1XNQQ

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnqQ00
1VQCA 4QIWE 4DR7L 1M1KC 4JI1L 2F4VL 5EAYA 5IYBG 3KLWA 2KHIA 2OQ0A 2Y0SG 4JI1Q 3S1QH 1WYDA 1VQ6A 3U4ZA 1L1OA 1WJJA 4A3BH 2B63G 1HZAA 4A3EH 4YWLA 1SLJA 3NBHB 1V1QA 2K4KA 3I56A 4HJ8A 4QJFA 1U5KA 3CMAA 4LF7Q 3PO2H 1UE6A 2HT1A 1VQ5A 1UE1A 3PIOA 3K7UC 1L2FA 3AFQA 4GN3B 4MTNA 1Q12A 1XMQQ 1HNXL 1VQBA 4NXMQ 2IX1A 4YWMA 2OCEA 1S3OA 2WAQE 4DV0L 2JA5G 1AE3A 4WJ3M 4GLXA 3PUVA 1X9NA 3CP0A 4R4TA 1JJ2A 4PG3A 5JJKA 3CC4A 3B6YA 2DGYA 1SMXA 4IPGA 4IPCA 2ZJRA 3J81j 5M3FG 3RZDH 2CQOA 1BKBA 4A3CG 2E8GA 4IOCA 3I4NG 4A3DH 2H5XA 3J80c 4A3KG 1QUQA 1TWAH 4HJ9A 2VL6A 1CKNB 2R7FA 5IE8A 5FJ8G 2PMZE 3CPFA 5GQOA 1PH3A 1EIFA 1OXUA 2ZJQA 2KCMA 1HR0W 3I4MH 1PHJA 5IWAL 2NN6I 4NB3A 4GNXC 4JBKA 1IL2A 4YWKA 3K80C 4LF9L 5IWAQ 3GTJH 1DGSA 4PZ8A 1GD7A 1E1OA 3PCOB 1PH7A 3F1ZA 2KBNA 3BJUA 2VUMG 4WJ4A 2CCZA 3MEFA 3S1MH 1FVIA 3A0JA 3JAMc 1YJNA 3GTQH 4JI6Q 1E7ZA 4IFDG 4JI8L 1VQKA 1XNRQ 1YBYA 5K36G 2LSSA 4YHHL 4C3JH 2K14A 4TQUS 4JC0A 4UY8C 5ELNA 3L0OA 1TWFH 1KC8C 5C4XH 1V9PA 2AHOB 2UU9Q 2C35B 2GVAA 1ASZA 2VZAA 4A4IA 4XTCS 4GLVB 2Y0SE 1T9HA 1CKOA 1X65A 2K5NA 2YYZA 1PH2A 1IZ6A 1JT8A 2RCNA 1YIJA 5C3EH 1HNZQ 4DAMA 3KF6A 4JI4Q 5E7NA 2IT1A 4MZ9A 4DR2L 1LTLA 3CXCA 3J7A5 4QY7A 4B3RQ 1Y1VH 2CWPA 1VQLA 1XPOA 2Q2TA 2VY3A 3OYYA 4OWXB 2Z6KA 2UUAL 1VS0A 4OWWB 1Z47A 3GTOH 3CCQA 1IXRA 4A3EG 2CKZB 3K81C 4LF8Q 4JI2Q 5JEAG 1U0LA 5BR8Q 4Y52H 3UDXA 1X3GA 4JI5L 5AJ3L 1UWVA 2MFIA 3PO2G 5C0XI 3PUXA 4JBJA 3T1YQ 4ME3A 1HNWQ 1GM5A 3D31A 2IY5B 2B29A 3KF8B 3S1RH 1UE5A 4AQYL 3PF4A 4A3LH 1QVCA 4JV5L 1KHIA 2CWAA 4OXPA 4L5TA 1VQ4A 4JV5Q 4X64L 4DK3C 2QGQA 4LF4L 1N33L 4TVAB 4GOPA 1N33Q 5LMNQ 2Q2UA 4LFAL 3AFPA 4L5QA 3TS0A 1SN8A 1XPRA 4P73A 4XIGS 1K8AC 3KOJA 1K9MC 1VQDA 1J5EL 3CCSA 4LF6L 5C44H 5IYDH 3RLNA 1XTDA 1HJPA 2R7DA 3I4MG 1OXVA 2V1CC 2DUDA 3U4VA 4DV2Q 5DLQE 4HIKA 4DR1L 1YHQA 1WI5A 4L5SA 1BBWA 1VCIA 3U58A 3PIPA 5LMUL 4BY7H 1KL9A 4DV1Q 4DV6L 4DR1Q 5LMUQ 1BVSA 4LWCA 4DV6Q 2BH2A 1I94L 1KD1C 4GKJQ 2IHEA 1I94Q 1NMFA 2PNHA 1ASYA 3CAMA 3RR5A 4POFA 3S14H 2MO1A 4JG2A 1PV4A 2R7ZH 3HOYH 1L1OB 1OXSC 2E5LL 2WB1G 4DNIA 4LF5L 1VQMA 3CC7A 3AEVA 4HJ5A 4JYAQ 2VS1A 4P72A 4IJLA 4KHZA 3BZCA 5C4XG 2KHJA 4JOIA 4JI0Q 2ASBA 1TWHH 1J6QA 3G4SA 1IBLL 1Q86C 4JI3Q 1I5FA 2GVBA 2R93H 4LFCL 1IBLQ 1B7YB 4OWTB 3S2HH 1X3EA 2Q2HA 4LFCQ 2ZJPA 1RIPA 5IP7H 1TWGH 1WCMH 1E24A 1Y1VG 4LF7L 1MJCA 4HJ7A 4GKKL 5H1SE 4X66Q 2RF4A 2PI2A 3M85A 3HOVH 1H95A 3BZKA 1BBUA 4HIOA 4FDBA 2F52A 4GKKQ 2ZTDA 4NXML 1XMQL 2NZHA 1PH1A 4PZ7A 1I6HH 1EFWA 3M3YH 1YEZA 1Q81C 4A3FH 1HZ9A 5C0XG 1SE8A 1LUZA 2Z0SA 4GS3A 1FGUA 2N8NA 1NTGA 4AH6A 4A3JG 1FJGQ 3GDEA 1S40A 1A0IA 3F2CA 2UUBQ 3W1GA 4EX5A 2L15A 1VQAA 4GN4B 4R4IA 4AYBE 1W3SA 1MJEA 2NVXH 4B3SQ 1YI2A 2JA8H 2JJQA 1Q8KA 1D8LA 4A3GH 3PGZA 4DV3Q 1SFOH 2ZM6Q 4OONA 2NVYH 4KHPL 2VQEQ 3S24A 1N9WA 4DR5Q 4KHPQ 2GN5A 3MXNB 2E2JH 1EQQA 1K0RA 5C44G 4A3MH 4QGUA 4A75A 2MNAA 1L1OC 1A63A 1N36L 3M4QA 1YHBA 4BY7G 2BA1A 4LW1A 1N36Q 2EQSA 4L5RC 2NVTH 3H0GH 1CUKA 3LGJA 1YNXA 4JI6L 1QVGA 4YCUA 4DUZL 1FL0A 1XNRL 1JJGA 2UXBQ 2WB1E 3A5ZB 2WP8J 2R6GA 4O0AA 1KRTA 4DUZQ 1YJ9A 4P75A 3S17H 5C0XJ 5GAGC 3I4OA 1GO3E 3HOZG 1N8RC 3BU2A 2UU9L 3UDFA 2K50A 3CCJA 1R9TH 3S2DH 3K0XA 1MIUA 1HNZL 2OTLA 4JI4L 3PUZA 1VQ9A 3PV0A 5GROA 4YY3L 1CKNA 1K8GA 4B3RL 1PYBA 5GADC 1LYLA 4Y7NH 4YY3Q 3F2DA 3M7NA 4BBRH 2R93G 2D0PA 5HGQA 3EBEA 3G6EA 1GVPA 2EXDA 4A3BG 1PH5A 3K7AH 3OW2A 4LF8L 4JI2L 5IP7G 4MNOA 3KDFB 5FLMH 3ICEA 2N49A 1B70B 1WCMG 2YTVA 5IP9H 5BR8L 4DV5Q 1JJCB 3AYHB 2XGTA 2KENA 4GOPB 4POGA 3KFUA 1WOCA 3T1YL 2JA7H 3HOVG 2K52A 1HNWL 2ZTEA 3G48A 3TEHB 3UE1A 1I50H 2ALYB 3E0EA 3IRBA 1S72A 1JB7A 3FP9A 3M9BA 1L0WA 4JBMA 5M5YH 4A3FG 4R4OA 4NXNL 4B3TQ 1B8AA 1E3PA 1Q1EA 3EIVA 5IT9c 3PF5A 1VQFA 4PMWA 4NXNQ 3JC66 3ULLA 3H15A 5LMNL 3AQQA 3STBD 4KI0A 1Y1WH 2I5HA 1Q1BA 4AYBG 4IO9A 2N3SA 4A3DG 2RHQB 2K75A 3H3VH 1WFQA 3E9IA 3H3VI 4A3GG 4R1JA 2E2IH 1LM0A 1OXXK 4HIMA 4DV2L 5IY0A 2A19A 1A8VA 2NN6G 3ZJYC 4OO1I 4DV1L 4HJAA 3HKSA 1SROA 4DV7L 1KXLA 1GKHA 4DV7Q 4A3MG 4GKJL 4LUZA 5M3MH 1I3QH 4KLKA 5GAEC 4DR3L 4QQBX 3HOUH 2Z6KC 4HIDA 3STBC 2OQKA 1KQSA 4DR3Q 3CD6A 1E1TA 1NBWA 3A74A 2JE6I 1X55A 1UEBA 3A5UA 2AKWB 4OX9Q 1EUJA 2OWOA 5HY6A 1PH4A 1XNQL 4C2MH 3FKIH 3PUYA 2QEXA 3F2BA 1PFSA 4JYAL 1XNQQ 3SGIA 4BY1H 3CW2C 5GAHC 4BA2I 1VQGA 3I2ZA 1YHAA 3PO3H 1EQRA 4APVA 4DKAC 2Q2IA 4DUYQ 1K73C 1JMCA 4JI0L 1EOVA 1K83H 4JI3L 1RL2A 4R4QA 3NENA 4GOPC 3GO5A 1A62A 3D0FA 3EN2A 5C3EG 2WFWA 1UE7A 2YV5A 3KYHC 3CF5A 1IBML 3HOXH 1XPUA 4GLAC 2ATWA 4IFDI 1IBMQ 1P16A 4BBRG 3GTKH 4X66L 1TWCH 1YVCA 5M5WH 5FLXc 2UUCQ 4AIMA 2YU9H 3RNUA 3K8AA 4UP7A 1QZHA 1SR3A 3GTPH 1QUQB 3UDGA 2KCTA 1OXTA 4RG1A 4B3ML 1QVFA 2JA7G 2UXCQ 4GNXA 4B3MQ 1FJGL 1VQJA 3I7FA 4X65L 4DV4Q 2PQAA 2CFMA 2UUBL 4A76A 4DR7Q 4X65Q 2F4VQ 4A3LG 3HFZB 4B3SL 1W2BA 3NEMA 3M4OH 4BXXH 1CKMA 3HKZE 3U50C 3RLFA 4DAYB 1OTCA 4DV3L 1VQNA 1YJWA 1MKHA 2ZM6L 4QL5A 3J7ZC 1Y1WG 2VQEL 5IYCH 4DR5L 2YTYA 3CQZH 2AWNA 5ELOA 3DLLA 2R92H 3J81i 4JOIC 3GTMH 2HIVA 1HNXQ 1VQ7A 5IYDG 1SRUA 4DV0Q 4NPSA 1X54A 3T1HL 4OO1G 2QA4A 3T1HQ 4LNQA 4A93H 2MQHA 4K0KL 2XTIA 1C7YA 1C0AA 4K0KQ 3GD7A 3I55A 4ALPA 4BA1I 2ZTCA 1E22A 5M3MG 4P74A 1CSQA 3HOUG 3TS2A 1PH9A 2UXBL 3KF6B 2LXKA 1YITA 1D7QA 2VQFL 4A3IH 4LFBL 2JA6H 3HOYG 2R7ZG 4JBWA 2VQFQ 2F3IA 1VQ8A 4LFBQ 1JE5A 5M5XH 2YTXA 3FKIG 2JQOA 4BBSH 1HZBA 4DK6C 3OTOL 1AE2A 4BY1G 3S16H 2LXJA 2VW9A 4LF9Q 4UPAA 3CC2A 1TXYA 3PO3G 3OTOQ 4X6AH 2JA9A 4JCVE 2D62A 4H02A 1G51A 1EYGA 1HR0L 5JJLA 1XJVA 3ULJA 1HR0Q 2I5MX 3L7ZC 2N78A 1Y14B 3CPWA 1Q46A 2NZOA 2I5LX 3GTGH 3HOWH 4EQ5A 4P71A 1Q82C 3ER0A 3L2PA 3HOXG 4C3HH 4DV5L 1KAWA 2RHSB 3TQYA 4JI8Q 2UXDL 1CSPA 1HH2P 4IPDA 1PH6A 4DPGA 3KJPA 2A1AA 4YCWA 4YHHQ 3CCUA 2UXDQ 1VQHA 1PA6A 4IPHA 5J3BA 1VQEA 5IYBH 3RN2A 3UDIA 5LMNW 2AMCB 1C9OA 4B3TL 1EIYB 1N32L 2K5HA 1QZGA 2HHHL 2B63H 1N32Q 3PSIA 3KJOA 2HHHQ 1HZCA 4UP9A 4IJHA 5C4JH 4DR2Q 2PI2E 3VDYA 3PUWA 2K5VA 2HQLA 3HKZG 1VQIA 1NY4A 4C3IH 2UUAQ 4BXXG 3CMEA 2IX0A 2JA8G 2E2HH 2NVQH 2VNUD 2JEBI 1Q7YC 3CCEA 5IYCG 2JA5H 1IBKL 1AH9A 3RLOA 5AJ3Q 1IBKQ 3CCLA 4JI5Q 4A3JH 2R92G 1IYJB 3UE0A 5M3FH 2WAQG 1K3RA 4PZ6A 3W1BA 2JEAI 3DM3A 3J80i 3J81c 1PYSB 4A3CH 3WWVA 4AQYQ 3I4NH 4IFDJ 3KDFA 4A3KH 1KIXA 4A93G 4R4CA 3CCVA 1N34L 4O2DA 3CCRA 4X64Q 2D0OA 5FJ8H 4LF4Q 2ID0A 3H0GG 4J15A 1N34Q 3GTLH 2BH8A 4OX9L 4JI7L 1M90C 2A8VA 4UP8A 4LFAQ 2AWOA 3RZOH 4JI7Q 2I0QA 3Q8DA 2MO0A 4A3IG 4RMFA 1X3FA 1VQOA 4YCVA 2JA6G 4DUYL 1J5EQ 3TRZA 4LUOA 4LF6Q 1G6PA 3NELA 1PH8A 2VUMH 4BBSG 3JAMi 4DR6L 3G71A 4DR4L 4DR6Q 2B3GA 3RN5A 5JJIA 1G291 4DR4Q 3TREA 3F8TA 1EWIA 1X56A 4GNXB 2EIFA 1X6OA 1P8LA 1NJIC 5JEAJ 2JK8A 2PQAB 4GN5A 2UUCL 3ULPA 1NMGA 3ERSX 3M4PA 4X62L 1NE3A 3HOWG 1Z9FA 1PVOA 1XMOL 3S1NH 2OTJA 3FHWA 1KRSA 1YZ6A 4X62Q 3HOZH 2BA0A 2HIXA 1XMOQ 2ES2A 2IHFA 5FLMG 5IP9G 2E5LQ 1VQPA 4LF5Q 3S15H 4IOAA 1V43A 3W5OA 3CCMA 2UXCL 3E9HA 4LUVA 4DV4L 1O7IA 2FXQA
chains in the Genus database with same CATH superfamily
5CV9A 5EAYA 3I72A 4A3BH 3FDTA 1HZAA 4A3EH 5DNFA 4YWLA 2OEOA 3R93A 4TKOB 2L9HA 4QJFA 3PO2H 1CT1D 1STNA 4KD4A 2HT1A 1G91A 1I3QB 1L2FA 3AFQA 1Q12A 4EGVA 1VQBA 3RD4A 2A68D 2RSOA 5JJKA 1SE3A 2L0CA 3NBIA 5M3FG 1SMXA 4IPGA 2ZJRA 1HA6A 3J81j 2WACA 3RZDH 4C2MB 3NHHA 5KNDA 3VR5A 1QUQA 4HJ9A 2HDMA 3CPFA 1PH3A 1H9JA 1W6JA 2ZJQA 4LAAA 2HQEA 5FK9C 2NN6I 5IWAL 1IL2A 1J8IA 4YWKA 5CV8A 3D4WA 1E1OA 1D1KA 1PH7A 2KBNA 4G7ZC 4IZ8A 1R4QB 3HOVB 3S1MH 5IT9L 4EQOA 1E7ZA 3D4DA 4JI8L 1ILPA 3OOCA 1YBYA 4RGTA 2JP1A 4YHHL 2K05A 1EU4A 4FYDA 3HKZB 5IGBA 2UU9Q 1ASZA 3KLRA 4XTCS 2Y0SE 2K5NA 2YYZA 4A3GB 1YIJA 1HNZQ 3KLSA 1M4VA 2DN8A 2IT1A 2EYHA 2PO4A 1DJRD 4DR2L 3J7A5 2VY3A 3OYYA 2UUAL 1RCVD 3GTOH 4ODGA 3P75A 2CH4A 3BVZA 1ET6A 4JI2Q 4DXFA 3H09A 5JEAG 1U0LA 4CJ0B 1V1OA 3F2UA 3UDXA 4DAPA 1UWVA 3H0GB 3PUXA 3M7GA 1KNEA 1LO5D 2SNSA 1I4PA 5F2DA 3S1RH 3PF4A 1QVCA 4JV5L 4OXPA 1LTSD 3MA2B 1N33L 1RHPA 2KEDA 1PRTC 3C1FA 3AFPA 1A2UA 1B3AA 4UDUC 4L5QA 1SN8A 1XPRA 3KOJA 1LTAD 1K9MC 1VQDA 1J5EL 5LL6S 2R7DA 1HJPA 1Y8NB 3I4MG 4PMBA 3ERQA 5DLQE 4DR1L 1WI5A 2HUGA 2JN4A 4LJZC 1BVSA 4LWCA 4DV6Q 2ICIA 1KD1C 3J7AV 2JA7B 2NZ1D 2PNHA 4EQNA 1ASYA 2VB2X 3CAMA 5JJZA 4IUVA 2F0GA 4JG2A 3HOYH 5KIXA 4FXDA 4LF5L 2B63B 4G7OC 4HJ5A 4C3JG 4JYAQ 1PFBA 5CV7A 2PPBC 3BZCA 5C4XG 2JXMB 2KHJA 2ASBA 1TWHH 1J6QA 3RUZA 1I5FA 2GVBA 4LFCL 1B7YB 1XXGA 1BUVT 2Q2HA 3S2HH 5IP7H 1WCMH 1E24A 1Y1VG 2EZVA 4GKKL 3BZKA 2ZTDA 4PZ7A 1I6HH 5BN5A 3M3YH 1CI3M 3GTLB 1SE8A 2N8NA 5DEHA 1S40A 2WKCA 4EX5A 5IGFA 4GN4B 1HUMA 2JJQA 3DXJC 3PGZA 4DV3Q 1LLRD 4OONA 4KHPL 4C56C 4NKLA 4L6TB 2GN5A 3MXNB 2E2JH 1EQQA 1KDCA 1WD0A 1PRTB 4E6IA 2MNAA 1L1OC 2MPMA 1X3PA 1YHBA 2YU9B 4LW1A 2QKIC 3S15B 1EYCA 1QVGA 5FO9B 4YCUA 1FL0A 2IWHA 2UXBQ 2QILA 1EOTA 2F1MA 2D5DA 4P75A 1RKNA 1RTOA 2UU9L 1DZ1A 3PIO3 1HNZL 2OTLA 2F3VA 5I2YA 5CV6A 3J81L 1VQ9A 2OXPA 1PYBA 5GADC 1LYLA 1PTOB 3F2DA 4BBRH 2D0PA 3G6EA 2Z8LA 2R92B 1GVPA 2PZTA 2WAQB 1Q90A 4JI2L 1H9KA 1B70B 3AYHB 2KENA 1EY9A 1FYCA 1PTOF 4RWSC 2ZTEA 2AQ1B 5DAUA 2ALYB 3IRBA 1SNCA 2B2TA 1ML0D 4IUUA 4HR7B 2B2VC 1O7LA 4PMWA 4EVOA 2KECA 3JC66 4BBSB 2K5DA 1PZJD 3A54A 2N3SA 1EQTA 1EY6A 1WTQA 5ELFA 3E9IA 5C5LA 2EYJA 2E2IH 1BDOA 3HOWB 4OO1H 4I7AA 3D6CA 4HJAA 4DV7L 1KXLA 2RQXA 4KLKA 4DR3L 3HOUH 4F7XA 2OQKA 1KQSA 1A6XA 4DNRB 1E1TA 1NBWA 2FJ2A 