1EQTA

Met-rantes
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
GYSSDTTPCCFAYIARPMPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-CELL SPECIFIC RANTES PROTEIN
publication title The Crystal Structure of MET-RANTES: Comparison with Native RANTES and AOP-RANTES
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eqtA00
5JJZA 4R9WA 1DONA 2FFKB 4HAEA 1EIHA 2K01A 4NW2A 4O42A 2KUMA 1QNKA 5EPKA 1F9PA 2RVLA 1WTRA 1HUNA 2X6GA 1PDQA 1WD0A 4CJ0B 5T1IA 1ZXTA 1PFBA 3FDTA 1WD1A 1HA6A 1SAPA 4CJ2C 2L9HA 3F2UA 4QUCA 2B2WA 1DZ1A 3D6WA 2L11A 1PFNA 2IL8A 1S4ZA 1GUWA 2KVMA 4HEDA 2J7ZA 1CA5A 1F2LA 1IKMA 5CMDA 1SSOA 1G2SA 1MGSA 2RA4A 3UI2A 1AZQA 3GV6A 1B50A 4LMQD 1HRJA 4ZLTF 3QO2A 3KBXA 1VMPA 4XDXA 1J9OA 1VMCA 2NYZD 2KOLA 5T1GA 2N55A 1RODA 3FPUB 2M2LA 1NR2A 1TVXA 4OIKA 1HHVA 1RHPA 1B2TA 1HFGA 1WVLA 1ILQA 4RA8A 1J8IA 3P7JA 4R8IA 1M8AA 4DN4M 1NAPA 2EPBA 2RSOA 4X3TA 2CVRA 3TZDA 1CA6A 1MI2A 1X3QA 2B2TC 4IUQA 1HFNA 2FINB 1ICWA 2MPMA 4RWSC 3TN2A 4U68A 2L12A 1Q3LA 2B2UC 2EE1A 2HDLA 1QG7A 2JYOA 2Q8TA 4ZK9B 5CBAE 2X6LA 1IKLA 1X32A 2Q8RE 1F9RA 5COYA 2L4NA 4CJ1B 4HSVA 2MGSA 3I3CA 3SVMA 2B2VC 4HCSA 4IUUA 2DY8A 2EOTA 2SDFA 3R93A 5EPLA 2R3ZA 1ILPA 1CM9A 2K05A 1RTNA 3IL8A 3I8ZA 2XIWA 1U4PA 2FHTA 2N88A 2RSNA 1WTQA 1DOLA 1MSHA 4IUVA 1RTOA 2NWGA 1U4LA 3KUPA 1WTPA 2K1BA 3G7LA 3LWEA 1MSGA 2KEDA 1F9SA 1E0BA 1LV9A 4X3UA 4ZAIA 4QUFA 1PLFA 5EKIA 1DOMA 2BDNA 2K04A 1IL8A 2KECA 1NCVA 4IURA 1JE4A 1XX8A 4X3KA 5CBEE 3HP3A 2K03A 2B2WC 2L1BA 5EPJA 2HCCA 1WTWA 1X3PA 1KNAA 1EQTA 1NR4A 5E4XA 2VXWA 5D65A 4ZKBB 1AZPA 2NZ1D 2D9UA 1HUMA 2MJ8A 1PFMA 1B53A 1WTXA 1BNZA 3DEPA 1A15A 1ESRA 1B4OA 2B2TA 2K28A 4OIJA 5D14A 3MTSA 2KEEA 1B3AA 3MWYW 1U4RA 1WTOA 4UAIA 5E4WC 1EOTA 2B2UA 3ONAB 4IUTA 3DM1A 3I91A 2HUGA 1O7YA 2B2YC 4IUPA 4MHEA 4MN3A 1O7ZA 5EJWA 1EL0A 2FJ2A 2B2VA 5CORA 2DY7A 2MP1A 1DOKA 1BBXC 2H1EA 3N52A 1BF4A 3Q6SA 1KNEA 1RJTA 1G91A 3GV3A 3DEOA 3H91A 4X3SA 1QE6A 4XT1B 1G2TA 1SDFA 1XYIA 1U4MA 2X69A 2HDMA 1F9QA 3I90A 1O80A 1ML0D 4RAUC 5EQ0A 4ZKCB 1G6ZA 1C8CA 5DNFA 4XT3B 1EIGA 1JICA 3IFDA 1WTVA 2FMMA 2HCIA 1AP0A 2B2YA 1BO0A 2JP1A 5AFWA
chains in the Genus database with same CATH superfamily
1DONA 3HOVH 2OQKA 2LFNA 4K2KA 5HURA 1I4PA 4FXKC 2BOSA 4HIDA 2L11A 1X54A 2F0DA 2NZOA 2D0OA 2ZT9C 2UXBQ 1Y14B 2D62A 3UI2A 2IPKD 3K8AA 4DR7L 4YY3Q 5M5WB 3HOVG 3HKSA 4P75A 2VY3A 2F0UA 5BR8L 4GZYC 4K6DA 4KV6A 4DV2Q 3NBHA 1KIXA 3HOWB 4L5RC 4DNIA 4RH6A 2D5DA 1JWMD 2N8NA 4X6AH 4DKAC 2CVRA 3DUZA 2OT2A 3E9IA 3PUZA 2B2TC 3TP7A 2DJFC 5JJIA 2YU9B 1AE3A 1JCKB 1HZAA 5LMNL 1T5EA 1IKLA 3JAME 3KF8A 3SVMA 1IZ6A 3I3CA 4IPCA 4ABNA 1WJJA 1GUSA 2PO4A 1I4QA 5JJKA 5KNDA 1TR5A 4JI5L 3IL8A 4JI7L 3FMCA 2WB1B 1XNRL 2R6GA 5EKLA 1EWIA 1IBLQ 3KLSA 4A3IH 3D4RA 4I65A 1BQQT 4PMCA 4RKLA 1CKMA 4B3SQ 1CT1D 3FHWA 2K32A 3NENA 1KC8C 4B3MQ 4POGA 5M5XH 2Y0SB 3QR8A 2JSOA 1IL8A 1C7YA 4A76A 2KECA 2KCTA 4TKOB 1ZEQX 3NPPA 1BXTA 1LTGD 2B2WC 3D8GA 3V05A 1KXLA 3IRBA 2CH4A 1QUQB 3G71A 5I4DA 1PYSB 1VQMA 1JMCA 2ZTDA 3TREA 5D14A 5DLQE 4PV1C 1U4RA 4LUVA 3VDYA 2ICIA 1PH4A 1STGA 3CQZB 3U4ZA 3GTKB 3BVGA 3TEHB 1FNVA 1VQIA 4CGYB 5LMUL 1TU2B 4HJ8A 2H1EA 1SNMA 2PZWA 4C2MB 4LF5Q 3J7YW 2K50A 4AYBE 1Z6HA 2F0IA 1STYA 2JA5B 3QB3A 2DUDA 1I4HA 1IL2A 4ZKCB 3A5UA 3IFDA 4R8NA 1I50B 3S15B 3VYRA 2EYMA 4FF4A 2B29A 1F2ZA 4H13C 2JA7H 2ATWA 1B8AA 4O1NA 3G6EA 4MTNA 3EJIA 4KMUC 1Q12A 1SN8A 3VYUA 2L9HA 1HA6A 1VQKA 1EY7A 1FJGQ 3TQYA 2E2JB 3BYYB 4A3DH 4WFN3 3CD6A 1VQJA 1SMYC 1VQBA 5BN3A 3C46A 3NQTA 3BVMA 1TS2A 1VMCA 2KOLA 1CHPD 3CHBD 1SYBA 2UXCL 4A3FH 3GTMH 4R8IA 1M8AA 4ME3A 2EY2A 4H02A 2RSOA 4G57A 1VQ9A 2RDFA 1L1OB 2Z4IA 2EXZA 1RKNA 4HJ5A 4A3DG 3CMEA 2WKCA 4F87A 4JBWA 1YITA 3HG9A 1NJIC 2NN6G 2B8FA 4A3FG 4FF3A 3BDLA 1CM9A 1QJOA 1ZYRC 2K05A 2L5TA 2EJFC 2GN5A 3H0GB 2WP8J 1FVIA 1BKBA 1RTOA 4GLVB 4MNOA 3LGJA 4A3MG 4IALA 1LLRD 1OXXK 2GVAA 2K33A 2RDGA 1FGBD 1AE2A 5J1ZA 1PRTF 3SXHA 2JA6H 4P74A 1YNJD 4LFCQ 3F2CA 1I4XA 2VXWA 1L0YB 3MXPA 4K0KQ 3CMAA 5M3FH 1SBBB 1EU4A 4AYBG 3VR5A 3S9WA 5JAVA 5GADC 4JBKA 2B2UA 2F0JA 5JEAJ 2JA6G 2XGTA 1EL0A 3T1HL 1XMOL 4ZRZA 1NMFA 3HOUB 4PZ7A 4KHPQ 1GXDC 1VF5C 3G6JB 1N34Q 2KENA 1RDPD 1HR0L 1IHZA 2YV5A 4E6IA 1R9TH 5EQ0A 4LF4Q 1P16A 2BH2A 5DNFA 1EIGA 2NVXB 4B3RL 3UDFA 3J81i 4NPSA 4DAYA 1AP0A 2Q2HA 5IT9L 4NW2A 4O42A 5C5MA 2VNUD 1TWGB 4RGNA 3J7A5 3FDTA 3S14B 4C3HH 3GQBA 1AH9A 3E0JA 4G7OC 4K5WA 4YHHQ 5A2QL 5C44B 3EIVA 1C4QA 2NYZD 1HNZL 2BCOA 5CV8A 5KNCA 2UXBL 3PF4A 1HQRD 2BE5D 1ILQA 1SFOB 3FVQA 4UP9A 1I4GA 4PZ6A 2MNAA 2E74C 2KA7A 3I4LA 3CRKC 1D5XC 2Q8TA 4DR4L 3MXNA 2XN9C 3H3VI 3T51B 1E3PA 2WINB 1UEAB 3RD4A 2R7ZH 3E3XA 4CKEA 4OO1H 3J81E 1Y1VH 4FVMA 2ZXRA 3A8JE 2IY5B 4IUVA 2NVYH 4DAMA 3G7LA 5CV5A 2F3IA 4TRDA 4UPAA 1J5EL 1IBLL 1I6HB 2Z4HA 2IX3A 2LXJA 3M4YA 1HZBA 4OO1G 4QMGA 1Y1VG 1NCVA 4B3SL 1JJGA 1MJCA 2EVBA 1SR3A 1NUCA 4A3JH 4LUZA 1SE2A 1NR4A 1K83B 1K8GA 2NZ1D 4L63B 1PFMA 4DV4L 2OCEA 3I4NB 5I2YA 1BNZA 2PI2A 3HKZE 3JAML 1EQRA 3I55A 1CZGA 4R1JA 1EOTA 1UWVA 2ZTCA 2E75C 1IBKQ 3GTLH 3VA7A 1NE3A 3GTPB 4A3CH 4A3JG 4MIUA 1NBWA 3OTOL 2E2IB 4A3BH 1EQQA 3RR5A 1GUNA 2MO0A 1X3FA 4LF5L 1RIPA 5K36G 1A8VA 3NWTA 1YNXA 2G5DA 4HIOA 1JT8A 4LF7Q 5AFWA 4HJ9A 4A3CG 1D6EC 1X3EA 1QNKA 2DNCA 4A3BG 3D0FA 5M5YB 4H44C 1SAPA 4CJ2C 1QOHA 3F2UA 3VR2A 4JI3L 1Q7YC 2N3SA 3L3OC 4A4IA 1EYGA 3CCQA 1HRJA 1EYCA 2WV6D 1EU3A 3M4OH 3TRZA 4B08A 3S2DH 2KBNA 3AYHB 1CKOA 2F0TA 4C3JG 1STHA 5C6AA 5I6YA 5IYCG 3W1GA 3S1QH 2ZJQA 2QDBA 4RWSC 4Q5VA 3PUXA 1SYGA 2EE1A 1I3QB 5COYA 4QY7A 2IHFA 2EYLA 4FYDA 5J3BA 3W3AA 4KTAA 1K8MA 4JI4L 2VB3X 4HTHA 1TWHB 3Q22A 3S1MH 1SMYD 4RGOS 3T16A 1U4PA 1B70B 2GA4B 1Q46A 2F03A 3CAMA 1L0XB 1OO9B 2XRSD 1TQOA 5LMNQ 3CCUA 1AEXA 2K52A 3K5MA 4JG2A 5E7NA 1EWHA 2MFIA 3HKZG 1PLFA 2TMPA 3GTJB 4JI7Q 1PH1A 4IURA 4CDFC 1XNRQ 1SYCA 3S1RB 4C1NK 2AKWB 2G9DA 2L1BA 4K8IA 4NB3A 4YCWA 2M9VA 1JB7A 2MJ8A 3RLFA 1GUOA 5LHY1 3AQQA 3WOEA 1ZYRD 4OGQC 1M90C 5IODA 1HR0W 3FEWX 1HCZA 1I4RA 2K14A 4HMJA 3DM3A 5F2DA 1V8QA 1IBML 2QW7A 4BY1G 2UUAL 2ENBA 1EFWA 4DK3C 4M8AA 1QVGA 1QZGA 1G2TA 4OXPA 4KHPL 1N34L 4OEMB 2Z1CA 1F2YA 3PO3H 3BDCA 2JP1A 1EQVA 4KN4C 4R9WA 5LMUQ 2DJGC 5C4XG 1KLUD 4P72A 3J7ZC 2Q8IB 1PFBA 3GTOH 2OWOA 1NSNS 3TSSA 1KDAA 1IKMA 5CMDA 5ELCA 4EQPA 4G7HC 4P2CB 3UE0A 2NZHA 3KBXA 2A19A 4A3IB 1U0LA 3WWVA 3AFQA 5IP9H 3VR3A 2NTTA 3STBD 4Y7NH 2M2LA 1NR2A 4OIKA 2F3VA 3E0EA 1NTGA 2RQXA 3IKJA 1GO3E 3H15A 1IYUA 4BXXH 3P20A 3H3VC 4X3TA 1CA6A 1KLGD 5M5XB 1AN8A 4DF7A 1EY0A 3BZKA 2EYHA 2B2UC 3KDFA 2JYOA 1X32A 2D2CC 5I2XA 2R93G 4HSVA 3NBHB 4F88A 4FXDA 5C3XA 3H09A 1W6JA 3R93A 5K5PA 2UXCQ 4PNYA 4BXXG 1VQ4A 1B9NA 1A3UA 1DD2A 2RSNA 3KJPA 2Q2UA 1X6OA 4GLXA 1B9MA 1BUVT 1K28A 3EN2A 5JJLA 2LXKA 3KF8B 3K81C 5JEAH 4QUFA 3RN5A 4O2DA 3T56B 5CV4A 5I9OA 2XWJB 4L5QA 1WTWA 1PH7A 5D65A 2VS1A 3K59A 2JA7B 1E1TA 1KHIA 2CH4W 4QGUA 1JOKA 5JEAG 1XTDA 4Q0FA 4XTCS 2F0WA 4KKSA 2N49A 1Y1WH 4M1UB 2NBFA 4MN3A 4YWKA 3J81L 5CORA 3CF5A 4A3DB 4LFBL 1DCZA 5TSSA 4UDUC 3URYA 1IBKL 4BA1I 1YNNC 1LTLA 5CYUA 2F0PA 4RAUC 4A3FB 3GTMB 3C3LA 2NTSA 1L1OC 1EFID 3NTHA 2FMMA 4JBJA 1SMXA 4NMZA 5JJZA 2NUCA 3T1HQ 2Q2TA 1BBWA 2VUMG 3AU7A 1LTID 2X6GA 1PDQA 3K7AH 4IQZA 1E2VA 1LTRD 1HR0Q 4LF7L 3QWNA 3W2DA 4L6TB 1W2BA 2PPBC 3PUVA 2L15A 1LM0A 1S5DD 4B3TL 4B3RQ 1MGSA 3BYTB 1IXRA 4HCEA 3NE5B 1Q1EA 4GN5A 4Y52H 4XDXA 4R4IA 4U673 4P71A 3CCSA 1TIID 2VQEQ 4DAVA 5I6WA 5FO7B 3DWAA 3L0OA 4RA8A 3P7JA 3QIAA 1FNUA 1NAPA 1HFNA 2LY7A 2XSCA 4IUQA 2JA6B 3TN2A 4U68A 5DM63 1VQPA 1XPOA 1PH8A 4ZK9B 1P8LA 1F9RA 1EYDA 1S72A 3K0YA 5M3FB 1HNZQ 3D4WA 1H9JA 2EOTA 2JK8A 3E5SA 3C1EA 5IYBG 3ULJA 4RHSA 2WFWA 3PIPA 3I8ZA 4A3EH 1LT5D 2K4KA 4C3IG 2J4XA 2B63B 2QGQA 2IW3A 4DR4Q 1X55A 2AQ1B 1EOVA 3IFTA 4DR2L 1G291 1R9TB 4A3EG 2E8GA 1PYWD 4F7XA 3C2PA 1CZWA 4DPGA 1L0WA 1NNXA 5FLXL 4FF2A 2PW5A 2FXQA 4N8FA 5C4HA 4BY7G 3DLLA 2AWOA 4OIJA 1AW7A 1J5EQ 2UU9Q 4J15A 2K5NA 1B3AA 4PZ8A 5H1SE 4C3HB 5JVH3 1EY8A 4MZ9A 2H5XA 2HUGA 2ASBA 4J8QA 1WCMG 1KNEA 5IP7G 3CCVA 1QE6A 1Y8NB 5C4ZA 1SE4A 4DV4Q 2BH8A 2X69A 1G6ZA 3SK4A 1CI3M 2PCFB 1TWAH 3BZCA 4GKKQ 3J7AF 1LUZA 5EPKA 1SYDA 2RVLA 3OTOQ 2SEBD 3MXUA 3PV0A 3RLNA 3MAQA 1PRTC 1Y8PB 1RD9D 3MXGA 3EBEA 1YBYA 1PFNA 3PIOA 2R7ZB 1YJWA 4DUZL 4DR6Q 4HEDA 4DAYB 5FLXc 4RGTA 1UUPA 1Y1VB 3PUWA 1KL9A 4LMQD 1MD2D 4ZLTF 1MIUA 3NXWA 1DGSA 2NVYB 4NXNL 4R4CA 1TKWB 1RODA 4JV5Q 4JI3Q 4DV1L 5FKAC 2K5WA 1A6XA 1UE7A 1BVSA 4R4TA 3M3YH 4YCVA 4A3JB 4X64Q 1BBUA 2Q8RE 4IJHA 2KHJA 4JC0A 2ZXPA 2HHHL 1XPUA 1RTNA 4B9XA 5HGTA 1EY6A 5IWAL 5IYDH 4DR5Q 