4DV1L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g, bound with streptomycin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv1L00
4NXNL 1J5EL 2Y0SG 4RMFA 4A75A 1OTCA 1UWVA 5M5XH 3TRZA 4JV5Q 3PUXA 3NEMA 4DR7L 4X66Q 2IY5B 1RL2A 1NE3A 2VL6A 3CCRA 1N34Q 2H5XA 4A3MG 4DV3Q 2Q2UA 3GTQH 2BH2A 3W5OA 2HIXA 3S2HH 1HNZL 1X6OA 4BBSG 1Y1WH 1KQSA 5M3FH 1HNZQ 4L5TA 4JI7L 4JYAL 4DK3C 2UUCL 2VS1A 1E7ZA 3KF6B 1V43A 3ERSX 4XTCS 4NXML 4HJ7A 4LF6L 1GD7A 4JOIA 4A3DG 2OQKA 4A3GG 3EBEA 1UE5A 3CC4A 4JG2A 1PH9A 3S1NH 1HR0Q 2YYZA 2ZTEA 4YHHL 1KRTA 1IBMQ 3CW2C 1V9PA 3PGZA 4K0KL 3S17H 1KXLA 1Q86C 4DV4Q 1IYJB 3CAMA 2JEAI 3TEHB 1T9HA 5FJ8H 2Q2HA 2YTVA 4C2MH 2ZJRA 1SRUA 4JI0Q 2NVQH 3CC7A 1OXUA 1HR0W 1L2FA 3CP0A 4IJLA 5JJIA 4GOPC 1I94L 2QEXA 1VQNA 2KCTA 1Y1WG 1I94Q 3RLOA 5M3FG 4B3MQ 1JJCB 3HOXH 3PO3H 1A0IA 3H3VI 3HKSA 3M4QA 2UXDQ 2I5LX 1FVIA 2IX1A 1TWGH 3GTGH 4POFA 2EXDA 1VQ4A 4GNXB 1R9TH 1NTGA 1MJEA 3RR5A 5GQOA 1PFSA 4DV7L 4HJ5A 3S24A 1VQPA 1K9MC 2VY3A 4DV7Q 3GTOH 1XMOL 2XTIA 3BU2A 1VQBA 1Z47A 2K5NA 1XPUA 4Y7NH 1YITA 1S3OA 1JJ2A 2E2JH 1PH2A 1LM0A 1PH7A 2OTJA 5E7NA 1OXTA 3NENA 5AJ3L 1X56A 2R7FA 5FJ8G 5AJ3Q 4UY8C 2JA5H 3OW2A 2IHEA 3I56A 4JBKA 3ZJYC 3PF4A 4DR4L 2K50A 2AKWB 2I5MX 1X55A 4X65Q 4HJ8A 1Q7YC 1ASZA 3G6EA 3F2BA 2RHSB 4DNIA 3KF8B 5IT9c 3K7AH 1N32Q 2WAQG 4OONA 4JI8Q 4LF5Q 2RF4A 3HKZG 1VQ9A 3CD6A 1I5FA 2B63H 1L0WA 2VNUD 1LUZA 4C3JH 3F2CA 1IBKL 3HOXG 3PO3G 3A0JA 4AIMA 4C3HH 2ASBA 2QGQA 1EQQA 2YU9H 3M4OH 2VW9A 4YWKA 1TWFH 4HIMA 2VUMH 4BXXH 3I2ZA 1X65A 2K75A 2JJQA 3S2DH 1FGUA 4HJ9A 4X6AH 4X62L 5H1SE 1WYDA 3J80i 4A3JH 4GOPA 1L1OA 4IOCA 2MO0A 1VQIA 1G291 3RLNA 4OWXB 3CCJA 2AWNA 3U50C 1VQKA 1GO3E 4MNOA 4R4OA 3HOVH 1N33L 5C4XH 2R93H 2YTXA 2OCEA 2JA5G 3F8TA 1B7YB 1N33Q 4LF4Q 2A19A 4JOIC 1N36L 1HJPA 3SGIA 1VS0A 1CSQA 1WFQA 1AH9A 4RG1A 1P8LA 4O2DA 4GOPB 2B63G 1UE7A 4JI4L 1CKMA 4A4IA 1GKHA 1PH8A 4JI4Q 3KDFA 3I4NH 5HY6A 4YY3Q 1SLJA 2Z0SA 5HGQA 4DUZL 4A3KH 4DAMA 1KL9A 3M85A 4DUZQ 3T1YQ 4LFAL 4GLAC 3G48A 2VUMG 3CCSA 4BXXG 4DV2L 1W3SA 5M5YH 1ASYA 3I4MH 1Q1EA 3PO2H 3K8AA 2PMZE 3KFUA 4DR3L 3RN2A 1KHIA 2JQOA 3J80c 4A3JG 1SE8A 4DUYQ 1VQJA 4OO1G 1XPOA 2WAQE 4JV5L 3VDYA 2VZAA 3AYHB 1K83H 3HKZE 4JBJA 4GLVB 4X66L 1PYSB 1E22A 2Q2IA 3HOVG 5C4XG 2R93G 1N34L 2JK8A 1PH3A 3AQQA 2ALYB 5GAGC 4DV3L 1AE2A 3JC66 2KENA 3G71A 1K73C 1YHBA 4DPGA 5IWAQ 2F4VQ 4FDBA 3W1BA 1PH6A 3ICEA 1E3PA 2JA9A 3I4NG 2JE6I 2HT1A 4OWTB 4A3KG 1WJJA 3E0EA 4KHZA 2A8VA 4OO1I 2K4KA 1VQGA 3ER0A 4IPDA 4JI2Q 1B70B 3H15A 4DR5L 1N8RC 3KOJA 2RHQB 4DR5Q 3J81j 4IJHA 1YJ9A 3U4ZA 3PO2G 1NMFA 4A3IH 1HR0L 2ES2A 1IBML 3KYHC 4IFDG 1KIXA 5C3EH 4PZ6A 2WB1G 4DV4L 3ULPA 1FJGL 3PUZA 1VQCA 4KHPQ 1FJGQ 1D7QA 3KJOA 4JI0L 4C3IH 1S40A 1PA6A 3HOYH 3GTKH 4MZ9A 4LUZA 5IE8A 1B8AA 1TWAH 1XNQL 1I50H 2K5HA 2K52A 1VQEA 1XNQQ 2MQHA 3CXCA 3CCVA 3RZOH 4QY7A 3S16H 3MEFA 4MTNA 5IYCH 1L1OC 4B3ML 1VQMA 5BR8Q 5LMUQ 4AYBG 4L5RC 2DGYA 3DLLA 4DR6Q 2UXDL 2V1CC 3PF5A 3I55A 3CC2A 1CSPA 2Y0SE 1GM5A 4IFDI 4LFBQ 1AE3A 2HQLA 2NVXH 4OX9Q 1HZAA 1HNWL 3GTPH 4BY1H 3BZCA 3L2PA 1MIUA 4A3IG 1K8GA 1HNWQ 4JYAQ 4GN4B 2ID0A 2UXCQ 4PMWA 5C3EG 3TREA 1TWHH 5C0XG 1BKBA 1HZBA 2CQOA 2WP8J 4BA1I 1PVOA 1XTDA 4BA2I 1I6HH 3FKIH 3HOYG 4X65L 1QVCA 3TS0A 1NJIC 2R6GA 4IPHA 1JJGA 1N32L 2AWOA 1Q82C 1EUJA 4JI8L 1VQHA 4LF5L 3S1RH 3S15H 4A93H 1XNRQ 5LMNW 5IYCG 1HH2P 3TS2A 1VQFA 4A3BH 5K36G 4WJ3M 2FXQA 1VQDA 3D0FA 5JEAG 2C35B 1OXXK 3E9IA 2JA8H 4DV6Q 4P72A 3CCLA 3M3YH 1VQAA 5GROA 2LXJA 1QVGA 4LW1A 1EIYB 4TQUS 1BVSA 5C0XI 3E9HA 1TWCH 2CFMA 3I7FA 3AFPA 1SFOH 1IBLQ 2HIVA 4J15A 2HHHL 4P71A 1GVPA 4BY1G 3RZDH 2HHHQ 4QL5A 4GN3B 3ULLA 4GLXA 2GN5A 1BBWA 3HOUH 3A74A 2JA7H 5C4JH 3J7A5 1O7IA 1VQ8A 3GD7A 1NY4A 4XIGS 1YIJA 3J81i 1UEBA 3OTOL 3OTOQ 4LF4L 4IOAA 4Y52H 1JMCA 2ZJPA 3FKIG 1YEZA 2AHOB 4JCVE 4OWWB 4IPCA 1PH1A 4JI1Q 2N78A 1CKNA 4DV0L 3RLFA 1PYBA 1CUKA 4LF8Q 4YCVA 4DV0Q 2R92H 4A93G 4A3BG 3Q8DA 5GAEC 1EYGA 5IP9H 1L1OB 3M9BA 4R4IA 3CF5A 4YY3L 1UE1A 3T1HL 1OXVA 5IP7H 4B3TL 3T1HQ 3T1YL 4B3TQ 2N8NA 2Z6KA 3M4PA 4JBWA 3D31A 3WWVA 2JA6H 2R7ZH 3FP9A 2UUAQ 4OXPA 4JI3L 1VQ5A 2UXBQ 1LYLA 4B3SL 2MFIA 4AQYL 1Q12A 1IXRA 1EQRA 5DLQE 2CKZB 4HIDA 4QJFA 4B3SQ 4AQYQ 4JI3Q 2WFWA 5M3MH 4ALPA 3K80C 4PG3A 4DUYL 1WI5A 3JAMi 4LF7L 2JA7G 4B3RQ 4EQ5A 1M1KC 2PNHA 4ME3A 4DV5Q 4LF7Q 4IPGA 4LF9L 3KDFB 4L5SA 3HFZB 4APVA 1EWIA 2IT1A 3UE0A 1E1TA 1SMXA 3J81c 4LF9Q 2D0PA 2NZHA 3EN2A 1Y14B 4PZ8A 4GKJQ 2ZTCA 3PSIA 2N3SA 2DUDA 2K5VA 1V1QA 1QVFA 3K0XA 2OTLA 1EOVA 1YVCA 1VQLA 4A3CH 1HZ9A 5ELOA 4LNQA 2YTYA 3H0GH 1YBYA 4HIOA 2R92G 2BA1A 3EIVA 1KD1C 1NMGA 2VQFQ 3LGJA 5IWAL 1IZ6A 1S72A 2ZTDA 1EIFA 2GVBA 3W1GA 2UU9Q 2F4VL 5IP9G 2IX0A 2I0QA 4R4TA 2JEBI 3MXNB 1YHQA 4LFCQ 3S1MH 5IP7G 3PIPA 4P73A 1X3EA 4BBRH 4A3FH 3ULJA 4JI2L 3UDIA 1Q46A 1E24A 1UE6A 2JA6G 2R7ZG 4BY7H 2KHJA 4NXNQ 1J6QA 4HJAA 4R1JA 3DM3A 1WCMH 3KF6A 4UP7A 1J5EQ 2ATWA 2KBNA 4NPSA 3I4MG 2NN6G 3BJUA 5M3MG 1IL2A 3UDFA 4DR7Q 2OQ0A 1VQ6A 2PI2A 3AEVA 5C44H 3JAMc 3S1QH 4LUVA 1XMQL 1XMQQ 3CPFA 4UP9A 1X3GA 4KHPL 1VQ7A 1SN8A 3K81C 3PV0A 2A1AA 2LXKA 1G6PA 4JI7Q 1KRSA 3CQZH 4H02A 4L5QA 5FLMH 3STBD 2BH8A 3RNUA 1QZHA 2UUCQ 4A3CG 3GDEA 3H0GG 4UP8A 3CCUA 3CCMA 1U0LA 3IRBA 3S14H 4R4QA 2E2IH 5BR8L 2D62A 5LMUL 4DV1L 2B3GA 1K0RA 2CWPA 3UDGA 4LF6Q 4DV1Q 3L7ZC 4NXMQ 2NN6I 3A5UA 3GTLH 4DR6L 4DAYB 3CCQA 2AMCB 1QZGA 1SR3A 4IO9A 5GAHC 1JE5A 4LFBL 4BBRG 4A3FG 4PZ7A 4YHHQ 4JC0A 4QGUA 4UPAA 1XPRA 4BY7G 4YCWA 4OX9L 4K0KQ 2CCZA 2KHIA 1WCMG 5IYBH 4A3LH 4A3EH 3NELA 4QIWE 4YWMA 2UUBL 1FL0A 4GNXA 2UXCL 4YCUA 2UUBQ 3NBHB 5C44G 1H95A 1G51A 5J3BA 2D0OA 5LMNL 1D8LA 3OYYA 1PHJA 4POGA 5LMNQ 4QQBX 3UE1A 4DK6C 1HNXL 2Z6KC 5EAYA 2GVAA 2PQAA 1C0AA 3FHWA 1Q81C 1HNXQ 1N9WA 5JJKA 1W2BA 3PUWA 1YZ6A 1OXSC 1C9OA 2R7DA 5IYDH 1P16A 5FLMG 5FLXc 1KC8C 2CWAA 2E8GA 1QUQA 1XNRL 3PCOB 4AH6A 1CKOA 2N49A 1A62A 3J7ZC 5IY0A 1X9NA 2OWOA 3GTJH 3STBC 1K8AC 2NVTH 3G4SA 2E2HH 2QA4A 4DV6L 1LTLA 1XMOQ 5GADC 2YV5A 1PV4A 4JBMA 4IFDJ 1Y1VH 2PQAB 2XGTA 2WB1E 5ELNA 3KJPA 1C7YA 3HOZH 3I4OA 4EX5A 1IBLL 3KLWA 4P74A 5IYBG 4A3LG 4A3EG 1KAWA 1Z9FA 1QUQB 2NZOA 4A76A 2EIFA 3GO5A 4DKAC 4GS3A 4DR4Q 5M5WH 3CPWA 1WOCA 4JI5L 1I3QH 2PI2E 1YJNA 3PUVA 4JI5Q 2K14A 4R4CA 1X3FA 4AYBE 2F52A 3TQYA 1XJVA 3F2DA 1VQOA 1DGSA 1JB7A 1NBWA 4JI6L 3L0OA 4JI1L 5IYDG 1IBKQ 4JI6Q 2L15A 2MO1A 4LF8L 5JJLA 3HOWH 3PIOA 1JT8A 3A5ZB 3PUYA 4TVAB 2BA0A 1K3RA 4NB3A 1MKHA 2LSSA 4P75A 4KI0A 3F1ZA 4DR1L 4X62Q 2JA8G 4DR1Q 4LUOA 1Y1VG 3HOZG 1Q8KA 1Q1BA 2UUAL 1E1OA 1TXYA 1MJCA 5C0XJ 2UXBL 1EFWA 3GTMH 1BBUA 2MNAA 1HZCA 3UDXA 1CKNB 2Q2TA 4B3RL 1YJWA 2NVYH 1PH4A 3HOUG 3CMAA 4DV5L 4A3MH 3CCEA 3AFQA 1N36Q 4YWLA 1A63A 2F3IA 2EQSA 4KLKA 2ZJQA 4O0AA 1SROA 2I5HA 4BBSH 4GKJL 1X54A 4GKKL 1PH5A 2ZM6L 5JEAJ 4X64L 1A8VA 4GKKQ 2RCNA 1YNXA 3U4VA 2ZM6Q 4X64Q 4DR2L 3BZKA 4DR2Q 3K7UC 3M7NA 4HIKA 2E5LL 1U5KA 1YHAA 2KCMA 2VQFL 2E5LQ 2UU9L 4GNXC 3HOWG 2IHFA 4LWCA 4LFAQ 4GN5A 3CMEA 4A3DH 1VCIA 4DV2Q 4A3GH 1M90C 4LFCL 2B29A 3RN5A 3H3VH 2VQEL 4DR3Q 3U58A 1YI2A 1RIPA 3B6YA 4WJ4A 2VQEQ
chains in the Genus database with same CATH superfamily
4H44C 5TSSA 4A75A 1OTCA 2JA6B 1UWVA 3NSWA 4KKTA 4DAVA 1CK1A 3SE0A 1Z6HA 4DR7L 2F1MA 1RL2A 4DAPA 1NE3A 4RCOA 1N34Q 5ELDA 4ZUIA 1STBA 4I65A 3GTQH 2F0EA 1HNZL 4O1NA 1KDAA 5EPLA 4JYAL 3E3XA 1EZ6A 2P5ZX 2LMCB 1PTOH 2XRSD 1LTBD 1SYCA 4F88A 4HJ7A 4JOIA 2Q8IB 4A3DB 3D4RA 2F0KA 4IURA 4JG2A 1JOOA 3S1MB 1ET6A 4M8AA 1HFNA 2K5DA 2ZTEA 1KRTA 4TKOB 3PGZA 1V9PA 3R2TA 1Q86C 3OWFA 2JEAI 1T9HA 5FJ8H 3A55A 3VA5A 2PZWA 1TS4A 5JJIA 4GOPC 1I94L 3U9OA 3S2HB 1VQNA 1VMPA 2KCTA 2O5IC 4B3MQ 3VR5A 5IIFA 3DEOA 1VQ4A 1R9TH 2VY3A 3BU2A 1VQBA 1CTMA 3SEBA 4DXGA 4G7OC 1PH2A 3NENA 2ZT9C 3A54A 1WTXA 5AJ3Q 2FMCA 2IHEA 3RMHA 2NVQB 2I5MX 1X55A 2DNEA 4X65Q 1RTNA 1Q7YC 3G6EA 2K6AA 1SBBB 3K7AH 1N32Q 1VMCA 5C4HA 4JI8Q 2RF4A 5CBEE 1PMRA 2K5QA 4C3JH 3F2CA 1TT2A 4IUVA 1IBKL 1FNUA 2F0MA 3M4OH 4YWKA 1TWFH 1NUCA 2Z9HA 2XVSA 4WJWA 3GTJB 4X62L 4A3JH 1GUWA 1VQIA 4ZYSA 1VQKA 4R4OA 5CV7A 1U4PA 4K8JA 1HHVA 2OCEA 1EYCA 1B7YB 4JOIC 4OL7A 3SGIA 4FXGC 5M5WB 1I3QB 1AH9A 1ONLA 3MXGA 1JQYD 1UE7A 1CKMA 1AEXA 3TP6A 1JB3A 1PH8A 1GKHA 2M2LA 3I4NH 2EDGA 5HGQA 1EY9A 1KDCA 4V0BA 4Z9CB 1TY2A 2V4DA 4DV2L 3HOWB 1W3SA 3I4MH 2PMZE 1Y8NB 1F9QA 4DFAA 5F2DA 3VYUA 4OO1G 4L8JA 4PMCA 5ELBA 1XPOA 1S5BD 2WAQE 3VDYA 4PMBA 3AYHB 4JBJA 4GLVB 3HOVB 2R93G 2JYOA 2JK8A 1DOMA 1EYAA 2EYPA 1XXGA 3JC66 4A3MB 3NQTA 4CBVA 1D5MC 2ZXRA 2B2VA 2I46A 3ICEA 1B50A 1PZID 2VB2X 4CKEA 4A3KG 4KHZA 1K28A 2K4KA 1VQGA 3ER0A 3H15A 2B2YA 4DR5Q 3J81j 4A3GB 4Q0FA 1B1ZA 4HCSA 5ELCA 3KYHC 5C3EH 2RBMA 2WB1G 4IUQA 5C0XH 2K5WA 1B3AA 3QJYA 3TN2A 1STAA 3PUZA 4KHPQ 4KY5A 4P2CB 4C3IH 1PA6A 1QCBD 2K03A 3GTKH 5IE8A 1B8AA 2FFKB 3F2UA 3OHXC 5CV9A 1LV9A 4KTAA 2KHSA 1X3QA 5IGFA 3NBHA 2A74C 5I4DA 1Y1WB 4KN7C 2G5DA 5JJZA 5JEAH 2MPMA 5LMUQ 4L5RC 1STNA 2V1CC 5FK9C 2Y0SE 1GM5A 1PLFA 3MFGA 1AE3A 4RKBA 1HTLD 2QF7A 2R3ZA 4BY1H 1VDZA 3L2PA 3S1NB 4GN4B 2A73B 2ID0A 2X6LA 3TREA 2CQOA 4CJ1B 4FF4A 2EYMA 3S17B 4BA1I 2JN4A 3LWUA 4C2MB 1SNMA 1AZPA 3IAYA 1QVCA 3LNNA 3TS0A 1JJGA 1QWYA 4QUCA 2MGSA 4J8QA 4HSVA 1Q82C 4LF5L 3S15H 3RZOB 2PW7A 5K36G 4WJ3M 1BCPD 2F03A 2C35B 3PO3B 1STEA 3CCLA 3M3YH 3QG1A 3TP7A 4C1NK 1EY5A 1G8ZD 3E9HA 1EWHA 1IBLQ 2HIVA 2HHHL 3GTPB 1TVXA 4K14A 4QL5A 2OF1A 2AQ2B 2F3WA 2B2VC 2GN5A 2WKCA 5C4JH 2L55A 3ND9A 1NCVA 