1QZGA

Crystal structure of pot1 (protection of telomere)- ssdna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
b'VIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords telomeric single-stranded DNA
publication title DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
total genus 46
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1qzgA00
1LUZA 1YHBA 2NN6I 2WP8J 3CPFA 4HIMA 2JEAI 1PA6A 1GO3E 2GN5A 4DV4Q 2ID0A 5IYDG 4UP7A 4A3BG 3NBHB 4DR7L 3J80c 1K3RA 3I4NG 4J15A 1S72A 1KL9A 1IBKL 4POGA 3D31A 1N9WA 1W3SA 2K50A 2NZOA 2UUBQ 4LF4Q 4LF7Q 2R7DA 1N33L 4LFBL 2K5HA 4OO1G 2E8GA 1QZGA 3T1YQ 4A3GG 3KFUA 1RL2A 4AH6A 4BBRG 1CSQA 2KBNA 4OXPA 2D0OA 2JK8A 4DUZQ 5IP7G 5GAEC 4IOCA 1IBLQ 1VQ5A 3IRBA 2OTLA 4LW1A 1UEBA 4B3SL 2AKWB 2CWAA 4JI7L 1UE1A 5IYCG 1SROA 4QQBX 1HNZQ 2E2JH 2VQFQ 2UU9L 2VS1A 4A3LG 1YI2A 1R9TH 1Q7YC 2R7ZG 2BA0A 5C3EG 2VUMG 1E1OA 3VDYA 3HFZB 3CQZH 4C3JH 4A3CG 4DV5L 1VQFA 4DR3L 3CP0A 1O7IA 1G291 2YTVA 1I3QH 4JI0L 5LMNQ 4DR2L 4LF9L 1I5FA 4BA1I 3S2HH 4X62Q 2OWOA 4JBKA 3HOUG 1KC8C 2N8NA 4ALPA 4NXNQ 2FXQA 1N32L 5AJ3Q 1A8VA 2VW9A 1Q81C 1EUJA 4AIMA 2HIVA 1PH5A 5IYBG 1FJGL 1V9PA 1N36Q 2IX1A 3A74A 4GKJL 1GVPA 4K0KQ 2UXCL 3GD7A 4GS3A 1AE2A 2XGTA 1PYBA 3CCMA 1TWGH 1EYGA 2EIFA 3PGZA 4XIGS 5M5YH 1L1OC 4R4CA 3I56A 1HNXL 4LNQA 1GM5A 2UXBL 4YCUA 1J5EQ 2WFWA 3H3VH 4JV5L 4QIWE 1IZ6A 3E9IA 3M4OH 2JE6I 3RLOA 3UE1A 4QGUA 1JB7A 1Z47A 2K4KA 4JCVE 5M5WH 1CKMA 1HR0W 1TWFH 3TREA 3S1QH 3M7NA 3STBC 2NVTH 1X3EA 4LF4L 5M3FH 3CW2C 3KF6B 4DUYL 1EQRA 4GOPA 4LF5L 4DR7Q 1IBML 1QVFA 1AH9A 4ME3A 3PO2G 1YHAA 4A3IG 3JAMc 3EIVA 4A75A 1IBKQ 3CXCA 2GVBA 2IY5B 1XJVA 1KXLA 2I5MX 1HZ9A 1N33Q 1JMCA 1S3OA 4B3TQ 1GKHA 3K81C 5FLMH 2JJQA 3E0EA 3CC7A 3G4SA 3RLFA 1KD1C 2R92H 3GTMH 1E22A 2K52A 3PUXA 1EIFA 3CPWA 2ATWA 2JA7H 1KIXA 1HNZL 2VQFL 1KHIA 5FJ8H 3W1GA 3KJOA 3RZDH 4DV6L 2ZM6L 1QUQA 3PIOA 4B3SQ 4JI7Q 4JI6Q 1ASZA 4Y52H 3GTQH 2HQLA 4JI4L 4PG3A 5LMNW 2UU9Q 1PH4A 1PH9A 4XTCS 1VQ6A 3FHWA 2NN6G 5GROA 4DV7L 2JA9A 4LUVA 1SFOH 3HOXH 2R92G 4LF6Q 1WYDA 3F2CA 2HIXA 5M3MH 4GLAC 4DR3Q 2RHSB 4GNXB 1C7YA 1YITA 1PV4A 5AJ3L 2WAQE 1NTGA 1HZBA 4JI1L 4POFA 5FLXc 2Z6KA 2NVYH 3ERSX 4LF9Q 4A3DH 1N36L 2R6GA 3NENA 1PH3A 3PO3H 4P73A 2DGYA 4B3ML 4OONA 1HZCA 2R93H 2PI2E 1EIYB 1N32Q 1B70B 3UDFA 5C4XH 1FJGQ 4JYAQ 3F2DA 3I55A 1YIJA 1BKBA 2Q2HA 3S1RH 3F1ZA 2A1AA 4R4IA 5IP9H 3DM3A 4L5RC 5BR8Q 3CCVA 1VQ8A 3H0GH 4GN4B 1T9HA 1WOCA 1E24A 4MTNA 1HNXQ 1VQGA 2OCEA 3HOYH 2UXBQ 2IHFA 3CC2A 3KF6A 4JV5Q 3RNUA 5EAYA 2AWNA 3PV0A 4HJ7A 1SN8A 4EQ5A 1VQNA 4DV1L 4WJ4A 2PI2A 2RCNA 2OQ0A 4DR4Q 3ER0A 3I4OA 4AQYQ 3M85A 1NY4A 4YWMA 4A3MH 1JJ2A 1I50H 1TXYA 1WI5A 3MXNB 4FDBA 5E7NA 3AEVA 4DUYQ 4L5SA 5IY0A 3EN2A 5LMUL 4LF5Q 3CCEA 1IBMQ 4B3TL 1YJNA 1E7ZA 3M4QA 1VS0A 2MNAA 3S24A 1QVCA 4GOPB 4O2DA 3PUWA 2CFMA 3CC4A 5M3FG 1Q1BA 3M4PA 1UE5A 3CMAA 4JI6L 2JA8G 1UWVA 1VQEA 1PH8A 4YWLA 4JI5Q 3HOVH 1BBWA 1WFQA 4DV6Q 5GQOA 2QGQA 2ZM6Q 4GNXA 2N3SA 4C3HH 4QJFA 1A0IA 2E2IH 5FLMG 4A3EH 4LF6L 1XPUA 3CCUA 3OTOL 4JI4Q 4LFAQ 3F8TA 1K73C 2NVXH 1QUQB 2CWPA 2QA4A 1VQ7A 2JA7G 1V1QA 4DV7Q 4KHPQ 1XNQL 5FJ8G 5IE8A 1BVSA 2UXDL 1MJCA 4DK3C 3H3VI 4C2MH 3TRZA 2ASBA 1S40A 3U58A 5C0XI 2VQEL 2BH8A 4DPGA 2XTIA 4JI1Q 4DV3L 2YTYA 3UDXA 2VNUD 1XMOQ 4BY7H 3HOXG 1VQLA 4B3MQ 1VQAA 4EX5A 3A0JA 4HIKA 5M3MG 5BR8L 2CKZB 4DAYB 1VQBA 1JJCB 2H5XA 2Z0SA 3CCLA 1G51A 4A3DG 4RG1A 3PO3G 2KHJA 1GD7A 1L0WA 5JJIA 2R93G 1EQQA 1WCMH 5ELNA 1JT8A 4IJHA 1UE6A 2HHHL 4JBJA 4PZ7A 3G6EA 3ZJYC 5C4XG 3CF5A 2E2HH 4DR4L 5HY6A 5IP9G 3CCQA 1PVOA 2ALYB 1HZAA 3JAMi 4AQYL 4DV1Q 2N49A 1Q86C 3H0GG 3FP9A 3S15H 4L5QA 4DR6Q 3HOYG 4TQUS 3RN5A 3GTKH 3H15A 4IOAA 4QL5A 1VQHA 5C0XJ 3GTJH 3KOJA 1SR3A 1CKNB 1LYLA 1TWHH 1G6PA 1K9MC 5LMUQ 4JOIC 4OWXB 3G48A 1PFSA 2WB1E 2AMCB 3AQQA 3I2ZA 3M9BA 1NMGA 4IPCA 2V1CC 3K0XA 3J81i 4DR5L 4A3MG 3A5UA 3NEMA 4LUZA 1EFWA 3K80C 4GN3B 1NJIC 1N34L 3KF8B 3HOWH 3ICEA 4JBWA 1B7YB 4KI0A 1VQKA 4JI5L 2WAQG 4IPGA 4Y7NH 2R7FA 2VL6A 2DUDA 3J81c 5GAGC 1KRSA 3GO5A 5IP7H 5J3BA 3KJPA 2ES2A 4GLXA 4APVA 1EOVA 3HKZE 4KHZA 3TEHB 4PMWA 4DR1L 4LFAL 3PF4A 2F52A 4KHPL 1K8GA 1HH2P 3BZCA 3L2PA 1NMFA 3OTOQ 1Q46A 3KYHC 4P72A 1XTDA 1OXSC 1MKHA 5C3EH 4HJAA 3BU2A 4GOPC 1PH1A 1XNQQ 4UP9A 3STBD 4LFCL 2UUAQ 3HOVG 3S17H 2Q2IA 2UXDQ 1XMOL 4A3EG 1XPRA 1Q82C 4P71A 2VQEQ 2YV5A 1X3GA 2RF4A 2Y0SE 3L0OA 4L5TA 4O0AA 3UE0A 4A4IA 4AYBG 4DV3Q 2L15A 4BBSG 2MO0A 4HIOA 1W2BA 3EBEA 1A62A 5C44H 4P75A 3I4MH 3PUYA 4YCVA 1L1OB 5IYBH 2EXDA 1QZHA 2K14A 2JA5H 4B3RL 1SE8A 1BBUA 4R4TA 1MJEA 4TVAB 4IFDI 1D8LA 1MIUA 3CAMA 4BY7G 4HJ5A 5JEAJ 3W1BA 3GDEA 4LUOA 5M5XH 4AYBE 3KDFB 2I5HA 4JI3L 3UDIA 1QVGA 2HHHQ 3KLWA 1NE3A 1CKNA 4UY8C 1RIPA 2YYZA 4X65Q 1KAWA 2VY3A 4DR6L 1D7QA 2ZTEA 3S1MH 1YVCA 1TWCH 2PQAB 4NXML 1FGUA 1HJPA 1Q8KA 1SLJA 1KRTA 1FL0A 5C0XG 1I94L 1X56A 1WJJA 2AHOB 3PSIA 3GTLH 3DLLA 3OW2A 2N78A 2PNHA 4GN5A 3K7UC 3TS2A 4IPHA 2RHQB 2B3GA 1X6OA 3U4ZA 1OTCA 5GAHC 4LF8Q 4RMFA 2UUCL 2K75A 4NB3A 3B6YA 4DR5Q 1X9NA 4GKKQ 4A3KH 2JQOA 1N34Q 1VQOA 1OXUA 5GADC 2ZJQA 3ULLA 1PYSB 4P74A 1Y1WH 4JC0A 2KCMA 3CCRA 3RZOH 4IFDJ 2MFIA 3F2BA 2K5NA 1HR0Q 4X64L 5IWAL 2GVAA 5JJLA 4A3FH 1PH2A 5HGQA 1OXXK 3J7ZC 4DR1Q 1TWAH 1VCIA 3HOWG 1EWIA 2F3IA 1XNRL 3M3YH 4BA2I 1SRUA 1VQIA 2PMZE 4DV0Q 3T1HL 2UUAL 4BY1H 4IO9A 3CD6A 2B63H 5K36G 1Y14B 2BH2A 4R4OA 4JBMA 2NZHA 4JI2L 1L1OA 3Q8DA 4R1JA 1XMQL 4LFCQ 4BXXH 1CUKA 3CCSA 1VQJA 3FKIH 2LXJA 1VQ4A 1PHJA 2IT1A 4JG2A 4YCWA 5ELOA 2K5VA 3AFQA 4X66Q 3BZKA 3A5ZB 1OXVA 4R4QA 1ASYA 3KDFA 3ULPA 4YY3L 4DV2Q 1Q12A 4H02A 2BA1A 2HT1A 1E3PA 3GTGH 1CSPA 5H1SE 4YHHQ 1N8RC 4OWWB 4B3RQ 1Q1EA 2KENA 4LWCA 4YWKA 5JEAG 2MO1A 2JA6H 3HOZH 3BJUA 4GNXC 3UDGA 4A93H 2CCZA 2PQAA 2E5LL 5C44G 2ZTDA 4OO1I 3CMEA 3I4MG 2WB1G 1V43A 4X65L 2LSSA 4UPAA 4JI3Q 4BBSH 1C9OA 1JE5A 2IX0A 4NPSA 1Y1VH 4JOIA 2JA5G 1P8LA 1K0RA 4JYAL 4QY7A 3CCJA 3PF5A 1YZ6A 2AWOA 3I7FA 4A3JH 4OX9L 2ZTCA 2YU9H 3OYYA 1IYJB 1X3FA 4JI8Q 1U5KA 1HNWQ 4MNOA 1KQSA 1CKOA 1LM0A 5IYDH 4A3BH 2IHEA 4NXMQ 1YJWA 2F4VL 3MEFA 3I4NH 3L7ZC 1IXRA 1U0LA 3HKZG 2QEXA 1I94Q 3GTOH 4LF8L 1XPOA 4IPDA 2ZJPA 4GKKL 5C4JH 1YJ9A 1UE7A 3PUVA 4DV4L 4A3GH 3AYHB 2OTJA 4BBRH 1NBWA 5JJKA 4OWTB 1A63A 2LXKA 2Q2TA 2UUCQ 3GTPH 4IFDG 2KCTA 1HR0L 1YNXA 3RLNA 4LF7L 1YEZA 2VZAA 2UUBL 2ZJRA 2B29A 1E1TA 3J81j 3K8AA 1FVIA 3T1YL 4C3IH 1C0AA 2Y0SG 5IYCH 4DNIA 1K8AC 3WWVA 4A76A 2I0QA 1AE3A 2JA8H 4X64Q 3G71A 4GLVB 5IWAQ 4DV0L 2MQHA 4LFBQ 4A3LH 4WJ3M 4A3KG 1OXTA 4DK6C 4DUZL 2R7ZH 1LTLA 2JEBI 3K7AH 2VUMH 4DKAC 3TS0A 2EQSA 1PH6A 1IBLL 1Y1WG 1XNRQ 4A3CH 3T1HQ 4HIDA 1JJGA 3E9HA 3RR5A 3PUZA 2Q2UA 1M90C 3D0FA 4X66L 4JI2Q 1X65A 4A3FG 1L2FA 1PH7A 1XMQQ 3HOUH 3S16H 4DV2L 1VQCA 3S2DH 1VQDA 4BY1G 1K83H 2B63G 4HJ9A 5DLQE 4UP8A 4YHHL 3S14H 2I5LX 5LMNL 1YHQA 1VQ9A 4X62L 3U50C 4YY3Q 4BXXG 4DV5Q 3ULJA 3FKIG 4NXNL 2A19A 4PZ6A 3TQYA 1IL2A 4JI0Q 1YBYA 4DR2Q 3JC66 4DAMA 2D62A 2OQKA 4K0KL 3SGIA 1Z9FA 4KLKA 4IJLA 4X6AH 1I6HH 3PCOB 2E5LQ 3NELA 1SMXA 4PZ8A 1P16A 4JI8L 4GKJQ 1X55A 3AFPA 3PIPA 4MZ9A 1HNWL 2NVQH 1DGSA 3LGJA 2UXCQ 2Z6KC 3U4VA 1WCMG 2A8VA 2JA6G 3HOZG 1VQMA 4OX9Q 1J5EL 4A93G 1B8AA 5IT9c 2YTXA 3W5OA 1X54A 4HJ8A 1H95A 2D0PA 2KHIA 2F4VQ 3J7A5 1VQPA 1Y1VG 3HKSA 2CQOA 3RN2A 3PO2H 4A3IH 1M1KC 3J80i 3S1NH 2C35B 4A3JG 1J6QA
chains in the Genus database with same CATH superfamily
4CGYB 1MSGA 2JEAI 5FO8B 3DMUA 5IT9L 4J15A 3Q0AA 1W3SA 2K50A 1SMYC 4OL7A 2F0JA 1LTAD 3ERQA 1U4LA 1RL2A 2D0OA 1O80A 2JK8A 2NN6H 1GUGA 3VR3A 1VQ5A 3IKJA 2NB0A 2OTLA 4LW1A 4JI7L 4C3IG 1K83B 4PMCA 2F0KA 1HNZQ 1SNDA 4DK0A 1WD1A 2R7ZG 1RCVD 2BA0A 2BDOA 4KHVA 4CBVA 2VUMG 3HFZB 1S5DD 1E2ZA 4C3JH 1KTKA 1GUTA 1RHPA 1H9SA 2Q8TA 3S2HH 1I5FA 1ESFA 4C56C 4X62Q 2OWOA 4JBKA 5D3DA 3HOUG 2N8NA 1UUPA 4ALPA 2J4XA 2VW9A 1BR9A 1EUJA 4JYAL 1IL8A 4GS3A 2L55A 1PYBA 3CCMA 2DNCA 5J22A 1TU2B 1HPCA 3PGZA 2KEEA 3S1NB 1GM5A 3QIAA 4JV5L 4K2KA 2KHSA 3KBGA 1KLGD 3K6OA 1CI3M 3QJYA 3LWEA 3TDQA 3UE1A 2B2YC 2B2WC 2F0HA 3D3RA 1EY9A 2AUJD 5KNBA 4XXEA 3STBC 3M4YA 5M3FH 1QCBD 4DUYL 4LF5L 1X32A 4TKOB 1YHAA 2LY7A 3BVGA 3EIVA 4A75A 2GVBA 2IY5B 4CDFC 5IGEA 1O7LA 3O13A 2IL8A 4B3TQ 1DCZA 1PDQA 2E2JB 2V4DA 3R93A 1E22A 2JA7H 2VQFL 3W1GA 5CV6A 3KJOA 4DV6L 2ZM6L 1QUQA 3RZDH 3JAML 4JI7Q 4JI6Q 3GTQH 4JI4L 5LMNW 3MAQA 1PH4A 5EQ0A 1TIID 2CVRA 2L0CA 1F9RA 2RHSB 4GNXB 1C7YA 2A73B 4HSVA 5T1GA 1YITA 1HZBA 5FLXc 2Z6KA 2NVYH 5T1IA 2ENBA 1F9QA 3NENA 1PH3A 4K5WA 1HZCA 2R93H 2PI2E 1EZ8A 1QNKA 5A35A 2MGSA 5I4DA 4JYAQ 3S1RH 1ONLA 1UNSA 1OO9B 3QO2A 4XDXA 3R3OA 3CCVA 4GN4B 1VDZA 1WOCA 1JOOA 3P75A 1PTOC 5EPJA 2IHFA 4JV5Q 4IZ8A 2EE1A 2AWNA 3PV0A 5CORA 4WJ4A 4DV1L 1M8AA 1J9OA 3GTJB 1BXTA 3I4OA 3OWEB 3OW7A 1NY4A 2QILA 1ET6A 3MXNB 5E7NA 3AEVA 4DUYQ 5IY0A 3EN2A 4X3SA 4LF5Q 1PRTB 4BWGB 3M4QA 3GTMB 5TSSA 4JPBW 4MIUA 4IQZA 3PUWA 2N55A 4Y7NB 1PLFA 3FPPA 3CMAA 3SK4A 2JA8G 4YWLA 4MHEA 4JI5Q 4DV6Q 2ZM6Q 1XYIA 5M3MB 4QJFA 2A6EC 3I4LA 2WINB 1DXMA 4JI4Q 1JICA 4LFAQ 3T16A 1K73C 2NVXH 2CWPA 1AFPA 3BYYB 3I73A 4OIKA 4NKLA 3H3VI 4DK3C 1R4PB 3BVMA 5C0XI 2VQEL 4FF4A 2ZXPA 2KA7A 3HOXG 2JA5B 5A2QE 2Q8IB 5BR8L 1JJCB 3HOYB 2H5XA 2SNMA 2BOSA 1QG7A 5DNFA 1WCMH 1FR3A 1JT8A 5C4XG 1NR2A 4JBJA 2ICIA 3ZJYC 1ZKOA 3G6EA 1WTOA 2Z4IA 3SK8A 2E2HH 4DR4L 4ULLA 1I50B 3S1MB 1TWCB 1PVOA 1KNAA 1HZAA 4AQYL 4DV1Q 2K03A 2EDGA 3H0GG 3H91A 3GTLB 1RODA 4DR6Q 2X69A 4TQUS 3RN5A 3SK5A 1HHVA 2Y0SB 1TWHH 2BE5C 4G7ZC 4JOIC 