9Q 5AJ3Q 1NTGA 3FKIH 2K50A 1PH5A 5C3EG 1Q1EA 1VQAA 4UP7A 3EBEA 1TWAH 5FLXc 1MKHA 2N3SA 5EAYA 4LFAL 1UEBA 1TXYA 2EIFA 2BA1A 4DKAC 4BXXG 1OXXK 4QQBX 5DLQE 1K9MC 2Z6KA 2OWOA 1HZ9A 2IX0A 1I5FA 1KAWA 1B8AA 1VQDA 2B3GA 1FJGL 2YTVA 4NXML 3CCUA 3CD6A 3I4NH 1TWFH 1VQKA 1U0LA 1GM5A 2HIXA 1SFOH 1L1OC 4DV5L 4A3GH 3K7UC 2PI2E 1HH2P 3G6EA 1UWVA 2FXQA 1SN8A 1AE3A 4GLAC 3KJOA 4UY8C 1XNRL 2LSSA 4DV0Q 3U58A 1QZGA 1IBLQ 3ERSX 3AFQA 3CC4A 3RLOA 2PMZE 3I56A 1IXRA 4GLXA 4IFDG 4WJ4A 1Q86C 2NZHA 3D0FA 3GTOH 3KF8B 2UUBL 3CXCA 5C4XG 1EUJA 3U4VA 3KYHC 3A5UA 2Z6KC 2ZTCA 2E2JH 3M4PA 1PHJA 4A3LH 4R4CA 4JI3Q 4DR1Q 1K0RA 4A3CH 1H95A 1J6QA 1JJGA 2JE6I 2ALYB 2R6GA 3RLFA 1GVPA 1VQ4A 1WYDA 1VCIA 2OQ0A 1FGUA 4GNXB 4GOPB 2VQFQ 1K8AC 1HNXL 2Q2TA 3GTQH 3I4MG 4DV7L 1B70B 3RZOH 1D7QA 1KRTA 4DV4Q 4Y7NH 3PSIA 4KLKA 3TS2A 2UXDL 5C0XI 2NVQH 4DV1Q 2F52A 1FL0A 2H5XA 3KF6B 4HIOA 1JE5A 3H3VH 3J7ZC 1SR3A 4OWXB 4A76A 3H3VI 4LFBL 1YI2A 5IYDG 1HNXQ 1NE3A 2VZAA 2K5HA 5HGQA 1I94L 4JI2L 1X9NA 4BY7H 4A3DG 2JA8H 5M3FG 1VQHA 3CW2C 2K75A 3RZDH 1X3FA 3SGIA 1Y1WG 4YY3L 3E9IA 2K52A 5C3EH 3EIVA 2YTXA 4X6AH 4LNQA 1Y14B 5IWAQ 1I94Q 2UUCL 1XPUA 4IOAA 4BXXH 4JI2Q 3VDYA 1BBWA 5JEAG 4DV6L 4LF9Q 2KHIA 4HJ5A 1M90C 2CKZB 1XPOA 1JJ2A 3IRBA 1CKMA 1N33L 3JC66 4OWTB 1HR0L 1NBWA 1X65A 1HZCA 1TWHH 5GADC 4GKJL 2JA5G 4OO1G 2UUCQ 1N32L 1LTLA 2PI2A 3OYYA 4JI6Q 2GN5A 3OTOL 4JI4L 2HHHQ 4JV5L 2AKWB 5IE8A 1HR0Q 3PCOB 3HOXG 3HOVG 1XNQL 2OCEA 4IFDI 3M4QA 4GNXA 4GN5A 4GOPA 1N32Q 3TREA 1SE8A 3DM3A 4KI0A 5C4XH 4DUYL 2UUAQ 4LF7L 1WFQA 4RMFA 1WCMG 2R7ZG 2CWAA 4JI4Q 4A3IH
chains in the Genus database with same CATH superfamily
4B3TQ 1QILA 1TWCB 1LO5D 4B3SL 3L9AX 1VQ6A 1X6OA 1B3AA 2Q8RE 3G7LA 2OF1A 1B44D 2F0OA 3NSWA 2WB1G 2V1CC 1SYFA 3S1NH 3HG9A 2E2HB 5BR8Q 3F2CA 2CH4A 1EWIA 2L15A 2HT1A 3PUXA 3DEOA 2ATWA 2F3VA 4KY7A 3P1HA 2WV6D 1V1QA 5K5PA 1STEA 3RN5A 4AQYL 1PMRA 4C3IG 1BBUA 2F0DA 2QDLA 1F2YA 2ZTEA 3VR4A 3VYTA 2K14A 1TS5A 1XMQQ 2KCMA 1SNCA 4TQUS 4FO2A 3VR5A 1SAPA 5D65A 1E2WA 4PMCA 3PV0A 4RHRA 4LF8Q 1XWEA 1AN8A 4DK0A 1AP0A 3BVZA 1J8IA 1PRTB 3UI2A 1PYWD 1D5ZC 3KUPA 2AMCB 2I46A 4JBWA 1SJHD 2XNAC 5CORA 3HOVH 1AEXA 3AQQA 3UDXA 1N36Q 3CHBD 1R4QB 2PZTA 4AH6A 4LFAQ 3L7ZC 1AH9A 1PDQA 2K28A 4XDXA 2SNSA 2R7ZH 1FJGQ 1E2ZA 4CDEC 3NE5B 1I6VC 2VB3X 4HJ8A 1CSPA 2FMMA 1D5MC 3HGBA 3HOYH 1S5DD 4A93G 4K2KA 2R93B 3CQZH 1Q8IA 3K8AA 4JBJA 3F2DA 3TSSA 3K0XA 4DAYB 3K5NA 1F9QA 1MJEA 3A7AB 4QJFA 5GAGC 1LABA 3NBHA 2UUBQ 2ENBA 2J4XA 2F03A 3KLSA 1LTSD 2VS1A 2D0OA 1HFGA 2GVAA 3MC0B 5IT9c 2NB0A 1KDAA 1XXGA 2CW0C 2JP1A 4B9XA 3I7FA 1WTRA 1E7ZA 4FVMA 3SK8A 2ZJQA 1EU4A 3GDEA 3CAMA 1HNWL 4BBRH 2K5NA 3BG3A 4ZK9B 5IT9L 4LFBQ 2EY1A 3I73A 4JVZA 2JA6H 3T13A 1WVLA 3HKZG 1WTVA 4DV3L 5IGBA 3TMEA 4WJWA 4YY3Q 1PYSB 3ITPA 1GJXA 1V9PA 1NJIC 1Q3LA 1CFMA 2QA4A 3J81i 3GTGH 2XRSD 2A69C 5M5YB 1A63A 1LTAD 1KAAA 2K03A 2VXWA 1AZPA 1LTBD 1E0BA 3J81c 2GA4B 5LMUL 2N55A 5C4XB 2UU9L 1VDZA 1CKNA 2MGSA 3I4LA 1I4QA 1X55A 5K36H 3PO3H 2N88A 1XTDA 4ZAIA 4HIKA 3AYHB 4HSVA 1YNJD 2F0MA 4DR5L 2QGQA 4HCSA 4JYAQ 2QKIC 2B2VC 1LT3D 1Y69U 1GUNA 3J81L 3T51B 4JI5L 4NP5A 3S1NB 3PF5A 1LLRD 3ULLA 2VW9A 5IP9H 5T1IA 1STGA 2QW7A 2K01A 1JOOA 1DYQA 4M1UB 1ENCA 5C4JH 2CQOA 5IYCG 2F4VQ 5KNDA 3H15A 2EYPA 3Q6SA 4QL5A 1K3BC 3HOZH 1DONA 1Z47A 3GV3A 4OWWB 1VQEA 4JI1Q 5LMNQ 1XX8A 3X3NA 2B63G 2I0QA 3DHQA 1A6XA 5FK9C 1WD0A 5FO7B 4KHZA 5CBEE 4A75A 2WKDA 2I5MX 1GXDC 5JJZA 3PUZA 3U9OA 4JI7Q 1Y1VH 4L5TA 4R1JA 4FNFA 1CI3M 3MWYW 1Q81C 2VUMG 3HOVB 2UXCQ 3IFTA 4OX9L 4RH6A 4JI8Q 4QY7A 4U673 1BF4A 1BCPD 3S16H 1TWGH 2R7ZB 3GTJH 3I3CA 1EYDA 1HA6A 2ICIA 4V0BA 4JW0A 1BKBA 1O78A 4ULLA 2LS01 3CQZB 2ZM6L 2Z4IA 2RCFA 3QJYA 4CDDC 4LFCQ 2YTYA 3P7JA 2E2JB 5JPMC 4IO9A 3CRKC 5D3DA 4A3JG 5IGGA 3GTQB 1D6EC 2BA0A 1KRSA 4IUUA 3HOUH 1JOQA 4ALPA 1I4RA 5JJIA 2K6AA 1T9HA 1VQMA 1E22A 2D62A 3CMEA 3J80E 3CCMA 2VY3A 2EY5A 3S1RH 3KLSX 4BY7B 4ZLTF 1S5ED 1QVGA 4BBRB 4L6TB 4DV1L 5IY0A 1BCPF 3HOZG 4P72A 3QIAA 5CC4A 2TMPA 2BCOA 3AB9A 3BDLA 2PYKA 3BVGA 4FXGC 3UE1A 1O7YA 2AWNA 1KLGD 1UE7A 5I2YA 1UE5A 1YHQA 2R7DA 3T1YQ 1A3TA 1X3EA 1Y8OB 4K8IA 5ELOA 2RCNA 4LF4L 2KCTA 2PNHA 4DUZQ 1KL9A 3TS0A 1SLJA 3PF4A 3LWUA 3PIP3 3G48A 1MJCA 3CPFA 1HTLD 4A3BH 4BBSH 1DGSA 4X65Q 2NVXH 1A8VA 3H09A 3PO3B 4JI6L 3M7NA 4S3SA 2F0FA 3IAYA 2SNMA 2NN6I 5A2QL 3LGJA 4P75A 2WAQG 4Z9CB 2NYZD 4K5XA 3ZJYC 5KIXA 3ZYYX 3NP8A 3FP9A 2JEAI 2I07B 3T1HQ 4A3GG 2EE1A 4K2LA 1TQOA 1E1OA 1YNJC 5C4JB 1N8RC 1TT2A 4HR7B 1SYBA 4GN4B 5FOBB 4KMUC 1JR0D 5KYLA 2QEXA 1G6PA 2F0EA 1Y1WB 2RKSA 1CK1A 4KHPL 2B2WC 1W3SA 2L9HA 4IUNA 1C8CA 2EYJA 2ICEC 4IURA 1K73C 4MHEA 3W1GA 1V8QA 1OXVA 3FMCA 1U4MA 3HOWH 5FLXE 1LYLA 1TVXA 2K5VA 3C2PA 1Q8KA 2EYMA 1Y1VB 4X62L 1TS3A 5C0XG 2KBNA 1HNZL 1HRJA 2K5WA 4G7ZC 3S16B 3KK7A 3PO2H 3VR3A 3GTJB 1PYBA 1YNND 4JI0Q 2JA8G 2N78A 1NTGA 3FKIH 1VQAA 1QJOA 3EBEA 1TWAH 4UP7A 3P20A 5EAYA 2B2TA 4DKAC 1TXYA 5DLQE 2Z6KA 2JYOA 1I5FA 3GTMB 3I4NH 1TWFH 1VQKA 3I70A 1EY5A 4KTAA 3HOUB 3URYA 1HH2P 5E4XA 3K57A 3KJOA 3ERSX 1EZ8A 1KTKA 4IFDG 2NZHA 3S1RB 3GTOH 3CXCA 2A6HD 1GUWA 1Z7TA 3A5UA 3T56B 2ZTCA 5E1FA 4M8AA 2VB2X 4CHTB 4JI3Q 4MIUA 3E6ZX 2QDBA 4NW2A 3R8BA 1VCIA 2R92B 1BOSA 2Q2TA 3D4WA 3QOJA 5DEHA 1T5XD 4DV7L 3RZOH 1EY4A 4KLKA 5DAUA 3NQTA 2EJGC 2H5XA 1FL0A 3KF6B 4XT3B 3MHBA 3H3VH 4XQQA 3J7ZC 5M3MB 1M4VA 1JE4A 2K5HA 5C3WA 4JI2L 1X9NA 1I4PA 4A3BB 4BBSB 2NZ1D 3RZDH 5EGTA 2NVXB 2DY8A 2K52A 4X6AH 1HA5A 2YTXA 5LL6X 1IKLA 1V1OA 1Y14B 3J80L 1FD7D 1M90C 1XPOA 1CKMA 1Z6HA 4OWTB 1X65A 3D4RA 2ZT9C 4ZCKA 2JA5G 3GTKB 4GKJL 5KEEA 4C3JG 3OYYA 4JI4L 1TIID 5IE8A 4RWSC 3HOXG 1HR0Q 1D5XC 3MXUA 1XNQL 1CT1D 1MSHA 1SE8A 4KI0A 4DUYL 5LHY1 3K5MA 4A3IH 4KN7C 2Q2UA 2F4IA 1F9SA 4HSPA 3VA5A 1UUPA 1LT6D 4ZKCB 4Q0FA 2E5LL 3K5OA 3HOWB 3S15H 1EIGA 4B3SQ 3H0GG 3U4ZA 2IJ0A 2KUMA 1WI5A 1SYGA 4LK1C 4HMIA 1B7YB 4RCOA 4MZ9A 2FFKB 4A3DH 4DV2L 3GO5A 4AYBE 2PQAB 4YWMA 1K28A 1PH7A 3S14H 1SMYC 1JT8A 1C7YA 4EX5A 1BQQT 1SYEA 3DUZA 1TWAB 3R2TA 2Q2HA 5CV5A 3SVMA 1EY0A 3A5ZB 4QUFA 4DK1A 4OO1I 4AYBB 4X64L 1X56A 1R9TH 2Z9HA 1TWFB 3M85A 1YNNC 2EOTA 4DNIA 3EQLC 5FO8B 4WJ3M 1A3VA 1B4OA 4MTNA 3PQIA 2JN4A 2A68D 5IT9E 1WCMH 5FLXL 2JA9A 5FJ8G 3CCVA 5IP7G 4K5WA 4L5SA 1JWUD 5TSSA 3GTOB 2DNCA 5I6WA 2Q2IA 3A0JA 1U9RA 1EWHA 1FNWA 4DV5Q 1L0XB 2Y0SE 2A1AA 4L5RC 2WIIB 3G6JB 1XNRQ 3EVQA 3KBGA 4A3IG 1EOVA 4P74A 2EPBA 4OELB 4NDXA 3GV6A 3TBIB 3UDGA 2QEJC 3A74A 2KQ3A 3SE0A 2WFWA 1O7IA 2A6HC 3K6OA 5ELCA 2Y0SB 4OIJA 2L5TA 4C3IH 3CC2A 2EJMA 2Z1CA 1VMCA 1SMXA 1IKMA 4RGTA 3BDCA 3CMAA 3S17H 2PW5A 1CA6A 3E5SA 2PCFB 1PXUA 5EBCA 1VF7A 3FEWX 1PRTD 2XIWA 5JVG3 3J81E 3UDIA 2IX1A 1SBBB 4PZ8A 1XMOL 4RGMA 4O42A 3SEBA 4KD3A 3WOEA 3I55A 3KDFB 1A3UA 4YWLA 4KHVA 1HNWQ 1K83H 1FYCA 1BVSA 2QF7A 4FF4A 1SE3A 2B2VA 2LXKA 2BOSA 1LT5D 2YV5A 4DV6Q 1IYUA 5JJKA 4DAYA 2MO0A 4LF6L 4C56C 1EYCA 2NVYB 2SDFA 1K3RA 1YBYA 1UE6A 4A93H 4DR3L 1MI2A 4B3RL 1ZXTA 4A3EG 3MVVA 4JBMA 1JB3A 3FPUB 4F7XA 1WTOA 1UEAB 2UXBL 4DFAA 4PG3A 3HKSA 4H44C 1PRTF 5JAVA 4P71A 3M4YA 2F0HA 1YVCA 2WINB 1BUVT 1STAA 1WTQA 4H02A 2BH2A 1EIHA 1VQPA 1PH3A 4XIGS 2HIVA 3UDFA 4UP8A 3S1QB 4A3DB 1X54A 1GOZA 3TZDA 1Y8NB 2FINB 1UNSA 5EKIA 1HTPA 2R93G 1FR3A 4N8X1 3TP6A 1BO0A 1O7LA 1PZKD 4KV6A 3S14B 2IW3A 4A3FG 1D1IA 2A6ED 3Q8DA 3K80C 3HZXA 4F88A 4GN3B 4PMWA 5JOBA 4LUVA 3CCLA 2CH4W 1MHWC 4RHSA 3E3XA 1R9TB 2JK8A 4APVA 4OONA 1VQFA 1RD9D 1IL8A 2WB1E 2HCIA 3NENA 1Q46A 5M9OA 1EFWA 4RA8A 1WCMB 3L2PA 2AQ2B 2B2YC 5EKLA 3NBIA 4K0KQ 2DJGC 3DWQA 4KKTA 1MSGA 1CZGA 4EQOA 2WB1B 3BU2A 1C4QA 1YEZA 2EXDA 4DF7A 4DV0L 1IBLL 3S9WA 2PW7A 5LMNW 4ID6A 2NN6G 2F0LA 2A68C 3HP3A 5J22A 2ZM6Q 1J5EL 2O5IC 3F1ZA 5GAEC 3HFZB 3C46A 2KCCA 2KVMA 1TY2A 1EQRA 4C3IB 5IYCH 1PH8A 3ULJA 1NAPA 2R61A 2AQ3B 4HCEA 1SE4A 3TP7A 3FDTA 5A2QE 2JEBI 4CGYB 1DOKA 2A5HA 4H7BA 4PZ7A 1A62A 2B63H 2BDNA 5C3EB 2HDMA 1EIFA 2RSNA 1U4PA 1YHBA 2RBMA 2F1MA 1KDCA 2K5DA 2VL6A 1B50A 4TRDA 1EZ6A 1W2BA 1KC8C 1GD7A 1K83B 5HURA 2VUMH 2MQHA 3A55A 3QO2A 4CJ0B 2LXJA 1PRTC 2E76C 3A54A 3RN2A 1U5KA 1F2LA 5IWAL 4JOIA 1OTCA 1MD2D 3SK6A 1UAPA 4PMBA 5CMDA 2E8GA 3BJUA 3BS1A 4R4IA 3ICEA 1PZJD 1VQGA 4LF4Q 3BDOA 3RLNA 5D3IB 5KYIA 4TSSA 5FLMG 1FVIA 2HHHL 1EY7A 3GP7A 3AMUA 1PH6A 1IBMQ 3MXPA 2B2WA 2KEEA 4HEDA 4GS3A 2MPMA 5E4WC 4A3JH 2UUAL 5D14A 2CQAA 5EJWA 1WTPA 3N52A 4ME3A 2E2DC 4B3TL 5ELFA 3BZDB 2B8FA 3DEPA 3QB3A 3HKZE 3CU7A 1Y8PB 3PUYA 3IL8A 3NUCA 2OEOA 3B6YA 4ILWA 1EY6A 2DN8A 1Q1BA 2Z0SA 5BR8L 4PZ6A 4HIDA 2X69A 4Y52H 4YCVA 1F9RA 4HAEA 3HKZB 4C2MH 3HRZC 1K8OA 1ET6A 3WWVA 5DM73 4A3LG 5GAHC 3TP8A 4UDUC 1RODA 2K4KA 4QMGA 3M3YH 1XMQL 2NZOA 1KDBA 2EZVA 3V05A 4KHPQ 4C1NK 3MEHA 4DXGA 2VNUD 1JOKA 2KENA 1HUMA 1Z9FA 1HJPA 