5JAVA

Crystal structure of staphylococcal nuclease variant delta+phs y91d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLADIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5javA00
3ERQA 4N9TA 5KYLA 1KABA 2F0WA 3BDLA 3MEHA 5CV5A 2F0SA 2F0DA 4WRDA 4KJNA 5CV8A 5E1FA 5IGFA 2ENBA 2F0HA 3H6MA 1STHA 1STNA 2EYLA 4DGZA 1JOKA 5IGEA 3EVQA 3SK4A 1NUCA 1AEXA 5J22A 2KQ3A 3MXPA 1RKNA 2EYJA 3SHLA 4J6HA 5KGUA 3TP6A 2PZWA 3SK5A 1NSNS 1TR5A 2EY1A 1EZ6A 2RDFA 5E3FA 5C5LA 1EY6A 5ISRA 3NHHA 4HTHA 5DAUA 1SYBA 2EY2A 2F0LA 2WACA 3SR1A 3C1FA 5EKKA 3SK8A 4EQPA 2OXPA 2EYHA 1II3A 2PW7A 1SYCA 5J39A 1ENCA 4QMGA 3TP5A 4K8IA 4KD3A 2EXZA 1JOOA 4KHVA 5CC4A 1SYEA 5C6AA 2F0QA 1SNPA 3BDCA 2F0KA 1F2ZA 2F0PA 5IODA 2HQEA 4EVOA 5I9OA 2OF1A 4B9WA 4HMJA 4DFAA 1STGA 1SNMA 2F0MA 5EGTA 3T16A 2F3VA 5IGGA 5C4HA 3V2TA 3PMFA 4ZUIA 4KD4A 4NDXA 3MHBA 2EY5A 4G57A 4K2KA 4ZUJA 4F8MA 2OEOA 3P75A 4KY7A 1KDCA 3D4WA 4KY6A 4K14A 5IGBA 3MZ5A 3OMGA 4TRDA 3E5SA 4K8JA 3C1EA 4K2LA 1EY8A 3ITPA 1EY4A 5KRUA 1SYGA 5KIXA 5I6WA 3HZXA 1EY0A 1A3TA 2F0EA 5CR3A 1SNCA 2F0GA 4I65A 1STYA 2M00A 4KTAA 2EYMA 5F2DA 2F0NA 1ENAA 5M9OA 2F0VA 2F0OA 3U9OA 1F2MA 1SNQA 2RKSA 2RBMA 4NP5A 4F7XA 5IGCA 2PW5A 1EY9A 4N9PA 5JAVA 4ID6A 4QF4A 1A2UA 5KEEA 3EROA 1STAA 4WORA 3TP8A 3RUZA 1A3UA 4PNYA 4PMCA 4S3SA 1U9RA 3QOLA 4RKLA 4EQOA 2F0IA 2F0UA 4IUNA 4K5VA 1TQOA 1IHZA 5C3WA 5K5PA 5C4ZA 3EJIA 2SNMA 3NUCA 3P1HA 3SXHA 2PZTA 2PZUA 3D8GA 5C3XA 5CV6A 5I9PA 5IOCA 1A3VA 1EYDA 2F0TA 2KHSA 3DMUA 3OSOA 4NKLA 1KAAA 5C5MA 5IGDA 1SNDA 3S9WA 3D6CA 4IALA 4LAAA 5J1ZA 5CV9A 3SK6A 5EKLA 2O4XA 1EYAA 4IZ8A 3TP7A 2F3WA 3VA5A 4NMZA 1F2YA 3D4DA 4OL7A 1EQVA 1EY7A 1A2TA 2EYOA 2F0JA 2SOBA 5DEHA 1JORA 2EYPA 2EYFA 3LX0A 4QB4A 2EY6A 4K5XA 1SNOA 4ME5A 1KDBA 4MIUA 4J1MA 4E6IA 5HGTA 5I6YA 1STBA 3MVVA 5NUCA 2QDBA 4YIJA 1SYDA 3OWFA 4H7BA 4KV6A 1KDAA 4KY5A 4DF7A 4ZQ3A 5JOBA 4DU9A 3R3OA 2LKVA 2PQEA 3QOJA 4R8NA 3NQTA 3NP8A 3T13A 4HMIA 1EYCA 1TT2A 4K5WA 2PYKA 4EQNA 4RKBA 2F0FA 3QB3A 5CGKA 1EZ8A 3NXWA 2SNSA 3OMCA 4B9XA 5IIFA 1JOQA 4KJOA 3TMEA 4PMBA 3DHQA 3HEJA 4K6DA 3NK9A 4ODGA 5CV4A 5HURA 1EY5A 5KYIA 1SYFA 2NUCA 5CV7A
chains in the Genus database with same CATH superfamily
1DCZA 3J80L 2F52A 1ICWA 1X32A 1IBMQ 5DM73 1G51A 4BBRH 1CTMA 5LL6S 3CC7A 4A3CH 4X3UA 1EIFA 2VQEQ 2XIWA 2WIIB 4X62Q 2LFNA 4ZYSA 5ELCA 1X9NA 1WTVA 1MIUA 3TZUA 4FF1A 4J15A 5H1SE 3SR1A 2VXWA 2A1AA 2H5XA 4ZK9B 3HOYB 2R92B 4QIWB 2IX3A 4K8IA 4IO9A 1PV4A 5JJIA 1Q8KA 2EJFC 3KYHC 5CC4A 4RHRA 4Y7NB 4KK7A 1L0XB 1IXRA 3K81C 3N6RA 4JPBW 4DNTB 5BN4A 1TS3A 3BG3A 3C3LA 1SE8A 5C4HA 3KF8B 2VB2X 5JEAH 1SLJA 2DNCA 2PI2E 4I7AA 3R8BA 1P16A 1WD0A 2OWOA 2BDNA 2VQFL 3MFGA 3NWTA 1QG7A 3PIPA 3C1EA 1IZ6A 4DK1A 1EY0A 1AW7A 4BY7G 4KTAA 4LF9L 2K75A 1ENAA 4BY7B 4P73A 2WAQE 4QF4A 4X65Q 2NZOA 4P2CB 4BA2I 1NBWA 2F4VL 3OIQA 4A3LG 1KAWA 1U9RA 1NNXA 2HCCA 3IRBA 2WB1G 2YTYA 3H3VH 3BVGA 3HOVG 1R9TB 2NTTA 3HOVB 5DLQE 2I5HA 2XWJB 1YNNC 5CV9A 2MHVA 4HJAA 3K5NA 1JB7A 1NMGA 2K28A 3LNNA 3CHBD 1PH5A 5EBCA 2L12A 1EQVA 4V0BA 1LV9A 2UU9Q 4L6TB 3J81L 1SJED 3ND9A 1G6ZA 1QUQA 1XXGA 4A3JH 3CW2C 1RDPD 3OWFA 1ASZA 1VMPA 4DU9A 3I4NH 2UUAL 3BYYB 3PO2G 4FXKC 2I07B 2MO0A 4EQNA 4A3FG 3FVQA 1I94Q 4A3DH 3QB3A 5CGKA 2H4OA 4GOPB 3CRLC 1HRJA 4K6DA 1PH6A 5HURA 3SGIA 3CQZB 2Z6KC 3M4PA 3HOUH 1PZID 3K8AA 3NBHB 4DV3L 1JJGA 2EVBA 1AEXA 3MTSA 4LF6Q 4DKAC 3M4QA 1Q3LA 3K58A 2X69A 2ZM6Q 1KD1C 3I7FA 5M3FH 1FYCA 4JV5Q 1YNXA 4R4OA 1AH9A 3CKIB 4KMUC 5CYUA 3Q23A 3KLSX 3JAME 1SYCA 1VQMA 1ENCA 4QMGA 1S5CD 3HS0C 1D1KA 3F2CA 1BCPC 3K7AH 1BCPF 1SE3A 1CKNA 2UUBL 4P74A 4YY3Q 4OO1H 3FEWX 3AFQA 2J0TD 5EGTA 2UUCL 2F3VA 5GAGC 1J6QA 1EEFD 3MXGA 4DR6Q 4KN7C 1VDZA 2ZTCA 5D3DA 3NBIA 1HQRD 1SMXA 3E5SA 4JI2L 1PH7A 1HZ9A 4FP5D 4GZYC 3CMAA 2NVXB 2B2WC 1EIGA 2N8NA 4CHTB 1NCVA 3EQLC 5F2DA 4ZKBB 2M00A 4AQYQ 3W3AA 3TRZA 3U9OA 4DV1Q 2Q8TA 2KECA 2B8GA 3GV3A 4LFAQ 4GNXB 2IWHA 1WCMB 4FF2A 2NVYH 1N32Q 4MNOA 1XNQQ 1D1IA 1WTOA 1Y8OB 2F4IA 2DJGC 3FPUB 4HJ9A 1VMCA 1MJCA 2JA7G 2HCIA 3D8GA 1A3VA 2JA7B 1O7LA 2WFWA 3FRPB 4PZ8A 4L63B 2OT2A 2AUJD 3F8TA 1EY7A 3ULPA 1I5FA 2WV6D 2EYFA 2HIVA 4LF8L 4QGUA 5I6YA 4J1MA 1KXLA 4YIJA 1TWHH 2D2CC 1D8LA 1D5MC 5M5XH 4P72A 4KKUA 1A0IA 3HOXB 3QOJA 4UY8C 2L55A 1F9QA 3CPWA 1TT2A 5IT9L 4A3GH 3K59A 5DM63 3RZOB 2XRSD 2HHHQ 3OMCA 3MAQA 2KVMA 2CCZA 1A63A 1BBUA 3HEJA 1XMOL 1I4HA 2EZVA 3EBEA 1HZBA 3KF6B 2K32A 1VF5C 2B63H 5AFWA 1UE7A 3GD7A 4B3TQ 2IW3A 4PQXA 5C44G 1E7ZA 1B9MA 4H02A 4ZCKA 4NPSA 3OTOQ 1CA5A 5M3MH 3ZYYX 2KJXA 5ISRA 1F9RA 5A2QE 1IBKL 3K7UC 4NXMQ 1HNZQ 2EYHA 4IJHA 1PTOH 1X3EA 5J39A 4QY7A 1D7QA 2E2JB 2K14A 1L1OC 2K5VA 1OXSC 4AIMA 3J7YW 1CQVA 4XT1B 3JAMc 4YCUA 4K0KQ 2JEBI 2K5WA 2BA1A 3D4RA 4ZUJA 4K2KA 1QNKA 2OTLA 3LGJA 3HKZE 1ET9A 4H0LC 1ET6A 1I4QA 4C3IH 1I4GA 4A3KH 4A93H 1G91A 2ICEC 5LMUQ 1I50H 2QCPX 5C4XH 3VR6A 1VQHA 3LWUA 1CHPD 1VQPA 1F2MA 4RG1A 4N9PA 2Y0SE 1TWAH 2JA6H 1JJ2A 2KCNA 2A6EC 1JMCA 1W6JA 2XVSA 3V05A 3QOLA 3KF6A 2VUMG 4XTCS 4JYAL 3S1QH 3QG1A 2KA7A 2VUMB 1G8ZD 1JQYD 3DMUA 4OHJA 5IGDA 3BVMA 4C3JH 5KNBA 2B2UC 4DUYQ 4LAAA 2E2IB 3TS0A 3TS2A 2ALYB 3Q24A 3PO3H 1L0YB 1IYUA 4JBWA 1G2TA 2EYPA 3H3VC 3PIO3 2VB3X 1K8OA 1G291 5M5YB 2L0CA 5IWAL 1EYCA 3S2HB 4A75A 1E22A 2JE6I 4XIGS 1HPCA 5FKAC 4RGMA 4JI1Q 4RAUC 3PF5A 2Q2TA 4OIKA 3S15B 4JI0L 3UDIA 4X66Q 1VQ8A 5JJKA 4APVA 3T1HL 3R2IA 1SYFA 2NUCA 5DNFA 2HDLA 2P5ZX 5CV5A 1LT5D 3MEHA 5BN3A 4DA2A 1DOLA 3NSWA 1K0SA 5HGQA 4FXGC 4IPDA 1PXUA 3TP6A 1RIPA 2NVTH 5JVH3 1TR5A 1H95A 4CDFC 3NHHA 3CD6A 1SEBD 3GTLB 5DAUA 2HD3A 1HTPA 4F88A 4F87A 1M4VA 1QWYA 1EOTA 1R4QB 4LWCA 4NXNL 1VQCA 2DN8A 5ELBA 1JWUD 1N33L 1HFNA 4POFA 4GKJL 1LT4D 1SYEA 1XMQL 3F1ZA 1B44D 1B7YB 1LO5D 2PI2A 2L9HA 1DGSA 3NEMA 2JA9A 4N8FA 4OX9L 1PH2A 4A3BB 4A3MH 3A7LA 5L37A 1CZWA 3P75A 3UE1A 4GN3B 1VQGA 1ZKOA 3MZ5A 3OYYA 2BH2A 1VQNA 1SYGA 4OELB 3UDGA 3FKIG 1JWSD 1ESFA 2G9HD 1VQLA 1HUNA 2DY8A 1XNRQ 2EJMA 3S16H 4A3IH 2ZJQA 4BBSH 2FMCA 5KNCA 5C3EG 1IBLQ 5LMNW 1HNXQ 3D6WA 4QL5A 3FDTA 5C3EB 4HN7A 5IP7G 2DJFC 3X3MA 1TWFB 2A19A 3P1HA 2NN6G 2A5HA 1RCVD 1KAAA 5EQ0A 2NZHA 4JI7L 3PF4A 1K8MA 3PUXA 1WTQA 5IY0A 1CFMA 2F3WA 4X3TA 2F0JA 2HT1A 4PV1C 2EY6A 2K03A 3T1YQ 1L2FA 3BS1A 1PFMA 2OCEA 1SE2A 2WB1E 4H7BA 1Y1VG 3R3OA 2E8GA 4CDCC 3MWYW 4R8NA 3NP8A 3NENA 1Y1VB 3I56A 1XX8A 4LUVA 2ZT9C 3K57A 4DAYB 4UHVA 4EGVA 1KLGD 4B9XA 1EFID 1S72A 1O78A 4PMBA 5IYCG 3ULJA 4IUTA 1EY5A 1AZQA 3TZDA 4DNIA 3BDLA 2MUYA 2F0DA 3OPOA 2M9VA 4BY1H 2PQAB 1KNAA 2NB0A 5C4JH 3PUYA 3JC66 4DPGA 4LUZA 2KCTA 2EYJA 4DR2Q 1J9OA 1O7ZA 3CPFA 2JA5H 2EY1A 1WTRA 1GHKA 4IPCA 1SN8A 4YCVA 3NTKA 1KNEA 3CC4A 4JBMA 5CBAE 1Y8PB 4P71A 1JCKB 2ZTEA 1NE3A 3NPPA 3GTPH 1DOKA 3CRKC 2A74C 1YHBA 1YZ6A 5I9OA 2F0MA 4LK1C 4K14A 2WKDA 1K3BC 1TY0A 1PTOF 5CR3A 4QCLA 3VYRA 4Y7NH 2BOSA 4IPHA 4DAYA 5COYA 2PW5A 1EY9A 2CFMA 2Z4IA 1A2UA 3A54A 3EROA 3H0GB 3S14H 4GN5A 4DV7L 4PMCA 2B3GA 1I3QB 1BCPD 4LF7Q 1SMYC 4L5RC 4DR3Q 2SNMA 1IBML 1E3PA 2NN6I 1EQTA 1HH2P 1X56A 4NKLA 4DAMA 1TS2A 5FLXL 2B2YA 4FXDA 5EPLA 4ZLTF 2JA8G 2VQEL 3DWAA 2RA4A 3G71A 4BXXH 3J7A5 4X62L 4BY7H 2I0QA 1FVIA 2XWBB 3CMEA 4IFDH 2B2TA 2K33A 1MSGA 2XRQD 4ZKCB 2L5TA 4KV6A 3R93A 4A3LH 4LW1A 3W2DA 1EOVA 2Y0SB 1VQKA 4L5SA 3VR5A 2EDGA 3RZDB 4GLXA 1TWCH 5IYDG 1R9TH 4RHSA 3ZJYC 1ONLA 2OQ0A 1IL2A 5FLMG 2GVBA 5CV7A 4HJ7A 3U50C 3GP7A 1Q46A 2RDHA 1GOZA 4IUPA 4B08A 4DK6C 2Q8RE 1GHJA 1LTSD 2E2HB 2N49A 3IKJA 3EN2A 1IKMA 2D62A 1VQIA 4RGOS 1Q1BA 2ZJRA 1MKHA 1QZGA 5C0XG 1JR0D 2X6GA 4CDDC 1QVCA 4X65L 3PO2H 5IYBG 3E0JA 4CGYB 4A3FH 1H9JA 1I6HH 1O80A 3UDFA 2PW7A 3MXNB 1VQFA 2R3ZA 3BDCA 2OTJA 1H9MA 3P7JA 2CWPA 3AU7A 4ULLA 3S17B 1S5DD 4G57A 1IW7C 1R4PB 2DUDA 4KY7A 2UU9L 2EJGC 5C0XJ 3SDZA 1FNWA 2R92G 3HOYG 2IPKD 3W5OA 3M85A 4LNQA 1T5XD 1A3TA 3S2DH 1Q90A 1PRTC 1QUQB 2EYMA 1PH3A 1PH8A 2N88A 4OONA 3HOZG 3I3CA 1PRTF 1I94L 3HOZB 4DAVA 2JYOA 1BCPB 4RKLA 3C2PA 3T56B 2KEDA 4GLAC 5CV6A 2KHIA 3D6CA 3PSIA 4LF6L 3EA6A 2RHSB 4GN4B 4KI0A 5GROA 3I8ZA 4M1UB 2X6LA 3A7AB 2ZM6L 1HR0W 1D6EC 5E4XA 1HUMA 2VY3A 4JV5L 3MXNA 2QDBA 1YHAA 4JC0A 2DNEA 2UXDQ 2PO4A 1YEZA 4RWSC 1UEBA 5HY6A 1YJWA 1BOSA 3NQTA 2PMZB 3QWNA 3QIAA 3K0XA 3GTGH 1T5EA 3S1NH 2Z6KA 4LF4Q 2A6ED 4YY3L 3GTQB 1ENFA 2BDOA 3G4SA 3RN2A 5CV4A 1GXDC 3CF5A 1CKNB 4DR6L 3RLOA 4DR5Q 2RCNA 2D0OA 2F0SA 4WRDA 4KJNA 5CV8A 