5IGEA 1G2TA 3J81i 2JP1A 2L12A 3OTOL 2OEOA 1J8IA 2JA5B 2B2YC 3FKIG 2AHOB 5M9OA 4OWWB 1GUSA 3ND8A 2N78A 2WV6D 1CUKA 3Q8DA 5GAEC 2B63B 4U68A 3M9BA 3SHLA 1EOTA 4B3TL 4MN3A 5FLXE 2N8NA 2Z6KA 2YU9B 3D31A 3WWVA 3FP9A 1EY8A 4OXPA 2UXBQ 1BCPC 2KOLA 4AQYL 1Q12A 1U4RA 4JI3Q 4ALPA 5M3MH 3S2DB 3RZDB 5E3FA 5D14A 2JA7B 3FVQA 1HFGA 1M1KC 4QCLA 4HR7B 3KDFB 4L5SA 1EWIA 4LF9Q 2D0PA 3EN2A 1Y14B 1EY0A 5C4XB 2KEDA 4QIWB 4KJOA 2F3VA 1EOVA 1YVCA 3J7AF 4G7ZC 2J4XA 3H0GH 2ZXOA 3P7JA 4HIOA 2R92G 1KD1C 4JBMA 2UU9Q 3TZUA 5IWAL 3CU7A 2ZTDA 1EIFA 2BDOA 2HDLA 5IP9G 2H1EA 2IX0A 2I0QA 4LFCQ 1YHQA 3MXNB 3PIPA 4JI2L 3ULJA 1BQQT 4BY7H 2JA6G 2R7ZB 4HJAA 4R1JA 2NYZD 3MC0B 2ATWA 3I4MG 2NN6G 1S5CD 1VF5C 4IZ8A 2K01A 1H9SA 3K5OA 5IOCA 2F0TA 1S5DD 3HEJA 1MHWC 3PV0A 2A1AA 2LXKA 2EJFC 5G3LD 4L5QA 4JVZA 3RNUA 4A3CG 3GDEA 4JW0A 2K33A 3IRBA 4R4QA 5EJWA 4DV1L 1K0RA 3UDGA 3GTLH 1KNAA 4DR6L 3OMGA 2EVBA 1SE3A 1H9JA 4DNRB 4BBRG 4YHHQ 4QGUA 3R8BA 4K0KQ 1O80A 2CCZA 1SSOA 1ZEQX 1DM0B 4RWSC 1FGBD 1ET9A 1LO5D 2N88A 4WORA 2Q8RE 5J3BA 3T56B 4DK6C 2HDMA 2Z6KC 5EAYA 2PQAA 4FXDA 3FHWA 3VYTA 1BOSA 1QNUA 1YZ6A 1ENAA 3I73A 1OXSC 1C9OA 3HOYB 5FLXc 3CQZB 1KC8C 3MHBA 2B2UA 1I50B 1ZXTA 3EJIA 2OWOA 3NXWA 2KCNA 3G4SA 4DV6L 2LS01 1LTLA 2YV5A 4IFDJ 1Y1VH 2NUCA 4XYOA 2C5CA 5ELNA 1HRJA 3J80L 3SDZA 1RTOA 3VR2A 2VB3X 1DOKA 3PMFA 2DJGC 1GUNA 2DY7A 4A3EB 1QUQB 2EIFA 4DKAC 1IL8A 1ILQA 3BVZA 1YJNA 5A2QL 1EZ8A 4R4CA 2M00A 4AYBE 2F52A 3F2DA 1JB7A 1I6HB 1A3TA 5IYDG 1STHA 1LTID 2L15A 5JJLA 1LT4D 3S1RB 3BDLA 1Z7TA 3BYTB 2NTTA 2LSSA 2FMMA 4E6IA 2NVTB 3F1ZA 1MSGA 4DR1Q 2JA8B 3HOZG 1TS2A 5JPNC 1TXYA 4KV6A 5CORA 2X69A 1EFWA 1HZCA 1CKNB 3NTKA 1PH4A 4DV5L 1N36Q 2KA7A 4FVMA 3NTHA 4ABNA 1BR9A 2I5HA 4GKJL 3WOEA 1X54A 4GKKL 3VR3A 1U9RA 5C3WA 3BZKA 1WTVA 4HIKA 2SEBD 4V190 1YHAA 1EY4A 2KCMA 3HOWG 4GN5A 1MD2D 2K1BA 5E4WC 4DR3Q 2L9HA 1RIPA 1LT6D 3MA2B 3Q6SA 1TS5A 5M5XH 4NP5A 1KDBA 2B2UC 1AW7A 2PNRC 3NEMA 4X66Q 2IY5B 3T51B 4R8IA 5JPMC 1PDQA 4A3MG 2WIIB 4DV3Q 4HEDA 3W5OA 2HIXA 2RDFA 1JICA 1PXUA 4ID6A 3R3OA 3T13A 4DK3C 2CH4A 4XDXA 3KF6B 4RGMA 3ERSX 4XTCS 2E2DC 4NXML 2JXMB 4A3GG 2TSSA 1WTRA 5LL6S 1PH9A 1UAPA 3LX0A 2YYZA 1IBMQ 4KMUC 4KD4A 3K6OA 1WCMB 3CAMA 3TEHB 2KUMA 2Q2HA 2YTVA 3DXJC 2ZJRA 5J39A 2KJXA 4JI0Q 4N8FA 1HR0W 3CKIB 1Y1WG 3TMEA 1JJCB 4X3UA 3H3VI 3HKSA 4RH6A 2I5LX 1FVIA 1TWGH 1PTOB 2EXDA 4GNXB 5KRUA 3S14B 3RR5A 1D1KA 1PFSA 5GQOA 1SXTA 3K5LA 1K9MC 2D5DA 4DV7Q 1CQVA 2XTIA 5EKKA 4DXFA 4CHTB 3T16A 1XPUA 4Y7NH 1YITA 1EIGA 1WVLA 1HA5A 3MXPA 1KTKA 3D4WA 4FF3A 1OXTA 1CZGA 5AJ3L 2OTJA 2R7FA 4G4KA 4UY8C 2N55A 4H0LC 2PMZB 4JBKA 3ZJYC 1ASZA 1SYFA 3VR6A 4DNIA 1GOZA 1I4RA 4MHEA 2WAQB 4OONA 3HKZG 1I5FA 1CA6A 1LUZA 4EGVA 4C1NI 3PO3G 3A0JA 2ASBA 4OELB 1SE4A 1G91A 2VW9A 1SNCA 5CV6A 1DZ1A 3NP8A 1X65A 2K75A 1FD7D 1FGUA 2E2HB 4GOPA 4OO1H 1L1OA 2L5TA 3OOCA 3VYSA 3JAML 3OPOA 3Q0AA 3CCJA 3U50C 3FPPA 1GO3E 1EFID 2KQ3A 3J7AV 1EQTA 5CBAE 2R93H 2YTXA 5C4ZA 2JA5G 3F8TA 1N33Q 4LF4Q 1GUTA 1HJPA 4HCEA 1VS0A 1CSQA 1R4QB 3QB3A 1EY6A 3K7AB 1JR0D 1PTOF 5EQ0A 4L6TB 4O2DA 4LK1C 2B63G 2M9VA 2XIWA 4C3JB 1I4PA 4C3HG 1SLJA 2K05A 3I70A 4X3TA 4A3KH 3M4OB 3M85A 4DUZQ 4LFAL 4EQPA 3G48A 4BXXG 2E76C 2OXPA 4K8IA 3Q24A 1BBXC 1HCZA 3RN2A 3NWTA 1KHIA 2JQOA 4A3JB 4DUYQ 4IUUA 1RJTA 4JV5L 3A8IE 2Y0SB 2XNAC 4IUPA 2QW7A 1D5XC 2Q2IA 5C4XG 1PZJD 1TY0A 1PH3A 4XYQA 2ALYB 4LJZC 2ICIA 2ZXPA 2KENA 4K2KA 5IODA 3QO2A 3QWNA 1BO0A 2F0SA 1YHBA 4PQXA 1A2TA 2F4VQ 3W1BA 1I4GA 1PRTD 1PH6A 1E3PA 2JA9A 1M4VA 4OGQC 2HT1A 2F0QA 3E0EA 3W2DA 3ITPA 1Y8PB 4IN3A 4IPDA 1N8RC 1B70B 2RKSA 4DR5L 1C4QA 2F0OA 1D6EC 4IJHA 2L4NA 1YJ9A 3PO2G 2PZTA 3FDTA 1HR0L 2MJ8A 3LWEA 4PZ6A 4Q5VA 4DV4L 5BN3A 3A8JE 3VR4A 3DM1A 3KBXA 1D7QA 3KJOA 1S40A 2B8FA 1TWAH 2K5HA 1VF7A 1XNQQ 2MQHA 3CXCA 3S16H 4QY7A 4TRDA 3J81E 1L1OC 5K36H 1VQMA 3I4LA 5M3FB 2UXDL 3PF5A 1IKLA 3CC2A 1QNKA 2F0UA 3EVQA 4IFDI 4NW2A 1PRTC 2HQLA 2NVXH 1NNXA 3BVGA 1G6ZA 1KLGD 5BN5A 1BF4A 4WRDA 1V1PA 2TMPA 2WP8J 1PVOA 1XTDA 4BA2I 2B2WA 2NZ1D 3DEPA 3FKIH 3HOYG 2DNCA 2EY1A 3QOLA 4MTKA 4F87A 4K5WA 3BDCA 1LTSD 1VQFA 5DM63 2K7VA 3D0FA 1M8AA 3I8ZA 3HOXB 1OXXK 3E9IA 1L0YB 1VQAA 5GROA 2LXJA 1EIYB 4TQUS 2IW3A 2RVLA 1TWCH 2CFMA 1LABA 1SFOH 4L63B 1XWEA 2HD3A 1GVPA 3GTOB 4GLXA 4H7BA 5CC4A 1NY4A 3PQIA 3SK5A 4RHSA 5CV5A 5T1IA 4IOAA 4JCVE 3GQBA 1O78A 1PH1A 1B53A 1PYBA 1EY7A 2R92H 2CVRA 2Z4HA 4A3BG 5IP9H 4I7AA 2DN8A 4R4IA 1BCPF 1ZKOA 2B2TA 4YY3L 1UE1A 3T1YL 2MUYA 2JA6H 2VUMB 4JI3L 5IGBA 1H9RA 1IXRA 1W6KA 2NN6H 2R61A 4KKUA 3K80C 4CKBA 5JVG3 1WI5A 3I72A 3T53B 4B3RQ 2A68D 2FJ2A 2NBFA 4LF7Q 4LF9L 3J81c 2NZHA 3PSIA 2K5VA 3K0XA 2OTLA 4A3CH 2RSNA 2BA1A 4HMJA 3LGJA 1IZ6A 1O7LA 3E6ZX 1IKMA 4FYDA 4R4TA 2JEBI 3S1MH 1X3EA 2B2WC 4BBRH 3UDIA 1Q46A 1E24A 1DONA 4UP7A 5M5YB 4NPSA 2EJGC 3UDFA 4DR7Q 3AEVA 2PI2A 3AU7A 1R4PB 2F0LA 4K5VA 1SJED 4LUVA 4DA2A 5KNBA 1XMQQ 1K83B 2L0CA 2A68C 3U9SA 5L37A 4JYAQ 4H02A 3H0GB 3CCMA 1U0LA 1LT3D 2E2IH 5BR8L 2D62A 1H9SB 2B3GA 1JC7A 1B2TA 4AYBB 1ESFA 3ONAB 4DAYB 1SR3A 3N6RA 5ISRA 4LFBL 1DXMA 4BY7B 4YCWA 4TSSA 4OX9L 3KBGA 1WCMG 2PYKA 2MP1A 1T5EA 3NELA 3HG9A 4YWMA 1FL0A 4A3IB 3I3CA 2UXCL 1H95A 4DK0A 2B2TC 3DHQA 3OYYA 4RKLA 2B39A 5JJKA 3NUCA 1HNXQ 4IALA 4ZUJA 5G3LF 2R7DA 2I07B 5IYDH 1QILA 5FLMG 5KIXA 2CWAA 1J9OA 1XNRL 3IFTA 3TBIB 3W3AA 3J7ZC 5IY0A 3Q23A 3GTLB 4XQNA 3GTJH 2QA4A 1CFMA 5EGTA 2OT2A 3TSSA 2PQAB 3HOZH 1X3PA 3EA6A 4EX5A 4CJ2C 5IYBG 4KY6A 4A76A 3GO5A 5EKLA 4ZCKA 2BOSA 5M5WH 3CPWA 1NR4A 1I3QH 2PI2E 2QKIC 4KKSA 1A2UA 3SXHA 4JI5Q 3A8KE 1U4LA 3TQYA 1XJVA 3EFXD 3V05A 2BDNA 3D6WA 3AMUA 4JI1L 2AQ1B 3O13A 1IBKQ 3D8GA 1EQVA 2MO1A 4NDXA 4LF8L 2D2CC 5KEEA 5KYLA 3HOWH 4A93B 2L1BA 4NB3A 4KI0A 3H3VC 1SJHD 4DR1L 5J1ZA 1Q90A 4X62Q 1SYBA 4LUOA 1Y1VB 2UUAL 5C0XJ 1QJOA 1BBUA 2MNAA 2QCPX 1YJWA 4A3MH 3HOUB 3CCEA 3AFQA 1A63A 2F3IA 2EQSA 4KLKA 4ZQ3A 2KECA 3A56A 5JAVA 4OEMB 5JEAJ 1A8VA 1TU2B 3U4VA 1YNXA 4X64Q 1ICFB 5C5LA 2VQFL 1DYQA 5IT9E 5C3XA 4LWCA 3CMEA 4DV2Q 4A3GH 2FHTA 3U58A 1YI2A 3M7GA 3B6YA 2VQEQ 3PIO3 4NXNL 1J5EL 2Y0SG 3L3OC 2G9DA 3K5NA 3TRZA 4DGZA 3NE5B 3R2IA 3TZDA 1YNJD 1I6VC 4BS9A 2Q2UA 3UI2A 1CHQD 1LACA 1X6OA 1Y1WH 1KQSA 4X3KA 2Z6BA 4JI7L 1KABA 2UUCL 2KCCA 2VS1A 2RDGA 4KD3A 4LF6L 4A3DG 3CHBD 3CC4A 3C1EA 5KNCA 3S1NH 1T5XD 3P20A 4A3FB 3S17H 4CJ0B 2RCFA 4C2MH 3BVMA 1JWUD 1SRUA 2A69D 3CC7A 4XT1B 5C44B 1BNZA 3SK6A 5KGUA 3KLSX 1L2FA 1YNJC 1CZWA 2QEXA 3S9WA 4IUTA 3RLOA 5M3FG 1B44D 3PO3H 1A0IA 2X6GA 4QUFA 1CA5A 3M4QA 2F0NA 1RDPD 3GTGH 4DV7L 3S24A 4XQQA 1XMOL 1Z47A 2KEEA 4IQZA 3C46A 3T4AC 2E2JH 1PH7A 5E7NA 4R9WA 1X56A 4FNFA 5COYA 2JA5H 4DR4L 2K50A 4J6HA 4ZKBB 4HJ8A 1BXTA 1IHZA 2RHSB 5IT9c 3KF8B 3SK4A 1HTPA 4LF5Q 3CD6A 1VQ9A 1PZKD 2B63H 2A69C 2VNUD 4DF7A 3HOXG 4C3HH 2YU9H 3H6MA 4ME5A 4HIMA 4BXXH 2IX3A 2A6HD 5IGDA 3S2DH 4HJ9A 2AUJD 5H1SE 3C1FA 3J80i 4OHJA 1LTRD 2Z4IA 2MHVA 2MO0A 1EEFD 1G291 3RLNA 4MNOA 4QB4A 5FO8B 1N33L 5C4XH 5EPKA 2A19A 4X3SA 1K3BC 1ICWA 1WFQA 5CV4A 2EYOA 1P8LA 4GOPB 4JI4Q 3KDFA 4RA8A 1STGA 5I9OA 1HQRD 3HP3A 4DUZL 2LFNA 4DAMA 2QILA 4GLAC 2VUMG 1CHPD 3CCSA 1ASYA 1Q1EA 4K6LA 3K8AA 4OIJA 3PO2H 3KFUA 3KK7A 1SE8A 3SR1A 1VQJA 2A6HC 3MXNA 3HKZE 2K04A 4R8NA 3GTMB 1MGSA 1E22A 1LT5D 3HOVG 2R93B 1N34L 3AQQA 2NVYB 5GAGC 2HUGA 5FLXL 1FR3A 4DPGA 1SNQA 4BBSB 5IWAQ 1CQFA 1H9MA 3P1HA 4RCNA 1ESRA 3V96A 1Q3LA 1W6JA 2XN9C 4OWTB 2A8VA 1WJJA 2F0HA 2Q8TA 5EBDA 5DM73 2Z8LA 2F0WA 4JI2Q 3KOJA 2RHQB 1IW7D 3U4ZA 3BYYB 4ZAIA 1C8CA 4IFDG 4ZK9B 2EY2A 1NSNS 1FNWA 2SOBA 1WTQA 1FJGQ 3FMCA 3HOYH 4MZ9A 1XNQL 1I50H 3GTQB 1QE6A 4XT3B 3NTIA 1II3A 4B3ML 4AYBG 2DGYA 4XXEA 4DR6Q 3I55A 2AUKA 1EIHA 1CSPA 1TR5A 5DNFA 1ILPA 3V2TA 1HZAA 1UUPA 1HNWQ 4A3IG 2BCOA 5DAUA 4PMWA 4NMZA 1TWHH 1IW7C 4LMQD 5IGCA 2O4XA 3D4DA 3OIPA 1I6HH 2HCIA 4X65L 2RDHA 4F8MA 4IPHA 1EU4A 4MIUA 3TDQA 1TWAB 1N32L 4ZLTF 3DWPA 1GJXA 4JI8L 3S1RH 2F0PA 1HH2P 5IYCG 4A3BH 2FXQA 2IJ0A 1WD1A 4N9TA 1TKWB 1DCZA 2JA8H 4DV6Q 4P72A 1RKNA 2XWJB 4LW1A 2EYHA 1BVSA 5C0XI 1R9TB 5D65A 2NVXB 5JVH3 4HMIA 4RGNA 4F7XA 3A7AB 1BBWA 1EU3A 3A74A 1O7IA 1VQ8A 3KLRA 3GD7A 4XIGS 1YIJA 3MFYA 1UEBA 1GXDC 5J22A 4S3SA 4EQOA 2ZJPA 4IPCA 1CKNA 5LHY1 3A7LA 4YCVA 4DV0Q 4A93G 5FOBB 2NTSA 1BUVT 1E2WA 1OXVA 3T1HQ 5BN4A 3M4PA 4JBWA 1KNEA 4ILWA 4CDCC 1TWFB 2CW0D 1VQ5A 2EY6A 3I91A 2MFIA 5DLQE 4LAAA 1TWCB 4HIDA 4B3SQ 2WFWA 2WKDA 4O42A 4PG3A 1HPCA 5E4XA 3JAMi 1WTOA 1HUMA 4LF7L 2JA7G 2PNHA 4DV5Q 2DY8A 4APVA 2IT1A 3UE0A 1E1TA 1SMXA 1AP0A 3TP5A 4GKJQ 1LTAD 1RHPA 1V1QA 2AQ3B 4NKLA 1VQLA 1HZ9A 2YTYA 1JORA 2GVBA 3X3NA 4CDEC 3I4NB 2CH4W 2F0IA 5IP7G 3MXUA 4QMGA 1HUNA 4ZRZA 5IGGA 1EEID 1UE6A 3FPUB 2R7ZG 1WCMH 3KF6A 3P75A 5CGKA 3I4MB 3G7LA 2RQXA 3BJUA 1IL2A 1ZYRD 3BZDB 2OQ0A 2CW0C 3BG3A 3S1QH 3K5MA 1XMQL 1CT1D 4UAIA 3CPFA 4UP9A 1X3GA 4KHPL 3K81C 3H94A 4HTHA 3MVVA 3G6JB 1G6PA 1KRSA 5FLMH 3L9AX 3CCUA 3S14H 4RGOS 2EPBA 5LMUL 4NXMQ 4G57A 3A5UA 3CCQA 1B9NA 1QZGA 4IO9A 5GAHC 3URYA 4A3FG 4BBRB 2E75C 4UPAA 1PFBA 2KHIA 5IYBH 1BCPB 5ELFA 1RF2D 2O2LD 1I4XA 2JSOA 4GNXA 4YCUA 2UUBQ 3NBHB 5FKAC 5C44G 3E5SA 2J7ZA 1PHJA 2D0OA 4J1MA 1D8LA 5C3EB 5LMNQ 1SEBD 1ZYRC 1HNXL 2GVAA 1C0AA 1N9WA 3PUWA 1X32A 4C3IB 1SAPA 3FRPB 5CV8A 1C48A 3GTKB 3GV3A 3PCOB 4AH6A 1HQMC 2E2IB 1CKOA 2N49A 1A62A 1X9NA 1WTPA 1SYGA 2E2HH 1PV4A 5GADC 2XGTA 1C7YA 2WB1E 5C6AA 2CHBD 4B08A 2F4IA 4ODGA 1IBLL 4A3LG 4A3EG 2QDLA 1KAWA 2NZOA 4BY1B 4GS3A 