2NN6H 3X3MA 2JA8H 1VQCA 3GTLB 2JN4A 1FR3A 3MXNB 4QQBX 2VW9A 3MC0B 1LV9A 1TS3A 3HOZH 3D4DA 4JI4Q 1S5BD 2JA9A 4A3MH 4OELB 5IYDG 1VQFA 5KIXA 2BA0A 3A8KE 2LMCB 2NN6I 3SGIA 2JA8G 3SK6A 1WTXA 4IJLA 2HT1A 2F1MA 1A15A 1ESRA 3K5NA 2VL6A 4XQQA 3HOZG 2ALYB 1ICFB 4QB4A 2WB1E 5EJWA 1GD7A 3KBGA 1SE8A 1LO5D 3N52A 1BCPC 1JB3A 2RF4A 3D3RA 3SR1A 4CHTB 3M4OB 2B8GA 5D3DA 2CHBD 2F0VA 3U9OA 1QVFA 5C3EH 3OOCA 4QCLA 5HGQA 4UHVA 3KLRA 2WACA 2Y0SE 3PQIA 3S1QB 1QB5D 4JVZA 1IBMQ 4CKCA 1F9PA 1JWSD 3TP8A 2UUAQ 3K5OA 1U5KA 4KD4A 5T1IA 5C3EG 3ITPA 1B7YB 3HS0C 2IL8A 2QILA 3S1MB 2I0QA 2IJ0A 1G2SA 1II3A 5E1FA 2HIXA 3R3OA 1QVCA 4QL5A 1YNND 2C35B 3STBC 1K3RA 3M9BA 3F2DA 3C1FA 3DWQA 4C1NI 1HHVA 4XQNA 2DN8A 4DN4M 2EQSA 2F0OA 3MFGA 2VQEL 2FINB 1N8RC 2AUKA 5C0XJ 2L4NA 3KOJA 1CKNA 1EYAA 2F0NA 1JE5A 3ULLA 4DXFA 3N6RA 1X9NA 1STNA 4JI2Q 1AFPA 2A73B 1SYEA 1L2FA 1ILPA 2SOBA 3HOWG 5A35A 3VA5A 1UE1A 3O13A 4QIWE 1STEA 5LMNW 3K58A 2QF7A 3KUPA 2G9HD 1SRUA 4QJFA 3VYTA 1C9OA 1F9SA 2ZTEA 5DM73 4X3UA 5CGKA 2KQ3A 4KN7C 2EY1A 2HIVA 3GP7A 1BCPF 4OHJA 3PO3B 3NUCA 1PRTB 2WB1G 1PZJD 3RLOA 3PIP3 3ERQA 3Q23A 2KHIA 3NP8A 3GTOB 3BDOA 4IFDH 3P1HA 3ND9A 3CW2C 4CDCC 4IUPA 2IX0A 1O7ZA 1TWFH 2UU9L 1VS0A 2B2VA 1B1ZA 1SROA 4JOIA 4J6HA 2WAQB 1YIJA 1TWCH 2LSSA 2F0EA 1XJVA 4OO1I 4HSPA 4I7AA 4GNXA 1O80A 1S5ED 1JICA 4K8JA 2K5VA 4IFDG 1V43A 1WTVA 2F0LA 2B2YA 1G6PA 2LKVA 2A6HC 4LFBQ 1HQMC 1E2ZA 1WTRA 5K36H 1Q8IA 3OW7A 4A3GH 4WORA 4ZCKA 3TDQA 4CJ0B 2VZAA 4GKKL 3A8IE 2KVMA 1PH2A 2K75A 5GAEC 2KHSA 3QO2A 4DR6L 4HN7A 4A3GG 4DK1A 2GVBA 3UDXA 3CCMA 4K14A 1PTOH 1GHJA 3SEBA 1IYJB 3Q8DA 3J80c 4B3TQ 3PO2H 1HA5A 2E5LL 3U9SA 3AMUA 4IPHA 2PW7A 1OXSC 5AJ3Q 1N32Q 1X3GA 3MVVA 1PRTD 1YHQA 4C3JH 4JV5L 1PH3A 5IYCH 4DA2A 4DV5L 1UNSA 5KGUA 2SDFA 5KNBA 1YEZA 5ISRA 2R3ZA 1D8LA 4X64L 1RCVD 2XIWA 1BCPB 1Y1WB 4GLAC 3PO2G 3U4VA 2YTVA 3H6MA 3KDFB 2EY6A 2JEBI 3F8TA 2HQEA 1MSGA 4MTKA 2EY5A 4KKUA 1SJHD 4DR5L 1OXUA 4RKBA 3I2ZA 4ZAIA 2B39A 5FLXE 3E9HA 3HZXA 2EJGC 4LNQA 1JE4A 2KCMA 2BDOA 3HP3A 3M7NA 1KDBA 3SDZA 1KTKA 2E76C 2D9UA 2UUBQ 4H0LC 3DEPA 3K7AB 4DUYL 3R2TA 1WTHA 4DR2Q 5L37A 3I91A 1HNWL 3CU7A 2WKDA 4KY6A 1DOKA 3X3NA 2F0FA 2PQAA 5M3MH 4FNFA 1VF7A 1TS5A 5C4JH 2IX1A 3K5LA 3S16H 1EUJA 2ZJRA 3ZJYC 5GAGC 4BY1H 3HOVB 3K7UC 1A3VA 4TSSA 4A75A 4LF8L 3DHQA 4YIJA 5IGFA 5IY0A 3KLSX 2KUMA 3L7ZC 4KD3A 4EGVA 4KHVA 3PMFA 2BA1A 4TVAB 5M3MG 5GAHC 2Z9HA 1PMRA 3LWUA 2OTJA 1EIFA 2MHVA 2A68D 4JW0A 2I07B 5C4XH 2EYOA 1SSOA 1HH2P 1BCPD 3CC7A 5IGCA 2PNHA 2DNEA 4GS3A 1B44D 3CC4A 1SXTA 3ER0A 4KJOA 3MEHA 5ELBA 3OWFA 2R7FA 4LWCA 3EROA 3V96A 2Z6KA 5C44H 2I5HA 5KEEA 4R4OA 1I94L 2PMZE 2B3GA 3NTKA 4DR3L 1VQDA 2O4XA 1MI2A 4DUZQ 1C0AA 4DV7L 1EY9A 4B9WA 2L12A 1LT3D 5IIFA 3BG3A 3WOFA 1W3SA 3F1ZA 4NXNQ 2EYJA 4HCSA 3K0XA 5C44G 3ERSX 5FLMG 3G48A 2CWAA 1JJ2A 3CC2A 1K8OA 1WI5A 2R93H 2CQAA 4DV1Q 4TQUS 2MUYA 4IOCA 1VQ6A 4JI2L 5NUCA 1U4LA 3DMUA 1X56A 5LL6S 1MKHA 1KABA 1OXVA 3CCEA 2HHHQ 3I70A 1DXMA 5G3LF 1IYVA 1O78A 5IWAQ 4QF4A 1SNDA 1TWAB 1LTAD 3HRZC 1B53A 1TY2A 5EGTA 4JBMA 2ID0A 2N78A 4X62L 1VQOA 1R4QB 3KYHC 1V1PA 4XXEA 1GJXA 3AEVA 3I4MH 2AWNA 4LFAL 4JK1C 4O0AA 4N9TA 3CCJA 1EEFD 1F9QA 1GM5A 4KK7A 5ELDA 5GQOA 3GO5A 3ZYYX 3LNNA 4C56C 3Q0AA 3I4MG 2FFKB 4OL7A 1JC7A 1KAWA 3BZDB 3M3YB 1HTPA 1STBA 4XQJA 4BBSH 4P73A 1WD1A 2A6EC 1Y69U 2R61A 4QUCA 3S2HH 3FKIH 2VUMH 1F2LA 5C0XH 3CPWA 1Q90A 1B50A 2QKIC 1JR0D 2RCFA 2JA8B 1VMPA 1R4PB 4CDEC 2EDGA 1VQGA 4JI6L 1J9OA 1LACA 1OTCA 1G8ZD 4BBSG 1YVCA 2OEOA 1N33L 1J8IA 3J80i 3HOZB 2CQOA 3FKIG 5C0XG 1X3QA 2A6HD 2F0KA 1F2MA 4A3MB 1ICWA 3GD7A 4UP7A 3ULPA 2A69C 1PTOC 1BR9A 1I6VC 1Z47A 5ELFA 2B2VC 1M1KC 4IUUA 4I7ZC 5IOCA 5AJ3L 4JOIC 1N32L 4HJ7A 5HY6A 3OYYA 1NMGA 4KLKA 2PQEA 4GOPA 2A74C 5IE8A 4GNXC 3A5ZB 1PFSA 1WTPA 3RN2A 1TS4A 2K1BA 2K7VA 4AYBB 1Z9FA 3LWEA 4OONA 5IYBH 3K57A 4LF9L 5IGDA 4C3IH 1QNUA 2PNRC 5C3EB 2Z0SA 3OW2A 4L8JA 2F0GA 3HOYH 1XWEA 1PV4A 2CFMA 3KLWA 4ZKBB 1S5CD 1T5XD 3A7LA 2F3WA 1TY0A 1D7QA 2LS01 2IWHA 3W1BA 1PH5A 4CBVA 1B4OA 2K28A 4JCVE 3MTSA 2KEEA 2J0TD 4DV3L 4DR1Q 1H9SA 1TXYA 3J80E 1PA6A 2VB2X 2RHSB 4S3SA 3KFUA 1PH9A 2UUBL 4KJNA 1N9WA 1JJCB 4JI8Q 4MHEA 3HOYG 4DFAA 4BY7H 3DWPA 3RZDH 1J6QA 3I72A 1C48A 3DEOA 3H91A 2EYFA 1V1QA 2OXPA 4IN3A 4RGMA 3A0JA 1CTMA 2O5IC 2YTYA 1RL2A 3I90A 4N9PA 3CPFA 4OWTB 2YYZA 1WCMH 1M4VA 5IGGA 2F0SA 3GTGH 5IP7H 2F52A 2JQOA 3KF6A 3CXCA 2NVTH 3BS1A 1GUGA 4GKJQ 2QCPX 5IGEA 1K8AC 3WDNA 3OIQA 1LTTD 3D6WA 5G3LD 1UEBA 4RFBA 1Q82C 1PTOF 1N36Q 3GV6A 2E2HH 4RHRA 3EFXD 5ELOA 1A63A 3HOXH 4DGZA 4BBRH 1K0RA 4EVOA 1D5MC 3KJOA 1WVLA 4A93H 4JI1L 1SLJA 1D1IA 3FP9A 3S17H 1K9MC 3M4QA 4RCNA 1H9KA 4NXML 3J81j 2HDLA 5CBAE 1W6KA 1A0IA 1VQAA 3HOXG 4BBRG 4A3IG 3KK7A 3TZUA 2WIIB 5IGBA 4A93G 3GTQH 4L5TA 2NB0A 1WYDA 3T13A 1H9RA 2L55A 3U58A 5GROA 4DV0L 1GVPA 1TWFB 2NWGA 4HR7B 2E5LQ 2PZUA 4JYAL 4FXGC 4EQOA 1JORA 1CKNB 3LX0A 2KCNA 4XYQA 1WOCA 2JXMB 1TWCB 1HNXQ 1GHKA 4L5SA 3CRLC 4DV5Q 3S24A 2UXDL 1VDZA 2BDNA 3CCRA 1PHJA 4FF1A 1JOOA 3G4SA 1XX8A 4X3KA 2UUCQ 5EPJA 2RKSA 2O5JC 2SNMA 2XWBB 1SNQA 4NDXA 3BJUA 5EBDA 3S1NH 4A3GB 3M85A 3TMEA 1YHAA 5BN5A 3GDEA 4EQ5A 1XMQL 4KHZA 3SHLA 3EQLC 2Z6KC 1ONLA 2AQ2B 1I5FA 4A3BB 3QOLA 1UE5A 4OX9Q 1HPCA 4OWWB 1MBYA 1KAAA 1FNWA 4LK1C 4QIWB 4X65Q 4UY8C 3H94A 2AQ3B 1SNOA 1O7IA 4X3SA 4XT1B 3R8BA 2Z6BA 4IZ8A 1U4MA 2VQFL 2P5ZX 4DUYQ 2JA7G 3MZ5A 1PTOB 2QEJC 2EZVA 4GN4B 2K5DA 3ICEA 3PO2B 1HNWQ 1JQYD 1NY4A 3VR6A 1VCIA 1SYFA 2QA4A 1HUNA 4C3JB 2O2LD 2Z8LA 1HXYD 1YJNA 1WD0A 2ZM6Q 1FL0A 3B6YA 4GNXB 2A68C 4BS9A 3NHHA 3TBIB 1CK1A 2HQLA 5FOBB 2OF1A 1S3OA 1CSQA 1E1OA 1E2WA 1IW7C 2RA4A 1AZQA 4LF8Q 3NBIA 4CKBA 2ZXOA 4V190 1LT6D 2NVQH 3S2DB 4FDBA 2R92H 1ZKOA 5FO9B 3NQIA 4LF6L 4YCUA 4A3KH 3RZOH 1TVXA 3M7GA 3SE0A 1RHPA 2DGYA 5CC4A 4DAPA 3TP6A 1A3TA 2MPMA 4R4QA 4F8MA 3NK9A 3HFZB 2A6ED 2R92G 3HKZB 1LTBD 1S5FD 1QWYA 3OSOA 4DXGA 4A3KG 4XYOA 3F2BA 1XNQL 5EPLA 1I94Q 3EA6A 1VQEA 1ENCA 5M9OA 2XVSA 4DR3Q 5M5WH 4DV7Q 4KKTA 1ENFA 4YWMA 2AUJD 1QUQA 3NTIA 4AH6A 2F0HA 3HOWH 2B63H 2C9OA 5KRUA 2F4VQ 2MO1A 5M3MB 1EY4A 5C4JB 4IO9A 3UE1A 3S16B 4K5VA 3D6CA 2A69D 5M3FG 1MHWC 4BY1B 1F77A 1PTOD 2YU9H 1X3PA 3IAYA 4X66Q 2CWPA 3K6OA 1PYBA 1HUMA 1EZ8A 4OWXB 2AHOB 2B63G 3ND8A 1Y8OB 4AQYQ 3MWYW 1EWCA 4UAIA 1T9HA 2JE6I 4DNTB 4GN3B 4IUTA 3BU2A 3M4PA 1V9PA 4H7BA 5C4XB 3PCOB 1ASZA 1JOQA 4DR1L 1FYCA 3OWEB 3TS2A 5CV6A 3AFPA 3L9AX 4IUNA 4JI8L 3VR4A 1SDFA 3A54A 2XTIA 1EIHA 2HDMA 3H3VH 3RUZA 1Z7TA 4X62Q 2D0PA 4YY3L 2EXDA 4JI0Q 3OMCA 1EEID 4ULLA 4C3HG 4HAEA 4BA2I 2PQAB 4K2LA 1FGUA 4DV2L 4GOPC 1H9MA 4LFAQ 1E7ZA 5LL6X 1ZXTA 4APVA 1LYLA 2Y0SG 4GKJL 2QDLA 1KRTA 1UE6A 3CQZH 1RF2D 4ME5A 1ASYA 3J80L 3GTKH 1L1OA 1HTLD 4RG1A 2R93B 4LW1A 1K73C 4C2MH 3K80C 4Y7NB 5IT9c 1VQ7A 2JA5H 4K6LA 1N36L 4IFDI 3L2PA 1K0SA 4JPBW 2PI2E 1B2TA 3T1YQ 3A56A 1D2BA 4HIKA 1I50H 3S15H 2R7ZG 4WJWA 3T4AC 3TP5A 1QG7A 1VQ5A 2JA5G 2MGSA 4N8X1 5ELNA 4JI6Q 2RBMA 1YZ6A 2K6AA 4B3ML 1N33Q 4CDDC 2E2JH 1EY5A 5E3FA 1Q1BA 2FHTA 1Q86C 4FO2A 4DV6Q 1PVOA 2PYKA 4WJ3M 3I4MB 3VYSA 4RMFA 1S40A 2F0MA 4J1MA 2CW0C 5J39A 1SJED 3MEFA 5EKIA 2C5CA 2PZTA 1ET9A 2K04A 3PIO3 1D1KA 3I4OA 2A1AA 1DJRD 5CR3A 2PMZB 4UP8A 5CBEE 2K03A 1KD1C 1HNXL 2KCCA 3FRPB 1AZPA 2F4IA 1VQHA 2Q2IA 4YWLA 3W5OA 3OPOA 4ZQ3A 2UUCL 2B2TA 4IOAA 4ODGA 4LF9Q 4BBSB 1SE3A 3H0GH 3ONAB 1HZ9A 3DM1A 3S2HB 3FKIB 1B3QA 1CQVA 2VUMB 2RCNA 2EJMA 4KI0A 1BBXC 2MP1A 2IHEA 3MHBA 2R7DA 3A7AB 1G91A 1UAPA 3V2TA 5C3WA 4FP5D 1MJEA 3JAMc 2E2DC 4HJAA 4OX9L 1XYIA 4X65L 1FJGL 4DV3Q 1C8CA 3H0GG 3CP0A 3DXJC 3Q24A 2HCIA 1V1PB 1E22A 2FMCA 2TSSA 2K01A 3FPPA 4HMIA 4K5XA 1PZID 1CQFA 4DR7Q 3NSWA 2RHQB 2B2WA 1HZCA 3D31A 3SK8A 1GUWA 1GOZA 5BR8Q 4Z9CB 1BOSA 4G4KA 2ZM6L 3HOUH 4ZUIA 2YTXA 3UDGA 5C5LA 1ESFA 5T1GA 3MFYA 2V1CC 5JVG3 2L0CA 2WAQE 1X65A 1HFGA 3EVQA 1BDOA 4C3IB 2NVXH 2OQ0A 3HOUG 2EIFA 3RNUA 3HOYB 1TWGH 4JI5Q 3QOJA 3S14H 1LABA 3OIPA 1HJPA 2DY8A 4A3EB 1XXGA 1IW7D 1PZKD 5I9PA 5KYIA 5JOBA 2A8VA 1TT2A 1U9RA 4JI1Q 4ILWA 4LFCL 1MSHA 3AB9A 1YJ9A 2IT1A 3BVZA 5FLMH 4BY7B 4KY5A 4NXMQ 4K0KL 2KEDA 4NKLA 3RZDB 3QJYA 1EIYB 1VQ8A 4LAAA 1E0BA 4PQXA 1SEBD 2AMCB 3NELA 1SFOH 5DAUA 3A55A 1DYQA 1DOMA 4EQNA 1WCMB 3I7FA 4BWGB 4GOPB 3I56A 3CKIB 2F4VL 3GTGB 4DU9A 3QG1A 2HCCA 2NVTB 4DV0Q 3E6ZX 1EZ6A 2RDHA 2OTLA 4JYAQ 4LF4L 4X66L 4DK6C 5BN4A 2UXDQ 2ES2A 1VQNA 1A2TA 2FJ2A 4LUOA 2DY7A 4AQYL 1BF4A 2EYPA 4DNRB 1O7LA 1KRSA 3PGZA 3Q6SA 1GUTA 2E2HB 1RJTA 4G7ZC 3PF5A 3GV3A 3PO3G 4IPGA 1I6HH 4KY7A 3R2IA 3HOXB 4BBRB 1H9SB 2A5HA 1ET6A 3SK5A 4POFA 1Q81C 4XT3B 4A93B 1PH6A 1XMQQ 2XNAC 1KDCA 1QZHA 4YHHL 1BO0A 2HD3A 3S17B 1K83H 1Q8KA 4WJ4A 1WFQA 1XTCD 2XRQD 3NWSA 4V0BA 3I4NH 1A2UA 4JI0L 1G51A 5EBCA 1JWUD 1DZ1A 2WAQG 2V4DA 4IPDA 5IP9G 1S4ZA 2VQFQ 4XIGS 4AIMA 2H4OA 1KQSA 2J7ZA 1CA5A 3GTQB 4PG3A 5DEHA 4RCOA 3KF6B 3GTPH 3T53B 3MA2B 2E2IH 1E24A 1PXUA 5EKKA 5FJ8H 3I4NG 2N55A 3FPUB 1LTSD 2CKZB 3HGBA 3U50C 2EPBA 3I73A 4ZYSA 3TZDA 2JJQA 4HIMA 1Q3LA 1LT4D 5JPNC 4PMBA 3T1YL 1CHQD 5M5YH 1K3BC 2X6LA 3P75A 5FJ8G 1CFMA 4WRDA 4CJ1B 1YNJC 2M00A 1GKHA 4LF6Q 5FO8B 1V1OA 3S1NB 2F0QA 3UDIA 5EAYA 4A3LH 5ELEA 2N88A 1WTQA 1DOLA 1OXTA 4PMWA 1H95A 3HEJA 4LJZC 5D3IB 4ID6A 4EX5A 1DM0B 3CCLA 3J7AV 4DV6L 1STAA 1ENAA 3RMHA 2SNSA 5C0XI 4DK0A 2JEAI 2I5MX 1XNQQ 4A3LG 3PUYA 1VQLA 5IT9E 4NP5A 1KNAA 1EQTA 2I5LX 1I3QH 5CV7A 5E4XA 1Y1WG 3OHXC 5JPMC 3NEMA 4ALPA 4IFDJ 1XMOQ 1YHBA 3PSIA 1TWHH 1WTOA 5E4WC 1CUKA 2KJXA 3JC66 2ZJPA 1SNCA 1SNPA 1O7YA 2B2YC 5A2QE 4ZUJA 5J22A 2ICEC 3TS0A 1QILA 2CW0D 2MQHA 1FD7D 5CV9A 3JAMi 2NVQB 2CCZA 2R92B 2I46A 1D5ZC 5KYLA 1YI2A 4A3KB 3RZOB 3OMGA 2K5QA 1ML0D 3A74A 3GTJH 1QCBD 1CSPA 2QEXA 1A62A 3S1RH 2BE5C 1XPRA 2K5HA 5FK9C 3J81c
