1QZGA

Crystal structure of pot1 (protection of telomere)- ssdna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
VIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords telomeric single-stranded DNA
publication title DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 46
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1qzgA00
2Q2HA 3D31A 2F52A 3PSIA 4MNOA 3TRZA 4X6AH 1I6HH 2Y0SE 3KFUA 3B6YA 1YI2A 2KCMA 1J5EL 4DV0L 2K5VA 4GLXA 4LF5L 3I4NG 1KHIA 3IRBA 3EN2A 4GN3B 4NPSA 3S2HH 1HNWL 3TEHB 1EIYB 4X66Q 5C4XG 3RNUA 4LW1A 4X62Q 5DLQE 2I5HA 2UUCL 2F4VQ 1HJPA 1FL0A 3G48A 1KD1C 1VQFA 1XNRQ 3CCLA 4JBWA 1C9OA 1YVCA 3ZJYC 4DV5Q 2HIXA 4J15A 5K36G 2FXQA 5IY0A 1JJGA 1ASYA 4B3SL 4A3GH 2UXCQ 4JYAQ 2R7ZH 3H3VH 4R4CA 4QQBX 4JOIA 4LF7L 1EOVA 3PUYA 5JJLA 4L5QA 2LXJA 4X66L 4C3IH 5C44H 4YHHQ 5M3FH 3HOWG 1X3FA 4X62L 3UDIA 4LFCQ 1X3GA 1XNRL 2HIVA 4R1JA 3RZDH 2EQSA 3NENA 3U50C 2WB1G 4JI1Q 4LF6Q 5BR8Q 2Q2TA 1C0AA 5LMNQ 2OQKA 1NY4A 2OQ0A 1TXYA 4LNQA 1NBWA 1JE5A 1WYDA 3A5ZB 3CPWA 4UP9A 4DUYL 2UXCL 3BZCA 4MZ9A 4YY3Q 3PF4A 2Q2IA 3F2DA 1G6PA 1V43A 1Y1WH 5J3BA 2CCZA 2D62A 3ER0A 4YCVA 2ZJPA 1I5FA 1X56A 2C35B 2H5XA 4EX5A 5FLMH 3I4MG 4LFCL 3AFQA 3PIOA 4PZ8A 3JAMi 4DR5L 3J81j 2A1AA 5EAYA 1KRTA 3HKZG 4LUZA 2HQLA 4LF6L 1PH8A 5LMNL 4IFDG 5IWAQ 2R7FA 4X64Q 3MEFA 1VQAA 3TS2A 1IL2A 1UE7A 2Z0SA 5LMUQ 4YY3L 2DUDA 3T1YQ 4WJ3M 5IP9H 2BH2A 4IOAA 1O7IA 3S14H 4LWCA 1I94L 1V1QA 1VQKA 4JI6L 1C7YA 1VQ9A 2V1CC 3RR5A 3M85A 1A62A 3CP0A 1S40A 4JCVE 1Q8KA 3PO3G 4HIDA 1D8LA 1BKBA 3CAMA 2IHFA 1LUZA 2MO0A 2E5LL 3S2DH 1IBML 3S16H 1TWHH 4KLKA 4JV5Q 1HZAA 2AMCB 2B3GA 1PH3A 4B3RL 4Y52H 1L0WA 4HJ7A 2NVYH 1RL2A 3JC66 5M5WH 3CD6A 4IJLA 1XMOQ 1UE1A 4IPDA 4GNXC 1VQ7A 1AH9A 4JI5Q 1EFWA 1N36L 5GAGC 4DR1Q 3G71A 4JI0L 3UE0A 4GOPC 4AIMA 2JA7G 4DR6Q 1B70B 3GTJH 3KOJA 3H3VI 2UUBL 1WCMH 1BBWA 3GD7A 1VQ6A 1KQSA 3LGJA 2JE6I 4OO1I 2B29A 4AYBE 1XPUA 3M4PA 4A76A 2NZOA 2UXBL 3E0EA 3HOYH 5IYCG 1TWGH 3J80c 3OYYA 3UDXA 2JA6G 2JA9A 1YJ9A 4A3DH 2VNUD 4A3EH 2K14A 4WJ4A 2VUMG 4KHPQ 5HY6A 3ULLA 4DR1L 3HOVG 3PUVA 4QJFA 4B3TQ 4L5TA 2VZAA 2DGYA 2PI2A 2K50A 4DR4Q 3OW2A 3A0JA 2MQHA 4GNXB 1E1TA 5E7NA 4PMWA 4DV3L 4HIKA 4GOPB 1M1KC 1WJJA 4BY1H 4OX9Q 4APVA 3GTGH 5M5XH 3W1BA 1YJNA 4A3CG 1KL9A 2YV5A 1KIXA 4JI3L 1Q86C 4P75A 2NVXH 1PHJA 1KC8C 4JBMA 3M4QA 4A93G 1IYJB 4L5SA 5GAEC 4DR4L 1CKMA 1OXTA 4BBSH 3PUZA 1PVOA 4KHZA 2A19A 3PO2H 1SROA 3F2CA 3TREA 1YITA 4OX9L 4H02A 4GNXA 1YZ6A 3S1RH 4POFA 5JEAJ 3VDYA 2WAQG 4GOPA 2K75A 1K8AC 4IPCA 3S24A 2AWNA 3HOUG 4A3LH 2PNHA 4GKKQ 2AKWB 1PV4A 2PI2E 1XMQQ 4LF4L 3W1GA 1Q1BA 4DV4Q 3BJUA 2UU9L 5IYBH 1R9TH 4DR2Q 3CC4A 1N8RC 4A3IH 4BA2I 1NMFA 2ZM6Q 1PH9A 5GADC 2K52A 1HZBA 4DR3Q 2N8NA 1NTGA 4DV7Q 3T1HQ 1Q46A 4BY7G 2ZTDA 1I3QH 2R93H 2I0QA 4P74A 4A4IA 3RZOH 3HOZH 1L2FA 1Q12A 4OWWB 5C4XH 1N33Q 3KF8B 2JA5H 1Z9FA 4LUVA 3A5UA 2BA1A 3GTMH 3L0OA 3I55A 1YIJA 2ATWA 1PH5A 4BY1G 4BA1I 3BZKA 4LF8Q 1Q82C 4IJHA 1WOCA 3H15A 1VQBA 4DR3L 1PH2A 1PH4A 3T1HL 3I2ZA 2F4VL 1CSPA 3RLOA 1OXUA 1N33L 1PH1A 1PA6A 4UY8C 1VQCA 4XTCS 4X65Q 4A3JG 1AE3A 3CQZH 2CFMA 4DV5L 5IYDH 3CCUA 4LF8L 4OWXB 5GAHC 4KI0A 1KAWA 4YWLA 2R7ZG 4JYAL 3GO5A 4OO1G 4HJ5A 2QGQA 5C44G 3RN5A 3CC2A 1RIPA 1SE8A 4YHHL 3K8AA 1Q81C 5C3EG 5LMNW 3STBD 1S3OA 3AFPA 4C2MH 4UP8A 4JI1L 1GKHA 1LYLA 4X65L 5BR8L 4R4QA 2GVBA 3UE1A 4BXXG 3J7ZC 4RG1A 5FJ8G 1PYBA 4PZ6A 1Y1WG 4DV1Q 3PUWA 1EUJA 3PIPA 3SGIA 1FGUA 1VQEA 2IX0A 5HGQA 3U4ZA 1HZCA 1K0RA 2PQAB 3M3YH 5GROA 4DNIA 1HR0W 1IXRA 1UE6A 1X65A 4YWKA 1N34Q 4A3BH 2IT1A 2MFIA 1P16A 2VQFQ 3HKSA 4IOCA 3CMEA 2UUAQ 4NXNQ 1XNQQ 5IWAL 3J80i 3M7NA 4X64L 1SMXA 4Y7NH 4BBRH 1Q1EA 2R92H 3PV0A 5LMUL 3OTOQ 1JB7A 3T1YL 5IP9G 3AQQA 1EWIA 2JEAI 2N49A 3CF5A 3S17H 4R4OA 4LUOA 1TWFH 1W3SA 4JBJA 1S72A 2GVAA 4DV6Q 2L15A 4EQ5A 2I5MX 2JJQA 3KLWA 3K81C 4NXNL 1OXVA 4R4TA 5M3MH 1XNQL 1EQRA 2PQAA 2LXKA 2RF4A 1Y1VG 3PGZA 2KHJA 1NE3A 3CXCA 2JA7H 1G291 3J81c 4JV5L 2CQOA 2BA0A 4UPAA 1VQLA 4XIGS 4DKAC 3J7A5 4OWTB 1D7QA 4DK3C 1VQDA 2K4KA 3K7AH 2IHEA 4A3KH 3KJPA 1YJWA 2WB1E 2B63H 3H0GH 4NB3A 2Y0SG 2MNAA 1G51A 3CC7A 3ULPA 3FKIH 5IYCH 4JI5L 3CCVA 3U4VA 1EQQA 1GM5A 5JJIA 1U0LA 3EIVA 4DR6L 4JI4Q 1M90C 5H1SE 2XTIA 1VCIA 2NN6I 3EBEA 3GTKH 1X9NA 1I50H 2ASBA 4DR7Q 2VUMH 1N32Q 1PFSA 4YCWA 4AQYQ 3HOVH 3G6EA 1VQMA 2E2JH 2ZJQA 3DM3A 1UWVA 2PMZE 2YTXA 5JJKA 4B3MQ 2OTJA 1MIUA 4MTNA 3HKZE 4JG2A 3W5OA 4TVAB 4A3MH 3G4SA 4DUZQ 4JI4L 1QVFA 2NVTH 4JC0A 4KHPL 1E3PA 1YHBA 3AYHB 4HJAA 4PZ7A 2NZHA 2KHIA 3I4OA 4B3TL 3HOXH 3GTOH 4A3CH 1VQHA 2KBNA 1N32L 2D0PA 4AQYL 3E9IA 2Z6KC 1HNZQ 1E1OA 1HZ9A 2K5NA 3K80C 1X55A 1PH6A 1X54A 4A93H 4A3FH 2N78A 2VY3A 5C0XJ 5JEAG 4B3ML 4JI8Q 2UXDQ 3S15H 2JA8G 2I5LX 1VQ8A 4OONA 1LM0A 1CSQA 4DV2Q 1YHAA 3F1ZA 2ALYB 4HIOA 1WFQA 3CPFA 5IP7H 4HJ9A 3GTPH 2QEXA 3S1NH 1QZHA 3HOUH 3KDFB 1HNZL 1AE2A 3K0XA 4BBSG 4K0KQ 4GS3A 3RLNA 1CKOA 4LF5Q 1HH2P 2E8GA 4QL5A 4JI8L 3I4NH 3PO2G 3FP9A 2E2IH 2CWPA 3RLFA 3KF6B 4LFAQ 1HNWQ 3Q8DA 5C4JH 4P71A 1UEBA 3A74A 2RHQB 4QGUA 1B8AA 1FJGQ 2VQEQ 3NEMA 4GKKL 3L7ZC 3CCJA 4GKJQ 1VQJA 5AJ3Q 3ERSX 4YWMA 1XMQL 1NMGA 2ID0A 1VQ5A 1Z47A 4DV4L 1E24A 5IYBG 1QVCA 3F8TA 4K0KL 4DR2L 1A63A 3I7FA 2WFWA 4A3IG 4AH6A 1L1OC 4P73A 4O2DA 2ZM6L 1J6QA 2RHSB 1K83H 3L2PA 1IBLQ 3KDFA 3PUXA 2QA4A 4B3SQ 4DV7L 3NBHB 1YHQA 3CCRA 4L5RC 4LFAL 2R93G 4LF7Q 1XMOL 3HOZG 5ELOA 5C0XI 4FDBA 1CUKA 3FHWA 2JA5G 1FJGL 2XGTA 3KF6A 5ELNA 1BVSA 2VQEL 3HOWH 4GKJL 1GO3E 5AJ3L 2Z6KA 4JI2Q 4A75A 5IE8A 4A3GG 3STBC 1E7ZA 4A3JH 1HNXQ 1EIFA 1K73C 1SRUA 3UDFA 4DUYQ 1IBLL 5M3FG 5FLXc 1X6OA 3DLLA 1Q7YC 2AHOB 1XJVA 2KENA 2YU9H 3D0FA 2ZJRA 3K7UC 4POGA 4AYBG 3E9HA 2N3SA 3I4MH 5C3EH 2IX1A 1KXLA 1L1OB 2IY5B 1BBUA 4DPGA 3ULJA 5IYDG 1KRSA 4DR5Q 1XPRA 4JI2L 2HT1A 1UE5A 2EIFA 1SFOH 1DGSA 2WAQE 4QY7A 2NN6G 1HNXL 4BXXH 4UP7A 1WI5A 3U58A 3WWVA 5FJ8H 2LSSA 5FLMG 4HJ8A 2EXDA 3J81i 4DK6C 1JJCB 1I94Q 1JMCA 3RN2A 4JI6Q 3MXNB 4JBKA 4OXPA 1XTDA 1K8GA 3PO3H 2JQOA 1L1OA 2ES2A 1U5KA 1CKNB 2CWAA 2WP8J 4GLAC 1VS0A 5GQOA 4DV1L 1HR0Q 1IBMQ 2E5LQ 4IFDJ 3CMAA 1VQNA 4B3RQ 3CW2C 1OXXK 4A3BG 4O0AA 1H95A 4QIWE 4LFBQ 4TQUS 1SLJA 1N34L 4IPHA 3S1MH 3S1QH 3BU2A 4LF9Q 2VQFL 3CCQA 1PYSB 2UUAL 3ICEA 2JEBI 1N36Q 2KCTA 4YCUA 4JI0Q 1T9HA 4BBRG 1VQ4A 2R92G 1VQOA 1Y14B 2UUBQ 3OTOL 4R4IA 1Y1VH 1HR0L 3JAMc 1VQPA 3I56A 2UXBQ 3F2BA 1FVIA 2OTLA 1JT8A 4DV6L 1CKNA 4IPGA 3KJOA 4LFBL 1NJIC 2YTVA 4NXMQ 2JA6H 5M3MG 4LF9L 1WCMG 1K9MC 5IT9c 1VQGA 1IBKQ 2OWOA 2D0OA 2E2HH 2CKZB 4GN5A 4ME3A 4P72A 3NELA 3HOYG 3PCOB 1LTLA 1TWAH 4A3KG 3TS0A 4A3DG 2B63G 1MJEA 3H0GG 3KYHC 4HIMA 1B7YB 4A3EG 1GVPA 2JK8A 3FKIG 4DV3Q 1SN8A 4ALPA 1W2BA 1QZGA 4NXML 3HFZB 4GLVB 3TQYA 1PH7A 4JI7Q 1IBKL 4DR7L 4IFDI 4RMFA 2NVQH 2BH8A 3M9BA 4JI3Q 2A8VA 3CCMA 3UDGA 1JJ2A 5C0XG 5M5YH 1X3EA 4DAYB 1IZ6A 1P8LA 1E22A 2Q2UA 2K5HA 1OXSC 1VQIA 1QUQB 1TWCH 2OCEA 1GD7A 4A3MG 4DUZL 4C3JH 2VW9A 1SR3A 2R7DA 2AWOA 4JOIC 1N9WA 2F3IA 1YEZA 4DAMA 3M4OH 4JI7L 3GDEA 3HOXG 2JA8H 4C3HH 1YNXA 2VL6A 2HHHQ 1A0IA 1K3RA 2YYZA 3PF5A 1EYGA 1J5EQ 2RCNA 4DV0Q 4A3FG 2ZTCA 1A8VA 1QVGA 3GTQH 1V9PA 2YTYA 2UXDL 2MO1A 4LF4Q 2GN5A 2UU9Q 4PG3A 2ZTEA 3GTLH 4DV2L 1OTCA 4A3LG 2R6GA 4IO9A 1MKHA 1QUQA 4GN4B 3CCEA 3CCSA 1XPOA 1MJCA 2VS1A 1ASZA 2UUCQ 3AEVA 4BY7H 5IP7G 2HHHL 1YBYA
chains in the Genus database with same CATH superfamily
2Q2HA 3D31A 2B2TA 2B8GA 3B6YA 4LF5L 1SAPA 3EN2A 3E0JA 5D3IB 3PIO3 4A3IB 1HNWL 1EIYB 4FF4A 5ISRA 3SK6A 4IQZA 3RNUA 4LK1C 2RBMA 1DOLA 4N8FA 1HJPA 1FL0A 2UUCL 1LTRD 3HOZB 2JA5B 5C3XA 1MI2A 4CKBA 2ICIA 3GTMB 1C9OA 1NCVA 4DV5Q 2ZXOA 2FXQA 5IY0A 2OEOA 3QB3A 1ASYA 4BS9A 4QQBX 4DK1A 1EOVA 2DNCA 4OO1H 4CJ0B 4YHHQ 4M8AA 1X3FA 5LHY1 2EE1A 1U9RA 3HZXA 4XQJA 2F0QA 5CV7A 4LF6Q 2OQKA 2K04A 3BZCA 2O4XA 3F2DA 3Q24A 1JQYD 1M8AA 5J3BA 1X56A 4FXGC 4C56C 4LFCL 4PZ8A 3TN2A 3JAMi 4DR5L 1MHWC 5EAYA 3HKZG 1QG7A 2HQLA 4H44C 2F0TA 3QOJA 3DUZA 1VQAA 5HGTA 3TS2A 1S5FD 1EY7A 1UE7A 5LMUQ 3SK4A 1EQVA 2DUDA 1RHPA 3NUCA 3J80E 1I4GA 5IOCA 1SNPA 2XWJB 3KK7A 3RR5A 3M85A 1J9OA 2R3ZA 5FO9B 1S40A 2G5DA 2ENBA 4QUFA 2BOSA 4JW0A 1DZ1A 2F0JA 1EYCA 4HSPA 1HZAA 3MA2B 1PH3A 1L0WA 5M5WB 2K03A 2D9UA 3CD6A 5FK9C 1UE1A 1VQ7A 1C48A 3TZUA 1KNAA 1HUMA 5GAGC 3FDTA 1WCMB 2DY7A 1B70B 3KOJA 5IGFA 2UUBL 1BBWA 1ESFA 2JE6I 2A68D 3K5NA 1PZID 2B29A 1W6KA 4DK0A 2GA4B 4PV1C 4A76A 1M4VA 3K7AB 3RZDB 2JA6G 2JA9A 1YJ9A 4A3DH 1G6ZA 2VNUD 4KHPQ 5HY6A 4E6IA 1PXUA 3PUVA 3AMUA 5M9OA 3GTKB 2K5DA 1JOOA 3L9AX 1PFMA 1SNCA 4DR4Q 4FXKC 1KDAA 1E1TA 1L0YB 5DEHA 1I4HA 2MUYA 4DV3L 1PLFA 1HPCA 4OX9Q 2DN8A 3SEBA 1IKLA 2NVTB 1GJXA 2YV5A 5FO7B 1Q86C 3A7LA 1TT2A 1PHJA 3P1HA 1KLUD 5GAEC 1E0BA 1HA5A 1OXTA 4A3FB 4BBSH 1PVOA 1GUNA 2N88A 2J7ZA 4H02A 1FR3A 1YZ6A 2C9OA 1IW7C 2DNEA 3MFGA 3C1EA 3HOUG 1WTHA 4FF2A 1S5ED 3HOUB 1HQMC 1Q1BA 1XXGA 2UU9L 1X3QA 5IYBH 1PFBA 3I4NB 2JSOA 3DWPA 4BA2I 2K52A 1NTGA 3T1HQ 1XX8A 2B2WA 5KGUA 1I3QH 5D65A 2R93H 3OHXC 2K6AA 4A4IA 1L2FA 4UDUC 4OWWB 2XSCA 1EY4A 1ONLA 3DWQA 3CU7A 3D4WA 2L11A 4RH6A 2AUKA 3WOEA 4HN7A 1PH2A 2F0LA 1CSPA 1OXUA 1N33L 3HOWB 4UY8C 4XTCS 3W3AA 3G7LA 4DV5L 1LV9A 2WB1B 3CCUA 1OO9B 4LF8L 2R7ZG 3WOFA 5GAHC 1WTXA 4G4KA 2QGQA 3MTSA 3RN5A 4YHHL 2YU9B 4C2MB 3AFPA 1GOZA 1O7ZA 2SOBA 3I4MB 4UP8A 4KY7A 2Z9HA 5AFWA 3DEOA 1SFOB 4PZ6A 2KHSA 5CGKA 1Y1WG 5JVG3 4ZQ3A 3SGIA 1D5MC 1SBBB 1UE6A 2IPKD 4YWKA 5CBAE 2MFIA 1P16A 5TSSA 3M7NA 4Y7NH 1Q1EA 3MEHA 1TQOA 5LMUL 3BDLA 1JB7A 