1EQTA

Met-rantes
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
GYSSDTTPCCFAYIARPMPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords T-CELL SPECIFIC RANTES PROTEIN
publication title The Crystal Structure of MET-RANTES: Comparison with Native RANTES and AOP-RANTES
pubmed rcsb
source organism Homo sapiens
total genus 13
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eqtA00
2IL8A 2KUMA 3DEOA 2B2WA 2HCCA 5EPKA 5D14A 4RWSC 4QUCA 1IKMA 1GUWA 1A15A 1ILPA 2FHTA 4MHEA 1QE6A 1PFBA 5EQ0A 2EPBA 1O80A 3KUPA 2VXWA 4X3TA 1PDQA 2MPMA 5T1GA 1F9RA 2X6LA 3IFDA 5EKIA 4QUFA 4NW2A 1XX8A 4HCSA 2HDMA 4ZK9B 1CM9A 1O7YA 4O42A 2K05A 1SDFA 2Q8RE 2L12A 1RHPA 3ONAB 3TZDA 3UI2A 1QG7A 4DN4M 2K04A 1F9SA 1F9QA 4ZKBB 2B2UC 1EQTA 1B2TA 2NYZD 5JJZA 2BDNA 4R9WA 4R8IA 1U4LA 5EPLA 3FDTA 4RAUC 1NAPA 2B2WC 4U68A 5CORA 2RA4A 4CJ1B 2RVLA 2DY7A 3F2UA 1VMPA 1B53A 1ESRA 1PFNA 2MJ8A 5T1IA 1J8IA 1HRJA 1HUNA 1RJTA 3MWYW 2HUGA 3Q6SA 1B50A 4IUTA 5DNFA 1HFNA 1HUMA 1NR4A 3DEPA 4IUVA 1IKLA 1HHVA 2RSOA 3H91A 3I91A 2D9UA 1NCVA 2FMMA 1BNZA 1NR2A 1WTXA 2L4NA 1RTNA 4UAIA 1MI2A 3D6WA 3KBXA 1HA6A 2MGSA 4ZAIA 1AZPA 1F9PA 2H1EA 1ML0D 2R3ZA 3SVMA 1SSOA 4IUQA 4IUPA 1WTPA 1DOLA 1X3QA 2FFKB 2KEEA 5E4WC 1CA5A 3GV6A 1BBXC 2L9HA 2Q8TA 1MSHA 1RTOA 4XDXA 5EPJA 1JICA 2N55A 3R93A 1B3AA 1HFGA 4HSVA 4X3SA 3IL8A 3I8ZA 2DY8A 3G7LA 3I3CA 1BF4A 2J7ZA 2JP1A 1MGSA 2XIWA 5E4XA 1G2SA 3MTSA 1EOTA 1BO0A 1ILQA 1RODA 5AFWA 2SDFA 5CMDA 1J9OA 1SAPA 1U4MA 1S4ZA 1JE4A 2B2YA 2EOTA 2L1BA 2L11A 4IUUA 1M8AA 1TVXA 2EE1A 4LMQD 4RA8A 4CJ2C 2K01A 2X69A 2M2LA 1WTVA 1WTRA 2HCIA 1IL8A 4HAEA 1F2LA 1XYIA 1WTWA 2B2TA 3GV3A 2K03A 2KECA 1WTOA 2FINB 3P7JA 1E0BA 2K1BA 3DM1A 1CA6A 2KOLA 1O7ZA 1X32A 3HP3A 3I90A 1EL0A 1C8CA 1EIHA 1DOMA 1QNKA 2CVRA 1X3PA 2NWGA 3LWEA 4HEDA 3QO2A 4X3UA 1DONA 1DZ1A 2FJ2A 4OIKA 4OIJA 2B2VA 2X6GA 4MN3A 1AZQA 5D65A 1G2TA 1U4RA 2B2YC 4X3KA 1ZXTA 1DOKA 4IURA 1LV9A 3FPUB 5EJWA 1ICWA 4ZLTF 1WD0A 2B2TC 2KEDA 2RSNA 1VMCA 1WD1A 1EIGA 2K28A 2HDLA 5CBAE 1G6ZA 1KNAA 2NZ1D 2MP1A 1WVLA 1G91A 1MSGA 1WTQA 1AP0A 4XT3B 2KVMA 4ZKCB 5CBEE 1U4PA 1PFMA 1PLFA 3TN2A 2B2VC 1KNEA 2N88A 5COYA 1B4OA 2JYOA 2B2UA 1Q3LA 3N52A 4XT1B 4CJ0B
chains in the Genus database with same CATH superfamily
3K7AH 3S1RH 1SYCA 2QW7A 4JI8L 2F0MA 1KDAA 3VR3A 3J81c 2Z1CA 5ELEA 5BN4A 3J80L 2RF4A 2FHTA 1H9KA 3VR6A 1TY2A 4DV6L 4L6TB 2WB1G 1PYSB 1EU3A 1SFOB 4DV2Q 4QJFA 5KRUA 3CPFA 1IYVA 3ONAB 1MIUA 1LM0A 1EY7A 1KC8C 1F9QA 3TP6A 3F8TA 4DR7L 3ICEA 2C35B 1U4LA 2ICIA 1QNUA 4A3IH 5JJKA 2RA4A 4LFAQ 5FO8B 1PRTB 4V190 2QDBA 3BVMA 4BY1G 2VY3A 1YHQA 1B53A 1CKMA 3S17B 4A3DB 1UEBA 5C3EH 3GTGH 1SJED 2HD3A 1ENFA 1P8LA 4KJOA 3DWAA 3PIP3 4K2LA 3FMCA 2PPBC 2PYKA 3D3RA 4JK1C 5JVG3 2NN6I 1WTPA 1VQ5A 5K5PA 4DNTB 4A3GH 4KJNA 1Y8PB 3IL8A 1X65A 4LF8Q 3PO3H 2NTTA 4JV5Q 4OO1G 1G2SA 2A6HC 2JJQA 1ET9A 2OWOA 4RA8A 3NHHA 4XIGS 3HOYG 4GKJQ 3GTLB 3FKIG 2ATWA 2LKVA 3UDIA 1JJ2A 1EY0A 3SR1A 1IBKQ 2ZXOA 4BBSG 5M3FB 1E7ZA 3P1HA 4DAMA 1RD9D 1SNOA 2XGTA 1X3PA 1PH8A 5M5YB 1WCMG 3NBIA 1D7QA 1HZCA 1TQOA 3NUCA 1SMXA 1V9PA 5ISRA 4CKEA 3PV0A 2WAQB 3G48A 2D0OA 4BA1I 1E3PA 2B2TC 4ZLTF 2RSNA 5C0XJ 1WD1A 3RZOB 2AWOA 1EQRA 2HDLA 3M4QA 3H94A 1JOOA 2GVBA 2MHVA 1JWSD 1D1KA 5LL6X 4LNQA 2YU9H 4QIWE 4ZKCB 3SK5A 2Z6KA 2VUMH 2JA7G 1PFMA 1PTOH 1PLFA 2F3VA 2OCEA 1EWHA 3SDZA 1SYEA 1ZYRC 2KCNA 4QB4A 1EEFD 2Q2UA 1HTLD 1LT6D 2G5DA 5C4XH 2R92G 4Y7NH 1XJVA 2A8VA 4EQNA 2XRQD 4HSPA 3S16H 3S14B 4DF7A 2RHQB 1LTGD 4LUZA 2KHSA 3RZDH 4A3MB 1UEAB 4A3JH 1F9RA 4JG2A 4DUZQ 2DJFC 1EYDA 2F0PA 4JI5L 1QWYA 1HR0L 4WJWA 1XMQQ 1EQTA 4JPBW 1YITA 1EY6A 1G291 1N33Q 4R9WA 1Q8IA 1BKBA 2R6GA 4U68A 2ZJPA 2B39A 2EYJA 4ABNA 2XNAC 4CJ1B 5EGTA 1XNQL 4A3KB 5J22A 4C3HH 1CTMA 4OO1I 4C3JG 2MQHA 2EVBA 2PMZE 2K75A 2UXBQ 1TIID 4K6DA 4FXDA 2YV5A 2KCCA 1JWMD 1XMOL 1PZKD 1NE3A 3J7AF 3HOXB 2JQOA 3KBXA 1GXDC 1EFWA 1L1OA 4NXMQ 4Q0FA 1A8VA 1FD7D 4OONA 5EBDA 3I55A 5LMUQ 1FL0A 1PTOC 1MSHA 1IBLL 2NVQB 3T1YL 1S72A 5IY0A 2EYPA 1B3AA 4DR3L 1VQNA 3UDGA 1I4GA 3PO2H 1EOTA 4X6AH 3GP7A 4JOIA 2EJGC 1TVXA 4CJ2C 2K01A 4LK1C 1WTRA 2YYZA 2K32A 4JYAL 2N3SA 3MEHA 5IP7H 2VQEL 1HJPA 1K9MC 1JCKB 2SNMA 2ASBA 1EOVA 5I9PA 4K5VA 2Z4HA 1N34Q 3K0YA 1Q46A 1X3GA 4QGUA 1VQLA 3PIO3 4YWKA 1TS2A 2PW5A 4RKLA 1DONA 5LL6S 2J0TD 4GLVB 3Q8DA 3BJUA 4B3MQ 2R7FA 3ER0A 3C2PA 2KEDA 1VMCA 5ELDA 1X54A 4X66L 4A3EH 1TXYA 1X55A 1L1OC 3PIPA 4JI4Q 1Y8NB 3BYYB 1Y14B 5FLMH 3J80c 5BR8Q 4C56C 2PZUA 5FLXE 3AB9A 1A2TA 4JI6L 1B70B 1HZ9A 3GTQH 4GLAC 1Y1WB 1AW7A 1SE4A 3V05A 3J81i 1Q86C 1A0IA 1LYLA 1S5FD 1D8LA 1TT2A 4LF9Q 2IL8A 2KUMA 4JOIC 3V96A 3I7FA 1DM0B 1EWCA 4A93B 2BOSA 5EKKA 1N32Q 1TWAB 4LW1A 2ZTCA 4RGNA 4DUYQ 5ELNA 3OSOA 3ULJA 1VQJA 3RN5A 3FDTA 4RGOS 4F87A 3GTOH 1NTGA 2OEOA 2K50A 2RVLA 2E76C 3F2UA 2BH8A 2IX0A 1HFNA 1HUMA 4IUVA 3GTJB 2DUDA 1LO5D 2ZTDA 3GTQB 2FMMA 3SEBA 3K7AB 3S1RB 2JA9A 2ZTEA 4YIJA 4UAIA 3PF5A 3UDXA 5FOBB 2EDGA 1KAAA 4GKKQ 4DR1Q 4J1MA 4UP9A 3KF6B 1SYFA 4DPGA 3A54A 4JI2Q 1G8ZD 3T4AC 2I0QA 4A3BG 2XIWA 3MTSA 3MVVA 1ILQA 3W3AA 5AFWA 4A3IB 1I5FA 4IPCA 5IODA 1U4MA 3FHWA 3BYTB 1SLJA 4JI7L 1XYIA 2M2LA 4HAEA 1U5KA 1Y8OB 1PHJA 3RD4A 3D4RA 3KDFB 4DV1L 1NJIC 3PUVA 5FO9B 1EFID 1HA5A 1I3QH 2B8GA 2I5LX 4GNXC 2QEJC 1S5CD 1ONLA 4OIKA 1G6ZA 4MN3A 1U4RA 4GKJL 4ALPA 1F2ZA 4X64L 4L5SA 1SROA 2K28A 4A3GB 3BU2A 4KY6A 1MSGA 4K5WA 3OYYA 4S3SA 3PO3B 1MBYA 4I7ZC 5IYCG 1KHIA 4A3CG 2N8NA 4LFBL 1L0XB 2WAQE 1B8AA 3CCLA 4POGA 3EFXD 2JYOA 2KA7A 2RDFA 4YY3L 2F4VL 4RWSC 1HXYD 2G9HD 3MXUA 3TMEA 5EQ0A 1B1ZA 1MJCA 3GDEA 1A6XA 3A56A 4HTHA 2ALYB 1XX8A 2PI2A 1KRTA 5KGUA 1CSPA 2K05A 1RHPA 4ZUJA 3QB3A 2Q2TA 4ZUIA 4DV6Q 3SK6A 1GJXA 2VL6A 2YTXA 3PIOA 3A0JA 5CGKA 2BDNA 4R1JA 1XPOA 3KFUA 3S17H 1GUNA 1QUQB 2YU9B 1RCVD 1CHPD 2CW0D 3VA5A 4OX9Q 2VUMB 3SE0A 5D3IB 1PTOB 4KKTA 4K0KL 1AN8A 1RJTA 3HFZB 2EY1A 2HUGA 3PUYA 3NP8A 1RF2D 4XTCS 5GADC 4HJ8A 5EAYA 3MXPA 2NN6H 5C4XB 3IKJA 5C3WA 4Y7NB 4H02A 4H7BA 3S16B 4DR2L 2C9OA 3CQZH 3RZDB 4A3JB 4NDXA 4PG3A 4ULLA 1MJEA 5EPJA 5IOCA 4FXGC 3H15A 3VDYA 2B8FA 2OQ0A 2J4XA 3ZYYX 1BBUA 3C1EA 3E6ZX 4RGMA 4QMGA 2GA4B 4KMUC 2EOTA 1O7IA 2OTLA 4LMQD 4HN7A 2F0IA 4C3HB 2EIFA 4TKOB 3P7JA 3A7AB 1HTPA 5M5YH 1L1OB 2Z9HA 3HP3A 5C3XA 1EIHA 3M4OB 2VS1A 1XXGA 1JOKA 3A7LA 1JE5A 1JJCB 4DGZA 2RQXA 4XYOA 4UY8C 2D0PA 4PMWA 1VQDA 3J80i 4PQXA 3C1FA 4K14A 4F8MA 5F2DA 2MP1A 1EEID 1Q1BA 1WI5A 2EY5A 1D5ZC 3PO2B 4LF5L 2KVMA 1I4XA 2B2VC 2BE5D 4DAPA 2ZT9C 3L3OC 1IYJB 5KNBA 4ME5A 2D62A 1YNNC 1GVPA 3H0GG 4QIWB 4BBRH 1BCPD 4LAAA 5EPKA 1SRUA 2BDOA 3CC7A 1HNZL 1GUWA 4H44C 3FVQA 1JB7A 1KIXA 3TREA 1QE6A 4FF1A 1M4VA 5BR8L 2K5QA 1PDQA 1XNRL 5CV5A 1T5XD 3TZDA 3JAME 4BA2I 1DD2A 3W1GA 3OTOL 1HPCA 1JORA 1E2ZA 5IP9G 4OO1H 4LF9L 4A3EB 2R7DA 1W2BA 2F0VA 5I9OA 1NAPA 4H13C 3BS1A 4LUVA 5EBCA 3I4NG 1I50H 1HR0Q 3K59A 3HOYH 1ENAA 3FKIH 3DM3A 2AMCB 4BBSH 1HUNA 2E2DC 3U9OA 3S1NH 3FPPA 1XNQQ 2KENA 1NR2A 1YZ6A 2UUBL 2E75C 1S3OA 1S5BD 1WCMH 3BG3A 1NUCA 3MFGA 3VYUA 1STGA 1VQHA 3OMGA 4RHSA 4CBVA 1XMOQ 1IXRA 3EJIA 3PF4A 5G3LD 1E22A 1KDBA 4DXFA 3I3CA 1ENCA 4GNXB 4MNOA 4HIMA 3T1YQ 3HOZG 1J9OA 3GTOB 2A68D 4RMFA 1JE4A 4JI1L 2EE1A 4DR3Q 4GKKL 1PH5A 2HCIA 1RDPD 5L37A 2R92H 3VYTA 3K5NA 4M8AA 1PYWD 3KYHC 2LY7A 1EY4A 1EL0A 3HKZB 3OMCA 1HZBA 2VQEQ 1XTCD 5FLXL 1SMYD 3HEJA 4X3KA 2F0KA 3DWPA 1YIJA 3H3VI 1LTRD 3W1BA 5IGCA 5IGDA 4PMBA 5JEAH 5M3MG 1PZID 5H1SE 4GN5A 5AJ3L 4I65A 4X66Q 1HH2P 1B4OA 1NSNS 1Y1VG 1Z47A 5J39A 4JI6Q 4KY5A 4YWLA 1IKMA 1NBWA 1M1KC 1I3QB 5C0XI 1TWAH 3G4SA 2MUYA 3HZXA 1EUJA 1BBWA 1BCPB 2PO4A 4NW2A 1Q8KA 3RLFA 5DM63 1SDFA 4DV7L 3U58A 3K0XA 1F9SA 1O78A 2NYZD 3ERSX 4RAUC 4B9XA 1KD1C 1ZKOA 1KLGD 2F0FA 5LMNL 2MJ8A 4JI0Q 1VDZA 1W3SA 2R7ZG 4JBKA 3H91A 3MZ5A 1WTHA 1F9PA 4FXKC 1N9WA 1PH6A 4PNYA 1EYGA 1X3QA 4OX9L 3KF6A 3BVZA 1BBXC 4JBWA 4B3RL 4C3IG 2Y0SB 3WOFA 3R93A 3JAMi 4HSVA 4LUOA 2VW9A 4UP8A 3D0FA 3M7GA 4DR6L 1I94L 3GQBA 3S1MH 2E2JH 3PUXA 1K83H 2B2TA 3KLWA 2PZTA 1D2BA 1B9MA 2E5LL 2A5HA 3KDFA 1VQ6A 4JI7Q 3GD7A 4DK0A 4DV3L 3S1QH 2CVRA 3ULLA 2F0DA 2FJ2A 1VQ8A 4DV1Q 3CQZB 2DNEA 1Z7TA 3UE1A 1CI3M 4A3FB 2BH2A 2HIXA 1WD0A 2EXZA 1X6OA 4RCNA 4Y52H 1QVCA 4EQ5A 4A3LG 5I4DA 4XQJA 1L0YB 3E3XA 4X64Q 1K8OA 3A8KE 4I7AA 1STYA 4JW0A 5C4ZA 5IT9E 1KNEA 1VCIA 2RDGA 3CPWA 5GAEC 1B7YB 4LFBQ 1JQYD 3A5UA 3OPOA 4J8QA 4QUCA 3TSSA 1PFBA 2WB1B 4BWGB 4YY3Q 1VQKA 4HCSA 1EU4A 2HDMA 2PCFB 2F4VQ 2NVXH 1HQRD 2V4DA 3GTPB 4R4CA 1AE2A 5JJZA 4H0LC 3EQLC 4X62L 3RNUA 1QUQA 1VQPA 1T9HA 1TKWB 1YNJD 1BOSA 2QEXA 2GN5A 3E0JA 4ZCKA 3ULPA 3MWYW 3DHQA 