1EQTA

Met-rantes
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
GYSSDTTPCCFAYIARPMPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL SPECIFIC RANTES PROTEIN
publication title The Crystal Structure of MET-RANTES: Comparison with Native RANTES and AOP-RANTES
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eqtA00
4OIJA 5E4WC 1HFGA 1G2SA 2HDLA 2Q8RE 1B50A 2L1BA 1ESRA 2RA4A 2D9UA 3I91A 5D14A 1PFNA 2H1EA 1BBXC 2KEEA 1RTNA 1ILQA 1X3QA 3MTSA 1IKLA 4IUPA 2K04A 4R9WA 4ZKBB 1XYIA 5CBAE 1KNAA 3I8ZA 1WD1A 1U4MA 1HA6A 1CA5A 1NCVA 1WTOA 5EPLA 1RODA 2J7ZA 4XDXA 5D65A 3D6WA 4QUFA 3IL8A 1NR4A 2N55A 4HEDA 1AP0A 1BO0A 2KEDA 3GV3A 4CJ1B 1EL0A 2KVMA 3DEPA 3FPUB 2XIWA 3ONAB 4HAEA 3R93A 1PFMA 1J8IA 1MSHA 4ZAIA 3DEOA 4XT1B 3KBXA 1C8CA 1A15A 1DOMA 4IUTA 1WTPA 2B2UA 1F2LA 5E4XA 1NR2A 1U4PA 5CBEE 1ILPA 1HRJA 2KECA 4IUQA 1VMCA 1DOLA 1S4ZA 4RWSC 2JYOA 1SAPA 2N88A 5T1IA 5EKIA 1GUWA 4NW2A 1HUNA 1RJTA 1KNEA 4MN3A 4QUCA 5AFWA 2B2VC 2DY8A 2EPBA 2L9HA 1AZPA 2B2TA 2KUMA 3N52A 2K1BA 4MHEA 1X32A 2K28A 4ZLTF 2X6GA 1BF4A 3HP3A 2L4NA 4X3TA 1B3AA 4HSVA 3I3CA 1U4LA 2SDFA 1X3PA 2RSNA 1LV9A 2MGSA 4RAUC 1WD0A 1DOKA 1ML0D 4RA8A 1O7ZA 1Q3LA 4HCSA 1PLFA 2FJ2A 2FMMA 1HFNA 3DM1A 1G2TA 5JJZA 1F9SA 2HDMA 4XT3B 3SVMA 2B2WA 4X3SA 4X3UA 2K05A 2L12A 2MJ8A 3LWEA 1G91A 2CVRA 1CM9A 4IUVA 5CMDA 2L11A 1F9PA 2EE1A 4CJ0B 2X69A 2R3ZA 2MP1A 1PDQA 1EIGA 2B2YC 2RVLA 4LMQD 4ZKCB 4R8IA 4IUUA 1O7YA 3P7JA 1QG7A 1DZ1A 3GV6A 2MPMA 1F9RA 1U4RA 4U68A 1WVLA 2KOLA 1M8AA 5EJWA 5EPKA 1HUMA 1EOTA 1WTRA 1XX8A 1SSOA 2K01A 3MWYW 2B2VA 5EQ0A 1G6ZA 2JP1A 1NAPA 2B2TC 2FINB 3H91A 4UAIA 1WTQA 3QO2A 1JICA 1B4OA 2VXWA 2HCCA 1EQTA 3TN2A 2BDNA 2FHTA 1MGSA 1WTVA 1F9QA 3KUPA 2EOTA 2HUGA 1WTWA 2IL8A 1QNKA 4IURA 1RTOA 3G7LA 1IKMA 1MI2A 1EIHA 1IL8A 1QE6A 2X6LA 3IFDA 4DN4M 1TVXA 3FDTA 5T1GA 4CJ2C 3F2UA 1MSGA 3I90A 2B2UC 3UI2A 5CORA 2B2WC 1O80A 1SDFA 2M2LA 2NZ1D 1WTXA 1AZQA 1BNZA 4O42A 4OIKA 5EPJA 3TZDA 2RSOA 1E0BA 4X3KA 5COYA 1J9OA 1JE4A 1RHPA 2NWGA 1HHVA 1PFBA 2B2YA 1VMPA 2K03A 2Q8TA 2HCIA 3Q6SA 1B2TA 1ICWA 1DONA 2NYZD 2DY7A 1CA6A 4ZK9B 1B53A 5DNFA 2FFKB 1ZXTA
chains in the Genus database with same CATH superfamily
2EIFA 2K5NA 1ET9A 1XWEA 3I91A 1MHWC 2PPBC 1I4PA 4KN4C 1C9OA 1KL9A 3KLRA 1XPUA 4GNXB 3A8JE 2KEDA 3GV3A 4YWKA 3A8KE 3T1HQ 4ODGA 4J8QA 2DNEA 5E4XA 1YNJD 3CCSA 4A3EG 1Q1BA 1N8RC 5AJ3Q 3X3NA 5LL6X 2M9VA 1PH1A 4K8IA 1I6VC 2Y0SB 1YIJA 1E1OA 3MXUA 1A2UA 4GS3A 4MN3A 4DK0A 2L9HA 2K33A 1YNXA 2SOBA 3F1ZA 3MEFA 4ID6A 4JBJA 3TP8A 4XTCS 4J6HA 4PMBA 2J4XA 3I3CA 5LMNW 3PUWA 3RLOA 2XN9C 2MGSA 3U50C 4A3GG 1SYBA 2ID0A 3DWAA 1VQ5A 4DU9A 3CW2C 4JCVE 1EQRA 5JJZA 5C3EH 3FKIH 1KRTA 5CV8A 5IYCH 1JOQA 1CM9A 4BY7G 4LF9L 1A3UA 3VR3A 1XPRA 2E2IB 5KEEA 4MNOA 1CSQA 4X62Q 3MFGA 2Y0SE 4NXNL 4ZYSA 3RZDH 3M4QA 1EY4A 4X6AH 1BUVT 5M3FB 4HMJA 2ENBA 3CRLC 2A69D 2PI2E 5EQ0A 1B70B 3C1FA 4FXGC 5ELDA 1VQPA 1JCKB 2A6HC 2YTVA 4WORA 1WTQA 1V9PA 4B3MQ 3QO2A 2D2CC 1XTCD 1I94L 1SNOA 4KHZA 1TS4A 4GOPA 5ISRA 4CGYB 4B3SL 1SMXA 4YCUA 5JPNC 2WP8J 3V05A 2KCTA 4DN4M 2RCNA 3DXJC 2A69C 2B2WC 1KRSA 3K7AH 1VQ4A 2YU9H 2K5VA 2ZTDA 4POGA 1HHVA 2F4VL 4C3JH 3NWSA 4JI0Q 4E6IA 1SN8A 2TMPA 3T1HL 4LF5Q 1QVCA 2RA4A 2RQXA 1PFNA 2LKVA 2ZJPA 4R8NA 4A93H 4A3EH 2NTTA 4JK1C 2F3WA 1E1TA 3FMCA 1VQ7A 1LM0A 4F7XA 2DN8A 4LK1C 2N55A 1LTID 2ZM6L 4HAEA 2IJ0A 3E5SA 2EJMA 1JJCB 1IZ6A 4DFAA 3DWPA 3A8IE 4WRDA 4A3GH 2RHSB 2M00A 1YI2A 4FP5D 2H5XA 3GD7A 2NBFA 2WACA 3RUZA 2VL6A 4BY7H 1OXSC 4QUCA 1HNXQ 3W1BA 4ZLTF 2TSSA 1TY0A 4X62L 1B3AA 3T1YQ 3M3YH 1LV9A 1Y8PB 2ZJQA 4NXMQ 1GVPA 4LF4L 1X65A 1HNWQ 3HOWB 4ZCKA 4MTNA 4B3ML 4JI7L 4AQYQ 1EY8A 4JI2L 4FYDA 5J1ZA 1NE3A 3TSSA 3VR6A 2KA7A 5HGTA 4LFAQ 4WJ3M 5C5LA 4DR7Q 5GQOA 4U68A 1QUQB 2O5JC 2EYJA 1QILA 4OHJA 3VA7A 5C3WA 1SMYD 4GN3B 1KTKA 2KQ3A 1WTVA 4LF5L 4IPHA 3SR1A 2K14A 1IL8A 1VCIA 4HJ8A 1B44D 1PYBA 3PF4A 4H02A 3V96A 1FVIA 3S16B 4XYOA 3HOXB 1FJGQ 2QDBA 1ZYRD 3GTLH 2L55A 5BN4A 1VQMA 2DY7A 1ASYA 2PW7A 2MQHA 3URYA 2NZOA 2PNRC 4A3KG 3SGIA 2F0GA 3ULLA 4DAPA 3GTOH 2QGQA 3PF5A 4BBSG 3I70A 1M1KC 4NP5A 3AYHB 2F0DA 3I8ZA 3HRZC 3AU7A 4RHSA 1F77A 4KI0A 3S1RH 4LUVA 3VR4A 3MAQA 1V1QA 3JAML 1YNNC 1HR0Q 1FYCA 3CC2A 3FPUB 2XIWA 3K59A 2EY6A 3K0XA 3L0OA 1ENAA 3W3AA 4BY1G 1A15A 4KV6A 3RNUA 1BDOA 1F2LA 3U9SA 1KC8C 1HRJA 4RGMA 5I2YA 1S40A 5JJIA 2QEJC 5IP7G 4NMZA 1HNWL 2XRSD 2R92G 3KOJA 2B2VC 2OQKA 2VQEL 1O7LA 1BR9A 5IT9c 4DAYA 4BA2I 3B6YA 5C0XJ 4B3RL 2HIVA 5C3EB 1DOKA 3FKIB 3C2PA 3VYSA 3BS1A 3QJYA 1EY6A 3GTJH 3PUXA 3MXNA 3LWEA 2VY3A 1H95A 1TXYA 2KHIA 5FKAC 3RZDB 1X3EA 3CCJA 1NBWA 2G9HD 4R8IA 3UDXA 2F0MA 2F0FA 2K75A 1L2FA 2F0HA 4G57A 1BBWA 4MZ9A 1XX8A 1EOVA 2K6AA 3MWYW 2NN6I 4HJ7A 5C44G 1FJGL 1YZ6A 1N34L 1NAPA 5IWAQ 4A3FG 3MXGA 1XMQQ 2LY7A 5C0XG 1PVOA 2HUGA 3K7AB 3PMFA 4TRDA 2YU9B 1A3VA 4H44C 1TVXA 4G7HC 3FDTA 4C3JB 3DHQA 1BNZA 5FLMG 1VQDA 1PTOD 3TZDA 3M4OH 2JEAI 1A2TA 2BH8A 4JC0A 2HCIA 1SE8A 4RMFA 4A93B 4G7OC 4DV1L 4A3EB 1GD7A 3I4NG 2HDLA 3A7LA 2NVQH 2NB0A 5FO8B 1VQLA 3O13A 4IQZA 4LW1A 3RZOH 3S2HH 1ILQA 1I5FA 3HOVG 5BR8Q 4KJOA 2ZXRA 4KKSA 1SRUA 3S14H 5CBAE 2R92H 4GNXC 4A3GB 4A3MG 3HZXA 2RF4A 4KY6A 4KY5A 4GKKQ 1JOOA 4R4OA 3ZJYC 2A5HA 2BH2A 3NK9A 4IUTA 3QIAA 3BDOA 1II3A 4Y7NH 4BY7B 1EFWA 4RWSC 3J81j 3CCRA 5E1FA 4M1UB 2YV5A 2F0SA 1PZID 5ELBA 1IBKL 1PZKD 1F2YA 1B8AA 2A6ED 3M3YB 1KQSA 1I50H 1IW7C 4UP7A 4X3TA 2MHVA 1SR3A 1ML0D 1EUJA 1QNUA 1B1ZA 4QCLA 1G2TA 4CHTB 5C44H 2YTYA 1SNQA 1T5XD 2L11A 3I56A 4A3FH 2EE1A 2WB1G 3NENA 4PNYA 1XMQL 2F0WA 4KHVA 2YTXA 2EXZA 4ILWA 4K5XA 2WKCA 3RN2A 1IBMQ 4JYAQ 1LYLA 2KCNA 2UU9Q 1F9RA 5C4HA 2OF1A 2AUJD 2KOLA 3KF6A 1SSOA 4HIKA 4JI5Q 4OX9Q 3KYHC 1G6ZA 2HCCA 4YCWA 3BZDB 1EU3A 3CD6A 1D8LA 1GHJA 3K0YA 3M4PA 3NWTA 4A4IA 3H3VI 1SE2A 2ZJRA 4A3DH 1TWHH 3HOVH 1F2MA 5JAVA 1EZ6A 5LL6S 5KGUA 4O2DA 3GTLB 4O42A 4DUYL 3D4RA 3ZYYX 3NUCA 1E2ZA 4UP9A 1EYGA 3C1EA 5KYLA 2F1MA 3GTOB 1X9NA 1WCMH 5CV6A 5DNFA 1BBUA 1CKNB 4X66Q 1XXGA 4JBKA 1I4GA 1ESRA 5CR3A 3MZ5A 2DUDA 3S1RB 3HFZB 1YJ9A 1Y1VG 4GN4B 2EDGA 4B08A 3CC4A 2JN4A 5IODA 1S5ED 5GROA 4XQJA 3NELA 4QB4A 3ULPA 2OTLA 3BG3A 3S1QH 2E76C 1YITA 1EWCA 4KHPQ 4NB3A 5ELNA 3T13A 2R93G 3T4AC 2VZAA 2JSOA 4NW2A 1EZ8A 2YYZA 1P16A 4IUNA 4FXDA 2K28A 2X6GA 4YCVA 1G291 3E0JA 2OTJA 3GTJB 4RAUC 2F0VA 3D6CA 2MFIA 2XNAC 3KDFA 2UU9L 4IFDJ 1RF2D 2HDMA 4JI5L 4CDDC 3J80c 4OX9L 1JQYD 5TSSA 1XNQQ 1F9PA 1TWAH 1HQMC 4KD3A 4EQ5A 3JAME 3LGJA 4IUUA 1Q8KA 1LT3D 1QOHA 3I2ZA 1JOKA 1BXTA 1W3SA 1Q86C 1EYAA 2ZXPA 2B2TC 4POFA 1J6QA 1STGA 4DA2A 1B4OA 2BCOA 3BVGA 5LMNL 2IW3A 2VQFL 1U5KA 3BVMA 5IIFA 3KUPA 5JEAH 3I4MG 3H3VH 5CV4A 1GUSA 4CDFC 2QA4A 1KAAA 4R4TA 3M7NA 1Y1VH 3NTHA 1W6JA 3F2UA 1CHQD 5T1GA 2B2UC 4LUZA 5F2DA 4EQNA 4C3HG 1SNCA 2V4DA 1TKWB 5IGFA 2NVQB 1VQHA 5IOCA 3RZOB 3S2HB 2UXDL 2LXJA 4LF9Q 4OIJA 4A3BG 3OMGA 1B50A 3S14B 4KHPL 3S1MH 1I3QH 5D14A 2R93H 2R92B 3GO5A 3BYTB 4KN7C 3MTSA 4NXNQ 1ENFA 5C3XA 3E3XA 3CHBD 4P75A 3NTKA 4APVA 1H9RA 3IL8A 4PZ8A 3J81E 4IJLA 4Y7NB 1J8IA 5C6AA 1O78A 1QZHA 3NP8A 2PO4A 1ICFB 3OHXC 4R1JA 1C8CA 2I0QA 2Q2UA 3Q22A 1NR2A 2VB3X 1TS5A 2D0PA 4B3SQ 4N9PA 1RIPA 1I50B 3K6OA 3QB3A 3WOFA 1HUNA 1PH9A 1TT2A 3F8TA 3D4WA 1NSNS 1N36L 4Q5VA 3SDZA 1XNQL 1BF4A 5I9OA 4F88A 3TMEA 1D5XC 1DM0B 4HSVA 2F4VQ 2SNSA 1JB3A 4QJFA 4OONA 2EY1A 1WD0A 3S2DH 5C44B 4R4CA 1YHAA 2NTSA 4EQPA 3CCEA 4LAAA 1LTGD 2RCFA 2K32A 5G3LF 4A3FB 1GXDC 3UE0A 2PNHA 1HXYD 2RDHA 1V43A 1KLGD 1YBYA 2CH4W 1K0SA 3BDLA 1TQOA 1STHA 1STBA 1PTOB 2B2YC 3CAMA 4QY7A 3HGBA 3I4MH 1D1KA 2ZM6Q 3PIP3 1PH7A 3I4OA 1SJED 4L5RC 4C3HH 3PV0A 4OO1G 3NXWA 4N8X1 1LTSD 3CPFA 5KNBA 3EROA 1I4HA 4UDUC 4A3DB 2CWAA 4DAMA 1TWHB 3HOVB 1JJGA 4DAYB 1JE5A 2A6HD 2SEBD 4RH6A 2HHHQ 2I5HA 4HJ9A 3OW2A 1EWHA 1VQBA 2AUKA 1ZEQX 2F52A 3LWUA 1WCMB 3P1HA 4G4KA 4PMWA 3MXNB 3A54A 1B9MA 4LF4Q 2K03A 1DONA 2F0QA 5BN3A 1NNXA 4DV5L 1LTRD 3K80C 4P71A 1C4QA 1EY0A 1G2SA 2BE5C 4PZ7A 2L1BA 4JI7Q 3AMUA 3PQIA 4JI2Q 3L3OC 2F0NA 1VQNA 2A74C 1IKLA 3A5UA 1XYIA 3SK8A 3S1QB 5D65A 1RL2A 2HT1A 1JWSD 5A2QE 4B3TL 4JI6L 1FR3A 2XSCA 2CW0D 2JK8A 1PFSA 4FO2A 1A8VA 3IFTA 4A3JG 1U4PA 1Z6HA 2A68D 4C56C 2WB1B 1BCPB 2AMCB 1A62A 1KDBA 3TDQA 1STNA 3U4ZA 1D6EC 1I4QA 5LHY1 2A19A 3PUVA 2EPBA 2KUMA 3NEMA 2JA5G 4L8JA 2UUCQ 2CW0C 1KABA 3OIPA 4LFBL 1U4LA 3VYRA 1ONLA 2F0IA 2RSNA 4O0AA 4JI4Q 2A68C 4JOIC 4BBRG 1KAWA 1SE3A 1HA5A 2VB2X 4I65A 1GHKA 3D4DA 4K14A 4TQUS 2R7ZG 4OO1H 1TWAB 1CQFA 2QILA 3J7AV 2CQAA 4K0KL 4DR5Q 2CFMA 1IYJB 1M4VA 2GVBA 1VQAA 2WB1E 1C48A 4AYBB 4NPSA 3EJIA 3HKZG 3P7JA 1PH2A 