3H0GH

Rna polymerase ii from schizosaccharomyces pombe
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
SESVLLDEIFTVTSVDKQKYQRVSRITAVSGQNDMNLTLDINSQIYPLEKDATFSLQITSNLNSPDLKEAADYIMYGKVYRVEEAKDEKVSVYVSFGGLLMAIEGSHRKLYRLSLDHVYLLLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit rpb1
publication title Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
pubmed doi rcsb
total genus 14
structure length 124
sequence length 124
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3h0gH00
2QA4A 4GLAC 3PGZA 3RLFA 4LF7Q 3K8AA 4LF4L 4DR4L 2D0PA 1VQ9A 3VDYA 3GDEA 3JAMi 1BBWA 1VQBA 1PH9A 1Z47A 1WOCA 3CCUA 2K5HA 4LF4Q 3AFQA 4A3EH 3B6YA 3S1MH 4DNIA 4DV1L 2NVYH 1UEBA 2ES2A 4JI6Q 3GTOH 5M3MG 1EUJA 1KQSA 3CQZH 5IYDG 2ALYB 3EIVA 3NEMA 4P74A 4GNXA 2WP8J 2Z6KC 4GN3B 2BA1A 1PH5A 4GKJQ 2YYZA 1EYGA 4OO1I 3PCOB 1N33L 4X64L 3RN2A 2KHJA 3I4OA 5C0XJ 2A8VA 2MO0A 4UPAA 3GTPH 5M3FG 4KHPQ 2IX0A 2K75A 1YZ6A 3NENA 1N33Q 5JJKA 1X55A 4JC0A 4YCVA 1L1OB 1XMQQ 3CXCA 1ASYA 5C4XH 1YJ9A 1I94L 3HOZH 2R92G 2R92H 1WJJA 4DR1L 4DV5Q 1NJIC 4A3DG 4OX9L 4A3DH 3HOYG 4DR5Q 2ZM6L 4DR1Q 2QEXA 1K9MC 1X3FA 2A1AA 2N8NA 3AEVA 4L5SA 3MEFA 2RHSB 2ZM6Q 2UUAQ 4BBSG 2N49A 2E8GA 4R4OA 3ERSX 4IFDG 4GKKL 2NZHA 4DV4L 1OXVA 2R7ZH 4RG1A 2JA8G 4RMFA 4BA2I 4X66Q 5GROA 1HNZQ 4GLVB 3FHWA 2I5HA 5JEAJ 5EAYA 3G6EA 4GKKQ 2VUMG 4DV4Q 2VUMH 2Q2IA 3KLWA 1MJEA 3I4MG 3H3VI 4YHHL 1CSQA 3PIPA 2VZAA 4R4CA 2L15A 4DV2L 2VQEQ 4QQBX 1A63A 1AH9A 4XIGS 4A3MG 2LXJA 2BA0A 1EFWA 4A3CG 4A3CH 3HKZE 3T1YL 2EQSA 4YHHQ 1VQ7A 3D31A 1XPOA 2KCTA 2FXQA 4BY1G 1C7YA 1OTCA 4BY1H 1FGUA 2BH2A 4LW1A 1OXXK 4AQYL 1EQRA 3OW2A 2B63H 2B63G 2YTVA 1LYLA 5M5WH 3U58A 3Q8DA 4O0AA 1X56A 4OONA 1IBLL 2IHEA 2ID0A 3U4VA 3L0OA 4DUYL 3ER0A 3TS0A 1VQKA 1UWVA 2JJQA 1TWCH 3KFUA 1SRUA 1NMGA 1IBLQ 5ELOA 4DUYQ 2ZJRA 3GTLH 1VQHA 2VW9A 1MKHA 3W1BA 1VQ6A 1EIYB 3S14H 4YWLA 4P71A 1SLJA 2UXBL 1X3EA 1CKMA 3CCMA 2E2JH 2AKWB 1G51A 3F2CA 1G6PA 4DV0L 4LUZA 1Q1BA 3CCJA 2Q2HA 5IT9c 1Y1VG 1K83H 2ZJPA 4DUZL 1YEZA 1X54A 4H02A 5IYCH 3PO2G 1UE7A 3J81j 1IBML 3A5ZB 1Q7YC 1GO3E 1I50H 2V1CC 4GN4B 2OTJA 4DUZQ 3DLLA 4AH6A 2E5LL 3RNUA 4K0KL 2CWPA 1YHBA 1SN8A 3UDFA 1M90C 4OO1G 4C2MH 3T1HQ 4JCVE 4P72A 1HR0Q 1A8VA 1IBMQ 4DR7L 4PZ8A 2OWOA 1E1OA 2UUBL 3S15H 3S1NH 4L5QA 1JMCA 2E5LQ 4L5RC 5C44G 5C44H 1YHAA 2K50A 3JC66 2E2IH 1Z9FA 3GTMH 2WAQG 4DR6L 2VNUD 4DR2L 2UUBQ 3RR5A 3BZCA 4P75A 1YBYA 1X9NA 3HOVG 2ZTCA 3PV0A 1NY4A 2QGQA 4PMWA 4DR2Q 2HHHQ 1YJNA 3UE1A 2XTIA 1WFQA 3FKIH 3FKIG 4DV3Q 4LF7L 1HJPA 1J5EL 1E7ZA 3MXNB 1W3SA 1HR0W 1D7QA 3E9HA 4XTCS 2JA7G 4JOIA 1K73C 4B3ML 5JJIA 1VQ4A 2Q2TA 3W5OA 1GD7A 3RN5A 1J5EQ 1K0RA 5GAHC 3H0GH 3H0GG 4LFCQ 1IBKL 3F8TA 4IPCA 2VQFL 4JI6L 5FLXc 2PMZE 4C3JH 3KJPA 4B3MQ 4A75A 4LF5L 4NXML 4UY8C 2R6GA 1OXUA 4GKJL 3UDIA 3CW2C 1PH7A 1IBKQ 1RL2A 1VQGA 2VQFQ 3H3VH 5M3MH 1KAWA 1QUQB 1QZGA 3ZJYC 4LF5Q 1E1TA 1VQPA 5IYDH 1E24A 2BH8A 1VQNA 1E22A 3CCQA 4B3TQ 5GQOA 4KHPL 1VQFA 2R7FA 3FP9A 3CC7A 1JE5A 1LUZA 5GAGC 1WCMG 1I5FA 4DK3C 4C3HH 4DKAC 5M3FH 1XMQL 2ATWA 3CPFA 1KC8C 2Y0SG 1VCIA 4NXNQ 1TWAH 4DV5L 3I7FA 1VS0A 3S2HH 1VQDA 4HIDA 5JJLA 3K7UC 3S1QH 4DR5L 1GKHA 1JJGA 5LMUQ 2B3GA 2C35B 1QUQA 2JE6I 2VL6A 4IPHA 3K0XA 4JI1L 2AHOB 1YNXA 3A5UA 1ASZA 1B70B 2NZOA 3HOYH 1W2BA 4NXMQ 3K7AH 3J81c 2UUAL 4LWCA 4A3KG 1CUKA 1N34Q 3L7ZC 4HIOA 4JI1Q 3I4NG 4DV6L 3TS2A 3U4ZA 1TXYA 4R1JA 4LNQA 4JYAL 1YITA 4LF6L 2Q2UA 2CWAA 1KRTA 4X66L 2YTXA 1VQOA 1HNZL 4DV6Q 4AYBG 4BBRG 1XNRL 4JYAQ 4DPGA 1WYDA 1FVIA 4KLKA 2JA8H 2N78A 1HZBA 2JK8A 1PH4A 3CC2A 4LF6Q 4BBSH 1G291 4OXPA 1OXSC 4DR3L 2E2HH 5GAEC 1VQJA 3UDXA 2VQEL 1KD1C 1VQLA 1XNRQ 4BY7G 4BY7H 3I4MH 3HOUG 1PYBA 4DR4Q 2K14A 1CSPA 2I5MX 4JI3Q 1IXRA 4DR3Q 4HIKA 1A0IA 3OTOQ 3KOJA 4A3MH 4A3FG 1C9OA 2CQOA 1CKNB 1XPUA 4A93G 3SGIA 3AQQA 3JAMc 2DGYA 4QL5A 1PH2A 1U5KA 4MZ9A 4FDBA 4OWTB 1Q1EA 3UDGA 2WAQE 4EQ5A 3GTJH 5M5YH 1UE5A 2VY3A 5IE8A 1T9HA 1HNXL 5H1SE 3TQYA 3KDFB 4GOPA 3F1ZA 1XJVA 1SROA 4A3GG 5C4JH 4HJ5A 2RCNA 1HNXQ 1X3GA 1GM5A 2ZTDA 1VQEA 3CF5A 3L2PA 1CKNA 2OTLA 4O2DA 3G4SA 3A0JA 4OWWB 1K8GA 3PIOA 1Q86C 2KHIA 1PH6A 1X6OA 3IRBA 3M4OH 1XTDA 3KF8B 3ICEA 4JOIC 4QY7A 4QIWE 1N9WA 1D8LA 2HIXA 2IT1A 1VQIA 3RLOA 1SR3A 3KDFA 3J80i 4A3JG 1PV4A 5C3EG 4JBKA 1Q82C 3F2DA 1FJGQ 4R4TA 2AWOA 4AIMA 4PZ7A 2PQAA 2KENA 1Y1VH 3PUZA 1U0LA 5IYBH 5IYBG 5HY6A 3PO2H 1BVSA 3T1HL 1HR0L 3BU2A 4MNOA 3ULLA 2HQLA 5HGQA 4IPGA 2HIVA 1TWFH 1IYJB 4B3SQ 1PVOA 1OXTA 2K4KA 2Y0SE 1PYSB 1QVGA 5IP7H 5IP7G 1MIUA 2ASBA 3TREA 1PFSA 5K36G 3NBHB 1Y1WG 1VQ8A 2I0QA 4DK6C 2HT1A 1CKOA 2GVAA 4R4IA 4JBMA 1KXLA 4TVAB 2JA5G 2HHHL 2LSSA 1L2FA 3I55A 2OQKA 3PF5A 1VQ5A 1KHIA 3H15A 2ZJQA 3EBEA 5BR8L 3HOVH 4A3LG 1SFOH 4A3LH 4DV3L 1Y14B 5M5XH 3CPWA 1YJWA 3PUYA 4GN5A 2NN6I 3PO3G 1X65A 5BR8Q 4QJFA 5FJ8H 5FJ8G 4IO9A 3RZDH 4ME3A 4JI2L 1XNQQ 3PF4A 4IOAA 3RLNA 4LFCL 4DAMA 1Q81C 1N36Q 2JA7H 3NELA 1NMFA 4JI8L 2OCEA 2K52A 4AYBE 4JI2Q 3M3YH 1IZ6A 2AMCB 2F52A 1N32Q 3I2ZA 5IP9G 5IP9H 3GTGH 3M4QA 4JI8Q 3ULPA 4JV5Q 1JT8A 4OWXB 3J7A5 4BXXG 1XMOL 2PI2E 1JB7A 2K5VA 1NE3A 1P16A 2CKZB 1JJ2A 4B3TL 3STBC 2JEBI 1LM0A 2A19A 4JBWA 1XMOQ 3PUVA 1JJCB 1Q46A 3AFPA 4DV7Q 4HJ7A 2PNHA 4IJLA 2RF4A 5GADC 4NXNL 1K8AC 2AWNA 1HH2P 1YIJA 4JI5L 1WCMH 4LUOA 4JI0L 4EX5A 5C0XI 1A62A 1S3OA 2JA9A 2F3IA 3PUWA 3M4PA 5LMUL 3DM3A 4GOPC 1HNWL 2JQOA 4JI5Q 1S72A 4JI0Q 2UXDQ 1EOVA 1L0WA 3HOWH 3HOWG 2JEAI 4JI7L 1QZHA 3ULJA 2OQ0A 3HKSA 1HNWQ 4A3EG 1N34L 1MJCA 1E3PA 3W1GA 1EIFA 4TQUS 3CCEA 3UE0A 2Z0SA 2UU9L 3CAMA 3TEHB 2UXDL 4KHZA 1PH3A 4JI7Q 3PUXA 1Q8KA 3CCRA 4A3KH 3I4NH 3EN2A 2RHQB 4DV1Q 2UU9Q 3CCSA 1TWGH 1PH8A 1LTLA 1PHJA 2ZTEA 1KIXA 3S1RH 1B8AA 2R7DA 2WB1G 4P73A 2VS1A 4X64Q 4BBRH 1KL9A 3AYHB 4YCUA 1NBWA 1IL2A 4A3BH 5IWAL 3GO5A 4A3BG 4JI3L 3J7ZC 5C4XG 4UP8A 1FL0A 4UP9A 3HOZG 4GOPB 3OTOL 3BZKA 3LGJA 4A3IG 4A3IH 3HOUH 2D62A 2XGTA 4JI4L 3G48A 2B29A 1HZ9A 2EIFA 5IWAQ 4Y52H 1I94Q 1SE8A 2IHFA 3K81C 4L5TA 1O7IA 1VQAA 1J6QA 4A3FH 4HJ9A 4OX9Q 4A93H 4JI4Q 1M1KC 4LF9L 4ALPA 5E7NA 4DAYB 3KJOA 2NVQH 3CP0A 3G71A 2IY5B 4X62L 3CCVA 4BA1I 2GVBA 1L1OA 1PH1A 2MNAA 4PZ6A 2JA6G 4J15A 5FLMG 5FLMH 3GD7A 4POFA 4LF9Q 4QGUA 1QVCA 3S17H 4IJHA 1NTGA 1PA6A 5LMNL 3TRZA 4WJ3M 4X62Q 3A74A 1DGSA 2R7ZG 4JBJA 3RZOH 4B3RL 2CFMA 4A3GH 2R93G 1AE3A 2R93H 2N3SA 2YV5A 1N8RC 4NB3A 1YVCA 2PQAB 4UP7A 5LMNQ 2YTYA 2YU9H 1YHQA 2LXKA 4B3RQ 2NN6G 2NVXH 3CD6A 4HJAA 1YI2A 2KBNA 2K5NA 4A76A 1P8LA 2F4VL 4X65L 1SMXA 4IOCA 2D0OA 3PSIA 2Z6KA 4C3IH 1XPRA 1FJGL 2NVTH 4DV2Q 3CCLA 5DLQE 2DUDA 4A3JH 2F4VQ 1UE1A 4X65Q 3GTKH 5C3EH 3T1YQ 4YY3L 3OYYA 4LFAL 1V9PA 4A4IA 3CMEA 5AJ3L 4JG2A 1I6HH 3M9BA 2MO1A 1UE6A 1B7YB 4YY3Q 4GLXA 4AQYQ 4LFAQ 4YWMA 5LMNW 4B3SL 1Q12A 4GS3A 4KI0A 3M85A 2EXDA 1QVFA 5AJ3Q 3S16H 4YCWA 1I3QH 2UUCL 3HFZB 2IX1A 3M7NA 2MQHA 4LUVA 4HIMA 4APVA 4X6AH 3WWVA 1WI5A 2MFIA 4NPSA 1H95A 5C0XG 3D0FA 2UUCQ 3CMAA 1Y1WH 2JA6H 4IFDI 4IPDA 3BJUA 1V1QA 4PG3A 5J3BA 2JA5H 2UXBQ 2UXCL 4YWKA 1XNQL 1S40A 5IYCG 1EQQA 4DV0Q 2UXCQ 4LFBL 1N36L 4GNXC 1R9TH 4LF8L 3PO3H 3E0EA 1N32L 4LFBQ 1TWHH 2WFWA 2H5XA 1KRSA 2WB1E 3KF6B 4LF8Q 4JV5L 1HZAA 3S24A 1C0AA 3HKZG 5IY0A 4K0KQ 3E9IA 3U50C 4IFDJ 2KCMA 3S2DH 1BBUA 4WJ4A 4DR7Q 3J81i 2PI2A 2GN5A 1K3RA 3CC4A 2CCZA 1VQCA 1GVPA 1EWIA 5ELNA 3GTQH 4BXXH 1VQMA 3STBD 3KYHC 4DV7L 4DR6Q 1RIPA 5JEAG 3I56A 2I5LX 3HOXG 3HOXH 3K80C 3J80c 4R4QA 4MTNA 1HZCA 3KF6A 4HJ8A 1V43A 1BKBA 4Y7NH 4GNXB 4POGA 1AE2A 1L1OC 3F2BA
chains in the Genus database with same CATH superfamily
1VMPA 4GLAC 4CKBA 1VQ9A 3VDYA 2N55A 3DEOA 1K28A 1WOCA 4FVMA 4ZCKA 3ZYYX 1PTOF 2SNSA 1H9MA 1RF2D 3QB3A 4A3EH 1RD9D 3QG1A 2B39A 2ES2A 5C3WA 4NDXA 1EUJA 3CQZH 3D4RA 1PH5A 4P74A 2Z6KC 2DN8A 2YYZA 1PRTF 3FPUB 4XYQA 2EYHA 3I4OA 1RTOA 4UPAA 1LTID 4KHPQ 1MHWC 3H3VC 3NENA 1GOZA 1X55A 1L1OB 1XMQQ 1YJ9A 1I94L 2PW7A 1NJIC 3HGBA 4OX9L 1S5ED 2NTTA 1HFNA 3HOYG 2A68C 2VXWA 3URYA 2K03A 2N8NA 3AEVA 2F0UA 3T51B 3MEFA 2RHSB 2ZM6Q 1DCZA 3SEBA 2E8GA 3ERSX 4EQPA 4PMBA 1TKWB 1U4RA 5DM73 2QW7A 4ME5A 3CKIB 1ILPA 2I5HA 4GKKQ 3ITPA 3H94A 1CA6A 3MHBA 1LLRD 1F9SA 3PIPA 4R4CA 1A63A 1QNUA 1EEID 2DNCA 3HKZE 4RKLA 3N52A 1C7YA 2BH2A 1KLUD 1OXXK 3J7AF 3C2PA 2B63H 2B63G 2YTVA 5M5WH 4OONA 1X56A 1IW7C 2B8GA 2K28A 4DUYL 1IKMA 2JJQA 1STGA 1TWCH 4CJ0B 3KFUA 1SRUA 1CQVA 4HSVA 1MKHA 3CU7A 1EYAA 1SLJA 1CZGA 3MXUA 4AYBB 2UXBL 4DF7A 1X3EA 2F0MA 2E2JH 2AKWB 3GQBA 1BCPC 4BY7B 1Q1BA 2RCFA 3N6RA 4DUZL 5EPKA 3J81L 3J81j 2HUGA 4OIJA 4A93B 1Q7YC 1DM0B 2OTJA 4ZYSA 2EY5A 1SNQA 4NKLA 4X3SA 4OO1G 4OO1H 4JCVE 1IBMQ 2JA6B 4DR7L 3S17B 3S15H 4L5QA 2K7VA 2E5LQ 4X3TA 2OXPA 4HAEA 1YHAA 3JC66 4WJWA 4A3GB 2IL8A 2F03A 1SMYC 2NVXB 3EA6A 3OIPA 4DR2Q 5JEAH 4GZYC 3KBXA 5FK9C 4DV3Q 4DAVA 1E7ZA 3EQLC 3MXNB 1D7QA 3NBHA 4I65A 2J4XA 1VQ4A 2B2VA 1J5EQ 3F8TA 4LK1C 4B3MQ 5EPLA 1NSNS 2E75C 2QCPX 3CW2C 5IOCA 1SYCA 1ICFB 5IYDH 1GUWA 1E24A 4KHPL 3CCQA 2BOSA 3LNNA 1TS4A 1LUZA 1I5FA 1XMQL 2ATWA 1CM9A 4NXNQ 1SYFA 2HQEA 3BDLA 5LMUQ 2PO4A 4L6TB 2ICIA 4JI1L 2HCIA 2AHOB 3DHQA 1ASZA 5EKKA 2QEJC 2EYLA 3K7AH 5E4XA 1GXDC 1D2BA 4DV6L 3TS2A 3KBGA 3TMEA 4CGYB 1J9OA 1YITA 4HCEA 3BVGA 2YTXA 2B2YA 1L0YB 2EE1A 4AYBG 1XNRL 2JN4A 4KLKA 5L37A 1G291 1KD1C 1VQJA 4BY7G 4BY7H 4KMUC 1Y8NB 1CSPA 4DR3Q 1A0IA 3Q23A 1CKNB 3KLSA 3BS1A 4A93G 3SGIA 3AQQA 1HRJA 1UE5A 2VY3A 1PTOB 5H1SE 2F1MA 4GOPA 3S1MB 1ILQA 3JAME 1KDCA 2BDOA 4RKBA 4A3GG 4KTAA 4KY7A 3MA2B 1X3GA 1GM5A 2ZTDA 5J22A 1PRTB 1EWCA 1CKNA 