3TP8A 4FYDA 1IKLA 1FNUA 2RSOA 4BXXH 4KK7A 1EIFA 1II3A 4UPAA 3VR4A 3BDOA 1BNZA 2IT1A 4AYBG 1GUSA 4K0KQ 3D6CA 4BBRB 2F0WA 3SVMA 1W6JA 4JBMA 4F88A 1KAWA 1K3RA 1VQ7A 2UU9L 2PNRC 3K57A 1SNPA 1SYGA 4DR2Q 5K36G 4X3SA 3FEWX 1PVOA 3I8ZA 5J1ZA 4PV1C 4EQPA 4KKUA 2SDFA 1SYDA 5CMDA 1SAPA 4KLKA 5IYDG 1SEBD 1I50B 2PNHA 3HOYB 5FLXc 3FKIB 2A19A 1PH4A 3M4OH 4BBSB 2KECA 1BR9A 3ZJYC 4KHZA 4KI0A 3S1NB 4FF3A 3CC2A 5E7NA 2F1MA 2IHEA 3DUZA 5JJLA 1WCMB 3G71A 4OIJA 3CCQA 1PTOF 4N9PA 2JA6H 4KV6A 4KTAA 2YTYA 2F0SA 2SNSA 3HKZE 1EWIA 4MTKA 3DWQA 3E0EA 2QDLA 2K4KA 4QF4A 1TS5A 4DU9A 4WFN3 2JA7B 1QZGA 3TBIB 3NQTA 3HOVG 1K28A 4K5XA 3TN2A 3CW2C 3JAML 4LF5Q 4ME3A 1SBBB 2R92B 5IGBA 2F0JA 2CH4A 4U673 3A8IE 3I4MG 1RKNA 1LTID 3A74A 3CCVA 3L0OA 2Q8RE 5C4JH 1HNZQ 2L12A 1BDOA 3EBEA 1CQFA 4UHVA 4DV5L 1XNRQ 1NY4A 3CAMA 4NMZA 4ODGA 4YCUA 5EPLA 3J81j 4B3SL 1VQIA 5CORA 4TSSA 3OTOQ 2Q2HA 5ELCA 4N9TA 2JSOA 3OWFA 2ES2A 1NNXA 2K5NA 4C3JB 5EKLA 4IUTA 2IWHA 1NR4A 3NTIA 5FK9C 5M9OA 2B3GA 3CCRA 1RTNA 1VQAA 4OEMB 4FP5D 3MHBA 1JC7A 1F2MA 2L55A 4OXPA 3WWVA 5C3EG 3TP7A 2UUBQ 4GS3A 2WKCA 5C44G 4JI0L 4DK3C 1UAPA 2N55A 5A2QE 4YHHL 2JN4A 4OWWB 2PI2E 4GNXA 4GZYC 2XVSA 4IPHA 1GM5A 3HOWG 4F7XA 2X69A 1H9SB 1SJHD 2VZAA 2Y0SE 3KF8B 2K03A 3QOJA 1GUOA 2FINB 2F52A 2WINB 2XSCA 3H0GH 4JI1Q 4CHTB 1CA6A 1X32A 2UXDL 3CRKC 1LUZA 4HCEA 4KN4C 1IYUA 3D31A 5CV4A 3H3VH 3HOUG 1T5EA 1VQ4A 1D1IA 4K2KA 5D3DA 4IFDJ 1SE2A 5GROA 2B2YC 1S40A 1HR0W 1ZXTA 2CW0C 2MNAA 1HNWL 1JWUD 1ICWA 5E1FA 4QQBX 1KNAA 1E1OA 2E74C 1A3TA 2PQEA 1OXTA 2OTJA 3OHXC 1L2FA 2IX3A 3I4NH 1GUGA 4YCVA 3DLLA 2F0TA 4LFCL 3PMFA 5LHY1 1F2YA 1N8RC 3S1MB 1W6KA 3BZCA 2E2JB 2F4IA 1K83B 2A6ED 3I4LA 5C0XH 2ZJQA 2VUMG 5AJ3Q 1CT1D 2CQAA 1CHQD 1NMGA 2HCCA 4R4QA 4LF7L 4MHEA 3PSIA 3S1QB 5C4XG 2B63H 5EKIA 2X6LA 2F3WA 1MHWC 1FGBD 4GN3B 4L5RC 3H6MA 4C2MH 1V1PB 4BY7G 2DJGC 2EY2A 4OGQC 2B2UC 1B2TA 3TDQA 4C1NI 1LTTD 4DV7Q 3HOZH 2B2WC 2AUJD 2WB1E 3E5SA 2LXJA 3E9HA 3H3VC 2UUCL 3Q6SA 2UXCL 2TMPA 2I46A 1QOHA 2D9UA 5LMNQ 4C3HG 1AE3A 4GOPC 4NXNL 4ZAIA 3LWUA 3CD6A 2R93G 4KHPL 3BZKA 3F2BA 3KOJA 2EZVA 3U4ZA 2BE5C 1Z9FA 3PQIA 3CKIB 1JICA 1A3VA 1QVFA 3H09A 2NVXB 5FJ8G 5M3MH 4FF4A 3G7LA 2VB3X 2XWJB 5E4XA 3FP9A 4G57A 1BCPC 1Q90A 4B3RQ 2QA4A 3AEVA 2Q8IB 5JJIA 1ICFB 3AFPA 3DMUA 3K80C 3TS0A 1BCPF 1CKNA 3S24A 4XQQA 3TP5A 1CUKA 3WOEA 1EYAA 2L0CA 4NKLA 2E2IH 2K5DA 4DR6Q 1I94Q 1Y1VH 2CFMA 3N6RA 2D5DA 1G6PA 4PMCA 5DAUA 1SN8A 3DXJC 3FRPB 3NBHB 4A3FH 1U0LA 1QNKA 5IP7G 3KJOA 2F0GA 2E5LQ 2IX1A 3BDLA 2B2VA 2X6GA 2ZXPA 4DV3Q 1J5EL 1FR3A 3M9BA 5IT9L 3VR2A 4G7OC 4IOAA 1K8MA 3JAMc 1V1QA 2KCTA 1LACA 3K6OA 2NVTH 3NPPA 4E6IA 3NWSA 1B44D 3CU7A 2VQFQ 3MXNB 1JB3A 1MD2D 3CP0A 2BA1A 5JOBA 1FVIA 4JC0A 4ZQ3A 5C5LA 3CF5A 2R7ZH 2F0NA 3RMHA 4AQYL 1Y69U 4CJ0B 1PH1A 3CCMA 4DV4L 5G3LF 5KNCA 4B9WA 1GHJA 3GTPH 3W2DA 2A68C 1X3FA 2NB0A 5CV6A 4DNRB 4C3IH 1TWGH 2JA6B 4MZ9A 1STHA 4BY1H 3MFYA 2K5WA 2JA5G 3NE5B 1VQBA 2H4OA 3STBD 1EQVA 1K3BC 4YWMA 3SXHA 3ERQA 1IZ6A 1CKOA 4IUNA 1SMYC 5T1IA 3NWTA 3L9AX 4X62Q 1B50A 2KBNA 4P71A 1TS3A 3KLSA 3I73A 1FJGQ 1NCVA 3T13A 1MKHA 4KN7C 1DCZA 3NELA 3NEMA 4DNIA 3RLOA 4IUQA 3I4OA 4IUPA 1DOLA 4N8FA 3SK4A 3ND9A 2LMCB 1RTOA 1SE8A 5I2XA 5C4JB 4A3LH 1LTSD 1LT5D 4C1NK 1OXSC 2J7ZA 1MGSA 2UU9Q 1CZWA 3L2PA 1RODA 4HIOA 4EVOA 3O13A 3K5MA 2VB2X 4RH6A 4K8JA 2KCMA 4ZRZA 1IBML 5CV9A 3T16A 2G9DA 3X3MA 2RDHA 4HEDA 2RCNA 5DLQE 3EVQA 5GAHC 1LT4D 2ZM6L 1DOKA 2EYLA 3NTKA 2SOBA 3TRZA 1LLRD 2F03A 5C4HA 1AEXA 1C48A 2FXQA 2JA7H 1OXUA 2IW3A 1EZ8A 4R8NA 4IQZA 4LF6L 1PRTD 3NTHA 1YJNA 1R9TH 4LF4L 3Q0AA 3S15H 4IN3A 4UDUC 2JA8G 5GAGC 4GN4B 3H0GB 5D14A 1FGUA 1V1OA 1JR0D 5ELBA 4APVA 4L63B 2HT1A 1UNSA 4QUFA 4LWCA 4O42A 3U4VA 2M9VA 2A69D 5K36H 1CQVA 4X65Q 5M5WH 5CR3A 5CV8A 2EYHA 1AH9A 4HJ7A 3ND8A 4C3JH 2I5MX 4GOPB 4IALA 3PGZA 1K0RA 4B08A 3I4NB 5HGQA 2DY7A 4DV0L 4DV5Q 2HHHL 1C7YA 1X56A 3I56A 3TZUA 4B3SQ 2JXMB 4XQNA 4A3DG 2WV6D 1XPRA 5A2QL 3URYA 3W5OA 1STNA 4PZ6A 3U9SA 4J6HA 1Q1EA 3D6WA 3S9WA 4FF2A 3J7A5 5TSSA 3SHLA 1SSOA 4HMIA 2KEEA 2RKSA 2B63B 4HJAA 1LTLA 4A76A 3LGJA 1I4RA 4C2MB 4OWTB 4QY7A 3RUZA 1VF7A 2ICEC 2WACA 4JI3L 5KIXA 3HOZB 2L11A 2L1BA 4YHHQ 1D6EC 3HOVH 5I6YA 1H9SA 3K5OA 1DJRD 3KF8A 4DR4L 3GV3A 5IT9c 5DEHA 5M3FG 2TSSA 4TVAB 4DK1A 1C8CA 1IW7D 2EQSA 3LWEA 3I4MH 4DXGA 2EXDA 2B29A 1AZQA 1HZAA 3Q22A 1YNJC 1QVGA 4B3TL 2UXDQ 4LJZC 4WORA 1LV9A 3VA7A 2M00A 1SR3A 2WAQG 5C6AA 3HG9A 2IPKD 1ZEQX 2LSSA 1X9NA 1CKNB 5M3MB 1XPUA 1WJJA 1YNXA 1HNWQ 2F0HA 3RLNA 1Z6HA 2NUCA 1N36L 5E3FA 5CYUA 3EA6A 4FNFA 1JJGA 1Q3LA 5IIFA 4LFCQ 2E2IB 4RGTA 1Y1VB 1TS4A 3EIVA 2AWNA 1ASYA 2RBMA 1GUTA 3QR8A 2VQFL 3QOLA 1WOCA 4A3MG 2JK8A 1YHBA 5HURA 5T1GA 4R4TA 3MC0B 4BBRG 1L0WA 1C0AA 5C44H 1O7YA 4IZ8A 2PZWA 1V1PA 4LF7Q 1QG7A 1A2UA 3R2IA 4CKBA 2O4XA 1TWCH 5IE8A 1UE1A 2PW7A 4IO9A 4HIKA 2DGYA 2K6AA 2NVTB 1GHKA 1P16A 4A3KG 3HOWH 4IFDG 1PMRA 1ESRA 1QZHA 2O2LD 1J8IA 4AH6A 1SNMA 3JC66 5I2YA 1Q7YC 2R7ZB 2AQ2B 4WJ4A 3J81E 1XTDA 2UUCQ 2UXCQ 3HOXG 3EN2A 1PV4A 3HOUH 1Q12A 5KEEA 2H1EA 4PZ7A 3T56B 3CMEA 4A3BH 1CK1A 3PUZA 3S2DH 3GTMH 2ID0A 4EQOA 4C3IB 3BDCA 2WFWA 3X3NA 4NXNQ 1TWGB 1Q82C 1HNXL 1E2WA 5BN5A 4BY1B 1FJGL 4KHPQ 2DY8A 4NB3A 5IGFA 2F0QA 2JP1A 1DYQA 5IGGA 3P75A 5I6WA 4DA2A 2WIIB 3A55A 4ILWA 2CWPA 1PH9A 4EGVA 4FDBA 2NZHA 1IL8A 3HRZC 1F2LA 1WTWA 1JOQA 3V2TA 3F1ZA 3T1HL 1I4QA 3DM1A 3A8JE 3I90A 3Q23A 3NBHA 2KHIA 2F0OA 2Z6BA 3K8AA 3NENA 3KJPA 1DXMA 4BY7H 4IURA 3FPUB 4IPGA 2VNUD 5IYCH 3SK8A 2YTVA 4HR7B 4IPDA 4A3CH 1J5EQ 3G6EA 4MIUA 3LX0A 2E8GA 2F0LA 5LMNW 1YBYA 1U9RA 2XWBB 1STBA 3MXNA 2BA0A 5JEAG 2KJXA 1K73C 3AMUA 3KBGA 1Y1WG 1EZ6A 2LFNA 1EY9A 3N52A 4DR5L 4IFDI 3OWEB 2QGQA 1OXVA 2F3IA 2A6HD 1A15A 3TEHB 4AQYQ 2PQAA 4IOCA 2R93H 4X3TA 1STEA 2Z6KC 1K0SA 4DV4Q 4A93G 3M3YH 1EQQA 2IHFA 2K04A 5FJ8H 3C46A 1TWFH 3BZDB 1IL2A 3CMAA 3E9IA 3ITPA 4V0BA 4L8JA 1K8GA 2NVYH 1R9TB 2D2CC 1VS0A 3S15B 1GOZA 2HQLA 1HHVA 5IYBG 1TU2B 3AYHB 3S2HH 3I91A 1I6HH 4X65L 3HKSA 2UUAL 1WTXA 1ET6A 4AYBB 1SXTA 4NP5A 2L4NA 2OXPA 1EYCA 3RR5A 1MI2A 1GKHA 1HA6A 1QB5D 2R3ZA 1CA5A 1H9RA 1ZYRD 3GV6A 2L15A 1OO9B 4XDXA 3UDFA 2EJFC 2A6EC 2K52A 1D5MC 1EIYB 3CCEA 1AFPA 5M5WB 3GTKB 5NUCA 2Z8LA 1VF5C 4P72A 1C9OA 4A3IG 2QCPX 1QJOA 2B2YA 1PXUA 3OIPA 1H9JA 2R61A 2HQEA 2AQ3B 1E0BA 2QKIC 3R3OA 3OIQA 4CGYB 3IRBA 1IHZA 2AQ1B 4OL7A 2L5TA 4HMJA 1G51A 3MEFA 1IBMQ 1TWHH 4KD3A 3VR5A 1E1TA 1QCBD 2KQ3A 4ZYSA 3MAQA 1LTAD 2XTIA 3NQIA 3VYRA 1UE5A 1QILA 2Z0SA 4OHJA 2JA5H 1EIGA 3PCOB 3KLSX 4A3GG 1VQOA 2ZM6Q 2CQOA 5JPNC 5KNDA 3PO3G 1K8AC 5C5MA 1O7LA 1KABA 2CHBD 1B3QA 3L7ZC 3HOVB 1PTOD 2EYOA 4LF6Q 2B2UA 4RHRA 4A75A 3OW2A 2RCFA 3HGBA 4LF4Q 2Q2IA 4DV2L 4FVMA 2B2WA 4WRDA 2QF7A 4OWXB 3KUPA 2VXWA 3BVGA 3QJYA 5IP9H 3I4MB 1AZPA 2K33A 2XRSD 1VQGA 2WP8J 4DN4M 3OW7A 4LFAL 4CDCC 4CDDC 2ENBA 3NXWA 1KRSA 4GOPA 3J80E 2JEBI 3I72A 1RL2A 2EYMA 4KHVA 5JVH3 3MA2B 1CSQA 4DAYA 1HRJA 3D8GA 5IWAQ 1UUPA 4DKAC 2LXKA 1JT8A 1FNWA 4DV0Q 3I2ZA 4UP7A 4L5QA 5CC4A 2HHHQ 4TQUS 5CV7A 4CKCA 2OQKA 2MGSA 1J6QA 4BXXG 1ML0D 5C3EB 3GO5A 1SYBA 3GTGB 3TS2A 3NK9A 4LF8L 5E4WC 4A3JG 1KLUD 4JV5L 2L9HA 3QWNA 3PUWA 2Q8TA 5C44B 1UE6A 1YVCA 4K6LA 1TWCB 3I70A 1BF4A 1UWVA 1IBKL 1PYBA 2E2HH 2FMCA 1S4ZA 3HOWB 3K5LA 1TR5A 4JI3Q 2JA8H 5M5XH 1STAA 1I4PA 3K58A 2A73B 5JEAJ 1SNDA 1KXLA 4DR4Q 3MXGA 3EROA 2WKDA 4QL5A 2NWGA 3STBC 3QO2A 3HOUB 3NSWA 1SFOH 5EJWA 4A3BB 3S2DB 3GTMB 2EJMA 4WJ3M 2LS01 4JI8Q 2KHJA 4OELB 2NZ1D 4B3TQ 1WVLA 2JA6G 1AP0A 3PO2G 4XT3B 4KD4A 1BVSA 4YCWA 5CBEE 4AIMA 3IFTA 3T51B 1VQEA 3RN2A 3J7YW 2DNCA 5FKAC 4A3DH 1X3EA 4XT1B 4DR7Q 3CXCA 1EY8A 1N36Q 3DEOA 4DUZL 3QIAA 5A35A 3QG1A 1PA6A 2EPBA 1O80A 3T53B 1XMQL 4ZK9B 3F2DA 3IFDA 1N33L 3UE0A 5BN3A 1I6VC 3UI2A 4BY7B 3R2TA 3P20A 3J81L 4HIDA 4N8X1 1FYCA 4CDEC 4R8IA 4A3EG 3D4DA 2UXBL 1LT3D 2P5ZX 1GD7A 2DN8A 4J15A 3KLRA 5IGEA 5FLMG 2K5VA 1LTBD 4P74A 3GTLH 3F2CA 1VMPA 3VYSA 2OF1A 4EX5A 4RG1A 3CCJA 3M4PA 5M3FH 5DNFA 3DEPA 2PQAB 2CWAA 1KL9A 4NXML 4A4IA 1A62A 1VQ9A 2F0EA 5LMUL 1ASZA 4KY7A 1C4QA 1TY0A 4P2CB 1S5ED 1PFSA 1H9MA 1V8QA 2K5HA 1SNQA 2R93B 1PRTC 1OTCA 4L5TA 4PZ8A 1WYDA 4NPSA 1PRTF 1D5XC 2CKZB 3M4YA 3M3YB 1VQCA 5J3BA 3WDNA 3RZOH 1GO3E 4AYBE 1TWFB 1Q81C 1HQMC 2RHSB 3IAYA 4JVZA 1V43A 4IUUA 2AKWB 1HNXQ 2NVYB 1M8AA 1N34L 4XYQA 4O0AA 2AUKA 4TRDA 1WTOA 4KKSA 3CCSA 1M90C 2V1CC 2A69C 2IY5B 5JPMC 3S2HB 1I6HB 3HKZG 4B3ML 2AHOB 3M85A 3S14H 2IJ0A 3Q24A 3AFQA 1KQSA 2I5HA 3T1HQ 4A3MH 1PH3A 4O1NA 4P73A 5JAVA 5D65A 1S5DD 3K7UC 4JI4L 1PH7A 4POFA 2JE6I 4R4OA 3J7ZC 5ELFA 1OXXK 2BCOA 4MTNA 5CBAE 2A74C 3B6YA 4IJHA 1G91A 2NTSA 1WTQA 2HIVA 4M1UB 4DK6C 4A3KH 1YJ9A 4IFDH 2SEBD 1CFMA 4DFAA 4GLXA 3J7AV 1EY5A 1YHAA 1E24A 4JI5Q 5COYA 4Z9CB 2N78A 3SGIA 3HOXH 1ILPA 1N32L 5C0XG 3OOCA 4DR5Q 1YI2A 5FO7B 3AQQA 4DUYL 1TWHB 2MPMA 4QCLA 3M7NA 2ZXRA 1CM9A 2NVQH 1E2VA 2Z4IA 2PMZB 2H5XA 3K81C 4G4KA 2NBFA 4ZKBB 1JMCA 1VQFA 2C5CA 4RKBA 2B63G 2JA5B 2MO1A 2O5IC 1IW7C 4HJ9A 2N49A 3G6JB 4O2DA 5KYIA 1B9NA 4K8IA 4R4IA 1PFNA 1R4QB 3U50C 1IBLQ 2XN9C 1A3UA 1PZJD 5KYLA 4DR1L 2K7VA 4JI2L 1YEZA 1PH2A 1BUVT 2UUAQ 4JYAQ 2FFKB 5DM73 3GTKH 4JCVE 1YNND 2CCZA 2MFIA 2Y0SG 5IWAL 4Q5VA 5IYDH 1H95A 1HFGA 2A1AA 1CZGA 1DGSA 3HS0C 4FO2A 4XXEA 4DAYB 1F77A 1BO0A 1NMFA 1ESFA 1XWEA 1WTVA 5ELOA 3R8BA 2EY6A 1Y1WH 2QILA 1WFQA 2I07B 3CCUA 1HCZA 2JEAI 2CH4W 1R4PB 1LABA 1KDCA 2K1BA 2K14A 2KOLA 1O7ZA 3CHBD 2NN6G 1DOMA 4X3UA 2OT2A 1DZ1A 5HGTA 1FNVA 1G2TA 4A93H 3A5ZB 3CC4A 4HJ5A 4BS9A 4IJLA 1VQMA 1SE3A 4A3FG 2EYFA 4RFBA 4CDFC 1I4HA 1BQQT 5HY6A 1SNCA 2NZOA 3LNNA 4P75A 1BXTA 2O5JC 4RCOA 4JBJA 4ID6A 3C3LA 4G7ZC 1YJWA 2GVAA 3CRLC 3D4WA 2MO0A 2E2HB 1U4PA 3TQYA 2ZJRA 1A63A 3AU7A 4DAVA 5GQOA 2N88A 2F0UA 2JA8B 4G7HC 3GTJH 5IYBH 5M5XB 1UE7A 1KTKA 1RIPA 3KK7A
