1XNQQ

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnqQ00
5HY6A 4DR6Q 1QUQB 1T9HA 2V1CC 2Q2UA 4IPGA 1VQKA 4AYBE 2IX0A 1XMQL 1A63A 1Q1EA 2VQFL 4LFBQ 3BZKA 2JE6I 4DK3C 5LMUL 3GTKH 3GTLH 2R92G 1Q81C 5M5XH 5C0XI 3W5OA 5IYBH 1IBMQ 2B3GA 3PIPA 4XTCS 1Q1BA 2BA1A 4DV2Q 1E7ZA 1KRTA 4GLVB 4JI6Q 4LF9L 4GOPA 2VNUD 3CC2A 1VQDA 4APVA 2ES2A 4JI0Q 5J3BA 4JI5Q 3L0OA 4WJ3M 3ICEA 2MO0A 1KIXA 1SMXA 3PUWA 3I56A 3OYYA 4R4TA 2VQFQ 5IP9H 4JI4L 1IXRA 2UXDQ 3SGIA 1KRSA 2HHHQ 2PMZE 5IYDG 3HOVG 1YJNA 5HGQA 1BVSA 1HNZQ 1BKBA 2ASBA 4OWTB 1CKOA 4BXXG 2GN5A 1K73C 3T1HL 2N78A 3NEMA 1VQNA 4JYAQ 2OWOA 1LUZA 4BY7H 3JAMi 5JJIA 1NTGA 2K14A 4A3CH 4A93H 3D0FA 4YWLA 4BY1G 1MJEA 4B3ML 1JJCB 1UE6A 4HJ7A 1VQ5A 3T1YQ 2UU9Q 4DR4Q 1P16A 1VQPA 2F3IA 4LUVA 4GNXB 4B3TQ 4BBSH 4A3IG 5M5YH 4DNIA 4A3GH 4L5QA 2OQKA 4GNXA 1TWGH 1PH3A 4X66L 5H1SE 4BBRH 3H0GH 4HJ5A 1QVFA 3E9IA 5IYDH 3FHWA 3TS0A 3CAMA 5LMNL 4LF6Q 1N33Q 3OW2A 1M1KC 3S15H 1HR0Q 1YJ9A 4LF8L 2R7DA 1B7YB 1IBLL 1SR3A 3TQYA 4B3RQ 4EQ5A 3PGZA 3CMEA 4KLKA 1IBLQ 1P8LA 5FJ8H 4B3SQ 4GOPC 1N34L 2UXDL 3KYHC 4BY7G 1LTLA 4A3KG 5C4XH 4JV5Q 1K0RA 5GAEC 1G6PA 4GKJQ 4YHHQ 2A19A 3DLLA 1M90C 1B70B 3AEVA 3HOUG 2VL6A 2F4VL 1KAWA 4B3TL 2MO1A 3FKIH 1S40A 5C3EG 4DV7L 1Q82C 4C3IH 4JI2Q 3F2CA 2UUCL 1NY4A 1WOCA 3RLFA 4BBRG 1JJ2A 1QVCA 5GQOA 4JBKA 4AIMA 1I94Q 3EBEA 1HZAA 4DAYB 4QGUA 4A3BG 5JEAJ 1XPUA 1K8GA 3CCEA 2B29A 5C44H 2OCEA 2K75A 1WJJA 4X65Q 1TWHH 4UPAA 3UDGA 1YIJA 1XPRA 2HIVA 3I55A 2RHSB 2JJQA 1MJCA 2NVQH 1UEBA 1WCMH 4HIOA 5C0XJ 2IX1A 3U4ZA 1I5FA 1OXVA 4QL5A 4LF7L 3GTJH 2B63H 3BU2A 2JA8H 1HNZL 4C3HH 4Y52H 3LGJA 1JB7A 4IFDI 2CQOA 4JI7Q 2NVTH 2K52A 5C4JH 2VQEQ 4BA2I 2UXBQ 1I94L 4R4CA 1D8LA 4HJ8A 1YHBA 3CCQA 3RNUA 2EQSA 1J6QA 3J81c 4OONA 2E5LQ 1Q46A 4YWMA 4DR2L 1X3GA 4A3JG 2LSSA 1E1TA 5C3EH 3GD7A 4JI2L 2PQAA 1OXUA 1KD1C 2ZTCA 3UE1A 1O7IA 1EUJA 3D31A 1VQOA 2ATWA 2ZTEA 1C9OA 3KLWA 4YHHL 3A5UA 1OXSC 3HKZG 2UUAL 2VUMH 1KHIA 3RZDH 1N9WA 1TWAH 1A0IA 1XTDA 1N36L 1EWIA 3VDYA 3STBD 5GADC 4JC0A 4LF8Q 4KHPQ 1NJIC 4KI0A 3I4OA 2R7ZH 4HJAA 1HNWQ 1Q86C 1K8AC 2A8VA 5ELNA 4UY8C 1CKMA 2H5XA 4BA1I 4L5SA 1VCIA 4P72A 1Q12A 3CD6A 1D7QA 2DUDA 3AFPA 1CKNA 3AYHB 3ULJA 2MNAA 1SROA 3CC7A 4A3JH 5IY0A 4LF4L 4GNXC 1PH7A 1GVPA 3I4NH 1HJPA 4OWWB 2ALYB 2NN6G 1E3PA 1EYGA 3PO3H 4YCUA 1CSPA 1I3QH 1CSQA 2ZM6L 3CCUA 2E2HH 1Y1VG 1X3FA 4NXML 3M4QA 2DGYA 2Y0SE 3AQQA 4BY1H 5E7NA 4R4OA 2N49A 2VUMG 3FP9A 1YBYA 4HIMA 1A62A 1VQEA 4A3FH 3M4OH 2PI2E 1VQ6A 1FJGQ 3S16H 4JI3L 4IPCA 2UXCL 1PA6A 3RLOA 1W2BA 1NMFA 1N8RC 4A3DG 2R7ZG 2AKWB 2E8GA 1HZCA 2VS1A 2WB1E 4POFA 2JA5H 3KJPA 1NMGA 3GTPH 4LNQA 2NVXH 5FLXc 1XMOQ 2JA6H 2MFIA 2XTIA 3HFZB 4IOAA 1TWFH 1IYJB 1FGUA 1PFSA 4JI5L 5IP7H 4JI0L 4BXXH 1V1QA 1B8AA 2QGQA 4R4IA 1L0WA 1PH8A 5M3FG 3S2HH 1HNWL 1MIUA 5IYCG 1HR0W 3PO3G 1PVOA 2R93H 3F1ZA 4A3CG 4A93G 4DR2Q 5BR8L 4A3MH 4DAMA 3F2DA 1DGSA 2AMCB 3J80c 2QEXA 4FDBA 2OQ0A 5IT9c 4JI1L 5LMUQ 2PNHA 4LFAQ 2N3SA 1IBML 2UUAQ 1VQGA 3CCJA 1ASYA 4DV3Q 4IFDJ 4MZ9A 1UE5A 4JI7L 4DV1L 4IO9A 4LWCA 3B6YA 4MTNA 4K0KQ 3KF8B 3CCLA 2UXBL 2JA5G 1YEZA 1XJVA 3HKZE 5IE8A 2E5LL 3HKSA 1LYLA 3KDFA 3UDXA 3ERSX 2ZJQA 1QZHA 1VQCA 4PZ7A 1Y14B 2N8NA 2AHOB 4PZ6A 3U58A 4LF7Q 2UXCQ 1FJGL 1YHAA 2D0OA 1HH2P 1SFOH 1VS0A 2HHHL 3KFUA 1GKHA 4A3MG 1X56A 2K5VA 2WFWA 1IBKL 1VQ9A 1GD7A 3S14H 3ZJYC 2ZM6Q 3HOUH 2JK8A 3BJUA 1X55A 1EOVA 1U0LA 3FKIG 1XNRL 4IFDG 1CUKA 3PF5A 2LXJA 4XIGS 1NBWA 4JI6L 4LF9Q 2ZTDA 2AWOA 3K7UC 4IOCA 4QJFA 3RN5A 4A3IH 4A3GG 4B3SL 1RIPA 4GN3B 3CCVA 4NPSA 3G71A 5EAYA 3MXNB 5BR8Q 3HOXH 1HZ9A 3K7AH 4GKJL 4PMWA 3J81j 1WFQA 4JV5L 4OWXB 2IY5B 3KF6A 1IL2A 4C2MH 4OO1I 1PYBA 1E24A 3I7FA 3A0JA 3CW2C 2R6GA 4TQUS 4A4IA 3M85A 1L2FA 3CQZH 3G4SA 1SE8A 5LMNQ 2KBNA 1XMOL 1JMCA 2E2IH 4POGA 3UE0A 1MKHA 2RCNA 3UDIA 3J7A5 4X62L 2WB1G 4YWKA 4DK6C 2NZOA 3NELA 3GTQH 1X3EA 5GROA 3TS2A 4JBWA 1RL2A 2F52A 2YTVA 3PUVA 4DR3Q 2I0QA 1KQSA 1JJGA 1XNRQ 3J80i 1U5KA 4JOIA 3TREA 3W1GA 1GM5A 4AQYQ 3T1YL 3HOWH 4LF5L 2BH2A 3PO2H 4DR4L 5JJKA 4DV5L 3A74A 5M5WH 4HIKA 3M9BA 4GS3A 2KENA 4O2DA 2K5HA 1J5EQ 3MEFA 1ASZA 1SLJA 3PSIA 1V9PA 1X54A 4ME3A 4O0AA 1Z9FA 2I5MX 3E0EA 3S17H 1VQFA 4GLXA 2WP8J 1IBKQ 1KXLA 1TWCH 4JYAL 3S1RH 1Y1WH 3TRZA 2UUBQ 4JBJA 2K50A 4H02A 1S3OA 3J81i 1UWVA 2HIXA 1VQAA 1YZ6A 1VQ7A 3AFQA 2NZHA 3CC4A 3OTOL 1PHJA 4NXNQ 2JA6G 1SN8A 5M3MH 3TEHB 1AE2A 2VZAA 4ALPA 1OTCA 4LFAL 3CMAA 4DV0Q 1QUQA 3GTMH 4C3JH 4DV7Q 2Q2IA 1Q7YC 1N36Q 2CKZB 3JC66 3GDEA 4DV2L 3NENA 1KC8C 4KHPL 1Y1VH 2WAQE 3GO5A 2JEBI 2PQAB 4YCVA 4L5RC 2GVAA 4OO1G 1R9TH 2IHFA 4A3FG 2YTXA 5DLQE 2JA7G 2BH8A 1VQIA 4DR6L 4DR7Q 4LFBL 4DV0L 5AJ3L 4Y7NH 4EX5A 1E1OA 4GLAC 4A3DH 4J15A 2KHJA 3K8AA 3I4MH 5FLMG 2GVBA 3S1MH 1HR0L 1C0AA 3HOZH 1W3SA 4X64L 2KHIA 4LF6L 3S1QH 1XNQQ 1VQMA 1L1OA 2ID0A 3KDFB 2YTYA 4GKKQ 2K5NA 5GAGC 1XPOA 5C0XG 3K80C 2CFMA 5M3FH 1AH9A 2VW9A 2R7FA 2L15A 1WYDA 4IPDA 2NVYH 3RZOH 1EIYB 4AYBG 2JA9A 4YY3Q 3PUXA 4DR1L 1K3RA 2R92H 4X65L 3CCSA 1PH1A 5IWAL 4DV5Q 3I4NG 4DKAC 1G291 3PF4A 4LF4Q 4QIWE 1V43A 2IHEA 2ZJPA 2JA7H 4BBSG 3F8TA 2UUCQ 4NXMQ 4UP9A 3H3VH 2Z6KC 3F2BA 1YJWA 1J5EL 5K36G 3T1HQ 2Y0SG 4A76A 3ULLA 2EXDA 1OXXK 1LM0A 4DR3L 4X62Q 1H95A 3H15A 3U4VA 1A8VA 4JCVE 2RF4A 2YYZA 1N32Q 4P71A 3RR5A 4B3RL 3M3YH 4OX9L 1N34Q 2HQLA 2D0PA 1KL9A 1FVIA 4OXPA 1UE7A 4DR7L 4DV6L 1G51A 4YCWA 5FJ8G 1VQ4A 2Z0SA 4X6AH 1NE3A 4LUOA 1X9NA 4JBMA 3CP0A 1EFWA 1HZBA 2RHQB 5AJ3Q 2QA4A 2CWPA 4A3KH 3CPFA 3CF5A 2XGTA 3PV0A 5IYCH 5IYBG 3NBHB 2I5HA 2JQOA 4L5TA 1BBUA 1C7YA 2R93G 3PUYA 1QVGA 2OTLA 5JJLA 3Q8DA 4DUZL 3UDFA 1YI2A 1PH5A 3ULPA 3U50C 2OTJA 3STBC 4KHZA 4DR5Q 1HNXQ 4QY7A 1VQJA 5JEAG 3S24A 3K0XA 1FL0A 4DUYL 3I2ZA 4DV4Q 5IP9G 3CCMA 2ZJRA 3H0GG 2KCMA 4GOPB 3BZCA 2IT1A 4YY3L 1UE1A 1VQLA 3J7ZC 3HOVH 4QQBX 2CCZA 3RLNA 3S1NH 3RN2A 1PH2A 1SRUA 2E2JH 2PI2A 2VQEL 1L1OB 1Y1WG 2CWAA 2NN6I 4P75A 2HT1A 4A3LH 2C35B 2UUBL 4JG2A 1QZGA 1XNQL 1CKNB 3W1BA 4TVAB 3WWVA 5GAHC 2FXQA 4P73A 4JI4Q 5ELOA 4R4QA 4IJLA 4MNOA 4DV4L 4DR5L 1HNXL 3GTOH 4DV3L 3M4PA 1E22A 5M3MG 3G6EA 3KOJA 4P74A 4UP7A 4JI1Q 2EIFA 4LF5Q 4DPGA 4DUYQ 4AQYL 2YV5A 1S72A 1K83H 3HOWG 1L1OC 4NB3A 1PV4A 3PO2G 2WAQG 4DV1Q 4K0KL 2F4VQ 3PUZA 2Q2TA 1YHQA 3CXCA 4IJHA 2A1AA 1PH9A 3EN2A 1VQBA 3KF6B 4R1JA 4LFCL 3CCRA 3EIVA 5LMNW 4A75A 2K4KA 1IZ6A 3HOXG 3PCOB 1XMQQ 3A5ZB 4DUZQ 4A3EH 1JT8A 4IPHA 3S2DH 3G48A 1WCMG 2JEAI 1AE3A 2D62A 4OX9Q 4A3LG 1N32L 4NXNL 1X65A 2VY3A 3OTOQ 1I6HH 2B63G 3I4MG 3M7NA 2KCTA 1PH4A 3L2PA 4GN5A 3HOZG 3H3VI 4X66Q 4PZ8A 3GTGH 2Z6KA 4GN4B 4RG1A 3E9HA 3CPWA 4DV6Q 4RMFA 5C4XG 4LFCQ 1PYSB 1TXYA 4JI8L 3L7ZC 4HIDA 1YITA 1PH6A 1K9MC 1N33L 3PIOA 1I50H 4HJ9A 1Z47A 4JI3Q 2LXKA 4LUZA 2UU9L 1VQHA 4B3MQ 5IWAQ 4A3BH 1YNXA 5C44G 3HOYG 3DM3A 4A3EG 1WI5A 4AH6A 4DR1Q 1BBWA 3IRBA 4PG3A 2I5LX 4JOIC 4WJ4A 1VQ8A 4X64Q 5FLMH 1OXTA 2MQHA 3K81C 4JI8Q 3JAMc 2AWNA 2JA8G 1GO3E 3HOYH 4GKKL 1EQRA 2Q2HA 1YVCA 2YU9H 1EIFA 1JE5A 4LW1A 3ER0A 2BA0A 4UP8A 3KJOA 1Q8KA 1EQQA 1X6OA 5IP7G
chains in the Genus database with same CATH superfamily
1Z6HA 4DR6Q 3C2PA 1QUQB 1W6JA 2HD3A 3KUPA 4RCNA 1VQKA 4AYBE 2IX0A 4KKUA 1CFMA 5EQ0A 4DK3C 4Q5VA 2O5JC 4ZUIA 2R92G 2EXZA 5C0XI 2XRSD 1IBMQ 4JPBW 2RKSA 2B2UC 4GLVB 4K5WA 4GOPA 2VNUD 1EY0A 3QWNA 2NVXB 2WKCA 4APVA 4HEDA 3S1NB 4JI0Q 1PTOH 1JORA 1SMXA 4H0LC 4R4TA 2CH4A 5IP9H 1IXRA 1M4VA 1HTLD 1WTOA 2B2UA 1SYDA 2B2WC 3QB3A 4IQZA 2A6HD 2TMPA 1E2WA 1F2MA 1BXTA 1SMYC 2ASBA 2PZWA 5HURA 3T1HL 3NEMA 3RMHA 1K8OA 1I4GA 4BY7H 3EJIA 5JJIA 4FF1A 4A3CH 1UE6A 1V1PA 1V1OA 2UU9Q 4DR4Q 1P16A 4GNXB 1G6ZA 2BE5C 4B3TQ 4A3GH 4C3IG 1PH3A 4O42A 5H1SE 3KLSX 1QVFA 2Q8RE 1GHJA 1EOTA 5FO9B 2IW3A 5CV9A 3OW2A 4PV1C 4BY1B 3S14B 1IBLL 1SR3A 4YIJA 3TQYA 1D2BA 4B3RQ 1I4RA 3ITPA 2E2DC 5ELBA 2K05A 1LTLA 1CI3M 4GKJQ 2A19A 3NP8A 1SYEA 1KAWA 1L0YB 2OF1A 3EROA 2UUCL 1NY4A 4BBRG 3OMCA 3OIQA 1EY6A 1I94Q 3GTJB 1HZAA 5JEAJ 1TIID 3RZDB 1XPUA 2E76C 3G6JB 3EA6A 1K8GA 1YIJA 1LT4D 3OW7A 4KD3A 4X65Q 4UPAA 3I55A 2JJQA 4QL5A 5D65A 2ICEC 2JA8H 3LGJA 1JB7A 4JI7Q 5C4JH 1EWCA 2HCIA 4V0BA 3C1FA 1CM9A 4ZYSA 3D3RA 1J6QA 2EZVA 4DR2L 2LSSA 1E1TA 3I4LA 3GD7A 4I7ZC 5I4DA 1OXUA 1SYGA 1KD1C 3PQIA 3UE1A 1EUJA 4OIKA 4J1MA 2ZTEA 3N52A 3ZYYX 1CZGA 1OXSC 2VUMH 3RZDH 1TWAH 1I4HA 1L0XB 1N36L 3MFGA 1EIHA 4FNFA 2CQAA 4KI0A 2MUYA 1SYFA 4FP5D 2A8VA 5ELNA 1STEA 4L5SA 4JW0A 4P72A 4CJ0B 3O13A 2FMCA 4DNRB 1D7QA 1HCZA 2DUDA 4TKOB 1BCPD 2F0TA 1PH7A 3I4NH 1HHVA 2ALYB 2WACA 2GA4B 1CSPA 1DCZA 2DNEA 2DGYA 4BY1H 1QJOA 4R4OA 5E7NA 2PI2E 4KD4A 1FJGQ 3OMGA 2UXCL 1NMFA 5EGTA 5EKLA 1N8RC 3MXNA 5CV6A 5C44B 3HOYB 4MN3A 2EYOA 2RQXA 3GTPH 3J80L 2K01A 1S5FD 1FGUA 5IP7H 1V1QA 1B8AA 1AFPA 4R4IA 1TQOA 1HR0W 5LL6X 4XT1B 5FO7B 1QNUA 4WJWA 2AMCB 4FDBA 2OQ0A 2WB1B 1IBML 4LFAQ 2OT2A 4XYQA 1ASYA 3TMEA 1VF5C 3KF8B 3CCLA 2JA5G 1IKMA 3J7AF 1C8CA 5IE8A 2B39A 2F0MA 1LYLA 3UDXA 4B9WA 5IT9E 1QZHA 2A6HC 1I4PA 3OOCA 3U58A 4OHJA 4ZK9B 1F9SA 4LF7Q 3R8BA 2CW0D 4CDFC 2XIWA 1EY8A 1JCKB 1VQ9A 3ONAB 4BWGB 1DONA 3S14H 3HOUH 2JK8A 4J8QA 3VYSA 1U0LA 3FKIG 3D4DA 2CVRA 4K6DA 4EQPA 1NBWA 4JI6L 3Q22A 2AWOA 3K7UC 4XQJA 4QJFA 1WTXA 2JA8B 1RIPA 4R9WA 4CJ1B 1HZ9A 1I6VC 4G57A 4PMWA 3KF6A 1WTQA 1E24A 3I7FA 3A0JA 3CQZH 2XN9C 2E2IH 5JVH3 3I8ZA 5IOCA 4V190 3UE0A 1MKHA 1TS3A 1PTOC 1JWSD 1K83B 5DM63 3TS2A 1RL2A 2YTVA 2XSCA 1TY2A 3J80i 1NUCA 1U5KA 5TSSA 2K7VA 4EQNA 1BBXC 4KY5A 2OXPA 3T1YL 2BH2A 