4OWXB 4A3KB 2WB1E 4IPCA 2V1CC 3J81i 2XNAC 3A5UA 4LUZA 4GN3B 3ICEA 1EY6A 4JBWA 4A3EB 2WAQG 1BCPD 4DNTB 3KBXA 2R7FA 1PRTF 5IP7H 5J3BA 4GLXA 4APVA 2EY5A 4KHZA 4KHPL 2B63B 1HH2P 1PZJD 5F2DA 3VA5A 1OXSC 1MKHA 4HJAA 4BY7B 3I91A 4ZKBB 1YNJC 1PH1A 3HOVG 2Q2IA 1XMOL 1Q82C 2VQEQ 4A4IA 4O0AA 4HN7A 2FHTA 3DUZA 3EBEA 5IYBH 1FGBD 2O2LD 1SE8A 1BBUA 4IFDI 1MIUA 3GDEA 3NTKA 1SAPA 3A54A 3KLWA 2FMMA 1CKNA 4UY8C 4G7HC 4QF4A 1KAWA 3I8ZA 2ZTEA 1YVCA 4RA8A 4GZYC 5CGKA 1V1PB 1FL0A 3URYA 1X56A 3FEWX 4ZQ3A 4GN5A 1JWSD 3TS2A 5HGTA 4IPHA 1CQVA 1QB5D 2G9HD 4RMFA 4CJ0B 4JK1C 4C3IB 2Z6BA 4P2CB 5C6AA 3RZOH 2LS01 5KYIA 4KY5A 2M2LA 1HR0Q 5I9PA 5IWAL 1I4PA 1G8ZD 2EY2A 4IURA 2UUAL 4BY1H 3Q24A 1E2VA 2I46A 3HOUB 4WRDA 1EY0A 5C44B 1XMQL 3I4MB 4KJOA 3EJIA 3NK9A 3FKIH 2IT1A 1A15A 5ELOA 2K5VA 3AU7A 3BZKA 1PMRA 3T4AC 1OXVA 1EQTA 1I4RA 3ULPA 5M5XB 1CSPA 3IL8A 4YHHQ 1N8RC 1PTOB 1Q1EA 4LWCA 3HP3A 3BJUA 2DJGC 4F88A 2RSOA 2ZTDA 1C9OA 1JE5A 2EJGC 3GV6A 1T5EA 1I4HA 4NDXA 3ZYYX 2YU9H 3OYYA 3KLRA 1HNWQ 1Q3LA 2XVSA 1BCPC 2B2UA 1KQSA 1LM0A 4A3BH 2F0PA 4C1NK 2IHEA 1YJWA 3MEFA 3J81E 3I4NH 5AFWA 1U0LA 3HKZG 5BN3A 1XPOA 3ITPA 4IUVA 1UE7A 4DV4L 4A3GH 2WACA 2PZWA 4OWTB 4PV1C 1A63A 1WTQA 2Q2TA 2VZAA 5FLXE 5JPMC 3SDZA 2B29A 4F7XA 1BQQT 1FVIA 3L3OC 3P20A 3T1YL 3H94A 4J8QA 1QWYA 5A2QL 4A76A 5IWAQ 1ESRA 4DV0L 4A3LH 2DY8A 4DK6C 3K5MA 4CKBA 4R8IA 4DUZL 4DKAC 3TS0A 3D8GA 3E9HA 5FO7B 3PUZA 2Q2UA 4X66L 3CQZB 1X65A 4V190 1LTID 1WVLA 1XMQQ 3SEBA 2H4OA 1VQDA 5ELEA 3D6CA 1K83H 4HR7B 5LMNL 2K04A 5EPLA 1IL2A 1C8CA 4JI0Q 4QB4A 4DAMA 2D62A 3Q22A 2KVMA 2KOLA 1I6HH 1H9SB 3MFYA 1IKLA 4JI8L 1CHPD 1X55A 4GKJQ 1K3BC 2UXCQ 4DXGA 2A8VA 3KLSX 3TSSA 1JQYD 3E0JA 3M4OB 4Q0FA 1J5EL 4A93G 1CM9A 5C4JB 1EEID 1X54A 4HJ8A 2D0PA 2KHIA 3VYRA 3RN2A 3J80i 4CDEC 3S1NH 4A3JG 5CMDA 1LUZA 4ZK9B 3G6JB 2GN5A 3NTIA 4DV4Q 4FF1A 4WFN3 2JA8B 2XRSD 3BDCA 1K3RA 4O1NA 1S72A 1G2SA 3MFGA 4DF7A 4LF4Q 3K7AB 1TY2A 4OO1G 4XYQA 2E8GA 3T1YQ 3KFUA 2N88A 2JN4A 4OXPA 3DEOA 4RH6A 1CFMA 3IFDA 4DUZQ 3K59A 5GAEC 1PFMA 3IRBA 3S16B 2VB2X 1UEBA 3GP7A 1D6EC 2EYHA 1VF7A 2CW0D 5IYCG 1ENFA 2PPBC 3HOXB 4KKTA 1VMCA 2E2JH 1Q7YC 1E1OA 2XWJB 4DV5L 1VQFA 4U673 3CP0A 1G291 3VYSA 5LMNQ 4DR2L 2EYFA 1TR5A 5C4XB 5AJ3Q 1U4PA 3N6RA 1PH5A 1FJGL 2HIVA 2CH4A 1N36Q 2F0MA 3A74A 1EYCA 2L5TA 1NNXA 2RBMA 1AE2A 2E2DC 2L9HA 3H0GB 5I2XA 3MEHA 1IYVA 1I4QA 3LNNA 1EYGA 2IJ0A 5M5YH 4R4CA 2TMPA 1Y8NB 2K33A 2UXBL 1J5EQ 2WFWA 4L6TB 2K1BA 3MHBA 3H3VH 4Q5VA 4QIWE 2HDLA 2D9UA 4HEDA 3RLOA 4K6LA 4QGUA 4EGVA 2EY1A 5IGBA 2F03A 5M5WH 1HR0W 3TREA 2WAQB 2X6LA 1L0XB 2M00A 1IBML 1QJOA 1AH9A 3PO2G 4A3IG 2KCCA 2VXWA 3CXCA 1XJVA 1X3PA 2I5MX 2JXMB 2QKIC 3SR1A 3QWNA 3OIQA 4F8MA 5JAVA 3C1EA 5COYA 1QE6A 3HOVB 5IOCA 3GTMH 2K52A 1EIFA 3EFXD 1HNZL 1KHIA 5FJ8H 1H9RA 3OSOA 4E6IA 1KABA 2A6HC 4LAAA 2A68D 2NN6G 2JA9A 4H7BA 3F2CA 3D4WA 5M3MH 2EYJA 2CHBD 5KNCA 3NQIA 3J81L 4A3DH 3PO3H 4LJZC 1GOZA 2DGYA 4OONA 5I6YA 1U4RA 1B70B 1R4QB 5HURA 1FJGQ 3F2DA 3NHHA 2E74C 2LKVA 2I07B 5DM63 1UEAB 3ONAB 2A1AA 4R4IA 1LT5D 3DM3A 5DM73 4B08A 2NYZD 1VQ8A 1HTLD 5FLXL 4RHSA 3J80E 1Z6HA 4G57A 1BF4A 5CV9A 3HOYH 3S1QB 1A2UA 2KECA 2UXBQ 1F2LA 1TS3A 2NVTB 3RNUA 4EQ5A 1VQNA 3J7AV 2IX3A 2PI2A 1JE4A 3GTKB 5ELDA 4N9TA 3ER0A 2RDFA 4HMIA 4MTKA 1I50H 1TXYA 1WI5A 2CW0C 4FDBA 1IBMQ 4B3TL 1TS5A 3KF8A 3MXGA 1VS0A 2R92B 3S24A 4KKSA 4GOPB 4L63B 4K14A 5M3FG 1Q1BA 3M4PA 4JI6L 1LLRD 1B2TA 1VQEA 3QR8A 2OEOA 1BBWA 1WFQA 5GQOA 2KQ3A 5CC4A 2N3SA 1A0IA 3MA2B 4A3EH 1XPUA 3CCUA 3OTOL 2L11A 4BBSH 3E5SA 2L4NA 2JA7G 3MWYW 4KTAA 4RKLA 4UDUC 1MJCA 5E3FA 1GUOA 3NWTA 3BYTB 2ASBA 3U58A 2YTYA 4BY7H 2HUGA 3A0JA 2RKSA 3EA6A 3HRZC 1TVXA 4WORA 1SEBD 4RG1A 1L0WA 3T13A 2R93G 3HKZB 5ELNA 2JYOA 3NP8A 3A8KE 4IJHA 1UE6A 4WJWA 4PZ7A 3RUZA 4A3MB 5I9OA 1XX8A 1BCPF 2HDMA 4CKEA 5E4WC 3AB9A 5FOBB 1Q86C 2B2VA 3FP9A 5M9OA 4L5QA 1XXGA 3DWQA 3H15A 4IOAA 5C0XJ 3KOJA 1CKNB 4G7OC 1LYLA 2KUMA 1G6PA 1K9MC 5CR3A 4N9PA 3C46A 3WOEA 1GXDC 2A68C 3I2ZA 2AMCB 4DR5L 3H6MA 1GUSA 3K80C 3HOWH 3K5OA 4C3HB 4CKCA 5CV7A 4JI5L 4IPGA 3J81c 5GAGC 1KRSA 3GO5A 4AYBB 2ES2A 1EOVA 4LFAL 4QUCA 2F52A 3BZCA 2D5DA 3EVQA 2BCOA 3OTOQ 4ZCKA 3SHLA 2WIIB 4XQJA 3I70A 4DAYA 3PQIA 4N8FA 2IPKD 3IAYA 1X3GA 2RF4A 3L0OA 1CA5A 2L15A 1HRJA 1IYUA 1W2BA 4KD3A 1S5CD 4QUFA 5C44H 1U4MA 4P75A 2K05A 3I4MH 1QILA 1K0SA 2EXDA 4A93B 4QMGA 4B3RL 1B44D 1MJEA 1TS4A 5JEAJ 3W1BA 2DN8A 5M5XH 1EIHA 5CV5A 4ZLTF 1QVGA 5LL6X 3S15B 4A3JB 2GA4B 3E6ZX 5ELCA 2AQ3B 1RIPA 4X65Q 4DR6L 4KKUA 5C4ZA 1D7QA 4XQNA 1ENAA 3TZDA 1TQOA 5IIFA 1ZYRD 1F9PA 3GTOB 1FGUA 1SLJA 3BVZA 5ELBA 1VMPA 2K5DA 2F0FA 3DXJC 1HUMA 3GTPB 1HCZA 3A55A 1SXTA 3OPOA 2B3GA 1C48A 1X6OA 4KV6A 4IUPA 5GAHC 4EQOA 3B6YA 4DR5Q 1SNCA 1TY0A 2XRQD 1B3QA 1VQOA 1OXUA 5DEHA 4IFDJ 3ULLA 1PYSB 1Y1WH 4LMQD 1JCKB 2B2TA 2MFIA 4M8AA 4A3FH 3S17B 5HGQA 3J7ZC 1TWAH 3Q23A 1EY7A 2CQAA 1EWIA 4XYOA 3S9WA 1XNRL 1B3AA 2PMZE 3T1HL 3J80L 4R4OA 1G2TA 4JI2L 1L1OA 1EU4A 4X3UA 3CCSA 1RKNA 1BO0A 4JG2A 3DWPA 3A5ZB 4DAPA 2XWBB 2PQEA 1GJXA 1ASYA 3KDFA 4H02A 1F2ZA 1U9RA 4KJNA 1JORA 4CDDC 5H1SE 1KDAA 3KUPA 4B3RQ 3HOZH 1ILQA 3HG9A 2CCZA 1O78A 2BDNA 1KDCA 1TS2A 1AN8A 3DEPA 4OO1I 2WB1G 2LSSA 4UPAA 4NPSA 5DAUA 1K0RA 1RTOA 1EFID 1YZ6A 5ISRA 2VB3X 4OX9L 3TP6A 3A8IE 1U5KA 4A3IB 5IYDH 2F0DA 1ZEQX 2LMCB 1SSOA 1YNND 3NPPA 4IUUA 2ZJPA 5CYUA 5C4JH 2OTJA 4BBRH 1NBWA 5JJKA 2LXKA 2KCTA 1BBXC 1HR0L 3RLNA 2RVLA 1PXUA 1EL0A 1E1TA 4ZUIA 4DNIA 2NTTA 3SVMA 3NXWA 2I0QA 2JA8H 3OIPA 1B4OA 2ICEC 4GLVB 2MQHA 1FD7D 2MJ8A 4LFBQ 2F3VA 4WJ3M 2JEBI 2B2VC 3K7AH 1IBLL 1PH6A 1XNRQ 1B1ZA 1EWCA 4A3CH 3T1HQ 3J7YW 4JI2Q 4JVZA 1L2FA 2F0NA 1KNEA 2DY7A 3QG1A 3S16H 4BY1G 1I6VC 3S2HB 2JA6B 3A7AB 2E76C 4YHHL 1YHQA 1VQ9A 3R2IA 3TP5A 2NTSA 1ZYRC 3FKIG 1Y1VB 1SYEA 1YBYA 2OQKA 4K0KL 3SGIA 2L12A 1Z9FA 4KLKA 3UI2A 4IJLA 1ENCA 2RDHA 4X6AH 1S4ZA 3PCOB 2F0OA 1XWEA 2DJFC 1P16A 2NBFA 3AFPA 1HNWL 3TP8A 5CBEE 2Z6KC 3U4VA 2K7VA 1T5XD 5CBAE 4OX9Q 1J8IA 1QOHA 1B8AA 3W3AA 3W5OA 1QNUA 1VQPA 3HKSA 1WTPA 5FO9B 2NN6I 2WP8J 4UHVA 1PA6A 1SJED 3NBIA 3A8JE 2Q8RE 2A5HA 4A3BG 3NBHB 4DR7L 2RSNA 3J80c 3I4NG 3BG3A 4HAEA 1KL9A 2XSCA 1IBKL 3HS0C 1N9WA 2NZOA 3BZDB 2R7ZB 2VUMB 2R7DA 1N33L 2K5HA 3KK7A 1QZGA 4PMBA 4A3GG 2ZXOA 4AH6A 2KBNA 4I7AA 4IOCA 3GTQB 1IBLQ 4B3SL 2AKWB 3S2DB 2UU9L 2VS1A 4A3LG 1FNWA 1R9TH 5NUCA 1F77A 1ICWA 4NMZA 2NZ1D 5C3EG 3VDYA 3SE0A 2NVYB 3F2UA 4JI0L 2R93B 2B2TC 2O4XA 2OXPA 5EBCA 1KC8C 1YNNC 2FXQA 1N32L 1D5XC 3S1RB 1A8VA 4K2LA 2NVQB 4V0BA 1Q81C 4AIMA 2HCCA 4FVMA 4GKJL 3ND8A 1GVPA 4K0KQ 2UXCL 2H1EA 2XGTA 1TWGH 2KCNA 4ODGA 4XIGS 1L1OC 3I56A 3OOCA 4LNQA 4MN3A 2MP1A 1IZ6A 1WTWA 4CJ1B 1Z47A 2K4KA 3MXNA 1CT1D 2WKDA 3S1QH 4ZRZA 3M7NA 2NVTH 3J7AF 5EKLA 1X3EA 4LF4L 2P5ZX 2WKCA 3CW2C 3SK6A 1EQRA 4DR7Q 1CHQD 1QVFA 1IBKQ 1AEXA 2AUKA 5IGCA 1HZ9A 1N33Q 1CA6A 1JMCA 3MXUA 3K81C 1G91A 5FLMH 2JJQA 3W2DA 3L9AX 1KD1C 2R92H 3CPWA 1KIXA 3DHQA 4M1UB 1FNUA 4B3SQ 2NWGA 1ASZA 2NVXB 1Z7TA 2HQLA 1EY8A 1I3QB 4PG3A 2UU9Q 4XTCS 1EEFD 1VQ6A 5GROA 4DV7L 4LUVA 4LF6Q 5C5LA 1PV4A 5AJ3L 1NTGA 4POFA 3ERSX 1N36L 1JR0D 4P73A 4B3ML 2HCIA 1EIYB 1N32Q 4UAIA 3UDFA 3VR2A 3I55A 1YIJA 4IALA 1BKBA 1STGA 3AMUA 5IP9H 4L5RC 5I2YA 2EXZA 1TWFB 3CC2A 3KF6A 4KN7C 4IUTA 4ZAIA 2PW7A 5BN5A 2F1MA 2HQEA 1DD2A 3BS1A 3NE5B 1HA5A 5EGTA 4A3MH 2EYMA 3D4DA 4YWMA 2B39A 1SE3A 3VR4A 5FK9C 3N52A 2Z1CA 1VF5C 3CCEA 1Y69U 2MNAA 1QVCA 1SBBB 1ICFB 3HGBA 4IUQA 4O2DA 5IGDA 1UE5A 1HUNA 1AP0A 5IGFA 3R2TA 2EYOA 1UWVA 1LT3D 4RGOS 1SFOB 1DONA 2K28A 2RDGA 4C3HH 5CV8A 1CTMA 3F8TA 5D14A 1QUQB 3TMEA 1V1QA 4DV7Q 5FJ8G 4DA2A 1SNPA 3WOFA 2C5CA 3H09A 3QOJA 3TRZA 3TP7A 1S40A 1JC7A 1EOTA 2BH8A 4DPGA 4DV3L 2WB1B 3UDXA 1SMYD 2F0LA 4B3MQ 1VQAA 4CHTB 2B8FA 5M3MG 4DGZA 1II3A 2CKZB 4DAYB 1WTRA 2F0UA 1JOQA 2Z0SA 1G51A 1LTBD 4DU9A 4A3DG 3PO3G 2F0GA 2KHJA 1GD7A 2O5JC 5JJIA 3CHBD 1NSNS 1EQQA 4HTHA 1STHA 2HHHL 5C0XH 2EJFC 1B9NA 1BOSA 2R3ZA 3K57A 2F0EA 3CF5A 3IFTA 1V1PA 2ALYB 4K8IA 1G6ZA 4XQQA 3S15H 3HOYG 4QL5A 5C3WA 1VQHA 3GTJH 3EQLC 1SR3A 3T53B 1LTTD 3RMHA 3G48A 3AQQA 4RCNA 1DZ1A 4FO2A 1IKMA 2B2UC 2E2IB 1GUNA 1VQKA 1B7YB 4H44C 5K36H 4Y7NH 4CDCC 3KJPA 4HCEA 3PF4A 4BY1B 1K8GA 2ZXRA 4C2MB 3TN2A 1DOMA 1EY5A 1Q46A 4P72A 1XTDA 3U9SA 3FKIB 5J1ZA 4UP9A 3STBD 3S17H 3C2PA 4FYDA 1B50A 4TSSA 3OHXC 4A3EG 1CZWA 1ET9A 3V2TA 5I6WA 1JJGA 1HQMC 2YV5A 4L5TA 2Y0SE 4C3JG 5JEAH 4BBSG 4DN4M 4DV3Q 2MO0A 4HIOA 1A62A 1BCPB 4HMJA 1L1OB 4YCVA 1QZHA 2JA5H 4TVAB 4RWSC 1D8LA 2OT2A 1O7YA 3CAMA 1S5ED 4HJ5A 4BY7G 1UAPA 3KDFB 4JI3L 2F0SA 3UDIA 2HHHQ 2YU9B 4OIJA 4DFAA 1JWMD 4FNFA 1DJRD 5C5MA 1SYBA 4A3BB 2VY3A 2NUCA 3I4NB 1O7ZA 3S1MH 1TWCH 1H9KA 1Q8KA 2R61A 2KEDA 3VR6A 2HD3A 4IFDH 2AHOB 3OMCA 3GTLH 3DLLA 2N78A 5C3XA 2X6GA 3U4ZA 3NSWA 5EPKA 3LX0A 1OTCA 4LF8Q 2K75A 4NB3A 1X9NA 4GKKQ 4A3KH 5GADC 1A3TA 4JC0A 4OHJA 3CCRA 2IW3A 3F2BA 1RJTA 1Y8PB 4X64L 5C3EB 1JWUD 4B9WA 1PTOD 4IN3A 4F87A 5JJLA 1PH2A 1VCIA 1STYA 3HOWG 3D6WA 1SRUA 1VQIA 2B63H 3I72A 2O5IC 2BH2A 4JBMA 4ZUJA 4BXXH 1CUKA 4I7ZC 1HFGA 1PHJA 2L1BA 4YCWA 3AFQA 4KD4A 4KY6A 4DV2Q 2HT1A 1SNOA 2F0TA 4OWWB 2KENA 4YWKA 2JA6H 1I6HB 3UDGA 2PQAA 2E5LL 4O42A 5C44G 3LWUA 3I4MG 1V43A 4X65L 4JI3Q 2A6ED 4R9WA 2IX0A 1Y1VH 2F3WA 2M9VA 4JOIA 4RFBA 3CCJA 2AWOA 3I7FA 1X3FA 4LK1C 4K6DA 3R8BA 4QCLA 2QDBA 2F4VL 2EYPA 1IXRA 2QEXA 4CJ2C 1LABA 4G4KA 4IPDA 1YJ9A 2DNEA 3AYHB 1L0YB 3NUCA 4LF7L 1SNQA 1YEZA 2UUBL 2ZJRA 3I90A 3M3YB 3J81j 