chains in the Genus database with same CATH topology
1SYCA 2F0MA 1KDAA 3VR3A 2Z1CA 5ELEA 5BN4A 3J80L 2FHTA 1H9KA 3VR6A 1TY2A 4L6TB 1EU3A 1SFOB 5KRUA 1IYVA 3ONAB 1EY7A 1F9QA 3TP6A 1U4LA 2ICIA 1QNUA 2RA4A 5FO8B 1PRTB 4V190 2QDBA 3BVMA 1B53A 3S17B 4A3DB 1SJED 1ENFA 4KJOA 3DWAA 3PIP3 4K2LA 3FMCA 2PPBC 2PYKA 3D3RA 4JK1C 5JVG3 2NN6I 1WTPA 5K5PA 4DNTB 4KJNA 1Y8PB 3IL8A 2NTTA 4OO1G 1G2SA 2A6HC 1ET9A 4RA8A 3NHHA 4XIGS 3GTLB 2LKVA 1EY0A 3SR1A 2ZXOA 5M3FB 3P1HA 1RD9D 1SNOA 1X3PA 5M5YB 3NBIA 1TQOA 3NUCA 5ISRA 4CKEA 3PV0A 2WAQB 4BA1I 4ZLTF 2B2TC 5C0XJ 2RSNA 1WD1A 3RZOB 2AWOA 2HDLA 3H94A 1JOOA 2MHVA 1JWSD 1D1KA 5LL6X 4ZKCB 3SK5A 1PFMA 1PTOH 1PLFA 2F3VA 1EWHA 3SDZA 1SYEA 1ZYRC 2KCNA 4QB4A 1EEFD 1HTLD 1LT6D 4EQNA 2XRQD 4HSPA 3S14B 4DF7A 1LTGD 2KHSA 4A3MB 1UEAB 1F9RA 1EYDA 2F0PA 1QWYA 4WJWA 1EQTA 1EY6A 1G291 4R9WA 1Q8IA 2R6GA 4U68A 2B39A 2EYJA 4ABNA 2XNAC 4CJ1B 5EGTA 4A3KB 5J22A 1CTMA 4OO1I 4C3JG 2EVBA 1TIID 4K6DA 4FXDA 2KCCA 1JWMD 1PZKD 3J7AF 3HOXB 3KBXA 1GXDC 4Q0FA 1FD7D 5EBDA 1PTOC 1MSHA 2NVQB 2EYPA 1B3AA 1I4GA 1EOTA 3GP7A 2EJGC 1TVXA 4CJ2C 2K01A 4LK1C 1WTRA 2YYZA 2K32A 3MEHA 1JCKB 2SNMA 5I9PA 4K5VA 2Z4HA 3K0YA 3PIO3 1TS2A 2PW5A 4RKLA 1DONA 5LL6S 2J0TD 3C2PA 2KEDA 1VMCA 5ELDA 1Y8NB 3BYYB 4C56C 2PZUA 5FLXE 3AB9A 1A2TA 1Y1WB 1AW7A 1SE4A 3V05A 1S5FD 1TT2A 2IL8A 2KUMA 3V96A 1DM0B 1EWCA 4A93B 2BOSA 5EKKA 1TWAB 4RGNA 3OSOA 3FDTA 4RGOS 4F87A 2OEOA 2RVLA 2E76C 3F2UA 2IX0A 1HFNA 1HUMA 4IUVA 3GTJB 1LO5D 3GTQB 2FMMA 3SEBA 3K7AB 3S1RB 4YIJA 4UAIA 5FOBB 2EDGA 1KAAA 4J1MA 1SYFA 3A54A 1G8ZD 3T4AC 2XIWA 3MTSA 3MVVA 1ILQA 3W3AA 5AFWA 4A3IB 5IODA 1U4MA 3BYTB 1XYIA 2M2LA 4HAEA 1Y8OB 3RD4A 3D4RA 3PUVA 5FO9B 1EFID 1HA5A 2B8GA 2QEJC 1S5CD 1ONLA 4OIKA 1G6ZA 4MN3A 1U4RA 1F2ZA 2K28A 4A3GB 4KY6A 1MSGA 4K5WA 3PO3B 4S3SA 1MBYA 4I7ZC 1L0XB 3EFXD 2JYOA 2KA7A 2RDFA 4RWSC 1HXYD 2G9HD 3MXUA 3TMEA 5EQ0A 1B1ZA 1A6XA 3A56A 4HTHA 1XX8A 5KGUA 2K05A 1RHPA 4ZUJA 3QB3A 1GJXA 4ZUIA 3SK6A 5CGKA 2BDNA 1GUNA 2YU9B 1RCVD 1CHPD 3VA5A 2CW0D 2VUMB 3SE0A 5D3IB 1PTOB 4KKTA 1AN8A 1RJTA 3PUYA 2EY1A 2HUGA 3NP8A 1RF2D 4XTCS 3MXPA 2NN6H 5C4XB 3IKJA 5C3WA 4Y7NB 4H7BA 3S16B 2C9OA 3RZDB 4A3JB 4NDXA 4ULLA 5EPJA 5IOCA 4FXGC 2B8FA 2J4XA 3ZYYX 4RGMA 3C1EA 3E6ZX 4QMGA 2GA4B 4KMUC 2EOTA 4LMQD 4HN7A 2F0IA 4C3HB 4TKOB 3P7JA 3A7AB 1HTPA 3HP3A 5C3XA 1EIHA 3M4OB 1XXGA 1JOKA 3A7LA 4DGZA 2RQXA 4XYOA 4PMWA 4PQXA 4F8MA 3C1FA 4K14A 5F2DA 2MP1A 1EEID 1Q1BA 2EY5A 1D5ZC 3PO2B 2KVMA 1I4XA 2B2VC 2BE5D 4DAPA 2ZT9C 3L3OC 5KNBA 4ME5A 2D62A 1YNNC 4QIWB 1BCPD 4LAAA 5EPKA 1GUWA 2BDOA 4H44C 3FVQA 1QE6A 4FF1A 1M4VA 2K5QA 1PDQA 5CV5A 1T5XD 3TZDA 3JAME 4BA2I 1DD2A 1HPCA 1JORA 1E2ZA 4OO1H 4A3EB 2F0VA 5I9OA 1NAPA 4H13C 3BS1A 5EBCA 3K59A 1ENAA 1HUNA 2E2DC 3U9OA 3FPPA 1NR2A 2E75C 1S5BD 3BG3A 1NUCA 3MFGA 3VYUA 1STGA 3OMGA 4RHSA 4CBVA 3EJIA 5G3LD 1KDBA 4DXFA 3I3CA 1ENCA 1J9OA 3GTOB 2A68D 1JE4A 2EE1A 2HCIA 1RDPD 3VYTA 3K5NA 4M8AA 1PYWD 2LY7A 1EY4A 1EL0A 3HKZB 3OMCA 1XTCD 5FLXL 1SMYD 3HEJA 4X3KA 2F0KA 3DWPA 1LTRD 5IGCA 5IGDA 4PMBA 5JEAH 1PZID 4I65A 1B4OA 1NSNS 1Z47A 5J39A 4KY5A 1IKMA 1I3QB 5C0XI 2MUYA 3HZXA 1BCPB 2PO4A 4NW2A 3RLFA 5DM63 1SDFA 1F9SA 1O78A 2NYZD 4RAUC 4B9XA 1ZKOA 1KLGD 2F0FA 2MJ8A 1VDZA 3H91A 3MZ5A 1F9PA 4FXKC 4PNYA 1X3QA 3BVZA 1BBXC 4JBWA 4C3IG 2Y0SB 3WOFA 3R93A 4HSVA 3M7GA 3GQBA 3PUXA 2B2TA 2PZTA 1D2BA 1B9MA 2A5HA 3GD7A 4DK0A 2CVRA 2F0DA 2FJ2A 3CQZB 2DNEA 1Z7TA 1CI3M 4A3FB 1WD0A 2EXZA 4RCNA 5I4DA 4XQJA 1L0YB 1K8OA 3A8KE 1STYA 5C4ZA 5IT9E 1KNEA 1VCIA 2RDGA 1JQYD 3OPOA 4J8QA 4QUCA 3TSSA 1PFBA 2WB1B 4BWGB 4HCSA 1EU4A 2HDMA 2PCFB 1HQRD 2V4DA 3GTPB 5JJZA 4H0LC 3EQLC 1TKWB 1YNJD 1BOSA 3E0JA 3MWYW 3DHQA 3TP8A 4FYDA 1IKLA 1FNUA 2RSOA 4KK7A 1II3A 3VR4A 3BDOA 1BNZA 2IT1A 1GUSA 3D6CA 4BBRB 2F0WA 3SVMA 1W6JA 4F88A 2PNRC 3K57A 1SNPA 1SYGA 5K36G 4X3SA 3FEWX 3I8ZA 5J1ZA 4PV1C 4EQPA 4KKUA 2SDFA 1SYDA 5CMDA 1SAPA 1SEBD 1I50B 3HOYB 3FKIB 4BBSB 2KECA 1BR9A 4KHZA 4KI0A 3S1NB 4FF3A 2F1MA 3DUZA 1WCMB 4OIJA 1PTOF 4N9PA 4KV6A 4KTAA 2F0SA 2SNSA 3DWQA 4QF4A 1TS5A 4DU9A 4WFN3 2JA7B 3TBIB 3NQTA 3TN2A 4K5XA 3JAML 1SBBB 2R92B 5IGBA 2F0JA 4U673 3A8IE 1RKNA 1LTID 2Q8RE 2L12A 1BDOA 1CQFA 4NMZA 4ODGA 5EPLA 5CORA 4TSSA 5ELCA 4N9TA 2JSOA 3OWFA 4C3JB 5EKLA 4IUTA 2IWHA 1NR4A 3NTIA 5FK9C 5M9OA 1RTNA 4FP5D 3MHBA 1JC7A 1F2MA 2L55A 3TP7A 2WKCA 1UAPA 2N55A 5A2QE 4GZYC 2XVSA 4F7XA 2X69A 1H9SB 1SJHD 2K03A 1GUOA 3QOJA 2FINB 2WINB 2XSCA 1CA6A 4CHTB 1X32A 3CRKC 4HCEA 4KN4C 1IYUA 3D31A 5CV4A 1T5EA 1D1IA 4K2KA 5D3DA 4IFDJ 1SE2A 2B2YC 1ZXTA 2CW0C 1JWUD 1ICWA 5E1FA 1KNAA 2E74C 1A3TA 1OXTA 2PQEA 3OHXC 2IX3A 1GUGA 2F0TA 3PMFA 5LHY1 1F2YA 3S1MB 1W6KA 2E2JB 2F4IA 1K83B 2A6ED 3I4LA 5C0XH 1CT1D 2CQAA 1CHQD 2HCCA 3S1QB 4MHEA 5EKIA 2X6LA 2F3WA 1FGBD 3H6MA 1V1PB 2EY2A 4OGQC 2B2UC 1B2TA 3TDQA 4C1NI 1LTTD 2B2WC 2AUJD 3E5SA 3H3VC 3Q6SA 2TMPA 2I46A 1QOHA 2D9UA 4C3HG 4ZAIA 3LWUA 2EZVA 2BE5C 3CKIB 1JICA 1A3VA 3H09A 2NVXB 4FF4A 3G7LA 2VB3X 2XWJB 5E4XA 4G57A 1BCPC 1Q90A 2Q8IB 3DMUA 1BCPF 4XQQA 3TP5A 3WOEA 1EYAA 2L0CA 4NKLA 2K5DA 3N6RA 2D5DA 4PMCA 5DAUA 3DXJC 3FRPB 1QNKA 2F0GA 2IX1A 3BDLA 2B2VA 2X6GA 2ZXPA 1FR3A 5IT9L 3VR2A 4G7OC 1K8MA 1LACA 3K6OA 3NPPA 4E6IA 3NWSA 1B44D 3CU7A 1JB3A 1MD2D 2BA1A 5JOBA 4ZQ3A 5C5LA 2F0NA 3RMHA 1Y69U 4CJ0B 5G3LF 5KNCA 4B9WA 1GHJA 3W2DA 2A68C 2NB0A 5CV6A 4DNRB 2JA6B 1STHA 3MFYA 2K5WA 3NE5B 2H4OA 1EQVA 3SXHA 3ERQA 4IUNA 1SMYC 5T1IA 3NWTA 3L9AX 1B50A 1TS3A 3KLSA 3I73A 1NCVA 3T13A 4KN7C 1DCZA 4IUQA 4IUPA 1DOLA 3SK4A 3ND9A 2LMCB 1RTOA 5I2XA 5C4JB 1LTSD 1LT5D 4C1NK 1OXSC 2J7ZA 1MGSA 1CZWA 1RODA 4EVOA 3O13A 3K5MA 2VB2X 4RH6A 4K8JA 4ZRZA 5CV9A 3T16A 2G9DA 3X3MA 2RDHA 4HEDA 3EVQA 1LT4D 1DOKA 2EYLA 3NTKA 2SOBA 1LLRD 2F03A 5C4HA 1AEXA 1C48A 1OXUA 2IW3A 1EZ8A 4R8NA 4IQZA 1PRTD 3NTHA 3Q0AA 4IN3A 4UDUC 3H0GB 5D14A 1V1OA 1JR0D 5ELBA 4L63B 1UNSA 4QUFA 4O42A 2M9VA 2A69D 5K36H 1CQVA 5CR3A 5CV8A 2EYHA 3ND8A 4IALA 4B08A 3I4NB 2DY7A 3TZUA 2JXMB 4XQNA 2WV6D 5A2QL 3URYA 1STNA 3U9SA 4J6HA 1Q1EA 3D6WA 3S9WA 4FF2A 5TSSA 3SHLA 1SSOA 4HMIA 2KEEA 2RKSA 2B63B 1I4RA 4C2MB 3RUZA 1VF7A 2ICEC 2WACA 5KIXA 3HOZB 2L11A 2L1BA 1D6EC 5I6YA 1H9SA 3K5OA 1DJRD 3KF8A 3GV3A 5DEHA 2TSSA 4DK1A 1C8CA 1IW7D 3LWEA 4DXGA 1AZQA 3Q22A 1YNJC 4LJZC 4WORA 1LV9A 3VA7A 2M00A 5C6AA 3HG9A 2IPKD 1ZEQX 5M3MB 2F0HA 1Z6HA 2NUCA 5E3FA 5CYUA 3EA6A 4FNFA 1Q3LA 5IIFA 2E2IB 4RGTA 1Y1VB 1TS4A 2AWNA 2RBMA 1GUTA 3QOLA 5HURA 5T1GA 3MC0B 1O7YA 4IZ8A 2PZWA 1V1PA 1QG7A 1A2UA 3R2IA 4CKBA 2O4XA 2PW7A 2K6AA 2NVTB 1GHKA 4IFDG 1PMRA 1ESRA 2O2LD 1J8IA 1SNMA 5I2YA 2R7ZB 2AQ2B 3J81E 1Q12A 5KEEA 2H1EA 3T56B 1CK1A 3PUZA 2ID0A 4EQOA 4C3IB 3BDCA 3X3NA 1TWGB 1E2WA 5BN5A 4BY1B 2DY8A 5IGFA 2F0QA 2JP1A 1DYQA 5IGGA 3P75A 5I6WA 4DA2A 2WIIB 3A55A 4ILWA 4EGVA 1IL8A 3HRZC 1F2LA 1WTWA 1JOQA 3V2TA 1I4QA 3DM1A 3A8JE 3I90A 3Q23A 3NBHA 2F0OA 1DXMA 4IURA 3FPUB 2VNUD 3SK8A 4HR7B 4MIUA 3LX0A 2F0LA 1U9RA 2XWBB 1STBA 3MXNA 2BA0A 5JEAG 2KJXA 3AMUA 3KBGA 1EZ6A 2LFNA 1EY9A 3N52A 4IFDI 3OWEB 1OXVA 2A6HD 1A15A 4X3TA 1STEA 2K04A 3C46A 3BZDB 3ITPA 4V0BA 4L8JA 1R9TB 2D2CC 3S15B 1GOZA 1HHVA 1TU2B 3I91A 1WTXA 1ET6A 4AYBB 1SXTA 4NP5A 2L4NA 2OXPA 1EYCA 1MI2A 1HA6A 1QB5D 2R3ZA 1CA5A 1H9RA 1ZYRD 3GV6A 1OO9B 4XDXA 2EJFC 2A6EC 1D5MC 1AFPA 5M5WB 3GTKB 5NUCA 2Z8LA 1VF5C 2QCPX 1QJOA 2B2YA 1PXUA 3OIPA 1H9JA 2R61A 2HQEA 2AQ3B 1E0BA 