3AQQA 3CF5A 1S72A 4DV6Q 2EPBA 1BOSA 3T13A 1K8MA 4NXNL 1XNQL 1Y8NB 4KD3A 3D6CA 2DY8A 3CXCA 1YNJC 1J8IA 2QDLA 3J7A5 4XIGS 1S5CD 1D7QA 5JJZA 3KJPA 4ZUIA 2B63H 2M9VA 3H0GH 2Y0SG 1G51A 1GM5A 3EBEA 5J1ZA 1N32Q 2SNSA 3HOVH 5EKIA 5C4HA 2E2JH 1UWVA 2PMZE 2YTXA 5JJKA 1Q8IA 1O7LA 4B3MQ 1MIUA 3HKZE 5I9PA 4DUZQ 3MFYA 4A3MH 1X3PA 3W2DA 4KHPL 4RKLA 4PZ7A 3GTOB 2KHIA 3I4OA 4HCEA 5A2QE 2KBNA 4N9PA 4HTHA 2L0CA 2XRQD 4F87A 1JOKA 2Z6KC 4CDCC 1HNZQ 1WTRA 4A93H 4DA2A 3IKJA 1CZWA 3LNNA 4N9TA 5BN5A 1VQ8A 4OONA 3NWTA 3GTPH 1SYDA 1CI3M 3UI2A 1ZXTA 3KF6B 4LFAQ 2OT2A 1BCPB 3Q8DA 1UEBA 3A74A 1GUOA 2RHQB 1FJGQ 2B2YA 2WKDA 4ULLA 4K2LA 5AJ3Q 3ERSX 4YWMA 1EU3A 1SJHD 2MPMA 2X69A 3K57A 1HCZA 4K0KL 3R2TA 5J22A 1PRTB 1IBLQ 1J6QA 3L2PA 4B3SQ 4BY1H 4OHJA 2QA4A 3NBHB 2B2VA 1BDOA 4LF7Q 5ELOA 1CUKA 4RFBA 2XGTA 3KF6A 1BVSA 1GO3E 4B9XA 2A74C 5IE8A 5JPNC 2H1EA 1ESRA 4A3JH 3F2UA 2NYZD 1SRUA 1EY6A 4DUYQ 5FLXc 1LTTD 3DLLA 1H9SB 2AHOB 1KTKA 3D0FA 1AZPA 3E9HA 2N3SA 4K6LA 1CM9A 3NBHA 2L12A 5C3EH 1KXLA 2IY5B 3ULJA 1XPRA 4FF1A 2HT1A 1PDQA 4RGMA 1U4LA 4ZKCB 4BXXH 2LKVA 1WTPA 3SXHA 4HJ8A 3NPPA 3EA6A 1H9SA 4X3UA 5EPKA 1TVXA 4OXPA 4DNRB 4UAIA 1XTDA 2L5TA 1PTOC 2F3VA 1GUSA 2WP8J 2E5LQ 4IFDJ 2MJ8A 4LMQD 2L4NA 1VQNA 1SLJA 4IN3A 3VYUA 3NP8A 5G3LF 4EGVA 3S1MH 3DWAA 5DAUA 5EKLA 1A3VA 2HCIA 2KCTA 4YCUA 4BBRG 1Y14B 3Q22A 2F0EA 4OEMB 4DV6L 4IPGA 3KJOA 4LFBL 2JA6H 5M3MG 1IBKQ 2KEEA 1JC7A 1VMCA 2CKZB 4DNTB 3G6JB 3E3XA 1SYBA 4K5XA 2B2TC 1WTQA 1TWAH 3K0YA 3TS0A 4DU9A 4A3DG 4HIMA 3X3MA 1GVPA 2JK8A 4ALPA 3VA7A 4A3DB 1QZGA 1CHQD 3HFZB 3OPOA 4KTAA 5CORA 4IFDI 1IL8A 4RMFA 3M9BA 4FF3A 5IT9L 3HEJA 1I4RA 1QUQB 3HP3A 4DUZL 5IODA 2RSNA 3EQLC 1HXYD 2JA8B 4IZ8A 4JI7L 3GDEA 2KEDA 1A0IA 2FJ2A 2ZTCA 5D3DA 2MO1A 4LF4Q 2GN5A 4BBSB 4QMGA 3GTLH 4ZKBB 4HCSA 1T5XD 1BUVT 3MZ5A 4XT3B 1MKHA 1QUQA 3CCEA 1MJCA 2VS1A 3Q0AA 1ASZA 2UUCQ 5NUCA 1PTOF 1QB5D 4MNOA 3TRZA 4X6AH 1I6HH 2Y0SE 1GHJA 3IFDA 4V190 2KCMA 4KJOA 3IRBA 3BG3A 1SDFA 3S9WA 1S5DD 5G3LD 3TEHB 2F0OA 2RVLA 3SK5A 4Z9CB 1I3QB 4LW1A 2R93B 2E75C 3BDCA 3G48A 5CBEE 1KD1C 5A35A 3CCLA 4JBWA 2PQEA 2CH4A 2HIXA 4B3SL 5I2YA 4JYAQ 2R7ZH 4R4CA 3FPPA 5DM63 4JOIA 4LF7L 2NWGA 2HDMA 4QCLA 4L5QA 2LXJA 4C3IH 2CHBD 4LFCQ 2HIVA 4R1JA 4ZLTF 2EYMA 4K8JA 3U9SA 4O1NA 2OQ0A 1KDCA 1TXYA 4LNQA 3KLSA 1NBWA 4DUYL 2EZVA 3CPWA 3EROA 3TDQA 2UXCL 1G6PA 1Y1WH 2CCZA 4YCVA 2ZJPA 4PMBA 3C1FA 1GHKA 1BXTA 3SE0A 3HGBA 3AFQA 5J39A 3VR4A 1B2TA 1KRTA 2J4XA 4LUZA 3KBGA 4IFDG 3IFTA 5EPJA 3MEFA 1RODA 4KKUA 4OL7A 4YY3L 1QJOA 4IUQA 1O7IA 3S14B 3BVZA 4LWCA 2KJXA 2AQ2B 1VQ9A 2V1CC 1Q8KA 1ZEQX 3TP7A 1D8LA 4Y7NB 3CAMA 2IHFA 2E5LL 2MO0A 2D5DA 3S16H 1TWHH 4KLKA 1K28A 2DJFC 5KRUA 2B3GA 4Y52H 2KCNA 1PTOD 1B3AA 4JI5Q 1EFWA 2RSOA 2Q8TA 3GTJH 1LTID 3H3VI 3GD7A 2EJFC 1KQSA 3LGJA 5L37A 1EEFD 1Q90A 1XPUA 3E0EA 3HOYH 2KOLA 2ZXRA 3UDXA 3D4RA 2B63B 3H0GB 3JAML 4H13C 4A3EH 1WVLA 2Q8IB 2B2WC 3HOVG 4B3TQ 1EWCA 4WORA 3HOVB 1CZGA 2K50A 2E2JB 3A0JA 4GNXB 2K7VA 5E7NA 1SNDA 1M1KC 4A3MB 4NKLA 1FD7D 3GTGH 1IHZA 2JN4A 2PO4A 4FXDA 4A93G 3M4QA 1IYJB 2IW3A 4NW2A 2Z8LA 1CKMA 1HFGA 5EPLA 1BNZA 4KHZA 2A19A 1SROA 5HURA 2EVBA 2VB2X 3F2CA 1YITA 4GNXA 3I4LA 4POFA 5IGCA 3QWNA 2WAQG 3A8KE 1K8AC 4RWSC 2PNHA 4IUNA 1TS5A 2AKWB 2KA7A 4TKOB 3GTPB 1I6VC 1O80A 2BE5C 3P7JA 4LF4L 4ZCKA 1R9TH 2DJGC 1SMYD 1LTAD 1PZJD 3TZDA 5IGDA 1HZBA 5T1IA 2FMMA 1V1OA 1N33Q 1Q12A 5C4XH 1Z9FA 1R4PB 3BVGA 5EJWA 1HUNA 2ATWA 1PH5A 4BY1G 3GP7A 4ZYSA 4LF8Q 5IGBA 1WOCA 2LFNA 3H15A 3BS1A 4L6TB 1WD0A 5EKKA 3D6WA 3CQZB 4A3JG 1AE3A 4A3JB 5K5PA 4JYAL 4J1MA 1PZKD 4HJ5A 3SDZA 3SR1A 5C44G 1EY8A 3CC2A 3N52A 5C3EG 5LMNW 4CKEA 1TIID 5C3EB 2PMZB 1GKHA 4R4QA 4BXXG 3UE1A 3J7ZC 3QR8A 3HKZB 3H91A 2RQXA 1JB3A 4KKSA 4DV1Q 3PUWA 1EUJA 1VQEA 1SNMA 4CJ2C 1DM0B 5BN4A 4DNIA 1IXRA 5CV9A 2IT1A 4NXNQ 2VQFQ 1XNQQ 3CMEA 2UUAQ 4ODGA 3WDNA 4BBRH 1RJTA 1EWIA 1TWFB 1W3SA 2GVAA 3S1MB 2I5MX 2J0TD 4CHTB 5M3MH 4JK1C 4CDDC 3I90A 1EQRA 2RF4A 3ZYYX 1CA6A 1CQVA 2KHJA 2JA7H 4MTKA 3J81c 4MN3A 4QUCA 1EY9A 1VQLA 1U4MA 1YJWA 3CC7A 3ULPA 4JI5L 3CCVA 3U4VA 2JA6B 1LTBD 4BWGB 1M90C 2XTIA 1VCIA 2NN6I 1X9NA 1I50H 2ASBA 2B2YC 2VUMH 1PFSA 3VR5A 1TWAB 4MTNA 1HRJA 4JI4L 3G4SA 2G9HD 4RGOS 2CW0C 2B2VC 4JC0A 5CV8A 1F77A 4HJAA 2NZHA 4B3TL 3D4DA 4IALA 1G2TA 2XNAC 1VQHA 1AEXA 1BCPC 4DAPA 4AQYL 1HZ9A 3K80C 4RCOA 5COYA 1QE6A 3PQIA 4KHVA 2KECA 4NDXA 1PRTC 5CYUA 1SSOA 2ALYB 3MVVA 1CT1D 1ML0D 1ICWA 3S1NH 4DXFA 1QZHA 1AE2A 4K0KQ 3RLNA 2E8GA 2E2IB 5FKAC 3URYA 1FNVA 1LT4D 2CWPA 2NUCA 3RLFA 3TSSA 3GTLB 1KABA 4QGUA 4C1NK 4RCNA 2EY2A 3NEMA 4G7OC 2SDFA 1TS2A 2EJGC 1VQJA 1Y69U 1I6HB 3D8GA 2ID0A 1XYIA 4X3TA 1Z47A 1E24A 1QVCA 3I7FA 1C8CA 2WFWA 4P73A 2F0UA 4O2DA 2RHSB 1K83H 2P5ZX 1I4XA 2PPBC 4FDBA 1SXTA 5ELNA 2VQEL 2K1BA 4DGZA 2M2LA 3STBC 5CV5A 1K73C 4NMZA 4C3IG 2R7ZB 4MIUA 2EY6A 1S4ZA 3A56A 3DHQA 3HS0C 2KENA 3OWEB 2ZJRA 2HDLA 4POGA 5ELFA 3NHHA 1L1OB 1Q3LA 2IX1A 5IYDG 1KDBA 2QDBA 1V8QA 1DGSA 2WAQE 4IFDH 2NN6G 4UP7A 3OOCA 3WWVA 5FJ8H 3IL8A 1Y1WB 2I07B 3BZDB 4DK6C 1JJCB 5JPMC 5FLXL 1JMCA 3RN2A 3RD4A 4JI6Q 5IT9E 4JBKA 3SHLA 4CDFC 1EY5A 2K33A 2JQOA 1L1OA 4GLAC 2Q8RE 4DV1L 3L3OC 1IBMQ 2NTSA 4B3RQ 3CW2C 4A3BG 1PRTF 1H95A 1RF2D 4QIWE 4N8X1 5DM73 4LFBQ 4IPHA 3S1QH 3R2IA 2VQFL 2UUAL 3ICEA 5DNFA 2R92G 1JR0D 2F0GA 4R4IA 1Y1VH 3IAYA 3S16B 1TWHB 2PYKA 1VQPA 3FEWX 4LJZC 4G57A 2EYHA 3FVQA 5I6WA 3I56A 1FVIA 1NJIC 2Y0SB 2YTVA 4LF9L 1D6EC 2OWOA 1MSGA 2E2HH 3GTJB 4GN5A 2PZWA 3HOYG 3C46A 1DXMA 2ZXPA 4A3KG 3HOYB 1B7YB 3VR6A 4A3EG 3FKIG 1DJRD 4B08A 4KN4C 4A3EB 4JI7Q 2NVQB 2O5JC 1DONA 4H0LC 1GXDC 5CR3A 2IX3A 3UDGA 3VA5A 2EYJA 1YNNC 1EZ6A 1IZ6A 1P8LA 2Q2UA 1TWCH 1FNWA 1STHA 4JOIC 2K01A 1N9WA 3GTGB 3M4OH 1EWHA 3HOXG 2F3WA 4HMJA 2VL6A 1SYGA 2LMCB 2TSSA 1PFNA 1K3RA 2YYZA 3PF5A 1EYGA 1VDZA 3GTQH 1STGA 2YTYA 2CW0D 2BDNA 2HCCA 3GV3A 2KVMA 4IO9A 1GUWA 1QOHA 2HHHL 3PSIA 1L0XB 2Z4IA 3KFUA 4K5VA 3TP6A 1A2UA 1QCBD 2K5VA 1IW7D 1F2LA 4DV0L 1KHIA 3AB9A 4RGNA 4GLXA 1R9TB 4NPSA 1PRTD 1SYFA 2XWBB 5C4XG 2V4DA 5DLQE 2HD3A 2F4VQ 1XTCD 1YVCA 3ZJYC 4J15A 4K14A 4HEDA 2KUMA 4A3GH 3K5OA 2UXCQ 3H3VH 1D2BA 2PCFB 3PUYA 4X66L 5EGTA 5C44H 2E74C 4JPBW 2O2LD 4IUTA 4X62L 5JAVA 3P75A 1X3GA 1XNRL 3NENA 4JI1Q 5BR8Q 4KMUC 5LL6S 1EEID 3I70A 2PW7A 1WYDA 1JE5A 3JAME 3BYYB 4YY3Q 4K8IA 1E2WA 2MP1A 1CQFA 2D62A 3ER0A 4ILWA 2C35B 2H5XA 5FLMH 3PIOA 2NTTA 1PH8A 4RHRA 1Z6HA 5LMNL 2R7FA 4WJ3M 2BH2A 2MGSA 1LO5D 3M7GA 5KIXA 1V1QA 4HAEA 1VQKA 2PZUA 4JI6L 2LS01 3DEPA 4KK7A 3FMCA 3CP0A 2F0MA 5KNDA 1V1PB 4JCVE 3ITPA 3PO3G 1BKBA 4J6HA 4BBRB 1LUZA 1TY0A 1IBML 3KLSX 2F0FA 2AMCB 4FP5D 4B3RL 3KBXA 4HJ7A 3JC66 4WJWA 5M5WH 4IJLA 4IPDA 4GNXC 1AH9A 2JA7G 1BQQT 2QILA 3UE0A 4AIMA 1ZKOA 5M3MB 1WCMH 2JA7B 1JOQA 1V1PA 1KAAA 3M4PA 2NZOA 1VF7A 3VR3A 3OYYA 3J80c 1IYVA 1ZYRC 1YNJD 3OW7A 1NNXA 4XXEA 4WJ4A 2VUMG 4DR1L 3P20A 4QJFA 1I50B 4L5TA 3RMHA 2VZAA 2VUMB 4C1NI 2C5CA 5C4ZA 2QEJC 4PMWA 1ENAA 4HIKA 4GOPB 3BDOA 3A8JE 3J7AV 3W1BA 4UHVA 1KL9A 2EOTA 1KIXA 1E2VA 4P75A 4P2CB 2A6HC 3J7AF 4JBMA 4L5SA 1WTOA 2F1MA 2EYPA 3DXJC 3MHBA 3NTHA 2HUGA 5CV4A 3K5MA 1EZ8A 3S1RH 5T1GA 5JEAJ 4C3HG 3VDYA 4ZRZA 4GOPA 2K75A 1YNND 5IGEA 3S24A 4A3LH 4DAVA 5C3WA 3S1NB 2PI2E 1XMQQ 3MAQA 3BJUA 4DR2Q 1N8RC 1NMFA 4DV7Q 1Q46A 4BY7G 4G7HC 3RZOH 3KF8B 2BA1A 3T16A 1U4PA 1YIJA 3V2TA 3BZKA 1R4QB 1B53A 4IJHA 1K83B 3BVMA 4DFAA 3ND8A 5K36H 2FMCA 1TY2A 3OSOA 4DR3L 2B2UA 3I2ZA 3DMUA 2F4VL 5C5LA 4U673 1EOTA 1PH1A 1RD9D 2RCFA 2CFMA 5IYDH 3U9OA 3KF8A 4KI0A 1KAWA 4YWLA 1WTWA 2SNMA 2NN6H 1SE8A 2XIWA 2ZT9C 4C2MH 4JI1L 4X65L 1LYLA 5BR8L 2XVSA 2GVBA 4KY6A 2K05A 1Y8OB 5FJ8G 1EY0A 4DF7A 2F4IA 2F0HA 2QKIC 3PIPA 2ICEC 1FGUA 5HGQA 5JVH3 3U4ZA 1HZCA 1K0RA 3M3YH 5GROA 4A3BH 1X65A 3FRPB 2LY7A 4PNYA 1SMXA 2R92H 1ILPA 1JWMD 1STAA 5IP9G 5LL6X 2N49A 3S17H 4R4OA 4LUOA 2A68C 3S1QB 4EQ5A 1UEAB 1DYQA 2JJQA 5FOBB 2PZTA 3PGZA 1Y1VG 1IYUA 1G291 3OMCA 4G7ZC 2BA0A 1Y1VB 4UPAA 4DKAC 3QIAA 1B3QA 4DK3C 1B9MA 1VQDA 2IHEA 3Q23A 4A3KH 4NB3A 4JI4Q 2MNAA 1EQQA 3PMFA 3FKIH 1F9SA 5IYCH 1K8OA 5JJIA 2M00A 4IUVA 3OIQA 2CH4W 4YCWA 4AQYQ 3G6EA 4GZYC 1VQMA 2ZJQA 3DM3A 2WACA 2QCPX 1EFID 2OTJA 3J81L 4S3SA 1MBYA 3ND9A 2VB3X 4LAAA 1QVFA 3VR2A 3T56B 1TU2B 1YHBA 3AYHB 4I7AA 1LTGD 3HOXH 3GTOH 4A3CH 2D0PA 3H6MA 4A93B 2K5NA 1ZYRD 2JXMB 3K59A 2UXDQ 2N78A 2VY3A 5C0XJ 5JEAG 3VYRA 3S15H 3I73A 2I5LX 2G9DA 1CK1A 1NAPA 1AP0A 1MSHA 1YHAA 4Q5VA 3QOLA 3F1ZA 2WAQB 4HIOA 4CDEC 3HRZC 2KQ3A 4HJ9A 1B4OA 3CPFA 5EQ0A 2QEXA 3KDFB 1UAPA 3GTQB 3PO2G 4JI8L 5I4DA 4O42A 3DM1A 4R9WA 5FLXE 2A6HD 5C4JH 2F0SA 1JICA 1B8AA 4XYOA 5BN3A 2VQEQ 4I7ZC 3NTKA 2EY5A 1NMGA 1XMQL 1VQ5A 4DR2L 4QIWB 4BY1B 4A3IG 4AH6A 1L1OC 3CHBD 3KDFA 2NB0A 4DV7L 1RTOA 3CKIB 2A69C 3CCRA 1YHQA 3HOZG 5C0XI 4KKTA 3FHWA 2JA5G 3EJIA 4IURA 1F9QA 4GKJL 3Q6SA 4A75A 4A3GG 1LT5D 3E5SA 3NQTA 4A3GB 3UDFA 2L55A 2H4OA 1JORA 5C44B 3K7UC 4AYBG 2EYOA 2JYOA 1BBUA 4DPGA 1KRSA 4AYBB 4JI2L 5E4WC 1UE5A 4YIJA 1HNXL 1GUTA 3SVMA 4RGTA 1WI5A 3U58A 4FO2A 2LSSA 3T51B 5FLMG 2XRSD 4IUUA 5KYLA 3HG9A 3J81i 1I94Q 4XQNA 3EVQA 4H7BA 2K28A 4KJNA 1H9MA 2QW7A 1D5XC 3PO3H 3NTIA 1AZQA 2ES2A 2PNRC 2CWAA 1VS0A 1CHPD 3TP8A 3TP5A 3CMAA 1K3BC 3GV6A 1F9RA 3BU2A 4LF9Q 5E4XA 3CCQA 2JEBI 1N36Q 1SNOA 4JI0Q 1VQOA 3MWYW 1X32A 3CRKC 1HR0L 3JAMc 2L9HA 4RHSA 2UXBQ 1E2ZA 4ME5A 1WCMG 1VQGA 1A6XA 1SE2A 2TMPA 4ME3A 1Z7TA 5KYIA 4P72A 3NELA 3R3OA 4CBVA 1LTLA 2RKSA 4TSSA 3VYSA 1MJEA 3R93A 