chains in the Genus database with same CATH topology
1DONA 2LFNA 4K2KA 5HURA 1I4PA 4FXKC 2BOSA 2L11A 2F0DA 2ZT9C 2D62A 3UI2A 2IPKD 5M5WB 2F0UA 4GZYC 4K6DA 4KV6A 3NBHA 3HOWB 4RH6A 2D5DA 1JWMD 2CVRA 3DUZA 2OT2A 3PUZA 2B2TC 3TP7A 2YU9B 1JCKB 1T5EA 1IKLA 3JAME 3KF8A 3SVMA 3I3CA 4ABNA 1GUSA 2PO4A 1I4QA 5KNDA 1TR5A 3IL8A 3FMCA 2WB1B 2R6GA 5EKLA 3KLSA 3D4RA 4I65A 1BQQT 4PMCA 4RKLA 1CT1D 2K32A 2Y0SB 2JSOA 1IL8A 2KECA 4TKOB 1ZEQX 3NPPA 1BXTA 1LTGD 2B2WC 3D8GA 3V05A 5I4DA 5D14A 4PV1C 1U4RA 2ICIA 1STGA 3CQZB 3GTKB 3BVGA 1FNVA 4CGYB 1TU2B 2H1EA 1SNMA 2PZWA 4C2MB 3J7YW 1Z6HA 2F0IA 1STYA 2JA5B 3QB3A 1I4HA 4ZKCB 3IFDA 4R8NA 1I50B 3S15B 3VYRA 2EYMA 4FF4A 1F2ZA 4H13C 4O1NA 4KMUC 3EJIA 1HA6A 1Q12A 3VYUA 2L9HA 1EY7A 2E2JB 3BYYB 4WFN3 1SMYC 5BN3A 3C46A 3NQTA 3BVMA 1TS2A 1VMCA 2KOLA 1CHPD 3CHBD 1SYBA 4R8IA 1M8AA 2EY2A 2RSOA 4G57A 2RDFA 2Z4IA 2EXZA 1RKNA 2WKCA 4F87A 4JBWA 3HG9A 2NN6G 2B8FA 4FF3A 3BDLA 1CM9A 1QJOA 1ZYRC 2K05A 2L5TA 2EJFC 3H0GB 2WP8J 1RTOA 4IALA 1LLRD 1OXXK 2K33A 2RDGA 1FGBD 5J1ZA 1PRTF 3SXHA 1YNJD 1I4XA 2VXWA 1L0YB 3MXPA 1SBBB 1EU4A 3VR5A 3S9WA 5JAVA 2B2UA 2F0JA 5JEAJ 1EL0A 4ZRZA 3HOUB 1GXDC 1VF5C 3G6JB 1RDPD 1IHZA 4E6IA 5EQ0A 5DNFA 1EIGA 2NVXB 4DAYA 1AP0A 5IT9L 4NW2A 4O42A 5C5MA 2VNUD 1TWGB 4RGNA 3FDTA 3S14B 3GQBA 3E0JA 4G7OC 4K5WA 5A2QL 5C44B 1C4QA 2NYZD 2BCOA 5CV8A 5KNCA 1HQRD 2BE5D 1ILQA 1SFOB 3FVQA 1I4GA 2E74C 2KA7A 3I4LA 3CRKC 1D5XC 2Q8TA 3MXNA 2XN9C 3T51B 2WINB 1UEAB 3RD4A 4CKEA 4OO1H 3J81E 4FVMA 2ZXRA 3A8JE 4IUVA 3G7LA 5CV5A 4TRDA 1I6HB 2Z4HA 2IX3A 3M4YA 4OO1G 4QMGA 1NCVA 2EVBA 1NUCA 1SE2A 1NR4A 1K83B 2NZ1D 4L63B 1PFMA 3I4NB 5I2YA 1BNZA 3JAML 1CZGA 1EOTA 2E75C 3VA7A 3GTPB 4MIUA 2E2IB 1GUNA 5K36G 3NWTA 5AFWA 1D6EC 1QNKA 2DNCA 5M5YB 4H44C 1SAPA 4CJ2C 1QOHA 3F2UA 3VR2A 3L3OC 1HRJA 1EYCA 2WV6D 1EU3A 4B08A 2F0TA 4C3JG 1STHA 5C6AA 5I6YA 2QDBA 4RWSC 4Q5VA 3PUXA 1SYGA 2EE1A 1I3QB 5COYA 2EYLA 4FYDA 3W3AA 4KTAA 1K8MA 2VB3X 4HTHA 1TWHB 3Q22A 1SMYD 4RGOS 3T16A 1U4PA 2GA4B 2F03A 1L0XB 1OO9B 2XRSD 1TQOA 1AEXA 3K5MA 1EWHA 1PLFA 2TMPA 3GTJB 4IURA 1SYCA 3S1RB 4C1NK 2L1BA 2G9DA 4K8IA 2M9VA 2MJ8A 3RLFA 1GUOA 5LHY1 3WOEA 1ZYRD 4OGQC 5IODA 3FEWX 1HCZA 1I4RA 4HMJA 5F2DA 1V8QA 2ENBA 4M8AA 1G2TA 2Z1CA 1F2YA 3BDCA 2JP1A 4KN4C 1EQVA 4R9WA 1KLUD 2Q8IB 1PFBA 1NSNS 3TSSA 1KDAA 1IKMA 5CMDA 5ELCA 4EQPA 4G7HC 4P2CB 3KBXA 4A3IB 3VR3A 2NTTA 2M2LA 1NR2A 4OIKA 2F3VA 3IKJA 2RQXA 1IYUA 3P20A 3H3VC 4X3TA 1CA6A 1KLGD 5M5XB 1AN8A 4DF7A 1EY0A 2EYHA 2B2UC 2JYOA 1X32A 2D2CC 5I2XA 4HSVA 4F88A 4FXDA 5C3XA 3H09A 1W6JA 3R93A 5K5PA 4PNYA 1B9NA 1A3UA 1DD2A 2RSNA 1B9MA 1BUVT 5JEAH 4QUFA 3T56B 5CV4A 5I9OA 2XWJB 1WTWA 5D65A 3K59A 2JA7B 1JOKA 5JEAG 4Q0FA 4XTCS 2F0WA 4KKSA 4M1UB 2NBFA 4MN3A 3J81L 5CORA 4A3DB 1DCZA 5TSSA 4UDUC 3URYA 4BA1I 1YNNC 5CYUA 2F0PA 4RAUC 4A3FB 3GTMB 3C3LA 2NTSA 1EFID 3NTHA 2FMMA 4NMZA 5JJZA 2NUCA 3AU7A 1LTID 2X6GA 1PDQA 4IQZA 1E2VA 1LTRD 3QWNA 3W2DA 4L6TB 2PPBC 3PUVA 1S5DD 1MGSA 3BYTB 4HCEA 3NE5B 1Q1EA 4XDXA 4U673 1TIID 4DAVA 5I6WA 5FO7B 3DWAA 4RA8A 3P7JA 3QIAA 1FNUA 1NAPA 1HFNA 2LY7A 2XSCA 4IUQA 2JA6B 3TN2A 4U68A 5DM63 4ZK9B 1F9RA 1EYDA 3K0YA 5M3FB 3D4WA 1H9JA 2EOTA 3E5SA 3C1EA 4RHSA 3I8ZA 1LT5D 4C3IG 2J4XA 2B63B 2IW3A 2AQ1B 3IFTA 1G291 1R9TB 1PYWD 4F7XA 3C2PA 1CZWA 5FLXL 4FF2A 2PW5A 5C4HA 2AWOA 4OIJA 1AW7A 1B3AA 5JVH3 4C3HB 1EY8A 2HUGA 4J8QA 1KNEA 1QE6A 1Y8NB 5C4ZA 1SE4A 2X69A 1G6ZA 3SK4A 1CI3M 2PCFB 3J7AF 5EPKA 1SYDA 2RVLA 2SEBD 3MXUA 3PV0A 3MAQA 1PRTC 1Y8PB 1RD9D 3MXGA 2R7ZB 1PFNA 4HEDA 4RGTA 1UUPA 1Y1VB 3PUWA 4LMQD 1MD2D 4ZLTF 3NXWA 2NVYB 1TKWB 1RODA 5FKAC 2K5WA 1A6XA 4A3JB 2Q8RE 2ZXPA 1RTNA 4B9XA 5HGTA 1EY6A 2NN6H 3X3MA 3GTLB 1FR3A 3MC0B 1LV9A 1TS3A 3D4DA 1S5BD 5KIXA 2BA0A 3A8KE 2LMCB 2NN6I 3SK6A 1WTXA 2F1MA 1A15A 1ESRA 3K5NA 4XQQA 4QB4A 5EJWA 3KBGA 1LO5D 3N52A 1JB3A 1BCPC 3D3RA 3SR1A 4CHTB 3M4OB 2B8GA 5D3DA 2CHBD 2F0VA 3U9OA 3OOCA 4QCLA 3KLRA 2WACA 3S1QB 1QB5D 4CKCA 1F9PA 1JWSD 3TP8A 3K5OA 4KD4A 5T1IA 3ITPA 3HS0C 2IL8A 2QILA 3S1MB 2IJ0A 1G2SA 1II3A 5E1FA 3R3OA 1YNND 3C1FA 3DWQA 4C1NI 1HHVA 4XQNA 2DN8A 4DN4M 2F0OA 3MFGA 2FINB 2AUKA 5C0XJ 2L4NA 1EYAA 2F0NA 4DXFA 3N6RA 1STNA 1AFPA 2A73B 1SYEA 1ILPA 2SOBA 5A35A 3VA5A 3O13A 1STEA 3K58A 2QF7A 3KUPA 2G9HD 3VYTA 1F9SA 5DM73 4X3UA 5CGKA 2KQ3A 4KN7C 2EY1A 3GP7A 1BCPF 4OHJA 3PO3B 3NUCA 1PRTB 1PZJD 3PIP3 3ERQA 3Q23A 3NP8A 3GTOB 3BDOA 4IFDH 3P1HA 3ND9A 4IUPA 2IX0A 1O7ZA 2B2VA 1B1ZA 4J6HA 2WAQB 2F0EA 4OO1I 4HSPA 1O80A 1S5ED 1JICA 4K8JA 4IFDG 1V43A 1WTVA 2F0LA 2B2YA 2LKVA 2A6HC 1HQMC 1E2ZA 1WTRA 5K36H 1Q8IA 3OW7A 4WORA 3TDQA 4CJ0B 3A8IE 2KVMA 2KHSA 3QO2A 4HN7A 4DK1A 4K14A 1PTOH 1GHJA 3SEBA 1HA5A 3U9SA 3AMUA 2PW7A 1OXSC 3MVVA 1PRTD 4DA2A 1UNSA 5KGUA 2SDFA 5KNBA 5ISRA 2R3ZA 1RCVD 2XIWA 1BCPB 1Y1WB 3H6MA 2EY6A 2JEBI 2HQEA 1MSGA 2EY5A 4KKUA 1SJHD 1OXUA 4RKBA 4ZAIA 2B39A 5FLXE 3HZXA 2EJGC 1JE4A 2BDOA 3HP3A 3M7NA 1KDBA 3SDZA 1KTKA 2E76C 2D9UA 4H0LC 3DEPA 3K7AB 3R2TA 3I91A 3CU7A 2WKDA 4KY6A 1DOKA 3X3NA 2F0FA 4FNFA 1VF7A 1TS5A 2IX1A 3K5LA 3HOVB 1A3VA 4TSSA 3DHQA 4YIJA 5IGFA 3KLSX 2KUMA 3L7ZC 4KD3A 4EGVA 4KHVA 3PMFA 2BA1A 1PMRA 3LWUA 2MHVA 2A68D 2I07B 2EYOA 1SSOA 1BCPD 5IGCA 2DNEA 1B44D 1SXTA 4KJOA 3MEHA 5ELBA 3OWFA 3EROA 3V96A 5KEEA 3NTKA 2O4XA 1MI2A 1EY9A 4B9WA 2L12A 1LT3D 5IIFA 3BG3A 3WOFA 2EYJA 4HCSA 1K8OA 2CQAA 4TQUS 2MUYA 5NUCA 1U4LA 3DMUA 5LL6S 1KABA 1OXVA 3I70A 1DXMA 5G3LF 1IYVA 1O78A 4QF4A 1SNDA 1TWAB 1LTAD 3HRZC 1B53A 1TY2A 5EGTA 2ID0A 1R4QB 1V1PA 4XXEA 1GJXA 2AWNA 4JK1C 4N9TA 1EEFD 1F9QA 4KK7A 5ELDA 3GO5A 3ZYYX 3LNNA 4C56C 3Q0AA 2FFKB 4OL7A 1JC7A 3BZDB 3M3YB 1HTPA 1STBA 4XQJA 1WD1A 2A6EC 1Y69U 2R61A 4QUCA 1F2LA 5C0XH 1Q90A 1B50A 2QKIC 1JR0D 2JA8B 1VMPA 1R4PB 2EDGA 1J9OA 1LACA 1G8ZD 2OEOA 1J8IA 3HOZB 5C0XG 1X3QA 2A6HD 2F0KA 1F2MA 4A3MB 1ICWA 3GD7A 2A69C 1PTOC 1BR9A 1I6VC 1Z47A 5ELFA 2B2VC 4IUUA 4I7ZC 5IOCA 2PQEA 2A74C 1WTPA 1TS4A 2K1BA 2K7VA 4AYBB 3LWEA 3K57A 5IGDA 1QNUA 2PNRC 5C3EB 4L8JA 2F0GA 1XWEA 4ZKBB 1S5CD 1T5XD 3A7LA 2F3WA 1TY0A 2LS01 2IWHA 4CBVA 1B4OA 2K28A 3MTSA 2KEEA 2J0TD 1H9SA 3J80E 2VB2X 4S3SA 4KJNA 4MHEA 4DFAA 3DWPA 3I72A 1C48A 3DEOA 3H91A 2EYFA 2OXPA 4IN3A 4RGMA 2O5IC 1CTMA 3I90A 4N9PA 2YYZA 1M4VA 5IGGA 2F0SA 3BS1A 1GUGA 2QCPX 5IGEA 3WDNA 3OIQA 1LTTD 3D6WA 5G3LD 4RFBA 1PTOF 3GV6A 4RHRA 3EFXD 4DGZA 4EVOA 1D5MC 1WVLA 1D1IA 4RCNA 1H9KA 2HDLA 5CBAE 1W6KA 3KK7A 3TZUA 2WIIB 5IGBA 2NB0A 3T13A 1H9RA 2L55A 1TWFB 2NWGA 4HR7B 2PZUA 4FXGC 4EQOA 1JORA 3LX0A 2KCNA 4XYQA 2JXMB 1TWCB 1GHKA 3CRLC 1VDZA 2BDNA 4FF1A 1JOOA 1XX8A 4X3KA 5EPJA 2RKSA 2O5JC 2SNMA 2XWBB 1SNQA 4NDXA 5EBDA 4A3GB 3M85A 3TMEA 5BN5A 4KHZA 3SHLA 3EQLC 1ONLA 2AQ2B 4A3BB 3QOLA 1HPCA 1KAAA 1MBYA 1FNWA 4LK1C 4QIWB 3H94A 2AQ3B 1SNOA 4X3SA 4XT1B 3R8BA 4IZ8A 1U4MA 3MZ5A 1PTOB 2QEJC 2EZVA 2K5DA 3PO2B 1JQYD 3VR6A 1VCIA 1SYFA 1HUNA 4C3JB 2O2LD 2Z8LA 1HXYD 1WD0A 2A68C 4BS9A 3NHHA 3TBIB 1CK1A 5FOBB 2OF1A 1E2WA 1IW7C 2RA4A 1AZQA 3NBIA 4CKBA 2ZXOA 4V190 1LT6D 3S2DB 1ZKOA 5FO9B 3NQIA 1TVXA 3M7GA 3SE0A 1RHPA 5CC4A 4DAPA 3TP6A 1A3TA 2MPMA 4F8MA 3NK9A 2A6ED 3HKZB 1LTBD 1S5FD 1QWYA 3OSOA 4DXGA 4XYOA 5EPLA 3EA6A 1ENCA 5M9OA 2XVSA 4KKTA 1ENFA 2AUJD 3NTIA 2F0HA 2C9OA 5KRUA 5M3MB 1EY4A 5C4JB 3S16B 4K5VA 3D6CA 2A69D 4BY1B 1F77A 1PTOD 1X3PA 3IAYA 3K6OA 1HUMA 1EZ8A 3ND8A 1Y8OB 3MWYW 1EWCA 4UAIA 2JE6I 4DNTB 4IUTA 4H7BA 5C4XB 1JOQA 1FYCA 3OWEB 5CV6A 3L9AX 4IUNA 