1S3OA

Human mitochondrial single strand dna binding protein (hmssb)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
116
structure length
107
Chain Sequence
LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein, mitochondrial
publication title Sequence-structure mapping errors in the PDB: OB-fold domains
pubmed doi rcsb
total genus 15
structure length 107
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1s3oA00
1YHQA 1I94Q 2NN6I 1OXUA 3CCSA 4JI5L 3TS2A 4A75A 4IPCA 3IRBA 2D62A 3W1GA 4YY3L 2OTLA 4X6AH 2K14A 3PF5A 2ID0A 4QIWE 3TRZA 1Z47A 4UPAA 1IL2A 3EN2A 4GLXA 3FKIG 1Q82C 1LTLA 4DV4Q 1SLJA 1J5EQ 2Z0SA 4YCUA 1KL9A 5FJ8G 4DV1Q 1XNRL 4QGUA 4WJ3M 2RF4A 3U4VA 4JOIC 4R1JA 5E7NA 4LUOA 1XMOL 1GKHA 1X54A 4P72A 1YI2A 1SRUA 1RL2A 4J15A 5IYBH 3JC66 4O2DA 4LFBL 3I4NH 1VQIA 1HZAA 4A3DH 5IWAL 1UE6A 1VQAA 1Y14B 4A3LG 4YWKA 1K73C 1S3OA 5IYDG 3CP0A 2NVQH 4OO1I 4LF8Q 3F1ZA 4H02A 1I5FA 3RN5A 4UP7A 5FLMG 1A8VA 3FP9A 5EAYA 4DK6C 1CSPA 4X64L 2ZM6Q 1YNXA 1PV4A 1GM5A 5LMUL 3ER0A 1VQ7A 1E7ZA 4A3CH 2I5MX 5HY6A 3UDIA 4LUZA 3GTKH 4JI2L 2B63G 4DPGA 4KHPQ 1VQDA 2UUAL 2UXBL 2CCZA 1G6PA 4R4OA 4DR5Q 3GTQH 1VQJA 2K50A 3KF8B 4DV0Q 5DLQE 5IP9G 5IYCH 3PIOA 3CMEA 4NB3A 2NVTH 4QQBX 1UWVA 2JQOA 1U5KA 1S40A 4MZ9A 2PI2A 3H0GG 3OTOQ 4DUYL 3HFZB 4LF4L 2R7ZH 4DV3Q 4X62L 1KQSA 3CCJA 4GKKL 2KCMA 3I55A 2F52A 2QEXA 2K5VA 2RCNA 1NE3A 1YEZA 5C44H 4A3GG 2ZJRA 2VQEQ 3A0JA 3AFQA 5FLXc 1XJVA 3S15H 1BBWA 1YHAA 3ERSX 2UXDQ 2JA7G 2OQKA 3K0XA 2K52A 2R7FA 2JE6I 3M4QA 1L1OB 2VZAA 3MXNB 3OW2A 1I50H 2HQLA 2EXDA 4B3SL 3SGIA 5M3MH 1HNXQ 4A3KH 2PQAB 2AMCB 1L0WA 3GTMH 4JC0A 1JT8A 1VQ5A 4X65L 1QVGA 2Q2IA 3I7FA 1CUKA 4HJ5A 1Z9FA 5M3FG 1VQPA 1PH3A 5GROA 3PGZA 3UDGA 1DGSA 1C9OA 1S72A 4LF7Q 2E5LQ 1I6HH 5C3EH 4NXML 1A62A 3A74A 4PZ6A 5GAHC 1IBKQ 4BY1H 3HKZE 2E2IH 1FJGQ 2Y0SE 1UEBA 4B3TQ 1X55A 3HOUG 4P73A 2C35B 4QL5A 3EBEA 2IHEA 4DKAC 1WOCA 3T1HQ 4B3MQ 4K0KQ 4BBSG 1TWAH 1OTCA 3HOWG 1V9PA 4GN4B 4QY7A 3DLLA 2AHOB 4A3EG 4HIMA 1YJNA 1K9MC 2VNUD 4JI1Q 3M4PA 2CWPA 2NN6G 4JI6Q 1OXVA 4X66Q 1XNQQ 4IJHA 4IOAA 2KENA 3KLWA 1VQLA 1JMCA 5J3BA 2R92H 1IBLL 1IYJB 1VQBA 1Q1BA 3CCQA 4IFDI 4A3LH 4JI0L 4LFAQ 4IO9A 3UE0A 3A5ZB 2JA5H 1PHJA 4UP8A 3CCVA 4PZ7A 4DR1L 1K83H 1L1OC 4LF5L 3KDFA 2B3GA 1C7YA 4DR7Q 2IX1A 2BA1A 4DV2Q 4BY7G 4A93G 1EFWA 2UXCL 2AKWB 1E22A 2YV5A 3CCRA 4YHHL 1D8LA 4AQYQ 1EQQA 3HKZG 4YWLA 2Y0SG 3K8AA 1X3EA 3GTLH 4LF9Q 5JJKA 4OO1G 4WJ4A 4LF6L 1VQEA 3VDYA 4XTCS 2PI2E 4B3RQ 4DR2L 2I0QA 2CFMA 1EUJA 4A3FH 1XNRQ 1AH9A 2PMZE 2JA8G 1B7YB 3ULJA 2E2HH 3PUVA 4YCVA 1N33L 3S24A 2K4KA 1UE7A 1FGUA 4PZ8A 5M5XH 3ULPA 4A3MG 3F2DA 4ALPA 1EQRA 1TXYA 4Y7NH 3T1YL 4A3IH 5GQOA 3KJPA 3H3VH 1FVIA 3RR5A 1HNZL 1PH7A 3UE1A 5HGQA 3G48A 4PG3A 3RLFA 4LUVA 1X3FA 2E8GA 2VQFL 3GDEA 1QUQA 4JG2A 1PH4A 1M1KC 1MJEA 3BZKA 4JI4Q 4GNXA 4IPHA 1HR0Q 3I4MG 3HOZH 3RZOH 1QVFA 2JEBI 4GKJQ 1K8AC 3NENA 4A76A 1N32Q 4GN5A 2UXBQ 4NXNQ 3CC4A 1T9HA 1PVOA 5BR8L 1B8AA 2F4VL 1P16A 1BVSA 2K75A 2RHQB 2DUDA 4JI3L 1B70B 2V1CC 5GADC 4DR3L 4BBRH 4A3JH 2UUBL 2NVYH 4RMFA 2Z6KC 4DUYQ 2UU9L 4DV7L 4LF4Q 1N34L 5C4JH 3L0OA 2Q2UA 1VQKA 3GTOH 1WJJA 1EYGA 2IHFA 1IZ6A 1H95A 1X56A 1KHIA 2JEAI 5LMNL 3FKIH 4OX9L 4DR6L 4C3JH 1TWGH 2QGQA 4HJ9A 5FJ8H 3I2ZA 3M9BA 3L2PA 1PH9A 4C2MH 3J81j 4B3SQ 3GO5A 3NBHB 2FXQA 4JOIA 2OWOA 1HNWL 2N8NA 4KI0A 3TS0A 5JJIA 1N36Q 1EIFA 1VCIA 2OCEA 4IPGA 5JJLA 1YJ9A 4LNQA 3CD6A 1HZCA 4RG1A 1NJIC 2NVXH 3CCLA 1Y1VG 2MFIA 4FDBA 5IYDH 3H3VI 4DUZQ 2YU9H 5FLMH 2XTIA 2JA9A 2HIXA 4GOPB 3HOVG 4APVA 4JI7Q 2LSSA 4R4TA 2IY5B 5GAEC 1I94L 2DGYA 3D0FA 5LMNW 1L2FA 3NEMA 2CKZB 3F8TA 4BA2I 1V43A 2B63H 1HZ9A 3CC2A 4A3BG 3F2BA 1PYSB 1GVPA 2EIFA 3PIPA 3G4SA 1G291 4P71A 3PV0A 5IP9H 3G6EA 2N78A 1YJWA 3PO3G 4DV4L 1OXSC 4DV1L 3J81c 3S17H 3BU2A 3BZCA 3AYHB 2HHHQ 4UY8C 3H0GH 3K7UC 5C0XI 2ALYB 1CKNA 2BA0A 5IE8A 1IBMQ 4OXPA 1YIJA 1PH6A 3BJUA 1EIYB 1CKNB 3GTJH 4MTNA 4LWCA 3KF6B 1KRTA 3WWVA 4A3GH 3PUXA 3RLOA 1EWIA 4HJ7A 4LF8L 4JBJA 4JCVE 4JI0Q 2JA7H 3M4OH 4AYBE 2ZM6L 3CF5A 1C0AA 1Q12A 3U50C 3K80C 2UUCL 1VQHA 2JK8A 2UXCQ 1X3GA 1XMQQ 4KHPL 1YITA 2ZTCA 3F2CA 4QJFA 1MIUA 5M3FH 4PMWA 4OWXB 4DV0L 4LFCQ 3PO2G 1NMFA 1PA6A 1VQFA 4LF6Q 4DR4Q 1QUQB 1RIPA 4ME3A 3S2DH 2IT1A 4DV5Q 4GNXB 1I3QH 4GOPC 1Q86C 2KHJA 2WFWA 1Q8KA 4DV3L 2WAQE 4XIGS 4R4QA 3AQQA 3HOXG 5IP7G 5AJ3Q 3G71A 4AH6A 4JYAQ 3CXCA 3HOUH 1ASZA 1AE3A 4JI8Q 1SMXA 1QVCA 4P74A 1TWHH 2VQEL 4BBSH 3HOWH 1HZBA 1SR3A 2R93G 2ES2A 1KAWA 4A3EH 4TQUS 3S1RH 3ICEA 5C4XG 3I56A 3TQYA 1Y1WG 1PFSA 4JV5L 1HNXL 3PUZA 4DAMA 4JI5Q 4AYBG 4YY3Q 2N49A 1G51A 2R6GA 1U0LA 3PUWA 3STBD 1YZ6A 4HIDA 4MNOA 4KHZA 4JBWA 2HT1A 1JJGA 3PUYA 1KD1C 2E5LL 1IBKL 1FJGL 1XMOQ 1A0IA 1L1OA 3GD7A 2L15A 3LGJA 5H1SE 2UU9Q 4B3TL 4A93H 4BY7H 4LFBQ 4YWMA 2JJQA 1HJPA 3NELA 2GN5A 5IWAQ 1NMGA 3CPWA 2E2JH 2K5HA 2WAQG 4K0KL 2R7DA 4DV6L 1WCMG 4HIKA 3T1HL 4B3ML 3HOYG 1EOVA 4BXXG 2F3IA 2VW9A 4X64Q 1SFOH 4JI1L 3M7NA 5LMUQ 2YTVA 1E24A 4JI6L 2YYZA 4X66L 1XNQL 2VL6A 4GNXC 2JA8H 2B29A 1JB7A 3KFUA 4JI2Q 4Y52H 1SROA 1TWFH 2UUAQ 4OWTB 1LUZA 4A3MH 2H5XA 1V1QA 1GO3E 1OXXK 1R9TH 1JE5A 1XTDA 1OXTA 4C3IH 2Q2HA 3CQZH 3W5OA 3M85A 3OYYA 4LFAL 3KJOA 1NTGA 2D0OA 3K7AH 3TEHB 5IT9c 2NZOA 3PSIA 3GTPH 4DR7L 1CSQA 4X62Q 1Q81C 4DV2L 4DK3C 5IYBG 2K5NA 4DAYB 3JAMc 1KIXA 1LYLA 3I4NG 4A3DG 3HKSA 4OWWB 3I4MH 4DNIA 4AQYL 4GKKQ 3U4ZA 1VQ6A 4GLVB 3RNUA 4LF9L 4IFDJ 2AWOA 3M3YH 1VS0A 4R4CA 1E3PA 1P8LA 3CW2C 3J81i 3CC7A 2KBNA 2GVBA 4GS3A 2VUMG 3PCOB 3UDFA 4IOCA 1PH5A 1VQGA 1E1TA 4B3RL 5IY0A 1VQ8A 3GTGH 3ZJYC 4A3CG 3U58A 4X65Q 2Z6KA 1VQ9A 3E0EA 3J80i 2LXKA 2BH2A 3EIVA 2MO1A 5IYCG 2WB1E 1VQNA 1VQMA 1IXRA 1M90C 2ATWA 1QZHA 4NXMQ 4C3HH 5GAGC 1GD7A 2R7ZG 4L5SA 3S14H 1Q46A 4JI4L 5M5YH 2Q2TA 1HH2P 2QA4A 3E9HA 1HR0L 2YTYA 2UUCQ 1E1OA 2MO0A 4R4IA 1O7IA 4IFDG 2N3SA 1ASYA 4A4IA 5M5WH 5C44G 1JJCB 3DM3A 4UP9A 4GKJL 1KRSA 4L5QA 1N32L 4NXNL 3A5UA 2VY3A 1J5EL 3FHWA 3KDFB 4HIOA 3W1BA 4P75A 3S1NH 1Y1VH 1VQCA 3CCEA 2OQ0A 1UE5A 3KYHC 3J7ZC 3CCUA 5M3MG 1NBWA 4A3KG 3HOVH 4L5TA 4HJAA 2A8VA 4NPSA 5ELOA 1UE1A 1LM0A 2XGTA 2D0PA 3CCMA 1IBLQ 3J80c 4A3BH 1Q7YC 3S16H 2AWNA 1HR0W 1XPRA 3H15A 5C3EG 2VS1A 3PO3H 4DR1Q 2OTJA 2WB1G 4LF5Q 4BY1G 4EQ5A 1WI5A 1VQ4A 1CKOA 5K36G 4YHHQ 4IPDA 1JJ2A 3RZDH 4DR5L 1N36L 3STBC 1N8RC 1KXLA 1BKBA 4EX5A 1MKHA 4JV5Q 3AEVA 1WYDA 3OTOL 1K8GA 1K3RA 4DUZL 4DR2Q 1A63A 4GLAC 1CKMA 3ULLA 4JI7L 1N33Q 2UXDL 2R92G 4L5RC 3S2HH 4BA1I 1SN8A 1W2BA 3E9IA 5JEAJ 1PH2A 1XPOA 3T1YQ 1MJCA 4JBMA 3RN2A 2KCTA 2I5LX 2NZHA 2ZJQA 2LXJA 1HNZQ 1WFQA 3MEFA 3UDXA 2I5HA 4DV6Q 1X9NA 1X65A 4LW1A 2JA5G 3PO2H 1YBYA 1K0RA 2VQFQ 1D7QA 2GVAA 1NY4A 3I4OA 4TVAB 2HHHL 2VUMH 3CAMA 1Q1EA 1X6OA 1IBML 1VQOA 3HOXH 4GOPA 4HJ8A 5IP7H 3S1MH 1PYBA 1J6QA 2YTXA 5BR8Q 2JA6G 2F4VQ 4LF7L 1YHBA 2CQOA 4POFA 1QZGA 4DR3Q 4JI3Q 4AIMA 2R93H 2UUBQ 5C0XJ 5C4XH 4A3FG 3JAMi 1Y1WH 2ZTEA 4DV7Q 3S1QH 1N34Q 1SE8A 5JEAG 2PQAA 1XMQL 1PH1A 3Q8DA 4IJLA 4A3IG 5LMNQ 2KHIA 3J7A5 4LFCL 3CPFA 4YCWA 3RLNA 2PNHA 3KOJA 4OX9Q 4DR6Q 2ZTDA 3KF6A 4GN3B 3PF4A 5ELNA 4DR4L 1AE2A 1W3SA 1BBUA 2CWAA 3D31A 2JA6H 4DV5L 2ZJPA 4POGA 3HOZG 2WP8J 4KLKA 3TREA 1XPUA 1N9WA 1FL0A 2MNAA 4JYAL 5AJ3L 1HNWQ 2A1AA 4O0AA 2A19A 3L7ZC 2HIVA 4JI8L 3CMAA 3B6YA 4OONA 4JBKA 2MQHA 1WCMH 1PH8A 3AFPA 5C0XG 3K81C 2EQSA 3HOYH 1YVCA 4A3JG 4BBRG 1TWCH 2IX0A 1KC8C 2RHSB 4BXXH 2BH8A 2ASBA
chains in the Genus database with same CATH superfamily
1K8MA 1I94Q 2NVTB 4JW0A 2J7ZA 4A75A 4IPCA 2D62A 5I6WA 3PF5A 2R7ZB 3SK5A 3FKIG 4C3JG 1LTLA 1J5EQ 4CDCC 2Z0SA 1F2LA 4DV1Q 5FJ8G 4WJ3M 5BN3A 3I91A 4R1JA 5LL6X 3MAQA 1YI2A 1XMOL 1SNMA 1SRUA 2ENBA 4UAIA 3MZ5A 1PTOH 1ZYRD 1PDQA 1PFMA 2EVBA 3L3OC 3F1ZA 3RN5A 4UP7A 2F0MA 2ZM6Q 1PV4A 1A3TA 2K33A 5LMUL 1GM5A 1FNWA 3ER0A 2CVRA 2MJ8A 3NTKA 4LUZA 2O2LD 3GTKH 2B63G 4OIKA 3AB9A 2WB1B 4KJNA 2CCZA 4DR5Q 5DLQE 5IYCH 2NVTH 4LMQD 1GUSA 1BF4A 2R7ZH 3HG9A 1MGSA 3CCJA 1HUMA 1JC7A 5D14A 4HCEA 4IFDH 4A3GG 3A0JA 5DM73 1YHAA 1LTAD 5D65A 2JA7G 2OQKA 2R7FA 2VZAA 2WKCA 4JV5Q 3SGIA 2JA5B 4X65L 2A68D 1XXGA 1GOZA 4QMGA 3I7FA 5M9OA 3QOJA 1WD1A 3PGZA 4RCNA 2A69C 2HUGA 1A62A 3VYUA 1D1KA 1X3PA 5IODA 1UEBA 1PYWD 2K28A 4I7AA 4DKAC 3VR5A 3CRLC 4BBSG 1OTCA 3DLLA 1KTKA 2AHOB 2EDGA 4A3EG 2VNUD 3M4PA 4JI6Q 1VF5C 1OXVA 1TR5A 4KJOA 4YIJA 2JN4A 4Q0FA 1PXUA 2XSCA 5L37A 5IGEA 5ISRA 2NUCA 1NCVA 1QJOA 1B50A 1E2WA 2SOBA 1AFPA 3UE0A 3A5ZB 2JA5H 4B9WA 5A35A 4DR1L 1L1OC 1S5DD 4LF5L 4DAPA 1C7YA 2MPMA 4DV2Q 1E22A 2LKVA 3K5MA 3K58A 3CCRA 4DU9A 1D8LA 4BBRB 4AQYQ 2NVYB 1EQQA 1X3EA 4LF9Q 2EJFC 5HURA 1ESRA 3C1EA 2I0QA 2CFMA 3V05A 5CV6A 1CT1D 1AH9A 1B7YB 3PUVA 4YCVA 1PMRA 1YNNC 3HS0C 2OEOA 1TKWB 3F2DA 2XWBB 3H3VH 5GQOA 3KJPA 4C3IG 1F9RA 3RR5A 2XRSD 2ZXPA 1PH7A 3RLFA 4LUVA 2E8GA 3GDEA 2B2UC 1PH4A 1AN8A 4GNXA 4IPHA 1O7YA 1QVFA 3I70A 4GKJQ 1LTSD 1CM9A 5IGBA 4GN5A 2UXBQ 1T9HA 2F4VL 4RCOA 2RHQB 1SYGA 3I8ZA 5GADC 4BBRH 3K5NA 2NVYH 2QDLA 2Z6KC 3VA5A 3QB3A 3MFYA 1JORA 4LF4Q 3ONAB 4FVMA 1N34L 2EY5A 2Q2UA 1D1IA 4LJZC 5FO8B 4KKSA 2IHFA 1Y69U 5CV7A 1X56A 1KHIA 1RDPD 4ZAIA 1PLFA 3MVVA 3KK7A 4OELB 3M9BA 4K5WA 3J81j 1DM0B 3GO5A 2FXQA 4JOIA 2OWOA 3AMUA 1V1OA 1HCZA 2L0CA 4IPGA 3CD6A 1HZCA 1Y1VG 2MFIA 1XX8A 4XYOA 5M3FB 4JI7Q 5FLXE 1G6ZA 2DGYA 3D0FA 1A2TA 1V43A 1SYDA 2BDOA 4X3UA 5IGDA 1PYSB 1G291 1DXMA 3ITPA 3HOUB 1SJED 3G6EA 2N78A 3PO3G 4DV4L 3J81c 3BU2A 3BZCA 1JR0D 3A8JE 2DY8A 3MTSA 2BA0A 1CKNA 3OMCA 1R4PB 2ICEC 2DY7A 