2QKIC 3R3OA 3OIQA 4CGYB 1IHZA 2AQ1B 4OL7A 2L5TA 4HMJA 4KD3A 3VR5A 1QCBD 2KQ3A 4ZYSA 3MAQA 1LTAD 3NQIA 3VYRA 1QILA 4OHJA 1EIGA 3KLSX 5JPNC 5KNDA 5C5MA 1O7LA 1KABA 2CHBD 3L7ZC 3HOVB 1PTOD 2EYOA 2B2UA 4RHRA 3HGBA 4FVMA 2B2WA 4WRDA 2QF7A 3KUPA 2VXWA 3BVGA 3QJYA 3I4MB 1AZPA 2K33A 2XRSD 2WP8J 4DN4M 3OW7A 2ENBA 3NXWA 3J80E 2JEBI 3I72A 2EYMA 4KHVA 5JVH3 3MA2B 4DAYA 1HRJA 3D8GA 1UUPA 1FNWA 5CC4A 4TQUS 5CV7A 4CKCA 2MGSA 1ML0D 5C3EB 3GO5A 1SYBA 3GTGB 3NK9A 5E4WC 1KLUD 2L9HA 3QWNA 3PUWA 2Q8TA 5C44B 4K6LA 1TWCB 3I70A 1BF4A 2FMCA 1S4ZA 3HOWB 3K5LA 1TR5A 1STAA 1I4PA 3K58A 2A73B 5JEAJ 1SNDA 3MXGA 3EROA 2WKDA 2NWGA 3QO2A 3HOUB 3NSWA 5EJWA 4A3BB 3S2DB 3GTMB 2EJMA 2LS01 2NZ1D 1WVLA 1AP0A 4XT3B 4KD4A 5CBEE 3IFTA 3T51B 3J7YW 2DNCA 5FKAC 4XT1B 1EY8A 3DEOA 3QIAA 5A35A 3QG1A 2EPBA 1O80A 3T53B 4ZK9B 3IFDA 5BN3A 1I6VC 3UI2A 4BY7B 3R2TA 3P20A 3J81L 1FYCA 4R8IA 3D4DA 1LT3D 2DN8A 3KLRA 5IGEA 1LTBD 1VMPA 3VYSA 2OF1A 5DNFA 3DEPA 2F0EA 4KY7A 1C4QA 1TY0A 4P2CB 1S5ED 1H9MA 1V8QA 1SNQA 2R93B 1PRTC 1PRTF 1D5XC 3M4YA 3M3YB 3WDNA 1TWFB 1HQMC 3IAYA 1V43A 4IUUA 2NVYB 1M8AA 4XYQA 2AUKA 4TRDA 1WTOA 4KKSA 2A69C 5JPMC 3S2HB 1I6HB 3M85A 2IJ0A 3Q24A 4O1NA 5JAVA 5D65A 1S5DD 2JE6I 5ELFA 1OXXK 2BCOA 5CBAE 2A74C 1G91A 2NTSA 1WTQA 4M1UB 4IFDH 2SEBD 1CFMA 4DFAA 3J7AV 1EY5A 5COYA 4Z9CB 1ILPA 5C0XG 3OOCA 5FO7B 1TWHB 2MPMA 4QCLA 3M7NA 2ZXRA 1CM9A 1E2VA 2Z4IA 2PMZB 4G4KA 2NBFA 4ZKBB 2C5CA 4RKBA 2JA5B 2O5IC 1IW7C 3G6JB 5KYIA 1B9NA 4K8IA 1PFNA 1R4QB 2XN9C 1A3UA 1PZJD 5KYLA 2K7VA 1BUVT 2FFKB 5DM73 1YNND 4Q5VA 1HFGA 1CZGA 4FO2A 3HS0C 4XXEA 1F77A 1BO0A 1ESFA 1XWEA 1WTVA 3R8BA 2EY6A 2QILA 2I07B 1HCZA 2JEAI 1R4PB 1LABA 1KDCA 2K1BA 2KOLA 1O7ZA 3CHBD 2NN6G 1DOMA 4X3UA 2OT2A 1DZ1A 5HGTA 1FNVA 1G2TA 4BS9A 1SE3A 2EYFA 4RFBA 1I4HA 1BQQT 1SNCA 3LNNA 2O5JC 1BXTA 4RCOA 4ID6A 3C3LA 4G7ZC 3CRLC 3D4WA 2E2HB 1U4PA 3AU7A 4DAVA 2N88A 2F0UA 2JA8B 4G7HC 5M5XB 1KTKA 3KK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IL8 A;  2KUM A;  3DEO A;  2B2W A;  2HCC A;  5EPK A;  5D14 A;  4RWS C;  4QUC A;  1IKM A;  1GUW A;  1A15 A;  1ILP A;  2FHT A;  4MHE A;  1QE6 A;  1PFB A;  5EQ0 A;  2EPB A;  1O80 A;  3KUP A;  2VXW A;  4X3T A;  1PDQ A;  2MPM A;  5T1G A;  1F9R A;  2X6L A;  3IFD A;  5EKI A;  4QUF A;  4NW2 A;  1XX8 A;  4HCS A;  2HDM A;  4ZK9 B;  1CM9 A;  1O7Y A;  4O42 A;  2K05 A;  1SDF A;  2Q8R E;  2L12 A;  1RHP A;  3ONA B;  3TZD A;  3UI2 A;  1QG7 A;  4DN4 M;  2K04 A;  1F9S A;  1F9Q A;  4ZKB B;  2B2U C;  1EQT A;  1B2T A;  2NYZ D;  5JJZ A;  2BDN A;  4R9W A;  4R8I A;  1U4L A;  5EPL A;  3FDT A;  4RAU C;  1NAP A;  2B2W C;  4U68 A;  5COR A;  2RA4 A;  4CJ1 B;  2RVL A;  2DY7 A;  3F2U A;  1VMP A;  1B53 A;  1ESR A;  1PFN A;  2MJ8 A;  5T1I A;  1J8I A;  1HRJ A;  1HUN A;  1RJT A;  3MWY W;  2HUG A;  3Q6S A;  1B50 A;  4IUT A;  5DNF A;  1HFN A;  1HUM A;  1NR4 A;  3DEP A;  4IUV A;  1IKL A;  1HHV A;  2RSO A;  3H91 A;  3I91 A;  2D9U A;  1NCV A;  2FMM A;  1BNZ A;  1NR2 A;  1WTX A;  2L4N A;  1RTN A;  4UAI A;  1MI2 A;  3D6W A;  3KBX A;  1HA6 A;  2MGS A;  4ZAI A;  1AZP A;  1F9P A;  2H1E A;  1ML0 D;  2R3Z A;  3SVM A;  1SSO A;  4IUQ A;  4IUP A;  1WTP A;  1DOL A;  1X3Q A;  2FFK B;  2KEE A;  5E4W C;  1CA5 A;  3GV6 A;  1BBX C;  2L9H A;  2Q8T A;  1MSH A;  1RTO A;  4XDX A;  5EPJ A;  1JIC A;  2N55 A;  3R93 A;  1B3A A;  1HFG A;  4HSV A;  4X3S A;  3IL8 A;  3I8Z A;  2DY8 A;  3G7L A;  3I3C A;  1BF4 A;  2J7Z A;  2JP1 A;  1MGS A;  2XIW A;  5E4X A;  1G2S A;  3MTS A;  1EOT A;  1BO0 A;  1ILQ A;  1ROD A;  5AFW A;  2SDF A;  5CMD A;  1J9O A;  1SAP A;  1U4M A;  1S4Z A;  1JE4 A;  2B2Y A;  2EOT A;  2L1B A;  2L11 A;  4IUU A;  1M8A A;  1TVX A;  2EE1 A;  4LMQ D;  4RA8 A;  4CJ2 C;  2K01 A;  2X69 A;  2M2L A;  1WTV A;  1WTR A;  2HCI A;  1IL8 A;  4HAE A;  1F2L A;  1XYI A;  1WTW A;  2B2T A;  3GV3 A;  2K03 A;  2KEC A;  1WTO A;  2FIN B;  3P7J A;  1E0B A;  2K1B A;  3DM1 A;  1CA6 A;  2KOL A;  1O7Z A;  1X32 A;  3HP3 A;  3I90 A;  1EL0 A;  1C8C A;  1EIH A;  1DOM A;  1QNK A;  2CVR A;  1X3P A;  2NWG A;  3LWE A;  4HED A;  3QO2 A;  4X3U A;  1DON A;  1DZ1 A;  2FJ2 A;  4OIK A;  4OIJ A;  2B2V A;  2X6G A;  4MN3 A;  1AZQ A;  5D65 A;  1G2T A;  1U4R A;  2B2Y C;  4X3K A;  1ZXT A;  1DOK A;  4IUR A;  1LV9 A;  3FPU B;  5EJW A;  1ICW A;  4ZLT F;  1WD0 A;  2B2T C;  2KED A;  2RSN A;  1VMC A;  1WD1 A;  1EIG A;  2K28 A;  2HDL A;  5CBA E;  1G6Z A;  1KNA A;  2NZ1 D;  2MP1 A;  1WVL A;  1G91 A;  1MSG A;  1WTQ A;  1AP0 A;  4XT3 B;  2KVM A;  4ZKC B;  5CBE E;  1U4P A;  1PFM A;  1PLF A;  3TN2 A;  2B2V C;  1KNE A;  2N88 A;  5COY A;  1B4O A;  2JYO A;  2B2U A;  1Q3L A;  3N52 A;  4XT1 B;  4CJ0 B; 
#chains in the Genus database with same CATH topology
 3K7A H;  3S1R H;  1SYC A;  2QW7 A;  4JI8 L;  2F0M A;  1KDA A;  3VR3 A;  3J81 c;  2Z1C A;  5ELE A;  5BN4 A;  3J80 L;  2RF4 A;  2FHT A;  1H9K A;  3VR6 A;  1TY2 A;  4DV6 L;  4L6T B;  2WB1 G;  1PYS B;  1EU3 A;  1SFO B;  4DV2 Q;  4QJF A;  5KRU A;  3CPF A;  1IYV A;  3ONA B;  1MIU A;  1LM0 A;  1EY7 A;  1KC8 C;  1F9Q A;  3TP6 A;  3F8T A;  4DR7 L;  3ICE A;  2C35 B;  1U4L A;  2ICI A;  1QNU A;  4A3I H;  5JJK A;  2RA4 A;  4LFA Q;  5FO8 B;  1PRT B;  4V19 0;  2QDB A;  3BVM A;  4BY1 G;  2VY3 A;  1YHQ A;  1B53 A;  1CKM A;  3S17 B;  4A3D B;  1UEB A;  5C3E H;  3GTG H;  1SJE D;  2HD3 A;  1ENF A;  1P8L A;  4KJO A;  3DWA A;  3PIP 3;  4K2L A;  3FMC A;  2PPB C;  2PYK A;  3D3R A;  4JK1 C;  5JVG 3;  2NN6 I;  1WTP A;  1VQ5 A;  5K5P A;  4DNT B;  4A3G H;  4KJN A;  1Y8P B;  3IL8 A;  1X65 A;  4LF8 Q;  3PO3 H;  2NTT A;  4JV5 Q;  4OO1 G;  1G2S A;  2A6H C;  2JJQ A;  1ET9 A;  2OWO A;  4RA8 A;  3NHH A;  4XIG S;  3HOY G;  4GKJ Q;  3GTL B;  3FKI G;  2ATW A;  2LKV A;  3UDI A;  1JJ2 A;  1EY0 A;  3SR1 A;  1IBK Q;  2ZXO A;  4BBS G;  5M3F B;  1E7Z A;  3P1H A;  4DAM A;  1RD9 D;  1SNO A;  2XGT A;  1X3P A;  1PH8 A;  5M5Y B;  1WCM G;  3NBI A;  1D7Q A;  1HZC A;  1TQO A;  3NUC A;  1SMX A;  1V9P A;  5ISR A;  4CKE A;  3PV0 A;  2WAQ B;  3G48 A;  2D0O A;  4BA1 I;  1E3P A;  2B2T C;  4ZLT F;  2RSN A;  5C0X J;  1WD1 A;  3RZO B;  2AWO A;  1EQR A;  2HDL A;  3M4Q A;  3H94 A;  1JOO A;  2GVB A;  2MHV A;  1JWS D;  1D1K A;  5LL6 X;  4LNQ A;  2YU9 H;  4QIW E;  4ZKC B;  3SK5 A;  2Z6K A;  2VUM H;  2JA7 G;  1PFM A;  1PTO H;  1PLF A;  2F3V A;  2OCE A;  1EWH A;  3SDZ A;  1SYE A;  1ZYR C;  2KCN A;  4QB4 A;  1EEF D;  2Q2U A;  1HTL D;  1LT6 D;  2G5D A;  5C4X H;  2R92 G;  4Y7N H;  1XJV A;  2A8V A;  4EQN A;  2XRQ D;  4HSP A;  3S16 H;  3S14 B;  4DF7 A;  2RHQ B;  1LTG D;  4LUZ A;  2KHS A;  3RZD H;  4A3M B;  1UEA B;  4A3J H;  1F9R A;  4JG2 A;  4DUZ Q;  2DJF C;  1EYD A;  2F0P A;  4JI5 L;  1QWY A;  1HR0 L;  4WJW A;  1XMQ Q;  1EQT A;  4JPB W;  1YIT A;  1EY6 A;  1G29 1;  1N33 Q;  4R9W A;  1Q8I A;  1BKB A;  2R6G A;  4U68 A;  2ZJP A;  2B39 A;  2EYJ A;  4ABN A;  2XNA C;  4CJ1 B;  5EGT A;  1XNQ L;  4A3K B;  5J22 A;  4C3H H;  1CTM A;  4OO1 I;  4C3J G;  2MQH A;  2EVB A;  2PMZ E;  2K75 A;  2UXB Q;  1TII D;  4K6D A;  4FXD A;  2YV5 A;  2KCC A;  1JWM D;  1XMO L;  1PZK D;  1NE3 A;  3J7A F;  3HOX B;  2JQO A;  3KBX A;  1GXD C;  1EFW A;  1L1O A;  4NXM Q;  4Q0F A;  1A8V A;  1FD7 D;  4OON A;  5EBD A;  3I55 A;  5LMU Q;  1FL0 A;  1PTO C;  1MSH A;  1IBL L;  2NVQ B;  3T1Y L;  1S72 A;  5IY0 A;  2EYP A;  1B3A A;  4DR3 L;  1VQN A;  3UDG A;  1I4G A;  3PO2 H;  1EOT A;  4X6A H;  3GP7 A;  4JOI A;  2EJG C;  1TVX A;  4CJ2 C;  2K01 A;  4LK1 C;  1WTR A;  2YYZ A;  2K32 A;  4JYA L;  2N3S A;  3MEH A;  5IP7 H;  2VQE L;  1HJP A;  1K9M C;  1JCK B;  2SNM A;  2ASB A;  1EOV A;  5I9P A;  4K5V A;  2Z4H A;  1N34 Q;  3K0Y A;  1Q46 A;  1X3G A;  4QGU A;  1VQL A;  3PIO 3;  4YWK A;  1TS2 A;  2PW5 A;  4RKL A;  1DON A;  5LL6 S;  2J0T D;  4GLV B;  3Q8D A;  3BJU A;  4B3M Q;  2R7F A;  3ER0 A;  3C2P A;  2KED A;  1VMC A;  5ELD A;  1X54 A;  4X66 L;  4A3E H;  1TXY A;  1X55 A;  1L1O C;  3PIP A;  4JI4 Q;  1Y8N B;  3BYY B;  1Y14 B;  5FLM H;  3J80 c;  5BR8 Q;  4C56 C;  2PZU A;  5FLX E;  3AB9 A;  1A2T A;  4JI6 L;  1B70 B;  1HZ9 A;  3GTQ H;  4GLA C;  1Y1W B;  1AW7 A;  1SE4 A;  3V05 A;  3J81 i;  1Q86 C;  1A0I A;  1LYL A;  1S5F D;  1D8L A;  1TT2 A;  4LF9 Q;  2IL8 A;  2KUM A;  4JOI C;  3V96 A;  3I7F A;  1DM0 B;  1EWC A;  4A93 B;  2BOS A;  5EKK A;  1N32 Q;  1TWA B;  4LW1 A;  2ZTC A;  4RGN A;  4DUY Q;  5ELN A;  3OSO A;  3ULJ A;  1VQJ A;  3RN5 A;  3FDT A;  4RGO S;  4F87 A;  3GTO H;  1NTG A;  2OEO A;  2K50 A;  2RVL A;  2E76 C;  3F2U A;  2BH8 