3VR4A 1SDFA 3A54A 1EIHA 2HDMA 3RUZA 1Z7TA 3OMCA 1EEID 4ULLA 4C3HG 4HAEA 4BA2I 4K2LA 1H9MA 5LL6X 1ZXTA 1RF2D 4ME5A 3J80L 1HTLD 2R93B 4Y7NB 4K6LA 4IFDI 1B2TA 3A56A 1D2BA 4WJWA 3T4AC 3TP5A 1QG7A 2MGSA 2RBMA 2K6AA 1EY5A 5E3FA 1Q1BA 2FHTA 4FO2A 2PYKA 3I4MB 3VYSA 2F0MA 4J1MA 2CW0C 5J39A 1SJED 5EKIA 2C5CA 2PZTA 1ET9A 2K04A 3PIO3 1D1KA 1DJRD 5CR3A 2PMZB 5CBEE 2K03A 2KCCA 3FRPB 1AZPA 2F4IA 3OPOA 4ZQ3A 4BBSB 2B2TA 4ODGA 1SE3A 3ONAB 3DM1A 3S2HB 3FKIB 1CQVA 2VUMB 2EJMA 4KI0A 1BBXC 2MP1A 3MHBA 3A7AB 1G91A 1UAPA 3V2TA 5C3WA 4FP5D 2E2DC 1XYIA 1C8CA 3DXJC 3Q24A 2HCIA 1V1PB 2FMCA 2TSSA 2K01A 3FPPA 4HMIA 4K5XA 1PZID 1CQFA 3NSWA 2B2WA 3D31A 3SK8A 1GUWA 1GOZA 4Z9CB 1BOSA 4G4KA 4ZUIA 5C5LA 1ESFA 5T1GA 3MFYA 5JVG3 2L0CA 1HFGA 3EVQA 1BDOA 4C3IB 3HOYB 3QOJA 1LABA 3OIPA 2DY8A 4A3EB 1XXGA 1IW7D 1PZKD 5I9PA 5KYIA 5JOBA 1TT2A 1U9RA 4ILWA 1MSHA 3AB9A 2IT1A 3BVZA 4BY7B 4KY5A 2KEDA 4NKLA 3RZDB 3QJYA 4LAAA 1E0BA 4PQXA 1SEBD 5DAUA 3A55A 1DYQA 1DOMA 4EQNA 1WCMB 4BWGB 3CKIB 3GTGB 4DU9A 3QG1A 2HCCA 2NVTB 3E6ZX 1EZ6A 2RDHA 5BN4A 1A2TA 2FJ2A 2DY7A 1BF4A 2EYPA 4DNRB 1O7LA 3Q6SA 1GUTA 2E2HB 1RJTA 4G7ZC 3GV3A 4KY7A 3R2IA 3HOXB 4BBRB 1H9SB 2A5HA 1ET6A 3SK5A 4A93B 4XT3B 2XNAC 1KDCA 1BO0A 3S17B 1XTCD 2XRQD 3NWSA 4V0BA 1A2UA 5EBCA 1JWUD 1DZ1A 2V4DA 1S4ZA 4XIGS 2H4OA 2J7ZA 1CA5A 3GTQB 5DEHA 4RCOA 3T53B 3MA2B 1PXUA 5EKKA 2N55A 3FPUB 1LTSD 3HGBA 2EPBA 3I73A 4ZYSA 3TZDA 1Q3LA 5JPNC 1LT4D 4PMBA 1CHQD 2X6LA 3P75A 1CFMA 4WRDA 4CJ1B 1YNJC 2M00A 5FO8B 1V1OA 3S1NB 2F0QA 5ELEA 2N88A 1WTQA 1DOLA 1OXTA 4PMWA 3HEJA 4LJZC 5D3IB 4ID6A 1DM0B 3J7AV 1STAA 1ENAA 3RMHA 2SNSA 5C0XI 4DK0A 2JEAI 3PUYA 5IT9E 4NP5A 1KNAA 5E4XA 1EQTA 5CV7A 3OHXC 5JPMC 4IFDJ 1WTOA 5E4WC 2KJXA 1SNCA 1SNPA 1O7YA 2B2YC 5A2QE 4ZUJA 5J22A 2ICEC 1QILA 2CW0D 1FD7D 5CV9A 2NVQB 2R92B 2I46A 1D5ZC 5KYLA 4A3KB 3RZOB 3OMGA 2K5QA 1ML0D 1QCBD 2BE5C 5FK9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJZ A;  4R9W A;  1DON A;  2FFK B;  4HAE A;  1EIH A;  2K01 A;  4NW2 A;  4O42 A;  2KUM A;  1QNK A;  5EPK A;  1F9P A;  2RVL A;  1WTR A;  1HUN A;  2X6G A;  1PDQ A;  1WD0 A;  4CJ0 B;  5T1I A;  1ZXT A;  1PFB A;  3FDT A;  1WD1 A;  1HA6 A;  1SAP A;  4CJ2 C;  2L9H A;  3F2U A;  4QUC A;  2B2W A;  1DZ1 A;  3D6W A;  2L11 A;  1PFN A;  2IL8 A;  1S4Z A;  1GUW A;  2KVM A;  4HED A;  2J7Z A;  1CA5 A;  1F2L A;  1IKM A;  5CMD A;  1SSO A;  1G2S A;  1MGS A;  2RA4 A;  3UI2 A;  1AZQ A;  3GV6 A;  1B50 A;  4LMQ D;  1HRJ A;  4ZLT F;  3QO2 A;  3KBX A;  1VMP A;  4XDX A;  1J9O A;  1VMC A;  2NYZ D;  2KOL A;  5T1G A;  2N55 A;  1ROD A;  3FPU B;  2M2L A;  1NR2 A;  1TVX A;  4OIK A;  1HHV A;  1RHP A;  1B2T A;  1HFG A;  1WVL A;  1ILQ A;  4RA8 A;  1J8I A;  3P7J A;  4R8I A;  1M8A A;  4DN4 M;  1NAP A;  2EPB A;  2RSO A;  4X3T A;  2CVR A;  3TZD A;  1CA6 A;  1MI2 A;  1X3Q A;  2B2T C;  4IUQ A;  1HFN A;  2FIN B;  1ICW A;  2MPM A;  4RWS C;  3TN2 A;  4U68 A;  2L12 A;  1Q3L A;  2B2U C;  2EE1 A;  2HDL A;  1QG7 A;  2JYO A;  2Q8T A;  4ZK9 B;  5CBA E;  2X6L A;  1IKL A;  1X32 A;  2Q8R E;  1F9R A;  5COY A;  2L4N A;  4CJ1 B;  4HSV A;  2MGS A;  3I3C A;  3SVM A;  2B2V C;  4HCS A;  4IUU A;  2DY8 A;  2EOT A;  2SDF A;  3R93 A;  5EPL A;  2R3Z A;  1ILP A;  1CM9 A;  2K05 A;  1RTN A;  3IL8 A;  3I8Z A;  2XIW A;  1U4P A;  2FHT A;  2N88 A;  2RSN A;  1WTQ A;  1DOL A;  1MSH A;  4IUV A;  1RTO A;  2NWG A;  1U4L A;  3KUP A;  1WTP A;  2K1B A;  3G7L A;  3LWE A;  1MSG A;  2KED A;  1F9S A;  1E0B A;  1LV9 A;  4X3U A;  4ZAI A;  4QUF A;  1PLF A;  5EKI A;  1DOM A;  2BDN A;  2K04 A;  1IL8 A;  2KEC A;  1NCV A;  4IUR A;  1JE4 A;  1XX8 A;  4X3K A;  5CBE E;  3HP3 A;  2K03 A;  2B2W C;  2L1B A;  5EPJ A;  2HCC A;  1WTW A;  1X3P A;  1KNA A;  1EQT A;  1NR4 A;  5E4X A;  2VXW A;  5D65 A;  4ZKB B;  1AZP A;  2NZ1 D;  2D9U A;  1HUM A;  2MJ8 A;  1PFM A;  1B53 A;  1WTX A;  1BNZ A;  3DEP A;  1A15 A;  1ESR A;  1B4O A;  2B2T A;  2K28 A;  4OIJ A;  5D14 A;  3MTS A;  2KEE A;  1B3A A;  3MWY W;  1U4R A;  1WTO A;  4UAI A;  5E4W C;  1EOT A;  2B2U A;  3ONA B;  4IUT A;  3DM1 A;  3I91 A;  2HUG A;  1O7Y A;  2B2Y C;  4IUP A;  4MHE A;  4MN3 A;  1O7Z A;  5EJW A;  1EL0 A;  2FJ2 A;  2B2V A;  5COR A;  2DY7 A;  2MP1 A;  1DOK A;  1BBX C;  2H1E A;  3N52 A;  1BF4 A;  3Q6S A;  1KNE A;  1RJT A;  1G91 A;  3GV3 A;  3DEO A;  3H91 A;  4X3S A;  1QE6 A;  4XT1 B;  1G2T A;  1SDF A;  1XYI A;  1U4M A;  2X69 A;  2HDM A;  1F9Q A;  3I90 A;  1O80 A;  1ML0 D;  4RAU C;  5EQ0 A;  4ZKC B;  1G6Z A;  1C8C A;  5DNF A;  4XT3 B;  1EIG A;  1JIC A;  3IFD A;  1WTV A;  2FMM A;  2HCI A;  1AP0 A;  2B2Y A;  1BO0 A;  2JP1 A;  5AFW A; 
#chains in the Genus database with same CATH topology
 1DON A;  3HOV H;  2OQK A;  2LFN A;  4K2K A;  5HUR A;  1I4P A;  4FXK C;  2BOS A;  4HID A;  2L11 A;  1X54 A;  2F0D A;  2NZO A;  2D0O A;  2ZT9 C;  2UXB Q;  1Y14 B;  2D62 A;  3UI2 A;  2IPK D;  3K8A A;  4DR7 L;  4YY3 Q;  5M5W B;  3HOV G;  3HKS A;  4P75 A;  2VY3 A;  2F0U A;  5BR8 L;  4GZY C;  4K6D A;  4KV6 A;  4DV2 Q;  3NBH A;  1KIX A;  3HOW B;  4L5R C;  4DNI A;  4RH6 A;  2D5D A;  1JWM D;  2N8N A;  4X6A H;  4DKA C;  2CVR A;  3DUZ A;  2OT2 A;  3E9I A;  3PUZ A;  2B2T C;  3TP7 A;  2DJF C;  5JJI A;  2YU9 B;  1AE3 A;  1JCK B;  1HZA A;  5LMN L;  1T5E A;  1IKL A;  3JAM E;  3KF8 A;  3SVM A;  1IZ6 A;  3I3C A;  4IPC A;  4ABN A;  1WJJ A;  1GUS A;  2PO4 A;  1I4Q A;  5JJK A;  5KND A;  1TR5 A;  4JI5 L;  3IL8 A;  4JI7 L;  3FMC A;  2WB1 B;  1XNR L;  2R6G A;  5EKL A;  1EWI A;  1IBL Q;  3KLS A;  4A3I H;  3D4R A;  4I65 A;  1BQQ T;  4PMC A;  4RKL A;  1CKM A;  4B3S Q;  1CT1 D;  3FHW A;  2K32 A;  3NEN A;  1KC8 C;  4B3M Q;  4POG A;  5M5X H;  2Y0S B;  3QR8 A;  2JSO A;  1IL8 A;  1C7Y A;  4A76 A;  2KEC A;  2KCT A;  4TKO B;  1ZEQ X;  3NPP A;  1BXT A;  1LTG D;  2B2W C;  3D8G A;  3V05 A;  1KXL A;  3IRB A;  2CH4 A;  1QUQ B;  3G71 A;  5I4D A;  1PYS B;  1VQM A;  1JMC A;  2ZTD A;  3TRE A;  5D14 A;  5DLQ E;  4PV1 C;  1U4R A;  4LUV A;  3VDY A;  2ICI A;  1PH4 A;  1STG A;  3CQZ B;  3U4Z A;  3GTK B;  3BVG A;  3TEH B;  1FNV A;  1VQI A;  4CGY B;  5LMU L;  1TU2 B;  4HJ8 A;  2H1E A;  1SNM A;  2PZW A;  4C2M B;  4LF5 Q;  3J7Y W;  2K50 A;  4AYB E;  1Z6H A;  2F0I A;  1STY A;  2JA5 B;  3QB3 A;  2DUD A;  1I4H A;  1IL2 A;  4ZKC B;  3A5U A;  3IFD A;  4R8N A;  1I50 B;  3S15 B;  3VYR A;  2EYM A;  4FF4 A;  2B29 A;  1F2Z A;  4H13 C;  2JA7 H;  2ATW A;  1B8A A;  4O1N A;  3G6E A;  4MTN A;  3EJI A;  4KMU C;  1Q12 A;  1SN8 A;  3VYU A;  2L9H A;  1HA6 A;  1VQK A;  1EY7 A;  1FJG Q;  3TQY A;  2E2J B;  3BYY B;  4A3D H;  4WFN 3;  3CD6 A;  1VQJ A;  1SMY C;  1VQB A;  5BN3 A;  3C46 A;  3NQT A;  3BVM A;  1TS2 A;  1VMC A;  2KOL A;  1CHP D;  3CHB D;  1SYB A;  2UXC L;  4A3F H;  3GTM H;  4R8I A;  1M8A A;  4ME3 A;  2EY2 A;  4H02 A;  2RSO A;  4G57 A;  1VQ9 A;  2RDF A;  1L1O B;  2Z4I A;  2EXZ A;  1RKN A;  4HJ5 A;  4A3D G;  3CME A;  2WKC A;  4F87 A;  4JBW A;  1YIT A;  3HG9 A;  1NJI C;  2NN6 G;  2B8F A;  4A3F G;  4FF3 A;  3BDL A;  1CM9 A;  1QJO A;  1ZYR C;  2K05 A;  2L5T A;  2EJF C;  2GN5 A;  3H0G B;  2WP8 J;  1FVI A;  1BKB A;  1RTO A;  4GLV B;  4MNO A;  3LGJ A;  4A3M G;  4IAL A;  1LLR D;  1OXX K;  2GVA A;  2K33 A;  2RDG A;  1FGB D;  1AE2 A;  5J1Z A;  1PRT F;  3SXH A;  2JA6 H;  4P74 A;  1YNJ D;  4LFC Q;  3F2C A;  1I4X A;  2VXW A;  1L0Y B;  3MXP A;  4K0K Q;  3CMA A;  5M3F H;  1SBB B;  1EU4 A;  4AYB G;  3VR5 A;  3S9W A;  5JAV A;  5GAD C;  4JBK A;  2B2U A;  2F0J A;  5JEA J;  2JA6 G;  2XGT A;  1EL0 A;  3T1H L;  1XMO L;  4ZRZ A;  1NMF A;  3HOU B;  4PZ7 A;  4KHP Q;  1GXD C;  1VF5 C;  3G6J B;  1N34 Q;  2KEN A;  1RDP D;  1HR0 L;  1IHZ A;  2YV5 A;  4E6I A;  1R9T H;  5EQ0 A;  4LF4 Q;  1P16 A;  2BH2 A;  5DNF A;  1EIG A;  2NVX B;  4B3R L;  3UDF A;  3J81 i;  4NPS A;  4DAY A;  1AP0 A;  2Q2H A;  5IT9 L;  4NW2 A;  4O42 A;  5C5M A;  2VNU D;  1TWG B;  4RGN A;  3J7A 5;  3FDT A;  3S14 B;  4C3H H;  3GQB A;  1AH9 A;  3E0J A;  4G7O C;  4K5W A;  4YHH Q;  5A2Q L;  5C44 B;  3EIV A;  1C4Q A;  2NYZ D;  1HNZ L;  2BCO A;  5CV8 A;  5KNC A;  2UXB L;  3PF4 A;  1HQR D;  2BE5 D;  1ILQ A;  1SFO B;  3FVQ A;  4UP9 A;  1I4G A;  4PZ6 A;  2MNA A;  2E74 C;  2KA7 A;  3I4L A;  3CRK C;  1D5X C;  2Q8T A;  4DR4 L;  3MXN A;  2XN9 C;  3H3V I;  3T51 B;  1E3P A;  2WIN B;  1UEA B;  3RD4 A;  2R7Z H;  3E3X A;  4CKE A;  4OO1 H;  3J81 E;  1Y1V H;  4FVM A;  2ZXR A;  3A8J E;  2IY5 B;  4IUV A;  2NVY H;  4DAM A;  3G7L A;  5CV5 A;  2F3I A;  4TRD A;  4UPA A;  1J5E L;  