1XNQQ

Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnqQ00
2K75A 2WB1E 3OTOQ 5C3EH 3E9IA 1KXLA 1VCIA 4IFDJ 1K83H 4JI4L 4DR4Q 3S2HH 4B3ML 1X6OA 2BA0A 3CPWA 3AEVA 5GADC 2JEBI 3I56A 3L0OA 2E8GA 4GN3B 5GAEC 4DV3L 4LF8Q 3U4ZA 4BBSH 1A63A 4A3BG 4DV2Q 3HOXH 1Q12A 4UP9A 3CCSA 1IBLQ 4BY7G 2R93G 3H0GH 1PYBA 1XMOL 2HIXA 2EXDA 3S2DH 1QVCA 3NEMA 4JBWA 2B63G 1QVFA 4RMFA 1HNXL 2NN6I 3K7AH 3PSIA 3ER0A 1X54A 3CCVA 4GOPC 1KQSA 4OO1I 2K5NA 3J7ZC 1I3QH 2BH8A 4APVA 3UDGA 1VQGA 1WOCA 2ZTEA 3ULJA 1PYSB 1YEZA 4GKKQ 1FL0A 2F4VQ 3PUXA 3I2ZA 1MIUA 4LUZA 4DR3L 4JI7L 1UE7A 2N8NA 4L5RC 3HOUH 2OCEA 5FLXc 1NTGA 1Q46A 1EFWA 4GOPB 3PF4A 4PZ6A 4A3DH 1UEBA 2QEXA 4LUOA 3A0JA 2CFMA 2EIFA 2NVYH 4OWXB 2UUAL 2CCZA 4LFCQ 1LUZA 1I94L 2D0OA 3S24A 1UWVA 5GQOA 2JA5G 4LFBQ 1G51A 2PI2A 5FJ8H 4DV6Q 4HIOA 1Q7YC 1E1OA 4A3MH 1IBMQ 2CKZB 5FLMG 5HGQA 5C4XH 4NXNQ 3HOVH 5M5YH 3HOZG 5C4JH 2E2HH 3S15H 2K50A 3ULPA 2XGTA 1BVSA 2E2IH 2Q2HA 5M3FG 4LF7Q 1TWAH 4B3RL 1PH2A 4QQBX 2E2JH 4A93G 2JA9A 5DLQE 3MEFA 5K36G 2NVQH 1VQMA 1VQCA 1BBUA 1Y14B 4B3MQ 4IFDG 2UXCL 1WCMH 3NBHB 1VQ5A 2OWOA 4DR6L 2VQFQ 3PF5A 2YYZA 3E9HA 2GVBA 1KIXA 1A0IA 2HIVA 5AJ3L 4DV3Q 2NZHA 3M4PA 5GAHC 4JI2L 4LW1A 1O7IA 3GTLH 4LFAQ 1XNQL 2JE6I 1XMOQ 1CKOA 2MFIA 3D31A 4X62L 2NVTH 1I50H 3HKZE 4ALPA 4JV5L 3CQZH 1HNXQ 1MJEA 1AH9A 1KL9A 3T1HQ 4LF6L 4POGA 1VQPA 4JI6L 1VQHA 2DUDA 3M3YH 5C44H 3KJPA 4J15A 1VQLA 1YVCA 4A3JG 4A3GH 2B63H 1NMGA 3G48A 3KOJA 3MXNB 1QUQB 4A3KH 2WAQE 5LMNQ 4DR3Q 1K8AC 2I5HA 2UXDQ 3A74A 2KHIA 1XPUA 3HKZG 4GLAC 3CF5A 1C7YA 3PO3H 3CCMA 3OW2A 1E24A 2PMZE 4P74A 3G6EA 5LMUL 4C2MH 1PA6A 3TS0A 1K3RA 2VUMG 1Y1VH 4OWTB 4P73A 3W1GA 5M5XH 5IYBG 5JJKA 4BBRH 2I0QA 1JB7A 3CC2A 3PV0A 3UDFA 2NZOA 3HOWH 3PO2G 1KHIA 5IYCG 1LM0A 3G4SA 3VDYA 3J81j 1SN8A 2WAQG 4HJ9A 3EBEA 4R4QA 4YY3Q 3TS2A 4IOAA 1SRUA 2WP8J 3A5ZB 3B6YA 3U50C 1W2BA 2YV5A 4PG3A 2PNHA 5IY0A 3GTPH 4R4TA 2YTYA 1HH2P 3HOYG 2A19A 3CMAA 3I55A 1Q86C 2VS1A 4BY1G 1CUKA 4DK3C 5IP7H 3AYHB 4AQYL 4JYAQ 4YHHQ 1OXSC 3K8AA 1I6HH 5IYDH 1FJGL 1G291 1X3GA 3TEHB 3T1YL 2N3SA 5AJ3Q 3GTMH 4DV7L 2CWPA 3CCEA 4JI2Q 4A3CG 2R6GA 2E5LL 2JA7H 3I4NG 1U0LA 4NPSA 4YWMA 3F2DA 1XNQQ 2Q2UA 1MJCA 5C0XJ 4X62Q 3J81c 3RN2A 2UXDL 4JG2A 2HHHL 3M7NA 5M3MG 5LMNW 3FKIH 4NXML 2UUCQ 2GVAA 4MZ9A 1KAWA 4JI6Q 2UXBQ 4KHPL 3H3VH 2RHSB 2IHEA 4DR7L 4YCVA 1PV4A 4MNOA 4A3FH 4KLKA 1B70B 1GVPA 4QIWE 1EOVA 4B3TQ 4IOCA 3H15A 3HKSA 2ALYB 4EX5A 3S1MH 3UDIA 4JBJA 3RLFA 4BXXH 3GO5A 1YHQA 3I4NH 5JEAJ 4LF4Q 4Y52H 1GO3E 2GN5A 3ULLA 1P16A 1PH7A 1N32Q 4P71A 4P72A 4EQ5A 1PH9A 3TREA 4A3IH 3M85A 1X56A 3GTGH 3IRBA 1FGUA 1XPRA 3BU2A 2VQEL 4JC0A 3J80c 1HR0L 5C3EG 4Y7NH 4X66Q 1B8AA 3CPFA 5IWAL 1TWFH 2MO0A 4LF9Q 1EUJA 1PHJA 1VQOA 4UP7A 1WI5A 1EQQA 3L2PA 4GOPA 2R7ZH 1PFSA 3GD7A 1CKNA 2UUBL 1K8GA 1L1OC 1N36L 3CCRA 4JI8L 4C3HH 2R7DA 3KDFB 1BBWA 3CMEA 1XMQQ 4DR2L 4BBSG 1CKNB 3HOXG 1X65A 3M4QA 1N9WA 4HIMA 3H0GG 3GTJH 4DV7Q 1OTCA 4JI5L 4BA1I 2IHFA 4A4IA 1VQFA 2AKWB 4PMWA 1XNRQ 4DR5Q 4LF5Q 1J6QA 1L1OB 2ES2A 1KC8C 1WYDA 5C0XG 1YJ9A 4L5SA 2BH2A 4NXMQ 4LWCA 2D0PA 5H1SE 4A3EH 5E7NA 1BKBA 2HQLA 2JA6H 3RZOH 2RHQB 1ASYA 4O0AA 3PUYA 2FXQA 2Z0SA 4GNXB 1UE1A 3LGJA 1S72A 4JI4Q 3HOUG 2QA4A 3CXCA 1KD1C 1N8RC 5IT9c 3RR5A 3RZDH 1N33L 4A3LH 1JJGA 4UPAA 1I5FA 3S14H 4R4OA 4A3DG 4JOIC 3PCOB 3RN5A 1AE2A 1DGSA 4JI3L 1Y1WH 5JJLA 3F8TA 4X65L 4A76A 3AQQA 5JEAG 2UU9L 4GN5A 2ZTDA 5FJ8G 3CAMA 4DV5L 4JOIA 5IP9H 4A3MG 1ASZA 2JA8H 1VQ9A 3CCLA 3BJUA 1U5KA 5C4XG 2KCMA 2RCNA 4OXPA 3HOVG 3JAMi 1HR0Q 1VQAA 1QUQA 1NJIC 4PZ8A 2ZM6L 2K5VA 1HNWL 3GTKH 2CQOA 2JJQA 3WWVA 3CC7A 4DV1L 1VQDA 1N34L 4JI7Q 1UE5A 4GS3A 1WCMG 2UUBQ 3AFPA 3FP9A 5ELOA 1K0RA 1VQNA 1MKHA 4JI8Q 4DV0L 1VQJA 4DR2Q 4GKJL 1OXUA 4KHZA 4A75A 2VNUD 3CP0A 2ZJPA 3HFZB 3M9BA 2R92H 1HZ9A 2R7FA 2UUAQ 1YZ6A 3K81C 1T9HA 2KENA 2L15A 1I94Q 1LTLA 5GROA 1HZAA 4HIKA 2B3GA 4QY7A 2N78A 4JI1L 1M90C 1IBKL 3FHWA 1Z9FA 2VL6A 4JCVE 4DR4L 5IE8A 4HJ5A 1E1TA 2ZJRA 2Q2TA 5C44G 1RIPA 1SMXA 1CKMA 2AHOB 5ELNA 4A3GG 3KYHC 4LF8L 1D8LA 3EIVA 3KF8B 3PGZA 4DR1L 4DV2L 1CSPA 4C3JH 4A3KG 2VZAA 1EIYB 4IO9A 2ID0A 4YCUA 1IBLL 4DUYL 3PO3G 2UXCQ 2ZJQA 2JK8A 1QZHA 2K4KA 3I4MG 3W1BA 2PQAB 2YU9H 4DR6Q 1Y1VG 1CSQA 1JT8A 4WJ4A 1VQ8A 4BBRG 3GTQH 1HR0W 3TRZA 3F2BA 1B7YB 1UE6A 3HOWG 2MO1A 2RF4A 1W3SA 4HJ7A 1PH8A 4JV5Q 3S1QH 1S3OA 4DV5Q 1NE3A 4HJ8A 4AH6A 4GLXA 1A62A 4GKKL 1WJJA 5M5WH 1JMCA 2F4VL 4AYBE 5J3BA 2AMCB 4LF6Q 1PH3A 4DNIA 3KF6B 1R9TH 3KLWA 2ATWA 2DGYA 1HZBA 3UE1A 1XTDA 2ZM6Q 3ICEA 1X3FA 4R4CA 1YJNA 4K0KL 1WFQA 3RLNA 3STBC 2AWOA 4A3BH 5IP7G 1YITA 4BY7H 2R93H 4TQUS 4DKAC 1VQBA 3Q8DA 4UY8C 5LMUQ 1EQRA 4DV6L 4DUZL 1PVOA 1OXVA 1SE8A 2IT1A 2N49A 3W5OA 4AYBG 1OXXK 4UP8A 1IBML 4IPDA 3SGIA 1XJVA 1J5EL 2CWAA 1H95A 2LXKA 2JA7G 3D0FA 1SROA 3GDEA 3I7FA 1HNZL 4O2DA 4JI0L 4DAYB 3RNUA 4LF7L 4IFDI 4JI1Q 1IBKQ 1IZ6A 3FKIG 4QJFA 1SR3A 1IYJB 3TQYA 3CCJA 1E7ZA 2MQHA 3PUWA 4XTCS 4LUVA 2VY3A 1YI2A 1Q82C 2K5HA 3S1NH 1X3EA 3KDFA 4L5QA 4A3FG 3CC4A 2VQFL 3CW2C 2AWNA 2H5XA 1VQ6A 1K73C 3I4MH 4DR1Q 2WB1G 1TWHH 4X64L 1NY4A 3BZCA 4LFAL 1NBWA 5HY6A 2C35B 1KRSA 1E3PA 3UE0A 2OQKA 4DUYQ 4AQYQ 1VQ7A 2JA5H 1SFOH 1M1KC 1E22A 3PUZA 1FJGQ 3T1YQ 1Q1BA 2ASBA 1PH4A 4B3SL 4GNXC 1L1OA 3T1HL 1JJ2A 4A3IG 5FLMH 4X6AH 1X55A 1TWCH 2E5LQ 1XPOA 2XTIA 3HOZH 4OONA 4MTNA 1A8VA 1HJPA 2LXJA 3K0XA 2HHHQ 2JEAI 1JE5A 4DAMA 5M3FH 3KFUA 1FVIA 1Q1EA 4A93H 4GNXA 1YIJA 4QGUA 5LMNL 4IPGA 5BR8L 4WJ3M 1G6PA 1C9OA 1K9MC 2IX1A 2BA1A 4KHPQ 2Q2IA 4NXNL 1VS0A 4DR7Q 2R7ZG 3U4VA 2KBNA 2YTXA 4HIDA 4K0KQ 1TWGH 4KI0A 1GKHA 1Q8KA 3STBD 3DLLA 3G71A 4OX9L 2KHJA 4DK6C 2PI2E 2MNAA 1YBYA 4DUZQ 4HJAA 1PH5A 2Y0SE 3DM3A 1L2FA 4PZ7A 1J5EQ 1V43A 4YY3L 2KCTA 2K14A 3CCQA 4FDBA 1HNZQ 3GTOH 3UDXA 2IX0A 2OTLA 4JI0Q 2VQEQ 2NVXH 4A3JH 4IPCA 4QL5A 1P8LA 2OQ0A 1D7QA 4DPGA 4RG1A 4A3EG 2NN6G 4DV4L 5IWAQ 1GM5A 4IJHA 2JA6G 1C0AA 2A1AA 4OO1G 3KJOA 4JYAL 4YHHL 1AE3A 1GD7A 2Y0SG 4AIMA 3J81i 2I5MX 2QGQA 3E0EA 2VUMH 3EN2A 4OWWB 3J7A5 5IYBH 1N36Q 4NB3A 4A3LG 5JJIA 1EWIA 4XIGS 4X64Q 3PUVA 4P75A 3PIOA 1HZCA 3F2CA 4ME3A 1S40A 1QVGA 1Y1WG 4B3RQ 3PO2H 2OTJA 5IYCH 5EAYA 2D62A 2IY5B 2I5LX 2WFWA 1N34Q 3S17H 3AFQA 3L7ZC 3PIPA 3ERSX 3OTOL 1V1QA 2V1CC 4R1JA 1X9NA 1VQKA 3OYYA 2UUCL 2JQOA 4B3SQ 4JI5Q 2UXBL 2JA8G 5IP9G 4LF5L 4IJLA 4LNQA 3HOYH 1VQ4A 1L0WA 4B3TL 4YWLA 3ZJYC 5BR8Q 4BY1H 4BA2I 3K7UC 4GLVB 4YCWA 4LF4L 2PQAA 1OXTA 1N32L 3I4OA 2F52A 3J80i 2HT1A 1IL2A 2YTVA 2VW9A 1N33Q 4POFA 4A3CH 1YNXA 5GAGC 3CCUA 3A5UA 3K80C 4OX9Q 2Z6KC 4JI3Q 3F1ZA 4IPHA 3BZKA 1TXYA 4GN4B 4X65Q 4JBMA 2R92G 3H3VI 5M3MH 1Q81C 4X66L 4TVAB 1YJWA 4JBKA 3KF6A 2UU9Q 4C3IH 4LF9L 2Z6KA 1EYGA 1Z47A 2B29A 1YHAA 2F3IA 4YWKA 1SLJA 1PH6A 3S16H 4DV4Q 1VQEA 4L5TA 1XMQL 1NMFA 1HNWQ 1EIFA 3M4OH 3RLOA 2EQSA 1VQIA 2LSSA 1QZGA 3JAMc 1YHBA 1JJCB 4H02A 2K52A 4R4IA 4LFCL 1KRTA 4DV1Q 2ZTCA 3S1RH 1RL2A 1PH1A 1IXRA 3CD6A 4LFBL 1LYLA 1V9PA 3NELA 3NENA 5IYDG 5C0XI 3U58A 2A8VA 4DV0Q 1XNRL 4BXXG 4DR5L 4GKJQ 3JC66
chains in the Genus database with same CATH superfamily
4DGZA 3OTOQ 3PIP3 1A3VA 4DNRB 5CV8A 3NQIA 2RQXA 4A3BB 4JI4L 5FO7B 4MN3A 3S2HH 4B3ML 2C5CA 3I4NB 1SE3A 2R93B 2RDHA 3CPWA 3BZDB 2C9OA 2K03A 3GQBA 3R3OA 3I56A 4LF8Q 1SNOA 4QIWB 5CYUA 3HOXH 3CCSA 1TU2B 3GTGB 3NEMA 4ILWA 4JBWA 1E2ZA 1TS5A 3CHBD 1LTTD 1X54A 2F0GA 4KY5A 3SK8A 1B4OA 1HXYD 1ILQA 1ZXTA 2NB0A 1YEZA 2B2WC 5EBDA 2F4VQ 4LUZA 4JI7L 1UE7A 1LT4D 2P5ZX 1D5MC 2K1BA 2JA5B 1S5CD 4A3DH 4LUOA 1PDQA 3A0JA 1UAPA 2BCOA 2NVYH 4OWXB 2A74C 2E75C 1RDPD 1QE6A 2EE1A 2PQEA 5EPLA 1UWVA 3ND9A 4FVMA 2PI2A 4HIOA 1IBMQ 2CKZB 2XRSD 5HGQA 3HOVH 5M5YH 2KHSA 4KKUA 3ITPA 4ZKBB 2E2IH 2Q2HA 4K8IA 2E2JH 5DLQE 1TWGB 5K36G 4QMGA 1GUGA 5KIXA 3KBXA 4C56C 4DV3Q 5FLXE 2F3WA 3TP5A 3GTLH 4LFAQ 4ZKCB 1XMOQ 2PW5A 3D31A 3HKZE 4K2KA 4HEDA 1MJEA 3CU7A 1EZ6A 4WFN3 1FNUA 3NBIA 1DOMA 1NSNS 3KJPA 4A3JG 4A3GH 1QJOA 1SYDA 3MXNB 1IW7D 1QUQB 2IPKD 4DR3Q 1XPUA 3HKZG 1F2YA 2Z8LA 4PV1C 3G6EA 4DXGA 4ULLA 1PA6A 4NXNQ 4IOAA 1K3RA 1CQFA 1Y1VH 3DM1A 4P73A 5KYIA 1JR0D 5M5XH 5JJKA 3PV0A 3UDFA 2PYKA 2X6GA 3EVQA 1KHIA 4K8JA 4YY3Q 3TBIB 2R3ZA 1TKWB 2B2VA 1HCZA 3GTPH 4RH6A 4R4TA 2YTYA 3I90A 3CMAA 4NDXA 1EIHA 1CUKA 1H9JA 3AYHB 4AQYL 1JQYD 4KD3A 1U4LA 2B2YC 4GZYC 4JK1C 4OIKA 2K01A 5M3MB 1Z7TA 3GTMH 4DV7L 4G7OC 2CWPA 4A3CG 2IL8A 4NPSA 5C0XJ 4X62Q 3TP8A 5BN3A 1BO0A 2GVAA 1TT2A 4J6HA 2UXBQ 4ZAIA 4DAVA 4K6DA 1XWEA 5CV4A 5C5MA 1B70B 4HMJA 3MVVA 4B3TQ 3C1FA 3I91A 3H15A 4K6LA 2HCCA 4JBJA 1L0YB 3DWPA 3RLFA 4BXXH 1YHQA 1P16A 4EQ5A 4A3IH 4B08A 1M8AA 1CHPD 1K0SA 1FGUA 1JOOA 3S2HB 2BDOA 3J80c 5EKIA 5C3EG 4Y7NH 4X66Q 1AP0A 2F0PA 3CPFA 3SK6A 3HGBA 1TWFH 5IWAL 2MO0A 1PHJA 3HOXB 1PFSA 3GD7A 4IUVA 1EWCA 2R7DA 3KDFB 4B9XA 5DNFA 4P2CB 3F2UA 3HOZB 3P1HA 1OTCA 1U4MA 4DR5Q 3IKJA 4LF5Q 1L1OB 2F0IA 2ES2A 1QNUA 2SNMA 1WYDA 3AMUA 4L5SA 2J0TD 4NXMQ 4O1NA 1BKBA 1Q90A 5IGCA 4A3DB 4OO1H 2F0TA 2HDLA 4GNXB 2NVYB 1S72A 3HOUG 2B2UC 1KD1C 3CXCA 1JJGA 4DAPA 3RZDH 2WACA 1GXDC 1I5FA 4R4OA 1Y1WH 4JI3L 4A76A 3HOVB 5M5YB 3OIPA 2E2IB 4GN5A 4DV5L 4JOIA 5IP9H 2E2JB 2F0SA 2KCNA 4HCSA 3CCLA 1U5KA 5CR3A 5C4XG 2KCMA 4OXPA 2K04A 2KCCA 1VQAA 5TSSA 3K5LA 2K5VA 1PLFA 3GTKH 1PRTB 3WWVA 1LO5D 3GTLB 1UE5A 3D3RA 5ELOA 2G5DA 1VQNA 3VR6A 3WOFA 1RHPA 4A75A 3M9BA 2R92H 3BG3A 1F9SA 2K33A 5FO9B 1I94Q 1ESFA 2OEOA 4HIKA 4QY7A 3I70A 1WTVA 2ICIA 1CK1A 4A3GB 4R8NA 2VL6A 1NAPA 3KF8A 