1EQTA

Met-rantes
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
GYSSDTTPCCFAYIARPMPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of MET-RANTES: Comparison with Native RANTES and AOP-RANTES
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords T-CELL SPECIFIC RANTES PROTEIN
total genus 13
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eqtA00
5JJZA 1JICA 2B2WA 2EE1A 4X3SA 1WD1A 2SDFA 1EIGA 1PDQA 4R9WA 1ZXTA 2B2UC 3MTSA 4RAUC 1NR2A 4XDXA 2K28A 1X32A 2N88A 2B2TC 4ZK9B 2HDLA 1AZPA 1EL0A 1EQTA 2L9HA 1RTNA 1DOMA 4XT3B 4R8IA 5CORA 1M8AA 4U68A 2Q8TA 1B4OA 1O80A 4IURA 1WTXA 1HHVA 1X3QA 1XX8A 2N55A 2RSNA 2NWGA 1CA5A 5T1IA 1MSGA 1X3PA 3D6WA 2DY8A 1QNKA 2VXWA 1G91A 2B2VA 2DY7A 2EOTA 1EOTA 2JP1A 2K01A 1WTWA 1DZ1A 4HEDA 1U4MA 1ICWA 1QG7A 1DOKA 1NR4A 2FINB 3FDTA 1VMPA 1MI2A 1Q3LA 1U4LA 3N52A 2HCIA 1KNAA 1BF4A 1RODA 1VMCA 3DM1A 4ZKCB 1SSOA 1F9PA 2KEDA 2L1BA 1B2TA 1ML0D 2K1BA 2L4NA 3I3CA 1AP0A 3MWYW 2EPBA 5EKIA 1F2LA 3GV3A 4UAIA 5T1GA 3Q6SA 5D65A 5CBAE 3LWEA 1HFGA 1RTOA 1HUMA 1HRJA 2NZ1D 2CVRA 1S4ZA 4ZLTF 2BDNA 1U4RA 2HCCA 3IL8A 5EPLA 1B53A 4RA8A 2X6LA 1PFBA 4O42A 1SDFA 2RSOA 1LV9A 2X6GA 1B50A 4CJ0B 1G6ZA 2KUMA 2J7ZA 2L11A 2XIWA 5E4XA 5EJWA 1WTVA 2X69A 2B2TA 1TVXA 1WVLA 1GUWA 1HA6A 5EPJA 1G2TA 2K04A 2RA4A 4MHEA 5CMDA 5D14A 2RVLA 3R93A 4MN3A 5COYA 1BNZA 1JE4A 4X3UA 2NYZD 2B2WC 4IUVA 3I91A 1HUNA 2KVMA 1WTPA 1WD0A 5EQ0A 1CM9A 1F9RA 4RWSC 2FJ2A 2B2YC 2FHTA 2FFKB 1SAPA 1IKMA 4QUCA 3H91A 2MJ8A 2B2VC 2D9UA 5AFWA 3SVMA 2H1EA 4IUPA 1RHPA 5DNFA 2MP1A 2MGSA 3FPUB 1EIHA 3ONAB 4IUQA 1F9SA 4NW2A 1BBXC 1J8IA 3GV6A 1G2SA 1BO0A 1NCVA 2KECA 4ZKBB 1IKLA 1O7YA 2JYOA 1HFNA 1WTQA 4LMQD 4HSVA 4ZAIA 1ILQA 3TN2A 3KUPA 5E4WC 2KEEA 2B2UA 3QO2A 3IFDA 1WTRA 4IUUA 1RJTA 1PFNA 2K05A 1A15A 1U4PA 3DEOA 2K03A 4HAEA 4HCSA 5EPKA 3I90A 2R3ZA 1PFMA 3G7LA 1F9QA 1NAPA 3F2UA 4DN4M 1XYIA 1DOLA 2IL8A 2L12A 3TZDA 2FMMA 1ESRA 4CJ2C 4CJ1B 1DONA 5CBEE 2HUGA 2MPMA 3UI2A 2M2LA 1B3AA 3KBXA 3DEPA 2HDMA 1KNEA 2Q8RE 1O7ZA 1IL8A 1E0BA 2KOLA 3HP3A 1C8CA 1CA6A 1J9OA 4IUTA 1AZQA 3I8ZA 4OIJA 4XT1B 4QUFA 4X3KA 1MGSA 1QE6A 4X3TA 1PLFA 4OIKA 1WTOA 1ILPA 2B2YA 3P7JA 1MSHA
chains in the Genus database with same CATH superfamily
2EE1A 3HFZB 4BBSB 4A3IH 2QGQA 1TY2A 4YY3Q 4YCWA 2UUAL 1YHBA 2R92G 5FJ8G 4PMCA 2J0TD 4XT3B 1YIJA 4A3DG 1B4OA 4LF6L 4JI4L 1TWFH 3S14B 5JJIA 2NWGA 5T1IA 1X3PA 4MZ9A 1EU4A 5K5PA 4TKOB 4LF4L 3J7A5 3VR4A 3NELA 1U4MA 5FLMH 3TZUA 3EQLC 1XNRL 3I4LA 4A3KB 2Y0SG 2JA5G 3KBGA 2DN8A 1VMCA 2KCTA 2JA6B 1TKWB 2EY6A 5LMNQ 4DR7L 1H9SA 2K75A 4EQOA 3OSOA 5JAVA 1UE1A 5T1GA 5BN4A 4RGTA 1JB7A 3J7AF 3PO2G 2HIXA 4RKBA 3PUWA 1DXMA 3V96A 1MJEA 3EVQA 2AKWB 3C2PA 1SROA 1CI3M 1U4RA 4CKEA 1Y1WH 3MXNA 5A2QE 1D1KA 3EFXD 1HCZA 4PQXA 4JI7Q 2Z1CA 2NB0A 5KIXA 2D62A 4GLXA 1B9MA 5E4XA 2XRQD 1IBKL 2VB2X 1G2TA 1Y8NB 1E22A 3FPPA 4OWXB 3T53B 4KHVA 4DR2Q 2UU9Q 3NWTA 4X64L 5C6AA 4KHZA 4L5RC 1V43A 1IW7C 4PZ7A 4YHHQ 1S40A 4HJ5A 1XMOQ 1J5EL 5GAEC 3D3RA 3RD4A 2HIVA 1J6QA 2YU9B 4HMIA 2KCCA 1F9SA 1NNXA 4NW2A 1GD7A 1BO0A 1AE2A 1IKLA 3KJPA 2OF1A 1WTQA 1U5KA 3H09A 1SYCA 3FKIG 3S1QH 1CHQD 1PFNA 3LWUA 2K03A 1B3QA 4C3IB 1IW7D 2IX0A 3MXUA 3K5NA 5F2DA 1I6HH 3L3OC 1DONA 3KBXA 3OW7A 4IOCA 1YNJD 2EYJA 4JI8L 1IHZA 2IHEA 2UUBL 1I4RA 1BCPF 4XT1B 5CV5A 2JA8H 3RR5A 5BR8Q 1N33Q 1VQFA 3DMUA 1JICA 3GTOB 1SMXA 2D0OA 3RZDH 1RKNA 3QIAA 1TWCH 1EL0A 2HDLA 2L9HA 1UE6A 1TY0A 5C4XH 1K0SA 3M9BA 3DWPA 3A7LA 5C3EH 2VW9A 3J81i 3T4AC 1W6JA 1K8MA 2VB3X 3F2CA 2K52A 4FF3A 3GTPH 2MQHA 4GKKL 4FYDA 1LT6D 3TDQA 2AQ1B 2Z8LA 3I4MH 4K5VA 5GQOA 5FO7B 3STBC 2KCMA 3G48A 1PXUA 3DWQA 1KAWA 1I6VC 3G6JB 2QEXA 4X65L 1FR3A 3BZDB 3K7UC 3IL8A 1EY7A 2WIIB 2B63B 4BBRH 1XMOL 1G291 2LXKA 1LTGD 1PTOD 4J8QA 1PZJD 5FJ8H 2EYFA 5EPJA 2ASBA 3P75A 1OTCA 2Z4IA 2OWOA 2GN5A 1WTHA 4X65Q 1BVSA 3R3OA 1WD0A 5E1FA 5C44G 3AQQA 4ZQ3A 5LMUQ 1Q81C 3H91A 3UDGA 3A5UA 4HJAA 1IBLL 5HURA 4Y52H 1HQRD 2D9UA 5ELFA 3X3MA 1RHPA 2XRSD 2E5LQ 4YHHL 1J5EQ 1HR0L 4GKKQ 1HFNA 1UAPA 4WRDA 3A54A 4RHSA 5E4WC 5J39A 3RNUA 3TP5A 1AH9A 2CW0C 3I4NH 3K7AH 4HAEA 1ENCA 2R3ZA 5IWAL 4DN4M 4LK1C 1SNQA 2IL8A 2JEBI 1IBMQ 4G4KA 3O13A 2D0PA 3ER0A 1Q90A 2V1CC 3FEWX 4K2KA 4DFAA 4LF7Q 2VL6A 1LT3D 2B39A 3S2HB 2A68D 1I4GA 3URYA 4CHTB 5EAYA 3BVZA 1ZXTA 3P20A 1LT5D 3ND9A 4ME3A 1QVGA 4BY1B 1L1OB 1SYFA 2ID0A 2F0IA 1JCKB 2I07B 3RLNA 5KGUA 3T56B 2CHBD 3K7AB 2C5CA 3PO3G 3S1RH 1DOKA 4PNYA 2PQEA 3G71A 1QUQB 4DNTB 4LF9Q 2CFMA 3MFGA 3GV3A 3VR5A 1PH7A 1YI2A 4IFDJ 3Q6SA 3PUZA 5C0XI 4K6DA 4OO1I 4K0KQ 5M3MB 4H7BA 4AYBE 1O7LA 3CU7A 4YCUA 4K5XA 3SDZA 4A3GB 4UHVA 3LGJA 4V190 3J81c 3F2BA 4N9TA 3KJOA 1RCVD 4IZ8A 1EWHA 1OO9B 1RDPD 1EIFA 1WTPA 2WAQG 5IODA 1IBML 5J22A 3H3VC 2AHOB 1XJVA 3FVQA 2OEOA 4C3JG 1HH2P 1H9MA 3I4MB 5C4JH 1EIHA 3JAMi 3QOLA 4P75A 2MFIA 2JEAI 1NCVA 1HPCA 2HQLA 2JYOA 4P73A 4IOAA 1HNXL 2NBFA 3ULPA 5I6YA 1VCIA 4HCEA 1WI5A 3I90A 4JBMA 5GADC 2CKZB 2L12A 5EKLA 2LKVA 3Q0AA 1JOKA 1JWSD 2EJGC 3L7ZC 1ET9A 2KJXA 4IQZA 1PZID 4DR4L 1TR5A 1JR0D 1VQAA 3KK7A 3NXWA 3CP0A 4BBSG 3I56A 2KA7A 5FLXL 1WYDA 2JA8B 4TRDA 4GZYC 1EIGA 1PDQA 4FVMA 3K80C 4I65A 4FNFA 2PYKA 1GUSA 4RCOA 1TWHH 5JOBA 1HHVA 1BBUA 3U50C 2N55A 2F0TA 2JXMB 3MVVA 4A93H 2EOTA 2JP1A 4KK7A 5IY0A 2BH2A 2A6HC 1ICWA 3HOZH 2F0WA 4KD3A 4DNIA 1OXXK 4K14A 4LWCA 3J80E 1FJGQ 2SEBD 2F0QA 1F9PA 3K5OA 4YIJA 2MUYA 3BZCA 2PQAB 1YJWA 1AFPA 3F2DA 1SE8A 2I5LX 1V8QA 3OW2A 5M5WH 3ZYYX 3KLSX 1OXVA 3ZJYC 1IBKQ 5KNBA 1B50A 1G6ZA 5EJWA 2Z0SA 3BYYB 1TVXA 4QB4A 4NXML 1EY4A 4DXFA 5IYBG 5KEEA 3R93A 4JI8Q 1PTOC 4K5WA 3AFPA 3IRBA 2IT1A 1HUNA 4XTCS 3C1FA 4DK0A 1X56A 4LW1A 5BR8L 1N33L 3HOWH 4QUCA 1RF2D 4C2MB 4ULLA 3GD7A 1VQ8A 4ME5A 1EFWA 5IGFA 2ENBA 1STHA 3FPUB 2ZJQA 2A69C 1EY8A 5CYUA 2KECA 4A3KH 1EYCA 4DAYB 5I9OA 3FMCA 3MEFA 4DV1Q 3NK9A 1HXYD 1I94L 4KY5A 1SEBD 4A75A 1K8GA 2WV6D 1I3QH 1TWAB 2R7ZG 1PMRA 4S3SA 3JAMc 1DOLA 3HS0C 2ALYB 3T1YQ 1TWHB 2E2DC 1CSQA 2F52A 1VQIA 4V0BA 2UUAQ 3HOYG 1A0IA 3KF6A 4GN5A 4MNOA 4P74A 2PMZB 3WWVA 5LHY1 1WCMH 2PZWA 1CA6A 4A3IB 1S3OA 1J9OA 4DUYL 2A73B 3KF6B 1IZ6A 3X3NA 3T16A 1FJGL 2B2YA 4XQJA 5E3FA 2ZTEA 1HR0Q 5IGGA 2E75C 3M4QA 2AWNA 4JI0L 4GKJQ 1JT8A 2EZVA 3DM3A 4DKAC 2F0UA 1IXRA 1GVPA 1QILA 4ZK9B 4FDBA 2NN6H 1AZPA 3Q8DA 4ABNA 1RL2A 2QEJC 4DV2L 2DY8A 5A2QL 1L0YB 2ZJPA 1WTWA 2N78A 4DUZL 1Y1VB 3HOWG 2Q2HA 1HTPA 1S5FD 2I5HA 4Q5VA 5IP7G 3HOZB 2XWBB 1YHAA 2NN6G 1B2TA 3PQIA 3A8JE 3U4ZA 5A35A 1F2YA 3S14H 3HKZB 4LF4Q 2NTSA 2OQKA 3TQYA 5IGBA 2F0PA 2Y0SE 4OELB 3CMEA 4C3IH 2NZ1D 3PIOA 1EY9A 1LABA 2R6GA 5HY6A 5IT9c 2BOSA 1Y14B 3V2TA 5M9OA 3D8GA 1D7QA 3GTGB 3I73A 4TVAB 2L11A 2J7ZA 2VS1A 4LF8Q 1E1TA 2WB1G 1WTVA 1VQLA 2WINB 4LUZA 3SR1A 1HNZQ 1D5XC 3UDIA 2YU9H 4MN3A 4DXGA 2K7VA 3EBEA 2MO1A 4IUVA 3ICEA 2AUKA 4IO9A 2F0SA 1JJ2A 4RWSC 4K8IA 3VYTA 1FNUA 4RGMA 3MXPA 1CKNA 2EXDA 1JE5A 5JJLA 1QZHA 3A74A 1KC8C 3RLFA 4CDEC 3I4OA 1J8IA 4DV6L 3HOVB 1X65A 4A76A 1D5ZC 2ES2A 5C4JB 4XXEA 2KEEA 1VQ5A 3PCOB 2BDOA 3HKZE 1U4PA 1DCZA 2PMZE 5CC4A 2F0GA 5I4DA 2Q2TA 3OPOA 5C0XH 3DEPA 3U58A 1R4PB 3HKZG 2K5WA 5FLXc 2HQEA 3HP3A 2E76C 4F7XA 1SYGA 3OHXC 1MGSA 1QE6A 3G4SA 1ASYA 1RD9D 5M3FH 1LO5D 3A8IE 4KI0A 4B3RL 5I6WA 1RIPA 4UDUC 4JI3L 4R9WA 4JV5Q 1ZYRC 2K28A 5CV9A 3U9OA 2F4VQ 3W2DA 5CORA 1E2ZA 1SMYD 4DGZA 2QDBA 1W3SA 1PH1A 2A6ED 4B3MQ 4E6IA 4OHJA 3TREA 4LUOA 4BBSH 1QG7A 5CV6A 1X3EA 5KRUA 1N9WA 1P16A 4OWWB 2LXJA 1BF4A 1YZ6A 2OTJA 1JJGA 2LSSA 2ZJRA 4CDDC 2V4DA 4J15A 3H0GH 5EKIA 1D1IA 1F2LA 2NVYB 3C3LA 4HJ7A 1CK1A 2R7ZB 1X3FA 3CCLA 2DGYA 4M8AA 5LMNW 1V1OA 2KHSA 2JN4A 2OQ0A 5FKAC 2RSOA 2N3SA 1SR3A 2KUMA 1TS4A 3HOVH 3S1MB 2ZTDA 1HJPA 4AQYL 4DV6Q 4JI7L 3GTKH 1S5CD 2H5XA 4R4TA 1BNZA 2E2IB 2RKSA 3M4OB 2WKCA 3GDEA 1KHIA 1UEAB 3L2PA 4LFBL 2NUCA 1H9KA 2WAQB 4DUYQ 1Q8KA 1HZBA 4IUPA 2ATWA 3AYHB 3L9AX 1HNXQ 1W6KA 3CC7A 4A3BG 5CGKA 3IAYA 3GV6A 3HZXA 3P1HA 4DF7A 3TRZA 1A2TA 3R2IA 3PUXA 1UWVA 3K8AA 2B2UA 4JI3Q 2K05A 3B6YA 1A15A 3GTQH 2L55A 2XNAC 1WFQA 4DR4Q 2R7ZH 2JA7B 4DR6L 4TQUS 3T51B 2PO4A 1JMCA 4DV7Q 1C8CA 1LTSD 1BDOA 4DV5L 3V05A 2Z9HA 1GKHA 1P8LA 5DM73 1SFOH 4OIKA 2ICIA 2O2LD 1EZ8A 4IPGA 1ONLA 5AJ3L 4R1JA 4YY3L 4G7HC 4QIWB 1VQOA 4A3BH 2B2UC 1CFMA 1EQTA 4RFBA 1DOMA 2CH4A 4QY7A 4Y7NB 4AIMA 3VA7A 1EUJA 1A63A 1TWCB 3R2TA 2KBNA 1V1QA 2DY7A 1VQMA 1R9TH 3CC4A 1DZ1A 4DR5Q 4JI6L 3H15A 4LJZC 4XQQA 4DAYA 1N34Q 2UXDL 2JQOA 1JB3A 1BOSA 4AYBB 5EBDA 3SGIA 3CF5A 2CWPA 2QW7A 2DJGC 3M85A 4LFCL 3BDCA 5M5YB 4FF1A 1GM5A 4YWLA 1HRJA 3W3AA 3S1QB 4LUVA 4N9PA 2AWOA 1IBLQ 1LV9A 4CJ0B 1PH3A 3NBIA 5G3LD 