1XNQQ

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnqQ00
2VUMG 3TS0A 4DUYQ 3RLNA 1VQ4A 1VCIA 1Q7YC 4A3JH 1HR0L 2V1CC 1X54A 3CCJA 1CKNB 3OW2A 3W1BA 1K8AC 1EWIA 4XIGS 2VY3A 2VUMH 3M9BA 4A3BG 4UPAA 5AJ3Q 4A3CG 1VQDA 4EQ5A 3GD7A 3KJOA 1VQNA 4DV0Q 5HGQA 4A3BH 4JI2Q 4QL5A 4A76A 1J6QA 1XTDA 4A3CH 2BH8A 5K36G 1NBWA 5FLXc 3AYHB 2Q2TA 5IWAL 3TRZA 1GVPA 5C0XJ 2JA6G 2UUBQ 3M4OH 3PF5A 3CD6A 3CCQA 3S2DH 1Q81C 3S17H 1G6PA 4LF8Q 3GDEA 1SR3A 1Y14B 4YWKA 1M90C 3K8AA 2JA6H 3HOZH 2F52A 1L2FA 2Y0SE 3G6EA 2H5XA 3CC2A 4X65Q 4TVAB 3EBEA 2R7FA 2OTLA 1DGSA 4R4OA 4QGUA 2NZHA 3PIPA 4DR2Q 3E9HA 4JOIA 3MXNB 5C4JH 1SE8A 1GD7A 4IPGA 4P71A 2YV5A 4GLAC 1UE1A 1VQEA 4JYAQ 3T1YL 4Y52H 4GOPB 3JC66 1X3FA 2Z0SA 4H02A 2ZTCA 3J81i 4PZ8A 2WFWA 1HR0W 2UU9Q 4LFAL 2JA8H 2Z6KC 3CCRA 3G4SA 1IBKL 2NN6G 2MO1A 3A5ZB 3HKSA 1Q12A 1QUQA 1YNXA 1Q86C 1CUKA 1Q8KA 1OTCA 5IP7G 5E7NA 4X62Q 2E5LQ 2JA7G 4RG1A 4ME3A 1BBUA 3I2ZA 5GQOA 4DV5Q 5GAEC 4DV2Q 4WJ4A 3JAMi 3K80C 5IP7H 3M4QA 4R4CA 4JI1L 1SFOH 1CKNA 2JA7H 2ZM6Q 3ULJA 1K73C 4DR6L 3BJUA 3PSIA 3UDGA 1SRUA 1U5KA 2OWOA 4BY7G 3A74A 4JI4Q 1VQKA 2ZJQA 3D0FA 4DR7L 3UE0A 4DV6Q 3RR5A 1AE3A 4YWLA 4L5QA 4Y7NH 4DV4L 1XJVA 5IYBG 4LFBL 4JBKA 4BY7H 1FVIA 5DLQE 4A75A 4NXNQ 4A3KG 1JJ2A 4YCVA 4R4TA 4LF4Q 4UP9A 1FJGQ 4DR4L 5HY6A 3UDIA 1XPOA 3FHWA 1K9MC 5IYBH 3F1ZA 1HZCA 5IYDG 1AE2A 4A3KH 4BA2I 5GAGC 2QA4A 3CF5A 3PF4A 1I6HH 3CPFA 3GO5A 2VQFL 4JI5L 2OCEA 3KDFB 5IYDH 3M85A 1PH4A 2Q2IA 4GNXC 4TQUS 2YYZA 1SMXA 1UE7A 1VQHA 1S40A 4BBRG 1YITA 4AYBE 2RHQB 2JJQA 4GOPA 4JCVE 2R7DA 3FP9A 3I4OA 4KHZA 1XPRA 4L5RC 4LF7Q 1QVFA 4BXXG 4B3RQ 1E3PA 2MFIA 4GLVB 1JE5A 4IFDI 2UXBQ 2CKZB 4BBRH 3KJPA 2LXJA 5M5WH 4NXML 3HKZE 3KLWA 4C3JH 3GTGH 1IYJB 2K5HA 4BXXH 3OYYA 5IT9c 2UXDL 1HH2P 2JA8G 2KBNA 4NPSA 4OX9Q 4AIMA 3J7ZC 2E2IH 5M5YH 2HT1A 1Y1WG 1K3RA 3EN2A 1B8AA 4YHHL 3I55A 2MNAA 3M3YH 3KYHC 1YZ6A 2F3IA 4L5SA 4DV1L 5JJKA 4BY1G 3TEHB 4OO1I 2EIFA 4PZ6A 3AEVA 2K50A 3CMAA 4X6AH 3CPWA 4IOCA 2B29A 3F2CA 4LF9Q 2KENA 1YHAA 4OXPA 2E2HH 4XTCS 4BY1H 1A0IA 1OXUA 2PNHA 3GTKH 4X64Q 4HJ8A 2YTVA 5BR8L 5M3MG 4DR5Q 5IY0A 1Z9FA 4WJ3M 3ZJYC 2FXQA 1VQGA 1I5FA 5IE8A 4GNXB 3U4VA 3D31A 3F8TA 3KOJA 3L2PA 4YY3L 3CCUA 1XNQQ 3I4NG 2ZJRA 2KCTA 3UDFA 4HJ7A 2YTXA 2QGQA 1G291 2RF4A 5M3MH 3A5UA 4GKJL 5JEAG 3STBC 2VS1A 1VQOA 4DUYL 3I4NH 4POFA 4IFDG 3PUXA 1EIFA 3BU2A 3CP0A 1JMCA 2WB1E 3KDFA 2UUCQ 2PQAB 3L0OA 3S1NH 4A93G 4IOAA 1HNXL 1D7QA 3A0JA 2K75A 4OONA 4RMFA 5LMUL 4A93H 4JI2L 1I3QH 4DPGA 1PH3A 2R7ZG 1OXSC 3RLFA 1W3SA 2K14A 1PYBA 1YJNA 3CCMA 3S14H 2CWAA 3NEMA 1TWFH 1X6OA 2N8NA 3STBD 1XMQQ 1N34Q 2UUBL 1VQFA 3B6YA 3S2HH 2R7ZH 4OO1G 3ER0A 2R92G 2N78A 1HNZQ 2GVBA 1LUZA 3CXCA 5LMNL 3I7FA 1HR0Q 2MO0A 1EIYB 1TXYA 1KD1C 5JJLA 4X65L 3IRBA 2R92H 1G51A 3PO2G 4GN4B 4KHPQ 2ES2A 3PUVA 4HIDA 4LFCQ 1KAWA 4JI8Q 2CWPA 3ERSX 4IPHA 4JI0Q 1CKMA 2A1AA 2DUDA 4QJFA 3KF8B 3HOXG 3PO2H 4GKKL 2UXCQ 2JK8A 3GTQH 5IWAQ 3F2DA 3TS2A 4OWXB 1RIPA 1VQMA 3J80i 4AQYL 1TWCH 3HOXH 4LWCA 4GNXA 3RNUA 4C3HH 4DV7Q 3WWVA 1H95A 1E1OA 2I5HA 3I4MG 4DK6C 2E5LL 4O0AA 4PG3A 4IJHA 1LM0A 4DR3Q 1PV4A 2NVXH 4DAMA 2A8VA 4DV5L 1VQAA 1E1TA 4DK3C 3I4MH 4BA1I 2CQOA 4YWMA 1YJ9A 1E24A 3S16H 2CFMA 3CCSA 3T1YQ 2N49A 1NMGA 4B3TL 4R4IA 2NZOA 1E7ZA 5LMNW 1UEBA 1Q46A 5C3EG 4DUZQ 1MKHA 4AYBG 4OWWB 3UDXA 3U58A 1J5EQ 4QQBX 1PVOA 2HHHL 4IO9A 3CCLA 4IJLA 2OTJA 3AQQA 1CSQA 2OQKA 1IL2A 5C3EH 1Y1VG 1I94L 4O2DA 1TWHH 4MNOA 3RN2A 1VQJA 1N36Q 3F2BA 3PGZA 4UP7A 1KRSA 2IX1A 2XGTA 1NTGA 2ASBA 1VQ8A 2BA0A 1WI5A 1Y1VH 4P72A 4B3SQ 4JI1Q 1A8VA 2I5MX 1YVCA 3M4PA 3ULLA 1KL9A 5FLMG 3GTJH 4DR6Q 4A3GG 4HJAA 1EQQA 3CC7A 2Q2UA 4UY8C 1EFWA 5FLMH 2JE6I 3H0GG 4HIMA 1E22A 1GO3E 4DV4Q 4A3GH 1YJWA 4DR1L 4MTNA 1P8LA 3Q8DA 1SROA 5GAHC 1NMFA 4UP8A 2WP8J 1PH1A 1X3EA 1VQ7A 3BZKA 3H0GH 2K52A 2ZTDA 3G71A 1YHQA 2GVAA 3AFPA 5EAYA 1N8RC 2AKWB 3HOYG 1B70B 4C2MH 2KHIA 1K83H 4B3ML 1YBYA 3PIOA 1RL2A 2E2JH 2JA9A 4X66Q 5FJ8G 1QZGA 4QIWE 3PCOB 2K5VA 4KI0A 2VQFQ 3HOYH 1NE3A 3S1RH 1EOVA 2UUAQ 4JI7L 2F4VL 2D62A 4K0KL 1QVGA 2IY5B 1VQLA 5FJ8H 5ELOA 1VQIA 3DLLA 2CCZA 2WB1G 5IP9G 4IPCA 1XPUA 2KCMA 1LYLA 4LF9L 1KHIA 3MEFA 1LTLA 3TQYA 4LF5Q 4JI3Q 1QZHA 4NB3A 2JA5G 4NXMQ 1CSPA 3PUWA 4JG2A 5J3BA 3SGIA 5IP9H 2ZTEA 1Q1EA 4DR5L 3OTOL 4DV3Q 5M5XH 1C7YA 4JI6Q 3KFUA 1IBML 2HQLA 4PZ7A 4POGA 2UXDQ 3NBHB 1EQRA 2JA5H 1XNQL 2VQEQ 1MJCA 1IBLL 3S15H 4JV5Q 4GN3B 1N33L 3T1HL 1OXTA 3BZCA 3S1MH 2LSSA 1HZAA 1YI2A 1XNRL 1WYDA 4L5TA 2PMZE 1PH5A 2JQOA 2Z6KA 4DV1Q 2C35B 2Y0SG 1X56A 3HOVG 2UUCL 3RZOH 4JBMA 5AJ3L 3HOWG 1HNWQ 1PH9A 1XMOQ 4LF6Q 2N3SA 2MQHA 4DKAC 1T9HA 1UE5A 4DV0L 1K8GA 5BR8Q 4LNQA 3HOVH 1N32Q 3HOUG 3W1GA 4A3LG 3HOWH 4YY3Q 2I0QA 1EUJA 3GTPH 1U0LA 1N34L 1ASYA 4JBJA 3HOUH 4A3LH 1SN8A 4GOPC 3GTLH 1HNZL 1X9NA 4LF8L 1X65A 1YHBA 1O7IA 3K0XA 3H15A 3E9IA 2PI2E 2NN6I 3CW2C 1L1OC 4KHPL 4AH6A 2IX0A 1HNXQ 3PUZA 2IHFA 3K7AH 2HIVA 4LUVA 1K0RA 1B7YB 2DGYA 4P73A 4LFCL 2XTIA 5C0XI 1BKBA 2ID0A 4DR2L 4JI8L 2Q2HA 4JI0L 2WAQE 3KF6B 5LMUQ 1PHJA 4HJ5A 1ASZA 3PO3G 1KRTA 4JYAL 2UXCL 3PV0A 1YEZA 4APVA 2GN5A 5ELNA 1P16A 3T1HQ 5GROA 1PA6A 3ICEA 3J81c 3RLOA 3J80c 2UU9L 4GS3A 1BBWA 4EX5A 3PUYA 3PO3H 1PFSA 4ALPA 1AH9A 1OXVA 1X3GA 4FDBA 2VW9A 2E8GA 4DV7L 2VNUD 1GM5A 1KXLA 5LMNQ 1PH6A 4X62L 4DR3L 1I50H 4A3IG 1EYGA 3JAMc 4DV2L 2HIXA 2YTYA 3CCEA 4HIKA 1NY4A 1HZ9A 2PQAA 2R6GA 2ZM6L 4GKKQ 4A3IH 1VQBA 2AMCB 3H3VI 1KIXA 1MIUA 2RCNA 4DUZL 3RZDH 4JI4L 1V1QA 1VQ6A 4LFAQ 4AQYQ 5H1SE 4DV6L 4JBWA 1J5EL 1L1OB 3CAMA 1IBKQ 2BH2A 2LXKA 4R1JA 4NXNL 3U4ZA 4C3IH 1FJGL 5IYCG 4LF4L 2RHSB 3I56A 5C0XG 3HKZG 1R9TH 1A62A 1N36L 1N9WA 3E0EA 1PH7A 2R93G 1VS0A 2A19A 2AHOB 5C4XG 5IYCH 4B3SL 2ALYB 3RN5A 1GKHA 1JT8A 1HJPA 1Q82C 1L0WA 2VZAA 4YCUA 4B3TQ 2R93H 2B3GA 5C4XH 1VQPA 4P74A 1W2BA 4IPDA 1IZ6A 1BVSA 1PH8A 3GTOH 3HOZG 1PYSB 4YCWA 4DR7Q 3KF6A 1MJEA 3CC4A 4HJ9A 3DM3A 3HFZB 3K81C 2HHHQ 4LFBQ 2NVQH 1X55A 4B3RL 2QEXA 2EQSA 3S24A 3NENA 4LF5L 4LF7L 3FKIG 1A63A 1I94Q 4BBSG 2UXBL 1WFQA 1TWGH 1S3OA 1Q1BA 4DR4Q 4MZ9A 4A3EG 2L15A 4PMWA 1JJCB 5JEAJ 3GTMH 4JOIC 3CMEA 2I5LX 3FKIH 4R4QA 1JJGA 5C44G 4BBSH 1YIJA 4X66L 2ZJPA 4OX9L 4IFDJ 4A3EH 4JI5Q 1FGUA 2BA1A 3M7NA 2PI2A 2UUAL 2NVTH 5C44H 1Z47A 2ATWA 1D8LA 3H3VH 2K4KA 1VQCA 1NJIC 2OQ0A 4A3MG 2AWOA 4DR1Q 2K5NA 4GLXA 4A3FG 1SLJA 2IHEA 3W5OA 1CKOA 2D0PA 2B63G 3AFQA 4JI3L 3L7ZC 3J7A5 1L1OA 4LUOA 4A3MH 2D0OA 4X64L 1OXXK 4DV3L 2YU9H 4J15A 4A3FH 4LUZA 4B3MQ 4JI6L 1V9PA 2B63H 1S72A 4A3DG 3UE1A 1PH2A 5JJIA 2VQEL 3G48A 4JV5L 1VQ9A 4JC0A 1JB7A 4JI7Q 4DNIA 3TREA 1UWVA 4YHHQ 2KHJA 4HIOA 1C9OA 3VDYA 2F4VQ 4A3DH 2NVYH 4K0KQ 1UE6A 1WCMG 2AWNA 4DAYB 1KC8C 2JEAI 1Y1WH 4P75A 3S1QH 3CCVA 3U50C 4GN5A 3J81j 1C0AA 2VL6A 3ULPA 1WCMH 4OWTB 1HNWL 4A4IA 2IT1A 5M3FG 1XMOL 4LF6L 2WAQG 2JEBI 1N32L 4QY7A 3OTOQ 3CQZH 1HZBA 1KQSA 2EXDA 3K7UC 1QVCA 1WOCA 4LW1A 1M1KC 1IXRA 1IBMQ 1VQ5A 4KLKA 5M3FH 1TWAH 1IBLQ 1WJJA 4GKJQ 3EIVA 1QUQB 4A3JG 3LGJA 1N33Q 5GADC 1V43A 1XMQL 3NELA 1FL0A 1XNRQ
chains in the Genus database with same CATH superfamily
4ZYSA 3GV3A 1G6ZA 1EY6A 2K5DA 5ELCA 3Q24A 2V1CC 3D4WA 4A3JH 3CCJA 1CKNB 3W1BA 2VUMH 3M9BA 3QIAA 4EQ5A 3KJOA 1VQNA 1NUCA 4A3BH 3IFTA 4ULLA 4JI2Q 4QL5A 4A76A 1G2TA 1XTDA 5EPJA 4CHTB 1NBWA 5FLXc 2Q2TA 5IWAL 4KD4A 5C0XJ 4FXKC 1IKLA 3CCQA 5FKAC 3GV6A 1Q81C 3S17H 3S2DH 4ID6A 2HQEA 4LF8Q 4YWKA 3K8AA 2JA6H 2N55A 3CC2A 3TZUA 4HMIA 3EBEA 2R7FA 4R4OA 4QGUA 1DOLA 1PFNA 5C4JH 1SE8A 4P71A 1PTOF 3S9WA 2Z4HA 4GOPB 3URYA 2UU9Q 4LFAL 1XX8A 1D5XC 3IAYA 3G4SA 1ESFA 1YNXA 3HGBA 3S1NB 5IP7G 2RKSA 4X62Q 2JA7G 1XTCD 2NN6H 5GQOA 4TSSA 4WJ4A 4R4CA 4JI1L 1SYCA 2F0SA 3ULJA 3UDGA 2OWOA 5CV5A 4JI4Q 2ZJQA 3D0FA 4DR7L 1IL8A 3S2HB 5E1FA 4Y7NH 4RCOA 3IL8A 4YWLA 4F7XA 1XJVA 4DR4L 2SOBA 5HY6A 1RF2D 2LY7A 3UDIA 3K7AB 1K9MC 5IYBH 2IPKD 5CV8A 5IYDH 2B2VA 3F2UA 3M85A 1TWCB 4GNXC 1T5EA 2J0TD 1VQHA 4TQUS 1S40A 3HOXB 4BBRG 2R7DA 1XPRA 4B3RQ 4KHZA 1E3PA 5EPKA 2NVXB 5M5WH 5L37A 1DYQA 1IYJB 2B2TA 1ENCA 3TP7A 5IT9c 2UXDL 4OGQC 1RKNA 2E2IH 2HT1A 2A74C 1F2MA 3RZDB 3I55A 2QW7A 3KYHC 3BDOA 1CFMA 4RKLA 2K04A 3TEHB 2SDFA 2F0IA 5C3EB 2K50A 1O78A 2B29A 2OF1A 4XTCS 1C4QA 4HJ8A 2YTVA 4DR5Q 1Y8PB 5IY0A 3HZXA 3GTJB 3QO2A 3D31A 3F8TA 1ENAA 1Z6HA 2KCTA 5C4XB 2QGQA 5M3MH 3A5UA 4TKOB 3STBC 4DNRB 2VS1A 1VQOA 2F0VA 4DUYL 3I4NH 3QB3A 3BU2A 1WD1A 5JEAH 4WORA 3MXPA 2PQAB 1HNXL 3A0JA 2B2UA 4IFDH 4EQPA 1HCZA 1CTMA 3S1RB 1B3QA 1YJNA 3S14H 5ELDA 1WTRA 4F87A 2CWAA 4OIKA 1TWFH 1R4QB 1R4PB 2UUBL 1AEXA 1VQFA 3B6YA 2R7ZH 2FMCA 2GVBA 1IYUA 4S3SA 4NMZA 1B44D 1B3AA 2R92H 4U673 2LKVA 2ES2A 1PTOH 2EYHA 3PUVA 1HUNA 4HIDA 5M5XB 1A2UA 5ISRA 4BWGB 1F2ZA 3ERSX 4IPHA 4QJFA 3HOXG 3KF8B 3PO2H 2JA5B 3BVGA 2JK8A 3GTQH 4MIUA 5IWAQ 1LT3D 4OWXB 2NVYB 1TY2A 3MFYA 2PW5A 3K5OA 3RZOB 1SJHD 5NUCA 3I4MG 4H0LC 3HP3A 1JR0D 4ZRZA 2SEBD 2E5LL 1S5CD 3Q23A 1QG7A 1PZID 2A73B 1E1TA 4DK3C 5KGUA 1S5FD 1YJ9A 1AFPA 5K5PA 3PQIA 1QJOA 2N49A 2WAQB 2L11A 4R4IA 1UEBA 1ICFB 5C3EG 1SYGA 4AYBG 4QQBX 1V1PB 4IJLA 1I94L 1TWHH 4MNOA 3F2BA 1JB3A 4UP7A 1KRSA 3HS0C 2XGTA 2MHVA 3AU7A 2ASBA 3TSSA 3MZ5A 4XXEA 4PNYA 4B3SQ 4JI1Q 4ZQ3A 1A8VA 2I5MX 1S5DD 1PTOD 3ULLA 1KL9A 1II3A 1F9SA 2NWGA 3A8KE 3M4OB 4UY8C 4HIMA 1KNAA 1GO3E 4A3GH 1YJWA 1VQ7A 4LF5Q 1PH1A 2K52A 2ZTDA 4G4KA 2GVAA 2EY5A 2HDLA 2KHIA 3T53B 1WTWA 1QZGA 2K5VA 4KI0A 3HOYH 3T51B 1NE3A 1EOVA 2JA8B 2D62A 4HCSA 2KOLA 1GUSA 4N8X1 