5JAVA

Crystal structure of staphylococcal nuclease variant delta+phs y91d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLADIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5javA00
1TT2A 4ODGA 2PZTA 4I65A 1KDCA 5IGDA 2F0KA 3NP8A 5CC4A 4MIUA 5CGKA 1KDAA 5IIFA 1JOQA 2F0OA 3P75A 5NUCA 4TRDA 4G57A 3MVVA 1SNQA 1EY7A 4N9TA 4KY6A 4ZUIA 5EGTA 3OSOA 2LKVA 3EROA 2RDFA 4PNYA 4PMCA 3TMEA 2QDBA 4K5XA 3TP5A 4KJNA 4DF7A 5C4ZA 1STHA 3MEHA 5KEEA 1NSNS 1STGA 3MHBA 4EVOA 2NUCA 2EXZA 3S9WA 5HURA 5I9OA 2OEOA 4HMIA 4KTAA 5ISRA 4K5VA 3ITPA 1SNPA 4N9PA 5EKKA 5IGGA 2OXPA 4KD3A 4OL7A 5J22A 5C5LA 3D4WA 3SR1A 4QMGA 1RKNA 5CV8A 5CV9A 5KGUA 1SYEA 1EY0A 1STBA 3C1EA 3T13A 1EY6A 4DGZA 4K8IA 5F2DA 4IUNA 4EQNA 1EYAA 5HGTA 1SNCA 3TP7A 2EYHA 3OWFA 5K5PA 1U9RA 3NQTA 1SYFA 1SNOA 1KABA 1STYA 2F0IA 4KY7A 5CV4A 4YIJA 5I6YA 2O4XA 4KV6A 2F0LA 1A3VA 4J1MA 2F0JA 2PZWA 2EYJA 4R8NA 1ENAA 1JOOA 2F0TA 3BDLA 4J6HA 4K2KA 4NP5A 1IHZA 5CV7A 3H6MA 5E3FA 1EY4A 2F0HA 5JAVA 3HZXA 4K6DA 4B9XA 2OF1A 3DMUA 3NK9A 4KHVA 2PYKA 3U9OA 4HMJA 3BDCA 4DU9A 5I6WA 4KJOA 3TP6A 2F0EA 2F3VA 2EYOA 3QOJA 4EQPA 2F0SA 2WACA 4HTHA 1EZ8A 1ENCA 3QOLA 4B9WA 2RKSA 4F7XA 1TQOA 5KRUA 2PQEA 3PMFA 4QF4A 1EY9A 3R3OA 1NUCA 4WRDA 2PZUA 2EYPA 3P1HA 4NKLA 5IGFA 4ID6A 4KY5A 3MZ5A 5I9PA 3T16A 5KIXA 1AEXA 4K5WA 4NDXA 2EY2A 3ERQA 3MXPA 2M00A 3SHLA 3SXHA 3VA5A 5E1FA 3OMGA 1EQVA 2F0QA 1A2TA 1EY8A 2F0MA 1II3A 5IOCA 4F8MA 3RUZA 3DHQA 1STNA 4K2LA 5KYLA 5IODA 5KYIA 4LAAA 4DFAA 5CR3A 4PMBA 4K14A 2F0GA 2SOBA 3TP8A 5IGBA 3V2TA 4S3SA 3SK4A 5DEHA 3SK5A 3NHHA 4IALA 4KD4A 5EKLA 4ME5A 3EVQA 4RKBA 3C1FA 4IZ8A 5CV5A 5C3XA 3NUCA 4H7BA 3LX0A 3D6CA 4K8JA 1SYDA 2F0VA 2F0NA 1KDBA 1KAAA 2F0WA 2F3WA 4WORA 5C3WA 5J1ZA 3HEJA 3EJIA 2SNMA 3E5SA 3NXWA 1F2YA 1SNDA 1SYCA 2KQ3A 1JOKA 1SNMA 2F0UA 2F0PA 2SNSA 4RKLA 1A3UA 1EY5A 1F2ZA 2EYLA 4ZUJA 3OMCA 1A2UA 2EY6A 1SYBA 1TR5A 2EY5A 5JOBA 4EQOA 2HQEA 2EY1A 2PW5A 3SK8A 5CV6A 1A3TA 1EYDA 5C6AA 4NMZA 4ZQ3A 1STAA 1SYGA 5C4HA 3D4DA 5IGCA 2EYFA 2RBMA 3D8GA 5C5MA 3SK6A 2F0DA 5J39A 2F0FA 2ENBA 2PW7A 4E6IA 5IGEA 5DAUA 5M9OA 1EZ6A 1JORA 2KHSA 2EYMA 1EYCA 1F2MA 4QB4A 3QB3A
chains in the Genus database with same CATH superfamily
1DOMA 2PZTA 2HT1A 1SMYD 1U0LA 4A3BG 1WI5A 5FO7B 4KHZA 4A3KB 2NB0A 2F0OA 4LF6Q 4A3CH 1I6HB 1UE7A 1JB3A 1LLRD 5AJ3L 4OONA 3M7NA 3SVMA 1DJRD 3OYYA 1WTXA 4A93H 1LTBD 1QVGA 1STGA 1I50H 3IKJA 4A3BB 1HR0W 4DR4L 4A3JG 5C5LA 4M1UB 1G51A 3S17B 3K7AB 1N32Q 2NZ1D 1GUSA 1L1OA 1HFNA 2RDHA 4DR6Q 4XT3B 4LF7L 1CSQA 4JW0A 1DOKA 2F0IA 1E2VA 1TVXA 1U4PA 2B2WC 4HSPA 2AWOA 1BBUA 3DXJC 1T9HA 1I3QH 4LJZC 1H9JA 5LMUL 2AUKA 1FNVA 4Z9CB 3AU7A 3C3LA 1L2FA 3RD4A 4HTHA 4DN4M 1WCMG 1LTTD 1L0WA 3MZ5A 3GTPH 4UP7A 4A3GH 1QNUA 3GV6A 1ASZA 1FL0A 5LL6X 3T1YQ 3E6ZX 3D31A 1GVPA 5IOCA 4OIKA 3I91A 1KL9A 1CTMA 4AYBG 4QJFA 1WCMB 4X65L 1R9TH 4KKUA 1V1PA 5EBDA 5K36G 3NHHA 4YY3L 1SE3A 1KTKA 3HP3A 3S2HH 1JJ2A 4Y7NB 2MUYA 4UPAA 1WTVA 3D6CA 1JT8A 2F0WA 4IFDJ 1IYVA 1Y69U 3U4VA 1SNDA 2WIIB 2VW9A 1SFOH 4JYAQ 2F0PA 3I56A 1L1OC 5KNDA 3GTMH 1HA5A 1FD7D 1XPRA 2N88A 2K5NA 3BZDB 4A75A 3OW2A 1HZCA 1EYDA 1NTGA 3H3VI 1L1OB 1TWAH 4MZ9A 4RA8A 1EQTA 4ZQ3A 3D4DA 2B63H 1FJGQ 4F88A 2D5DA 3OPOA 3VR4A 1YNNC 3TEHB 3UE0A 2EQSA 5IWAQ 2I5MX 1SDFA 4A3KH 4IFDH 1BBWA 1RD9D 3I55A 1I6HH 4HAEA 1QNKA 4K6LA 1KLGD 2V1CC 4DV3Q 5NUCA 2OWOA 3M4QA 3M4YA 1L0YB 4OGQC 4LK1C 1ET9A 4X3UA 3KLSA 3S2DB 1DZ1A 3RLOA 1S40A 2RDFA 4LF4Q 4RCOA 2Z6KA 4DR1Q 4A3BH 1XMOQ 1HPCA 4QIWE 2D62A 2RCFA 2FMMA 5IYBG 1ZYRC 3S17H 1MJCA 4K5VA 1FNWA 4AQYL 1JCKB 2BOSA 1CKOA 4FP5D 2A68D 3C1EA 5EKIA 4DKAC 4XYOA 1EYAA 5HGTA 1EEFD 5EPJA 4F87A 4A3JH 4CKCA 2QF7A 5A2QL 1JWMD 2Z4IA 2UUCL 1T5EA 1GJXA 2WV6D 3KDFB 4DAPA 1GM5A 1VQKA 2JA9A 3OHXC 4RHRA 1K8MA 4OWWB 4A3EB 3UDXA 1TS5A 3DUZA 3TS2A 1ENCA 3STBC 3CQZB 2XTIA 4DK6C 1UE6A 2KJXA 2M9VA 1HR0Q 3K5LA 5IT9c 2HUGA 2B3GA 3G6EA 4JI5Q 4JI7L 1WJJA 3CCEA 4NDXA 3CC4A 3VA5A 2KUMA 2Z0SA 2LXKA 1A2TA 4DR3L 3C2PA 4K2LA 1WCMH 1XJVA 1CI3M 4L63B 1OXXK 4RHSA 1S5DD 4XQJA 3F1ZA 1IBKQ 2NZHA 2DJFC 4Y7NH 2CVRA 1CSPA 2G9DA 1JE5A 1HUNA 1B2TA 3LX0A 4B3TQ 1I5FA 3GTKB 3QWNA 3CKIB 4DV2L 1KXLA 1RDPD 2SNMA 1Q46A 3I70A 5K36H 1LABA 3P7JA 5C3EB 3K0YA 1M8AA 4DV0Q 3R93A 1T5XD 3HG9A 1SROA 2RSOA 5C4HA 1PRTF 1PRTB 4TKOB 3X3MA 2F0DA 2AHOB 2ZTCA 1GUGA 4HJ8A 2E2JB 3PV0A 4HIKA 3CHBD 5C44B 1GUWA 3NP8A 1EU3A 4JI2L 2Z9HA 3JAME 3S2DH 5JVH3 1PV4A 3HOXG 1L0XB 1YITA 2ZJPA 2XSCA 2RDGA 3OSOA 3EROA 2KHJA 3AEVA 5KEEA 1HNWL 1YNXA 1B3QA 2PNHA 3I4NG 4CHTB 2UUAL 3EA6A 1X3FA 1Y1WB 3CCQA 1EY0A 4C3IG 1XTCD 1MJEA 1DYQA 4MTKA 4R1JA 1JB7A 2ZTDA 3BYYB 5GROA 3NQTA 3AQQA 4EX5A 5I6YA 2IX0A 1TKWB 2F03A 3F2CA 5E4XA 2A69C 1U4RA 5EPLA 1LTID 1PTOD 1HUMA 2VNUD 1XX8A 3CW2C 1ML0D 4J15A 1NMGA 2OF1A 1QZHA 5GAEC 1B1ZA 3NK9A 3CQZH 3HRZC 4B9WA 1LV9A 1TU2B 4MHEA 2CW0C 1W2BA 1IBLL 4X3SA 2Q8IB 1PDQA 2LMCB 4R4CA 4XXEA 3S1NB 4KK7A 3FRPB 3K5NA 1D1KA 2M00A 1AN8A 5E1FA 1X3EA 3T1HQ 5CORA 2KA7A 1KD1C 5IYCG 2RF4A 1ICFB 3S1RH 1QWYA 1KRTA 3GQBA 3D3RA 2ZXOA 1EFWA 1EIHA 4S3SA 3SK5A 1YBYA 1EUJA 4BBRG 1WTQA 1U5KA 3GTKH 1LO5D 2D2CC 3CPWA 1PH1A 1CKNA 4KN7C 4AYBE 4C2MB 1BOSA 3G48A 4IPDA 3K59A 2UXCL 4B3SQ 4POFA 1Q1BA 5C4XG 4QCLA 4PMWA 2IHFA 1TWHH 1SXTA 3H15A 4JI1Q 3J7YW 5JEAJ 2EY6A 1SYBA 4BBRB 3RNUA 3ER0A 3SK8A 4X62Q 5ELCA 1JE4A 4L5TA 5CBAE 1TS2A 2E2JH 2JA7B 4IJHA 5C44H 1FNUA 1Z7TA 2R7ZB 1EQRA 1MBYA 1TT2A 3RN5A 1HHVA 1N36L 3HOYB 1JOQA 1VQJA 3D0FA 2L5TA 2RA4A 3HOWB 1WD0A 4LFCL 3MVVA 2NN6G 2LY7A 4GKJL 3GTJB 3I4MB 2LKVA 3FKIG 4KJNA 1STHA 3MEHA 1YNJD 3CCUA 4DUYL 1FGBD 2AQ2B 2A6HC 4KTAA 2OQKA 2XN9C 1S5BD 4FNFA 1YHBA 3FKIB 1SAPA 3MXUA 3I4NH 4X3KA 1BF4A 1EWIA 2R61A 2F0JA 4QGUA 4R4OA 4PZ7A 4K2KA 2RSNA 1EIGA 3H0GB 5DNFA 1ZEQX 1N33Q 2F0HA 4R8IA 1U4LA 5ELBA 3M4PA 5EPKA 2GVAA 2AQ1B 2EJMA 3TP6A 1C0AA 2EYOA 1FVIA 4NW2A 2KECA 3EQLC 1SJED 1MGSA 1CK1A 3HS0C 3R3OA 3S1NH 4A3MB 4JBWA 1XNQL 4IPHA 1GUNA 3FDTA 3H91A 3SXHA 3F2UA 3GTLB 4HIOA 4JI4Q 3T53B 1CQFA 2BH2A 3A5ZB 1GUTA 2C35B 3DEPA 2R7FA 2K6AA 4TQUS 3SK4A 4ABNA 2NVTH 3D6WA 4C2MH 5C0XJ 5KNCA 1PH2A 2PPBC 1LT6D 1VQHA 2G9HD 3HGBA 1PH8A 1IYUA 4NXNL 2KQ3A 4WJ3M 3NBHA 4BBRH 4EQOA 2EY1A 1MIUA 2ATWA 3EBEA 2JYOA 2PCFB 3P20A 2JA7H 4NB3A 3CCLA 5JPMC 1PTOF 1PTOB 3Q24A 4DV7Q 3SK6A 1D2BA 2R7ZH 4A3IB 4L6TB 2JK8A 3HOYH 2H4OA 4BBSG 1WFQA 2E2DC 3WOEA 3HOWH 4RGMA 1E24A 3QG1A 3GTJH 1QZGA 4OO1G 3NTKA 2PMZB 3UDGA 1HZ9A 4KY6A 3TP5A 2QDBA 3CRKC 3SDZA 3BVMA 4CJ1B 1WTOA 4A3CG 3AFPA 3D4WA 2NN6H 1WTPA 1UE1A 2X69A 3FKIH 1VF5C 4A93G 1LT3D 1SNCA 1TWCH 2UXBL 4JV5L 3NPPA 3AYHB 2D0PA 2WFWA 2O4XA 4P74A 5AJ3Q 3CXCA 3H0GH 1QUQA 2MFIA 4DAMA 4ZK9B 1G2TA 4X64L 3CPFA 4UP8A 3LWUA 3CMAA 3DM3A 4DU9A 3RZDB 3MFYA 2F0EA 4ME3A 4HEDA 4DR4Q 1IW7C 1JJCB 2WACA 2K03A 4A3MH 3FMCA 3S24A 3NBHB 3CMEA 4QL5A 1VQ5A 4LF7Q 1SRUA 3J80E 3GTLH 2B8GA 1KHIA 3I2ZA 3KF8A 3ERQA 3SHLA 1YZ6A 2PI2A 1RODA 1EQVA 1HRJA 2K52A 3MWYW 2XVSA 1Q12A 5JVG3 4LAAA 4DR2Q 2F0GA 1NY4A 3IRBA 5C4JB 2HQLA 5LMUQ 1PMRA 5FK9C 2DUDA 1YNND 4C3HG 2ZJQA 2JA8B 4HJ9A 3C1FA 1SE2A 3PUXA 4YWMA 4BWGB 2JP1A 1I4HA 3W5OA 4DV4Q 2XWJB 3RMHA 1KDBA 2EE1A 4BA2I 5D65A 3J81j 2HDLA 2A6EC 1A3UA 1AE3A 5M5WB 2N55A 1FGUA 4GKKQ 4RFBA 1TR5A 2NVYB 1PTOH 2AKWB 1HNXL 4B3RL 2HCCA 1BCPC 2GA4B 4X65Q 4LUZA 2CH4A 1ZYRD 4C56C 2RBMA 3PUYA 1Q8IA 2A1AA 2EJFC 4YY3Q 2K5VA 3L2PA 4NXML 4DV5L 1BCPB 3QB3A 4DAVA 1KDCA 2OCEA 5IE8A 5CC4A 4MIUA 2OT2A 3A7AB 1Y14B 2DNEA 4DK0A 1K28A 3K7UC 3FEWX 4XDXA 1E1OA 3W2DA 3TMEA 3OOCA 1PZJD 4XTCS 3L7ZC 5IP7G 2ASBA 4IFDG 5I9OA 1ET6A 2PQAA 3ZJYC 3M4OB 4O42A 1RJTA 1NNXA 3HOUG 3STBD 3T13A 1HH2P 1WOCA 2BH8A 2JA6B 2EYHA 5K5PA 2E8GA 1STYA 3GD7A 4Y52H 1E2WA 3CCJA 2FHTA 1QVCA 4EQ5A 3HOUB 1IHZA 5CV7A 1CA6A 3RZDH 3BU2A 1Y1VG 3KF6B 3WOFA 2K32A 4KHVA 3KLRA 4DAYA 1BXTA 2F0SA 3BJUA 4GNXA 1PFMA 4DV1L 3J7AF 3HFZB 3OIPA 1HZBA 4G7ZC 1TXYA 2Y0SG 3P1HA 3X3NA 3QO2A 1O7LA 1Y1VB 2B29A 1M1KC 1VQPA 1D5XC 4IUQA 4MNOA 1P16A 2UUCQ 4XT1B 1STNA 1PRTD 5C4JH 4KLKA 2JJQA 2Y0SB 3FHWA 2JN4A 1OXVA 4IOAA 3F2DA 4IZ8A 3CC2A 1CZGA 3OW7A 3J7AV 3G7LA 5G3LF 3F8TA 4JI7Q 4OHJA 5M5XH 1HQMC 5LL6S 4DR5L 3Q0AA 3EJIA 5FJ8G 1N9WA 1F2YA 3J81L 4DA2A 2NZOA 1LM0A 4C3HH 2NVYH 2LXJA 4DR3Q 2NTSA 4DXFA 2WKCA 1HNZQ 1PFSA 2NYZD 3KLSX 2A73B 5J39A 5KNBA 2R93B 1GKHA 4JOIA 5DAUA 1FR3A 1YHAA 4CBVA 1RCVD 4QB4A 4FF4A 1DCZA 2L0CA 3K57A 1CT1D 4DV2Q 4GNXC 1YJNA 4TRDA 2ZJRA 2A69D 4GLAC 1NR2A 4JBJA 4ZUIA 3KFUA 2CQAA 3DEOA 3M4OH 2KCNA 3G71A 2H5XA 4OWXB 1AH9A 2MHVA 4OL7A 2NN6I 4IOCA 4ZKCB 4I7ZC 1VQ4A 5IP7H 1HTLD 1U9RA 3TZDA 3RN2A 1I4RA 1KABA 4KY7A 5CV4A 1I4PA 3T56B 