A;  2IX0 A;  1HFN A;  1HUM A;  4IUV A;  3GTJ B;  2DUD A;  1LO5 D;  2ZTD A;  3GTQ B;  2FMM A;  3SEB A;  3K7A B;  3S1R B;  2JA9 A;  2ZTE A;  4YIJ A;  4UAI A;  3PF5 A;  3UDX A;  5FOB B;  2EDG A;  1KAA A;  4GKK Q;  4DR1 Q;  4J1M A;  4UP9 A;  3KF6 B;  1SYF A;  4DPG A;  3A54 A;  4JI2 Q;  1G8Z D;  3T4A C;  2I0Q A;  4A3B G;  2XIW A;  3MTS A;  3MVV A;  1ILQ A;  3W3A A;  5AFW A;  4A3I B;  1I5F A;  4IPC A;  5IOD A;  1U4M A;  3FHW A;  3BYT B;  1SLJ A;  4JI7 L;  1XYI A;  2M2L A;  4HAE A;  1U5K A;  1Y8O B;  1PHJ A;  3RD4 A;  3D4R A;  3KDF B;  4DV1 L;  1NJI C;  3PUV A;  5FO9 B;  1EFI D;  1HA5 A;  1I3Q H;  2B8G A;  2I5L X;  4GNX C;  2QEJ C;  1S5C D;  1ONL A;  4OIK A;  1G6Z A;  4MN3 A;  1U4R A;  4GKJ L;  4ALP A;  1F2Z A;  4X64 L;  4L5S A;  1SRO A;  2K28 A;  4A3G B;  3BU2 A;  4KY6 A;  1MSG A;  4K5W A;  3OYY A;  4S3S A;  3PO3 B;  1MBY A;  4I7Z C;  5IYC G;  1KHI A;  4A3C G;  2N8N A;  4LFB L;  1L0X B;  2WAQ E;  1B8A A;  3CCL A;  4POG A;  3EFX D;  2JYO A;  2KA7 A;  2RDF A;  4YY3 L;  2F4V L;  4RWS C;  1HXY D;  2G9H D;  3MXU A;  3TME A;  5EQ0 A;  1B1Z A;  1MJC A;  3GDE A;  1A6X A;  3A56 A;  4HTH A;  2ALY B;  1XX8 A;  2PI2 A;  1KRT A;  5KGU A;  1CSP A;  2K05 A;  1RHP A;  4ZUJ A;  3QB3 A;  2Q2T A;  4ZUI A;  4DV6 Q;  3SK6 A;  1GJX A;  2VL6 A;  2YTX A;  3PIO A;  3A0J A;  5CGK A;  2BDN A;  4R1J A;  1XPO A;  3KFU A;  3S17 H;  1GUN A;  1QUQ B;  2YU9 B;  1RCV D;  1CHP D;  2CW0 D;  3VA5 A;  4OX9 Q;  2VUM B;  3SE0 A;  5D3I B;  1PTO B;  4KKT A;  4K0K L;  1AN8 A;  1RJT A;  3HFZ B;  2EY1 A;  2HUG A;  3PUY A;  3NP8 A;  1RF2 D;  4XTC S;  5GAD C;  4HJ8 A;  5EAY A;  3MXP A;  2NN6 H;  5C4X B;  3IKJ A;  5C3W A;  4Y7N B;  4H02 A;  4H7B A;  3S16 B;  4DR2 L;  2C9O A;  3CQZ H;  3RZD B;  4A3J B;  4NDX A;  4PG3 A;  4ULL A;  1MJE A;  5EPJ A;  5IOC A;  4FXG C;  3H15 A;  3VDY A;  2B8F A;  2OQ0 A;  2J4X A;  3ZYY X;  1BBU A;  3C1E A;  3E6Z X;  4RGM A;  4QMG A;  2GA4 B;  4KMU C;  2EOT A;  1O7I A;  2OTL A;  4LMQ D;  4HN7 A;  2F0I A;  4C3H B;  2EIF A;  4TKO B;  3P7J A;  3A7A B;  1HTP A;  5M5Y H;  1L1O B;  2Z9H A;  3HP3 A;  5C3X A;  1EIH A;  3M4O B;  2VS1 A;  1XXG A;  1JOK A;  3A7L A;  1JE5 A;  1JJC B;  4DGZ A;  2RQX A;  4XYO A;  4UY8 C;  2D0P A;  4PMW A;  1VQD A;  3J80 i;  4PQX A;  3C1F A;  4K14 A;  4F8M A;  5F2D A;  2MP1 A;  1EEI D;  1Q1B A;  1WI5 A;  2EY5 A;  1D5Z C;  3PO2 B;  4LF5 L;  2KVM A;  1I4X A;  2B2V C;  2BE5 D;  4DAP A;  2ZT9 C;  3L3O C;  1IYJ B;  5KNB A;  4ME5 A;  2D62 A;  1YNN C;  1GVP A;  3H0G G;  4QIW B;  4BBR H;  1BCP D;  4LAA A;  5EPK A;  1SRU A;  2BDO A;  3CC7 A;  1HNZ L;  1GUW A;  4H44 C;  3FVQ A;  1JB7 A;  1KIX A;  3TRE A;  1QE6 A;  4FF1 A;  1M4V A;  5BR8 L;  2K5Q A;  1PDQ A;  1XNR L;  5CV5 A;  1T5X D;  3TZD A;  3JAM E;  4BA2 I;  1DD2 A;  3W1G A;  3OTO L;  1HPC A;  1JOR A;  1E2Z A;  5IP9 G;  4OO1 H;  4LF9 L;  4A3E B;  2R7D A;  1W2B A;  2F0V A;  5I9O A;  1NAP A;  4H13 C;  3BS1 A;  4LUV A;  5EBC A;  3I4N G;  1I50 H;  1HR0 Q;  3K59 A;  3HOY H;  1ENA A;  3FKI H;  3DM3 A;  2AMC B;  4BBS H;  1HUN A;  2E2D C;  3U9O A;  3S1N H;  3FPP A;  1XNQ Q;  2KEN A;  1NR2 A;  1YZ6 A;  2UUB L;  2E75 C;  1S3O A;  1S5B D;  1WCM H;  3BG3 A;  1NUC A;  3MFG A;  3VYU A;  1STG A;  1VQH A;  3OMG A;  4RHS A;  4CBV A;  1XMO Q;  1IXR A;  3EJI A;  3PF4 A;  5G3L D;  1E22 A;  1KDB A;  4DXF A;  3I3C A;  1ENC A;  4GNX B;  4MNO A;  4HIM A;  3T1Y Q;  3HOZ G;  1J9O A;  3GTO B;  2A68 D;  4RMF A;  1JE4 A;  4JI1 L;  2EE1 A;  4DR3 Q;  4GKK L;  1PH5 A;  2HCI A;  1RDP D;  5L37 A;  2R92 H;  3VYT A;  3K5N A;  4M8A A;  1PYW D;  3KYH C;  2LY7 A;  1EY4 A;  1EL0 A;  3HKZ B;  3OMC A;  1HZB A;  2VQE Q;  1XTC D;  5FLX L;  1SMY D;  3HEJ A;  4X3K A;  2F0K A;  3DWP A;  1YIJ A;  3H3V I;  1LTR D;  3W1B A;  5IGC A;  5IGD A;  4PMB A;  5JEA H;  5M3M G;  1PZI D;  5H1S E;  4GN5 A;  5AJ3 L;  4I65 A;  4X66 Q;  1HH2 P;  1B4O A;  1NSN S;  1Y1V G;  1Z47 A;  5J39 A;  4JI6 Q;  4KY5 A;  4YWL A;  1IKM A;  1NBW A;  1M1K C;  1I3Q B;  5C0X I;  1TWA H;  3G4S A;  2MUY A;  3HZX A;  1EUJ A;  1BBW A;  1BCP B;  2PO4 A;  4NW2 A;  1Q8K A;  3RLF A;  5DM6 3;  1SDF A;  4DV7 L;  3U58 A;  3K0X A;  1F9S A;  1O78 A;  2NYZ D;  3ERS X;  4RAU C;  4B9X A;  1KD1 C;  1ZKO A;  1KLG D;  2F0F A;  5LMN L;  2MJ8 A;  4JI0 Q;  1VDZ A;  1W3S A;  2R7Z G;  4JBK A;  3H91 A;  3MZ5 A;  1WTH A;  1F9P A;  4FXK C;  1N9W A;  1PH6 A;  4PNY A;  1EYG A;  1X3Q A;  4OX9 L;  3KF6 A;  3BVZ A;  1BBX C;  4JBW A;  4B3R L;  4C3I G;  2Y0S B;  3WOF A;  3R93 A;  3JAM i;  4HSV A;  4LUO A;  2VW9 A;  4UP8 A;  3D0F A;  3M7G A;  4DR6 L;  1I94 L;  3GQB A;  3S1M H;  2E2J H;  3PUX A;  1K83 H;  2B2T A;  3KLW A;  2PZT A;  1D2B A;  1B9M A;  2E5L L;  2A5H A;  3KDF A;  1VQ6 A;  4JI7 Q;  3GD7 A;  4DK0 A;  4DV3 L;  3S1Q H;  2CVR A;  3ULL A;  2F0D A;  2FJ2 A;  1VQ8 A;  4DV1 Q;  3CQZ B;  2DNE A;  1Z7T A;  3UE1 A;  1CI3 M;  4A3F B;  2BH2 A;  2HIX A;  1WD0 A;  2EXZ A;  1X6O A;  4RCN A;  4Y52 H;  1QVC A;  4EQ5 A;  4A3L G;  5I4D A;  4XQJ A;  1L0Y B;  3E3X A;  4X64 Q;  1K8O A;  3A8K E;  4I7A A;  1STY A;  4JW0 A;  5C4Z A;  5IT9 E;  1KNE A;  1VCI A;  2RDG A;  3CPW A;  5GAE C;  1B7Y B;  4LFB Q;  1JQY D;  3A5U A;  3OPO A;  4J8Q A;  4QUC A;  3TSS A;  1PFB A;  2WB1 B;  4BWG B;  4YY3 Q;  1VQK A;  4HCS A;  1EU4 A;  2HDM A;  2PCF B;  2F4V Q;  2NVX H;  1HQR D;  2V4D A;  3GTP B;  4R4C A;  1AE2 A;  5JJZ A;  4H0L C;  3EQL C;  4X62 L;  3RNU A;  1QUQ A;  1VQP A;  1T9H A;  1TKW B;  1YNJ D;  1BOS A;  2QEX A;  2GN5 A;  3E0J A;  4ZCK A;  3ULP A;  3MWY W;  3DHQ A;  3TP8 A;  4FYD A;  1IKL A;  1FNU A;  2RSO A;  4BXX H;  4KK7 A;  1EIF A;  1II3 A;  4UPA A;  3VR4 A;  3BDO A;  1BNZ A;  2IT1 A;  4AYB G;  1GUS A;  4K0K Q;  3D6C A;  4BBR B;  2F0W A;  3SVM A;  1W6J A;  4JBM A;  4F88 A;  1KAW A;  1K3R A;  1VQ7 A;  2UU9 L;  2PNR C;  3K57 A;  1SNP A;  1SYG A;  4DR2 Q;  5K36 G;  4X3S A;  3FEW X;  1PVO A;  3I8Z A;  5J1Z A;  4PV1 C;  4EQP A;  4KKU A;  2SDF A;  1SYD A;  5CMD A;  1SAP A;  4KLK A;  5IYD G;  1SEB D;  1I50 B;  2PNH A;  3HOY B;  5FLX c;  3FKI B;  2A19 A;  1PH4 A;  3M4O H;  4BBS B;  2KEC A;  1BR9 A;  3ZJY C;  4KHZ A;  4KI0 A;  3S1N B;  4FF3 A;  3CC2 A;  5E7N A;  2F1M A;  2IHE A;  3DUZ A;  5JJL A;  1WCM B;  3G71 A;  4OIJ A;  3CCQ A;  1PTO F;  4N9P A;  2JA6 H;  4KV6 A;  4KTA A;  2YTY A;  2F0S A;  2SNS A;  3HKZ E;  1EWI A;  4MTK A;  3DWQ A;  3E0E A;  2QDL A;  2K4K A;  4QF4 A;  1TS5 A;  4DU9 A;  4WFN 3;  2JA7 B;  1QZG A;  3TBI B;  3NQT A;  3HOV G;  1K28 A;  4K5X A;  3TN2 A;  3CW2 C;  3JAM L;  4LF5 Q;  4ME3 A;  1SBB B;  2R92 B;  5IGB A;  2F0J A;  2CH4 A;  4U67 3;  3A8I E;  3I4M G;  1RKN A;  1LTI D;  3A74 A;  3CCV A;  3L0O A;  2Q8R E;  5C4J H;  1HNZ Q;  2L12 A;  1BDO A;  3EBE A;  1CQF A;  4UHV A;  4DV5 L;  1XNR Q;  1NY4 A;  3CAM A;  4NMZ A;  4ODG A;  4YCU A;  5EPL A;  3J81 j;  4B3S L;  1VQI A;  5COR A;  4TSS A;  3OTO Q;  2Q2H A;  5ELC A;  4N9T A;  2JSO A;  3OWF A;  2ES2 A;  1NNX A;  2K5N A;  4C3J B;  5EKL A;  4IUT A;  2IWH A;  1NR4 A;  3NTI A;  5FK9 C;  5M9O A;  2B3G A;  3CCR A;  1RTN A;  1VQA A;  4OEM B;  4FP5 D;  3MHB A;  1JC7 A;  1F2M A;  2L55 A;  4OXP A;  3WWV A;  5C3E G;  3TP7 A;  2UUB Q;  4GS3 A;  2WKC A;  5C44 G;  4JI0 L;  4DK3 C;  1UAP A;  2N55 A;  5A2Q E;  4YHH L;  2JN4 A;  4OWW B;  2PI2 E;  4GNX A;  4GZY C;  2XVS A;  4IPH A;  1GM5 A;  3HOW G;  4F7X A;  2X69 A;  1H9S B;  1SJH D;  2VZA A;  2Y0S E;  3KF8 B;  2K03 A;  3QOJ A;  1GUO A;  2FIN B;  2F52 A;  2WIN B;  2XSC A;  3H0G H;  4JI1 Q;  4CHT B;  1CA6 A;  1X32 A;  2UXD L;  3CRK C;  1LUZ A;  4HCE A;  4KN4 C;  1IYU A;  3D31 A;  5CV4 A;  3H3V H;  3HOU G;  1T5E A;  1VQ4 A;  1D1I A;  4K2K A;  5D3D A;  4IFD J;  1SE2 A;  5GRO A;  2B2Y C;  1S40 A;  1HR0 W;  1ZXT A;  2CW0 C;  2MNA A;  1HNW L;  1JWU D;  1ICW A;  5E1F A;  4QQB X;  1KNA A;  1E1O A;  2E74 C;  1A3T A;  2PQE A;  1OXT A;  2OTJ A;  3OHX C;  1L2F A;  2IX3 A;  3I4N H;  1GUG A;  4YCV A;  3DLL A;  2F0T A;  4LFC L;  3PMF A;  5LHY 1;  1F2Y A;  1N8R C;  3S1M B;  1W6K A;  3BZC A;  2E2J B;  2F4I A;  1K83 B;  2A6E D;  3I4L A;  5C0X H;  2ZJQ A;  2VUM G;  5AJ3 Q;  1CT1 D;  2CQA A;  1CHQ D;  1NMG A;  2HCC A;  4R4Q A;  4LF7 L;  4MHE A;  3PSI A;  3S1Q B;  5C4X G;  2B63 H;  5EKI A;  2X6L A;  2F3W A;  1MHW C;  1FGB D;  4GN3 B;  4L5R C;  3H6M A;  4C2M H;  1V1P B;  4BY7 G;  2DJG C;  2EY2 A;  4OGQ C;  2B2U C;  1B2T A;  3TDQ A;  4C1N I;  1LTT D;  4DV7 Q;  3HOZ H;  2B2W C;  2AUJ D;  2WB1 E;  3E5S