1S3OA

Human mitochondrial single strand dna binding protein (hmssb)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
116
structure length
107
Chain Sequence
LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence-structure mapping errors in the PDB: OB-fold domains
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein, mitochondrial
total genus 15
structure length 107
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1s3oA00
4LFAQ 1S3OA 2HIVA 3PGZA 1KXLA 1IBKQ 2ZTCA 4R4QA 3UDFA 1OTCA 1QVCA 2QA4A 1W2BA 1SFOH 2JA5H 3HKZG 4B3SQ 3RLFA 1K0RA 4OWTB 4XTCS 1T9HA 2MO1A 1Y1WH 4NPSA 1YJWA 5C3EH 4A3FG 1IBLQ 1PH2A 4DR6L 2UU9Q 2K5NA 3TREA 1EWIA 3CCUA 4R4TA 3TRZA 3ICEA 5C0XJ 4L5RC 1U0LA 4RG1A 1VQFA 4HJAA 1LTLA 4JG2A 4JYAQ 3NEMA 4JV5Q 2CWPA 3I4OA 1N34Q 4DR3Q 2PQAA 1V1QA 1E22A 2OTJA 1M90C 3PF4A 4DV0Q 2B3GA 4BA2I 4JI0Q 2PI2A 4X66L 3NBHB 3PUZA 4DV0L 1AE3A 2OQKA 3UE1A 4AQYQ 2KHIA 1MKHA 4YHHL 1LM0A 1K8GA 4OO1I 4DR1L 2K14A 3PF5A 5C4JH 1C9OA 2ZM6L 4DV7Q 4A3MH 5M3MG 2K52A 4LF7Q 1G6PA 2UXCL 4YCWA 1PH8A 5EAYA 1ASZA 3PUYA 2MQHA 2A19A 1K9MC 3B6YA 3M3YH 3CCLA 1YVCA 1QUQA 3RLOA 2E2HH 3CQZH 4JI6L 2RHQB 5ELOA 1XNRQ 3J7A5 4LWCA 3I7FA 4MTNA 2RHSB 4JI1Q 2R7DA 4LF5Q 4BY1G 3PO2G 1WOCA 1TXYA 3PUWA 2R93H 2VY3A 3S1RH 1N33L 2HHHQ 3HOVH 5HGQA 2CQOA 3HOXH 1R9TH 3KFUA 1FJGQ 4LF6Q 4A3EG 4UP8A 1X54A 3KDFA 4AIMA 3L2PA 1I94L 4PG3A 1IBML 2ATWA 3K8AA 4X62L 4B3MQ 2VZAA 4HIKA 3PO3H 3CAMA 1N36L 2HT1A 1BVSA 4BY1H 1XMQL 2E8GA 4A3LG 5J3BA 4P72A 1PH6A 2HHHL 4JYAL 4A3BH 1GD7A 3UDIA 1EIYB 4LW1A 4HJ5A 2B63H 3HOVG 3HOXG 2KHJA 4AH6A 3RN5A 1IBLL 2ZJQA 4GOPA 3PV0A 1BBUA 2E5LQ 1DGSA 1VQ7A 4LF9Q 2AKWB 4A3IG 2LXJA 1YBYA 1CKMA 2YTXA 5JJIA 4B3TL 3SGIA 3TQYA 2IX0A 4IJLA 3U50C 4BBRH 5M5XH 3OTOQ 1Q46A 4DR4Q 4A3LH 1VCIA 2KBNA 3AQQA 3GTPH 1SMXA 1B8AA 1NJIC 3KYHC 1KD1C 4OX9Q 1VQLA 1UE1A 1E7ZA 4OWWB 3I55A 1NMGA 1IBKL 1HR0L 3RNUA 1YHBA 2YTVA 5IE8A 1Q8KA 4K0KQ 2C35B 4JI3Q 4GN5A 1A62A 1VQCA 4GN3B 5BR8Q 3CPFA 4L5SA 3ER0A 2JA8H 4DV3L 3M4OH 1QVFA 1Q12A 2IY5B 1KRTA 3AEVA 3HOZH 1HNXQ 3KF6B 5AJ3L 3M9BA 2NVQH 1S40A 4DV4L 2GVAA 4JBWA 4KLKA 3CCQA 2Y0SE 4UP9A 4DV1L 2NVTH 1JB7A 4JI3L 3AFQA 3E9HA 3K0XA 5FJ8H 2D62A 3LGJA 4A3JH 3CD6A 4IFDG 2ZTDA 3CP0A 5JJLA 4JOIC 4R1JA 4JI8Q 1I5FA 2GVBA 1QVGA 4QY7A 5K36G 2UXBL 3ULJA 3PIPA 1CKOA 3H0GH 1PVOA 3BJUA 3I4MG 1SROA 3F8TA 1OXSC 1X3EA 2AWOA 2I5HA 1EQRA 2YTYA 3A74A 2KCMA 3M4QA 1L1OB 4NXNL 3J81c 3F2DA 1YI2A 4LF9L 3I2ZA 4A3MG 1YZ6A 4RMFA 4A3JG 4PZ6A 3BZCA 1PHJA 1VQ5A 1YHQA 5GROA 3GO5A 1FGUA 2UXBQ 3DLLA 4WJ3M 1E24A 1X65A 4DV6L 3U58A 4DR2L 4A93H 2LSSA 1HZ9A 4L5QA 4HIOA 1GVPA 2UUAQ 5IWAQ 5LMNW 4HIDA 2MNAA 4DV2Q 1L1OA 1VS0A 2IT1A 4DV3Q 5M3FG 4HIMA 4X65Q 1OXVA 1VQPA 2Q2TA 1B7YB 3U4VA 4HJ7A 1VQ4A 1GO3E 1RIPA 2JA9A 4JOIA 4X62Q 5LMUQ 4A3DG 2WFWA 2R93G 1JMCA 4GKJQ 4A3CH 3GTKH 1SR3A 4IOCA 1PV4A 2L15A 4JI2L 4LNQA 4BXXH 5E7NA 4MZ9A 2K4KA 4IPDA 1HNZL 1PH4A 2YYZA 5GAHC 3S24A 4Y7NH 3VDYA 2CCZA 1PYBA 4C2MH 2JEBI 5M5WH 3CCRA 5M3FH 3ULPA 3PO3G 3RZOH 2GN5A 1W3SA 5GAEC 2VQEQ 3JAMi 5ELNA 3CMEA 2Q2IA 4BY7G 3KF8B 3OTOL 2ZJRA 1Q86C 1VQNA 2B63G 2F4VQ 3GD7A 3KOJA 4GLAC 3G71A 4J15A 4JI8L 1HJPA 1WCMG 4JC0A 4LFAL 1YHAA 5DLQE 1GKHA 1FVIA 1UE5A 2F3IA 1I50H 1YNXA 3HFZB 3PUXA 3S1NH 3OW2A 4TQUS 3BU2A 4JI7Q 3S14H 4A3GG 1QUQB 3CPWA 1EQQA 4DAMA 2N49A 3TEHB 1EOVA 1SRUA 4DV2L 2YV5A 4GKJL 2ES2A 1N33Q 3S2DH 2CFMA 3A5ZB 1E3PA 1HR0Q 4KHZA 3KJPA 4JI4Q 2IX1A 1IL2A 2R92H 2PI2E 4HJ9A 3W1BA 3HOZG 4GNXB 2N8NA 5FLMG 4DV6Q 3I4NH 4DR4L 2EIFA 3J80c 3STBD 2PMZE 4P71A 3CMAA 4EX5A 3M85A 4DR7Q 2VUMG 1HZAA 1X6OA 3FHWA 1YITA 2JA6H 4DPGA 1J6QA 1N32L 4DR7L 1PYSB 3J80i 1TWCH 2PQAB 4AYBG 3ULLA 1K73C 2QGQA 1M1KC 2R6GA 1L1OC 2WP8J 2Z6KA 2D0OA 1VQDA 4OXPA 2E2IH 3GTGH 2UXCQ 2MFIA 1J5EQ 4KHPQ 1NTGA 3H0GG 3I4MH 4JI2Q 4DV7L 3RR5A 3HOYG 1YEZA 1A63A 5C4XG 1Q1EA 4A76A 1RL2A 2VQFL 4A3BG 5AJ3Q 4B3ML 4O2DA 1PH7A 2BH2A 1XMQQ 2JK8A 5LMNL 1XTDA 4UPAA 1O7IA 1X3FA 3NELA 4C3JH 3A5UA 3KJOA 1XPRA 4JI5Q 2VNUD 4A3IH 2VQFQ 3F2BA 4DR2Q 1KHIA 5C0XG 4LF6L 3STBC 4QGUA 1KL9A 2HQLA 4C3IH 5C4XH 5JEAG 4DV5L 4DNIA 2OQ0A 1XNQL 3FP9A 2KCTA 1WFQA 4GKKQ 4NXNQ 2EXDA 2AWNA 3GTOH 3JC66 2K5HA 4GLXA 1Y1VH 5IP7H 2UUBQ 5HY6A 3T1YL 4GNXC 2N3SA 4GKKL 4GNXA 2UUCL 1HR0W 3K7UC 1LUZA 1G291 4LFCQ 2DGYA 1L0WA 1TWHH 4JI5L 5H1SE 1FL0A 1TWGH 1XPOA 2ZM6Q 4X66Q 4JI4L 2JEAI 1IZ6A 2D0PA 2NZOA 1QZGA 3W5OA 1HNWL 1QZHA 3Q8DA 4PMWA 1WYDA 1OXUA 1VQMA 1A8VA 3EBEA 1Y1VG 5IP7G 1Y1WG 5LMNQ 4DK3C 2XGTA 4L5TA 4QIWE 1XJVA 2WAQE 1N34L 1FJGL 2Q2HA 2I5LX 2Y0SG 3TS0A 3ERSX 3PCOB 1VQ9A 2K75A 1PH9A 1Q81C 1N8RC 3UDXA 3M4PA 4EQ5A 1EIFA 4B3RL 1HNWQ 2UUCQ 1E1TA 1BBWA 2BA0A 1XMOQ 2WAQG 2JQOA 2Z6KC 3CCVA 5IP9G 4NB3A 4LF8Q 3H3VI 2CKZB 3GTJH 3GTQH 4HJ8A 1ASYA 1VQAA 3HKZE 2OTLA 4DK6C 2AMCB 4B3TQ 2R7FA 2VL6A 4IPCA 4DR5L 2RF4A 1N32Q 1JT8A 4R4OA 1AE2A 2JJQA 1SLJA 4DAYB 2F52A 3T1HL 3WWVA 3CC7A 1D8LA 3E0EA 1PA6A 3CC2A 4LF8L 2A8VA 4QL5A 4A75A 3I4NG 1K3RA 1PFSA 1WJJA 4LUOA 1VQ6A 4B3RQ 3PUVA 2B29A 3K80C 4LUVA 4BA1I 3CXCA 4JBKA 4YHHQ 5IYDH 2BH8A 2CWAA 1P8LA 4H02A 4LUZA 4UP7A 1K83H 3EN2A 1VQJA 4IFDJ 3PSIA 4QQBX 1V9PA 4LFBL 1OXXK 1X56A 2KENA 3RZDH 2ALYB 4IPHA 5IY0A 4JI7L 3AYHB 1P16A 5GAGC 1SE8A 2DUDA 1YJNA 3MXNB 1VQKA 1C7YA 3CCJA 3L0OA 3HOYH 3PO2H 4IJHA 2ASBA 3RLNA 2QEXA 5GQOA 5IWAL 4BY7H 1CKNA 1IYJB 5M5YH 5C0XI 4LF4L 3S1MH 4WJ4A 1Q7YC 1JJGA 2R7ZG 3CCSA 4Y52H 4A3EH 4DR6Q 1D7QA 4R4IA 3T1YQ 4KHPL 1LYLA 1UWVA 1Q82C 4IO9A 4GS3A 1NE3A 3UE0A 1G51A 1I3QH 4P73A 3G6EA 1K8AC 2XTIA 4PZ8A 2VS1A 4JBMA 2F4VL 1MIUA 5IYBG 4A3DH 1XNQQ 5C44H 3F1ZA 1HNZQ 1Q1BA 4YCUA 2I5MX 4B3SL 4A3GH 1NMFA 4A3CG 2Q2UA 3W1GA 1BKBA 3HOUG 2A1AA 2R7ZH 1PH1A 3D31A 4KI0A 3GTLH 4BXXG 4FDBA 3HOWH 3CCEA 2NN6I 4X64Q 4AQYL 4DUYQ 1UE6A 2E2JH 4APVA 4DUZQ 3S16H 4QJFA 4A3KG 2I0QA 4JI0L 3GDEA 1N36Q 2FXQA 4BBRG 2IHEA 4R4CA 2RCNA 4BBSH 1TWFH 1IBMQ 4OONA 5FLXc 4LFBQ 2MO0A 4OO1G 5BR8L 2N78A 3HOUH 2JA5G 2Z0SA 3G48A 5IYDG 3I56A 2NZHA 3F2CA 4JV5L 4DUYL 4OWXB 1H95A 1JJCB 4PZ7A 4IOAA 1PH3A 2UUAL 5JJKA 5C3EG 1IXRA 1B70B 3CW2C 4A3FH 5IT9c 4GLVB 2K50A 3S15H 2VW9A 1HNXL 3K81C 2UU9L 2ZJPA 4NXML 1OXTA 2UUBL 1X3GA 1XNRL 4BBSG 1I6HH 2BA1A 3L7ZC 2V1CC 3PIOA 4X6AH 5JEAJ 3RN2A 5IYCH 1L2FA 3D0FA 1TWAH 3J81j 3H3VH 2LXKA 5IP9H 1NY4A 3J7ZC 2JE6I 2EQSA 2VQEL 3CCMA 1YJ9A 1S72A 4YY3L 2E5LL 3M7NA 1HH2P 2ID0A 1XMOL 1UEBA 4POFA 4DV1Q 3JAMc 4DR1Q 3DM3A 1X9NA 2R92G 4ME3A 2YU9H 1HZBA 1Z9FA 1Z47A 1WI5A 3OYYA 5FLMH 4P74A 4C3HH 2OWOA 1CSQA 1A0IA 1UE7A 5M3MH 4X65L 4DV4Q 5GADC 5IYCG 1YIJA 2VUMH 1E1OA 1JE5A 2PNHA 2JA6G 4YCVA 1VQOA 2IHFA 2H5XA 3EIVA 3FKIH 1I94Q 1V43A 3MEFA 2K5VA 1XPUA 4O0AA 3UDGA 2WB1G 3CF5A 4JCVE 4DUZL 4OX9L 4DKAC 1VQGA 1VQ8A 4K0KL 1EUJA 4LFCL 4X64L 2AHOB 3J81i 3T1HQ 4UY8C 1CSPA 2JA8G 4XIGS 2NVXH 1KRSA 1SN8A 1HZCA 2WB1E 4LF5L 3H15A 3GTMH 1VQBA 1N9WA 1VQIA 5FJ8G 3S1QH 4JBJA 4JI6Q 3FKIG 4YWLA 3AFPA 4DR5Q 4NXMQ 3G4SA 3K7AH 1C0AA 3KF6A 3IRBA 1NBWA 4DV5Q 4LF4Q 4LF7L 3TS2A 3BZKA 2HIXA 1PH5A 1MJEA 3S17H 1U5KA 1VQHA 2JA7G 4AYBE 1Y14B 3S2HH 5IYBH 3KLWA 3CC4A 4P75A 1KC8C 5C44G 1AH9A 5LMUL 4GOPC 3ZJYC 2UXDQ 4GOPB 1VQEA 2OCEA 4TVAB 4IPGA 1MJCA 1EFWA 1KAWA 3KDFB 1KQSA 2UXDL 3U4ZA 4ALPA 4POGA 2NN6G 4A93G 3NENA 1WCMH 4YWMA 1KIXA 1CUKA 4YY3Q 4GN4B 1GM5A 1EYGA 3HOWG 4DR3L 4IFDI 4YWKA 2ZTEA 2NVYH 4A3KH 2JA7H 4MNOA 4A4IA 3A0JA 4JI1L 3E9IA 1X55A 1JJ2A 3HKSA 1J5EL 1CKNB
chains in the Genus database with same CATH superfamily
4LFAQ 3PGZA 1KXLA 1IBKQ 4R4QA 2Q8TA 5JVG3 1SNOA 1EFID 3S1QB 2JA8B 2EYJA 1LT6D 4OWTB 1BUVT 5J22A 5IOCA 5C3EH 1IBLQ 1QNKA 2MPMA 4DR6L 2K5NA 3CCUA 3TRZA 4NKLA 3A8KE 4RG1A 2H1EA 1VQFA 4HJAA 1LTLA 1YNJC 3NXWA 4JV5Q 3I4OA 3J7AV 4BA2I 4JI0Q 2PI2A 3C1FA 1SEBD 1MKHA 1Y8PB 2ZXPA 4DR1L 1C9OA 3VYSA 1STNA 2K52A 4LF7Q 5M3FB 1G6PA 4CJ0B 2MQHA 4N8X1 3B6YA 3M3YH 4XQNA 4JI6L 4RCOA 2RHQB 1XNRQ 3J7A5 3R2IA 2RCFA 3SK6A 4LF5Q 1SNDA 1Y8NB 1TXYA 2K01A 2B8GA 1DM0B 2CH4W 1N33L 1R9TH 5D3DA 1EU4A 1FJGQ 3HS0C 1XXGA 1X54A 2Z4HA 5EQ0A 3K8AA 4X62L 1SJED 1XYIA 3CAMA 1EY7A 3VYUA 2BE5D 2HHHL 1PH6A 1V1PB 4A3BH 3ONAB 1EIYB 2B2TA 2B63H 4J6HA 5K5PA 4ZKBB 2R93B 4KHVA 1TWAB 2FJ2A 3PV0A 1EZ8A 2J0TD 2DY7A 1TT2A 1YBYA 2K5QA 2LXJA 3OTOQ 4IJLA 4BBRH 1Q46A 1TS5A 2Z9HA 1PRTF 3GTKB 4L63B 1KD1C 2KQ3A 1PZJD 1E7ZA 1UE1A 4DU9A 4OWWB 1NMGA 1YHBA 4PQXA 4CDCC 3QG1A 3S17B 1RJTA 4R8IA 1LT5D 5BR8Q 3PO2B 1EIHA 2F03A 3ER0A 3M4OH 4FXDA 1Q12A 1EEID 1KRTA 2HD3A 3NK9A 4RFBA 3HOZH 3M9BA 1S40A 4KLKA 3AFQA 3K0XA 2K32A 4IFDG 3CP0A 5JJLA 5KGUA 1ILPA 1U4PA 1QVGA 3PIPA 1CKOA 2PO4A 3E5SA 3TP6A 4BWGB 1PVOA 5LHY1 4PV1C 2F0DA 3A74A 3QO2A 4LF9L 2ZXOA 1TIID 4PZ6A 3HZXA 3S14B 3DLLA 1AZQA 1RODA 3C46A 1RF2D 1JWSD 1Y8OB 3GTLB 3R8BA 4DV2Q 1I4XA 1MI2A 1VS0A 4V190 1VQPA 1B7YB 1VQ4A 4JOIA 3SVMA 2NBFA 1KNEA 4A3DG 1SJHD 1JMCA 5C6AA 2KECA 2CW0C 5FO7B 1W6JA 2GA4B 3PIO3 3S2HB 1PV4A 1QNUA 1PLFA 2DJFC 3DXJC 1STAA 4MZ9A 2L0CA 1AZPA 2NTSA 1AW7A 1PH4A 2YYZA 3S24A 1F2MA 3CCRA 4FYDA 1IKLA 1STYA 1W3SA 5GAEC 2E2IB 3H94A 1EY6A 1QJOA 2JA6B 3KOJA 1NNXA 1RHPA 3AU7A 1WCMG 4DNTB 2F3IA 1PRTD 5IGDA 5E4XA 3BVGA 3S1NH 4TQUS 3BU2A 3S14H 3J81L 3DWPA 3W2DA 1EOVA 1SRUA 4GKJL 2ES2A 2WAQB 1EY0A 4XYOA 4G7HC 2EDGA 3MXUA 1HR0Q 3EJIA 1NCVA 4UHVA 1MGSA 4OL7A 2R92H 1JOKA 3QOLA 1U9RA 2N8NA 4EQPA 2EIFA 3J80c 3STBD 4A3JB 4ZUJA 3M85A 4RGTA 4DR7Q 2E75C 3A7LA 1X6OA 5DM63 5D65A 3MC0B 4DPGA 1N32L 4DR7L 1PYSB 3MA2B 3ULLA 1M1KC 4I65A 1EWHA 2WP8J 5L37A 2E2IH 