2YV5A 2I0QA 2KENA 3HOUH 3S1MB 2K5HA 2R3ZA 1MI2A 2F0TA 3TRZA 3H6MA 1EY4A 1HNWQ 2O5JC 4K6DA 1GD7A 3TN2A 4DV6Q 4JBMA 3DMUA 5M3FB 4OX9L 2UUAQ 2UUBL 3K7AH 1LUZA 3N52A 1EWHA 1BBXC 4LUVA 1E22A 2IX1A 4KY5A 1Y1VH 4IPGA 5CMDA 4A3EG 3T16A 1VQEA 3JAMi 2FMCA 3A7LA 4JOIC 4L8JA 1FYCA 3LWEA 2SDFA 3ONAB 2HCIA 1G8ZD 3UE1A 1I4GA 2OTJA 4EGVA 1LTRD 1CHPD 1V1PB 2CWPA 2SEBD 5FLXL 1EL0A 1S5FD 1SJHD 4GOPA 3KOJA 2ID0A 3VDYA 3CD6A 5D3DA 2DNCA 1N32L 2J4XA 1EFID 5CV5A 4IUPA 4CGYB 5C3XA 3B6YA 1IBLQ 4OEMB 1TWFB 1E3PA 4ZYSA 1D7QA 4O1NA 4DR7L 3G4SA 1Y8NB 4YWLA 5CYUA 4G7OC 2VS1A 2QW7A 5LMNW 5FJ8H 5FO8B 2A6HD 5C3EG 2I5HA 5GQOA 3C46A 2F0FA 1B4OA 2ZXPA 3E0EA 2VQFL 1VQMA 1W3SA 1KC8C 1EIYB 2AMCB 1UUPA 1K0SA 2VB2X 1I94Q 2A8VA 2Z6KC 2MO1A 5TSSA 5JJLA 3T51B 4HJ5A 2UXCQ 3J7A5 3I7FA 2R7DA 4NPSA 1SR3A 1RTNA 3T1YL 1D6EC 2NTTA 5BR8Q 4G57A 2QEJC 3OIQA 4A3LG 5C44G 5EGTA 1SEBD 3WWVA 3MHBA 4CDFC 2TMPA 4FO2A 4J8QA 1A62A 1SNPA 5EKKA 5IGGA 1ESRA 2D0OA 4OO1I 3HKSA 5JEAG 4GOPC 3S1QB 2BDOA 4C1NI 3TP7A 1N36Q 4ALPA 4A4IA 4JYAL 1SYFA 2C9OA 3A8IE 3S1MH 4LFCQ 5IT9E 2XGTA 1Y1WG 4IQZA 4GKJQ 1Y8PB 2CCZA 3VYRA 1VQNA 4JK1C 5E3FA 3U58A 5M3FH 1J6QA 5E7NA 1OXTA 4DUYQ 2CKZB 4IUVA 4LFAL 3VR5A 5I6WA 1J5EL 2Q2HA 4F7XA 5KRUA 1JC7A 4UDUC 1WVLA 3S16B 1IL8A 1SE4A 2RCNA 3AFQA 4OXPA 5IGFA 3K81C 3IFDA 4DV3L 5I4DA 5T1IA 3IAYA 2Y0SE 3CF5A 4A3EH 4K14A 2EJGC 4IPCA 1VQFA 2MNAA 3NWTA 1B70B 3V05A 3EFXD 3RLNA 2ZXRA 3RLFA 1TWFH 5JJKA 1PH5A 2F0NA 1XNQQ 5JPNC 1IBML 3AMUA 5J1ZA 1K8AC 2F4VQ 3JAML 4ZRZA 2SNSA 3H94A 5FKAC 4B3ML 3QR8A 1ILQA 3I4LA 1STEA 2VXWA 5CV6A 1HTPA 1MHWC 5E4WC 4ILWA 1JWSD 1SYGA 4RCNA 3D8GA 1IL2A 4E6IA 2BE5D 2IPKD 1XNRQ 4OIJA 4JC0A 3KBXA 5M5YB 4PZ8A 2JA7G 1KDAA 5C3EH 2JXMB 4NXNQ 3P75A 4L5QA 4JI6Q 4QUFA 1O80A 1J8IA 3IL8A 2R7ZG 1EY7A 1WTHA 1NMFA 2IL8A 5C0XG 4LF9L 3HOYG 2Z1CA 2K5DA 4A3DB 2ICIA 1VMPA 3VR6A 2NUCA 3HOWG 4PZ6A 4R4TA 5J22A 1IW7D 3S15B 3CCMA 3I4MG 5LMNQ 3S1QH 4A3LH 2TSSA 4U673 4B3TL 1G2SA 4DGZA 1WD1A 2ALYB 3RZOB 1PH9A 2LS01 1BDOA 1O7YA 2B2VA 4IFDI 3TZUA 4CKBA 4RH6A 1UEBA 4WJ4A 1VMCA 1Y8OB 2KBNA 5JEAH 1JOOA 3URYA 3A8JE 4QQBX 1AZPA 3K8AA 1EU4A 2ZM6L 3BDCA 4WJWA 2HIXA 3SEBA 1Y1WH 2IY5B 2RKSA 3H0GG 4HSVA 4RGTA 4WRDA 3SGIA 2A74C 2PZUA 3M3YB 2EYPA 3ND8A 4O2DA 2UXBQ 4JV5Q 3CRLC 4K5WA 4LNQA 2FXQA 3MXPA 2A6ED 1LT5D 3TS0A 4UAIA 1II3A 3MAQA 3H3VC 3K0XA 3J7ZC 4A3MG 4CDDC 1YJ9A 1K73C 4X64Q 1YJWA 3CCSA 3RR5A 3BVGA 3KBGA 1BCPD 1CKNB 3U9SA 3UDIA 3M85A 2A19A 5GADC 4DUZQ 3BVZA 1GXDC 2F3WA 1AE2A 4GN5A 2MGSA 4RWSC 3A55A 4A3FB 2A5HA 3NXWA 1E1TA 5A35A 4RKLA 1QILA 3KYHC 4JI0L 4HN7A 3PO3B 3IFTA 5DM63 2B2VC 3E3XA 4DNIA 2HQEA 1H9KA 5LHY1 2WP8J 4JI8L 4HR7B 4LFBL 1X3QA 3I8ZA 1XPUA 1KQSA 1GUOA 2E2HB 4RAUC 3JC66 5M5YH 3J80i 2Z8LA 5DLQE 2DY7A 4A3IG 3NEMA 2B2TA 4A3DH 1K8GA 3OTOL 1G291 4APVA 4WFN3 4EVOA 1HNXQ 4B3RQ 3S9WA 3I90A 1IKLA 2OEOA 5ISRA 2EPBA 2Z4HA 3CCVA 2HD3A 1V9PA 4JCVE 1R4QB 3RZOH 4NXMQ 4DV5Q 1ZKOA 1XXGA 2EXDA 5AFWA 5C0XH 1IKMA 1AFPA 2RHSB 4FXGC 3ULJA 1YEZA 5ELFA 3PSIA 4JI1L 2Q2IA 2MO0A 3I4MH 4J1MA 2NWGA 1OXSC 1UE5A 3MXNA 1JJGA 2K14A 2QILA 3ULLA 1JMCA 1DXMA 3NTHA 5G3LD 1AZQA 1S3OA 2BA0A 1EZ8A 4YCWA 3PMFA 3TBIB 4QF4A 1EOTA 3K5MA 1MSGA 2P5ZX 1UAPA 4YWKA 2VY3A 1OXUA 1VDZA 2DJGC 1TY2A 3E0JA 1TS4A 4FVMA 3GDEA 4RGOS 4RGNA 3PGZA 2L9HA 4F8MA 1B8AA 1V43A 2Q2TA 4DFAA 1N8RC 4LF8L 3GTQB 1OTCA 1BQQT 4FXDA 2K50A 4DV1Q 1YHQA 2BCOA 3BG3A 2N3SA 2K5QA 5ELEA 2BDNA 3ULPA 3BS1A 2N49A 1A8VA 2MP1A 2WINB 3PO3H 2JA8G 3M7GA 3K6OA 3VYSA 2RQXA 2YTYA 1A2UA 1Q86C 4IJLA 3CP0A 3OWEB 4V190 2X6GA 1N33L 1EEID 4YHHL 3PQIA 2E2HH 5C5MA 2E2IB 1ILPA 1X55A 4KHPL 1N34L 1KNAA 3NQIA 1PYBA 4CJ2C 4X66L 2QKIC 4N8X1 1G6ZA 1PFBA 2L12A 4UP9A 4C1NK 4PG3A 1M4VA 4KI0A 4DK3C 4PNYA 2QEXA 2VQEL 1QCBD 1YNJC 3KK7A 2Q8TA 4BS9A 2JEBI 2ES2A 3Q8DA 2F52A 2EXZA 1I3QB 4HMIA 4A3IH 2RVLA 1Q7YC 2OXPA 4FDBA 5CV8A 1E0BA 1RIPA 3J80L 2D9UA 1BCPF 4HCEA 1PH7A 4R4QA 1JICA 4AIMA 3J81c 3HOZB 2EDGA 1QUQB 1B44D 4LF5L 2E5LL 3MC0B 4ZAIA 4CKEA 4L5RC 2EYJA 4GN4B 2L55A 1U4MA 2JA6G 1E2ZA 1A15A 3S14B 5L37A 1BKBA 1PXUA 1X3PA 2Q2UA 4XQNA 3K58A 4C3JG 2NVQB 3KF8B 2B8FA 3NELA 5GAHC 2PQEA 1C9OA 1NUCA 2AUJD 2I46A 1H9RA 2J7ZA 1BO0A 3A5UA 2MJ8A 1YI2A 3UI2A 2PO4A 4QY7A 1X32A 2Q8RE 2F0QA 1KNEA 1MSHA 1BUVT 3KJOA 4C3JB 5KYLA 3GTQH 2AQ3B 4O0AA 1K3RA 2VB3X 5ELDA 2SOBA 1VQIA 2UU9L 4FYDA 1TWAB 2GN5A 3EN2A 4LMQD 5DEHA 2UUBQ 2QCPX 4IALA 1BNZA 3PIOA 4RKBA 3PCOB 4AQYQ 2CH4W 2F0VA 2FINB 1KAAA 3QJYA 1X65A 3PUWA 1X9NA 3A54A 1CKMA 1NE3A 3E5SA 3U4ZA 3J81E 4CDEC 1F2ZA 2AWNA 2EYLA 4IN3A 4MN3A 1ESFA 5JOBA 1ICWA 4K0KL 3LNNA 2EOTA 3R2TA 3GO5A 5C6AA 2FFKB 5FLMG 2E2IH 4FF3A 2HDMA 4DXGA 2JA8H 2EYFA 2PW7A 1F2MA 4CDCC 2XRSD 2KHIA 3GV3A 1CUKA 4I65A 4ZLTF 2EVBA 1O7ZA 5ELNA 5CGKA 1IZ6A 4BY7G 5M5WH 2R93G 1XMQL 2HHHL 5EJWA 5FLXc 4DR7Q 1SNQA 1NAPA 4A3JB 1PH6A 3WDNA 2PQAB 1VQ6A 4JI3L 2JQOA 5C4ZA 2R6GA 4DF7A 4DR2L 3BZKA 4K5XA 3CCRA 4BXXG 1NSNS 1C48A 1OO9B 1Q82C 2R92G 3ITPA 4N9PA 2VQFQ 4BY7B 5IP9G 4DV4L 1VQCA 4R4IA 4YCUA 1SN8A 1PZID 3I4OA 4XQQA 5BN5A 3E9HA 3I3CA 4GLVB 1H9MA 5C0XI 3HOZH 1VQBA 2PMZE 2UXDL 2IWHA 4YIJA 1B50A 4H13C 2WAQG 2R92B 1RL2A 2B2YA 4GKKL 3S14H 1K0RA 4DAYB 2MPMA 3TSSA 4GLXA 4GNXB 3ZYYX 3HZXA 4X3TA 1S5ED 1HXYD 2PYKA 5BN4A 2NVQH 5ELOA 3KDFA 4EQPA 5D14A 3GP7A 1EY9A 3VYUA 2JA6H 2WAQB 2CW0D 5M3FG 3CAMA 5KIXA 1AEXA 1I4QA 4AYBB 2EY2A 2K04A 2LSSA 4C3JH 1XTDA 4JI2Q 1EY8A 4XYQA 1CM9A 2LFNA 2K33A 5A2QE 2IJ0A 5IODA 5EBCA 5FLXE 4ZCKA 5CR3A 4PMBA 4RG1A 2L1BA 3Q23A 5IY0A 1X3GA 4BA1I 1QE6A 4LFAQ 4U68A 1WYDA 1HCZA 1J5EQ 2XWBB 1Z47A 1JR0D 3ERSX 1SYDA 3DLLA 1PZKD 4LW1A 5EAYA 4G4KA 1SYCA 4LF6L 1SNMA 2F0UA 2Z6BA 1W6KA 4ZUJA 1AW7A 5M3MG 4CJ0B 4Q5VA 1Z6HA 1NJIC 1Q1EA 4DNTB 2E75C 1XYIA 2KEDA 2B2YC 2DGYA 2F1MA 5M9OA 3E9IA 2WB1G 1H95A 4AH6A 4QUCA 4DR6L 1Z9FA 1IBMQ 5M3MB 5FLMH 2CWAA 3W1GA 1CFMA 3PIPA 1QJOA 1S72A 4B3MQ 1K83B 4N9TA 2KVMA 2WB1B 2O5IC 2EIFA 3BYTB 4FXKC 1VQLA 1TS3A 4BY7H 2R93H 4KD3A 2B39A 1EOVA 1EY6A 4BXXH 3JAMc 1TWGB 4EQNA 2NVXB 1SMYC 1BVSA 4TVAB 5HGQA 1SNOA 1K8OA 4HCSA 2R92H 3PO2G 2K7VA 1EQQA 2F0LA 5IP9H 4R8NA 1ENAA 3FP9A 1HNZL 2ZTEA 1P8LA 4LF9Q 2OQ0A 1E7ZA 1PA6A 3S1RB 2CQOA 4ZKBB 1HJPA 2PI2E 2KEEA 3QOJA 3PO2B 3TREA 2V4DA 2F3IA 1DGSA 4YCVA 3EIVA 2VUMG 3ICEA 2XNAC 4GOPB 1KLUD 4ULLA 2L11A 3GTOB 3MEFA 2F0MA 4KN4C 1PRTC 3D4RA 1TWHB 4BY1G 1PH3A 3VR3A 5KYIA 1VS0A 1XWEA 1ZXTA 3TP8A 2ZM6Q 1VCIA 1FJGL 1B53A 4KD4A 1C8CA 2VUMB 1HZAA 3NUCA 5IWAL 1SE8A 3VA7A 2IX3A 2CFMA 5JJIA 4P2CB 5BN3A 4BY1B 3GTGB 4P71A 1JOKA 1PH4A 2XRQD 1EY5A 1NBWA 2J0TD 3PUVA 3OMCA 5CBEE 2N78A 2YTVA 4LF4L 4DV6L 5FOBB 4DR1L 1XMOL 1A6XA 1F77A 2WKDA 4PQXA 4UHVA 2HIVA 1JQYD 4Q0FA 5IGEA 1G6PA 2KHSA 3HOXB 1EYCA 3MFGA 1VQ8A 4JPBW 5M3MH 3DWQA 4HJ7A 1J9OA 4GZYC 4P73A 5H1SE 5IYBH 5IIFA 5IT9L 1K83H 3I4NB 1H9SA 3BDOA 2PNRC 4A76A 4JI0Q 1B7YB 3CC7A 1PHJA 4PMCA 4C3IB 2O2LD 4JI8Q 3W3AA 1GHJA 1VQ9A 4LFBQ 5D3IB 3NENA 2KCTA 1B3AA 1BR9A 1TWGH 1STBA 3L3OC 2NVXH 5FO9B 4A3DG 1HR0L 3R2IA 2K28A 4IUNA 4JI5L 5I2XA 4DNRB 3NE5B 1WTRA 1YVCA 2H1EA 3T4AC 1D1IA 1HQRD 2MQHA 1F9PA 2C5CA 3BDLA 4J6HA 3OTOQ 3K80C 3NTIA 4V0BA 2I5LX 5EQ0A 3U9OA 3PO2H 1IBKL 2WAQE 4X6AH 4P72A 3QOLA 1LACA 1LTGD 1I94L 2JA5G 2A68C 2G5DA 2NVTB 1JWUD 2L15A 3PIO3 1RHPA 4LUOA 3GTOH 1HFGA 5BR8L 4H02A 3OMGA 3O13A 4DV0L 5T1GA 2JA5B 4POGA 1QOHA 2VUMH 3V2TA 3PF4A 1PYWD 3A74A 5C4XB 2E76C 1Q90A 3S16H 3EVQA 1D5MC 1W6JA 1H9SB 5IYDG 1RTOA 4H7BA 2K5WA 4BY1H 1RF2D 1PYSB 4K8JA 3GTGH 4WORA 3QIAA 3HEJA 2YTXA 3W1BA 2KCMA 1CQVA 1X56A 3G6JB 3A0JA 2EY5A 3MA2B 2F4IA 3HKZG 4A3FG 1SMXA 3FPUB 4LF8Q 1O78A 4JG2A 4NMZA 1VQAA 2X6LA 5IGCA 3HOXH 3PO3G 2RHQB 2K75A 3ND9A 2NBFA 2EYMA 1LYLA 1DONA 2ICEC 4ODGA 3KUPA 5IGDA 3HKZB 2YU9B 3HOVG 1TWCB 2IT1A 2IW3A 1MKHA 1GOZA 2WB1E 4I7AA 4C3IH 2K05A 1Q81C 4YHHQ 4H44C 5HURA 3HOVB 1S4ZA 1A63A 4IURA 1SYEA 4KHPQ 1N34Q 1IXRA 5F2DA 1QG7A 2F4VL 4X66Q 1VQ7A 2FJ2A 1WTWA 1SBBB 2BA1A 3T1HL 2PZWA 2JE6I 2CHBD 2VQEQ 5JAVA 4DK1A 5DM73 3A8KE 5HY6A 4B9XA 1K9MC 2EZVA 4UY8C 3NSWA 3S15H 3TQYA 2IHEA 3F2BA 2QGQA 5I2YA 1XNRL 5IYCH 4JBKA 1LTLA 4NKLA 4ID6A 5I9PA 4B3SL 4HIMA 5J3BA 4JI6L 1PLFA 3CU7A 3NWSA 4LF5Q 2E5LQ 1NCVA 1PTOC 2JA5H 3DHQA 1VQGA 1DM0B 4X62L 4HIDA 4B08A 4FF2A 5C4XH 4OELB 3L9AX 3MXGA 5LMNL 5EKLA 3DM1A 4ME5A 4KMUC 3J80c 3M3YH 2KOLA 4FF1A 4N8FA 5GAGC 5C3WA 1S5CD 4XIGS 1Q8KA 1X54A 3KJPA 1F9SA 2GVBA 1B9NA 3Q22A 3BZCA 1LT4D 1B9MA 5IYDH 3PIP3 2PW5A 3Q6SA 4GN3B 1A3TA 3H3VH 1D5ZC 4BBSB 1ENFA 2K01A 3DWPA 3A56A 1STAA 1HA6A 1DOLA 1IYJB 2UU9Q 1M90C 5COYA 2B2TC 1EWCA 2BE5C 1EIFA 1EZ6A 1D8LA 4IO9A 3N6RA 2VZAA 3AB9A 4A3FH 2YU9H 2DY8A 1V8QA 1R4PB 1KAWA 2F0KA 3PF5A 1CA5A 1KRSA 3H09A 3UDFA 1EYGA 1G91A 1ONLA 2VL6A 4K0KQ 3I72A 4KKSA 1QVFA 1GO3E 2B2UA 4A93B 3I73A 4OWTB 3HOVH 1F9RA 4GS3A 1AP0A 1I50B 1V1OA 3M9BA 4DUZL 1VF7A 3SR1A 4QMGA 1RKNA 1UEAB 1TIID 4P75A 5CV9A 5KGUA 1SLJA 4QIWB 1NR4A 3DWAA 4K8IA 3LGJA 1VQDA 1UWVA 2L4NA 3OWFA 4IUUA 1GHKA 1ASYA 3MXNB 1I4XA 3J81i 4DR5Q 1F9QA 3K5OA 3MTSA 2E74C 3R8BA 4KV6A 1XMQQ 2HHHQ 4JI4L 1A3VA 3VYTA 4JI3Q 1K3BC 2XIWA 4NP5A 3TDQA 4KKTA 2K1BA 3HOZG 3SE0A 2KCCA 4A3GG 3PUZA 4HMJA 4KJOA 4TSSA 2QDLA 1I6VC 2F3VA 1KIXA 1C4QA 3U50C 3KF6A 1TQOA 4M8AA 3KLWA 1SSOA 1UNSA 4L5SA 1PFNA 2UXDQ 5M5XB 4PV1C 3GTPB 4A3GB 1Q3LA 4H0LC 3RUZA 4C3HB 2N8NA 5JJZA 4R9WA 5IGBA 1TY0A 1VQOA 4DV7L 4LWCA 4HJAA 1YIJA 1MD2D 4G7HC 1R9TB 1CZWA 1V1QA 2B2UC 1LTSD 2B2WA 1X6OA 2K4KA 4JVZA 3S2HB 2JEAI 1PVOA 3VR2A 3FVQA 2I07B 3L0OA 2DN8A 3NBIA 4MTNA 1XPOA 2B63G 1DD2A 1O7IA 1F2LA 3FPPA 1SFOB 2JSOA 4DPGA 4BBSH 1CHQD 1C7YA 1QB5D 3GTMB 4A3KG 4IUTA 1A0IA 4RMFA 2QA4A 4OO1H 1LTAD 4OX9Q 3V96A 2ENBA 2B63B 1JORA 3HKZE 2OTLA 2ZT9C 2YYZA 2M2LA