1FNVA 1KAAA 3I90A 1TQOA 4JI5L 4KHVA 3OW7A 2K14A 1PTOD 1X3FA 2Z1CA 2F0VA 4JI6Q 1EWCA 2O5JC 5C5MA 1KLUD 3MEHA 3PIOA 2F0GA 3S15B 3A5ZB 4TVAB 2BA0A 1K3RA 1MKHA 3H91A 2SNMA 1A3VA 5K5PA 2JA8G 1BDOA 3HOZB 1Q8KA 1Q1BA 3M3YB 2UXBL 1MJCA 1GHJA 1E2ZA 3UDXA 3K58A 1MSHA 4FF1A 1ENCA 4RAUC 5C4JB 1LTTD 2ZJQA 2A6ED 1SROA 1PH5A 4X64L 1WD0A 2RCNA 1K8OA 2ZM6Q 2EJMA 4DR2Q 1SMYD 3K7UC 3M7NA 2PZUA 1PTOC 2E5LQ 2UU9L 3MWYW 4GNXC 4FXKC 4LFAQ 4A3DH 4LFCL 2B29A 3RN5A 3H3VH 2VQEL 1S5FD 2G9HD 1EYGA 4RMFA 4JV5Q 3PUXA 3OWEB 4UHVA 2QDBA 2QEJC 5M3MB 3NHHA 2VL6A 3CCRA 4U673 2H5XA 2BH2A 3S2HH 1A15A 4GZYC 4BBSG 5M3FH 1HNZQ 5EKIA 4L5TA 3NWSA 1E7ZA 2A6EC 1V43A 3D6CA 1GD7A 2OQKA 1SMYC 1EYDA 3EBEA 1UE5A 5FO7B 5CMDA 4HSPA 2XWBB 1HR0Q 4YHHL 3M4YA 3CW2C 3SK8A 4K0KL 1KXLA 1SNPA 4DV4Q 1IYJB 2XRQD 1SNOA 3J80E 2NVQH 1D1IA 1S4ZA 1OXUA 1K8MA 3CP0A 4IJLA 1I94Q 1E2VA 1AN8A 3HOXH 2EYJA 5A2QE 2UXDQ 3GV6A 3GP7A 2IX1A 4B9WA 4POFA 1MJEA 1NTGA 4DN4M 4HJ5A 1VQPA 1CM9A 3GTOH 2K5NA 1S3OA 2PCFB 4FP5D 1JJ2A 1B3QA 1LM0A 1SNDA 2VXWA 4KK7A 5FJ8G 3J81L 3OW2A 3I56A 1RD9D 1I4HA 3PF4A 2AKWB 2WINB 1F2YA 3F2BA 3SVMA 2WAQG 5D3IB 1DD2A 3HKZB 1L0WA 2IL8A 3J7YW 2EZVA 4XQJA 1E0BA 4AIMA 5I9PA 2QGQA 1EQQA 1K0SA 2VUMH 3GTGB 1DOLA 5E1FA 3I2ZA 4CDDC 2F0JA 4YIJA 2JJQA 3K0YA 4X6AH 1WYDA 3HZXA 3NBIA 4IOCA 4OWXB 2AWNA 2ENBA 2E2JB 1WTHA 3NQIA 1SYDA 3HOVH 4H13C 3EQLC 1RODA 1N36L 5I6WA 1WTWA 1JE4A 2D9UA 4RG1A 4N8X1 2LKVA 3MAQA 3FEWX 4RFBA 4JI4L 4C3JG 4A4IA 5HY6A 4YY3Q 4C3HB 2Z0SA 1AFPA 1JCKB 1KL9A 3T1YQ 3QIAA 1JWMD 1O7YA 1ENFA 5M5YH 2F0FA 4DR3L 3R93A 3J80c 4A3JG 2L11A 5ELEA 4IFDH 1V8QA 4QF4A 2VZAA 1K83H 1SE2A 4X66L 1F2ZA 1PYSB 1SDFA 4JPBW 2A5HA 4DV3L 1AE2A 3G71A 3X3MA 2LY7A 1K73C 2NB0A 1UEAB 4FDBA 4C56C 3DUZA 3I4NG 1I4QA 2JE6I 1Q8IA 1XYIA 1TS3A 3HGBA 4OO1I 4FO2A 3ERQA 3EROA 1MBYA 3PO2B 1UNSA 4K6DA 4OIKA 1NMFA 1F9SA 4A3IH 2ES2A 1IBML 1KIXA 3K57A 2SNSA 2NWGA 4DAYA 3ULPA 4K2LA 5M5XB 3C3LA 1FJGL 1VQCA 1OO9B 2J0TD 4JI0L 2RA4A 4LUZA 2K52A 1B4OA 3C2PA 1VQEA 5A35A 3CCVA 3RZOH 3MEFA 4MTNA 5IYCH 2FINB 2EE1A 2DJFC 5BR8Q 3DLLA 1AZQA 1STYA 3MTSA 5HURA 1Y69U 4LFBQ 4OX9Q 3Q22A 3AB9A 1HNWL 3GTPH 3RD4A 3BZCA 1MIUA 1K8GA 1RCVD 2HCCA 5T1GA 2UXCQ 5CYUA 5C3EG 5C0XG 1BKBA 1HZBA 5KNDA 2CQAA 4KJNA 4M1UB 1H9KA 4HN7A 2SDFA 4C3IG 2WACA 2ICEC 1NJIC 2R6GA 3JAME 1F9RA 2GA4B 1D5ZC 1EL0A 2AWOA 3IL8A 1EUJA 1VQHA 4A93H 2IPKD 1XNRQ 5LMNW 3TS2A 2PPBC 1VQDA 3HRZC 4ULLA 5JEAG 1S5ED 2B8GA 2KVMA 4CKCA 1QOHA 1QVGA 1TWGB 3I7FA 3AFPA 4J15A 5FO9B 4P71A 4BY1G 5I2YA 3RZDH 2HHHQ 2PQEA 4GN3B 3ULLA 2XSCA 3HOUH 3J7A5 4RHRA 2JA7H 4Y7NB 4PNYA 1GUGA 3MZ5A 4B9XA 1HA6A 1TWHB 1SYEA 3OIQA 4CGYB 4BWGB 5AFWA 3OTOQ 4LF4L 4Y52H 1XX8A 1JMCA 1YEZA 1QB5D 4ZKCB 4WFN3 4JI1Q 4DV0L 3RLFA 4LF8Q 3H09A 4KN4C 4A3BB 1L1OB 1B9MA 5JOBA 3CF5A 3E0JA 3T1HL 4G7HC 5IP7H 3WDNA 2BE5D 4B3TQ 1PYWD 2R7ZH 5EPJA 2UUAQ 1LYLA 4B3SL 1PRTB 5NUCA 1EQRA 2CKZB 1JWSD 1PFNA 4QJFA 5D3DA 4AQYQ 5I2XA 4N9PA 4DUYL 4CDFC 3NK9A 4EQ5A 4ME3A 2K32A 1JOQA 4IPGA 3WOFA 3RUZA 3HFZB 4PZ8A 2ZTCA 1IYVA 2N3SA 2DUDA 4EQNA 1QVFA 4PV1C 1LTGD 5ELOA 4LNQA 1YBYA 3EIVA 1NMGA 2VQFQ 1S72A 2F4VL 3W1GA 1F2MA 5LL6X 4HAEA 4P73A 1TIID 4A3KB 1F9PA 4A3FH 1GUOA 2KHJA 1J6QA 1J5EQ 4NXNQ 3DM3A 4EVOA 2KBNA 3DMUA 2BE5C 5M3MG 1MI2A 1VQ6A 2EOTA 2RSOA 5C44H 3VA7A 3JAMc 1HXYD 3N52A 2WB1B 1Y8OB 5IT9L 2EYLA 1VQ7A 1SN8A 1GHKA 3IKJA 1G2SA 2EXZA 3K59A 4JI7Q 3CQZH 2F0DA 1O7ZA 2BH8A 3STBD 1QZHA 3HS0C 2UUCQ 3TP8A 1YNND 3H0GG 4UP8A 2EY5A 5CR3A 1PRTF 2CWPA 4LF6Q 4DV1Q 3L7ZC 2NN6I 2PW5A 2AMCB 3IFDA 1V1OA 1JE5A 5I6YA 4PZ7A 1XPRA 4JC0A 4BY7G 4IUNA 2HQEA 3DWQA 4A3LH 4FF2A 4A3EH 5KYIA 4QIWE 3PIP3 2UUBL 1NAPA 3KLSA 1G51A 5LMNL 4POGA 3S1QB 4QQBX 3UE1A 2C9OA 1Q81C 1W2BA 1P16A 1CI3M 3VYRA 2E8GA 2IWHA 1QUQA 5DEHA 3S16B 3KF8A 3STBC 1K8AC 2NVTH 1V1PB 1LLRD 3BS1A 1D2BA 1YNNC 1XMOQ 4DK1A 1U4MA 3KJPA 1DJRD 1F2LA 2EYFA 3I4OA 1XTCD 4RGTA 5HGTA 3KLWA 4P74A 1PFMA 1Z9FA 3QOJA 4DR4Q 1WOCA 3PUVA 2K28A 4I7ZC 1A3UA 3CRLC 1VQOA 1DGSA 1NBWA 1JOKA 4JI6L 3CRKC 3L0OA 3FKIB 5EBCA 4K5XA 1JT8A 3PUYA 3OMCA 4DNTB 1A6XA 4P75A 3QR8A 3D3RA 1Y1VG 1QG7A 1E1OA 3ZYYX 3GTMH 1F77A 1IYUA 1L0XB 1SFOB 2H4OA 4UDUC 4KY7A 2Q2TA 4B3RL 2NVYH 1FYCA 3NPPA 3HOUG 4JK1C 3CMAA 2E74C 4YWLA 4O0AA 3DWAA 4BBSH 2ZM6L 4GKKQ 4DR2L 4DU9A 2E5LL 1U5KA 3OSOA 2PO4A 2R92B 2IHFA 1ML0D 1VCIA 3BDOA 1M90C 1NR2A 3KUPA 4WJ4A
chains in the Genus database with same CATH topology
4NXNL 1J5EL 2Y0SG 4RMFA 4A75A 1OTCA 1UWVA 5M5XH 3TRZA 4JV5Q 3PUXA 3NEMA 4DR7L 4X66Q 2IY5B 1RL2A 1NE3A 2VL6A 3CCRA 1N34Q 2H5XA 4A3MG 4DV3Q 2Q2UA 3GTQH 2BH2A 3W5OA 2HIXA 3S2HH 1HNZL 1X6OA 4BBSG 1Y1WH 1KQSA 5M3FH 1HNZQ 4L5TA 4JI7L 4JYAL 4DK3C 2UUCL 2VS1A 1E7ZA 3KF6B 1V43A 3ERSX 4XTCS 4NXML 4HJ7A 4LF6L 1GD7A 4JOIA 4A3DG 2OQKA 4A3GG 3EBEA 1UE5A 3CC4A 4JG2A 1PH9A 3S1NH 1HR0Q 2YYZA 2ZTEA 4YHHL 1KRTA 1IBMQ 3CW2C 1V9PA 3PGZA 4K0KL 3S17H 1KXLA 1Q86C 4DV4Q 1IYJB 3CAMA 2JEAI 3TEHB 1T9HA 5FJ8H 2Q2HA 2YTVA 4C2MH 2ZJRA 1SRUA 4JI0Q 2NVQH 3CC7A 1OXUA 1HR0W 1L2FA 3CP0A 4IJLA 5JJIA 4GOPC 1I94L 2QEXA 1VQNA 2KCTA 1Y1WG 1I94Q 3RLOA 5M3FG 4B3MQ 1JJCB 3HOXH 3PO3H 1A0IA 3H3VI 3HKSA 3M4QA 2UXDQ 2I5LX 1FVIA 2IX1A 1TWGH 3GTGH 4POFA 2EXDA 1VQ4A 4GNXB 1R9TH 1NTGA 1MJEA 3RR5A 5GQOA 1PFSA 4DV7L 4HJ5A 3S24A 1VQPA 1K9MC 2VY3A 4DV7Q 3GTOH 1XMOL 2XTIA 3BU2A 1VQBA 1Z47A 2K5NA 1XPUA 4Y7NH 1YITA 1S3OA 1JJ2A 2E2JH 1PH2A 1LM0A 1PH7A 2OTJA 5E7NA 1OXTA 3NENA 5AJ3L 1X56A 2R7FA 5FJ8G 5AJ3Q 4UY8C 2JA5H 3OW2A 2IHEA 3I56A 4JBKA 3ZJYC 3PF4A 4DR4L 2K50A 2AKWB 2I5MX 1X55A 4X65Q 4HJ8A 1Q7YC 1ASZA 3G6EA 3F2BA 2RHSB 4DNIA 3KF8B 5IT9c 3K7AH 1N32Q 2WAQG 4OONA 4JI8Q 4LF5Q 2RF4A 3HKZG 1VQ9A 3CD6A 1I5FA 2B63H 1L0WA 2VNUD 1LUZA 4C3JH 3F2CA 1IBKL 3HOXG 3PO3G 3A0JA 4AIMA 4C3HH 2ASBA 2QGQA 1EQQA 2YU9H 3M4OH 2VW9A 4YWKA 1TWFH 4HIMA 2VUMH 4BXXH 3I2ZA 1X65A 2K75A 2JJQA 3S2DH 1FGUA 4HJ9A 4X6AH 4X62L 5H1SE 1WYDA 3J80i 4A3JH 4GOPA 1L1OA 4IOCA 2MO0A 1VQIA 1G291 3RLNA 4OWXB 3CCJA 2AWNA 3U50C 1VQKA 1GO3E 4MNOA 4R4OA 3HOVH 1N33L 5C4XH 2R93H 2YTXA 2OCEA 2JA5G 3F8TA 1B7YB 1N33Q 4LF4Q 2A19A 4JOIC 1N36L 1HJPA 3SGIA 1VS0A 1CSQA 1WFQA 1AH9A 4RG1A 1P8LA 4O2DA 4GOPB 2B63G 1UE7A 4JI4L 1CKMA 4A4IA 1GKHA 1PH8A 4JI4Q 3KDFA 3I4NH 5HY6A 4YY3Q 1SLJA 2Z0SA 5HGQA 4DUZL 4A3KH 4DAMA 1KL9A 3M85A 4DUZQ 3T1YQ 4LFAL 4GLAC 3G48A 2VUMG 3CCSA 4BXXG 4DV2L 1W3SA 5M5YH 1ASYA 3I4MH 1Q1EA 3PO2H 3K8AA 2PMZE 3KFUA 4DR3L 3RN2A 1KHIA 2JQOA 3J80c 4A3JG 1SE8A 4DUYQ 1VQJA 4OO1G 1XPOA 2WAQE 4JV5L 3VDYA 2VZAA 3AYHB 1K83H 3HKZE 4JBJA 4GLVB 4X66L 1PYSB 1E22A 2Q2IA 3HOVG 5C4XG 2R93G 1N34L 2JK8A 1PH3A 3AQQA 2ALYB 5GAGC 4DV3L 1AE2A 3JC66 2KENA 3G71A 1K73C 1YHBA 4DPGA 5IWAQ 2F4VQ 4FDBA 3W1BA 1PH6A 3ICEA 1E3PA 2JA9A 3I4NG 2JE6I 2HT1A 4OWTB 4A3KG 1WJJA 3E0EA 4KHZA 2A8VA 4OO1I 2K4KA 1VQGA 3ER0A 4IPDA 4JI2Q 1B70B 3H15A 4DR5L 1N8RC 3KOJA 2RHQB 4DR5Q 3J81j 4IJHA 1YJ9A 3U4ZA 3PO2G 1NMFA 4A3IH 1HR0L 2ES2A 1IBML 3KYHC 4IFDG 1KIXA 5C3EH 4PZ6A 2WB1G 4DV4L 3ULPA 1FJGL 3PUZA 1VQCA 4KHPQ 1FJGQ 1D7QA 3KJOA 4JI0L 4C3IH 1S40A 1PA6A 3HOYH 3GTKH 4MZ9A 4LUZA 5IE8A 1B8AA 1TWAH 1XNQL 1I50H 2K5HA 2K52A 1VQEA 1XNQQ 2MQHA 3CXCA 3CCVA 3RZOH 4QY7A 3S16H 3MEFA 4MTNA 5IYCH 1L1OC 4B3ML 1VQMA 5BR8Q 5LMUQ 4AYBG 4L5RC 2DGYA 3DLLA 4DR6Q 2UXDL 2V1CC 3PF5A 3I55A 3CC2A 1CSPA 2Y0SE 1GM5A 4IFDI 4LFBQ 1AE3A 2HQLA 2NVXH 4OX9Q 1HZAA 1HNWL 3GTPH 4BY1H 3BZCA 3L2PA 1MIUA 4A3IG 1K8GA 1HNWQ 4JYAQ 4GN4B 2ID0A 2UXCQ 4PMWA 5C3EG 3TREA 1TWHH 5C0XG 1BKBA 1HZBA 2CQOA 2WP8J 4BA1I 1PVOA 1XTDA 4BA2I 1I6HH 3FKIH 3HOYG 4X65L 1QVCA 3TS0A 1NJIC 2R6GA 4IPHA 1JJGA 1N32L 2AWOA 1Q82C 1EUJA 4JI8L 1VQHA 4LF5L 3S1RH 3S15H 4A93H 1XNRQ 5LMNW 5IYCG 1HH2P 3TS2A 1VQFA 4A3BH 5K36G 4WJ3M 2FXQA 1VQDA 3D0FA 5JEAG 2C35B 1OXXK 3E9IA 2JA8H 4DV6Q 4P72A 3CCLA 3M3YH 1VQAA 5GROA 2LXJA 1QVGA 4LW1A 1EIYB 4TQUS 1BVSA 5C0XI 3E9HA 1TWCH 2CFMA 3I7FA 3AFPA 1SFOH 1IBLQ 2HIVA 4J15A 2HHHL 4P71A 1GVPA 4BY1G 3RZDH 2HHHQ 4QL5A 4GN3B 3ULLA 4GLXA 2GN5A 1BBWA 3HOUH 3A74A 2JA7H 5C4JH 3J7A5 1O7IA 1VQ8A 3GD7A 1NY4A 4XIGS 1YIJA 3J81i 1UEBA 3OTOL 3OTOQ 4LF4L 4IOAA 4Y52H 1JMCA 2ZJPA 3FKIG 1YEZA 2AHOB 4JCVE 4OWWB 4IPCA 1PH1A 4JI1Q 2N78A 1CKNA 4DV0L 3RLFA 1PYBA 1CUKA 4LF8Q 4YCVA 4DV0Q 2R92H 4A93G 4A3BG 3Q8DA 5GAEC 1EYGA 5IP9H 1L1OB 3M9BA 4R4IA 3CF5A 4YY3L 1UE1A 3T1HL 1OXVA 5IP7H 4B3TL 3T1HQ 3T1YL 4B3TQ 2N8NA 2Z6KA 3M4PA 4JBWA 3D31A 3WWVA 2JA6H 2R7ZH 3FP9A 2UUAQ 4OXPA 4JI3L 1VQ5A 2UXBQ 1LYLA 4B3SL 2MFIA 4AQYL 1Q12A 1IXRA 1EQRA 5DLQE 2CKZB 4HIDA 4QJFA 4B3SQ 4AQYQ 4JI3Q 2WFWA 5M3MH 4ALPA 3K80C 4PG3A 4DUYL 1WI5A 3JAMi 4LF7L 2JA7G 4B3RQ 4EQ5A 1M1KC 2PNHA 4ME3A 4DV5Q 4LF7Q 4IPGA 4LF9L 3KDFB 4L5SA 3HFZB 4APVA 1EWIA 2IT1A 3UE0A 1E1TA 1SMXA 3J81c 4LF9Q 2D0PA 2NZHA 3EN2A 1Y14B 4PZ8A 4GKJQ 2ZTCA 3PSIA 2N3SA 2DUDA 2K5VA 1V1QA 1QVFA 3K0XA 2OTLA 1EOVA 1YVCA 1VQLA 4A3CH 1HZ9A 5ELOA 4LNQA 2YTYA 3H0GH 1YBYA 4HIOA 2R92G 2BA1A 3EIVA 1KD1C 1NMGA 2VQFQ 3LGJA 5IWAL 1IZ6A 1S72A 2ZTDA 1EIFA 2GVBA 3W1GA 2UU9Q 2F4VL 5IP9G 2IX0A 2I0QA 4R4TA 2JEBI 3MXNB 1YHQA 4LFCQ 3S1MH 5IP7G 3PIPA 4P73A 1X3EA 4BBRH 4A3FH 3ULJA 4JI2L 3UDIA 1Q46A 1E24A 1UE6A 2JA6G 2R7ZG 4BY7H 2KHJA 4NXNQ 1J6QA 4HJAA 4R1JA 3DM3A 1WCMH 3KF6A 4UP7A 1J5EQ 2ATWA 2KBNA 4NPSA 3I4MG 2NN6G 3BJUA 5M3MG 1IL2A 3UDFA 4DR7Q 2OQ0A 1VQ6A 2PI2A 3AEVA 5C44H 3JAMc 3S1QH 4LUVA 1XMQL 1XMQQ 3CPFA 4UP9A 1X3GA 4KHPL 1VQ7A 1SN8A 3K81C 3PV0A 2A1AA 2LXKA 1G6PA 4JI7Q 