1QZGA

Crystal structure of pot1 (protection of telomere)- ssdna complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
170
structure length
170
Chain Sequence
VIDSLQLNELLNAGEYKIGELTFQSIRSSQELQKKNTIVNLFGIVKDFTPSRQSLHGTKDWVTTVYLWDPTCDTSSIGLQIHLFSKQGNDLPVIKQVGQPLLLHQITLRSYRDRTQGLSKDQFRYALWPDFSSNSKDTLCPQPMPRLMKTGDKEEQFALLLNKIWDEQTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords telomeric single-stranded DNA
publication title DNA self-recognition in the structure of Pot1 bound to telomeric single-stranded DNA
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein/dna
total genus 46
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02765 POT1 Telomeric single stranded DNA binding POT1/CDC13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1qzgA00
3NENA 4LUZA 3CC7A 1IBML 4YY3L 1C0AA 4R4QA 1N9WA 4UPAA 4JI3L 3S24A 1YI2A 2GVAA 4IOCA 4JI7Q 4LF5Q 4B3RL 5IYDH 5IP7H 1Q7YC 4HJ7A 1UE6A 5IYCH 5EAYA 4K0KQ 5GAGC 4JI8Q 4DR7L 1E1TA 5HGQA 4TVAB 3PGZA 3RLOA 5M5XH 1L2FA 3KF6A 1I94L 4BY1G 4HIMA 2OCEA 2R93H 1M1KC 4DV7Q 4APVA 3FKIG 2DGYA 1Q46A 4LFAQ 4DR5Q 3HOZG 4WJ4A 3RLFA 1Q12A 4P74A 1J6QA 1VQFA 4DV3Q 2UU9Q 3G71A 4DUYL 4A93G 4GOPC 4C3IH 1VQGA 1X56A 3GTLH 1N36L 2R92H 4AQYL 2ATWA 3S17H 1X65A 1J5EQ 4IJLA 5ELNA 2PQAA 4JC0A 2PMZE 3BZCA 2MO0A 2KBNA 4NB3A 4RMFA 4MZ9A 4DV4Q 2R7ZH 2MO1A 2WAQE 3JAMc 3I4MG 2Z6KA 2ZTCA 4GS3A 3W5OA 1PH2A 5IWAL 2A8VA 3KOJA 3PUXA 1P8LA 4YWLA 2HHHL 2NZOA 4LF6L 2Y0SG 4LW1A 4NPSA 4H02A 1XPRA 4GN4B 2E2HH 3PF4A 1A62A 2WB1E 3ER0A 4DR4Q 2JA9A 2HIXA 1MIUA 1X3EA 5BR8L 4LF9L 1SFOH 1ASZA 1IZ6A 3H0GH 1N33L 4JI4L 3A5ZB 1IBLQ 2OWOA 2UXCL 2A1AA 4BY1H 4ME3A 1QZGA 4JBWA 2UXDL 4A3LG 3FKIH 3HOZH 3E9IA 4IPCA 3AYHB 4BA1I 3PIOA 3PV0A 4PG3A 4GKKQ 4BXXH 1XMOL 3W1BA 1WOCA 1SR3A 4C2MH 4B3SQ 4JOIC 3CCEA 2VW9A 2NVXH 4JI0Q 4JI7L 4OO1G 2CKZB 2YU9H 3PUWA 3PIPA 2D0PA 1RL2A 1KD1C 1JJGA 1WYDA 3CMEA 1Q86C 3K8AA 1I3QH 3HOYG 4JG2A 1XJVA 2GVBA 1PYBA 2VY3A 3KJPA 3I4MH 2PI2A 1Y1WH 1FJGL 2ZM6Q 3RNUA 4YHHL 4B3ML 5E7NA 3NELA 3WWVA 1D8LA 5C3EG 5LMUQ 4A3KH 1KAWA 1XMQQ 1KL9A 3MEFA 4IFDG 2RF4A 3K7AH 3S1RH 3U50C 2JK8A 4OWWB 2NVTH 1B7YB 3RZOH 1PHJA 2Y0SE 5M5YH 4KHPL 3JAMi 1PVOA 2NN6G 4JI6Q 4A3DG 1T9HA 3UDIA 3A5UA 3HOVH 1Q8KA 4DNIA 1CKMA 2D62A 4QIWE 5GROA 4JYAL 2Q2UA 1B8AA 1TWGH 1IYJB 1L1OB 1SLJA 2PI2E 3CPFA 4GOPB 1Q81C 4A3GG 1LTLA 2VQFQ 2JA7G 2YTXA 1TWFH 4NXNL 4DK6C 3TREA 2IY5B 2OTJA 1Q1EA 1PYSB 3E0EA 4IFDJ 2KHJA 3HOWH 4DV6Q 3HKZE 4HJAA 1VQLA 4KHZA 1OXUA 4DUZL 1K0RA 4JBJA 2V1CC 4L5SA 1VS0A 3M4PA 3S14H 1HZCA 3J7A5 4HJ9A 1Y1VG 1A63A 4KLKA 5C4JH 4DR3L 1N34L 1PH8A 3HOYH 1HZBA 4EQ5A 2K5VA 3KLWA 1C7YA 3GDEA 4LUOA 1S72A 1MKHA 4BA2I 2F3IA 2IT1A 3JC66 4EX5A 3RN2A 3W1GA 3RN5A 1XNRL 1YVCA 4IPHA 5IYBG 1YZ6A 3I7FA 1G6PA 3GTOH 3CCJA 1VCIA 3TQYA 3VDYA 1EYGA 4GKJQ 2F4VQ 2B3GA 4OX9L 5C3EH 4DV2Q 1EQRA 2BH8A 4JI1Q 1QUQA 1XPOA 3J7ZC 1I5FA 1VQ8A 1SN8A 5JEAG 2UXBQ 3T1HL 1VQ6A 3S1QH 3D31A 4OWTB 1HNXL 1LYLA 2N8NA 4X65L 3TS2A 4QY7A 2XGTA 5M5WH 1M90C 4ALPA 2AKWB 1SROA 4XTCS 4A3FG 2WB1G 4A3GH 2NZHA 3I55A 3I56A 2JA7H 3RLNA 3A74A 4A3JG 2OQ0A 3Q8DA 4R4CA 2KHIA 1UWVA 4P75A 3UDFA 5M3FH 4HJ8A 4DR2L 4LF8L 4R1JA 3L2PA 1VQNA 2D0OA 1S40A 5FLMH 1KHIA 1A8VA 5JEAJ 2K75A 2N78A 3KJOA 1Y1VH 5LMNQ 1QVCA 2UUCQ 2JQOA 4JV5L 2YYZA 3HKSA 4YWKA 4LFBQ 5IYBH 1EUJA 1X3FA 3CAMA 1NTGA 4YCVA 1PA6A 4DR1L 2R6GA 4IJHA 3L7ZC 1HJPA 1SRUA 3GTQH 2QGQA 4AYBG 1KRTA 5C44G 4LNQA 5C4XG 5AJ3Q 1YEZA 4GNXB 3AQQA 4JBMA 4PMWA 3I4NG 1GVPA 3GD7A 3U4VA 2ES2A 1EFWA 1BBWA 1NMGA 1KIXA 3CCRA 3PO3H 4JI5L 3L0OA 4YCUA 2CCZA 1IBKL 4MNOA 2Z6KC 1WJJA 4P71A 2OTLA 4A3CG 4A75A 4B3TL 3HFZB 3STBD 2QEXA 3TEHB 2E5LQ 4X66Q 4POGA 1YIJA 3ERSX 4DV1Q 3KYHC 5H1SE 1L1OA 1Y14B 4GLVB 4X64Q 1PH7A 5LMNW 1LM0A 2Z0SA 3IRBA 4X62Q 1YJNA 3ULLA 1GM5A 2UUBL 3S2DH 1XNQL 1NJIC 5C0XG 4LF4Q 2ZTEA 5IE8A 3RZDH 4NXML 1TWAH 1HZ9A 3LGJA 4P73A 4DV0L 2VQEL 3S1NH 2K52A 3HKZG 3T1YL 2ZJPA 2EQSA 1AE3A 1GKHA 3CCLA 3PO2G 1JJCB 2JA8G 2CWAA 4YWMA 3ZJYC 5IY0A 2UUAQ 3KDFA 3E9HA 3J81c 4LF5L 1R9TH 1MJCA 4A93H 3STBC 5C44H 3M85A 1X9NA 4K0KL 1TWCH 5C4XH 4LUVA 4JI8L 4JI2Q 1IXRA 4OONA 3OW2A 4AYBE 1DGSA 4Y7NH 2ZJRA 5LMNL 4JCVE 2MNAA 2YV5A 1EIYB 4DPGA 3I4NH 5C0XJ 4OO1I 1FVIA 4DV7L 1CUKA 4LFAL 4DR5L 3S1MH 5IT9c 4OWXB 4DV5Q 3EBEA 4A3CH 1N32Q 1VQBA 2R7DA 4DV3L 1XPUA 1P16A 1Z47A 1S3OA 1UE7A 1BKBA 4C3JH 2UU9L 4R4IA 1VQDA 3M3YH 1VQJA 3PUZA 3GTJH 1HR0Q 2FXQA 1PH1A 3KF6B 1I50H 1J5EL 1YHBA 2YTYA 3OTOQ 4DV4L 2JA6G 2Q2HA 3ULJA 1VQPA 1PH9A 4IFDI 2HQLA 2IHFA 4DR6Q 1G51A 1VQIA 1HNWQ 1PH5A 2JEBI 4GLXA 4A3LH 3G6EA 3M7NA 4LFCQ 2NN6I 5ELOA 3T1HQ 4A3IG 2E5LL 3PO2H 1LUZA 1WCMG 2JA8H 2A19A 4YY3Q 4DR4L 2QA4A 4B3RQ 2AWOA 3ICEA 1O7IA 2C35B 1G291 1UE1A 2K50A 3M4QA 4C3HH 3AFPA 2LSSA 1H95A 4DR7Q 1K3RA 1VQ5A 1IBLL 3CMAA 3NEMA 1XTDA 1JE5A 4HIKA 3U58A 4MTNA 1I94Q 2LXJA 3U4ZA 3CC2A 1PFSA 4GNXA 3CC4A 3KFUA 3DM3A 4GKKL 2K4KA 2CWPA 4A3MG 3KF8B 4B3SL 1W2BA 2ALYB 4JI0L 2PNHA 1NE3A 4A3BG 4QJFA 3BU2A 1CSPA 2NVYH 4DUYQ 5HY6A 1YBYA 3ULPA 2L15A 4HIOA 1OXVA 4R4OA 1N36Q 4AQYQ 1UE5A 4A3DH 2MQHA 4HIDA 1JB7A 2Q2TA 2JA6H 1PH6A 1QVFA 3UDGA 3K7UC 2JJQA 1JJ2A 2ZM6L 1Q82C 5DLQE 4PZ6A 1NBWA 4O2DA 2BH2A 5IWAQ 2HT1A 4A4IA 5LMUL 1XMQL 4WJ3M 3I4OA 2VS1A 4UY8C 2HHHQ 4LF6Q 2JE6I 1WCMH 2AWNA 4BY7G 1FL0A 1KXLA 4OXPA 4DAYB 3GTGH 2HIVA 4JI6L 4L5QA 1TXYA 1K8GA 2B29A 2RCNA 5BR8Q 2JA5G 4LF9Q 1N33Q 3BZKA 4JI4Q 2NVQH 1SMXA 3PSIA 2UXCQ 2ZTDA 4PZ7A 4YCWA 4QGUA 1C9OA 2VQFL 1N8RC 1E3PA 2UXDQ 3CP0A 1E24A 1IL2A 1EOVA 3AFQA 1YHAA 3F2DA 4A3MH 3PCOB 1OXXK 4LWCA 2R7FA 3J81j 2N3SA 1FGUA 4DV6L 1VQEA 1YNXA 4UP7A 2K14A 5GQOA 2EXDA 1L0WA 3UE1A 1KQSA 4RG1A 1ASYA 3GTKH 4A3BH 5JJLA 3OYYA 1E22A 1VQMA 4IPDA 2BA1A 3PUVA 3BJUA 1Z9FA 3H0GG 4AH6A 3H15A 3F2CA 4A76A 1EWIA 3F8TA 4A3FH 1OXSC 1FJGQ 1QVGA 3A0JA 4GKJL 4YHHQ 4B3MQ 2F4VL 4A3JH 4DV2L 2I5LX 3MXNB 4JI1L 4BXXG 1WI5A 3G4SA 1XMOQ 4BBRG 5FLXc 4GOPA 4BY7H 3CPWA 3S15H 5FJ8G 1L1OC 2AMCB 2UXBL 4IO9A 1YJ9A 4KHPQ 4GN3B 1CKNB 2VUMG 3S16H 4GLAC 2IHEA 1VQCA 2JA5H 2ASBA 1A0IA 1EQQA 3PUYA 3J80c 4XIGS 4JYAQ 5JJIA 1Y1WG 1QUQB 2EIFA 4UP9A 2H5XA 5J3BA 3H3VI 5IP9G 1K9MC 1WFQA 3I2ZA 4NXNQ 4A3KG 4BBSG 2CQOA 5C0XI 1HNZQ 1YJWA 1VQ7A 4LF7Q 4KI0A 1OXTA 2RHSB 5M3MG 4DUZQ 1RIPA 4QL5A 2KENA 3EIVA 2UUCL 1NY4A 2I5HA 3HOVG 4DR3Q 1N34Q 3K80C 2ZJQA 2B63G 4LFBL 1EIFA 1W3SA 1YHQA 1XNRQ 2K5NA 5JJKA 1E7ZA 1E1OA 3SGIA 1KC8C 1GO3E 2LXKA 3M4OH 4O0AA 4HJ5A 4JOIA 3K0XA 3UE0A 3FP9A 1K73C 4OX9Q 2JEAI 3HOWG 4BBRH 1BBUA 1X6OA 1KRSA 5AJ3L 5FJ8H 1U0LA 2WP8J 4J15A 1MJEA 3H3VH 1X55A 4R4TA 3M9BA 1I6HH 1PH4A 2VUMH 1HNXQ 1K8AC 1VQOA 3GO5A 1GD7A 4X65Q 2OQKA 3TRZA 1AE2A 2BA0A 1OTCA 2KCTA 2I0QA 4Y52H 3PF5A 5IP9H 1QZHA 4TQUS 3CCVA 4X66L 2E8GA 4DV1L 1IBMQ 2PQAB 3CCSA 2E2IH 4BBSH 3FHWA 4AIMA 1V43A 4JI3Q 4X64L 2RHQB 4DR2Q 4A3EG 3RR5A 2KCMA 4GN5A 5M3MH 2N49A 1JMCA 4LF8Q 4X62L 2WFWA 1UEBA 3HOXG 5GADC 1TWHH 3J80i 1PH3A 3CD6A 5GAHC 4LF4L 1AH9A 5GAEC 1Q1BA 2I5MX 3HOUG 1VQ9A 2DUDA 3B6YA 3TS0A 2B63H 1VQHA 4JV5Q 3NBHB 3J81i 2ID0A 4IPGA 4GNXC 3G48A 2F52A 1JT8A 1VQ4A 1SE8A 1HR0W 2UUAL 3UDXA 4DR1Q 4X6AH 2MFIA 1HNZL 1CSQA 4QQBX 3CCMA 5M3FG 4LF7L 5IYDG 3CF5A 3CXCA 5IP7G 4DK3C 4JI2L 5IYCG 5FLMG 1X3GA 1VQAA 1HZAA 2GN5A 3F1ZA 4L5RC 3EN2A 1VQKA 1CKOA 3S2HH 1K83H 2VZAA 2VL6A 2AHOB 3K81C 1V1QA 3CCUA 4L5TA 4JI5Q 2R93G 3KDFB 4DV5L 3F2BA 1IBKQ 1N32L 1D7QA 1CKNA 4DAMA 2IX1A 4B3TQ 3GTPH 4A3IH 2CFMA 3CQZH 4FDBA 4P72A 1HR0L 3CCQA 5K36G 1U5KA 4A3EH 3D0FA 4JBKA 2R92G 4PZ8A 4UP8A 3GTMH 2Q2IA 2WAQG 3OTOL 1YITA 3HOXH 1B70B 2VNUD 3CW2C 2UUBQ 4DR6L 1HNWL 2IX0A 2R7ZG 3DLLA 1PV4A 1XNQQ 3PO3G 4IOAA 1HH2P 3HOUH 4NXMQ 2XTIA 3AEVA 4DKAC 2YTVA 4DV0Q 4LFCL 2VQEQ 4POFA 1X54A 3T1YQ 1NMFA 1V9PA 1BVSA 2E2JH 2K5HA
chains in the Genus database with same CATH superfamily
2F0HA 2RCFA 4YY3L 4PQXA 2XRQD 4UPAA 3S24A 2GVAA 5IP7H 1TT2A 4C3HB 2EYLA 2AQ1B 4X3TA 2K28A 3QJYA 1L2FA 3KF6A 2K33A 2MGSA 4DV7Q 2DGYA 1Q46A 4DR5Q 1Q12A 4P74A 2JXMB 1SJHD 4DV3Q 2UU9Q 3G71A 4DUYL 3HS0C 4RHSA 2R92H 3S17H 2JA6B 5KRUA 4NB3A 2KBNA 3S2HB 4MZ9A 3MXGA 1JE4A 4X3SA 5IWAL 2A8VA 1SSOA 1P8LA 4LAAA 4LF6L 1JORA 1O7LA 4TRDA 4NPSA 4NKLA 5JAVA 2N88A 3GTGB 3PF4A 1HA5A 1VF7A 1GUTA 2CHBD 3IFTA 2EY2A 3H0GH 5EPJA 4JI4L 2A1AA 4ME3A 1QZGA 3WDNA 2UXDL 4A3LG 1EEFD 1EYAA 4NDXA 4KY6A 4BXXH 1JQYD 4A3BB 4C2MH 1WOCA 1SR3A 3R93A 4B3SQ 3NTIA 4ID6A 3CCEA 2CKZB 5JPNC 2YU9H 2D0PA 1S4ZA 4OIKA 4JG2A 4O1NA 5E1FA 1PRTB 4DAYA 2VY3A 3KJPA 4N8X1 1Y1WH 4ZK9B 3NELA 5LMUQ 3D4DA 5IGEA 1KL9A 5IGDA 2HCIA 2RF4A 5FOBB 2NVTH 3RZOH 2ZXRA 1A2TA 3J80L 1PHJA 2NN6G 2BDOA 1I4HA 2WACA 1S5FD 2D62A 5GROA 1K28A 4JYAL 4KJOA 2Q2UA 5A35A 3NSWA 1QNKA 4A3GG 1F2MA 2VQFQ 2JA7G 1TWFH 1EY0A 4KKSA 2HQEA 2IY5B 1DONA 1JWUD 2F0GA 4PV1C 4DV6Q 1QE6A 4KHZA 2K7VA 4KV6A 4DUZL 4JBJA 4L63B 1FGBD 4KLKA 1N34L 1SDFA 4BA2I 3FPUB 1S72A 4G7OC 3RN5A 3RN2A 1JC7A 2VB2X 4IPHA 2A73B 2EYFA 1G6PA 3GTOH 1A3VA 3TQYA 4OX9L 4IFDH 5CV9A 4RKBA 4KJNA 4DNTB 3BDCA 1WTHA 5JEAG 3D31A 1HNXL 1E2VA 3QIAA 1LYLA 1EIGA 1EL0A 1EY7A 3HGBA 3URYA 4XQNA 1ESFA 3SK4A 2AKWB 2X6LA 4LK1C 4A3FG 5EKLA 1LLRD 2OQ0A 4R4CA 1EQVA 2KHIA 4P75A 4F87A 2BDNA 3K5MA 3EROA 1O7ZA 5FLMH 2OXPA 1LV9A 2K75A 1Y1VH 1QVCA 1SYCA 3IAYA 3HKSA 2A5HA 5A2QL 1X3FA 3CAMA 2X6GA 3HOWB 1HJPA 5KGUA 2QGQA 4ZUJA 1KRTA 2RKSA 4NMZA 1JR0D 4LNQA 3WOFA 5C4XG 1YEZA 4PMWA 3U4VA 3KLRA 2ES2A 1NMGA 1ESRA 4WFN3 4FXGC 5D14A 1ONLA 1IBKL 2Z6KC 2D2CC 4A3IB 1U4LA 5CV4A 3H6MA 4HSPA 3STBD 2KQ3A 3TEHB 1PH7A 