4JPBW 1HCZA 3PUWA 5AJ3L 2A6EC 4DNTB 5C4ZA 3NBHB 4YHHQ 1PV4A 3BZKA 1IBKQ 4DAPA 4BY7G 1HNZQ 1NR4A 4HIMA 3HOYB 3BYYB 4OEMB 1PTOH 1Q1EA 1WTHA 1DXMA 4LFAL 2Z4HA 3PIO3 1U4RA 4EQPA 3TDQA 1VQDA 2B3GA 3MAQA 1FJGL 1CA5A 3CD6A 4QF4A 4R8IA 1SFOH 2G9DA 2TSSA 4A3GH 2PI2E 3R3OA 1NNXA 1UWVA 4GLAC 2LSSA 4L63B 1QZGA 1CHPD 2G9HD 3R2IA 3KF8B 2UUBL 1EUJA 1U4LA 3U4VA 3MXGA 4DAVA 2B63B 2M2LA 4R4CA 5J1ZA 2B2UC 1K0RA 2KECA 4DR1Q 1H95A 1J6QA 1HXYD 2ALYB 2L12A 2J0TD 2JA6B 1T5EA 1VQ4A 2OQ0A 4GOPB 1HNXL 3I4MG 2VQFQ 2O2LD 2VUMB 1D7QA 1KRTA 4DV4Q 4Y7NH 5C0XH 1STHA 2DY7A 1JE5A 4LFBL 3GTGB 5IYDG 1NE3A 3WOFA 4MN3A 5IGDA 2JA8H 5M3FG 1G6ZA 1WD1A 1O80A 1Y1WG 2QILA 4YY3L 3EIVA 2UUCL 4JI2Q 5ELBA 1BBWA 4X3SA 5JEAG 4LF9Q 4HJ5A 3NTKA 3JC66 1TWHH 2L1BA 2OXPA 4OO1G 1LTLA 5LL6S 5KRUA 1FGBD 4IUVA 4JK1C 3PCOB 1GHJA 3MTSA 4ZUJA 4IFDH 2R3ZA 5C5LA 1EY9A 3J7AF 1CZWA 4JI4Q 4LF5Q 4KK7A 2VQEL 1H9SB 1PA6A 2AQ1B 4JBKA 3HOZB 2HUGA 2ASBA 3RR5A 3PIOA 3I8ZA 1QE6A 3KFUA 2AWOA 4PV1C 4DUYQ 3DMUA 5GQOA 3TP5A 1KNEA 3STBD 3M3YB 4J1MA 1PFBA 1PFSA 1RKNA 3E9HA 2F4VL 5T1GA 3MZ5A 2LY7A 2KCNA 1SMYD 4GOPC 2FMCA 3L3OC 2RHSB 3I90A 4JI1L 4FXDA 3IKJA 4YCWA 4DR7Q 5J39A 1EQTA 2DNEA 3T4AC 1C9OA 2ID0A 4L5QA 5L37A 1H9JA 2E5LQ 1JJGA 2WAQE 4IPHA 1GO3E 4IZ8A 4X3UA 2FJ2A 1HR0W 1RF2D 5IODA 1TWGB 1WTWA 4DR4L 2KHJA 3CRLC 1G2TA 4JI7L 1SJED 4WRDA 4O1NA 4PQXA 5F2DA 2Z6BA 2F0SA 2UXCL 2SOBA 1PTOB 1XYIA 4DAMA 4DV2Q 3NTIA 1QZHA 1ZEQX 2IX3A 2RDHA 5G3LF 4JI8L 1V43A 2WAQB 4NXNL 2R92G 2JA5H 3D4DA 4O2DA 4C3JH 3CC7A 4ZYSA 3HOXH 4A3GB 4DNRB 5M3MG 3PIPA 4LW1A 2D5DA 5J3BA 4LFCL 4X64Q 1AW7A 1SDFA 2PZWA 3MA2B 4NXMQ 1OXTA 2E75C 3OPOA 1VQ5A 3SK4A 4HJ9A 4IUTA 3S2DH 2OTJA 2NBFA 3NK9A 5DM63 3DXJC 4A3MH 2BDOA 3OHXC 2ZXOA 1NY4A 1SNDA 1RDPD 3LWEA 3FVQA 3K5LA 4P73A 3H0GH 4CKBA 2K04A 2NVTH 3ND8A 4Y7NB 1S3OA 2IPKD 1QWYA 2XVSA 1F9PA 4BY1G 1SRUA 4K6DA 2JA7G 1C0AA 4DK6C 1BDOA 1F77A 2F3WA 1G91A 3TEHB 4G7OC 1VQLA 4IPDA 1EWCA 2JA8B 3E0JA 4IUPA 4A4IA 2UXDQ 5IYBG 3W1BA 1QUQB 2RDGA 3C1EA 3OIPA 4BA1I 2MNAA 2F0JA 1E24A 4RGNA 5COYA 4DUZL 1PLFA 2MJ8A 5H1SE 2KOLA 1G2SA 1TWHB 4A3KG 4B3ML 2CVRA 1SYCA 1CSQA 4FDBA 4PNYA 1XMOQ 4X66L 1EQVA 2IT1A 3AU7A 2KHSA 1N33Q 3SDZA 5FJ8H 1YIJA 5ELNA 4DR2L 2EJFC 5IP7H 3NXWA 1PVOA 1NSNS 2EYFA 5BN4A 4N9PA 5C44G 2IL8A 2EYOA 4XQNA 3OTOQ 2PZUA 4JV5Q 3CF5A 3U50C 3MEFA 4IJLA 4HJAA 1HPCA 2HQLA 2EDGA 3D31A 4LF7Q 4B3RQ 1Q7YC 1LUZA 4AYBG 4EVOA 3DLLA 4A3MG 4X3TA 2K33A 5C0XJ 1YITA 1JQYD 1LT4D 4IPCA 4E6IA 1EY8A 3EJIA 2GVBA 4C3HG 1Q12A 1IYVA 3BYTB 3X3MA 3KDFA 3NELA 1S72A 2C35B 1I50H 5EPJA 1QOHA 2MFIA 1BXTA 1S40A 3STBC 3PO2B 1A2TA 3AEVA 2I5HA 3F8TA 1K0SA 2B2YA 2H1EA 1STYA 4AQYQ 1II3A 2E2HH 3FKIB 4CKEA 2A8VA 1I3QH 5CYUA 3S24A 2JA5B 3VYUA 3JAMi 4I7AA 1G291 1F2ZA 1RIPA 2O4XA 4JI0L 1N34L 1JORA 3HOXB 3I4NB 4CBVA 5I4DA 3JAMc 1WJJA 2OQKA 1ILPA 4IFDJ 4EQ5A 3MXNB 1PH9A 4GLVB 4XYQA 5E7NA 2A73B 3F2BA 3VYRA 4A3EH 5JJLA 1IHZA 3SHLA 2RSOA 4IQZA 3S2DB 1EEFD 3JAML 4RAUC 1MIUA 1L2FA 1PZID 3CCQA 3J7A5 1X32A 2F0IA 4J6HA 1LTID 4H0LC 2NVTB 4I7ZC 1QCBD 2EQSA 5CV8A 3SR1A 1I4XA 2IY5B 2JJQA 3RZOB 2AHOB 4KN4C 1A2UA 3GQBA 5C6AA 3D3RA 1H9RA 4ODGA 2JSOA 5AFWA 1DOLA 4JI3L 4CJ1B 2OTLA 1CUKA 5A35A 2BH8A 5HY6A 1J5EQ 4BA2I 2R93H 1ENFA 1E3PA 2HD3A 4LWCA 1O7ZA 4A3FH 2I5LX 2NUCA 1PH2A 4FF3A 3RZDB 4YCUA 4HMJA 3J7AV 2IHFA 3DWAA 1RL2A 3V2TA 1FNVA 1ML0D 4ZKBB 2EYHA 1Q82C 1JMCA 1RHPA 4KJOA 3M9BA 1DZ1A 1D1KA 1S5CD 4IALA 5M5XH 4FP5D 4DV3Q 3OWEB 4POFA 4L8JA 3I2ZA 3VR2A 4TVAB 5M5WH 1HQMC 2L11A 3GD7A 2OT2A 4P2CB 1SNMA 1QVCA 5CV7A 4A3IB 1SNOA 3S1MH 1VQIA 1L0WA 4UAIA 1LTRD 4K8JA 2EYLA 2NN6H 4J8QA 5LMUQ 1L1OB 1S5FD 1ILQA 1P16A 4DN4M 1YHAA 2UU9Q 1W6JA 2F0GA 4GKKL 2C9OA 3ND9A 5M5YH 3S15B 2XGTA 3G71A 3CCRA 4DR6L 2K5QA 1D2BA 2M9VA 2XTIA 3PMFA 5CBAE 4DR5Q 2R7FA 1JJCB 4G4KA 4JI5Q 4R9WA 3KJPA 3RUZA 2N8NA 5KNCA 1I50B 2XWBB 5I6YA 3H3VC 3J81j 3TN2A 2A19A 4B08A 2K05A 2YU9H 4QGUA 2MP1A 1SYDA 4A3CG 1VQBA 1I3QB 2NTTA 4Q5VA 4DPGA 4IOCA 3OW2A 1EOTA 1C48A 1VQCA 5IOCA 3K0YA 1LV9A 3G4SA 2A74C 5EBDA 3NWTA 3UE0A 4KKUA 4A3EB 2X6LA 5ISRA 1GHKA 5FLMH 4ME5A 1YJWA 4UPAA 4OX9Q 5AJ3Q 2K50A 1PH5A 5C3EG 4IUQA 1LACA 1TU2B 1MKHA 3J7YW 4R8NA 4BXXG 1RCVD 2OWOA 4N8FA 3RD4A 4G57A 1E2VA 2Q8IB 1SNQA 2B2UA 3CCUA 1U0LA 1ICFB 3D8GA 4K6LA 1L1OC 4DV5L 4XYOA 2P5ZX 2PPBC 1STNA 3C3LA 3G6EA 2FXQA 1SN8A 4KY5A 1XNRL 4EQNA 3U58A 3AFQA 1BR9A 3CC4A 3RLOA 2PMZE 1IXRA 4RGOS 2KA7A 2KJXA 3P75A 1TY0A 3S17B 2XRQD 1JWSD 5C4XG 1DD2A 4A3FB 2PNRC 3KYHC 2E2JH 5IGEA 2KEDA 3M4PA 3OSOA 4G7HC 3FRPB 1PHJA 4A3LH 3NQIA 1V1PB 2JE6I 2L4NA 1HUNA 1H9MA 2PMZB 1WYDA 4GNXB 1TR5A 1FGUA 3GTQH 2XWJB 2L55A 1B70B 3TS2A 3M7GA 2NVQH 4DV1Q 5BN3A 2CHBD 1QB5D 4HIOA 4DA2A 2E74C 3D6CA 1SR3A 4OWXB 4A76A 3H3VI 1HNXQ 5HGQA 2Z8LA 3QWNA 1I94L 3WDNA 5M5XB 2BE5D 4BY7H 3H94A 4HN7A 1TS2A 3TZUA 2K75A 4IN3A 4KD4A 5M5WB 4XT1B 4A93B 3E9IA 1R4PB 3I72A 2HQEA 4LNQA 4IOAA 2O5JC 3NTHA 3S1MB 4FF2A 4DV6L 2KHIA 2CKZB 3IRBA 2AUJD 4UHVA 1HZCA 3RMHA 3KF8A 5I2XA 2UUCQ 1N32L 2RA4A 4GZYC 2PI2A 5C4HA 2GN5A 4F8MA 4JI6Q 1QNUA 3HOVG 3MFYA 3EROA 1BNZA 3SXHA 1CTMA 4GN5A 4GOPA 1I4HA 1DOMA 4I65A 2NTSA 2R7ZG 5JVH3 1KNAA 1M8AA 4F87A 5CGKA 1LM0A 3H6MA 2YYZA 1QNKA 2B39A 3HOYG 5CV4A 2SEBD 4KKSA 1AFPA 1SEBD 2YU9B 1IZ6A 3I4MH 2WACA 1N9WA 2VQEQ 1ENAA 1VQOA 1NMFA 1YJ9A 4GNXC 4R4OA 1B1ZA 5IYDH 4XXEA 3NEMA 4DXFA 3EN2A 4LF8L 5M3FH 1Y1WH 4OHJA 2H4OA 2IHEA 1SNPA 4QIWE 4N9TA 4X62Q 3QR8A 2F0NA 3KLRA 5JEAH 2RVLA 1JB7A 3K59A 2F0PA 1VQJA 4BBRG 1KHIA 1N36L 1QVFA 2JA6G 4DR4Q 1RJTA 4OO1H 4NPSA 3HS0C 1YJNA 4QIWB 4ZRZA 1EL0A 1GKHA 1H9SA 4K0KL 5I9PA 1IL2A 4NXNQ 3QOLA 2EY6A 3FHWA 1DJRD 1GUTA 2MUYA 1XJVA 4MTKA 1KD1C 1DCZA 1X3QA 2IWHA 3GTLH 1TS4A 3PUVA 3HEJA 1JC7A 3NWSA 5K36G 4DGZA 3PO3G 3MFGA 3TRZA 3GTMH 1QG7A 1B3QA 3W2DA 2ZTDA 1EYAA 1B53A 1CKNB 2RF4A 2PO4A 5IP9G 1AZQA 2NVQB 3SK5A 1NCVA 4RCNA 4K14A 5GROA 2V4DA 2N49A 4TKOB 3Q24A 3DWPA 2HDLA 3CCJA 1EQQA 1GUGA 1PTOD 4FF1A 3M4OH 1RTOA 4DV7Q 1PFMA 2ES2A 1G51A 1GUSA 1WTXA 3D6WA 1J9OA 1OXUA 2F0KA 2R92H 4FXKC 2F0WA 4ABNA 1RTNA 1PH4A 4QCLA 1HFNA 4IJHA 5I9OA 2JQOA 1CHQD 3VYSA 2BE5C 4LUOA 4A3JB 4RKBA 2C5CA 3A8KE 5M3MH 1Y1VG 4ZUIA 4DK3C 1ZKOA 3Q22A 4RFBA 2CWPA 4UP9A 5FKAC 1IBML 4B3MQ 3BZCA 3NPPA 3LNNA 4JYAL 1DM0B 1CKOA 1S5BD 2LMCB 4GKJQ 2L0CA 3CCSA 3K7AH 4X66Q 5G3LD 1A0IA 1P8LA 5CV6A 3I4OA 2RQXA 1BCPB 1YNXA 1LTTD 1EYGA 1KQSA 3E0EA 4DR2Q 3KF6A 1XNQQ 1PTOF 2DGYA 4R4QA 3CCEA 4C2MB 1VQ9A 5DNFA 3I4MB 4JOIC 1X3PA 3K58A 3GTKH 1WOCA 1H9KA 2MO1A 1QUQA 2WP8J 4BY1H 3CPWA 2JA7H 1HZAA 2LFNA 3HOUG 1KIXA 3W3AA 4NB3A 3A8JE 2F0VA 5LMNL 1GUOA 3PGZA 5EPLA 1D8LA 5M3FB 3JAME 1HZBA 1A15A 4XQJA 5IYBH 4BS9A 1ASZA 3CP0A 1MGSA 1L0YB 1JICA 3H91A 5KGUA 1VMPA 4JCVE 2ZJPA 2PQEA 3IFDA 4A3KH 3TQYA 3V96A 2X6GA 4YHHL 1VS0A 4WFN3 1IBKL 2DUDA 3O13A 4JC0A 1E1TA 5KNBA 1SFOB 2DJFC 5CR3A 4NKLA 5IGFA 2K7VA 1B2TA 1EU3A 5C44H 2CFMA 4YWKA 1N34Q 2EY2A 1KLUD 3Q23A 3S2HH 4A3BG 4BBSG 1F2MA 1SE2A 3GTLB 4U68A 3W5OA 1ASYA 1ESRA 4HJ7A 4MNOA 1BCPC 4JG2A 2E2IH 3ULPA 2K1BA 1NR2A 2PQAA 2MHVA 1STBA 3FPPA 4KJNA 2RHQB 3A56A 5CV9A 4C3HH 3KBXA 1UE1A 4DR1L 1W6KA 3KLWA 3T53B 3M4OB 4ZQ3A 2VQFL 1LTGD 4DV4L 4AIMA 5JEAJ 1VQ8A 1EEID 1AE2A 3T1YL 1VQNA 3LX0A 3MXNA 4CDCC 1PH1A 1I4GA 1VQ7A 1ZYRD 3GTPH 3A7LA 3J80i 5ELEA 2M00A 1G8ZD 3VA7A 1ESFA 1XPRA 1PTOC 1X3GA 3HOWG 3NHHA 1SROA 3J80c 4CDFC 4IPGA 3Q0AA 4X65L 2ZJRA 3EA6A 4LUZA 1IYJB 3ERQA 4LF9L 2F0QA 2JXMB 1FNUA 1ET9A 1I6HH 3QG1A 3RNUA 1IW7D 3BVMA 3PO2G 3F2UA 3K7AB 2QCPX 4B9WA 4CKCA 4POGA 1B9NA 1M1KC 3OMGA 4K5VA 2WKCA 2D0PA 4LF6Q 3FKIG 1TKWB 2NWGA 3T1HL 1SXTA 4DR3Q 2RDFA 2XSCA 1HQRD 4LF5L 3OOCA 1CM9A 4BY1B 3ONAB 4R4TA 4C1NI 4RG1A 2JA7B 3I4NG 2NVYH 5EPKA 5IGCA 2UXBQ 1BBXC 1B9MA 1KABA 3OMCA 2F3IA 2D2CC 4GKKQ 3AFPA 4DR6Q 1NUCA 3ER0A 4LMQD 4DU9A 1TWCH 2HCCA 1CQVA 4X3KA 2F0UA 2CCZA 4J15A 4WORA 1OXSC 4OXPA 4BWGB 1KXLA 4DR7L 1Q90A 4A3KB 3N6RA 5ELDA 1XTCD 1EFID 4C3JB 3R93A 2EXZA 1YZ6A 3K81C 3S1QH 3OW7A 5BN5A 2Y0SG 3L0OA 2LKVA 4EGVA 1L1OA 4XTCS 2K32A 5C44B 1NMGA 1EIYB 5EQ0A 2B29A 2B8GA 1K8GA 3S2HB 4QUCA 4O0AA 3KOJA 3T16A 1ICWA 4LJZC 5IIFA 5FLXc 4OIKA 1ONLA 2N3SA 1UEBA 2EIFA 3I91A 2BA1A 4QQBX 1OXXK 4OGQC 1K9MC 1JWMD 4A3MB 1HZ9A 2E2IB 2IX0A 1CQFA 1B8AA 1KAWA 2YTVA 4NXML 1MBYA 5NUCA 3H0GB 1GM5A 2HIXA 3K7UC 4C3HB 5JPNC 4UY8C 1AE3A 4KY6A 4H13C 1SSOA 4DV0Q 1IBLQ 4QB4A 3VR6A 4GLXA 3I56A 4WJ4A 4LAAA 4RKLA 1Q86C 3OWFA 3D0FA 2FHTA 2D9UA 2B2TC 2Z6KC 2CW0D 5EKKA 1HHVA 4A3CH 2R6GA 3RLFA 1S4ZA 1GVPA 3C1FA 3GTPB 1K8AC 1PFNA 5HGTA 3PSIA 2UXDL 4CJ2C 5C0XI 4OL7A 2F52A 2EVBA 2F0TA 5C5MA 1YI2A 2VZAA 4A3DG 1ZYRC 1I6HB 1VQHA 3CW2C 1JCKB 1X3FA 3SGIA 3EFXD 4FYDA 5E3FA 4HTHA 2A69D 5C3EH 5FO9B 5IWAQ 1XPUA 1I94Q 2ZXPA 4BXXH 3VDYA 2G5DA 5C3XA 1N33L 1JJ2A 2Q8TA 4YIJA 1HR0L 1NBWA 3CKIB 5GADC 4V190 1VF5C 3OIQA 3U9SA 1IW7C 1OO9B 3OTOL 4JV5L 2HHHQ 2AKWB 1V1PA 2ZXRA 2OCEA 3A8IE 4IFDI 3M4QA 4GNXA 2XN9C 2J7ZA 3DM1A 3TREA 1N32Q 5C4XH 1K8MA 2AUKA 3DM3A 2UUAQ 4NMZA 4LF7L 1WFQA 4RMFA 1WCMG 2CWAA