2QCPX 1MBYA 4C3IH 2Z9HA 4OEMB 2IWHA 1AE3A 4X64Q 2R7ZH 2VUMH 1GHKA 2MHVA 3GQBA 2EQSA 1SYGA 1Y1WG 5G3LD 1M90C 1B9MA 2JP1A 3D0FA 4A3FG 2C9OA 3HOUH 2LFNA 2BE5D 4RHRA 3VYTA 2SNSA 3GTGB 3EROA 3S2DH 2SDFA 5DLQE 2I5LX 2PCFB 4XT1B 1LO5D 1SE2A 1D5ZC 2RCFA 1V1OA 3ULJA 4NXNL 2PZUA 3TQYA 3JC66 4ZYSA 1PTOH 1NUCA 2E5LQ 5M5YB 2E75C 1EZ6A 1RTNA 2QDLA 4MZ9A 2NVQH 3LGJA 4RAUC 3HOZG 1WCMG 4NW2A 1AW7A 1VQMA 1YNJD 2QW7A 3K5LA 3KLSA 5IT9c 4IUNA 1STEA 1H95A 5M5WB 2F4VQ 1W6JA 3J7A5 3CRKC 5FKAC 2CQOA 1BUVT 2C35B 1J6QA 1YHBA 3CPFA 4FP5D 4HIMA 1STBA 1GO3E 4B9XA 3FPUB 2ID0A 5IYDG 4UP7A 1WTHA 4POGA 3D31A 3TBIB 1JOKA 4LF7Q 2K5QA 4H13C 2UUBQ 3VYUA 4LFBL 1D1KA 1LTSD 1MI2A 3Q6SA 4BBRG 2K5WA 1CSQA 1RDPD 2F0QA 5IGGA 4C1NI 5IP7G 4K5XA 4NP5A 1LTRD 2CWAA 1UE1A 4QIWB 1SROA 4QQBX 3S14B 2VQFQ 1YI2A 2Z4HA 3OWFA 3CQZH 1Q8IA 2EYLA 4A3CG 1LT4D 4DR3L 4A3DB 3PO3B 1O7IA 2YTVA 3FVQA 1H9MA 1I3QH 4LF9L 2D2CC 4BA1I 1F9SA 1D1IA 4DXFA 4NXNQ 4FF3A 2Z8LA 3FDTA 2IX1A 5IYBG 1V9PA 3GD7A 2RA4A 3X3MA 4OGQC 2K32A 3G7LA 2EIFA 3PO2B 1BDOA 1HNXL 3X3NA 4RGTA 2J0TD 4RCOA 4YCUA 1TKWB 3CRLC 2MUYA 1EU3A 2JE6I 3E9IA 3M4OH 1WTVA 1JB7A 4JCVE 3K5NA 1CKMA 1TWFH 1DOKA 3CU7A 4HSPA 1PZKD 3KF6B 4GOPA 1F2MA 4ABNA 3VA7A 3C1FA 4JW0A 3MXPA 4ME3A 3JAMc 4L8JA 1KXLA 5KYLA 3FRPB 4KMUC 1S3OA 4DK1A 1GKHA 1Q90A 2J7ZA 3E0EA 3CC7A 3G4SA 3RLFA 1CQFA 1GHJA 3PUXA 2ATWA 3V05A 1PZID 4ZKCB 3PIOA 4C3JB 2FFKB 4KY7A 1PFBA 4BBSB 4Y52H 1FNVA 3P7JA 2PO4A 4EQNA 1PH9A 3FHWA 3PIO3 1S5BD 1SFOH 3HOXH 3MVVA 1WYDA 2HIXA 1SYCA 4GLAC 4DR3Q 2WAQE 1M4VA 4JI1L 1JB3A 3ND9A 1IW7D 4LF9Q 2R6GA 1EWHA 4ID6A 1GUWA 3E3XA 4DAVA 5C4XH 2Q2HA 4N8X1 5EKIA 3F1ZA 4I65A 5BR8Q 1EYDA 2XN9C 3H0GH 1PFNA 4FXKC 1T9HA 1E24A 4MTNA 1HNXQ 1VQGA 2OCEA 3RD4A 1V8QA 3MZ5A 5EAYA 4HJ7A 5M3FB 1SN8A 1SYDA 2RCNA 5EBDA 1HXYD 2OQ0A 1LT6D 4DR4Q 2F0IA 1K28A 3M85A 4AQYQ 1JJ2A 1W6KA 2G9DA 3QOLA 3DWAA 1A3VA 1C4QA 4L5SA 1DYQA 5C4HA 5LMUL 5KGUA 1YJNA 1E7ZA 5KEEA 2JA7B 3HOWB 2PZTA 2CFMA 3RZDB 3CC4A 1CZGA 3D4RA 1SE4A 1H9JA 1RF2D 1PH8A 3HOVH 2E2IH 2QGQA 4GNXA 4J6HA 4LF6L 4RKBA 5L37A 5FLMG 1KDBA 1EYAA 1I4XA 2EZVA 1VQ7A 2R92G 2QA4A 4KHPQ 1XTCD 1XNQL 4Z9CB 1NCVA 5IE8A 1BVSA 2UXDL 4C2MH 5EKKA 5D65A 2XTIA 4JI1Q 2A74C 1XMOQ 2VNUD 1HQRD 1VQLA 3P1HA 4EX5A 3OMGA 4HIKA 1VQBA 5CV4A 2SOBA 4H0LC 3CCLA 5JOBA 5JPNC 3FMCA 1K8OA 1HFNA 1LACA 1AZQA 3K0YA 1DOLA 5HY6A 5IP9G 3CCQA 3JAMi 2B8GA 1NAPA 2EVBA 2N49A 3WDNA 3CKIB 1STAA 3GTKH 5LMUQ 1X3QA 1A6XA 1MGSA 1PFSA 3M9BA 2F0WA 1NMGA 3K0XA 1Y1WB 4A3MG 1S5FD 3NEMA 1EFWA 1N34L 1NJIC 4ME5A 1HTPA 3KF8B 1SYFA 4KI0A 2G5DA 5LHY1 2VL6A 4A3FB 1IW7C 2DUDA 1TWAB 4X3TA 3HKZE 4OELB 3TEHB 4PMWA 4DR1L 2ZT9C 3L2PA 1NMFA 2F4IA 3KYHC 2PYKA 5C3EH 3BU2A 4GOPC 2WV6D 4KK7A 1XNQQ 4LFCL 2UUAQ 2UXDQ 1I4GA 5IT9E 4C3HG 2SEBD 1XPRA 1LV9A 5K5PA 4P71A 3UE0A 2MPMA 4AYBG 1PRTD 3MC0B 1ILPA 3SXHA 3M7GA 3HOZB 3PUYA 1WCMB 4X3KA 1LTGD 1STNA 1EIGA 2K14A 4R4TA 2E2HB 3TZUA 3VR5A 1SJHD 3QB3A 4LUOA 4AYBE 2I5HA 1A2TA 1NE3A 2A6HD 2PMZB 1DM0B 2YYZA 4PQXA 1TWHB 5LL6S 2A69D 2PQAB 4NXML 1PTOF 5C0XG 1HJPA 1E0BA 1RD9D 1KRTA 2EJMA 1I94L 1WJJA 2TSSA 3PSIA 3OW2A 4RGNA 2EOTA 2PNHA 4BBRB 3K7UC 4ILWA 5KRUA 2RHQB 2AQ1B 2UUCL 1SDFA 4FF2A 2JQOA 2PNRC 4FXGC 3C3LA 1N34Q 2ZJQA 4P74A 2KCMA 3BDLA 1E2WA 2K5NA 3HZXA 1MHWC 1IHZA 2GVAA 5J39A 1OXXK 4DR1Q 3M3YH 2F3IA 4BA2I 1K8MA 4DV0Q 3CD6A 5IODA 1TT2A 4U68A 4IO9A 5K36G 1EQVA 1Y14B 2NZHA 3Q8DA 2FJ2A 4R1JA 1WTXA 4LFCQ 1VQJA 1VQ4A 2LXJA 2K6AA 1ML0D 1CK1A 4X66Q 3MTSA 2EY6A 1WD0A 2B2YA 2B2WA 3T56B 4HCSA 4R4QA 4YY3L 1Q12A 2BA1A 3BDOA 1E3PA 3GTGH 1KAAA 2QEJC 2QF7A 2MO1A 5JEAG 4GNXC 2JSOA 4A93H 3JAME 2F0VA 3CMEA 4YIJA 1B53A 2JA5G 2XIWA 1P8LA 4QY7A 3PF5A 2CH4W 4A3JH 2ZTCA 1IYJB 4JI8Q 3H3VC 3A7LA 4MNOA 1CKOA 4DNRB 2FINB 3A56A 5EJWA 4NXMQ 3K58A 4K5VA 3L7ZC 3GV3A 1I94Q 3NBHA 3GTOH 2OF1A 5E4XA 4LF8L 1D5MC 3RZOB 4GKKL 4OO1H 3I3CA 4R8NA 5D3IB 3PUVA 5G3LF 5KNDA 4FXDA 2PW5A 2UUCQ 3GTPH 3PMFA 4IFDG 1YNXA 4TRDA 3K8AA 1C0AA 2Y0SG 5IYCH 1K8AC 3WWVA 3G71A 1MSHA 1PRTC 3NTHA 4A3KG 1OXTA 1LTLA 4PNYA 2FMCA 1BNZA 5JVG3 4HIDA 1R9TB 3RR5A 4KN4C 1PYWD 4XT3B 4EVOA 1SNMA 2EPBA 1PH7A 2KJXA 4RGMA 3V96A 1NR4A 4DV2L 1VQCA 4EQPA 2B63G 4HJ9A 4UP8A 3S14H 3T51B 4X62L 3U50C 4YY3Q 2A69C 4BXXG 4DV5Q 1FYCA 1Y8OB 1KLUD 2A19A 4PZ6A 5JVH3 4DR2Q 5ELFA 5JJZA 5BN4A 4K8JA 1TWGB 1ZXTA 3NQTA 3NELA 2RQXA 1SMXA 4PZ8A 4S3SA 1HA6A 2AQ2B 3PIPA 3NWSA 3HEJA 1DGSA 4BS9A 5E1FA 2JA6G 1MD2D 1D2BA 5KIXA 1EY4A 3PIP3 2YTXA 3U9OA 4A3GB 3DM1A 4J1MA 1F2YA 1Y1VG 3PO2H 2K01A 4A3IH 1M1KC 1A3UA 1AZPA
chains in the Genus database with same CATH topology
1LUZA 1YHBA 2NN6I 2WP8J 3CPFA 4HIMA 2JEAI 1PA6A 1GO3E 2GN5A 4DV4Q 2ID0A 5IYDG 4UP7A 4A3BG 3NBHB 4DR7L 3J80c 1K3RA 3I4NG 4J15A 1S72A 1KL9A 1IBKL 4POGA 3D31A 1N9WA 1W3SA 2K50A 2NZOA 2UUBQ 4LF4Q 4LF7Q 2R7DA 1N33L 4LFBL 2K5HA 4OO1G 2E8GA 1QZGA 3T1YQ 4A3GG 3KFUA 1RL2A 4AH6A 4BBRG 1CSQA 2KBNA 4OXPA 2D0OA 2JK8A 4DUZQ 5IP7G 5GAEC 4IOCA 1IBLQ 1VQ5A 3IRBA 2OTLA 4LW1A 1UEBA 4B3SL 2AKWB 2CWAA 4JI7L 1UE1A 5IYCG 1SROA 4QQBX 1HNZQ 2E2JH 2VQFQ 2UU9L 2VS1A 4A3LG 1YI2A 1R9TH 1Q7YC 2R7ZG 2BA0A 5C3EG 2VUMG 1E1OA 3VDYA 3HFZB 3CQZH 4C3JH 4A3CG 4DV5L 1VQFA 4DR3L 3CP0A 1O7IA 1G291 2YTVA 1I3QH 4JI0L 5LMNQ 4DR2L 4LF9L 1I5FA 4BA1I 3S2HH 4X62Q 2OWOA 4JBKA 3HOUG 1KC8C 2N8NA 4ALPA 4NXNQ 2FXQA 1N32L 5AJ3Q 1A8VA 2VW9A 1Q81C 1EUJA 4AIMA 2HIVA 1PH5A 5IYBG 1FJGL 1V9PA 1N36Q 2IX1A 3A74A 4GKJL 1GVPA 4K0KQ 2UXCL 3GD7A 4GS3A 1AE2A 2XGTA 1PYBA 3CCMA 1TWGH 1EYGA 2EIFA 3PGZA 4XIGS 5M5YH 1L1OC 4R4CA 3I56A 1HNXL 4LNQA 1GM5A 2UXBL 4YCUA 1J5EQ 2WFWA 3H3VH 4JV5L 4QIWE 1IZ6A 3E9IA 3M4OH 2JE6I 3RLOA 3UE1A 4QGUA 1JB7A 1Z47A 2K4KA 4JCVE 5M5WH 1CKMA 1HR0W 1TWFH 3TREA 3S1QH 3M7NA 3STBC 2NVTH 1X3EA 4LF4L 5M3FH 3CW2C 3KF6B 4DUYL 1EQRA 4GOPA 4LF5L 4DR7Q 1IBML 1QVFA 1AH9A 4ME3A 3PO2G 1YHAA 4A3IG 3JAMc 3EIVA 4A75A 1IBKQ 3CXCA 2GVBA 2IY5B 1XJVA 1KXLA 2I5MX 1HZ9A 1N33Q 1JMCA 1S3OA 4B3TQ 1GKHA 3K81C 5FLMH 2JJQA 3E0EA 3CC7A 3G4SA 3RLFA 1KD1C 2R92H 3GTMH 1E22A 2K52A 3PUXA 1EIFA 3CPWA 2ATWA 2JA7H 1KIXA 1HNZL 2VQFL 1KHIA 5FJ8H 3W1GA 3KJOA 3RZDH 4DV6L 2ZM6L 1QUQA 3PIOA 4B3SQ 4JI7Q 4JI6Q 1ASZA 4Y52H 3GTQH 2HQLA 4JI4L 4PG3A 5LMNW 2UU9Q 1PH4A 1PH9A 4XTCS 1VQ6A 3FHWA 2NN6G 5GROA 4DV7L 2JA9A 4LUVA 1SFOH 3HOXH 2R92G 4LF6Q 1WYDA 3F2CA 2HIXA 5M3MH 4GLAC 4DR3Q 2RHSB 4GNXB 1C7YA 1YITA 1PV4A 5AJ3L 2WAQE 1NTGA 1HZBA 4JI1L 4POFA 5FLXc 2Z6KA 2NVYH 3ERSX 4LF9Q 4A3DH 1N36L 2R6GA 3NENA 1PH3A 3PO3H 4P73A 2DGYA 4B3ML 4OONA 1HZCA 2R93H 2PI2E 1EIYB 1N32Q 1B70B 3UDFA 5C4XH 1FJGQ 4JYAQ 3F2DA 3I55A 1YIJA 1BKBA 2Q2HA 3S1RH 3F1ZA 2A1AA 4R4IA 5IP9H 3DM3A 4L5RC 5BR8Q 3CCVA 1VQ8A 3H0GH 4GN4B 1T9HA 1WOCA 1E24A 4MTNA 1HNXQ 1VQGA 2OCEA 3HOYH 2UXBQ 2IHFA 3CC2A 3KF6A 4JV5Q 3RNUA 5EAYA 2AWNA 3PV0A 4HJ7A 1SN8A 4EQ5A 1VQNA 4DV1L 4WJ4A 2PI2A 2RCNA 2OQ0A 4DR4Q 3ER0A 3I4OA 4AQYQ 3M85A 1NY4A 4YWMA 4A3MH 1JJ2A 1I50H 1TXYA 1WI5A 3MXNB 4FDBA 5E7NA 3AEVA 4DUYQ 4L5SA 5IY0A 3EN2A 5LMUL 4LF5Q 3CCEA 1IBMQ 4B3TL 1YJNA 1E7ZA 3M4QA 1VS0A 2MNAA 3S24A 1QVCA 4GOPB 4O2DA 3PUWA 2CFMA 3CC4A 5M3FG 1Q1BA 3M4PA 1UE5A 3CMAA 4JI6L 2JA8G 1UWVA 1VQEA 1PH8A 4YWLA 4JI5Q 3HOVH 1BBWA 1WFQA 4DV6Q 5GQOA 2QGQA 2ZM6Q 4GNXA 2N3SA 4C3HH 4QJFA 1A0IA 2E2IH 5FLMG 4A3EH 4LF6L 1XPUA 3CCUA 3OTOL 4JI4Q 4LFAQ 3F8TA 1K73C 2NVXH 1QUQB 2CWPA 2QA4A 1VQ7A 2JA7G 1V1QA 4DV7Q 4KHPQ 1XNQL 5FJ8G 5IE8A 1BVSA 2UXDL 1MJCA 4DK3C 3H3VI 4C2MH 3TRZA 2ASBA 1S40A 3U58A 5C0XI 2VQEL 2BH8A 4DPGA 2XTIA 4JI1Q 4DV3L 2YTYA 3UDXA 2VNUD 1XMOQ 4BY7H 3HOXG 1VQLA 4B3MQ 1VQAA 4EX5A 3A0JA 4HIKA 5M3MG 5BR8L 2CKZB 4DAYB 1VQBA 1JJCB 2H5XA 2Z0SA 3CCLA 1G51A 4A3DG 4RG1A 3PO3G 2KHJA 1GD7A 1L0WA 5JJIA 2R93G 1EQQA 1WCMH 5ELNA 1JT8A 4IJHA 1UE6A 2HHHL 4JBJA 4PZ7A 3G6EA 3ZJYC 5C4XG 3CF5A 2E2HH 4DR4L 5HY6A 5IP9G 3CCQA 1PVOA 2ALYB 1HZAA 3JAMi 4AQYL 4DV1Q 2N49A 1Q86C 3H0GG 3FP9A 3S15H 4L5QA 4DR6Q 3HOYG 4TQUS 3RN5A 3GTKH 3H15A 4IOAA 4QL5A 1VQHA 5C0XJ 3GTJH 3KOJA 1SR3A 1CKNB 1LYLA 1TWHH 1G6PA 1K9MC 5LMUQ 4JOIC 4OWXB 3G48A 1PFSA 2WB1E 2AMCB 3AQQA 3I2ZA 3M9BA 1NMGA 4IPCA 2V1CC 3K0XA 3J81i 4DR5L 4A3MG 3A5UA 3NEMA 4LUZA 1EFWA 3K80C 4GN3B 1NJIC 1N34L 3KF8B 3HOWH 3ICEA 4JBWA 1B7YB 4KI0A 1VQKA 4JI5L 2WAQG 4IPGA 4Y7NH 2R7FA 2VL6A 2DUDA 3J81c 5GAGC 1KRSA 3GO5A 5IP7H 5J3BA 3KJPA 2ES2A 4GLXA 4APVA 1EOVA 3HKZE 4KHZA 3TEHB 4PMWA 4DR1L 4LFAL 3PF4A 2F52A 4KHPL 1K8GA 1HH2P 3BZCA 3L2PA 1NMFA 3OTOQ 1Q46A 3KYHC 4P72A 1XTDA 1OXSC 1MKHA 5C3EH 4HJAA 3BU2A 4GOPC 1PH1A 1XNQQ 4UP9A 3STBD 4LFCL 2UUAQ 3HOVG 3S17H 2Q2IA 2UXDQ 1XMOL 4A3EG 1XPRA 1Q82C 4P71A 2VQEQ 2YV5A 1X3GA 2RF4A 2Y0SE 3L0OA 4L5TA 4O0AA 3UE0A 4A4IA 4AYBG 4DV3Q 2L15A 4BBSG 2MO0A 4HIOA 1W2BA 3EBEA 1A62A 5C44H 4P75A 3I4MH 3PUYA 4YCVA 1L1OB 5IYBH 2EXDA 1QZHA 2K14A 2JA5H 4B3RL 1SE8A 1BBUA 4R4TA 1MJEA 4TVAB 4IFDI 1D8LA 1MIUA 3CAMA 4BY7G 4HJ5A 5JEAJ 3W1BA 3GDEA 4LUOA 5M5XH 4AYBE 3KDFB 2I5HA 4JI3L 3UDIA 1QVGA 2HHHQ 3KLWA 1NE3A 1CKNA 4UY8C 1RIPA 2YYZA 4X65Q 1KAWA 2VY3A 4DR6L 1D7QA 2ZTEA 3S1MH 1YVCA 1TWCH 2PQAB 4NXML 1FGUA 1HJPA 1Q8KA 1SLJA 1KRTA 1FL0A 5C0XG 1I94L 1X56A 1WJJA 2AHOB 3PSIA 3GTLH 3DLLA 3OW2A 2N78A 2PNHA 4GN5A 3K7UC 3TS2A 4IPHA 2RHQB 2B3GA 1X6OA 3U4ZA 1OTCA 5GAHC 4LF8Q 4RMFA 2UUCL 2K75A 4NB3A 3B6YA 4DR5Q 1X9NA 4GKKQ 4A3KH 2JQOA 1N34Q 1VQOA 1OXUA 5GADC 2ZJQA 3ULLA 1PYSB 4P74A 1Y1WH 4JC0A 2KCMA 3CCRA 3RZOH 4IFDJ 2MFIA 3F2BA 2K5NA 1HR0Q 4X64L 5IWAL 2GVAA 5JJLA 4A3FH 1PH2A 5HGQA 