3KF6B 3RLOA 1MD2D 3I4LA 5CR3A 2FHTA 4CHTB 4ZK9B 3U50C 1IYVA 5CC4A 2KJXA 1X3GA 1XMQQ 4KHPL 1YITA 2XN9C 4DV0L 4A93B 5M3FH 3N52A 4LFCQ 4OWXB 4BY7B 2HD3A 2RDHA 1QUQB 2N55A 2IT1A 4GOPC 1QNUA 4XIGS 1HTPA 4JYAQ 1JCKB 3MXPA 3HOUH 1D5MC 1ASZA 3NXWA 4JI8Q 2IX3A 2JA8B 5E4WC 5EBDA 5I9OA 4A3MB 2NBFA 4QUFA 3C3LA 1Y1WG 1R9TB 2NN6H 3D6CA 3C46A 3PUZA 4DAMA 5IIFA 2FINB 4AYBG 2R6GA 1HPCA 1U0LA 3GTPB 2AQ1B 4LK1C 2HT1A 3D4RA 3PUYA 1KD1C 1EEFD 2E5LL 5I9PA 3M3YB 1XMOQ 4ZUJA 2PO4A 5H1SE 2L15A 4A93H 4M8AA 2UU9Q 4BY7H 4B08A 4YWMA 1NMGA 1SNCA 1H9JA 2R7DA 3T1HL 4OO1H 5EBCA 4M1UB 2F3IA 2KCCA 2BDNA 3P20A 5LMUQ 1I4GA 2YYZA 2JA8H 2B29A 1BCPD 3ZYYX 4OWTB 1LUZA 4A3MH 1ICFB 3QJYA 1JE5A 5IT9E 1R9TH 4RWSC 2K1BA 1T5XD 1QE6A 3KJOA 3JAME 2D0OA 3TEHB 4KD3A 2NZOA 3GTPH 1VF7A 4DK3C 1HQRD 2Z9HA 3I4NG 2IWHA 3U4ZA 2AUJD 1KDAA 3HOVB 3OIPA 2AWOA 3M3YH 2JYOA 3J81i 4C3HG 2KBNA 3PCOB 3UDFA 5CYUA 2F4IA 1VQ8A 2EY1A 1IKLA 1SNOA 3S16B 4A3CG 4X65Q 5JPMC 5J1ZA 1BR9A 3E0EA 1PZKD 1PZID 1EL0A 2MO1A 4IURA 1VQMA 1CK1A 2ZT9C 3RZDB 1IXRA 3CHBD 2ATWA 4PMCA 2V4DA 3ERQA 4L5SA 2Q2TA 1EIGA 2UUCQ 2MO0A 1O7IA 4A4IA 3BG3A 3DM3A 1N32L 2XWJB 1J5EL 3S2HB 3KDFB 3W1BA 3D4DA 5M3MG 4A3KG 3VYRA 3J80E 3FMCA 1IHZA 3SXHA 4HJAA 3HOVH 4NPSA 5KRUA 1BCPB 1H9SB 4EQNA 4P2CB 3CCMA 1L0XB 1NSNS 2HCCA 5ELFA 3S16H 3H15A 4KK7A 4DR1Q 4LF5Q 4KN7C 4EQ5A 3DMUA 3A55A 1SBBB 3JAML 1DZ1A 3TBIB 2NB0A 3RZDH 4ODGA 3KLRA 4DR5L 5C4XB 1ENAA 3I73A 3S1QB 1QG7A 1N8RC 2R61A 1WYDA 1QNKA 4KHVA 5FK9C 2Z4HA 3S2HH 4BA1I 1SN8A 1B3AA 1W2BA 1PH2A 5JEAJ 2KEEA 5JVG3 5I2YA 4JBMA 4RKLA 3RN2A 2ZJQA 1V8QA 2LXJA 4A3LG 3MEFA 2I5HA 4U673 4DV6Q 4LW1A 2F0LA 5HGTA 1K0RA 2HHHL 3HOYB 1X6OA 1SE3A 3DWQA 1H9MA 1EU3A 3T53B 2F4VQ 2DJFC 2G9DA 2JSOA 1QZGA 2A69D 1KDBA 2RDFA 1EEID 5C0XJ 5C4XH 1B2TA 2PZUA 3S1QH 4F7XA 1SE8A 1N34Q 3X3NA 1E0BA 1PH1A 4IJLA 2GA4B 3H94A 2H4OA 3J7A5 2B8GA 4RAUC 4YCWA 1W6KA 3KF6A 3PF4A 1IL8A 2NVQB 1K28A 2FMCA 4DV5L 2ZJPA 1SMYC 3A8IE 4KLKA 3TREA 1N9WA 2ZXRA 2L4NA 2HIVA 2EJMA 4JBKA 1PH8A 2EYPA 3AFPA 3HOYH 3Q0AA 3TP5A 3TDQA 2BH8A 4OHJA 2ASBA 1OXUA 3CCSA 2XIWA 2OTLA 4YY3L 1ENCA 3A7AB 2K05A 2K6AA 2K14A 1Z47A 1IL2A 3EN2A 4GLXA 2FJ2A 1Q82C 3E3XA 4DV4Q 1SLJA 1KL9A 2TMPA 5C44B 3S15B 5E7NA 2PQEA 4LUOA 1DYQA 4J15A 1U4PA 1YNND 1HZAA 1Y14B 4YWKA 2NVQH 3CP0A 2D5DA 4NMZA 2NTTA 2EYFA 5FLMG 5CBAE 1A8VA 3FVQA 4ZQ3A 2LS01 2XRQD 1TU2B 1IYUA 2I5MX 4JI2L 2EY2A 1B44D 4DNTB 4DPGA 4KHPQ 2B39A 2UXBL 4BY1B 2E2IB 4R4OA 1G6PA 3KF8B 4DV0Q 1SNPA 3PIOA 2I07B 2JQOA 2F0KA 3H0GG 3OTOQ 3RUZA 4LF4L 3P75A 4X62L 4V190 1UUPA 2HDMA 3I55A 3E0JA 2F52A 2QEXA 4DN4M 5C44H 1EOTA 1XJVA 3S15H 5FLXc 1PTOD 1F2ZA 1ZXTA 2B2WC 3KLSX 2K52A 2JE6I 1L1OB 3OW2A 4TRDA 2PQAB 2AMCB 1BQQT 4JC0A 1VQ5A 3K5LA 4N9TA 3N6RA 2MUYA 4JPBW 1PH3A 1Z9FA 5GROA 1DCZA 4IALA 1WTXA 4XDXA 1QCBD 4C1NI 2E5LQ 4NXML 3A74A 4BY1H 2F0GA 3HKZE 2E2IH 2Y0SE 5C5MA 5K36H 2EE1A 5E1FA 3OOCA 1CQVA 1JOQA 3T1HQ 4X3KA 3HOWG 4GN4B 4QY7A 1FR3A 4HIMA 1K9MC 2CWPA 1X3QA 5EPLA 5BN5A 3J7AF 4IJHA 1XTCD 4JK1C 1WTOA 1NR4A 1JMCA 5EPKA 1IBLL 3TP6A 3FDTA 3LX0A 4IFDI 4R9WA 4IO9A 2L11A 4UP8A 4PZ7A 1K83H 4QUCA 2EJGC 3KDFA 2IX1A 2WIIB 4K2LA 2YV5A 2J4XA 4A3JB 4O1NA 1STHA 1DD2A 1H9SA 1EY0A 2CH4A 1VQEA 2VB3X 2A74C 3HP3A 2PMZE 3BDCA 4DK1A 5C5LA 3WOFA 5FOBB 1IKMA 3SK4A 1N33L 2K4KA 4RKBA 4PZ8A 1WTHA 2DN8A 4C2MB 1EQRA 5T1GA 5DEHA 5HGQA 2KCNA 1QILA 2VQFL 1SYBA 2NVXB 3NE5B 3BZKA 1D2BA 4WRDA 2CW0C 5E4XA 3I4MG 1FD7D 1J9OA 1K8AC 1N32Q 2F0IA 4HCSA 1WTPA 2F0VA 1WTVA 1B8AA 1EYAA 1P16A 2DUDA 1B70B 2V1CC 2BOSA 4A3JH 2UUBL 4RMFA 4DUYQ 2UU9L 1TY0A 3L0OA 2B2VC 2KA7A 3GTOH 1A6XA 2JEAI 2QEJC 5KNDA 5LMNL 4OX9L 2WKDA 3NP8A 4HJ9A 5C4ZA 3I2ZA 3NSWA 5ELEA 1PH9A 3V96A 4C2MH 4B3SQ 3NBHB 2IL8A 3M4OB 3BZDB 1VCIA 2OCEA 4RG1A 1NJIC 2NVXH 5IYDH 3H3VI 4MN3A 4ILWA 4GOPB 3NQIA 5GAEC 5LMNW 3ND9A 2CKZB 4PQXA 3T56B 4BA2I 3SR1A 1BNZA 3QO2A 2A6ED 4CKEA 2EIFA 5KGUA 4P71A 5IP9H 1LTRD 3IKJA 1EU4A 2F1MA 2HHHQ 1TWHB 1SYCA 5IE8A 1K3BC 2L12A 4HR7B 3S1RB 5CV4A 1FYCA 3MFGA 4FXKC 4EVOA 4LWCA 3WWVA 1WTRA 4LF8L 2PW7A 4JBJA 4JI0Q 1GUTA 3M4OH 4PV1C 1Q12A 3HZXA 1GUGA 5EJWA 3K80C 2UUCL 1UEAB 1VQHA 2I46A 3P1HA 2UXCQ 3RD4A 1EWHA 3H91A 3P7JA 2KVMA 1DONA 2WV6D 4PMWA 3PO2G 1NMFA 1PA6A 2E2JB 2R3ZA 2X6LA 3HKZB 4AYBB 2Y0SB 4ME3A 2X69A 4DV5Q 4XXEA 4L6TB 2WFWA 4NKLA 4O42A 4DV3L 4HN7A 3G71A 5IP7G 1F2MA 1SFOB 3CXCA 1SMXA 3MC0B 4P74A 1EY4A 1TWHH 2VQEL 2R93G 3KF8A 2ES2A 1KAWA 3ICEA 4TQUS 3S1RH 3I56A 1PFSA 1H9RA 1O7ZA 4K6DA 3BDOA 1G2SA 4YY3Q 2N49A 1LT5D 3K7AB 3PUWA 1JICA 3HEJA 2D2CC 4RGNA 2EYHA 4QB4A 1EY9A 4FP5D 1ILQA 1D5XC 1CZWA 1IBKL 1L1OA 4B3TL 4FYDA 2E2JH 2GN5A 2K5HA 2WAQG 4DV6L 1HRJA 1I4PA 4N8FA 4FF3A 3BS1A 4BXXG 2VW9A 2PMZB 1SFOH 4JI1L 2YTVA 1E24A 3D8GA 3NTHA 2VL6A 1NR2A 4C56C 4BS9A 4GNXC 2QDBA 4L8JA 3TN2A 1EY6A 4JI2Q 4Y52H 4HSPA 4F87A 4HMIA 1C8CA 4QCLA 3KUPA 1XTDA 1LABA 1OXTA 1W6JA 2A73B 2AQ2B 3J7AV 5M5WB 3K7AH 1CZGA 4DR7L 4X62Q 2A5HA 3S1NB 3SHLA 4DAYB 1U4LA 2B2UA 3M7GA 1TS2A 1CA5A 4RFBA 3H09A 3CW2C 1R4QB 3CC7A 2GVBA 4CDDC 4IOCA 5E3FA 1VMPA 4A3BB 3E6ZX 4ZKCB 3ZJYC 4PMBA 5C6AA 1JQYD 2Z6KA 1U4MA 3J80i 1J8IA 5IYCG 2EOTA 5DAUA 4NXMQ 4C3HH 2R7ZG 1GD7A 3F2UA 1STGA 1HH2P 1LTID 2HQEA 1AEXA 1HR0L 2YTYA 1E1OA 4IFDG 5M5WH 1GHJA 4NXNL 4DA2A 3NBIA 3S1NH 1VQCA 1UE5A 3J7ZC 3CCUA 2NYZD 4L5TA 3VR4A 1I6VC 1XYIA 1D6EC 1LM0A 1IBLQ 4RGOS 5A2QE 2Z4IA 4A3BH 1LTBD 3HOXB 3OSOA 3TP8A 1HR0W 4B9XA 2KUMA 4V0BA 1BO0A 2F0DA 2OTJA 2WB1G 5JPNC 3DM1A 4DNRB 4IPDA 5ELDA 3O13A 1N36L 3STBC 1KXLA 1BKBA 1G2TA 1KLGD 3WDNA 2F0UA 4GZYC 3AEVA 3VR6A 4LAAA 3OTOL 1K3RA 2KOLA 1N33Q 4RHRA 2QW7A 3NBHA 3TZUA 4G7ZC 3UDXA 2F0FA 2FFKB 1EZ8A 1X65A 3GV3A 2RCFA 2JA5G 4K2KA 2TSSA 2VQFQ 1NY4A 4TVAB 1DOMA 1WCMB 2HDLA 1CA6A 1IBML 1TWCB 3HOXH 4GOPA 4HJ8A 1STNA 1PFNA 2YTXA 1CTMA 1SXTA 2JA6G 2LMCB 2CQOA 2K5DA 2UUBQ 2ZTEA 5KNBA 1WVLA 1A3VA 1C4QA 2E76C 4DXFA 5LMNQ 5A2QL 3CPFA 3RLNA 4OX9Q 1B9NA 4HEDA 4OL7A 4FF2A 4A3DB 4QF4A 4DR4L 1HQMC 1W3SA 2A6HD 1BBUA 2ZXOA 3W2DA 2MGSA 4POGA 2B2TC 1FL0A 2VUMB 1SEBD 2A1AA 4O0AA 1U9RA 4IUUA 1TT2A 1DOKA 1ICWA 3B6YA 5C3XA 3RMHA 1WCMH 3D3RA 5KIXA 2FMMA 2EYOA 1SYFA 3K81C 1YVCA 4BBRG 1TWCH 3GTQB 3I72A 2RHSB 3I90A 1HFGA 1YHQA 3PIO3 4JI5L 3W1GA 4ULLA 5ELBA 4X6AH 3NWTA 1MI2A 2ID0A 4ZUIA 2CH4W 4YCUA 4CKBA 4QGUA 2RF4A 4FXGC 3U4VA 1EQTA 1D7QA 5IYBH 3JC66 4JVZA 1EY7A 4A3DH 5IWAL 1VQAA 1K73C 1S3OA 2OF1A 4LF8Q 1I5FA 4MHEA 1EFID 3FP9A 2VUMH 4H0LC 1CSPA 3G6JB 4X64L 1I4HA 2Q8TA 2F0PA 2CW0D 3MXGA 3TMEA 5HY6A 3UDIA 1I6HB 2K04A 5C3EB 4J8QA 1Q90A 2UUAL 4PNYA 2PYKA 3GTQH 2K50A 1U4RA 1KNAA 2M9VA 4X3SA 2J0TD 4NB3A 4H44C 2Q8RE 4MZ9A 1LV9A 3R2TA 4DUYL 1TWAB 1QOHA 3K57A 4DV3Q 4K6LA 2KCMA 1LO5D 2D9UA 2K5VA 2RCNA 1NE3A 4XT1B 1GUNA 2VQEQ 3AFQA 3ERSX 2R92B 2UXDQ 3C1FA 1I4QA 3K0XA 3M4QA 4U68A 3MXNB 1I50H 2HQLA 2RSOA 4B3SL 2F0OA 1L0WA 5CORA 2LFNA 4WORA 1CUKA 4DAYA 4HJ5A 5M3FG 1VQPA 3T13A 1C9OA 1JOKA 4Q5VA 3IAYA 1I6HH 5C3EH 2QILA 1UAPA 4PZ6A 5GAHC 3A54A 4UHVA 1IBKQ 1TS3A 4KKUA 2MHVA 4B3TQ 4KN4C 3HOUG 3R3OA 2EYJA 4P73A 1SSOA 2C35B 4A3FB 3EBEA 1WOCA 2E2HB 3FPPA 1TWAH 1V9PA 3GP7A 5M5XB 1YJNA 4DGZA 2K01A 1OO9B 4JI1Q 4A3IB 2NN6G 1Z6HA 2NWGA 4IOAA 1CI3M 2B8FA 3DWAA 4ZRZA 1F9SA 2R92H 5IOCA 1IYJB 4XT3B 4EGVA 1Q1BA 3NWSA 3KLSA 3HOZB 3CCQA 4DK0A 1O78A 4Z9CB 1I4XA 4JI0L 4RA8A 5D3IB 1PHJA 3CCVA 4NDXA 2B3GA 4DR7Q 2BA1A 2Z1CA 4BY7G 3A7LA 1EFWA 4A93G 1IW7C 2UXCL 4YHHL 1LT6D 4YWLA 4OO1G 4N9PA 1A15A 1JWMD 1LLRD 4DFAA 1S4ZA 1RODA 4HMJA 2PI2E 4A3FH 1XNRQ 2JA8G 3FKIB 4IN3A 1STBA 3ULJA 4C3JB 2E2HH 1TWGB 2JP1A 3S24A 5JEAH 5M5XH 3ULPA 4A3MG 3CRKC 3PQIA 4ALPA 1TXYA 3T1YL 4A3IH 3VR3A 4MIUA 1VDZA 2LY7A 3MA2B 5D3DA 1QUQA 2O4XA 2VXWA 1MJEA 1M1KC 3HOZH 1HR0Q 2X6GA 2YU9B 4RH6A 2JEBI 3KBGA 4A76A 1A3UA 2AUKA 1S5ED 2H1EA 3CC4A 4NXNQ 1PVOA 3ND8A 1JE4A 2SDFA 1BVSA 2B63B 5C0XH 4DR3L 1UNSA 1TVXA 4DV7L 3A56A 5ELCA 3S17B 1VQKA 1RCVD 1WJJA 1EYGA 1GXDC 1D5ZC 3FKIH 4DR6L 2MP1A 4C3JH 1TWGH 2QGQA 4IUTA 3GTJB 4CKCA 5FJ8H 2K03A 4A3GB 2RBMA 5AFWA 5KEEA 1HNWL 2JA7B 2N8NA 3TS0A 1JB3A 2ICIA 1F9QA 1N36Q 1KDCA 1EYCA 4IQZA 4LNQA 5JJLA 3NTIA 2F3WA 1TY2A 3CCLA 4FDBA 2YU9H 2KECA 3HOVG 5I6YA 2EZVA 2IY5B 3NEMA 1ML0D 3F8TA 4OIJA 1HZ9A 2B63H 5CV5A 3CC2A 3BYYB 3J81E 3F2BA 3G4SA 3PIPA 2AQ3B 1YJWA 1TIID 1OXSC 1JWSD 1Y8NB 3S17H 4UY8C 1TQOA 4BBSB 1K83B 1IBMQ 4OXPA 4A3EB 1YIJA 1PH6A 3BJUA 3K5OA 2NZ1D 1EIYB 4FXDA 3GTJH 4A3GH 2Z8LA 5FKAC 3SDZA 4DAVA 2CQAA 1FGBD 2JA7H 2WINB 4MTKA 4AYBE 2B2WA 4NW2A 3R93A 2F3VA 1PZJD 2OXPA 2QCPX 4L63B 2ZTCA 5IGGA 3IL8A 2NTSA 3NPPA 1VQFA 4LF6Q 4DR4Q 1L0YB 1PFBA 1RIPA 3K59A 4GNXB 2KHJA 3VDYA 1Q8KA 3AQQA 4AH6A 5CV8A 5BN4A 1AE3A 5KYIA 1HHVA 4K5VA 3EROA 4BBSH 1Q8IA 1HZBA 4A3EH 5C4XG 1S5FD 3HGBA 1RTOA 4C3IB 1HNXL 4IUQA 4JI5Q 1HTLD 4UDUC 3NQTA 1AW7A 1FNUA 2SNMA 1STYA 1CQFA 3STBD 4MNOA 4ID6A 3GTOB 4JBWA 3DUZA 3J81L 1JJGA 3LNNA 2EYLA 1RD9D 2RSNA 2B2YC 1B9MA 3WOEA 3C2PA 1FJGL 1A0IA 3OW7A 3GD7A 3LGJA 3QG1A 3FRPB 3VR2A 3QOLA 2JJQA 1HJPA 3NELA 3NUCA 5IWAQ 1SNQA 5IGCA 4K0KL 4B3ML 3HOYG 1M8AA 1B1ZA 4X64Q 3L9AX 4X66L 1XNQL 2PZTA 5JJZA 3EFXD 2Q8IB 4CDFC 1SROA 2UUAQ 5EQ0A 3S14B 2H5XA 5M5YB 1NNXA 4C3IH 3W5OA 4ME5A 3M85A 3MHBA 4LFAL 2PZWA 1NTGA 5FO9B 5IT9c 3OHXC 3PSIA 1Y1VB 2K5NA 3JAMc 1KIXA 4FF1A 4OWWB 2PW5A 3RNUA 3VYTA 4IFDJ 1VS0A 4R4CA 3VYSA 1E3PA 2OT2A 5CBEE 3LWUA 4GS3A 4KD4A 1VQGA 1HFNA 1E1TA 4B3RL 1ET9A 4ZCKA 1CFMA 3H6MA 2G5DA 3U58A 2F03A 1BUVT 3PO3B 3Q22A 2RDGA 2E2DC 