1VDZA 3DLLA 5IP9G 1KLUD 2KCMA 3M3YH 3MEFA 1LTLA 3I73A 4I65A 1U4PA 1QZHA 2JA5G 2PYKA 2ZTEA 4KJOA 3KFUA 1H9JA 4QCLA 2UXDQ 1XNQL 5CMDA 2R93B 1MJCA 3J81E 1EZ6A 4JV5Q 1DZ1A 1LT6D 3BZCA 1XNRL 4HCEA 1ET9A 4DA2A 1OO9B 2PMZE 1PH5A 3A54A 1X3PA 3JAML 2A6ED 2Y0SG 2ZT9C 3A7LA 5KYIA 2UUCL 2EY2A 2XNAC 5EPLA 1SE3A 3GTMB 3H09A 2EE1A 4N9TA 1K8GA 1I6HB 3HOWH 4WFN3 2I0QA 1EUJA 3HEJA 3IFDA 5C44B 1NR4A 4A3LH 3GTLH 1SYBA 2EYPA 1HNZL 5C3WA 5JJZA 2GA4B 3T13A 3R3OA 1YHBA 3E9IA 4FNFA 2NN6I 2L5TA 4KHPL 1HNXQ 2IX0A 4LUVA 3K59A 2HIVA 4A3MB 1B7YB 4DR2L 1HPCA 4JI0L 4B08A 1MD2D 2UXCL 1KAAA 2GN5A 2K5QA 5ELNA 1WTPA 5GROA 4PMCA 1STNA 4O1NA 1BBWA 4MHEA 2E2DC 1PFSA 4ALPA 4LAAA 1AH9A 2F0GA 2O2LD 4K6DA 2EYFA 2E8GA 4DV7L 1Y1WB 1GM5A 1RTNA 2CH4W 5C4ZA 2RVLA 1TS2A 4DR3L 3UI2A 3C1EA 1E0BA 1I50H 3I4LA 3GTKB 1HZ9A 1X3QA 3VYUA 2F0JA 2F0TA 4XQJA 2ZM6L 1A3VA 5M3FB 2JN4A 1PTOC 4A3IH 4K5XA 1SNQA 5I9OA 1VQ6A 5H1SE 1J5EL 4JBWA 4C3IH 5IYCG 1R9TH 1M4VA 5C0XG 3A7AB 1A62A 1N36L 2IWHA 1B1ZA 2R93G 4XQNA 2Z8LA 4A93B 1B9NA 4FF3A 1I3QB 2EJGC 4IPDA 1K0SA 3GTOH 1SNDA 4OHJA 1MJEA 2NVQH 1C48A 2EQSA 2E76C 3NENA 3S24A 1A63A 1ONLA 3NPPA 1I94Q 4BBSG 2UXBL 4IN3A 4CBVA 2NYZD 2F0HA 2F3WA 1FD7D 4G7OC 2I5LX 1JJGA 5C44G 3NTIA 4X66L 3MVVA 2B2YC 2M00A 4A3EH 1GOZA 3MHBA 4IZ8A 1HRJA 2KEDA 1Y69U 2L4NA 4B9WA 3H3VH 4RHSA 2R3ZA 4C3HB 2PZTA 4A3MG 1B4OA 5F2DA 2G9DA 3C1FA 4GLXA 1H9KA 2A6EC 2C9OA 2D0PA 4JI3L 3J7A5 1IYVA 1L1OA 4LUOA 2D0OA 3CRLC 4X64L 3TZDA 2QEJC 4DV3L 2WKDA 2B63H 3DMUA 5JJIA 5FLXE 4DXFA 4QF4A 3J80E 2EZVA 1DM0B 3J7YW 1LV9A 1WCMG 1KC8C 4DAYB 2OXPA 3S1QH 3CCVA 2F3VA 2Q8IB 1C0AA 2HCCA 2VL6A 5M3FG 5JOBA 4QY7A 2EXDA 2XIWA 3VR6A 1QVCA 1VQ5A 1JOQA 1TT2A 1L0XB 2B2VC 1TWAH 1WJJA 1G51A 1XMQL 1LTGD 1XNRQ 3TS0A 5A2QE 5IOCA 1VCIA 2A6HC 1HR0L 3HRZC 4J8QA 1O7YA 1HUMA 3OW2A 4IUNA 1EWIA 1K8AC 4UPAA 2K1BA 4HSPA 3GD7A 1ZKOA 3W3AA 3AYHB 2F0PA 1NCVA 3K0YA 1F2LA 2PO4A 4CGYB 1Y14B 1GHKA 1M90C 1HHVA 1L2FA 2Y0SE 4ME5A 1LTSD 4X65Q 1VMPA 2OTLA 2NZHA 4DR2Q 1ICWA 1MSHA 2EYOA 4JOIA 1MSGA 1GD7A 1KDCA 1VQEA 4RGTA 1F9RA 2HD3A 4H02A 2ZTCA 5E4XA 5T1IA 3J81i 4C3IG 2WFWA 1HR0W 2KQ3A 2D5DA 2Z6KC 1IBKL 4DAVA 4ILWA 3HKSA 4OELB 1OTCA 2RQXA 5E7NA 4RG1A 5C6AA 1BBUA 5LL6X 5HGTA 4DV5Q 5GAEC 5IT9E 5IP7H 3DHQA 1HFNA 2RDGA 2JA7H 5C5MA 2ZM6Q 4I7AA 3BJUA 3DUZA 3NHHA 1SRUA 2L55A 1I4XA 3HOUB 2K5WA 1D5MC 4PV1C 1CHQD 3RR5A 1LTAD 4LFBL 1HQRD 4L5QA 4DV4L 3C2PA 4CJ0B 1FNUA 1U4RA 3OIQA 4A3KG 1JJ2A 3L3OC 4R4TA 1B50A 3PIP3 2ICEC 4QB4A 3OWFA 2QA4A 1EWHA 4HN7A 5DAUA 2XRQD 1BNZA 5C3XA 3PO3B 3MXNA 1DOKA 1UE7A 4C3JG 3QJYA 4BXXG 2MFIA 4CJ2C 2UXBQ 1CI3M 4BBRH 4NXML 3KLWA 1EY4A 3VA7A 3S16B 4X3UA 4RGOS 2AUJD 5M5YH 3VYRA 1K3RA 1WTOA 1ZYRD 3TP6A 3E5SA 4L5SA 5JJKA 4FO2A 4OO1I 2KCCA 4PZ6A 3H3VC 4IUVA 3EVQA 5J39A 4LF9Q 2KENA 2E2HH 1WVLA 2PNHA 4X64Q 1JICA 3J81L 1TS5A 3HKZB 2FXQA 1VQGA 5IE8A 4GNXB 3CCUA 3L2PA 5TSSA 2DN8A 3K5LA 3NSWA 3UDFA 4GKJL 2YTXA 2RF4A 1AP0A 1I4HA 1SYFA 3NTKA 1CK1A 4POFA 2C5CA 2WB1E 4KN7C 3KDFA 4CDDC 1Q90A 3R2IA 3S1NH 1TWGB 1SE4A 1PRTF 1JORA 5C4HA 4C2MB 3FKIB 1XYIA 4RMFA 5LMUL 1X32A 4IUUA 4DPGA 1PH3A 4M8AA 1OXSC 3RLFA 4K14A 1PYBA 1IW7D 1YNJC 5J1ZA 2Q8TA 3STBD 1XMQQ 3N52A 3T16A 2J4XA 3S2HH 2L1BA 3ND9A 2NBFA 2N78A 4KHVA 3CXCA 1HR0Q 1EIYB 1TXYA 1EY0A 1SE2A 5JJLA 4JK1C 1CZGA 3IRBA 3TMEA 2KUMA 2WINB 4LFCQ 1PFBA 1KAWA 4A3FB 4JW0A 3MWYW 2CWPA 2WACA 3SE0A 2A1AA 2B2YA 4CKCA 3F2DA 3J80i 5CC4A 1TWCH 3HOXH 1SMYC 2F0OA 1RJTA 3LWEA 1SJED 3BVMA 3ERQA 3OSOA 2NVXH 4EVOA 2RDHA 1TIID 1S5BD 2RCFA 2A5HA 3VA5A 3I4MH 4YWMA 1O7LA 2CFMA 3CCSA 4B3TL 3GTPB 5CORA 2D9UA 2A68D 2F0NA 3P75A 3TP8A 4DUZQ 1WTXA 3I70A 2HHHL 3AQQA 2K01A 4A3JB 1CSQA 2OQKA 4HMJA 5C3EH 4NP5A 2VUMB 4QMGA 2ZXPA 1EIGA 1VQ8A 4RWSC 4U68A 1WI5A 2F0KA 3VR2A 2HDMA 3GTJH 3M4PA 1KDAA 1J8IA 1JC7A 2P5ZX 3I3CA 1V1OA 1NNXA 2JE6I 1ZYRC 3I8ZA 4DV4Q 2EJFC 4MTNA 1P8LA 2JA6B 4ZK9B 1SROA 5GAHC 2KCNA 2WP8J 5G3LD 3G71A 3Q22A 1SYEA 1N8RC 2X69A 1H9RA 2E2JH 4XDXA 1GXDC 4DNTB 3S1RH 3KLSX 2G5DA 2UUAQ 2H1EA 2IY5B 1S4ZA 1MHWC 1FYCA 1PVOA 5FOBB 2IX3A 1XPUA 1KHIA 5CV4A 4NXMQ 4JG2A 5IP9H 3KLRA 1Q1EA 5FLXL 1JE4A 5M5XH 1C7YA 3J80L 5AFWA 1QNUA 4IURA 2JA5H 3A8IE 2VQEQ 3S15H 4XT1B 4V0BA 1IW7C 1OXTA 3S1MH 4QIWB 5IGEA 1HZAA 1YI2A 1WYDA 1BCPF 2BDOA 1SBBB 2Z6KA 4Y7NB 4PMBA 5CBAE 3SXHA 3RZOH 3ND8A 5E4WC 5AJ3L 4LF6Q 1O80A 4MN3A 1CT1D 1F9QA 4ZKBB 2KA7A 2Q8RE 1U0LA 1N34L 4JBJA 4DFAA 2BOSA 4GOPC 1X65A 1BUVT 2PI2E 3CW2C 1L1OC 5M5WB 3PUZA 4P73A 2YU9B 4FXDA 2ID0A 4JI8L 2Q2HA 1LABA 5LMUQ 1PHJA 3PV0A 1YEZA 1KLGD 2E2IB 1RD9D 1PA6A 2QKIC 2XWBB 2WV6D 3ICEA 2A68C 3PUYA 1OXVA 2TSSA 1GUTA 5DM73 3SHLA 3OMCA 4QUCA 1PRTD 2L0CA 2QDLA 3JAMc 4DV2L 1NY4A 3FEWX 1WTVA 2QF7A 2DJGC 2JSOA 3FRPB 3BS1A 5D3IB 5JVG3 5M3MB 4JPBW 1MIUA 4K2KA 4LFAQ 5KEEA 3I4NB 2M2LA 3CAMA 5CV9A 4B9XA 2BH2A 4R1JA 2F0QA 4NXNL 3U4ZA 1FJGL 4R9WA 1ZEQX 1N9WA 2M9VA 3K58A 3E0EA 1MGSA 2OT2A 4G57A 2A19A 5C4XG 5IYCH 3RN5A 1GKHA 5C0XH 1JT8A 1Q82C 3E6ZX 1IHZA 1KABA 4B3TQ 2R93H 1LTID 2B3GA 2K33A 3S14B 1STHA 1W2BA 1IZ6A 3E3XA 1LTTD 4YCWA 4DR7Q 3KF6A 2HHHQ 2PPBC 3SVMA 2SNSA 4KKSA 1HTLD 1S3OA 4DR4Q 2L15A 1PTOB 3V96A 3GTMH 4JOIC 4BBSH 3MA2B 3PMFA 4CKBA 3PO2B 4H13C 1FGUA 3D4DA 2BA1A 3GTQB 5JVH3 1STGA 2PI2A 2EDGA 1SNOA 5C44H 1Z47A 2K4KA 1VQCA 1NJIC 1H9MA 2K5NA 4KK7A 1SLJA 2IHEA 2IJ0A 1XXGA 4JVZA 3L7ZC 1JOKA 4A3MH 4JI6L 1SFOB 1S72A 3UE1A 1PH2A 2O5IC 5FK9C 4RH6A 2FHTA 4DNIA 3TREA 2F03A 2KHJA 1SDFA 1CQVA 1UE6A 2AWNA 1QOHA 3A8JE 1Y1WH 4BY7B 4P75A 3ULPA 1WCMH 1HNWL 4EQOA 4A4IA 2IT1A 3ITPA 1XMOL 2BDNA 5FO8B 2WAQG 1N32L 1HZBA 1KQSA 4L63B 4IUTA 1BBXC 4G7HC 4N9PA 4KLKA 5M3FH 1SXTA 1D5ZC 3OHXC 3KUPA 3EQLC 1PMRA 4OIJA 3TS2A 1V43A 1FL0A 3FMCA 3R93A 4DUYQ 3RLNA 1VQ4A 4A3GB 3H91A 5EGTA 1AN8A 1X54A 4CDFC 5EQ0A 2XSCA 2VY3A 3GTGB 5AJ3Q 4A3CG 5CGKA 1VQDA 1ENFA 1PRTC 1HTPA 1EQTA 5HGQA 1EEID 1GUGA 1O7ZA 1J6QA 4K8IA 3HOYB 2BH8A 5K36G 1GJXA 4C56C 3TRZA 1DD2A 1GVPA 2L12A 3P7JA 2UUBQ 3PF5A 3CD6A 1BCPD 2PNRC 2A6HD 1G6PA 1PZJD 5ELEA 3GDEA 1SR3A 3I90A 3M3YB 1HFGA 4TVAB 4BY1B 1DGSA 1EZ8A 2CW0D 3PIPA 2JA8G 3A56A 4IPGA 2YV5A 4Y52H 5C5LA 1YNND 1X3FA 1RHPA 1TU2B 3EFXD 3OW7A 1LLRD 1KDBA 3A5ZB 1Y8OB 1QUQA 5IIFA 2E5LQ 4FP5D 1AZQA 3OOCA 4ME3A 1WTHA 4ZLTF 3I2ZA 4DV2Q 3SDZA 3K80C 3M4QA 1CKNA 2HCIA 4ODGA 3HOWB 1GUOA 1K73C 3MFGA 5CV6A 1U5KA 4BY7G 2MPMA 3A74A 2ICIA 1AE3A 1JWUD 4A75A 4NXNQ 1U4MA 1DOMA 1FJGQ 2PZWA 4LMQD 4UP9A 2E75C 1XPOA 3FHWA 3F1ZA 1DXMA 1AE2A 4A3KH 2SNMA 5GAGC 3CF5A 3DWQA 4JI5L 4F8MA 2DJFC 2OCEA 2KHSA 1PH4A 2Q2IA 3RUZA 2YYZA 4AYBE 2RHQB 4GOPA 1RODA 3I4OA 2F0EA 1RDPD 4LJZC 4IFDI 1JE5A 2CKZB 3Q0AA 1G91A 1A2TA 2LXJA 3KJPA 3D3RA 1I50B 4C3JH 1QWYA 4YIJA 1I4GA 4BXXH 3OYYA 1HH2P 2KBNA 4NPSA 4A3IB 3J7ZC 2A69D 1Y1WG 3EN2A 1H9SA 4YHHL 2LS01 1YZ6A 4TRDA 3K6OA 4DV1L 4BY1G 3MXGA 4XYQA 4X6AH 2XRSD 4UAIA 4IOCA 3SK5A 2NTSA 3NK9A 3F2CA 2NZ1D 4V190 1A0IA 1OXUA 1Y1VB 1Z9FA 1G2SA 4WJ3M 3ZJYC 4KKUA 1I5FA 2CHBD 3U4VA 1XNQQ 4DK0A 3K5NA 1JWSD 4CKEA 3GTOB 2BCOA 1BDOA 4O42A 1PDQA 1BCPC 2NVQB 3PUXA 1EL0A 3CP0A 4DK1A 3HOZB 2UUCQ 1GUNA 3H0GB 3L0OA 4A93G 1D7QA 1K83B 4FF2A 2N88A 4OONA 2CW0C 3CU7A 3OPOA 4JI2L 3BG3A 3G6JB 1YNNC 2K14A 4ZKCB 1QNKA 2N8NA 3FPUB 4OO1G 4XT3B 1HNZQ 3I72A 1LUZA 5LMNL 3I7FA 2MO0A 2AQ1B 4KY7A 3FDTA 3L9AX 3P1HA 4KHPQ 3OWEB 3GP7A 1PFMA 4JI0Q 2B8GA 3Q6SA 1TR5A 1CKMA 3DWPA 2DUDA 2UXCQ 2EY1A 4C3HG 1YNJD 2NUCA 1VQMA 5J22A 4AQYL 1Y8NB 3H6MA 2KVMA 4LWCA 1TS3A 3RNUA 4Z9CB 4DV7Q 3WWVA 1H95A 2XVSA 1E1OA 2I5HA 3S1QB 5G3LF 2FFKB 4PG3A 2D2CC 4DR3Q 1Q3LA 1UUPA 3HOVB 4BA1I 1AW7A 3QWNA 1E24A 1K8MA 3S16H 5LMNW 3TN2A 1Q46A 1MKHA 4RKBA 3DWAA 1SMYD 2BE5C 4NDXA 3U58A 1EYCA 1J5EQ 4IO9A 4X3KA 1LT5D 3CCLA 1IL2A 1Y1VG 1ILQA 4KV6A 1N36Q 3PGZA 3MXUA 5LL6S 1NTGA 2K05A 5FLMG 3X3NA 4QUFA 1BXTA 3BYTB 2A69C 1EU3A 2NTTA 4C1NK 3X3MA 1EFWA 3H0GG 3KF8A 5JAVA 3NTHA 1B53A 4DR1L 3Q8DA 4KD3A 1X3EA 3BZKA 3QOLA 1YHQA 1SNMA 4H7BA 5EAYA 2E74C 1B70B 4C2MH 3PIOA 1EYDA 5EKKA 3H94A 1DONA 4X66Q 1A3TA 5FJ8G 3RD4A 3WOFA 2F4VL 1QVGA 1EY8A 5ELOA 2CCZA 4N8FA 4H44C 3NQTA 2EPBA 3GQBA 3WDNA 1LYLA 4KN4C 3SK6A 3TQYA 4JI3Q 1V1PA 3PUWA 1NSNS 4DR5L 3OTOL 4DV3Q 5CBEE 2DNCA 1IBML 3SEBA 2F0WA 1EQRA 1PXUA 1IBLL 1U4LA 4GN3B 1N33L 1SNCA 4HSVA 3VYTA 2EVBA 5CYUA 2LSSA 4UDUC 3MAQA 1D6EC 4L5TA 2JQOA 5D14A 1UAPA 4DV1Q 4CDEC 3EROA 1X56A 3NWSA 4RGNA 3HOVG 1KNEA 3D6WA 4RA8A 3JAME 1PH9A 2N3SA 2MQHA 3TDQA 2NB0A 1UE5A 4DKAC 1PLFA 4DV0L 4LNQA 1STEA 4ABNA 3HOUG 2DY7A 1Q8IA 2R61A 3KBXA 3GTPH 2NVTB 1ASYA 1B9MA 1SN8A 1X9NA 3HG9A 2O4XA 2Z4IA 3K0XA 2PMZB 3H15A 4CJ1B 1SNPA 4BBRB 1EWCA 2IHFA 3K7AH 1RCVD 1K0RA 2DGYA 4RCNA 3EA6A 1BKBA 4JYAL 3PO3G 1KRTA 2HUGA 4APVA 1J9OA 5M5YB 1P16A 3RLOA 3J80c 4GS3A 4A3DB 2F0FA 2VW9A 4HR7B 2WIIB 2F0DA 5LMNQ 1UEAB 2ENBA 3T4AC 1G8ZD 5KYLA 5KNDA 2E2HB 1DJRD 2F0UA 1EYGA 1CM9A 1STBA 2HIXA 3CCEA 3CQZB 4HIKA 3NWTA 1FNVA 3NBIA 1QILA 2R6GA 5JPMC 4BS9A 1VQBA 4UHVA 3H3VI 1FNWA 2EJMA 3RZDH 1V1QA 2B2WA 4AQYQ 4DV6L 1L1OB 1IBKQ 5LHY1 2LXKA 4FVMA 4RGMA 1E2WA 4LF4L 2ZXRA 3HKZG 3KLSA 1VS0A 2AHOB 4EGVA 1ILPA 5D65A 1H9SB 4A3BB 4B3SL 4ZAIA 1BOSA 5IGGA 2VZAA 4YCUA 5C4XH 1VQPA 5EBDA 3J7AF 3CC4A 1SEBD 3S2DB 3S17B 2EY6A 3HFZB 3DXJC 4K5VA 4LFBQ 1X55A 3LNNA 4LF7L 4LF5L 2CH4A 2F4IA 1LT4D 3FKIG 1Q1BA 2F0LA 4MZ9A 1STAA 1JJCB 1NR2A 3CMEA 5C4JB 4C1NI 1S5ED 1T5XD 4OX9L 5KRUA 2ATWA 1XWEA 2CQAA 4HTHA 2RSNA 1DCZA 5CR3A 2OQ0A 