1OXXK 3J7ZC 4DR1Q 1TWAH 1VCIA 3HOWG 1EWIA 2F3IA 1XNRL 3M3YH 4BA2I 1SRUA 1VQIA 2PMZE 4DV0Q 3T1HL 2UUAL 4BY1H 4IO9A 3CD6A 2B63H 5K36G 1Y14B 2BH2A 4R4OA 4JBMA 2NZHA 4JI2L 1L1OA 3Q8DA 4R1JA 1XMQL 4LFCQ 4BXXH 1CUKA 3CCSA 1VQJA 3FKIH 2LXJA 1VQ4A 1PHJA 2IT1A 4JG2A 4YCWA 5ELOA 2K5VA 3AFQA 4X66Q 3BZKA 3A5ZB 1OXVA 4R4QA 1ASYA 3KDFA 3ULPA 4YY3L 4DV2Q 1Q12A 4H02A 2BA1A 2HT1A 1E3PA 3GTGH 1CSPA 5H1SE 4YHHQ 1N8RC 4OWWB 4B3RQ 1Q1EA 2KENA 4LWCA 4YWKA 5JEAG 2MO1A 2JA6H 3HOZH 3BJUA 4GNXC 3UDGA 4A93H 2CCZA 2PQAA 2E5LL 5C44G 2ZTDA 4OO1I 3CMEA 3I4MG 2WB1G 1V43A 4X65L 2LSSA 4UPAA 4JI3Q 4BBSH 1C9OA 1JE5A 2IX0A 4NPSA 1Y1VH 4JOIA 2JA5G 1P8LA 1K0RA 4JYAL 4QY7A 3CCJA 3PF5A 1YZ6A 2AWOA 3I7FA 4A3JH 4OX9L 2ZTCA 2YU9H 3OYYA 1IYJB 1X3FA 4JI8Q 1U5KA 1HNWQ 4MNOA 1KQSA 1CKOA 1LM0A 5IYDH 4A3BH 2IHEA 4NXMQ 1YJWA 2F4VL 3MEFA 3I4NH 3L7ZC 1IXRA 1U0LA 3HKZG 2QEXA 1I94Q 3GTOH 4LF8L 1XPOA 4IPDA 2ZJPA 4GKKL 5C4JH 1YJ9A 1UE7A 3PUVA 4DV4L 4A3GH 3AYHB 2OTJA 4BBRH 1NBWA 5JJKA 4OWTB 1A63A 2LXKA 2Q2TA 2UUCQ 3GTPH 4IFDG 2KCTA 1HR0L 1YNXA 3RLNA 4LF7L 1YEZA 2VZAA 2UUBL 2ZJRA 2B29A 1E1TA 3J81j 3K8AA 1FVIA 3T1YL 4C3IH 1C0AA 2Y0SG 5IYCH 4DNIA 1K8AC 3WWVA 4A76A 2I0QA 1AE3A 2JA8H 4X64Q 3G71A 4GLVB 5IWAQ 4DV0L 2MQHA 4LFBQ 4A3LH 4WJ3M 4A3KG 1OXTA 4DK6C 4DUZL 2R7ZH 1LTLA 2JEBI 3K7AH 2VUMH 4DKAC 3TS0A 2EQSA 1PH6A 1IBLL 1Y1WG 1XNRQ 4A3CH 3T1HQ 4HIDA 1JJGA 3E9HA 3RR5A 3PUZA 2Q2UA 1M90C 3D0FA 4X66L 4JI2Q 1X65A 4A3FG 1L2FA 1PH7A 1XMQQ 3HOUH 3S16H 4DV2L 1VQCA 3S2DH 1VQDA 4BY1G 1K83H 2B63G 4HJ9A 5DLQE 4UP8A 4YHHL 3S14H 2I5LX 5LMNL 1YHQA 1VQ9A 4X62L 3U50C 4YY3Q 4BXXG 4DV5Q 3ULJA 3FKIG 4NXNL 2A19A 4PZ6A 3TQYA 1IL2A 4JI0Q 1YBYA 4DR2Q 3JC66 4DAMA 2D62A 2OQKA 4K0KL 3SGIA 1Z9FA 4KLKA 4IJLA 4X6AH 1I6HH 3PCOB 2E5LQ 3NELA 1SMXA 4PZ8A 1P16A 4JI8L 4GKJQ 1X55A 3AFPA 3PIPA 4MZ9A 1HNWL 2NVQH 1DGSA 3LGJA 2UXCQ 2Z6KC 3U4VA 1WCMG 2A8VA 2JA6G 3HOZG 1VQMA 4OX9Q 1J5EL 4A93G 1B8AA 5IT9c 2YTXA 3W5OA 1X54A 4HJ8A 1H95A 2D0PA 2KHIA 2F4VQ 3J7A5 1VQPA 1Y1VG 3HKSA 2CQOA 3RN2A 3PO2H 4A3IH 1M1KC 3J80i 3S1NH 2C35B 4A3JG 1J6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUZ A;  1YHB A;  2NN6 I;  2WP8 J;  3CPF A;  4HIM A;  2JEA I;  1PA6 A;  1GO3 E;  2GN5 A;  4DV4 Q;  2ID0 A;  5IYD G;  4UP7 A;  4A3B G;  3NBH B;  4DR7 L;  3J80 c;  1K3R A;  3I4N G;  4J15 A;  1S72 A;  1KL9 A;  1IBK L;  4POG A;  3D31 A;  1N9W A;  1W3S A;  2K50 A;  2NZO A;  2UUB Q;  4LF4 Q;  4LF7 Q;  2R7D A;  1N33 L;  4LFB L;  2K5H A;  4OO1 G;  2E8G A;  1QZG A;  3T1Y Q;  4A3G G;  3KFU A;  1RL2 A;  4AH6 A;  4BBR G;  1CSQ A;  2KBN A;  4OXP A;  2D0O A;  2JK8 A;  4DUZ Q;  5IP7 G;  5GAE C;  4IOC A;  1IBL Q;  1VQ5 A;  3IRB A;  2OTL A;  4LW1 A;  1UEB A;  4B3S L;  2AKW B;  2CWA A;  4JI7 L;  1UE1 A;  5IYC G;  1SRO A;  4QQB X;  1HNZ Q;  2E2J H;  2VQF Q;  2UU9 L;  2VS1 A;  4A3L G;  1YI2 A;  1R9T H;  1Q7Y C;  2R7Z G;  2BA0 A;  5C3E G;  2VUM G;  1E1O A;  3VDY A;  3HFZ B;  3CQZ H;  4C3J H;  4A3C G;  4DV5 L;  1VQF A;  4DR3 L;  3CP0 A;  1O7I A;  1G29 1;  2YTV A;  1I3Q H;  4JI0 L;  5LMN Q;  4DR2 L;  4LF9 L;  1I5F A;  4BA1 I;  3S2H H;  4X62 Q;  2OWO A;  4JBK A;  3HOU G;  1KC8 C;  2N8N A;  4ALP A;  4NXN Q;  2FXQ A;  1N32 L;  5AJ3 Q;  1A8V A;  2VW9 A;  1Q81 C;  1EUJ A;  4AIM A;  2HIV A;  1PH5 A;  5IYB G;  1FJG L;  1V9P A;  1N36 Q;  2IX1 A;  3A74 A;  4GKJ L;  1GVP A;  4K0K Q;  2UXC L;  3GD7 A;  4GS3 A;  1AE2 A;  2XGT A;  1PYB A;  3CCM A;  1TWG H;  1EYG A;  2EIF A;  3PGZ A;  4XIG S;  5M5Y H;  1L1O C;  4R4C A;  3I56 A;  1HNX L;  4LNQ A;  1GM5 A;  2UXB L;  4YCU A;  1J5E Q;  2WFW A;  3H3V H;  4JV5 L;  4QIW E;  1IZ6 A;  3E9I A;  3M4O H;  2JE6 I;  3RLO A;  3UE1 A;  4QGU A;  1JB7 A;  1Z47 A;  2K4K A;  4JCV E;  5M5W H;  1CKM A;  1HR0 W;  1TWF H;  3TRE A;  3S1Q H;  3M7N A;  3STB C;  2NVT H;  1X3E A;  4LF4 L;  5M3F H;  3CW2 C;  3KF6 B;  4DUY L;  1EQR A;  4GOP A;  4LF5 L;  4DR7 Q;  1IBM L;  1QVF A;  1AH9 A;  4ME3 A;  3PO2 G;  1YHA A;  4A3I G;  3JAM c;  3EIV A;  4A75 A;  1IBK Q;  3CXC A;  2GVB A;  2IY5 B;  1XJV A;  1KXL A;  2I5M X;  1HZ9 A;  1N33 Q;  1JMC A;  1S3O A;  4B3T Q;  1GKH A;  3K81 C;  5FLM H;  2JJQ A;  3E0E A;  3CC7 A;  3G4S A;  3RLF A;  1KD1 C;  2R92 H;  3GTM H;  1E22 A;  2K52 A;  3PUX A;  1EIF A;  3CPW A;  2ATW A;  2JA7 H;  1KIX A;  1HNZ L;  2VQF L;  1KHI A;  5FJ8 H;  3W1G A;  3KJO A;  3RZD H;  4DV6 L;  2ZM6 L;  1QUQ A;  3PIO A;  4B3S Q;  4JI7 Q;  4JI6 Q;  1ASZ A;  4Y52 H;  3GTQ H;  2HQL A;  4JI4 L;  4PG3 A;  5LMN W;  2UU9 Q;  1PH4 A;  1PH9 A;  4XTC S;  1VQ6 A;  3FHW A;  2NN6 G;  5GRO A;  4DV7 L;  2JA9 A;  4LUV A;  1SFO H;  3HOX H;  2R92 G;  4LF6 Q;  1WYD A;  3F2C A;  2HIX A;  5M3M H;  4GLA C;  4DR3 Q;  2RHS B;  4GNX B;  1C7Y A;  1YIT A;  1PV4 A;  5AJ3 L;  2WAQ E;  1NTG A;  1HZB A;  4JI1 L;  4POF A;  5FLX c;  2Z6K A;  2NVY H;  3ERS X;  4LF9 Q;  4A3D H;  1N36 L;  2R6G A;  3NEN A;  1PH3 A;  3PO3 H;  4P73 A;  2DGY A;  4B3M L;  4OON A;  1HZC A;  2R93 H;  2PI2 E;  1EIY B;  1N32 Q;  1B70 B;  3UDF A;  5C4X H;  1FJG Q;  4JYA Q;  3F2D A;  3I55 A;  1YIJ A;  1BKB A;  2Q2H A;  3S1R H;  3F1Z A;  2A1A A;  4R4I A;  5IP9 H;  3DM3 A;  4L5R C;  5BR8 Q;  3CCV A;  1VQ8 A;  3H0G H;  4GN4 B;  1T9H A;  1WOC A;  1E24 A;  4MTN A;  1HNX Q;  1VQG A;  2OCE A;  3HOY H;  2UXB Q;  2IHF A;  3CC2 A;  3KF6 A;  4JV5 Q;  3RNU A;  5EAY A;  2AWN A;  3PV0 A;  4HJ7 A;  1SN8 A;  4EQ5 A;  1VQN A;  4DV1 L;  4WJ4 A;  2PI2 A;  2RCN A;  2OQ0 A;  4DR4 Q;  3ER0 A;  3I4O A;  4AQY Q;  3M85 A;  1NY4 A;  4YWM A;  4A3M H;  1JJ2 A;  1I50 H;  1TXY A;  1WI5 A;  3MXN B;  4FDB A;  5E7N A;  3AEV A;  4DUY Q;  4L5S A;  5IY0 A;  3EN2 A;  5LMU L;  4LF5 Q;  3CCE A;  1IBM Q;  4B3T L;  1YJN A;  1E7Z A;  3M4Q A;  1VS0 A;  2MNA A;  3S24 A;  1QVC A;  4GOP B;  4O2D A;  3PUW A;  2CFM A;  3CC4 A;  5M3F G;  1Q1B A;  3M4P A;  1UE5 A;  3CMA A;  4JI6 L;  2JA8 G;  1UWV A;  1VQE A;  1PH8 A;  4YWL A;  4JI5 Q;  3HOV H;  1BBW A;  1WFQ A;  4DV6 Q;  5GQO A;  2QGQ A;  2ZM6 Q;  4GNX A;  2N3S A;  4C3H H;  4QJF A;  1A0I A;  2E2I H;  5FLM G;  4A3E H;  4LF6 L;  1XPU A;  3CCU A;  3OTO L;  4JI4 Q;  4LFA Q;  3F8T A;  1K73 C;  2NVX H;  1QUQ B;  2CWP A;  2QA4 A;  1VQ7 A;  2JA7 G;  1V1Q A;  4DV7 Q;  4KHP Q;  1XNQ L;  5FJ8 G;  5IE8 A;  1BVS A;  2UXD L;  1MJC A;  4DK3 C;  3H3V I;  4C2M H;  3TRZ A;  2ASB A;  1S40 A;  3U58 A;  5C0X I;  2VQE L;  2BH8 A;  4DPG A;  2XTI A;  4JI1 Q;  4DV3 L;  2YTY A;  3UDX A;  2VNU D;  1XMO Q;  4BY7 H;  3HOX G;  1VQL A;  4B3M Q;  1VQA A;  4EX5 A;  3A0J A;  4HIK A;  5M3M G;  5BR8 L;  2CKZ B;  4DAY B;  1VQB A;  1JJC B;  2H5X A;  2Z0S A;  3CCL A;  1G51 A;  4A3D G;  4RG1 A;  3PO3 G;  2KHJ A;  1GD7 A;  1L0W A;  5JJI A;  2R93 G;  1EQQ A;  1WCM H;  5ELN A;  1JT8 A;  4IJH A;  1UE6 A;  2HHH L;  4JBJ A;  4PZ7 A;  3G6E A;  3ZJY C;  5C4X G;  3CF5 A;  2E2H H;  4DR4 L;  5HY6 A;  5IP9 G;  3CCQ A;  1PVO A;  2ALY B;  1HZA A;  3JAM i;  4AQY L;  4DV1 Q;  2N49 A;  1Q86 C;  3H0G G;  3FP9 A;  3S15 H;  4L5Q A;  4DR6 Q;  3HOY G;  4TQU S;  3RN5 A;  3GTK H;  3H15 A;  4IOA A;  4QL5 A;  1VQH A;  5C0X J;  3GTJ H;  3KOJ A;  1SR3 A;  1CKN B;  1LYL A;  1TWH H;  1G6P A;  1K9M C;  5LMU Q;  4JOI C;  4OWX B;  3G48 A;  1PFS A;  2WB1 E;  2AMC B;  3AQQ A;  3I2Z A;  3M9B A;  1NMG A;  4IPC A;  2V1C C;  3K0X A;  3J81 i;  4DR5 L;  4A3M G;  3A5U A;  3NEM A;  4LUZ A;  1EFW A;  3K80 C;  4GN3 B;  1NJI C;  1N34 L;  3KF8 B;  3HOW H;  3ICE A;  4JBW A;  1B7Y B;  4KI0 A;  1VQK A;  4JI5 L;  2WAQ G;  4IPG A;  4Y7N H;  2R7F A;  2VL6 A;  2DUD A;  3J81 c;  5GAG C;  1KRS A;  3GO5 A;  5IP7 H;  5J3B A;  3KJP A;  2ES2 A;  4GLX A;  4APV A;  1EOV A;  3HKZ E;  4KHZ A;  3TEH B;  4PMW A;  4DR1 L;  4LFA L;  3PF4 A;  2F52 A;  4KHP L;  1K8G A;  1HH2 P;  3BZC A;  3L2P A;  1NMF A;  3OTO Q;  1Q46 A;  3KYH C;  4P72 A;  1XTD A;  1OXS C;  1MKH A;  5C3E H;  4HJA A;  3BU2 A;  4GOP C;  1PH1 A;  1XNQ Q;  4UP9 A;  3STB D;  4LFC L;  2UUA Q;  3HOV G;  3S17 H;  2Q2I A;  2UXD Q;  1XMO L;  4A3E G;  1XPR A;  1Q82 C;  4P71 A;  2VQE Q;  2YV5 A;  1X3G A;  2RF4 A;  2Y0S E;  3L0O A;  4L5T A;  4O0A A;  3UE0 A;  4A4I A;  4AYB G;  4DV3 Q;  2L15 A;  4BBS G;  2MO0 A;  4HIO A;  1W2B A;  3EBE A;  1A62 A;  5C44 H;  4P75 A;  3I4M H;  3PUY A;  4YCV A;  1L1O B;  5IYB H;  2EXD A;  1QZH A;  2K14 A;  2JA5 H;  4B3R L;  1SE8 A;  1BBU A;  4R4T A;  1MJE A;  4TVA B;  4IFD I;  1D8L A;  1MIU A;  3CAM A;  4BY7 G;  4HJ5 A;  5JEA J;  3W1B A;  3GDE A;  4LUO A;  5M5X H;  4AYB E;  3KDF B;  2I5H A;  4JI3 L;  3UDI A;  1QVG A;  2HHH Q;  3KLW A;  1NE3 A;  1CKN A;  4UY8 C;  1RIP A;  2YYZ A;  4X65 Q;  1KAW A;  2VY3 A;  4DR6 L;  1D7Q A;  2ZTE A;  3S1M H;  1YVC A;  1TWC H;  2PQA B;  4NXM L;  1FGU A;  1HJP A;  1Q8K A;  1SLJ A;  1KRT A;  1FL0 A;  5C0X G;  1I94 L;  1X56 A;  1WJJ A;  2AHO B;  3PSI A;  3GTL H;  3DLL A;  3OW2 A;  2N78 A;  2PNH A;  4GN5 A;  3K7U C;  3TS2 A;  4IPH A;  2RHQ B;  2B3G A;  1X6O A;  3U4Z A;  1OTC A;  5GAH C;  4LF8 Q;  4RMF A;  2UUC L;  2K75 A;  4NB3 A;  3B6Y A;  4DR5 Q;  1X9N A;  4GKK Q;  4A3K H;  2JQO A;  1N34 Q;  1VQO A;  1OXU A;  5GAD C;  2ZJQ A;  3ULL A;  1PYS B;  4P74 A;  1Y1W H;  4JC0 A;  2KCM A;  3CCR A;  3RZO H;  4IFD J;  2MFI A;  3F2B A;  2K5N A;  1HR0 Q;  4X64 L;  5IWA L;  2GVA A;  5JJL A;  4A3F H;  1PH2 A;  5HGQ A;  1OXX K;  3J7Z C;  4DR1 Q;  1TWA H;  1VCI A;  3HOW