4CBVA 3M9BA 1VQBA 1Q7YC 1VF7A 3EVQA 1S5BD 4L5TA 5J22A 4AQYL 3IAYA 3V96A 2JEAI 5EJWA 3SVMA 2CH4W 4DV1L 1S3OA 5IP9G 4EQ5A 5C0XI 4LFAL 1GKHA 2CVRA 1K83H 1SYBA 2EY2A 2WACA 4FNFA 4LUOA 3Q22A 1N32L 1XNQL 4LFCQ 1YBYA 2FFKB 1JOOA 3PUVA 3CCMA 4B3SL 1OO9B 1RTOA 4B9WA 2K5QA 1IL8A 1ILQA 5C44H 5CORA 1DOMA 3HOWG 3J80i 4WJ3M 2JK8A 2B2WA 4G7ZC 3HOWB 4KY6A 1FL0A 5KRUA 2QDLA 2K50A 4XQNA 1HFGA 2F0OA 1XYIA 5JJLA 2AQ3B 4L5QA 4KKTA 5JAVA 1A62A 3I72A 4OWTB 2HHHL 4BBRB 3N52A 1BQQT 1OXVA 4O0AA 5D14A 1QNUA 2N78A 2XN9C 1CM9A 4K5VA 1TQOA 1AZPA 1L1OB 3TQYA 2IT1A 1N36Q 5I9PA 1VQ4A 4B3TL 2R7DA 1U4LA 4IALA 5EKLA 3M4OB 1H9KA 1F2YA 3OTOL 5DEHA 1JORA 1GJXA 1WCMG 1GUOA 3LX0A 2MFIA 2NBFA 1KDBA 1SE4A 2BE5C 2CW0D 1X6OA 2QW7A 1SYDA 4NXML 1HNZL 1SFOH 1UUPA 1G2SA 4MHEA 4RA8A 4Y52H 2WINB 5ELOA 2VUMH 2ATWA 4CKCA 2KENA 1V1OA 5D3IB 2PYKA 1HXYD 4B3SQ 1V1PA 5GQOA 1ZYRC 3G7LA 3TMEA 3KLSA 4K0KL 4ODGA 3WOEA 3NK9A 4ZAIA 3I70A 2NYZD 1VQOA 2R7ZG 4MZ9A 1P8LA 3PCOB 2F3IA 1KABA 2R7ZB 1S5FD 4JI8Q 4KHPL 3B6YA 5LMNQ 2A6HC 3GTJH 3HOXG 5LMUL 1CZGA 2RSNA 5GADC 4X3KA 1EQQA 1NR2A 1MJEA 3S2HH 3J81i 2RDFA 3RN5A 2EPBA 3CCUA 3C1FA 2NVQH 1II3A 2E5LQ 1L1OA 1W3SA 3L7ZC 3PV0A 3TP5A 1WTXA 4KD3A 1QILA 4NB3A 4KHVA 4DR1Q 1M90C 4M8AA 2F0QA 1SRUA 2YU9B 3X3NA 1O7IA 4DUYL 4GOPC 1O7YA 4A3JB 2JN4A 3T53B 1SNMA 3E0EA 4NDXA 3I4NB 1UE5A 1Q1EA 4DV2Q 3GTLH 4MN3A 1WI5A 5IGBA 4CJ2C 3GV6A 2KCCA 4A3DB 5I6WA 3URYA 3HOUG 4JK1C 1SSOA 4JBJA 1K9MC 2IHEA 1H9RA 1TWGH 2F0VA 3HOUB 1LM0A 4L8JA 1PMRA 2R93G 1MSHA 2ID0A 3NTHA 4ME3A 4JI1L 3A8JE 2CQAA 4FYDA 2R93B 3ONAB 4X66L 4CKEA 3D3RA 4PNYA 3VYSA 3I55A 3OW7A 4EQOA 2L4NA 4ILWA 2B2UA 1TIID 1NAPA 3EJIA 5C4ZA 1QB5D 1XTCD 5A35A 1XJVA 2PZUA 2B2VA 2JXMB 1C48A 3S1MH 4KHPQ 3CU7A 3HP3A 4CDEC 5FJ8G 3A0JA 4IURA 3CCRA 1PTOD 1LTTD 1Q8IA 3FKIH 1FGUA 4R4QA 2EYOA 3VR3A 4C1NI 4TQUS 2KBNA 3A8IE 4MIUA 3KJOA 4JI3Q 3Q8DA 3CCLA 3K7AB 4IUUA 1LACA 5C3EH 4PZ7A 1A8VA 3PGZA 4IPGA 3QR8A 4FO2A 1YJ9A 2L11A 4HMIA 5IP7H 3S1RB 3GTKH 3M3YH 4CJ1B 2FXQA 1FGBD 2NN6H 2WP8J 2MNAA 4GNXC 2SNSA 2CQOA 1EFWA 1KHIA 2B2VC 5M5WB 1B9NA 2KEEA 3P20A 1DD2A 2MQHA 3GDEA 3QO2A 2SEBD 2MPMA 1Y69U 2SDFA 2UXCQ 2NVYB 2C9OA 2WAQG 3SHLA 3WOFA 4CJ0B 5JPMC 1Y1VH 1M1KC 1XNRL 2WAQB 3HGBA 1D5ZC 1IBLL 3ER0A 4J8QA 2LS01 4RGTA 1HNXL 1GUNA 3W1GA 4AYBE 5EPJA 3PUZA 4DUZQ 4OXPA 5EPKA 1TS5A 5ELNA 1VQEA 4DAPA 3NELA 2HIXA 5CMDA 3GTMH 4O2DA 2F0KA 3DUZA 5IODA 1Y14B 1HZCA 3A5ZB 4HMJA 1I4XA 1SJHD 1TWHB 2LXJA 3AMUA 3E3XA 4KKSA 1N34Q 4ZUIA 5M5XB 3DM1A 4R8IA 5JPNC 1GUTA 1YJNA 1QVFA 3EIVA 3T1YL 1KRSA 2K4KA 3M7NA 1EY8A 5ELDA 2MJ8A 4DV0Q 3FP9A 3VA7A 1X55A 4I65A 1W6KA 1RL2A 4Z9CB 5I2XA 1C0AA 5AJ3Q 3RR5A 3NE5B 1JE4A 3MEFA 3BZDB 5FO7B 4XYOA 3JAML 2O5IC 4A3BG 4MTKA 4RMFA 2A69C 2F1MA 3DLLA 4QIWE 4JI6Q 5K5PA 5C3WA 1Z9FA 4DV6Q 1FNVA 5C3XA 2JP1A 3J80E 2M2LA 1EYDA 2KHSA 3OSOA 4ABNA 1IKLA 5C5MA 5LHY1 2R6GA 2LY7A 4A76A 4C2MH 4DR4Q 1UEAB 4OWWB 1MI2A 4DR2L 1PTOB 4X64Q 1EQRA 3L3OC 1OXTA 2SOBA 1VQ6A 1NTGA 3I4MG 4K5XA 2VS1A 1RHPA 1B70B 3VR4A 3ULLA 5NUCA 3I4MB 1X65A 1PRTD 4ZQ3A 3CCSA 1D2BA 1UAPA 4TSSA 5JVG3 1LTID 3KLWA 1YI2A 2IHFA 3NWSA 4C3IG 4C56C 4QQBX 1PDQA 2C35B 2I5LX 2G9DA 3RLNA 4HR7B 4C3IB 4YWKA 4KJOA 2K05A 4A93B 1I4PA 2XTIA 2JA8H 1PYBA 1I50B 5KYIA 2ZTDA 1UWVA 3H91A 3CCEA 5KYLA 4UP9A 1S4ZA 2JA6G 4LF5Q 1FJGQ 4B3RQ 1JOKA 1U5KA 2YV5A 2JA6B 2VW9A 4DV5Q 4PG3A 3MXPA 1RKNA 1X3GA 2IX1A 5K36G 4DK3C 2PZWA 3SK5A 4JI4Q 3S1QB 2E76C 2EE1A 4C3JG 4JOIC 5IYDH 4JI5Q 4DXGA 4C3JB 3T4AC 3STBC 3PO3B 4LF7L 1GUWA 4DR3L 5C6AA 1UNSA 5T1GA 4ZRZA 1HR0Q 2Z9HA 2ZXRA 1LTAD 1HZAA 3W1BA 5IGGA 1YNND 1EWCA 1HA6A 4KD4A 1V1QA 3E9HA 5C0XH 3L2PA 5IYBH 4N8X1 2LMCB 4FF3A 4QJFA 1FD7D 1V8QA 4HIMA 5M9OA 1JB3A 3GTOB 4TKOB 5IGCA 1B8AA 1JC7A 2UXBQ 4A3EG 5A2QL 2I46A 2IL8A 2A8VA 1EEID 4A3EB 1LTRD 2TSSA 3CCQA 2NVTB 2HQLA 3NUCA 3JAMi 1F9PA 1WJJA 2AMCB 1L0WA 2R92H 3HOYH 1EYAA 4DR7Q 3EFXD 1BR9A 4P75A 3J80c 3H0GG 4B3MQ 4C3HG 1EUJA 3TDQA 3MVVA 1C9OA 4A3MG 1PRTB 4C3HB 1HQMC 3U4ZA 2D0PA 1SDFA 4A3MB 3WWVA 4JBKA 3TN2A 1D5XC 3PQIA 4V190 1K73C 1EZ8A 3NXWA 1C7YA 2B39A 2E2DC 3HKZG 4A3IG 4YWMA 4AH6A 3HKZB 4A3IB 4A4IA 2ENBA 1KQSA 2EYLA 1B53A 4HCSA 4QUFA 3SK4A 1HCZA 2Y0SG 2IJ0A 1WTHA 2XSCA 1CSQA 1TXYA 2GN5A 1BXTA 3KBGA 2EOTA 2V4DA 1PZKD 1E2VA 4POGA 3AFPA 3E6ZX 4RCOA 4HTHA 4XQQA 1Y1WG 3TBIB 5BR8Q 3HOVH 3SK8A 4KHZA 2RHQB 1K8GA 1Y1WB 1PHJA 1YIJA 1EU3A 5FK9C 4UDUC 5I2YA 5T1IA 4BA1I 1F2ZA 4DV4Q 2OF1A 2FMMA 1PYSB 3MHBA 1OTCA 4GS3A 2OEOA 4R1JA 3VR2A 1AP0A 1EWIA 3A55A 2O5JC 4IOCA 3OMGA 1BVSA 5IP9H 3D0FA 3O13A 3ITPA 2A6HD 3FMCA 5KIXA 2UXDL 4IJLA 3F2BA 3CQZH 3I4LA 2PNHA 2F0NA 4F7XA 2R7FA 2GA4B 3TREA 4EX5A 1WD1A 3M4YA 3J81c 3MA2B 2Z6BA 5KEEA 5IT9E 4R4CA 2A68C 4BY1B 4LF4L 1WYDA 5C4JB 1KTKA 1U4MA 2G5DA 2ZXPA 1GUGA 1E2ZA 2F0UA 1IHZA 4DR5L 2MGSA 2JA5B 3MFYA 1UE6A 3IL8A 4WFN3 2OQKA 4DXFA 1NJIC 1PYWD 3SK6A 4O1NA 1F2LA 1J5EQ 3GTPB 4OIJA 2J4XA 4LFCL 1JWMD 4C1NK 2V1CC 2BH8A 4JVZA 4KLKA 2NVXH 2K1BA 3F2DA 3M4OH 2GVAA 3WDNA 2AHOB 2F0WA 1V43A 4JCVE 5IGFA 1WCMH 3Q6SA 1H9SA 3H6MA 2ASBA 4GLVB 4DGZA 1PA6A 5IGEA 3S14B 3BYTB 3RLFA 1QVGA 4GKKQ 1HNWQ 4HAEA 5D65A 4Q5VA 1EZ6A 5E3FA 1EY6A 2EXDA 2JA7H 3J81j 4BXXG 5IE8A 4MTNA 2PNRC 3G48A 1LT3D 1Z6HA 4UAIA 4IFDG 2R7ZH 1N36L 5ELFA 2Z4HA 2RQXA 4U68A 2YYZA 1VQ9A 4DFAA 4LFBQ 3HOXH 4YHHQ 2A73B 2QGQA 1CI3M 1CUKA 1TWCB 3CCVA 3RZOH 2WB1B 4K8JA 1I4RA 1X3FA 3KFUA 3H94A 2F0EA 2F0GA 2QEJC 4HJ5A 2CHBD 2ZXOA 1N9WA 3BVZA 4IFDJ 3AYHB 1RF2D 2YU9H 3T51B 2QF7A 1Z7TA 4ID6A 1XPOA 3H09A 4JW0A 3TP8A 4HIOA 3I73A 5EKIA 1V1PB 1NY4A 5IT9c 3KOJA 3PO2B 2F0TA 3KF8A 4JI8L 5LMNL 1SNDA 1MD2D 4A3FB 1I6HB 4IUQA 4R4TA 5BN5A 1PZJD 2E2JH 4OL7A 3DEOA 4G7OC 4BBRG 4A3CG 2R93H 1U4PA 2VQFQ 2B8FA 1LLRD 1STBA 2Z8LA 2E5LL 5EAYA 4KY5A 4PMWA 2KCMA 4WJ4A 4LF9Q 3SE0A 1A6XA 1NMFA 4DR1L 4NW2A 2HDMA 1B4OA 1MGSA 2RVLA 3DWPA 1DJRD 1IYVA 3H15A 2A69D 2JSOA 1JOQA 2F4VQ 5G3LF 3S2DB 5FJ8H 5LL6X 3TSSA 1PVOA 4DNRB 1VQJA 4XYQA 4DV2L 3KDFB 4PZ6A 2HUGA 5E1FA 1HJPA 2LXKA 2NZ1D 5GAHC 2NWGA 3QJYA 1NUCA 5JEAG 1CKMA 5KGUA 4HIKA 4J6HA 1B3AA 3S1RH 1EL0A 3UE0A 1F77A 1TY2A 1AE2A 2B29A 5EKKA 2CWAA 1LABA 1Z47A 4EQPA 2E2IH 5M5WH 2E75C 3BDOA 1BKBA 4XDXA 2UUAQ 4GOPA 1HHVA 4IFDI 2Q8IB 1SNPA 4OWXB 2K5NA 2K04A 5M5YH 2D5DA 3LWEA 1STGA 4XT3B 3NBHA 3PMFA 5JEAJ 3V2TA 1VQ7A 1E24A 2KOLA 3CAMA 1OXUA 1GD7A 2VL6A 4JI3L 3D31A 3GTGB 3S15H 3S1NB 4DV3Q 1EY4A 3HZXA 5KNDA 3J7AF 2TMPA 3U4VA 4FDBA 1KRTA 2LSSA 2RBMA 4HIDA 1LUZA 2K52A 1U0LA 4A3JG 4IUVA 1MHWC 4O42A 1PH9A 1STAA 2ICIA 3G6EA 3I4NG 1LT6D 4DN4M 3KDFA 5JJZA 1YNJC 3STBD 1G6PA 3C46A 4IUNA 4UP7A 2MO1A 4A3DG 1BUVT 3K5OA 2UXCL 1K83B 3BZCA 3S9WA 2UUBQ 3OOCA 2UUCQ 4IZ8A 2K01A 3K5LA 3D4DA 2E74C 4E6IA 3ERSX 3E9IA 4JI2Q 3RD4A 2Z1CA 4CKBA 1SAPA 1SROA 4A3BH 1NR4A 5C44B 2F03A 1LTGD 5JOBA 4DUZL 1VQ5A 4GNXA 1KC8C 1K3RA 2MP1A 3KUPA 5M3FG 3RMHA 3DXJC 4RKBA 2F0FA 5M3FB 1BBXC 3L9AX 1FNUA 3KJPA 1N34L 5J3BA 1OXXK 1C4QA 3I4MH 2RSOA 4OGQC 2F0HA 1STHA 4OO1G 2DGYA 3I90A 1HA5A 4UPAA 4DV0L 2QKIC 2YTXA 1JE5A 3U9SA 1TWFH 5AJ3L 5C5LA 3BU2A 2QEXA 3L0OA 4LF8Q 2J7ZA 1U4RA 1K8AC 2F0LA 5TSSA 4K6LA 2OXPA 1X3PA 2FINB 5ELEA 3HRZC 4R9WA 3DWQA 4JI6L 3A74A 1LTLA 4DV6L 1SMYD 3K5MA 4R4IA 4RCNA 1E0BA 2RF4A 3VYTA 3K6OA 2AKWB 1PLFA 3DEPA 4H44C 1EIYB 3GO5A 4DR4L 1YITA 5FLXE 1XMOQ 1SFOB 1W2BA 1SBBB 1ILPA 4HSVA 5I4DA 4X64L 2EY5A 1MBYA 1XTDA 3IFDA 5K36H 3H3VI 1KDCA 1K28A 1KLUD 3D4WA 4TRDA 4UP8A 2AWOA 2BA0A 4LMQD 2Q2HA 1YHQA 1BF4A 2I5MX 1K0RA 1CQFA 4XXEA 2FHTA 1VQDA 1RTNA 3K80C 2R61A 5IYCH 3HFZB 4NP5A 1Q81C 4RH6A 3PUWA 4QUCA 3AQQA 1SR3A 1IBKQ 2AQ1B 3RUZA 3GTJB 1DZ1A 2N55A 3OHXC 4OEMB 3G6JB 3GQBA 1DXMA 4A3GG 2PZTA 4LF5L 1IYJB 4BS9A 1FJGL 4A3GB 4B3RL 2ZJPA 2NVQB 3DM3A 5J1ZA 2WKCA 4DV5L 4BWGB 1X54A 2O4XA 3GTOH 3TP7A 1TVXA 4NMZA 1A2TA 4JI4L 2B63G 4IQZA 2RDGA 1SNOA 1VQAA 4A3EH 2KHJA 4JI5L 5HGTA 2EIFA 1LTBD 2B63B 3FPPA 2Q2IA 3F2UA 2LKVA 1BNZA 5M3MG 3T13A 1QE6A 3BJUA 1HTLD 1HR0L 4ALPA 5M3MB 2A68D 1UE1A 3KLRA 1X3QA 3SEBA 4HSPA 2L15A 1IW7D 4JYAQ 1TWGB 3ERQA 4N9TA 4YWLA 1GO3E 3H0GH 3M7GA 3A56A 4C3HH 1STNA 2Q2UA 2QA4A 5GAEC 2H1EA 4OO1I 1I3QH 4JOIA 1ZEQX 2K7VA 1NSNS 3VYUA 2UXBL 1DONA 1XPRA 2CW0C 1PH4A 4A3KG 4A93G 2QILA 3PIOA 4DK0A 1JJCB 3S1MB 5C4XG 1T9HA 4A3KB 2EQSA 1J8IA 1Q82C 1Q86C 5IWAQ 1E1OA 1AE3A 1ZXTA 5FO8B 3FKIB 5C4XB 1CK1A 2AUKA 3HG9A 2PMZE 2F0PA 