1QZGA

Crystal structure of pot1 (protection of telomere)- ssdna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
VIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
molecule keywords telomeric single-stranded DNA
total genus 46
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1qzgA00
5IP7G 3TEHB 5GAGC 1HR0Q 4NPSA 3PO3G 3CW2C 4OO1G 4HIOA 1TWAH 1QZGA 4A3BG 4LWCA 3ZJYC 2PI2A 4C3IH 3KF6B 4IFDG 1JMCA 4NXNQ 3S14H 4DR6L 2AWNA 1W2BA 1IL2A 4JI3L 4JI0Q 4JCVE 3AYHB 3RLOA 1NJIC 1TWHH 5GQOA 1Q46A 4POFA 5AJ3L 1IXRA 1FGUA 3LGJA 3J80c 3DM3A 3CF5A 1XPRA 1PV4A 1IBLL 1HNWL 2XGTA 2VZAA 4B3ML 1I5FA 4GNXB 3S17H 2UXBL 2Z6KC 3PO2H 2Q2TA 3KF6A 4IOCA 4JC0A 1SROA 1N32L 5M5YH 4AIMA 1L1OA 4P74A 1PH5A 1X3FA 2R92H 5LMUQ 4JI4L 2ZM6Q 2N3SA 1PH9A 2AMCB 4A3JH 1PH3A 4IPCA 1N8RC 4A3GG 2Z6KA 1NMFA 3J7ZC 4GLAC 5C0XJ 4PZ6A 3K8AA 1EOVA 3CQZH 4DV7Q 3PIOA 2D0OA 1G6PA 2RF4A 3HKSA 1JJ2A 1DGSA 1VQKA 1OXXK 2IX1A 4GOPC 2IY5B 4JI8L 1UE6A 2R6GA 3HOXH 4R4OA 1XNRL 2ASBA 5IYCH 1CUKA 1N36L 2JQOA 2PQAB 4MZ9A 4PMWA 3G6EA 1QVGA 4X66Q 1KL9A 3CP0A 1LM0A 5C4XG 4L5SA 2B63H 4OXPA 4YCVA 1OXUA 2UUBL 1GM5A 1L2FA 1XNRQ 1D7QA 1MIUA 1M1KC 4DR5Q 4DAMA 2BH8A 1CSQA 3BU2A 1FVIA 1X56A 4YWLA 3CCLA 4DR3Q 4JBKA 4X62Q 4NXNL 4DR6Q 5IWAL 1YVCA 4R1JA 5M3FG 1YHQA 4O0AA 3J81j 3UE1A 2WAQG 5IP9H 1XNQQ 2I5HA 2IHFA 3ICEA 4JI5L 3E9IA 4RG1A 1L1OB 1SRUA 4DAYB 1T9HA 4DR2L 4KHPL 5C3EG 4A75A 3EIVA 2ID0A 4JI5Q 2BA1A 4ALPA 4LF8L 1NY4A 4O2DA 1XMQL 5JJKA 3IRBA 2CWAA 3S2DH 3AFQA 5IWAQ 3A74A 4DNIA 1IYJB 1VQ8A 3PUWA 1B70B 3PCOB 2JA6G 1X65A 1E24A 3PO2G 4DUZL 5IP9G 4NXMQ 4GLVB 4OWXB 3JC66 3PSIA 3I4MG 2VUMG 2MFIA 1U5KA 1HZ9A 3HOZH 1XMQQ 1W3SA 4A4IA 3PUXA 4IJHA 5C4JH 4A3KH 4DV0Q 3TS2A 4P73A 3S24A 4JI8Q 3CCSA 4JI2L 4X64L 4A3BH 5IT9c 4LFCL 2UXDL 4OX9L 4GLXA 4POGA 3KDFB 1VQ5A 1N34Q 5IP7H 4BBRG 2K5VA 2ZJPA 4AH6A 1GO3E 2A1AA 4X66L 1IBKQ 5EAYA 5J3BA 3UDFA 2R7ZG 3KJPA 4DV6L 3CAMA 4QY7A 3B6YA 2K14A 1VQAA 1LUZA 1EUJA 1EQRA 1Z47A 4UP7A 5IY0A 5BR8L 3CC7A 3GTLH 4DR4L 3OYYA 4GNXA 1YZ6A 1YJNA 1MKHA 1VQHA 4R4IA 1N32Q 3KLWA 1L1OC 2ZTDA 5IYCG 3KYHC 2ATWA 3W1GA 4WJ3M 4DV0L 1YBYA 2VQEQ 4DV2L 4A93H 1N34L 4GNXC 1VQ7A 3FKIG 4PZ8A 1AE3A 4BY1H 2CFMA 1HR0W 4R4QA 3M85A 1TXYA 3UDIA 4GOPA 1X6OA 2PNHA 3G48A 3T1HQ 4A3JG 4IPDA 1VS0A 4UY8C 4LF6L 2N78A 1P16A 1VQFA 4PG3A 5AJ3Q 4HIDA 3TRZA 1X54A 4NXML 4A93G 4YCWA 1I3QH 3I4OA 3CCVA 3PF5A 2NZOA 1K73C 4B3RQ 2GVBA 1VQ9A 4X65Q 4DPGA 2YV5A 3FKIH 2QA4A 2I0QA 2K5HA 1YHAA 1Q86C 2K75A 1VQGA 4DV1Q 2N49A 1OXTA 2K5NA 1R9TH 4JV5Q 5ELOA 1IZ6A 5IYDG 1C0AA 5HY6A 1Y1WH 1A63A 1HZBA 4A3DG 1LTLA 2UXDQ 1E3PA 3JAMc 2AHOB 4B3TL 4DV4Q 3M7NA 1CKNA 1JE5A 1P8LA 1OXSC 2DGYA 1UEBA 3PUYA 3RN5A 4A3FH 1BBUA 1GKHA 2F3IA 3GTGH 1X3GA 5ELNA 4GKJQ 1BVSA 2QGQA 3K7UC 3M4PA 3W1BA 4DR1L 1HNXL 4JBMA 4WJ4A 4P72A 4JYAL 3CCMA 3U50C 3HOZG 3K7AH 1K8GA 4JI6Q 2VQFL 3DLLA 2VQEL 2IT1A 4QIWE 1SR3A 1VQCA 1WFQA 1Q1EA 2AWOA 4DV2Q 1K9MC 1J5EQ 2GN5A 4QL5A 4LUZA 4A3DH 3M9BA 4JG2A 5GROA 4JI7L 2UUBQ 3K81C 1TWCH 2XTIA 5C0XG 3H3VH 4DV3Q 2NVQH 2LSSA 3K80C 3PIPA 5GAEC 3CC4A 3ULPA 1PH6A 1H95A 1VCIA 4BXXH 1D8LA 4OO1I 4OWWB 1UE5A 4AYBG 1N33Q 1YJ9A 3FHWA 4IPHA 1CKMA 5C44G 1PH7A 1EFWA 4IPGA 2EIFA 2KHJA 1XNQL 2JA9A 2JA5G 1V9PA 3KF8B 3JAMi 2A8VA 1EIYB 4DKAC 1HZCA 1A0IA 2H5XA 2OTLA 2YU9H 4GOPB 1X9NA 3HOUG 4GN4B 3I4NH 3KOJA 4LFBL 1OXVA 4DV6Q 1XJVA 1I94Q 4BA2I 2AKWB 2E8GA 3NELA 4DUZQ 2JA7H 4JI2Q 3OTOQ 3TQYA 2K50A 3ER0A 2LXJA 3EBEA 2B29A 2E5LL 4LF4L 2WB1G 2KBNA 1KAWA 3MXNB 5LMNW 1VQDA 1EWIA 3PUZA 1QUQB 2HQLA 2NVYH 2E2HH 3T1YL 1YHBA 1IBMQ 1VQ6A 2WFWA 4AQYL 4GKJL 1HJPA 5IE8A 4A3FG 2ALYB 1I50H 1N36Q 4JI0L 4LF4Q 4B3TQ 3NBHB 3STBC 2Y0SG 1L0WA 2UUCL 4BA1I 4EX5A 1QUQA 2A19A 4YY3L 1XPUA 4JI1Q 1TWFH 2Q2UA 3CXCA 1YJWA 2R93G 3PO3H 4LF7L 4A3CH 2HHHL 1BKBA 4BY7H 1AE2A 3WWVA 3F2BA 1PHJA 1HNZL 3PF4A 1E22A 4AYBE 3HOXG 3J7A5 1XMOQ 1VQBA 1Q12A 2HIVA 1E7ZA 2KCTA 2ZM6L 1U0LA 3CCEA 4LF7Q 2Q2IA 5H1SE 2R92G 4LF8Q 1FL0A 1PH1A 4A3LH 4A3MG 1VQ4A 2ZTCA 2NN6G 4QJFA 4UPAA 3D0FA 3U4VA 4K0KL 4DR2Q 4QQBX 1CSPA 1NBWA 3TREA 1YIJA 4Y7NH 3BJUA 1S72A 2JEBI 3L2PA 1YEZA 2ZJRA 4IO9A 1S40A 2F4VL 4A3LG 4DV5L 5C44H 2E2IH 2WP8J 2CQOA 1XMOL 3GTOH 4LW1A 1AH9A 4DUYL 4IOAA 3GTMH 1PA6A 3CPWA 3GTQH 1K8AC 2F4VQ 4BY1G 4XTCS 1JJCB 4GKKQ 1WCMH 2JA8H 2C35B 3EN2A 2R93H 5GADC 3A5UA 2NN6I 2DUDA 2Y0SE 1C9OA 4QGUA 5FJ8H 1VQOA 2N8NA 3RN2A 3VDYA 1M90C 3RZOH 4TQUS 1OTCA 3D31A 4MNOA 5JJLA 2UUAQ 2KENA 4DR1Q 3S1RH 1CKOA 1PFSA 3GD7A 3NENA 4JI7Q 3RR5A 4R4CA 1G291 4LF5L 2KCMA 3CMEA 3E9HA 4LFCQ 2NVTH 3M4QA 4X64Q 1QVFA 1ASZA 3TS0A 4H02A 2R7FA 1SE8A 3J81i 2FXQA 2OWOA 1QZHA 1HNZQ 4DV1L 1NE3A 1CKNB 4BBSH 2YTYA 1O7IA 3S15H 4J15A 2B63G 1KHIA 4ME3A 1HNXQ 4YCUA 1PH8A 1Q82C 2E2JH 3HOVH 1B8AA 2I5LX 5FLMH 2ES2A 2UXCQ 4JOIA 3KJOA 2JA7G 2ZTEA 3RLFA 2VY3A 2VUMH 1KXLA 3RLNA 3W5OA 4DR7L 5C4XH 3BZKA 1HNWQ 2LXKA 5JEAG 2UXBQ 3HOYH 2MO1A 3M3YH 4JI3Q 3E0EA 4APVA 2RHQB 2JE6I 3FP9A 3PGZA 2V1CC 1WYDA 1PYSB 4LFAQ 4K0KQ 1VQPA 1WI5A 1ASYA 3L7ZC 1VQNA 3L0OA 1J5EL 1Z9FA 1Q7YC 1SN8A 1I94L 5FLMG 4DV7L 3GTPH 2YYZA 3KFUA 3GTJH 4HJ7A 1TWGH 4B3SL 4GN3B 4FDBA 3RZDH 3MEFA 4R4TA 1GVPA 3NEMA 5BR8Q 3G71A 3STBD 3CCJA 1EQQA 2CCZA 3J81c 1N33L 4LFAL 1LYLA 1UE1A 4C3JH 1UWVA 5M3FH 1VQLA 2I5MX 2EXDA 1FJGQ 2HT1A 1A8VA 2JEAI 2MQHA 4A3MH 1WJJA 1PYBA 5IYBH 3AEVA 5M5WH 4P75A 1SFOH 4XIGS 3ULJA 1XTDA 4LFBQ 5JJIA 4AQYQ 2L15A 4YHHL 1VQEA 1SLJA 1EIFA 4BBRH 2K52A 2VNUD 4A3CG 3F2CA 1MJCA 1VQIA 5JEAJ 4HJ8A 4DR3L 1K3RA 3H15A 1A62A 4KHZA 4YHHQ 4A76A 1E1TA 4DK6C 4C2MH 1KC8C 1Y1VH 2VS1A 4UP8A 3F2DA 4JI6L 1X55A 2OQKA 4OX9Q 3G4SA 5FJ8G 4B3MQ 2RCNA 3A0JA 1XPOA 1Q81C 2EQSA 5LMNL 1VQMA 2UUCQ 3I4MH 2B3GA 1E1OA 3CCRA 4NB3A 3CD6A 4A3IG 4A3KG 4KHPQ 5LMNQ 4HIMA 2BH2A 1I6HH 3M4OH 1KRTA 5K36G 4HIKA 5GAHC 4OONA 2D0PA 4RMFA 2MO0A 2F52A 4GS3A 4LUVA 4B3SQ 1RL2A 4EQ5A 2D62A 4A3IH 4LF9Q 4L5QA 3UE0A 3K0XA 3U4ZA 4UP9A 3GDEA 2VW9A 3CC2A 3HOUH 5C0XI 3KDFA 2UU9L 1G51A 3I2ZA 4JI4Q 1Q1BA 4YWMA 4DUYQ 4JYAQ 4LF9L 5DLQE 1K83H 1KQSA 3S1NH 4DR7Q 2Z0SA 3T1YQ 1X3EA 1IBML 4BXXG 2PI2E 3HKZE 3S1QH 2PMZE 3A5ZB 3GO5A 4HJ5A 2BA0A 4DK3C 4DR5L 1YITA 4BY7G 3HOYG 3HOWH 2HIXA 4JOIC 2OTJA 2KHIA 3I7FA 2IHEA 2JK8A 1Y14B 5M5XH 1FJGL 5M3MG 4A3EH 1V43A 4MTNA 1SMXA 1VQJA 3BZCA 2YTVA 4DV3L 2UU9Q 2R7ZH 3I55A 3GTKH 4X65L 1B7YB 2YTXA 1NTGA 1Q8KA 2VL6A 2MNAA 2PQAA 2JJQA 3S2HH 5IYBG 2WB1E 2IX0A 4YY3Q 2K4KA 3I4NG 3HOWG 4KLKA 4HJ9A 4LNQA 4C3HH 1NMGA 4P71A 4GN5A 1Y1WG 4TVAB 2JA6H 3CPFA 1S3OA 3I56A 1J6QA 4L5RC 4Y52H 5HGQA 3PUVA 2NZHA 3S16H 2ZJQA 2CKZB 3T1HL 4LUOA 1V1QA 4IFDI 2R7DA 3H0GG 1WCMG 2JA8G 4IFDJ 1GD7A 3H3VI 4LF6Q 3AFPA 3OTOL 3CMAA 1KD1C 2JA5H 3CCQA 5IYDH 3F1ZA 4JBWA 1YNXA 5E7NA 3OW2A 2E5LQ 4A3GH 1IBLQ 3CCUA 2WAQE 1HH2P 2Q2HA 2RHSB 3SGIA 3U58A 1PVOA 1JJGA 1YI2A 1KIXA 3HKZG 2UXCL 2QEXA 1MJEA 4GKKL 4X6AH 4DV5Q 3H0GH 4IJLA 2CWPA 3J80i 5LMUL 3AQQA 1C7YA 1KRSA 4L5TA 5C3EH 4B3RL 1N9WA 1PH4A 4BBSG 2OQ0A 4JI1L 4OWTB 1QVCA 1HR0L 4DV4L 4DR4Q 4PZ7A 1K0RA 1PH2A 3HOVG 3S1MH 1HZAA 2GVAA 1BBWA 1UE7A 4HJAA 1IBKL 4LF5Q 3ERSX 3UDGA 3HFZB 4JBJA 5M3MH 4A3EG 4JV5L 1JT8A 4YWKA 3PV0A 2OCEA 3RNUA 3F8TA 3ULLA 2UUAL 4KI0A 1Y1VG 5FLXc 1JB7A 3UDXA 2HHHQ 2NVXH 4X62L 1WOCA 1EYGA 2VQFQ 3Q8DA 1RIPA
chains in the Genus database with same CATH superfamily
1CM9A 3TEHB 4NPSA 3PO3G 5EPLA 4A3BG 1ILPA 1H9SB 3KF6B 2PW5A 4IFDG 3FMCA 3J80E 1KLUD 3SXHA 4JI3L 2F0NA 1TWHH 5GQOA 1IXRA 1CHQD 1F77A 1HNWL 2XGTA 3S17H 1I5FA 4IUTA 3K0YA 4JC0A 1SROA 1TWFB 3NHHA 4CKEA 3TN2A 2XIWA 4P74A 1PH5A 5LMUQ 2A68D 4K8JA 4A3GG 1N8RC 1VF5C 3SEBA 1NAPA 1VDZA 3K8AA 2JP1A 1EOVA 1SDFA 5I4DA 1FGBD 2F03A 1G6PA 5EJWA 2NVQB 1NNXA 4JI8L 1GUTA 3WOFA 1CUKA 1N36L 2PQAB 4X66Q 3CP0A 5M5YB 5C4XG 2B63H 4YCVA 1OXUA 2UUBL 1XNRQ 3H09A 1EIHA 4DR5Q 4DAMA 3J80L 1X56A 4YWLA 2PMZB 4DR3Q 3CCLA 3BYTB 4X62Q 2EYOA 2B39A 4NXNL 5I2YA 1RDPD 1YVCA 3JAME 1AZPA 4PQXA 2WAQG 1XNQQ 2I5HA 3TMEA 4JI5L 3G6JB 3E9IA 2L5TA 1L1OB 4DAYB 1ONLA 5CBEE 5BN3A 3J7AF 1LABA 1NR4A 2BA1A 2KQ3A 4O2DA 5JJKA 4CDDC 3IRBA 4UHVA 1HRJA 1D5ZC 4KTAA 4X3UA 1B70B 1D1IA 5M5WB 2JA6G 5HGTA 1X65A 1E24A 2CW0C 1GUOA 1SE3A 5KNCA 5NUCA 4N9TA 4FF2A 4GLVB 4OWXB 3GTLB 1WD0A 3I4MG 2MFIA 1HZ9A 4CKCA 3HOZH 4IJHA 5C4JH 1F2YA 1U4PA 2M2LA 1U4MA 4P73A 3S24A 3DEOA 1CK1A 2A69C 3CCSA 4YIJA 2UXDL 4POGA 3AB9A 5IP7H 4BBRG 1IBKQ 4HMIA 2PZWA 3CAMA 1EUJA 4UP7A 3CC7A 2KCNA 4DR4L 1MKHA 1VQHA 1L1OC 5IYCG 4WJ3M 1SYFA 3J7YW 2GA4B 3AU7A 3MFYA 3K6OA 4A93H 5BN5A 2R61A 4NMZA 4RH6A 3I70A 1LTAD 1G2TA 1I4PA 1AFPA 1VQFA 5CR3A 1DOLA 2PO4A 4O42A 2NZOA 5CV8A 1EU3A 2I0QA 5C6AA 1Q86C 4ZK9B 4GZYC 4A3DB 4P2CB 1WD1A 1E3PA 3NK9A 1FD7D 3M7NA 1DD2A 1P8LA 4A3FH 2CQAA 3PUYA 4DR7L 4GKJQ 1X3GA 3CU7A 1I3QB 5A35A 1GUGA 4DR1L 3GTPB 4JBMA 1HNXL 2K01A 2HUGA 1S5CD 1SNCA 3SHLA 2HCIA 3FKIB 2R92B 1K8GA 1IKLA 4JI6Q 4DV2Q 2IT1A 4QIWE 1K9MC 1WFQA 3GTMB 1A15A 2GN5A 4LUZA 1LLRD 4JG2A 4JI7L 3I4NB 2UUBQ 2R93B 1F2MA 5C0XG 5EBCA 2NB0A 3PIPA 5GAEC 2R3ZA 3IAYA 2Z6BA 1H95A 1PFBA 1VCIA 4OWWB 1N33Q 2B8GA 1YJ9A 4DN4M 3W3AA 2E2DC 5C44G 1O7LA 1XNQL 2JA9A 1V9PA 1EU4A 3KF8B 4G7ZC 1K0SA 2OTLA 1A0IA 3I3CA 4GOPB 2FINB 3QWNA 3W2DA 5C0XH 1XJVA 1BQQT 4DUZQ 3TQYA 1RD9D 3T13A 1B1ZA 2KBNA 5LMNW 2L0CA 1QUQB 1ILQA 1IBMQ 1YHBA 4XDXA 3C1EA 4XQNA 1HJPA 5IE8A 5DM63 4PMCA 4A3IB 2UUCL 1QG7A 3KLSX 4BA1I 4YY3L 3S2DB 2B2YC 3Q24A 3CXCA 1KNAA 1B2TA 4FO2A 5AFWA 3NSWA 5FK9C 1PHJA 4RGTA 2EY2A 3AMUA 3J7A5 