5IE8A 3IL8A 4HJ5A 3LNNA 1Y1VB 1KABA 4LF8L 3KF8B 5M5XB 3PGZA 4DR1L 4XT3B 2ID0A 5JPMC 2Q8TA 2JK8A 2K4KA 2YU9H 5CORA 1UEAB 3GTQH 3F2BA 1SNQA 3GTPB 1U9RA 4AH6A 4XYOA 1JMCA 2F4VL 1STGA 4RGMA 5J3BA 4LF6Q 1ET9A 1PH3A 2A6HC 2DGYA 5I2YA 3H3VC 1X3FA 4AYBB 3E5SA 3GTMB 4BY7H 5JOBA 4DKAC 3Q8DA 5LMUQ 1SNPA 1PVOA 1D1KA 1OXXK 4UP8A 1IBML 3SGIA 1H95A 1I6VC 4JI0L 3H94A 4JI1Q 1IZ6A 2IW3A 1IYJB 3CCJA 4Z9CB 1QILA 4XTCS 2QW7A 1X3EA 3H09A 4CDCC 4A3IB 2L5TA 1M4VA 4LFAL 3I4NG 3P75A 3NWTA 1SFOH 1E22A 1KNEA 3T1YQ 2F0NA 1PH4A 4B3SL 4Y7NB 2FMCA 4X6AH 1TWCH 1TY0A 1TWFB 1B3AA 4MTNA 5CV7A 1A8VA 5BN5A 2LXJA 4V0BA 1Q8IA 1Y8OB 2X69A 2QDBA 3KFUA 4DAMA 5M3FH 4U673 1IW7C 1YIJA 3MZ5A 2BOSA 1H9SA 4WJ3M 1K9MC 4KHPQ 2BA1A 4IFDH 2Q2IA 4NXNL 1VS0A 3FMCA 2M00A 5IGGA 1HQMC 2KBNA 2F0MA 4K0KQ 2G9DA 2L0CA 4L8JA 1GKHA 3STBD 1BNZA 2Q8IB 3TP7A 4DK6C 5AFWA 4RKLA 2PI2E 3MFGA 1YBYA 4HJAA 1L2FA 4YY3L 3EQLC 3CCQA 1E0BA 2IX0A 2NVQB 1HUNA 4CJ2C 2VQEQ 4QL5A 4RG1A 4TRDA 4ZK9B 1EY0A 5A35A 1Y1WB 5KNCA 1EY9A 2QGQA 4OWWB 3J7A5 4NB3A 2KQ3A 2NVTB 1I50B 1GHKA 1FGBD 3F2CA 4ME3A 1GUWA 2OTJA 5KYLA 2IY5B 2WFWA 3AFQA 3L7ZC 4HMIA 1V1QA 4JI5Q 3AB9A 2NWGA 4WORA 2UXBL 3DWAA 1TS4A 3KLSA 3U9SA 4EVOA 4LNQA 1GUNA 1L0WA 4B3TL 4YWLA 1ZYRC 4BY1H 1BQQT 3BVGA 1OXTA 3VYTA 2R92B 2F52A 2HT1A 2IX3A 5J22A 1IL2A 4EQPA 1N33Q 2F0HA 2EJMA 3BZKA 4KN7C 5ELDA 5CMDA 4X66L 1SJHD 4C3IH 2AUJD 5CV6A 2YU9B 3QIAA 2KOLA 1NMFA 1EIFA 3GTQB 2EQSA 4C3JG 4R9WA 4DV1Q 3S1RH 1PH1A 1LYLA 5IYDG 2A8VA 4DV0Q 3T56B 4DR5L 4GKJQ 1LT3D 1ONLA 4LF5L 1W6JA 2WB1E 5I6YA 2EDGA 1BCPD 2JP1A 1BOSA 1D1IA 3A54A 4BY7B 1X6OA 3AEVA 4I7AA 5GAEC 4BBSH 3ONAB 2FFKB 4DV2Q 2EYPA 3H0GH 1PYBA 2F0KA 3S2DH 4XT1B 1QVCA 2B63G 1HNXL 3PSIA 3CCVA 1KQSA 2O5IC 1Q3LA 3MXPA 3FPUB 2JN4A 2Z1CA 1ENFA 1EQTA 3UDGA 4H13C 1VQGA 1WOCA 1PYSB 4GKKQ 1CHQD 2QKIC 1SEBD 1QG7A 2OCEA 5FLXc 1SFOB 2PPBC 4GOPB 4PZ6A 2QEXA 4XQQA 2EIFA 1TWCB 1EL0A 4LFCQ 5JEAH 3D8GA 1LUZA 4ZUJA 1I94L 2D0OA 1CQVA 5GQOA 5FJ8H 4DV6Q 5M3FB 3TMEA 3WOEA 1NR4A 1DXMA 1GUSA 1KLGD 1F2LA 3HOZG 2K50A 3ULPA 4QQBX 4A93G 1TWAH 3DEOA 3MEFA 1DM0B 1VQMA 1VQCA 1T5XD 1Y14B 1WCMH 3J7AV 2N55A 5ELCA 3PF5A 1A0IA 3VA5A 5AJ3L 2NZHA 2PZUA 1XNQL 1K3BC 3MHBA 1CKOA 2K28A 3CQZH 5KNDA 3T1HQ 4LF6L 3SEBA 5BN4A 2DUDA 1JCKB 4HAEA 1IL8A 1K8MA 2J4XA 3G48A 5IT9L 4A3KH 3VR3A 2WAQE 1ENAA 3M4YA 2I5HA 5C5LA 3CF5A 4Q0FA 5LMUL 4P74A 4TSSA 2VUMG 4OWTB 3W1GA 4XDXA 2NZOA 3A8IE 3PO2G 5IYCG 4F7XA 3VDYA 1XYIA 2E2DC 2WAQG 4HJ9A 2CH4A 4R4QA 4BY1B 3Q24A 1CA6A 1W2BA 3A8JE 2DNEA 2PNHA 5C6AA 3HOYG 2A19A 3V05A 2VS1A 4RCOA 4JYAQ 2D9UA 3K8AA 1I6HH 5IYDH 1X3GA 3TEHB 3T1YL 1SAPA 3MA2B 3ZYYX 3CCEA 4F8MA 4JI2Q 2R6GA 1U0LA 4C3IB 2XN9C 2PZTA 2AQ3B 1MHWC 4ZCKA 1MJCA 4KJOA 1CI3M 4M1UB 2NYZD 3RN2A 4JG2A 3M7NA 5LL6X 3FKIH 5C3WA 4JI6Q 1EYCA 1HHVA 4KHPL 4F87A 2IHEA 3OMGA 1EOVA 4LAAA 2F0FA 5EPKA 2J7ZA 4MTKA 4CBVA 2GN5A 1I4XA 4P71A 4P72A 1HA6A 2O4XA 3OWEB 4V190 3IRBA 3SDZA 2VQEL 4JC0A 3S1NB 2RCFA 2RBMA 2EZVA 1DYQA 1TIID 1H9KA 5G3LD 4B9WA 4BBSB 1WI5A 1D6EC 1SYCA 4KHVA 1CKNA 1I4HA 3H0GB 3S2DB 2RVLA 4JI8L 1MBYA 4O42A 3BYTB 1BBWA 1EYDA 1XMQQ 3SK4A 1SDFA 2WINB 1PTOD 1CKNB 1KTKA 1BCPF 1DOLA 3M4QA 1SXTA 3GTJH 4JI5L 2HDMA 4BA1I 3QOJA 1W6KA 2TMPA 5C0XG 3K58A 1WTOA 4LWCA 2D0PA 1A3TA 2NN6H 4A3EH 2HQLA 1LTGD 3PUYA 2Z0SA 2QA4A 1N33L 2EY6A 2L55A 4XYQA 3S14H 4NMZA 3RN5A 3PCOB 3F8TA 3AQQA 1LTBD 1BR9A 2DN8A 2K7VA 1TWAB 5IGEA 1ASZA 4A3MG 3BJUA 3R93A 1YNJD 3MXNA 1L0XB 1WCMB 1QUQA 3H91A 1HR0Q 1A2UA 4PZ8A 3VR5A 1O7LA 3EROA 2JJQA 2F0JA 4DV1L 1VQDA 1X32A 3A7LA 2UUBQ 1SMYD 1F9PA 1K0RA 4DK1A 3CQZB 4DV0L 4DR2Q 5IT9E 4GKJL 1OXUA 1IYUA 5D14A 1O80A 3HFZB 3NSWA 1PXUA 2UUAQ 2EVBA 2EY5A 3V2TA 2N78A 2Q8RE 3D6WA 1BCPC 1M90C 1IBKL 4FXKC 3FHWA 1TVXA 1AW7A 2A73B 3MAQA 2AQ2B 2ZJRA 5C44G 1RIPA 1SMXA 3D6CA 2AHOB 3TSSA 4DK0A 1D8LA 4IUTA 3NUCA 4DV2L 1CSPA 3DMUA 2VZAA 4YCUA 3PO3G 2ZJQA 3I4MG 1E2WA 4J1MA 4DR6Q 3HEJA 4BBRG 1HR0W 1QWYA 3HOWG 1X3PA 5A2QL 2F0DA 3S1QH 1NE3A 3H6MA 3QO2A 4GKKL 1GHJA 1I4PA 2FHTA 1I6HB 3T16A 4I7ZC 5DEHA 2ZM6Q 4R4CA 1YJNA 3RLNA 5IP7G 1YITA 2BE5D 4TQUS 5E4XA 2SOBA 1EQRA 4DV6L 1OXVA 2N49A 2IT1A 4G7HC 1S5DD 3FKIB 4IPDA 2JA7G 3A7AB 1SROA 1UUPA 1K28A 1Z6HA 1G6ZA 4QJFA 1MGSA 3I3CA 2WB1B 3DUZA 3FDTA 2MQHA 3PUWA 2A6ED 4KY6A 2VY3A 1VMPA 3G7LA 3KDFA 4A3FG 3CW2C 3JAML 1VQ6A 3TN2A 3FVQA 4X64L 3V96A 3BZCA 1GUOA 2C35B 4DUYQ 1E3PA 2OQKA 3Q22A 5KGUA 2ASBA 3PUZA 2JSOA 2SNSA 3HS0C 1L1OA 2B2TA 3T1HL 3A55A 1X55A 2MGSA 1MI2A 2XTIA 5EJWA 4OONA 1XPOA 4LK1C 3K0XA 2JEAI 2UXDQ 1JE5A 2R61A 4DFAA 4GNXA 5K36H 4IPGA 3QR8A 5BR8L 2A69D 4DR7Q 2R7ZG 3DXJC 3GTJB 4C1NK 3NP8A 4C3HG 3RMHA 3QG1A 1RODA 5G3LF 4CJ1B 4DUZQ 1PH5A 4CKEA 1J5EQ 1JB3A 4A3EB 2KCTA 3T51B 4FDBA 4XQNA 1CZGA 1KNAA 3L9AX 1HNZQ 3GTOH 1ZEQX 1F2ZA 2Y0SB 1BXTA 2OTLA 1PTOF 2NVXH 4A3JH 2DY7A 1P8LA 4RGNA 1CT1D 4DV4L 2JA6G 1JORA 4H0LC 4JYAL 3CRLC 1MSGA 5FKAC 4HTHA 1FYCA 4A3LG 5JJIA 4CKBA 1II3A 3HG9A 4B3RQ 1HZCA 1QVGA 1S40A 2D62A 2PW7A 4FF3A 1PZJD 2B8GA 4UAIA 3OTOL 3OYYA 2JQOA 1V8QA 2JA8G 3G6JB 2MHVA 5ELFA 4CGYB 4PMBA 1VQ4A 1HPCA 2N88A 3ZJYC 3K7UC 2ZXOA 1EYAA 1B9NA 3URYA 2YTVA 4Q5VA 4A3CH 1YNXA 4IN3A 3IAYA 3D4RA 3CCUA 4X3KA 3K80C 4OX9Q 1LTRD 4IPHA 3Q0AA 1TXYA 4X65Q 2XNAC 1STEA 1YJWA 2L9HA 1VF5C 4HCEA 2Z6KA 5EKLA 1EYGA 1XXGA 4ME5A 1YHAA 2F3IA 4CDDC 3I72A 5A2QE 1XTCD 1PH6A 3S16H 1VQEA 1IYVA 1XMQL 1HNWQ 1F77A 1PTOC 4DXFA 2IJ0A 3FPPA 1PFBA 2K52A 4H02A 3CD6A 1O78A 1RL2A 5E1FA 3NENA 1V9PA 3NELA 5C0XI 3S1QB 1VMCA 4RGOS 1EQVA 2AQ1B 1KLUD 2K75A 5C3EH 3E9IA 4K5XA 2QCPX 5I6WA 5IIFA 1VCIA 2K6AA 4IFDJ 4DR4Q 5DM63 1NUCA 3DEPA 4N9PA 4CKCA 1EY7A 4GN3B 2PCFB 1EU4A 5I4DA 3U4ZA 4DV3L 2KEDA 1A63A 4A3BG 4TKOB 1Q12A 4UP9A 2R93G 4ID6A 1XMOL 2HIXA 3KBGA 3JAME 3J81L 3R2TA 1QVFA 3K7AH 4CDFC 1YNJC 3ER0A 4OO1I 3J7ZC 1I3QH 2BH8A 1B2TA 3IFDA 4APVA 5CBEE 4K5VA 2ZTEA 3ULJA 2KECA 3PUXA 1SYEA 3I2ZA 3HOUH 4DR3L 1SMYC 2N8NA 1HUMA 1UNSA 2K32A 1Q46A 3K5OA 1UEBA 2CFMA 1KDBA 2UUAL 3K57A 1TY2A 4LFBQ 2JA5G 1DJRD 1G51A 1LABA 1Q7YC 1E1OA 1FD7D 1GJXA 5FLMG 5C4XH 1CFMA 3TZUA 1I4RA 5C4JH 2E2HH 4IURA 3S15H 1BVSA 1FNVA 1S5ED 3NE5B 4LF7Q 3DHQA 4IUPA 3RZDB 4N8X1 4B3MQ 4K14A 3NBHB 1DD2A 3AU7A 4DR6L 2VQFQ 5CV5A 2HIVA 3M4PA 5GAHC 2RSOA 1O7IA 4EQNA 3A56A 2JE6I 3GTOB 1STBA 2MFIA 4X62L 3L3OC 1C8CA 2NVXB 4A3JB 1AH9A 1A6XA 1KL9A 1VQPA 5I2XA 3HKZB 1VQHA 4HSVA 3GTKB 3M3YH 4FO2A 2VB2X 4J15A 1VQLA 3KOJA 4KK7A 5LMNQ 1K8AC 3A74A 2FINB 1PZID 3CCMA 5FOBB 1E24A 2PMZE 1ML0D 3I73A 5E4WC 4C2MH 3OW2A 3TS0A 3K0YA 5IYBG 2I0QA 3CC2A 2B2VC 3J81j 1SN8A 4RWSC 1RKNA 2A6EC 3TS2A 5EQ0A 1STAA 1SRUA 1SNDA 1KDCA 3NTIA 3U50C 2YV5A 2SDFA 5IY0A 3SVMA 1HH2P 1VF7A 2NUCA 2HQEA 1F2MA 1Q86C 4KD4A 3LX0A 2FJ2A 4DK3C 1G291 1SYBA 2N3SA 3C2PA 3N6RA 1F9QA 2OF1A 4YWMA 4L63B 3T4AC 1I4QA 1CTMA 2Q2UA 2B2YA 4QCLA 2UXDL 3M7GA 5M3MG 1WD0A 5LMNW 2KEEA 4NXML 3S16B 2UUCQ 2A69C 2CHBD 5E3FA 3H3VH 2LKVA 1YNND 1PTOH 4DR7L 4YCVA 4MNOA 2FMMA 1GVPA 3S1MH 4IOCA 1EOTA 3HKSA 4PQXA 1AFPA 2LY7A 4NKLA 3UDIA 3I4NH 2DJFC 5JEAJ 2WKDA 1N32Q 5K5PA 5C3EB 4MIUA 5ELBA 2O5JC 1X56A 2RA4A 3GTGH 1B1ZA 3NPPA 3WDNA 4R8IA 3J81E 4I65A 1SBBB 4LF9Q 1Y8PB 1EQQA 3L2PA 4GOPA 1RTOA 1L1OC 3CCRA 3K7AB 3HOXG 1Y69U 1E2VA 3TDQA 4HIMA 4DV7Q 4RHSA 5C4HA 4A4IA 1XNRQ 3HOUB 1KC8C 2ICEC 1PYWD 3NWSA 5E7NA 2QF7A 3RZOH 2RHQB 1BBXC 1UE1A 1GOZA 1DCZA 2CH4W 5IT9c 4A3DG 1RCVD 2RSNA 2KJXA 4JOIC 5CV9A 1AE2A 1DGSA 5JJLA 4X65L 2B2UA 5C4XB 3KLRA 5C4JB 2E2HB 3S15B 4WJWA 3CAMA 1VQ9A 3HOVG 3JAMi 4NP5A 1NJIC 2EYMA 1SSOA 1HNWL 2DJGC 3BDCA 3C3LA 2WKCA 4CHTB 1V1OA 4GS3A 3AFPA 3FP9A 3LWUA 1MKHA 5IODA 3CP0A 2R7FA 1MD2D 4BWGB 3K81C 2KENA 1BUVT 4XXEA 2GA4B 1LTLA 5GROA 3X3NA 3M3YB 2B3GA 4JI1L 5JVH3 1ZKOA 4JCVE 3NQTA 4DR4L 1SYFA 1E1TA 2WIIB 4C2MB 1CKMA 5ELNA 4A3GG 3KYHC 4RAUC 4IUQA 4C3JH 4MHEA 1EIYB 2UXCQ 2XSCA 2PQAB 5IGBA 4OHJA 2A68D 1Y1VG 2AUKA 1G2SA 1TS2A 1WTQA 1HRJA 2ZXPA 3NHHA 2RF4A 1W3SA 4KY7A 4ABNA 4HJ7A 4UDUC 1PH8A 4JV5Q 4DV5Q 1WJJA 5M5WH 3K5NA 4AYBE 3I8ZA 2AMCB 1D5ZC 2Z4HA 2EJFC 4DNIA 3KF6B 1R9TH 2KA7A 4FXGC 1XTDA 3ICEA 2PZWA 1AZQA 3OOCA 3S1RB 4K0KL 1HTPA 2ENBA 4X3TA 3STBC 2VXWA 1PZKD 1TR5A 1VQBA 1WD1A 5LHY1 3NTHA 2B63H 3N52A 4AYBG 1G91A 2JXMB 2CWAA 2H4OA 2LXKA 2F0UA 3D0FA 3GDEA 1IKLA 3GP7A 1PTOB 2L4NA 4O2DA 4NW2A 1WTXA 4C1NI 4LF7L 1IHZA 3ERQA 3TQYA 3S1MB 1YI2A 1B44D 2EYOA 2D2CC 2K5HA 1S5BD 3CC4A 1LTSD 2VQFL 2AWNA 1K73C 4DR1Q 1TWHH 5EKKA 4BXXG 1R4QB 5HY6A 1KRSA 3UE0A 1VQ7A 2F0OA 4DN4M 2XWJB 1M1KC 1FJGQ 1Q1BA 1JJ2A 3ND8A 4A3IG 2K5DA 2E5LQ 3HOZH 1HTLD 1JE4A 2HHHQ 4HSPA 4A93H 4QGUA 2SEBD 5LMNL 1G6PA 1EWHA 4RKBA 2IX1A 2A6HD 1DONA 1T5EA 3U4VA 3W2DA 2NTSA 1Q8KA 1WTWA 3G71A 3HZXA 2KUMA 4HR7B 3DM3A 1SE2A 5JAVA 2F4IA 3SK5A 3RZOB 1G8ZD 3UDXA 4JI0Q 3T13A 1D7QA 4DPGA 4KKSA 2EYLA 4IJHA 1C0AA 2A1AA 4OO1G 1AN8A 2E74C 1AE3A 2H1EA 2CQAA 3J81i 3MXUA 1J8IA 2NBFA 2I5MX 3E0EA 3VR4A 3EN2A 2VUMH 3Q6SA 2EY1A 3RD4A 1N36Q 4LMQD 1NCVA 1A3UA 1EWIA 2JYOA 2CW0D 3PIOA 1Y1WG 3PO2H 5IYCH 1B53A 3S17H 3PIPA 1JWSD 3ERSX 4B3SQ 2V1CC 1VQKA 1X9NA 2UUCL 4BS9A 3OIQA 4L6TB 1EIGA 1YNNC 3HRZC 4IALA 5IP9G 4RHRA 4IJLA 1WTHA 4CDEC 4A3KB 4PMCA 5EGTA 3HOYH 1O7YA 3CRKC 3RUZA 4GLVB 1JOQA 5JJZA 1U4RA 2VB3X 1N32L 5FK9C 5ISRA 5LL6S 2VW9A 1SNCA 4CJ0B 2PMZB 4QUFA 3BYYB 3UI2A 3F1ZA 2I07B 4JBMA 2F0LA 2R92G 1B3QA 5JVG3 5C3XA 2UU9Q 3OSOA 4LF9L 1Z47A 5EBCA 4C3JB 1J9OA 2B29A 4U68A 5M9OA 1FNWA 3M4OH 1VQIA 