2JE6I 3A5UA 1IHZA 1EUJA 2OWOA 4IN3A 2J7ZA 2K6AA 2PW5A 4K14A 3J7YW 3T16A 2KJXA 3PUYA 2QEXA 3F2BA 4JYAL 1SYCA 2SEBD 4V0BA 1YHAA 3ND9A 3IL8A 3GQBA 2EYPA 5C4JB 1K83H 2AUJD 3HP3A 2E2HB 2F0SA 1A62A 5C3EG 3CF5A 2E76C 2ATWA 1V1PB 3KK7A 5E3FA 1IBMQ 1P16A 4IFDI 4A3JB 2DJGC 3D6WA 2M2LA 5M3FB 1G6ZA 4FF3A 4CKEA 1QZHA 4DK1A 3GTPH 2WIIB 4IALA 2KCTA 1QE6A 1K8MA 1AZPA 4CDFC 4X65Q 2F4VQ 3NQIA 1EY0A 3HFZB 3JAML 2C9OA 2L4NA 4DV3L 1D6EC 3VA7A 5EPKA 1YJWA 1Y1WG 4DNTB 1C48A 3NE5B 3MVVA 3IFDA 5ELOA 3DLLA 3I73A 3J81i 1HNXQ 5JOBA 2E74C 4XT1B 1T5XD 4ZK9B 3Q6SA 4A93H 2MQHA 3HOZB 5KGUA 1I4QA 4BA1I 1GHKA 2UXBL 4R8IA 3CHBD 1D7QA 2VQFL 4A3IH 1VQ8A 4LFBQ 2R93B 1KDBA 1JE5A 3FKIG 2KEEA 1STHA 1SEBD 1AE2A 2A69D 4BY1G 2VW9A 2XN9C 4LF9Q 3PO3G 3OTOQ 1FNWA 2D62A 3VR4A 1HR0Q 1IKLA 1BF4A 4U673 3GTGH 3NTKA 2O5JC 4C3HH 1RD9D 2NYZD 3A8JE 4FO2A 4X3TA 5T1GA 4XQQA 2FHTA 1CZGA 4IPHA 1LT6D 3SDZA 4B08A 4A3DB 5IYBH 3FPPA 3VYSA 3E0JA 1I6VC 1ZYRD 1UEAB 1QZGA 1WTOA 1GUWA 3PSIA 1TS2A 1SYDA 2HHHQ 3I4MB 1SYGA 1JOKA 1DOMA 2KHSA 3HKZG 4ABNA 4CKBA 4BXXG 3TSSA 1TY2A 3OIQA 1HFNA 4KKUA 3NUCA 4L63B 3RLOA 4JI5Q 3QR8A 3OIPA 3KLSX 3VYUA 1J9OA 4PZ6A 2JEAI 3DM3A 4A3CH 5AFWA 3TZDA 4C3JB 1BCPD 3CCVA 2F0QA 4J1MA 3X3MA 3CCRA 3S2DB 3H0GG 1N34Q 4J15A 5C4XB 4JI7L 5DM63 4LFAQ 1SNMA 2MO0A 4YCVA 2B2YA 2XSCA 1Y1VB 3HRZC 1F2ZA 2VUMH 4DR6L 3JAMi 3G71A 4DR4L 1G291 4ZLTF 1X56A 3D8GA 4GNXB 1X6OA 3GV6A 5JEAJ 3M4PA 4X62L 4RCOA 3FHWA 2EY2A 1CZWA 2BA0A 1DD2A 3CKIB 1Y8PB 5IP9G 1VQPA 2E5LQ 3W5OA 2Z4HA 4L8JA 1M1KC 2B2UC 2F4VL 2Z4IA 3KLWA 2RBMA 1WYDA 5FKAC 3U4ZA 3NWSA 4K2KA 2B63G 2X6LA 1YNND 3NBHB 1UAPA 1V1QA 2K4KA 2A74C 4G57A 3K7UC 3QB3A 2DY8A 1PZKD 4ZAIA 1XMQQ 1HNXL 2IX1A 5K36G 4YWMA 2OCEA 2JA5G 4GLXA 1I4GA 3PUVA 1JJ2A 4IUNA 2R7ZB 3CC4A 3B6YA 2NTTA 2DY7A 1A3TA 1RJTA 1U4MA 2CQOA 2O5IC 3J7AF 2H5XA 4N9PA 1TWAH 1CKNB 5IE8A 4HMJA 1AFPA 5A2QE 1OXUA 1PZID 2KCMA 5EKKA 3DMUA 3P20A 4HN7A 4JBKA 4LF9L 5IWAQ 3MFYA 4KKTA 1AN8A 4DK0A 1TWGB 1GD7A 3PCOB 3HGBA 5EGTA 2CCZA 4LMQD 1ZKOA 1FVIA 1YJNA 1STYA 3GTQH 5DM73 3MFGA 1B9MA 1LTRD 2K14A 4JC0A 4UY8C 5ELNA 4P2CB 3L0OA 1TWFH 1KC8C 4ZUJA 2NVXB 2VZAA 4X3UA 1B1ZA 3ND8A 4GLVB 5CC4A 2RCNA 5C3EH 3IAYA 3P7JA 3KF6A 5HGTA 5E7NA 1LTLA 2BCOA 1HUNA 3K58A 2Z9HA 1XPOA 4OWXB 2Z6KA 4OWWB 3CCQA 2CKZB 2KUMA 4LF8Q 2Z1CA 4CDEC 4JI5L 2WV6D 2ZXRA 5C0XH 3DWQA 3V2TA 1HNWQ 1MSHA 5E1FA 2IX3A 2IY5B 1B2TA 2CWAA 3S17B 1ICFB 4JV5Q 4TVAB 4GOPA 1EEID 1R9TB 1N33Q 2Q2UA 1HFGA 4LFAL 3BYTB 5I4DA 3TS0A 3BZDB 4XIGS 1H9SB 3A7LA 1K8AC 4J6HA 3MHBA 1M8AA 4Y7NB 1OXVA 2V1CC 4BWGB 1JQYD 4NMZA 2RDGA 4DR1Q 4F87A 3NK9A 2RA4A 5JPNC 5CBEE 1NMFA 1KLUD 4HCSA 1S5DD 4POFA 1GUSA 4C1NK 2H1EA 1HA5A 1OXSC 2FMMA 2WB1G 4DNIA 2E5LL 3CC7A 1ZXTA 4IUTA 5ELCA 1O7ZA 4IJLA 1Y1WB 1W6KA 4JOIA 4CGYB 4FXGC 1VMPA 2F03A 2K28A 1AW7A 4HMIA 1X3EA 4LFCQ 3QIAA 3PQIA 2AUKA 1GJXA 4K5WA 5H1SE 3MZ5A 3HOVH 1H95A 1BBUA 4HIOA 4GKKQ 1XMQL 1BBXC 5I2XA 1ESFA 1Q81C 1HZ9A 3WOFA 1B3QA 1XX8A 4A3JG 1NTGA 1X32A 3W1GA 3FKIB 4R4IA 3A8KE 3Q23A 4BY1B 1RODA 1W3SA 3PO3B 4DAVA 4A3GH 2ZM6Q 3KBGA 5FLXE 3S24A 2VQEQ 4KHPQ 5ELEA 5IGEA 1NNXA 5D65A 2L55A 5C44G 3H6MA 4DAYA 5M5WB 1A63A 3M4QA 3NPPA 3U9SA 4BY7G 4H0LC 2EQSA 3H0GH 1G2TA 4RH6A 5I6YA 1SYFA 4DUZL 3A5ZB 1ESRA 2WP8J 2Q8RE 4O0AA 1YJ9A 3C2PA 5C0XJ 3H3VC 2PW7A 1QWYA 3HOZG 1O78A 3BU2A 2K50A 3CCJA 3SK8A 2CW0D 3K0XA 4YY3L 5GROA 4PV1C 3CQZB 1K8GA 2R93G 1EYAA 4QMGA 1PH5A 4LF8L 4MNOA 3ICEA 2N49A 5IP9H 1JJCB 1EQVA 2JA7H 5C4ZA 1HNWL 2K04A 3UE1A 5EPJA 4OGQC 3FP9A 2HDLA 3WDNA 5K5PA 4A3FG 2PMZB 2A6ED 3A7AB 4NXNL 1B8AA 1E3PA 3EIVA 4HTHA 1VQFA 1F9SA 4KKSA 4CHTB 1Q8IA 3H15A 3OPOA 3STBD 4KI0A 4IO9A 4A3DG 3H3VH 1A3UA 1WFQA 4X3SA 2F0DA 4CKCA 3I70A 1LM0A 2B8GA 1FNVA 5FO8B 2A19A 2NN6G 4OELB 3HKSA 1OO9B 2A6HD 4DV7Q 4A3MG 4LUZA 4QQBX 3NSWA 4DR3Q 3L9AX 2HCCA 1STEA 3A74A 4KY7A 1LT4D 5C4HA 2O2LD 1LTTD 4OX9Q 5JVH3 1PH4A 4OHJA 2TSSA 4BA2I 1PTOC 3CW2C 5GAHC 1PFNA 1VQGA 3I2ZA 1JOQA 1IW7D 1EQRA 4DKAC 2Q8IB 4DUYQ 1K73C 5J39A 1RL2A 3NENA 4KJOA 3EN2A 3J81E 2JA5B 1CK1A 2BDOA 3GP7A 1GHJA 4KV6A 1IYVA 5KYLA 2YU9H 3DEOA 3K8AA 1SNDA 4FF4A 2M9VA 3GV3A 2DJFC 1EWCA 1ENAA 4B3ML 1IL8A 2UXCQ 3LWEA 2PQAA 2CFMA 4DR7Q 3MWYW 4U68A 5I6WA 4A3LG 2XNAC 4I7ZC 3NEMA 3HKZE 1WTPA 1CFMA 1OTCA 4DFAA 2ZM6L 2VQEL 3RMHA 5C3XA 1PTOH 2R92H 2F0EA 3ITPA 1JWUD 2EE1A 2RCFA 1YNJC 1PFMA 1VQ7A 2V4DA 3D3RA 3T1HL 3S1NB 1X3QA 4K0KL 2XTIA 1C7YA 2IPKD 3GD7A 3MEHA 3I55A 2BDNA 3VYTA 3V96A 5M3MG 1CSQA 1F9RA 1WVLA 3QOLA 3K5MA 1YITA 4QIWB 3EVQA 1SMYC 2R7ZG 1SYEA 4JBWA 2VQFQ 2F3IA 2ICEC 1SNPA 3S1QB 3EFXD 1KNAA 1IKMA 4O1NA 4BBSH 4R9WA 4UPAA 4JCVE 1G51A 1S5CD 1TR5A 2I5MX 3L7ZC 2K01A 4N8FA 2LY7A 2NZOA 2I5LX 3HOWH 2NTSA 1Q82C 4KY6A 3L2PA 1CHPD 3LX0A 3HOXG 4IURA 1DCZA 1KAWA 2RHSB 4TSSA 4CDDC 3TQYA 2UXDL 1CSPA 1BCPB 3CCUA 3KJPA 2XWBB 3HZXA 5J3BA 3U9OA 2QW7A 3UDIA 4MHEA 1EY8A 4RCNA 4CJ1B 1BCPF 1ENFA 3L3OC 3X3NA 1ET9A 1HZCA 4IJHA 5C4JH 3JAME 3BYYB 2K5VA 3GTJB 5JVG3 2BE5C 4RKBA 1NY4A 2P5ZX 2IX0A 1TS5A 2E2HH 5KNCA 2JEBI 5IYCG 4QB4A 1WD1A 1IBKL 2FMCA 1HTPA 4A3JH 1IYJB 4KTAA 3SXHA 3UE0A 5M3FH 2WB1B 1MD2D 1PYSB 3WWVA 1SJHD 4R4CA 2D0OA 4LF4Q 2BH8A 4OX9L 1M90C 4UP8A 1II3A 3RZOH 3LWUA 4DU9A 4JI7Q 2I0QA 3Q8DA 3KF8A 1EU3A 4WFN3 2JA6G 4DUYL 1CA6A 3TRZA 1G6PA 2B2WC 2LS01 4DR6Q 3RN5A 3QOJA 3MAQA 4DR4Q 2QF7A 4V190 3F8TA 1EWIA 3MXGA 3E5SA 2EIFA 1NJIC 4BS9A 3ERSX 1EIHA 2F0PA 1NE3A 1Z9FA 1KRSA 1YZ6A 4X62Q 3HOZH 2HIXA 5E4XA 4IOAA 2XWJB 2UXCL 3E9HA 4LUVA 1O7IA 1DOLA 1C8CA 1VQCA 1SYBA 1JCKB 4QIWE 1B44D 4DR7L 4JI1L 2KHIA 2OQ0A 2Y0SG 3I4LA 1U4RA 1L1OA 1CHQD 1E2ZA 5C44B 3TZUA 1SLJA 2XVSA 5JEAH 3TMEA 1TU2B 3I56A 4HJ8A 1U5KA 2OF1A 4BY7B 4C3IG 4LF7Q 1UE6A 1PXUA 5CV4A 1UE1A 1ONLA 4MTNA 3CRKC 1S3OA 2WAQE 3BVMA 1AE3A 1X9NA 2CVRA 1KABA 3S14B 4PG3A 3HG9A 1QCBD 2DGYA 2IW3A 4B9XA 2F0VA 3CU7A 3I4NG 5CGKA 5C5MA 3J80c 4A3KG 4A3DH 2F0UA 5FJ8G 2EYOA 5GQOA 4MTKA 3DWAA 4K6DA 1WTWA 3I4MH 1C4QA 4NB3A 1U9RA 4GNXC 1FR3A 2A68C 3K80C 4M8AA 2EDGA 3F1ZA 1SDFA 3BJUA 4WJ4A 4DXGA 2MP1A 3MEFA 4S3SA 2K1BA 2A73B 3FPUB 2RKSA 3OMGA 2B2VA 5CBAE 4JI6Q 3AMUA 3J80E 4A3FB 4IFDG 1EEFD 1XNRQ 4C3JH 2TMPA 1SE2A 4WJWA 5C4XH 2C35B 2JA8B 1PH2A 1JT8A 1IZ6A 1SFOB 4DAMA 2NVYB 4JI4Q 4MZ9A 5HURA 3VR6A 3CXCA 4B3RQ 1Y1VH 1MHWC 2Q2TA 1BR9A 1SBBB 1VS0A 2K03A 1IXRA 5KRUA 4A3EG 1PRTD 3K81C 4A3MB 3SK5A 5BR8Q 3PO2G 1X3GA 5IIFA 2MFIA 1ENCA 2NVTB 2SNMA 4ME3A 1STAA 3D31A 2B29A 4RGOS 1UE5A 4A3LH 2O4XA 1KHIA 1LT3D 4IUQA 4UAIA 2AQ2B 4L5TA 4OEMB 2QGQA 4LF4L 3WOEA 4H44C 4FVMA 3A56A 5EPLA 2RDFA 4P73A 1GUTA 1EL0A 1Q3LA 1XTDA 1S4ZA 3U4VA 4DV2Q 1BBWA 1VCIA 3U58A 3PIPA 3K7AB 5LMUL 1KL9A 1U4PA 4DV1Q 5CYUA 4HCEA 2NBFA 4FF1A 4ME5A 2BH2A 2EY6A 1I94L 4GKJQ 5BN4A 1I50B 2DNEA 1PV4A 2R7ZH 3NQTA 5M5YB 2R3ZA 1S5ED 4ZUIA 2EYFA 4HSPA 1GUOA 1RDPD 3AEVA 1LV9A 5M9OA 4P72A 2KCNA 4JI0Q 1G8ZD 1IBLL 1Q86C 3ZYYX 2ZJPA 1RIPA 1TWGH 3G6JB 4CDCC 4LF7L 1MJCA 2RSNA 4X66Q 2RF4A 2PI2A 3M85A 4FDBA 2KOLA 3R8BA 2SDFA 5M3MB 3QG1A 1EFWA 2PZWA 4XYQA 1LUZA 2VXWA 1TT2A 2Z0SA 2XRQD 3GDEA 1A0IA 3F2CA 2UUBQ 3LNNA 3D4RA 1JWMD 3M4YA 1MJEA 2NVXH 4B3SQ 1YI2A 2CQAA 2EYLA 1D8LA 3K0YA 2QDBA 2F0FA 1WTHA 1XTCD 1N9WA 4DR5Q 1XWEA 2JYOA 2RDHA 3BDCA 4RGNA 1EYDA 2KA7A 5D14A 1AZQA 3HOXB 1K0RA 4RAUC 1ICWA 3GTKB 4QGUA 1TWCB 2EPBA 1N36L 5C3WA 5BN3A 4L5RC 2MGSA 4JI6L 1A3VA 2Z6BA 1XNRL 2M00A 4XQJA 4DUZQ 3S17H 4YIJA 1S5BD 3I4OA 1N8RC 5G3LD 3UDFA 1R9TH 3M4OB 2NUCA 1MIUA 3VYRA 3BDOA 4JI4L 2IJ0A 3PUZA 5EBDA 1CKNA 4B3RL 4Y7NH 4YY3Q 3M7NA 1U4LA 3EBEA 4ZKCB 3GTMB 2EXDA 1KTKA 3NTHA 3OW2A 1BXTA 5IP7G 3KDFB 5D3IB 1WCMG 4KY5A 5BR8L 4DV5Q 4GOPB 2XGTA 4POGA 3KFUA 1WOCA 2K52A 3G48A 3TEHB 3E0EA 1S72A 1JB7A 3M9BA 1TWAB 4R4OA 4F88A 3BS1A 5IT9c 3PF5A 2JA6B 2E75C 2K7VA 4NXNQ 3ULLA 5M5XB 3AQQA 1UUPA 1Y1WH 1DM0B 2I5HA 4AYBG 3S16B 1SJED 2RHQB 4KJNA 2F0OA 2K75A 4KN7C 1OXXK 4DV2L 5IY0A 1A8VA 4QUCA 3GTQB 2OT2A 4OO1I 2GA4B 4DV1L 4XXEA 1GKHA 4GKJL 5GAEC 1I3QH 3OHXC 2B2UA 1TQOA 5IT9E 1DOKA 3CD6A 1X55A 2EYMA 5A2QL 5IOCA 5A35A 2Y0SB 1XNQL 4C2MH 3FKIH 3VA5A 4ZKBB 4BY1H 3PO3H 4APVA 2Q2IA 1JMCA 1HQMC 4JI0L 4C3IB 3Q22A 2BOSA 3GO5A 5FOBB 3D0FA 3E3XA 2NVQB 1MI2A 1B9NA 5LHY1 1EY5A 1H9SA 4BBRG 2PZUA 4X66L 1O7YA 3SR1A 5M5WH 5FLXc 4AIMA 3RNUA 4HAEA 1QUQB 3I4NB 3UDGA 4A3KB 1OXTA 2L1BA 4RG1A 1Y8OB 4B3MQ 1NSNS 1VQJA 3HS0C 2UUBL 3BVGA 3QJYA 2K33A 4RFBA 2WKDA 2F0MA 4B3SL 4BXXH 1CKMA 4DAYB 5L37A 1JORA 3FMCA 3MXUA 3SK4A 4H13C 2X69A 4DR5L 3CQZH 1VF5C 1QB5D 2AWNA 1RTNA 4XT3B 2HIVA 1CQVA 5IYDG 1SRUA 4DV0Q 2MUYA 1X54A 1PMRA 4OO1G 1F9QA 1HPCA 3T1HQ 4KD3A 4Q0FA 2F0LA 4K0KQ 2MJ8A 3OWEB 4EQPA 1A15A 3HOUG 3TS2A 1HCZA 2EJMA 5IGCA 1PH9A 2F0NA 2LXKA 4XQNA 1XYIA 2FFKB 1TIID 3FEWX 4DF7A 1D5MC 2JQOA 4OIKA 1HZBA 3K5NA 4A3BB 4A3EB 1TXYA 4X6AH 2JA9A 1EYGA 4HEDA 5JJLA 5IGDA 4HSVA 3ULJA 3PO2B 4KHVA 1Y14B 3CPWA 1A2TA 4WRDA 3TP6A 2PNRC 5EBCA 3T13A 4DV5L 2CHBD 3QWNA 4K2LA 1HH2P 4IPDA 1PH6A 1JR0D 4DPGA 2A1AA 2KVMA 3RZDB 2UXDQ 2A69C 3EROA 1PA6A 4KN4C 3RN2A 3I91A 5LMNW 2AMCB 1C9OA 1KAAA 1N32L 2B63H 4WORA 3KJOA 2L5TA 4NDXA 2HQLA 1VQIA 1DXMA 2JA8G 1WTXA 2F0WA 5IGGA 3C1EA 5K36H 3CCEA 2JA5H 3S1MB 3CRLC 5AJ3Q 1IBKQ 3CCLA 1I4XA 1ZYRC 1K3RA 2EJGC 2K5WA 3NP8A 3J81c 1K8OA 4RKLA 1H9MA 4AQYQ 4IFDJ 5TSSA 3DEPA 2DNCA 4A93G 5IODA 4X64Q 3GTLH 2A8VA 5FLXL 2F0HA 2AWOA 5COYA 2AQ3B 3EA6A 4MIUA 4A3IG 4RMFA 1X3FA 2RVLA 1QNKA 2B2TC 4LUOA 4LF6Q 1SNOA 4K5VA 