2N3SA 1TWAB 4JI0Q 1CSPA 1Q12A 2AQ2B 5CBEE 3T16A 4IOAA 4TVAB 4DR7L 3CCJA 3T1HQ 4F8MA 4XQJA 3RZDH 1EIHA 4B3ML 1ESRA 3GTKB 1QJOA 3UI2A 3M3YB 5FLXc 1Y1WH 3PO3G 1FR3A 3BZKA 1SNCA 2NTSA 3MC0B 1CKOA 2VNUD 3HKSA 5FLMH 1S5ED 1RODA 1SNQA 2FJ2A 1EU4A 2IX0A 5E4WC 4HCEA 4KN4C 3FHWA 4I7ZC 1M8AA 1VS0A 1A3UA 4WORA 4NXNQ 1YVCA 2E2HH 1B2TA 5E7NA 3OIPA 3J7ZC 1E1TA 1N8RC 3ICEA 1KIXA 1N33Q 4GKJQ 3SXHA 4G7HC 1XMQQ 2C5CA 1B3QA 1DM0B 1WVLA 1RJTA 2AWNA 3J81E 4OX9Q 1QCBD 1AN8A 2L1BA 2RCFA 3A8KE 5FO9B 3KBXA 1TKWB 1Y8NB 4QB4A 3GTMB 1DYQA 2K6AA 5BR8L 1WOCA 1PFSA 3S17H 1KDAA 1BO0A 4LJZC 4DF7A 4HJ8A 2PQEA 1XPUA 4X3SA 1TS4A 4JG2A 3Q0AA 1CT1D 1C8CA 2KUMA 2BCOA 4DV4L 2XNAC 1BDOA 1E2WA 3DHQA 2VZAA 2YTVA 3HOZH 1BBWA 1VCIA 2D9UA 3OWEB 3AEVA 4JI7Q 2CH4A 2KQ3A 1PTOC 3VDYA 4WJWA 4U673 1XWEA 1CHQD 3CXCA 4C2MB 2EXZA 4BBSG 4FF4A 1ASYA 1GVPA 2JQOA 2K5HA 4RFBA 4H13C 3S16B 5G3LD 3NQIA 4BBSB 3I2ZA 1ICFB 2HQEA 2PPBC 3CP0A 4EVOA 2DY7A 3OW2A 3UDXA 2PCFB 1V9PA 3IFTA 3K0YA 4G4KA 1J5EL 3AB9A 2PQAA 3R2TA 3J7AV 1QZHA 2O2LD 1F9SA 1KL9A 2BE5D 4K2LA 3MXUA 3S24A 3GTQH 1I6VC 1CA6A 1JICA 1STYA 2JA8B 1B50A 1PFBA 2RKSA 2JJQA 1PH1A 4FVMA 5FOBB 3ND8A 1ZYRD 4S3SA 3U58A 1LYLA 1WTWA 2F0IA 2IY5B 1TU2B 3TEHB 5IOCA 4Q0FA 1H9SB 4GKKL 1HNWL 3NTIA 3I91A 3VA5A 1SXTA 3PIP3 2B2YC 4AYBG 1A15A 4BY1G 4ME5A 3I4OA 4HEDA 4AYBB 5EBDA 3CC2A 3A5UA 1JT8A 1PFNA 2B2TC 4IN3A 3RNUA 2JA5G 1EWHA 3HOWH 4K5WA 2K5DA 1GM5A 1QOHA 1B1ZA 2Z0SA 1STEA 1WFQA 4RGNA 1WTPA 4X6AH 1RD9D 2XGTA 5IIFA 4DV7Q 1AFPA 2CKZB 4LFBL 1EYGA 1ML0D 1YNJD 4YCWA 4YHHL 2ES2A 3KK7A 1S40A 1GUSA
chains in the Genus database with same CATH topology
1DCZA 3J80L 1ICWA 1X32A 5DM73 1CTMA 5LL6S 4X3UA 2XIWA 2WIIB 2LFNA 4ZYSA 5ELCA 1WTVA 3TZUA 4FF1A 3SR1A 2VXWA 4ZK9B 3HOYB 2R92B 4QIWB 2IX3A 4K8IA 2EJFC 5CC4A 4RHRA 4Y7NB 4KK7A 1L0XB 3N6RA 4DNTB 5BN4A 1TS3A 3BG3A 3C3LA 5C4HA 5JEAH 2VB2X 2DNCA 3R8BA 1WD0A 2BDNA 3MFGA 3NWTA 1QG7A 3C1EA 4DK1A 1EY0A 1AW7A 4KTAA 1ENAA 4BY7B 4QF4A 4P2CB 4BA2I 3OIQA 1U9RA 2HCCA 3BVGA 1R9TB 2NTTA 3HOVB 2XWJB 1YNNC 5CV9A 2MHVA 3K5NA 2K28A 3LNNA 3CHBD 5EBCA 2L12A 1EQVA 4V0BA 1LV9A 4L6TB 3J81L 1SJED 3ND9A 1G6ZA 1XXGA 1RDPD 3OWFA 1VMPA 4DU9A 3BYYB 4FXKC 2I07B 4EQNA 3FVQA 3QB3A 5CGKA 2H4OA 3CRLC 1HRJA 4K6DA 5HURA 3CQZB 1PZID 2EVBA 1AEXA 3MTSA 1Q3LA 3K58A 2X69A 1FYCA 3CKIB 4KMUC 5CYUA 3Q23A 3KLSX 3JAME 1SYCA 1ENCA 4QMGA 1S5CD 3HS0C 1D1KA 1BCPC 1BCPF 1SE3A 4OO1H 3FEWX 2J0TD 5EGTA 2F3VA 1EEFD 3MXGA 4KN7C 1VDZA 5D3DA 3NBIA 1HQRD 3E5SA 4FP5D 4GZYC 2NVXB 2B2WC 1EIGA 4ZKBB 4CHTB 1NCVA 3EQLC 5F2DA 2M00A 3W3AA 3U9OA 2Q8TA 2KECA 2B8GA 3GV3A 2IWHA 1WCMB 4FF2A 1D1IA 1WTOA 1Y8OB 2F4IA 3FPUB 1VMCA 2HCIA 3D8GA 1A3VA 2JA7B 1O7LA 3FRPB 4L63B 2OT2A 2AUJD 1EY7A 2WV6D 2EYFA 5I6YA 4J1MA 4YIJA 2D2CC 1D5MC 4KKUA 3HOXB 3QOJA 2L55A 1F9QA 1TT2A 5IT9L 3K59A 5DM63 3RZOB 2XRSD 3OMCA 3MAQA 2KVMA 3HEJA 1I4HA 2EZVA 2K32A 1VF5C 5AFWA 3GD7A 2IW3A 4PQXA 1B9MA 1CA5A 3ZYYX 2KJXA 5ISRA 1F9RA 5A2QE 2EYHA 1PTOH 5J39A 2E2JB 1OXSC 3J7YW 1CQVA 4XT1B 2JEBI 2K5WA 2BA1A 3D4RA 4ZUJA 4K2KA 1QNKA 1ET9A 4H0LC 1ET6A 1I4QA 1I4GA 1G91A 2ICEC 2QCPX 3VR6A 3LWUA 1CHPD 1F2MA 4N9PA 2KCNA 2A6EC 1W6JA 2XVSA 3V05A 3QOLA 4XTCS 3QG1A 2KA7A 2VUMB 1G8ZD 1JQYD 3DMUA 4OHJA 5IGDA 3BVMA 5KNBA 2B2UC 4LAAA 2E2IB 3Q24A 1L0YB 1IYUA 4JBWA 1G2TA 2EYPA 3H3VC 3PIO3 2VB3X 1K8OA 1G291 5M5YB 2L0CA 1EYCA 3S2HB 2JE6I 4XIGS 1HPCA 5FKAC 4RGMA 4RAUC 3S15B 4OIKA 3R2IA 1SYFA 2NUCA 5DNFA 2HDLA 5CV5A 1LT5D 3MEHA 5BN3A 4DA2A 1DOLA 3NSWA 4FXGC 1PXUA 3TP6A 5JVH3 1TR5A 3NHHA 1SEBD 3GTLB 5DAUA 4F87A 1HTPA 4F88A 1M4VA 1QWYA 1EOTA 1R4QB 2DN8A 5ELBA 1JWUD 1HFNA 1LT4D 1SYEA 1B44D 1LO5D 2L9HA 4A3BB 3A7LA 1CZWA 3P75A 3MZ5A 1ZKOA 1SYGA 1JWSD 1ESFA 2G9HD 1HUNA 2DY8A 2EJMA 2FMCA 5KNCA 3D6WA 3FDTA 5C3EB 4HN7A 3X3MA 1TWFB 3P1HA 2NN6G 2A5HA 1RCVD 1KAAA 5EQ0A 1K8MA 3PUXA 1WTQA 1CFMA 2F3WA 4X3TA 2F0JA 4PV1C 2EY6A 2K03A 3BS1A 1PFMA 1SE2A 4H7BA 3R3OA 3MWYW 4R8NA 3NP8A 1Y1VB 1XX8A 2ZT9C 3K57A 4EGVA 1KLGD 4B9XA 1EFID 1O78A 4PMBA 4IUTA 1EY5A 1AZQA 3TZDA 3BDLA 2MUYA 2F0DA 3OPOA 2M9VA 1KNAA 2NB0A 3PUYA 2EYJA 1J9OA 1O7ZA 2EY1A 1WTRA 1GHKA 3NTKA 1KNEA 5CBAE 1Y8PB 1JCKB 3NPPA 1DOKA 3CRKC 2A74C 5I9OA 2F0MA 4LK1C 4K14A 2WKDA 1TY0A 1PTOF 5CR3A 4QCLA 3VYRA 2BOSA 4DAYA 5COYA 2PW5A 1EY9A 2Z4IA 1A2UA 3A54A 3EROA 3H0GB 4PMCA 1I3QB 1BCPD 1SMYC 2SNMA 2NN6I 1EQTA 4NKLA 1TS2A 5FLXL 2B2YA 4FXDA 5EPLA 4ZLTF 3DWAA 2RA4A 2XWBB 4IFDH 2B2TA 2K33A 1MSGA 2XRQD 4ZKCB 2L5TA 4KV6A 3R93A 3W2DA 2Y0SB 3VR5A 2EDGA 3RZDB 4RHSA 1ONLA 5CV7A 3GP7A 2RDHA 1GOZA 4IUPA 4B08A 2Q8RE 1GHJA 1LTSD 2E2HB 3IKJA 1IKMA 2D62A 4RGOS 1Q1BA 5C0XG 1JR0D 2X6GA 3E0JA 4CGYB 1H9JA 1O80A 2PW7A 2R3ZA 3BDCA 1H9MA 3P7JA 3AU7A 4ULLA 3S17B 1S5DD 4G57A 1IW7C 1R4PB 4KY7A 2EJGC 5C0XJ 3SDZA 1FNWA 2IPKD 3M85A 1T5XD 1A3TA 1Q90A 1PRTC 2EYMA 2N88A 3I3CA 1PRTF 3HOZB 4DAVA 2JYOA 1BCPB 4RKLA 3C2PA 3T56B 2KEDA 5CV6A 3D6CA 3EA6A 4KI0A 3I8ZA 4M1UB 2X6LA 3A7AB 1D6EC 5E4XA 1HUMA 3MXNA 2QDBA 2DNEA 2PO4A 4RWSC 1BOSA 3NQTA 2PMZB 3QWNA 3QIAA 1T5EA 2A6ED 3GTQB 1ENFA 2BDOA 5CV4A 1GXDC 2F0SA 4WRDA 4KJNA 5CV8A 4CBVA 1VF7A 3EVQA 1S5BD 5J22A 3IAYA 3V96A 2JEAI 5EJWA 3SVMA 5C0XI 4FNFA 2CVRA 1SYBA 2EY2A 2WACA 3Q22A 2FFKB 1JOOA 3PUVA 1OO9B 1RTOA 4B9WA 2K5QA 1IL8A 1ILQA 5CORA 1DOMA 2B2WA 4G7ZC 3HOWB 4KY6A 5KRUA 4XQNA 1HFGA 2F0OA 1XYIA 2AQ3B 5JAVA 4KKTA 3I72A 4BBRB 3N52A 1BQQT 1OXVA 5D14A 1QNUA 2XN9C 1CM9A 4K5VA 1TQOA 1AZPA 2IT1A 5I9PA 1U4LA 4IALA 5EKLA 3M4OB 1H9KA 1F2YA 5DEHA 1JORA 1GJXA 1GUOA 3LX0A 2NBFA 1KDBA 1SE4A 2BE5C 2CW0D 1SYDA 1UUPA 1G2SA 4MHEA 4RA8A 2WINB 4CKCA 1V1OA 5D3IB 2PYKA 1HXYD 1V1PA 1ZYRC 3G7LA 3TMEA 3KLSA 4ODGA 3WOEA 3NK9A 4ZAIA 3I70A 2NYZD 1KABA 2R7ZB 1S5FD 2A6HC 1CZGA 2RSNA 4X3KA 1NR2A 2RDFA 2EPBA 3C1FA 1II3A 3L7ZC 3PV0A 3TP5A 1WTXA 4KD3A 1QILA 4KHVA 4M8AA 2F0QA 2YU9B 3X3NA 4A3JB 1O7YA 3T53B 1SNMA 4NDXA 3I4NB 1Q1EA 4MN3A 5IGBA 4CJ2C 3GV6A 2KCCA 4A3DB 5I6WA 3URYA 4JK1C 1SSOA 1H9RA 2F0VA 3HOUB 4L8JA 1PMRA 1MSHA 2ID0A 3NTHA 3A8JE 2CQAA 4FYDA 2R93B 3ONAB 4CKEA 3D3RA 4PNYA 3VYSA 3OW7A 4EQOA 2L4NA 4ILWA 2B2UA 1TIID 1NAPA 3EJIA 5C4ZA 1QB5D 1XTCD 5A35A 2PZUA 2B2VA 2JXMB 1C48A 3CU7A 3HP3A 4IURA 1PTOD 1LTTD 1Q8IA 4C1NI 2EYOA 3VR3A 4TQUS 3A8IE 4MIUA 3K7AB 4IUUA 1LACA 4FO2A 2L11A 4HMIA 3S1RB 4CJ1B 2NN6H 1FGBD 2WP8J 2SNSA 2B2VC 5M5WB 1B9NA 2KEEA 3P20A 1DD2A 3QO2A 2SEBD 2MPMA 1Y69U 2SDFA 2NVYB 2C9OA 3SHLA 3WOFA 4CJ0B 5JPMC 2WAQB 3HGBA 1D5ZC 4J8QA 2LS01 4RGTA 1GUNA 5EPJA 3PUZA 5EPKA 1TS5A 4DAPA 5CMDA 2F0KA 3DUZA 5IODA 4HMJA 1I4XA 1SJHD 1TWHB 3AMUA 4KKSA 4ZUIA 5M5XB 3DM1A 4R8IA 5JPNC 1GUTA 3M7NA 1EY8A 5ELDA 2MJ8A 3VA7A 4I65A 1W6KA 4Z9CB 5I2XA 3NE5B 1JE4A 3BZDB 5FO7B 4XYOA 3JAML 2O5IC 2A69C 2F1MA 5K5PA 5C3WA 1FNVA 5C3XA 2JP1A 3J80E 2M2LA 1EYDA 2KHSA 3OSOA 4ABNA 1IKLA 5C5MA 5LHY1 2R6GA 2LY7A 1UEAB 1MI2A 1PTOB 3L3OC 1OXTA 2SOBA 4K5XA 1RHPA 3VR4A 5NUCA 3I4MB 1PRTD 4ZQ3A 1D2BA 1UAPA 4TSSA 5JVG3 1LTID 3NWSA 4C3IG 4C56C 1PDQA 2G9DA 4HR7B 4C3IB 4KJOA 2K05A 4A93B 1I4PA 1I50B 5KYIA 3H91A 5KYLA 1S4ZA 1JOKA 2JA6B 2IX1A 3MXPA 1RKNA 5K36G 2PZWA 3SK5A 3S1QB 2E76C 2EE1A 4C3JG 4DXGA 4C3JB 3T4AC 3PO3B 1GUWA 5C6AA 1UNSA 5T1GA 4ZRZA 2ZXRA 1LTAD 5IGGA 1YNND 1EWCA 1HA6A 4KD4A 5C0XH 2LMCB 4FF3A 1FD7D 1V8QA 5M9OA 1JB3A 3GTOB 4TKOB 5IGCA 1JC7A 5A2QL 2I46A 2IL8A 1EEID 4A3EB 1LTRD 2TSSA 2NVTB 3NUCA 1F9PA 1EYAA 3EFXD 1BR9A 4C3HG 3TDQA 3MVVA 1PRTB 4C3HB 1HQMC 1SDFA 4A3MB 3TN2A 1D5XC 4V190 1EZ8A 3NXWA 2B39A 2E2DC 3HKZB 4A3IB 2ENBA 2EYLA 1B53A 4HCSA 4QUFA 3SK4A 1HCZA 2IJ0A 2XSCA 1BXTA 3KBGA 2EOTA 2V4DA 1PZKD 1E2VA 3E6ZX 4RCOA 4HTHA 4XQQA 3TBIB 3SK8A 4KHZA 1Y1WB 1EU3A 5FK9C 4UDUC 5I2YA 5T1IA 4BA1I 1F2ZA 2OF1A 2FMMA 3MHBA 2OEOA 3VR2A 1AP0A 3A55A 2O5JC 3OMGA 3O13A 3ITPA 2A6HD 3FMCA 5KIXA 3I4LA 2F0NA 4F7XA 2GA4B 1WD1A 3M4YA 3MA2B 5KEEA 5IT9E 2A68C 4BY1B 5C4JB 1KTKA 1U4MA 2ZXPA 1GUGA 1E2ZA 2F0UA 1IHZA 2MGSA 2JA5B 3MFYA 3IL8A 4WFN3 4DXFA 1PYWD 3SK6A 4O1NA 1F2LA 3GTPB 4OIJA 2J4XA 1JWMD 4C1NK 2K1BA 3WDNA 2F0WA 1V43A 5IGFA 3Q6SA 1H9SA 3H6MA 4DGZA 3S14B 5IGEA 3BYTB 3RLFA 4HAEA 5D65A 4Q5VA 1EZ6A 5E3FA 1EY6A 2PNRC 1LT3D 1Z6HA 4UAIA 4IFDG 5ELFA 2Z4HA 2RQXA 4U68A 2YYZA 4DFAA 2A73B 1CI3M 1TWCB 2WB1B 4K8JA 1I4RA 3H94A 2F0EA 2F0GA 2QEJC 2CHBD 2ZXOA 3BVZA 4IFDJ 1RF2D 3T51B 2QF7A 1Z7TA 4ID6A 3H09A 3TP8A 3I73A 5EKIA 