2RDFA 3E0JA 2LFNA 2LSSA 4FYDA 3JAMc 1YHBA 4LFCL 1KRTA 1N34Q 1IXRA 4ZLTF 3U58A 4OELB 1XNRL 5M5WB 2XIWA 2B39A 5FO8B 1R9TB 2E76C 1KXLA 3OMCA 3P20A 3FRPB 5D65A 2EYFA 1AZPA 1K83H 4EQOA 1ILPA 2BA0A 5GADC 3MC0B 3X3MA 1ZYRD 2JEBI 2B63B 3GV6A 2E8GA 3L0OA 2L1BA 1ENCA 4BY7G 1IBLQ 5CC4A 2EXDA 4KMUC 4RMFA 2NN6I 1S4ZA 3W3AA 3QOLA 4GOPC 2K5NA 3OPOA 3HP3A 3PMFA 4H7BA 5I9PA 5L37A 5C0XH 1CZWA 2NZ1D 2EPBA 1U4PA 1STHA 1FL0A 1MIUA 3NK9A 1TWHB 4L5RC 5CGKA 2F1MA 4OIJA 1WVLA 1NTGA 1EFWA 3PF4A 5CBAE 2HD3A 2CCZA 1O7ZA 3S24A 3MWYW 4A93B 2Z4IA 4WRDA 4A3MH 3J80L 4IUNA 1HFGA 3EJIA 2A5HA 2EOTA 2XGTA 5M3FG 1PH2A 1EZ8A 2JA9A 5D3IB 2NVQH 4G7ZC 1BBUA 3S14B 4IFDG 1C4QA 2UXCL 1LLRD 3KK7A 2A68C 1VQ5A 2OWOA 2EJGC 2ZXRA 2YYZA 3E9HA 2K05A 2GVBA 1KIXA 3EFXD 3SR1A 1A2TA 2X6LA 1JICA 4RA8A 2OT2A 4LW1A 5I9OA 3BS1A 4JI2L 1V1PA 4FP5D 4JV5L 2NVTH 3D4WA 1I50H 4ALPA 1I4GA 3GV3A 2EXZA 4F88A 1HNXQ 1D2BA 1D5XC 4POGA 1V1PB 4JI6L 1B50A 5IGFA 3FEWX 2PNRC 5C44H 2VUMB 1YVCA 1NMGA 1LTAD 1PFNA 2KHIA 4GLAC 1C7YA 3PO3H 3PO2B 3I4MH 2F0WA 2F0VA 3MTSA 5NUCA 4DF7A 4FF4A 3S17B 4PNYA 2WAQB 4RFBA 4BBRH 1JB7A 2CVRA 4EGVA 1CA5A 2MPMA 3HOWH 1LM0A 4IZ8A 4K5WA 3G4SA 2RKSA 4JW0A 3HOYB 2IWHA 3EBEA 1PRTD 4FNFA 2WP8J 3VYSA 3A5ZB 3B6YA 1ESRA 1KAAA 1DZ1A 4PG3A 2XRQD 1EEID 2I46A 4FF1A 3I55A 4BY1G 4J8QA 2B8FA 5IP7H 4YHHQ 1OXSC 1FJGL 3MFYA 5AJ3Q 1LACA 2E5LL 2JA7H 1RJTA 3F2DA 1XNQQ 3R8BA 2QDLA 5IOCA 2WV6D 3OHXC 3J81c 2HHHL 1HFNA 4ODGA 4ZYSA 4X3SA 4MZ9A 1KAWA 4C3IG 5T1GA 4XQJA 4YIJA 2RHSB 3M4OB 1PV4A 4A3FH 3K6OA 4KLKA 4QIWE 2ALYB 2DNCA 4EX5A 5COYA 3GO5A 4LF4Q 4Y52H 4H44C 1GO3E 3ULLA 1PH7A 1MSHA 1PH9A 1JC7A 1NR2A 3TREA 4DU9A 3J7AF 2M9VA 3M85A 1OO9B 1K83B 1XPRA 3BU2A 2K5WA 2Z6BA 1PMRA 1HR0L 1EEFD 1B8AA 1EY6A 4FF2A 1EUJA 5F2DA 1VQOA 4UP7A 3OWFA 2R7ZH 1NNXA 3BDLA 4DA2A 1K8GA 2UUBL 1N36L 1AEXA 2CW0C 4C3HH 3CMEA 4DR2L 3SE0A 4BBSG 2B2WA 2MP1A 1X65A 1N9WA 3H0GG 2IHFA 3C46A 1VQFA 2AKWB 4PMWA 4UHVA 3D4DA 1J6QA 1SJED 2L11A 1YJ9A 2V4DA 2BH2A 5H1SE 2JA6H 3NBHA 3J80E 1H9MA 3S9WA 1ASYA 2F3VA 4O0AA 2FXQA 2XVSA 3LGJA 4JI4Q 1C48A 3NXWA 5ELEA 1H9SB 4OEMB 1N8RC 1GUTA 3RR5A 4A3LH 3O13A 4UPAA 4E6IA 4M8AA 1R4PB 1ICFB 4A3MB 5HURA 2F03A 1TQOA 1SYGA 2BDNA 5JEAG 2KVMA 4KKTA 1BDOA 5T1IA 2UU9L 2ZTDA 5FJ8G 3VR2A 2QEJC 4N9TA 2JA8H 3K59A 1WTRA 2Z9HA 4ZRZA 2RCNA 2ZM6L 3C1EA 1EY4A 3J7YW 1LTID 3E3XA 2CQOA 3CC7A 1N34L 2BE5C 4JI7Q 1WCMG 2ZT9C 4JI8Q 4KN4C 3LWEA 3VA7A 1VQJA 1DOKA 4KHZA 4JPBW 2VNUD 2HCIA 2ZJPA 1SNMA 1HZ9A 1YZ6A 1T9HA 2L15A 1HA5A 1HZAA 4KJNA 5C44B 2F0EA 1KDAA 1Z9FA 2OXPA 3PO3B 2Q2TA 3I4MB 1F9RA 3EA6A 4G4KA 3MEHA 3EIVA 5KEEA 4BBRB 4A3KG 2EY2A 1ET6A 4IO9A 1IBLL 2PO4A 4QUCA 4DUYL 5J1ZA 3HOWB 1BCPB 1QZHA 3QJYA 3W1BA 1CSQA 4KV6A 1JT8A 4WJ4A 1VQ8A 3TRZA 4IQZA 1B7YB 3VYRA 3R2IA 1UE6A 3NTKA 2MO1A 1TS3A 1S3OA 4HJ8A 4GLXA 1RF2D 3T53B 1A62A 1RD9D 3Q23A 3TZDA 4FXDA 1JWMD 1LV9A 3KLWA 2ATWA 1HZBA 3UE1A 2LS01 1EU3A 1H9RA 2F0QA 3DWQA 1WFQA 1PFMA 5D3DA 4A3BH 2AWOA 5IGDA 2JA7B 1PRTF 3K5MA 2R93H 1Y8NB 4UY8C 2DY8A 4DUZL 1SE8A 4RCNA 3W5OA 4HN7A 4DAYA 1XJVA 1J5EL 1A15A 2XWBB 3I7FA 1B9MA 1XX8A 1HNZL 2G9HD 4A3FB 4DAYB 3RNUA 4IFDI 1IBKQ 2QILA 3BVMA 3FKIG 1SR3A 3PQIA 1E7ZA 2TSSA 1Q82C 4LUVA 3S1NH 1EY5A 4L5QA 2EYHA 1FR3A 2O2LD 2H5XA 1EFID 2B2TC 2WB1G 3SHLA 2L12A 2M2LA 1NY4A 1NBWA 4B3RL 1LT5D 4KTAA 4AQYQ 4OGQC 3U9OA 2EYJA 5KNBA 2JA5H 1I3QB 4GNXC 5FLMH 4QF4A 4DNTB 1G2TA 5J39A 1HJPA 2R7ZB 1FVIA 1Q1EA 4N8FA 4C3HB 1C9OA 3IFTA 4ZUIA 1QOHA 2YTXA 4HIDA 3KUPA 1TWGH 2HUGA 3SXHA 4KI0A 2NTTA 1K8OA 3DLLA 4OX9L 2KHJA 2MNAA 1SE4A 1JOKA 2MUYA 2Y0SE 3E6ZX 5EPJA 1PRTC 4PZ7A 4RGTA 1V43A 5HGTA 1QB5D 2K14A 2JA6B 3OW7A 1EY8A 1HQRD 3P7JA 1WTPA 1STYA 4IPCA 1S5FD 2OQ0A 4A3EG 2NN6G 1QNKA 5IWAQ 5FLXL 1GM5A 3KJOA 4YHHL 1GD7A 3QWNA 2Y0SG 4ZQ3A 4AIMA 5KRUA 2K5QA 4LJZC 1CM9A 5IYBH 1X3QA 4XIGS 4X64Q 3PUVA 4P75A 2JA8B 1BF4A 5EAYA 2I5LX 2LMCB 3MXGA 4R1JA 4G57A 1LT6D 1RTNA 4X3UA 4OL7A 1QCBD 4QB4A 5DM73 5BR8Q 4BA2I 1ICWA 4YCWA 4LF4L 2PQAA 3BVZA 3I4OA 2MJ8A 3J80i 1JWUD 4POFA 4IUUA 5GAGC 3A5UA 3CKIB 2Z6KC 4JI3Q 5JPNC 4GN4B 3H3VI 3QB3A 5M3MH 3I4LA 1Q81C 4TVAB 4JBKA 4K2LA 3KF6A 3KLSX 1STNA 3BDOA 3A8KE 4YWKA 1SLJA 4JVZA 4DV4Q 4L5TA 3RLOA 1QZGA 3TP6A 1JJCB 2D5DA 4R4IA 1VDZA 2ZTCA 1IKMA 4LFBL 2RDGA 5C4ZA 3PIO3 3JC66 4S3SA 5DAUA 3VYUA
chains in the Genus database with same CATH topology
2K75A 2WB1E 3OTOQ 5C3EH 3E9IA 1KXLA 1VCIA 4IFDJ 1K83H 4JI4L 4DR4Q 3S2HH 4B3ML 1X6OA 2BA0A 3CPWA 3AEVA 5GADC 2JEBI 3I56A 3L0OA 2E8GA 4GN3B 5GAEC 4DV3L 4LF8Q 3U4ZA 4BBSH 1A63A 4A3BG 4DV2Q 3HOXH 1Q12A 4UP9A 3CCSA 1IBLQ 4BY7G 2R93G 3H0GH 1PYBA 1XMOL 2HIXA 2EXDA 3S2DH 1QVCA 3NEMA 4JBWA 2B63G 1QVFA 4RMFA 1HNXL 2NN6I 3K7AH 3PSIA 3ER0A 1X54A 3CCVA 4GOPC 1KQSA 4OO1I 2K5NA 3J7ZC 1I3QH 2BH8A 4APVA 3UDGA 1VQGA 1WOCA 2ZTEA 3ULJA 1PYSB 1YEZA 4GKKQ 1FL0A 2F4VQ 3PUXA 3I2ZA 1MIUA 4LUZA 4DR3L 4JI7L 1UE7A 2N8NA 4L5RC 3HOUH 2OCEA 5FLXc 1NTGA 1Q46A 1EFWA 4GOPB 3PF4A 4PZ6A 4A3DH 1UEBA 2QEXA 4LUOA 3A0JA 2CFMA 2EIFA 2NVYH 4OWXB 2UUAL 2CCZA 4LFCQ 1LUZA 1I94L 2D0OA 3S24A 1UWVA 5GQOA 2JA5G 4LFBQ 1G51A 2PI2A 5FJ8H 4DV6Q 4HIOA 1Q7YC 1E1OA 4A3MH 1IBMQ 2CKZB 5FLMG 5HGQA 5C4XH 4NXNQ 3HOVH 5M5YH 3HOZG 5C4JH 2E2HH 3S15H 2K50A 3ULPA 2XGTA 1BVSA 2E2IH 2Q2HA 5M3FG 4LF7Q 1TWAH 4B3RL 1PH2A 4QQBX 2E2JH 4A93G 2JA9A 5DLQE 3MEFA 5K36G 2NVQH 1VQMA 1VQCA 1BBUA 1Y14B 4B3MQ 4IFDG 2UXCL 1WCMH 3NBHB 1VQ5A 2OWOA 4DR6L 2VQFQ 3PF5A 2YYZA 3E9HA 2GVBA 1KIXA 1A0IA 2HIVA 5AJ3L 4DV3Q 2NZHA 3M4PA 5GAHC 4JI2L 4LW1A 1O7IA 3GTLH 4LFAQ 1XNQL 2JE6I 1XMOQ 1CKOA 2MFIA 3D31A 4X62L 2NVTH 1I50H 3HKZE 4ALPA 4JV5L 3CQZH 1HNXQ 1MJEA 1AH9A 1KL9A 3T1HQ 4LF6L 4POGA 1VQPA 4JI6L 1VQHA 2DUDA 3M3YH 5C44H 3KJPA 4J15A 1VQLA 1YVCA 4A3JG 4A3GH 2B63H 1NMGA 3G48A 3KOJA 3MXNB 1QUQB 4A3KH 2WAQE 5LMNQ 4DR3Q 1K8AC 2I5HA 2UXDQ 3A74A 2KHIA 1XPUA 3HKZG 4GLAC 3CF5A 1C7YA 3PO3H 3CCMA 3OW2A 1E24A 2PMZE 4P74A 3G6EA 5LMUL 4C2MH 1PA6A 3TS0A 1K3RA 2VUMG 1Y1VH 4OWTB 4P73A 3W1GA 5M5XH 5IYBG 5JJKA 4BBRH 2I0QA 1JB7A 3CC2A 3PV0A 3UDFA 2NZOA 3HOWH 3PO2G 1KHIA 5IYCG 1LM0A 3G4SA 3VDYA 3J81j 1SN8A 2WAQG 4HJ9A 3EBEA 4R4QA 4YY3Q 3TS2A 4IOAA 1SRUA 2WP8J 3A5ZB 3B6YA 3U50C 1W2BA 2YV5A 4PG3A 2PNHA 5IY0A 3GTPH 4R4TA 2YTYA 1HH2P 3HOYG 2A19A 3CMAA 3I55A 1Q86C 2VS1A 4BY1G 1CUKA 4DK3C 5IP7H 3AYHB 4AQYL 4JYAQ 4YHHQ 1OXSC 3K8AA 1I6HH 5IYDH 1FJGL 1G291 1X3GA 3TEHB 3T1YL 2N3SA 5AJ3Q 3GTMH 4DV7L 2CWPA 3CCEA 4JI2Q 4A3CG 2R6GA 2E5LL 2JA7H 3I4NG 1U0LA 4NPSA 4YWMA 3F2DA 1XNQQ 2Q2UA 1MJCA 5C0XJ 4X62Q 3J81c 3RN2A 2UXDL 4JG2A 2HHHL 3M7NA 5M3MG 5LMNW 3FKIH 4NXML 2UUCQ 2GVAA 4MZ9A 1KAWA 4JI6Q 2UXBQ 4KHPL 3H3VH 2RHSB 2IHEA 4DR7L 4YCVA 1PV4A 4MNOA 4A3FH 4KLKA 1B70B 1GVPA 4QIWE 1EOVA 4B3TQ 4IOCA 3H15A 3HKSA 2ALYB 4EX5A 3S1MH 3UDIA 4JBJA 3RLFA 4BXXH 3GO5A 1YHQA 3I4NH 5JEAJ 4LF4Q 4Y52H 1GO3E 2GN5A 3ULLA 1P16A 1PH7A 1N32Q 4P71A 4P72A 4EQ5A 1PH9A 3TREA 4A3IH 3M85A 1X56A 3GTGH 3IRBA 1FGUA 1XPRA 3BU2A 2VQEL 4JC0A 3J80c 1HR0L 5C3EG 4Y7NH 4X66Q 1B8AA 3CPFA 5IWAL 1TWFH 2MO0A 4LF9Q 1EUJA 1PHJA 1VQOA 4UP7A 1WI5A 1EQQA 3L2PA 4GOPA 2R7ZH 1PFSA 3GD7A 1CKNA 2UUBL 1K8GA 1L1OC 1N36L 3CCRA 4JI8L 4C3HH 2R7DA 3KDFB 1BBWA 3CMEA 1XMQQ 4DR2L 4BBSG 1CKNB 3HOXG 1X65A 3M4QA 1N9WA 4HIMA 3H0GG 3GTJH 4DV7Q 1OTCA 4JI5L 4BA1I 2IHFA 4A4IA 1VQFA 2AKWB 4PMWA 1XNRQ 4DR5Q 4LF5Q 1J6QA 1L1OB 2ES2A 1KC8C 1WYDA 5C0XG 1YJ9A 4L5SA 2BH2A 4NXMQ 4LWCA 2D0PA 5H1SE 4A3EH 5E7NA 1BKBA 2HQLA 2JA6H 3RZOH 2RHQB 1ASYA 4O0AA 3PUYA 2FXQA 2Z0SA 4GNXB 1UE1A 3LGJA 1S72A 4JI4Q 3HOUG 2QA4A 3CXCA 1KD1C 1N8RC 5IT9c 3RR5A 3RZDH 1N33L 4A3LH 1JJGA 4UPAA 1I5FA 3S14H 4R4OA 4A3DG 4JOIC 3PCOB 3RN5A 1AE2A 1DGSA 4JI3L 1Y1WH 5JJLA 3F8TA 4X65L 4A76A 3AQQA 5JEAG 2UU9L 4GN5A 2ZTDA 5FJ8G 3CAMA 4DV5L 4JOIA 5IP9H 4A3MG 1ASZA 2JA8H 1VQ9A 3CCLA 3BJUA 1U5KA 5C4XG 2KCMA 2RCNA 4OXPA 3HOVG 3JAMi 1HR0Q 1VQAA 1QUQA 1NJIC 4PZ8A 2ZM6L 2K5VA 1HNWL 3GTKH 2CQOA 2JJQA 3WWVA 3CC7A 4DV1L 1VQDA 1N34L 4JI7Q 1UE5A 4GS3A 1WCMG 2UUBQ 3AFPA 3FP9A 5ELOA 1K0RA 1VQNA 1MKHA 4JI8Q 4DV0L 1VQJA 4DR2Q 4GKJL 1OXUA 4KHZA 4A75A 2VNUD 3CP0A 2ZJPA 3HFZB 3M9BA 2R92H 1HZ9A 2R7FA 2UUAQ 1YZ6A 3K81C 1T9HA 2KENA 2L15A 1I94Q 1LTLA 5GROA 1HZAA 4HIKA 2B3GA 4QY7A 2N78A 4JI1L 1M90C 1IBKL 3FHWA 1Z9FA 2VL6A 4JCVE 4DR4L 5IE8A 4HJ5A 1E1TA 2ZJRA 2Q2TA 5C44G 1RIPA 1SMXA 1CKMA 2AHOB 5ELNA 4A3GG 3KYHC 4LF8L 1D8LA 3EIVA 3KF8B 3PGZA 4DR1L 4DV2L 1CSPA 4C3JH 4A3KG 2VZAA 1EIYB 4IO9A 2ID0A 4YCUA 1IBLL 4DUYL 3PO3G 2UXCQ 2ZJQA 2JK8A 1QZHA 2K4KA 3I4MG 3W1BA 2PQAB 2YU9H 4DR6Q 1Y1VG 1CSQA 1JT8A 4WJ4A 1VQ8A 4BBRG 3GTQH 1HR0W 3TRZA 3F2BA 1B7YB 1UE6A 3HOWG 2MO1A 2RF4A 1W3SA 4HJ7A 1PH8A 4JV5Q 3S1QH 1S3OA 4DV5Q 1NE3A 4HJ8A 4AH6A 4GLXA 1A62A 4GKKL 1WJJA 5M5WH 1JMCA 2F4VL 4AYBE 5J3BA 2AMCB 4LF6Q 1PH3A 4DNIA 3KF6B 1R9TH 3KLWA 2ATWA 2DGYA 1HZBA 3UE1A 1XTDA 2ZM6Q 3ICEA 1X3FA 4R4CA 1YJNA 4K0KL 1WFQA 3RLNA 3STBC 2AWOA 4A3BH 5IP7G 1YITA 4BY7H 2R93H 4TQUS 4DKAC 1VQBA 3Q8DA 4UY8C 5LMUQ 1EQRA 4DV6L 4DUZL 1PVOA 1OXVA 1SE8A 2IT1A 2N49A 3W5OA 4AYBG 1OXXK 4UP8A 1IBML 4IPDA 3SGIA 1XJVA 1J5EL 2CWAA 1H95A 2LXKA 2JA7G 3D0FA 1SROA 3GDEA 3I7FA 1HNZL 4O2DA 4JI0L 4DAYB 3RNUA 4LF7L 4IFDI 4JI1Q 1IBKQ 1IZ6A 3FKIG 4QJFA 1SR3A 1IYJB 3TQYA 3CCJA 1E7ZA 2MQHA 3PUWA 4XTCS 4LUVA 2VY3A 1YI2A 1Q82C 2K5HA 3S1NH 1X3EA 3KDFA 4L5QA 4A3FG 3CC4A 2VQFL 3CW2C 2AWNA 2H5XA 1VQ6A 1K73C 3I4MH 4DR1Q 2WB1G 1TWHH 4X64L 1NY4A 3BZCA 