2BDNA 4O2DA 3A0JA 2KECA 3GTPB 1K8OA 1D6EC 1X6OA 1QB5D 1N9WA 5I6YA 1NUCA 2CH4W 1WTQA 1FJGQ 5E1FA 4UHVA 5EBDA 4AIMA 1C8CA 1WTVA 1GUTA 3GV6A 2KENA 1GJXA 5J39A 1BVSA 4OHJA 3BU2A 5JVG3 2HQLA 5EJWA 4IPGA 1Q90A 1UUPA 5EKIA 1IYJB 4KY6A 2K4KA 1PVOA 3K5OA 1PYSB 4RWSC 5IP7H 5IP7G 1MIUA 2ASBA 5IGGA 3TREA 2R7ZB 1PFSA 5EPJA 3WDNA 4DK6C 1CKOA 1SE2A 4R4IA 4HCSA 1QOHA 2LSSA 5HGTA 1L2FA 2ZJQA 2OQKA 3PF5A 4ZRZA 4DV3L 2MGSA 3CPWA 3PUYA 4C3IB 5EBCA 4DXFA 3RZDH 2Q8IB 5M9OA 3RLNA 1N36Q 2JA7H 3X3NA 1QJOA 4AYBE 4JI2Q 1IZ6A 3VYRA 1WVLA 3TSSA 4C1NK 3ULPA 1JT8A 1PLFA 1S4ZA 1XMOL 3T53B 1JB7A 1UEAB 2K5VA 1P16A 3QIAA 3GTLB 2JEBI 3VA7A 4QF4A 1Q46A 2PNHA 3LWUA 4IALA 4NXNL 5BN4A 4Q5VA 2OT2A 1YIJA 2QILA 4LUOA 4EX5A 4DU9A 2JA9A 3PUWA 3M4PA 5LMUL 5D3IB 1EY6A 4JI0Q 2HCCA 1L0WA 2A5HA 1PTOH 1R9TB 1I50B 1HNWQ 4K8JA 4TQUS 3UE0A 4KHZA 1PH3A 1IHZA 1A3UA 1Q8KA 3CRKC 3EN2A 1S5BD 2RHQB 4DV1Q 1BNZA 2ZTEA 1KIXA 1VF5C 4QB4A 4CKEA 4RGNA 4X64Q 3E0JA 2XVSA 3AYHB 1FL0A 3LGJA 1LO5D 3MZ5A 5A2QL 2Z4IA 4Y52H 5IWAQ 3K81C 5BN5A 3LWEA 4A3FH 4XQQA 4HJ9A 2NVQH 3CCVA 2GVBA 1PH1A 5FLMG 5FLMH 1NTGA 3OMGA 2R7ZG 3A74A 4U68A 4XDXA 1A3TA 1MGSA 1AE3A 1JC7A 2PQAB 1LTAD 4CBVA 2MHVA 2YTYA 4CDDC 2NN6G 2NN6H 2OF1A 4HJAA 1YI2A 1W6JA 1IKLA 1P8LA 5M3FB 4RCOA 2Z6KA 1ZKOA 4C3IH 4C3IG 3A56A 1FJGL 4DV2Q 3NHHA 3BYYB 3S1QB 2PZWA 5C3EH 1CFMA 3OYYA 4FXGC 4LFAL 1G8ZD 1GUOA 1LTRD 3BDOA 3T56B 5AJ3L 5ELDA 4AQYQ 3C1EA 1HCZA 4I7AA 4YWMA 3MXGA 4DK1A 1QVFA 3SK6A 4YCWA 2MQHA 4LUVA 4HIMA 4X6AH 3WWVA 2MP1A 5C0XG 5C0XH 2UUCQ 3CMAA 1Y1WH 4DFAA 3BJUA 3I4MB 2VUMB 1I4RA 1JB3A 1PFBA 5IYCG 4A3MB 1H9KA 4DV0Q 1KLGD 1N36L 4LFBL 1R9TH 4LF8L 1ET9A 2XWJB 1SNMA 4BY1B 3E0EA 3GTJB 1RHPA 5CYUA 1SNDA 2EY2A 4CKCA 1KRSA 3D8GA 5IY0A 4B9WA 2E74C 2GN5A 1EWIA 2A6HD 5ELNA 1VDZA 3I56A 3M4OB 2A69C 2X6GA 3K80C 3R2IA 4OEMB 2MJ8A 4HJ8A 1BKBA 3G6JB 4GNXB 2OWOA 3D6CA 3J80E 4LF7Q 3K8AA 3ERQA 1K83B 2D0PA 2Z4HA 3DWAA 2KEDA 4F87A 3PO2B 1JCKB 3AFQA 1D5ZC 3B6YA 4DNIA 3Q24A 4DV1L 2NVYH 4KV6A 1R4PB 1UEBA 2EZVA 4JI6Q 1STEA 2KQ3A 3NEMA 4GNXA 5C5MA 1JWUD 2WP8J 4GN3B 5T1IA 4OO1I 2WINB 4X64L 3RN2A 2KHJA 5IGDA 2A8VA 2MO0A 2IJ0A 1O7YA 3NQTA 5M3FG 1DONA 1D1KA 2KEEA 3HOVB 4JC0A 3CXCA 4M1UB 1ASYA 1SNPA 3HOZH 2R92G 2R92H 3SE0A 1RKNA 4DR1L 4ZUJA 4DV5Q 1G2TA 1TT2A 4MIUA 4CHTB 3E6ZX 1MSHA 3NWTA 4DR5Q 4DK0A 2O2LD 1M8AA 1F9RA 4F8MA 1T5XD 2Z9HA 2A1AA 3U9OA 4FXDA 1I4QA 1DOKA 2EXZA 4X3KA 5G3LD 2UUAQ 1CK1A 2N49A 1TIID 4DXGA 1STYA 1FR3A 2F0SA 3BYTB 4PNYA 4RG1A 3I3CA 4RMFA 4BA2I 3G6EA 5JEAJ 2VUMG 2VUMH 3I4MG 5COYA 3H91A 2L15A 4DV2L 2VQEQ 1AH9A 1B4OA 4A3MG 2BA0A 1ZXTA 5D65A 1LT4D 5ELFA 2EYFA 2LFNA 2FXQA 2XRQD 4BY1G 4BY1H 1PFMA 3I70A 1FGUA 5A35A 4AQYL 3OW2A 1CA5A 2F0GA 1IBLL 3U4VA 2ID0A 3TS0A 2F0QA 3K5LA 1IYUA 1WD1A 4A3KB 4FF3A 3I4NB 4OELB 5I4DA 4DUYQ 1TWGB 1G91A 2EPBA 1EIYB 3S1RB 3GV3A 4RH6A 2WV6D 1O78A 4ZKCB 2WACA 4MN3A 4BBSB 1G51A 5C6AA 2V4DA 4DV0L 4LUZA 3X3MA 3QOLA 2G9DA 5KEEA 5IT9c 1K83H 2ZJPA 2L11A 4H02A 3PO2G 1FYCA 3A5ZB 1GO3E 1AW7A 4DUZQ 1M90C 3UDFA 1HUNA 4C2MH 3T1HQ 1A8VA 2UUBL 1JMCA 5JOBA 3W3AA 2FJ2A 2K50A 2CH4A 1Z9FA 2RVLA 2PPBC 2K5WA 1X9NA 1YBYA 3HOVG 3T4AC 4DN4M 2ZTCA 3PV0A 1NY4A 2XIWA 3J7YW 2XTIA 2NVTB 4ID6A 2M00A 2VB2X 4LF7L 4K8IA 1HJPA 1HR0W 5FO7B 2KVMA 5E4WC 2E2DC 2PYKA 3H0GH 3H0GG 1TS5A 1IBKL 4IPCA 4JI6L 5FLXc 4RA8A 1CT1D 5I9OA 4RHSA 3TP6A 1OXUA 1DYQA 2F0LA 1I3QB 1Q3LA 4OGQC 1QZGA 1E1TA 1SYBA 1E22A 5GQOA 2F0TA 3FP9A 4DK3C 3CPFA 4ZLTF 1KC8C 1GHKA 2P5ZX 3NWSA 4DV5L 1SFOB 1VS0A 3AU7A 4HIDA 3K7UC 2FINB 3FVQA 4DR5L 1JJGA 1KNAA 4YIJA 3PO3B 1STNA 3K0XA 1YNXA 3FRPB 3HOYH 1TWHB 1W2BA 5G3LF 2UUAL 3DM1A 4A3KG 1N34Q 1EU3A 3I4NG 4HIOA 4JI1Q 2Z1CA 2JXMB 3S2DB 3U4ZA 4LNQA 4ODGA 1JOQA 3T13A 1VQOA 4DV6Q 3J81E 2K33A 2N78A 3CC2A 4BBSH 3MTSA 3HOXB 4BBSG 1I6HH 1AEXA 1OXSC 1Z6HA 2RDGA 5GAEC 2VQEL 2E2HH 1VQLA 3QR8A 1XNRQ 1A2TA 1IYVA 3HP3A 4RGTA 1LABA 4KD4A 3KOJA 1C9OA 3J7AV 2CW0C 2DGYA 2EOTA 1PH2A 5I9PA 4FDBA 2EDGA 3PMFA 1IW7D 1AFPA 3DXJC 3VR2A 3GTOB 1L0XB 3KLRA 2DY8A 1U9RA 3SR1A 4IUPA 3DWPA 3CF5A 1WTOA 3R8BA 3L2PA 3A8JE 3C1FA 4DAYA 4OWWB 3BVZA 3PIOA 1PH6A 1XTDA 3KF8B 4ZQ3A 1Y8PB 3EROA 4QY7A 1SNOA 1SR3A 1PV4A 5C4XB 1ESRA 1BCPD 3F2DA 1B50A 2AWOA 3NTHA 3MC0B 1VF7A 2E76C 1SBBB 3PUZA 4IUNA 3I91A 1U0LA 4HEDA 4FF4A 5HY6A 4ULLA 3T1HL 1BDOA 3ULLA 3KF8A 2HIVA 4NMZA 4B3SQ 4ZK9B 1FNVA 3NP8A 4IUUA 5KRUA 5K36G 5K36H 3NBHB 2O4XA 2I0QA 2HT1A 4QMGA 2R93B 1KXLA 3SK4A 4Q0FA 4JBMA 1B3QA 4TVAB 1SMYD 5KYLA 5FOBB 5BR8L 1SFOH 1YJWA 4IURA 2NN6I 4E6IA 2DNEA 3PO3G 1X65A 5FJ8H 5FJ8G 3PF4A 1LV9A 5LHY1 2OCEA 1BXTA 2L9HA 3VR5A 2F52A 2AMCB 4KKSA 3VYSA 3QWNA 2LS01 5JPNC 1SYEA 4HR7B 2EY1A 4J8QA 4LJZC 5JPMC 3STBC 3S14B 1A3VA 4JBWA 1XMOQ 5IIFA 3AFPA 4DV7Q 2SDFA 1STBA 2RF4A 1XWEA 2A6EC 1HH2P 2KCCA 4CJ2C 1I4GA 5C0XI 4EQOA 1S3OA 1SYDA 1PFNA 3P1HA 5DEHA 2IPKD 1EOVA 4JI7L 1QZHA 1N34L 3DWQA 1MJCA 1EIFA 2L5TA 1JWMD 5ELEA 1Z7TA 4XYOA 2HD3A 3PUXA 3CCSA 1Y69U 3NBIA 2E2IB 3GTMB 4CDEC 1LTLA 5CV4A 1W6KA 2R7DA 4N8FA 2NYZD 4P73A 3GTQB 2VS1A 1ENAA 1KL9A 4B08A 4YCUA 1IL2A 4BS9A 5C4XG 2A73B 3J7ZC 4UP8A 4GOPB 3TP7A 4JI4L 3G48A 2B29A 1HZ9A 4NW2A 3SVMA 3HZXA 1RODA 1SE8A 2IHFA 2NB0A 4L5TA 3K59A 1O7IA 1VQAA 1J6QA 4A93H 2RSOA 4LF9L 5KIXA 4ALPA 3KJOA 1SE4A 2IY5B 2D9UA 4J1MA 4X62L 4XT1B 1BQQT 4C3JB 2JA6G 2JA6H 2Q8RE 1EZ6A 3S17H 1QVCA 4H13C 4WJ3M 5LMNL 1KNEA 2KUMA 1EEFD 2CFMA 4A3GH 3ND8A 5M3MB 2R93G 2R93H 2N3SA 4NB3A 4UP7A 2CQAA 2NVXH 4CDCC 5I6WA 2K5NA 3P7JA 4C3HB 2F4VL 1SMXA 3PSIA 1BCPF 2FMCA 1TWAB 5DLQE 2DUDA 3S2HB 1HTLD 3RUZA 3T1YQ 5AFWA 4YY3L 3Q0AA 3CMEA 3IAYA 4A3DB 1EYDA 3M9BA 2MO1A 4N9PA 1F9PA 4GLXA 4LFAQ 3I90A 5LMNW 4B3SL 4KI0A 4GS3A 2EXDA 5AJ3Q 3VR6A 5C4HA 2MPMA 3HFZB 1SAPA 1QCBD 2MFIA 1H95A 2JA8B 2ZXPA 2F0PA 1H9JA 4HMJA 2WKDA 2UXCL 4K2KA 5M5YB 2R61A 2KOLA 4LFBQ 1ENFA 2WFWA 4LF8Q 3O13A 1HZAA 1C0AA 1X32A 4K0KQ 3E9IA 2KCMA 2PI2A 5C4JB 1Q8IA 4K6DA 5A2QE 3K0YA 2B2WC 3CC4A 1GVPA 3GTQH 2I07B 1VQMA 2PZUA 4DR6Q 1BR9A 4DV7L 3MAQA 2CHBD 2I5LX 3A55A 3TDQA 4MTNA 3R2TA 2EJMA 1HZCA 2PQEA 4K5WA 5KNDA 5D14A 4POGA 1AE2A 1L1OC 3PGZA 3RLFA 4L63B 4LF4L 1Y1VB 3P20A 5CV7A 3GDEA 4DNTB 1BBWA 4XQNA 1PH9A 4C3JG 1AZQA 1SYGA 5C5LA 3S1MH 1TWFB 1AN8A 1U4LA 5M3MG 5TSSA 1CI3M 3EIVA 4LMQD 4GKJQ 3S1NB 5C44B 1N33L 1JWSD 2WAQB 3GTPH 4C3HG 1FNUA 2RSNA 2IX0A 2K75A 1SSOA 5IT9L 4CJ1B 5JJKA 2PCFB 2F0DA 5DAUA 1WJJA 3TN2A 5DNFA 1K0SA 4A3DG 4A3DH 5CV5A 4DR1Q 3F2UA 3S9WA 1K9MC 1QILA 3M3YB 3I8ZA 3OPOA 1NR2A 4L5SA 1GUSA 4IFDG 4IFDH 1F9QA 4DV4L 1OXVA 4IN3A 2R7ZH 2JA8G 2EY6A 5GROA 4GLVB 3FHWA 5EAYA 2B2TC 2Q2IA 3KLWA 1EY8A 1MJEA 4YHHL 4V190 5K5PA 2EYPA 2VZAA 2EYMA 1EY4A 4QQBX 1WCMB 3T1YL 2Y0SB 1EQTA 3D31A 1D5MC 5FLXL 1C48A 4LW1A 1EQRA 3U58A 1H9SA 3Q8DA 4FP5D 1AZPA 3P75A 2IHEA 3L0OA 1VQKA 3ER0A 1BF4A 1UWVA 2ENBA 1DOLA 1NMGA 1IBLQ 3GTLH 4FF1A 1VQHA 2VW9A 1VQ6A 1DJRD 4P71A 1SNCA 2IX3A 4BBRB 2EJFC 1CKMA 4X3UA 4A3BB 1MD2D 5HURA 1ONLA 2O5IC 3HOUB 3CCJA 1Y1VG 1YEZA 1X54A 5IYCH 1I50H 4GN4B 1HQRD 3DLLA 2G5DA 3RNUA 4K0KL 2CWPA 2NUCA 4P72A 1HR0Q 1D1IA 1JQYD 1E1OA 1ZYRC 4ZUIA 3S1NH 2EVBA 5C44G 5C44H 1RJTA 4DR6L 2WAQG 3FDTA 2VNUD 4K6LA 2UUBQ 3BZCA 1EOTA 5C3XA 2L12A 2A69D 1BCPB 1JE4A 2QGQA 2HHHQ 2BE5C 3PIP3 3A7AB 1UAPA 4EVOA 2PZTA 4A3JB 4L8JA 1HQMC 3E9HA 4XTCS 2ZXOA 1K73C 3W5OA 3RN5A 4HTHA 2RDHA 1I4XA 2M2LA 2VQFL 3KJPA 4A75A 4LF5L 4UY8C 1JORA 4GKJL 3NUCA 1IBKQ 4KHVA 1RL2A 1VQGA 3H3VH 3OHXC 1KAWA 1JICA 1VQPA 1YNNC 1TU2B 3IFDA 1VQFA 3RMHA 4RGMA 1HXYD 5GAGC 1NR4A 1WCMG 4DKAC 5M3FH 2JA5B 2Y0SG 1S5FD 1XXGA 2SNMA 1VQDA 2M9VA 5M5XB 1EIGA 3V96A 3S1QH 5JJLA 2B3GA 2C35B 4CDFC 5JJZA 4FO2A 1EU4A 1EIHA 3A5UA 1B70B 1S5DD 3TP8A 1EYCA 5IGBA 4LWCA 3HKZB 3L7ZC 1PTOC 2J7ZA 2L55A 4JYAL 1WD0A 4LF6L 2CWAA 1ICWA 2PNRC 4BBRG 4DPGA 1PRTC 2TSSA 1FVIA 4DR4L 5LL6X 3VA5A 1PH4A 1EWHA 4XT3B 3HS0C 5FO8B 3I4MH 3HOUG 1JR0D 1PYBA 5CBEE 1IXRA 4Y7NB 4HIKA 1RTNA 1XPUA 4A3MH 2CQOA 4PQXA 3JAMc 1U5KA 4MZ9A 4OWTB 3UDGA 2WAQE 3GTJH 5IE8A 1HNXL 1LT3D 3TQYA 1EL0A 3KDFB 3A54A 4A3EB 4WRDA 1SROA 4HJ5A 5JVH3 1VQEA 3VYTA 1HA5A 2NWGA 1K8GA 1Q86C 3M4OH 3IRBA 1YNJC 4JOIC 1D8LA 1PZKD 1SJED 2C5CA 2IWHA 4KY5A 3KDFA 3RLOA 4A3JG 4RCNA 2KHSA 3C46A 1A2UA 4PZ7A 1ML0D 4IUQA 2X6LA 5IYBH 5IYBG 3PO2H 4QCLA 2N88A 4R8NA 1HR0L 3MWYW 4NP5A 4FXKC 1E2WA 1QG7A 2Y0SE 1LTTD 1QVGA 2JSOA 2KA7A 1VQ8A 1TY2A 1M4VA 2KJXA 2JA5G 2HHHL 1EY9A 2YU9B 1DZ1A 3I55A 1VQ5A 3HOVH 1KHIA 3EBEA 1Y14B 5M5XH 3CRLC 4GN5A 4IUTA 1G2SA 3L3OC 3H6MA 5BR8Q 1XNQQ 4IOAA 3MFGA 2IW3A 2HDMA 5CV6A 3GTKB 5E3FA 5EQ0A 3SK8A 4JI8L 1NMFA 3I73A 4DA2A 1N32Q 2Z8LA 1DD2A 3M4QA 4OWXB 2C9OA 1F2YA 4BXXG 1NE3A 1JJ2A 3S16B 3NXWA 4IQZA 1JOKA 4HJ7A 1JJCB 1RCVD 1X3PA 3FMCA 1K8AC 4JI5L 4HSPA 2NTSA 3EFXD 1A15A 1A62A 4BWGB 4XQJA 3DM3A 3OMCA 2JQOA 1S72A 2UXDQ 3M7GA 3K57A 2JEAI 3HEJA 5DM63 2ZT9C 3ULJA 3HKSA 3L9AX 4A3EG 1E3PA 3W1GA 3K5MA 3CCEA 2Z0SA 2UU9L 2A68D 4JI7Q 1H9RA 3S15B 4A3KH 3I4NH 2AQ1B 4K5XA 3AMUA 1TWGH 1PH8A 3R93A 1PHJA 2LKVA 3Q22A 3S1RH 1B8AA 2XRSD 1B53A 4N8X1 1EQVA 1NBWA 1V8QA 3GO5A 1TS2A 2B2WA 3A7LA 4H44C 3K58A 2FHTA 5FKAC 5JAVA 2JYOA 1PZJD 2D62A 1TR5A 2K01A 2XGTA 3VR3A 1MI2A 1MSGA 4JPBW 1LACA 2CW0D 5CORA 1BUVT 1S5CD 4JI4Q 4DAYB 4FNFA 3G71A 1XX8A 2KCNA 1L1OA 4TRDA 1F2ZA 3GD7A 4POFA 4LF9Q 3TRZA 4X62Q 1DGSA 4B3RL 2B2UC 1N8RC 1YVCA 5LMNQ 2YU9H 2LXKA 4MTKA 5I2YA 2Q8TA 2KBNA 4X65L 5CGKA 5F2DA 1XPRA 1LT5D 2NVTH 1HFGA 3T16A 2WKCA 2F4VQ 3GTKH 2D2CC 4KKUA 1V9PA 4A4IA 