1PH8A 2SOBA 3GTOB 5E4WC 1CTMA 5JJIA 4ZQ3A 2G9HD 1BCPC 1GXDC 3TREA 2N88A 1P8LA 1B50A 2JK8A 2PQAB 5LL6X 1LABA 4GN5A 4GZYC 1F77A 1XMOL 5ISRA 3S1NH 2OTJA 3S1RB 4C3HG 5FLMG 4PNYA 2F0IA 1QG7A 1AEXA 1D1IA 4R8NA 3S15H 1V43A 4K8JA 2FXQA 2H4OA 3C46A 2K32A 5IYBG 1PYWD 1SNQA 4JI1Q 3S1QH 1BO0A 3FVQA 1VQ6A 1WJJA 4KMUC 2QEJC 3CMAA 1VQ5A 3PIOA 4GN3B 4NXMQ 1MSGA 4DV0L 4K8IA 5T1IA 4FF2A 3CP0A 4R4TA 3HOYB 4IPCA 1YNNC 1BKBA 4A3CG 2E8GA 4IOCA 2VL6A 2R7FA 5I9PA 2PMZE 4ULLA 2ZXOA 1EIFA 1TWHB 4QCLA 4Q5VA 1HR0W 1PHJA 3S2HB 3GTJH 1DGSA 4PZ8A 3AB9A 1WCMB 3K59A 2X6GA 2VUMG 3I90A 3JAMc 3A0JA 2I07B 4QF4A 1D2BA 1I6HB 3M3YB 1PRTF 3MXNA 1VQKA 1LACA 2LSSA 4TQUS 2FINB 1I4RA 4AYBB 1V9PA 2AHOB 2GVAA 1Y69U 4A4IA 1T9HA 1CKOA 1X65A 4J8QA 3I8ZA 4FP5D 1I4HA 1CA5A 4QY7A 1KLGD 3SE0A 2G5DA 2C5CA 2CWPA 3DHQA 1JC7A 3EQLC 3NWTA 1VQLA 1BQQT 3TP8A 2E2JB 3OSOA 1Z47A 1EIGA 1V8QA 3NTIA 5D3DA 4Y52H 1PDQA 1QOHA 5AJ3L 5C0XI 3T1YQ 4JBJA 2B39A 4JPBW 4JVZA 1R4PB 1GM5A 1NR2A 1NCVA 3KF8B 4XYOA 2XIWA 4AQYL 1T5EA 2N55A 1PLFA 1VQ4A 4X64L 4DK3C 1LT5D 1D5XC 1EWHA 4IUPA 1DYQA 5LMNQ 3BG3A 4K6LA 5JPMC 3MXPA 3CCSA 4LF6L 5C44H 5IYDH 3R2IA 3RLNA 4BBRB 4HIKA 2DUDA 4C1NI 4L5SA 1YHQA 4BY7H 5I9OA 4DV6L 3KBXA 5LMUQ 3VR2A 2IHEA 3FRPB 1GOZA 1I94Q 3T53B 1EY4A 3TP7A 3RR5A 3S14H 1LTBD 2MO1A 2EY5A 1EY7A 3C3LA 1L1OB 4B9WA 1VMCA 2F3WA 3H91A 4ID6A 1VQMA 1SXTA 4I65A 4RA8A 2VS1A 4KK7A 4KHZA 1TKWB 3R2TA 3OMCA 3HEJA 5EKLA 1E2VA 3G4SA 4JI3Q 2R93H 1IBLQ 4OWTB 3Q24A 2E2IB 4ZRZA 3IFTA 1STBA 4HJ7A 2VB3X 1O80A 3SHLA 2B2YC 2F52A 4NXML 2NZHA 4ZCKA 2G9DA 3IKJA 1PH1A 3HOUB 1VDZA 1YEZA 4MN3A 1NR4A 4PQXA 4A3FH 5C0XG 4GS3A 1FGUA 4AH6A 1V1PA 1FJGQ 3RZOB 1S5FD 1CQFA 1HXYD 2L15A 3SEBA 1VQAA 4AYBE 2JA8H 1Q8KA 1SFOH 2EOTA 1K83B 2NVYH 5G3LF 1F2LA 1QNUA 2NN6H 3T4AC 1ILQA 4A3MH 4A75A 1FNUA 3A55A 4F8MA 5EKIA 4OL7A 3K57A 2BA1A 1N36Q 2NVTH 1CUKA 3PMFA 3GTPB 3LGJA 1QJOA 1YNXA 2XRSD 3UI2A 2I46A 1EZ6A 1JJGA 2WB1E 1KRTA 2L12A 1GUNA 2R6GA 5GAGC 1GO3E 1WTVA 2K5QA 2E2DC 3S2DH 3W3AA 1TS3A 1H9RA 3PV0A 1KDAA 5HGQA 4PMCA 2PYKA 1K28A 4JW0A 3W2DA 4A3BG 3K7AH 1HHVA 3O13A 4H7BA 5FLMH 3S9WA 2YTVA 4A93B 1EFID 3T1YL 3HOVG 3BDLA 1E0BA 2CW0C 1I50H 1L0WA 5KEEA 4JBMA 5M5YH 5FO7B 4A3IB 4B3TQ 2B2WA 1Q1EA 2F4IA 2ZXPA 2HD3A 5LMNL 3EJIA 1ZEQX 1Q1BA 3DWPA 5KNBA 5JAVA 3H3VI 2KCCA 4A3GG 1D5ZC 1G2SA 4R1JA 3OWFA 4NP5A 3QO2A 4HIMA 2F0KA 1PTOD 3GTGB 3ZJYC 1SROA 2A6EC 1HTLD 1FGBD 5CV5A 4OIJA 4C3HB 5M3MH 4DN4M 2Z6KC 4HIDA 3STBC 2ZT9C 5NUCA 5EQ0A 3N6RA 4QUFA 1SSOA 1UEBA 2WINB 2AKWB 1JOOA 1SAPA 2PCFB 2PQEA 3N52A 5HY6A 2EXZA 2JSOA 1PFSA 1XNQQ 3SGIA 1JWSD 2EY1A 2Q8TA 4RHRA 1LTGD 4RGMA 1JE4A 5ELDA 2A6HC 1EOVA 4JI3L 3TBIB 4R4QA 4DA2A 1TVXA 4GOPC 3R3OA 3H94A 3MTSA 2WFWA 1UE7A 2YV5A 3KYHC 1IBML 1HQRD 3HOXH 1XPUA 4GLAC 3KUPA 3J80L 5ELBA 4TRDA 4G7HC 3GTKH 1TWCH 1YVCA 1MGSA 2UUCQ 1IYUA 1QILA 4UP7A 1SR3A 1K3BC 1IW7C 4DGZA 1QVFA 2JA7G 4GNXA 1FJGL 1YNJD 2D2CC 4ILWA 3I7FA 4UHVA 5CMDA 4X65L 4DV4Q 5EJWA 4A76A 1F2MA 4NW2A 2QCPX 3PIP3 4CBVA 5CORA 1W2BA 3M4OH 3TN2A 3U50C 3RLFA 1VQNA 1WTRA 1MKHA 4QL5A 3J7ZC 4M1UB 3SK6A 2VUMB 5IYCH 2YTYA 1BOSA 1SMYD 3I3CA 3GTMH 4JOIC 5J22A 1EZ8A 5C6AA 4FXKC 4NPSA 2QA4A 3NBHA 4LNQA 1C0AA 4N9TA 4ALPA 2ZTCA 1E22A 4P74A 4FNFA 4RHSA 3KF6B 4IQZA 1TS4A 4LFBL 4X3KA 2JA6H 3HOYG 5CR3A 3K5OA 1STGA 5M5XH 2YTXA 5KYIA 3AU7A 4DK6C 1LTID 3OTOL 3S16H 4WJ3M 2LXJA 1NAPA 3CC2A 1HRJA 1HR0L 1JB3A 2A5HA 4H02A 2D9UA 1XJVA 2N78A 2F0TA 1Q46A 1Z7TA 4EQ5A 4P71A 3ER0A 3DM1A 2MHVA 2J4XA 4K5XA 4XDXA 2BE5D 2EVBA 4JI8Q 1AP0A 1TY0A 1JICA 1BNZA 4YCWA 4YHHQ 1B53A 1VQHA 3E6ZX 1E2WA 1VQEA 2CH4W 2ENBA 1SE4A 3T51B 4B3TL 1EIYB 3VR3A 2K5HA 2HHHL 1NUCA 1N32Q 3SVMA 3OW7A 4UP9A 4DR2Q 2PI2E 3VDYA 1FD7D 3PUWA 1MBYA 4C3IH 1F9PA 2UUAQ 3CMEA 3TP5A 1K0SA 2EJFC 3DUZA 3TDQA 2NVQH 2VNUD 3T56B 4JK1C 1Q7YC 1B4OA 1L0YB 1AH9A 2R92G 1F2YA 2R61A 2WAQG 1GUGA 3W1BA 1CM9A 3J80i 3ONAB 3I4NH 1DONA 4N8X1 3KDFA 5J1ZA 4A3KH 2J0TD 3A8IE 2L11A 1KIXA 1N34L 4O2DA 2NWGA 3NXWA 5FJ8H 1TWFB 2F0JA 2ID0A 4O42A 3URYA 3K6OA 5C3EB 1UNSA 2NB0A 1VQOA 2LKVA 1J5EQ 2B8FA 4G4KA 2HCIA 3NELA 4BBSG 2KQ3A 2LMCB 2B3GA 1RF2D 2QDLA 4LK1C 3V05A 4CJ2C 3Q0AA 4IFDH 4ZYSA 2UUCL 3ULPA 3K5LA 1NMGA 3HOWG 1VF7A 1PVOA 3P1HA 3G7LA 1XMOQ 2ES2A 2IHFA 3MC0B 1L0XB 4LF5Q 2LFNA 4Z9CB 1Z6HA 3CCMA 2IL8A 4DV4L
chains in the Genus database with same CATH topology
1VQCA 4QIWE 4DR7L 1M1KC 4JI1L 2F4VL 5EAYA 5IYBG 3KLWA 2KHIA 2OQ0A 2Y0SG 4JI1Q 3S1QH 1WYDA 1VQ6A 3U4ZA 1L1OA 1WJJA 4A3BH 2B63G 1HZAA 4A3EH 4YWLA 1SLJA 3NBHB 1V1QA 2K4KA 3I56A 4HJ8A 4QJFA 1U5KA 3CMAA 4LF7Q 3PO2H 1UE6A 2HT1A 1VQ5A 1UE1A 3PIOA 3K7UC 1L2FA 3AFQA 4GN3B 4MTNA 1Q12A 1XMQQ 1HNXL 1VQBA 4NXMQ 2IX1A 4YWMA 2OCEA 1S3OA 2WAQE 4DV0L 2JA5G 1AE3A 4WJ3M 4GLXA 3PUVA 1X9NA 3CP0A 4R4TA 1JJ2A 4PG3A 5JJKA 3CC4A 3B6YA 2DGYA 1SMXA 4IPGA 4IPCA 2ZJRA 3J81j 5M3FG 3RZDH 2CQOA 1BKBA 4A3CG 2E8GA 4IOCA 3I4NG 4A3DH 2H5XA 3J80c 4A3KG 1QUQA 1TWAH 4HJ9A 2VL6A 1CKNB 2R7FA 5IE8A 5FJ8G 2PMZE 3CPFA 5GQOA 1PH3A 1EIFA 1OXUA 2ZJQA 2KCMA 1HR0W 3I4MH 1PHJA 5IWAL 2NN6I 4NB3A 4GNXC 4JBKA 1IL2A 4YWKA 3K80C 4LF9L 5IWAQ 3GTJH 1DGSA 4PZ8A 1GD7A 1E1OA 3PCOB 1PH7A 3F1ZA 2KBNA 3BJUA 2VUMG 4WJ4A 2CCZA 3MEFA 3S1MH 1FVIA 3A0JA 3JAMc 1YJNA 3GTQH 4JI6Q 1E7ZA 4IFDG 4JI8L 1VQKA 1XNRQ 1YBYA 5K36G 2LSSA 4YHHL 4C3JH 2K14A 4TQUS 4JC0A 4UY8C 5ELNA 3L0OA 1TWFH 1KC8C 5C4XH 1V9PA 2AHOB 2UU9Q 2C35B 2GVAA 1ASZA 2VZAA 4A4IA 4XTCS 4GLVB 2Y0SE 1T9HA 1CKOA 1X65A 2K5NA 2YYZA 1PH2A 1IZ6A 1JT8A 2RCNA 1YIJA 5C3EH 1HNZQ 4DAMA 3KF6A 4JI4Q 5E7NA 2IT1A 4MZ9A 4DR2L 1LTLA 3CXCA 3J7A5 4QY7A 4B3RQ 1Y1VH 2CWPA 1VQLA 1XPOA 2Q2TA 2VY3A 3OYYA 4OWXB 2Z6KA 2UUAL 1VS0A 4OWWB 1Z47A 3GTOH 3CCQA 1IXRA 4A3EG 2CKZB 3K81C 4LF8Q 4JI2Q 5JEAG 1U0LA 5BR8Q 4Y52H 3UDXA 1X3GA 4JI5L 5AJ3L 1UWVA 2MFIA 3PO2G 5C0XI 3PUXA 4JBJA 3T1YQ 4ME3A 1HNWQ 1GM5A 3D31A 2IY5B 2B29A 3KF8B 3S1RH 1UE5A 4AQYL 3PF4A 4A3LH 1QVCA 4JV5L 1KHIA 2CWAA 4OXPA 4L5TA 1VQ4A 4JV5Q 4X64L 4DK3C 2QGQA 4LF4L 1N33L 4TVAB 4GOPA 1N33Q 5LMNQ 2Q2UA 4LFAL 3AFPA 4L5QA 3TS0A 1SN8A 1XPRA 4P73A 4XIGS 1K8AC 3KOJA 1K9MC 1VQDA 1J5EL 3CCSA 4LF6L 5C44H 5IYDH 3RLNA 1XTDA 1HJPA 2R7DA 3I4MG 1OXVA 2V1CC 2DUDA 3U4VA 4DV2Q 5DLQE 4HIKA 4DR1L 1YHQA 1WI5A 4L5SA 1BBWA 1VCIA 3U58A 3PIPA 5LMUL 4BY7H 1KL9A 4DV1Q 4DV6L 4DR1Q 5LMUQ 1BVSA 4LWCA 4DV6Q 2BH2A 1I94L 1KD1C 4GKJQ 2IHEA 1I94Q 1NMFA 2PNHA 1ASYA 3CAMA 3RR5A 4POFA 3S14H 2MO1A 4JG2A 1PV4A 2R7ZH 3HOYH 1L1OB 1OXSC 2E5LL 2WB1G 4DNIA 4LF5L 1VQMA 3CC7A 3AEVA 4HJ5A 4JYAQ 2VS1A 4P72A 4IJLA 4KHZA 3BZCA 5C4XG 2KHJA 4JOIA 4JI0Q 2ASBA 1TWHH 1J6QA 3G4SA 1IBLL 1Q86C 4JI3Q 1I5FA 2GVBA 2R93H 4LFCL 1IBLQ 1B7YB 4OWTB 3S2HH 1X3EA 2Q2HA 4LFCQ 2ZJPA 1RIPA 5IP7H 1TWGH 1WCMH 1E24A 1Y1VG 4LF7L 1MJCA 4HJ7A 4GKKL 5H1SE 4X66Q 2RF4A 2PI2A 3M85A 3HOVH 1H95A 3BZKA 1BBUA 4HIOA 4FDBA 2F52A 4GKKQ 2ZTDA 4NXML 1XMQL 2NZHA 1PH1A 4PZ7A 1I6HH 1EFWA 3M3YH 1YEZA 1Q81C 4A3FH 1HZ9A 5C0XG 1SE8A 1LUZA 2Z0SA 4GS3A 1FGUA 2N8NA 1NTGA 4AH6A 4A3JG 1FJGQ 3GDEA 1S40A 1A0IA 3F2CA 2UUBQ 3W1GA 4EX5A 2L15A 1VQAA 4GN4B 4R4IA 4AYBE 1W3SA 1MJEA 2NVXH 4B3SQ 1YI2A 2JA8H 2JJQA 1Q8KA 1D8LA 4A3GH 3PGZA 4DV3Q 1SFOH 2ZM6Q 4OONA 2NVYH 4KHPL 2VQEQ 3S24A 1N9WA 4DR5Q 4KHPQ 2GN5A 3MXNB 2E2JH 1EQQA 1K0RA 5C44G 4A3MH 4QGUA 4A75A 2MNAA 1L1OC 1A63A 1N36L 3M4QA 1YHBA 4BY7G 2BA1A 4LW1A 1N36Q 2EQSA 4L5RC 2NVTH 3H0GH 1CUKA 3LGJA 1YNXA 4JI6L 1QVGA 4YCUA 4DUZL 1FL0A 1XNRL 1JJGA 2UXBQ 2WB1E 3A5ZB 2WP8J 2R6GA 4O0AA 1KRTA 4DUZQ 1YJ9A 4P75A 3S17H 5C0XJ 5GAGC 3I4OA 1GO3E 3HOZG 1N8RC 3BU2A 2UU9L 3UDFA 2K50A 3CCJA 1R9TH 3S2DH 3K0XA 1MIUA 1HNZL 2OTLA 4JI4L 3PUZA 1VQ9A 3PV0A 5GROA 4YY3L 1CKNA 1K8GA 4B3RL 1PYBA 5GADC 1LYLA 4Y7NH 4YY3Q 3F2DA 3M7NA 4BBRH 2R93G 2D0PA 5HGQA 3EBEA 3G6EA 1GVPA 2EXDA 4A3BG 1PH5A 3K7AH 3OW2A 4LF8L 4JI2L 5IP7G 4MNOA 3KDFB 5FLMH 3ICEA 2N49A 1B70B 1WCMG 2YTVA 5IP9H 5BR8L 4DV5Q 1JJCB 3AYHB 2XGTA 2KENA 4GOPB 4POGA 3KFUA 1WOCA 3T1YL 2JA7H 3HOVG 2K52A 1HNWL 2ZTEA 3G48A 3TEHB 3UE1A 1I50H 2ALYB 3E0EA 3IRBA 1S72A 1JB7A 3FP9A 3M9BA 1L0WA 4JBMA 5M5YH 4A3FG 4R4OA 4NXNL 4B3TQ 1B8AA 1E3PA 1Q1EA 3EIVA 5IT9c 3PF5A 1VQFA 4PMWA 4NXNQ 3JC66 3ULLA 3H15A 5LMNL 3AQQA 3STBD 4KI0A 1Y1WH 2I5HA 1Q1BA 4AYBG 4IO9A 2N3SA 4A3DG 2RHQB 2K75A 3H3VH 1WFQA 3E9IA 3H3VI 4A3GG 4R1JA 2E2IH 1LM0A 1OXXK 4HIMA 4DV2L 5IY0A 2A19A 1A8VA 2NN6G 3ZJYC 4OO1I 4DV1L 4HJAA 3HKSA 1SROA 4DV7L 1KXLA 1GKHA 4DV7Q 4A3MG 4GKJL 4LUZA 5M3MH 1I3QH 4KLKA 5GAEC 4DR3L 4QQBX 3HOUH 2Z6KC 4HIDA 3STBC 2OQKA 1KQSA 4DR3Q 3CD6A 1E1TA 1NBWA 3A74A 2JE6I 1X55A 1UEBA 3A5UA 2AKWB 4OX9Q 1EUJA 2OWOA 5HY6A 1PH4A 1XNQL 4C2MH 3FKIH 3PUYA 2QEXA 3F2BA 1PFSA 4JYAL 1XNQQ 3SGIA 4BY1H 3CW2C 5GAHC 4BA2I 1VQGA 3I2ZA 1YHAA 3PO3H 1EQRA 4APVA 4DKAC 2Q2IA 4DUYQ 1K73C 1JMCA 4JI0L 1EOVA 1K83H 4JI3L 1RL2A 4R4QA 3NENA 4GOPC 3GO5A 1A62A 3D0FA 3EN2A 5C3EG 2WFWA 1UE7A 2YV5A 3KYHC 3CF5A 1IBML 3HOXH 1XPUA 4GLAC 2ATWA 4IFDI 1IBMQ 1P16A 4BBRG 3GTKH 4X66L 1TWCH 1YVCA 5M5WH 5FLXc 2UUCQ 4AIMA 2YU9H 3RNUA 3K8AA 4UP7A 1QZHA 1SR3A 3GTPH 1QUQB 3UDGA 2KCTA 1OXTA 4RG1A 4B3ML 1QVFA 2JA7G 2UXCQ 4GNXA 4B3MQ 1FJGL 1VQJA 3I7FA 4X65L 4DV4Q 2PQAA 2CFMA 2UUBL 4A76A 4DR7Q 4X65Q 2F4VQ 4A3LG 3HFZB 4B3SL 1W2BA 3NEMA 3M4OH 4BXXH 1CKMA 3HKZE 3U50C 3RLFA 4DAYB 1OTCA 4DV3L 1VQNA 1YJWA 1MKHA 2ZM6L 4QL5A 3J7ZC 1Y1WG 2VQEL 5IYCH 4DR5L 2YTYA 3CQZH 2AWNA 5ELOA 3DLLA 2R92H 3J81i 4JOIC 3GTMH 2HIVA 1HNXQ 