2RBMA 2HHHL 4FDBA 3GV6A 4OWTB 1KXLA 5JJKA 1SYGA 5M5WH 2B2VA 3CMAA 2WFWA 1LTTD 3V2TA 3HOUG 1G6PA 4RCOA 4J15A 1Y1VB 3P75A 2A73B 2J0TD 2EOTA 5CV9A 3G4SA 2VQEQ 1FNVA 3KFUA 4HMIA 1QNKA 3EA6A 2B8FA 2Z4IA 2E2DC 5ELCA 4AYBE 1S5DD 3I90A 4MTKA 4IN3A 4HJ5A 4B3RQ 1UEAB 1TWGH 4C1NI 4JI3Q 1MJCA 1LACA 3NPPA 5COYA 1J9OA 1JE4A 4YWLA 1SYEA 1K0RA 1SXTA 1QVGA 3Q6SA 3S1MB 1I3QB 2R93B 4ZK9B 4C1NK 2FFKB 2PZUA 1HFGA 4WJWA 4A3JH 4FNFA 1L1OC 3RN5A 4KMUC 3I7FA 3VA5A 2VUMG 1GUTA 2MO1A 3KF6B 2K52A 1KNAA 4ABNA 2E5LL 2JA7G 1U4MA 3DMUA 5EPLA 2JA6G 2J7ZA 4KLKA 1FD7D 2JA5H 2PW5A 3ULJA 1EL0A 4C3IG 2UUCL 2KVMA 1N34Q 5EBCA 1BQQT 1Q7YC 3CCLA 1FGUA 1DOMA 4JI4L 1PRTB 1YNND 3T56B 4IUQA 5KNDA 2UUAQ 2R7ZH 1LTBD 1Q8IA 2F0JA 2F0LA 3NHHA 2KHSA 1N33Q 3OIQA 2AWOA 3ERQA 4DR5L 4FF2A 1V1PA 3A55A 3S2DB 1LTAD 2F0KA 4F87A 5M5XH 5FLXE 3CC7A 3I4LA 4KK7A 4DV1Q 3BDCA 3EQLC 3HOZG 2RDFA 3OTOL 4KKUA 2H4OA 1OXXK 4X3UA 2CVRA 3I4MB 4L5QA 1Q1EA 3U4VA 3OWFA 4A3IG 2MP1A 4TKOB 1DXMA 1JORA 5DAUA 3T53B 1BCPF 4C3HB 3QWNA 3C3LA 1PXUA 2N3SA 1DZ1A 3NBHA 1VF5C 3LNNA 3DUZA 1M8AA 1EOTA 4FF4A 2F03A 1PA6A 4JI3L 4N8FA 2WAQG 2PI2A 3VYUA 4AIMA 1GOZA 3F2DA 1XMOQ 2WIIB 1Q12A 5D3DA 1IBKQ 2MO0A 3X3MA 1RD9D 2BDNA 4CDEC 5IYDG 3MXPA 1GO3E 2ALYB 3NTIA 1EIHA 1RTOA 4LF8L 1MI2A 2WINB 3KLSA 1Y1WG 2ZT9C 5C0XI 1Z9FA 2VUMH 3UI2A 2IT1A 1WTXA 1O80A 2Z6KA 2JA7H 3R8BA 1QZGA 2RDGA 3HG9A 2Q8TA 2OT2A 3JAMc 5ELOA 3S9WA 3A74A 4RKBA 1ET6A 1W2BA 1ESFA 5DLQE 1HNZQ 1KDCA 3J81L 4DV0Q 2EYMA 1LUZA 2KENA 4DNTB 4RGOS 3KF8A 5IYBG 4A3KH 2UUAL 2K50A 4IUPA 3TS2A 1UE6A 2IX1A 2UXCQ 2IHFA 1HTPA 1HA6A 5FJ8G 4BBSH 1NCVA 1K8AC 1N33L 4X64L 2B63G 1HQRD 1AP0A 1BO0A 5EKKA 4CJ1B 2ES2A 4Z9CB 3I73A 5IY0A 2ATWA 3NQTA 3F2CA 1TIID 5GAEC 1WTPA 1TWCH 2R7DA 3S1NH 1S4ZA 4BY1H 2EJFC 2EZVA 2OCEA 4A3CG 4RGNA 2Y0SG 3Q23A 5IP7H 1TR5A 2DY8A 5ELFA 2IHEA 2B8GA 4A3IH 4DUYQ 1Q46A 1YEZA 2L4NA 3UDFA 4P74A 5CC4A 1K28A 3S15H 1IW7D 2PYKA 1AW7A 1KHIA 1HFNA 3CF5A 2HD3A 5KRUA 2F0EA 3J81c 4PZ6A 4DXGA 2E2JH 2BA1A 4CJ0B 1XMOL 1PRTF 4LMQD 4DXFA 5IYDH 4ZKCB 1X6OA 5M5WB 2O2LD 1Y1WH 4ZUIA 1O7IA 2CH4A 1HJPA 4JPBW 2F0TA 1EU4A 5NUCA 3D0FA 3BU2A 1Q82C 1IYUA 2LS01 2JP1A 4PQXA 1WI5A 5CGKA 1OTCA 1QB5D 3ND9A 3QOLA 3TP7A 1YHBA 2FHTA 3K81C 2DJGC 1HNZL 1TS3A 2I5LX 5FK9C 4JV5Q 4P73A 1TWGB 5IYBH 4DV0L 1QE6A 5C0XH 4DKAC 3HKSA 4CJ2C 1S3OA 2XGTA 2UXCL 4K6LA 4L5TA 5I4DA 1VQOA 2K7VA 4K8JA 4EX5A 5K5PA 1PTOH 3TS0A 2B63H 4BXXG 1K8GA 1IHZA 3AFQA 5FLMH 3IRBA 5L37A 4A3JB 4G7ZC 3U58A 2EYOA 4ULLA 5A2QL 4JI1L 5C4XG 3T16A 4DR2Q 1K3BC 3Q0AA 1X54A 3I4NH 2ZTCA 4KKTA 4DR1Q 2F4IA 3H09A 3QR8A 4IO9A 2JA5B 1G51A 2Z4HA 3GQBA 4A3CH 5JOBA 5IGBA 2GVAA 3DEPA 1VS0A 2P5ZX 2D5DA 4A3MH 2R7ZB 3SEBA 3KBXA 1EQQA 3J80i 3G48A 3VR5A 1JR0D 2B2UA 3CU7A 1H9KA 4GLAC 5DEHA 2KCMA 5LMNQ 3PIO3 2VQFQ 4DV4L 3RR5A 4B9XA 1DOLA 2K4KA 4RGTA 2K5WA 2N88A 4YHHQ 4YIJA 5ELEA 3D8GA 3HKZB 3R2IA 2KBNA 1R4PB 5M5XB 4WFN3 1HR0W 2BOSA 3TEHB 2JJQA 1SJHD 1X3FA 4MIUA 1H9SA 4JI8L 3WWVA 2QF7A 5FO9B 4GOPB 4OGQC 2UXDQ 1PLFA 1JWUD 1EY9A 3HOUB 1VQCA 3DM1A 1F9SA 2QW7A 4CBVA 4I7ZC 4R4IA 2MJ8A 3H0GG 1CSPA 4RFBA 4TSSA 1PMRA 1GUOA 1UE7A 2VNUD 1T5EA 3K5MA 4JV5L 5E7NA 3EFXD 5M9OA 2E2HH 1D7QA 1HZ9A 3CPWA 5D3IB 1WVLA 5EJWA 4KY7A 4BXXH 5I9PA 4EQOA 4UAIA 2PZTA 3H91A 4CKBA 5I6WA 2GA4B 1B9NA 1VQIA 5C4XH 4IALA 1VF7A 2VUMB 1N36Q 3GTGB 4DR2L 2JA7B 2UUBL 3GTMH 3SHLA 4DR1L 4DV3L 1R9TH 2M2LA 3KJPA 1EY7A 3W5OA 1STEA 2Z6BA 3WDNA 2ICEC 4A3LG 4XXEA 5BN5A 3HOXG 5KYIA 2B2YA 3J7AF 3ERSX 5C4ZA 2C35B 3JC66 4KD4A 4ZQ3A 1IL2A 1B53A 5FO7B 4A3KB 2KHJA 2L15A 4I7AA 2EXDA 5E4WC 3GP7A 3SK6A 4B9WA 4BBSB 2KEEA 3R3OA 4TVAB 3A56A 1KLUD 4YHHL 2IY5B 1SBBB 2MNAA 1RODA 4IFDG 1CQVA 1TWCB 1SEBD 2F0PA 1PV4A 4U673 3S1NB 5E3FA 4BY1B 4FF3A 4XT1B 4OWWB 4H13C 1PRTC 3ER0A 3G6EA 1C7YA 1JWMD 1CK1A 1UE1A 2JA9A 5FLXL 3TREA 4GN5A 2JYOA 1HPCA 4OWXB 4A3IB 3NE5B 3H0GH 1GUWA 5H1SE 1KNEA 2XRQD 3S17H 3MA2B 4DK3C 3S15B 4OELB 3HP3A 1FL0A 1XNRL 2CHBD 2JEBI 1CHPD 1A6XA 4DV5Q 3CCUA 1CI3M 4CKCA 3M9BA 2E2JB 5IYCG 2NZHA 1T9HA 2IX3A 2B2WA 1Q81C 2K05A 5J22A 1W6KA 1PH5A 1Y1WB 3GTKH 1SNDA 1EIGA 5CYUA 5IGGA 1GKHA 4B3TQ 5M3MG 4JI6Q 2HQEA 2OEOA 1E22A 3G6JB 4DNRB 3D3RA 2DGYA 3GDEA 1PYWD 1U4RA 3RD4A 1UEBA 4ZUJA 2PZWA 4K2LA 5EAYA 2N78A 2OXPA 3F2BA 1PH6A 2F3VA 2FINB 2I07B 2NVYH 1QJOA 1V1PB 1XPOA 1K8MA 1TWFH 1LT6D 2VXWA 3PO2G 1TY2A 4OO1I 5FLXc 1EQTA 4LJZC 4K5VA 3SXHA 3C46A 2ASBA 3PIPA 3HOYG 5JVG3 4JOIA 2IL8A 1PH8A 2WV6D 4UPAA 2B63B 5A35A 4LFBQ 3I72A 3FRPB 1PH3A 5CORA 2EYHA 4C3JG 4M8AA 5EPJA 2RSOA 4LF6L 1GM5A 4IFDH 2EJGC 3TQYA 2KJXA 1ICWA 3I4NB 3BVZA 4K0KQ 4PV1C 2RHQB 4A93G 2Q8RE 4EGVA 3UDGA 3FVQA 1HZCA 1OXUA 2XVSA 5HY6A 2D9UA 1BBXC 4A3BH 2N8NA 3NBHB 4IZ8A 1HZBA 2JE6I 2BE5D 4R9WA 4ZKBB 1X3GA 3CMEA 3VR2A 3QG1A 4A3MB 2JA8G 4BA1I 2LXKA 1KDAA 1JB7A 4LF7L 4HEDA 1YNJC 2VS1A 1S5BD 3E9IA 4RKLA 4ZAIA 2AHOB 1VDZA 4UY8C 2O4XA 5CBEE 3CXCA 2EYFA 1AN8A 1JC7A 3M85A 3I55A 4LWCA 1CKNA 1RJTA 1WYDA 1NJIC 3LX0A 4MHEA 1EFID 3DLLA 4X65L 3CQZH 1L1OA 2Z1CA 3A0JA 5M3MH 2Z9HA 4HSPA 4DK6C 4JBMA 1NY4A 3KF8B 4IPDA 3N6RA 2FJ2A 1PH4A 4OEMB 1N32L 2UXBL 1ENCA 3TZUA 3KJOA 2IPKD 3PO2H 2E5LQ 3SE0A 3BYYB 1UE5A 3PSIA 2E2HB 3HOYH 1CKMA 2RVLA 1IYVA 1DCZA 4HIDA 5IGCA 1HCZA 2LMCB 2O5IC 2EYLA 4QMGA 1G8ZD 1FNUA 1HH2P 2MPMA 1SFOH 1EYDA 2GN5A 2K01A 1ZKOA 5C4XB 4DNIA 4HJAA 2PQAA 4RCNA 1JICA 3PO3G 3GTMB 1MIUA 1MGSA 2E75C 1F9QA 1N9WA 4IJHA 1AFPA 1Y8NB 1R9TB 5AJ3L 5LMUQ 3DM3A 3R2TA 5GAGC 3J7A5 4DV2Q 4DAVA 1NMGA 4P2CB 4QIWB 3E0EA 1XTDA 3J80E 1C0AA 1D1IA 2JA8H 1A63A 3AB9A 1RHPA 2NWGA 2VW9A 2K5DA 2OQ0A 3OTOQ 3K5NA 1CZGA 3TP5A 3AFPA 5K36G 5IP9G 1MKHA 5JJLA 3ITPA 1Z47A 3KLWA 4HN7A 3E9HA 3OSOA 4L6TB 1P8LA 1CA5A 3GTQH 3TP6A 2AQ2B 3L7ZC 2AQ1B 2EVBA 1PTOF 4QIWE 3IAYA 1JT8A 3ONAB 1AH9A 5G3LD 1H9MA 3DEOA 2IX0A 2XWBB 3OMCA 4OL7A 3H0GB 1EEFD 1E3PA 3S17B 5T1IA 4LF8Q 3PGZA 4XIGS 4Q0FA 4DR3Q 5EKLA 4RG1A 2K1BA 2PQEA 4NKLA 4J1MA 2CWPA 3H94A 3TBIB 1V1OA 4GOPC 3BJUA 4HCSA 2R7FA 4F8MA 3VDYA 1UWVA 2FMMA 3OPOA 2ZXOA 5GADC 4BBRH 3GTKB 4JI0L 2OWOA 1F2ZA 1FGBD 5CMDA 2NVXH 1D2BA 3PO3H 1VQFA 3Q24A 4DR6Q 2X69A 2R3ZA 1E2VA 1PDQA 4X64Q 5C4JH 1CT1D 3EN2A 1KD1C 5IT9L 1O7YA 1AE3A 3FHWA 2E8GA 5KIXA 2G9DA 5LMUL 1UUPA 4CKEA 1H9JA 2NVYB 3JAMi 1SMYC 4DV2L 4L5SA 1TWFB 1WTRA 2XTIA 4N9TA 3SK4A 1Q90A 1E24A 1CFMA 4GNXA 3PUZA 1X55A 5J39A 3TN2A 3UE1A 1K9MC 5K36H 5IP9H 4DR4Q 3BZCA 3K5OA 3HOUH 1WTWA 1H9SB 3G7LA 2FMCA 1SE4A 2R6GA 3K5LA 1ZYRC 4HIMA 1GJXA 1B7YB 2NZ1D 1HNXL 3M7GA 4Y52H 1QCBD 1WOCA 1PFBA 1VMPA 2Q2TA 3T1YL 1CA6A 1BOSA 1MBYA 1I6HH 4NXML 4A3BB 1CKOA 3U9OA 2EY5A 1K83H 3RLFA 2QKIC 1L0YB 3J7ZC 1X3QA 1EY5A 1XJVA 1GUNA 3J7YW 2QEXA 3W1GA 4DUZQ 2MUYA 4AQYL 4KJNA 4DR3L 3KDFB 2Q2IA 3AQQA 3D6WA 4QUFA 3GTGH 5HGQA 1YJNA 2JA6H 1DGSA 1L0XB 3MFYA 4LFAL 4DR7L 4HR7B 4C3IH 1HTLD 3J81i 1RDPD 1RCVD 2KECA 1D5ZC 4JG2A 4RHRA 1K8OA 5J3BA 1STYA 1I4RA 3CQZB 1DYQA 4JBWA 5M3MB 1AZPA 3CRKC 4DR6L 1UNSA 4XYQA 3FEWX 1LT4D 1SYCA 3CCMA 4XQQA 4OXPA 3MC0B 4JVZA 1O7ZA 3GTPH 1CZWA 1GUGA 4JI1Q 4C2MH 1LLRD 3PO2B 1S5FD 5IGEA 5DM63 1DD2A 1ASZA 3HOZH 3HOYB 1VQEA 2DNCA 4IUVA 5JPMC 1A3TA 3K57A 1STAA 1WFQA 3OW7A 1L0WA 1SFOB 1V8QA 4NDXA 4DR4L 3RLNA 2IWHA 2NN6G 1BKBA 1VQ6A 3TRZA 2B3GA 1SYDA 3WOEA 5FOBB 4IPGA 2R61A 4GLXA 4IOAA 4DV4Q 1HR0L 1CUKA 1KIXA 2D0OA 3RMHA 4LFCQ 3FPPA 4H0LC 4H7BA 2HIXA 4V190 3OYYA 2Q8IB 4A3DG 1FNWA 4K6DA 3MVVA 4BWGB 5DM73 1PTOC 3IKJA 1IKMA 5IE8A 2L0CA 2X6LA 2JA8B 3IFDA 2F0OA 1MSGA 4HCEA 2NVTH 1TS2A 4JI8Q 3L9AX 3CCQA 3HEJA 1E0BA 1LABA 4DUZL 4FF1A 1WCMG 4AH6A 1X56A 1M90C 2B29A 5M3FG 5M5YH 4DV6Q 2WKDA 1SLJA 5I2XA 2NYZD 3A5ZB 2CKZB 4EVOA 1ZXTA 2F0UA 1MJEA 1EYCA 2EQSA 1IBLQ 2H1EA 1RTNA 3GTQB 2ZTEA 3G71A 1VQGA 2EY2A 2K04A 1JMCA 1J5EQ 1CTMA 1WD1A 2K5QA 3ICEA 4XDXA 3EVQA 1U0LA 2KCCA 5FJ8H 1EIFA 2LFNA 1K73C 4A76A 1PFMA 4O1NA 1YJWA 2RKSA 4DK1A 2AQ3B 3DWQA 4CDCC 2NUCA 1I4XA 2A6EC 1OXTA 1VMCA 2Z6KC 3EBEA 4JW0A 1QUQA 1WTHA 5CV5A 3AEVA 1VQ8A 2UUBQ 1A0IA 2ICIA 1IXRA 5IWAL 3BZKA 4A75A 5AFWA 1SNMA 1BCPD 4DV3Q 2B2TA 4PG3A 5JEAJ 2Q2HA 1X32A 3KBGA 3MEHA 4GZYC 4K2KA 3PIOA 1AEXA 1WJJA 2SDFA 5I6YA 1X3PA 3L2PA 1E2WA 4BBRB 1YHQA 4RA8A 1OO9B 2NN6H 2NVXB 3PO3B 4UP8A 5HURA 4HIOA 3SVMA 4XT3B 3SK5A 2D62A 4HTHA 4V0BA 2K5HA 4X3SA 2L12A 3K8AA 5C4JB 1BCPC 3D31A 1OXVA 4LFCL 3T51B 1K3RA 4AYBG 2EYPA 5BR8L 2F3IA 3QOJA 3K7UC 1EQVA 2SNMA 2E2IH 4IPCA 3H6MA 4ME5A 1HUMA 3HS0C 4DPGA 2QDLA 1Z7TA 5M3FH 1VQ9A 4GKKL 3J80L 3CCVA 3CP0A 4DV6L 5JEAG 1VQKA 2QCPX 4YY3Q 4DGZA 1L1OB 3UDIA 3HOWG 3CKIB 4IURA 2I46A 1IBLL 4QQBX 1BVSA 1XNRQ 3HKZE 1SDFA 2V1CC 1LT5D 4ME3A 4OIKA 5IGDA 1J5EL 1I6HB 4UHVA 2I5MX 4GKJQ 2Z0SA 4LNQA 3PUYA 1K83B 4L63B 3STBD 4DV7Q 3H3VC 1YVCA 1S5CD 1Q3LA 1B2TA 2DJFC 2FXQA 4KTAA 3FP9A 2C5CA 1QWYA 5IT9E 2G5DA 1U9RA 4FVMA 2JA6B 3OWEB 1WTOA 1EWIA 4BS9A 2BDOA 3KK7A 2PQAB 4C3IB 1NR4A 2AWNA 4PMCA 2XWJB 2C9OA 3STBC 3ND8A 1IBML 4JYAL 3R93A 1MSHA 4IFDI 3OOCA 1PYSB 3M4YA 3VYTA 3EIVA 1ILPA 2A8VA 1SAPA 3MHBA 5EKIA 1SYFA 1PRTD 4S3SA 2CCZA 1MD2D 3E6ZX 3NBIA 1NMFA 1UAPA 1S72A 3N52A 1Y69U 1HZAA 4LF6Q 5CV7A 3GTPB 3KLSX 4GLVB 4C2MB 2A1AA 3NQIA 4QF4A 1PHJA 3HOZB 1EEID 3K58A 1QVFA 1DJRD 1NUCA 1NTGA 2PMZB 5JVH3 2PCFB 4IOCA 1G91A 1E7ZA 3A7AB 4DF7A 1SROA 4X66L 2BA0A 4ZRZA 4YY3L 3M4OB 4R4QA 1D5MC 2JXMB 3W2DA 5KNCA 3HOWH 4YWMA 4LF7Q 1EIYB 1TU2B 5GAHC 1PZJD 1QG7A 3P20A 3S24A 4XQNA 2JQOA 2B39A 4FXKC 2LSSA 5EBDA 5EPKA 2WAQB 2HQLA 1B3QA 5C5MA 5C3EG 3FKIG 4GKJL 4K5WA 1LTLA 5EGTA 1Y8OB 4DV7L 2PMZE 1VQJA 1R4QB 1RKNA 2E74C 4WJ4A 1JJ2A 2NVTB 3H15A 2N49A 1Y14B 3PCOB 4QGUA 4X65Q 5M5YB 4P72A 3NSWA 2AKWB 1AZQA 4ALPA 1LO5D 4X3KA 4QL5A 2Z8LA 2CQOA 1I94Q 1N32Q 2L5TA 1AE2A 3S16H 4A3LH 2UXBQ 4LUOA 3HOXH 2WAQE 1SNPA 3Q8DA