2RQXA 1EYCA 3TBIB 2DN8A 2JA8B 1ESRA 4ABNA 4LF7Q 2Q2IA 5H1SE 1FL0A 1I50B 3ERQA 3P75A 4K8IA 1SBBB 3NWTA 4DR2Q 2RVLA 2JEBI 2ZJRA 1S40A 1HA5A 2F4VL 4H44C 1Q90A 2E2IH 1XMOL 1AZQA 1SFOB 1AH9A 4DUYL 5EGTA 3C46A 3HGBA 3GTMH 3L3OC 1KLGD 1SNMA 1XTCD 3MEHA 2PZTA 2BE5C 2R93H 2NN6I 2D2CC 1V1OA 3MTSA 4MNOA 3S17B 5JJLA 2UUAQ 2K5QA 1PFSA 3FVQA 3GD7A 3NENA 3R93A 2O5JC 4JI7Q 3RR5A 4R4CA 5ELCA 2OT2A 4LFCQ 2NVTH 3TS0A 1SE8A 3TP8A 2FXQA 2ENBA 3SR1A 4DV1L 3S15H 3CHBD 4ME5A 1HNXQ 3QB3A 2E2JH 1B8AA 2JA7G 1QE6A 4CJ2C 4FF3A 2VY3A 2VUMH 1KXLA 1SMYD 2LXKA 4RHSA 5JEAG 3M3YH 2A74C 2MO1A 4DK0A 3BDLA 3E0EA 4APVA 2RHQB 1GOZA 3PGZA 2V1CC 1WYDA 1PYSB 1WI5A 3L7ZC 4I7ZC 4QMGA 1J5EL 1Z9FA 4A3EB 1Q7YC 1SE2A 4DV7L 2YYZA 2M9VA 4HEDA 4J1MA 4B3SL 2XNAC 1BCPD 3EVQA 3K59A 2B2VC 1GVPA 3LWUA 3NEMA 3G71A 3STBD 3J81c 1W6KA 4C2MB 2HT1A 4K5XA 4KN7C 5IOCA 1H9MA 1WJJA 5LL6S 3AEVA 1SFOH 4XIGS 4OEMB 1I4QA 1CQFA 2Q8IB 5JJIA 4AQYQ 4DU9A 1LO5D 3IKJA 1SLJA 2K52A 3M4OB 3VYSA 4HJ8A 1WTVA 1A62A 1O80A 1Q8IA 5C4JB 1I6VC 4OIJA 1E1TA 4B9WA 1Y1VH 1A2TA 4UP8A 4RWSC 1X55A 4B3MQ 1BCPF 1XPOA 4M8AA 5FOBB 5LMNL 2UUCQ 1EY9A 1HHVA 4UDUC 4TKOB 2EJGC 5C4ZA 4KN4C 4N8X1 1BCPC 3HOWB 2F0DA 2MO0A 2F52A 4LUVA 4B3SQ 4IALA 3CC2A 1HUMA 1IKMA 3FPUB 1G51A 2G9DA 1B3QA 3E6ZX 3P1HA 4DUYQ 5DLQE 3M3YB 4OL7A 2I46A 3T1YQ 1X3EA 3NWSA 3S1QH 2PMZE 3A5ZB 4K14A 3GO5A 4FXGC 4DK3C 1I6HB 4JOIC 2KHIA 2H4OA 1Y14B 5M5XH 1FJGL 5M3MG 4A3EH 1EY5A 1V43A 1VQJA 2UU9Q 3I55A 4FXKC 1B7YB 3BVMA 2YTXA 2MNAA 3BVGA 2O4XA 2WB1E 2F1MA 2D9UA 4KLKA 4HJ9A 4LNQA 1NMGA 1Y1WG 1LT4D 2EDGA 3CPFA 1WVLA 1ENCA 5HGQA 5I9OA 1CA6A 1SSOA 3T1HL 5CV9A 4V0BA 1WCMG 4IFDJ 3Q23A 4KKSA 4IUUA 4LF6Q 4ILWA 3CCQA 3F1ZA 4JBWA 1YNXA 3J81E 2E5LQ 4LJZC 5JPMC 3SGIA 1HH2P 2Q2HA 3CCUA 1JJGA 3VR4A 3HKZG 2UXCL 4F7XA 4X6AH 3FEWX 4LMQD 1EL0A 2M00A 4IJLA 3NQTA 5CC4A 1KRSA 4L5TA 1BF4A 4B3RL 2DNEA 1PH4A 2L55A 2OQ0A 4OWTB 1QVCA 3H94A 1JWUD 2K1BA 4DV4L 5DNFA 3S1MH 2IW3A 4HJAA 4XT1B 3OIPA 4JV5L 1D6EC 4YWKA 3S9WA 2K7VA 3MHBA 3D6CA 2FJ2A 5FLXc 1JB7A 1DXMA 3UDXA 4X62L 2F0QA 1WOCA 3BG3A 3H3VH 5GAGC 4R8NA 4OO1G 1U4LA 3CW2C 5FLXE 4KJNA 4LWCA 2PI2A 3VYUA 3TP6A 4NXNQ 2I07B 3PQIA 1IL2A 3ND8A 3J7AV 1NJIC 1HTPA 1PZKD 5E3FA 2RDFA 2SNSA 5AJ3L 3LGJA 3J80c 1XPRA 1IBLL 2R7ZB 2NVXB 4I7AA 2E76C 1NUCA 2Q2TA 3V96A 1C8CA 1N32L 2R92H 1X3FA 4ZLTF 2ZM6Q 1Q3LA 2AMCB 1JB3A 1PH3A 4IPCA 1S5ED 4GLAC 4PZ6A 3CQZH 1T5EA 1BDOA 1JJ2A 1DGSA 1SYBA 2IX1A 1UE6A 2R6GA 1S5DD 2OXPA 1QVGA 2F0EA 3D4WA 4PMWA 3G6EA 1V1PB 4OGQC 1KL9A 4XYOA 4HCSA 2PZUA 2V4DA 4DF7A 4BS9A 4OXPA 1JCKB 1NSNS 4C1NK 1GM5A 1HQRD 5JPNC 1MIUA 1ZXTA 1OO9B 2YU9B 2BH8A 3BU2A 1RF2D 3WOEA 1K28A 2XRSD 3FRPB 5D3IB 2ZXRA 3EFXD 4R1JA 4O0AA 3Q22A 1PLFA 2NYZD 4JW0A 1KTKA 1E0BA 1I4RA 3EIVA 1EY0A 3A55A 1BCPB 1NY4A 2HDLA 1TS3A 5IWAQ 4K6LA 1VQ8A 1XX8A 2E2JB 3OMGA 5IP9G 5FO8B 1RHPA 4KKUA 3FPPA 1EY4A 3JC66 1G8ZD 1U5KA 5K36H 1GUWA 2KEEA 1JOOA 3ITPA 2L12A 4WJWA 3TS2A 1B9MA 4X64L 5IT9c 4GLXA 3KDFB 2PNRC 4AH6A 5EAYA 2R7ZG 3KJPA 4DV6L 3GTJB 5C3WA 3OWEB 4QY7A 4L63B 3GP7A 5IY0A 5BR8L 3DMUA 3GTLH 1YZ6A 3KLWA 1H9RA 2XRQD 4DV2L 4A3MB 1MSHA 1AE3A 1LTBD 1WTOA 1HR0W 4GOPA 5IGFA 2IL8A 3G48A 1EQTA 4IPDA 2E74C 4CGYB 4HIDA 5IIFA 3S15B 1TS4A 2FFKB 4XQQA 3PF5A 5L37A 4B3RQ 2GVBA 3SK5A 4X65Q 2QA4A 1YHAA 3ND9A 1FNWA 4C3IB 1R9TH 1OXTA 2K5NA 5ELOA 2B2TC 3JAMc 4B3TL 2JA6B 4MIUA 2DGYA 1BBUA 1Y8PB 5ELNA 1IYUA 1SJHD 1S4ZA 2PPBC 2PW7A 3K5LA 4LAAA 3K7UC 2EYJA 2LS01 1DONA 2PCFB 1CQVA 1LT3D 3V2TA 3HOUB 3DHQA 3NTIA 2KECA 1F9PA 1EFID 3P7JA 5E4WC 1R4PB 2EJMA 1C0AA 1VQCA 2AWOA 2HD3A 3K57A 2LFNA 1F2ZA 3QJYA 5F2DA 1WTXA 3K81C 1TWCH 4WORA 5CV7A 2LSSA 3GTGB 2LMCB 3CC4A 3ULPA 1PH6A 3K58A 3DXJC 4BXXH 4RHRA 2NVYB 3V05A 5M3MB 2MJ8A 3O13A 1B3AA 1MD2D 4IPGA 2EIFA 2KHJA 3VR6A 3JAMi 1SYEA 1YNNC 2H5XA 1Y1VB 3I4NH 2SEBD 3KOJA 4DV6Q 2AKWB 2JA7H 1GHKA 3EJIA 3X3NA 3EBEA 2WB1G 1EWIA 2DJFC 1PZJD 2E2HH 2F0VA 2F0IA 4G7OC 1HXYD 4LF4Q 4FP5D 1E2WA 2CW0D 2A19A 4HSVA 1V1PA 1YJWA 1G6ZA 4MTKA 2R93G 4OO1H 4LF7L 4A3CH 1BKBA 1AE2A 2HDMA 4ZKCB 4U673 3R8BA 1E22A 4AYBE 1VQBA 4OHJA 3S1QB 2TMPA 1PDQA 2N55A 2R92G 2G9HD 1WTWA 4A3LH 5IGBA 2BDNA 2FHTA 2ZTCA 1O7ZA 2NN6G 2EYLA 4UPAA 3OW7A 1STHA 4K0KL 4QQBX 1A2UA 3BJUA 3L2PA 4IO9A 3NPPA 2WP8J 3HZXA 4IOAA 1MI2A 2RKSA 4C3HB 3CPWA 2F4VQ 4GKKQ 1Z6HA 2JA8H 3D6WA 1TWCB 1C9OA 5KNDA 2QKIC 2N8NA 2Z4HA 2EJFC 2JXMB 3U9SA 3KLRA 3RZOH 2EPBA 4TQUS 1EZ6A 3SK8A 1A3TA 3C2PA 3KUPA 2KCMA 2EY5A 3E9HA 2L9HA 1EIGA 2R7FA 3CQZB 2EYPA 2OWOA 3N52A 4BBSH 2YTYA 1KHIA 2JA7B 3NP8A 5E4XA 3HOVH 4IUQA 1CZGA 1TWGB 4PV1C 2F0HA 3W5OA 3BZKA 3BS1A 3S1NB 4ZUIA 2NVTB 1ZYRD 1B9NA 1JOQA 4K0KQ 3OSOA 3L0OA 4BY7B 2B2VA 4L8JA 4NDXA 3VR5A 5FLMG 3GTJH 4FDBA 3T53B 4R4TA 5JAVA 2CCZA 1I4HA 2EYHA 4LFAL 1LYLA 5M3FH 1UWVA 3NE5B 3R2TA 2D5DA 2EXDA 1A8VA 2OEOA 1H9SA 3HKZB 3VYTA 4C3IG 2JEAI 4A3MH 1EEFD 3MXPA 4CDFC 1PYBA 1LV9A 3ULJA 2JN4A 1GXDC 1SNDA 3GTQB 4YHHL 1VQEA 2K6AA 2VNUD 4A3CG 4DAYA 5KYLA 4DR3L 3H15A 1J9OA 1SEBD 4C2MH 2A6HC 1TQOA 4JI6L 3G4SA 3K5MA 1M8AA 1DZ1A 2Z9HA 3CCRA 4QCLA 4NB3A 1Y1WB 4A3IG 4KHPQ 3OHXC 2F0SA 4HIMA 5ELEA 1AW7A 4HIKA 4OONA 3A8JE 2D62A 4G4KA 3UE0A 3K0XA 5T1GA 2VW9A 2XWJB 3HOUH 1H9JA 4ZRZA 1Q1BA 3ONAB 1BBXC 1KQSA 3S1NH 3BZDB 1KDCA 4HJ5A 1YITA 1DM0B 2K03A 4KY6A 4KY5A 2F0OA 3U9OA 4MTNA 2R7ZH 4DGZA 1QCBD 4X65L 3KK7A 4C3HG 1D5MC 2VL6A 2Q8TA 3S2HH 2X69A 1U4RA 2QW7A 3LWEA 1BUVT 4N8FA 4YY3Q 3A56A 3I4NG 2VXWA 1QNUA 3HOWG 1B53A 2CHBD 4CKBA 4TVAB 1V8QA 3R2IA 2JA6H 4EQPA 1HA6A 1J6QA 3BYYB 4RAUC 3PUVA 2F0TA 3S16H 2ZJQA 4HMJA 5M5XB 1G91A 4IFDI 1IW7C 3H3VI 2E2HB 5CYUA 1RTOA 2RHSB 2B2UC 2C9OA 1YI2A 2AUJD 1HFNA 5TSSA 4TRDA 3I72A 4UAIA 3H0GH 5LMUL 2B2UA 2Z8LA 1HQMC 3TP7A 3DUZA 4BBSG 1HTLD 2N88A 3I91A 4JI1L 1LTID 2RDGA 1K0RA 1PH2A 1IBKL 1HCZA 2NN6H 3ERSX 3UDGA 5M3MH 4A3EG 1JT8A 3PV0A 2KUMA 1C48A 2AQ2B 2UUAL 2WINB 2IX3A 1Y1VG 2HHHQ 2RSNA 2J4XA 2WV6D 1DYQA 4RKLA 1RIPA 1TWAH 1QZGA 3ZJYC 4K2LA 4C3IH 4N9PA 4DR6L 3S14H 2AWNA 2VB3X 3G7LA 4CBVA 2K05A 1BOSA 1W2BA 4O1NA 1RJTA 4JCVE 3AYHB 3RZDB 3NTHA 1EWHA 4FNFA 3CF5A 1ZYRC 3OOCA 2F0WA 3S1RB 4IOCA 5M5YH 3URYA 1B44D 2N3SA 3H6MA 1PH9A 4G7HC 4Q5VA 2Z6KA 1NMFA 5CORA 3J7ZC 1IYVA 5C0XJ 3H3VC 2F3VA 4DV7Q 1AP0A 3PIOA 2D0OA 3HKSA 4X3SA 1XXGA 1VQKA 2BOSA 1OXXK 3NBIA 2F4IA 5CGKA 1IL8A 3HOXH 2ASBA 5IYCH 2JQOA 4MZ9A 1EEID 5EQ0A 4L5SA 2KEDA 4NW2A 3ZYYX 4EQOA 3GTOB 1K8MA 1L2FA 1EY7A 1M1KC 1HPCA 1DCZA 4JBKA 5COYA 5EKKA 1UNSA 4NKLA 5IWAL 2XVSA 2WAQB 2IHFA 2IWHA 5C4HA 4H0LC 1T9HA 1Y8NB 4A75A 1R9TB 1RTNA 5EBDA 3TZDA 1WTHA 2CWAA 3S2DH 3A74A 4ZUJA 1IYJB 3PUWA 1ET6A 1XWEA 5KEEA 1EOTA 4DUZL 5FLXL 2QEJC 5JVG3 3EA6A 4X3TA 3M7GA 3PSIA 3H91A 1MSGA 2Z1CA 5D14A 1XMQQ 1W3SA 3PUXA 1AN8A 4A3KH 2X6LA 4DA2A 5C5MA 4IFDH 4A93B 2CH4A 4JI2L 3A8KE 4OX9L 1ENAA 2ZJPA 2K5VA 3VA7A 1GO3E 2A1AA 4KK7A 1UAPA 2F0KA 2JYOA 5J3BA 3HS0C 1VQAA 4K2KA 1EQRA 1Z47A 2NUCA 3I90A 3OYYA 1B4OA 2ATWA 5CV4A 1YBYA 2VQEQ 3QOJA 4KY7A 3IL8A 1N34L 4GNXC 1VQ7A 3FKIG 4PZ8A 2QDLA 4FXDA 1TS5A 2A68C 4BY1H 2CFMA 1L0YB 5EKLA 3WDNA 3UDIA 4A3JG 5IGEA 3T1HQ 1BR9A 1VS0A 2B8FA 2P5ZX 4LF6L 2N78A 1X54A 4NXML 1I3QH 3I4OA 1STAA 3P20A 4FYDA 2MP1A 3S2HB 4KV6A 4PNYA 2VUMB 5HURA 4CHTB 2MHVA 1TR5A 3MFGA 4DV1Q 2N49A 1EY8A 1IZ6A 5HY6A 1Y1WH 1A63A 2WB1B 4A3DG 1LTLA 3TSSA 4DV4Q 3R3OA 1JE5A 1OXSC 1T5XD 1UEBA 1GKHA 2F3IA 1O78A 1STBA 2EYFA 3M4PA 1JR0D 4P72A 4JYAL 2B2WA 4J8QA 3U50C 3HOZG 2VQFL 1WTQA 1SR3A 1J5EQ 4A3DH 3KLSA 5GROA 5IGCA 4DV3Q 1LTRD 2NVQH 3K80C 2DNCA 5ELBA 2DJGC 4OO1I 1UE5A 4AYBG 4B9XA 3FHWA 4IPHA 1CKMA 2H1EA 5J1ZA 5CV6A 1PH7A 1EFWA 3DWPA 4DKAC 1HZCA 3HOUG 1JE4A 1B50A 1BXTA 1QWYA 2EOTA 2EYMA 5JEAH 4QB4A 4BA2I 1EYAA 1O7YA 2E8GA 3NELA 4JI2Q 1JORA 3OTOQ 3ER0A 4KHVA 3MXUA 2LXJA 2B29A 4XT3B 4LF4L 3MXNB 3S14B 1KAWA 1PTOH 3PUZA 4X3KA 2HQLA 1VQ6A 2JA5B 1TS2A 3T1YL 2A6EC 3EQLC 4AQYL 2RCFA 4A3FG 1I50H 2EY6A 1A6XA 1YNJD 2K5DA 4JI0L 4B3TQ 1HUNA 3BDCA 1QUQA 4JI1Q 2Q2UA 3QIAA 3PO3H 2E2IB 3TZUA 4BY7H 3PF4A 1HNZL 5CBAE 1Q12A 2KCTA 2ZM6L 1U0LA 2WIIB 4HSPA 1WCMB 1IHZA 2A73B 2ZT9C 2AQ1B 4A3MG 1H9KA 2J7ZA 5J22A 3U4VA 3D0FA 4RCOA 1PRTC 1CSPA 3TREA 2RDHA 4Z9CB 3E3XA 1YEZA 2AQ3B 4DV5L 5C44H 3GTOH 2HQEA 4LW1A 1Z7TA 1PA6A 5FKAC 4JPBW 4QUFA 5C3XA 3GTQH 4BY1G 4XTCS 3NBHA 3EN2A 1DOKA 3KBGA 1TKWB 2C35B 1SNOA 4HAEA 2Y0SE 1VQOA 5FJ8H 4G57A 3VDYA 1M90C 2RBMA 1OTCA 1QNKA 1SNPA 4RGMA 2KENA 4DR1Q 3S1RH 1CKOA 5ISRA 2J0TD 2VB2X 1G291 2QDBA 4X64Q 1ASZA 4KJOA 1BNZA 4CDCC 3C3LA 1NE3A 1CKNB 3NXWA 4EGVA 3CKIB 4ME3A 4YCUA 1Q82C 4F87A 3OWFA 2UXCQ 5FLMH 4KD4A 3KJOA 3I8ZA 4KMUC 3RLNA 5C4XH 1HNWQ 1SMYC 3HOYH 3A7LA 2JE6I 3LNNA 1PZID 4LFAQ 3T4AC 1VQNA 3PO3B 1SN8A 1QJOA 3OMCA 2XWBB 2F0JA 3HOVB 5C5LA 3KFUA 5CMDA 1K8OA 1EZ8A 4GN3B 3T16A 3RZDH 3MEFA 1KDBA 3RUZA 5BR8Q 1EQQA 1N33L 2CH4W 3MAQA 1UE1A 4C3JH 1FNVA 2MQHA 1RKNA 3Q6SA 5JOBA 1QB5D 1LTTD 3S16B 5IYBH 4P75A 5I6YA 3IFTA 4BWGB 2L15A 5IT9L 3X3MA 4BBRH 1GUSA 1MJCA 3NQIA 5D3DA 2EE1A 1X3QA 4H13C 4KHZA 4YHHQ 4DK6C 5M3FB 1KC8C 3F2DA 2OQKA 4OX9Q 3A0JA 1Q81C 3DWAA 1VQMA 5ELFA 3I4MH 2L11A 5FO7B 1PTOC 3NUCA 2Y0SB 3PMFA 4A3KG 2F0GA 1RODA 2BH2A 1I6HH 2F0UA 3M4OH 5GAHC 1K3BC 4LF9Q 4L5QA 1PFMA 1Y69U 3U4ZA 4UP9A 2RA4A 3I2ZA 3MZ5A 4JI4Q 4YWMA 4ZKBB 4C1NI 2KJXA 1K83H 1ML0D 3HOYB 4DR7Q 2IPKD 1IBML 4BXXG 3HKZE 2BA0A 3F2UA 3HOWH 2HIXA 1F9SA 2JK8A 3D4DA 4HCEA 3DM1A 1D5XC 3RMHA 1SMXA 3BZCA 2YTVA 3GTKH 2ICEC 3BVZA 4K6DA 1NTGA 2PQAA 