1V1PB 3PO2B 2F0TA 3KF8A 1SNDA 1MD2D 4A3FB 1I6HB 4IUQA 5BN5A 1PZJD 4OL7A 3DEOA 4G7OC 1U4PA 2B8FA 1LLRD 1STBA 2Z8LA 4KY5A 4PMWA 3SE0A 1A6XA 4NW2A 2HDMA 1B4OA 1MGSA 2RVLA 3DWPA 1DJRD 1IYVA 2A69D 2JSOA 1JOQA 5G3LF 3S2DB 5LL6X 3TSSA 4DNRB 4XYQA 2HUGA 5E1FA 2NZ1D 2NWGA 3QJYA 1NUCA 5JEAG 5KGUA 4J6HA 1B3AA 1EL0A 1F77A 1TY2A 5EKKA 1LABA 1Z47A 4EQPA 2E75C 3BDOA 4XDXA 1HHVA 4IFDI 2Q8IB 1SNPA 2K04A 2D5DA 3LWEA 1STGA 4XT3B 3NBHA 3PMFA 5JEAJ 3V2TA 2KOLA 1OXUA 3GTGB 3D31A 3S1NB 1EY4A 3HZXA 5KNDA 3J7AF 2TMPA 2RBMA 4IUVA 4O42A 1STAA 2ICIA 1LT6D 4DN4M 5JJZA 1YNJC 3C46A 4IUNA 1BUVT 3K5OA 1K83B 3S9WA 3OOCA 4IZ8A 2K01A 3K5LA 3D4DA 2E74C 4E6IA 3RD4A 2Z1CA 4CKBA 1SAPA 1NR4A 5C44B 2F03A 1LTGD 5JOBA 2MP1A 3KUPA 3RMHA 3DXJC 4RKBA 2F0FA 5M3FB 1BBXC 3L9AX 1FNUA 1OXXK 1C4QA 2RSOA 4OGQC 2F0HA 1STHA 4OO1G 3I90A 1HA5A 2QKIC 3U9SA 5C5LA 2J7ZA 1U4RA 2F0LA 5TSSA 4K6LA 2OXPA 1X3PA 2FINB 5ELEA 3HRZC 4R9WA 3DWQA 1SMYD 3K5MA 4RCNA 1E0BA 3VYTA 3K6OA 1PLFA 3DEPA 4H44C 3GO5A 5FLXE 1SFOB 1ILPA 1SBBB 4HSVA 5I4DA 2EY5A 1MBYA 3IFDA 5K36H 1KDCA 1KLUD 3D4WA 4TRDA 2AWOA 2BA0A 4LMQD 1BF4A 1CQFA 4XXEA 2FHTA 1RTNA 2R61A 4NP5A 4RH6A 3PUWA 4QUCA 2AQ1B 3RUZA 3GTJB 1DZ1A 2N55A 3OHXC 3G6JB 3GQBA 1DXMA 2PZTA 4BS9A 4A3GB 2NVQB 5J1ZA 2WKCA 4BWGB 2O4XA 3TP7A 1TVXA 4NMZA 1A2TA 4IQZA 2RDGA 1SNOA 5HGTA 2B63B 1LTBD 3FPPA 3F2UA 2LKVA 1BNZA 3T13A 1QE6A 1HTLD 5M3MB 2A68D 3KLRA 1X3QA 3SEBA 4HSPA 1IW7D 1TWGB 3ERQA 4N9TA 3M7GA 3A56A 1STNA 4OO1I 2H1EA 1ZEQX 2K7VA 1NSNS 3VYUA 1DONA 2CW0C 2QILA 4DK0A 3S1MB 4A3KB 1J8IA 1ZXTA 5FO8B 5C4XB 3FKIB 1CK1A 2AUKA 3HG9A 2F0PA 1TWAB 1Q12A 2AQ2B 5CBEE 3T16A 4F8MA 4XQJA 1EIHA 1ESRA 3GTKB 1QJOA 3UI2A 3M3YB 1FR3A 1SNCA 2NTSA 3MC0B 2VNUD 1S5ED 1RODA 1SNQA 2FJ2A 1EU4A 2IX0A 5E4WC 4HCEA 4WORA 4KN4C 4I7ZC 1M8AA 1A3UA 1B2TA 3OIPA 3SXHA 4G7HC 2C5CA 1WVLA 1DM0B 1RJTA 2AWNA 3J81E 1QCBD 1AN8A 2L1BA 3A8KE 5FO9B 3KBXA 1TKWB 1Y8NB 4QB4A 3GTMB 1DYQA 2K6AA 1KDAA 1BO0A 4LJZC 4DF7A 2PQEA 4X3SA 1TS4A 3Q0AA 1CT1D 1C8CA 2KUMA 2BCOA 2XNAC 1BDOA 1E2WA 3DHQA 1VCIA 2D9UA 3OWEB 2KQ3A 1PTOC 4WJWA 4U673 1XWEA 1CHQD 4C2MB 2EXZA 4FF4A 4RFBA 4H13C 3S16B 5G3LD 3NQIA 4BBSB 2HQEA 2PPBC 4EVOA 2DY7A 2PCFB 3IFTA 3K0YA 4G4KA 3AB9A 3R2TA 3J7AV 2O2LD 1F9SA 2BE5D 4K2LA 3MXUA 1I6VC 1CA6A 1JICA 1STYA 2JA8B 1B50A 1PFBA 2RKSA 4FVMA 5FOBB 3ND8A 1ZYRD 4S3SA 1WTWA 2F0IA 1TU2B 5IOCA 4Q0FA 1H9SB 3VA5A 3I91A 3NTIA 1SXTA 3PIP3 2B2YC 1A15A 4ME5A 4HEDA 4AYBB 5EBDA 1PFNA 2B2TC 4IN3A 1EWHA 4K5WA 2K5DA 1QOHA 1B1ZA 1STEA 4RGNA 1WTPA 1RD9D 5IIFA 1AFPA 1ML0D 1YNJD 3KK7A 1GUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERQ A;  4N9T A;  5KYL A;  1KAB A;  2F0W A;  3BDL A;  3MEH A;  5CV5 A;  2F0S A;  2F0D A;  4WRD A;  4KJN A;  5CV8 A;  5E1F A;  5IGF A;  2ENB A;  2F0H A;  3H6M A;  1STH A;  1STN A;  2EYL A;  4DGZ A;  1JOK A;  5IGE A;  3EVQ A;  3SK4 A;  1NUC A;  1AEX A;  5J22 A;  2KQ3 A;  3MXP A;  1RKN A;  2EYJ A;  3SHL A;  4J6H A;  5KGU A;  3TP6 A;  2PZW A;  3SK5 A;  1NSN S;  1TR5 A;  2EY1 A;  1EZ6 A;  2RDF A;  5E3F A;  5C5L A;  1EY6 A;  5ISR A;  3NHH A;  4HTH A;  5DAU A;  1SYB A;  2EY2 A;  2F0L A;  2WAC A;  3SR1 A;  3C1F A;  5EKK A;  3SK8 A;  4EQP A;  2OXP A;  2EYH A;  1II3 A;  2PW7 A;  1SYC A;  5J39 A;  1ENC A;  4QMG A;  3TP5 A;  4K8I A;  4KD3 A;  2EXZ A;  1JOO A;  4KHV A;  5CC4 A;  1SYE A;  5C6A A;  2F0Q A;  1SNP A;  3BDC A;  2F0K A;  1F2Z A;  2F0P A;  5IOD A;  2HQE A;  4EVO A;  5I9O A;  2OF1 A;  4B9W A;  4HMJ A;  4DFA A;  1STG A;  1SNM A;  2F0M A;  5EGT A;  3T16 A;  2F3V A;  5IGG A;  5C4H A;  3V2T A;  3PMF A;  4ZUI A;  4KD4 A;  4NDX A;  3MHB A;  2EY5 A;  4G57 A;  4K2K A;  4ZUJ A;  4F8M A;  2OEO A;  3P75 A;  4KY7 A;  1KDC A;  3D4W A;  4KY6 A;  4K14 A;  5IGB A;  3MZ5 A;  3OMG A;  4TRD A;  3E5S A;  4K8J A;  3C1E A;  4K2L A;  1EY8 A;  3ITP A;  1EY4 A;  5KRU A;  1SYG A;  5KIX A;  5I6W A;  3HZX A;  1EY0 A;  1A3T A;  2F0E A;  5CR3 A;  1SNC A;  2F0G A;  4I65 A;  1STY A;  2M00 A;  4KTA A;  2EYM A;  5F2D A;  2F0N A;  1ENA A;  5M9O A;  2F0V A;  2F0O A;  3U9O A;  1F2M A;  1SNQ A;  2RKS A;  2RBM A;  4NP5 A;  4F7X A;  5IGC A;  2PW5 A;  1EY9 A;  4N9P A;  5JAV A;  4ID6 A;  4QF4 A;  1A2U A;  5KEE A;  3ERO A;  1STA A;  4WOR A;  3TP8 A;  3RUZ A;  1A3U A;  4PNY A;  4PMC A;  4S3S A;  1U9R A;  3QOL A;  4RKL A;  4EQO A;  2F0I A;  2F0U A;  4IUN A;  4K5V A;  1TQO A;  1IHZ A;  5C3W A;  5K5P A;  5C4Z A;  3EJI A;  2SNM A;  3NUC A;  3P1H A;  3SXH A;  2PZT A;  2PZU A;  3D8G A;  5C3X A;  5CV6 A;  5I9P A;  5IOC A;  1A3V A;  1EYD A;  2F0T A;  2KHS A;  3DMU A;  3OSO A;  4NKL A;  1KAA A;  5C5M A;  5IGD A;  1SND A;  3S9W A;  3D6C A;  4IAL A;  4LAA A;  5J1Z A;  5CV9 A;  3SK6 A;  5EKL A;  2O4X A;  1EYA A;  4IZ8 A;  3TP7 A;  2F3W A;  3VA5 A;  4NMZ A;  1F2Y A;  3D4D A;  4OL7 A;  1EQV A;  1EY7 A;  1A2T A;  2EYO A;  2F0J A;  2SOB A;  5DEH A;  1JOR A;  2EYP A;  2EYF A;  3LX0 A;  4QB4 A;  2EY6 A;  4K5X A;  1SNO A;  4ME5 A;  1KDB A;  4MIU A;  4J1M A;  4E6I A;  5HGT A;  5I6Y A;  1STB A;  3MVV A;  5NUC A;  2QDB A;  4YIJ A;  1SYD A;  3OWF A;  4H7B A;  4KV6 A;  1KDA A;  4KY5 A;  4DF7 A;  4ZQ3 A;  5JOB A;  4DU9 A;  3R3O A;  2LKV A;  2PQE A;  3QOJ A;  4R8N A;  3NQT A;  3NP8 A;  3T13 A;  4HMI A;  1EYC A;  1TT2 A;  4K5W A;  2PYK A;  4EQN A;  4RKB A;  2F0F A;  3QB3 A;  5CGK A;  1EZ8 A;  3NXW A;  2SNS A;  3OMC A;  4B9X A;  5IIF A;  1JOQ A;  4KJO A;  3TME A;  4PMB A;  3DHQ A;  3HEJ A;  4K6D A;  3NK9 A;  4ODG A;  5CV4 A;  5HUR A;  1EY5 A;  5KYI A;  1SYF A;  2NUC A;  5CV7 A; 
#chains in the Genus database with same CATH topology
 1DCZ A;  3J80 L;  2F52 A;  1ICW A;  1X32 A;  1IBM Q;  5DM7 3;  1G51 A;  4BBR H;  1CTM A;  5LL6 S;  3CC7 A;  4A3C H;  4X3U A;  1EIF A;  2VQE Q;  2XIW A;  2WII B;  4X62 Q;  2LFN A;  4ZYS A;  5ELC A;  1X9N A;  1WTV A;  1MIU A;  3TZU A;  4FF1 A;  4J15 A;  5H1S E;  3SR1 A;  2VXW A;  2A1A A;  2H5X A;  4ZK9 B;  3HOY B;  2R92 B;  4QIW B;  2IX3 A;  4K8I A;  4IO9 A;  1PV4 A;  5JJI A;  1Q8K A;  2EJF C;  3KYH C;  5CC4 A;  4RHR A;  4Y7N B;  4KK7 A;  1L0X B;  1IXR A;  3K81 C;  3N6R A;  4JPB W;  4DNT B;  5BN4 A;  1TS3 A;  3BG3 A;  3C3L A;  1SE8 A;  5C4H A;  3KF8 B;  2VB2 X;  5JEA H;  1SLJ A;  2DNC A;  2PI2 E;  4I7A A;  3R8B A;  1P16 A;  1WD0 A;  2OWO A;  2BDN A;  2VQF L;  3MFG A;  3NWT A;  1QG7 A;  3PIP A;  3C1E A;  1IZ6 A;  4DK1 A;  1EY0 A;  1AW7 A;  4BY7 G;  4KTA A;  4LF9 L;  2K75 A;  1ENA A;  4BY7 B;  4P73 A;  2WAQ E;  4QF4 A;  4X65 Q;  2NZO A;  4P2C B;  4BA2 I;  1NBW A;  2F4V L;  3OIQ A;  4A3L G;  1KAW A;  1U9R A;  1NNX A;  2HCC A;  3IRB A;  2WB1 G;  2YTY A;  3H3V H;  3BVG A;  3HOV G;  1R9T B;  2NTT A;  3HOV B;  5DLQ E;  2I5H A;  2XWJ B;  1YNN C;  5CV9 A;  2MHV A;  4HJA A;  3K5N A;  1JB7 A;  1NMG A;  2K28 A;  3LNN A;  3CHB D;  1PH5 A;  5EBC A;  2L12 A;  1EQV A;  4V0B A;  1LV9 A;  2UU9 Q;  4L6T B;  3J81 L;  1SJE D;  3ND9 A;  1G6Z A;  1QUQ A;  1XXG A;  4A3J H;  3CW2 C;  1RDP D;  3OWF A;  1ASZ A;  1VMP A;  4DU9 A;  3I4N H;  2UUA L;  3BYY B;  3PO2 G;  4FXK C;  2I07 B;  2MO0 A;  4EQN A;  4A3F G;  3FVQ A;  1I94 Q;  4A3D H;  3QB3 A;  5CGK A;  2H4O A;  4GOP B;  3CRL C;  1HRJ A;  4K6D A;  1PH6 A;  5HUR A;  3SGI A;  3CQZ B;  2Z6K C;  3M4P A;  3HOU H;  1PZI D;  3K8A A;  3NBH B;  4DV3 L;  1JJG A;  2EVB A;  1AEX A;  3MTS A;  4LF6 Q;  4DKA C;  3M4Q A;  1Q3L A;  3K58 A;  2X69 A;  2ZM6 Q;  1KD1 C;  3I7F A;  5M3F H;  1FYC A;  4JV5 Q;  1YNX A;  4R4O A;  1AH9 A;  3CKI B;  4KMU C;  5CYU A;  3Q23 A;  3KLS X;  3JAM E;  1SYC A;  1VQM A;  1ENC A;  4QMG A;  1S5C D;  3HS0 C;  1D1K A;  3F2C A;  1BCP C;  3K7A H;  1BCP F;  1SE3 A;  1CKN A;  2UUB L;  4P74 A;  4YY3 Q;  4OO1 H;  3FEW X;  3AFQ A;  2J0T D;  5EGT A;  2UUC L;  2F3V A;  5GAG C;  1J6Q A;  1EEF D;  3MXG A;  4DR6 Q;  4KN7 C;  1VDZ A;  2ZTC A;  5D3D A;  3NBI A;  1HQR D;  1SMX A;  3E5S A;  4JI2 L;  1PH7 A;  1HZ9 A;  4FP5 D;  4GZY C;  3CMA A;  2NVX B;  2B2W C;  1EIG A;  2N8N A;  4CHT B;  1NCV A;  3EQL C;  5F2D A;  4ZKB B;  2M00 A;  4AQY Q;  3W3A A;  3TRZ A;  3U9O A;  4DV1 Q;  2Q8T A;  2KEC A;  2B8G A;  3GV3 A;  4LFA Q;  4GNX B;  2IWH A;  1WCM B;  4FF2 A;  2NVY H;  1N32 Q;  4MNO A;  1XNQ Q;  1D1I A;  1WTO A;  1Y8O B;  2F4I A;  2DJG C;  3FPU B;  4HJ9 A;  1VMC