G;  1EWI A;  2F3I A;  1XNR L;  3M3Y H;  4BA2 I;  1SRU A;  1VQI A;  2PMZ E;  4DV0 Q;  3T1H L;  2UUA L;  4BY1 H;  4IO9 A;  3CD6 A;  2B63 H;  5K36 G;  1Y14 B;  2BH2 A;  4R4O A;  4JBM A;  2NZH A;  4JI2 L;  1L1O A;  3Q8D A;  4R1J A;  1XMQ L;  4LFC Q;  4BXX H;  1CUK A;  3CCS A;  1VQJ A;  3FKI H;  2LXJ A;  1VQ4 A;  1PHJ A;  2IT1 A;  4JG2 A;  4YCW A;  5ELO A;  2K5V A;  3AFQ A;  4X66 Q;  3BZK A;  3A5Z B;  1OXV A;  4R4Q A;  1ASY A;  3KDF A;  3ULP A;  4YY3 L;  4DV2 Q;  1Q12 A;  4H02 A;  2BA1 A;  2HT1 A;  1E3P A;  3GTG H;  1CSP A;  5H1S E;  4YHH Q;  1N8R C;  4OWW B;  4B3R Q;  1Q1E A;  2KEN A;  4LWC A;  4YWK A;  5JEA G;  2MO1 A;  2JA6 H;  3HOZ H;  3BJU A;  4GNX C;  3UDG A;  4A93 H;  2CCZ A;  2PQA A;  2E5L L;  5C44 G;  2ZTD A;  4OO1 I;  3CME A;  3I4M G;  2WB1 G;  1V43 A;  4X65 L;  2LSS A;  4UPA A;  4JI3 Q;  4BBS H;  1C9O A;  1JE5 A;  2IX0 A;  4NPS A;  1Y1V H;  4JOI A;  2JA5 G;  1P8L A;  1K0R A;  4JYA L;  4QY7 A;  3CCJ A;  3PF5 A;  1YZ6 A;  2AWO A;  3I7F A;  4A3J H;  4OX9 L;  2ZTC A;  2YU9 H;  3OYY A;  1IYJ B;  1X3F A;  4JI8 Q;  1U5K A;  1HNW Q;  4MNO A;  1KQS A;  1CKO A;  1LM0 A;  5IYD H;  4A3B H;  2IHE A;  4NXM Q;  1YJW A;  2F4V L;  3MEF A;  3I4N H;  3L7Z C;  1IXR A;  1U0L A;  3HKZ G;  2QEX A;  1I94 Q;  3GTO H;  4LF8 L;  1XPO A;  4IPD A;  2ZJP A;  4GKK L;  5C4J H;  1YJ9 A;  1UE7 A;  3PUV A;  4DV4 L;  4A3G H;  3AYH B;  2OTJ A;  4BBR H;  1NBW A;  5JJK A;  4OWT B;  1A63 A;  2LXK A;  2Q2T A;  2UUC Q;  3GTP H;  4IFD G;  2KCT A;  1HR0 L;  1YNX A;  3RLN A;  4LF7 L;  1YEZ A;  2VZA A;  2UUB L;  2ZJR A;  2B29 A;  1E1T A;  3J81 j;  3K8A A;  1FVI A;  3T1Y L;  4C3I H;  1C0A A;  2Y0S G;  5IYC H;  4DNI A;  1K8A C;  3WWV A;  4A76 A;  2I0Q A;  1AE3 A;  2JA8 H;  4X64 Q;  3G71 A;  4GLV B;  5IWA Q;  4DV0 L;  2MQH A;  4LFB Q;  4A3L H;  4WJ3 M;  4A3K G;  1OXT A;  4DK6 C;  4DUZ L;  2R7Z H;  1LTL A;  2JEB I;  3K7A H;  2VUM H;  4DKA C;  3TS0 A;  2EQS A;  1PH6 A;  1IBL L;  1Y1W G;  1XNR Q;  4A3C H;  3T1H Q;  4HID A;  1JJG A;  3E9H A;  3RR5 A;  3PUZ A;  2Q2U A;  1M90 C;  3D0F A;  4X66 L;  4JI2 Q;  1X65 A;  4A3F G;  1L2F A;  1PH7 A;  1XMQ Q;  3HOU H;  3S16 H;  4DV2 L;  1VQC A;  3S2D H;  1VQD A;  4BY1 G;  1K83 H;  2B63 G;  4HJ9 A;  5DLQ E;  4UP8 A;  4YHH L;  3S14 H;  2I5L X;  5LMN L;  1YHQ A;  1VQ9 A;  4X62 L;  3U50 C;  4YY3 Q;  4BXX G;  4DV5 Q;  3ULJ A;  3FKI G;  4NXN L;  2A19 A;  4PZ6 A;  3TQY A;  1IL2 A;  4JI0 Q;  1YBY A;  4DR2 Q;  3JC6 6;  4DAM A;  2D62 A;  2OQK A;  4K0K L;  3SGI A;  1Z9F A;  4KLK A;  4IJL A;  4X6A H;  1I6H H;  3PCO B;  2E5L Q;  3NEL A;  1SMX A;  4PZ8 A;  1P16 A;  4JI8 L;  4GKJ Q;  1X55 A;  3AFP A;  3PIP A;  4MZ9 A;  1HNW L;  2NVQ H;  1DGS A;  3LGJ A;  2UXC Q;  2Z6K C;  3U4V A;  1WCM G;  2A8V A;  2JA6 G;  3HOZ G;  1VQM A;  4OX9 Q;  1J5E L;  4A93 G;  1B8A A;  5IT9 c;  2YTX A;  3W5O A;  1X54 A;  4HJ8 A;  1H95 A;  2D0P A;  2KHI A;  2F4V Q;  3J7A 5;  1VQP A;  1Y1V G;  3HKS A;  2CQO A;  3RN2 A;  3PO2 H;  4A3I H;  1M1K C;  3J80 i;  3S1N H;  2C35 B;  4A3J G;  1J6Q A; 
#chains in the Genus database with same CATH topology
 4CGY B;  1MSG A;  2JEA I;  5FO8 B;  3DMU A;  5IT9 L;  4J15 A;  3Q0A A;  1W3S A;  2K50 A;  1SMY C;  4OL7 A;  2F0J A;  1LTA D;  3ERQ A;  1U4L A;  1RL2 A;  2D0O A;  1O80 A;  2JK8 A;  2NN6 H;  1GUG A;  3VR3 A;  1VQ5 A;  3IKJ A;  2NB0 A;  2OTL A;  4LW1 A;  4JI7 L;  4C3I G;  1K83 B;  4PMC A;  2F0K A;  1HNZ Q;  1SND A;  4DK0 A;  1WD1 A;  2R7Z G;  1RCV D;  2BA0 A;  2BDO A;  4KHV A;  4CBV A;  2VUM G;  3HFZ B;  1S5D D;  1E2Z A;  4C3J H;  1KTK A;  1GUT A;  1RHP A;  1H9S A;  2Q8T A;  3S2H H;  1I5F A;  1ESF A;  4C56 C;  4X62 Q;  2OWO A;  4JBK A;  5D3D A;  3HOU G;  2N8N A;  1UUP A;  4ALP A;  2J4X A;  2VW9 A;  1BR9 A;  1EUJ A;  4JYA L;  1IL8 A;  4GS3 A;  2L55 A;  1PYB A;  3CCM A;  2DNC A;  5J22 A;  1TU2 B;  1HPC A;  3PGZ A;  2KEE A;  3S1N B;  1GM5 A;  3QIA A;  4JV5 L;  4K2K A;  2KHS A;  3KBG A;  1KLG D;  3K6O A;  1CI3 M;  3QJY A;  3LWE A;  3TDQ A;  3UE1 A;  2B2Y C;  2B2W C;  2F0H A;  3D3R A;  1EY9 A;  2AUJ D;  5KNB A;  4XXE A;  3STB C;  3M4Y A;  5M3F H;  1QCB D;  4DUY L;  4LF5 L;  1X32 A;  4TKO B;  1YHA A;  2LY7 A;  3BVG A;  3EIV A;  4A75 A;  2GVB A;  2IY5 B;  4CDF C;  5IGE A;  1O7L A;  3O13 A;  2IL8 A;  4B3T Q;  1DCZ A;  1PDQ A;  2E2J B;  2V4D A;  3R93 A;  1E22 A;  2JA7 H;  2VQF L;  3W1G A;  5CV6 A;  3KJO A;  4DV6 L;  2ZM6 L;  1QUQ A;  3RZD H;  3JAM L;  4JI7 Q;  4JI6 Q;  3GTQ H;  4JI4 L;  5LMN W;  3MAQ A;  1PH4 A;  5EQ0 A;  1TII D;  2CVR A;  2L0C A;  1F9R A;  2RHS B;  4GNX B;  1C7Y A;  2A73 B;  4HSV A;  5T1G A;  1YIT A;  1HZB A;  5FLX c;  2Z6K A;  2NVY H;  5T1I A;  2ENB A;  1F9Q A;  3NEN A;  1PH3 A;  4K5W A;  1HZC A;  2R93 H;  2PI2 E;  1EZ8 A;  1QNK A;  5A35 A;  2MGS A;  5I4D A;  4JYA Q;  3S1R H;  1ONL A;  1UNS A;  1OO9 B;  3QO2 A;  4XDX A;  3R3O A;  3CCV A;  4GN4 B;  1VDZ A;  1WOC A;  1JOO A;  3P75 A;  1PTO C;  5EPJ A;  2IHF A;  4JV5 Q;  4IZ8 A;  2EE1 A;  2AWN A;  3PV0 A;  5COR A;  4WJ4 A;  4DV1 L;  1M8A A;  1J9O A;  3GTJ B;  1BXT A;  3I4O A;  3OWE B;  3OW7 A;  1NY4 A;  2QIL A;  1ET6 A;  3MXN B;  5E7N A;  3AEV A;  4DUY Q;  5IY0 A;  3EN2 A;  4X3S A;  4LF5 Q;  1PRT B;  4BWG B;  3M4Q A;  3GTM B;  5TSS A;  4JPB W;  4MIU A;  4IQZ A;  3PUW A;  2N55 A;  4Y7N B;  1PLF A;  3FPP A;  3CMA A;  3SK4 A;  2JA8 G;  4YWL A;  4MHE A;  4JI5 Q;  4DV6 Q;  2ZM6 Q;  1XYI A;  5M3M B;  4QJF A;  2A6E C;  3I4L A;  2WIN B;  1DXM A;  4JI4 Q;  1JIC A;  4LFA Q;  3T16 A;  1K73 C;  2NVX H;  2CWP A;  1AFP A;  3BYY B;  3I73 A;  4OIK A;  4NKL A;  3H3V I;  4DK3 C;  1R4P B;  3BVM A;  5C0X I;  2VQE L;  4FF4 A;  2ZXP A;  2KA7 A;  3HOX G;  2JA5 B;  5A2Q E;  2Q8I B;  5BR8 L;  1JJC B;  3HOY B;  2H5X A;  2SNM A;  2BOS A;  1QG7 A;  5DNF A;  1WCM H;  1FR3 A;  1JT8 A;  5C4X G;  1NR2 A;  4JBJ A;  2ICI A;  3ZJY C;  1ZKO A;  3G6E A;  1WTO A;  2Z4I A;  3SK8 A;  2E2H H;  4DR4 L;  4ULL A;  1I50 B;  3S1M B;  1TWC B;  1PVO A;  1KNA A;  1HZA A;  4AQY L;  4DV1 Q;  2K03 A;  2EDG A;  3H0G G;  3H91 A;  3GTL B;  1ROD A;  4DR6 Q;  2X69 A;  4TQU S;  3RN5 A;  3SK5 A;  1HHV A;  2Y0S B;  1TWH H;  2BE5 C;  4G7Z C;  4JOI C;  4OWX B;  4A3K B;  2WB1 E;  4IPC A;  2V1C C;  3J81 i;  2XNA C;  3A5U A;  4LUZ A;  4GN3 B;  3ICE A;  1EY6 A;  4JBW A;  4A3E B;  2WAQ G;  1BCP D;  4DNT B;  3KBX A;  2R7F A;  1PRT F;  5IP7 H;  5J3B A;  4GLX A;  4APV A;  2EY5 A;  4KHZ A;  4KHP L;  2B63 B;  1HH2 P;  1PZJ D;  5F2D A;  3VA5 A;  1OXS C;  1MKH A;  4HJA A;  4BY7 B;  3I91 A;  4ZKB B;  1YNJ C;  1PH1 A;  3HOV G;  2Q2I A;  1XMO L;  1Q82 C;  2VQE Q;  4A4I A;  4O0A A;  4HN7 A;  2FHT A;  3DUZ A;  3EBE A;  5IYB H;  1FGB D;  2O2L D;  1SE8 A;  1BBU A;  4IFD I;  1MIU A;  3GDE A;  3NTK A;  1SAP A;  3A54 A;  3KLW A;  2FMM A;  1CKN A;  4UY8 C;  4G7H C;  4QF4 A;  1KAW A;  3I8Z A;  2ZTE A;  1YVC A;  4RA8 A;  4GZY C;  5CGK A;  1V1P B;  1FL0 A;  3URY A;  1X56 A;  3FEW X;  4ZQ3 A;  4GN5 A;  1JWS D;  3TS2 A;  5HGT A;  4IPH A;  1CQV A;  1QB5 D;  2G9H D;  4RMF A;  4CJ0 B;  4JK1 C;  4C3I B;  2Z6B A;  4P2C B;  5C6A A;  3RZO H;  2LS0 1;  5KYI A;  4KY5 A;  2M2L A;  1HR0 Q;  5I9P A;  5IWA L;  1I4P A;  1G8Z D;  2EY2 A;  4IUR A;  2UUA L;  4BY1 H;  3Q24 A;  1E2V A;  2I46 A;  3HOU B;  4WRD A;  1EY0 A;  5C44 B;  1XMQ L;  3I4M B;  4KJO A;  3EJI A;  3NK9 A;  3FKI H;  2IT1 A;  1A15 A;  5ELO A;  2K5V A;  3AU7 A;  3BZK A;  1PMR A;  3T4A C;  1OXV A;  1EQT A;  1I4R A;  3ULP A;  5M5X B;  1CSP A;  3IL8 A;  4YHH Q;  1N8R C;  1PTO B;  1Q1E A;  4LWC A;  3HP3 A;  3BJU A;  2DJG C;  4F88 A;  2RSO A;  2ZTD A;  1C9O A;  1JE5 A;  2EJG C;  3GV6 A;  1T5E A;  1I4H A;  4NDX A;  3ZYY X;  2YU9 H;  3OYY A;  3KLR A;  1HNW Q;  1Q3L A;  2XVS A;  1BCP C;  2B2U A;  1KQS A;  1LM0 A;  4A3B H;  2F0P A;  4C1N K;  2IHE A;  1YJW A;  3MEF A;  3J81 E;  3I4N H;  5AFW A;  1U0L A;  3HKZ G;  5BN3 A;  1XPO A;  3ITP A;  4IUV A;  1UE7 A;  4DV4 L;  4A3G H;  2WAC A;  2PZW A;  4OWT B;  4PV1 C;  1A63 A;  1WTQ A;  2Q2T A;  2VZA A;  5FLX E;  5JPM C;  3SDZ A;  2B29 A;  4F7X A;  1BQQ T;  1FVI A;  3L3O C;  3P20 A;  3T1Y L;  3H94 A;  4J8Q A;  1QWY A;  5A2Q L;  4A76 A;  5IWA Q;  1ESR A;  4DV0 L;  4A3L H;  2DY8 A;  4DK6 C;  3K5M A;  4CKB A;  4R8I A;  4DUZ L;  4DKA C;  3TS0 A;  3D8G A;  3E9H A;  5FO7 B;  3PUZ A;  2Q2U A;  4X66 L;  3CQZ B;  1X65 A;  4V19 0;  1LTI D;  1WVL A;  1XMQ Q;  3SEB A;  2H4O A;  1VQD A;  5ELE A;  3D6C A;  1K83 H;  4HR7 B;  5LMN L;  2K04 A;  5EPL A;  1IL2 A;  1C8C A;  4JI0 Q;  4QB4 A;  4DAM A;  2D62 A;  3Q22 A;  2KVM A;  2KOL A;  1I6H H;  1H9S B;  3MFY A;  1IKL A;  4JI8 L;  1CHP D;  1X55 A;  4GKJ Q;  1K3B C;  2UXC Q;  4DXG A;  2A8V A;  3KLS X;  3TSS A;  1JQY D;  3E0J A;  3M4O B;  4Q0F A;  1J5E L;  4A93 G;  1CM9 A;  5C4J B;  1EEI D;  1X54 A;  4HJ8 A;  2D0P A;  2KHI A;  3VYR A;  3RN2 A;  3J80 i;  4CDE C;  3S1N H;  4A3J G;  5CMD A;  1LUZ A;  4ZK9 B;  3G6J B;  2GN5 A;  3NTI A;  4DV4 Q;  4FF1 A;  4WFN 3;  2JA8 B;  2XRS D;  3BDC A;  1K3R A;  4O1N A;  1S72 A;  1G2S A;  3MFG A;  4DF7 A;  4LF4 Q;  3K7A B;  1TY2 A;  4OO1 G;  4XYQ A;  2E8G A;  3T1Y Q;  3KFU A;  2N88 A;  2JN4 A;  4OXP A;  3DEO A;  4RH6 A;  1CFM A;  3IFD A;  4DUZ Q;  3K59 A;  5GAE C;  1PFM A;  3IRB A;  3S16 B;  2VB2 X;  1UEB A;  3GP7 A;  1D6E C;  2EYH A;  1VF7 A;  2CW0 D;  