1EYAA 4KY5A 1EU4A 4NXML 1FNUA 4CJ1B 2B8FA 1PH7A 4OIKA 1HTLD 1WD1A 4JI3Q 2A8VA 2JP1A 1C4QA 4L63B 1JJ2A 5C0XG 1CA5A 5M5YH 1STEA 3H94A 1X3EA 4IUPA 4DAYB 1A15A 1VQIA 2K5HA 5I6YA 3VYTA 1B50A 4MHEA 4C3JH 2VW9A 4HSVA 1SR3A 2F3IA 1YEZA 2JA8H 1QNKA 4C3HH 1YNXA 2EXZA 2HHHQ 2A5HA 1D1IA 2CVRA 5JOBA 4A3FG 4DV0Q 2UXDL 4R8NA 1F2YA 3MXGA 3X3NA 4DAYA 3S1RB 4A3LG 1HFNA 3A8IE 4GN4B 2IWHA 4R8IA 1KLGD 1XPOA 2RDHA 2FINB 5D14A 4BY7H 5IP7G 2F52A 1AN8A 4L8JA 4U68A 1YI2A 1J5EL 4XYQA 1S5BD 5EBDA 1ENCA 3I4NG 4GN3B 1BBXC 1H9RA 3S2HH 3D3RA 4HMIA 5KNBA 4X66Q 2BE5D 3K58A 4X62Q 3RZOB 2I5HA 1XNRQ 1VQFA 3PIP3 5K36G 1JJGA 2F0WA 2EDGA 4C3IB 1TR5A 1D1KA 5JJLA 5M3FH 3HOWG 4WFN3 3UDIA 2L1BA 3FPUB 3AU7A 1NR4A 1TS3A 2EQSA 3U50C 2WB1G 1C0AA 2Q2TA 1QILA 5LMNQ 1B44D 1NY4A 5ELEA 2A69D 2NZ1D 4QF4A 3A5ZB 4UP9A 4F88A 4Q0FA 3MC0B 4MZ9A 2WIIB 3PF4A 2Q2IA 1V43A 2RDFA 2F0NA 1I5FA 2O5IC 4EX5A 3I4MG 1BCPF 4ZUJA 3J81j 2A1AA 3R8BA 3KLRA 1BF4A 1HTPA 4LF6L 4FNFA 5IWAQ 4X64Q 3OMGA 2HQEA 1IL2A 1SNQA 2Z0SA 3I8ZA 2Z4HA 3T1YQ 5IP9H 4IOAA 2F0DA 1I4PA 3S14H 1I94L 2E2DC 2EJMA 3M3YB 3NBIA 4X3KA 4A3BB 1F9PA 1C7YA 2QF7A 3LWEA 5ELCA 1A62A 3NWSA 4HIDA 2F0PA 2R92B 3S2DH 3TMEA 4JV5Q 1ENFA 4EQOA 3S17B 1UNSA 4K5WA 5CMDA 2NVYH 1RL2A 3CRLC 1PTOH 1XMOQ 1VF5C 4CKCA 1N36L 4DR1Q 3G71A 4JI0L 1II3A 4GOPC 4DR6Q 4KV6A 1LLRD 1SYEA 1VQ6A 1I4QA 3KUPA 4OO1I 1A3UA 1STBA 4AYBE 2D2CC 2UXBL 5IYCG 1W6JA 4FVMA 1TWGH 4A3KB 1WTVA 5IGGA 3FKIB 2K14A 3A55A 4B9WA 5IIFA 5CV6A 3ULLA 1NSNS 4X3SA 1U4RA 3A54A 2DGYA 2B39A 1SJED 2PI2A 2A73B 4DXGA 4RA8A 3OW2A 1GUGA 2MQHA 2Z6BA 2F0VA 5JEAH 1WJJA 2OXPA 4ID6A 1T5EA 4APVA 5M5XH 1YJNA 4A3CG 2B2UC 2BCOA 4JI3L 3NE5B 2I46A 1O7YA 3J80L 2NVXH 1KC8C 3HOXB 1EYDA 5FO8B 4DR4L 2CQAA 4F8MA 3PUZA 3S15B 2X6GA 3PO2H 3TREA 3I72A 4OX9L 1BCPD 1JWUD 4IPCA 1FYCA 1CTMA 4OIJA 2AWNA 1DOKA 4GKKQ 1STYA 1MD2D 1PV4A 3LX0A 1QWYA 2A6EC 3W1GA 4DV4Q 3CC4A 4A3IH 2ZM6Q 1PH9A 3T4AC 5GADC 1RCVD 1TKWB 1AFPA 4DR3Q 2N8NA 5C4JB 2SEBD 2RDGA 2ZTDA 2I0QA 4P74A 5C4XB 3HOZH 4XDXA 4XQQA 1H9KA 3TBIB 2JA5H 1G8ZD 4LUVA 3V96A 3MXPA 3A5UA 3GTMH 3L0OA 3I55A 4RAUC 4BA1I 1Q82C 5KNCA 1BO0A 1VQBA 1PH4A 3QG1A 3T1HL 4KD4A 3E6ZX 3RLOA 1G2SA 2NBFA 1PA6A 4JVZA 1VQCA 2PW5A 4X65Q 3CQZH 3OWFA 3ERQA 5ELBA 4OWXB 3GO5A 4OO1G 1A3TA 2KCCA 2K5QA 1RIPA 3K8AA 1Q81C 3STBD 1S3OA 1SEBD 1ILQA 4KN7C 3OIPA 2AUJD 2IJ0A 4RG1A 3J81E 3ONAB 1PYBA 3V05A 1LABA 1H9JA 2RA4A 4ZK9B 1ET6A 2IX0A 1NR2A 2PQAB 4QB4A 1HR0W 1N34Q 1LT3D 3NK9A 3HKSA 4IOCA 5IWAL 3J80i 3C2PA 4X64L 4RKBA 3PV0A 3PO3B 3OTOQ 3T1YL 2JEAI 1EIHA 1A2TA 3O13A 4FYDA 2EYFA 1TWFH 3T53B 4JBJA 1CFMA 1LACA 1DCZA 4EQPA 1B9NA 2L15A 3J7YW 2F03A 3KLWA 3K81C 1JWSD 1TS4A 3EFXD 1OXVA 1RTNA 4R4TA 2PQAA 2LXKA 3I3CA 1NE3A 4JV5L 2CQOA 1XWEA 4OWTB 1EQTA 2K4KA 3K7AH 2WB1E 3RZDH 1XMOL 4PMCA 1RKNA 1U0LA 3EIVA 4DR6L 2WKCA 5H1SE 2K5WA 4PQXA 4DR7Q 5F2DA 3GTKH 4OGQC 5C0XH 2AQ3B 4JG2A 3W5OA 4TVAB 3I91A 5E1FA 2NVTH 3GQBA 1E3PA 2XN9C 3RUZA 4F7XA 1VMPA 2VXWA 1N32L 5M5YB 3E9IA 2E76C 1E1OA 4C3JG 1X55A 4XT1B 1X54A 1PH6A 4A3FH 4B3ML 4JI8Q 3NSWA 1PMRA 4C3JB 2JA8G 3BYTB 1D5ZC 1CSQA 1LM0A 4DV2Q 4C3HB 1SMYC 1K0SA 1WFQA 5IP7H 2EY1A 3NXWA 3HOUH 1HNZL 3K0XA 4BBSG 4J8QA 4GS3A 4LF5Q 1CKOA 1HH2P 4QL5A 3I4NH 3FP9A 2E2IH 1EL0A 1HNWQ 1SE3A 3N6RA 4P71A 1G91A 1JE4A 4BY7B 5ELDA 3H3VC 4GKKL 3L7ZC 3CCJA 4GKJQ 1HA6A 3H09A 4DV4L 1QNUA 5IYBG 3F8TA 1JCKB 5C6AA 1A63A 2ZM6L 5E3FA 3S2HB 4L5RC 2Z1CA 3PUXA 4LFAL 4ZAIA 1LTSD 5CC4A 2R93G 1HQRD 3SK8A 2WV6D 1FJGL 2A6ED 3HOWH 5EBCA 5C5MA 1PYWD 5AJ3L 2Z6KA 4JI2Q 4HR7B 5A2QL 4WRDA 1E7ZA 1HNXQ 1EIFA 1KNEA 1IBLL 3C3LA 5M3FG 1X6OA 1Q7YC 1XJVA 2YU9H 5M3FB 3I4MH 4DR5Q 4K2KA 3QO2A 2EIFA 1HHVA 1SFOH 4QY7A 1MGSA 4EQNA 2F0KA 2EXDA 4V0BA 3MXNB 3QJYA 3K6OA 1RDPD 2OF1A 1K8GA 1NUCA 1U5KA 1CKNB 1ICFB 1ET9A 1HR0Q 5GQOA 1DD2A 3M4YA 2N55A 1OXXK 4K6DA 4EVOA 4O0AA 4TQUS 1N34L 2K32A 1PYSB 2BDOA 4ABNA 4M1UB 1EIGA 1T9HA 2MHVA 1VQ4A 3MXUA 1SE4A 2UUBQ 3OTOL 3MXNA 3LWUA 3S2DB 2WINB 1IKMA 2EYLA 3F2BA 4I65A 2OTLA 1JT8A 2NVYB 2F0IA 1CKNA 1PTOB 5I2XA 4NXMQ 1K9MC 1AW7A 5IT9c 2E2HB 2D0OA 4OELB 1F2ZA 3PCOB 1B1ZA 2B63G 3H0GG 3KYHC 1TWGB 4DV3Q 1SN8A 2FHTA 2FFKB 1W2BA 2IL8A 3NQIA 4GLVB 3TQYA 1IBKL 4DR7L 2NVQH 2AQ1B 2BH8A 1Y8PB 3CCMA 1STNA 3A7AB 1TWCB 1O78A 1E22A 1OXSC 2OCEA 2R61A 4A3MG 1GD7A 1LT6D 2X6LA 2R7DA 2AWOA 5I9OA 3M4OB 5M5XB 4DAMA 1DOMA 2NVXB 4CGYB 4DN4M 5KEEA 1J5EQ 1FGBD 2RCNA 4TRDA 1QVGA 1A8VA 1V9PA 2UU9Q 1UUPA 4PG3A 2ZTEA 1F2MA 3PO2B 1SYCA 4DV2L 1OTCA 1BR9A 2R6GA 3CCSA 3AEVA 4NP5A 1YBYA 3K5LA
chains in the Genus database with same CATH topology
2Q2HA 3D31A 2F52A 3PSIA 4MNOA 3TRZA 4X6AH 1I6HH 2Y0SE 3KFUA 3B6YA 1YI2A 2KCMA 1J5EL 4DV0L 2K5VA 4GLXA 4LF5L 3I4NG 1KHIA 3IRBA 3EN2A 4GN3B 4NPSA 3S2HH 1HNWL 3TEHB 1EIYB 4X66Q 5C4XG 3RNUA 4LW1A 4X62Q 5DLQE 2I5HA 2UUCL 2F4VQ 1HJPA 1FL0A 3G48A 1KD1C 1VQFA 1XNRQ 3CCLA 4JBWA 1C9OA 1YVCA 3ZJYC 4DV5Q 2HIXA 4J15A 5K36G 2FXQA 5IY0A 1JJGA 1ASYA 4B3SL 4A3GH 2UXCQ 4JYAQ 2R7ZH 3H3VH 4R4CA 4QQBX 4JOIA 4LF7L 1EOVA 3PUYA 5JJLA 4L5QA 2LXJA 4X66L 4C3IH 5C44H 4YHHQ 5M3FH 3HOWG 1X3FA 4X62L 3UDIA 4LFCQ 1X3GA 1XNRL 2HIVA 4R1JA 3RZDH 2EQSA 3NENA 3U50C 2WB1G 4JI1Q 4LF6Q 5BR8Q 2Q2TA 1C0AA 5LMNQ 2OQKA 1NY4A 2OQ0A 1TXYA 4LNQA 1NBWA 1JE5A 1WYDA 3A5ZB 3CPWA 4UP9A 4DUYL 2UXCL 3BZCA 4MZ9A 4YY3Q 3PF4A 2Q2IA 3F2DA 1G6PA 1V43A 1Y1WH 5J3BA 2CCZA 2D62A 3ER0A 4YCVA 2ZJPA 1I5FA 1X56A 2C35B 2H5XA 4EX5A 5FLMH 3I4MG 4LFCL 3AFQA 3PIOA 4PZ8A 3JAMi 4DR5L 3J81j 2A1AA 5EAYA 1KRTA 3HKZG 4LUZA 2HQLA 4LF6L 1PH8A 5LMNL 4IFDG 5IWAQ 2R7FA 4X64Q 3MEFA 1VQAA 3TS2A 1IL2A 1UE7A 2Z0SA 5LMUQ 4YY3L 2DUDA 3T1YQ 4WJ3M 5IP9H 2BH2A 4IOAA 1O7IA 3S14H 4LWCA 1I94L 1V1QA 1VQKA 4JI6L 1C7YA 1VQ9A 2V1CC 3RR5A 3M85A 1A62A 3CP0A 1S40A 4JCVE 1Q8KA 3PO3G 4HIDA 1D8LA 1BKBA 3CAMA 2IHFA 1LUZA 2MO0A 2E5LL 3S2DH 1IBML 3S16H 1TWHH 4KLKA 4JV5Q 1HZAA 2AMCB 2B3GA 1PH3A 4B3RL 4Y52H 1L0WA 4HJ7A 2NVYH 1RL2A 3JC66 5M5WH 3CD6A 4IJLA 1XMOQ 1UE1A 4IPDA 4GNXC 1VQ7A 1AH9A 4JI5Q 1EFWA 1N36L 5GAGC 4DR1Q 3G71A 4JI0L 3UE0A 4GOPC 4AIMA 2JA7G 4DR6Q 1B70B 3GTJH 3KOJA 3H3VI 2UUBL 1WCMH 1BBWA 3GD7A 1VQ6A 1KQSA 3LGJA 2JE6I 4OO1I 2B29A 4AYBE 1XPUA 3M4PA 4A76A 2NZOA 2UXBL 3E0EA 3HOYH 5IYCG 1TWGH 3J80c 3OYYA 3UDXA 2JA6G 2JA9A 1YJ9A 4A3DH 2VNUD 4A3EH 2K14A 4WJ4A 2VUMG 4KHPQ 5HY6A 3ULLA 4DR1L 3HOVG 3PUVA 4QJFA 4B3TQ 4L5TA 2VZAA 2DGYA 2PI2A 2K50A 4DR4Q 3OW2A 3A0JA 2MQHA 4GNXB 1E1TA 5E7NA 4PMWA 4DV3L 4HIKA 4GOPB 1M1KC 1WJJA 4BY1H 4OX9Q 4APVA 3GTGH 5M5XH 3W1BA 1YJNA 4A3CG 1KL9A 2YV5A 1KIXA 4JI3L 1Q86C 4P75A 2NVXH 1PHJA 1KC8C 4JBMA 3M4QA 4A93G 1IYJB 4L5SA 5GAEC 4DR4L 1CKMA 1OXTA 4BBSH 3PUZA 1PVOA 4KHZA 2A19A 3PO2H 1SROA 3F2CA 3TREA 1YITA 4OX9L 4H02A 4GNXA 1YZ6A 3S1RH 4POFA 5JEAJ 3VDYA 2WAQG 4GOPA 2K75A 1K8AC 4IPCA 3S24A 2AWNA 3HOUG 4A3LH 2PNHA 4GKKQ 2AKWB 1PV4A 2PI2E 1XMQQ 4LF4L 3W1GA 1Q1BA 4DV4Q 3BJUA 2UU9L 5IYBH 1R9TH 4DR2Q 3CC4A 1N8RC 4A3IH 4BA2I 1NMFA 2ZM6Q 1PH9A 5GADC 2K52A 1HZBA 4DR3Q 2N8NA 1NTGA 4DV7Q 3T1HQ 1Q46A 4BY7G 2ZTDA 1I3QH 2R93H 2I0QA 4P74A 4A4IA 3RZOH 3HOZH 1L2FA 1Q12A 4OWWB 5C4XH 1N33Q 3KF8B 2JA5H 1Z9FA 4LUVA 3A5UA 2BA1A 3GTMH 3L0OA 3I55A 1YIJA 2ATWA 1PH5A 4BY1G 4BA1I 3BZKA 4LF8Q 1Q82C 4IJHA 1WOCA 3H15A 1VQBA 4DR3L 1PH2A 1PH4A 3T1HL 3I2ZA 2F4VL 1CSPA 3RLOA 1OXUA 1N33L 1PH1A 1PA6A 4UY8C 1VQCA 4XTCS 4X65Q 4A3JG 1AE3A 3CQZH 2CFMA 4DV5L 5IYDH 3CCUA 4LF8L 4OWXB 5GAHC 4KI0A 1KAWA 4YWLA 2R7ZG 4JYAL 3GO5A 4OO1G 4HJ5A 2QGQA 5C44G 3RN5A 3CC2A 1RIPA 1SE8A 4YHHL 3K8AA 1Q81C 5C3EG 5LMNW 3STBD 1S3OA 3AFPA 4C2MH 4UP8A 4JI1L 1GKHA 1LYLA 4X65L 5BR8L 4R4QA 2GVBA 3UE1A 4BXXG 3J7ZC 4RG1A 5FJ8G 1PYBA 4PZ6A 1Y1WG 4DV1Q 3PUWA 1EUJA 3PIPA 3SGIA 1FGUA 1VQEA 2IX0A 5HGQA 3U4ZA 1HZCA 1K0RA 2PQAB 3M3YH 5GROA 4DNIA 1HR0W 1IXRA 1UE6A 1X65A 4YWKA 1N34Q 4A3BH 2IT1A 2MFIA 1P16A 2VQFQ 3HKSA 4IOCA 3CMEA 2UUAQ 4NXNQ 1XNQQ 5IWAL 3J80i 3M7NA 4X64L 1SMXA 4Y7NH 4BBRH 1Q1EA 2R92H 3PV0A 5LMUL 3OTOQ 1JB7A 3T1YL 5IP9G 3AQQA 1EWIA 2JEAI 2N49A 3CF5A 3S17H 4R4OA 4LUOA 1TWFH 1W3SA 4JBJA 1S72A 2GVAA 4DV6Q 2L15A 4EQ5A 2I5MX 2JJQA 3KLWA 3K81C 4NXNL 1OXVA 4R4TA 5M3MH 1XNQL 1EQRA 2PQAA 2LXKA 2RF4A 1Y1VG 3PGZA 2KHJA 1NE3A 3CXCA 2JA7H 1G291 3J81c 4JV5L 2CQOA 2BA0A 4UPAA 1VQLA 4XIGS 4DKAC 3J7A5 4OWTB 1D7QA 4DK3C 1VQDA 2K4KA 3K7AH 2IHEA 4A3KH 3KJPA 1YJWA 2WB1E 2B63H 3H0GH 4NB3A 2Y0SG 2MNAA 1G51A 3CC7A 3ULPA 3FKIH 5IYCH 4JI5L 3CCVA 3U4VA 1EQQA 1GM5A 5JJIA 1U0LA 3EIVA 4DR6L 4JI4Q 1M90C 5H1SE 2XTIA 1VCIA 2NN6I 3EBEA 3GTKH 1X9NA 1I50H 2ASBA 4DR7Q 2VUMH 1N32Q 1PFSA 4YCWA 4AQYQ 3HOVH 3G6EA 1VQMA 2E2JH 2ZJQA 3DM3A 1UWVA 2PMZE 2YTXA 5JJKA 4B3MQ 2OTJA 1MIUA 4MTNA 3HKZE 4JG2A 3W5OA 4TVAB 4A3MH 3G4SA 4DUZQ 4JI4L 1QVFA 2NVTH 4JC0A 4KHPL 1E3PA 1YHBA 3AYHB 4HJAA 4PZ7A 2NZHA 2KHIA 3I4OA 4B3TL 3HOXH 3GTOH 4A3CH 1VQHA 2KBNA 1N32L 2D0PA 4AQYL 3E9IA 2Z6KC 1HNZQ 1E1OA 1HZ9A 2K5NA 3K80C 1X55A 1PH6A 1X54A 4A93H 4A3FH 2N78A 2VY3A 5C0XJ 5JEAG 4B3ML 4JI8Q 2UXDQ 3S15H 2JA8G 2I5LX 1VQ8A 4OONA 1LM0A 1CSQA 4DV2Q 1YHAA 3F1ZA 2ALYB 4HIOA 1WFQA 3CPFA 5IP7H 4HJ9A 3GTPH 2QEXA 3S1NH 1QZHA 3HOUH 3KDFB 1HNZL 1AE2A 3K0XA 4BBSG 4K0KQ 4GS3A 3RLNA 1CKOA 4LF5Q 1HH2P 2E8GA 4QL5A 4JI8L 3I4NH 3PO2G 3FP9A 2E2IH 2CWPA 3RLFA 3KF6B 4LFAQ 1HNWQ 3Q8DA 5C4JH 4P71A 1UEBA 3A74A 2RHQB 4QGUA 1B8AA 1FJGQ 2VQEQ 3NEMA 4GKKL 3L7ZC 3CCJA 4GKJQ 1VQJA 5AJ3Q 3ERSX 4YWMA 1XMQL 1NMGA 2ID0A 1VQ5A 1Z47A 4DV4L 1E24A 5IYBG 1QVCA 3F8TA 4K0KL 4DR2L 1A63A 