1PFNA 4DV5L 4HIKA 3EQLC 1ASZA 1STGA 2ZXPA 3D4RA 1F77A 2YU9B 1AZQA 1V9PA 1X54A 2I5MX 1STHA 1GUNA 1VQFA 1KXLA 5T1IA 1TWCH 4JBJA 2K50A 5M5YB 1S3OA 2Z6BA 1AZPA 3MWYW 1YZ6A 1VQ7A 3NTKA 3CC4A 3OTOL 2JA6G 1SN8A 4ALPA 3K5NA 1OTCA 3CMAA 2K5WA 1QUQA 5J22A 2B2TC 3VA5A 1Q7YC 3QOJA 4U673 3QG1A 3A8JE 2JEBI 3NHHA 4L5RC 2GVAA 4ZCKA 2LKVA 3MA2B 4A3FG 2MP1A 1SSOA 3K7AB 1KTKA 4DR6L 1IW7C 5CBAE 4LFBL 4DV0L 1DYQA 2LS01 1E1OA 4EX5A 1F2YA 2EY1A 4J15A 3K8AA 3TZDA 5FLMG 3S1MH 1YNND 3E0JA 3T51B 3S1QH 5IGEA 4RGNA 1RD9D 4DXGA 2K5NA 5GAGC 5JJZA 1B53A 3K80C 5M3FH 2D9UA 4C3HB 5D14A 1WYDA 3RZOH 1E2VA 4UAIA 2R92H 1SNCA 1KNAA 4DV5Q 5CV5A 1VMPA 2K5QA 2ZJPA 3F8TA 2UUCQ 3H3VH 4BBSG 3ULLA 3NK9A 1OXXK 3BG3A 1VF7A 4WORA 4H7BA 1A8VA 4JCVE 1ET9A 2RF4A 4P71A 4RFBA 4B3RL 1N34Q 5IT9L 4PMBA 3H94A 1G51A 5FJ8G 4DV6L 2FFKB 2Z0SA 1VQ4A 4X6AH 4IUUA 2F0FA 4MIUA 3CU7A 4FXKC 5IYBG 2I5HA 4PMCA 1LACA 2R93G 5D3IB 1QVGA 1LO5D 3Q8DA 4DUZL 5CR3A 1FNVA 3ULPA 2IL8A 1B3QA 4QY7A 1VQJA 3K0XA 3I2ZA 4M1UB 4DV4Q 4RGMA 1K0SA 1X3PA 3H0GG 2MPMA 1WTPA 4YY3L 1UE1A 3HOVH 5C5LA 1JOOA 2DNCA 3S1NH 2E2JH 2VQEL 2SNSA 2A69D 1PXUA 4C3IB 1G91A 1LLRD 1S5ED 1Z7TA 4A3LH 4DFAA 1XNQL 3Q6SA 2FXQA 2F3WA 5ELOA 2UXDL 1HNXL 1HFNA 3A54A 1GOZA 4P74A 2EPBA 2EIFA 4KKTA 4DAVA 4FF2A 3HOWG 4QMGA 4DV1Q 2Z4HA 3PUZA 1PH9A 4RAUC 3JAME 3T16A 4CHTB 1EY4A 1VQBA 2LY7A 2QDLA 3CHBD 3PCOB 1II3A 3S2DH 2DJFC 4FVMA 1S5DD 4RHRA 3OTOQ 2VY3A 1RKNA 2B63G 4HTHA 3L2PA 1RJTA 4GN5A 2F0LA 2G9HD 4PZ8A 3CPWA 1HUNA 3E9HA 4A93B 4RMFA 4JI8L 3L7ZC 1N33L 1PH6A 1K9MC 1DZ1A 2B63B 2L0CA 3TP7A 3K57A 4A3KB 3S1MB 1VQHA 5IWAQ 4Y7NB 2I07B 1YNXA 5C44G 3HOYG 2HDLA 4DR1Q 4BS9A 5C4HA 1GUOA 1D5XC 4X64Q 5FLMH 1OXTA 2MQHA 3JAMc 2EOTA 4K8IA 1EQRA 1YVCA 2Q2HA 1EIFA 2O2LD 4LW1A 1JE5A 2BA0A 2I46A 2E74C 4KHPL 1BOSA 4NP5A 4A3MB 1XMQL 4HSPA 4LFBQ 1B9MA 2JE6I 5LMUL 1PFMA 5M5XH 1DOMA 2KECA 2B3GA 3PIPA 1Q1BA 4IUVA 4ZKBB 1E7ZA 1KRTA 3D6CA 4JI6Q 5G3LD 3CC2A 2BCOA 3E5SA 4DF7A 4KJNA 4WJ3M 2F0KA 4XT3B 2MO0A 4I7AA 3OYYA 4KMUC 2VQFQ 2ZXOA 3SGIA 1KRSA 2HHHQ 1U4RA 5IYDG 4QIWB 2A5HA 1YJNA 4Z9CB 2AQ1B 1BVSA 1FR3A 1BKBA 1IYVA 1BUVT 2R93B 4BXXG 2GN5A 1K73C 1VQNA 2OWOA 1LUZA 3P20A 1SNPA 4TSSA 3JAMi 4ZQ3A 2NVTB 5M3MB 3I72A 4A93H 3D0FA 2IWHA 1JJCB 1VQ5A 3T1YQ 2QF7A 1ICWA 3FDTA 4DAPA 1VQPA 4KHVA 4LUVA 1SDFA 2QDBA 3HKZB 4X66L 2R7ZB 5L37A 4BBRH 4HJ5A 1BCPB 3CAMA 3QOLA 3NQIA 3SXHA 1M1KC 3S15H 1HR0Q 1YJ9A 4LF8L 2R7DA 3TP5A 1TS5A 2K6AA 4HCEA 5JPNC 1IBLQ 1EIGA 5FJ8H 5IGBA 3SVMA 1N34L 4BY7G 2E75C 5KNBA 1QOHA 2JP1A 2KCCA 3I90A 1B50A 1S40A 1GHKA 4DV7L 4C3IH 4IUNA 5HGTA 4C1NI 1WOCA 3RLFA 4JBKA 3BDOA 1JJ2A 1YNNC 3EBEA 4QGUA 1XTCD 2OCEA 2NVQH 4HIOA 5C0XJ 1E0BA 1F2ZA 2BDOA 5ELEA 2C5CA 3U4ZA 4B08A 4LF7L 1EWHA 2Y0SB 2B63H 4L8JA 1HNZL 2SEBD 4L63B 2UXBQ 4R4CA 1YHBA 3VR3A 2E5LQ 1Q46A 4YWMA 5C3EH 3NBHA 4NW2A 2PQAA 3J7AV 2KUMA 3VR4A 2K03A 2ATWA 1C9OA 3LWEA 2Q8IB 3KLWA 4RWSC 1KHIA 5IGCA 3R2TA 1XTDA 2KEDA 5IODA 4JC0A 2D5DA 4KHPQ 2R7ZH 3KBXA 4R8IA 2K32A 1ESRA 3I4NB 4UY8C 2H5XA 2EVBA 1LV9A 2RA4A 3ULJA 3A56A 5EPLA 5KGUA 4LF4L 4GNXC 1RODA 1GVPA 1LTBD 3GV3A 4N8X1 1HXYD 2NN6G 2XVSA 3PO3H 1EY5A 2ZM6L 1CSQA 3M4QA 3URYA 2VUMG 3FP9A 1JC7A 1LT6D 4A3FH 3S9WA 1YNJC 4PQXA 3S16H 3TN2A 2B8FA 1TWGB 1PA6A 5ELCA 1DXMA 4A3DG 2FMMA 1MSGA 4POFA 1NMGA 1A3VA 1ILQA 2MFIA 1TWFH 3C46A 1PFSA 4JI5L 4FF3A 1Y69U 1L0WA 1PH8A 5M3FG 5M9OA 1TR5A 1MIUA 5IYCG 2KVMA 1SXTA 1PVOA 1IYUA 2VB3X 2EY2A 4HR7B 2TSSA 5FOBB 1O78A 4A93G 4A3MH 1DGSA 3J80c 1B3AA 4JI1L 3ND9A 4MZ9A 3DHQA 1LABA 2X6GA 1R9TB 4MTNA 2F3VA 1KDAA 3HKZE 3WDNA 2PW5A 3HKSA 5CV4A 2ZJQA 1H9KA 1VQCA 1Y14B 2N8NA 4CDEC 1UEAB 4PNYA 1Y8PB 3A8KE 1HH2P 1PLFA 2RVLA 1NNXA 1AW7A 5I2XA 1A3UA 2HHHL 3KFUA 2MHVA 1V1PB 3ZJYC 2ZM6Q 1X55A 3A55A 1CUKA 2IJ0A 3HG9A 1KABA 4LF9Q 2ZTDA 1D1KA 3RN5A 4F87A 2PMZB 3HS0C 4A3GG 3CCVA 4HMIA 1EFID 3G71A 4XDXA 5EAYA 3K7AH 3J81L 3J81j 1WFQA 3S2DB 4A3GB 2IY5B 4B9XA 4C2MH 2V4DA 3G4SA 1JMCA 2KBNA 4QF4A 2F0VA 2NBFA 4POGA 2XWBB 1I50B 1SJED 2A6ED 2WB1G 4DK6C 3NELA 1EY7A 2EJFC 4JOIA 1GM5A 5JJKA 1TU2B 3P1HA 3NQTA 2K5HA 1J5EQ 3MEFA 4IURA 2QILA 4ME3A 4Q0FA 1KLGD 4A3FB 3E0EA 3S17H 2ZXRA 4GLXA 2SOBA 5BN3A 3TRZA 5I6WA 3FVQA 1AP0A 4H02A 3J81i 2HIXA 1KNEA 2PPBC 1JICA 4NXNQ 1Y1VB 1PHJA 1HTPA 2VZAA 4C3JH 4G7ZC 1Y8OB 3GDEA 2X69A 3NENA 5FLXL 1MD2D 2O5IC 2PQAB 4YCVA 2SNMA 4ME5A 2F0QA 2IHFA 4KTAA 2QEJC 2JA7G 4KK7A 4DR7Q 5AJ3L 4GLAC 1R4PB 1C0AA 1HR0L 3HOZH 1R4QB 4CJ2C 2KHIA 4LF6L 1J8IA 3MXPA 1X3QA 1VQMA 3KDFB 1O7YA 2CFMA 3X3MA 1AH9A 4P2CB 2WIIB 2L15A 3E6ZX 2NVYH 3MXGA 1GUSA 4YY3Q 3PUXA 4DR1L 2RDGA 3UI2A 5E4WC 1EYCA 3CCSA 5IWAL 4DKAC 2F0IA 1G291 3PF4A 1TVXA 2NVQB 1PRTF 2L55A 5BN4A 4QIWE 1V43A 3BS1A 4UP9A 3F2BA 3S1QB 3S17B 1FNWA 2PO4A 5EBCA 1LM0A 4X62Q 1H95A 3VR6A 3H15A 2E2HB 3U4VA 3RD4A 3FPUB 4X3UA 3RR5A 1ILPA 1CA6A 1KL9A 4OXPA 1UE7A 4DR7L 4A3JB 2QKIC 4LUOA 5G3LF 1WD0A 4DK1A 4ODGA 2EYMA 5CORA 2OTLA 3UDFA 1TWFB 2KCNA 1FGBD 2OTJA 1S4ZA 1C4QA 1TS4A 4DR5Q 2RDFA 4C2MB 2PZUA 5JEAG 1DD2A 1FL0A 1EU4A 2ZJRA 4A3BB 2P5ZX 4WFN3 4QQBX 3V96A 2CCZA 3S16B 1O7ZA 4OIJA 1L1OB 1ET6A 4ULLA 2NN6I 2HT1A 2C35B 4JG2A 1QZGA 3RUZA 3H6MA 4ID6A 1CKNB 3PIP3 4TVAB 3WWVA 3GTMB 4JI4Q 4R4QA 4MNOA 3GTKB 4DV3L 1SE3A 1E22A 5M3MG 3KOJA 4UP7A 4AQYL 3GTOB 4IN3A 1WTRA 2EDGA 1K83H 1PV4A 2F4VQ 2A1AA 2DN8A 3EN2A 4LFCL 2E2IB 2MGSA 2ZT9C 3H91A 1DM0B 2K4KA 4K14A 1XMQQ 2B2VC 4A3EH 3GV6A 3MHBA 2JEAI 2D62A 2DY8A 2A6EC 4F88A 1RDPD 2QW7A 4A3LG 3HEJA 4NXNL 1I6HH 3I4MG 4X3KA 2KCTA 3IFTA 2B2YA 1U4LA 3FEWX 2Z6KA 1FYCA 5C3EB 1PYSB 1TXYA 4HIDA 1YITA 3HOUB 3PIOA 4JI3Q 2K28A 1NCVA 2RBMA 3WOEA 2XNAC 4LUZA 3GTGB 2L4NA 1SYCA 1PRTD 2XWJB 3DM3A 4A3EG 1BBWA 3IRBA 2EYPA 2I5LX 2OEOA 3K81C 4JI8Q 2AWNA 4ZRZA 2H1EA 5KEEA 5AFWA 3ER0A 4DA2A 2NZ1D 3SK6A 3M4YA 2XRQD 4K2KA 5IP7G 2KHSA 1LTSD 1T9HA 2V1CC 1A63A 1Q1EA 3T13A 4KN7C 1Q81C 1PTOD 5IYBH 2WV6D 3JAML 2H4OA 2BOSA 3K5OA 1Q90A 1PFBA 1ZEQX 3TDQA 4LF9L 1WTVA 1BNZA 1KLUD 1B2TA 1D6EC 2ES2A 4G7OC 4JI5Q 5J3BA 4N8FA 3L0OA 1SEBD 5ELDA 3ICEA 1HA6A 4FF4A 3I3CA 1KIXA 3PUWA 1WCMB 3I56A 1K3BC 1STYA 2UXDQ 3PMFA 1TWHB 1G2SA 1NAPA 3D6WA 3TBIB 1YNJD 3HOVG 3J80E 1UNSA 5E4XA 1Q3LA 2VXWA 1CKOA 3BVZA 3SK4A 4BY7B 4K5VA 4IUPA 1Q8IA 2AQ3B 1XX8A 2F0PA 1LTGD 4HSVA 1WD1A 1HRJA 2F3IA 4BBSH 4A3IG 4L5QA 2OQKA 3HOXB 1PTOB 3H0GH 2EYLA 3E9IA 3EFXD 3TS0A 5LMNL 3T4AC 1N33Q 1QNKA 2WAQB 5IIFA 1B7YB 3EVQA 3PGZA 4KLKA 3MTSA 4K5XA 5ELFA 5M5XB 1HQRD 3D4WA 4A3KG 5KRUA 5C4XH 1K0RA 1G2TA 1BDOA 1B70B 3AEVA 2VL6A 3DM1A 3FKIH 1Y1WB 4CDCC 1Q82C 4KN4C 3F2CA 1NSNS 4ZLTF 4AIMA 5JEAH 1CK1A 4HCSA 2O4XA 1RTNA 4BBRB 2B29A 2K75A 1WJJA 3UDGA 2RHSB 2FHTA 1MJCA 2WKDA 3NWSA 2K1BA 3N6RA 3IL8A 2IX1A 1I5FA 1OXVA 5E1FA 5CBEE 3GTJH 3T53B 4S3SA 4C3HH 3A7LA 4Y52H 4IFDI 2NVTH 3NWTA 2VQEQ 1I94L 3RNUA 1H9SA 2EQSA 3J81c 1JQYD 4A3JG 5LL6S 3A8IE 1H9JA 4KY6A 4CKEA 4JI2L 1KAAA 2IPKD 3V2TA 2ZTCA 1O7IA 1VQOA 3D31A 5C3XA 1ZYRD 5KYIA 1BR9A 2B2WA 2B2TA 4A3IB 4IZ8A 1EWIA 5DM73 4LF8Q 3SK5A 1NJIC 3I4OA 1HNWQ 1QB5D 2A69C 4QUCA 1BO0A 1CKMA 4QB4A 4BA1I 1SFOB 4UDUC 1Q12A 1C48A 2K5DA 2MNAA 4A3JH 4NMZA 3VYUA 4FXDA 1JOQA 1SNMA 1HJPA 4OWWB 1EYGA 1SBBB 3CCUA 1I3QH 2E2HH 2B2YC 4NXML 1Y1VG 2SDFA 3LX0A 4DAYA 2F0HA 2NWGA 4HIMA 1A62A 2F03A 1A2TA 4K2LA 4JI3L 4IPCA 3RLOA 4CDDC 2R7ZG 3I73A 1DOKA 1GUGA 3KLRA 2F0DA 2JA5H 1B9NA 4LNQA 2NVXH 2NVYB 5JPMC 2F0SA 5FLXc 1XMOQ 4DU9A 4L6TB 2JA6H 4IOAA 1GUWA 1IYJB 5JVG3 3BZDB 4LMQD 3S2HH 1HNWL 1MGSA 3PO3G 3F1ZA 4DR2Q 3K0YA 5BR8L 4DAMA 3F2DA 4OO1H 5LMUQ 2QEXA 5I9PA 2KA7A 3CRLC 2N3SA 2Z8LA 3CCJA 1EEID 4IFDJ 4NDXA 5IGDA 4K0KQ 4LWCA 3B6YA 2UXBL 2WINB 1XJVA 4MTKA 4N9PA 3QIAA 4G7HC 2E5LL 3KDFA 3OIPA 5C5MA 3ERSX 3I91A 1LT5D 4PZ7A 4C3JB 2F0EA 4PZ6A 2UXCQ 1LT3D 4UHVA 3K59A 1D5MC 1QE6A 1X56A 2K5VA 2WFWA 3QJYA 4ILWA 1EOVA 4IFDG 5FLXE 2JA6B 2E2JB 2G9DA 3BYTB 2PYKA 5I2YA 2G5DA 3L9AX 5BR8Q 4H13C 1ESFA 1PTOF 4OWXB 1IL2A 4FO2A 1JR0D 3W3AA 5T1GA 3M85A 5LMNQ 1XMOL 1SE8A 3OPOA 4OELB 3CRKC 3UDIA 2RCNA 1I3QB 3J7A5 4GZYC 4YWKA 2B2VA 1AEXA 2F52A 1GUTA 2I0QA 1JJGA 2F0JA 1XNRQ 3TREA 3NTHA 1CT1D 1X32A 1EU3A 4KY7A 2M00A 2N55A 2NTTA 1CZWA 3LWUA 5CC4A 4LF5L 3FMCA 1IL8A 3D8GA 5M5WH 3M9BA 4GS3A 4JK1C 4O2DA 1SLJA 4KKSA 1F9QA 4I65A 4O0AA 1SYBA 2WP8J 1IBKQ 1DOLA 4JYAL 4A3DB 2R3ZA 3S1RH 1JE4A 5DEHA 5KNDA 2L11A 3K6OA 4TRDA 2J0TD 1VQAA 2A73B 3BDLA 5M3MH 3J81E 1AE2A 5M3FB 3DEPA 4LFAL 5KIXA 4DV0Q 3GTMH 3GTQB 4QCLA 4DV7Q 2Q2IA 1ZYRC 3G7LA 1N36Q 1ENFA 3JC66 4IUQA 2L1BA 5COYA 1KC8C 2Z1CA 3E3XA 1H9RA 2EJGC 3GO5A 1R9TH 1U4PA 5DLQE 2BH8A 1VQIA 5CV7A 2EY6A 4A3DH 1A6XA 3I4MH 1W3SA 5LHY1 1XNQQ 5I9OA 1L1OA 2YTYA 4GKKQ 1LTAD 1XPOA 5C0XG 3DUZA 1UUPA 2JA9A 1PH1A 4ZUJA 3TP8A 4LF4Q 3T56B 3WOFA 1G8ZD 1BF4A 4NXMQ 3Q23A 5CMDA 2BDNA 3NSWA 1YJWA 1S5CD 2Y0SG 1IW7D 4A76A 5FO8B 4DR3L 2YYZA 1N32Q 2X6LA 4RHSA 4IUTA 3M3YH 4DK0A 3GQBA 3NBIA 1KDCA 2F0NA 4HMJA 1NE3A 4RGTA 1RCVD 2QA4A 3CPFA 4AYBB 2XGTA 3MXUA 4L5TA 1EQVA 3NBHB 1BBUA 1SE2A 1C7YA 4KJOA 1T5XD 5IGFA 1D1IA 3U50C 5K36H 2KEEA 4KHZA 4RA8A 3SR1A 1RHPA 5FK9C 4MHEA 3S24A 3BDCA 4DUYL 1XWEA 4OEMB 2KCMA 4GOPB 3BZCA 1Y8NB 1VQLA 3J7ZC 3MVVA 3ND8A 3RLNA 3H09A 3RN2A 1PH2A 2PI2A 1A15A 3F2UA 3KK7A 4P75A 4P73A 2RCFA 4DV4L 4DR5L 3GTOH 3G6EA 4JI1Q 1PZKD 3HZXA 4DPGA 1S72A 4NB3A 1W6KA 2JSOA 2Q2TA 3CXCA 4IJHA 3SK8A 4R1JA 1IZ6A 3HOXG 2JA5B 4DUZQ 2RSNA 4IPHA 1EY9A 3G48A 1AE3A 2C9OA 1HFGA 1U4MA 1X65A 