2BH2A 2B2VA 3EIVA 5LL6S 1VQNA 1JOOA 1M90C 2KQ3A 4K8JA 3EQLC 1QZHA 1GUWA 1ILPA 3S14H 3Q23A 4JI4L 5M5YH 1ASYA 2KHSA 5C44G 1KRSA 3OWEB 4CJ0B 3FHWA 2K32A 4P75A 1Y1VH 1NBWA 1O7LA 1UE1A 2PNRC 2XGTA 4H13C 2O5IC 3J80c 3FEWX 1EY8A 1LT4D 1Q7YC 3S1MB 2AWNA 4K5XA 1XPRA 4IZ8A 2VS1A 1QWYA 4ZKBB 3PO3H 4BY1G 3CU7A 1ESFA 2BE5C 3LWEA 1VQ4A 5K36G 4YHHQ 1Y1WB 4WFN3 3BDLA 1VMCA 3TSSA 1MKHA 1BOSA 4DUZL 1A63A 2E74C 3GQBA 4GLAC 1MHWC 4S3SA 2JA6B 1X32A 3E9IA 3T1YQ 1MJCA 4TSSA 2NZHA 2UXDL 1GJXA 1Y8OB 3IFDA 3CAMA 1S5CD 1LT3D 3S1MH 1PYBA 5J22A 4C1NK 1B4OA 1EZ6A 4EQOA 1SYEA 1YHBA 1V1PB 4POFA 2PCFB 4DR3Q 2F0JA 3JAMi 1LACA 1Y1WH 4DV7Q 2PQAA 3Q8DA 4KTAA 1RKNA 3Q24A 2KHIA 4IUPA 4CJ2C 3I4NB 2PNHA 3KOJA 4R8NA 4DR6Q 4GN3B 3HRZC 5ELNA 4X3TA 2L1BA 2CWAA 3D31A 2JA6H 4C3HB 1HNWQ 3K6OA 2MNAA 2L55A 5AJ3L 2A19A 3L7ZC 1TS5A 5JOBA 2MQHA 2EQSA 4A3JG 1KC8C 2O5JC 4EQPA 2DNCA 4DF7A 2NN6I 1IW7D 5EKKA 1PRTC 4F88A 3TS2A 3IRBA 4WJWA 4QIWE 3TRZA 4UPAA 1XNRL 1SMYD 4JOIC 4ZLTF 2F0TA 1GKHA 1X54A 4P72A 1RL2A 2CHBD 4O2DA 4LFBL 2K7VA 3I4NH 3URYA 1VQIA 1O80A 4RHSA 1UE6A 5M3MB 5C3WA 4A3KB 3GTMB 3UI2A 5IYDG 4OO1I 1F2YA 4H02A 5CMDA 5EAYA 4DK6C 1PTOC 1YNXA 3D4WA 1VQ7A 1E7ZA 3U9SA 4A3CH 4TKOB 3BYTB 1VQDA 1B3QA 1SDFA 1HA5A 1VQJA 2E75C 5IP9G 3CMEA 1S5BD 1QB5D 4QQBX 1UWVA 1S40A 1U5KA 2PI2A 3QWNA 3HFZB 3KBXA 1G8ZD 1SNDA 1KQSA 4GKKL 1YEZA 2ZJRA 5NUCA 1BBWA 5C4HA 4R8IA 4ABNA 5DM63 2EXDA 5M3MH 1HNXQ 3GTMH 4A3KH 1JT8A 1SAPA 2EPBA 1QVGA 2Q2IA 3K0YA 5EPJA 5G3LF 3BVGA 4KKTA 3AU7A 1YNJC 3UDGA 1DGSA 1S72A 4LF7Q 3GTLB 4CGYB 5LHY1 1FJGQ 5CV9A 1X55A 1ZEQX 4KY7A 4QL5A 2QKIC 1E2VA 2IHEA 4FO2A 1BBXC 4K0KQ 4B3MQ 4KV6A 2F0WA 5G3LD 1STEA 4Y7NB 5COYA 4X66Q 1XNQQ 3TP7A 2KENA 2Z6BA 3KLWA 1VQLA 4KY6A 5J3BA 1VQBA 3RZOB 4A3LH 2M00A 4LFAQ 4CDEC 4J1MA 3SVMA 2AKWB 3MWYW 3FPUB 3HKZG 2Y0SG 3K8AA 3GTLH 5FLXL 3SEBA 2DNEA 4HSVA 5C4JB 5I4DA 4WJ4A 1AZPA 4LF6L 1I4RA 4XTCS 4B3RQ 4DR2L 4K14A 3U9OA 1EUJA 3MEHA 5TSSA 3M4YA 1BCPF 1FGUA 1UE7A 2XVSA 1JWUD 1DJRD 3DEOA 2L9HA 4Y7NH 1ZYRC 1FVIA 1HNZL 3UE1A 3CKIB 3G48A 4PG3A 1X3FA 4N8X1 3H3VC 3VA7A 4JG2A 4JI4Q 5T1IA 5K5PA 3RZOH 2B2TA 3NENA 3OWFA 2EXZA 2XNAC 5BR8L 1NAPA 1TS4A 2K75A 4JI3L 4IUVA 3PIP3 1I50B 5C4JH 3E5SA 4QIWB 3A8KE 3H0GB 1CHPD 2F0HA 1EQVA 1IZ6A 1H95A 2IW3A 2A6EC 2VB2X 2HCIA 3MXUA 1V1PA 3L2PA 1F77A 4KI0A 1EYDA 1XWEA 5JJIA 2A68C 1EIFA 3NHHA 1FNVA 1YJ9A 3GV6A 3IFTA 1STAA 4DUZQ 5FLMH 2XTIA 2JA9A 1ET6A 2HIXA 4APVA 2LSSA 4R4TA 1I94L 1L2FA 1Q3LA 3S2DB 1HXYD 1I3QB 4A3BG 1GVPA 4RGTA 4FF4A 3PV0A 3V2TA 4CBVA 3OPOA 2JXMB 5EKIA 4DV1L 1G91A 1Y8PB 2K5QA 3AYHB 3H0GH 3K7UC 5C0XI 1BDOA 3T16A 3HOWB 1GUOA 2ALYB 2IJ0A 2F0EA 1ZKOA 4I65A 4MTNA 1KRTA 2F0QA 4IUNA 3DXJC 3PUXA 1EWIA 4HJ7A 1C0AA 4JCVE 3CF5A 5EGTA 2C5CA 2ZM6L 5IT9L 1LTGD 1K0SA 3DWPA 2JK8A 4XQNA 4CJ1B 4FNFA 4XYQA 3BVMA 3F2CA 4QJFA 1MIUA 1AZQA 2C9OA 4G57A 1KNEA 4XQQA 3EJIA 3S2DH 4J6HA 1Q86C 1I3QH 2WAQE 3HOXG 4R4QA 3BVZA 5AJ3Q 2P5ZX 3OMGA 1QVCA 4KMUC 1SE2A 3HOWH 1RTNA 1TWFB 1SR3A 3T51B 3TZDA 3TQYA 2BE5D 4RGMA 4JV5L 3CQZB 5I2XA 3OIQA 3X3MA 1G51A 1WTWA 1YZ6A 4HIDA 2RQXA 1A2UA 4KHZA 3I4MB 2F0NA 3DHQA 5CGKA 1HA6A 3W3AA 1C48A 4LFBQ 5KNCA 2RVLA 3NK9A 3CPWA 4HTHA 3GTGB 5JVH3 3J80L 1MSHA 1WCMG 3SK6A 4HIKA 1EOVA 3SE0A 3M7NA 4JI6L 1JB7A 3KFUA 5J39A 1TWFH 4G7HC 1V1QA 1GO3E 1OXXK 1KLUD 2Q2HA 3CQZH 3OYYA 2L5TA 2K5WA 3QR8A 4H7BA 1RHPA 4OGQC 1CSQA 1Q81C 1MBYA 3G7LA 4DV2L 5IYBG 1LYLA 2EYMA 4A3DG 3HKSA 4E6IA 3I4MH 4DNIA 4AQYL 4GKKQ 1VQ6A 1DOLA 1LTTD 1NUCA 1T5EA 4GLVB 4LF9L 1P8LA 2VUMG 1PH5A 5IY0A 3GTGH 1PRTF 4HAEA 2BCOA 5JAVA 1VQ9A 1WTQA 2LXKA 4ZYSA 1EWCA 2WB1E 1RJTA 5FO7B 1EIHA 5GAGC 1PRTD 1Q46A 2N88A 2QA4A 3E9HA 4R4IA 2N3SA 1RF2D 1ENFA 1JJCB 4UP9A 4GKJL 4L5QA 4KY5A 1E2ZA 3A5UA 2VY3A 4HIOA 1PTOF 3CCEA 2OQ0A 4G4KA 3KYHC 1H9KA 3PO2B 2A8VA 1AP0A 5ELOA 4XQJA 1BXTA 2D0PA 2SEBD 1MSGA 1II3A 1SE4A 1KAAA 5C3EG 5KYLA 2PPBC 2QF7A 1Z7TA 1WI5A 5EKLA 1CKOA 2M2LA 2R93B 5DNFA 3J7YW 1JJ2A 1M4VA 2EY6A 3R2IA 3EA6A 4G7OC 4EX5A 4K8IA 1K8GA 4DR2Q 3Q6SA 1CHQD 1CKMA 3ULLA 4JI7L 5IGFA 2R92G 4L5RC 2IPKD 4I7ZC 1XPOA 3S9WA 2KCTA 2I5LX 1HNZQ 1WFQA 1X9NA 4BWGB 3PO2H 1YBYA 1K8OA 2RKSA 2WAQB 2GVAA 3I4OA 3T4AC 1ONLA 1PRTB 1Q1EA 2A6HC 3DEPA 1B53A 4DXGA 1VQOA 3EVQA 1GHKA 1BCPC 4F8MA 5IP7H 4NP5A 1J6QA 3I3CA 2RA4A 3R8BA 5BR8Q 1YNJD 4LF7L 4JI3Q 4AIMA 2R93H 4A3FG 2SNSA 3MXNA 5JEAG 1HUNA 1XMQL 1KABA 1SJHD 3PMFA 2F0SA 4A3IG 4LFCL 1WD0A 5JJKA 2ZTDA 1PTOB 1AE2A 3QIAA 3HOZG 2G9HD 2WP8J 1F9PA 2B2YA 1XPUA 4JYAL 3D6WA 1EY5A 4JI8L 5F2DA 3CMAA 4OONA 3GTKB 2WACA 3SK8A 4OEMB 5C0XG 2KEDA 2DJGC 2IX0A 4BXXH 1CKNB
chains in the Genus database with same CATH topology
1YHQA 1I94Q 2NN6I 1OXUA 3CCSA 4JI5L 3TS2A 4A75A 4IPCA 3IRBA 2D62A 3W1GA 4YY3L 2OTLA 4X6AH 2K14A 3PF5A 2ID0A 4QIWE 3TRZA 1Z47A 4UPAA 1IL2A 3EN2A 4GLXA 3FKIG 1Q82C 1LTLA 4DV4Q 1SLJA 1J5EQ 2Z0SA 4YCUA 1KL9A 5FJ8G 4DV1Q 1XNRL 4QGUA 4WJ3M 2RF4A 3U4VA 4JOIC 4R1JA 5E7NA 4LUOA 1XMOL 1GKHA 1X54A 4P72A 1YI2A 1SRUA 1RL2A 4J15A 5IYBH 3JC66 4O2DA 4LFBL 3I4NH 1VQIA 1HZAA 4A3DH 5IWAL 1UE6A 1VQAA 1Y14B 4A3LG 4YWKA 1K73C 1S3OA 5IYDG 3CP0A 2NVQH 4OO1I 4LF8Q 3F1ZA 4H02A 1I5FA 3RN5A 4UP7A 5FLMG 1A8VA 3FP9A 5EAYA 4DK6C 1CSPA 4X64L 2ZM6Q 1YNXA 1PV4A 1GM5A 5LMUL 3ER0A 1VQ7A 1E7ZA 4A3CH 2I5MX 5HY6A 3UDIA 4LUZA 3GTKH 4JI2L 2B63G 4DPGA 4KHPQ 1VQDA 2UUAL 2UXBL 2CCZA 1G6PA 4R4OA 4DR5Q 3GTQH 1VQJA 2K50A 3KF8B 4DV0Q 5DLQE 5IP9G 5IYCH 3PIOA 3CMEA 4NB3A 2NVTH 4QQBX 1UWVA 2JQOA 1U5KA 1S40A 4MZ9A 2PI2A 3H0GG 3OTOQ 4DUYL 3HFZB 4LF4L 2R7ZH 4DV3Q 4X62L 1KQSA 3CCJA 4GKKL 2KCMA 3I55A 2F52A 2QEXA 2K5VA 2RCNA 1NE3A 1YEZA 5C44H 4A3GG 2ZJRA 2VQEQ 3A0JA 3AFQA 5FLXc 1XJVA 3S15H 1BBWA 1YHAA 3ERSX 2UXDQ 2JA7G 2OQKA 3K0XA 2K52A 2R7FA 2JE6I 3M4QA 1L1OB 2VZAA 3MXNB 3OW2A 1I50H 2HQLA 2EXDA 4B3SL 3SGIA 5M3MH 1HNXQ 4A3KH 2PQAB 2AMCB 1L0WA 3GTMH 4JC0A 1JT8A 1VQ5A 4X65L 1QVGA 2Q2IA 3I7FA 1CUKA 4HJ5A 1Z9FA 5M3FG 1VQPA 1PH3A 5GROA 3PGZA 3UDGA 1DGSA 1C9OA 1S72A 4LF7Q 2E5LQ 1I6HH 5C3EH 4NXML 1A62A 3A74A 4PZ6A 5GAHC 1IBKQ 4BY1H 3HKZE 2E2IH 1FJGQ 2Y0SE 1UEBA 4B3TQ 1X55A 3HOUG 4P73A 2C35B 4QL5A 3EBEA 2IHEA 4DKAC 1WOCA 3T1HQ 4B3MQ 4K0KQ 4BBSG 1TWAH 1OTCA 3HOWG 1V9PA 4GN4B 4QY7A 3DLLA 2AHOB 4A3EG 4HIMA 1YJNA 1K9MC 2VNUD 4JI1Q 3M4PA 2CWPA 2NN6G 4JI6Q 1OXVA 4X66Q 1XNQQ 4IJHA 4IOAA 2KENA 3KLWA 1VQLA 1JMCA 5J3BA 2R92H 1IBLL 1IYJB 1VQBA 1Q1BA 3CCQA 4IFDI 4A3LH 4JI0L 4LFAQ 4IO9A 3UE0A 3A5ZB 2JA5H 1PHJA 4UP8A 3CCVA 4PZ7A 4DR1L 1K83H 1L1OC 4LF5L 3KDFA 2B3GA 1C7YA 4DR7Q 2IX1A 2BA1A 4DV2Q 4BY7G 4A93G 1EFWA 2UXCL 2AKWB 1E22A 2YV5A 3CCRA 4YHHL 1D8LA 4AQYQ 1EQQA 3HKZG 4YWLA 2Y0SG 3K8AA 1X3EA 3GTLH 4LF9Q 5JJKA 4OO1G 4WJ4A 4LF6L 1VQEA 3VDYA 4XTCS 2PI2E 4B3RQ 4DR2L 2I0QA 2CFMA 1EUJA 4A3FH 1XNRQ 1AH9A 2PMZE 2JA8G 1B7YB 3ULJA 2E2HH 3PUVA 4YCVA 1N33L 3S24A 2K4KA 1UE7A 1FGUA 4PZ8A 5M5XH 3ULPA 4A3MG 3F2DA 4ALPA 1EQRA 1TXYA 4Y7NH 3T1YL 4A3IH 5GQOA 3KJPA 3H3VH 1FVIA 3RR5A 1HNZL 1PH7A 3UE1A 5HGQA 3G48A 4PG3A 3RLFA 4LUVA 1X3FA 2E8GA 2VQFL 3GDEA 1QUQA 4JG2A 1PH4A 1M1KC 1MJEA 3BZKA 4JI4Q 4GNXA 4IPHA 1HR0Q 3I4MG 3HOZH 3RZOH 1QVFA 2JEBI 4GKJQ 1K8AC 3NENA 4A76A 1N32Q 4GN5A 2UXBQ 4NXNQ 3CC4A 1T9HA 1PVOA 5BR8L 1B8AA 2F4VL 1P16A 1BVSA 2K75A 2RHQB 2DUDA 4JI3L 1B70B 2V1CC 5GADC 4DR3L 4BBRH 4A3JH 2UUBL 2NVYH 4RMFA 2Z6KC 4DUYQ 2UU9L 4DV7L 4LF4Q 1N34L 5C4JH 3L0OA 2Q2UA 1VQKA 3GTOH 1WJJA 1EYGA 2IHFA 1IZ6A 1H95A 1X56A 1KHIA 2JEAI 5LMNL 3FKIH 4OX9L 4DR6L 4C3JH 1TWGH 2QGQA 4HJ9A 5FJ8H 3I2ZA 3M9BA 3L2PA 1PH9A 4C2MH 3J81j 4B3SQ 3GO5A 3NBHB 2FXQA 4JOIA 2OWOA 1HNWL 2N8NA 4KI0A 3TS0A 5JJIA 1N36Q 1EIFA 1VCIA 2OCEA 4IPGA 5JJLA 1YJ9A 4LNQA 3CD6A 1HZCA 4RG1A 1NJIC 2NVXH 3CCLA 1Y1VG 2MFIA 4FDBA 5IYDH 3H3VI 4DUZQ 2YU9H 5FLMH 2XTIA 2JA9A 2HIXA 4GOPB 3HOVG 4APVA 4JI7Q 2LSSA 4R4TA 2IY5B 5GAEC 1I94L 2DGYA 3D0FA 5LMNW 1L2FA 3NEMA 2CKZB 3F8TA 4BA2I 1V43A 2B63H 1HZ9A 3CC2A 4A3BG 3F2BA 1PYSB 1GVPA 2EIFA 3PIPA 3G4SA 1G291 4P71A 3PV0A 5IP9H 3G6EA 2N78A 1YJWA 3PO3G 4DV4L 1OXSC 4DV1L 3J81c 3S17H 3BU2A 3BZCA 3AYHB 2HHHQ 4UY8C 3H0GH 3K7UC 5C0XI 2ALYB 1CKNA 2BA0A 5IE8A 1IBMQ 4OXPA 1YIJA 1PH6A 3BJUA 1EIYB 1CKNB 3GTJH 4MTNA 4LWCA 3KF6B 1KRTA 3WWVA 4A3GH 3PUXA 3RLOA 1EWIA 4HJ7A 4LF8L 4JBJA 4JCVE 4JI0Q 2JA7H 3M4OH 4AYBE 2ZM6L 3CF5A 1C0AA 1Q12A 3U50C 3K80C 2UUCL 1VQHA 2JK8A 2UXCQ 1X3GA 1XMQQ 4KHPL 1YITA 2ZTCA 3F2CA 4QJFA 1MIUA 5M3FH 4PMWA 4OWXB 4DV0L 4LFCQ 3PO2G 1NMFA 1PA6A 1VQFA 4LF6Q 4DR4Q 1QUQB 1RIPA 4ME3A 3S2DH 2IT1A 4DV5Q 4GNXB 1I3QH 4GOPC 1Q86C 2KHJA 2WFWA 1Q8KA 4DV3L 2WAQE 4XIGS 4R4QA 3AQQA 3HOXG 5IP7G 5AJ3Q 3G71A 4AH6A 4JYAQ 3CXCA 3HOUH 1ASZA 1AE3A 4JI8Q 1SMXA 1QVCA 4P74A 1TWHH 2VQEL 4BBSH 3HOWH 1HZBA 1SR3A 2R93G 2ES2A 1KAWA 4A3EH 4TQUS 3S1RH 3ICEA 5C4XG 3I56A 3TQYA 1Y1WG 1PFSA 4JV5L 1HNXL 3PUZA 4DAMA 4JI5Q 4AYBG 4YY3Q 2N49A 1G51A 2R6GA 1U0LA 3PUWA 3STBD 1YZ6A 4HIDA 4MNOA 4KHZA 4JBWA 2HT1A 1JJGA 3PUYA 1KD1C 2E5LL 1IBKL 1FJGL 1XMOQ 1A0IA 1L1OA 3GD7A 2L15A 3LGJA 5H1SE 2UU9Q 4B3TL 4A93H 4BY7H 4LFBQ 4YWMA 2JJQA 1HJPA 3NELA 2GN5A 5IWAQ 1NMGA 3CPWA 2E2JH 2K5HA 2WAQG 4K0KL 2R7DA 4DV6L 1WCMG 4HIKA 3T1HL 4B3ML 3HOYG 1EOVA 4BXXG 2F3IA 2VW9A 4X64Q 1SFOH 4JI1L 3M7NA 5LMUQ 2YTVA 1E24A 4JI6L 2YYZA 4X66L 1XNQL 2VL6A 4GNXC 2JA8H 2B29A 1JB7A 3KFUA 4JI2Q 4Y52H 1SROA 1TWFH 2UUAQ 4OWTB 1LUZA 4A3MH 2H5XA 1V1QA 1GO3E 1OXXK 1R9TH 1JE5A 1XTDA 1OXTA 4C3IH 2Q2HA 3CQZH 3W5OA 3M85A 3OYYA 4LFAL 3KJOA 1NTGA 2D0OA 3K7AH 3TEHB 5IT9c 2NZOA 