chains in the Genus database with same CATH topology
1LM0A 4B3TQ 2YYZA 2VQEL 1PA6A 4JBKA 3HOYG 4B3SL 1VQ6A 2ASBA 2Q2UA 3RR5A 3PIOA 1X6OA 3KFUA 2AWOA 1IZ6A 4DUYQ 2WB1G 3I4MH 2V1CC 5GQOA 3S1NH 3STBD 5BR8Q 2E5LL 1N9WA 3F2CA 1EWIA 1PFSA 2L15A 3E9HA 2VQEQ 2HT1A 2F4VL 4B3SQ 3H0GG 3PUXA 1NMFA 3U4ZA 1VQOA 1YJ9A 4GNXC 1WI5A 4GOPC 4R4OA 2ATWA 5IYDH 2RHSB 4JI1L 4YCWA 3NEMA 1V1QA 4DR7Q 1B7YB 3EN2A 3RN5A 4MZ9A 1C9OA 2ID0A 4L5QA 4AQYL 2E5LQ 4LF8L 5M3FH 2WAQE 4IPHA 1BBUA 3S15H 1GO3E 4DV2L 2ZTEA 1XMQQ 1HR0W 2K14A 1Y1WH 3GO5A 2KCMA 2IHEA 4TQUS 4AYBE 4DR4L 2KHJA 4QIWE 2PQAB 4YWMA 4X62Q 1PH7A 4JI7L 3S14H 3PV0A 1JT8A 1JB7A 1C7YA 2UXCL 4LF8Q 4EX5A 1VQJA 4DAMA 4BBRG 4DV2Q 1QZHA 1KHIA 1N36L 4JI8L 1QVFA 1V43A 2Q2HA 2JA6G 4NXNL 4DR4Q 2R92G 3A5ZB 2JA5H 4O2DA 4NPSA 2AMCB 4C3JH 4JBWA 4OO1I 4X64L 3CC7A 1X56A 1YJNA 1R9TH 1GKHA 3M85A 3HOVH 3HOXH 3AQQA 4K0KL 3UDXA 1N36Q 4DNIA 1IL2A 5M3MG 4AH6A 4NXNQ 3PIPA 4WJ3M 4LW1A 4LFAQ 3L7ZC 4MTNA 5J3BA 4LFCL 3FHWA 1AH9A 4X64Q 2R7ZH 1WCMH 2JA9A 1FJGQ 5FJ8G 1XJVA 3CCVA 5IP7G 4NXMQ 1KD1C 4HJ8A 1CSPA 1OXTA 4L5SA 3HOYH 2Q2IA 3A0JA 1VQ5A 4A93G 4DV5Q 3CQZH 4HJ9A 3GTLH 3S2DH 2OTJA 3PUVA 2Y0SE 3K8AA 2A1AA 4JBJA 3F2DA 4L5RC 1XNRQ 3PO3G 5K36G 4A3IG 1EOVA 4A3MH 4P74A 3K0XA 4DAYB 3TRZA 1NY4A 3GTMH 1MJEA 4P73A 4QJFA 3H0GH 5GAGC 2NVTH 3UDGA 3A74A 2ZTDA 2UUBQ 2WFWA 1CKNB 1O7IA 2RF4A 1S3OA 2VS1A 5IP9G 2D0OA 2GVAA 5IT9c 4BY1G 1SRUA 5GROA 4C3IH 2N49A 3CC2A 4DK6C 2JA7G 1C0AA 1SMXA 3TEHB 3I7FA 3CMAA 1E7ZA 1VQLA 3CCJA 4IPDA 1EQQA 3S17H 3M4OH 4DV7Q 2ZJQA 3GDEA 4A4IA 2UXDQ 5IYBG 2ES2A 1G51A 3CAMA 1QUQB 3W1BA 1HNWL 4BA1I 2MNAA 4BBRH 1E24A 1OXUA 2K5NA 3UDIA 2IX1A 4LFBQ 4DUZL 2JA6H 2R92H 3HKZG 4PZ8A 1XMOL 1PH4A 3I55A 3KDFB 4IJHA 2JQOA 5H1SE 4YWLA 1HNWQ 4DV3L 1K83H 1BVSA 4A3KG 4B3ML 4LUOA 4YY3Q 1PYSB 2LXKA 1V9PA 1NJIC 5M3MH 1CSQA 4FDBA 3J81i 2QA4A 3GTGH 1XMOQ 1Y1VG 4X66L 2YV5A 4DK3C 4DV6Q 2IT1A 1A63A 5JJKA 2MO0A 1N33Q 4LF6L 2CWPA 4UP9A 5FJ8H 1YIJA 5ELNA 3J81c 5IP7H 4DR2L 1K3RA 3BZCA 1IBML 4B3MQ 4JYAL 1YBYA 5LMUL 1PVOA 1UE6A 4A93H 1CKOA 4DR3L 2UU9L 4GKJQ 3CCSA 1CKNA 3K7AH 4X66Q 5C44G 4B3RL 1A0IA 4A3EG 1P8LA 4JBMA 3I4OA 1X55A 3OTOQ 3PO3H 1YNXA 1EYGA 4JV5Q 1XTDA 3CF5A 4HIKA 1KQSA 3AYHB 3E0EA 4DR2Q 4DR5L 3KF6A 3U50C 2QGQA 1XNQQ 4JYAQ 3MEFA 2DGYA 4IJLA 4R4QA 2UXBL 3CCEA 4HJAA 4PG3A 3HKSA 1VQ9A 2HQLA 4JOIC 3D31A 3GTKH 4LF7Q 4JI5L 4B3RQ 4P71A 3PF5A 1Q7YC 1WOCA 1LUZA 4AYBG 3ULLA 1YVCA 2VW9A 3DLLA 4A3MG 2MO1A 1QUQA 2WP8J 5IP9H 5C0XJ 4BY1H 3CPWA 1YITA 4H02A 2JA7H 2BH2A 1HZAA 4IPCA 1VQPA 2GVBA 1PH3A 4XIGS 2HIVA 1Q12A 1KIXA 4NB3A 3HOUG 3UDFA 4UP8A 5C4JH 5LMNL 3KDFA 2CQOA 1X54A 3NELA 1D8LA 3PGZA 5IYCG 1S72A 2C35B 1HZBA 1I50H 5IYBH 2F4VQ 2MFIA 3H15A 1S40A 4QL5A 3STBC 1ASZA 3HOZH 3CP0A 2R93G 3AEVA 1Z47A 2I5HA 4OWWB 1VQEA 3F8TA 4JI1Q 4A3FG 5LMNQ 3Q8DA 3K80C 4AQYQ 4JCVE 2E2HH 2ZJPA 2B63G 2I0QA 4GN3B 4PMWA 4A3KH 1I3QH 3S24A 4LUVA 2A8VA 3TQYA 4YHHL 1VS0A 3CCLA 3JAMi 4KHZA 4A75A 1IBKL 4JI7Q 1G291 2I5MX 1RIPA 3PUZA 4JI0L 1Y1VH 2JK8A 4L5TA 4R1JA 4OONA 2DUDA 4APVA 1Q81C 1N34L 2VUMG 1VQFA 4JC0A 2UXCQ 1E1TA 4OX9L 3JAMc 1WJJA 2OQKA 2WB1E 4JI8Q 3NENA 4EQ5A 4IFDJ 3MXNB 1Q46A 4QY7A 3S16H 1PH9A 4GLVB 1EFWA 1TWGH 3GTJH 5E7NA 3F2BA 3L2PA 5C44H 2CFMA 4YWKA 4A3EH 1N34Q 5JJLA 3S2HH 1BKBA 4A3BG 4BBSG 4K0KQ 2ZM6L 3W5OA 1ASYA 3BU2A 1MIUA 4HJ7A 4MNOA 4LFCQ 2YTYA 1L2FA 1YEZA 3CCQA 2EXDA 4DV0L 1IBLL 3J7A5 5LMNW 4JG2A 2E2IH 4IO9A 2NN6G 3ULPA 2ZM6Q 1J5EL 2EQSA 4A3JG 3F1ZA 5GAEC 2IY5B 2PQAA 2JJQA 3HFZB 2BA0A 1KRSA 3HOUH 2AHOB 4C3HH 2RHQB 4ALPA 5JJIA 1T9HA 1VQMA 1EQRA 5IYCH 1E22A 1UE1A 2D62A 4JI3L 1CUKA 3ULJA 3CMEA 4DR1L 1PH8A 2OTLA 2BH8A 3KLWA 3CCMA 5HY6A 1J5EQ 4BA2I 2VY3A 2R93H 3S1RH 2VQFL 1E3PA 4LWCA 4A3FH 4DV4L 4AIMA 2I5LX 1PH2A 5JEAJ 2JEBI 1QVGA 4YCUA 1VQ8A 1AE2A 4PZ7A 5IY0A 4DV1L 3T1YL 1A62A 2B63H 1VQNA 3HOZG 1EIFA 2IHFA 1YHBA 4P72A 1RL2A 2VL6A 1PH1A 1VQ7A 3UE1A 3GTPH 1W2BA 3J80i 1KC8C 2AWNA 1GD7A 1UE7A 2VUMH 1Q82C 1UE5A 1X3GA 1XPRA 2MQHA 2R7DA 3T1YQ 1X3EA 1YHQA 1JMCA 3HOWG 1SROA 5ELOA 2LXJA 3J80c 2RCNA 4LF4L 3M9BA 4IPGA 2KCTA 2PNHA 4X65L 2ZJRA 1U5KA 3RN2A 4DUZQ 1KL9A 3TS0A 1SLJA 4JOIA 4LUZA 5IWAL 1OTCA 3PF4A 1IYJB 4LF9L 3G48A 1MJCA 3CPFA 5M5XH 2E8GA 3BJUA 4DV3Q 4R4IA 3ICEA 4A3BH 4BBSH 1VQGA 4LF4Q 1I6HH 1DGSA 3RLNA 4POFA 3RNUA 3I2ZA 4X65Q 3PO2G 5M5WH 4TVAB 2NVXH 1A8VA 3GD7A 4POGA 1M1KC 1QVCA 5FLMG 1FVIA 4JI6L 3M7NA 3S1MH 2HHHL 1VQIA 1L0WA 2D0PA 4LF6Q 3FKIG 1PH6A 1IBMQ 2NN6I 3T1HL 5LMUQ 1L1OB 4GS3A 4DR3Q 1P16A 3LGJA 1YHAA 2WAQG 4P75A 4A3JH 2UU9Q 2UUAL 4GKKL 4ME3A 4LF5L 3ZJYC 5M5YH 2XGTA 4B3TL 3G71A 4R4TA 3CCRA 4RG1A 4DR6L 3I4NG 3FP9A 2XTIA 4DR5Q 2JEAI 2NVYH 3HKZE 3T1HQ 3PUYA 4A3GG 2UXBQ 2R7FA 1JJCB 1E1OA 4LF5Q 3B6YA 2F3IA 4JI5Q 4GKKQ 3KJPA 1N8RC 2N8NA 3AFPA 1Q1BA 2Z0SA 4GN4B 5BR8L 4DR6Q 4PZ6A 4HIDA 3ER0A 2QEXA 3J81j 1G6PA 1TWCH 4Y52H 2A19A 4YCVA 4KHPL 2CCZA 1W3SA 4J15A 1OXSC 4C2MH 4A3DH 4OXPA 3WWVA 2YU9H 1K73C 4QGUA 1KXLA 3W1GA 4DR7L 1OXVA 4A3LG 5GAHC 4A3CG 1VQBA 2K4KA 3M3YH 3HOWH 1XMQL 2NZOA 4KHPQ 1LYLA 2K5VA 4DPGA 4IOCA 3OW2A 1Q8KA 4X62L 1VQCA 2VNUD 1YZ6A 2KENA 5C0XG 2KBNA 3G4SA 1Z9FA 3K81C 1HJPA 1HNZL 3S1QH 2Y0SG 3PUWA 3L0OA 5AJ3L 3UE0A 1L1OA 3PO2H 4XTCS 3NBHB 4YHHQ 1PV4A 1NMGA 3BZKA 1PYBA 1IBKQ 1EIYB 4JI0Q 4BY7G 2B29A 5FLMH 1K8GA 1HNZQ 2JA8G 1YJWA 2N78A 3KOJA 4O0AA 4HIMA 4UPAA 4OX9Q 5AJ3Q 1NTGA 3FKIH 2K50A 1PH5A 5C3EG 1Q1EA 1VQAA 4UP7A 3EBEA 1TWAH 5FLXc 1MKHA 2N3SA 5EAYA 4LFAL 1UEBA 1TXYA 2EIFA 2BA1A 4DKAC 4BXXG 1OXXK 4QQBX 5DLQE 1K9MC 2Z6KA 2OWOA 1HZ9A 2IX0A 1I5FA 1KAWA 1B8AA 1VQDA 2B3GA 1FJGL 2YTVA 4NXML 3CCUA 3CD6A 3I4NH 1TWFH 1VQKA 1U0LA 1GM5A 2HIXA 1SFOH 1L1OC 4DV5L 4A3GH 3K7UC 2PI2E 1HH2P 3G6EA 1UWVA 2FXQA 1SN8A 1AE3A 4GLAC 3KJOA 4UY8C 1XNRL 2LSSA 4DV0Q 3U58A 1QZGA 1IBLQ 3ERSX 3AFQA 3CC4A 3RLOA 2PMZE 3I56A 1IXRA 4GLXA 4IFDG 4WJ4A 1Q86C 2NZHA 3D0FA 3GTOH 3KF8B 2UUBL 3CXCA 5C4XG 1EUJA 3U4VA 3KYHC 3A5UA 2Z6KC 2ZTCA 2E2JH 3M4PA 1PHJA 4A3LH 4R4CA 4JI3Q 4DR1Q 1K0RA 4A3CH 1H95A 1J6QA 1JJGA 2JE6I 2ALYB 2R6GA 3RLFA 1GVPA 1VQ4A 1WYDA 1VCIA 2OQ0A 1FGUA 4GNXB 4GOPB 2VQFQ 1K8AC 1HNXL 2Q2TA 3GTQH 3I4MG 4DV7L 1B70B 3RZOH 1D7QA 1KRTA 4DV4Q 4Y7NH 3PSIA 4KLKA 3TS2A 2UXDL 5C0XI 2NVQH 4DV1Q 2F52A 1FL0A 2H5XA 3KF6B 4HIOA 1JE5A 3H3VH 3J7ZC 1SR3A 4OWXB 4A76A 3H3VI 4LFBL 1YI2A 5IYDG 1HNXQ 1NE3A 2VZAA 2K5HA 5HGQA 1I94L 4JI2L 1X9NA 4BY7H 4A3DG 2JA8H 5M3FG 1VQHA 3CW2C 2K75A 3RZDH 1X3FA 3SGIA 1Y1WG 4YY3L 3E9IA 2K52A 5C3EH 3EIVA 2YTXA 4X6AH 4LNQA 1Y14B 5IWAQ 1I94Q 2UUCL 1XPUA 4IOAA 4BXXH 4JI2Q 3VDYA 1BBWA 5JEAG 4DV6L 4LF9Q 2KHIA 4HJ5A 1M90C 2CKZB 1XPOA 1JJ2A 3IRBA 1CKMA 1N33L 3JC66 4OWTB 1HR0L 1NBWA 1X65A 1HZCA 1TWHH 5GADC 4GKJL 2JA5G 4OO1G 2UUCQ 1N32L 1LTLA 2PI2A 3OYYA 4JI6Q 2GN5A 3OTOL 4JI4L 2HHHQ 4JV5L 2AKWB 5IE8A 1HR0Q 3PCOB 3HOXG 3HOVG 1XNQL 2OCEA 4IFDI 3M4QA 4GNXA 4GN5A 4GOPA 1N32Q 3TREA 1SE8A 3DM3A 4KI0A 5C4XH 4DUYL 2UUAQ 4LF7L 1WFQA 4RMFA 1WCMG 2R7ZG 2CWAA 4JI4Q 4A3IH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM0 A;  4B3T Q;  2YYZ A;  2VQE L;  1PA6 A;  4JBK A;  3HOY G;  4B3S L;  1VQ6 A;  2ASB A;  2Q2U A;  3RR5 A;  3PIO A;  1X6O A;  3KFU A;  2AWO A;  1IZ6 A;  4DUY Q;  2WB1 G;  3I4M H;  2V1C C;  5GQO A;  3S1N H;  3STB D;  5BR8 Q;  2E5L L;  1N9W A;  3F2C A;  1EWI A;  1PFS A;  2L15 A;  3E9H A;  2VQE Q;  2HT1 A;  2F4V L;  4B3S Q;  3H0G G;  3PUX A;  1NMF A;  3U4Z A;  1VQO A;  1YJ9 A;  4GNX C;  1WI5 A;  4GOP C;  4R4O A;  2ATW A;  5IYD H;  2RHS B;  4JI1 L;  4YCW A;  3NEM A;  1V1Q A;  4DR7 Q;  1B7Y B;  3EN2 A;  3RN5 A;  4MZ9 A;  1C9O A;  2ID0 A;  4L5Q A;  4AQY L;  2E5L Q;  4LF8 L;  5M3F H;  2WAQ E;  4IPH A;  1BBU A;  3S15 H;  1GO3 E;  4DV2 L;  2ZTE A;  1XMQ Q;  1HR0 W;  2K14 A;  1Y1W H;  3GO5 A;  2KCM A;  2IHE A;  4TQU S;  4AYB E;  4DR4 L;  2KHJ A;  4QIW E;  2PQA B;  4YWM A;  4X62 Q;  1PH7 A;  4JI7 L;  3S14 H;  3PV0 A;  1JT8 A;  1JB7 A;  1C7Y A;  2UXC L;  4LF8 Q;  4EX5 A;  1VQJ A;  4DAM A;  4BBR G;  4DV2 Q;  1QZH A;  1KHI A;  1N36 L;  4JI8 L;  1QVF A;  1V43 A;  2Q2H A;  2JA6 G;  4NXN L;  4DR4 Q;  2R92 G;  3A5Z B;  2JA5 H;  4O2D A;  4NPS A;  2AMC B;  4C3J H;  4JBW A;  4OO1 I;  4X64 L;  3CC7 A;  1X56 A;  1YJN A;  1R9T H;  1GKH A;  3M85 A;  3HOV H;  3HOX H;  3AQQ A;  4K0K L;  3UDX A;  1N36 Q;  4DNI A;  1IL2 A;  5M3M G;  4AH6 A;  4NXN Q;  3PIP A;  4WJ3 M;  4LW1 A;  4LFA Q;  3L7Z C;  4MTN A;  5J3B A;  4LFC L;  3FHW