2EYFA 1AN8A 1PH4A 1ICFB 3GTGH 1HPCA 4GN4B 5EKIA 4DV6Q 2PQEA 1BQQT 4C3JG 5C0XH 1I50H 4HJ9A 1Z47A 5EPKA 5EKKA 5BN5A 3HOZB 5C4JB 1PZID 3MAQA 2UU9L 4B3MQ 3R93A 3Q0AA 3C1EA 1TT2A 3DWPA 4PG3A 3HP3A 1TWCB 2JA8G 4GKKL 1GO3E 2NYZD 3IKJA 2YU9H 2HUGA 4DN4M 2KOLA 3BVGA 2K33A 4UP8A 4CGYB 3KJOA 1Q8KA 4RKLA 5HY6A 4DNTB 2Q2UA 4IPGA 1CQFA 2VQFL 3BZKA 3GTLH 2EYHA 3GTKH 1EYDA 1F9PA 1MI2A 4K6LA 3W5OA 1SAPA 4XTCS 3AB9A 2BA1A 4CBVA 4DV2Q 3OHXC 3AMUA 3FPPA 1RTOA 1ENAA 2NB0A 4ZAIA 1VQDA 3LNNA 1TWAB 1TS2A 2FJ2A 1EYAA 2VUMB 4JI4L 5C6AA 1NR2A 2PMZE 4F7XA 5HGQA 1HNZQ 2AUKA 1K8MA 1ML0D 4OWTB 5EPJA 2N78A 4JYAQ 3NTIA 1MBYA 4XXEA 1NTGA 2EY5A 2K14A 4CKCA 4YWLA 4BY1G 1MJEA 4B3ML 3I4MB 4HJ7A 2PZTA 2Z9HA 1EZ8A 5M5YH 4DNIA 4GNXA 1TWGH 5CGKA 3K5MA 5IYDH 3FHWA 4LF6Q 3SEBA 3H0GB 4OGQC 3J7YW 3VYRA 1PRTB 3SDZA 3TSSA 4EQ5A 3CMEA 4WRDA 1P8LA 4LAAA 4RH6A 4B3SQ 4GOPC 2NTSA 3KBGA 3KYHC 4C3HG 4ABNA 1VDZA 4JV5Q 5GAEC 1G6PA 4YHHQ 3DLLA 1M90C 3I70A 3HOUG 1I4QA 2F4VL 4B3TL 2MO1A 5KNCA 3S1RB 5C3EG 4IALA 4JI2Q 5A2QE 5J39A 1QVCA 5GQOA 3FRPB 3K5LA 2KJXA 4DAYB 1XYIA 4A3BG 1JB3A 1WTHA 2JA7B 3CCEA 5C44H 3HOYH 1XPRA 1TWHH 2HIVA 1UEBA 1WCMH 3NXWA 2B8GA 3BU2A 5J1ZA 1XXGA 4HN7A 2N88A 2CQOA 4BA2I 2K52A 1H9SB 4HJ8A 1D8LA 3CCQA 1K28A 4OONA 1B4OA 1X3GA 3R3OA 1ZXTA 3BYYB 4XQNA 4LK1C 1STAA 1O7LA 1SNOA 4YHHL 3A5UA 2UUAL 3HKZG 1ZKOA 1N9WA 2CHBD 1A0IA 1KDBA 3DXJC 4O1NA 3VDYA 1RF2D 2FINB 3STBD 5GADC 2EE1A 1ONLA 2CW0C 1WVLA 2DJGC 4HJAA 1Q86C 1K8AC 1VCIA 3CD6A 1O80A 3AFPA 1CKNA 3AYHB 1SROA 3CC7A 5IY0A 5KYLA 2HCCA 1B44D 2A68D 1LTID 1E3PA 4YCUA 5D3DA 1X3FA 2Y0SE 3AQQA 4FYDA 5ISRA 2N49A 5NUCA 5K5PA 1YBYA 3C3LA 1VQEA 3M4OH 1VQ6A 3HGBA 3H3VC 3U9OA 1W2BA 4X3SA 4A3EB 3PO2B 2AKWB 2Z4IA 2E8GA 1HZCA 2VS1A 2WB1E 3KJPA 2L5TA 3PIO3 2R92B 1STBA 2CH4W 3RZOB 1STNA 2XTIA 3HFZB 4LJZC 1CA5A 3S2HB 1A3TA 3A7AB 2PNRC 1I4XA 3DWQA 4JI0L 4BXXH 1J9OA 2QGQA 3MZ5A 2NN6H 3OWEB 2R93H 4XQQA 4A3CG 1HA5A 3OSOA 4CKBA 1HUMA 3M3YB 5IT9c 2PNHA 2UUAQ 2DY7A 4IFDH 1FD7D 1VQGA 3L3OC 2F0WA 3VA7A 4DV3Q 1A2UA 1UE5A 4JI7L 1NR4A 1VMCA 4DV1L 4IO9A 3DMUA 1YEZA 3KF8A 3DWAA 3R2IA 4C1NK 4J6HA 4R8NA 2AHOB 5M5WB 3NPPA 1BCPC 1FJGL 1YHAA 2D0OA 3P7JA 5C4XB 1SFOH 1VS0A 3ERQA 1GKHA 4A3MG 1IBKL 1GD7A 3BJUA 4DGZA 3IAYA 1XNRL 4X3TA 3U9SA 3PF5A 2LXJA 4KV6A 1T5EA 4XIGS 4IOCA 3TZUA 4A3IH 4B3SL 4GN3B 4NPSA 1IHZA 3MXNB 5C3WA 1JOKA 3HOXH 4GKJL 4JV5L 4E6IA 5FKAC 4OO1I 1OO9B 1PYBA 3CW2C 4TQUS 2R6GA 4A4IA 1L2FA 1PYWD 3V05A 2M9VA 1QG7A 5DAUA 4ZKCB 2IX3A 1LTTD 4X62L 2NUCA 1GXDC 5IGGA 2NZOA 3GTQH 1X3EA 5GROA 4JBWA 1GJXA 3PUVA 4DR3Q 2M2LA 1KQSA 1E2ZA 3W1GA 1PRTC 2MJ8A 4AQYQ 5DNFA 3HOWH 4DR4L 3PO2H 4M8AA 3A74A 2KENA 1QWYA 1SNQA 1EQTA 3PSIA 1PDQA 3QR8A 1Z9FA 3M4OB 2JYOA 3S15B 5CV8A 1Y1WH 1QCBD 2UUBQ 5JOBA 2J4XA 1SE4A 4G4KA 3HRZC 1UWVA 2F0OA 3HOWB 3AFQA 1SJHD 2NZHA 2J7ZA 5F2DA 3TEHB 4OL7A 5E3FA 1SNDA 1MHWC 3SHLA 1PZJD 2CKZB 4DXFA 4DV2L 1Y1VH 1UAPA 2F4IA 4C56C 2WAQE 4OO1G 1EL0A 3M7GA 2HDMA 2ICIA 2YTXA 4BBSB 2RDHA 4Y7NH 1SMYD 5CYUA 2KHJA 2GVBA 4X64L 3K58A 1B1ZA 2ID0A 4U68A 2L9HA 2QCPX 4RCOA 2LMCB 4QUFA 2A68C 1V8QA 1WTWA 2VW9A 2R7FA 4IPDA 5EJWA 1EIYB 4AYBG 2BE5D 1PMRA 3GTPB 1K3RA 4JVZA 3P75A 4EQOA 1MSHA 4X65L 3I4NG 4H44C 5A2QL 2L12A 2AUJD 2IHEA 2JA7H 2PW7A 2Z6KC 1J5EL 5K36G 5C4ZA 3T1HQ 1EZ6A 2EXDA 1U9RA 1BCPF 2F0UA 2K04A 1ENCA 1QILA 1JWUD 2EYJA 4OX9L 2HQLA 2D0PA 1FVIA 1CTMA 2VB2X 4YCWA 2ENBA 2F0GA 3NUCA 1X9NA 4JBMA 3CP0A 1EFWA 1HZBA 2RHQB 5AJ3Q 4A3KH 2CWPA 3CF5A 3OWFA 1H9MA 3PV0A 5IYCH 5A35A 2JQOA 4K8JA 3PUYA 5JJLA 1D5ZC 1YI2A 1PH5A 3X3NA 3HOVB 3MFYA 3STBC 1HNXQ 5EBDA 1DJRD 3NE5B 1LTRD 5IP9G 3CCMA 3GP7A 1CQVA 1CHPD 2IT1A 1EEFD 2F1MA 1SRUA 1Y1WG 2JN4A 2CWAA 1HQMC 2KQ3A 3KLSA 3FKIB 5JAVA 2UUBL 1F2LA 3W1BA 5GAHC 3QO2A 2D2CC 1JWMD 4IJLA 4F8MA 3W2DA 3M4PA 1I6HB 4N9TA 4LF5Q 4DUYQ 2YV5A 1IKLA 4FXGC 1L1OC 3PO2G 2WAQG 4K0KL 1YHQA 5I6YA 2RSOA 3TP6A 4EGVA 3KF6B 1TY0A 1TKWB 3CCRA 3EIVA 5LMNW 4A75A 3A5ZB 3VR5A 1JT8A 4HAEA 1WCMG 4OX9Q 4RKBA 1N32L 4EVOA 3GTLB 3M7NA 3MC0B 3HOZG 3H3VI 4X66Q 4RG1A 3MEHA 5C4XG 3VYTA 4LFCQ 2EJMA 3CKIB 3PO3B 2A74C 2AQ2B 4NKLA 2JXMB 2LXKA 2R61A 3CQZB 2Q8TA 4A3BH 3Q24A 3VR2A 3SE0A 1FNUA 1M8AA 1WI5A 4AH6A 2HQEA 1S5BD 1CHQD 3IFDA 2LFNA 4XYOA 2PCFB 4JOIC 4WJ4A 1VQ8A 3BVMA 4RGOS 1F9RA 3AU7A 1EQQA 1X6OA 3DEOA
chains in the Genus database with same CATH topology
5HY6A 4DR6Q 1QUQB 1T9HA 2V1CC 2Q2UA 4IPGA 1VQKA 4AYBE 2IX0A 1XMQL 1A63A 1Q1EA 2VQFL 4LFBQ 3BZKA 2JE6I 4DK3C 5LMUL 3GTKH 3GTLH 2R92G 1Q81C 5M5XH 5C0XI 3W5OA 5IYBH 1IBMQ 2B3GA 3PIPA 4XTCS 1Q1BA 2BA1A 4DV2Q 1E7ZA 1KRTA 4GLVB 4JI6Q 4LF9L 4GOPA 2VNUD 3CC2A 1VQDA 4APVA 2ES2A 4JI0Q 5J3BA 4JI5Q 3L0OA 4WJ3M 3ICEA 2MO0A 1KIXA 1SMXA 3PUWA 3I56A 3OYYA 4R4TA 2VQFQ 5IP9H 4JI4L 1IXRA 2UXDQ 3SGIA 1KRSA 2HHHQ 2PMZE 5IYDG 3HOVG 1YJNA 5HGQA 1BVSA 1HNZQ 1BKBA 2ASBA 4OWTB 1CKOA 4BXXG 2GN5A 1K73C 3T1HL 2N78A 3NEMA 1VQNA 4JYAQ 2OWOA 1LUZA 4BY7H 3JAMi 5JJIA 1NTGA 2K14A 4A3CH 4A93H 3D0FA 4YWLA 4BY1G 1MJEA 4B3ML 1JJCB 1UE6A 4HJ7A 1VQ5A 3T1YQ 2UU9Q 4DR4Q 1P16A 1VQPA 2F3IA 4LUVA 4GNXB 4B3TQ 4BBSH 4A3IG 5M5YH 4DNIA 4A3GH 4L5QA 2OQKA 4GNXA 1TWGH 1PH3A 4X66L 5H1SE 4BBRH 3H0GH 4HJ5A 1QVFA 3E9IA 5IYDH 3FHWA 3TS0A 3CAMA 5LMNL 4LF6Q 1N33Q 3OW2A 1M1KC 3S15H 1HR0Q 1YJ9A 4LF8L 2R7DA 1B7YB 1IBLL 1SR3A 3TQYA 4B3RQ 4EQ5A 3PGZA 3CMEA 4KLKA 1IBLQ 1P8LA 5FJ8H 4B3SQ 4GOPC 1N34L 2UXDL 3KYHC 4BY7G 1LTLA 4A3KG 5C4XH 4JV5Q 1K0RA 5GAEC 1G6PA 4GKJQ 4YHHQ 2A19A 3DLLA 1M90C 1B70B 3AEVA 3HOUG 2VL6A 2F4VL 1KAWA 4B3TL 2MO1A 3FKIH 1S40A 5C3EG 4DV7L 1Q82C 4C3IH 4JI2Q 3F2CA 2UUCL 1NY4A 1WOCA 3RLFA 4BBRG 1JJ2A 1QVCA 5GQOA 4JBKA 4AIMA 1I94Q 3EBEA 1HZAA 4DAYB 4QGUA 4A3BG 5JEAJ 1XPUA 1K8GA 3CCEA 2B29A 5C44H 2OCEA 2K75A 1WJJA 4X65Q 1TWHH 4UPAA 3UDGA 1YIJA 1XPRA 2HIVA 3I55A 2RHSB 2JJQA 1MJCA 2NVQH 1UEBA 1WCMH 4HIOA 5C0XJ 2IX1A 3U4ZA 1I5FA 1OXVA 4QL5A 4LF7L 3GTJH 2B63H 3BU2A 2JA8H 1HNZL 4C3HH 4Y52H 3LGJA 1JB7A 4IFDI 2CQOA 4JI7Q 2NVTH 2K52A 5C4JH 2VQEQ 4BA2I 2UXBQ 1I94L 4R4CA 1D8LA 4HJ8A 1YHBA 3CCQA 3RNUA 2EQSA 1J6QA 3J81c 4OONA 2E5LQ 1Q46A 4YWMA 4DR2L 1X3GA 4A3JG 2LSSA 1E1TA 5C3EH 3GD7A 4JI2L 2PQAA 1OXUA 1KD1C 2ZTCA 3UE1A 1O7IA 1EUJA 3D31A 1VQOA 2ATWA 2ZTEA 1C9OA 3KLWA 4YHHL 3A5UA 1OXSC 3HKZG 2UUAL 2VUMH 1KHIA 3RZDH 1N9WA 1TWAH 1A0IA 1XTDA 1N36L 1EWIA 3VDYA 3STBD 5GADC 4JC0A 4LF8Q 4KHPQ 1NJIC 4KI0A 3I4OA 2R7ZH 4HJAA 1HNWQ 1Q86C 1K8AC 2A8VA 5ELNA 4UY8C 1CKMA 2H5XA 4BA1I 4L5SA 1VCIA 4P72A 1Q12A 3CD6A 1D7QA 2DUDA 3AFPA 1CKNA 3AYHB 3ULJA 2MNAA 1SROA 3CC7A 4A3JH 5IY0A 4LF4L 4GNXC 1PH7A 1GVPA 3I4NH 1HJPA 4OWWB 2ALYB 2NN6G 1E3PA 1EYGA 3PO3H 4YCUA 1CSPA 1I3QH 1CSQA 2ZM6L 3CCUA 2E2HH 1Y1VG 1X3FA 4NXML 3M4QA 2DGYA 2Y0SE 3AQQA 4BY1H 5E7NA 4R4OA 2N49A 2VUMG 3FP9A 1YBYA 4HIMA 1A62A 1VQEA 4A3FH 3M4OH 2PI2E 1VQ6A 1FJGQ 3S16H 4JI3L 4IPCA 2UXCL 1PA6A 3RLOA 1W2BA 1NMFA 1N8RC 4A3DG 2R7ZG 2AKWB 2E8GA 1HZCA 2VS1A 2WB1E 4POFA 2JA5H 3KJPA 1NMGA 3GTPH 4LNQA 2NVXH 5FLXc 1XMOQ 2JA6H 2MFIA 2XTIA 3HFZB 4IOAA 1TWFH 1IYJB 1FGUA 1PFSA 4JI5L 5IP7H 4JI0L 4BXXH 1V1QA 1B8AA 2QGQA 4R4IA 1L0WA 1PH8A 5M3FG 3S2HH 1HNWL 1MIUA 5IYCG 1HR0W 3PO3G 1PVOA 2R93H 3F1ZA 4A3CG 4A93G 4DR2Q 5BR8L 4A3MH 4DAMA 3F2DA 1DGSA 2AMCB 3J80c 2QEXA 4FDBA 2OQ0A 5IT9c 4JI1L 5LMUQ 2PNHA 4LFAQ 2N3SA 1IBML 2UUAQ 1VQGA 3CCJA 1ASYA 4DV3Q 4IFDJ 4MZ9A 1UE5A 4JI7L 4DV1L 4IO9A 4LWCA 3B6YA 4MTNA 4K0KQ 3KF8B 3CCLA 2UXBL 2JA5G 1YEZA 1XJVA 3HKZE 5IE8A 2E5LL 3HKSA 1LYLA 3KDFA 3UDXA 3ERSX 2ZJQA 1QZHA 1VQCA 4PZ7A 1Y14B 2N8NA 2AHOB 4PZ6A 3U58A 4LF7Q 2UXCQ 1FJGL 1YHAA 2D0OA 1HH2P 1SFOH 1VS0A 2HHHL 3KFUA 1GKHA 4A3MG 1X56A 2K5VA 2WFWA 1IBKL 1VQ9A 1GD7A 3S14H 3ZJYC 2ZM6Q 3HOUH 2JK8A 3BJUA 1X55A 1EOVA 1U0LA 3FKIG 1XNRL 4IFDG 1CUKA 3PF5A 2LXJA 4XIGS 1NBWA 4JI6L 4LF9Q 2ZTDA 2AWOA 3K7UC 4IOCA 4QJFA 3RN5A 4A3IH 4A3GG 4B3SL 1RIPA 4GN3B 3CCVA 4NPSA 3G71A 5EAYA 3MXNB 5BR8Q 3HOXH 1HZ9A 3K7AH 4GKJL 4PMWA 3J81j 1WFQA 4JV5L 4OWXB 2IY5B 3KF6A 1IL2A 4C2MH 4OO1I 1PYBA 1E24A 3I7FA 3A0JA 3CW2C 2R6GA 4TQUS 4A4IA 3M85A 1L2FA 3CQZH 3G4SA 1SE8A 5LMNQ 2KBNA 1XMOL 1JMCA 2E2IH 4POGA 3UE0A 1MKHA 2RCNA 3UDIA 3J7A5 4X62L 2WB1G 4YWKA 4DK6C 2NZOA 3NELA 3GTQH 1X3EA 5GROA 3TS2A 4JBWA 1RL2A 2F52A 2YTVA 3PUVA 4DR3Q 2I0QA 1KQSA 1JJGA 1XNRQ 3J80i 1U5KA 4JOIA 3TREA 3W1GA 1GM5A 4AQYQ 3T1YL 3HOWH 4LF5L 2BH2A 3PO2H 4DR4L 5JJKA 4DV5L 3A74A 5M5WH 4HIKA 3M9BA 4GS3A 2KENA 4O2DA 2K5HA 1J5EQ 3MEFA 1ASZA 1SLJA 3PSIA 1V9PA 1X54A 4ME3A 4O0AA 1Z9FA 2I5MX 3E0EA 3S17H 1VQFA 4GLXA 2WP8J 1IBKQ 1KXLA 1TWCH 4JYAL 3S1RH 1Y1WH 3TRZA 2UUBQ 4JBJA 2K50A 4H02A 1S3OA 3J81i 1UWVA 2HIXA 1VQAA 1YZ6A 1VQ7A 3AFQA 2NZHA 3CC4A 3OTOL 1PHJA 4NXNQ 2JA6G 1SN8A 5M3MH 3TEHB 1AE2A 2VZAA 4ALPA 1OTCA 4LFAL 3CMAA 4DV0Q 1QUQA 3GTMH 4C3JH 4DV7Q 2Q2IA 1Q7YC 1N36Q 2CKZB 3JC66 3GDEA 4DV2L 3NENA 1KC8C 4KHPL 1Y1VH 2WAQE 3GO5A 2JEBI 2PQAB 4YCVA 4L5RC 2GVAA 4OO1G 1R9TH 2IHFA 4A3FG 2YTXA 5DLQE 2JA7G 2BH8A 1VQIA 4DR6L 4DR7Q 4LFBL 4DV0L 5AJ3L 4Y7NH 4EX5A 1E1OA 4GLAC 4A3DH 4J15A 2KHJA 3K8AA 3I4MH 5FLMG 2GVBA 3S1MH 1HR0L 1C0AA 3HOZH 1W3SA 4X64L 2KHIA 4LF6L 3S1QH 1XNQQ 1VQMA 1L1OA 2ID0A 3KDFB 2YTYA 4GKKQ 2K5NA 5GAGC 1XPOA 5C0XG 3K80C 2CFMA 5M3FH 1AH9A 2VW9A 2R7FA 2L15A 1WYDA 4IPDA 2NVYH 3RZOH 1EIYB 4AYBG 2JA9A 4YY3Q 3PUXA 4DR1L 1K3RA 2R92H 4X65L 3CCSA 1PH1A 5IWAL 4DV5Q 3I4NG 4DKAC 1G291 3PF4A 4LF4Q 4QIWE 1V43A 2IHEA 2ZJPA 2JA7H 4BBSG 3F8TA 2UUCQ 