1EQVA 2AWOA 4LK1C 4DR1Q 4A3FG 3W5OA 1CKOA 2VB3X 5IGCA 2YU9H 3ONAB 4J15A 4LUZA 3I4MB 4A3DG 2QCPX 3G48A 4JV5L 1VQ9A 4JC0A 2EXZA 1UWVA 2F4VQ 1C9OA 2NVYH 4OEMB 5DM63 2FINB 2X6GA 4WJWA 5BN4A 4AYBB 4GN5A 3J81j 1QB5D 2KJXA 3PIO3 5A35A 2PCFB 4DAPA 2JEBI 3KBGA 3OTOQ 3V05A 3K7UC 4LW1A 1IXRA 1IBMQ 1L0YB 1WTQA 1AZPA 1IBLQ 5A2QL 4FF4A 4GKJQ 1WD0A 4A3JG 5ELFA 3LGJA 1N33Q 1L0WA 4IQZA 3NELA 2K6AA 1PZKD 2FMMA 1ESRA 1CA5A 2VUMG 4WRDA 2JYOA 3EJIA 4ZCKA 1Q7YC 4Q0FA 1VF5C 2I46A 5I4DA 4A3BG 1I6VC 3TP5A 4XIGS 3O13A 5EBCA 3R2TA 2E2JB 1RTOA 4DV0Q 1JCKB 4IALA 4A3CH 4DN4M 2MUYA 2DY8A 2K28A 3M4YA 1VMCA 2JA6G 3M4OH 1D1KA 3NBHA 5K36H 3FVQA 1TQOA 1SYDA 2F52A 3G6EA 2H5XA 3D6CA 4DAYA 3U9OA 1MBYA 4K8JA 3E9HA 4R8NA 3MXNB 1UNSA 4GLAC 1UE1A 4JYAQ 3T1YL 3BVZA 3JC66 2Z0SA 3S15B 5I6YA 3S1MB 2JA8H 4PZ8A 3CCRA 5DEHA 2NN6G 2MO1A 1Q12A 1PRTB 3D8GA 1Q86C 1CUKA 1Q8KA 2LMCB 5IT9L 4FYDA 4DGZA 1MI2A 1B2TA 2Y0SB 3IKJA 3JAMi 1LACA 2Z6BA 1SFOH 5FO7B 5I2XA 4DR6L 1FGBD 2WKCA 4K6LA 3PSIA 1NAPA 2JXMB 1EY9A 1TWFB 1VQKA 4E6IA 3UE0A 2R7ZB 4DV6Q 3NUCA 4PQXA 5IYBG 2K32A 4JBKA 4BY7H 1FVIA 5DLQE 4L6TB 2AQ3B 1EEFD 2TMPA 3NQIA 4FXGC 4YCVA 5I2YA 4LF4Q 3C3LA 2R92B 1HZCA 1EU4A 5IYDG 1ET6A 3PF4A 4BA2I 1I6HH 3CPFA 3GO5A 2VQFL 3U9SA 3KDFB 1M8AA 1SMXA 4FF1A 1YITA 1LTBD 2JJQA 4JCVE 2ZXOA 2O5JC 4ZUIA 3FP9A 4L5RC 4LF7Q 1QVFA 4XYOA 4GLVB 3GTGH 3HKZE 4KY6A 1A15A 2K5HA 3TBIB 5M9OA 4KTAA 3SR1A 4AIMA 4OX9Q 2B39A 1B8AA 3NE5B 2MNAA 2F3IA 1D1IA 3QR8A 2EIFA 1U9RA 5IGDA 3MTSA 3CMAA 3AEVA 5CV7A 3CPWA 1TWHB 1TVXA 1YHAA 4OXPA 4BY1H 4KKTA 2X6LA 3GTKH 4M1UB 3MC0B 5BR8L 5M3MG 5IGBA 1C8CA 2FJ2A 1JOOA 3KOJA 1K8OA 2EYLA 3I4NG 4YY3L 2ZJRA 4HJ7A 1BF4A 1SAPA 1G291 5JEAG 1VF7A 4IFDG 1EIFA 4KJNA 1JMCA 1FR3A 3T56B 1TY0A 4IOAA 2VB2X 1W6KA 2JP1A 3CKIB 2K75A 4BBSB 2OEOA 3E0JA 3BDCA 4A93H 1I3QH 1HQMC 2R7ZG 2RBMA 3D4RA 1W3SA 3CCMA 2L9HA 3NEMA 1N34Q 1X6OA 1ZXTA 1W6JA 3ER0A 2R92G 5COYA 2CVRA 2V4DA 1KD1C 4OO1H 3K57A 4X65L 5E3FA 3PO2G 2WB1B 4GN4B 2PZUA 3BYYB 4JI8Q 4GKKL 3G7LA 1BCPB 1RIPA 3VR3A 4GNXA 4C3HH 5I6WA 2MJ8A 1QE6A 2AUKA 3DM1A 4DK6C 1QCBD 4O0AA 4IJHA 1LM0A 1WCMB 3NXWA 5ELBA 5EKIA 1PV4A 4DAMA 2A8VA 4DV5L 1VQAA 3P20A 2CQOA 1LO5D 5JPNC 3T1YQ 1NMGA 1A6XA 2NZOA 1E7ZA 4X3TA 5DNFA 4K5WA 4OWWB 3UDXA 3GTLB 2OTJA 5BN3A 4J6HA 3MEHA 1CQFA 2EYMA 4O2DA 3RN2A 2IX1A 1VQJA 4L8JA 3KK7A 1STYA 1HXYD 3AMUA 2BA0A 1D2BA 4P72A 1Y1VH 2AQ2B 2RDFA 1YVCA 3ZYYX 5KNBA 4DR6Q 1E2VA 4HJAA 4A3GG 4ZUJA 3QOJA 4X3SA 1EQQA 1F9PA 3CC7A 2Q2UA 2BE5D 4F88A 5FLMH 1I4QA 3VYSA 1CHPD 1E22A 3CRKC 2RSOA 3R8BA 3HOZH 2I07B 1NMFA 4UP8A 5T1GA 3H0GH 3AFPA 2AKWB 3HOYG 3SK4A 1K83H 4B3ML 4P2CB 1YBYA 1RL2A 2JA9A 4QIWE 3PCOB 2VQFQ 2B2WC 1V8QA 4JI7L 2IW3A 4K0KL 1CA6A 1VQLA 5FJ8H 3K5MA 1VQIA 2WB1G 4I7ZC 4IPCA 4C3IB 1R9TB 2PW7A 3BZDB 2K7VA 1TS4A 3AB9A 4DU9A 4HEDA 4LF9L 4NB3A 1CSPA 5J3BA 3SGIA 2PQEA 4JI6Q 3M7GA 2HQLA 4PZ7A 4POGA 3NBHB 4K2LA 2H4OA 3T1HL 1GHJA 2IL8A 5EKLA 4RFBA 5HURA 2J7ZA 1HA5A 2C35B 2QILA 4R8IA 4JBMA 3HOWG 1HNWQ 3OMGA 1XMOQ 1JQYD 1T9HA 3CHBD 1N32Q 4A3KB 5BR8Q 3HOVH 4HAEA 5EJWA 3W1GA 4A3LG 1KTKA 4A3EB 3J7AV 4YY3Q 3W2DA 2QDBA 2XWJB 5IODA 3LX0A 1TKWB 3HOUH 2RA4A 4LF8L 4Q5VA 1O7IA 4AH6A 2B2TC 4C3JB 3I91A 1EOTA 3SK8A 5C0XI 4LFCL 2XTIA 3V2TA 2WAQE 2B63B 3KF6B 1ASZA 4HJ5A 3N6RA 1EY7A 1E2ZA 2Z1CA 1F2YA 2EOTA 3J81c 2UU9L 3VR4A 4EX5A 4XQQA 3PO3H 1X3GA 4FDBA 1I4PA 2VNUD 1KXLA 2EYJA 1PH6A 4X62L 3DEOA 5I9PA 4A3IG 2YTYA 1PYWD 3OIPA 2LFNA 2PQAA 4RAUC 4RHRA 4GKKQ 1TWAB 2AMCB 2DNEA 1KIXA 2RCNA 4DUZL 2Z9HA 4JI4L 1K3BC 3DEPA 4DF7A 1ML0D 4GZYC 1EIHA 2RHSB 3I56A 2KEEA 2B2UC 4NKLA 1PH7A 5D3DA 5KNCA 2ALYB 1I4RA 1HJPA 1Z7TA 2F1MA 1CZWA 3BDLA 3NP8A 4P74A 1PH8A 1BVSA 3HOZG 1PYSB 4HJ9A 4G7ZC 3DM3A 3K81C 5BN5A 4EQNA 4B3RL 2QEXA 2MGSA 4MTKA 1WFQA 1TWGH 2KECA 1BQQT 4PMWA 4A3EG 5JEAJ 3C46A 3FKIH 4R4QA 1YIJA 4KMUC 2ZJPA 3A55A 4IFDJ 4JI5Q 4J1MA 3M7NA 1IKMA 2UUAL 2VXWA 2NVTH 1BR9A 3LWUA 1EYAA 1D8LA 1HA6A 4IUQA 1SSOA 4DXGA 2B63G 5FO9B 3AFQA 1F77A 1JWMD 4KY5A 4OL7A 2G9HD 1OXXK 3WOEA 4B3MQ 4A3FH 1GUWA 4IUPA 1V9PA 2F0MA 2JA7B 3RMHA 2VQEL 1EFID 4NW2A 3FPPA 1BO0A 1K28A 1JB7A 3VR5A 4JI7Q 4YHHQ 4K0KQ 4HIOA 3VDYA 4A3DH 2JEAI 1EY5A 2MP1A 3U50C 2XN9C 4CDCC 4OWTB 1LTRD 5KIXA 4LF6L 3QG1A 2B8FA 3CQZH 1A3UA 1WOCA 2K03A 1M1KC 3EIVA 1QUQB 3T1HQ 5IGFA 5GADC
chains in the Genus database with same CATH topology
2VUMG 3TS0A 4DUYQ 3RLNA 1VQ4A 1VCIA 1Q7YC 4A3JH 1HR0L 2V1CC 1X54A 3CCJA 1CKNB 3OW2A 3W1BA 1K8AC 1EWIA 4XIGS 2VY3A 2VUMH 3M9BA 4A3BG 4UPAA 5AJ3Q 4A3CG 1VQDA 4EQ5A 3GD7A 3KJOA 1VQNA 4DV0Q 5HGQA 4A3BH 4JI2Q 4QL5A 4A76A 1J6QA 1XTDA 4A3CH 2BH8A 5K36G 1NBWA 5FLXc 3AYHB 2Q2TA 5IWAL 3TRZA 1GVPA 5C0XJ 2JA6G 2UUBQ 3M4OH 3PF5A 3CD6A 3CCQA 3S2DH 1Q81C 3S17H 1G6PA 4LF8Q 3GDEA 1SR3A 1Y14B 4YWKA 1M90C 3K8AA 2JA6H 3HOZH 2F52A 1L2FA 2Y0SE 3G6EA 2H5XA 3CC2A 4X65Q 4TVAB 3EBEA 2R7FA 2OTLA 1DGSA 4R4OA 4QGUA 2NZHA 3PIPA 4DR2Q 3E9HA 4JOIA 3MXNB 5C4JH 1SE8A 1GD7A 4IPGA 4P71A 2YV5A 4GLAC 1UE1A 1VQEA 4JYAQ 3T1YL 4Y52H 4GOPB 3JC66 1X3FA 2Z0SA 4H02A 2ZTCA 3J81i 4PZ8A 2WFWA 1HR0W 2UU9Q 4LFAL 2JA8H 2Z6KC 3CCRA 3G4SA 1IBKL 2NN6G 2MO1A 3A5ZB 3HKSA 1Q12A 1QUQA 1YNXA 1Q86C 1CUKA 1Q8KA 1OTCA 5IP7G 5E7NA 4X62Q 2E5LQ 2JA7G 4RG1A 4ME3A 1BBUA 3I2ZA 5GQOA 4DV5Q 5GAEC 4DV2Q 4WJ4A 3JAMi 3K80C 5IP7H 3M4QA 4R4CA 4JI1L 1SFOH 1CKNA 2JA7H 2ZM6Q 3ULJA 1K73C 4DR6L 3BJUA 3PSIA 3UDGA 1SRUA 1U5KA 2OWOA 4BY7G 3A74A 4JI4Q 1VQKA 2ZJQA 3D0FA 4DR7L 3UE0A 4DV6Q 3RR5A 1AE3A 4YWLA 4L5QA 4Y7NH 4DV4L 1XJVA 5IYBG 4LFBL 4JBKA 4BY7H 1FVIA 5DLQE 4A75A 4NXNQ 4A3KG 1JJ2A 4YCVA 4R4TA 4LF4Q 4UP9A 1FJGQ 4DR4L 5HY6A 3UDIA 1XPOA 3FHWA 1K9MC 5IYBH 3F1ZA 1HZCA 5IYDG 1AE2A 4A3KH 4BA2I 5GAGC 2QA4A 3CF5A 3PF4A 1I6HH 3CPFA 3GO5A 2VQFL 4JI5L 2OCEA 3KDFB 5IYDH 3M85A 1PH4A 2Q2IA 4GNXC 4TQUS 2YYZA 1SMXA 1UE7A 1VQHA 1S40A 4BBRG 1YITA 4AYBE 2RHQB 2JJQA 4GOPA 4JCVE 2R7DA 3FP9A 3I4OA 4KHZA 1XPRA 4L5RC 4LF7Q 1QVFA 4BXXG 4B3RQ 1E3PA 2MFIA 4GLVB 1JE5A 4IFDI 2UXBQ 2CKZB 4BBRH 3KJPA 2LXJA 5M5WH 4NXML 3HKZE 3KLWA 4C3JH 3GTGH 1IYJB 2K5HA 4BXXH 3OYYA 5IT9c 2UXDL 1HH2P 2JA8G 2KBNA 4NPSA 4OX9Q 4AIMA 3J7ZC 2E2IH 5M5YH 2HT1A 1Y1WG 1K3RA 3EN2A 1B8AA 4YHHL 3I55A 2MNAA 3M3YH 3KYHC 1YZ6A 2F3IA 4L5SA 4DV1L 5JJKA 4BY1G 3TEHB 4OO1I 2EIFA 4PZ6A 3AEVA 2K50A 3CMAA 4X6AH 3CPWA 4IOCA 2B29A 3F2CA 4LF9Q 2KENA 1YHAA 4OXPA 2E2HH 4XTCS 4BY1H 1A0IA 1OXUA 2PNHA 3GTKH 4X64Q 4HJ8A 2YTVA 5BR8L 5M3MG 4DR5Q 5IY0A 1Z9FA 4WJ3M 3ZJYC 2FXQA 1VQGA 1I5FA 5IE8A 4GNXB 3U4VA 3D31A 3F8TA 3KOJA 3L2PA 4YY3L 3CCUA 1XNQQ 3I4NG 2ZJRA 2KCTA 3UDFA 4HJ7A 2YTXA 2QGQA 1G291 2RF4A 5M3MH 3A5UA 4GKJL 5JEAG 3STBC 2VS1A 1VQOA 4DUYL 3I4NH 4POFA 4IFDG 3PUXA 1EIFA 3BU2A 3CP0A 1JMCA 2WB1E 3KDFA 2UUCQ 2PQAB 3L0OA 3S1NH 4A93G 4IOAA 1HNXL 1D7QA 3A0JA 2K75A 4OONA 4RMFA 5LMUL 4A93H 4JI2L 1I3QH 4DPGA 1PH3A 2R7ZG 1OXSC 3RLFA 1W3SA 2K14A 1PYBA 1YJNA 3CCMA 3S14H 2CWAA 3NEMA 1TWFH 1X6OA 2N8NA 3STBD 1XMQQ 1N34Q 2UUBL 1VQFA 3B6YA 3S2HH 2R7ZH 4OO1G 3ER0A 2R92G 2N78A 1HNZQ 2GVBA 1LUZA 3CXCA 5LMNL 3I7FA 1HR0Q 2MO0A 1EIYB 1TXYA 1KD1C 5JJLA 4X65L 3IRBA 2R92H 1G51A 3PO2G 4GN4B 4KHPQ 2ES2A 3PUVA 4HIDA 4LFCQ 1KAWA 4JI8Q 2CWPA 3ERSX 4IPHA 4JI0Q 1CKMA 2A1AA 2DUDA 4QJFA 3KF8B 3HOXG 3PO2H 4GKKL 2UXCQ 2JK8A 3GTQH 5IWAQ 3F2DA 3TS2A 4OWXB 1RIPA 1VQMA 3J80i 4AQYL 1TWCH 3HOXH 4LWCA 4GNXA 3RNUA 4C3HH 4DV7Q 3WWVA 1H95A 1E1OA 2I5HA 3I4MG 4DK6C 2E5LL 4O0AA 4PG3A 4IJHA 1LM0A 4DR3Q 1PV4A 2NVXH 4DAMA 2A8VA 4DV5L 1VQAA 1E1TA 4DK3C 3I4MH 4BA1I 2CQOA 4YWMA 1YJ9A 1E24A 3S16H 2CFMA 3CCSA 3T1YQ 2N49A 1NMGA 4B3TL 4R4IA 2NZOA 1E7ZA 5LMNW 1UEBA 1Q46A 5C3EG 4DUZQ 1MKHA 4AYBG 4OWWB 3UDXA 3U58A 1J5EQ 4QQBX 1PVOA 2HHHL 4IO9A 3CCLA 4IJLA 2OTJA 3AQQA 1CSQA 2OQKA 1IL2A 5C3EH 1Y1VG 1I94L 4O2DA 1TWHH 4MNOA 3RN2A 1VQJA 1N36Q 3F2BA 3PGZA 4UP7A 1KRSA 2IX1A 2XGTA 1NTGA 2ASBA 1VQ8A 2BA0A 1WI5A 1Y1VH 4P72A 4B3SQ 4JI1Q 1A8VA 2I5MX 1YVCA 3M4PA 3ULLA 1KL9A 5FLMG 3GTJH 4DR6Q 4A3GG 4HJAA 1EQQA 3CC7A 2Q2UA 4UY8C 1EFWA 5FLMH 2JE6I 3H0GG 4HIMA 1E22A 1GO3E 4DV4Q 4A3GH 1YJWA 4DR1L 4MTNA 1P8LA 3Q8DA 1SROA 5GAHC 1NMFA 4UP8A 2WP8J 1PH1A 1X3EA 1VQ7A 3BZKA 3H0GH 2K52A 2ZTDA 3G71A 1YHQA 2GVAA 3AFPA 5EAYA 1N8RC 2AKWB 3HOYG 1B70B 4C2MH 2KHIA 1K83H 4B3ML 1YBYA 3PIOA 1RL2A 2E2JH 2JA9A 4X66Q 5FJ8G 1QZGA 4QIWE 3PCOB 2K5VA 4KI0A 2VQFQ 3HOYH 1NE3A 3S1RH 1EOVA 2UUAQ 4JI7L 2F4VL 2D62A 4K0KL 1QVGA 2IY5B 1VQLA 5FJ8H 5ELOA 1VQIA 3DLLA 2CCZA 2WB1G 5IP9G 4IPCA 1XPUA 2KCMA 1LYLA 4LF9L 1KHIA 3MEFA 1LTLA 3TQYA 4LF5Q 4JI3Q 1QZHA 4NB3A 2JA5G 4NXMQ 1CSPA 3PUWA 4JG2A 5J3BA 3SGIA 5IP9H 2ZTEA 1Q1EA 4DR5L 3OTOL 4DV3Q 5M5XH 1C7YA 4JI6Q 3KFUA 1IBML 2HQLA 4PZ7A 4POGA 2UXDQ 3NBHB 1EQRA 2JA5H 1XNQL 2VQEQ 1MJCA 1IBLL 3S15H 4JV5Q 4GN3B 1N33L 3T1HL 1OXTA 3BZCA 3S1MH 2LSSA 1HZAA 1YI2A 1XNRL 1WYDA 4L5TA 2PMZE 1PH5A 2JQOA 2Z6KA 4DV1Q 2C35B 2Y0SG 1X56A 3HOVG 2UUCL 3RZOH 4JBMA 5AJ3L 3HOWG 1HNWQ 1PH9A 1XMOQ 4LF6Q 2N3SA 2MQHA 4DKAC 1T9HA 1UE5A 4DV0L 1K8GA 5BR8Q 4LNQA 3HOVH 1N32Q 3HOUG 3W1GA 4A3LG 3HOWH 4YY3Q 2I0QA 1EUJA 3GTPH 1U0LA 1N34L 1ASYA 4JBJA 3HOUH 4A3LH 1SN8A 4GOPC 3GTLH 1HNZL 1X9NA 4LF8L 1X65A 1YHBA 1O7IA 3K0XA 3H15A 3E9IA 2PI2E 2NN6I 3CW2C 1L1OC 4KHPL 4AH6A 2IX0A 1HNXQ 3PUZA 2IHFA 3K7AH 2HIVA 4LUVA 1K0RA 1B7YB 2DGYA 4P73A 4LFCL 2XTIA 5C0XI 1BKBA 2ID0A 4DR2L 4JI8L 2Q2HA 4JI0L 2WAQE 3KF6B 5LMUQ 1PHJA 4HJ5A 1ASZA 3PO3G 1KRTA 4JYAL 2UXCL 3PV0A 1YEZA 4APVA 2GN5A 