3PSIA 3GTPH 4DR7L 1CSQA 4X62Q 1Q81C 4DV2L 4DK3C 5IYBG 2K5NA 4DAYB 3JAMc 1KIXA 1LYLA 3I4NG 4A3DG 3HKSA 4OWWB 3I4MH 4DNIA 4AQYL 4GKKQ 3U4ZA 1VQ6A 4GLVB 3RNUA 4LF9L 4IFDJ 2AWOA 3M3YH 1VS0A 4R4CA 1E3PA 1P8LA 3CW2C 3J81i 3CC7A 2KBNA 2GVBA 4GS3A 2VUMG 3PCOB 3UDFA 4IOCA 1PH5A 1VQGA 1E1TA 4B3RL 5IY0A 1VQ8A 3GTGH 3ZJYC 4A3CG 3U58A 4X65Q 2Z6KA 1VQ9A 3E0EA 3J80i 2LXKA 2BH2A 3EIVA 2MO1A 5IYCG 2WB1E 1VQNA 1VQMA 1IXRA 1M90C 2ATWA 1QZHA 4NXMQ 4C3HH 5GAGC 1GD7A 2R7ZG 4L5SA 3S14H 1Q46A 4JI4L 5M5YH 2Q2TA 1HH2P 2QA4A 3E9HA 1HR0L 2YTYA 2UUCQ 1E1OA 2MO0A 4R4IA 1O7IA 4IFDG 2N3SA 1ASYA 4A4IA 5M5WH 5C44G 1JJCB 3DM3A 4UP9A 4GKJL 1KRSA 4L5QA 1N32L 4NXNL 3A5UA 2VY3A 1J5EL 3FHWA 3KDFB 4HIOA 3W1BA 4P75A 3S1NH 1Y1VH 1VQCA 3CCEA 2OQ0A 1UE5A 3KYHC 3J7ZC 3CCUA 5M3MG 1NBWA 4A3KG 3HOVH 4L5TA 4HJAA 2A8VA 4NPSA 5ELOA 1UE1A 1LM0A 2XGTA 2D0PA 3CCMA 1IBLQ 3J80c 4A3BH 1Q7YC 3S16H 2AWNA 1HR0W 1XPRA 3H15A 5C3EG 2VS1A 3PO3H 4DR1Q 2OTJA 2WB1G 4LF5Q 4BY1G 4EQ5A 1WI5A 1VQ4A 1CKOA 5K36G 4YHHQ 4IPDA 1JJ2A 3RZDH 4DR5L 1N36L 3STBC 1N8RC 1KXLA 1BKBA 4EX5A 1MKHA 4JV5Q 3AEVA 1WYDA 3OTOL 1K8GA 1K3RA 4DUZL 4DR2Q 1A63A 4GLAC 1CKMA 3ULLA 4JI7L 1N33Q 2UXDL 2R92G 4L5RC 3S2HH 4BA1I 1SN8A 1W2BA 3E9IA 5JEAJ 1PH2A 1XPOA 3T1YQ 1MJCA 4JBMA 3RN2A 2KCTA 2I5LX 2NZHA 2ZJQA 2LXJA 1HNZQ 1WFQA 3MEFA 3UDXA 2I5HA 4DV6Q 1X9NA 1X65A 4LW1A 2JA5G 3PO2H 1YBYA 1K0RA 2VQFQ 1D7QA 2GVAA 1NY4A 3I4OA 4TVAB 2HHHL 2VUMH 3CAMA 1Q1EA 1X6OA 1IBML 1VQOA 3HOXH 4GOPA 4HJ8A 5IP7H 3S1MH 1PYBA 1J6QA 2YTXA 5BR8Q 2JA6G 2F4VQ 4LF7L 1YHBA 2CQOA 4POFA 1QZGA 4DR3Q 4JI3Q 4AIMA 2R93H 2UUBQ 5C0XJ 5C4XH 4A3FG 3JAMi 1Y1WH 2ZTEA 4DV7Q 3S1QH 1N34Q 1SE8A 5JEAG 2PQAA 1XMQL 1PH1A 3Q8DA 4IJLA 4A3IG 5LMNQ 2KHIA 3J7A5 4LFCL 3CPFA 4YCWA 3RLNA 2PNHA 3KOJA 4OX9Q 4DR6Q 2ZTDA 3KF6A 4GN3B 3PF4A 5ELNA 4DR4L 1AE2A 1W3SA 1BBUA 2CWAA 3D31A 2JA6H 4DV5L 2ZJPA 4POGA 3HOZG 2WP8J 4KLKA 3TREA 1XPUA 1N9WA 1FL0A 2MNAA 4JYAL 5AJ3L 1HNWQ 2A1AA 4O0AA 2A19A 3L7ZC 2HIVA 4JI8L 3CMAA 3B6YA 4OONA 4JBKA 2MQHA 1WCMH 1PH8A 3AFPA 5C0XG 3K81C 2EQSA 3HOYH 1YVCA 4A3JG 4BBRG 1TWCH 2IX0A 1KC8C 2RHSB 4BXXH 2BH8A 2ASBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ A;  1I94 Q;  2NN6 I;  1OXU A;  3CCS A;  4JI5 L;  3TS2 A;  4A75 A;  4IPC A;  3IRB A;  2D62 A;  3W1G A;  4YY3 L;  2OTL A;  4X6A H;  2K14 A;  3PF5 A;  2ID0 A;  4QIW E;  3TRZ A;  1Z47 A;  4UPA A;  1IL2 A;  3EN2 A;  4GLX A;  3FKI G;  1Q82 C;  1LTL A;  4DV4 Q;  1SLJ A;  1J5E Q;  2Z0S A;  4YCU A;  1KL9 A;  5FJ8 G;  4DV1 Q;  1XNR L;  4QGU A;  4WJ3 M;  2RF4 A;  3U4V A;  4JOI C;  4R1J A;  5E7N A;  4LUO A;  1XMO L;  1GKH A;  1X54 A;  4P72 A;  1YI2 A;  1SRU A;  1RL2 A;  4J15 A;  5IYB H;  3JC6 6;  4O2D A;  4LFB L;  3I4N H;  1VQI A;  1HZA A;  4A3D H;  5IWA L;  1UE6 A;  1VQA A;  1Y14 B;  4A3L G;  4YWK A;  1K73 C;  1S3O A;  5IYD G;  3CP0 A;  2NVQ H;  4OO1 I;  4LF8 Q;  3F1Z A;  4H02 A;  1I5F A;  3RN5 A;  4UP7 A;  5FLM G;  1A8V A;  3FP9 A;  5EAY A;  4DK6 C;  1CSP A;  4X64 L;  2ZM6 Q;  1YNX A;  1PV4 A;  1GM5 A;  5LMU L;  3ER0 A;  1VQ7 A;  1E7Z A;  4A3C H;  2I5M X;  5HY6 A;  3UDI A;  4LUZ A;  3GTK H;  4JI2 L;  2B63 G;  4DPG A;  4KHP Q;  1VQD A;  2UUA L;  2UXB L;  2CCZ A;  1G6P A;  4R4O A;  4DR5 Q;  3GTQ H;  1VQJ A;  2K50 A;  3KF8 B;  4DV0 Q;  5DLQ E;  5IP9 G;  5IYC H;  3PIO A;  3CME A;  4NB3 A;  2NVT H;  4QQB X;  1UWV A;  2JQO A;  1U5K A;  1S40 A;  4MZ9 A;  2PI2 A;  3H0G G;  3OTO Q;  4DUY L;  3HFZ B;  4LF4 L;  2R7Z H;  4DV3 Q;  4X62 L;  1KQS A;  3CCJ A;  4GKK L;  2KCM A;  3I55 A;  2F52 A;  2QEX A;  2K5V A;  2RCN A;  1NE3 A;  1YEZ A;  5C44 H;  4A3G G;  2ZJR A;  2VQE Q;  3A0J A;  3AFQ A;  5FLX c;  1XJV A;  3S15 H;  1BBW A;  1YHA A;  3ERS X;  2UXD Q;  2JA7 G;  2OQK A;  3K0X A;  2K52 A;  2R7F A;  2JE6 I;  3M4Q A;  1L1O B;  2VZA A;  3MXN B;  3OW2 A;  1I50 H;  2HQL A;  2EXD A;  4B3S L;  3SGI A;  5M3M H;  1HNX Q;  4A3K H;  2PQA B;  2AMC B;  1L0W A;  3GTM H;  4JC0 A;  1JT8 A;  1VQ5 A;  4X65 L;  1QVG A;  2Q2I A;  3I7F A;  1CUK A;  4HJ5 A;  1Z9F A;  5M3F G;  1VQP A;  1PH3 A;  5GRO A;  3PGZ A;  3UDG A;  1DGS A;  1C9O A;  1S72 A;  4LF7 Q;  2E5L Q;  1I6H H;  5C3E H;  4NXM L;  1A62 A;  3A74 A;  4PZ6 A;  5GAH C;  1IBK Q;  4BY1 H;  3HKZ E;  2E2I H;  1FJG Q;  2Y0S E;  1UEB A;  4B3T Q;  1X55 A;  3HOU G;  4P73 A;  2C35 B;  4QL5 A;  3EBE A;  2IHE A;  4DKA C;  1WOC A;  3T1H Q;  4B3M Q;  4K0K Q;  4BBS G;  1TWA H;  1OTC A;  3HOW G;  1V9P A;  4GN4 B;  4QY7 A;  3DLL A;  2AHO B;  4A3E G;  4HIM A;  1YJN A;  1K9M C;  2VNU D;  4JI1 Q;  3M4P A;  2CWP A;  2NN6 G;  4JI6 Q;  1OXV A;  4X66 Q;  1XNQ Q;  4IJH A;  4IOA A;  2KEN A;  3KLW A;  1VQL A;  1JMC A;  5J3B A;  2R92 H;  1IBL L;  1IYJ B;  1VQB A;  1Q1B A;  3CCQ A;  4IFD I;  4A3L H;  4JI0 L;  4LFA Q;  4IO9 A;  3UE0 A;  3A5Z B;  2JA5 H;  1PHJ A;  4UP8 A;  3CCV A;  4PZ7 A;  4DR1 L;  1K83 H;  1L1O C;  4LF5 L;  3KDF A;  2B3G A;  1C7Y A;  4DR7 Q;  2IX1 A;  2BA1 A;  4DV2 Q;  4BY7 G;  4A93 G;  1EFW A;  2UXC L;  2AKW B;  1E22 A;  2YV5 A;  3CCR A;  4YHH L;  1D8L A;  4AQY Q;  1EQQ A;  3HKZ G;  4YWL A;  2Y0S G;  3K8A A;  1X3E A;  3GTL H;  4LF9 Q;  5JJK A;  4OO1 G;  4WJ4 A;  4LF6 L;  1VQE A;  3VDY A;  4XTC S;  2PI2 E;  4B3R Q;  4DR2 L;  2I0Q A;  2CFM A;  1EUJ A;  4A3F H;  1XNR Q;  1AH9 A;  2PMZ E;  2JA8 G;  1B7Y B;  3ULJ A;  2E2H H;  3PUV A;  4YCV A;  1N33 L;  3S24 A;  2K4K A;  1UE7 A;  1FGU A;  4PZ8 A;  5M5X H;  3ULP A;  4A3M G;  3F2D A;  4ALP A;  1EQR A;  1TXY A;  4Y7N H;  3T1Y L;  4A3I H;  5GQO A;  3KJP A;  3H3V H;  1FVI A;  3RR5 A;  1HNZ L;  1PH7 A;  3UE1 A;  5HGQ A;  3G48 A;  4PG3 A;  3RLF A;  4LUV A;  1X3F A;  2E8G A;  2VQF L;  3GDE A;  1QUQ A;  4JG2 A;  1PH4 A;  1M1K C;  1MJE A;  3BZK A;  4JI4 Q;  4GNX A;  4IPH A;  1HR0 Q;  3I4M G;  3HOZ H;  3RZO H;  1QVF A;  2JEB I;  4GKJ Q;  1K8A C;  3NEN A;  4A76 A;  1N32 Q;  4GN5 A;  2UXB Q;  4NXN Q;  3CC4 A;  1T9H A;  1PVO A;  5BR8 L;  1B8A A;  2F4V L;  1P16 A;  1BVS A;  2K75 A;  2RHQ B;  2DUD A;  4JI3 L;  1B70 B;  2V1C C;  5GAD C;  4DR3 L;  4BBR H;  4A3J H;  2UUB L;  2NVY H;  4RMF A;  2Z6K C;  4DUY Q;  2UU9 L;  4DV7 L;  4LF4 Q;  1N34 L;  5C4J H;  3L0O A;  2Q2U A;  1VQK A;  3GTO H;  1WJJ A;  1EYG A;  2IHF A;  1IZ6 A;  1H95 A;  1X56 A;  1KHI A;  2JEA I;  5LMN L;  3FKI H;  4OX9 L;  4DR6 L;  4C3J H;  1TWG H;  2QGQ A;  4HJ9 A;  5FJ8 H;  3I2Z A;  3M9B A;  3L2P A;  1PH9 A;  4C2M H;  3J81 j;  4B3S Q;  3GO5 A;  3NBH B;  2FXQ A;  4JOI A;  2OWO A;  1HNW L;  2N8N A;  4KI0 A;  3TS0 A;  5JJI A;  1N36 Q;  1EIF A;  1VCI A;  2OCE A;  4IPG A;  5JJL A;  1YJ9 A;  4LNQ A;  3CD6 A;  1HZC A;  4RG1 A;  1NJI C;  2NVX H;  3CCL A;  1Y1V G;  2MFI A;  4FDB A;  5IYD H;  3H3V I;  4DUZ Q;  2YU9 H;  5FLM H;  2XTI A;  2JA9 A;  2HIX A;  4GOP B;  3HOV G;  4APV A;  4JI7 Q;  2LSS A;  4R4T A;  2IY5 B;  5GAE C;  1I94 L;  2DGY A;  3D0F A;  5LMN W;  1L2F A;  3NEM A;  2CKZ B;  3F8T A;  4BA2 I;  1V43 A;  2B63 H;  1HZ9 A;  3CC2 A;  4A3B G;  3F2B A;  1PYS B;  1GVP A;  2EIF A;  3PIP A;  3G4S A;  1G29 1;  4P71 A;  3PV0 A;  5IP9 H;  3G6E A;  2N78 A;  1YJW A;  3PO3 G;  4DV4 L;  1OXS C;  4DV1 L;  3J81 c;  3S17 H;  3BU2 A;  3BZC A;  3AYH B;  2HHH Q;  4UY8 C;  3H0G H;  3K7U C;  5C0X I;  2ALY B;  1CKN A;  2BA0 A;  5IE8 A;  1IBM Q;  4OXP A;  1YIJ A;  1PH6 A;  3BJU A;  1EIY B;  1CKN B;  3GTJ H;  4MTN A;  4LWC A;  3KF6 B;  1KRT A;  3WWV A;  4A3G H;  3PUX A;  3RLO A;  1EWI A;  4HJ7 A;  4LF8 L;  4JBJ A;  4JCV E;  4JI0 Q;  2JA7 H;  3M4O H;  4AYB E;  2ZM6 L;  3CF5 A;  1C0A A;  1Q12 A;  3U50 C;  3K80 C;  2UUC L;  1VQH A;  2JK8 A;  2UXC Q;  1X3G A;  1XMQ Q;  4KHP L;  1YIT A;  2ZTC A;  3F2C A;  4QJF A;  1MIU A;  5M3F H;  4PMW A;  4OWX B;  4DV0 L;  4LFC Q;  3PO2 G;  1NMF A;  1PA6 A;  1VQF A;  4LF6 Q;  4DR4 Q;  1QUQ B;  1RIP A;  4ME3 A;  3S2D H;  2IT1 A;  4DV5 Q;  4GNX B;  1I3Q H;  4GOP C;  1Q86 C;  2KHJ A;  2WFW A;  1Q8K A;  4DV3 L;  2WAQ E;  4XIG S;  4R4Q A;  3AQQ A;  3HOX G;  5IP7 G;  5AJ3 Q;  3G71 A;  4AH6 A;  4JYA Q;  3CXC A;  3HOU H;  1ASZ A;  1AE3 A;  4JI8 Q;  1SMX A;  1QVC A;  4P74 A;  1TWH H;  2VQE L;  4BBS H;  3HOW H;  1HZB A;  1SR3 A;  2R93 G;  2ES2 A;  1KAW A;  4A3E H;  4TQU S;  3S1R H;  3ICE A;  5C4X G;  3I56 A;  3TQY A;  1Y1W G;  1PFS A;  4JV5 L;  1HNX L;  3PUZ A;  4DAM A;  4JI5 Q;  4AYB G;  4YY3 Q;  2N49 A;  1G51 A;  2R6G A;  1U0L A;  3PUW A;  3STB D;  1YZ6 A;  4HID A;  4MNO A;  4KHZ A;  4JBW A;  2HT1 A;  1JJG A;  3PUY A;  1KD1 C;  2E5L L;  1IBK L;  1FJG L;  1XMO Q;  1A0I A;  1L1O A;  3GD7 A;  2L15 A;  3LGJ A;  5H1S E;  2UU9 Q;  4B3T L;  4A93 H;  4BY7 H;  4LFB Q;  4YWM A;  2JJQ A;  1HJP A;  3NEL A;  2GN5 A;  5IWA Q;  1NMG A;  3CPW A;  2E2J H;  2K5H A;  2WAQ G;  4K0K L;  2R7D A;  4DV6 L;  1WCM G;  4HIK A;  3T1H L;  4B3M L;  3HOY G;  1EOV A;  4BXX G;  2F3I A;  2VW9 A;  4X64 Q;  1SFO H;  4JI1 L;  3M7N A;  5LMU Q;  2YTV A;  1E24 A;  4JI6 L;  2YYZ A;  4X66 L;  1XNQ L;  2VL6 A;  4GNX C;  2JA8 H;  2B29 A;  1JB7 A;  3KFU A;  4JI2 Q;  4Y52 H;  1SRO A;  1TWF H;  2UUA Q;  4OWT B;  1LUZ A;  4A3M H;  2H5X A;  1V1Q A;  1GO3 E;  1OXX K;  1R9T H;  1JE5 A;  1XTD A;  1OXT A;  4C3I H;  2Q2H A;  3CQZ H;  3W5O A;  3M85 A;  3OYY A;  4LFA L;  3KJO A;  1NTG A;  2D0O A;  3K7A H;  3TEH B;  5IT9 c;  2NZO A;  3PSI A;  3GTP H;  4DR7 L;  1CSQ A;  4X62 Q;  1Q81 C;  4DV2 L;  4DK3 C;  5IYB