2VQEQ 3W1GA 1O7IA 1VQKA 2K5HA 2RA4A 1L0XB 1STBA 1S5DD 3KF8A 1UE7A 3DXJC 4B3ML 1HNZL 3QWNA 2NVTB 2J4XA 1CM9A 5D3DA 3S16B 4O2DA 1E24A 1I4PA 4J1MA 1II3A 4A3JH 3NTIA 1KAAA 4BXXH 1HTLD 1VQHA 3H94A 4IPDA 5FO9B 3ONAB 3W1BA 3TP7A 2WAQE 5IYBH 3I7FA 1LLRD 4A3GG 1TXYA 3Q22A 1ZKOA 3GTGH 3QO2A 1Y1WB 4BBRB 1QZGA 2IPKD 1V9PA 1Q12A 1KIXA 2BA0A 3NE5B 3MZ5A 1A8VA 2VY3A 4IN3A 1Q7YC 1JWUD 4DV0Q 1AE3A 1SNDA 4DR2L 3I4MG 4DPGA 2A1AA 1B3AA 1GOZA 4JOIC 5K36G 3J81j 4QUFA 1PYSB 5GROA 1VQGA 4JBJA 2RBMA 2XGTA 5BN5A 3RZOB 2G9HD 4NB3A 3S9WA 4DV5Q 1PH5A 2MHVA 2ZT9C 4JBWA 3W5OA 2D5DA 4H02A 4XDXA 1N34L 2UXDQ 1JC7A 4P72A 1GHJA 3KOJA 1CQFA 4NXNQ 1LACA 4KHPL 3GO5A 5LL6X 1XX8A 2PI2E 2RCNA 3WOEA 3D6WA 2HHHQ 3TMEA 3BYTB 2QF7A 3CRKC 4B3TQ 1M4VA 1D5MC 1NR4A 3M7GA 2WKDA 4PG3A 4C1NK 4GOPB 1GJXA 2F1MA 3T13A 1V1PB 3DM1A 1EEFD 3KDFA 3K57A 3S1NH 2NVQB 4OX9Q 4L5TA 4JI5L 5H1SE 2YTXA 3UE1A 2AUJD 5IGDA 2EY2A 1PH4A 3NWSA 3FP9A 4G7ZC 3S16H 1HFGA 3S2DH 1RTOA 3PIP3 2E5LL 3A56A 4LF5L 4JI2L 1B53A 5FOBB 2EVBA 2EY5A 1SDFA 4APVA 4JG2A 1BKBA 4JCVE 1GUWA 4DU9A 3S15B 2NZOA 1FNVA 4HJ9A 3J7ZC 1JE4A 4POGA 2B2WC 5C5MA 2IX3A 1S72A 5C3XA 3MFYA 2FJ2A 3HOZG 4BY7H 3PO3B 3CCJA 1QB5D 1ASZA 4DV2Q 4G7OC 2MGSA 2K14A 4PMBA 3E3XA 3MHBA 3NBHA 1UUPA 4IUUA 4JW0A 1A6XA 1BR9A 2F0VA 1IYJB 1F9QA 4N8FA 1K83H 2F3WA 2K33A 1ENFA 2NVYH 1ESRA 1AN8A 4DR3L 4L63B 5CBEE 1KDAA 2M2LA 3PIO3 4GS3A 3N6RA 3PIPA 2R92B 4YWMA 5ELNA 3TSSA 4IUTA 4GNXB 3CCUA 1YNXA 2QILA 2G5DA 3BJUA 3UDFA 2A6HD 1K3BC 1NTGA 4DV4L 3DHQA 5IYCG 1XXGA 2SDFA 3RMHA 2DNEA 2RHQB 3CKIB 5IYCH 2YV5A 4OX9L 1STAA 2L0CA 2HT1A 4UP9A 1XTCD 1ET6A 4XQNA 2MO0A 1E7ZA 3HOUH 4OWTB 3AFQA 1U9RA 2XTIA 1G91A 1FGBD 1EY5A 5EGTA 2JE6I 2F3VA 4HEDA 2XWJB 1OXUA 4F8MA 4WJ3M 2Z6KA 1FD7D 2FINB 1R4QB 5ELBA 1JJCB 4CDCC 2QDLA 1F2ZA 3AEVA 1XPUA 2L4NA 5ISRA 4J6HA 5JVH3 3EJIA 3K0YA 4DK1A 1K83B 4C3JB 1NSNS 1NUCA 1N32Q 4C1NI 1FYCA 4LFCQ 3NP8A 3TBIB 1B44D 5KNDA 1PFSA 3J81L 4GNXA 3PGZA 2XIWA 2BH8A 2B2TA 1WVLA 1SJHD 1EZ6A 4MHEA 1EQVA 4CDFC 1JOQA 1PRTC 2OCEA 4NXMQ 2B2YC 3PO3H 4BY7B 1I50H 1T9HA 2FFKB 1N8RC 2MJ8A 2E2HH 4RHRA 1ENAA 3A0JA 5DNFA 4GLAC 3D4WA 1D6EC 2WB1B 3JAME 3OIPA 3BS1A 3HOXG 4AQYQ 1N36Q 3GTKB 4ZKBB 2K5QA 3PV0A 1I5FA 2SNMA 3VR6A 4HSVA 3H3VH 1YBYA 2IX1A 3FHWA 3NSWA 2UUBQ 4A3GH 4HCSA 2Q2IA 1ICFB 4IJLA 4DV0L 1MD2D 5I9PA 1BCPB 2R7DA 4ZUJA 1Q1BA 3OWFA 5M5XH 1CZWA 1ZYRD 4A3JG 4LF7L 2EYHA 1QCBD 4JV5L 3STBD 2PI2A 3RN2A 1SN8A 3S1NB 1Z47A 1KDCA 3NHHA 3ITPA 1B9NA 3M3YH 3OTOL 1CKOA 3ULJA 1PRTB 5C4ZA 1EOVA 5KNCA 1VQ9A 4FXDA 4F88A 1L1OC 4X3SA 1BCPC 1LTID 4RAUC 2NN6I 4JVZA 3RN5A 1A2UA 3OYYA 3JC66 2N88A 2B2TC 4QGUA 4RGOS 3CHBD 1RTNA 1N32L 3I2ZA 2IHFA 2B29A 1X3QA 5C4XG 3RZDB 4HMJA 1TS5A 1Q82C 1A3UA 2A68C 4QQBX 3S2HH 1RODA 1VQCA 1ML0D 1WCMB 4OGQC 3HOYB 1PH9A 3PO2H 2RCFA 4UAIA 1I6HB 4A3KG 2EYPA 3BU2A 1I4QA 4K8JA 3MC0B 1KABA 2Z6KC 1LTRD 4ZLTF 3U4VA 3T1HQ 3CQZH 4Z9CB 4FP5D 2D2CC 3PSIA 1A3VA 5JPMC 5EKKA 1YJ9A 2LFNA 4B9XA 2EYLA 2K04A 2DUDA 2RDHA 2GVAA 2SOBA 5CMDA 2NVXH 1STNA 2RHSB 2F0LA 2KQ3A 4RMFA 2GA4B 4C2MH 5EQ0A 4XYOA 2IW3A 4NKLA 2FHTA 4CGYB 5C0XJ 3KLSA 5KYLA 2O5IC 2IY5B 4IFDI 4A3IG 1Q86C 2F0OA 2EJFC 5AFWA 2Z6BA 2EYOA 1AEXA 1JORA 1BBXC 1G2SA 3MXNB 2R93H 2BCOA 1CSPA 1EU3A 4O0AA 2JA9A 5IOCA 2QA4A 1PVOA 1V1PA 4NP5A 1SYDA 2N8NA 3PMFA 2EXZA 1Y1WG 1PTOF 1XYIA 2A6EC 2ZXOA 4KKSA 1PYBA 1Y8PB 4CJ1B 1CZGA 2E2JH 4IPCA 2OXPA 4A3LH 4DR1L 1Y8OB 4EVOA 1X54A 2F0JA 2TSSA 2ZXPA 4GLVB 3VR2A 5EBCA 2JA6H 1Z9FA 3EIVA 5CV7A 1GUGA 3DUZA 3K5LA 2I46A 2PPBC 4X64Q 1MSHA 1R9TB 3SE0A 4DR1Q 3CCRA 2LMCB 3HG9A 3OMGA 3QB3A 3BDOA 4R8IA 1C0AA 1CKNB 2CQOA 1GUTA 3F8TA 4A3BB 1MSGA 1TWAH 3CRLC 3MA2B 2RDFA 3L0OA 4C3IG 1VQ6A 4OO1H 2K6AA 4IPHA 2PNRC 4OO1G 1T5XD 1H9SB 1Q3LA 1Y1VH 2KEDA 4H13C 3FRPB 5GAGC 3NUCA 1PYWD 3GTMH 1TT2A 5LMNL 4A3FB 2R93G 3CPWA 1XWEA 1K9MC 1MBYA 2JA7H 4LFBQ 3OTOQ 2EQSA 1EYGA 2Z4HA 1PH8A 2QKIC 3LWEA 4DAVA 4B3TL 2NVTH 4CKCA 5L37A 2K50A 1SYBA 4R4OA 4JK1C 3DWAA 4IALA 1SRUA 4FXKC 2RVLA 3K81C 2Q8IB 3ERSX 1VQ4A 1L0WA 4KN7C 4RH6A 2KVMA 1F9RA 4C3HB 5HGQA 2PQAA 4MTNA 2K5DA 3A5ZB 2UU9L 2VNUD 1HZ9A 2CH4W 2CQAA 3RUZA 3PO2B 2B2VC 4DV7L 1QWYA 3HOYH 4H44C 5I2XA 1EYAA 4X62Q 2FMCA 4ZAIA 3VA5A 5IIFA 3KUPA 3AU7A 4G57A 1QUQA 4OXPA 1VQJA 2GVBA 3E0EA 4JI5Q 1L1OA 1PFMA 5IYDH 5KYIA 4OL7A 3HOWB 4Y7NH 2OT2A 3TZDA 2AQ3B 4CJ2C 1VS0A 2F0EA 4L5SA 5IWAQ 3GTJH 2ZM6Q 2HDMA 1LTTD 2KHJA 2UXCQ 1E0BA 2VUMB 4JI2Q 1U0LA 1NE3A 5JEAH 4KLKA 3HKSA 3Q23A 4JYAQ 1ILPA 1KL9A 3S1RB 1SFOB 4KD4A 4KMUC 3M3YB 4I7ZC 3H6MA 4LF9L 4QJFA 1PA6A 3CW2C 1TWFB 3PUVA 4A3MB 4BY1H 1DYQA 2TMPA 3SK4A 4U68A 5JVG3 3U9SA 2QCPX 5JJKA 1JOOA 1QJOA 4PZ6A 3GTQB 4C3HG 1EQQA 2VQFQ 1DGSA 4BBRG 1U4LA 3N52A 3WOFA 4ZKCB 2L1BA 1K28A 4RG1A 4X6AH 1C7YA 3J80c 2K1BA 5IP7H 3HGBA 4NDXA 1AP0A 4B3RQ 2PCFB 3VDYA 1H9RA 4PZ8A 2E2JB 5HGTA 1KRSA 1PTOB 4A3EG 1A3TA 1QVCA 5I2YA 1HUMA 3SXHA 3MXGA 1S4ZA 4UPAA 3I4NB 4R4CA 5EPLA 1A62A 4A3CG 3RLOA 4DAPA 1NJIC 3KFUA 2NTTA 3MEHA 3VR3A 3S1MH 2MNAA 3K59A 1GUNA 3HEJA 5C3EG 1MJCA 4U673 1X9NA 1PH2A 2K5VA 4LF5Q 5FLXE 2HD3A 1BBWA 4LNQA 4WJ4A 1LT4D 2EIFA 1TS2A 3D6CA 4ALPA 3QR8A 4P2CB 2H1EA 2UXCL 1SNCA 2DJFC 4EQNA 4KY6A 4IUQA 1CTMA 1EEID 1Z7TA 1IYUA 4JYAL 4LF8L 4GN4B 1HR0W 4OONA 2B63H 4EQPA 3IFDA 1TIID 4RGNA 2JSOA 1O78A 1RJTA 4KN4C 4DR7Q 2YTYA 2F0NA 1GUOA 1DM0B 3CAMA 1I50B 1M1KC 2FMMA 3M4OH 4HTHA 4A3MH 2EY1A 1N36L 4DAMA 2F0FA 1EY0A 4L8JA 3G6EA 3PUYA 2HHHL 1KNEA 1PV4A 1IL8A 4ZUIA 4AH6A 1I94Q 1SJED 1YNND 4LF6Q 1BCPD 1KLUD 5M3FB 2CW0D 1SLJA 3P7JA 5CV4A 1XMQL 2VQFL 1TQOA 4WFN3 4DUZQ 3T1HL 4A4IA 1WD1A 1Y1VG 2R92H 1UEBA 5ELCA 1BXTA 3ND8A 5DAUA 5M3MH 5C4XB 2F3IA 4AYBG 2WP8J 1O80A 3J80L 4GNXC 1B70B 1F2MA 4JI1Q 3H0GB 4WORA 1UE5A 4HIKA 3J81E 4HIMA 1STEA 4KTAA 4FF2A 2K01A 2LS01 2DNCA 2E8GA 1VQEA 1VMPA 5LMUL 4YWKA 1XNQL 4JI6Q 3S17B 4OEMB 5GAHC 4A3EB 4B3SQ 3KLRA 2VUMH 1HNWQ 4LAAA 1D8LA 4HJ8A 5IP9G 3GTJB 2KHIA 1SE4A 3K0XA 3CC2A 2IWHA 2A19A 4DA2A 1YJNA 1K8OA 1CKMA 1VQNA 5M5XB 4CBVA 3EN2A 3E9IA 1C48A 4ILWA 1XPOA 4ID6A 4P71A 2F0DA 3TS2A 3FKIB 1MKHA 1SNPA 4DR6Q 4LFAQ 2VUMG 2B8GA 4FO2A 4UY8C 2A69D 4F87A 3Q24A 4GOPC 3C1EA 1VQ7A 1HA5A 3I91A 2EJMA 4DV1L 3IFTA 3CCEA 5M3FG 3J80i 1SAPA 3NTKA 2PW5A 4CKBA 3SVMA 5M3MG 2ZXRA 1PHJA 1KLGD 3NENA 3CCVA 2Q2UA 3CCQA 4BY1G 4WJWA 2NVQH 2K4KA 4ZCKA 2ICEC 1YNJC 1TU2B 1E2VA 4X62L 2XN9C 4ZRZA 1XPRA 5IE8A 3DEOA 3SK5A 3VYSA 4ODGA 4DV4Q 1LTAD 3G7LA 1NAPA 3F2UA 3UE0A 1X3GA 4ZYSA 2CCZA 4KJNA 2XVSA 1TWGB 2JK8A 2RQXA 1PZKD 3GTMB 4JOIA 1Y69U 1O7ZA 1DJRD 3OWEB 3WDNA 3J7YW 1AZQA 4DK6C 4X3KA 3QG1A 1W2BA 4K0KL 2B63G 4B08A 4QCLA 2JA5H 1IL2A 2O5JC 2B2WA 2G9DA 2I5MX 3K6OA 2KCNA 1EWIA 3SK6A 1MHWC 4RCNA 3MTSA 5C3EB 4POFA 3S2DB 1XMQQ 1X32A 2R7FA 1EQRA 1KQSA 5K36H 1CQVA 1HQMC 2VQEL 4YCVA 1M8AA 1Q46A 2Q8TA 4EGVA 4DR5L 4HIDA 1CA5A 5CV8A 1I3QB 3CD6A 3KLWA 5C4HA 1NMFA 1LTBD 2JA5B 2EDGA 3J7AV 2ZM6L 3GTOH 1ZEQX 1I4XA 2BE5C 4JI1L 3CCSA 1XTDA 1MI2A 4LFAL 2F0KA 1E1OA 1KNAA 3NBHB 1LM0A 4HN7A 4IJHA 4K2LA 1PRTF 4L6TB 5IGCA 1C4QA 1VDZA 1STYA 4JBKA 3I3CA 4A3JB 1K73C 4PMWA 5ELDA 4IFDH 5D65A 1FL0A 5CBAE 1VQBA 3PF5A 2XSCA 4UP8A 2WACA 4EX5A 5J1ZA 5NUCA 2X6LA 3TP8A 2X6GA 3OIQA 4BA1I 2RDGA 3VYRA 2R61A 5DEHA 2ZTCA 2P5ZX 3IKJA 5D14A 4UP7A 3ERQA 3QJYA 4X3UA 2NYZD 2F4IA 1B7YB 1FVIA 1VF7A 3M7NA 3A7AB 1WOCA 1GO3E 1JQYD 2EYMA 4IUNA 2AMCB 3EROA 2MP1A 3OMCA 1YVCA 2K5NA 4KHPQ 3A55A 2M00A 4LMQD 1WTRA 3TP6A 4A93B 4KV6A 1D2BA 3NQIA 1Q1EA 4JI4Q 4DR3Q 3OOCA 4FF4A 3CCMA 3TEHB 2F4VL 2HUGA 2MPMA 3UI2A 3JAML 1L2FA 1BQQT 1FGUA 4A3FH 2NVXB 4A3EH 2LY7A 3I8ZA 3S17H 1PLFA 1KRTA 1K3RA 2BE5D 2JA7G 1VF5C 5JEAJ 4NPSA 4R4QA 3E6ZX 5M5WB 1NR2A 3NQTA 3AMUA 4DV3Q 2L15A 3HOXB 2A74C 4HR7B 4IURA 1WTXA 4X66L 1YITA 2FXQA 4L5QA 2RSNA 1QNUA 1E3PA 1HZAA 1KXLA 2VXWA 1KDBA 2BA1A 3LNNA 2B2VA 1E2WA 3BVMA 3RZOH 4A3CH 2PZTA 1F77A 1SNOA 2F03A 4DV3L 1SSOA 2N49A 3NPPA 1UNSA 1YNNC 5LL6S 1CUKA 3D31A 2E74C 2B8FA 3MWYW 3VYUA 4JI0Q 3GP7A 1TWGH 2H4OA 3BDLA 1LUZA 4NXNL 5FLMG 3A8KE 5C3WA 5JPNC 2Y0SB 3E5SA 4A93G 2BDNA 2HCCA 3D4RA 4RA8A 1X6OA 1PFBA 4TSSA 1GXDC 4A3DH 5D3IB 5TSSA 5IYDG 3GTLH 2R93B 5IP9H 1HA6A 1MIUA 1VQPA 4H0LC 1BUVT 1SE2A 3MAQA 2O4XA 5COYA 1TS3A 2PZUA 1HZCA 2JA8G 1HNWL 2AQ2B 1STGA 1SYEA 3GQBA 1SBBB 5E7NA 1IKMA 3EA6A 4QIWE 5C44B 4BS9A 3BG3A 5FK9C 2PNHA 1EY6A 3ULLA 1CT1D 2WFWA 3HOUG 1O7YA 4XIGS 3KDFB 1ILQA 3TN2A 3FKIH 2IJ0A 5IGEA 1G6PA 3S24A 3CQZB 4R4IA 5ELEA 2CWAA 5AJ3Q 4QL5A 1OXTA 1SMYC 1X55A 2YYZA 3BZKA 3LX0A 3SEBA 4A3LG 1G8ZD 5M5YH 4I7AA 3HOVG 2A5HA 1S5ED 1SNMA 1H9JA 2KOLA 2NZHA 4BA2I 4KJOA 1NY4A 3F1ZA 5DLQE 3GTPB 4X3TA 1WCMG 4M1UB 1KTKA 4JPBW 2Q8RE 5J3BA 5DM63 3TS0A 1K0RA 5JJZA 4B9WA 2UUCL 3KYHC 4Q0FA 3E9HA 4EQ5A 4HSPA 3I70A 3H0GG 1PRTD 4R8NA 3UDXA 3HOXH 3CPFA 4QF4A 4NMZA 1IYVA 4BWGB 1Q8IA 5BN3A 5C0XG 1B8AA 2F0HA 3NTHA 4PV1C 4DNRB 1FNWA 1EIYB 2KENA 1QNKA 1SXTA 2UXBL 5G3LF 1EOTA 1AW7A 4FXGC 3C46A 3DLLA 3FDTA 4KY7A 3H3VI 2HCIA 1LYLA 3KF8B 4C56C 4BY7G 3R8BA 1K8AC 1NBWA 5IT9L 1YEZA 3PF4A 4GOPA 4A3MG 5JEAG 1WJJA 3HRZC 2EPBA 3HOUB 4IFDG 1EWCA 4JC0A 2JA6G 3D4DA 3M4PA 1H95A 1C9OA 5ELOA 4K6LA 2CVRA 1DD2A 2M9VA 1QOHA 1JWMD 1ESFA 2C35B 4O42A 4N8X1 4B3SL 3K5MA 3QOJA 4MTKA 3SHLA 1XNRQ 1CHPD 1XNQQ 2X69A 3I72A 5CR3A 1EYDA 4A3DB 1NMGA 2YTVA 4GN3B 4MIUA 4GKJL 5FO8B 5IT9E 1PH6A 4KKUA 2E2HB 4DK3C 1QVFA 3K58A 4XYQA 3BVGA 4C3HH 2A8VA 1VQDA 3I4NG 1KD1C 1LTLA 4BXXG 1Z6HA 2E2IH 2UXBQ 3CXCA 3I55A 2B3GA 2L5TA 1YHQA 4A3FG 4QMGA 3T1YL 2F0MA 2RF4A 1GHKA 1SE3A 1S5BD 4RKLA 3M4YA 5C5LA 1I4HA 2UUCQ 2OTLA 5C44H 1M90C 5EPKA 3CMAA 4X66Q 1OXSC 4HIOA 2C9OA 2VZAA 3SK8A 1B1ZA 2SNSA 3AB9A 1PTOH 4C3JH 2I0QA 1T5EA 1EFID 3E0JA 4KKTA 3D0FA 2PW7A 1G51A 2JJQA 3S15H 4OIJA 3GTLB 2K32A 4O1NA 1WTOA 3NEMA 2WB1E