1KRSA 3CQZH 4H02A 4L5QA 5FLMH 3STBD 2BH8A 3RNUA 1QZHA 2UUCQ 4A3CG 3GDEA 3H0GG 4UP8A 3CCUA 3CCMA 1U0LA 3IRBA 3S14H 4R4QA 2E2IH 5BR8L 2D62A 5LMUL 4DV1L 2B3GA 1K0RA 2CWPA 3UDGA 4LF6Q 4DV1Q 3L7ZC 4NXMQ 2NN6I 3A5UA 3GTLH 4DR6L 4DAYB 3CCQA 2AMCB 1QZGA 1SR3A 4IO9A 5GAHC 1JE5A 4LFBL 4BBRG 4A3FG 4PZ7A 4YHHQ 4JC0A 4QGUA 4UPAA 1XPRA 4BY7G 4YCWA 4OX9L 4K0KQ 2CCZA 2KHIA 1WCMG 5IYBH 4A3LH 4A3EH 3NELA 4QIWE 4YWMA 2UUBL 1FL0A 4GNXA 2UXCL 4YCUA 2UUBQ 3NBHB 5C44G 1H95A 1G51A 5J3BA 2D0OA 5LMNL 1D8LA 3OYYA 1PHJA 4POGA 5LMNQ 4QQBX 3UE1A 4DK6C 1HNXL 2Z6KC 5EAYA 2GVAA 2PQAA 1C0AA 3FHWA 1Q81C 1HNXQ 1N9WA 5JJKA 1W2BA 3PUWA 1YZ6A 1OXSC 1C9OA 2R7DA 5IYDH 1P16A 5FLMG 5FLXc 1KC8C 2CWAA 2E8GA 1QUQA 1XNRL 3PCOB 4AH6A 1CKOA 2N49A 1A62A 3J7ZC 5IY0A 1X9NA 2OWOA 3GTJH 3STBC 1K8AC 2NVTH 3G4SA 2E2HH 2QA4A 4DV6L 1LTLA 1XMOQ 5GADC 2YV5A 1PV4A 4JBMA 4IFDJ 1Y1VH 2PQAB 2XGTA 2WB1E 5ELNA 3KJPA 1C7YA 3HOZH 3I4OA 4EX5A 1IBLL 3KLWA 4P74A 5IYBG 4A3LG 4A3EG 1KAWA 1Z9FA 1QUQB 2NZOA 4A76A 2EIFA 3GO5A 4DKAC 4GS3A 4DR4Q 5M5WH 3CPWA 1WOCA 4JI5L 1I3QH 2PI2E 1YJNA 3PUVA 4JI5Q 2K14A 4R4CA 1X3FA 4AYBE 2F52A 3TQYA 1XJVA 3F2DA 1VQOA 1DGSA 1JB7A 1NBWA 4JI6L 3L0OA 4JI1L 5IYDG 1IBKQ 4JI6Q 2L15A 2MO1A 4LF8L 5JJLA 3HOWH 3PIOA 1JT8A 3A5ZB 3PUYA 4TVAB 2BA0A 1K3RA 4NB3A 1MKHA 2LSSA 4P75A 4KI0A 3F1ZA 4DR1L 4X62Q 2JA8G 4DR1Q 4LUOA 1Y1VG 3HOZG 1Q8KA 1Q1BA 2UUAL 1E1OA 1TXYA 1MJCA 5C0XJ 2UXBL 1EFWA 3GTMH 1BBUA 2MNAA 1HZCA 3UDXA 1CKNB 2Q2TA 4B3RL 1YJWA 2NVYH 1PH4A 3HOUG 3CMAA 4DV5L 4A3MH 3CCEA 3AFQA 1N36Q 4YWLA 1A63A 2F3IA 2EQSA 4KLKA 2ZJQA 4O0AA 1SROA 2I5HA 4BBSH 4GKJL 1X54A 4GKKL 1PH5A 2ZM6L 5JEAJ 4X64L 1A8VA 4GKKQ 2RCNA 1YNXA 3U4VA 2ZM6Q 4X64Q 4DR2L 3BZKA 4DR2Q 3K7UC 3M7NA 4HIKA 2E5LL 1U5KA 1YHAA 2KCMA 2VQFL 2E5LQ 2UU9L 4GNXC 3HOWG 2IHFA 4LWCA 4LFAQ 4GN5A 3CMEA 4A3DH 1VCIA 4DV2Q 4A3GH 1M90C 4LFCL 2B29A 3RN5A 3H3VH 2VQEL 4DR3Q 3U58A 1YI2A 1RIPA 3B6YA 4WJ4A 2VQEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN L;  1J5E L;  2Y0S G;  4RMF A;  4A75 A;  1OTC A;  1UWV A;  5M5X H;  3TRZ A;  4JV5 Q;  3PUX A;  3NEM A;  4DR7 L;  4X66 Q;  2IY5 B;  1RL2 A;  1NE3 A;  2VL6 A;  3CCR A;  1N34 Q;  2H5X A;  4A3M G;  4DV3 Q;  2Q2U A;  3GTQ H;  2BH2 A;  3W5O A;  2HIX A;  3S2H H;  1HNZ L;  1X6O A;  4BBS G;  1Y1W H;  1KQS A;  5M3F H;  1HNZ Q;  4L5T A;  4JI7 L;  4JYA L;  4DK3 C;  2UUC L;  2VS1 A;  1E7Z A;  3KF6 B;  1V43 A;  3ERS X;  4XTC S;  4NXM L;  4HJ7 A;  4LF6 L;  1GD7 A;  4JOI A;  4A3D G;  2OQK A;  4A3G G;  3EBE A;  1UE5 A;  3CC4 A;  4JG2 A;  1PH9 A;  3S1N H;  1HR0 Q;  2YYZ A;  2ZTE A;  4YHH L;  1KRT A;  1IBM Q;  3CW2 C;  1V9P A;  3PGZ A;  4K0K L;  3S17 H;  1KXL A;  1Q86 C;  4DV4 Q;  1IYJ B;  3CAM A;  2JEA I;  3TEH B;  1T9H A;  5FJ8 H;  2Q2H A;  2YTV A;  4C2M H;  2ZJR A;  1SRU A;  4JI0 Q;  2NVQ H;  3CC7 A;  1OXU A;  1HR0 W;  1L2F A;  3CP0 A;  4IJL A;  5JJI A;  4GOP C;  1I94 L;  2QEX A;  1VQN A;  2KCT A;  1Y1W G;  1I94 Q;  3RLO A;  5M3F G;  4B3M Q;  1JJC B;  3HOX H;  3PO3 H;  1A0I A;  3H3V I;  3HKS A;  3M4Q A;  2UXD Q;  2I5L X;  1FVI A;  2IX1 A;  1TWG H;  3GTG H;  4POF A;  2EXD A;  1VQ4 A;  4GNX B;  1R9T H;  1NTG A;  1MJE A;  3RR5 A;  5GQO A;  1PFS A;  4DV7 L;  4HJ5 A;  3S24 A;  1VQP A;  1K9M C;  2VY3 A;  4DV7 Q;  3GTO H;  1XMO L;  2XTI A;  3BU2 A;  1VQB A;  1Z47 A;  2K5N A;  1XPU A;  4Y7N H;  1YIT A;  1S3O A;  1JJ2 A;  2E2J H;  1PH2 A;  1LM0 A;  1PH7 A;  2OTJ A;  5E7N A;  1OXT A;  3NEN A;  5AJ3 L;  1X56 A;  2R7F A;  5FJ8 G;  5AJ3 Q;  4UY8 C;  2JA5 H;  3OW2 A;  2IHE A;  3I56 A;  4JBK A;  3ZJY C;  3PF4 A;  4DR4 L;  2K50 A;  2AKW B;  2I5M X;  1X55 A;  4X65 Q;  4HJ8 A;  1Q7Y C;  1ASZ A;  3G6E A;  3F2B A;  2RHS B;  4DNI A;  3KF8 B;  5IT9 c;  3K7A H;  1N32 Q;  2WAQ G;  4OON A;  4JI8 Q;  4LF5 Q;  2RF4 A;  3HKZ G;  1VQ9 A;  3CD6 A;  1I5F A;  2B63 H;  1L0W A;  2VNU D;  1LUZ A;  4C3J H;  3F2C A;  1IBK L;  3HOX G;  3PO3 G;  3A0J A;  4AIM A;  4C3H H;  2ASB A;  2QGQ A;  1EQQ A;  2YU9 H;  3M4O H;  2VW9 A;  4YWK A;  1TWF H;  4HIM A;  2VUM H;  4BXX H;  3I2Z A;  1X65 A;  2K75 A;  2JJQ A;  3S2D H;  1FGU A;  4HJ9 A;  4X6A H;  4X62 L;  5H1S E;  1WYD A;  3J80 i;  4A3J H;  4GOP A;  1L1O A;  4IOC A;  2MO0 A;  1VQI A;  1G29 1;  3RLN A;  4OWX B;  3CCJ A;  2AWN A;  3U50 C;  1VQK A;  1GO3 E;  4MNO A;  4R4O A;  3HOV H;  1N33 L;  5C4X H;  2R93 H;  2YTX A;  2OCE A;  2JA5 G;  3F8T A;  1B7Y B;  1N33 Q;  4LF4 Q;  2A19 A;  4JOI C;  1N36 L;  1HJP A;  3SGI A;  1VS0 A;  1CSQ A;  1WFQ A;  1AH9 A;  4RG1 A;  1P8L A;  4O2D A;  4GOP B;  2B63 G;  1UE7 A;  4JI4 L;  1CKM A;  4A4I A;  1GKH A;  1PH8 A;  4JI4 Q;  3KDF A;  3I4N H;  5HY6 A;  4YY3 Q;  1SLJ A;  2Z0S A;  5HGQ A;  4DUZ L;  4A3K H;  4DAM A;  1KL9 A;  3M85 A;  4DUZ Q;  3T1Y Q;  4LFA L;  4GLA C;  3G48 A;  2VUM G;  3CCS A;  4BXX G;  4DV2 L;  1W3S A;  5M5Y H;  1ASY A;  3I4M H;  1Q1E A;  3PO2 H;  3K8A A;  2PMZ E;  3KFU A;  4DR3 L;  3RN2 A;  1KHI A;  2JQO A;  3J80 c;  4A3J G;  1SE8 A;  4DUY Q;  1VQJ A;  4OO1 G;  1XPO A;  2WAQ E;  4JV5 L;  3VDY A;  2VZA A;  3AYH B;  1K83 H;  3HKZ E;  4JBJ A;  4GLV B;  4X66 L;  1PYS B;  1E22 A;  2Q2I A;  3HOV G;  5C4X G;  2R93 G;  1N34 L;  2JK8 A;  1PH3 A;  3AQQ A;  2ALY B;  5GAG C;  4DV3 L;  1AE2 A;  3JC6 6;  2KEN A;  3G71 A;  1K73 C;  1YHB A;  4DPG A;  5IWA Q;  2F4V Q;  4FDB A;  3W1B A;  1PH6 A;  3ICE A;  1E3P A;  2JA9 A;  3I4N G;  2JE6 I;  2HT1 A;  4OWT B;  4A3K G;  1WJJ A;  3E0E A;  4KHZ A;  2A8V A;  4OO1 I;  2K4K A;  1VQG A;  3ER0 A;  4IPD A;  4JI2 Q;  1B70 B;  3H15 A;  4DR5 L;  1N8R C;  3KOJ A;  2RHQ B;  4DR5 Q;  3J81 j;  4IJH A;  1YJ9 A;  3U4Z A;  3PO2 G;  1NMF A;  4A3I H;  1HR0 L;  2ES2 A;  1IBM L;  3KYH C;  4IFD G;  1KIX A;  5C3E H;  4PZ6 A;  2WB1 G;  4DV4 L;  3ULP A;  1FJG L;  3PUZ A;  1VQC A;  4KHP Q;  1FJG Q;  1D7Q A;  3KJO A;  4JI0 L;  4C3I H;  1S40 A;  1PA6 A;  3HOY H;  3GTK H;  4MZ9 A;  4LUZ A;  5IE8 A;  1B8A A;  1TWA H;  1XNQ L;  1I50 H;  2K5H A;  2K52 A;  1VQE A;  1XNQ Q;  2MQH A;  3CXC A;  3CCV A;  3RZO H;  4QY7 A;  3S16 H;  3MEF A;  4MTN A;  5IYC H;  1L1O C;  4B3M L;  1VQM A;  5BR8 Q;  5LMU Q;  4AYB G;  4L5R C;  2DGY A;  3DLL A;  4DR6 Q;  2UXD L;  2V1C C;  3PF5 A;  3I55 A;  3CC2 A;  1CSP A;  2Y0S E;  1GM5 A;  4IFD I;  4LFB Q;  1AE3 A;  2HQL A;  2NVX H;  4OX9 Q;  1HZA A;  1HNW L;  3GTP H;  4BY1 H;  3BZC A;  3L2P A;  1MIU A;  4A3I G;  1K8G A;  1HNW Q;  4JYA Q;  4GN4 B;  2ID0 A;  2UXC Q;  4PMW A;  5C3E G;  3TRE A;  1TWH H;  5C0X G;  1BKB A;  1HZB A;  2CQO A;  2WP8 J;  4BA1 I;  1PVO A;  1XTD A;  4BA2 I;  1I6H H;  3FKI H;  3HOY G;  4X65 L;  1QVC A;  3TS0 A;  1NJI C;  2R6G A;  4IPH A;  1JJG A;  1N32 L;  2AWO A;  1Q82 C;  1EUJ A;  4JI8 L;  1VQH A;  4LF5 L;  3S1R H;  3S15 H;  4A93 H;  1XNR Q;  5LMN W;  5IYC G;  1HH2 P;  3TS2 A;  1VQF A;  4A3B H;  5K36 G;  4WJ3 M;  2FXQ A;  1VQD A;  3D0F A;  5JEA G;  2C35 B;  1OXX K;  3E9I A;  2JA8 H;  4DV6 Q;  4P72 A;  3CCL A;  3M3Y H;  1VQA A;  5GRO A;  2LXJ A;  1QVG A;  4LW1 A;  1EIY B;  4TQU S;  1BVS A;  5C0X I;  3E9H A;  1TWC H;  2CFM A;  3I7F A;  3AFP A;  1SFO H;  1IBL Q;  2HIV A;  4J15 A;  2HHH L;  4P71 A;  1GVP A;  4BY1 G;  3RZD H;  2HHH Q;  4QL5 A;  4GN3 B;  3ULL A;  4GLX A;  2GN5 A;  1BBW A;  3HOU H;  3A74 A;  2JA7 H;  5C4J H;  3J7A 5;  1O7I A;  1VQ8 A;  3GD7 A;  1NY4 A;  4XIG S;  1YIJ A;  3J81 i;  1UEB A;  3OTO L;  3OTO Q;  4LF4 L;  4IOA A;  4Y52 H;  1JMC A;  2ZJP A;  3FKI G;  1YEZ A;  2AHO B;  4JCV E;  4OWW B;  4IPC A;  1PH1 A;  4JI1 Q;  2N78 A;  1CKN A;  4DV0 L;  3RLF A;  1PYB A;  1CUK A;  4LF8 Q;  4YCV A;  4DV0 Q;  2R92 H;  4A93 G;  4A3B G;  3Q8D A;  5GAE C;  1EYG A;  5IP9 H;  1L1O B;  3M9B A;  4R4I A;  3CF5 A;  4YY3 L;  1UE1 A;  3T1H L;  1OXV A;  5IP7 H;  4B3T L;  3T1H Q;  3T1Y L;  4B3T Q;  2N8N A;  2Z6K A;  3M4P A;  4JBW A;  3D31 A;  3WWV A;  2JA6 H;  2R7Z H;  3FP9 A;  2UUA Q;  4OXP A;  4JI3 L;  1VQ5 A;  2UXB Q;  1LYL A;  4B3S L;  2MFI A;  4AQY L;  1Q12 A;  1IXR A;  1EQR A;  5DLQ E;  2CKZ B;  4HID A;  4QJF A;  4B3S Q;  4AQY Q;  4JI3 Q;  2WFW A;  5M3M H;  4ALP A;  3K80 C;  4PG3 A;  4DUY L;  1WI5 A;  3JAM i;  4LF7 L;  2JA7 G;  4B3R Q;  4EQ5 A;  1M1K C;  2PNH A;  4ME3 A;  4DV5 Q;  4LF7 Q;  4IPG A;  4LF9 L;  3KDF B;  4L5S A;  3HFZ B;  4APV A;  1EWI A;  2IT1 A;  3UE0 A;  1E1T A;  1SMX A;  3J81 c;  4LF9 Q;  2D0P A;  2NZH A;  3EN2 A;  1Y14 B;  4PZ8 A;  4GKJ Q;  2ZTC A;  3PSI A;  2N3S A;  2DUD A;  2K5V A;  1V1Q A;  1QVF A;  3K0X A;  2OTL A;  1EOV A;  1YVC A;  1VQL A;  4A3C H;  1HZ9 A;  5ELO A;  4LNQ A;  2YTY A;  3H0G H;  1YBY A;  4HIO A;  2R92 G;  2BA1 A;  3EIV A;  1KD1 C;  1NMG A;  2VQF Q;  3LGJ A;  5IWA L;  1IZ6 A;  1S72 A;  2ZTD A;  1EIF A;  2GVB A;  3W1G A;  2UU9 Q;  2F4V L;  5IP9 G;  2IX0 A;  2I0Q A;  4R4T A;  2JEB I;  3MXN B;  1YHQ A;  4LFC Q;  3S1M H;  5IP7 G;  3PIP A;  4P73 A;  1X3E A;  4BBR H;  4A3F H;  3ULJ A;  4JI2 L;  3UDI A;  1Q46 A;  1E24 A;  1UE6 A;  2JA6 G;  2R7Z G;  4BY7 H;  2KHJ A;  4NXN Q;  1J6Q A;  4HJA A;  4R1J A;  3DM3 A;  1WCM H;  3KF6 A;  4UP7 A;  1J5E Q;  2ATW A;  2KBN A;  4NPS A;  3I4M G;  2NN6 G;  3BJU A;  5M3M G;  1IL2 A;  3UDF A;  4DR7 Q;  2OQ0 A;  1VQ6 A;  2PI2 A;  3AEV A;  5C44 H;  3JAM c;  3S1Q H;  4LUV A;  1XMQ L;  1XMQ Q;  3CPF A;  4UP9 A;  1X3G A;  4KHP L;  1VQ7 A;  1SN8 A;  3K81 