2F0LA 2JJQA 5IYBG 2L4NA 3D4RA 2IX0A 4IZ8A 2XN9C 2K4KA 2WKDA 3Q0AA 4HTHA 4GN5A 4C3JB 1S3OA 4L5RC 4Y52H 1TY2A 3CRKC 1YNND 4LUOA 3MVVA 3H0GG 2JA8G 3CMAA 1KD1C 2JA5H 2MPMA 4A3GH 1IBLQ 4NP5A 1KIXA 4FF4A 4WFN3 1KAAA 1A3UA 2CWPA 4RKBA 3AQQA 5C3EH 3NTKA 1KDAA 1N9WA 1VMCA 4E6IA 4QUCA 1RCVD 4BY1B 2L1BA 3A7AB 4PZ7A 1HZAA 1BBWA 1SXTA 2GVAA 3GV3A 4LF5Q 3MWYW 3HFZB 5KYIA 4IUPA 2OCEA 2CVRA 1CTMA 4CJ0B 3MA2B 3H0GB 1TIID 1EYGA 2VQFQ 1D2BA 4DV0Q 5IP7G 3D8GA 1HR0Q 3D3RA 4IUVA 4HIOA 2KVMA 1G2SA 1PMRA 1I4XA 1JMCA 4FF1A 1DJRD 2QCPX 5E1FA 4JI0Q 1SYGA 1TT2A 3RLOA 1Q46A 1Y8OB 4POFA 1FGUA 2KA7A 3DM3A 1PV4A 5KGUA 4R9WA 4B3ML 2VZAA 2G5DA 2UXBL 2ZXOA 4GNXB 2Z6KC 3MXGA 3PO2H 3KF6A 4KD3A 4A3BB 4AIMA 5KIXA 1L1OA 1EQVA 4RGOS 2B63B 2O2LD 4QF4A 4JI4L 5I2XA 4A3JH 1GUNA 1L0XB 1MGSA 5A2QL 2Z4IA 4K5VA 1STNA 2RF4A 2QF7A 4JK1C 4GOPC 1KNEA 2IY5B 2MUYA 1XNRL 4R4OA 4DNRB 4Y7NB 5EPJA 1LM0A 1JWMD 1U9RA 3C1FA 1D7QA 3TP5A 1M4VA 1CSQA 4RA8A 1FVIA 4OIKA 3FDTA 2WKCA 4F88A 4DR6Q 5M3FG 1YHQA 3J81j 1PRTD 3UE1A 5IP9H 2PQEA 1SE4A 3I73A 3HOXB 3ICEA 1FYCA 4RG1A 2MGSA 4ID6A 1SRUA 4DR2L 2F0MA 4KHPL 5C3EG 2IJ0A 1PTOD 4MN3A 2ID0A 4L6TB 4JI5Q 4LF8L 4ALPA 1PXUA 1XMQL 2SDFA 5G3LF 3AFQA 4DNIA 2KCCA 4B08A 1SAPA 2XSCA 3PCOB 3PO2G 4NXMQ 3LX0A 5ELDA 4BBRB 2VUMG 5DM73 4A4IA 2EXZA 3HRZC 1SYCA 4J6HA 1JC7A 3QG1A 2A69D 4JI8Q 4A3BH 4LFCL 5JVH3 1CI3M 1VQ5A 1N34Q 4X66L 3UDFA 3B6YA 2K14A 5G3LD 5J39A 4RGNA 1LUZA 5EPKA 4GNXA 1YJNA 4R4IA 1N32Q 1PTOF 2ZTDA 4ZYSA 3QO2A 3KYHC 3W1GA 2JSOA 4DV0L 1F9RA 5I9PA 4C56C 1PRTB 4JVZA 1PRTF 1UEAB 2HCCA 4R4QA 1CFMA 5A2QE 1IW7D 3M85A 1TXYA 4IUNA 1PTOB 2B2YA 1X6OA 2NBFA 2PNHA 4WRDA 3TDQA 1C4QA 1LTGD 4UY8C 2NWGA 1P16A 4PG3A 5AJ3Q 3TRZA 4A93G 4YCWA 3HP3A 3A54A 3CCVA 1SJED 1K73C 3RD4A 1VQ9A 4FVMA 2RSOA 1AEXA 2YV5A 3FKIH 4DPGA 2K5HA 1MHWC 4IQZA 5IGDA 2K75A 1VQGA 1TU2B 4JV5Q 1UUPA 5IYDG 1HZBA 2UXDQ 2K33A 2AHOB 1CKNA 1QVFA 2B2WC 2Q8RE 3RN5A 3GTGH 1NCVA 1BVSA 3VA5A 1ICWA 2E75C 2PYKA 2QGQA 3W1BA 3MXNA 4WJ4A 3CCMA 2WACA 3HEJA 4DNTB 3K7AH 2EZVA 1HFGA 5C44B 4Q0FA 3VR3A 1K83B 3DLLA 2VQEL 1Q1EA 5D65A 4QL5A 3K5NA 3M9BA 2F0PA 1ZEQX 4ODGA 1WTRA 2XTIA 2LY7A 2KOLA 1TY0A 1D8LA 5BN4A 4XQJA 4KKTA 1MBYA 3HG9A 2JA5G 2A8VA 2K32A 1EIYB 3SK6A 2YU9H 1X9NA 4GN4B 3PIP3 4LFBL 1OXVA 1STEA 3JAML 1I94Q 4ZQ3A 1JICA 2K50A 2A6HD 4EVOA 2E5LL 1VQDA 4DAPA 2NVYH 4GKJL 2A6ED 1E2VA 2WFWA 2ALYB 2BCOA 1N36Q 3NBHB 3STBC 4OELB 2Y0SG 1L0WA 1D1KA 4EX5A 1XPUA 3PO2B 1GHJA 5C3EB 1TWFH 5IGGA 2HHHL 3WWVA 3F2BA 3HOXG 5CV5A 1XMOQ 2HIVA 1E7ZA 1S5BD 3CRLC 3CCEA 2F0FA 1SNQA 4RCNA 4LF8Q 1PH1A 2FMMA 5KRUA 3HOZB 3UI2A 4DXFA 1VQ4A 3RZOB 2QILA 4QJFA 3GTKB 1NBWA 3KBXA 1YIJA 3IFDA 1I4GA 4Y7NH 2B2TA 1S72A 4A3LG 1ESFA 4R8IA 3GQBA 3SE0A 4ZCKA 2SOBA 5KNBA 2CQOA 4ZAIA 4ULLA 1CHPD 4I65A 3N6RA 1K8AC 3QR8A 1JJCB 1WCMH 1J8IA 1A3VA 1CZWA 1BO0A 5GADC 4S3SA 1CT1D 2DUDA 4CJ1B 4QGUA 1TWHB 2K04A 3A5UA 2EVBA 3RN2A 1NR2A 1WTPA 3SK4A 3D31A 5DEHA 3I4MB 3J81L 4LF5L 1ICFB 3CMEA 4A3JB 1QILA 3M4QA 2DY7A 4DAVA 4H02A 1KABA 3J81i 3T56B 1QZHA 1HNZQ 1O7IA 2C5CA 4J15A 2B63G 4XXEA 1LTSD 2TSSA 1PH8A 2ZXPA 1QOHA 2I5LX 2ES2A 4JOIA 2OF1A 2ZTEA 3RLFA 4MHEA 2UXBQ 4LK1C 4JI3Q 1LACA 4CDEC 1W6JA 3FP9A 2NZ1D 1VMPA 3SDZA 1VQPA 1ASYA 2NTTA 1TWAB 4K5WA 1I94L 3E5SA 3GTPH 5IODA 4HJ7A 1TWGH 1VF7A 5C4XB 4PMBA 1STYA 3KF8A 3CCJA 1LT6D 1TVXA 2KHSA 1VQLA 3OPOA 2I5MX 1FJGQ 4HN7A 1E2ZA 3T51B 3BDOA 1JWSD 4IN3A 5M5WH 1PFNA 2BDOA 1XTDA 4LFBQ 4A3GB 1EIFA 1F2LA 4DXGA 3DEPA 1LT5D 3F2CA 3VYRA 1VQIA 1XYIA 5JEAJ 2K5WA 1K3RA 2FMCA 4A76A 2VS1A 5FJ8G 2RCNA 1SYDA 2EQSA 2X6GA 5I6WA 3DWQA 2B3GA 5EKIA 1E1OA 5JJZA 3CD6A 4C3JG 4DK1A 4DFAA 1CA5A 5LMNQ 4XYQA 2DY8A 5K36G 1KRTA 4A3FB 3VR2A 3I4LA 2D0PA 4RMFA 1EY6A 4GS3A 2O5IC 1RL2A 4EQ5A 5LL6X 4A3IH 4F8MA 3SVMA 3GDEA 3GV6A 5C0XI 3KDFA 2UU9L 1GJXA 5FO9B 4JYAQ 4LF9L 4TSSA 1JOKA 2Z0SA 3L9AX 5DAUA 2PI2E 4DR5L 4BY7G 1F9QA 3HOYG 1ZKOA 4V190 2OTJA 3I7FA 3MC0B 2IHEA 1X3PA 2NTSA 2ICIA 4AYBB 2EY1A 3OIQA 1FNUA 4DV3L 1PYWD 5M9OA 1Q8KA 1EWCA 1S5FD 2K28A 3A8IE 1EYDA 3E0JA 4U68A 4IURA 3EROA 4C3HH 4A3KB 4P71A 3I56A 2NZHA 5T1IA 3M4YA 2CKZB 1V1QA 2R7DA 1GD7A 3S1MB 1STGA 2LKVA 1ENFA 3AFPA 3OTOL 5IYDH 5E7NA 3OW2A 3U58A 2WAQE 2AUKA 3K7AB 1PVOA 2A5HA 4RFBA 5LHY1 2QEXA 1R4QB 1JQYD 1MJEA 4GKKL 5IT9E 3PIO3 4DV5Q 4HR7B 3J80i 4H7BA 4M1UB 1C7YA 1YNJC 2BE5D 4BBSB 1ET9A 1II3A 1HR0L 4EQNA 4DR4Q 2F3WA 1FR3A 3HOVG 1UE7A 1X32A 4JBJA 3QOLA 1DOMA 3RNUA 3K5OA 2SNMA 3F8TA 3ULLA 4QIWB 4KI0A 2NVXH 5K5PA 3Q8DA
chains in the Genus database with same CATH topology
5IP7G 3TEHB 5GAGC 1HR0Q 4NPSA 3PO3G 3CW2C 4OO1G 4HIOA 1TWAH 1QZGA 4A3BG 4LWCA 3ZJYC 2PI2A 4C3IH 3KF6B 4IFDG 1JMCA 4NXNQ 3S14H 4DR6L 2AWNA 1W2BA 1IL2A 4JI3L 4JI0Q 4JCVE 3AYHB 3RLOA 1NJIC 1TWHH 5GQOA 1Q46A 4POFA 5AJ3L 1IXRA 1FGUA 3LGJA 3J80c 3DM3A 3CF5A 1XPRA 1PV4A 1IBLL 1HNWL 2XGTA 2VZAA 4B3ML 1I5FA 4GNXB 3S17H 2UXBL 2Z6KC 3PO2H 2Q2TA 3KF6A 4IOCA 4JC0A 1SROA 1N32L 5M5YH 4AIMA 1L1OA 4P74A 1PH5A 1X3FA 2R92H 5LMUQ 4JI4L 2ZM6Q 2N3SA 1PH9A 2AMCB 4A3JH 1PH3A 4IPCA 1N8RC 4A3GG 2Z6KA 1NMFA 3J7ZC 4GLAC 5C0XJ 4PZ6A 3K8AA 1EOVA 3CQZH 4DV7Q 3PIOA 2D0OA 1G6PA 2RF4A 3HKSA 1JJ2A 1DGSA 1VQKA 1OXXK 2IX1A 4GOPC 2IY5B 4JI8L 1UE6A 2R6GA 3HOXH 4R4OA 1XNRL 2ASBA 5IYCH 1CUKA 1N36L 2JQOA 2PQAB 4MZ9A 4PMWA 3G6EA 1QVGA 4X66Q 1KL9A 3CP0A 1LM0A 5C4XG 4L5SA 2B63H 4OXPA 4YCVA 1OXUA 2UUBL 1GM5A 1L2FA 1XNRQ 1D7QA 1MIUA 1M1KC 4DR5Q 4DAMA 2BH8A 1CSQA 3BU2A 1FVIA 1X56A 4YWLA 3CCLA 4DR3Q 4JBKA 4X62Q 4NXNL 4DR6Q 5IWAL 1YVCA 4R1JA 5M3FG 1YHQA 4O0AA 3J81j 3UE1A 2WAQG 5IP9H 1XNQQ 2I5HA 2IHFA 3ICEA 4JI5L 3E9IA 4RG1A 1L1OB 1SRUA 4DAYB 1T9HA 4DR2L 4KHPL 5C3EG 4A75A 3EIVA 2ID0A 4JI5Q 2BA1A 4ALPA 4LF8L 1NY4A 4O2DA 1XMQL 5JJKA 3IRBA 2CWAA 3S2DH 3AFQA 5IWAQ 3A74A 4DNIA 1IYJB 1VQ8A 3PUWA 1B70B 3PCOB 2JA6G 1X65A 1E24A 3PO2G 4DUZL 5IP9G 4NXMQ 4GLVB 4OWXB 3JC66 3PSIA 3I4MG 2VUMG 2MFIA 1U5KA 1HZ9A 3HOZH 1XMQQ 1W3SA 4A4IA 3PUXA 4IJHA 5C4JH 4A3KH 4DV0Q 3TS2A 4P73A 3S24A 4JI8Q 3CCSA 4JI2L 4X64L 4A3BH 5IT9c 4LFCL 2UXDL 4OX9L 4GLXA 4POGA 3KDFB 1VQ5A 1N34Q 5IP7H 4BBRG 2K5VA 2ZJPA 4AH6A 1GO3E 2A1AA 4X66L 1IBKQ 5EAYA 5J3BA 3UDFA 2R7ZG 3KJPA 4DV6L 3CAMA 4QY7A 3B6YA 2K14A 1VQAA 1LUZA 1EUJA 1EQRA 1Z47A 4UP7A 5IY0A 5BR8L 3CC7A 3GTLH 4DR4L 3OYYA 4GNXA 1YZ6A 1YJNA 1MKHA 1VQHA 4R4IA 1N32Q 3KLWA 1L1OC 2ZTDA 5IYCG 3KYHC 2ATWA 3W1GA 4WJ3M 4DV0L 1YBYA 2VQEQ 4DV2L 4A93H 1N34L 4GNXC 1VQ7A 3FKIG 4PZ8A 1AE3A 4BY1H 2CFMA 1HR0W 4R4QA 3M85A 1TXYA 3UDIA 4GOPA 1X6OA 2PNHA 3G48A 3T1HQ 4A3JG 4IPDA 1VS0A 4UY8C 4LF6L 2N78A 1P16A 1VQFA 4PG3A 5AJ3Q 4HIDA 3TRZA 1X54A 4NXML 4A93G 4YCWA 1I3QH 3I4OA 3CCVA 3PF5A 2NZOA 1K73C 4B3RQ 2GVBA 1VQ9A 4X65Q 4DPGA 2YV5A 3FKIH 2QA4A 2I0QA 2K5HA 1YHAA 1Q86C 2K75A 1VQGA 4DV1Q 2N49A 1OXTA 2K5NA 1R9TH 4JV5Q 5ELOA 1IZ6A 5IYDG 1C0AA 5HY6A 1Y1WH 1A63A 1HZBA 4A3DG 1LTLA 2UXDQ 1E3PA 3JAMc 2AHOB 4B3TL 4DV4Q 3M7NA 1CKNA 1JE5A 1P8LA 1OXSC 2DGYA 1UEBA 3PUYA 3RN5A 4A3FH 1BBUA 1GKHA 2F3IA 3GTGH 1X3GA 5ELNA 4GKJQ 1BVSA 2QGQA 3K7UC 3M4PA 3W1BA 4DR1L 1HNXL 4JBMA 4WJ4A 4P72A 4JYAL 3CCMA 3U50C 3HOZG 3K7AH 1K8GA 4JI6Q 2VQFL 3DLLA 2VQEL 2IT1A 4QIWE 1SR3A 1VQCA 1WFQA 1Q1EA 2AWOA 4DV2Q 1K9MC 1J5EQ 2GN5A 4QL5A 4LUZA 4A3DH 3M9BA 4JG2A 5GROA 4JI7L 2UUBQ 3K81C 1TWCH 2XTIA 5C0XG 3H3VH 4DV3Q 2NVQH 2LSSA 3K80C 3PIPA 5GAEC 3CC4A 3ULPA 1PH6A 1H95A 1VCIA 4BXXH 1D8LA 4OO1I 4OWWB 1UE5A 4AYBG 1N33Q 1YJ9A 3FHWA 4IPHA 1CKMA 5C44G 1PH7A 1EFWA 4IPGA 2EIFA 2KHJA 1XNQL 2JA9A 2JA5G 1V9PA 3KF8B 3JAMi 2A8VA 1EIYB 4DKAC 1HZCA 1A0IA 2H5XA 2OTLA 2YU9H 4GOPB 1X9NA 3HOUG 4GN4B 3I4NH 3KOJA 4LFBL 1OXVA 4DV6Q 1XJVA 1I94Q 4BA2I 2AKWB 2E8GA 3NELA 4DUZQ 2JA7H 4JI2Q 3OTOQ 3TQYA 2K50A 3ER0A 2LXJA 3EBEA 2B29A 2E5LL 4LF4L 2WB1G 2KBNA 1KAWA 3MXNB 5LMNW 1VQDA 1EWIA 3PUZA 1QUQB 2HQLA 2NVYH 2E2HH 3T1YL 1YHBA 1IBMQ 1VQ6A 2WFWA 4AQYL 4GKJL 1HJPA 5IE8A 4A3FG 2ALYB 1I50H 1N36Q 4JI0L 4LF4Q 4B3TQ 3NBHB 3STBC 2Y0SG 1L0WA 2UUCL 4BA1I 4EX5A 1QUQA 2A19A 4YY3L 1XPUA 4JI1Q 1TWFH 2Q2UA 3CXCA 1YJWA 2R93G 3PO3H 4LF7L 4A3CH 2HHHL 1BKBA 4BY7H 1AE2A 3WWVA 3F2BA 1PHJA 1HNZL 3PF4A 1E22A 4AYBE 3HOXG 3J7A5 1XMOQ 1VQBA 1Q12A 2HIVA 1E7ZA 2KCTA 2ZM6L 1U0LA 3CCEA 4LF7Q 2Q2IA 5H1SE 2R92G 4LF8Q 1FL0A 1PH1A 4A3LH 4A3MG 1VQ4A 2ZTCA 2NN6G 4QJFA 4UPAA 3D0FA 3U4VA 4K0KL 4DR2Q 4QQBX 1CSPA 1NBWA 3TREA 1YIJA 4Y7NH 3BJUA 1S72A 2JEBI 3L2PA 1YEZA 2ZJRA 4IO9A 1S40A 2F4VL 4A3LG 4DV5L 5C44H 2E2IH 2WP8J 2CQOA 1XMOL 3GTOH 4LW1A 1AH9A 4DUYL 4IOAA 3GTMH 1PA6A 3CPWA 3GTQH 1K8AC 2F4VQ 4BY1G 4XTCS 1JJCB 4GKKQ 1WCMH 2JA8H 2C35B 3EN2A 2R93H 5GADC 3A5UA 2NN6I 2DUDA 2Y0SE 1C9OA 4QGUA 5FJ8H 1VQOA 2N8NA 3RN2A 3VDYA 1M90C 3RZOH 4TQUS 1OTCA 3D31A 4MNOA 5JJLA 2UUAQ 2KENA 4DR1Q 3S1RH 1CKOA 1PFSA 3GD7A 3NENA 4JI7Q 3RR5A 4R4CA 1G291 4LF5L 2KCMA 3CMEA 3E9HA 4LFCQ 2NVTH 3M4QA 4X64Q 1QVFA 1ASZA 3TS0A 4H02A 2R7FA 1SE8A 3J81i 2FXQA 2OWOA 1QZHA 1HNZQ 4DV1L 1NE3A 1CKNB 4BBSH 2YTYA 1O7IA 3S15H 4J15A 2B63G 1KHIA 4ME3A 1HNXQ 4YCUA 1PH8A 1Q82C 2E2JH 3HOVH 1B8AA 2I5LX 5FLMH 2ES2A 2UXCQ 4JOIA 3KJOA 2JA7G 2ZTEA 3RLFA 2VY3A 2VUMH 1KXLA 3RLNA 3W5OA 4DR7L 5C4XH 3BZKA 1HNWQ 2LXKA 5JEAG 2UXBQ 3HOYH 2MO1A 3M3YH 4JI3Q 3E0EA 4APVA 2RHQB 2JE6I 3FP9A 3PGZA 2V1CC 1WYDA 1PYSB 4LFAQ 4K0KQ 1VQPA 1WI5A 1ASYA 3L7ZC 1VQNA 3L0OA 1J5EL 1Z9FA 1Q7YC 1SN8A 1I94L 5FLMG 4DV7L 3GTPH 2YYZA 3KFUA 3GTJH 4HJ7A 1TWGH 4B3SL 4GN3B 4FDBA 3RZDH 3MEFA 4R4TA 1GVPA 3NEMA 5BR8Q 3G71A 