3C3LA 1NAPA 2Z0SA 1YJNA 2FFKB 3HOUB 1NJIC 5C0XG 4DFAA 2ZTEA 3NXWA 3RZDH 4NXML 2VQEL 2K52A 4KD3A 2E2JB 2IJ0A 4NP5A 1GKHA 1SAPA 4FXKC 3CCLA 3PO2G 3D8GA 5IY0A 2UUAQ 1R9TH 3M85A 3PIP3 4K0KL 1TWCH 4LUVA 4JI8L 4JI2Q 3D6CA 3OW2A 4C3HG 1V1PA 2IL8A 4Y7NH 4JCVE 2F0VA 2MNAA 2D9UA 4K2KA 3N52A 3S1MH 2F0LA 1HCZA 2PO4A 4DV5Q 4A3CH 1BKBA 4C3JH 2PMZB 2R92B 3S17B 3JAML 3V2TA 1I50H 4HN7A 2JA6G 1EFID 2HQLA 4DR6Q 1TU2B 4A3LH 1TQOA 2J4XA 3M7NA 4CDCC 4LFCQ 2NN6I 3EFXD 3T1HQ 1PTOH 1LUZA 2JA8H 5ELCA 4YIJA 2QA4A 3ICEA 2C35B 2ICEC 4K14A 1G2TA 3AFPA 4DR7Q 2Z4HA 1B9MA 3U58A 2NWGA 2LXJA 1RDPD 5E4XA 4PMCA 3DM3A 1ILPA 4C2MB 2CWPA 1PZID 2YU9B 4JI0L 2Z6BA 1NE3A 4A3BG 2NVYH 4K6LA 1KTKA 4R4OA 3G6JB 1D5MC 2A69C 4AQYQ 1ENFA 3FVQA 1PH6A 3KBXA 5J39A 1Y1WB 1QVFA 2JJQA 1JJ2A 1PRTD 2WKCA 4PZ6A 4RCOA 5FLXE 1WTXA 3I4OA 2NVTB 3RZOB 1WCMH 4OXPA 1AP0A 2EYMA 5EQ0A 4Q5VA 2MUYA 1L0XB 1K8GA 1TXYA 3V96A 2B29A 1LO5D 5BR8Q 2DY7A 1RD9D 1N33Q 1E2ZA 2NVQH 3PSIA 1SMXA 1EY6A 1TWFB 3CRLC 4WJWA 4YCWA 1N8RC 3CP0A 1EOVA 1SNCA 3PCOB 3AB9A 1OXXK 1VQNA 1VQEA 4C1NI 3GTKH 4G4KA 1LTGD 1VQMA 4IPDA 2A6EC 3EVQA 3PUVA 2F0WA 4B9XA 4QUFA 2XIWA 3F8TA 3GTOB 4A3FH 1OXSC 1QVGA 1DZ1A 2LKVA 4YHHQ 2F4VL 2I5LX 3MXNB 4JI1L 4CDDC 4GOPA 4V190 5LL6X 2UXBL 1HFGA 2R3ZA 1YJ9A 4KHPQ 3AU7A 4GN3B 5ELBA 2JA5H 2ASBA 1A0IA 1EQQA 3PUYA 4HMJA 4XIGS 3DEOA 4LJZC 4XQQA 1XX8A 1Q3LA 3A8KE 4NXNQ 4KY7A 5C0XI 3K5OA 5L37A 2RHSB 1RIPA 5IODA 1Y1VB 1WTPA 2KENA 2UUCL 4TKOB 2KOLA 4QF4A 2JP1A 1S5CD 2KHSA 1YHQA 3NWTA 3SGIA 1CT1D 1GO3E 4RHRA 3M4OH 4JOIA 1EEID 1K73C 1FNUA 3HOWG 2DNCA 1F2LA 1HQMC 1A6XA 4HR7B 2VXWA 4KN7C 3FMCA 2EPBA 2BOSA 1K8AC 1VQOA 3GO5A 2NTSA 1MHWC 4X65Q 3IL8A 1LT5D 5I9OA 1AW7A 2KCTA 2I0QA 5IP9H 5CV5A 2E8GA 5K5PA 2PQAB 3CCSA 3TSSA 4AIMA 1V43A 1JMCA 4LF8Q 2KCMA 4X62L 1RKNA 3C46A 3O13A 1Z7TA 3CD6A 1CA6A 5GAHC 5GAEC 3RZDB 2O5JC 1Q1BA 3HOUG 3TS0A 3ZYYX 4GNXC 2Z9HA 3NP8A 1BDOA 4OELB 4AYBB 1R9TB 1STAA 1C8CA 1CSQA 4V0BA 2RVLA 5BN4A 2EY5A 3TP7A 5IP7G 4DK3C 2K32A 3MXNA 1D5XC 1VQAA 1X3GA 2GN5A 3F1ZA 4ZKCB 4EVOA 1SE3A 4XYOA 4L5RC 3S1MB 1QILA 3S2HH 1K83H 1KLGD 2AHOB 3K81C 1FYCA 1B1ZA 2K5QA 1LTRD 3VA7A 1N32L 4C3JB 2PZWA 4B3TQ 2CFMA 2L9HA 1VMPA 1U5KA 4A3EH 2R92G 4PZ8A 4XT3B 1IW7C 1YITA 4XXEA 3IFDA 3VR3A 3CW2C 3DLLA 5ELFA 4RKLA 2XTIA 4DV0Q 2JA8B 1T5EA 3NENA 2EYOA 1C0AA 4ZQ3A 1STGA 4LF5Q 1ZYRC 3I3CA 1QJOA 4IUVA 1RODA 5IYCH 5EAYA 5HGQA 4TVAB 3PGZA 5ELDA 2LMCB 2RSNA 1UAPA 2CH4A 1I94L 2OCEA 5IGCA 1PFBA 2M00A 1DD2A 4WJ4A 4IUPA 3OPOA 1J6QA 1WTOA 2NVYB 1N36L 2ATWA 2RBMA 1X65A 1E2WA 1YNNC 4G57A 4IJLA 2PQAA 1I6VC 4JC0A 4DV4Q 4GS3A 3W5OA 1PH2A 3BVMA 1CQVA 3PUXA 3GTPB 4X3KA 3MHBA 1WCMB 4LW1A 1TKWB 3P75A 5K36H 4G7HC 1YNJD 1A62A 5JOBA 5LL6S 3A7LA 1EY4A 1MIUA 2P5ZX 3NE5B 2NVQB 3A5ZB 2OWOA 2UXCL 1BBXC 4JBWA 1I4PA 4BA1I 3AYHB 3PV0A 4PG3A 1JOKA 3GTKB 2K5DA 3W1BA 1PMRA 2RSOA 2NVXH 1U4PA 1XXGA 1RL2A 3QOJA 1LABA 1IYUA 4R9WA 1Q86C 5KNBA 1I3QH 1XJVA 3I4MH 2PI2A 1FJGL 2ZM6Q 5E7NA 1D8LA 1KAWA 4IFDG 4JK1C 3U50C 1CQFA 4F7XA 1E0BA 2G5DA 5M5YH 1BQQT 2A68C 1II3A 2JA5B 4JI6Q 1EIHA 1M8AA 4A3DG 3BS1A 1SNPA 1SLJA 2PI2E 4N9PA 1SNMA 1LTLA 4DK6C 1BCPF 3SR1A 3TREA 2OTJA 1PYSB 3E0EA 2ENBA 3HOWH 1R4QB 1VQLA 1K0RA 1F9SA 1HZCA 1RCVD 4HJ9A 1Y1VG 1A63A 2MJ8A 2CH4W 4DR3L 4EQ5A 3KLWA 1G2SA 1MKHA 2M9VA 2IT1A 3W1GA 3R2TA 1ZEQX 3UI2A 4CGYB 3M4OB 5E3FA 4G7ZC 4FF4A 3VDYA 4GKJQ 4DV2Q 1EQRA 2BH8A 3E5SA 1O7YA 1I5FA 1VQ8A 1SN8A 3S1QH 1GUWA 3NPPA 4OWTB 2N8NA 4JPBW 4DF7A 2K04A 2TSSA 4Z9CB 3DXJC 2AUJD 4P2CB 3J7AF 4KKUA 1JOOA 1UWVA 2DJGC 3UDFA 4DR2L 2D0OA 1A8VA 5JEAJ 2N78A 1CZWA 4FO2A 4JV5L 4LFBQ 5IYBH 1EUJA 4YCVA 3CHBD 3OIQA 4DR1L 4N9TA 4AYBG 4MTKA 2CVRA 1QG7A 4ZCKA 5FO9B 1GJXA 5KYLA 1K83B 1EFWA 1BBWA 4PNYA 1BCPC 5CC4A 4JI5L 4YCUA 3A56A 2OTLA 4A3CG 3RD4A 3HFZB 2QEXA 4C3JG 2E5LQ 3TN2A 4A3EB 3ERSX 4JW0A 1Y14B 4OHJA 4GLVB 2F3WA 2O4XA 4X64Q 5LMNW 1LM0A 3IRBA 3ULLA 2UUBL 3C1EA 5IE8A 3LGJA 1DOMA 3T1YL 3H09A 4ZRZA 3TZUA 1D1KA 3MFYA 2ZJPA 3PIO3 3R2IA 5J22A 4CDEC 4ZKBB 5M3FB 2JA8G 3ND9A 2HCCA 1PTOD 4IZ8A 3J81c 1G91A 1MJCA 5CYUA 1SJED 1IXRA 2NUCA 1DGSA 1TY0A 1EIYB 1C48A 5C0XJ 4DV7L 1LTID 4DR5L 5IT9c 1RHPA 1VQBA 2KUMA 4WRDA 1DOKA 4DV3L 1P16A 1X32A 1S3OA 1Z47A 2B2VA 1VMCA 4I7AA 2UU9L 1CM9A 2SNMA 1VQJA 2L1BA 3PUZA 2PYKA 2WAQB 1F77A 2YTYA 3OTOQ 1M4VA 3R3OA 2Q2HA 3ULJA 3D3RA 1PH9A 4IFDI 2A6HC 5IOCA 3QO2A 1STBA 5ELOA 4C1NK 2E5LL 2DY8A 1WCMG 1RTOA 5J1ZA 3SDZA 1LTTD 1BCPB 1D5ZC 1EU4A 2K05A 5EGTA 4B3RQ 2K01A 1G291 2PZUA 4RGMA 2LSSA 3J7AV 4IUQA 1EY5A 2B2UA 1XTDA 1JE5A 1T5XD 1LT3D 4HIKA 3U4ZA 1TIID 3CC4A 2H4OA 2NVXB 3OWEB 3KF8B 5FO8B 4B3SL 2F0QA 2KCCA 1YBYA 3RMHA 3ULPA 1I3QB 3I8ZA 1B3AA 4J6HA 4A3DH 1EWHA 4BS9A 1JB7A 3I4MB 3UDGA 3A55A 5DLQE 4O2DA 3P20A 2Y0SB 5LMUL 2HHHQ 4KTAA 1A15A 1FL0A 3K58A 5M5YB 1CFMA 4FP5D 4QIWB 1FNWA 3NBIA 3VA5A 3J80E 2LY7A 2JA5G 4LF9Q 1ET9A 3N6RA 2ZTDA 2VQFL 3J81E 2C5CA 1E3PA 1E24A 3AFQA 3F2DA 4A3MH 1DXMA 2H1EA 4DV6L 1XMOQ 1FGUA 5GQOA 5CBEE 4R8IA 1YNND 5EKKA 1E22A 5CMDA 2BA1A 4NW2A 1VDZA 2SDFA 5IT9E 1TS4A 1H9RA 1Z9FA 1EWIA 3I91A 2CQAA 3KK7A 4B3MQ 1ICWA 1VF5C 2M2LA 5KNCA 5FLXc 4BY7H 3I4LA 1L1OC 3SK8A 3S1QB 4OIJA 3T13A 5LHY1 3J7YW 1CKNB 1XWEA 3S16H 4H44C 1VQCA 3MWYW 2L0CA 1EOTA 5JJIA 1DCZA 1QUQB 2H5XA 5J3BA 5IP9G 1K9MC 1LTBD 3I2ZA 1Q90A 1HNZQ 2B2YC 1YJWA 1VQ7A 4K5XA 1B4OA 1FR3A 2G9HD 1MD2D 1EZ8A 4CDFC 3EIVA 3KF8A 1ENCA 1SNDA 2XWJB 2LS01 1H9MA 3H3VC 1CZGA 3TP8A 1D1IA 1LT6D 3L3OC 4RFBA 2FINB 1XNRQ 5JJKA 1E1OA 5A2QE 4HJ5A 1U9RA 3UE0A 3FP9A 4PMBA 3DWQA 2LFNA 4E6IA 1U0LA 1J8IA 4EQNA 4R4TA 3M9BA 3LWEA 1I6HH 1PH4A 4UHVA 3NQIA 4U673 4R8NA 3TRZA 1AE2A 2QKIC 2WB1B 3DMUA 2BA0A 4DU9A 2L12A 1QZHA 3CCVA 2Q8RE 2BE5D 1IBMQ 3U9SA 4Q0FA 2QF7A 3BYYB 4A3EG 2KJXA 2RHQB 3VR4A 3RR5A 2WFWA 5GADC 1HPCA 1TWHH 3X3NA 2EE1A 3DHQA 4CHTB 1CK1A 2DUDA 1VQHA 3NBHB 2CW0D 4IPGA 4RWSC 1VQ4A 4IUTA 2UUAL 1HNZL 4QQBX 3K57A 3CCMA 5M3FG 3PMFA 3G7LA 1IHZA 5IYCG 4JI2L 1Z6HA 5HGTA 1B50A 5IGFA 3EN2A 5T1GA 4FXDA 2EJMA 2VZAA 4KN4C 1BR9A 3CCUA 1FNVA 3KDFB 4DV5L 1CKNA 3GTPH 4FDBA 3ITPA 3W3AA 1FD7D 4J8QA 1HQRD 3GTMH 2WAQG 3HOXH 3W2DA 4DR6L 2IX0A 3PO3G 1PV4A 1XNQQ 5E4WC 4DKAC 4LFCL 4K6DA 3K0YA 1V9PA 3T1HL 4LUZA 1IBML 4R4QA 1N9WA 1YI2A 2SEBD 2WKDA 1BOSA 3QWNA 1Q7YC 1BCPD 1TY2A 4MHEA 3VYSA 1NUCA 3KLSA 4DR7L 1E1TA 4MN3A 3OHXC 1JOQA 4QCLA 2D5DA 4HIMA 4APVA 4LFAQ 1QCBD 1VQFA 3HZXA 4C3IH 1DYQA 4KHVA 1VQGA 1X56A 5COYA 3GTLH 1JCKB 4AQYL 4A3DB 1J5EQ 5ELNA 3SVMA 2PMZE 1XTCD 2EOTA 3BZCA 4RMFA 1A3TA 3I4MG 2MO1A 2Z6KA 2ZTCA 2OF1A 3KOJA 4QMGA 2F0PA 2QILA 2Y0SG 4H02A 2F0SA 4GN4B 2AQ3B 2WB1E 2TMPA 3ER0A 5TSSA 4DR4Q 2F0KA 2B2TA 2HIXA 1A2UA 1KABA 5KYIA 1X3EA 4DA2A 5BR8L 4DAPA 2EYHA 1ASZA 1IZ6A 1N33L 1IBLQ 4S3SA 4BY1H 1MSHA 1KDBA 3FKIH 4A3MB 2EDGA 2EY1A 3E9IA 3HOZH 3PQIA 4GKKQ 2EXZA 1SYGA 1O78A 1GXDC 3PUWA 3PIPA 4QUCA 2ZXOA 3E3XA 1WYDA 1JJGA 3S9WA 3K8AA 1J9OA 1PYBA 3OOCA 2PW5A 3RNUA 4YHHL 2I07B 3NWSA 1B53A 2A74C 4JVZA 4DNRB 1XMQQ 4BY7B 3K7AH 1DM0B 2B2WC 2JK8A 4OWWB 2RDFA 1DJRD 4KHPL 3H94A 3S16B 1S5BD 1IL8A 1CKMA 1B8AA 1S5ED 4RGOS 1Q81C 4NXNL 3K59A 1Q1EA 4IFDJ 2KHJA 4OO1H 4HJAA 2FMCA 4CKEA 1AFPA 3NHHA 2V1CC 4L5SA 1G8ZD 1VS0A 4DGZA 5I9PA 4RGTA 3S14H 2K5WA 3J7A5 5C4JH 3HOYH 3GDEA 4LUOA 3KUPA 2EYJA 2F3IA 3JC66 1S5DD 1YVCA 5IYBG 3I7FA 3CCJA 1VCIA 2QCPX 4L6TB 2XNAC 5C3EH 1AZQA 1XYIA 3X3MA 3J7ZC 1I6HB 2GA4B 3T51B 3DEPA 4X65L 2E2DC 4CJ1B 4M1UB 3NTHA 2XGTA 1M90C 4ALPA 4XTCS 1LACA 2WB1G 2PW7A 3NK9A 3I55A 3DM1A 3I56A 3A74A 1SE2A 1BF4A 1PLFA 2JN4A 5M3FH 4HJ8A 4LF8L 1B2TA 4R1JA 2L55A 1TWHB 3L2PA 1S40A 1STHA 3HOVB 3KJOA 1GUGA 4MIUA 5LMNQ 2JQOA 3P1HA 2I46A 4YWKA 1GUOA 4U68A 1UNSA 3DUZA 3LX0A 3Q22A 3Q23A 1EU3A 5AJ3Q 4KD4A 4GNXB 2QEJC 3AQQA 1MGSA 3OMGA 2J0TD 3PO3H 2F4IA 3HP3A 3CCRA 2CCZA 4A75A 5BN3A 1I4RA 4B3TL 1STYA 5BN5A 4X66Q 4ZAIA 1YIJA 4DV1Q 3KYHC 3A54A 3GTMB 3HOXB 3E0JA 1MSGA 2F0FA 2FHTA 5G3LF 5CV6A 3S2DH 1GM5A 1LTSD 2KEDA 4LF4Q 5D3IB 3H91A 1I4XA 3OWFA 1HZ9A 4DV0L 3S1NH 1W6JA 5C4HA 3ERQA 4M8AA 1RF2D 1F2YA 1AE3A 4UAIA 5F2DA 5I2YA 1JJCB 2CWAA 4LF5L 3ZJYC 2FJ2A 4TSSA 3STBC 2BCOA 2QDBA 3V05A 5C44H 1U4RA 1MBYA 1SMYC 4AYBE 3NTKA 2NZ1D 4XDXA 5LMNL 3I4NH 2YV5A 3C1FA 3GV6A 1EYDA 1FVIA 1CUKA 1NNXA 2R7DA 1XPUA 1UE7A 3CU7A 5C3XA 4C3IB 1VQDA 3M3YH 3GTLB 1EQTA 3GTJH 1HR0Q 1KDAA 1KLUD 3BDOA 1PH1A 3KF6B 2PNRC 1PRTF 4DV4L 2PQEA 2KCNA 3IKJA 3I73A 2IHFA 1HNWQ 2JEBI 4IALA 1F9PA 3G6EA 4K5VA 5FO7B 2KECA 2A69D 4IURA 4YY3Q 2F0NA 4CBVA 2OEOA 5T1IA 1UE1A 4XQJA 2K50A 3M4QA 2ZXPA 1K3RA 3K6OA 3CMAA 4BY1B 1TWAB 3NEMA 3FKIB 4HAEA 4MTNA 1SYDA 5NUCA 2HDMA 5CBAE 4GNXA 3HOZB 3SEBA 3KFUA 3KLSX 3MTSA 4A3MG 3D6WA 1W2BA 2AUKA 2ALYB 4A93B 1HA6A 3BU2A 4DUYQ 5HY6A 2XVSA 4HIOA 3NUCA 3MVVA 1UE5A 1V8QA 2ZM6L 1WTWA 1Q82C 5DM63 1NBWA 2BH2A 5IWAQ 1X3PA 5KNDA 3K7AB 2NTTA 4WJ3M 3SE0A 1TR5A 4LF6Q 2AWNA 4BY7G 2A6ED 1PDQA 4DAYB 1CI3M 1ET6A 1K3BC 2KA7A 2HIVA 4JI6L 4L8JA 4L5QA 1F9QA 2RCNA 3FRPB 3BVZA 1RTNA 4ZUIA 4JI4Q 2N55A 4PZ7A 4QGUA 1IYVA 2UXDQ 3CRKC 1IL2A 1IKLA 2F0UA 1PRTC 2N3SA 3K5LA 2K14A 2EXDA 1KQSA 4RG1A 1ASYA 3S14B 1SYBA 2EY6A 5C4JB 3HOYB 1I4GA 5EKIA 5C5LA 1JB3A 5DAUA 4QB4A 2ICIA 4AH6A 3H15A 3F2CA 1NR4A 3HG9A 1SXTA 2SOBA 5C3EB 4GKJL 4RAUC 4DV2L 1Y8PB 1WI5A 3MXPA 2F1MA 1PZJD 2JSOA 3LNNA 3S15H 3EQLC 2DN8A 2QDLA 3Q0AA 4GLAC 2IHEA 2SNSA 2QW7A 3J80c 4JYAQ 2J7ZA 1G6ZA 4UP9A 4HTHA 3FEWX 3H3VI 3A8JE 1WFQA 1DOLA 4A3KG 2CQOA 3MZ5A 1JICA 4I7ZC 3EJIA 4KI0A 4DUZQ 2I5HA 3HOVG 1N34Q 2ZJQA 4LFBL 4RA8A 1W3SA 