4NXMQ 4UP9A 3H3VH 2Z6KC 3F2BA 1YJWA 1J5EL 5K36G 3T1HQ 2Y0SG 4A76A 3ULLA 2EXDA 1OXXK 1LM0A 4DR3L 4X62Q 1H95A 3H15A 3U4VA 1A8VA 4JCVE 2RF4A 2YYZA 1N32Q 4P71A 3RR5A 4B3RL 3M3YH 4OX9L 1N34Q 2HQLA 2D0PA 1KL9A 1FVIA 4OXPA 1UE7A 4DR7L 4DV6L 1G51A 4YCWA 5FJ8G 1VQ4A 2Z0SA 4X6AH 1NE3A 4LUOA 1X9NA 4JBMA 3CP0A 1EFWA 1HZBA 2RHQB 5AJ3Q 2QA4A 2CWPA 4A3KH 3CPFA 3CF5A 2XGTA 3PV0A 5IYCH 5IYBG 3NBHB 2I5HA 2JQOA 4L5TA 1BBUA 1C7YA 2R93G 3PUYA 1QVGA 2OTLA 5JJLA 3Q8DA 4DUZL 3UDFA 1YI2A 1PH5A 3ULPA 3U50C 2OTJA 3STBC 4KHZA 4DR5Q 1HNXQ 4QY7A 1VQJA 5JEAG 3S24A 3K0XA 1FL0A 4DUYL 3I2ZA 4DV4Q 5IP9G 3CCMA 2ZJRA 3H0GG 2KCMA 4GOPB 3BZCA 2IT1A 4YY3L 1UE1A 1VQLA 3J7ZC 3HOVH 4QQBX 2CCZA 3RLNA 3S1NH 3RN2A 1PH2A 1SRUA 2E2JH 2PI2A 2VQEL 1L1OB 1Y1WG 2CWAA 2NN6I 4P75A 2HT1A 4A3LH 2C35B 2UUBL 4JG2A 1QZGA 1XNQL 1CKNB 3W1BA 4TVAB 3WWVA 5GAHC 2FXQA 4P73A 4JI4Q 5ELOA 4R4QA 4IJLA 4MNOA 4DV4L 4DR5L 1HNXL 3GTOH 4DV3L 3M4PA 1E22A 5M3MG 3G6EA 3KOJA 4P74A 4UP7A 4JI1Q 2EIFA 4LF5Q 4DPGA 4DUYQ 4AQYL 2YV5A 1S72A 1K83H 3HOWG 1L1OC 4NB3A 1PV4A 3PO2G 2WAQG 4DV1Q 4K0KL 2F4VQ 3PUZA 2Q2TA 1YHQA 3CXCA 4IJHA 2A1AA 1PH9A 3EN2A 1VQBA 3KF6B 4R1JA 4LFCL 3CCRA 3EIVA 5LMNW 4A75A 2K4KA 1IZ6A 3HOXG 3PCOB 1XMQQ 3A5ZB 4DUZQ 4A3EH 1JT8A 4IPHA 3S2DH 3G48A 1WCMG 2JEAI 1AE3A 2D62A 4OX9Q 4A3LG 1N32L 4NXNL 1X65A 2VY3A 3OTOQ 1I6HH 2B63G 3I4MG 3M7NA 2KCTA 1PH4A 3L2PA 4GN5A 3HOZG 3H3VI 4X66Q 4PZ8A 3GTGH 2Z6KA 4GN4B 4RG1A 3E9HA 3CPWA 4DV6Q 4RMFA 5C4XG 4LFCQ 1PYSB 1TXYA 4JI8L 3L7ZC 4HIDA 1YITA 1PH6A 1K9MC 1N33L 3PIOA 1I50H 4HJ9A 1Z47A 4JI3Q 2LXKA 4LUZA 2UU9L 1VQHA 4B3MQ 5IWAQ 4A3BH 1YNXA 5C44G 3HOYG 3DM3A 4A3EG 1WI5A 4AH6A 4DR1Q 1BBWA 3IRBA 4PG3A 2I5LX 4JOIC 4WJ4A 1VQ8A 4X64Q 5FLMH 1OXTA 2MQHA 3K81C 4JI8Q 3JAMc 2AWNA 2JA8G 1GO3E 3HOYH 4GKKL 1EQRA 2Q2HA 1YVCA 2YU9H 1EIFA 1JE5A 4LW1A 3ER0A 2BA0A 4UP8A 3KJOA 1Q8KA 1EQQA 1X6OA 5IP7G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HY6 A;  4DR6 Q;  1QUQ B;  1T9H A;  2V1C C;  2Q2U A;  4IPG A;  1VQK A;  4AYB E;  2IX0 A;  1XMQ L;  1A63 A;  1Q1E A;  2VQF L;  4LFB Q;  3BZK A;  2JE6 I;  4DK3 C;  5LMU L;  3GTK H;  3GTL H;  2R92 G;  1Q81 C;  5M5X H;  5C0X I;  3W5O A;  5IYB H;  1IBM Q;  2B3G A;  3PIP A;  4XTC S;  1Q1B A;  2BA1 A;  4DV2 Q;  1E7Z A;  1KRT A;  4GLV B;  4JI6 Q;  4LF9 L;  4GOP A;  2VNU D;  3CC2 A;  1VQD A;  4APV A;  2ES2 A;  4JI0 Q;  5J3B A;  4JI5 Q;  3L0O A;  4WJ3 M;  3ICE A;  2MO0 A;  1KIX A;  1SMX A;  3PUW A;  3I56 A;  3OYY A;  4R4T A;  2VQF Q;  5IP9 H;  4JI4 L;  1IXR A;  2UXD Q;  3SGI A;  1KRS A;  2HHH Q;  2PMZ E;  5IYD G;  3HOV G;  1YJN A;  5HGQ A;  1BVS A;  1HNZ Q;  1BKB A;  2ASB A;  4OWT B;  1CKO A;  4BXX G;  2GN5 A;  1K73 C;  3T1H L;  2N78 A;  3NEM A;  1VQN A;  4JYA Q;  2OWO A;  1LUZ A;  4BY7 H;  3JAM i;  5JJI A;  1NTG A;  2K14 A;  4A3C H;  4A93 H;  3D0F A;  4YWL A;  4BY1 G;  1MJE A;  4B3M L;  1JJC B;  1UE6 A;  4HJ7 A;  1VQ5 A;  3T1Y Q;  2UU9 Q;  4DR4 Q;  1P16 A;  1VQP A;  2F3I A;  4LUV A;  4GNX B;  4B3T Q;  4BBS H;  4A3I G;  5M5Y H;  4DNI A;  4A3G H;  4L5Q A;  2OQK A;  4GNX A;  1TWG H;  1PH3 A;  4X66 L;  5H1S E;  4BBR H;  3H0G H;  4HJ5 A;  1QVF A;  3E9I A;  5IYD H;  3FHW A;  3TS0 A;  3CAM A;  5LMN L;  4LF6 Q;  1N33 Q;  3OW2 A;  1M1K C;  3S15 H;  1HR0 Q;  1YJ9 A;  4LF8 L;  2R7D A;  1B7Y B;  1IBL L;  1SR3 A;  3TQY A;  4B3R Q;  4EQ5 A;  3PGZ A;  3CME A;  4KLK A;  1IBL Q;  1P8L A;  5FJ8 H;  4B3S Q;  4GOP C;  1N34 L;  2UXD L;  3KYH C;  4BY7 G;  1LTL A;  4A3K G;  5C4X H;  4JV5 Q;  1K0R A;  5GAE C;  1G6P A;  4GKJ Q;  4YHH Q;  2A19 A;  3DLL A;  1M90 C;  1B70 B;  3AEV A;  3HOU G;  2VL6 A;  2F4V L;  1KAW A;  4B3T L;  2MO1 A;  3FKI H;  1S40 A;  5C3E G;  4DV7 L;  1Q82 C;  4C3I H;  4JI2 Q;  3F2C A;  2UUC L;  1NY4 A;  1WOC A;  3RLF A;  4BBR G;  1JJ2 A;  1QVC A;  5GQO A;  4JBK A;  4AIM A;  1I94 Q;  3EBE A;  1HZA A;  4DAY B;  4QGU A;  4A3B G;  5JEA J;  1XPU A;  1K8G A;  3CCE A;  2B29 A;  5C44 H;  2OCE A;  2K75 A;  1WJJ A;  4X65 Q;  1TWH H;  4UPA A;  3UDG A;  1YIJ A;  1XPR A;  2HIV A;  3I55 A;  2RHS B;  2JJQ A;  1MJC A;  2NVQ H;  1UEB A;  1WCM H;  4HIO A;  5C0X J;  2IX1 A;  3U4Z A;  1I5F A;  1OXV A;  4QL5 A;  4LF7 L;  3GTJ H;  2B63 H;  3BU2 A;  2JA8 H;  1HNZ L;  4C3H H;  4Y52 H;  3LGJ A;  1JB7 A;  4IFD I;  2CQO A;  4JI7 Q;  2NVT H;  2K52 A;  5C4J H;  2VQE Q;  4BA2 I;  2UXB Q;  1I94 L;  4R4C A;  1D8L A;  4HJ8 A;  1YHB A;  3CCQ A;  3RNU A;  2EQS A;  1J6Q A;  3J81 c;  4OON A;  2E5L Q;  1Q46 A;  4YWM A;  4DR2 L;  1X3G A;  4A3J G;  2LSS A;  1E1T A;  5C3E H;  3GD7 A;  4JI2 L;  2PQA A;  1OXU A;  1KD1 C;  2ZTC A;  3UE1 A;  1O7I A;  1EUJ A;  3D31 A;  1VQO A;  2ATW A;  2ZTE A;  1C9O A;  3KLW A;  4YHH L;  3A5U A;  1OXS C;  3HKZ G;  2UUA L;  2VUM H;  1KHI A;  3RZD H;  1N9W A;  1TWA H;  1A0I A;  1XTD A;  1N36 L;  1EWI A;  3VDY A;  3STB D;  5GAD C;  4JC0 A;  4LF8 Q;  4KHP Q;  1NJI C;  4KI0 A;  3I4O A;  2R7Z H;  4HJA A;  1HNW Q;  1Q86 C;  1K8A C;  2A8V A;  5ELN A;  4UY8 C;  1CKM A;  2H5X A;  4BA1 I;  4L5S A;  1VCI A;  4P72 A;  1Q12 A;  3CD6 A;  1D7Q A;  2DUD A;  3AFP A;  1CKN A;  3AYH B;  3ULJ A;  2MNA A;  1SRO A;  3CC7 A;  4A3J H;  5IY0 A;  4LF4 L;  4GNX C;  1PH7 A;  1GVP A;  3I4N H;  1HJP A;  4OWW B;  2ALY B;  2NN6 G;  1E3P A;  1EYG A;  3PO3 H;  4YCU A;  1CSP A;  1I3Q H;  1CSQ A;  2ZM6 L;  3CCU A;  2E2H H;  1Y1V G;  1X3F A;  4NXM L;  3M4Q A;  2DGY A;  2Y0S E;  3AQQ A;  4BY1 H;  5E7N A;  4R4O A;  2N49 A;  2VUM G;  3FP9 A;  1YBY A;  4HIM A;  1A62 A;  1VQE A;  4A3F H;  3M4O H;  2PI2 E;  1VQ6 A;  1FJG Q;  3S16 H;  4JI3 L;  4IPC A;  2UXC L;  1PA6 A;  3RLO A;  1W2B A;  1NMF A;  1N8R C;  4A3D G;  2R7Z G;  2AKW B;  2E8G A;  1HZC A;  2VS1 A;  2WB1 E;  4POF A;  2JA5 H;  3KJP A;  1NMG A;  3GTP H;  4LNQ A;  2NVX H;  5FLX c;  1XMO Q;  2JA6 H;  2MFI A;  2XTI A;  3HFZ B;  4IOA A;  1TWF H;  1IYJ B;  1FGU A;  1PFS A;  4JI5 L;  5IP7 H;  4JI0 L;  4BXX H;  1V1Q A;  1B8A A;  2QGQ A;  4R4I A;  1L0W A;  1PH8 A;  5M3F G;  3S2H H;  1HNW L;  1MIU A;  5IYC G;  1HR0 W;  3PO3 G;  1PVO A;  2R93 H;  3F1Z A;  4A3C G;  4A93 G;  4DR2 Q;  5BR8 L;  4A3M H;  4DAM A;  3F2D A;  1DGS A;  2AMC B;  3J80 c;  2QEX A;  4FDB A;  2OQ0 A;  5IT9 c;  4JI1 L;  5LMU Q;  2PNH A;  4LFA Q;  2N3S A;  1IBM L;  2UUA Q;  1VQG A;  3CCJ A;  1ASY A;  4DV3 Q;  4IFD J;  4MZ9 A;  1UE5 A;  4JI7 L;  4DV1 L;  4IO9 A;  4LWC A;  3B6Y A;  4MTN A;  4K0K Q;  3KF8 B;  3CCL A;  2UXB L;  2JA5 G;  1YEZ A;  1XJV A;  3HKZ E;  5IE8 A;  2E5L L;  3HKS A;  1LYL A;  3KDF A;  3UDX A;  3ERS X;  2ZJQ A;  1QZH A;  1VQC A;  4PZ7 A;  1Y14 B;  2N8N A;  2AHO B;  4PZ6 A;  3U58 A;  4LF7 Q;  2UXC Q;  1FJG L;  1YHA A;  2D0O A;  1HH2 P;  1SFO H;  1VS0 A;  2HHH L;  3KFU A;  1GKH A;  4A3M G;  1X56 A;  2K5V A;  2WFW A;  1IBK L;  1VQ9 A;  1GD7 A;  3S14 H;  3ZJY C;  2ZM6 Q;  3HOU H;  2JK8 A;  3BJU A;  1X55 A;  1EOV A;  1U0L A;  3FKI G;  1XNR L;  4IFD G;  1CUK A;  3PF5 A;  2LXJ A;  4XIG S;  1NBW A;  4JI6 L;  4LF9 Q;  2ZTD A;  2AWO A;  3K7U C;  4IOC A;  4QJF A;  3RN5 A;  4A3I H;  4A3G G;  4B3S L;  1RIP A;  4GN3 B;  3CCV A;  4NPS A;  3G71 A;  5EAY A;  3MXN B;  5BR8 Q;  3HOX H;  1HZ9 A;  3K7A H;  4GKJ L;  4PMW A;  3J81 j;  1WFQ A;  4JV5 L;  4OWX B;  2IY5 B;  3KF6 A;  1IL2 A;  4C2M H;  4OO1 I;  1PYB A;  1E24 A;  3I7F A;  3A0J A;  3CW2 C;  2R6G A;  4TQU S;  4A4I A;  3M85 A;  1L2F A;  3CQZ H;  3G4S A;  1SE8 A;  5LMN Q;  2KBN A;  1XMO L;  1JMC A;  2E2I H;  4POG A;  3UE0 A;  1MKH A;  2RCN A;  3UDI A;  3J7A 5;  4X62 L;  2WB1 G;  4YWK A;  4DK6 C;  2NZO A;  3NEL A;  3GTQ H;  1X3E A;  5GRO A;  3TS2 A;  4JBW A;  1RL2 A;  2F52 A;  2YTV A;  3PUV A;  4DR3 Q;  2I0Q A;  1KQS A;  1JJG A;  1XNR Q;  3J80 i;  1U5K A;  4JOI A;  3TRE A;  3W1G A;  1GM5 A;  4AQY Q;  3T1Y L;  3HOW H;  4LF5 L;  2BH2 A;  3PO2 H;  4DR4 L;  5JJK A;  4DV5 L;  3A74 A;  5M5W H;  4HIK A;  3M9B A;  4GS3 A;  2KEN A;  4O2D A;  2K5H A;  1J5E Q;  3MEF A;  1ASZ A;  1SLJ A;  3PSI A;  1V9P A;  1X54 A;  4ME3 A;  4O0A A;  1Z9F A;  2I5M X;  3E0E A;  3S17 H;  1VQF A;  4GLX A;  2WP8 J;  1IBK Q;  1KXL A;  1TWC H;  4JYA L;  3S1R H;  1Y1W H;  3TRZ A;  2UUB Q;  4JBJ A;  2K50 A;  4H02 A;  1S3O A;  3J81 i;  1UWV A;  2HIX A;  1VQA A;  1YZ6 A;  1VQ7 A;  3AFQ A;  2NZH A;  3CC4 A;  3OTO L;  1PHJ A;  4NXN Q;  2JA6 G;  1SN8 A;  5M3M H;  3TEH B;  1AE2 A;  2VZA A;  4ALP A;  1OTC A;  4LFA L;  3CMA A;  4DV0 Q;  1QUQ A;  3GTM H;  4C3J H;  4DV7 Q;  2Q2I A;  1Q7Y C;  1N36 Q;  2CKZ B;  3JC6 6;  3GDE A;  4DV2 L;  3NEN A;  1KC8 C;  4KHP L;  1Y1V H;  2WAQ E;  3GO5 A;  2JEB I;  2PQA B;  4YCV A;  4L5R C;  2GVA A;  4OO1 G;  1R9T H;  2IHF A;  4A3F G;  2YTX A;  5DLQ E;  2JA7 G;  2BH8 A;  1VQI A;  4DR6 L;  4DR7 Q;  4LFB L;  4DV0 L;  5AJ3 L;  4Y7N H;  4EX5 A;  1E1O A;  4GLA C;  4A3D H;  4J15 A;  2KHJ A;  3K8A A;  3I4M H;  5FLM G;  2GVB A;  3S1M H;  1HR0 L;  1C0A A;  3HOZ H;  1W3S A;  4X64 L;  2KHI A;  4LF6 L;  3S1Q H;  1XNQ Q;  1VQM A;  1L1O A;  2ID0 A;  3KDF B;  2YTY A;  4GKK Q;  2K5N A;  5GAG C;  1XPO A;  5C0X G;  3K80 C;  2CFM A;  5M3F H;  1AH9 A;  2VW9 A;  2R7F A;  2L15 A;  1WYD A;  4IPD A;  2NVY H;  3RZO H;  1EIY B;  4AYB G;  2JA9 A;  4YY3 Q;  3PUX A;  4DR1 L;  1K3R A;  2R92 H;  4X65 L;  3CCS A;  1PH1 A;  5IWA L;  4DV5 Q;  3I4N G;  4DKA C;  1G29 1;  3PF4 