3STBD 3CCJA 1EQQA 2CCZA 3J81c 1N33L 4LFAL 1LYLA 1UE1A 4C3JH 1UWVA 5M3FH 1VQLA 2I5MX 2EXDA 1FJGQ 2HT1A 1A8VA 2JEAI 2MQHA 4A3MH 1WJJA 1PYBA 5IYBH 3AEVA 5M5WH 4P75A 1SFOH 4XIGS 3ULJA 1XTDA 4LFBQ 5JJIA 4AQYQ 2L15A 4YHHL 1VQEA 1SLJA 1EIFA 4BBRH 2K52A 2VNUD 4A3CG 3F2CA 1MJCA 1VQIA 5JEAJ 4HJ8A 4DR3L 1K3RA 3H15A 1A62A 4KHZA 4YHHQ 4A76A 1E1TA 4DK6C 4C2MH 1KC8C 1Y1VH 2VS1A 4UP8A 3F2DA 4JI6L 1X55A 2OQKA 4OX9Q 3G4SA 5FJ8G 4B3MQ 2RCNA 3A0JA 1XPOA 1Q81C 2EQSA 5LMNL 1VQMA 2UUCQ 3I4MH 2B3GA 1E1OA 3CCRA 4NB3A 3CD6A 4A3IG 4A3KG 4KHPQ 5LMNQ 4HIMA 2BH2A 1I6HH 3M4OH 1KRTA 5K36G 4HIKA 5GAHC 4OONA 2D0PA 4RMFA 2MO0A 2F52A 4GS3A 4LUVA 4B3SQ 1RL2A 4EQ5A 2D62A 4A3IH 4LF9Q 4L5QA 3UE0A 3K0XA 3U4ZA 4UP9A 3GDEA 2VW9A 3CC2A 3HOUH 5C0XI 3KDFA 2UU9L 1G51A 3I2ZA 4JI4Q 1Q1BA 4YWMA 4DUYQ 4JYAQ 4LF9L 5DLQE 1K83H 1KQSA 3S1NH 4DR7Q 2Z0SA 3T1YQ 1X3EA 1IBML 4BXXG 2PI2E 3HKZE 3S1QH 2PMZE 3A5ZB 3GO5A 4HJ5A 2BA0A 4DK3C 4DR5L 1YITA 4BY7G 3HOYG 3HOWH 2HIXA 4JOIC 2OTJA 2KHIA 3I7FA 2IHEA 2JK8A 1Y14B 5M5XH 1FJGL 5M3MG 4A3EH 1V43A 4MTNA 1SMXA 1VQJA 3BZCA 2YTVA 4DV3L 2UU9Q 2R7ZH 3I55A 3GTKH 4X65L 1B7YB 2YTXA 1NTGA 1Q8KA 2VL6A 2MNAA 2PQAA 2JJQA 3S2HH 5IYBG 2WB1E 2IX0A 4YY3Q 2K4KA 3I4NG 3HOWG 4KLKA 4HJ9A 4LNQA 4C3HH 1NMGA 4P71A 4GN5A 1Y1WG 4TVAB 2JA6H 3CPFA 1S3OA 3I56A 1J6QA 4L5RC 4Y52H 5HGQA 3PUVA 2NZHA 3S16H 2ZJQA 2CKZB 3T1HL 4LUOA 1V1QA 4IFDI 2R7DA 3H0GG 1WCMG 2JA8G 4IFDJ 1GD7A 3H3VI 4LF6Q 3AFPA 3OTOL 3CMAA 1KD1C 2JA5H 3CCQA 5IYDH 3F1ZA 4JBWA 1YNXA 5E7NA 3OW2A 2E5LQ 4A3GH 1IBLQ 3CCUA 2WAQE 1HH2P 2Q2HA 2RHSB 3SGIA 3U58A 1PVOA 1JJGA 1YI2A 1KIXA 3HKZG 2UXCL 2QEXA 1MJEA 4GKKL 4X6AH 4DV5Q 3H0GH 4IJLA 2CWPA 3J80i 5LMUL 3AQQA 1C7YA 1KRSA 4L5TA 5C3EH 4B3RL 1N9WA 1PH4A 4BBSG 2OQ0A 4JI1L 4OWTB 1QVCA 1HR0L 4DV4L 4DR4Q 4PZ7A 1K0RA 1PH2A 3HOVG 3S1MH 1HZAA 2GVAA 1BBWA 1UE7A 4HJAA 1IBKL 4LF5Q 3ERSX 3UDGA 3HFZB 4JBJA 5M3MH 4A3EG 4JV5L 1JT8A 4YWKA 3PV0A 2OCEA 3RNUA 3F8TA 3ULLA 2UUAL 4KI0A 1Y1VG 5FLXc 1JB7A 3UDXA 2HHHQ 2NVXH 4X62L 1WOCA 1EYGA 2VQFQ 3Q8DA 1RIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 G;  3TEH B;  5GAG C;  1HR0 Q;  4NPS A;  3PO3 G;  3CW2 C;  4OO1 G;  4HIO A;  1TWA H;  1QZG A;  4A3B G;  4LWC A;  3ZJY C;  2PI2 A;  4C3I H;  3KF6 B;  4IFD G;  1JMC A;  4NXN Q;  3S14 H;  4DR6 L;  2AWN A;  1W2B A;  1IL2 A;  4JI3 L;  4JI0 Q;  4JCV E;  3AYH B;  3RLO A;  1NJI C;  1TWH H;  5GQO A;  1Q46 A;  4POF A;  5AJ3 L;  1IXR A;  1FGU A;  3LGJ A;  3J80 c;  3DM3 A;  3CF5 A;  1XPR A;  1PV4 A;  1IBL L;  1HNW L;  2XGT A;  2VZA A;  4B3M L;  1I5F A;  4GNX B;  3S17 H;  2UXB L;  2Z6K C;  3PO2 H;  2Q2T A;  3KF6 A;  4IOC A;  4JC0 A;  1SRO A;  1N32 L;  5M5Y H;  4AIM A;  1L1O A;  4P74 A;  1PH5 A;  1X3F A;  2R92 H;  5LMU Q;  4JI4 L;  2ZM6 Q;  2N3S A;  1PH9 A;  2AMC B;  4A3J H;  1PH3 A;  4IPC A;  1N8R C;  4A3G G;  2Z6K A;  1NMF A;  3J7Z C;  4GLA C;  5C0X J;  4PZ6 A;  3K8A A;  1EOV A;  3CQZ H;  4DV7 Q;  3PIO A;  2D0O A;  1G6P A;  2RF4 A;  3HKS A;  1JJ2 A;  1DGS A;  1VQK A;  1OXX K;  2IX1 A;  4GOP C;  2IY5 B;  4JI8 L;  1UE6 A;  2R6G A;  3HOX H;  4R4O A;  1XNR L;  2ASB A;  5IYC H;  1CUK A;  1N36 L;  2JQO A;  2PQA B;  4MZ9 A;  4PMW A;  3G6E A;  1QVG A;  4X66 Q;  1KL9 A;  3CP0 A;  1LM0 A;  5C4X G;  4L5S A;  2B63 H;  4OXP A;  4YCV A;  1OXU A;  2UUB L;  1GM5 A;  1L2F A;  1XNR Q;  1D7Q A;  1MIU A;  1M1K C;  4DR5 Q;  4DAM A;  2BH8 A;  1CSQ A;  3BU2 A;  1FVI A;  1X56 A;  4YWL A;  3CCL A;  4DR3 Q;  4JBK A;  4X62 Q;  4NXN L;  4DR6 Q;  5IWA L;  1YVC A;  4R1J A;  5M3F G;  1YHQ A;  4O0A A;  3J81 j;  3UE1 A;  2WAQ G;  5IP9 H;  1XNQ Q;  2I5H A;  2IHF A;  3ICE A;  4JI5 L;  3E9I A;  4RG1 A;  1L1O B;  1SRU A;  4DAY B;  1T9H A;  4DR2 L;  4KHP L;  5C3E G;  4A75 A;  3EIV A;  2ID0 A;  4JI5 Q;  2BA1 A;  4ALP A;  4LF8 L;  1NY4 A;  4O2D A;  1XMQ L;  5JJK A;  3IRB A;  2CWA A;  3S2D H;  3AFQ A;  5IWA Q;  3A74 A;  4DNI A;  1IYJ B;  1VQ8 A;  3PUW A;  1B70 B;  3PCO B;  2JA6 G;  1X65 A;  1E24 A;  3PO2 G;  4DUZ L;  5IP9 G;  4NXM Q;  4GLV B;  4OWX B;  3JC6 6;  3PSI A;  3I4M G;  2VUM G;  2MFI A;  1U5K A;  1HZ9 A;  3HOZ H;  1XMQ Q;  1W3S A;  4A4I A;  3PUX A;  4IJH A;  5C4J H;  4A3K H;  4DV0 Q;  3TS2 A;  4P73 A;  3S24 A;  4JI8 Q;  3CCS A;  4JI2 L;  4X64 L;  4A3B H;  5IT9 c;  4LFC L;  2UXD L;  4OX9 L;  4GLX A;  4POG A;  3KDF B;  1VQ5 A;  1N34 Q;  5IP7 H;  4BBR G;  2K5V A;  2ZJP A;  4AH6 A;  1GO3 E;  2A1A A;  4X66 L;  1IBK Q;  5EAY A;  5J3B A;  3UDF A;  2R7Z G;  3KJP A;  4DV6 L;  3CAM A;  4QY7 A;  3B6Y A;  2K14 A;  1VQA A;  1LUZ A;  1EUJ A;  1EQR A;  1Z47 A;  4UP7 A;  5IY0 A;  5BR8 L;  3CC7 A;  3GTL H;  4DR4 L;  3OYY A;  4GNX A;  1YZ6 A;  1YJN A;  1MKH A;  1VQH A;  4R4I A;  1N32 Q;  3KLW A;  1L1O C;  2ZTD A;  5IYC G;  3KYH C;  2ATW A;  3W1G A;  4WJ3 M;  4DV0 L;  1YBY A;  2VQE Q;  4DV2 L;  4A93 H;  1N34 L;  4GNX C;  1VQ7 A;  3FKI G;  4PZ8 A;  1AE3 A;  4BY1 H;  2CFM A;  1HR0 W;  4R4Q A;  3M85 A;  1TXY A;  3UDI A;  4GOP A;  1X6O A;  2PNH A;  3G48 A;  3T1H Q;  4A3J G;  4IPD A;  1VS0 A;  4UY8 C;  4LF6 L;  2N78 A;  1P16 A;  1VQF A;  4PG3 A;  5AJ3 Q;  4HID A;  3TRZ A;  1X54 A;  4NXM L;  4A93 G;  4YCW A;  1I3Q H;  3I4O A;  3CCV A;  3PF5 A;  2NZO A;  1K73 C;  4B3R Q;  2GVB A;  1VQ9 A;  4X65 Q;  4DPG A;  2YV5 A;  3FKI H;  2QA4 A;  2I0Q A;  2K5H A;  1YHA A;  1Q86 C;  2K75 A;  1VQG A;  4DV1 Q;  2N49 A;  1OXT A;  2K5N A;  1R9T H;  4JV5 Q;  5ELO A;  1IZ6 A;  5IYD G;  1C0A A;  5HY6 A;  1Y1W H;  1A63 A;  1HZB A;  4A3D G;  1LTL A;  2UXD Q;  1E3P A;  3JAM c;  2AHO B;  4B3T L;  4DV4 Q;  3M7N A;  1CKN A;  1JE5 A;  1P8L A;  1OXS C;  2DGY A;  1UEB A;  3PUY A;  3RN5 A;  4A3F H;  1BBU A;  1GKH A;  2F3I A;  3GTG H;  1X3G A;  5ELN A;  4GKJ Q;  1BVS A;  2QGQ A;  3K7U C;  3M4P A;  3W1B A;  4DR1 L;  1HNX L;  4JBM A;  4WJ4 A;  4P72 A;  4JYA L;  3CCM A;  3U50 C;  3HOZ G;  3K7A H;  1K8G A;  4JI6 Q;  2VQF L;  3DLL A;  2VQE L;  2IT1 A;  4QIW E;  1SR3 A;  1VQC A;  1WFQ A;  1Q1E A;  2AWO A;  4DV2 Q;  1K9M C;  1J5E Q;  2GN5 A;  4QL5 A;  4LUZ A;  4A3D H;  3M9B A;  4JG2 A;  5GRO A;  4JI7 L;  2UUB Q;  3K81 C;  1TWC H;  2XTI A;  5C0X G;  3H3V H;  4DV3 Q;  2NVQ H;  2LSS A;  3K80 C;  3PIP A;  5GAE C;  3CC4 A;  3ULP A;  1PH6 A;  1H95 A;  1VCI A;  4BXX H;  1D8L A;  4OO1 I;  4OWW B;  1UE5 A;  4AYB G;  1N33 Q;  1YJ9 A;  3FHW A;  4IPH A;  1CKM A;  5C44 G;  1PH7 A;  1EFW A;  4IPG A;  2EIF A;  2KHJ A;  1XNQ L;  2JA9 A;  2JA5 G;  1V9P A;  3KF8 B;  3JAM i;  2A8V A;  1EIY B;  4DKA C;  1HZC A;  1A0I A;  2H5X A;  2OTL A;  2YU9 H;  4GOP B;  1X9N A;  3HOU G;  4GN4 B;  3I4N H;  3KOJ A;  4LFB L;  1OXV A;  4DV6 Q;  1XJV A;  1I94 Q;  4BA2 I;  2AKW B;  2E8G A;  3NEL A;  4DUZ Q;  2JA7 H;  4JI2 Q;  3OTO Q;  3TQY A;  2K50 A;  3ER0 A;  2LXJ A;  3EBE A;  2B29 A;  2E5L L;  4LF4 L;  2WB1 G;  2KBN A;  1KAW A;  3MXN B;  5LMN W;  1VQD A;  1EWI A;  3PUZ A;  1QUQ B;  2HQL A;  2NVY H;  2E2H H;  3T1Y L;  1YHB A;  1IBM Q;  1VQ6 A;  2WFW A;  4AQY L;  4GKJ L;  1HJP A;  5IE8 A;  4A3F G;  2ALY B;  1I50 H;  1N36 Q;  4JI0 L;  4LF4 Q;  4B3T Q;  3NBH B;  3STB C;  2Y0S G;  1L0W A;  2UUC L;  4BA1 I;  4EX5 A;  1QUQ A;  2A19 A;  4YY3 L;  1XPU A;  4JI1 Q;  1TWF H;  2Q2U A;  3CXC A;  1YJW A;  2R93 G;  3PO3 H;  4LF7 L;  4A3C H;  2HHH L;  1BKB A;  4BY7 H;  1AE2 A;  3WWV A;  3F2B A;  1PHJ A;  1HNZ L;  3PF4 A;  1E22 A;  4AYB E;  3HOX G;  3J7A 5;  1XMO Q;  1VQB A;  1Q12 A;  2HIV A;  1E7Z A;  2KCT A;  2ZM6 L;  1U0L A;  3CCE A;  4LF7 Q;  2Q2I A;  5H1S E;  2R92 G;  4LF8 Q;  1FL0 A;  1PH1 A;  4A3L H;  4A3M G;  1VQ4 A;  2ZTC A;  2NN6 G;  4QJF A;  4UPA A;  3D0F A;  3U4V A;  4K0K L;  4DR2 Q;  4QQB X;  1CSP A;  1NBW A;  3TRE A;  1YIJ A;  4Y7N H;  3BJU A;  1S72 A;  2JEB I;  3L2P A;  1YEZ A;  2ZJR A;  4IO9 A;  1S40 A;  2F4V L;  4A3L G;  4DV5 L;  5C44 H;  2E2I H;  2WP8 J;  2CQO A;  1XMO L;  3GTO H;  4LW1 A;  1AH9 A;  4DUY L;  4IOA A;  3GTM H;  1PA6 A;  3CPW A;  3GTQ H;  1K8A C;  2F4V Q;  4BY1 G;  4XTC S;  1JJC B;  4GKK Q;  1WCM H;  2JA8 H;  2C35 B;  3EN2 A;  2R93 H;  5GAD C;  3A5U A;  2NN6 I;  2DUD A;  2Y0S E;  1C9O A;  4QGU A;  5FJ8 H;  1VQO A;  2N8N A;  3RN2 A;  3VDY A;  1M90 C;  3RZO H;  4TQU S;  1OTC A;  3D31 A;  4MNO A;  5JJL A;  2UUA Q;  2KEN A;  4DR1 Q;  3S1R H;  1CKO A;  1PFS A;  3GD7 A;  3NEN A;  4JI7 Q;  3RR5 A;  4R4C A;  1G29 1;  4LF5 L;  2KCM A;  3CME A;  3E9H A;  4LFC Q;  2NVT H;  3M4Q A;  4X64 Q;  1QVF A;  1ASZ A;  3TS0 A;  4H02 A;  2R7F A;  1SE8 A;  3J81 i;  2FXQ A;  2OWO A;  1QZH A;  1HNZ Q;  4DV1 L;  1NE3 A;  1CKN B;  4BBS H;  2YTY A;  1O7I A;  3S15 H;  4J15 A;  2B63 G;  1KHI A;  4ME3 A;  1HNX Q;  4YCU A;  1PH8 A;  1Q82 C;  2E2J H;  3HOV H;  1B8A A;  2I5L X;  5FLM H;  2ES2 A;  2UXC Q;  4JOI A;  3KJO A;  2JA7 G;  2ZTE A;  3RLF A;  2VY3 A;  2VUM H;  1KXL A;  3RLN A;  3W5O A;  4DR7 L;  5C4X H;  3BZK A;  1HNW Q;  2LXK A;  5JEA G;  2UXB Q;  3HOY H;  2MO1 A;  3M3Y H;  4JI3 Q;  3E0E A;  4APV A;  2RHQ B;  2JE6 I;  3FP9 A;  3PGZ A;  2V1C C;  1WYD A;  1PYS B;  4LFA Q;  4K0K Q;  1VQP A;  1WI5 A;  1ASY A;  3L7Z C;  1VQN A;  3L0O A;  1J5E L;  1Z9F A;  1Q7Y C;  1SN8 A;  1I94 L;  5FLM G;  4DV7 L;  3GTP H;  2YYZ A;  3KFU A;  3GTJ H;  4HJ7 A;  1TWG H;  4B3S L;  4GN3 B;  4FDB A;  3RZD H;  3MEF A;  4R4T A;  1GVP A;  3NEM A;  5BR8 Q;  3G71 A;  3STB D;  3CCJ A;  1EQQ A;  