3MEHA 1G2TA 2JXMB 3HOVB 1B2TA 3RR5A 1A63A 5IGFA 1RL2A 5AJ3Q 3M4YA 2IL8A 4O2DA 2BH2A 4V0BA 5E1FA 2OXPA 1XTDA 5E3FA 2ENBA 4A3IH 2VQFQ 4DR2Q 1KHIA 5C0XG 1F2ZA 4QGUA 1LO5D 2QF7A 1JQYD 1BCPB 4DNIA 2OQ0A 3VR6A 2ZT9C 2KCTA 1WFQA 1DZ1A 1TR5A 3NSWA 4R9WA 1E0BA 3GTOH 2K5HA 1TQOA 1TS4A 1DD2A 4J8QA 3TP5A 1CHQD 2N3SA 4GKKL 4GNXA 4LMQD 2A6EC 4LFCQ 1L0WA 1TWHH 1XPOA 2F0VA 2JEAI 2E76C 1QZGA 1FNUA 1OXUA 1Y1WG 5LMNQ 4L5TA 2WAQE 1X3QA 2Q2HA 1FJGL 2M2LA 1A3TA 3TS0A 1F9RA 4DN4M 2L11A 2OEOA 4F7XA 1E1TA 4DA2A 2WAQG 1BCPF 3H3VI 3H3VC 2CKZB 3VA5A 3IKJA 4HJ8A 1XWEA 5C3XA 4CGYB 4B3TQ 3OW7A 5T1GA 4KN4C 5HURA 4R4OA 1AE2A 3T1HL 3WWVA 3CC7A 1D8LA 1MBYA 4QL5A 4B3RQ 4RHSA 4JBKA 3VR5A 4A3EB 2CWAA 2QCPX 1GUOA 1YNND 3EN2A 5K36H 1VDZA 4QQBX 4BY7B 4OEMB 4JI7L 3AYHB 5G3LD 1PYWD 1SE8A 1C7YA 1STEA 3HOYH 4IJHA 2QEXA 5IWAL 1CKNA 3S1MH 1Q7YC 1JJGA 3JAML 4R4IA 3LX0A 1B3AA 1UWVA 1Z7TA 1Q82C 1GUWA 4IO9A 3N52A 5C4HA 3NWSA 2VS1A 2F4VL 4YIJA 2K33A 5C44H 3ZYYX 1HNZQ 4YCUA 2I5MX 1NMFA 2ICIA 2Q2UA 1BKBA 2A1AA 2LS01 5C4XB 5ELEA 5COYA 3HOWH 4DFAA 2NN6I 3I70A 4AQYL 4G7OC 4DUZQ 2P5ZX 3J80L 4A3KG 3N6RA 3K0YA 1N36Q 4XYQA 1PZKD 1TWFH 1IBMQ 4OONA 4RH6A 1SNQA 4OO1G 1H95A 4OWXB 4ILWA 1B4OA 1WTHA 2A68D 2CQAA 4A3FH 3CW2C 1Y69U 3T53B 2EYFA 2WIIB 2K50A 2VW9A 1J9OA 2RSOA 3K81C 1A3VA 3RUZA 3OWFA 5CV4A 3BDOA 1IL8A 1X3GA 5CV5A 3Q22A 4BBSG 1GUGA 2V1CC 4I7AA 4H13C 5CC4A 3RN2A 1PTOH 1TWAH 2LXKA 1ZYRC 1NY4A 2E5LL 3MFYA 1S72A 1VF5C 1HH2P 1H9KA 5ELBA 1XMOL 4POFA 2IPKD 3TN2A 3OOCA 2R92G 2KVMA 1WI5A 5FLMH 4RGOS 4C3HH 1KLGD 2OWOA 1CSQA 4IUQA 5GADC 1YIJA 1A2TA 5JEAH 1E1OA 4YCVA 2IHFA 1V43A 2EYOA 3CF5A 4OX9L 1EUJA 3HKZB 3J81i 3RMHA 2PYKA 5KRUA 3DM1A 5A2QE 3A8IE 5FKAC 2DN8A 1VQBA 1N9WA 1Q90A 4JBJA 4JI6Q 3FKIG 3AFPA 1D1KA 4UAIA 2DNCA 3G4SA 3IRBA 2RKSA 1NBWA 3LWUA 4M1UB 1D2BA 4G7ZC 4QUFA 5J39A 4P2CB 1JC7A 2F0WA 1G6ZA 2J4XA 1BXTA 1Y14B 3OHXC 1ZEQX 1KC8C 2XWBB 4TSSA 5LMUL 1AH9A 4TVAB 5KNDA 2NYZD 3W3AA 4HR7B 1KQSA 2F1MA 5CV8A 4POGA 4KK7A 2EXZA 1TWGB 4XDXA 1KIXA 5D14A 4GN4B 1GM5A 4DR3L 1JR0D 2ZTEA 1JJ2A 4L8JA 1SFOH 4ME5A 3HKSA 1K3BC 1S5BD 4O1NA 3S9WA 4K0KL 2PPBC 3ND9A 4IALA 2JA5H 4B3SQ 3RLFA 1K0RA 2MO1A 1YJWA 2K6AA 1EWIA 2EE1A 4L5RC 1U0LA 4IQZA 1HTLD 1C8CA 1EU3A 4F8MA 1CZWA 2CWPA 3NQIA 5BN5A 1N34Q 3VYRA 3FKIB 4DR3Q 1MD2D 2PQAA 1EIGA 1V1QA 2OTJA 1M90C 3PF4A 4PMCA 3T56B 2MP1A 1QOHA 4JVZA 1K8MA 3NBHB 1AE3A 2OQKA 3UE1A 2F0JA 4OO1I 2NZ1D 4DV7Q 1PTOC 4A93B 1PH8A 1S5CD 3PUYA 2IJ0A 1A6XA 1K9MC 1F2YA 3CCLA 2TSSA 1HFNA 1LTBD 1WOCA 3NBIA 1GJXA 3HOVH 1NR2A 4BS9A 3KFUA 4A3EG 4UP8A 3QR8A 3URYA 3G7LA 3L2PA 1I94L 3M4OB 2VZAA 4HIKA 2HT1A 4BY1H 1XMQL 2X6LA 3QIAA 4A3LG 3BVZA 1CA5A 1GD7A 4DK1A 3DUZA 3HOXG 2KHJA 3RN5A 4X3SA 1IBLL 2ZJQA 5C5MA 3V96A 2E5LQ 1BBUA 1S5FD 1JOOA 1DGSA 4N9TA 4NP5A 4NDXA 1CKMA 2L12A 2YTXA 3NTIA 4B3TL 3SGIA 3TQYA 2IX0A 2E2HB 4TRDA 1M4VA 4A3LH 4DK0A 2Q8IB 3AQQA 4OIJA 3GTPH 2BOSA 1SMXA 1NJIC 1VQLA 1T5XD 1IBKL 3RNUA 4RCNA 3NE5B 3K57A 4JI3Q 4GN5A 4GN3B 3L3OC 4L5SA 2JA8H 1QVFA 4C3IB 2K5DA 1B44D 3KF6B 5AJ3L 4R8NA 3WOFA 2D62A 4XQJA 4JOIC 4R1JA 5CGKA 2G9DA 2UXBL 3ULJA 1I4RA 2F0HA 3BJUA 4QUCA 1TU2B 3M4QA 2AWOA 5IGGA 1HNXQ 1L1OB 3F2DA 2Y0SB 1UNSA 4CKBA 2AUJD 4A3JG 1VQ5A 3BZCA 5GROA 3GO5A 1EYAA 3Q0AA 1X65A 1B9MA 2LSSA 1PTOB 4ZQ3A 1GVPA 2O2LD 1J8IA 5IWAQ 5LMNW 3HOYB 1GHJA 1H9SB 2N55A 2PZWA 2MNAA 4F87A 4HSVA 4HJ7A 1RIPA 2JA9A 4KKSA 1GOZA 1GUSA 1SYCA 4A3GB 1WD1A 3R3OA 5C3WA 4JI2L 4LNQA 5E7NA 2VUMB 2K4KA 1HNZL 2L4NA 2A6HC 2F0QA 1PYBA 4C2MH 1ENCA 3ULPA 3PO3G 3RZOH 1CFMA 1HA5A 3K58A 3CU7A 3JAMi 5CV9A 4G57A 2Q2IA 5ELFA 1EZ6A 2HQEA 1Q86C 4LJZC 2B63G 1HFGA 4J15A 4JI8L 2NN6H 3UI2A 1HJPA 3QJYA 4JC0A 5DLQE 3TP7A 2E74C 3HFZB 2B2WC 3PUXA 4ZK9B 3FVQA 3GV6A 3A54A 1CQFA 3EVQA 4RHRA 2XNAC 2O4XA 1UAPA 2PMZB 2RDFA 4H7BA 5I4DA 3J7AF 2EOTA 5M3MB 2YV5A 5T1IA 2A69D 3S2DH 3A5ZB 3KJPA 2IX1A 4ZCKA 2HCIA 1IL2A 2A69C 4X3TA 4GNXB 1D6EC 3A7AB 3WDNA 4P71A 2LMCB 3TMEA 1HZAA 2F0EA 3M7GA 1TY0A 2QGQA 2AQ1B 2F0KA 2UXCQ 1J5EQ 4KHPQ 1NTGA 3H0GG 4IUVA 5NUCA 4DV7L 3HOYG 5D3IB 5C4XG 1U4LA 5G3LF 3IAYA 4CHTB 2H4OA 2QILA 3TBIB 1B50A 4HCSA 3HOZB 3A5UA 1X3FA 4QB4A 4JI5Q 3F2BA 4MTKA 4DAPA 1LTTD 1KL9A 5C4XH 4C3IH 5LL6X 1JCKB 4C1NK 1XNQL 4NXNQ 1I4QA 1PTOF 3BZDB 2Z4IA 1EWCA 2RBMA 3JC66 4M8AA 4TKOB 3SEBA 1Y1VH 5HY6A 5CBEE 2EY5A 3FPUB 1GUTA 3HP3A 4A3FB 2DGYA 1PRTB 4JI5L 1TWGH 2NTTA 1M8AA 4X66Q 2ZM6Q 3W5OA 1RTNA 1QZHA 2MHVA 1CK1A 3Q8DA 1PXUA 3J7YW 2WV6D 3SK4A 1H9SA 2V4DA 1SBBB 2XRSD 4DK3C 5HGTA 3S1NB 1WTVA 3C2PA 3S16B 1GXDC 3PCOB 1VQ9A 1PH9A 1N8RC 3M4PA 3HEJA 4EQ5A 5DAUA 4B3RL 2UUCQ 1HNWQ 1SMYC 1I6HB 1BBWA 1EYDA 4LF8Q 3VYTA 5IP9G 1UEAB 1ZXTA 1ASYA 1VQAA 5JOBA 3NBHA 4DK6C 2AMCB 2RF4A 1ML0D 4FF2A 1BNZA 2JJQA 2BDOA 2F52A 4DAYB 4Y7NB 2NWGA 4RGNA 1D5XC 1K3RA 3FEWX 1Q3LA 1WJJA 1FYCA 3K80C 4LUVA 1LTSD 3EROA 4H02A 1X32A 1K83H 1AN8A 4LFBL 1OXXK 2KENA 2ALYB 1X3PA 5IY0A 1LT4D 1YJNA 3CCJA 1CHPD 3K59A 4KMUC 2NVYB 5C0XI 1IYJB 1EYCA 4DF7A 3T51B 3D8GA 2R7ZG 1HA6A 3LNNA 4DR6Q 4NMZA 2QKIC 2JN4A 2RVLA 1R4PB 3GP7A 2XTIA 1MIUA 2HDMA 3D3RA 5EKKA 4MIUA 5IYBG 2IX3A 1XNQQ 4KKTA 3F1ZA 4B3SL 4A3CG 2X69A 4B9XA 2G5DA 3OMGA 3HOUG 4K6DA 3TP8A 1YNNC 4KI0A 4N8FA 4BXXG 4Z9CB 3KK7A 4FDBA 3CCEA 2O5JC 5DM73 4C56C 1LT3D 4QCLA 4QJFA 3GDEA 2FXQA 2IHEA 1D5MC 4DXGA 1JICA 1HTPA 5FLXc 1FD7D 1XX8A 3BDCA 2N78A 5BR8L 2JA5G 3G48A 3I56A 4JV5L 2NZHA 4XXEA 4DUYL 1CQVA 1PH3A 1DONA 2OF1A 4GLVB 2N88A 3S15H 1SYGA 2C9OA 4FVMA 1IYUA 1A2UA 4XT1B 1HNXL 3SXHA 3P7JA 1OXTA 2BA1A 4X6AH 3D6WA 2YU9B 5IYCH 3D0FA 2Z6BA 4J1MA 2JE6I 2EQSA 1YJ9A 4KY5A 2ID0A 3P75A 1X9NA 2AQ2B 3U9OA 4ME3A 3TDQA 2YU9H 2RSNA 1Z47A 3I3CA 4IUNA 4K14A 5KNCA 5M3MH 5IYCG 1S5ED 4JK1C 3I72A 3EIVA 2H5XA 4WORA 4U673 1I94Q 3MEFA 2K5VA 1XPUA 4WRDA 5CMDA 4DKAC 1VQ8A 4HN7A 2I46A 5KYLA 3MTSA 4UY8C 1HZCA 2WACA 2A6ED 5CR3A 3CRKC 2JA5B 1HXYD 1O7ZA 2DNEA 3EQLC 4NXMQ 4XT3B 1CM9A 3KF6A 5IODA 4DV5Q 4LF4Q 1EQTA 2XRQD 4S3SA 3BZKA 2HIXA 4KTAA 2LFNA 2A73B 4K2LA 2JA7G 4AYBE 3R2TA 1LTID 3CC4A 5C44G 2KEEA 3ZJYC 3KLRA 1VQEA 2OCEA 1EFWA 3KDFB 1F2LA 1OO9B 2EYMA 4ALPA 3GQBA 1WCMH 4YWMA 1CUKA 1EYGA 5CV7A 5F2DA 4IFDI 4YWKA 3CHBD 2JA7H 4MNOA 4A4IA 2F0GA 1YI2A 1X55A 2L1BA 1CKNB 1S3OA 2HIVA 3X3NA 1OTCA 2ZTCA 2EY6A 2Z1CA 1QVCA 4A3BB 3EA6A 1BCPC 3HKZG 3QB3A 4XTCS 1T9HA 2WKDA 4B08A 4A3FG 1JORA 3BG3A 4R4TA 2OT2A 1EY4A 3O13A 4Q5VA 1HRJA 3SE0A 3S2DB 1BO0A 4KV6A 2AQ3B 2KHSA 4DV0Q 2B3GA 1I4HA 1G8ZD 5FLXE 4X66L 4DV0L 2J7ZA 3PUZA 3VR4A 1AFPA 4C3HB 1LM0A 1K8GA 1CZGA 4PNYA 2K14A 3FDTA 5FO8B 3FPPA 2B2TC 3RZOB 4ZLTF 2UXCL 1ASZA 3KBGA 2KJXA 2HUGA 2A19A 1TKWB 1YVCA 2E2HH 3CQZH 3I4LA 3OPOA 3H91A 5IGBA 1KNAA 4MTNA 1WCMB 1RKNA 3PUWA 5JPMC 2R93H 4B9WA 2VY3A 3S1RH 2HHHQ 4KJNA 5HGQA 2CQOA 1VMPA 1IBML 1KDCA 2ATWA 2XWJB 4B3MQ 1TWFB 3PO3H 1Y1VB 2E2DC 1Q8IA 1ENAA 1GUNA 5J3BA 4P72A 3T4AC 2EYHA 3UDIA 4LW1A 4AH6A 3Q6SA 1B53A 3KLSA 3QWNA 4C3JG 3V05A 1FNVA 4LF9Q 2AKWB 4A3IG 1QCBD 5JJIA 4E6IA 1IW7D 4HMIA 3CRLC 1VCIA 5EPKA 3KYHC 4K2KA 1Z6HA 3CQZB 5IE8A 2C35B 1A62A 1VQCA 4KKUA 3CPFA 3KUPA 1LTGD 4DV3L 4G4KA 3BS1A 1JWMD 4DV4L 2GVAA 3CCQA 2Y0SE 4UP9A 4DV1L 1JB7A 4JI3L 2B8FA 3CD6A 2ZTDA 1AP0A 2FFKB 4JI8Q 1I5FA 2GVBA 4IUPA 5K36G 4QY7A 1SE3A 1WTXA 3H0GH 3T16A 2I5HA 3MXPA 2UU9Q 2SNMA 2KCMA 3J81c 4NXNL 1EQVA 4A3MG 1YZ6A 4RMFA 1PHJA 1YHQA 5M5YB 1FGUA 1WTOA 4WJ3M 1E24A 4DV6L 3U58A 4A93H 3SHLA 4HIOA 2WKCA 2UUAQ 4HIDA 3NQTA 4HIMA 4K5XA 1OXVA 3H0GB 1O80A 3RZDB 2BE5C 3U4VA 2WFWA 2EYLA 2JYOA 3GTKH 4IOCA 2L15A 1B9NA 2CCZA 3GTJB 2JEBI 1I6VC 1ZKOA 2GN5A 1O7YA 3VR2A 1U4RA 1JOQA 3CMEA 4BY7G 4RKLA 5DNFA 3KF8B 2ZJRA 1VQNA 1KLUD 2FINB 4FP5D 1YHAA 1GKHA 1FVIA 1WTWA 4FF1A 1I50H 4MHEA 1QILA 1NUCA 1O78A 3OW2A 1HCZA 4A3IB 4KD3A 1EY5A 4A3GG 1EQQA 4DAMA 2N49A 3TEHB 4DV2L 1N33Q 5CV6A 1E3PA 4K8JA 1PRTC 1BCPD 4JI4Q 3KLSX 1LTRD 1I50B 2PI2E 3W1BA 5FK9C 2EY1A 2B2UA 1YNJD 3K7AB 4ZKCB 5FLMG 4DR4L 3CMAA 5CBAE 2VUMG 1SNCA 3IFDA 3GTMB 3U9SA 3J80i 4AYBG 3SR1A 1K73C 4DAVA 1L1OC 4OXPA 2FHTA 1STGA 4ZAIA 3X3MA 4JW0A 4JI2Q 3I4MH 4UDUC 1YEZA 1Q1EA 5I6YA 4A3BG 1W6KA 1XMQQ 2D9UA 2JK8A 3OMCA 3OIQA 1O7IA 4C3JH 3KJOA 5EGTA 2X6GA 5BN4A 4LF6L 4C3HG 4FF3A 1TS2A 3QOJA 1F9QA 4H0LC 5JEAG 4DV5L 1V1PA 3K5LA 4OELB 2EXDA 2AWNA 3G6JB 1S4ZA 1WD0A 2HCCA 5IP7H 3T1YL 3NWTA 4GNXC 4EGVA 2A68C 4CDEC 5I9OA 2UUCL 3K7UC 4OHJA 1LUZA 5ISRA 2A6HD 5H1SE 1FL0A 5IYDH 1DOLA 3JAME 1IZ6A 2D0PA 1DOMA 1E2VA 1DYQA 1WYDA 2FMCA 2R3ZA 1ZYRD 2NUCA 1KDBA 1VQMA 1A8VA 3EBEA 1RCVD 5IP7G 2XGTA 4QIWE 1N34L 2E2JB 2I5LX 2Y0SG 4OIKA 1L0XB 2K75A 3UDXA 2EJGC 5JPNC 1XMOQ 2JQOA 3CCVA 4NB3A 5M9OA 2CH4A 4A3DB 3GTQH 3K5OA 3HKZE 2OTLA 1RDPD 4WJWA 2R7FA 2PZTA 4IPCA 2PQEA 1JT8A 1SLJA 2ZXRA 1BBXC 4MN3A 4A75A 4IZ8A 3I4NG 2B29A 3CXCA 4IFDH 5TSSA 4LUZA 1H9RA 4HCEA 4IFDJ 1V9PA 1X56A 3PQIA 4RKBA 3HRZC 1TWCB 1P16A 1SNMA 2I07B 5GAGC 3MXNB 3L0OA 1SMYD 3PO2H 1KABA 3D4WA 2ASBA 1ESFA 1UUPA 4BY7H 3S1RB 2G9HD 4Y52H 2SEBD 4A3EH 3VR3A 3VA7A 4CKEA 3E6ZX 2XVSA 1LYLA 4GS3A 3G6EA 1G51A 1I3QH 4P73A 2D2CC 4PZ8A 4JBMA 5I2YA 1T5EA 4A3DH 1Q1BA 4A3GH 1S5DD 3W1GA 4KY7A 1MSGA 3GTGB 1PH1A 5I9PA 1TS3A 3D31A 3GTLH 3A56A 3C3LA 1K83B 4RA8A 2NVQB 1UE6A 2LY7A 1C4QA 4APVA 2E2JH 2B2VC 4JI0L 1FR3A 5IGEA 4R4CA 4A3KB 3MXGA 1FGBD 4BBSH 1G91A 2MO0A 3J81E 1R9TB 2Z0SA 1NR4A 3K6OA 5EPJA 1JJCB 4PZ7A 1G2SA 5C3EG 1B70B 1KAAA 4HSPA 1DXMA 3DEPA 1SDFA 2UU9L 2UUBL 1XNRL 1I6HH 3L7ZC 1DCZA 3PIOA 1LACA 2B2WA 3J81j 3H3VH 1R4QB 