1VQ7A 5IYDG 1SRUA 4DV0Q 4NPSA 1X54A 3T1HL 4OO1G 2QA4A 3T1HQ 4LNQA 4A93H 2MQHA 4K0KL 2XTIA 1C7YA 1C0AA 4K0KQ 3GD7A 3I55A 4ALPA 4BA1I 2ZTCA 1E22A 5M3MG 4P74A 1CSQA 3HOUG 3TS2A 1PH9A 2UXBL 3KF6B 2LXKA 1YITA 1D7QA 2VQFL 4A3IH 4LFBL 2JA6H 3HOYG 2R7ZG 4JBWA 2VQFQ 2F3IA 1VQ8A 4LFBQ 1JE5A 5M5XH 2YTXA 3FKIG 2JQOA 4BBSH 1HZBA 4DK6C 3OTOL 1AE2A 4BY1G 3S16H 2LXJA 2VW9A 4LF9Q 4UPAA 3CC2A 1TXYA 3PO3G 3OTOQ 4X6AH 2JA9A 4JCVE 2D62A 4H02A 1G51A 1EYGA 1HR0L 5JJLA 1XJVA 3ULJA 1HR0Q 2I5MX 3L7ZC 2N78A 1Y14B 3CPWA 1Q46A 2NZOA 2I5LX 3GTGH 3HOWH 4EQ5A 4P71A 1Q82C 3ER0A 3L2PA 3HOXG 4C3HH 4DV5L 1KAWA 2RHSB 3TQYA 4JI8Q 2UXDL 1CSPA 1HH2P 4IPDA 1PH6A 4DPGA 3KJPA 2A1AA 4YCWA 4YHHQ 3CCUA 2UXDQ 1VQHA 1PA6A 4IPHA 5J3BA 1VQEA 5IYBH 3RN2A 3UDIA 5LMNW 2AMCB 1C9OA 4B3TL 1EIYB 1N32L 2K5HA 1QZGA 2HHHL 2B63H 1N32Q 3PSIA 3KJOA 2HHHQ 1HZCA 4UP9A 4IJHA 5C4JH 4DR2Q 2PI2E 3VDYA 3PUWA 2K5VA 2HQLA 3HKZG 1VQIA 1NY4A 4C3IH 2UUAQ 4BXXG 3CMEA 2IX0A 2JA8G 2E2HH 2NVQH 2VNUD 2JEBI 1Q7YC 3CCEA 5IYCG 2JA5H 1IBKL 1AH9A 3RLOA 5AJ3Q 1IBKQ 3CCLA 4JI5Q 4A3JH 2R92G 1IYJB 3UE0A 5M3FH 2WAQG 1K3RA 4PZ6A 3W1BA 2JEAI 3DM3A 3J80i 3J81c 1PYSB 4A3CH 3WWVA 4AQYQ 3I4NH 4IFDJ 3KDFA 4A3KH 1KIXA 4A93G 4R4CA 3CCVA 1N34L 4O2DA 3CCRA 4X64Q 2D0OA 5FJ8H 4LF4Q 2ID0A 3H0GG 4J15A 1N34Q 3GTLH 2BH8A 4OX9L 4JI7L 1M90C 2A8VA 4UP8A 4LFAQ 2AWOA 3RZOH 4JI7Q 2I0QA 3Q8DA 2MO0A 4A3IG 4RMFA 1X3FA 1VQOA 4YCVA 2JA6G 4DUYL 1J5EQ 3TRZA 4LUOA 4LF6Q 1G6PA 3NELA 1PH8A 2VUMH 4BBSG 3JAMi 4DR6L 3G71A 4DR4L 4DR6Q 2B3GA 3RN5A 5JJIA 1G291 4DR4Q 3TREA 3F8TA 1EWIA 1X56A 4GNXB 2EIFA 1X6OA 1P8LA 1NJIC 5JEAJ 2JK8A 2PQAB 4GN5A 2UUCL 3ULPA 1NMGA 3ERSX 3M4PA 4X62L 1NE3A 3HOWG 1Z9FA 1PVOA 1XMOL 3S1NH 2OTJA 3FHWA 1KRSA 1YZ6A 4X62Q 3HOZH 2BA0A 2HIXA 1XMOQ 2ES2A 2IHFA 5FLMG 5IP9G 2E5LQ 1VQPA 4LF5Q 3S15H 4IOAA 1V43A 3W5OA 3CCMA 2UXCL 3E9HA 4LUVA 4DV4L 1O7IA 2FXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQC A;  4QIW E;  4DR7 L;  1M1K C;  4JI1 L;  2F4V L;  5EAY A;  5IYB G;  3KLW A;  2KHI A;  2OQ0 A;  2Y0S G;  4JI1 Q;  3S1Q H;  1WYD A;  1VQ6 A;  3U4Z A;  1L1O A;  1WJJ A;  4A3B H;  2B63 G;  1HZA A;  4A3E H;  4YWL A;  1SLJ A;  3NBH B;  1V1Q A;  2K4K A;  3I56 A;  4HJ8 A;  4QJF A;  1U5K A;  3CMA A;  4LF7 Q;  3PO2 H;  1UE6 A;  2HT1 A;  1VQ5 A;  1UE1 A;  3PIO A;  3K7U C;  1L2F A;  3AFQ A;  4GN3 B;  4MTN A;  1Q12 A;  1XMQ Q;  1HNX L;  1VQB A;  4NXM Q;  2IX1 A;  4YWM A;  2OCE A;  1S3O A;  2WAQ E;  4DV0 L;  2JA5 G;  1AE3 A;  4WJ3 M;  4GLX A;  3PUV A;  1X9N A;  3CP0 A;  4R4T A;  1JJ2 A;  4PG3 A;  5JJK A;  3CC4 A;  3B6Y A;  2DGY A;  1SMX A;  4IPG A;  4IPC A;  2ZJR A;  3J81 j;  5M3F G;  3RZD H;  2CQO A;  1BKB A;  4A3C G;  2E8G A;  4IOC A;  3I4N G;  4A3D H;  2H5X A;  3J80 c;  4A3K G;  1QUQ A;  1TWA H;  4HJ9 A;  2VL6 A;  1CKN B;  2R7F A;  5IE8 A;  5FJ8 G;  2PMZ E;  3CPF A;  5GQO A;  1PH3 A;  1EIF A;  1OXU A;  2ZJQ A;  2KCM A;  1HR0 W;  3I4M H;  1PHJ A;  5IWA L;  2NN6 I;  4NB3 A;  4GNX C;  4JBK A;  1IL2 A;  4YWK A;  3K80 C;  4LF9 L;  5IWA Q;  3GTJ H;  1DGS A;  4PZ8 A;  1GD7 A;  1E1O A;  3PCO B;  1PH7 A;  3F1Z A;  2KBN A;  3BJU A;  2VUM G;  4WJ4 A;  2CCZ A;  3MEF A;  3S1M H;  1FVI A;  3A0J A;  3JAM c;  1YJN A;  3GTQ H;  4JI6 Q;  1E7Z A;  4IFD G;  4JI8 L;  1VQK A;  1XNR Q;  1YBY A;  5K36 G;  2LSS A;  4YHH L;  4C3J H;  2K14 A;  4TQU S;  4JC0 A;  4UY8 C;  5ELN A;  3L0O A;  1TWF H;  1KC8 C;  5C4X H;  1V9P A;  2AHO B;  2UU9 Q;  2C35 B;  2GVA A;  1ASZ A;  2VZA A;  4A4I A;  4XTC S;  4GLV B;  2Y0S E;  1T9H A;  1CKO A;  1X65 A;  2K5N A;  2YYZ A;  1PH2 A;  1IZ6 A;  1JT8 A;  2RCN A;  1YIJ A;  5C3E H;  1HNZ Q;  4DAM A;  3KF6 A;  4JI4 Q;  5E7N A;  2IT1 A;  4MZ9 A;  4DR2 L;  1LTL A;  3CXC A;  3J7A 5;  4QY7 A;  4B3R Q;  1Y1V H;  2CWP A;  1VQL A;  1XPO A;  2Q2T A;  2VY3 A;  3OYY A;  4OWX B;  2Z6K A;  2UUA L;  1VS0 A;  4OWW B;  1Z47 A;  3GTO H;  3CCQ A;  1IXR A;  4A3E G;  2CKZ B;  3K81 C;  4LF8 Q;  4JI2 Q;  5JEA G;  1U0L A;  5BR8 Q;  4Y52 H;  3UDX A;  1X3G A;  4JI5 L;  5AJ3 L;  1UWV A;  2MFI A;  3PO2 G;  5C0X I;  3PUX A;  4JBJ A;  3T1Y Q;  4ME3 A;  1HNW Q;  1GM5 A;  3D31 A;  2IY5 B;  2B29 A;  3KF8 B;  3S1R H;  1UE5 A;  4AQY L;  3PF4 A;  4A3L H;  1QVC A;  4JV5 L;  1KHI A;  2CWA A;  4OXP A;  4L5T A;  1VQ4 A;  4JV5 Q;  4X64 L;  4DK3 C;  2QGQ A;  4LF4 L;  1N33 L;  4TVA B;  4GOP A;  1N33 Q;  5LMN Q;  2Q2U A;  4LFA L;  3AFP A;  4L5Q A;  3TS0 A;  1SN8 A;  1XPR A;  4P73 A;  4XIG S;  1K8A C;  3KOJ A;  1K9M C;  1VQD A;  1J5E L;  3CCS A;  4LF6 L;  5C44 H;  5IYD H;  3RLN A;  1XTD A;  1HJP A;  2R7D A;  3I4M G;  1OXV A;  2V1C C;  2DUD A;  3U4V A;  4DV2 Q;  5DLQ E;  4HIK A;  4DR1 L;  1YHQ A;  1WI5 A;  4L5S A;  1BBW A;  1VCI A;  3U58 A;  3PIP A;  5LMU L;  4BY7 H;  1KL9 A;  4DV1 Q;  4DV6 L;  4DR1 Q;  5LMU Q;  1BVS A;  4LWC A;  4DV6 Q;  2BH2 A;  1I94 L;  1KD1 C;  4GKJ Q;  2IHE A;  1I94 Q;  1NMF A;  2PNH A;  1ASY A;  3CAM A;  3RR5 A;  4POF A;  3S14 H;  2MO1 A;  4JG2 A;  1PV4 A;  2R7Z H;  3HOY H;  1L1O B;  1OXS C;  2E5L L;  2WB1 G;  4DNI A;  4LF5 L;  1VQM A;  3CC7 A;  3AEV A;  4HJ5 A;  4JYA Q;  2VS1 A;  4P72 A;  4IJL A;  4KHZ A;  3BZC A;  5C4X G;  2KHJ A;  4JOI A;  4JI0 Q;  2ASB A;  1TWH H;  1J6Q A;  3G4S A;  1IBL L;  1Q86 C;  4JI3 Q;  1I5F A;  2GVB A;  2R93 H;  4LFC L;  1IBL Q;  1B7Y B;  4OWT B;  3S2H H;  1X3E A;  2Q2H A;  4LFC Q;  2ZJP A;  1RIP A;  5IP7 H;  1TWG H;  1WCM H;  1E24 A;  1Y1V G;  4LF7 L;  1MJC A;  4HJ7 A;  4GKK L;  5H1S E;  4X66 Q;  2RF4 A;  2PI2 A;  3M85 A;  3HOV H;  1H95 A;  3BZK A;  1BBU A;  4HIO A;  4FDB A;  2F52 A;  4GKK Q;  2ZTD A;  4NXM L;  1XMQ L;  2NZH A;  1PH1 A;  4PZ7 A;  1I6H H;  1EFW A;  3M3Y H;  1YEZ A;  1Q81 C;  4A3F H;  1HZ9 A;  5C0X G;  1SE8 A;  1LUZ A;  2Z0S A;  4GS3 A;  1FGU A;  2N8N A;  1NTG A;  4AH6 A;  4A3J G;  1FJG Q;  3GDE A;  1S40 A;  1A0I A;  3F2C A;  2UUB Q;  3W1G A;  4EX5 A;  2L15 A;  1VQA A;  4GN4 B;  4R4I A;  4AYB E;  1W3S A;  1MJE A;  2NVX H;  4B3S Q;  1YI2 A;  2JA8 H;  2JJQ A;  1Q8K A;  1D8L A;  4A3G H;  3PGZ A;  4DV3 Q;  1SFO H;  2ZM6 Q;  4OON A;  2NVY H;  4KHP L;  2VQE Q;  3S24 A;  1N9W A;  4DR5 Q;  4KHP Q;  2GN5 A;  3MXN B;  2E2J H;  1EQQ A;  1K0R A;  5C44 G;  4A3M H;  4QGU A;  4A75 A;  2MNA A;  1L1O C;  1A63 A;  1N36 L;  3M4Q A;  1YHB A;  4BY7 G;  2BA1 A;  4LW1 A;  1N36 Q;  2EQS A;  4L5R C;  2NVT H;  3H0G H;  1CUK A;  3LGJ A;  1YNX A;  4JI6 L;  1QVG A;  4YCU A;  4DUZ L;  1FL0 A;  1XNR L;  1JJG A;  2UXB Q;  2WB1 E;  3A5Z B;  2WP8 J;  2R6G A;  4O0A A;  1KRT A;  4DUZ Q;  1YJ9 A;  4P75 A;  3S17 H;  5C0X J;  5GAG C;  3I4O A;  1GO3 E;  3HOZ G;  1N8R C;  3BU2 A;  2UU9 L;  3UDF A;  2K50 A;  3CCJ A;  1R9T H;  3S2D H;  3K0X A;  1MIU A;  1HNZ L;  2OTL A;  4JI4 L;  3PUZ A;  1VQ9 A;  3PV0 A;  5GRO A;  4YY3 L;  1CKN A;  1K8G A;  4B3R L;  1PYB A;  5GAD C;  1LYL A;  4Y7N H;  4YY3 Q;  3F2D A;  3M7N A;  4BBR H;  2R93 G;  2D0P A;  5HGQ A;  3EBE A;  3G6E A;  1GVP A;  2EXD A;  4A3B G;  1PH5 A;  3K7A H;  3OW2 A;  4LF8 L;  4JI2 L;  5IP7 G;  4MNO A;  3KDF B;  5FLM H;  3ICE A;  2N49 A;  1B70 B;  1WCM G;  2YTV A;  5IP9 H;  5BR8 L;  4DV5 Q;  1JJC B;  3AYH B;  2XGT A;  2KEN A;  4GOP B;  4POG A;  3KFU A;  1WOC A;  3T1Y L;  2JA7 H;  3HOV G;  2K52 A;  1HNW L;  2ZTE A;  3G48 A;  3TEH B;  3UE1 A;  1I50 H;  2ALY B;  3E0E A;  3IRB A;  1S72 A;  1JB7 A;  3FP9 A;  3M9B A;  1L0W A;  4JBM A;  5M5Y H;  4A3F G;  4R4O A;  4NXN L;  4B3T Q;  1B8A A;  1E3P A;  1Q1E A;  3EIV A;  5IT9 c;  3PF5 A;  1VQF A;  4PMW A;  4NXN Q;  3JC6 6;  3ULL A;  3H15 A;  5LMN L;  3AQQ A;  3STB D;  4KI0 A;  1Y1W H;  2I5H A;  1Q1B A;  4AYB G;  4IO9 A;  2N3S A;  4A3D G;  2RHQ B;  2K75 A;  3H3V H;  1WFQ A;  3E9I A;  3H3V I;  4A3G G;  4R1J A;  2E2I H;  1LM0 A;  1OXX K;  4HIM A;  4DV2 L;  5IY0 A;  2A19 A;  1A8V A;  2NN6 G;  3ZJY C;  4OO1 I;  4DV1 L;  4HJA A;  3HKS A;  1SRO A;  4DV7 L;  1KXL A;  1GKH A;  4DV7 Q;  4A3M G;  4GKJ L;  4LUZ A;  5M3M H;  1I3Q H;  4KLK A;  5GAE C;  4DR3 L;  4QQB X;  3HOU H;  2Z6K C;  4HID A;  3STB C;  2OQK A;  1KQS A;  4DR3 Q;  3CD6 A;  1E1T A;  1NBW A;  3A74 A;  2JE6 I;  1X55 A;  1UEB A;  3A5U A;  2AKW B;  4OX9 Q;  1EUJ A;  2OWO A;  5HY6 A;  1PH4 A;  1XNQ L;  4C2M H;  3FKI H;  3PUY A;  2QEX A;  3F2B A;  1PFS A;  4JYA L;  1XNQ Q;  3SGI A;  4BY1 H;  3CW2 C;  5GAH C;  4BA2 I;  1VQG A;  3I2Z A;  1YHA A;  3PO3 H;  1EQR A;  4APV A;  4DKA C;  2Q2I A;  4DUY Q;  1K73 C;  1JMC A;  4JI0 L;  1EOV A;  1K83 H;  4JI3 L;  1RL2 A;  4R4Q A;  3NEN A;  4GOP C;  3GO5 A;  1A62 A;  3D0F A;  3EN2 A;  5C3E G;  2WFW A;  1UE7 A;  2YV5 A;  3KYH C;  3CF5 A;  1IBM L;  3HOX H;  1XPU A;  4GLA C;  2ATW A;  4IFD I;  1IBM Q;  1P16 A;  4BBR G;  3GTK H;  4X66 L;  1TWC H;  1YVC A;  5M5W H;  5FLX c;  2UUC Q;  4AIM A;  2YU9 H;  3RNU A;  3K8A A;  4UP7 A;  1QZH A;  1SR3 A;  3GTP H;  1QUQ B;  3UDG A;  2KCT A;  1OXT A;  4RG1 A;  4B3M L;  1QVF A;  2JA7 G;  2UXC Q;  4GNX A;  4B3M Q;  1FJG L;  1VQJ A;  3I7F A;  4X65 L;  4DV4 Q;  2PQA A;  2CFM A;  2UUB L;  4A76 A;  4DR7 Q;  4X65 Q;  2F4V Q;  4A3L G;  3HFZ B;  4B3S L;  1W2B A;  3NEM A;  3M4O H;  4BXX H;  1CKM A;  3HKZ E;  3U50 C;  3RLF A;  4DAY B;  1OTC A;  4DV3 L;  1VQN A;  1YJW A;  1MKH A;  2ZM6 L;  4QL5 A;  3J7Z C;  1Y1W G;  2VQE L;  5IYC H;  4DR5 L;  2YTY A;  3CQZ H;  2AWN A;  5ELO A;  3DLL A;  2R92 H;  3J81 i;  4JOI C;  3GTM H;  2HIV A;  1HNX Q;  1VQ7 A;  5IYD G;  1SRU A;  4DV0 Q;  4NPS A;  1X54 A;  3T1H L;  4OO1 G;  2QA4 A;  3T1H Q;  4LNQ A;  4A93 H;  2MQH A;  4K0K L;  2XTI A;  1C7Y A;  1C0A A;  4K0K Q;  3GD7 A;  3I55 A;  4ALP A;  4BA1 I;  2ZTC A;  1E22 A;  5M3M G;  4P74 A;  1CSQ A;  3HOU G;  3TS2 A;  1PH9 A;  2UXB L;  3KF6 B;  2LXK A;  1YIT A;  1D7Q A;  2VQF L;  4A3I H;  4LFB L;  2JA6 H;  3HOY G;  2R7Z G;  4JBW A;  2VQF Q;  2F3I A;  1VQ8 A;  4LFB Q;  1JE5 A;  5M5X H;  2YTX A;  3FKI G;  2JQO A;  4BBS H;  1HZB A;  4DK6 C;  3OTO L;  1AE2 A;  4BY1 G;  3S16 H;  2LXJ A;  2VW9 A;  4LF9 Q;  4UPA A;  3CC2 A;  1TXY A;  3PO3 G;  3OTO Q;  4X6A H;  2JA9 A;  4JCV E;  2D62 A;  4H02 A;  1G51 A;  1EYG A;  1HR0 L;  5JJL A;  1XJV A;  3ULJ A;  1HR0 Q;  2I5M X;  3L7Z C;  2N78 A;  1Y14 B;  3CPW A;  1Q46 A;  2NZO A;  2I5L X;  3GTG H;  3HOW H;  4EQ5 A;  4P71 A;  1Q82 C;  3ER0 A;  3L2P A;  3HOX G;  4C3H H;  4DV5 L;  1KAW A;  2RHS B;  3TQY A;  4JI8 Q;  2UXD L;  1CSP A;  1HH2 P;  4IPD A;  1PH6 A;  4DPG A;  3KJP A;  2A1A A;  4YCW A;  4YHH Q;  3CCU A;  2UXD Q;  1VQH A;  1PA6 A;  4IPH A;  5J3B A;  1VQE A;  5IYB H;  3RN2 A;  3UDI A;  5LMN W;  2AMC B;  1C9O A;  4B3T L;  1EIY B;  1N32 L;  2K5H A;  1QZG A;  2HHH L;  2B63 H;  1N32 Q;  3PSI A;  3KJO A;  2HHH Q;  1HZC A;  4UP9 A;  4IJH A;  5C4J H;  4DR2 Q;  2PI2 E;  3VDY A;  3PUW A;  2K5V A;  2HQL A;  3HKZ G;  1VQI A;  1NY4 A;  4C3I H;  2UUA Q;  4BXX G;  3CME A;  2IX0 A;  2JA8 G;  2E2H H;  2NVQ H;  2VNU D;  2JEB I;  1Q7Y C;  3CCE A;  5IYC G;  2JA5 H;  1IBK L;  1AH9 A;  3RLO A;  5AJ3 Q;  1IBK Q;  3CCL A;  4JI5 Q;  4A3J H;  2R92 G;  1IYJ B;  3UE0 A;  5M3F H;  2WAQ G;  1K3R A;  4PZ6 A;  3W1B A;  2JEA I;  3DM3 A;  3J80 i;  3J81 c;  1PYS B;  4A3C H;  3WWV A;  4AQY Q;  3I4N H;  4IFD J;  3KDF A;  4A3K H;  1KIX A;  4A93 G;  4R4C A;  3CCV A;  1N34 L;  4O2D A;  3CCR A;  4X64 Q;  2D0O A;  5FJ8 H;  4LF4 Q;  2ID0 A;  3H0G G;  4J15 A;  1N34 Q;  3GTL H;  2BH8 A;  4OX9 L;  4JI7 L;  1M90 C;  2A8V A;  4UP8 A;  4LFA Q;  2AWO A;  3RZO H;  4JI7 Q;  2I0Q A;  3Q8D A;  2MO0 A;  4A3I G;  4RMF A;  1X3F A;  1VQO A;  4YCV A;  2JA6 G;  4DUY L;  1J5E Q;  3TRZ A;  4LUO A;  4LF6 Q;  1G6P A;  3NEL A;  1PH8 A;  2VUM H;  4BBS G;  3JAM i;  4DR6 L;  3G71 A;  4DR4 L;  4DR6 Q;  2B3G A;  3RN5 A;  5JJI A;  1G29 1;  4DR4 Q;  3TRE A;  3F8T A;  1EWI A;  1X56 A;  4GNX B;  2EIF A;  1X6O A;  1P8L A;  1NJI C;  5JEA J;  2JK8 A;  2PQA B;  4GN5 A;  2UUC L;  3ULP A;  1NMG A;  3ERS X;  3M4P A;  4X62 L;  1NE3 A;  3HOW G;  1Z9F A;  1PVO A;  1XMO L;  3S1N H;  2OTJ A;  3FHW A;  1KRS A;  1YZ6 A;  4X62 Q;  3HOZ H;  2BA0 A;  2HIX A;  1XMO Q;  2ES2 A;  2IHF A;  5FLM G;  5IP9 G;  2E5L Q;  1VQP A;  4LF5 Q;  3S15 H;  4IOA A;  1V43 A;  3W5O A;  3CCM A;  2UXC L;  3E9H A;  4LUV A;  4DV4 L;  1O7I A;  2FXQ A; 
#chains in the Genus database with same CATH topology
 5CV9 A;  5EAY A;  3I72 A;  4A3B H;  3FDT A;  1HZA A;  4A3E H;  5DNF A;  4YWL A;  2OEO A;  3R93 A;  4TKO B;  2L9H A;  4QJF A;  3PO2 H;  1CT1 D;  1STN A;  4KD4 A;  2HT1 A;  1G91 A;  1I3Q B;  1L2F A;  3AFQ A;  1Q12 A;  4EGV A;  1VQB A;  3RD4 A;  2A68 D;  2RSO A;  5JJK A;  1SE3 A;  2L0C A;  3NBI A;  5M3F G;  1SMX A;  4IPG A;  2ZJR A;  1HA6 A;  3J81 j;  2WAC A;  3RZD H;  4C2M B;  3NHH A;  5KND A;  3VR5 A;  1QUQ A;  4HJ9 A;  2HDM A;  3CPF A;  1PH3 A;  1H9J A;  1W6J A;  2ZJQ A;  4LAA A;  2HQE A;  5FK9 C;  2NN6 I;  5IWA L;  1IL2 A;  1J8I A;  4YWK A;  5CV8 A;  3D4W A;  1E1O A;  1D1K A;  1PH7 A;  2KBN A;  4G7Z C;  4IZ8 A;  1R4Q B;  3HOV B;  3S1M H;  5IT9 L;  4EQO A;  1E7Z A;  3D4D A;  4JI8 L;  1ILP A;  3OOC A;  1YBY A;  4RGT A;  2JP1 A;  4YHH L;  2K05 A;  1EU4 A;  4FYD A;  3HKZ B;  5IGB A;  2UU9 Q;  1ASZ A;  3KLR A;  4XTC S;  2Y0S E;  2K5N A;  2YYZ A;  4A3G B;  1YIJ A;  1HNZ Q;  3KLS A;  1M4V A;  2DN8 A;  2IT1 A;  2EYH A;  2PO4 A;  1DJR D;  4DR2 L;  3J7A 5;  2VY3 A;  3OYY A;  2UUA L;  1RCV D;  3GTO H;  4ODG A;  3P75 A;  2CH4 A;  3BVZ A;  1ET6 A;  4JI2 Q;  4DXF A;  3H09 A;  5JEA G;  1U0L A;  4CJ0 B;  1V1O A;  3F2U A;  3UDX A;  4DAP A;  1UWV A;  3H0G B;  3PUX A;  3M7G A;  1KNE A;  1LO5 D;  2SNS A;  1I4P A;  5F2D A;  3S1R H;  3PF4 A;  1QVC A;  4JV5 L;  4OXP A;  1LTS D;  3MA2 B;  1N33 L;  1RHP A;  2KED A;  1PRT C;  3C1F A;  3AFP A;  1A2U A;  1B3A A;  4UDU C;  4L5Q A;  1SN8 A;  1XPR A;  3KOJ A;  1LTA D;  1K9M C;  1VQD A;  1J5E L;  5LL6 S;  2R7D A;  1HJP A;  1Y8N B;  3I4M G;  4PMB A;  3ERQ A;  5DLQ E;  4DR1 L;  1WI5 A;  2HUG A;  2JN4 A;  4LJZ C;  1BVS A;  4LWC A;  4DV6 Q;  2ICI A;  1KD1 C;  3J7A V;  2JA7 B;  2NZ1 D;  2PNH A;  4EQN A;  1ASY A;  2VB2 X;  3CAM A;  5JJZ A;  4IUV A;  2F0G A;  4JG2 A;  3HOY H;  5KIX A;  4FXD A;  4LF5 L;  2B63 B;  4G7O C;  4HJ5 A;  4C3J G;  4JYA Q;  1PFB A;  5CV7 A;  2PPB C;  3BZC A;  5C4X G;  2JXM B;  2KHJ A;  2ASB A;  1TWH H;  1J6Q A;  3RUZ A;  1I5F A;  2GVB A;  4LFC L;  1B7Y B;  1XXG A;  1BUV T;  2Q2H A;  3S2H H;  5IP7 H;  1WCM H;  1E24 A;  1Y1V G;  2EZV A;  4GKK L;  3BZK A;  2ZTD A;  4PZ7 A;  1I6H H;  5BN5 A;  3M3Y H;  1CI3 M;  3GTL B;  1SE8 A;  2N8N A;  5DEH A;  1S40 A;  2WKC A;  4EX5 A;  5IGF A;  4GN4 B;  1HUM A;  2JJQ A;  3DXJ C;  3PGZ A;  4DV3 Q;  1LLR D;  4OON A;  4KHP L;  4C56 C;  4NKL A;  4L6T B;  2GN5 A;  3MXN B;  2E2J H;  1EQQ A;  1KDC A;  1WD0 A;  1PRT B;  4E6I A;  2MNA A;  1L1O C;  2MPM A;  1X3P A;  1YHB A;  2YU9 B;  4LW1 A;  2QKI C;  3S15 B;  1EYC A;  1QVG A;  5FO9 B;  4YCU A;  1FL0 A;  2IWH A;  2UXB Q;  2QIL A;  1EOT A;  2F1M A;  2D5D A;  4P75 A;  1RKN A;  1RTO A;  2UU9 L;  1DZ1 A;  3PIO 3;  1HNZ L;  2OTL A;  2F3V A;  5I2Y A;  5CV6 A;  3J81 L;  1VQ9 A;  2OXP A;  1PYB A;  5GAD C;  1LYL A;  1PTO B;  3F2D A;  4BBR H;  2D0P A;  3G6E A;  2Z8L A;  2R92 B;  1GVP A;  2PZT A;  2WAQ B;  1Q90 A;  4JI2 L;  1H9K A;  1B70 B;  3AYH B;  2KEN A;  1EY9 A;  1FYC A;  1PTO F;  4RWS C;  2ZTE A;  2AQ1 B;  5DAU A;  2ALY B;  3IRB A;  1SNC A;  2B2T A;  1ML0 D;  4IUU A;  4HR7 B;  2B2V C;  1O7L A;  4PMW A;  4EVO A;  2KEC A;  3JC6 6;  4BBS B;  2K5D A;  1PZJ D;  3A54 A;  2N3S A;  1EQT A;  1EY6 A;  1WTQ A;  5ELF A;  3E9I A;  5C5L A;  2EYJ A;  2E2I H;  1BDO A;  3HOW B;  4OO1 H;  4I7A A;  3D6C A;  4HJA A;  4DV7 L;  1KXL A;  2RQX A;  4KLK A;  4DR3 L;  3HOU H;  4F7X A;  2OQK A;  1KQS A;  1A6X A;  4DNR B;  1E1T A;  1NBW A;  2FJ2 A;  2JE6 I;  3A5U A;  1IHZ A;  1EUJ A;  2OWO A;  4IN3 A;  2J7Z A;  2K6A A;  2PW5 A;  4K14 A;  3J7Y W;  3T16 A;  2KJX A;  3PUY A;  2QEX A;  3F2B A;  4JYA L;  1SYC A;  2SEB D;  4V0B A;  1YHA A;  3ND9 A;  3IL8 A;  3GQB A;  2EYP A;  5C4J B;  1K83 H;  2AUJ D;  3HP3 A;  2E2H B;  2F0S A;  1A62 A;  5C3E G;  3CF5 A;  2E76 C;  2ATW A;  1V1P B;  3KK7 A;  5E3F A;  1IBM Q;  1P16 A;  4IFD I;  4A3J B;  2DJG C;  3D6W A;  2M2L A;  5M3F B;  1G6Z A;  4FF3 A;  4CKE A;  1QZH A;  4DK1 A;  3GTP H;  2WII B;  4IAL A;  2KCT A;  1QE6 A;  1K8M A;  1AZP A;  4CDF C;  4X65 Q;  2F4V Q;  3NQI A;  1EY0 A;  3HFZ B;  3JAM L;  2C9O A;  2L4N A;  4DV3 L;  1D6E C;  3VA7 A;  5EPK A;  1YJW A;  1Y1W G;  4DNT B;  1C48 A;  3NE5 B;  3MVV A;  3IFD A;  5ELO A;  3DLL A;  3I73 A;  3J81 i;  1HNX Q;  5JOB A;  2E74 C;  4XT1 B;  1T5X D;  4ZK9 B;  3Q6S A;  4A93 H;  2MQH A;  3HOZ B;  5KGU A;  1I4Q A;  4BA1 I;  1GHK A;  2UXB L;  4R8I A;  3CHB D;  1D7Q A;  2VQF L;  4A3I H;  1VQ8 A;  4LFB Q;  2R93 B;  1KDB A;  1JE5 A;  3FKI G;  2KEE A;  1STH A;  1SEB D;  1AE2 A;  2A69 D;  4BY1 G;  2VW9 A;  2XN9 C;  4LF9 Q;  3PO3 G;  3OTO Q;  1FNW A;  2D62 A;  3VR4 A;  1HR0 Q;  1IKL A;  1BF4 A;  4U67 3;  3GTG H;  3NTK A;  2O5J C;  4C3H H;  1RD9 D;  2NYZ D;  3A8J E;  4FO2 A;  4X3T A;  5T1G A;  4XQQ A;  2FHT A;  1CZG A;  4IPH A;  1LT6 D;  3SDZ A;  4B08 A;  4A3D B;  5IYB H;  3FPP A;  3VYS A;  3E0J A;  1I6V C;  1ZYR D;  1UEA B;  1QZG A;  1WTO A;  1GUW A;  3PSI A;  1TS2 A;  1SYD A;  2HHH Q;  3I4M B;  1SYG A;  1JOK A;  1DOM A;  2KHS A;  3HKZ G;  4ABN A;  4CKB A;  4BXX G;  3TSS A;  1TY2 A;  3OIQ A;  1HFN A;  4KKU A;  3NUC A;  4L63 B;  3RLO A;  4JI5 Q;  3QR8 A;  3OIP A;  3KLS X;  3VYU A;  1J9O A;  4PZ6 A;  2JEA I;  3DM3 A;  4A3C H;  5AFW A;  3TZD A;  4C3J B;  1BCP D;  3CCV A;  2F0Q A;  4J1M A;  3X3M A;  3CCR A;  3S2D B;  3H0G G;  1N34 Q;  4J15 A;  5C4X B;  4JI7 L;  5DM6 3;  4LFA Q;  1SNM A;  2MO0 A;  4YCV A;  2B2Y A;  2XSC A;  1Y1V B;  3HRZ C;  1F2Z A;  2VUM H;  4DR6 L;  3JAM i;  3G71 A;  4DR4 L;  1G29 1;  4ZLT F;  1X56 A;  3D8G A;  4GNX B;  1X6O A;  3GV6 A;  5JEA J;  3M4P A;  4X62 L;  4RCO A;  3FHW A;  2EY2 A;  1CZW A;  2BA0 A;  1DD2 A;  3CKI B;  1Y8P B;  5IP9 G;  1VQP A;  2E5L Q;  3W5O A;  2Z4H A;  4L8J A;  1M1K C;  2B2U C;  2F4V L;  2Z4I A;  3KLW A;  2RBM A;  1WYD A;  5FKA C;  3U4Z A;  3NWS A;  4K2K A;  2B63 G;  2X6L A;  1YNN D;  3NBH B;  1UAP A;  1V1Q A;  2K4K A;  2A74 C;  4G57 A;  3K7U C;  3QB3 A;  2DY8 A;  1PZK D;  4ZAI A;  1XMQ Q;  1HNX L;  2IX1 A;  5K36 G;  4YWM A;  2OCE A;  2JA5 G;  4GLX A;  1I4G A;  3PUV A;  1JJ2 A;  4IUN A;  2R7Z B;  3CC4 A;  3B6Y A;  2NTT A;  2DY7 A;  1A3T A;  1RJT A;  1U4M A;  2CQO A;  2O5I C;  3J7A F;  2H5X A;  4N9P A;  1TWA H;  1CKN B;  5IE8 A;  4HMJ A;  1AFP A;  5A2Q E;  1OXU A;  1PZI D;  2KCM A;  