chains in the Genus database with same CATH topology
1DOMA 2PZTA 1SMYD 5FO7B 4KHZA 4A3KB 2NB0A 2F0OA 1I6HB 1JB3A 1LLRD 3M7NA 3SVMA 1DJRD 1WTXA 1LTBD 1STGA 3IKJA 4A3BB 5C5LA 4M1UB 3S17B 3K7AB 2NZ1D 1GUSA 1HFNA 2RDHA 4XT3B 1DOKA 2F0IA 1E2VA 1TVXA 1U4PA 2B2WC 4HSPA 2AWOA 3DXJC 4LJZC 1H9JA 2AUKA 1FNVA 4Z9CB 3AU7A 3C3LA 3RD4A 4HTHA 4DN4M 1LTTD 3MZ5A 1QNUA 3GV6A 5LL6X 3E6ZX 3D31A 5IOCA 4OIKA 3I91A 1CTMA 1WCMB 4KKUA 1V1PA 5EBDA 5K36G 3NHHA 1SE3A 1KTKA 3HP3A 4Y7NB 2MUYA 1WTVA 3D6CA 2F0WA 4IFDJ 1IYVA 1Y69U 1SNDA 2WIIB 2F0PA 5KNDA 1HA5A 1FD7D 2N88A 3BZDB 1EYDA 4ZQ3A 4RA8A 1EQTA 3D4DA 4F88A 2D5DA 3OPOA 3VR4A 1YNNC 1SDFA 4IFDH 1RD9D 4HAEA 1QNKA 4K6LA 1KLGD 5NUCA 3M4YA 1L0YB 4OGQC 4LK1C 1ET9A 4X3UA 3KLSA 3S2DB 1DZ1A 2RDFA 4RCOA 1HPCA 2D62A 2FMMA 1ZYRC 4K5VA 1FNWA 1JCKB 2BOSA 4FP5D 5EKIA 2A68D 3C1EA 4XYOA 1EYAA 5HGTA 1EEFD 5EPJA 4F87A 4CKCA 2QF7A 5A2QL 1JWMD 2Z4IA 1GJXA 1T5EA 2WV6D 4DAPA 3OHXC 4RHRA 1K8MA 4A3EB 1TS5A 3DUZA 1ENCA 3CQZB 2KJXA 2M9VA 3K5LA 2HUGA 4NDXA 3VA5A 2KUMA 1A2TA 3C2PA 4K2LA 1CI3M 4L63B 1OXXK 4RHSA 1S5DD 4XQJA 2CVRA 2G9DA 1HUNA 1B2TA 3LX0A 3GTKB 3QWNA 3CKIB 1RDPD 2SNMA 3I70A 5K36H 1LABA 3P7JA 5C3EB 3K0YA 1M8AA 3R93A 1T5XD 3HG9A 2RSOA 5C4HA 1PRTF 1PRTB 4TKOB 3X3MA 2F0DA 1GUGA 2E2JB 3PV0A 3CHBD 5C44B 1GUWA 3NP8A 1EU3A 3JAME 5JVH3 1L0XB 2XSCA 2RDGA 3OSOA 3EROA 5KEEA 4CHTB 3EA6A 1Y1WB 1EY0A 4C3IG 1XTCD 1DYQA 3BYYB 3NQTA 5I6YA 2IX0A 1TKWB 2F03A 5E4XA 2A69C 1U4RA 5EPLA 1LTID 1PTOD 1HUMA 2VNUD 1XX8A 1ML0D 2OF1A 1B1ZA 3NK9A 3HRZC 4B9WA 1LV9A 1TU2B 4MHEA 2CW0C 4X3SA 2Q8IB 1PDQA 2LMCB 4XXEA 3S1NB 4KK7A 3FRPB 3K5NA 1D1KA 2M00A 1AN8A 5E1FA 5CORA 2KA7A 1QWYA 3GQBA 3D3RA 2ZXOA 1EIHA 4S3SA 3SK5A 1WTQA 1LO5D 2D2CC 4KN7C 4C2MB 1BOSA 3K59A 1Q1BA 4QCLA 4PMWA 1SXTA 3J7YW 5JEAJ 2EY6A 1SYBA 4BBRB 3SK8A 5ELCA 1JE4A 5CBAE 1TS2A 2JA7B 1FNUA 1Z7TA 2R7ZB 1MBYA 1TT2A 1HHVA 3HOYB 1JOQA 2L5TA 2RA4A 3HOWB 1WD0A 3MVVA 2NN6G 2LY7A 3GTJB 3I4MB 2LKVA 4KJNA 1STHA 3MEHA 1YNJD 1FGBD 2AQ2B 4KTAA 2A6HC 2XN9C 1S5BD 4FNFA 3FKIB 1SAPA 3MXUA 4X3KA 1BF4A 2R61A 2F0JA 4K2KA 2RSNA 1EIGA 3H0GB 5DNFA 1ZEQX 2F0HA 4R8IA 1U4LA 5ELBA 5EPKA 2AQ1B 2EJMA 3TP6A 2EYOA 4NW2A 2KECA 3EQLC 1SJED 1MGSA 1CK1A 3HS0C 3R3OA 4A3MB 4JBWA 1GUNA 3FDTA 3H91A 3SXHA 3F2UA 3GTLB 3T53B 1CQFA 1GUTA 3DEPA 2K6AA 4TQUS 3SK4A 4ABNA 3D6WA 5C0XJ 5KNCA 2PPBC 1LT6D 2G9HD 3HGBA 1IYUA 2KQ3A 3NBHA 4EQOA 2EY1A 2JYOA 2PCFB 3P20A 5JPMC 1PTOF 1PTOB 3Q24A 3SK6A 1D2BA 4A3IB 4L6TB 2H4OA 2E2DC 3WOEA 4RGMA 3QG1A 4OO1G 3NTKA 2PMZB 4KY6A 3TP5A 2QDBA 3CRKC 3SDZA 3BVMA 4CJ1B 1WTOA 3D4WA 2NN6H 1WTPA 2X69A 1VF5C 1LT3D 1SNCA 3NPPA 2O4XA 4ZK9B 1G2TA 3LWUA 4DU9A 3RZDB 3MFYA 2F0EA 4HEDA 1IW7C 2WACA 2K03A 3FMCA 3J80E 2B8GA 3KF8A 3ERQA 3SHLA 1RODA 1EQVA 1HRJA 3MWYW 2XVSA 1Q12A 5JVG3 4LAAA 2F0GA 5C4JB 1PMRA 5FK9C 1YNND 4C3HG 2JA8B 3C1FA 1SE2A 3PUXA 4BWGB 2JP1A 1I4HA 2XWJB 3RMHA 1KDBA 2EE1A 4BA2I 5D65A 2HDLA 2A6EC 1A3UA 5M5WB 2N55A 4RFBA 1TR5A 2NVYB 1PTOH 2HCCA 1BCPC 2GA4B 1ZYRD 4C56C 2RBMA 3PUYA 1Q8IA 2EJFC 1BCPB 3QB3A 4DAVA 1KDCA 5CC4A 4MIUA 2OT2A 3A7AB 2DNEA 4DK0A 3FEWX 4XDXA 3W2DA 3TMEA 3OOCA 1PZJD 4XTCS 3L7ZC 4IFDG 5I9OA 1ET6A 3M4OB 4O42A 1RJTA 3T13A 2JA6B 2EYHA 5K5PA 1STYA 3GD7A 1E2WA 2FHTA 3HOUB 1IHZA 5CV7A 1CA6A 3WOFA 2K32A 4KHVA 3KLRA 4DAYA 1BXTA 2F0SA 1PFMA 3J7AF 3OIPA 4G7ZC 3P1HA 3X3NA 3QO2A 1O7LA 1Y1VB 1D5XC 4IUQA 4XT1B 1STNA 1PRTD 2Y0SB 1OXVA 4IZ8A 1CZGA 3OW7A 3J7AV 3G7LA 5G3LF 4OHJA 1HQMC 5LL6S 3Q0AA 3EJIA 1F2YA 3J81L 4DA2A 2NTSA 4DXFA 2WKCA 2NYZD 3KLSX 2A73B 5J39A 5KNBA 2R93B 5DAUA 1FR3A 4CBVA 1RCVD 4QB4A 4FF4A 1DCZA 2L0CA 3K57A 1CT1D 4TRDA 2A69D 1NR2A 4ZUIA 2CQAA 3DEOA 2KCNA 2MHVA 4OL7A 2NN6I 4ZKCB 4I7ZC 1HTLD 1U9RA 3TZDA 1I4RA 1KABA 4KY7A 5CV4A 1I4PA 3T56B 3S1MB 2R3ZA 1MI2A 2F0TA 3H6MA 1EY4A 2O5JC 4K6DA 3TN2A 3DMUA 5M3FB 3N52A 1EWHA 1BBXC 2IX1A 4KY5A 5CMDA 3T16A 2FMCA 3A7LA 4L8JA 1FYCA 3LWEA 2SDFA 3ONAB 2HCIA 1G8ZD 1I4GA 4EGVA 1LTRD 1CHPD 1V1PB 2SEBD 5FLXL 1EL0A 1S5FD 1SJHD 2ID0A 5D3DA 2DNCA 2J4XA 1EFID 5CV5A 4IUPA 4CGYB 5C3XA 1TWFB 4ZYSA 4O1NA 1Y8NB 5CYUA 4G7OC 5FO8B 2A6HD 3C46A 2F0FA 1B4OA 2ZXPA 1UUPA 2VB2X 5TSSA 3T51B 1RTNA 1D6EC 2NTTA 4G57A 2QEJC 3OIQA 5EGTA 1SEBD 3MHBA 2TMPA 4FO2A 4J8QA 1SNPA 5EKKA 5IGGA 1ESRA 4OO1I 5JEAG 3S1QB 2BDOA 4C1NI 3TP7A 1SYFA 2C9OA 3A8IE 5IT9E 4IQZA 1Y8PB 3VYRA 4JK1C 5E3FA 1OXTA 4IUVA 3VR5A 5I6WA 4F7XA 5KRUA 1JC7A 4UDUC 1WVLA 3S16B 1IL8A 1SE4A 5IGFA 3IFDA 5I4DA 5T1IA 3IAYA 4K14A 2EJGC 3NWTA 3V05A 3EFXD 2ZXRA 3RLFA 2F0NA 5JPNC 3AMUA 5J1ZA 3JAML 4ZRZA 2SNSA 3H94A 5FKAC 1ILQA 3I4LA 1STEA 2VXWA 5CV6A 1HTPA 5E4WC 4ILWA 1JWSD 1SYGA 4RCNA 3D8GA 4E6IA 2BE5D 2IPKD 4OIJA 3KBXA 5M5YB 1KDAA 2JXMB 3P75A 4QUFA 1O80A 1J8IA 3IL8A 1EY7A 5C0XG 2IL8A 2Z1CA 2K5DA 4A3DB 2ICIA 1VMPA 3VR6A 2NUCA 5J22A 1IW7D 3S15B 2TSSA 4U673 1G2SA 4DGZA 1WD1A 3RZOB 2LS01 1BDOA 1O7YA 2B2VA 4IFDI 3TZUA 4CKBA 4RH6A 1VMCA 1Y8OB 5JEAH 1JOOA 3URYA 3A8JE 1AZPA 1EU4A 3BDCA 4WJWA 3SEBA 2RKSA 4HSVA 4RGTA 4WRDA 3M3YB 2A74C 2PZUA 2EYPA 3ND8A 3CRLC 4K5WA 3MXPA 2A6ED 1LT5D 4UAIA 1II3A 3MAQA 3H3VC 3BVGA 3KBGA 1BCPD 3U9SA 3M85A 3BVZA 1GXDC 2F3WA 2MGSA 4RWSC 3A55A 4A3FB 2A5HA 3NXWA 5A35A 4RKLA 1QILA 4HN7A 3PO3B 3IFTA 5DM63 2B2VC 2HQEA 1H9KA 5LHY1 2WP8J 4HR7B 1X3QA 3I8ZA 1GUOA 2E2HB 4RAUC 2Z8LA 2DY7A 2B2TA 1G291 4WFN3 4EVOA 3S9WA 3I90A 1IKLA 2OEOA 5ISRA 2EPBA 2Z4HA 1R4QB 1ZKOA 1XXGA 5AFWA 5C0XH 1IKMA 1AFPA 4FXGC 5ELFA 4J1MA 2NWGA 1OXSC 3MXNA 2QILA 1DXMA 3NTHA 5G3LD 1AZQA 2BA0A 1EZ8A 3PMFA 3TBIB 4QF4A 1EOTA 3K5MA 1MSGA 1UAPA 1OXUA 1VDZA 1TY2A 3E0JA 1TS4A 4FVMA 4RGOS 4RGNA 2L9HA 4F8MA 1V43A 4DFAA 3GTQB 1BQQT 4FXDA 2BCOA 3BG3A 2K5QA 5ELEA 2BDNA 3BS1A 2MP1A 2WINB 3M7GA 3K6OA 3VYSA 2RQXA 1A2UA 3OWEB 4V190 2X6GA 1EEID 5C5MA 2E2IB 1ILPA 1KNAA 3NQIA 4CJ2C 2QKIC 1G6ZA 1PFBA 2L12A 4C1NK 1M4VA 4KI0A 4PNYA 1QCBD 1YNJC 3KK7A 2Q8TA 4BS9A 2JEBI 2EXZA 1I3QB 4HMIA 2RVLA 2OXPA 5CV8A 1E0BA 3J80L 2D9UA 1BCPF 4HCEA 1JICA 3HOZB 2EDGA 1B44D 3MC0B 4ZAIA 4CKEA 2EYJA 2L55A 1U4MA 1E2ZA 1A15A 3S14B 1PXUA 1X3PA 4XQNA 3K58A 4C3JG 2NVQB 2B8FA 2PQEA 1NUCA 2AUJD 2I46A 1H9RA 2J7ZA 1BO0A 2MJ8A 3UI2A 2PO4A 1X32A 2Q8RE 2F0QA 1KNEA 1MSHA 1BUVT 4C3JB 5KYLA 2AQ3B 2VB3X 5ELDA 2SOBA 4FYDA 1TWAB 4LMQD 5DEHA 2QCPX 4IALA 1BNZA 4RKBA 2F0VA 2FINB 1KAAA 3QJYA 3PUWA 3A54A 3E5SA 3J81E 1F2ZA 2AWNA 2EYLA 4IN3A 4MN3A 1ESFA 5JOBA 1ICWA 3LNNA 2EOTA 3R2TA 3GO5A 5C6AA 2FFKB 4FF3A 2HDMA 4DXGA 2EYFA 2PW7A 1F2MA 2XRSD 3GV3A 4I65A 4ZLTF 2EVBA 1O7ZA 5CGKA 5EJWA 1SNQA 1NAPA 4A3JB 3WDNA 5C4ZA 2R6GA 4DF7A 4K5XA 1NSNS 1C48A 1OO9B 3ITPA 4N9PA 4BY7B 1PZID 4XQQA 5BN5A 3I3CA 5C0XI 1H9MA 2IWHA 4YIJA 1B50A 4H13C 2R92B 2B2YA 3TSSA 2MPMA 3ZYYX 3HZXA 4X3TA 1S5ED 1HXYD 2PYKA 5BN4A 4EQPA 5D14A 3GP7A 1EY9A 3VYUA 2WAQB 2CW0D 5KIXA 1AEXA 1I4QA 4AYBB 2EY2A 2K04A 1EY8A 4XYQA 1CM9A 2LFNA 2K33A 5A2QE 2IJ0A 5IODA 5EBCA 5FLXE 5CR3A 4PMBA 2L1BA 3Q23A 4BA1I 1QE6A 4U68A 1HCZA 2XWBB 1Z47A 1JR0D 1SYDA 1PZKD 4G4KA 1SYCA 1SNMA 2F0UA 1W6KA 4ZUJA 1AW7A 4CJ0B 4Q5VA 1Z6HA 1Q1EA 4DNTB 2E75C 1XYIA 2KEDA 2B2YC 2F1MA 5M9OA 4QUCA 5M3MB 1CFMA 1QJOA 1K83B 4N9TA 2KVMA 2WB1B 2O5IC 3BYTB 4FXKC 1TS3A 4KD3A 2B39A 1EY6A 1TWGB 4EQNA 2NVXB 1SMYC 1SNOA 1K8OA 4HCSA 2K7VA 2F0LA 4R8NA 1ENAA 3S1RB 4ZKBB 2KEEA 3QOJA 3PO2B 2V4DA 2XNAC 1KLUD 4ULLA 2L11A 3GTOB 2F0MA 4KN4C 1PRTC 3D4RA 1TWHB 3VR3A 5KYIA 1XWEA 1ZXTA 3TP8A 1VCIA 1B53A 4KD4A 1C8CA 2VUMB 3NUCA 3VA7A 2IX3A 4P2CB 5BN3A 4BY1B 3GTGB 1JOKA 2XRQD 1EY5A 2J0TD 3PUVA 3OMCA 