A;  2LXJ A;  3E9H A;  3H3V C;  2UUC L;  3Q6S A;  2UXC L;  2TMP A;  2I46 A;  1QOH A;  2D9U A;  5LMN Q;  4C3H G;  1AE3 A;  4GOP C;  4NXN L;  4ZAI A;  3LWU A;  3CD6 A;  2R93 G;  4KHP L;  3BZK A;  3F2B A;  3KOJ A;  2EZV A;  3U4Z A;  2BE5 C;  1Z9F A;  3PQI A;  3CKI B;  1JIC A;  1A3V A;  1QVF A;  3H09 A;  2NVX B;  5FJ8 G;  5M3M H;  4FF4 A;  3G7L A;  2VB3 X;  2XWJ B;  5E4X A;  3FP9 A;  4G57 A;  1BCP C;  1Q90 A;  4B3R Q;  2QA4 A;  3AEV A;  2Q8I B;  5JJI A;  1ICF B;  3AFP A;  3DMU A;  3K80 C;  3TS0 A;  1BCP F;  1CKN A;  3S24 A;  4XQQ A;  3TP5 A;  1CUK A;  3WOE A;  1EYA A;  2L0C A;  4NKL A;  2E2I H;  2K5D A;  4DR6 Q;  1I94 Q;  1Y1V H;  2CFM A;  3N6R A;  2D5D A;  1G6P A;  4PMC A;  5DAU A;  1SN8 A;  3DXJ C;  3FRP B;  3NBH B;  4A3F H;  1U0L A;  1QNK A;  5IP7 G;  3KJO A;  2F0G A;  2E5L Q;  2IX1 A;  3BDL A;  2B2V A;  2X6G A;  2ZXP A;  4DV3 Q;  1J5E L;  1FR3 A;  3M9B A;  5IT9 L;  3VR2 A;  4G7O C;  4IOA A;  1K8M A;  3JAM c;  1V1Q A;  2KCT A;  1LAC A;  3K6O A;  2NVT H;  3NPP A;  4E6I A;  3NWS A;  1B44 D;  3CU7 A;  2VQF Q;  3MXN B;  1JB3 A;  1MD2 D;  3CP0 A;  2BA1 A;  5JOB A;  1FVI A;  4JC0 A;  4ZQ3 A;  5C5L A;  3CF5 A;  2R7Z H;  2F0N A;  3RMH A;  4AQY L;  1Y69 U;  4CJ0 B;  1PH1 A;  3CCM A;  4DV4 L;  5G3L F;  5KNC A;  4B9W A;  1GHJ A;  3GTP H;  3W2D A;  2A68 C;  1X3F A;  2NB0 A;  5CV6 A;  4DNR B;  4C3I H;  1TWG H;  2JA6 B;  4MZ9 A;  1STH A;  4BY1 H;  3MFY A;  2K5W A;  2JA5 G;  3NE5 B;  1VQB A;  2H4O A;  3STB D;  1EQV A;  1K3B C;  4YWM A;  3SXH A;  3ERQ A;  1IZ6 A;  1CKO A;  4IUN A;  1SMY C;  5T1I A;  3NWT A;  3L9A X;  4X62 Q;  1B50 A;  2KBN A;  4P71 A;  1TS3 A;  3KLS A;  3I73 A;  1FJG Q;  1NCV A;  3T13 A;  1MKH A;  4KN7 C;  1DCZ A;  3NEL A;  3NEM A;  4DNI A;  3RLO A;  4IUQ A;  3I4O A;  4IUP A;  1DOL A;  4N8F A;  3SK4 A;  3ND9 A;  2LMC B;  1RTO A;  1SE8 A;  5I2X A;  5C4J B;  4A3L H;  1LTS D;  1LT5 D;  4C1N K;  1OXS C;  2J7Z A;  1MGS A;  2UU9 Q;  1CZW A;  3L2P A;  1ROD A;  4HIO A;  4EVO A;  3O13 A;  3K5M A;  2VB2 X;  4RH6 A;  4K8J A;  2KCM A;  4ZRZ A;  1IBM L;  5CV9 A;  3T16 A;  2G9D A;  3X3M A;  2RDH A;  4HED A;  2RCN A;  5DLQ E;  3EVQ A;  5GAH C;  1LT4 D;  2ZM6 L;  1DOK A;  2EYL A;  3NTK A;  2SOB A;  3TRZ A;  1LLR D;  2F03 A;  5C4H A;  1AEX A;  1C48 A;  2FXQ A;  2JA7 H;  1OXU A;  2IW3 A;  1EZ8 A;  4R8N A;  4IQZ A;  4LF6 L;  1PRT D;  3NTH A;  1YJN A;  1R9T H;  4LF4 L;  3Q0A A;  3S15 H;  4IN3 A;  4UDU C;  2JA8 G;  5GAG C;  4GN4 B;  3H0G B;  5D14 A;  1FGU A;  1V1O A;  1JR0 D;  5ELB A;  4APV A;  4L63 B;  2HT1 A;  1UNS A;  4QUF A;  4LWC A;  4O42 A;  3U4V A;  2M9V A;  2A69 D;  5K36 H;  1CQV A;  4X65 Q;  5M5W H;  5CR3 A;  5CV8 A;  2EYH A;  1AH9 A;  4HJ7 A;  3ND8 A;  4C3J H;  2I5M X;  4GOP B;  4IAL A;  3PGZ A;  1K0R A;  4B08 A;  3I4N B;  5HGQ A;  2DY7 A;  4DV0 L;  4DV5 Q;  2HHH L;  1C7Y A;  1X56 A;  3I56 A;  3TZU A;  4B3S Q;  2JXM B;  4XQN A;  4A3D G;  2WV6 D;  1XPR A;  5A2Q L;  3URY A;  3W5O A;  1STN A;  4PZ6 A;  3U9S A;  4J6H A;  1Q1E A;  3D6W A;  3S9W A;  4FF2 A;  3J7A 5;  5TSS A;  3SHL A;  1SSO A;  4HMI A;  2KEE A;  2RKS A;  2B63 B;  4HJA A;  1LTL A;  4A76 A;  3LGJ A;  1I4R A;  4C2M B;  4OWT B;  4QY7 A;  3RUZ A;  1VF7 A;  2ICE C;  2WAC A;  4JI3 L;  5KIX A;  3HOZ B;  2L11 A;  2L1B A;  4YHH Q;  1D6E C;  3HOV H;  5I6Y A;  1H9S A;  3K5O A;  1DJR D;  3KF8 A;  4DR4 L;  3GV3 A;  5IT9 c;  5DEH A;  5M3F G;  2TSS A;  4TVA B;  4DK1 A;  1C8C A;  1IW7 D;  2EQS A;  3LWE A;  3I4M H;  4DXG A;  2EXD A;  2B29 A;  1AZQ A;  1HZA A;  3Q22 A;  1YNJ C;  1QVG A;  4B3T L;  2UXD Q;  4LJZ C;  4WOR A;  1LV9 A;  3VA7 A;  2M00 A;  1SR3 A;  2WAQ G;  5C6A A;  3HG9 A;  2IPK D;  1ZEQ X;  2LSS A;  1X9N A;  1CKN B;  5M3M B;  1XPU A;  1WJJ A;  1YNX A;  1HNW Q;  2F0H A;  3RLN A;  1Z6H A;  2NUC A;  1N36 L;  5E3F A;  5CYU A;  3EA6 A;  4FNF A;  1JJG A;  1Q3L A;  5IIF A;  4LFC Q;  2E2I B;  4RGT A;  1Y1V B;  1TS4 A;  3EIV A;  2AWN A;  1ASY A;  2RBM A;  1GUT A;  3QR8 A;  2VQF L;  3QOL A;  1WOC A;  4A3M G;  2JK8 A;  1YHB A;  5HUR A;  5T1G A;  4R4T A;  3MC0 B;  4BBR G;  1L0W A;  1C0A A;  5C44 H;  1O7Y A;  4IZ8 A;  2PZW A;  1V1P A;  4LF7 Q;  1QG7 A;  1A2U A;  3R2I A;  4CKB A;  2O4X A;  1TWC H;  5IE8 A;  1UE1 A;  2PW7 A;  4IO9 A;  4HIK A;  2DGY A;  2K6A A;  2NVT B;  1GHK A;  1P16 A;  4A3K G;  3HOW H;  4IFD G;  1PMR A;  1ESR A;  1QZH A;  2O2L D;  1J8I A;  4AH6 A;  1SNM A;  3JC6 6;  5I2Y A;  1Q7Y C;  2R7Z B;  2AQ2 B;  4WJ4 A;  3J81 E;  1XTD A;  2UUC Q;  2UXC Q;  3HOX G;  3EN2 A;  1PV4 A;  3HOU H;  1Q12 A;  5KEE A;  2H1E A;  4PZ7 A;  3T56 B;  3CME A;  4A3B H;  1CK1 A;  3PUZ A;  3S2D H;  3GTM H;  2ID0 A;  4EQO A;  4C3I B;  3BDC A;  2WFW A;  3X3N A;  4NXN Q;  1TWG B;  1Q82 C;  1HNX L;  1E2W A;  5BN5 A;  4BY1 B;  1FJG L;  4KHP Q;  2DY8 A;  4NB3 A;  5IGF A;  2F0Q A;  2JP1 A;  1DYQ A;  5IGG A;  3P75 A;  5I6W A;  4DA2 A;  2WII B;  3A55 A;  4ILW A;  2CWP A;  1PH9 A;  4EGV A;  4FDB A;  2NZH A;  1IL8 A;  3HRZ C;  1F2L A;  1WTW A;  1JOQ A;  3V2T A;  3F1Z A;  3T1H L;  1I4Q A;  3DM1 A;  3A8J E;  3I90 A;  3Q23 A;  3NBH A;  2KHI A;  2F0O A;  2Z6B A;  3K8A A;  3NEN A;  3KJP A;  1DXM A;  4BY7 H;  4IUR A;  3FPU B;  4IPG A;  2VNU D;  5IYC H;  3SK8 A;  2YTV A;  4HR7 B;  4IPD A;  4A3C H;  1J5E Q;  3G6E A;  4MIU A;  3LX0 A;  2E8G A;  2F0L A;  5LMN W;  1YBY A;  1U9R A;  2XWB B;  1STB A;  3MXN A;  2BA0 A;  5JEA G;  2KJX A;  1K73 C;  3AMU A;  3KBG A;  1Y1W G;  1EZ6 A;  2LFN A;  1EY9 A;  3N52 A;  4DR5 L;  4IFD I;  3OWE B;  2QGQ A;  1OXV A;  2F3I A;  2A6H D;  1A15 A;  3TEH B;  4AQY Q;  2PQA A;  4IOC A;  2R93 H;  4X3T A;  1STE A;  2Z6K C;  1K0S A;  4DV4 Q;  4A93 G;  3M3Y H;  1EQQ A;  2IHF A;  2K04 A;  5FJ8 H;  3C46 A;  1TWF H;  3BZD B;  1IL2 A;  3CMA A;  3E9I A;  3ITP A;  4V0B A;  4L8J A;  1K8G A;  2NVY H;  1R9T B;  2D2C C;  1VS0 A;  3S15 B;  1GOZ A;  2HQL A;  1HHV A;  5IYB G;  1TU2 B;  3AYH B;  3S2H H;  3I91 A;  1I6H H;  4X65 L;  3HKS A;  2UUA L;  1WTX A;  1ET6 A;  4AYB B;  1SXT A;  4NP5 A;  2L4N A;  2OXP A;  1EYC A;  3RR5 A;  1MI2 A;  1GKH A;  1HA6 A;  1QB5 D;  2R3Z A;  1CA5 A;  1H9R A;  1ZYR D;  3GV6 A;  2L15 A;  1OO9 B;  4XDX A;  3UDF A;  2EJF C;  2A6E C;  2K52 A;  1D5M C;  1EIY B;  3CCE A;  1AFP A;  5M5W B;  3GTK B;  5NUC A;  2Z8L A;  1VF5 C;  4P72 A;  1C9O A;  4A3I G;  2QCP X;  1QJO A;  2B2Y A;  1PXU A;  3OIP A;  1H9J A;  2R61 A;  2HQE A;  2AQ3 B;  1E0B A;  2QKI C;  3R3O A;  3OIQ A;  4CGY B;  3IRB A;  1IHZ A;  2AQ1 B;  4OL7 A;  2L5T A;  4HMJ A;  1G51 A;  3MEF A;  1IBM Q;  1TWH H;  4KD3 A;  3VR5 A;  1E1T A;  1QCB D;  2KQ3 A;  4ZYS A;  3MAQ A;  1LTA D;  2XTI A;  3NQI A;  3VYR A;  1UE5 A;  1QIL A;  2Z0S A;  4OHJ A;  2JA5 H;  1EIG A;  3PCO B;  3KLS X;  4A3G G;  1VQO A;  2ZM6 Q;  2CQO A;  5JPN C;  5KND A;  3PO3 G;  1K8A C;  5C5M A;  1O7L A;  1KAB A;  2CHB D;  1B3Q A;  3L7Z C;  3HOV B;  1PTO D;  2EYO A;  4LF6 Q;  2B2U A;  4RHR A;  4A75 A;  3OW2 A;  2RCF A;  3HGB A;  4LF4 Q;  2Q2I A;  4DV2 L;  4FVM A;  2B2W A;  4WRD A;  2QF7 A;  4OWX B;  3KUP A;  2VXW A;  3BVG A;  3QJY A;  5IP9 H;  3I4M B;  1AZP A;  2K33 A;  2XRS D;  1VQG A;  2WP8 J;  4DN4 M;  3OW7 A;  4LFA L;  4CDC C;  4CDD C;  2ENB A;  3NXW A;  1KRS A;  4GOP A;  3J80 E;  2JEB I;  3I72 A;  1RL2 A;  2EYM A;  4KHV A;  5JVH 3;  3MA2 B;  1CSQ A;  4DAY A;  1HRJ A;  3D8G A;  5IWA Q;  1UUP A;  4DKA C;  2LXK A;  1JT8 A;  1FNW A;  4DV0 Q;  3I2Z A;  4UP7 A;  4L5Q A;  5CC4 A;  2HHH Q;  4TQU S;  5CV7 A;  4CKC A;  2OQK A;  2MGS A;  1J6Q A;  4BXX G;  1ML0 D;  5C3E B;  3GO5 A;  1SYB A;  3GTG B;  3TS2 A;  3NK9 A;  4LF8 L;  5E4W C;  4A3J G;  1KLU D;  4JV5 L;  2L9H A;  3QWN A;  3PUW A;  2Q8T A;  5C44 B;  1UE6 A;  1YVC A;  4K6L A;  1TWC B;  3I70 A;  1BF4 A;  1UWV A;  1IBK L;  1PYB A;  2E2H H;  2FMC A;  1S4Z A;  3HOW B;  3K5L A;  1TR5 A;  4JI3 Q;  2JA8 H;  5M5X H;  1STA A;  1I4P A;  3K58 A;  2A73 B;  5JEA J;  1SND A;  1KXL A;  4DR4 Q;  3MXG A;  3ERO A;  2WKD A;  4QL5 A;  2NWG A;  3STB C;  3QO2 A;  3HOU B;  3NSW A;  1SFO H;  5EJW A;  4A3B B;  3S2D B;  3GTM B;  2EJM A;  4WJ3 M;  2LS0 1;  4JI8 Q;  2KHJ A;  4OEL B;  2NZ1 D;  4B3T Q;  1WVL A;  2JA6 G;  1AP0 A;  3PO2 G;  4XT3 B;  4KD4 A;  1BVS A;  4YCW A;  5CBE E;  4AIM A;  3IFT A;  3T51 B;  1VQE A;  3RN2 A;  3J7Y W;  2DNC A;  5FKA C;  4A3D H;  1X3E A;  4XT1 B;  4DR7 Q;  3CXC A;  1EY8 A;  1N36 Q;  3DEO A;  4DUZ L;  3QIA A;  5A35 A;  3QG1 A;  1PA6 A;  2EPB A;  1O80 A;  3T53 B;  1XMQ L;  4ZK9 B;  3F2D A;  3IFD A;  1N33 L;  3UE0 A;  5BN3 A;  1I6V C;  3UI2 A;  4BY7 B;  3R2T A;  3P20 A;  3J81 L;  4HID A;  4N8X 1;  1FYC A;  4CDE C;  4R8I A;  4A3E G;  3D4D A;  2UXB L;  1LT3 D;  2P5Z X;  1GD7 A;  2DN8 A;  4J15 A;  3KLR A;  5IGE A;  5FLM G;  2K5V A;  1LTB D;  4P74 A;  3GTL H;  3F2C A;  1VMP A;  3VYS A;  2OF1 A;  4EX5 A;  4RG1 A;  3CCJ A;  3M4P A;  5M3F H;  5DNF A;  3DEP A;  2PQA B;  2CWA A;  1KL9 A;  4NXM L;  4A4I A;  1A62 A;  1VQ9 A;  2F0E A;  5LMU L;  1ASZ A;  4KY7 A;  1C4Q A;  1TY0 A;  4P2C B;  1S5E D;  1PFS A;  1H9M A;  1V8Q A;  2K5H A;  1SNQ A;  2R93 B;  1PRT C;  1OTC A;  4L5T A;  4PZ8 A;  1WYD A;  4NPS A;  1PRT F;  1D5X C;  2CKZ B;  3M4Y A;  3M3Y B;  1VQC A;  5J3B A;  3WDN A;  3RZO H;  1GO3 E;  4AYB E;  1TWF B;  1Q81 C;  1HQM C;  2RHS B;  3IAY A;  4JVZ A;  1V43 A;  4IUU A;  2AKW B;  1HNX Q;  2NVY B;  1M8A A;  1N34 L;  4XYQ A;  4O0A A;  2AUK A;  4TRD A;  1WTO A;  4KKS A;  3CCS A;  1M90 C;  2V1C C;  2A69 C;  2IY5 B;  5JPM C;  3S2H B;  1I6H B;  3HKZ G;  4B3M L;  2AHO B;  3M85 A;  3S14 H;  2IJ0 A;  3Q24 A;  3AFQ A;  1KQS A;  2I5H A;  3T1H Q;  4A3M H;  1PH3 A;  4O1N A;  4P73 A;  5JAV A;  5D65 A;  1S5D D;  3K7U C;  4JI4 L;  1PH7 A;  4POF A;  2JE6 I;  4R4O A;  3J7Z C;  5ELF A;  1OXX K;  2BCO A;  4MTN A;  5CBA E;  2A74 C;  3B6Y A;  4IJH A;  1G91 A;  2NTS A;  1WTQ A;  2HIV A;  4M1U B;  4DK6 C;  4A3K H;  1YJ9 A;  4IFD H;  2SEB D;  1CFM A;  4DFA A;  4GLX A;  3J7A V;  1EY5 A;  1YHA A;  1E24 A;  4JI5 Q;  5COY A;  4Z9C B;  2N78 A;  3SGI A;  3HOX H;  1ILP A;  1N32 L;  5C0X G;  3OOC A;  4DR5 Q;  1YI2 A;  5FO7 B;  3AQQ A;  4DUY L;  1TWH B;  2MPM A;  4QCL A;  3M7N A;  2ZXR A;  1CM9 A;  2NVQ H;  1E2V A;  2Z4I A;  2PMZ B;  2H5X A;  3K81 C;  4G4K A;  2NBF A;  4ZKB B;  1JMC A;  1VQF A;  2C5C A;  4RKB A;  2B63 G;  2JA5 B;  2MO1 A;  2O5I C;  1IW7 C;  4HJ9 A;  2N49 A;  3G6J B;  4O2D A;  5KYI A;  1B9N A;  4K8I A;  4R4I A;  1PFN A;  1R4Q B;  3U50 C;  1IBL Q;  2XN9 C;  1A3U A;  1PZJ D;  5KYL A;  4DR1 L;  2K7V A;  4JI2 L;  1YEZ A;  1PH2 A;  1BUV T;  2UUA Q;  4JYA Q;  2FFK B;  5DM7 3;  3GTK H;  4JCV E;  1YNN D;  2CCZ A;  2MFI A;  2Y0S G;  5IWA L;  4Q5V A;  5IYD H;  1H95 A;  1HFG A;  2A1A A;  1CZG A;  1DGS A;  3HS0 C;  4FO2 A;  4XXE A;  4DAY B;  1F77 A;  1BO0 A;  1NMF A;  1ESF A;  1XWE A;  1WTV A;  5ELO A;  3R8B A;  2EY6 A;  1Y1W H;  2QIL A;  1WFQ A;  2I07 B;  3CCU A;  1HCZ A;  2JEA I;  2CH4 W;  1R4P B;  1LAB A;  1KDC A;  2K1B A;  2K14 A;  2KOL A;  1O7Z A;  3CHB D;  2NN6 G;  1DOM A;  4X3U A;  2OT2 A;  1DZ1 A;  5HGT A;  1FNV A;  1G2T A;  4A93 H;  3A5Z B;  3CC4 A;  4HJ5 A;  4BS9 A;  4IJL A;  1VQM A;  1SE3 A;  4A3F G;  2EYF A;  4RFB A;  4CDF C;  1I4H A;  1BQQ T;  5HY6 A;  1SNC A;  2NZO A;  3LNN A;  4P75 A;  1BXT A;  2O5J C;  4RCO A;  4JBJ A;  4ID6 A;  3C3L A;  4G7Z C;  1YJW A;  2GVA A;  3CRL C;  3D4W A;  2MO0 A;  2E2H B;  1U4P A;  3TQY A;  2ZJR A;  1A63 A;  3AU7 A;  4DAV A;  5GQO A;  2N88 A;  2F0U A;  2JA8 B;  4G7H C;  3GTJ H;  5IYB H;  5M5X B;  1UE7 A;  1KTK A;  1RIP A;  3KK7 A; 
#chains in the Genus database with same CATH homology
 1SYC A;  2F0M A;  1KDA A;  3VR3 A;  2Z1C A;  5ELE A;  5BN4 A;  3J80 L;  2FHT A;  1H9K A;  3VR6 A;  1TY2 A;  4L6T B;  1EU3 A;  1SFO B;  5KRU A;  1IYV A;  3ONA B;  1EY7 A;  1F9Q A;  3TP6 A;  1U4L A;  2ICI A;  1QNU A;  2RA4 A;  5FO8 B;  1PRT B;  4V19 0;  2QDB A;  3BVM A;  1B53 A;  3S17 B;  4A3D B;  1SJE D;  1ENF A;  4KJO A;  3DWA A;  3PIP 3;  4K2L A;  3FMC A;  2PPB C;  2PYK A;  3D3R A;  4JK1 C;  5JVG 3;  2NN6 I;  1WTP A;  5K5P A;  4DNT B;  4KJN A;  1Y8P B;  3IL8 A;  2NTT A;  4OO1 G;  1G2S A;  2A6H C;  1ET9 A;  4RA8 A;  3NHH A;  4XIG S;  3GTL B;  2LKV A;  1EY0 A;  3SR1 A;  2ZXO A;  5M3F B;  3P1H A;  1RD9 D;  1SNO A;  1X3P A;  5M5Y B;  3NBI A;  1TQO A;  3NUC A;  5ISR A;  4CKE A;  3PV0 A;  2WAQ B;  4BA1 I;  4ZLT F;  2B2T C;  5C0X J;  2RSN A;  1WD1 A;  3RZO B;  2AWO A;  2HDL A;  3H94 A;  1JOO A;  2MHV A;  1JWS D;  1D1K A;  5LL6 X;  4ZKC B;  3SK5 A;  1PFM A;  1PTO H;  1PLF A;  2F3V A;  1EWH A;  3SDZ A;  1SYE A;  1ZYR C;  2KCN A;  4QB4 A;  1EEF D;  1HTL D;  1LT6 D;  4EQN A;  2XRQ D;  4HSP A;  3S14 B;  4DF7 A;  1LTG D;  2KHS A;  4A3M B;  1UEA B;  1F9R A;  1EYD A;  2F0P A;  1QWY A;  4WJW A;  1EQT A;  1EY6 A;  1G29 1;  4R9W A;  1Q8I A;  2R6G A;  4U68 A;  2B39 A;  2EYJ A;  4ABN A;  2XNA C;  4CJ1 B;  5EGT A;  4A3K B;  5J22 A;  1CTM A;  4OO1 I;  4C3J G;  2EVB A;  1TII D;  4K6D A;  4FXD A;  2KCC A;  1JWM D;  1PZK D;  3J7A F;  3HOX B;  3KBX A;  1GXD C;  4Q0F A;  1FD7 D;  5EBD A;  1PTO C;  1MSH A;  2NVQ B;  2EYP A;  1B3A A;  1I4G A;  1EOT A;  3GP7 A;  2EJG C;  1TVX A;  4CJ2 C;  2K01 A;  4LK1 C;  1WTR A;  2YYZ A;  2K32 A;  3MEH A;  1JCK B;  2SNM A;  5I9P A;  4K5V A;  2Z4H A;  3K0Y A;  3PIO 3;  1TS2 A;  2PW5 A;  4RKL A;  1DON A;  5LL6 S;  2J0T D;  3C2P A;  2KED A;  1VMC A;  5ELD A;  1Y8N B;  3BYY B;  4C56 C;  2PZU A;  5FLX E;  3AB9 A;  1A2T A;  1Y1W B;  1AW7 A;  1SE4 A;  3V05 A;  1S5F D;  1TT2 A;  2IL8 A;  2KUM A;  3V96 A;  1DM0 B;  1EWC A;  4A93 B;  2BOS A;  5EKK A;  1TWA B;  4RGN A;  3OSO A;  3FDT A;  4RGO S;  4F87 A;  2OEO A;  2RVL A;  2E76 C;  3F2U A;  2IX0 A;  1HFN A;  1HUM A;  4IUV A;  3GTJ B;  1LO5 D;  3GTQ B;  2FMM A;  3SEB A;  3K7A B;  3S1R B;  4YIJ A;  4UAI A;  5FOB B;  2EDG A;  1KAA A;  4J1M A;  1SYF A;  3A54 A;  1G8Z D;  3T4A C;  2XIW A;  3MTS A;  3MVV A;  1ILQ A;  3W3A A;  5AFW A;  4A3I B;  5IOD A;  1U4M A;  3BYT B;  1XYI A;  2M2L A;  4HAE A;  1Y8O B;  3RD4 A;  3D4R A;  3PUV A;  5FO9 B;  1EFI D;  1HA5 A;  2B8G A;  2QEJ C;  1S5C D;  1ONL A;  4OIK A;  1G6Z A;  4MN3 A;  1U4R A;  1F2Z A;  2K28 A;  4A3G B;  4KY6 A;  1MSG A;  4K5W A;  3PO3 B;  4S3S A;  1MBY A;  4I7Z C;  1L0X B;  3EFX D;  2JYO A;  2KA7 A;  2RDF A;  4RWS C;  1HXY D;  2G9H D;  3MXU A;  3TME A;  5EQ0 A;  1B1Z A;  1A6X A;  3A56 A;  4HTH A;  1XX8 A;  5KGU A;  2K05 A;  1RHP A;  4ZUJ A;  3QB3 A;  1GJX A;  4ZUI A;  3SK6 A;  5CGK A;  2BDN A;  1GUN A;  2YU9 B;  1RCV D;  1CHP D;  3VA5 A;  2CW0 D;  2VUM B;  3SE0 A;  5D3I B;  1PTO B;  4KKT A;  1AN8 A;  1RJT A;  3PUY A;  2EY1 A;  2HUG A;  3NP8 A;  1RF2 D;  4XTC S;  3MXP A;  2NN6 H;  5C4X B;  3IKJ A;  5C3W A;  4Y7N B;  4H7B A;  3S16 B;  2C9O A;  3RZD B;  4A3J B;  4NDX A;  4ULL A;  5EPJ A;  5IOC A;  4FXG C;  2B8F A;  2J4X A;  3ZYY X;  4RGM A;  3C1E A;  3E6Z X;  4QMG A;  2GA4 B;  4KMU C;  2EOT A;  4LMQ D;  4HN7 A;  2F0I A;  4C3H B;  4TKO B;  3P7J A;  3A7A B;  1HTP A;  3HP3 A;  5C3X A;  1EIH A;  3M4O B;  1XXG A;  1JOK A;  3A7L A;  4DGZ A;  2RQX A;  4XYO A;  4PMW A;  4PQX A;  4F8M A;  3C1F A;  4K14 A;  5F2D A;  2MP1 A;  1EEI D;  1Q1B A;  2EY5 A;  1D5Z C;  3PO2 B;  2KVM A;  1I4X A;  2B2V C;  2BE5 D;  4DAP A;  2ZT9 C;  3L3O C;  5KNB A;  4ME5 A;  2D62 A;  1YNN C;  4QIW B;  1BCP D;  4LAA A;  5EPK A;  1GUW A;  2BDO A;  4H44 C;  3FVQ A;  1QE6 A;  4FF1 A;  1M4V A;  2K5Q A;  1PDQ A;  5CV5 A;  1T5X D;  3TZD A;  3JAM E;  4BA2 I;  1DD2 A;  1HPC A;  1JOR A;  1E2Z A;  4OO1 H;  4A3E B;  2F0V A;  5I9O A;  1NAP A;  4H13 C;  3BS1 A;  5EBC A;  3K59 A;  1ENA A;  1HUN A;  2E2D C;  3U9O A;  3FPP A;  1NR2 A;  2E75 C;  1S5B D;  3BG3 A;  1NUC A;  3MFG A;  3VYU A;  1STG A;  3OMG A;  4RHS A;  4CBV A;  3EJI A;  5G3L D;  1KDB A;  4DXF A;  3I3C A;  1ENC A;  1J9O A;  3GTO B;  2A68 D;  1JE4 A;  2EE1 A;  2HCI A;  1RDP D;  3VYT A;  3K5N A;  4M8A A;  1PYW D;  2LY7 A;  1EY4 A;  1EL0 A;  3HKZ B;  3OMC A;  1XTC D;  5FLX L;  1SMY D;  3HEJ A;  4X3K A;  2F0K A;  3DWP A;  1LTR D;  5IGC A;  5IGD A;  4PMB A;  5JEA H;  1PZI D;  4I65 A;  1B4O A;  1NSN S;  1Z47 A;  5J39 A;  4KY5 A;  1IKM A;  1I3Q B;  5C0X I;  2MUY A;  3HZX A;  1BCP B;  2PO4 A;  4NW2 A;  3RLF A;  5DM6 3;  1SDF A;  1F9S A;  1O78 A;  2NYZ D;  4RAU C;  4B9X A;  1ZKO A;  1KLG D;  2F0F A;  2MJ8 A;  1VDZ A;  3H91 A;  3MZ5 A;  1F9P A;  4FXK C;  4PNY A;  1X3Q A;  3BVZ A;  1BBX C;  4JBW A;  4C3I G;  2Y0S B;  3WOF A;  3R93 A;  4HSV A;  3M7G A;  3GQB A;  3PUX A;  2B2T A;  2PZT A;  1D2B A;  1B9M A;  2A5H A;  3GD7 A;  4DK0 A;  2CVR A;  2F0D A;  2FJ2 A;  3CQZ B;  2DNE A;  1Z7T A;  1CI3 M;  4A3F B;  1WD0 A;  2EXZ A;  4RCN A;  5I4D A;  4XQJ A;  1L0Y B;  1K8O A;  3A8K E;  1STY A;  5C4Z A;  5IT9 E;  1KNE A;  1VCI A;  2RDG A;  1JQY D;  3OPO A;  4J8Q A;  4QUC A;  3TSS A;  1PFB A;  2WB1 B;  4BWG B;  4HCS A;  1EU4 A;  2HDM A;  2PCF B;  1HQR D;  2V4D A;  3GTP B;  5JJZ A;  