A;  4LF4 Q;  4QIW E;  1V43 A;  2IHE A;  2ZJP A;  2JA7 H;  4BBS G;  3F8T A;  2UUC Q;  4NXM Q;  4UP9 A;  3H3V H;  2Z6K C;  3F2B A;  1YJW A;  1J5E L;  5K36 G;  3T1H Q;  2Y0S G;  4A76 A;  3ULL A;  2EXD A;  1OXX K;  1LM0 A;  4DR3 L;  4X62 Q;  1H95 A;  3H15 A;  3U4V A;  1A8V A;  4JCV E;  2RF4 A;  2YYZ A;  1N32 Q;  4P71 A;  3RR5 A;  4B3R L;  3M3Y H;  4OX9 L;  1N34 Q;  2HQL A;  2D0P A;  1KL9 A;  1FVI A;  4OXP A;  1UE7 A;  4DR7 L;  4DV6 L;  1G51 A;  4YCW A;  5FJ8 G;  1VQ4 A;  2Z0S A;  4X6A H;  1NE3 A;  4LUO A;  1X9N A;  4JBM A;  3CP0 A;  1EFW A;  1HZB A;  2RHQ B;  5AJ3 Q;  2QA4 A;  2CWP A;  4A3K H;  3CPF A;  3CF5 A;  2XGT A;  3PV0 A;  5IYC H;  5IYB G;  3NBH B;  2I5H A;  2JQO A;  4L5T A;  1BBU A;  1C7Y A;  2R93 G;  3PUY A;  1QVG A;  2OTL A;  5JJL A;  3Q8D A;  4DUZ L;  3UDF A;  1YI2 A;  1PH5 A;  3ULP A;  3U50 C;  2OTJ A;  3STB C;  4KHZ A;  4DR5 Q;  1HNX Q;  4QY7 A;  1VQJ A;  5JEA G;  3S24 A;  3K0X A;  1FL0 A;  4DUY L;  3I2Z A;  4DV4 Q;  5IP9 G;  3CCM A;  2ZJR A;  3H0G G;  2KCM A;  4GOP B;  3BZC A;  2IT1 A;  4YY3 L;  1UE1 A;  1VQL A;  3J7Z C;  3HOV H;  4QQB X;  2CCZ A;  3RLN A;  3S1N H;  3RN2 A;  1PH2 A;  1SRU A;  2E2J H;  2PI2 A;  2VQE L;  1L1O B;  1Y1W G;  2CWA A;  2NN6 I;  4P75 A;  2HT1 A;  4A3L H;  2C35 B;  2UUB L;  4JG2 A;  1QZG A;  1XNQ L;  1CKN B;  3W1B A;  4TVA B;  3WWV A;  5GAH C;  2FXQ A;  4P73 A;  4JI4 Q;  5ELO A;  4R4Q A;  4IJL A;  4MNO A;  4DV4 L;  4DR5 L;  1HNX L;  3GTO H;  4DV3 L;  3M4P A;  1E22 A;  5M3M G;  3G6E A;  3KOJ A;  4P74 A;  4UP7 A;  4JI1 Q;  2EIF A;  4LF5 Q;  4DPG A;  4DUY Q;  4AQY L;  2YV5 A;  1S72 A;  1K83 H;  3HOW G;  1L1O C;  4NB3 A;  1PV4 A;  3PO2 G;  2WAQ G;  4DV1 Q;  4K0K L;  2F4V Q;  3PUZ A;  2Q2T A;  1YHQ A;  3CXC A;  4IJH A;  2A1A A;  1PH9 A;  3EN2 A;  1VQB A;  3KF6 B;  4R1J A;  4LFC L;  3CCR A;  3EIV A;  5LMN W;  4A75 A;  2K4K A;  1IZ6 A;  3HOX G;  3PCO B;  1XMQ Q;  3A5Z B;  4DUZ Q;  4A3E H;  1JT8 A;  4IPH A;  3S2D H;  3G48 A;  1WCM G;  2JEA I;  1AE3 A;  2D62 A;  4OX9 Q;  4A3L G;  1N32 L;  4NXN L;  1X65 A;  2VY3 A;  3OTO Q;  1I6H H;  2B63 G;  3I4M G;  3M7N A;  2KCT A;  1PH4 A;  3L2P A;  4GN5 A;  3HOZ G;  3H3V I;  4X66 Q;  4PZ8 A;  3GTG H;  2Z6K A;  4GN4 B;  4RG1 A;  3E9H A;  3CPW A;  4DV6 Q;  4RMF A;  5C4X G;  4LFC Q;  1PYS B;  1TXY A;  4JI8 L;  3L7Z C;  4HID A;  1YIT A;  1PH6 A;  1K9M C;  1N33 L;  3PIO A;  1I50 H;  4HJ9 A;  1Z47 A;  4JI3 Q;  2LXK A;  4LUZ A;  2UU9 L;  1VQH A;  4B3M Q;  5IWA Q;  4A3B H;  1YNX A;  5C44 G;  3HOY G;  3DM3 A;  4A3E G;  1WI5 A;  4AH6 A;  4DR1 Q;  1BBW A;  3IRB A;  4PG3 A;  2I5L X;  4JOI C;  4WJ4 A;  1VQ8 A;  4X64 Q;  5FLM H;  1OXT A;  2MQH A;  3K81 C;  4JI8 Q;  3JAM c;  2AWN A;  2JA8 G;  1GO3 E;  3HOY H;  4GKK L;  1EQR A;  2Q2H A;  1YVC A;  2YU9 H;  1EIF A;  1JE5 A;  4LW1 A;  3ER0 A;  2BA0 A;  4UP8 A;  3KJO A;  1Q8K A;  1EQQ A;  1X6O A;  5IP7 G; 
#chains in the Genus database with same CATH topology
 1Z6H A;  4DR6 Q;  3C2P A;  1QUQ B;  1W6J A;  2HD3 A;  3KUP A;  4RCN A;  1VQK A;  4AYB E;  2IX0 A;  4KKU A;  1CFM A;  5EQ0 A;  4DK3 C;  4Q5V A;  2O5J C;  4ZUI A;  2R92 G;  2EXZ A;  5C0X I;  2XRS D;  1IBM Q;  4JPB W;  2RKS A;  2B2U C;  4GLV B;  4K5W A;  4GOP A;  2VNU D;  1EY0 A;  3QWN A;  2NVX B;  2WKC A;  4APV A;  4HED A;  3S1N B;  4JI0 Q;  1PTO H;  1JOR A;  1SMX A;  4H0L C;  4R4T A;  2CH4 A;  5IP9 H;  1IXR A;  1M4V A;  1HTL D;  1WTO A;  2B2U A;  1SYD A;  2B2W C;  3QB3 A;  4IQZ A;  2A6H D;  2TMP A;  1E2W A;  1F2M A;  1BXT A;  1SMY C;  2ASB A;  2PZW A;  5HUR A;  3T1H L;  3NEM A;  3RMH A;  1K8O A;  1I4G A;  4BY7 H;  3EJI A;  5JJI A;  4FF1 A;  4A3C H;  1UE6 A;  1V1P A;  1V1O A;  2UU9 Q;  4DR4 Q;  1P16 A;  4GNX B;  1G6Z A;  2BE5 C;  4B3T Q;  4A3G H;  4C3I G;  1PH3 A;  4O42 A;  5H1S E;  3KLS X;  1QVF A;  2Q8R E;  1GHJ A;  1EOT A;  5FO9 B;  2IW3 A;  5CV9 A;  3OW2 A;  4PV1 C;  4BY1 B;  3S14 B;  1IBL L;  1SR3 A;  4YIJ A;  3TQY A;  1D2B A;  4B3R Q;  1I4R A;  3ITP A;  2E2D C;  5ELB A;  2K05 A;  1LTL A;  1CI3 M;  4GKJ Q;  2A19 A;  3NP8 A;  1SYE A;  1KAW A;  1L0Y B;  2OF1 A;  3ERO A;  2UUC L;  1NY4 A;  4BBR G;  3OMC A;  3OIQ A;  1EY6 A;  1I94 Q;  3GTJ B;  1HZA A;  5JEA J;  1TII D;  3RZD B;  1XPU A;  2E76 C;  3G6J B;  3EA6 A;  1K8G A;  1YIJ A;  1LT4 D;  3OW7 A;  4KD3 A;  4X65 Q;  4UPA A;  3I55 A;  2JJQ A;  4QL5 A;  5D65 A;  2ICE C;  2JA8 H;  3LGJ A;  1JB7 A;  4JI7 Q;  5C4J H;  1EWC A;  2HCI A;  4V0B A;  3C1F A;  1CM9 A;  4ZYS A;  3D3R A;  1J6Q A;  2EZV A;  4DR2 L;  2LSS A;  1E1T A;  3I4L A;  3GD7 A;  4I7Z C;  5I4D A;  1OXU A;  1SYG A;  1KD1 C;  3PQI A;  3UE1 A;  1EUJ A;  4OIK A;  4J1M A;  2ZTE A;  3N52 A;  3ZYY X;  1CZG A;  1OXS C;  2VUM H;  3RZD H;  1TWA H;  1I4H A;  1L0X B;  1N36 L;  3MFG A;  1EIH A;  4FNF A;  2CQA A;  4KI0 A;  2MUY A;  1SYF A;  4FP5 D;  2A8V A;  5ELN A;  1STE A;  4L5S A;  4JW0 A;  4P72 A;  4CJ0 B;  3O13 A;  2FMC A;  4DNR B;  1D7Q A;  1HCZ A;  2DUD A;  4TKO B;  1BCP D;  2F0T A;  1PH7 A;  3I4N H;  1HHV A;  2ALY B;  2WAC A;  2GA4 B;  1CSP A;  1DCZ A;  2DNE A;  2DGY A;  4BY1 H;  1QJO A;  4R4O A;  5E7N A;  2PI2 E;  4KD4 A;  1FJG Q;  3OMG A;  2UXC L;  1NMF A;  5EGT A;  5EKL A;  1N8R C;  3MXN A;  5CV6 A;  5C44 B;  3HOY B;  4MN3 A;  2EYO A;  2RQX A;  3GTP H;  3J80 L;  2K01 A;  1S5F D;  1FGU A;  5IP7 H;  1V1Q A;  1B8A A;  1AFP A;  4R4I A;  1TQO A;  1HR0 W;  5LL6 X;  4XT1 B;  5FO7 B;  1QNU A;  4WJW A;  2AMC B;  4FDB A;  2OQ0 A;  2WB1 B;  1IBM L;  4LFA Q;  2OT2 A;  4XYQ A;  1ASY A;  3TME A;  1VF5 C;  3KF8 B;  3CCL A;  2JA5 G;  1IKM A;  3J7A F;  1C8C A;  5IE8 A;  2B39 A;  2F0M A;  1LYL A;  3UDX A;  4B9W A;  5IT9 E;  1QZH A;  2A6H C;  1I4P A;  3OOC A;  3U58 A;  4OHJ A;  4ZK9 B;  1F9S A;  4LF7 Q;  3R8B A;  2CW0 D;  4CDF C;  2XIW A;  1EY8 A;  1JCK B;  1VQ9 A;  3ONA B;  4BWG B;  1DON A;  3S14 H;  3HOU H;  2JK8 A;  4J8Q A;  3VYS A;  1U0L A;  3FKI G;  3D4D A;  2CVR A;  4K6D A;  4EQP A;  1NBW A;  4JI6 L;  3Q22 A;  2AWO A;  3K7U C;  4XQJ A;  4QJF A;  1WTX A;  2JA8 B;  1RIP A;  4R9W A;  4CJ1 B;  1HZ9 A;  1I6V C;  4G57 A;  4PMW A;  3KF6 A;  1WTQ A;  1E24 A;  3I7F A;  3A0J A;  3CQZ H;  2XN9 C;  2E2I H;  5JVH 3;  3I8Z A;  5IOC A;  4V19 0;  3UE0 A;  1MKH A;  1TS3 A;  1PTO C;  1JWS D;  1K83 B;  5DM6 3;  3TS2 A;  1RL2 A;  2YTV A;  2XSC A;  1TY2 A;  3J80 i;  1NUC A;  1U5K A;  5TSS A;  2K7V A;  4EQN A;  1BBX C;  4KY5 A;  2OXP A;  3T1Y L;  2BH2 A;  1PFN A;  4DV5 L;  4HIK A;  3EQL C;  1ASZ A;  1STG A;  2ZXP A;  3D4R A;  1F77 A;  2YU9 B;  1AZQ A;  1V9P A;  1X54 A;  2I5M X;  1STH A;  1GUN A;  1VQF A;  1KXL A;  5T1I A;  1TWC H;  4JBJ A;  2K50 A;  5M5Y B;  1S3O A;  2Z6B A;  1AZP A;  3MWY W;  1YZ6 A;  1VQ7 A;  3NTK A;  3CC4 A;  3OTO L;  2JA6 G;  1SN8 A;  4ALP A;  3K5N A;  1OTC A;  3CMA A;  2K5W A;  1QUQ A;  5J22 A;  2B2T C;  3VA5 A;  1Q7Y C;  3QOJ A;  4U67 3;  3QG1 A;  3A8J E;  2JEB I;  3NHH A;  4L5R C;  2GVA A;  4ZCK A;  2LKV A;  3MA2 B;  4A3F G;  2MP1 A;  1SSO A;  3K7A B;  1KTK A;  4DR6 L;  1IW7 C;  5CBA E;  4LFB L;  4DV0 L;  1DYQ A;  2LS0 1;  1E1O A;  4EX5 A;  1F2Y A;  2EY1 A;  4J15 A;  3K8A A;  3TZD A;  5FLM G;  3S1M H;  1YNN D;  3E0J A;  3T51 B;  3S1Q H;  5IGE A;  4RGN A;  1RD9 D;  4DXG A;  2K5N A;  5GAG C;  5JJZ A;  1B53 A;  3K80 C;  5M3F H;  2D9U A;  4C3H B;  5D14 A;  1WYD A;  3RZO H;  1E2V A;  4UAI A;  2R92 H;  1SNC A;  1KNA A;  4DV5 Q;  5CV5 A;  1VMP A;  2K5Q A;  2ZJP A;  3F8T A;  2UUC Q;  3H3V H;  4BBS G;  3ULL A;  3NK9 A;  1OXX K;  3BG3 A;  1VF7 A;  4WOR A;  4H7B A;  1A8V A;  4JCV E;  1ET9 A;  2RF4 A;  4P71 A;  4RFB A;  4B3R L;  1N34 Q;  5IT9 L;  4PMB A;  3H94 A;  1G51 A;  5FJ8 G;  4DV6 L;  2FFK B;  2Z0S A;  1VQ4 A;  4X6A H;  4IUU A;  2F0F A;  4MIU A;  3CU7 A;  4FXK C;  5IYB G;  2I5H A;  4PMC A;  1LAC A;  2R93 G;  5D3I B;  1QVG A;  1LO5 D;  3Q8D A;  4DUZ L;  5CR3 A;  1FNV A;  3ULP A;  2IL8 A;  1B3Q A;  4QY7 A;  1VQJ A;  3K0X A;  3I2Z A;  4M1U B;  4DV4 Q;  4RGM A;  1K0S A;  1X3P A;  3H0G G;  2MPM A;  1WTP A;  4YY3 L;  1UE1 A;  3HOV H;  5C5L A;  1JOO A;  2DNC A;  3S1N H;  2E2J H;  2VQE L;  2SNS A;  2A69 D;  1PXU A;  4C3I B;  1G91 A;  1LLR D;  1S5E D;  1Z7T A;  4A3L H;  4DFA A;  1XNQ L;  3Q6S A;  2FXQ A;  2F3W A;  5ELO A;  2UXD L;  1HNX L;  1HFN A;  3A54 A;  1GOZ A;  4P74 A;  2EPB A;  2EIF A;  4KKT A;  4DAV A;  4FF2 A;  3HOW G;  4QMG A;  4DV1 Q;  2Z4H A;  3PUZ A;  1PH9 A;  4RAU C;  3JAM E;  3T16 A;  4CHT B;  1EY4 A;  1VQB A;  2LY7 A;  2QDL A;  3CHB D;  3PCO B;  1II3 A;  3S2D H;  2DJF C;  4FVM A;  1S5D D;  4RHR A;  3OTO Q;  2VY3 A;  1RKN A;  2B63 G;  4HTH A;  3L2P A;  1RJT A;  4GN5 A;  2F0L A;  2G9H D;  4PZ8 A;  3CPW A;  1HUN A;  3E9H A;  4A93 B;  4RMF A;  4JI8 L;  3L7Z C;  1N33 L;  1PH6 A;  1K9M C;  1DZ1 A;  2B63 B;  2L0C A;  3TP7 A;  3K57 A;  4A3K B;  3S1M B;  1VQH A;  5IWA Q;  4Y7N B;  2I07 B;  1YNX A;  5C44 G;  3HOY G;  2HDL A;  4DR1 Q;  4BS9 A;  5C4H A;  1GUO A;  1D5X C;  4X64 Q;  5FLM H;  1OXT A;  2MQH A;  3JAM c;  2EOT A;  4K8I A;  1EQR A;  1YVC A;  2Q2H A;  1EIF A;  2O2L D;  4LW1 A;  1JE5 A;  2BA0 A;  2I46 A;  2E74 C;  4KHP L;  1BOS A;  4NP5 A;  4A3M B;  1XMQ L;  4HSP A;  4LFB Q;  1B9M A;  2JE6 I;  5LMU L;  1PFM A;  5M5X H;  1DOM A;  2KEC A;  2B3G A;  3PIP A;  1Q1B A;  4IUV A;  4ZKB B;  1E7Z A;  1KRT A;  3D6C A;  4JI6 Q;  5G3L D;  3CC2 A;  2BCO A;  3E5S A;  4DF7 A;  4KJN A;  4WJ3 M;  2F0K A;  4XT3 B;  2MO0 A;  4I7A A;  3OYY A;  4KMU C;  2VQF Q;  2ZXO A;  3SGI A;  1KRS A;  2HHH Q;  1U4R A;  5IYD G;  4QIW B;  2A5H A;  1YJN A;  4Z9C B;  2AQ1 B;  1BVS A;  1FR3 A;  1BKB A;  1IYV A;  1BUV T;  2R93 B;  4BXX G;  2GN5 A;  1K73 C;  1VQN A;  2OWO A;  1LUZ A;  3P20 A;  1SNP A;  4TSS A;  3JAM i;  4ZQ3 A;  2NVT B;  5M3M B;  3I72 A;  4A93 H;  3D0F A;  2IWH A;  1JJC B;  1VQ5 A;  3T1Y Q;  2QF7 A;  1ICW A;  3FDT A;  4DAP A;  1VQP A;  4KHV A;  4LUV A;  1SDF A;  2QDB A;  3HKZ B;  4X66 L;  2R7Z B;  5L37 A;  4BBR H;  4HJ5 A;  1BCP B;  3CAM A;  3QOL A;  3NQI A;  3SXH A;  1M1K C;  3S15 H;  1HR0 Q;  1YJ9 A;  4LF8 L;  2R7D A;  3TP5 A;  1TS5 A;  2K6A A;  4HCE A;  5JPN C;  1IBL Q;  1EIG A;  5FJ8 H;  5IGB A;  3SVM A;  1N34 L;  4BY7 G;  2E75 C;  5KNB A;  1QOH A;  2JP1 A;  2KCC A;  3I90 A;  1B50 A;  1S40 A;  1GHK A;  4DV7 L;  4C3I H;  4IUN A;  5HGT A;  4C1N I;  1WOC A;  3RLF A;  4JBK A;  3BDO A;  1JJ2 A;  1YNN C;  3EBE A;  4QGU A;  1XTC D;  2OCE A;  2NVQ H;  4HIO A;  5C0X J;  1E0B A;  1F2Z A;  2BDO A;  5ELE A;  2C5C A;  3U4Z A;  4B08 A;  4LF7 L;  1EWH A;  2Y0S B;  2B63 H;  4L8J A;  1HNZ L;  2SEB D;  4L63 B;  2UXB Q;  4R4C A;  1YHB A;  3VR3 A;  2E5L Q;  1Q46 A;  4YWM A;  5C3E H;  3NBH A;  4NW2 A;  2PQA A;  3J7A V;  2KUM A;  3VR4 A;  2K03 A;  2ATW A;  1C9O A;  3LWE A;  2Q8I B;  3KLW A;  4RWS C;  1KHI A;  5IGC A;  3R2T A;  1XTD A;  2KED A;  5IOD A;  4JC0 A;  2D5D A;  4KHP Q;  2R7Z H;  3KBX A;  4R8I A;  2K32 A;  1ESR A;  3I4N B;  4UY8 C;  2H5X A;  2EVB A;  1LV9 A;  2RA4 A;  3ULJ A;  3A56 A;  5EPL A;  5KGU A;  4LF4 L;  4GNX C;  1ROD A;  1GVP A;  1LTB D;  3GV3 A;  4N8X 1;  1HXY D;  2NN6 G;  2XVS A;  3PO3 H;  1EY5 A;  2ZM6 L;  1CSQ A;  3M4Q A;  3URY A;  2VUM G;  3FP9 A;  1JC7 A;  1LT6 D;  4A3F H;  3S9W A;  1YNJ C;  4PQX A;  3S16 H;  3TN2 A;  2B8F A;  1TWG B;  1PA6 A;  5ELC A;  1DXM A;  4A3D G;  2FMM A;  1MSG A;  4POF A;  1NMG A;  1A3V A;  1ILQ A;  2MFI A;  1TWF H;  3C46 A;  1PFS A;  4JI5 L;  4FF3 A;  1Y69 U;  1L0W A;  1PH8 A;  5M3F G;  5M9O A;  1TR5 A;  1MIU A;  5IYC G;  2KVM A;  1SXT A;  1PVO A;  1IYU A;  2VB3 X;  2EY2 A;  4HR7 B;  2TSS A;  5FOB B;  1O78 A;  4A93 G;  4A3M H;  1DGS A;  3J80 c;  1B3A A;  4JI1 L;  3ND9 A;  4MZ9 A;  3DHQ A;  1LAB A;  2X6G A;  1R9T B;  4MTN A;  2F3V A;  1KDA A;  3HKZ E;  3WDN A;  2PW5 A;  3HKS A;  5CV4 A;  2ZJQ A;  1H9K A;  1VQC A;  1Y14 B;  2N8N A;  4CDE C;  1UEA B;  4PNY A;  1Y8P B;  3A8K E;  1HH2 P;  1PLF A;  2RVL A;  1NNX A;  1AW7 A;  5I2X A;  1A3U A;  2HHH L;  3KFU A;  2MHV A;  1V1P B;  3ZJY C;  2ZM6 Q;  1X55 A;  3A55 A;  1CUK A;  2IJ0 A;  3HG9 A;  1KAB A;  4LF9 Q;  2ZTD A;  1D1K A;  3RN5 A;  4F87 A;  2PMZ B;  3HS0 C;  4A3G G;  3CCV A;  4HMI A;  1EFI D;  3G71 A;  4XDX A;  5EAY A;  3K7A H;  3J81 L;  3J81 j;  1WFQ A;  3S2D B;  4A3G B;  2IY5 B;  4B9X A;  4C2M H;  2V4D A;  3G4S A;  1JMC A;  2KBN A;  4QF4 A;  2F0V A;  2NBF A;  4POG A;  2XWB B;  1I50 B;  1SJE D;  2A6E D;  2WB1 G;  4DK6 C;  3NEL A;  1EY7 A;  2EJF C;  4JOI A;  1GM5 A;  5JJK A;  1TU2 B;  3P1H A;  3NQT A;  2K5H A;  1J5E Q;  3MEF A;  4IUR A;  2QIL A;  4ME3 A;  4Q0F A;  1KLG D;  4A3F B;  3E0E A;  3S17 H;  2ZXR A;  4GLX A;  2SOB A;  5BN3 A;  3TRZ A;  5I6W A;  3FVQ A;  1AP0 A;  4H02 A;  3J81 i;  2HIX A;  1KNE A;  2PPB C;  1JIC A;  4NXN Q;  1Y1V B;  1PHJ A;  1HTP A;  2VZA A;  4C3J H;  4G7Z C;  1Y8O B;  3GDE A;  2X69 A;  3NEN A;  5FLX L;  1MD2 D;  2O5I C;  2PQA B;  4YCV A;  2SNM A;  4ME5 A;  2F0Q A;  2IHF A;  4KTA A;  2QEJ C;  2JA7 G;  4KK7 A;  4DR7 Q;  5AJ3 L;  4GLA C;  1R4P B;  1C0A A;  1HR0 L;  3HOZ H;  1R4Q B;  4CJ2 C;  2KHI A;  4LF6 L;  1J8I A;  3MXP A;  1X3Q A;  1VQM A;  3KDF B;  1O7Y A;  2CFM A;  3X3M A;  1AH9 A;  4P2C B;  2WII B;  2L15 A;  3E6Z X;  2NVY H;  3MXG A;  1GUS A;  4YY3 Q;  3PUX A;  4DR1 L;  2RDG A;  3UI2 A;  5E4W C;  1EYC A;  3CCS A;  5IWA L;  4DKA C;  2F0I A;  1G29 1;  3PF4 A;  1TVX A;  2NVQ B;  1PRT F;  2L55 A;  5BN4 A;  4QIW E;  1V43 A;  3BS1 A;  4UP9 A;  3F2B A;  3S1Q B;  3S17 B;  1FNW A;  2PO4 A;  5EBC A;  1LM0 A;  4X62 Q;  1H95 A;  3VR6 A;  3H15 A;  2E2H B;  3U4V A;  3RD4 A;  3FPU B;  4X3U A;  3RR5 A;  1ILP A;  1CA6 A;  1KL9 A;  4OXP A;  1UE7 A;  4DR7 L;  4A3J B;  2QKI C;  4LUO A;  5G3L F;  1WD0 A;  4DK1 A;  4ODG A;  2EYM A;  5COR A;  2OTL A;  3UDF A;  1TWF B;  2KCN A;  1FGB D;  2OTJ A;  1S4Z A;  1C4Q A;  1TS4 A;  4DR5 Q;  2RDF A;  4C2M B;  2PZU A;  5JEA G;  1DD2 A;  1FL0 A;  1EU4 A;  2ZJR A;  4A3B B;  2P5Z X;  4WFN 3;  4QQB X;  3V96 A;  2CCZ A;  3S16 B;  1O7Z A;  4OIJ A;  1L1O B;  1ET6 A;  4ULL A;  2NN6 I;  2HT1 A;  2C35 B;  4JG2 A;  1QZG A;  3RUZ A;  3H6M A;  4ID6 A;  1CKN B;  3PIP 3;  4TVA B;  3WWV A;  3GTM B;  4JI4 Q;  4R4Q A;  4MNO A;  3GTK B;  4DV3 L;  1SE3 A;  1E22 A;  5M3M G;  3KOJ A;  4UP7 A;  4AQY L;  3GTO B;  4IN3 A;  1WTR A;  2EDG A;  1K83 H;  1PV4 A;  2F4V Q;  2A1A A;  2DN8 A;  3EN2 A;  4LFC L;  2E2I B;  2MGS A;  2ZT9 C;  3H91 A;  1DM0 B;  2K4K A;  4K14 A;  1XMQ Q;  2B2V C;  4A3E H;  3GV6 A;  3MHB A;  2JEA I;  2D62 A;  2DY8 A;  2A6E C;  4F88 A;  1RDP D;  2QW7 A;  4A3L G;  3HEJ A;  4NXN L;  1I6H H;  3I4M G;  4X3K A;  2KCT A;  3IFT A;  2B2Y A;  1U4L A;  3FEW X;  2Z6K A;  1FYC A;  5C3E B;  1PYS B;  1TXY A;  4HID A;  1YIT A;  3HOU B;  3PIO A;  4JI3 Q;  2K28 A;  1NCV A;  2RBM A;  3WOE A;  2XNA C;  4LUZ A;  3GTG B;  2L4N A;  1SYC A;  1PRT D;  2XWJ B;  3DM3 A;  4A3E G;  1BBW A;  3IRB A;  2EYP A;  2I5L X;  2OEO A;  3K81 C;  4JI8 Q;  2AWN A;  4ZRZ A;  2H1E A;  5KEE A;  5AFW A;  3ER0 A;  4DA2 A;  2NZ1 D;  3SK6 A;  3M4Y A;  2XRQ D;  4K2K A;  5IP7 G;  2KHS A;  1LTS D;  1T9H A;  2V1C C;  1A63 A;  1Q1E A;  3T13 A;  4KN7 C;  1Q81 C;  1PTO D;  5IYB H;  2WV6 D;  3JAM L;  2H4O A;  2BOS A;  3K5O A;  1Q90 A;  1PFB A;  1ZEQ X;  3TDQ A;  4LF9 L;  1WTV A;  1BNZ A;  1KLU D;  1B2T A;  1D6E C;  2ES2 A;  4G7O C;  4JI5 Q;  5J3B A;  4N8F A;  3L0O A;  1SEB D;  5ELD A;  3ICE A;  1HA6 A;  4FF4 A;  3I3C A;  1KIX A;  3PUW A;  1WCM B;  3I56 A;  1K3B C;  1STY A;  2UXD Q;  3PMF A;  1TWH B;  1G2S A;  1NAP A;  3D6W A;  3TBI B;  1YNJ D;  3HOV G;  3J80 E;  1UNS A;  5E4X A;  1Q3L A;  2VXW A;  1CKO A;  3BVZ A;  3SK4 A;  4BY7 B;  4K5V A;  4IUP A;  1Q8I A;  2AQ3 B;  1XX8 A;  2F0P A;  1LTG D;  4HSV A;  1WD1 A;  1HRJ A;  2F3I A;  4BBS H;  4A3I G;  4L5Q A;  2OQK A;  3HOX B;  1PTO B;  3H0G H;  2EYL A;  3E9I A;  3EFX D;  3TS0 A;  5LMN L;  3T4A C;  1N33 Q;  1QNK A;  2WAQ B;  5IIF A;  1B7Y B;  3EVQ A;  3PGZ A;  4KLK A;  3MTS A;  4K5X A;  5ELF A;  5M5X B;  1HQR D;  3D4W A;  4A3K G;  5KRU A;  5C4X H;  1K0R A;  1G2T A;  1BDO A;  1B70 B;  3AEV A;  2VL6 A;  3DM1 A;  3FKI H;  1Y1W B;  4CDC C;  1Q82 C;  4KN4 C;  3F2C A;  1NSN S;  4ZLT F;  4AIM A;  5JEA H;  1CK1 A;  4HCS A;  2O4X A;  1RTN A;  4BBR B;  2B29 A;  2K75 A;  1WJJ A;  3UDG A;  2RHS B;  2FHT A;  1MJC A;  2WKD A;  3NWS A;  2K1B A;  3N6R A;  3IL8 A;  2IX1 A;  1I5F A;  1OXV A;  5E1F A;  5CBE E;  3GTJ H;  3T53 B;  4S3S A;  4C3H H;  3A7L A;  4Y52 H;  4IFD I;  2NVT H;  3NWT A;  2VQE Q;  1I94 L;  3RNU A;  1H9S A;  2EQS A;  3J81 c;  1JQY D;  4A3J G;  5LL6 S;  3A8I E;  1H9J A;  4KY6 A;  4CKE A;  4JI2 L;  1KAA A;  2IPK D;  3V2T A;  2ZTC A;  1O7I A;  1VQO A;  3D31 A;  5C3X A;  1ZYR D;  5KYI A;  1BR9 A;  2B2W A;  2B2T A;  4A3I B;  4IZ8 A;  1EWI A;  5DM7 3;  4LF8 Q;  3SK5 A;  1NJI C;  3I4O A;  1HNW Q;  1QB5 D;  2A69 C;  4QUC A;  1BO0 A;  1CKM A;  4QB4 A;  4BA1 I;  1SFO B;  4UDU C;  1Q12 A;  1C48 A;  2K5D A;  2MNA A;  4A3J H;  4NMZ A;  3VYU A;  4FXD A;  1JOQ A;  1SNM A;  1HJP A;  4OWW B;  1EYG A;  1SBB B;  3CCU A;  1I3Q H;  2E2H H;  2B2Y C;  4NXM L;  1Y1V G;  2SDF A;  3LX0 A;  4DAY A;  2F0H A;  2NWG A;  4HIM A;  1A62 A;  2F03 A;  1A2T A;  4K2L A;  4JI3 L;  4IPC A;  3RLO A;  4CDD C;  2R7Z G;  3I73 A;  1DOK A;  1GUG A;  3KLR A;  2F0D A;  2JA5 H;  1B9N A;  4LNQ A;  2NVX H;  2NVY B;  5JPM C;  2F0S A;  5FLX c;  1XMO Q;  4DU9 A;  4L6T B;  2JA6 H;  4IOA A;  1GUW A;  1IYJ B;  5JVG 3;  3BZD B;  4LMQ D;  3S2H H;  1HNW L;  1MGS A;  3PO3 G;  3F1Z A;  4DR2 Q;  3K0Y A;  5BR8 L;  4DAM A;  3F2D A;  4OO1 H;  5LMU Q;  2QEX A;  5I9P A;  2KA7 A;  3CRL C;  2N3S A;  2Z8L A;  3CCJ A;  1EEI D;  4IFD J;  4NDX A;  5IGD A;  4K0K Q;  4LWC A;  3B6Y A;  2UXB L;  2WIN B;  1XJV A;  4MTK A;  4N9P A;  3QIA A;  4G7H C;  2E5L L;  3KDF A;  3OIP A;  5C5M A;  3ERS X;  3I91 A;  1LT5 D;  4PZ7 A;  4C3J B;  2F0E A;  4PZ6 A;  2UXC Q;  1LT3 D;  4UHV A;  3K59 A;  1D5M C;  1QE6 A;  1X56 A;  2K5V A;  2WFW A;  3QJY A;  4ILW A;  1EOV A;  4IFD G;  5FLX E;  2JA6 B;  2E2J B;  2G9D A;  3BYT B;  2PYK A;  5I2Y A;  2G5D A;  3L9A X;  5BR8 Q;  4H13 C;  1ESF A;  1PTO F;  4OWX B;  1IL2 A;  4FO2 A;  1JR0 D;  3W3A A;  5T1G A;  3M85 A;  5LMN Q;  1XMO L;  1SE8 A;  3OPO A;  4OEL B;  3CRK C;  3UDI A;  2RCN A;  1I3Q B;  3J7A 5;  4GZY C;  4YWK A;  2B2V A;  1AEX A;  2F52 A;  1GUT A;  2I0Q A;  1JJG A;  2F0J A;  1XNR Q;  3TRE A;  3NTH A;  1CT1 D;  1X32 A;  1EU3 A;  4KY7 A;  2M00 A;  2N55 A;  2NTT A;  1CZW A;  3LWU A;  5CC4 A;  4LF5 L;  3FMC A;  1IL8 A;  3D8G A;  5M5W H;  3M9B A;  4GS3 