5IP9H 3I4NB 4ZUIA 2TMPA 4YY3L 4DV1Q 3JAMc 1TVXA 4DR1Q 1RTOA 5C4ZA 1HZBA 1MHWC 1Z9FA 4P74A 2K28A 1PZID 2VUMH 5J1ZA 1JE5A 2ICEC 2PNHA 1U4MA 3FKIH 1TWHB 2M00A 2DJGC 4O0AA 2QEJC 4FXGC 5KYIA 1VQGA 4LFCL 4RAUC 3DWAA 2AHOB 1WTRA 3T1HQ 2EVBA 1CSPA 2JA8G 5EKIA 1Y1WB 4ZRZA 2A74C 3MWYW 4FNFA 5JJZA 3TZDA 3R93A 3H15A 3GTMH 5C4JB 5FJ8G 3S1QH 4YWLA 4HTHA 2MGSA 2F0UA 3DHQA 3K7AH 5ELDA 3HOWB 2EJFC 3FMCA 3E3XA 2CHBD 4LF7L 4K6LA 3TS2A 5C0XH 4IUUA 1PH5A 3S17H 1B1ZA 1VQHA 3S2HH 5IYBH 2F0FA 4P75A 1PFNA 1E2ZA 4EQNA 4GOPB 4IPGA 1MJCA 4DGZA 3U4ZA 2KUMA 4BBRB 2NN6G 1HQMC 3NENA 4YY3Q 1PDQA 3I8ZA 2L9HA 2NVYH 1PFBA 3A0JA 1HUMA 3K5NA 3UDFA 3TZUA 2QA4A 1W2BA 2XIWA 5IGCA 5EBDA 1Y1WH 4NPSA 2F0MA 1PH2A 3TREA 3ICEA 3NTKA 5C0XJ 2QDBA 4JG2A 4JYAQ 3NEMA 1QE6A 1SE2A 3BYTB 3H6MA 1E22A 2K7VA 3DMUA 5A35A 4ID6A 1HUNA 5LL6S 3MAQA 4AQYQ 2KHIA 4YHHL 3D4DA 2K5WA 3PF5A 5C4JH 2ZM6L 1BF4A 1H9JA 4A3MH 5M3MG 1FNWA 4YCWA 5EAYA 1A3UA 3V2TA 1QUQA 3RLOA 5ELOA 4KJOA 4LWCA 3I7FA 1LABA 1JWUD 2A5HA 2RHSB 4JI1Q 2R7DA 4BY1G 5KIXA 5KNBA 1ET9A 1ESRA 3PO2G 3I4MB 4X3UA 2FMMA 5FO9B 3HOXH 4LF6Q 3MXNA 3KDFA 2NVTB 4AIMA 1LLRD 4DAYA 4PG3A 4QF4A 2BDNA 5CORA 1AEXA 4ULLA 1SAPA 1N36L 1BVSA 2PW5A 2E8GA 3LWEA 4X3KA 5E4WC 4JYAL 2Z8LA 3HOVG 4HJ5A 1BR9A 3Q24A 2F0NA 4GOPA 3TSSA 2EY2A 1LTAD 1VQ7A 2RDGA 1HHVA 4QMGA 5EPLA 3U50C 5M5XH 4DR4Q 4U68A 1STBA 1PFMA 2KBNA 3S15B 1B8AA 1BQQT 2F4IA 4OX9Q 4OGQC 2WINB 2PNRC 3I55A 1HR0L 2YTVA 1Q8KA 4K0KQ 4HAEA 3MZ5A 2O5IC 2IY5B 3AEVA 4DNRB 2NVXB 1TY2A 2NVQH 2MUYA 4JBWA 3BYYB 1IW7C 2L55A 2NVTH 3E9HA 5FJ8H 3LGJA 4A3JH 2F0TA 4ODGA 2L5TA 1HQRD 3KBXA 3HG9A 2PCFB 1F9PA 1HPCA 1ICFB 3Q23A 3I4MG 4AYBB 1SROA 3F8TA 1OXSC 1X3EA 2YTYA 1EQRA 3OSOA 1K0SA 1SNPA 3I2ZA 4BY1B 3M3YB 4O42A 1VF7A 2UXBQ 4K8IA 3PIP3 2NB0A 5A2QL 4DR2L 4L5QA 1HZ9A 1I4PA 2M9VA 1SYFA 1L1OA 2IT1A 4DV3Q 1JE4A 5M3FG 4X65Q 3IFTA 2VB3X 2Q2TA 2B39A 1GO3E 2DY8A 5LMUQ 4X62Q 1BDOA 2R93G 4C2MB 4GKJQ 4A3CH 5AFWA 1SR3A 4IUTA 2B2UC 4BXXH 3AMUA 4IPDA 2C5CA 1V1OA 4IURA 2PZUA 4ABNA 4NW2A 5GAHC 4Y7NH 3VDYA 3GTQB 5M5WH 5M3FH 3C1EA 4Q0FA 1WTQA 2VQEQ 1ENFA 5ELNA 5C5LA 2B63B 4EQOA 3OTOL 1SYDA 3AB9A 2F4VQ 2R61A 3GD7A 4GLAC 3G71A 3K5MA 1ONLA 5CYUA 4LFAL 1UE5A 1ICWA 4CJ1B 3NP8A 1YNXA 2JA7B 2SDFA 2B2YA 4DXFA 1WTPA 1LV9A 2K1BA 4PMBA 3CKIB 3DEOA 4JI7Q 1QUQB 3CPWA 4IN3A 4H44C 2JP1A 2CFMA 4KHZA 3GV3A 3DWQA 4CJ2C 4HJ9A 3HOZG 4DV6Q 3I4NH 1MSHA 2PMZE 3D6CA 2F0IA 4EX5A 3SDZA 4LK1C 3FHWA 1IHZA 1YITA 2JA6H 1J6QA 5EBCA 1TWCH 2PQAB 1KDAA 4CDDC 5I6WA 2R6GA 2Z6KA 2D0OA 1VQDA 3GTGH 2MFIA 2CW0D 5IT9L 2QDLA 1QWYA 4A76A 1VMCA 3MHBA 2VQFL 2PW7A 4I7ZC 1XTCD 4B3ML 1B3QA 1PH7A 3WOEA 1C48A 3S1MB 5LMNL 4UPAA 1KTKA 3NELA 1XPRA 2VNUD 2JSOA 3EFXD 2LKVA 3SK5A 3A55A 3STBC 4EVOA 4ZYSA 2KOLA 3BVMA 2HQLA 3A8JE 5C3EB 3FP9A 4GKKQ 2QW7A 1STHA 5EKLA 1NSNS 2IWHA 4CBVA 4FO2A 4GLXA 4C1NI 3L9AX 2UUBQ 1ILQA 2F3VA 1EOTA 1WVLA 3J80E 4C3IG 1HR0W 2K04A 3OWEB 1G291 2SNSA 4OO1H 2RDHA 4JI4L 1GHKA 2NZOA 1HNWL 4PMWA 1K28A 1JB3A 5I2XA 2F0OA 1Y1VG 3I90A 2CVRA 1XJVA 1L0YB 4N9PA 3ERSX 2F0LA 1Q81C 3RD4A 1EIFA 1DJRD 1II3A 2BA0A 4WFN3 2Z6KC 1SFOB 1A15A 1E2WA 3GTJH 1I4GA 1EY8A 2VL6A 1I3QB 4DR5L 1N32Q 2EYPA 3SK8A 5ELCA 1CT1D 5FLXL 5M5WB 1PA6A 3E0EA 3CC2A 4LF8L 2A8VA 2Q8RE 1O7LA 1PFSA 3ERQA 4LUOA 1VQ6A 3PUVA 4A3MB 2EJMA 2VXWA 4BA1I 4YHHQ 1QG7A 2BH8A 1P8LA 3NPPA 4UP7A 1IYVA 4KN7C 5JVH3 2BCOA 1VQJA 3PSIA 1CA6A 3RZDH 1CTMA 2B2VA 4IPHA 3F2UA 3FRPB 1EY9A 2DUDA 1VQKA 3PO3B 3P20A 2KCCA 4K5VA 3RLNA 5GQOA 2SOBA 4LF4L 5M5YH 4WJ4A 3PMFA 3CCSA 1CI3M 1D7QA 3T1YQ 2EZVA 4KHPL 4HEDA 1NE3A 3UE0A 1K8AC 4HMJA 5FOBB 1PTOD 1K8OA 3H09A 3HOUB 2MJ8A 2RQXA 3HGBA 1EEFD 2R7ZH 3T13A 1H9MA 2WB1B 4X64Q 2XN9C 2F3WA 4DUYQ 3S16H 2I0QA 2B2YC 4BBRG 1SE4A 2R7ZB 2D5DA 2RCNA 5EJWA 4RGMA 4FF4A 3MVVA 4LFBQ 3HOXB 3HOUH 5IYDG 3F2CA 1BOSA 2KA7A 1NAPA 2UUAL 4IOAA 2VB2X 5JJKA 1IXRA 2K03A 5IT9c 4JPBW 3GTPB 1F77A 2ZJPA 4NXML 4GZYC 4F88A 5BN3A 5JEAJ 5IIFA 5KEEA 1L2FA 3J7ZC 1SYEA 3I91A 4K5WA 2VQEL 2KCNA 2KEDA 4RWSC 4XQQA 3CCMA 3M7NA 1PMRA 1UEBA 4CKCA 4LAAA 1SYBA 2R92B 3DM3A 4FXKC 1SXTA 3OYYA 2K05A 3E0JA 2XSCA 3I73A 1A0IA 1UE7A 1F9SA 4CDFC 4X65L 4DV4Q 4C3JB 2JA6G 4L6TB 1SSOA 1VQOA 1EL0A 2IW3A 3OIPA 3UDGA 2WB1G 4JCVE 4DUZL 2AUKA 3P1HA 2F0SA 4X64L 2RA4A 4XIGS 2NVXH 1KRSA 1SN8A 2WB1E 4LF5L 3NHHA 2EPBA 5IT9E 1VQIA 3GTOB 1IKMA 5JAVA 4DR5Q 1D1IA 2F0PA 2HDLA 3ND8A 4KD4A 5DEHA 1C0AA 1DOKA 1QB5D 1MJEA 1U5KA 5C44B 3KF8A 3KLWA 1ET6A 1D5ZC 3NUCA 4GOPC 2UXDQ 1KAWA 3ITPA 4KY6A 2UXDL 5M5XB 4A93G 1RD9D 4QIWB 1V8QA 3HOWG 3IL8A 3NTHA 3MFGA 3D4RA 3BDLA 4A3KH 4BBSB 4JI1L 3E9IA 1J5EL
chains in the Genus database with same CATH topology
4LFAQ 1S3OA 2HIVA 3PGZA 1KXLA 1IBKQ 2ZTCA 4R4QA 3UDFA 1OTCA 1QVCA 2QA4A 1W2BA 1SFOH 2JA5H 3HKZG 4B3SQ 3RLFA 1K0RA 4OWTB 4XTCS 1T9HA 2MO1A 1Y1WH 4NPSA 1YJWA 5C3EH 4A3FG 1IBLQ 1PH2A 4DR6L 2UU9Q 2K5NA 3TREA 1EWIA 3CCUA 4R4TA 3TRZA 3ICEA 5C0XJ 4L5RC 1U0LA 4RG1A 1VQFA 4HJAA 1LTLA 4JG2A 4JYAQ 3NEMA 4JV5Q 2CWPA 3I4OA 1N34Q 4DR3Q 2PQAA 1V1QA 1E22A 2OTJA 1M90C 3PF4A 4DV0Q 2B3GA 4BA2I 4JI0Q 2PI2A 4X66L 3NBHB 3PUZA 4DV0L 1AE3A 2OQKA 3UE1A 4AQYQ 2KHIA 1MKHA 4YHHL 1LM0A 1K8GA 4OO1I 4DR1L 2K14A 3PF5A 5C4JH 1C9OA 2ZM6L 4DV7Q 4A3MH 5M3MG 2K52A 4LF7Q 1G6PA 2UXCL 4YCWA 1PH8A 5EAYA 1ASZA 3PUYA 2MQHA 2A19A 1K9MC 3B6YA 3M3YH 3CCLA 1YVCA 1QUQA 3RLOA 2E2HH 3CQZH 4JI6L 2RHQB 5ELOA 1XNRQ 3J7A5 4LWCA 3I7FA 4MTNA 2RHSB 4JI1Q 2R7DA 4LF5Q 4BY1G 3PO2G 1WOCA 1TXYA 3PUWA 2R93H 2VY3A 3S1RH 1N33L 2HHHQ 3HOVH 5HGQA 2CQOA 3HOXH 1R9TH 3KFUA 1FJGQ 4LF6Q 4A3EG 4UP8A 1X54A 3KDFA 4AIMA 3L2PA 1I94L 4PG3A 1IBML 2ATWA 3K8AA 4X62L 4B3MQ 2VZAA 4HIKA 3PO3H 3CAMA 1N36L 2HT1A 1BVSA 4BY1H 1XMQL 2E8GA 4A3LG 5J3BA 4P72A 1PH6A 2HHHL 4JYAL 4A3BH 1GD7A 3UDIA 1EIYB 4LW1A 4HJ5A 2B63H 3HOVG 3HOXG 2KHJA 4AH6A 3RN5A 1IBLL 2ZJQA 4GOPA 3PV0A 1BBUA 2E5LQ 1DGSA 1VQ7A 4LF9Q 2AKWB 4A3IG 2LXJA 1YBYA 1CKMA 2YTXA 5JJIA 4B3TL 3SGIA 3TQYA 2IX0A 4IJLA 3U50C 4BBRH 5M5XH 3OTOQ 1Q46A 4DR4Q 4A3LH 1VCIA 2KBNA 3AQQA 3GTPH 1SMXA 1B8AA 1NJIC 3KYHC 1KD1C 4OX9Q 1VQLA 1UE1A 1E7ZA 4OWWB 3I55A 1NMGA 1IBKL 1HR0L 3RNUA 1YHBA 2YTVA 5IE8A 1Q8KA 4K0KQ 2C35B 4JI3Q 4GN5A 1A62A 1VQCA 4GN3B 5BR8Q 3CPFA 4L5SA 3ER0A 2JA8H 4DV3L 3M4OH 1QVFA 1Q12A 2IY5B 1KRTA 3AEVA 3HOZH 1HNXQ 3KF6B 5AJ3L 3M9BA 2NVQH 1S40A 4DV4L 2GVAA 4JBWA 4KLKA 3CCQA 2Y0SE 4UP9A 4DV1L 2NVTH 1JB7A 4JI3L 3AFQA 3E9HA 3K0XA 5FJ8H 2D62A 3LGJA 4A3JH 3CD6A 4IFDG 2ZTDA 3CP0A 5JJLA 4JOIC 4R1JA 4JI8Q 1I5FA 2GVBA 1QVGA 4QY7A 5K36G 2UXBL 3ULJA 3PIPA 1CKOA 3H0GH 1PVOA 3BJUA 3I4MG 1SROA 3F8TA 1OXSC 1X3EA 2AWOA 2I5HA 1EQRA 2YTYA 3A74A 2KCMA 3M4QA 1L1OB 4NXNL 3J81c 3F2DA 1YI2A 4LF9L 3I2ZA 4A3MG 1YZ6A 4RMFA 4A3JG 4PZ6A 3BZCA 1PHJA 1VQ5A 1YHQA 5GROA 3GO5A 1FGUA 2UXBQ 3DLLA 4WJ3M 1E24A 1X65A 4DV6L 3U58A 4DR2L 4A93H 2LSSA 1HZ9A 4L5QA 4HIOA 1GVPA 2UUAQ 5IWAQ 5LMNW 4HIDA 2MNAA 4DV2Q 1L1OA 1VS0A 2IT1A 4DV3Q 5M3FG 4HIMA 4X65Q 1OXVA 1VQPA 2Q2TA 1B7YB 3U4VA 4HJ7A 1VQ4A 1GO3E 1RIPA 2JA9A 4JOIA 4X62Q 5LMUQ 4A3DG 2WFWA 2R93G 1JMCA 4GKJQ 4A3CH 3GTKH 1SR3A 4IOCA 1PV4A 2L15A 4JI2L 4LNQA 4BXXH 5E7NA 4MZ9A 2K4KA 4IPDA 1HNZL 1PH4A 2YYZA 5GAHC 3S24A 4Y7NH 3VDYA 2CCZA 1PYBA 4C2MH 2JEBI 5M5WH 3CCRA 5M3FH 3ULPA 3PO3G 3RZOH 2GN5A 1W3SA 5GAEC 2VQEQ 3JAMi 5ELNA 3CMEA 2Q2IA 4BY7G 3KF8B 3OTOL 2ZJRA 1Q86C 1VQNA 2B63G 2F4VQ 3GD7A 3KOJA 4GLAC 3G71A 4J15A 4JI8L 1HJPA 1WCMG 4JC0A 4LFAL 1YHAA 5DLQE 1GKHA 1FVIA 1UE5A 2F3IA 1I50H 1YNXA 3HFZB 3PUXA 3S1NH 3OW2A 4TQUS 3BU2A 4JI7Q 3S14H 4A3GG 1QUQB 3CPWA 1EQQA 4DAMA 2N49A 3TEHB 1EOVA 1SRUA 4DV2L 2YV5A 4GKJL 2ES2A 1N33Q 3S2DH 2CFMA 3A5ZB 1E3PA 1HR0Q 4KHZA 3KJPA 4JI4Q 2IX1A 1IL2A 2R92H 2PI2E 4HJ9A 3W1BA 3HOZG 4GNXB 2N8NA 5FLMG 4DV6Q 3I4NH 4DR4L 2EIFA 3J80c 3STBD 2PMZE 4P71A 3CMAA 4EX5A 3M85A 4DR7Q 2VUMG 1HZAA 1X6OA 3FHWA 1YITA 2JA6H 4DPGA 1J6QA 1N32L 4DR7L 1PYSB 3J80i 1TWCH 2PQAB 4AYBG 3ULLA 1K73C 2QGQA 1M1KC 2R6GA 1L1OC 2WP8J 2Z6KA 2D0OA 1VQDA 4OXPA 2E2IH 3GTGH 2UXCQ 2MFIA 1J5EQ 4KHPQ 1NTGA 3H0GG 3I4MH 4JI2Q 4DV7L 3RR5A 3HOYG 1YEZA 1A63A 5C4XG 1Q1EA 4A76A 1RL2A 2VQFL 4A3BG 5AJ3Q 4B3ML 4O2DA 1PH7A 2BH2A 1XMQQ 2JK8A 5LMNL 1XTDA 4UPAA 1O7IA 1X3FA 3NELA 4C3JH 3A5UA 3KJOA 1XPRA 4JI5Q 2VNUD 4A3IH 2VQFQ 3F2BA 4DR2Q 1KHIA 5C0XG 4LF6L 3STBC 4QGUA 1KL9A 2HQLA 4C3IH 5C4XH 5JEAG 4DV5L 4DNIA 2OQ0A 1XNQL 3FP9A 2KCTA 1WFQA 4GKKQ 4NXNQ 2EXDA 2AWNA 3GTOH 3JC66 2K5HA 4GLXA 1Y1VH 5IP7H 2UUBQ 5HY6A 3T1YL 4GNXC 2N3SA 4GKKL 4GNXA 2UUCL 1HR0W 3K7UC 1LUZA 1G291 4LFCQ 2DGYA 1L0WA 1TWHH 4JI5L 5H1SE 1FL0A 1TWGH 1XPOA 2ZM6Q 4X66Q 4JI4L 2JEAI 1IZ6A 2D0PA 2NZOA 1QZGA 3W5OA 1HNWL 1QZHA 3Q8DA 4PMWA 1WYDA 1OXUA 1VQMA 1A8VA 3EBEA 1Y1VG 5IP7G 1Y1WG 5LMNQ 4DK3C 2XGTA 4L5TA 4QIWE 1XJVA 2WAQE 1N34L 1FJGL 2Q2HA 2I5LX 2Y0SG 3TS0A 3ERSX 3PCOB 1VQ9A 2K75A 1PH9A 1Q81C 1N8RC 3UDXA 3M4PA 4EQ5A 1EIFA 4B3RL 1HNWQ 2UUCQ 1E1TA 1BBWA 2BA0A 1XMOQ 2WAQG 2JQOA 2Z6KC 3CCVA 5IP9G 4NB3A 4LF8Q 3H3VI 2CKZB 3GTJH 3GTQH 4HJ8A 1ASYA 1VQAA 3HKZE 2OTLA 4DK6C 2AMCB 4B3TQ 2R7FA 2VL6A 4IPCA 4DR5L 2RF4A 1N32Q 1JT8A 4R4OA 1AE2A 2JJQA 1SLJA 4DAYB 2F52A 3T1HL 3WWVA 3CC7A 1D8LA 3E0EA 1PA6A 3CC2A 4LF8L 2A8VA 4QL5A 4A75A 3I4NG 1K3RA 1PFSA 1WJJA 4LUOA 1VQ6A 4B3RQ 3PUVA 2B29A 3K80C 4LUVA 4BA1I 3CXCA 4JBKA 4YHHQ 5IYDH 2BH8A 2CWAA 1P8LA 4H02A 4LUZA 4UP7A 1K83H 3EN2A 1VQJA 4IFDJ 3PSIA 4QQBX 1V9PA 4LFBL 1OXXK 1X56A 2KENA 3RZDH 2ALYB 4IPHA 5IY0A 4JI7L 3AYHB 1P16A 5GAGC 1SE8A 2DUDA 