C;  3PV0 A;  2A1A A;  2LXK A;  1G6P A;  4JI7 Q;  1KRS A;  3CQZ H;  4H02 A;  4L5Q A;  5FLM H;  3STB D;  2BH8 A;  3RNU A;  1QZH A;  2UUC Q;  4A3C G;  3GDE A;  3H0G G;  4UP8 A;  3CCU A;  3CCM A;  1U0L A;  3IRB A;  3S14 H;  4R4Q A;  2E2I H;  5BR8 L;  2D62 A;  5LMU L;  4DV1 L;  2B3G A;  1K0R A;  2CWP A;  3UDG A;  4LF6 Q;  4DV1 Q;  3L7Z C;  4NXM Q;  2NN6 I;  3A5U A;  3GTL H;  4DR6 L;  4DAY B;  3CCQ A;  2AMC B;  1QZG A;  1SR3 A;  4IO9 A;  5GAH C;  1JE5 A;  4LFB L;  4BBR G;  4A3F G;  4PZ7 A;  4YHH Q;  4JC0 A;  4QGU A;  4UPA A;  1XPR A;  4BY7 G;  4YCW A;  4OX9 L;  4K0K Q;  2CCZ A;  2KHI A;  1WCM G;  5IYB H;  4A3L H;  4A3E H;  3NEL A;  4QIW E;  4YWM A;  2UUB L;  1FL0 A;  4GNX A;  2UXC L;  4YCU A;  2UUB Q;  3NBH B;  5C44 G;  1H95 A;  1G51 A;  5J3B A;  2D0O A;  5LMN L;  1D8L A;  3OYY A;  1PHJ A;  4POG A;  5LMN Q;  4QQB X;  3UE1 A;  4DK6 C;  1HNX L;  2Z6K C;  5EAY A;  2GVA A;  2PQA A;  1C0A A;  3FHW A;  1Q81 C;  1HNX Q;  1N9W A;  5JJK A;  1W2B A;  3PUW A;  1YZ6 A;  1OXS C;  1C9O A;  2R7D A;  5IYD H;  1P16 A;  5FLM G;  5FLX c;  1KC8 C;  2CWA A;  2E8G A;  1QUQ A;  1XNR L;  3PCO B;  4AH6 A;  1CKO A;  2N49 A;  1A62 A;  3J7Z C;  5IY0 A;  1X9N A;  2OWO A;  3GTJ H;  3STB C;  1K8A C;  2NVT H;  3G4S A;  2E2H H;  2QA4 A;  4DV6 L;  1LTL A;  1XMO Q;  5GAD C;  2YV5 A;  1PV4 A;  4JBM A;  4IFD J;  1Y1V H;  2PQA B;  2XGT A;  2WB1 E;  5ELN A;  3KJP A;  1C7Y A;  3HOZ H;  3I4O A;  4EX5 A;  1IBL L;  3KLW A;  4P74 A;  5IYB G;  4A3L G;  4A3E G;  1KAW A;  1Z9F A;  1QUQ B;  2NZO A;  4A76 A;  2EIF A;  3GO5 A;  4DKA C;  4GS3 A;  4DR4 Q;  5M5W H;  3CPW A;  1WOC A;  4JI5 L;  1I3Q H;  2PI2 E;  1YJN A;  3PUV A;  4JI5 Q;  2K14 A;  4R4C A;  1X3F A;  4AYB E;  2F52 A;  3TQY A;  1XJV A;  3F2D A;  1VQO A;  1DGS A;  1JB7 A;  1NBW A;  4JI6 L;  3L0O A;  4JI1 L;  5IYD G;  1IBK Q;  4JI6 Q;  2L15 A;  2MO1 A;  4LF8 L;  5JJL A;  3HOW H;  3PIO A;  1JT8 A;  3A5Z B;  3PUY A;  4TVA B;  2BA0 A;  1K3R A;  4NB3 A;  1MKH A;  2LSS A;  4P75 A;  4KI0 A;  3F1Z A;  4DR1 L;  4X62 Q;  2JA8 G;  4DR1 Q;  4LUO A;  1Y1V G;  3HOZ G;  1Q8K A;  1Q1B A;  2UUA L;  1E1O A;  1TXY A;  1MJC A;  5C0X J;  2UXB L;  1EFW A;  3GTM H;  1BBU A;  2MNA A;  1HZC A;  3UDX A;  1CKN B;  2Q2T A;  4B3R L;  1YJW A;  2NVY H;  1PH4 A;  3HOU G;  3CMA A;  4DV5 L;  4A3M H;  3CCE A;  3AFQ A;  1N36 Q;  4YWL A;  1A63 A;  2F3I A;  2EQS A;  4KLK A;  2ZJQ A;  4O0A A;  1SRO A;  2I5H A;  4BBS H;  4GKJ L;  1X54 A;  4GKK L;  1PH5 A;  2ZM6 L;  5JEA J;  4X64 L;  1A8V A;  4GKK Q;  2RCN A;  1YNX A;  3U4V A;  2ZM6 Q;  4X64 Q;  4DR2 L;  3BZK A;  4DR2 Q;  3K7U C;  3M7N A;  4HIK A;  2E5L L;  1U5K A;  1YHA A;  2KCM A;  2VQF L;  2E5L Q;  2UU9 L;  4GNX C;  3HOW G;  2IHF A;  4LWC A;  4LFA Q;  4GN5 A;  3CME A;  4A3D H;  1VCI A;  4DV2 Q;  4A3G H;  1M90 C;  4LFC L;  2B29 A;  3RN5 A;  3H3V H;  2VQE L;  4DR3 Q;  3U58 A;  1YI2 A;  1RIP A;  3B6Y A;  4WJ4 A;  2VQE Q; 
#chains in the Genus database with same CATH topology
 4H44 C;  5TSS A;  4A75 A;  1OTC A;  2JA6 B;  1UWV A;  3NSW A;  4KKT A;  4DAV A;  1CK1 A;  3SE0 A;  1Z6H A;  4DR7 L;  2F1M A;  1RL2 A;  4DAP A;  1NE3 A;  4RCO A;  1N34 Q;  5ELD A;  4ZUI A;  1STB A;  4I65 A;  3GTQ H;  2F0E A;  1HNZ L;  4O1N A;  1KDA A;  5EPL A;  4JYA L;  3E3X A;  1EZ6 A;  2P5Z X;  2LMC B;  1PTO H;  2XRS D;  1LTB D;  1SYC A;  4F88 A;  4HJ7 A;  4JOI A;  2Q8I B;  4A3D B;  3D4R A;  2F0K A;  4IUR A;  4JG2 A;  1JOO A;  3S1M B;  1ET6 A;  4M8A A;  1HFN A;  2K5D A;  2ZTE A;  1KRT A;  4TKO B;  3PGZ A;  1V9P A;  3R2T A;  1Q86 C;  3OWF A;  2JEA I;  1T9H A;  5FJ8 H;  3A55 A;  3VA5 A;  2PZW A;  1TS4 A;  5JJI A;  4GOP C;  1I94 L;  3U9O A;  3S2H B;  1VQN A;  1VMP A;  2KCT A;  2O5I C;  4B3M Q;  3VR5 A;  5IIF A;  3DEO A;  1VQ4 A;  1R9T H;  2VY3 A;  3BU2 A;  1VQB A;  1CTM A;  3SEB A;  4DXG A;  4G7O C;  1PH2 A;  3NEN A;  2ZT9 C;  3A54 A;  1WTX A;  5AJ3 Q;  2FMC A;  2IHE A;  3RMH A;  2NVQ B;  2I5M X;  1X55 A;  2DNE A;  4X65 Q;  1RTN A;  1Q7Y C;  3G6E A;  2K6A A;  1SBB B;  3K7A H;  1N32 Q;  1VMC A;  5C4H A;  4JI8 Q;  2RF4 A;  5CBE E;  1PMR A;  2K5Q A;  4C3J H;  3F2C A;  1TT2 A;  4IUV A;  1IBK L;  1FNU A;  2F0M A;  3M4O H;  4YWK A;  1TWF H;  1NUC A;  2Z9H A;  2XVS A;  4WJW A;  3GTJ B;  4X62 L;  4A3J H;  1GUW A;  1VQI A;  4ZYS A;  1VQK A;  4R4O A;  5CV7 A;  1U4P A;  4K8J A;  1HHV A;  2OCE A;  1EYC A;  1B7Y B;  4JOI C;  4OL7 A;  3SGI A;  4FXG C;  5M5W B;  1I3Q B;  1AH9 A;  1ONL A;  3MXG A;  1JQY D;  1UE7 A;  1CKM A;  1AEX A;  3TP6 A;  1JB3 A;  1PH8 A;  1GKH A;  2M2L A;  3I4N H;  2EDG A;  5HGQ A;  1EY9 A;  1KDC A;  4V0B A;  4Z9C B;  1TY2 A;  2V4D A;  4DV2 L;  3HOW B;  1W3S A;  3I4M H;  2PMZ E;  1Y8N B;  1F9Q A;  4DFA A;  5F2D A;  3VYU A;  4OO1 G;  4L8J A;  4PMC A;  5ELB A;  1XPO A;  1S5B D;  2WAQ E;  3VDY A;  4PMB A;  3AYH B;  4JBJ A;  4GLV B;  3HOV B;  2R93 G;  2JYO A;  2JK8 A;  1DOM A;  1EYA A;  2EYP A;  1XXG A;  3JC6 6;  4A3M B;  3NQT A;  4CBV A;  1D5M C;  2ZXR A;  2B2V A;  2I46 A;  3ICE A;  1B50 A;  1PZI D;  2VB2 X;  4CKE A;  4A3K G;  4KHZ A;  1K28 A;  2K4K A;  1VQG A;  3ER0 A;  3H15 A;  2B2Y A;  4DR5 Q;  3J81 j;  4A3G B;  4Q0F A;  1B1Z A;  4HCS A;  5ELC A;  3KYH C;  5C3E H;  2RBM A;  2WB1 G;  4IUQ A;  5C0X H;  2K5W A;  1B3A A;  3QJY A;  3TN2 A;  1STA A;  3PUZ A;  4KHP Q;  4KY5 A;  4P2C B;  4C3I H;  1PA6 A;  1QCB D;  2K03 A;  3GTK H;  5IE8 A;  1B8A A;  2FFK B;  3F2U A;  3OHX C;  5CV9 A;  1LV9 A;  4KTA A;  2KHS A;  1X3Q A;  5IGF A;  3NBH A;  2A74 C;  5I4D A;  1Y1W B;  4KN7 C;  2G5D A;  5JJZ A;  5JEA H;  2MPM A;  5LMU Q;  4L5R C;  1STN A;  2V1C C;  5FK9 C;  2Y0S E;  1GM5 A;  1PLF A;  3MFG A;  1AE3 A;  4RKB A;  1HTL D;  2QF7 A;  2R3Z A;  4BY1 H;  1VDZ A;  3L2P A;  3S1N B;  4GN4 B;  2A73 B;  2ID0 A;  2X6L A;  3TRE A;  2CQO A;  4CJ1 B;  4FF4 A;  2EYM A;  3S17 B;  4BA1 I;  2JN4 A;  3LWU A;  4C2M B;  1SNM A;  1AZP A;  3IAY A;  1QVC A;  3LNN A;  3TS0 A;  1JJG A;  1QWY A;  4QUC A;  2MGS A;  4J8Q A;  4HSV A;  1Q82 C;  4LF5 L;  3S15 H;  3RZO B;  2PW7 A;  5K36 G;  4WJ3 M;  1BCP D;  2F03 A;  2C35 B;  3PO3 B;  1STE A;  3CCL A;  3M3Y H;  3QG1 A;  3TP7 A;  4C1N K;  1EY5 A;  1G8Z D;  3E9H A;  1EWH A;  1IBL Q;  2HIV A;  2HHH L;  3GTP B;  1TVX A;  4K14 A;  4QL5 A;  2OF1 A;  2AQ2 B;  2F3W A;  2B2V C;  2GN5 A;  2WKC A;  5C4J H;  2L55 A;  3ND9 A;  1NCV A;  5IGE A;  1G2T A;  3J81 i;  2JP1 A;  2L12 A;  3OTO L;  2OEO A;  1J8I A;  2JA5 B;  2B2Y C;  3FKI G;  2AHO B;  5M9O A;  4OWW B;  1GUS A;  3ND8 A;  2N78 A;  2WV6 D;  1CUK A;  3Q8D A;  5GAE C;  2B63 B;  4U68 A;  3M9B A;  3SHL A;  1EOT A;  4B3T L;  4MN3 A;  5FLX E;  2N8N A;  2Z6K A;  2YU9 B;  3D31 A;  3WWV A;  3FP9 A;  1EY8 A;  4OXP A;  2UXB Q;  1BCP C;  2KOL A;  4AQY L;  1Q12 A;  1U4R A;  4JI3 Q;  4ALP A;  5M3M H;  3S2D B;  3RZD B;  5E3F A;  5D14 A;  2JA7 B;  3FVQ A;  1HFG A;  1M1K C;  4QCL A;  4HR7 B;  3KDF B;  4L5S A;  1EWI A;  4LF9 Q;  2D0P A;  3EN2 A;  1Y14 B;  1EY0 A;  5C4X B;  2KED A;  4QIW B;  4KJO A;  2F3V A;  1EOV A;  1YVC A;  3J7A F;  4G7Z C;  2J4X A;  3H0G H;  2ZXO A;  3P7J A;  4HIO A;  2R92 G;  1KD1 C;  4JBM A;  2UU9 Q;  3TZU A;  5IWA L;  3CU7 A;  2ZTD A;  1EIF A;  2BDO A;  2HDL A;  5IP9 G;  2H1E A;  2IX0 A;  2I0Q A;  4LFC Q;  1YHQ A;  3MXN B;  3PIP A;  4JI2 L;  3ULJ A;  1BQQ T;  4BY7 H;  2JA6 G;  2R7Z B;  4HJA A;  4R1J A;  2NYZ D;  3MC0 B;  2ATW A;  3I4M G;  2NN6 G;  1S5C D;  1VF5 C;  4IZ8 A;  2K01 A;  1H9S A;  3K5O A;  5IOC A;  2F0T A;  1S5D D;  3HEJ A;  1MHW C;  3PV0 A;  2A1A A;  2LXK A;  2EJF C;  5G3L D;  4L5Q A;  4JVZ A;  3RNU A;  4A3C G;  3GDE A;  4JW0 A;  2K33 A;  3IRB A;  4R4Q A;  5EJW A;  4DV1 L;  1K0R A;  3UDG A;  3GTL H;  1KNA A;  4DR6 L;  3OMG A;  2EVB A;  1SE3 A;  1H9J A;  4DNR B;  4BBR G;  4YHH Q;  4QGU A;  3R8B A;  4K0K Q;  1O80 A;  2CCZ A;  1SSO A;  1ZEQ X;  1DM0 B;  4RWS C;  1FGB D;  1ET9 A;  1LO5 D;  2N88 A;  4WOR A;  2Q8R E;  5J3B A;  3T56 B;  4DK6 C;  2HDM A;  2Z6K C;  5EAY A;  2PQA A;  4FXD A;  3FHW A;  3VYT A;  1BOS A;  1QNU A;  1YZ6 A;  1ENA A;  3I73 A;  1OXS C;  1C9O A;  3HOY B;  5FLX c;  3CQZ B;  1KC8 C;  3MHB A;  2B2U A;  1I50 B;  1ZXT A;  3EJI A;  2OWO A;  3NXW A;  2KCN A;  3G4S A;  4DV6 L;  2LS0 1;  1LTL A;  2YV5 A;  4IFD J;  1Y1V H;  2NUC A;  4XYO A;  2C5C A;  5ELN A;  1HRJ A;  3J80 L;  3SDZ A;  1RTO A;  3VR2 A;  2VB3 X;  1DOK A;  3PMF A;  2DJG C;  1GUN A;  2DY7 A;  4A3E B;  1QUQ B;  2EIF A;  4DKA C;  1IL8 A;  1ILQ A;  3BVZ A;  1YJN A;  5A2Q L;  1EZ8 A;  4R4C A;  2M00 A;  4AYB E;  2F52 A;  3F2D A;  1JB7 A;  1I6H B;  1A3T A;  5IYD G;  1STH A;  1LTI D;  2L15 A;  5JJL A;  1LT4 D;  3S1R B;  3BDL A;  1Z7T A;  3BYT B;  2NTT A;  2LSS A;  2FMM A;  4E6I A;  2NVT B;  3F1Z A;  1MSG A;  4DR1 Q;  2JA8 B;  3HOZ G;  1TS2 A;  5JPN C;  1TXY A;  4KV6 A;  5COR A;  2X69 A;  1EFW A;  1HZC A;  1CKN B;  3NTK A;  1PH4 A;  4DV5 L;  1N36 Q;  2KA7 A;  4FVM A;  3NTH A;  4ABN A;  1BR9 A;  2I5H A;  4GKJ L;  3WOE A;  1X54 A;  4GKK L;  3VR3 A;  1U9R A;  5C3W A;  3BZK A;  1WTV A;  4HIK A;  2SEB D;  4V19 0;  1YHA A;  1EY4 A;  2KCM A;  3HOW G;  4GN5 A;  1MD2 D;  2K1B A;  5E4W C;  4DR3 Q;  2L9H A;  1RIP A;  1LT6 D;  3MA2 B;  3Q6S A;  1TS5 A;  5M5X H;  4NP5 A;  1KDB A;  2B2U C;  1AW7 A;  2PNR C;  3NEM A;  4X66 Q;  