4LFAL 1NBWA 5HY6A 2C35B 1KRSA 1E3PA 3UE0A 2OQKA 4DUYQ 4AQYQ 1VQ7A 2JA5H 1SFOH 1M1KC 1E22A 3PUZA 1FJGQ 3T1YQ 1Q1BA 2ASBA 1PH4A 4B3SL 4GNXC 1L1OA 3T1HL 1JJ2A 4A3IG 5FLMH 4X6AH 1X55A 1TWCH 2E5LQ 1XPOA 2XTIA 3HOZH 4OONA 4MTNA 1A8VA 1HJPA 2LXJA 3K0XA 2HHHQ 2JEAI 1JE5A 4DAMA 5M3FH 3KFUA 1FVIA 1Q1EA 4A93H 4GNXA 1YIJA 4QGUA 5LMNL 4IPGA 5BR8L 4WJ3M 1G6PA 1C9OA 1K9MC 2IX1A 2BA1A 4KHPQ 2Q2IA 4NXNL 1VS0A 4DR7Q 2R7ZG 3U4VA 2KBNA 2YTXA 4HIDA 4K0KQ 1TWGH 4KI0A 1GKHA 1Q8KA 3STBD 3DLLA 3G71A 4OX9L 2KHJA 4DK6C 2PI2E 2MNAA 1YBYA 4DUZQ 4HJAA 1PH5A 2Y0SE 3DM3A 1L2FA 4PZ7A 1J5EQ 1V43A 4YY3L 2KCTA 2K14A 3CCQA 4FDBA 1HNZQ 3GTOH 3UDXA 2IX0A 2OTLA 4JI0Q 2VQEQ 2NVXH 4A3JH 4IPCA 4QL5A 1P8LA 2OQ0A 1D7QA 4DPGA 4RG1A 4A3EG 2NN6G 4DV4L 5IWAQ 1GM5A 4IJHA 2JA6G 1C0AA 2A1AA 4OO1G 3KJOA 4JYAL 4YHHL 1AE3A 1GD7A 2Y0SG 4AIMA 3J81i 2I5MX 2QGQA 3E0EA 2VUMH 3EN2A 4OWWB 3J7A5 5IYBH 1N36Q 4NB3A 4A3LG 5JJIA 1EWIA 4XIGS 4X64Q 3PUVA 4P75A 3PIOA 1HZCA 3F2CA 4ME3A 1S40A 1QVGA 1Y1WG 4B3RQ 3PO2H 2OTJA 5IYCH 5EAYA 2D62A 2IY5B 2I5LX 2WFWA 1N34Q 3S17H 3AFQA 3L7ZC 3PIPA 3ERSX 3OTOL 1V1QA 2V1CC 4R1JA 1X9NA 1VQKA 3OYYA 2UUCL 2JQOA 4B3SQ 4JI5Q 2UXBL 2JA8G 5IP9G 4LF5L 4IJLA 4LNQA 3HOYH 1VQ4A 1L0WA 4B3TL 4YWLA 3ZJYC 5BR8Q 4BY1H 4BA2I 3K7UC 4GLVB 4YCWA 4LF4L 2PQAA 1OXTA 1N32L 3I4OA 2F52A 3J80i 2HT1A 1IL2A 2YTVA 2VW9A 1N33Q 4POFA 4A3CH 1YNXA 5GAGC 3CCUA 3A5UA 3K80C 4OX9Q 2Z6KC 4JI3Q 3F1ZA 4IPHA 3BZKA 1TXYA 4GN4B 4X65Q 4JBMA 2R92G 3H3VI 5M3MH 1Q81C 4X66L 4TVAB 1YJWA 4JBKA 3KF6A 2UU9Q 4C3IH 4LF9L 2Z6KA 1EYGA 1Z47A 2B29A 1YHAA 2F3IA 4YWKA 1SLJA 1PH6A 3S16H 4DV4Q 1VQEA 4L5TA 1XMQL 1NMFA 1HNWQ 1EIFA 3M4OH 3RLOA 2EQSA 1VQIA 2LSSA 1QZGA 3JAMc 1YHBA 1JJCB 4H02A 2K52A 4R4IA 4LFCL 1KRTA 4DV1Q 2ZTCA 3S1RH 1RL2A 1PH1A 1IXRA 3CD6A 4LFBL 1LYLA 1V9PA 3NELA 3NENA 5IYDG 5C0XI 3U58A 2A8VA 4DV0Q 1XNRL 4BXXG 4DR5L 4GKJQ 3JC66
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K75 A;  2WB1 E;  3OTO Q;  5C3E H;  3E9I A;  1KXL A;  1VCI A;  4IFD J;  1K83 H;  4JI4 L;  4DR4 Q;  3S2H H;  4B3M L;  1X6O A;  2BA0 A;  3CPW A;  3AEV A;  5GAD C;  2JEB I;  3I56 A;  3L0O A;  2E8G A;  4GN3 B;  5GAE C;  4DV3 L;  4LF8 Q;  3U4Z A;  4BBS H;  1A63 A;  4A3B G;  4DV2 Q;  3HOX H;  1Q12 A;  4UP9 A;  3CCS A;  1IBL Q;  4BY7 G;  2R93 G;  3H0G H;  1PYB A;  1XMO L;  2HIX A;  2EXD A;  3S2D H;  1QVC A;  3NEM A;  4JBW A;  2B63 G;  1QVF A;  4RMF A;  1HNX L;  2NN6 I;  3K7A H;  3PSI A;  3ER0 A;  1X54 A;  3CCV A;  4GOP C;  1KQS A;  4OO1 I;  2K5N A;  3J7Z C;  1I3Q H;  2BH8 A;  4APV A;  3UDG A;  1VQG A;  1WOC A;  2ZTE A;  3ULJ A;  1PYS B;  1YEZ A;  4GKK Q;  1FL0 A;  2F4V Q;  3PUX A;  3I2Z A;  1MIU A;  4LUZ A;  4DR3 L;  4JI7 L;  1UE7 A;  2N8N A;  4L5R C;  3HOU H;  2OCE A;  5FLX c;  1NTG A;  1Q46 A;  1EFW A;  4GOP B;  3PF4 A;  4PZ6 A;  4A3D H;  1UEB A;  2QEX A;  4LUO A;  3A0J A;  2CFM A;  2EIF A;  2NVY H;  4OWX B;  2UUA L;  2CCZ A;  4LFC Q;  1LUZ A;  1I94 L;  2D0O A;  3S24 A;  1UWV A;  5GQO A;  2JA5 G;  4LFB Q;  1G51 A;  2PI2 A;  5FJ8 H;  4DV6 Q;  4HIO A;  1Q7Y C;  1E1O A;  4A3M H;  1IBM Q;  2CKZ B;  5FLM G;  5HGQ A;  5C4X H;  4NXN Q;  3HOV H;  5M5Y H;  3HOZ G;  5C4J H;  2E2H H;  3S15 H;  2K50 A;  3ULP A;  2XGT A;  1BVS A;  2E2I H;  2Q2H A;  5M3F G;  4LF7 Q;  1TWA H;  4B3R L;  1PH2 A;  4QQB X;  2E2J H;  4A93 G;  2JA9 A;  5DLQ E;  3MEF A;  5K36 G;  2NVQ H;  1VQM A;  1VQC A;  1BBU A;  1Y14 B;  4B3M Q;  4IFD G;  2UXC L;  1WCM H;  3NBH B;  1VQ5 A;  2OWO A;  4DR6 L;  2VQF Q;  3PF5 A;  2YYZ A;  3E9H A;  2GVB A;  1KIX A;  1A0I A;  2HIV A;  5AJ3 L;  4DV3 Q;  2NZH A;  3M4P A;  5GAH C;  4JI2 L;  4LW1 A;  1O7I A;  3GTL H;  4LFA Q;  1XNQ L;  2JE6 I;  1XMO Q;  1CKO A;  2MFI A;  3D31 A;  4X62 L;  2NVT H;  1I50 H;  3HKZ E;  4ALP A;  4JV5 L;  3CQZ H;  1HNX Q;  1MJE A;  1AH9 A;  1KL9 A;  3T1H Q;  4LF6 L;  4POG A;  1VQP A;  4JI6 L;  1VQH A;  2DUD A;  3M3Y H;  5C44 H;  3KJP A;  4J15 A;  1VQL A;  1YVC A;  4A3J G;  4A3G H;  2B63 H;  1NMG A;  3G48 A;  3KOJ A;  3MXN B;  1QUQ B;  4A3K H;  2WAQ E;  5LMN Q;  4DR3 Q;  1K8A C;  2I5H A;  2UXD Q;  3A74 A;  2KHI A;  1XPU A;  3HKZ G;  4GLA C;  3CF5 A;  1C7Y A;  3PO3 H;  3CCM A;  3OW2 A;  1E24 A;  2PMZ E;  4P74 A;  3G6E A;  5LMU L;  4C2M H;  1PA6 A;  3TS0 A;  1K3R A;  2VUM G;  1Y1V H;  4OWT B;  4P73 A;  3W1G A;  5M5X H;  5IYB G;  5JJK A;  4BBR H;  2I0Q A;  1JB7 A;  3CC2 A;  3PV0 A;  3UDF A;  2NZO A;  3HOW H;  3PO2 G;  1KHI A;  5IYC G;  1LM0 A;  3G4S A;  3VDY A;  3J81 j;  1SN8 A;  2WAQ G;  4HJ9 A;  3EBE A;  4R4Q A;  4YY3 Q;  3TS2 A;  4IOA A;  1SRU A;  2WP8 J;  3A5Z B;  3B6Y A;  3U50 C;  1W2B A;  2YV5 A;  4PG3 A;  2PNH A;  5IY0 A;  3GTP H;  4R4T A;  2YTY A;  1HH2 P;  3HOY G;  2A19 A;  3CMA A;  3I55 A;  1Q86 C;  2VS1 A;  4BY1 G;  1CUK A;  4DK3 C;  5IP7 H;  3AYH B;  4AQY L;  4JYA Q;  4YHH Q;  1OXS C;  3K8A A;  1I6H H;  5IYD H;  1FJG L;  1G29 1;  1X3G A;  3TEH B;  3T1Y L;  2N3S A;  5AJ3 Q;  3GTM H;  4DV7 L;  2CWP A;  3CCE A;  4JI2 Q;  4A3C G;  2R6G A;  2E5L L;  2JA7 H;  3I4N G;  1U0L A;  4NPS A;  4YWM A;  3F2D A;  1XNQ Q;  2Q2U A;  1MJC A;  5C0X J;  4X62 Q;  3J81 c;  3RN2 A;  2UXD L;  4JG2 A;  2HHH L;  3M7N A;  5M3M G;  5LMN W;  3FKI H;  4NXM L;  2UUC Q;  2GVA A;  4MZ9 A;  1KAW A;  4JI6 Q;  2UXB Q;  4KHP L;  3H3V H;  2RHS B;  2IHE A;  4DR7 L;  4YCV A;  1PV4 A;  4MNO A;  4A3F H;  4KLK A;  1B70 B;  1GVP A;  4QIW E;  1EOV A;  4B3T Q;  4IOC A;  3H15 A;  3HKS A;  2ALY B;  4EX5 A;  3S1M H;  3UDI A;  4JBJ A;  3RLF A;  4BXX H;  3GO5 A;  1YHQ A;  3I4N H;  5JEA J;  4LF4 Q;  4Y52 H;  1GO3 E;  2GN5 A;  3ULL A;  1P16 A;  1PH7 A;  1N32 Q;  4P71 A;  4P72 A;  4EQ5 A;  1PH9 A;  3TRE A;  4A3I H;  3M85 A;  1X56 A;  3GTG H;  3IRB A;  1FGU A;  1XPR A;  3BU2 A;  2VQE L;  4JC0 A;  3J80 c;  1HR0 L;  5C3E G;  4Y7N H;  4X66 Q;  1B8A A;  3CPF A;  5IWA L;  1TWF H;  2MO0 A;  4LF9 Q;  1EUJ A;  1PHJ A;  1VQO A;  4UP7 A;  1WI5 A;  1EQQ A;  3L2P A;  4GOP A;  2R7Z H;  1PFS A;  3GD7 A;  1CKN A;  2UUB L;  1K8G A;  1L1O C;  1N36 L;  3CCR A;  4JI8 L;  4C3H H;  2R7D A;  3KDF B;  1BBW A;  3CME A;  1XMQ Q;  4DR2 L;  4BBS G;  1CKN B;  3HOX G;  1X65 A;  3M4Q A;  1N9W A;  4HIM A;  3H0G G;  3GTJ H;  4DV7 Q;  1OTC A;  4JI5 L;  4BA1 I;  2IHF A;  4A4I A;  1VQF A;  2AKW B;  4PMW A;  1XNR Q;  4DR5 Q;  4LF5 Q;  1J6Q A;  1L1O B;  2ES2 A;  1KC8 C;  1WYD A;  5C0X G;  1YJ9 A;  4L5S A;  2BH2 A;  4NXM Q;  4LWC A;  2D0P A;  5H1S E;  4A3E H;  5E7N A;  1BKB A;  2HQL A;  2JA6 H;  3RZO H;  2RHQ B;  1ASY A;  4O0A A;  3PUY A;  2FXQ A;  2Z0S A;  4GNX B;  1UE1 A;  3LGJ A;  1S72 A;  4JI4 Q;  3HOU G;  2QA4 A;  3CXC A;  1KD1 C;  1N8R C;  5IT9 c;  3RR5 A;  3RZD H;  1N33 L;  4A3L H;  1JJG A;  4UPA A;  1I5F A;  3S14 H;  4R4O A;  4A3D G;  4JOI C;  3PCO B;  3RN5 A;  1AE2 A;  1DGS A;  4JI3 L;  1Y1W H;  5JJL A;  3F8T A;  4X65 L;  4A76 A;  3AQQ A;  5JEA G;  2UU9 L;  4GN5 A;  2ZTD A;  5FJ8 G;  3CAM A;  4DV5 L;  4JOI A;  5IP9 H;  4A3M G;  1ASZ A;  2JA8 H;  1VQ9 A;  3CCL A;  3BJU A;  1U5K A;  5C4X G;  2KCM A;  2RCN A;  4OXP A;  3HOV G;  3JAM i;  1HR0 Q;  1VQA A;  1QUQ A;  1NJI C;  4PZ8 A;  2ZM6 L;  2K5V A;  1HNW L;  3GTK H;  2CQO A;  2JJQ A;  3WWV A;  3CC7 A;  4DV1 L;  1VQD A;  1N34 L;  4JI7 Q;  1UE5 A;  4GS3 A;  1WCM G;  2UUB Q;  3AFP A;  3FP9 A;  5ELO A;  1K0R A;  1VQN A;  1MKH A;  4JI8 Q;  4DV0 L;  1VQJ A;  4DR2 Q;  4GKJ L;  1OXU A;  4KHZ A;  4A75 A;  2VNU D;  3CP0 A;  2ZJP A;  3HFZ B;  3M9B A;  2R92 H;  1HZ9 A;  2R7F A;  2UUA Q;  1YZ6 A;  3K81 C;  1T9H A;  2KEN A;  2L15 A;  1I94 Q;  1LTL A;  5GRO A;  1HZA A;  4HIK A;  2B3G A;  4QY7 A;  2N78 A;  4JI1 L;  1M90 C;  1IBK L;  3FHW A;  1Z9F A;  2VL6 A;  4JCV E;  4DR4 L;  5IE8 A;  4HJ5 A;  1E1T A;  2ZJR A;  2Q2T A;  5C44 G;  1RIP A;  1SMX A;  1CKM A;  2AHO B;  5ELN A;  4A3G G;  3KYH C;  4LF8 L;  1D8L A;  3EIV A;  3KF8 B;  3PGZ A;  4DR1 L;  4DV2 L;  1CSP A;  4C3J H;  4A3K G;  2VZA A;  1EIY B;  4IO9 A;  2ID0 A;  4YCU A;  1IBL L;  4DUY L;  3PO3 G;  2UXC Q;  2ZJQ A;  2JK8 A;  1QZH A;  2K4K A;  3I4M G;  3W1B A;  2PQA B;  2YU9 H;  4DR6 Q;  1Y1V G;  1CSQ A;  1JT8 A;  4WJ4 A;  1VQ8 A;  4BBR G;  3GTQ H;  1HR0 W;  3TRZ A;  3F2B A;  1B7Y B;  1UE6 A;  3HOW G;  2MO1 A;  2RF4 A;  1W3S A;  4HJ7 A;  1PH8 A;  4JV5 Q;  3S1Q H;  1S3O A;  4DV5 Q;  1NE3 A;  4HJ8 A;  4AH6 A;  4GLX A;  1A62 A;  4GKK L;  1WJJ A;  5M5W H;  1JMC A;  2F4V L;  4AYB E;  5J3B A;  2AMC B;  4LF6 Q;  1PH3 A;  4DNI A;  3KF6 B;  1R9T H;  3KLW A;  2ATW A;  2DGY A;  1HZB A;  3UE1 A;  1XTD A;  2ZM6 Q;  3ICE A;  1X3F A;  4R4C A;  1YJN A;  4K0K L;  1WFQ A;  3RLN A;  3STB C;  2AWO A;  4A3B H;  5IP7 G;  1YIT A;  4BY7 H;  2R93 H;  4TQU S;  4DKA C;  1VQB A;  3Q8D A;  4UY8 C;  5LMU Q;  1EQR A;  4DV6 L;  4DUZ L;  1PVO A;  1OXV A;  1SE8 A;  2IT1 A;  2N49 A;  3W5O A;  4AYB G;  1OXX K;  4UP8 A;  1IBM L;  4IPD A;  3SGI A;  1XJV A;  1J5E L;  2CWA A;  1H95 A;  2LXK A;  2JA7 G;  3D0F A;  1SRO A;  3GDE A;  3I7F A;  1HNZ L;  4O2D A;  4JI0 L;  4DAY B;  3RNU A;  4LF7 L;  4IFD I;  4JI1 Q;  1IBK Q;  1IZ6 A;  3FKI G;  4QJF A;  1SR3 A;  1IYJ B;  3TQY A;  3CCJ A;  1E7Z A;  2MQH A;  3PUW A;  4XTC S;  4LUV A;  2VY3 A;  1YI2 A;  1Q82 C;  2K5H A;  3S1N H;  1X3E A;  3KDF A;  4L5Q A;  4A3F G;  3CC4 A;  2VQF L;  3CW2 C;  2AWN A;  2H5X