1NAPA 4N9TA 4JG2A 1FNWA 1B7YB 4YY3Q 1DOMA 4K2LA 3K7AB 3S16H 1SJHD 1I3QH 3V05A 3M7NA 1STAA 4APVA 1WI5A 3U9SA 1HHVA 1PYWD 5ELCA 4IFDI 4IPDA 4R8IA 4QUCA 2PMZB 3SXHA 4YWKA 1XNQL 1EZ8A 1S40A 2B2TA 2UXCQ 3DMUA 4PV1C 4GNXC 3PO3H 2A74C 1N32L 1A6XA 1TWHH 2H5XA 3KF6B 4IFDJ 3S2DH 4WJ4A 5ISRA 2F0EA 1K3RA 2CCZA 1VQCA 3MEHA 3STBD 3KYHC 3UI2A 5JEAG 3HOXG 3HOXH 1J8IA 3J80c 1VMCA 4R4QA 2A6ED 3KF6A 1V43A 2F0KA 4WFN3 1HUMA 3S24A 3I4LA 3F2BA 2UXDL 2K04A 3NK9A 2QA4A 2RBMA 4J6HA 2VB3X 3JAMi 1VQBA 1Z47A 3CCUA 2K5HA 4LF4Q 3QJYA 3TBIB 1FGBD 3GTOH 3NTKA 4P2CB 1HA6A 3V2TA 1KQSA 3NE5B 3MXNA 5IYDG 2ALYB 4R9WA 3C3LA 4NXMQ 2BA1A 4OIKA 1EYGA 1LTSD 3PCOB 3MXPA 1LTGD 4KN4C 5C0XJ 5IODA 3OOCA 1YZ6A 2I46A 1N33Q 2K1BA 1C4QA 1I6VC 4YCVA 4I7ZC 5C4XH 3RZDB 2J0TD 3FKIB 1BO0A 3VR4A 3SK5A 3OSOA 2ZM6L 2JA7B 2F0FA 2QEXA 2XNAC 1ENCA 3G7LA 4RGOS 1X3FA 2QDLA 4KN7C 1EFID 4QIWB 1LTBD 4R4OA 2X69A 3IKJA 2F3VA 4GKKL 1G6ZA 2NZHA 4ILWA 4KJNA 4X66Q 1HNZQ 4DV4Q 5BN3A 3H3VI 1CSQA 4XIGS 3TZUA 2LXJA 1EFWA 4A3CG 4A3CH 2RA4A 1I4HA 2K6AA 2OEOA 4QUFA 2EQSA 4YHHQ 4H7BA 1VQ7A 1XPOA 2KCTA 1OTCA 1NNXA 2AQ2B 2CVRA 3EJIA 1LYLA 4O0AA 1Y8OB 4DNRB 1IL8A 2F3WA 1WTHA 3A8IE 5ELOA 2ZJRA 3KLSX 5J1ZA 2D5DA 1WTRA 3W1BA 1EY5A 5CR3A 3S14H 1JOOA 2DJGC 4YWLA 4ZAIA 3CCMA 1BBXC 5C4ZA 3F2CA 1G6PA 1WTWA 1TS3A 2Q2HA 5I2XA 3E5SA 1B1ZA 4A3FB 1UE7A 3FPPA 1IBML 2V1CC 1B2TA 3MVVA 2E5LL 4AH6A 2NVQB 2SEBD 5IT9E 1YHBA 1SN8A 4JVZA 4PZ8A 4UDUC 2ZXRA 4L5RC 1PZID 3GP7A 2E2IH 3GTMH 4DR2L 3NTIA 3RR5A 5CC4A 4P75A 4KKTA 4G7HC 1D5XC 4PMWA 1K8MA 3D4WA 1YJNA 3JAML 1SEBD 2EYOA 2MUYA 2EJGC 3UE1A 1WFQA 3FKIH 3FKIG 1AP0A 1HTPA 1J5EL 1W3SA 5C3EB 2JA7G 5FO9B 4JOIA 3OWFA 4B3ML 5JJIA 4FF2A 2Q2TA 1GD7A 1K0RA 5GAHC 2F0IA 4LFCQ 2RDFA 2FMMA 2PMZE 4C3JH 1PMRA 2GA4B 2XN9C 3D6WA 4Z9CB 4NXML 2R6GA 3R3OA 3UDIA 4F88A 1PH7A 1V1PB 2VQFQ 2L4NA 1F77A 5M3MH 1QUQB 5LL6S 1ET6A 3ZJYC 2AUKA 4G7ZC 4RFBA 4LF5Q 5FLXE 1VQNA 2BH8A 4B3TQ 1U4PA 4G57A 1WTXA 2R7FA 4V0BA 1Y1WB 3CC7A 1JE5A 4C3HH 2SOBA 4F7XA 1KABA 1VCIA 1V1OA 2LY7A 2WIIB 1TWAH 1GUGA 3KUPA 3I7FA 2TMPA 2Z6BA 3S2HH 1V1PA 1GKHA 4KJOA 5IGCA 1QUQA 2JE6I 2VL6A 4IPHA 3TZDA 2NZOA 3WOEA 1O80A 2QF7A 3J81c 4TSSA 3TP5A 1CUKA 1E2ZA 3QO2A 1TXYA 4R1JA 4RHRA 3GTGB 2Q2UA 1KRTA 3W2DA 4X66L 3K5NA 1HNZL 2K5DA 1KDBA 4JYAQ 1ZEQX 1WYDA 5KGUA 2K5QA 2JA8H 4LF6Q 1HZBA 2JK8A 4OXPA 4DR3L 4O42A 3UDXA 1GHJA 2F0NA 4WORA 1H9SB 4ABNA 4DR4Q 2K14A 3K6OA 2I5MX 1XYIA 4JI3Q 1EY7A 1O7ZA 3H09A 3OTOQ 1T5EA 4A3FG 2FFKB 4QL5A 2F0WA 1Q1EA 4EQ5A 5M5YH 1F2MA 3HOWB 1T9HA 4KK7A 2PW5A 3F1ZA 1XJVA 2NVYB 5C4JH 1B9MA 2RCNA 1HNXQ 4FYDA 2OTLA 3Q6SA 1RDPD 5NUCA 3G4SA 1CQFA 2KHIA 3ICEA 2WB1B 3I72A 4QIWE 2B2VC 2HIXA 2IT1A 1VQIA 4S3SA 3J80i 4G4KA 5C3EG 4JBKA 1Q82C 3HOZB 2R92B 4R4TA 3BDCA 4A3IB 2NBFA 2R3ZA 1WTPA 2L1BA 2PQAA 1I4PA 1Y1VH 1CHQD 2AUJD 4ZKBB 1ESFA 3BVMA 1STHA 4MNOA 4UAIA 3EVQA 5D3DA 1E0BA 3ONAB 5HGQA 4TKOB 4K5VA 4G7OC 1TWFH 1O7LA 3RD4A 4EGVA 1OXTA 1ZYRD 4HN7A 1CTMA 3D4DA 3RZOB 2B8FA 1Y1WG 5KNCA 3NPPA 2GVAA 4HMIA 4MHEA 4JK1C 5CV8A 3H15A 4A3LG 4A3LH 2BE5D 2B2UA 1LT6D 4EQNA 4IO9A 4QJFA 3IFTA 4ME3A 4JI2L 2DJFC 1MBYA 1UNSA 4LFCL 4DAMA 1Q81C 5CMDA 4DGZA 3NELA 3PQIA 2K52A 3OWEB 2B2YC 3M3YH 3I2ZA 2F0JA 3HRZC 5IP9G 5IP9H 3GTGH 1CHPD 4JI8Q 3FEWX 4JV5Q 3J7A5 1K3BC 4U673 2PI2E 5EGTA 3AB9A 2A6HC 2CKZB 4B3TL 2L0CA 2QDBA 1OO9B 1QNKA 3OW7A 1GUNA 1LM0A 2A19A 1HPCA 1YNND 2K05A 3PUVA 3PIO3 4IJLA 5GADC 2AWNA 1WCMH 4JI0L 2K32A 2F3IA 3NQIA 4GOPC 4DAPA 1HNWL 4O1NA 4JI5Q 1QE6A 3HOWH 3HOWG 1X3QA 4OL7A 2F0VA 2OQ0A 3CAMA 3TEHB 4C2MB 4LAAA 1PTOD 1B9NA 3CCRA 2UU9Q 1TQOA 1XTCD 2ICEC 2JP1A 4IZ8A 2WB1G 1PRTD 4BBRH 2QKIC 4A3BH 5IWAL 4A3BG 4JI3L 1E2VA 3SHLA 3HOZG 4UP9A 3OTOL 1BOSA 1KAAA 3BZKA 2BCOA 4A3IG 4A3IH 4RAUC 3HOUH 5IGEA 3DEPA 2EIFA 1I94Q 4M8AA 5EKLA 1U4MA 4OX9Q 3QOJA 1M1KC 5E7NA 2H1EA 3CP0A 3H0GB 4BA1I 3WOFA 2MNAA 4PZ6A 4J15A 4QGUA 4IJHA 1PA6A 3RZOH 1CZWA 4JBJA 4PMCA 3NSWA 3J80L 2YV5A 3CQZB 1F2LA 1TVXA 1YHQA 5KNBA 4B3RQ 1SDFA 2XWBB 3CD6A 3BG3A 4A76A 4KD3A 1SE3A 2EYJA 3A8KE 1YNJD 4H0LC 2D0OA 4IOCA 1KTKA 1PXUA 2H4OA 3D3RA 3CCLA 3VYUA 4A3JH 1UE1A 4X65Q 1KDAA 3LX0A 4C56C 5CV9A 2XSCA 4XXEA 1UE6A 4IUVA 3HOYB 2RQXA 3SDZA 1Q12A 3M85A 2UUCL 2IX1A 2AQ3B 3DUZA 1B44D 1DXMA 1R4QB 3M4YA 4NPSA 4C1NI 3D0FA 1I6HB 2E2HB 1V1QA 4PG3A 5J3BA 2JA5H 2F0HA 2UXBQ 2O5JC 1TY0A 2F4IA 5T1GA 4B9XA 1II3A 1EQQA 3IL8A 2HDLA 2DY7A 5CBAE 1EY0A 5ELBA 3BZDB 4K14A 2G9HD 2LMCB 3KK7A 2WB1E 3CHBD 3ND9A 1QWYA 1SXTA 4JW0A 2B63B 3HKZG 4JV5L 3U50C 5M5WB 3E3XA 5KYIA 1BBUA 4DR7Q 3J81i 3MFYA 1TWCB 4BXXH 2NZ1D 1B3AA 3OIQA 1PDQA 1RIPA 5IGFA 1NCVA 2F0OA 3HG9A 2E2JB 4Y7NH 1FD7D 2RKSA
chains in the Genus database with same CATH topology
2QA4A 4GLAC 3PGZA 3RLFA 4LF7Q 3K8AA 4LF4L 4DR4L 2D0PA 1VQ9A 3VDYA 3GDEA 3JAMi 1BBWA 1VQBA 1PH9A 1Z47A 1WOCA 3CCUA 2K5HA 4LF4Q 3AFQA 4A3EH 3B6YA 3S1MH 4DNIA 4DV1L 2NVYH 1UEBA 2ES2A 4JI6Q 3GTOH 5M3MG 1EUJA 1KQSA 3CQZH 5IYDG 2ALYB 3EIVA 3NEMA 4P74A 4GNXA 2WP8J 2Z6KC 4GN3B 2BA1A 1PH5A 4GKJQ 2YYZA 1EYGA 4OO1I 3PCOB 1N33L 4X64L 3RN2A 2KHJA 3I4OA 5C0XJ 2A8VA 2MO0A 4UPAA 3GTPH 5M3FG 4KHPQ 2IX0A 2K75A 1YZ6A 3NENA 1N33Q 5JJKA 1X55A 4JC0A 4YCVA 1L1OB 1XMQQ 3CXCA 1ASYA 5C4XH 1YJ9A 1I94L 3HOZH 2R92G 2R92H 1WJJA 4DR1L 4DV5Q 1NJIC 4A3DG 4OX9L 4A3DH 3HOYG 4DR5Q 2ZM6L 4DR1Q 2QEXA 1K9MC 1X3FA 2A1AA 2N8NA 3AEVA 4L5SA 3MEFA 2RHSB 2ZM6Q 2UUAQ 4BBSG 2N49A 2E8GA 4R4OA 3ERSX 4IFDG 4GKKL 2NZHA 4DV4L 1OXVA 2R7ZH 4RG1A 2JA8G 4RMFA 4BA2I 4X66Q 5GROA 1HNZQ 4GLVB 3FHWA 2I5HA 5JEAJ 5EAYA 3G6EA 4GKKQ 2VUMG 4DV4Q 2VUMH 2Q2IA 3KLWA 1MJEA 3I4MG 3H3VI 4YHHL 1CSQA 3PIPA 2VZAA 4R4CA 2L15A 4DV2L 2VQEQ 4QQBX 1A63A 1AH9A 4XIGS 4A3MG 2LXJA 2BA0A 1EFWA 4A3CG 4A3CH 3HKZE 3T1YL 2EQSA 4YHHQ 1VQ7A 3D31A 1XPOA 2KCTA 2FXQA 4BY1G 1C7YA 1OTCA 4BY1H 1FGUA 2BH2A 4LW1A 1OXXK 4AQYL 1EQRA 3OW2A 2B63H 2B63G 2YTVA 1LYLA 5M5WH 3U58A 3Q8DA 4O0AA 1X56A 4OONA 1IBLL 2IHEA 2ID0A 3U4VA 3L0OA 4DUYL 3ER0A 3TS0A 1VQKA 1UWVA 2JJQA 1TWCH 3KFUA 1SRUA 1NMGA 1IBLQ 5ELOA 4DUYQ 2ZJRA 3GTLH 1VQHA 2VW9A 1MKHA 3W1BA 1VQ6A 1EIYB 3S14H 4YWLA 4P71A 1SLJA 2UXBL 1X3EA 1CKMA 3CCMA 2E2JH 2AKWB 1G51A 3F2CA 1G6PA 4DV0L 4LUZA 1Q1BA 3CCJA 2Q2HA 5IT9c 1Y1VG 1K83H 2ZJPA 4DUZL 1YEZA 1X54A 4H02A 5IYCH 3PO2G 1UE7A 3J81j 1IBML 3A5ZB 1Q7YC 1GO3E 1I50H 2V1CC 4GN4B 2OTJA 4DUZQ 3DLLA 4AH6A 2E5LL 3RNUA 4K0KL 2CWPA 1YHBA 1SN8A 3UDFA 1M90C 4OO1G 4C2MH 3T1HQ 4JCVE 4P72A 1HR0Q 1A8VA 1IBMQ 4DR7L 4PZ8A 2OWOA 1E1OA 2UUBL 3S15H 3S1NH 4L5QA 1JMCA 2E5LQ 4L5RC 5C44G 5C44H 1YHAA 2K50A 3JC66 2E2IH 1Z9FA 3GTMH 2WAQG 4DR6L 2VNUD 4DR2L 2UUBQ 3RR5A 3BZCA 4P75A 1YBYA 1X9NA 3HOVG 2ZTCA 3PV0A 1NY4A 2QGQA 4PMWA 4DR2Q 2HHHQ 1YJNA 3UE1A 2XTIA 1WFQA 3FKIH 3FKIG 4DV3Q 4LF7L 1HJPA 1J5EL 1E7ZA 3MXNB 1W3SA 1HR0W 1D7QA 3E9HA 4XTCS 2JA7G 4JOIA 1K73C 4B3ML 5JJIA 1VQ4A 2Q2TA 3W5OA 1GD7A 3RN5A 1J5EQ 1K0RA 5GAHC 3H0GH 3H0GG 4LFCQ 1IBKL 3F8TA 4IPCA 2VQFL 4JI6L 5FLXc 2PMZE 4C3JH 3KJPA 4B3MQ 4A75A 4LF5L 4NXML 4UY8C 2R6GA 1OXUA 4GKJL 3UDIA 3CW2C 1PH7A 1IBKQ 1RL2A 1VQGA 2VQFQ 3H3VH 5M3MH 1KAWA 1QUQB 1QZGA 3ZJYC 4LF5Q 1E1TA 1VQPA 5IYDH 1E24A 2BH8A 1VQNA 1E22A 3CCQA 4B3TQ 5GQOA 4KHPL 1VQFA 2R7FA 3FP9A 3CC7A 1JE5A 1LUZA 5GAGC 1WCMG 1I5FA 4DK3C 4C3HH 4DKAC 5M3FH 1XMQL 2ATWA 3CPFA 1KC8C 2Y0SG 1VCIA 4NXNQ 1TWAH 4DV5L 3I7FA 1VS0A 3S2HH 1VQDA 4HIDA 5JJLA 3K7UC 3S1QH 4DR5L 1GKHA 1JJGA 5LMUQ 2B3GA 2C35B 1QUQA 2JE6I 2VL6A 4IPHA 3K0XA 4JI1L 2AHOB 1YNXA 3A5UA 1ASZA 1B70B 2NZOA 3HOYH 1W2BA 4NXMQ 3K7AH 3J81c 2UUAL 4LWCA 4A3KG 1CUKA 1N34Q 3L7ZC 4HIOA 4JI1Q 3I4NG 4DV6L 3TS2A 3U4ZA 1TXYA 4R1JA 4LNQA 4JYAL 1YITA 4LF6L 2Q2UA 2CWAA 1KRTA 4X66L 2YTXA 1VQOA 1HNZL 4DV6Q 4AYBG 4BBRG 1XNRL 4JYAQ 4DPGA 1WYDA 1FVIA 4KLKA 2JA8H 2N78A 1HZBA 2JK8A 1PH4A 3CC2A 4LF6Q 4BBSH 1G291 4OXPA 1OXSC 4DR3L 2E2HH 5GAEC 1VQJA 3UDXA 2VQEL 1KD1C 1VQLA 1XNRQ 4BY7G 4BY7H 3I4MH 3HOUG 1PYBA 4DR4Q 2K14A 1CSPA 2I5MX 4JI3Q 1IXRA 4DR3Q 4HIKA 1A0IA 3OTOQ 3KOJA 4A3MH 4A3FG 1C9OA 2CQOA 1CKNB 1XPUA 4A93G 3SGIA 3AQQA 3JAMc 2DGYA 4QL5A 1PH2A 1U5KA 4MZ9A 4FDBA 4OWTB 1Q1EA 3UDGA 2WAQE 4EQ5A 3GTJH 5M5YH 1UE5A 2VY3A 5IE8A 1T9HA 1HNXL 5H1SE 3TQYA 3KDFB 4GOPA 3F1ZA 1XJVA 1SROA 4A3GG 5C4JH 4HJ5A 2RCNA 1HNXQ 1X3GA 1GM5A 2ZTDA 1VQEA 3CF5A 3L2PA 1CKNA 2OTLA 4O2DA 3G4SA 3A0JA 4OWWB 1K8GA 3PIOA 1Q86C 2KHIA 1PH6A 1X6OA 3IRBA 3M4OH 1XTDA 3KF8B 3ICEA 4JOIC 4QY7A 4QIWE 1N9WA 1D8LA 2HIXA 2IT1A 1VQIA 3RLOA 1SR3A 3KDFA 3J80i 4A3JG 1PV4A 5C3EG 4JBKA 1Q82C 3F2DA 1FJGQ 4R4TA 2AWOA 4AIMA 4PZ7A 2PQAA 2KENA 1Y1VH 3PUZA 1U0LA 5IYBH 5IYBG 5HY6A 3PO2H 1BVSA 3T1HL 1HR0L 3BU2A 4MNOA 3ULLA 2HQLA 5HGQA 4IPGA 2HIVA 1TWFH 1IYJB 4B3SQ 1PVOA 1OXTA 2K4KA 2Y0SE 1PYSB 1QVGA 5IP7H 5IP7G 1MIUA 2ASBA 3TREA 1PFSA 5K36G 3NBHB 1Y1WG 1VQ8A 2I0QA 4DK6C 2HT1A 1CKOA 2GVAA 4R4IA 4JBMA 1KXLA 4TVAB 2JA5G 2HHHL 2LSSA 1L2FA 3I55A 2OQKA 3PF5A 1VQ5A 1KHIA 3H15A 2ZJQA 3EBEA 5BR8L 3HOVH 4A3LG 1SFOH 4A3LH 4DV3L 1Y14B 5M5XH 3CPWA 1YJWA 3PUYA 4GN5A 2NN6I 3PO3G 1X65A 5BR8Q 4QJFA 5FJ8H 5FJ8G 4IO9A 3RZDH 4ME3A 4JI2L 1XNQQ 3PF4A 4IOAA 3RLNA 4LFCL 4DAMA 1Q81C 1N36Q 2JA7H 3NELA 1NMFA 4JI8L 2OCEA 2K52A 4AYBE 4JI2Q 3M3YH 1IZ6A 2AMCB 2F52A 1N32Q 3I2ZA 5IP9G 5IP9H 3GTGH 3M4QA 4JI8Q 3ULPA 4JV5Q 1JT8A 4OWXB 3J7A5 4BXXG 1XMOL 2PI2E 1JB7A 2K5VA 1NE3A 1P16A 2CKZB 1JJ2A 4B3TL 3STBC 2JEBI 1LM0A 2A19A 4JBWA 1XMOQ 3PUVA 1JJCB 1Q46A 3AFPA 4DV7Q 4HJ7A 2PNHA 4IJLA 2RF4A 5GADC 4NXNL 1K8AC 2AWNA 1HH2P 1YIJA 4JI5L 1WCMH 