4H0L C;  3EQL C;  1TKW B;  1YNJ D;  1BOS A;  3E0J A;  3MWY W;  3DHQ A;  3TP8 A;  4FYD A;  1IKL A;  1FNU A;  2RSO A;  4KK7 A;  1II3 A;  3VR4 A;  3BDO A;  1BNZ A;  2IT1 A;  1GUS A;  3D6C A;  4BBR B;  2F0W A;  3SVM A;  1W6J A;  4F88 A;  2PNR C;  3K57 A;  1SNP A;  1SYG A;  5K36 G;  4X3S A;  3FEW X;  3I8Z A;  5J1Z A;  4PV1 C;  4EQP A;  4KKU A;  2SDF A;  1SYD A;  5CMD A;  1SAP A;  1SEB D;  1I50 B;  3HOY B;  3FKI B;  4BBS B;  2KEC A;  1BR9 A;  4KHZ A;  4KI0 A;  3S1N B;  4FF3 A;  2F1M A;  3DUZ A;  1WCM B;  4OIJ A;  1PTO F;  4N9P A;  4KV6 A;  4KTA A;  2F0S A;  2SNS A;  3DWQ A;  4QF4 A;  1TS5 A;  4DU9 A;  4WFN 3;  2JA7 B;  3TBI B;  3NQT A;  3TN2 A;  4K5X A;  3JAM L;  1SBB B;  2R92 B;  5IGB A;  2F0J A;  4U67 3;  3A8I E;  1RKN A;  1LTI D;  2Q8R E;  2L12 A;  1BDO A;  1CQF A;  4NMZ A;  4ODG A;  5EPL A;  5COR A;  4TSS A;  5ELC A;  4N9T A;  2JSO A;  3OWF A;  4C3J B;  5EKL A;  4IUT A;  2IWH A;  1NR4 A;  3NTI A;  5FK9 C;  5M9O A;  1RTN A;  4FP5 D;  3MHB A;  1JC7 A;  1F2M A;  2L55 A;  3TP7 A;  2WKC A;  1UAP A;  2N55 A;  5A2Q E;  4GZY C;  2XVS A;  4F7X A;  2X69 A;  1H9S B;  1SJH D;  2K03 A;  1GUO A;  3QOJ A;  2FIN B;  2WIN B;  2XSC A;  1CA6 A;  4CHT B;  1X32 A;  3CRK C;  4HCE A;  4KN4 C;  1IYU A;  3D31 A;  5CV4 A;  1T5E A;  1D1I A;  4K2K A;  5D3D A;  4IFD J;  1SE2 A;  2B2Y C;  1ZXT A;  2CW0 C;  1JWU D;  1ICW A;  5E1F A;  1KNA A;  2E74 C;  1A3T A;  1OXT A;  2PQE A;  3OHX C;  2IX3 A;  1GUG A;  2F0T A;  3PMF A;  5LHY 1;  1F2Y A;  3S1M B;  1W6K A;  2E2J B;  2F4I A;  1K83 B;  2A6E D;  3I4L A;  5C0X H;  1CT1 D;  2CQA A;  1CHQ D;  2HCC A;  3S1Q B;  4MHE A;  5EKI A;  2X6L A;  2F3W A;  1FGB D;  3H6M A;  1V1P B;  2EY2 A;  4OGQ C;  2B2U C;  1B2T A;  3TDQ A;  4C1N I;  1LTT D;  2B2W C;  2AUJ D;  3E5S A;  3H3V C;  3Q6S A;  2TMP A;  2I46 A;  1QOH A;  2D9U A;  4C3H G;  4ZAI A;  3LWU A;  2EZV A;  2BE5 C;  3CKI B;  1JIC A;  1A3V A;  3H09 A;  2NVX B;  4FF4 A;  3G7L A;  2VB3 X;  2XWJ B;  5E4X A;  4G57 A;  1BCP C;  1Q90 A;  2Q8I B;  3DMU A;  1BCP F;  4XQQ A;  3TP5 A;  3WOE A;  1EYA A;  2L0C A;  4NKL A;  2K5D A;  3N6R A;  2D5D A;  4PMC A;  5DAU A;  3DXJ C;  3FRP B;  1QNK A;  2F0G A;  2IX1 A;  3BDL A;  2B2V A;  2X6G A;  2ZXP A;  1FR3 A;  5IT9 L;  3VR2 A;  4G7O C;  1K8M A;  1LAC A;  3K6O A;  3NPP A;  4E6I A;  3NWS A;  1B44 D;  3CU7 A;  1JB3 A;  1MD2 D;  2BA1 A;  5JOB A;  4ZQ3 A;  5C5L A;  2F0N A;  3RMH A;  1Y69 U;  4CJ0 B;  5G3L F;  5KNC A;  4B9W A;  1GHJ A;  3W2D A;  2A68 C;  2NB0 A;  5CV6 A;  4DNR B;  2JA6 B;  1STH A;  3MFY A;  2K5W A;  3NE5 B;  2H4O A;  1EQV A;  3SXH A;  3ERQ A;  4IUN A;  1SMY C;  5T1I A;  3NWT A;  3L9A X;  1B50 A;  1TS3 A;  3KLS A;  3I73 A;  1NCV A;  3T13 A;  4KN7 C;  1DCZ A;  4IUQ A;  4IUP A;  1DOL A;  3SK4 A;  3ND9 A;  2LMC B;  1RTO A;  5I2X A;  5C4J B;  1LTS D;  1LT5 D;  4C1N K;  1OXS C;  2J7Z A;  1MGS A;  1CZW A;  1ROD A;  4EVO A;  3O13 A;  3K5M A;  2VB2 X;  4RH6 A;  4K8J A;  4ZRZ A;  5CV9 A;  3T16 A;  2G9D A;  3X3M A;  2RDH A;  4HED A;  3EVQ A;  1LT4 D;  1DOK A;  2EYL A;  3NTK A;  2SOB A;  1LLR D;  2F03 A;  5C4H A;  1AEX A;  1C48 A;  1OXU A;  2IW3 A;  1EZ8 A;  4R8N A;  4IQZ A;  1PRT D;  3NTH A;  3Q0A A;  4IN3 A;  4UDU C;  3H0G B;  5D14 A;  1V1O A;  1JR0 D;  5ELB A;  4L63 B;  1UNS A;  4QUF A;  4O42 A;  2M9V A;  2A69 D;  5K36 H;  1CQV A;  5CR3 A;  5CV8 A;  2EYH A;  3ND8 A;  4IAL A;  4B08 A;  3I4N B;  2DY7 A;  3TZU A;  2JXM B;  4XQN A;  2WV6 D;  5A2Q L;  3URY A;  1STN A;  3U9S A;  4J6H A;  1Q1E A;  3D6W A;  3S9W A;  4FF2 A;  5TSS A;  3SHL A;  1SSO A;  4HMI A;  2KEE A;  2RKS A;  2B63 B;  1I4R A;  4C2M B;  3RUZ A;  1VF7 A;  2ICE C;  2WAC A;  5KIX A;  3HOZ B;  2L11 A;  2L1B A;  1D6E C;  5I6Y A;  1H9S A;  3K5O A;  1DJR D;  3KF8 A;  3GV3 A;  5DEH A;  2TSS A;  4DK1 A;  1C8C A;  1IW7 D;  3LWE A;  4DXG A;  1AZQ A;  3Q22 A;  1YNJ C;  4LJZ C;  4WOR A;  1LV9 A;  3VA7 A;  2M00 A;  5C6A A;  3HG9 A;  2IPK D;  1ZEQ X;  5M3M B;  2F0H A;  1Z6H A;  2NUC A;  5E3F A;  5CYU A;  3EA6 A;  4FNF A;  1Q3L A;  5IIF A;  2E2I B;  4RGT A;  1Y1V B;  1TS4 A;  2AWN A;  2RBM A;  1GUT A;  3QOL A;  5HUR A;  5T1G A;  3MC0 B;  1O7Y A;  4IZ8 A;  2PZW A;  1V1P A;  1QG7 A;  1A2U A;  3R2I A;  4CKB A;  2O4X A;  2PW7 A;  2K6A A;  2NVT B;  1GHK A;  4IFD G;  1PMR A;  1ESR A;  2O2L D;  1J8I A;  1SNM A;  5I2Y A;  2R7Z B;  2AQ2 B;  3J81 E;  1Q12 A;  5KEE A;  2H1E A;  3T56 B;  1CK1 A;  3PUZ A;  2ID0 A;  4EQO A;  4C3I B;  3BDC A;  3X3N A;  1TWG B;  1E2W A;  5BN5 A;  4BY1 B;  2DY8 A;  5IGF A;  2F0Q A;  2JP1 A;  1DYQ A;  5IGG A;  3P75 A;  5I6W A;  4DA2 A;  2WII B;  3A55 A;  4ILW A;  4EGV A;  1IL8 A;  3HRZ C;  1F2L A;  1WTW A;  1JOQ A;  3V2T A;  1I4Q A;  3DM1 A;  3A8J E;  3I90 A;  3Q23 A;  3NBH A;  2F0O A;  1DXM A;  4IUR A;  3FPU B;  2VNU D;  3SK8 A;  4HR7 B;  4MIU A;  3LX0 A;  2F0L A;  1U9R A;  2XWB B;  1STB A;  3MXN A;  2BA0 A;  5JEA G;  2KJX A;  3AMU A;  3KBG A;  1EZ6 A;  2LFN A;  1EY9 A;  3N52 A;  4IFD I;  3OWE B;  1OXV A;  2A6H D;  1A15 A;  4X3T A;  1STE A;  2K04 A;  3C46 A;  3BZD B;  3ITP A;  4V0B A;  4L8J A;  1R9T B;  2D2C C;  3S15 B;  1GOZ A;  1HHV A;  1TU2 B;  3I91 A;  1WTX A;  1ET6 A;  4AYB B;  1SXT A;  4NP5 A;  2L4N A;  2OXP A;  1EYC A;  1MI2 A;  1HA6 A;  1QB5 D;  2R3Z A;  1CA5 A;  1H9R A;  1ZYR D;  3GV6 A;  1OO9 B;  4XDX A;  2EJF C;  2A6E C;  1D5M C;  1AFP A;  5M5W B;  3GTK B;  5NUC A;  2Z8L A;  1VF5 C;  2QCP X;  1QJO A;  2B2Y A;  1PXU A;  3OIP A;  1H9J A;  2R61 A;  2HQE A;  2AQ3 B;  1E0B A;  2QKI C;  3R3O A;  3OIQ A;  4CGY B;  1IHZ A;  2AQ1 B;  4OL7 A;  2L5T A;  4HMJ A;  4KD3 A;  3VR5 A;  1QCB D;  2KQ3 A;  4ZYS A;  3MAQ A;  1LTA D;  3NQI A;  3VYR A;  1QIL A;  4OHJ A;  1EIG A;  3KLS X;  5JPN C;  5KND A;  5C5M A;  1O7L A;  1KAB A;  2CHB D;  3L7Z C;  3HOV B;  1PTO D;  2EYO A;  2B2U A;  4RHR A;  3HGB A;  4FVM A;  2B2W A;  4WRD A;  2QF7 A;  3KUP A;  2VXW A;  3BVG A;  3QJY A;  3I4M B;  1AZP A;  2K33 A;  2XRS D;  2WP8 J;  4DN4 M;  3OW7 A;  2ENB A;  3NXW A;  3J80 E;  2JEB I;  3I72 A;  2EYM A;  4KHV A;  5JVH 3;  3MA2 B;  4DAY A;  1HRJ A;  3D8G A;  1UUP A;  1FNW A;  5CC4 A;  4TQU S;  5CV7 A;  4CKC A;  2MGS A;  1ML0 D;  5C3E B;  3GO5 A;  1SYB A;  3GTG B;  3NK9 A;  5E4W C;  1KLU D;  2L9H A;  3QWN A;  3PUW A;  2Q8T A;  5C44 B;  4K6L A;  1TWC B;  3I70 A;  1BF4 A;  2FMC A;  1S4Z A;  3HOW B;  3K5L A;  1TR5 A;  1STA A;  1I4P A;  3K58 A;  2A73 B;  5JEA J;  1SND A;  3MXG A;  3ERO A;  2WKD A;  2NWG A;  3QO2 A;  3HOU B;  3NSW A;  5EJW A;  4A3B B;  3S2D B;  3GTM B;  2EJM A;  2LS0 1;  2NZ1 D;  1WVL A;  1AP0 A;  4XT3 B;  4KD4 A;  5CBE E;  3IFT A;  3T51 B;  3J7Y W;  2DNC A;  5FKA C;  4XT1 B;  1EY8 A;  3DEO A;  3QIA A;  5A35 A;  3QG1 A;  2EPB A;  1O80 A;  3T53 B;  4ZK9 B;  3IFD A;  5BN3 A;  1I6V C;  3UI2 A;  4BY7 B;  3R2T A;  3P20 A;  3J81 L;  1FYC A;  4R8I A;  3D4D A;  1LT3 D;  2DN8 A;  3KLR A;  5IGE A;  1LTB D;  1VMP A;  3VYS A;  2OF1 A;  5DNF A;  3DEP A;  2F0E A;  4KY7 A;  1C4Q A;  1TY0 A;  4P2C B;  1S5E D;  1H9M A;  1V8Q A;  1SNQ A;  2R93 B;  1PRT C;  1PRT F;  1D5X C;  3M4Y A;  3M3Y B;  3WDN A;  1TWF B;  1HQM C;  3IAY A;  1V43 A;  4IUU A;  2NVY B;  1M8A A;  4XYQ A;  2AUK A;  4TRD A;  1WTO A;  4KKS A;  2A69 C;  5JPM C;  3S2H B;  1I6H B;  3M85 A;  2IJ0 A;  3Q24 A;  4O1N A;  5JAV A;  5D65 A;  1S5D D;  2JE6 I;  5ELF A;  1OXX K;  2BCO A;  5CBA E;  2A74 C;  1G91 A;  2NTS A;  1WTQ A;  4M1U B;  4IFD H;  2SEB D;  1CFM A;  4DFA A;  3J7A V;  1EY5 A;  5COY A;  4Z9C B;  1ILP A;  5C0X G;  3OOC A;  5FO7 B;  1TWH B;  2MPM A;  4QCL A;  3M7N A;  2ZXR A;  1CM9 A;  1E2V A;  2Z4I A;  2PMZ B;  4G4K A;  2NBF A;  4ZKB B;  2C5C A;  4RKB A;  2JA5 B;  2O5I C;  1IW7 C;  3G6J B;  5KYI A;  1B9N A;  4K8I A;  1PFN A;  1R4Q B;  2XN9 C;  1A3U A;  1PZJ D;  5KYL A;  2K7V A;  1BUV T;  2FFK B;  5DM7 3;  1YNN D;  4Q5V A;  1HFG A;  1CZG A;  4FO2 A;  3HS0 C;  4XXE A;  1F77 A;  1BO0 A;  1ESF A;  1XWE A;  1WTV A;  3R8B A;  2EY6 A;  2QIL A;  2I07 B;  1HCZ A;  2JEA I;  1R4P B;  1LAB A;  1KDC A;  2K1B A;  2KOL A;  1O7Z A;  3CHB D;  2NN6 G;  1DOM A;  4X3U A;  2OT2 A;  1DZ1 A;  5HGT A;  1FNV A;  1G2T A;  4BS9 A;  1SE3 A;  2EYF A;  4RFB A;  1I4H A;  1BQQ T;  1SNC A;  3LNN A;  2O5J C;  1BXT A;  4RCO A;  4ID6 A;  3C3L A;  4G7Z C;  3CRL C;  3D4W A;  2E2H B;  1U4P A;  3AU7 A;  4DAV A;  2N88 A;  2F0U A;  2JA8 B;  4G7H C;  5M5X B;  1KTK A;  3KK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...