5CBEE 5FOBB 1A6XA 1F77A 2WKDA 4PQXA 5IGEA 1JQYD 4Q0FA 2KHSA 3HOXB 1EYCA 3MFGA 3DWQA 1J9OA 4GZYC 5IIFA 5IT9L 3I4NB 1H9SA 3BDOA 2PNRC 4PMCA 4C3IB 2O2LD 3W3AA 1GHJA 5D3IB 1B3AA 1BR9A 1STBA 3L3OC 5FO9B 3R2IA 2K28A 4IUNA 5I2XA 4DNRB 3NE5B 1WTRA 2H1EA 3T4AC 1D1IA 1HQRD 1F9PA 2C5CA 3BDLA 4J6HA 3NTIA 4V0BA 5EQ0A 3U9OA 3QOLA 1LACA 1LTGD 2NVTB 2A68C 1JWUD 3PIO3 1RHPA 1HFGA 3OMGA 3O13A 5T1GA 2JA5B 1QOHA 3V2TA 1PYWD 5C4XB 2E76C 1Q90A 3EVQA 1D5MC 1W6JA 1H9SB 1RTOA 4H7BA 2K5WA 1RF2D 4K8JA 4WORA 3QIAA 3HEJA 1CQVA 3G6JB 2EY5A 3MA2B 2F4IA 3FPUB 1O78A 4NMZA 2X6LA 5IGCA 3ND9A 2NBFA 2EYMA 1DONA 2ICEC 4ODGA 3KUPA 5IGDA 3HKZB 2YU9B 1TWCB 2IT1A 2IW3A 1GOZA 2K05A 4H44C 5HURA 3HOVB 1S4ZA 4IURA 1SYEA 5F2DA 1QG7A 2FJ2A 1WTWA 1SBBB 2BA1A 2PZWA 2JE6I 2CHBD 5JAVA 4DK1A 5DM73 3A8KE 4B9XA 2EZVA 3NSWA 5I2YA 4NKLA 4ID6A 5I9PA 1PLFA 3CU7A 3NWSA 1NCVA 1PTOC 3DHQA 1DM0B 4B08A 4FF2A 3L9AX 3MXGA 5EKLA 3DM1A 4ME5A 4KMUC 2KOLA 4FF1A 5C3WA 1S5CD 4XIGS 1F9SA 1B9NA 3Q22A 1LT4D 1B9MA 3PIP3 2PW5A 3Q6SA 1A3TA 1D5ZC 4BBSB 1ENFA 2K01A 3DWPA 3A56A 1STAA 1HA6A 1DOLA 5COYA 2B2TC 1EWCA 2BE5C 1EZ6A 3N6RA 3AB9A 2DY8A 1V8QA 1R4PB 2F0KA 1CA5A 3H09A 1G91A 1ONLA 3I72A 4KKSA 2B2UA 4A93B 3I73A 1F9RA 1AP0A 1I50B 1V1OA 1VF7A 3SR1A 4QMGA 1RKNA 1UEAB 1TIID 5CV9A 5KGUA 4QIWB 1NR4A 3DWAA 4K8IA 2L4NA 3OWFA 4IUUA 1GHKA 1I4XA 1F9QA 3K5OA 3MTSA 2E74C 3R8BA 4KV6A 1A3VA 3VYTA 2XIWA 4NP5A 3TDQA 4KKTA 2K1BA 3SE0A 2KCCA 3PUZA 4HMJA 4KJOA 4TSSA 1I6VC 2F3VA 1C4QA 1TQOA 4M8AA 1SSOA 1UNSA 1PFNA 5M5XB 4PV1C 3GTPB 4A3GB 1Q3LA 4H0LC 3RUZA 4C3HB 5JJZA 4R9WA 5IGBA 1TY0A 1MD2D 4G7HC 1R9TB 1CZWA 2B2UC 1LTSD 2B2WA 3S2HB 2JEAI 3VR2A 3FVQA 2I07B 2DN8A 3NBIA 1DD2A 1F2LA 3FPPA 1SFOB 2JSOA 1CHQD 1QB5D 3GTMB 4IUTA 4OO1H 1LTAD 3V96A 2ENBA 2B63B 1JORA 2ZT9C 2YYZA 2M2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TT2 A;  4ODG A;  2PZT A;  4I65 A;  1KDC A;  5IGD A;  2F0K A;  3NP8 A;  5CC4 A;  4MIU A;  5CGK A;  1KDA A;  5IIF A;  1JOQ A;  2F0O A;  3P75 A;  5NUC A;  4TRD A;  4G57 A;  3MVV A;  1SNQ A;  1EY7 A;  4N9T A;  4KY6 A;  4ZUI A;  5EGT A;  3OSO A;  2LKV A;  3ERO A;  2RDF A;  4PNY A;  4PMC A;  3TME A;  2QDB A;  4K5X A;  3TP5 A;  4KJN A;  4DF7 A;  5C4Z A;  1STH A;  3MEH A;  5KEE A;  1NSN S;  1STG A;  3MHB A;  4EVO A;  2NUC A;  2EXZ A;  3S9W A;  5HUR A;  5I9O A;  2OEO A;  4HMI A;  4KTA A;  5ISR A;  4K5V A;  3ITP A;  1SNP A;  4N9P A;  5EKK A;  5IGG A;  2OXP A;  4KD3 A;  4OL7 A;  5J22 A;  5C5L A;  3D4W A;  3SR1 A;  4QMG A;  1RKN A;  5CV8 A;  5CV9 A;  5KGU A;  1SYE A;  1EY0 A;  1STB A;  3C1E A;  3T13 A;  1EY6 A;  4DGZ A;  4K8I A;  5F2D A;  4IUN A;  4EQN A;  1EYA A;  5HGT A;  1SNC A;  3TP7 A;  2EYH A;  3OWF A;  5K5P A;  1U9R A;  3NQT A;  1SYF A;  1SNO A;  1KAB A;  1STY A;  2F0I A;  4KY7 A;  5CV4 A;  4YIJ A;  5I6Y A;  2O4X A;  4KV6 A;  2F0L A;  1A3V A;  4J1M A;  2F0J A;  2PZW A;  2EYJ A;  4R8N A;  1ENA A;  1JOO A;  2F0T A;  3BDL A;  4J6H A;  4K2K A;  4NP5 A;  1IHZ A;  5CV7 A;  3H6M A;  5E3F A;  1EY4 A;  2F0H A;  5JAV A;  3HZX A;  4K6D A;  4B9X A;  2OF1 A;  3DMU A;  3NK9 A;  4KHV A;  2PYK A;  3U9O A;  4HMJ A;  3BDC A;  4DU9 A;  5I6W A;  4KJO A;  3TP6 A;  2F0E A;  2F3V A;  2EYO A;  3QOJ A;  4EQP A;  2F0S A;  2WAC A;  4HTH A;  1EZ8 A;  1ENC A;  3QOL A;  4B9W A;  2RKS A;  4F7X A;  1TQO A;  5KRU A;  2PQE A;  3PMF A;  4QF4 A;  1EY9 A;  3R3O A;  1NUC A;  4WRD A;  2PZU A;  2EYP A;  3P1H A;  4NKL A;  5IGF A;  4ID6 A;  4KY5 A;  3MZ5 A;  5I9P A;  3T16 A;  5KIX A;  1AEX A;  4K5W A;  4NDX A;  2EY2 A;  3ERQ A;  3MXP A;  2M00 A;  3SHL A;  3SXH A;  3VA5 A;  5E1F A;  3OMG A;  1EQV A;  2F0Q A;  1A2T A;  1EY8 A;  2F0M A;  1II3 A;  5IOC A;  4F8M A;  3RUZ A;  3DHQ A;  1STN A;  4K2L A;  5KYL A;  5IOD A;  5KYI A;  4LAA A;  4DFA A;  5CR3 A;  4PMB A;  4K14 A;  2F0G A;  2SOB A;  3TP8 A;  5IGB A;  3V2T A;  4S3S A;  3SK4 A;  5DEH A;  3SK5 A;  3NHH A;  4IAL A;  4KD4 A;  5EKL A;  4ME5 A;  3EVQ A;  4RKB A;  3C1F A;  4IZ8 A;  5CV5 A;  5C3X A;  3NUC A;  4H7B A;  3LX0 A;  3D6C A;  4K8J A;  1SYD A;  2F0V A;  2F0N A;  1KDB A;  1KAA A;  2F0W A;  2F3W A;  4WOR A;  5C3W A;  5J1Z A;  3HEJ A;  3EJI A;  2SNM A;  3E5S A;  3NXW A;  1F2Y A;  1SND A;  1SYC A;  2KQ3 A;  1JOK A;  1SNM A;  2F0U A;  2F0P A;  2SNS A;  4RKL A;  1A3U A;  1EY5 A;  1F2Z A;  2EYL A;  4ZUJ A;  3OMC A;  1A2U A;  2EY6 A;  1SYB A;  1TR5 A;  2EY5 A;  5JOB A;  4EQO A;  2HQE A;  2EY1 A;  2PW5 A;  3SK8 A;  5CV6 A;  1A3T A;  1EYD A;  5C6A A;  4NMZ A;  4ZQ3 A;  1STA A;  1SYG A;  5C4H A;  3D4D A;  5IGC A;  2EYF A;  2RBM A;  3D8G A;  5C5M A;  3SK6 A;  2F0D A;  5J39 A;  2F0F A;  2ENB A;  2PW7 A;  4E6I A;  5IGE A;  5DAU A;  5M9O A;  1EZ6 A;  1JOR A;  2KHS A;  2EYM A;  1EYC A;  1F2M A;  4QB4 A;  3QB3 A; 
#chains in the Genus database with same CATH topology
 1DOM A;  2PZT A;  2HT1 A;  1SMY D;  1U0L A;  4A3B G;  1WI5 A;  5FO7 B;  4KHZ A;  4A3K B;  2NB0 A;  2F0O A;  4LF6 Q;  4A3C H;  1I6H B;  1UE7 A;  1JB3 A;  1LLR D;  5AJ3 L;  4OON A;  3M7N A;  3SVM A;  1DJR D;  3OYY A;  1WTX A;  4A93 H;  1LTB D;  1QVG A;  1STG A;  1I50 H;  3IKJ A;  4A3B B;  1HR0 W;  4DR4 L;  4A3J G;  5C5L A;  4M1U B;  1G51 A;  3S17 B;  3K7A B;  1N32 Q;  2NZ1 D;  1GUS A;  1L1O A;  1HFN A;  2RDH A;  4DR6 Q;  4XT3 B;  4LF7 L;  1CSQ A;  4JW0 A;  1DOK A;  2F0I A;  1E2V A;  1TVX A;  1U4P A;  2B2W C;  4HSP A;  2AWO A;  1BBU A;  3DXJ C;  1T9H A;  1I3Q H;  4LJZ C;  1H9J A;  5LMU L;  2AUK A;  1FNV A;  4Z9C B;  3AU7 A;  3C3L A;  1L2F A;  3RD4 A;  4HTH A;  4DN4 M;  1WCM G;  1LTT D;  1L0W A;  3MZ5 A;  3GTP H;  4UP7 A;  4A3G H;  1QNU A;  3GV6 A;  1ASZ A;  1FL0 A;  5LL6 X;  3T1Y Q;  3E6Z X;  3D31 A;  1GVP A;  5IOC A;  4OIK A;  3I91 A;  1KL9 A;  1CTM A;  4AYB G;  4QJF A;  1WCM B;  4X65 L;  1R9T H;  4KKU A;  1V1P A;  5EBD A;  5K36 G;  3NHH A;  4YY3 L;  1SE3 A;  1KTK A;  3HP3 A;  3S2H H;  1JJ2 A;  4Y7N B;  2MUY A;  4UPA A;  1WTV A;  3D6C A;  1JT8 A;  2F0W A;  4IFD J;  1IYV A;  1Y69 U;  3U4V A;  1SND A;  2WII B;  2VW9 A;  1SFO H;  4JYA Q;  2F0P A;  3I56 A;  1L1O C;  5KND A;  3GTM H;  1HA5 A;  1FD7 D;  1XPR A;  2N88 A;  2K5N A;  3BZD B;  4A75 A;  3OW2 A;  1HZC A;  1EYD A;  1NTG A;  3H3V I;  1L1O B;  1TWA H;  4MZ9 A;  4RA8 A;  1EQT A;  4ZQ3 A;  3D4D A;  2B63 H;  1FJG Q;  4F88 A;  2D5D A;  3OPO A;  3VR4 A;  1YNN C;  3TEH B;  3UE0 A;  2EQS A;  5IWA Q;  2I5M X;  1SDF A;  4A3K H;  4IFD H;  1BBW A;  1RD9 D;  3I55 A;  1I6H H;  4HAE A;  1QNK A;  4K6L A;  1KLG D;  2V1C C;  4DV3 Q;  5NUC A;  2OWO A;  3M4Q A;  3M4Y A;  1L0Y B;  4OGQ C;  4LK1 C;  1ET9 A;  4X3U A;  3KLS A;  3S2D B;  1DZ1 A;  3RLO A;  1S40 A;  2RDF A;  4LF4 Q;  4RCO A;  2Z6K A;  4DR1 Q;  4A3B H;  1XMO Q;  1HPC A;  4QIW E;  2D62 A;  2RCF A;  2FMM A;  5IYB G;  1ZYR C;  3S17 H;  1MJC A;  4K5V A;  1FNW A;  4AQY L;  1JCK B;  2BOS A;  1CKO A;  4FP5 D;  2A68 D;  3C1E A;  5EKI A;  4DKA C;  4XYO A;  1EYA A;  5HGT A;  1EEF D;  5EPJ A;  4F87 A;  4A3J H;  4CKC A;  2QF7 A;  5A2Q L;  1JWM D;  2Z4I A;  2UUC L;  1T5E A;  1GJX A;  2WV6 D;  3KDF B;  4DAP A;  1GM5 A;  1VQK A;  2JA9 A;  3OHX C;  4RHR A;  1K8M A;  4OWW B;  4A3E B;  3UDX A;  1TS5 A;  3DUZ A;  3TS2 A;  1ENC A;  3STB C;  3CQZ B;  2XTI A;  4DK6 C;  1UE6 A;  2KJX A;  2M9V A;  1HR0 Q;  3K5L A;  5IT9 c;  2HUG A;  2B3G A;  3G6E A;  4JI5 Q;  4JI7 L;  1WJJ A;  3CCE A;  4NDX A;  3CC4 A;  3VA5 A;  2KUM A;  2Z0S A;  2LXK A;  1A2T A;  4DR3 L;  3C2P A;  4K2L A;  1WCM H;  1XJV A;  1CI3 M;  4L63 B;  1OXX K;  4RHS A;  1S5D D;  4XQJ A;  3F1Z A;  1IBK Q;  2NZH A;  2DJF C;  4Y7N H;  2CVR A;  1CSP A;  2G9D A;  1JE5 A;  1HUN A;  1B2T A;  3LX0 A;  4B3T Q;  1I5F A;  3GTK B;  3QWN A;  3CKI B;  4DV2 L;  1KXL A;  1RDP D;  2SNM A;  1Q46 A;  3I70 A;  5K36 H;  1LAB A;  3P7J A;  5C3E B;  3K0Y A;  1M8A A;  4DV0 Q;  3R93 A;  1T5X D;  3HG9 A;  1SRO A;  2RSO A;  5C4H A;  1PRT F;  1PRT B;  4TKO B;  3X3M A;  2F0D A;  2AHO B;  2ZTC A;  1GUG A;  4HJ8 A;  2E2J B;  3PV0 A;  4HIK A;  3CHB D;  5C44 B;  1GUW A;  3NP8 A;  1EU3 A;  4JI2 L;  2Z9H A;  3JAM E;  3S2D H;  5JVH 3;  1PV4 A;  3HOX G;  1L0X B;  1YIT A;  2ZJP A;  2XSC A;  2RDG A;  3OSO A;  3ERO A;  2KHJ A;  3AEV A;  5KEE A;  1HNW L;  1YNX A;  1B3Q A;  2PNH A;  3I4N G;  4CHT B;  2UUA L;  3EA6 A;  1X3F A;  1Y1W B;  3CCQ A;  1EY0 A;  4C3I G;  1XTC D;  1MJE A;  1DYQ A;  4MTK A;  4R1J A;  1JB7 A;  2ZTD A;  3BYY B;  5GRO A;  3NQT A;  3AQQ A;  4EX5 A;  5I6Y A;  2IX0 A;  1TKW B;  2F03 A;  3F2C A;  5E4X A;  2A69 C;  