chains in the Genus database with same CATH topology
1ET9A 1XWEA 3I91A 2PPBC 1I4PA 4KN4C 3KLRA 3A8JE 2KEDA 3GV3A 3A8KE 4ODGA 4J8QA 2DNEA 5E4XA 1YNJD 1Q1BA 3X3NA 5LL6X 2M9VA 4K8IA 1I6VC 2Y0SB 3MXUA 1A2UA 4MN3A 4DK0A 2L9HA 2K33A 3TP8A 2SOBA 4ID6A 4XTCS 4J6HA 4PMBA 2J4XA 3I3CA 3PUWA 2XN9C 2MGSA 1SYBA 2ID0A 3DWAA 4DU9A 5JJZA 5CV8A 1JOQA 1CM9A 1A3UA 3VR3A 2E2IB 5KEEA 3MFGA 4ZYSA 1EY4A 1BUVT 5M3FB 4HMJA 2ENBA 3CRLC 2A69D 5EQ0A 4FXGC 3C1FA 5ELDA 1JCKB 2A6HC 4WORA 1WTQA 3QO2A 2D2CC 1XTCD 1SNOA 4KHZA 1TS4A 5ISRA 4CGYB 5JPNC 2WP8J 3V05A 4DN4M 3DXJC 2A69C 2B2WC 1HHVA 3NWSA 4E6IA 2TMPA 2RA4A 2RQXA 1PFNA 2LKVA 4R8NA 2NTTA 4JK1C 2F3WA 3FMCA 4F7XA 2DN8A 4LK1C 2N55A 1LTID 4HAEA 2IJ0A 3E5SA 2EJMA 4DFAA 3DWPA 3A8IE 4WRDA 2M00A 4FP5D 3GD7A 2NBFA 2WACA 3RUZA 1OXSC 4QUCA 4ZLTF 2TSSA 1TY0A 1B3AA 1LV9A 1Y8PB 3HOWB 1EY8A 4FYDA 5J1ZA 3TSSA 3VR6A 2KA7A 5HGTA 5C5LA 4U68A 2O5JC 2EYJA 1QILA 4OHJA 3VA7A 5C3WA 1SMYD 1KTKA 2KQ3A 1WTVA 3SR1A 1IL8A 1VCIA 1B44D 3V96A 3S16B 4XYOA 3HOXB 2QDBA 1ZYRD 2L55A 5BN4A 2DY7A 2PW7A 3URYA 2PNRC 2F0GA 4DAPA 3I70A 4NP5A 2F0DA 3I8ZA 3HRZC 3AU7A 4RHSA 1F77A 4KI0A 3VR4A 3MAQA 3JAML 1YNNC 1FYCA 3FPUB 2XIWA 3K59A 2EY6A 1ENAA 3W3AA 1A15A 4KV6A 1BDOA 1F2LA 3U9SA 1HRJA 4RGMA 5I2YA 2QEJC 4NMZA 2XRSD 2B2VC 1O7LA 1BR9A 4BA2I 4DAYA 5C0XJ 5C3EB 1DOKA 3FKIB 3C2PA 3VYSA 3BS1A 3QJYA 1EY6A 3PUXA 3MXNA 3LWEA 5FKAC 3RZDB 4R8IA 2G9HD 2F0MA 2F0FA 2F0HA 4G57A 1XX8A 2K6AA 3MWYW 2NN6I 1NAPA 3MXGA 2LY7A 5C0XG 2HUGA 4TRDA 3K7AB 3PMFA 2YU9B 1A3VA 4H44C 1TVXA 4G7HC 3FDTA 4C3JB 3DHQA 1BNZA 1PTOD 3TZDA 2JEAI 1A2TA 2HCIA 4A93B 4G7OC 4A3EB 2HDLA 3A7LA 5FO8B 2NB0A 3O13A 4IQZA 1ILQA 4KJOA 2ZXRA 4KKSA 5CBAE 4A3GB 3HZXA 4KY6A 4KY5A 1JOOA 2A5HA 3NK9A 4IUTA 3QIAA 3BDOA 1II3A 4BY7B 4RWSC 5E1FA 4M1UB 2F0SA 1PZID 5ELBA 1PZKD 1F2YA 2A6ED 3M3YB 1IW7C 4X3TA 2MHVA 1ML0D 1QNUA 1B1ZA 4QCLA 1G2TA 4CHTB 1SNQA 1T5XD 2L11A 2EE1A 4PNYA 2F0WA 4KHVA 2EXZA 4ILWA 4K5XA 2WKCA 2KCNA 1F9RA 5C4HA 2OF1A 2AUJD 2KOLA 1SSOA 1G6ZA 2HCCA 3BZDB 1EU3A 1GHJA 3K0YA 3NWTA 1SE2A 1F2MA 5JAVA 1EZ6A 5LL6S 5KGUA 3GTLB 4O42A 3D4RA 3ZYYX 3NUCA 1E2ZA 3C1EA 5KYLA 2F1MA 3GTOB 5CV6A 5DNFA 1XXGA 1I4GA 1ESRA 5CR3A 3MZ5A 3S1RB 2EDGA 4B08A 5IODA 1S5ED 4XQJA 4QB4A 3BG3A 2E76C 1EWCA 3T13A 3T4AC 2JSOA 4NW2A 1EZ8A 2YYZA 4IUNA 4FXDA 2K28A 2X6GA 1G291 3E0JA 3GTJB 4RAUC 2F0VA 3D6CA 2XNAC 1SNPA 4IFDJ 1RF2D 2HDMA 1JQYD 5TSSA 1F9PA 1HQMC 4KD3A 3JAME 4IUUA 1LT3D 1QOHA 1JOKA 1BXTA 1EYAA 2ZXPA 2B2TC 1STGA 4DA2A 1B4OA 2BCOA 3BVGA 2IW3A 3BVMA 5IIFA 3KUPA 5JEAH 5CV4A 1GUSA 1KAAA 3M7NA 5T1GA 3NTHA 1W6JA 3F2UA 1CHQD 2B2UC 5F2DA 4EQNA 4C3HG 1SNCA 2V4DA 1TKWB 5IGFA 2NVQB 5IOCA 3RZOB 3S2HB 4OIJA 3OMGA 1B50A 3S14B 5D14A 2R92B 3GO5A 3BYTB 4KN7C 3MTSA 1ENFA 5C3XA 3CHBD 3NTKA 1H9RA 3IL8A 3J81E 4Y7NB 1J8IA 5C6AA 1O78A 3NP8A 2PO4A 3OHXC 1C8CA 3Q22A 1NR2A 2VB3X 1TS5A 4N9PA 1I50B 3K6OA 3QB3A 3WOFA 1HUNA 1TT2A 3D4WA 1NSNS 4Q5VA 3SDZA 1BF4A 5I9OA 4F88A 3TMEA 1D5XC 1DM0B 4HSVA 2SNSA 1JB3A 2EY1A 1WD0A 5C44B 4EQPA 2NTSA 4LAAA 1LTGD 2K32A 5G3LF 4A3FB 1GXDC 1HXYD 2RDHA 1V43A 1KLGD 3BDLA 1TQOA 1STHA 1STBA 1PTOB 2B2YC 3HGBA 1D1KA 3PIP3 1SJED 3PV0A 4OO1G 3NXWA 1LTSD 5KNBA 3EROA 1I4HA 4UDUC 4A3DB 1TWHB 3HOVB 2A6HD 2SEBD 4RH6A 1EWHA 2AUKA 1ZEQX 3LWUA 1WCMB 3P1HA 4G4KA 4PMWA 3A54A 1B9MA 2K03A 1DONA 2F0QA 5BN3A 1LTRD 1C4QA 1EY0A 1G2SA 2BE5C 2L1BA 3AMUA 3L3OC 2F0NA 2A74C 1IKLA 1XYIA 3SK8A 3S1QB 5D65A 1JWSD 5A2QE 1FR3A 2XSCA 2CW0D 4FO2A 3IFTA 1U4PA 1Z6HA 2A68D 4C56C 2WB1B 1BCPB 1KDBA 3TDQA 1STNA 1D6EC 1I4QA 5LHY1 3PUVA 2EPBA 2KUMA 4L8JA 2CW0C 1KABA 3OIPA 1U4LA 3VYRA 1ONLA 2F0IA 2RSNA 2A68C 1SE3A 1HA5A 2VB2X 4I65A 1GHKA 3D4DA 4K14A 4TQUS 4OO1H 1TWAB 1CQFA 2QILA 3J7AV 2CQAA 1M4VA 1C48A 4AYBB 3EJIA 3P7JA 2RBMA 3GV6A 1SYGA 2B2VA 1LTTD 3V2TA 4RCOA 1Y1VB 3P75A 2A73B 2J0TD 2EOTA 5CV9A 1FNVA 4HMIA 1QNKA 3EA6A 2B8FA 2Z4IA 2E2DC 5ELCA 1S5DD 3I90A 4IN3A 1UEAB 4C1NI 1LACA 3NPPA 5COYA 1J9OA 1JE4A 1SYEA 1SXTA 3Q6SA 3S1MB 1I3QB 2R93B 4ZK9B 4C1NK 2FFKB 2PZUA 1HFGA 4WJWA 4FNFA 4KMUC 3VA5A 1GUTA 4ABNA 1KNAA 1U4MA 3DMUA 5EPLA 2J7ZA 1FD7D 2PW5A 1EL0A 4C3IG 2KVMA 5EBCA 1BQQT 1DOMA 1PRTB 1YNND 3T56B 4IUQA 5KNDA 1LTBD 1Q8IA 2F0JA 2F0LA 3NHHA 2KHSA 3OIQA 2AWOA 3ERQA 4FF2A 1V1PA 3A55A 3S2DB 1LTAD 2F0KA 4F87A 5FLXE 3I4LA 4KK7A 3BDCA 3EQLC 2RDFA 4KKUA 2H4OA 1OXXK 4X3UA 2CVRA 3I4MB 1Q1EA 3OWFA 2MP1A 4TKOB 1DXMA 1JORA 5DAUA 3T53B 1BCPF 4C3HB 3QWNA 3C3LA 1PXUA 1DZ1A 3NBHA 1VF5C 3LNNA 3DUZA 1M8AA 1EOTA 4FF4A 2F03A 3VYUA 1GOZA 2WIIB 1Q12A 5D3DA 3X3MA 1RD9D 2BDNA 3MXPA 3NTIA 1EIHA 1RTOA 1MI2A 2WINB 3KLSA 2ZT9C 5C0XI 3UI2A 2IT1A 1WTXA 1O80A 3R8BA 2RDGA 3HG9A 2Q8TA 2OT2A 3S9WA 4RKBA 1ET6A 1ESFA 1KDCA 3J81L 2EYMA 4DNTB 4RGOS 3KF8A 4IUPA 2IX1A 1HTPA 1HA6A 1NCVA 1HQRD 1AP0A 1BO0A 5EKKA 4CJ1B 4Z9CB 3I73A 3NQTA 1TIID 1WTPA 1S4ZA 2EJFC 2EZVA 4RGNA 3Q23A 1TR5A 2DY8A 5ELFA 2B8GA 2L4NA 5CC4A 1IW7D 2PYKA 1AW7A 1HFNA 5KRUA 2F0EA 4DXGA 2BA1A 4CJ0B 1PRTF 4LMQD 4DXFA 4ZKCB 5M5WB 2O2LD 4ZUIA 2F0TA 1EU4A 5NUCA 1IYUA 2LS01 2JP1A 4PQXA 5CGKA 1QB5D 3ND9A 3QOLA 3TP7A 2FHTA 1TS3A 5FK9C 1TWGB 1QE6A 5C0XH 4CJ2C 4K6LA 5I4DA 2K7VA 4K8JA 5K5PA 1PTOH 1IHZA 4A3JB 4G7ZC 2EYOA 4ULLA 5A2QL 3T16A 3Q0AA 4KKTA 2F4IA 3H09A 2JA5B 2Z4HA 3GQBA 5JOBA 5IGBA 3DEPA 2D5DA 2R7ZB 3SEBA 3KBXA 3VR5A 1JR0D 2B2UA 3CU7A 1H9KA 5DEHA 3PIO3 4B9XA 1DOLA 4RGTA 2K5WA 2N88A 4YIJA 5ELEA 3D8GA 3HKZB 3R2IA 1R4PB 5M5XB 4WFN3 2BOSA 1SJHD 4MIUA 1H9SA 2QF7A 5FO9B 4OGQC 1PLFA 1EY9A 3HOUB 3DM1A 1F9SA 4CBVA 4I7ZC 2MJ8A 4RFBA 4TSSA 1PMRA 1GUOA 2VNUD 1T5EA 3K5MA 3EFXD 5M9OA 5D3IB 1WVLA 5EJWA 4KY7A 5I9PA 4EQOA 4UAIA 5I6WA 2PZTA 3H91A 4CKBA 2GA4B 1B9NA 4IALA 1VF7A 2VUMB 3GTGB 2JA7B 3SHLA 2M2LA 1EY7A 1STEA 3WDNA 2ICEC 4XXEA 5BN5A 5KYIA 2B2YA 3J7AF 5C4ZA 4KD4A 4ZQ3A 1B53A 5FO7B 4A3KB 5E4WC 3GP7A 3SK6A 4B9WA 4BBSB 2KEEA 3R3OA 3A56A 1KLUD 1SBBB 1RODA 4IFDG 1CQVA 1TWCB 1SEBD 2F0PA 4U673 3S1NB 5E3FA 4BY1B 4FF3A 4XT1B 4H13C 1PRTC 1JWMD 1CK1A 5FLXL 2JYOA 1HPCA 4A3IB 3NE5B 1GUWA 1KNEA 2XRQD 3MA2B 3S15B 3HP3A 2CHBD 2JEBI 1CHPD 1A6XA 1CI3M 4CKCA 2E2JB 2IX3A 2B2WA 2K05A 5J22A 1W6KA 1Y1WB 1SNDA 1EIGA 5CYUA 5IGGA 2HQEA 2OEOA 3G6JB 4DNRB 3D3RA 1PYWD 1U4RA 3RD4A 4ZUJA 2PZWA 4K2LA 2OXPA 2F3VA 2FINB 2I07B 1QJOA 1V1PB 1K8MA 1LT6D 2VXWA 4OO1I 1TY2A 1EQTA 4LJZC 4K5VA 3SXHA 3C46A 5JVG3 2IL8A 2WV6D 2B63B 5A35A 3I72A 3FRPB 5CORA 2EYHA 4C3JG 4M8AA 5EPJA 2RSOA 4IFDH 2EJGC 2KJXA 1ICWA 3I4NB 3BVZA 4PV1C 2Q8RE 4EGVA 3FVQA 1OXUA 2XVSA 2D9UA 1BBXC 4IZ8A 2JE6I 2BE5D 4R9WA 4ZKBB 3VR2A 3QG1A 4A3MB 4BA1I 1KDAA 4HEDA 1YNJC 1S5BD 4RKLA 4ZAIA 1VDZA 2O4XA 5CBEE 2EYFA 1AN8A 1JC7A 3M85A 1RJTA 3LX0A 4MHEA 1EFID 2Z1CA 4HSPA 3N6RA 2FJ2A 1ENCA 3TZUA 2IPKD 3SE0A 3BYYB 2E2HB 2RVLA 1IYVA 1DCZA 5IGCA 1HCZA 2LMCB 2O5IC 2EYLA 4QMGA 1G8ZD 1FNUA 2MPMA 1EYDA 2K01A 1ZKOA 5C4XB 4RCNA 1JICA 3GTMB 1MGSA 2E75C 1F9QA 1AFPA 1Y8NB 1R9TB 3R2TA 4DAVA 4P2CB 4QIWB 3J80E 1D1IA 3AB9A 1RHPA 2NWGA 2K5DA 3K5NA 1CZGA 3TP5A 5K36G 3ITPA 1Z47A 4HN7A 4L6TB 3OSOA 1CA5A 3TP6A 2AQ2B 3L7ZC 2AQ1B 2EVBA 1PTOF 3IAYA 3ONAB 5G3LD 1H9MA 3DEOA 2IX0A 2XWBB 3OMCA 4OL7A 3H0GB 1EEFD 3S17B 5T1IA 4XIGS 4Q0FA 5EKLA 2K1BA 2PQEA 4NKLA 4J1MA 3H94A 3TBIB 1V1OA 4HCSA 4F8MA 2FMMA 3OPOA 2ZXOA 3GTKB 1F2ZA 1FGBD 5CMDA 1D2BA 3Q24A 2X69A 2R3ZA 1E2VA 1PDQA 1CT1D 5IT9L 1O7YA 5KIXA 2G9DA 1UUPA 4CKEA 1H9JA 2NVYB 1SMYC 1TWFB 1WTRA 4N9TA 3SK4A 1Q90A 1CFMA 