A;  1VQ6 A;  1K73 C;  3I4M H;  4DR1 Q;  2WB1 G;  1TWH H;  4X64 L;  1NY4 A;  3BZC A;  4LFA L;  1NBW A;  5HY6 A;  2C35 B;  1KRS A;  1E3P A;  3UE0 A;  2OQK A;  4DUY Q;  4AQY Q;  1VQ7 A;  2JA5 H;  1SFO H;  1M1K C;  1E22 A;  3PUZ A;  1FJG Q;  3T1Y Q;  1Q1B A;  2ASB A;  1PH4 A;  4B3S L;  4GNX C;  1L1O A;  3T1H L;  1JJ2 A;  4A3I G;  5FLM H;  4X6A H;  1X55 A;  1TWC H;  2E5L Q;  1XPO A;  2XTI A;  3HOZ H;  4OON A;  4MTN A;  1A8V A;  1HJP A;  2LXJ A;  3K0X A;  2HHH Q;  2JEA I;  1JE5 A;  4DAM A;  5M3F H;  3KFU A;  1FVI A;  1Q1E A;  4A93 H;  4GNX A;  1YIJ A;  4QGU A;  5LMN L;  4IPG A;  5BR8 L;  4WJ3 M;  1G6P A;  1C9O A;  1K9M C;  2IX1 A;  2BA1 A;  4KHP Q;  2Q2I A;  4NXN L;  1VS0 A;  4DR7 Q;  2R7Z G;  3U4V A;  2KBN A;  2YTX A;  4HID A;  4K0K Q;  1TWG H;  4KI0 A;  1GKH A;  1Q8K A;  3STB D;  3DLL A;  3G71 A;  4OX9 L;  2KHJ A;  4DK6 C;  2PI2 E;  2MNA A;  1YBY A;  4DUZ Q;  4HJA A;  1PH5 A;  2Y0S E;  3DM3 A;  1L2F A;  4PZ7 A;  1J5E Q;  1V43 A;  4YY3 L;  2KCT A;  2K14 A;  3CCQ A;  4FDB A;  1HNZ Q;  3GTO H;  3UDX A;  2IX0 A;  2OTL A;  4JI0 Q;  2VQE Q;  2NVX H;  4A3J H;  4IPC A;  4QL5 A;  1P8L A;  2OQ0 A;  1D7Q A;  4DPG A;  4RG1 A;  4A3E G;  2NN6 G;  4DV4 L;  5IWA Q;  1GM5 A;  4IJH A;  2JA6 G;  1C0A A;  2A1A A;  4OO1 G;  3KJO A;  4JYA L;  4YHH L;  1AE3 A;  1GD7 A;  2Y0S G;  4AIM A;  3J81 i;  2I5M X;  2QGQ A;  3E0E A;  2VUM H;  3EN2 A;  4OWW B;  3J7A 5;  5IYB H;  1N36 Q;  4NB3 A;  4A3L G;  5JJI A;  1EWI A;  4XIG S;  4X64 Q;  3PUV A;  4P75 A;  3PIO A;  1HZC A;  3F2C A;  4ME3 A;  1S40 A;  1QVG A;  1Y1W G;  4B3R Q;  3PO2 H;  2OTJ A;  5IYC H;  5EAY A;  2D62 A;  2IY5 B;  2I5L X;  2WFW A;  1N34 Q;  3S17 H;  3AFQ A;  3L7Z C;  3PIP A;  3ERS X;  3OTO L;  1V1Q A;  2V1C C;  4R1J A;  1X9N A;  1VQK A;  3OYY A;  2UUC L;  2JQO A;  4B3S Q;  4JI5 Q;  2UXB L;  2JA8 G;  5IP9 G;  4LF5 L;  4IJL A;  4LNQ A;  3HOY H;  1VQ4 A;  1L0W A;  4B3T L;  4YWL A;  3ZJY C;  5BR8 Q;  4BY1 H;  4BA2 I;  3K7U C;  4GLV B;  4YCW A;  4LF4 L;  2PQA A;  1OXT A;  1N32 L;  3I4O A;  2F52 A;  3J80 i;  2HT1 A;  1IL2 A;  2YTV A;  2VW9 A;  1N33 Q;  4POF A;  4A3C H;  1YNX A;  5GAG C;  3CCU A;  3A5U A;  3K80 C;  4OX9 Q;  2Z6K C;  4JI3 Q;  3F1Z A;  4IPH A;  3BZK A;  1TXY A;  4GN4 B;  4X65 Q;  4JBM A;  2R92 G;  3H3V I;  5M3M H;  1Q81 C;  4X66 L;  4TVA B;  1YJW A;  4JBK A;  3KF6 A;  2UU9 Q;  4C3I H;  4LF9 L;  2Z6K A;  1EYG A;  1Z47 A;  2B29 A;  1YHA A;  2F3I A;  4YWK A;  1SLJ A;  1PH6 A;  3S16 H;  4DV4 Q;  1VQE A;  4L5T A;  1XMQ L;  1NMF A;  1HNW Q;  1EIF A;  3M4O H;  3RLO A;  2EQS A;  1VQI A;  2LSS A;  1QZG A;  3JAM c;  1YHB A;  1JJC B;  4H02 A;  2K52 A;  4R4I A;  4LFC L;  1KRT A;  4DV1 Q;  2ZTC A;  3S1R H;  1RL2 A;  1PH1 A;  1IXR A;  3CD6 A;  4LFB L;  1LYL A;  1V9P A;  3NEL A;  3NEN A;  5IYD G;  5C0X I;  3U58 A;  2A8V A;  4DV0 Q;  1XNR L;  4BXX G;  4DR5 L;  4GKJ Q;  3JC6 6; 
#chains in the Genus database with same CATH topology
 4DGZ A;  3OTO Q;  3PIP 3;  1A3V A;  4DNR B;  5CV8 A;  3NQI A;  2RQX A;  4A3B B;  4JI4 L;  5FO7 B;  4MN3 A;  3S2H H;  4B3M L;  2C5C A;  3I4N B;  1SE3 A;  2R93 B;  2RDH A;  3CPW A;  3BZD B;  2C9O A;  2K03 A;  3GQB A;  3R3O A;  3I56 A;  4LF8 Q;  1SNO A;  4QIW B;  5CYU A;  3HOX H;  3CCS A;  1TU2 B;  3GTG B;  3NEM A;  4ILW A;  4JBW A;  1E2Z A;  1TS5 A;  3CHB D;  1LTT D;  1X54 A;  2F0G A;  4KY5 A;  3SK8 A;  1B4O A;  1HXY D;  1ILQ A;  1ZXT A;  2NB0 A;  1YEZ A;  2B2W C;  5EBD A;  2F4V Q;  4LUZ A;  4JI7 L;  1UE7 A;  1LT4 D;  2P5Z X;  1D5M C;  2K1B A;  2JA5 B;  1S5C D;  4A3D H;  4LUO A;  1PDQ A;  3A0J A;  1UAP A;  2BCO A;  2NVY H;  4OWX B;  2A74 C;  2E75 C;  1RDP D;  1QE6 A;  2EE1 A;  2PQE A;  5EPL A;  1UWV A;  3ND9 A;  4FVM A;  2PI2 A;  4HIO A;  1IBM Q;  2CKZ B;  2XRS D;  5HGQ A;  3HOV H;  5M5Y H;  2KHS A;  4KKU A;  3ITP A;  4ZKB B;  2E2I H;  2Q2H A;  4K8I A;  2E2J H;  5DLQ E;  1TWG B;  5K36 G;  4QMG A;  1GUG A;  5KIX A;  3KBX A;  4C56 C;  4DV3 Q;  5FLX E;  2F3W A;  3TP5 A;  3GTL H;  4LFA Q;  4ZKC B;  1XMO Q;  2PW5 A;  3D31 A;  3HKZ E;  4K2K A;  4HED A;  1MJE A;  3CU7 A;  1EZ6 A;  4WFN 3;  1FNU A;  3NBI A;  1DOM A;  1NSN S;  3KJP A;  4A3J G;  4A3G H;  1QJO A;  1SYD A;  3MXN B;  1IW7 D;  1QUQ B;  2IPK D;  4DR3 Q;  1XPU A;  3HKZ G;  1F2Y A;  2Z8L A;  4PV1 C;  3G6E A;  4DXG A;  4ULL A;  1PA6 A;  4NXN Q;  4IOA A;  1K3R A;  1CQF A;  1Y1V H;  3DM1 A;  4P73 A;  5KYI A;  1JR0 D;  5M5X H;  5JJK A;  3PV0 A;  3UDF A;  2PYK A;  2X6G A;  3EVQ A;  1KHI A;  4K8J A;  4YY3 Q;  3TBI B;  2R3Z A;  1TKW B;  2B2V A;  1HCZ A;  3GTP H;  4RH6 A;  4R4T A;  2YTY A;  3I90 A;  3CMA A;  4NDX A;  1EIH A;  1CUK A;  1H9J A;  3AYH B;  4AQY L;  1JQY D;  4KD3 A;  1U4L A;  2B2Y C;  4GZY C;  4JK1 C;  4OIK A;  2K01 A;  5M3M B;  1Z7T A;  3GTM H;  4DV7 L;  4G7O C;  2CWP A;  4A3C G;  2IL8 A;  4NPS A;  5C0X J;  4X62 Q;  3TP8 A;  5BN3 A;  1BO0 A;  2GVA A;  1TT2 A;  4J6H A;  2UXB Q;  4ZAI A;  4DAV A;  4K6D A;  1XWE A;  5CV4 A;  5C5M A;  1B70 B;  4HMJ A;  3MVV A;  4B3T Q;  3C1F A;  3I91 A;  3H15 A;  4K6L A;  2HCC A;  4JBJ A;  1L0Y B;  3DWP A;  3RLF A;  4BXX H;  1YHQ A;  1P16 A;  4EQ5 A;  4A3I H;  4B08 A;  1M8A A;  1CHP D;  1K0S A;  1FGU A;  1JOO A;  3S2H B;  2BDO A;  3J80 c;  5EKI A;  5C3E G;  4Y7N H;  4X66 Q;  1AP0 A;  2F0P A;  3CPF A;  3SK6 A;  3HGB A;  1TWF H;  5IWA L;  2MO0 A;  1PHJ A;  3HOX B;  1PFS A;  3GD7 A;  4IUV A;  1EWC A;  2R7D A;  3KDF B;  4B9X A;  5DNF A;  4P2C B;  3F2U A;  3HOZ B;  3P1H A;  1OTC A;  1U4M A;  4DR5 Q;  3IKJ A;  4LF5 Q;  1L1O B;  2F0I A;  2ES2 A;  1QNU A;  2SNM A;  1WYD A;  3AMU A;  4L5S A;  2J0T D;  4NXM Q;  4O1N A;  1BKB A;  1Q90 A;  5IGC A;  4A3D B;  4OO1 H;  2F0T A;  2HDL A;  4GNX B;  2NVY B;  1S72 A;  3HOU G;  2B2U C;  1KD1 C;  3CXC A;  1JJG A;  4DAP A;  3RZD H;  2WAC A;  1GXD C;  1I5F A;  4R4O A;  1Y1W H;  4JI3 L;  4A76 A;  3HOV B;  5M5Y B;  3OIP A;  2E2I B;  4GN5 A;  4DV5 L;  4JOI A;  5IP9 H;  2E2J B;  2F0S A;  2KCN A;  4HCS A;  3CCL A;  1U5K A;  5CR3 A;  5C4X G;  2KCM A;  4OXP A;  2K04 A;  2KCC A;  1VQA A;  5TSS A;  3K5L A;  2K5V A;  1PLF A;  3GTK H;  1PRT B;  3WWV A;  1LO5 D;  3GTL B;  1UE5 A;  3D3R A;  5ELO A;  2G5D A;  1VQN A;  3VR6 A;  3WOF A;  1RHP A;  4A75 A;  3M9B A;  2R92 H;  3BG3 A;  1F9S A;  2K33 A;  5FO9 B;  1I94 Q;  1ESF A;  2OEO A;  4HIK A;  4QY7 A;  3I70 A;  1WTV A;  2ICI A;  1CK1 A;  4A3G B;  4R8N A;  2VL6 A;  1NAP A;  3KF8 A;  5IE8 A;  3IL8 A;  4HJ5 A;  3LNN A;  1Y1V B;  1KAB A;  4LF8 L;  3KF8 B;  5M5X B;  3PGZ A;  4DR1 L;  4XT3 B;  2ID0 A;  5JPM C;  2Q8T A;  2JK8 A;  2K4K A;  2YU9 H;  5COR A;  1UEA B;  3GTQ H;  3F2B A;  1SNQ A;  3GTP B;  1U9R A;  4AH6 A;  4XYO A;  1JMC A;  2F4V L;  1STG A;  4RGM A;  5J3B A;  4LF6 Q;  1ET9 A;  1PH3 A;  2A6H C;  2DGY A;  5I2Y A;  3H3V C;  1X3F A;  4AYB B;  3E5S A;  3GTM B;  4BY7 H;  5JOB A;  4DKA C;  3Q8D A;  5LMU Q;  1SNP A;  1PVO A;  1D1K A;  1OXX K;  4UP8 A;  1IBM L;  3SGI A;  1H95 A;  1I6V C;  4JI0 L;  3H94 A;  4JI1 Q;  1IZ6 A;  2IW3 A;  1IYJ B;  3CCJ A;  4Z9C B;  1QIL A;  4XTC S;  2QW7 A;  1X3E A;  3H09 A;  4CDC C;  4A3I B;  2L5T A;  1M4V A;  4LFA L;  3I4N G;  3P75 A;  3NWT A;  1SFO H;  1E22 A;  1KNE A;  3T1Y Q;  2F0N A;  1PH4 A;  4B3S L;  4Y7N B;  2FMC A;  4X6A H;  1TWC H;  1TY0 A;  1TWF B;  1B3A A;  4MTN A;  5CV7 A;  1A8V A;  5BN5 A;  2LXJ A;  4V0B A;  1Q8I A;  1Y8O B;  2X69 A;  2QDB A;  3KFU A;  4DAM A;  5M3F H;  4U67 3;  1IW7 C;  1YIJ A;  3MZ5 A;  2BOS A;  1H9S A;  4WJ3 M;  1K9M C;  4KHP Q;  2BA1 A;  4IFD H;  2Q2I A;  4NXN L;  1VS0 A;  3FMC A;  2M00 A;  5IGG A;  1HQM C;  2KBN A;  2F0M A;  4K0K Q;  2G9D A;  2L0C A;  4L8J A;  1GKH A;  3STB D;  1BNZ A;  2Q8I B;  3TP7 A;  4DK6 C;  5AFW A;  4RKL A;  2PI2 E;  3MFG A;  1YBY A;  4HJA A;  1L2F A;  4YY3 L;  3EQL C;  3CCQ A;  1E0B A;  2IX0 A;  2NVQ B;  1HUN A;  4CJ2 C;  2VQE Q;  4QL5 A;  4RG1 A;  4TRD A;  4ZK9 B;  1EY0 A;  5A35 A;  1Y1W B;  5KNC A;  1EY9 A;  2QGQ A;  4OWW B;  3J7A 5;  4NB3 A;  2KQ3 A;  2NVT B;  1I50 B;  1GHK A;  1FGB D;  3F2C A;  4ME3 A;  1GUW A;  2OTJ A;  5KYL A;  2IY5 B;  2WFW A;  3AFQ A;  3L7Z C;  4HMI A;  1V1Q A;  4JI5 Q;  3AB9 A;  2NWG A;  4WOR A;  2UXB L;  3DWA A;  1TS4 A;  3KLS A;  3U9S A;  4EVO A;  4LNQ A;  1GUN A;  1L0W A;  4B3T L;  4YWL A;  1ZYR C;  4BY1 H;  1BQQ T;  3BVG A;  1OXT A;  3VYT A;  2R92 B;  2F52 A;  2HT1 A;  2IX3 A;  5J22 A;  1IL2 A;  4EQP A;  1N33 Q;  2F0H A;  2EJM A;  3BZK A;  4KN7 C;  5ELD A;  5CMD A;  4X66 L;  1SJH D;  4C3I H;  2AUJ D;  5CV6 A;  2YU9 B;  3QIA A;  2KOL A;  1NMF A;  1EIF A;  3GTQ B;  2EQS A;  4C3J G;  4R9W A;  4DV1 Q;  3S1R H;  1PH1 A;  1LYL A;  5IYD G;  2A8V A;  4DV0 Q;  3T56 B;  4DR5 L;  4GKJ Q;  1LT3 D;  1ONL A;  4LF5 L;  1W6J A;  2WB1 E;  5I6Y A;  2EDG A;  1BCP D;  2JP1 A;  1BOS A;  1D1I A;  3A54 A;  4BY7 B;  1X6O A;  3AEV A;  4I7A A;  5GAE C;  4BBS H;  3ONA B;  2FFK B;  4DV2 Q;  2EYP A;  3H0G H;  1PYB A;  2F0K A;  3S2D H;  4XT1 B;  1QVC A;  2B63 G;  1HNX L;  3PSI A;  3CCV A;  1KQS A;  2O5I C;  1Q3L A;  3MXP A;  3FPU B;  2JN4 A;  2Z1C A;  1ENF A;  1EQT A;  3UDG A;  4H13 C;  1VQG A;  1WOC A;  1PYS B;  4GKK Q;  1CHQ D;  2QKI C;  1SEB D;  1QG7 A;  2OCE A;  5FLX c;  1SFO B;  2PPB C;  4GOP B;  4PZ6 A;  2QEX A;  4XQQ A;  2EIF A;  