1U4R A;  5EPL A;  1LTI D;  1PTO D;  1HUM A;  2VNU D;  1XX8 A;  3CW2 C;  1ML0 D;  4J15 A;  1NMG A;  2OF1 A;  1QZH A;  5GAE C;  1B1Z A;  3NK9 A;  3CQZ H;  3HRZ C;  4B9W A;  1LV9 A;  1TU2 B;  4MHE A;  2CW0 C;  1W2B A;  1IBL L;  4X3S A;  2Q8I B;  1PDQ A;  2LMC B;  4R4C A;  4XXE A;  3S1N B;  4KK7 A;  3FRP B;  3K5N A;  1D1K A;  2M00 A;  1AN8 A;  5E1F A;  1X3E A;  3T1H Q;  5COR A;  2KA7 A;  1KD1 C;  5IYC G;  2RF4 A;  1ICF B;  3S1R H;  1QWY A;  1KRT A;  3GQB A;  3D3R A;  2ZXO A;  1EFW A;  1EIH A;  4S3S A;  3SK5 A;  1YBY A;  1EUJ A;  4BBR G;  1WTQ A;  1U5K A;  3GTK H;  1LO5 D;  2D2C C;  3CPW A;  1PH1 A;  1CKN A;  4KN7 C;  4AYB E;  4C2M B;  1BOS A;  3G48 A;  4IPD A;  3K59 A;  2UXC L;  4B3S Q;  4POF A;  1Q1B A;  5C4X G;  4QCL A;  4PMW A;  2IHF A;  1TWH H;  1SXT A;  3H15 A;  4JI1 Q;  3J7Y W;  5JEA J;  2EY6 A;  1SYB A;  4BBR B;  3RNU A;  3ER0 A;  3SK8 A;  4X62 Q;  5ELC A;  1JE4 A;  4L5T A;  5CBA E;  1TS2 A;  2E2J H;  2JA7 B;  4IJH A;  5C44 H;  1FNU A;  1Z7T A;  2R7Z B;  1EQR A;  1MBY A;  1TT2 A;  3RN5 A;  1HHV A;  1N36 L;  3HOY B;  1JOQ A;  1VQJ A;  3D0F A;  2L5T A;  2RA4 A;  3HOW B;  1WD0 A;  4LFC L;  3MVV A;  2NN6 G;  2LY7 A;  4GKJ L;  3GTJ B;  3I4M B;  2LKV A;  3FKI G;  4KJN A;  1STH A;  3MEH A;  1YNJ D;  3CCU A;  4DUY L;  1FGB D;  2AQ2 B;  2A6H C;  4KTA A;  2OQK A;  2XN9 C;  1S5B D;  4FNF A;  1YHB A;  3FKI B;  1SAP A;  3MXU A;  3I4N H;  4X3K A;  1BF4 A;  1EWI A;  2R61 A;  2F0J A;  4QGU A;  4R4O A;  4PZ7 A;  4K2K A;  2RSN A;  1EIG A;  3H0G B;  5DNF A;  1ZEQ X;  1N33 Q;  2F0H A;  4R8I A;  1U4L A;  5ELB A;  3M4P A;  5EPK A;  2GVA A;  2AQ1 B;  2EJM A;  3TP6 A;  1C0A A;  2EYO A;  1FVI A;  4NW2 A;  2KEC A;  3EQL C;  1SJE D;  1MGS A;  1CK1 A;  3HS0 C;  3R3O A;  3S1N H;  4A3M B;  4JBW A;  1XNQ L;  4IPH A;  1GUN A;  3FDT A;  3H91 A;  3SXH A;  3F2U A;  3GTL B;  4HIO A;  4JI4 Q;  3T53 B;  1CQF A;  2BH2 A;  3A5Z B;  1GUT A;  2C35 B;  3DEP A;  2R7F A;  2K6A A;  4TQU S;  3SK4 A;  4ABN A;  2NVT H;  3D6W A;  4C2M H;  5C0X J;  5KNC A;  1PH2 A;  2PPB C;  1LT6 D;  1VQH A;  2G9H D;  3HGB A;  1PH8 A;  1IYU A;  4NXN L;  2KQ3 A;  4WJ3 M;  3NBH A;  4BBR H;  4EQO A;  2EY1 A;  1MIU A;  2ATW A;  3EBE A;  2JYO A;  2PCF B;  3P20 A;  2JA7 H;  4NB3 A;  3CCL A;  5JPM C;  1PTO F;  1PTO B;  3Q24 A;  4DV7 Q;  3SK6 A;  1D2B A;  2R7Z H;  4A3I B;  4L6T B;  2JK8 A;  3HOY H;  2H4O A;  4BBS G;  1WFQ A;  2E2D C;  3WOE A;  3HOW H;  4RGM A;  1E24 A;  3QG1 A;  3GTJ H;  1QZG A;  4OO1 G;  3NTK A;  2PMZ B;  3UDG A;  1HZ9 A;  4KY6 A;  3TP5 A;  2QDB A;  3CRK C;  3SDZ A;  3BVM A;  4CJ1 B;  1WTO A;  4A3C G;  3AFP A;  3D4W A;  2NN6 H;  1WTP A;  1UE1 A;  2X69 A;  3FKI H;  1VF5 C;  4A93 G;  1LT3 D;  1SNC A;  1TWC H;  2UXB L;  4JV5 L;  3NPP A;  3AYH B;  2D0P A;  2WFW A;  2O4X A;  4P74 A;  5AJ3 Q;  3CXC A;  3H0G H;  1QUQ A;  2MFI A;  4DAM A;  4ZK9 B;  1G2T A;  4X64 L;  3CPF A;  4UP8 A;  3LWU A;  3CMA A;  3DM3 A;  4DU9 A;  3RZD B;  3MFY A;  2F0E A;  4ME3 A;  4HED A;  4DR4 Q;  1IW7 C;  1JJC B;  2WAC A;  2K03 A;  4A3M H;  3FMC A;  3S24 A;  3NBH B;  3CME A;  4QL5 A;  1VQ5 A;  4LF7 Q;  1SRU A;  3J80 E;  3GTL H;  2B8G A;  1KHI A;  3I2Z A;  3KF8 A;  3ERQ A;  3SHL A;  1YZ6 A;  2PI2 A;  1ROD A;  1EQV A;  1HRJ A;  2K52 A;  3MWY W;  2XVS A;  1Q12 A;  5JVG 3;  4LAA A;  4DR2 Q;  2F0G A;  1NY4 A;  3IRB A;  5C4J B;  2HQL A;  5LMU Q;  1PMR A;  5FK9 C;  2DUD A;  1YNN D;  4C3H G;  2ZJQ A;  2JA8 B;  4HJ9 A;  3C1F A;  1SE2 A;  3PUX A;  4YWM A;  4BWG B;  2JP1 A;  1I4H A;  3W5O A;  4DV4 Q;  2XWJ B;  3RMH A;  1KDB A;  2EE1 A;  4BA2 I;  5D65 A;  3J81 j;  2HDL A;  2A6E C;  1A3U A;  1AE3 A;  5M5W B;  2N55 A;  1FGU A;  4GKK Q;  4RFB A;  1TR5 A;  2NVY B;  1PTO H;  2AKW B;  1HNX L;  4B3R L;  2HCC A;  1BCP C;  2GA4 B;  4X65 Q;  4LUZ A;  2CH4 A;  1ZYR D;  4C56 C;  2RBM A;  3PUY A;  1Q8I A;  2A1A A;  2EJF C;  4YY3 Q;  2K5V A;  3L2P A;  4NXM L;  4DV5 L;  1BCP B;  3QB3 A;  4DAV A;  1KDC A;  2OCE A;  5IE8 A;  5CC4 A;  4MIU A;  2OT2 A;  3A7A B;  1Y14 B;  2DNE A;  4DK0 A;  1K28 A;  3K7U C;  3FEW X;  4XDX A;  1E1O A;  3W2D A;  3TME A;  3OOC A;  1PZJ D;  4XTC S;  3L7Z C;  5IP7 G;  2ASB A;  4IFD G;  5I9O A;  1ET6 A;  2PQA A;  3ZJY C;  3M4O B;  4O42 A;  1RJT A;  1NNX A;  3HOU G;  3STB D;  3T13 A;  1HH2 P;  1WOC A;  2BH8 A;  2JA6 B;  2EYH A;  5K5P A;  2E8G A;  1STY A;  3GD7 A;  4Y52 H;  1E2W A;  3CCJ A;  2FHT A;  1QVC A;  4EQ5 A;  3HOU B;  1IHZ A;  5CV7 A;  1CA6 A;  3RZD H;  3BU2 A;  1Y1V G;  3KF6 B;  3WOF A;  2K32 A;  4KHV A;  3KLR A;  4DAY A;  1BXT A;  2F0S A;  3BJU A;  4GNX A;  1PFM A;  4DV1 L;  3J7A F;  3HFZ B;  3OIP A;  1HZB A;  4G7Z C;  1TXY A;  2Y0S G;  3P1H A;  3X3N A;  3QO2 A;  1O7L A;  1Y1V B;  2B29 A;  1M1K C;  1VQP A;  1D5X C;  4IUQ A;  4MNO A;  1P16 A;  2UUC Q;  4XT1 B;  1STN A;  1PRT D;  5C4J H;  4KLK A;  2JJQ A;  2Y0S B;  3FHW A;  2JN4 A;  1OXV A;  4IOA A;  3F2D A;  4IZ8 A;  3CC2 A;  1CZG A;  3OW7 A;  3J7A V;  3G7L A;  5G3L F;  3F8T A;  4JI7 Q;  4OHJ A;  5M5X H;  1HQM C;  5LL6 S;  4DR5 L;  3Q0A A;  3EJI A;  5FJ8 G;  1N9W A;  1F2Y A;  3J81 L;  4DA2 A;  2NZO A;  1LM0 A;  4C3H H;  2NVY H;  2LXJ A;  4DR3 Q;  2NTS A;  4DXF A;  2WKC A;  1HNZ Q;  1PFS A;  2NYZ D;  3KLS X;  2A73 B;  5J39 A;  5KNB A;  2R93 B;  1GKH A;  4JOI A;  5DAU A;  1FR3 A;  1YHA A;  4CBV A;  1RCV D;  4QB4 A;  4FF4 A;  1DCZ A;  2L0C A;  3K57 A;  1CT1 D;  4DV2 Q;  4GNX C;  1YJN A;  4TRD A;  2ZJR A;  2A69 D;  4GLA C;  1NR2 A;  4JBJ A;  4ZUI A;  3KFU A;  2CQA A;  3DEO A;  3M4O H;  2KCN A;  3G71 A;  2H5X A;  4OWX B;  1AH9 A;  2MHV A;  4OL7 A;  2NN6 I;  4IOC A;  4ZKC B;  4I7Z C;  1VQ4 A;  5IP7 H;  1HTL D;  1U9R A;  3TZD A;  3RN2 A;  1I4R A;  1KAB A;  4KY7 A;  5CV4 A;  1I4P A;  3T56 B;  2YV5 A;  2I0Q A;  2KEN A;  3HOU H;  3S1M B;  2K5H A;  2R3Z A;  1MI2 A;  2F0T A;  3TRZ A;  3H6M A;  1EY4 A;  1HNW Q;  2O5J C;  4K6D A;  1GD7 A;  3TN2 A;  4DV6 Q;  4JBM A;  3DMU A;  5M3F B;  4OX9 L;  2UUA Q;  2UUB L;  3K7A H;  1LUZ A;  3N52 A;  1EWH A;  1BBX C;  4LUV A;  1E22 A;  2IX1 A;  4KY5 A;  1Y1V H;  4IPG A;  5CMD A;  4A3E G;  3T16 A;  1VQE A;  3JAM i;  2FMC A;  3A7L A;  4JOI C;  4L8J A;  1FYC A;  3LWE A;  2SDF A;  3ONA B;  2HCI A;  1G8Z D;  3UE1 A;  1I4G A;  2OTJ A;  4EGV A;  1LTR D;  1CHP D;  1V1P B;  2CWP A;  2SEB D;  5FLX L;  1EL0 A;  1S5F D;  1SJH D;  4GOP A;  3KOJ A;  2ID0 A;  3VDY A;  3CD6 A;  5D3D A;  2DNC A;  1N32 L;  2J4X A;  1EFI D;  5CV5 A;  4IUP A;  4CGY B;  5C3X A;  3B6Y A;  1IBL Q;  4OEM B;  1TWF B;  1E3P A;  4ZYS A;  1D7Q A;  4O1N A;  4DR7 L;  3G4S A;  1Y8N B;  4YWL A;  5CYU A;  4G7O C;  2VS1 A;  2QW7 A;  5LMN W;  5FJ8 H;  5FO8 B;  2A6H D;  5C3E G;  2I5H A;  5GQO A;  3C46 A;  2F0F A;  1B4O A;  2ZXP A;  3E0E A;  2VQF L;  1VQM A;  1W3S A;  1KC8 C;  1EIY B;  2AMC B;  1UUP A;  1K0S A;  2VB2 X;  1I94 Q;  2A8V A;  2Z6K C;  2MO1 A;  5TSS A;  5JJL A;  3T51 B;  4HJ5 A;  2UXC Q;  3J7A 5;  3I7F A;  2R7D A;  4NPS A;  1SR3 A;  1RTN A;  3T1Y L;  1D6E C;  2NTT A;  5BR8 Q;  4G57 A;  2QEJ C;  3OIQ A;  4A3L G;  5C44 G;  5EGT A;  1SEB D;  3WWV A;  3MHB A;  4CDF C;  2TMP A;  4FO2 A;  4J8Q A;  1A62 A;  1SNP A;  5EKK A;  5IGG A;  1ESR A;  2D0O A;  4OO1 I;  3HKS A;  5JEA G;  4GOP C;  3S1Q B;  2BDO A;  4C1N I;  3TP7 A;  1N36 Q;  4ALP A;  4A4I A;  4JYA L;  1SYF A;  2C9O A;  3A8I E;  3S1M H;  4LFC Q;  5IT9 E;  2XGT A;  1Y1W G;  4IQZ A;  4GKJ Q;  1Y8P B;  2CCZ A;  3VYR A;  1VQN A;  4JK1 C;  5E3F A;  3U58 A;  5M3F H;  1J6Q A;  5E7N A;  1OXT A;  4DUY Q;  2CKZ B;  4IUV A;  4LFA L;  3VR5 A;  5I6W A;  1J5E L;  2Q2H A;  4F7X A;  5KRU A;  1JC7 A;  4UDU C;  1WVL A;  3S16 B;  1IL8 A;  1SE4 A;  2RCN A;  3AFQ A;  4OXP A;  5IGF A;  3K81 C;  3IFD A;  4DV3 L;  5I4D A;  5T1I A;  3IAY A;  2Y0S E;  3CF5 A;  4A3E H;  4K14 A;  2EJG C;  4IPC A;  1VQF A;  2MNA A;  3NWT A;  1B70 B;  3V05 A;  3EFX D;  3RLN A;  2ZXR A;  3RLF A;  1TWF H;  5JJK A;  1PH5 A;  2F0N A;  1XNQ Q;  5JPN C;  1IBM L;  3AMU A;  5J1Z A;  1K8A C;  2F4V Q;  3JAM L;  4ZRZ A;  2SNS A;  3H94 A;  5FKA C;  4B3M L;  3QR8 A;  1ILQ A;  3I4L A;  1STE A;  2VXW A;  5CV6 A;  1HTP A;  1MHW C;  5E4W C;  4ILW A;  1JWS D;  1SYG A;  4RCN A;  3D8G A;  1IL2 A;  4E6I A;  2BE5 D;  2IPK D;  1XNR Q;  4OIJ A;  4JC0 A;  3KBX A;  5M5Y B;  4PZ8 A;  2JA7 G;  1KDA A;  5C3E H;  2JXM B;  4NXN Q;  3P75 A;  4L5Q A;  4JI6 Q;  4QUF A;  1O80 A;  1J8I A;  3IL8 A;  2R7Z G;  1EY7 A;  1WTH A;  1NMF A;  2IL8 A;  5C0X G;  4LF9 L;  3HOY G;  2Z1C