3PUZA 5J39A 3TN2A 5K36H 3K5OA 1WTWA 1H9SB 3G7LA 2FMCA 1SE4A 2R6GA 3K5LA 1ZYRC 1GJXA 2NZ1D 3M7GA 1QCBD 1PFBA 1VMPA 1CA6A 1BOSA 1MBYA 4A3BB 3U9OA 2EY5A 3RLFA 2QKIC 1L0YB 1X3QA 1EY5A 1GUNA 3J7YW 2MUYA 4KJNA 3D6WA 4QUFA 3MFYA 1L0XB 4HR7B 1HTLD 1RDPD 1RCVD 2KECA 1D5ZC 4RHRA 1K8OA 1STYA 1I4RA 3CQZB 1DYQA 4JBWA 5M3MB 1AZPA 3CRKC 1UNSA 4XYQA 3FEWX 1LT4D 1SYCA 4XQQA 3MC0B 1O7ZA 1CZWA 1GUGA 1LLRD 3PO2B 1S5FD 5IGEA 5DM63 1DD2A 3HOYB 2DNCA 4IUVA 5JPMC 1A3TA 3K57A 1STAA 3OW7A 1SFOB 1V8QA 4NDXA 2IWHA 2NN6G 1SYDA 3WOEA 5FOBB 2R61A 3RMHA 3FPPA 4H0LC 4H7BA 4V190 2Q8IB 1FNWA 4K6DA 3MVVA 4BWGB 5DM73 1PTOC 3IKJA 1IKMA 2L0CA 2X6LA 2JA8B 3IFDA 2F0OA 1MSGA 4HCEA 1TS2A 3L9AX 3HEJA 1E0BA 1LABA 4FF1A 2WKDA 5I2XA 2NYZD 4EVOA 1ZXTA 2F0UA 1EYCA 2H1EA 1RTNA 3GTQB 2EY2A 2K04A 1CTMA 1WD1A 2K5QA 4XDXA 3EVQA 2KCCA 2LFNA 1PFMA 4O1NA 2RKSA 4DK1A 2AQ3B 3DWQA 2NUCA 1I4XA 2A6EC 1OXTA 1VMCA 5CV5A 2ICIA 5AFWA 1SNMA 1BCPD 2B2TA 5JEAJ 1X32A 3KBGA 3MEHA 4GZYC 4K2KA 1AEXA 2SDFA 5I6YA 1X3PA 1E2WA 4BBRB 4RA8A 1OO9B 2NN6H 2NVXB 3PO3B 5HURA 3SVMA 4XT3B 3SK5A 4X3SA 2D62A 4HTHA 4V0BA 2L12A 5C4JB 1BCPC 3D31A 1OXVA 3T51B 2EYPA 3QOJA 1EQVA 2SNMA 3H6MA 4ME5A 1HUMA 3HS0C 1Z7TA 3J80L 5JEAG 2QCPX 4DGZA 3CKIB 4IURA 2I46A 1SDFA 1LT5D 4OIKA 5IGDA 1I6HB 3PUYA 1K83B 4L63B 3H3VC 1S5CD 1Q3LA 1B2TA 4KTAA 2C5CA 1QWYA 5IT9E 1U9RA 4FVMA 2JA6B 3OWEB 1WTOA 4BS9A 2BDOA 3KK7A 4C3IB 1NR4A 2AWNA 4PMCA 2XWJB 2C9OA 3ND8A 3R93A 1MSHA 4IFDI 3OOCA 3M4YA 3VYTA 1ILPA 1SAPA 3MHBA 5EKIA 1SYFA 1PRTD 4S3SA 1MD2D 3E6ZX 3NBIA 1UAPA 3N52A 1Y69U 5CV7A 3GTPB 3KLSX 4C2MB 3NQIA 4QF4A 3HOZB 1EEID 3K58A 1DJRD 1NUCA 2PMZB 5JVH3 2PCFB 1G91A 3A7AB 4DF7A 2BA0A 4ZRZA 3M4OB 1D5MC 2JXMB 3W2DA 5KNCA 1TU2B 1PZJD 1QG7A 3P20A 4XQNA 2B39A 4FXKC 5EBDA 5EPKA 2WAQB 5C5MA 4K5WA 5EGTA 1Y8OB 1R4QB 1RKNA 2E74C 2NVTB 5M5YB 3NSWA 1AZQA 1LO5D 4X3KA 2Z8LA 2L5TA 1JWUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIJ A;  5E4W C;  1HFG A;  1G2S A;  2HDL A;  2Q8R E;  1B50 A;  2L1B A;  1ESR A;  2RA4 A;  2D9U A;  3I91 A;  5D14 A;  1PFN A;  2H1E A;  1BBX C;  2KEE A;  1RTN A;  1ILQ A;  1X3Q A;  3MTS A;  1IKL A;  4IUP A;  2K04 A;  4R9W A;  4ZKB B;  1XYI A;  5CBA E;  1KNA A;  3I8Z A;  1WD1 A;  1U4M A;  1HA6 A;  1CA5 A;  1NCV A;  1WTO A;  5EPL A;  1ROD A;  2J7Z A;  4XDX A;  5D65 A;  3D6W A;  4QUF A;  3IL8 A;  1NR4 A;  2N55 A;  4HED A;  1AP0 A;  1BO0 A;  2KED A;  3GV3 A;  4CJ1 B;  1EL0 A;  2KVM A;  3DEP A;  3FPU B;  2XIW A;  3ONA B;  4HAE A;  3R93 A;  1PFM A;  1J8I A;  1MSH A;  4ZAI A;  3DEO A;  4XT1 B;  3KBX A;  1C8C A;  1A15 A;  1DOM A;  4IUT A;  1WTP A;  2B2U A;  1F2L A;  5E4X A;  1NR2 A;  1U4P A;  5CBE E;  1ILP A;  1HRJ A;  2KEC A;  4IUQ A;  1VMC A;  1DOL A;  1S4Z A;  4RWS C;  2JYO A;  1SAP A;  2N88 A;  5T1I A;  5EKI A;  1GUW A;  4NW2 A;  1HUN A;  1RJT A;  1KNE A;  4MN3 A;  4QUC A;  5AFW A;  2B2V C;  2DY8 A;  2EPB A;  2L9H A;  1AZP A;  2B2T A;  2KUM A;  3N52 A;  2K1B A;  4MHE A;  1X32 A;  2K28 A;  4ZLT F;  2X6G A;  1BF4 A;  3HP3 A;  2L4N A;  4X3T A;  1B3A A;  4HSV A;  3I3C A;  1U4L A;  2SDF A;  1X3P A;  2RSN A;  1LV9 A;  2MGS A;  4RAU C;  1WD0 A;  1DOK A;  1ML0 D;  4RA8 A;  1O7Z A;  1Q3L A;  4HCS A;  1PLF A;  2FJ2 A;  2FMM A;  1HFN A;  3DM1 A;  1G2T A;  5JJZ A;  1F9S A;  2HDM A;  4XT3 B;  3SVM A;  2B2W A;  4X3S A;  4X3U A;  2K05 A;  2L12 A;  2MJ8 A;  3LWE A;  1G91 A;  2CVR A;  1CM9 A;  4IUV A;  5CMD A;  2L11 A;  1F9P A;  2EE1 A;  4CJ0 B;  2X69 A;  2R3Z A;  2MP1 A;  1PDQ A;  1EIG A;  2B2Y C;  2RVL A;  4LMQ D;  4ZKC B;  4R8I A;  4IUU A;  1O7Y A;  3P7J A;  1QG7 A;  1DZ1 A;  3GV6 A;  2MPM A;  1F9R A;  1U4R A;  4U68 A;  1WVL A;  2KOL A;  1M8A A;  5EJW A;  5EPK A;  1HUM A;  1EOT A;  1WTR A;  1XX8 A;  1SSO A;  2K01 A;  3MWY W;  2B2V A;  5EQ0 A;  1G6Z A;  2JP1 A;  1NAP A;  2B2T C;  2FIN B;  3H91 A;  4UAI A;  1WTQ A;  3QO2 A;  1JIC A;  1B4O A;  2VXW A;  2HCC A;  1EQT A;  3TN2 A;  2BDN A;  2FHT A;  1MGS A;  1WTV A;  1F9Q A;  3KUP A;  2EOT A;  2HUG A;  1WTW A;  2IL8 A;  1QNK A;  4IUR A;  1RTO A;  3G7L A;  1IKM A;  1MI2 A;  1EIH A;  1IL8 A;  1QE6 A;  2X6L A;  3IFD A;  4DN4 M;  1TVX A;  3FDT A;  5T1G A;  4CJ2 C;  3F2U A;  1MSG A;  3I90 A;  2B2U C;  3UI2 A;  5COR A;  2B2W C;  1O80 A;  1SDF A;  2M2L A;  2NZ1 D;  1WTX A;  1AZQ A;  1BNZ A;  4O42 A;  4OIK A;  5EPJ A;  3TZD A;  2RSO A;  1E0B A;  4X3K A;  5COY A;  1J9O A;  1JE4 A;  1RHP A;  2NWG A;  1HHV A;  1PFB A;  2B2Y A;  1VMP A;  2K03 A;  2Q8T A;  2HCI A;  3Q6S A;  1B2T A;  1ICW A;  1DON A;  2NYZ D;  2DY7 A;  1CA6 A;  4ZK9 B;  1B53 A;  5DNF A;  2FFK B;  1ZXT A; 
#chains in the Genus database with same CATH topology
 2EIF A;  2K5N A;  1ET9 A;  1XWE A;  3I91 A;  1MHW C;  2PPB C;  1I4P A;  4KN4 C;  1C9O A;  1KL9 A;  3KLR A;  1XPU A;  4GNX B;  3A8J E;  2KED A;  3GV3 A;  4YWK A;  3A8K E;  3T1H Q;  4ODG A;  4J8Q A;  2DNE A;  5E4X A;  1YNJ D;  3CCS A;  4A3E G;  1Q1B A;  1N8R C;  5AJ3 Q;  3X3N A;  5LL6 X;  2M9V A;  1PH1 A;  4K8I A;  1I6V C;  2Y0S B;  1YIJ A;  1E1O A;  3MXU A;  1A2U A;  4GS3 A;  4MN3 A;  4DK0 A;  2L9H A;  2K33 A;  1YNX A;  2SOB A;  3F1Z A;  3MEF A;  4ID6 A;  4JBJ A;  3TP8 A;  4XTC S;  4J6H A;  4PMB A;  2J4X A;  3I3C A;  5LMN W;  3PUW A;  3RLO A;  2XN9 C;  2MGS A;  3U50 C;  4A3G G;  1SYB A;  2ID0 A;  3DWA A;  1VQ5 A;  4DU9 A;  3CW2 C;  4JCV E;  1EQR A;  5JJZ A;  5C3E H;  3FKI H;  1KRT A;  5CV8 A;  5IYC H;  1JOQ A;  1CM9 A;  4BY7 G;  4LF9 L;  1A3U A;  3VR3 A;  1XPR A;  2E2I B;  5KEE A;  4MNO A;  1CSQ A;  4X62 Q;  3MFG A;  2Y0S E;  4NXN L;  4ZYS A;  3RZD H;  3M4Q A;  1EY4 A;  4X6A H;  1BUV T;  5M3F B;  4HMJ A;  2ENB A;  3CRL C;  2A69 D;  2PI2 E;  5EQ0 A;  1B70 B;  3C1F A;  4FXG C;  5ELD A;  1VQP A;  1JCK B;  2A6H C;  2YTV A;  4WOR A;  1WTQ A;  1V9P A;  4B3M Q;  3QO2 A;  2D2C C;  1XTC D;  1I94 L;  1SNO A;  4KHZ A;  1TS4 A;  4GOP A;  5ISR A;  4CGY B;  4B3S L;  1SMX A;  4YCU A;  5JPN C;  2WP8 J;  3V05 A;  2KCT A;  4DN4 M;  2RCN A;  3DXJ C;  2A69 C;  2B2W C;  1KRS A;  3K7A H;  1VQ4 A;  2YU9 H;  2K5V A;  2ZTD A;  4POG A;  1HHV A;  2F4V L;  4C3J H;  3NWS A;  4JI0 Q;  4E6I A;  1SN8 A;  2TMP A;  3T1H L;  4LF5 Q;  1QVC A;  2RA4 A;  2RQX A;  1PFN A;  2LKV A;  2ZJP A;  4R8N A;  4A93 H;  4A3E H;  2NTT A;  4JK1 C;  2F3W A;  1E1T A;  3FMC A;  1VQ7 A;  1LM0 A;  4F7X A;  2DN8 A;  4LK1 C;  2N55 A;  1LTI D;  2ZM6 L;  4HAE A;  2IJ0 A;  3E5S A;  2EJM A;  1JJC B;  1IZ6 A;  4DFA A;  3DWP A;  3A8I E;  4WRD A;  4A3G H;  2RHS B;  2M00 A;  1YI2 A;  4FP5 D;  2H5X A;  3GD7 A;  2NBF A;  2WAC A;  3RUZ A;  2VL6 A;  4BY7 H;  1OXS C;  4QUC A;  1HNX Q;  3W1B A;  4ZLT F;  2TSS A;  1TY0 A;  4X62 L;  1B3A A;  3T1Y Q;  3M3Y H;  1LV9 A;  1Y8P B;  2ZJQ A;  4NXM Q;  1GVP A;  4LF4 L;  1X65 A;  1HNW Q;  3HOW B;  4ZCK A;  4MTN A;  4B3M L;  4JI7 L;  4AQY Q;  1EY8 A;  4JI2 L;  4FYD A;  5J1Z A;  1NE3 A;  3TSS A;  3VR6 A;  2KA7 A;  5HGT A;  4LFA Q;  4WJ3 M;  5C5L A;  4DR7 Q;  5GQO A;  4U68 A;  1QUQ B;  2O5J C;  2EYJ A;  1QIL A;  4OHJ A;  3VA7 A;  5C3W A;  1SMY D;  4GN3 B;  1KTK A;  2KQ3 A;  1WTV A;  4LF5 L;  4IPH A;  3SR1 A;  2K14 A;  1IL8 A;  1VCI A;  4HJ8 A;  1B44 D;  1PYB A;  3PF4 A;  4H02 A;  3V96 A;  1FVI A;  3S16 B;  4XYO A;  3HOX B;  1FJG Q;  2QDB A;  1ZYR D;  3GTL H;  2L55 A;  5BN4 A;  1VQM A;  2DY7 A;  1ASY A;  2PW7 A;  2MQH A;  3URY A;  2NZO A;  2PNR C;  4A3K G;  3SGI A;  2F0G A;  3ULL A;  4DAP A;  3GTO H;  2QGQ A;  3PF5 A;  4BBS G;  3I70 A;  1M1K C;  4NP5 A;  3AYH B;  2F0D A;  3I8Z A;  3HRZ C;  3AU7 A;  4RHS A;  1F77 A;  4KI0 A;  3S1R H;  4LUV A;  3VR4 A;  3MAQ A;  1V1Q A;  3JAM L;  1YNN C;  1HR0 Q;  1FYC A;  3CC2 A;  3FPU B;  2XIW A;  3K59 A;  2EY6 A;  3K0X A;  3L0O A;  1ENA A;  3W3A A;  4BY1 G;  1A15 A;  4KV6 A;  3RNU A;  1BDO A;  1F2L A;  3U9S A;  1KC8 C;  1HRJ A;  4RGM A;  5I2Y A;  1S40 A;  5JJI A;  2QEJ C;  5IP7 G;  4NMZ A;  1HNW L;  2XRS D;  2R92 G;  3KOJ A;  2B2V C;  2OQK A;  2VQE L;  1O7L A;  1BR9 A;  5IT9 c;  4DAY A;  4BA2 I;  3B6Y A;  5C0X J;  4B3R L;  2HIV A;  5C3E B;  1DOK A;  3FKI B;  3C2P A;  3VYS A;  3BS1 A;  3QJY A;  1EY6 A;  3GTJ H;  3PUX A;  3MXN A;  3LWE A;  2VY3 A;  1H95 A;  1TXY A;  2KHI A;  5FKA C;  3RZD B;  1X3E A;  3CCJ A;  1NBW A;  2G9H D;  4R8I A;  3UDX A;  2F0M A;  2F0F A;  2K75 A;  1L2F A;  2F0H A;  4G57 A;  1BBW A;  4MZ9 A;  1XX8 A;  1EOV A;  2K6A A;  3MWY W;  2NN6 I;  4HJ7 A;  5C44 G;  1FJG L;  1YZ6 A;  1N34 L;  1NAP A;  5IWA Q;  4A3F G;  3MXG