1YJNA 3MXNB 1VQKA 1C7YA 3CCJA 3L0OA 3HOYH 3PO2H 4IJHA 2ASBA 3RLNA 2QEXA 5GQOA 5IWAL 4BY7H 1CKNA 1IYJB 5M5YH 5C0XI 4LF4L 3S1MH 4WJ4A 1Q7YC 1JJGA 2R7ZG 3CCSA 4Y52H 4A3EH 4DR6Q 1D7QA 4R4IA 3T1YQ 4KHPL 1LYLA 1UWVA 1Q82C 4IO9A 4GS3A 1NE3A 3UE0A 1G51A 1I3QH 4P73A 3G6EA 1K8AC 2XTIA 4PZ8A 2VS1A 4JBMA 2F4VL 1MIUA 5IYBG 4A3DH 1XNQQ 5C44H 3F1ZA 1HNZQ 1Q1BA 4YCUA 2I5MX 4B3SL 4A3GH 1NMFA 4A3CG 2Q2UA 3W1GA 1BKBA 3HOUG 2A1AA 2R7ZH 1PH1A 3D31A 4KI0A 3GTLH 4BXXG 4FDBA 3HOWH 3CCEA 2NN6I 4X64Q 4AQYL 4DUYQ 1UE6A 2E2JH 4APVA 4DUZQ 3S16H 4QJFA 4A3KG 2I0QA 4JI0L 3GDEA 1N36Q 2FXQA 4BBRG 2IHEA 4R4CA 2RCNA 4BBSH 1TWFH 1IBMQ 4OONA 5FLXc 4LFBQ 2MO0A 4OO1G 5BR8L 2N78A 3HOUH 2JA5G 2Z0SA 3G48A 5IYDG 3I56A 2NZHA 3F2CA 4JV5L 4DUYL 4OWXB 1H95A 1JJCB 4PZ7A 4IOAA 1PH3A 2UUAL 5JJKA 5C3EG 1IXRA 1B70B 3CW2C 4A3FH 5IT9c 4GLVB 2K50A 3S15H 2VW9A 1HNXL 3K81C 2UU9L 2ZJPA 4NXML 1OXTA 2UUBL 1X3GA 1XNRL 4BBSG 1I6HH 2BA1A 3L7ZC 2V1CC 3PIOA 4X6AH 5JEAJ 3RN2A 5IYCH 1L2FA 3D0FA 1TWAH 3J81j 3H3VH 2LXKA 5IP9H 1NY4A 3J7ZC 2JE6I 2EQSA 2VQEL 3CCMA 1YJ9A 1S72A 4YY3L 2E5LL 3M7NA 1HH2P 2ID0A 1XMOL 1UEBA 4POFA 4DV1Q 3JAMc 4DR1Q 3DM3A 1X9NA 2R92G 4ME3A 2YU9H 1HZBA 1Z9FA 1Z47A 1WI5A 3OYYA 5FLMH 4P74A 4C3HH 2OWOA 1CSQA 1A0IA 1UE7A 5M3MH 4X65L 4DV4Q 5GADC 5IYCG 1YIJA 2VUMH 1E1OA 1JE5A 2PNHA 2JA6G 4YCVA 1VQOA 2IHFA 2H5XA 3EIVA 3FKIH 1I94Q 1V43A 3MEFA 2K5VA 1XPUA 4O0AA 3UDGA 2WB1G 3CF5A 4JCVE 4DUZL 4OX9L 4DKAC 1VQGA 1VQ8A 4K0KL 1EUJA 4LFCL 4X64L 2AHOB 3J81i 3T1HQ 4UY8C 1CSPA 2JA8G 4XIGS 2NVXH 1KRSA 1SN8A 1HZCA 2WB1E 4LF5L 3H15A 3GTMH 1VQBA 1N9WA 1VQIA 5FJ8G 3S1QH 4JBJA 4JI6Q 3FKIG 4YWLA 3AFPA 4DR5Q 4NXMQ 3G4SA 3K7AH 1C0AA 3KF6A 3IRBA 1NBWA 4DV5Q 4LF4Q 4LF7L 3TS2A 3BZKA 2HIXA 1PH5A 1MJEA 3S17H 1U5KA 1VQHA 2JA7G 4AYBE 1Y14B 3S2HH 5IYBH 3KLWA 3CC4A 4P75A 1KC8C 5C44G 1AH9A 5LMUL 4GOPC 3ZJYC 2UXDQ 4GOPB 1VQEA 2OCEA 4TVAB 4IPGA 1MJCA 1EFWA 1KAWA 3KDFB 1KQSA 2UXDL 3U4ZA 4ALPA 4POGA 2NN6G 4A93G 3NENA 1WCMH 4YWMA 1KIXA 1CUKA 4YY3Q 4GN4B 1GM5A 1EYGA 3HOWG 4DR3L 4IFDI 4YWKA 2ZTEA 2NVYH 4A3KH 2JA7H 4MNOA 4A4IA 3A0JA 4JI1L 3E9IA 1X55A 1JJ2A 3HKSA 1J5EL 1CKNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA Q;  1S3O A;  2HIV A;  3PGZ A;  1KXL A;  1IBK Q;  2ZTC A;  4R4Q A;  3UDF A;  1OTC A;  1QVC A;  2QA4 A;  1W2B A;  1SFO H;  2JA5 H;  3HKZ G;  4B3S Q;  3RLF A;  1K0R A;  4OWT B;  4XTC S;  1T9H A;  2MO1 A;  1Y1W H;  4NPS A;  1YJW A;  5C3E H;  4A3F G;  1IBL Q;  1PH2 A;  4DR6 L;  2UU9 Q;  2K5N A;  3TRE A;  1EWI A;  3CCU A;  4R4T A;  3TRZ A;  3ICE A;  5C0X J;  4L5R C;  1U0L A;  4RG1 A;  1VQF A;  4HJA A;  1LTL A;  4JG2 A;  4JYA Q;  3NEM A;  4JV5 Q;  2CWP A;  3I4O A;  1N34 Q;  4DR3 Q;  2PQA A;  1V1Q A;  1E22 A;  2OTJ A;  1M90 C;  3PF4 A;  4DV0 Q;  2B3G A;  4BA2 I;  4JI0 Q;  2PI2 A;  4X66 L;  3NBH B;  3PUZ A;  4DV0 L;  1AE3 A;  2OQK A;  3UE1 A;  4AQY Q;  2KHI A;  1MKH A;  4YHH L;  1LM0 A;  1K8G A;  4OO1 I;  4DR1 L;  2K14 A;  3PF5 A;  5C4J H;  1C9O A;  2ZM6 L;  4DV7 Q;  4A3M H;  5M3M G;  2K52 A;  4LF7 Q;  1G6P A;  2UXC L;  4YCW A;  1PH8 A;  5EAY A;  1ASZ A;  3PUY A;  2MQH A;  2A19 A;  1K9M C;  3B6Y A;  3M3Y H;  3CCL A;  1YVC A;  1QUQ A;  3RLO A;  2E2H H;  3CQZ H;  4JI6 L;  2RHQ B;  5ELO A;  1XNR Q;  3J7A 5;  4LWC A;  3I7F A;  4MTN A;  2RHS B;  4JI1 Q;  2R7D A;  4LF5 Q;  4BY1 G;  3PO2 G;  1WOC A;  1TXY A;  3PUW A;  2R93 H;  2VY3 A;  3S1R H;  1N33 L;  2HHH Q;  3HOV H;  5HGQ A;  2CQO A;  3HOX H;  1R9T H;  3KFU A;  1FJG Q;  4LF6 Q;  4A3E G;  4UP8 A;  1X54 A;  3KDF A;  4AIM A;  3L2P A;  1I94 L;  4PG3 A;  1IBM L;  2ATW A;  3K8A A;  4X62 L;  4B3M Q;  2VZA A;  4HIK A;  3PO3 H;  3CAM A;  1N36 L;  2HT1 A;  1BVS A;  4BY1 H;  1XMQ L;  2E8G A;  4A3L G;  5J3B A;  4P72 A;  1PH6 A;  2HHH L;  4JYA L;  4A3B H;  1GD7 A;  3UDI A;  1EIY B;  4LW1 A;  4HJ5 A;  2B63 H;  3HOV G;  3HOX G;  2KHJ A;  4AH6 A;  3RN5 A;  1IBL L;  2ZJQ A;  4GOP A;  3PV0 A;  1BBU A;  2E5L Q;  1DGS A;  1VQ7 A;  4LF9 Q;  2AKW B;  4A3I G;  2LXJ A;  1YBY A;  1CKM A;  2YTX A;  5JJI A;  4B3T L;  3SGI A;  3TQY A;  2IX0 A;  4IJL A;  3U50 C;  4BBR H;  5M5X H;  3OTO Q;  1Q46 A;  4DR4 Q;  4A3L H;  1VCI A;  2KBN A;  3AQQ A;  3GTP H;  1SMX A;  1B8A A;  1NJI C;  3KYH C;  1KD1 C;  4OX9 Q;  1VQL A;  1UE1 A;  1E7Z A;  4OWW B;  3I55 A;  1NMG A;  1IBK L;  1HR0 L;  3RNU A;  1YHB A;  2YTV A;  5IE8 A;  1Q8K A;  4K0K Q;  2C35 B;  4JI3 Q;  4GN5 A;  1A62 A;  1VQC A;  4GN3 B;  5BR8 Q;  3CPF A;  4L5S A;  3ER0 A;  2JA8 H;  4DV3 L;  3M4O H;  1QVF A;  1Q12 A;  2IY5 B;  1KRT A;  3AEV A;  3HOZ H;  1HNX Q;  3KF6 B;  5AJ3 L;  3M9B A;  2NVQ H;  1S40 A;  4DV4 L;  2GVA A;  4JBW A;  4KLK A;  3CCQ A;  2Y0S E;  4UP9 A;  4DV1 L;  2NVT H;  1JB7 A;  4JI3 L;  3AFQ A;  3E9H A;  3K0X A;  5FJ8 H;  2D62 A;  3LGJ A;  4A3J H;  3CD6 A;  4IFD G;  2ZTD A;  3CP0 A;  5JJL A;  4JOI C;  4R1J A;  4JI8 Q;  1I5F A;  2GVB A;  1QVG A;  4QY7 A;  5K36 G;  2UXB L;  3ULJ A;  3PIP A;  1CKO A;  3H0G H;  1PVO A;  3BJU A;  3I4M G;  1SRO A;  3F8T A;  1OXS C;  1X3E A;  2AWO A;  2I5H A;  1EQR A;  2YTY A;  3A74 A;  2KCM A;  3M4Q A;  1L1O B;  4NXN L;  3J81 c;  3F2D A;  1YI2 A;  4LF9 L;  3I2Z A;  4A3M G;  1YZ6 A;  4RMF A;  4A3J G;  4PZ6 A;  3BZC A;  1PHJ A;  1VQ5 A;  1YHQ A;  5GRO A;  3GO5 A;  1FGU A;  2UXB Q;  3DLL A;  4WJ3 M;  1E24 A;  1X65 A;  4DV6 L;  3U58 A;  4DR2 L;  4A93 H;  2LSS A;  1HZ9 A;  4L5Q A;  4HIO A;  1GVP A;  2UUA Q;  5IWA Q;  5LMN W;  4HID A;  2MNA A;  4DV2 Q;  1L1O A;  1VS0 A;  2IT1 A;  4DV3 Q;  5M3F G;  4HIM A;  4X65 Q;  1OXV A;  1VQP A;  2Q2T A;  1B7Y B;  3U4V A;  4HJ7 A;  1VQ4 A;  1GO3 E;  1RIP A;  2JA9 A;  4JOI A;  4X62 Q;  5LMU Q;  4A3D G;  2WFW A;  2R93 G;  1JMC A;  4GKJ Q;  4A3C H;  3GTK H;  1SR3 A;  4IOC A;  1PV4 A;  2L15 A;  4JI2 L;  4LNQ A;  4BXX H;  5E7N A;  4MZ9 A;  2K4K A;  4IPD A;  1HNZ L;  1PH4 A;  2YYZ A;  5GAH C;  3S24 A;  4Y7N H;  3VDY A;  2CCZ A;  1PYB A;  4C2M H;  2JEB I;  5M5W H;  3CCR A;  5M3F H;  3ULP A;  3PO3 G;  3RZO H;  2GN5 A;  1W3S A;  5GAE C;  2VQE Q;  3JAM i;  5ELN A;  3CME A;  2Q2I A;  4BY7 G;  3KF8 B;  3OTO L;  2ZJR A;  1Q86 C;  1VQN A;  2B63 G;  2F4V Q;  3GD7 A;  3KOJ A;  4GLA C;  3G71 A;  4J15 A;  4JI8 L;  1HJP A;  1WCM G;  4JC0 A;  4LFA L;  1YHA A;  5DLQ E;  1GKH A;  1FVI A;  1UE5 A;  2F3I A;  1I50 H;  1YNX A;  3HFZ B;  3PUX A;  3S1N H;  3OW2 A;  4TQU S;  3BU2 A;  4JI7 Q;  3S14 H;  4A3G G;  1QUQ B;  3CPW A;  1EQQ A;  4DAM A;  2N49 A;  3TEH B;  1EOV A;  1SRU A;  4DV2 L;  2YV5 A;  4GKJ L;  2ES2 A;  1N33 Q;  3S2D H;  2CFM A;  3A5Z B;  1E3P A;  1HR0 Q;  4KHZ A;  3KJP A;  4JI4 Q;  2IX1 A;  1IL2 A;  2R92 H;  2PI2 E;  4HJ9 A;  3W1B A;  3HOZ G;  4GNX B;  2N8N A;  5FLM G;  4DV6 Q;  3I4N H;  4DR4 L;  2EIF A;  3J80 c;  3STB D;  2PMZ E;  4P71 A;  3CMA A;  4EX5 A;  3M85 A;  4DR7 Q;  2VUM G;  1HZA A;  1X6O A;  3FHW A;  1YIT A;  2JA6 H;  4DPG A;  1J6Q A;  1N32 L;  4DR7 L;  1PYS B;  3J80 i;  1TWC H;  2PQA B;  4AYB G;  3ULL A;  1K73 C;  2QGQ A;  1M1K C;  2R6G A;  1L1O C;  2WP8 J;  2Z6K A;  2D0O A;  1VQD A;  4OXP A;  2E2I H;  3GTG H;  2UXC Q;  2MFI A;  1J5E Q;  4KHP Q;  1NTG A;  3H0G G;  3I4M H;  4JI2 Q;  4DV7 L;  3RR5 A;  3HOY G;  1YEZ A;  1A63 A;  5C4X G;  1Q1E A;  4A76 A;  1RL2 A;  2VQF L;  4A3B G;  5AJ3 Q;  4B3M L;  4O2D A;  1PH7 A;  2BH2 A;  1XMQ Q;  2JK8 A;  5LMN L;  1XTD A;  4UPA A;  1O7I A;  1X3F A;  3NEL A;  4C3J H;  3A5U A;  3KJO A;  1XPR A;  4JI5 Q;  2VNU D;  4A3I H;  2VQF Q;  3F2B A;  4DR2 Q;  1KHI A;  5C0X G;  4LF6 L;  3STB C;  4QGU A;  1KL9 A;  2HQL A;  4C3I H;  5C4X H;  5JEA G;  4DV5 L;  4DNI A;  2OQ0 A;  1XNQ L;  3FP9 A;  2KCT A;  1WFQ A;  4GKK Q;  4NXN Q;  2EXD A;  2AWN A;  3GTO H;  3JC6 6;  2K5H A;  4GLX A;  1Y1V H;  5IP7 H;  2UUB Q;  5HY6 A;  3T1Y L;  4GNX C;  2N3S A;  4GKK L;  4GNX A;  2UUC L;  1HR0 W;  3K7U C;  1LUZ A;  1G29 1;  4LFC Q;  2DGY A;  1L0W A;  1TWH H;  4JI5 L;  5H1S E;  1FL0 A;  1TWG H;  1XPO A;  2ZM6 Q;  4X66 Q;  4JI4 L;  2JEA I;  1IZ6 A;  2D0P A;  2NZO A;  1QZG A;  3W5O A;  1HNW L;  1QZH A;  3Q8D A;  4PMW A;  1WYD A;  1OXU A;  1VQM A;  1A8V A;  3EBE A;  1Y1V G;  5IP7 G;  1Y1W G;  5LMN Q;  4DK3 C;  2XGT A;  4L5T A;  4QIW E;  1XJV A;  2WAQ E;  1N34 L;  1FJG L;  2Q2H A;  2I5L X;  2Y0S G;  3TS0 A;  3ERS X;  3PCO B;  1VQ9 A;  2K75 A;  1PH9 A;  1Q81 C;  1N8R C;  3UDX A;  3M4P A;  4EQ5 A;  1EIF A;  4B3R L;  1HNW Q;  2UUC Q;  1E1T A;  1BBW A;  2BA0 A;  1XMO Q;  2WAQ G;  2JQO A;  2Z6K C;  3CCV A;  5IP9 G;  4NB3 A;  4LF8 Q;  3H3V I;  2CKZ B;  3GTJ H;  3GTQ H;  4HJ8 A;  1ASY A;  1VQA A;  3HKZ E;  2OTL A;  4DK6 C;  2AMC B;  4B3T Q;  2R7F A;  2VL6 A;  4IPC A;  4DR5 L;  2RF4 A;  1N32 Q;  1JT8 A;  4R4O A;  1AE2 A;  2JJQ A;  1SLJ A;  4DAY B;  2F52 A;  3T1H L;  3WWV A;  3CC7 A;  1D8L A;  3E0E A;  1PA6 A;  3CC2 A;  4LF8 L;  2A8V A;  4QL5 A;  4A75 A;  3I4N G;  1K3R A;  1PFS A;  1WJJ A;  4LUO A;  1VQ6 A;  4B3R Q;  3PUV A;  2B29 A;  3K80 C;  4LUV A;  4BA1 I;  3CXC A;  4JBK A;  4YHH Q;  5IYD H;  2BH8 A;  2CWA A;  1P8L A;  4H02 A;  4LUZ A;  4UP7 A;  1K83 H;  3EN2 A;  1VQJ A;  4IFD J;  3PSI A;  4QQB X;  1V9P A;  4LFB L;  1OXX K;  1X56 A;  2KEN A;  3RZD H;  2ALY B;  4IPH A;  5IY0 A;  4JI7 L;  3AYH B;  1P16 A;  5GAG C;  1SE8 A;  2DUD A;  1YJN A;  3MXN B;  1VQK A;  1C7Y A;  3CCJ A;  3L0O A;  3HOY H;  3PO2 H;  4IJH A;  2ASB