G;  2K5N A;  4DAY B;  3JAM c;  1KIX A;  1LYL A;  3I4N G;  4A3D G;  3HKS A;  4OWW B;  3I4M H;  4DNI A;  4AQY L;  4GKK Q;  3U4Z A;  1VQ6 A;  4GLV B;  3RNU A;  4LF9 L;  4IFD J;  2AWO A;  3M3Y H;  1VS0 A;  4R4C A;  1E3P A;  1P8L A;  3CW2 C;  3J81 i;  3CC7 A;  2KBN A;  2GVB A;  4GS3 A;  2VUM G;  3PCO B;  3UDF A;  4IOC A;  1PH5 A;  1VQG A;  1E1T A;  4B3R L;  5IY0 A;  1VQ8 A;  3GTG H;  3ZJY C;  4A3C G;  3U58 A;  4X65 Q;  2Z6K A;  1VQ9 A;  3E0E A;  3J80 i;  2LXK A;  2BH2 A;  3EIV A;  2MO1 A;  5IYC G;  2WB1 E;  1VQN A;  1VQM A;  1IXR A;  1M90 C;  2ATW A;  1QZH A;  4NXM Q;  4C3H H;  5GAG C;  1GD7 A;  2R7Z G;  4L5S A;  3S14 H;  1Q46 A;  4JI4 L;  5M5Y H;  2Q2T A;  1HH2 P;  2QA4 A;  3E9H A;  1HR0 L;  2YTY A;  2UUC Q;  1E1O A;  2MO0 A;  4R4I A;  1O7I A;  4IFD G;  2N3S A;  1ASY A;  4A4I A;  5M5W H;  5C44 G;  1JJC B;  3DM3 A;  4UP9 A;  4GKJ L;  1KRS A;  4L5Q A;  1N32 L;  4NXN L;  3A5U A;  2VY3 A;  1J5E L;  3FHW A;  3KDF B;  4HIO A;  3W1B A;  4P75 A;  3S1N H;  1Y1V H;  1VQC A;  3CCE A;  2OQ0 A;  1UE5 A;  3KYH C;  3J7Z C;  3CCU A;  5M3M G;  1NBW A;  4A3K G;  3HOV H;  4L5T A;  4HJA A;  2A8V A;  4NPS A;  5ELO A;  1UE1 A;  1LM0 A;  2XGT A;  2D0P A;  3CCM A;  1IBL Q;  3J80 c;  4A3B H;  1Q7Y C;  3S16 H;  2AWN A;  1HR0 W;  1XPR A;  3H15 A;  5C3E G;  2VS1 A;  3PO3 H;  4DR1 Q;  2OTJ A;  2WB1 G;  4LF5 Q;  4BY1 G;  4EQ5 A;  1WI5 A;  1VQ4 A;  1CKO A;  5K36 G;  4YHH Q;  4IPD A;  1JJ2 A;  3RZD H;  4DR5 L;  1N36 L;  3STB C;  1N8R C;  1KXL A;  1BKB A;  4EX5 A;  1MKH A;  4JV5 Q;  3AEV A;  1WYD A;  3OTO L;  1K8G A;  1K3R A;  4DUZ L;  4DR2 Q;  1A63 A;  4GLA C;  1CKM A;  3ULL A;  4JI7 L;  1N33 Q;  2UXD L;  2R92 G;  4L5R C;  3S2H H;  4BA1 I;  1SN8 A;  1W2B A;  3E9I A;  5JEA J;  1PH2 A;  1XPO A;  3T1Y Q;  1MJC A;  4JBM A;  3RN2 A;  2KCT A;  2I5L X;  2NZH A;  2ZJQ A;  2LXJ A;  1HNZ Q;  1WFQ A;  3MEF A;  3UDX A;  2I5H A;  4DV6 Q;  1X9N A;  1X65 A;  4LW1 A;  2JA5 G;  3PO2 H;  1YBY A;  1K0R A;  2VQF Q;  1D7Q A;  2GVA A;  1NY4 A;  3I4O A;  4TVA B;  2HHH L;  2VUM H;  3CAM A;  1Q1E A;  1X6O A;  1IBM L;  1VQO A;  3HOX H;  4GOP A;  4HJ8 A;  5IP7 H;  3S1M H;  1PYB A;  1J6Q A;  2YTX A;  5BR8 Q;  2JA6 G;  2F4V Q;  4LF7 L;  1YHB A;  2CQO A;  4POF A;  1QZG A;  4DR3 Q;  4JI3 Q;  4AIM A;  2R93 H;  2UUB Q;  5C0X J;  5C4X H;  4A3F G;  3JAM i;  1Y1W H;  2ZTE A;  4DV7 Q;  3S1Q H;  1N34 Q;  1SE8 A;  5JEA G;  2PQA A;  1XMQ L;  1PH1 A;  3Q8D A;  4IJL A;  4A3I G;  5LMN Q;  2KHI A;  3J7A 5;  4LFC L;  3CPF A;  4YCW A;  3RLN A;  2PNH A;  3KOJ A;  4OX9 Q;  4DR6 Q;  2ZTD A;  3KF6 A;  4GN3 B;  3PF4 A;  5ELN A;  4DR4 L;  1AE2 A;  1W3S A;  1BBU A;  2CWA A;  3D31 A;  2JA6 H;  4DV5 L;  2ZJP A;  4POG A;  3HOZ G;  2WP8 J;  4KLK A;  3TRE A;  1XPU A;  1N9W A;  1FL0 A;  2MNA A;  4JYA L;  5AJ3 L;  1HNW Q;  2A1A A;  4O0A A;  2A19 A;  3L7Z C;  2HIV A;  4JI8 L;  3CMA A;  3B6Y A;  4OON A;  4JBK A;  2MQH A;  1WCM H;  1PH8 A;  3AFP A;  5C0X G;  3K81 C;  2EQS A;  3HOY H;  1YVC A;  4A3J G;  4BBR G;  1TWC H;  2IX0 A;  1KC8 C;  2RHS B;  4BXX H;  2BH8 A;  2ASB A; 
#chains in the Genus database with same CATH topology
 1K8M A;  1I94 Q;  2NVT B;  4JW0 A;  2J7Z A;  4A75 A;  4IPC A;  2D62 A;  5I6W A;  3PF5 A;  2R7Z B;  3SK5 A;  3FKI G;  4C3J G;  1LTL A;  1J5E Q;  4CDC C;  2Z0S A;  1F2L A;  4DV1 Q;  5FJ8 G;  4WJ3 M;  5BN3 A;  3I91 A;  4R1J A;  5LL6 X;  3MAQ A;  1YI2 A;  1XMO L;  1SNM A;  1SRU A;  2ENB A;  4UAI A;  3MZ5 A;  1PTO H;  1ZYR D;  1PDQ A;  1PFM A;  2EVB A;  3L3O C;  3F1Z A;  3RN5 A;  4UP7 A;  2F0M A;  2ZM6 Q;  1PV4 A;  1A3T A;  2K33 A;  5LMU L;  1GM5 A;  1FNW A;  3ER0 A;  2CVR A;  2MJ8 A;  3NTK A;  4LUZ A;  2O2L D;  3GTK H;  2B63 G;  4OIK A;  3AB9 A;  2WB1 B;  4KJN A;  2CCZ A;  4DR5 Q;  5DLQ E;  5IYC H;  2NVT H;  4LMQ D;  1GUS A;  1BF4 A;  2R7Z H;  3HG9 A;  1MGS A;  3CCJ A;  1HUM A;  1JC7 A;  5D14 A;  4HCE A;  4IFD H;  4A3G G;  3A0J A;  5DM7 3;  1YHA A;  1LTA D;  5D65 A;  2JA7 G;  2OQK A;  2R7F A;  2VZA A;  2WKC A;  4JV5 Q;  3SGI A;  2JA5 B;  4X65 L;  2A68 D;  1XXG A;  1GOZ A;  4QMG A;  3I7F A;  5M9O A;  3QOJ A;  1WD1 A;  3PGZ A;  4RCN A;  2A69 C;  2HUG A;  1A62 A;  3VYU A;  1D1K A;  1X3P A;  5IOD A;  1UEB A;  1PYW D;  2K28 A;  4I7A A;  4DKA C;  3VR5 A;  3CRL C;  4BBS G;  1OTC A;  3DLL A;  1KTK A;  2AHO B;  2EDG A;  4A3E G;  2VNU D;  3M4P A;  4JI6 Q;  1VF5 C;  1OXV A;  1TR5 A;  4KJO A;  4YIJ A;  2JN4 A;  4Q0F A;  1PXU A;  2XSC A;  5L37 A;  5IGE A;  5ISR A;  2NUC A;  1NCV A;  1QJO A;  1B50 A;  1E2W A;  2SOB A;  1AFP A;  3UE0 A;  3A5Z B;  2JA5 H;  4B9W A;  5A35 A;  4DR1 L;  1L1O C;  1S5D D;  4LF5 L;  4DAP A;  1C7Y A;  2MPM A;  4DV2 Q;  1E22 A;  2LKV A;  3K5M A;  3K58 A;  3CCR A;  4DU9 A;  1D8L A;  4BBR B;  4AQY Q;  2NVY B;  1EQQ A;  1X3E A;  4LF9 Q;  2EJF C;  5HUR A;  1ESR A;  3C1E A;  2I0Q A;  2CFM A;  3V05 A;  5CV6 A;  1CT1 D;  1AH9 A;  1B7Y B;  3PUV A;  4YCV A;  1PMR A;  1YNN C;  3HS0 C;  2OEO A;  1TKW B;  3F2D A;  2XWB B;  3H3V H;  5GQO A;  3KJP A;  4C3I G;  1F9R A;  3RR5 A;  2XRS D;  2ZXP A;  1PH7 A;  3RLF A;  4LUV A;  2E8G A;  3GDE A;  2B2U C;  1PH4 A;  1AN8 A;  4GNX A;  4IPH A;  1O7Y A;  1QVF A;  3I70 A;  4GKJ Q;  1LTS D;  1CM9 A;  5IGB A;  4GN5 A;  2UXB Q;  1T9H A;  2F4V L;  4RCO A;  2RHQ B;  1SYG A;  3I8Z A;  5GAD C;  4BBR H;  3K5N A;  2NVY H;  2QDL A;  2Z6K C;  3VA5 A;  3QB3 A;  3MFY A;  1JOR A;  4LF4 Q;  3ONA B;  4FVM A;  1N34 L;  2EY5 A;  2Q2U A;  1D1I A;  4LJZ C;  5FO8 B;  4KKS A;  2IHF A;  1Y69 U;  5CV7 A;  1X56 A;  1KHI A;  1RDP D;  4ZAI A;  1PLF A;  3MVV A;  3KK7 A;  4OEL B;  3M9B A;  4K5W A;  3J81 j;  1DM0 B;  3GO5 A;  2FXQ A;  4JOI A;  2OWO A;  3AMU A;  1V1O A;  1HCZ A;  2L0C A;  4IPG A;  3CD6 A;  1HZC A;  1Y1V G;  2MFI A;  1XX8 A;  4XYO A;  5M3F B;  4JI7 Q;  5FLX E;  1G6Z A;  2DGY A;  3D0F A;  1A2T A;  1V43 A;  1SYD A;  2BDO A;  4X3U A;  5IGD A;  1PYS B;  1G29 1;  1DXM A;  3ITP A;  3HOU B;  1SJE D;  3G6E A;  2N78 A;  3PO3 G;  4DV4 L;  3J81 c;  3BU2 A;  3BZC A;  1JR0 D;  3A8J E;  2DY8 A;  3MTS A;  2BA0 A;  1CKN A;  3OMC A;  1R4P B;  2ICE C;  2DY7 A;  3KF6 B;  3RLO A;  1MD2 D;  3I4L A;  5CR3 A;  2FHT A;  4CHT B;  4ZK9 B;  3U50 C;  1IYV A;  5CC4 A;  2KJX A;  1X3G A;  1XMQ Q;  4KHP L;  1YIT A;  2XN9 C;  4DV0 L;  4A93 B;  5M3F H;  3N52 A;  4LFC Q;  4OWX B;  4BY7 B;  2HD3 A;  2RDH A;  1QUQ B;  2N55 A;  2IT1 A;  4GOP C;  1QNU A;  4XIG S;  1HTP A;  4JYA Q;  1JCK B;  3MXP A;  3HOU H;  1D5M C;  1ASZ A;  3NXW A;  4JI8 Q;  2IX3 A;  2JA8 B;  5E4W C;  5EBD A;  5I9O A;  4A3M B;  2NBF A;  4QUF A;  3C3L A;  1Y1W G;  1R9T B;  2NN6 H;  3D6C A;  3C46 A;  3PUZ A;  4DAM A;  5IIF A;  2FIN B;  4AYB G;  2R6G A;  1HPC A;  1U0L A;  3GTP B;  2AQ1 B;  4LK1 C;  2HT1 A;  3D4R A;  3PUY A;  1KD1 C;  1EEF D;  2E5L L;  5I9P A;  3M3Y B;  1XMO Q;  4ZUJ A;  2PO4 A;  5H1S E;  2L15 A;  4A93 H;  4M8A A;  2UU9 Q;  4BY7 H;  4B08 A;  4YWM A;  1NMG A;  1SNC A;  1H9J A;  2R7D A;  3T1H L;  4OO1 H;  5EBC A;  4M1U B;  2F3I A;  2KCC A;  2BDN A;  3P20 A;  5LMU Q;  1I4G A;  2YYZ A;  2JA8 H;  2B29 A;  1BCP D;  3ZYY X;  4OWT B;  1LUZ A;  4A3M H;  1ICF B;  3QJY A;  1JE5 A;  5IT9 E;  1R9T H;  4RWS C;  2K1B A;  1T5X D;  1QE6 A;  3KJO A;  3JAM E;  2D0O A;  3TEH B;  4KD3 A;  2NZO A;  3GTP H;  1VF7 A;  4DK3 C;  1HQR D;  2Z9H A;  3I4N G;  2IWH A;  3U4Z A;  2AUJ D;  1KDA A;  3HOV B;  3OIP A;  2AWO A;  3M3Y H;  2JYO A;  3J81 i;  4C3H G;  2KBN A;  3PCO B;  3UDF A;  5CYU A;  2F4I A;  1VQ8 A;  2EY1 A;  1IKL A;  1SNO A;  3S16 B;  4A3C G;  4X65 Q;  5JPM C;  5J1Z A;  1BR9 A;  3E0E A;  1PZK D;  1PZI D;  1EL0 A;  2MO1 A;  4IUR A;  1VQM A;  1CK1 A;  2ZT9 C;  3RZD B;  1IXR A;  3CHB D;  2ATW A;  4PMC A;  2V4D A;  3ERQ A;  4L5S A;  2Q2T A;  1EIG A;  2UUC Q;  2MO0 A;  1O7I A;  4A4I A;  3BG3 A;  3DM3 A;  1N32 L;  2XWJ B;  1J5E L;  3S2H B;  3KDF B;  3W1B A;  3D4D A;  5M3M G;  4A3K G;  3VYR A;  3J80 E;  3FMC A;  1IHZ A;  3SXH A;  4HJA A;  3HOV H;  4NPS A;  5KRU A;  1BCP B;  1H9S B;  4EQN A;  4P2C B;  3CCM A;  1L0X B;  1NSN S;  2HCC A;  5ELF A;  3S16 H;  3H15 A;  4KK7 A;  4DR1 Q;  4LF5 Q;  4KN7 C;  4EQ5 A;  3DMU A;  3A55 A;  1SBB B;  3JAM L;  1DZ1 A;  3TBI B;  2NB0 A;  3RZD H;  4ODG A;  3KLR A;  4DR5 L;  5C4X B;  1ENA A;  3I73 A;  3S1Q B;  1QG7 A;  1N8R C;  2R61 A;  1WYD A;  1QNK A;  4KHV A;  5FK9 C;  2Z4H A;  3S2H H;  4BA1 I;  1SN8 A;  1B3A A;  1W2B A;  1PH2 A;  5JEA J;  2KEE A;  5JVG 3;  5I2Y A;  4JBM A;  4RKL A;  3RN2 A;  2ZJQ A;  1V8Q A;  2LXJ A;  4A3L G;  3MEF A;  2I5H A;  4U67 3;  4DV6 Q;  4LW1 A;  2F0L A;  5HGT A;  1K0R A;  2HHH L;  3HOY B;  1X6O A;  1SE3 A;  3DWQ A;  1H9M A;  1EU3 A;  3T53 B;  2F4V Q;  2DJF C;  2G9D A;  2JSO A;  1QZG A;  2A69 D;  1KDB A;  2RDF A;  1EEI D;  5C0X J;  5C4X H;  1B2T A;  2PZU A;  3S1Q H;  4F7X A;  1SE8 A;  1N34 Q;  3X3N A;  1E0B A;  1PH1 A;  4IJL A;  2GA4 B;  3H94 A;  2H4O A;  3J7A 5;  2B8G A;  4RAU C;  4YCW A;  1W6K A;  3KF6 A;  3PF4 A;  1IL8 A;  2NVQ B;  1K28 A;  2FMC A;  4DV5 L;  2ZJP A;  1SMY C;  3A8I E;  4KLK A;  3TRE A;  1N9W A;  2ZXR A;  2L4N A;  2HIV A;  2EJM A;  4JBK A;  1PH8 A;  2EYP A;  3AFP A;  3HOY H;  3Q0A A;  3TP5 A;  3TDQ A;  2BH8 A;  4OHJ A;  2ASB A;  1OXU A;  3CCS A;  2XIW A;  2OTL A;  4YY3 L;  1ENC A;  3A7A B;  2K05 A;  2K6A A;  2K14 A;  1Z47 A;  