4LUOA 4JI0L 4EX5A 5C0XI 1A62A 1S3OA 2JA9A 2F3IA 3PUWA 3M4PA 5LMUL 3DM3A 4GOPC 1HNWL 2JQOA 4JI5Q 1S72A 4JI0Q 2UXDQ 1EOVA 1L0WA 3HOWH 3HOWG 2JEAI 4JI7L 1QZHA 3ULJA 2OQ0A 3HKSA 1HNWQ 4A3EG 1N34L 1MJCA 1E3PA 3W1GA 1EIFA 4TQUS 3CCEA 3UE0A 2Z0SA 2UU9L 3CAMA 3TEHB 2UXDL 4KHZA 1PH3A 4JI7Q 3PUXA 1Q8KA 3CCRA 4A3KH 3I4NH 3EN2A 2RHQB 4DV1Q 2UU9Q 3CCSA 1TWGH 1PH8A 1LTLA 1PHJA 2ZTEA 1KIXA 3S1RH 1B8AA 2R7DA 2WB1G 4P73A 2VS1A 4X64Q 4BBRH 1KL9A 3AYHB 4YCUA 1NBWA 1IL2A 4A3BH 5IWAL 3GO5A 4A3BG 4JI3L 3J7ZC 5C4XG 4UP8A 1FL0A 4UP9A 3HOZG 4GOPB 3OTOL 3BZKA 3LGJA 4A3IG 4A3IH 3HOUH 2D62A 2XGTA 4JI4L 3G48A 2B29A 1HZ9A 2EIFA 5IWAQ 4Y52H 1I94Q 1SE8A 2IHFA 3K81C 4L5TA 1O7IA 1VQAA 1J6QA 4A3FH 4HJ9A 4OX9Q 4A93H 4JI4Q 1M1KC 4LF9L 4ALPA 5E7NA 4DAYB 3KJOA 2NVQH 3CP0A 3G71A 2IY5B 4X62L 3CCVA 4BA1I 2GVBA 1L1OA 1PH1A 2MNAA 4PZ6A 2JA6G 4J15A 5FLMG 5FLMH 3GD7A 4POFA 4LF9Q 4QGUA 1QVCA 3S17H 4IJHA 1NTGA 1PA6A 5LMNL 3TRZA 4WJ3M 4X62Q 3A74A 1DGSA 2R7ZG 4JBJA 3RZOH 4B3RL 2CFMA 4A3GH 2R93G 1AE3A 2R93H 2N3SA 2YV5A 1N8RC 4NB3A 1YVCA 2PQAB 4UP7A 5LMNQ 2YTYA 2YU9H 1YHQA 2LXKA 4B3RQ 2NN6G 2NVXH 3CD6A 4HJAA 1YI2A 2KBNA 2K5NA 4A76A 1P8LA 2F4VL 4X65L 1SMXA 4IOCA 2D0OA 3PSIA 2Z6KA 4C3IH 1XPRA 1FJGL 2NVTH 4DV2Q 3CCLA 5DLQE 2DUDA 4A3JH 2F4VQ 1UE1A 4X65Q 3GTKH 5C3EH 3T1YQ 4YY3L 3OYYA 4LFAL 1V9PA 4A4IA 3CMEA 5AJ3L 4JG2A 1I6HH 3M9BA 2MO1A 1UE6A 1B7YB 4YY3Q 4GLXA 4AQYQ 4LFAQ 4YWMA 5LMNW 4B3SL 1Q12A 4GS3A 4KI0A 3M85A 2EXDA 1QVFA 5AJ3Q 3S16H 4YCWA 1I3QH 2UUCL 3HFZB 2IX1A 3M7NA 2MQHA 4LUVA 4HIMA 4APVA 4X6AH 3WWVA 1WI5A 2MFIA 4NPSA 1H95A 5C0XG 3D0FA 2UUCQ 3CMAA 1Y1WH 2JA6H 4IFDI 4IPDA 3BJUA 1V1QA 4PG3A 5J3BA 2JA5H 2UXBQ 2UXCL 4YWKA 1XNQL 1S40A 5IYCG 1EQQA 4DV0Q 2UXCQ 4LFBL 1N36L 4GNXC 1R9TH 4LF8L 3PO3H 3E0EA 1N32L 4LFBQ 1TWHH 2WFWA 2H5XA 1KRSA 2WB1E 3KF6B 4LF8Q 4JV5L 1HZAA 3S24A 1C0AA 3HKZG 5IY0A 4K0KQ 3E9IA 3U50C 4IFDJ 2KCMA 3S2DH 1BBUA 4WJ4A 4DR7Q 3J81i 2PI2A 2GN5A 1K3RA 3CC4A 2CCZA 1VQCA 1GVPA 1EWIA 5ELNA 3GTQH 4BXXH 1VQMA 3STBD 3KYHC 4DV7L 4DR6Q 1RIPA 5JEAG 3I56A 2I5LX 3HOXG 3HOXH 3K80C 3J80c 4R4QA 4MTNA 1HZCA 3KF6A 4HJ8A 1V43A 1BKBA 4Y7NH 4GNXB 4POGA 1AE2A 1L1OC 3F2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 A;  4GLA C;  3PGZ A;  3RLF A;  4LF7 Q;  3K8A A;  4LF4 L;  4DR4 L;  2D0P A;  1VQ9 A;  3VDY A;  3GDE A;  3JAM i;  1BBW A;  1VQB A;  1PH9 A;  1Z47 A;  1WOC A;  3CCU A;  2K5H A;  4LF4 Q;  3AFQ A;  4A3E H;  3B6Y A;  3S1M H;  4DNI A;  4DV1 L;  2NVY H;  1UEB A;  2ES2 A;  4JI6 Q;  3GTO H;  5M3M G;  1EUJ A;  1KQS A;  3CQZ H;  5IYD G;  2ALY B;  3EIV A;  3NEM A;  4P74 A;  4GNX A;  2WP8 J;  2Z6K C;  4GN3 B;  2BA1 A;  1PH5 A;  4GKJ Q;  2YYZ A;  1EYG A;  4OO1 I;  3PCO B;  1N33 L;  4X64 L;  3RN2 A;  2KHJ A;  3I4O A;  5C0X J;  2A8V A;  2MO0 A;  4UPA A;  3GTP H;  5M3F G;  4KHP Q;  2IX0 A;  2K75 A;  1YZ6 A;  3NEN A;  1N33 Q;  5JJK A;  1X55 A;  4JC0 A;  4YCV A;  1L1O B;  1XMQ Q;  3CXC A;  1ASY A;  5C4X H;  1YJ9 A;  1I94 L;  3HOZ H;  2R92 G;  2R92 H;  1WJJ A;  4DR1 L;  4DV5 Q;  1NJI C;  4A3D G;  4OX9 L;  4A3D H;  3HOY G;  4DR5 Q;  2ZM6 L;  4DR1 Q;  2QEX A;  1K9M C;  1X3F A;  2A1A A;  2N8N A;  3AEV A;  4L5S A;  3MEF A;  2RHS B;  2ZM6 Q;  2UUA Q;  4BBS G;  2N49 A;  2E8G A;  4R4O A;  3ERS X;  4IFD G;  4GKK L;  2NZH A;  4DV4 L;  1OXV A;  2R7Z H;  4RG1 A;  2JA8 G;  4RMF A;  4BA2 I;  4X66 Q;  5GRO A;  1HNZ Q;  4GLV B;  3FHW A;  2I5H A;  5JEA J;  5EAY A;  3G6E A;  4GKK Q;  2VUM G;  4DV4 Q;  2VUM H;  2Q2I A;  3KLW A;  1MJE A;  3I4M G;  3H3V I;  4YHH L;  1CSQ A;  3PIP A;  2VZA A;  4R4C A;  2L15 A;  4DV2 L;  2VQE Q;  4QQB X;  1A63 A;  1AH9 A;  4XIG S;  4A3M G;  2LXJ A;  2BA0 A;  1EFW A;  4A3C G;  4A3C H;  3HKZ E;  3T1Y L;  2EQS A;  4YHH Q;  1VQ7 A;  3D31 A;  1XPO A;  2KCT A;  2FXQ A;  4BY1 G;  1C7Y A;  1OTC A;  4BY1 H;  1FGU A;  2BH2 A;  4LW1 A;  1OXX K;  4AQY L;  1EQR A;  3OW2 A;  2B63 H;  2B63 G;  2YTV A;  1LYL A;  5M5W H;  3U58 A;  3Q8D A;  4O0A A;  1X56 A;  4OON A;  1IBL L;  2IHE A;  2ID0 A;  3U4V A;  3L0O A;  4DUY L;  3ER0 A;  3TS0 A;  1VQK A;  1UWV A;  2JJQ A;  1TWC H;  3KFU A;  1SRU A;  1NMG A;  1IBL Q;  5ELO A;  4DUY Q;  2ZJR A;  3GTL H;  1VQH A;  2VW9 A;  1MKH A;  3W1B A;  1VQ6 A;  1EIY B;  3S14 H;  4YWL A;  4P71 A;  1SLJ A;  2UXB L;  1X3E A;  1CKM A;  3CCM A;  2E2J H;  2AKW B;  1G51 A;  3F2C A;  1G6P A;  4DV0 L;  4LUZ A;  1Q1B A;  3CCJ A;  2Q2H A;  5IT9 c;  1Y1V G;  1K83 H;  2ZJP A;  4DUZ L;  1YEZ A;  1X54 A;  4H02 A;  5IYC H;  3PO2 G;  1UE7 A;  3J81 j;  1IBM L;  3A5Z B;  1Q7Y C;  1GO3 E;  1I50 H;  2V1C C;  4GN4 B;  2OTJ A;  4DUZ Q;  3DLL A;  4AH6 A;  2E5L L;  3RNU A;  4K0K L;  2CWP A;  1YHB A;  1SN8 A;  3UDF A;  1M90 C;  4OO1 G;  4C2M H;  3T1H Q;  4JCV E;  4P72 A;  1HR0 Q;  1A8V A;  1IBM Q;  4DR7 L;  4PZ8 A;  2OWO A;  1E1O A;  2UUB L;  3S15 H;  3S1N H;  4L5Q A;  1JMC A;  2E5L Q;  4L5R C;  5C44 G;  5C44 H;  1YHA A;  2K50 A;  3JC6 6;  2E2I H;  1Z9F A;  3GTM H;  2WAQ G;  4DR6 L;  2VNU D;  4DR2 L;  2UUB Q;  3RR5 A;  3BZC A;  4P75 A;  1YBY A;  1X9N A;  3HOV G;  2ZTC A;  3PV0 A;  1NY4 A;  2QGQ A;  4PMW A;  4DR2 Q;  2HHH Q;  1YJN A;  3UE1 A;  2XTI A;  1WFQ A;  3FKI H;  3FKI G;  4DV3 Q;  4LF7 L;  1HJP A;  1J5E L;  1E7Z A;  3MXN B;  1W3S A;  1HR0 W;  1D7Q A;  3E9H A;  4XTC S;  2JA7 G;  4JOI A;  1K73 C;  4B3M L;  5JJI A;  1VQ4 A;  2Q2T A;  3W5O A;  1GD7 A;  3RN5 A;  1J5E Q;  1K0R A;  5GAH C;  3H0G H;  3H0G G;  4LFC Q;  1IBK L;  3F8T A;  4IPC A;  2VQF L;  4JI6 L;  5FLX c;  2PMZ E;  4C3J H;  3KJP A;  4B3M Q;  4A75 A;  4LF5 L;  4NXM L;  4UY8 C;  2R6G A;  1OXU A;  4GKJ L;  3UDI A;  3CW2 C;  1PH7 A;  1IBK Q;  1RL2 A;  1VQG A;  2VQF Q;  3H3V H;  5M3M H;  1KAW A;  1QUQ B;  1QZG A;  3ZJY C;  4LF5 Q;  1E1T A;  1VQP A;  5IYD H;  1E24 A;  2BH8 A;  1VQN A;  1E22 A;  3CCQ A;  4B3T Q;  5GQO A;  4KHP L;  1VQF A;  2R7F A;  3FP9 A;  3CC7 A;  1JE5 A;  1LUZ A;  5GAG C;  1WCM G;  1I5F A;  4DK3 C;  4C3H H;  4DKA C;  5M3F H;  1XMQ L;  2ATW A;  3CPF A;  1KC8 C;  2Y0S G;  1VCI A;  4NXN Q;  1TWA H;  4DV5 L;  3I7F A;  1VS0 A;  3S2H H;  1VQD A;  4HID A;  5JJL A;  3K7U C;  3S1Q H;  4DR5 L;  1GKH A;  1JJG A;  5LMU Q;  2B3G A;  2C35 B;  1QUQ A;  2JE6 I;  2VL6 A;  4IPH A;  3K0X A;  4JI1 L;  2AHO B;  1YNX A;  3A5U A;  1ASZ A;  1B70 B;  2NZO A;  3HOY H;  1W2B A;  4NXM Q;  3K7A H;  3J81 c;  2UUA L;  4LWC A;  4A3K G;  1CUK A;  1N34 Q;  3L7Z C;  4HIO A;  4JI1 Q;  3I4N G;  4DV6 L;  3TS2 A;  3U4Z A;  1TXY A;  4R1J A;  4LNQ A;  4JYA L;  1YIT A;  4LF6 L;  2Q2U A;  2CWA A;  1KRT A;  4X66 L;  2YTX A;  1VQO A;  1HNZ L;  4DV6 Q;  4AYB G;  4BBR G;  1XNR L;  4JYA Q;  4DPG A;  1WYD A;  1FVI A;  4KLK A;  2JA8 H;  2N78 A;  1HZB A;  2JK8 A;  1PH4 A;  3CC2 A;  4LF6 Q;  4BBS H;  1G29 1;  4OXP A;  1OXS C;  4DR3 L;  2E2H H;  5GAE C;  1VQJ A;  3UDX A;  2VQE L;  1KD1 C;  1VQL A;  1XNR Q;  4BY7 G;  4BY7 H;  3I4M H;  3HOU G;  1PYB A;  4DR4 Q;  2K14 A;  1CSP A;  2I5M X;  4JI3 Q;  1IXR A;  4DR3 Q;  4HIK A;  1A0I A;  3OTO Q;  3KOJ A;  4A3M H;  4A3F G;  1C9O A;  2CQO A;  1CKN B;  1XPU A;  4A93 G;  3SGI A;  3AQQ A;  3JAM c;  2DGY A;  4QL5 A;  1PH2 A;  1U5K A;  4MZ9 A;  4FDB A;  4OWT B;  1Q1E A;  3UDG A;  2WAQ E;  4EQ5 A;  3GTJ H;  5M5Y H;  1UE5 A;  2VY3 A;  5IE8 A;  1T9H A;  1HNX L;  5H1S E;  3TQY A;  3KDF B;  4GOP A;  3F1Z A;  1XJV A;  1SRO A;  4A3G G;  5C4J H;  4HJ5 A;  2RCN A;  1HNX Q;  1X3G A;  1GM5 A;  2ZTD A;  1VQE A;  3CF5 A;  3L2P A;  1CKN A;  2OTL A;  4O2D A;  3G4S A;  3A0J A;  4OWW B;  1K8G A;  3PIO A;  1Q86 C;  2KHI A;  1PH6 A;  1X6O A;  3IRB A;  3M4O H;  1XTD A;  3KF8 B;  3ICE A;  4JOI C;  4QY7 A;  4QIW E;  1N9W A;  1D8L A;  2HIX A;  2IT1 A;  1VQI A;  3RLO A;  1SR3 A;  3KDF A;  3J80 i;  4A3J G;  1PV4 A;  5C3E G;  4JBK A;  1Q82 C;  3F2D A;  1FJG Q;  4R4T A;  2AWO A;  4AIM A;  4PZ7 A;  2PQA A;  2KEN A;  1Y1V H;  3PUZ A;  1U0L A;  5IYB H;  5IYB G;  5HY6 A;  3PO2 H;  1BVS A;  3T1H L;  1HR0 L;  3BU2 A;  4MNO A;  3ULL A;  2HQL A;  5HGQ A;  4IPG A;  2HIV A;  1TWF H;  1IYJ B;  4B3S Q;  1PVO A;  1OXT A;  2K4K A;  2Y0S E;  1PYS B;  1QVG A;  5IP7 H;  5IP7 G;  1MIU A;  2ASB A;  3TRE A;  1PFS A;  5K36 G;  3NBH B;  1Y1W G;  1VQ8 A;  2I0Q A;  4DK6 C;  2HT1 A;  1CKO A;  2GVA A;  4R4I A;  4JBM A;  1KXL A;  4TVA B;  2JA5 G;  2HHH L;  2LSS A;  1L2F A;  3I55 A;  2OQK A;  3PF5 A;  1VQ5 A;  1KHI A;  3H15 A;  2ZJQ A;  3EBE A;  5BR8 L;  3HOV H;  4A3L G;  1SFO H;  4A3L H;  4DV3 L;  1Y14 B;  5M5X H;  3CPW A;  1YJW A;  3PUY A;  4GN5 A;  2NN6 I;  3PO3 G;  1X65 A;  5BR8 Q;  4QJF A;  5FJ8 H;  5FJ8 G;  4IO9 A;  3RZD H;  4ME3 A;  4JI2 L;  1XNQ Q;  3PF4 A;  4IOA A;  3RLN A;  4LFC L;  4DAM A;  1Q81 C;  1N36 Q;  2JA7 H;  3NEL A;  1NMF A;  4JI8 L;  2OCE A;  2K52 A;  4AYB E;  4JI2 Q;  3M3Y H;  1IZ6 A;  2AMC B;  2F52 A;  1N32 Q;  3I2Z A;  5IP9 G;  5IP9 H;  3GTG H;  3M4Q A;  4JI8 Q;  3ULP A;  4JV5 Q;  1JT8 A;  4OWX B;  3J7A 5;  4BXX G;  1XMO L;  2PI2 E;  1JB7 A;  2K5V A;  1NE3 A;  1P16 A;  2CKZ B;  1JJ2 A;  4B3T L;  3STB C;  2JEB I;  1LM0 A;  2A19 A;  4JBW A;  1XMO Q;  3PUV A;  1JJC B;  1Q46 A;  3AFP A;  4DV7 Q;  4HJ7 A;  2PNH A;  4IJL A;  2RF4 A;  5GAD C;  4NXN L;  1K8A C;  2AWN A;  1HH2 P;  1YIJ A;  4JI5 L;  1WCM H;  4LUO A;  4JI0 L;  4EX5 A;  5C0X I;  1A62 A;  1S3O A;  2JA9 A;  2F3I A;  3PUW A;  3M4P A;  5LMU L;  3DM3 A;  