A;  1XMQ Q;  2LY7 A;  5C0X G;  1PVO A;  2HUG A;  3K7A B;  3PMF A;  4TRD A;  2YU9 B;  1A3V A;  4H44 C;  1TVX A;  4G7H C;  3FDT A;  4C3J B;  3DHQ A;  1BNZ A;  5FLM G;  1VQD A;  1PTO D;  3TZD A;  3M4O H;  2JEA I;  1A2T A;  2BH8 A;  4JC0 A;  2HCI A;  1SE8 A;  4RMF A;  4A93 B;  4G7O C;  4DV1 L;  4A3E B;  1GD7 A;  3I4N G;  2HDL A;  3A7L A;  2NVQ H;  2NB0 A;  5FO8 B;  1VQL A;  3O13 A;  4IQZ A;  4LW1 A;  3RZO H;  3S2H H;  1ILQ A;  1I5F A;  3HOV G;  5BR8 Q;  4KJO A;  2ZXR A;  4KKS A;  1SRU A;  3S14 H;  5CBA E;  2R92 H;  4GNX C;  4A3G B;  4A3M G;  3HZX A;  2RF4 A;  4KY6 A;  4KY5 A;  4GKK Q;  1JOO A;  4R4O A;  3ZJY C;  2A5H A;  2BH2 A;  3NK9 A;  4IUT A;  3QIA A;  3BDO A;  1II3 A;  4Y7N H;  4BY7 B;  1EFW A;  4RWS C;  3J81 j;  3CCR A;  5E1F A;  4M1U B;  2YV5 A;  2F0S A;  1PZI D;  5ELB A;  1IBK L;  1PZK D;  1F2Y A;  1B8A A;  2A6E D;  3M3Y B;  1KQS A;  1I50 H;  1IW7 C;  4UP7 A;  4X3T A;  2MHV A;  1SR3 A;  1ML0 D;  1EUJ A;  1QNU A;  1B1Z A;  4QCL A;  1G2T A;  4CHT B;  5C44 H;  2YTY A;  1SNQ A;  1T5X D;  2L11 A;  3I56 A;  4A3F H;  2EE1 A;  2WB1 G;  3NEN A;  4PNY A;  1XMQ L;  2F0W A;  4KHV A;  2YTX A;  2EXZ A;  4ILW A;  4K5X A;  2WKC A;  3RN2 A;  1IBM Q;  4JYA Q;  1LYL A;  2KCN A;  2UU9 Q;  1F9R A;  5C4H A;  2OF1 A;  2AUJ D;  2KOL A;  3KF6 A;  1SSO A;  4HIK A;  4JI5 Q;  4OX9 Q;  3KYH C;  1G6Z A;  2HCC A;  4YCW A;  3BZD B;  1EU3 A;  3CD6 A;  1D8L A;  1GHJ A;  3K0Y A;  3M4P A;  3NWT A;  4A4I A;  3H3V I;  1SE2 A;  2ZJR A;  4A3D H;  1TWH H;  3HOV H;  1F2M A;  5JAV A;  1EZ6 A;  5LL6 S;  5KGU A;  4O2D A;  3GTL B;  4O42 A;  4DUY L;  3D4R A;  3ZYY X;  3NUC A;  1E2Z A;  4UP9 A;  1EYG A;  3C1E A;  5KYL A;  2F1M A;  3GTO B;  1X9N A;  1WCM H;  5CV6 A;  5DNF A;  1BBU A;  1CKN B;  4X66 Q;  1XXG A;  4JBK A;  1I4G A;  1ESR A;  5CR3 A;  3MZ5 A;  2DUD A;  3S1R B;  3HFZ B;  1YJ9 A;  1Y1V G;  4GN4 B;  2EDG A;  4B08 A;  3CC4 A;  2JN4 A;  5IOD A;  1S5E D;  5GRO A;  4XQJ A;  3NEL A;  4QB4 A;  3ULP A;  2OTL A;  3BG3 A;  3S1Q H;  2E76 C;  1YIT A;  1EWC A;  4KHP Q;  4NB3 A;  5ELN A;  3T13 A;  2R93 G;  3T4A C;  2VZA A;  2JSO A;  4NW2 A;  1EZ8 A;  2YYZ A;  1P16 A;  4IUN A;  4FXD A;  2K28 A;  2X6G A;  4YCV A;  1G29 1;  3E0J A;  2OTJ A;  3GTJ B;  4RAU C;  2F0V A;  3D6C A;  2MFI A;  2XNA C;  3KDF A;  2UU9 L;  4IFD J;  1RF2 D;  2HDM A;  4JI5 L;  4CDD C;  3J80 c;  4OX9 L;  1JQY D;  5TSS A;  1XNQ Q;  1F9P A;  1TWA H;  1HQM C;  4KD3 A;  4EQ5 A;  3JAM E;  3LGJ A;  4IUU A;  1Q8K A;  1LT3 D;  1QOH A;  3I2Z A;  1JOK A;  1BXT A;  1W3S A;  1Q86 C;  1EYA A;  2ZXP A;  2B2T C;  4POF A;  1J6Q A;  1STG A;  4DA2 A;  1B4O A;  2BCO A;  3BVG A;  5LMN L;  2IW3 A;  2VQF L;  1U5K A;  3BVM A;  5IIF A;  3KUP A;  5JEA H;  3I4M G;  3H3V H;  5CV4 A;  1GUS A;  4CDF C;  2QA4 A;  1KAA A;  4R4T A;  3M7N A;  1Y1V H;  3NTH A;  1W6J A;  3F2U A;  1CHQ D;  5T1G A;  2B2U C;  4LUZ A;  5F2D A;  4EQN A;  4C3H G;  1SNC A;  2V4D A;  1TKW B;  5IGF A;  2NVQ B;  1VQH A;  5IOC A;  3RZO B;  3S2H B;  2UXD L;  2LXJ A;  4LF9 Q;  4OIJ A;  4A3B G;  3OMG A;  1B50 A;  3S14 B;  4KHP L;  3S1M H;  1I3Q H;  5D14 A;  2R93 H;  2R92 B;  3GO5 A;  3BYT B;  4KN7 C;  3MTS A;  4NXN Q;  1ENF A;  5C3X A;  3E3X A;  3CHB D;  4P75 A;  3NTK A;  4APV A;  1H9R A;  3IL8 A;  4PZ8 A;  3J81 E;  4IJL A;  4Y7N B;  1J8I A;  5C6A A;  1O78 A;  1QZH A;  3NP8 A;  2PO4 A;  1ICF B;  3OHX C;  4R1J A;  1C8C A;  2I0Q A;  2Q2U A;  3Q22 A;  1NR2 A;  2VB3 X;  1TS5 A;  2D0P A;  4B3S Q;  4N9P A;  1RIP A;  1I50 B;  3K6O A;  3QB3 A;  3WOF A;  1HUN A;  1PH9 A;  1TT2 A;  3F8T A;  3D4W A;  1NSN S;  1N36 L;  4Q5V A;  3SDZ A;  1XNQ L;  1BF4 A;  5I9O A;  4F88 A;  3TME A;  1D5X C;  1DM0 B;  4HSV A;  2F4V Q;  2SNS A;  1JB3 A;  4QJF A;  4OON A;  2EY1 A;  1WD0 A;  3S2D H;  5C44 B;  4R4C A;  1YHA A;  2NTS A;  4EQP A;  3CCE A;  4LAA A;  1LTG D;  2RCF A;  2K32 A;  5G3L F;  4A3F B;  1GXD C;  3UE0 A;  2PNH A;  1HXY D;  2RDH A;  1V43 A;  1KLG D;  1YBY A;  2CH4 W;  1K0S A;  3BDL A;  1TQO A;  1STH A;  1STB A;  1PTO B;  2B2Y C;  3CAM A;  4QY7 A;  3HGB A;  3I4M H;  1D1K A;  2ZM6 Q;  3PIP 3;  1PH7 A;  3I4O A;  1SJE D;  4L5R C;  4C3H H;  3PV0 A;  4OO1 G;  3NXW A;  4N8X 1;  1LTS D;  3CPF A;  5KNB A;  3ERO A;  1I4H A;  4UDU C;  4A3D B;  2CWA A;  4DAM A;  1TWH B;  3HOV B;  1JJG A;  4DAY B;  1JE5 A;  2A6H D;  2SEB D;  4RH6 A;  2HHH Q;  2I5H A;  4HJ9 A;  3OW2 A;  1EWH A;  1VQB A;  2AUK A;  1ZEQ X;  2F52 A;  3LWU A;  1WCM B;  3P1H A;  4G4K A;  4PMW A;  3MXN B;  3A54 A;  1B9M A;  4LF4 Q;  2K03 A;  1DON A;  2F0Q A;  5BN3 A;  1NNX A;  4DV5 L;  1LTR D;  3K80 C;  4P71 A;  1C4Q A;  1EY0 A;  1G2S A;  2BE5 C;  4PZ7 A;  2L1B A;  4JI7 Q;  3AMU A;  3PQI A;  4JI2 Q;  3L3O C;  2F0N A;  1VQN A;  2A74 C;  1IKL A;  3A5U A;  1XYI A;  3SK8 A;  3S1Q B;  5D65 A;  1RL2 A;  2HT1 A;  1JWS D;  5A2Q E;  4B3T L;  4JI6 L;  1FR3 A;  2XSC A;  2CW0 D;  2JK8 A;  1PFS A;  4FO2 A;  1A8V A;  3IFT A;  4A3J G;  1U4P A;  1Z6H A;  2A68 D;  4C56 C;  2WB1 B;  1BCP B;  2AMC B;  1A62 A;  1KDB A;  3TDQ A;  1STN A;  3U4Z A;  1D6E C;  1I4Q A;  5LHY 1;  2A19 A;  3PUV A;  2EPB A;  2KUM A;  3NEM A;  2JA5 G;  4L8J A;  2UUC Q;  2CW0 C;  1KAB A;  3OIP A;  4LFB L;  1U4L A;  3VYR A;  1ONL A;  2F0I A;  2RSN A;  4O0A A;  4JI4 Q;  2A68 C;  4JOI C;  4BBR G;  1KAW A;  1SE3 A;  1HA5 A;  2VB2 X;  4I65 A;  1GHK A;  3D4D A;  4K14 A;  4TQU S;  2R7Z G;  4OO1 H;  1TWA B;  1CQF A;  2QIL A;  3J7A V;  2CQA A;  4K0K L;  4DR5 Q;  2CFM A;  1IYJ B;  1M4V A;  2GVB A;  1VQA A;  2WB1 E;  1C48 A;  4AYB B;  4NPS A;  3EJI A;  3HKZ G;  3P7J A;  1PH2 A;  2RBM A;  2HHH L;  4FDB A;  3GV6 A;  4OWT B;  1KXL A;  5JJK A;  1SYG A;  5M5W H;  2B2V A;  3CMA A;  2WFW A;  1LTT D;  3V2T A;  3HOU G;  1G6P A;  4RCO A;  4J15 A;  1Y1V B;  3P75 A;  2A73 B;  2J0T D;  2EOT A;  5CV9 A;  3G4S A;  2VQE Q;  1FNV A;  3KFU A;  4HMI A;  1QNK A;  3EA6 A;  2B8F A;  2Z4I A;  2E2D C;  5ELC A;  4AYB E;  1S5D D;  3I90 A;  4MTK A;  4IN3 A;  4HJ5 A;  4B3R Q;  1UEA B;  1TWG H;  4C1N I;  4JI3 Q;  1MJC A;  1LAC A;  3NPP A;  5COY A;  1J9O A;  1JE4 A;  4YWL A;  1SYE A;  1K0R A;  1SXT A;  1QVG A;  3Q6S A;  3S1M B;  1I3Q B;  2R93 B;  4ZK9 B;  4C1N K;  2FFK B;  2PZU A;  1HFG A;  4WJW A;  4A3J H;  4FNF A;  1L1O C;  3RN5 A;  4KMU C;  3I7F A;  3VA5 A;  2VUM G;  1GUT A;  2MO1 A;  3KF6 B;  2K52 A;  1KNA A;  4ABN A;  2E5L L;  2JA7 G;  1U4M A;  3DMU A;  5EPL A;  2JA6 G;  2J7Z A;  4KLK A;  1FD7 D;  2JA5 H;  2PW5 A;  3ULJ A;  1EL0 A;  4C3I G;  2UUC L;  2KVM A;  1N34 Q;  5EBC A;  1BQQ T;  1Q7Y C;  3CCL A;  1FGU A;  1DOM A;  4JI4 L;  1PRT B;  1YNN D;  3T56 B;  4IUQ A;  5KND A;  2UUA Q;  2R7Z H;  1LTB D;  1Q8I A;  2F0J A;  2F0L A;  3NHH A;  2KHS A;  1N33 Q;  3OIQ A;  2AWO A;  3ERQ A;  4DR5 L;  4FF2 A;  1V1P A;  3A55 A;  3S2D B;  1LTA D;  2F0K A;  4F87 A;  5M5X H;  5FLX E;  3CC7 A;  3I4L A;  4KK7 A;  4DV1 Q;  3BDC A;  3EQL C;  3HOZ G;  2RDF A;  3OTO L;  4KKU A;  2H4O A;  1OXX K;  4X3U A;  2CVR A;  3I4M B;  4L5Q A;  1Q1E A;  3U4V A;  3OWF A;  4A3I G;  2MP1 A;  4TKO B;  1DXM A;  1JOR A;  5DAU A;  3T53 B;  1BCP F;  4C3H B;  3QWN A;  3C3L A;  1PXU A;  2N3S A;  1DZ1 A;  3NBH A;  1VF5 C;  3LNN A;  3DUZ A;  1M8A A;  1EOT A;  4FF4 A;  2F03 A;  1PA6 A;  4JI3 L;  4N8F A;  2WAQ G;  2PI2 A;  3VYU A;  4AIM A;  1GOZ A;  3F2D A;  1XMO Q;  2WII B;  1Q12 A;  5D3D A;  1IBK Q;  2MO0 A;  3X3M A;  1RD9 D;  2BDN A;  4CDE C;  5IYD G;  3MXP A;  1GO3 E;  2ALY B;  3NTI A;  1EIH A;  1RTO A;  4LF8 L;  1MI2 A;  2WIN B;  3KLS A;  1Y1W G;  2ZT9 C;  5C0X I;  1Z9F A;  2VUM H;  3UI2 A;  2IT1 A;  1WTX A;  1O80 A;  2Z6K A;  2JA7 H;  3R8B A;  1QZG A;  2RDG A;  3HG9 A;  2Q8T A;  2OT2 A;  3JAM c;  5ELO A;  3S9W A;  3A74 A;  4RKB A;  1ET6 A;  1W2B A;  1ESF A;  5DLQ E;  1HNZ Q;  1KDC A;  3J81 L;  4DV0 Q;  2EYM A;  1LUZ A;  2KEN A;  4DNT B;  4RGO S;  3KF8 A;  5IYB G;  4A3K H;  2UUA L;  2K50 A;  4IUP A;  3TS2 A;  1UE6 A;  2IX1 A;  2UXC Q;  2IHF A;  1HTP A;  1HA6 A;  5FJ8 G;  4BBS H;  1NCV A;  1K8A C;  1N33 L;  4X64 L;  2B63 G;  1HQR D;  1AP0 A;  1BO0 A;  5EKK A;  4CJ1 B;  2ES2 A;  4Z9C B;  3I73 A;  5IY0 A;  2ATW A;  3NQT A;  3F2C A;  1TII D;  5GAE C;  1WTP A;  1TWC H;  2R7D A;  3S1N H;  1S4Z A;  4BY1 H;  2EJF C;  2EZV A;  2OCE A;  4A3C G;  4RGN A;  2Y0S G;  3Q23 A;  5IP7 H;  1TR5 A;  2DY8 A;  5ELF A;  2IHE A;  2B8G A;  4A3I H;  4DUY Q;  1Q46 A;  1YEZ A;  2L4N A;  3UDF A;  4P74 A;  5CC4 A;  1K28 A;  