2IY5 B;  3T51 B;  4R8I A;  5JPM C;  1PDQ A;  4A3M G;  2WII B;  4DV3 Q;  4HED A;  3W5O A;  2HIX A;  2RDF A;  1JIC A;  1PXU A;  4ID6 A;  3R3O A;  3T13 A;  4DK3 C;  2CH4 A;  4XDX A;  3KF6 B;  4RGM A;  3ERS X;  4XTC S;  2E2D C;  4NXM L;  2JXM B;  4A3G G;  2TSS A;  1WTR A;  5LL6 S;  1PH9 A;  1UAP A;  3LX0 A;  2YYZ A;  1IBM Q;  4KMU C;  4KD4 A;  3K6O A;  1WCM B;  3CAM A;  3TEH B;  2KUM A;  2Q2H A;  2YTV A;  3DXJ C;  2ZJR A;  5J39 A;  2KJX A;  4JI0 Q;  4N8F A;  1HR0 W;  3CKI B;  1Y1W G;  3TME A;  1JJC B;  4X3U A;  3H3V I;  3HKS A;  4RH6 A;  2I5L X;  1FVI A;  1TWG H;  1PTO B;  2EXD A;  4GNX B;  5KRU A;  3S14 B;  3RR5 A;  1D1K A;  1PFS A;  5GQO A;  1SXT A;  3K5L A;  1K9M C;  2D5D A;  4DV7 Q;  1CQV A;  2XTI A;  5EKK A;  4DXF A;  4CHT B;  3T16 A;  1XPU A;  4Y7N H;  1YIT A;  1EIG A;  1WVL A;  1HA5 A;  3MXP A;  1KTK A;  3D4W A;  4FF3 A;  1OXT A;  1CZG A;  5AJ3 L;  2OTJ A;  2R7F A;  4G4K A;  4UY8 C;  2N55 A;  4H0L C;  2PMZ B;  4JBK A;  3ZJY C;  1ASZ A;  1SYF A;  3VR6 A;  4DNI A;  1GOZ A;  1I4R A;  4MHE A;  2WAQ B;  4OON A;  3HKZ G;  1I5F A;  1CA6 A;  1LUZ A;  4EGV A;  4C1N I;  3PO3 G;  3A0J A;  2ASB A;  4OEL B;  1SE4 A;  1G91 A;  2VW9 A;  1SNC A;  5CV6 A;  1DZ1 A;  3NP8 A;  1X65 A;  2K75 A;  1FD7 D;  1FGU A;  2E2H B;  4GOP A;  4OO1 H;  1L1O A;  2L5T A;  3OOC A;  3VYS A;  3JAM L;  3OPO A;  3Q0A A;  3CCJ A;  3U50 C;  3FPP A;  1GO3 E;  1EFI D;  2KQ3 A;  3J7A V;  1EQT A;  5CBA E;  2R93 H;  2YTX A;  5C4Z A;  2JA5 G;  3F8T A;  1N33 Q;  4LF4 Q;  1GUT A;  1HJP A;  4HCE A;  1VS0 A;  1CSQ A;  1R4Q B;  3QB3 A;  1EY6 A;  3K7A B;  1JR0 D;  1PTO F;  5EQ0 A;  4L6T B;  4O2D A;  4LK1 C;  2B63 G;  2M9V A;  2XIW A;  4C3J B;  1I4P A;  4C3H G;  1SLJ A;  2K05 A;  3I70 A;  4X3T A;  4A3K H;  3M4O B;  3M85 A;  4DUZ Q;  4LFA L;  4EQP A;  3G48 A;  4BXX G;  2E76 C;  2OXP A;  4K8I A;  3Q24 A;  1BBX C;  1HCZ A;  3RN2 A;  3NWT A;  1KHI A;  2JQO A;  4A3J B;  4DUY Q;  4IUU A;  1RJT A;  4JV5 L;  3A8I E;  2Y0S B;  2XNA C;  4IUP A;  2QW7 A;  1D5X C;  2Q2I A;  5C4X G;  1PZJ D;  1TY0 A;  1PH3 A;  4XYQ A;  2ALY B;  4LJZ C;  2ICI A;  2ZXP A;  2KEN A;  4K2K A;  5IOD A;  3QO2 A;  3QWN A;  1BO0 A;  2F0S A;  1YHB A;  4PQX A;  1A2T A;  2F4V Q;  3W1B A;  1I4G A;  1PRT D;  1PH6 A;  1E3P A;  2JA9 A;  1M4V A;  4OGQ C;  2HT1 A;  2F0Q A;  3E0E A;  3W2D A;  3ITP A;  1Y8P B;  4IN3 A;  4IPD A;  1N8R C;  1B70 B;  2RKS A;  4DR5 L;  1C4Q A;  2F0O A;  1D6E C;  4IJH A;  2L4N A;  1YJ9 A;  3PO2 G;  2PZT A;  3FDT A;  1HR0 L;  2MJ8 A;  3LWE A;  4PZ6 A;  4Q5V A;  4DV4 L;  5BN3 A;  3A8J E;  3VR4 A;  3DM1 A;  3KBX A;  1D7Q A;  3KJO A;  1S40 A;  2B8F A;  1TWA H;  2K5H A;  1VF7 A;  1XNQ Q;  2MQH A;  3CXC A;  3S16 H;  4QY7 A;  4TRD A;  3J81 E;  1L1O C;  5K36 H;  1VQM A;  3I4L A;  5M3F B;  2UXD L;  3PF5 A;  1IKL A;  3CC2 A;  1QNK A;  2F0U A;  3EVQ A;  4IFD I;  4NW2 A;  1PRT C;  2HQL A;  2NVX H;  1NNX A;  3BVG A;  1G6Z A;  1KLG D;  5BN5 A;  1BF4 A;  4WRD A;  1V1P A;  2TMP A;  2WP8 J;  1PVO A;  1XTD A;  4BA2 I;  2B2W A;  2NZ1 D;  3DEP A;  3FKI H;  3HOY G;  2DNC A;  2EY1 A;  3QOL A;  4MTK A;  4F87 A;  4K5W A;  3BDC A;  1LTS D;  1VQF A;  5DM6 3;  2K7V A;  3D0F A;  1M8A A;  3I8Z A;  3HOX B;  1OXX K;  3E9I A;  1L0Y B;  1VQA A;  5GRO A;  2LXJ A;  1EIY B;  4TQU S;  2IW3 A;  2RVL A;  1TWC H;  2CFM A;  1LAB A;  1SFO H;  4L63 B;  1XWE A;  2HD3 A;  1GVP A;  3GTO B;  4GLX A;  4H7B A;  5CC4 A;  1NY4 A;  3PQI A;  3SK5 A;  4RHS A;  5CV5 A;  5T1I A;  4IOA A;  4JCV E;  3GQB A;  1O78 A;  1PH1 A;  1B53 A;  1PYB A;  1EY7 A;  2R92 H;  2CVR A;  2Z4H A;  4A3B G;  5IP9 H;  4I7A A;  2DN8 A;  4R4I A;  1BCP F;  1ZKO A;  2B2T A;  4YY3 L;  1UE1 A;  3T1Y L;  2MUY A;  2JA6 H;  2VUM B;  4JI3 L;  5IGB A;  1H9R A;  1IXR A;  1W6K A;  2NN6 H;  2R61 A;  4KKU A;  3K80 C;  4CKB A;  5JVG 3;  1WI5 A;  3I72 A;  3T53 B;  4B3R Q;  2A68 D;  2FJ2 A;  2NBF A;  4LF7 Q;  4LF9 L;  3J81 c;  2NZH A;  3PSI A;  2K5V A;  3K0X A;  2OTL A;  4A3C H;  2RSN A;  2BA1 A;  4HMJ A;  3LGJ A;  1IZ6 A;  1O7L A;  3E6Z X;  1IKM A;  4FYD A;  4R4T A;  2JEB I;  3S1M H;  1X3E A;  2B2W C;  4BBR H;  3UDI A;  1Q46 A;  1E24 A;  1DON A;  4UP7 A;  5M5Y B;  4NPS A;  2EJG C;  3UDF A;  4DR7 Q;  3AEV A;  2PI2 A;  3AU7 A;  1R4P B;  2F0L A;  4K5V A;  1SJE D;  4LUV A;  4DA2 A;  5KNB A;  1XMQ Q;  1K83 B;  2L0C A;  2A68 C;  3U9S A;  5L37 A;  4JYA Q;  4H02 A;  3H0G B;  3CCM A;  1U0L A;  1LT3 D;  2E2I H;  5BR8 L;  2D62 A;  1H9S B;  2B3G A;  1JC7 A;  1B2T A;  4AYB B;  1ESF A;  3ONA B;  4DAY B;  1SR3 A;  3N6R A;  5ISR A;  4LFB L;  1DXM A;  4BY7 B;  4YCW A;  4TSS A;  4OX9 L;  3KBG A;  1WCM G;  2PYK A;  2MP1 A;  1T5E A;  3NEL A;  3HG9 A;  4YWM A;  1FL0 A;  4A3I B;  3I3C A;  2UXC L;  1H95 A;  4DK0 A;  2B2T C;  3DHQ A;  3OYY A;  4RKL A;  2B39 A;  5JJK A;  3NUC A;  1HNX Q;  4IAL A;  4ZUJ A;  5G3L F;  2R7D A;  2I07 B;  5IYD H;  1QIL A;  5FLM G;  5KIX A;  2CWA A;  1J9O A;  1XNR L;  3IFT A;  3TBI B;  3W3A A;  3J7Z C;  5IY0 A;  3Q23 A;  3GTL B;  4XQN A;  3GTJ H;  2QA4 A;  1CFM A;  5EGT A;  2OT2 A;  3TSS A;  2PQA B;  3HOZ H;  1X3P A;  3EA6 A;  4EX5 A;  4CJ2 C;  5IYB G;  4KY6 A;  4A76 A;  3GO5 A;  5EKL A;  4ZCK A;  2BOS A;  5M5W H;  3CPW A;  1NR4 A;  1I3Q H;  2PI2 E;  2QKI C;  4KKS A;  1A2U A;  3SXH A;  4JI5 Q;  3A8K E;  1U4L A;  3TQY A;  1XJV A;  3EFX D;  3V05 A;  2BDN A;  3D6W A;  3AMU A;  4JI1 L;  2AQ1 B;  3O13 A;  1IBK Q;  3D8G A;  1EQV A;  2MO1 A;  4NDX A;  4LF8 L;  2D2C C;  5KEE A;  5KYL A;  3HOW H;  4A93 B;  2L1B A;  4NB3 A;  4KI0 A;  3H3V C;  1SJH D;  4DR1 L;  5J1Z A;  1Q90 A;  4X62 Q;  1SYB A;  4LUO A;  1Y1V B;  2UUA L;  5C0X J;  1QJO A;  1BBU A;  2MNA A;  2QCP X;  1YJW A;  4A3M H;  3HOU B;  3CCE A;  3AFQ A;  1A63 A;  2F3I A;  2EQS A;  4KLK A;  4ZQ3 A;  2KEC A;  3A56 A;  5JAV A;  4OEM B;  5JEA J;  1A8V A;  1TU2 B;  3U4V A;  1YNX A;  4X64 Q;  1ICF B;  5C5L A;  2VQF L;  1DYQ A;  5IT9 E;  5C3X A;  4LWC A;  3CME A;  4DV2 Q;  4A3G H;  2FHT A;  3U58 A;  1YI2 A;  3M7G A;  3B6Y A;  2VQE Q;  3PIO 3;  4NXN L;  1J5E L;  2Y0S G;  3L3O C;  2G9D A;  3K5N A;  3TRZ A;  4DGZ A;  3NE5 B;  3R2I A;  3TZD A;  1YNJ D;  1I6V C;  4BS9 A;  2Q2U A;  3UI2 A;  1CHQ D;  1LAC A;  1X6O A;  1Y1W H;  1KQS A;  4X3K A;  2Z6B A;  4JI7 L;  1KAB A;  2UUC L;  2KCC A;  2VS1 A;  2RDG A;  4KD3 A;  4LF6 L;  4A3D G;  3CHB D;  3CC4 A;  3C1E A;  5KNC A;  3S1N H;  1T5X D;  3P20 A;  4A3F B;  3S17 H;  4CJ0 B;  2RCF A;  4C2M H;  3BVM A;  1JWU D;  1SRU A;  2A69 D;  3CC7 A;  4XT1 B;  5C44 B;  1BNZ A;  3SK6 A;  5KGU A;  3KLS X;  1L2F A;  1YNJ C;  1CZW A;  2QEX A;  3S9W A;  4IUT A;  3RLO A;  5M3F G;  1B44 D;  3PO3 H;  1A0I A;  2X6G A;  4QUF A;  1CA5 A;  3M4Q A;  2F0N A;  1RDP D;  3GTG H;  4DV7 L;  3S24 A;  4XQQ A;  1XMO L;  1Z47 A;  2KEE A;  4IQZ A;  3C46 A;  3T4A C;  2E2J H;  1PH7 A;  5E7N A;  4R9W A;  1X56 A;  4FNF A;  5COY A;  2JA5 H;  4DR4 L;  2K50 A;  4J6H A;  4ZKB B;  4HJ8 A;  1BXT A;  1IHZ A;  2RHS B;  5IT9 c;  3KF8 B;  3SK4 A;  1HTP A;  4LF5 Q;  3CD6 A;  1VQ9 A;  1PZK D;  2B63 H;  2A69 C;  2VNU D;  4DF7 A;  3HOX G;  4C3H H;  2YU9 H;  3H6M A;  4ME5 A;  4HIM A;  4BXX H;  2IX3 A;  2A6H D;  5IGD A;  3S2D H;  4HJ9 A;  2AUJ D;  5H1S E;  3C1F A;  3J80 i;  4OHJ A;  1LTR D;  2Z4I A;  2MHV A;  2MO0 A;  1EEF D;  1G29 1;  3RLN A;  4MNO A;  4QB4 A;  5FO8 B;  1N33 L;  5C4X H;  5EPK A;  2A19 A;  4X3S A;  1K3B C;  1ICW A;  1WFQ A;  5CV4 A;  2EYO A;  1P8L A;  4GOP B;  4JI4 Q;  3KDF A;  4RA8 A;  1STG A;  5I9O A;  1HQR D;  3HP3 A;  4DUZ L;  2LFN A;  4DAM A;  2QIL A;  4GLA C;  2VUM G;  1CHP D;  3CCS A;  1ASY A;  1Q1E A;  4K6L A;  3K8A A;  4OIJ A;  3PO2 H;  3KFU A;  3KK7 A;  1SE8 A;  3SR1 A;  1VQJ A;  2A6H C;  3MXN A;  3HKZ E;  2K04 A;  4R8N A;  3GTM B;  1MGS A;  1E22 A;  1LT5 D;  3HOV G;  2R93 B;  1N34 L;  3AQQ A;  2NVY B;  5GAG C;  2HUG A;  5FLX L;  1FR3 A;  4DPG A;  1SNQ A;  4BBS B;  5IWA Q;  1CQF A;  1H9M A;  3P1H A;  4RCN A;  1ESR A;  3V96 A;  1Q3L A;  1W6J A;  2XN9 C;  4OWT B;  2A8V A;  1WJJ A;  2F0H A;  2Q8T A;  5EBD A;  5DM7 3;  2Z8L A;  2F0W A;  4JI2 Q;  3KOJ A;  2RHQ B;  1IW7 D;  3U4Z A;  3BYY B;  4ZAI A;  1C8C A;  4IFD G;  4ZK9 B;  2EY2 A;  1NSN S;  1FNW A;  2SOB A;  1WTQ A;  1FJG Q;  3FMC A;  3HOY H;  4MZ9 A;  1XNQ L;  1I50 H;  3GTQ B;  1QE6 A;  4XT3 B;  3NTI A;  1II3 A;  4B3M L;  4AYB G;  2DGY A;  4XXE A;  4DR6 Q;  3I55 A;  2AUK A;  1EIH A;  1CSP A;  1TR5 A;  5DNF A;  1ILP A;  3V2T A;  1HZA A;  1UUP A;  1HNW Q;  4A3I G;  2BCO A;  5DAU A;  4PMW A;  4NMZ A;  1TWH H;  1IW7 C;  4LMQ D;  5IGC A;  2O4X A;  3D4D A;  3OIP A;  1I6H H;  2HCI A;  4X65 L;  2RDH A;  4F8M A;  4IPH A;  1EU4 A;  4MIU A;  3TDQ A;  1TWA B;  1N32 L;  4ZLT F;  3DWP A;  1GJX A;  4JI8 L;  3S1R H;  2F0P A;  1HH2 P;  5IYC G;  4A3B H;  2FXQ A;  2IJ0 A;  1WD1 A;  4N9T A;  1TKW B;  1DCZ A;  2JA8 H;  4DV6 Q;  4P72 A;  1RKN A;  2XWJ B;  4LW1 A;  2EYH A;  1BVS A;  5C0X I;  1R9T B;  5D65 A;  2NVX B;  5JVH 3;  4HMI A;  4RGN A;  4F7X A;  3A7A B;  1BBW A;  1EU3 A;  3A74 A;  1O7I A;  1VQ8 A;  3KLR A;  3GD7 A;  4XIG S;  1YIJ A;  3MFY A;  1UEB A;  1GXD C;  5J22 A;  4S3S A;  4EQO A;  2ZJP A;  4IPC A;  1CKN A;  5LHY 1;  3A7L A;  4YCV A;  4DV0 Q;  4A93 G;  5FOB B;  2NTS A;  1BUV T;  1E2W A;  1OXV A;  3T1H