A;  1AH9 A;  4X64 Q;  2R7Z H;  1WCM H;  2JA9 A;  1FJG Q;  5FJ8 G;  1XJV A;  3CCV A;  5IP7 G;  4NXM Q;  1KD1 C;  4HJ8 A;  1CSP A;  1OXT A;  4L5S A;  3HOY H;  2Q2I A;  3A0J A;  1VQ5 A;  4A93 G;  4DV5 Q;  3CQZ H;  4HJ9 A;  3GTL H;  3S2D H;  2OTJ A;  3PUV A;  2Y0S E;  3K8A A;  2A1A A;  4JBJ A;  3F2D A;  4L5R C;  1XNR Q;  3PO3 G;  5K36 G;  4A3I G;  1EOV A;  4A3M H;  4P74 A;  3K0X A;  4DAY B;  3TRZ A;  1NY4 A;  3GTM H;  1MJE A;  4P73 A;  4QJF A;  3H0G H;  5GAG C;  2NVT H;  3UDG A;  3A74 A;  2ZTD A;  2UUB Q;  2WFW A;  1CKN B;  1O7I A;  2RF4 A;  1S3O A;  2VS1 A;  5IP9 G;  2D0O A;  2GVA A;  5IT9 c;  4BY1 G;  1SRU A;  5GRO A;  4C3I H;  2N49 A;  3CC2 A;  4DK6 C;  2JA7 G;  1C0A A;  1SMX A;  3TEH B;  3I7F A;  3CMA A;  1E7Z A;  1VQL A;  3CCJ A;  4IPD A;  1EQQ A;  3S17 H;  3M4O H;  4DV7 Q;  2ZJQ A;  3GDE A;  4A4I A;  2UXD Q;  5IYB G;  2ES2 A;  1G51 A;  3CAM A;  1QUQ B;  3W1B A;  1HNW L;  4BA1 I;  2MNA A;  4BBR H;  1E24 A;  1OXU A;  2K5N A;  3UDI A;  2IX1 A;  4LFB Q;  4DUZ L;  2JA6 H;  2R92 H;  3HKZ G;  4PZ8 A;  1XMO L;  1PH4 A;  3I55 A;  3KDF B;  4IJH A;  2JQO A;  5H1S E;  4YWL A;  1HNW Q;  4DV3 L;  1K83 H;  1BVS A;  4A3K G;  4B3M L;  4LUO A;  4YY3 Q;  1PYS B;  2LXK A;  1V9P A;  1NJI C;  5M3M H;  1CSQ A;  4FDB A;  3J81 i;  2QA4 A;  3GTG H;  1XMO Q;  1Y1V G;  4X66 L;  2YV5 A;  4DK3 C;  4DV6 Q;  2IT1 A;  1A63 A;  5JJK A;  2MO0 A;  1N33 Q;  4LF6 L;  2CWP A;  4UP9 A;  5FJ8 H;  1YIJ A;  5ELN A;  3J81 c;  5IP7 H;  4DR2 L;  1K3R A;  3BZC A;  1IBM L;  4B3M Q;  4JYA L;  1YBY A;  5LMU L;  1PVO A;  1UE6 A;  4A93 H;  1CKO A;  4DR3 L;  2UU9 L;  4GKJ Q;  3CCS A;  1CKN A;  3K7A H;  4X66 Q;  5C44 G;  4B3R L;  1A0I A;  4A3E G;  1P8L A;  4JBM A;  3I4O A;  1X55 A;  3OTO Q;  3PO3 H;  1YNX A;  1EYG A;  4JV5 Q;  1XTD A;  3CF5 A;  4HIK A;  1KQS A;  3AYH B;  3E0E A;  4DR2 Q;  4DR5 L;  3KF6 A;  3U50 C;  2QGQ A;  1XNQ Q;  4JYA Q;  3MEF A;  2DGY A;  4IJL A;  4R4Q A;  2UXB L;  3CCE A;  4HJA A;  4PG3 A;  3HKS A;  1VQ9 A;  2HQL A;  4JOI C;  3D31 A;  3GTK H;  4LF7 Q;  4JI5 L;  4B3R Q;  4P71 A;  3PF5 A;  1Q7Y C;  1WOC A;  1LUZ A;  4AYB G;  3ULL A;  1YVC A;  2VW9 A;  3DLL A;  4A3M G;  2MO1 A;  1QUQ A;  2WP8 J;  5IP9 H;  5C0X J;  4BY1 H;  3CPW A;  1YIT A;  4H02 A;  2JA7 H;  2BH2 A;  1HZA A;  4IPC A;  1VQP A;  2GVB A;  1PH3 A;  4XIG S;  2HIV A;  1Q12 A;  1KIX A;  4NB3 A;  3HOU G;  3UDF A;  4UP8 A;  5C4J H;  5LMN L;  3KDF A;  2CQO A;  1X54 A;  3NEL A;  1D8L A;  3PGZ A;  5IYC G;  1S72 A;  2C35 B;  1HZB A;  1I50 H;  5IYB H;  2F4V Q;  2MFI A;  3H15 A;  1S40 A;  4QL5 A;  3STB C;  1ASZ A;  3HOZ H;  3CP0 A;  2R93 G;  3AEV A;  1Z47 A;  2I5H A;  4OWW B;  1VQE A;  3F8T A;  4JI1 Q;  4A3F G;  5LMN Q;  3Q8D A;  3K80 C;  4AQY Q;  4JCV E;  2E2H H;  2ZJP A;  2B63 G;  2I0Q A;  4GN3 B;  4PMW A;  4A3K H;  1I3Q H;  3S24 A;  4LUV A;  2A8V A;  3TQY A;  4YHH L;  1VS0 A;  3CCL A;  3JAM i;  4KHZ A;  4A75 A;  1IBK L;  4JI7 Q;  1G29 1;  2I5M X;  1RIP A;  3PUZ A;  4JI0 L;  1Y1V H;  2JK8 A;  4L5T A;  4R1J A;  4OON A;  2DUD A;  4APV A;  1Q81 C;  1N34 L;  2VUM G;  1VQF A;  4JC0 A;  2UXC Q;  1E1T A;  4OX9 L;  3JAM c;  1WJJ A;  2OQK A;  2WB1 E;  4JI8 Q;  3NEN A;  4EQ5 A;  4IFD J;  3MXN B;  1Q46 A;  4QY7 A;  3S16 H;  1PH9 A;  4GLV B;  1EFW A;  1TWG H;  3GTJ H;  5E7N A;  3F2B A;  3L2P A;  5C44 H;  2CFM A;  4YWK A;  4A3E H;  1N34 Q;  5JJL A;  3S2H H;  1BKB A;  4A3B G;  4BBS G;  4K0K Q;  2ZM6 L;  3W5O A;  1ASY A;  3BU2 A;  1MIU A;  4HJ7 A;  4MNO A;  4LFC Q;  2YTY A;  1L2F A;  1YEZ A;  3CCQ A;  2EXD A;  4DV0 L;  1IBL L;  3J7A 5;  5LMN W;  4JG2 A;  2E2I H;  4IO9 A;  2NN6 G;  3ULP A;  2ZM6 Q;  1J5E L;  2EQS A;  4A3J G;  3F1Z A;  5GAE C;  2IY5 B;  2PQA A;  2JJQ A;  3HFZ B;  2BA0 A;  1KRS A;  3HOU H;  2AHO B;  4C3H H;  2RHQ B;  4ALP A;  5JJI A;  1T9H A;  1VQM A;  1EQR A;  5IYC H;  1E22 A;  1UE1 A;  2D62 A;  4JI3 L;  1CUK A;  3ULJ A;  3CME A;  4DR1 L;  1PH8 A;  2OTL A;  2BH8 A;  3KLW A;  3CCM A;  5HY6 A;  1J5E Q;  4BA2 I;  2VY3 A;  2R93 H;  3S1R H;  2VQF L;  1E3P A;  4LWC A;  4A3F H;  4DV4 L;  4AIM A;  2I5L X;  1PH2 A;  5JEA J;  2JEB I;  1QVG A;  4YCU A;  1VQ8 A;  1AE2 A;  4PZ7 A;  5IY0 A;  4DV1 L;  3T1Y L;  1A62 A;  2B63 H;  1VQN A;  3HOZ G;  1EIF A;  2IHF A;  1YHB A;  4P72 A;  1RL2 A;  2VL6 A;  1PH1 A;  1VQ7 A;  3UE1 A;  3GTP H;  1W2B A;  3J80 i;  1KC8 C;  2AWN A;  1GD7 A;  1UE7 A;  2VUM H;  1Q82 C;  1UE5 A;  1X3G A;  1XPR A;  2MQH A;  2R7D A;  3T1Y Q;  1X3E A;  1YHQ A;  1JMC A;  3HOW G;  1SRO A;  5ELO A;  2LXJ A;  3J80 c;  2RCN A;  4LF4 L;  3M9B A;  4IPG A;  2KCT A;  2PNH A;  4X65 L;  2ZJR A;  1U5K A;  3RN2 A;  4DUZ Q;  1KL9 A;  3TS0 A;  1SLJ A;  4JOI A;  4LUZ A;  5IWA L;  1OTC A;  3PF4 A;  1IYJ B;  4LF9 L;  3G48 A;  1MJC A;  3CPF A;  5M5X H;  2E8G A;  3BJU A;  4DV3 Q;  4R4I A;  3ICE A;  4A3B H;  4BBS H;  1VQG A;  4LF4 Q;  1I6H H;  1DGS A;  3RLN A;  4POF A;  3RNU A;  3I2Z A;  4X65 Q;  3PO2 G;  5M5W H;  4TVA B;  2NVX H;  1A8V A;  3GD7 A;  4POG A;  1M1K C;  1QVC A;  5FLM G;  1FVI A;  4JI6 L;  3M7N A;  3S1M H;  2HHH L;  1VQI A;  1L0W A;  2D0P A;  4LF6 Q;  3FKI G;  1PH6 A;  1IBM Q;  2NN6 I;  3T1H L;  5LMU Q;  1L1O B;  4GS3 A;  4DR3 Q;  1P16 A;  3LGJ A;  1YHA A;  2WAQ G;  4P75 A;  4A3J H;  2UU9 Q;  2UUA L;  4GKK L;  4ME3 A;  4LF5 L;  3ZJY C;  5M5Y H;  2XGT A;  4B3T L;  3G71 A;  4R4T A;  3CCR A;  4RG1 A;  4DR6 L;  3I4N G;  3FP9 A;  2XTI A;  4DR5 Q;  2JEA I;  2NVY H;  3HKZ E;  3T1H Q;  3PUY A;  4A3G G;  2UXB Q;  2R7F A;  1JJC B;  1E1O A;  4LF5 Q;  3B6Y A;  2F3I A;  4JI5 Q;  4GKK Q;  3KJP A;  1N8R C;  2N8N A;  3AFP A;  1Q1B A;  2Z0S A;  4GN4 B;  5BR8 L;  4DR6 Q;  4PZ6 A;  4HID A;  3ER0 A;  2QEX A;  3J81 j;  1G6P A;  1TWC H;  4Y52 H;  2A19 A;  4YCV A;  4KHP L;  2CCZ A;  1W3S A;  4J15 A;  1OXS C;  4C2M H;  4A3D H;  4OXP A;  3WWV A;  2YU9 H;  1K73 C;  4QGU A;  1KXL A;  3W1G A;  4DR7 L;  1OXV A;  4A3L G;  5GAH C;  4A3C G;  1VQB A;  2K4K A;  3M3Y H;  3HOW H;  1XMQ L;  2NZO A;  4KHP Q;  1LYL A;  2K5V A;  4DPG A;  4IOC A;  3OW2 A;  1Q8K A;  4X62 L;  1VQC A;  2VNU D;  1YZ6 A;  2KEN A;  5C0X G;  2KBN A;  3G4S A;  1Z9F A;  3K81 C;  1HJP A;  1HNZ L;  3S1Q H;  2Y0S G;  3PUW A;  3L0O A;  5AJ3 L;  3UE0 A;  1L1O A;  3PO2 H;  4XTC S;  3NBH B;  4YHH Q;  1PV4 A;  1NMG A;  3BZK A;  1PYB A;  1IBK Q;  1EIY B;  4JI0 Q;  4BY7 G;  2B29 A;  5FLM H;  1K8G A;  1HNZ Q;  2JA8 G;  1YJW A;  2N78 A;  3KOJ A;  4O0A A;  4HIM A;  4UPA A;  4OX9 Q;  5AJ3 Q;  1NTG A;  3FKI H;  2K50 A;  1PH5 A;  5C3E G;  1Q1E A;  1VQA A;  4UP7 A;  3EBE A;  1TWA H;  5FLX c;  1MKH A;  2N3S A;  5EAY A;  4LFA L;  1UEB A;  1TXY A;  2EIF A;  2BA1 A;  4DKA C;  4BXX G;  1OXX K;  4QQB X;  5DLQ E;  1K9M C;  2Z6K A;  2OWO A;  1HZ9 A;  2IX0 A;  1I5F A;  1KAW A;  1B8A A;  1VQD A;  2B3G A;  1FJG L;  2YTV A;  4NXM L;  3CCU A;  3CD6 A;  3I4N H;  1TWF H;  1VQK A;  1U0L A;  1GM5 A;  2HIX A;  1SFO H;  1L1O C;  4DV5 L;  4A3G H;  3K7U C;  2PI2 E;  1HH2 P;  3G6E A;  1UWV A;  2FXQ A;  1SN8 A;  1AE3 A;  4GLA C;  3KJO A;  4UY8 C;  1XNR L;  2LSS A;  4DV0 Q;  3U58 A;  1QZG A;  1IBL Q;  3ERS X;  3AFQ A;  3CC4 A;  3RLO A;  2PMZ E;  3I56 A;  1IXR A;  4GLX A;  4IFD G;  4WJ4 A;  1Q86 C;  2NZH A;  3D0F A;  3GTO H;  3KF8 B;  2UUB L;  3CXC A;  5C4X G;  1EUJ A;  3U4V A;  3KYH C;  3A5U A;  2Z6K C;  2ZTC A;  2E2J H;  3M4P A;  1PHJ A;  4A3L H;  4R4C A;  4JI3 Q;  4DR1 Q;  1K0R A;  4A3C H;  1H95 A;  1J6Q A;  1JJG A;  2JE6 I;  2ALY B;  2R6G A;  3RLF A;  1GVP A;  1VQ4 A;  1WYD A;  1VCI A;  2OQ0 A;  1FGU A;  4GNX B;  4GOP B;  2VQF Q;  1K8A C;  1HNX L;  2Q2T A;  3GTQ H;  3I4M G;  4DV7 L;  1B70 B;  3RZO H;  1D7Q A;  1KRT A;  4DV4 Q;  4Y7N H;  3PSI A;  4KLK A;  3TS2 A;  2UXD L;  5C0X I;  2NVQ H;  4DV1 Q;  2F52 A;  1FL0 A;  2H5X A;  3KF6 B;  4HIO A;  1JE5 A;  3H3V H;  3J7Z C;  1SR3 A;  4OWX B;  4A76 A;  3H3V I;  4LFB L;  1YI2 A;  5IYD G;  1HNX Q;  1NE3 A;  2VZA A;  2K5H A;  5HGQ A;  1I94 L;  4JI2 L;  1X9N A;  4BY7 H;  4A3D G;  2JA8 H;  5M3F G;  1VQH A;  3CW2 C;  2K75 A;  3RZD H;  1X3F A;  3SGI A;  1Y1W G;  4YY3 L;  3E9I A;  2K52 A;  5C3E H;  3EIV A;  2YTX A;  4X6A H;  4LNQ A;  1Y14 B;  5IWA Q;  1I94 Q;  2UUC L;  1XPU A;  4IOA A;  4BXX H;  4JI2 Q;  3VDY A;  1BBW A;  5JEA G;  4DV6 L;  4LF9 Q;  2KHI A;  4HJ5 A;  1M90 C;  2CKZ B;  1XPO A;  1JJ2 A;  3IRB A;  1CKM A;  1N33 L;  3JC6 6;  4OWT B;  1HR0 L;  1NBW A;  1X65 A;  1HZC A;  1TWH H;  5GAD C;  4GKJ L;  2JA5 G;  4OO1 G;  2UUC Q;  1N32 L;  1LTL A;  2PI2 A;  3OYY A;  4JI6 Q;  2GN5 A;  3OTO L;  4JI4 L;  2HHH Q;  4JV5 L;  2AKW B;  5IE8 A;  1HR0 Q;  3PCO B;  3HOX G;  3HOV G;  1XNQ L;  2OCE A;  4IFD I;  3M4Q A;  4GNX A;  4GN5 A;  4GOP A;  1N32 Q;  3TRE A;  1SE8 A;  3DM3 A;  4KI0 A;  5C4X H;  4DUY L;  2UUA Q;  4LF7 L;  1WFQ A;  4RMF A;  1WCM G;  2R7Z G;  2CWA A;  4JI4 Q;  4A3I H; 