A;  3RLN A;  2QEX A;  5GQO A;  5IWA L;  4BY7 H;  1CKN A;  1IYJ B;  5M5Y H;  5C0X I;  4LF4 L;  3S1M H;  4WJ4 A;  1Q7Y C;  1JJG A;  2R7Z G;  3CCS A;  4Y52 H;  4A3E H;  4DR6 Q;  1D7Q A;  4R4I A;  3T1Y Q;  4KHP L;  1LYL A;  1UWV A;  1Q82 C;  4IO9 A;  4GS3 A;  1NE3 A;  3UE0 A;  1G51 A;  1I3Q H;  4P73 A;  3G6E A;  1K8A C;  2XTI A;  4PZ8 A;  2VS1 A;  4JBM A;  2F4V L;  1MIU A;  5IYB G;  4A3D H;  1XNQ Q;  5C44 H;  3F1Z A;  1HNZ Q;  1Q1B A;  4YCU A;  2I5M X;  4B3S L;  4A3G H;  1NMF A;  4A3C G;  2Q2U A;  3W1G A;  1BKB A;  3HOU G;  2A1A A;  2R7Z H;  1PH1 A;  3D31 A;  4KI0 A;  3GTL H;  4BXX G;  4FDB A;  3HOW H;  3CCE A;  2NN6 I;  4X64 Q;  4AQY L;  4DUY Q;  1UE6 A;  2E2J H;  4APV A;  4DUZ Q;  3S16 H;  4QJF A;  4A3K G;  2I0Q A;  4JI0 L;  3GDE A;  1N36 Q;  2FXQ A;  4BBR G;  2IHE A;  4R4C A;  2RCN A;  4BBS H;  1TWF H;  1IBM Q;  4OON A;  5FLX c;  4LFB Q;  2MO0 A;  4OO1 G;  5BR8 L;  2N78 A;  3HOU H;  2JA5 G;  2Z0S A;  3G48 A;  5IYD G;  3I56 A;  2NZH A;  3F2C A;  4JV5 L;  4DUY L;  4OWX B;  1H95 A;  1JJC B;  4PZ7 A;  4IOA A;  1PH3 A;  2UUA L;  5JJK A;  5C3E G;  1IXR A;  1B70 B;  3CW2 C;  4A3F H;  5IT9 c;  4GLV B;  2K50 A;  3S15 H;  2VW9 A;  1HNX L;  3K81 C;  2UU9 L;  2ZJP A;  4NXM L;  1OXT A;  2UUB L;  1X3G A;  1XNR L;  4BBS G;  1I6H H;  2BA1 A;  3L7Z C;  2V1C C;  3PIO A;  4X6A H;  5JEA J;  3RN2 A;  5IYC H;  1L2F A;  3D0F A;  1TWA H;  3J81 j;  3H3V H;  2LXK A;  5IP9 H;  1NY4 A;  3J7Z C;  2JE6 I;  2EQS A;  2VQE L;  3CCM A;  1YJ9 A;  1S72 A;  4YY3 L;  2E5L L;  3M7N A;  1HH2 P;  2ID0 A;  1XMO L;  1UEB A;  4POF A;  4DV1 Q;  3JAM c;  4DR1 Q;  3DM3 A;  1X9N A;  2R92 G;  4ME3 A;  2YU9 H;  1HZB A;  1Z9F A;  1Z47 A;  1WI5 A;  3OYY A;  5FLM H;  4P74 A;  4C3H H;  2OWO A;  1CSQ A;  1A0I A;  1UE7 A;  5M3M H;  4X65 L;  4DV4 Q;  5GAD C;  5IYC G;  1YIJ A;  2VUM H;  1E1O A;  1JE5 A;  2PNH A;  2JA6 G;  4YCV A;  1VQO A;  2IHF A;  2H5X A;  3EIV A;  3FKI H;  1I94 Q;  1V43 A;  3MEF A;  2K5V A;  1XPU A;  4O0A A;  3UDG A;  2WB1 G;  3CF5 A;  4JCV E;  4DUZ L;  4OX9 L;  4DKA C;  1VQG A;  1VQ8 A;  4K0K L;  1EUJ A;  4LFC L;  4X64 L;  2AHO B;  3J81 i;  3T1H Q;  4UY8 C;  1CSP A;  2JA8 G;  4XIG S;  2NVX H;  1KRS A;  1SN8 A;  1HZC A;  2WB1 E;  4LF5 L;  3H15 A;  3GTM H;  1VQB A;  1N9W A;  1VQI A;  5FJ8 G;  3S1Q H;  4JBJ A;  4JI6 Q;  3FKI G;  4YWL A;  3AFP A;  4DR5 Q;  4NXM Q;  3G4S A;  3K7A H;  1C0A A;  3KF6 A;  3IRB A;  1NBW A;  4DV5 Q;  4LF4 Q;  4LF7 L;  3TS2 A;  3BZK A;  2HIX A;  1PH5 A;  1MJE A;  3S17 H;  1U5K A;  1VQH A;  2JA7 G;  4AYB E;  1Y14 B;  3S2H H;  5IYB H;  3KLW A;  3CC4 A;  4P75 A;  1KC8 C;  5C44 G;  1AH9 A;  5LMU L;  4GOP C;  3ZJY C;  2UXD Q;  4GOP B;  1VQE A;  2OCE A;  4TVA B;  4IPG A;  1MJC A;  1EFW A;  1KAW A;  3KDF B;  1KQS A;  2UXD L;  3U4Z A;  4ALP A;  4POG A;  2NN6 G;  4A93 G;  3NEN A;  1WCM H;  4YWM A;  1KIX A;  1CUK A;  4YY3 Q;  4GN4 B;  1GM5 A;  1EYG A;  3HOW G;  4DR3 L;  4IFD I;  4YWK A;  2ZTE A;  2NVY H;  4A3K H;  2JA7 H;  4MNO A;  4A4I A;  3A0J A;  4JI1 L;  3E9I A;  1X55 A;  1JJ2 A;  3HKS A;  1J5E L;  1CKN B; 
#chains in the Genus database with same CATH topology
 4LFA Q;  3PGZ A;  1KXL A;  1IBK Q;  4R4Q A;  2Q8T A;  5JVG 3;  1SNO A;  1EFI D;  3S1Q B;  2JA8 B;  2EYJ A;  1LT6 D;  4OWT B;  1BUV T;  5J22 A;  5IOC A;  5C3E H;  1IBL Q;  1QNK A;  2MPM A;  4DR6 L;  2K5N A;  3CCU A;  3TRZ A;  4NKL A;  3A8K E;  4RG1 A;  2H1E A;  1VQF A;  4HJA A;  1LTL A;  1YNJ C;  3NXW A;  4JV5 Q;  3I4O A;  3J7A V;  4BA2 I;  4JI0 Q;  2PI2 A;  3C1F A;  1SEB D;  1MKH A;  1Y8P B;  2ZXP A;  4DR1 L;  1C9O A;  3VYS A;  1STN A;  2K52 A;  4LF7 Q;  5M3F B;  1G6P A;  4CJ0 B;  2MQH A;  4N8X 1;  3B6Y A;  3M3Y H;  4XQN A;  4JI6 L;  4RCO A;  2RHQ B;  1XNR Q;  3J7A 5;  3R2I A;  2RCF A;  3SK6 A;  4LF5 Q;  1SND A;  1Y8N B;  1TXY A;  2K01 A;  2B8G A;  1DM0 B;  2CH4 W;  1N33 L;  1R9T H;  5D3D A;  1EU4 A;  1FJG Q;  3HS0 C;  1XXG A;  1X54 A;  2Z4H A;  5EQ0 A;  3K8A A;  4X62 L;  1SJE D;  1XYI A;  3CAM A;  1EY7 A;  3VYU A;  2BE5 D;  2HHH L;  1PH6 A;  1V1P B;  4A3B H;  3ONA B;  1EIY B;  2B2T A;  2B63 H;  4J6H A;  5K5P A;  4ZKB B;  2R93 B;  4KHV A;  1TWA B;  2FJ2 A;  3PV0 A;  1EZ8 A;  2J0T D;  2DY7 A;  1TT2 A;  1YBY A;  2K5Q A;  2LXJ A;  3OTO Q;  4IJL A;  4BBR H;  1Q46 A;  1TS5 A;  2Z9H A;  1PRT F;  3GTK B;  4L63 B;  1KD1 C;  2KQ3 A;  1PZJ D;  1E7Z A;  1UE1 A;  4DU9 A;  4OWW B;  1NMG A;  1YHB A;  4PQX A;  4CDC C;  3QG1 A;  3S17 B;  1RJT A;  4R8I A;  1LT5 D;  5BR8 Q;  3PO2 B;  1EIH A;  2F03 A;  3ER0 A;  3M4O H;  4FXD A;  1Q12 A;  1EEI D;  1KRT A;  2HD3 A;  3NK9 A;  4RFB A;  3HOZ H;  3M9B A;  1S40 A;  4KLK A;  3AFQ A;  3K0X A;  2K32 A;  4IFD G;  3CP0 A;  5JJL A;  5KGU A;  1ILP A;  1U4P A;  1QVG A;  3PIP A;  1CKO A;  2PO4 A;  3E5S A;  3TP6 A;  4BWG B;  1PVO A;  5LHY 1;  4PV1 C;  2F0D A;  3A74 A;  3QO2 A;  4LF9 L;  2ZXO A;  1TII D;  4PZ6 A;  3HZX A;  3S14 B;  3DLL A;  1AZQ A;  1ROD A;  3C46 A;  1RF2 D;  1JWS D;  1Y8O B;  3GTL B;  3R8B A;  4DV2 Q;  1I4X A;  1MI2 A;  1VS0 A;  4V19 0;  1VQP A;  1B7Y B;  1VQ4 A;  4JOI A;  3SVM A;  2NBF A;  1KNE A;  4A3D G;  1SJH D;  1JMC A;  5C6A A;  2KEC A;  2CW0 C;  5FO7 B;  1W6J A;  2GA4 B;  3PIO 3;  3S2H B;  1PV4 A;  1QNU A;  1PLF A;  2DJF C;  3DXJ C;  1STA A;  4MZ9 A;  2L0C A;  1AZP A;  2NTS A;  1AW7 A;  1PH4 A;  2YYZ A;  3S24 A;  1F2M A;  3CCR A;  4FYD A;  1IKL A;  1STY A;  1W3S A;  5GAE C;  2E2I B;  3H94 A;  1EY6 A;  1QJO A;  2JA6 B;  3KOJ A;  1NNX A;  1RHP A;  3AU7 A;  1WCM G;  4DNT B;  2F3I A;  1PRT D;  5IGD A;  5E4X A;  3BVG A;  3S1N H;  4TQU S;  3BU2 A;  3S14 H;  3J81 L;  3DWP A;  3W2D A;  1EOV A;  1SRU A;  4GKJ L;  2ES2 A;  2WAQ B;  1EY0 A;  4XYO A;  4G7H C;  2EDG A;  3MXU A;  1HR0 Q;  3EJI A;  1NCV A;  4UHV A;  1MGS A;  4OL7 A;  2R92 H;  1JOK A;  3QOL A;  1U9R A;  2N8N A;  4EQP A;  2EIF A;  3J80 c;  3STB D;  4A3J B;  4ZUJ A;  3M85 A;  4RGT A;  4DR7 Q;  2E75 C;  3A7L A;  1X6O A;  5DM6 3;  5D65 A;  3MC0 B;  4DPG A;  1N32 L;  4DR7 L;  1PYS B;  3MA2 B;  3ULL A;  1M1K C;  4I65 A;  1EWH A;  2WP8 J;  5L37 A;  2E2I H;  3MEH A;  1G2T A;  2JXM B;  3HOV B;  1B2T A;  3RR5 A;  1A63 A;  5IGF A;  1RL2 A;  5AJ3 Q;  3M4Y A;  2IL8 A;  4O2D A;  2BH2 A;  4V0B A;  5E1F A;  2OXP A;  1XTD A;  5E3F A;  2ENB A;  4A3I H;  2VQF Q;  4DR2 Q;  1KHI A;  5C0X G;  1F2Z A;  4QGU A;  1LO5 D;  2QF7 A;  1JQY D;  1BCP B;  4DNI A;  2OQ0 A;  3VR6 A;  2ZT9 C;  2KCT A;  1WFQ A;  1DZ1 A;  1TR5 A;  3NSW A;  4R9W A;  1E0B A;  3GTO H;  2K5H A;  1TQO A;  1TS4 A;  1DD2 A;  4J8Q A;  3TP5 A;  1CHQ D;  2N3S A;  4GKK L;  4GNX A;  4LMQ D;  2A6E C;  4LFC Q;  1L0W A;  1TWH H;  1XPO A;  2F0V A;  2JEA I;  2E76 C;  1QZG A;  1FNU A;  1OXU A;  1Y1W G;  5LMN Q;  4L5T A;  2WAQ E;  1X3Q A;  2Q2H A;  1FJG L;  2M2L A;  1A3T A;  3TS0 A;  1F9R A;  4DN4 M;  2L11 A;  2OEO A;  4F7X A;  1E1T A;  4DA2 A;  2WAQ G;  1BCP F;  3H3V I;  3H3V C;  2CKZ B;  3VA5 A;  3IKJ A;  4HJ8 A;  1XWE A;  5C3X A;  4CGY B;  4B3T Q;  3OW7 A;  5T1G A;  4KN4 C;  5HUR A;  4R4O A;  1AE2 A;  3T1H L;  3WWV A;  3CC7 A;  1D8L A;  1MBY A;  4QL5 A;  4B3R Q;  4RHS A;  4JBK A;  3VR5 A;  4A3E B;  2CWA A;  2QCP X;  1GUO A;  1YNN D;  3EN2 A;  5K36 H;  1VDZ A;  4QQB X;  4BY7 B;  4OEM B;  4JI7 L;  3AYH B;  5G3L D;  1PYW D;  1SE8 A;  1C7Y A;  1STE A;  3HOY H;  4IJH A;  2QEX A;  5IWA L;  1CKN A;  3S1M H;  1Q7Y C;  1JJG A;  3JAM L;  4R4I A;  3LX0 A;  1B3A A;  1UWV A;  1Z7T A;  1Q82 C;  1GUW A;  4IO9 A;  3N52 A;  5C4H A;  3NWS A;  2VS1 A;  2F4V L;  4YIJ A;  2K33 A;  5C44 H;  3ZYY X;  1HNZ Q;  4YCU A;  2I5M X;  1NMF A;  2ICI A;  2Q2U A;  1BKB A;  2A1A A;  2LS0 1;  5C4X B;  5ELE A;  5COY A;  3HOW H;  4DFA A;  2NN6 I;  3I70 A;  4AQY L;  4G7O C;  4DUZ Q;  2P5Z X;  3J80 L;  4A3K G;  3N6R A;  3K0Y A;  1N36 Q;  4XYQ A;  1PZK D;  1TWF H;  1IBM Q;  4OON A;  4RH6 A;  1SNQ A;  4OO1 G;  1H95 A;  4OWX B;  4ILW A;  1B4O A;  1WTH A;  2A68 D;  2CQA A;  4A3F H;  3CW2 C;  1Y69 U;  3T53 B;  2EYF A;  2WII B;  2K50 A;  2VW9 A;  1J9O A;  2RSO A;  3K81 C;  1A3V A;  3RUZ A;  3OWF A;  5CV4 A;  3BDO A;  1IL8 A;  1X3G A;  5CV5 A;  3Q22 A;  4BBS G;  1GUG A;  2V1C C;  4I7A A;  4H13 C;  5CC4 A;  3RN2 A;  1PTO H;  1TWA H;  2LXK A;  1ZYR C;  1NY4 A;  2E5L L;  3MFY A;  1S72 A;  1VF5 C;  1HH2 P;  1H9K A;  5ELB A;  1XMO L;  4POF A;  2IPK D;  3TN2 A;  3OOC A;  2R92 G;  2KVM A;  1WI5 A;  5FLM H;  4RGO S;  4C3H H;  1KLG D;  2OWO A;  1CSQ A;  4IUQ A;  5GAD C;  1YIJ A;  1A2T A;  5JEA H;  1E1O A;  4YCV A;  2IHF A;  1V43 A;  2EYO A;  3CF5 A;  4OX9 L;  1EUJ A;  3HKZ B;  3J81 i;  3RMH A;  2PYK A;  5KRU A;  3DM1 A;  5A2Q E;  3A8I E;  5FKA C;  2DN8 A;  1VQB A;  1N9W A;  1Q90 A;  4JBJ A;  4JI6 Q;  3FKI G;  3AFP A;  1D1K A;  4UAI A;  2DNC A;  3G4S A;  3IRB A;  2RKS A;  1NBW A;  3LWU A;  4M1U B;  1D2B A;  4G7Z C;  4QUF A;  5J39 A;  4P2C B;  1JC7 A;  2F0W A;  1G6Z A;  2J4X A;  1BXT A;  1Y14 B;  3OHX C;  1ZEQ X;  1KC8 C;  2XWB B;  4TSS A;  5LMU L;  1AH9 A;  4TVA B;  5KND A;  2NYZ D;  3W3A A;  4HR7 B;  1KQS A;  2F1M A;  5CV8 A;  4POG A;  4KK7 A;  2EXZ A;  1TWG B;  4XDX A;  1KIX A;  5D14 A;  4GN4 B;  1GM5 A;  4DR3 L;  1JR0 D;  2ZTE A;  1JJ2 A;  4L8J A;  1SFO H;  4ME5 A;  3HKS A;  1K3B C;  1S5B D;  4O1N A;  3S9W A;  4K0K L;  2PPB C;  3ND9 A;  4IAL A;  2JA5 H;  4B3S