4ZLTF 3I90A 2F0MA 4DXFA 4EGVA 1KC8C 1BUVT 4O0AA 1HTPA 3K0XA 4OX9Q 2IWHA 4HCEA 2NYZD 4WORA 4BBRH 1BBUA 1X6OA 5I6YA 5FJ8H 4J15A 1MJEA 3H3VH 3M7GA 3PO3B 3MEHA 1KAAA 4DN4M 2VUMH 1HNXQ 4XYQA 2F3VA 2VB3X 4A3JB 3T16A 4FYDA 3PF5A 2NBFA 5EJWA 4BBSH 4HSVA 4RGNA 2E2IH 2O5IC 3FHWA 4JI3Q 4X64L 3OSOA 4GN5A 2N49A 5M3MH 2X69A 3S2DB 3HOXG 2RDHA 1ZXTA 4KKTA 3J80i 4ABNA 1B44D 3FPPA 3R8BA 1PXUA 3S1NB 4KK7A 1R4PB 3B6YA 4UDUC 3J81L 2B63H 5EBCA 3J81i 3QB3A 3G48A 1JT8A 1HR0W 1SE8A 2E74C 3UDXA 1IW7D 5C44B 3HRZC 3CF5A 4B08A 3I4NB 4OL7A 5IT9L 1VQKA 1WD1A 1WTQA 4ME5A 2VL6A 1V1QA 2K6AA 4L5TA 1IBKQ 1NR2A 1UEAB 1ZYRD 3M3YB 3CQZH 3GTJB 1GHKA 1V1PB 1AEXA 4P72A 2G9DA 3EA6A 3TP5A 3CCQA 3A8IE 4C3IG 5K36G 2Q2IA 3HEJA 3OTOL 1B9NA 2HUGA 1EY9A 2B39A 3LWUA 1CHQD 1BO0A 3HKZB 4NXMQ 3AEVA 2F0IA 2YTVA 3WOEA 2VQEQ 1X54A 5KIXA 5EPLA 1K8MA 3CC7A 2Z4IA 4JI3L 4JI7Q 4B3RL 1ZKOA 4IOCA 5IYDH 3TDQA 4HJ7A 1UE6A 1GUSA 4K0KQ 3BZDB 5GAGC 4JI8Q 2C9OA 3RLOA 5M5XH 1AZPA 4BY1G 5M9OA 2MP1A 2R93H 3KBGA 3BDLA 1M1KC 1Y8OB 3FKIG 3HOZG 3RLFA 3D4WA 2NB0A 4A93G 5C3WA 4GOPC 4K2LA 2Q8IB 3AMUA 3ONAB 3GV3A 2EYPA 2XN9C 1D6EC 2MO0A 3DWPA 2R7ZH 1QWYA 2WAQE 3JAMc 2WIIB 3TP6A 4YWLA 2HHHL 2NZOA 2EJFC 5I2XA 1SEBD 1XPRA 5C6AA 2E2HH 1SMYD 2ZT9C 3DWAA 2JA9A 1TS2A 2B2TC 2KEEA 4LF9L 1SFOH 3SK5A 5C4ZA 1WVLA 3BVGA 1TS5A 4IPCA 3PIOA 4RCNA 2EJGC 1XMOL 2A68D 4JOIC 4OO1G 2VW9A 1PYWD 4JI0Q 4JI7L 1ENAA 1KD1C 3CMEA 1YNJC 3HOYG 2GVBA 3OMCA 1JWSD 5FLXL 4H0LC 4B3ML 4HMIA 4CKCA 3WWVA 5C3EG 1NCVA 4A3KH 4DXGA 1I4QA 3MEFA 3S1RH 3S15B 5CR3A 1B7YB 2Y0SE 3JAMi 1PVOA 3CKIB 1T9HA 3UDIA 3A5UA 3HOVH 1Q8KA 4DNIA 4ODGA 4QIWE 5CV8A 2K1BA 1TWGH 1IYJB 1L1OB 3CPFA 5G3LD 4GOPB 4K5WA 2HDLA 2YTXA 3NQTA 1HTLD 1K0SA 3HKZE 1HUNA 1CA5A 1HRJA 3SK6A 1OXUA 4XT1B 2WV6D 2F03A 4FNFA 3M4PA 1WTVA 3VR6A 3H0GB 1H9JA 3RUZA 1PH8A 1HZBA 2K5VA 3E6ZX 1C7YA 2IW3A 4EX5A 1Y8NB 1XNRL 3Q6SA 1YZ6A 1EYGA 3I72A 2F4VQ 2B3GA 4I65A 3QR8A 4BBRB 4JI1Q 1F9RA 1QUQA 1XPOA 1QB5D 1C4QA 1X3QA 3JAME 2VUMB 2UXBQ 2WINB 2NN6H 4K8IA 2JYOA 4HEDA 1VQ6A 3VR2A 2E76C 1Y69U 3TS2A 4QY7A 5M5WH 5CGKA 4K8JA 1SROA 3K5NA 4A3GH 2NZHA 2XWBB 2JA7H 4BBSB 3RLNA 4A3JG 4CKBA 2E2IB 3Q8DA 4X3UA 4F88A 4N8FA 5M3MB 2IPKD 1SNQA 2B8GA 2PCFB 1KHIA 5DNFA 2HD3A 2UUCQ 2B63B 2F0OA 4EQOA 2YYZA 1PTOF 2EVBA 3GQBA 4H13C 1KNAA 1NTGA 1PA6A 5I6WA 2R6GA 4IJHA 3L7ZC 1SRUA 3GTQH 1STEA 5C44G 5JPMC 5JEAH 1ICFB 4JBMA 3I4NG 1GVPA 3GD7A 3T56B 5HURA 1HFNA 1KIXA 2Z1CA 3L0OA 4ILWA 4MNOA 1WJJA 4FF3A 3MC0B 4P71A 3CQZB 2OT2A 4POGA 4EQPA 3NBHA 5H1SE 1L1OA 4FF2A 2RQXA 1AN8A 3D4RA 4X62Q 3SXHA 3GP7A 1XNQL 2RDGA 1TWAH 4P73A 3HKZG 2EZVA 1WTRA 2EQSA 4CJ0B 2B2YA 3T53B 1JWMD 4YWMA 1NSNS 3E9HA 3KDFA 4A93H 1K8OA 2F0JA 5ISRA 2F0EA 1X9NA 1GOZA 5C4XH 4OONA 2IX3A 5M5XB 2ZJRA 4DPGA 1CHPD 2A6HD 2R93B 4OEMB 1SYFA 4OO1I 1L0YB 4LFAL 4OWXB 2F0TA 3EBEA 3TMEA 1N32Q 1Q8IA 5IGGA 1IKMA 4R4IA 1UUPA 2MPMA 2FXQA 1J5EL 1YHBA 1PTOC 3VR5A 3I70A 2R7ZB 4CJ2C 1VQPA 5C0XH 1G51A 1VQIA 1PFNA 1PH5A 4GLXA 2Q8TA 2XSCA 1D2BA 2MHVA 4A3IG 2E2HB 3PO2H 2A19A 1F2ZA 1EYCA 4DR4L 1WD0A 2AWOA 1O7IA 1SFOB 4C3HH 1HHVA 1H95A 1GUNA 2PZTA 1VQ5A 1IBLL 1SNOA 1I94Q 3CC2A 4F8MA 1PFSA 3BG3A 5EBDA 4GKKL 2K4KA 1PZKD 4RH6A 5JVH3 2PNHA 4KMUC 3QOLA 4QJFA 1CSPA 1TWCB 2KVMA 1EY8A 2L15A 2R61A 1OXVA 4DK0A 3M4YA 4Y7NB 1N36Q 4IQZA 2MQHA 4HIDA 2JA6H 2Q2TA 3K7UC 1KDCA 1RJTA 1ML0D 4A3KB 2HT1A 4A4IA 1XMQL 3S1RB 2VS1A 4UY8C 3VYUA 2JE6I 4O42A 1TVXA 1KXLA 1U4MA 1BNZA 3P7JA 5DM73 1I50B 5I4DA 3MXUA 1LTAD 3GTGH 1W6KA 3L9AX 1TWGB 3BZKA 2FMMA 2UXCQ 1EZ6A 1PFMA 2AQ2B 1C9OA 2PPBC 1H9SB 1PTOB 1YHAA 4KY5A 4LWCA 2Z8LA 2R7FA 3J81j 3VYRA 1OO9B 2XRSD 1YNXA 4UP7A 1L0WA 3UE1A 3FDTA 4A3BH 5EPKA 5JJLA 1B3QA 3OYYA 4ULLA 1GHJA 1MI2A 3VYTA 3BJUA 3H0GG 2K03A 4A76A 3A7AB 3U9OA 5JVG3 4HCSA 1FJGQ 1O80A 3A0JA 3F2UA 4A3JH 4BXXG 3G4SA 5AFWA 4FF1A 4BBRG 3CPWA 1A3UA 5FJ8G 4H7BA 2RA4A 2AMCB 3Q24A 4IO9A 1H9KA 1TS3A 2VUMG 5M5WB 5FK9C 4A3GB 1Y1WG 2JA7B 2EIFA 2O2LD 1QOHA 4BBSG 4IUNA 4LF7Q 1OXTA 5M3MG 4QL5A 2F0DA 1NY4A 5D65A 3C2PA 5CV7A 4DR3Q 4DK1A 2DJFC 3K80C 2B63G 1EWCA 1CTMA 1EIFA 2K5NA 2L5TA 1E7ZA 4LMQD 1V1OA 3GTQB 2LXKA 3MA2B 2JEAI 2B2VC 5IGBA 3MFGA 1KRSA 5AJ3L 3QG1A 4DAVA 2DNEA 2WP8J 1X55A 5DEHA 4ZYSA 2L4NA 1GD7A 1KNEA 2OQKA 2E75C 4FVMA 4A3FB 3ND8A 1OTCA 4Y52H 2B8FA 1SBBB 5C5MA 4TQUS 4OGQC 5FKAC 4X66L 4DV1L 2B2WA 3OIPA 4DR2Q 1H9SA 1UEBA 5JJZA 1PH3A 4BWGB 4B9WA 4LF4L 1AH9A 4GZYC 1ILQA 2I5MX 2B2UC 1VQ9A 5KEEA 4JV5Q 1HXYD 2ID0A 1BXTA 1STNA 2F52A 1HUMA 4DR1Q 4X6AH 1SE4A 2MFIA 4C56C 4J1MA 4LF7L 5IYDG 1SYEA 5C4XB 3CXCA 2BE5C 3TZDA 5FLMG 3OW7A 1HZAA 1CKOA 1LT4D 5IIFA 2R93G 4JI5Q 1D7QA 3F2BA 3TBIB 4DAMA 2IX1A 4IN3A 4A3IH 5D3DA 3SHLA 2CW0C 1HR0L 4IUUA 3D0FA 1QNUA 4JBKA 4UP8A 3MAQA 1B70B 2VNUD 2V4DA 2UUBQ 5CORA 1HNWL 2R7ZG 4IOAA 1HH2P 3HOUH 3T4AC 3BYTB 4POFA 5ELEA 3T1YQ 1NMFA 2E2JH 1BVSA 3PO2B 2K5HA 2L11A
chains in the Genus database with same CATH topology
3NENA 4LUZA 3CC7A 1IBML 4YY3L 1C0AA 4R4QA 1N9WA 4UPAA 4JI3L 3S24A 1YI2A 2GVAA 4IOCA 4JI7Q 4LF5Q 4B3RL 5IYDH 5IP7H 1Q7YC 4HJ7A 1UE6A 5IYCH 5EAYA 4K0KQ 5GAGC 4JI8Q 4DR7L 1E1TA 5HGQA 4TVAB 3PGZA 3RLOA 5M5XH 1L2FA 3KF6A 1I94L 4BY1G 4HIMA 2OCEA 2R93H 1M1KC 4DV7Q 4APVA 3FKIG 2DGYA 1Q46A 4LFAQ 4DR5Q 3HOZG 4WJ4A 3RLFA 1Q12A 4P74A 1J6QA 1VQFA 4DV3Q 2UU9Q 3G71A 4DUYL 4A93G 4GOPC 4C3IH 1VQGA 1X56A 3GTLH 1N36L 2R92H 4AQYL 2ATWA 3S17H 1X65A 1J5EQ 4IJLA 5ELNA 2PQAA 4JC0A 2PMZE 3BZCA 2MO0A 2KBNA 4NB3A 4RMFA 4MZ9A 4DV4Q 2R7ZH 2MO1A 2WAQE 3JAMc 3I4MG 2Z6KA 2ZTCA 4GS3A 3W5OA 1PH2A 5IWAL 2A8VA 3KOJA 3PUXA 1P8LA 4YWLA 2HHHL 2NZOA 4LF6L 2Y0SG 4LW1A 4NPSA 4H02A 1XPRA 4GN4B 2E2HH 3PF4A 1A62A 2WB1E 3ER0A 4DR4Q 2JA9A 2HIXA 1MIUA 1X3EA 5BR8L 4LF9L 1SFOH 1ASZA 1IZ6A 3H0GH 1N33L 4JI4L 3A5ZB 1IBLQ 2OWOA 2UXCL 2A1AA 4BY1H 4ME3A 1QZGA 4JBWA 2UXDL 4A3LG 3FKIH 3HOZH 3E9IA 4IPCA 3AYHB 4BA1I 3PIOA 3PV0A 4PG3A 4GKKQ 4BXXH 1XMOL 3W1BA 1WOCA 1SR3A 4C2MH 4B3SQ 4JOIC 3CCEA 2VW9A 2NVXH 4JI0Q 4JI7L 4OO1G 2CKZB 2YU9H 3PUWA 3PIPA 2D0PA 1RL2A 1KD1C 1JJGA 1WYDA 3CMEA 1Q86C 3K8AA 1I3QH 3HOYG 4JG2A 1XJVA 2GVBA 1PYBA 2VY3A 3KJPA 3I4MH 2PI2A 1Y1WH 1FJGL 2ZM6Q 3RNUA 4YHHL 4B3ML 5E7NA 3NELA 3WWVA 1D8LA 5C3EG 5LMUQ 4A3KH 1KAWA 1XMQQ 1KL9A 3MEFA 4IFDG 2RF4A 3K7AH 3S1RH 3U50C 2JK8A 4OWWB 2NVTH 1B7YB 3RZOH 1PHJA 2Y0SE 5M5YH 4KHPL 3JAMi 1PVOA 2NN6G 4JI6Q 4A3DG 1T9HA 3UDIA 3A5UA 3HOVH 1Q8KA 4DNIA 1CKMA 2D62A 4QIWE 5GROA 4JYAL 2Q2UA 1B8AA 1TWGH 1IYJB 1L1OB 1SLJA 2PI2E 3CPFA 4GOPB 1Q81C 4A3GG 1LTLA 2VQFQ 2JA7G 2YTXA 1TWFH 4NXNL 4DK6C 3TREA 2IY5B 2OTJA 1Q1EA 1PYSB 3E0EA 4IFDJ 2KHJA 3HOWH 4DV6Q 3HKZE 4HJAA 1VQLA 4KHZA 1OXUA 4DUZL 1K0RA 4JBJA 2V1CC 4L5SA 1VS0A 3M4PA 3S14H 1HZCA 3J7A5 4HJ9A 1Y1VG 1A63A 4KLKA 5C4JH 4DR3L 1N34L 1PH8A 3HOYH 1HZBA 4EQ5A 2K5VA 3KLWA 1C7YA 3GDEA 4LUOA 1S72A 1MKHA 4BA2I 2F3IA 2IT1A 3JC66 4EX5A 3RN2A 3W1GA 3RN5A 1XNRL 1YVCA 4IPHA 5IYBG 1YZ6A 3I7FA 1G6PA 3GTOH 3CCJA 1VCIA 3TQYA 3VDYA 1EYGA 4GKJQ 2F4VQ 2B3GA 4OX9L 5C3EH 4DV2Q 1EQRA 2BH8A 4JI1Q 1QUQA 1XPOA 3J7ZC 1I5FA 1VQ8A 1SN8A 5JEAG 2UXBQ 3T1HL 1VQ6A 3S1QH 3D31A 4OWTB 1HNXL 1LYLA 2N8NA 4X65L 3TS2A 4QY7A 2XGTA 5M5WH 1M90C 4ALPA 2AKWB 1SROA 4XTCS 4A3FG 2WB1G 4A3GH 2NZHA 3I55A 3I56A 2JA7H 3RLNA 3A74A 4A3JG 2OQ0A 3Q8DA 4R4CA 2KHIA 1UWVA 4P75A 3UDFA 5M3FH 4HJ8A 4DR2L 4LF8L 4R1JA 3L2PA 1VQNA 2D0OA 1S40A 5FLMH 1KHIA 1A8VA 5JEAJ 2K75A 2N78A 3KJOA 1Y1VH 5LMNQ 1QVCA 2UUCQ 2JQOA 4JV5L 2YYZA 3HKSA 4YWKA 4LFBQ 5IYBH 1EUJA 1X3FA 3CAMA 1NTGA 4YCVA 1PA6A 4DR1L 2R6GA 4IJHA 3L7ZC 1HJPA 1SRUA 3GTQH 2QGQA 4AYBG 1KRTA 5C44G 4LNQA 5C4XG 5AJ3Q 1YEZA 4GNXB 3AQQA 4JBMA 4PMWA 3I4NG 1GVPA 3GD7A 3U4VA 2ES2A 1EFWA 1BBWA 1NMGA 1KIXA 3CCRA 3PO3H 4JI5L 3L0OA 4YCUA 2CCZA 1IBKL 4MNOA 2Z6KC 1WJJA 4P71A 2OTLA 4A3CG 4A75A 4B3TL 3HFZB 3STBD 2QEXA 3TEHB 2E5LQ 4X66Q 4POGA 1YIJA 3ERSX 4DV1Q 3KYHC 5H1SE 1L1OA 1Y14B 4GLVB 4X64Q 1PH7A 5LMNW 1LM0A 2Z0SA 3IRBA 4X62Q 1YJNA 3ULLA 1GM5A 2UUBL 3S2DH 1XNQL 1NJIC 5C0XG 4LF4Q 2ZTEA 5IE8A 3RZDH 4NXML 1TWAH 1HZ9A 3LGJA 4P73A 4DV0L 2VQEL 3S1NH 2K52A 3HKZG 3T1YL 2ZJPA 2EQSA 1AE3A 1GKHA 3CCLA 3PO2G 1JJCB 2JA8G 2CWAA 4YWMA 3ZJYC 5IY0A 2UUAQ 3KDFA 3E9HA 3J81c 4LF5L 1R9TH 1MJCA 4A93H 3STBC 5C44H 3M85A 1X9NA 4K0KL 1TWCH 5C4XH 4LUVA 4JI8L 4JI2Q 1IXRA 4OONA 3OW2A 4AYBE 1DGSA 4Y7NH 2ZJRA 5LMNL 4JCVE 2MNAA 2YV5A 1EIYB 4DPGA 3I4NH 5C0XJ 4OO1I 1FVIA 4DV7L 1CUKA 4LFAL 4DR5L 3S1MH 5IT9c 4OWXB 4DV5Q 3EBEA 4A3CH 1N32Q 1VQBA 2R7DA 4DV3L 1XPUA 1P16A 1Z47A 1S3OA 1UE7A 1BKBA 4C3JH 2UU9L 4R4IA 1VQDA 3M3YH 1VQJA 3PUZA 3GTJH 1HR0Q 2FXQA 1PH1A 3KF6B 1I50H 1J5EL 1YHBA 2YTYA 3OTOQ 4DV4L 2JA6G 2Q2HA 3ULJA 1VQPA 1PH9A 4IFDI 2HQLA 2IHFA 4DR6Q 1G51A 1VQIA 1HNWQ 1PH5A 2JEBI 4GLXA 4A3LH 3G6EA 3M7NA 4LFCQ 2NN6I 5ELOA 3T1HQ 4A3IG 2E5LL 3PO2H 1LUZA 1WCMG 2JA8H 2A19A 4YY3Q 4DR4L 2QA4A 4B3RQ 2AWOA 3ICEA 1O7IA 2C35B 1G291 1UE1A 2K50A 3M4QA 4C3HH 3AFPA 2LSSA 1H95A 4DR7Q 1K3RA 1VQ5A 1IBLL 3CMAA 3NEMA 1XTDA 1JE5A 4HIKA 3U58A 4MTNA 1I94Q 2LXJA 3U4ZA 3CC2A 1PFSA 4GNXA 3CC4A 3KFUA 3DM3A 4GKKL 2K4KA 2CWPA 4A3MG 3KF8B 4B3SL 1W2BA 2ALYB 4JI0L 2PNHA 1NE3A 4A3BG 4QJFA 3BU2A 1CSPA 2NVYH 4DUYQ 5HY6A 1YBYA 3ULPA 2L15A 4HIOA 1OXVA 4R4OA 1N36Q 4AQYQ 1UE5A 4A3DH 2MQHA 4HIDA 1JB7A 2Q2TA 2JA6H 1PH6A 1QVFA 3UDGA 3K7UC 2JJQA 1JJ2A 2ZM6L 1Q82C 5DLQE 4PZ6A 1NBWA 4O2DA 2BH2A 5IWAQ 2HT1A 4A4IA 5LMUL 1XMQL 4WJ3M 3I4OA 2VS1A 4UY8C 2HHHQ 4LF6Q 2JE6I 1WCMH 2AWNA 4BY7G 1FL0A 1KXLA 4OXPA 4DAYB 3GTGH 2HIVA 4JI6L 4L5QA 1TXYA 1K8GA 