5EKK A;  3DMU A;  3P20 A;  4HN7 A;  4JBK A;  4LF9 L;  5IWA Q;  3MFY A;  4KKT A;  1AN8 A;  4DK0 A;  1TWG B;  1GD7 A;  3PCO B;  3HGB A;  5EGT A;  2CCZ A;  4LMQ D;  1ZKO A;  1FVI A;  1YJN A;  1STY A;  3GTQ H;  5DM7 3;  3MFG A;  1B9M A;  1LTR D;  2K14 A;  4JC0 A;  4UY8 C;  5ELN A;  4P2C B;  3L0O A;  1TWF H;  1KC8 C;  4ZUJ A;  2NVX B;  2VZA A;  4X3U A;  1B1Z A;  3ND8 A;  4GLV B;  5CC4 A;  2RCN A;  5C3E H;  3IAY A;  3P7J A;  3KF6 A;  5HGT A;  5E7N A;  1LTL A;  2BCO A;  1HUN A;  3K58 A;  2Z9H A;  1XPO A;  4OWX B;  2Z6K A;  4OWW B;  3CCQ A;  2CKZ B;  2KUM A;  4LF8 Q;  2Z1C A;  4CDE C;  4JI5 L;  2WV6 D;  2ZXR A;  5C0X H;  3DWQ A;  3V2T A;  1HNW Q;  1MSH A;  5E1F A;  2IX3 A;  2IY5 B;  1B2T A;  2CWA A;  3S17 B;  1ICF B;  4JV5 Q;  4TVA B;  4GOP A;  1EEI D;  1R9T B;  1N33 Q;  2Q2U A;  1HFG A;  4LFA L;  3BYT B;  5I4D A;  3TS0 A;  3BZD B;  4XIG S;  1H9S B;  3A7L A;  1K8A C;  4J6H A;  3MHB A;  1M8A A;  4Y7N B;  1OXV A;  2V1C C;  4BWG B;  1JQY D;  4NMZ A;  2RDG A;  4DR1 Q;  4F87 A;  3NK9 A;  2RA4 A;  5JPN C;  5CBE E;  1NMF A;  1KLU D;  4HCS A;  1S5D D;  4POF A;  1GUS A;  4C1N K;  2H1E A;  1HA5 A;  1OXS C;  2FMM A;  2WB1 G;  4DNI A;  2E5L L;  3CC7 A;  1ZXT A;  4IUT A;  5ELC A;  1O7Z A;  4IJL A;  1Y1W B;  1W6K A;  4JOI A;  4CGY B;  4FXG C;  1VMP A;  2F03 A;  2K28 A;  1AW7 A;  4HMI A;  1X3E A;  4LFC Q;  3QIA A;  3PQI A;  2AUK A;  1GJX A;  4K5W A;  5H1S E;  3MZ5 A;  3HOV H;  1H95 A;  1BBU A;  4HIO A;  4GKK Q;  1XMQ L;  1BBX C;  5I2X A;  1ESF A;  1Q81 C;  1HZ9 A;  3WOF A;  1B3Q A;  1XX8 A;  4A3J G;  1NTG A;  1X32 A;  3W1G A;  3FKI B;  4R4I A;  3A8K E;  3Q23 A;  4BY1 B;  1ROD A;  1W3S A;  3PO3 B;  4DAV A;  4A3G H;  2ZM6 Q;  3KBG A;  5FLX E;  3S24 A;  2VQE Q;  4KHP Q;  5ELE A;  5IGE A;  1NNX A;  5D65 A;  2L55 A;  5C44 G;  3H6M A;  4DAY A;  5M5W B;  1A63 A;  3M4Q A;  3NPP A;  3U9S A;  4BY7 G;  4H0L C;  2EQS A;  3H0G H;  1G2T A;  4RH6 A;  5I6Y A;  1SYF A;  4DUZ L;  3A5Z B;  1ESR A;  2WP8 J;  2Q8R E;  4O0A A;  1YJ9 A;  3C2P A;  5C0X J;  3H3V C;  2PW7 A;  1QWY A;  3HOZ G;  1O78 A;  3BU2 A;  2K50 A;  3CCJ A;  3SK8 A;  2CW0 D;  3K0X A;  4YY3 L;  5GRO A;  4PV1 C;  3CQZ B;  1K8G A;  2R93 G;  1EYA A;  4QMG A;  1PH5 A;  4LF8 L;  4MNO A;  3ICE A;  2N49 A;  5IP9 H;  1JJC B;  1EQV A;  2JA7 H;  5C4Z A;  1HNW L;  2K04 A;  3UE1 A;  5EPJ A;  4OGQ C;  3FP9 A;  2HDL A;  3WDN A;  5K5P A;  4A3F G;  2PMZ B;  2A6E D;  3A7A B;  4NXN L;  1B8A A;  1E3P A;  3EIV A;  4HTH A;  1VQF A;  1F9S A;  4KKS A;  4CHT B;  1Q8I A;  3H15 A;  3OPO A;  3STB D;  4KI0 A;  4IO9 A;  4A3D G;  3H3V H;  1A3U A;  1WFQ A;  4X3S A;  2F0D A;  4CKC A;  3I70 A;  1LM0 A;  2B8G A;  1FNV A;  5FO8 B;  2A19 A;  2NN6 G;  4OEL B;  3HKS A;  1OO9 B;  2A6H D;  4DV7 Q;  4A3M G;  4LUZ A;  4QQB X;  3NSW A;  4DR3 Q;  3L9A X;  2HCC A;  1STE A;  3A74 A;  4KY7 A;  1LT4 D;  5C4H A;  2O2L D;  1LTT D;  4OX9 Q;  5JVH 3;  1PH4 A;  4OHJ A;  2TSS A;  4BA2 I;  1PTO C;  3CW2 C;  5GAH C;  1PFN A;  1VQG A;  3I2Z A;  1JOQ A;  1IW7 D;  1EQR A;  4DKA C;  2Q8I B;  4DUY Q;  1K73 C;  5J39 A;  1RL2 A;  3NEN A;  4KJO A;  3EN2 A;  3J81 E;  2JA5 B;  1CK1 A;  2BDO A;  3GP7 A;  1GHJ A;  4KV6 A;  1IYV A;  5KYL A;  2YU9 H;  3DEO A;  3K8A A;  1SND A;  4FF4 A;  2M9V A;  3GV3 A;  2DJF C;  1EWC A;  1ENA A;  4B3M L;  1IL8 A;  2UXC Q;  3LWE A;  2PQA A;  2CFM A;  4DR7 Q;  3MWY W;  4U68 A;  5I6W A;  4A3L G;  2XNA C;  4I7Z C;  3NEM A;  3HKZ E;  1WTP A;  1CFM A;  1OTC A;  4DFA A;  2ZM6 L;  2VQE L;  3RMH A;  5C3X A;  1PTO H;  2R92 H;  2F0E A;  3ITP A;  1JWU D;  2EE1 A;  2RCF A;  1YNJ C;  1PFM A;  1VQ7 A;  2V4D A;  3D3R A;  3T1H L;  3S1N B;  1X3Q A;  4K0K L;  2XTI A;  1C7Y A;  2IPK D;  3GD7 A;  3MEH A;  3I55 A;  2BDN A;  3VYT A;  3V96 A;  5M3M G;  1CSQ A;  1F9R A;  1WVL A;  3QOL A;  3K5M A;  1YIT A;  4QIW B;  3EVQ A;  1SMY C;  2R7Z G;  1SYE A;  4JBW A;  2VQF Q;  2F3I A;  2ICE C;  1SNP A;  3S1Q B;  3EFX D;  1KNA A;  1IKM A;  4O1N A;  4BBS H;  4R9W A;  4UPA A;  4JCV E;  1G51 A;  1S5C D;  1TR5 A;  2I5M X;  3L7Z C;  2K01 A;  4N8F A;  2LY7 A;  2NZO A;  2I5L X;  3HOW H;  2NTS A;  1Q82 C;  4KY6 A;  3L2P A;  1CHP D;  3LX0 A;  3HOX G;  4IUR A;  1DCZ A;  1KAW A;  2RHS B;  4TSS A;  4CDD C;  3TQY A;  2UXD L;  1CSP A;  1BCP B;  3CCU A;  3KJP A;  2XWB B;  3HZX A;  5J3B A;  3U9O A;  2QW7 A;  3UDI A;  4MHE A;  1EY8 A;  4RCN A;  4CJ1 B;  1BCP F;  1ENF A;  3L3O C;  3X3N A;  1ET9 A;  1HZC A;  4IJH A;  5C4J H;  3JAM E;  3BYY B;  2K5V A;  3GTJ B;  5JVG 3;  2BE5 C;  4RKB A;  1NY4 A;  2P5Z X;  2IX0 A;  1TS5 A;  2E2H H;  5KNC A;  2JEB I;  5IYC G;  4QB4 A;  1WD1 A;  1IBK L;  2FMC A;  1HTP A;  4A3J H;  1IYJ B;  4KTA A;  3SXH A;  3UE0 A;  5M3F H;  2WB1 B;  1MD2 D;  1PYS B;  3WWV A;  1SJH D;  4R4C A;  2D0O A;  4LF4 Q;  2BH8 A;  4OX9 L;  1M90 C;  4UP8 A;  1II3 A;  3RZO H;  3LWU A;  4DU9 A;  4JI7 Q;  2I0Q A;  3Q8D A;  3KF8 A;  1EU3 A;  4WFN 3;  2JA6 G;  4DUY L;  1CA6 A;  3TRZ A;  1G6P A;  2B2W C;  2LS0 1;  4DR6 Q;  3RN5 A;  3QOJ A;  3MAQ A;  4DR4 Q;  2QF7 A;  4V19 0;  3F8T A;  1EWI A;  3MXG A;  3E5S A;  2EIF A;  1NJI C;  4BS9 A;  3ERS X;  1EIH A;  2F0P A;  1NE3 A;  1Z9F A;  1KRS A;  1YZ6 A;  4X62 Q;  3HOZ H;  2HIX A;  5E4X A;  4IOA A;  2XWJ B;  2UXC L;  3E9H A;  4LUV A;  1O7I A;  1DOL A;  1C8C A;  1VQC A;  1SYB A;  1JCK B;  4QIW E;  1B44 D;  4DR7 L;  4JI1 L;  2KHI A;  2OQ0 A;  2Y0S G;  3I4L A;  1U4R A;  1L1O A;  1CHQ D;  1E2Z A;  5C44 B;  3TZU A;  1SLJ A;  2XVS A;  5JEA H;  3TME A;  1TU2 B;  3I56 A;  4HJ8 A;  1U5K A;  2OF1 A;  4BY7 B;  4C3I G;  4LF7 Q;  1UE6 A;  1PXU A;  5CV4 A;  1UE1 A;  1ONL A;  4MTN A;  3CRK C;  1S3O A;  2WAQ E;  3BVM A;  1AE3 A;  1X9N A;  2CVR A;  1KAB A;  3S14 B;  4PG3 A;  3HG9 A;  1QCB D;  2DGY A;  2IW3 A;  4B9X A;  2F0V A;  3CU7 A;  3I4N G;  5CGK A;  5C5M A;  3J80 c;  4A3K G;  4A3D H;  2F0U A;  5FJ8 G;  2EYO A;  5GQO A;  4MTK A;  3DWA A;  4K6D A;  1WTW A;  3I4M H;  1C4Q A;  4NB3 A;  1U9R A;  4GNX C;  1FR3 A;  2A68 C;  3K80 C;  4M8A A;  2EDG A;  3F1Z A;  1SDF A;  3BJU A;  4WJ4 A;  4DXG A;  2MP1 A;  3MEF A;  4S3S A;  2K1B A;  2A73 B;  3FPU B;  2RKS A;  3OMG A;  2B2V A;  5CBA E;  4JI6 Q;  3AMU A;  3J80 E;  4A3F B;  4IFD G;  1EEF D;  1XNR Q;  4C3J H;  2TMP A;  1SE2 A;  4WJW A;  5C4X H;  2C35 B;  2JA8 B;  1PH2 A;  1JT8 A;  1IZ6 A;  1SFO B;  4DAM A;  2NVY B;  4JI4 Q;  4MZ9 A;  5HUR A;  3VR6 A;  3CXC A;  4B3R Q;  1Y1V H;  1MHW C;  2Q2T A;  1BR9 A;  1SBB B;  1VS0 A;  2K03 A;  1IXR A;  5KRU A;  4A3E G;  1PRT D;  3K81 C;  4A3M B;  3SK5 A;  5BR8 Q;  3PO2 G;  1X3G A;  5IIF A;  2MFI A;  1ENC A;  2NVT B;  2SNM A;  4ME3 A;  1STA A;  3D31 A;  2B29 A;  4RGO S;  1UE5 A;  4A3L H;  2O4X A;  1KHI A;  1LT3 D;  4IUQ A;  4UAI A;  2AQ2 B;  4L5T A;  4OEM B;  2QGQ A;  4LF4 L;  3WOE A;  4H44 C;  4FVM A;  3A56 A;  5EPL A;  2RDF A;  4P73 A;  1GUT A;  1EL0 A;  1Q3L A;  1XTD A;  1S4Z A;  3U4V A;  4DV2 Q;  1BBW A;  1VCI A;  3U58 A;  3PIP A;  3K7A B;  5LMU L;  1KL9 A;  1U4P A;  4DV1 Q;  5CYU A;  4HCE A;  2NBF A;  4FF1 A;  4ME5 A;  2BH2 A;  2EY6 A;  1I94 L;  4GKJ Q;  5BN4 A;  1I50 B;  2DNE A;  1PV4 A;  2R7Z H;  3NQT A;  5M5Y B;  2R3Z A;  1S5E D;  4ZUI A;  2EYF A;  4HSP A;  1GUO A;  1RDP D;  3AEV A;  1LV9 A;  5M9O A;  4P72 A;  2KCN A;  4JI0 Q;  1G8Z D;  1IBL L;  1Q86 C;  3ZYY X;  2ZJP A;  1RIP A;  1TWG H;  3G6J B;  4CDC C;  4LF7 L;  1MJC A;  2RSN A;  4X66 Q;  2RF4 A;  2PI2 A;  3M85 A;  4FDB A;  2KOL A;  3R8B A;  2SDF A;  5M3M B;  3QG1 A;  1EFW A;  2PZW A;  4XYQ A;  1LUZ A;  2VXW A;  1TT2 A;  2Z0S A;  2XRQ D;  3GDE A;  1A0I A;  3F2C A;  2UUB Q;  3LNN A;  3D4R A;  1JWM D;  3M4Y A;  1MJE A;  2NVX H;  4B3S Q;  1YI2 A;  2CQA A;  2EYL A;  1D8L A;  3K0Y A;  2QDB A;  2F0F A;  1WTH A;  1XTC D;  1N9W A;  4DR5 Q;  1XWE A;  2JYO A;  2RDH A;  3BDC A;  4RGN A;  1EYD A;  2KA7 A;  5D14 A;  1AZQ A;  3HOX B;  1K0R A;  4RAU C;  1ICW A;  3GTK B;  4QGU A;  1TWC B;  2EPB A;  1N36 L;  5C3W A;  5BN3 A;  4L5R C;  2MGS A;  4JI6 L;  1A3V A;  2Z6B A;  1XNR L;  2M00 A;  4XQJ A;  4DUZ Q;  3S17 H;  4YIJ A;  1S5B D;  3I4O A;  1N8R C;  5G3L D;  3UDF A;  1R9T H;  3M4O B;  2NUC A;  1MIU A;  3VYR A;  3BDO A;  4JI4 L;  2IJ0 A;  3PUZ A;  5EBD A;  1CKN A;  4B3R L;  4Y7N H;  4YY3 Q;  3M7N A;  1U4L A;  3EBE A;  4ZKC B;  3GTM B;  2EXD A;  1KTK A;  3NTH A;  3OW2 A;  1BXT A;  5IP7 G;  3KDF B;  5D3I B;  1WCM G;  4KY5 A;  5BR8 L;  4DV5 Q;  4GOP B;  2XGT A;  4POG A;  3KFU A;  1WOC A;  2K52 A;  3G48 A;  3TEH B;  3E0E A;  1S72 A;  1JB7 A;  3M9B A;  1TWA B;  4R4O A;  4F88 A;  3BS1 A;  5IT9 c;  3PF5 A;  2JA6 B;  2E75 C;  2K7V A;  4NXN Q;  3ULL A;  5M5X B;  3AQQ A;  1UUP A;  1Y1W H;  1DM0 B;  2I5H A;  4AYB G;  3S16 B;  1SJE D;  2RHQ B;  4KJN A;  2F0O A;  2K75 A;  4KN7 C;  1OXX K;  4DV2 L;  5IY0 A;  1A8V A;  4QUC A;  3GTQ B;  2OT2 A;  4OO1 I;  2GA4 B;  4DV1 L;  4XXE A;  1GKH A;  4GKJ L;  5GAE C;  1I3Q H;  3OHX C;  2B2U A;  1TQO A;  5IT9 E;  1DOK A;  3CD6 A;  1X55 A;  2EYM A;  5A2Q L;  5IOC A;  5A35 A;  2Y0S B;  1XNQ L;  4C2M H;  3FKI H;  3VA5 A;  4ZKB B;  4BY1 H;  3PO3 H;  4APV A;  2Q2I A;  1JMC A;  1HQM C;  4JI0 L;  4C3I B;  3Q22 A;  2BOS A;  3GO5 A;  5FOB B;  3D0F A;  3E3X A;  2NVQ B;  1MI2 A;  1B9N A;  5LHY 1;  1EY5 A;  1H9S A;  4BBR