Q;  5BN4 A;  3M4P A;  4JBW A;  1KNE A;  4ILW A;  4CDC C;  1TWF B;  2CW0 D;  1VQ5 A;  2EY6 A;  3I91 A;  2MFI A;  5DLQ E;  4LAA A;  1TWC B;  4HID A;  4B3S Q;  2WFW A;  2WKD A;  4O42 A;  4PG3 A;  1HPC A;  5E4X A;  3JAM i;  1WTO A;  1HUM A;  4LF7 L;  2JA7 G;  2PNH A;  4DV5 Q;  2DY8 A;  4APV A;  2IT1 A;  3UE0 A;  1E1T A;  1SMX A;  1AP0 A;  3TP5 A;  4GKJ Q;  1LTA D;  1RHP A;  1V1Q A;  2AQ3 B;  4NKL A;  1VQL A;  1HZ9 A;  2YTY A;  1JOR A;  2GVB A;  3X3N A;  4CDE C;  3I4N B;  2CH4 W;  2F0I A;  5IP7 G;  3MXU A;  4QMG A;  1HUN A;  4ZRZ A;  5IGG A;  1EEI D;  1UE6 A;  3FPU B;  2R7Z G;  1WCM H;  3KF6 A;  3P75 A;  5CGK A;  3I4M B;  3G7L A;  2RQX A;  3BJU A;  1IL2 A;  1ZYR D;  3BZD B;  2OQ0 A;  2CW0 C;  3BG3 A;  3S1Q H;  3K5M A;  1XMQ L;  1CT1 D;  4UAI A;  3CPF A;  4UP9 A;  1X3G A;  4KHP L;  3K81 C;  3H94 A;  4HTH A;  3MVV A;  3G6J B;  1G6P A;  1KRS A;  5FLM H;  3L9A X;  3CCU A;  3S14 H;  4RGO S;  2EPB A;  5LMU L;  4NXM Q;  4G57 A;  3A5U A;  3CCQ A;  1B9N A;  1QZG A;  4IO9 A;  5GAH C;  3URY A;  4A3F G;  4BBR B;  2E75 C;  4UPA A;  1PFB A;  2KHI A;  5IYB H;  1BCP B;  5ELF A;  1RF2 D;  2O2L D;  1I4X A;  2JSO A;  4GNX A;  4YCU A;  2UUB Q;  3NBH B;  5FKA C;  5C44 G;  3E5S A;  2J7Z A;  1PHJ A;  2D0O A;  4J1M A;  1D8L A;  5C3E B;  5LMN Q;  1SEB D;  1ZYR C;  1HNX L;  2GVA A;  1C0A A;  1N9W A;  3PUW A;  1X32 A;  4C3I B;  1SAP A;  3FRP B;  5CV8 A;  1C48 A;  3GTK B;  3GV3 A;  3PCO B;  4AH6 A;  1HQM C;  2E2I B;  1CKO A;  2N49 A;  1A62 A;  1X9N A;  1WTP A;  1SYG A;  2E2H H;  1PV4 A;  5GAD C;  2XGT A;  1C7Y A;  2WB1 E;  5C6A A;  2CHB D;  4B08 A;  2F4I A;  4ODG A;  1IBL L;  4A3L G;  4A3E G;  2QDL A;  1KAW A;  2NZO A;  4BY1 B;  4GS3 A;  1FNV A;  1KAA A;  3I90 A;  1TQO A;  4JI5 L;  4KHV A;  3OW7 A;  2K14 A;  1PTO D;  1X3F A;  2Z1C A;  2F0V A;  4JI6 Q;  1EWC A;  2O5J C;  5C5M A;  1KLU D;  3MEH A;  3PIO A;  2F0G A;  3S15 B;  3A5Z B;  4TVA B;  2BA0 A;  1K3R A;  1MKH A;  3H91 A;  2SNM A;  1A3V A;  5K5P A;  2JA8 G;  1BDO A;  3HOZ B;  1Q8K A;  1Q1B A;  3M3Y B;  2UXB L;  1MJC A;  1GHJ A;  1E2Z A;  3UDX A;  3K58 A;  1MSH A;  4FF1 A;  1ENC A;  4RAU C;  5C4J B;  1LTT D;  2ZJQ A;  2A6E D;  1SRO A;  1PH5 A;  4X64 L;  1WD0 A;  2RCN A;  1K8O A;  2ZM6 Q;  2EJM A;  4DR2 Q;  1SMY D;  3K7U C;  3M7N A;  2PZU A;  1PTO C;  2E5L Q;  2UU9 L;  3MWY W;  4GNX C;  4FXK C;  4LFA Q;  4A3D H;  4LFC L;  2B29 A;  3RN5 A;  3H3V H;  2VQE L;  1S5F D;  2G9H D;  1EYG A;  4RMF A;  4JV5 Q;  3PUX A;  3OWE B;  4UHV A;  2QDB A;  2QEJ C;  5M3M B;  3NHH A;  2VL6 A;  3CCR A;  4U67 3;  2H5X A;  2BH2 A;  3S2H H;  1A15 A;  4GZY C;  4BBS G;  5M3F H;  1HNZ Q;  5EKI A;  4L5T A;  3NWS A;  1E7Z A;  2A6E C;  1V43 A;  3D6C A;  1GD7 A;  2OQK A;  1SMY C;  1EYD A;  3EBE A;  1UE5 A;  5FO7 B;  5CMD A;  4HSP A;  2XWB B;  1HR0 Q;  4YHH L;  3M4Y A;  3CW2 C;  3SK8 A;  4K0K L;  1KXL A;  1SNP A;  4DV4 Q;  1IYJ B;  2XRQ D;  1SNO A;  3J80 E;  2NVQ H;  1D1I A;  1S4Z A;  1OXU A;  1K8M A;  3CP0 A;  4IJL A;  1I94 Q;  1E2V A;  1AN8 A;  3HOX H;  2EYJ A;  5A2Q E;  2UXD Q;  3GV6 A;  3GP7 A;  2IX1 A;  4B9W A;  4POF A;  1MJE A;  1NTG A;  4DN4 M;  4HJ5 A;  1VQP A;  1CM9 A;  3GTO H;  2K5N A;  1S3O A;  2PCF B;  4FP5 D;  1JJ2 A;  1B3Q A;  1LM0 A;  1SND A;  2VXW A;  4KK7 A;  5FJ8 G;  3J81 L;  3OW2 A;  3I56 A;  1RD9 D;  1I4H A;  3PF4 A;  2AKW B;  2WIN B;  1F2Y A;  3F2B A;  3SVM A;  2WAQ G;  5D3I B;  1DD2 A;  3HKZ B;  1L0W A;  2IL8 A;  3J7Y W;  2EZV A;  4XQJ A;  1E0B A;  4AIM A;  5I9P A;  2QGQ A;  1EQQ A;  1K0S A;  2VUM H;  3GTG B;  1DOL A;  5E1F A;  3I2Z A;  4CDD C;  2F0J A;  4YIJ A;  2JJQ A;  3K0Y A;  4X6A H;  1WYD A;  3HZX A;  3NBI A;  4IOC A;  4OWX B;  2AWN A;  2ENB A;  2E2J B;  1WTH A;  3NQI A;  1SYD A;  3HOV H;  4H13 C;  3EQL C;  1ROD A;  1N36 L;  5I6W A;  1WTW A;  1JE4 A;  2D9U A;  4RG1 A;  4N8X 1;  2LKV A;  3MAQ A;  3FEW X;  4RFB A;  4JI4 L;  4C3J G;  4A4I A;  5HY6 A;  4YY3 Q;  4C3H B;  2Z0S A;  1AFP A;  1JCK B;  1KL9 A;  3T1Y Q;  3QIA A;  1JWM D;  1O7Y A;  1ENF A;  5M5Y H;  2F0F A;  4DR3 L;  3R93 A;  3J80 c;  4A3J G;  2L11 A;  5ELE A;  4IFD H;  1V8Q A;  4QF4 A;  2VZA A;  1K83 H;  1SE2 A;  4X66 L;  1F2Z A;  1PYS B;  1SDF A;  4JPB W;  2A5H A;  4DV3 L;  1AE2 A;  3G71 A;  3X3M A;  2LY7 A;  1K73 C;  2NB0 A;  1UEA B;  4FDB A;  4C56 C;  3DUZ A;  3I4N G;  1I4Q A;  2JE6 I;  1Q8I A;  1XYI A;  1TS3 A;  3HGB A;  4OO1 I;  4FO2 A;  3ERQ A;  3ERO A;  1MBY A;  3PO2 B;  1UNS A;  4K6D A;  4OIK A;  1NMF A;  1F9S A;  4A3I H;  2ES2 A;  1IBM L;  1KIX A;  3K57 A;  2SNS A;  2NWG A;  4DAY A;  3ULP A;  4K2L A;  5M5X B;  3C3L A;  1FJG L;  1VQC A;  1OO9 B;  2J0T D;  4JI0 L;  2RA4 A;  4LUZ A;  2K52 A;  1B4O A;  3C2P A;  1VQE A;  5A35 A;  3CCV A;  3RZO H;  3MEF A;  4MTN A;  5IYC H;  2FIN B;  2EE1 A;  2DJF C;  5BR8 Q;  3DLL A;  1AZQ A;  1STY A;  3MTS A;  5HUR A;  1Y69 U;  4LFB Q;  4OX9 Q;  3Q22 A;  3AB9 A;  1HNW L;  3GTP H;  3RD4 A;  3BZC A;  1MIU A;  1K8G A;  1RCV D;  2HCC A;  5T1G A;  2UXC Q;  5CYU A;  5C3E G;  5C0X G;  1BKB A;  1HZB A;  5KND A;  2CQA A;  4KJN A;  4M1U B;  1H9K A;  4HN7 A;  2SDF A;  4C3I G;  2WAC A;  2ICE C;  1NJI C;  2R6G A;  3JAM E;  1F9R A;  2GA4 B;  1D5Z C;  1EL0 A;  2AWO A;  3IL8 A;  1EUJ A;  1VQH A;  4A93 H;  2IPK D;  1XNR Q;  5LMN W;  3TS2 A;  2PPB C;  1VQD A;  3HRZ C;  4ULL A;  5JEA G;  1S5E D;  2B8G A;  2KVM A;  4CKC A;  1QOH A;  1QVG A;  1TWG B;  3I7F A;  3AFP A;  4J15 A;  5FO9 B;  4P71 A;  4BY1 G;  5I2Y A;  3RZD H;  2HHH Q;  2PQE A;  4GN3 B;  3ULL A;  2XSC A;  3HOU H;  3J7A 5;  4RHR A;  2JA7 H;  4Y7N B;  4PNY A;  1GUG A;  3MZ5 A;  4B9X A;  1HA6 A;  1TWH B;  1SYE A;  3OIQ A;  4CGY B;  4BWG B;  5AFW A;  3OTO Q;  4LF4 L;  4Y52 H;  1XX8 A;  1JMC A;  1YEZ A;  1QB5 D;  4ZKC B;  4WFN 3;  4JI1 Q;  4DV0 L;  3RLF A;  4LF8 Q;  3H09 A;  4KN4 C;  4A3B B;  1L1O B;  1B9M A;  5JOB A;  3CF5 A;  3E0J A;  3T1H L;  4G7H C;  5IP7 H;  3WDN A;  2BE5 D;  4B3T Q;  1PYW D;  2R7Z H;  5EPJ A;  2UUA Q;  1LYL A;  4B3S L;  1PRT B;  5NUC A;  1EQR A;  2CKZ B;  1JWS D;  1PFN A;  4QJF A;  5D3D A;  4AQY Q;  5I2X A;  4N9P A;  4DUY L;  4CDF C;  3NK9 A;  4EQ5 A;  4ME3 A;  2K32 A;  1JOQ A;  4IPG A;  3WOF A;  3RUZ A;  3HFZ B;  4PZ8 A;  2ZTC A;  1IYV A;  2N3S A;  2DUD A;  4EQN A;  1QVF A;  4PV1 C;  1LTG D;  5ELO A;  4LNQ A;  1YBY A;  3EIV A;  1NMG A;  2VQF Q;  1S72 A;  2F4V L;  3W1G A;  1F2M A;  5LL6 X;  4HAE A;  4P73 A;  1TII D;  4A3K B;  1F9P A;  4A3F H;  1GUO A;  2KHJ A;  1J6Q A;  1J5E Q;  4NXN Q;  3DM3 A;  4EVO A;  2KBN A;  3DMU A;  2BE5 C;  5M3M G;  1MI2 A;  1VQ6 A;  2EOT A;  2RSO A;  5C44 H;  3VA7 A;  3JAM c;  1HXY D;  3N52 A;  2WB1 B;  1Y8O B;  5IT9 L;  2EYL A;  1VQ7 A;  1SN8 A;  1GHK A;  3IKJ A;  1G2S A;  2EXZ A;  3K59 A;  4JI7 Q;  3CQZ H;  2F0D A;  1O7Z A;  2BH8 A;  3STB D;  1QZH A;  3HS0 C;  2UUC Q;  3TP8 A;  1YNN D;  3H0G G;  4UP8 A;  2EY5 A;  5CR3 A;  1PRT F;  2CWP A;  4LF6 Q;  4DV1 Q;  3L7Z C;  2NN6 I;  2PW5 A;  2AMC B;  3IFD A;  1V1O A;  1JE5 A;  5I6Y A;  4PZ7 A;  1XPR A;  4JC0 A;  4BY7 G;  4IUN A;  2HQE A;  3DWQ A;  4A3L H;  4FF2 A;  4A3E H;  5KYI A;  4QIW E;  3PIP 3;  2UUB L;  1NAP A;  3KLS A;  1G51 A;  5LMN L;  4POG A;  3S1Q B;  4QQB X;  3UE1 A;  2C9O A;  1Q81 C;  1W2B A;  1P16 A;  1CI3 M;  3VYR A;  2E8G A;  2IWH A;  1QUQ A;  5DEH A;  3S16 B;  3KF8 A;  3STB C;  1K8A C;  2NVT H;  1V1P B;  1LLR D;  3BS1 A;  1D2B A;  1YNN C;  1XMO Q;  4DK1 A;  1U4M A;  3KJP A;  1DJR D;  1F2L A;  2EYF A;  3I4O A;  1XTC D;  4RGT A;  5HGT A;  3KLW A;  4P74 A;  1PFM A;  1Z9F A;  3QOJ A;  4DR4 Q;  1WOC A;  3PUV A;  2K28 A;  4I7Z C;  1A3U A;  3CRL C;  1VQO A;  1DGS A;  1NBW A;  1JOK A;  4JI6 L;  3CRK C;  3L0O A;  3FKI B;  5EBC A;  4K5X A;  1JT8 A;  3PUY A;  3OMC A;  4DNT B;  1A6X A;  4P75 A;  3QR8 A;  3D3R A;  1Y1V G;  1QG7 A;  1E1O A;  3ZYY X;  3GTM H;  1F77 A;  1IYU A;  1L0X B;  1SFO B;  2H4O A;  4UDU C;  4KY7 A;  2Q2T A;  4B3R L;  2NVY H;  1FYC A;  3NPP A;  3HOU G;  4JK1 C;  3CMA A;  2E74 C;  4YWL A;  4O0A A;  3DWA A;  4BBS H;  2ZM6 L;  4GKK Q;  4DR2 L;  4DU9 A;  2E5L L;  1U5K A;  3OSO A;  2PO4 A;  2R92 B;  2IHF A;  1ML0 D;  1VCI A;  3BDO A;  1M90 C;  1NR2 A;  3KUP A;  4WJ4 A; 
#chains in the Genus database with same CATH homology