3I7FA 2WFWA 4A3IG 4AH6A 1L1OC 4P73A 4O2DA 2ZM6L 1J6QA 2RHSB 1K83H 3L2PA 1IBLQ 3KDFA 3PUXA 2QA4A 4B3SQ 4DV7L 3NBHB 1YHQA 3CCRA 4L5RC 4LFAL 2R93G 4LF7Q 1XMOL 3HOZG 5ELOA 5C0XI 4FDBA 1CUKA 3FHWA 2JA5G 1FJGL 2XGTA 3KF6A 5ELNA 1BVSA 2VQEL 3HOWH 4GKJL 1GO3E 5AJ3L 2Z6KA 4JI2Q 4A75A 5IE8A 4A3GG 3STBC 1E7ZA 4A3JH 1HNXQ 1EIFA 1K73C 1SRUA 3UDFA 4DUYQ 1IBLL 5M3FG 5FLXc 1X6OA 3DLLA 1Q7YC 2AHOB 1XJVA 2KENA 2YU9H 3D0FA 2ZJRA 3K7UC 4POGA 4AYBG 3E9HA 2N3SA 3I4MH 5C3EH 2IX1A 1KXLA 1L1OB 2IY5B 1BBUA 4DPGA 3ULJA 5IYDG 1KRSA 4DR5Q 1XPRA 4JI2L 2HT1A 1UE5A 2EIFA 1SFOH 1DGSA 2WAQE 4QY7A 2NN6G 1HNXL 4BXXH 4UP7A 1WI5A 3U58A 3WWVA 5FJ8H 2LSSA 5FLMG 4HJ8A 2EXDA 3J81i 4DK6C 1JJCB 1I94Q 1JMCA 3RN2A 4JI6Q 3MXNB 4JBKA 4OXPA 1XTDA 1K8GA 3PO3H 2JQOA 1L1OA 2ES2A 1U5KA 1CKNB 2CWAA 2WP8J 4GLAC 1VS0A 5GQOA 4DV1L 1HR0Q 1IBMQ 2E5LQ 4IFDJ 3CMAA 1VQNA 4B3RQ 3CW2C 1OXXK 4A3BG 4O0AA 1H95A 4QIWE 4LFBQ 4TQUS 1SLJA 1N34L 4IPHA 3S1MH 3S1QH 3BU2A 4LF9Q 2VQFL 3CCQA 1PYSB 2UUAL 3ICEA 2JEBI 1N36Q 2KCTA 4YCUA 4JI0Q 1T9HA 4BBRG 1VQ4A 2R92G 1VQOA 1Y14B 2UUBQ 3OTOL 4R4IA 1Y1VH 1HR0L 3JAMc 1VQPA 3I56A 2UXBQ 3F2BA 1FVIA 2OTLA 1JT8A 4DV6L 1CKNA 4IPGA 3KJOA 4LFBL 1NJIC 2YTVA 4NXMQ 2JA6H 5M3MG 4LF9L 1WCMG 1K9MC 5IT9c 1VQGA 1IBKQ 2OWOA 2D0OA 2E2HH 2CKZB 4GN5A 4ME3A 4P72A 3NELA 3HOYG 3PCOB 1LTLA 1TWAH 4A3KG 3TS0A 4A3DG 2B63G 1MJEA 3H0GG 3KYHC 4HIMA 1B7YB 4A3EG 1GVPA 2JK8A 3FKIG 4DV3Q 1SN8A 4ALPA 1W2BA 1QZGA 4NXML 3HFZB 4GLVB 3TQYA 1PH7A 4JI7Q 1IBKL 4DR7L 4IFDI 4RMFA 2NVQH 2BH8A 3M9BA 4JI3Q 2A8VA 3CCMA 3UDGA 1JJ2A 5C0XG 5M5YH 1X3EA 4DAYB 1IZ6A 1P8LA 1E22A 2Q2UA 2K5HA 1OXSC 1VQIA 1QUQB 1TWCH 2OCEA 1GD7A 4A3MG 4DUZL 4C3JH 2VW9A 1SR3A 2R7DA 2AWOA 4JOIC 1N9WA 2F3IA 1YEZA 4DAMA 3M4OH 4JI7L 3GDEA 3HOXG 2JA8H 4C3HH 1YNXA 2VL6A 2HHHQ 1A0IA 1K3RA 2YYZA 3PF5A 1EYGA 1J5EQ 2RCNA 4DV0Q 4A3FG 2ZTCA 1A8VA 1QVGA 3GTQH 1V9PA 2YTYA 2UXDL 2MO1A 4LF4Q 2GN5A 2UU9Q 4PG3A 2ZTEA 3GTLH 4DV2L 1OTCA 4A3LG 2R6GA 4IO9A 1MKHA 1QUQA 4GN4B 3CCEA 3CCSA 1XPOA 1MJCA 2VS1A 1ASZA 2UUCQ 3AEVA 4BY7H 5IP7G 2HHHL 1YBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2H A;  3D31 A;  2F52 A;  3PSI A;  4MNO A;  3TRZ A;  4X6A H;  1I6H H;  2Y0S E;  3KFU A;  3B6Y A;  1YI2 A;  2KCM A;  1J5E L;  4DV0 L;  2K5V A;  4GLX A;  4LF5 L;  3I4N G;  1KHI A;  3IRB A;  3EN2 A;  4GN3 B;  4NPS A;  3S2H H;  1HNW L;  3TEH B;  1EIY B;  4X66 Q;  5C4X G;  3RNU A;  4LW1 A;  4X62 Q;  5DLQ E;  2I5H A;  2UUC L;  2F4V Q;  1HJP A;  1FL0 A;  3G48 A;  1KD1 C;  1VQF A;  1XNR Q;  3CCL A;  4JBW A;  1C9O A;  1YVC A;  3ZJY C;  4DV5 Q;  2HIX A;  4J15 A;  5K36 G;  2FXQ A;  5IY0 A;  1JJG A;  1ASY A;  4B3S L;  4A3G H;  2UXC Q;  4JYA Q;  2R7Z H;  3H3V H;  4R4C A;  4QQB X;  4JOI A;  4LF7 L;  1EOV A;  3PUY A;  5JJL A;  4L5Q A;  2LXJ A;  4X66 L;  4C3I H;  5C44 H;  4YHH Q;  5M3F H;  3HOW G;  1X3F A;  4X62 L;  3UDI A;  4LFC Q;  1X3G A;  1XNR L;  2HIV A;  4R1J A;  3RZD H;  2EQS A;  3NEN A;  3U50 C;  2WB1 G;  4JI1 Q;  4LF6 Q;  5BR8 Q;  2Q2T A;  1C0A A;  5LMN Q;  2OQK A;  1NY4 A;  2OQ0 A;  1TXY A;  4LNQ A;  1NBW A;  1JE5 A;  1WYD A;  3A5Z B;  3CPW A;  4UP9 A;  4DUY L;  2UXC L;  3BZC A;  4MZ9 A;  4YY3 Q;  3PF4 A;  2Q2I A;  3F2D A;  1G6P A;  1V43 A;  1Y1W H;  5J3B A;  2CCZ A;  2D62 A;  3ER0 A;  4YCV A;  2ZJP A;  1I5F A;  1X56 A;  2C35 B;  2H5X A;  4EX5 A;  5FLM H;  3I4M G;  4LFC L;  3AFQ A;  3PIO A;  4PZ8 A;  3JAM i;  4DR5 L;  3J81 j;  2A1A A;  5EAY A;  1KRT A;  3HKZ G;  4LUZ A;  2HQL A;  4LF6 L;  1PH8 A;  5LMN L;  4IFD G;  5IWA Q;  2R7F A;  4X64 Q;  3MEF A;  1VQA A;  3TS2 A;  1IL2 A;  1UE7 A;  2Z0S A;  5LMU Q;  4YY3 L;  2DUD A;  3T1Y Q;  4WJ3 M;  5IP9 H;  2BH2 A;  4IOA A;  1O7I A;  3S14 H;  4LWC A;  1I94 L;  1V1Q A;  1VQK A;  4JI6 L;  1C7Y A;  1VQ9 A;  2V1C C;  3RR5 A;  3M85 A;  1A62 A;  3CP0 A;  1S40 A;  4JCV E;  1Q8K A;  3PO3 G;  4HID A;  1D8L A;  1BKB A;  3CAM A;  2IHF A;  1LUZ A;  2MO0 A;  2E5L L;  3S2D H;  1IBM L;  3S16 H;  1TWH H;  4KLK A;  4JV5 Q;  1HZA A;  2AMC B;  2B3G A;  1PH3 A;  4B3R L;  4Y52 H;  1L0W A;  4HJ7 A;  2NVY H;  1RL2 A;  3JC6 6;  5M5W H;  3CD6 A;  4IJL A;  1XMO Q;  1UE1 A;  4IPD A;  4GNX C;  1VQ7 A;  1AH9 A;  4JI5 Q;  1EFW A;  1N36 L;  5GAG C;  4DR1 Q;  3G71 A;  4JI0 L;  3UE0 A;  4GOP C;  4AIM A;  2JA7 G;  4DR6 Q;  1B70 B;  3GTJ H;  3KOJ A;  3H3V I;  2UUB L;  1WCM H;  1BBW A;  3GD7 A;  1VQ6 A;  1KQS A;  3LGJ A;  2JE6 I;  4OO1 I;  2B29 A;  4AYB E;  1XPU A;  3M4P A;  4A76 A;  2NZO A;  2UXB L;  3E0E A;  3HOY H;  5IYC G;  1TWG H;  3J80 c;  3OYY A;  3UDX A;  2JA6 G;  2JA9 A;  1YJ9 A;  4A3D H;  2VNU D;  4A3E H;  2K14 A;  4WJ4 A;  2VUM G;  4KHP Q;  5HY6 A;  3ULL A;  4DR1 L;  3HOV G;  3PUV A;  4QJF A;  4B3T Q;  4L5T A;  2VZA A;  2DGY A;  2PI2 A;  2K50 A;  4DR4 Q;  3OW2 A;  3A0J A;  2MQH A;  4GNX B;  1E1T A;  5E7N A;  4PMW A;  4DV3 L;  4HIK A;  4GOP B;  1M1K C;  1WJJ A;  4BY1 H;  4OX9 Q;  4APV A;  3GTG H;  5M5X H;  3W1B A;  1YJN A;  4A3C G;  1KL9 A;  2YV5 A;  1KIX A;  4JI3 L;  1Q86 C;  4P75 A;  2NVX H;  1PHJ A;  1KC8 C;  4JBM A;  3M4Q A;  4A93 G;  1IYJ B;  4L5S A;  5GAE C;  4DR4 L;  1CKM A;  1OXT A;  4BBS H;  3PUZ A;  1PVO A;  4KHZ A;  2A19 A;  3PO2 H;  1SRO A;  3F2C A;  3TRE A;  1YIT A;  4OX9 L;  4H02 A;  4GNX A;  1YZ6 A;  3S1R H;  4POF A;  5JEA J;  3VDY A;  2WAQ G;  4GOP A;  2K75 A;  1K8A C;  4IPC A;  3S24 A;  2AWN A;  3HOU G;  4A3L H;  2PNH A;  4GKK Q;  2AKW B;  1PV4 A;  2PI2 E;  1XMQ Q;  4LF4 L;  3W1G A;  1Q1B A;  4DV4 Q;  3BJU A;  2UU9 L;  5IYB H;  1R9T H;  4DR2 Q;  3CC4 A;  1N8R C;  4A3I H;  4BA2 I;  1NMF A;  2ZM6 Q;  1PH9 A;  5GAD C;  2K52 A;  1HZB A;  4DR3 Q;  2N8N A;  1NTG A;  4DV7 Q;  3T1H Q;  1Q46 A;  4BY7 G;  2ZTD A;  1I3Q H;  2R93 H;  2I0Q A;  4P74 A;  4A4I A;  3RZO H;  3HOZ H;  1L2F A;  1Q12 A;  4OWW B;  5C4X H;  1N33 Q;  3KF8 B;  2JA5 H;  1Z9F A;  4LUV A;  3A5U A;  2BA1 A;  3GTM H;  3L0O A;  3I55 A;  1YIJ A;  2ATW A;  1PH5 A;  4BY1 G;  4BA1 I;  3BZK A;  4LF8 Q;  1Q82 C;  4IJH A;  1WOC A;  3H15 A;  1VQB A;  4DR3 L;  1PH2 A;  1PH4 A;  3T1H L;  3I2Z A;  2F4V L;  1CSP A;  3RLO A;  1OXU A;  1N33 L;  1PH1 A;  1PA6 A;  4UY8 C;  1VQC A;  4XTC S;  4X65 Q;  4A3J G;  1AE3 A;  3CQZ H;  2CFM A;  4DV5 L;  5IYD H;  3CCU A;  4LF8 L;  4OWX B;  5GAH C;  4KI0 A;  1KAW A;  4YWL A;  2R7Z G;  4JYA L;  3GO5 A;  4OO1 G;  4HJ5 A;  2QGQ A;  5C44 G;  3RN5 A;  3CC2 A;  1RIP A;  1SE8 A;  4YHH L;  3K8A A;  1Q81 C;  5C3E G;  5LMN W;  3STB D;  1S3O A;  3AFP A;  4C2M H;  4UP8 A;  4JI1 L;  1GKH A;  1LYL A;  4X65 L;  5BR8 L;  4R4Q A;  2GVB A;  3UE1 A;  4BXX G;  3J7Z C;  4RG1 A;  5FJ8 G;  1PYB A;  4PZ6 A;  1Y1W G;  4DV1 Q;  3PUW A;  1EUJ A;  3PIP A;  3SGI A;  1FGU A;  1VQE A;  2IX0 A;  5HGQ A;  3U4Z A;  1HZC A;  1K0R A;  2PQA B;  3M3Y H;  5GRO A;  4DNI A;  1HR0 W;  1IXR A;  1UE6 A;  1X65 A;  4YWK A;  1N34 Q;  4A3B H;  2IT1 A;  2MFI A;  1P16 A;  2VQF Q;  3HKS A;  4IOC A;  3CME A;  2UUA Q;  4NXN Q;  1XNQ Q;  5IWA L;  3J80 i;  3M7N A;  4X64 L;  1SMX A;  4Y7N H;  4BBR H;  1Q1E A;  2R92 H;  3PV0 A;  5LMU L;  3OTO Q;  1JB7 A;  3T1Y L;  5IP9 G;  3AQQ A;  1EWI A;  2JEA I;  2N49 A;  3CF5 A;  3S17 H;  4R4O A;  4LUO A;  1TWF H;  1W3S A;  4JBJ A;  1S72 A;  2GVA A;  4DV6 Q;  2L15 A;  4EQ5 A;  2I5M X;  2JJQ A;  3KLW A;  3K81 C;  4NXN L;  1OXV A;  4R4T A;  5M3M H;  1XNQ L;  1EQR A;  2PQA A;  2LXK A;  2RF4 A;  1Y1V G;  3PGZ A;  2KHJ A;  1NE3 A;  3CXC A;  2JA7 H;  1G29 1;  3J81 c;  4JV5 L;  2CQO A;  2BA0 A;  4UPA A;  1VQL A;  4XIG S;  4DKA C;  3J7A 5;  4OWT B;  1D7Q A;  4DK3 C;  1VQD A;  2K4K A;  3K7A H;  2IHE A;  4A3K H;  3KJP A;  1YJW A;  2WB1 E;  2B63 H;  3H0G H;  4NB3 A;  2Y0S G;  2MNA A;  1G51 A;  3CC7 A;  3ULP A;  3FKI H;  5IYC H;  4JI5 L;  3CCV A;  3U4V A;  1EQQ A;  1GM5 A;  5JJI A;  1U0L A;  3EIV A;  4DR6 L;  4JI4 Q;  1M90 C;  5H1S E;  2XTI A;  1VCI A;  2NN6 I;  3EBE A;  3GTK H;  1X9N A;  1I50 H;  2ASB A;  4DR7 Q;  2VUM H;  1N32 Q;  1PFS A;  4YCW A;  4AQY Q;  3HOV H;  3G6E A;  1VQM A;  2E2J H;  2ZJQ A;  3DM3 A;  1UWV A;  2PMZ E;  2YTX A;  5JJK A;  4B3M Q;  2OTJ A;  1MIU A;  4MTN A;  3HKZ E;  4JG2 A;  3W5O A;  4TVA B;  4A3M H;  3G4S A;  4DUZ Q;  4JI4 L;  1QVF A;  2NVT H;  4JC0 A;  4KHP L;  1E3P A;  1YHB A;  3AYH B;  4HJA A;  4PZ7 A;  2NZH A;  2KHI A;  3I4O A;  4B3T L;  3HOX H;  3GTO H;  4A3C H;  1VQH A;  2KBN A;  1N32 L;  2D0P A;  4AQY L;  3E9I A;  2Z6K C;  1HNZ Q;  1E1O A;  1HZ9 A;  2K5N A;  3K80 C;  1X55 A;  1PH6 A;  1X54 A;  4A93 H;  4A3F H;  2N78 A;  2VY3 A;  5C0X J;  5JEA G;  4B3M L;  4JI8 Q;  2UXD Q;  3S15 H;  2JA8 G;  2I5L X;  1VQ8 A;  4OON A;  1LM0 A;  1CSQ A;  4DV2 Q;  1YHA A;  3F1Z A;  2ALY B;  4HIO A;  1WFQ A;  3CPF A;  5IP7 H;  4HJ9 A;  3GTP H;  2QEX A;  3S1N H;  1QZH A;  3HOU H;  3KDF B;  1HNZ L;  1AE2 A;  3K0X A;  4BBS G;  4K0K Q;  4GS3 A;  3RLN A;  1CKO A;  4LF5 Q;  1HH2 P;  2E8G A;  4QL5 A;  4JI8 L;  3I4N H;  3PO2 G;  3FP9 A;  2E2I H;  2CWP A;  3RLF A;  3KF6 B;  4LFA Q;  1HNW Q;  3Q8D A;  5C4J H;  4P71 A;  1UEB A;  3A74 A;  2RHQ B;  4QGU A;  1B8A A;  1FJG Q;  2VQE Q;  3NEM A;  4GKK L;  3L7Z C;  3CCJ A;  4GKJ Q;  1VQJ A;  5AJ3 Q;  3ERS X;  4YWM A;  1XMQ L;  1NMG A;  2ID0 A;  1VQ5 A;  1Z47 A;  4DV4 L;  1E24 A;  5IYB G;  1QVC A;  3F8T A;  4K0K L;  4DR2 L;  1A63 A;  3I7F A;  2WFW A;  4A3I G;  4AH6 A;  