2B29A 2RCNA 5BR8Q 2JA5G 4LF9Q 1N33Q 3BZKA 4JI4Q 2NVQH 1SMXA 3PSIA 2UXCQ 2ZTDA 4PZ7A 4YCWA 4QGUA 1C9OA 2VQFL 1N8RC 1E3PA 2UXDQ 3CP0A 1E24A 1IL2A 1EOVA 3AFQA 1YHAA 3F2DA 4A3MH 3PCOB 1OXXK 4LWCA 2R7FA 3J81j 2N3SA 1FGUA 4DV6L 1VQEA 1YNXA 4UP7A 2K14A 5GQOA 2EXDA 1L0WA 3UE1A 1KQSA 4RG1A 1ASYA 3GTKH 4A3BH 5JJLA 3OYYA 1E22A 1VQMA 4IPDA 2BA1A 3PUVA 3BJUA 1Z9FA 3H0GG 4AH6A 3H15A 3F2CA 4A76A 1EWIA 3F8TA 4A3FH 1OXSC 1FJGQ 1QVGA 3A0JA 4GKJL 4YHHQ 4B3MQ 2F4VL 4A3JH 4DV2L 2I5LX 3MXNB 4JI1L 4BXXG 1WI5A 3G4SA 1XMOQ 4BBRG 5FLXc 4GOPA 4BY7H 3CPWA 3S15H 5FJ8G 1L1OC 2AMCB 2UXBL 4IO9A 1YJ9A 4KHPQ 4GN3B 1CKNB 2VUMG 3S16H 4GLAC 2IHEA 1VQCA 2JA5H 2ASBA 1A0IA 1EQQA 3PUYA 3J80c 4XIGS 4JYAQ 5JJIA 1Y1WG 1QUQB 2EIFA 4UP9A 2H5XA 5J3BA 3H3VI 5IP9G 1K9MC 1WFQA 3I2ZA 4NXNQ 4A3KG 4BBSG 2CQOA 5C0XI 1HNZQ 1YJWA 1VQ7A 4LF7Q 4KI0A 1OXTA 2RHSB 5M3MG 4DUZQ 1RIPA 4QL5A 2KENA 3EIVA 2UUCL 1NY4A 2I5HA 3HOVG 4DR3Q 1N34Q 3K80C 2ZJQA 2B63G 4LFBL 1EIFA 1W3SA 1YHQA 1XNRQ 2K5NA 5JJKA 1E7ZA 1E1OA 3SGIA 1KC8C 1GO3E 2LXKA 3M4OH 4O0AA 4HJ5A 4JOIA 3K0XA 3UE0A 3FP9A 1K73C 4OX9Q 2JEAI 3HOWG 4BBRH 1BBUA 1X6OA 1KRSA 5AJ3L 5FJ8H 1U0LA 2WP8J 4J15A 1MJEA 3H3VH 1X55A 4R4TA 3M9BA 1I6HH 1PH4A 2VUMH 1HNXQ 1K8AC 1VQOA 3GO5A 1GD7A 4X65Q 2OQKA 3TRZA 1AE2A 2BA0A 1OTCA 2KCTA 2I0QA 4Y52H 3PF5A 5IP9H 1QZHA 4TQUS 3CCVA 4X66L 2E8GA 4DV1L 1IBMQ 2PQAB 3CCSA 2E2IH 4BBSH 3FHWA 4AIMA 1V43A 4JI3Q 4X64L 2RHQB 4DR2Q 4A3EG 3RR5A 2KCMA 4GN5A 5M3MH 2N49A 1JMCA 4LF8Q 4X62L 2WFWA 1UEBA 3HOXG 5GADC 1TWHH 3J80i 1PH3A 3CD6A 5GAHC 4LF4L 1AH9A 5GAEC 1Q1BA 2I5MX 3HOUG 1VQ9A 2DUDA 3B6YA 3TS0A 2B63H 1VQHA 4JV5Q 3NBHB 3J81i 2ID0A 4IPGA 4GNXC 3G48A 2F52A 1JT8A 1VQ4A 1SE8A 1HR0W 2UUAL 3UDXA 4DR1Q 4X6AH 2MFIA 1HNZL 1CSQA 4QQBX 3CCMA 5M3FG 4LF7L 5IYDG 3CF5A 3CXCA 5IP7G 4DK3C 4JI2L 5IYCG 5FLMG 1X3GA 1VQAA 1HZAA 2GN5A 3F1ZA 4L5RC 3EN2A 1VQKA 1CKOA 3S2HH 1K83H 2VZAA 2VL6A 2AHOB 3K81C 1V1QA 3CCUA 4L5TA 4JI5Q 2R93G 3KDFB 4DV5L 3F2BA 1IBKQ 1N32L 1D7QA 1CKNA 4DAMA 2IX1A 4B3TQ 3GTPH 4A3IH 2CFMA 3CQZH 4FDBA 4P72A 1HR0L 3CCQA 5K36G 1U5KA 4A3EH 3D0FA 4JBKA 2R92G 4PZ8A 4UP8A 3GTMH 2Q2IA 2WAQG 3OTOL 1YITA 3HOXH 1B70B 2VNUD 3CW2C 2UUBQ 4DR6L 1HNWL 2IX0A 2R7ZG 3DLLA 1PV4A 1XNQQ 3PO3G 4IOAA 1HH2P 3HOUH 4NXMQ 2XTIA 3AEVA 4DKAC 2YTVA 4DV0Q 4LFCL 2VQEQ 4POFA 1X54A 3T1YQ 1NMFA 1V9PA 1BVSA 2E2JH 2K5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEN A;  4LUZ A;  3CC7 A;  1IBM L;  4YY3 L;  1C0A A;  4R4Q A;  1N9W A;  4UPA A;  4JI3 L;  3S24 A;  1YI2 A;  2GVA A;  4IOC A;  4JI7 Q;  4LF5 Q;  4B3R L;  5IYD H;  5IP7 H;  1Q7Y C;  4HJ7 A;  1UE6 A;  5IYC H;  5EAY A;  4K0K Q;  5GAG C;  4JI8 Q;  4DR7 L;  1E1T A;  5HGQ A;  4TVA B;  3PGZ A;  3RLO A;  5M5X H;  1L2F A;  3KF6 A;  1I94 L;  4BY1 G;  4HIM A;  2OCE A;  2R93 H;  1M1K C;  4DV7 Q;  4APV A;  3FKI G;  2DGY A;  1Q46 A;  4LFA Q;  4DR5 Q;  3HOZ G;  4WJ4 A;  3RLF A;  1Q12 A;  4P74 A;  1J6Q A;  1VQF A;  4DV3 Q;  2UU9 Q;  3G71 A;  4DUY L;  4A93 G;  4GOP C;  4C3I H;  1VQG A;  1X56 A;  3GTL H;  1N36 L;  2R92 H;  4AQY L;  2ATW A;  3S17 H;  1X65 A;  1J5E Q;  4IJL A;  5ELN A;  2PQA A;  4JC0 A;  2PMZ E;  3BZC A;  2MO0 A;  2KBN A;  4NB3 A;  4RMF A;  4MZ9 A;  4DV4 Q;  2R7Z H;  2MO1 A;  2WAQ E;  3JAM c;  3I4M G;  2Z6K A;  2ZTC A;  4GS3 A;  3W5O A;  1PH2 A;  5IWA L;  2A8V A;  3KOJ A;  3PUX A;  1P8L A;  4YWL A;  2HHH L;  2NZO A;  4LF6 L;  2Y0S G;  4LW1 A;  4NPS A;  4H02 A;  1XPR A;  4GN4 B;  2E2H H;  3PF4 A;  1A62 A;  2WB1 E;  3ER0 A;  4DR4 Q;  2JA9 A;  2HIX A;  1MIU A;  1X3E A;  5BR8 L;  4LF9 L;  1SFO H;  1ASZ A;  1IZ6 A;  3H0G H;  1N33 L;  4JI4 L;  3A5Z B;  1IBL Q;  2OWO A;  2UXC L;  2A1A A;  4BY1 H;  4ME3 A;  1QZG A;  4JBW A;  2UXD L;  4A3L G;  3FKI H;  3HOZ H;  3E9I A;  4IPC A;  3AYH B;  4BA1 I;  3PIO A;  3PV0 A;  4PG3 A;  4GKK Q;  4BXX H;  1XMO L;  3W1B A;  1WOC A;  1SR3 A;  4C2M H;  4B3S Q;  4JOI C;  3CCE A;  2VW9 A;  2NVX H;  4JI0 Q;  4JI7 L;  4OO1 G;  2CKZ B;  2YU9 H;  3PUW A;  3PIP A;  2D0P A;  1RL2 A;  1KD1 C;  1JJG A;  1WYD A;  3CME A;  1Q86 C;  3K8A A;  1I3Q H;  3HOY G;  4JG2 A;  1XJV A;  2GVB A;  1PYB A;  2VY3 A;  3KJP A;  3I4M H;  2PI2 A;  1Y1W H;  1FJG L;  2ZM6 Q;  3RNU A;  4YHH L;  4B3M L;  5E7N A;  3NEL A;  3WWV A;  1D8L A;  5C3E G;  5LMU Q;  4A3K H;  1KAW A;  1XMQ Q;  1KL9 A;  3MEF A;  4IFD G;  2RF4 A;  3K7A H;  3S1R H;  3U50 C;  2JK8 A;  4OWW B;  2NVT H;  1B7Y B;  3RZO H;  1PHJ A;  2Y0S E;  5M5Y H;  4KHP L;  3JAM i;  1PVO A;  2NN6 G;  4JI6 Q;  4A3D G;  1T9H A;  3UDI A;  3A5U A;  3HOV H;  1Q8K A;  4DNI A;  1CKM A;  2D62 A;  4QIW E;  5GRO A;  4JYA L;  2Q2U A;  1B8A A;  1TWG H;  1IYJ B;  1L1O B;  1SLJ A;  2PI2 E;  3CPF A;  4GOP B;  1Q81 C;  4A3G G;  1LTL A;  2VQF Q;  2JA7 G;  2YTX A;  1TWF H;  4NXN L;  4DK6 C;  3TRE A;  2IY5 B;  2OTJ A;  1Q1E A;  1PYS B;  3E0E A;  4IFD J;  2KHJ A;  3HOW H;  4DV6 Q;  3HKZ E;  4HJA A;  1VQL A;  4KHZ A;  1OXU A;  4DUZ L;  1K0R A;  4JBJ A;  2V1C C;  4L5S A;  1VS0 A;  3M4P A;  3S14 H;  1HZC A;  3J7A 5;  4HJ9 A;  1Y1V G;  1A63 A;  4KLK A;  5C4J H;  4DR3 L;  1N34 L;  1PH8 A;  3HOY H;  1HZB A;  4EQ5 A;  2K5V A;  3KLW A;  1C7Y A;  3GDE A;  4LUO A;  1S72 A;  1MKH A;  4BA2 I;  2F3I A;  2IT1 A;  3JC6 6;  4EX5 A;  3RN2 A;  3W1G A;  3RN5 A;  1XNR L;  1YVC A;  4IPH A;  5IYB G;  1YZ6 A;  3I7F A;  1G6P A;  3GTO H;  3CCJ A;  1VCI A;  3TQY A;  3VDY A;  1EYG A;  4GKJ Q;  2F4V Q;  2B3G A;  4OX9 L;  5C3E H;  4DV2 Q;  1EQR A;  2BH8 A;  4JI1 Q;  1QUQ A;  1XPO A;  3J7Z C;  1I5F A;  1VQ8 A;  1SN8 A;  5JEA G;  2UXB Q;  3T1H L;  1VQ6 A;  3S1Q H;  3D31 A;  4OWT B;  1HNX L;  1LYL A;  2N8N A;  4X65 L;  3TS2 A;  4QY7 A;  2XGT A;  5M5W H;  1M90 C;  4ALP A;  2AKW B;  1SRO A;  4XTC S;  4A3F G;  2WB1 G;  4A3G H;  2NZH A;  3I55 A;  3I56 A;  2JA7 H;  3RLN A;  3A74 A;  4A3J G;  2OQ0 A;  3Q8D A;  4R4C A;  2KHI A;  1UWV A;  4P75 A;  3UDF A;  5M3F H;  4HJ8 A;  4DR2 L;  4LF8 L;  4R1J A;  3L2P A;  1VQN A;  2D0O A;  1S40 A;  5FLM H;  1KHI A;  1A8V A;  5JEA J;  2K75 A;  2N78 A;  3KJO A;  1Y1V H;  5LMN Q;  1QVC A;  2UUC Q;  2JQO A;  4JV5 L;  2YYZ A;  3HKS A;  4YWK A;  4LFB Q;  5IYB H;  1EUJ A;  1X3F A;  3CAM A;  1NTG A;  4YCV A;  1PA6 A;  4DR1 L;  2R6G A;  4IJH A;  3L7Z C;  1HJP A;  1SRU A;  3GTQ H;  2QGQ A;  4AYB G;  1KRT A;  5C44 G;  4LNQ A;  5C4X G;  5AJ3 Q;  1YEZ A;  4GNX B;  3AQQ A;  4JBM A;  4PMW A;  3I4N G;  1GVP A;  3GD7 A;  3U4V A;  2ES2 A;  1EFW A;  1BBW A;  1NMG A;  1KIX A;  3CCR A;  3PO3 H;  4JI5 L;  3L0O A;  4YCU A;  2CCZ A;  1IBK L;  4MNO A;  2Z6K C;  1WJJ A;  4P71 A;  2OTL A;  4A3C G;  4A75 A;  4B3T L;  3HFZ B;  3STB D;  2QEX A;  3TEH B;  2E5L Q;  4X66 Q;  4POG A;  1YIJ A;  3ERS X;  4DV1 Q;  3KYH C;  5H1S E;  1L1O A;  1Y14 B;  4GLV B;  4X64 Q;  1PH7 A;  5LMN W;  1LM0 A;  2Z0S A;  3IRB A;  4X62 Q;  1YJN A;  3ULL A;  1GM5 A;  2UUB L;  3S2D H;  1XNQ L;  1NJI C;  5C0X G;  4LF4 Q;  2ZTE A;  5IE8 A;  3RZD H;  4NXM L;  1TWA H;  1HZ9 A;  3LGJ A;  4P73 A;  4DV0 L;  2VQE L;  3S1N H;  2K52 A;  3HKZ G;  3T1Y L;  2ZJP A;  2EQS A;  1AE3 A;  1GKH A;  3CCL A;  3PO2 G;  1JJC B;  2JA8 G;  2CWA A;  4YWM A;  3ZJY C;  5IY0 A;  2UUA Q;  3KDF A;  3E9H A;  3J81 c;  4LF5 L;  1R9T H;  1MJC A;  4A93 H;  3STB C;  5C44 H;  3M85 A;  1X9N A;  4K0K L;  1TWC H;  5C4X H;  4LUV A;  4JI8 L;  4JI2 Q;  1IXR A;  4OON A;  3OW2 A;  4AYB E;  1DGS A;  4Y7N H;  2ZJR A;  5LMN L;  4JCV E;  2MNA A;  2YV5 A;  1EIY B;  4DPG A;  3I4N H;  5C0X J;  4OO1 I;  1FVI A;  4DV7 L;  1CUK A;  4LFA L;  4DR5 L;  3S1M H;  5IT9 c;  4OWX B;  4DV5 Q;  3EBE A;  4A3C H;  1N32 Q;  1VQB A;  2R7D A;  4DV3 L;  1XPU A;  1P16 A;  1Z47 A;  1S3O A;  1UE7 A;  1BKB A;  4C3J H;  2UU9 L;  4R4I A;  1VQD A;  3M3Y H;  1VQJ A;  3PUZ A;  3GTJ H;  1HR0 Q;  2FXQ A;  1PH1 A;  3KF6 B;  1I50 H;  1J5E L;  1YHB A;  2YTY A;  3OTO Q;  4DV4 L;  2JA6 G;  2Q2H A;  3ULJ A;  1VQP A;  1PH9 A;  4IFD I;  2HQL A;  2IHF A;  4DR6 Q;  1G51 A;  1VQI A;  1HNW Q;  1PH5 A;  2JEB I;  4GLX A;  4A3L H;  3G6E A;  3M7N A;  4LFC Q;  2NN6 I;  5ELO A;  3T1H Q;  4A3I G;  2E5L L;  3PO2 H;  1LUZ A;  1WCM G;  2JA8 H;  2A19 A;  4YY3 Q;  4DR4 L;  2QA4 A;  4B3R Q;  2AWO A;  3ICE A;  1O7I A;  2C35 B;  1G29 1;  1UE1 A;  2K50 A;  3M4Q A;  4C3H H;  3AFP A;  2LSS A;  1H95 A;  4DR7 Q;  1K3R A;  1VQ5 A;  1IBL L;  3CMA A;  3NEM A;  1XTD A;  1JE5 A;  4HIK A;  3U58 A;  4MTN A;  1I94 Q;  2LXJ A;  3U4Z A;  3CC2 A;  1PFS A;  4GNX A;  3CC4 A;  3KFU A;  3DM3 A;  4GKK L;  2K4K A;  2CWP A;  4A3M G;  3KF8 B;  4B3S L;  1W2B A;  2ALY B;  4JI0 L;  2PNH A;  1NE3 A;  4A3B G;  4QJF A;  3BU2 A;  1CSP A;  2NVY H;  4DUY Q;  5HY6 A;  1YBY A;  3ULP A;  2L15 A;  4HIO A;  1OXV A;  4R4O A;  1N36 Q;  4AQY Q;  1UE5 A;  4A3D H;  2MQH A;  4HID A;  1JB7 A;  2Q2T A;  2JA6 H;  1PH6 A;  1QVF A;  3UDG A;  3K7U C;  2JJQ A;  1JJ2 A;  2ZM6 L;  1Q82 C;  5DLQ E;  4PZ6 A;  1NBW A;  4O2D A;  2BH2 A;  5IWA Q;  2HT1 A;  4A4I A;  5LMU L;  1XMQ L;  4WJ3 M;  3I4O A;  2VS1 A;  4UY8 C;  2HHH Q;  4LF6 Q;  2JE6 I;  1WCM H;  2AWN A;  4BY7 G;  1FL0 A;  1KXL A;  4OXP A;  4DAY B;  3GTG H;  2HIV A;  4JI6 L;  4L5Q A;  1TXY A;  1K8G A;  2B29 A;  2RCN A;  5BR8 Q;  2JA5 G;  4LF9 Q;  1N33 Q;  3BZK A;  4JI4 Q;  2NVQ H;  1SMX A;  3PSI A;  2UXC Q;  2ZTD A;  4PZ7 A;  4YCW A;  4QGU A;  1C9O A;  2VQF L;  1N8R C;  1E3P A;  2UXD Q;  3CP0 A;  1E24 A;  1IL2 A;  1EOV A;  3AFQ A;  1YHA A;  3F2D A;  4A3M H;  3PCO B;  1OXX K;  4LWC A;  2R7F A;  3J81 j;  2N3S A;  1FGU A;  4DV6 L;  1VQE A;  1YNX A;  4UP7 A;  2K14 A;  5GQO A;  2EXD A;  1L0W A;  3UE1 A;  1KQS A;  4RG1 A;  1ASY A;  3GTK H;  4A3B H;  5JJL A;  3OYY A;  1E22 A;  1VQM A;  4IPD A;  2BA1 A;  3PUV A;  3BJU A;  1Z9F A;  3H0G G;  4AH6 A;  3H15 A;  3F2C A;  4A76 A;  1EWI A;  3F8T A;  4A3F H;  1OXS C;  1FJG Q;  1QVG A;  3A0J A;  4GKJ L;  4YHH Q;  4B3M Q;  2F4V L;  4A3J H;  4DV2 L;  2I5L X;  3MXN B;  4JI1 L;  4BXX G;  1WI5 A;  3G4S A;  1XMO Q;  4BBR G;  5FLX c;  4GOP A;  4BY7 H;  3CPW A;  3S15 H;  5FJ8 G;  1L1O C;  2AMC B;  2UXB L;  4IO9 A;  1YJ9 A;  4KHP Q;  4GN3 B;  1CKN B;  2VUM G;  3S16 H;  4GLA C;  2IHE A;  1VQC A;  2JA5 H;  2ASB A;  1A0I A;  1EQQ A;  3PUY A;  3J80 c;  4XIG S;  4JYA Q;  5JJI A;  1Y1W G;  1QUQ B;  2EIF A;  4UP9 A;  2H5X A;  5J3B A;  3H3V I;  5IP9 G;  1K9M C;  1WFQ A;  3I2Z A;  4NXN Q;  4A3K G;  4BBS G;  2CQO A;  5C0X I;  1HNZ Q;  1YJW A;  1VQ7 A;  4LF7 Q;  4KI0 A;  1OXT A;  2RHS B;  5M3M G;  4DUZ Q;  1RIP A;  4QL5 A;  2KEN A;  3EIV A;  2UUC L;  1NY4 A;  2I5H A;  3HOV G;  4DR3 Q;  1N34 Q;  3K80 C;  2ZJQ A;  2B63 G;  4LFB L;  1EIF A;  1W3S A;  1YHQ A;  1XNR Q;  2K5N A;  5JJK A;  1E7Z A;  1E1O A;  3SGI A;  1KC8 C;  1GO3 E;  2LXK A;  3M4O H;  4O0A A;  4HJ5 A;  4JOI A;  3K0X A;  3UE0 A;  3FP9 A;  1K73 C;  4OX9 Q;  2JEA I;  3HOW G;  4BBR H;  1BBU A;  1X6O A;  1KRS A;  5AJ3 L;  5FJ8 H;  1U0L A;  2WP8 J;  4J15 A;  1MJE A;  3H3V H;  1X55 A;  4R4T A;  3M9B A;  1I6H H;  1PH4 A;  2VUM H;  1HNX Q;  1K8A C;  1VQO A;  3GO5 A;  1GD7 A;  4X65 Q;  2OQK A;  3TRZ A;  1AE2 A;  2BA0 A;  1OTC A;  2KCT A;  2I0Q A;  4Y52 H;  3PF5 A;  5IP9 H;  1QZH A;  4TQU S;  3CCV A;  4X66 L;  2E8G A;  4DV1 L;  1IBM Q;  2PQA B;  3CCS A;  2E2I H;  4BBS H;  3FHW A;  4AIM A;  1V43 A;  4JI3 Q;  4X64 L;  2RHQ B;  4DR2 Q;  4A3E G;  3RR5 A;  2KCM A;  4GN5 A;  5M3M H;  2N49 A;  1JMC A;  4LF8 Q;  4X62 L;  2WFW A;  1UEB A;  3HOX G;  5GAD C;  1TWH H;  3J80 i;  1PH3 A;  3CD6 A;  5GAH C;  4LF4 L;  1AH9 A;  5GAE C;  1Q1B A;  2I5M X;  3HOU G;  1VQ9 A;  2DUD A;  3B6Y A;  3TS0 A;  2B63 H;  1VQH A;  4JV5 Q;  3NBH B;  3J81 i;  2ID0 A;  4IPG A;  4GNX C;  3G48 A;  2F52 A;  1JT8 A;  1VQ4 A;  1SE8 A;  1HR0 W;  2UUA L;  3UDX A;  4DR1 Q;  4X6A H;  2MFI A;  1HNZ L;  1CSQ A;  4QQB X;  3CCM A;  5M3F G;  4LF7 L;  5IYD G;  3CF5 A;  3CXC A;  5IP7 G;  4DK3 C;  4JI2 L;  5IYC G;  5FLM G;  1X3G A;  1VQA A;  1HZA A;  2GN5 A;  3F1Z A;  4L5R C;  3EN2 A;  1VQK A;  1CKO A;  3S2H H;  1K83 H;  2VZA A;  2VL6 A;  2AHO B;  3K81 C;  1V1Q A;  3CCU A;  4L5T A;  4JI5 Q;  2R93 G;  3KDF B;  4DV5 L;  3F2B A;  1IBK Q;  1N32 L;  1D7Q A;  1CKN A;  4DAM A;  2IX1 A;  4B3T Q;  3GTP H;  4A3I H;  2CFM A;  3CQZ H;  4FDB A;  4P72 A;  1HR0 L;  3CCQ A;  5K36 G;  1U5K A;  4A3E H;  3D0F A;  4JBK A;  2R92 G;  4PZ8 A;  4UP8 A;  3GTM H;  2Q2I A;  2WAQ G;  3OTO L;  1YIT A;  3HOX H;  1B70 B;  2VNU D;  3CW2 C;  2UUB Q;  4DR6 L;  1HNW L;  2IX0 A;  2R7Z G;  3DLL A;  1PV4 A;  1XNQ Q;  3PO3 G;  4IOA A;  1HH2 P;  3HOU H;  4NXM Q;  2XTI A;  3AEV A;  4DKA C;  2YTV A;  4DV0 Q;  4LFC L;  2VQE Q;  4POF A;  1X54 A;  3T1Y Q;  1NMF A;  1V9P A;  1BVS A;  2E2J H;  2K5H A; 
#chains in the Genus database with same CATH topology
 2F0H A;  2RCF A;  4YY3 L;  4PQX A;  2XRQ D;  4UPA A;  3S24 A;  2GVA A;  5IP7 H;  1TT2 A;  4C3H B;  2EYL A;  2AQ1 B;  4X3T A;  2K28 A;  3QJY A;  1L2F A;  3KF6 A;  2K33 A;  2MGS A;  4DV7 Q;  2DGY A;  1Q46 A;  4DR5 Q;  1Q12 A;  4P74 A;  2JXM B;  1SJH D;  4DV3 Q;  2UU9 Q;  3G71 A;  4DUY L;  3HS0 C;  4RHS A;  2R92 H;  3S17 H;  2JA6 B;  5KRU A;  4NB3 A;  2KBN A;  3S2H B;  4MZ9 A;  3MXG A;  1JE4 A;  4X3S A;  5IWA L;  2A8V A;  1SSO A;  1P8L A;  4LAA A;  4LF6 L;  1JOR A;  1O7L A;  4TRD A;  4NPS A;  4NKL A;  5JAV A;  2N88 A;  3GTG B;  3PF4 A;  1HA5 A;  1VF7 A;  1GUT A;  2CHB D;  3IFT A;  2EY2 A;  3H0G H;  5EPJ A;  4JI4 L;  2A1A A;  4ME3 A;  1QZG A;  3WDN A;  2UXD L;  4A3L G;  1EEF D;  1EYA A;  4NDX A;  4KY6 A;  4BXX H;  1JQY D;  4A3B B;  4C2M H;  1WOC A;  1SR3 A;  3R93 A;  4B3S Q;  3NTI A;  4ID6 A;  3CCE A;  2CKZ B;  5JPN C;  2YU9 H;  2D0P A;  1S4Z A;  4OIK A;  4JG2 A;  4O1N A;  5E1F A;  1PRT B;  4DAY A;  2VY3 A;  3KJP A;  4N8X 1;  1Y1W H;  4ZK9 B;  3NEL A;  5LMU Q;  3D4D A;  5IGE A;  1KL9 A;  5IGD A;  2HCI A;  2RF4 A;  5FOB B;  2NVT H;  3RZO H;  2ZXR A;  1A2T A;  3J80 L;  1PHJ A;  2NN6 G;  2BDO A;  1I4H A;  2WAC A;  1S5F D;  2D62 A;  5GRO A;  1K28 A;  4JYA L;  4KJO A;  2Q2U A;  5A35 A;  3NSW A;  1QNK A;  4A3G G;  1F2M A;  2VQF Q;  2JA7 G;  1TWF H;  1EY0 A;  4KKS A;  2HQE A;  2IY5 B;  1DON A;  1JWU D;  2F0G A;  4PV1 C;  4DV6 Q;  1QE6 A;  4KHZ A;  2K7V A;  4KV6 A;  4DUZ L;  4JBJ A;  4L63 B;  1FGB D;  4KLK A;  1N34 L;  1SDF A;  4BA2 I;  3FPU B;  1S72 A;  4G7O C;  3RN5 A;  3RN2 A;  1JC7 A;  2VB2 X;  4IPH A;  2A73 B;  2EYF A;  1G6P A;  3GTO H;  1A3V A;  3TQY A;  4OX9 L;  4IFD H;  5CV9 A;  4RKB A;  4KJN A;  4DNT B;  3BDC A;  1WTH A;  5JEA G;  3D31 A;  1HNX L;  1E2V A;  3QIA A;  1LYL A;  1EIG A;  1EL0 A;  1EY7 A;  3HGB A;  3URY A;  4XQN A;  1ESF A;  3SK4 A;  2AKW B;  2X6L A;  4LK1 C;  4A3F G;  5EKL A;  1LLR D;  2OQ0 A;  4R4C A;  1EQV A;  2KHI A;  4P75 A;  4F87 A;  2BDN A;  3K5M A;  3ERO A;  1O7Z A;  5FLM H;  2OXP A;  1LV9 A;  2K75 A;  1Y1V H;  1QVC A;  1SYC A;  3IAY A;  3HKS A;  2A5H A;  5A2Q L;  1X3F A;  3CAM A;  2X6G A;  3HOW B;  1HJP A;  5KGU A;  2QGQ A;  4ZUJ A;  1KRT A;  2RKS A;  4NMZ A;  1JR0 D;  4LNQ A;  3WOF A;  5C4X G;  1YEZ A;  4PMW A;  3U4V A;  3KLR A;  2ES2 A;  1NMG A;  1ESR A;  4WFN 3;  4FXG C;  5D14 A;  1ONL A;  1IBK L;  2Z6K C;  2D2C C;  4A3I B;  1U4L A;  5CV4 A;  3H6M A;  4HSP A;  3STB D;  2KQ3 A;  3TEH B;  1PH7 A;  3C3L A;  1NAP A;  2Z0S A;  1YJN A;  2FFK B;  3HOU B;  1NJI C;  5C0X G;  4DFA A;  2ZTE A;  3NXW A;  3RZD H;  4NXM L;  2VQE L;  2K52 A;  4KD3 A;  2E2J B;  2IJ0 A;  4NP5 A;  1GKH A;  1SAP A;  4FXK C;  3CCL A;  3PO2 G;  3D8G A;  5IY0 A;  2UUA Q;  1R9T H;  3M85 A;  3PIP 3;  4K0K L;  1TWC H;  4LUV A;  4JI8 L;  4JI2 Q;  3D6C A;  3OW2 A;  4C3H G;  1V1P A;  2IL8 A;  4Y7N H;  4JCV E;  2F0V A;  2MNA A;  2D9U A;  4K2K A;  3N52 A;  3S1M H;  2F0L A;  1HCZ A;  2PO4 A;  4DV5 Q;  4A3C H;  1BKB A;  4C3J H;  2PMZ B;  2R92 B;  3S17 B;  3JAM L;  3V2T A;  1I50 H;  4HN7 A;  2JA6 G;  1EFI D;  2HQL A;  4DR6 Q;  1TU2 B;  4A3L H;  1TQO A;  2J4X A;  3M7N A;  4CDC C;  4LFC Q;  2NN6 I;  3EFX D;  3T1H Q;  1PTO H;  1LUZ A;  2JA8 H;  5ELC A;  4YIJ A;  2QA4 A;  3ICE A;  2C35 B;  2ICE C;  4K14 A;  1G2T A;  3AFP A;  4DR7 Q;  2Z4H A;  1B9M A;  3U58 A;  2NWG A;  2LXJ A;  1RDP D;  5E4X A;  4PMC A;  3DM3 A;  1ILP A;  4C2M B;  2CWP A;  1PZI D;  2YU9 B;  4JI0 L;  2Z6B A;  1NE3 A;  4A3B G;  2NVY H;  4K6L A;  1KTK A;  4R4O A;  3G6J B;  1D5M C;  2A69 C;  4AQY Q;  1ENF A;  3FVQ A;  1PH6 A;  3KBX A;  5J39 A;  1Y1W B;  1QVF A;  2JJQ A;  1JJ2 A;  1PRT D;  2WKC A;  4PZ6 A;  4RCO A;  5FLX E;  1WTX A;  3I4O A;  2NVT B;  3RZO B;  1WCM H;  4OXP A;  1AP0 A;  2EYM A;  5EQ0 A;  4Q5V A;  2MUY A;  1L0X B;  1K8G A;  1TXY A;  3V96 A;  2B29 A;  1LO5 D;  5BR8 Q;  2DY7 A;  1RD9 D;  1N33 Q;  1E2Z A;  2NVQ H;  3PSI A;  1SMX A;  1EY6 A;  1TWF B;  3CRL C;  4WJW A;  4YCW A;  1N8R C;  3CP0 A;  1EOV A;  1SNC A;  3PCO B;  3AB9 A;  1OXX K;  1VQN A;  1VQE A;  4C1N I;  3GTK H;  4G4K A;  1LTG D;  1VQM A;  4IPD A;  2A6E C;  3EVQ A;  3PUV A;  2F0W A;  4B9X A;  4QUF A;  2XIW A;  3F8T A;  3GTO B;  4A3F H;  1OXS C;  1QVG A;  1DZ1 A;  2LKV A;  4YHH Q;  2F4V L;  2I5L X;  3MXN B;  4JI1 L;  4CDD C;  4GOP A;  4V19 0;  5LL6 X;  2UXB L;  1HFG A;  2R3Z A;  1YJ9 A;  4KHP Q;  3AU7 A;  4GN3 B;  5ELB A;  2JA5 H;  2ASB A;  1A0I A;  1EQQ A;  3PUY A;  4HMJ A;  4XIG S;  3DEO A;  4LJZ C;  4XQQ A;  1XX8 A;  1Q3L A;  3A8K E;  4NXN Q;  4KY7 A;  5C0X I;  3K5O A;  5L37 A;  2RHS B;  1RIP A;  5IOD A;  1Y1V B;  1WTP A;  2KEN A;  2UUC L;  4TKO B;  2KOL A;  4QF4 A;  2JP1 A;  1S5C D;  2KHS A;  1YHQ A;  3NWT A;  3SGI A;  1CT1 D;  1GO3 E;  4RHR A;  3M4O H;  4JOI A;  1EEI D;  1K73 C;  1FNU A;  3HOW G;  2DNC A;  1F2L A;  1HQM C;  1A6X A;  4HR7 B;  2VXW A;  4KN7 C;  3FMC A;  2EPB A;  2BOS A;  1K8A C;  1VQO A;  3GO5 A;  2NTS A;  1MHW C;  4X65 Q;  3IL8 A;  1LT5 D;  5I9O A;  1AW7 A;  2KCT A;  2I0Q A;  5IP9 H;  5CV5 A;  2E8G A;  5K5P A;  2PQA B;  3CCS A;  3TSS A;  4AIM A;  1V43 A;  1JMC A;  4LF8 Q;  2KCM A;  4X62 L;  1RKN A;  3C46 A;  3O13 A;  1Z7T A;  3CD6 A;  1CA6 A;  5GAH C;  5GAE C;  3RZD B;  2O5J C;  1Q1B A;  3HOU G;  3TS0 A;  3ZYY X;  4GNX C;  2Z9H A;  3NP8 A;  1BDO A;  4OEL B;  4AYB B;  1R9T B;  1STA A;  1C8C A;  1CSQ A;  4V0B A;  2RVL A;  5BN4 A;  2EY5 A;  3TP7 A;  5IP7 G;  4DK3 C;  2K32 A;  3MXN A;  1D5X C;  1VQA A;  1X3G A;  2GN5 A;  3F1Z A;  4ZKC B;  4EVO A;  1SE3 A;  4XYO A;  4L5R C;  3S1M B;  1QIL A;  3S2H H;  1K83 H;  1KLG D;  2AHO B;  3K81 C;  1FYC A;  1B1Z A;  2K5Q A;  1LTR D;  3VA7 A;  1N32 L;  4C3J B;  2PZW A;  4B3T Q;  2CFM A;  2L9H A;  1VMP A;  1U5K A;  4A3E H;  2R92 G;  4PZ8 A;  4XT3 B;  1IW7 C;  1YIT A;  4XXE A;  3IFD A;  3VR3 A;  3CW2 C;  3DLL A;  5ELF A;  4RKL A;  2XTI A;  4DV0 Q;  2JA8 B;  1T5E A;  3NEN A;  2EYO A;  1C0A A;  4ZQ3 A;  1STG A;  4LF5 Q;  1ZYR C;  3I3C A;  1QJO A;  4IUV