2CCZ A;  3J81 c;  1N33 L;  4LFA L;  1LYL A;  1UE1 A;  4C3J H;  1UWV A;  5M3F H;  1VQL A;  2I5M X;  2EXD A;  1FJG Q;  2HT1 A;  1A8V A;  2JEA I;  2MQH A;  4A3M H;  1WJJ A;  1PYB A;  5IYB H;  3AEV A;  5M5W H;  4P75 A;  1SFO H;  4XIG S;  3ULJ A;  1XTD A;  4LFB Q;  5JJI A;  4AQY Q;  2L15 A;  4YHH L;  1VQE A;  1SLJ A;  1EIF A;  4BBR H;  2K52 A;  2VNU D;  4A3C G;  3F2C A;  1MJC A;  1VQI A;  5JEA J;  4HJ8 A;  4DR3 L;  1K3R A;  3H15 A;  1A62 A;  4KHZ A;  4YHH Q;  4A76 A;  1E1T A;  4DK6 C;  4C2M H;  1KC8 C;  1Y1V H;  2VS1 A;  4UP8 A;  3F2D A;  4JI6 L;  1X55 A;  2OQK A;  4OX9 Q;  3G4S A;  5FJ8 G;  4B3M Q;  2RCN A;  3A0J A;  1XPO A;  1Q81 C;  2EQS A;  5LMN L;  1VQM A;  2UUC Q;  3I4M H;  2B3G A;  1E1O A;  3CCR A;  4NB3 A;  3CD6 A;  4A3I G;  4A3K G;  4KHP Q;  5LMN Q;  4HIM A;  2BH2 A;  1I6H H;  3M4O H;  1KRT A;  5K36 G;  4HIK A;  5GAH C;  4OON A;  2D0P A;  4RMF A;  2MO0 A;  2F52 A;  4GS3 A;  4LUV A;  4B3S Q;  1RL2 A;  4EQ5 A;  2D62 A;  4A3I H;  4LF9 Q;  4L5Q A;  3UE0 A;  3K0X A;  3U4Z A;  4UP9 A;  3GDE A;  2VW9 A;  3CC2 A;  3HOU H;  5C0X I;  3KDF A;  2UU9 L;  1G51 A;  3I2Z A;  4JI4 Q;  1Q1B A;  4YWM A;  4DUY Q;  4JYA Q;  4LF9 L;  5DLQ E;  1K83 H;  1KQS A;  3S1N H;  4DR7 Q;  2Z0S A;  3T1Y Q;  1X3E A;  1IBM L;  4BXX G;  2PI2 E;  3HKZ E;  3S1Q H;  2PMZ E;  3A5Z B;  3GO5 A;  4HJ5 A;  2BA0 A;  4DK3 C;  4DR5 L;  1YIT A;  4BY7 G;  3HOY G;  3HOW H;  2HIX A;  4JOI C;  2OTJ A;  2KHI A;  3I7F A;  2IHE A;  2JK8 A;  1Y14 B;  5M5X H;  1FJG L;  5M3M G;  4A3E H;  1V43 A;  4MTN A;  1SMX A;  1VQJ A;  3BZC A;  2YTV A;  4DV3 L;  2UU9 Q;  2R7Z H;  3I55 A;  3GTK H;  4X65 L;  1B7Y B;  2YTX A;  1NTG A;  1Q8K A;  2VL6 A;  2MNA A;  2PQA A;  2JJQ A;  3S2H H;  5IYB G;  2WB1 E;  2IX0 A;  4YY3 Q;  2K4K A;  3I4N G;  3HOW G;  4KLK A;  4HJ9 A;  4LNQ A;  4C3H H;  1NMG A;  4P71 A;  4GN5 A;  1Y1W G;  4TVA B;  2JA6 H;  3CPF A;  1S3O A;  3I56 A;  1J6Q A;  4L5R C;  4Y52 H;  5HGQ A;  3PUV A;  2NZH A;  3S16 H;  2ZJQ A;  2CKZ B;  3T1H L;  4LUO A;  1V1Q A;  4IFD I;  2R7D A;  3H0G G;  1WCM G;  2JA8 G;  4IFD J;  1GD7 A;  3H3V I;  4LF6 Q;  3AFP A;  3OTO L;  3CMA A;  1KD1 C;  2JA5 H;  3CCQ A;  5IYD H;  3F1Z A;  4JBW A;  1YNX A;  5E7N A;  3OW2 A;  2E5L Q;  4A3G H;  1IBL Q;  3CCU A;  2WAQ E;  1HH2 P;  2Q2H A;  2RHS B;  3SGI A;  3U58 A;  1PVO A;  1JJG A;  1YI2 A;  1KIX A;  3HKZ G;  2UXC L;  2QEX A;  1MJE A;  4GKK L;  4X6A H;  4DV5 Q;  3H0G H;  4IJL A;  2CWP A;  3J80 i;  5LMU L;  3AQQ A;  1C7Y A;  1KRS A;  4L5T A;  5C3E H;  4B3R L;  1N9W A;  1PH4 A;  4BBS G;  2OQ0 A;  4JI1 L;  4OWT B;  1QVC A;  1HR0 L;  4DV4 L;  4DR4 Q;  4PZ7 A;  1K0R A;  1PH2 A;  3HOV G;  3S1M H;  1HZA A;  2GVA A;  1BBW A;  1UE7 A;  4HJA A;  1IBK L;  4LF5 Q;  3ERS X;  3UDG A;  3HFZ B;  4JBJ A;  5M3M H;  4A3E G;  4JV5 L;  1JT8 A;  4YWK A;  3PV0 A;  2OCE A;  3RNU A;  3F8T A;  3ULL A;  2UUA L;  4KI0 A;  1Y1V G;  5FLX c;  1JB7 A;  3UDX A;  2HHH Q;  2NVX H;  4X62 L;  1WOC A;  1EYG A;  2VQF Q;  3Q8D A;  1RIP A; 
#chains in the Genus database with same CATH topology
 1CM9 A;  3TEH B;  4NPS A;  3PO3 G;  5EPL A;  4A3B G;  1ILP A;  1H9S B;  3KF6 B;  2PW5 A;  4IFD G;  3FMC A;  3J80 E;  1KLU D;  3SXH A;  4JI3 L;  2F0N A;  1TWH H;  5GQO A;  1IXR A;  1CHQ D;  1F77 A;  1HNW L;  2XGT A;  3S17 H;  1I5F A;  4IUT A;  3K0Y A;  4JC0 A;  1SRO A;  1TWF B;  3NHH A;  4CKE A;  3TN2 A;  2XIW A;  4P74 A;  1PH5 A;  5LMU Q;  2A68 D;  4K8J A;  4A3G G;  1N8R C;  1VF5 C;  3SEB A;  1NAP A;  1VDZ A;  3K8A A;  2JP1 A;  1EOV A;  1SDF A;  5I4D A;  1FGB D;  2F03 A;  1G6P A;  5EJW A;  2NVQ B;  1NNX A;  4JI8 L;  1GUT A;  3WOF A;  1CUK A;  1N36 L;  2PQA B;  4X66 Q;  3CP0 A;  5M5Y B;  5C4X G;  2B63 H;  4YCV A;  1OXU A;  2UUB L;  1XNR Q;  3H09 A;  1EIH A;  4DR5 Q;  4DAM A;  3J80 L;  1X56 A;  4YWL A;  2PMZ B;  4DR3 Q;  3CCL A;  3BYT B;  4X62 Q;  2EYO A;  2B39 A;  4NXN L;  5I2Y A;  1RDP D;  1YVC A;  3JAM E;  1AZP A;  4PQX A;  2WAQ G;  1XNQ Q;  2I5H A;  3TME A;  4JI5 L;  3G6J B;  3E9I A;  2L5T A;  1L1O B;  4DAY B;  1ONL A;  5CBE E;  5BN3 A;  3J7A F;  1LAB A;  1NR4 A;  2BA1 A;  2KQ3 A;  4O2D A;  5JJK A;  4CDD C;  3IRB A;  4UHV A;  1HRJ A;  1D5Z C;  4KTA A;  4X3U A;  1B70 B;  1D1I A;  5M5W B;  2JA6 G;  5HGT A;  1X65 A;  1E24 A;  2CW0 C;  1GUO A;  1SE3 A;  5KNC A;  5NUC A;  4N9T A;  4FF2 A;  4GLV B;  4OWX B;  3GTL B;  1WD0 A;  3I4M G;  2MFI A;  1HZ9 A;  4CKC A;  3HOZ H;  4IJH A;  5C4J H;  1F2Y A;  1U4P A;  2M2L A;  1U4M A;  4P73 A;  3S24 A;  3DEO A;  1CK1 A;  2A69 C;  3CCS A;  4YIJ A;  2UXD L;  4POG A;  3AB9 A;  5IP7 H;  4BBR G;  1IBK Q;  4HMI A;  2PZW A;  3CAM A;  1EUJ A;  4UP7 A;  3CC7 A;  2KCN A;  4DR4 L;  1MKH A;  1VQH A;  1L1O C;  5IYC G;  4WJ3 M;  1SYF A;  3J7Y W;  2GA4 B;  3AU7 A;  3MFY A;  3K6O A;  4A93 H;  5BN5 A;  2R61 A;  4NMZ A;  4RH6 A;  3I70 A;  1LTA D;  1G2T A;  1I4P A;  1AFP A;  1VQF A;  5CR3 A;  1DOL A;  2PO4 A;  4O42 A;  2NZO A;  5CV8 A;  1EU3 A;  2I0Q A;  5C6A A;  1Q86 C;  4ZK9 B;  4GZY C;  4A3D B;  4P2C B;  1WD1 A;  1E3P A;  3NK9 A;  1FD7 D;  3M7N A;  1DD2 A;  1P8L A;  4A3F H;  2CQA A;  3PUY A;  4DR7 L;  4GKJ Q;  1X3G A;  3CU7 A;  1I3Q B;  5A35 A;  1GUG A;  4DR1 L;  3GTP B;  4JBM A;  1HNX L;  2K01 A;  2HUG A;  1S5C D;  1SNC A;  3SHL A;  2HCI A;  3FKI B;  2R92 B;  1K8G A;  1IKL A;  4JI6 Q;  4DV2 Q;  2IT1 A;  4QIW E;  1K9M C;  1WFQ A;  3GTM B;  1A15 A;  2GN5 A;  4LUZ A;  1LLR D;  4JG2 A;  4JI7 L;  3I4N B;  2UUB Q;  2R93 B;  1F2M A;  5C0X G;  5EBC A;  2NB0 A;  3PIP A;  5GAE C;  2R3Z A;  3IAY A;  2Z6B A;  1H95 A;  1PFB A;  1VCI A;  4OWW B;  1N33 Q;  2B8G A;  1YJ9 A;  4DN4 M;  3W3A A;  2E2D C;  5C44 G;  1O7L A;  1XNQ L;  2JA9 A;  1V9P A;  1EU4 A;  3KF8 B;  4G7Z C;  1K0S A;  2OTL A;  1A0I A;  3I3C A;  4GOP B;  2FIN B;  3QWN A;  3W2D A;  5C0X H;  1XJV A;  1BQQ T;  4DUZ Q;  3TQY A;  1RD9 D;  3T13 A;  1B1Z A;  2KBN A;  5LMN W;  2L0C A;  1QUQ B;  1ILQ A;  1IBM Q;  1YHB A;  4XDX A;  3C1E A;  4XQN A;  1HJP A;  5IE8 A;  5DM6 3;  4PMC A;  4A3I B;  2UUC L;  1QG7 A;  3KLS X;  4BA1 I;  4YY3 L;  3S2D B;  2B2Y C;  3Q24 A;  3CXC A;  1KNA A;  1B2T A;  4FO2 A;  5AFW A;  3NSW A;  5FK9 C;  1PHJ A;  4RGT A;  2EY2 A;  3AMU A;  3J7A 5;  2RQX A;  1EYC A;  3TBI B;  2DN8 A;  2JA8 B;  1ESR A;  4ABN A;  4LF7 Q;  2Q2I A;  5H1S E;  1FL0 A;  1I50 B;  3ERQ A;  3P75 A;  4K8I A;  1SBB B;  3NWT A;  4DR2 Q;  2RVL A;  2JEB I;  2ZJR A;  1S40 A;  1HA5 A;  2F4V L;  4H44 C;  1Q90 A;  2E2I H;  1XMO L;  1AZQ A;  1SFO B;  1AH9 A;  4DUY L;  5EGT A;  3C46 A;  3HGB A;  3GTM H;  3L3O C;  1KLG D;  1SNM A;  1XTC D;  3MEH A;  2PZT A;  2BE5 C;  2R93 H;  2NN6 I;  2D2C C;  1V1O A;  3MTS A;  4MNO A;  3S17 B;  5JJL A;  2UUA Q;  2K5Q A;  1PFS A;  3FVQ A;  3GD7 A;  3NEN A;  3R93 A;  2O5J C;  4JI7 Q;  3RR5 A;  4R4C A;  5ELC A;  2OT2 A;  4LFC Q;  2NVT H;  3TS0 A;  1SE8 A;  3TP8 A;  2FXQ A;  2ENB A;  3SR1 A;  4DV1 L;  3S15 H;  3CHB D;  4ME5 A;  1HNX Q;  3QB3 A;  2E2J H;  1B8A A;  2JA7 G;  1QE6 A;  4CJ2 C;  4FF3 A;  2VY3 A;  2VUM H;  1KXL A;  1SMY D;  2LXK A;  4RHS A;  5JEA G;  3M3Y H;  2A74 C;  2MO1 A;  4DK0 A;  3BDL A;  3E0E A;  4APV A;  2RHQ B;  1GOZ A;  3PGZ A;  2V1C C;  1WYD A;  1PYS B;  1WI5 A;  3L7Z C;  4I7Z C;  4QMG A;  1J5E L;  1Z9F A;  4A3E B;  1Q7Y C;  1SE2 A;  4DV7 L;  2YYZ A;  2M9V A;  4HED A;  4J1M A;  4B3S L;  2XNA C;  1BCP D;  3EVQ A;  3K59 A;  2B2V C;  1GVP A;  3LWU A;  3NEM A;  3G71 A;  3STB D;  3J81 c;  1W6K A;  4C2M B;  2HT1 A;  4K5X A;  4KN7 C;  5IOC A;  1H9M A;  1WJJ A;  5LL6 S;  3AEV A;  1SFO H;  4XIG S;  4OEM B;  1I4Q A;  1CQF A;  2Q8I B;  5JJI A;  4AQY Q;  4DU9 A;  1LO5 D;  3IKJ A;  1SLJ A;  2K52 A;  3M4O B;  3VYS A;  4HJ8 A;  1WTV A;  1A62 A;  1O80 A;  1Q8I A;  5C4J B;  1I6V C;  4OIJ A;  1E1T A;  4B9W A;  1Y1V H;  1A2T A;  4UP8 A;  4RWS C;  1X55 A;  4B3M Q;  1BCP F;  1XPO A;  4M8A A;  5FOB B;  5LMN L;  2UUC Q;  1EY9 A;  1HHV A;  4UDU C;  4TKO B;  2EJG C;  5C4Z A;  4KN4 C;  4N8X 1;  1BCP C;  3HOW B;  2F0D A;  2MO0 A;  2F52 A;  4LUV A;  4B3S Q;  4IAL A;  3CC2 A;  1HUM A;  1IKM A;  3FPU B;  1G51 A;  2G9D A;  1B3Q A;  3E6Z X;  3P1H A;  4DUY Q;  5DLQ E;  3M3Y B;  4OL7 A;  2I46 A;  3T1Y Q;  1X3E A;  3NWS A;  3S1Q H;  2PMZ E;  3A5Z B;  4K14 A;  3GO5 A;  4FXG C;  4DK3 C;  1I6H B;  4JOI C;  2KHI A;  2H4O A;  1Y14 B;  5M5X H;  1FJG L;  5M3M G;  4A3E H;  1EY5 A;  1V43 A;  1VQJ A;  2UU9 Q;  3I55 A;  4FXK C;  1B7Y B;  3BVM A;  2YTX A;  2MNA A;  3BVG A;  2O4X A;  2WB1 E;  2F1M A;  2D9U A;  4KLK A;  4HJ9 A;  4LNQ A;  1NMG A;  1Y1W G;  1LT4 D;  2EDG A;  3CPF A;  1WVL A;  1ENC A;  5HGQ A;  5I9O A;  1CA6 A;  1SSO A;  3T1H L;  5CV9 A;  4V0B A;  1WCM G;  4IFD J;  3Q23 A;  4KKS A;  4IUU A;  4LF6 Q;  4ILW A;  3CCQ A;  3F1Z A;  4JBW A;  1YNX A;  3J81 E;  2E5L Q;  4LJZ C;  5JPM C;  3SGI A;  1HH2 P;  2Q2H A;  3CCU A;  1JJG A;  3VR4 A;  3HKZ G;  2UXC L;  4F7X A;  4X6A H;  3FEW X;  4LMQ D;  1EL0 A;  2M00 A;  4IJL A;  3NQT A;  5CC4 A;  1KRS A;  4L5T A;  1BF4 A;  4B3R L;  2DNE A;  1PH4 A;  2L55 A;  2OQ0 A;  4OWT B;  1QVC A;  3H94 A;  1JWU D;  2K1B A;  4DV4 L;  5DNF A;  3S1M H;  2IW3 A;  4HJA A;  4XT1 B;  3OIP A;  4JV5 L;  1D6E C;  4YWK A;  3S9W A;  2K7V A;  3MHB A;  3D6C A;  2FJ2 A;  5FLX c;  1JB7 A;  1DXM A;  3UDX A;  4X62 L;  2F0Q