A;  2K5D A;  4A3D B;  2ICI A;  1VMP A;  3VR6 A;  2NUC A;  3HOW G;  4PZ6 A;  4R4T A;  5J22 A;  1IW7 D;  3S15 B;  3CCM A;  3I4M G;  5LMN Q;  3S1Q H;  4A3L H;  2TSS A;  4U67 3;  4B3T L;  1G2S A;  4DGZ A;  1WD1 A;  2ALY B;  3RZO B;  1PH9 A;  2LS0 1;  1BDO A;  1O7Y A;  2B2V A;  4IFD I;  3TZU A;  4CKB A;  4RH6 A;  1UEB A;  4WJ4 A;  1VMC A;  1Y8O B;  2KBN A;  5JEA H;  1JOO A;  3URY A;  3A8J E;  4QQB X;  1AZP A;  3K8A A;  1EU4 A;  2ZM6 L;  3BDC A;  4WJW A;  2HIX A;  3SEB A;  1Y1W H;  2IY5 B;  2RKS A;  3H0G G;  4HSV A;  4RGT A;  4WRD A;  3SGI A;  2A74 C;  2PZU A;  3M3Y B;  2EYP A;  3ND8 A;  4O2D A;  2UXB Q;  4JV5 Q;  3CRL C;  4K5W A;  4LNQ A;  2FXQ A;  3MXP A;  2A6E D;  1LT5 D;  3TS0 A;  4UAI A;  1II3 A;  3MAQ A;  3H3V C;  3K0X A;  3J7Z C;  4A3M G;  4CDD C;  1YJ9 A;  1K73 C;  4X64 Q;  1YJW A;  3CCS A;  3RR5 A;  3BVG A;  3KBG A;  1BCP D;  1CKN B;  3U9S A;  3UDI A;  3M85 A;  2A19 A;  5GAD C;  4DUZ Q;  3BVZ A;  1GXD C;  2F3W A;  1AE2 A;  4GN5 A;  2MGS A;  4RWS C;  3A55 A;  4A3F B;  2A5H A;  3NXW A;  1E1T A;  5A35 A;  4RKL A;  1QIL A;  3KYH C;  4JI0 L;  4HN7 A;  3PO3 B;  3IFT A;  5DM6 3;  2B2V C;  3E3X A;  4DNI A;  2HQE A;  1H9K A;  5LHY 1;  2WP8 J;  4JI8 L;  4HR7 B;  4LFB L;  1X3Q A;  3I8Z A;  1XPU A;  1KQS A;  1GUO A;  2E2H B;  4RAU C;  3JC6 6;  5M5Y H;  3J80 i;  2Z8L A;  5DLQ E;  2DY7 A;  4A3I G;  3NEM A;  2B2T A;  4A3D H;  1K8G A;  3OTO L;  1G29 1;  4APV A;  4WFN 3;  4EVO A;  1HNX Q;  4B3R Q;  3S9W A;  3I90 A;  1IKL A;  2OEO A;  5ISR A;  2EPB A;  2Z4H A;  3CCV A;  2HD3 A;  1V9P A;  4JCV E;  1R4Q B;  3RZO H;  4NXM Q;  4DV5 Q;  1ZKO A;  1XXG A;  2EXD A;  5AFW A;  5C0X H;  1IKM A;  1AFP A;  2RHS B;  4FXG C;  3ULJ A;  1YEZ A;  5ELF A;  3PSI A;  4JI1 L;  2Q2I A;  2MO0 A;  3I4M H;  4J1M A;  2NWG A;  1OXS C;  1UE5 A;  3MXN A;  1JJG A;  2K14 A;  2QIL A;  3ULL A;  1JMC A;  1DXM A;  3NTH A;  5G3L D;  1AZQ A;  1S3O A;  2BA0 A;  1EZ8 A;  4YCW A;  3PMF A;  3TBI B;  4QF4 A;  1EOT A;  3K5M A;  1MSG A;  2P5Z X;  1UAP A;  4YWK A;  2VY3 A;  1OXU A;  1VDZ A;  2DJG C;  1TY2 A;  3E0J A;  1TS4 A;  4FVM A;  3GDE A;  4RGO S;  4RGN A;  3PGZ A;  2L9H A;  4F8M A;  1B8A A;  1V43 A;  2Q2T A;  4DFA A;  1N8R C;  4LF8 L;  3GTQ B;  1OTC A;  1BQQ T;  4FXD A;  2K50 A;  4DV1 Q;  1YHQ A;  2BCO A;  3BG3 A;  2N3S A;  2K5Q A;  5ELE A;  2BDN A;  3ULP A;  3BS1 A;  2N49 A;  1A8V A;  2MP1 A;  2WIN B;  3PO3 H;  2JA8 G;  3M7G A;  3K6O A;  3VYS A;  2RQX A;  2YTY A;  1A2U A;  1Q86 C;  4IJL A;  3CP0 A;  3OWE B;  4V19 0;  2X6G A;  1N33 L;  1EEI D;  4YHH L;  3PQI A;  2E2H H;  5C5M A;  2E2I B;  1ILP A;  1X55 A;  4KHP L;  1N34 L;  1KNA A;  3NQI A;  1PYB A;  4CJ2 C;  4X66 L;  2QKI C;  4N8X 1;  1G6Z A;  1PFB A;  2L12 A;  4UP9 A;  4C1N K;  4PG3 A;  1M4V A;  4KI0 A;  4DK3 C;  4PNY A;  2QEX A;  2VQE L;  1QCB D;  1YNJ C;  3KK7 A;  2Q8T A;  4BS9 A;  2JEB I;  2ES2 A;  3Q8D A;  2F52 A;  2EXZ A;  1I3Q B;  4HMI A;  4A3I H;  2RVL A;  1Q7Y C;  2OXP A;  4FDB A;  5CV8 A;  1E0B A;  1RIP A;  3J80 L;  2D9U A;  1BCP F;  4HCE A;  1PH7 A;  4R4Q A;  1JIC A;  4AIM A;  3J81 c;  3HOZ B;  2EDG A;  1QUQ B;  1B44 D;  4LF5 L;  2E5L L;  3MC0 B;  4ZAI A;  4CKE A;  4L5R C;  2EYJ A;  4GN4 B;  2L55 A;  1U4M A;  2JA6 G;  1E2Z A;  1A15 A;  3S14 B;  5L37 A;  1BKB A;  1PXU A;  1X3P A;  2Q2U A;  4XQN A;  3K58 A;  4C3J G;  2NVQ B;  3KF8 B;  2B8F A;  3NEL A;  5GAH C;  2PQE A;  1C9O A;  1NUC A;  2AUJ D;  2I46 A;  1H9R A;  2J7Z A;  1BO0 A;  3A5U A;  2MJ8 A;  1YI2 A;  3UI2 A;  2PO4 A;  4QY7 A;  1X32 A;  2Q8R E;  2F0Q A;  1KNE A;  1MSH A;  1BUV T;  3KJO A;  4C3J B;  5KYL A;  3GTQ H;  2AQ3 B;  4O0A A;  1K3R A;  2VB3 X;  5ELD A;  2SOB A;  1VQI A;  2UU9 L;  4FYD A;  1TWA B;  2GN5 A;  3EN2 A;  4LMQ D;  5DEH A;  2UUB Q;  2QCP X;  4IAL A;  1BNZ A;  3PIO A;  4RKB A;  3PCO B;  4AQY Q;  2CH4 W;  2F0V A;  2FIN B;  1KAA A;  3QJY A;  1X65 A;  3PUW A;  1X9N A;  3A54 A;  1CKM A;  1NE3 A;  3E5S A;  3U4Z A;  3J81 E;  4CDE C;  1F2Z A;  2AWN A;  2EYL A;  4IN3 A;  4MN3 A;  1ESF A;  5JOB A;  1ICW A;  4K0K L;  3LNN A;  2EOT A;  3R2T A;  3GO5 A;  5C6A A;  2FFK B;  5FLM G;  2E2I H;  4FF3 A;  2HDM A;  4DXG A;  2JA8 H;  2EYF A;  2PW7 A;  1F2M A;  4CDC C;  2XRS D;  2KHI A;  3GV3 A;  1CUK A;  4I65 A;  4ZLT F;  2EVB A;  1O7Z A;  5ELN A;  5CGK A;  1IZ6 A;  4BY7 G;  5M5W H;  2R93 G;  1XMQ L;  2HHH L;  5EJW A;  5FLX c;  4DR7 Q;  1SNQ A;  1NAP A;  4A3J B;  1PH6 A;  3WDN A;  2PQA B;  1VQ6 A;  4JI3 L;  2JQO A;  5C4Z A;  2R6G A;  4DF7 A;  4DR2 L;  3BZK A;  4K5X A;  3CCR A;  4BXX G;  1NSN S;  1C48 A;  1OO9 B;  1Q82 C;  2R92 G;  3ITP A;  4N9P A;  2VQF Q;  4BY7 B;  5IP9 G;  4DV4 L;  1VQC A;  4R4I A;  4YCU A;  1SN8 A;  1PZI D;  3I4O A;  4XQQ A;  5BN5 A;  3E9H A;  3I3C A;  4GLV B;  1H9M A;  5C0X I;  3HOZ H;  1VQB A;  2PMZ E;  2UXD L;  2IWH A;  4YIJ A;  1B50 A;  4H13 C;  2WAQ G;  2R92 B;  1RL2 A;  2B2Y A;  4GKK L;  3S14 H;  1K0R A;  4DAY B;  2MPM A;  3TSS A;  4GLX A;  4GNX B;  3ZYY X;  3HZX A;  4X3T A;  1S5E D;  1HXY D;  2PYK A;  5BN4 A;  2NVQ H;  5ELO A;  3KDF A;  4EQP A;  5D14 A;  3GP7 A;  1EY9 A;  3VYU A;  2JA6 H;  2WAQ B;  2CW0 D;  5M3F G;  3CAM A;  5KIX A;  1AEX A;  1I4Q A;  4AYB B;  2EY2 A;  2K04 A;  2LSS A;  4C3J H;  1XTD A;  4JI2 Q;  1EY8 A;  4XYQ A;  1CM9 A;  2LFN A;  2K33 A;  5A2Q E;  2IJ0 A;  5IOD A;  5EBC A;  5FLX E;  4ZCK A;  5CR3 A;  4PMB A;  4RG1 A;  2L1B A;  3Q23 A;  5IY0 A;  1X3G A;  4BA1 I;  1QE6 A;  4LFA Q;  4U68 A;  1WYD A;  1HCZ A;  1J5E Q;  2XWB B;  1Z47 A;  1JR0 D;  3ERS X;  1SYD A;  3DLL A;  1PZK D;  4LW1 A;  5EAY A;  4G4K A;  1SYC A;  4LF6 L;  1SNM A;  2F0U A;  2Z6B A;  1W6K A;  4ZUJ A;  1AW7 A;  5M3M G;  4CJ0 B;  4Q5V A;  1Z6H A;  1NJI C;  1Q1E A;  4DNT B;  2E75 C;  1XYI A;  2KED A;  2B2Y C;  2DGY A;  2F1M A;  5M9O A;  3E9I A;  2WB1 G;  1H95 A;  4AH6 A;  4QUC A;  4DR6 L;  1Z9F A;  1IBM Q;  5M3M B;  5FLM H;  2CWA A;  3W1G A;  1CFM A;  3PIP A;  1QJO A;  1S72 A;  4B3M Q;  1K83 B;  4N9T A;  2KVM A;  2WB1 B;  2O5I C;  2EIF A;  3BYT B;  4FXK C;  1VQL A;  1TS3 A;  4BY7 H;  2R93 H;  4KD3 A;  2B39 A;  1EOV A;  1EY6 A;  4BXX H;  3JAM c;  1TWG B;  4EQN A;  2NVX B;  1SMY C;  1BVS A;  4TVA B;  5HGQ A;  1SNO A;  1K8O A;  4HCS A;  2R92 H;  3PO2 G;  2K7V A;  1EQQ A;  2F0L A;  5IP9 H;  4R8N A;  1ENA A;  3FP9 A;  1HNZ L;  2ZTE A;  1P8L A;  4LF9 Q;  2OQ0 A;  1E7Z A;  1PA6 A;  3S1R B;  2CQO A;  4ZKB B;  1HJP A;  2PI2 E;  2KEE A;  3QOJ A;  3PO2 B;  3TRE A;  2V4D A;  2F3I A;  1DGS A;  4YCV A;  3EIV A;  2VUM G;  3ICE A;  2XNA C;  4GOP B;  1KLU D;  4ULL A;  2L11 A;  3GTO B;  3MEF A;  2F0M A;  4KN4 C;  1PRT C;  3D4R A;  1TWH B;  4BY1 G;  1PH3 A;  3VR3 A;  5KYI A;  1VS0 A;  1XWE A;  1ZXT A;  3TP8 A;  2ZM6 Q;  1VCI A;  1FJG L;  1B53 A;  4KD4 A;  1C8C A;  2VUM B;  1HZA A;  3NUC A;  5IWA L;  1SE8 A;  3VA7 A;  2IX3 A;  2CFM A;  5JJI A;  4P2C B;  5BN3 A;  4BY1 B;  3GTG B;  4P71 A;  1JOK A;  1PH4 A;  2XRQ D;  1EY5 A;  1NBW A;  2J0T D;  3PUV A;  3OMC A;  5CBE E;  2N78 A;  2YTV A;  4LF4 L;  4DV6 L;  5FOB B;  4DR1 L;  1XMO L;  1A6X A;  1F77 A;  2WKD A;  4PQX A;  4UHV A;  2HIV A;  1JQY D;  4Q0F A;  5IGE A;  1G6P A;  2KHS A;  3HOX B;  1EYC A;  3MFG A;  1VQ8 A;  4JPB W;  5M3M H;  3DWQ A;  4HJ7 A;  1J9O A;  4GZY C;  4P73 A;  5H1S E;  5IYB H;  5IIF A;  5IT9 L;  1K83 H;  3I4N B;  1H9S A;  3BDO A;  2PNR C;  4A76 A;  4JI0 Q;  1B7Y B;  3CC7 A;  1PHJ A;  4PMC A;  4C3I B;  2O2L D;  4JI8 Q;  3W3A A;  1GHJ A;  1VQ9 A;  4LFB Q;  5D3I B;  3NEN A;  2KCT A;  1B3A A;  1BR9 A;  1TWG H;  1STB A;  3L3O C;  2NVX H;  5FO9 B;  4A3D G;  1HR0 L;  3R2I A;  2K28 A;  4IUN A;  4JI5 L;  5I2X A;  4DNR B;  3NE5 B;  1WTR A;  1YVC A;  2H1E A;  3T4A C;  1D1I A;  1HQR D;  2MQH A;  1F9P A;  2C5C A;  3BDL A;  4J6H A;  3OTO Q;  3K80 C;  3NTI A;  4V0B A;  2I5L X;  5EQ0 A;  3U9O A;  3PO2 H;  1IBK L;  2WAQ E;  4X6A H;  4P72 A;  3QOL A;  1LAC A;  1LTG D;  1I94 L;  2JA5 G;  2A68 C;  2G5D A;  2NVT B;  1JWU D;  2L15 A;  3PIO 3;  1RHP A;  4LUO A;  3GTO H;  1HFG A;  5BR8 L;  4H02 A;  3OMG A;  3O13 A;  4DV0 L;  5T1G A;  2JA5 B;  4POG A;  1QOH A;  2VUM H;  3V2T A;  3PF4 A;  1PYW D;  3A74 A;  5C4X B;  2E76 C;  1Q90 A;  3S16 H;  3EVQ A;  1D5M C;  1W6J A;  1H9S B;  5IYD G;  1RTO A;  4H7B A;  2K5W A;  4BY1 H;  1RF2 D;  1PYS B;  4K8J A;  3GTG H;  4WOR A;  3QIA A;  3HEJ A;  2YTX A;  3W1B A;  2KCM A;  1CQV A;  1X56 A;  3G6J B;  3A0J A;  2EY5 A;  3MA2 B;  2F4I A;  3HKZ G;  4A3F G;  1SMX A;  3FPU