1TWC B;  1EL0 A;  4LFC Q;  5JEA H;  3D8G A;  1LUZ A;  4ZUJ A;  1I94 L;  2D0O A;  1CQV A;  5GQO A;  5FJ8 H;  4DV6 Q;  5M3F B;  3TME A;  3WOE A;  1NR4 A;  1DXM A;  1GUS A;  1KLG D;  1F2L A;  3HOZ G;  2K50 A;  3ULP A;  4QQB X;  4A93 G;  1TWA H;  3DEO A;  3MEF A;  1DM0 B;  1VQM A;  1VQC A;  1T5X D;  1Y14 B;  1WCM H;  3J7A V;  2N55 A;  5ELC A;  3PF5 A;  1A0I A;  3VA5 A;  5AJ3 L;  2NZH A;  2PZU A;  1XNQ L;  1K3B C;  3MHB A;  1CKO A;  2K28 A;  3CQZ H;  5KND A;  3T1H Q;  4LF6 L;  3SEB A;  5BN4 A;  2DUD A;  1JCK B;  4HAE A;  1IL8 A;  1K8M A;  2J4X A;  3G48 A;  5IT9 L;  4A3K H;  3VR3 A;  2WAQ E;  1ENA A;  3M4Y A;  2I5H A;  5C5L A;  3CF5 A;  4Q0F A;  5LMU L;  4P74 A;  4TSS A;  2VUM G;  4OWT B;  3W1G A;  4XDX A;  2NZO A;  3A8I E;  3PO2 G;  5IYC G;  4F7X A;  3VDY A;  1XYI A;  2E2D C;  2WAQ G;  4HJ9 A;  2CH4 A;  4R4Q A;  4BY1 B;  3Q24 A;  1CA6 A;  1W2B A;  3A8J E;  2DNE A;  2PNH A;  5C6A A;  3HOY G;  2A19 A;  3V05 A;  2VS1 A;  4RCO A;  4JYA Q;  2D9U A;  3K8A A;  1I6H H;  5IYD H;  1X3G A;  3TEH B;  3T1Y L;  1SAP A;  3MA2 B;  3ZYY X;  3CCE A;  4F8M A;  4JI2 Q;  2R6G A;  1U0L A;  4C3I B;  2XN9 C;  2PZT A;  2AQ3 B;  1MHW C;  4ZCK A;  1MJC A;  4KJO A;  1CI3 M;  4M1U B;  2NYZ D;  3RN2 A;  4JG2 A;  3M7N A;  5LL6 X;  3FKI H;  5C3W A;  4JI6 Q;  1EYC A;  1HHV A;  4KHP L;  4F87 A;  2IHE A;  3OMG A;  1EOV A;  4LAA A;  2F0F A;  5EPK A;  2J7Z A;  4MTK A;  4CBV A;  2GN5 A;  1I4X A;  4P71 A;  4P72 A;  1HA6 A;  2O4X A;  3OWE B;  4V19 0;  3IRB A;  3SDZ A;  2VQE L;  4JC0 A;  3S1N B;  2RCF A;  2RBM A;  2EZV A;  1DYQ A;  1TII D;  1H9K A;  5G3L D;  4B9W A;  4BBS B;  1WI5 A;  1D6E C;  1SYC A;  4KHV A;  1CKN A;  1I4H A;  3H0G B;  3S2D B;  2RVL A;  4JI8 L;  1MBY A;  4O42 A;  3BYT B;  1BBW A;  1EYD A;  1XMQ Q;  3SK4 A;  1SDF A;  2WIN B;  1PTO D;  1CKN B;  1KTK A;  1BCP F;  1DOL A;  3M4Q A;  1SXT A;  3GTJ H;  4JI5 L;  2HDM A;  4BA1 I;  3QOJ A;  1W6K A;  2TMP A;  5C0X G;  3K58 A;  1WTO A;  4LWC A;  2D0P A;  1A3T A;  2NN6 H;  4A3E H;  2HQL A;  1LTG D;  3PUY A;  2Z0S A;  2QA4 A;  1N33 L;  2EY6 A;  2L55 A;  4XYQ A;  3S14 H;  4NMZ A;  3RN5 A;  3PCO B;  3F8T A;  3AQQ A;  1LTB D;  1BR9 A;  2DN8 A;  2K7V A;  1TWA B;  5IGE A;  1ASZ A;  4A3M G;  3BJU A;  3R93 A;  1YNJ D;  3MXN A;  1L0X B;  1WCM B;  1QUQ A;  3H91 A;  1HR0 Q;  1A2U A;  4PZ8 A;  3VR5 A;  1O7L A;  3ERO A;  2JJQ A;  2F0J A;  4DV1 L;  1VQD A;  1X32 A;  3A7L A;  2UUB Q;  1SMY D;  1F9P A;  1K0R A;  4DK1 A;  3CQZ B;  4DV0 L;  4DR2 Q;  5IT9 E;  4GKJ L;  1OXU A;  1IYU A;  5D14 A;  1O80 A;  3HFZ B;  3NSW A;  1PXU A;  2UUA Q;  2EVB A;  2EY5 A;  3V2T A;  2N78 A;  2Q8R E;  3D6W A;  1BCP C;  1M90 C;  1IBK L;  4FXK C;  3FHW A;  1TVX A;  1AW7 A;  2A73 B;  3MAQ A;  2AQ2 B;  2ZJR A;  5C44 G;  1RIP A;  1SMX A;  3D6C A;  2AHO B;  3TSS A;  4DK0 A;  1D8L A;  4IUT A;  3NUC A;  4DV2 L;  1CSP A;  3DMU A;  2VZA A;  4YCU A;  3PO3 G;  2ZJQ A;  3I4M G;  1E2W A;  4J1M A;  4DR6 Q;  3HEJ A;  4BBR G;  1HR0 W;  1QWY A;  3HOW G;  1X3P A;  5A2Q L;  2F0D A;  3S1Q H;  1NE3 A;  3H6M A;  3QO2 A;  4GKK L;  1GHJ A;  1I4P A;  2FHT A;  1I6H B;  3T16 A;  4I7Z C;  5DEH A;  2ZM6 Q;  4R4C A;  1YJN A;  3RLN A;  5IP7 G;  1YIT A;  2BE5 D;  4TQU S;  5E4X A;  2SOB A;  1EQR A;  4DV6 L;  1OXV A;  2N49 A;  2IT1 A;  4G7H C;  1S5D D;  3FKI B;  4IPD A;  2JA7 G;  3A7A B;  1SRO A;  1UUP A;  1K28 A;  1Z6H A;  1G6Z A;  4QJF A;  1MGS A;  3I3C A;  2WB1 B;  3DUZ A;  3FDT A;  2MQH A;  3PUW A;  2A6E D;  4KY6 A;  2VY3 A;  1VMP A;  3G7L A;  3KDF A;  4A3F G;  3CW2 C;  3JAM L;  1VQ6 A;  3TN2 A;  3FVQ A;  4X64 L;  3V96 A;  3BZC A;  1GUO A;  2C35 B;  4DUY Q;  1E3P A;  2OQK A;  3Q22 A;  5KGU A;  2ASB A;  3PUZ A;  2JSO A;  2SNS A;  3HS0 C;  1L1O A;  2B2T A;  3T1H L;  3A55 A;  1X55 A;  2MGS A;  1MI2 A;  2XTI A;  5EJW A;  4OON A;  1XPO A;  4LK1 C;  3K0X A;  2JEA I;  2UXD Q;  1JE5 A;  2R61 A;  4DFA A;  4GNX A;  5K36 H;  4IPG A;  3QR8 A;  5BR8 L;  2A69 D;  4DR7 Q;  2R7Z G;  3DXJ C;  3GTJ B;  4C1N K;  3NP8 A;  4C3H G;  3RMH A;  3QG1 A;  1ROD A;  5G3L F;  4CJ1 B;  4DUZ Q;  1PH5 A;  4CKE A;  1J5E Q;  1JB3 A;  4A3E B;  2KCT A;  3T51 B;  4FDB A;  4XQN A;  1CZG A;  1KNA A;  3L9A X;  1HNZ Q;  3GTO H;  1ZEQ X;  1F2Z A;  2Y0S B;  1BXT A;  2OTL A;  1PTO F;  2NVX H;  4A3J H;  2DY7 A;  1P8L A;  4RGN A;  1CT1 D;  4DV4 L;  2JA6 G;  1JOR A;  4H0L C;  4JYA L;  3CRL C;  1MSG A;  5FKA C;  4HTH A;  1FYC A;  4A3L G;  5JJI A;  4CKB A;  1II3 A;  3HG9 A;  4B3R Q;  1HZC A;  1QVG A;  1S40 A;  2D62 A;  2PW7 A;  4FF3 A;  1PZJ D;  2B8G A;  4UAI A;  3OTO L;  3OYY A;  2JQO A;  1V8Q A;  2JA8 G;  3G6J B;  2MHV A;  5ELF A;  4CGY B;  4PMB A;  1VQ4 A;  1HPC A;  2N88 A;  3ZJY C;  3K7U C;  2ZXO A;  1EYA A;  1B9N A;  3URY A;  2YTV A;  4Q5V A;  4A3C H;  1YNX A;  4IN3 A;  3IAY A;  3D4R A;  3CCU A;  4X3K A;  3K80 C;  4OX9 Q;  1LTR D;  4IPH A;  3Q0A A;  1TXY A;  4X65 Q;  2XNA C;  1STE A;  1YJW A;  2L9H A;  1VF5 C;  4HCE A;  2Z6K A;  5EKL A;  1EYG A;  1XXG A;  4ME5 A;  1YHA A;  2F3I A;  4CDD C;  3I72 A;  5A2Q E;  1XTC D;  1PH6 A;  3S16 H;  1VQE A;  1IYV A;  1XMQ L;  1HNW Q;  1F77 A;  1PTO C;  4DXF A;  2IJ0 A;  3FPP A;  1PFB A;  2K52 A;  4H02 A;  3CD6 A;  1O78 A;  1RL2 A;  5E1F A;  3NEN A;  1V9P A;  3NEL A;  5C0X I;  3S1Q B;  1VMC A;  4RGO S;  1EQV A;  2AQ1 B;  1KLU D;  2K75 A;  5C3E H;  3E9I A;  4K5X A;  2QCP X;  5I6W A;  5IIF A;  1VCI A;  2K6A A;  4IFD J;  4DR4 Q;  5DM6 3;  1NUC A;  3DEP A;  4N9P A;  4CKC A;  1EY7 A;  4GN3 B;  2PCF B;  1EU4 A;  5I4D A;  3U4Z A;  4DV3 L;  2KED A;  1A63 A;  4A3B G;  4TKO B;  1Q12 A;  4UP9 A;  2R93 G;  4ID6 A;  1XMO L;  2HIX A;  3KBG A;  3JAM E;  3J81 L;  3R2T A;  1QVF A;  3K7A H;  4CDF C;  1YNJ C;  3ER0 A;  4OO1 I;  3J7Z C;  1I3Q H;  2BH8 A;  1B2T A;  3IFD A;  4APV A;  5CBE E;  4K5V A;  2ZTE A;  3ULJ A;  2KEC A;  3PUX A;  1SYE A;  3I2Z A;  3HOU H;  4DR3 L;  1SMY C;  2N8N A;  1HUM A;  1UNS A;  2K32 A;  1Q46 A;  3K5O A;  1UEB A;  2CFM A;  1KDB A;  2UUA L;  3K57 A;  1TY2 A;  4LFB Q;  2JA5 G;  1DJR D;  1G51 A;  1LAB A;  1Q7Y C;  1E1O A;  1FD7 D;  1GJX A;  5FLM G;  5C4X H;  1CFM A;  3TZU A;  1I4R A;  5C4J H;  2E2H H;  4IUR A;  3S15 H;  1BVS A;  1FNV A;  1S5E D;  3NE5 B;  4LF7 Q;  3DHQ A;  4IUP A;  3RZD B;  4N8X 1;  4B3M Q;  4K14 A;  3NBH B;  1DD2 A;  3AU7 A;  4DR6 L;  2VQF Q;  5CV5 A;  2HIV A;  3M4P A;  5GAH C;  2RSO A;  1O7I A;  4EQN A;  3A56 A;  2JE6 I;  3GTO B;  1STB A;  2MFI A;  4X62 L;  3L3O C;  1C8C A;  2NVX B;  4A3J B;  1AH9 A;  1A6X A;  1KL9 A;  1VQP A;  5I2X A;  3HKZ B;  1VQH A;  4HSV A;  3GTK B;  3M3Y H;  4FO2 A;  2VB2 X;  4J15 A;  1VQL A;  3KOJ A;  4KK7 A;  5LMN Q;  1K8A C;  3A74 A;  2FIN B;  1PZI D;  3CCM A;  5FOB B;  1E24 A;  2PMZ E;  1ML0 D;  3I73 A;  5E4W C;  4C2M H;  3OW2 A;  3TS0 A;  3K0Y A;  5IYB G;  2I0Q A;  3CC2 A;  2B2V C;  3J81 j;  1SN8 A;  4RWS C;  1RKN A;  2A6E C;  3TS2 A;  5EQ0 A;  1STA A;  1SRU A;  1SND A;  1KDC A;  3NTI A;  3U50 C;  2YV5 A;  2SDF A;  5IY0 A;  3SVM A;  1HH2 P;  1VF7 A;  2NUC A;  2HQE A;  1F2M A;  1Q86 C;  4KD4 A;  3LX0 A;  2FJ2 A;  4DK3 C;  1G29 1;  1SYB A;  2N3S A;  3C2P A;  3N6R A;  1F9Q A;  2OF1 A;  4YWM A;  4L63 B;  3T4A C;  1I4Q A;  1CTM A;  2Q2U A;  2B2Y A;  4QCL A;  2UXD L;  3M7G A;  5M3M G;  1WD0 A;  5LMN W;  2KEE A;  4NXM L;  3S16 B;  2UUC Q;  2A69 C;  2CHB D;  5E3F A;  3H3V H;  2LKV A;  1YNN D;  1PTO H;  4DR7 L;  4YCV A;  4MNO A;  2FMM A;  1GVP A;  3S1M H;  4IOC A;  1EOT A;  3HKS A;  4PQX A;  1AFP A;  2LY7 A;  4NKL A;  3UDI A;  3I4N H;  2DJF C;  5JEA J;  2WKD A;  1N32 Q;  5K5P A;  5C3E B;  4MIU A;  5ELB A;  2O5J C;  1X56 A;  2RA4 A;  3GTG H;  1B1Z A;  3NPP A;  3WDN A;  4R8I A;  3J81 E;  4I65 A;  1SBB B;  4LF9 Q;  1Y8P B;  1EQQ A;  3L2P A;  4GOP A;  1RTO A;  1L1O C;  3CCR A;  3K7A B;  3HOX G;  1Y69 U;  1E2V A;  3TDQ A;  4HIM A;  4DV7 Q;  4RHS A;  5C4H A;  4A4I A;  1XNR Q;  3HOU B;  1KC8 C;  2ICE C;  1PYW D;  3NWS A;  5E7N A;  2QF7 A;  3RZO H;  2RHQ B;  1BBX C;  1UE1 A;  1GOZ A;  1DCZ A;  2CH4 W;  5IT9 c;  4A3D G;  1RCV D;  2RSN A;  2KJX A;  4JOI C;  5CV9 A;  1AE2 A;  1DGS A;  5JJL A;  4X65 L;  2B2U A;  5C4X B;  3KLR A;  5C4J B;  2E2H B;  3S15 B;  4WJW A;  3CAM A;  1VQ9 A;  3HOV G;  3JAM i;  4NP5 A;  1NJI C;  2EYM A;  1SSO A;  1HNW L;  2DJG C;  3BDC A;  3C3L A;  2WKC A;  4CHT B;  1V1O A;  4GS3 A;  3AFP A;  3FP9 A;  3LWU A;  1MKH A;  5IOD A;  3CP0 A;  2R7F A;  1MD2 D;  4BWG B;  3K81 C;  2KEN A;  1BUV T;  4XXE A;  2GA4 B;  1LTL A;  5GRO A;  3X3N A;  3M3Y B;  2B3G A;  4JI1 L;  5JVH 3;  1ZKO A;  4JCV E;  3NQT A;  4DR4 L;  1SYF A;  1E1T A;  2WII B;  4C2M B;  1CKM A;  5ELN A;  4A3G G;  3KYH C;  4RAU C;  4IUQ A;  4C3J H;  4MHE A;  1EIY B;  2UXC Q;  2XSC A;  2PQA B;  5IGB A;  4OHJ A;  2A68 D;  1Y1V G;  2AUK A;  1G2S A;  1TS2 A;  1WTQ A;  1HRJ A;  2ZXP A;  3NHH A;  2RF4 A;  1W3S A;  4KY7 A;  4ABN A;  4HJ7 A;  4UDU C;  1PH8 A;  4JV5 Q;  4DV5 Q;  1WJJ A;  5M5W H;  3K5N A;  4AYB E;  3I8Z A;  2AMC B;  1D5Z C;  2Z4H A;  2EJF C;  4DNI A;  3KF6 B;  1R9T H;  2KA7 A;  4FXG C;  1XTD A;  3ICE A;  2PZW A;  1AZQ A;  3OOC A;  3S1R B;  4K0K L;  1HTP A;  2ENB A;  4X3T A;  3STB C;  2VXW A;  1PZK D;  1TR5 A;  1VQB A;  1WD1 A;  5LHY 1;  3NTH A;  2B63 H;  3N52 A;  4AYB G;  