A;  1WOC A;  3BG3 A;  3H3V H;  5GAG C;  4R8N A;  4OO1 G;  1U4L A;  3CW2 C;  5FLX E;  4KJN A;  4LWC A;  2PI2 A;  3VYU A;  3TP6 A;  4NXN Q;  2I07 B;  3PQI A;  1IL2 A;  3ND8 A;  3J7A V;  1NJI C;  1HTP A;  1PZK D;  5E3F A;  2RDF A;  2SNS A;  5AJ3 L;  3LGJ A;  3J80 c;  1XPR A;  1IBL L;  2R7Z B;  2NVX B;  4I7A A;  2E76 C;  1NUC A;  2Q2T A;  3V96 A;  1C8C A;  1N32 L;  2R92 H;  1X3F A;  4ZLT F;  2ZM6 Q;  1Q3L A;  2AMC B;  1JB3 A;  1PH3 A;  4IPC A;  1S5E D;  4GLA C;  4PZ6 A;  3CQZ H;  1T5E A;  1BDO A;  1JJ2 A;  1DGS A;  1SYB A;  2IX1 A;  1UE6 A;  2R6G A;  1S5D D;  2OXP A;  1QVG A;  2F0E A;  3D4W A;  4PMW A;  3G6E A;  1V1P B;  4OGQ C;  1KL9 A;  4XYO A;  4HCS A;  2PZU A;  2V4D A;  4DF7 A;  4BS9 A;  4OXP A;  1JCK B;  1NSN S;  4C1N K;  1GM5 A;  1HQR D;  5JPN C;  1MIU A;  1ZXT A;  1OO9 B;  2YU9 B;  2BH8 A;  3BU2 A;  1RF2 D;  3WOE A;  1K28 A;  2XRS D;  3FRP B;  5D3I B;  2ZXR A;  3EFX D;  4R1J A;  4O0A A;  3Q22 A;  1PLF A;  2NYZ D;  4JW0 A;  1KTK A;  1E0B A;  1I4R A;  3EIV A;  1EY0 A;  3A55 A;  1BCP B;  1NY4 A;  2HDL A;  1TS3 A;  5IWA Q;  4K6L A;  1VQ8 A;  1XX8 A;  2E2J B;  3OMG A;  5IP9 G;  5FO8 B;  1RHP A;  4KKU A;  3FPP A;  1EY4 A;  3JC6 6;  1G8Z D;  1U5K A;  5K36 H;  1GUW A;  2KEE A;  1JOO A;  3ITP A;  2L12 A;  4WJW A;  3TS2 A;  1B9M A;  4X64 L;  5IT9 c;  4GLX A;  3KDF B;  2PNR C;  4AH6 A;  5EAY A;  2R7Z G;  3KJP A;  4DV6 L;  3GTJ B;  5C3W A;  3OWE B;  4QY7 A;  4L63 B;  3GP7 A;  5IY0 A;  5BR8 L;  3DMU A;  3GTL H;  1YZ6 A;  3KLW A;  1H9R A;  2XRQ D;  4DV2 L;  4A3M B;  1MSH A;  1AE3 A;  1LTB D;  1WTO A;  1HR0 W;  4GOP A;  5IGF A;  2IL8 A;  3G48 A;  1EQT A;  4IPD A;  2E74 C;  4CGY B;  4HID A;  5IIF A;  3S15 B;  1TS4 A;  2FFK B;  4XQQ A;  3PF5 A;  5L37 A;  4B3R Q;  2GVB A;  3SK5 A;  4X65 Q;  2QA4 A;  1YHA A;  3ND9 A;  1FNW A;  4C3I B;  1R9T H;  1OXT A;  2K5N A;  5ELO A;  2B2T C;  3JAM c;  4B3T L;  2JA6 B;  4MIU A;  2DGY A;  1BBU A;  1Y8P B;  5ELN A;  1IYU A;  1SJH D;  1S4Z A;  2PPB C;  2PW7 A;  3K5L A;  4LAA A;  3K7U C;  2EYJ A;  2LS0 1;  1DON A;  2PCF B;  1CQV A;  1LT3 D;  3V2T A;  3HOU B;  3DHQ A;  3NTI A;  2KEC A;  1F9P A;  1EFI D;  3P7J A;  5E4W C;  1R4P B;  2EJM A;  1C0A A;  1VQC A;  2AWO A;  2HD3 A;  3K57 A;  2LFN A;  1F2Z A;  3QJY A;  5F2D A;  1WTX A;  3K81 C;  1TWC H;  4WOR A;  5CV7 A;  2LSS A;  3GTG B;  2LMC B;  3CC4 A;  3ULP A;  1PH6 A;  3K58 A;  3DXJ C;  4BXX H;  4RHR A;  2NVY B;  3V05 A;  5M3M B;  2MJ8 A;  3O13 A;  1B3A A;  1MD2 D;  4IPG A;  2EIF A;  2KHJ A;  3VR6 A;  3JAM i;  1SYE A;  1YNN C;  2H5X A;  1Y1V B;  3I4N H;  2SEB D;  3KOJ A;  4DV6 Q;  2AKW B;  2JA7 H;  1GHK A;  3EJI A;  3X3N A;  3EBE A;  2WB1 G;  1EWI A;  2DJF C;  1PZJ D;  2E2H H;  2F0V A;  2F0I A;  4G7O C;  1HXY D;  4LF4 Q;  4FP5 D;  1E2W A;  2CW0 D;  2A19 A;  4HSV A;  1V1P A;  1YJW A;  1G6Z A;  4MTK A;  2R93 G;  4OO1 H;  4LF7 L;  4A3C H;  1BKB A;  1AE2 A;  2HDM A;  4ZKC B;  4U67 3;  3R8B A;  1E22 A;  4AYB E;  1VQB A;  4OHJ A;  3S1Q B;  2TMP A;  1PDQ A;  2N55 A;  2R92 G;  2G9H D;  1WTW A;  4A3L H;  5IGB A;  2BDN A;  2FHT A;  2ZTC A;  1O7Z A;  2NN6 G;  2EYL A;  4UPA A;  3OW7 A;  1STH A;  4K0K L;  4QQB X;  1A2U A;  3BJU A;  3L2P A;  4IO9 A;  3NPP A;  2WP8 J;  3HZX A;  4IOA A;  1MI2 A;  2RKS A;  4C3H B;  3CPW A;  2F4V Q;  4GKK Q;  1Z6H A;  2JA8 H;  3D6W A;  1TWC B;  1C9O A;  5KND A;  2QKI C;  2N8N A;  2Z4H A;  2EJF C;  2JXM B;  3U9S A;  3KLR A;  3RZO H;  2EPB A;  4TQU S;  1EZ6 A;  3SK8 A;  1A3T A;  3C2P A;  3KUP A;  2KCM A;  2EY5 A;  3E9H A;  2L9H A;  1EIG A;  2R7F A;  3CQZ B;  2EYP A;  2OWO A;  3N52 A;  4BBS H;  2YTY A;  1KHI A;  2JA7 B;  3NP8 A;  5E4X A;  3HOV H;  4IUQ A;  1CZG A;  1TWG B;  4PV1 C;  2F0H A;  3W5O A;  3BZK A;  3BS1 A;  3S1N B;  4ZUI A;  2NVT B;  1ZYR D;  1B9N A;  1JOQ A;  4K0K Q;  3OSO A;  3L0O A;  4BY7 B;  2B2V A;  4L8J A;  4NDX A;  3VR5 A;  5FLM G;  3GTJ H;  4FDB A;  3T53 B;  4R4T A;  5JAV A;  2CCZ A;  1I4H A;  2EYH A;  4LFA L;  1LYL A;  5M3F H;  1UWV A;  3NE5 B;  3R2T A;  2D5D A;  2EXD A;  1A8V A;  2OEO A;  1H9S A;  3HKZ B;  3VYT A;  4C3I G;  2JEA I;  4A3M H;  1EEF D;  3MXP A;  4CDF C;  1PYB A;  1LV9 A;  3ULJ A;  2JN4 A;  1GXD C;  1SND A;  3GTQ B;  4YHH L;  1VQE A;  2K6A A;  2VNU D;  4A3C G;  4DAY A;  5KYL A;  4DR3 L;  3H15 A;  1J9O A;  1SEB D;  4C2M H;  2A6H C;  1TQO A;  4JI6 L;  3G4S A;  3K5M A;  1M8A A;  1DZ1 A;  2Z9H A;  3CCR A;  4QCL A;  4NB3 A;  1Y1W B;  4A3I G;  4KHP Q;  3OHX C;  2F0S A;  4HIM A;  5ELE A;  1AW7 A;  4HIK A;  4OON A;  3A8J E;  2D62 A;  4G4K A;  3UE0 A;  3K0X A;  5T1G A;  2VW9 A;  2XWJ B;  3HOU H;  1H9J A;  4ZRZ A;  1Q1B A;  3ONA B;  1BBX C;  1KQS A;  3S1N H;  3BZD B;  1KDC A;  4HJ5 A;  1YIT A;  1DM0 B;  2K03 A;  4KY6 A;  4KY5 A;  2F0O A;  3U9O A;  4MTN A;  2R7Z H;  4DGZ A;  1QCB D;  4X65 L;  3KK7 A;  4C3H G;  1D5M C;  2VL6 A;  2Q8T A;  3S2H H;  2X69 A;  1U4R A;  2QW7 A;  3LWE A;  1BUV T;  4N8F A;  4YY3 Q;  3A56 A;  3I4N G;  2VXW A;  1QNU A;  3HOW G;  1B53 A;  2CHB D;  4CKB A;  4TVA B;  1V8Q A;  3R2I A;  2JA6 H;  4EQP A;  1HA6 A;  1J6Q A;  3BYY B;  4RAU C;  3PUV A;  2F0T A;  3S16 H;  2ZJQ A;  4HMJ A;  5M5X B;  1G91 A;  4IFD I;  1IW7 C;  3H3V I;  2E2H B;  5CYU A;  1RTO A;  2RHS B;  2B2U C;  2C9O A;  1YI2 A;  2AUJ D;  1HFN A;  5TSS A;  4TRD A;  3I72 A;  4UAI A;  3H0G H;  5LMU L;  2B2U A;  2Z8L A;  1HQM C;  3TP7 A;  3DUZ A;  4BBS G;  1HTL D;  2N88 A;  3I91 A;  4JI1 L;  1LTI D;  2RDG A;  1K0R A;  1PH2 A;  1IBK L;  1HCZ A;  2NN6 H;  3ERS X;  3UDG A;  5M3M H;  4A3E G;  1JT8 A;  3PV0 A;  2KUM A;  1C48 A;  2AQ2 B;  2UUA L;  2WIN B;  2IX3 A;  1Y1V G;  2HHH Q;  2RSN A;  2J4X A;  2WV6 D;  1DYQ A;  4RKL A;  1RIP A;  1TWA H;  1QZG A;  3ZJY C;  4K2L A;  4C3I H;  4N9P A;  4DR6 L;  3S14 H;  2AWN A;  2VB3 X;  3G7L A;  4CBV A;  2K05 A;  1BOS A;  1W2B A;  4O1N A;  1RJT A;  4JCV E;  3AYH B;  3RZD B;  3NTH A;  1EWH A;  4FNF A;  3CF5 A;  1ZYR C;  3OOC A;  2F0W A;  3S1R B;  4IOC A;  5M5Y H;  3URY A;  1B44 D;  2N3S A;  3H6M A;  1PH9 A;  4G7H C;  4Q5V A;  2Z6K A;  1NMF A;  5COR A;  3J7Z C;  1IYV A;  5C0X J;  3H3V C;  2F3V A;  4DV7 Q;  1AP0 A;  3PIO A;  2D0O A;  3HKS A;  4X3S A;  1XXG A;  1VQK A;  2BOS A;  1OXX K;  3NBI A;  2F4I A;  5CGK A;  1IL8 A;  3HOX H;  2ASB A;  5IYC H;  2JQO A;  4MZ9 A;  1EEI D;  5EQ0 A;  4L5S A;  2KED A;  4NW2 A;  3ZYY X;  4EQO A;  3GTO B;  1K8M A;  1L2F A;  1EY7 A;  1M1K C;  1HPC A;  1DCZ A;  4JBK A;  5COY A;  5EKK A;  1UNS A;  4NKL A;  5IWA L;  2XVS A;  2WAQ B;  2IHF A;  2IWH A;  5C4H A;  4H0L C;  1T9H A;  1Y8N B;  4A75 A;  1R9T B;  1RTN A;  5EBD A;  3TZD A;  1WTH A;  2CWA A;  3S2D H;  3A74 A;  4ZUJ A;  1IYJ B;  3PUW A;  1ET6 A;  1XWE A;  5KEE A;  1EOT A;  4DUZ L;  5FLX L;  2QEJ C;  5JVG 3;  3EA6 A;  4X3T A;  3M7G A;  3PSI A;  3H91 A;  1MSG A;  2Z1C A;  5D14 A;  1XMQ Q;  1W3S A;  3PUX A;  1AN8 A;  4A3K H;  2X6L A;  4DA2 A;  5C5M A;  4IFD H;  4A93 B;  2CH4 A;  4JI2 L;  3A8K E;  4OX9 L;  1ENA A;  2ZJP A;  2K5V A;  3VA7 A;  1GO3 E;  2A1A A;  4KK7 A;  1UAP A;  2F0K A;  2JYO A;  5J3B A;  3HS0 C;  1VQA A;  4K2K A;  1EQR A;  1Z47 A;  2NUC A;  3I90 A;  3OYY A;  1B4O A;  2ATW A;  5CV4 A;  1YBY A;  2VQE Q;  3QOJ A;  4KY7 A;  3IL8 A;  1N34 L;  4GNX C;  1VQ7 A;  3FKI G;  4PZ8 A;  2QDL A;  4FXD A;  1TS5 A;  2A68 C;  4BY1 H;  2CFM A;  1L0Y B;  5EKL A;  3WDN A;  3UDI A;  4A3J G;  5IGE A;  3T1H Q;  1BR9 A;  1VS0 A;  2B8F A;  2P5Z X;  4LF6 L;  2N78 A;  1X54 A;  4NXM L;  1I3Q H;  3I4O A;  1STA A;  3P20 A;  4FYD A;  2MP1 A;  3S2H B;  4KV6 A;  4PNY A;  2VUM B;  5HUR A;  4CHT B;  2MHV A;  1TR5 A;  3MFG A;  4DV1 Q;  2N49 A;  1EY8 A;  1IZ6 A;  5HY6 A;  1Y1W H;  1A63 A;  2WB1 B;  4A3D G;  1LTL A;  3TSS A;  4DV4 Q;  3R3O A;  1JE5 A;  1OXS C;  1T5X D;  1UEB A;  1GKH A;  2F3I A;  1O78 A;  1STB A;  2EYF A;  3M4P A;  1JR0 D;  4P72 A;  4JYA L;  2B2W A;  4J8Q A;  3U50 C;  3HOZ G;  2VQF L;  1WTQ A;  1SR3 A;  1J5E Q;  4A3D H;  3KLS A;  5GRO A;  5IGC A;  4DV3 Q;  1LTR D;  2NVQ H;  3K80 C;  2DNC A;  5ELB A;  2DJG C;  4OO1 I;  1UE5 A;  4AYB G;  4B9X A;  3FHW A;  4IPH A;  1CKM A;  2H1E A;  5J1Z A;  5CV6 A;  1PH7 A;  1EFW A;  3DWP A;  4DKA C;  1HZC A;  3HOU G;  1JE4 A;  1B50 A;  1BXT A;  1QWY A;  2EOT A;  2EYM A;  5JEA H;  4QB4 A;  4BA2 I;  1EYA A;  1O7Y A;  2E8G A;  3NEL A;  4JI2 Q;  1JOR A;  3OTO Q;  3ER0 A;  4KHV A;  3MXU A;  2LXJ A;  2B29 A;  4XT3 B;  4LF4 L;  3MXN B;  3S14 B;  1KAW A;  1PTO H;  3PUZ A;  4X3K A;  2HQL A;  1VQ6 A;  2JA5 B;  1TS2 A;  3T1Y L;  2A6E C;  3EQL C;  4AQY L;  2RCF A;  4A3F G;  1I50 H;  2EY6 A;  1A6X A;  1YNJ D;  2K5D A;  4JI0 L;  4B3T Q;  1HUN A;  3BDC A;  1QUQ A;  4JI1 Q;  2Q2U A;  3QIA A;  3PO3 H;  2E2I B;  3TZU A;  4BY7 H;  3PF4 A;  1HNZ L;  5CBA E;  1Q12 A;  2KCT A;  2ZM6 L;  1U0L A;  2WII B;  4HSP A;  1WCM B;  1IHZ A;  2A73 B;  2ZT9 C;  2AQ1 B;  4A3M G;  1H9K A;  2J7Z A;  5J22 A;  3U4V A;  3D0F A;  4RCO A;  1PRT C;  1CSP A;  3TRE A;  2RDH A;  4Z9C B;  3E3X A;  1YEZ A;  2AQ3 B;  4DV5 L;  5C44 H;  3GTO H;  2HQE A;  4LW1 A;  1Z7T A;  1PA6 A;  5FKA C;  4JPB W;  4QUF A;  5C3X A;  3GTQ H;  4BY1 G;  4XTC S;  3NBH A;  3EN2 A;  1DOK A;  3KBG A;  1TKW B;  2C35 B;  1SNO A;  4HAE A;  2Y0S E;  1VQO A;  5FJ8 H;  4G57 A;  3VDY A;  1M90 C;  2RBM A;  1OTC A;  