5ELNA 1P16A 3T1HQ 5GROA 1PA6A 3ICEA 3J81c 3RLOA 3J80c 2UU9L 4GS3A 1BBWA 4EX5A 3PUYA 3PO3H 1PFSA 4ALPA 1AH9A 1OXVA 1X3GA 4FDBA 2VW9A 2E8GA 4DV7L 2VNUD 1GM5A 1KXLA 5LMNQ 1PH6A 4X62L 4DR3L 1I50H 4A3IG 1EYGA 3JAMc 4DV2L 2HIXA 2YTYA 3CCEA 4HIKA 1NY4A 1HZ9A 2PQAA 2R6GA 2ZM6L 4GKKQ 4A3IH 1VQBA 2AMCB 3H3VI 1KIXA 1MIUA 2RCNA 4DUZL 3RZDH 4JI4L 1V1QA 1VQ6A 4LFAQ 4AQYQ 5H1SE 4DV6L 4JBWA 1J5EL 1L1OB 3CAMA 1IBKQ 2BH2A 2LXKA 4R1JA 4NXNL 3U4ZA 4C3IH 1FJGL 5IYCG 4LF4L 2RHSB 3I56A 5C0XG 3HKZG 1R9TH 1A62A 1N36L 1N9WA 3E0EA 1PH7A 2R93G 1VS0A 2A19A 2AHOB 5C4XG 5IYCH 4B3SL 2ALYB 3RN5A 1GKHA 1JT8A 1HJPA 1Q82C 1L0WA 2VZAA 4YCUA 4B3TQ 2R93H 2B3GA 5C4XH 1VQPA 4P74A 1W2BA 4IPDA 1IZ6A 1BVSA 1PH8A 3GTOH 3HOZG 1PYSB 4YCWA 4DR7Q 3KF6A 1MJEA 3CC4A 4HJ9A 3DM3A 3HFZB 3K81C 2HHHQ 4LFBQ 2NVQH 1X55A 4B3RL 2QEXA 2EQSA 3S24A 3NENA 4LF5L 4LF7L 3FKIG 1A63A 1I94Q 4BBSG 2UXBL 1WFQA 1TWGH 1S3OA 1Q1BA 4DR4Q 4MZ9A 4A3EG 2L15A 4PMWA 1JJCB 5JEAJ 3GTMH 4JOIC 3CMEA 2I5LX 3FKIH 4R4QA 1JJGA 5C44G 4BBSH 1YIJA 4X66L 2ZJPA 4OX9L 4IFDJ 4A3EH 4JI5Q 1FGUA 2BA1A 3M7NA 2PI2A 2UUAL 2NVTH 5C44H 1Z47A 2ATWA 1D8LA 3H3VH 2K4KA 1VQCA 1NJIC 2OQ0A 4A3MG 2AWOA 4DR1Q 2K5NA 4GLXA 4A3FG 1SLJA 2IHEA 3W5OA 1CKOA 2D0PA 2B63G 3AFQA 4JI3L 3L7ZC 3J7A5 1L1OA 4LUOA 4A3MH 2D0OA 4X64L 1OXXK 4DV3L 2YU9H 4J15A 4A3FH 4LUZA 4B3MQ 4JI6L 1V9PA 2B63H 1S72A 4A3DG 3UE1A 1PH2A 5JJIA 2VQEL 3G48A 4JV5L 1VQ9A 4JC0A 1JB7A 4JI7Q 4DNIA 3TREA 1UWVA 4YHHQ 2KHJA 4HIOA 1C9OA 3VDYA 2F4VQ 4A3DH 2NVYH 4K0KQ 1UE6A 1WCMG 2AWNA 4DAYB 1KC8C 2JEAI 1Y1WH 4P75A 3S1QH 3CCVA 3U50C 4GN5A 3J81j 1C0AA 2VL6A 3ULPA 1WCMH 4OWTB 1HNWL 4A4IA 2IT1A 5M3FG 1XMOL 4LF6L 2WAQG 2JEBI 1N32L 4QY7A 3OTOQ 3CQZH 1HZBA 1KQSA 2EXDA 3K7UC 1QVCA 1WOCA 4LW1A 1M1KC 1IXRA 1IBMQ 1VQ5A 4KLKA 5M3FH 1TWAH 1IBLQ 1WJJA 4GKJQ 3EIVA 1QUQB 4A3JG 3LGJA 1N33Q 5GADC 1V43A 1XMQL 3NELA 1FL0A 1XNRQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM G;  3TS0 A;  4DUY Q;  3RLN A;  1VQ4 A;  1VCI A;  1Q7Y C;  4A3J H;  1HR0 L;  2V1C C;  1X54 A;  3CCJ A;  1CKN B;  3OW2 A;  3W1B A;  1K8A C;  1EWI A;  4XIG S;  2VY3 A;  2VUM H;  3M9B A;  4A3B G;  4UPA A;  5AJ3 Q;  4A3C G;  1VQD A;  4EQ5 A;  3GD7 A;  3KJO A;  1VQN A;  4DV0 Q;  5HGQ A;  4A3B H;  4JI2 Q;  4QL5 A;  4A76 A;  1J6Q A;  1XTD A;  4A3C H;  2BH8 A;  5K36 G;  1NBW A;  5FLX c;  3AYH B;  2Q2T A;  5IWA L;  3TRZ A;  1GVP A;  5C0X J;  2JA6 G;  2UUB Q;  3M4O H;  3PF5 A;  3CD6 A;  3CCQ A;  3S2D H;  1Q81 C;  3S17 H;  1G6P A;  4LF8 Q;  3GDE A;  1SR3 A;  1Y14 B;  4YWK A;  1M90 C;  3K8A A;  2JA6 H;  3HOZ H;  2F52 A;  1L2F A;  2Y0S E;  3G6E A;  2H5X A;  3CC2 A;  4X65 Q;  4TVA B;  3EBE A;  2R7F A;  2OTL A;  1DGS A;  4R4O A;  4QGU A;  2NZH A;  3PIP A;  4DR2 Q;  3E9H A;  4JOI A;  3MXN B;  5C4J H;  1SE8 A;  1GD7 A;  4IPG A;  4P71 A;  2YV5 A;  4GLA C;  1UE1 A;  1VQE A;  4JYA Q;  3T1Y L;  4Y52 H;  4GOP B;  3JC6 6;  1X3F A;  2Z0S A;  4H02 A;  2ZTC A;  3J81 i;  4PZ8 A;  2WFW A;  1HR0 W;  2UU9 Q;  4LFA L;  2JA8 H;  2Z6K C;  3CCR A;  3G4S A;  1IBK L;  2NN6 G;  2MO1 A;  3A5Z B;  3HKS A;  1Q12 A;  1QUQ A;  1YNX A;  1Q86 C;  1CUK A;  1Q8K A;  1OTC A;  5IP7 G;  5E7N A;  4X62 Q;  2E5L Q;  2JA7 G;  4RG1 A;  4ME3 A;  1BBU A;  3I2Z A;  5GQO A;  4DV5 Q;  5GAE C;  4DV2 Q;  4WJ4 A;  3JAM i;  3K80 C;  5IP7 H;  3M4Q A;  4R4C A;  4JI1 L;  1SFO H;  1CKN A;  2JA7 H;  2ZM6 Q;  3ULJ A;  1K73 C;  4DR6 L;  3BJU A;  3PSI A;  3UDG A;  1SRU A;  1U5K A;  2OWO A;  4BY7 G;  3A74 A;  4JI4 Q;  1VQK A;  2ZJQ A;  3D0F A;  4DR7 L;  3UE0 A;  4DV6 Q;  3RR5 A;  1AE3 A;  4YWL A;  4L5Q A;  4Y7N H;  4DV4 L;  1XJV A;  5IYB G;  4LFB L;  4JBK A;  4BY7 H;  1FVI A;  5DLQ E;  4A75 A;  4NXN Q;  4A3K G;  1JJ2 A;  4YCV A;  4R4T A;  4LF4 Q;  4UP9 A;  1FJG Q;  4DR4 L;  5HY6 A;  3UDI A;  1XPO A;  3FHW A;  1K9M C;  5IYB H;  3F1Z A;  1HZC A;  5IYD G;  1AE2 A;  4A3K H;  4BA2 I;  5GAG C;  2QA4 A;  3CF5 A;  3PF4 A;  1I6H H;  3CPF A;  3GO5 A;  2VQF L;  4JI5 L;  2OCE A;  3KDF B;  5IYD H;  3M85 A;  1PH4 A;  2Q2I A;  4GNX C;  4TQU S;  2YYZ A;  1SMX A;  1UE7 A;  1VQH A;  1S40 A;  4BBR G;  1YIT A;  4AYB E;  2RHQ B;  2JJQ A;  4GOP A;  4JCV E;  2R7D A;  3FP9 A;  3I4O A;  4KHZ A;  1XPR A;  4L5R C;  4LF7 Q;  1QVF A;  4BXX G;  4B3R Q;  1E3P A;  2MFI A;  4GLV B;  1JE5 A;  4IFD I;  2UXB Q;  2CKZ B;  4BBR H;  3KJP A;  2LXJ A;  5M5W H;  4NXM L;  3HKZ E;  3KLW A;  4C3J H;  3GTG H;  1IYJ B;  2K5H A;  4BXX H;  3OYY A;  5IT9 c;  2UXD L;  1HH2 P;  2JA8 G;  2KBN A;  4NPS A;  4OX9 Q;  4AIM A;  3J7Z C;  2E2I H;  5M5Y H;  2HT1 A;  1Y1W G;  1K3R A;  3EN2 A;  1B8A A;  4YHH L;  3I55 A;  2MNA A;  3M3Y H;  3KYH C;  1YZ6 A;  2F3I A;  4L5S A;  4DV1 L;  5JJK A;  4BY1 G;  3TEH B;  4OO1 I;  2EIF A;  4PZ6 A;  3AEV A;  2K50 A;  3CMA A;  4X6A H;  3CPW A;  4IOC A;  2B29 A;  3F2C A;  4LF9 Q;  2KEN A;  1YHA A;  4OXP A;  2E2H H;  4XTC S;  4BY1 H;  1A0I A;  1OXU A;  2PNH A;  3GTK H;  4X64 Q;  4HJ8 A;  2YTV A;  5BR8 L;  5M3M G;  4DR5 Q;  5IY0 A;  1Z9F A;  4WJ3 M;  3ZJY C;  2FXQ A;  1VQG A;  1I5F A;  5IE8 A;  4GNX B;  3U4V A;  3D31 A;  3F8T A;  3KOJ A;  3L2P A;  4YY3 L;  3CCU A;  1XNQ Q;  3I4N G;  2ZJR A;  2KCT A;  3UDF A;  4HJ7 A;  2YTX A;  2QGQ A;  1G29 1;  2RF4 A;  5M3M H;  3A5U A;  4GKJ L;  5JEA G;  3STB C;  2VS1 A;  1VQO A;  4DUY L;  3I4N H;  4POF A;  4IFD G;  3PUX A;  1EIF A;  3BU2 A;  3CP0 A;  1JMC A;  2WB1 E;  3KDF A;  2UUC Q;  2PQA B;  3L0O A;  3S1N H;  4A93 G;  4IOA A;  1HNX L;  1D7Q A;  3A0J A;  2K75 A;  4OON A;  4RMF A;  5LMU L;  4A93 H;  4JI2 L;  1I3Q H;  4DPG A;  1PH3 A;  2R7Z G;  1OXS C;  3RLF A;  1W3S A;  2K14 A;  1PYB A;  1YJN A;  3CCM A;  3S14 H;  2CWA A;  3NEM A;  1TWF H;  1X6O A;  2N8N A;  3STB D;  1XMQ Q;  1N34 Q;  2UUB L;  1VQF A;  3B6Y A;  3S2H H;  2R7Z H;  4OO1 G;  3ER0 A;  2R92 G;  2N78 A;  1HNZ Q;  2GVB A;  1LUZ A;  3CXC A;  5LMN L;  3I7F A;  1HR0 Q;  2MO0 A;  1EIY B;  1TXY A;  1KD1 C;  5JJL A;  4X65 L;  3IRB A;  2R92 H;  1G51 A;  3PO2 G;  4GN4 B;  4KHP Q;  2ES2 A;  3PUV A;  4HID A;  4LFC Q;  1KAW A;  4JI8 Q;  2CWP A;  3ERS X;  4IPH A;  4JI0 Q;  1CKM A;  2A1A A;  2DUD A;  4QJF A;  3KF8 B;  3HOX G;  3PO2 H;  4GKK L;  2UXC Q;  2JK8 A;  3GTQ H;  5IWA Q;  3F2D A;  3TS2 A;  4OWX B;  1RIP A;  1VQM A;  3J80 i;  4AQY L;  1TWC H;  3HOX H;  4LWC A;  4GNX A;  3RNU A;  4C3H H;  4DV7 Q;  3WWV A;  1H95 A;  1E1O A;  2I5H A;  3I4M G;  4DK6 C;  2E5L L;  4O0A A;  4PG3 A;  4IJH A;  1LM0 A;  4DR3 Q;  1PV4 A;  2NVX H;  4DAM A;  2A8V A;  4DV5 L;  1VQA A;  1E1T A;  4DK3 C;  3I4M H;  4BA1 I;  2CQO A;  4YWM A;  1YJ9 A;  1E24 A;  3S16 H;  2CFM A;  3CCS A;  3T1Y Q;  2N49 A;  1NMG A;  4B3T L;  4R4I A;  2NZO A;  1E7Z A;  5LMN W;  1UEB A;  1Q46 A;  5C3E G;  4DUZ Q;  1MKH A;  4AYB G;  4OWW B;  3UDX A;  3U58 A;  1J5E Q;  4QQB X;  1PVO A;  2HHH L;  4IO9 A;  3CCL A;  4IJL A;  2OTJ A;  3AQQ A;  1CSQ A;  2OQK A;  1IL2 A;  5C3E H;  1Y1V G;  1I94 L;  4O2D A;  1TWH H;  4MNO A;  3RN2 A;  1VQJ A;  1N36 Q;  3F2B A;  3PGZ A;  4UP7 A;  1KRS A;  2IX1 A;  2XGT A;  1NTG A;  2ASB A;  1VQ8 A;  2BA0 A;  1WI5 A;  1Y1V H;  4P72 A;  4B3S Q;  4JI1 Q;  1A8V A;  2I5M X;  1YVC A;  3M4P A;  3ULL A;  1KL9 A;  5FLM G;  3GTJ H;  4DR6 Q;  4A3G G;  4HJA A;  1EQQ A;  3CC7 A;  2Q2U A;  4UY8 C;  1EFW A;  5FLM H;  2JE6 I;  3H0G G;  4HIM A;  1E22 A;  1GO3 E;  4DV4 Q;  4A3G H;  1YJW A;  4DR1 L;  4MTN A;  1P8L A;  3Q8D A;  1SRO A;  5GAH C;  1NMF A;  4UP8 A;  2WP8 J;  1PH1 A;  1X3E A;  1VQ7 A;  3BZK A;  3H0G H;  2K52 A;  2ZTD A;  3G71 A;  1YHQ A;  2GVA A;  3AFP A;  5EAY A;  1N8R C;  2AKW B;  3HOY G;  1B70 B;  4C2M H;  2KHI A;  1K83 H;  4B3M L;  1YBY A;  3PIO A;  1RL2 A;  2E2J H;  2JA9 A;  4X66 Q;  5FJ8 G;  1QZG A;  4QIW E;  3PCO B;  2K5V A;  4KI0 A;  2VQF Q;  3HOY H;  1NE3 A;  3S1R H;  1EOV A;  2UUA Q;  4JI7 L;  2F4V L;  2D62 A;  4K0K L;  1QVG A;  2IY5 B;  1VQL A;  5FJ8 H;  5ELO A;  1VQI A;  3DLL A;  2CCZ A;  2WB1 G;  5IP9 G;  4IPC A;  1XPU A;  2KCM A;  1LYL A;  4LF9 L;  1KHI A;  3MEF A;  1LTL A;  3TQY A;  4LF5 Q;  4JI3 Q;  1QZH A;  4NB3 A;  2JA5 G;  4NXM Q;  1CSP A;  3PUW A;  4JG2 A;  5J3B A;  3SGI A;  5IP9 H;  2ZTE A;  1Q1E A;  4DR5 L;  3OTO L;  4DV3 Q;  5M5X H;  1C7Y A;  4JI6 Q;  3KFU A;  1IBM L;  2HQL A;  4PZ7 A;  4POG A;  2UXD Q;  3NBH B;  1EQR A;  2JA5 H;  1XNQ L;  2VQE Q;  1MJC A;  1IBL L;  3S15 H;  4JV5 Q;  4GN3 B;  1N33 L;  3T1H L;  1OXT A;  3BZC A;  3S1M H;  2LSS A;  1HZA A;  1YI2 A;  1XNR L;  1WYD A;  4L5T A;  2PMZ E;  1PH5 A;  2JQO A;  2Z6K A;  4DV1 Q;  2C35 B;  2Y0S G;  1X56 A;  3HOV G;  2UUC L;  3RZO H;  4JBM A;  5AJ3 L;  3HOW G;  1HNW Q;  1PH9 A;  1XMO Q;  4LF6 Q;  2N3S A;  2MQH A;  4DKA C;  1T9H A;  1UE5 A;  4DV0 L;  1K8G A;  5BR8 Q;  4LNQ A;  3HOV H;  1N32 Q;  3HOU G;  3W1G A;  4A3L G;  3HOW H;  4YY3 Q;  2I0Q A;  1EUJ A;  3GTP H;  1U0L A;  1N34 L;  1ASY A;  4JBJ A;  3HOU H;  4A3L H;  1SN8 A;  4GOP C;  3GTL H;  1HNZ L;  1X9N A;  4LF8 L;  1X65 A;  1YHB A;  1O7I A;  3K0X A;  3H15 A;  3E9I A;  2PI2 E;  2NN6 I;  3CW2 C;  1L1O C;  4KHP L;  4AH6 A;  2IX0 A;  1HNX Q;  3PUZ A;  2IHF A;  3K7A H;  2HIV A;  4LUV A;  1K0R A;  1B7Y B;  2DGY A;  4P73 A;  4LFC L;  2XTI A;  5C0X I;  1BKB A;  2ID0 A;  4DR2 L;  4JI8 L;  2Q2H A;  4JI0 L;  2WAQ E;  3KF6 B;  5LMU Q;  1PHJ A;  4HJ5 