3S15 H;  1IW7 D;  2PYK A;  1AW7 A;  1KHI A;  1HFN A;  3CF5 A;  2HD3 A;  5KRU A;  2F0E A;  3J81 c;  4PZ6 A;  4DXG A;  2E2J H;  2BA1 A;  4CJ0 B;  1XMO L;  1PRT F;  4LMQ D;  4DXF A;  5IYD H;  4ZKC B;  1X6O A;  5M5W B;  2O2L D;  1Y1W H;  4ZUI A;  1O7I A;  2CH4 A;  1HJP A;  4JPB W;  2F0T A;  1EU4 A;  5NUC A;  3D0F A;  3BU2 A;  1Q82 C;  1IYU A;  2LS0 1;  2JP1 A;  4PQX A;  1WI5 A;  5CGK A;  1OTC A;  1QB5 D;  3ND9 A;  3QOL A;  3TP7 A;  1YHB A;  2FHT A;  3K81 C;  2DJG C;  1HNZ L;  1TS3 A;  2I5L X;  5FK9 C;  4JV5 Q;  4P73 A;  1TWG B;  5IYB H;  4DV0 L;  1QE6 A;  5C0X H;  4DKA C;  3HKS A;  4CJ2 C;  1S3O A;  2XGT A;  2UXC L;  4K6L A;  4L5T A;  5I4D A;  1VQO A;  2K7V A;  4K8J A;  4EX5 A;  5K5P A;  1PTO H;  3TS0 A;  2B63 H;  4BXX G;  1K8G A;  1IHZ A;  3AFQ A;  5FLM H;  3IRB A;  5L37 A;  4A3J B;  4G7Z C;  3U58 A;  2EYO A;  4ULL A;  5A2Q L;  4JI1 L;  5C4X G;  3T16 A;  4DR2 Q;  1K3B C;  3Q0A A;  1X54 A;  3I4N H;  2ZTC A;  4KKT A;  4DR1 Q;  2F4I A;  3H09 A;  3QR8 A;  4IO9 A;  2JA5 B;  1G51 A;  2Z4H A;  3GQB A;  4A3C H;  5JOB A;  5IGB A;  2GVA A;  3DEP A;  1VS0 A;  2P5Z X;  2D5D A;  4A3M H;  2R7Z B;  3SEB A;  3KBX A;  1EQQ A;  3J80 i;  3G48 A;  3VR5 A;  1JR0 D;  2B2U A;  3CU7 A;  1H9K A;  4GLA C;  5DEH A;  2KCM A;  5LMN Q;  3PIO 3;  2VQF Q;  4DV4 L;  3RR5 A;  4B9X A;  1DOL A;  2K4K A;  4RGT A;  2K5W A;  2N88 A;  4YHH Q;  4YIJ A;  5ELE A;  3D8G A;  3HKZ B;  3R2I A;  2KBN A;  1R4P B;  5M5X B;  4WFN 3;  1HR0 W;  2BOS A;  3TEH B;  2JJQ A;  1SJH D;  1X3F A;  4MIU A;  1H9S A;  4JI8 L;  3WWV A;  2QF7 A;  5FO9 B;  4GOP B;  4OGQ C;  2UXD Q;  1PLF A;  1JWU D;  1EY9 A;  3HOU B;  1VQC A;  3DM1 A;  1F9S A;  2QW7 A;  4CBV A;  4I7Z C;  4R4I A;  2MJ8 A;  3H0G G;  1CSP A;  4RFB A;  4TSS A;  1PMR A;  1GUO A;  1UE7 A;  2VNU D;  1T5E A;  3K5M A;  4JV5 L;  5E7N A;  3EFX D;  5M9O A;  2E2H H;  1D7Q A;  1HZ9 A;  3CPW A;  5D3I B;  1WVL A;  5EJW A;  4KY7 A;  4BXX H;  5I9P A;  4EQO A;  4UAI A;  2PZT A;  3H91 A;  4CKB A;  5I6W A;  2GA4 B;  1B9N A;  1VQI A;  5C4X H;  4IAL A;  1VF7 A;  2VUM B;  1N36 Q;  3GTG B;  4DR2 L;  2JA7 B;  2UUB L;  3GTM H;  3SHL A;  4DR1 L;  4DV3 L;  1R9T H;  2M2L A;  3KJP A;  1EY7 A;  3W5O A;  1STE A;  2Z6B A;  3WDN A;  2ICE C;  4A3L G;  4XXE A;  5BN5 A;  3HOX G;  5KYI A;  2B2Y A;  3J7A F;  3ERS X;  5C4Z A;  2C35 B;  3JC6 6;  4KD4 A;  4ZQ3 A;  1IL2 A;  1B53 A;  5FO7 B;  4A3K B;  2KHJ A;  2L15 A;  4I7A A;  2EXD A;  5E4W C;  3GP7 A;  3SK6 A;  4B9W A;  4BBS B;  2KEE A;  3R3O A;  4TVA B;  3A56 A;  1KLU D;  4YHH L;  2IY5 B;  1SBB B;  2MNA A;  1ROD A;  4IFD G;  1CQV A;  1TWC B;  1SEB D;  2F0P A;  1PV4 A;  4U67 3;  3S1N B;  5E3F A;  4BY1 B;  4FF3 A;  4XT1 B;  4OWW B;  4H13 C;  1PRT C;  3ER0 A;  3G6E A;  1C7Y A;  1JWM D;  1CK1 A;  1UE1 A;  2JA9 A;  5FLX L;  3TRE A;  4GN5 A;  2JYO A;  1HPC A;  4OWX B;  4A3I B;  3NE5 B;  3H0G H;  1GUW A;  5H1S E;  1KNE A;  2XRQ D;  3S17 H;  3MA2 B;  4DK3 C;  3S15 B;  4OEL B;  3HP3 A;  1FL0 A;  1XNR L;  2CHB D;  2JEB I;  1CHP D;  1A6X A;  4DV5 Q;  3CCU A;  1CI3 M;  4CKC A;  3M9B A;  2E2J B;  5IYC G;  2NZH A;  1T9H A;  2IX3 A;  2B2W A;  1Q81 C;  2K05 A;  5J22 A;  1W6K A;  1PH5 A;  1Y1W B;  3GTK H;  1SND A;  1EIG A;  5CYU A;  5IGG A;  1GKH A;  4B3T Q;  5M3M G;  4JI6 Q;  2HQE A;  2OEO A;  1E22 A;  3G6J B;  4DNR B;  3D3R A;  2DGY A;  3GDE A;  1PYW D;  1U4R A;  3RD4 A;  1UEB A;  4ZUJ A;  2PZW A;  4K2L A;  5EAY A;  2N78 A;  2OXP A;  3F2B A;  1PH6 A;  2F3V A;  2FIN B;  2I07 B;  2NVY H;  1QJO A;  1V1P B;  1XPO A;  1K8M A;  1TWF H;  1LT6 D;  2VXW A;  3PO2 G;  1TY2 A;  4OO1 I;  5FLX c;  1EQT A;  4LJZ C;  4K5V A;  3SXH A;  3C46 A;  2ASB A;  3PIP A;  3HOY G;  5JVG 3;  4JOI A;  2IL8 A;  1PH8 A;  2WV6 D;  4UPA A;  2B63 B;  5A35 A;  4LFB Q;  3I72 A;  3FRP B;  1PH3 A;  5COR A;  2EYH A;  4C3J G;  4M8A A;  5EPJ A;  2RSO A;  4LF6 L;  1GM5 A;  4IFD H;  2EJG C;  3TQY A;  2KJX A;  1ICW A;  3I4N B;  3BVZ A;  4K0K Q;  4PV1 C;  2RHQ B;  4A93 G;  2Q8R E;  4EGV A;  3UDG A;  3FVQ A;  1HZC A;  1OXU A;  2XVS A;  5HY6 A;  2D9U A;  1BBX C;  4A3B H;  2N8N A;  3NBH B;  4IZ8 A;  1HZB A;  2JE6 I;  2BE5 D;  4R9W A;  4ZKB B;  1X3G A;  3CME A;  3VR2 A;  3QG1 A;  4A3M B;  2JA8 G;  4BA1 I;  2LXK A;  1KDA A;  1JB7 A;  4LF7 L;  4HED A;  1YNJ C;  2VS1 A;  1S5B D;  3E9I A;  4RKL A;  4ZAI A;  2AHO B;  1VDZ A;  4UY8 C;  2O4X A;  5CBE E;  3CXC A;  2EYF A;  1AN8 A;  1JC7 A;  3M85 A;  3I55 A;  4LWC A;  1CKN A;  1RJT A;  1WYD A;  1NJI C;  3LX0 A;  4MHE A;  1EFI D;  3DLL A;  4X65 L;  3CQZ H;  1L1O A;  2Z1C A;  3A0J A;  5M3M H;  2Z9H A;  4HSP A;  4DK6 C;  4JBM A;  1NY4 A;  3KF8 B;  4IPD A;  3N6R A;  2FJ2 A;  1PH4 A;  4OEM B;  1N32 L;  2UXB L;  1ENC A;  3TZU A;  3KJO A;  2IPK D;  3PO2 H;  2E5L Q;  3SE0 A;  3BYY B;  1UE5 A;  3PSI A;  2E2H B;  3HOY H;  1CKM A;  2RVL A;  1IYV A;  1DCZ A;  4HID A;  5IGC A;  1HCZ A;  2LMC B;  2O5I C;  2EYL A;  4QMG A;  1G8Z D;  1FNU A;  1HH2 P;  2MPM A;  1SFO H;  1EYD A;  2GN5 A;  2K01 A;  1ZKO A;  5C4X B;  4DNI A;  4HJA A;  2PQA A;  4RCN A;  1JIC A;  3PO3 G;  3GTM B;  1MIU A;  1MGS A;  2E75 C;  1F9Q A;  1N9W A;  4IJH A;  1AFP A;  1Y8N B;  1R9T B;  5AJ3 L;  5LMU Q;  3DM3 A;  3R2T A;  5GAG C;  3J7A 5;  4DV2 Q;  4DAV A;  1NMG A;  4P2C B;  4QIW B;  3E0E A;  1XTD A;  3J80 E;  1C0A A;  1D1I A;  2JA8 H;  1A63 A;  3AB9 A;  1RHP A;  2NWG A;  2VW9 A;  2K5D A;  2OQ0 A;  3OTO Q;  3K5N A;  1CZG A;  3TP5 A;  3AFP A;  5K36 G;  5IP9 G;  1MKH A;  5JJL A;  3ITP A;  1Z47 A;  3KLW A;  4HN7 A;  3E9H A;  3OSO A;  4L6T B;  1P8L A;  1CA5 A;  3GTQ H;  3TP6 A;  2AQ2 B;  3L7Z C;  2AQ1 B;  2EVB A;  1PTO F;  4QIW E;  3IAY A;  1JT8 A;  3ONA B;  1AH9 A;  5G3L D;  1H9M A;  3DEO A;  2IX0 A;  2XWB B;  3OMC A;  4OL7 A;  3H0G B;  1EEF D;  1E3P A;  3S17 B;  5T1I A;  4LF8 Q;  3PGZ A;  4XIG S;  4Q0F A;  4DR3 Q;  5EKL A;  4RG1 A;  2K1B A;  2PQE A;  4NKL A;  4J1M A;  2CWP A;  3H94 A;  3TBI B;  1V1O A;  4GOP C;  3BJU A;  4HCS A;  2R7F A;  4F8M A;  3VDY A;  1UWV A;  2FMM A;  3OPO A;  2ZXO A;  5GAD C;  4BBR H;  3GTK B;  4JI0 L;  2OWO A;  1F2Z A;  1FGB D;  5CMD A;  2NVX H;  1D2B A;  3PO3 H;  1VQF A;  3Q24 A;  4DR6 Q;  2X69 A;  2R3Z A;  1E2V A;  1PDQ A;  4X64 Q;  5C4J H;  1CT1 D;  3EN2 A;  1KD1 C;  5IT9 L;  1O7Y A;  1AE3 A;  3FHW A;  2E8G A;  5KIX A;  2G9D A;  5LMU L;  1UUP A;  4CKE A;  1H9J A;  2NVY B;  3JAM i;  1SMY C;  4DV2 L;  4L5S A;  1TWF B;  1WTR A;  2XTI A;  4N9T A;  3SK4 A;  1Q90 A;  1E24 A;  1CFM A;  4GNX A;  3PUZ A;  1X55 A;  5J39 A;  3TN2 A;  3UE1 A;  1K9M C;  5K36 H;  5IP9 H;  4DR4 Q;  3BZC A;  3K5O A;  3HOU H;  1WTW A;  1H9S B;  3G7L A;  2FMC A;  1SE4 A;  2R6G A;  3K5L A;  1ZYR C;  4HIM A;  1GJX A;  1B7Y B;  2NZ1 D;  1HNX L;  3M7G A;  4Y52 H;  1QCB D;  1WOC A;  1PFB A;  1VMP A;  2Q2T A;  3T1Y L;  1CA6 A;  1BOS A;  1MBY A;  1I6H H;  4NXM L;  4A3B B;  1CKO A;  3U9O A;  2EY5 A;  1K83 H;  3RLF A;  2QKI C;  1L0Y B;  3J7Z C;  1X3Q A;  1EY5 A;  1XJV A;  1GUN A;  3J7Y W;  2QEX A;  3W1G A;  4DUZ Q;  2MUY A;  4AQY L;  4KJN A;  4DR3 L;  3KDF B;  2Q2I A;  3AQQ A;  3D6W A;  4QUF A;  3GTG H;  5HGQ A;  1YJN A;  2JA6 H;  1DGS A;  1L0X B;  3MFY A;  4LFA L;  4DR7 L;  4HR7 B;  4C3I H;  1HTL D;  3J81 i;  1RDP D;  1RCV D;  2KEC A;  1D5Z C;  4JG2 A;  4RHR A;  1K8O A;  5J3B A;  1STY A;  1I4R A;  3CQZ B;  1DYQ A;  4JBW A;  5M3M B;  1AZP A;  3CRK C;  4DR6 L;  1UNS A;  4XYQ A;  3FEW X;  1LT4 D;  1SYC A;  3CCM A;  4XQQ A;  4OXP A;  3MC0 B;  4JVZ A;  1O7Z A;  3GTP H;  1CZW A;  1GUG A;  4JI1 Q;  4C2M H;  1LLR D;  3PO2 B;  1S5F D;  5IGE A;  5DM6 3;  1DD2 A;  1ASZ A;  3HOZ H;  3HOY B;  1VQE A;  2DNC A;  4IUV A;  5JPM C;  1A3T A;  3K57 A;  1STA A;  1WFQ A;  3OW7 A;  1L0W A;  1SFO B;  1V8Q A;  4NDX A;  4DR4 L;  3RLN A;  2IWH A;  2NN6 G;  1BKB A;  1VQ6 A;  3TRZ A;  2B3G A;  1SYD A;  3WOE A;  5FOB B;  4IPG A;  2R61 A;  4GLX A;  4IOA A;  4DV4 Q;  1HR0 L;  1CUK A;  1KIX A;  2D0O A;  3RMH A;  4LFC Q;  3FPP A;  4H0L C;  4H7B A;  2HIX A;  4V19 0;  3OYY A;  2Q8I B;  4A3D G;  1FNW A;  4K6D A;  3MVV A;  4BWG B;  5DM7 3;  1PTO C;  3IKJ A;  1IKM A;  5IE8 A;  2L0C A;  2X6L A;  2JA8 B;  3IFD A;  2F0O A;  1MSG A;  4HCE A;  2NVT H;  1TS2 A;  4JI8 Q;  3L9A X;  3CCQ A;  3HEJ A;  1E0B A;  1LAB A;  4DUZ L;  4FF1 A;  1WCM G;  4AH6 A;  1X56 A;  1M90 C;  2B29 A;  5M3F G;  5M5Y H;  4DV6 Q;  2WKD A;  1SLJ A;  5I2X A;  2NYZ D;  3A5Z B;  2CKZ B;  4EVO A;  1ZXT A;  2F0U A;  