chains in the Genus database with same CATH topology
2EE1A 4BBSB 1TY2A 4PMCA 2J0TD 4XT3B 1B4OA 3S14B 2NWGA 5T1IA 1X3PA 5K5PA 1EU4A 4TKOB 3VR4A 1U4MA 3TZUA 3EQLC 3I4LA 4A3KB 3KBGA 2DN8A 1VMCA 2JA6B 1TKWB 2EY6A 1H9SA 4EQOA 3OSOA 5JAVA 5T1GA 5BN4A 4RGTA 3J7AF 4RKBA 3PUWA 1DXMA 3V96A 3EVQA 3C2PA 1CI3M 1U4RA 4CKEA 3MXNA 5A2QE 1D1KA 3EFXD 1HCZA 4PQXA 2Z1CA 2NB0A 5KIXA 2D62A 1B9MA 5E4XA 2XRQD 2VB2X 1G2TA 1Y8NB 3FPPA 3T53B 4KHVA 3NWTA 5C6AA 4KHZA 1V43A 1IW7C 3D3RA 3RD4A 2YU9B 4HMIA 2KCCA 1F9SA 4NW2A 1BO0A 1IKLA 2OF1A 1WTQA 3H09A 1SYCA 1CHQD 1PFNA 3LWUA 2K03A 4C3IB 1IW7D 2IX0A 3MXUA 3K5NA 5F2DA 3L3OC 1DONA 3KBXA 3OW7A 1YNJD 2EYJA 1IHZA 1I4RA 1BCPF 4XT1B 5CV5A 3DMUA 1JICA 3GTOB 1RKNA 3QIAA 1EL0A 2HDLA 2L9HA 1TY0A 3DWPA 3A7LA 3T4AC 1W6JA 1K8MA 2VB3X 4FF3A 4FYDA 1LT6D 3TDQA 2AQ1B 2Z8LA 4K5VA 5FO7B 1PXUA 3DWQA 1I6VC 3G6JB 1FR3A 3BZDB 3IL8A 1EY7A 2WIIB 2B63B 1G291 1LTGD 1PTOD 4J8QA 1PZJD 2EYFA 5EPJA 3P75A 2Z4IA 3R3OA 1WD0A 5E1FA 4ZQ3A 3H91A 5HURA 1HQRD 2D9UA 5ELFA 3X3MA 1RHPA 2XRSD 1HFNA 1UAPA 4WRDA 3A54A 4RHSA 5E4WC 5J39A 3TP5A 2CW0C 4HAEA 1ENCA 2R3ZA 4DN4M 4LK1C 1SNQA 2IL8A 2JEBI 4G4KA 3O13A 1Q90A 3FEWX 4K2KA 4DFAA 1LT3D 2B39A 3S2HB 2A68D 1I4GA 3URYA 4CHTB 3BVZA 1ZXTA 3P20A 1LT5D 3ND9A 4BY1B 1SYFA 2ID0A 2F0IA 1JCKB 2I07B 5KGUA 3T56B 2CHBD 3K7AB 2C5CA 1DOKA 4PNYA 2PQEA 4DNTB 3MFGA 3GV3A 3VR5A 4IFDJ 3Q6SA 3PUZA 5C0XI 4K6DA 4OO1I 5M3MB 4H7BA 1O7LA 3CU7A 4K5XA 3SDZA 4A3GB 4V190 4N9TA 1RCVD 4IZ8A 1EWHA 1OO9B 1RDPD 1WTPA 5IODA 5J22A 3H3VC 3FVQA 2OEOA 4C3JG 1H9MA 3I4MB 1EIHA 3QOLA 2JEAI 1NCVA 1HPCA 2JYOA 2NBFA 5I6YA 1VCIA 4HCEA 3I90A 2L12A 5EKLA 2LKVA 3Q0AA 1JOKA 1JWSD 2EJGC 3L7ZC 1ET9A 2KJXA 4IQZA 1PZID 1TR5A 1JR0D 3KK7A 3NXWA 2KA7A 5FLXL 2JA8B 4TRDA 4GZYC 1EIGA 1PDQA 4FVMA 4I65A 4FNFA 2PYKA 1GUSA 4RCOA 5JOBA 1HHVA 2N55A 2F0TA 2JXMB 3MVVA 2EOTA 2JP1A 4KK7A 2A6HC 1ICWA 2F0WA 4KD3A 3J80E 1OXXK 4K14A 2SEBD 2F0QA 1F9PA 3K5OA 4YIJA 2MUYA 1AFPA 1V8QA 3ZYYX 3KLSX 1OXVA 5KNBA 1B50A 1G6ZA 5EJWA 3BYYB 1TVXA 4QB4A 1EY4A 4DXFA 5KEEA 3R93A 1PTOC 4K5WA 2IT1A 1HUNA 4XTCS 3C1FA 4DK0A 4QUCA 1RF2D 4C2MB 4ULLA 3GD7A 4ME5A 5IGFA 2ENBA 1STHA 3FPUB 2A69C 1EY8A 5CYUA 2KECA 1EYCA 5I9OA 3FMCA 3NK9A 1HXYD 4KY5A 1SEBD 2WV6D 1TWAB 1PMRA 4S3SA 1DOLA 3HS0C 1TWHB 2E2DC 4V0BA 5LHY1 2PMZB 2PZWA 1CA6A 4A3IB 1J9OA 2A73B 3X3NA 3T16A 2B2YA 4XQJA 5E3FA 5IGGA 2E75C 2AWNA 2EZVA 2F0UA 4ZK9B 1QILA 1AZPA 2NN6H 4ABNA 2QEJC 2DY8A 5A2QL 1L0YB 1WTWA 1Y1VB 1HTPA 1S5FD 4Q5VA 3HOZB 2XWBB 2NN6G 1B2TA 3A8JE 5A35A 1F2YA 3HKZB 2NTSA 5IGBA 2F0PA 2NZ1D 1EY9A 1LABA 2R6GA 2BOSA 3V2TA 5M9OA 3D8GA 3GTGB 3I73A 2L11A 2J7ZA 1WTVA 2WINB 3SR1A 1D5XC 4MN3A 4DXGA 2K7VA 4IUVA 2AUKA 2F0SA 4RWSC 4K8IA 3VYTA 1FNUA 4RGMA 3MXPA 3RLFA 1J8IA 3HOVB 1D5ZC 5C4JB 4XXEA 2KEEA 2BDOA 1U4PA 1DCZA 5CC4A 2F0GA 5I4DA 3OPOA 5C0XH 3DEPA 1R4PB 2K5WA 2HQEA 3HP3A 2E76C 4F7XA 1SYGA 3OHXC 1MGSA 1QE6A 1RD9D 1LO5D 3A8IE 4KI0A 5I6WA 4UDUC 4R9WA 1ZYRC 2K28A 5CV9A 3U9OA 3W2DA 5CORA 1E2ZA 1SMYD 4DGZA 2QDBA 2A6ED 4E6IA 4OHJA 1QG7A 5CV6A 5KRUA 1BF4A 2V4DA 5EKIA 1D1IA 1F2LA 2NVYB 3C3LA 1CK1A 2R7ZB 4M8AA 1V1OA 2KHSA 5FKAC 2RSOA 2KUMA 1TS4A 3S1MB 1S5CD 1BNZA 2E2IB 2RKSA 3M4OB 2WKCA 1UEAB 2NUCA 1H9KA 2WAQB 4IUPA 3L9AX 1W6KA 5CGKA 3IAYA 3GV6A 3HZXA 3P1HA 4DF7A 1A2TA 3R2IA 3PUXA 2B2UA 2K05A 1A15A 2L55A 2XNAC 2JA7B 4TQUS 3T51B 2PO4A 1C8CA 1LTSD 1BDOA 3V05A 5DM73 4OIKA 2ICIA 2O2LD 1EZ8A 1ONLA 4G7HC 4QIWB 2B2UC 1CFMA 1EQTA 4RFBA 1DOMA 4Y7NB 3VA7A 1TWCB 3R2TA 2DY7A 1DZ1A 4LJZC 4XQQA 4DAYA 1JB3A 1BOSA 4AYBB 5EBDA 3M85A 3BDCA 5M5YB 4FF1A 1HRJA 3W3AA 3S1QB 4N9PA 2AWOA 1LV9A 4CJ0B 3NBIA 5G3LD 2RA4A 1L0XB 1STBA 1S5DD 3KF8A 3DXJC 3QWNA 2NVTB 2J4XA 1CM9A 5D3DA 3S16B 1I4PA 4J1MA 1II3A 3NTIA 1KAAA 1HTLD 3H94A 5FO9B 3ONAB 3TP7A 1LLRD 3Q22A 1ZKOA 3QO2A 1Y1WB 4BBRB 2IPKD 1Q12A 2BA0A 3NE5B 3MZ5A 4IN3A 1JWUD 1SNDA 1B3AA 1GOZA 5K36G 4QUFA 2RBMA 5BN5A 3RZOB 2G9HD 3S9WA 2MHVA 2ZT9C 4JBWA 2D5DA 4XDXA 1JC7A 1GHJA 1CQFA 1LACA 3GO5A 5LL6X 1XX8A 3WOEA 3D6WA 3TMEA 3BYTB 2QF7A 3CRKC 1M4VA 1D5MC 1NR4A 3M7GA 2WKDA 4C1NK 1GJXA 2F1MA 3T13A 1V1PB 3DM1A 1EEFD 2NVQB 3K57A 2AUJD 5IGDA 2EY2A 3NWSA 4G7ZC 1HFGA 1RTOA 3PIP3 3A56A 1B53A 5FOBB 2EVBA 2EY5A 1SDFA 1GUWA 4DU9A 3S15B 1FNVA 1JE4A 2B2WC 5C5MA 2IX3A 5C3XA 3MFYA 2FJ2A 3PO3B 1QB5D 4G7OC 2MGSA 4PMBA 3MHBA 3NBHA 1UUPA 4IUUA 1A6XA 1BR9A 2F0VA 1F9QA 2F3WA 2K33A 1ENFA 1ESRA 1AN8A 5CBEE 4L63B 1KDAA 2M2LA 3PIO3 3N6RA 2R92B 3TSSA 4IUTA 2QILA 2A6HD 3DHQA 1XXGA 2SDFA 3RMHA 2DNEA 3CKIB 1STAA 2L0CA 1XTCD 1ET6A 4XQNA 1U9RA 1G91A 1FGBD 1EY5A 5EGTA 2JE6I 2F3VA 4HEDA 2XWJB 1OXUA 4F8MA 1FD7D 2FINB 1R4QB 5ELBA 1F2ZA 2L4NA 5ISRA 4J6HA 5JVH3 3EJIA 3K0YA 4DK1A 1K83B 4C3JB 1NSNS 1NUCA 4C1NI 1FYCA 3NP8A 3TBIB 1B44D 5KNDA 3J81L 2XIWA 2B2TA 1WVLA 1SJHD 1EZ6A 4MHEA 1EQVA 1JOQA 1PRTC 2B2YC 4BY7B 2FFKB 2MJ8A 4RHRA 1ENAA 5DNFA 3D4WA 1D6EC 2WB1B 3JAME 3OIPA 3BS1A 3GTKB 4ZKBB 2K5QA 3PV0A 2SNMA 3VR6A 4HSVA 2IX1A 3NSWA 4HCSA 1MD2D 5I9PA 1BCPB 4ZUJA 1Q1BA 3OWFA 1CZWA 1ZYRD 2EYHA 1QCBD 3S1NB 1Z47A 1KDCA 3NHHA 3ITPA 1B9NA 1PRTB 5C4ZA 5KNCA 4FXDA 4F88A 4X3SA 1BCPC 1LTID 4RAUC 2NN6I 1A2UA 2N88A 2B2TC 4RGOS 3CHBD 1RTNA 1X3QA 3RZDB 4HMJA 1TS5A 1A3UA 2A68C 1RODA 1ML0D 1WCMB 4OGQC 3HOYB 4UAIA 1I6HB 2EYPA 1I4QA 4K8JA 3MC0B 1KABA 1LTRD 4ZLTF 4Z9CB 4FP5D 2D2CC 1A3VA 5JPMC 5EKKA 2LFNA 4B9XA 2EYLA 2K04A 2RDHA 2SOBA 5CMDA 1STNA 2F0LA 2KQ3A 2GA4B 5EQ0A 4XYOA 2IW3A 4NKLA 2FHTA 4CGYB 5C0XJ 3KLSA 5KYLA 2O5IC 4IFDI 2F0OA 2EJFC 5AFWA 2EYOA 1AEXA 1JORA 1BBXC 1G2SA 2BCOA 1EU3A 5IOCA 1V1PA 4NP5A 1SYDA 3PMFA 2EXZA 1PTOF 1XYIA 2A6EC 2ZXOA 4KKSA 1Y8PB 4CJ1B 1CZGA 2OXPA 1Y8OB 4EVOA 2F0JA 2TSSA 2ZXPA 3VR2A 5EBCA 5CV7A 1GUGA 3DUZA 3K5LA 2I46A 2PPBC 1MSHA 1R9TB 3SE0A 2LMCB 3HG9A 3OMGA 3QB3A 3BDOA 4R8IA 1GUTA 4A3BB 1MSGA 3CRLC 3MA2B 2RDFA 4C3IG 4OO1H 2K6AA 2PNRC 4OO1G 1T5XD 1H9SB 1Q3LA 2KEDA 4H13C 3FRPB 3NUCA 1PYWD 1TT2A 4A3FB 1XWEA 1MBYA 2Z4HA 2QKIC 3LWEA 4DAVA 4CKCA 1SYBA 4JK1C 3DWAA 4IALA 4FXKC 2RVLA 2Q8IB 4KN7C 4RH6A 2KVMA 1F9RA 4C3HB 2K5DA 2VNUD 2CQAA 3RUZA 3PO2B 2B2VC 1QWYA 4H44C 5I2XA 1EYAA 2FMCA 4ZAIA 3VA5A 5IIFA 3KUPA 3AU7A 4G57A 1PFMA 5KYIA 4OL7A 3HOWB 2OT2A 3TZDA 2AQ3B 4CJ2C 2F0EA 2HDMA 1LTTD 1E0BA 2VUMB 5JEAH 3Q23A 1ILPA 3S1RB 1SFOB 4KD4A 4KMUC 3M3YB 4I7ZC 3H6MA 1TWFB 3PUVA 4A3MB 1DYQA 5JVG3 2TMPA 4U68A 3SK4A 3U9SA 2QCPX 1JOOA 1QJOA 3GTQB 4C3HG 1U4LA 3N52A 3WOFA 4ZKCB 2L1BA 2K1BA 3HGBA 4NDXA 1AP0A 2PCFB 1H9RA 2E2JB 5HGTA 1PTOB 1A3TA 5I2YA 1HUMA 3SXHA 3MXGA 1S4ZA 3I4NB 5EPLA 4DAPA 2NTTA 3MEHA 3VR3A 3K59A 1GUNA 3HEJA 4U673 5FLXE 1LT4D 1TS2A 3D6CA 4P2CB 2H1EA 1SNCA 4EQNA 4KY6A 4IUQA 1CTMA 1EEID 1Z7TA 1IYUA 4EQPA 3IFDA 1TIID 4RGNA 2JSOA 1O78A 1RJTA 4KN4C 2F0NA 1GUOA 1DM0B 1I50B 2FMMA 4HTHA 2EY1A 2F0FA 1EY0A 4L8JA 3PUYA 1KNEA 1IL8A 4ZUIA 1SJED 1YNND 1BCPD 1KLUD 5M3FB 2CW0D 3P7JA 5CV4A 1TQOA 4WFN3 1WD1A 5ELCA 1BXTA 3ND8A 5DAUA 5C4XB 2WP8J 1O80A 3J80L 1F2MA 3H0GB 4WORA 3J81E 1STEA 4KTAA 4FF2A 2K01A 2LS01 2DNCA 1VMPA 3S17B 4A3EB 3KLRA 4LAAA 3GTJB 1SE4A 2IWHA 4DA2A 1K8OA 5M5XB 4CBVA 1C48A 4ILWA 4ID6A 2F0DA 3FKIB 1SNPA 2B8GA 4FO2A 2A69D 4F87A 3Q24A 3C1EA 1HA5A 3I91A 2EJMA 3IFTA 1SAPA 3NTKA 2PW5A 4CKBA 3SVMA 2ZXRA 1KLGD 4WJWA 2ICEC 1YNJC 1TU2B 1E2VA 2XN9C 4ZRZA 3DEOA 3SK5A 3VYSA 4ODGA 1LTAD 3G7LA 1NAPA 3F2UA 4ZYSA 4KJNA 2XVSA 1TWGB 2RQXA 1PZKD 3GTMB 1Y69U 1O7ZA 