1IBL L;  1I6H B;  2Z4H A;  2IX3 A;  2LXJ A;  3M4Y A;  1HZB A;  4OO1 G;  4QMG A;  1Y1V G;  1NCV A;  4B3S L;  1JJG A;  1MJC A;  2EVB A;  1SR3 A;  1NUC A;  4A3J H;  4LUZ A;  1SE2 A;  1NR4 A;  1K83 B;  1K8G A;  2NZ1 D;  4L63 B;  1PFM A;  4DV4 L;  2OCE A;  3I4N B;  5I2Y A;  1BNZ A;  2PI2 A;  3HKZ E;  3JAM L;  1EQR A;  3I55 A;  1CZG A;  4R1J A;  1EOT A;  1UWV A;  2ZTC A;  2E75 C;  1IBK Q;  3GTL H;  3VA7 A;  1NE3 A;  3GTP B;  4A3C H;  4A3J G;  4MIU A;  1NBW A;  3OTO L;  2E2I B;  4A3B H;  1EQQ A;  3RR5 A;  1GUN A;  2MO0 A;  1X3F A;  4LF5 L;  1RIP A;  5K36 G;  1A8V A;  3NWT A;  1YNX A;  2G5D A;  4HIO A;  1JT8 A;  4LF7 Q;  5AFW A;  4HJ9 A;  4A3C G;  1D6E C;  1X3E A;  1QNK A;  2DNC A;  4A3B G;  3D0F A;  5M5Y B;  4H44 C;  1SAP A;  4CJ2 C;  1QOH A;  3F2U A;  3VR2 A;  4JI3 L;  1Q7Y C;  2N3S A;  3L3O C;  4A4I A;  1EYG A;  3CCQ A;  1HRJ A;  1EYC A;  2WV6 D;  1EU3 A;  3M4O H;  3TRZ A;  4B08 A;  3S2D H;  2KBN A;  3AYH B;  1CKO A;  2F0T A;  4C3J G;  1STH A;  5C6A A;  5I6Y A;  5IYC G;  3W1G A;  3S1Q H;  2ZJQ A;  2QDB A;  4RWS C;  4Q5V A;  3PUX A;  1SYG A;  2EE1 A;  1I3Q B;  5COY A;  4QY7 A;  2IHF A;  2EYL A;  4FYD A;  5J3B A;  3W3A A;  4KTA A;  1K8M A;  4JI4 L;  2VB3 X;  4HTH A;  1TWH B;  3Q22 A;  3S1M H;  1SMY D;  4RGO S;  3T16 A;  1U4P A;  1B70 B;  2GA4 B;  1Q46 A;  2F03 A;  3CAM A;  1L0X B;  1OO9 B;  2XRS D;  1TQO A;  5LMN Q;  3CCU A;  1AEX A;  2K52 A;  3K5M A;  4JG2 A;  5E7N A;  1EWH A;  2MFI A;  3HKZ G;  1PLF A;  2TMP A;  3GTJ B;  4JI7 Q;  1PH1 A;  4IUR A;  4CDF C;  1XNR Q;  1SYC A;  3S1R B;  4C1N K;  2AKW B;  2G9D A;  2L1B A;  4K8I A;  4NB3 A;  4YCW A;  2M9V A;  1JB7 A;  2MJ8 A;  3RLF A;  1GUO A;  5LHY 1;  3AQQ A;  3WOE A;  1ZYR D;  4OGQ C;  1M90 C;  5IOD A;  1HR0 W;  3FEW X;  1HCZ A;  1I4R A;  2K14 A;  4HMJ A;  3DM3 A;  5F2D A;  1V8Q A;  1IBM L;  2QW7 A;  4BY1 G;  2UUA L;  2ENB A;  1EFW A;  4DK3 C;  4M8A A;  1QVG A;  1QZG A;  1G2T A;  4OXP A;  4KHP L;  1N34 L;  4OEM B;  2Z1C A;  1F2Y A;  3PO3 H;  3BDC A;  2JP1 A;  1EQV A;  4KN4 C;  4R9W A;  5LMU Q;  2DJG C;  5C4X G;  1KLU D;  4P72 A;  3J7Z C;  2Q8I B;  1PFB A;  3GTO H;  2OWO A;  1NSN S;  3TSS A;  1KDA A;  1IKM A;  5CMD A;  5ELC A;  4EQP A;  4G7H C;  4P2C B;  3UE0 A;  2NZH A;  3KBX A;  2A19 A;  4A3I B;  1U0L A;  3WWV A;  3AFQ A;  5IP9 H;  3VR3 A;  2NTT A;  3STB D;  4Y7N H;  2M2L A;  1NR2 A;  4OIK A;  2F3V A;  3E0E A;  1NTG A;  2RQX A;  3IKJ A;  1GO3 E;  3H15 A;  1IYU A;  4BXX H;  3P20 A;  3H3V C;  4X3T A;  1CA6 A;  1KLG D;  5M5X B;  1AN8 A;  4DF7 A;  1EY0 A;  3BZK A;  2EYH A;  2B2U C;  3KDF A;  2JYO A;  1X32 A;  2D2C C;  5I2X A;  2R93 G;  4HSV A;  3NBH B;  4F88 A;  4FXD A;  5C3X A;  3H09 A;  1W6J A;  3R93 A;  5K5P A;  2UXC Q;  4PNY A;  4BXX G;  1VQ4 A;  1B9N A;  1A3U A;  1DD2 A;  2RSN A;  3KJP A;  2Q2U A;  1X6O A;  4GLX A;  1B9M A;  1BUV T;  1K28 A;  3EN2 A;  5JJL A;  2LXK A;  3KF8 B;  3K81 C;  5JEA H;  4QUF A;  3RN5 A;  4O2D A;  3T56 B;  5CV4 A;  5I9O A;  2XWJ B;  4L5Q A;  1WTW A;  1PH7 A;  5D65 A;  2VS1 A;  3K59 A;  2JA7 B;  1E1T A;  1KHI A;  2CH4 W;  4QGU A;  1JOK A;  5JEA G;  1XTD A;  4Q0F A;  4XTC S;  2F0W A;  4KKS A;  2N49 A;  1Y1W H;  4M1U B;  2NBF A;  4MN3 A;  4YWK A;  3J81 L;  5COR A;  3CF5 A;  4A3D B;  4LFB L;  1DCZ A;  5TSS A;  4UDU C;  3URY A;  1IBK L;  4BA1 I;  1YNN C;  1LTL A;  5CYU A;  2F0P A;  4RAU C;  4A3F B;  3GTM B;  3C3L A;  2NTS A;  1L1O C;  1EFI D;  3NTH A;  2FMM A;  4JBJ A;  1SMX A;  4NMZ A;  5JJZ A;  2NUC A;  3T1H Q;  2Q2T A;  1BBW A;  2VUM G;  3AU7 A;  1LTI D;  2X6G A;  1PDQ A;  3K7A H;  4IQZ A;  1E2V A;  1LTR D;  1HR0 Q;  4LF7 L;  3QWN A;  3W2D A;  4L6T B;  1W2B A;  2PPB C;  3PUV A;  2L15 A;  1LM0 A;  1S5D D;  4B3T L;  4B3R Q;  1MGS A;  3BYT B;  1IXR A;  4HCE A;  3NE5 B;  1Q1E A;  4GN5 A;  4Y52 H;  4XDX A;  4R4I A;  4U67 3;  4P71 A;  3CCS A;  1TII D;  2VQE Q;  4DAV A;  5I6W A;  5FO7 B;  3DWA A;  3L0O A;  4RA8 A;  3P7J A;  3QIA A;  1FNU A;  1NAP A;  1HFN A;  2LY7 A;  2XSC A;  4IUQ A;  2JA6 B;  3TN2 A;  4U68 A;  5DM6 3;  1VQP A;  1XPO A;  1PH8 A;  4ZK9 B;  1P8L A;  1F9R A;  1EYD A;  1S72 A;  3K0Y A;  5M3F B;  1HNZ Q;  3D4W A;  1H9J A;  2EOT A;  2JK8 A;  3E5S A;  3C1E A;  5IYB G;  3ULJ A;  4RHS A;  2WFW A;  3PIP A;  3I8Z A;  4A3E H;  1LT5 D;  2K4K A;  4C3I G;  2J4X A;  2B63 B;  2QGQ A;  2IW3 A;  4DR4 Q;  1X55 A;  2AQ1 B;  1EOV A;  3IFT A;  4DR2 L;  1G29 1;  1R9T B;  4A3E G;  2E8G A;  1PYW D;  4F7X A;  3C2P A;  1CZW A;  4DPG A;  1L0W A;  1NNX A;  5FLX L;  4FF2 A;  2PW5 A;  2FXQ A;  4N8F A;  5C4H A;  4BY7 G;  3DLL A;  2AWO A;  4OIJ A;  1AW7 A;  1J5E Q;  2UU9 Q;  4J15 A;  2K5N A;  1B3A A;  4PZ8 A;  5H1S E;  4C3H B;  5JVH 3;  1EY8 A;  4MZ9 A;  2H5X A;  2HUG A;  2ASB A;  4J8Q A;  1WCM G;  1KNE A;  5IP7 G;  3CCV A;  1QE6 A;  1Y8N B;  5C4Z A;  1SE4 A;  4DV4 Q;  2BH8 A;  2X69 A;  1G6Z A;  3SK4 A;  1CI3 M;  2PCF B;  1TWA H;  3BZC A;  4GKK Q;  3J7A F;  1LUZ A;  5EPK A;  1SYD A;  2RVL A;  3OTO Q;  2SEB D;  3MXU A;  3PV0 A;  3RLN A;  3MAQ A;  1PRT C;  1Y8P B;  1RD9 D;  3MXG A;  3EBE A;  1YBY A;  1PFN A;  3PIO A;  2R7Z B;  1YJW A;  4DUZ L;  4DR6 Q;  4HED A;  4DAY B;  5FLX c;  4RGT A;  1UUP A;  1Y1V B;  3PUW A;  1KL9 A;  4LMQ D;  1MD2 D;  4ZLT F;  1MIU A;  3NXW A;  1DGS A;  2NVY B;  4NXN L;  4R4C A;  1TKW B;  1ROD A;  4JV5 Q;  4JI3 Q;  4DV1 L;  5FKA C;  2K5W A;  1A6X A;  1UE7 A;  1BVS A;  4R4T A;  3M3Y H;  4YCV A;  4A3J B;  4X64 Q;  1BBU A;  2Q8R E;  4IJH A;  2KHJ A;  4JC0 A;  2ZXP A;  2HHH L;  1XPU A;  1RTN A;  4B9X A;  5HGT A;  1EY6 A;  5IWA L;  5IYD H;  4DR5 Q;  2NN6 H;  3X3M A;  2JA8 H;  1VQC A;  3GTL B;  2JN4 A;  1FR3 A;  3MXN B;  4QQB X;  2VW9 A;  3MC0 B;  1LV9 A;  1TS3 A;  3HOZ H;  3D4D A;  4JI4 Q;  1S5B D;  2JA9 A;  4A3M H;  4OEL B;  5IYD G;  1VQF A;  5KIX A;  2BA0 A;  3A8K E;  2LMC B;  2NN6 I;  3SGI A;  2JA8 G;  3SK6 A;  1WTX A;  4IJL A;  2HT1 A;  2F1M A;  1A15 A;  1ESR A;  3K5N A;  2VL6 A;  4XQQ A;  3HOZ G;  2ALY B;  1ICF B;  4QB4 A;  2WB1 E;  5EJW A;  1GD7 A;  3KBG A;  1SE8 A;  1LO5 D;  3N52 A;  1BCP C;  1JB3 A;  2RF4 A;  3D3R A;  3SR1 A;  4CHT B;  3M4O B;  2B8G A;  5D3D A;  2CHB D;  2F0V A;  3U9O A;  1QVF A;  5C3E H;  3OOC A;  4QCL A;  5HGQ A;  4UHV A;  3KLR A;  2WAC A;  2Y0S E;  3PQI A;  3S1Q B;  1QB5 D;  4JVZ A;  1IBM Q;  4CKC A;  1F9P A;  1JWS D;  3TP8 A;  2UUA Q;  3K5O A;  1U5K A;  4KD4 A;  5T1I A;  5C3E G;  3ITP A;  1B7Y B;  3HS0 C;  2IL8 A;  2QIL A;  3S1M B;  2I0Q A;  2IJ0 A;  1G2S A;  1II3 A;  5E1F A;  2HIX A;  3R3O A;  1QVC A;  4QL5 A;  1YNN D;  2C35 B;  3STB C;  1K3R A;  3M9B A;  3F2D A;  3C1F A;  3DWQ A;  4C1N I;  1HHV A;  4XQN A;  2DN8 A;  4DN4 M;  2EQS A;  2F0O A;  3MFG A;  2VQE L;  2FIN B;  1N8R C;  2AUK A;  5C0X J;  2L4N A;  3KOJ A;  1CKN A;  1EYA A;  2F0N A;  1JE5 A;  3ULL A;  4DXF A;  3N6R A;  1X9N A;  1STN A;  4JI2 Q;  1AFP A;  2A73 B;  1SYE A;  1L2F A;  1ILP A;  2SOB A;  3HOW G;  5A35 A;  3VA5 A;  1UE1 A;  3O13 A;  4QIW E;  1STE A;  5LMN W;  3K58 A;  2QF7 A;  3KUP A;  2G9H D;  1SRU A;  4QJF A;  3VYT A;  1C9O A;  1F9S A;  2ZTE A;  5DM7 3;  4X3U A;  5CGK A;  2KQ3 A;  4KN7 C;  2EY1 A;  2HIV A;  3GP7 A;  1BCP F;  4OHJ A;  3PO3 B;  3NUC A;  1PRT B;  2WB1 G;  1PZJ D;  3RLO A;  3PIP 3;  3ERQ A;  3Q23 A;  2KHI A;  3NP8 A;  3GTO B;  3BDO A;  4IFD H;  3P1H A;  3ND9 A;  3CW2 C;  4CDC C;  4IUP A;  2IX0 A;  1O7Z A;  1TWF H;  2UU9 L;  1VS0 A;  2B2V A;  1B1Z A;  1SRO A;  4JOI A;  4J6H A;  2WAQ B;  1YIJ A;  1TWC H;  2LSS A;  2F0E A;  1XJV A;  4OO1 I;  4HSP A;  4I7A A;  4GNX A;  1O80 A;  1S5E D;  1JIC A;  4K8J A;  2K5V A;  4IFD G;  1V43 A;  1WTV A;  2F0L A;  2B2Y A;  1G6P A;  2LKV A;  2A6H C;  4LFB Q;  1HQM C;  1E2Z A;  1WTR A;  5K36 H;  1Q8I A;  3OW7 A;  4A3G H;  4WOR A;  4ZCK A;  3TDQ A;  4CJ0 B;  2VZA A;  4GKK L;  3A8I E;  2KVM A;  1PH2 A;  2K75 A;  5GAE C;  2KHS A;  3QO2 A;  4DR6 L;  4HN7 A;  4A3G G;  4DK1 A;  2GVB A;  3UDX A;  3CCM A;  4K14 A;  1PTO H;  1GHJ A;  3SEB A;  1IYJ B;  3Q8D A;  3J80 c;  4B3T Q;  3PO2 H;  1HA5 A;  2E5L L;  3U9S A;  3AMU A;  4IPH A;  2PW7 A;  1OXS C;  5AJ3 Q;  1N32 Q;  1X3G A;  3MVV A;  1PRT D;  1YHQ A;  4C3J H;  4JV5 L;  1PH3 A;  5IYC H;  4DA2 A;  4DV5 L;  1UNS A;  5KGU A;  2SDF A;  5KNB A;  1YEZ A;  5ISR A;  2R3Z A;  1D8L A;  4X64 L;  1RCV D;  2XIW A;  1BCP B;  1Y1W B;  4GLA C;  3PO2 G;  3U4V A;  2YTV A;  3H6M A;  3KDF B;  2EY6 A;  2JEB I;  3F8T A;  2HQE A;  1MSG A;  