1QNK A;  1SNP A;  4RGM A;  2KEN A;  4DR1 Q;  3S1R H;  1CKO A;  5ISR A;  2J0T D;  2VB2 X;  1G29 1;  2QDB A;  4X64 Q;  1ASZ A;  4KJO A;  1BNZ A;  4CDC C;  3C3L A;  1NE3 A;  1CKN B;  3NXW A;  4EGV A;  3CKI B;  4ME3 A;  4YCU A;  1Q82 C;  4F87 A;  3OWF A;  2UXC Q;  5FLM H;  4KD4 A;  3KJO A;  3I8Z A;  4KMU C;  3RLN A;  5C4X H;  1HNW Q;  1SMY C;  3HOY H;  3A7L A;  2JE6 I;  3LNN A;  1PZI D;  4LFA Q;  3T4A C;  1VQN A;  3PO3 B;  1SN8 A;  1QJO A;  3OMC A;  2XWB B;  2F0J A;  3HOV B;  5C5L A;  3KFU A;  5CMD A;  1K8O A;  1EZ8 A;  4GN3 B;  3T16 A;  3RZD H;  3MEF A;  1KDB A;  3RUZ A;  5BR8 Q;  1EQQ A;  1N33 L;  2CH4 W;  3MAQ A;  1UE1 A;  4C3J H;  1FNV A;  2MQH A;  1RKN A;  3Q6S A;  5JOB A;  1QB5 D;  1LTT D;  3S16 B;  5IYB H;  4P75 A;  5I6Y A;  3IFT A;  4BWG B;  2L15 A;  5IT9 L;  3X3M A;  4BBR H;  1GUS A;  1MJC A;  3NQI A;  5D3D A;  2EE1 A;  1X3Q A;  4H13 C;  4KHZ A;  4YHH Q;  4DK6 C;  5M3F B;  1KC8 C;  3F2D A;  2OQK A;  4OX9 Q;  3A0J A;  1Q81 C;  3DWA A;  1VQM A;  5ELF A;  3I4M H;  2L11 A;  5FO7 B;  1PTO C;  3NUC A;  2Y0S B;  3PMF A;  4A3K G;  2F0G A;  1ROD A;  2BH2 A;  1I6H H;  2F0U A;  3M4O H;  5GAH C;  1K3B C;  4LF9 Q;  4L5Q A;  1PFM A;  1Y69 U;  3U4Z A;  4UP9 A;  2RA4 A;  3I2Z A;  3MZ5 A;  4JI4 Q;  4YWM A;  4ZKB B;  4C1N I;  2KJX A;  1K83 H;  1ML0 D;  3HOY B;  4DR7 Q;  2IPK D;  1IBM L;  4BXX G;  3HKZ E;  2BA0 A;  3F2U A;  3HOW H;  2HIX A;  1F9S A;  2JK8 A;  3D4D A;  4HCE A;  3DM1 A;  1D5X C;  3RMH A;  1SMX A;  3BZC A;  2YTV A;  3GTK H;  2ICE C;  3BVZ A;  4K6D A;  1NTG A;  2PQA A;  2F0L A;  2JJQ A;  5IYB G;  2L4N A;  3D4R A;  2IX0 A;  4IZ8 A;  2XN9 C;  2K4K A;  2WKD A;  3Q0A A;  4HTH A;  4GN5 A;  4C3J B;  1S3O A;  4L5R C;  4Y52 H;  1TY2 A;  3CRK C;  1YNN D;  4LUO A;  3MVV A;  3H0G G;  2JA8 G;  3CMA A;  1KD1 C;  2JA5 H;  2MPM A;  4A3G H;  1IBL Q;  4NP5 A;  1KIX A;  4FF4 A;  4WFN 3;  1KAA A;  1A3U A;  2CWP A;  4RKB A;  3AQQ A;  5C3E H;  3NTK A;  1KDA A;  1N9W A;  1VMC A;  4E6I A;  4QUC A;  1RCV D;  4BY1 B;  2L1B A;  3A7A B;  4PZ7 A;  1HZA A;  1BBW A;  1SXT A;  2GVA A;  3GV3 A;  4LF5 Q;  3MWY W;  3HFZ B;  5KYI A;  4IUP A;  2OCE A;  2CVR A;  1CTM A;  4CJ0 B;  3MA2 B;  3H0G B;  1TII D;  1EYG A;  2VQF Q;  1D2B A;  4DV0 Q;  5IP7 G;  3D8G A;  1HR0 Q;  3D3R A;  4IUV A;  4HIO A;  2KVM A;  1G2S A;  1PMR A;  1I4X A;  1JMC A;  4FF1 A;  1DJR D;  2QCP X;  5E1F A;  4JI0 Q;  1SYG A;  1TT2 A;  3RLO A;  1Q46 A;  1Y8O B;  4POF A;  1FGU A;  2KA7 A;  3DM3 A;  1PV4 A;  5KGU A;  4R9W A;  4B3M L;  2VZA A;  2G5D A;  2UXB L;  2ZXO A;  4GNX B;  2Z6K C;  3MXG A;  3PO2 H;  3KF6 A;  4KD3 A;  4A3B B;  4AIM A;  5KIX A;  1L1O A;  1EQV A;  4RGO S;  2B63 B;  2O2L D;  4QF4 A;  4JI4 L;  5I2X A;  4A3J H;  1GUN A;  1L0X B;  1MGS A;  5A2Q L;  2Z4I A;  4K5V A;  1STN A;  2RF4 A;  2QF7 A;  4JK1 C;  4GOP C;  1KNE A;  2IY5 B;  2MUY A;  1XNR L;  4R4O A;  4DNR B;  4Y7N B;  5EPJ A;  1LM0 A;  1JWM D;  1U9R A;  3C1F A;  1D7Q A;  3TP5 A;  1M4V A;  1CSQ A;  4RA8 A;  1FVI A;  4OIK A;  3FDT A;  2WKC A;  4F88 A;  4DR6 Q;  5M3F G;  1YHQ A;  3J81 j;  1PRT D;  3UE1 A;  5IP9 H;  2PQE A;  1SE4 A;  3I73 A;  3HOX B;  3ICE A;  1FYC A;  4RG1 A;  2MGS A;  4ID6 A;  1SRU A;  4DR2 L;  2F0M A;  4KHP L;  5C3E G;  2IJ0 A;  1PTO D;  4MN3 A;  2ID0 A;  4L6T B;  4JI5 Q;  4LF8 L;  4ALP A;  1PXU A;  1XMQ L;  2SDF A;  5G3L F;  3AFQ A;  4DNI A;  2KCC A;  4B08 A;  1SAP A;  2XSC A;  3PCO B;  3PO2 G;  4NXM Q;  3LX0 A;  5ELD A;  4BBR B;  2VUM G;  5DM7 3;  4A4I A;  2EXZ A;  3HRZ C;  1SYC A;  4J6H A;  1JC7 A;  3QG1 A;  2A69 D;  4JI8 Q;  4A3B H;  4LFC L;  5JVH 3;  1CI3 M;  1VQ5 A;  1N34 Q;  4X66 L;  3UDF A;  3B6Y A;  2K14 A;  5G3L D;  5J39 A;  4RGN A;  1LUZ A;  5EPK A;  4GNX A;  1YJN A;  4R4I A;  1N32 Q;  1PTO F;  2ZTD A;  4ZYS A;  3QO2 A;  3KYH C;  3W1G A;  2JSO A;  4DV0 L;  1F9R A;  5I9P A;  4C56 C;  1PRT B;  4JVZ A;  1PRT F;  1UEA B;  2HCC A;  4R4Q A;  1CFM A;  5A2Q E;  1IW7 D;  3M85 A;  1TXY A;  4IUN A;  1PTO B;  2B2Y A;  1X6O A;  2NBF A;  2PNH A;  4WRD A;  3TDQ A;  1C4Q A;  1LTG D;  4UY8 C;  2NWG A;  1P16 A;  4PG3 A;  5AJ3 Q;  3TRZ A;  4A93 G;  4YCW A;  3HP3 A;  3A54 A;  3CCV A;  1SJE D;  1K73 C;  3RD4 A;  1VQ9 A;  4FVM A;  2RSO A;  1AEX A;  2YV5 A;  3FKI H;  4DPG A;  2K5H A;  1MHW C;  4IQZ A;  5IGD A;  2K75 A;  1VQG A;  1TU2 B;  4JV5 Q;  1UUP A;  5IYD G;  1HZB A;  2UXD Q;  2K33 A;  2AHO B;  1CKN A;  1QVF A;  2B2W C;  2Q8R E;  3RN5 A;  3GTG H;  1NCV A;  1BVS A;  3VA5 A;  1ICW A;  2E75 C;  2PYK A;  2QGQ A;  3W1B A;  3MXN A;  4WJ4 A;  3CCM A;  2WAC A;  3HEJ A;  4DNT B;  3K7A H;  2EZV A;  1HFG A;  5C44 B;  4Q0F A;  3VR3 A;  1K83 B;  3DLL A;  2VQE L;  1Q1E A;  5D65 A;  4QL5 A;  3K5N A;  3M9B A;  2F0P A;  1ZEQ X;  4ODG A;  1WTR A;  2XTI A;  2LY7 A;  2KOL A;  1TY0 A;  1D8L A;  5BN4 A;  4XQJ A;  4KKT A;  1MBY A;  3HG9 A;  2JA5 G;  2A8V A;  2K32 A;  1EIY B;  3SK6 A;  2YU9 H;  1X9N A;  4GN4 B;  3PIP 3;  4LFB L;  1OXV A;  1STE A;  3JAM L;  1I94 Q;  4ZQ3 A;  1JIC A;  2K50 A;  2A6H D;  4EVO A;  2E5L L;  1VQD A;  4DAP A;  2NVY H;  4GKJ L;  2A6E D;  1E2V A;  2WFW A;  2ALY B;  2BCO A;  1N36 Q;  3NBH B;  3STB C;  4OEL B;  2Y0S G;  1L0W A;  1D1K A;  4EX5 A;  1XPU A;  3PO2 B;  1GHJ A;  5C3E B;  1TWF H;  5IGG A;  2HHH L;  3WWV A;  3F2B A;  3HOX G;  5CV5 A;  1XMO Q;  2HIV A;  1E7Z A;  1S5B D;  3CRL C;  3CCE A;  2F0F A;  1SNQ A;  4RCN A;  4LF8 Q;  1PH1 A;  2FMM A;  5KRU A;  3HOZ B;  3UI2 A;  4DXF A;  1VQ4 A;  3RZO B;  2QIL A;  4QJF A;  3GTK B;  1NBW A;  3KBX A;  1YIJ A;  3IFD A;  1I4G A;  4Y7N H;  2B2T A;  1S72 A;  4A3L G;  1ESF A;  4R8I A;  3GQB A;  3SE0 A;  4ZCK A;  2SOB A;  5KNB A;  2CQO A;  4ZAI A;  4ULL A;  1CHP D;  4I65 A;  3N6R A;  1K8A C;  3QR8 A;  1JJC B;  1WCM H;  1J8I A;  1A3V A;  1CZW A;  1BO0 A;  5GAD C;  4S3S A;  1CT1 D;  2DUD A;  4CJ1 B;  4QGU A;  1TWH B;  2K04 A;  3A5U A;  2EVB A;  3RN2 A;  1NR2 A;  1WTP A;  3SK4 A;  3D31 A;  5DEH A;  3I4M B;  3J81 L;  4LF5 L;  1ICF B;  3CME A;  4A3J B;  1QIL A;  3M4Q A;  2DY7 A;  4DAV A;  4H02 A;  1KAB A;  3J81 i;  3T56 B;  1QZH A;  1HNZ Q;  1O7I A;  2C5C A;  4J15 A;  2B63 G;  4XXE A;  1LTS D;  2TSS A;  1PH8 A;  2ZXP A;  1QOH A;  2I5L X;  2ES2 A;  4JOI A;  2OF1 A;  2ZTE A;  3RLF A;  4MHE A;  2UXB Q;  4LK1 C;  4JI3 Q;  1LAC A;  4CDE C;  1W6J A;  3FP9 A;  2NZ1 D;  1VMP A;  3SDZ A;  1VQP A;  1ASY A;  2NTT A;  1TWA B;  4K5W A;  1I94 L;  3E5S A;  3GTP H;  5IOD A;  4HJ7 A;  1TWG H;  1VF7 A;  5C4X B;  4PMB A;  1STY A;  3KF8 A;  3CCJ A;  1LT6 D;  1TVX A;  2KHS A;  1VQL A;  3OPO A;  2I5M X;  1FJG Q;  4HN7 A;  1E2Z A;  3T51 B;  3BDO A;  1JWS D;  4IN3 A;  5M5W H;  1PFN A;  2BDO A;  1XTD A;  4LFB Q;  4A3G B;  1EIF A;  1F2L A;  4DXG A;  3DEP A;  1LT5 D;  3F2C A;  3VYR A;  1VQI A;  1XYI A;  5JEA J;  2K5W A;  1K3R A;  2FMC A;  4A76 A;  2VS1 A;  5FJ8 G;  2RCN A;  1SYD A;  2EQS A;  2X6G A;  5I6W A;  3DWQ A;  2B3G A;  5EKI A;  1E1O A;  5JJZ A;  3CD6 A;  4C3J G;  4DK1 A;  4DFA A;  1CA5 A;  5LMN Q;  4XYQ A;  2DY8 A;  5K36 G;  1KRT A;  4A3F B;  3VR2 A;  3I4L A;  2D0P A;  4RMF A;  1EY6 A;  4GS3 A;  2O5I C;  1RL2 A;  4EQ5 A;  5LL6 X;  4A3I H;  4F8M A;  3SVM A;  3GDE A;  3GV6 A;  5C0X I;  3KDF A;  2UU9 L;  1GJX A;  5FO9 B;  4JYA Q;  4LF9 L;  4TSS A;  1JOK A;  2Z0S A;  3L9A X;  5DAU A;  2PI2 E;  4DR5 L;  4BY7 G;  1F9Q A;  3HOY G;  1ZKO A;  4V19 0;  2OTJ A;  3I7F A;  3MC0 B;  2IHE A;  1X3P A;  2NTS A;  2ICI A;  4AYB B;  2EY1 A;  3OIQ A;  1FNU A;  4DV3 L;  1PYW D;  5M9O A;  1Q8K A;  1EWC A;  1S5F D;  2K28 A;  3A8I E;  1EYD A;  3E0J A;  4U68 A;  4IUR A;  3ERO A;  4C3H H;  4A3K B;  4P71 A;  3I56 A;  2NZH A;  5T1I A;  3M4Y A;  2CKZ B;  1V1Q A;  2R7D A;  1GD7 A;  3S1M B;  1STG A;  2LKV A;  1ENF A;  3AFP A;  3OTO L;  5IYD H;  5E7N A;  3OW2 A;  3U58 A;  2WAQ E;  2AUK A;  3K7A B;  1PVO A;  2A5H A;  4RFB A;  5LHY 1;  2QEX A;  1R4Q B;  1JQY D;  1MJE A;  4GKK L;  5IT9 E;  3PIO 3;  4DV5 Q;  4HR7 B;  3J80 i;  4H7B A;  4M1U B;  1C7Y A;  1YNJ C;  2BE5 D;  4BBS B;  1ET9 A;  1II3 A;  1HR0 L;  4EQN A;  4DR4 Q;  2F3W A;  1FR3 A;  3HOV G;  1UE7 A;  1X32 A;  4JBJ A;  3QOL A;  1DOM A;  3RNU A;  3K5O A;  2SNM A;  3F8T A;  3ULL A;  4QIW B;  4KI0 A;  2NVX H;  5K5P A;  3Q8D A; 
#chains in the Genus database with same CATH homology