Q;  3RLF A;  1K0R A;  2MO1 A;  1YJW A;  2K6A A;  1EWI A;  2EE1 A;  4L5R C;  1U0L A;  4IQZ A;  1HTL D;  1C8C A;  1EU3 A;  4F8M A;  1CZW A;  2CWP A;  3NQI A;  5BN5 A;  1N34 Q;  3VYR A;  3FKI B;  4DR3 Q;  1MD2 D;  2PQA A;  1EIG A;  1V1Q A;  2OTJ A;  1M90 C;  3PF4 A;  4PMC A;  3T56 B;  2MP1 A;  1QOH A;  4JVZ A;  1K8M A;  3NBH B;  1AE3 A;  2OQK A;  3UE1 A;  2F0J A;  4OO1 I;  2NZ1 D;  4DV7 Q;  1PTO C;  4A93 B;  1PH8 A;  1S5C D;  3PUY A;  2IJ0 A;  1A6X A;  1K9M C;  1F2Y A;  3CCL A;  2TSS A;  1HFN A;  1LTB D;  1WOC A;  3NBI A;  1GJX A;  3HOV H;  1NR2 A;  4BS9 A;  3KFU A;  4A3E G;  4UP8 A;  3QR8 A;  3URY A;  3G7L A;  3L2P A;  1I94 L;  3M4O B;  2VZA A;  4HIK A;  2HT1 A;  4BY1 H;  1XMQ L;  2X6L A;  3QIA A;  4A3L G;  3BVZ A;  1CA5 A;  1GD7 A;  4DK1 A;  3DUZ A;  3HOX G;  2KHJ A;  3RN5 A;  4X3S A;  1IBL L;  2ZJQ A;  5C5M A;  3V96 A;  2E5L Q;  1BBU A;  1S5F D;  1JOO A;  1DGS A;  4N9T A;  4NP5 A;  4NDX A;  1CKM A;  2L12 A;  2YTX A;  3NTI A;  4B3T L;  3SGI A;  3TQY A;  2IX0 A;  2E2H B;  4TRD A;  1M4V A;  4A3L H;  4DK0 A;  2Q8I B;  3AQQ A;  4OIJ A;  3GTP H;  2BOS A;  1SMX A;  1NJI C;  1VQL A;  1T5X D;  1IBK L;  3RNU A;  4RCN A;  3NE5 B;  3K57 A;  4JI3 Q;  4GN5 A;  4GN3 B;  3L3O C;  4L5S A;  2JA8 H;  1QVF A;  4C3I B;  2K5D A;  1B44 D;  3KF6 B;  5AJ3 L;  4R8N A;  3WOF A;  2D62 A;  4XQJ A;  4JOI C;  4R1J A;  5CGK A;  2G9D A;  2UXB L;  3ULJ A;  1I4R A;  2F0H A;  3BJU A;  4QUC A;  1TU2 B;  3M4Q A;  2AWO A;  5IGG A;  1HNX Q;  1L1O B;  3F2D A;  2Y0S B;  1UNS A;  4CKB A;  2AUJ D;  4A3J G;  1VQ5 A;  3BZC A;  5GRO A;  3GO5 A;  1EYA A;  3Q0A A;  1X65 A;  1B9M A;  2LSS A;  1PTO B;  4ZQ3 A;  1GVP A;  2O2L D;  1J8I A;  5IWA Q;  5LMN W;  3HOY B;  1GHJ A;  1H9S B;  2N55 A;  2PZW A;  2MNA A;  4F87 A;  4HSV A;  4HJ7 A;  1RIP A;  2JA9 A;  4KKS A;  1GOZ A;  1GUS A;  1SYC A;  4A3G B;  1WD1 A;  3R3O A;  5C3W A;  4JI2 L;  4LNQ A;  5E7N A;  2VUM B;  2K4K A;  1HNZ L;  2L4N A;  2A6H C;  2F0Q A;  1PYB A;  4C2M H;  1ENC A;  3ULP A;  3PO3 G;  3RZO H;  1CFM A;  1HA5 A;  3K58 A;  3CU7 A;  3JAM i;  5CV9 A;  4G57 A;  2Q2I A;  5ELF A;  1EZ6 A;  2HQE A;  1Q86 C;  4LJZ C;  2B63 G;  1HFG A;  4J15 A;  4JI8 L;  2NN6 H;  3UI2 A;  1HJP A;  3QJY A;  4JC0 A;  5DLQ E;  3TP7 A;  2E74 C;  3HFZ B;  2B2W C;  3PUX A;  4ZK9 B;  3FVQ A;  3GV6 A;  3A54 A;  1CQF A;  3EVQ A;  4RHR A;  2XNA C;  2O4X A;  1UAP A;  2PMZ B;  2RDF A;  4H7B A;  5I4D A;  3J7A F;  2EOT A;  5M3M B;  2YV5 A;  5T1I A;  2A69 D;  3S2D H;  3A5Z B;  3KJP A;  2IX1 A;  4ZCK A;  2HCI A;  1IL2 A;  2A69 C;  4X3T A;  4GNX B;  1D6E C;  3A7A B;  3WDN A;  4P71 A;  2LMC B;  3TME A;  1HZA A;  2F0E A;  3M7G A;  1TY0 A;  2QGQ A;  2AQ1 B;  2F0K A;  2UXC Q;  1J5E Q;  4KHP Q;  1NTG A;  3H0G G;  4IUV A;  5NUC A;  4DV7 L;  3HOY G;  5D3I B;  5C4X G;  1U4L A;  5G3L F;  3IAY A;  4CHT B;  2H4O A;  2QIL A;  3TBI B;  1B50 A;  4HCS A;  3HOZ B;  3A5U A;  1X3F A;  4QB4 A;  4JI5 Q;  3F2B A;  4MTK A;  4DAP A;  1LTT D;  1KL9 A;  5C4X H;  4C3I H;  5LL6 X;  1JCK B;  4C1N K;  1XNQ L;  4NXN Q;  1I4Q A;  1PTO F;  3BZD B;  2Z4I A;  1EWC A;  2RBM A;  3JC6 6;  4M8A A;  4TKO B;  3SEB A;  1Y1V H;  5HY6 A;  5CBE E;  2EY5 A;  3FPU B;  1GUT A;  3HP3 A;  4A3F B;  2DGY A;  1PRT B;  4JI5 L;  1TWG H;  2NTT A;  1M8A A;  4X66 Q;  2ZM6 Q;  3W5O A;  1RTN A;  1QZH A;  2MHV A;  1CK1 A;  3Q8D A;  1PXU A;  3J7Y W;  2WV6 D;  3SK4 A;  1H9S A;  2V4D A;  1SBB B;  2XRS D;  4DK3 C;  5HGT A;  3S1N B;  1WTV A;  3C2P A;  3S16 B;  1GXD C;  3PCO B;  1VQ9 A;  1PH9 A;  1N8R C;  3M4P A;  3HEJ A;  4EQ5 A;  5DAU A;  4B3R L;  2UUC Q;  1HNW Q;  1SMY C;  1I6H B;  1BBW A;  1EYD A;  4LF8 Q;  3VYT A;  5IP9 G;  1UEA B;  1ZXT A;  1ASY A;  1VQA A;  5JOB A;  3NBH A;  4DK6 C;  2AMC B;  2RF4 A;  1ML0 D;  4FF2 A;  1BNZ A;  2JJQ A;  2BDO A;  2F52 A;  4DAY B;  4Y7N B;  2NWG A;  4RGN A;  1D5X C;  1K3R A;  3FEW X;  1Q3L A;  1WJJ A;  1FYC A;  3K80 C;  4LUV A;  1LTS D;  3ERO A;  4H02 A;  1X32 A;  1K83 H;  1AN8 A;  4LFB L;  1OXX K;  2KEN A;  2ALY B;  1X3P A;  5IY0 A;  1LT4 D;  1YJN A;  3CCJ A;  1CHP D;  3K59 A;  4KMU C;  2NVY B;  5C0X I;  1IYJ B;  1EYC A;  4DF7 A;  3T51 B;  3D8G A;  2R7Z G;  1HA6 A;  3LNN A;  4DR6 Q;  4NMZ A;  2QKI C;  2JN4 A;  2RVL A;  1R4P B;  3GP7 A;  2XTI A;  1MIU A;  2HDM A;  3D3R A;  5EKK A;  4MIU A;  5IYB G;  2IX3 A;  1XNQ Q;  4KKT A;  3F1Z A;  4B3S L;  4A3C G;  2X69 A;  4B9X A;  2G5D A;  3OMG A;  3HOU G;  4K6D A;  3TP8 A;  1YNN C;  4KI0 A;  4N8F A;  4BXX G;  4Z9C B;  3KK7 A;  4FDB A;  3CCE A;  2O5J C;  5DM7 3;  4C56 C;  1LT3 D;  4QCL A;  4QJF A;  3GDE A;  2FXQ A;  2IHE A;  1D5M C;  4DXG A;  1JIC A;  1HTP A;  5FLX c;  1FD7 D;  1XX8 A;  3BDC A;  2N78 A;  5BR8 L;  2JA5 G;  3G48 A;  3I56 A;  4JV5 L;  2NZH A;  4XXE A;  4DUY L;  1CQV A;  1PH3 A;  1DON A;  2OF1 A;  4GLV B;  2N88 A;  3S15 H;  1SYG A;  2C9O A;  4FVM A;  1IYU A;  1A2U A;  4XT1 B;  1HNX L;  3SXH A;  3P7J A;  1OXT A;  2BA1 A;  4X6A H;  3D6W A;  2YU9 B;  5IYC H;  3D0F A;  2Z6B A;  4J1M A;  2JE6 I;  2EQS A;  1YJ9 A;  4KY5 A;  2ID0 A;  3P75 A;  1X9N A;  2AQ2 B;  3U9O A;  4ME3 A;  3TDQ A;  2YU9 H;  2RSN A;  1Z47 A;  3I3C A;  4IUN A;  4K14 A;  5KNC A;  5M3M H;  5IYC G;  1S5E D;  4JK1 C;  3I72 A;  3EIV A;  2H5X A;  4WOR A;  4U67 3;  1I94 Q;  3MEF A;  2K5V A;  1XPU A;  4WRD A;  5CMD A;  4DKA C;  1VQ8 A;  4HN7 A;  2I46 A;  5KYL A;  3MTS A;  4UY8 C;  1HZC A;  2WAC A;  2A6E D;  5CR3 A;  3CRK C;  2JA5 B;  1HXY D;  1O7Z A;  2DNE A;  3EQL C;  4NXM Q;  4XT3 B;  1CM9 A;  3KF6 A;  5IOD A;  4DV5 Q;  4LF4 Q;  1EQT A;  2XRQ D;  4S3S A;  3BZK A;  2HIX A;  4KTA A;  2LFN A;  2A73 B;  4K2L A;  2JA7 G;  4AYB E;  3R2T A;  1LTI D;  3CC4 A;  5C44 G;  2KEE A;  3ZJY C;  3KLR A;  1VQE A;  2OCE A;  1EFW A;  3KDF B;  1F2L A;  1OO9 B;  2EYM A;  4ALP A;  3GQB A;  1WCM H;  4YWM A;  1CUK A;  1EYG A;  5CV7 A;  5F2D A;  4IFD I;  4YWK A;  3CHB D;  2JA7 H;  4MNO A;  4A4I A;  2F0G A;  1YI2 A;  1X55 A;  2L1B A;  1CKN B;  1S3O A;  2HIV A;  3X3N A;  1OTC A;  2ZTC A;  2EY6 A;  2Z1C A;  1QVC A;  4A3B B;  3EA6 A;  1BCP C;  3HKZ G;  3QB3 A;  4XTC S;  1T9H A;  2WKD A;  4B08 A;  4A3F G;  1JOR A;  3BG3 A;  4R4T A;  2OT2 A;  1EY4 A;  3O13 A;  4Q5V A;  1HRJ A;  3SE0 A;  3S2D B;  1BO0 A;  4KV6 A;  2AQ3 B;  2KHS A;  4DV0 Q;  2B3G A;  1I4H A;  1G8Z D;  5FLX E;  4X66 L;  4DV0 L;  2J7Z A;  3PUZ A;  3VR4 A;  1AFP A;  4C3H B;  1LM0 A;  1K8G A;  1CZG A;  4PNY A;  2K14 A;  3FDT A;  5FO8 B;  3FPP A;  2B2T C;  3RZO B;  4ZLT F;  2UXC L;  1ASZ A;  3KBG A;  2KJX A;  2HUG A;  2A19 A;  1TKW B;  1YVC A;  2E2H H;  3CQZ H;  3I4L A;  3OPO A;  3H91 A;  5IGB A;  1KNA A;  4MTN A;  1WCM B;  1RKN A;  3PUW A;  5JPM C;  2R93 H;  4B9W A;  2VY3 A;  3S1R H;  2HHH Q;  4KJN A;  5HGQ A;  2CQO A;  1VMP A;  1IBM L;  1KDC A;  2ATW A;  2XWJ B;  4B3M Q;  1TWF B;  3PO3 H;  1Y1V B;  2E2D C;  1Q8I A;  1ENA A;  1GUN A;  5J3B A;  4P72 A;  3T4A C;  2EYH A;  3UDI A;  4LW1 A;  4AH6 A;  3Q6S A;  1B53 A;  3KLS A;  3QWN A;  4C3J G;  3V05 A;  1FNV A;  4LF9 Q;  2AKW B;  4A3I G;  1QCB D;  5JJI A;  4E6I A;  1IW7 D;  4HMI A;  3CRL C;  1VCI A;  5EPK A;  3KYH C;  4K2K A;  1Z6H A;  3CQZ B;  5IE8 A;  2C35 B;  1A62 A;  1VQC A;  4KKU A;  3CPF A;  3KUP A;  1LTG D;  4DV3 L;  4G4K A;  3BS1 A;  1JWM D;  4DV4 L;  2GVA A;  3CCQ A;  2Y0S E;  4UP9 A;  4DV1 L;  1JB7 A;  4JI3 L;  2B8F A;  3CD6 A;  2ZTD A;  1AP0 A;  2FFK B;  4JI8 Q;  1I5F A;  2GVB A;  4IUP A;  5K36 G;  4QY7 A;  1SE3 A;  1WTX A;  3H0G H;  3T16 A;  2I5H A;  3MXP A;  2UU9 Q;  2SNM A;  2KCM A;  3J81 c;  4NXN L;  1EQV A;  4A3M G;  1YZ6 A;  4RMF A;  1PHJ A;  1YHQ A;  5M5Y B;  1FGU A;  1WTO A;  4WJ3 M;  1E24 A;  4DV6 L;  3U58 A;  4A93 H;  3SHL A;  4HIO A;  2WKC A;  2UUA Q;  4HID A;  3NQT A;  4HIM A;  4K5X A;  1OXV A;  3H0G B;  1O80 A;  3RZD B;  2BE5 C;  3U4V A;  2WFW A;  2EYL A;  2JYO A;  3GTK H;  4IOC A;  2L15 A;  1B9N A;  2CCZ A;  3GTJ B;  2JEB I;  1I6V C;  1ZKO A;  2GN5 A;  1O7Y A;  3VR2 A;  1U4R A;  1JOQ A;  3CME A;  4BY7 G;  4RKL A;  5DNF A;  3KF8 B;  2ZJR A;  1VQN A;  1KLU D;  2FIN B;  4FP5 D;  1YHA A;  1GKH A;  1FVI A;  1WTW A;  4FF1 A;  1I50 H;  4MHE A;  1QIL A;  1NUC A;  1O78 A;  3OW2 A;  1HCZ A;  4A3I B;  4KD3 A;  1EY5 A;  4A3G G;  1EQQ A;  4DAM A;  2N49 A;  3TEH B;  4DV2 L;  1N33 Q;  5CV6 A;  1E3P A;  4K8J A;  1PRT C;  1BCP D;  4JI4 Q;  3KLS X;  1LTR D;  1I50 B;  2PI2 E;  3W1B A;  5FK9 C;  2EY1 A;  2B2U A;  1YNJ D;  3K7A B;  4ZKC B;  5FLM G;  4DR4 L;  3CMA A;  5CBA E;  2VUM G;  1SNC A;  3IFD A;  3GTM B;  3U9S A;  3J80 i;  4AYB G;  3SR1 A;  1K73 C;  4DAV A;  1L1O C;  4OXP A;  2FHT A;  1STG A;  4ZAI A;  3X3M A;  4JW0 A;  4JI2 Q;  3I4M H;  4UDU C;  1YEZ A;  1Q1E A;  5I6Y A;  4A3B G;  1W6K A;  1XMQ Q;  2D9U A;  2JK8 A;  3OMC A;  3OIQ A;  1O7I A;  4C3J H;  3KJO A;  5EGT A;  2X6G A;  5BN4 A;  4LF6 L;  4C3H G;  4FF3 A;  1TS2 A;  3QOJ A;  1F9Q A;  4H0L C;  5JEA G;  4DV5 L;  1V1P A;  3K5L A;  4OEL B;  2EXD A;  2AWN A;  3G6J B;  1S4Z A;  1WD0 A;  2HCC A;  5IP7 H;  3T1Y L;  3NWT A;  4GNX C;  4EGV A;  2A68 C;  4CDE C;  5I9O A;  2UUC L;  3K7U C;  4OHJ A;  1LUZ A;  5ISR A;  2A6H D;  5H1S E;  1FL0 A;  5IYD H;  1DOL A;  3JAM E;  1IZ6 A;  2D0P A;  1DOM A;  1E2V A;  1DYQ A;  1WYD A;  2FMC A;  2R3Z A;  1ZYR D;  2NUC A;  1KDB A;  1VQM A;  