A;  1MJC A;  2JA7 G;  2HCI A;  3D8G A;  1A3V A;  2JA7 B;  1O7L A;  2WFW A;  3FRP B;  4PZ8 A;  4L63 B;  2OT2 A;  2AUJ D;  3F8T A;  1EY7 A;  3ULP A;  1I5F A;  2WV6 D;  2EYF A;  2HIV A;  4LF8 L;  4QGU A;  5I6Y A;  4J1M A;  1KXL A;  4YIJ A;  1TWH H;  2D2C C;  1D8L A;  1D5M C;  5M5X H;  4P72 A;  4KKU A;  1A0I A;  3HOX B;  3QOJ A;  4UY8 C;  2L55 A;  1F9Q A;  3CPW A;  1TT2 A;  5IT9 L;  4A3G H;  3K59 A;  5DM6 3;  3RZO B;  2XRS D;  2HHH Q;  3OMC A;  3MAQ A;  2KVM A;  2CCZ A;  1A63 A;  1BBU A;  3HEJ A;  1XMO L;  1I4H A;  2EZV A;  3EBE A;  1HZB A;  3KF6 B;  2K32 A;  1VF5 C;  2B63 H;  5AFW A;  1UE7 A;  3GD7 A;  4B3T Q;  2IW3 A;  4PQX A;  5C44 G;  1E7Z A;  1B9M A;  4H02 A;  4ZCK A;  4NPS A;  3OTO Q;  1CA5 A;  5M3M H;  3ZYY X;  2KJX A;  5ISR A;  1F9R A;  5A2Q E;  1IBK L;  3K7U C;  4NXM Q;  1HNZ Q;  2EYH A;  4IJH A;  1PTO H;  1X3E A;  5J39 A;  4QY7 A;  1D7Q A;  2E2J B;  2K14 A;  1L1O C;  2K5V A;  1OXS C;  4AIM A;  3J7Y W;  1CQV A;  4XT1 B;  3JAM c;  4YCU A;  4K0K Q;  2JEB I;  2K5W A;  2BA1 A;  3D4R A;  4ZUJ A;  4K2K A;  1QNK A;  2OTL A;  3LGJ A;  3HKZ E;  1ET9 A;  4H0L C;  1ET6 A;  1I4Q A;  4C3I H;  1I4G A;  4A3K H;  4A93 H;  1G91 A;  2ICE C;  5LMU Q;  1I50 H;  2QCP X;  5C4X H;  3VR6 A;  1VQH A;  3LWU A;  1CHP D;  1VQP A;  1F2M A;  4RG1 A;  4N9P A;  2Y0S E;  1TWA H;  2JA6 H;  1JJ2 A;  2KCN A;  2A6E C;  1JMC A;  1W6J A;  2XVS A;  3V05 A;  3QOL A;  3KF6 A;  2VUM G;  4XTC S;  4JYA L;  3S1Q H;  3QG1 A;  2KA7 A;  2VUM B;  1G8Z D;  1JQY D;  3DMU A;  4OHJ A;  5IGD A;  3BVM A;  4C3J H;  5KNB A;  2B2U C;  4DUY Q;  4LAA A;  2E2I B;  3TS0 A;  3TS2 A;  2ALY B;  3Q24 A;  3PO3 H;  1L0Y B;  1IYU A;  4JBW A;  1G2T A;  2EYP A;  3H3V C;  3PIO 3;  2VB3 X;  1K8O A;  1G29 1;  5M5Y B;  2L0C A;  5IWA L;  1EYC A;  3S2H B;  4A75 A;  1E22 A;  2JE6 I;  4XIG S;  1HPC A;  5FKA C;  4RGM A;  4JI1 Q;  4RAU C;  3PF5 A;  2Q2T A;  4OIK A;  3S15 B;  4JI0 L;  3UDI A;  4X66 Q;  1VQ8 A;  5JJK A;  4APV A;  3T1H L;  3R2I A;  1SYF A;  2NUC A;  5DNF A;  2HDL A;  2P5Z X;  5CV5 A;  1LT5 D;  3MEH A;  5BN3 A;  4DA2 A;  1DOL A;  3NSW A;  1K0S A;  5HGQ A;  4FXG C;  4IPD A;  1PXU A;  3TP6 A;  1RIP A;  2NVT H;  5JVH 3;  1TR5 A;  1H95 A;  4CDF C;  3NHH A;  3CD6 A;  1SEB D;  3GTL B;  5DAU A;  2HD3 A;  1HTP A;  4F88 A;  4F87 A;  1M4V A;  1QWY A;  1EOT A;  1R4Q B;  4LWC A;  4NXN L;  1VQC A;  2DN8 A;  5ELB A;  1JWU D;  1N33 L;  1HFN A;  4POF A;  4GKJ L;  1LT4 D;  1SYE A;  1XMQ L;  3F1Z A;  1B44 D;  1B7Y B;  1LO5 D;  2PI2 A;  2L9H A;  1DGS A;  3NEM A;  2JA9 A;  4N8F A;  4OX9 L;  1PH2 A;  4A3B B;  4A3M H;  3A7L A;  5L37 A;  1CZW A;  3P75 A;  3UE1 A;  4GN3 B;  1VQG A;  1ZKO A;  3MZ5 A;  3OYY A;  2BH2 A;  1VQN A;  1SYG A;  4OEL B;  3UDG A;  3FKI G;  1JWS D;  1ESF A;  2G9H D;  1VQL A;  1HUN A;  2DY8 A;  1XNR Q;  2EJM A;  3S16 H;  4A3I H;  2ZJQ A;  4BBS H;  2FMC A;  5KNC A;  5C3E G;  1IBL Q;  5LMN W;  1HNX Q;  3D6W A;  4QL5 A;  3FDT A;  5C3E B;  4HN7 A;  5IP7 G;  2DJF C;  3X3M A;  1TWF B;  2A19 A;  3P1H A;  2NN6 G;  2A5H A;  1RCV D;  1KAA A;  5EQ0 A;  2NZH A;  4JI7 L;  3PF4 A;  1K8M A;  3PUX A;  1WTQ A;  5IY0 A;  1CFM A;  2F3W A;  4X3T A;  2F0J A;  2HT1 A;  4PV1 C;  2EY6 A;  2K03 A;  3T1Y Q;  1L2F A;  3BS1 A;  1PFM A;  2OCE A;  1SE2 A;  2WB1 E;  4H7B A;  1Y1V G;  3R3O A;  2E8G A;  4CDC C;  3MWY W;  4R8N A;  3NP8 A;  3NEN A;  1Y1V B;  3I56 A;  1XX8 A;  4LUV A;  2ZT9 C;  3K57 A;  4DAY B;  4UHV A;  4EGV A;  1KLG D;  4B9X A;  1EFI D;  1S72 A;  1O78 A;  4PMB A;  5IYC G;  3ULJ A;  4IUT A;  1EY5 A;  1AZQ A;  3TZD A;  4DNI A;  3BDL A;  2MUY A;  2F0D A;  3OPO A;  2M9V A;  4BY1 H;  2PQA B;  1KNA A;  2NB0 A;  5C4J H;  3PUY A;  3JC6 6;  4DPG A;  4LUZ A;  2KCT A;  2EYJ A;  4DR2 Q;  1J9O A;  1O7Z A;  3CPF A;  2JA5 H;  2EY1 A;  1WTR A;  1GHK A;  4IPC A;  1SN8 A;  4YCV A;  3NTK A;  1KNE A;  3CC4 A;  4JBM A;  5CBA E;  1Y8P B;  4P71 A;  1JCK B;  2ZTE A;  1NE3 A;  3NPP A;  3GTP H;  1DOK A;  3CRK C;  2A74 C;  1YHB A;  1YZ6 A;  5I9O A;  2F0M A;  4LK1 C;  4K14 A;  2WKD A;  1K3B C;  1TY0 A;  1PTO F;  5CR3 A;  4QCL A;  3VYR A;  4Y7N H;  2BOS A;  4IPH A;  4DAY A;  5COY A;  2PW5 A;  1EY9 A;  2CFM A;  2Z4I A;  1A2U A;  3A54 A;  3ERO A;  3H0G B;  3S14 H;  4GN5 A;  4DV7 L;  4PMC A;  2B3G A;  1I3Q B;  1BCP D;  4LF7 Q;  1SMY C;  4L5R C;  4DR3 Q;  2SNM A;  1IBM L;  1E3P A;  2NN6 I;  1EQT A;  1HH2 P;  1X56 A;  4NKL A;  4DAM A;  1TS2 A;  5FLX L;  2B2Y A;  4FXD A;  5EPL A;  4ZLT F;  2JA8 G;  2VQE L;  3DWA A;  2RA4 A;  3G71 A;  4BXX H;  3J7A 5;  4X62 L;  4BY7 H;  2I0Q A;  1FVI A;  2XWB B;  3CME A;  4IFD H;  2B2T A;  2K33 A;  1MSG A;  2XRQ D;  4ZKC B;  2L5T A;  4KV6 A;  3R93 A;  4A3L H;  4LW1 A;  3W2D A;  1EOV A;  2Y0S B;  1VQK A;  4L5S A;  3VR5 A;  2EDG A;  3RZD B;  4GLX A;  1TWC H;  5IYD G;  1R9T H;  4RHS A;  3ZJY C;  1ONL A;  2OQ0 A;  1IL2 A;  5FLM G;  2GVB A;  5CV7 A;  4HJ7 A;  3U50 C;  3GP7 A;  1Q46 A;  2RDH A;  1GOZ A;  4IUP A;  4B08 A;  4DK6 C;  2Q8R E;  1GHJ A;  1LTS D;  2E2H B;  2N49 A;  3IKJ A;  3EN2 A;  1IKM A;  2D62 A;  1VQI A;  4RGO S;  1Q1B A;  2ZJR A;  1MKH A;  1QZG A;  5C0X G;  1JR0 D;  2X6G A;  4CDD C;  1QVC A;  4X65 L;  3PO2 H;  5IYB G;  3E0J A;  4CGY B;  4A3F H;  1H9J A;  1I6H H;  1O80 A;  3UDF A;  2PW7 A;  3MXN B;  1VQF A;  2R3Z A;  3BDC A;  2OTJ A;  1H9M A;  3P7J A;  2CWP A;  3AU7 A;  4ULL A;  3S17 B;  1S5D D;  4G57 A;  1IW7 C;  1R4P B;  2DUD A;  4KY7 A;  2UU9 L;  2EJG C;  5C0X J;  3SDZ A;  1FNW A;  2R92 G;  3HOY G;  2IPK D;  3W5O A;  3M85 A;  4LNQ A;  1T5X D;  1A3T A;  3S2D H;  1Q90 A;  1PRT C;  1QUQ B;  2EYM A;  1PH3 A;  1PH8 A;  2N88 A;  4OON A;  3HOZ G;  3I3C A;  1PRT F;  1I94 L;  3HOZ B;  4DAV A;  2JYO A;  1BCP B;  4RKL A;  3C2P A;  3T56 B;  2KED A;  4GLA C;  5CV6 A;  2KHI A;  3D6C A;  3PSI A;  4LF6 L;  3EA6 A;  2RHS B;  4GN4 B;  4KI0 A;  5GRO A;  3I8Z A;  4M1U B;  2X6L A;  3A7A B;  2ZM6 L;  1HR0 W;  1D6E C;  5E4X A;  1HUM A;  2VY3 A;  4JV5 L;  3MXN A;  2QDB A;  1YHA A;  4JC0 A;  2DNE A;  2UXD Q;  2PO4 A;  1YEZ A;  4RWS C;  1UEB A;  5HY6 A;  1YJW A;  1BOS A;  3NQT A;  2PMZ B;  3QWN A;  3QIA A;  3K0X A;  3GTG H;  1T5E A;  3S1N H;  2Z6K A;  4LF4 Q;  2A6E D;  4YY3 L;  3GTQ B;  1ENF A;  2BDO A;  3G4S A;  3RN2 A;  5CV4 A;  1GXD C;  3CF5 A;  1CKN B;  4DR6 L;  3RLO A;  4DR5 Q;  2RCN A;  2D0O A;  2F0S A;  4WRD A;  4KJN A;  5CV8 A;  4CBV A;  3M9B A;  1VQB A;  1Q7Y C;  1VF7 A;  3EVQ A;  1S5B D;  4L5T A;  5J22 A;  4AQY L;  3IAY A;  3V96 A;  2JEA I;  5EJW A;  3SVM A;  2CH4 W;  4DV1 L;  1S3O A;  5IP9 G;  4EQ5 A;  5C0X I;  4LFA L;  1GKH A;  2CVR A;  1K83 H;  1SYB A;  2EY2 A;  2WAC A;  4FNF A;  4LUO A;  3Q22 A;  1N32 L;  1XNQ L;  4LFC Q;  1YBY A;  2FFK B;  1JOO A;  3PUV A;  3CCM A;  4B3S L;  1OO9 B;  1RTO A;  4B9W A;  2K5Q A;  1IL8 A;  1ILQ A;  5C44 H;  5COR A;  1DOM A;  3HOW G;  3J80 i;  4WJ3 M;  2JK8 A;  2B2W A;  4G7Z C;  3HOW B;  4KY6 A;  1FL0 A;  5KRU A;  2QDL A;  2K50 A;  4XQN A;  1HFG A;  2F0O A;  1XYI A;  5JJL A;  2AQ3 B;  4L5Q A;  4KKT A;  5JAV A;  1A62 A;  3I72 A;  4OWT B;  2HHH L;  4BBR B;  3N52 A;  1BQQ T;  1OXV A;  4O0A A;  5D14 A;  1QNU A;  2N78 A;  2XN9 C;  1CM9 A;  4K5V A;  1TQO A;  1AZP A;  1L1O B;  3TQY A;  2IT1 A;  1N36 Q;  5I9P A;  1VQ4 A;  4B3T L;  2R7D A;  1U4L A;  4IAL A;  5EKL A;  3M4O B;  1H9K A;  1F2Y A;  3OTO L;  5DEH A;  1JOR A;  1GJX A;  1WCM G;  1GUO A;  3LX0 A;  2MFI A;  2NBF A;  1KDB A;  1SE4 A;  2BE5 C;  2CW0 D;  1X6O A;  2QW7 A;  1SYD A;  4NXM L;  1HNZ L;  1SFO H;  1UUP A;  1G2S A;  4MHE A;  4RA8 A;  4Y52 H;  2WIN B;  5ELO A;  2VUM H;  2ATW A;  4CKC A;  2KEN A;  1V1O A;  5D3I B;  2PYK A;  1HXY D;  4B3S Q;  1V1P A;  5GQO A;  1ZYR C;  3G7L A;  3TME A;  3KLS A;  4K0K L;  4ODG A;  3WOE A;  3NK9 A;  4ZAI A;  3I70 A;  2NYZ D;  1VQO A;  2R7Z G;  4MZ9 A;  1P8L A;  3PCO B;  2F3I A;  1KAB A;  2R7Z B;  1S5F D;  4JI8 Q;  4KHP L;  3B6Y A;  5LMN Q;  2A6H C;  3GTJ H;  3HOX G;  5LMU L;  1CZG A;  2RSN A;  5GAD C;  4X3K A;  1EQQ A;  1NR2 A;  1MJE A;  3S2H H;  3J81 i;  2RDF A;  3RN5 A;  2EPB A;  3CCU A;  3C1F A;  2NVQ H;  1II3 A;  2E5L Q;  1L1O A;  1W3S A;  3L7Z C;  3PV0 A;  3TP5 A;  1WTX A;  4KD3 A;  1QIL A;  4NB3 A;  4KHV A;  4DR1 Q;  