4MTK A;  2EY5 A;  4KKU A;  1SJH D;  4DR5 L;  1OXU A;  4RKB A;  3I2Z A;  4ZAI A;  2B39 A;  5FLX E;  3E9H A;  3HZX A;  2EJG C;  4LNQ A;  1JE4 A;  2KCM A;  2BDO A;  3HP3 A;  3M7N A;  1KDB A;  3SDZ A;  1KTK A;  2E76 C;  2D9U A;  2UUB Q;  4H0L C;  3DEP A;  3K7A B;  4DUY L;  3R2T A;  1WTH A;  4DR2 Q;  5L37 A;  3I91 A;  1HNW L;  3CU7 A;  2WKD A;  4KY6 A;  1DOK A;  3X3N A;  2F0F A;  2PQA A;  5M3M H;  4FNF A;  1VF7 A;  1TS5 A;  5C4J H;  2IX1 A;  3K5L A;  3S16 H;  1EUJ A;  2ZJR A;  3ZJY C;  5GAG C;  4BY1 H;  3HOV B;  3K7U C;  1A3V A;  4TSS A;  4A75 A;  4LF8 L;  3DHQ A;  4YIJ A;  5IGF A;  5IY0 A;  3KLS X;  2KUM A;  3L7Z C;  4KD3 A;  4EGV A;  4KHV A;  3PMF A;  2BA1 A;  4TVA B;  5M3M G;  5GAH C;  2Z9H A;  1PMR A;  3LWU A;  2OTJ A;  1EIF A;  2MHV A;  2A68 D;  4JW0 A;  2I07 B;  5C4X H;  2EYO A;  1SSO A;  1HH2 P;  1BCP D;  3CC7 A;  5IGC A;  2PNH A;  2DNE A;  4GS3 A;  1B44 D;  3CC4 A;  1SXT A;  3ER0 A;  4KJO A;  3MEH A;  5ELB A;  3OWF A;  2R7F A;  4LWC A;  3ERO A;  3V96 A;  2Z6K A;  5C44 H;  2I5H A;  5KEE A;  4R4O A;  1I94 L;  2PMZ E;  2B3G A;  3NTK A;  4DR3 L;  1VQD A;  2O4X A;  1MI2 A;  4DUZ Q;  1C0A A;  4DV7 L;  1EY9 A;  4B9W A;  2L12 A;  1LT3 D;  5IIF A;  3BG3 A;  3WOF A;  1W3S A;  3F1Z A;  4NXN Q;  2EYJ A;  4HCS A;  3K0X A;  5C44 G;  3ERS X;  5FLM G;  3G48 A;  2CWA A;  1JJ2 A;  3CC2 A;  1K8O A;  1WI5 A;  2R93 H;  2CQA A;  4DV1 Q;  4TQU S;  2MUY A;  4IOC A;  1VQ6 A;  4JI2 L;  5NUC A;  1U4L A;  3DMU A;  1X56 A;  5LL6 S;  1MKH A;  1KAB A;  1OXV A;  3CCE A;  2HHH Q;  3I70 A;  1DXM A;  5G3L F;  1IYV A;  1O78 A;  5IWA Q;  4QF4 A;  1SND A;  1TWA B;  1LTA D;  3HRZ C;  1B53 A;  1TY2 A;  5EGT A;  4JBM A;  2ID0 A;  2N78 A;  4X62 L;  1VQO A;  1R4Q B;  3KYH C;  1V1P A;  4XXE A;  1GJX A;  3AEV A;  3I4M H;  2AWN A;  4LFA L;  4JK1 C;  4O0A A;  4N9T A;  3CCJ A;  1EEF D;  1F9Q A;  1GM5 A;  4KK7 A;  5ELD A;  5GQO A;  3GO5 A;  3ZYY X;  3LNN A;  4C56 C;  3Q0A A;  3I4M G;  2FFK B;  4OL7 A;  1JC7 A;  1KAW A;  3BZD B;  3M3Y B;  1HTP A;  1STB A;  4XQJ A;  4BBS H;  4P73 A;  1WD1 A;  2A6E C;  1Y69 U;  2R61 A;  4QUC A;  3S2H H;  3FKI H;  2VUM H;  1F2L A;  5C0X H;  3CPW A;  1Q90 A;  1B50 A;  2QKI C;  1JR0 D;  2RCF A;  2JA8 B;  1VMP A;  1R4P B;  4CDE C;  2EDG A;  1VQG A;  4JI6 L;  1J9O A;  1LAC A;  1OTC A;  1G8Z D;  4BBS G;  1YVC A;  2OEO A;  1N33 L;  1J8I A;  3J80 i;  3HOZ B;  2CQO A;  3FKI G;  5C0X G;  1X3Q A;  2A6H D;  2F0K A;  1F2M A;  4A3M B;  1ICW A;  3GD7 A;  4UP7 A;  3ULP A;  2A69 C;  1PTO C;  1BR9 A;  1I6V C;  1Z47 A;  5ELF A;  2B2V C;  1M1K C;  4IUU A;  4I7Z C;  5IOC A;  5AJ3 L;  4JOI C;  1N32 L;  4HJ7 A;  5HY6 A;  3OYY A;  1NMG A;  4KLK A;  2PQE A;  4GOP A;  2A74 C;  5IE8 A;  4GNX C;  3A5Z B;  1PFS A;  1WTP A;  3RN2 A;  1TS4 A;  2K1B A;  2K7V A;  4AYB B;  1Z9F A;  3LWE A;  4OON A;  5IYB H;  3K57 A;  4LF9 L;  5IGD A;  4C3I H;  1QNU A;  2PNR C;  5C3E B;  2Z0S A;  3OW2 A;  4L8J A;  2F0G A;  3HOY H;  1XWE A;  1PV4 A;  2CFM A;  3KLW A;  4ZKB B;  1S5C D;  1T5X D;  3A7L A;  2F3W A;  1TY0 A;  1D7Q A;  2LS0 1;  2IWH A;  3W1B A;  1PH5 A;  4CBV A;  1B4O A;  2K28 A;  4JCV E;  3MTS A;  2KEE A;  2J0T D;  4DV3 L;  4DR1 Q;  1H9S A;  1TXY A;  3J80 E;  1PA6 A;  2VB2 X;  2RHS B;  4S3S A;  3KFU A;  1PH9 A;  2UUB L;  4KJN A;  1N9W A;  1JJC B;  4JI8 Q;  4MHE A;  3HOY G;  4DFA A;  4BY7 H;  3DWP A;  3RZD H;  1J6Q A;  3I72 A;  1C48 A;  3DEO A;  3H91 A;  2EYF A;  1V1Q A;  2OXP A;  4IN3 A;  4RGM A;  3A0J A;  1CTM A;  2O5I C;  2YTY A;  1RL2 A;  3I90 A;  4N9P A;  3CPF A;  4OWT B;  2YYZ A;  1WCM H;  1M4V A;  5IGG A;  2F0S A;  3GTG H;  5IP7 H;  2F52 A;  2JQO A;  3KF6 A;  3CXC A;  2NVT H;  3BS1 A;  1GUG A;  4GKJ Q;  2QCP X;  5IGE A;  1K8A C;  3WDN A;  3OIQ A;  1LTT D;  3D6W A;  5G3L D;  1UEB A;  4RFB A;  1Q82 C;  1PTO F;  1N36 Q;  3GV6 A;  2E2H H;  4RHR A;  3EFX D;  5ELO A;  1A63 A;  3HOX H;  4DGZ A;  4BBR H;  1K0R A;  4EVO A;  1D5M C;  3KJO A;  1WVL A;  4A93 H;  4JI1 L;  1SLJ A;  1D1I A;  3FP9 A;  3S17 H;  1K9M C;  3M4Q A;  4RCN A;  1H9K A;  4NXM L;  3J81 j;  2HDL A;  5CBA E;  1W6K A;  1A0I A;  1VQA A;  3HOX G;  4BBR G;  4A3I G;  3KK7 A;  3TZU A;  2WII B;  5IGB A;  4A93 G;  3GTQ H;  4L5T A;  2NB0 A;  1WYD A;  3T13 A;  1H9R A;  2L55 A;  3U58 A;  5GRO A;  4DV0 L;  1GVP A;  1TWF B;  2NWG A;  4HR7 B;  2E5L Q;  2PZU A;  4JYA L;  4FXG C;  4EQO A;  1JOR A;  1CKN B;  3LX0 A;  2KCN A;  4XYQ A;  1WOC A;  2JXM B;  1TWC B;  1HNX Q;  1GHK A;  4L5S A;  3CRL C;  4DV5 Q;  3S24 A;  2UXD L;  1VDZ A;  2BDN A;  3CCR A;  1PHJ A;  4FF1 A;  1JOO A;  3G4S A;  1XX8 A;  4X3K A;  2UUC Q;  5EPJ A;  2RKS A;  2O5J C;  2SNM A;  2XWB B;  1SNQ A;  4NDX A;  3BJU A;  5EBD A;  3S1N H;  4A3G B;  3M85 A;  3TME A;  1YHA A;  5BN5 A;  3GDE A;  4EQ5 A;  1XMQ L;  4KHZ A;  3SHL A;  3EQL C;  2Z6K C;  1ONL A;  2AQ2 B;  1I5F A;  4A3B B;  3QOL A;  1UE5 A;  4OX9 Q;  1HPC A;  4OWW B;  1MBY A;  1KAA A;  1FNW A;  4LK1 C;  4QIW B;  4X65 Q;  4UY8 C;  3H94 A;  2AQ3 B;  1SNO A;  1O7I A;  4X3S A;  4XT1 B;  3R8B A;  2Z6B A;  4IZ8 A;  1U4M A;  2VQF L;  2P5Z X;  4DUY Q;  2JA7 G;  3MZ5 A;  1PTO B;  2QEJ C;  2EZV A;  4GN4 B;  2K5D A;  3ICE A;  3PO2 B;  1HNW Q;  1JQY D;  1NY4 A;  3VR6 A;  1VCI A;  1SYF A;  2QA4 A;  1HUN A;  4C3J B;  2O2L D;  2Z8L A;  1HXY D;  1YJN A;  1WD0 A;  2ZM6 Q;  1FL0 A;  3B6Y A;  4GNX B;  2A68 C;  4BS9 A;  3NHH A;  3TBI B;  1CK1 A;  2HQL A;  5FOB B;  2OF1 A;  1S3O A;  1CSQ A;  1E1O A;  1E2W A;  1IW7 C;  2RA4 A;  1AZQ A;  4LF8 Q;  3NBI A;  4CKB A;  2ZXO A;  4V19 0;  1LT6 D;  2NVQ H;  3S2D B;  4FDB A;  2R92 H;  1ZKO A;  5FO9 B;  3NQI A;  4LF6 L;  4YCU A;  4A3K H;  3RZO H;  1TVX A;  3M7G A;  3SE0 A;  1RHP A;  2DGY A;  5CC4 A;  4DAP A;  3TP6 A;  1A3T A;  2MPM A;  4R4Q A;  4F8M A;  3NK9 A;  3HFZ B;  2A6E D;  2R92 G;  3HKZ B;  1LTB D;  1S5F D;  1QWY A;  3OSO A;  4DXG A;  4A3K G;  4XYO A;  3F2B A;  1XNQ L;  5EPL A;  1I94 Q;  3EA6 A;  1VQE A;  1ENC A;  5M9O A;  2XVS A;  4DR3 Q;  5M5W H;  4DV7 Q;  4KKT A;  1ENF A;  4YWM A;  2AUJ D;  1QUQ A;  3NTI A;  4AH6 A;  2F0H A;  3HOW H;  2B63 H;  2C9O A;  5KRU A;  2F4V Q;  2MO1 A;  5M3M B;  1EY4 A;  5C4J B;  4IO9 A;  3UE1 A;  3S16 B;  4K5V A;  3D6C A;  2A69 D;  5M3F G;  1MHW C;  4BY1 B;  1F77 A;  1PTO D;  2YU9 H;  1X3P A;  3IAY A;  4X66 Q;  2CWP A;  3K6O A;  1PYB A;  1HUM A;  1EZ8 A;  4OWX B;  2AHO B;  2B63 G;  3ND8 A;  1Y8O B;  4AQY Q;  3MWY W;  1EWC A;  4UAI A;  1T9H A;  2JE6 I;  4DNT B;  4GN3 B;  4IUT A;  3BU2 A;  3M4P A;  1V9P A;  4H7B A;  5C4X B;  3PCO B;  1ASZ A;  1JOQ A;  4DR1 L;  1FYC A;  3OWE B;  3TS2 A;  5CV6 A;  3AFP A;  3L9A X;  4IUN A;  4JI8 L;  3VR4 A;  1SDF A;  3A54 A;  2XTI A;  1EIH A;  2HDM A;  3H3V H;  3RUZ A;  1Z7T A;  4X62 Q;  2D0P A;  4YY3 L;  2EXD A;  4JI0 Q;  3OMC A;  1EEI D;  4ULL A;  4C3H G;  4HAE A;  4BA2 I;  2PQA B;  4K2L A;  1FGU A;  4DV2 L;  4GOP C;  1H9M A;  4LFA Q;  1E7Z A;  5LL6 X;  1ZXT A;  4APV A;  1LYL A;  2Y0S G;  4GKJ L;  2QDL A;  1KRT A;  1UE6 A;  3CQZ H;  1RF2 D;  4ME5 A;  1ASY A;  3J80 L;  3GTK H;  1L1O A;  1HTL D;  4RG1 A;  2R93 B;  4LW1 A;  1K73 C;  4C2M H;  3K80 C;  4Y7N B;  5IT9 c;  1VQ7 A;  2JA5 H;  4K6L A;  1N36 L;  4IFD I;  3L2P A;  1K0S A;  4JPB W;  2PI2 E;  1B2T A;  3T1Y Q;  3A56 A;  1D2B A;  4HIK A;  1I50 H;  3S15 H;  2R7Z G;  4WJW A;  3T4A C;  3TP5 A;  1QG7 A;  1VQ5 A;  2JA5 G;  2MGS A;  4N8X 1;  5ELN A;  4JI6 Q;  2RBM A;  1YZ6 A;  2K6A A;  4B3M L;  1N33 Q;  4CDD C;  2E2J H;  1EY5 A;  5E3F A;  1Q1B A;  2FHT A;  1Q86 C;  4FO2 A;  4DV6 Q;  1PVO A;  2PYK A;  4WJ3 M;  3I4M B;  3VYS A;  4RMF A;  1S40 A;  2F0M A;  4J1M A;  2CW0 C;  5J39 A;  1SJE D;  3MEF A;  5EKI A;  2C5C A;  2PZT A;  1ET9 A;  2K04 A;  3PIO 3;  1D1K A;  3I4O A;  2A1A A;  1DJR D;  5CR3 A;  2PMZ B;  4UP8 A;  5CBE E;  2K03 A;  1KD1 C;  1HNX L;  2KCC A;  3FRP B;  1AZP A;  2F4I A;  1VQH A;  2Q2I A;  4YWL A;  3W5O A;  3OPO A;  4ZQ3 A;  2UUC L;  2B2T A;  4IOA A;  4ODG A;  4LF9 Q;  4BBS B;  1SE3 A;  3H0G H;  3ONA B;  1HZ9 A;  3DM1 A;  3S2H B;  3FKI B;  1B3Q A;  1CQV A;  2VUM B;  2RCN A;  2EJM A;  4KI0 A;  1BBX C;  2MP1 A;  2IHE A;  3MHB A;  2R7D A;  3A7A B;  1G91 A;  1UAP A;  3V2T A;  5C3W A;  4FP5 D;  1MJE A;  3JAM c;  2E2D C;  4HJA A;  4OX9 L;  1XYI A;  4X65 L;  1FJG L;  4DV3 Q;  1C8C A;  3H0G G;  3CP0 A;  3DXJ C;  3Q24 A;  2HCI A;  1V1P B;  1E22 A;  2FMC A;  2TSS A;  2K01 A;  3FPP A;  4HMI A;  4K5X A;  1PZI D;  1CQF A;  