4GOP C;  1HNW L;  2JQO A;  4JI5 Q;  1S72 A;  4JI0 Q;  2UXD Q;  1EOV A;  1L0W A;  3HOW H;  3HOW G;  2JEA I;  4JI7 L;  1QZH A;  3ULJ A;  2OQ0 A;  3HKS A;  1HNW Q;  4A3E G;  1N34 L;  1MJC A;  1E3P A;  3W1G A;  1EIF A;  4TQU S;  3CCE A;  3UE0 A;  2Z0S A;  2UU9 L;  3CAM A;  3TEH B;  2UXD L;  4KHZ A;  1PH3 A;  4JI7 Q;  3PUX A;  1Q8K A;  3CCR A;  4A3K H;  3I4N H;  3EN2 A;  2RHQ B;  4DV1 Q;  2UU9 Q;  3CCS A;  1TWG H;  1PH8 A;  1LTL A;  1PHJ A;  2ZTE A;  1KIX A;  3S1R H;  1B8A A;  2R7D A;  2WB1 G;  4P73 A;  2VS1 A;  4X64 Q;  4BBR H;  1KL9 A;  3AYH B;  4YCU A;  1NBW A;  1IL2 A;  4A3B H;  5IWA L;  3GO5 A;  4A3B G;  4JI3 L;  3J7Z C;  5C4X G;  4UP8 A;  1FL0 A;  4UP9 A;  3HOZ G;  4GOP B;  3OTO L;  3BZK A;  3LGJ A;  4A3I G;  4A3I H;  3HOU H;  2D62 A;  2XGT A;  4JI4 L;  3G48 A;  2B29 A;  1HZ9 A;  2EIF A;  5IWA Q;  4Y52 H;  1I94 Q;  1SE8 A;  2IHF A;  3K81 C;  4L5T A;  1O7I A;  1VQA A;  1J6Q A;  4A3F H;  4HJ9 A;  4OX9 Q;  4A93 H;  4JI4 Q;  1M1K C;  4LF9 L;  4ALP A;  5E7N A;  4DAY B;  3KJO A;  2NVQ H;  3CP0 A;  3G71 A;  2IY5 B;  4X62 L;  3CCV A;  4BA1 I;  2GVB A;  1L1O A;  1PH1 A;  2MNA A;  4PZ6 A;  2JA6 G;  4J15 A;  5FLM G;  5FLM H;  3GD7 A;  4POF A;  4LF9 Q;  4QGU A;  1QVC A;  3S17 H;  4IJH A;  1NTG A;  1PA6 A;  5LMN L;  3TRZ A;  4WJ3 M;  4X62 Q;  3A74 A;  1DGS A;  2R7Z G;  4JBJ A;  3RZO H;  4B3R L;  2CFM A;  4A3G H;  2R93 G;  1AE3 A;  2R93 H;  2N3S A;  2YV5 A;  1N8R C;  4NB3 A;  1YVC A;  2PQA B;  4UP7 A;  5LMN Q;  2YTY A;  2YU9 H;  1YHQ A;  2LXK A;  4B3R Q;  2NN6 G;  2NVX H;  3CD6 A;  4HJA A;  1YI2 A;  2KBN A;  2K5N A;  4A76 A;  1P8L A;  2F4V L;  4X65 L;  1SMX A;  4IOC A;  2D0O A;  3PSI A;  2Z6K A;  4C3I H;  1XPR A;  1FJG L;  2NVT H;  4DV2 Q;  3CCL A;  5DLQ E;  2DUD A;  4A3J H;  2F4V Q;  1UE1 A;  4X65 Q;  3GTK H;  5C3E H;  3T1Y Q;  4YY3 L;  3OYY A;  4LFA L;  1V9P A;  4A4I A;  3CME A;  5AJ3 L;  4JG2 A;  1I6H H;  3M9B A;  2MO1 A;  1UE6 A;  1B7Y B;  4YY3 Q;  4GLX A;  4AQY Q;  4LFA Q;  4YWM A;  5LMN W;  4B3S L;  1Q12 A;  4GS3 A;  4KI0 A;  3M85 A;  2EXD A;  1QVF A;  5AJ3 Q;  3S16 H;  4YCW A;  1I3Q H;  2UUC L;  3HFZ B;  2IX1 A;  3M7N A;  2MQH A;  4LUV A;  4HIM A;  4APV A;  4X6A H;  3WWV A;  1WI5 A;  2MFI A;  4NPS A;  1H95 A;  5C0X G;  3D0F A;  2UUC Q;  3CMA A;  1Y1W H;  2JA6 H;  4IFD I;  4IPD A;  3BJU A;  1V1Q A;  4PG3 A;  5J3B A;  2JA5 H;  2UXB Q;  2UXC L;  4YWK A;  1XNQ L;  1S40 A;  5IYC G;  1EQQ A;  4DV0 Q;  2UXC Q;  4LFB L;  1N36 L;  4GNX C;  1R9T H;  4LF8 L;  3PO3 H;  3E0E A;  1N32 L;  4LFB Q;  1TWH H;  2WFW A;  2H5X A;  1KRS A;  2WB1 E;  3KF6 B;  4LF8 Q;  4JV5 L;  1HZA A;  3S24 A;  1C0A A;  3HKZ G;  5IY0 A;  4K0K Q;  3E9I A;  3U50 C;  4IFD J;  2KCM A;  3S2D H;  1BBU A;  4WJ4 A;  4DR7 Q;  3J81 i;  2PI2 A;  2GN5 A;  1K3R A;  3CC4 A;  2CCZ A;  1VQC A;  1GVP A;  1EWI A;  5ELN A;  3GTQ H;  4BXX H;  1VQM A;  3STB D;  3KYH C;  4DV7 L;  4DR6 Q;  1RIP A;  5JEA G;  3I56 A;  2I5L X;  3HOX G;  3HOX H;  3K80 C;  3J80 c;  4R4Q A;  4MTN A;  1HZC A;  3KF6 A;  4HJ8 A;  1V43 A;  1BKB A;  4Y7N H;  4GNX B;  4POG A;  1AE2 A;  1L1O C;  3F2B A; 
#chains in the Genus database with same CATH topology
 1VMP A;  4GLA C;  4CKB A;  1VQ9 A;  3VDY A;  2N55 A;  3DEO A;  1K28 A;  1WOC A;  4FVM A;  4ZCK A;  3ZYY X;  1PTO F;  2SNS A;  1H9M A;  1RF2 D;  3QB3 A;  4A3E H;  1RD9 D;  3QG1 A;  2B39 A;  2ES2 A;  5C3W A;  4NDX A;  1EUJ A;  3CQZ H;  3D4R A;  1PH5 A;  4P74 A;  2Z6K C;  2DN8 A;  2YYZ A;  1PRT F;  3FPU B;  4XYQ A;  2EYH A;  3I4O A;  1RTO A;  4UPA A;  1LTI D;  4KHP Q;  1MHW C;  3H3V C;  3NEN A;  1GOZ A;  1X55 A;  1L1O B;  1XMQ Q;  1YJ9 A;  1I94 L;  2PW7 A;  1NJI C;  3HGB A;  4OX9 L;  1S5E D;  2NTT A;  1HFN A;  3HOY G;  2A68 C;  2VXW A;  3URY A;  2K03 A;  2N8N A;  3AEV A;  2F0U A;  3T51 B;  3MEF A;  2RHS B;  2ZM6 Q;  1DCZ A;  3SEB A;  2E8G A;  3ERS X;  4EQP A;  4PMB A;  1TKW B;  1U4R A;  5DM7 3;  2QW7 A;  4ME5 A;  3CKI B;  1ILP A;  2I5H A;  4GKK Q;  3ITP A;  3H94 A;  1CA6 A;  3MHB A;  1LLR D;  1F9S A;  3PIP A;  4R4C A;  1A63 A;  1QNU A;  1EEI D;  2DNC A;  3HKZ E;  4RKL A;  3N52 A;  1C7Y A;  2BH2 A;  1KLU D;  1OXX K;  3J7A F;  3C2P A;  2B63 H;  2B63 G;  2YTV A;  5M5W H;  4OON A;  1X56 A;  1IW7 C;  2B8G A;  2K28 A;  4DUY L;  1IKM A;  2JJQ A;  1STG A;  1TWC H;  4CJ0 B;  3KFU A;  1SRU A;  1CQV A;  4HSV A;  1MKH A;  3CU7 A;  1EYA A;  1SLJ A;  1CZG A;  3MXU A;  4AYB B;  2UXB L;  4DF7 A;  1X3E A;  2F0M A;  2E2J H;  2AKW B;  3GQB A;  1BCP C;  4BY7 B;  1Q1B A;  2RCF A;  3N6R A;  4DUZ L;  5EPK A;  3J81 L;  3J81 j;  2HUG A;  4OIJ A;  4A93 B;  1Q7Y C;  1DM0 B;  2OTJ A;  4ZYS A;  2EY5 A;  1SNQ A;  4NKL A;  4X3S A;  4OO1 G;  4OO1 H;  4JCV E;  1IBM Q;  2JA6 B;  4DR7 L;  3S17 B;  3S15 H;  4L5Q A;  2K7V A;  2E5L Q;  4X3T A;  2OXP A;  4HAE A;  1YHA A;  3JC6 6;  4WJW A;  4A3G B;  2IL8 A;  2F03 A;  1SMY C;  2NVX B;  3EA6 A;  3OIP A;  4DR2 Q;  5JEA H;  4GZY C;  3KBX A;  5FK9 C;  4DV3 Q;  4DAV A;  1E7Z A;  3EQL C;  3MXN B;  1D7Q A;  3NBH A;  4I65 A;  2J4X A;  1VQ4 A;  2B2V A;  1J5E Q;  3F8T A;  4LK1 C;  4B3M Q;  5EPL A;  1NSN S;  2E75 C;  2QCP X;  3CW2 C;  5IOC A;  1SYC A;  1ICF B;  5IYD H;  1GUW A;  1E24 A;  4KHP L;  3CCQ A;  2BOS A;  3LNN A;  1TS4 A;  1LUZ A;  1I5F A;  1XMQ L;  2ATW A;  1CM9 A;  4NXN Q;  1SYF A;  2HQE A;  3BDL A;  5LMU Q;  2PO4 A;  4L6T B;  2ICI A;  4JI1 L;  2HCI A;  2AHO B;  3DHQ A;  1ASZ A;  5EKK A;  2QEJ C;  2EYL A;  3K7A H;  5E4X A;  1GXD C;  1D2B A;  4DV6 L;  3TS2 A;  3KBG A;  3TME A;  4CGY B;  1J9O A;  1YIT A;  4HCE A;  3BVG A;  2YTX A;  2B2Y A;  1L0Y B;  2EE1 A;  4AYB G;  1XNR L;  2JN4 A;  4KLK A;  5L37 A;  1G29 1;  1KD1 C;  1VQJ A;  4BY7 G;  4BY7 H;  4KMU C;  1Y8N B;  1CSP A;  4DR3 Q;  1A0I A;  3Q23 A;  1CKN B;  3KLS A;  3BS1 A;  4A93 G;  3SGI A;  3AQQ A;  1HRJ A;  1UE5 A;  2VY3 A;  1PTO B;  5H1S E;  2F1M A;  4GOP A;  3S1M B;  1ILQ A;  3JAM E;  1KDC A;  2BDO A;  4RKB A;  4A3G G;  4KTA A;  4KY7 A;  3MA2 B;  1X3G A;  1GM5 A;  2ZTD A;  5J22 A;  1PRT B;  1EWC A;  1CKN A;  2BDN A;  4O2D A;  3A0J A;  2KEC A;  3GTP B;  1K8O A;  1D6E C;  1X6O A;  1QB5 D;  1N9W A;  5I6Y A;  1NUC A;  2CH4 W;  1WTQ A;  1FJG Q;  5E1F A;  4UHV A;  5EBD A;  4AIM A;  1C8C A;  1WTV A;  1GUT A;  3GV6 A;  2KEN A;  1GJX A;  5J39 A;  1BVS A;  4OHJ A;  3BU2 A;  5JVG 3;  2HQL A;  5EJW A;  4IPG A;  1Q90 A;  1UUP A;  5EKI A;  1IYJ B;  4KY6 A;  2K4K A;  1PVO A;  3K5O A;  1PYS B;  4RWS C;  5IP7 H;  5IP7 G;  1MIU A;  2ASB A;  5IGG A;  3TRE A;  2R7Z B;  1PFS A;  5EPJ A;  3WDN A;  4DK6 C;  1CKO A;  1SE2 A;  4R4I A;  4HCS A;  1QOH A;  2LSS A;  5HGT A;  1L2F A;  2ZJQ A;  2OQK A;  3PF5 A;  4ZRZ A;  4DV3 L;  2MGS A;  3CPW A;  3PUY A;  4C3I B;  5EBC A;  4DXF A;  3RZD H;  2Q8I B;  5M9O A;  3RLN A;  1N36 Q;  2JA7 H;  3X3N A;  1QJO A;  4AYB E;  4JI2 Q;  1IZ6 A;  3VYR A;  1WVL A;  3TSS A;  4C1N K;  3ULP A;  1JT8 A;  1PLF A;  1S4Z A;  1XMO L;  3T53 B;  1JB7 A;  1UEA B;  2K5V A;  1P16 A;  3QIA A;  3GTL B;  2JEB I;  3VA7 A;  4QF4 A;  1Q46 A;  2PNH A;  3LWU A;  4IAL A;  4NXN L;  5BN4 A;  4Q5V A;  2OT2 A;  1YIJ A;  2QIL A;  4LUO A;  4EX5 A;  4DU9 A;  2JA9 A;  3PUW A;  3M4P A;  5LMU L;  5D3I B;  1EY6 A;  4JI0 Q;  2HCC A;  1L0W A;  2A5H A;  1PTO H;  1R9T B;  1I50 B;  1HNW Q;  4K8J A;  4TQU S;  3UE0 A;  4KHZ A;  1PH3 A;  1IHZ A;  1A3U A;  1Q8K A;  3CRK C;  3EN2 A;  1S5B D;  2RHQ B;  4DV1 Q;  1BNZ A;  2ZTE A;  1KIX A;  1VF5 C;  4QB4 A;  4CKE A;  4RGN A;  4X64 Q;  3E0J A;  2XVS A;  3AYH B;  1FL0 A;  3LGJ A;  1LO5 D;  3MZ5 A;  5A2Q L;  2Z4I A;  4Y52 H;  5IWA Q;  3K81 C;  5BN5 A;  3LWE A;  4A3F H;  4XQQ A;  4HJ9 A;  2NVQ H;  3CCV A;  2GVB A;  1PH1 A;  5FLM G;  5FLM H;  1NTG A;  3OMG A;  2R7Z G;  3A74 A;  4U68 A;  4XDX A;  1A3T A;  1MGS A;  1AE3 A;  1JC7 A;  2PQA B;  1LTA D;  4CBV A;  2MHV A;  2YTY A;  4CDD C;  2NN6 G;  2NN6 H;  2OF1 A;  4HJA A;  1YI2 A;  1W6J A;  1IKL A;  1P8L A;  5M3F B;  4RCO A;  2Z6K A;  1ZKO A;  4C3I H;  4C3I G;  3A56 A;  1FJG L;  4DV2 Q;  3NHH A;  3BYY B;  3S1Q B;  2PZW A;  5C3E H;  1CFM A;  3OYY A;  4FXG C;  4LFA L;  1G8Z D;  1GUO A;  1LTR D;  3BDO A;  3T56 B;  5AJ3 L;  5ELD A;  4AQY Q;  3C1E A;  1HCZ A;  4I7A A;  4YWM A;  3MXG A;  4DK1 A;  1QVF A;  3SK6 A;  4YCW A;  2MQH A;  4LUV A;  4HIM A;  4X6A H;  3WWV A;  2MP1 A;  5C0X G;  5C0X H;  2UUC Q;  3CMA A;  1Y1W H;  4DFA A;  3BJU A;  3I4M B;  2VUM B;  1I4R A;  1JB3 A;  1PFB A;  5IYC G;  4A3M B;  1H9K A;  4DV0 Q;  1KLG D;  1N36 L;  4LFB L;  1R9T H;  4LF8 L;  1ET9 A;  2XWJ B;  1SNM A;  4BY1 B;  3E0E A;  3GTJ B;  1RHP A;  5CYU A;  1SND A;  2EY2 A;  4CKC A;  1KRS A;  3D8G A;  5IY0 A;  4B9W A;  2E74 C;  2GN5 A;  1EWI A;  2A6H D;  5ELN A;  1VDZ A;  3I56 A;  3M4O B;  2A69 C;  2X6G A;  3K80 C;  3R2I A;  4OEM B;  2MJ8 A;  4HJ8 A;  1BKB A;  3G6J B;  4GNX B;  2OWO A;  3D6C A;  3J80 E;  4LF7 Q;  3K8A A;  3ERQ A;  1K83 B;  2D0P A;  2Z4H A;  3DWA A;  2KED A;  4F87 A;  3PO2 B;  1JCK B;  3AFQ A;  1D5Z C;  3B6Y A;  4DNI A;  3Q24 A;  4DV1 L;  2NVY H;  4KV6 A;  1R4P B;  1UEB A;  2EZV A;  4JI6 Q;  1STE A;  2KQ3 A;  3NEM A;  4GNX A;  5C5M A;  1JWU D;  2WP8 J;  4GN3 B;  5T1I A;  4OO1 I;  2WIN B;  4X64 L;  3RN2 A;  2KHJ A;  5IGD A;  2A8V A;  2MO0 A;  2IJ0 A;  1O7Y A;  3NQT A;  5M3F G;  1DON A;  1D1K A;  2KEE A;  3HOV B;  