1MJE A;  1EYC A;  2EQS A;  1IBL Q;  2H1E A;  1RTN A;  3GTQ B;  2ZTE A;  3G71 A;  1VQG A;  2EY2 A;  2K04 A;  1JMC A;  1J5E Q;  1CTM A;  1WD1 A;  2K5Q A;  3ICE A;  4XDX A;  3EVQ A;  1U0L A;  2KCC A;  5FJ8 H;  1EIF A;  2LFN A;  1K73 C;  4A76 A;  1PFM A;  4O1N A;  1YJW A;  2RKS A;  4DK1 A;  2AQ3 B;  3DWQ A;  4CDC C;  2NUC A;  1I4X A;  2A6E C;  1OXT A;  1VMC A;  2Z6K C;  3EBE A;  4JW0 A;  1QUQ A;  1WTH A;  5CV5 A;  3AEV A;  1VQ8 A;  2UUB Q;  1A0I A;  2ICI A;  1IXR A;  5IWA L;  3BZK A;  4A75 A;  5AFW A;  1SNM A;  1BCP D;  4DV3 Q;  2B2T A;  4PG3 A;  5JEA J;  2Q2H A;  1X32 A;  3KBG A;  3MEH A;  4GZY C;  4K2K A;  3PIO A;  1AEX A;  1WJJ A;  2SDF A;  5I6Y A;  1X3P A;  3L2P A;  1E2W A;  4BBR B;  1YHQ A;  4RA8 A;  1OO9 B;  2NN6 H;  2NVX B;  3PO3 B;  4UP8 A;  5HUR A;  4HIO A;  3SVM A;  4XT3 B;  3SK5 A;  2D62 A;  4HTH A;  4V0B A;  2K5H A;  4X3S A;  2L12 A;  3K8A A;  5C4J B;  1BCP C;  3D31 A;  1OXV A;  4LFC L;  3T51 B;  1K3R A;  4AYB G;  2EYP A;  5BR8 L;  2F3I A;  3QOJ A;  3K7U C;  1EQV A;  2SNM A;  2E2I H;  4IPC A;  3H6M A;  4ME5 A;  1HUM A;  3HS0 C;  4DPG A;  2QDL A;  1Z7T A;  5M3F H;  1VQ9 A;  4GKK L;  3J80 L;  3CCV A;  3CP0 A;  4DV6 L;  5JEA G;  1VQK A;  2QCP X;  4YY3 Q;  4DGZ A;  1L1O B;  3UDI A;  3HOW G;  3CKI B;  4IUR A;  2I46 A;  1IBL L;  4QQB X;  1BVS A;  1XNR Q;  3HKZ E;  1SDF A;  2V1C C;  1LT5 D;  4ME3 A;  4OIK A;  5IGD A;  1J5E L;  1I6H B;  4UHV A;  2I5M X;  4GKJ Q;  2Z0S A;  4LNQ A;  3PUY A;  1K83 B;  4L63 B;  3STB D;  4DV7 Q;  3H3V C;  1YVC A;  1S5C D;  1Q3L A;  1B2T A;  2DJF C;  2FXQ A;  4KTA A;  3FP9 A;  2C5C A;  1QWY A;  5IT9 E;  2G5D A;  1U9R A;  4FVM A;  2JA6 B;  3OWE B;  1WTO A;  1EWI A;  4BS9 A;  2BDO A;  3KK7 A;  2PQA B;  4C3I B;  1NR4 A;  2AWN A;  4PMC A;  2XWJ B;  2C9O A;  3STB C;  3ND8 A;  1IBM L;  4JYA L;  3R93 A;  1MSH A;  4IFD I;  3OOC A;  1PYS B;  3M4Y A;  3VYT A;  3EIV A;  1ILP A;  2A8V A;  1SAP A;  3MHB A;  5EKI A;  1SYF A;  1PRT D;  4S3S A;  2CCZ A;  1MD2 D;  3E6Z X;  3NBI A;  1NMF A;  1UAP A;  1S72 A;  3N52 A;  1Y69 U;  1HZA A;  4LF6 Q;  5CV7 A;  3GTP B;  3KLS X;  4GLV B;  4C2M B;  2A1A A;  3NQI A;  4QF4 A;  1PHJ A;  3HOZ B;  1EEI D;  3K58 A;  1QVF A;  1DJR D;  1NUC A;  1NTG A;  2PMZ B;  5JVH 3;  2PCF B;  4IOC A;  1G91 A;  1E7Z A;  3A7A B;  4DF7 A;  1SRO A;  4X66 L;  2BA0 A;  4ZRZ A;  4YY3 L;  3M4O B;  4R4Q A;  1D5M C;  2JXM B;  3W2D A;  5KNC A;  3HOW H;  4YWM A;  4LF7 Q;  1EIY B;  1TU2 B;  5GAH C;  1PZJ D;  1QG7 A;  3P20 A;  3S24 A;  4XQN A;  2JQO A;  2B39 A;  4FXK C;  2LSS A;  5EBD A;  5EPK A;  2WAQ B;  2HQL A;  1B3Q A;  5C5M A;  5C3E G;  3FKI G;  4GKJ L;  4K5W A;  1LTL A;  5EGT A;  1Y8O B;  4DV7 L;  2PMZ E;  1VQJ A;  1R4Q B;  1RKN A;  2E74 C;  4WJ4 A;  1JJ2 A;  2NVT B;  3H15 A;  2N49 A;  1Y14 B;  3PCO B;  4QGU A;  4X65 Q;  5M5Y B;  4P72 A;  3NSW A;  2AKW B;  1AZQ A;  4ALP A;  1LO5 D;  4X3K A;  4QL5 A;  2Z8L A;  2CQO A;  1I94 Q;  1N32 Q;  2L5T A;  1AE2 A;  3S16 H;  4A3L H;  2UXB Q;  4LUO A;  3HOX H;  2WAQ E;  1SNP A;  3Q8D A; 
#chains in the Genus database with same CATH homology
 1ET9 A;  1XWE A;  3I91 A;  2PPB C;  1I4P A;  4KN4 C;  3KLR A;  3A8J E;  2KED A;  3GV3 A;  3A8K E;  4ODG A;  4J8Q A;  2DNE A;  5E4X A;  1YNJ D;  1Q1B A;  3X3N A;  5LL6 X;  2M9V A;  4K8I A;  1I6V C;  2Y0S B;  3MXU A;  1A2U A;  4MN3 A;  4DK0 A;  2L9H A;  2K33 A;  3TP8 A;  2SOB A;  4ID6 A;  4XTC S;  4J6H A;  4PMB A;  2J4X A;  3I3C A;  3PUW A;  2XN9 C;  2MGS A;  1SYB A;  2ID0 A;  3DWA A;  4DU9 A;  5JJZ A;  5CV8 A;  1JOQ A;  1CM9 A;  1A3U A;  3VR3 A;  2E2I B;  5KEE A;  3MFG A;  4ZYS A;  1EY4 A;  1BUV T;  5M3F B;  4HMJ A;  2ENB A;  3CRL C;  2A69 D;  5EQ0 A;  4FXG C;  3C1F A;  5ELD A;  1JCK B;  2A6H C;  4WOR A;  1WTQ A;  3QO2 A;  2D2C C;  1XTC D;  1SNO A;  4KHZ A;  1TS4 A;  5ISR A;  4CGY B;  5JPN C;  2WP8 J;  3V05 A;  4DN4 M;  3DXJ C;  2A69 C;  2B2W C;  1HHV A;  3NWS A;  4E6I A;  2TMP A;  2RA4 A;  2RQX A;  1PFN A;  2LKV A;  4R8N A;  2NTT A;  4JK1 C;  2F3W A;  3FMC A;  4F7X A;  2DN8 A;  4LK1 C;  2N55 A;  1LTI D;  4HAE A;  2IJ0 A;  3E5S A;  2EJM A;  4DFA A;  3DWP A;  3A8I E;  4WRD A;  2M00 A;  4FP5 D;  3GD7 A;  2NBF A;  2WAC A;  3RUZ A;  1OXS C;  4QUC A;  4ZLT F;  2TSS A;  1TY0 A;  1B3A A;  1LV9 A;  1Y8P B;  3HOW B;  1EY8 A;  4FYD A;  5J1Z A;  3TSS A;  3VR6 A;  2KA7 A;  5HGT A;  5C5L A;  4U68 A;  2O5J C;  2EYJ A;  1QIL A;  4OHJ A;  3VA7 A;  5C3W A;  1SMY D;  1KTK A;  2KQ3 A;  1WTV A;  3SR1 A;  1IL8 A;  1VCI A;  1B44 D;  3V96 A;  3S16 B;  4XYO A;  3HOX B;  2QDB A;  1ZYR D;  2L55 A;  5BN4 A;  2DY7 A;  2PW7 A;  3URY A;  2PNR C;  2F0G A;  4DAP A;  3I70 A;  4NP5 A;  2F0D A;  3I8Z A;  3HRZ C;  3AU7 A;  4RHS A;  1F77 A;  4KI0 A;  3VR4 A;  3MAQ A;  3JAM L;  1YNN C;  1FYC A;  3FPU B;  2XIW A;  3K59 A;  2EY6 A;  1ENA A;  3W3A A;  1A15 A;  4KV6 A;  1BDO A;  1F2L A;  3U9S A;  1HRJ A;  4RGM A;  5I2Y A;  2QEJ C;  4NMZ A;  2XRS D;  2B2V C;  1O7L A;  1BR9 A;  4BA2 I;  4DAY A;  5C0X J;  5C3E B;  1DOK A;  3FKI B;  3C2P A;  3VYS A;  3BS1 A;  3QJY A;  1EY6 A;  3PUX A;  3MXN A;  3LWE A;  5FKA C;  3RZD B;  4R8I A;  2G9H D;  2F0M A;  2F0F A;  2F0H A;  4G57 A;  1XX8 A;  2K6A A;  3MWY W;  2NN6 I;  1NAP A;  3MXG A;  2LY7 A;  5C0X G;  2HUG A;  4TRD A;  3K7A B;  3PMF A;  2YU9 B;  1A3V A;  4H44 C;  1TVX A;  4G7H C;  3FDT A;  4C3J B;  3DHQ A;  1BNZ A;  1PTO D;  3TZD A;  2JEA I;  1A2T A;  2HCI A;  4A93 B;  4G7O C;  4A3E B;  2HDL A;  3A7L A;  5FO8 B;  2NB0 A;  3O13 A;  4IQZ A;  1ILQ A;  4KJO A;  2ZXR A;  4KKS A;  5CBA E;  4A3G B;  3HZX A;  4KY6 A;  4KY5 A;  1JOO A;  2A5H A;  3NK9 A;  4IUT A;  3QIA A;  3BDO A;  1II3 A;  4BY7 B;  4RWS C;  5E1F A;  4M1U B;  2F0S A;  1PZI D;  5ELB A;  1PZK D;  1F2Y A;  2A6E D;  3M3Y B;  1IW7 C;  4X3T A;  2MHV A;  1ML0 D;  1QNU A;  1B1Z A;  4QCL A;  1G2T A;  4CHT B;  1SNQ A;  1T5X D;  2L11 A;  2EE1 A;  4PNY A;  2F0W A;  4KHV A;  2EXZ A;  4ILW A;  4K5X A;  2WKC A;  2KCN A;  1F9R A;  5C4H A;  2OF1 A;  2AUJ D;  2KOL A;  1SSO A;  1G6Z A;  2HCC A;  3BZD B;  1EU3 A;  1GHJ A;  3K0Y A;  3NWT A;  1SE2 A;  1F2M A;  5JAV A;  1EZ6 A;  5LL6 S;  5KGU A;  3GTL B;  4O42 A;  3D4R A;  3ZYY X;  3NUC A;  1E2Z A;  3C1E A;  5KYL A;  2F1M A;  3GTO B;  5CV6 A;  5DNF A;  1XXG A;  1I4G A;  1ESR A;  5CR3 A;  3MZ5 A;  3S1R B;  2EDG A;  4B08 A;  5IOD A;  1S5E D;  4XQJ A;  4QB4 A;  3BG3 A;  2E76 C;  1EWC A;  3T13 A;  3T4A C;  2JSO A;  4NW2 A;  1EZ8 A;  2YYZ A;  4IUN A;  4FXD A;  2K28 A;  2X6G A;  1G29 1;  3E0J A;  3GTJ B;  4RAU C;  2F0V A;  3D6C A;  2XNA C;  1SNP A;  4IFD J;  1RF2 D;  2HDM A;  1JQY D;  5TSS A;  1F9P A;  1HQM C;  4KD3 A;  3JAM E;  4IUU A;  1LT3 D;  1QOH A;  1JOK A;  1BXT A;  1EYA A;  2ZXP A;  2B2T C;  1STG A;  4DA2 A;  1B4O A;  2BCO A;  3BVG A;  2IW3 A;  3BVM A;  5IIF A;  3KUP A;  5JEA H;  5CV4 A;  1GUS A;  1KAA A;  3M7N A;  5T1G A;  3NTH A;  1W6J A;  3F2U A;  1CHQ D;  2B2U C;  5F2D A;  4EQN A;  4C3H G;  1SNC A;  2V4D A;  1TKW B;  5IGF A;  2NVQ B;  5IOC A;  3RZO B;  3S2H B;  4OIJ A;  3OMG A;  1B50 A;  3S14 B;  5D14 A;  2R92 B;  3GO5 A;  3BYT B;  4KN7 C;  3MTS A;  1ENF A;  5C3X A;  3CHB D;  3NTK A;  1H9R A;  3IL8 A;  3J81 E;  4Y7N B;  1J8I A;  5C6A A;  1O78 A;  3NP8 A;  2PO4 A;  3OHX C;  1C8C A;  3Q22 A;  1NR2 A;  2VB3 X;  1TS5 A;  4N9P A;  1I50 B;  3K6O A;  3QB3 A;  3WOF A;  1HUN A;  1TT2 A;  3D4W A;  1NSN S;  4Q5V A;  3SDZ A;  1BF4 A;  5I9O A;  4F88 A;  3TME A;  1D5X C;  1DM0 B;  4HSV A;  2SNS A;  1JB3 A;  2EY1 A;  1WD0 A;  5C44 B;  4EQP A;  2NTS A;  4LAA A;  1LTG D;  2K32 A;  5G3L F;  4A3F B;  1GXD C;  1HXY D;  2RDH A;  1V43 A;  1KLG D;  3BDL A;  1TQO A;  1STH A;  1STB A;  1PTO B;  2B2Y C;  3HGB A;  1D1K A;  3PIP 3;  1SJE D;  3PV0 A;  4OO1 G;  3NXW A;  1LTS D;  5KNB A;  3ERO A;  1I4H A;  4UDU C;  4A3D B;  1TWH B;  3HOV B;  2A6H D;  2SEB D;  4RH6 A;  1EWH A;  2AUK A;  1ZEQ X;  3LWU A;  1WCM B;  3P1H A;  4G4K A;  4PMW A;  3A54 A;  1B9M A;  2K03 A;  1DON A;  2F0Q A;  5BN3 A;  1LTR D;  1C4Q A;  1EY0 A;  1G2S A;  2BE5 C;  2L1B A;  3AMU A;  3L3O C;  2F0N A;  2A74 C;  1IKL A;  1XYI A;  3SK8 A;  3S1Q B;  5D65 A;  1JWS D;  5A2Q E;  1FR3 A;  2XSC A;  2CW0 D;  4FO2 A;  3IFT A;  1U4P A;  1Z6H A;  2A68 D;  4C56 C;  2WB1 B;  1BCP B;  1KDB A;  3TDQ A;  1STN A;  1D6E C;  1I4Q A;  5LHY 1;  3PUV A;  2EPB A;  2KUM A;  4L8J A;  2CW0 C;  1KAB A;  3OIP A;  1U4L A;  3VYR A;  1ONL A;  2F0I A;  2RSN A;  2A68 C;  