1DJRD 3OWEB 3WDNA 3J7YW 1AZQA 4X3KA 3QG1A 4B08A 4QCLA 2O5JC 2B2WA 2G9DA 3K6OA 2KCNA 3SK6A 4RCNA 3MTSA 5C3EB 3S2DB 1X32A 5K36H 1CQVA 1HQMC 2Q8TA 1M8AA 4EGVA 1CA5A 5CV8A 1I3QB 5C4HA 1LTBD 2JA5B 2EDGA 3J7AV 1ZEQX 1I4XA 2BE5C 1MI2A 2F0KA 1KNAA 4HN7A 4K2LA 4L6TB 1PRTF 5IGCA 1C4QA 1VDZA 1STYA 3I3CA 4A3JB 4PMWA 5ELDA 4IFDH 5D65A 5CBAE 2XSCA 2WACA 5J1ZA 5NUCA 2X6LA 3TP8A 2X6GA 3OIQA 4BA1I 2RDGA 3VYRA 2R61A 5DEHA 3IKJA 5D14A 3ERQA 3QJYA 4X3UA 2NYZD 2F4IA 1VF7A 3M7NA 3A7AB 1JQYD 2EYMA 4IUNA 3EROA 2MP1A 3OMCA 3A55A 2M00A 4LMQD 1WTRA 3TP6A 4A93B 4KV6A 1D2BA 3NQIA 1Q1EA 3OOCA 4FF4A 2HUGA 2MPMA 3UI2A 3JAML 1BQQT 2NVXB 2LY7A 3I8ZA 1PLFA 2BE5D 1VF5C 5JEAJ 5M5WB 3E6ZX 1NR2A 3NQTA 3AMUA 3HOXB 2A74C 4HR7B 4IURA 1WTXA 2RSNA 1QNUA 2VXWA 1KDBA 2BA1A 3LNNA 2B2VA 1E2WA 3BVMA 2PZTA 1F77A 1SNOA 2F03A 1SSOA 3NPPA 1UNSA 1YNNC 5LL6S 3D31A 2E74C 2B8FA 3MWYW 3VYUA 3GP7A 2H4OA 3BDLA 3A8KE 5C3WA 5JPNC 2Y0SB 3E5SA 2BDNA 2HCCA 3D4RA 4RA8A 4TSSA 1PFBA 1GXDC 5D3IB 5TSSA 2R93B 1HA6A 4H0LC 1BUVT 1SE2A 3MAQA 2O4XA 5COYA 1TS3A 2PZUA 2AQ2B 1STGA 1SYEA 3GQBA 1SBBB 1IKMA 3EA6A 5C44B 4BS9A 3BG3A 5FK9C 1EY6A 1CT1D 1O7YA 4XIGS 1ILQA 3TN2A 2IJ0A 5IGEA 3CQZB 5ELEA 1SMYC 1OXTA 2YYZA 3LX0A 3SEBA 1G8ZD 2A5HA 1S5ED 1SNMA 1H9JA 2KOLA 4BA2I 4KJOA 3GTPB 4X3TA 4M1UB 1KTKA 2Q8RE 5DM63 5JJZA 4B9WA 4Q0FA 4HSPA 3I70A 1PRTD 4R8NA 4QF4A 4NMZA 1IYVA 4BWGB 1Q8IA 5BN3A 5C0XG 2F0HA 3NTHA 4PV1C 4DNRB 1FNWA 1QNKA 1SXTA 5G3LF 1EOTA 1AW7A 4FXGC 3C46A 3FDTA 4KY7A 2HCIA 4C56C 3R8BA 5IT9L 5JEAG 3HRZC 2EPBA 3HOUB 4IFDG 1EWCA 3D4DA 4K6LA 2CVRA 1DD2A 2M9VA 1QOHA 1JWMD 1ESFA 4O42A 3K5MA 3QOJA 3SHLA 1CHPD 2X69A 3I72A 5CR3A 1EYDA 4A3DB 4MIUA 5FO8B 5IT9E 4KKUA 2E2HB 3K58A 4XYQA 3BVGA 1Z6HA 2L5TA 4QMGA 2F0MA 1GHKA 1SE3A 1S5BD 4RKLA 3M4YA 5C5LA 1I4HA 5EPKA 1OXSC 2C9OA 3SK8A 1B1ZA 2SNSA 1PTOH 3AB9A 1T5EA 1EFID 3E0JA 4KKTA 2PW7A 4OIJA 3GTLB 2K32A 4O1NA 1WTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJZ A;  1JIC A;  2B2W A;  2EE1 A;  4X3S A;  1WD1 A;  2SDF A;  1EIG A;  1PDQ A;  4R9W A;  1ZXT A;  2B2U C;  3MTS A;  4RAU C;  1NR2 A;  4XDX A;  2K28 A;  1X32 A;  2N88 A;  2B2T C;  4ZK9 B;  2HDL A;  1AZP A;  1EL0 A;  1EQT A;  2L9H A;  1RTN A;  1DOM A;  4XT3 B;  4R8I A;  5COR A;  1M8A A;  4U68 A;  2Q8T A;  1B4O A;  1O80 A;  4IUR A;  1WTX A;  1HHV A;  1X3Q A;  1XX8 A;  2N55 A;  2RSN A;  2NWG A;  1CA5 A;  5T1I A;  1MSG A;  1X3P A;  3D6W A;  2DY8 A;  1QNK A;  2VXW A;  1G91 A;  2B2V A;  2DY7 A;  2EOT A;  1EOT A;  2JP1 A;  2K01 A;  1WTW A;  1DZ1 A;  4HED A;  1U4M A;  1ICW A;  1QG7 A;  1DOK A;  1NR4 A;  2FIN B;  3FDT A;  1VMP A;  1MI2 A;  1Q3L A;  1U4L A;  3N52 A;  2HCI A;  1KNA A;  1BF4 A;  1ROD A;  1VMC A;  3DM1 A;  4ZKC B;  1SSO A;  1F9P A;  2KED A;  2L1B A;  1B2T A;  1ML0 D;  2K1B A;  2L4N A;  3I3C A;  1AP0 A;  3MWY W;  2EPB A;  5EKI A;  1F2L A;  3GV3 A;  4UAI A;  5T1G A;  3Q6S A;  5D65 A;  5CBA E;  3LWE A;  1HFG A;  1RTO A;  1HUM A;  1HRJ A;  2NZ1 D;  2CVR A;  1S4Z A;  4ZLT F;  2BDN A;  1U4R A;  2HCC A;  3IL8 A;  5EPL A;  1B53 A;  4RA8 A;  2X6L A;  1PFB A;  4O42 A;  1SDF A;  2RSO A;  1LV9 A;  2X6G A;  1B50 A;  4CJ0 B;  1G6Z A;  2KUM A;  2J7Z A;  2L11 A;  2XIW A;  5E4X A;  5EJW A;  1WTV A;  2X69 A;  2B2T A;  1TVX A;  1WVL A;  1GUW A;  1HA6 A;  5EPJ A;  1G2T A;  2K04 A;  2RA4 A;  4MHE A;  5CMD A;  5D14 A;  2RVL A;  3R93 A;  4MN3 A;  5COY A;  1BNZ A;  1JE4 A;  4X3U A;  2NYZ D;  2B2W C;  4IUV A;  3I91 A;  1HUN A;  2KVM A;  1WTP A;  1WD0 A;  5EQ0 A;  1CM9 A;  1F9R A;  4RWS C;  2FJ2 A;  2B2Y C;  2FHT A;  2FFK B;  1SAP A;  1IKM A;  4QUC A;  3H91 A;  2MJ8 A;  2B2V C;  2D9U A;  5AFW A;  3SVM A;  2H1E A;  4IUP A;  1RHP A;  5DNF A;  2MP1 A;  2MGS A;  3FPU B;  1EIH A;  3ONA B;  4IUQ A;  1F9S A;  4NW2 A;  1BBX C;  1J8I A;  3GV6 A;  1G2S A;  1BO0 A;  1NCV A;  2KEC A;  4ZKB B;  1IKL A;  1O7Y A;  2JYO A;  1HFN A;  1WTQ A;  4LMQ D;  4HSV A;  4ZAI A;  1ILQ A;  3TN2 A;  3KUP A;  5E4W C;  2KEE A;  2B2U A;  3QO2 A;  3IFD A;  1WTR A;  4IUU A;  1RJT A;  1PFN A;  2K05 A;  1A15 A;  1U4P A;  3DEO A;  2K03 A;  4HAE A;  4HCS A;  5EPK A;  3I90 A;  2R3Z A;  1PFM A;  3G7L A;  1F9Q A;  1NAP A;  3F2U A;  4DN4 M;  1XYI A;  1DOL A;  2IL8 A;  2L12 A;  3TZD A;  2FMM A;  1ESR A;  4CJ2 C;  4CJ1 B;  1DON A;  5CBE E;  2HUG A;  2MPM A;  3UI2 A;  2M2L A;  1B3A A;  3KBX A;  3DEP A;  2HDM A;  1KNE A;  2Q8R E;  1O7Z A;  1IL8 A;  1E0B A;  2KOL A;  3HP3 A;  1C8C A;  1CA6 A;  1J9O A;  4IUT A;  1AZQ A;  3I8Z A;  4OIJ A;  4XT1 B;  4QUF A;  4X3K A;  1MGS A;  1QE6 A;  4X3T A;  1PLF A;  4OIK A;  1WTO A;  1ILP A;  2B2Y A;  3P7J A;  1MSH A; 
#chains in the Genus database with same CATH topology
 2EE1 A;  3HFZ B;  4BBS B;  4A3I H;  2QGQ A;  1TY2 A;  4YY3 Q;  4YCW A;  2UUA L;  1YHB A;  2R92 G;  5FJ8 G;  4PMC A;  2J0T D;  4XT3 B;  1YIJ A;  4A3D G;  1B4O A;  4LF6 L;  4JI4 L;  1TWF H;  3S14 B;  5JJI A;  2NWG A;  5T1I A;  1X3P A;  4MZ9 A;  1EU4 A;  5K5P A;  4TKO B;  4LF4 L;  3J7A 5;  3VR4 A;  3NEL A;  1U4M A;  5FLM H;  3TZU A;  3EQL C;  1XNR L;  3I4L A;  4A3K B;  2Y0S G;  2JA5 G;  3KBG A;  2DN8 A;  1VMC A;  2KCT A;  2JA6 B;  1TKW B;  2EY6 A;  5LMN Q;  4DR7 L;  1H9S A;  2K75 A;  4EQO A;  3OSO A;  5JAV A;  1UE1 A;  5T1G A;  5BN4 A;  4RGT A;  1JB7 A;  3J7A F;  3PO2 G;  2HIX A;  4RKB A;  3PUW A;  1DXM A;  3V96 A;  1MJE A;  3EVQ A;  2AKW B;  3C2P A;  1SRO A;  1CI3 M;  1U4R A;  4CKE A;  1Y1W H;  3MXN A;  5A2Q E;  1D1K A;  3EFX D;  1HCZ A;  4PQX A;  4JI7 Q;  2Z1C A;  2NB0 A;  5KIX A;  2D62 A;  4GLX A;  1B9M A;  5E4X A;  2XRQ D;  1IBK L;  2VB2 X;  1G2T A;  1Y8N B;  1E22 A;  3FPP A;  4OWX B;  3T53 B;  4KHV A;  4DR2 Q;  2UU9 Q;  3NWT A;  4X64 L;  5C6A A;  4KHZ A;  4L5R C;  1V43 A;  1IW7 C;  4PZ7 A;  4YHH Q;  1S40 A;  4HJ5 A;  1XMO Q;  1J5E L;  5GAE C;  3D3R A;  3RD4 A;  2HIV A;  1J6Q A;  2YU9 B;  4HMI A;  2KCC A;  1F9S A;  1NNX A;  4NW2 A;  1GD7 A;  1BO0 A;  1AE2 A;  1IKL A;  3KJP A;  2OF1 A;  1WTQ A;  1U5K A;  3H09 A;  1SYC A;  3FKI G;  3S1Q H;  1CHQ D;  1PFN A;  3LWU A;  2K03 A;  1B3Q A;  4C3I B;  1IW7 D;  2IX0 A;  3MXU A;  3K5N A;  5F2D A;  1I6H H;  3L3O C;  1DON A;  3KBX A;  3OW7 A;  4IOC A;  1YNJ D;  2EYJ A;  4JI8 L;  1IHZ A;  2IHE A;  2UUB L;  1I4R A;  1BCP F;  4XT1 B;  5CV5 A;  2JA8 H;  3RR5 A;  5BR8 Q;  1N33 Q;  1VQF A;  3DMU A;  1JIC A;  3GTO B;  1SMX A;  2D0O A;  3RZD H;  1RKN A;  3QIA A;  1TWC H;  1EL0 A;  2HDL A;  2L9H A;  1UE6 A;  1TY0 A;  5C4X H;  1K0S A;  3M9B A;  3DWP A;  3A7L A;  5C3E H;  2VW9 A;  3J81 i;  3T4A C;  1W6J A;  1K8M A;  2VB3 X;  3F2C A;  2K52 A;  4FF3 A;  3GTP H;  2MQH A;  4GKK L;  4FYD A;  1LT6 D;  3TDQ A;  2AQ1 B;  2Z8L A;  3I4M H;  4K5V A;  5GQO A;  5FO7 B;  3STB C;  2KCM A;  3G48 A;  1PXU A;  3DWQ A;  1KAW A;  1I6V C;  3G6J B;  2QEX A;  4X65 L;  1FR3 A;  3BZD B;  3K7U C;  3IL8 A;  1EY7 A;  2WII B;  2B63 B;  4BBR H;  1XMO L;  1G29 1;  2LXK A;  1LTG D;  1PTO D;  4J8Q A;  1PZJ D;  5FJ8 H;  2EYF A;  5EPJ A;  2ASB A;  3P75 A;  1OTC A;  2Z4I A;  2OWO A;  2GN5 A;  1WTH A;  4X65 Q;  1BVS A;  3R3O A;  1WD0 A;  5E1F A;  5C44 G;  3AQQ A;  4ZQ3 A;  5LMU Q;  1Q81 C;  3H91 A;  3UDG A;  3A5U A;  4HJA A;  1IBL L;  5HUR A;  4Y52 H;  1HQR D;  2D9U A;  5ELF A;  3X3M A;  1RHP A;  2XRS D;  2E5L Q;  4YHH L;  1J5E Q;  1HR0 L;  4GKK Q;  1HFN A;  1UAP A;  4WRD A;  3A54 A;  4RHS A;  5E4W C;  5J39 A;  3RNU A;  3TP5 A;  1AH9 A;  2CW0 C;  3I4N H;  3K7A H;  4HAE A;  1ENC A;  2R3Z A;  5IWA L;  4DN4 M;  4LK1 C;  1SNQ A;  2IL8 A;  2JEB I;  1IBM Q;  4G4K A;  3O13 A;  2D0P A;  3ER0 A;  1Q90 A;  2V1C C;  3FEW X;  4K2K A;  4DFA A;  4LF7 Q;  2VL6 A;  1LT3 D;  2B39 A;  3S2H B;  2A68 D;  1I4G A;  3URY A;  4CHT B;  5EAY A;  3BVZ A;  1ZXT A;  3P20 A;  1LT5 D;  3ND9 A;  4ME3 A;  1QVG A;  4BY1 B;  1L1O B;  1SYF A;  2ID0 A;  2F0I A;  1JCK B;  2I07 B;  3RLN A;  5KGU A;  3T56 B;  2CHB D;  3K7A B;  2C5C A;  3PO3 G;  3S1R H;  1DOK A;  4PNY A;  2PQE A;  3G71 A;  1QUQ B;  4DNT B;  4LF9 Q;  2CFM A;  3MFG A;  3GV3 A;  3VR5 A;  1PH7 A;  1YI2 A;  4IFD J;  3Q6S A;  3PUZ A;  5C0X I;  4K6D A;  4OO1 I;  4K0K Q;  5M3M B;  4H7B A;  4AYB E;  1O7L A;  3CU7 A;  4YCU A;  4K5X A;  3SDZ A;  4A3G B;  4UHV A;  3LGJ A;  4V19 0;  3J81 c;  3F2B A;  4N9T A;  3KJO A;  1RCV D;  4IZ8 A;  1EWH A;  1OO9 B;  1RDP D;  1EIF A;  1WTP A;  2WAQ G;  5IOD A;  1IBM L;  5J22 A;  3H3V C;  2AHO B;  1XJV A;  3FVQ A;  2OEO A;  4C3J G;  1HH2 P;  1H9M A;  3I4M B;  5C4J H;  