4JC0 A;  3CXC A;  4M1U B;  1ASY A;  1SNP A;  3HOZ H;  2R92 G;  2R92 H;  3SE0 A;  1RKN A;  4DR1 L;  4ZUJ A;  4DV5 Q;  1G2T A;  1TT2 A;  4MIU A;  4CHT B;  3E6Z X;  1MSH A;  3NWT A;  4DR5 Q;  4DK0 A;  2O2L D;  1M8A A;  1F9R A;  4F8M A;  1T5X D;  2Z9H A;  2A1A A;  3U9O A;  4FXD A;  1I4Q A;  1DOK A;  2EXZ A;  4X3K A;  5G3L D;  2UUA Q;  1CK1 A;  2N49 A;  1TII D;  4DXG A;  1STY A;  1FR3 A;  2F0S A;  3BYT B;  4PNY A;  4RG1 A;  3I3C A;  4RMF A;  4BA2 I;  3G6E A;  5JEA J;  2VUM G;  2VUM H;  3I4M G;  5COY A;  3H91 A;  2L15 A;  4DV2 L;  2VQE Q;  1AH9 A;  1B4O A;  4A3M G;  2BA0 A;  1ZXT A;  5D65 A;  1LT4 D;  5ELF A;  2EYF A;  2LFN A;  2FXQ A;  2XRQ D;  4BY1 G;  4BY1 H;  1PFM A;  3I70 A;  1FGU A;  5A35 A;  4AQY L;  3OW2 A;  1CA5 A;  2F0G A;  1IBL L;  3U4V A;  2ID0 A;  3TS0 A;  2F0Q A;  3K5L A;  1IYU A;  1WD1 A;  4A3K B;  4FF3 A;  3I4N B;  4OEL B;  5I4D A;  4DUY Q;  1TWG B;  1G91 A;  2EPB A;  1EIY B;  3S1R B;  3GV3 A;  4RH6 A;  2WV6 D;  1O78 A;  4ZKC B;  2WAC A;  4MN3 A;  4BBS B;  1G51 A;  5C6A A;  2V4D A;  4DV0 L;  4LUZ A;  3X3M A;  3QOL A;  2G9D A;  5KEE A;  5IT9 c;  1K83 H;  2ZJP A;  2L11 A;  4H02 A;  3PO2 G;  1FYC A;  3A5Z B;  1GO3 E;  1AW7 A;  4DUZ Q;  1M90 C;  3UDF A;  1HUN A;  4C2M H;  3T1H Q;  1A8V A;  2UUB L;  1JMC A;  5JOB A;  3W3A A;  2FJ2 A;  2K50 A;  2CH4 A;  1Z9F A;  2RVL A;  2PPB C;  2K5W A;  1X9N A;  1YBY A;  3HOV G;  3T4A C;  4DN4 M;  2ZTC A;  3PV0 A;  1NY4 A;  2XIW A;  3J7Y W;  2XTI A;  2NVT B;  4ID6 A;  2M00 A;  2VB2 X;  4LF7 L;  4K8I A;  1HJP A;  1HR0 W;  5FO7 B;  2KVM A;  5E4W C;  2E2D C;  2PYK A;  3H0G H;  3H0G G;  1TS5 A;  1IBK L;  4IPC A;  4JI6 L;  5FLX c;  4RA8 A;  1CT1 D;  5I9O A;  4RHS A;  3TP6 A;  1OXU A;  1DYQ A;  2F0L A;  1I3Q B;  1Q3L A;  4OGQ C;  1QZG A;  1E1T A;  1SYB A;  1E22 A;  5GQO A;  2F0T A;  3FP9 A;  4DK3 C;  3CPF A;  4ZLT F;  1KC8 C;  1GHK A;  2P5Z X;  3NWS A;  4DV5 L;  1SFO B;  1VS0 A;  3AU7 A;  4HID A;  3K7U C;  2FIN B;  3FVQ A;  4DR5 L;  1JJG A;  1KNA A;  4YIJ A;  3PO3 B;  1STN A;  3K0X A;  1YNX A;  3FRP B;  3HOY H;  1TWH B;  1W2B A;  5G3L F;  2UUA L;  3DM1 A;  4A3K G;  1N34 Q;  1EU3 A;  3I4N G;  4HIO A;  4JI1 Q;  2Z1C A;  2JXM B;  3S2D B;  3U4Z A;  4LNQ A;  4ODG A;  1JOQ A;  3T13 A;  1VQO A;  4DV6 Q;  3J81 E;  2K33 A;  2N78 A;  3CC2 A;  4BBS H;  3MTS A;  3HOX B;  4BBS G;  1I6H H;  1AEX A;  1OXS C;  1Z6H A;  2RDG A;  5GAE C;  2VQE L;  2E2H H;  1VQL A;  3QR8 A;  1XNR Q;  1A2T A;  1IYV A;  3HP3 A;  4RGT A;  1LAB A;  4KD4 A;  3KOJ A;  1C9O A;  3J7A V;  2CW0 C;  2DGY A;  2EOT A;  1PH2 A;  5I9P A;  4FDB A;  2EDG A;  3PMF A;  1IW7 D;  1AFP A;  3DXJ C;  3VR2 A;  3GTO B;  1L0X B;  3KLR A;  2DY8 A;  1U9R A;  3SR1 A;  4IUP A;  3DWP A;  3CF5 A;  1WTO A;  3R8B A;  3L2P A;  3A8J E;  3C1F A;  4DAY A;  4OWW B;  3BVZ A;  3PIO A;  1PH6 A;  1XTD A;  3KF8 B;  4ZQ3 A;  1Y8P B;  3ERO A;  4QY7 A;  1SNO A;  1SR3 A;  1PV4 A;  5C4X B;  1ESR A;  1BCP D;  3F2D A;  1B50 A;  2AWO A;  3NTH A;  3MC0 B;  1VF7 A;  2E76 C;  1SBB B;  3PUZ A;  4IUN A;  3I91 A;  1U0L A;  4HED A;  4FF4 A;  5HY6 A;  4ULL A;  3T1H L;  1BDO A;  3ULL A;  3KF8 A;  2HIV A;  4NMZ A;  4B3S Q;  4ZK9 B;  1FNV A;  3NP8 A;  4IUU A;  5KRU A;  5K36 G;  5K36 H;  3NBH B;  2O4X A;  2I0Q A;  2HT1 A;  4QMG A;  2R93 B;  1KXL A;  3SK4 A;  4Q0F A;  4JBM A;  1B3Q A;  4TVA B;  1SMY D;  5KYL A;  5FOB B;  5BR8 L;  1SFO H;  1YJW A;  4IUR A;  2NN6 I;  4E6I A;  2DNE A;  3PO3 G;  1X65 A;  5FJ8 H;  5FJ8 G;  3PF4 A;  1LV9 A;  5LHY 1;  2OCE A;  1BXT A;  2L9H A;  3VR5 A;  2F52 A;  2AMC B;  4KKS A;  3VYS A;  3QWN A;  2LS0 1;  5JPN C;  1SYE A;  4HR7 B;  2EY1 A;  4J8Q A;  4LJZ C;  5JPM C;  3STB C;  3S14 B;  1A3V A;  4JBW A;  1XMO Q;  5IIF A;  3AFP A;  4DV7 Q;  2SDF A;  1STB A;  2RF4 A;  1XWE A;  2A6E C;  1HH2 P;  2KCC A;  4CJ2 C;  1I4G A;  5C0X I;  4EQO A;  1S3O A;  1SYD A;  1PFN A;  3P1H A;  5DEH A;  2IPK D;  1EOV A;  4JI7 L;  1QZH A;  1N34 L;  3DWQ A;  1MJC A;  1EIF A;  2L5T A;  1JWM D;  5ELE A;  1Z7T A;  4XYO A;  2HD3 A;  3PUX A;  3CCS A;  1Y69 U;  3NBI A;  2E2I B;  3GTM B;  4CDE C;  1LTL A;  5CV4 A;  1W6K A;  2R7D A;  4N8F A;  2NYZ D;  4P73 A;  3GTQ B;  2VS1 A;  1ENA A;  1KL9 A;  4B08 A;  4YCU A;  1IL2 A;  4BS9 A;  5C4X G;  2A73 B;  3J7Z C;  4UP8 A;  4GOP B;  3TP7 A;  4JI4 L;  3G48 A;  2B29 A;  1HZ9 A;  4NW2 A;  3SVM A;  3HZX A;  1ROD A;  1SE8 A;  2IHF A;  2NB0 A;  4L5T A;  3K59 A;  1O7I A;  1VQA A;  1J6Q A;  4A93 H;  2RSO A;  4LF9 L;  5KIX A;  4ALP A;  3KJO A;  1SE4 A;  2IY5 B;  2D9U A;  4J1M A;  4X62 L;  4XT1 B;  1BQQ T;  4C3J B;  2JA6 G;  2JA6 H;  2Q8R E;  1EZ6 A;  3S17 H;  1QVC A;  4H13 C;  4WJ3 M;  5LMN L;  1KNE A;  2KUM A;  1EEF D;  2CFM A;  4A3G H;  3ND8 A;  5M3M B;  2R93 G;  2R93 H;  2N3S A;  4NB3 A;  4UP7 A;  2CQA A;  2NVX H;  4CDC C;  5I6W A;  2K5N A;  3P7J A;  4C3H B;  2F4V L;  1SMX A;  3PSI A;  1BCP F;  2FMC A;  1TWA B;  5DLQ E;  2DUD A;  3S2H B;  1HTL D;  3RUZ A;  3T1Y Q;  5AFW A;  4YY3 L;  3Q0A A;  3CME A;  3IAY A;  4A3D B;  1EYD A;  3M9B A;  2MO1 A;  4N9P A;  1F9P A;  4GLX A;  4LFA Q;  3I90 A;  5LMN W;  4B3S L;  4KI0 A;  4GS3 A;  2EXD A;  5AJ3 Q;  3VR6 A;  5C4H A;  2MPM A;  3HFZ B;  1SAP A;  1QCB D;  2MFI A;  1H95 A;  2JA8 B;  2ZXP A;  2F0P A;  1H9J A;  4HMJ A;  2WKD A;  2UXC L;  4K2K A;  5M5Y B;  2R61 A;  2KOL A;  4LFB Q;  1ENF A;  2WFW A;  4LF8 Q;  3O13 A;  1HZA A;  1C0A A;  1X32 A;  4K0K Q;  3E9I A;  2KCM A;  2PI2 A;  5C4J B;  1Q8I A;  4K6D A;  5A2Q E;  3K0Y A;  2B2W C;  3CC4 A;  1GVP A;  3GTQ H;  2I07 B;  1VQM A;  2PZU A;  4DR6 Q;  1BR9 A;  4DV7 L;  3MAQ A;  2CHB D;  2I5L X;  3A55 A;  3TDQ A;  4MTN A;  3R2T A;  2EJM A;  1HZC A;  2PQE A;  4K5W A;  5KND A;  5D14 A;  4POG A;  1AE2 A;  1L1O C;  3PGZ A;  3RLF A;  4L63 B;  4LF4 L;  1Y1V B;  3P20 A;  5CV7 A;  3GDE A;  4DNT B;  1BBW A;  4XQN A;  1PH9 A;  4C3J G;  1AZQ A;  1SYG A;  5C5L A;  3S1M H;  1TWF B;  1AN8 A;  1U4L A;  5M3M G;  5TSS A;  1CI3 M;  3EIV A;  4LMQ D;  4GKJ Q;  3S1N B;  5C44 B;  1N33 L;  1JWS D;  2WAQ B;  3GTP H;  4C3H G;  1FNU A;  2RSN A;  2IX0 A;  2K75 A;  1SSO A;  5IT9 L;  4CJ1 B;  5JJK A;  2PCF B;  2F0D A;  5DAU A;  1WJJ A;  3TN2 A;  5DNF A;  1K0S A;  4A3D G;  4A3D H;  5CV5 A;  4DR1 Q;  3F2U A;  3S9W A;  1K9M C;  1QIL A;  3M3Y B;  3I8Z A;  3OPO A;  1NR2 A;  4L5S A;  1GUS A;  4IFD G;  4IFD H;  1F9Q A;  4DV4 L;  1OXV A;  4IN3 A;  2R7Z H;  2JA8 G;  2EY6 A;  5GRO A;  4GLV B;  3FHW A;  5EAY A;  2B2T C;  2Q2I A;  3KLW A;  1EY8 A;  1MJE A;  4YHH L;  4V19 0;  5K5P A;  2EYP A;  2VZA A;  2EYM A;  1EY4 A;  4QQB X;  1WCM B;  3T1Y L;  2Y0S B;  1EQT A;  3D31 A;  1D5M C;  5FLX L;  1C48 A;  4LW1 A;  1EQR A;  3U58 A;  1H9S A;  3Q8D A;  4FP5 D;  1AZP A;  3P75 A;  2IHE A;  3L0O A;  1VQK A;  3ER0 A;  1BF4 A;  1UWV A;  2ENB A;  1DOL A;  1NMG A;  1IBL Q;  3GTL H;  4FF1 A;  1VQH A;  2VW9 A;  1VQ6 A;  1DJR D;  4P71 A;  1SNC A;  2IX3 A;  4BBR B;  2EJF C;  1CKM A;  4X3U A;  4A3B B;  1MD2 D;  5HUR A;  1ONL A;  2O5I C;  3HOU B;  3CCJ A;  1Y1V G;  1YEZ A;  1X54 A;  5IYC H;  1I50 H;  4GN4 B;  1HQR D;  3DLL A;  2G5D A;  3RNU A;  4K0K L;  2CWP A;  2NUC A;  4P72 A;  1HR0 Q;  1D1I A;  1JQY D;  1E1O A;  1ZYR C;  4ZUI A;  3S1N H;  2EVB A;  5C44 G;  5C44 H;  1RJT A;  4DR6 L;  2WAQ G;  3FDT A;  2VNU D;  4K6L A;  2UUB Q;  3BZC A;  1EOT A;  5C3X A;  2L12 A;  2A69 D;  1BCP B;  1JE4 A;  2QGQ A;  2HHH Q;  2BE5 C;  3PIP 3;  3A7A B;  1UAP A;  4EVO A;  2PZT A;  4A3J B;  4L8J A;  1HQM C;  3E9H A;  4XTC S;  2ZXO A;  1K73 C;  3W5O A;  3RN5 A;  4HTH A;  2RDH A;  1I4X A;  2M2L A;  2VQF L;  3KJP A;  4A75 A;  4LF5 L;  4UY8 C;  1JOR A;  4GKJ L;  3NUC A;  1IBK Q;  4KHV A;  1RL2 A;  1VQG A;  3H3V H;  3OHX C;  1KAW A;  1JIC A;  1VQP A;  1YNN C;  1TU2 B;  3IFD A;  1VQF A;  3RMH A;  4RGM A;  1HXY D;  5GAG C;  1NR4 A;  1WCM G;  4DKA C;  5M3F H;  2JA5 B;  2Y0S G;  1S5F D;  1XXG A;  2SNM A;  1VQD A;  2M9V A;  5M5X B;  1EIG A;  3V96 A;  3S1Q H;  5JJL A;  2B3G A;  2C35 B;  4CDF C;  5JJZ A;  4FO2 A;  1EU4 A;  1EIH A;  3A5U A;  1B70 B;  1S5D D;  3TP8 A;  1EYC A;  5IGB A;  4LWC A;  3HKZ B;  3L7Z C;  1PTO C;  2J7Z A;  2L55 A;  4JYA L;  1WD0 A;  4LF6 L;  2CWA A;  1ICW A;  2PNR C;  4BBR G;  4DPG A;  1PRT C;  2TSS A;  1FVI A;  4DR4 L;  5LL6 X;  3VA5 A;  1PH4 A;  1EWH A;  4XT3 B;  3HS0 C;  5FO8 B;  3I4M H;  3HOU G;  1JR0 D;  1PYB A;  5CBE E;  1IXR A;  4Y7N B;  4HIK A;  1RTN A;  1XPU A;  4A3M H;  2CQO A;  4PQX A;  3JAM c;  1U5K A;  4MZ9 A;  4OWT B;  3UDG A;  2WAQ E;  3GTJ H;  5IE8 A;  1HNX L;  1LT3 D;  3TQY A;  1EL0 A;  3KDF B;  3A54 A;  4A3E B;  4WRD A;  1SRO A;  4HJ5 A;  5JVH 3;  1VQE A;  3VYT A;  1HA5 A;  2NWG A;  1K8G A;  1Q86 C;  3M4O H;  3IRB A;  1YNJ C;  4JOI C;  1D8L A;  1PZK D;  1SJE D;  2C5C A;  2IWH A;  4KY5 A;  3KDF A;  3RLO A;  4A3J G;  4RCN A;  2KHS A;  3C46 A;  1A2U A;  4PZ7 A;  1ML0 D;  4IUQ A;  2X6L A;  5IYB H;  5IYB G;  3PO2 H;  4QCL A;  2N88 A;  4R8N A;  1HR0 L;  3MWY W;  4NP5 A;  4FXK C;  1E2W A;  1QG7 A;  2Y0S E;  1LTT D;  1QVG A;  2JSO A;  2KA7 A;  1VQ8 A;  1TY2 A;  1M4V A;  2KJX A;  2JA5 G;  2HHH L;  1EY9 A;  2YU9 B;  1DZ1 A;  3I55 A;  1VQ5 A;  3HOV H;  1KHI A;  3EBE A;  1Y14 B;  5M5X H;  3CRL C;  4GN5 A;  4IUT A;  1G2S A;  3L3O C;  3H6M A;  5BR8 Q;  1XNQ Q;  4IOA A;  3MFG A;  2IW3 A;  2HDM