1IL2 A;  3EN2 A;  4GLX A;  2FJ2 A;  1Q82 C;  3E3X A;  4DV4 Q;  1SLJ A;  1KL9 A;  2TMP A;  5C44 B;  3S15 B;  5E7N A;  2PQE A;  4LUO A;  1DYQ A;  4J15 A;  1U4P A;  1YNN D;  1HZA A;  1Y14 B;  4YWK A;  2NVQ H;  3CP0 A;  2D5D A;  4NMZ A;  2NTT A;  2EYF A;  5FLM G;  5CBA E;  1A8V A;  3FVQ A;  4ZQ3 A;  2LS0 1;  2XRQ D;  1TU2 B;  1IYU A;  2I5M X;  4JI2 L;  2EY2 A;  1B44 D;  4DNT B;  4DPG A;  4KHP Q;  2B39 A;  2UXB L;  4BY1 B;  2E2I B;  4R4O A;  1G6P A;  3KF8 B;  4DV0 Q;  1SNP A;  3PIO A;  2I07 B;  2JQO A;  2F0K A;  3H0G G;  3OTO Q;  3RUZ A;  4LF4 L;  3P75 A;  4X62 L;  4V19 0;  1UUP A;  2HDM A;  3I55 A;  3E0J A;  2F52 A;  2QEX A;  4DN4 M;  5C44 H;  1EOT A;  1XJV A;  3S15 H;  5FLX c;  1PTO D;  1F2Z A;  1ZXT A;  2B2W C;  3KLS X;  2K52 A;  2JE6 I;  1L1O B;  3OW2 A;  4TRD A;  2PQA B;  2AMC B;  1BQQ T;  4JC0 A;  1VQ5 A;  3K5L A;  4N9T A;  3N6R A;  2MUY A;  4JPB W;  1PH3 A;  1Z9F A;  5GRO A;  1DCZ A;  4IAL A;  1WTX A;  4XDX A;  1QCB D;  4C1N I;  2E5L Q;  4NXM L;  3A74 A;  4BY1 H;  2F0G A;  3HKZ E;  2E2I H;  2Y0S E;  5C5M A;  5K36 H;  2EE1 A;  5E1F A;  3OOC A;  1CQV A;  1JOQ A;  3T1H Q;  4X3K A;  3HOW G;  4GN4 B;  4QY7 A;  1FR3 A;  4HIM A;  1K9M C;  2CWP A;  1X3Q A;  5EPL A;  5BN5 A;  3J7A F;  4IJH A;  1XTC D;  4JK1 C;  1WTO A;  1NR4 A;  1JMC A;  5EPK A;  1IBL L;  3TP6 A;  3FDT A;  3LX0 A;  4IFD I;  4R9W A;  4IO9 A;  2L11 A;  4UP8 A;  4PZ7 A;  1K83 H;  4QUC A;  2EJG C;  3KDF A;  2IX1 A;  2WII B;  4K2L A;  2YV5 A;  2J4X A;  4A3J B;  4O1N A;  1STH A;  1DD2 A;  1H9S A;  1EY0 A;  2CH4 A;  1VQE A;  2VB3 X;  2A74 C;  3HP3 A;  2PMZ E;  3BDC A;  4DK1 A;  5C5L A;  3WOF A;  5FOB B;  1IKM A;  3SK4 A;  1N33 L;  2K4K A;  4RKB A;  4PZ8 A;  1WTH A;  2DN8 A;  4C2M B;  1EQR A;  5T1G A;  5DEH A;  5HGQ A;  2KCN A;  1QIL A;  2VQF L;  1SYB A;  2NVX B;  3NE5 B;  3BZK A;  1D2B A;  4WRD A;  2CW0 C;  5E4X A;  3I4M G;  1FD7 D;  1J9O A;  1K8A C;  1N32 Q;  2F0I A;  4HCS A;  1WTP A;  2F0V A;  1WTV A;  1B8A A;  1EYA A;  1P16 A;  2DUD A;  1B70 B;  2V1C C;  2BOS A;  4A3J H;  2UUB L;  4RMF A;  4DUY Q;  2UU9 L;  1TY0 A;  3L0O A;  2B2V C;  2KA7 A;  3GTO H;  1A6X A;  2JEA I;  2QEJ C;  5KND A;  5LMN L;  4OX9 L;  2WKD A;  3NP8 A;  4HJ9 A;  5C4Z A;  3I2Z A;  3NSW A;  5ELE A;  1PH9 A;  3V96 A;  4C2M H;  4B3S Q;  3NBH B;  2IL8 A;  3M4O B;  3BZD B;  1VCI A;  2OCE A;  4RG1 A;  1NJI C;  2NVX H;  5IYD H;  3H3V I;  4MN3 A;  4ILW A;  4GOP B;  3NQI A;  5GAE C;  5LMN W;  3ND9 A;  2CKZ B;  4PQX A;  3T56 B;  4BA2 I;  3SR1 A;  1BNZ A;  3QO2 A;  2A6E D;  4CKE A;  2EIF A;  5KGU A;  4P71 A;  5IP9 H;  1LTR D;  3IKJ A;  1EU4 A;  2F1M A;  2HHH Q;  1TWH B;  1SYC A;  5IE8 A;  1K3B C;  2L12 A;  4HR7 B;  3S1R B;  5CV4 A;  1FYC A;  3MFG A;  4FXK C;  4EVO A;  4LWC A;  3WWV A;  1WTR A;  4LF8 L;  2PW7 A;  4JBJ A;  4JI0 Q;  1GUT A;  3M4O H;  4PV1 C;  1Q12 A;  3HZX A;  1GUG A;  5EJW A;  3K80 C;  2UUC L;  1UEA B;  1VQH A;  2I46 A;  3P1H A;  2UXC Q;  3RD4 A;  1EWH A;  3H91 A;  3P7J A;  2KVM A;  1DON A;  2WV6 D;  4PMW A;  3PO2 G;  1NMF A;  1PA6 A;  2E2J B;  2R3Z A;  2X6L A;  3HKZ B;  4AYB B;  2Y0S B;  4ME3 A;  2X69 A;  4DV5 Q;  4XXE A;  4L6T B;  2WFW A;  4NKL A;  4O42 A;  4DV3 L;  4HN7 A;  3G71 A;  5IP7 G;  1F2M A;  1SFO B;  3CXC A;  1SMX A;  3MC0 B;  4P74 A;  1EY4 A;  1TWH H;  2VQE L;  2R93 G;  3KF8 A;  2ES2 A;  1KAW A;  3ICE A;  4TQU S;  3S1R H;  3I56 A;  1PFS A;  1H9R A;  1O7Z A;  4K6D A;  3BDO A;  1G2S A;  4YY3 Q;  2N49 A;  1LT5 D;  3K7A B;  3PUW A;  1JIC A;  3HEJ A;  2D2C C;  4RGN A;  2EYH A;  4QB4 A;  1EY9 A;  4FP5 D;  1ILQ A;  1D5X C;  1CZW A;  1IBK L;  1L1O A;  4B3T L;  4FYD A;  2E2J H;  2GN5 A;  2K5H A;  2WAQ G;  4DV6 L;  1HRJ A;  1I4P A;  4N8F A;  4FF3 A;  3BS1 A;  4BXX G;  2VW9 A;  2PMZ B;  1SFO H;  4JI1 L;  2YTV A;  1E24 A;  3D8G A;  3NTH A;  2VL6 A;  1NR2 A;  4C56 C;  4BS9 A;  4GNX C;  2QDB A;  4L8J A;  3TN2 A;  1EY6 A;  4JI2 Q;  4Y52 H;  4HSP A;  4F87 A;  4HMI A;  1C8C A;  4QCL A;  3KUP A;  1XTD A;  1LAB A;  1OXT A;  1W6J A;  2A73 B;  2AQ2 B;  3J7A V;  5M5W B;  3K7A H;  1CZG A;  4DR7 L;  4X62 Q;  2A5H A;  3S1N B;  3SHL A;  4DAY B;  1U4L A;  2B2U A;  3M7G A;  1TS2 A;  1CA5 A;  4RFB A;  3H09 A;  3CW2 C;  1R4Q B;  3CC7 A;  2GVB A;  4CDD C;  4IOC A;  5E3F A;  1VMP A;  4A3B B;  3E6Z X;  4ZKC B;  3ZJY C;  4PMB A;  5C6A A;  1JQY D;  2Z6K A;  1U4M A;  3J80 i;  1J8I A;  5IYC G;  2EOT A;  5DAU A;  4NXM Q;  4C3H H;  2R7Z G;  1GD7 A;  3F2U A;  1STG A;  1HH2 P;  1LTI D;  2HQE A;  1AEX A;  1HR0 L;  2YTY A;  1E1O A;  4IFD G;  5M5W H;  1GHJ A;  4NXN L;  4DA2 A;  3NBI A;  3S1N H;  1VQC A;  1UE5 A;  3J7Z C;  3CCU A;  2NYZ D;  4L5T A;  3VR4 A;  1I6V C;  1XYI A;  1D6E C;  1LM0 A;  1IBL Q;  4RGO S;  5A2Q E;  2Z4I A;  4A3B H;  1LTB D;  3HOX B;  3OSO A;  3TP8 A;  1HR0 W;  4B9X A;  2KUM A;  4V0B A;  1BO0 A;  2F0D A;  2OTJ A;  2WB1 G;  5JPN C;  3DM1 A;  4DNR B;  4IPD A;  5ELD A;  3O13 A;  1N36 L;  3STB C;  1KXL A;  1BKB A;  1G2T A;  1KLG D;  3WDN A;  2F0U A;  4GZY C;  3AEV A;  3VR6 A;  4LAA A;  3OTO L;  1K3R A;  2KOL A;  1N33 Q;  4RHR A;  2QW7 A;  3NBH A;  3TZU A;  4G7Z C;  3UDX A;  2F0F A;  2FFK B;  1EZ8 A;  1X65 A;  3GV3 A;  2RCF A;  2JA5 G;  4K2K A;  2TSS A;  2VQF Q;  1NY4 A;  4TVA B;  1DOM A;  1WCM B;  2HDL A;  1CA6 A;  1IBM L;  1TWC B;  3HOX H;  4GOP A;  4HJ8 A;  1STN A;  1PFN A;  2YTX A;  1CTM A;  1SXT A;  2JA6 G;  2LMC B;  2CQO A;  2K5D A;  2UUB Q;  2ZTE A;  5KNB A;  1WVL A;  1A3V A;  1C4Q A;  2E76 C;  4DXF A;  5LMN Q;  5A2Q L;  3CPF A;  3RLN A;  4OX9 Q;  1B9N A;  4HED A;  4OL7 A;  4FF2 A;  4A3D B;  4QF4 A;  4DR4 L;  1HQM C;  1W3S A;  2A6H D;  1BBU A;  2ZXO A;  3W2D A;  2MGS A;  4POG A;  2B2T C;  1FL0 A;  2VUM B;  1SEB D;  2A1A A;  4O0A A;  1U9R A;  4IUU A;  1TT2 A;  1DOK A;  1ICW A;  3B6Y A;  5C3X A;  3RMH A;  1WCM H;  3D3R A;  5KIX A;  2FMM A;  2EYO A;  1SYF A;  3K81 C;  1YVC A;  4BBR G;  1TWC H;  3GTQ B;  3I72 A;  2RHS B;  3I90 A;  1HFG A;  1YHQ A;  3PIO 3;  4JI5 L;  3W1G A;  4ULL A;  5ELB A;  4X6A H;  3NWT A;  1MI2 A;  2ID0 A;  4ZUI A;  2CH4 W;  4YCU A;  4CKB A;  4QGU A;  2RF4 A;  4FXG C;  3U4V A;  1EQT A;  1D7Q A;  5IYB H;  3JC6 6;  4JVZ A;  1EY7 A;  4A3D H;  5IWA L;  1VQA A;  1K73 C;  1S3O A;  2OF1 A;  4LF8 Q;  1I5F A;  4MHE A;  1EFI D;  3FP9 A;  2VUM H;  4H0L C;  1CSP A;  3G6J B;  4X64 L;  1I4H A;  2Q8T A;  2F0P A;  2CW0 D;  3MXG A;  3TME A;  5HY6 A;  3UDI A;  1I6H B;  2K04 A;  5C3E B;  4J8Q A;  1Q90 A;  2UUA L;  4PNY A;  2PYK A;  3GTQ H;  2K50 A;  1U4R A;  1KNA A;  2M9V A;  4X3S A;  2J0T D;  4NB3 A;  4H44 C;  2Q8R E;  4MZ9 A;  1LV9 A;  3R2T A;  4DUY L;  1TWA B;  1QOH A;  3K57 A;  4DV3 Q;  4K6L A;  2KCM A;  1LO5 D;  2D9U A;  2K5V A;  2RCN A;  1NE3 A;  4XT1 B;  1GUN A;  2VQE Q;  3AFQ A;  3ERS X;  2R92 B;  2UXD Q;  3C1F A;  1I4Q A;  3K0X A;  3M4Q A;  4U68 A;  3MXN B;  1I50 H;  2HQL A;  2RSO A;  4B3S L;  2F0O A;  1L0W A;  5COR A;  2LFN A;  4WOR A;  1CUK A;  4DAY A;  4HJ5 A;  5M3F G;  1VQP A;  3T13 A;  1C9O A;  1JOK A;  4Q5V A;  3IAY A;  1I6H H;  5C3E H;  2QIL A;  1UAP A;  4PZ6 A;  5GAH C;  3A54 A;  4UHV A;  1IBK Q;  1TS3 A;  4KKU A;  2MHV A;  4B3T Q;  4KN4 C;  3HOU G;  3R3O A;  2EYJ A;  4P73 A;  1SSO A;  2C35 B;  4A3F B;  3EBE A;  1WOC A;  2E2H B;  3FPP A;  1TWA H;  1V9P A;  3GP7 A;  5M5X B;  1YJN A;  4DGZ A;  2K01 A;  1OO9 B;  4JI1 Q;  4A3I B;  2NN6 G;  1Z6H A;  2NWG A;  4IOA A;  1CI3 M;  2B8F A;  3DWA A;  4ZRZ A;  1F9S A;  2R92 H;  5IOC A;  1IYJ B;  4XT3 B;  4EGV A;  1Q1B A;  3NWS A;  3KLS A;  3HOZ B;  3CCQ A;  4DK0 A;  1O78 A;  4Z9C B;  1I4X A;  4JI0 L;  4RA8 A;  5D3I B;  1PHJ A;  3CCV A;  4NDX A;  2B3G A;  4DR7 Q;  2BA1 A;  2Z1C A;  4BY7 G;  3A7L A;  1EFW A;  4A93 G;  1IW7 C;  2UXC L;  4YHH L;  1LT6 D;  4YWL A;  4OO1 G;  4N9P A;  1A15 A;  1JWM D;  1LLR D;  4DFA A;  1S4Z A;  1ROD A;  4HMJ A;  2PI2 E;  4A3F H;  1XNR Q;  2JA8 G;  3FKI B;  4IN3 A;  1STB A;  3ULJ A;  4C3J B;  2E2H H;  1TWG B;  2JP1 A;  3S24 A;  5JEA H;  5M5X H;  3ULP A;  4A3M G;  3CRK C;  3PQI A;  4ALP A;  1TXY A;  3T1Y L;  4A3I H;  3VR3 A;  4MIU A;  1VDZ A;  2LY7 A;  3MA2 B;  5D3D A;  1QUQ A;  2O4X A;  2VXW A;  1MJE A;  1M1K C;  3HOZ H;  1HR0 Q;  2X6G A;  2YU9 B;  4RH6 A;  2JEB I;  3KBG A;  4A76 A;  1A3U A;  2AUK A;  1S5E D;  2H1E A;  3CC4 A;  4NXN Q;  1PVO A;  3ND8 A;  1JE4 A;  2SDF A;  1BVS A;  2B63 B;  5C0X H;  4DR3 L;  1UNS A;  1TVX A;  4DV7 L;  3A56 A;  5ELC A;  3S17 B;  1VQK A;  1RCV D;  1WJJ A;  1EYG A;  1GXD C;  1D5Z C;  3FKI H;  4DR6 L;  2MP1 A;  4C3J H;  1TWG H;  2QGQ A;  4IUT A;  3GTJ B;  4CKC A;  5FJ8 H;  2K03 A;  4A3G B;  2RBM A;  5AFW A;  5KEE A;  1HNW L;  2JA7 B;  2N8N A;  3TS0 A;  1JB3 A;  2ICI A;  1F9Q A;  1N36 Q;  1KDC A;  1EYC A;  4IQZ A;  4LNQ A;  5JJL A;  3NTI A;  2F3W A;  1TY2 A;  3CCL A;  4FDB A;  2YU9 H;  2KEC A;  3HOV G;  5I6Y A;  2EZV A;  2IY5 B;  3NEM A;  1ML0 D;  3F8T A;  4OIJ A;  1HZ9 A;  2B63 H;  5CV5 A;  3CC2 A;  3BYY B;  3J81 E;  3F2B A;  3G4S A;  3PIP A;  2AQ3 B;  1YJW A;  1TII D;  1OXS C;  1JWS D;  1Y8N B;  3S17 H;  4UY8 C;  1TQO A;  4BBS B;  1K83 B;  1IBM Q;  4OXP A;  4A3E B;  1YIJ A;  1PH6 A;  3BJU A;  3K5O A;  2NZ1 D;  1EIY B;  4FXD A;  3GTJ H;  4A3G H;  2Z8L A;  5FKA C;  3SDZ A;  4DAV A;  2CQA A;  1FGB D;  2JA7 H;  2WIN B;  4MTK A;  4AYB