G;  2PZU A;  4X66 L;  1O7Y A;  3SR1 A;  5M5W H;  5FLX c;  4AIM A;  3RNU A;  4HAE A;  1QUQ B;  3I4N B;  3UDG A;  4A3K B;  1OXT A;  2L1B A;  4RG1 A;  1Y8O B;  4B3M Q;  1NSN S;  1VQJ A;  3HS0 C;  2UUB L;  3BVG A;  3QJY A;  2K33 A;  4RFB A;  2WKD A;  2F0M A;  4B3S L;  4BXX H;  1CKM A;  4DAY B;  5L37 A;  1JOR A;  3FMC A;  3MXU A;  3SK4 A;  4H13 C;  2X69 A;  4DR5 L;  3CQZ H;  1VF5 C;  1QB5 D;  2AWN A;  1RTN A;  4XT3 B;  2HIV A;  1CQV A;  5IYD G;  1SRU A;  4DV0 Q;  2MUY A;  1X54 A;  1PMR A;  4OO1 G;  1F9Q A;  1HPC A;  3T1H Q;  4KD3 A;  4Q0F A;  2F0L A;  4K0K Q;  2MJ8 A;  3OWE B;  4EQP A;  1A15 A;  3HOU G;  3TS2 A;  1HCZ A;  2EJM A;  5IGC A;  1PH9 A;  2F0N A;  2LXK A;  4XQN A;  1XYI A;  2FFK B;  1TII D;  3FEW X;  4DF7 A;  1D5M C;  2JQO A;  4OIK A;  1HZB A;  3K5N A;  4A3B B;  4A3E B;  1TXY A;  4X6A H;  2JA9 A;  1EYG A;  4HED A;  5JJL A;  5IGD A;  4HSV A;  3ULJ A;  3PO2 B;  4KHV A;  1Y14 B;  3CPW A;  1A2T A;  4WRD A;  3TP6 A;  2PNR C;  5EBC A;  3T13 A;  4DV5 L;  2CHB D;  3QWN A;  4K2L A;  1HH2 P;  4IPD A;  1PH6 A;  1JR0 D;  4DPG A;  2A1A A;  2KVM A;  3RZD B;  2UXD Q;  2A69 C;  3ERO A;  1PA6 A;  4KN4 C;  3RN2 A;  3I91 A;  5LMN W;  2AMC B;  1C9O A;  1KAA A;  1N32 L;  2B63 H;  4WOR A;  3KJO A;  2L5T A;  4NDX A;  2HQL A;  1VQI A;  1DXM A;  2JA8 G;  1WTX A;  2F0W A;  5IGG A;  3C1E A;  5K36 H;  3CCE A;  2JA5 H;  3S1M B;  3CRL C;  5AJ3 Q;  1IBK Q;  3CCL A;  1I4X A;  1ZYR C;  1K3R A;  2EJG C;  2K5W A;  3NP8 A;  3J81 c;  1K8O A;  4RKL A;  1H9M A;  4AQY Q;  4IFD J;  5TSS A;  3DEP A;  2DNC A;  4A93 G;  5IOD A;  4X64 Q;  3GTL H;  2A8V A;  5FLX L;  2F0H A;  2AWO A;  5COY A;  2AQ3 B;  3EA6 A;  4MIU A;  4A3I G;  4RMF A;  1X3F A;  2RVL A;  1QNK A;  2B2T C;  4LUO A;  4LF6 Q;  1SNO A;  4K5V A;  1PH8 A;  2SOB A;  3GTO B;  5E4W C;  1CTM A;  5JJI A;  4ZQ3 A;  2G9H D;  1BCP C;  1GXD C;  3TRE A;  2N88 A;  1P8L A;  1B50 A;  2JK8 A;  2PQA B;  5LL6 X;  1LAB A;  4GN5 A;  4GZY C;  1F77 A;  1XMO L;  5ISR A;  3S1N H;  2OTJ A;  3S1R B;  4C3H G;  5FLM G;  4PNY A;  2F0I A;  1QG7 A;  1AEX A;  1D1I A;  4R8N A;  3S15 H;  1V43 A;  4K8J A;  2FXQ A;  2H4O A;  3C46 A;  2K32 A;  5IYB G;  1PYW D;  1SNQ A;  4JI1 Q;  3S1Q H;  1BO0 A;  3FVQ A;  1VQ6 A;  1WJJ A;  4KMU C;  2QEJ C;  3CMA A;  1VQ5 A;  3PIO A;  4GN3 B;  4NXM Q;  1MSG A;  4DV0 L;  4K8I A;  5T1I A;  4FF2 A;  3CP0 A;  4R4T A;  3HOY B;  4IPC A;  1YNN C;  1BKB A;  4A3C G;  2E8G A;  4IOC A;  2VL6 A;  2R7F A;  5I9P A;  2PMZ E;  4ULL A;  2ZXO A;  1EIF A;  1TWH B;  4QCL A;  4Q5V A;  1HR0 W;  1PHJ A;  3S2H B;  3GTJ H;  1DGS A;  4PZ8 A;  3AB9 A;  1WCM B;  3K59 A;  2X6G A;  2VUM G;  3I90 A;  3JAM c;  3A0J A;  2I07 B;  4QF4 A;  1D2B A;  1I6H B;  3M3Y B;  1PRT F;  3MXN A;  1VQK A;  1LAC A;  2LSS A;  4TQU S;  2FIN B;  1I4R A;  4AYB B;  1V9P A;  2AHO B;  2GVA A;  1Y69 U;  4A4I A;  1T9H A;  1CKO A;  1X65 A;  4J8Q A;  3I8Z A;  4FP5 D;  1I4H A;  1CA5 A;  4QY7 A;  1KLG D;  3SE0 A;  2G5D A;  2C5C A;  2CWP A;  3DHQ A;  1JC7 A;  3EQL C;  3NWT A;  1VQL A;  1BQQ T;  3TP8 A;  2E2J B;  3OSO A;  1Z47 A;  1EIG A;  1V8Q A;  3NTI A;  5D3D A;  4Y52 H;  1PDQ A;  1QOH A;  5AJ3 L;  5C0X I;  3T1Y Q;  4JBJ A;  2B39 A;  4JPB W;  4JVZ A;  1R4P B;  1GM5 A;  1NR2 A;  1NCV A;  3KF8 B;  4XYO A;  2XIW A;  4AQY L;  1T5E A;  2N55 A;  1PLF A;  1VQ4 A;  4X64 L;  4DK3 C;  1LT5 D;  1D5X C;  1EWH A;  4IUP A;  1DYQ A;  5LMN Q;  3BG3 A;  4K6L A;  5JPM C;  3MXP A;  3CCS A;  4LF6 L;  5C44 H;  5IYD H;  3R2I A;  3RLN A;  4BBR B;  4HIK A;  2DUD A;  4C1N I;  4L5S A;  1YHQ A;  4BY7 H;  5I9O A;  4DV6 L;  3KBX A;  5LMU Q;  3VR2 A;  2IHE A;  3FRP B;  1GOZ A;  1I94 Q;  3T53 B;  1EY4 A;  3TP7 A;  3RR5 A;  3S14 H;  1LTB D;  2MO1 A;  2EY5 A;  1EY7 A;  3C3L A;  1L1O B;  4B9W A;  1VMC A;  2F3W A;  3H91 A;  4ID6 A;  1VQM A;  1SXT A;  4I65 A;  4RA8 A;  2VS1 A;  4KK7 A;  4KHZ A;  1TKW B;  3R2T A;  3OMC A;  3HEJ A;  5EKL A;  1E2V A;  3G4S A;  4JI3 Q;  2R93 H;  1IBL Q;  4OWT B;  3Q24 A;  2E2I B;  4ZRZ A;  3IFT A;  1STB A;  4HJ7 A;  2VB3 X;  1O80 A;  3SHL A;  2B2Y C;  2F52 A;  4NXM L;  2NZH A;  4ZCK A;  2G9D A;  3IKJ A;  1PH1 A;  3HOU B;  1VDZ A;  1YEZ A;  4MN3 A;  1NR4 A;  4PQX A;  4A3F H;  5C0X G;  4GS3 A;  1FGU A;  4AH6 A;  1V1P A;  1FJG Q;  3RZO B;  1S5F D;  1CQF A;  1HXY D;  2L15 A;  3SEB A;  1VQA A;  4AYB E;  2JA8 H;  1Q8K A;  1SFO H;  2EOT A;  1K83 B;  2NVY H;  5G3L F;  1F2L A;  1QNU A;  2NN6 H;  3T4A C;  1ILQ A;  4A3M H;  4A75 A;  1FNU A;  3A55 A;  4F8M A;  5EKI A;  4OL7 A;  3K57 A;  2BA1 A;  1N36 Q;  2NVT H;  1CUK A;  3PMF A;  3GTP B;  3LGJ A;  1QJO A;  1YNX A;  2XRS D;  3UI2 A;  2I46 A;  1EZ6 A;  1JJG A;  2WB1 E;  1KRT A;  2L12 A;  1GUN A;  2R6G A;  5GAG C;  1GO3 E;  1WTV A;  2K5Q A;  2E2D C;  3S2D H;  3W3A A;  1TS3 A;  1H9R A;  3PV0 A;  1KDA A;  5HGQ A;  4PMC A;  2PYK A;  1K28 A;  4JW0 A;  3W2D A;  4A3B G;  3K7A H;  1HHV A;  3O13 A;  4H7B A;  5FLM H;  3S9W A;  2YTV A;  4A93 B;  1EFI D;  3T1Y L;  3HOV G;  3BDL A;  1E0B A;  2CW0 C;  1I50 H;  1L0W A;  5KEE A;  4JBM A;  5M5Y H;  5FO7 B;  4A3I B;  4B3T Q;  2B2W A;  1Q1E A;  2F4I A;  2ZXP A;  2HD3 A;  5LMN L;  3EJI A;  1ZEQ X;  1Q1B A;  3DWP A;  5KNB A;  5JAV A;  3H3V I;  2KCC A;  4A3G G;  1D5Z C;  1G2S A;  4R1J A;  3OWF A;  4NP5 A;  3QO2 A;  4HIM A;  2F0K A;  1PTO D;  3GTG B;  3ZJY C;  1SRO A;  2A6E C;  1HTL D;  1FGB D;  5CV5 A;  4OIJ A;  4C3H B;  5M3M H;  4DN4 M;  2Z6K C;  4HID A;  3STB C;  2ZT9 C;  5NUC A;  5EQ0 A;  3N6R A;  4QUF A;  1SSO A;  1UEB A;  2WIN B;  2AKW B;  1JOO A;  1SAP A;  2PCF B;  2PQE A;  3N52 A;  5HY6 A;  2EXZ A;  2JSO A;  1PFS A;  1XNQ Q;  3SGI A;  1JWS D;  2EY1 A;  2Q8T A;  4RHR A;  1LTG D;  4RGM A;  1JE4 A;  5ELD A;  2A6H C;  1EOV A;  4JI3 L;  3TBI B;  4R4Q A;  4DA2 A;  1TVX A;  4GOP C;  3R3O A;  3H94 A;  3MTS A;  2WFW A;  1UE7 A;  2YV5 A;  3KYH C;  1IBM L;  1HQR D;  3HOX H;  1XPU A;  4GLA C;  3KUP A;  3J80 L;  5ELB A;  4TRD A;  4G7H C;  3GTK H;  1TWC H;  1YVC A;  1MGS A;  2UUC Q;  1IYU A;  1QIL A;  4UP7 A;  1SR3 A;  1K3B C;  1IW7 C;  4DGZ A;  1QVF A;  2JA7 G;  4GNX A;  1FJG L;  1YNJ D;  2D2C C;  4ILW A;  3I7F A;  4UHV A;  5CMD A;  4X65 L;  4DV4 Q;  5EJW A;  4A76 A;  1F2M A;  4NW2 A;  2QCP X;  3PIP 3;  4CBV A;  5COR A;  1W2B A;  3M4O H;  3TN2 A;  3U50 C;  3RLF A;  1VQN A;  1WTR A;  1MKH A;  4QL5 A;  3J7Z C;  4M1U B;  3SK6 A;  2VUM B;  5IYC H;  2YTY A;  1BOS A;  1SMY D;  3I3C A;  3GTM H;  4JOI C;  5J22 A;  1EZ8 A;  5C6A A;  4FXK C;  4NPS A;  2QA4 A;  3NBH A;  4LNQ A;  1C0A A;  4N9T A;  4ALP A;  2ZTC A;  1E22 A;  4P74 A;  4FNF A;  4RHS A;  3KF6 B;  4IQZ A;  1TS4 A;  4LFB L;  4X3K A;  2JA6 H;  3HOY G;  5CR3 A;  3K5O A;  1STG A;  5M5X H;  2YTX A;  5KYI A;  3AU7 A;  4DK6 C;  1LTI D;  3OTO L;  3S16 H;  4WJ3 M;  2LXJ A;  1NAP A;  3CC2 A;  1HRJ A;  1HR0 L;  1JB3 A;  2A5H A;  4H02 A;  2D9U A;  1XJV A;  2N78 A;  2F0T A;  1Q46 A;  1Z7T A;  4EQ5 A;  4P71 A;  3ER0 A;  3DM1 A;  2MHV A;  2J4X A;  4K5X A;  4XDX A;  2BE5 D;  2EVB A;  4JI8 Q;  1AP0 A;  1TY0 A;  1JIC A;  1BNZ A;  4YCW A;  4YHH Q;  1B53 A;  1VQH A;  3E6Z X;  1E2W A;  1VQE A;  2CH4 W;  2ENB A;  1SE4 A;  3T51 B;  4B3T L;  1EIY B;  3VR3 A;  2K5H A;  2HHH L;  1NUC A;  1N32 Q;  3SVM A;  3OW7 A;  4UP9 A;  4DR2 Q;  2PI2 E;  3VDY A;  1FD7 D;  3PUW A;  1MBY A;  4C3I H;  1F9P A;  2UUA Q;  3CME A;  3TP5 A;  1K0S A;  2EJF C;  3DUZ A;  3TDQ A;  2NVQ H;  2VNU D;  3T56 B;  4JK1 C;  1Q7Y C;  1B4O A;  1L0Y B;  1AH9 A;  2R92 G;  1F2Y A;  2R61 A;  2WAQ G;  1GUG A;  3W1B A;  1CM9 A;  3J80 i;  3ONA B;  3I4N H;  1DON A;  4N8X 1;  3KDF A;  5J1Z A;  4A3K H;  2J0T D;  3A8I E;  2L11 A;  1KIX A;  1N34 L;  4O2D A;  2NWG A;  3NXW A;  5FJ8 H;  1TWF B;  2F0J A;  2ID0 A;  4O42 A;  3URY A;  3K6O A;  5C3E B;  1UNS A;  2NB0 A;  1VQO A;  2LKV A;  1J5E Q;  2B8F A;  4G4K A;  2HCI A;  3NEL A;  4BBS G;  2KQ3 A;  2LMC B;  2B3G A;  1RF2 D;  2QDL A;  4LK1 C;  3V05 A;  4CJ2 C;  3Q0A A;  4IFD H;  4ZYS A;  2UUC L;  3ULP A;  3K5L A;  1NMG A;  3HOW G;  1VF7 A;  1PVO A;  3P1H A;  3G7L A;  1XMO Q;  2ES2 A;  2IHF A;  3MC0 B;  1L0X B;  4LF5 Q;  2LFN A;  4Z9C B;  1Z6H A;  3CCM A;  2IL8 A;  4DV4 L; 
#chains in the Genus database with same CATH homology