A;  4JK1 C;  4O2D A;  1SLJ A;  4KKS A;  1F9Q A;  4I65 A;  4O0A A;  1SYB A;  2WP8 J;  1IBK Q;  1DOL A;  4JYA L;  4A3D B;  2R3Z A;  3S1R H;  1JE4 A;  5DEH A;  5KND A;  2L11 A;  3K6O A;  4TRD A;  2J0T D;  1VQA A;  2A73 B;  3BDL A;  5M3M H;  3J81 E;  1AE2 A;  5M3F B;  3DEP A;  4LFA L;  5KIX A;  4DV0 Q;  3GTM H;  3GTQ B;  4QCL A;  4DV7 Q;  2Q2I A;  1ZYR C;  3G7L A;  1N36 Q;  1ENF A;  3JC6 6;  4IUQ A;  2L1B A;  5COY A;  1KC8 C;  2Z1C A;  3E3X A;  1H9R A;  2EJG C;  3GO5 A;  1R9T H;  1U4P A;  5DLQ E;  2BH8 A;  1VQI A;  5CV7 A;  2EY6 A;  4A3D H;  1A6X A;  3I4M H;  1W3S A;  5LHY 1;  1XNQ Q;  5I9O A;  1L1O A;  2YTY A;  4GKK Q;  1LTA D;  1XPO A;  5C0X G;  3DUZ A;  1UUP A;  2JA9 A;  1PH1 A;  4ZUJ A;  3TP8 A;  4LF4 Q;  3T56 B;  3WOF A;  1G8Z D;  1BF4 A;  4NXM Q;  3Q23 A;  5CMD A;  2BDN A;  3NSW A;  1YJW A;  1S5C D;  2Y0S G;  1IW7 D;  4A76 A;  5FO8 B;  4DR3 L;  2YYZ A;  1N32 Q;  2X6L A;  4RHS A;  4IUT A;  3M3Y H;  4DK0 A;  3GQB A;  3NBI A;  1KDC A;  2F0N A;  4HMJ A;  1NE3 A;  4RGT A;  1RCV D;  2QA4 A;  3CPF A;  4AYB B;  2XGT A;  3MXU A;  4L5T A;  1EQV A;  3NBH B;  1BBU A;  1SE2 A;  1C7Y A;  4KJO A;  1T5X D;  5IGF A;  1D1I A;  3U50 C;  5K36 H;  2KEE A;  4KHZ A;  4RA8 A;  3SR1 A;  1RHP A;  5FK9 C;  4MHE A;  3S24 A;  3BDC A;  4DUY L;  1XWE A;  4OEM B;  2KCM A;  4GOP B;  3BZC A;  1Y8N B;  1VQL A;  3J7Z C;  3MVV A;  3ND8 A;  3RLN A;  3H09 A;  3RN2 A;  1PH2 A;  2PI2 A;  1A15 A;  3F2U A;  3KK7 A;  4P75 A;  4P73 A;  2RCF A;  4DV4 L;  4DR5 L;  3GTO H;  3G6E A;  4JI1 Q;  1PZK D;  3HZX A;  4DPG A;  1S72 A;  4NB3 A;  1W6K A;  2JSO A;  2Q2T A;  3CXC A;  4IJH A;  3SK8 A;  4R1J A;  1IZ6 A;  3HOX G;  2JA5 B;  4DUZ Q;  2RSN A;  4IPH A;  1EY9 A;  3G48 A;  1AE3 A;  2C9O A;  1HFG A;  1U4M A;  1X65 A;  2EYF A;  1AN8 A;  1PH4 A;  1ICF B;  3GTG H;  1HPC A;  4GN4 B;  5EKI A;  4DV6 Q;  2PQE A;  1BQQ T;  4C3J G;  5C0X H;  1I50 H;  4HJ9 A;  1Z47 A;  5EPK A;  5EKK A;  5BN5 A;  3HOZ B;  5C4J B;  1PZI D;  3MAQ A;  2UU9 L;  4B3M Q;  3R93 A;  3Q0A A;  3C1E A;  1TT2 A;  3DWP A;  4PG3 A;  3HP3 A;  1TWC B;  2JA8 G;  4GKK L;  1GO3 E;  2NYZ D;  3IKJ A;  2YU9 H;  2HUG A;  4DN4 M;  2KOL A;  3BVG A;  2K33 A;  4UP8 A;  4CGY B;  3KJO A;  1Q8K A;  4RKL A;  5HY6 A;  4DNT B;  2Q2U A;  4IPG A;  1CQF A;  2VQF L;  3BZK A;  3GTL H;  2EYH A;  3GTK H;  1EYD A;  1F9P A;  1MI2 A;  4K6L A;  3W5O A;  1SAP A;  4XTC S;  3AB9 A;  2BA1 A;  4CBV A;  4DV2 Q;  3OHX C;  3AMU A;  3FPP A;  1RTO A;  1ENA A;  2NB0 A;  4ZAI A;  1VQD A;  3LNN A;  1TWA B;  1TS2 A;  2FJ2 A;  1EYA A;  2VUM B;  4JI4 L;  5C6A A;  1NR2 A;  2PMZ E;  4F7X A;  5HGQ A;  1HNZ Q;  2AUK A;  1K8M A;  1ML0 D;  4OWT B;  5EPJ A;  2N78 A;  4JYA Q;  3NTI A;  1MBY A;  4XXE A;  1NTG A;  2EY5 A;  2K14 A;  4CKC A;  4YWL A;  4BY1 G;  1MJE A;  4B3M L;  3I4M B;  4HJ7 A;  2PZT A;  2Z9H A;  1EZ8 A;  5M5Y H;  4DNI A;  4GNX A;  1TWG H;  5CGK A;  3K5M A;  5IYD H;  3FHW A;  4LF6 Q;  3SEB A;  3H0G B;  4OGQ C;  3J7Y W;  3VYR A;  1PRT B;  3SDZ A;  3TSS A;  4EQ5 A;  3CME A;  4WRD A;  1P8L A;  4LAA A;  4RH6 A;  4B3S Q;  4GOP C;  2NTS A;  3KBG A;  3KYH C;  4C3H G;  4ABN A;  1VDZ A;  4JV5 Q;  5GAE C;  1G6P A;  4YHH Q;  3DLL A;  1M90 C;  3I70 A;  3HOU G;  1I4Q A;  2F4V L;  4B3T L;  2MO1 A;  5KNC A;  3S1R B;  5C3E G;  4IAL A;  4JI2 Q;  5A2Q E;  5J39 A;  1QVC A;  5GQO A;  3FRP B;  3K5L A;  2KJX A;  4DAY B;  1XYI A;  4A3B G;  1JB3 A;  1WTH A;  2JA7 B;  3CCE A;  5C44 H;  3HOY H;  1XPR A;  1TWH H;  2HIV A;  1UEB A;  1WCM H;  3NXW A;  2B8G A;  3BU2 A;  5J1Z A;  1XXG A;  4HN7 A;  2N88 A;  2CQO A;  4BA2 I;  2K52 A;  1H9S B;  4HJ8 A;  1D8L A;  3CCQ A;  1K28 A;  4OON A;  1B4O A;  1X3G A;  3R3O A;  1ZXT A;  3BYY B;  4XQN A;  4LK1 C;  1STA A;  1O7L A;  1SNO A;  4YHH L;  3A5U A;  2UUA L;  3HKZ G;  1ZKO A;  1N9W A;  2CHB D;  1A0I A;  1KDB A;  3DXJ C;  4O1N A;  3VDY A;  1RF2 D;  2FIN B;  3STB D;  5GAD C;  2EE1 A;  1ONL A;  2CW0 C;  1WVL A;  2DJG C;  4HJA A;  1Q86 C;  1K8A C;  1VCI A;  3CD6 A;  1O80 A;  3AFP A;  1CKN A;  3AYH B;  1SRO A;  3CC7 A;  5IY0 A;  5KYL A;  2HCC A;  1B44 D;  2A68 D;  1LTI D;  1E3P A;  4YCU A;  5D3D A;  1X3F A;  2Y0S E;  3AQQ A;  4FYD A;  5ISR A;  2N49 A;  5NUC A;  5K5P A;  1YBY A;  3C3L A;  1VQE A;  3M4O H;  1VQ6 A;  3HGB A;  3H3V C;  3U9O A;  1W2B A;  4X3S A;  4A3E B;  3PO2 B;  2AKW B;  2Z4I A;  2E8G A;  1HZC A;  2VS1 A;  2WB1 E;  3KJP A;  2L5T A;  3PIO 3;  2R92 B;  1STB A;  2CH4 W;  3RZO B;  1STN A;  2XTI A;  3HFZ B;  4LJZ C;  1CA5 A;  3S2H B;  1A3T A;  3A7A B;  2PNR C;  1I4X A;  3DWQ A;  4JI0 L;  4BXX H;  1J9O A;  2QGQ A;  3MZ5 A;  2NN6 H;  3OWE B;  2R93 H;  4XQQ A;  4A3C G;  1HA5 A;  3OSO A;  4CKB A;  1HUM A;  3M3Y B;  5IT9 c;  2PNH A;  2UUA Q;  2DY7 A;  4IFD H;  1FD7 D;  1VQG A;  3L3O C;  2F0W A;  3VA7 A;  4DV3 Q;  1A2U A;  1UE5 A;  4JI7 L;  1NR4 A;  1VMC A;  4DV1 L;  4IO9 A;  3DMU A;  1YEZ A;  3KF8 A;  3DWA A;  3R2I A;  4C1N K;  4J6H A;  4R8N A;  2AHO B;  5M5W B;  3NPP A;  1BCP C;  1FJG L;  1YHA A;  2D0O A;  3P7J A;  5C4X B;  1SFO H;  1VS0 A;  3ERQ A;  1GKH A;  4A3M G;  1IBK L;  1GD7 A;  3BJU A;  4DGZ A;  3IAY A;  1XNR L;  4X3T A;  3U9S A;  3PF5 A;  2LXJ A;  4KV6 A;  1T5E A;  4XIG S;  4IOC A;  3TZU A;  4A3I H;  4B3S L;  4GN3 B;  4NPS A;  1IHZ A;  3MXN B;  5C3W A;  1JOK A;  3HOX H;  4GKJ L;  4JV5 L;  4E6I A;  5FKA C;  4OO1 I;  1OO9 B;  1PYB A;  3CW2 C;  4TQU S;  2R6G A;  4A4I A;  1L2F A;  1PYW D;  3V05 A;  2M9V A;  1QG7 A;  5DAU A;  4ZKC B;  2IX3 A;  1LTT D;  4X62 L;  2NUC A;  1GXD C;  5IGG A;  2NZO A;  3GTQ H;  1X3E A;  5GRO A;  4JBW A;  1GJX A;  3PUV A;  4DR3 Q;  2M2L A;  1KQS A;  1E2Z A;  3W1G A;  1PRT C;  2MJ8 A;  4AQY Q;  5DNF A;  3HOW H;  4DR4 L;  3PO2 H;  4M8A A;  3A74 A;  2KEN A;  1QWY A;  1SNQ A;  1EQT A;  3PSI A;  1PDQ A;  3QR8 A;  1Z9F A;  3M4O B;  2JYO A;  3S15 B;  5CV8 A;  1Y1W H;  1QCB D;  2UUB Q;  5JOB A;  2J4X A;  1SE4 A;  4G4K A;  3HRZ C;  1UWV A;  2F0O A;  3HOW B;  3AFQ A;  1SJH D;  2NZH A;  2J7Z A;  5F2D A;  3TEH B;  4OL7 A;  5E3F A;  1SND A;  1MHW C;  3SHL A;  1PZJ D;  2CKZ B;  4DXF A;  4DV2 L;  1Y1V H;  1UAP A;  2F4I A;  4C56 C;  2WAQ E;  4OO1 G;  1EL0 A;  3M7G A;  2HDM A;  2ICI A;  2YTX A;  4BBS B;  2RDH A;  4Y7N H;  1SMY D;  5CYU A;  2KHJ A;  2GVB A;  4X64 L;  3K58 A;  1B1Z A;  2ID0 A;  4U68 A;  2L9H A;  2QCP X;  4RCO A;  2LMC B;  4QUF A;  2A68 C;  1V8Q A;  1WTW A;  2VW9 A;  2R7F A;  4IPD A;  5EJW A;  1EIY B;  4AYB G;  2BE5 D;  1PMR A;  3GTP B;  1K3R A;  4JVZ A;  3P75 A;  4EQO A;  1MSH A;  4X65 L;  3I4N G;  4H44 C;  5A2Q L;  2L12 A;  2AUJ D;  2IHE A;  2JA7 H;  2PW7 A;  2Z6K C;  1J5E L;  5K36 G;  5C4Z A;  3T1H Q;  1EZ6 A;  2EXD A;  1U9R A;  1BCP F;  2F0U A;  2K04 A;  1ENC A;  1QIL A;  1JWU D;  2EYJ A;  4OX9 L;  2HQL A;  2D0P A;  1FVI A;  1CTM A;  2VB2 X;  4YCW A;  2ENB A;  2F0G A;  3NUC A;  1X9N A;  4JBM A;  3CP0 A;  1EFW A;  1HZB A;  2RHQ B;  5AJ3 Q;  4A3K H;  2CWP A;  3CF5 A;  3OWF A;  1H9M A;  3PV0 A;  5IYC H;  5A35 A;  2JQO A;  4K8J A;  3PUY A;  5JJL A;  1D5Z C;  1YI2 A;  1PH5 A;  3X3N A;  3HOV B;  3MFY A;  3STB C;  1HNX Q;  5EBD A;  1DJR D;  3NE5 B;  1LTR D;  5IP9 G;  3CCM A;  3GP7 A;  1CQV A;  1CHP D;  2IT1 A;  1EEF D;  2F1M A;  1SRU A;  1Y1W G;  2JN4 A;  2CWA A;  1HQM C;  2KQ3 A;  3KLS A;  3FKI B;  5JAV A;  2UUB L;  1F2L A;  3W1B A;  5GAH C;  3QO2 A;  2D2C C;  1JWM D;  4IJL A;  4F8M A;  3W2D A;  3M4P A;  1I6H B;  4N9T A;  4LF5 Q;  4DUY Q;  2YV5 A;  1IKL A;  4FXG C;  1L1O C;  3PO2 G;  2WAQ G;  4K0K L;  1YHQ A;  5I6Y A;  2RSO A;  3TP6 A;  4EGV A;  3KF6 B;  1TY0 A;  1TKW B;  3CCR A;  3EIV A;  5LMN W;  4A75 A;  3A5Z B;  3VR5 A;  1JT8 A;  4HAE A;  1WCM G;  4OX9 Q;  4RKB A;  1N32 L;  4EVO A;  3GTL B;  3M7N A;  3MC0 B;  3HOZ G;  3H3V I;  4X66 Q;  4RG1 A;  3MEH A;  5C4X G;  3VYT A;  4LFC Q;  2EJM A;  3CKI B;  3PO3 B;  2A74 C;  2AQ2 B;  4NKL A;  2JXM B;  2LXK A;  2R61 A;  3CQZ B;  2Q8T A;  4A3B H;  3Q24 A;  3VR2 A;  3SE0 A;  1FNU A;  1M8A A;  1WI5 A;  4AH6 A;  2HQE A;  1S5B D;  1CHQ D;  3IFD A;  2LFN A;  4XYO A;  2PCF B;  4JOI C;  4WJ4 A;  1VQ8 A;  3BVM A;  4RGO S;  1F9R A;  3AU7 A;  1EQQ A;  1X6O A;  3DEO A; 
#chains in the Genus database with same CATH homology