4DR7 Q;  3NSW A;  2RHQ B;  2B2W A;  1HZC A;  3D31 A;  3SK8 A;  1GUW A;  1GOZ A;  5BR8 Q;  4Z9C B;  1BOS A;  4G4K A;  2ZM6 L;  3HOU H;  4ZUI A;  2YTX A;  3UDG A;  5C5L A;  1ESF A;  5T1G A;  3MFY A;  2V1C C;  5JVG 3;  2L0C A;  2WAQ E;  1X65 A;  1HFG A;  3EVQ A;  1BDO A;  4C3I B;  2NVX H;  2OQ0 A;  3HOU G;  2EIF A;  3RNU A;  3HOY B;  1TWG H;  4JI5 Q;  3QOJ A;  3S14 H;  1LAB A;  3OIP A;  1HJP A;  2DY8 A;  4A3E B;  1XXG A;  1IW7 D;  1PZK D;  5I9P A;  5KYI A;  5JOB A;  2A8V A;  1TT2 A;  1U9R A;  4JI1 Q;  4ILW A;  4LFC L;  1MSH A;  3AB9 A;  1YJ9 A;  2IT1 A;  3BVZ A;  5FLM H;  4BY7 B;  4KY5 A;  4NXM Q;  4K0K L;  2KED A;  4NKL A;  3RZD B;  3QJY A;  1EIY B;  1VQ8 A;  4LAA A;  1E0B A;  4PQX A;  1SEB D;  2AMC B;  3NEL A;  1SFO H;  5DAU A;  3A55 A;  1DYQ A;  1DOM A;  4EQN A;  1WCM B;  3I7F A;  4BWG B;  4GOP B;  3I56 A;  3CKI B;  2F4V L;  3GTG B;  4DU9 A;  3QG1 A;  2HCC A;  2NVT B;  4DV0 Q;  3E6Z X;  1EZ6 A;  2RDH A;  2OTL A;  4JYA Q;  4LF4 L;  4X66 L;  4DK6 C;  5BN4 A;  2UXD Q;  2ES2 A;  1VQN A;  1A2T A;  2FJ2 A;  4LUO A;  2DY7 A;  4AQY L;  1BF4 A;  2EYP A;  4DNR B;  1O7L A;  1KRS A;  3PGZ A;  3Q6S A;  1GUT A;  2E2H B;  1RJT A;  4G7Z C;  3PF5 A;  3GV3 A;  3PO3 G;  4IPG A;  1I6H H;  4KY7 A;  3R2I A;  3HOX B;  4BBR B;  1H9S B;  2A5H A;  1ET6 A;  3SK5 A;  4POF A;  1Q81 C;  4XT3 B;  4A93 B;  1PH6 A;  1XMQ Q;  2XNA C;  1KDC A;  1QZH A;  4YHH L;  1BO0 A;  2HD3 A;  3S17 B;  1K83 H;  1Q8K A;  4WJ4 A;  1WFQ A;  1XTC D;  2XRQ D;  3NWS A;  4V0B A;  3I4N H;  1A2U A;  4JI0 L;  1G51 A;  5EBC A;  1JWU D;  1DZ1 A;  2WAQ G;  2V4D A;  4IPD A;  5IP9 G;  1S4Z A;  2VQF Q;  4XIG S;  4AIM A;  2H4O A;  1KQS A;  2J7Z A;  1CA5 A;  3GTQ B;  4PG3 A;  5DEH A;  4RCO A;  3KF6 B;  3GTP H;  3T53 B;  3MA2 B;  2E2I H;  1E24 A;  1PXU A;  5EKK A;  5FJ8 H;  3I4N G;  2N55 A;  3FPU B;  1LTS D;  2CKZ B;  3HGB A;  3U50 C;  2EPB A;  3I73 A;  4ZYS A;  3TZD A;  2JJQ A;  4HIM A;  1Q3L A;  1LT4 D;  5JPN C;  4PMB A;  3T1Y L;  1CHQ D;  5M5Y H;  1K3B C;  2X6L A;  3P75 A;  5FJ8 G;  1CFM A;  4WRD A;  4CJ1 B;  1YNJ C;  2M00 A;  1GKH A;  4LF6 Q;  5FO8 B;  1V1O A;  3S1N B;  2F0Q A;  3UDI A;  5EAY A;  4A3L H;  5ELE A;  2N88 A;  1WTQ A;  1DOL A;  1OXT A;  4PMW A;  1H95 A;  3HEJ A;  4LJZ C;  5D3I B;  4ID6 A;  4EX5 A;  1DM0 B;  3CCL A;  3J7A V;  4DV6 L;  1STA A;  1ENA A;  3RMH A;  2SNS A;  5C0X I;  4DK0 A;  2JEA I;  2I5M X;  1XNQ Q;  4A3L G;  3PUY A;  1VQL A;  5IT9 E;  4NP5 A;  1KNA A;  1EQT A;  2I5L X;  1I3Q H;  5CV7 A;  5E4X A;  1Y1W G;  3OHX C;  5JPM C;  3NEM A;  4ALP A;  4IFD J;  1XMO Q;  1YHB A;  3PSI A;  1TWH H;  1WTO A;  5E4W C;  1CUK A;  2KJX A;  3JC6 6;  2ZJP A;  1SNC A;  1SNP A;  1O7Y A;  2B2Y C;  5A2Q E;  4ZUJ A;  5J22 A;  2ICE C;  3TS0 A;  1QIL A;  2CW0 D;  2MQH A;  1FD7 D;  5CV9 A;  3JAM i;  2NVQ B;  2CCZ A;  2R92 B;  2I46 A;  1D5Z C;  5KYL A;  1YI2 A;  4A3K B;  3RZO B;  3OMG A;  2K5Q A;  1ML0 D;  3A74 A;  3GTJ H;  1QCB D;  1CSP A;  2QEX A;  1A62 A;  3S1R H;  2BE5 C;  1XPR A;  2K5H A;  5FK9 C;  3J81 c; 
#chains in the Genus database with same CATH homology
 1DON A;  2LFN A;  4K2K A;  5HUR A;  1I4P A;  4FXK C;  2BOS A;  2L11 A;  2F0D A;  2ZT9 C;  2D62 A;  3UI2 A;  2IPK D;  5M5W B;  2F0U A;  4GZY C;  4K6D A;  4KV6 A;  3NBH A;  3HOW B;  4RH6 A;  2D5D A;  1JWM D;  2CVR A;  3DUZ A;  2OT2 A;  3PUZ A;  2B2T C;  3TP7 A;  2YU9 B;  1JCK B;  1T5E A;  1IKL A;  3JAM E;  3KF8 A;  3SVM A;  3I3C A;  4ABN A;  1GUS A;  2PO4 A;  1I4Q A;  5KND A;  1TR5 A;  3IL8 A;  3FMC A;  2WB1 B;  2R6G A;  5EKL A;  3KLS A;  3D4R A;  4I65 A;  1BQQ T;  4PMC A;  4RKL A;  1CT1 D;  2K32 A;  2Y0S B;  2JSO A;  1IL8 A;  2KEC A;  4TKO B;  1ZEQ X;  3NPP A;  1BXT A;  1LTG D;  2B2W C;  3D8G A;  3V05 A;  5I4D A;  5D14 A;  4PV1 C;  1U4R A;  2ICI A;  1STG A;  3CQZ B;  3GTK B;  3BVG A;  1FNV A;  4CGY B;  1TU2 B;  2H1E A;  1SNM A;  2PZW A;  4C2M B;  3J7Y W;  1Z6H A;  2F0I A;  1STY A;  2JA5 B;  3QB3 A;  1I4H A;  4ZKC B;  3IFD A;  4R8N A;  1I50 B;  3S15 B;  3VYR A;  2EYM A;  4FF4 A;  1F2Z A;  4H13 C;  4O1N A;  4KMU C;  3EJI A;  1HA6 A;  1Q12 A;  3VYU A;  2L9H A;  1EY7 A;  2E2J B;  3BYY B;  4WFN 3;  1SMY C;  5BN3 A;  3C46 A;  3NQT A;  3BVM A;  1TS2 A;  1VMC A;  2KOL A;  1CHP D;  3CHB D;  1SYB A;  4R8I A;  1M8A A;  2EY2 A;  2RSO A;  4G57 A;  2RDF A;  2Z4I A;  2EXZ A;  1RKN A;  2WKC A;  4F87 A;  4JBW A;  3HG9 A;  2NN6 G;  2B8F A;  4FF3 A;  3BDL A;  1CM9 A;  1QJO A;  1ZYR C;  2K05 A;  2L5T A;  2EJF C;  3H0G B;  2WP8 J;  1RTO A;  4IAL A;  1LLR D;  1OXX K;  2K33 A;  2RDG A;  1FGB D;  5J1Z A;  1PRT F;  3SXH A;  1YNJ D;  1I4X A;  2VXW A;  1L0Y B;  3MXP A;  1SBB B;  1EU4 A;  3VR5 A;  3S9W A;  5JAV A;  2B2U A;  2F0J A;  5JEA J;  1EL0 A;  4ZRZ A;  3HOU B;  1GXD C;  1VF5 C;  3G6J B;  1RDP D;  1IHZ A;  4E6I A;  5EQ0 A;  5DNF A;  1EIG A;  2NVX B;  4DAY A;  1AP0 A;  5IT9 L;  4NW2 A;  4O42 A;  5C5M A;  2VNU D;  1TWG B;  4RGN A;  3FDT A;  3S14 B;  3GQB A;  3E0J A;  4G7O C;  4K5W A;  5A2Q L;  5C44 B;  1C4Q A;  2NYZ D;  2BCO A;  5CV8 A;  5KNC A;  1HQR D;  2BE5 D;  1ILQ A;  1SFO B;  3FVQ A;  1I4G A;  2E74 C;  2KA7 A;  3I4L A;  3CRK C;  1D5X C;  2Q8T A;  3MXN A;  2XN9 C;  3T51 B;  2WIN B;  1UEA B;  3RD4 A;  4CKE A;  4OO1 H;  3J81 E;  4FVM A;  2ZXR A;  3A8J E;  4IUV A;  3G7L A;  5CV5 A;  4TRD A;  1I6H B;  2Z4H A;  2IX3 A;  3M4Y A;  4OO1 G;  4QMG A;  1NCV A;  2EVB A;  1NUC A;  1SE2 A;  1NR4 A;  1K83 B;  2NZ1 D;  4L63 B;  1PFM A;  3I4N B;  5I2Y A;  1BNZ A;  3JAM L;  1CZG A;  1EOT A;  2E75 C;  3VA7 A;  3GTP B;  4MIU A;  2E2I B;  1GUN A;  5K36 G;  3NWT A;  5AFW A;  1D6E C;  1QNK A;  2DNC A;  5M5Y B;  4H44 C;  1SAP A;  4CJ2 C;  1QOH A;  3F2U A;  3VR2 A;  3L3O C;  1HRJ A;  1EYC A;  2WV6 D;  1EU3 A;  4B08 A;  2F0T A;  4C3J G;  1STH A;  5C6A A;  5I6Y A;  2QDB A;  4RWS C;  4Q5V A;  3PUX A;  1SYG A;  2EE1 A;  1I3Q B;  5COY A;  2EYL A;  4FYD A;  3W3A A;  4KTA A;  1K8M A;  2VB3 X;  4HTH A;  1TWH B;  3Q22 A;  1SMY D;  4RGO S;  3T16 A;  1U4P A;  2GA4 B;  2F03 A;  1L0X B;  1OO9 B;  2XRS D;  1TQO A;  1AEX A;  3K5M A;  1EWH A;  1PLF A;  2TMP A;  3GTJ B;  4IUR A;  1SYC A;  3S1R B;  4C1N K;  2L1B A;  2G9D A;  4K8I A;  2M9V A;  2MJ8 A;  3RLF A;  1GUO A;  5LHY 1;  3WOE A;  1ZYR D;  4OGQ C;  5IOD A;  3FEW X;  1HCZ A;  1I4R A;  4HMJ A;  5F2D A;  1V8Q A;  2ENB A;  4M8A A;  1G2T A;  2Z1C A;  1F2Y A;  3BDC A;  2JP1 A;  4KN4 C;  1EQV A;  4R9W A;  1KLU D;  2Q8I B;  1PFB A;  1NSN S;  3TSS A;  1KDA A;  1IKM A;  5CMD A;  5ELC A;  4EQP A;  4G7H C;  4P2C B;  3KBX A;  4A3I B;  3VR3 A;  2NTT A;  2M2L A;  1NR2 A;  4OIK A;  2F3V A;  3IKJ A;  2RQX A;  1IYU A;  3P20 A;  3H3V C;  4X3T A;  1CA6 A;  1KLG D;  5M5X B;  1AN8 A;  4DF7 A;  1EY0 A;  2EYH A;  2B2U C;  2JYO A;  1X32 A;  2D2C C;  5I2X A;  4HSV A;  4F88 A;  4FXD A;  5C3X A;  3H09 A;  1W6J A;  3R93 A;  5K5P A;  4PNY A;  1B9N A;  1A3U A;  1DD2 A;  2RSN A;  1B9M A;  1BUV T;  5JEA H;  4QUF A;  3T56 B;  5CV4 A;  5I9O A;  2XWJ B;  1WTW A;  5D65 A;  3K59 A;  2JA7 B;  1JOK A;  5JEA G;  4Q0F A;  4XTC S;  2F0W A;  4KKS A;  4M1U B;  2NBF A;  4MN3 A;  3J81 L;  5COR A;  4A3D B;  1DCZ A;  5TSS A;  4UDU C;  3URY A;  4BA1 I;  1YNN C;  5CYU A;  2F0P A;  4RAU C;  4A3F B;  3GTM B;  3C3L A;  2NTS A;  1EFI D;  3NTH A;  2FMM A;  4NMZ A;  5JJZ A;  2NUC A;  3AU7 A;  1LTI D;  2X6G A;  1PDQ A;  4IQZ A;  1E2V A;  1LTR D;  3QWN A;  3W2D A;  4L6T B;  2PPB C;  3PUV A;  1S5D D;  1MGS A;  3BYT B;  4HCE A;  3NE5 B;  1Q1E A;  4XDX A;  4U67 3;  1TII D;  4DAV A;  5I6W A;  5FO7 B;  3DWA A;  4RA8 A;  3P7J A;  3QIA A;  1FNU A;  1NAP A;  1HFN A;  2LY7 A;  2XSC A;  4IUQ A;  2JA6 B;  3TN2 A;  4U68 A;  5DM6 3;  4ZK9 B;  1F9R A;  1EYD A;  3K0Y A;  5M3F B;  3D4W A;  1H9J A;  2EOT A;  3E5S A;  3C1E A;  4RHS A;  3I8Z A;  1LT5 D;  4C3I G;  2J4X A;  2B63 B;  2IW3 A;  2AQ1 B;  3IFT A;  1G29 1;  1R9T B;  1PYW D;  4F7X A;  3C2P A;  1CZW A;  5FLX L;  4FF2 A;  2PW5 A;  5C4H A;  2AWO A;  4OIJ A;  1AW7 A;  1B3A A;  5JVH 3;  4C3H B;  1EY8 A;  2HUG A;  4J8Q A;  1KNE A;  1QE6 A;  1Y8N B;  5C4Z A;  1SE4 A;  2X69 A;  1G6Z A;  3SK4 A;  1CI3 M;  2PCF B;  3J7A F;  5EPK A;  1SYD A;  2RVL A;  2SEB D;  3MXU A;  3PV0 A;  3MAQ A;  1PRT C;  1Y8P B;  1RD9 D;  3MXG A;  2R7Z B;  1PFN A;  4HED A;  4RGT A;  1UUP A;  1Y1V B;  3PUW A;  4LMQ D;  1MD2 D;  4ZLT F;  3NXW A;  2NVY B;  1TKW B;  1ROD A;  5FKA C;  2K5W A;  1A6X A;  4A3J B;  2Q8R E;  2ZXP