1L1O C;  4P73 A;  4O2D A;  2ZM6 L;  1J6Q A;  2RHS B;  1K83 H;  3L2P A;  1IBL Q;  3KDF A;  3PUX A;  2QA4 A;  4B3S Q;  4DV7 L;  3NBH B;  1YHQ A;  3CCR A;  4L5R C;  4LFA L;  2R93 G;  4LF7 Q;  1XMO L;  3HOZ G;  5ELO A;  5C0X I;  4FDB A;  1CUK A;  3FHW A;  2JA5 G;  1FJG L;  2XGT A;  3KF6 A;  5ELN A;  1BVS A;  2VQE L;  3HOW H;  4GKJ L;  1GO3 E;  5AJ3 L;  2Z6K A;  4JI2 Q;  4A75 A;  5IE8 A;  4A3G G;  3STB C;  1E7Z A;  4A3J H;  1HNX Q;  1EIF A;  1K73 C;  1SRU A;  3UDF A;  4DUY Q;  1IBL L;  5M3F G;  5FLX c;  1X6O A;  3DLL A;  1Q7Y C;  2AHO B;  1XJV A;  2KEN A;  2YU9 H;  3D0F A;  2ZJR A;  3K7U C;  4POG A;  4AYB G;  3E9H A;  2N3S A;  3I4M H;  5C3E H;  2IX1 A;  1KXL A;  1L1O B;  2IY5 B;  1BBU A;  4DPG A;  3ULJ A;  5IYD G;  1KRS A;  4DR5 Q;  1XPR A;  4JI2 L;  2HT1 A;  1UE5 A;  2EIF A;  1SFO H;  1DGS A;  2WAQ E;  4QY7 A;  2NN6 G;  1HNX L;  4BXX H;  4UP7 A;  1WI5 A;  3U58 A;  3WWV A;  5FJ8 H;  2LSS A;  5FLM G;  4HJ8 A;  2EXD A;  3J81 i;  4DK6 C;  1JJC B;  1I94 Q;  1JMC A;  3RN2 A;  4JI6 Q;  3MXN B;  4JBK A;  4OXP A;  1XTD A;  1K8G A;  3PO3 H;  2JQO A;  1L1O A;  2ES2 A;  1U5K A;  1CKN B;  2CWA A;  2WP8 J;  4GLA C;  1VS0 A;  5GQO A;  4DV1 L;  1HR0 Q;  1IBM Q;  2E5L Q;  4IFD J;  3CMA A;  1VQN A;  4B3R Q;  3CW2 C;  1OXX K;  4A3B G;  4O0A A;  1H95 A;  4QIW E;  4LFB Q;  4TQU S;  1SLJ A;  1N34 L;  4IPH A;  3S1M H;  3S1Q H;  3BU2 A;  4LF9 Q;  2VQF L;  3CCQ A;  1PYS B;  2UUA L;  3ICE A;  2JEB I;  1N36 Q;  2KCT A;  4YCU A;  4JI0 Q;  1T9H A;  4BBR G;  1VQ4 A;  2R92 G;  1VQO A;  1Y14 B;  2UUB Q;  3OTO L;  4R4I A;  1Y1V H;  1HR0 L;  3JAM c;  1VQP A;  3I56 A;  2UXB Q;  3F2B A;  1FVI A;  2OTL A;  1JT8 A;  4DV6 L;  1CKN A;  4IPG A;  3KJO A;  4LFB L;  1NJI C;  2YTV A;  4NXM Q;  2JA6 H;  5M3M G;  4LF9 L;  1WCM G;  1K9M C;  5IT9 c;  1VQG A;  1IBK Q;  2OWO A;  2D0O A;  2E2H H;  2CKZ B;  4GN5 A;  4ME3 A;  4P72 A;  3NEL A;  3HOY G;  3PCO B;  1LTL A;  1TWA H;  4A3K G;  3TS0 A;  4A3D G;  2B63 G;  1MJE A;  3H0G G;  3KYH C;  4HIM A;  1B7Y B;  4A3E G;  1GVP A;  2JK8 A;  3FKI G;  4DV3 Q;  1SN8 A;  4ALP A;  1W2B A;  1QZG A;  4NXM L;  3HFZ B;  4GLV B;  3TQY A;  1PH7 A;  4JI7 Q;  1IBK L;  4DR7 L;  4IFD I;  4RMF A;  2NVQ H;  2BH8 A;  3M9B A;  4JI3 Q;  2A8V A;  3CCM A;  3UDG A;  1JJ2 A;  5C0X G;  5M5Y H;  1X3E A;  4DAY B;  1IZ6 A;  1P8L A;  1E22 A;  2Q2U A;  2K5H A;  1OXS C;  1VQI A;  1QUQ B;  1TWC H;  2OCE A;  1GD7 A;  4A3M G;  4DUZ L;  4C3J H;  2VW9 A;  1SR3 A;  2R7D A;  2AWO A;  4JOI C;  1N9W A;  2F3I A;  1YEZ A;  4DAM A;  3M4O H;  4JI7 L;  3GDE A;  3HOX G;  2JA8 H;  4C3H H;  1YNX A;  2VL6 A;  2HHH Q;  1A0I A;  1K3R A;  2YYZ A;  3PF5 A;  1EYG A;  1J5E Q;  2RCN A;  4DV0 Q;  4A3F G;  2ZTC A;  1A8V A;  1QVG A;  3GTQ H;  1V9P A;  2YTY A;  2UXD L;  2MO1 A;  4LF4 Q;  2GN5 A;  2UU9 Q;  4PG3 A;  2ZTE A;  3GTL H;  4DV2 L;  1OTC A;  4A3L G;  2R6G A;  4IO9 A;  1MKH A;  1QUQ A;  4GN4 B;  3CCE A;  3CCS A;  1XPO A;  1MJC A;  2VS1 A;  1ASZ A;  2UUC Q;  3AEV A;  4BY7 H;  5IP7 G;  2HHH L;  1YBY A; 
#chains in the Genus database with same CATH topology
 2Q2H A;  3D31 A;  2B2T A;  2B8G A;  3B6Y A;  4LF5 L;  1SAP A;  3EN2 A;  3E0J A;  5D3I B;  3PIO 3;  4A3I B;  1HNW L;  1EIY B;  4FF4 A;  5ISR A;  3SK6 A;  4IQZ A;  3RNU A;  4LK1 C;  2RBM A;  1DOL A;  4N8F A;  1HJP A;  1FL0 A;  2UUC L;  1LTR D;  3HOZ B;  2JA5 B;  5C3X A;  1MI2 A;  4CKB A;  2ICI A;  3GTM B;  1C9O A;  1NCV A;  4DV5 Q;  2ZXO A;  2FXQ A;  5IY0 A;  2OEO A;  3QB3 A;  1ASY A;  4BS9 A;  4QQB X;  4DK1 A;  1EOV A;  2DNC A;  4OO1 H;  4CJ0 B;  4YHH Q;  4M8A A;  1X3F A;  5LHY 1;  2EE1 A;  1U9R A;  3HZX A;  4XQJ A;  2F0Q A;  5CV7 A;  4LF6 Q;  2OQK A;  2K04 A;  3BZC A;  2O4X A;  3F2D A;  3Q24 A;  1JQY D;  1M8A A;  5J3B A;  1X56 A;  4FXG C;  4C56 C;  4LFC L;  4PZ8 A;  3TN2 A;  3JAM i;  4DR5 L;  1MHW C;  5EAY A;  3HKZ G;  1QG7 A;  2HQL A;  4H44 C;  2F0T A;  3QOJ A;  3DUZ A;  1VQA A;  5HGT A;  3TS2 A;  1S5F D;  1EY7 A;  1UE7 A;  5LMU Q;  3SK4 A;  1EQV A;  2DUD A;  1RHP A;  3NUC A;  3J80 E;  1I4G A;  5IOC A;  1SNP A;  2XWJ B;  3KK7 A;  3RR5 A;  3M85 A;  1J9O A;  2R3Z A;  5FO9 B;  1S40 A;  2G5D A;  2ENB A;  4QUF A;  2BOS A;  4JW0 A;  1DZ1 A;  2F0J A;  1EYC A;  4HSP A;  1HZA A;  3MA2 B;  1PH3 A;  1L0W A;  5M5W B;  2K03 A;  2D9U A;  3CD6 A;  5FK9 C;  1UE1 A;  1VQ7 A;  1C48 A;  3TZU A;  1KNA A;  1HUM A;  5GAG C;  3FDT A;  1WCM B;  2DY7 A;  1B70 B;  3KOJ A;  5IGF A;  2UUB L;  1BBW A;  1ESF A;  2JE6 I;  2A68 D;  3K5N A;  1PZI D;  2B29 A;  1W6K A;  4DK0 A;  2GA4 B;  4PV1 C;  4A76 A;  1M4V A;  3K7A B;  3RZD B;  2JA6 G;  2JA9 A;  1YJ9 A;  4A3D H;  1G6Z A;  2VNU D;  4KHP Q;  5HY6 A;  4E6I A;  1PXU A;  3PUV A;  3AMU A;  5M9O A;  3GTK B;  2K5D A;  1JOO A;  3L9A X;  1PFM A;  1SNC A;  4DR4 Q;  4FXK C;  1KDA A;  1E1T A;  1L0Y B;  5DEH A;  1I4H A;  2MUY A;  4DV3 L;  1PLF A;  1HPC A;  4OX9 Q;  2DN8 A;  3SEB A;  1IKL A;  2NVT B;  1GJX A;  2YV5 A;  5FO7 B;  1Q86 C;  3A7L A;  1TT2 A;  1PHJ A;  3P1H A;  1KLU D;  5GAE C;  1E0B A;  1HA5 A;  1OXT A;  4A3F B;  4BBS H;  1PVO A;  1GUN A;  2N88 A;  2J7Z A;  4H02 A;  1FR3 A;  1YZ6 A;  2C9O A;  1IW7 C;  2DNE A;  3MFG A;  3C1E A;  3HOU G;  1WTH A;  4FF2 A;  1S5E D;  3HOU B;  1HQM C;  1Q1B A;  1XXG A;  2UU9 L;  1X3Q A;  5IYB H;  1PFB A;  3I4N B;  2JSO A;  3DWP A;  4BA2 I;  2K52 A;  1NTG A;  3T1H Q;  1XX8 A;  2B2W A;  5KGU A;  1I3Q H;  5D65 A;  2R93 H;  3OHX C;  2K6A A;  4A4I A;  1L2F A;  4UDU C;  4OWW B;  2XSC A;  1EY4 A;  1ONL A;  3DWQ A;  3CU7 A;  3D4W A;  2L11 A;  4RH6 A;  2AUK A;  3WOE A;  4HN7 A;  1PH2 A;  2F0L A;  1CSP A;  1OXU A;  1N33 L;  3HOW B;  4UY8 C;  4XTC S;  3W3A A;  3G7L A;  4DV5 L;  1LV9 A;  2WB1 B;  3CCU A;  1OO9 B;  4LF8 L;  2R7Z G;  3WOF A;  5GAH C;  1WTX A;  4G4K A;  2QGQ A;  3MTS A;  3RN5 A;  4YHH L;  2YU9 B;  4C2M B;  3AFP A;  1GOZ A;  1O7Z A;  2SOB A;  3I4M B;  4UP8 A;  4KY7 A;  2Z9H A;  5AFW A;  3DEO A;  1SFO B;  4PZ6 A;  2KHS A;  5CGK A;  1Y1W G;  5JVG 3;  4ZQ3 A;  3SGI A;  1D5M C;  1SBB B;  1UE6 A;  2IPK D;  4YWK A;  5CBA E;  2MFI A;  1P16 A;  5TSS A;  3M7N A;  4Y7N H;  1Q1E A;  3MEH A;  1TQO A;  5LMU L;  3BDL A;  1JB7 A;  3AQQ A;  3CF5 A;  1S72 A;  4DV6 Q;  2EPB A;  1BOS A;  3T13 A;  1K8M A;  4NXN L;  1XNQ L;  1Y8N B;  4KD3 A;  3D6C A;  2DY8 A;  3CXC A;  1YNJ C;  1J8I A;  2QDL A;  3J7A 5;  4XIG S;  1S5C D;  1D7Q A;  5JJZ A;  3KJP A;  4ZUI A;  2B63 H;  2M9V A;  3H0G H;  2Y0S G;  1G51 A;  1GM5 A;  3EBE A;  5J1Z A;  1N32 Q;  2SNS A;  3HOV H;  5EKI A;  5C4H A;  2E2J H;  1UWV A;  2PMZ E;  2YTX A;  5JJK A;  1Q8I A;  1O7L A;  4B3M Q;  1MIU A;  3HKZ E;  5I9P A;  4DUZ Q;  3MFY A;  4A3M H;  1X3P A;  3W2D A;  4KHP L;  4RKL A;  4PZ7 A;  3GTO B;  2KHI A;  3I4O A;  4HCE A;  5A2Q E;  2KBN A;  4N9P A;  4HTH A;  2L0C A;  2XRQ D;  4F87 A;  1JOK A;  2Z6K C;  4CDC C;  1HNZ Q;  1WTR A;  4A93 H;  4DA2 A;  3IKJ A;  1CZW A;  3LNN A;  4N9T A;  5BN5 A;  1VQ8 A;  4OON A;  3NWT A;  3GTP H;  1SYD A;  1CI3 M;  3UI2 A;  1ZXT A;  3KF6 B;  4LFA Q;  2OT2 A;  1BCP B;  3Q8D A;  1UEB A;  3A74 A;  1GUO A;  2RHQ B;  1FJG Q;  2B2Y A;  2WKD A;  4ULL A;  4K2L A;  5AJ3 Q;  3ERS X;  4YWM A;  1EU3 A;  1SJH D;  2MPM A;  2X69 A;  3K57 A;  1HCZ A;  4K0K L;  3R2T A;  5J22 A;  1PRT B;  1IBL Q;  1J6Q A;  3L2P A;  4B3S Q;  4BY1 H;  4OHJ A;  2QA4 A;  3NBH B;  2B2V A;  1BDO A;  4LF7 Q;  5ELO A;  1CUK A;  4RFB A;  2XGT A;  3KF6 A;  1BVS A;  1GO3 E;  4B9X A;  2A74 C;  5IE8 A;  5JPN C;  2H1E A;  1ESR A;  4A3J H;  3F2U A;  2NYZ D;  1SRU A;  1EY6 A;  4DUY Q;  5FLX c;  1LTT D;  3DLL A;  1H9S B;  2AHO B;  1KTK A;  3D0F A;  1AZP A;  3E9H A;  2N3S A;  4K6L A;  1CM9 A;  3NBH A;  2L12 A;  5C3E H;  1KXL A;  2IY5 B;  3ULJ A;  1XPR A;  4FF1 A;  2HT1 A;  1PDQ A;  4RGM A;  1U4L A;  4ZKC B;  4BXX H;  2LKV A;  1WTP A;  3SXH A;  4HJ8 A;  3NPP A;  3EA6 A;  1H9S A;  4X3U A;  5EPK A;  1TVX A;  4OXP A;  4DNR B;  4UAI A;  1XTD A;  2L5T A;  1PTO C;  2F3V A;  1GUS A;  2WP8 J;  2E5L Q;  4IFD J;  2MJ8 A;  4LMQ D;  2L4N A;  1VQN A;  1SLJ A;  4IN3 A;  3VYU A;  3NP8 A;  5G3L F;  4EGV A;  3S1M H;  3DWA A;  5DAU A;  5EKL A;  1A3V A;  2HCI A;  2KCT A;  4YCU A;  4BBR G;  1Y14 B;  3Q22 A;  2F0E A;  4OEM B;  4DV6 L;  4IPG A;  3KJO A;  4LFB L;  2JA6 H;  5M3M G;  1IBK Q;  2KEE A;  1JC7 A;  1VMC A;  2CKZ B;  4DNT B;  3G6J B;  3E3X A;  1SYB A;  4K5X A;  2B2T C;  1WTQ A;  1TWA H;  3K0Y A;  3TS0 A;  4DU9 A;  4A3D G;  4HIM A;  3X3M A;  1GVP A;  2JK8 A;  4ALP A;  3VA7 A;  4A3D B;  1QZG A;  1CHQ D;  3HFZ B;  3OPO A;  4KTA A;  5COR A;  4IFD I;  1IL8 A;  4RMF A;  3M9B A;  4FF3 A;  5IT9 L;  3HEJ A;  1I4R A;  1QUQ B;  3HP3 A;  4DUZ L;  5IOD A;  2RSN A;  3EQL C;  1HXY D;  2JA8 B;  4IZ8 A;  4JI7 L;  3GDE A;  2KED A;  1A0I A;  2FJ2 A;  2ZTC A;  5D3D A;  2MO1 A;  4LF4 Q;  2GN5 A;  4BBS B;  4QMG A;  3GTL H;  4ZKB B;  4HCS A;  1T5X D;  1BUV T;  3MZ5 A;  4XT3 B;  1MKH A;  1QUQ A;  3CCE A;  1MJC A;  2VS1 A;  3Q0A A;  1ASZ A;  2UUC Q;  5NUC A;  1PTO F;  1QB5 D;  4MNO A;  3TRZ A;  4X6A H;  1I6H H;  2Y0S E;  1GHJ A;  3IFD A;  4V19 0;  2KCM A;  4KJO A;  3IRB A;  3BG3 A;  1SDF A;  3S9W A;  1S5D D;  5G3L D;  3TEH B;  2F0O A;  2RVL A;  3SK5 A;  4Z9C B;  1I3Q B;  4LW1 A;  2R93 B;  2E75 C;  3BDC A;  3G48 A;  5CBE E;  1KD1 C;  5A35 A;  3CCL