 4NXN L;  1J5E L;  2Y0S G;  4RMF A;  4A75 A;  1OTC A;  1UWV A;  5M5X H;  3TRZ A;  4JV5 Q;  3PUX A;  3NEM A;  4DR7 L;  4X66 Q;  2IY5 B;  1RL2 A;  1NE3 A;  2VL6 A;  3CCR A;  1N34 Q;  2H5X A;  4A3M G;  4DV3 Q;  2Q2U A;  3GTQ H;  2BH2 A;  3W5O A;  2HIX A;  3S2H H;  1HNZ L;  1X6O A;  4BBS G;  1Y1W H;  1KQS A;  5M3F H;  1HNZ Q;  4L5T A;  4JI7 L;  4JYA L;  4DK3 C;  2UUC L;  2VS1 A;  1E7Z A;  3KF6 B;  1V43 A;  3ERS X;  4XTC S;  4NXM L;  4HJ7 A;  4LF6 L;  1GD7 A;  4JOI A;  4A3D G;  2OQK A;  4A3G G;  3EBE A;  1UE5 A;  3CC4 A;  4JG2 A;  1PH9 A;  3S1N H;  1HR0 Q;  2YYZ A;  2ZTE A;  4YHH L;  1KRT A;  1IBM Q;  3CW2 C;  1V9P A;  3PGZ A;  4K0K L;  3S17 H;  1KXL A;  1Q86 C;  4DV4 Q;  1IYJ B;  3CAM A;  2JEA I;  3TEH B;  1T9H A;  5FJ8 H;  2Q2H A;  2YTV A;  4C2M H;  2ZJR A;  1SRU A;  4JI0 Q;  2NVQ H;  3CC7 A;  1OXU A;  1HR0 W;  1L2F A;  3CP0 A;  4IJL A;  5JJI A;  4GOP C;  1I94 L;  2QEX A;  1VQN A;  2KCT A;  1Y1W G;  1I94 Q;  3RLO A;  5M3F G;  4B3M Q;  1JJC B;  3HOX H;  3PO3 H;  1A0I A;  3H3V I;  3HKS A;  3M4Q A;  2UXD Q;  2I5L X;  1FVI A;  2IX1 A;  1TWG H;  3GTG H;  4POF A;  2EXD A;  1VQ4 A;  4GNX B;  1R9T H;  1NTG A;  1MJE A;  3RR5 A;  5GQO A;  1PFS A;  4DV7 L;  4HJ5 A;  3S24 A;  1VQP A;  1K9M C;  2VY3 A;  4DV7 Q;  3GTO H;  1XMO L;  2XTI A;  3BU2 A;  1VQB A;  1Z47 A;  2K5N A;  1XPU A;  4Y7N H;  1YIT A;  1S3O A;  1JJ2 A;  2E2J H;  1PH2 A;  1LM0 A;  1PH7 A;  2OTJ A;  5E7N A;  1OXT A;  3NEN A;  5AJ3 L;  1X56 A;  2R7F A;  5FJ8 G;  5AJ3 Q;  4UY8 C;  2JA5 H;  3OW2 A;  2IHE A;  3I56 A;  4JBK A;  3ZJY C;  3PF4 A;  4DR4 L;  2K50 A;  2AKW B;  2I5M X;  1X55 A;  4X65 Q;  4HJ8 A;  1Q7Y C;  1ASZ A;  3G6E A;  3F2B A;  2RHS B;  4DNI A;  3KF8 B;  5IT9 c;  3K7A H;  1N32 Q;  2WAQ G;  4OON A;  4JI8 Q;  4LF5 Q;  2RF4 A;  3HKZ G;  1VQ9 A;  3CD6 A;  1I5F A;  2B63 H;  1L0W A;  2VNU D;  1LUZ A;  4C3J H;  3F2C A;  1IBK L;  3HOX G;  3PO3 G;  3A0J A;  4AIM A;  4C3H H;  2ASB A;  2QGQ A;  1EQQ A;  2YU9 H;  3M4O H;  2VW9 A;  4YWK A;  1TWF H;  4HIM A;  2VUM H;  4BXX H;  3I2Z A;  1X65 A;  2K75 A;  2JJQ A;  3S2D H;  1FGU A;  4HJ9 A;  4X6A H;  4X62 L;  5H1S E;  1WYD A;  3J80 i;  4A3J H;  4GOP A;  1L1O A;  4IOC A;  2MO0 A;  1VQI A;  1G29 1;  3RLN A;  4OWX B;  3CCJ A;  2AWN A;  3U50 C;  1VQK A;  1GO3 E;  4MNO A;  4R4O A;  3HOV H;  1N33 L;  5C4X H;  2R93 H;  2YTX A;  2OCE A;  2JA5 G;  3F8T A;  1B7Y B;  1N33 Q;  4LF4 Q;  2A19 A;  4JOI C;  1N36 L;  1HJP A;  3SGI A;  1VS0 A;  1CSQ A;  1WFQ A;  1AH9 A;  4RG1 A;  1P8L A;  4O2D A;  4GOP B;  2B63 G;  1UE7 A;  4JI4 L;  1CKM A;  4A4I A;  1GKH A;  1PH8 A;  4JI4 Q;  3KDF A;  3I4N H;  5HY6 A;  4YY3 Q;  1SLJ A;  2Z0S A;  5HGQ A;  4DUZ L;  4A3K H;  4DAM A;  1KL9 A;  3M85 A;  4DUZ Q;  3T1Y Q;  4LFA L;  4GLA C;  3G48 A;  2VUM G;  3CCS A;  4BXX G;  4DV2 L;  1W3S A;  5M5Y H;  1ASY A;  3I4M H;  1Q1E A;  3PO2 H;  3K8A A;  2PMZ E;  3KFU A;  4DR3 L;  3RN2 A;  1KHI A;  2JQO A;  3J80 c;  4A3J G;  1SE8 A;  4DUY Q;  1VQJ A;  4OO1 G;  1XPO A;  2WAQ E;  4JV5 L;  3VDY A;  2VZA A;  3AYH B;  1K83 H;  3HKZ E;  4JBJ A;  4GLV B;  4X66 L;  1PYS B;  1E22 A;  2Q2I A;  3HOV G;  5C4X G;  2R93 G;  1N34 L;  2JK8 A;  1PH3 A;  3AQQ A;  2ALY B;  5GAG C;  4DV3 L;  1AE2 A;  3JC6 6;  2KEN A;  3G71 A;  1K73 C;  1YHB A;  4DPG A;  5IWA Q;  2F4V Q;  4FDB A;  3W1B A;  1PH6 A;  3ICE A;  1E3P A;  2JA9 A;  3I4N G;  2JE6 I;  2HT1 A;  4OWT B;  4A3K G;  1WJJ A;  3E0E A;  4KHZ A;  2A8V A;  4OO1 I;  2K4K A;  1VQG A;  3ER0 A;  4IPD A;  4JI2 Q;  1B70 B;  3H15 A;  4DR5 L;  1N8R C;  3KOJ A;  2RHQ B;  4DR5 Q;  3J81 j;  4IJH A;  1YJ9 A;  3U4Z A;  3PO2 G;  1NMF A;  4A3I H;  1HR0 L;  2ES2 A;  1IBM L;  3KYH C;  4IFD G;  1KIX A;  5C3E H;  4PZ6 A;  2WB1 G;  4DV4 L;  3ULP A;  1FJG L;  3PUZ A;  1VQC A;  4KHP Q;  1FJG Q;  1D7Q A;  3KJO A;  4JI0 L;  4C3I H;  1S40 A;  1PA6 A;  3HOY H;  3GTK H;  4MZ9 A;  4LUZ A;  5IE8 A;  1B8A A;  1TWA H;  1XNQ L;  1I50 H;  2K5H A;  2K52 A;  1VQE A;  1XNQ Q;  2MQH A;  3CXC A;  3CCV A;  3RZO H;  4QY7 A;  3S16 H;  3MEF A;  4MTN A;  5IYC H;  1L1O C;  4B3M L;  1VQM A;  5BR8 Q;  5LMU Q;  4AYB G;  4L5R C;  2DGY A;  3DLL A;  4DR6 Q;  2UXD L;  2V1C C;  3PF5 A;  3I55 A;  3CC2 A;  1CSP A;  2Y0S E;  1GM5 A;  4IFD I;  4LFB Q;  1AE3 A;  2HQL A;  2NVX H;  4OX9 Q;  1HZA A;  1HNW L;  3GTP H;  4BY1 H;  3BZC A;  3L2P A;  1MIU A;  4A3I G;  1K8G A;  1HNW Q;  4JYA Q;  4GN4 B;  2ID0 A;  2UXC Q;  4PMW A;  5C3E G;  3TRE A;  1TWH H;  5C0X G;  1BKB A;  1HZB A;  2CQO A;  2WP8 J;  4BA1 I;  1PVO A;  1XTD A;  4BA2 I;  1I6H H;  3FKI H;  3HOY G;  4X65 L;  1QVC A;  3TS0 A;  1NJI C;  2R6G A;  4IPH A;  1JJG A;  1N32 L;  2AWO A;  1Q82 C;  1EUJ A;  4JI8 L;  1VQH A;  4LF5 L;  3S1R H;  3S15 H;  4A93 H;  1XNR Q;  5LMN W;  5IYC G;  1HH2 P;  3TS2 A;  1VQF A;  4A3B H;  5K36 G;  4WJ3 M;  2FXQ A;  1VQD A;  3D0F A;  5JEA G;  2C35 B;  1OXX K;  3E9I A;  2JA8 H;  4DV6 Q;  4P72 A;  3CCL A;  3M3Y H;  1VQA A;  5GRO A;  2LXJ A;  1QVG A;  4LW1 A;  1EIY B;  4TQU S;  1BVS A;  5C0X I;  3E9H A;  1TWC H;  2CFM A;  3I7F A;  3AFP A;  1SFO H;  1IBL Q;  2HIV A;  4J15 A;  2HHH L;  4P71 A;  1GVP A;  4BY1 G;  3RZD H;  2HHH Q;  4QL5 A;  4GN3 B;  3ULL A;  4GLX A;  2GN5 A;  1BBW A;  3HOU H;  3A74 A;  2JA7 H;  5C4J H;  3J7A 5;  1O7I A;  1VQ8 A;  3GD7 A;  1NY4 A;  4XIG S;  1YIJ A;  3J81 i;  1UEB A;  3OTO L;  3OTO Q;  4LF4 L;  4IOA A;  4Y52 H;  1JMC A;  2ZJP A;  3FKI G;  1YEZ A;  2AHO B;  4JCV E;  4OWW B;  4IPC A;  1PH1 A;  4JI1 Q;  2N78 A;  1CKN A;  4DV0 L;  3RLF A;  1PYB A;  1CUK A;  4LF8 Q;  4YCV A;  4DV0 Q;  2R92 H;  4A93 G;  4A3B G;  3Q8D A;  5GAE C;  1EYG A;  5IP9 H;  1L1O B;  3M9B A;  4R4I A;  3CF5 A;  4YY3 L;  1UE1 A;  3T1H L;  1OXV A;  5IP7 H;  4B3T L;  3T1H Q;  3T1Y L;  4B3T Q;  2N8N A;  2Z6K A;  3M4P A;  4JBW A;  3D31 A;  3WWV A;  2JA6 H;  2R7Z H;  3FP9 A;  2UUA Q;  4OXP A;  4JI3 L;  1VQ5 A;  2UXB Q;  1LYL A;  4B3S L;  2MFI A;  4AQY L;  1Q12 A;  1IXR A;  1EQR A;  5DLQ E;  2CKZ B;  4HID A;  4QJF A;  4B3S Q;  4AQY Q;  4JI3 Q;  2WFW A;  5M3M H;  4ALP A;  3K80 C;  4PG3 A;  4DUY L;  1WI5 A;  3JAM i;  4LF7 L;  2JA7 G;  4B3R Q;  4EQ5 A;  1M1K C;  2PNH A;  4ME3 A;  4DV5 Q;  4LF7 Q;  4IPG A;  4LF9 L;  3KDF B;  4L5S A;  3HFZ B;  4APV A;  1EWI A;  2IT1 A;  3UE0 A;  1E1T A;  1SMX A;  3J81 c;  4LF9 Q;  2D0P A;  2NZH A;  3EN2 A;  1Y14 B;  4PZ8 A;  4GKJ Q;  2ZTC A;  3PSI A;  2N3S A;  2DUD A;  2K5V A;  1V1Q A;  1QVF A;  3K0X A;  2OTL A;  1EOV A;  1YVC A;  1VQL A;  4A3C H;  1HZ9 A;  5ELO A;  4LNQ A;  2YTY A;  3H0G H;  1YBY A;  4HIO A;  2R92 G;  2BA1 A;  3EIV A;  1KD1 C;  1NMG A;  2VQF Q;  3LGJ A;  5IWA L;  1IZ6 A;  1S72 A;  2ZTD A;  1EIF A;  2GVB A;  3W1G A;  2UU9 Q;  2F4V L;  5IP9 G;  2IX0 A;  2I0Q A;  4R4T A;  2JEB I;  3MXN B;  1YHQ A;  4LFC Q;  3S1M H;  5IP7 G;  3PIP A;  4P73 A;  1X3E A;  4BBR H;  4A3F H;  3ULJ A;  4JI2 L;  3UDI A;  1Q46 A;  1E24 A;  1UE6 A;  2JA6 G;  2R7Z G;  4BY7 H;  2KHJ A;  4NXN Q;  1J6Q A;  4HJA A;  4R1J A;  3DM3 A;  1WCM H;  3KF6 A;  4UP7 A;  1J5E Q;  2ATW A;  2KBN A;  4NPS A;  3I4M G;  2NN6 G;  3BJU A;  5M3M G;  1IL2 A;  3UDF A;  4DR7 Q;  2OQ0 A;  1VQ6 A;  2PI2 A;  3AEV A;  5C44 H;  3JAM c;  3S1Q H;  4LUV A;  1XMQ L;  1XMQ Q;  3CPF A;  4UP9 A;  1X3G A;  4KHP L;  1VQ7 A;  1SN8 A;  3K81 C;  3PV0 A;  2A1A A;  2LXK A;  1G6P A;  4JI7 Q;  1KRS A;  3CQZ H;  4H02 A;  4L5Q A;  5FLM H;  3STB D;  2BH8 A;  3RNU A;  1QZH A;  2UUC Q;  4A3C G;  3GDE A;  3H0G G;  4UP8 A;  3CCU A;  3CCM A;  1U0L A;  3IRB A;  3S14 H;  4R4Q A;  2E2I H;  5BR8 L;  2D62 A;  5LMU L;  4DV1 L;  2B3G A;  1K0R A;  2CWP A;  3UDG A;  4LF6 Q;  4DV1 Q;  3L7Z C;  4NXM Q;  2NN6 I;  3A5U A;  3GTL H;  4DR6 L;  4DAY B;  3CCQ A;  2AMC B;  1QZG A;  1SR3 A;  4IO9 A;  5GAH C;  1JE5 A;  4LFB L;  4BBR G;  4A3F G;  4PZ7 A;  4YHH Q;  4JC0 A;  4QGU A;  4UPA A;  1XPR A;  4BY7 G;  4YCW A;  4OX9 L;  4K0K Q;  2CCZ A;  2KHI A;  1WCM G;  5IYB H;  4A3L H;  4A3E H;  3NEL A;  4QIW E;  4YWM A;  2UUB L;  1FL0 A;  4GNX A;  2UXC L;  4YCU A;  2UUB Q;  3NBH B;  5C44 G;  1H95 A;  1G51 A;  5J3B A;  2D0O A;  5LMN L;  1D8L A;  3OYY A;  1PHJ A;  4POG A;  5LMN Q;  4QQB X;  3UE1 A;  4DK6 C;  1HNX L;  2Z6K C;  5EAY A;  2GVA A;  2PQA A;  1C0A A;  3FHW A;  1Q81 C;  1HNX Q;  1N9W A;  5JJK A;  1W2B A;  3PUW A;  1YZ6 A;  1OXS C;  1C9O A;  2R7D A;  5IYD H;  1P16 A;  5FLM G;  5FLX c;  1KC8 C;  2CWA A;  2E8G A;  1QUQ A;  1XNR L;  3PCO B;  4AH6 A;  1CKO A;  2N49 A;  1A62 A;  3J7Z C;  5IY0 A;  1X9N A;  2OWO A;  3GTJ H;  3STB C;  1K8A C;  2NVT H;  3G4S A;  2E2H H;  2QA4 A;  4DV6 L;  1LTL A;  1XMO Q;  5GAD C;  2YV5 A;  1PV4 A;  4JBM A;  4IFD J;  1Y1V H;  2PQA B;  2XGT A;  2WB1 E;  5ELN A;  3KJP A;  1C7Y A;  3HOZ H;  3I4O A;  4EX5 A;  1IBL L;  3KLW A;  4P74 A;  5IYB G;  4A3L G;  4A3E G;  1KAW A;  1Z9F A;  1QUQ B;  2NZO A;  4A76 A;  2EIF A;  3GO5 A;  4DKA C;  4GS3 A;  4DR4 Q;  5M5W H;  3CPW A;  1WOC A;  4JI5 L;  1I3Q H;  2PI2 E;  1YJN A;  3PUV A;  4JI5 Q;  2K14 A;  4R4C A;  1X3F A;  4AYB E;  2F52 A;  3TQY A;  1XJV A;  3F2D A;  1VQO A;  1DGS A;  1JB7 A;  1NBW A;  4JI6 L;  3L0O A;  4JI1 L;  5IYD G;  1IBK Q;  4JI6 Q;  2L15 A;  2MO1 A;  4LF8 L;  5JJL A;  3HOW H;  3PIO A;  1JT8 A;  3A5Z B;  3PUY A;  4TVA B;  2BA0 A;  1K3R A;  4NB3 A;  1MKH A;  2LSS A;  4P75 A;  4KI0 A;  3F1Z A;  4DR1 L;  4X62 Q;  2JA8 G;  4DR1 Q;  4LUO A;  1Y1V G;  3HOZ G;  1Q8K A;  1Q1B A;  2UUA L;  1E1O A;  1TXY A;  1MJC A;  5C0X J;  2UXB L;  1EFW A;  3GTM H;  1BBU A;  2MNA A;  1HZC A;  3UDX A;  1CKN B;  2Q2T A;  4B3R L;  1YJW A;  2NVY H;  1PH4 A;  3HOU G;  3CMA A;  4DV5 L;  4A3M H;  3CCE A;  3AFQ A;  1N36 Q;  4YWL A;  1A63 A;  2F3I A;  2EQS A;  4KLK A;  2ZJQ A;  4O0A A;  1SRO A;  2I5H A;  4BBS H;  4GKJ L;  1X54 A;  4GKK L;  1PH5 A;  2ZM6 L;  5JEA J;  4X64 L;  1A8V A;  4GKK Q;  2RCN A;  1YNX A;  3U4V A;  2ZM6 Q;  4X64 Q;  4DR2 L;  3BZK A;  4DR2 Q;  3K7U C;  3M7N A;  4HIK A;  2E5L L;  1U5K A;  1YHA A;  2KCM A;  2VQF L;  2E5L Q;  2UU9 L;  4GNX C;  3HOW G;  2IHF A;  4LWC A;  4LFA Q;  4GN5 A;  3CME A;  4A3D H;  1VCI A;  4DV2 Q;  4A3G H;  1M90 C;  4LFC L;  2B29 A;  3RN5 A;  3H3V H;  2VQE L;  4DR3 Q;  3U58 A;  1YI2 A;  1RIP A;  3B6Y A;  4WJ4 A;  2VQE Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...