A;  1RTN A;  4B9X A;  5HGT A;  1EY6 A;  2NN6 H;  3X3M A;  3GTL B;  1FR3 A;  3MC0 B;  1LV9 A;  1TS3 A;  3D4D A;  1S5B D;  5KIX A;  2BA0 A;  3A8K E;  2LMC B;  2NN6 I;  3SK6 A;  1WTX A;  2F1M A;  1A15 A;  1ESR A;  3K5N A;  4XQQ A;  4QB4 A;  5EJW A;  3KBG A;  1LO5 D;  3N52 A;  1JB3 A;  1BCP C;  3D3R A;  3SR1 A;  4CHT B;  3M4O B;  2B8G A;  5D3D A;  2CHB D;  2F0V A;  3U9O A;  3OOC A;  4QCL A;  3KLR A;  2WAC A;  3S1Q B;  1QB5 D;  4CKC A;  1F9P A;  1JWS D;  3TP8 A;  3K5O A;  4KD4 A;  5T1I A;  3ITP A;  3HS0 C;  2IL8 A;  2QIL A;  3S1M B;  2IJ0 A;  1G2S A;  1II3 A;  5E1F A;  3R3O A;  1YNN D;  3C1F A;  3DWQ A;  4C1N I;  1HHV A;  4XQN A;  2DN8 A;  4DN4 M;  2F0O A;  3MFG A;  2FIN B;  2AUK A;  5C0X J;  2L4N A;  1EYA A;  2F0N A;  4DXF A;  3N6R A;  1STN A;  1AFP A;  2A73 B;  1SYE A;  1ILP A;  2SOB A;  5A35 A;  3VA5 A;  3O13 A;  1STE A;  3K58 A;  2QF7 A;  3KUP A;  2G9H D;  3VYT A;  1F9S A;  5DM7 3;  4X3U A;  5CGK A;  2KQ3 A;  4KN7 C;  2EY1 A;  3GP7 A;  1BCP F;  4OHJ A;  3PO3 B;  3NUC A;  1PRT B;  1PZJ D;  3PIP 3;  3ERQ A;  3Q23 A;  3NP8 A;  3GTO B;  3BDO A;  4IFD H;  3P1H A;  3ND9 A;  4IUP A;  2IX0 A;  1O7Z A;  2B2V A;  1B1Z A;  4J6H A;  2WAQ B;  2F0E A;  4OO1 I;  4HSP A;  1O80 A;  1S5E D;  1JIC A;  4K8J A;  4IFD G;  1V43 A;  1WTV A;  2F0L A;  2B2Y A;  2LKV A;  2A6H C;  1HQM C;  1E2Z A;  1WTR A;  5K36 H;  1Q8I A;  3OW7 A;  4WOR A;  3TDQ A;  4CJ0 B;  3A8I E;  2KVM A;  2KHS A;  3QO2 A;  4HN7 A;  4DK1 A;  4K14 A;  1PTO H;  1GHJ A;  3SEB A;  1HA5 A;  3U9S A;  3AMU A;  2PW7 A;  1OXS C;  3MVV A;  1PRT D;  4DA2 A;  1UNS A;  5KGU A;  2SDF A;  5KNB A;  5ISR A;  2R3Z A;  1RCV D;  2XIW A;  1BCP B;  1Y1W B;  3H6M A;  2EY6 A;  2JEB I;  2HQE A;  1MSG A;  2EY5 A;  4KKU A;  1SJH D;  1OXU A;  4RKB A;  4ZAI A;  2B39 A;  5FLX E;  3HZX A;  2EJG C;  1JE4 A;  2BDO A;  3HP3 A;  3M7N A;  1KDB A;  3SDZ A;  1KTK A;  2E76 C;  2D9U A;  4H0L C;  3DEP A;  3K7A B;  3R2T A;  3I91 A;  3CU7 A;  2WKD A;  4KY6 A;  1DOK A;  3X3N A;  2F0F A;  4FNF A;  1VF7 A;  1TS5 A;  2IX1 A;  3K5L A;  3HOV B;  1A3V A;  4TSS A;  3DHQ A;  4YIJ A;  5IGF A;  3KLS X;  2KUM A;  3L7Z C;  4KD3 A;  4EGV A;  4KHV A;  3PMF A;  2BA1 A;  1PMR A;  3LWU A;  2MHV A;  2A68 D;  2I07 B;  2EYO A;  1SSO A;  1BCP D;  5IGC A;  2DNE A;  1B44 D;  1SXT A;  4KJO A;  3MEH A;  5ELB A;  3OWF A;  3ERO A;  3V96 A;  5KEE A;  3NTK A;  2O4X A;  1MI2 A;  1EY9 A;  4B9W A;  2L12 A;  1LT3 D;  5IIF A;  3BG3 A;  3WOF A;  2EYJ A;  4HCS A;  1K8O A;  2CQA A;  4TQU S;  2MUY A;  5NUC A;  1U4L A;  3DMU A;  5LL6 S;  1KAB A;  1OXV A;  3I70 A;  1DXM A;  5G3L F;  1IYV A;  1O78 A;  4QF4 A;  1SND A;  1TWA B;  1LTA D;  3HRZ C;  1B53 A;  1TY2 A;  5EGT A;  2ID0 A;  1R4Q B;  1V1P A;  4XXE A;  1GJX A;  2AWN A;  4JK1 C;  4N9T A;  1EEF D;  1F9Q A;  4KK7 A;  5ELD A;  3GO5 A;  3ZYY X;  3LNN A;  4C56 C;  3Q0A A;  2FFK B;  4OL7 A;  1JC7 A;  3BZD B;  3M3Y B;  1HTP A;  1STB A;  4XQJ A;  1WD1 A;  2A6E C;  1Y69 U;  2R61 A;  4QUC A;  1F2L A;  5C0X H;  1Q90 A;  1B50 A;  2QKI C;  1JR0 D;  2JA8 B;  1VMP A;  1R4P B;  2EDG A;  1J9O A;  1LAC A;  1G8Z D;  2OEO A;  1J8I A;  3HOZ B;  5C0X G;  1X3Q A;  2A6H D;  2F0K A;  1F2M A;  4A3M B;  1ICW A;  3GD7 A;  2A69 C;  1PTO C;  1BR9 A;  1I6V C;  1Z47 A;  5ELF A;  2B2V C;  4IUU A;  4I7Z C;  5IOC A;  2PQE A;  2A74 C;  1WTP A;  1TS4 A;  2K1B A;  2K7V A;  4AYB B;  3LWE A;  3K57 A;  5IGD A;  1QNU A;  2PNR C;  5C3E B;  4L8J A;  2F0G A;  1XWE A;  4ZKB B;  1S5C D;  1T5X D;  3A7L A;  2F3W A;  1TY0 A;  2LS0 1;  2IWH A;  4CBV A;  1B4O A;  2K28 A;  3MTS A;  2KEE A;  2J0T D;  1H9S A;  3J80 E;  2VB2 X;  4S3S A;  4KJN A;  4MHE A;  4DFA A;  3DWP A;  3I72 A;  1C48 A;  3DEO A;  3H91 A;  2EYF A;  2OXP A;  4IN3 A;  4RGM A;  2O5I C;  1CTM A;  3I90 A;  4N9P A;  2YYZ A;  1M4V A;  5IGG A;  2F0S A;  3BS1 A;  1GUG A;  2QCP X;  5IGE A;  3WDN A;  3OIQ A;  1LTT D;  3D6W A;  5G3L D;  4RFB A;  1PTO F;  3GV6 A;  4RHR A;  3EFX D;  4DGZ A;  4EVO A;  1D5M C;  1WVL A;  1D1I A;  4RCN A;  1H9K A;  2HDL A;  5CBA E;  1W6K A;  3KK7 A;  3TZU A;  2WII B;  5IGB A;  2NB0 A;  3T13 A;  1H9R A;  2L55 A;  1TWF B;  2NWG A;  4HR7 B;  2PZU A;  4FXG C;  4EQO A;  1JOR A;  3LX0 A;  2KCN A;  4XYQ A;  2JXM B;  1TWC B;  1GHK A;  3CRL C;  1VDZ A;  2BDN A;  4FF1 A;  1JOO A;  1XX8 A;  4X3K A;  5EPJ A;  2RKS A;  2O5J C;  2SNM A;  2XWB B;  1SNQ A;  4NDX A;  5EBD A;  4A3G B;  3M85 A;  3TME A;  5BN5 A;  4KHZ A;  3SHL A;  3EQL C;  1ONL A;  2AQ2 B;  4A3B B;  3QOL A;  1HPC A;  1KAA A;  1MBY A;  1FNW A;  4LK1 C;  4QIW B;  3H94 A;  2AQ3 B;  1SNO A;  4X3S A;  4XT1 B;  3R8B A;  4IZ8 A;  1U4M A;  3MZ5 A;  1PTO B;  2QEJ C;  2EZV A;  2K5D A;  3PO2 B;  1JQY D;  3VR6 A;  1VCI A;  1SYF A;  1HUN A;  4C3J B;  2O2L D;  2Z8L A;  1HXY D;  1WD0 A;  2A68 C;  4BS9 A;  3NHH A;  3TBI B;  1CK1 A;  5FOB B;  2OF1 A;  1E2W A;  1IW7 C;  2RA4 A;  1AZQ A;  3NBI A;  4CKB A;  2ZXO A;  4V19 0;  1LT6 D;  3S2D B;  1ZKO A;  5FO9 B;  3NQI A;  1TVX A;  3M7G A;  3SE0 A;  1RHP A;  5CC4 A;  4DAP A;  3TP6 A;  1A3T A;  2MPM A;  4F8M A;  3NK9 A;  2A6E D;  3HKZ B;  1LTB D;  1S5F D;  1QWY A;  3OSO A;  4DXG A;  4XYO A;  5EPL A;  3EA6 A;  1ENC A;  5M9O A;  2XVS A;  4KKT A;  1ENF A;  2AUJ D;  3NTI A;  2F0H A;  2C9O A;  5KRU A;  5M3M B;  1EY4 A;  5C4J B;  3S16 B;  4K5V A;  3D6C A;  2A69 D;  4BY1 B;  1F77 A;  1PTO D;  1X3P A;  3IAY A;  3K6O A;  1HUM A;  1EZ8 A;  3ND8 A;  1Y8O B;  3MWY W;  1EWC A;  4UAI A;  2JE6 I;  4DNT B;  4IUT A;  4H7B A;  5C4X B;  1JOQ A;  1FYC A;  3OWE B;  5CV6 A;  3L9A X;  4IUN A;  3VR4 A;  1SDF A;  3A54 A;  1EIH A;  2HDM A;  3RUZ A;  1Z7T A;  3OMC A;  1EEI D;  4ULL A;  4C3H G;  4HAE A;  4BA2 I;  4K2L A;  1H9M A;  5LL6 X;  1ZXT A;  1RF2 D;  4ME5 A;  3J80 L;  1HTL D;  2R93 B;  4Y7N B;  4K6L A;  4IFD I;  1B2T A;  3A56 A;  1D2B A;  4WJW A;  3T4A C;  3TP5 A;  1QG7 A;  2MGS A;  2RBM A;  2K6A A;  1EY5 A;  5E3F A;  1Q1B A;  2FHT A;  4FO2 A;  2PYK A;  3I4M B;  3VYS A;  2F0M A;  4J1M A;  2CW0 C;  5J39 A;  1SJE D;  5EKI A;  2C5C A;  2PZT A;  1ET9 A;  2K04 A;  3PIO 3;  1D1K A;  1DJR D;  5CR3 A;  2PMZ B;  5CBE E;  2K03 A;  2KCC A;  3FRP B;  1AZP A;  2F4I A;  3OPO A;  4ZQ3 A;  4BBS B;  2B2T A;  4ODG A;  1SE3 A;  3ONA B;  3DM1 A;  3S2H B;  3FKI B;  1CQV A;  2VUM B;  2EJM A;  4KI0 A;  1BBX C;  2MP1 A;  3MHB A;  3A7A B;  1G91 A;  1UAP A;  3V2T A;  5C3W A;  4FP5 D;  2E2D C;  1XYI A;  1C8C A;  3DXJ C;  3Q24 A;  2HCI A;  1V1P B;  2FMC A;  2TSS A;  2K01 A;  3FPP A;  4HMI A;  4K5X A;  1PZI D;  1CQF A;  3NSW A;  2B2W A;  3D31 A;  3SK8 A;  1GUW A;  1GOZ A;  4Z9C B;  1BOS A;  4G4K A;  4ZUI A;  5C5L A;  1ESF A;  5T1G A;  3MFY A;  5JVG 3;  2L0C A;  1HFG A;  3EVQ A;  1BDO A;  4C3I B;  3HOY B;  3QOJ A;  1LAB A;  3OIP A;  2DY8 A;  4A3E B;  1XXG A;  1IW7 D;  1PZK D;  5I9P A;  5KYI A;  5JOB A;  1TT2 A;  1U9R A;  4ILW A;  1MSH A;  3AB9 A;  2IT1 A;  3BVZ A;  4BY7 B;  4KY5 A;  2KED A;  4NKL A;  3RZD B;  3QJY A;  4LAA A;  1E0B A;  4PQX A;  1SEB D;  5DAU A;  3A55 A;  1DYQ A;  1DOM A;  4EQN A;  1WCM B;  4BWG B;  3CKI B;  3GTG B;  4DU9 A;  3QG1 A;  2HCC A;  2NVT B;  3E6Z X;  1EZ6 A;  2RDH A;  5BN4 A;  1A2T A;  2FJ2 A;  2DY7 A;  1BF4 A;  2EYP A;  4DNR B;  1O7L A;  3Q6S A;  1GUT A;  2E2H B;  1RJT A;  4G7Z C;  3GV3 A;  4KY7 A;  3R2I A;  3HOX B;  4BBR B;  1H9S B;  2A5H A;  1ET6 A;  3SK5 A;  4A93 B;  4XT3 B;  2XNA C;  1KDC A;  1BO0 A;  3S17 B;  1XTC D;  2XRQ D;  3NWS A;  4V0B A;  1A2U A;  5EBC A;  1JWU D;  1DZ1 A;  2V4D A;  1S4Z A;  4XIG S;  2H4O A;  2J7Z A;  1CA5 A;  3GTQ B;  5DEH A;  4RCO A;  3T53 B;  3MA2 B;  1PXU A;  5EKK A;  2N55 A;  3FPU B;  1LTS D;  3HGB A;  2EPB A;  3I73 A;  4ZYS A;  3TZD A;  1Q3L A;  5JPN C;  1LT4 D;  4PMB A;  1CHQ D;  2X6L A;  3P75 A;  1CFM A;  4WRD A;  4CJ1 B;  1YNJ C;  2M00 A;  5FO8 B;  1V1O A;  3S1N B;  2F0Q A;  5ELE A;  2N88 A;  1WTQ A;  1DOL A;  1OXT A;  4PMW A;  3HEJ A;  4LJZ C;  5D3I B;  4ID6 A;  1DM0 B;  3J7A V;  1STA A;  1ENA A;  3RMH A;  2SNS A;  5C0X I;  4DK0 A;  2JEA I;  3PUY A;  5IT9 E;  4NP5 A;  1KNA A;  5E4X A;  1EQT A;  5CV7 A;  3OHX C;  5JPM C;  4IFD J;  1WTO A;  5E4W C;  2KJX A;  1SNC A;  1SNP A;  1O7Y A;  2B2Y C;  5A2Q E;  4ZUJ A;  5J22 A;  2ICE C;  1QIL A;  2CW0 D;  1FD7 D;  5CV9 A;  2NVQ B;  2R92 B;  2I46 A;  1D5Z C;  5KYL A;  4A3K B;  3RZO B;  3OMG A;  2K5Q A;  1ML0 D;  1QCB D;  2BE5 C;  5FK9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...