 5HY6 A;  4DR6 Q;  1QUQ B;  1T9H A;  2V1C C;  2Q2U A;  4IPG A;  1VQK A;  4AYB E;  2IX0 A;  1XMQ L;  1A63 A;  1Q1E A;  2VQF L;  4LFB Q;  3BZK A;  2JE6 I;  4DK3 C;  5LMU L;  3GTK H;  3GTL H;  2R92 G;  1Q81 C;  5M5X H;  5C0X I;  3W5O A;  5IYB H;  1IBM Q;  2B3G A;  3PIP A;  4XTC S;  1Q1B A;  2BA1 A;  4DV2 Q;  1E7Z A;  1KRT A;  4GLV B;  4JI6 Q;  4LF9 L;  4GOP A;  2VNU D;  3CC2 A;  1VQD A;  4APV A;  2ES2 A;  4JI0 Q;  5J3B A;  4JI5 Q;  3L0O A;  4WJ3 M;  3ICE A;  2MO0 A;  1KIX A;  1SMX A;  3PUW A;  3I56 A;  3OYY A;  4R4T A;  2VQF Q;  5IP9 H;  4JI4 L;  1IXR A;  2UXD Q;  3SGI A;  1KRS A;  2HHH Q;  2PMZ E;  5IYD G;  3HOV G;  1YJN A;  5HGQ A;  1BVS A;  1HNZ Q;  1BKB A;  2ASB A;  4OWT B;  1CKO A;  4BXX G;  2GN5 A;  1K73 C;  3T1H L;  2N78 A;  3NEM A;  1VQN A;  4JYA Q;  2OWO A;  1LUZ A;  4BY7 H;  3JAM i;  5JJI A;  1NTG A;  2K14 A;  4A3C H;  4A93 H;  3D0F A;  4YWL A;  4BY1 G;  1MJE A;  4B3M L;  1JJC B;  1UE6 A;  4HJ7 A;  1VQ5 A;  3T1Y Q;  2UU9 Q;  4DR4 Q;  1P16 A;  1VQP A;  2F3I A;  4LUV A;  4GNX B;  4B3T Q;  4BBS H;  4A3I G;  5M5Y H;  4DNI A;  4A3G H;  4L5Q A;  2OQK A;  4GNX A;  1TWG H;  1PH3 A;  4X66 L;  5H1S E;  4BBR H;  3H0G H;  4HJ5 A;  1QVF A;  3E9I A;  5IYD H;  3FHW A;  3TS0 A;  3CAM A;  5LMN L;  4LF6 Q;  1N33 Q;  3OW2 A;  1M1K C;  3S15 H;  1HR0 Q;  1YJ9 A;  4LF8 L;  2R7D A;  1B7Y B;  1IBL L;  1SR3 A;  3TQY A;  4B3R Q;  4EQ5 A;  3PGZ A;  3CME A;  4KLK A;  1IBL Q;  1P8L A;  5FJ8 H;  4B3S Q;  4GOP C;  1N34 L;  2UXD L;  3KYH C;  4BY7 G;  1LTL A;  4A3K G;  5C4X H;  4JV5 Q;  1K0R A;  5GAE C;  1G6P A;  4GKJ Q;  4YHH Q;  2A19 A;  3DLL A;  1M90 C;  1B70 B;  3AEV A;  3HOU G;  2VL6 A;  2F4V L;  1KAW A;  4B3T L;  2MO1 A;  3FKI H;  1S40 A;  5C3E G;  4DV7 L;  1Q82 C;  4C3I H;  4JI2 Q;  3F2C A;  2UUC L;  1NY4 A;  1WOC A;  3RLF A;  4BBR G;  1JJ2 A;  1QVC A;  5GQO A;  4JBK A;  4AIM A;  1I94 Q;  3EBE A;  1HZA A;  4DAY B;  4QGU A;  4A3B G;  5JEA J;  1XPU A;  1K8G A;  3CCE A;  2B29 A;  5C44 H;  2OCE A;  2K75 A;  1WJJ A;  4X65 Q;  1TWH H;  4UPA A;  3UDG A;  1YIJ A;  1XPR A;  2HIV A;  3I55 A;  2RHS B;  2JJQ A;  1MJC A;  2NVQ H;  1UEB A;  1WCM H;  4HIO A;  5C0X J;  2IX1 A;  3U4Z A;  1I5F A;  1OXV A;  4QL5 A;  4LF7 L;  3GTJ H;  2B63 H;  3BU2 A;  2JA8 H;  1HNZ L;  4C3H H;  4Y52 H;  3LGJ A;  1JB7 A;  4IFD I;  2CQO A;  4JI7 Q;  2NVT H;  2K52 A;  5C4J H;  2VQE Q;  4BA2 I;  2UXB Q;  1I94 L;  4R4C A;  1D8L A;  4HJ8 A;  1YHB A;  3CCQ A;  3RNU A;  2EQS A;  1J6Q A;  3J81 c;  4OON A;  2E5L Q;  1Q46 A;  4YWM A;  4DR2 L;  1X3G A;  4A3J G;  2LSS A;  1E1T A;  5C3E H;  3GD7 A;  4JI2 L;  2PQA A;  1OXU A;  1KD1 C;  2ZTC A;  3UE1 A;  1O7I A;  1EUJ A;  3D31 A;  1VQO A;  2ATW A;  2ZTE A;  1C9O A;  3KLW A;  4YHH L;  3A5U A;  1OXS C;  3HKZ G;  2UUA L;  2VUM H;  1KHI A;  3RZD H;  1N9W A;  1TWA H;  1A0I A;  1XTD A;  1N36 L;  1EWI A;  3VDY A;  3STB D;  5GAD C;  4JC0 A;  4LF8 Q;  4KHP Q;  1NJI C;  4KI0 A;  3I4O A;  2R7Z H;  4HJA A;  1HNW Q;  1Q86 C;  1K8A C;  2A8V A;  5ELN A;  4UY8 C;  1CKM A;  2H5X A;  4BA1 I;  4L5S A;  1VCI A;  4P72 A;  1Q12 A;  3CD6 A;  1D7Q A;  2DUD A;  3AFP A;  1CKN A;  3AYH B;  3ULJ A;  2MNA A;  1SRO A;  3CC7 A;  4A3J H;  5IY0 A;  4LF4 L;  4GNX C;  1PH7 A;  1GVP A;  3I4N H;  1HJP A;  4OWW B;  2ALY B;  2NN6 G;  1E3P A;  1EYG A;  3PO3 H;  4YCU A;  1CSP A;  1I3Q H;  1CSQ A;  2ZM6 L;  3CCU A;  2E2H H;  1Y1V G;  1X3F A;  4NXM L;  3M4Q A;  2DGY A;  2Y0S E;  3AQQ A;  4BY1 H;  5E7N A;  4R4O A;  2N49 A;  2VUM G;  3FP9 A;  1YBY A;  4HIM A;  1A62 A;  1VQE A;  4A3F H;  3M4O H;  2PI2 E;  1VQ6 A;  1FJG Q;  3S16 H;  4JI3 L;  4IPC A;  2UXC L;  1PA6 A;  3RLO A;  1W2B A;  1NMF A;  1N8R C;  4A3D G;  2R7Z G;  2AKW B;  2E8G A;  1HZC A;  2VS1 A;  2WB1 E;  4POF A;  2JA5 H;  3KJP A;  1NMG A;  3GTP H;  4LNQ A;  2NVX H;  5FLX c;  1XMO Q;  2JA6 H;  2MFI A;  2XTI A;  3HFZ B;  4IOA A;  1TWF H;  1IYJ B;  1FGU A;  1PFS A;  4JI5 L;  5IP7 H;  4JI0 L;  4BXX H;  1V1Q A;  1B8A A;  2QGQ A;  4R4I A;  1L0W A;  1PH8 A;  5M3F G;  3S2H H;  1HNW L;  1MIU A;  5IYC G;  1HR0 W;  3PO3 G;  1PVO A;  2R93 H;  3F1Z A;  4A3C G;  4A93 G;  4DR2 Q;  5BR8 L;  4A3M H;  4DAM A;  3F2D A;  1DGS A;  2AMC B;  3J80 c;  2QEX A;  4FDB A;  2OQ0 A;  5IT9 c;  4JI1 L;  5LMU Q;  2PNH A;  4LFA Q;  2N3S A;  1IBM L;  2UUA Q;  1VQG A;  3CCJ A;  1ASY A;  4DV3 Q;  4IFD J;  4MZ9 A;  1UE5 A;  4JI7 L;  4DV1 L;  4IO9 A;  4LWC A;  3B6Y A;  4MTN A;  4K0K Q;  3KF8 B;  3CCL A;  2UXB L;  2JA5 G;  1YEZ A;  1XJV A;  3HKZ E;  5IE8 A;  2E5L L;  3HKS A;  1LYL A;  3KDF A;  3UDX A;  3ERS X;  2ZJQ A;  1QZH A;  1VQC A;  4PZ7 A;  1Y14 B;  2N8N A;  2AHO B;  4PZ6 A;  3U58 A;  4LF7 Q;  2UXC Q;  1FJG L;  1YHA A;  2D0O A;  1HH2 P;  1SFO H;  1VS0 A;  2HHH L;  3KFU A;  1GKH A;  4A3M G;  1X56 A;  2K5V A;  2WFW A;  1IBK L;  1VQ9 A;  1GD7 A;  3S14 H;  3ZJY C;  2ZM6 Q;  3HOU H;  2JK8 A;  3BJU A;  1X55 A;  1EOV A;  1U0L A;  3FKI G;  1XNR L;  4IFD G;  1CUK A;  3PF5 A;  2LXJ A;  4XIG S;  1NBW A;  4JI6 L;  4LF9 Q;  2ZTD A;  2AWO A;  3K7U C;  4IOC A;  4QJF A;  3RN5 A;  4A3I H;  4A3G G;  4B3S L;  1RIP A;  4GN3 B;  3CCV A;  4NPS A;  3G71 A;  5EAY A;  3MXN B;  5BR8 Q;  3HOX H;  1HZ9 A;  3K7A H;  4GKJ L;  4PMW A;  3J81 j;  1WFQ A;  4JV5 L;  4OWX B;  2IY5 B;  3KF6 A;  1IL2 A;  4C2M H;  4OO1 I;  1PYB A;  1E24 A;  3I7F A;  3A0J A;  3CW2 C;  2R6G A;  4TQU S;  4A4I A;  3M85 A;  1L2F A;  3CQZ H;  3G4S A;  1SE8 A;  5LMN Q;  2KBN A;  1XMO L;  1JMC A;  2E2I H;  4POG A;  3UE0 A;  1MKH A;  2RCN A;  3UDI A;  3J7A 5;  4X62 L;  2WB1 G;  4YWK A;  4DK6 C;  2NZO A;  3NEL A;  3GTQ H;  1X3E A;  5GRO A;  3TS2 A;  4JBW A;  1RL2 A;  2F52 A;  2YTV A;  3PUV A;  4DR3 Q;  2I0Q A;  1KQS A;  1JJG A;  1XNR Q;  3J80 i;  1U5K A;  4JOI A;  3TRE A;  3W1G A;  1GM5 A;  4AQY Q;  3T1Y L;  3HOW H;  4LF5 L;  2BH2 A;  3PO2 H;  4DR4 L;  5JJK A;  4DV5 L;  3A74 A;  5M5W H;  4HIK A;  3M9B A;  4GS3 A;  2KEN A;  4O2D A;  2K5H A;  1J5E Q;  3MEF A;  1ASZ A;  1SLJ A;  3PSI A;  1V9P A;  1X54 A;  4ME3 A;  4O0A A;  1Z9F A;  2I5M X;  3E0E A;  3S17 H;  1VQF A;  4GLX A;  2WP8 J;  1IBK Q;  1KXL A;  1TWC H;  4JYA L;  3S1R H;  1Y1W H;  3TRZ A;  2UUB Q;  4JBJ A;  2K50 A;  4H02 A;  1S3O A;  3J81 i;  1UWV A;  2HIX A;  1VQA A;  1YZ6 A;  1VQ7 A;  3AFQ A;  2NZH A;  3CC4 A;  3OTO L;  1PHJ A;  4NXN Q;  2JA6 G;  1SN8 A;  5M3M H;  3TEH B;  1AE2 A;  2VZA A;  4ALP A;  1OTC A;  4LFA L;  3CMA A;  4DV0 Q;  1QUQ A;  3GTM H;  4C3J H;  4DV7 Q;  2Q2I A;  1Q7Y C;  1N36 Q;  2CKZ B;  3JC6 6;  3GDE A;  4DV2 L;  3NEN A;  1KC8 C;  4KHP L;  1Y1V H;  2WAQ E;  3GO5 A;  2JEB I;  2PQA B;  4YCV A;  4L5R C;  2GVA A;  4OO1 G;  1R9T H;  2IHF A;  4A3F G;  2YTX A;  5DLQ E;  2JA7 G;  2BH8 A;  1VQI A;  4DR6 L;  4DR7 Q;  4LFB L;  4DV0 L;  5AJ3 L;  4Y7N H;  4EX5 A;  1E1O A;  4GLA C;  4A3D H;  4J15 A;  2KHJ A;  3K8A A;  3I4M H;  5FLM G;  2GVB A;  3S1M H;  1HR0 L;  1C0A A;  3HOZ H;  1W3S A;  4X64 L;  2KHI A;  4LF6 L;  3S1Q H;  1XNQ Q;  1VQM A;  1L1O A;  2ID0 A;  3KDF B;  2YTY A;  4GKK Q;  2K5N A;  5GAG C;  1XPO A;  5C0X G;  3K80 C;  2CFM A;  5M3F H;  1AH9 A;  2VW9 A;  2R7F A;  2L15 A;  1WYD A;  4IPD A;  2NVY H;  3RZO H;  1EIY B;  4AYB G;  2JA9 A;  4YY3 Q;  3PUX A;  4DR1 L;  1K3R A;  2R92 H;  4X65 L;  3CCS A;  1PH1 A;  5IWA L;  4DV5 Q;  3I4N G;  4DKA C;  1G29 1;  3PF4 A;  4LF4 Q;  4QIW E;  1V43 A;  2IHE A;  2ZJP A;  2JA7 H;  4BBS G;  3F8T A;  2UUC Q;  4NXM Q;  4UP9 A;  3H3V H;  2Z6K C;  3F2B A;  1YJW A;  1J5E L;  5K36 G;  3T1H Q;  2Y0S G;  4A76 A;  3ULL A;  2EXD A;  1OXX K;  1LM0 A;  4DR3 L;  4X62 Q;  1H95 A;  3H15 A;  3U4V A;  1A8V A;  4JCV E;  2RF4 A;  2YYZ A;  1N32 Q;  4P71 A;  3RR5 A;  4B3R L;  3M3Y H;  4OX9 L;  1N34 Q;  2HQL A;  2D0P A;  1KL9 A;  1FVI A;  4OXP A;  1UE7 A;  4DR7 L;  4DV6 L;  1G51 A;  4YCW A;  5FJ8 G;  1VQ4 A;  2Z0S A;  4X6A H;  1NE3 A;  4LUO A;  1X9N A;  4JBM A;  3CP0 A;  1EFW A;  1HZB A;  2RHQ B;  5AJ3 Q;  2QA4 A;  2CWP A;  4A3K H;  3CPF A;  3CF5 A;  2XGT A;  3PV0 A;  5IYC H;  5IYB G;  3NBH B;  2I5H A;  2JQO A;  4L5T A;  1BBU A;  1C7Y A;  2R93 G;  3PUY A;  1QVG A;  2OTL A;  5JJL A;  3Q8D A;  4DUZ L;  3UDF A;  1YI2 A;  1PH5 A;  3ULP A;  3U50 C;  2OTJ A;  3STB C;  4KHZ A;  4DR5 Q;  1HNX Q;  4QY7 A;  1VQJ A;  5JEA G;  3S24 A;  3K0X A;  1FL0 A;  4DUY L;  3I2Z A;  4DV4 Q;  5IP9 G;  3CCM A;  2ZJR A;  3H0G G;  2KCM A;  4GOP B;  3BZC A;  2IT1 A;  4YY3 L;  1UE1 A;  1VQL A;  3J7Z C;  3HOV H;  4QQB X;  2CCZ A;  3RLN A;  3S1N H;  3RN2 A;  1PH2 A;  1SRU A;  2E2J H;  2PI2 A;  2VQE L;  1L1O B;  1Y1W G;  2CWA A;  2NN6 I;  4P75 A;  2HT1 A;  4A3L H;  2C35 B;  2UUB L;  4JG2 A;  1QZG A;  1XNQ L;  1CKN B;  3W1B A;  4TVA B;  3WWV A;  5GAH C;  2FXQ A;  4P73 A;  4JI4 Q;  5ELO A;  4R4Q A;  4IJL A;  4MNO A;  4DV4 L;  4DR5 L;  1HNX L;  3GTO H;  4DV3 L;  3M4P A;  1E22 A;  5M3M G;  3G6E A;  3KOJ A;  4P74 A;  4UP7 A;  4JI1 Q;  2EIF A;  4LF5 Q;  4DPG A;  4DUY Q;  4AQY L;  2YV5 A;  1S72 A;  1K83 H;  3HOW G;  1L1O C;  4NB3 A;  1PV4 A;  3PO2 G;  2WAQ G;  4DV1 Q;  4K0K L;  2F4V Q;  3PUZ A;  2Q2T A;  1YHQ A;  3CXC A;  4IJH A;  2A1A A;  1PH9 A;  3EN2 A;  1VQB A;  3KF6 B;  4R1J A;  4LFC L;  3CCR A;  3EIV A;  5LMN W;  4A75 A;  2K4K A;  1IZ6 A;  3HOX G;  3PCO B;  1XMQ Q;  3A5Z B;  4DUZ Q;  4A3E H;  1JT8 A;  4IPH A;  3S2D H;  3G48 A;  1WCM G;  2JEA I;  1AE3 A;  2D62 A;  4OX9 Q;  4A3L G;  1N32 L;  4NXN L;  1X65 A;  2VY3 A;  3OTO Q;  1I6H H;  2B63 G;  3I4M G;  3M7N A;  2KCT A;  1PH4 A;  3L2P A;  4GN5 A;  3HOZ G;  3H3V I;  4X66 Q;  4PZ8 A;  3GTG H;  2Z6K A;  4GN4 B;  4RG1 A;  3E9H A;  3CPW A;  4DV6 Q;  4RMF A;  5C4X G;  4LFC Q;  1PYS B;  1TXY A;  4JI8 L;  3L7Z C;  4HID A;  1YIT A;  1PH6 A;  1K9M C;  1N33 L;  3PIO A;  1I50 H;  4HJ9 A;  1Z47 A;  4JI3 Q;  2LXK A;  4LUZ A;  2UU9 L;  1VQH A;  4B3M Q;  5IWA Q;  4A3B H;  1YNX A;  5C44 G;  3HOY G;  3DM3 A;  4A3E G;  1WI5 A;  4AH6 A;  4DR1 Q;  1BBW A;  3IRB A;  4PG3 A;  2I5L X;  4JOI C;  4WJ4 A;  1VQ8 A;  4X64 Q;  5FLM H;  1OXT A;  2MQH A;  3K81 C;  4JI8 Q;  3JAM c;  2AWN A;  2JA8 G;  1GO3 E;  3HOY H;  4GKK L;  1EQR A;  2Q2H A;  1YVC A;  2YU9 H;  1EIF A;  1JE5 A;  4LW1 A;  3ER0 A;  2BA0 A;  4UP8 A;  3KJO A;  1Q8K A;  1EQQ A;  1X6O A;  5IP7 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...