A;  4JBW A;  2PQE A;  2CH4 A;  2HIX A;  4B3S L;  5I2Y A;  4JYA Q;  2R7Z H;  4R4C A;  3FPP A;  5DM6 3;  4JOI A;  4LF7 L;  2NWG A;  2HDM A;  4QCL A;  4L5Q A;  2LXJ A;  4C3I H;  2CHB D;  4LFC Q;  2HIV A;  4R1J A;  4ZLT F;  2EYM A;  4K8J A;  3U9S A;  4O1N A;  2OQ0 A;  1KDC A;  1TXY A;  4LNQ A;  3KLS A;  1NBW A;  4DUY L;  2EZV A;  3CPW A;  3ERO A;  3TDQ A;  2UXC L;  1G6P A;  1Y1W H;  2CCZ A;  4YCV A;  2ZJP A;  4PMB A;  3C1F A;  1GHK A;  1BXT A;  3SE0 A;  3HGB A;  3AFQ A;  5J39 A;  3VR4 A;  1B2T A;  1KRT A;  2J4X A;  4LUZ A;  3KBG A;  4IFD G;  3IFT A;  5EPJ A;  3MEF A;  1ROD A;  4KKU A;  4OL7 A;  4YY3 L;  1QJO A;  4IUQ A;  1O7I A;  3S14 B;  3BVZ A;  4LWC A;  2KJX A;  2AQ2 B;  1VQ9 A;  2V1C C;  1Q8K A;  1ZEQ X;  3TP7 A;  1D8L A;  4Y7N B;  3CAM A;  2IHF A;  2E5L L;  2MO0 A;  2D5D A;  3S16 H;  1TWH H;  4KLK A;  1K28 A;  2DJF C;  5KRU A;  2B3G A;  4Y52 H;  2KCN A;  1PTO D;  1B3A A;  4JI5 Q;  1EFW A;  2RSO A;  2Q8T A;  3GTJ H;  1LTI D;  3H3V I;  3GD7 A;  2EJF C;  1KQS A;  3LGJ A;  5L37 A;  1EEF D;  1Q90 A;  1XPU A;  3E0E A;  3HOY H;  2KOL A;  2ZXR A;  3UDX A;  3D4R A;  2B63 B;  3H0G B;  3JAM L;  4H13 C;  4A3E H;  1WVL A;  2Q8I B;  2B2W C;  3HOV G;  4B3T Q;  1EWC A;  4WOR A;  3HOV B;  1CZG A;  2K50 A;  2E2J B;  3A0J A;  4GNX B;  2K7V A;  5E7N A;  1SND A;  1M1K C;  4A3M B;  4NKL A;  1FD7 D;  3GTG H;  1IHZ A;  2JN4 A;  2PO4 A;  4FXD A;  4A93 G;  3M4Q A;  1IYJ B;  2IW3 A;  4NW2 A;  2Z8L A;  1CKM A;  1HFG A;  5EPL A;  1BNZ A;  4KHZ A;  2A19 A;  1SRO A;  5HUR A;  2EVB A;  2VB2 X;  3F2C A;  1YIT A;  4GNX A;  3I4L A;  4POF A;  5IGC A;  3QWN A;  2WAQ G;  3A8K E;  1K8A C;  4RWS C;  2PNH A;  4IUN A;  1TS5 A;  2AKW B;  2KA7 A;  4TKO B;  3GTP B;  1I6V C;  1O80 A;  2BE5 C;  3P7J A;  4LF4 L;  4ZCK A;  1R9T H;  2DJG C;  1SMY D;  1LTA D;  1PZJ D;  3TZD A;  5IGD A;  1HZB A;  5T1I A;  2FMM A;  1V1O A;  1N33 Q;  1Q12 A;  5C4X H;  1Z9F A;  1R4P B;  3BVG A;  5EJW A;  1HUN A;  2ATW A;  1PH5 A;  4BY1 G;  3GP7 A;  4ZYS A;  4LF8 Q;  5IGB A;  1WOC A;  2LFN A;  3H15 A;  3BS1 A;  4L6T B;  1WD0 A;  5EKK A;  3D6W A;  3CQZ B;  4A3J G;  1AE3 A;  4A3J B;  5K5P A;  4JYA L;  4J1M A;  1PZK D;  4HJ5 A;  3SDZ A;  3SR1 A;  5C44 G;  1EY8 A;  3CC2 A;  3N52 A;  5C3E G;  5LMN W;  4CKE A;  1TII D;  5C3E B;  2PMZ B;  1GKH A;  4R4Q A;  4BXX G;  3UE1 A;  3J7Z C;  3QR8 A;  3HKZ B;  3H91 A;  2RQX A;  1JB3 A;  4KKS A;  4DV1 Q;  3PUW A;  1EUJ A;  1VQE A;  1SNM A;  4CJ2 C;  1DM0 B;  5BN4 A;  4DNI A;  1IXR A;  5CV9 A;  2IT1 A;  4NXN Q;  2VQF Q;  1XNQ Q;  3CME A;  2UUA Q;  4ODG A;  3WDN A;  4BBR H;  1RJT A;  1EWI A;  1TWF B;  1W3S A;  2GVA A;  3S1M B;  2I5M X;  2J0T D;  4CHT B;  5M3M H;  4JK1 C;  4CDD C;  3I90 A;  1EQR A;  2RF4 A;  3ZYY X;  1CA6 A;  1CQV A;  2KHJ A;  2JA7 H;  4MTK A;  3J81 c;  4MN3 A;  4QUC A;  1EY9 A;  1VQL A;  1U4M A;  1YJW A;  3CC7 A;  3ULP A;  4JI5 L;  3CCV A;  3U4V A;  2JA6 B;  1LTB D;  4BWG B;  1M90 C;  2XTI A;  1VCI A;  2NN6 I;  1X9N A;  1I50 H;  2ASB A;  2B2Y C;  2VUM H;  1PFS A;  3VR5 A;  1TWA B;  4MTN A;  1HRJ A;  4JI4 L;  3G4S A;  2G9H D;  4RGO S;  2CW0 C;  2B2V C;  4JC0 A;  5CV8 A;  1F77 A;  4HJA A;  2NZH A;  4B3T L;  3D4D A;  4IAL A;  1G2T A;  2XNA C;  1VQH A;  1AEX A;  1BCP C;  4DAP A;  4AQY L;  1HZ9 A;  3K80 C;  4RCO A;  5COY A;  1QE6 A;  3PQI A;  4KHV A;  2KEC A;  4NDX A;  1PRT C;  5CYU A;  1SSO A;  2ALY B;  3MVV A;  1CT1 D;  1ML0 D;  1ICW A;  3S1N H;  4DXF A;  1QZH A;  1AE2 A;  4K0K Q;  3RLN A;  2E8G A;  2E2I B;  5FKA C;  3URY A;  1FNV A;  1LT4 D;  2CWP A;  2NUC A;  3RLF A;  3TSS A;  3GTL B;  1KAB A;  4QGU A;  4C1N K;  4RCN A;  2EY2 A;  3NEM A;  4G7O C;  2SDF A;  1TS2 A;  2EJG C;  1VQJ A;  1Y69 U;  1I6H B;  3D8G A;  2ID0 A;  1XYI A;  4X3T A;  1Z47 A;  1E24 A;  1QVC A;  3I7F A;  1C8C A;  2WFW A;  4P73 A;  2F0U A;  4O2D A;  2RHS B;  1K83 H;  2P5Z X;  1I4X A;  2PPB C;  4FDB A;  1SXT A;  5ELN A;  2VQE L;  2K1B A;  4DGZ A;  2M2L A;  3STB C;  5CV5 A;  1K73 C;  4NMZ A;  4C3I G;  2R7Z B;  4MIU A;  2EY6 A;  1S4Z A;  3A56 A;  3DHQ A;  3HS0 C;  2KEN A;  3OWE B;  2ZJR A;  2HDL A;  4POG A;  5ELF A;  3NHH A;  1L1O B;  1Q3L A;  2IX1 A;  5IYD G;  1KDB A;  2QDB A;  1V8Q A;  1DGS A;  2WAQ E;  4IFD H;  2NN6 G;  4UP7 A;  3OOC A;  3WWV A;  5FJ8 H;  3IL8 A;  1Y1W B;  2I07 B;  3BZD B;  4DK6 C;  1JJC B;  5JPM C;  5FLX L;  1JMC A;  3RN2 A;  3RD4 A;  4JI6 Q;  5IT9 E;  4JBK A;  3SHL A;  4CDF C;  1EY5 A;  2K33 A;  2JQO A;  1L1O A;  4GLA C;  2Q8R E;  4DV1 L;  3L3O C;  1IBM Q;  2NTS A;  4B3R Q;  3CW2 C;  4A3B G;  1PRT F;  1H95 A;  1RF2 D;  4QIW E;  4N8X 1;  5DM7 3;  4LFB Q;  4IPH A;  3S1Q H;  3R2I A;  2VQF L;  2UUA L;  3ICE A;  5DNF A;  2R92 G;  1JR0 D;  2F0G A;  4R4I A;  1Y1V H;  3IAY A;  3S16 B;  1TWH B;  2PYK A;  1VQP A;  3FEW X;  4LJZ C;  4G57 A;  2EYH A;  3FVQ A;  5I6W A;  3I56 A;  1FVI A;  1NJI C;  2Y0S B;  2YTV A;  4LF9 L;  1D6E C;  2OWO A;  1MSG A;  2E2H H;  3GTJ B;  4GN5 A;  2PZW A;  3HOY G;  3C46 A;  1DXM A;  2ZXP A;  4A3K G;  3HOY B;  1B7Y B;  3VR6 A;  4A3E G;  3FKI G;  1DJR D;  4B08 A;  4KN4 C;  4A3E B;  4JI7 Q;  2NVQ B;  2O5J C;  1DON A;  4H0L C;  1GXD C;  5CR3 A;  2IX3 A;  3UDG A;  3VA5 A;  2EYJ A;  1YNN C;  1EZ6 A;  1IZ6 A;  1P8L A;  2Q2U A;  1TWC H;  1FNW A;  1STH A;  4JOI C;  2K01 A;  1N9W A;  3GTG B;  3M4O H;  1EWH A;  3HOX G;  2F3W A;  4HMJ A;  2VL6 A;  1SYG A;  2LMC B;  2TSS A;  1PFN A;  1K3R A;  2YYZ A;  3PF5 A;  1EYG A;  1VDZ A;  3GTQ H;  1STG A;  2YTY A;  2CW0 D;  2BDN A;  2HCC A;  3GV3 A;  2KVM A;  4IO9 A;  1GUW A;  1QOH A;  2HHH L;  3PSI A;  1L0X B;  2Z4I A;  3KFU A;  4K5V A;  3TP6 A;  1A2U A;  1QCB D;  2K5V A;  1IW7 D;  1F2L A;  4DV0 L;  1KHI A;  3AB9 A;  4RGN A;  4GLX A;  1R9T B;  4NPS A;  1PRT D;  1SYF A;  2XWB B;  5C4X G;  2V4D A;  5DLQ E;  2HD3 A;  2F4V Q;  1XTC D;  1YVC A;  3ZJY C;  4J15 A;  4K14 A;  4HED A;  2KUM A;  4A3G H;  3K5O A;  2UXC Q;  3H3V H;  1D2B A;  2PCF B;  3PUY A;  4X66 L;  5EGT A;  5C44 H;  2E74 C;  4JPB W;  2O2L D;  4IUT A;  4X62 L;  5JAV A;  3P75 A;  1X3G A;  1XNR L;  3NEN A;  4JI1 Q;  5BR8 Q;  4KMU C;  5LL6 S;  1EEI D;  3I70 A;  2PW7 A;  1WYD A;  1JE5 A;  3JAM E;  3BYY B;  4YY3 Q;  4K8I A;  1E2W A;  2MP1 A;  1CQF A;  2D62 A;  3ER0 A;  4ILW A;  2C35 B;  2H5X A;  5FLM H;  3PIO A;  2NTT A;  1PH8 A;  4RHR A;  1Z6H A;  5LMN L;  2R7F A;  4WJ3 M;  2BH2 A;  2MGS A;  1LO5 D;  3M7G A;  5KIX A;  1V1Q A;  4HAE A;  1VQK A;  2PZU A;  4JI6 L;  2LS0 1;  3DEP A;  4KK7 A;  3FMC A;  3CP0 A;  2F0M A;  5KND A;  1V1P B;  4JCV E;  3ITP A;  3PO3 G;  1BKB A;  4J6H A;  4BBR B;  1LUZ A;  1TY0 A;  1IBM L;  3KLS X;  2F0F A;  2AMC B;  4FP5 D;  4B3R L;  3KBX A;  4HJ7 A;  3JC6 6;  4WJW A;  5M5W H;  4IJL A;  4IPD A;  4GNX C;  1AH9 A;  2JA7 G;  1BQQ T;  2QIL A;  3UE0 A;  4AIM A;  1ZKO A;  5M3M B;  1WCM H;  2JA7 B;  1JOQ A;  1V1P A;  1KAA A;  3M4P A;  2NZO A;  1VF7 A;  3VR3 A;  3OYY A;  3J80 c;  1IYV A;  1ZYR C;  1YNJ D;  3OW7 A;  1NNX A;  4XXE A;  4WJ4 A;  2VUM G;  4DR1 L;  3P20 A;  4QJF A;  1I50 B;  4L5T A;  3RMH A;  2VZA A;  2VUM B;  4C1N I;  2C5C A;  5C4Z A;  2QEJ C;  4PMW A;  1ENA A;  4HIK A;  4GOP B;  3BDO A;  3A8J E;  3J7A V;  3W1B A;  4UHV A;  1KL9 A;  2EOT A;  1KIX A;  1E2V A;  4P75 A;  4P2C B;  2A6H C;  3J7A F;  4JBM A;  4L5S A;  1WTO A;  2F1M A;  2EYP A;  3DXJ C;  3MHB A;  3NTH A;  2HUG A;  5CV4 A;  3K5M A;  1EZ8 A;  3S1R H;  5T1G A;  5JEA J;  4C3H G;  3VDY A;  4ZRZ A;  4GOP A;  2K75 A;  1YNN D;  5IGE A;  3S24 A;  4A3L H;  4DAV A;  5C3W A;  3S1N B;  2PI2 E;  1XMQ Q;  3MAQ A;  3BJU A;  4DR2 Q;  1N8R C;  1NMF A;  4DV7 Q;  1Q46 A;  4BY7 G;  4G7H C;  3RZO H;  3KF8 B;  2BA1 A;  3T16 A;  1U4P A;  1YIJ A;  3V2T A;  3BZK A;  1R4Q B;  1B53 A;  4IJH A;  1K83 B;  3BVM A;  4DFA A;  3ND8 A;  5K36 H;  2FMC A;  1TY2 A;  3OSO A;  4DR3 L;  2B2U A;  3I2Z A;  3DMU A;  2F4V L;  5C5L A;  4U67 3;  1EOT A;  1PH1 A;  1RD9 D;  2RCF A;  2CFM A;  5IYD H;  3U9O A;  3KF8 A;  4KI0 A;  1KAW A;  4YWL A;  1WTW A;  2SNM A;  2NN6 H;  1SE8 A;  2XIW A;  2ZT9 C;  4C2M H;  4JI1 L;  4X65 L;  1LYL A;  5BR8 L;  2XVS A;  2GVB A;  4KY6 A;  2K05 A;  1Y8O B;  5FJ8 G;  1EY0 A;  4DF7 A;  2F4I A;  2F0H A;  2QKI C;  3PIP A;  2ICE C;  1FGU A;  5HGQ A;  5JVH 3;  3U4Z A;  1HZC A;  1K0R A;  3M3Y H;  5GRO A;  4A3B H;  1X65 A;  3FRP B;  2LY7 A;  4PNY A;  1SMX A;  2R92 H;  1ILP A;  1JWM D;  1STA A;  5IP9 G;  5LL6 X;  2N49 A;  3S17 H;  4R4O A;  4LUO A;  2A68 C;  3S1Q B;  4EQ5 A;  1UEA B;  1DYQ A;  2JJQ A;  5FOB B;  2PZT A;  3PGZ A;  1Y1V G;  1IYU A;  1G29 1;  3OMC A;  4G7Z C;  2BA0 A;  1Y1V B;  4UPA A;  4DKA C;  3QIA A;  1B3Q A;  4DK3 C;  1B9M A;  1VQD A;  2IHE A;  3Q23 A;  4A3K H;  4NB3 A;  4JI4 Q;  2MNA A;  1EQQ A;  3PMF A;  3FKI H;  1F9S A;  5IYC H;  1K8O A;  5JJI A;  2M00 A;  4IUV A;  3OIQ A;  2CH4 W;  4YCW A;  4AQY Q;  3G6E A;  4GZY C;  1VQM A;  2ZJQ A;  3DM3 A;  2WAC A;  2QCP X;  1EFI D;  2OTJ A;  3J81 L;  4S3S A;  1MBY A;  3ND9 A;  2VB3 X;  4LAA A;  1QVF A;  3VR2 A;  3T56 B;  1TU2 B;  1YHB A;  3AYH B;  4I7A A;  1LTG D;  3HOX H;  3GTO H;  4A3C H;  2D0P A;  3H6M A;  4A93 B;  2K5N A;  1ZYR D;  2JXM B;  3K59 A;  2UXD Q;  2N78 A;  2VY3 A;  5C0X J;  5JEA G;  3VYR A;  3S15 H;  3I73 A;  2I5L X;  2G9D A;  1CK1 A;  1NAP A;  1AP0 A;  1MSH A;  