1SE3 A;  1HA5 A;  2VB2 X;  4I65 A;  1GHK A;  3D4D A;  4K14 A;  4TQU S;  4OO1 H;  1TWA B;  1CQF A;  2QIL A;  3J7A V;  2CQA A;  1M4V A;  1C48 A;  4AYB B;  3EJI A;  3P7J A;  2RBM A;  3GV6 A;  1SYG A;  2B2V A;  1LTT D;  3V2T A;  4RCO A;  1Y1V B;  3P75 A;  2A73 B;  2J0T D;  2EOT A;  5CV9 A;  1FNV A;  4HMI A;  1QNK A;  3EA6 A;  2B8F A;  2Z4I A;  2E2D C;  5ELC A;  1S5D D;  3I90 A;  4IN3 A;  1UEA B;  4C1N I;  1LAC A;  3NPP A;  5COY A;  1J9O A;  1JE4 A;  1SYE A;  1SXT A;  3Q6S A;  3S1M B;  1I3Q B;  2R93 B;  4ZK9 B;  4C1N K;  2FFK B;  2PZU A;  1HFG A;  4WJW A;  4FNF A;  4KMU C;  3VA5 A;  1GUT A;  4ABN A;  1KNA A;  1U4M A;  3DMU A;  5EPL A;  2J7Z A;  1FD7 D;  2PW5 A;  1EL0 A;  4C3I G;  2KVM A;  5EBC A;  1BQQ T;  1DOM A;  1PRT B;  1YNN D;  3T56 B;  4IUQ A;  5KND A;  1LTB D;  1Q8I A;  2F0J A;  2F0L A;  3NHH A;  2KHS A;  3OIQ A;  2AWO A;  3ERQ A;  4FF2 A;  1V1P A;  3A55 A;  3S2D B;  1LTA D;  2F0K A;  4F87 A;  5FLX E;  3I4L A;  4KK7 A;  3BDC A;  3EQL C;  2RDF A;  4KKU A;  2H4O A;  1OXX K;  4X3U A;  2CVR A;  3I4M B;  1Q1E A;  3OWF A;  2MP1 A;  4TKO B;  1DXM A;  1JOR A;  5DAU A;  3T53 B;  1BCP F;  4C3H B;  3QWN A;  3C3L A;  1PXU A;  1DZ1 A;  3NBH A;  1VF5 C;  3LNN A;  3DUZ A;  1M8A A;  1EOT A;  4FF4 A;  2F03 A;  3VYU A;  1GOZ A;  2WII B;  1Q12 A;  5D3D A;  3X3M A;  1RD9 D;  2BDN A;  3MXP A;  3NTI A;  1EIH A;  1RTO A;  1MI2 A;  2WIN B;  3KLS A;  2ZT9 C;  5C0X I;  3UI2 A;  2IT1 A;  1WTX A;  1O80 A;  3R8B A;  2RDG A;  3HG9 A;  2Q8T A;  2OT2 A;  3S9W A;  4RKB A;  1ET6 A;  1ESF A;  1KDC A;  3J81 L;  2EYM A;  4DNT B;  4RGO S;  3KF8 A;  4IUP A;  2IX1 A;  1HTP A;  1HA6 A;  1NCV A;  1HQR D;  1AP0 A;  1BO0 A;  5EKK A;  4CJ1 B;  4Z9C B;  3I73 A;  3NQT A;  1TII D;  1WTP A;  1S4Z A;  2EJF C;  2EZV A;  4RGN A;  3Q23 A;  1TR5 A;  2DY8 A;  5ELF A;  2B8G A;  2L4N A;  5CC4 A;  1IW7 D;  2PYK A;  1AW7 A;  1HFN A;  5KRU A;  2F0E A;  4DXG A;  2BA1 A;  4CJ0 B;  1PRT F;  4LMQ D;  4DXF A;  4ZKC B;  5M5W B;  2O2L D;  4ZUI A;  2F0T A;  1EU4 A;  5NUC A;  1IYU A;  2LS0 1;  2JP1 A;  4PQX A;  5CGK A;  1QB5 D;  3ND9 A;  3QOL A;  3TP7 A;  2FHT A;  1TS3 A;  5FK9 C;  1TWG B;  1QE6 A;  5C0X H;  4CJ2 C;  4K6L A;  5I4D A;  2K7V A;  4K8J A;  5K5P A;  1PTO H;  1IHZ A;  4A3J B;  4G7Z C;  2EYO A;  4ULL A;  5A2Q L;  3T16 A;  3Q0A A;  4KKT A;  2F4I A;  3H09 A;  2JA5 B;  2Z4H A;  3GQB A;  5JOB A;  5IGB A;  3DEP A;  2D5D A;  2R7Z B;  3SEB A;  3KBX A;  3VR5 A;  1JR0 D;  2B2U A;  3CU7 A;  1H9K A;  5DEH A;  3PIO 3;  4B9X A;  1DOL A;  4RGT A;  2K5W A;  2N88 A;  4YIJ A;  5ELE A;  3D8G A;  3HKZ B;  3R2I A;  1R4P B;  5M5X B;  4WFN 3;  2BOS A;  1SJH D;  4MIU A;  1H9S A;  2QF7 A;  5FO9 B;  4OGQ C;  1PLF A;  1EY9 A;  3HOU B;  3DM1 A;  1F9S A;  4CBV A;  4I7Z C;  2MJ8 A;  4RFB A;  4TSS A;  1PMR A;  1GUO A;  2VNU D;  1T5E A;  3K5M A;  3EFX D;  5M9O A;  5D3I B;  1WVL A;  5EJW A;  4KY7 A;  5I9P A;  4EQO A;  4UAI A;  5I6W A;  2PZT A;  3H91 A;  4CKB A;  2GA4 B;  1B9N A;  4IAL A;  1VF7 A;  2VUM B;  3GTG B;  2JA7 B;  3SHL A;  2M2L A;  1EY7 A;  1STE A;  3WDN A;  2ICE C;  4XXE A;  5BN5 A;  5KYI A;  2B2Y A;  3J7A F;  5C4Z A;  4KD4 A;  4ZQ3 A;  1B53 A;  5FO7 B;  4A3K B;  5E4W C;  3GP7 A;  3SK6 A;  4B9W A;  4BBS B;  2KEE A;  3R3O A;  3A56 A;  1KLU D;  1SBB B;  1ROD A;  4IFD G;  1CQV A;  1TWC B;  1SEB D;  2F0P A;  4U67 3;  3S1N B;  5E3F A;  4BY1 B;  4FF3 A;  4XT1 B;  4H13 C;  1PRT C;  1JWM D;  1CK1 A;  5FLX L;  2JYO A;  1HPC A;  4A3I B;  3NE5 B;  1GUW A;  1KNE A;  2XRQ D;  3MA2 B;  3S15 B;  3HP3 A;  2CHB D;  2JEB I;  1CHP D;  1A6X A;  1CI3 M;  4CKC A;  2E2J B;  2IX3 A;  2B2W A;  2K05 A;  5J22 A;  1W6K A;  1Y1W B;  1SND A;  1EIG A;  5CYU A;  5IGG A;  2HQE A;  2OEO A;  3G6J B;  4DNR B;  3D3R A;  1PYW D;  1U4R A;  3RD4 A;  4ZUJ A;  2PZW A;  4K2L A;  2OXP A;  2F3V A;  2FIN B;  2I07 B;  1QJO A;  1V1P B;  1K8M A;  1LT6 D;  2VXW A;  4OO1 I;  1TY2 A;  1EQT A;  4LJZ C;  4K5V A;  3SXH A;  3C46 A;  5JVG 3;  2IL8 A;  2WV6 D;  2B63 B;  5A35 A;  3I72 A;  3FRP B;  5COR A;  2EYH A;  4C3J G;  4M8A A;  5EPJ A;  2RSO A;  4IFD H;  2EJG C;  2KJX A;  1ICW A;  3I4N B;  3BVZ A;  4PV1 C;  2Q8R E;  4EGV A;  3FVQ A;  1OXU A;  2XVS A;  2D9U A;  1BBX C;  4IZ8 A;  2JE6 I;  2BE5 D;  4R9W A;  4ZKB B;  3VR2 A;  3QG1 A;  4A3M B;  4BA1 I;  1KDA A;  4HED A;  1YNJ C;  1S5B D;  4RKL A;  4ZAI A;  1VDZ A;  2O4X A;  5CBE E;  2EYF A;  1AN8 A;  1JC7 A;  3M85 A;  1RJT A;  3LX0 A;  4MHE A;  1EFI D;  2Z1C A;  4HSP A;  3N6R A;  2FJ2 A;  1ENC A;  3TZU A;  2IPK D;  3SE0 A;  3BYY B;  2E2H B;  2RVL A;  1IYV A;  1DCZ A;  5IGC A;  1HCZ A;  2LMC B;  2O5I C;  2EYL A;  4QMG A;  1G8Z D;  1FNU A;  2MPM A;  1EYD A;  2K01 A;  1ZKO A;  5C4X B;  4RCN A;  1JIC A;  3GTM B;  1MGS A;  2E75 C;  1F9Q A;  1AFP A;  1Y8N B;  1R9T B;  3R2T A;  4DAV A;  4P2C B;  4QIW B;  3J80 E;  1D1I A;  3AB9 A;  1RHP A;  2NWG A;  2K5D A;  3K5N A;  1CZG A;  3TP5 A;  5K36 G;  3ITP A;  1Z47 A;  4HN7 A;  4L6T B;  3OSO A;  1CA5 A;  3TP6 A;  2AQ2 B;  3L7Z C;  2AQ1 B;  2EVB A;  1PTO F;  3IAY A;  3ONA B;  5G3L D;  1H9M A;  3DEO A;  2IX0 A;  2XWB B;  3OMC A;  4OL7 A;  3H0G B;  1EEF D;  3S17 B;  5T1I A;  4XIG S;  4Q0F A;  5EKL A;  2K1B A;  2PQE A;  4NKL A;  4J1M A;  3H94 A;  3TBI B;  1V1O A;  4HCS A;  4F8M A;  2FMM A;  3OPO A;  2ZXO A;  3GTK B;  1F2Z A;  1FGB D;  5CMD A;  1D2B A;  3Q24 A;  2X69 A;  2R3Z A;  1E2V A;  1PDQ A;  1CT1 D;  5IT9 L;  1O7Y A;  5KIX A;  2G9D A;  1UUP A;  4CKE A;  1H9J A;  2NVY B;  1SMY C;  1TWF B;  1WTR A;  4N9T A;  3SK4 A;  1Q90 A;  1CFM A;  3PUZ A;  5J39 A;  3TN2 A;  5K36 H;  3K5O A;  1WTW A;  1H9S B;  3G7L A;  2FMC A;  1SE4 A;  2R6G A;  3K5L A;  1ZYR C;  1GJX A;  2NZ1 D;  3M7G A;  1QCB D;  1PFB A;  1VMP A;  1CA6 A;  1BOS A;  1MBY A;  4A3B B;  3U9O A;  2EY5 A;  3RLF A;  2QKI C;  1L0Y B;  1X3Q A;  1EY5 A;  1GUN A;  3J7Y W;  2MUY A;  4KJN A;  3D6W A;  4QUF A;  3MFY A;  1L0X B;  4HR7 B;  1HTL D;  1RDP D;  1RCV D;  2KEC A;  1D5Z C;  4RHR A;  1K8O A;  1STY A;  1I4R A;  3CQZ B;  1DYQ A;  4JBW A;  5M3M B;  1AZP A;  3CRK C;  1UNS A;  4XYQ A;  3FEW X;  1LT4 D;  1SYC A;  4XQQ A;  3MC0 B;  1O7Z A;  1CZW A;  1GUG A;  1LLR D;  3PO2 B;  1S5F D;  5IGE A;  5DM6 3;  1DD2 A;  3HOY B;  2DNC A;  4IUV A;  5JPM C;  1A3T A;  3K57 A;  1STA A;  3OW7 A;  1SFO B;  1V8Q A;  4NDX A;  2IWH A;  2NN6 G;  1SYD A;  3WOE A;  5FOB B;  2R61 A;  3RMH A;  3FPP A;  4H0L C;  4H7B A;  4V19 0;  2Q8I B;  1FNW A;  4K6D A;  3MVV A;  4BWG B;  5DM7 3;  1PTO C;  3IKJ A;  1IKM A;  2L0C A;  2X6L A;  2JA8 B;  3IFD A;  2F0O A;  1MSG A;  4HCE A;  1TS2 A;  3L9A X;  3HEJ A;  1E0B A;  1LAB A;  4FF1 A;  2WKD A;  5I2X A;  2NYZ D;  4EVO A;  1ZXT A;  2F0U A;  1EYC A;  2H1E A;  1RTN A;  3GTQ B;  2EY2 A;  2K04 A;  1CTM A;  1WD1 A;  2K5Q A;  4XDX A;  3EVQ A;  2KCC A;  2LFN A;  1PFM A;  4O1N A;  2RKS A;  4DK1 A;  2AQ3 B;  3DWQ A;  2NUC A;  1I4X A;  2A6E C;  1OXT A;  1VMC A;  5CV5 A;  2ICI A;  5AFW A;  1SNM A;  1BCP D;  2B2T A;  5JEA J;  1X32 A;  3KBG A;  3MEH A;  4GZY C;  4K2K A;  1AEX A;  2SDF A;  5I6Y A;  1X3P A;  1E2W A;  4BBR B;  4RA8 A;  1OO9 B;  2NN6 H;  2NVX B;  3PO3 B;  5HUR A;  3SVM A;  4XT3 B;  3SK5 A;  4X3S A;  2D62 A;  4HTH A;  4V0B A;  2L12 A;  5C4J B;  1BCP C;  3D31 A;  1OXV A;  3T51 B;  2EYP A;  3QOJ A;  1EQV A;  2SNM A;  3H6M A;  4ME5 A;  1HUM A;  3HS0 C;  1Z7T A;  3J80 L;  5JEA G;  2QCP X;  4DGZ A;  3CKI B;  4IUR A;  2I46 A;  1SDF A;  1LT5 D;  4OIK A;  5IGD A;  1I6H B;  3PUY A;  1K83 B;  4L63 B;  3H3V C;  1S5C D;  1Q3L A;  1B2T A;  4KTA A;  2C5C A;  1QWY A;  5IT9 E;  1U9R A;  4FVM A;  2JA6 B;  3OWE B;  1WTO A;  4BS9 A;  2BDO A;  3KK7 A;  4C3I B;  1NR4 A;  2AWN A;  4PMC A;  2XWJ B;  2C9O A;  3ND8 A;  3R93 A;  1MSH A;  4IFD I;  3OOC A;  3M4Y A;  3VYT A;  1ILP A;  1SAP A;  3MHB A;  5EKI A;  1SYF A;  1PRT D;  4S3S A;  1MD2 D;  3E6Z X;  3NBI A;  1UAP A;  3N52 A;  1Y69 U;  5CV7 A;  3GTP B;  3KLS X;  4C2M B;  3NQI A;  4QF4 A;  3HOZ B;  1EEI D;  3K58 A;  1DJR D;  1NUC A;  2PMZ B;  5JVH 3;  2PCF B;  1G91 A;  3A7A B;  4DF7 A;  2BA0 A;  4ZRZ A;  3M4O B;  1D5M C;  2JXM B;  3W2D A;  5KNC A;  1TU2 B;  1PZJ D;  1QG7 A;  3P20 A;  4XQN A;  2B39 A;  4FXK C;  5EBD A;  5EPK A;  2WAQ B;  5C5M A;  4K5W A;  5EGT A;  1Y8O B;  1R4Q B;  1RKN A;  2E74 C;  2NVT B;  5M5Y B;  3NSW A;  1AZQ A;  1LO5 D;  4X3K A;  2Z8L A;  2L5T A;  1JWU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...