A;  1ROD A;  5IYC H;  5EAY A;  5HGQ A;  4TVA B;  3PGZ A;  5ELD A;  2LMC B;  2RSN A;  1UAP A;  2CH4 A;  1I94 L;  2OCE A;  5IGC A;  1PFB A;  2M00 A;  1DD2 A;  4WJ4 A;  4IUP A;  3OPO A;  1J6Q A;  1WTO A;  2NVY B;  1N36 L;  2ATW A;  2RBM A;  1X65 A;  1E2W A;  1YNN C;  4G57 A;  4IJL A;  2PQA A;  1I6V C;  4JC0 A;  4DV4 Q;  4GS3 A;  3W5O A;  1PH2 A;  3BVM A;  1CQV A;  3PUX A;  3GTP B;  4X3K A;  3MHB A;  1WCM B;  4LW1 A;  1TKW B;  3P75 A;  5K36 H;  4G7H C;  1YNJ D;  1A62 A;  5JOB A;  5LL6 S;  3A7L A;  1EY4 A;  1MIU A;  2P5Z X;  3NE5 B;  2NVQ B;  3A5Z B;  2OWO A;  2UXC L;  1BBX C;  4JBW A;  1I4P A;  4BA1 I;  3AYH B;  3PV0 A;  4PG3 A;  1JOK A;  3GTK B;  2K5D A;  3W1B A;  1PMR A;  2RSO A;  2NVX H;  1U4P A;  1XXG A;  1RL2 A;  3QOJ A;  1LAB A;  1IYU A;  4R9W A;  1Q86 C;  5KNB A;  1I3Q H;  1XJV A;  3I4M H;  2PI2 A;  1FJG L;  2ZM6 Q;  5E7N A;  1D8L A;  1KAW A;  4IFD G;  4JK1 C;  3U50 C;  1CQF A;  4F7X A;  1E0B A;  2G5D A;  5M5Y H;  1BQQ T;  2A68 C;  1II3 A;  2JA5 B;  4JI6 Q;  1EIH A;  1M8A A;  4A3D G;  3BS1 A;  1SNP A;  1SLJ A;  2PI2 E;  4N9P A;  1SNM A;  1LTL A;  4DK6 C;  1BCP F;  3SR1 A;  3TRE A;  2OTJ A;  1PYS B;  3E0E A;  2ENB A;  3HOW H;  1R4Q B;  1VQL A;  1K0R A;  1F9S A;  1HZC A;  1RCV D;  4HJ9 A;  1Y1V G;  1A63 A;  2MJ8 A;  2CH4 W;  4DR3 L;  4EQ5 A;  3KLW A;  1G2S A;  1MKH A;  2M9V A;  2IT1 A;  3W1G A;  3R2T A;  1ZEQ X;  3UI2 A;  4CGY B;  3M4O B;  5E3F A;  4G7Z C;  4FF4 A;  3VDY A;  4GKJ Q;  4DV2 Q;  1EQR A;  2BH8 A;  3E5S A;  1O7Y A;  1I5F A;  1VQ8 A;  1SN8 A;  3S1Q H;  1GUW A;  3NPP A;  4OWT B;  2N8N A;  4JPB W;  4DF7 A;  2K04 A;  2TSS A;  4Z9C B;  3DXJ C;  2AUJ D;  4P2C B;  3J7A F;  4KKU A;  1JOO A;  1UWV A;  2DJG C;  3UDF A;  4DR2 L;  2D0O A;  1A8V A;  5JEA J;  2N78 A;  1CZW A;  4FO2 A;  4JV5 L;  4LFB Q;  5IYB H;  1EUJ A;  4YCV A;  3CHB D;  3OIQ A;  4DR1 L;  4N9T A;  4AYB G;  4MTK A;  2CVR A;  1QG7 A;  4ZCK A;  5FO9 B;  1GJX A;  5KYL A;  1K83 B;  1EFW A;  1BBW A;  4PNY A;  1BCP C;  5CC4 A;  4JI5 L;  4YCU A;  3A56 A;  2OTL A;  4A3C G;  3RD4 A;  3HFZ B;  2QEX A;  4C3J G;  2E5L Q;  3TN2 A;  4A3E B;  3ERS X;  4JW0 A;  1Y14 B;  4OHJ A;  4GLV B;  2F3W A;  2O4X A;  4X64 Q;  5LMN W;  1LM0 A;  3IRB A;  3ULL A;  2UUB L;  3C1E A;  5IE8 A;  3LGJ A;  1DOM A;  3T1Y L;  3H09 A;  4ZRZ A;  3TZU A;  1D1K A;  3MFY A;  2ZJP A;  3PIO 3;  3R2I A;  5J22 A;  4CDE C;  4ZKB B;  5M3F B;  2JA8 G;  3ND9 A;  2HCC A;  1PTO D;  4IZ8 A;  3J81 c;  1G91 A;  1MJC A;  5CYU A;  1SJE D;  1IXR A;  2NUC A;  1DGS A;  1TY0 A;  1EIY B;  1C48 A;  5C0X J;  4DV7 L;  1LTI D;  4DR5 L;  5IT9 c;  1RHP A;  1VQB A;  2KUM A;  4WRD A;  1DOK A;  4DV3 L;  1P16 A;  1X32 A;  1S3O A;  1Z47 A;  2B2V A;  1VMC A;  4I7A A;  2UU9 L;  1CM9 A;  2SNM A;  1VQJ A;  2L1B A;  3PUZ A;  2PYK A;  2WAQ B;  1F77 A;  2YTY A;  3OTO Q;  1M4V A;  3R3O A;  2Q2H A;  3ULJ A;  3D3R A;  1PH9 A;  4IFD I;  2A6H C;  5IOC A;  3QO2 A;  1STB A;  5ELO A;  4C1N K;  2E5L L;  2DY8 A;  1WCM G;  1RTO A;  5J1Z A;  3SDZ A;  1LTT D;  1BCP B;  1D5Z C;  1EU4 A;  2K05 A;  5EGT A;  4B3R Q;  2K01 A;  1G29 1;  2PZU A;  4RGM A;  2LSS A;  3J7A V;  4IUQ A;  1EY5 A;  2B2U A;  1XTD A;  1JE5 A;  1T5X D;  1LT3 D;  4HIK A;  3U4Z A;  1TII D;  3CC4 A;  2H4O A;  2NVX B;  3OWE B;  3KF8 B;  5FO8 B;  4B3S L;  2F0Q A;  2KCC A;  1YBY A;  3RMH A;  3ULP A;  1I3Q B;  3I8Z A;  1B3A A;  4J6H A;  4A3D H;  1EWH A;  4BS9 A;  1JB7 A;  3I4M B;  3UDG A;  3A55 A;  5DLQ E;  4O2D A;  3P20 A;  2Y0S B;  5LMU L;  2HHH Q;  4KTA A;  1A15 A;  1FL0 A;  3K58 A;  5M5Y B;  1CFM A;  4FP5 D;  4QIW B;  1FNW A;  3NBI A;  3VA5 A;  3J80 E;  2LY7 A;  2JA5 G;  4LF9 Q;  1ET9 A;  3N6R A;  2ZTD A;  2VQF L;  3J81 E;  2C5C A;  1E3P A;  1E24 A;  3AFQ A;  3F2D A;  4A3M H;  1DXM A;  2H1E A;  4DV6 L;  1XMO Q;  1FGU A;  5GQO A;  5CBE E;  4R8I A;  1YNN D;  5EKK A;  1E22 A;  5CMD A;  2BA1 A;  4NW2 A;  1VDZ A;  2SDF A;  5IT9 E;  1TS4 A;  1H9R A;  1Z9F A;  1EWI A;  3I91 A;  2CQA A;  3KK7 A;  4B3M Q;  1ICW A;  1VF5 C;  2M2L A;  5KNC A;  5FLX c;  4BY7 H;  3I4L A;  1L1O C;  3SK8 A;  3S1Q B;  4OIJ A;  3T13 A;  5LHY 1;  3J7Y W;  1CKN B;  1XWE A;  3S16 H;  4H44 C;  1VQC A;  3MWY W;  2L0C A;  1EOT A;  5JJI A;  1DCZ A;  1QUQ B;  2H5X A;  5J3B A;  5IP9 G;  1K9M C;  1LTB D;  3I2Z A;  1Q90 A;  1HNZ Q;  2B2Y C;  1YJW A;  1VQ7 A;  4K5X A;  1B4O A;  1FR3 A;  2G9H D;  1MD2 D;  1EZ8 A;  4CDF C;  3EIV A;  3KF8 A;  1ENC A;  1SND A;  2XWJ B;  2LS0 1;  1H9M A;  3H3V C;  1CZG A;  3TP8 A;  1D1I A;  1LT6 D;  3L3O C;  4RFB A;  2FIN B;  1XNR Q;  5JJK A;  1E1O A;  5A2Q E;  4HJ5 A;  1U9R A;  3UE0 A;  3FP9 A;  4PMB A;  3DWQ A;  2LFN A;  4E6I A;  1U0L A;  1J8I A;  4EQN A;  4R4T A;  3M9B A;  3LWE A;  1I6H H;  1PH4 A;  4UHV A;  3NQI A;  4U67 3;  4R8N A;  3TRZ A;  1AE2 A;  2QKI C;  2WB1 B;  3DMU A;  2BA0 A;  4DU9 A;  2L12 A;  1QZH A;  3CCV A;  2Q8R E;  2BE5 D;  1IBM Q;  3U9S A;  4Q0F A;  2QF7 A;  3BYY B;  4A3E G;  2KJX A;  2RHQ B;  3VR4 A;  3RR5 A;  2WFW A;  5GAD C;  1HPC A;  1TWH H;  3X3N A;  2EE1 A;  3DHQ A;  4CHT B;  1CK1 A;  2DUD A;  1VQH A;  3NBH B;  2CW0 D;  4IPG A;  4RWS C;  1VQ4 A;  4IUT A;  2UUA L;  1HNZ L;  4QQB X;  3K57 A;  3CCM A;  5M3F G;  3PMF A;  3G7L A;  1IHZ A;  5IYC G;  4JI2 L;  1Z6H A;  5HGT A;  1B50 A;  5IGF A;  3EN2 A;  5T1G A;  4FXD A;  2EJM A;  2VZA A;  4KN4 C;  1BR9 A;  3CCU A;  1FNV A;  3KDF B;  4DV5 L;  1CKN A;  3GTP H;  4FDB A;  3ITP A;  3W3A A;  1FD7 D;  4J8Q A;  1HQR D;  3GTM H;  2WAQ G;  3HOX H;  3W2D A;  4DR6 L;  2IX0 A;  3PO3 G;  1PV4 A;  1XNQ Q;  5E4W C;  4DKA C;  4LFC L;  4K6D A;  3K0Y A;  1V9P A;  3T1H L;  4LUZ A;  1IBM L;  4R4Q A;  1N9W A;  1YI2 A;  2SEB D;  2WKD A;  1BOS A;  3QWN A;  1Q7Y C;  1BCP D;  1TY2 A;  4MHE A;  3VYS A;  1NUC A;  3KLS A;  4DR7 L;  1E1T A;  4MN3 A;  3OHX C;  1JOQ A;  4QCL A;  2D5D A;  4HIM A;  4APV A;  4LFA Q;  1QCB D;  1VQF A;  3HZX A;  4C3I H;  1DYQ A;  4KHV A;  1VQG A;  1X56 A;  5COY A;  3GTL H;  1JCK B;  4AQY L;  4A3D B;  1J5E Q;  5ELN A;  3SVM A;  2PMZ E;  1XTC D;  2EOT A;  3BZC A;  4RMF A;  1A3T A;  3I4M G;  2MO1 A;  2Z6K A;  2ZTC A;  2OF1 A;  3KOJ A;  4QMG A;  2F0P A;  2QIL A;  2Y0S G;  4H02 A;  2F0S A;  4GN4 B;  2AQ3 B;  2WB1 E;  2TMP A;  3ER0 A;  5TSS A;  4DR4 Q;  2F0K A;  2B2T A;  2HIX A;  1A2U A;  1KAB A;  5KYI A;  1X3E A;  4DA2 A;  5BR8 L;  4DAP A;  2EYH A;  1ASZ A;  1IZ6 A;  1N33 L;  1IBL Q;  4S3S A;  4BY1 H;  1MSH A;  1KDB A;  3FKI H;  4A3M B;  2EDG A;  2EY1 A;  3E9I A;  3HOZ H;  3PQI A;  4GKK Q;  2EXZ A;  1SYG A;  1O78 A;  1GXD C;  3PUW A;  3PIP A;  4QUC A;  2ZXO A;  3E3X A;  1WYD A;  1JJG A;  3S9W A;  3K8A A;  1J9O A;  1PYB A;  3OOC A;  2PW5 A;  3RNU A;  4YHH L;  2I07 B;  3NWS A;  1B53 A;  2A74 C;  4JVZ A;  4DNR B;  1XMQ Q;  4BY7 B;  3K7A H;  1DM0 B;  2B2W C;  2JK8 A;  4OWW B;  2RDF A;  1DJR D;  4KHP L;  3H94 A;  3S16 B;  1S5B D;  1IL8 A;  1CKM A;  1B8A A;  1S5E D;  4RGO S;  1Q81 C;  4NXN L;  3K59 A;  1Q1E A;  4IFD J;  2KHJ A;  4OO1 H;  4HJA A;  2FMC A;  4CKE A;  1AFP A;  3NHH A;  2V1C C;  4L5S A;  1G8Z D;  1VS0 A;  4DGZ A;  5I9P A;  4RGT A;  3S14 H;  2K5W A;  3J7A 5;  5C4J H;  3HOY H;  3GDE A;  4LUO A;  3KUP A;  2EYJ A;  2F3I A;  3JC6 6;  1S5D D;  1YVC A;  5IYB G;  3I7F A;  3CCJ A;  1VCI A;  2QCP X;  4L6T B;  2XNA C;  5C3E H;  1AZQ A;  1XYI A;  3X3M A;  3J7Z C;  1I6H B;  2GA4 B;  3T51 B;  3DEP A;  4X65 L;  2E2D C;  4CJ1 B;  4M1U B;  3NTH A;  2XGT A;  1M90 C;  4ALP A;  4XTC S;  1LAC A;  2WB1 G;  2PW7 A;  3NK9 A;  3I55 A;  3DM1 A;  3I56 A;  3A74 A;  1SE2 A;  1BF4 A;  1PLF A;  2JN4 A;  5M3F H;  4HJ8 A;  4LF8 L;  1B2T A;  4R1J A;  2L55 A;  1TWH B;  3L2P A;  1S40 A;  1STH A;  3HOV B;  3KJO A;  1GUG A;  4MIU A;  5LMN Q;  2JQO A;  3P1H A;  2I46 A;  4YWK A;  1GUO A;  4U68 A;  1UNS A;  3DUZ A;  3LX0 A;  3Q22 A;  3Q23 A;  1EU3 A;  5AJ3 Q;  4KD4 A;  4GNX B;  2QEJ C;  3AQQ A;  1MGS A;  3OMG A;  2J0T D;  3PO3 H;  2F4I A;  3HP3 A;  3CCR A;  2CCZ A;  4A75 A;  5BN3 A;  1I4R A;  4B3T L;  1STY A;  5BN5 A;  4X66 Q;  4ZAI A;  1YIJ A;  4DV1 Q;  3KYH C;  3A54 A;  3GTM B;  3HOX B;  3E0J A;  1MSG A;  2F0F A;  2FHT A;  5G3L F;  5CV6 A;  3S2D H;  1GM5 A;  1LTS D;  2KED A;  4LF4 Q;  5D3I B;  3H91 A;  1I4X A;  3OWF A;  1HZ9 A;  4DV0 L;  3S1N H;  1W6J A;  5C4H A;  3ERQ A;  4M8A A;  1RF2 D;  1F2Y A;  1AE3 A;  4UAI A;  5F2D A;  5I2Y A;  1JJC B;  2CWA A;  4LF5 L;  3ZJY C;  2FJ2 A;  4TSS A;  3STB C;  2BCO A;  2QDB A;  3V05 A;  5C44 H;  1U4R A;  1MBY A;  1SMY C;  4AYB E;  3NTK A;  2NZ1 D;  4XDX A;  5LMN L;  3I4N H;  2YV5 A;  3C1F A;  3GV6 A;  1EYD A;  1FVI A;  1CUK A;  1NNX A;  2R7D A;  1XPU A;  1UE7 A;  3CU7 A;  5C3X A;  4C3I B;  1VQD A;  3M3Y H;  3GTL B;  1EQT A;  3GTJ H;  1HR0 Q;  1KDA A;  1KLU D;  3BDO A;  1PH1 A;  3KF6 B;  2PNR C;  1PRT F;  4DV4 L;  2PQE A;  2KCN A;  3IKJ A;  3I73 A;  2IHF A;  1HNW Q;  2JEB I;  4IAL A;  1F9P A;  3G6E A;  4K5V A;  5FO7 B;  2KEC A;  2A69 D;  4IUR A;  4YY3 Q;  2F0N A;  4CBV A;  2OEO A;  5T1I A;  1UE1 A;  4XQJ A;  2K50 A;  3M4Q A;  2ZXP A;  1K3R A;  3K6O A;  3CMA A;  4BY1 B;  1TWA B;  3NEM A;  3FKI B;  4HAE A;  4MTN A;  1SYD A;  5NUC A;  2HDM A;  5CBA E;  4GNX A;  3HOZ B;  3SEB A;  3KFU A;  3KLS X;  3MTS A;  4A3M G;  3D6W A;  1W2B A;  2AUK A;  2ALY B;  4A93 B;  1HA6 A;  3BU2 A;  4DUY Q;  5HY6 A;  2XVS A;  4HIO A;  3NUC A;  