#chains in the Genus database with same CATH topology
 4B3T Q;  1QIL A;  1TWC B;  1LO5 D;  4B3S L;  3L9A X;  1VQ6 A;  1X6O A;  1B3A A;  2Q8R E;  3G7L A;  2OF1 A;  1B44 D;  2F0O A;  3NSW A;  2WB1 G;  2V1C C;  1SYF A;  3S1N H;  3HG9 A;  2E2H B;  5BR8 Q;  3F2C A;  2CH4 A;  1EWI A;  2L15 A;  2HT1 A;  3PUX A;  3DEO A;  2ATW A;  2F3V A;  4KY7 A;  3P1H A;  2WV6 D;  1V1Q A;  5K5P A;  1STE A;  3RN5 A;  4AQY L;  1PMR A;  4C3I G;  1BBU A;  2F0D A;  2QDL A;  1F2Y A;  2ZTE A;  3VR4 A;  3VYT A;  2K14 A;  1TS5 A;  1XMQ Q;  2KCM A;  1SNC A;  4TQU S;  4FO2 A;  3VR5 A;  1SAP A;  5D65 A;  1E2W A;  4PMC A;  3PV0 A;  4RHR A;  4LF8 Q;  1XWE A;  1AN8 A;  4DK0 A;  1AP0 A;  3BVZ A;  1J8I A;  1PRT B;  3UI2 A;  1PYW D;  1D5Z C;  3KUP A;  2AMC B;  2I46 A;  4JBW A;  1SJH D;  2XNA C;  5COR A;  3HOV H;  1AEX A;  3AQQ A;  3UDX A;  1N36 Q;  3CHB D;  1R4Q B;  2PZT A;  4AH6 A;  4LFA Q;  3L7Z C;  1AH9 A;  1PDQ A;  2K28 A;  4XDX A;  2SNS A;  2R7Z H;  1FJG Q;  1E2Z A;  4CDE C;  3NE5 B;  1I6V C;  2VB3 X;  4HJ8 A;  1CSP A;  2FMM A;  1D5M C;  3HGB A;  3HOY H;  1S5D D;  4A93 G;  4K2K A;  2R93 B;  3CQZ H;  1Q8I A;  3K8A A;  4JBJ A;  3F2D A;  3TSS A;  3K0X A;  4DAY B;  3K5N A;  1F9Q A;  1MJE A;  3A7A B;  4QJF A;  5GAG C;  1LAB A;  3NBH A;  2UUB Q;  2ENB A;  2J4X A;  2F03 A;  3KLS A;  1LTS D;  2VS1 A;  2D0O A;  1HFG A;  2GVA A;  3MC0 B;  5IT9 c;  2NB0 A;  1KDA A;  1XXG A;  2CW0 C;  2JP1 A;  4B9X A;  3I7F A;  1WTR A;  1E7Z A;  4FVM A;  3SK8 A;  2ZJQ A;  1EU4 A;  3GDE A;  3CAM A;  1HNW L;  4BBR H;  2K5N A;  3BG3 A;  4ZK9 B;  5IT9 L;  4LFB Q;  2EY1 A;  3I73 A;  4JVZ A;  2JA6 H;  3T13 A;  1WVL A;  3HKZ G;  1WTV A;  4DV3 L;  5IGB A;  3TME A;  4WJW A;  4YY3 Q;  1PYS B;  3ITP A;  1GJX A;  1V9P A;  1NJI C;  1Q3L A;  1CFM A;  2QA4 A;  3J81 i;  3GTG H;  2XRS D;  2A69 C;  5M5Y B;  1A63 A;  1LTA D;  1KAA A;  2K03 A;  2VXW A;  1AZP A;  1LTB D;  1E0B A;  3J81 c;  2GA4 B;  5LMU L;  2N55 A;  5C4X B;  2UU9 L;  1VDZ A;  1CKN A;  2MGS A;  3I4L A;  1I4Q A;  1X55 A;  5K36 H;  3PO3 H;  2N88 A;  1XTD A;  4ZAI A;  4HIK A;  3AYH B;  4HSV A;  1YNJ D;  2F0M A;  4DR5 L;  2QGQ A;  4HCS A;  4JYA Q;  2QKI C;  2B2V C;  1LT3 D;  1Y69 U;  1GUN A;  3J81 L;  3T51 B;  4JI5 L;  4NP5 A;  3S1N B;  3PF5 A;  1LLR D;  3ULL A;  2VW9 A;  5IP9 H;  5T1I A;  1STG A;  2QW7 A;  2K01 A;  1JOO A;  1DYQ A;  4M1U B;  1ENC A;  5C4J H;  2CQO A;  5IYC G;  2F4V Q;  5KND A;  3H15 A;  2EYP A;  3Q6S A;  4QL5 A;  1K3B C;  3HOZ H;  1DON A;  1Z47 A;  3GV3 A;  4OWW B;  1VQE A;  4JI1 Q;  5LMN Q;  1XX8 A;  3X3N A;  2B63 G;  2I0Q A;  3DHQ A;  1A6X A;  5FK9 C;  1WD0 A;  5FO7 B;  4KHZ A;  5CBE E;  4A75 A;  2WKD A;  2I5M X;  1GXD C;  5JJZ A;  3PUZ A;  3U9O A;  4JI7 Q;  1Y1V H;  4L5T A;  4R1J A;  4FNF A;  1CI3 M;  3MWY W;  1Q81 C;  2VUM G;  3HOV B;  2UXC Q;  3IFT A;  4OX9 L;  4RH6 A;  4JI8 Q;  4QY7 A;  4U67 3;  1BF4 A;  1BCP D;  3S16 H;  1TWG H;  2R7Z B;  3GTJ H;  3I3C A;  1EYD A;  1HA6 A;  2ICI A;  4V0B A;  4JW0 A;  1BKB A;  1O78 A;  4ULL A;  2LS0 1;  3CQZ B;  2ZM6 L;  2Z4I A;  2RCF A;  3QJY A;  4CDD C;  4LFC Q;  2YTY A;  3P7J A;  2E2J B;  5JPM C;  4IO9 A;  3CRK C;  5D3D A;  4A3J G;  5IGG A;  3GTQ B;  1D6E C;  2BA0 A;  1KRS A;  4IUU A;  3HOU H;  1JOQ A;  4ALP A;  1I4R A;  5JJI A;  2K6A A;  1T9H A;  1VQM A;  1E22 A;  2D62 A;  3CME A;  3J80 E;  3CCM A;  2VY3 A;  2EY5 A;  3S1R H;  3KLS X;  4BY7 B;  4ZLT F;  1S5E D;  1QVG A;  4BBR B;  4L6T B;  4DV1 L;  5IY0 A;  1BCP F;  3HOZ G;  4P72 A;  3QIA A;  5CC4 A;  2TMP A;  2BCO A;  3AB9 A;  3BDL A;  2PYK A;  3BVG A;  4FXG C;  3UE1 A;  1O7Y A;  2AWN A;  1KLG D;  1UE7 A;  5I2Y A;  1UE5 A;  1YHQ A;  2R7D A;  3T1Y Q;  1A3T A;  1X3E A;  1Y8O B;  4K8I A;  5ELO A;  2RCN A;  4LF4 L;  2KCT A;  2PNH A;  4DUZ Q;  1KL9 A;  3TS0 A;  1SLJ A;  3PF4 A;  3LWU A;  3PIP 3;  3G48 A;  1MJC A;  3CPF A;  1HTL D;  4A3B H;  4BBS H;  1DGS A;  4X65 Q;  2NVX H;  1A8V A;  3H09 A;  3PO3 B;  4JI6 L;  3M7N A;  4S3S A;  2F0F A;  3IAY A;  2SNM A;  2NN6 I;  5A2Q L;  3LGJ A;  4P75 A;  2WAQ G;  4Z9C B;  2NYZ D;  4K5X A;  3ZJY C;  5KIX A;  3ZYY X;  3NP8 A;  3FP9 A;  2JEA I;  2I07 B;  3T1H Q;  4A3G G;  2EE1 A;  4K2L A;  1TQO A;  1E1O A;  1YNJ C;  5C4J B;  1N8R C;  1TT2 A;  4HR7 B;  1SYB A;  4GN4 B;  5FOB B;  4KMU C;  1JR0 D;  5KYL A;  2QEX A;  1G6P A;  2F0E A;  1Y1W B;  2RKS A;  1CK1 A;  4KHP L;  2B2W C;  1W3S A;  2L9H A;  4IUN A;  1C8C A;  2EYJ A;  2ICE C;  4IUR A;  1K73 C;  4MHE A;  3W1G A;  1V8Q A;  1OXV A;  3FMC A;  1U4M A;  3HOW H;  5FLX E;  1LYL A;  1TVX A;  2K5V A;  3C2P A;  1Q8K A;  2EYM A;  1Y1V B;  4X62 L;  1TS3 A;  5C0X G;  2KBN A;  1HNZ L;  1HRJ A;  2K5W A;  4G7Z C;  3S16 B;  3KK7 A;  3PO2 H;  3VR3 A;  3GTJ B;  1PYB A;  1YNN D;  4JI0 Q;  2JA8 G;  2N78 A;  1NTG A;  3FKI H;  1VQA A;  1QJO A;  3EBE A;  1TWA H;  4UP7 A;  3P20 A;  5EAY A;  2B2T A;  4DKA C;  1TXY A;  5DLQ E;  2Z6K A;  2JYO A;  1I5F A;  3GTM B;  3I4N H;  1TWF H;  1VQK A;  3I70 A;  1EY5 A;  4KTA A;  3HOU B;  3URY A;  1HH2 P;  5E4X A;  3K57 A;  3KJO A;  3ERS X;  1EZ8 A;  1KTK A;  4IFD G;  2NZH A;  3S1R B;  3GTO H;  3CXC A;  2A6H D;  1GUW A;  1Z7T A;  3A5U A;  3T56 B;  2ZTC A;  5E1F A;  4M8A A;  2VB2 X;  4CHT B;  4JI3 Q;  4MIU A;  3E6Z X;  2QDB A;  4NW2 A;  3R8B A;  1VCI A;  2R92 B;  1BOS A;  2Q2T A;  3D4W A;  3QOJ A;  5DEH A;  1T5X D;  4DV7 L;  3RZO H;  1EY4 A;  4KLK A;  5DAU A;  3NQT A;  2EJG C;  2H5X A;  1FL0 A;  3KF6 B;  4XT3 B;  3MHB A;  3H3V H;  4XQQ A;  3J7Z C;  5M3M B;  1M4V A;  1JE4 A;  2K5H A;  5C3W A;  4JI2 L;  1X9N A;  1I4P A;  4A3B B;  4BBS B;  2NZ1 D;  3RZD H;  5EGT A;  2NVX B;  2DY8 A;  2K52 A;  4X6A H;  1HA5 A;  2YTX A;  5LL6 X;  1IKL A;  1V1O A;  1Y14 B;  3J80 L;  1FD7 D;  1M90 C;  1XPO A;  1CKM A;  1Z6H A;  4OWT B;  1X65 A;  3D4R A;  2ZT9 C;  4ZCK A;  2JA5 G;  3GTK B;  4GKJ L;  5KEE A;  4C3J G;  3OYY A;  4JI4 L;  1TII D;  5IE8 A;  4RWS C;  3HOX G;  1HR0 Q;  1D5X C;  3MXU A;  1XNQ L;  1CT1 D;  1MSH A;  1SE8 A;  4KI0 A;  4DUY L;  5LHY 1;  3K5M A;  4A3I H;  4KN7 C;  2Q2U A;  2F4I A;  1F9S A;  4HSP A;  3VA5 A;  1UUP A;  1LT6 D;  4ZKC B;  4Q0F A;  2E5L L;  3K5O A;  3HOW B;  3S15 H;  1EIG A;  4B3S Q;  3H0G G;  3U4Z A;  2IJ0 A;  2KUM A;  1WI5 A;  1SYG A;  4LK1 C;  4HMI A;  1B7Y B;  4RCO A;  4MZ9 A;  2FFK B;  4A3D H;  4DV2 L;  3GO5 A;  4AYB E;  2PQA B;  4YWM A;  1K28 A;  1PH7 A;  3S14 H;  1SMY C;  1JT8 A;  1C7Y A;  4EX5 A;  1BQQ T;  1SYE A;  3DUZ A;  1TWA B;  3R2T A;  2Q2H A;  5CV5 A;  3SVM A;  1EY0 A;  3A5Z B;  4QUF A;  4DK1 A;  4OO1 I;  4AYB B;  4X64 L;  1X56 A;  1R9T H;  2Z9H A;  1TWF B;  3M85 A;  1YNN C;  2EOT A;  4DNI A;  3EQL C;  5FO8 B;  4WJ3 M;  1A3V A;  1B4O A;  4MTN A;  3PQI A;  2JN4 A;  2A68 D;  5IT9 E;  1WCM H;  5FLX L;  2JA9 A;  5FJ8 G;  3CCV A;  5IP7 G;  4K5W A;  4L5S A;  1JWU D;  5TSS A;  3GTO B;  2DNC A;  5I6W A;  2Q2I A;  3A0J A;  1U9R A;  1EWH A;  1FNW A;  4DV5 Q;  1L0X B;  2Y0S E;  2A1A A;  4L5R C;  2WII B;  3G6J B;  1XNR Q;  3EVQ A;  3KBG A;  4A3I G;  1EOV A;  4P74 A;  2EPB A;  4OEL B;  4NDX A;  3GV6 A;  3TBI B;  3UDG A;  2QEJ C;  3A74 A;  2KQ3 A;  3SE0 A;  2WFW A;  1O7I A;  2A6H C;  3K6O A;  5ELC A;  2Y0S B;  4OIJ A;  2L5T A;  4C3I H;  3CC2 A;  2EJM A;  2Z1C A;  1VMC A;  1SMX A;  1IKM A;  4RGT A;  3BDC A;  3CMA A;  3S17 H;  2PW5 A;  1CA6 A;  3E5S A;  2PCF B;  1PXU A;  5EBC A;  1VF7 A;  3FEW X;  1PRT D;  2XIW A;  5JVG 3;  3J81 E;  3UDI A;  2IX1 A;  1SBB B;  4PZ8 A;  1XMO L;  4RGM A;  4O42 A;  3SEB A;  4KD3 A;  3WOE A;  3I55 A;  3KDF B;  1A3U A;  4YWL A;  4KHV A;  1HNW Q;  1K83 H;  1FYC A;  1BVS A;  2QF7 A;  4FF4 A;  1SE3 A;  2B2V A;  2LXK A;  2BOS A;  1LT5 D;  2YV5 A;  4DV6 Q;  1IYU A;  5JJK A;  4DAY A;  2MO0 A;  4LF6 L;  4C56 C;  1EYC A;  2NVY B;  2SDF A;  1K3R A;  1YBY A;  1UE6 A;  4A93 H;  4DR3 L;  1MI2 A;  4B3R L;  1ZXT A;  4A3E G;  3MVV A;  4JBM A;  1JB3 A;  3FPU B;  4F7X A;  1WTO A;  1UEA B;  2UXB L;  4DFA A;  4PG3 A;  3HKS A;  4H44 C;  1PRT F;  5JAV A;  4P71 A;  3M4Y A;  2F0H A;  1YVC A;  2WIN B;  1BUV T;  1STA A;  1WTQ A;  4H02 A;  2BH2 A;  1EIH A;  1VQP A;  1PH3 A;  4XIG S;  2HIV A;  3UDF A;  4UP8 A;  3S1Q B;  4A3D B;  1X54 A;  1GOZ A;  3TZD A;  1Y8N B;  2FIN B;  1UNS A;  5EKI A;  1HTP A;  2R93 G;  1FR3 A;  4N8X 1;  3TP6 A;  1BO0 A;  1O7L A;  1PZK D;  4KV6 A;  3S14 B;  2IW3 A;  