1EIH A;  3JAM i;  3QOL A;  4P75 A;  2MFI A;  2JEA I;  1NCV A;  1HPC A;  2HQL A;  2JYO A;  4P73 A;  4IOA A;  1HNX L;  2NBF A;  3ULP A;  5I6Y A;  1VCI A;  4HCE A;  1WI5 A;  3I90 A;  4JBM A;  5GAD C;  2CKZ B;  2L12 A;  5EKL A;  2LKV A;  3Q0A A;  1JOK A;  1JWS D;  2EJG C;  3L7Z C;  1ET9 A;  2KJX A;  4IQZ A;  1PZI D;  4DR4 L;  1TR5 A;  1JR0 D;  1VQA A;  3KK7 A;  3NXW A;  3CP0 A;  4BBS G;  3I56 A;  2KA7 A;  5FLX L;  1WYD A;  2JA8 B;  4TRD A;  4GZY C;  1EIG A;  1PDQ A;  4FVM A;  3K80 C;  4I65 A;  4FNF A;  2PYK A;  1GUS A;  4RCO A;  1TWH H;  5JOB A;  1HHV A;  1BBU A;  3U50 C;  2N55 A;  2F0T A;  2JXM B;  3MVV A;  4A93 H;  2EOT A;  2JP1 A;  4KK7 A;  5IY0 A;  2BH2 A;  2A6H C;  1ICW A;  3HOZ H;  2F0W A;  4KD3 A;  4DNI A;  1OXX K;  4K14 A;  4LWC A;  3J80 E;  1FJG Q;  2SEB D;  2F0Q A;  1F9P A;  3K5O A;  4YIJ A;  2MUY A;  3BZC A;  2PQA B;  1YJW A;  1AFP A;  3F2D A;  1SE8 A;  2I5L X;  1V8Q A;  3OW2 A;  5M5W H;  3ZYY X;  3KLS X;  1OXV A;  3ZJY C;  1IBK Q;  5KNB A;  1B50 A;  1G6Z A;  5EJW A;  2Z0S A;  3BYY B;  1TVX A;  4QB4 A;  4NXM L;  1EY4 A;  4DXF A;  5IYB G;  5KEE A;  3R93 A;  4JI8 Q;  1PTO C;  4K5W A;  3AFP A;  3IRB A;  2IT1 A;  1HUN A;  4XTC S;  3C1F A;  4DK0 A;  1X56 A;  4LW1 A;  5BR8 L;  1N33 L;  3HOW H;  4QUC A;  1RF2 D;  4C2M B;  4ULL A;  3GD7 A;  1VQ8 A;  4ME5 A;  1EFW A;  5IGF A;  2ENB A;  1STH A;  3FPU B;  2ZJQ A;  2A69 C;  1EY8 A;  5CYU A;  2KEC A;  4A3K H;  1EYC A;  4DAY B;  5I9O A;  3FMC A;  3MEF A;  4DV1 Q;  3NK9 A;  1HXY D;  1I94 L;  4KY5 A;  1SEB D;  4A75 A;  1K8G A;  2WV6 D;  1I3Q H;  1TWA B;  2R7Z G;  1PMR A;  4S3S A;  3JAM c;  1DOL A;  3HS0 C;  2ALY B;  3T1Y Q;  1TWH B;  2E2D C;  1CSQ A;  2F52 A;  1VQI A;  4V0B A;  2UUA Q;  3HOY G;  1A0I A;  3KF6 A;  4GN5 A;  4MNO A;  4P74 A;  2PMZ B;  3WWV A;  5LHY 1;  1WCM H;  2PZW A;  1CA6 A;  4A3I B;  1S3O A;  1J9O A;  4DUY L;  2A73 B;  3KF6 B;  1IZ6 A;  3X3N A;  3T16 A;  1FJG L;  2B2Y A;  4XQJ A;  5E3F A;  2ZTE A;  1HR0 Q;  5IGG A;  2E75 C;  3M4Q A;  2AWN A;  4JI0 L;  4GKJ Q;  1JT8 A;  2EZV A;  3DM3 A;  4DKA C;  2F0U A;  1IXR A;  1GVP A;  1QIL A;  4ZK9 B;  4FDB A;  2NN6 H;  1AZP A;  3Q8D A;  4ABN A;  1RL2 A;  2QEJ C;  4DV2 L;  2DY8 A;  5A2Q L;  1L0Y B;  2ZJP A;  1WTW A;  2N78 A;  4DUZ L;  1Y1V B;  3HOW G;  2Q2H A;  1HTP A;  1S5F D;  2I5H A;  4Q5V A;  5IP7 G;  3HOZ B;  2XWB B;  1YHA A;  2NN6 G;  1B2T A;  3PQI A;  3A8J E;  3U4Z A;  5A35 A;  1F2Y A;  3S14 H;  3HKZ B;  4LF4 Q;  2NTS A;  2OQK A;  3TQY A;  5IGB A;  2F0P A;  2Y0S E;  4OEL B;  3CME A;  4C3I H;  2NZ1 D;  3PIO A;  1EY9 A;  1LAB A;  2R6G A;  5HY6 A;  5IT9 c;  2BOS A;  1Y14 B;  3V2T A;  5M9O A;  3D8G A;  1D7Q A;  3GTG B;  3I73 A;  4TVA B;  2L11 A;  2J7Z A;  2VS1 A;  4LF8 Q;  1E1T A;  2WB1 G;  1WTV A;  1VQL A;  2WIN B;  4LUZ A;  3SR1 A;  1HNZ Q;  1D5X C;  3UDI A;  2YU9 H;  4MN3 A;  4DXG A;  2K7V A;  3EBE A;  2MO1 A;  4IUV A;  3ICE A;  2AUK A;  4IO9 A;  2F0S A;  1JJ2 A;  4RWS C;  4K8I A;  3VYT A;  1FNU A;  4RGM A;  3MXP A;  1CKN A;  2EXD A;  1JE5 A;  5JJL A;  1QZH A;  3A74 A;  1KC8 C;  3RLF A;  4CDE C;  3I4O A;  1J8I A;  4DV6 L;  3HOV B;  1X65 A;  4A76 A;  1D5Z C;  2ES2 A;  5C4J B;  4XXE A;  2KEE A;  1VQ5 A;  3PCO B;  2BDO A;  3HKZ E;  1U4P A;  1DCZ A;  2PMZ E;  5CC4 A;  2F0G A;  5I4D A;  2Q2T A;  3OPO A;  5C0X H;  3DEP A;  3U58 A;  1R4P B;  3HKZ G;  2K5W A;  5FLX c;  2HQE A;  3HP3 A;  2E76 C;  4F7X A;  1SYG A;  3OHX C;  1MGS A;  1QE6 A;  3G4S A;  1ASY A;  1RD9 D;  5M3F H;  1LO5 D;  3A8I E;  4KI0 A;  4B3R L;  5I6W A;  1RIP A;  4UDU C;  4JI3 L;  4R9W A;  4JV5 Q;  1ZYR C;  2K28 A;  5CV9 A;  3U9O A;  2F4V Q;  3W2D A;  5COR A;  1E2Z A;  1SMY D;  4DGZ A;  2QDB A;  1W3S A;  1PH1 A;  2A6E D;  4B3M Q;  4E6I A;  4OHJ A;  3TRE A;  4LUO A;  4BBS H;  1QG7 A;  5CV6 A;  1X3E A;  5KRU A;  1N9W A;  1P16 A;  4OWW B;  2LXJ A;  1BF4 A;  1YZ6 A;  2OTJ A;  1JJG A;  2LSS A;  2ZJR A;  4CDD C;  2V4D A;  4J15 A;  3H0G H;  5EKI A;  1D1I A;  1F2L A;  2NVY B;  3C3L A;  4HJ7 A;  1CK1 A;  2R7Z B;  1X3F A;  3CCL A;  2DGY A;  4M8A A;  5LMN W;  1V1O A;  2KHS A;  2JN4 A;  2OQ0 A;  5FKA C;  2RSO A;  2N3S A;  1SR3 A;  2KUM A;  1TS4 A;  3HOV H;  3S1M B;  2ZTD A;  1HJP A;  4AQY L;  4DV6 Q;  4JI7 L;  3GTK H;  1S5C D;  2H5X A;  4R4T A;  1BNZ A;  2E2I B;  2RKS A;  3M4O B;  2WKC A;  3GDE A;  1KHI A;  1UEA B;  3L2P A;  4LFB L;  2NUC A;  1H9K A;  2WAQ B;  4DUY Q;  1Q8K A;  1HZB A;  4IUP A;  2ATW A;  3AYH B;  3L9A X;  1HNX Q;  1W6K A;  3CC7 A;  4A3B G;  5CGK A;  3IAY A;  3GV6 A;  3HZX A;  3P1H A;  4DF7 A;  3TRZ A;  1A2T A;  3R2I A;  3PUX A;  1UWV A;  3K8A A;  2B2U A;  4JI3 Q;  2K05 A;  3B6Y A;  1A15 A;  3GTQ H;  2L55 A;  2XNA C;  1WFQ A;  4DR4 Q;  2R7Z H;  2JA7 B;  4DR6 L;  4TQU S;  3T51 B;  2PO4 A;  1JMC A;  4DV7 Q;  1C8C A;  1LTS D;  1BDO A;  4DV5 L;  3V05 A;  2Z9H A;  1GKH A;  1P8L A;  5DM7 3;  1SFO H;  4OIK A;  2ICI A;  2O2L D;  1EZ8 A;  4IPG A;  1ONL A;  5AJ3 L;  4R1J A;  4YY3 L;  4G7H C;  4QIW B;  1VQO A;  4A3B H;  2B2U C;  1CFM A;  1EQT A;  4RFB A;  1DOM A;  2CH4 A;  4QY7 A;  4Y7N B;  4AIM A;  3VA7 A;  1EUJ A;  1A63 A;  1TWC B;  3R2T A;  2KBN A;  1V1Q A;  2DY7 A;  1VQM A;  1R9T H;  3CC4 A;  1DZ1 A;  4DR5 Q;  4JI6 L;  3H15 A;  4LJZ C;  4XQQ A;  4DAY A;  1N34 Q;  2UXD L;  2JQO A;  1JB3 A;  1BOS A;  4AYB B;  5EBD A;  3SGI A;  3CF5 A;  2CWP A;  2QW7 A;  2DJG C;  3M85 A;  4LFC L;  3BDC A;  5M5Y B;  4FF1 A;  1GM5 A;  4YWL A;  1HRJ A;  3W3A A;  3S1Q B;  4LUV A;  4N9P A;  2AWO A;  1IBL Q;  1LV9 A;  4CJ0 B;  1PH3 A;  3NBI A;  5G3L D;  2VQE Q;  3W1G A;  1O7I A;  1VQK A;  2K5H A;  2RA4 A;  1L0X B;  1STB A;  1S5D D;  3KF8 A;  1UE7 A;  3DXJ C;  4B3M L;  1HNZ L;  3QWN A;  2NVT B;  2J4X A;  1CM9 A;  5D3D A;  3S16 B;  4O2D A;  1E24 A;  1I4P A;  4J1M A;  1II3 A;  4A3J H;  3NTI A;  1KAA A;  4BXX H;  1HTL D;  1VQH A;  3H94 A;  4IPD A;  5FO9 B;  3ONA B;  3W1B A;  3TP7 A;  2WAQ E;  5IYB H;  3I7F A;  1LLR D;  4A3G G;  1TXY A;  3Q22 A;  1ZKO A;  3GTG H;  3QO2 A;  1Y1W B;  4BBR B;  1QZG A;  2IPK D;  1V9P A;  1Q12 A;  1KIX A;  2BA0 A;  3NE5 B;  3MZ5 A;  1A8V A;  2VY3 A;  4IN3 A;  1Q7Y C;  1JWU D;  4DV0 Q;  1AE3 A;  1SND A;  4DR2 L;  3I4M G;  4DPG A;  2A1A A;  1B3A A;  1GOZ A;  4JOI C;  5K36 G;  3J81 j;  4QUF A;  1PYS B;  5GRO A;  1VQG A;  4JBJ A;  2RBM A;  2XGT A;  5BN5 A;  3RZO B;  2G9H D;  4NB3 A;  3S9W A;  4DV5 Q;  1PH5 A;  2MHV A;  2ZT9 C;  4JBW A;  3W5O A;  2D5D A;  4H02 A;  4XDX A;  1N34 L;  2UXD Q;  1JC7 A;  4P72 A;  1GHJ A;  3KOJ A;  1CQF A;  4NXN Q;  1LAC A;  4KHP L;  3GO5 A;  5LL6 X;  1XX8 A;  2PI2 E;  2RCN A;  3WOE A;  3D6W A;  2HHH Q;  3TME A;  3BYT B;  2QF7 A;  3CRK C;  4B3T Q;  1M4V A;  1D5M C;  1NR4 A;  3M7G A;  2WKD A;  4PG3 A;  4C1N K;  4GOP B;  1GJX A;  2F1M A;  3T13 A;  1V1P B;  3DM1 A;  1EEF D;  3KDF A;  3K57 A;  3S1N H;  2NVQ B;  4OX9 Q;  4L5T A;  4JI5 L;  5H1S E;  2YTX A;  3UE1 A;  2AUJ D;  5IGD A;  2EY2 A;  1PH4 A;  3NWS A;  3FP9 A;  4G7Z C;  3S16 H;  1HFG A;  3S2D H;  1RTO A;  3PIP 3;  2E5L L;  3A56 A;  4LF5 L;  4JI2 L;  1B53 A;  5FOB B;  2EVB A;  2EY5 A;  1SDF A;  4APV A;  4JG2 A;  1BKB A;  4JCV E;  1GUW A;  4DU9 A;  3S15 B;  2NZO A;  1FNV A;  4HJ9 A;  3J7Z C;  1JE4 A;  4POG A;  2B2W C;  5C5M A;  2IX3 A;  1S72 A;  5C3X A;  3MFY A;  2FJ2 A;  3HOZ G;  4BY7 H;  3PO3 B;  3CCJ A;  1QB5 D;  1ASZ A;  4DV2 Q;  4G7O C;  2MGS A;  2K14 A;  4PMB A;  3E3X A;  3MHB A;  3NBH A;  1UUP A;  4IUU A;  4JW0 A;  1A6X A;  1BR9 A;  2F0V A;  1IYJ B;  1F9Q A;  4N8F A;  1K83 H;  2F3W A;  2K33 A;  1ENF A;  2NVY H;  1ESR A;  1AN8 A;  4DR3 L;  4L63 B;  5CBE E;  1KDA A;  2M2L A;  3PIO 3;  4GS3 A;  3N6R A;  3PIP A;  2R92 B;  4YWM A;  5ELN A;  3TSS A;  4IUT A;  4GNX B;  3CCU A;  1YNX A;  2QIL A;  2G5D A;  3BJU A;  3UDF A;  2A6H D;  1K3B C;  1NTG A;  4DV4 L;  3DHQ A;  5IYC G;  1XXG A;  2SDF A;  3RMH A;  2DNE A;  2RHQ B;  3CKI B;  5IYC H;  2YV5 A;  4OX9 L;  1STA A;  2L0C A;  2HT1 A;  4UP9 A;  1XTC D;  1ET6 A;  4XQN A;  2MO0 A;  1E7Z A;  3HOU H;  4OWT B;  3AFQ A;  1U9R A;  2XTI A;  1G91 A;  1FGB D;  1EY5 A;  5EGT A;  2JE6 I;  2F3V A;  4HED A;  2XWJ B;  1OXU A;  4F8M A;  4WJ3 M;  2Z6K A;  1FD7 D;  2FIN B;  1R4Q B;  5ELB A;  1JJC B;  4CDC C;  2QDL A;  1F2Z A;  3AEV A;  1XPU A;  2L4N A;  5ISR A;  4J6H A;  5JVH 3;  3EJI A;  3K0Y A;  4DK1 A;  1K83 B;  4C3J B;  1NSN S;  1NUC A;  1N32 Q;  4C1N I;  1FYC A;  4LFC Q;  3NP8 A;  3TBI B;  1B44 D;  5KND