3MVV A;  1UE5 A;  1V8Q A;  2ZM6 L;  1WTW A;  1Q82 C;  5DM6 3;  1NBW A;  2BH2 A;  5IWA Q;  1X3P A;  5KND A;  3K7A B;  2NTT A;  4WJ3 M;  3SE0 A;  1TR5 A;  4LF6 Q;  2AWN A;  4BY7 G;  2A6E D;  1PDQ A;  4DAY B;  1CI3 M;  1ET6 A;  1K3B C;  2KA7 A;  2HIV A;  4JI6 L;  4L8J A;  4L5Q A;  1F9Q A;  2RCN A;  3FRP B;  3BVZ A;  1RTN A;  4ZUI A;  4JI4 Q;  2N55 A;  4PZ7 A;  4QGU A;  1IYV A;  2UXD Q;  3CRK C;  1IL2 A;  1IKL A;  2F0U A;  1PRT C;  2N3S A;  3K5L A;  2K14 A;  2EXD A;  1KQS A;  4RG1 A;  1ASY A;  3S14 B;  1SYB A;  2EY6 A;  5C4J B;  3HOY B;  1I4G A;  5EKI A;  5C5L A;  1JB3 A;  5DAU A;  4QB4 A;  2ICI A;  4AH6 A;  3H15 A;  3F2C A;  1NR4 A;  3HG9 A;  1SXT A;  2SOB A;  5C3E B;  4GKJ L;  4RAU C;  4DV2 L;  1Y8P B;  1WI5 A;  3MXP A;  2F1M A;  1PZJ D;  2JSO A;  3LNN A;  3S15 H;  3EQL C;  2DN8 A;  2QDL A;  3Q0A A;  4GLA C;  2IHE A;  2SNS A;  2QW7 A;  3J80 c;  4JYA Q;  2J7Z A;  1G6Z A;  4UP9 A;  4HTH A;  3FEW X;  3H3V I;  3A8J E;  1WFQ A;  1DOL A;  4A3K G;  2CQO A;  3MZ5 A;  1JIC A;  4I7Z C;  3EJI A;  4KI0 A;  4DUZ Q;  2I5H A;  3HOV G;  1N34 Q;  2ZJQ A;  4LFB L;  4RA8 A;  1W3S A;  4ZLT F;  3I90 A;  2F0M A;  4DXF A;  4EGV A;  1KC8 C;  1BUV T;  4O0A A;  1HTP A;  3K0X A;  4OX9 Q;  2IWH A;  4HCE A;  2NYZ D;  4WOR A;  4BBR H;  1BBU A;  1X6O A;  5I6Y A;  5FJ8 H;  4J15 A;  1MJE A;  3H3V H;  3M7G A;  3PO3 B;  3MEH A;  1KAA A;  4DN4 M;  2VUM H;  1HNX Q;  4XYQ A;  2F3V A;  2VB3 X;  4A3J B;  3T16 A;  4FYD A;  3PF5 A;  2NBF A;  5EJW A;  4BBS H;  4HSV A;  4RGN A;  2E2I H;  2O5I C;  3FHW A;  4JI3 Q;  4X64 L;  3OSO A;  4GN5 A;  2N49 A;  5M3M H;  2X69 A;  3S2D B;  3HOX G;  2RDH A;  1ZXT A;  4KKT A;  3J80 i;  4ABN A;  1B44 D;  3FPP A;  3R8B A;  1PXU A;  3S1N B;  4KK7 A;  1R4P B;  3B6Y A;  4UDU C;  3J81 L;  2B63 H;  5EBC A;  3J81 i;  3QB3 A;  3G48 A;  1JT8 A;  1HR0 W;  1SE8 A;  2E74 C;  3UDX A;  1IW7 D;  5C44 B;  3HRZ C;  3CF5 A;  4B08 A;  3I4N B;  4OL7 A;  5IT9 L;  1VQK A;  1WD1 A;  1WTQ A;  4ME5 A;  2VL6 A;  1V1Q A;  2K6A A;  4L5T A;  1IBK Q;  1NR2 A;  1UEA B;  1ZYR D;  3M3Y B;  3CQZ H;  3GTJ B;  1GHK A;  1V1P B;  1AEX A;  4P72 A;  2G9D A;  3EA6 A;  3TP5 A;  3CCQ A;  3A8I E;  4C3I G;  5K36 G;  2Q2I A;  3HEJ A;  3OTO L;  1B9N A;  2HUG A;  1EY9 A;  2B39 A;  3LWU A;  1CHQ D;  1BO0 A;  3HKZ B;  4NXM Q;  3AEV A;  2F0I A;  2YTV A;  3WOE A;  2VQE Q;  1X54 A;  5KIX A;  5EPL A;  1K8M A;  3CC7 A;  2Z4I A;  4JI3 L;  4JI7 Q;  4B3R L;  1ZKO A;  4IOC A;  5IYD H;  3TDQ A;  4HJ7 A;  1UE6 A;  1GUS A;  4K0K Q;  3BZD B;  5GAG C;  4JI8 Q;  2C9O A;  3RLO A;  5M5X H;  1AZP A;  4BY1 G;  5M9O A;  2MP1 A;  2R93 H;  3KBG A;  3BDL A;  1M1K C;  1Y8O B;  3FKI G;  3HOZ G;  3RLF A;  3D4W A;  2NB0 A;  4A93 G;  5C3W A;  4GOP C;  4K2L A;  2Q8I B;  3AMU A;  3ONA B;  3GV3 A;  2EYP A;  2XN9 C;  1D6E C;  2MO0 A;  3DWP A;  2R7Z H;  1QWY A;  2WAQ E;  3JAM c;  2WII B;  3TP6 A;  4YWL A;  2HHH L;  2NZO A;  2EJF C;  5I2X A;  1SEB D;  1XPR A;  5C6A A;  2E2H H;  1SMY D;  2ZT9 C;  3DWA A;  2JA9 A;  1TS2 A;  2B2T C;  2KEE A;  4LF9 L;  1SFO H;  3SK5 A;  5C4Z A;  1WVL A;  3BVG A;  1TS5 A;  4IPC A;  3PIO A;  4RCN A;  2EJG C;  1XMO L;  2A68 D;  4JOI C;  4OO1 G;  2VW9 A;  1PYW D;  4JI0 Q;  4JI7 L;  1ENA A;  1KD1 C;  3CME A;  1YNJ C;  3HOY G;  2GVB A;  3OMC A;  1JWS D;  5FLX L;  4H0L C;  4B3M L;  4HMI A;  4CKC A;  3WWV A;  5C3E G;  1NCV A;  4A3K H;  4DXG A;  1I4Q A;  3MEF A;  3S1R H;  3S15 B;  5CR3 A;  1B7Y B;  2Y0S E;  3JAM i;  1PVO A;  3CKI B;  1T9H A;  3UDI A;  3A5U A;  3HOV H;  1Q8K A;  4DNI A;  4ODG A;  4QIW E;  5CV8 A;  2K1B A;  1TWG H;  1IYJ B;  1L1O B;  3CPF A;  5G3L D;  4GOP B;  4K5W A;  2HDL A;  2YTX A;  3NQT A;  1HTL D;  1K0S A;  3HKZ E;  1HUN A;  1CA5 A;  1HRJ A;  3SK6 A;  1OXU A;  4XT1 B;  2WV6 D;  2F03 A;  4FNF A;  3M4P A;  1WTV A;  3VR6 A;  3H0G B;  1H9J A;  3RUZ A;  1PH8 A;  1HZB A;  2K5V A;  3E6Z X;  1C7Y A;  2IW3 A;  4EX5 A;  1Y8N B;  1XNR L;  3Q6S A;  1YZ6 A;  1EYG A;  3I72 A;  2F4V Q;  2B3G A;  4I65 A;  3QR8 A;  4BBR B;  4JI1 Q;  1F9R A;  1QUQ A;  1XPO A;  1QB5 D;  1C4Q A;  1X3Q A;  3JAM E;  2VUM B;  2UXB Q;  2WIN B;  2NN6 H;  4K8I A;  2JYO A;  4HED A;  1VQ6 A;  3VR2 A;  2E76 C;  1Y69 U;  3TS2 A;  4QY7 A;  5M5W H;  5CGK A;  4K8J A;  1SRO A;  3K5N A;  4A3G H;  2NZH A;  2XWB B;  2JA7 H;  4BBS B;  3RLN A;  4A3J G;  4CKB A;  2E2I B;  3Q8D A;  4X3U A;  4F88 A;  4N8F A;  5M3M B;  2IPK D;  1SNQ A;  2B8G A;  2PCF B;  1KHI A;  5DNF A;  2HD3 A;  2UUC Q;  2B63 B;  2F0O A;  4EQO A;  2YYZ A;  1PTO F;  2EVB A;  3GQB A;  4H13 C;  1KNA A;  1NTG A;  1PA6 A;  5I6W A;  2R6G A;  4IJH A;  3L7Z C;  1SRU A;  3GTQ H;  1STE A;  5C44 G;  5JPM C;  5JEA H;  1ICF B;  4JBM A;  3I4N G;  1GVP A;  3GD7 A;  3T56 B;  5HUR A;  1HFN A;  1KIX A;  2Z1C A;  3L0O A;  4ILW A;  4MNO A;  1WJJ A;  4FF3 A;  3MC0 B;  4P71 A;  3CQZ B;  2OT2 A;  4POG A;  4EQP A;  3NBH A;  5H1S E;  1L1O A;  4FF2 A;  2RQX A;  1AN8 A;  3D4R A;  4X62 Q;  3SXH A;  3GP7 A;  1XNQ L;  2RDG A;  1TWA H;  4P73 A;  3HKZ G;  2EZV A;  1WTR A;  2EQS A;  4CJ0 B;  2B2Y A;  3T53 B;  1JWM D;  4YWM A;  1NSN S;  3E9H A;  3KDF A;  4A93 H;  1K8O A;  2F0J A;  5ISR A;  2F0E A;  1X9N A;  1GOZ A;  5C4X H;  4OON A;  2IX3 A;  5M5X B;  2ZJR A;  4DPG A;  1CHP D;  2A6H D;  2R93 B;  4OEM B;  1SYF A;  4OO1 I;  1L0Y B;  4LFA L;  4OWX B;  2F0T A;  3EBE A;  3TME A;  1N32 Q;  1Q8I A;  5IGG A;  1IKM A;  4R4I A;  1UUP A;  2MPM A;  2FXQ A;  1J5E L;  1YHB A;  1PTO C;  3VR5 A;  3I70 A;  2R7Z B;  4CJ2 C;  1VQP A;  5C0X H;  1G51 A;  1VQI A;  1PFN A;  1PH5 A;  4GLX A;  2Q8T A;  2XSC A;  1D2B A;  2MHV A;  4A3I G;  2E2H B;  3PO2 H;  2A19 A;  1F2Z A;  1EYC A;  4DR4 L;  1WD0 A;  2AWO A;  1O7I A;  1SFO B;  4C3H H;  1HHV A;  1H95 A;  1GUN A;  2PZT A;  1VQ5 A;  1IBL L;  1SNO A;  1I94 Q;  3CC2 A;  4F8M A;  1PFS A;  3BG3 A;  5EBD A;  4GKK L;  2K4K A;  1PZK D;  4RH6 A;  5JVH 3;  2PNH A;  4KMU C;  3QOL A;  4QJF A;  1CSP A;  1TWC B;  2KVM A;  1EY8 A;  2L15 A;  2R61 A;  1OXV A;  4DK0 A;  3M4Y A;  4Y7N B;  1N36 Q;  4IQZ A;  2MQH A;  4HID A;  2JA6 H;  2Q2T A;  3K7U C;  1KDC A;  1RJT A;  1ML0 D;  4A3K B;  2HT1 A;  4A4I A;  1XMQ L;  3S1R B;  2VS1 A;  4UY8 C;  3VYU A;  2JE6 I;  4O42 A;  1TVX A;  1KXL A;  1U4M A;  1BNZ A;  3P7J A;  5DM7 3;  1I50 B;  5I4D A;  3MXU A;  1LTA D;  3GTG H;  1W6K A;  3L9A X;  1TWG B;  3BZK A;  2FMM A;  2UXC Q;  1EZ6 A;  1PFM A;  2AQ2 B;  1C9O A;  2PPB C;  1H9S B;  1PTO B;  1YHA A;  4KY5 A;  4LWC A;  2Z8L A;  2R7F A;  3J81 j;  3VYR A;  1OO9 B;  2XRS D;  1YNX A;  4UP7 A;  1L0W A;  3UE1 A;  3FDT A;  4A3B H;  5EPK A;  5JJL A;  1B3Q A;  3OYY A;  4ULL A;  1GHJ A;  1MI2 A;  3VYT A;  3BJU A;  3H0G G;  2K03 A;  4A76 A;  3A7A B;  3U9O A;  5JVG 3;  4HCS A;  1FJG Q;  1O80 A;  3A0J A;  3F2U A;  4A3J H;  4BXX G;  3G4S A;  5AFW A;  4FF1 A;  4BBR G;  3CPW A;  1A3U A;  5FJ8 G;  4H7B A;  2RA4 A;  2AMC B;  3Q24 A;  4IO9 A;  1H9K A;  1TS3 A;  2VUM G;  5M5W B;  5FK9 C;  4A3G B;  1Y1W G;  2JA7 B;  2EIF A;  2O2L D;  1QOH A;  4BBS G;  4IUN A;  4LF7 Q;  1OXT A;  5M3M G;  4QL5 A;  2F0D A;  1NY4 A;  5D65 A;  3C2P A;  5CV7 A;  4DR3 Q;  4DK1 A;  2DJF C;  3K80 C;  2B63 G;  1EWC A;  1CTM A;  1EIF A;  2K5N A;  2L5T A;  1E7Z A;  4LMQ D;  1V1O A;  3GTQ B;  2LXK A;  3MA2 B;  2JEA I;  2B2V C;  5IGB A;  3MFG A;  1KRS A;  5AJ3 L;  3QG1 A;  4DAV A;  2DNE A;  2WP8 J;  1X55 A;  5DEH A;  4ZYS A;  2L4N A;  1GD7 A;  1KNE A;  2OQK A;  2E75 C;  4FVM A;  4A3F B;  3ND8 A;  1OTC A;  4Y52 H;  2B8F A;  1SBB B;  5C5M A;  4TQU S;  4OGQ C;  5FKA C;  4X66 L;  4DV1 L;  2B2W A;  3OIP A;  4DR2 Q;  1H9S A;  1UEB A;  5JJZ A;  1PH3 A;  4BWG B;  4B9W A;  4LF4 L;  1AH9 A;  4GZY C;  1ILQ A;  2I5M X;  2B2U C;  1VQ9 A;  5KEE A;  4JV5 Q;  1HXY D;  2ID0 A;  1BXT A;  1STN A;  2F52 A;  1HUM A;  4DR1 Q;  4X6A H;  1SE4 A;  2MFI A;  4C56 C;  4J1M A;  4LF7 L;  5IYD G;  1SYE A;  5C4X B;  3CXC A;  2BE5 C;  3TZD A;  5FLM G;  3OW7 A;  1HZA A;  1CKO A;  1LT4 D;  5IIF A;  2R93 G;  4JI5 Q;  1D7Q A;  3F2B A;  3TBI B;  4DAM A;  2IX1 A;  4IN3 A;  4A3I H;  5D3D A;  3SHL A;  2CW0 C;  1HR0 L;  4IUU A;  3D0F A;  1QNU A;  4JBK A;  4UP8 A;  3MAQ A;  1B70 B;  2VNU D;  2V4D A;  2UUB Q;  5COR A;  1HNW L;  2R7Z G;  4IOA A;  1HH2 P;  3HOU H;  3T4A C;  3BYT B;  4POF A;  5ELE A;  3T1Y Q;  1NMF A;  2E2J H;  1BVS A;  3PO2 B;  2K5H A;  2L11 A; 
#chains in the Genus database with same CATH homology