1YHA A;  4Q5V A;  3QOL A;  3F1Z A;  2WAQ B;  4HIO A;  4CDE C;  3HRZ C;  2KQ3 A;  4HJ9 A;  1B4O A;  3CPF A;  5EQ0 A;  2QEX A;  3KDF B;  1UAP A;  3GTQ B;  3PO2 G;  4JI8 L;  5I4D A;  4O42 A;  3DM1 A;  4R9W A;  5FLX E;  2A6H D;  5C4J H;  2F0S A;  1JIC A;  1B8A A;  4XYO A;  5BN3 A;  2VQE Q;  4I7Z C;  3NTK A;  2EY5 A;  1NMG A;  1XMQ L;  1VQ5 A;  4DR2 L;  4QIW B;  4BY1 B;  4A3I G;  4AH6 A;  1L1O C;  3CHB D;  3KDF A;  2NB0 A;  4DV7 L;  1RTO A;  3CKI B;  2A69 C;  3CCR A;  1YHQ A;  3HOZ G;  5C0X I;  4KKT A;  3FHW A;  2JA5 G;  3EJI A;  4IUR A;  1F9Q A;  4GKJ L;  3Q6S A;  4A75 A;  4A3G G;  1LT5 D;  3E5S A;  3NQT A;  4A3G B;  3UDF A;  2L55 A;  2H4O A;  1JOR A;  5C44 B;  3K7U C;  4AYB G;  2EYO A;  2JYO A;  1BBU A;  4DPG A;  1KRS A;  4AYB B;  4JI2 L;  5E4W C;  1UE5 A;  4YIJ A;  1HNX L;  1GUT A;  3SVM A;  4RGT A;  1WI5 A;  3U58 A;  4FO2 A;  2LSS A;  3T51 B;  5FLM G;  2XRS D;  4IUU A;  5KYL A;  3HG9 A;  3J81 i;  1I94 Q;  4XQN A;  3EVQ A;  4H7B A;  2K28 A;  4KJN A;  1H9M A;  2QW7 A;  1D5X C;  3PO3 H;  3NTI A;  1AZQ A;  2ES2 A;  2PNR C;  2CWA A;  1VS0 A;  1CHP D;  3TP8 A;  3TP5 A;  3CMA A;  1K3B C;  3GV6 A;  1F9R A;  3BU2 A;  4LF9 Q;  5E4X A;  3CCQ A;  2JEB I;  1N36 Q;  1SNO A;  4JI0 Q;  1VQO A;  3MWY W;  1X32 A;  3CRK C;  1HR0 L;  3JAM c;  2L9H A;  4RHS A;  2UXB Q;  1E2Z A;  4ME5 A;  1WCM G;  1VQG A;  1A6X A;  1SE2 A;  2TMP A;  4ME3 A;  1Z7T A;  5KYI A;  4P72 A;  3NEL A;  3R3O A;  4CBV A;  1LTL A;  2RKS A;  4TSS A;  3VYS A;  1MJE A;  3R93 A;  1EYA A;  4KY5 A;  1EU4 A;  4NXM L;  1FNU A;  4CJ1 B;  2B8F A;  1PH7 A;  4OIK A;  1HTL D;  1WD1 A;  4JI3 Q;  2A8V A;  2JP1 A;  1C4Q A;  4L63 B;  1JJ2 A;  5C0X G;  1CA5 A;  5M5Y H;  1STE A;  3H94 A;  1X3E A;  4IUP A;  4DAY B;  1A15 A;  1VQI A;  2K5H A;  5I6Y A;  3VYT A;  1B50 A;  4MHE A;  4C3J H;  2VW9 A;  4HSV A;  1SR3 A;  2F3I A;  1YEZ A;  2JA8 H;  1QNK A;  4C3H H;  1YNX A;  2EXZ A;  2HHH Q;  2A5H A;  1D1I A;  2CVR A;  5JOB A;  4A3F G;  4DV0 Q;  2UXD L;  4R8N A;  1F2Y A;  3MXG A;  3X3N A;  4DAY A;  3S1R B;  4A3L G;  1HFN A;  3A8I E;  4GN4 B;  2IWH A;  4R8I A;  1KLG D;  1XPO A;  2RDH A;  2FIN B;  5D14 A;  4BY7 H;  5IP7 G;  2F52 A;  1AN8 A;  4L8J A;  4U68 A;  1YI2 A;  1J5E L;  4XYQ A;  1S5B D;  5EBD A;  1ENC A;  3I4N G;  4GN3 B;  1BBX C;  1H9R A;  3S2H H;  3D3R A;  4HMI A;  5KNB A;  4X66 Q;  2BE5 D;  3K58 A;  4X62 Q;  3RZO B;  2I5H A;  1XNR Q;  1VQF A;  3PIP 3;  5K36 G;  1JJG A;  2F0W A;  2EDG A;  4C3I B;  1TR5 A;  1D1K A;  5JJL A;  5M3F H;  3HOW G;  4WFN 3;  3UDI A;  2L1B A;  3FPU B;  3AU7 A;  1NR4 A;  1TS3 A;  2EQS A;  3U50 C;  2WB1 G;  1C0A A;  2Q2T A;  1QIL A;  5LMN Q;  1B44 D;  1NY4 A;  5ELE A;  2A69 D;  2NZ1 D;  4QF4 A;  3A5Z B;  4UP9 A;  4F88 A;  4Q0F A;  3MC0 B;  4MZ9 A;  2WII B;  3PF4 A;  2Q2I A;  1V43 A;  2RDF A;  2F0N A;  1I5F A;  2O5I C;  4EX5 A;  3I4M G;  1BCP F;  4ZUJ A;  3J81 j;  2A1A A;  3R8B A;  3KLR A;  1BF4 A;  1HTP A;  4LF6 L;  4FNF A;  5IWA Q;  4X64 Q;  3OMG A;  2HQE A;  1IL2 A;  1SNQ A;  2Z0S A;  3I8Z A;  2Z4H A;  3T1Y Q;  5IP9 H;  4IOA A;  2F0D A;  1I4P A;  3S14 H;  1I94 L;  2E2D C;  2EJM A;  3M3Y B;  3NBI A;  4X3K A;  4A3B B;  1F9P A;  1C7Y A;  2QF7 A;  3LWE A;  5ELC A;  1A62 A;  3NWS A;  4HID A;  2F0P A;  2R92 B;  3S2D H;  3TME A;  4JV5 Q;  1ENF A;  4EQO A;  3S17 B;  1UNS A;  4K5W A;  5CMD A;  2NVY H;  1RL2 A;  3CRL C;  1PTO H;  1XMO Q;  1VF5 C;  4CKC A;  1N36 L;  4DR1 Q;  3G71 A;  4JI0 L;  1II3 A;  4GOP C;  4DR6 Q;  4KV6 A;  1LLR D;  1SYE A;  1VQ6 A;  1I4Q A;  3KUP A;  4OO1 I;  1A3U A;  1STB A;  4AYB E;  2D2C C;  2UXB L;  5IYC G;  1W6J A;  4FVM A;  1TWG H;  4A3K B;  1WTV A;  5IGG A;  3FKI B;  2K14 A;  3A55 A;  4B9W A;  5IIF A;  5CV6 A;  3ULL A;  1NSN S;  4X3S A;  1U4R A;  3A54 A;  2DGY A;  2B39 A;  1SJE D;  2PI2 A;  2A73 B;  4DXG A;  4RA8 A;  3OW2 A;  1GUG A;  2MQH A;  2Z6B A;  2F0V A;  5JEA H;  1WJJ A;  2OXP A;  4ID6 A;  1T5E A;  4APV A;  5M5X H;  1YJN A;  4A3C G;  2B2U C;  2BCO A;  4JI3 L;  3NE5 B;  2I46 A;  1O7Y A;  3J80 L;  2NVX H;  1KC8 C;  3HOX B;  1EYD A;  5FO8 B;  4DR4 L;  2CQA A;  4F8M A;  3PUZ A;  3S15 B;  2X6G A;  3PO2 H;  3TRE A;  3I72 A;  4OX9 L;  1BCP D;  1JWU D;  4IPC A;  1FYC A;  1CTM A;  4OIJ A;  2AWN A;  1DOK A;  4GKK Q;  1STY A;  1MD2 D;  1PV4 A;  3LX0 A;  1QWY A;  2A6E C;  3W1G A;  4DV4 Q;  3CC4 A;  4A3I H;  2ZM6 Q;  1PH9 A;  3T4A C;  5GAD C;  1RCV D;  1TKW B;  1AFP A;  4DR3 Q;  2N8N A;  5C4J B;  2SEB D;  2RDG A;  2ZTD A;  2I0Q A;  4P74 A;  5C4X B;  3HOZ H;  4XDX A;  4XQQ A;  1H9K A;  3TBI B;  2JA5 H;  1G8Z D;  4LUV A;  3V96 A;  3MXP A;  3A5U A;  3GTM H;  3L0O A;  3I55 A;  4RAU C;  4BA1 I;  1Q82 C;  5KNC A;  1BO0 A;  1VQB A;  1PH4 A;  3QG1 A;  3T1H L;  4KD4 A;  3E6Z X;  3RLO A;  1G2S A;  2NBF A;  1PA6 A;  4JVZ A;  1VQC A;  2PW5 A;  4X65 Q;  3CQZ H;  3OWF A;  3ERQ A;  5ELB A;  4OWX B;  3GO5 A;  4OO1 G;  1A3T A;  2KCC A;  2K5Q A;  1RIP A;  3K8A A;  1Q81 C;  3STB D;  1S3O A;  1SEB D;  1ILQ A;  4KN7 C;  3OIP A;  2AUJ D;  2IJ0 A;  4RG1 A;  3J81 E;  3ONA B;  1PYB A;  3V05 A;  1LAB A;  1H9J A;  2RA4 A;  4ZK9 B;  1ET6 A;  2IX0 A;  1NR2 A;  2PQA B;  4QB4 A;  1HR0 W;  1N34 Q;  1LT3 D;  3NK9 A;  3HKS A;  4IOC A;  5IWA L;  3J80 i;  3C2P A;  4X64 L;  4RKB A;  3PV0 A;  3PO3 B;  3OTO Q;  3T1Y L;  2JEA I;  1EIH A;  1A2T A;  3O13 A;  4FYD A;  2EYF A;  1TWF H;  3T53 B;  4JBJ A;  1CFM A;  1LAC A;  1DCZ A;  4EQP A;  1B9N A;  2L15 A;  3J7Y W;  2F03 A;  3KLW A;  3K81 C;  1JWS D;  1TS4 A;  3EFX D;  1OXV A;  1RTN A;  4R4T A;  2PQA A;  2LXK A;  3I3C A;  1NE3 A;  4JV5 L;  2CQO A;  1XWE A;  4OWT B;  1EQT A;  2K4K A;  3K7A H;  2WB1 E;  3RZD H;  1XMO L;  4PMC A;  1RKN A;  1U0L A;  3EIV A;  4DR6 L;  2WKC A;  5H1S E;  2K5W A;  4PQX A;  4DR7 Q;  5F2D A;  3GTK H;  4OGQ C;  5C0X H;  2AQ3 B;  4JG2 A;  3W5O A;  4TVA B;  3I91 A;  5E1F A;  2NVT H;  3GQB A;  1E3P A;  2XN9 C;  3RUZ A;  4F7X A;  1VMP A;  2VXW A;  1N32 L;  5M5Y B;  3E9I A;  2E76 C;  1E1O A;  4C3J G;  1X55 A;  4XT1 B;  1X54 A;  1PH6 A;  4A3F H;  4B3M L;  4JI8 Q;  3NSW A;  1PMR A;  4C3J B;  2JA8 G;  3BYT B;  1D5Z C;  1CSQ A;  1LM0 A;  4DV2 Q;  4C3H B;  1SMY C;  1K0S A;  1WFQ A;  5IP7 H;  2EY1 A;  3NXW A;  3HOU H;  1HNZ L;  3K0X A;  4BBS G;  4J8Q A;  4GS3 A;  4LF5 Q;  1CKO A;  1HH2 P;  4QL5 A;  3I4N H;  3FP9 A;  2E2I H;  1EL0 A;  1HNW Q;  1SE3 A;  3N6R A;  4P71 A;  1G91 A;  1JE4 A;  4BY7 B;  5ELD A;  3H3V C;  4GKK L;  3L7Z C;  3CCJ A;  4GKJ Q;  1HA6 A;  3H09 A;  4DV4 L;  1QNU A;  5IYB G;  3F8T A;  1JCK B;  5C6A A;  1A63 A;  2ZM6 L;  5E3F A;  3S2H B;  4L5R C;  2Z1C A;  3PUX A;  4LFA L;  4ZAI A;  1LTS D;  5CC4 A;  2R93 G;  1HQR D;  3SK8 A;  2WV6 D;  1FJG L;  2A6E D;  3HOW H;  5EBC A;  5C5M A;  1PYW D;  5AJ3 L;  2Z6K A;  4JI2 Q;  4HR7 B;  5A2Q L;  4WRD A;  1E7Z A;  1HNX Q;  1EIF A;  1KNE A;  1IBL L;  3C3L A;  5M3F G;  1X6O A;  1Q7Y C;  1XJV A;  2YU9 H;  5M3F B;  3I4M H;  4DR5 Q;  4K2K A;  3QO2 A;  2EIF A;  1HHV A;  1SFO H;  4QY7 A;  1MGS A;  4EQN A;  2F0K A;  2EXD A;  4V0B A;  3MXN B;  3QJY A;  3K6O A;  1RDP D;  2OF1 A;  1K8G A;  1NUC A;  1U5K A;  1CKN B;  1ICF B;  1ET9 A;  1HR0 Q;  5GQO A;  1DD2 A;  3M4Y A;  2N55 A;  1OXX K;  4K6D A;  4EVO A;  4O0A A;  4TQU S;  1N34 L;  2K32 A;  1PYS B;  2BDO A;  4ABN A;  4M1U B;  1EIG A;  1T9H A;  2MHV A;  1VQ4 A;  3MXU A;  1SE4 A;  2UUB Q;  3OTO L;  3MXN A;  3LWU A;  3S2D B;  2WIN B;  1IKM A;  2EYL A;  3F2B A;  4I65 A;  2OTL A;  1JT8 A;  2NVY B;  2F0I A;  1CKN A;  1PTO B;  5I2X A;  4NXM Q;  1K9M C;  1AW7 A;  5IT9 c;  2E2H B;  2D0O A;  4OEL B;  1F2Z A;  3PCO B;  1B1Z A;  2B63 G;  3H0G G;  3KYH C;  1TWG B;  4DV3 Q;  1SN8 A;  2FHT A;  2FFK B;  1W2B A;  2IL8 A;  3NQI A;  4GLV B;  3TQY A;  1IBK L;  4DR7 L;  2NVQ H;  2AQ1 B;  2BH8 A;  1Y8P B;  3CCM A;  1STN A;  3A7A B;  1TWC B;  1O78 A;  1E22 A;  1OXS C;  2OCE A;  2R61 A;  4A3M G;  1GD7 A;  1LT6 D;  2X6L A;  2R7D A;  2AWO A;  5I9O A;  3M4O B;  5M5X B;  4DAM A;  1DOM A;  2NVX B;  4CGY B;  4DN4 M;  5KEE A;  1J5E Q;  1FGB D;  2RCN A;  4TRD A;  1QVG A;  1A8V A;  1V9P A;  2UU9 Q;  1UUP A;  4PG3 A;  2ZTE A;  1F2M A;  3PO2 B;  1SYC A;  4DV2 L;  1OTC A;  1BR9 A;  2R6G A;  3CCS A;  3AEV A;  4NP5 A;  1YBY A;  3K5L A; 
#chains in the Genus database with same CATH homology