E;  2B2W A;  4NW2 A;  3R93 A;  2F3V A;  1PZJ D;  2OXP A;  2QCP X;  4L63 B;  2ZTC A;  5IGG A;  3IL8 A;  2NTS A;  3NPP A;  1VQF A;  4LF6 Q;  4DR4 Q;  1L0Y B;  1PFB A;  1RIP A;  3K59 A;  4GNX B;  2KHJ A;  3VDY A;  1Q8K A;  3AQQ A;  4AH6 A;  5CV8 A;  5BN4 A;  1AE3 A;  5KYI A;  1HHV A;  4K5V A;  3ERO A;  4BBS H;  1Q8I A;  1HZB A;  4A3E H;  5C4X G;  1S5F D;  3HGB A;  1RTO A;  4C3I B;  1HNX L;  4IUQ A;  4JI5 Q;  1HTL D;  4UDU C;  3NQT A;  1AW7 A;  1FNU A;  2SNM A;  1STY A;  1CQF A;  3STB D;  4MNO A;  4ID6 A;  3GTO B;  4JBW A;  3DUZ A;  3J81 L;  1JJG A;  3LNN A;  2EYL A;  1RD9 D;  2RSN A;  2B2Y C;  1B9M A;  3WOE A;  3C2P A;  1FJG L;  1A0I A;  3OW7 A;  3GD7 A;  3LGJ A;  3QG1 A;  3FRP B;  3VR2 A;  3QOL A;  2JJQ A;  1HJP A;  3NEL A;  3NUC A;  5IWA Q;  1SNQ A;  5IGC A;  4K0K L;  4B3M L;  3HOY G;  1M8A A;  1B1Z A;  4X64 Q;  3L9A X;  4X66 L;  1XNQ L;  2PZT A;  5JJZ A;  3EFX D;  2Q8I B;  4CDF C;  1SRO A;  2UUA Q;  5EQ0 A;  3S14 B;  2H5X A;  5M5Y B;  1NNX A;  4C3I H;  3W5O A;  4ME5 A;  3M85 A;  3MHB A;  4LFA L;  2PZW A;  1NTG A;  5FO9 B;  5IT9 c;  3OHX C;  3PSI A;  1Y1V B;  2K5N A;  3JAM c;  1KIX A;  4FF1 A;  4OWW B;  2PW5 A;  3RNU A;  3VYT A;  4IFD J;  1VS0 A;  4R4C A;  3VYS A;  1E3P A;  2OT2 A;  5CBE E;  3LWU A;  4GS3 A;  4KD4 A;  1VQG A;  1HFN A;  1E1T A;  4B3R L;  1ET9 A;  4ZCK A;  1CFM A;  3H6M A;  2G5D A;  3U58 A;  2F03 A;  1BUV T;  3PO3 B;  3Q22 A;  2RDG A;  2E2D C;  2BH2 A;  2B2V A;  3EIV A;  5LL6 S;  1VQN A;  1JOO A;  1M90 C;  2KQ3 A;  4K8J A;  3EQL C;  1QZH A;  1GUW A;  1ILP A;  3S14 H;  3Q23 A;  4JI4 L;  5M5Y H;  1ASY A;  2KHS A;  5C44 G;  1KRS A;  3OWE B;  4CJ0 B;  3FHW A;  2K32 A;  4P75 A;  1Y1V H;  1NBW A;  1O7L A;  1UE1 A;  2PNR C;  2XGT A;  4H13 C;  2O5I C;  3J80 c;  3FEW X;  1EY8 A;  1LT4 D;  1Q7Y C;  3S1M B;  2AWN A;  4K5X A;  1XPR A;  4IZ8 A;  2VS1 A;  1QWY A;  4ZKB B;  3PO3 H;  4BY1 G;  3CU7 A;  1ESF A;  2BE5 C;  3LWE A;  1VQ4 A;  5K36 G;  4YHH Q;  1Y1W B;  4WFN 3;  3BDL A;  1VMC A;  3TSS A;  1MKH A;  1BOS A;  4DUZ L;  1A63 A;  2E74 C;  3GQB A;  4GLA C;  1MHW C;  4S3S A;  2JA6 B;  1X32 A;  3E9I A;  3T1Y Q;  1MJC A;  4TSS A;  2NZH A;  2UXD L;  1GJX A;  1Y8O B;  3IFD A;  3CAM A;  1S5C D;  1LT3 D;  3S1M H;  1PYB A;  5J22 A;  4C1N K;  1B4O A;  1EZ6 A;  4EQO A;  1SYE A;  1YHB A;  1V1P B;  4POF A;  2PCF B;  4DR3 Q;  2F0J A;  3JAM i;  1LAC A;  1Y1W H;  4DV7 Q;  2PQA A;  3Q8D A;  4KTA A;  1RKN A;  3Q24 A;  2KHI A;  4IUP A;  4CJ2 C;  3I4N B;  2PNH A;  3KOJ A;  4R8N A;  4DR6 Q;  4GN3 B;  3HRZ C;  5ELN A;  4X3T A;  2L1B A;  2CWA A;  3D31 A;  2JA6 H;  4C3H B;  1HNW Q;  3K6O A;  2MNA A;  2L55 A;  5AJ3 L;  2A19 A;  3L7Z C;  1TS5 A;  5JOB A;  2MQH A;  2EQS A;  4A3J G;  1KC8 C;  2O5J C;  4EQP A;  2DNC A;  4DF7 A;  2NN6 I;  1IW7 D;  5EKK A;  1PRT C;  4F88 A;  3TS2 A;  3IRB A;  4WJW A;  4QIW E;  3TRZ A;  4UPA A;  1XNR L;  1SMY D;  4JOI C;  4ZLT F;  2F0T A;  1GKH A;  1X54 A;  4P72 A;  1RL2 A;  2CHB D;  4O2D A;  4LFB L;  2K7V A;  3I4N H;  3URY A;  1VQI A;  1O80 A;  4RHS A;  1UE6 A;  5M3M B;  5C3W A;  4A3K B;  3GTM B;  3UI2 A;  5IYD G;  4OO1 I;  1F2Y A;  4H02 A;  5CMD A;  5EAY A;  4DK6 C;  1PTO C;  1YNX A;  3D4W A;  1VQ7 A;  1E7Z A;  3U9S A;  4A3C H;  4TKO B;  3BYT B;  1VQD A;  1B3Q A;  1SDF A;  1HA5 A;  1VQJ A;  2E75 C;  5IP9 G;  3CME A;  1S5B D;  1QB5 D;  4QQB X;  1UWV A;  1S40 A;  1U5K A;  2PI2 A;  3QWN A;  3HFZ B;  3KBX A;  1G8Z D;  1SND A;  1KQS A;  4GKK L;  1YEZ A;  2ZJR A;  5NUC A;  1BBW A;  5C4H A;  4R8I A;  4ABN A;  5DM6 3;  2EXD A;  5M3M H;  1HNX Q;  3GTM H;  4A3K H;  1JT8 A;  1SAP A;  2EPB A;  1QVG A;  2Q2I A;  3K0Y A;  5EPJ A;  5G3L F;  3BVG A;  4KKT A;  3AU7 A;  1YNJ C;  3UDG A;  1DGS A;  1S72 A;  4LF7 Q;  3GTL B;  4CGY B;  5LHY 1;  1FJG Q;  5CV9 A;  1X55 A;  1ZEQ X;  4KY7 A;  4QL5 A;  2QKI C;  1E2V A;  2IHE A;  4FO2 A;  1BBX C;  4K0K Q;  4B3M Q;  4KV6 A;  2F0W A;  5G3L D;  1STE A;  4Y7N B;  5COY A;  4X66 Q;  1XNQ Q;  3TP7 A;  2KEN A;  2Z6B A;  3KLW A;  1VQL A;  4KY6 A;  5J3B A;  1VQB A;  3RZO B;  4A3L H;  2M00 A;  4LFA Q;  4CDE C;  4J1M A;  3SVM A;  2AKW B;  3MWY W;  3FPU B;  3HKZ G;  2Y0S G;  3K8A A;  3GTL H;  5FLX L;  3SEB A;  2DNE A;  4HSV A;  5C4J B;  5I4D A;  4WJ4 A;  1AZP A;  4LF6 L;  1I4R A;  4XTC S;  4B3R Q;  4DR2 L;  4K14 A;  3U9O A;  1EUJ A;  3MEH A;  5TSS A;  3M4Y A;  1BCP F;  1FGU A;  1UE7 A;  2XVS A;  1JWU D;  1DJR D;  3DEO A;  2L9H A;  4Y7N H;  1ZYR C;  1FVI A;  1HNZ L;  3UE1 A;  3CKI B;  3G48 A;  4PG3 A;  1X3F A;  4N8X 1;  3H3V C;  3VA7 A;  4JG2 A;  4JI4 Q;  5T1I A;  5K5P A;  3RZO H;  2B2T A;  3NEN A;  3OWF A;  2EXZ A;  2XNA C;  5BR8 L;  1NAP A;  1TS4 A;  2K75 A;  4JI3 L;  4IUV A;  3PIP 3;  1I50 B;  5C4J H;  3E5S A;  4QIW B;  3A8K E;  3H0G B;  1CHP D;  2F0H A;  1EQV A;  1IZ6 A;  1H95 A;  2IW3 A;  2A6E C;  2VB2 X;  2HCI A;  3MXU A;  1V1P A;  3L2P A;  1F77 A;  4KI0 A;  1EYD A;  1XWE A;  5JJI A;  2A68 C;  1EIF A;  3NHH A;  1FNV A;  1YJ9 A;  3GV6 A;  3IFT A;  1STA A;  4DUZ Q;  5FLM H;  2XTI A;  2JA9 A;  1ET6 A;  2HIX A;  4APV A;  2LSS A;  4R4T A;  1I94 L;  1L2F A;  1Q3L A;  3S2D B;  1HXY D;  1I3Q B;  4A3B G;  1GVP A;  4RGT A;  4FF4 A;  3PV0 A;  3V2T A;  4CBV A;  3OPO A;  2JXM B;  5EKI A;  4DV1 L;  1G91 A;  1Y8P B;  2K5Q A;  3AYH B;  3H0G H;  3K7U C;  5C0X I;  1BDO A;  3T16 A;  3HOW B;  1GUO A;  2ALY B;  2IJ0 A;  2F0E A;  1ZKO A;  4I65 A;  4MTN A;  1KRT A;  2F0Q A;  4IUN A;  3DXJ C;  3PUX A;  1EWI A;  4HJ7 A;  1C0A A;  4JCV E;  3CF5 A;  5EGT A;  2C5C A;  2ZM6 L;  5IT9 L;  1LTG D;  1K0S A;  3DWP A;  2JK8 A;  4XQN A;  4CJ1 B;  4FNF A;  4XYQ A;  3BVM A;  3F2C A;  4QJF A;  1MIU A;  1AZQ A;  2C9O A;  4G57 A;  1KNE A;  4XQQ A;  3EJI A;  3S2D H;  4J6H A;  1Q86 C;  1I3Q H;  2WAQ E;  3HOX G;  4R4Q A;  3BVZ A;  5AJ3 Q;  2P5Z X;  3OMG A;  1QVC A;  4KMU C;  1SE2 A;  3HOW H;  1RTN A;  1TWF B;  1SR3 A;  3T51 B;  3TZD A;  3TQY A;  2BE5 D;  4RGM A;  4JV5 L;  3CQZ B;  5I2X A;  3OIQ A;  3X3M A;  1G51 A;  1WTW A;  1YZ6 A;  4HID A;  2RQX A;  1A2U A;  4KHZ A;  3I4M B;  2F0N A;  3DHQ A;  5CGK A;  1HA6 A;  3W3A A;  1C48 A;  4LFB Q;  5KNC A;  2RVL A;  3NK9 A;  3CPW A;  4HTH A;  3GTG B;  5JVH 3;  3J80 L;  1MSH A;  1WCM G;  3SK6 A;  4HIK A;  1EOV A;  3SE0 A;  3M7N A;  4JI6 L;  1JB7 A;  3KFU A;  5J39 A;  1TWF H;  4G7H C;  1V1Q A;  1GO3 E;  1OXX K;  1KLU D;  2Q2H A;  3CQZ H;  3OYY A;  2L5T A;  2K5W A;  3QR8 A;  4H7B A;  1RHP A;  4OGQ C;  1CSQ A;  1Q81 C;  1MBY A;  3G7L A;  4DV2 L;  5IYB G;  1LYL A;  2EYM A;  4A3D G;  3HKS A;  4E6I A;  3I4M H;  4DNI A;  4AQY L;  4GKK Q;  1VQ6 A;  1DOL A;  1LTT D;  1NUC A;  1T5E A;  4GLV B;  4LF9 L;  1P8L A;  2VUM G;  1PH5 A;  5IY0 A;  3GTG H;  1PRT F;  4HAE A;  2BCO A;  5JAV A;  1VQ9 A;  1WTQ A;  2LXK A;  4ZYS A;  1EWC A;  2WB1 E;  1RJT A;  5FO7 B;  1EIH A;  5GAG C;  1PRT D;  1Q46 A;  2N88 A;  2QA4 A;  3E9H A;  4R4I A;  2N3S A;  1RF2 D;  1ENF A;  1JJC B;  4UP9 A;  4GKJ L;  4L5Q A;  4KY5 A;  1E2Z A;  3A5U A;  2VY3 A;  4HIO A;  1PTO F;  3CCE A;  2OQ0 A;  4G4K A;  3KYH C;  1H9K A;  3PO2 B;  2A8V A;  1AP0 A;  5ELO A;  4XQJ A;  1BXT A;  2D0P A;  2SEB D;  1MSG A;  1II3 A;  1SE4 A;  1KAA A;  5C3E G;  5KYL A;  2PPB C;  2QF7 A;  1Z7T A;  1WI5 A;  5EKL A;  1CKO A;  2M2L A;  2R93 B;  5DNF A;  3J7Y W;  1JJ2 A;  1M4V A;  2EY6 A;  3R2I A;  3EA6 A;  4G7O C;  4EX5 A;  4K8I A;  1K8G A;  4DR2 Q;  3Q6S A;  1CHQ D;  1CKM A;  3ULL A;  4JI7 L;  5IGF A;  2R92 G;  4L5R C;  2IPK D;  4I7Z C;  1XPO A;  3S9W A;  2KCT A;  2I5L X;  1HNZ Q;  1WFQ A;  1X9N A;  4BWG B;  3PO2 H;  1YBY A;  1K8O A;  2RKS A;  2WAQ B;  2GVA A;  3I4O A;  3T4A C;  1ONL A;  1PRT B;  1Q1E A;  2A6H C;  3DEP A;  1B53 A;  4DXG A;  1VQO A;  3EVQ A;  1GHK A;  1BCP C;  4F8M A;  5IP7 H;  4NP5 A;  1J6Q A;  3I3C A;  2RA4 A;  3R8B A;  5BR8 Q;  1YNJ D;  4LF7 L;  4JI3 Q;  4AIM A;  2R93 H;  4A3F G;  2SNS A;  3MXN A;  5JEA G;  1HUN A;  1XMQ L;  1KAB A;  1SJH D;  3PMF A;  2F0S A;  4A3I G;  4LFC L;  1WD0 A;  5JJK A;  2ZTD A;  1PTO B;  1AE2 A;  3QIA A;  3HOZ G;  2G9H D;  2WP8 J;  1F9P A;  2B2Y A;  1XPU A;  4JYA L;  3D6W A;  1EY5 A;  4JI8 L;  5F2D A;  3CMA A;  4OON A;  3GTK B;  2WAC A;  3SK8 A;  4OEM B;  5C0X G;  2KED A;  2DJG C;  2IX0 A;  4BXX H;  1CKN B; 
#chains in the Genus database with same CATH homology