A;  1PFS A;  3J81 L;  4GNX A;  3PGZ A;  2XIW A;  2BH8 A;  2B2T A;  1WVL A;  1SJH D;  1EZ6 A;  4MHE A;  1EQV A;  4CDF C;  1JOQ A;  1PRT C;  2OCE A;  4NXM Q;  2B2Y C;  3PO3 H;  4BY7 B;  1I50 H;  1T9H A;  2FFK B;  1N8R C;  2MJ8 A;  2E2H H;  4RHR A;  1ENA A;  3A0J A;  5DNF A;  4GLA C;  3D4W A;  1D6E C;  2WB1 B;  3JAM E;  3OIP A;  3BS1 A;  3HOX G;  4AQY Q;  1N36 Q;  3GTK B;  4ZKB B;  2K5Q A;  3PV0 A;  1I5F A;  2SNM A;  3VR6 A;  4HSV A;  3H3V H;  1YBY A;  2IX1 A;  3FHW A;  3NSW A;  2UUB Q;  4A3G H;  4HCS A;  2Q2I A;  1ICF B;  4IJL A;  4DV0 L;  1MD2 D;  5I9P A;  1BCP B;  2R7D A;  4ZUJ A;  1Q1B A;  3OWF A;  5M5X H;  1CZW A;  1ZYR D;  4A3J G;  4LF7 L;  2EYH A;  1QCB D;  4JV5 L;  3STB D;  2PI2 A;  3RN2 A;  1SN8 A;  3S1N B;  1Z47 A;  1KDC A;  3NHH A;  3ITP A;  1B9N A;  3M3Y H;  3OTO L;  1CKO A;  3ULJ A;  1PRT B;  5C4Z A;  1EOV A;  5KNC A;  1VQ9 A;  4FXD A;  4F88 A;  1L1O C;  4X3S A;  1BCP C;  1LTI D;  4RAU C;  2NN6 I;  4JVZ A;  3RN5 A;  1A2U A;  3OYY A;  3JC6 6;  2N88 A;  2B2T C;  4QGU A;  4RGO S;  3CHB D;  1RTN A;  1N32 L;  3I2Z A;  2IHF A;  2B29 A;  1X3Q A;  5C4X G;  3RZD B;  4HMJ A;  1TS5 A;  1Q82 C;  1A3U A;  2A68 C;  4QQB X;  3S2H H;  1ROD A;  1VQC A;  1ML0 D;  1WCM B;  4OGQ C;  3HOY B;  1PH9 A;  3PO2 H;  2RCF A;  4UAI A;  1I6H B;  4A3K G;  2EYP A;  3BU2 A;  1I4Q A;  4K8J A;  3MC0 B;  1KAB A;  2Z6K C;  1LTR D;  4ZLT F;  3U4V A;  3T1H Q;  3CQZ H;  4Z9C B;  4FP5 D;  2D2C C;  3PSI A;  1A3V A;  5JPM C;  5EKK A;  1YJ9 A;  2LFN A;  4B9X A;  2EYL A;  2K04 A;  2DUD A;  2RDH A;  2GVA A;  2SOB A;  5CMD A;  2NVX H;  1STN A;  2RHS B;  2F0L A;  2KQ3 A;  4RMF A;  2GA4 B;  4C2M H;  5EQ0 A;  4XYO A;  2IW3 A;  4NKL A;  2FHT A;  4CGY B;  5C0X J;  3KLS A;  5KYL A;  2O5I C;  2IY5 B;  4IFD I;  4A3I G;  1Q86 C;  2F0O A;  2EJF C;  5AFW A;  2Z6B A;  2EYO A;  1AEX A;  1JOR A;  1BBX C;  1G2S A;  3MXN B;  2R93 H;  2BCO A;  1CSP A;  1EU3 A;  4O0A A;  2JA9 A;  5IOC A;  2QA4 A;  1PVO A;  1V1P A;  4NP5 A;  1SYD A;  2N8N A;  3PMF A;  2EXZ A;  1Y1W G;  1PTO F;  1XYI A;  2A6E C;  2ZXO A;  4KKS A;  1PYB A;  1Y8P B;  4CJ1 B;  1CZG A;  2E2J H;  4IPC A;  2OXP A;  4A3L H;  4DR1 L;  1Y8O B;  4EVO A;  1X54 A;  2F0J A;  2TSS A;  2ZXP A;  4GLV B;  3VR2 A;  5EBC A;  2JA6 H;  1Z9F A;  3EIV A;  5CV7 A;  1GUG A;  3DUZ A;  3K5L A;  2I46 A;  2PPB C;  4X64 Q;  1MSH A;  1R9T B;  3SE0 A;  4DR1 Q;  3CCR A;  2LMC B;  3HG9 A;  3OMG A;  3QB3 A;  3BDO A;  4R8I A;  1C0A A;  1CKN B;  2CQO A;  1GUT A;  3F8T A;  4A3B B;  1MSG A;  1TWA H;  3CRL C;  3MA2 B;  2RDF A;  3L0O A;  4C3I G;  1VQ6 A;  4OO1 H;  2K6A A;  4IPH A;  2PNR C;  4OO1 G;  1T5X D;  1H9S B;  1Q3L A;  1Y1V H;  2KED A;  4H13 C;  3FRP B;  5GAG C;  3NUC A;  1PYW D;  3GTM H;  1TT2 A;  5LMN L;  4A3F B;  2R93 G;  3CPW A;  1XWE A;  1K9M C;  1MBY A;  2JA7 H;  4LFB Q;  3OTO Q;  2EQS A;  1EYG A;  2Z4H A;  1PH8 A;  2QKI C;  3LWE A;  4DAV A;  4B3T L;  2NVT H;  4CKC A;  5L37 A;  2K50 A;  1SYB A;  4R4O A;  4JK1 C;  3DWA A;  4IAL A;  1SRU A;  4FXK C;  2RVL A;  3K81 C;  2Q8I B;  3ERS X;  1VQ4 A;  1L0W A;  4KN7 C;  4RH6 A;  2KVM A;  1F9R A;  4C3H B;  5HGQ A;  2PQA A;  4MTN A;  2K5D A;  3A5Z B;  2UU9 L;  2VNU D;  1HZ9 A;  2CH4 W;  2CQA A;  3RUZ A;  3PO2 B;  2B2V C;  4DV7 L;  1QWY A;  3HOY H;  4H44 C;  5I2X A;  1EYA A;  4X62 Q;  2FMC A;  4ZAI A;  3VA5 A;  5IIF A;  3KUP A;  3AU7 A;  4G57 A;  1QUQ A;  4OXP A;  1VQJ A;  2GVB A;  3E0E A;  4JI5 Q;  1L1O A;  1PFM A;  5IYD H;  5KYI A;  4OL7 A;  3HOW B;  4Y7N H;  2OT2 A;  3TZD A;  2AQ3 B;  4CJ2 C;  1VS0 A;  2F0E A;  4L5S A;  5IWA Q;  3GTJ H;  2ZM6 Q;  2HDM A;  1LTT D;  2KHJ A;  2UXC Q;  1E0B A;  2VUM B;  4JI2 Q;  1U0L A;  1NE3 A;  5JEA H;  4KLK A;  3HKS A;  3Q23 A;  4JYA Q;  1ILP A;  1KL9 A;  3S1R B;  1SFO B;  4KD4 A;  4KMU C;  3M3Y B;  4I7Z C;  3H6M A;  4LF9 L;  4QJF A;  1PA6 A;  3CW2 C;  1TWF B;  3PUV A;  4A3M B;  4BY1 H;  1DYQ A;  2TMP A;  3SK4 A;  4U68 A;  5JVG 3;  3U9S A;  2QCP X;  5JJK A;  1JOO A;  1QJO A;  4PZ6 A;  3GTQ B;  4C3H G;  1EQQ A;  2VQF Q;  1DGS A;  4BBR G;  1U4L A;  3N52 A;  3WOF A;  4ZKC B;  2L1B A;  1K28 A;  4RG1 A;  4X6A H;  1C7Y A;  3J80 c;  2K1B A;  5IP7 H;  3HGB A;  4NDX A;  1AP0 A;  4B3R Q;  2PCF B;  3VDY A;  1H9R A;  4PZ8 A;  2E2J B;  5HGT A;  1KRS A;  1PTO B;  4A3E G;  1A3T A;  1QVC A;  5I2Y A;  1HUM A;  3SXH A;  3MXG A;  1S4Z A;  4UPA A;  3I4N B;  4R4C A;  5EPL A;  1A62 A;  4A3C G;  3RLO A;  4DAP A;  1NJI C;  3KFU A;  2NTT A;  3MEH A;  3VR3 A;  3S1M H;  2MNA A;  3K59 A;  1GUN A;  3HEJ A;  5C3E G;  1MJC A;  4U67 3;  1X9N A;  1PH2 A;  2K5V A;  4LF5 Q;  5FLX E;  2HD3 A;  1BBW A;  4LNQ A;  4WJ4 A;  1LT4 D;  2EIF A;  1TS2 A;  3D6C A;  4ALP A;  3QR8 A;  4P2C B;  2H1E A;  2UXC L;  1SNC A;  2DJF C;  4EQN A;  4KY6 A;  4IUQ A;  1CTM A;  1EEI D;  1Z7T A;  1IYU A;  4JYA L;  4LF8 L;  4GN4 B;  1HR0 W;  4OON A;  2B63 H;  4EQP A;  3IFD A;  1TII D;  4RGN A;  2JSO A;  1O78 A;  1RJT A;  4KN4 C;  4DR7 Q;  2YTY A;  2F0N A;  1GUO A;  1DM0 B;  3CAM A;  1I50 B;  1M1K C;  2FMM A;  3M4O H;  4HTH A;  4A3M H;  2EY1 A;  1N36 L;  4DAM A;  2F0F A;  1EY0 A;  4L8J A;  3G6E A;  3PUY A;  2HHH L;  1KNE A;  1PV4 A;  1IL8 A;  4ZUI A;  4AH6 A;  1I94 Q;  1SJE D;  1YNN D;  4LF6 Q;  1BCP D;  1KLU D;  5M3F B;  2CW0 D;  1SLJ A;  3P7J A;  5CV4 A;  1XMQ L;  2VQF L;  1TQO A;  4WFN 3;  4DUZ Q;  3T1H L;  4A4I A;  1WD1 A;  1Y1V G;  2R92 H;  1UEB A;  5ELC A;  1BXT A;  3ND8 A;  5DAU A;  5M3M H;  5C4X B;  2F3I A;  4AYB G;  2WP8 J;  1O80 A;  3J80 L;  4GNX C;  1B70 B;  1F2M A;  4JI1 Q;  3H0G B;  4WOR A;  1UE5 A;  4HIK A;  3J81 E;  4HIM A;  1STE A;  4KTA A;  4FF2 A;  2K01 A;  2LS0 1;  2DNC A;  2E8G A;  1VQE A;  1VMP A;  5LMU L;  4YWK A;  1XNQ L;  4JI6 Q;  3S17 B;  4OEM B;  5GAH C;  4A3E B;  4B3S Q;  3KLR A;  2VUM H;  1HNW Q;  4LAA A;  1D8L A;  4HJ8 A;  5IP9 G;  3GTJ B;  2KHI A;  1SE4 A;  3K0X A;  3CC2 A;  2IWH A;  2A19 A;  4DA2 A;  1YJN A;  1K8O A;  1CKM A;  1VQN A;  5M5X B;  4CBV A;  3EN2 A;  3E9I A;  1C48 A;  4ILW A;  1XPO A;  4ID6 A;  4P71 A;  2F0D A;  3TS2 A;  3FKI B;  1MKH A;  1SNP A;  4DR6 Q;  4LFA Q;  2VUM G;  2B8G A;  4FO2 A;  4UY8 C;  2A69 D;  4F87 A;  3Q24 A;  4GOP C;  3C1E A;  1VQ7 A;  1HA5 A;  3I91 A;  2EJM A;  4DV1 L;  3IFT A;  3CCE A;  5M3F G;  3J80 i;  1SAP A;  3NTK A;  2PW5 A;  4CKB A;  3SVM A;  5M3M G;  2ZXR A;  1PHJ A;  1KLG D;  3NEN A;  3CCV A;  2Q2U A;  3CCQ A;  4BY1 G;  4WJW A;  2NVQ H;  2K4K A;  4ZCK A;  2ICE C;  1YNJ C;  1TU2 B;  1E2V A;  4X62 L;  2XN9 C;  4ZRZ A;  1XPR A;  5IE8 A;  3DEO A;  3SK5 A;  3VYS A;  4ODG A;  4DV4 Q;  1LTA D;  3G7L A;  1NAP A;  3F2U A;  3UE0 A;  1X3G A;  4ZYS A;  2CCZ A;  4KJN A;  2XVS A;  1TWG B;  2JK8 A;  2RQX A;  1PZK D;  3GTM B;  4JOI A;  1Y69 U;  1O7Z A;  1DJR D;  3OWE B;  3WDN A;  3J7Y W;  1AZQ A;  4DK6 C;  4X3K A;  3QG1 A;  1W2B A;  4K0K L;  2B63 G;  4B08 A;  4QCL A;  2JA5 H;  1IL2 A;  2O5J C;  2B2W A;  2G9D A;  2I5M X;  3K6O A;  2KCN A;  1EWI A;  3SK6 A;  1MHW C;  4RCN A;  3MTS A;  5C3E B;  4POF A;  3S2D B;  1XMQ Q;  1X32 A;  2R7F A;  1EQR A;  1KQS A;  5K36 H;  1CQV A;  1HQM C;  2VQE L;  4YCV A;  1M8A A;  1Q46 A;  2Q8T A;  4EGV A;  4DR5 L;  4HID A;  1CA5 A;  5CV8 A;  1I3Q B;  3CD6 A;  3KLW A;  5C4H A;  1NMF A;  1LTB D;  2JA5 B;  2EDG A;  3J7A V;  2ZM6 L;  3GTO H;  1ZEQ X;  1I4X A;  2BE5 C;  4JI1 L;  3CCS A;  1XTD A;  1MI2 A;  4LFA L;  2F0K A;  1E1O A;  1KNA A;  3NBH B;  1LM0 A;  4HN7 A;  4IJH A;  4K2L A;  1PRT F;  4L6T B;  5IGC A;  1C4Q A;  1VDZ A;  1STY A;  4JBK A;  3I3C A;  4A3J B;  1K73 C;  4PMW A;  5ELD A;  4IFD H;  5D65 A;  1FL0 A;  5CBA E;  1VQB A;  3PF5 A;  2XSC A;  4UP8 A;  2WAC A;  4EX5 A;  5J1Z A;  5NUC A;  2X6L A;  3TP8 A;  2X6G A;  3OIQ A;  4BA1 I;  2RDG A;  3VYR A;  2R61 A;  5DEH A;  2ZTC A;  2P5Z X;  3IKJ A;  5D14 A;  4UP7 A;  3ERQ A;  3QJY A;  4X3U A;  2NYZ D;  2F4I A;  1B7Y B;  1FVI A;  1VF7 A;  3M7N A;  3A7A B;  1WOC A;  1GO3 E;  1JQY D;  2EYM A;  4IUN A;  2AMC B;  3ERO A;  2MP1 A;  3OMC A;  1YVC A;  2K5N A;  4KHP Q;  3A55 A;  2M00 A;  4LMQ D;  1WTR A;  3TP6 A;  4A93 B;  4KV6 A;  1D2B A;  3NQI A;  1Q1E A;  4JI4 Q;  4DR3 Q;  3OOC A;  4FF4 A;  3CCM A;  3TEH B;  2F4V L;  2HUG A;  2MPM A;  3UI2 A;  3JAM L;  1L2F A;  1BQQ T;  1FGU A;  4A3F H;  2NVX B;  4A3E H;  2LY7 A;  3I8Z A;  3S17 H;  1PLF A;  1KRT A;  1K3R A;  2BE5 D;  2JA7 G;  1VF5 C;  5JEA J;  4NPS A;  4R4Q A;  3E6Z X;  5M5W B;  1NR2 A;  3NQT A;  