 2Q2H A;  3D31 A;  2F52 A;  3PSI A;  4MNO A;  3TRZ A;  4X6A H;  1I6H H;  2Y0S E;  3KFU A;  3B6Y A;  1YI2 A;  2KCM A;  1J5E L;  4DV0 L;  2K5V A;  4GLX A;  4LF5 L;  3I4N G;  1KHI A;  3IRB A;  3EN2 A;  4GN3 B;  4NPS A;  3S2H H;  1HNW L;  3TEH B;  1EIY B;  4X66 Q;  5C4X G;  3RNU A;  4LW1 A;  4X62 Q;  5DLQ E;  2I5H A;  2UUC L;  2F4V Q;  1HJP A;  1FL0 A;  3G48 A;  1KD1 C;  1VQF A;  1XNR Q;  3CCL A;  4JBW A;  1C9O A;  1YVC A;  3ZJY C;  4DV5 Q;  2HIX A;  4J15 A;  5K36 G;  2FXQ A;  5IY0 A;  1JJG A;  1ASY A;  4B3S L;  4A3G H;  2UXC Q;  4JYA Q;  2R7Z H;  3H3V H;  4R4C A;  4QQB X;  4JOI A;  4LF7 L;  1EOV A;  3PUY A;  5JJL A;  4L5Q A;  2LXJ A;  4X66 L;  4C3I H;  5C44 H;  4YHH Q;  5M3F H;  3HOW G;  1X3F A;  4X62 L;  3UDI A;  4LFC Q;  1X3G A;  1XNR L;  2HIV A;  4R1J A;  3RZD H;  2EQS A;  3NEN A;  3U50 C;  2WB1 G;  4JI1 Q;  4LF6 Q;  5BR8 Q;  2Q2T A;  1C0A A;  5LMN Q;  2OQK A;  1NY4 A;  2OQ0 A;  1TXY A;  4LNQ A;  1NBW A;  1JE5 A;  1WYD A;  3A5Z B;  3CPW A;  4UP9 A;  4DUY L;  2UXC L;  3BZC A;  4MZ9 A;  4YY3 Q;  3PF4 A;  2Q2I A;  3F2D A;  1G6P A;  1V43 A;  1Y1W H;  5J3B A;  2CCZ A;  2D62 A;  3ER0 A;  4YCV A;  2ZJP A;  1I5F A;  1X56 A;  2C35 B;  2H5X A;  4EX5 A;  5FLM H;  3I4M G;  4LFC L;  3AFQ A;  3PIO A;  4PZ8 A;  3JAM i;  4DR5 L;  3J81 j;  2A1A A;  5EAY A;  1KRT A;  3HKZ G;  4LUZ A;  2HQL A;  4LF6 L;  1PH8 A;  5LMN L;  4IFD G;  5IWA Q;  2R7F A;  4X64 Q;  3MEF A;  1VQA A;  3TS2 A;  1IL2 A;  1UE7 A;  2Z0S A;  5LMU Q;  4YY3 L;  2DUD A;  3T1Y Q;  4WJ3 M;  5IP9 H;  2BH2 A;  4IOA A;  1O7I A;  3S14 H;  4LWC A;  1I94 L;  1V1Q A;  1VQK A;  4JI6 L;  1C7Y A;  1VQ9 A;  2V1C C;  3RR5 A;  3M85 A;  1A62 A;  3CP0 A;  1S40 A;  4JCV E;  1Q8K A;  3PO3 G;  4HID A;  1D8L A;  1BKB A;  3CAM A;  2IHF A;  1LUZ A;  2MO0 A;  2E5L L;  3S2D H;  1IBM L;  3S16 H;  1TWH H;  4KLK A;  4JV5 Q;  1HZA A;  2AMC B;  2B3G A;  1PH3 A;  4B3R L;  4Y52 H;  1L0W A;  4HJ7 A;  2NVY H;  1RL2 A;  3JC6 6;  5M5W H;  3CD6 A;  4IJL A;  1XMO Q;  1UE1 A;  4IPD A;  4GNX C;  1VQ7 A;  1AH9 A;  4JI5 Q;  1EFW A;  1N36 L;  5GAG C;  4DR1 Q;  3G71 A;  4JI0 L;  3UE0 A;  4GOP C;  4AIM A;  2JA7 G;  4DR6 Q;  1B70 B;  3GTJ H;  3KOJ A;  3H3V I;  2UUB L;  1WCM H;  1BBW A;  3GD7 A;  1VQ6 A;  1KQS A;  3LGJ A;  2JE6 I;  4OO1 I;  2B29 A;  4AYB E;  1XPU A;  3M4P A;  4A76 A;  2NZO A;  2UXB L;  3E0E A;  3HOY H;  5IYC G;  1TWG H;  3J80 c;  3OYY A;  3UDX A;  2JA6 G;  2JA9 A;  1YJ9 A;  4A3D H;  2VNU D;  4A3E H;  2K14 A;  4WJ4 A;  2VUM G;  4KHP Q;  5HY6 A;  3ULL A;  4DR1 L;  3HOV G;  3PUV A;  4QJF A;  4B3T Q;  4L5T A;  2VZA A;  2DGY A;  2PI2 A;  2K50 A;  4DR4 Q;  3OW2 A;  3A0J A;  2MQH A;  4GNX B;  1E1T A;  5E7N A;  4PMW A;  4DV3 L;  4HIK A;  4GOP B;  1M1K C;  1WJJ A;  4BY1 H;  4OX9 Q;  4APV A;  3GTG H;  5M5X H;  3W1B A;  1YJN A;  4A3C G;  1KL9 A;  2YV5 A;  1KIX A;  4JI3 L;  1Q86 C;  4P75 A;  2NVX H;  1PHJ A;  1KC8 C;  4JBM A;  3M4Q A;  4A93 G;  1IYJ B;  4L5S A;  5GAE C;  4DR4 L;  1CKM A;  1OXT A;  4BBS H;  3PUZ A;  1PVO A;  4KHZ A;  2A19 A;  3PO2 H;  1SRO A;  3F2C A;  3TRE A;  1YIT A;  4OX9 L;  4H02 A;  4GNX A;  1YZ6 A;  3S1R H;  4POF A;  5JEA J;  3VDY A;  2WAQ G;  4GOP A;  2K75 A;  1K8A C;  4IPC A;  3S24 A;  2AWN A;  3HOU G;  4A3L H;  2PNH A;  4GKK Q;  2AKW B;  1PV4 A;  2PI2 E;  1XMQ Q;  4LF4 L;  3W1G A;  1Q1B A;  4DV4 Q;  3BJU A;  2UU9 L;  5IYB H;  1R9T H;  4DR2 Q;  3CC4 A;  1N8R C;  4A3I H;  4BA2 I;  1NMF A;  2ZM6 Q;  1PH9 A;  5GAD C;  2K52 A;  1HZB A;  4DR3 Q;  2N8N A;  1NTG A;  4DV7 Q;  3T1H Q;  1Q46 A;  4BY7 G;  2ZTD A;  1I3Q H;  2R93 H;  2I0Q A;  4P74 A;  4A4I A;  3RZO H;  3HOZ H;  1L2F A;  1Q12 A;  4OWW B;  5C4X H;  1N33 Q;  3KF8 B;  2JA5 H;  1Z9F A;  4LUV A;  3A5U A;  2BA1 A;  3GTM H;  3L0O A;  3I55 A;  1YIJ A;  2ATW A;  1PH5 A;  4BY1 G;  4BA1 I;  3BZK A;  4LF8 Q;  1Q82 C;  4IJH A;  1WOC A;  3H15 A;  1VQB A;  4DR3 L;  1PH2 A;  1PH4 A;  3T1H L;  3I2Z A;  2F4V L;  1CSP A;  3RLO A;  1OXU A;  1N33 L;  1PH1 A;  1PA6 A;  4UY8 C;  1VQC A;  4XTC S;  4X65 Q;  4A3J G;  1AE3 A;  3CQZ H;  2CFM A;  4DV5 L;  5IYD H;  3CCU A;  4LF8 L;  4OWX B;  5GAH C;  4KI0 A;  1KAW A;  4YWL A;  2R7Z G;  4JYA L;  3GO5 A;  4OO1 G;  4HJ5 A;  2QGQ A;  5C44 G;  3RN5 A;  3CC2 A;  1RIP A;  1SE8 A;  4YHH L;  3K8A A;  1Q81 C;  5C3E G;  5LMN W;  3STB D;  1S3O A;  3AFP A;  4C2M H;  4UP8 A;  4JI1 L;  1GKH A;  1LYL A;  4X65 L;  5BR8 L;  4R4Q A;  2GVB A;  3UE1 A;  4BXX G;  3J7Z C;  4RG1 A;  5FJ8 G;  1PYB A;  4PZ6 A;  1Y1W G;  4DV1 Q;  3PUW A;  1EUJ A;  3PIP A;  3SGI A;  1FGU A;  1VQE A;  2IX0 A;  5HGQ A;  3U4Z A;  1HZC A;  1K0R A;  2PQA B;  3M3Y H;  5GRO A;  4DNI A;  1HR0 W;  1IXR A;  1UE6 A;  1X65 A;  4YWK A;  1N34 Q;  4A3B H;  2IT1 A;  2MFI A;  1P16 A;  2VQF Q;  3HKS A;  4IOC A;  3CME A;  2UUA Q;  4NXN Q;  1XNQ Q;  5IWA L;  3J80 i;  3M7N A;  4X64 L;  1SMX A;  4Y7N H;  4BBR H;  1Q1E A;  2R92 H;  3PV0 A;  5LMU L;  3OTO Q;  1JB7 A;  3T1Y L;  5IP9 G;  3AQQ A;  1EWI A;  2JEA I;  2N49 A;  3CF5 A;  3S17 H;  4R4O A;  4LUO A;  1TWF H;  1W3S A;  4JBJ A;  1S72 A;  2GVA A;  4DV6 Q;  2L15 A;  4EQ5 A;  2I5M X;  2JJQ A;  3KLW A;  3K81 C;  4NXN L;  1OXV A;  4R4T A;  5M3M H;  1XNQ L;  1EQR A;  2PQA A;  2LXK A;  2RF4 A;  1Y1V G;  3PGZ A;  2KHJ A;  1NE3 A;  3CXC A;  2JA7 H;  1G29 1;  3J81 c;  4JV5 L;  2CQO A;  2BA0 A;  4UPA A;  1VQL A;  4XIG S;  4DKA C;  3J7A 5;  4OWT B;  1D7Q A;  4DK3 C;  1VQD A;  2K4K A;  3K7A H;  2IHE A;  4A3K H;  3KJP A;  1YJW A;  2WB1 E;  2B63 H;  3H0G H;  4NB3 A;  2Y0S G;  2MNA A;  1G51 A;  3CC7 A;  3ULP A;  3FKI H;  5IYC H;  4JI5 L;  3CCV A;  3U4V A;  1EQQ A;  1GM5 A;  5JJI A;  1U0L A;  3EIV A;  4DR6 L;  4JI4 Q;  1M90 C;  5H1S E;  2XTI A;  1VCI A;  2NN6 I;  3EBE A;  3GTK H;  1X9N A;  1I50 H;  2ASB A;  4DR7 Q;  2VUM H;  1N32 Q;  1PFS A;  4YCW A;  4AQY Q;  3HOV H;  3G6E A;  1VQM A;  2E2J H;  2ZJQ A;  3DM3 A;  1UWV A;  2PMZ E;  2YTX A;  5JJK A;  4B3M Q;  2OTJ A;  1MIU A;  4MTN A;  3HKZ E;  4JG2 A;  3W5O A;  4TVA B;  4A3M H;  3G4S A;  4DUZ Q;  4JI4 L;  1QVF A;  2NVT H;  4JC0 A;  4KHP L;  1E3P A;  1YHB A;  3AYH B;  4HJA A;  4PZ7 A;  2NZH A;  2KHI A;  3I4O A;  4B3T L;  3HOX H;  3GTO H;  4A3C H;  1VQH A;  2KBN A;  1N32 L;  2D0P A;  4AQY L;  3E9I A;  2Z6K C;  1HNZ Q;  1E1O A;  1HZ9 A;  2K5N A;  3K80 C;  1X55 A;  1PH6 A;  1X54 A;  4A93 H;  4A3F H;  2N78 A;  2VY3 A;  5C0X J;  5JEA G;  4B3M L;  4JI8 Q;  2UXD Q;  3S15 H;  2JA8 G;  2I5L X;  1VQ8 A;  4OON A;  1LM0 A;  1CSQ A;  4DV2 Q;  1YHA A;  3F1Z A;  2ALY B;  4HIO A;  1WFQ A;  3CPF A;  5IP7 H;  4HJ9 A;  3GTP H;  2QEX A;  3S1N H;  1QZH A;  3HOU H;  3KDF B;  1HNZ L;  1AE2 A;  3K0X A;  4BBS G;  4K0K Q;  4GS3 A;  3RLN A;  1CKO A;  4LF5 Q;  1HH2 P;  2E8G A;  4QL5 A;  4JI8 L;  3I4N H;  3PO2 G;  3FP9 A;  2E2I H;  2CWP A;  3RLF A;  3KF6 B;  4LFA Q;  1HNW Q;  3Q8D A;  5C4J H;  4P71 A;  1UEB A;  3A74 A;  2RHQ B;  4QGU A;  1B8A A;  1FJG Q;  2VQE Q;  3NEM A;  4GKK L;  3L7Z C;  3CCJ A;  4GKJ Q;  1VQJ A;  5AJ3 Q;  3ERS X;  4YWM A;  1XMQ L;  1NMG A;  2ID0 A;  1VQ5 A;  1Z47 A;  4DV4 L;  1E24 A;  5IYB G;  1QVC A;  3F8T A;  4K0K L;  4DR2 L;  1A63 A;  3I7F A;  2WFW A;  4A3I G;  4AH6 A;  1L1O C;  4P73 A;  4O2D A;  2ZM6 L;  1J6Q A;  2RHS B;  1K83 H;  3L2P A;  1IBL Q;  3KDF A;  3PUX A;  2QA4 A;  4B3S Q;  4DV7 L;  3NBH B;  1YHQ A;  3CCR A;  4L5R C;  4LFA L;  2R93 G;  4LF7 Q;  1XMO L;  3HOZ G;  5ELO A;  5C0X I;  4FDB A;  1CUK A;  3FHW A;  2JA5 G;  1FJG L;  2XGT A;  3KF6 A;  5ELN A;  1BVS A;  2VQE L;  3HOW H;  4GKJ L;  1GO3 E;  5AJ3 L;  2Z6K A;  4JI2 Q;  4A75 A;  5IE8 A;  4A3G G;  3STB C;  1E7Z A;  4A3J H;  1HNX Q;  1EIF A;  1K73 C;  1SRU A;  3UDF A;  4DUY Q;  1IBL L;  5M3F G;  5FLX c;  1X6O A;  3DLL A;  1Q7Y C;  2AHO B;  1XJV A;  2KEN A;  2YU9 H;  3D0F A;  2ZJR A;  3K7U C;  4POG A;  4AYB G;  3E9H A;  2N3S A;  3I4M H;  5C3E H;  2IX1 A;  1KXL A;  1L1O B;  2IY5 B;  1BBU A;  4DPG A;  3ULJ A;  5IYD G;  1KRS A;  4DR5 Q;  1XPR A;  4JI2 L;  2HT1 A;  1UE5 A;  2EIF A;  1SFO H;  1DGS A;  2WAQ E;  4QY7 A;  2NN6 G;  1HNX L;  4BXX H;  4UP7 A;  1WI5 A;  3U58 A;  3WWV A;  5FJ8 H;  2LSS A;  5FLM G;  4HJ8 A;  2EXD A;  3J81 i;  4DK6 C;  1JJC B;  1I94 Q;  1JMC A;  3RN2 A;  4JI6 Q;  3MXN B;  4JBK A;  4OXP A;  1XTD A;  1K8G A;  3PO3 H;  2JQO A;  1L1O A;  2ES2 A;  1U5K A;  1CKN B;  2CWA A;  2WP8 J;  4GLA C;  1VS0 A;  5GQO A;  4DV1 L;  1HR0 Q;  1IBM Q;  2E5L Q;  4IFD J;  3CMA A;  1VQN A;  4B3R Q;  3CW2 C;  1OXX K;  4A3B G;  4O0A A;  1H95 A;  4QIW E;  4LFB Q;  4TQU S;  1SLJ A;  1N34 L;  4IPH A;  3S1M H;  3S1Q H;  3BU2 A;  4LF9 Q;  2VQF L;  3CCQ A;  1PYS B;  2UUA L;  3ICE A;  2JEB I;  1N36 Q;  2KCT A;  4YCU A;  4JI0 Q;  1T9H A;  4BBR G;  1VQ4 A;  2R92 G;  1VQO A;  1Y14 B;  2UUB Q;  3OTO L;  4R4I A;  1Y1V H;  1HR0 L;  3JAM c;  1VQP A;  3I56 A;  2UXB Q;  3F2B A;  1FVI A;  2OTL A;  1JT8 A;  4DV6 L;  1CKN A;  4IPG A;  3KJO A;  4LFB L;  1NJI C;  2YTV A;  4NXM Q;  2JA6 H;  5M3M G;  4LF9 L;  1WCM G;  1K9M C;  5IT9 c;  1VQG A;  1IBK Q;  2OWO A;  2D0O A;  2E2H H;  2CKZ B;  4GN5 A;  4ME3 A;  4P72 A;  3NEL A;  3HOY G;  3PCO B;  1LTL A;  1TWA H;  4A3K G;  3TS0 A;  4A3D G;  2B63 G;  1MJE A;  3H0G G;  3KYH C;  4HIM A;  1B7Y B;  4A3E G;  1GVP A;  2JK8 A;  3FKI G;  4DV3 Q;  1SN8 A;  4ALP A;  1W2B A;  1QZG A;  4NXM L;  3HFZ B;  4GLV B;  3TQY A;  1PH7 A;  4JI7 Q;  1IBK L;  4DR7 L;  4IFD I;  4RMF A;  2NVQ H;  2BH8 A;  3M9B A;  4JI3 Q;  2A8V A;  3CCM A;  3UDG A;  1JJ2 A;  5C0X G;  5M5Y H;  1X3E A;  4DAY B;  1IZ6 A;  1P8L A;  1E22 A;  2Q2U A;  2K5H A;  1OXS C;  1VQI A;  1QUQ B;  1TWC H;  2OCE A;  1GD7 A;  4A3M G;  4DUZ L;  4C3J H;  2VW9 A;  1SR3 A;  2R7D A;  2AWO A;  4JOI C;  1N9W A;  2F3I A;  1YEZ A;  4DAM A;  3M4O H;  4JI7 L;  3GDE A;  3HOX G;  2JA8 H;  4C3H H;  1YNX A;  2VL6 A;  2HHH Q;  1A0I A;  1K3R A;  2YYZ A;  3PF5 A;  1EYG A;  1J5E Q;  2RCN A;  4DV0 Q;  4A3F G;  2ZTC A;  1A8V A;  1QVG A;  3GTQ H;  1V9P A;  2YTY A;  2UXD L;  2MO1 A;  4LF4 Q;  2GN5 A;  2UU9 Q;  4PG3 A;  2ZTE A;  3GTL H;  4DV2 L;  1OTC A;  4A3L G;  2R6G A;  4IO9 A;  1MKH A;  1QUQ A;  4GN4 B;  3CCE A;  3CCS A;  1XPO A;  1MJC A;  2VS1 A;  1ASZ A;  2UUC Q;  3AEV A;  4BY7 H;  5IP7 G;  2HHH L;  1YBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...