1G91 A;  2JXM B;  2CWA A;  2H4O A;  2LXK A;  2F0U A;  3D0F A;  3GDE A;  1IKL A;  3GP7 A;  1PTO B;  2L4N A;  4O2D A;  4NW2 A;  1WTX A;  4C1N I;  4LF7 L;  1IHZ A;  3ERQ A;  3TQY A;  3S1M B;  1YI2 A;  1B44 D;  2EYO A;  2D2C C;  2K5H A;  1S5B D;  3CC4 A;  1LTS D;  2VQF L;  2AWN A;  1K73 C;  4DR1 Q;  1TWH H;  5EKK A;  4BXX G;  1R4Q B;  5HY6 A;  1KRS A;  3UE0 A;  1VQ7 A;  2F0O A;  4DN4 M;  2XWJ B;  1M1K C;  1FJG Q;  1Q1B A;  1JJ2 A;  3ND8 A;  4A3I G;  2K5D A;  2E5L Q;  3HOZ H;  1HTL D;  1JE4 A;  2HHH Q;  4HSP A;  4A93 H;  4QGU A;  2SEB D;  5LMN L;  1G6P A;  1EWH A;  4RKB A;  2IX1 A;  2A6H D;  1DON A;  1T5E A;  3U4V A;  3W2D A;  2NTS A;  1Q8K A;  1WTW A;  3G71 A;  3HZX A;  2KUM A;  4HR7 B;  3DM3 A;  1SE2 A;  5JAV A;  2F4I A;  3SK5 A;  3RZO B;  1G8Z D;  3UDX A;  4JI0 Q;  3T13 A;  1D7Q A;  4DPG A;  4KKS A;  2EYL A;  4IJH A;  1C0A A;  2A1A A;  4OO1 G;  1AN8 A;  2E74 C;  1AE3 A;  2H1E A;  2CQA A;  3J81 i;  3MXU A;  1J8I A;  2NBF A;  2I5M X;  3E0E A;  3VR4 A;  3EN2 A;  2VUM H;  3Q6S A;  2EY1 A;  3RD4 A;  1N36 Q;  4LMQ D;  1NCV A;  1A3U A;  1EWI A;  2JYO A;  2CW0 D;  3PIO A;  1Y1W G;  3PO2 H;  5IYC H;  1B53 A;  3S17 H;  3PIP A;  1JWS D;  3ERS X;  4B3S Q;  2V1C C;  1VQK A;  1X9N A;  2UUC L;  4BS9 A;  3OIQ A;  4L6T B;  1EIG A;  1YNN C;  3HRZ C;  4IAL A;  5IP9 G;  4RHR A;  4IJL A;  1WTH A;  4CDE C;  4A3K B;  4PMC A;  5EGT A;  3HOY H;  1O7Y A;  3CRK C;  3RUZ A;  4GLV B;  1JOQ A;  5JJZ A;  1U4R A;  2VB3 X;  1N32 L;  5FK9 C;  5ISR A;  5LL6 S;  2VW9 A;  1SNC A;  4CJ0 B;  2PMZ B;  4QUF A;  3BYY B;  3UI2 A;  3F1Z A;  2I07 B;  4JBM A;  2F0L A;  2R92 G;  1B3Q A;  5JVG 3;  5C3X A;  2UU9 Q;  3OSO A;  4LF9 L;  1Z47 A;  5EBC A;  4C3J B;  1J9O A;  2B29 A;  4U68 A;  5M9O A;  1FNW A;  3M4O H;  1VQI A;  2RDF A;  3E0J A;  2LFN A;  2LSS A;  4FYD A;  3JAM c;  1YHB A;  4LFC L;  1KRT A;  1N34 Q;  1IXR A;  4ZLT F;  3U58 A;  4OEL B;  1XNR L;  5M5W B;  2XIW A;  2B39 A;  5FO8 B;  1R9T B;  2E76 C;  1KXL A;  3OMC A;  3P20 A;  3FRP B;  5D65 A;  2EYF A;  1AZP A;  1K83 H;  4EQO A;  1ILP A;  2BA0 A;  5GAD C;  3MC0 B;  3X3M A;  1ZYR D;  2JEB I;  2B63 B;  3GV6 A;  2E8G A;  3L0O A;  2L1B A;  1ENC A;  4BY7 G;  1IBL Q;  5CC4 A;  2EXD A;  4KMU C;  4RMF A;  2NN6 I;  1S4Z A;  3W3A A;  3QOL A;  4GOP C;  2K5N A;  3OPO A;  3HP3 A;  3PMF A;  4H7B A;  5I9P A;  5L37 A;  5C0X H;  1CZW A;  2NZ1 D;  2EPB A;  1U4P A;  1STH A;  1FL0 A;  1MIU A;  3NK9 A;  1TWH B;  4L5R C;  5CGK A;  2F1M A;  4OIJ A;  1WVL A;  1NTG A;  1EFW A;  3PF4 A;  5CBA E;  2HD3 A;  2CCZ A;  1O7Z A;  3S24 A;  3MWY W;  4A93 B;  2Z4I A;  4WRD A;  4A3M H;  3J80 L;  4IUN A;  1HFG A;  3EJI A;  2A5H A;  2EOT A;  2XGT A;  5M3F G;  1PH2 A;  1EZ8 A;  2JA9 A;  5D3I B;  2NVQ H;  4G7Z C;  1BBU A;  3S14 B;  4IFD G;  1C4Q A;  2UXC L;  1LLR D;  3KK7 A;  2A68 C;  1VQ5 A;  2OWO A;  2EJG C;  2ZXR A;  2YYZ A;  3E9H A;  2K05 A;  2GVB A;  1KIX A;  3EFX D;  3SR1 A;  1A2T A;  2X6L A;  1JIC A;  4RA8 A;  2OT2 A;  4LW1 A;  5I9O A;  3BS1 A;  4JI2 L;  1V1P A;  4FP5 D;  4JV5 L;  2NVT H;  3D4W A;  1I50 H;  4ALP A;  1I4G A;  3GV3 A;  2EXZ A;  4F88 A;  1HNX Q;  1D2B A;  1D5X C;  4POG A;  1V1P B;  4JI6 L;  1B50 A;  5IGF A;  3FEW X;  2PNR C;  5C44 H;  2VUM B;  1YVC A;  1NMG A;  1LTA D;  1PFN A;  2KHI A;  4GLA C;  1C7Y A;  3PO3 H;  3PO2 B;  3I4M H;  2F0W A;  2F0V A;  3MTS A;  5NUC A;  4DF7 A;  4FF4 A;  3S17 B;  4PNY A;  2WAQ B;  4RFB A;  4BBR H;  1JB7 A;  2CVR A;  4EGV A;  1CA5 A;  2MPM A;  3HOW H;  1LM0 A;  4IZ8 A;  4K5W A;  3G4S A;  2RKS A;  4JW0 A;  3HOY B;  2IWH A;  3EBE A;  1PRT D;  4FNF A;  2WP8 J;  3VYS A;  3A5Z B;  3B6Y A;  1ESR A;  1KAA A;  1DZ1 A;  4PG3 A;  2XRQ D;  1EEI D;  2I46 A;  4FF1 A;  3I55 A;  4BY1 G;  4J8Q A;  2B8F A;  5IP7 H;  4YHH Q;  1OXS C;  1FJG L;  3MFY A;  5AJ3 Q;  1LAC A;  2E5L L;  2JA7 H;  1RJT A;  3F2D A;  1XNQ Q;  3R8B A;  2QDL A;  5IOC A;  2WV6 D;  3OHX C;  3J81 c;  2HHH L;  1HFN A;  4ODG A;  4ZYS A;  4X3S A;  4MZ9 A;  1KAW A;  4C3I G;  5T1G A;  4XQJ A;  4YIJ A;  2RHS B;  3M4O B;  1PV4 A;  4A3F H;  3K6O A;  4KLK A;  4QIW E;  2ALY B;  2DNC A;  4EX5 A;  5COY A;  3GO5 A;  4LF4 Q;  4Y52 H;  4H44 C;  1GO3 E;  3ULL A;  1PH7 A;  1MSH A;  1PH9 A;  1JC7 A;  1NR2 A;  3TRE A;  4DU9 A;  3J7A F;  2M9V A;  3M85 A;  1OO9 B;  1K83 B;  1XPR A;  3BU2 A;  2K5W A;  2Z6B A;  1PMR A;  1HR0 L;  1EEF D;  1B8A A;  1EY6 A;  4FF2 A;  1EUJ A;  5F2D A;  1VQO A;  4UP7 A;  3OWF A;  2R7Z H;  1NNX A;  3BDL A;  4DA2 A;  1K8G A;  2UUB L;  1N36 L;  1AEX A;  2CW0 C;  4C3H H;  3CME A;  4DR2 L;  3SE0 A;  4BBS G;  2B2W A;  2MP1 A;  1X65 A;  1N9W A;  3H0G G;  2IHF A;  3C46 A;  1VQF A;  2AKW B;  4PMW A;  4UHV A;  3D4D A;  1J6Q A;  1SJE D;  2L11 A;  1YJ9 A;  2V4D A;  2BH2 A;  5H1S E;  2JA6 H;  3NBH A;  3J80 E;  1H9M A;  3S9W A;  1ASY A;  2F3V A;  4O0A A;  2FXQ A;  2XVS A;  3LGJ A;  4JI4 Q;  1C48 A;  3NXW A;  5ELE A;  1H9S B;  4OEM B;  1N8R C;  1GUT A;  3RR5 A;  4A3L H;  3O13 A;  4UPA A;  4E6I A;  4M8A A;  1R4P B;  1ICF B;  4A3M B;  5HUR A;  2F03 A;  1TQO A;  1SYG A;  2BDN A;  5JEA G;  2KVM A;  4KKT A;  1BDO A;  5T1I A;  2UU9 L;  2ZTD A;  5FJ8 G;  3VR2 A;  2QEJ C;  4N9T A;  2JA8 H;  3K59 A;  1WTR A;  2Z9H A;  4ZRZ A;  2RCN A;  2ZM6 L;  3C1E A;  1EY4 A;  3J7Y W;  1LTI D;  3E3X A;  2CQO A;  3CC7 A;  1N34 L;  2BE5 C;  4JI7 Q;  1WCM G;  2ZT9 C;  4JI8 Q;  4KN4 C;  3LWE A;  3VA7 A;  1VQJ A;  1DOK A;  4KHZ A;  4JPB W;  2VNU D;  2HCI A;  2ZJP A;  1SNM A;  1HZ9 A;  1YZ6 A;  1T9H A;  2L15 A;  1HA5 A;  1HZA A;  4KJN A;  5C44 B;  2F0E A;  1KDA A;  1Z9F A;  2OXP A;  3PO3 B;  2Q2T A;  3I4M B;  1F9R A;  3EA6 A;  4G4K A;  3MEH A;  3EIV A;  5KEE A;  4BBR B;  4A3K G;  2EY2 A;  1ET6 A;  4IO9 A;  1IBL L;  2PO4 A;  4QUC A;  4DUY L;  5J1Z A;  3HOW B;  1BCP B;  1QZH A;  3QJY A;  3W1B A;  1CSQ A;  4KV6 A;  1JT8 A;  4WJ4 A;  1VQ8 A;  3TRZ A;  4IQZ A;  1B7Y B;  3VYR A;  3R2I A;  1UE6 A;  3NTK A;  2MO1 A;  1TS3 A;  1S3O A;  4HJ8 A;  4GLX A;  1RF2 D;  3T53 B;  1A62 A;  1RD9 D;  3Q23 A;  3TZD A;  4FXD A;  1JWM D;  1LV9 A;  3KLW A;  2ATW A;  1HZB A;  3UE1 A;  2LS0 1;  1EU3 A;  1H9R A;  2F0Q A;  3DWQ A;  1WFQ A;  1PFM A;  5D3D A;  4A3B H;  2AWO A;  5IGD A;  2JA7 B;  1PRT F;  3K5M A;  2R93 H;  1Y8N B;  4UY8 C;  2DY8 A;  4DUZ L;  1SE8 A;  4RCN A;  3W5O A;  4HN7 A;  4DAY A;  1XJV A;  1J5E L;  1A15 A;  2XWB B;  3I7F A;  1B9M A;  1XX8 A;  1HNZ L;  2G9H D;  4A3F B;  4DAY B;  3RNU A;  4IFD I;  1IBK Q;  2QIL A;  3BVM A;  3FKI G;  1SR3 A;  3PQI A;  1E7Z A;  2TSS A;  1Q82 C;  4LUV A;  3S1N H;  1EY5 A;  4L5Q A;  2EYH A;  1FR3 A;  2O2L D;  2H5X A;  1EFI D;  2B2T C;  2WB1 G;  3SHL A;  2L12 A;  2M2L A;  1NY4 A;  1NBW A;  4B3R L;  1LT5 D;  4KTA A;  4AQY Q;  4OGQ C;  3U9O A;  2EYJ A;  5KNB A;  2JA5 H;  1I3Q B;  4GNX C;  5FLM H;  4QF4 A;  4DNT B;  1G2T A;  5J39 A;  1HJP A;  2R7Z B;  1FVI A;  1Q1E A;  4N8F A;  4C3H B;  1C9O A;  3IFT A;  4ZUI A;  1QOH A;  2YTX A;  4HID A;  3KUP A;  1TWG H;  2HUG A;  3SXH A;  4KI0 A;  2NTT A;  1K8O A;  3DLL A;  4OX9 L;  2KHJ A;  2MNA A;  1SE4 A;  1JOK A;  2MUY A;  2Y0S E;  3E6Z X;  5EPJ A;  1PRT C;  4PZ7 A;  4RGT A;  1V43 A;  5HGT A;  1QB5 D;  2K14 A;  2JA6 B;  3OW7 A;  1EY8 A;  1HQR D;  3P7J A;  1WTP A;  1STY A;  4IPC A;  1S5F D;  2OQ0 A;  4A3E G;  2NN6 G;  1QNK A;  5IWA Q;  5FLX L;  1GM5 A;  3KJO A;  4YHH L;  1GD7 A;  3QWN A;  2Y0S G;  4ZQ3 A;  4AIM A;  5KRU A;  2K5Q A;  4LJZ C;  1CM9 A;  5IYB H;  1X3Q A;  4XIG S;  4X64 Q;  3PUV A;  4P75 A;  2JA8 B;  1BF4 A;  5EAY A;  2I5L X;  2LMC B;  3MXG A;  4R1J A;  4G57 A;  1LT6 D;  1RTN A;  4X3U A;  4OL7 A;  1QCB D;  4QB4 A;  5DM7 3;  5BR8 Q;  4BA2 I;  1ICW A;  4YCW A;  4LF4 L;  2PQA A;  3BVZ A;  3I4O A;  2MJ8 A;  3J80 i;  1JWU D;  4POF A;  4IUU A;  5GAG C;  3A5U A;  3CKI B;  2Z6K C;  4JI3 Q;  5JPN C;  4GN4 B;  3H3V I;  3QB3 A;  5M3M H;  3I4L A;  1Q81 C;  4TVA B;  4JBK A;  4K2L A;  3KF6 A;  3KLS X;  1STN A;  3BDO A;  3A8K E;  4YWK A;  1SLJ A;  4JVZ A;  4DV4 Q;  4L5T A;  3RLO A;  1QZG A;  3TP6 A;  1JJC B;  2D5D A;  4R4I A;  1VDZ A;  2ZTC A;  1IKM A;  4LFB L;  2RDG A;  5C4Z A;  3PIO 3;  3JC6 6;  4S3S A;  5DAU A;  3VYU A; 
#chains in the Genus database with same CATH homology