1M90 C;  4M8A A;  2F0Q A;  1SRU A;  2YU9 B;  3X3N A;  1O7I A;  4DUY L;  4GOP C;  1O7Y A;  4A3J B;  2JN4 A;  3T53 B;  1SNM A;  3E0E A;  4NDX A;  3I4N B;  1UE5 A;  1Q1E A;  4DV2 Q;  3GTL H;  4MN3 A;  1WI5 A;  5IGB A;  4CJ2 C;  3GV6 A;  2KCC A;  4A3D B;  5I6W A;  3URY A;  3HOU G;  4JK1 C;  1SSO A;  4JBJ A;  1K9M C;  2IHE A;  1H9R A;  1TWG H;  2F0V A;  3HOU B;  1LM0 A;  4L8J A;  1PMR A;  2R93 G;  1MSH A;  2ID0 A;  3NTH A;  4ME3 A;  4JI1 L;  3A8J E;  2CQA A;  4FYD A;  2R93 B;  3ONA B;  4X66 L;  4CKE A;  3D3R A;  4PNY A;  3VYS A;  3I55 A;  3OW7 A;  4EQO A;  2L4N A;  4ILW A;  2B2U A;  1TII D;  1NAP A;  3EJI A;  5C4Z A;  1QB5 D;  1XTC D;  5A35 A;  1XJV A;  2PZU A;  2B2V A;  2JXM B;  1C48 A;  3S1M H;  4KHP Q;  3CU7 A;  3HP3 A;  4CDE C;  5FJ8 G;  3A0J A;  4IUR A;  3CCR A;  1PTO D;  1LTT D;  1Q8I A;  3FKI H;  1FGU A;  4R4Q A;  2EYO A;  3VR3 A;  4C1N I;  4TQU S;  2KBN A;  3A8I E;  4MIU A;  3KJO A;  4JI3 Q;  3Q8D A;  3CCL A;  3K7A B;  4IUU A;  1LAC A;  5C3E H;  4PZ7 A;  1A8V A;  3PGZ A;  4IPG A;  3QR8 A;  4FO2 A;  1YJ9 A;  2L11 A;  4HMI A;  5IP7 H;  3S1R B;  3GTK H;  3M3Y H;  4CJ1 B;  2FXQ A;  1FGB D;  2NN6 H;  2WP8 J;  2MNA A;  4GNX C;  2SNS A;  2CQO A;  1EFW A;  1KHI A;  2B2V C;  5M5W B;  1B9N A;  2KEE A;  3P20 A;  1DD2 A;  2MQH A;  3GDE A;  3QO2 A;  2SEB D;  2MPM A;  1Y69 U;  2SDF A;  2UXC Q;  2NVY B;  2C9O A;  2WAQ G;  3SHL A;  3WOF A;  4CJ0 B;  5JPM C;  1Y1V H;  1M1K C;  1XNR L;  2WAQ B;  3HGB A;  1D5Z C;  1IBL L;  3ER0 A;  4J8Q A;  2LS0 1;  4RGT A;  1HNX L;  1GUN A;  3W1G A;  4AYB E;  5EPJ A;  3PUZ A;  4DUZ Q;  4OXP A;  5EPK A;  1TS5 A;  5ELN A;  1VQE A;  4DAP A;  3NEL A;  2HIX A;  5CMD A;  3GTM H;  4O2D A;  2F0K A;  3DUZ A;  5IOD A;  1Y14 B;  1HZC A;  3A5Z B;  4HMJ A;  1I4X A;  1SJH D;  1TWH B;  2LXJ A;  3AMU A;  3E3X A;  4KKS A;  1N34 Q;  4ZUI A;  5M5X B;  3DM1 A;  4R8I A;  5JPN C;  1GUT A;  1YJN A;  1QVF A;  3EIV A;  3T1Y L;  1KRS A;  2K4K A;  3M7N A;  1EY8 A;  5ELD A;  2MJ8 A;  4DV0 Q;  3FP9 A;  3VA7 A;  1X55 A;  4I65 A;  1W6K A;  1RL2 A;  4Z9C B;  5I2X A;  1C0A A;  5AJ3 Q;  3RR5 A;  3NE5 B;  1JE4 A;  3MEF A;  3BZD B;  5FO7 B;  4XYO A;  3JAM L;  2O5I C;  4A3B G;  4MTK A;  4RMF A;  2A69 C;  2F1M A;  3DLL A;  4QIW E;  4JI6 Q;  5K5P A;  5C3W A;  1Z9F A;  4DV6 Q;  1FNV A;  5C3X A;  2JP1 A;  3J80 E;  2M2L A;  1EYD A;  2KHS A;  3OSO A;  4ABN A;  1IKL A;  5C5M A;  5LHY 1;  2R6G A;  2LY7 A;  4A76 A;  4C2M H;  4DR4 Q;  1UEA B;  4OWW B;  1MI2 A;  4DR2 L;  1PTO B;  4X64 Q;  1EQR A;  3L3O C;  1OXT A;  2SOB A;  1VQ6 A;  1NTG A;  3I4M G;  4K5X A;  2VS1 A;  1RHP A;  1B70 B;  3VR4 A;  3ULL A;  5NUC A;  3I4M B;  1X65 A;  1PRT D;  4ZQ3 A;  3CCS A;  1D2B A;  1UAP A;  4TSS A;  5JVG 3;  1LTI D;  3KLW A;  1YI2 A;  2IHF A;  3NWS A;  4C3I G;  4C56 C;  4QQB X;  1PDQ A;  2C35 B;  2I5L X;  2G9D A;  3RLN A;  4HR7 B;  4C3I B;  4YWK A;  4KJO A;  2K05 A;  4A93 B;  1I4P A;  2XTI A;  2JA8 H;  1PYB A;  1I50 B;  5KYI A;  2ZTD A;  1UWV A;  3H91 A;  3CCE A;  5KYL A;  4UP9 A;  1S4Z A;  2JA6 G;  4LF5 Q;  1FJG Q;  4B3R Q;  1JOK A;  1U5K A;  2YV5 A;  2JA6 B;  2VW9 A;  4DV5 Q;  4PG3 A;  3MXP A;  1RKN A;  1X3G A;  2IX1 A;  5K36 G;  4DK3 C;  2PZW A;  3SK5 A;  4JI4 Q;  3S1Q B;  2E76 C;  2EE1 A;  4C3J G;  4JOI C;  5IYD H;  4JI5 Q;  4DXG A;  4C3J B;  3T4A C;  3STB C;  3PO3 B;  4LF7 L;  1GUW A;  4DR3 L;  5C6A A;  1UNS A;  5T1G A;  4ZRZ A;  1HR0 Q;  2Z9H A;  2ZXR A;  1LTA D;  1HZA A;  3W1B A;  5IGG A;  1YNN D;  1EWC A;  1HA6 A;  4KD4 A;  1V1Q A;  3E9H A;  5C0X H;  3L2P A;  5IYB H;  4N8X 1;  2LMC B;  4FF3 A;  4QJF A;  1FD7 D;  1V8Q A;  4HIM A;  5M9O A;  1JB3 A;  3GTO B;  4TKO B;  5IGC A;  1B8A A;  1JC7 A;  2UXB Q;  4A3E G;  5A2Q L;  2I46 A;  2IL8 A;  2A8V A;  1EEI D;  4A3E B;  1LTR D;  2TSS A;  3CCQ A;  2NVT B;  2HQL A;  3NUC A;  3JAM i;  1F9P A;  1WJJ A;  2AMC B;  1L0W A;  2R92 H;  3HOY H;  1EYA A;  4DR7 Q;  3EFX D;  1BR9 A;  4P75 A;  3J80 c;  3H0G G;  4B3M Q;  4C3H G;  1EUJ A;  3TDQ A;  3MVV A;  1C9O A;  4A3M G;  1PRT B;  4C3H B;  1HQM C;  3U4Z A;  2D0P A;  1SDF A;  4A3M B;  3WWV A;  4JBK A;  3TN2 A;  1D5X C;  3PQI A;  4V19 0;  1K73 C;  1EZ8 A;  3NXW A;  1C7Y A;  2B39 A;  2E2D C;  3HKZ G;  4A3I G;  4YWM A;  4AH6 A;  3HKZ B;  4A3I B;  4A4I A;  2ENB A;  1KQS A;  2EYL A;  1B53 A;  4HCS A;  4QUF A;  3SK4 A;  1HCZ A;  2Y0S G;  2IJ0 A;  1WTH A;  2XSC A;  1CSQ A;  1TXY A;  2GN5 A;  1BXT A;  3KBG A;  2EOT A;  2V4D A;  1PZK D;  1E2V A;  4POG A;  3AFP A;  3E6Z X;  4RCO A;  4HTH A;  4XQQ A;  1Y1W G;  3TBI B;  5BR8 Q;  3HOV H;  3SK8 A;  4KHZ A;  2RHQ B;  1K8G A;  1Y1W B;  1PHJ A;  1YIJ A;  1EU3 A;  5FK9 C;  4UDU C;  5I2Y A;  5T1I A;  4BA1 I;  1F2Z A;  4DV4 Q;  2OF1 A;  2FMM A;  1PYS B;  3MHB A;  1OTC A;  4GS3 A;  2OEO A;  4R1J A;  3VR2 A;  1AP0 A;  1EWI A;  3A55 A;  2O5J C;  4IOC A;  3OMG A;  1BVS A;  5IP9 H;  3D0F A;  3O13 A;  3ITP A;  2A6H D;  3FMC A;  5KIX A;  2UXD L;  4IJL A;  3F2B A;  3CQZ H;  3I4L A;  2PNH A;  2F0N A;  4F7X A;  2R7F A;  2GA4 B;  3TRE A;  4EX5 A;  1WD1 A;  3M4Y A;  3J81 c;  3MA2 B;  2Z6B A;  5KEE A;  5IT9 E;  4R4C A;  2A68 C;  4BY1 B;  4LF4 L;  1WYD A;  5C4J B;  1KTK A;  1U4M A;  2G5D A;  2ZXP A;  1GUG A;  1E2Z A;  2F0U A;  1IHZ A;  4DR5 L;  2MGS A;  2JA5 B;  3MFY A;  1UE6 A;  3IL8 A;  4WFN 3;  2OQK A;  4DXF A;  1NJI C;  1PYW D;  3SK6 A;  4O1N A;  1F2L A;  1J5E Q;  3GTP B;  4OIJ A;  2J4X A;  4LFC L;  1JWM D;  4C1N K;  2V1C C;  2BH8 A;  4JVZ A;  4KLK A;  2NVX H;  2K1B A;  3F2D A;  3M4O H;  2GVA A;  3WDN A;  2AHO B;  2F0W A;  1V43 A;  4JCV E;  5IGF A;  1WCM H;  3Q6S A;  1H9S A;  3H6M A;  2ASB A;  4GLV B;  4DGZ A;  1PA6 A;  5IGE A;  3S14 B;  3BYT B;  3RLF A;  1QVG A;  4GKK Q;  1HNW Q;  4HAE A;  5D65 A;  4Q5V A;  1EZ6 A;  5E3F A;  1EY6 A;  2EXD A;  2JA7 H;  3J81 j;  4BXX G;  5IE8 A;  4MTN A;  2PNR C;  3G48 A;  1LT3 D;  1Z6H A;  4UAI A;  4IFD G;  2R7Z H;  1N36 L;  5ELF A;  2Z4H A;  2RQX A;  4U68 A;  2YYZ A;  1VQ9 A;  4DFA A;  4LFB Q;  3HOX H;  4YHH Q;  2A73 B;  2QGQ A;  1CI3 M;  1CUK A;  1TWC B;  3CCV A;  3RZO H;  2WB1 B;  4K8J A;  1I4R A;  1X3F A;  3KFU A;  3H94 A;  2F0E A;  2F0G A;  2QEJ C;  4HJ5 A;  2CHB D;  2ZXO A;  1N9W A;  3BVZ A;  4IFD J;  3AYH B;  1RF2 D;  2YU9 H;  3T51 B;  2QF7 A;  1Z7T A;  4ID6 A;  1XPO A;  3H09 A;  4JW0 A;  3TP8 A;  4HIO A;  3I73 A;  5EKI A;  1V1P B;  1NY4 A;  5IT9 c;  3KOJ A;  3PO2 B;  2F0T A;  3KF8 A;  4JI8 L;  5LMN L;  1SND A;  1MD2 D;  4A3F B;  1I6H B;  4IUQ A;  4R4T A;  5BN5 A;  1PZJ D;  2E2J H;  4OL7 A;  3DEO A;  4G7O C;  4BBR G;  4A3C G;  2R93 H;  1U4P A;  2VQF Q;  2B8F A;  1LLR D;  1STB A;  2Z8L A;  2E5L L;  5EAY A;  4KY5 A;  4PMW A;  2KCM A;  4WJ4 A;  4LF9 Q;  3SE0 A;  1A6X A;  1NMF A;  4DR1 L;  4NW2 A;  2HDM A;  1B4O A;  1MGS A;  2RVL A;  3DWP A;  1DJR D;  1IYV A;  3H15 A;  2A69 D;  2JSO A;  1JOQ A;  2F4V Q;  5G3L F;  3S2D B;  5FJ8 H;  5LL6 X;  3TSS A;  1PVO A;  4DNR B;  1VQJ A;  4XYQ A;  4DV2 L;  3KDF B;  4PZ6 A;  2HUG A;  5E1F A;  1HJP A;  2LXK A;  2NZ1 D;  5GAH C;  2NWG A;  3QJY A;  1NUC A;  5JEA G;  1CKM A;  5KGU A;  4HIK A;  4J6H A;  1B3A A;  3S1R H;  1EL0 A;  3UE0 A;  1F77 A;  1TY2 A;  1AE2 A;  2B29 A;  5EKK A;  2CWA A;  1LAB A;  1Z47 A;  4EQP A;  2E2I H;  5M5W H;  2E75 C;  3BDO A;  1BKB A;  4XDX A;  2UUA Q;  4GOP A;  1HHV A;  4IFD I;  2Q8I B;  1SNP A;  4OWX B;  2K5N A;  2K04 A;  5M5Y H;  2D5D A;  3LWE A;  1STG A;  4XT3 B;  3NBH A;  3PMF A;  5JEA J;  3V2T A;  1VQ7 A;  1E24 A;  2KOL A;  3CAM A;  1OXU A;  1GD7 A;  2VL6 A;  4JI3 L;  3D31 A;  3GTG B;  3S15 H;  3S1N B;  4DV3 Q;  1EY4 A;  3HZX A;  5KND A;  3J7A F;  2TMP A;  3U4V A;  4FDB A;  1KRT A;  2LSS A;  2RBM A;  4HID A;  1LUZ A;  2K52 A;  1U0L A;  4A3J G;  4IUV A;  1MHW C;  4O42 A;  1PH9 A;  1STA A;  2ICI A;  3G6E A;  3I4N G;  1LT6 D;  4DN4 M;  3KDF A;  5JJZ A;  1YNJ C;  3STB D;  1G6P A;  3C46 A;  4IUN A;  4UP7 A;  2MO1 A;  4A3D G;  1BUV T;  3K5O A;  2UXC L;  1K83 B;  3BZC A;  3S9W A;  2UUB Q;  3OOC A;  2UUC Q;  4IZ8 A;  2K01 A;  3K5L A;  3D4D A;  2E74 C;  4E6I A;  3ERS X;  3E9I A;  4JI2 Q;  3RD4 A;  2Z1C A;  4CKB A;  1SAP A;  1SRO A;  4A3B H;  1NR4 A;  5C44 B;  2F03 A;  1LTG D;  5JOB A;  4DUZ L;  1VQ5 