A;  5CV6 A;  3GTK B;  5E3F A;  5EQ0 A;  3SK8 A;  4JI8 L;  1NMF A;  3I73 A;  4DA2 A;  1N32 Q;  2Z8L A;  1DD2 A;  3M4Q A;  4OWX B;  2C9O A;  1F2Y A;  4BXX G;  1NE3 A;  1JJ2 A;  3S16 B;  3NXW A;  4IQZ A;  1JOK A;  4HJ7 A;  1JJC B;  1RCV D;  1X3P A;  3FMC A;  1K8A C;  4JI5 L;  4HSP A;  2NTS A;  3EFX D;  1A15 A;  1A62 A;  4BWG B;  4XQJ A;  3DM3 A;  3OMC A;  2JQO A;  1S72 A;  2UXD Q;  3M7G A;  3K57 A;  2JEA I;  3HEJ A;  5DM6 3;  2ZT9 C;  3ULJ A;  3HKS A;  3L9A X;  4A3E G;  1E3P A;  3W1G A;  3K5M A;  3CCE A;  2Z0S A;  2UU9 L;  2A68 D;  4JI7 Q;  1H9R A;  3S15 B;  4A3K H;  3I4N H;  2AQ1 B;  4K5X A;  3AMU A;  1TWG H;  1PH8 A;  3R93 A;  1PHJ A;  2LKV A;  3Q22 A;  3S1R H;  1B8A A;  2XRS D;  1B53 A;  4N8X 1;  1EQV A;  1NBW A;  1V8Q A;  3GO5 A;  1TS2 A;  2B2W A;  3A7L A;  4H44 C;  3K58 A;  2FHT A;  5FKA C;  5JAV A;  2JYO A;  1PZJ D;  2D62 A;  1TR5 A;  2K01 A;  2XGT A;  3VR3 A;  1MI2 A;  1MSG A;  4JPB W;  1LAC A;  2CW0 D;  5COR A;  1BUV T;  1S5C D;  4JI4 Q;  4DAY B;  4FNF A;  3G71 A;  1XX8 A;  2KCN A;  1L1O A;  4TRD A;  1F2Z A;  3GD7 A;  4POF A;  4LF9 Q;  3TRZ A;  4X62 Q;  1DGS A;  4B3R L;  2B2U C;  1N8R C;  1YVC A;  5LMN Q;  2YU9 H;  2LXK A;  4MTK A;  5I2Y A;  2Q8T A;  2KBN A;  4X65 L;  5CGK A;  5F2D A;  1XPR A;  1LT5 D;  2NVT H;  1HFG A;  3T16 A;  2WKC A;  2F4V Q;  3GTK H;  2D2C C;  4KKU A;  1V9P A;  4A4I A;  1NAP A;  4N9T A;  4JG2 A;  1FNW A;  1B7Y B;  4YY3 Q;  1DOM A;  4K2L A;  3K7A B;  3S16 H;  1SJH D;  1I3Q H;  3V05 A;  3M7N A;  1STA A;  4APV A;  1WI5 A;  3U9S A;  1HHV A;  1PYW D;  5ELC A;  4IFD I;  4IPD A;  4R8I A;  4QUC A;  2PMZ B;  3SXH A;  4YWK A;  1XNQ L;  1EZ8 A;  1S40 A;  2B2T A;  2UXC Q;  3DMU A;  4PV1 C;  4GNX C;  3PO3 H;  2A74 C;  1N32 L;  1A6X A;  1TWH H;  2H5X A;  3KF6 B;  4IFD J;  3S2D H;  4WJ4 A;  5ISR A;  2F0E A;  1K3R A;  2CCZ A;  1VQC A;  3MEH A;  3STB D;  3KYH C;  3UI2 A;  5JEA G;  3HOX G;  3HOX H;  1J8I A;  3J80 c;  1VMC A;  4R4Q A;  2A6E D;  3KF6 A;  1V43 A;  2F0K A;  4WFN 3;  1HUM A;  3S24 A;  3I4L A;  3F2B A;  2UXD L;  2K04 A;  3NK9 A;  2QA4 A;  2RBM A;  4J6H A;  2VB3 X;  3JAM i;  1VQB A;  1Z47 A;  3CCU A;  2K5H A;  4LF4 Q;  3QJY A;  3TBI B;  1FGB D;  3GTO H;  3NTK A;  4P2C B;  1HA6 A;  3V2T A;  1KQS A;  3NE5 B;  3MXN A;  5IYD G;  2ALY B;  4R9W A;  3C3L A;  4NXM Q;  2BA1 A;  4OIK A;  1EYG A;  1LTS D;  3PCO B;  3MXP A;  1LTG D;  4KN4 C;  5C0X J;  5IOD A;  3OOC A;  1YZ6 A;  2I46 A;  1N33 Q;  2K1B A;  1C4Q A;  1I6V C;  4YCV A;  4I7Z C;  5C4X H;  3RZD B;  2J0T D;  3FKI B;  1BO0 A;  3VR4 A;  3SK5 A;  3OSO A;  2ZM6 L;  2JA7 B;  2F0F A;  2QEX A;  2XNA C;  1ENC A;  3G7L A;  4RGO S;  1X3F A;  2QDL A;  4KN7 C;  1EFI D;  4QIW B;  1LTB D;  4R4O A;  2X69 A;  3IKJ A;  2F3V A;  4GKK L;  1G6Z A;  2NZH A;  4ILW A;  4KJN A;  4X66 Q;  1HNZ Q;  4DV4 Q;  5BN3 A;  3H3V I;  1CSQ A;  4XIG S;  3TZU A;  2LXJ A;  1EFW A;  4A3C G;  4A3C H;  2RA4 A;  1I4H A;  2K6A A;  2OEO A;  4QUF A;  2EQS A;  4YHH Q;  4H7B A;  1VQ7 A;  1XPO A;  2KCT A;  1OTC A;  1NNX A;  2AQ2 B;  2CVR A;  3EJI A;  1LYL A;  4O0A A;  1Y8O B;  4DNR B;  1IL8 A;  2F3W A;  1WTH A;  3A8I E;  5ELO A;  2ZJR A;  3KLS X;  5J1Z A;  2D5D A;  1WTR A;  3W1B A;  1EY5 A;  5CR3 A;  3S14 H;  1JOO A;  2DJG C;  4YWL A;  4ZAI A;  3CCM A;  1BBX C;  5C4Z A;  3F2C A;  1G6P A;  1WTW A;  1TS3 A;  2Q2H A;  5I2X A;  3E5S A;  1B1Z A;  4A3F B;  1UE7 A;  3FPP A;  1IBM L;  2V1C C;  1B2T A;  3MVV A;  2E5L L;  4AH6 A;  2NVQ B;  2SEB D;  5IT9 E;  1YHB A;  1SN8 A;  4JVZ A;  4PZ8 A;  4UDU C;  2ZXR A;  4L5R C;  1PZI D;  3GP7 A;  2E2I H;  3GTM H;  4DR2 L;  3NTI A;  3RR5 A;  5CC4 A;  4P75 A;  4KKT A;  4G7H C;  1D5X C;  4PMW A;  1K8M A;  3D4W A;  1YJN A;  3JAM L;  1SEB D;  2EYO A;  2MUY A;  2EJG C;  3UE1 A;  1WFQ A;  3FKI H;  3FKI G;  1AP0 A;  1HTP A;  1J5E L;  1W3S A;  5C3E B;  2JA7 G;  5FO9 B;  4JOI A;  3OWF A;  4B3M L;  5JJI A;  4FF2 A;  2Q2T A;  1GD7 A;  1K0R A;  5GAH C;  2F0I A;  4LFC Q;  2RDF A;  2FMM A;  2PMZ E;  4C3J H;  1PMR A;  2GA4 B;  2XN9 C;  3D6W A;  4Z9C B;  4NXM L;  2R6G A;  3R3O A;  3UDI A;  4F88 A;  1PH7 A;  1V1P B;  2VQF Q;  2L4N A;  1F77 A;  5M3M H;  1QUQ B;  5LL6 S;  1ET6 A;  3ZJY C;  2AUK A;  4G7Z C;  4RFB A;  4LF5 Q;  5FLX E;  1VQN A;  2BH8 A;  4B3T Q;  1U4P A;  4G57 A;  1WTX A;  2R7F A;  4V0B A;  1Y1W B;  3CC7 A;  1JE5 A;  4C3H H;  2SOB A;  4F7X A;  1KAB A;  1VCI A;  1V1O A;  2LY7 A;  2WII B;  1TWA H;  1GUG A;  3KUP A;  3I7F A;  2TMP A;  2Z6B A;  3S2H H;  1V1P A;  1GKH A;  4KJO A;  5IGC A;  1QUQ A;  2JE6 I;  2VL6 A;  4IPH A;  3TZD A;  2NZO A;  3WOE A;  1O80 A;  2QF7 A;  3J81 c;  4TSS A;  3TP5 A;  1CUK A;  1E2Z A;  3QO2 A;  1TXY A;  4R1J A;  4RHR A;  3GTG B;  2Q2U A;  1KRT A;  3W2D A;  4X66 L;  3K5N A;  1HNZ L;  2K5D A;  1KDB A;  4JYA Q;  1ZEQ X;  1WYD A;  5KGU A;  2K5Q A;  2JA8 H;  4LF6 Q;  1HZB A;  2JK8 A;  4OXP A;  4DR3 L;  4O42 A;  3UDX A;  1GHJ A;  2F0N A;  4WOR A;  1H9S B;  4ABN A;  4DR4 Q;  2K14 A;  3K6O A;  2I5M X;  1XYI A;  4JI3 Q;  1EY7 A;  1O7Z A;  3H09 A;  3OTO Q;  1T5E A;  4A3F G;  2FFK B;  4QL5 A;  2F0W A;  1Q1E A;  4EQ5 A;  5M5Y H;  1F2M A;  3HOW B;  1T9H A;  4KK7 A;  2PW5 A;  3F1Z A;  1XJV A;  2NVY B;  5C4J H;  1B9M A;  2RCN A;  1HNX Q;  4FYD A;  2OTL A;  3Q6S A;  1RDP D;  5NUC A;  3G4S A;  1CQF A;  2KHI A;  3ICE A;  2WB1 B;  3I72 A;  4QIW E;  2B2V C;  2HIX A;  2IT1 A;  1VQI A;  4S3S A;  3J80 i;  4G4K A;  5C3E G;  4JBK A;  1Q82 C;  3HOZ B;  2R92 B;  4R4T A;  3BDC A;  4A3I B;  2NBF A;  2R3Z A;  1WTP A;  2L1B A;  2PQA A;  1I4P A;  1Y1V H;  1CHQ D;  2AUJ D;  4ZKB B;  1ESF A;  3BVM A;  1STH A;  4MNO A;  4UAI A;  3EVQ A;  5D3D A;  1E0B A;  3ONA B;  5HGQ A;  4TKO B;  4K5V A;  4G7O C;  1TWF H;  1O7L A;  3RD4 A;  4EGV A;  1OXT A;  1ZYR D;  4HN7 A;  1CTM A;  3D4D A;  3RZO B;  2B8F A;  1Y1W G;  5KNC A;  3NPP A;  2GVA A;  4HMI A;  4MHE A;  4JK1 C;  5CV8 A;  3H15 A;  4A3L G;  4A3L H;  2BE5 D;  2B2U A;  1LT6 D;  4EQN A;  4IO9 A;  4QJF A;  3IFT A;  4ME3 A;  4JI2 L;  2DJF C;  1MBY A;  1UNS A;  4LFC L;  4DAM A;  1Q81 C;  5CMD A;  4DGZ A;  3NEL A;  3PQI A;  2K52 A;  3OWE B;  2B2Y C;  3M3Y H;  3I2Z A;  2F0J A;  3HRZ C;  5IP9 G;  5IP9 H;  3GTG H;  1CHP D;  4JI8 Q;  3FEW X;  4JV5 Q;  3J7A 5;  1K3B C;  4U67 3;  2PI2 E;  5EGT A;  3AB9 A;  2A6H C;  2CKZ B;  4B3T L;  2L0C A;  2QDB A;  1OO9 B;  1QNK A;  3OW7 A;  1GUN A;  1LM0 A;  2A19 A;  1HPC A;  1YNN D;  2K05 A;  3PUV A;  3PIO 3;  4IJL A;  5GAD C;  2AWN A;  1WCM H;  4JI0 L;  2K32 A;  2F3I A;  3NQI A;  4GOP C;  4DAP A;  1HNW L;  4O1N A;  4JI5 Q;  1QE6 A;  3HOW H;  3HOW G;  1X3Q A;  4OL7 A;  2F0V A;  2OQ0 A;  3CAM A;  3TEH B;  4C2M B;  4LAA A;  1PTO D;  1B9N A;  3CCR A;  2UU9 Q;  1TQO A;  1XTC D;  2ICE C;  2JP1 A;  4IZ8 A;  2WB1 G;  1PRT D;  4BBR H;  2QKI C;  4A3B H;  5IWA L;  4A3B G;  4JI3 L;  1E2V A;  3SHL A;  3HOZ G;  4UP9 A;  3OTO L;  1BOS A;  1KAA A;  3BZK A;  2BCO A;  4A3I G;  4A3I H;  4RAU C;  3HOU H;  5IGE A;  3DEP A;  2EIF A;  1I94 Q;  4M8A A;  5EKL A;  1U4M A;  4OX9 Q;  3QOJ A;  1M1K C;  5E7N A;  2H1E A;  3CP0 A;  3H0G B;  4BA1 I;  3WOF A;  2MNA A;  4PZ6 A;  4J15 A;  4QGU A;  4IJH A;  1PA6 A;  3RZO H;  1CZW A;  4JBJ A;  4PMC A;  3NSW A;  3J80 L;  2YV5 A;  3CQZ B;  1F2L A;  1TVX A;  1YHQ A;  5KNB A;  4B3R Q;  1SDF A;  2XWB B;  3CD6 A;  3BG3 A;  4A76 A;  4KD3 A;  1SE3 A;  2EYJ A;  3A8K E;  1YNJ D;  4H0L C;  2D0O A;  4IOC A;  1KTK A;  1PXU A;  2H4O A;  3D3R A;  3CCL A;  3VYU A;  4A3J H;  1UE1 A;  4X65 Q;  1KDA A;  3LX0 A;  4C56 C;  5CV9 A;  2XSC A;  4XXE A;  1UE6 A;  4IUV A;  3HOY B;  2RQX A;  3SDZ A;  1Q12 A;  3M85 A;  2UUC L;  2IX1 A;  2AQ3 B;  3DUZ A;  1B44 D;  1DXM A;  1R4Q B;  3M4Y A;  4NPS A;  4C1N I;  3D0F A;  1I6H B;  2E2H B;  1V1Q A;  4PG3 A;  5J3B A;  2JA5 H;  2F0H A;  2UXB Q;  2O5J C;  1TY0 A;  2F4I A;  5T1G A;  4B9X A;  1II3 A;  1EQQ A;  3IL8 A;  2HDL A;  2DY7 A;  5CBA E;  1EY0 A;  5ELB A;  3BZD B;  4K14 A;  2G9H D;  2LMC B;  3KK7 A;  2WB1 E;  3CHB D;  3ND9 A;  1QWY A;  1SXT A;  4JW0 A;  2B63 B;  3HKZ G;  4JV5 L;  3U50 C;  5M5W B;  3E3X A;  5KYI A;  1BBU A;  4DR7 Q;  3J81 i;  3MFY A;  1TWC B;  4BXX H;  2NZ1 D;  1B3A A;  3OIQ A;  1PDQ A;  1RIP A;  5IGF A;  1NCV A;  2F0O A;  3HG9 A;  2E2J B;  4Y7N H;  1FD7 D;  2RKS A; 
#chains in the Genus database with same CATH homology