 2K75 A;  2WB1 E;  3OTO Q;  5C3E H;  3E9I A;  1KXL A;  1VCI A;  4IFD J;  1K83 H;  4JI4 L;  4DR4 Q;  3S2H H;  4B3M L;  1X6O A;  2BA0 A;  3CPW A;  3AEV A;  5GAD C;  2JEB I;  3I56 A;  3L0O A;  2E8G A;  4GN3 B;  5GAE C;  4DV3 L;  4LF8 Q;  3U4Z A;  4BBS H;  1A63 A;  4A3B G;  4DV2 Q;  3HOX H;  1Q12 A;  4UP9 A;  3CCS A;  1IBL Q;  4BY7 G;  2R93 G;  3H0G H;  1PYB A;  1XMO L;  2HIX A;  2EXD A;  3S2D H;  1QVC A;  3NEM A;  4JBW A;  2B63 G;  1QVF A;  4RMF A;  1HNX L;  2NN6 I;  3K7A H;  3PSI A;  3ER0 A;  1X54 A;  3CCV A;  4GOP C;  1KQS A;  4OO1 I;  2K5N A;  3J7Z C;  1I3Q H;  2BH8 A;  4APV A;  3UDG A;  1VQG A;  1WOC A;  2ZTE A;  3ULJ A;  1PYS B;  1YEZ A;  4GKK Q;  1FL0 A;  2F4V Q;  3PUX A;  3I2Z A;  1MIU A;  4LUZ A;  4DR3 L;  4JI7 L;  1UE7 A;  2N8N A;  4L5R C;  3HOU H;  2OCE A;  5FLX c;  1NTG A;  1Q46 A;  1EFW A;  4GOP B;  3PF4 A;  4PZ6 A;  4A3D H;  1UEB A;  2QEX A;  4LUO A;  3A0J A;  2CFM A;  2EIF A;  2NVY H;  4OWX B;  2UUA L;  2CCZ A;  4LFC Q;  1LUZ A;  1I94 L;  2D0O A;  3S24 A;  1UWV A;  5GQO A;  2JA5 G;  4LFB Q;  1G51 A;  2PI2 A;  5FJ8 H;  4DV6 Q;  4HIO A;  1Q7Y C;  1E1O A;  4A3M H;  1IBM Q;  2CKZ B;  5FLM G;  5HGQ A;  5C4X H;  4NXN Q;  3HOV H;  5M5Y H;  3HOZ G;  5C4J H;  2E2H H;  3S15 H;  2K50 A;  3ULP A;  2XGT A;  1BVS A;  2E2I H;  2Q2H A;  5M3F G;  4LF7 Q;  1TWA H;  4B3R L;  1PH2 A;  4QQB X;  2E2J H;  4A93 G;  2JA9 A;  5DLQ E;  3MEF A;  5K36 G;  2NVQ H;  1VQM A;  1VQC A;  1BBU A;  1Y14 B;  4B3M Q;  4IFD G;  2UXC L;  1WCM H;  3NBH B;  1VQ5 A;  2OWO A;  4DR6 L;  2VQF Q;  3PF5 A;  2YYZ A;  3E9H A;  2GVB A;  1KIX A;  1A0I A;  2HIV A;  5AJ3 L;  4DV3 Q;  2NZH A;  3M4P A;  5GAH C;  4JI2 L;  4LW1 A;  1O7I A;  3GTL H;  4LFA Q;  1XNQ L;  2JE6 I;  1XMO Q;  1CKO A;  2MFI A;  3D31 A;  4X62 L;  2NVT H;  1I50 H;  3HKZ E;  4ALP A;  4JV5 L;  3CQZ H;  1HNX Q;  1MJE A;  1AH9 A;  1KL9 A;  3T1H Q;  4LF6 L;  4POG A;  1VQP A;  4JI6 L;  1VQH A;  2DUD A;  3M3Y H;  5C44 H;  3KJP A;  4J15 A;  1VQL A;  1YVC A;  4A3J G;  4A3G H;  2B63 H;  1NMG A;  3G48 A;  3KOJ A;  3MXN B;  1QUQ B;  4A3K H;  2WAQ E;  5LMN Q;  4DR3 Q;  1K8A C;  2I5H A;  2UXD Q;  3A74 A;  2KHI A;  1XPU A;  3HKZ G;  4GLA C;  3CF5 A;  1C7Y A;  3PO3 H;  3CCM A;  3OW2 A;  1E24 A;  2PMZ E;  4P74 A;  3G6E A;  5LMU L;  4C2M H;  1PA6 A;  3TS0 A;  1K3R A;  2VUM G;  1Y1V H;  4OWT B;  4P73 A;  3W1G A;  5M5X H;  5IYB G;  5JJK A;  4BBR H;  2I0Q A;  1JB7 A;  3CC2 A;  3PV0 A;  3UDF A;  2NZO A;  3HOW H;  3PO2 G;  1KHI A;  5IYC G;  1LM0 A;  3G4S A;  3VDY A;  3J81 j;  1SN8 A;  2WAQ G;  4HJ9 A;  3EBE A;  4R4Q A;  4YY3 Q;  3TS2 A;  4IOA A;  1SRU A;  2WP8 J;  3A5Z B;  3B6Y A;  3U50 C;  1W2B A;  2YV5 A;  4PG3 A;  2PNH A;  5IY0 A;  3GTP H;  4R4T A;  2YTY A;  1HH2 P;  3HOY G;  2A19 A;  3CMA A;  3I55 A;  1Q86 C;  2VS1 A;  4BY1 G;  1CUK A;  4DK3 C;  5IP7 H;  3AYH B;  4AQY L;  4JYA Q;  4YHH Q;  1OXS C;  3K8A A;  1I6H H;  5IYD H;  1FJG L;  1G29 1;  1X3G A;  3TEH B;  3T1Y L;  2N3S A;  5AJ3 Q;  3GTM H;  4DV7 L;  2CWP A;  3CCE A;  4JI2 Q;  4A3C G;  2R6G A;  2E5L L;  2JA7 H;  3I4N G;  1U0L A;  4NPS A;  4YWM A;  3F2D A;  1XNQ Q;  2Q2U A;  1MJC A;  5C0X J;  4X62 Q;  3J81 c;  3RN2 A;  2UXD L;  4JG2 A;  2HHH L;  3M7N A;  5M3M G;  5LMN W;  3FKI H;  4NXM L;  2UUC Q;  2GVA A;  4MZ9 A;  1KAW A;  4JI6 Q;  2UXB Q;  4KHP L;  3H3V H;  2RHS B;  2IHE A;  4DR7 L;  4YCV A;  1PV4 A;  4MNO A;  4A3F H;  4KLK A;  1B70 B;  1GVP A;  4QIW E;  1EOV A;  4B3T Q;  4IOC A;  3H15 A;  3HKS A;  2ALY B;  4EX5 A;  3S1M H;  3UDI A;  4JBJ A;  3RLF A;  4BXX H;  3GO5 A;  1YHQ A;  3I4N H;  5JEA J;  4LF4 Q;  4Y52 H;  1GO3 E;  2GN5 A;  3ULL A;  1P16 A;  1PH7 A;  1N32 Q;  4P71 A;  4P72 A;  4EQ5 A;  1PH9 A;  3TRE A;  4A3I H;  3M85 A;  1X56 A;  3GTG H;  3IRB A;  1FGU A;  1XPR A;  3BU2 A;  2VQE L;  4JC0 A;  3J80 c;  1HR0 L;  5C3E G;  4Y7N H;  4X66 Q;  1B8A A;  3CPF A;  5IWA L;  1TWF H;  2MO0 A;  4LF9 Q;  1EUJ A;  1PHJ A;  1VQO A;  4UP7 A;  1WI5 A;  1EQQ A;  3L2P A;  4GOP A;  2R7Z H;  1PFS A;  3GD7 A;  1CKN A;  2UUB L;  1K8G A;  1L1O C;  1N36 L;  3CCR A;  4JI8 L;  4C3H H;  2R7D A;  3KDF B;  1BBW A;  3CME A;  1XMQ Q;  4DR2 L;  4BBS G;  1CKN B;  3HOX G;  1X65 A;  3M4Q A;  1N9W A;  4HIM A;  3H0G G;  3GTJ H;  4DV7 Q;  1OTC A;  4JI5 L;  4BA1 I;  2IHF A;  4A4I A;  1VQF A;  2AKW B;  4PMW A;  1XNR Q;  4DR5 Q;  4LF5 Q;  1J6Q A;  1L1O B;  2ES2 A;  1KC8 C;  1WYD A;  5C0X G;  1YJ9 A;  4L5S A;  2BH2 A;  4NXM Q;  4LWC A;  2D0P A;  5H1S E;  4A3E H;  5E7N A;  1BKB A;  2HQL A;  2JA6 H;  3RZO H;  2RHQ B;  1ASY A;  4O0A A;  3PUY A;  2FXQ A;  2Z0S A;  4GNX B;  1UE1 A;  3LGJ A;  1S72 A;  4JI4 Q;  3HOU G;  2QA4 A;  3CXC A;  1KD1 C;  1N8R C;  5IT9 c;  3RR5 A;  3RZD H;  1N33 L;  4A3L H;  1JJG A;  4UPA A;  1I5F A;  3S14 H;  4R4O A;  4A3D G;  4JOI C;  3PCO B;  3RN5 A;  1AE2 A;  1DGS A;  4JI3 L;  1Y1W H;  5JJL A;  3F8T A;  4X65 L;  4A76 A;  3AQQ A;  5JEA G;  2UU9 L;  4GN5 A;  2ZTD A;  5FJ8 G;  3CAM A;  4DV5 L;  4JOI A;  5IP9 H;  4A3M G;  1ASZ A;  2JA8 H;  1VQ9 A;  3CCL A;  3BJU A;  1U5K A;  5C4X G;  2KCM A;  2RCN A;  4OXP A;  3HOV G;  3JAM i;  1HR0 Q;  1VQA A;  1QUQ A;  1NJI C;  4PZ8 A;  2ZM6 L;  2K5V A;  1HNW L;  3GTK H;  2CQO A;  2JJQ A;  3WWV A;  3CC7 A;  4DV1 L;  1VQD A;  1N34 L;  4JI7 Q;  1UE5 A;  4GS3 A;  1WCM G;  2UUB Q;  3AFP A;  3FP9 A;  5ELO A;  1K0R A;  1VQN A;  1MKH A;  4JI8 Q;  4DV0 L;  1VQJ A;  4DR2 Q;  4GKJ L;  1OXU A;  4KHZ A;  4A75 A;  2VNU D;  3CP0 A;  2ZJP A;  3HFZ B;  3M9B A;  2R92 H;  1HZ9 A;  2R7F A;  2UUA Q;  1YZ6 A;  3K81 C;  1T9H A;  2KEN A;  2L15 A;  1I94 Q;  1LTL A;  5GRO A;  1HZA A;  4HIK A;  2B3G A;  4QY7 A;  2N78 A;  4JI1 L;  1M90 C;  1IBK L;  3FHW A;  1Z9F A;  2VL6 A;  4JCV E;  4DR4 L;  5IE8 A;  4HJ5 A;  1E1T A;  2ZJR A;  2Q2T A;  5C44 G;  1RIP A;  1SMX A;  1CKM A;  2AHO B;  5ELN A;  4A3G G;  3KYH C;  4LF8 L;  1D8L A;  3EIV A;  3KF8 B;  3PGZ A;  4DR1 L;  4DV2 L;  1CSP A;  4C3J H;  4A3K G;  2VZA A;  1EIY B;  4IO9 A;  2ID0 A;  4YCU A;  1IBL L;  4DUY L;  3PO3 G;  2UXC Q;  2ZJQ A;  2JK8 A;  1QZH A;  2K4K A;  3I4M G;  3W1B A;  2PQA B;  2YU9 H;  4DR6 Q;  1Y1V G;  1CSQ A;  1JT8 A;  4WJ4 A;  1VQ8 A;  4BBR G;  3GTQ H;  1HR0 W;  3TRZ A;  3F2B A;  1B7Y B;  1UE6 A;  3HOW G;  2MO1 A;  2RF4 A;  1W3S A;  4HJ7 A;  1PH8 A;  4JV5 Q;  3S1Q H;  1S3O A;  4DV5 Q;  1NE3 A;  4HJ8 A;  4AH6 A;  4GLX A;  1A62 A;  4GKK L;  1WJJ A;  5M5W H;  1JMC A;  2F4V L;  4AYB E;  5J3B A;  2AMC B;  4LF6 Q;  1PH3 A;  4DNI A;  3KF6 B;  1R9T H;  3KLW A;  2ATW A;  2DGY A;  1HZB A;  3UE1 A;  1XTD A;  2ZM6 Q;  3ICE A;  1X3F A;  4R4C A;  1YJN A;  4K0K L;  1WFQ A;  3RLN A;  3STB C;  2AWO A;  4A3B H;  5IP7 G;  1YIT A;  4BY7 H;  2R93 H;  4TQU S;  4DKA C;  1VQB A;  3Q8D A;  4UY8 C;  5LMU Q;  1EQR A;  4DV6 L;  4DUZ L;  1PVO A;  1OXV A;  1SE8 A;  2IT1 A;  2N49 A;  3W5O A;  4AYB G;  1OXX K;  4UP8 A;  1IBM L;  4IPD A;  3SGI A;  1XJV A;  1J5E L;  2CWA A;  1H95 A;  2LXK A;  2JA7 G;  3D0F A;  1SRO A;  3GDE A;  3I7F A;  1HNZ L;  4O2D A;  4JI0 L;  4DAY B;  3RNU A;  4LF7 L;  4IFD I;  4JI1 Q;  1IBK Q;  1IZ6 A;  3FKI G;  4QJF A;  1SR3 A;  1IYJ B;  3TQY A;  3CCJ A;  1E7Z A;  2MQH A;  3PUW A;  4XTC S;  4LUV A;  2VY3 A;  1YI2 A;  1Q82 C;  2K5H A;  3S1N H;  1X3E A;  3KDF A;  4L5Q A;  4A3F G;  3CC4 A;  2VQF L;  3CW2 C;  2AWN A;  2H5X A;  1VQ6 A;  1K73 C;  3I4M H;  4DR1 Q;  2WB1 G;  1TWH H;  4X64 L;  1NY4 A;  3BZC A;  4LFA L;  1NBW A;  5HY6 A;  2C35 B;  1KRS A;  1E3P A;  3UE0 A;  2OQK A;  4DUY Q;  4AQY Q;  1VQ7 A;  2JA5 H;  1SFO H;  1M1K C;  1E22 A;  3PUZ A;  1FJG Q;  3T1Y Q;  1Q1B A;  2ASB A;  1PH4 A;  4B3S L;  4GNX C;  1L1O A;  3T1H L;  1JJ2 A;  4A3I G;  5FLM H;  4X6A H;  1X55 A;  1TWC H;  2E5L Q;  1XPO A;  2XTI A;  3HOZ H;  4OON A;  4MTN A;  1A8V A;  1HJP A;  2LXJ A;  3K0X A;  2HHH Q;  2JEA I;  1JE5 A;  4DAM A;  5M3F H;  3KFU A;  1FVI A;  1Q1E A;  4A93 H;  4GNX A;  1YIJ A;  4QGU A;  5LMN L;  4IPG A;  5BR8 L;  4WJ3 M;  1G6P A;  1C9O A;  1K9M C;  2IX1 A;  2BA1 A;  4KHP Q;  2Q2I A;  4NXN L;  1VS0 A;  4DR7 Q;  2R7Z G;  3U4V A;  2KBN A;  2YTX A;  4HID A;  4K0K Q;  1TWG H;  4KI0 A;  1GKH A;  1Q8K A;  3STB D;  3DLL A;  3G71 A;  4OX9 L;  2KHJ A;  4DK6 C;  2PI2 E;  2MNA A;  1YBY A;  4DUZ Q;  4HJA A;  1PH5 A;  2Y0S E;  3DM3 A;  1L2F A;  4PZ7 A;  1J5E Q;  1V43 A;  4YY3 L;  2KCT A;  2K14 A;  3CCQ A;  4FDB A;  1HNZ Q;  3GTO H;  3UDX A;  2IX0 A;  2OTL A;  4JI0 Q;  2VQE Q;  2NVX H;  4A3J H;  4IPC A;  4QL5 A;  1P8L A;  2OQ0 A;  1D7Q A;  4DPG A;  4RG1 A;  4A3E G;  2NN6 G;  4DV4 L;  5IWA Q;  1GM5 A;  4IJH A;  2JA6 G;  1C0A A;  2A1A A;  4OO1 G;  3KJO A;  4JYA L;  4YHH L;  1AE3 A;  1GD7 A;  2Y0S G;  4AIM A;  3J81 i;  2I5M X;  2QGQ A;  3E0E A;  2VUM H;  3EN2 A;  4OWW B;  3J7A 5;  5IYB H;  1N36 Q;  4NB3 A;  4A3L G;  5JJI A;  1EWI A;  4XIG S;  4X64 Q;  3PUV A;  4P75 A;  3PIO A;  1HZC A;  3F2C A;  4ME3 A;  1S40 A;  1QVG A;  1Y1W G;  4B3R Q;  3PO2 H;  2OTJ A;  5IYC H;  5EAY A;  2D62 A;  2IY5 B;  2I5L X;  2WFW A;  1N34 Q;  3S17 H;  3AFQ A;  3L7Z C;  3PIP A;  3ERS X;  3OTO L;  1V1Q A;  2V1C C;  4R1J A;  1X9N A;  1VQK A;  3OYY A;  2UUC L;  2JQO A;  4B3S Q;  4JI5 Q;  2UXB L;  2JA8 G;  5IP9 G;  4LF5 L;  4IJL A;  4LNQ A;  3HOY H;  1VQ4 A;  1L0W A;  4B3T L;  4YWL A;  3ZJY C;  5BR8 Q;  4BY1 H;  4BA2 I;  3K7U C;  4GLV B;  4YCW A;  4LF4 L;  2PQA A;  1OXT A;  1N32 L;  3I4O A;  2F52 A;  3J80 i;  2HT1 A;  1IL2 A;  2YTV A;  2VW9 A;  1N33 Q;  4POF A;  4A3C H;  1YNX A;  5GAG C;  3CCU A;  3A5U A;  3K80 C;  4OX9 Q;  2Z6K C;  4JI3 Q;  3F1Z A;  4IPH A;  3BZK A;  1TXY A;  4GN4 B;  4X65 Q;  4JBM A;  2R92 G;  3H3V I;  5M3M H;  1Q81 C;  4X66 L;  4TVA B;  1YJW A;  4JBK A;  3KF6 A;  2UU9 Q;  4C3I H;  4LF9 L;  2Z6K A;  1EYG A;  1Z47 A;  2B29 A;  1YHA A;  2F3I A;  4YWK A;  1SLJ A;  1PH6 A;  3S16 H;  4DV4 Q;  1VQE A;  4L5T A;  1XMQ L;  1NMF A;  1HNW Q;  1EIF A;  3M4O H;  3RLO A;  2EQS A;  1VQI A;  2LSS A;  1QZG A;  3JAM c;  1YHB A;  1JJC B;  4H02 A;  2K52 A;  4R4I A;  4LFC L;  1KRT A;  4DV1 Q;  2ZTC A;  3S1R H;  1RL2 A;  1PH1 A;  1IXR A;  3CD6 A;  4LFB L;  1LYL A;  1V9P A;  3NEL A;  3NEN A;  5IYD G;  5C0X I;  3U58 A;  2A8V A;  4DV0 Q;  1XNR L;  4BXX G;  4DR5 L;  4GKJ Q;  3JC6 6; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...