5IYC G;  1ENF A;  2PPB C;  3HOX B;  4KKT A;  1VMC A;  2E2J H;  1Q7Y C;  1E1O A;  2XWJ B;  4DV5 L;  1VQF A;  4U67 3;  3CP0 A;  1G29 1;  3VYS A;  5LMN Q;  4DR2 L;  2EYF A;  1TR5 A;  5C4X B;  5AJ3 Q;  1U4P A;  3N6R A;  1PH5 A;  1FJG L;  2HIV A;  2CH4 A;  1N36 Q;  2F0M A;  3A74 A;  1EYC A;  2L5T A;  1NNX A;  2RBM A;  1AE2 A;  2E2D C;  2L9H A;  3H0G B;  5I2X A;  3MEH A;  1IYV A;  1I4Q A;  3LNN A;  1EYG A;  2IJ0 A;  5M5Y H;  4R4C A;  2TMP A;  1Y8N B;  2K33 A;  2UXB L;  1J5E Q;  2WFW A;  4L6T B;  2K1B A;  3MHB A;  3H3V H;  4Q5V A;  4QIW E;  2HDL A;  2D9U A;  4HED A;  3RLO A;  4K6L A;  4QGU A;  4EGV A;  2EY1 A;  5IGB A;  2F03 A;  5M5W H;  1HR0 W;  3TRE A;  2WAQ B;  2X6L A;  1L0X B;  2M00 A;  1IBM L;  1QJO A;  1AH9 A;  3PO2 G;  4A3I G;  2KCC A;  2VXW A;  3CXC A;  1XJV A;  1X3P A;  2I5M X;  2JXM B;  2QKI C;  3SR1 A;  3QWN A;  3OIQ A;  4F8M A;  5JAV A;  3C1E A;  5COY A;  1QE6 A;  3HOV B;  5IOC A;  3GTM H;  2K52 A;  1EIF A;  3EFX D;  1HNZ L;  1KHI A;  5FJ8 H;  1H9R A;  3OSO A;  4E6I A;  1KAB A;  2A6H C;  4LAA A;  2A68 D;  2NN6 G;  2JA9 A;  4H7B A;  3F2C A;  3D4W A;  5M3M H;  2EYJ A;  2CHB D;  5KNC A;  3NQI A;  3J81 L;  4A3D H;  3PO3 H;  4LJZ C;  1GOZ A;  2DGY A;  4OON A;  5I6Y A;  1U4R A;  1B70 B;  1R4Q B;  5HUR A;  1FJG Q;  3F2D A;  3NHH A;  2E74 C;  2LKV A;  2I07 B;  5DM6 3;  1UEA B;  3ONA B;  2A1A A;  4R4I A;  1LT5 D;  3DM3 A;  5DM7 3;  4B08 A;  2NYZ D;  1VQ8 A;  1HTL D;  5FLX L;  4RHS A;  3J80 E;  1Z6H A;  4G57 A;  1BF4 A;  5CV9 A;  3HOY H;  3S1Q B;  1A2U A;  2KEC A;  2UXB Q;  1F2L A;  1TS3 A;  2NVT B;  3RNU A;  4EQ5 A;  1VQN A;  3J7A V;  2IX3 A;  2PI2 A;  1JE4 A;  3GTK B;  5ELD A;  4N9T A;  3ER0 A;  2RDF A;  4HMI A;  4MTK A;  1I50 H;  1TXY A;  1WI5 A;  2CW0 C;  4FDB A;  1IBM Q;  4B3T L;  1TS5 A;  3KF8 A;  3MXG A;  1VS0 A;  2R92 B;  3S24 A;  4KKS A;  4GOP B;  4L63 B;  4K14 A;  5M3F G;  1Q1B A;  3M4P A;  4JI6 L;  1LLR D;  1B2T A;  1VQE A;  3QR8 A;  2OEO A;  1BBW A;  1WFQ A;  5GQO A;  2KQ3 A;  5CC4 A;  2N3S A;  1A0I A;  3MA2 B;  4A3E H;  1XPU A;  3CCU A;  3OTO L;  2L11 A;  4BBS H;  3E5S A;  2L4N A;  2JA7 G;  3MWY W;  4KTA A;  4RKL A;  4UDU C;  1MJC A;  5E3F A;  1GUO A;  3NWT A;  3BYT B;  2ASB A;  3U58 A;  2YTY A;  4BY7 H;  2HUG A;  3A0J A;  2RKS A;  3EA6 A;  3HRZ C;  1TVX A;  4WOR A;  1SEB D;  4RG1 A;  1L0W A;  3T13 A;  2R93 G;  3HKZ B;  5ELN A;  2JYO A;  3NP8 A;  3A8K E;  4IJH A;  1UE6 A;  4WJW A;  4PZ7 A;  3RUZ A;  4A3M B;  5I9O A;  1XX8 A;  1BCP F;  2HDM A;  4CKE A;  5E4W C;  3AB9 A;  5FOB B;  1Q86 C;  2B2V A;  3FP9 A;  5M9O A;  4L5Q A;  1XXG A;  3DWQ A;  3H15 A;  4IOA A;  5C0X J;  3KOJ A;  1CKN B;  4G7O C;  1LYL A;  2KUM A;  1G6P A;  1K9M C;  5CR3 A;  4N9P A;  3C46 A;  3WOE A;  1GXD C;  2A68 C;  3I2Z A;  2AMC B;  4DR5 L;  3H6M A;  1GUS A;  3K80 C;  3HOW H;  3K5O A;  4C3H B;  4CKC A;  5CV7 A;  4JI5 L;  4IPG A;  3J81 c;  5GAG C;  1KRS A;  3GO5 A;  4AYB B;  2ES2 A;  1EOV A;  4LFA L;  4QUC A;  2F52 A;  3BZC A;  2D5D A;  3EVQ A;  2BCO A;  3OTO Q;  4ZCK A;  3SHL A;  2WII B;  4XQJ A;  3I70 A;  4DAY A;  3PQI A;  4N8F A;  2IPK D;  3IAY A;  1X3G A;  2RF4 A;  3L0O A;  1CA5 A;  2L15 A;  1HRJ A;  1IYU A;  1W2B A;  4KD3 A;  1S5C D;  4QUF A;  5C44 H;  1U4M A;  4P75 A;  2K05 A;  3I4M H;  1QIL A;  1K0S A;  2EXD A;  4A93 B;  4QMG A;  4B3R L;  1B44 D;  1MJE A;  1TS4 A;  5JEA J;  3W1B A;  2DN8 A;  5M5X H;  1EIH A;  5CV5 A;  4ZLT F;  1QVG A;  5LL6 X;  3S15 B;  4A3J B;  2GA4 B;  3E6Z X;  5ELC A;  2AQ3 B;  1RIP A;  4X65 Q;  4DR6 L;  4KKU A;  5C4Z A;  1D7Q A;  4XQN A;  1ENA A;  3TZD A;  1TQO A;  5IIF A;  1ZYR D;  1F9P A;  3GTO B;  1FGU A;  1SLJ A;  3BVZ A;  5ELB A;  1VMP A;  2K5D A;  2F0F A;  3DXJ C;  1HUM A;  3GTP B;  1HCZ A;  3A55 A;  1SXT A;  3OPO A;  2B3G A;  1C48 A;  1X6O A;  4KV6 A;  4IUP A;  5GAH C;  4EQO A;  3B6Y A;  4DR5 Q;  1SNC A;  1TY0 A;  2XRQ D;  1B3Q A;  1VQO A;  1OXU A;  5DEH A;  4IFD J;  3ULL A;  1PYS B;  1Y1W H;  4LMQ D;  1JCK B;  2B2T A;  2MFI A;  4M8A A;  4A3F H;  3S17 B;  5HGQ A;  3J7Z C;  1TWA H;  3Q23 A;  1EY7 A;  2CQA A;  1EWI A;  4XYO A;  3S9W A;  1XNR L;  1B3A A;  2PMZ E;  3T1H L;  3J80 L;  4R4O A;  1G2T A;  4JI2 L;  1L1O A;  1EU4 A;  4X3U A;  3CCS A;  1RKN A;  1BO0 A;  4JG2 A;  3DWP A;  3A5Z B;  4DAP A;  2XWB B;  2PQE A;  1GJX A;  1ASY A;  3KDF A;  4H02 A;  1F2Z A;  1U9R A;  4KJN A;  1JOR A;  4CDD C;  5H1S E;  1KDA A;  3KUP A;  4B3R Q;  3HOZ H;  1ILQ A;  3HG9 A;  2CCZ A;  1O78 A;  2BDN A;  1KDC A;  1TS2 A;  1AN8 A;  3DEP A;  4OO1 I;  2WB1 G;  2LSS A;  4UPA A;  4NPS A;  5DAU A;  1K0R A;  1RTO A;  1EFI D;  1YZ6 A;  5ISR A;  2VB3 X;  4OX9 L;  3TP6 A;  3A8I E;  1U5K A;  4A3I B;  5IYD H;  2F0D A;  1ZEQ X;  2LMC B;  1SSO A;  1YNN D;  3NPP A;  4IUU A;  2ZJP A;  5CYU A;  5C4J H;  2OTJ A;  4BBR H;  1NBW A;  5JJK A;  2LXK A;  2KCT A;  1BBX C;  1HR0 L;  3RLN A;  2RVL A;  1PXU A;  1EL0 A;  1E1T A;  4ZUI A;  4DNI A;  2NTT A;  3SVM A;  3NXW A;  2I0Q A;  2JA8 H;  3OIP A;  1B4O A;  2ICE C;  4GLV B;  2MQH A;  1FD7 D;  2MJ8 A;  4LFB Q;  2F3V A;  4WJ3 M;  2JEB I;  2B2V C;  3K7A H;  1IBL L;  1PH6 A;  1XNR Q;  1B1Z A;  1EWC A;  4A3C H;  3T1H Q;  3J7Y W;  4JI2 Q;  4JVZ A;  1L2F A;  2F0N A;  1KNE A;  2DY7 A;  3QG1 A;  3S16 H;  4BY1 G;  1I6V C;  3S2H B;  2JA6 B;  3A7A B;  2E76 C;  4YHH L;  1YHQ A;  1VQ9 A;  3R2I A;  3TP5 A;  2NTS A;  1ZYR C;  3FKI G;  1Y1V B;  1SYE A;  1YBY A;  2OQK A;  4K0K L;  3SGI A;  2L12 A;  1Z9F A;  4KLK A;  3UI2 A;  4IJL A;  1ENC A;  2RDH A;  4X6A H;  1S4Z A;  3PCO B;  2F0O A;  1XWE A;  2DJF C;  1P16 A;  2NBF A;  3AFP A;  1HNW L;  3TP8 A;  5CBE E;  2Z6K C;  3U4V A;  2K7V A;  1T5X D;  5CBA E;  4OX9 Q;  1J8I A;  1QOH A;  1B8A A;  3W3A A;  3W5O A;  1QNU A;  1VQP A;  3HKS A;  1WTP A;  5FO9 B;  2NN6 I;  2WP8 J;  4UHV A;  1PA6 A;  1SJE D;  3NBI A;  3A8J E;  2Q8R E;  2A5H A;  4A3B G;  3NBH B;  4DR7 L;  2RSN A;  3J80 c;  3I4N G;  3BG3 A;  4HAE A;  1KL9 A;  2XSC A;  1IBK L;  3HS0 C;  1N9W A;  2NZO A;  3BZD B;  2R7Z B;  2VUM B;  2R7D A;  1N33 L;  2K5H A;  3KK7 A;  1QZG A;  4PMB A;  4A3G G;  2ZXO A;  4AH6 A;  2KBN A;  4I7A A;  4IOC A;  3GTQ B;  1IBL Q;  4B3S L;  2AKW B;  3S2D B;  2UU9 L;  2VS1 A;  4A3L G;  1FNW A;  1R9T H;  5NUC A;  1F77 A;  1ICW A;  4NMZ A;  2NZ1 D;  5C3E G;  3VDY A;  3SE0 A;  2NVY B;  3F2U A;  4JI0 L;  2R93 B;  2B2T C;  2O4X A;  2OXP A;  5EBC A;  1KC8 C;  1YNN C;  2FXQ A;  1N32 L;  1D5X C;  3S1R B;  1A8V A;  4K2L A;  2NVQ B;  4V0B A;  1Q81 C;  4AIM A;  2HCC A;  4FVM A;  4GKJ L;  3ND8 A;  1GVP A;  4K0K Q;  2UXC L;  2H1E A;  2XGT A;  1TWG H;  2KCN A;  4ODG A;  4XIG S;  1L1O C;  3I56 A;  3OOC A;  4LNQ A;  4MN3 A;  2MP1 A;  1IZ6 A;  1WTW A;  4CJ1 B;  1Z47 A;  2K4K A;  3MXN A;  1CT1 D;  2WKD A;  3S1Q H;  4ZRZ A;  3M7N A;  2NVT H;  3J7A F;  5EKL A;  1X3E A;  4LF4 L;  2P5Z X;  2WKC A;  3CW2 C;  3SK6 A;  1EQR A;  4DR7 Q;  1CHQ D;  1QVF A;  1IBK Q;  1AEX A;  2AUK A;  5IGC A;  1HZ9 A;  1N33 Q;  1CA6 A;  1JMC A;  3MXU A;  3K81 C;  1G91 A;  5FLM H;  2JJQ A;  3W2D A;  3L9A X;  1KD1 C;  2R92 H;  3CPW A;  1KIX A;  3DHQ A;  4M1U B;  1FNU A;  4B3S Q;  2NWG A;  1ASZ A;  2NVX B;  1Z7T A;  2HQL A;  1EY8 A;  1I3Q B;  4PG3 A;  2UU9 Q;  4XTC S;  1EEF D;  1VQ6 A;  5GRO A;  4DV7 L;  4LUV A;  4LF6 Q;  5C5L A;  1PV4 A;  5AJ3 L;  1NTG A;  4POF A;  3ERS X;  1N36 L;  1JR0 D;  4P73 A;  4B3M L;  2HCI A;  1EIY B;  1N32 Q;  4UAI A;  3UDF A;  3VR2 A;  3I55 A;  1YIJ A;  4IAL A;  1BKB A;  1STG A;  3AMU A;  5IP9 H;  4L5R C;  5I2Y A;  2EXZ A;  1TWF B;  3CC2 A;  3KF6 A;  4KN7 C;  4IUT A;  4ZAI A;  2PW7 A;  5BN5 A;  2F1M A;  2HQE A;  1DD2 A;  3BS1 A;  3NE5 B;  1HA5 A;  5EGT A;  4A3M H;  2EYM A;  3D4D A;  4YWM A;  2B39 A;  1SE3 A;  3VR4 A;  5FK9 C;  3N52 A;  2Z1C A;  1VF5 C;  3CCE A;  1Y69 U;  2MNA A;  1QVC A;  1SBB B;  1ICF B;  3HGB A;  4IUQ A;  4O2D A;  5IGD A;  1UE5 A;  1HUN A;  1AP0 A;  5IGF A;  3R2T A;  2EYO A;  1UWV A;  1LT3 D;  4RGO S;  1SFO B;  1DON A;  2K28 A;  2RDG A;  4C3H H;  5CV8 A;  1CTM A;  3F8T A;  5D14 A;  1QUQ B;  3TME A;  1V1Q A;  4DV7 Q;  5FJ8 G;  4DA2 A;  1SNP A;  3WOF A;  2C5C A;  3H09 A;  3QOJ A;  3TRZ A;  3TP7 A;  1S40 A;  1JC7 A;  1EOT A;  2BH8 A;  4DPG A;  4DV3 L;  2WB1 B;  3UDX A;  1SMY D;  2F0L A;  4B3M Q;  1VQA A;  4CHT B;  2B8F A;  5M3M G;  4DGZ A;  1II3 A;  2CKZ B;  4DAY B;  1WTR A;  2F0U A;  1JOQ A;  2Z0S A;  1G51 A;  1LTB D;  4DU9 A;  4A3D G;  3PO3 G;  2F0G A;  2KHJ A;  1GD7 A;  2O5J C;  5JJI A;  3CHB D;  1NSN S;  1EQQ A;  4HTH A;  1STH A;  2HHH L;  5C0X H;  2EJF C;  1B9N A;  1BOS A;  2R3Z A;  3K57 A;  2F0E A;  3CF5 A;  3IFT A;  1V1P A;  2ALY B;  4K8I A;  1G6Z A;  4XQQ A;  3S15 H;  3HOY G;  4QL5 A;  5C3W A;  1VQH A;  3GTJ H;  3EQL C;  1SR3 A;  3T53 B;  1LTT D;  3RMH A;  3G48 A;  3AQQ A;  4RCN A;  1DZ1 A;  4FO2 A;  1IKM A;  2B2U C;  2E2I B;  1GUN A;  1VQK A;  1B7Y B;  4H44 C;  5K36 H;  4Y7N H;  4CDC C;  3KJP A;  4HCE A;  3PF4 A;  4BY1 B;  1K8G A;  2ZXR A;  4C2M B;  3TN2 A;  1DOM A;  1EY5 A;  1Q46 A;  4P72 A;  1XTD A;  3U9S A;  3FKI B;  5J1Z A;  4UP9 A;  3STB D;  3S17 H;  3C2P A;  4FYD A;  1B50 A;  4TSS A;  3OHX C;  4A3E G;  1CZW A;  1ET9 A;  3V2T A;  5I6W A;  1JJG A;  1HQM C;  2YV5 A;  4L5T A;  2Y0S E;  4C3J G;  5JEA H;  4BBS G;  4DN4 M;  4DV3 Q;  2MO0 