3AMU A;  4DV3 Q;  2L15 A;  3HOX B;  2A74 C;  4HR7 B;  4IUR A;  1WTX A;  4X66 L;  1YIT A;  2FXQ A;  4L5Q A;  2RSN A;  1QNU A;  1E3P A;  1HZA A;  1KXL A;  2VXW A;  1KDB A;  2BA1 A;  3LNN A;  2B2V A;  1E2W A;  3BVM A;  3RZO H;  4A3C H;  2PZT A;  1F77 A;  1SNO A;  2F03 A;  4DV3 L;  1SSO A;  2N49 A;  3NPP A;  1UNS A;  1YNN C;  5LL6 S;  1CUK A;  3D31 A;  2E74 C;  2B8F A;  3MWY W;  3VYU A;  4JI0 Q;  3GP7 A;  1TWG H;  2H4O A;  3BDL A;  1LUZ A;  4NXN L;  5FLM G;  3A8K E;  5C3W A;  5JPN C;  2Y0S B;  3E5S A;  4A93 G;  2BDN A;  2HCC A;  3D4R A;  4RA8 A;  1X6O A;  1PFB A;  4TSS A;  1GXD C;  4A3D H;  5D3I B;  5TSS A;  5IYD G;  3GTL H;  2R93 B;  5IP9 H;  1HA6 A;  1MIU A;  1VQP A;  4H0L C;  1BUV T;  1SE2 A;  3MAQ A;  2O4X A;  5COY A;  1TS3 A;  2PZU A;  1HZC A;  2JA8 G;  1HNW L;  2AQ2 B;  1STG A;  1SYE A;  3GQB A;  1SBB B;  5E7N A;  1IKM A;  3EA6 A;  4QIW E;  5C44 B;  4BS9 A;  3BG3 A;  5FK9 C;  2PNH A;  1EY6 A;  3ULL A;  1CT1 D;  2WFW A;  3HOU G;  1O7Y A;  4XIG S;  3KDF B;  1ILQ A;  3TN2 A;  3FKI H;  2IJ0 A;  5IGE A;  1G6P A;  3S24 A;  3CQZ B;  4R4I A;  5ELE A;  2CWA A;  5AJ3 Q;  4QL5 A;  1OXT A;  1SMY C;  1X55 A;  2YYZ A;  3BZK A;  3LX0 A;  3SEB A;  4A3L G;  1G8Z D;  5M5Y H;  4I7A A;  3HOV G;  2A5H A;  1S5E D;  1SNM A;  1H9J A;  2KOL A;  2NZH A;  4BA2 I;  4KJO A;  1NY4 A;  3F1Z A;  5DLQ E;  3GTP B;  4X3T A;  1WCM G;  4M1U B;  1KTK A;  4JPB W;  2Q8R E;  5J3B A;  5DM6 3;  3TS0 A;  1K0R A;  5JJZ A;  4B9W A;  2UUC L;  3KYH C;  4Q0F A;  3E9H A;  4EQ5 A;  4HSP A;  3I70 A;  3H0G G;  1PRT D;  4R8N A;  3UDX A;  3HOX H;  3CPF A;  4QF4 A;  4NMZ A;  1IYV A;  4BWG B;  1Q8I A;  5BN3 A;  5C0X G;  1B8A A;  2F0H A;  3NTH A;  4PV1 C;  4DNR B;  1FNW A;  1EIY B;  2KEN A;  1QNK A;  1SXT A;  2UXB L;  5G3L F;  1EOT A;  1AW7 A;  4FXG C;  3C46 A;  3DLL A;  3FDT A;  4KY7 A;  3H3V I;  2HCI A;  1LYL A;  3KF8 B;  4C56 C;  4BY7 G;  3R8B A;  1K8A C;  1NBW A;  5IT9 L;  1YEZ A;  3PF4 A;  4GOP A;  4A3M G;  5JEA G;  1WJJ A;  3HRZ C;  2EPB A;  3HOU B;  4IFD G;  1EWC A;  4JC0 A;  2JA6 G;  3D4D A;  3M4P A;  1H95 A;  1C9O A;  5ELO A;  4K6L A;  2CVR A;  1DD2 A;  2M9V A;  1QOH A;  1JWM D;  1ESF A;  2C35 B;  4O42 A;  4N8X 1;  4B3S L;  3K5M A;  3QOJ A;  4MTK A;  3SHL A;  1XNR Q;  1CHP D;  1XNQ Q;  2X69 A;  3I72 A;  5CR3 A;  1EYD A;  4A3D B;  1NMG A;  2YTV A;  4GN3 B;  4MIU A;  4GKJ L;  5FO8 B;  5IT9 E;  1PH6 A;  4KKU A;  2E2H B;  4DK3 C;  1QVF A;  3K58 A;  4XYQ A;  3BVG A;  4C3H H;  2A8V A;  1VQD A;  3I4N G;  1KD1 C;  1LTL A;  4BXX G;  1Z6H A;  2E2I H;  2UXB Q;  3CXC A;  3I55 A;  2B3G A;  2L5T A;  1YHQ A;  4A3F G;  4QMG A;  3T1Y L;  2F0M A;  2RF4 A;  1GHK A;  1SE3 A;  1S5B D;  4RKL A;  3M4Y A;  5C5L A;  1I4H A;  2UUC Q;  2OTL A;  5C44 H;  1M90 C;  5EPK A;  3CMA A;  4X66 Q;  1OXS C;  4HIO A;  2C9O A;  2VZA A;  3SK8 A;  1B1Z A;  2SNS A;  3AB9 A;  1PTO H;  4C3J H;  2I0Q A;  1T5E A;  1EFI D;  3E0J A;  4KKT A;  3D0F A;  2PW7 A;  1G51 A;  2JJQ A;  3S15 H;  4OIJ A;  3GTL B;  2K32 A;  4O1N A;  1WTO A;  3NEM A;  2WB1 E; 
#chains in the Genus database with same CATH homology
 2EE1 A;  4BBS B;  1TY2 A;  4PMC A;  2J0T D;  4XT3 B;  1B4O A;  3S14 B;  2NWG A;  5T1I A;  1X3P A;  5K5P A;  1EU4 A;  4TKO B;  3VR4 A;  1U4M A;  3TZU A;  3EQL C;  3I4L A;  4A3K B;  3KBG A;  2DN8 A;  1VMC A;  2JA6 B;  1TKW B;  2EY6 A;  1H9S A;  4EQO A;  3OSO A;  5JAV A;  5T1G A;  5BN4 A;  4RGT A;  3J7A F;  4RKB A;  3PUW A;  1DXM A;  3V96 A;  3EVQ A;  3C2P A;  1CI3 M;  1U4R A;  4CKE A;  3MXN A;  5A2Q E;  1D1K A;  3EFX D;  1HCZ A;  4PQX A;  2Z1C A;  2NB0 A;  5KIX A;  2D62 A;  1B9M A;  5E4X A;  2XRQ D;  2VB2 X;  1G2T A;  1Y8N B;  3FPP A;  3T53 B;  4KHV A;  3NWT A;  5C6A A;  4KHZ A;  1V43 A;  1IW7 C;  3D3R A;  3RD4 A;  2YU9 B;  4HMI A;  2KCC A;  1F9S A;  4NW2 A;  1BO0 A;  1IKL A;  2OF1 A;  1WTQ A;  3H09 A;  1SYC A;  1CHQ D;  1PFN A;  3LWU A;  2K03 A;  4C3I B;  1IW7 D;  2IX0 A;  3MXU A;  3K5N A;  5F2D A;  3L3O C;  1DON A;  3KBX A;  3OW7 A;  1YNJ D;  2EYJ A;  1IHZ A;  1I4R A;  1BCP F;  4XT1 B;  5CV5 A;  3DMU A;  1JIC A;  3GTO B;  1RKN A;  3QIA A;  1EL0 A;  2HDL A;  2L9H A;  1TY0 A;  3DWP A;  3A7L A;  3T4A C;  1W6J A;  1K8M A;  2VB3 X;  4FF3 A;  4FYD A;  1LT6 D;  3TDQ A;  2AQ1 B;  2Z8L A;  4K5V A;  5FO7 B;  1PXU A;  3DWQ A;  1I6V C;  3G6J B;  1FR3 A;  3BZD B;  3IL8 A;  1EY7 A;  2WII B;  2B63 B;  1G29 1;  1LTG D;  1PTO D;  4J8Q A;  1PZJ D;  2EYF A;  5EPJ A;  3P75 A;  2Z4I A;  3R3O A;  1WD0 A;  5E1F A;  4ZQ3 A;  3H91 A;  5HUR A;  1HQR D;  2D9U A;  5ELF A;  3X3M A;  1RHP A;  2XRS D;  1HFN A;  1UAP A;  4WRD A;  3A54 A;  4RHS A;  5E4W C;  5J39 A;  3TP5 A;  2CW0 C;  4HAE A;  1ENC A;  2R3Z A;  4DN4 M;  4LK1 C;  1SNQ A;  2IL8 A;  2JEB I;  4G4K A;  3O13 A;  1Q90 A;  3FEW X;  4K2K A;  4DFA A;  1LT3 D;  2B39 A;  3S2H B;  2A68 D;  1I4G A;  3URY A;  4CHT B;  3BVZ A;  1ZXT A;  3P20 A;  1LT5 D;  3ND9 A;  4BY1 B;  1SYF A;  2ID0 A;  2F0I A;  1JCK B;  2I07 B;  5KGU A;  3T56 B;  2CHB D;  3K7A B;  2C5C A;  1DOK A;  4PNY A;  2PQE A;  4DNT B;  3MFG A;  3GV3 A;  3VR5 A;  4IFD J;  3Q6S A;  3PUZ A;  5C0X I;  4K6D A;  4OO1 I;  5M3M B;  4H7B A;  1O7L A;  3CU7 A;  4K5X A;  3SDZ A;  4A3G B;  4V19 0;  4N9T A;  1RCV D;  4IZ8 A;  1EWH A;  1OO9 B;  1RDP D;  1WTP A;  5IOD A;  5J22 A;  3H3V C;  3FVQ A;  2OEO A;  4C3J G;  1H9M A;  3I4M B;  1EIH A;  3QOL A;  2JEA I;  1NCV A;  1HPC A;  2JYO A;  2NBF A;  5I6Y A;  1VCI A;  4HCE A;  3I90 A;  2L12 A;  5EKL A;  2LKV A;  3Q0A A;  1JOK A;  1JWS D;  2EJG C;  3L7Z C;  1ET9 A;  2KJX A;  4IQZ A;  1PZI D;  1TR5 A;  1JR0 D;  3KK7 A;  3NXW A;  2KA7 A;  5FLX L;  2JA8 B;  4TRD A;  4GZY C;  1EIG A;  1PDQ A;  4FVM A;  4I65 A;  4FNF A;  2PYK A;  1GUS A;  4RCO A;  5JOB A;  1HHV A;  2N55 A;  2F0T A;  2JXM B;  3MVV A;  2EOT A;  2JP1 A;  4KK7 A;  2A6H C;  1ICW A;  2F0W A;  4KD3 A;  3J80 E;  1OXX K;  4K14 A;  2SEB D;  2F0Q A;  1F9P A;  3K5O A;  4YIJ A;  2MUY A;  1AFP A;  1V8Q A;  3ZYY X;  3KLS X;  1OXV A;  5KNB A;  1B50 A;  1G6Z A;  5EJW A;  3BYY B;  1TVX A;  4QB4 A;  1EY4 A;  4DXF A;  5KEE A;  3R93 A;  1PTO C;  4K5W A;  2IT1 A;  1HUN A;  4XTC S;  3C1F A;  4DK0 A;  4QUC A;  1RF2 D;  4C2M B;  4ULL A;  3GD7 A;  4ME5 A;  5IGF A;  2ENB A;  1STH A;  3FPU B;  2A69 C;  1EY8 A;  5CYU A;  2KEC A;  1EYC A;  5I9O A;  3FMC A;  3NK9 A;  1HXY D;  4KY5 A;  1SEB D;  2WV6 D;  1TWA B;  1PMR A;  4S3S A;  1DOL A;  3HS0 C;  1TWH B;  2E2D C;  4V0B A;  5LHY 1;  2PMZ B;  2PZW A;  1CA6 A;  4A3I B;  1J9O A;  2A73 B;  3X3N A;  3T16 A;  2B2Y A;  4XQJ A;  5E3F A;  5IGG A;  2E75 C;  2AWN A;  2EZV A;  2F0U A;  4ZK9 B;  1QIL A;  1AZP A;  2NN6 H;  4ABN A;  2QEJ C;  2DY8 A;  5A2Q L;  1L0Y B;  1WTW A;  1Y1V B;  1HTP A;  1S5F D;  4Q5V A;  3HOZ B;  2XWB B;  2NN6 G;  1B2T A;  3A8J E;  5A35 A;  1F2Y A;  3HKZ B;  2NTS A;  5IGB A;  2F0P A;  2NZ1 D;  1EY9 A;  1LAB A;  2R6G A;  2BOS A;  3V2T A;  5M9O A;  3D8G A;  3GTG B;  3I73 A;  2L11 A;  2J7Z A;  1WTV A;  2WIN B;  3SR1 A;  1D5X C;  4MN3 A;  4DXG A;  2K7V A;  4IUV A;  2AUK A;  2F0S A;  4RWS C;  4K8I A;  3VYT A;  1FNU A;  4RGM A;  3MXP A;  3RLF A;  1J8I A;  3HOV B;  1D5Z C;  5C4J B;  4XXE A;  2KEE A;  2BDO A;  1U4P A;  1DCZ A;  5CC4 A;  2F0G A;  5I4D A;  3OPO A;  5C0X H;  3DEP A;  1R4P B;  2K5W A;  2HQE A;  3HP3 A;  2E76 C;  4F7X A;  1SYG A;  3OHX C;  1MGS A;  1QE6 A;  1RD9 D;  1LO5 D;  3A8I E;  4KI0 A;  5I6W A;  4UDU C;  4R9W A;  1ZYR C;  2K28 A;  5CV9 A;  3U9O A;  3W2D A;  5COR A;  1E2Z A;  1SMY D;  4DGZ A;  2QDB A;  2A6E D;  4E6I A;  4OHJ A;  1QG7 A;  5CV6 A;  5KRU A;  1BF4 A;  2V4D A;  5EKI A;  1D1I A;  1F2L A;  2NVY B;  3C3L A;  1CK1 A;  2R7Z B;  4M8A A;  1V1O A;  2KHS A;  5FKA C;  2RSO A;  2KUM A;  1TS4 A;  3S1M B;  1S5C D;  1BNZ A;  2E2I B;  2RKS A;  3M4O B;  2WKC A;  1UEA B;  2NUC A;  1H9K A;  2WAQ B;  4IUP A;  3L9A X;  1W6K A;  5CGK A;  3IAY A;  3GV6 A;  3HZX A;  3P1H A;  4DF7 A;  1A2T A;  3R2I A;  3PUX A;  2B2U A;  2K05 A;  1A15 A;  2L55 A;  2XNA C;  2JA7 B;  4TQU S;  3T51 B;  2PO4 A;  1C8C A;  1LTS D;  1BDO A;  3V05 A;  5DM7 3;  4OIK A;  2ICI A;  2O2L D;  1EZ8 A;  1ONL A;  4G7H C;  4QIW B;  2B2U C;  1CFM A;  1EQT A;  4RFB A;  1DOM A;  4Y7N B;  3VA7 A;  1TWC B;  3R2T A;  2DY7 A;  1DZ1 A;  4LJZ C;  4XQQ A;  4DAY A;  1JB3 A;  1BOS A;  4AYB B;  5EBD A;  3M85 A;  3BDC A;  5M5Y B;  4FF1 A;  1HRJ A;  3W3A A;  3S1Q B;  4N9P A;  2AWO A;  1LV9 A;  4CJ0 B;  3NBI A;  