A;  1ASZ A;  3PO3 G;  1KRT A;  4JYA L;  2UXC L;  3PV0 A;  1YEZ A;  4APV A;  2GN5 A;  5ELN A;  1P16 A;  3T1H Q;  5GRO A;  1PA6 A;  3ICE A;  3J81 c;  3RLO A;  3J80 c;  2UU9 L;  4GS3 A;  1BBW A;  4EX5 A;  3PUY A;  3PO3 H;  1PFS A;  4ALP A;  1AH9 A;  1OXV A;  1X3G A;  4FDB A;  2VW9 A;  2E8G A;  4DV7 L;  2VNU D;  1GM5 A;  1KXL A;  5LMN Q;  1PH6 A;  4X62 L;  4DR3 L;  1I50 H;  4A3I G;  1EYG A;  3JAM c;  4DV2 L;  2HIX A;  2YTY A;  3CCE A;  4HIK A;  1NY4 A;  1HZ9 A;  2PQA A;  2R6G A;  2ZM6 L;  4GKK Q;  4A3I H;  1VQB A;  2AMC B;  3H3V I;  1KIX A;  1MIU A;  2RCN A;  4DUZ L;  3RZD H;  4JI4 L;  1V1Q A;  1VQ6 A;  4LFA Q;  4AQY Q;  5H1S E;  4DV6 L;  4JBW A;  1J5E L;  1L1O B;  3CAM A;  1IBK Q;  2BH2 A;  2LXK A;  4R1J A;  4NXN L;  3U4Z A;  4C3I H;  1FJG L;  5IYC G;  4LF4 L;  2RHS B;  3I56 A;  5C0X G;  3HKZ G;  1R9T H;  1A62 A;  1N36 L;  1N9W A;  3E0E A;  1PH7 A;  2R93 G;  1VS0 A;  2A19 A;  2AHO B;  5C4X G;  5IYC H;  4B3S L;  2ALY B;  3RN5 A;  1GKH A;  1JT8 A;  1HJP A;  1Q82 C;  1L0W A;  2VZA A;  4YCU A;  4B3T Q;  2R93 H;  2B3G A;  5C4X H;  1VQP A;  4P74 A;  1W2B A;  4IPD A;  1IZ6 A;  1BVS A;  1PH8 A;  3GTO H;  3HOZ G;  1PYS B;  4YCW A;  4DR7 Q;  3KF6 A;  1MJE A;  3CC4 A;  4HJ9 A;  3DM3 A;  3HFZ B;  3K81 C;  2HHH Q;  4LFB Q;  2NVQ H;  1X55 A;  4B3R L;  2QEX A;  2EQS A;  3S24 A;  3NEN A;  4LF5 L;  4LF7 L;  3FKI G;  1A63 A;  1I94 Q;  4BBS G;  2UXB L;  1WFQ A;  1TWG H;  1S3O A;  1Q1B A;  4DR4 Q;  4MZ9 A;  4A3E G;  2L15 A;  4PMW A;  1JJC B;  5JEA J;  3GTM H;  4JOI C;  3CME A;  2I5L X;  3FKI H;  4R4Q A;  1JJG A;  5C44 G;  4BBS H;  1YIJ A;  4X66 L;  2ZJP A;  4OX9 L;  4IFD J;  4A3E H;  4JI5 Q;  1FGU A;  2BA1 A;  3M7N A;  2PI2 A;  2UUA L;  2NVT H;  5C44 H;  1Z47 A;  2ATW A;  1D8L A;  3H3V H;  2K4K A;  1VQC A;  1NJI C;  2OQ0 A;  4A3M G;  2AWO A;  4DR1 Q;  2K5N A;  4GLX A;  4A3F G;  1SLJ A;  2IHE A;  3W5O A;  1CKO A;  2D0P A;  2B63 G;  3AFQ A;  4JI3 L;  3L7Z C;  3J7A 5;  1L1O A;  4LUO A;  4A3M H;  2D0O A;  4X64 L;  1OXX K;  4DV3 L;  2YU9 H;  4J15 A;  4A3F H;  4LUZ A;  4B3M Q;  4JI6 L;  1V9P A;  2B63 H;  1S72 A;  4A3D G;  3UE1 A;  1PH2 A;  5JJI A;  2VQE L;  3G48 A;  4JV5 L;  1VQ9 A;  4JC0 A;  1JB7 A;  4JI7 Q;  4DNI A;  3TRE A;  1UWV A;  4YHH Q;  2KHJ A;  4HIO A;  1C9O A;  3VDY A;  2F4V Q;  4A3D H;  2NVY H;  4K0K Q;  1UE6 A;  1WCM G;  2AWN A;  4DAY B;  1KC8 C;  2JEA I;  1Y1W H;  4P75 A;  3S1Q H;  3CCV A;  3U50 C;  4GN5 A;  3J81 j;  1C0A A;  2VL6 A;  3ULP A;  1WCM H;  4OWT B;  1HNW L;  4A4I A;  2IT1 A;  5M3F G;  1XMO L;  4LF6 L;  2WAQ G;  2JEB I;  1N32 L;  4QY7 A;  3OTO Q;  3CQZ H;  1HZB A;  1KQS A;  2EXD A;  3K7U C;  1QVC A;  1WOC A;  4LW1 A;  1M1K C;  1IXR A;  1IBM Q;  1VQ5 A;  4KLK A;  5M3F H;  1TWA H;  1IBL Q;  1WJJ A;  4GKJ Q;  3EIV A;  1QUQ B;  4A3J G;  3LGJ A;  1N33 Q;  5GAD C;  1V43 A;  1XMQ L;  3NEL A;  1FL0 A;  1XNR Q; 
#chains in the Genus database with same CATH topology
 4ZYS A;  3GV3 A;  1G6Z A;  1EY6 A;  2K5D A;  5ELC A;  3Q24 A;  2V1C C;  3D4W A;  4A3J H;  3CCJ A;  1CKN B;  3W1B A;  2VUM H;  3M9B A;  3QIA A;  4EQ5 A;  3KJO A;  1VQN A;  1NUC A;  4A3B H;  3IFT A;  4ULL A;  4JI2 Q;  4QL5 A;  4A76 A;  1G2T A;  1XTD A;  5EPJ A;  4CHT B;  1NBW A;  5FLX c;  2Q2T A;  5IWA L;  4KD4 A;  5C0X J;  4FXK C;  1IKL A;  3CCQ A;  5FKA C;  3GV6 A;  1Q81 C;  3S17 H;  3S2D H;  4ID6 A;  2HQE A;  4LF8 Q;  4YWK A;  3K8A A;  2JA6 H;  2N55 A;  3CC2 A;  3TZU A;  4HMI A;  3EBE A;  2R7F A;  4R4O A;  4QGU A;  1DOL A;  1PFN A;  5C4J H;  1SE8 A;  4P71 A;  1PTO F;  3S9W A;  2Z4H A;  4GOP B;  3URY A;  2UU9 Q;  4LFA L;  1XX8 A;  1D5X C;  3IAY A;  3G4S A;  1ESF A;  1YNX A;  3HGB A;  3S1N B;  5IP7 G;  2RKS A;  4X62 Q;  2JA7 G;  1XTC D;  2NN6 H;  5GQO A;  4TSS A;  4WJ4 A;  4R4C A;  4JI1 L;  1SYC A;  2F0S A;  3ULJ A;  3UDG A;  2OWO A;  5CV5 A;  4JI4 Q;  2ZJQ A;  3D0F A;  4DR7 L;  1IL8 A;  3S2H B;  5E1F A;  4Y7N H;  4RCO A;  3IL8 A;  4YWL A;  4F7X A;  1XJV A;  4DR4 L;  2SOB A;  5HY6 A;  1RF2 D;  2LY7 A;  3UDI A;  3K7A B;  1K9M C;  5IYB H;  2IPK D;  5CV8 A;  5IYD H;  2B2V A;  3F2U A;  3M85 A;  1TWC B;  4GNX C;  1T5E A;  2J0T D;  1VQH A;  4TQU S;  1S40 A;  3HOX B;  4BBR G;  2R7D A;  1XPR A;  4B3R Q;  4KHZ A;  1E3P A;  5EPK A;  2NVX B;  5M5W H;  5L37 A;  1DYQ A;  1IYJ B;  2B2T A;  1ENC A;  3TP7 A;  5IT9 c;  2UXD L;  4OGQ C;  1RKN A;  2E2I H;  2HT1 A;  2A74 C;  1F2M A;  3RZD B;  3I55 A;  2QW7 A;  3KYH C;  3BDO A;  1CFM A;  4RKL A;  2K04 A;  3TEH B;  2SDF A;  2F0I A;  5C3E B;  2K50 A;  1O78 A;  2B29 A;  2OF1 A;  4XTC S;  1C4Q A;  4HJ8 A;  2YTV A;  4DR5 Q;  1Y8P B;  5IY0 A;  3HZX A;  3GTJ B;  3QO2 A;  3D31 A;  3F8T A;  1ENA A;  1Z6H A;  2KCT A;  5C4X B;  2QGQ A;  5M3M H;  3A5U A;  4TKO B;  3STB C;  4DNR B;  2VS1 A;  1VQO A;  2F0V A;  4DUY L;  3I4N H;  3QB3 A;  3BU2 A;  1WD1 A;  5JEA H;  4WOR A;  3MXP A;  2PQA B;  1HNX L;  3A0J A;  2B2U A;  4IFD H;  4EQP A;  1HCZ A;  1CTM A;  3S1R B;  1B3Q A;  1YJN A;  3S14 H;  5ELD A;  1WTR A;  4F87 A;  2CWA A;  4OIK A;  1TWF H;  1R4Q B;  1R4P B;  2UUB L;  1AEX A;  1VQF A;  3B6Y A;  2R7Z H;  2FMC A;  2GVB A;  1IYU A;  4S3S A;  4NMZ A;  1B44 D;  1B3A A;  2R92 H;  4U67 3;  2LKV A;  2ES2 A;  1PTO H;  2EYH A;  3PUV A;  1HUN A;  4HID A;  5M5X B;  1A2U A;  5ISR A;  4BWG B;  1F2Z A;  3ERS X;  4IPH A;  4QJF A;  3HOX G;  3KF8 B;  3PO2 H;  2JA5 B;  3BVG A;  2JK8 A;  3GTQ H;  4MIU A;  5IWA Q;  1LT3 D;  4OWX B;  2NVY B;  1TY2 A;  3MFY A;  2PW5 A;  3K5O A;  3RZO B;  1SJH D;  5NUC A;  3I4M G;  4H0L C;  3HP3 A;  1JR0 D;  4ZRZ A;  2SEB D;  2E5L L;  1S5C D;  3Q23 A;  1QG7 A;  1PZI D;  2A73 B;  1E1T A;  4DK3 C;  5KGU A;  1S5F D;  1YJ9 A;  1AFP A;  5K5P A;  3PQI A;  1QJO A;  2N49 A;  2WAQ B;  2L11 A;  4R4I A;  1UEB A;  1ICF B;  5C3E G;  1SYG A;  4AYB G;  4QQB X;  1V1P B;  4IJL A;  1I94 L;  1TWH H;  4MNO A;  3F2B A;  1JB3 A;  4UP7 A;  1KRS A;  3HS0 C;  2XGT A;  2MHV A;  3AU7 A;  2ASB A;  3TSS A;  3MZ5 A;  4XXE A;  4PNY A;  4B3S Q;  4JI1 Q;  4ZQ3 A;  1A8V A;  2I5M X;  1S5D D;  1PTO D;  3ULL A;  1KL9 A;  1II3 A;  1F9S A;  2NWG A;  3A8K E;  3M4O B;  4UY8 C;  4HIM A;  1KNA A;  1GO3 E;  4A3G H;  1YJW A;  1VQ7 A;  4LF5 Q;  1PH1 A;  2K52 A;  2ZTD A;  4G4K A;  2GVA A;  2EY5 A;  2HDL A;  2KHI A;  3T53 B;  1WTW A;  1QZG A;  2K5V A;  4KI0 A;  3HOY H;  3T51 B;  1NE3 A;  1EOV A;  2JA8 B;  2D62 A;  4HCS A;  2KOL A;  1GUS A;  4N8X 1;  1VDZ A;  3DLL A;  5IP9 G;  1KLU D;  2KCM A;  3M3Y H;  3MEF A;  1LTL A;  3I73 A;  4I65 A;  1U4P A;  1QZH A;  2JA5 G;  2PYK A;  2ZTE A;  4KJO A;  3KFU A;  1H9J A;  4QCL A;  2UXD Q;  1XNQ L;  5CMD A;  2R93 B;  1MJC A;  3J81 E;  1EZ6 A;  4JV5 Q;  1DZ1 A;  1LT6 D;  3BZC A;  1XNR L;  4HCE A;  1ET9 A;  4DA2 A;  1OO9 B;  2PMZ E;  1PH5 A;  3A54 A;  1X3P A;  3JAM L;  2A6E D;  2Y0S G;  2ZT9 C;  3A7L A;  5KYI A;  2UUC L;  2EY2 A;  2XNA C;  5EPL A;  1SE3 A;  3GTM B;  3H09 A;  2EE1 A;  4N9T A;  1K8G A;  1I6H B;  3HOW H;  4WFN 3;  2I0Q A;  1EUJ A;  3HEJ A;  3IFD A;  5C44 B;  1NR4 A;  4A3L H;  3GTL H;  1SYB A;  2EYP A;  1HNZ L;  5C3W A;  5JJZ A;  2GA4 B;  3T13 A;  3R3O A;  1YHB A;  3E9I A;  4FNF A;  2NN6 I;  2L5T A;  4KHP L;  1HNX Q;  2IX0 A;  4LUV A;  3K59 A;  2HIV A;  4A3M B;  1B7Y B;  4DR2 L;  1HPC A;  4JI0 L;  4B08 A;  1MD2 D;  2UXC L;  1KAA A;  2GN5 A;  2K5Q A;  5ELN A;  1WTP A;  5GRO A;  4PMC A;  1STN A;  4O1N A;  1BBW A;  4MHE A;  2E2D C;  1PFS A;  4ALP A;  4LAA A;  1AH9 A;  2F0G A;  2O2L D;  4K6D A;  2EYF A;  2E8G A;  4DV7 L;  1Y1W B;  1GM5 A;  1RTN A;  2CH4 W;  5C4Z A;  2RVL A;  1TS2 A;  4DR3 L;  3UI2 A;  3C1E A;  1E0B A;  1I50 H;  3I4L A;  3GTK B;  1HZ9 A;  1X3Q A;  3VYU A;  2F0J A;  2F0T A;  4XQJ A;  2ZM6 L;  1A3V A;  5M3F B;  2JN4 A;  1PTO C;  4A3I H;  4K5X A;  1SNQ A;  5I9O A;  1VQ6 A;  5H1S E;  1J5E L;  4JBW A;  4C3I H;  5IYC G;  1R9T H;  1M4V A;  5C0X G;  3A7A B;  1A62 A;  1N36 L;  2IWH A;  1B1Z A;  2R93 G;  4XQN A;  2Z8L A;  4A93 B;  1B9N A;  4FF3 A;  1I3Q B;  2EJG C;  4IPD A;  1K0S A;  3GTO H;  1SND A;  4OHJ A;  1MJE A;  2NVQ H;  1C48 A;  2EQS A;  2E76 C;  3NEN A;  3S24 A;  1A63 A;  1ONL A;  3NPP A;  1I94 Q;  4BBS G;  2UXB L;  4IN3 A;  4CBV A;  2NYZ D;  2F0H A;  2F3W A;  1FD7 D;  4G7O C;  2I5L X;  1JJG A;  5C44 G;  3NTI A;  4X66 L;  3MVV A;  2B2Y C;  2M00 A;  4A3E H;  1GOZ A;  3MHB A;  4IZ8 A;  1HRJ A;  2KED A;  1Y69 U;  2L4N A;  4B9W A;  3H3V H;  4RHS A;  2R3Z A;  4C3H B;  2PZT A;  4A3M G;  1B4O A;  5F2D A;  2G9D A;  3C1F A;  4GLX A;  1H9K A;  2A6E C;  2C9O A;  2D0P A;  4JI3 L;  3J7A 5;  1IYV A;  1L1O A;  4LUO A;  2D0O A;  3CRL C;  4X64 L;  3TZD A;  2QEJ C;  4DV3 L;  2WKD A;  2B63 H;  3DMU A;  5JJI A;  5FLX E;  4DXF A;  4QF4 A;  3J80 E;  2EZV A;  1DM0 B;  3J7Y W;  1LV9 A;  1WCM G;  1KC8 C;  4DAY B;  2OXP A;  3S1Q H;  3CCV A;  2F3V A;  2Q8I B;  1C0A A;  2HCC A;  2VL6 A;  5M3F G;  5JOB A;  4QY7 A;  2EXD A;  2XIW A;  3VR6 A;  1QVC A;  1VQ5 A;  1JOQ A;  1TT2 A;  1L0X B;  2B2V C;  1TWA H;  1WJJ A;  1G51 A;  1XMQ L;  1LTG D;  1XNR Q;  3TS0 A;  5A2Q E;  5IOC A;  1VCI A;  2A6H C;  1HR0 L;  3HRZ C;  4J8Q A;  1O7Y A;  1HUM A;  3OW2 A;  4IUN A;  1EWI A;  1K8A C;  4UPA A;  2K1B A;  4HSP A;  3GD7 A;  1ZKO A;  3W3A A;  3AYH B;  2F0P A;  1NCV A;  3K0Y A;  