4A3F G;  1D1I A;  2A6E D;  3Q8D A;  3K80 C;  3HZX A;  4F88 A;  4GN3 B;  4PMW A;  5JOB A;  4LUV A;  3CCL A;  2CH4 W;  1MHW C;  4RHS A;  3E3X A;  1R9T B;  2JK8 A;  4APV A;  4OON A;  1VQF A;  1RD9 D;  1IL8 A;  2WB1 E;  2HCI A;  3NEN A;  1Q46 A;  5M9O A;  1EFW A;  4RA8 A;  1WCM B;  3L2P A;  2AQ2 B;  2B2Y C;  5EKL A;  3NBI A;  4K0K Q;  2DJG C;  3DWQ A;  4KKT A;  1MSG A;  1CZG A;  4EQO A;  2WB1 B;  3BU2 A;  1C4Q A;  1YEZ A;  2EXD A;  4DF7 A;  4DV0 L;  1IBL L;  3S9W A;  2PW7 A;  5LMN W;  4ID6 A;  2NN6 G;  2F0L A;  2A68 C;  3HP3 A;  5J22 A;  2ZM6 Q;  1J5E L;  2O5I C;  3F1Z A;  5GAE C;  3HFZ B;  3C46 A;  2KCC A;  2KVM A;  1TY2 A;  1EQR A;  4C3I B;  5IYC H;  1PH8 A;  3ULJ A;  1NAP A;  2R61 A;  2AQ3 B;  4HCE A;  1SE4 A;  3TP7 A;  3FDT A;  5A2Q E;  2JEB I;  4CGY B;  1DOK A;  2A5H A;  4H7B A;  4PZ7 A;  1A62 A;  2B63 H;  2BDN A;  5C3E B;  2HDM A;  1EIF A;  2RSN A;  1U4P A;  1YHB A;  2RBM A;  2F1M A;  1KDC A;  2K5D A;  2VL6 A;  1B50 A;  4TRD A;  1EZ6 A;  1W2B A;  1KC8 C;  1GD7 A;  1K83 B;  5HUR A;  2VUM H;  2MQH A;  3A55 A;  3QO2 A;  4CJ0 B;  2LXJ A;  1PRT C;  2E76 C;  3A54 A;  3RN2 A;  1U5K A;  1F2L A;  5IWA L;  4JOI A;  1OTC A;  1MD2 D;  3SK6 A;  1UAP A;  4PMB A;  5CMD A;  2E8G A;  3BJU A;  3BS1 A;  4R4I A;  3ICE A;  1PZJ D;  1VQG A;  4LF4 Q;  3BDO A;  3RLN A;  5D3I B;  5KYI A;  4TSS A;  5FLM G;  1FVI A;  2HHH L;  1EY7 A;  3GP7 A;  3AMU A;  1PH6 A;  1IBM Q;  3MXP A;  2B2W A;  2KEE A;  4HED A;  4GS3 A;  2MPM A;  5E4W C;  4A3J H;  2UUA L;  5D14 A;  2CQA A;  5EJW A;  1WTP A;  3N52 A;  4ME3 A;  2E2D C;  4B3T L;  5ELF A;  3BZD B;  2B8F A;  3DEP A;  3QB3 A;  3HKZ E;  3CU7 A;  1Y8P B;  3PUY A;  3IL8 A;  3NUC A;  2OEO A;  3B6Y A;  4ILW A;  1EY6 A;  2DN8 A;  1Q1B A;  2Z0S A;  5BR8 L;  4PZ6 A;  4HID A;  2X69 A;  4Y52 H;  4YCV A;  1F9R A;  4HAE A;  3HKZ B;  4C2M H;  3HRZ C;  1K8O A;  1ET6 A;  3WWV A;  5DM7 3;  4A3L G;  5GAH C;  3TP8 A;  4UDU C;  1ROD A;  2K4K A;  4QMG A;  3M3Y H;  1XMQ L;  2NZO A;  1KDB A;  2EZV A;  3V05 A;  4KHP Q;  4C1N K;  3MEH A;  4DXG A;  2VNU D;  1JOK A;  2KEN A;  1HUM A;  1Z9F A;  1HJP A;  4JPB W;  1HCZ A;  3PUW A;  5AJ3 L;  2A6E C;  4DNT B;  5C4Z A;  3NBH B;  4YHH Q;  1PV4 A;  3BZK A;  1IBK Q;  4DAP A;  4BY7 G;  1HNZ Q;  1NR4 A;  4HIM A;  3HOY B;  3BYY B;  4OEM B;  1PTO H;  1Q1E A;  1WTH A;  1DXM A;  4LFA L;  2Z4H A;  3PIO 3;  1U4R A;  4EQP A;  3TDQ A;  1VQD A;  2B3G A;  3MAQ A;  1FJG L;  1CA5 A;  3CD6 A;  4QF4 A;  4R8I A;  1SFO H;  2G9D A;  2TSS A;  4A3G H;  2PI2 E;  3R3O A;  1NNX A;  1UWV A;  4GLA C;  2LSS A;  4L63 B;  1QZG A;  1CHP D;  2G9H D;  3R2I A;  3KF8 B;  2UUB L;  1EUJ A;  1U4L A;  3U4V A;  3MXG A;  4DAV A;  2B63 B;  2M2L A;  4R4C A;  5J1Z A;  2B2U C;  1K0R A;  2KEC A;  4DR1 Q;  1H95 A;  1J6Q A;  1HXY D;  2ALY B;  2L12 A;  2J0T D;  2JA6 B;  1T5E A;  1VQ4 A;  2OQ0 A;  4GOP B;  1HNX L;  3I4M G;  2VQF Q;  2O2L D;  2VUM B;  1D7Q A;  1KRT A;  4DV4 Q;  4Y7N H;  5C0X H;  1STH A;  2DY7 A;  1JE5 A;  4LFB L;  3GTG B;  5IYD G;  1NE3 A;  3WOF A;  4MN3 A;  5IGD A;  2JA8 H;  5M3F G;  1G6Z A;  1WD1 A;  1O80 A;  1Y1W G;  2QIL A;  4YY3 L;  3EIV A;  2UUC L;  4JI2 Q;  5ELB A;  1BBW A;  4X3S A;  5JEA G;  4LF9 Q;  4HJ5 A;  3NTK A;  3JC6 6;  1TWH H;  2L1B A;  2OXP A;  4OO1 G;  1LTL A;  5LL6 S;  5KRU A;  1FGB D;  4IUV A;  4JK1 C;  3PCO B;  1GHJ A;  3MTS A;  4ZUJ A;  4IFD H;  2R3Z A;  5C5L A;  1EY9 A;  3J7A F;  1CZW A;  4JI4 Q;  4LF5 Q;  4KK7 A;  2VQE L;  1H9S B;  1PA6 A;  2AQ1 B;  4JBK A;  3HOZ B;  2HUG A;  2ASB A;  3RR5 A;  3PIO A;  3I8Z A;  1QE6 A;  3KFU A;  2AWO A;  4PV1 C;  4DUY Q;  3DMU A;  5GQO A;  3TP5 A;  1KNE A;  3STB D;  3M3Y B;  4J1M A;  1PFB A;  1PFS A;  1RKN A;  3E9H A;  2F4V L;  5T1G A;  3MZ5 A;  2LY7 A;  2KCN A;  1SMY D;  4GOP C;  2FMC A;  3L3O C;  2RHS B;  3I90 A;  4JI1 L;  4FXD A;  3IKJ A;  4YCW A;  4DR7 Q;  5J39 A;  1EQT A;  2DNE A;  3T4A C;  1C9O A;  2ID0 A;  4L5Q A;  5L37 A;  1H9J A;  2E5L Q;  1JJG A;  2WAQ E;  4IPH A;  1GO3 E;  4IZ8 A;  4X3U A;  2FJ2 A;  1HR0 W;  1RF2 D;  5IOD A;  1TWG B;  1WTW A;  4DR4 L;  2KHJ A;  3CRL C;  1G2T A;  4JI7 L;  1SJE D;  4WRD A;  4O1N A;  4PQX A;  5F2D A;  2Z6B A;  2F0S A;  2UXC L;  2SOB A;  1PTO B;  1XYI A;  4DAM A;  4DV2 Q;  3NTI A;  1QZH A;  1ZEQ X;  2IX3 A;  2RDH A;  5G3L F;  4JI8 L;  1V43 A;  2WAQ B;  4NXN L;  2R92 G;  2JA5 H;  3D4D A;  4O2D A;  4C3J H;  3CC7 A;  4ZYS A;  3HOX H;  4A3G B;  4DNR B;  5M3M G;  3PIP A;  4LW1 A;  2D5D A;  5J3B A;  4LFC L;  4X64 Q;  1AW7 A;  1SDF A;  2PZW A;  3MA2 B;  4NXM Q;  1OXT A;  2E75 C;  3OPO A;  1VQ5 A;  3SK4 A;  4HJ9 A;  4IUT A;  3S2D H;  2OTJ A;  2NBF A;  3NK9 A;  5DM6 3;  3DXJ C;  4A3M H;  2BDO A;  3OHX C;  2ZXO A;  1NY4 A;  1SND A;  1RDP D;  3LWE A;  3FVQ A;  3K5L A;  4P73 A;  3H0G H;  4CKB A;  2K04 A;  2NVT H;  3ND8 A;  4Y7N B;  1S3O A;  2IPK D;  1QWY A;  2XVS A;  1F9P A;  4BY1 G;  1SRU A;  4K6D A;  2JA7 G;  1C0A A;  4DK6 C;  1BDO A;  1F77 A;  2F3W A;  1G91 A;  3TEH B;  4G7O C;  1VQL A;  4IPD A;  1EWC A;  2JA8 B;  3E0J A;  4IUP A;  4A4I A;  2UXD Q;  5IYB G;  3W1B A;  1QUQ B;  2RDG A;  3C1E A;  3OIP A;  4BA1 I;  2MNA A;  2F0J A;  1E24 A;  4RGN A;  5COY A;  4DUZ L;  1PLF A;  2MJ8 A;  5H1S E;  2KOL A;  1G2S A;  1TWH B;  4A3K G;  4B3M L;  2CVR A;  1SYC A;  1CSQ A;  4FDB A;  4PNY A;  1XMO Q;  4X66 L;  1EQV A;  2IT1 A;  3AU7 A;  2KHS A;  1N33 Q;  3SDZ A;  5FJ8 H;  1YIJ A;  5ELN A;  4DR2 L;  2EJF C;  5IP7 H;  3NXW A;  1PVO A;  1NSN S;  2EYF A;  5BN4 A;  4N9P A;  5C44 G;  2IL8 A;  2EYO A;  4XQN A;  3OTO Q;  2PZU A;  4JV5 Q;  3CF5 A;  3U50 C;  3MEF A;  4IJL A;  4HJA A;  1HPC A;  2HQL A;  2EDG A;  3D31 A;  4LF7 Q;  4B3R Q;  1Q7Y C;  1LUZ A;  4AYB G;  4EVO A;  3DLL A;  4A3M G;  4X3T A;  2K33 A;  5C0X J;  1YIT A;  1JQY D;  1LT4 D;  4IPC A;  4E6I A;  1EY8 A;  3EJI A;  2GVB A;  4C3H G;  1Q12 A;  1IYV A;  3BYT B;  3X3M A;  3KDF A;  3NEL A;  1S72 A;  2C35 B;  1I50 H;  5EPJ A;  1QOH A;  2MFI A;  1BXT A;  1S40 A;  3STB C;  3PO2 B;  1A2T A;  3AEV A;  2I5H A;  3F8T A;  1K0S A;  2B2Y A;  2H1E A;  1STY A;  4AQY Q;  1II3 A;  2E2H H;  3FKI B;  4CKE A;  2A8V A;  1I3Q H;  5CYU A;  3S24 A;  2JA5 B;  3VYU A;  3JAM i;  4I7A A;  1G29 1;  1F2Z A;  1RIP A;  2O4X A;  4JI0 L;  1N34 L;  1JOR A;  3HOX B;  3I4N B;  4CBV A;  5I4D A;  3JAM c;  1WJJ A;  2OQK A;  1ILP A;  4IFD J;  4EQ5 A;  3MXN B;  1PH9 A;  4GLV B;  4XYQ A;  5E7N A;  2A73 B;  3F2B A;  3VYR A;  4A3E H;  5JJL A;  1IHZ A;  3SHL A;  2RSO A;  4IQZ A;  3S2D B;  1EEF D;  3JAM L;  4RAU C;  1MIU A;  1L2F A;  1PZI D;  3CCQ A;  3J7A 5;  1X32 A;  2F0I A;  4J6H A;  1LTI D;  4H0L C;  2NVT B;  4I7Z C;  1QCB D;  2EQS A;  5CV8 A;  3SR1 A;  1I4X A;  2IY5 B;  2JJQ A;  3RZO B;  2AHO B;  4KN4 C;  1A2U A;  3GQB A;  5C6A A;  3D3R A;  1H9R A;  4ODG A;  2JSO A;  5AFW A;  1DOL A;  4JI3 L;  4CJ1 B;  2OTL A;  1CUK A;  5A35 A;  2BH8 A;  5HY6 A;  1J5E Q;  4BA2 I;  2R93 H;  1ENF A;  1E3P A;  2HD3 A;  4LWC A;  1O7Z A;  4A3F H;  2I5L X;  2NUC A;  1PH2 A;  4FF3 A;  3RZD B;  4YCU A;  4HMJ A;  3J7A V;  2IHF A;  3DWA A;  1RL2 A;  3V2T A;  1FNV A;  1ML0 D;  4ZKB B;  2EYH A;  1Q82 C;  1JMC A;  1RHP A;  4KJO A;  3M9B A;  1DZ1 A;  1D1K A;  1S5C D;  4IAL A;  5M5X H;  4FP5 D;  4DV3 Q;  3OWE B;  4POF A;  4L8J A;  3I2Z A;  3VR2 A;  4TVA B;  5M5W H;  1HQM C;  2L11 A;  3GD7 A;  2OT2 A;  4P2C B;  1SNM A;  1QVC A;  5CV7 A;  4A3I B;  1SNO A;  3S1M H;  1VQI A;  1L0W A;  4UAI A;  1LTR D;  4K8J A;  2EYL A;  2NN6 H;  4J8Q A;  5LMU Q;  1L1O B;  1S5F D;  1ILQ A;  1P16 A;  4DN4 M;  1YHA A;  2UU9 Q;  1W6J A;  2F0G A;  4GKK L;  2C9O A;  3ND9 A;  5M5Y H;  3S15 B;  2XGT A;  3G71 A;  3CCR A;  4DR6 L;  2K5Q A;  1D2B A;  2M9V A;  2XTI A;  3PMF A;  5CBA E;  4DR5 Q;  2R7F A;  1JJC B;  4G4K A;  4JI5 Q;  4R9W A;  3KJP A;  3RUZ A;  2N8N A;  5KNC A;  1I50 B;  2XWB B;  5I6Y A;  3H3V C;  3J81 j;  3TN2 A;  2A19 A;  4B08 A;  2K05 A;  2YU9 H;  4QGU A;  2MP1 A;  1SYD A;  4A3C G;  1VQB A;  1I3Q B;  2NTT A;  4Q5V A;  4DPG A;  4IOC A;  3OW2 A;  1EOT A;  1C48 A;  1VQC A;  5IOC A;  3K0Y A;  1LV9 A;  3G4S A;  2A74 C;  5EBD A;  3NWT A;  3UE0 A;  4KKU A;  4A3E B;  2X6L A;  5ISR A;  1GHK A;  5FLM H;  4ME5 A;  1YJW A;  4UPA A;  4OX9 Q;  5AJ3 Q;  2K50 A;  1PH5 A;  5C3E G;  4IUQ A;  1LAC A;  1TU2 B;  1MKH A;  3J7Y W;  4R8N A;  4BXX G;  1RCV D;  2OWO A;  4N8F A;  3RD4 A;  4G57 A;  1E2V A;  2Q8I B;  1SNQ A;  2B2U A;  3CCU A;  1U0L A;  1ICF B;  3D8G A;  4K6L A;  1L1O C;  4DV5 L;  4XYO A;  2P5Z X;  2PPB C;  1STN A;  3C3L A;  3G6E A;  2FXQ A;  1SN8 A;  4KY5 A;  1XNR L;  4EQN