1A8V A;  3EBE A;  1RCV D;  5IP7 G;  2XGT A;  4QIW E;  1N34 L;  2E2J B;  2I5L X;  2Y0S G;  4OIK A;  1L0X B;  2K75 A;  3UDX A;  2EJG C;  5JPN C;  1XMO Q;  2JQO A;  3CCV A;  4NB3 A;  5M9O A;  2CH4 A;  4A3D B;  3GTQ H;  3K5O A;  3HKZ E;  2OTL A;  1RDP D;  4WJW A;  2R7F A;  2PZT A;  4IPC A;  2PQE A;  1JT8 A;  1SLJ A;  2ZXR A;  1BBX C;  4MN3 A;  4A75 A;  4IZ8 A;  3I4N G;  2B29 A;  3CXC A;  4IFD H;  5TSS A;  4LUZ A;  1H9R A;  4HCE A;  4IFD J;  1V9P A;  1X56 A;  3PQI A;  4RKB A;  3HRZ C;  1TWC B;  1P16 A;  1SNM A;  2I07 B;  5GAG C;  3MXN B;  3L0O A;  1SMY D;  3PO2 H;  1KAB A;  3D4W A;  2ASB A;  1ESF A;  1UUP A;  4BY7 H;  3S1R B;  2G9H D;  4Y52 H;  2SEB D;  4A3E H;  3VR3 A;  3VA7 A;  4CKE A;  3E6Z X;  2XVS A;  1LYL A;  4GS3 A;  3G6E A;  1G51 A;  1I3Q H;  4P73 A;  2D2C C;  4PZ8 A;  4JBM A;  5I2Y A;  1T5E A;  4A3D H;  1Q1B A;  4A3G H;  1S5D D;  3W1G A;  4KY7 A;  1MSG A;  3GTG B;  1PH1 A;  5I9P A;  1TS3 A;  3D31 A;  3GTL H;  3A56 A;  3C3L A;  1K83 B;  4RA8 A;  2NVQ B;  1UE6 A;  2LY7 A;  1C4Q A;  4APV A;  2E2J H;  2B2V C;  4JI0 L;  1FR3 A;  5IGE A;  4R4C A;  4A3K B;  3MXG A;  1FGB D;  4BBS H;  1G91 A;  2MO0 A;  3J81 E;  1R9T B;  2Z0S A;  1NR4 A;  3K6O A;  5EPJ A;  1JJC B;  4PZ7 A;  1G2S A;  5C3E G;  1B70 B;  1KAA A;  4HSP A;  1DXM A;  3DEP A;  1SDF A;  2UU9 L;  2UUB L;  1XNR L;  1I6H H;  3L7Z C;  1DCZ A;  3PIO A;  1LAC A;  2B2W A;  3J81 j;  3H3V H;  1R4Q B;  5IP9 H;  3I4N B;  4ZUI A;  2TMP A;  4YY3 L;  4DV1 Q;  3JAM c;  1TVX A;  4DR1 Q;  1RTO A;  5C4Z A;  1HZB A;  1MHW C;  1Z9F A;  4P74 A;  2K28 A;  1PZI D;  2VUM H;  5J1Z A;  1JE5 A;  2ICE C;  2PNH A;  1U4M A;  3FKI H;  1TWH B;  2M00 A;  2DJG C;  4O0A A;  2QEJ C;  4FXG C;  5KYI A;  1VQG A;  4LFC L;  4RAU C;  3DWA A;  2AHO B;  1WTR A;  3T1H Q;  2EVB A;  1CSP A;  2JA8 G;  5EKI A;  1Y1W B;  4ZRZ A;  2A74 C;  3MWY W;  4FNF A;  5JJZ A;  3TZD A;  3R93 A;  3H15 A;  3GTM H;  5C4J B;  5FJ8 G;  3S1Q H;  4YWL A;  4HTH A;  2MGS A;  2F0U A;  3DHQ A;  3K7A H;  5ELD A;  3HOW B;  2EJF C;  3FMC A;  3E3X A;  2CHB D;  4LF7 L;  4K6L A;  3TS2 A;  5C0X H;  4IUU A;  1PH5 A;  3S17 H;  1B1Z A;  1VQH A;  3S2H H;  5IYB H;  2F0F A;  4P75 A;  1PFN A;  1E2Z A;  4EQN A;  4GOP B;  4IPG A;  1MJC A;  4DGZ A;  3U4Z A;  2KUM A;  4BBR B;  2NN6 G;  1HQM C;  3NEN A;  4YY3 Q;  1PDQ A;  3I8Z A;  2L9H A;  2NVY H;  1PFB A;  3A0J A;  1HUM A;  3K5N A;  3UDF A;  3TZU A;  2QA4 A;  1W2B A;  2XIW A;  5IGC A;  5EBD A;  1Y1W H;  4NPS A;  2F0M A;  1PH2 A;  3TRE A;  3ICE A;  3NTK A;  5C0X J;  2QDB A;  4JG2 A;  4JYA Q;  3NEM A;  1QE6 A;  1SE2 A;  3BYT B;  3H6M A;  1E22 A;  2K7V A;  3DMU A;  5A35 A;  4ID6 A;  1HUN A;  5LL6 S;  3MAQ A;  4AQY Q;  2KHI A;  4YHH L;  3D4D A;  2K5W A;  3PF5 A;  5C4J H;  2ZM6 L;  1BF4 A;  1H9J A;  4A3M H;  5M3M G;  1FNW A;  4YCW A;  5EAY A;  1A3U A;  3V2T A;  1QUQ A;  3RLO A;  5ELO A;  4KJO A;  4LWC A;  3I7F A;  1LAB A;  1JWU D;  2A5H A;  2RHS B;  4JI1 Q;  2R7D A;  4BY1 G;  5KIX A;  5KNB A;  1ET9 A;  1ESR A;  3PO2 G;  3I4M B;  4X3U A;  2FMM A;  5FO9 B;  3HOX H;  4LF6 Q;  3MXN A;  3KDF A;  2NVT B;  4AIM A;  1LLR D;  4DAY A;  4PG3 A;  4QF4 A;  2BDN A;  5COR A;  1AEX A;  4ULL A;  1SAP A;  1N36 L;  1BVS A;  2PW5 A;  2E8G A;  3LWE A;  4X3K A;  5E4W C;  4JYA L;  2Z8L A;  3HOV G;  4HJ5 A;  1BR9 A;  3Q24 A;  2F0N A;  4GOP A;  3TSS A;  2EY2 A;  1LTA D;  1VQ7 A;  2RDG A;  1HHV A;  4QMG A;  5EPL A;  3U50 C;  5M5X H;  4DR4 Q;  4U68 A;  1STB A;  1PFM A;  2KBN A;  3S15 B;  1B8A A;  1BQQ T;  2F4I A;  4OX9 Q;  4OGQ C;  2WIN B;  2PNR C;  3I55 A;  1HR0 L;  2YTV A;  1Q8K A;  4K0K Q;  4HAE A;  3MZ5 A;  2O5I C;  2IY5 B;  3AEV A;  4DNR B;  2NVX B;  1TY2 A;  2NVQ H;  2MUY A;  4JBW A;  3BYY B;  1IW7 C;  2L55 A;  2NVT H;  3E9H A;  5FJ8 H;  3LGJ A;  4A3J H;  2F0T A;  4ODG A;  2L5T A;  1HQR D;  3KBX A;  3HG9 A;  2PCF B;  1F9P A;  1HPC A;  1ICF B;  3Q23 A;  3I4M G;  4AYB B;  1SRO A;  3F8T A;  1OXS C;  1X3E A;  2YTY A;  1EQR A;  3OSO A;  1K0S A;  1SNP A;  3I2Z A;  4BY1 B;  3M3Y B;  4O42 A;  1VF7 A;  2UXB Q;  4K8I A;  3PIP 3;  2NB0 A;  5A2Q L;  4DR2 L;  4L5Q A;  1HZ9 A;  1I4P A;  2M9V A;  1SYF A;  1L1O A;  2IT1 A;  4DV3 Q;  1JE4 A;  5M3F G;  4X65 Q;  3IFT A;  2VB3 X;  2Q2T A;  2B39 A;  1GO3 E;  2DY8 A;  5LMU Q;  4X62 Q;  1BDO A;  2R93 G;  4C2M B;  4GKJ Q;  4A3C H;  5AFW A;  1SR3 A;  4IUT A;  2B2U C;  4BXX H;  3AMU A;  4IPD A;  2C5C A;  1V1O A;  4IUR A;  2PZU A;  4ABN A;  4NW2 A;  5GAH C;  4Y7N H;  3VDY A;  3GTQ B;  5M5W H;  5M3F H;  3C1E A;  4Q0F A;  1WTQ A;  2VQE Q;  1ENF A;  5ELN A;  5C5L A;  2B63 B;  4EQO A;  3OTO L;  1SYD A;  3AB9 A;  2F4V Q;  2R61 A;  3GD7 A;  4GLA C;  3G71 A;  3K5M A;  1ONL A;  5CYU A;  4LFA L;  1UE5 A;  1ICW A;  4CJ1 B;  3NP8 A;  1YNX A;  2JA7 B;  2SDF A;  2B2Y A;  4DXF A;  1WTP A;  1LV9 A;  2K1B A;  4PMB A;  3CKI B;  3DEO A;  4JI7 Q;  1QUQ B;  3CPW A;  4IN3 A;  4H44 C;  2JP1 A;  2CFM A;  4KHZ A;  3GV3 A;  3DWQ A;  4CJ2 C;  4HJ9 A;  3HOZ G;  4DV6 Q;  3I4N H;  1MSH A;  2PMZ E;  3D6C A;  2F0I A;  4EX5 A;  3SDZ A;  4LK1 C;  3FHW A;  1IHZ A;  1YIT A;  2JA6 H;  1J6Q A;  5EBC A;  1TWC H;  2PQA B;  1KDA A;  4CDD C;  5I6W A;  2R6G A;  2Z6K A;  2D0O A;  1VQD A;  3GTG H;  2MFI A;  2CW0 D;  5IT9 L;  2QDL A;  1QWY A;  4A76 A;  1VMC A;  3MHB A;  2VQF L;  2PW7 A;  4I7Z C;  1XTC D;  4B3M L;  1B3Q A;  1PH7 A;  3WOE A;  1C48 A;  3S1M B;  5LMN L;  4UPA A;  1KTK A;  3NEL A;  1XPR A;  2VNU D;  2JSO A;  3EFX D;  2LKV A;  3SK5 A;  3A55 A;  3STB C;  4EVO A;  4ZYS A;  2KOL A;  3BVM A;  2HQL A;  3A8J E;  5C3E B;  3FP9 A;  4GKK Q;  2QW7 A;  1STH A;  5EKL A;  1NSN S;  2IWH A;  4CBV A;  4FO2 A;  4GLX A;  4C1N I;  3L9A X;  2UUB Q;  1ILQ A;  2F3V A;  1EOT A;  1WVL A;  3J80 E;  4C3I G;  1HR0 W;  2K04 A;  3OWE B;  1G29 1;  2SNS A;  4OO1 H;  2RDH A;  4JI4 L;  1GHK A;  2NZO A;  1HNW L;  4PMW A;  1K28 A;  1JB3 A;  5I2X A;  2F0O A;  1Y1V G;  3I90 A;  2CVR A;  1XJV A;  1L0Y B;  4N9P A;  3ERS X;  2F0L A;  1Q81 C;  3RD4 A;  1EIF A;  1DJR D;  1II3 A;  2BA0 A;  4WFN 3;  2Z6K C;  1SFO B;  1A15 A;  1E2W A;  3GTJ H;  1I4G A;  1EY8 A;  2VL6 A;  1I3Q B;  4DR5 L;  1N32 Q;  2EYP A;  3SK8 A;  5ELC A;  1CT1 D;  5FLX L;  5M5W B;  1PA6 A;  3E0E A;  3CC2 A;  4LF8 L;  2A8V A;  2Q8R E;  1O7L A;  1PFS A;  3ERQ A;  4LUO A;  1VQ6 A;  3PUV A;  4A3M B;  2EJM A;  2VXW A;  4BA1 I;  4YHH Q;  1QG7 A;  2BH8 A;  1P8L A;  3NPP A;  4UP7 A;  1IYV A;  4KN7 C;  5JVH 3;  2BCO A;  1VQJ A;  3PSI A;  1CA6 A;  3RZD H;  1CTM A;  2B2V A;  4IPH A;  3F2U A;  3FRP B;  1EY9 A;  2DUD A;  1VQK A;  3PO3 B;  3P20 A;  2KCC A;  4K5V A;  3RLN A;  5GQO A;  2SOB A;  4LF4 L;  5M5Y H;  4WJ4 A;  3PMF A;  3CCS A;  1CI3 M;  1D7Q A;  3T1Y Q;  2EZV A;  4KHP L;  4HED A;  1NE3 A;  3UE0 A;  1K8A C;  4HMJ A;  5FOB B;  1PTO D;  1K8O A;  3H09 A;  3HOU B;  2MJ8 A;  2RQX A;  3HGB A;  1EEF D;  2R7Z H;  3T13 A;  1H9M A;  2WB1 B;  4X64 Q;  2XN9 C;  2F3W A;  4DUY Q;  3S16 H;  2I0Q A;  2B2Y C;  4BBR G;  1SE4 A;  2R7Z B;  2D5D A;  2RCN A;  5EJW A;  4RGM A;  4FF4 A;  3MVV A;  4LFB Q;  3HOX B;  3HOU H;  5IYD G;  3F2C A;  1BOS A;  2KA7 A;  1NAP A;  2UUA L;  4IOA A;  2VB2 X;  5JJK A;  1IXR A;  2K03 A;  5IT9 c;  4JPB W;  3GTP B;  1F77 A;  2ZJP A;  4NXM L;  4GZY C;  4F88 A;  5BN3 A;  5JEA J;  5IIF A;  5KEE A;  1L2F A;  3J7Z C;  1SYE A;  3I91 A;  4K5W A;  2VQE L;  2KCN A;  2KED A;  4RWS C;  4XQQ A;  3CCM A;  3M7N A;  1PMR A;  1UEB A;  4CKC A;  4LAA A;  1SYB A;  2R92 B;  3DM3 A;  4FXK C;  1SXT A;  3OYY A;  2K05 A;  3E0J A;  2XSC A;  3I73 A;  1A0I A;  1UE7 A;  1F9S A;  4CDF C;  4X65 L;  4DV4 Q;  4C3J B;  2JA6 G;  4L6T B;  1SSO A;  1VQO A;  1EL0 A;  2IW3 A;  3OIP A;  3UDG A;  2WB1 G;  4JCV E;  4DUZ L;  2AUK A;  3P1H A;  2F0S A;  4X64 L;  2RA4 A;  4XIG S;  2NVX H;  1KRS A;  1SN8 A;  2WB1 E;  4LF5 L;  3NHH A;  2EPB A;  5IT9 E;  1VQI A;  3GTO B;  1IKM A;  5JAV A;  4DR5 Q;  1D1I A;  2F0P A;  2HDL A;  3ND8 A;  4KD4 A;  5DEH A;  1C0A A;  1DOK A;  1QB5 D;  1MJE A;  1U5K A;  5C44 B;  3KF8 A;  3KLW A;  1ET6 A;  1D5Z C;  3NUC A;  4GOP C;  2UXD Q;  1KAW A;  3ITP A;  4KY6 A;  2UXD L;  5M5X B;  4A93 G;  1RD9 D;  4QIW B;  1V8Q A;  3HOW G;  3IL8 A;  3NTH A;  3MFG A;  3D4R A;  3BDL A;  4A3K H;  4BBS B;  4JI1 L;  3E9I A;  1J5E L; 
#chains in the Genus database with same CATH homology