 3NEN A;  4LUZ A;  3CC7 A;  1IBM L;  4YY3 L;  1C0A A;  4R4Q A;  1N9W A;  4UPA A;  4JI3 L;  3S24 A;  1YI2 A;  2GVA A;  4IOC A;  4JI7 Q;  4LF5 Q;  4B3R L;  5IYD H;  5IP7 H;  1Q7Y C;  4HJ7 A;  1UE6 A;  5IYC H;  5EAY A;  4K0K Q;  5GAG C;  4JI8 Q;  4DR7 L;  1E1T A;  5HGQ A;  4TVA B;  3PGZ A;  3RLO A;  5M5X H;  1L2F A;  3KF6 A;  1I94 L;  4BY1 G;  4HIM A;  2OCE A;  2R93 H;  1M1K C;  4DV7 Q;  4APV A;  3FKI G;  2DGY A;  1Q46 A;  4LFA Q;  4DR5 Q;  3HOZ G;  4WJ4 A;  3RLF A;  1Q12 A;  4P74 A;  1J6Q A;  1VQF A;  4DV3 Q;  2UU9 Q;  3G71 A;  4DUY L;  4A93 G;  4GOP C;  4C3I H;  1VQG A;  1X56 A;  3GTL H;  1N36 L;  2R92 H;  4AQY L;  2ATW A;  3S17 H;  1X65 A;  1J5E Q;  4IJL A;  5ELN A;  2PQA A;  4JC0 A;  2PMZ E;  3BZC A;  2MO0 A;  2KBN A;  4NB3 A;  4RMF A;  4MZ9 A;  4DV4 Q;  2R7Z H;  2MO1 A;  2WAQ E;  3JAM c;  3I4M G;  2Z6K A;  2ZTC A;  4GS3 A;  3W5O A;  1PH2 A;  5IWA L;  2A8V A;  3KOJ A;  3PUX A;  1P8L A;  4YWL A;  2HHH L;  2NZO A;  4LF6 L;  2Y0S G;  4LW1 A;  4NPS A;  4H02 A;  1XPR A;  4GN4 B;  2E2H H;  3PF4 A;  1A62 A;  2WB1 E;  3ER0 A;  4DR4 Q;  2JA9 A;  2HIX A;  1MIU A;  1X3E A;  5BR8 L;  4LF9 L;  1SFO H;  1ASZ A;  1IZ6 A;  3H0G H;  1N33 L;  4JI4 L;  3A5Z B;  1IBL Q;  2OWO A;  2UXC L;  2A1A A;  4BY1 H;  4ME3 A;  1QZG A;  4JBW A;  2UXD L;  4A3L G;  3FKI H;  3HOZ H;  3E9I A;  4IPC A;  3AYH B;  4BA1 I;  3PIO A;  3PV0 A;  4PG3 A;  4GKK Q;  4BXX H;  1XMO L;  3W1B A;  1WOC A;  1SR3 A;  4C2M H;  4B3S Q;  4JOI C;  3CCE A;  2VW9 A;  2NVX H;  4JI0 Q;  4JI7 L;  4OO1 G;  2CKZ B;  2YU9 H;  3PUW A;  3PIP A;  2D0P A;  1RL2 A;  1KD1 C;  1JJG A;  1WYD A;  3CME A;  1Q86 C;  3K8A A;  1I3Q H;  3HOY G;  4JG2 A;  1XJV A;  2GVB A;  1PYB A;  2VY3 A;  3KJP A;  3I4M H;  2PI2 A;  1Y1W H;  1FJG L;  2ZM6 Q;  3RNU A;  4YHH L;  4B3M L;  5E7N A;  3NEL A;  3WWV A;  1D8L A;  5C3E G;  5LMU Q;  4A3K H;  1KAW A;  1XMQ Q;  1KL9 A;  3MEF A;  4IFD G;  2RF4 A;  3K7A H;  3S1R H;  3U50 C;  2JK8 A;  4OWW B;  2NVT H;  1B7Y B;  3RZO H;  1PHJ A;  2Y0S E;  5M5Y H;  4KHP L;  3JAM i;  1PVO A;  2NN6 G;  4JI6 Q;  4A3D G;  1T9H A;  3UDI A;  3A5U A;  3HOV H;  1Q8K A;  4DNI A;  1CKM A;  2D62 A;  4QIW E;  5GRO A;  4JYA L;  2Q2U A;  1B8A A;  1TWG H;  1IYJ B;  1L1O B;  1SLJ A;  2PI2 E;  3CPF A;  4GOP B;  1Q81 C;  4A3G G;  1LTL A;  2VQF Q;  2JA7 G;  2YTX A;  1TWF H;  4NXN L;  4DK6 C;  3TRE A;  2IY5 B;  2OTJ A;  1Q1E A;  1PYS B;  3E0E A;  4IFD J;  2KHJ A;  3HOW H;  4DV6 Q;  3HKZ E;  4HJA A;  1VQL A;  4KHZ A;  1OXU A;  4DUZ L;  1K0R A;  4JBJ A;  2V1C C;  4L5S A;  1VS0 A;  3M4P A;  3S14 H;  1HZC A;  3J7A 5;  4HJ9 A;  1Y1V G;  1A63 A;  4KLK A;  5C4J H;  4DR3 L;  1N34 L;  1PH8 A;  3HOY H;  1HZB A;  4EQ5 A;  2K5V A;  3KLW A;  1C7Y A;  3GDE A;  4LUO A;  1S72 A;  1MKH A;  4BA2 I;  2F3I A;  2IT1 A;  3JC6 6;  4EX5 A;  3RN2 A;  3W1G A;  3RN5 A;  1XNR L;  1YVC A;  4IPH A;  5IYB G;  1YZ6 A;  3I7F A;  1G6P A;  3GTO H;  3CCJ A;  1VCI A;  3TQY A;  3VDY A;  1EYG A;  4GKJ Q;  2F4V Q;  2B3G A;  4OX9 L;  5C3E H;  4DV2 Q;  1EQR A;  2BH8 A;  4JI1 Q;  1QUQ A;  1XPO A;  3J7Z C;  1I5F A;  1VQ8 A;  1SN8 A;  5JEA G;  2UXB Q;  3T1H L;  1VQ6 A;  3S1Q H;  3D31 A;  4OWT B;  1HNX L;  1LYL A;  2N8N A;  4X65 L;  3TS2 A;  4QY7 A;  2XGT A;  5M5W H;  1M90 C;  4ALP A;  2AKW B;  1SRO A;  4XTC S;  4A3F G;  2WB1 G;  4A3G H;  2NZH A;  3I55 A;  3I56 A;  2JA7 H;  3RLN A;  3A74 A;  4A3J G;  2OQ0 A;  3Q8D A;  4R4C A;  2KHI A;  1UWV A;  4P75 A;  3UDF A;  5M3F H;  4HJ8 A;  4DR2 L;  4LF8 L;  4R1J A;  3L2P A;  1VQN A;  2D0O A;  1S40 A;  5FLM H;  1KHI A;  1A8V A;  5JEA J;  2K75 A;  2N78 A;  3KJO A;  1Y1V H;  5LMN Q;  1QVC A;  2UUC Q;  2JQO A;  4JV5 L;  2YYZ A;  3HKS A;  4YWK A;  4LFB Q;  5IYB H;  1EUJ A;  1X3F A;  3CAM A;  1NTG A;  4YCV A;  1PA6 A;  4DR1 L;  2R6G A;  4IJH A;  3L7Z C;  1HJP A;  1SRU A;  3GTQ H;  2QGQ A;  4AYB G;  1KRT A;  5C44 G;  4LNQ A;  5C4X G;  5AJ3 Q;  1YEZ A;  4GNX B;  3AQQ A;  4JBM A;  4PMW A;  3I4N G;  1GVP A;  3GD7 A;  3U4V A;  2ES2 A;  1EFW A;  1BBW A;  1NMG A;  1KIX A;  3CCR A;  3PO3 H;  4JI5 L;  3L0O A;  4YCU A;  2CCZ A;  1IBK L;  4MNO A;  2Z6K C;  1WJJ A;  4P71 A;  2OTL A;  4A3C G;  4A75 A;  4B3T L;  3HFZ B;  3STB D;  2QEX A;  3TEH B;  2E5L Q;  4X66 Q;  4POG A;  1YIJ A;  3ERS X;  4DV1 Q;  3KYH C;  5H1S E;  1L1O A;  1Y14 B;  4GLV B;  4X64 Q;  1PH7 A;  5LMN W;  1LM0 A;  2Z0S A;  3IRB A;  4X62 Q;  1YJN A;  3ULL A;  1GM5 A;  2UUB L;  3S2D H;  1XNQ L;  1NJI C;  5C0X G;  4LF4 Q;  2ZTE A;  5IE8 A;  3RZD H;  4NXM L;  1TWA H;  1HZ9 A;  3LGJ A;  4P73 A;  4DV0 L;  2VQE L;  3S1N H;  2K52 A;  3HKZ G;  3T1Y L;  2ZJP A;  2EQS A;  1AE3 A;  1GKH A;  3CCL A;  3PO2 G;  1JJC B;  2JA8 G;  2CWA A;  4YWM A;  3ZJY C;  5IY0 A;  2UUA Q;  3KDF A;  3E9H A;  3J81 c;  4LF5 L;  1R9T H;  1MJC A;  4A93 H;  3STB C;  5C44 H;  3M85 A;  1X9N A;  4K0K L;  1TWC H;  5C4X H;  4LUV A;  4JI8 L;  4JI2 Q;  1IXR A;  4OON A;  3OW2 A;  4AYB E;  1DGS A;  4Y7N H;  2ZJR A;  5LMN L;  4JCV E;  2MNA A;  2YV5 A;  1EIY B;  4DPG A;  3I4N H;  5C0X J;  4OO1 I;  1FVI A;  4DV7 L;  1CUK A;  4LFA L;  4DR5 L;  3S1M H;  5IT9 c;  4OWX B;  4DV5 Q;  3EBE A;  4A3C H;  1N32 Q;  1VQB A;  2R7D A;  4DV3 L;  1XPU A;  1P16 A;  1Z47 A;  1S3O A;  1UE7 A;  1BKB A;  4C3J H;  2UU9 L;  4R4I A;  1VQD A;  3M3Y H;  1VQJ A;  3PUZ A;  3GTJ H;  1HR0 Q;  2FXQ A;  1PH1 A;  3KF6 B;  1I50 H;  1J5E L;  1YHB A;  2YTY A;  3OTO Q;  4DV4 L;  2JA6 G;  2Q2H A;  3ULJ A;  1VQP A;  1PH9 A;  4IFD I;  2HQL A;  2IHF A;  4DR6 Q;  1G51 A;  1VQI A;  1HNW Q;  1PH5 A;  2JEB I;  4GLX A;  4A3L H;  3G6E A;  3M7N A;  4LFC Q;  2NN6 I;  5ELO A;  3T1H Q;  4A3I G;  2E5L L;  3PO2 H;  1LUZ A;  1WCM G;  2JA8 H;  2A19 A;  4YY3 Q;  4DR4 L;  2QA4 A;  4B3R Q;  2AWO A;  3ICE A;  1O7I A;  2C35 B;  1G29 1;  1UE1 A;  2K50 A;  3M4Q A;  4C3H H;  3AFP A;  2LSS A;  1H95 A;  4DR7 Q;  1K3R A;  1VQ5 A;  1IBL L;  3CMA A;  3NEM A;  1XTD A;  1JE5 A;  4HIK A;  3U58 A;  4MTN A;  1I94 Q;  2LXJ A;  3U4Z A;  3CC2 A;  1PFS A;  4GNX A;  3CC4 A;  3KFU A;  3DM3 A;  4GKK L;  2K4K A;  2CWP A;  4A3M G;  3KF8 B;  4B3S L;  1W2B A;  2ALY B;  4JI0 L;  2PNH A;  1NE3 A;  4A3B G;  4QJF A;  3BU2 A;  1CSP A;  2NVY H;  4DUY Q;  5HY6 A;  1YBY A;  3ULP A;  2L15 A;  4HIO A;  1OXV A;  4R4O A;  1N36 Q;  4AQY Q;  1UE5 A;  4A3D H;  2MQH A;  4HID A;  1JB7 A;  2Q2T A;  2JA6 H;  1PH6 A;  1QVF A;  3UDG A;  3K7U C;  2JJQ A;  1JJ2 A;  2ZM6 L;  1Q82 C;  5DLQ E;  4PZ6 A;  1NBW A;  4O2D A;  2BH2 A;  5IWA Q;  2HT1 A;  4A4I A;  5LMU L;  1XMQ L;  4WJ3 M;  3I4O A;  2VS1 A;  4UY8 C;  2HHH Q;  4LF6 Q;  2JE6 I;  1WCM H;  2AWN A;  4BY7 G;  1FL0 A;  1KXL A;  4OXP A;  4DAY B;  3GTG H;  2HIV A;  4JI6 L;  4L5Q A;  1TXY A;  1K8G A;  2B29 A;  2RCN A;  5BR8 Q;  2JA5 G;  4LF9 Q;  1N33 Q;  3BZK A;  4JI4 Q;  2NVQ H;  1SMX A;  3PSI A;  2UXC Q;  2ZTD A;  4PZ7 A;  4YCW A;  4QGU A;  1C9O A;  2VQF L;  1N8R C;  1E3P A;  2UXD Q;  3CP0 A;  1E24 A;  1IL2 A;  1EOV A;  3AFQ A;  1YHA A;  3F2D A;  4A3M H;  3PCO B;  1OXX K;  4LWC A;  2R7F A;  3J81 j;  2N3S A;  1FGU A;  4DV6 L;  1VQE A;  1YNX A;  4UP7 A;  2K14 A;  5GQO A;  2EXD A;  1L0W A;  3UE1 A;  1KQS A;  4RG1 A;  1ASY A;  3GTK H;  4A3B H;  5JJL A;  3OYY A;  1E22 A;  1VQM A;  4IPD A;  2BA1 A;  3PUV A;  3BJU A;  1Z9F A;  3H0G G;  4AH6 A;  3H15 A;  3F2C A;  4A76 A;  1EWI A;  3F8T A;  4A3F H;  1OXS C;  1FJG Q;  1QVG A;  3A0J A;  4GKJ L;  4YHH Q;  4B3M Q;  2F4V L;  4A3J H;  4DV2 L;  2I5L X;  3MXN B;  4JI1 L;  4BXX G;  1WI5 A;  3G4S A;  1XMO Q;  4BBR G;  5FLX c;  4GOP A;  4BY7 H;  3CPW A;  3S15 H;  5FJ8 G;  1L1O C;  2AMC B;  2UXB L;  4IO9 A;  1YJ9 A;  4KHP Q;  4GN3 B;  1CKN B;  2VUM G;  3S16 H;  4GLA C;  2IHE A;  1VQC A;  2JA5 H;  2ASB A;  1A0I A;  1EQQ A;  3PUY A;  3J80 c;  4XIG S;  4JYA Q;  5JJI A;  1Y1W G;  1QUQ B;  2EIF A;  4UP9 A;  2H5X A;  5J3B A;  3H3V I;  5IP9 G;  1K9M C;  1WFQ A;  3I2Z A;  4NXN Q;  4A3K G;  4BBS G;  2CQO A;  5C0X I;  1HNZ Q;  1YJW A;  1VQ7 A;  4LF7 Q;  4KI0 A;  1OXT A;  2RHS B;  5M3M G;  4DUZ Q;  1RIP A;  4QL5 A;  2KEN A;  3EIV A;  2UUC L;  1NY4 A;  2I5H A;  3HOV G;  4DR3 Q;  1N34 Q;  3K80 C;  2ZJQ A;  2B63 G;  4LFB L;  1EIF A;  1W3S A;  1YHQ A;  1XNR Q;  2K5N A;  5JJK A;  1E7Z A;  1E1O A;  3SGI A;  1KC8 C;  1GO3 E;  2LXK A;  3M4O H;  4O0A A;  4HJ5 A;  4JOI A;  3K0X A;  3UE0 A;  3FP9 A;  1K73 C;  4OX9 Q;  2JEA I;  3HOW G;  4BBR H;  1BBU A;  1X6O A;  1KRS A;  5AJ3 L;  5FJ8 H;  1U0L A;  2WP8 J;  4J15 A;  1MJE A;  3H3V H;  1X55 A;  4R4T A;  3M9B A;  1I6H H;  1PH4 A;  2VUM H;  1HNX Q;  1K8A C;  1VQO A;  3GO5 A;  1GD7 A;  4X65 Q;  2OQK A;  3TRZ A;  1AE2 A;  2BA0 A;  1OTC A;  2KCT A;  2I0Q A;  4Y52 H;  3PF5 A;  5IP9 H;  1QZH A;  4TQU S;  3CCV A;  4X66 L;  2E8G A;  4DV1 L;  1IBM Q;  2PQA B;  3CCS A;  2E2I H;  4BBS H;  3FHW A;  4AIM A;  1V43 A;  4JI3 Q;  4X64 L;  2RHQ B;  4DR2 Q;  4A3E G;  3RR5 A;  2KCM A;  4GN5 A;  5M3M H;  2N49 A;  1JMC A;  4LF8 Q;  4X62 L;  2WFW A;  1UEB A;  3HOX G;  5GAD C;  1TWH H;  3J80 i;  1PH3 A;  3CD6 A;  5GAH C;  4LF4 L;  1AH9 A;  5GAE C;  1Q1B A;  2I5M X;  3HOU G;  1VQ9 A;  2DUD A;  3B6Y A;  3TS0 A;  2B63 H;  1VQH A;  4JV5 Q;  3NBH B;  3J81 i;  2ID0 A;  4IPG A;  4GNX C;  3G48 A;  2F52 A;  1JT8 A;  1VQ4 A;  1SE8 A;  1HR0 W;  2UUA L;  3UDX A;  4DR1 Q;  4X6A H;  2MFI A;  1HNZ L;  1CSQ A;  4QQB X;  3CCM A;  5M3F G;  4LF7 L;  5IYD G;  3CF5 A;  3CXC A;  5IP7 G;  4DK3 C;  4JI2 L;  5IYC G;  5FLM G;  1X3G A;  1VQA A;  1HZA A;  2GN5 A;  3F1Z A;  4L5R C;  3EN2 A;  1VQK A;  1CKO A;  3S2H H;  1K83 H;  2VZA A;  2VL6 A;  2AHO B;  3K81 C;  1V1Q A;  3CCU A;  4L5T A;  4JI5 Q;  2R93 G;  3KDF B;  4DV5 L;  3F2B A;  1IBK Q;  1N32 L;  1D7Q A;  1CKN A;  4DAM A;  2IX1 A;  4B3T Q;  3GTP H;  4A3I H;  2CFM A;  3CQZ H;  4FDB A;  4P72 A;  1HR0 L;  3CCQ A;  5K36 G;  1U5K A;  4A3E H;  3D0F A;  4JBK A;  2R92 G;  4PZ8 A;  4UP8 A;  3GTM H;  2Q2I A;  2WAQ G;  3OTO L;  1YIT A;  3HOX H;  1B70 B;  2VNU D;  3CW2 C;  2UUB Q;  4DR6 L;  1HNW L;  2IX0 A;  2R7Z G;  3DLL A;  1PV4 A;  1XNQ Q;  3PO3 G;  4IOA A;  1HH2 P;  3HOU H;  4NXM Q;  2XTI A;  3AEV A;  4DKA C;  2YTV A;  4DV0 Q;  4LFC L;  2VQE Q;  4POF A;  1X54 A;  3T1Y Q;  1NMF A;  1V9P A;  1BVS A;  2E2J H;  2K5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...