A;  4GNX A;  1KC8 C;  1K3R A;  2MP1 A;  3KUP A;  5M3F G;  3RMH A;  3DXJ C;  4RKB A;  2F0F A;  5M3F B;  1BBX C;  3L9A X;  1FNU A;  3KJP A;  1N34 L;  5J3B A;  1OXX K;  1C4Q A;  3I4M H;  2RSO A;  4OGQ C;  2F0H A;  1STH A;  4OO1 G;  2DGY A;  3I90 A;  1HA5 A;  4UPA A;  4DV0 L;  2QKI C;  2YTX A;  1JE5 A;  3U9S A;  1TWF H;  5AJ3 L;  5C5L A;  3BU2 A;  2QEX A;  3L0O A;  4LF8 Q;  2J7Z A;  1U4R A;  1K8A C;  2F0L A;  5TSS A;  4K6L A;  2OXP A;  1X3P A;  2FIN B;  5ELE A;  3HRZ C;  4R9W A;  3DWQ A;  4JI6 L;  3A74 A;  1LTL A;  4DV6 L;  1SMY D;  3K5M A;  4R4I A;  4RCN A;  1E0B A;  2RF4 A;  3VYT A;  3K6O A;  2AKW B;  1PLF A;  3DEP A;  4H44 C;  1EIY B;  3GO5 A;  4DR4 L;  1YIT A;  5FLX E;  1XMO Q;  1SFO B;  1W2B A;  1SBB B;  1ILP A;  4HSV A;  5I4D A;  4X64 L;  2EY5 A;  1MBY A;  1XTD A;  3IFD A;  5K36 H;  3H3V I;  1KDC A;  1K28 A;  1KLU D;  3D4W A;  4TRD A;  4UP8 A;  2AWO A;  2BA0 A;  4LMQ D;  2Q2H A;  1YHQ A;  1BF4 A;  2I5M X;  1K0R A;  1CQF A;  4XXE A;  2FHT A;  1VQD A;  1RTN A;  3K80 C;  2R61 A;  5IYC H;  3HFZ B;  4NP5 A;  1Q81 C;  4RH6 A;  3PUW A;  4QUC A;  3AQQ A;  1SR3 A;  1IBK Q;  2AQ1 B;  3RUZ A;  3GTJ B;  1DZ1 A;  2N55 A;  3OHX C;  4OEM B;  3G6J B;  3GQB A;  1DXM A;  4A3G G;  2PZT A;  4LF5 L;  1IYJ B;  4BS9 A;  1FJG L;  4A3G B;  4B3R L;  2ZJP A;  2NVQ B;  3DM3 A;  5J1Z A;  2WKC A;  4DV5 L;  4BWG B;  1X54 A;  2O4X A;  3GTO H;  3TP7 A;  1TVX A;  4NMZ A;  1A2T A;  4JI4 L;  2B63 G;  4IQZ A;  2RDG A;  1SNO A;  1VQA A;  4A3E H;  2KHJ A;  4JI5 L;  5HGT A;  2EIF A;  1LTB D;  2B63 B;  3FPP A;  2Q2I A;  3F2U A;  2LKV A;  1BNZ A;  5M3M G;  3T13 A;  1QE6 A;  3BJU A;  1HTL D;  1HR0 L;  4ALP A;  5M3M B;  2A68 D;  1UE1 A;  3KLR A;  1X3Q A;  3SEB A;  4HSP A;  2L15 A;  1IW7 D;  4JYA Q;  1TWG B;  3ERQ A;  4N9T A;  4YWL A;  1GO3 E;  3H0G H;  3M7G A;  3A56 A;  4C3H H;  1STN A;  2Q2U A;  2QA4 A;  5GAE C;  2H1E A;  4OO1 I;  1I3Q H;  4JOI A;  1ZEQ X;  2K7V A;  1NSN S;  3VYU A;  2UXB L;  1DON A;  1XPR A;  2CW0 C;  1PH4 A;  4A3K G;  4A93 G;  2QIL A;  3PIO A;  4DK0 A;  1JJC B;  3S1M B;  5C4X G;  1T9H A;  4A3K B;  2EQS A;  1J8I A;  1Q82 C;  1Q86 C;  5IWA Q;  1E1O A;  1AE3 A;  1ZXT A;  5FO8 B;  3FKI B;  5C4X B;  1CK1 A;  2AUK A;  3HG9 A;  2PMZ E;  2F0P A;  2N3S A;  1TWA B;  4JI0 Q;  1CSP A;  1Q12 A;  2AQ2 B;  5CBE E;  3T16 A;  4IOA A;  4TVA B;  4DR7 L;  3CCJ A;  3T1H Q;  4F8M A;  4XQJ A;  3RZD H;  1EIH A;  4B3M L;  1ESR A;  3GTK B;  1QJO A;  3UI2 A;  3M3Y B;  5FLX c;  1Y1W H;  3PO3 G;  1FR3 A;  3BZK A;  1SNC A;  2NTS A;  3MC0 B;  1CKO A;  2VNU D;  3HKS A;  5FLM H;  1S5E D;  1ROD A;  1SNQ A;  2FJ2 A;  1EU4 A;  2IX0 A;  5E4W C;  4HCE A;  4KN4 C;  3FHW A;  4I7Z C;  1M8A A;  1VS0 A;  1A3U A;  4WOR A;  4NXN Q;  1YVC A;  2E2H H;  1B2T A;  5E7N A;  3OIP A;  3J7Z C;  1E1T A;  1N8R C;  3ICE A;  1KIX A;  1N33 Q;  4GKJ Q;  3SXH A;  4G7H C;  1XMQ Q;  2C5C A;  1B3Q A;  1DM0 B;  1WVL A;  1RJT A;  2AWN A;  3J81 E;  4OX9 Q;  1QCB D;  1AN8 A;  2L1B A;  2RCF A;  3A8K E;  5FO9 B;  3KBX A;  1TKW B;  1Y8N B;  4QB4 A;  3GTM B;  1DYQ A;  2K6A A;  5BR8 L;  1WOC A;  1PFS A;  3S17 H;  1KDA A;  1BO0 A;  4LJZ C;  4DF7 A;  4HJ8 A;  2PQE A;  1XPU A;  4X3S A;  1TS4 A;  4JG2 A;  3Q0A A;  1CT1 D;  1C8C A;  2KUM A;  2BCO A;  4DV4 L;  2XNA C;  1BDO A;  1E2W A;  3DHQ A;  2VZA A;  2YTV A;  3HOZ H;  1BBW A;  1VCI A;  2D9U A;  3OWE B;  3AEV A;  4JI7 Q;  2CH4 A;  2KQ3 A;  1PTO C;  3VDY A;  4WJW A;  4U67 3;  1XWE A;  1CHQ D;  3CXC A;  4C2M B;  2EXZ A;  4BBS G;  4FF4 A;  1ASY A;  1GVP A;  2JQO A;  2K5H A;  4RFB A;  4H13 C;  3S16 B;  5G3L D;  3NQI A;  4BBS B;  3I2Z A;  1ICF B;  2HQE A;  2PPB C;  3CP0 A;  4EVO A;  2DY7 A;  3OW2 A;  3UDX A;  2PCF B;  1V9P A;  3IFT A;  3K0Y A;  4G4K A;  1J5E L;  3AB9 A;  2PQA A;  3R2T A;  3J7A V;  1QZH A;  2O2L D;  1F9S A;  1KL9 A;  2BE5 D;  4K2L A;  3MXU A;  3S24 A;  3GTQ H;  1I6V C;  1CA6 A;  1JIC A;  1STY A;  2JA8 B;  1B50 A;  1PFB A;  2RKS A;  2JJQ A;  1PH1 A;  4FVM A;  5FOB B;  3ND8 A;  1ZYR D;  4S3S A;  3U58 A;  1LYL A;  1WTW A;  2F0I A;  2IY5 B;  1TU2 B;  3TEH B;  5IOC A;  4Q0F A;  1H9S B;  4GKK L;  1HNW L;  3NTI A;  3I91 A;  3VA5 A;  1SXT A;  3PIP 3;  2B2Y C;  4AYB G;  1A15 A;  4BY1 G;  4ME5 A;  3I4O A;  4HED A;  4AYB B;  5EBD A;  3CC2 A;  3A5U A;  1JT8 A;  1PFN A;  2B2T C;  4IN3 A;  3RNU A;  2JA5 G;  1EWH A;  3HOW H;  4K5W A;  2K5D A;  1GM5 A;  1QOH A;  1B1Z A;  2Z0S A;  1STE A;  1WFQ A;  4RGN A;  1WTP A;  4X6A H;  1RD9 D;  2XGT A;  5IIF A;  4DV7 Q;  1AFP A;  2CKZ B;  4LFB L;  1EYG A;  1ML0 D;  1YNJ D;  4YCW A;  4YHH L;  2ES2 A;  3KK7 A;  1S40 A;  1GUS A; 
#chains in the Genus database with same CATH homology
 1DCZ A;  3J80 L;  1ICW A;  1X32 A;  5DM7 3;  1CTM A;  5LL6 S;  4X3U A;  2XIW A;  2WII B;  2LFN A;  4ZYS A;  5ELC A;  1WTV A;  3TZU A;  4FF1 A;  3SR1 A;  2VXW A;  4ZK9 B;  3HOY B;  2R92 B;  4QIW B;  2IX3 A;  4K8I A;  2EJF C;  5CC4 A;  4RHR A;  4Y7N B;  4KK7 A;  1L0X B;  3N6R A;  4DNT B;  5BN4 A;  1TS3 A;  3BG3 A;  3C3L A;  5C4H A;  5JEA H;  2VB2 X;  2DNC A;  3R8B A;  1WD0 A;  2BDN A;  3MFG A;  3NWT A;  1QG7 A;  3C1E A;  4DK1 A;  1EY0 A;  1AW7 A;  4KTA A;  1ENA A;  4BY7 B;  4QF4 A;  4P2C B;  4BA2 I;  3OIQ A;  1U9R A;  2HCC A;  3BVG A;  1R9T B;  2NTT A;  3HOV B;  2XWJ B;  1YNN C;  5CV9 A;  2MHV A;  3K5N A;  2K28 A;  3LNN A;  3CHB D;  5EBC A;  2L12 A;  1EQV A;  4V0B A;  1LV9 A;  4L6T B;  3J81 L;  1SJE D;  3ND9 A;  1G6Z A;  1XXG A;  1RDP D;  3OWF A;  1VMP A;  4DU9 A;  3BYY B;  4FXK C;  2I07 B;  4EQN A;  3FVQ A;  3QB3 A;  5CGK A;  2H4O A;  3CRL C;  1HRJ A;  4K6D A;  5HUR A;  3CQZ B;  1PZI D;  2EVB A;  1AEX A;  3MTS A;  1Q3L A;  3K58 A;  2X69 A;  1FYC A;  3CKI B;  4KMU C;  5CYU A;  3Q23 A;  3KLS X;  3JAM E;  1SYC A;  1ENC A;  4QMG A;  1S5C D;  3HS0 C;  1D1K A;  1BCP C;  1BCP F;  1SE3 A;  4OO1 H;  3FEW X;  2J0T D;  5EGT A;  2F3V A;  1EEF D;  3MXG A;  4KN7 C;  1VDZ A;  5D3D A;  3NBI A;  1HQR D;  3E5S A;  4FP5 D;  4GZY C;  2NVX B;  2B2W C;  1EIG A;  4ZKB B;  4CHT B;  1NCV A;  3EQL C;  5F2D A;  2M00 A;  3W3A A;  3U9O A;  2Q8T A;  2KEC A;  2B8G A;  3GV3 A;  2IWH A;  1WCM B;  4FF2 A;  1D1I A;  1WTO A;  1Y8O B;  2F4I A;  3FPU B;  1VMC A;  2HCI A;  3D8G A;  1A3V A;  2JA7 B;  1O7L A;  3FRP B;  4L63 B;  2OT2 A;  2AUJ D;  1EY7 A;  2WV6 D;  2EYF A;  5I6Y A;  4J1M A;  4YIJ A;  2D2C C;  1D5M C;  4KKU A;  3HOX B;  3QOJ A;  2L55 A;  1F9Q A;  1TT2 A;  5IT9 L;  3K59 A;  5DM6 3;  3RZO B;  2XRS D;  3OMC A;  3MAQ A;  2KVM A;  3HEJ A;  1I4H A;  2EZV A;  2K32 A;  1VF5 C;  5AFW A;  3GD7 A;  2IW3 A;  4PQX A;  1B9M A;  1CA5 A;  3ZYY X;  2KJX A;  5ISR A;  1F9R A;  5A2Q E;  2EYH A;  1PTO H;  5J39 A;  2E2J B;  1OXS C;  3J7Y W;  1CQV A;  4XT1 B;  2JEB I;  2K5W A;  2BA1 A;  3D4R A;  4ZUJ A;  4K2K A;  1QNK A;  1ET9 A;  4H0L C;  1ET6 A;  1I4Q A;  1I4G A;  1G91 A;  2ICE C;  2QCP X;  3VR6 A;  3LWU A;  1CHP D;  1F2M A;  4N9P A;  2KCN A;  2A6E C;  1W6J A;  2XVS A;  3V05 A;  3QOL A;  4XTC S;  3QG1 A;  2KA7 A;  2VUM B;  1G8Z D;  1JQY D;  3DMU A;  4OHJ A;  5IGD A;  3BVM A;  5KNB A;  2B2U C;  4LAA A;  2E2I B;  3Q24 A;  1L0Y B;  1IYU A;  4JBW A;  1G2T A;  2EYP A;  3H3V C;  3PIO 3;  2VB3 X;  1K8O A;  1G29 1;  5M5Y B;  2L0C A;  1EYC A;  3S2H B;  2JE6 I;  4XIG S;  1HPC A;  5FKA C;  4RGM A;  4RAU C;  3S15 B;  4OIK A;  3R2I A;  1SYF A;  2NUC A;  5DNF A;  2HDL A;  5CV5 A;  1LT5 D;  3MEH A;  5BN3 A;  4DA2 A;  1DOL A;  3NSW A;  4FXG C;  1PXU A;  3TP6 A;  5JVH 3;  1TR5 A;  3NHH A;  1SEB D;  3GTL B;  5DAU A;  4F87 A;  1HTP A;  4F88 A;  1M4V A;  1QWY A;  1EOT A;  1R4Q B;  2DN8 A;  5ELB A;  1JWU D;  1HFN A;  1LT4 D;  1SYE A;  1B44 D;  1LO5 D;  2L9H A;  4A3B B;  3A7L A;  1CZW A;  3P75 A;  3MZ5 A;  1ZKO A;  1SYG A;  1JWS D;  1ESF A;  2G9H D;  1HUN A;  2DY8 A;  2EJM A;  2FMC A;  5KNC A;  3D6W A;  3FDT A;  5C3E B;  4HN7 A;  3X3M A;  1TWF B;  3P1H A;  2NN6 G;  2A5H A;  1RCV D;  1KAA A;  5EQ0 A;  1K8M A;  3PUX A;  1WTQ A;  1CFM A;  2F3W A;  4X3T A;  2F0J A;  4PV1 C;  2EY6 A;  2K03 A;  3BS1 A;  1PFM A;  1SE2 A;  4H7B A;  3R3O A;  3MWY W;  4R8N A;  3NP8 A;  1Y1V B;  1XX8 A;  2ZT9 C;  3K57 A;  4EGV A;  1KLG D;  4B9X A;  1EFI D;  1O78 A;  4PMB A;  4IUT A;  