A;  3U58 A;  3AFQ A;  1BR9 A;  3CC4 A;  3RLO A;  2PMZ E;  1IXR A;  4RGO S;  2KA7 A;  2KJX A;  3P75 A;  1TY0 A;  3S17 B;  2XRQ D;  1JWS D;  5C4X G;  1DD2 A;  4A3F B;  2PNR C;  3KYH C;  2E2J H;  5IGE A;  2KED A;  3M4P A;  3OSO A;  4G7H C;  3FRP B;  1PHJ A;  4A3L H;  3NQI A;  1V1P B;  2JE6 I;  2L4N A;  1HUN A;  1H9M A;  2PMZ B;  1WYD A;  4GNX B;  1TR5 A;  1FGU A;  3GTQ H;  2XWJ B;  2L55 A;  1B70 B;  3TS2 A;  3M7G A;  2NVQ H;  4DV1 Q;  5BN3 A;  2CHB D;  1QB5 D;  4HIO A;  4DA2 A;  2E74 C;  3D6C A;  1SR3 A;  4OWX B;  4A76 A;  3H3V I;  1HNX Q;  5HGQ A;  2Z8L A;  3QWN A;  1I94 L;  3WDN A;  5M5X B;  2BE5 D;  4BY7 H;  3H94 A;  4HN7 A;  1TS2 A;  3TZU A;  2K75 A;  4IN3 A;  4KD4 A;  5M5W B;  4XT1 B;  4A93 B;  3E9I A;  1R4P B;  3I72 A;  2HQE A;  4LNQ A;  4IOA A;  2O5J C;  3NTH A;  3S1M B;  4FF2 A;  4DV6 L;  2KHI A;  2CKZ B;  3IRB A;  2AUJ D;  4UHV A;  1HZC A;  3RMH A;  3KF8 A;  5I2X A;  2UUC Q;  1N32 L;  2RA4 A;  4GZY C;  2PI2 A;  5C4H A;  2GN5 A;  4F8M A;  4JI6 Q;  1QNU A;  3HOV G;  3MFY A;  3ERO A;  1BNZ A;  3SXH A;  1CTM A;  4GN5 A;  4GOP A;  1I4H A;  1DOM A;  4I65 A;  2NTS A;  2R7Z G;  5JVH 3;  1KNA A;  1M8A A;  4F87 A;  5CGK A;  1LM0 A;  3H6M A;  2YYZ A;  1QNK A;  2B39 A;  3HOY G;  5CV4 A;  2SEB D;  4KKS A;  1AFP A;  1SEB D;  2YU9 B;  1IZ6 A;  3I4M H;  2WAC A;  1N9W A;  2VQE Q;  1ENA A;  1VQO A;  1NMF A;  1YJ9 A;  4GNX C;  4R4O A;  1B1Z A;  5IYD H;  4XXE A;  3NEM A;  4DXF A;  3EN2 A;  4LF8 L;  5M3F H;  1Y1W H;  4OHJ A;  2H4O A;  2IHE A;  1SNP A;  4QIW E;  4N9T A;  4X62 Q;  3QR8 A;  2F0N A;  3KLR A;  5JEA H;  2RVL A;  1JB7 A;  3K59 A;  2F0P A;  1VQJ A;  4BBR G;  1KHI A;  1N36 L;  1QVF A;  2JA6 G;  4DR4 Q;  1RJT A;  4OO1 H;  4NPS A;  3HS0 C;  1YJN A;  4QIW B;  4ZRZ A;  1EL0 A;  1GKH A;  1H9S A;  4K0K L;  5I9P A;  1IL2 A;  4NXN Q;  3QOL A;  2EY6 A;  3FHW A;  1DJR D;  1GUT A;  2MUY A;  1XJV A;  4MTK A;  1KD1 C;  1DCZ A;  1X3Q A;  2IWH A;  3GTL H;  1TS4 A;  3PUV A;  3HEJ A;  1JC7 A;  3NWS A;  5K36 G;  4DGZ A;  3PO3 G;  3MFG A;  3TRZ A;  3GTM H;  1QG7 A;  1B3Q A;  3W2D A;  2ZTD A;  1EYA A;  1B53 A;  1CKN B;  2RF4 A;  2PO4 A;  5IP9 G;  1AZQ A;  2NVQ B;  3SK5 A;  1NCV A;  4RCN A;  4K14 A;  5GRO A;  2V4D A;  2N49 A;  4TKO B;  3Q24 A;  3DWP A;  2HDL A;  3CCJ A;  1EQQ A;  1GUG A;  1PTO D;  4FF1 A;  3M4O H;  1RTO A;  4DV7 Q;  1PFM A;  2ES2 A;  1G51 A;  1GUS A;  1WTX A;  3D6W A;  1J9O A;  1OXU A;  2F0K A;  2R92 H;  4FXK C;  2F0W A;  4ABN A;  1RTN A;  1PH4 A;  4QCL A;  1HFN A;  4IJH A;  5I9O A;  2JQO A;  1CHQ D;  3VYS A;  2BE5 C;  4LUO A;  4A3J B;  4RKB A;  2C5C A;  3A8K E;  5M3M H;  1Y1V G;  4ZUI A;  4DK3 C;  1ZKO A;  3Q22 A;  4RFB A;  2CWP A;  4UP9 A;  5FKA C;  1IBM L;  4B3M Q;  3BZC A;  3NPP A;  3LNN A;  4JYA L;  1DM0 B;  1CKO A;  1S5B D;  2LMC B;  4GKJ Q;  2L0C A;  3CCS A;  3K7A H;  4X66 Q;  5G3L D;  1A0I A;  1P8L A;  5CV6 A;  3I4O A;  2RQX A;  1BCP B;  1YNX A;  1LTT D;  1EYG A;  1KQS A;  3E0E A;  4DR2 Q;  3KF6 A;  1XNQ Q;  1PTO F;  2DGY A;  4R4Q A;  3CCE A;  4C2M B;  1VQ9 A;  5DNF A;  3I4M B;  4JOI C;  1X3P A;  3K58 A;  3GTK H;  1WOC A;  1H9K A;  2MO1 A;  1QUQ A;  2WP8 J;  4BY1 H;  3CPW A;  2JA7 H;  1HZA A;  2LFN A;  3HOU G;  1KIX A;  3W3A A;  4NB3 A;  3A8J E;  2F0V A;  5LMN L;  1GUO A;  3PGZ A;  5EPL A;  1D8L A;  5M3F B;  3JAM E;  1HZB A;  1A15 A;  4XQJ A;  5IYB H;  4BS9 A;  1ASZ A;  3CP0 A;  1MGS A;  1L0Y B;  1JIC A;  3H91 A;  5KGU A;  1VMP A;  4JCV E;  2ZJP A;  2PQE A;  3IFD A;  4A3K H;  3TQY A;  3V96 A;  2X6G A;  4YHH L;  1VS0 A;  4WFN 3;  1IBK L;  2DUD A;  3O13 A;  4JC0 A;  1E1T A;  5KNB A;  1SFO B;  2DJF C;  5CR3 A;  4NKL A;  5IGF A;  2K7V A;  1B2T A;  1EU3 A;  5C44 H;  2CFM A;  4YWK A;  1N34 Q;  2EY2 A;  1KLU D;  3Q23 A;  3S2H H;  4A3B G;  4BBS G;  1F2M A;  1SE2 A;  3GTL B;  4U68 A;  3W5O A;  1ASY A;  1ESR A;  4HJ7 A;  4MNO A;  1BCP C;  4JG2 A;  2E2I H;  3ULP A;  2K1B A;  1NR2 A;  2PQA A;  2MHV A;  1STB A;  3FPP A;  4KJN A;  2RHQ B;  3A56 A;  5CV9 A;  4C3H H;  3KBX A;  1UE1 A;  4DR1 L;  1W6K A;  3KLW A;  3T53 B;  3M4O B;  4ZQ3 A;  2VQF L;  1LTG D;  4DV4 L;  4AIM A;  5JEA J;  1VQ8 A;  1EEI D;  1AE2 A;  3T1Y L;  1VQN A;  3LX0 A;  3MXN A;  4CDC C;  1PH1 A;  1I4G A;  1VQ7 A;  1ZYR D;  3GTP H;  3A7L A;  3J80 i;  5ELE A;  2M00 A;  1G8Z D;  3VA7 A;  1ESF A;  1XPR A;  1PTO C;  1X3G A;  3HOW G;  3NHH A;  1SRO A;  3J80 c;  4CDF C;  4IPG A;  3Q0A A;  4X65 L;  2ZJR A;  3EA6 A;  4LUZ A;  1IYJ B;  3ERQ A;  4LF9 L;  2F0Q A;  2JXM B;  1FNU A;  1ET9 A;  1I6H H;  3QG1 A;  3RNU A;  1IW7 D;  3BVM A;  3PO2 G;  3F2U A;  3K7A B;  2QCP X;  4B9W A;  4CKC A;  4POG A;  1B9N A;  1M1K C;  3OMG A;  4K5V A;  2WKC A;  2D0P A;  4LF6 Q;  3FKI G;  1TKW B;  2NWG A;  3T1H L;  1SXT A;  4DR3 Q;  2RDF A;  2XSC A;  1HQR D;  4LF5 L;  3OOC A;  1CM9 A;  4BY1 B;  3ONA B;  4R4T A;  4C1N I;  4RG1 A;  2JA7 B;  3I4N G;  2NVY H;  5EPK A;  5IGC A;  2UXB Q;  1BBX C;  1B9M A;  1KAB A;  3OMC A;  2F3I A;  2D2C C;  4GKK Q;  3AFP A;  4DR6 Q;  1NUC A;  3ER0 A;  4LMQ D;  4DU9 A;  1TWC H;  2HCC A;  1CQV A;  4X3K A;  2F0U A;  2CCZ A;  4J15 A;  4WOR A;  1OXS C;  4OXP A;  4BWG B;  1KXL A;  4DR7 L;  1Q90 A;  4A3K B;  3N6R A;  5ELD A;  1XTC D;  1EFI D;  4C3J B;  3R93 A;  2EXZ A;  1YZ6 A;  3K81 C;  3S1Q H;  3OW7 A;  5BN5 A;  2Y0S G;  3L0O A;  2LKV A;  4EGV A;  1L1O A;  4XTC S;  2K32 A;  5C44 B;  1NMG A;  1EIY B;  5EQ0 A;  2B29 A;  2B8G A;  1K8G A;  3S2H B;  4QUC A;  4O0A A;  3KOJ A;  3T16 A;  1ICW A;  4LJZ C;  5IIF A;  5FLX c;  4OIK A;  1ONL A;  2N3S A;  1UEB A;  2EIF A;  3I91 A;  2BA1 A;  4QQB X;  1OXX K;  4OGQ C;  1K9M C;  1JWM D;  4A3M B;  1HZ9 A;  2E2I B;  2IX0 A;  1CQF A;  1B8A A;  1KAW A;  2YTV A;  4NXM L;  1MBY A;  5NUC A;  3H0G B;  1GM5 A;  2HIX A;  3K7U C;  4C3H B;  5JPN C;  4UY8 C;  1AE3 A;  4KY6 A;  4H13 C;  1SSO A;  4DV0 Q;  1IBL Q;  4QB4 A;  3VR6 A;  4GLX A;  3I56 A;  4WJ4 A;  4LAA A;  4RKL A;  1Q86 C;  3OWF A;  3D0F A;  2FHT A;  2D9U A;  2B2T C;  2Z6K C;  2CW0 D;  5EKK A;  1HHV A;  4A3C H;  2R6G A;  3RLF A;  1S4Z A;  1GVP A;  3C1F A;  3GTP B;  1K8A C;  1PFN A;  5HGT A;  3PSI A;  2UXD L;  4CJ2 C;  5C0X I;  4OL7 A;  2F52 A;  2EVB A;  2F0T A;  5C5M A;  1YI2 A;  2VZA A;  4A3D G;  1ZYR C;  1I6H B;  1VQH A;  3CW2 C;  1JCK B;  1X3F A;  3SGI A;  3EFX D;  4FYD A;  5E3F A;  4HTH A;  2A69 D;  5C3E H;  5FO9 B;  5IWA Q;  1XPU A;  1I94 Q;  2ZXP A;  4BXX H;  3VDY A;  2G5D A;  5C3X A;  1N33 L;  1JJ2 A;  2Q8T A;  4YIJ A;  1HR0 L;  1NBW A;  3CKI B;  5GAD C;  4V19 0;  1VF5 C;  3OIQ A;  3U9S A;  1IW7 C;  1OO9 B;  3OTO L;  4JV5 L;  2HHH Q;  2AKW B;  1V1P A;  2ZXR A;  2OCE A;  3A8I E;  4IFD I;  3M4Q A;  4GNX A;  2XN9 C;  2J7Z A;  3DM1 A;  3TRE A;  1N32 Q;  5C4X H;  1K8M A;  2AUK A;  3DM3 A;  2UUA Q;  4NMZ A;  4LF7 L;  1WFQ A;  4RMF A;  1WCM G;  2CWA A; 
#chains in the Genus database with same CATH homology
 1LM0 A;  4B3T Q;  2YYZ A;  2VQE L;  1PA6 A;  4JBK A;  3HOY G;  4B3S L;  1VQ6 A;  2ASB A;  2Q2U A;  3RR5 A;  3PIO A;  1X6O A;  3KFU A;  2AWO A;  1IZ6 A;  4DUY Q;  2WB1 G;  3I4M H;  2V1C C;  5GQO A;  3S1N H;  3STB D;  5BR8 Q;  2E5L L;  1N9W A;  3F2C A;  1EWI A;  1PFS A;  2L15 A;  3E9H A;  2VQE Q;  2HT1 A;  2F4V L;  4B3S Q;  3H0G G;  3PUX A;  1NMF A;  3U4Z A;  1VQO A;  1YJ9 A;  4GNX C;  1WI5 A;  4GOP C;  4R4O A;  2ATW A;  5IYD H;  2RHS B;  4JI1 L;  4YCW A;  3NEM A;  1V1Q A;  4DR7 Q;  1B7Y B;  3EN2 A;  3RN5 A;  4MZ9 A;  1C9O A;  2ID0 A;  4L5Q A;  4AQY L;  2E5L Q;  4LF8 L;  5M3F H;  2WAQ E;  4IPH A;  1BBU A;  3S15 H;  1GO3 E;  4DV2 L;  2ZTE A;  1XMQ Q;  1HR0 W;  2K14 A;  1Y1W H;  3GO5 A;  2KCM A;  2IHE A;  4TQU S;  4AYB E;  4DR4 L;  2KHJ A;  4QIW E;  2PQA B;  4YWM A;  4X62 Q;  1PH7 A;  4JI7 L;  3S14 H;  3PV0 A;  1JT8 A;  1JB7 A;  1C7Y A;  2UXC L;  4LF8 Q;  4EX5 A;  1VQJ A;  4DAM A;  4BBR G;  4DV2 Q;  1QZH A;  1KHI A;  1N36 L;  4JI8 L;  1QVF A;  1V43 A;  2Q2H A;  2JA6 G;  4NXN L;  4DR4 Q;  2R92 G;  3A5Z B;  2JA5 H;  4O2D A;  4NPS A;  2AMC B;  4C3J H;  4JBW A;  4OO1 I;  4X64 L;  3CC7 A;  1X56 A;  1YJN A;  1R9T H;  1GKH A;  3M85 A;  3HOV H;  3HOX H;  3AQQ A;  4K0K L;  3UDX A;  1N36 Q;  4DNI A;  1IL2 A;  5M3M G;  4AH6 A;  4NXN Q;  3PIP A;  4WJ3 M;  4LW1 A;  4LFA Q;  3L7Z C;  4MTN A;  5J3B A;  4LFC L;  3FHW A;  1AH9 A;  4X64 Q;  2R7Z H;  1WCM H;  2JA9 A;  1FJG Q;  5FJ8 G;  1XJV A;  3CCV A;  5IP7 G;  4NXM Q;  1KD1 C;  4HJ8 A;  1CSP A;  1OXT A;  4L5S A;  3HOY H;  2Q2I A;  3A0J A;  1VQ5 A;  4A93 G;  4DV5 Q;  3CQZ H;  4HJ9 A;  3GTL H;  3S2D H;  2OTJ A;  3PUV A;  2Y0S E;  3K8A A;  2A1A A;  