 4LFA Q;  1S3O A;  2HIV A;  3PGZ A;  1KXL A;  1IBK Q;  2ZTC A;  4R4Q A;  3UDF A;  1OTC A;  1QVC A;  2QA4 A;  1W2B A;  1SFO H;  2JA5 H;  3HKZ G;  4B3S Q;  3RLF A;  1K0R A;  4OWT B;  4XTC S;  1T9H A;  2MO1 A;  1Y1W H;  4NPS A;  1YJW A;  5C3E H;  4A3F G;  1IBL Q;  1PH2 A;  4DR6 L;  2UU9 Q;  2K5N A;  3TRE A;  1EWI A;  3CCU A;  4R4T A;  3TRZ A;  3ICE A;  5C0X J;  4L5R C;  1U0L A;  4RG1 A;  1VQF A;  4HJA A;  1LTL A;  4JG2 A;  4JYA Q;  3NEM A;  4JV5 Q;  2CWP A;  3I4O A;  1N34 Q;  4DR3 Q;  2PQA A;  1V1Q A;  1E22 A;  2OTJ A;  1M90 C;  3PF4 A;  4DV0 Q;  2B3G A;  4BA2 I;  4JI0 Q;  2PI2 A;  4X66 L;  3NBH B;  3PUZ A;  4DV0 L;  1AE3 A;  2OQK A;  3UE1 A;  4AQY Q;  2KHI A;  1MKH A;  4YHH L;  1LM0 A;  1K8G A;  4OO1 I;  4DR1 L;  2K14 A;  3PF5 A;  5C4J H;  1C9O A;  2ZM6 L;  4DV7 Q;  4A3M H;  5M3M G;  2K52 A;  4LF7 Q;  1G6P A;  2UXC L;  4YCW A;  1PH8 A;  5EAY A;  1ASZ A;  3PUY A;  2MQH A;  2A19 A;  1K9M C;  3B6Y A;  3M3Y H;  3CCL A;  1YVC A;  1QUQ A;  3RLO A;  2E2H H;  3CQZ H;  4JI6 L;  2RHQ B;  5ELO A;  1XNR Q;  3J7A 5;  4LWC A;  3I7F A;  4MTN A;  2RHS B;  4JI1 Q;  2R7D A;  4LF5 Q;  4BY1 G;  3PO2 G;  1WOC A;  1TXY A;  3PUW A;  2R93 H;  2VY3 A;  3S1R H;  1N33 L;  2HHH Q;  3HOV H;  5HGQ A;  2CQO A;  3HOX H;  1R9T H;  3KFU A;  1FJG Q;  4LF6 Q;  4A3E G;  4UP8 A;  1X54 A;  3KDF A;  4AIM A;  3L2P A;  1I94 L;  4PG3 A;  1IBM L;  2ATW A;  3K8A A;  4X62 L;  4B3M Q;  2VZA A;  4HIK A;  3PO3 H;  3CAM A;  1N36 L;  2HT1 A;  1BVS A;  4BY1 H;  1XMQ L;  2E8G A;  4A3L G;  5J3B A;  4P72 A;  1PH6 A;  2HHH L;  4JYA L;  4A3B H;  1GD7 A;  3UDI A;  1EIY B;  4LW1 A;  4HJ5 A;  2B63 H;  3HOV G;  3HOX G;  2KHJ A;  4AH6 A;  3RN5 A;  1IBL L;  2ZJQ A;  4GOP A;  3PV0 A;  1BBU A;  2E5L Q;  1DGS A;  1VQ7 A;  4LF9 Q;  2AKW B;  4A3I G;  2LXJ A;  1YBY A;  1CKM A;  2YTX A;  5JJI A;  4B3T L;  3SGI A;  3TQY A;  2IX0 A;  4IJL A;  3U50 C;  4BBR H;  5M5X H;  3OTO Q;  1Q46 A;  4DR4 Q;  4A3L H;  1VCI A;  2KBN A;  3AQQ A;  3GTP H;  1SMX A;  1B8A A;  1NJI C;  3KYH C;  1KD1 C;  4OX9 Q;  1VQL A;  1UE1 A;  1E7Z A;  4OWW B;  3I55 A;  1NMG A;  1IBK L;  1HR0 L;  3RNU A;  1YHB A;  2YTV A;  5IE8 A;  1Q8K A;  4K0K Q;  2C35 B;  4JI3 Q;  4GN5 A;  1A62 A;  1VQC A;  4GN3 B;  5BR8 Q;  3CPF A;  4L5S A;  3ER0 A;  2JA8 H;  4DV3 L;  3M4O H;  1QVF A;  1Q12 A;  2IY5 B;  1KRT A;  3AEV A;  3HOZ H;  1HNX Q;  3KF6 B;  5AJ3 L;  3M9B A;  2NVQ H;  1S40 A;  4DV4 L;  2GVA A;  4JBW A;  4KLK A;  3CCQ A;  2Y0S E;  4UP9 A;  4DV1 L;  2NVT H;  1JB7 A;  4JI3 L;  3AFQ A;  3E9H A;  3K0X A;  5FJ8 H;  2D62 A;  3LGJ A;  4A3J H;  3CD6 A;  4IFD G;  2ZTD A;  3CP0 A;  5JJL A;  4JOI C;  4R1J A;  4JI8 Q;  1I5F A;  2GVB A;  1QVG A;  4QY7 A;  5K36 G;  2UXB L;  3ULJ A;  3PIP A;  1CKO A;  3H0G H;  1PVO A;  3BJU A;  3I4M G;  1SRO A;  3F8T A;  1OXS C;  1X3E A;  2AWO A;  2I5H A;  1EQR A;  2YTY A;  3A74 A;  2KCM A;  3M4Q A;  1L1O B;  4NXN L;  3J81 c;  3F2D A;  1YI2 A;  4LF9 L;  3I2Z A;  4A3M G;  1YZ6 A;  4RMF A;  4A3J G;  4PZ6 A;  3BZC A;  1PHJ A;  1VQ5 A;  1YHQ A;  5GRO A;  3GO5 A;  1FGU A;  2UXB Q;  3DLL A;  4WJ3 M;  1E24 A;  1X65 A;  4DV6 L;  3U58 A;  4DR2 L;  4A93 H;  2LSS A;  1HZ9 A;  4L5Q A;  4HIO A;  1GVP A;  2UUA Q;  5IWA Q;  5LMN W;  4HID A;  2MNA A;  4DV2 Q;  1L1O A;  1VS0 A;  2IT1 A;  4DV3 Q;  5M3F G;  4HIM A;  4X65 Q;  1OXV A;  1VQP A;  2Q2T A;  1B7Y B;  3U4V A;  4HJ7 A;  1VQ4 A;  1GO3 E;  1RIP A;  2JA9 A;  4JOI A;  4X62 Q;  5LMU Q;  4A3D G;  2WFW A;  2R93 G;  1JMC A;  4GKJ Q;  4A3C H;  3GTK H;  1SR3 A;  4IOC A;  1PV4 A;  2L15 A;  4JI2 L;  4LNQ A;  4BXX H;  5E7N A;  4MZ9 A;  2K4K A;  4IPD A;  1HNZ L;  1PH4 A;  2YYZ A;  5GAH C;  3S24 A;  4Y7N H;  3VDY A;  2CCZ A;  1PYB A;  4C2M H;  2JEB I;  5M5W H;  3CCR A;  5M3F H;  3ULP A;  3PO3 G;  3RZO H;  2GN5 A;  1W3S A;  5GAE C;  2VQE Q;  3JAM i;  5ELN A;  3CME A;  2Q2I A;  4BY7 G;  3KF8 B;  3OTO L;  2ZJR A;  1Q86 C;  1VQN A;  2B63 G;  2F4V Q;  3GD7 A;  3KOJ A;  4GLA C;  3G71 A;  4J15 A;  4JI8 L;  1HJP A;  1WCM G;  4JC0 A;  4LFA L;  1YHA A;  5DLQ E;  1GKH A;  1FVI A;  1UE5 A;  2F3I A;  1I50 H;  1YNX A;  3HFZ B;  3PUX A;  3S1N H;  3OW2 A;  4TQU S;  3BU2 A;  4JI7 Q;  3S14 H;  4A3G G;  1QUQ B;  3CPW A;  1EQQ A;  4DAM A;  2N49 A;  3TEH B;  1EOV A;  1SRU A;  4DV2 L;  2YV5 A;  4GKJ L;  2ES2 A;  1N33 Q;  3S2D H;  2CFM A;  3A5Z B;  1E3P A;  1HR0 Q;  4KHZ A;  3KJP A;  4JI4 Q;  2IX1 A;  1IL2 A;  2R92 H;  2PI2 E;  4HJ9 A;  3W1B A;  3HOZ G;  4GNX B;  2N8N A;  5FLM G;  4DV6 Q;  3I4N H;  4DR4 L;  2EIF A;  3J80 c;  3STB D;  2PMZ E;  4P71 A;  3CMA A;  4EX5 A;  3M85 A;  4DR7 Q;  2VUM G;  1HZA A;  1X6O A;  3FHW A;  1YIT A;  2JA6 H;  4DPG A;  1J6Q A;  1N32 L;  4DR7 L;  1PYS B;  3J80 i;  1TWC H;  2PQA B;  4AYB G;  3ULL A;  1K73 C;  2QGQ A;  1M1K C;  2R6G A;  1L1O C;  2WP8 J;  2Z6K A;  2D0O A;  1VQD A;  4OXP A;  2E2I H;  3GTG H;  2UXC Q;  2MFI A;  1J5E Q;  4KHP Q;  1NTG A;  3H0G G;  3I4M H;  4JI2 Q;  4DV7 L;  3RR5 A;  3HOY G;  1YEZ A;  1A63 A;  5C4X G;  1Q1E A;  4A76 A;  1RL2 A;  2VQF L;  4A3B G;  5AJ3 Q;  4B3M L;  4O2D A;  1PH7 A;  2BH2 A;  1XMQ Q;  2JK8 A;  5LMN L;  1XTD A;  4UPA A;  1O7I A;  1X3F A;  3NEL A;  4C3J H;  3A5U A;  3KJO A;  1XPR A;  4JI5 Q;  2VNU D;  4A3I H;  2VQF Q;  3F2B A;  4DR2 Q;  1KHI A;  5C0X G;  4LF6 L;  3STB C;  4QGU A;  1KL9 A;  2HQL A;  4C3I H;  5C4X H;  5JEA G;  4DV5 L;  4DNI A;  2OQ0 A;  1XNQ L;  3FP9 A;  2KCT A;  1WFQ A;  4GKK Q;  4NXN Q;  2EXD A;  2AWN A;  3GTO H;  3JC6 6;  2K5H A;  4GLX A;  1Y1V H;  5IP7 H;  2UUB Q;  5HY6 A;  3T1Y L;  4GNX C;  2N3S A;  4GKK L;  4GNX A;  2UUC L;  1HR0 W;  3K7U C;  1LUZ A;  1G29 1;  4LFC Q;  2DGY A;  1L0W A;  1TWH H;  4JI5 L;  5H1S E;  1FL0 A;  1TWG H;  1XPO A;  2ZM6 Q;  4X66 Q;  4JI4 L;  2JEA I;  1IZ6 A;  2D0P A;  2NZO A;  1QZG A;  3W5O A;  1HNW L;  1QZH A;  3Q8D A;  4PMW A;  1WYD A;  1OXU A;  1VQM A;  1A8V A;  3EBE A;  1Y1V G;  5IP7 G;  1Y1W G;  5LMN Q;  4DK3 C;  2XGT A;  4L5T A;  4QIW E;  1XJV A;  2WAQ E;  1N34 L;  1FJG L;  2Q2H A;  2I5L X;  2Y0S G;  3TS0 A;  3ERS X;  3PCO B;  1VQ9 A;  2K75 A;  1PH9 A;  1Q81 C;  1N8R C;  3UDX A;  3M4P A;  4EQ5 A;  1EIF A;  4B3R L;  1HNW Q;  2UUC Q;  1E1T A;  1BBW A;  2BA0 A;  1XMO Q;  2WAQ G;  2JQO A;  2Z6K C;  3CCV A;  5IP9 G;  4NB3 A;  4LF8 Q;  3H3V I;  2CKZ B;  3GTJ H;  3GTQ H;  4HJ8 A;  1ASY A;  1VQA A;  3HKZ E;  2OTL A;  4DK6 C;  2AMC B;  4B3T Q;  2R7F A;  2VL6 A;  4IPC A;  4DR5 L;  2RF4 A;  1N32 Q;  1JT8 A;  4R4O A;  1AE2 A;  2JJQ A;  1SLJ A;  4DAY B;  2F52 A;  3T1H L;  3WWV A;  3CC7 A;  1D8L A;  3E0E A;  1PA6 A;  3CC2 A;  4LF8 L;  2A8V A;  4QL5 A;  4A75 A;  3I4N G;  1K3R A;  1PFS A;  1WJJ A;  4LUO A;  1VQ6 A;  4B3R Q;  3PUV A;  2B29 A;  3K80 C;  4LUV A;  4BA1 I;  3CXC A;  4JBK A;  4YHH Q;  5IYD H;  2BH8 A;  2CWA A;  1P8L A;  4H02 A;  4LUZ A;  4UP7 A;  1K83 H;  3EN2 A;  1VQJ A;  4IFD J;  3PSI A;  4QQB X;  1V9P A;  4LFB L;  1OXX K;  1X56 A;  2KEN A;  3RZD H;  2ALY B;  4IPH A;  5IY0 A;  4JI7 L;  3AYH B;  1P16 A;  5GAG C;  1SE8 A;  2DUD A;  1YJN A;  3MXN B;  1VQK A;  1C7Y A;  3CCJ A;  3L0O A;  3HOY H;  3PO2 H;  4IJH A;  2ASB A;  3RLN A;  2QEX A;  5GQO A;  5IWA L;  4BY7 H;  1CKN A;  1IYJ B;  5M5Y H;  5C0X I;  4LF4 L;  3S1M H;  4WJ4 A;  1Q7Y C;  1JJG A;  2R7Z G;  3CCS A;  4Y52 H;  4A3E H;  4DR6 Q;  1D7Q A;  4R4I A;  3T1Y Q;  4KHP L;  1LYL A;  1UWV A;  1Q82 C;  4IO9 A;  4GS3 A;  1NE3 A;  3UE0 A;  1G51 A;  1I3Q H;  4P73 A;  3G6E A;  1K8A C;  2XTI A;  4PZ8 A;  2VS1 A;  4JBM A;  2F4V L;  1MIU A;  5IYB G;  4A3D H;  1XNQ Q;  5C44 H;  3F1Z A;  1HNZ Q;  1Q1B A;  4YCU A;  2I5M X;  4B3S L;  4A3G H;  1NMF A;  4A3C G;  2Q2U A;  3W1G A;  1BKB A;  3HOU G;  2A1A A;  2R7Z H;  1PH1 A;  3D31 A;  4KI0 A;  3GTL H;  4BXX G;  4FDB A;  3HOW H;  3CCE A;  2NN6 I;  4X64 Q;  4AQY L;  4DUY Q;  1UE6 A;  2E2J H;  4APV A;  4DUZ Q;  3S16 H;  4QJF A;  4A3K G;  2I0Q A;  4JI0 L;  3GDE A;  1N36 Q;  2FXQ A;  4BBR G;  2IHE A;  4R4C A;  2RCN A;  4BBS H;  1TWF H;  1IBM Q;  4OON A;  5FLX c;  4LFB Q;  2MO0 A;  4OO1 G;  5BR8 L;  2N78 A;  3HOU H;  2JA5 G;  2Z0S A;  3G48 A;  5IYD G;  3I56 A;  2NZH A;  3F2C A;  4JV5 L;  4DUY L;  4OWX B;  1H95 A;  1JJC B;  4PZ7 A;  4IOA A;  1PH3 A;  2UUA L;  5JJK A;  5C3E G;  1IXR A;  1B70 B;  3CW2 C;  4A3F H;  5IT9 c;  4GLV B;  2K50 A;  3S15 H;  2VW9 A;  1HNX L;  3K81 C;  2UU9 L;  2ZJP A;  4NXM L;  1OXT A;  2UUB L;  1X3G A;  1XNR L;  4BBS G;  1I6H H;  2BA1 A;  3L7Z C;  2V1C C;  3PIO A;  4X6A H;  5JEA J;  3RN2 A;  5IYC H;  1L2F A;  3D0F A;  1TWA H;  3J81 j;  3H3V H;  2LXK A;  5IP9 H;  1NY4 A;  3J7Z C;  2JE6 I;  2EQS A;  2VQE L;  3CCM A;  1YJ9 A;  1S72 A;  4YY3 L;  2E5L L;  3M7N A;  1HH2 P;  2ID0 A;  1XMO L;  1UEB A;  4POF A;  4DV1 Q;  3JAM c;  4DR1 Q;  3DM3 A;  1X9N A;  2R92 G;  4ME3 A;  2YU9 H;  1HZB A;  1Z9F A;  1Z47 A;  1WI5 A;  3OYY A;  5FLM H;  4P74 A;  4C3H H;  2OWO A;  1CSQ A;  1A0I A;  1UE7 A;  5M3M H;  4X65 L;  4DV4 Q;  5GAD C;  5IYC G;  1YIJ A;  2VUM H;  1E1O A;  1JE5 A;  2PNH A;  2JA6 G;  4YCV A;  1VQO A;  2IHF A;  2H5X A;  3EIV A;  3FKI H;  1I94 Q;  1V43 A;  3MEF A;  2K5V A;  1XPU A;  4O0A A;  3UDG A;  2WB1 G;  3CF5 A;  4JCV E;  4DUZ L;  4OX9 L;  4DKA C;  1VQG A;  1VQ8 A;  4K0K L;  1EUJ A;  4LFC L;  4X64 L;  2AHO B;  3J81 i;  3T1H Q;  4UY8 C;  1CSP A;  2JA8 G;  4XIG S;  2NVX H;  1KRS A;  1SN8 A;  1HZC A;  2WB1 E;  4LF5 L;  3H15 A;  3GTM H;  1VQB A;  1N9W A;  1VQI A;  5FJ8 G;  3S1Q H;  4JBJ A;  4JI6 Q;  3FKI G;  4YWL A;  3AFP A;  4DR5 Q;  4NXM Q;  3G4S A;  3K7A H;  1C0A A;  3KF6 A;  3IRB A;  1NBW A;  4DV5 Q;  4LF4 Q;  4LF7 L;  3TS2 A;  3BZK A;  2HIX A;  1PH5 A;  1MJE A;  3S17 H;  1U5K A;  1VQH A;  2JA7 G;  4AYB E;  1Y14 B;  3S2H H;  5IYB H;  3KLW A;  3CC4 A;  4P75 A;  1KC8 C;  5C44 G;  1AH9 A;  5LMU L;  4GOP C;  3ZJY C;  2UXD Q;  4GOP B;  1VQE A;  2OCE A;  4TVA B;  4IPG A;  1MJC A;  1EFW A;  1KAW A;  3KDF B;  1KQS A;  2UXD L;  3U4Z A;  4ALP A;  4POG A;  2NN6 G;  4A93 G;  3NEN A;  1WCM H;  4YWM A;  1KIX A;  1CUK A;  4YY3 Q;  4GN4 B;  1GM5 A;  1EYG A;  3HOW G;  4DR3 L;  4IFD I;  4YWK A;  2ZTE A;  2NVY H;  4A3K H;  2JA7 H;  4MNO A;  4A4I A;  3A0J A;  4JI1 L;  3E9I A;  1X55 A;  1JJ2 A;  3HKS A;  1J5E L;  1CKN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...