1F2L A;  2PO4 A;  4CGY B;  1Y14 B;  1GHK A;  1M90 C;  1HHV A;  1L2F A;  2Y0S E;  4ME5 A;  1LTS D;  4X65 Q;  1VMP A;  2OTL A;  2NZH A;  4DR2 Q;  1ICW A;  1MSH A;  2EYO A;  4JOI A;  1MSG A;  1GD7 A;  1KDC A;  1VQE A;  4RGT A;  1F9R A;  2HD3 A;  4H02 A;  2ZTC A;  5E4X A;  5T1I A;  3J81 i;  4C3I G;  2WFW A;  1HR0 W;  2KQ3 A;  2D5D A;  2Z6K C;  1IBK L;  4DAV A;  4ILW A;  3HKS A;  4OEL B;  1OTC A;  2RQX A;  5E7N A;  4RG1 A;  5C6A A;  1BBU A;  5LL6 X;  5HGT A;  4DV5 Q;  5GAE C;  5IT9 E;  5IP7 H;  3DHQ A;  1HFN A;  2RDG A;  2JA7 H;  5C5M A;  2ZM6 Q;  4I7A A;  3BJU A;  3DUZ A;  3NHH A;  1SRU A;  2L55 A;  1I4X A;  3HOU B;  2K5W A;  1D5M C;  4PV1 C;  1CHQ D;  3RR5 A;  1LTA D;  4LFB L;  1HQR D;  4L5Q A;  4DV4 L;  3C2P A;  4CJ0 B;  1FNU A;  1U4R A;  3OIQ A;  4A3K G;  1JJ2 A;  3L3O C;  4R4T A;  1B50 A;  3PIP 3;  2ICE C;  4QB4 A;  3OWF A;  2QA4 A;  1EWH A;  4HN7 A;  5DAU A;  2XRQ D;  1BNZ A;  5C3X A;  3PO3 B;  3MXN A;  1DOK A;  1UE7 A;  4C3J G;  3QJY A;  4BXX G;  2MFI A;  4CJ2 C;  2UXB Q;  1CI3 M;  4BBR H;  4NXM L;  3KLW A;  1EY4 A;  3VA7 A;  3S16 B;  4X3U A;  4RGO S;  2AUJ D;  5M5Y H;  3VYR A;  1K3R A;  1WTO A;  1ZYR D;  3TP6 A;  3E5S A;  4L5S A;  5JJK A;  4FO2 A;  4OO1 I;  2KCC A;  4PZ6 A;  3H3V C;  4IUV A;  3EVQ A;  5J39 A;  4LF9 Q;  2KEN A;  2E2H H;  1WVL A;  2PNH A;  4X64 Q;  1JIC A;  3J81 L;  1TS5 A;  3HKZ B;  2FXQ A;  1VQG A;  5IE8 A;  4GNX B;  3CCU A;  3L2P A;  5TSS A;  2DN8 A;  3K5L A;  3NSW A;  3UDF A;  4GKJ L;  2YTX A;  2RF4 A;  1AP0 A;  1I4H A;  1SYF A;  3NTK A;  1CK1 A;  4POF A;  2C5C A;  2WB1 E;  4KN7 C;  3KDF A;  4CDD C;  1Q90 A;  3R2I A;  3S1N H;  1TWG B;  1SE4 A;  1PRT F;  1JOR A;  5C4H A;  4C2M B;  3FKI B;  1XYI A;  4RMF A;  5LMU L;  1X32 A;  4IUU A;  4DPG A;  1PH3 A;  4M8A A;  1OXS C;  3RLF A;  4K14 A;  1PYB A;  1IW7 D;  1YNJ C;  5J1Z A;  2Q8T A;  3STB D;  1XMQ Q;  3N52 A;  3T16 A;  2J4X A;  3S2H H;  2L1B A;  3ND9 A;  2NBF A;  2N78 A;  4KHV A;  3CXC A;  1HR0 Q;  1EIY B;  1TXY A;  1EY0 A;  1SE2 A;  5JJL A;  4JK1 C;  1CZG A;  3IRB A;  3TME A;  2KUM A;  2WIN B;  4LFC Q;  1PFB A;  1KAW A;  4A3F B;  4JW0 A;  3MWY W;  2CWP A;  2WAC A;  3SE0 A;  2A1A A;  2B2Y A;  4CKC A;  3F2D A;  3J80 i;  5CC4 A;  1TWC H;  3HOX H;  1SMY C;  2F0O A;  1RJT A;  3LWE A;  1SJE D;  3BVM A;  3ERQ A;  3OSO A;  2NVX H;  4EVO A;  2RDH A;  1TII D;  1S5B D;  2RCF A;  2A5H A;  3VA5 A;  3I4M H;  4YWM A;  1O7L A;  2CFM A;  3CCS A;  4B3T L;  3GTP B;  5COR A;  2D9U A;  2A68 D;  2F0N A;  3P75 A;  3TP8 A;  4DUZ Q;  1WTX A;  3I70 A;  2HHH L;  3AQQ A;  2K01 A;  4A3J B;  1CSQ A;  2OQK A;  4HMJ A;  5C3E H;  4NP5 A;  2VUM B;  4QMG A;  2ZXP A;  1EIG A;  1VQ8 A;  4RWS C;  4U68 A;  1WI5 A;  2F0K A;  3VR2 A;  2HDM A;  3GTJ H;  3M4P A;  1KDA A;  1J8I A;  1JC7 A;  2P5Z X;  3I3C A;  1V1O A;  1NNX A;  2JE6 I;  1ZYR C;  3I8Z A;  4DV4 Q;  2EJF C;  4MTN A;  1P8L A;  2JA6 B;  4ZK9 B;  1SRO A;  5GAH C;  2KCN A;  2WP8 J;  5G3L D;  3G71 A;  3Q22 A;  1SYE A;  1N8R C;  2X69 A;  1H9R A;  2E2J H;  4XDX A;  1GXD C;  4DNT B;  3S1R H;  3KLS X;  2G5D A;  2UUA Q;  2H1E A;  2IY5 B;  1S4Z A;  1MHW C;  1FYC A;  1PVO A;  5FOB B;  2IX3 A;  1XPU A;  1KHI A;  5CV4 A;  4NXM Q;  4JG2 A;  5IP9 H;  3KLR A;  1Q1E A;  5FLX L;  1JE4 A;  5M5X H;  1C7Y A;  3J80 L;  5AFW A;  1QNU A;  4IUR A;  2JA5 H;  3A8I E;  2VQE Q;  3S15 H;  4XT1 B;  4V0B A;  1IW7 C;  1OXT A;  3S1M H;  4QIW B;  5IGE A;  1HZA A;  1YI2 A;  1WYD A;  1BCP F;  2BDO A;  1SBB B;  2Z6K A;  4Y7N B;  4PMB A;  5CBA E;  3SXH A;  3RZO H;  3ND8 A;  5E4W C;  5AJ3 L;  4LF6 Q;  1O80 A;  4MN3 A;  1CT1 D;  1F9Q A;  4ZKB B;  2KA7 A;  2Q8R E;  1U0L A;  1N34 L;  4JBJ A;  4DFA A;  2BOS A;  4GOP C;  1X65 A;  1BUV T;  2PI2 E;  3CW2 C;  1L1O C;  5M5W B;  3PUZ A;  4P73 A;  2YU9 B;  4FXD A;  2ID0 A;  4JI8 L;  2Q2H A;  1LAB A;  5LMU Q;  1PHJ A;  3PV0 A;  1YEZ A;  1KLG D;  2E2I B;  1RD9 D;  1PA6 A;  2QKI C;  2XWB B;  2WV6 D;  3ICE A;  2A68 C;  3PUY A;  1OXV A;  2TSS A;  1GUT A;  5DM7 3;  3SHL A;  3OMC A;  4QUC A;  1PRT D;  2L0C A;  2QDL A;  3JAM c;  4DV2 L;  1NY4 A;  3FEW X;  1WTV A;  2QF7 A;  2DJG C;  2JSO A;  3FRP B;  3BS1 A;  5D3I B;  5JVG 3;  5M3M B;  4JPB W;  1MIU A;  4K2K A;  4LFA Q;  5KEE A;  3I4N B;  2M2L A;  3CAM A;  5CV9 A;  4B9X A;  2BH2 A;  4R1J A;  2F0Q A;  4NXN L;  3U4Z A;  1FJG L;  4R9W A;  1ZEQ X;  1N9W A;  2M9V A;  3K58 A;  3E0E A;  1MGS A;  2OT2 A;  4G57 A;  2A19 A;  5C4X G;  5IYC H;  3RN5 A;  1GKH A;  5C0X H;  1JT8 A;  1Q82 C;  3E6Z X;  1IHZ A;  1KAB A;  4B3T Q;  2R93 H;  1LTI D;  2B3G A;  2K33 A;  3S14 B;  1STH A;  1W2B A;  1IZ6 A;  3E3X A;  1LTT D;  4YCW A;  4DR7 Q;  3KF6 A;  2HHH Q;  2PPB C;  3SVM A;  2SNS A;  4KKS A;  1HTL D;  1S3O A;  4DR4 Q;  2L15 A;  1PTO B;  3V96 A;  3GTM H;  4JOI C;  4BBS H;  3MA2 B;  3PMF A;  4CKB A;  3PO2 B;  4H13 C;  1FGU A;  3D4D A;  2BA1 A;  3GTQ B;  5JVH 3;  1STG A;  2PI2 A;  2EDG A;  1SNO A;  5C44 H;  1Z47 A;  2K4K A;  1VQC A;  1NJI C;  1H9M A;  2K5N A;  4KK7 A;  1SLJ A;  2IHE A;  2IJ0 A;  1XXG A;  4JVZ A;  3L7Z C;  1JOK A;  4A3M H;  4JI6 L;  1SFO B;  1S72 A;  3UE1 A;  1PH2 A;  2O5I C;  5FK9 C;  4RH6 A;  2FHT A;  4DNI A;  3TRE A;  2F03 A;  2KHJ A;  1SDF A;  1CQV A;  1UE6 A;  2AWN A;  1QOH A;  3A8J E;  1Y1W H;  4BY7 B;  4P75 A;  3ULP A;  1WCM H;  1HNW L;  4EQO A;  4A4I A;  2IT1 A;  3ITP A;  1XMO L;  2BDN A;  5FO8 B;  2WAQ G;  1N32 L;  1HZB A;  1KQS A;  4L63 B;  4IUT A;  1BBX C;  4G7H C;  4N9P A;  4KLK A;  5M3F H;  1SXT A;  1D5Z C;  3OHX C;  3KUP A;  3EQL C;  1PMR A;  4OIJ A;  3TS2 A;  1V43 A;  1FL0 A;  3FMC A;  3R93 A;  4DUY Q;  3RLN A;  1VQ4 A;  4A3G B;  3H91 A;  5EGT A;  1AN8 A;  1X54 A;  4CDF C;  5EQ0 A;  2XSC A;  2VY3 A;  3GTG B;  5AJ3 Q;  4A3C G;  5CGK A;  1VQD A;  1ENF A;  1PRT C;  1HTP A;  1EQT A;  5HGQ A;  1EEI D;  1GUG A;  1O7Z A;  1J6Q A;  4K8I A;  3HOY B;  2BH8 A;  5K36 G;  1GJX A;  4C56 C;  3TRZ A;  1DD2 A;  1GVP A;  2L12 A;  3P7J A;  2UUB Q;  3PF5 A;  3CD6 A;  1BCP D;  2PNR C;  2A6H D;  1G6P A;  1PZJ D;  5ELE A;  3GDE A;  1SR3 A;  3I90 A;  3M3Y B;  1HFG A;  4TVA B;  4BY1 B;  1DGS A;  1EZ8 A;  2CW0 D;  3PIP A;  2JA8 G;  3A56 A;  4IPG A;  2YV5 A;  4Y52 H;  5C5L A;  1YNN D;  1X3F A;  1RHP A;  1TU2 B;  3EFX D;  3OW7 A;  1LLR D;  1KDB A;  3A5Z B;  1Y8O B;  1QUQ A;  5IIF A;  2E5L Q;  4FP5 D;  1AZQ A;  3OOC A;  4ME3 A;  1WTH A;  4ZLT F;  3I2Z A;  4DV2 Q;  3SDZ A;  3K80 C;  3M4Q A;  1CKN A;  2HCI A;  4ODG A;  3HOW B;  1GUO A;  1K73 C;  3MFG A;  5CV6 A;  1U5K A;  4BY7 G;  2MPM A;  3A74 A;  2ICI A;  1AE3 A;  1JWU D;  4A75 A;  4NXN Q;  1U4M A;  1DOM A;  1FJG Q;  2PZW A;  4LMQ D;  4UP9 A;  2E75 C;  1XPO A;  3FHW A;  3F1Z A;  1DXM A;  1AE2 A;  4A3K H;  2SNM A;  5GAG C;  3CF5 A;  3DWQ A;  4JI5 L;  4F8M A;  2DJF C;  2OCE A;  2KHS A;  1PH4 A;  2Q2I A;  3RUZ A;  2YYZ A;  4AYB E;  2RHQ B;  4GOP A;  1ROD A;  3I4O A;  2F0E A;  1RDP D;  4LJZ C;  4IFD I;  1JE5 A;  2CKZ B;  3Q0A A;  1G91 A;  1A2T A;  2LXJ A;  3KJP A;  3D3R A;  1I50 B;  4C3J H;  1QWY A;  4YIJ A;  1I4G A;  4BXX H;  3OYY A;  1HH2 P;  2KBN A;  4NPS A;  4A3I B;  3J7Z C;  2A69 D;  1Y1W G;  3EN2 A;  1H9S A;  4YHH L;  2LS0 1;  1YZ6 A;  4TRD A;  3K6O A;  4DV1 L;  4BY1 G;  3MXG A;  4XYQ A;  4X6A H;  2XRS D;  4UAI A;  4IOC A;  3SK5 A;  2NTS A;  3NK9 A;  3F2C A;  2NZ1 D;  4V19 0;  1A0I A;  1OXU A;  1Y1V B;  1Z9F A;  1G2S A;  4WJ3 M;  3ZJY C;  4KKU A;  1I5F A;  2CHB D;  3U4V A;  1XNQ Q;  4DK0 A;  3K5N A;  1JWS D;  4CKE A;  3GTO B;  2BCO A;  1BDO A;  4O42 A;  1PDQ A;  1BCP C;  2NVQ B;  3PUX A;  1EL0 A;  3CP0 A;  4DK1 A;  3HOZ B;  2UUC Q;  1GUN A;  3H0G B;  3L0O A;  4A93 G;  1D7Q A;  1K83 B;  4FF2 A;  2N88 A;  4OON A;  2CW0 C;  3CU7 A;  3OPO A;  4JI2 L;  3BG3 A;  3G6J B;  1YNN C;  2K14 A;  4ZKC B;  1QNK A;  2N8N A;  3FPU B;  4OO1 G;  4XT3 B;  1HNZ Q;  3I72 A;  1LUZ A;  5LMN L;  3I7F A;  2MO0 A;  2AQ1 B;  4KY7 A;  3FDT A;  3L9A X;  3P1H A;  4KHP Q;  3OWE B;  3GP7 A;  1PFM A;  4JI0 Q;  2B8G A;  3Q6S A;  1TR5 A;  1CKM A;  3DWP A;  2DUD A;  2UXC Q;  2EY1 A;  4C3H G;  1YNJ D;  2NUC A;  1VQM A;  5J22 A;  4AQY L;  1Y8N B;  3H6M A;  2KVM A;  4LWC A;  1TS3 A;  3RNU A;  4Z9C B;  4DV7 Q;  3WWV A;  1H95 A;  2XVS A;  1E1O A;  2I5H A;  3S1Q B;  5G3L F;  2FFK B;  4PG3 A;  2D2C C;  4DR3 Q;  1Q3L A;  1UUP A;  3HOV B;  4BA1 I;  1AW7 A;  3QWN A;  1E24 A;  1K8M A;  3S16 H;  5LMN W;  3TN2 A;  1Q46 A;  1MKH A;  4RKB A;  3DWA A;  1SMY D;  2BE5 C;  4NDX A;  3U58 A;  1EYC A;  1J5E Q;  4IO9 A;  4X3K A;  1LT5 D;  3CCL A;  1IL2 A;  1Y1V G;  1ILQ A;  4KV6 A;  1N36 Q;  3PGZ A;  3MXU A;  5LL6 S;  1NTG A;  2K05 A;  5FLM G;  3X3N A;  4QUF A;  1BXT A;  3BYT B;  2A69 C;  1EU3 A;  2NTT A;  4C1N K;  3X3M A;  1EFW A;  3H0G G;  3KF8 A;  5JAV A;  3NTH A;  1B53 A;  4DR1 L;  3Q8D A;  4KD3 A;  1X3E A;  3BZK A;  3QOL A;  1YHQ A;  1SNM A;  4H7B A;  5EAY A;  2E74 C;  1B70 B;  4C2M H;  3PIO A;  1EYD A;  5EKK A;  3H94 A;  1DON A;  4X66 Q;  1A3T A;  5FJ8 G;  3RD4 A;  3WOF A;  2F4V L;  1QVG A;  1EY8 A;  5ELO A;  2CCZ A;  4N8F A;  4H44 C;  3NQT A;  2EPB A;  3GQB A;  3WDN A;  1LYL A;  4KN4 C;  3SK6 A;  3TQY A;  4JI3 Q;  1V1P A;  3PUW A;  1NSN S;  4DR5 L;  3OTO L;  4DV3 Q;  5CBE E;  2DNC A;  1IBM L;  3SEB A;  2F0W