4JBJ A;  3F2D A;  4L5R C;  1XNR Q;  3PO3 G;  5K36 G;  4A3I G;  1EOV A;  4A3M H;  4P74 A;  3K0X A;  4DAY B;  3TRZ A;  1NY4 A;  3GTM H;  1MJE A;  4P73 A;  4QJF A;  3H0G H;  5GAG C;  2NVT H;  3UDG A;  3A74 A;  2ZTD A;  2UUB Q;  2WFW A;  1CKN B;  1O7I A;  2RF4 A;  1S3O A;  2VS1 A;  5IP9 G;  2D0O A;  2GVA A;  5IT9 c;  4BY1 G;  1SRU A;  5GRO A;  4C3I H;  2N49 A;  3CC2 A;  4DK6 C;  2JA7 G;  1C0A A;  1SMX A;  3TEH B;  3I7F A;  3CMA A;  1E7Z A;  1VQL A;  3CCJ A;  4IPD A;  1EQQ A;  3S17 H;  3M4O H;  4DV7 Q;  2ZJQ A;  3GDE A;  4A4I A;  2UXD Q;  5IYB G;  2ES2 A;  1G51 A;  3CAM A;  1QUQ B;  3W1B A;  1HNW L;  4BA1 I;  2MNA A;  4BBR H;  1E24 A;  1OXU A;  2K5N A;  3UDI A;  2IX1 A;  4LFB Q;  4DUZ L;  2JA6 H;  2R92 H;  3HKZ G;  4PZ8 A;  1XMO L;  1PH4 A;  3I55 A;  3KDF B;  4IJH A;  2JQO A;  5H1S E;  4YWL A;  1HNW Q;  4DV3 L;  1K83 H;  1BVS A;  4A3K G;  4B3M L;  4LUO A;  4YY3 Q;  1PYS B;  2LXK A;  1V9P A;  1NJI C;  5M3M H;  1CSQ A;  4FDB A;  3J81 i;  2QA4 A;  3GTG H;  1XMO Q;  1Y1V G;  4X66 L;  2YV5 A;  4DK3 C;  4DV6 Q;  2IT1 A;  1A63 A;  5JJK A;  2MO0 A;  1N33 Q;  4LF6 L;  2CWP A;  4UP9 A;  5FJ8 H;  1YIJ A;  5ELN A;  3J81 c;  5IP7 H;  4DR2 L;  1K3R A;  3BZC A;  1IBM L;  4B3M Q;  4JYA L;  1YBY A;  5LMU L;  1PVO A;  1UE6 A;  4A93 H;  1CKO A;  4DR3 L;  2UU9 L;  4GKJ Q;  3CCS A;  1CKN A;  3K7A H;  4X66 Q;  5C44 G;  4B3R L;  1A0I A;  4A3E G;  1P8L A;  4JBM A;  3I4O A;  1X55 A;  3OTO Q;  3PO3 H;  1YNX A;  1EYG A;  4JV5 Q;  1XTD A;  3CF5 A;  4HIK A;  1KQS A;  3AYH B;  3E0E A;  4DR2 Q;  4DR5 L;  3KF6 A;  3U50 C;  2QGQ A;  1XNQ Q;  4JYA Q;  3MEF A;  2DGY A;  4IJL A;  4R4Q A;  2UXB L;  3CCE A;  4HJA A;  4PG3 A;  3HKS A;  1VQ9 A;  2HQL A;  4JOI C;  3D31 A;  3GTK H;  4LF7 Q;  4JI5 L;  4B3R Q;  4P71 A;  3PF5 A;  1Q7Y C;  1WOC A;  1LUZ A;  4AYB G;  3ULL A;  1YVC A;  2VW9 A;  3DLL A;  4A3M G;  2MO1 A;  1QUQ A;  2WP8 J;  5IP9 H;  5C0X J;  4BY1 H;  3CPW A;  1YIT A;  4H02 A;  2JA7 H;  2BH2 A;  1HZA A;  4IPC A;  1VQP A;  2GVB A;  1PH3 A;  4XIG S;  2HIV A;  1Q12 A;  1KIX A;  4NB3 A;  3HOU G;  3UDF A;  4UP8 A;  5C4J H;  5LMN L;  3KDF A;  2CQO A;  1X54 A;  3NEL A;  1D8L A;  3PGZ A;  5IYC G;  1S72 A;  2C35 B;  1HZB A;  1I50 H;  5IYB H;  2F4V Q;  2MFI A;  3H15 A;  1S40 A;  4QL5 A;  3STB C;  1ASZ A;  3HOZ H;  3CP0 A;  2R93 G;  3AEV A;  1Z47 A;  2I5H A;  4OWW B;  1VQE A;  3F8T A;  4JI1 Q;  4A3F G;  5LMN Q;  3Q8D A;  3K80 C;  4AQY Q;  4JCV E;  2E2H H;  2ZJP A;  2B63 G;  2I0Q A;  4GN3 B;  4PMW A;  4A3K H;  1I3Q H;  3S24 A;  4LUV A;  2A8V A;  3TQY A;  4YHH L;  1VS0 A;  3CCL A;  3JAM i;  4KHZ A;  4A75 A;  1IBK L;  4JI7 Q;  1G29 1;  2I5M X;  1RIP A;  3PUZ A;  4JI0 L;  1Y1V H;  2JK8 A;  4L5T A;  4R1J A;  4OON A;  2DUD A;  4APV A;  1Q81 C;  1N34 L;  2VUM G;  1VQF A;  4JC0 A;  2UXC Q;  1E1T A;  4OX9 L;  3JAM c;  1WJJ A;  2OQK A;  2WB1 E;  4JI8 Q;  3NEN A;  4EQ5 A;  4IFD J;  3MXN B;  1Q46 A;  4QY7 A;  3S16 H;  1PH9 A;  4GLV B;  1EFW A;  1TWG H;  3GTJ H;  5E7N A;  3F2B A;  3L2P A;  5C44 H;  2CFM A;  4YWK A;  4A3E H;  1N34 Q;  5JJL A;  3S2H H;  1BKB A;  4A3B G;  4BBS G;  4K0K Q;  2ZM6 L;  3W5O A;  1ASY A;  3BU2 A;  1MIU A;  4HJ7 A;  4MNO A;  4LFC Q;  2YTY A;  1L2F A;  1YEZ A;  3CCQ A;  2EXD A;  4DV0 L;  1IBL L;  3J7A 5;  5LMN W;  4JG2 A;  2E2I H;  4IO9 A;  2NN6 G;  3ULP A;  2ZM6 Q;  1J5E L;  2EQS A;  4A3J G;  3F1Z A;  5GAE C;  2IY5 B;  2PQA A;  2JJQ A;  3HFZ B;  2BA0 A;  1KRS A;  3HOU H;  2AHO B;  4C3H H;  2RHQ B;  4ALP A;  5JJI A;  1T9H A;  1VQM A;  1EQR A;  5IYC H;  1E22 A;  1UE1 A;  2D62 A;  4JI3 L;  1CUK A;  3ULJ A;  3CME A;  4DR1 L;  1PH8 A;  2OTL A;  2BH8 A;  3KLW A;  3CCM A;  5HY6 A;  1J5E Q;  4BA2 I;  2VY3 A;  2R93 H;  3S1R H;  2VQF L;  1E3P A;  4LWC A;  4A3F H;  4DV4 L;  4AIM A;  2I5L X;  1PH2 A;  5JEA J;  2JEB I;  1QVG A;  4YCU A;  1VQ8 A;  1AE2 A;  4PZ7 A;  5IY0 A;  4DV1 L;  3T1Y L;  1A62 A;  2B63 H;  1VQN A;  3HOZ G;  1EIF A;  2IHF A;  1YHB A;  4P72 A;  1RL2 A;  2VL6 A;  1PH1 A;  1VQ7 A;  3UE1 A;  3GTP H;  1W2B A;  3J80 i;  1KC8 C;  2AWN A;  1GD7 A;  1UE7 A;  2VUM H;  1Q82 C;  1UE5 A;  1X3G A;  1XPR A;  2MQH A;  2R7D A;  3T1Y Q;  1X3E A;  1YHQ A;  1JMC A;  3HOW G;  1SRO A;  5ELO A;  2LXJ A;  3J80 c;  2RCN A;  4LF4 L;  3M9B A;  4IPG A;  2KCT A;  2PNH A;  4X65 L;  2ZJR A;  1U5K A;  3RN2 A;  4DUZ Q;  1KL9 A;  3TS0 A;  1SLJ A;  4JOI A;  4LUZ A;  5IWA L;  1OTC A;  3PF4 A;  1IYJ B;  4LF9 L;  3G48 A;  1MJC A;  3CPF A;  5M5X H;  2E8G A;  3BJU A;  4DV3 Q;  4R4I A;  3ICE A;  4A3B H;  4BBS H;  1VQG A;  4LF4 Q;  1I6H H;  1DGS A;  3RLN A;  4POF A;  3RNU A;  3I2Z A;  4X65 Q;  3PO2 G;  5M5W H;  4TVA B;  2NVX H;  1A8V A;  3GD7 A;  4POG A;  1M1K C;  1QVC A;  5FLM G;  1FVI A;  4JI6 L;  3M7N A;  3S1M H;  2HHH L;  1VQI A;  1L0W A;  2D0P A;  4LF6 Q;  3FKI G;  1PH6 A;  1IBM Q;  2NN6 I;  3T1H L;  5LMU Q;  1L1O B;  4GS3 A;  4DR3 Q;  1P16 A;  3LGJ A;  1YHA A;  2WAQ G;  4P75 A;  4A3J H;  2UU9 Q;  2UUA L;  4GKK L;  4ME3 A;  4LF5 L;  3ZJY C;  5M5Y H;  2XGT A;  4B3T L;  3G71 A;  4R4T A;  3CCR A;  4RG1 A;  4DR6 L;  3I4N G;  3FP9 A;  2XTI A;  4DR5 Q;  2JEA I;  2NVY H;  3HKZ E;  3T1H Q;  3PUY A;  4A3G G;  2UXB Q;  2R7F A;  1JJC B;  1E1O A;  4LF5 Q;  3B6Y A;  2F3I A;  4JI5 Q;  4GKK Q;  3KJP A;  1N8R C;  2N8N A;  3AFP A;  1Q1B A;  2Z0S A;  4GN4 B;  5BR8 L;  4DR6 Q;  4PZ6 A;  4HID A;  3ER0 A;  2QEX A;  3J81 j;  1G6P A;  1TWC H;  4Y52 H;  2A19 A;  4YCV A;  4KHP L;  2CCZ A;  1W3S A;  4J15 A;  1OXS C;  4C2M H;  4A3D H;  4OXP A;  3WWV A;  2YU9 H;  1K73 C;  4QGU A;  1KXL A;  3W1G A;  4DR7 L;  1OXV A;  4A3L G;  5GAH C;  4A3C G;  1VQB A;  2K4K A;  3M3Y H;  3HOW H;  1XMQ L;  2NZO A;  4KHP Q;  1LYL A;  2K5V A;  4DPG A;  4IOC A;  3OW2 A;  1Q8K A;  4X62 L;  1VQC A;  2VNU D;  1YZ6 A;  2KEN A;  5C0X G;  2KBN A;  3G4S A;  1Z9F A;  3K81 C;  1HJP A;  1HNZ L;  3S1Q H;  2Y0S G;  3PUW A;  3L0O A;  5AJ3 L;  3UE0 A;  1L1O A;  3PO2 H;  4XTC S;  3NBH B;  4YHH Q;  1PV4 A;  1NMG A;  3BZK A;  1PYB A;  1IBK Q;  1EIY B;  4JI0 Q;  4BY7 G;  2B29 A;  5FLM H;  1K8G A;  1HNZ Q;  2JA8 G;  1YJW A;  2N78 A;  3KOJ A;  4O0A A;  4HIM A;  4UPA A;  4OX9 Q;  5AJ3 Q;  1NTG A;  3FKI H;  2K50 A;  1PH5 A;  5C3E G;  1Q1E A;  1VQA A;  4UP7 A;  3EBE A;  1TWA H;  5FLX c;  1MKH A;  2N3S A;  5EAY A;  4LFA L;  1UEB A;  1TXY A;  2EIF A;  2BA1 A;  4DKA C;  4BXX G;  1OXX K;  4QQB X;  5DLQ E;  1K9M C;  2Z6K A;  2OWO A;  1HZ9 A;  2IX0 A;  1I5F A;  1KAW A;  1B8A A;  1VQD A;  2B3G A;  1FJG L;  2YTV A;  4NXM L;  3CCU A;  3CD6 A;  3I4N H;  1TWF H;  1VQK A;  1U0L A;  1GM5 A;  2HIX A;  1SFO H;  1L1O C;  4DV5 L;  4A3G H;  3K7U C;  2PI2 E;  1HH2 P;  3G6E A;  1UWV A;  2FXQ A;  1SN8 A;  1AE3 A;  4GLA C;  3KJO A;  4UY8 C;  1XNR L;  2LSS A;  4DV0 Q;  3U58 A;  1QZG A;  1IBL Q;  3ERS X;  3AFQ A;  3CC4 A;  3RLO A;  2PMZ E;  3I56 A;  1IXR A;  4GLX A;  4IFD G;  4WJ4 A;  1Q86 C;  2NZH A;  3D0F A;  3GTO H;  3KF8 B;  2UUB L;  3CXC A;  5C4X G;  1EUJ A;  3U4V A;  3KYH C;  3A5U A;  2Z6K C;  2ZTC A;  2E2J H;  3M4P A;  1PHJ A;  4A3L H;  4R4C A;  4JI3 Q;  4DR1 Q;  1K0R A;  4A3C H;  1H95 A;  1J6Q A;  1JJG A;  2JE6 I;  2ALY B;  2R6G A;  3RLF A;  1GVP A;  1VQ4 A;  1WYD A;  1VCI A;  2OQ0 A;  1FGU A;  4GNX B;  4GOP B;  2VQF Q;  1K8A C;  1HNX L;  2Q2T A;  3GTQ H;  3I4M G;  4DV7 L;  1B70 B;  3RZO H;  1D7Q A;  1KRT A;  4DV4 Q;  4Y7N H;  3PSI A;  4KLK A;  3TS2 A;  2UXD L;  5C0X I;  2NVQ H;  4DV1 Q;  2F52 A;  1FL0 A;  2H5X A;  3KF6 B;  4HIO A;  1JE5 A;  3H3V H;  3J7Z C;  1SR3 A;  4OWX B;  4A76 A;  3H3V I;  4LFB L;  1YI2 A;  5IYD G;  1HNX Q;  1NE3 A;  2VZA A;  2K5H A;  5HGQ A;  1I94 L;  4JI2 L;  1X9N A;  4BY7 H;  4A3D G;  2JA8 H;  5M3F G;  1VQH A;  3CW2 C;  2K75 A;  3RZD H;  1X3F A;  3SGI A;  1Y1W G;  4YY3 L;  3E9I A;  2K52 A;  5C3E H;  3EIV A;  2YTX A;  4X6A H;  4LNQ A;  1Y14 B;  5IWA Q;  1I94 Q;  2UUC L;  1XPU A;  4IOA A;  4BXX H;  4JI2 Q;  3VDY A;  1BBW A;  5JEA G;  4DV6 L;  4LF9 Q;  2KHI A;  4HJ5 A;  1M90 C;  2CKZ B;  1XPO A;  1JJ2 A;  3IRB A;  1CKM A;  1N33 L;  3JC6 6;  4OWT B;  1HR0 L;  1NBW A;  1X65 A;  1HZC A;  1TWH H;  5GAD C;  4GKJ L;  2JA5 G;  4OO1 G;  2UUC Q;  1N32 L;  1LTL A;  2PI2 A;  3OYY A;  4JI6 Q;  2GN5 A;  3OTO L;  4JI4 L;  2HHH Q;  4JV5 L;  2AKW B;  5IE8 A;  1HR0 Q;  3PCO B;  3HOX G;  3HOV G;  1XNQ L;  2OCE A;  4IFD I;  3M4Q A;  4GNX A;  4GN5 A;  4GOP A;  1N32 Q;  3TRE A;  1SE8 A;  3DM3 A;  4KI0 A;  5C4X H;  4DUY L;  2UUA Q;  4LF7 L;  1WFQ A;  4RMF A;  1WCM G;  2R7Z G;  2CWA A;  4JI4 Q;  4A3I H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...