B;  4LF8 Q;  1O78 A;  4JG2 A;  4NMZ A;  1VQA A;  2X6L A;  5IGC A;  3HOX H;  3PO3 G;  2RHQ B;  2K75 A;  3ND9 A;  2NBF A;  2EYM A;  1LYL A;  1DON A;  2ICE C;  4ODG A;  3KUP A;  5IGD A;  3HKZ B;  2YU9 B;  3HOV G;  1TWC B;  2IT1 A;  2IW3 A;  1MKH A;  1GOZ A;  2WB1 E;  4I7A A;  4C3I H;  2K05 A;  1Q81 C;  4YHH Q;  4H44 C;  5HUR A;  3HOV B;  1S4Z A;  1A63 A;  4IUR A;  1SYE A;  4KHP Q;  1N34 Q;  1IXR A;  5F2D A;  1QG7 A;  2F4V L;  4X66 Q;  1VQ7 A;  2FJ2 A;  1WTW A;  1SBB B;  2BA1 A;  3T1H L;  2PZW A;  2JE6 I;  2CHB D;  2VQE Q;  5JAV A;  4DK1 A;  5DM7 3;  3A8K E;  5HY6 A;  4B9X A;  1K9M C;  2EZV A;  4UY8 C;  3NSW A;  3S15 H;  3TQY A;  2IHE A;  3F2B A;  2QGQ A;  5I2Y A;  1XNR L;  5IYC H;  4JBK A;  1LTL A;  4NKL A;  4ID6 A;  5I9P A;  4B3S L;  4HIM A;  5J3B A;  4JI6 L;  1PLF A;  3CU7 A;  3NWS A;  4LF5 Q;  2E5L Q;  1NCV A;  1PTO C;  2JA5 H;  3DHQ A;  1VQG A;  1DM0 B;  4X62 L;  4HID A;  4B08 A;  4FF2 A;  5C4X H;  4OEL B;  3L9A X;  3MXG A;  5LMN L;  5EKL A;  3DM1 A;  4ME5 A;  4KMU C;  3J80 c;  3M3Y H;  2KOL A;  4FF1 A;  4N8F A;  5GAG C;  5C3W A;  1S5C D;  4XIG S;  1Q8K A;  1X54 A;  3KJP A;  1F9S A;  2GVB A;  1B9N A;  3Q22 A;  3BZC A;  1LT4 D;  1B9M A;  5IYD H;  3PIP 3;  2PW5 A;  3Q6S A;  4GN3 B;  1A3T A;  3H3V H;  1D5Z C;  4BBS B;  1ENF A;  2K01 A;  3DWP A;  3A56 A;  1STA A;  1HA6 A;  1DOL A;  1IYJ B;  2UU9 Q;  1M90 C;  5COY A;  2B2T C;  1EWC A;  2BE5 C;  1EIF A;  1EZ6 A;  1D8L A;  4IO9 A;  3N6R A;  2VZA A;  3AB9 A;  4A3F H;  2YU9 H;  2DY8 A;  1V8Q A;  1R4P B;  1KAW A;  2F0K A;  3PF5 A;  1CA5 A;  1KRS A;  3H09 A;  3UDF A;  1EYG A;  1G91 A;  1ONL A;  2VL6 A;  4K0K Q;  3I72 A;  4KKS A;  1QVF A;  1GO3 E;  2B2U A;  4A93 B;  3I73 A;  4OWT B;  3HOV H;  1F9R A;  4GS3 A;  1AP0 A;  1I50 B;  1V1O A;  3M9B A;  4DUZ L;  1VF7 A;  3SR1 A;  4QMG A;  1RKN A;  1UEA B;  1TII D;  4P75 A;  5CV9 A;  5KGU A;  1SLJ A;  4QIW B;  1NR4 A;  3DWA A;  4K8I A;  3LGJ A;  1VQD A;  1UWV A;  2L4N A;  3OWF A;  4IUU A;  1GHK A;  1ASY A;  3MXN B;  1I4X A;  3J81 i;  4DR5 Q;  1F9Q A;  3K5O A;  3MTS A;  2E74 C;  3R8B A;  4KV6 A;  1XMQ Q;  2HHH Q;  4JI4 L;  1A3V A;  3VYT A;  4JI3 Q;  1K3B C;  2XIW A;  4NP5 A;  3TDQ A;  4KKT A;  2K1B A;  3HOZ G;  3SE0 A;  2KCC A;  4A3G G;  3PUZ A;  4HMJ A;  4KJO A;  4TSS A;  2QDL A;  1I6V C;  2F3V A;  1KIX A;  1C4Q A;  3U50 C;  3KF6 A;  1TQO A;  4M8A A;  3KLW A;  1SSO A;  1UNS A;  4L5S A;  1PFN A;  2UXD Q;  5M5X B;  4PV1 C;  3GTP B;  4A3G B;  1Q3L A;  4H0L C;  3RUZ A;  4C3H B;  2N8N A;  5JJZ A;  4R9W A;  5IGB A;  1TY0 A;  1VQO A;  4DV7 L;  4LWC A;  4HJA A;  1YIJ A;  1MD2 D;  4G7H C;  1R9T B;  1CZW A;  1V1Q A;  2B2U C;  1LTS D;  2B2W A;  1X6O A;  2K4K A;  4JVZ A;  3S2H B;  2JEA I;  1PVO A;  3VR2 A;  3FVQ A;  2I07 B;  3L0O A;  2DN8 A;  3NBI A;  4MTN A;  1XPO A;  2B63 G;  1DD2 A;  1O7I A;  1F2L A;  3FPP A;  1SFO B;  2JSO A;  4DPG A;  4BBS H;  1CHQ D;  1C7Y A;  1QB5 D;  3GTM B;  4A3K G;  4IUT A;  1A0I A;  4RMF A;  2QA4 A;  4OO1 H;  1LTA D;  4OX9 Q;  3V96 A;  2ENB A;  2B63 B;  1JOR A;  3HKZ E;  2OTL A;  2ZT9 C;  2YYZ A;  2M2L A; 
#chains in the Genus database with same CATH homology
 1DOM A;  2PZT A;  1SMY D;  5FO7 B;  4KHZ A;  4A3K B;  2NB0 A;  2F0O A;  1I6H B;  1JB3 A;  1LLR D;  3M7N A;  3SVM A;  1DJR D;  1WTX A;  1LTB D;  1STG A;  3IKJ A;  4A3B B;  5C5L A;  4M1U B;  3S17 B;  3K7A B;  2NZ1 D;  1GUS A;  1HFN A;  2RDH A;  4XT3 B;  1DOK A;  2F0I A;  1E2V A;  1TVX A;  1U4P A;  2B2W C;  4HSP A;  2AWO A;  3DXJ C;  4LJZ C;  1H9J A;  2AUK A;  1FNV A;  4Z9C B;  3AU7 A;  3C3L A;  3RD4 A;  4HTH A;  4DN4 M;  1LTT D;  3MZ5 A;  1QNU A;  3GV6 A;  5LL6 X;  3E6Z X;  3D31 A;  5IOC A;  4OIK A;  3I91 A;  1CTM A;  1WCM B;  4KKU A;  1V1P A;  5EBD A;  5K36 G;  3NHH A;  1SE3 A;  1KTK A;  3HP3 A;  4Y7N B;  2MUY A;  1WTV A;  3D6C A;  2F0W A;  4IFD J;  1IYV A;  1Y69 U;  1SND A;  2WII B;  2F0P A;  5KND A;  1HA5 A;  1FD7 D;  2N88 A;  3BZD B;  1EYD A;  4ZQ3 A;  4RA8 A;  1EQT A;  3D4D A;  4F88 A;  2D5D A;  3OPO A;  3VR4 A;  1YNN C;  1SDF A;  4IFD H;  1RD9 D;  4HAE A;  1QNK A;  4K6L A;  1KLG D;  5NUC A;  3M4Y A;  1L0Y B;  4OGQ C;  4LK1 C;  1ET9 A;  4X3U A;  3KLS A;  3S2D B;  1DZ1 A;  2RDF A;  4RCO A;  1HPC A;  2D62 A;  2FMM A;  1ZYR C;  4K5V A;  1FNW A;  1JCK B;  2BOS A;  4FP5 D;  5EKI A;  2A68 D;  3C1E A;  4XYO A;  1EYA A;  5HGT A;  1EEF D;  5EPJ A;  4F87 A;  4CKC A;  2QF7 A;  5A2Q L;  1JWM D;  2Z4I A;  1GJX A;  1T5E A;  2WV6 D;  4DAP A;  3OHX C;  4RHR A;  1K8M A;  4A3E B;  1TS5 A;  3DUZ A;  1ENC A;  3CQZ B;  2KJX A;  2M9V A;  3K5L A;  2HUG A;  4NDX A;  3VA5 A;  2KUM A;  1A2T A;  3C2P A;  4K2L A;  1CI3 M;  4L63 B;  1OXX K;  4RHS A;  1S5D D;  4XQJ A;  2CVR A;  2G9D A;  1HUN A;  1B2T A;  3LX0 A;  3GTK B;  3QWN A;  3CKI B;  1RDP D;  2SNM A;  3I70 A;  5K36 H;  1LAB A;  3P7J A;  5C3E B;  3K0Y A;  1M8A A;  3R93 A;  1T5X D;  3HG9 A;  2RSO A;  5C4H A;  1PRT F;  1PRT B;  4TKO B;  3X3M A;  2F0D A;  1GUG A;  2E2J B;  3PV0 A;  3CHB D;  5C44 B;  1GUW A;  3NP8 A;  1EU3 A;  3JAM E;  5JVH 3;  1L0X B;  2XSC A;  2RDG A;  3OSO A;  3ERO A;  5KEE A;  4CHT B;  3EA6 A;  1Y1W B;  1EY0 A;  4C3I G;  1XTC D;  1DYQ A;  3BYY B;  3NQT A;  5I6Y A;  2IX0 A;  1TKW B;  2F03 A;  5E4X A;  2A69 C;  1U4R A;  5EPL A;  1LTI D;  1PTO D;  1HUM A;  2VNU D;  1XX8 A;  1ML0 D;  2OF1 A;  1B1Z A;  3NK9 A;  3HRZ C;  4B9W A;  1LV9 A;  1TU2 B;  4MHE A;  2CW0 C;  4X3S A;  2Q8I B;  1PDQ A;  2LMC B;  4XXE A;  3S1N B;  4KK7 A;  3FRP B;  3K5N A;  1D1K A;  2M00 A;  1AN8 A;  5E1F A;  5COR A;  2KA7 A;  1QWY A;  3GQB A;  3D3R A;  2ZXO A;  1EIH A;  4S3S A;  3SK5 A;  1WTQ A;  1LO5 D;  2D2C C;  4KN7 C;  4C2M B;  1BOS A;  3K59 A;  1Q1B A;  4QCL A;  4PMW A;  1SXT A;  3J7Y W;  5JEA J;  2EY6 A;  1SYB A;  4BBR B;  3SK8 A;  5ELC A;  1JE4 A;  5CBA E;  1TS2 A;  2JA7 B;  1FNU A;  1Z7T A;  2R7Z B;  1MBY A;  1TT2 A;  1HHV A;  3HOY B;  1JOQ A;  2L5T A;  2RA4 A;  3HOW B;  1WD0 A;  3MVV A;  2NN6 G;  2LY7 A;  3GTJ B;  3I4M B;  2LKV A;  4KJN A;  1STH A;  3MEH A;  1YNJ D;  1FGB D;  2AQ2 B;  4KTA A;  2A6H C;  2XN9 C;  1S5B D;  4FNF A;  3FKI B;  1SAP A;  3MXU A;  4X3K A;  1BF4 A;  2R61 A;  2F0J A;  4K2K A;  2RSN A;  1EIG A;  3H0G B;  5DNF A;  1ZEQ X;  2F0H A;  4R8I A;  1U4L A;  5ELB A;  5EPK A;  2AQ1 B;  2EJM A;  3TP6 A;  2EYO A;  4NW2 A;  2KEC A;  3EQL C;  1SJE D;  1MGS A;  1CK1 A;  3HS0 C;  3R3O A;  4A3M B;  4JBW A;  1GUN A;  3FDT A;  3H91 A;  3SXH A;  3F2U A;  3GTL B;  3T53 B;  1CQF A;  1GUT A;  3DEP A;  2K6A A;  4TQU S;  3SK4 A;  4ABN A;  3D6W A;  5C0X J;  5KNC A;  2PPB C;  1LT6 D;  2G9H D;  3HGB A;  1IYU A;  2KQ3 A;  3NBH A;  4EQO A;  2EY1 A;  2JYO A;  2PCF B;  3P20 A;  5JPM C;  1PTO F;  1PTO B;  3Q24 A;  3SK6 A;  1D2B A;  4A3I B;  4L6T B;  2H4O A;  2E2D C;  3WOE A;  4RGM A;  3QG1 A;  4OO1 G;  3NTK A;  2PMZ B;  4KY6 A;  3TP5 A;  2QDB A;  3CRK C;  3SDZ A;  3BVM A;  4CJ1 B;  1WTO A;  3D4W A;  2NN6 H;  1WTP A;  2X69 A;  1VF5 C;  1LT3 D;  1SNC A;  3NPP A;  2O4X A;  4ZK9 B;  1G2T A;  3LWU A;  4DU9 A;  3RZD B;  3MFY A;  2F0E A;  4HED A;  1IW7 C;  2WAC A;  2K03 A;  3FMC A;  3J80 E;  2B8G A;  3KF8 A;  3ERQ A;  3SHL A;  1ROD A;  1EQV A;  1HRJ A;  3MWY W;  2XVS A;  1Q12 A;  5JVG 3;  4LAA A;  2F0G A;  5C4J B;  1PMR A;  5FK9 C;  1YNN D;  4C3H G;  2JA8 B;  3C1F A;  1SE2 A;  3PUX A;  4BWG B;  2JP1 A;  1I4H A;  2XWJ B;  3RMH A;  1KDB A;  2EE1 A;  4BA2 I;  5D65 A;  2HDL A;  2A6E C;  1A3U A;  5M5W B;  2N55 A;  4RFB A;  1TR5 A;  2NVY B;  1PTO H;  2HCC A;  1BCP C;  2GA4 B;  1ZYR D;  4C56 C;  2RBM A;  3PUY A;  1Q8I A;  2EJF C;  1BCP B;  3QB3 A;  4DAV A;  1KDC A;  5CC4 A;  4MIU A;  2OT2 A;  3A7A B;  2DNE A;  4DK0 A;  3FEW X;  4XDX A;  3W2D A;  3TME A;  3OOC A;  1PZJ D;  4XTC S;  3L7Z C;  4IFD G;  5I9O A;  1ET6 A;  3M4O B;  4O42 A;  1RJT A;  3T13 A;  2JA6 B;  2EYH A;  5K5P A;  1STY A;  3GD7 A;  1E2W A;  2FHT A;  3HOU B;  1IHZ A;  5CV7 A;  1CA6 A;  3WOF A;  2K32 A;  4KHV A;  3KLR A;  4DAY A;  1BXT A;  2F0S A;  1PFM A;  3J7A F;  3OIP A;  4G7Z C;  3P1H A;  3X3N A;  3QO2 A;  1O7L A;  1Y1V B;  1D5X C;  4IUQ A;  4XT1 B;  1STN A;  1PRT D;  2Y0S B;  1OXV A;  4IZ8 A;  1CZG A;  3OW7 A;  3J7A V;  3G7L A;  5G3L F;  4OHJ A;  1HQM C;  5LL6 S;  3Q0A A;  3EJI A;  1F2Y A;  3J81 L;  4DA2 A;  2NTS A;  4DXF A;  2WKC A;  2NYZ D;  3KLS X;  2A73 B;  5J39 A;  5KNB A;  2R93 B;  5DAU A;  1FR3 A;  4CBV A;  1RCV D;  4QB4 A;  4FF4 A;  1DCZ A;  2L0C A;  3K57 A;  1CT1 