A;  4HIO A;  1A62 A;  1BCP B;  4HMJ A;  1L1O B;  4YCV A;  1QZH A;  2JA5 H;  4TVA B;  4RWS C;  1D8L A;  2OT2 A;  1O7Y A;  3CAM A;  1S5E D;  4HJ5 A;  4BY7 G;  1UAP A;  3KDF B;  4JI3 L;  2F0S A;  3UDI A;  2HHH Q;  2YU9 B;  4OIJ A;  4DFA A;  1JWM D;  4FNF A;  1DJR D;  5C5M A;  1SYB A;  4A3B B;  2VY3 A;  2NUC A;  3I4N B;  1O7Z A;  3S1M H;  1TWC H;  1H9K A;  1Q8K A;  2R61 A;  2KED A;  3VR6 A;  2HD3 A;  4IFD H;  2AHO B;  3OMC A;  3GTL H;  3DLL A;  2N78 A;  5C3X A;  2X6G A;  3U4Z A;  3NSW A;  5EPK A;  3LX0 A;  1OTC A;  4LF8 Q;  2K75 A;  4NB3 A;  1X9N A;  4GKK Q;  4A3K H;  5GAD C;  1A3T A;  4JC0 A;  4OHJ A;  3CCR A;  2IW3 A;  3F2B A;  1RJT A;  1Y8P B;  4X64 L;  5C3E B;  1JWU D;  4B9W A;  1PTO D;  4IN3 A;  4F87 A;  5JJL A;  1PH2 A;  1VCI A;  1STY A;  3HOW G;  3D6W A;  1SRU A;  1VQI A;  2B63 H;  3I72 A;  2O5I C;  2BH2 A;  4JBM A;  4ZUJ A;  4BXX H;  1CUK A;  4I7Z C;  1HFG A;  1PHJ A;  2L1B A;  4YCW A;  3AFQ A;  4KD4 A;  4KY6 A;  4DV2 Q;  2HT1 A;  1SNO A;  2F0T A;  4OWW B;  2KEN A;  4YWK A;  2JA6 H;  1I6H B;  3UDG A;  2PQA A;  2E5L L;  4O42 A;  5C44 G;  3LWU A;  3I4M G;  1V43 A;  4X65 L;  4JI3 Q;  2A6E D;  4R9W A;  2IX0 A;  1Y1V H;  2F3W A;  2M9V A;  4JOI A;  4RFB A;  3CCJ A;  2AWO A;  3I7F A;  1X3F A;  4LK1 C;  4K6D A;  3R8B A;  4QCL A;  2QDB A;  2F4V L;  2EYP A;  1IXR A;  2QEX A;  4CJ2 C;  1LAB A;  4G4K A;  4IPD A;  1YJ9 A;  2DNE A;  3AYH B;  1L0Y B;  3NUC A;  4LF7 L;  1SNQ A;  1YEZ A;  2UUB L;  2ZJR A;  3I90 A;  3M3Y B;  3J81 j;  2QCP X;  1MBY A;  4C3I H;  2Z9H A;  4OEM B;  2IWH A;  1AE3 A;  4X64 Q;  2R7Z H;  2VUM H;  1GHK A;  2MHV A;  3GQB A;  2EQS A;  1SYG A;  1Y1W G;  5G3L D;  1M90 C;  1B9M A;  2JP1 A;  3D0F A;  4A3F G;  2C9O A;  3HOU H;  2LFN A;  2BE5 D;  4RHR A;  3VYT A;  2SNS A;  3GTG B;  3ERO A;  3S2D H;  2SDF A;  5DLQ E;  2I5L X;  2PCF B;  4XT1 B;  1LO5 D;  1SE2 A;  1D5Z C;  2RCF A;  1V1O A;  3ULJ A;  4NXN L;  2PZU A;  3TQY A;  3JC6 6;  4ZYS A;  1PTO H;  1NUC A;  2E5L Q;  5M5Y B;  2E75 C;  1EZ6 A;  1RTN A;  2QDL A;  4MZ9 A;  2NVQ H;  3LGJ A;  4RAU C;  3HOZ G;  1WCM G;  4NW2 A;  1AW7 A;  1VQM A;  1YNJ D;  2QW7 A;  3K5L A;  3KLS A;  5IT9 c;  4IUN A;  1STE A;  1H95 A;  5M5W B;  2F4V Q;  1W6J A;  3J7A 5;  3CRK C;  5FKA C;  2CQO A;  1BUV T;  2C35 B;  1J6Q A;  1YHB A;  3CPF A;  4FP5 D;  4HIM A;  1STB A;  1GO3 E;  4B9X A;  3FPU B;  2ID0 A;  5IYD G;  4UP7 A;  1WTH A;  4POG A;  3D31 A;  3TBI B;  1JOK A;  4LF7 Q;  2K5Q A;  4H13 C;  2UUB Q;  3VYU A;  4LFB L;  1D1K A;  1LTS D;  1MI2 A;  3Q6S A;  4BBR G;  2K5W A;  1CSQ A;  1RDP D;  2F0Q A;  5IGG A;  4C1N I;  5IP7 G;  4K5X A;  4NP5 A;  1LTR D;  2CWA A;  1UE1 A;  4QIW B;  1SRO A;  4QQB X;  3S14 B;  2VQF Q;  1YI2 A;  2Z4H A;  3OWF A;  3CQZ H;  1Q8I A;  2EYL A;  4A3C G;  1LT4 D;  4DR3 L;  4A3D B;  3PO3 B;  1O7I A;  2YTV A;  3FVQ A;  1H9M A;  1I3Q H;  4LF9 L;  2D2C C;  4BA1 I;  1F9S A;  1D1I A;  4DXF A;  4NXN Q;  4FF3 A;  2Z8L A;  3FDT A;  2IX1 A;  5IYB G;  1V9P A;  3GD7 A;  2RA4 A;  3X3M A;  4OGQ C;  2K32 A;  3G7L A;  2EIF A;  3PO2 B;  1BDO A;  1HNX L;  3X3N A;  4RGT A;  2J0T D;  4RCO A;  4YCU A;  1TKW B;  3CRL C;  2MUY A;  1EU3 A;  2JE6 I;  3E9I A;  3M4O H;  1WTV A;  1JB7 A;  4JCV E;  3K5N A;  1CKM A;  1TWF H;  1DOK A;  3CU7 A;  4HSP A;  1PZK D;  3KF6 B;  4GOP A;  1F2M A;  4ABN A;  3VA7 A;  3C1F A;  4JW0 A;  3MXP A;  4ME3 A;  3JAM c;  4L8J A;  1KXL A;  5KYL A;  3FRP B;  4KMU C;  1S3O A;  4DK1 A;  1GKH A;  1Q90 A;  2J7Z A;  3E0E A;  3CC7 A;  3G4S A;  3RLF A;  1CQF A;  1GHJ A;  3PUX A;  2ATW A;  3V05 A;  1PZI D;  4ZKC B;  3PIO A;  4C3J B;  2FFK B;  4KY7 A;  1PFB A;  4BBS B;  4Y52 H;  1FNV A;  3P7J A;  2PO4 A;  4EQN A;  1PH9 A;  3FHW A;  3PIO 3;  1S5B D;  1SFO H;  3HOX H;  3MVV A;  1WYD A;  2HIX A;  1SYC A;  4GLA C;  4DR3 Q;  2WAQ E;  1M4V A;  4JI1 L;  1JB3 A;  3ND9 A;  1IW7 D;  4LF9 Q;  2R6G A;  1EWH A;  4ID6 A;  1GUW A;  3E3X A;  4DAV A;  5C4X H;  2Q2H A;  4N8X 1;  5EKI A;  3F1Z A;  4I65 A;  5BR8 Q;  1EYD A;  2XN9 C;  3H0G H;  1PFN A;  4FXK C;  1T9H A;  1E24 A;  4MTN A;  1HNX Q;  1VQG A;  2OCE A;  3RD4 A;  1V8Q A;  3MZ5 A;  5EAY A;  4HJ7 A;  5M3F B;  1SN8 A;  1SYD A;  2RCN A;  5EBD A;  1HXY D;  2OQ0 A;  1LT6 D;  4DR4 Q;  2F0I A;  1K28 A;  3M85 A;  4AQY Q;  1JJ2 A;  1W6K A;  2G9D A;  3QOL A;  3DWA A;  1A3V A;  1C4Q A;  4L5S A;  1DYQ A;  5C4H A;  5LMU L;  5KGU A;  1YJN A;  1E7Z A;  5KEE A;  2JA7 B;  3HOW B;  2PZT A;  2CFM A;  3RZD B;  3CC4 A;  1CZG A;  3D4R A;  1SE4 A;  1H9J A;  1RF2 D;  1PH8 A;  3HOV H;  2E2I H;  2QGQ A;  4GNX A;  4J6H A;  4LF6 L;  4RKB A;  5L37 A;  5FLM G;  1KDB A;  1EYA A;  1I4X A;  2EZV A;  1VQ7 A;  2R92 G;  2QA4 A;  4KHP Q;  1XTC D;  1XNQ L;  4Z9C B;  1NCV A;  5IE8 A;  1BVS A;  2UXD L;  4C2M H;  5EKK A;  5D65 A;  2XTI A;  4JI1 Q;  2A74 C;  1XMO Q;  2VNU D;  1HQR D;  1VQL A;  3P1H A;  4EX5 A;  3OMG A;  4HIK A;  1VQB A;  5CV4 A;  2SOB A;  4H0L C;  3CCL A;  5JOB A;  5JPN C;  3FMC A;  1K8O A;  1HFN A;  1LAC A;  1AZQ A;  3K0Y A;  1DOL A;  5HY6 A;  5IP9 G;  3CCQ A;  3JAM i;  2B8G A;  1NAP A;  2EVB A;  2N49 A;  3WDN A;  3CKI B;  1STA A;  3GTK H;  5LMU Q;  1X3Q A;  1A6X A;  1MGS A;  1PFS A;  3M9B A;  2F0W A;  1NMG A;  3K0X A;  1Y1W B;  4A3M G;  1S5F D;  3NEM A;  1EFW A;  1N34 L;  1NJI C;  4ME5 A;  1HTP A;  3KF8 B;  1SYF A;  4KI0 A;  2G5D A;  5LHY 1;  2VL6 A;  4A3F B;  1IW7 C;  2DUD A;  1TWA B;  4X3T A;  3HKZ E;  4OEL B;  3TEH B;  4PMW A;  4DR1 L;  2ZT9 C;  3L2P A;  1NMF A;  2F4I A;  3KYH C;  2PYK A;  5C3E H;  3BU2 A;  4GOP C;  2WV6 D;  4KK7 A;  1XNQ Q;  4LFC L;  2UUA Q;  2UXD Q;  1I4G A;  5IT9 E;  4C3H G;  2SEB D;  1XPR A;  1LV9 A;  5K5P A;  4P71 A;  3UE0 A;  2MPM A;  4AYB G;  1PRT D;  3MC0 B;  1ILP A;  3SXH A;  3M7G A;  3HOZ B;  3PUY A;  1WCM B;  4X3K A;  1LTG D;  1STN A;  1EIG A;  2K14 A;  4R4T A;  2E2H B;  3TZU A;  3VR5 A;  1SJH D;  3QB3 A;  4LUO A;  4AYB E;  2I5H A;  1A2T A;  1NE3 A;  2A6H D;  2PMZ B;  1DM0 B;  2YYZ A;  4PQX A;  1TWH B;  5LL6 S;  2A69 D;  2PQA B;  4NXM L;  1PTO F;  5C0X G;  1HJP A;  1E0B A;  1RD9 D;  1KRT A;  2EJM A;  1I94 L;  1WJJ A;  2TSS A;  3PSI A;  3OW2 A;  4RGN A;  2EOT A;  2PNH A;  4BBR B;  3K7U C;  4ILW A;  5KRU A;  2RHQ B;  2AQ1 B;  2UUC L;  1SDF A;  4FF2 A;  2JQO A;  2PNR C;  4FXG C;  3C3L A;  1N34 Q;  2ZJQ A;  4P74 A;  2KCM A;  3BDL A;  1E2W A;  2K5N A;  3HZX A;  1MHW C;  1IHZ A;  2GVA A;  5J39 A;  1OXX K;  4DR1 Q;  3M3Y H;  2F3I A;  4BA2 I;  1K8M A;  4DV0 Q;  3CD6 A;  5IOD A;  1TT2 A;  4U68 A;  4IO9 A;  5K36 G;  1EQV A;  1Y14 B;  2NZH A;  3Q8D A;  2FJ2 A;  4R1J A;  1WTX A;  4LFC Q;  1VQJ A;  1VQ4 A;  2LXJ A;  2K6A A;  1ML0 D;  1CK1 A;  4X66 Q;  3MTS A;  2EY6 A;  1WD0 A;  2B2Y A;  2B2W A;  3T56 B;  4HCS A;  4R4Q A;  4YY3 L;  1Q12 A;  2BA1 A;  3BDO A;  1E3P A;  3GTG H;  1KAA A;  2QEJ C;  2QF7 A;  2MO1 A;  5JEA G;  4GNX C;  2JSO A;  4A93 H;  3JAM E;  2F0V A;  3CME A;  4YIJ A;  1B53 A;  2JA5 G;  2XIW A;  1P8L A;  4QY7 A;  3PF5 A;  2CH4 W;  4A3J H;  2ZTC A;  1IYJ B;  4JI8 Q;  3H3V C;  3A7L A;  4MNO A;  1CKO A;  4DNR B;  2FIN B;  3A56 A;  5EJW A;  4NXM Q;  3K58 A;  4K5V A;  3L7Z C;  3GV3 A;  1I94 Q;  3NBH A;  3GTO H;  2OF1 A;  5E4X A;  4LF8 L;  1D5M C;  3RZO B;  4GKK L;  4OO1 H;  3I3C A;  4R8N A;  5D3I B;  3PUV A;  5G3L F;  5KND A;  4FXD A;  2PW5 A;  2UUC Q;  3GTP H;  3PMF A;  4IFD G;  1YNX A;  4TRD A;  3K8A A;  1C0A A;  2Y0S G;  5IYC H;  1K8A C;  3WWV A;  3G71 A;  1MSH A;  1PRT C;  3NTH A;  4A3K G;  1OXT A;  1LTL A;  4PNY A;  2FMC A;  1BNZ A;  5JVG 3;  4HID A;  1R9T B;  3RR5 A;  4KN4 C;  1PYW D;  4XT3 B;  4EVO A;  1SNM A;  2EPB A;  1PH7 A;  2KJX A;  4RGM A;  3V96 A;  1NR4 A;  4DV2 L;  1VQC A;  4EQP A;  2B63 G;  4HJ9 A;  4UP8 A;  3S14 H;  3T51 B;  4X62 L;  3U50 C;  4YY3 Q;  2A69 C;  4BXX G;  4DV5 Q;  1FYC A;  1Y8O B;  1KLU D;  2A19 A;  4PZ6 A;  5JVH 3;  4DR2 Q;  5ELF A;  5JJZ A;  5BN4 A;  4K8J A;  1TWG B;  1ZXT A;  3NQT A;  3NEL A;  2RQX A;  1SMX A;  4PZ8 A;  4S3S A;  1HA6 A;  2AQ2 B;  3PIP A;  3NWS A;  3HEJ A;  1DGS A;  4BS9 A;  5E1F A;  2JA6 G;  1MD2 D;  1D2B A;  5KIX A;  1EY4 A;  3PIP 3;  2YTX A;  3U9O A;  4A3G B;  3DM1 A;  4J1M A;  1F2Y A;  1Y1V G;  3PO2 H;  2K01 A;  4A3I H;  1M1K C;  1A3U A;  1AZP A; 
#chains in the Genus database with same CATH homology