 1VQC A;  4QIW E;  4DR7 L;  1M1K C;  4JI1 L;  2F4V L;  5EAY A;  5IYB G;  3KLW A;  2KHI A;  2OQ0 A;  2Y0S G;  4JI1 Q;  3S1Q H;  1WYD A;  1VQ6 A;  3U4Z A;  1L1O A;  1WJJ A;  4A3B H;  2B63 G;  1HZA A;  4A3E H;  4YWL A;  1SLJ A;  3NBH B;  1V1Q A;  2K4K A;  3I56 A;  4HJ8 A;  4QJF A;  1U5K A;  3CMA A;  4LF7 Q;  3PO2 H;  1UE6 A;  2HT1 A;  1VQ5 A;  1UE1 A;  3PIO A;  3K7U C;  1L2F A;  3AFQ A;  4GN3 B;  4MTN A;  1Q12 A;  1XMQ Q;  1HNX L;  1VQB A;  4NXM Q;  2IX1 A;  4YWM A;  2OCE A;  1S3O A;  2WAQ E;  4DV0 L;  2JA5 G;  1AE3 A;  4WJ3 M;  4GLX A;  3PUV A;  1X9N A;  3CP0 A;  4R4T A;  1JJ2 A;  4PG3 A;  5JJK A;  3CC4 A;  3B6Y A;  2DGY A;  1SMX A;  4IPG A;  4IPC A;  2ZJR A;  3J81 j;  5M3F G;  3RZD H;  2CQO A;  1BKB A;  4A3C G;  2E8G A;  4IOC A;  3I4N G;  4A3D H;  2H5X A;  3J80 c;  4A3K G;  1QUQ A;  1TWA H;  4HJ9 A;  2VL6 A;  1CKN B;  2R7F A;  5IE8 A;  5FJ8 G;  2PMZ E;  3CPF A;  5GQO A;  1PH3 A;  1EIF A;  1OXU A;  2ZJQ A;  2KCM A;  1HR0 W;  3I4M H;  1PHJ A;  5IWA L;  2NN6 I;  4NB3 A;  4GNX C;  4JBK A;  1IL2 A;  4YWK A;  3K80 C;  4LF9 L;  5IWA Q;  3GTJ H;  1DGS A;  4PZ8 A;  1GD7 A;  1E1O A;  3PCO B;  1PH7 A;  3F1Z A;  2KBN A;  3BJU A;  2VUM G;  4WJ4 A;  2CCZ A;  3MEF A;  3S1M H;  1FVI A;  3A0J A;  3JAM c;  1YJN A;  3GTQ H;  4JI6 Q;  1E7Z A;  4IFD G;  4JI8 L;  1VQK A;  1XNR Q;  1YBY A;  5K36 G;  2LSS A;  4YHH L;  4C3J H;  2K14 A;  4TQU S;  4JC0 A;  4UY8 C;  5ELN A;  3L0O A;  1TWF H;  1KC8 C;  5C4X H;  1V9P A;  2AHO B;  2UU9 Q;  2C35 B;  2GVA A;  1ASZ A;  2VZA A;  4A4I A;  4XTC S;  4GLV B;  2Y0S E;  1T9H A;  1CKO A;  1X65 A;  2K5N A;  2YYZ A;  1PH2 A;  1IZ6 A;  1JT8 A;  2RCN A;  1YIJ A;  5C3E H;  1HNZ Q;  4DAM A;  3KF6 A;  4JI4 Q;  5E7N A;  2IT1 A;  4MZ9 A;  4DR2 L;  1LTL A;  3CXC A;  3J7A 5;  4QY7 A;  4B3R Q;  1Y1V H;  2CWP A;  1VQL A;  1XPO A;  2Q2T A;  2VY3 A;  3OYY A;  4OWX B;  2Z6K A;  2UUA L;  1VS0 A;  4OWW B;  1Z47 A;  3GTO H;  3CCQ A;  1IXR A;  4A3E G;  2CKZ B;  3K81 C;  4LF8 Q;  4JI2 Q;  5JEA G;  1U0L A;  5BR8 Q;  4Y52 H;  3UDX A;  1X3G A;  4JI5 L;  5AJ3 L;  1UWV A;  2MFI A;  3PO2 G;  5C0X I;  3PUX A;  4JBJ A;  3T1Y Q;  4ME3 A;  1HNW Q;  1GM5 A;  3D31 A;  2IY5 B;  2B29 A;  3KF8 B;  3S1R H;  1UE5 A;  4AQY L;  3PF4 A;  4A3L H;  1QVC A;  4JV5 L;  1KHI A;  2CWA A;  4OXP A;  4L5T A;  1VQ4 A;  4JV5 Q;  4X64 L;  4DK3 C;  2QGQ A;  4LF4 L;  1N33 L;  4TVA B;  4GOP A;  1N33 Q;  5LMN Q;  2Q2U A;  4LFA L;  3AFP A;  4L5Q A;  3TS0 A;  1SN8 A;  1XPR A;  4P73 A;  4XIG S;  1K8A C;  3KOJ A;  1K9M C;  1VQD A;  1J5E L;  3CCS A;  4LF6 L;  5C44 H;  5IYD H;  3RLN A;  1XTD A;  1HJP A;  2R7D A;  3I4M G;  1OXV A;  2V1C C;  2DUD A;  3U4V A;  4DV2 Q;  5DLQ E;  4HIK A;  4DR1 L;  1YHQ A;  1WI5 A;  4L5S A;  1BBW A;  1VCI A;  3U58 A;  3PIP A;  5LMU L;  4BY7 H;  1KL9 A;  4DV1 Q;  4DV6 L;  4DR1 Q;  5LMU Q;  1BVS A;  4LWC A;  4DV6 Q;  2BH2 A;  1I94 L;  1KD1 C;  4GKJ Q;  2IHE A;  1I94 Q;  1NMF A;  2PNH A;  1ASY A;  3CAM A;  3RR5 A;  4POF A;  3S14 H;  2MO1 A;  4JG2 A;  1PV4 A;  2R7Z H;  3HOY H;  1L1O B;  1OXS C;  2E5L L;  2WB1 G;  4DNI A;  4LF5 L;  1VQM A;  3CC7 A;  3AEV A;  4HJ5 A;  4JYA Q;  2VS1 A;  4P72 A;  4IJL A;  4KHZ A;  3BZC A;  5C4X G;  2KHJ A;  4JOI A;  4JI0 Q;  2ASB A;  1TWH H;  1J6Q A;  3G4S A;  1IBL L;  1Q86 C;  4JI3 Q;  1I5F A;  2GVB A;  2R93 H;  4LFC L;  1IBL Q;  1B7Y B;  4OWT B;  3S2H H;  1X3E A;  2Q2H A;  4LFC Q;  2ZJP A;  1RIP A;  5IP7 H;  1TWG H;  1WCM H;  1E24 A;  1Y1V G;  4LF7 L;  1MJC A;  4HJ7 A;  4GKK L;  5H1S E;  4X66 Q;  2RF4 A;  2PI2 A;  3M85 A;  3HOV H;  1H95 A;  3BZK A;  1BBU A;  4HIO A;  4FDB A;  2F52 A;  4GKK Q;  2ZTD A;  4NXM L;  1XMQ L;  2NZH A;  1PH1 A;  4PZ7 A;  1I6H H;  1EFW A;  3M3Y H;  1YEZ A;  1Q81 C;  4A3F H;  1HZ9 A;  5C0X G;  1SE8 A;  1LUZ A;  2Z0S A;  4GS3 A;  1FGU A;  2N8N A;  1NTG A;  4AH6 A;  4A3J G;  1FJG Q;  3GDE A;  1S40 A;  1A0I A;  3F2C A;  2UUB Q;  3W1G A;  4EX5 A;  2L15 A;  1VQA A;  4GN4 B;  4R4I A;  4AYB E;  1W3S A;  1MJE A;  2NVX H;  4B3S Q;  1YI2 A;  2JA8 H;  2JJQ A;  1Q8K A;  1D8L A;  4A3G H;  3PGZ A;  4DV3 Q;  1SFO H;  2ZM6 Q;  4OON A;  2NVY H;  4KHP L;  2VQE Q;  3S24 A;  1N9W A;  4DR5 Q;  4KHP Q;  2GN5 A;  3MXN B;  2E2J H;  1EQQ A;  1K0R A;  5C44 G;  4A3M H;  4QGU A;  4A75 A;  2MNA A;  1L1O C;  1A63 A;  1N36 L;  3M4Q A;  1YHB A;  4BY7 G;  2BA1 A;  4LW1 A;  1N36 Q;  2EQS A;  4L5R C;  2NVT H;  3H0G H;  1CUK A;  3LGJ A;  1YNX A;  4JI6 L;  1QVG A;  4YCU A;  4DUZ L;  1FL0 A;  1XNR L;  1JJG A;  2UXB Q;  2WB1 E;  3A5Z B;  2WP8 J;  2R6G A;  4O0A A;  1KRT A;  4DUZ Q;  1YJ9 A;  4P75 A;  3S17 H;  5C0X J;  5GAG C;  3I4O A;  1GO3 E;  3HOZ G;  1N8R C;  3BU2 A;  2UU9 L;  3UDF A;  2K50 A;  3CCJ A;  1R9T H;  3S2D H;  3K0X A;  1MIU A;  1HNZ L;  2OTL A;  4JI4 L;  3PUZ A;  1VQ9 A;  3PV0 A;  5GRO A;  4YY3 L;  1CKN A;  1K8G A;  4B3R L;  1PYB A;  5GAD C;  1LYL A;  4Y7N H;  4YY3 Q;  3F2D A;  3M7N A;  4BBR H;  2R93 G;  2D0P A;  5HGQ A;  3EBE A;  3G6E A;  1GVP A;  2EXD A;  4A3B G;  1PH5 A;  3K7A H;  3OW2 A;  4LF8 L;  4JI2 L;  5IP7 G;  4MNO A;  3KDF B;  5FLM H;  3ICE A;  2N49 A;  1B70 B;  1WCM G;  2YTV A;  5IP9 H;  5BR8 L;  4DV5 Q;  1JJC B;  3AYH B;  2XGT A;  2KEN A;  4GOP B;  4POG A;  3KFU A;  1WOC A;  3T1Y L;  2JA7 H;  3HOV G;  2K52 A;  1HNW L;  2ZTE A;  3G48 A;  3TEH B;  3UE1 A;  1I50 H;  2ALY B;  3E0E A;  3IRB A;  1S72 A;  1JB7 A;  3FP9 A;  3M9B A;  1L0W A;  4JBM A;  5M5Y H;  4A3F G;  4R4O A;  4NXN L;  4B3T Q;  1B8A A;  1E3P A;  1Q1E A;  3EIV A;  5IT9 c;  3PF5 A;  1VQF A;  4PMW A;  4NXN Q;  3JC6 6;  3ULL A;  3H15 A;  5LMN L;  3AQQ A;  3STB D;  4KI0 A;  1Y1W H;  2I5H A;  1Q1B A;  4AYB G;  4IO9 A;  2N3S A;  4A3D G;  2RHQ B;  2K75 A;  3H3V H;  1WFQ A;  3E9I A;  3H3V I;  4A3G G;  4R1J A;  2E2I H;  1LM0 A;  1OXX K;  4HIM A;  4DV2 L;  5IY0 A;  2A19 A;  1A8V A;  2NN6 G;  3ZJY C;  4OO1 I;  4DV1 L;  4HJA A;  3HKS A;  1SRO A;  4DV7 L;  1KXL A;  1GKH A;  4DV7 Q;  4A3M G;  4GKJ L;  4LUZ A;  5M3M H;  1I3Q H;  4KLK A;  5GAE C;  4DR3 L;  4QQB X;  3HOU H;  2Z6K C;  4HID A;  3STB C;  2OQK A;  1KQS A;  4DR3 Q;  3CD6 A;  1E1T A;  1NBW A;  3A74 A;  2JE6 I;  1X55 A;  1UEB A;  3A5U A;  2AKW B;  4OX9 Q;  1EUJ A;  2OWO A;  5HY6 A;  1PH4 A;  1XNQ L;  4C2M H;  3FKI H;  3PUY A;  2QEX A;  3F2B A;  1PFS A;  4JYA L;  1XNQ Q;  3SGI A;  4BY1 H;  3CW2 C;  5GAH C;  4BA2 I;  1VQG A;  3I2Z A;  1YHA A;  3PO3 H;  1EQR A;  4APV A;  4DKA C;  2Q2I A;  4DUY Q;  1K73 C;  1JMC A;  4JI0 L;  1EOV A;  1K83 H;  4JI3 L;  1RL2 A;  4R4Q A;  3NEN A;  4GOP C;  3GO5 A;  1A62 A;  3D0F A;  3EN2 A;  5C3E G;  2WFW A;  1UE7 A;  2YV5 A;  3KYH C;  3CF5 A;  1IBM L;  3HOX H;  1XPU A;  4GLA C;  2ATW A;  4IFD I;  1IBM Q;  1P16 A;  4BBR G;  3GTK H;  4X66 L;  1TWC H;  1YVC A;  5M5W H;  5FLX c;  2UUC Q;  4AIM A;  2YU9 H;  3RNU A;  3K8A A;  4UP7 A;  1QZH A;  1SR3 A;  3GTP H;  1QUQ B;  3UDG A;  2KCT A;  1OXT A;  4RG1 A;  4B3M L;  1QVF A;  2JA7 G;  2UXC Q;  4GNX A;  4B3M Q;  1FJG L;  1VQJ A;  3I7F A;  4X65 L;  4DV4 Q;  2PQA A;  2CFM A;  2UUB L;  4A76 A;  4DR7 Q;  4X65 Q;  2F4V Q;  4A3L G;  3HFZ B;  4B3S L;  1W2B A;  3NEM A;  3M4O H;  4BXX H;  1CKM A;  3HKZ E;  3U50 C;  3RLF A;  4DAY B;  1OTC A;  4DV3 L;  1VQN A;  1YJW A;  1MKH A;  2ZM6 L;  4QL5 A;  3J7Z C;  1Y1W G;  2VQE L;  5IYC H;  4DR5 L;  2YTY A;  3CQZ H;  2AWN A;  5ELO A;  3DLL A;  2R92 H;  3J81 i;  4JOI C;  3GTM H;  2HIV A;  1HNX Q;  1VQ7 A;  5IYD G;  1SRU A;  4DV0 Q;  4NPS A;  1X54 A;  3T1H L;  4OO1 G;  2QA4 A;  3T1H Q;  4LNQ A;  4A93 H;  2MQH A;  4K0K L;  2XTI A;  1C7Y A;  1C0A A;  4K0K Q;  3GD7 A;  3I55 A;  4ALP A;  4BA1 I;  2ZTC A;  1E22 A;  5M3M G;  4P74 A;  1CSQ A;  3HOU G;  3TS2 A;  1PH9 A;  2UXB L;  3KF6 B;  2LXK A;  1YIT A;  1D7Q A;  2VQF L;  4A3I H;  4LFB L;  2JA6 H;  3HOY G;  2R7Z G;  4JBW A;  2VQF Q;  2F3I A;  1VQ8 A;  4LFB Q;  1JE5 A;  5M5X H;  2YTX A;  3FKI G;  2JQO A;  4BBS H;  1HZB A;  4DK6 C;  3OTO L;  1AE2 A;  4BY1 G;  3S16 H;  2LXJ A;  2VW9 A;  4LF9 Q;  4UPA A;  3CC2 A;  1TXY A;  3PO3 G;  3OTO Q;  4X6A H;  2JA9 A;  4JCV E;  2D62 A;  4H02 A;  1G51 A;  1EYG A;  1HR0 L;  5JJL A;  1XJV A;  3ULJ A;  1HR0 Q;  2I5M X;  3L7Z C;  2N78 A;  1Y14 B;  3CPW A;  1Q46 A;  2NZO A;  2I5L X;  3GTG H;  3HOW H;  4EQ5 A;  4P71 A;  1Q82 C;  3ER0 A;  3L2P A;  3HOX G;  4C3H H;  4DV5 L;  1KAW A;  2RHS B;  3TQY A;  4JI8 Q;  2UXD L;  1CSP A;  1HH2 P;  4IPD A;  1PH6 A;  4DPG A;  3KJP A;  2A1A A;  4YCW A;  4YHH Q;  3CCU A;  2UXD Q;  1VQH A;  1PA6 A;  4IPH A;  5J3B A;  1VQE A;  5IYB H;  3RN2 A;  3UDI A;  5LMN W;  2AMC B;  1C9O A;  4B3T L;  1EIY B;  1N32 L;  2K5H A;  1QZG A;  2HHH L;  2B63 H;  1N32 Q;  3PSI A;  3KJO A;  2HHH Q;  1HZC A;  4UP9 A;  4IJH A;  5C4J H;  4DR2 Q;  2PI2 E;  3VDY A;  3PUW A;  2K5V A;  2HQL A;  3HKZ G;  1VQI A;  1NY4 A;  4C3I H;  2UUA Q;  4BXX G;  3CME A;  2IX0 A;  2JA8 G;  2E2H H;  2NVQ H;  2VNU D;  2JEB I;  1Q7Y C;  3CCE A;  5IYC G;  2JA5 H;  1IBK L;  1AH9 A;  3RLO A;  5AJ3 Q;  1IBK Q;  3CCL A;  4JI5 Q;  4A3J H;  2R92 G;  1IYJ B;  3UE0 A;  5M3F H;  2WAQ G;  1K3R A;  4PZ6 A;  3W1B A;  2JEA I;  3DM3 A;  3J80 i;  3J81 c;  1PYS B;  4A3C H;  3WWV A;  4AQY Q;  3I4N H;  4IFD J;  3KDF A;  4A3K H;  1KIX A;  4A93 G;  4R4C A;  3CCV A;  1N34 L;  4O2D A;  3CCR A;  4X64 Q;  2D0O A;  5FJ8 H;  4LF4 Q;  2ID0 A;  3H0G G;  4J15 A;  1N34 Q;  3GTL H;  2BH8 A;  4OX9 L;  4JI7 L;  1M90 C;  2A8V A;  4UP8 A;  4LFA Q;  2AWO A;  3RZO H;  4JI7 Q;  2I0Q A;  3Q8D A;  2MO0 A;  4A3I G;  4RMF A;  1X3F A;  1VQO A;  4YCV A;  2JA6 G;  4DUY L;  1J5E Q;  3TRZ A;  4LUO A;  4LF6 Q;  1G6P A;  3NEL A;  1PH8 A;  2VUM H;  4BBS G;  3JAM i;  4DR6 L;  3G71 A;  4DR4 L;  4DR6 Q;  2B3G A;  3RN5 A;  5JJI A;  1G29 1;  4DR4 Q;  3TRE A;  3F8T A;  1EWI A;  1X56 A;  4GNX B;  2EIF A;  1X6O A;  1P8L A;  1NJI C;  5JEA J;  2JK8 A;  2PQA B;  4GN5 A;  2UUC L;  3ULP A;  1NMG A;  3ERS X;  3M4P A;  4X62 L;  1NE3 A;  3HOW G;  1Z9F A;  1PVO A;  1XMO L;  3S1N H;  2OTJ A;  3FHW A;  1KRS A;  1YZ6 A;  4X62 Q;  3HOZ H;  2BA0 A;  2HIX A;  1XMO Q;  2ES2 A;  2IHF A;  5FLM G;  5IP9 G;  2E5L Q;  1VQP A;  4LF5 Q;  3S15 H;  4IOA A;  1V43 A;  3W5O A;  3CCM A;  2UXC L;  3E9H A;  4LUV A;  4DV4 L;  1O7I A;  2FXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...