A;  1EQR A;  1PXU A;  1IBL L;  1U4L A;  4GN3 B;  1N33 L;  1SNC A;  4HSV A;  3VYT A;  2EVB A;  5CYU A;  2LSS A;  4UDU C;  3MAQ A;  1D6E C;  4L5T A;  2JQO A;  5D14 A;  1UAP A;  4DV1 Q;  4CDE C;  3ERO A;  1X56 A;  3NWS A;  4RGN A;  3HOV G;  1KNE A;  3D6W A;  4RA8 A;  3JAM E;  1PH9 A;  2N3S A;  2MQH A;  3TDQ A;  2NB0 A;  1UE5 A;  4DKA C;  1PLF A;  4DV0 L;  4LNQ A;  1STE A;  4ABN A;  3HOU G;  2DY7 A;  1Q8I A;  2R61 A;  3KBX A;  3GTP H;  2NVT B;  1ASY A;  1B9M A;  1SN8 A;  1X9N A;  3HG9 A;  2O4X A;  2Z4I A;  3K0X A;  2PMZ B;  3H15 A;  4CJ1 B;  1SNP A;  4BBR B;  1EWC A;  2IHF A;  3K7A H;  1RCV D;  1K0R A;  2DGY A;  4RCN A;  3EA6 A;  1BKB A;  4JYA L;  3PO3 G;  1KRT A;  2HUG A;  4APV A;  1J9O A;  5M5Y B;  1P16 A;  3RLO A;  3J80 c;  4GS3 A;  4A3D B;  2F0F A;  2VW9 A;  4HR7 B;  2WII B;  2F0D A;  5LMN Q;  1UEA B;  2ENB A;  3T4A C;  1G8Z D;  5KYL A;  5KND A;  2E2H B;  1DJR D;  2F0U A;  1EYG A;  1CM9 A;  1STB A;  2HIX A;  3CCE A;  3CQZ B;  4HIK A;  3NWT A;  1FNV A;  3NBI A;  1QIL A;  2R6G A;  5JPM C;  4BS9 A;  1VQB A;  4UHV A;  3H3V I;  1FNW A;  2EJM A;  3RZD H;  1V1Q A;  2B2W A;  4AQY Q;  4DV6 L;  1L1O B;  1IBK Q;  5LHY 1;  2LXK A;  4FVM A;  4RGM A;  1E2W A;  4LF4 L;  2ZXR A;  3HKZ G;  3KLS A;  1VS0 A;  2AHO B;  4EGV A;  1ILP A;  5D65 A;  1H9S B;  4A3B B;  4B3S L;  4ZAI A;  1BOS A;  5IGG A;  2VZA A;  4YCU A;  5C4X H;  1VQP A;  5EBD A;  3J7A F;  3CC4 A;  1SEB D;  3S2D B;  3S17 B;  2EY6 A;  3HFZ B;  3DXJ C;  4K5V A;  4LFB Q;  1X55 A;  3LNN A;  4LF7 L;  4LF5 L;  2CH4 A;  2F4I A;  1LT4 D;  3FKI G;  1Q1B A;  2F0L A;  4MZ9 A;  1STA A;  1JJC B;  1NR2 A;  3CME A;  5C4J B;  4C1N I;  1S5E D;  1T5X D;  4OX9 L;  5KRU A;  2ATW A;  1XWE A;  2CQA A;  4HTH A;  2RSN A;  1DCZ A;  5CR3 A;  2OQ0 A;  1EQV A;  2AWO A;  4LK1 C;  4DR1 Q;  4A3F G;  3W5O A;  1CKO A;  2VB3 X;  5IGC A;  2YU9 H;  3ONA B;  4J15 A;  4LUZ A;  3I4M B;  4A3D G;  2QCP X;  3G48 A;  4JV5 L;  1VQ9 A;  4JC0 A;  2EXZ A;  1UWV A;  2F4V Q;  1C9O A;  2NVY H;  4OEM B;  5DM6 3;  2FIN B;  2X6G A;  4WJW A;  5BN4 A;  4AYB B;  4GN5 A;  3J81 j;  1QB5 D;  2KJX A;  3PIO 3;  5A35 A;  2PCF B;  4DAP A;  2JEB I;  3KBG A;  3OTO Q;  3V05 A;  3K7U C;  4LW1 A;  1IXR A;  1IBM Q;  1L0Y B;  1WTQ A;  1AZP A;  1IBL Q;  5A2Q L;  4FF4 A;  4GKJ Q;  1WD0 A;  4A3J G;  5ELF A;  3LGJ A;  1N33 Q;  1L0W A;  4IQZ A;  3NEL A;  2K6A A;  1PZK D;  2FMM A;  1ESR A;  1CA5 A;  2VUM G;  4WRD A;  2JYO A;  3EJI A;  4ZCK A;  1Q7Y C;  4Q0F A;  1VF5 C;  2I46 A;  5I4D A;  4A3B G;  1I6V C;  3TP5 A;  4XIG S;  3O13 A;  5EBC A;  3R2T A;  2E2J B;  1RTO A;  4DV0 Q;  1JCK B;  4IAL A;  4A3C H;  4DN4 M;  2MUY A;  2DY8 A;  2K28 A;  3M4Y A;  1VMC A;  2JA6 G;  3M4O H;  1D1K A;  3NBH A;  5K36 H;  3FVQ A;  1TQO A;  1SYD A;  2F52 A;  3G6E A;  2H5X A;  3D6C A;  4DAY A;  3U9O A;  1MBY A;  4K8J A;  3E9H A;  4R8N A;  3MXN B;  1UNS A;  4GLA C;  1UE1 A;  4JYA Q;  3T1Y L;  3BVZ A;  3JC6 6;  2Z0S A;  3S15 B;  5I6Y A;  3S1M B;  2JA8 H;  4PZ8 A;  3CCR A;  5DEH A;  2NN6 G;  2MO1 A;  1Q12 A;  1PRT B;  3D8G A;  1Q86 C;  1CUK A;  1Q8K A;  2LMC B;  5IT9 L;  4FYD A;  4DGZ A;  1MI2 A;  1B2T A;  2Y0S B;  3IKJ A;  3JAM i;  1LAC A;  2Z6B A;  1SFO H;  5FO7 B;  5I2X A;  4DR6 L;  1FGB D;  2WKC A;  4K6L A;  3PSI A;  1NAP A;  2JXM B;  1EY9 A;  1TWF B;  1VQK A;  4E6I A;  3UE0 A;  2R7Z B;  4DV6 Q;  3NUC A;  4PQX A;  5IYB G;  2K32 A;  4JBK A;  4BY7 H;  1FVI A;  5DLQ E;  4L6T B;  2AQ3 B;  1EEF D;  2TMP A;  3NQI A;  4FXG C;  4YCV A;  5I2Y A;  4LF4 Q;  3C3L A;  2R92 B;  1HZC A;  1EU4 A;  5IYD G;  1ET6 A;  3PF4 A;  4BA2 I;  1I6H H;  3CPF A;  3GO5 A;  2VQF L;  3U9S A;  3KDF B;  1M8A A;  1SMX A;  4FF1 A;  1YIT A;  1LTB D;  2JJQ A;  4JCV E;  2ZXO A;  2O5J C;  4ZUI A;  3FP9 A;  4L5R C;  4LF7 Q;  1QVF A;  4XYO A;  4GLV B;  3GTG H;  3HKZ E;  4KY6 A;  1A15 A;  2K5H A;  3TBI B;  5M9O A;  4KTA A;  3SR1 A;  4AIM A;  4OX9 Q;  2B39 A;  1B8A A;  3NE5 B;  2MNA A;  2F3I A;  1D1I A;  3QR8 A;  2EIF A;  1U9R A;  5IGD A;  3MTS A;  3CMA A;  3AEV A;  5CV7 A;  3CPW A;  1TWH B;  1TVX A;  1YHA A;  4OXP A;  4BY1 H;  4KKT A;  2X6L A;  3GTK H;  4M1U B;  3MC0 B;  5BR8 L;  5M3M G;  5IGB A;  1C8C A;  2FJ2 A;  1JOO A;  3KOJ A;  1K8O A;  2EYL A;  3I4N G;  4YY3 L;  2ZJR A;  4HJ7 A;  1BF4 A;  1SAP A;  1G29 1;  5JEA G;  1VF7 A;  4IFD G;  1EIF A;  4KJN A;  1JMC A;  1FR3 A;  3T56 B;  1TY0 A;  4IOA A;  2VB2 X;  1W6K A;  2JP1 A;  3CKI B;  2K75 A;  4BBS B;  2OEO A;  3E0J A;  3BDC A;  4A93 H;  1I3Q H;  1HQM C;  2R7Z G;  2RBM A;  3D4R A;  1W3S A;  3CCM A;  2L9H A;  3NEM A;  1N34 Q;  1X6O A;  1ZXT A;  1W6J A;  3ER0 A;  2R92 G;  5COY A;  2CVR A;  2V4D A;  1KD1 C;  4OO1 H;  3K57 A;  4X65 L;  5E3F A;  3PO2 G;  2WB1 B;  4GN4 B;  2PZU A;  3BYY B;  4JI8 Q;  4GKK L;  3G7L A;  1BCP B;  1RIP A;  3VR3 A;  4GNX A;  4C3H H;  5I6W A;  2MJ8 A;  1QE6 A;  2AUK A;  3DM1 A;  4DK6 C;  1QCB D;  4O0A A;  4IJH A;  1LM0 A;  1WCM B;  3NXW A;  5ELB A;  5EKI A;  1PV4 A;  4DAM A;  2A8V A;  4DV5 L;  1VQA A;  3P20 A;  2CQO A;  1LO5 D;  5JPN C;  3T1Y Q;  1NMG A;  1A6X A;  2NZO A;  1E7Z A;  4X3T A;  5DNF A;  4K5W A;  4OWW B;  3UDX A;  3GTL B;  2OTJ A;  5BN3 A;  4J6H A;  3MEH A;  1CQF A;  2EYM A;  4O2D A;  3RN2 A;  2IX1 A;  1VQJ A;  4L8J A;  3KK7 A;  1STY A;  1HXY D;  3AMU A;  2BA0 A;  1D2B A;  4P72 A;  1Y1V H;  2AQ2 B;  2RDF A;  1YVC A;  3ZYY X;  5KNB A;  4DR6 Q;  1E2V A;  4HJA A;  4A3G G;  4ZUJ A;  3QOJ A;  4X3S A;  1EQQ A;  1F9P A;  3CC7 A;  2Q2U A;  2BE5 D;  4F88 A;  5FLM H;  1I4Q A;  3VYS A;  1CHP D;  1E22 A;  3CRK C;  2RSO A;  3R8B A;  3HOZ H;  2I07 B;  1NMF A;  4UP8 A;  5T1G A;  3H0G H;  3AFP A;  2AKW B;  3HOY G;  3SK4 A;  1K83 H;  4B3M L;  4P2C B;  1YBY A;  1RL2 A;  2JA9 A;  4QIW E;  3PCO B;  2VQF Q;  2B2W C;  1V8Q A;  4JI7 L;  2IW3 A;  4K0K L;  1CA6 A;  1VQL A;  5FJ8 H;  3K5M A;  1VQI A;  2WB1 G;  4I7Z C;  4IPC A;  4C3I B;  1R9T B;  2PW7 A;  3BZD B;  2K7V A;  1TS4 A;  3AB9 A;  4DU9 A;  4HED A;  4LF9 L;  4NB3 A;  1CSP A;  5J3B A;  3SGI A;  2PQE A;  4JI6 Q;  3M7G A;  2HQL A;  4PZ7 A;  4POG A;  3NBH B;  4K2L A;  2H4O A;  3T1H L;  1GHJ A;  2IL8 A;  5EKL A;  4RFB A;  5HUR A;  2J7Z A;  1HA5 A;  2C35 B;  2QIL A;  4R8I A;  4JBM A;  3HOW G;  1HNW Q;  3OMG A;  1XMO Q;  1JQY D;  1T9H A;  3CHB D;  1N32 Q;  4A3K B;  5BR8 Q;  3HOV H;  4HAE A;  5EJW A;  3W1G A;  4A3L G;  1KTK A;  4A3E B;  3J7A V;  4YY3 Q;  3W2D A;  2QDB A;  2XWJ B;  5IOD A;  3LX0 A;  1TKW B;  3HOU H;  2RA4 A;  4LF8 L;  4Q5V A;  1O7I A;  4AH6 A;  2B2T C;  4C3J B;  3I91 A;  1EOT A;  3SK8 A;  5C0X I;  4LFC L;  2XTI A;  3V2T A;  2WAQ E;  2B63 B;  3KF6 B;  1ASZ A;  4HJ5 A;  3N6R A;  1EY7 A;  1E2Z A;  2Z1C A;  1F2Y A;  2EOT A;  3J81 c;  2UU9 L;  3VR4 A;  4EX5 A;  4XQQ A;  3PO3 H;  1X3G A;  4FDB A;  1I4P A;  2VNU D;  1KXL A;  2EYJ A;  1PH6 A;  4X62 L;  3DEO A;  5I9P A;  4A3I G;  2YTY A;  1PYW D;  3OIP A;  2LFN A;  2PQA A;  4RAU C;  4RHR A;  4GKK Q;  1TWA B;  2AMC B;  2DNE A;  1KIX A;  2RCN A;  4DUZ L;  2Z9H A;  4JI4 L;  1K3B C;  3DEP A;  4DF7 A;  1ML0 D;  4GZY C;  1EIH A;  2RHS B;  3I56 A;  2KEE A;  2B2U C;  4NKL A;  1PH7 A;  5D3D A;  5KNC A;  2ALY B;  1I4R A;  1HJP A;  1Z7T A;  2F1M A;  1CZW A;  3BDL A;  3NP8 A;  4P74 A;  1PH8 A;  1BVS A;  3HOZ G;  1PYS B;  4HJ9 A;  4G7Z C;  3DM3 A;  3K81 C;  5BN5 A;  4EQN A;  4B3R L;  2QEX A;  2MGS A;  4MTK A;  1WFQ A;  1TWG H;  2KEC A;  1BQQ T;  4PMW A;  4A3E G;  5JEA J;  3C46 A;  3FKI H;  4R4Q A;  1YIJ A;  4KMU C;  2ZJP A;  3A55 A;  4IFD J;  4JI5 Q;  4J1M A;  3M7N A;  1IKM A;  2UUA L;  2VXW A;  2NVT H;  1BR9 A;  3LWU A;  1EYA A;  1D8L A;  1HA6 A;  4IUQ A;  1SSO A;  4DXG A;  2B63 G;  5FO9 B;  3AFQ A;  1F77 A;  1JWM D;  4KY5 A;  4OL7 A;  2G9H D;  1OXX K;  3WOE A;  4B3M Q;  4A3F H;  1GUW A;  4IUP A;  1V9P A;  2F0M A;  2JA7 B;  3RMH A;  2VQE L;  1EFI D;  4NW2 A;  3FPP A;  1BO0 A;  1K28 A;  1JB7 A;  3VR5 A;  4JI7 Q;  4YHH Q;  4K0K Q;  4HIO A;  3VDY A;  4A3D H;  2JEA I;  1EY5 A;  2MP1 A;  3U50 C;  2XN9 C;  4CDC C;  4OWT B;  1LTR D;  5KIX A;  4LF6 L;  3QG1 A;  2B8F A;  3CQZ H;  1A3U A;  1WOC A;  2K03 A;  1M1K C;  3EIV A;  1QUQ B;  3T1H Q;  5IGF A;  5GAD C; 
#chains in the Genus database with same CATH homology