 2QA4 A;  4GLA C;  3PGZ A;  3RLF A;  4LF7 Q;  3K8A A;  4LF4 L;  4DR4 L;  2D0P A;  1VQ9 A;  3VDY A;  3GDE A;  3JAM i;  1BBW A;  1VQB A;  1PH9 A;  1Z47 A;  1WOC A;  3CCU A;  2K5H A;  4LF4 Q;  3AFQ A;  4A3E H;  3B6Y A;  3S1M H;  4DNI A;  4DV1 L;  2NVY H;  1UEB A;  2ES2 A;  4JI6 Q;  3GTO H;  5M3M G;  1EUJ A;  1KQS A;  3CQZ H;  5IYD G;  2ALY B;  3EIV A;  3NEM A;  4P74 A;  4GNX A;  2WP8 J;  2Z6K C;  4GN3 B;  2BA1 A;  1PH5 A;  4GKJ Q;  2YYZ A;  1EYG A;  4OO1 I;  3PCO B;  1N33 L;  4X64 L;  3RN2 A;  2KHJ A;  3I4O A;  5C0X J;  2A8V A;  2MO0 A;  4UPA A;  3GTP H;  5M3F G;  4KHP Q;  2IX0 A;  2K75 A;  1YZ6 A;  3NEN A;  1N33 Q;  5JJK A;  1X55 A;  4JC0 A;  4YCV A;  1L1O B;  1XMQ Q;  3CXC A;  1ASY A;  5C4X H;  1YJ9 A;  1I94 L;  3HOZ H;  2R92 G;  2R92 H;  1WJJ A;  4DR1 L;  4DV5 Q;  1NJI C;  4A3D G;  4OX9 L;  4A3D H;  3HOY G;  4DR5 Q;  2ZM6 L;  4DR1 Q;  2QEX A;  1K9M C;  1X3F A;  2A1A A;  2N8N A;  3AEV A;  4L5S A;  3MEF A;  2RHS B;  2ZM6 Q;  2UUA Q;  4BBS G;  2N49 A;  2E8G A;  4R4O A;  3ERS X;  4IFD G;  4GKK L;  2NZH A;  4DV4 L;  1OXV A;  2R7Z H;  4RG1 A;  2JA8 G;  4RMF A;  4BA2 I;  4X66 Q;  5GRO A;  1HNZ Q;  4GLV B;  3FHW A;  2I5H A;  5JEA J;  5EAY A;  3G6E A;  4GKK Q;  2VUM G;  4DV4 Q;  2VUM H;  2Q2I A;  3KLW A;  1MJE A;  3I4M G;  3H3V I;  4YHH L;  1CSQ A;  3PIP A;  2VZA A;  4R4C A;  2L15 A;  4DV2 L;  2VQE Q;  4QQB X;  1A63 A;  1AH9 A;  4XIG S;  4A3M G;  2LXJ A;  2BA0 A;  1EFW A;  4A3C G;  4A3C H;  3HKZ E;  3T1Y L;  2EQS A;  4YHH Q;  1VQ7 A;  3D31 A;  1XPO A;  2KCT A;  2FXQ A;  4BY1 G;  1C7Y A;  1OTC A;  4BY1 H;  1FGU A;  2BH2 A;  4LW1 A;  1OXX K;  4AQY L;  1EQR A;  3OW2 A;  2B63 H;  2B63 G;  2YTV A;  1LYL A;  5M5W H;  3U58 A;  3Q8D A;  4O0A A;  1X56 A;  4OON A;  1IBL L;  2IHE A;  2ID0 A;  3U4V A;  3L0O A;  4DUY L;  3ER0 A;  3TS0 A;  1VQK A;  1UWV A;  2JJQ A;  1TWC H;  3KFU A;  1SRU A;  1NMG A;  1IBL Q;  5ELO A;  4DUY Q;  2ZJR A;  3GTL H;  1VQH A;  2VW9 A;  1MKH A;  3W1B A;  1VQ6 A;  1EIY B;  3S14 H;  4YWL A;  4P71 A;  1SLJ A;  2UXB L;  1X3E A;  1CKM A;  3CCM A;  2E2J H;  2AKW B;  1G51 A;  3F2C A;  1G6P A;  4DV0 L;  4LUZ A;  1Q1B A;  3CCJ A;  2Q2H A;  5IT9 c;  1Y1V G;  1K83 H;  2ZJP A;  4DUZ L;  1YEZ A;  1X54 A;  4H02 A;  5IYC H;  3PO2 G;  1UE7 A;  3J81 j;  1IBM L;  3A5Z B;  1Q7Y C;  1GO3 E;  1I50 H;  2V1C C;  4GN4 B;  2OTJ A;  4DUZ Q;  3DLL A;  4AH6 A;  2E5L L;  3RNU A;  4K0K L;  2CWP A;  1YHB A;  1SN8 A;  3UDF A;  1M90 C;  4OO1 G;  4C2M H;  3T1H Q;  4JCV E;  4P72 A;  1HR0 Q;  1A8V A;  1IBM Q;  4DR7 L;  4PZ8 A;  2OWO A;  1E1O A;  2UUB L;  3S15 H;  3S1N H;  4L5Q A;  1JMC A;  2E5L Q;  4L5R C;  5C44 G;  5C44 H;  1YHA A;  2K50 A;  3JC6 6;  2E2I H;  1Z9F A;  3GTM H;  2WAQ G;  4DR6 L;  2VNU D;  4DR2 L;  2UUB Q;  3RR5 A;  3BZC A;  4P75 A;  1YBY A;  1X9N A;  3HOV G;  2ZTC A;  3PV0 A;  1NY4 A;  2QGQ A;  4PMW A;  4DR2 Q;  2HHH Q;  1YJN A;  3UE1 A;  2XTI A;  1WFQ A;  3FKI H;  3FKI G;  4DV3 Q;  4LF7 L;  1HJP A;  1J5E L;  1E7Z A;  3MXN B;  1W3S A;  1HR0 W;  1D7Q A;  3E9H A;  4XTC S;  2JA7 G;  4JOI A;  1K73 C;  4B3M L;  5JJI A;  1VQ4 A;  2Q2T A;  3W5O A;  1GD7 A;  3RN5 A;  1J5E Q;  1K0R A;  5GAH C;  3H0G H;  3H0G G;  4LFC Q;  1IBK L;  3F8T A;  4IPC A;  2VQF L;  4JI6 L;  5FLX c;  2PMZ E;  4C3J H;  3KJP A;  4B3M Q;  4A75 A;  4LF5 L;  4NXM L;  4UY8 C;  2R6G A;  1OXU A;  4GKJ L;  3UDI A;  3CW2 C;  1PH7 A;  1IBK Q;  1RL2 A;  1VQG A;  2VQF Q;  3H3V H;  5M3M H;  1KAW A;  1QUQ B;  1QZG A;  3ZJY C;  4LF5 Q;  1E1T A;  1VQP A;  5IYD H;  1E24 A;  2BH8 A;  1VQN A;  1E22 A;  3CCQ A;  4B3T Q;  5GQO A;  4KHP L;  1VQF A;  2R7F A;  3FP9 A;  3CC7 A;  1JE5 A;  1LUZ A;  5GAG C;  1WCM G;  1I5F A;  4DK3 C;  4C3H H;  4DKA C;  5M3F H;  1XMQ L;  2ATW A;  3CPF A;  1KC8 C;  2Y0S G;  1VCI A;  4NXN Q;  1TWA H;  4DV5 L;  3I7F A;  1VS0 A;  3S2H H;  1VQD A;  4HID A;  5JJL A;  3K7U C;  3S1Q H;  4DR5 L;  1GKH A;  1JJG A;  5LMU Q;  2B3G A;  2C35 B;  1QUQ A;  2JE6 I;  2VL6 A;  4IPH A;  3K0X A;  4JI1 L;  2AHO B;  1YNX A;  3A5U A;  1ASZ A;  1B70 B;  2NZO A;  3HOY H;  1W2B A;  4NXM Q;  3K7A H;  3J81 c;  2UUA L;  4LWC A;  4A3K G;  1CUK A;  1N34 Q;  3L7Z C;  4HIO A;  4JI1 Q;  3I4N G;  4DV6 L;  3TS2 A;  3U4Z A;  1TXY A;  4R1J A;  4LNQ A;  4JYA L;  1YIT A;  4LF6 L;  2Q2U A;  2CWA A;  1KRT A;  4X66 L;  2YTX A;  1VQO A;  1HNZ L;  4DV6 Q;  4AYB G;  4BBR G;  1XNR L;  4JYA Q;  4DPG A;  1WYD A;  1FVI A;  4KLK A;  2JA8 H;  2N78 A;  1HZB A;  2JK8 A;  1PH4 A;  3CC2 A;  4LF6 Q;  4BBS H;  1G29 1;  4OXP A;  1OXS C;  4DR3 L;  2E2H H;  5GAE C;  1VQJ A;  3UDX A;  2VQE L;  1KD1 C;  1VQL A;  1XNR Q;  4BY7 G;  4BY7 H;  3I4M H;  3HOU G;  1PYB A;  4DR4 Q;  2K14 A;  1CSP A;  2I5M X;  4JI3 Q;  1IXR A;  4DR3 Q;  4HIK A;  1A0I A;  3OTO Q;  3KOJ A;  4A3M H;  4A3F G;  1C9O A;  2CQO A;  1CKN B;  1XPU A;  4A93 G;  3SGI A;  3AQQ A;  3JAM c;  2DGY A;  4QL5 A;  1PH2 A;  1U5K A;  4MZ9 A;  4FDB A;  4OWT B;  1Q1E A;  3UDG A;  2WAQ E;  4EQ5 A;  3GTJ H;  5M5Y H;  1UE5 A;  2VY3 A;  5IE8 A;  1T9H A;  1HNX L;  5H1S E;  3TQY A;  3KDF B;  4GOP A;  3F1Z A;  1XJV A;  1SRO A;  4A3G G;  5C4J H;  4HJ5 A;  2RCN A;  1HNX Q;  1X3G A;  1GM5 A;  2ZTD A;  1VQE A;  3CF5 A;  3L2P A;  1CKN A;  2OTL A;  4O2D A;  3G4S A;  3A0J A;  4OWW B;  1K8G A;  3PIO A;  1Q86 C;  2KHI A;  1PH6 A;  1X6O A;  3IRB A;  3M4O H;  1XTD A;  3KF8 B;  3ICE A;  4JOI C;  4QY7 A;  4QIW E;  1N9W A;  1D8L A;  2HIX A;  2IT1 A;  1VQI A;  3RLO A;  1SR3 A;  3KDF A;  3J80 i;  4A3J G;  1PV4 A;  5C3E G;  4JBK A;  1Q82 C;  3F2D A;  1FJG Q;  4R4T A;  2AWO A;  4AIM A;  4PZ7 A;  2PQA A;  2KEN A;  1Y1V H;  3PUZ A;  1U0L A;  5IYB H;  5IYB G;  5HY6 A;  3PO2 H;  1BVS A;  3T1H L;  1HR0 L;  3BU2 A;  4MNO A;  3ULL A;  2HQL A;  5HGQ A;  4IPG A;  2HIV A;  1TWF H;  1IYJ B;  4B3S Q;  1PVO A;  1OXT A;  2K4K A;  2Y0S E;  1PYS B;  1QVG A;  5IP7 H;  5IP7 G;  1MIU A;  2ASB A;  3TRE A;  1PFS A;  5K36 G;  3NBH B;  1Y1W G;  1VQ8 A;  2I0Q A;  4DK6 C;  2HT1 A;  1CKO A;  2GVA A;  4R4I A;  4JBM A;  1KXL A;  4TVA B;  2JA5 G;  2HHH L;  2LSS A;  1L2F A;  3I55 A;  2OQK A;  3PF5 A;  1VQ5 A;  1KHI A;  3H15 A;  2ZJQ A;  3EBE A;  5BR8 L;  3HOV H;  4A3L G;  1SFO H;  4A3L H;  4DV3 L;  1Y14 B;  5M5X H;  3CPW A;  1YJW A;  3PUY A;  4GN5 A;  2NN6 I;  3PO3 G;  1X65 A;  5BR8 Q;  4QJF A;  5FJ8 H;  5FJ8 G;  4IO9 A;  3RZD H;  4ME3 A;  4JI2 L;  1XNQ Q;  3PF4 A;  4IOA A;  3RLN A;  4LFC L;  4DAM A;  1Q81 C;  1N36 Q;  2JA7 H;  3NEL A;  1NMF A;  4JI8 L;  2OCE A;  2K52 A;  4AYB E;  4JI2 Q;  3M3Y H;  1IZ6 A;  2AMC B;  2F52 A;  1N32 Q;  3I2Z A;  5IP9 G;  5IP9 H;  3GTG H;  3M4Q A;  4JI8 Q;  3ULP A;  4JV5 Q;  1JT8 A;  4OWX B;  3J7A 5;  4BXX G;  1XMO L;  2PI2 E;  1JB7 A;  2K5V A;  1NE3 A;  1P16 A;  2CKZ B;  1JJ2 A;  4B3T L;  3STB C;  2JEB I;  1LM0 A;  2A19 A;  4JBW A;  1XMO Q;  3PUV A;  1JJC B;  1Q46 A;  3AFP A;  4DV7 Q;  4HJ7 A;  2PNH A;  4IJL A;  2RF4 A;  5GAD C;  4NXN L;  1K8A C;  2AWN A;  1HH2 P;  1YIJ A;  4JI5 L;  1WCM H;  4LUO A;  4JI0 L;  4EX5 A;  5C0X I;  1A62 A;  1S3O A;  2JA9 A;  2F3I A;  3PUW A;  3M4P A;  5LMU L;  3DM3 A;  4GOP C;  1HNW L;  2JQO A;  4JI5 Q;  1S72 A;  4JI0 Q;  2UXD Q;  1EOV A;  1L0W A;  3HOW H;  3HOW G;  2JEA I;  4JI7 L;  1QZH A;  3ULJ A;  2OQ0 A;  3HKS A;  1HNW Q;  4A3E G;  1N34 L;  1MJC A;  1E3P A;  3W1G A;  1EIF A;  4TQU S;  3CCE A;  3UE0 A;  2Z0S A;  2UU9 L;  3CAM A;  3TEH B;  2UXD L;  4KHZ A;  1PH3 A;  4JI7 Q;  3PUX A;  1Q8K A;  3CCR A;  4A3K H;  3I4N H;  3EN2 A;  2RHQ B;  4DV1 Q;  2UU9 Q;  3CCS A;  1TWG H;  1PH8 A;  1LTL A;  1PHJ A;  2ZTE A;  1KIX A;  3S1R H;  1B8A A;  2R7D A;  2WB1 G;  4P73 A;  2VS1 A;  4X64 Q;  4BBR H;  1KL9 A;  3AYH B;  4YCU A;  1NBW A;  1IL2 A;  4A3B H;  5IWA L;  3GO5 A;  4A3B G;  4JI3 L;  3J7Z C;  5C4X G;  4UP8 A;  1FL0 A;  4UP9 A;  3HOZ G;  4GOP B;  3OTO L;  3BZK A;  3LGJ A;  4A3I G;  4A3I H;  3HOU H;  2D62 A;  2XGT A;  4JI4 L;  3G48 A;  2B29 A;  1HZ9 A;  2EIF A;  5IWA Q;  4Y52 H;  1I94 Q;  1SE8 A;  2IHF A;  3K81 C;  4L5T A;  1O7I A;  1VQA A;  1J6Q A;  4A3F H;  4HJ9 A;  4OX9 Q;  4A93 H;  4JI4 Q;  1M1K C;  4LF9 L;  4ALP A;  5E7N A;  4DAY B;  3KJO A;  2NVQ H;  3CP0 A;  3G71 A;  2IY5 B;  4X62 L;  3CCV A;  4BA1 I;  2GVB A;  1L1O A;  1PH1 A;  2MNA A;  4PZ6 A;  2JA6 G;  4J15 A;  5FLM G;  5FLM H;  3GD7 A;  4POF A;  4LF9 Q;  4QGU A;  1QVC A;  3S17 H;  4IJH A;  1NTG A;  1PA6 A;  5LMN L;  3TRZ A;  4WJ3 M;  4X62 Q;  3A74 A;  1DGS A;  2R7Z G;  4JBJ A;  3RZO H;  4B3R L;  2CFM A;  4A3G H;  2R93 G;  1AE3 A;  2R93 H;  2N3S A;  2YV5 A;  1N8R C;  4NB3 A;  1YVC A;  2PQA B;  4UP7 A;  5LMN Q;  2YTY A;  2YU9 H;  1YHQ A;  2LXK A;  4B3R Q;  2NN6 G;  2NVX H;  3CD6 A;  4HJA A;  1YI2 A;  2KBN A;  2K5N A;  4A76 A;  1P8L A;  2F4V L;  4X65 L;  1SMX A;  4IOC A;  2D0O A;  3PSI A;  2Z6K A;  4C3I H;  1XPR A;  1FJG L;  2NVT H;  4DV2 Q;  3CCL A;  5DLQ E;  2DUD A;  4A3J H;  2F4V Q;  1UE1 A;  4X65 Q;  3GTK H;  5C3E H;  3T1Y Q;  4YY3 L;  3OYY A;  4LFA L;  1V9P A;  4A4I A;  3CME A;  5AJ3 L;  4JG2 A;  1I6H H;  3M9B A;  2MO1 A;  1UE6 A;  1B7Y B;  4YY3 Q;  4GLX A;  4AQY Q;  4LFA Q;  4YWM A;  5LMN W;  4B3S L;  1Q12 A;  4GS3 A;  4KI0 A;  3M85 A;  2EXD A;  1QVF A;  5AJ3 Q;  3S16 H;  4YCW A;  1I3Q H;  2UUC L;  3HFZ B;  2IX1 A;  3M7N A;  2MQH A;  4LUV A;  4HIM A;  4APV A;  4X6A H;  3WWV A;  1WI5 A;  2MFI A;  4NPS A;  1H95 A;  5C0X G;  3D0F A;  2UUC Q;  3CMA A;  1Y1W H;  2JA6 H;  4IFD I;  4IPD A;  3BJU A;  1V1Q A;  4PG3 A;  5J3B A;  2JA5 H;  2UXB Q;  2UXC L;  4YWK A;  1XNQ L;  1S40 A;  5IYC G;  1EQQ A;  4DV0 Q;  2UXC Q;  4LFB L;  1N36 L;  4GNX C;  1R9T H;  4LF8 L;  3PO3 H;  3E0E A;  1N32 L;  4LFB Q;  1TWH H;  2WFW A;  2H5X A;  1KRS A;  2WB1 E;  3KF6 B;  4LF8 Q;  4JV5 L;  1HZA A;  3S24 A;  1C0A A;  3HKZ G;  5IY0 A;  4K0K Q;  3E9I A;  3U50 C;  4IFD J;  2KCM A;  3S2D H;  1BBU A;  4WJ4 A;  4DR7 Q;  3J81 i;  2PI2 A;  2GN5 A;  1K3R A;  3CC4 A;  2CCZ A;  1VQC A;  1GVP A;  1EWI A;  5ELN A;  3GTQ H;  4BXX H;  1VQM A;  3STB D;  3KYH C;  4DV7 L;  4DR6 Q;  1RIP A;  5JEA G;  3I56 A;  2I5L X;  3HOX G;  3HOX H;  3K80 C;  3J80 c;  4R4Q A;  4MTN A;  1HZC A;  3KF6 A;  4HJ8 A;  1V43 A;  1BKB A;  4Y7N H;  4GNX B;  4POG A;  1AE2 A;  1L1O C;  3F2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...