 5IP7 G;  3TEH B;  5GAG C;  1HR0 Q;  4NPS A;  3PO3 G;  3CW2 C;  4OO1 G;  4HIO A;  1TWA H;  1QZG A;  4A3B G;  4LWC A;  3ZJY C;  2PI2 A;  4C3I H;  3KF6 B;  4IFD G;  1JMC A;  4NXN Q;  3S14 H;  4DR6 L;  2AWN A;  1W2B A;  1IL2 A;  4JI3 L;  4JI0 Q;  4JCV E;  3AYH B;  3RLO A;  1NJI C;  1TWH H;  5GQO A;  1Q46 A;  4POF A;  5AJ3 L;  1IXR A;  1FGU A;  3LGJ A;  3J80 c;  3DM3 A;  3CF5 A;  1XPR A;  1PV4 A;  1IBL L;  1HNW L;  2XGT A;  2VZA A;  4B3M L;  1I5F A;  4GNX B;  3S17 H;  2UXB L;  2Z6K C;  3PO2 H;  2Q2T A;  3KF6 A;  4IOC A;  4JC0 A;  1SRO A;  1N32 L;  5M5Y H;  4AIM A;  1L1O A;  4P74 A;  1PH5 A;  1X3F A;  2R92 H;  5LMU Q;  4JI4 L;  2ZM6 Q;  2N3S A;  1PH9 A;  2AMC B;  4A3J H;  1PH3 A;  4IPC A;  1N8R C;  4A3G G;  2Z6K A;  1NMF A;  3J7Z C;  4GLA C;  5C0X J;  4PZ6 A;  3K8A A;  1EOV A;  3CQZ H;  4DV7 Q;  3PIO A;  2D0O A;  1G6P A;  2RF4 A;  3HKS A;  1JJ2 A;  1DGS A;  1VQK A;  1OXX K;  2IX1 A;  4GOP C;  2IY5 B;  4JI8 L;  1UE6 A;  2R6G A;  3HOX H;  4R4O A;  1XNR L;  2ASB A;  5IYC H;  1CUK A;  1N36 L;  2JQO A;  2PQA B;  4MZ9 A;  4PMW A;  3G6E A;  1QVG A;  4X66 Q;  1KL9 A;  3CP0 A;  1LM0 A;  5C4X G;  4L5S A;  2B63 H;  4OXP A;  4YCV A;  1OXU A;  2UUB L;  1GM5 A;  1L2F A;  1XNR Q;  1D7Q A;  1MIU A;  1M1K C;  4DR5 Q;  4DAM A;  2BH8 A;  1CSQ A;  3BU2 A;  1FVI A;  1X56 A;  4YWL A;  3CCL A;  4DR3 Q;  4JBK A;  4X62 Q;  4NXN L;  4DR6 Q;  5IWA L;  1YVC A;  4R1J A;  5M3F G;  1YHQ A;  4O0A A;  3J81 j;  3UE1 A;  2WAQ G;  5IP9 H;  1XNQ Q;  2I5H A;  2IHF A;  3ICE A;  4JI5 L;  3E9I A;  4RG1 A;  1L1O B;  1SRU A;  4DAY B;  1T9H A;  4DR2 L;  4KHP L;  5C3E G;  4A75 A;  3EIV A;  2ID0 A;  4JI5 Q;  2BA1 A;  4ALP A;  4LF8 L;  1NY4 A;  4O2D A;  1XMQ L;  5JJK A;  3IRB A;  2CWA A;  3S2D H;  3AFQ A;  5IWA Q;  3A74 A;  4DNI A;  1IYJ B;  1VQ8 A;  3PUW A;  1B70 B;  3PCO B;  2JA6 G;  1X65 A;  1E24 A;  3PO2 G;  4DUZ L;  5IP9 G;  4NXM Q;  4GLV B;  4OWX B;  3JC6 6;  3PSI A;  3I4M G;  2VUM G;  2MFI A;  1U5K A;  1HZ9 A;  3HOZ H;  1XMQ Q;  1W3S A;  4A4I A;  3PUX A;  4IJH A;  5C4J H;  4A3K H;  4DV0 Q;  3TS2 A;  4P73 A;  3S24 A;  4JI8 Q;  3CCS A;  4JI2 L;  4X64 L;  4A3B H;  5IT9 c;  4LFC L;  2UXD L;  4OX9 L;  4GLX A;  4POG A;  3KDF B;  1VQ5 A;  1N34 Q;  5IP7 H;  4BBR G;  2K5V A;  2ZJP A;  4AH6 A;  1GO3 E;  2A1A A;  4X66 L;  1IBK Q;  5EAY A;  5J3B A;  3UDF A;  2R7Z G;  3KJP A;  4DV6 L;  3CAM A;  4QY7 A;  3B6Y A;  2K14 A;  1VQA A;  1LUZ A;  1EUJ A;  1EQR A;  1Z47 A;  4UP7 A;  5IY0 A;  5BR8 L;  3CC7 A;  3GTL H;  4DR4 L;  3OYY A;  4GNX A;  1YZ6 A;  1YJN A;  1MKH A;  1VQH A;  4R4I A;  1N32 Q;  3KLW A;  1L1O C;  2ZTD A;  5IYC G;  3KYH C;  2ATW A;  3W1G A;  4WJ3 M;  4DV0 L;  1YBY A;  2VQE Q;  4DV2 L;  4A93 H;  1N34 L;  4GNX C;  1VQ7 A;  3FKI G;  4PZ8 A;  1AE3 A;  4BY1 H;  2CFM A;  1HR0 W;  4R4Q A;  3M85 A;  1TXY A;  3UDI A;  4GOP A;  1X6O A;  2PNH A;  3G48 A;  3T1H Q;  4A3J G;  4IPD A;  1VS0 A;  4UY8 C;  4LF6 L;  2N78 A;  1P16 A;  1VQF A;  4PG3 A;  5AJ3 Q;  4HID A;  3TRZ A;  1X54 A;  4NXM L;  4A93 G;  4YCW A;  1I3Q H;  3I4O A;  3CCV A;  3PF5 A;  2NZO A;  1K73 C;  4B3R Q;  2GVB A;  1VQ9 A;  4X65 Q;  4DPG A;  2YV5 A;  3FKI H;  2QA4 A;  2I0Q A;  2K5H A;  1YHA A;  1Q86 C;  2K75 A;  1VQG A;  4DV1 Q;  2N49 A;  1OXT A;  2K5N A;  1R9T H;  4JV5 Q;  5ELO A;  1IZ6 A;  5IYD G;  1C0A A;  5HY6 A;  1Y1W H;  1A63 A;  1HZB A;  4A3D G;  1LTL A;  2UXD Q;  1E3P A;  3JAM c;  2AHO B;  4B3T L;  4DV4 Q;  3M7N A;  1CKN A;  1JE5 A;  1P8L A;  1OXS C;  2DGY A;  1UEB A;  3PUY A;  3RN5 A;  4A3F H;  1BBU A;  1GKH A;  2F3I A;  3GTG H;  1X3G A;  5ELN A;  4GKJ Q;  1BVS A;  2QGQ A;  3K7U C;  3M4P A;  3W1B A;  4DR1 L;  1HNX L;  4JBM A;  4WJ4 A;  4P72 A;  4JYA L;  3CCM A;  3U50 C;  3HOZ G;  3K7A H;  1K8G A;  4JI6 Q;  2VQF L;  3DLL A;  2VQE L;  2IT1 A;  4QIW E;  1SR3 A;  1VQC A;  1WFQ A;  1Q1E A;  2AWO A;  4DV2 Q;  1K9M C;  1J5E Q;  2GN5 A;  4QL5 A;  4LUZ A;  4A3D H;  3M9B A;  4JG2 A;  5GRO A;  4JI7 L;  2UUB Q;  3K81 C;  1TWC H;  2XTI A;  5C0X G;  3H3V H;  4DV3 Q;  2NVQ H;  2LSS A;  3K80 C;  3PIP A;  5GAE C;  3CC4 A;  3ULP A;  1PH6 A;  1H95 A;  1VCI A;  4BXX H;  1D8L A;  4OO1 I;  4OWW B;  1UE5 A;  4AYB G;  1N33 Q;  1YJ9 A;  3FHW A;  4IPH A;  1CKM A;  5C44 G;  1PH7 A;  1EFW A;  4IPG A;  2EIF A;  2KHJ A;  1XNQ L;  2JA9 A;  2JA5 G;  1V9P A;  3KF8 B;  3JAM i;  2A8V A;  1EIY B;  4DKA C;  1HZC A;  1A0I A;  2H5X A;  2OTL A;  2YU9 H;  4GOP B;  1X9N A;  3HOU G;  4GN4 B;  3I4N H;  3KOJ A;  4LFB L;  1OXV A;  4DV6 Q;  1XJV A;  1I94 Q;  4BA2 I;  2AKW B;  2E8G A;  3NEL A;  4DUZ Q;  2JA7 H;  4JI2 Q;  3OTO Q;  3TQY A;  2K50 A;  3ER0 A;  2LXJ A;  3EBE A;  2B29 A;  2E5L L;  4LF4 L;  2WB1 G;  2KBN A;  1KAW A;  3MXN B;  5LMN W;  1VQD A;  1EWI A;  3PUZ A;  1QUQ B;  2HQL A;  2NVY H;  2E2H H;  3T1Y L;  1YHB A;  1IBM Q;  1VQ6 A;  2WFW A;  4AQY L;  4GKJ L;  1HJP A;  5IE8 A;  4A3F G;  2ALY B;  1I50 H;  1N36 Q;  4JI0 L;  4LF4 Q;  4B3T Q;  3NBH B;  3STB C;  2Y0S G;  1L0W A;  2UUC L;  4BA1 I;  4EX5 A;  1QUQ A;  2A19 A;  4YY3 L;  1XPU A;  4JI1 Q;  1TWF H;  2Q2U A;  3CXC A;  1YJW A;  2R93 G;  3PO3 H;  4LF7 L;  4A3C H;  2HHH L;  1BKB A;  4BY7 H;  1AE2 A;  3WWV A;  3F2B A;  1PHJ A;  1HNZ L;  3PF4 A;  1E22 A;  4AYB E;  3HOX G;  3J7A 5;  1XMO Q;  1VQB A;  1Q12 A;  2HIV A;  1E7Z A;  2KCT A;  2ZM6 L;  1U0L A;  3CCE A;  4LF7 Q;  2Q2I A;  5H1S E;  2R92 G;  4LF8 Q;  1FL0 A;  1PH1 A;  4A3L H;  4A3M G;  1VQ4 A;  2ZTC A;  2NN6 G;  4QJF A;  4UPA A;  3D0F A;  3U4V A;  4K0K L;  4DR2 Q;  4QQB X;  1CSP A;  1NBW A;  3TRE A;  1YIJ A;  4Y7N H;  3BJU A;  1S72 A;  2JEB I;  3L2P A;  1YEZ A;  2ZJR A;  4IO9 A;  1S40 A;  2F4V L;  4A3L G;  4DV5 L;  5C44 H;  2E2I H;  2WP8 J;  2CQO A;  1XMO L;  3GTO H;  4LW1 A;  1AH9 A;  4DUY L;  4IOA A;  3GTM H;  1PA6 A;  3CPW A;  3GTQ H;  1K8A C;  2F4V Q;  4BY1 G;  4XTC S;  1JJC B;  4GKK Q;  1WCM H;  2JA8 H;  2C35 B;  3EN2 A;  2R93 H;  5GAD C;  3A5U A;  2NN6 I;  2DUD A;  2Y0S E;  1C9O A;  4QGU A;  5FJ8 H;  1VQO A;  2N8N A;  3RN2 A;  3VDY A;  1M90 C;  3RZO H;  4TQU S;  1OTC A;  3D31 A;  4MNO A;  5JJL A;  2UUA Q;  2KEN A;  4DR1 Q;  3S1R H;  1CKO A;  1PFS A;  3GD7 A;  3NEN A;  4JI7 Q;  3RR5 A;  4R4C A;  1G29 1;  4LF5 L;  2KCM A;  3CME A;  3E9H A;  4LFC Q;  2NVT H;  3M4Q A;  4X64 Q;  1QVF A;  1ASZ A;  3TS0 A;  4H02 A;  2R7F A;  1SE8 A;  3J81 i;  2FXQ A;  2OWO A;  1QZH A;  1HNZ Q;  4DV1 L;  1NE3 A;  1CKN B;  4BBS H;  2YTY A;  1O7I A;  3S15 H;  4J15 A;  2B63 G;  1KHI A;  4ME3 A;  1HNX Q;  4YCU A;  1PH8 A;  1Q82 C;  2E2J H;  3HOV H;  1B8A A;  2I5L X;  5FLM H;  2ES2 A;  2UXC Q;  4JOI A;  3KJO A;  2JA7 G;  2ZTE A;  3RLF A;  2VY3 A;  2VUM H;  1KXL A;  3RLN A;  3W5O A;  4DR7 L;  5C4X H;  3BZK A;  1HNW Q;  2LXK A;  5JEA G;  2UXB Q;  3HOY H;  2MO1 A;  3M3Y H;  4JI3 Q;  3E0E A;  4APV A;  2RHQ B;  2JE6 I;  3FP9 A;  3PGZ A;  2V1C C;  1WYD A;  1PYS B;  4LFA Q;  4K0K Q;  1VQP A;  1WI5 A;  1ASY A;  3L7Z C;  1VQN A;  3L0O A;  1J5E L;  1Z9F A;  1Q7Y C;  1SN8 A;  1I94 L;  5FLM G;  4DV7 L;  3GTP H;  2YYZ A;  3KFU A;  3GTJ H;  4HJ7 A;  1TWG H;  4B3S L;  4GN3 B;  4FDB A;  3RZD H;  3MEF A;  4R4T A;  1GVP A;  3NEM A;  5BR8 Q;  3G71 A;  3STB D;  3CCJ A;  1EQQ A;  2CCZ A;  3J81 c;  1N33 L;  4LFA L;  1LYL A;  1UE1 A;  4C3J H;  1UWV A;  5M3F H;  1VQL A;  2I5M X;  2EXD A;  1FJG Q;  2HT1 A;  1A8V A;  2JEA I;  2MQH A;  4A3M H;  1WJJ A;  1PYB A;  5IYB H;  3AEV A;  5M5W H;  4P75 A;  1SFO H;  4XIG S;  3ULJ A;  1XTD A;  4LFB Q;  5JJI A;  4AQY Q;  2L15 A;  4YHH L;  1VQE A;  1SLJ A;  1EIF A;  4BBR H;  2K52 A;  2VNU D;  4A3C G;  3F2C A;  1MJC A;  1VQI A;  5JEA J;  4HJ8 A;  4DR3 L;  1K3R A;  3H15 A;  1A62 A;  4KHZ A;  4YHH Q;  4A76 A;  1E1T A;  4DK6 C;  4C2M H;  1KC8 C;  1Y1V H;  2VS1 A;  4UP8 A;  3F2D A;  4JI6 L;  1X55 A;  2OQK A;  4OX9 Q;  3G4S A;  5FJ8 G;  4B3M Q;  2RCN A;  3A0J A;  1XPO A;  1Q81 C;  2EQS A;  5LMN L;  1VQM A;  2UUC Q;  3I4M H;  2B3G A;  1E1O A;  3CCR A;  4NB3 A;  3CD6 A;  4A3I G;  4A3K G;  4KHP Q;  5LMN Q;  4HIM A;  2BH2 A;  1I6H H;  3M4O H;  1KRT A;  5K36 G;  4HIK A;  5GAH C;  4OON A;  2D0P A;  4RMF A;  2MO0 A;  2F52 A;  4GS3 A;  4LUV A;  4B3S Q;  1RL2 A;  4EQ5 A;  2D62 A;  4A3I H;  4LF9 Q;  4L5Q A;  3UE0 A;  3K0X A;  3U4Z A;  4UP9 A;  3GDE A;  2VW9 A;  3CC2 A;  3HOU H;  5C0X I;  3KDF A;  2UU9 L;  1G51 A;  3I2Z A;  4JI4 Q;  1Q1B A;  4YWM A;  4DUY Q;  4JYA Q;  4LF9 L;  5DLQ E;  1K83 H;  1KQS A;  3S1N H;  4DR7 Q;  2Z0S A;  3T1Y Q;  1X3E A;  1IBM L;  4BXX G;  2PI2 E;  3HKZ E;  3S1Q H;  2PMZ E;  3A5Z B;  3GO5 A;  4HJ5 A;  2BA0 A;  4DK3 C;  4DR5 L;  1YIT A;  4BY7 G;  3HOY G;  3HOW H;  2HIX A;  4JOI C;  2OTJ A;  2KHI A;  3I7F A;  2IHE A;  2JK8 A;  1Y14 B;  5M5X H;  1FJG L;  5M3M G;  4A3E H;  1V43 A;  4MTN A;  1SMX A;  1VQJ A;  3BZC A;  2YTV A;  4DV3 L;  2UU9 Q;  2R7Z H;  3I55 A;  3GTK H;  4X65 L;  1B7Y B;  2YTX A;  1NTG A;  1Q8K A;  2VL6 A;  2MNA A;  2PQA A;  2JJQ A;  3S2H H;  5IYB G;  2WB1 E;  2IX0 A;  4YY3 Q;  2K4K A;  3I4N G;  3HOW G;  4KLK A;  4HJ9 A;  4LNQ A;  4C3H H;  1NMG A;  4P71 A;  4GN5 A;  1Y1W G;  4TVA B;  2JA6 H;  3CPF A;  1S3O A;  3I56 A;  1J6Q A;  4L5R C;  4Y52 H;  5HGQ A;  3PUV A;  2NZH A;  3S16 H;  2ZJQ A;  2CKZ B;  3T1H L;  4LUO A;  1V1Q A;  4IFD I;  2R7D A;  3H0G G;  1WCM G;  2JA8 G;  4IFD J;  1GD7 A;  3H3V I;  4LF6 Q;  3AFP A;  3OTO L;  3CMA A;  1KD1 C;  2JA5 H;  3CCQ A;  5IYD H;  3F1Z A;  4JBW A;  1YNX A;  5E7N A;  3OW2 A;  2E5L Q;  4A3G H;  1IBL Q;  3CCU A;  2WAQ E;  1HH2 P;  2Q2H A;  2RHS B;  3SGI A;  3U58 A;  1PVO A;  1JJG A;  1YI2 A;  1KIX A;  3HKZ G;  2UXC L;  2QEX A;  1MJE A;  4GKK L;  4X6A H;  4DV5 Q;  3H0G H;  4IJL A;  2CWP A;  3J80 i;  5LMU L;  3AQQ A;  1C7Y A;  1KRS A;  4L5T A;  5C3E H;  4B3R L;  1N9W A;  1PH4 A;  4BBS G;  2OQ0 A;  4JI1 L;  4OWT B;  1QVC A;  1HR0 L;  4DV4 L;  4DR4 Q;  4PZ7 A;  1K0R A;  1PH2 A;  3HOV G;  3S1M H;  1HZA A;  2GVA A;  1BBW A;  1UE7 A;  4HJA A;  1IBK L;  4LF5 Q;  3ERS X;  3UDG A;  3HFZ B;  4JBJ A;  5M3M H;  4A3E G;  4JV5 L;  1JT8 A;  4YWK A;  3PV0 A;  2OCE A;  3RNU A;  3F8T A;  3ULL A;  2UUA L;  4KI0 A;  1Y1V G;  5FLX c;  1JB7 A;  3UDX A;  2HHH Q;  2NVX H;  4X62 L;  1WOC A;  1EYG A;  2VQF Q;  3Q8D A;  1RIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...