 1YHQ A;  1I94 Q;  2NN6 I;  1OXU A;  3CCS A;  4JI5 L;  3TS2 A;  4A75 A;  4IPC A;  3IRB A;  2D62 A;  3W1G A;  4YY3 L;  2OTL A;  4X6A H;  2K14 A;  3PF5 A;  2ID0 A;  4QIW E;  3TRZ A;  1Z47 A;  4UPA A;  1IL2 A;  3EN2 A;  4GLX A;  3FKI G;  1Q82 C;  1LTL A;  4DV4 Q;  1SLJ A;  1J5E Q;  2Z0S A;  4YCU A;  1KL9 A;  5FJ8 G;  4DV1 Q;  1XNR L;  4QGU A;  4WJ3 M;  2RF4 A;  3U4V A;  4JOI C;  4R1J A;  5E7N A;  4LUO A;  1XMO L;  1GKH A;  1X54 A;  4P72 A;  1YI2 A;  1SRU A;  1RL2 A;  4J15 A;  5IYB H;  3JC6 6;  4O2D A;  4LFB L;  3I4N H;  1VQI A;  1HZA A;  4A3D H;  5IWA L;  1UE6 A;  1VQA A;  1Y14 B;  4A3L G;  4YWK A;  1K73 C;  1S3O A;  5IYD G;  3CP0 A;  2NVQ H;  4OO1 I;  4LF8 Q;  3F1Z A;  4H02 A;  1I5F A;  3RN5 A;  4UP7 A;  5FLM G;  1A8V A;  3FP9 A;  5EAY A;  4DK6 C;  1CSP A;  4X64 L;  2ZM6 Q;  1YNX A;  1PV4 A;  1GM5 A;  5LMU L;  3ER0 A;  1VQ7 A;  1E7Z A;  4A3C H;  2I5M X;  5HY6 A;  3UDI A;  4LUZ A;  3GTK H;  4JI2 L;  2B63 G;  4DPG A;  4KHP Q;  1VQD A;  2UUA L;  2UXB L;  2CCZ A;  1G6P A;  4R4O A;  4DR5 Q;  3GTQ H;  1VQJ A;  2K50 A;  3KF8 B;  4DV0 Q;  5DLQ E;  5IP9 G;  5IYC H;  3PIO A;  3CME A;  4NB3 A;  2NVT H;  4QQB X;  1UWV A;  2JQO A;  1U5K A;  1S40 A;  4MZ9 A;  2PI2 A;  3H0G G;  3OTO Q;  4DUY L;  3HFZ B;  4LF4 L;  2R7Z H;  4DV3 Q;  4X62 L;  1KQS A;  3CCJ A;  4GKK L;  2KCM A;  3I55 A;  2F52 A;  2QEX A;  2K5V A;  2RCN A;  1NE3 A;  1YEZ A;  5C44 H;  4A3G G;  2ZJR A;  2VQE Q;  3A0J A;  3AFQ A;  5FLX c;  1XJV A;  3S15 H;  1BBW A;  1YHA A;  3ERS X;  2UXD Q;  2JA7 G;  2OQK A;  3K0X A;  2K52 A;  2R7F A;  2JE6 I;  3M4Q A;  1L1O B;  2VZA A;  3MXN B;  3OW2 A;  1I50 H;  2HQL A;  2EXD A;  4B3S L;  3SGI A;  5M3M H;  1HNX Q;  4A3K H;  2PQA B;  2AMC B;  1L0W A;  3GTM H;  4JC0 A;  1JT8 A;  1VQ5 A;  4X65 L;  1QVG A;  2Q2I A;  3I7F A;  1CUK A;  4HJ5 A;  1Z9F A;  5M3F G;  1VQP A;  1PH3 A;  5GRO A;  3PGZ A;  3UDG A;  1DGS A;  1C9O A;  1S72 A;  4LF7 Q;  2E5L Q;  1I6H H;  5C3E H;  4NXM L;  1A62 A;  3A74 A;  4PZ6 A;  5GAH C;  1IBK Q;  4BY1 H;  3HKZ E;  2E2I H;  1FJG Q;  2Y0S E;  1UEB A;  4B3T Q;  1X55 A;  3HOU G;  4P73 A;  2C35 B;  4QL5 A;  3EBE A;  2IHE A;  4DKA C;  1WOC A;  3T1H Q;  4B3M Q;  4K0K Q;  4BBS G;  1TWA H;  1OTC A;  3HOW G;  1V9P A;  4GN4 B;  4QY7 A;  3DLL A;  2AHO B;  4A3E G;  4HIM A;  1YJN A;  1K9M C;  2VNU D;  4JI1 Q;  3M4P A;  2CWP A;  2NN6 G;  4JI6 Q;  1OXV A;  4X66 Q;  1XNQ Q;  4IJH A;  4IOA A;  2KEN A;  3KLW A;  1VQL A;  1JMC A;  5J3B A;  2R92 H;  1IBL L;  1IYJ B;  1VQB A;  1Q1B A;  3CCQ A;  4IFD I;  4A3L H;  4JI0 L;  4LFA Q;  4IO9 A;  3UE0 A;  3A5Z B;  2JA5 H;  1PHJ A;  4UP8 A;  3CCV A;  4PZ7 A;  4DR1 L;  1K83 H;  1L1O C;  4LF5 L;  3KDF A;  2B3G A;  1C7Y A;  4DR7 Q;  2IX1 A;  2BA1 A;  4DV2 Q;  4BY7 G;  4A93 G;  1EFW A;  2UXC L;  2AKW B;  1E22 A;  2YV5 A;  3CCR A;  4YHH L;  1D8L A;  4AQY Q;  1EQQ A;  3HKZ G;  4YWL A;  2Y0S G;  3K8A A;  1X3E A;  3GTL H;  4LF9 Q;  5JJK A;  4OO1 G;  4WJ4 A;  4LF6 L;  1VQE A;  3VDY A;  4XTC S;  2PI2 E;  4B3R Q;  4DR2 L;  2I0Q A;  2CFM A;  1EUJ A;  4A3F H;  1XNR Q;  1AH9 A;  2PMZ E;  2JA8 G;  1B7Y B;  3ULJ A;  2E2H H;  3PUV A;  4YCV A;  1N33 L;  3S24 A;  2K4K A;  1UE7 A;  1FGU A;  4PZ8 A;  5M5X H;  3ULP A;  4A3M G;  3F2D A;  4ALP A;  1EQR A;  1TXY A;  4Y7N H;  3T1Y L;  4A3I H;  5GQO A;  3KJP A;  3H3V H;  1FVI A;  3RR5 A;  1HNZ L;  1PH7 A;  3UE1 A;  5HGQ A;  3G48 A;  4PG3 A;  3RLF A;  4LUV A;  1X3F A;  2E8G A;  2VQF L;  3GDE A;  1QUQ A;  4JG2 A;  1PH4 A;  1M1K C;  1MJE A;  3BZK A;  4JI4 Q;  4GNX A;  4IPH A;  1HR0 Q;  3I4M G;  3HOZ H;  3RZO H;  1QVF A;  2JEB I;  4GKJ Q;  1K8A C;  3NEN A;  4A76 A;  1N32 Q;  4GN5 A;  2UXB Q;  4NXN Q;  3CC4 A;  1T9H A;  1PVO A;  5BR8 L;  1B8A A;  2F4V L;  1P16 A;  1BVS A;  2K75 A;  2RHQ B;  2DUD A;  4JI3 L;  1B70 B;  2V1C C;  5GAD C;  4DR3 L;  4BBR H;  4A3J H;  2UUB L;  2NVY H;  4RMF A;  2Z6K C;  4DUY Q;  2UU9 L;  4DV7 L;  4LF4 Q;  1N34 L;  5C4J H;  3L0O A;  2Q2U A;  1VQK A;  3GTO H;  1WJJ A;  1EYG A;  2IHF A;  1IZ6 A;  1H95 A;  1X56 A;  1KHI A;  2JEA I;  5LMN L;  3FKI H;  4OX9 L;  4DR6 L;  4C3J H;  1TWG H;  2QGQ A;  4HJ9 A;  5FJ8 H;  3I2Z A;  3M9B A;  3L2P A;  1PH9 A;  4C2M H;  3J81 j;  4B3S Q;  3GO5 A;  3NBH B;  2FXQ A;  4JOI A;  2OWO A;  1HNW L;  2N8N A;  4KI0 A;  3TS0 A;  5JJI A;  1N36 Q;  1EIF A;  1VCI A;  2OCE A;  4IPG A;  5JJL A;  1YJ9 A;  4LNQ A;  3CD6 A;  1HZC A;  4RG1 A;  1NJI C;  2NVX H;  3CCL A;  1Y1V G;  2MFI A;  4FDB A;  5IYD H;  3H3V I;  4DUZ Q;  2YU9 H;  5FLM H;  2XTI A;  2JA9 A;  2HIX A;  4GOP B;  3HOV G;  4APV A;  4JI7 Q;  2LSS A;  4R4T A;  2IY5 B;  5GAE C;  1I94 L;  2DGY A;  3D0F A;  5LMN W;  1L2F A;  3NEM A;  2CKZ B;  3F8T A;  4BA2 I;  1V43 A;  2B63 H;  1HZ9 A;  3CC2 A;  4A3B G;  3F2B A;  1PYS B;  1GVP A;  2EIF A;  3PIP A;  3G4S A;  1G29 1;  4P71 A;  3PV0 A;  5IP9 H;  3G6E A;  2N78 A;  1YJW A;  3PO3 G;  4DV4 L;  1OXS C;  4DV1 L;  3J81 c;  3S17 H;  3BU2 A;  3BZC A;  3AYH B;  2HHH Q;  4UY8 C;  3H0G H;  3K7U C;  5C0X I;  2ALY B;  1CKN A;  2BA0 A;  5IE8 A;  1IBM Q;  4OXP A;  1YIJ A;  1PH6 A;  3BJU A;  1EIY B;  1CKN B;  3GTJ H;  4MTN A;  4LWC A;  3KF6 B;  1KRT A;  3WWV A;  4A3G H;  3PUX A;  3RLO A;  1EWI A;  4HJ7 A;  4LF8 L;  4JBJ A;  4JCV E;  4JI0 Q;  2JA7 H;  3M4O H;  4AYB E;  2ZM6 L;  3CF5 A;  1C0A A;  1Q12 A;  3U50 C;  3K80 C;  2UUC L;  1VQH A;  2JK8 A;  2UXC Q;  1X3G A;  1XMQ Q;  4KHP L;  1YIT A;  2ZTC A;  3F2C A;  4QJF A;  1MIU A;  5M3F H;  4PMW A;  4OWX B;  4DV0 L;  4LFC Q;  3PO2 G;  1NMF A;  1PA6 A;  1VQF A;  4LF6 Q;  4DR4 Q;  1QUQ B;  1RIP A;  4ME3 A;  3S2D H;  2IT1 A;  4DV5 Q;  4GNX B;  1I3Q H;  4GOP C;  1Q86 C;  2KHJ A;  2WFW A;  1Q8K A;  4DV3 L;  2WAQ E;  4XIG S;  4R4Q A;  3AQQ A;  3HOX G;  5IP7 G;  5AJ3 Q;  3G71 A;  4AH6 A;  4JYA Q;  3CXC A;  3HOU H;  1ASZ A;  1AE3 A;  4JI8 Q;  1SMX A;  1QVC A;  4P74 A;  1TWH H;  2VQE L;  4BBS H;  3HOW H;  1HZB A;  1SR3 A;  2R93 G;  2ES2 A;  1KAW A;  4A3E H;  4TQU S;  3S1R H;  3ICE A;  5C4X G;  3I56 A;  3TQY A;  1Y1W G;  1PFS A;  4JV5 L;  1HNX L;  3PUZ A;  4DAM A;  4JI5 Q;  4AYB G;  4YY3 Q;  2N49 A;  1G51 A;  2R6G A;  1U0L A;  3PUW A;  3STB D;  1YZ6 A;  4HID A;  4MNO A;  4KHZ A;  4JBW A;  2HT1 A;  1JJG A;  3PUY A;  1KD1 C;  2E5L L;  1IBK L;  1FJG L;  1XMO Q;  1A0I A;  1L1O A;  3GD7 A;  2L15 A;  3LGJ A;  5H1S E;  2UU9 Q;  4B3T L;  4A93 H;  4BY7 H;  4LFB Q;  4YWM A;  2JJQ A;  1HJP A;  3NEL A;  2GN5 A;  5IWA Q;  1NMG A;  3CPW A;  2E2J H;  2K5H A;  2WAQ G;  4K0K L;  2R7D A;  4DV6 L;  1WCM G;  4HIK A;  3T1H L;  4B3M L;  3HOY G;  1EOV A;  4BXX G;  2F3I A;  2VW9 A;  4X64 Q;  1SFO H;  4JI1 L;  3M7N A;  5LMU Q;  2YTV A;  1E24 A;  4JI6 L;  2YYZ A;  4X66 L;  1XNQ L;  2VL6 A;  4GNX C;  2JA8 H;  2B29 A;  1JB7 A;  3KFU A;  4JI2 Q;  4Y52 H;  1SRO A;  1TWF H;  2UUA Q;  4OWT B;  1LUZ A;  4A3M H;  2H5X A;  1V1Q A;  1GO3 E;  1OXX K;  1R9T H;  1JE5 A;  1XTD A;  1OXT A;  4C3I H;  2Q2H A;  3CQZ H;  3W5O A;  3M85 A;  3OYY A;  4LFA L;  3KJO A;  1NTG A;  2D0O A;  3K7A H;  3TEH B;  5IT9 c;  2NZO A;  3PSI A;  3GTP H;  4DR7 L;  1CSQ A;  4X62 Q;  1Q81 C;  4DV2 L;  4DK3 C;  5IYB G;  2K5N A;  4DAY B;  3JAM c;  1KIX A;  1LYL A;  3I4N G;  4A3D G;  3HKS A;  4OWW B;  3I4M H;  4DNI A;  4AQY L;  4GKK Q;  3U4Z A;  1VQ6 A;  4GLV B;  3RNU A;  4LF9 L;  4IFD J;  2AWO A;  3M3Y H;  1VS0 A;  4R4C A;  1E3P A;  1P8L A;  3CW2 C;  3J81 i;  3CC7 A;  2KBN A;  2GVB A;  4GS3 A;  2VUM G;  3PCO B;  3UDF A;  4IOC A;  1PH5 A;  1VQG A;  1E1T A;  4B3R L;  5IY0 A;  1VQ8 A;  3GTG H;  3ZJY C;  4A3C G;  3U58 A;  4X65 Q;  2Z6K A;  1VQ9 A;  3E0E A;  3J80 i;  2LXK A;  2BH2 A;  3EIV A;  2MO1 A;  5IYC G;  2WB1 E;  1VQN A;  1VQM A;  1IXR A;  1M90 C;  2ATW A;  1QZH A;  4NXM Q;  4C3H H;  5GAG C;  1GD7 A;  2R7Z G;  4L5S A;  3S14 H;  1Q46 A;  4JI4 L;  5M5Y H;  2Q2T A;  1HH2 P;  2QA4 A;  3E9H A;  1HR0 L;  2YTY A;  2UUC Q;  1E1O A;  2MO0 A;  4R4I A;  1O7I A;  4IFD G;  2N3S A;  1ASY A;  4A4I A;  5M5W H;  5C44 G;  1JJC B;  3DM3 A;  4UP9 A;  4GKJ L;  1KRS A;  4L5Q A;  1N32 L;  4NXN L;  3A5U A;  2VY3 A;  1J5E L;  3FHW A;  3KDF B;  4HIO A;  3W1B A;  4P75 A;  3S1N H;  1Y1V H;  1VQC A;  3CCE A;  2OQ0 A;  1UE5 A;  3KYH C;  3J7Z C;  3CCU A;  5M3M G;  1NBW A;  4A3K G;  3HOV H;  4L5T A;  4HJA A;  2A8V A;  4NPS A;  5ELO A;  1UE1 A;  1LM0 A;  2XGT A;  2D0P A;  3CCM A;  1IBL Q;  3J80 c;  4A3B H;  1Q7Y C;  3S16 H;  2AWN A;  1HR0 W;  1XPR A;  3H15 A;  5C3E G;  2VS1 A;  3PO3 H;  4DR1 Q;  2OTJ A;  2WB1 G;  4LF5 Q;  4BY1 G;  4EQ5 A;  1WI5 A;  1VQ4 A;  1CKO A;  5K36 G;  4YHH Q;  4IPD A;  1JJ2 A;  3RZD H;  4DR5 L;  1N36 L;  3STB C;  1N8R C;  1KXL A;  1BKB A;  4EX5 A;  1MKH A;  4JV5 Q;  3AEV A;  1WYD A;  3OTO L;  1K8G A;  1K3R A;  4DUZ L;  4DR2 Q;  1A63 A;  4GLA C;  1CKM A;  3ULL A;  4JI7 L;  1N33 Q;  2UXD L;  2R92 G;  4L5R C;  3S2H H;  4BA1 I;  1SN8 A;  1W2B A;  3E9I A;  5JEA J;  1PH2 A;  1XPO A;  3T1Y Q;  1MJC A;  4JBM A;  3RN2 A;  2KCT A;  2I5L X;  2NZH A;  2ZJQ A;  2LXJ A;  1HNZ Q;  1WFQ A;  3MEF A;  3UDX A;  2I5H A;  4DV6 Q;  1X9N A;  1X65 A;  4LW1 A;  2JA5 G;  3PO2 H;  1YBY A;  1K0R A;  2VQF Q;  1D7Q A;  2GVA A;  1NY4 A;  3I4O A;  4TVA B;  2HHH L;  2VUM H;  3CAM A;  1Q1E A;  1X6O A;  1IBM L;  1VQO A;  3HOX H;  4GOP A;  4HJ8 A;  5IP7 H;  3S1M H;  1PYB A;  1J6Q A;  2YTX A;  5BR8 Q;  2JA6 G;  2F4V Q;  4LF7 L;  1YHB A;  2CQO A;  4POF A;  1QZG A;  4DR3 Q;  4JI3 Q;  4AIM A;  2R93 H;  2UUB Q;  5C0X J;  5C4X H;  4A3F G;  3JAM i;  1Y1W H;  2ZTE A;  4DV7 Q;  3S1Q H;  1N34 Q;  1SE8 A;  5JEA G;  2PQA A;  1XMQ L;  1PH1 A;  3Q8D A;  4IJL A;  4A3I G;  5LMN Q;  2KHI A;  3J7A 5;  4LFC L;  3CPF A;  4YCW A;  3RLN A;  2PNH A;  3KOJ A;  4OX9 Q;  4DR6 Q;  2ZTD A;  3KF6 A;  4GN3 B;  3PF4 A;  5ELN A;  4DR4 L;  1AE2 A;  1W3S A;  1BBU A;  2CWA A;  3D31 A;  2JA6 H;  4DV5 L;  2ZJP A;  4POG A;  3HOZ G;  2WP8 J;  4KLK A;  3TRE A;  1XPU A;  1N9W A;  1FL0 A;  2MNA A;  4JYA L;  5AJ3 L;  1HNW Q;  2A1A A;  4O0A A;  2A19 A;  3L7Z C;  2HIV A;  4JI8 L;  3CMA A;  3B6Y A;  4OON A;  4JBK A;  2MQH A;  1WCM H;  1PH8 A;  3AFP A;  5C0X G;  3K81 C;  2EQS A;  3HOY H;  1YVC A;  4A3J G;  4BBR G;  1TWC H;  2IX0 A;  1KC8 C;  2RHS B;  4BXX H;  2BH8 A;  2ASB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...