D;  4TRD A;  2A69 D;  1NR2 A;  4ZUI A;  2CQA A;  3DEO A;  2KCN A;  2MHV A;  4OL7 A;  2NN6 I;  4ZKC B;  4I7Z C;  1HTL D;  1U9R A;  3TZD A;  1I4R A;  1KAB A;  4KY7 A;  5CV4 A;  1I4P A;  3T56 B;  3S1M B;  2R3Z A;  1MI2 A;  2F0T A;  3H6M A;  1EY4 A;  2O5J C;  4K6D A;  3TN2 A;  3DMU A;  5M3F B;  3N52 A;  1EWH A;  1BBX C;  2IX1 A;  4KY5 A;  5CMD A;  3T16 A;  2FMC A;  3A7L A;  4L8J A;  1FYC A;  3LWE A;  2SDF A;  3ONA B;  2HCI A;  1G8Z D;  1I4G A;  4EGV A;  1LTR D;  1CHP D;  1V1P B;  2SEB D;  5FLX L;  1EL0 A;  1S5F D;  1SJH D;  2ID0 A;  5D3D A;  2DNC A;  2J4X A;  1EFI D;  5CV5 A;  4IUP A;  4CGY B;  5C3X A;  1TWF B;  4ZYS A;  4O1N A;  1Y8N B;  5CYU A;  4G7O C;  5FO8 B;  2A6H D;  3C46 A;  2F0F A;  1B4O A;  2ZXP A;  1UUP A;  2VB2 X;  5TSS A;  3T51 B;  1RTN A;  1D6E C;  2NTT A;  4G57 A;  2QEJ C;  3OIQ A;  5EGT A;  1SEB D;  3MHB A;  2TMP A;  4FO2 A;  4J8Q A;  1SNP A;  5EKK A;  5IGG A;  1ESR A;  4OO1 I;  5JEA G;  3S1Q B;  2BDO A;  4C1N I;  3TP7 A;  1SYF A;  2C9O A;  3A8I E;  5IT9 E;  4IQZ A;  1Y8P B;  3VYR A;  4JK1 C;  5E3F A;  1OXT A;  4IUV A;  3VR5 A;  5I6W A;  4F7X A;  5KRU A;  1JC7 A;  4UDU C;  1WVL A;  3S16 B;  1IL8 A;  1SE4 A;  5IGF A;  3IFD A;  5I4D A;  5T1I A;  3IAY A;  4K14 A;  2EJG C;  3NWT A;  3V05 A;  3EFX D;  2ZXR A;  3RLF A;  2F0N A;  5JPN C;  3AMU A;  5J1Z A;  3JAM L;  4ZRZ A;  2SNS A;  3H94 A;  5FKA C;  1ILQ A;  3I4L A;  1STE A;  2VXW A;  5CV6 A;  1HTP A;  5E4W C;  4ILW A;  1JWS D;  1SYG A;  4RCN A;  3D8G A;  4E6I A;  2BE5 D;  2IPK D;  4OIJ A;  3KBX A;  5M5Y B;  1KDA A;  2JXM B;  3P75 A;  4QUF A;  1O80 A;  1J8I A;  3IL8 A;  1EY7 A;  5C0X G;  2IL8 A;  2Z1C A;  2K5D A;  4A3D B;  2ICI A;  1VMP A;  3VR6 A;  2NUC A;  5J22 A;  1IW7 D;  3S15 B;  2TSS A;  4U67 3;  1G2S A;  4DGZ A;  1WD1 A;  3RZO B;  2LS0 1;  1BDO A;  1O7Y A;  2B2V A;  4IFD I;  3TZU A;  4CKB A;  4RH6 A;  1VMC A;  1Y8O B;  5JEA H;  1JOO A;  3URY A;  3A8J E;  1AZP A;  1EU4 A;  3BDC A;  4WJW A;  3SEB A;  2RKS A;  4HSV A;  4RGT A;  4WRD A;  3M3Y B;  2A74 C;  2PZU A;  2EYP A;  3ND8 A;  3CRL C;  4K5W A;  3MXP A;  2A6E D;  1LT5 D;  4UAI A;  1II3 A;  3MAQ A;  3H3V C;  3BVG A;  3KBG A;  1BCP D;  3U9S A;  3M85 A;  3BVZ A;  1GXD C;  2F3W A;  2MGS A;  4RWS C;  3A55 A;  4A3F B;  2A5H A;  3NXW A;  5A35 A;  4RKL A;  1QIL A;  4HN7 A;  3PO3 B;  3IFT A;  5DM6 3;  2B2V C;  2HQE A;  1H9K A;  5LHY 1;  2WP8 J;  4HR7 B;  1X3Q A;  3I8Z A;  1GUO A;  2E2H B;  4RAU C;  2Z8L A;  2DY7 A;  2B2T A;  1G29 1;  4WFN 3;  4EVO A;  3S9W A;  3I90 A;  1IKL A;  2OEO A;  5ISR A;  2EPB A;  2Z4H A;  1R4Q B;  1ZKO A;  1XXG A;  5AFW A;  5C0X H;  1IKM A;  1AFP A;  4FXG C;  5ELF A;  4J1M A;  2NWG A;  1OXS C;  3MXN A;  2QIL A;  1DXM A;  3NTH A;  5G3L D;  1AZQ A;  2BA0 A;  1EZ8 A;  3PMF A;  3TBI B;  4QF4 A;  1EOT A;  3K5M A;  1MSG A;  1UAP A;  1OXU A;  1VDZ A;  1TY2 A;  3E0J A;  1TS4 A;  4FVM A;  4RGO S;  4RGN A;  2L9H A;  4F8M A;  1V43 A;  4DFA A;  3GTQ B;  1BQQ T;  4FXD A;  2BCO A;  3BG3 A;  2K5Q A;  5ELE A;  2BDN A;  3BS1 A;  2MP1 A;  2WIN B;  3M7G A;  3K6O A;  3VYS A;  2RQX A;  1A2U A;  3OWE B;  4V19 0;  2X6G A;  1EEI D;  5C5M A;  2E2I B;  1ILP A;  1KNA A;  3NQI A;  4CJ2 C;  2QKI C;  1G6Z A;  1PFB A;  2L12 A;  4C1N K;  1M4V A;  4KI0 A;  4PNY A;  1QCB D;  1YNJ C;  3KK7 A;  2Q8T A;  4BS9 A;  2JEB I;  2EXZ A;  1I3Q B;  4HMI A;  2RVL A;  2OXP A;  5CV8 A;  1E0B A;  3J80 L;  2D9U A;  1BCP F;  4HCE A;  1JIC A;  3HOZ B;  2EDG A;  1B44 D;  3MC0 B;  4ZAI A;  4CKE A;  2EYJ A;  2L55 A;  1U4M A;  1E2Z A;  1A15 A;  3S14 B;  1PXU A;  1X3P A;  4XQN A;  3K58 A;  4C3J G;  2NVQ B;  2B8F A;  2PQE A;  1NUC A;  2AUJ D;  2I46 A;  1H9R A;  2J7Z A;  1BO0 A;  2MJ8 A;  3UI2 A;  2PO4 A;  1X32 A;  2Q8R E;  2F0Q A;  1KNE A;  1MSH A;  1BUV T;  4C3J B;  5KYL A;  2AQ3 B;  2VB3 X;  5ELD A;  2SOB A;  4FYD A;  1TWA B;  4LMQ D;  5DEH A;  2QCP X;  4IAL A;  1BNZ A;  4RKB A;  2F0V A;  2FIN B;  1KAA A;  3QJY A;  3PUW A;  3A54 A;  3E5S A;  3J81 E;  1F2Z A;  2AWN A;  2EYL A;  4IN3 A;  4MN3 A;  1ESF A;  5JOB A;  1ICW A;  3LNN A;  2EOT A;  3R2T A;  3GO5 A;  5C6A A;  2FFK B;  4FF3 A;  2HDM A;  4DXG A;  2EYF A;  2PW7 A;  1F2M A;  2XRS D;  3GV3 A;  4I65 A;  4ZLT F;  2EVB A;  1O7Z A;  5CGK A;  5EJW A;  1SNQ A;  1NAP A;  4A3J B;  3WDN A;  5C4Z A;  2R6G A;  4DF7 A;  4K5X A;  1NSN S;  1C48 A;  1OO9 B;  3ITP A;  4N9P A;  4BY7 B;  1PZI D;  4XQQ A;  5BN5 A;  3I3C A;  5C0X I;  1H9M A;  2IWH A;  4YIJ A;  1B50 A;  4H13 C;  2R92 B;  2B2Y A;  3TSS A;  2MPM A;  3ZYY X;  3HZX A;  4X3T A;  1S5E D;  1HXY D;  2PYK A;  5BN4 A;  4EQP A;  5D14 A;  3GP7 A;  1EY9 A;  3VYU A;  2WAQ B;  2CW0 D;  5KIX A;  1AEX A;  1I4Q A;  4AYB B;  2EY2 A;  2K04 A;  1EY8 A;  4XYQ A;  1CM9 A;  2LFN A;  2K33 A;  5A2Q E;  2IJ0 A;  5IOD A;  5EBC A;  5FLX E;  5CR3 A;  4PMB A;  2L1B A;  3Q23 A;  4BA1 I;  1QE6 A;  4U68 A;  1HCZ A;  2XWB B;  1Z47 A;  1JR0 D;  1SYD A;  1PZK D;  4G4K A;  1SYC A;  1SNM A;  2F0U A;  1W6K A;  4ZUJ A;  1AW7 A;  4CJ0 B;  4Q5V A;  1Z6H A;  1Q1E A;  4DNT B;  2E75 C;  1XYI A;  2KED A;  2B2Y C;  2F1M A;  5M9O A;  4QUC A;  5M3M B;  1CFM A;  1QJO A;  1K83 B;  4N9T A;  2KVM A;  2WB1 B;  2O5I C;  3BYT B;  4FXK C;  1TS3 A;  4KD3 A;  2B39 A;  1EY6 A;  1TWG B;  4EQN A;  2NVX B;  1SMY C;  1SNO A;  1K8O A;  4HCS A;  2K7V A;  2F0L A;  4R8N A;  1ENA A;  3S1R B;  4ZKB B;  2KEE A;  3QOJ A;  3PO2 B;  2V4D A;  2XNA C;  1KLU D;  4ULL A;  2L11 A;  3GTO B;  2F0M A;  4KN4 C;  1PRT C;  3D4R A;  1TWH B;  3VR3 A;  5KYI A;  1XWE A;  1ZXT A;  3TP8 A;  1VCI A;  1B53 A;  4KD4 A;  1C8C A;  2VUM B;  3NUC A;  3VA7 A;  2IX3 A;  4P2C B;  5BN3 A;  4BY1 B;  3GTG B;  1JOK A;  2XRQ D;  1EY5 A;  2J0T D;  3PUV A;  3OMC A;  5CBE E;  5FOB B;  1A6X A;  1F77 A;  2WKD A;  4PQX A;  5IGE A;  1JQY D;  4Q0F A;  2KHS A;  3HOX B;  1EYC A;  3MFG A;  3DWQ A;  1J9O A;  4GZY C;  5IIF A;  5IT9 L;  3I4N B;  1H9S A;  3BDO A;  2PNR C;  4PMC A;  4C3I B;  2O2L D;  3W3A A;  1GHJ A;  5D3I B;  1B3A A;  1BR9 A;  1STB A;  3L3O C;  5FO9 B;  3R2I A;  2K28 A;  4IUN A;  5I2X A;  4DNR B;  3NE5 B;  1WTR A;  2H1E A;  3T4A C;  1D1I A;  1HQR D;  1F9P A;  2C5C A;  3BDL A;  4J6H A;  3NTI A;  4V0B A;  5EQ0 A;  3U9O A;  3QOL A;  1LAC A;  1LTG D;  2NVT B;  2A68 C;  1JWU D;  3PIO 3;  1RHP A;  1HFG A;  3OMG A;  3O13 A;  5T1G A;  2JA5 B;  1QOH A;  3V2T A;  1PYW D;  5C4X B;  2E76 C;  1Q90 A;  3EVQ A;  1D5M C;  1W6J A;  1H9S B;  1RTO A;  4H7B A;  2K5W A;  1RF2 D;  4K8J A;  4WOR A;  3QIA A;  3HEJ A;  1CQV A;  3G6J B;  2EY5 A;  3MA2 B;  2F4I A;  3FPU B;  1O78 A;  4NMZ A;  2X6L A;  5IGC A;  3ND9 A;  2NBF A;  2EYM A;  1DON A;  2ICE C;  4ODG A;  3KUP A;  5IGD A;  3HKZ B;  2YU9 B;  1TWC B;  2IT1 A;  2IW3 A;  1GOZ A;  2K05 A;  4H44 C;  5HUR A;  3HOV B;  1S4Z A;  4IUR A;  1SYE A;  5F2D A;  1QG7 A;  2FJ2 A;  1WTW A;  1SBB B;  2BA1 A;  2PZW A;  2JE6 I;  2CHB D;  5JAV A;  4DK1 A;  5DM7 3;  3A8K E;  4B9X A;  2EZV A;  3NSW A;  5I2Y A;  4NKL A;  4ID6 A;  5I9P A;  1PLF A;  3CU7 A;  3NWS A;  1NCV A;  1PTO C;  3DHQ A;  1DM0 B;  4B08 A;  4FF2 A;  3L9A X;  3MXG A;  5EKL A;  3DM1 A;  4ME5 A;  4KMU C;  2KOL A;  4FF1 A;  5C3W A;  1S5C D;  4XIG S;  1F9S A;  1B9N A;  3Q22 A;  1LT4 D;  1B9M A;  3PIP 3;  2PW5 A;  3Q6S A;  1A3T A;  1D5Z C;  4BBS B;  1ENF A;  2K01 A;  3DWP A;  3A56 A;  1STA A;  1HA6 A;  1DOL A;  5COY A;  2B2T C;  1EWC A;  2BE5 C;  1EZ6 A;  3N6R A;  3AB9 A;  2DY8 A;  1V8Q A;  1R4P B;  2F0K A;  1CA5 A;  3H09 A;  1G91 A;  1ONL A;  3I72 A;  4KKS A;  2B2U A;  4A93 B;  3I73 A;  1F9R A;  1AP0 A;  1I50 B;  1V1O A;  1VF7 A;  3SR1 A;  4QMG A;  1RKN A;  1UEA B;  1TII D;  5CV9 A;  5KGU A;  4QIW B;  1NR4 A;  3DWA A;  4K8I A;  2L4N A;  3OWF A;  4IUU A;  1GHK A;  1I4X A;  1F9Q A;  3K5O A;  3MTS A;  2E74 C;  3R8B A;  4KV6 A;  1A3V A;  3VYT A;  2XIW A;  4NP5 A;  3TDQ A;  4KKT A;  2K1B A;  3SE0 A;  2KCC A;  3PUZ A;  4HMJ A;  4KJO A;  4TSS A;  1I6V C;  2F3V A;  1C4Q A;  1TQO A;  4M8A A;  1SSO A;  1UNS A;  1PFN A;  5M5X B;  4PV1 C;  3GTP B;  4A3G B;  1Q3L A;  4H0L C;  3RUZ A;  4C3H B;  5JJZ A;  4R9W A;  5IGB A;  1TY0 A;  1MD2 D;  4G7H C;  1R9T B;  1CZW A;  2B2U C;  1LTS D;  2B2W A;  3S2H B;  2JEA I;  3VR2 A;  3FVQ A;  2I07 B;  2DN8 A;  3NBI A;  1DD2 A;  1F2L A;  3FPP A;  1SFO B;  2JSO A;  1CHQ D;  1QB5 D;  3GTM B;  4IUT A;  4OO1 H;  1LTA D;  3V96 A;  2ENB A;  2B63 B;  1JOR A;  2ZT9 C;  2YYZ A;  2M2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...