 1LUZ A;  1YHB A;  2NN6 I;  2WP8 J;  3CPF A;  4HIM A;  2JEA I;  1PA6 A;  1GO3 E;  2GN5 A;  4DV4 Q;  2ID0 A;  5IYD G;  4UP7 A;  4A3B G;  3NBH B;  4DR7 L;  3J80 c;  1K3R A;  3I4N G;  4J15 A;  1S72 A;  1KL9 A;  1IBK L;  4POG A;  3D31 A;  1N9W A;  1W3S A;  2K50 A;  2NZO A;  2UUB Q;  4LF4 Q;  4LF7 Q;  2R7D A;  1N33 L;  4LFB L;  2K5H A;  4OO1 G;  2E8G A;  1QZG A;  3T1Y Q;  4A3G G;  3KFU A;  1RL2 A;  4AH6 A;  4BBR G;  1CSQ A;  2KBN A;  4OXP A;  2D0O A;  2JK8 A;  4DUZ Q;  5IP7 G;  5GAE C;  4IOC A;  1IBL Q;  1VQ5 A;  3IRB A;  2OTL A;  4LW1 A;  1UEB A;  4B3S L;  2AKW B;  2CWA A;  4JI7 L;  1UE1 A;  5IYC G;  1SRO A;  4QQB X;  1HNZ Q;  2E2J H;  2VQF Q;  2UU9 L;  2VS1 A;  4A3L G;  1YI2 A;  1R9T H;  1Q7Y C;  2R7Z G;  2BA0 A;  5C3E G;  2VUM G;  1E1O A;  3VDY A;  3HFZ B;  3CQZ H;  4C3J H;  4A3C G;  4DV5 L;  1VQF A;  4DR3 L;  3CP0 A;  1O7I A;  1G29 1;  2YTV A;  1I3Q H;  4JI0 L;  5LMN Q;  4DR2 L;  4LF9 L;  1I5F A;  4BA1 I;  3S2H H;  4X62 Q;  2OWO A;  4JBK A;  3HOU G;  1KC8 C;  2N8N A;  4ALP A;  4NXN Q;  2FXQ A;  1N32 L;  5AJ3 Q;  1A8V A;  2VW9 A;  1Q81 C;  1EUJ A;  4AIM A;  2HIV A;  1PH5 A;  5IYB G;  1FJG L;  1V9P A;  1N36 Q;  2IX1 A;  3A74 A;  4GKJ L;  1GVP A;  4K0K Q;  2UXC L;  3GD7 A;  4GS3 A;  1AE2 A;  2XGT A;  1PYB A;  3CCM A;  1TWG H;  1EYG A;  2EIF A;  3PGZ A;  4XIG S;  5M5Y H;  1L1O C;  4R4C A;  3I56 A;  1HNX L;  4LNQ A;  1GM5 A;  2UXB L;  4YCU A;  1J5E Q;  2WFW A;  3H3V H;  4JV5 L;  4QIW E;  1IZ6 A;  3E9I A;  3M4O H;  2JE6 I;  3RLO A;  3UE1 A;  4QGU A;  1JB7 A;  1Z47 A;  2K4K A;  4JCV E;  5M5W H;  1CKM A;  1HR0 W;  1TWF H;  3TRE A;  3S1Q H;  3M7N A;  3STB C;  2NVT H;  1X3E A;  4LF4 L;  5M3F H;  3CW2 C;  3KF6 B;  4DUY L;  1EQR A;  4GOP A;  4LF5 L;  4DR7 Q;  1IBM L;  1QVF A;  1AH9 A;  4ME3 A;  3PO2 G;  1YHA A;  4A3I G;  3JAM c;  3EIV A;  4A75 A;  1IBK Q;  3CXC A;  2GVB A;  2IY5 B;  1XJV A;  1KXL A;  2I5M X;  1HZ9 A;  1N33 Q;  1JMC A;  1S3O A;  4B3T Q;  1GKH A;  3K81 C;  5FLM H;  2JJQ A;  3E0E A;  3CC7 A;  3G4S A;  3RLF A;  1KD1 C;  2R92 H;  3GTM H;  1E22 A;  2K52 A;  3PUX A;  1EIF A;  3CPW A;  2ATW A;  2JA7 H;  1KIX A;  1HNZ L;  2VQF L;  1KHI A;  5FJ8 H;  3W1G A;  3KJO A;  3RZD H;  4DV6 L;  2ZM6 L;  1QUQ A;  3PIO A;  4B3S Q;  4JI7 Q;  4JI6 Q;  1ASZ A;  4Y52 H;  3GTQ H;  2HQL A;  4JI4 L;  4PG3 A;  5LMN W;  2UU9 Q;  1PH4 A;  1PH9 A;  4XTC S;  1VQ6 A;  3FHW A;  2NN6 G;  5GRO A;  4DV7 L;  2JA9 A;  4LUV A;  1SFO H;  3HOX H;  2R92 G;  4LF6 Q;  1WYD A;  3F2C A;  2HIX A;  5M3M H;  4GLA C;  4DR3 Q;  2RHS B;  4GNX B;  1C7Y A;  1YIT A;  1PV4 A;  5AJ3 L;  2WAQ E;  1NTG A;  1HZB A;  4JI1 L;  4POF A;  5FLX c;  2Z6K A;  2NVY H;  3ERS X;  4LF9 Q;  4A3D H;  1N36 L;  2R6G A;  3NEN A;  1PH3 A;  3PO3 H;  4P73 A;  2DGY A;  4B3M L;  4OON A;  1HZC A;  2R93 H;  2PI2 E;  1EIY B;  1N32 Q;  1B70 B;  3UDF A;  5C4X H;  1FJG Q;  4JYA Q;  3F2D A;  3I55 A;  1YIJ A;  1BKB A;  2Q2H A;  3S1R H;  3F1Z A;  2A1A A;  4R4I A;  5IP9 H;  3DM3 A;  4L5R C;  5BR8 Q;  3CCV A;  1VQ8 A;  3H0G H;  4GN4 B;  1T9H A;  1WOC A;  1E24 A;  4MTN A;  1HNX Q;  1VQG A;  2OCE A;  3HOY H;  2UXB Q;  2IHF A;  3CC2 A;  3KF6 A;  4JV5 Q;  3RNU A;  5EAY A;  2AWN A;  3PV0 A;  4HJ7 A;  1SN8 A;  4EQ5 A;  1VQN A;  4DV1 L;  4WJ4 A;  2PI2 A;  2RCN A;  2OQ0 A;  4DR4 Q;  3ER0 A;  3I4O A;  4AQY Q;  3M85 A;  1NY4 A;  4YWM A;  4A3M H;  1JJ2 A;  1I50 H;  1TXY A;  1WI5 A;  3MXN B;  4FDB A;  5E7N A;  3AEV A;  4DUY Q;  4L5S A;  5IY0 A;  3EN2 A;  5LMU L;  4LF5 Q;  3CCE A;  1IBM Q;  4B3T L;  1YJN A;  1E7Z A;  3M4Q A;  1VS0 A;  2MNA A;  3S24 A;  1QVC A;  4GOP B;  4O2D A;  3PUW A;  2CFM A;  3CC4 A;  5M3F G;  1Q1B A;  3M4P A;  1UE5 A;  3CMA A;  4JI6 L;  2JA8 G;  1UWV A;  1VQE A;  1PH8 A;  4YWL A;  4JI5 Q;  3HOV H;  1BBW A;  1WFQ A;  4DV6 Q;  5GQO A;  2QGQ A;  2ZM6 Q;  4GNX A;  2N3S A;  4C3H H;  4QJF A;  1A0I A;  2E2I H;  5FLM G;  4A3E H;  4LF6 L;  1XPU A;  3CCU A;  3OTO L;  4JI4 Q;  4LFA Q;  3F8T A;  1K73 C;  2NVX H;  1QUQ B;  2CWP A;  2QA4 A;  1VQ7 A;  2JA7 G;  1V1Q A;  4DV7 Q;  4KHP Q;  1XNQ L;  5FJ8 G;  5IE8 A;  1BVS A;  2UXD L;  1MJC A;  4DK3 C;  3H3V I;  4C2M H;  3TRZ A;  2ASB A;  1S40 A;  3U58 A;  5C0X I;  2VQE L;  2BH8 A;  4DPG A;  2XTI A;  4JI1 Q;  4DV3 L;  2YTY A;  3UDX A;  2VNU D;  1XMO Q;  4BY7 H;  3HOX G;  1VQL A;  4B3M Q;  1VQA A;  4EX5 A;  3A0J A;  4HIK A;  5M3M G;  5BR8 L;  2CKZ B;  4DAY B;  1VQB A;  1JJC B;  2H5X A;  2Z0S A;  3CCL A;  1G51 A;  4A3D G;  4RG1 A;  3PO3 G;  2KHJ A;  1GD7 A;  1L0W A;  5JJI A;  2R93 G;  1EQQ A;  1WCM H;  5ELN A;  1JT8 A;  4IJH A;  1UE6 A;  2HHH L;  4JBJ A;  4PZ7 A;  3G6E A;  3ZJY C;  5C4X G;  3CF5 A;  2E2H H;  4DR4 L;  5HY6 A;  5IP9 G;  3CCQ A;  1PVO A;  2ALY B;  1HZA A;  3JAM i;  4AQY L;  4DV1 Q;  2N49 A;  1Q86 C;  3H0G G;  3FP9 A;  3S15 H;  4L5Q A;  4DR6 Q;  3HOY G;  4TQU S;  3RN5 A;  3GTK H;  3H15 A;  4IOA A;  4QL5 A;  1VQH A;  5C0X J;  3GTJ H;  3KOJ A;  1SR3 A;  1CKN B;  1LYL A;  1TWH H;  1G6P A;  1K9M C;  5LMU Q;  4JOI C;  4OWX B;  3G48 A;  1PFS A;  2WB1 E;  2AMC B;  3AQQ A;  3I2Z A;  3M9B A;  1NMG A;  4IPC A;  2V1C C;  3K0X A;  3J81 i;  4DR5 L;  4A3M G;  3A5U A;  3NEM A;  4LUZ A;  1EFW A;  3K80 C;  4GN3 B;  1NJI C;  1N34 L;  3KF8 B;  3HOW H;  3ICE A;  4JBW A;  1B7Y B;  4KI0 A;  1VQK A;  4JI5 L;  2WAQ G;  4IPG A;  4Y7N H;  2R7F A;  2VL6 A;  2DUD A;  3J81 c;  5GAG C;  1KRS A;  3GO5 A;  5IP7 H;  5J3B A;  3KJP A;  2ES2 A;  4GLX A;  4APV A;  1EOV A;  3HKZ E;  4KHZ A;  3TEH B;  4PMW A;  4DR1 L;  4LFA L;  3PF4 A;  2F52 A;  4KHP L;  1K8G A;  1HH2 P;  3BZC A;  3L2P A;  1NMF A;  3OTO Q;  1Q46 A;  3KYH C;  4P72 A;  1XTD A;  1OXS C;  1MKH A;  5C3E H;  4HJA A;  3BU2 A;  4GOP C;  1PH1 A;  1XNQ Q;  4UP9 A;  3STB D;  4LFC L;  2UUA Q;  3HOV G;  3S17 H;  2Q2I A;  2UXD Q;  1XMO L;  4A3E G;  1XPR A;  1Q82 C;  4P71 A;  2VQE Q;  2YV5 A;  1X3G A;  2RF4 A;  2Y0S E;  3L0O A;  4L5T A;  4O0A A;  3UE0 A;  4A4I A;  4AYB G;  4DV3 Q;  2L15 A;  4BBS G;  2MO0 A;  4HIO A;  1W2B A;  3EBE A;  1A62 A;  5C44 H;  4P75 A;  3I4M H;  3PUY A;  4YCV A;  1L1O B;  5IYB H;  2EXD A;  1QZH A;  2K14 A;  2JA5 H;  4B3R L;  1SE8 A;  1BBU A;  4R4T A;  1MJE A;  4TVA B;  4IFD I;  1D8L A;  1MIU A;  3CAM A;  4BY7 G;  4HJ5 A;  5JEA J;  3W1B A;  3GDE A;  4LUO A;  5M5X H;  4AYB E;  3KDF B;  2I5H A;  4JI3 L;  3UDI A;  1QVG A;  2HHH Q;  3KLW A;  1NE3 A;  1CKN A;  4UY8 C;  1RIP A;  2YYZ A;  4X65 Q;  1KAW A;  2VY3 A;  4DR6 L;  1D7Q A;  2ZTE A;  3S1M H;  1YVC A;  1TWC H;  2PQA B;  4NXM L;  1FGU A;  1HJP A;  1Q8K A;  1SLJ A;  1KRT A;  1FL0 A;  5C0X G;  1I94 L;  1X56 A;  1WJJ A;  2AHO B;  3PSI A;  3GTL H;  3DLL A;  3OW2 A;  2N78 A;  2PNH A;  4GN5 A;  3K7U C;  3TS2 A;  4IPH A;  2RHQ B;  2B3G A;  1X6O A;  3U4Z A;  1OTC A;  5GAH C;  4LF8 Q;  4RMF A;  2UUC L;  2K75 A;  4NB3 A;  3B6Y A;  4DR5 Q;  1X9N A;  4GKK Q;  4A3K H;  2JQO A;  1N34 Q;  1VQO A;  1OXU A;  5GAD C;  2ZJQ A;  3ULL A;  1PYS B;  4P74 A;  1Y1W H;  4JC0 A;  2KCM A;  3CCR A;  3RZO H;  4IFD J;  2MFI A;  3F2B A;  2K5N A;  1HR0 Q;  4X64 L;  5IWA L;  2GVA A;  5JJL A;  4A3F H;  1PH2 A;  5HGQ A;  1OXX K;  3J7Z C;  4DR1 Q;  1TWA H;  1VCI A;  3HOW G;  1EWI A;  2F3I A;  1XNR L;  3M3Y H;  4BA2 I;  1SRU A;  1VQI A;  2PMZ E;  4DV0 Q;  3T1H L;  2UUA L;  4BY1 H;  4IO9 A;  3CD6 A;  2B63 H;  5K36 G;  1Y14 B;  2BH2 A;  4R4O A;  4JBM A;  2NZH A;  4JI2 L;  1L1O A;  3Q8D A;  4R1J A;  1XMQ L;  4LFC Q;  4BXX H;  1CUK A;  3CCS A;  1VQJ A;  3FKI H;  2LXJ A;  1VQ4 A;  1PHJ A;  2IT1 A;  4JG2 A;  4YCW A;  5ELO A;  2K5V A;  3AFQ A;  4X66 Q;  3BZK A;  3A5Z B;  1OXV A;  4R4Q A;  1ASY A;  3KDF A;  3ULP A;  4YY3 L;  4DV2 Q;  1Q12 A;  4H02 A;  2BA1 A;  2HT1 A;  1E3P A;  3GTG H;  1CSP A;  5H1S E;  4YHH Q;  1N8R C;  4OWW B;  4B3R Q;  1Q1E A;  2KEN A;  4LWC A;  4YWK A;  5JEA G;  2MO1 A;  2JA6 H;  3HOZ H;  3BJU A;  4GNX C;  3UDG A;  4A93 H;  2CCZ A;  2PQA A;  2E5L L;  5C44 G;  2ZTD A;  4OO1 I;  3CME A;  3I4M G;  2WB1 G;  1V43 A;  4X65 L;  2LSS A;  4UPA A;  4JI3 Q;  4BBS H;  1C9O A;  1JE5 A;  2IX0 A;  4NPS A;  1Y1V H;  4JOI A;  2JA5 G;  1P8L A;  1K0R A;  4JYA L;  4QY7 A;  3CCJ A;  3PF5 A;  1YZ6 A;  2AWO A;  3I7F A;  4A3J H;  4OX9 L;  2ZTC A;  2YU9 H;  3OYY A;  1IYJ B;  1X3F A;  4JI8 Q;  1U5K A;  1HNW Q;  4MNO A;  1KQS A;  1CKO A;  1LM0 A;  5IYD H;  4A3B H;  2IHE A;  4NXM Q;  1YJW A;  2F4V L;  3MEF A;  3I4N H;  3L7Z C;  1IXR A;  1U0L A;  3HKZ G;  2QEX A;  1I94 Q;  3GTO H;  4LF8 L;  1XPO A;  4IPD A;  2ZJP A;  4GKK L;  5C4J H;  1YJ9 A;  1UE7 A;  3PUV A;  4DV4 L;  4A3G H;  3AYH B;  2OTJ A;  4BBR H;  1NBW A;  5JJK A;  4OWT B;  1A63 A;  2LXK A;  2Q2T A;  2UUC Q;  3GTP H;  4IFD G;  2KCT A;  1HR0 L;  1YNX A;  3RLN A;  4LF7 L;  1YEZ A;  2VZA A;  2UUB L;  2ZJR A;  2B29 A;  1E1T A;  3J81 j;  3K8A A;  1FVI A;  3T1Y L;  4C3I H;  1C0A A;  2Y0S G;  5IYC H;  4DNI A;  1K8A C;  3WWV A;  4A76 A;  2I0Q A;  1AE3 A;  2JA8 H;  4X64 Q;  3G71 A;  4GLV B;  5IWA Q;  4DV0 L;  2MQH A;  4LFB Q;  4A3L H;  4WJ3 M;  4A3K G;  1OXT A;  4DK6 C;  4DUZ L;  2R7Z H;  1LTL A;  2JEB I;  3K7A H;  2VUM H;  4DKA C;  3TS0 A;  2EQS A;  1PH6 A;  1IBL L;  1Y1W G;  1XNR Q;  4A3C H;  3T1H Q;  4HID A;  1JJG A;  3E9H A;  3RR5 A;  3PUZ A;  2Q2U A;  1M90 C;  3D0F A;  4X66 L;  4JI2 Q;  1X65 A;  4A3F G;  1L2F A;  1PH7 A;  1XMQ Q;  3HOU H;  3S16 H;  4DV2 L;  1VQC A;  3S2D H;  1VQD A;  4BY1 G;  1K83 H;  2B63 G;  4HJ9 A;  5DLQ E;  4UP8 A;  4YHH L;  3S14 H;  2I5L X;  5LMN L;  1YHQ A;  1VQ9 A;  4X62 L;  3U50 C;  4YY3 Q;  4BXX G;  4DV5 Q;  3ULJ A;  3FKI G;  4NXN L;  2A19 A;  4PZ6 A;  3TQY A;  1IL2 A;  4JI0 Q;  1YBY A;  4DR2 Q;  3JC6 6;  4DAM A;  2D62 A;  2OQK A;  4K0K L;  3SGI A;  1Z9F A;  4KLK A;  4IJL A;  4X6A H;  1I6H H;  3PCO B;  2E5L Q;  3NEL A;  1SMX A;  4PZ8 A;  1P16 A;  4JI8 L;  4GKJ Q;  1X55 A;  3AFP A;  3PIP A;  4MZ9 A;  1HNW L;  2NVQ H;  1DGS A;  3LGJ A;  2UXC Q;  2Z6K C;  3U4V A;  1WCM G;  2A8V A;  2JA6 G;  3HOZ G;  1VQM A;  4OX9 Q;  1J5E L;  4A93 G;  1B8A A;  5IT9 c;  2YTX A;  3W5O A;  1X54 A;  4HJ8 A;  1H95 A;  2D0P A;  2KHI A;  2F4V Q;  3J7A 5;  1VQP A;  1Y1V G;  3HKS A;  2CQO A;  3RN2 A;  3PO2 H;  4A3I H;  1M1K C;  3J80 i;  3S1N H;  2C35 B;  4A3J G;  1J6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...