5G3L D;  2RA4 A;  1L0X B;  1STB A;  1S5D D;  3KF8 A;  3DXJ C;  3QWN A;  2NVT B;  2J4X A;  1CM9 A;  5D3D A;  3S16 B;  1I4P A;  4J1M A;  1II3 A;  3NTI A;  1KAA A;  1HTL D;  3H94 A;  5FO9 B;  3ONA B;  3TP7 A;  1LLR D;  3Q22 A;  1ZKO A;  3QO2 A;  1Y1W B;  4BBR B;  2IPK D;  1Q12 A;  2BA0 A;  3NE5 B;  3MZ5 A;  4IN3 A;  1JWU D;  1SND A;  1B3A A;  1GOZ A;  5K36 G;  4QUF A;  2RBM A;  5BN5 A;  3RZO B;  2G9H D;  3S9W A;  2MHV A;  2ZT9 C;  4JBW A;  2D5D A;  4XDX A;  1JC7 A;  1GHJ A;  1CQF A;  1LAC A;  3GO5 A;  5LL6 X;  1XX8 A;  3WOE A;  3D6W A;  3TME A;  3BYT B;  2QF7 A;  3CRK C;  1M4V A;  1D5M C;  1NR4 A;  3M7G A;  2WKD A;  4C1N K;  1GJX A;  2F1M A;  3T13 A;  1V1P B;  3DM1 A;  1EEF D;  2NVQ B;  3K57 A;  2AUJ D;  5IGD A;  2EY2 A;  3NWS A;  4G7Z C;  1HFG A;  1RTO A;  3PIP 3;  3A56 A;  1B53 A;  5FOB B;  2EVB A;  2EY5 A;  1SDF A;  1GUW A;  4DU9 A;  3S15 B;  1FNV A;  1JE4 A;  2B2W C;  5C5M A;  2IX3 A;  5C3X A;  3MFY A;  2FJ2 A;  3PO3 B;  1QB5 D;  4G7O C;  2MGS A;  4PMB A;  3MHB A;  3NBH A;  1UUP A;  4IUU A;  1A6X A;  1BR9 A;  2F0V A;  1F9Q A;  2F3W A;  2K33 A;  1ENF A;  1ESR A;  1AN8 A;  5CBE E;  4L63 B;  1KDA A;  2M2L A;  3PIO 3;  3N6R A;  2R92 B;  3TSS A;  4IUT A;  2QIL A;  2A6H D;  3DHQ A;  1XXG A;  2SDF A;  3RMH A;  2DNE A;  3CKI B;  1STA A;  2L0C A;  1XTC D;  1ET6 A;  4XQN A;  1U9R A;  1G91 A;  1FGB D;  1EY5 A;  5EGT A;  2JE6 I;  2F3V A;  4HED A;  2XWJ B;  1OXU A;  4F8M A;  1FD7 D;  2FIN B;  1R4Q B;  5ELB A;  1F2Z A;  2L4N A;  5ISR A;  4J6H A;  5JVH 3;  3EJI A;  3K0Y A;  4DK1 A;  1K83 B;  4C3J B;  1NSN S;  1NUC A;  4C1N I;  1FYC A;  3NP8 A;  3TBI B;  1B44 D;  5KND A;  3J81 L;  2XIW A;  2B2T A;  1WVL A;  1SJH D;  1EZ6 A;  4MHE A;  1EQV A;  1JOQ A;  1PRT C;  2B2Y C;  4BY7 B;  2FFK B;  2MJ8 A;  4RHR A;  1ENA A;  5DNF A;  3D4W A;  1D6E C;  2WB1 B;  3JAM E;  3OIP A;  3BS1 A;  3GTK B;  4ZKB B;  2K5Q A;  3PV0 A;  2SNM A;  3VR6 A;  4HSV A;  2IX1 A;  3NSW A;  4HCS A;  1MD2 D;  5I9P A;  1BCP B;  4ZUJ A;  1Q1B A;  3OWF A;  1CZW A;  1ZYR D;  2EYH A;  1QCB D;  3S1N B;  1Z47 A;  1KDC A;  3NHH A;  3ITP A;  1B9N A;  1PRT B;  5C4Z A;  5KNC A;  4FXD A;  4F88 A;  4X3S A;  1BCP C;  1LTI D;  4RAU C;  2NN6 I;  1A2U A;  2N88 A;  2B2T C;  4RGO S;  3CHB D;  1RTN A;  1X3Q A;  3RZD B;  4HMJ A;  1TS5 A;  1A3U A;  2A68 C;  1ROD A;  1ML0 D;  1WCM B;  4OGQ C;  3HOY B;  4UAI A;  1I6H B;  2EYP A;  1I4Q A;  4K8J A;  3MC0 B;  1KAB A;  1LTR D;  4ZLT F;  4Z9C B;  4FP5 D;  2D2C C;  1A3V A;  5JPM C;  5EKK A;  2LFN A;  4B9X A;  2EYL A;  2K04 A;  2RDH A;  2SOB A;  5CMD A;  1STN A;  2F0L A;  2KQ3 A;  2GA4 B;  5EQ0 A;  4XYO A;  2IW3 A;  4NKL A;  2FHT A;  4CGY B;  5C0X J;  3KLS A;  5KYL A;  2O5I C;  4IFD I;  2F0O A;  2EJF C;  5AFW A;  2EYO A;  1AEX A;  1JOR A;  1BBX C;  1G2S A;  2BCO A;  1EU3 A;  5IOC A;  1V1P A;  4NP5 A;  1SYD A;  3PMF A;  2EXZ A;  1PTO F;  1XYI A;  2A6E C;  2ZXO A;  4KKS A;  1Y8P B;  4CJ1 B;  1CZG A;  2OXP A;  1Y8O B;  4EVO A;  2F0J A;  2TSS A;  2ZXP A;  3VR2 A;  5EBC A;  5CV7 A;  1GUG A;  3DUZ A;  3K5L A;  2I46 A;  2PPB C;  1MSH A;  1R9T B;  3SE0 A;  2LMC B;  3HG9 A;  3OMG A;  3QB3 A;  3BDO A;  4R8I A;  1GUT A;  4A3B B;  1MSG A;  3CRL C;  3MA2 B;  2RDF A;  4C3I G;  4OO1 H;  2K6A A;  2PNR C;  4OO1 G;  1T5X D;  1H9S B;  1Q3L A;  2KED A;  4H13 C;  3FRP B;  3NUC A;  1PYW D;  1TT2 A;  4A3F B;  1XWE A;  1MBY A;  2Z4H A;  2QKI C;  3LWE A;  4DAV A;  4CKC A;  1SYB A;  4JK1 C;  3DWA A;  4IAL A;  4FXK C;  2RVL A;  2Q8I B;  4KN7 C;  4RH6 A;  2KVM A;  1F9R A;  4C3H B;  2K5D A;  2VNU D;  2CQA A;  3RUZ A;  3PO2 B;  2B2V C;  1QWY A;  4H44 C;  5I2X A;  1EYA A;  2FMC A;  4ZAI A;  3VA5 A;  5IIF A;  3KUP A;  3AU7 A;  4G57 A;  1PFM A;  5KYI A;  4OL7 A;  3HOW B;  2OT2 A;  3TZD A;  2AQ3 B;  4CJ2 C;  2F0E A;  2HDM A;  1LTT D;  1E0B A;  2VUM B;  5JEA H;  3Q23 A;  1ILP A;  3S1R B;  1SFO B;  4KD4 A;  4KMU C;  3M3Y B;  4I7Z C;  3H6M A;  1TWF B;  3PUV A;  4A3M B;  1DYQ A;  5JVG 3;  2TMP A;  4U68 A;  3SK4 A;  3U9S A;  2QCP X;  1JOO A;  1QJO A;  3GTQ B;  4C3H G;  1U4L A;  3N52 A;  3WOF A;  4ZKC B;  2L1B A;  2K1B A;  3HGB A;  4NDX A;  1AP0 A;  2PCF B;  1H9R A;  2E2J B;  5HGT A;  1PTO B;  1A3T A;  5I2Y A;  1HUM A;  3SXH A;  3MXG A;  1S4Z A;  3I4N B;  5EPL A;  4DAP A;  2NTT A;  3MEH A;  3VR3 A;  3K59 A;  1GUN A;  3HEJ A;  4U67 3;  5FLX E;  1LT4 D;  1TS2 A;  3D6C A;  4P2C B;  2H1E A;  1SNC A;  4EQN A;  4KY6 A;  4IUQ A;  1CTM A;  1EEI D;  1Z7T A;  1IYU A;  4EQP A;  3IFD A;  1TII D;  4RGN A;  2JSO A;  1O78 A;  1RJT A;  4KN4 C;  2F0N A;  1GUO A;  1DM0 B;  1I50 B;  2FMM A;  4HTH A;  2EY1 A;  2F0F A;  1EY0 A;  4L8J A;  3PUY A;  1KNE A;  1IL8 A;  4ZUI A;  1SJE D;  1YNN D;  1BCP D;  1KLU D;  5M3F B;  2CW0 D;  3P7J A;  5CV4 A;  1TQO A;  4WFN 3;  1WD1 A;  5ELC A;  1BXT A;  3ND8 A;  5DAU A;  5C4X B;  2WP8 J;  1O80 A;  3J80 L;  1F2M A;  3H0G B;  4WOR A;  3J81 E;  1STE A;  4KTA A;  4FF2 A;  2K01 A;  2LS0 1;  2DNC A;  1VMP A;  3S17 B;  4A3E B;  3KLR A;  4LAA A;  3GTJ B;  1SE4 A;  2IWH A;  4DA2 A;  1K8O A;  5M5X B;  4CBV A;  1C48 A;  4ILW A;  4ID6 A;  2F0D A;  3FKI B;  1SNP A;  2B8G A;  4FO2 A;  2A69 D;  4F87 A;  3Q24 A;  3C1E A;  1HA5 A;  3I91 A;  2EJM A;  3IFT A;  1SAP A;  3NTK A;  2PW5 A;  4CKB A;  3SVM A;  2ZXR A;  1KLG D;  4WJW A;  2ICE C;  1YNJ C;  1TU2 B;  1E2V A;  2XN9 C;  4ZRZ A;  3DEO A;  3SK5 A;  3VYS A;  4ODG A;  1LTA D;  3G7L A;  1NAP A;  3F2U A;  4ZYS A;  4KJN A;  2XVS A;  1TWG B;  2RQX A;  1PZK D;  3GTM B;  1Y69 U;  1O7Z A;  1DJR D;  3OWE B;  3WDN A;  3J7Y W;  1AZQ A;  4X3K A;  3QG1 A;  4B08 A;  4QCL A;  2O5J C;  2B2W A;  2G9D A;  3K6O A;  2KCN A;  3SK6 A;  4RCN A;  3MTS A;  5C3E B;  3S2D B;  1X32 A;  5K36 H;  1CQV A;  1HQM C;  2Q8T A;  1M8A A;  4EGV A;  1CA5 A;  5CV8 A;  1I3Q B;  5C4H A;  1LTB D;  2JA5 B;  2EDG A;  3J7A V;  1ZEQ X;  1I4X A;  2BE5 C;  1MI2 A;  2F0K A;  1KNA A;  4HN7 A;  4K2L A;  4L6T B;  1PRT F;  5IGC A;  1C4Q A;  1VDZ A;  1STY A;  3I3C A;  4A3J B;  4PMW A;  5ELD A;  4IFD H;  5D65 A;  5CBA E;  2XSC A;  2WAC A;  5J1Z A;  5NUC A;  2X6L A;  3TP8 A;  2X6G A;  3OIQ A;  4BA1 I;  2RDG A;  3VYR A;  2R61 A;  5DEH A;  3IKJ A;  5D14 A;  3ERQ A;  3QJY A;  4X3U A;  2NYZ D;  2F4I A;  1VF7 A;  3M7N A;  3A7A B;  1JQY D;  2EYM A;  4IUN A;  3ERO A;  2MP1 A;  3OMC A;  3A55 A;  2M00 A;  4LMQ D;  1WTR A;  3TP6 A;  4A93 B;  4KV6 A;  1D2B A;  3NQI A;  1Q1E A;  3OOC A;  4FF4 A;  2HUG A;  2MPM A;  3UI2 A;  3JAM L;  1BQQ T;  2NVX B;  2LY7 A;  3I8Z A;  1PLF A;  2BE5 D;  1VF5 C;  5JEA J;  5M5W B;  3E6Z X;  1NR2 A;  3NQT A;  3AMU A;  3HOX B;  2A74 C;  4HR7 B;  4IUR A;  1WTX A;  2RSN A;  1QNU A;  2VXW A;  1KDB A;  2BA1 A;  3LNN A;  2B2V A;  1E2W A;  3BVM A;  2PZT A;  1F77 A;  1SNO A;  2F03 A;  1SSO A;  3NPP A;  1UNS A;  1YNN C;  5LL6 S;  3D31 A;  2E74 C;  2B8F A;  3MWY W;  3VYU A;  3GP7 A;  2H4O A;  3BDL A;  3A8K E;  5C3W A;  5JPN C;  2Y0S B;  3E5S A;  2BDN A;  2HCC A;  3D4R A;  4RA8 A;  4TSS A;  1PFB A;  1GXD C;  5D3I B;  5TSS A;  2R93 B;  1HA6 A;  4H0L C;  1BUV T;  1SE2 A;  3MAQ A;  2O4X A;  5COY A;  1TS3 A;  2PZU A;  2AQ2 B;  1STG A;  1SYE A;  3GQB A;  1SBB B;  1IKM A;  3EA6 A;  5C44 B;  4BS9 A;  3BG3 A;  5FK9 C;  1EY6 A;  1CT1 D;  1O7Y A;  4XIG S;  1ILQ A;  3TN2 A;  2IJ0 A;  5IGE A;  3CQZ B;  5ELE A;  1SMY C;  1OXT A;  2YYZ A;  3LX0 A;  3SEB A;  1G8Z D;  2A5H A;  1S5E D;  1SNM A;  1H9J A;  2KOL A;  4BA2 I;  4KJO A;  3GTP B;  4X3T A;  4M1U B;  1KTK A;  2Q8R E;  5DM6 3;  5JJZ A;  4B9W A;  4Q0F A;  4HSP A;  3I70 A;  1PRT D;  4R8N A;  4QF4 A;  4NMZ A;  1IYV A;  4BWG B;  1Q8I A;  5BN3 A;  5C0X G;  2F0H A;  3NTH A;  4PV1 C;  4DNR B;  1FNW A;  1QNK A;  1SXT A;  5G3L F;  1EOT A;  1AW7 A;  4FXG C;  3C46 A;  3FDT A;  4KY7 A;  2HCI A;  4C56 C;  3R8B A;  5IT9 L;  5JEA G;  3HRZ C;  2EPB A;  3HOU B;  4IFD G;  1EWC A;  3D4D A;  4K6L A;  2CVR A;  1DD2 A;  2M9V A;  1QOH A;  1JWM D;  1ESF A;  4O42 A;  3K5M A;  3QOJ A;  3SHL A;  1CHP D;  2X69 A;  3I72 A;  5CR3 A;  1EYD A;  4A3D B;  4MIU A;  5FO8 B;  5IT9 E;  4KKU A;  2E2H B;  3K58 A;  4XYQ A;  3BVG A;  1Z6H A;  2L5T A;  4QMG A;  2F0M A;  1GHK A;  1SE3 A;  1S5B D;  4RKL A;  3M4Y A;  5C5L A;  1I4H A;  5EPK A;  1OXS C;  2C9O A;  3SK8 A;  1B1Z A;  2SNS A;  1PTO H;  3AB9 A;  1T5E A;  1EFI D;  3E0J A;  4KKT A;  2PW7 A;  4OIJ A;  3GTL B;  2K32 A;  4O1N A;  1WTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...