 2VUM G;  3TS0 A;  4DUY Q;  3RLN A;  1VQ4 A;  1VCI A;  1Q7Y C;  4A3J H;  1HR0 L;  2V1C C;  1X54 A;  3CCJ A;  1CKN B;  3OW2 A;  3W1B A;  1K8A C;  1EWI A;  4XIG S;  2VY3 A;  2VUM H;  3M9B A;  4A3B G;  4UPA A;  5AJ3 Q;  4A3C G;  1VQD A;  4EQ5 A;  3GD7 A;  3KJO A;  1VQN A;  4DV0 Q;  5HGQ A;  4A3B H;  4JI2 Q;  4QL5 A;  4A76 A;  1J6Q A;  1XTD A;  4A3C H;  2BH8 A;  5K36 G;  1NBW A;  5FLX c;  3AYH B;  2Q2T A;  5IWA L;  3TRZ A;  1GVP A;  5C0X J;  2JA6 G;  2UUB Q;  3M4O H;  3PF5 A;  3CD6 A;  3CCQ A;  3S2D H;  1Q81 C;  3S17 H;  1G6P A;  4LF8 Q;  3GDE A;  1SR3 A;  1Y14 B;  4YWK A;  1M90 C;  3K8A A;  2JA6 H;  3HOZ H;  2F52 A;  1L2F A;  2Y0S E;  3G6E A;  2H5X A;  3CC2 A;  4X65 Q;  4TVA B;  3EBE A;  2R7F A;  2OTL A;  1DGS A;  4R4O A;  4QGU A;  2NZH A;  3PIP A;  4DR2 Q;  3E9H A;  4JOI A;  3MXN B;  5C4J H;  1SE8 A;  1GD7 A;  4IPG A;  4P71 A;  2YV5 A;  4GLA C;  1UE1 A;  1VQE A;  4JYA Q;  3T1Y L;  4Y52 H;  4GOP B;  3JC6 6;  1X3F A;  2Z0S A;  4H02 A;  2ZTC A;  3J81 i;  4PZ8 A;  2WFW A;  1HR0 W;  2UU9 Q;  4LFA L;  2JA8 H;  2Z6K C;  3CCR A;  3G4S A;  1IBK L;  2NN6 G;  2MO1 A;  3A5Z B;  3HKS A;  1Q12 A;  1QUQ A;  1YNX A;  1Q86 C;  1CUK A;  1Q8K A;  1OTC A;  5IP7 G;  5E7N A;  4X62 Q;  2E5L Q;  2JA7 G;  4RG1 A;  4ME3 A;  1BBU A;  3I2Z A;  5GQO A;  4DV5 Q;  5GAE C;  4DV2 Q;  4WJ4 A;  3JAM i;  3K80 C;  5IP7 H;  3M4Q A;  4R4C A;  4JI1 L;  1SFO H;  1CKN A;  2JA7 H;  2ZM6 Q;  3ULJ A;  1K73 C;  4DR6 L;  3BJU A;  3PSI A;  3UDG A;  1SRU A;  1U5K A;  2OWO A;  4BY7 G;  3A74 A;  4JI4 Q;  1VQK A;  2ZJQ A;  3D0F A;  4DR7 L;  3UE0 A;  4DV6 Q;  3RR5 A;  1AE3 A;  4YWL A;  4L5Q A;  4Y7N H;  4DV4 L;  1XJV A;  5IYB G;  4LFB L;  4JBK A;  4BY7 H;  1FVI A;  5DLQ E;  4A75 A;  4NXN Q;  4A3K G;  1JJ2 A;  4YCV A;  4R4T A;  4LF4 Q;  4UP9 A;  1FJG Q;  4DR4 L;  5HY6 A;  3UDI A;  1XPO A;  3FHW A;  1K9M C;  5IYB H;  3F1Z A;  1HZC A;  5IYD G;  1AE2 A;  4A3K H;  4BA2 I;  5GAG C;  2QA4 A;  3CF5 A;  3PF4 A;  1I6H H;  3CPF A;  3GO5 A;  2VQF L;  4JI5 L;  2OCE A;  3KDF B;  5IYD H;  3M85 A;  1PH4 A;  2Q2I A;  4GNX C;  4TQU S;  2YYZ A;  1SMX A;  1UE7 A;  1VQH A;  1S40 A;  4BBR G;  1YIT A;  4AYB E;  2RHQ B;  2JJQ A;  4GOP A;  4JCV E;  2R7D A;  3FP9 A;  3I4O A;  4KHZ A;  1XPR A;  4L5R C;  4LF7 Q;  1QVF A;  4BXX G;  4B3R Q;  1E3P A;  2MFI A;  4GLV B;  1JE5 A;  4IFD I;  2UXB Q;  2CKZ B;  4BBR H;  3KJP A;  2LXJ A;  5M5W H;  4NXM L;  3HKZ E;  3KLW A;  4C3J H;  3GTG H;  1IYJ B;  2K5H A;  4BXX H;  3OYY A;  5IT9 c;  2UXD L;  1HH2 P;  2JA8 G;  2KBN A;  4NPS A;  4OX9 Q;  4AIM A;  3J7Z C;  2E2I H;  5M5Y H;  2HT1 A;  1Y1W G;  1K3R A;  3EN2 A;  1B8A A;  4YHH L;  3I55 A;  2MNA A;  3M3Y H;  3KYH C;  1YZ6 A;  2F3I A;  4L5S A;  4DV1 L;  5JJK A;  4BY1 G;  3TEH B;  4OO1 I;  2EIF A;  4PZ6 A;  3AEV A;  2K50 A;  3CMA A;  4X6A H;  3CPW A;  4IOC A;  2B29 A;  3F2C A;  4LF9 Q;  2KEN A;  1YHA A;  4OXP A;  2E2H H;  4XTC S;  4BY1 H;  1A0I A;  1OXU A;  2PNH A;  3GTK H;  4X64 Q;  4HJ8 A;  2YTV A;  5BR8 L;  5M3M G;  4DR5 Q;  5IY0 A;  1Z9F A;  4WJ3 M;  3ZJY C;  2FXQ A;  1VQG A;  1I5F A;  5IE8 A;  4GNX B;  3U4V A;  3D31 A;  3F8T A;  3KOJ A;  3L2P A;  4YY3 L;  3CCU A;  1XNQ Q;  3I4N G;  2ZJR A;  2KCT A;  3UDF A;  4HJ7 A;  2YTX A;  2QGQ A;  1G29 1;  2RF4 A;  5M3M H;  3A5U A;  4GKJ L;  5JEA G;  3STB C;  2VS1 A;  1VQO A;  4DUY L;  3I4N H;  4POF A;  4IFD G;  3PUX A;  1EIF A;  3BU2 A;  3CP0 A;  1JMC A;  2WB1 E;  3KDF A;  2UUC Q;  2PQA B;  3L0O A;  3S1N H;  4A93 G;  4IOA A;  1HNX L;  1D7Q A;  3A0J A;  2K75 A;  4OON A;  4RMF A;  5LMU L;  4A93 H;  4JI2 L;  1I3Q H;  4DPG A;  1PH3 A;  2R7Z G;  1OXS C;  3RLF A;  1W3S A;  2K14 A;  1PYB A;  1YJN A;  3CCM A;  3S14 H;  2CWA A;  3NEM A;  1TWF H;  1X6O A;  2N8N A;  3STB D;  1XMQ Q;  1N34 Q;  2UUB L;  1VQF A;  3B6Y A;  3S2H H;  2R7Z H;  4OO1 G;  3ER0 A;  2R92 G;  2N78 A;  1HNZ Q;  2GVB A;  1LUZ A;  3CXC A;  5LMN L;  3I7F A;  1HR0 Q;  2MO0 A;  1EIY B;  1TXY A;  1KD1 C;  5JJL A;  4X65 L;  3IRB A;  2R92 H;  1G51 A;  3PO2 G;  4GN4 B;  4KHP Q;  2ES2 A;  3PUV A;  4HID A;  4LFC Q;  1KAW A;  4JI8 Q;  2CWP A;  3ERS X;  4IPH A;  4JI0 Q;  1CKM A;  2A1A A;  2DUD A;  4QJF A;  3KF8 B;  3HOX G;  3PO2 H;  4GKK L;  2UXC Q;  2JK8 A;  3GTQ H;  5IWA Q;  3F2D A;  3TS2 A;  4OWX B;  1RIP A;  1VQM A;  3J80 i;  4AQY L;  1TWC H;  3HOX H;  4LWC A;  4GNX A;  3RNU A;  4C3H H;  4DV7 Q;  3WWV A;  1H95 A;  1E1O A;  2I5H A;  3I4M G;  4DK6 C;  2E5L L;  4O0A A;  4PG3 A;  4IJH A;  1LM0 A;  4DR3 Q;  1PV4 A;  2NVX H;  4DAM A;  2A8V A;  4DV5 L;  1VQA A;  1E1T A;  4DK3 C;  3I4M H;  4BA1 I;  2CQO A;  4YWM A;  1YJ9 A;  1E24 A;  3S16 H;  2CFM A;  3CCS A;  3T1Y Q;  2N49 A;  1NMG A;  4B3T L;  4R4I A;  2NZO A;  1E7Z A;  5LMN W;  1UEB A;  1Q46 A;  5C3E G;  4DUZ Q;  1MKH A;  4AYB G;  4OWW B;  3UDX A;  3U58 A;  1J5E Q;  4QQB X;  1PVO A;  2HHH L;  4IO9 A;  3CCL A;  4IJL A;  2OTJ A;  3AQQ A;  1CSQ A;  2OQK A;  1IL2 A;  5C3E H;  1Y1V G;  1I94 L;  4O2D A;  1TWH H;  4MNO A;  3RN2 A;  1VQJ A;  1N36 Q;  3F2B A;  3PGZ A;  4UP7 A;  1KRS A;  2IX1 A;  2XGT A;  1NTG A;  2ASB A;  1VQ8 A;  2BA0 A;  1WI5 A;  1Y1V H;  4P72 A;  4B3S Q;  4JI1 Q;  1A8V A;  2I5M X;  1YVC A;  3M4P A;  3ULL A;  1KL9 A;  5FLM G;  3GTJ H;  4DR6 Q;  4A3G G;  4HJA A;  1EQQ A;  3CC7 A;  2Q2U A;  4UY8 C;  1EFW A;  5FLM H;  2JE6 I;  3H0G G;  4HIM A;  1E22 A;  1GO3 E;  4DV4 Q;  4A3G H;  1YJW A;  4DR1 L;  4MTN A;  1P8L A;  3Q8D A;  1SRO A;  5GAH C;  1NMF A;  4UP8 A;  2WP8 J;  1PH1 A;  1X3E A;  1VQ7 A;  3BZK A;  3H0G H;  2K52 A;  2ZTD A;  3G71 A;  1YHQ A;  2GVA A;  3AFP A;  5EAY A;  1N8R C;  2AKW B;  3HOY G;  1B70 B;  4C2M H;  2KHI A;  1K83 H;  4B3M L;  1YBY A;  3PIO A;  1RL2 A;  2E2J H;  2JA9 A;  4X66 Q;  5FJ8 G;  1QZG A;  4QIW E;  3PCO B;  2K5V A;  4KI0 A;  2VQF Q;  3HOY H;  1NE3 A;  3S1R H;  1EOV A;  2UUA Q;  4JI7 L;  2F4V L;  2D62 A;  4K0K L;  1QVG A;  2IY5 B;  1VQL A;  5FJ8 H;  5ELO A;  1VQI A;  3DLL A;  2CCZ A;  2WB1 G;  5IP9 G;  4IPC A;  1XPU A;  2KCM A;  1LYL A;  4LF9 L;  1KHI A;  3MEF A;  1LTL A;  3TQY A;  4LF5 Q;  4JI3 Q;  1QZH A;  4NB3 A;  2JA5 G;  4NXM Q;  1CSP A;  3PUW A;  4JG2 A;  5J3B A;  3SGI A;  5IP9 H;  2ZTE A;  1Q1E A;  4DR5 L;  3OTO L;  4DV3 Q;  5M5X H;  1C7Y A;  4JI6 Q;  3KFU A;  1IBM L;  2HQL A;  4PZ7 A;  4POG A;  2UXD Q;  3NBH B;  1EQR A;  2JA5 H;  1XNQ L;  2VQE Q;  1MJC A;  1IBL L;  3S15 H;  4JV5 Q;  4GN3 B;  1N33 L;  3T1H L;  1OXT A;  3BZC A;  3S1M H;  2LSS A;  1HZA A;  1YI2 A;  1XNR L;  1WYD A;  4L5T A;  2PMZ E;  1PH5 A;  2JQO A;  2Z6K A;  4DV1 Q;  2C35 B;  2Y0S G;  1X56 A;  3HOV G;  2UUC L;  3RZO H;  4JBM A;  5AJ3 L;  3HOW G;  1HNW Q;  1PH9 A;  1XMO Q;  4LF6 Q;  2N3S A;  2MQH A;  4DKA C;  1T9H A;  1UE5 A;  4DV0 L;  1K8G A;  5BR8 Q;  4LNQ A;  3HOV H;  1N32 Q;  3HOU G;  3W1G A;  4A3L G;  3HOW H;  4YY3 Q;  2I0Q A;  1EUJ A;  3GTP H;  1U0L A;  1N34 L;  1ASY A;  4JBJ A;  3HOU H;  4A3L H;  1SN8 A;  4GOP C;  3GTL H;  1HNZ L;  1X9N A;  4LF8 L;  1X65 A;  1YHB A;  1O7I A;  3K0X A;  3H15 A;  3E9I A;  2PI2 E;  2NN6 I;  3CW2 C;  1L1O C;  4KHP L;  4AH6 A;  2IX0 A;  1HNX Q;  3PUZ A;  2IHF A;  3K7A H;  2HIV A;  4LUV A;  1K0R A;  1B7Y B;  2DGY A;  4P73 A;  4LFC L;  2XTI A;  5C0X I;  1BKB A;  2ID0 A;  4DR2 L;  4JI8 L;  2Q2H A;  4JI0 L;  2WAQ E;  3KF6 B;  5LMU Q;  1PHJ A;  4HJ5 A;  1ASZ A;  3PO3 G;  1KRT A;  4JYA L;  2UXC L;  3PV0 A;  1YEZ A;  4APV A;  2GN5 A;  5ELN A;  1P16 A;  3T1H Q;  5GRO A;  1PA6 A;  3ICE A;  3J81 c;  3RLO A;  3J80 c;  2UU9 L;  4GS3 A;  1BBW A;  4EX5 A;  3PUY A;  3PO3 H;  1PFS A;  4ALP A;  1AH9 A;  1OXV A;  1X3G A;  4FDB A;  2VW9 A;  2E8G A;  4DV7 L;  2VNU D;  1GM5 A;  1KXL A;  5LMN Q;  1PH6 A;  4X62 L;  4DR3 L;  1I50 H;  4A3I G;  1EYG A;  3JAM c;  4DV2 L;  2HIX A;  2YTY A;  3CCE A;  4HIK A;  1NY4 A;  1HZ9 A;  2PQA A;  2R6G A;  2ZM6 L;  4GKK Q;  4A3I H;  1VQB A;  2AMC B;  3H3V I;  1KIX A;  1MIU A;  2RCN A;  4DUZ L;  3RZD H;  4JI4 L;  1V1Q A;  1VQ6 A;  4LFA Q;  4AQY Q;  5H1S E;  4DV6 L;  4JBW A;  1J5E L;  1L1O B;  3CAM A;  1IBK Q;  2BH2 A;  2LXK A;  4R1J A;  4NXN L;  3U4Z A;  4C3I H;  1FJG L;  5IYC G;  4LF4 L;  2RHS B;  3I56 A;  5C0X G;  3HKZ G;  1R9T H;  1A62 A;  1N36 L;  1N9W A;  3E0E A;  1PH7 A;  2R93 G;  1VS0 A;  2A19 A;  2AHO B;  5C4X G;  5IYC H;  4B3S L;  2ALY B;  3RN5 A;  1GKH A;  1JT8 A;  1HJP A;  1Q82 C;  1L0W A;  2VZA A;  4YCU A;  4B3T Q;  2R93 H;  2B3G A;  5C4X H;  1VQP A;  4P74 A;  1W2B A;  4IPD A;  1IZ6 A;  1BVS A;  1PH8 A;  3GTO H;  3HOZ G;  1PYS B;  4YCW A;  4DR7 Q;  3KF6 A;  1MJE A;  3CC4 A;  4HJ9 A;  3DM3 A;  3HFZ B;  3K81 C;  2HHH Q;  4LFB Q;  2NVQ H;  1X55 A;  4B3R L;  2QEX A;  2EQS A;  3S24 A;  3NEN A;  4LF5 L;  4LF7 L;  3FKI G;  1A63 A;  1I94 Q;  4BBS G;  2UXB L;  1WFQ A;  1TWG H;  1S3O A;  1Q1B A;  4DR4 Q;  4MZ9 A;  4A3E G;  2L15 A;  4PMW A;  1JJC B;  5JEA J;  3GTM H;  4JOI C;  3CME A;  2I5L X;  3FKI H;  4R4Q A;  1JJG A;  5C44 G;  4BBS H;  1YIJ A;  4X66 L;  2ZJP A;  4OX9 L;  4IFD J;  4A3E H;  4JI5 Q;  1FGU A;  2BA1 A;  3M7N A;  2PI2 A;  2UUA L;  2NVT H;  5C44 H;  1Z47 A;  2ATW A;  1D8L A;  3H3V H;  2K4K A;  1VQC A;  1NJI C;  2OQ0 A;  4A3M G;  2AWO A;  4DR1 Q;  2K5N A;  4GLX A;  4A3F G;  1SLJ A;  2IHE A;  3W5O A;  1CKO A;  2D0P A;  2B63 G;  3AFQ A;  4JI3 L;  3L7Z C;  3J7A 5;  1L1O A;  4LUO A;  4A3M H;  2D0O A;  4X64 L;  1OXX K;  4DV3 L;  2YU9 H;  4J15 A;  4A3F H;  4LUZ A;  4B3M Q;  4JI6 L;  1V9P A;  2B63 H;  1S72 A;  4A3D G;  3UE1 A;  1PH2 A;  5JJI A;  2VQE L;  3G48 A;  4JV5 L;  1VQ9 A;  4JC0 A;  1JB7 A;  4JI7 Q;  4DNI A;  3TRE A;  1UWV A;  4YHH Q;  2KHJ A;  4HIO A;  1C9O A;  3VDY A;  2F4V Q;  4A3D H;  2NVY H;  4K0K Q;  1UE6 A;  1WCM G;  2AWN A;  4DAY B;  1KC8 C;  2JEA I;  1Y1W H;  4P75 A;  3S1Q H;  3CCV A;  3U50 C;  4GN5 A;  3J81 j;  1C0A A;  2VL6 A;  3ULP A;  1WCM H;  4OWT B;  1HNW L;  4A4I A;  2IT1 A;  5M3F G;  1XMO L;  4LF6 L;  2WAQ G;  2JEB I;  1N32 L;  4QY7 A;  3OTO Q;  3CQZ H;  1HZB A;  1KQS A;  2EXD A;  3K7U C;  1QVC A;  1WOC A;  4LW1 A;  1M1K C;  1IXR A;  1IBM Q;  1VQ5 A;  4KLK A;  5M3F H;  1TWA H;  1IBL Q;  1WJJ A;  4GKJ Q;  3EIV A;  1QUQ B;  4A3J G;  3LGJ A;  1N33 Q;  5GAD C;  1V43 A;  1XMQ L;  3NEL A;  1FL0 A;  1XNR Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...