1EY5 A;  1AZQ A;  3TZD A;  3BDL A;  2MUY A;  2F0D A;  3OPO A;  2M9V A;  1KNA A;  2NB0 A;  3PUY A;  2EYJ A;  1J9O A;  1O7Z A;  2EY1 A;  1WTR A;  1GHK A;  3NTK A;  1KNE A;  5CBA E;  1Y8P B;  1JCK B;  3NPP A;  1DOK A;  3CRK C;  2A74 C;  5I9O A;  2F0M A;  4LK1 C;  4K14 A;  2WKD A;  1TY0 A;  1PTO F;  5CR3 A;  4QCL A;  3VYR A;  2BOS A;  4DAY A;  5COY A;  2PW5 A;  1EY9 A;  2Z4I A;  1A2U A;  3A54 A;  3ERO A;  3H0G B;  4PMC A;  1I3Q B;  1BCP D;  1SMY C;  2SNM A;  2NN6 I;  1EQT A;  4NKL A;  1TS2 A;  5FLX L;  2B2Y A;  4FXD A;  5EPL A;  4ZLT F;  3DWA A;  2RA4 A;  2XWB B;  4IFD H;  2B2T A;  2K33 A;  1MSG A;  2XRQ D;  4ZKC B;  2L5T A;  4KV6 A;  3R93 A;  3W2D A;  2Y0S B;  3VR5 A;  2EDG A;  3RZD B;  4RHS A;  1ONL A;  5CV7 A;  3GP7 A;  2RDH A;  1GOZ A;  4IUP A;  4B08 A;  2Q8R E;  1GHJ A;  1LTS D;  2E2H B;  3IKJ A;  1IKM A;  2D62 A;  4RGO S;  1Q1B A;  5C0X G;  1JR0 D;  2X6G A;  3E0J A;  4CGY B;  1H9J A;  1O80 A;  2PW7 A;  2R3Z A;  3BDC A;  1H9M A;  3P7J A;  3AU7 A;  4ULL A;  3S17 B;  1S5D D;  4G57 A;  1IW7 C;  1R4P B;  4KY7 A;  2EJG C;  5C0X J;  3SDZ A;  1FNW A;  2IPK D;  3M85 A;  1T5X D;  1A3T A;  1Q90 A;  1PRT C;  2EYM A;  2N88 A;  3I3C A;  1PRT F;  3HOZ B;  4DAV A;  2JYO A;  1BCP B;  4RKL A;  3C2P A;  3T56 B;  2KED A;  5CV6 A;  3D6C A;  3EA6 A;  4KI0 A;  3I8Z A;  4M1U B;  2X6L A;  3A7A B;  1D6E C;  5E4X A;  1HUM A;  3MXN A;  2QDB A;  2DNE A;  2PO4 A;  4RWS C;  1BOS A;  3NQT A;  2PMZ B;  3QWN A;  3QIA A;  1T5E A;  2A6E D;  3GTQ B;  1ENF A;  2BDO A;  5CV4 A;  1GXD C;  2F0S A;  4WRD A;  4KJN A;  5CV8 A;  4CBV A;  1VF7 A;  3EVQ A;  1S5B D;  5J22 A;  3IAY A;  3V96 A;  2JEA I;  5EJW A;  3SVM A;  5C0X I;  4FNF A;  2CVR A;  1SYB A;  2EY2 A;  2WAC A;  3Q22 A;  2FFK B;  1JOO A;  3PUV A;  1OO9 B;  1RTO A;  4B9W A;  2K5Q A;  1IL8 A;  1ILQ A;  5COR A;  1DOM A;  2B2W A;  4G7Z C;  3HOW B;  4KY6 A;  5KRU A;  4XQN A;  1HFG A;  2F0O A;  1XYI A;  2AQ3 B;  5JAV A;  4KKT A;  3I72 A;  4BBR B;  3N52 A;  1BQQ T;  1OXV A;  5D14 A;  1QNU A;  2XN9 C;  1CM9 A;  4K5V A;  1TQO A;  1AZP A;  2IT1 A;  5I9P A;  1U4L A;  4IAL A;  5EKL A;  3M4O B;  1H9K A;  1F2Y A;  5DEH A;  1JOR A;  1GJX A;  1GUO A;  3LX0 A;  2NBF A;  1KDB A;  1SE4 A;  2BE5 C;  2CW0 D;  1SYD A;  1UUP A;  1G2S A;  4MHE A;  4RA8 A;  2WIN B;  4CKC A;  1V1O A;  5D3I B;  2PYK A;  1HXY D;  1V1P A;  1ZYR C;  3G7L A;  3TME A;  3KLS A;  4ODG A;  3WOE A;  3NK9 A;  4ZAI A;  3I70 A;  2NYZ D;  1KAB A;  2R7Z B;  1S5F D;  2A6H C;  1CZG A;  2RSN A;  4X3K A;  1NR2 A;  2RDF A;  2EPB A;  3C1F A;  1II3 A;  3L7Z C;  3PV0 A;  3TP5 A;  1WTX A;  4KD3 A;  1QIL A;  4KHV A;  4M8A A;  2F0Q A;  2YU9 B;  3X3N A;  4A3J B;  1O7Y A;  3T53 B;  1SNM A;  4NDX A;  3I4N B;  1Q1E A;  4MN3 A;  5IGB A;  4CJ2 C;  3GV6 A;  2KCC A;  4A3D B;  5I6W A;  3URY A;  4JK1 C;  1SSO A;  1H9R A;  2F0V A;  3HOU B;  4L8J A;  1PMR A;  1MSH A;  2ID0 A;  3NTH A;  3A8J E;  2CQA A;  4FYD A;  2R93 B;  3ONA B;  4CKE A;  3D3R A;  4PNY A;  3VYS A;  3OW7 A;  4EQO A;  2L4N A;  4ILW A;  2B2U A;  1TII D;  1NAP A;  3EJI A;  5C4Z A;  1QB5 D;  1XTC D;  5A35 A;  2PZU A;  2B2V A;  2JXM B;  1C48 A;  3CU7 A;  3HP3 A;  4IUR A;  1PTO D;  1LTT D;  1Q8I A;  4C1N I;  2EYO A;  3VR3 A;  4TQU S;  3A8I E;  4MIU A;  3K7A B;  4IUU A;  1LAC A;  4FO2 A;  2L11 A;  4HMI A;  3S1R B;  4CJ1 B;  2NN6 H;  1FGB D;  2WP8 J;  2SNS A;  2B2V C;  5M5W B;  1B9N A;  2KEE A;  3P20 A;  1DD2 A;  3QO2 A;  2SEB D;  2MPM A;  1Y69 U;  2SDF A;  2NVY B;  2C9O A;  3SHL A;  3WOF A;  4CJ0 B;  5JPM C;  2WAQ B;  3HGB A;  1D5Z C;  4J8Q A;  2LS0 1;  4RGT A;  1GUN A;  5EPJ A;  3PUZ A;  5EPK A;  1TS5 A;  4DAP A;  5CMD A;  2F0K A;  3DUZ A;  5IOD A;  4HMJ A;  1I4X A;  1SJH D;  1TWH B;  3AMU A;  4KKS A;  4ZUI A;  5M5X B;  3DM1 A;  4R8I A;  5JPN C;  1GUT A;  3M7N A;  1EY8 A;  5ELD A;  2MJ8 A;  3VA7 A;  4I65 A;  1W6K A;  4Z9C B;  5I2X A;  3NE5 B;  1JE4 A;  3BZD B;  5FO7 B;  4XYO A;  3JAM L;  2O5I C;  2A69 C;  2F1M A;  5K5P A;  5C3W A;  1FNV A;  5C3X A;  2JP1 A;  3J80 E;  2M2L A;  1EYD A;  2KHS A;  3OSO A;  4ABN A;  1IKL A;  5C5M A;  5LHY 1;  2R6G A;  2LY7 A;  1UEA B;  1MI2 A;  1PTO B;  3L3O C;  1OXT A;  2SOB A;  4K5X A;  1RHP A;  3VR4 A;  5NUC A;  3I4M B;  1PRT D;  4ZQ3 A;  1D2B A;  1UAP A;  4TSS A;  5JVG 3;  1LTI D;  3NWS A;  4C3I G;  4C56 C;  1PDQ A;  2G9D A;  4HR7 B;  4C3I B;  4KJO A;  2K05 A;  4A93 B;  1I4P A;  1I50 B;  5KYI A;  3H91 A;  5KYL A;  1S4Z A;  1JOK A;  2JA6 B;  2IX1 A;  3MXP A;  1RKN A;  5K36 G;  2PZW A;  3SK5 A;  3S1Q B;  2E76 C;  2EE1 A;  4C3J G;  4DXG A;  4C3J B;  3T4A C;  3PO3 B;  1GUW A;  5C6A A;  1UNS A;  5T1G A;  4ZRZ A;  2ZXR A;  1LTA D;  5IGG A;  1YNN D;  1EWC A;  1HA6 A;  4KD4 A;  5C0X H;  2LMC B;  4FF3 A;  1FD7 D;  1V8Q A;  5M9O A;  1JB3 A;  3GTO B;  4TKO B;  5IGC A;  1JC7 A;  5A2Q L;  2I46 A;  2IL8 A;  1EEI D;  4A3E B;  1LTR D;  2TSS A;  2NVT B;  3NUC A;  1F9P A;  1EYA A;  3EFX D;  1BR9 A;  4C3H G;  3TDQ A;  3MVV A;  1PRT B;  4C3H B;  1HQM C;  1SDF A;  4A3M B;  3TN2 A;  1D5X C;  4V19 0;  1EZ8 A;  3NXW A;  2B39 A;  2E2D C;  3HKZ B;  4A3I B;  2ENB A;  2EYL A;  1B53 A;  4HCS A;  4QUF A;  3SK4 A;  1HCZ A;  2IJ0 A;  2XSC A;  1BXT A;  3KBG A;  2EOT A;  2V4D A;  1PZK D;  1E2V A;  3E6Z X;  4RCO A;  4HTH A;  4XQQ A;  3TBI B;  3SK8 A;  4KHZ A;  1Y1W B;  1EU3 A;  5FK9 C;  4UDU C;  5I2Y A;  5T1I A;  4BA1 I;  1F2Z A;  2OF1 A;  2FMM A;  3MHB A;  2OEO A;  3VR2 A;  1AP0 A;  3A55 A;  2O5J C;  3OMG A;  3O13 A;  3ITP A;  2A6H D;  3FMC A;  5KIX A;  3I4L A;  2F0N A;  4F7X A;  2GA4 B;  1WD1 A;  3M4Y A;  3MA2 B;  5KEE A;  5IT9 E;  2A68 C;  4BY1 B;  5C4J B;  1KTK A;  1U4M A;  2ZXP A;  1GUG A;  1E2Z A;  2F0U A;  1IHZ A;  2MGS A;  2JA5 B;  3MFY A;  3IL8 A;  4WFN 3;  4DXF A;  1PYW D;  3SK6 A;  4O1N A;  1F2L A;  3GTP B;  4OIJ A;  2J4X A;  1JWM D;  4C1N K;  2K1B A;  3WDN A;  2F0W A;  1V43 A;  5IGF A;  3Q6S A;  1H9S A;  3H6M A;  4DGZ A;  3S14 B;  5IGE A;  3BYT B;  3RLF A;  4HAE A;  5D65 A;  4Q5V A;  1EZ6 A;  5E3F A;  1EY6 A;  2PNR C;  1LT3 D;  1Z6H A;  4UAI A;  4IFD G;  5ELF A;  2Z4H A;  2RQX A;  4U68 A;  2YYZ A;  4DFA A;  2A73 B;  1CI3 M;  1TWC B;  2WB1 B;  4K8J A;  1I4R A;  3H94 A;  2F0E A;  2F0G A;  2QEJ C;  2CHB D;  2ZXO A;  3BVZ A;  4IFD J;  1RF2 D;  3T51 B;  2QF7 A;  1Z7T A;  4ID6 A;  3H09 A;  3TP8 A;  3I73 A;  5EKI A;  1V1P B;  3PO2 B;  2F0T A;  3KF8 A;  1SND A;  1MD2 D;  4A3F B;  1I6H B;  4IUQ A;  5BN5 A;  1PZJ D;  4OL7 A;  3DEO A;  4G7O C;  1U4P A;  2B8F A;  1LLR D;  1STB A;  2Z8L A;  4KY5 A;  4PMW A;  3SE0 A;  1A6X A;  4NW2 A;  2HDM A;  1B4O A;  1MGS A;  2RVL A;  3DWP A;  1DJR D;  1IYV A;  2A69 D;  2JSO A;  1JOQ A;  5G3L F;  3S2D B;  5LL6 X;  3TSS A;  4DNR B;  4XYQ A;  2HUG A;  5E1F A;  2NZ1 D;  2NWG A;  3QJY A;  1NUC A;  5JEA G;  5KGU A;  4J6H A;  1B3A A;  1EL0 A;  1F77 A;  1TY2 A;  5EKK A;  1LAB A;  1Z47 A;  4EQP A;  2E75 C;  3BDO A;  4XDX A;  1HHV A;  4IFD I;  2Q8I B;  1SNP A;  2K04 A;  2D5D A;  3LWE A;  1STG A;  4XT3 B;  3NBH A;  3PMF A;  5JEA J;  3V2T A;  2KOL A;  1OXU A;  3GTG B;  3D31 A;  3S1N B;  1EY4 A;  3HZX A;  5KND A;  3J7A F;  2TMP A;  2RBM A;  4IUV A;  4O42 A;  1STA A;  2ICI A;  1LT6 D;  4DN4 M;  5JJZ A;  1YNJ C;  3C46 A;  4IUN A;  1BUV T;  3K5O A;  1K83 B;  3S9W A;  3OOC A;  4IZ8 A;  2K01 A;  3K5L A;  3D4D A;  2E74 C;  4E6I A;  3RD4 A;  2Z1C A;  4CKB A;  1SAP A;  1NR4 A;  5C44 B;  2F03 A;  1LTG D;  5JOB A;  2MP1 A;  3KUP A;  3RMH A;  3DXJ C;  4RKB A;  2F0F A;  5M3F B;  1BBX C;  3L9A X;  1FNU A;  1OXX K;  1C4Q A;  2RSO A;  4OGQ C;  2F0H A;  1STH A;  4OO1 G;  3I90 A;  1HA5 A;  2QKI C;  3U9S A;  5C5L A;  2J7Z A;  1U4R A;  2F0L A;  5TSS A;  4K6L A;  2OXP A;  1X3P A;  2FIN B;  5ELE A;  3HRZ C;  4R9W A;  3DWQ A;  1SMY D;  3K5M A;  4RCN A;  1E0B A;  3VYT A;  3K6O A;  1PLF A;  3DEP A;  4H44 C;  3GO5 A;  5FLX E;  1SFO B;  1ILP A;  1SBB B;  4HSV A;  5I4D A;  2EY5 A;  1MBY A;  3IFD A;  5K36 H;  1KDC A;  1KLU D;  3D4W A;  4TRD A;  2AWO A;  2BA0 A;  4LMQ D;  1BF4 A;  1CQF A;  4XXE A;  2FHT A;  1RTN A;  2R61 A;  4NP5 A;  4RH6 A;  3PUW A;  4QUC A;  2AQ1 B;  3RUZ A;  3GTJ B;  1DZ1 A;  2N55 A;  3OHX C;  3G6J B;  3GQB A;  1DXM A;  2PZT A;  4BS9 A;  4A3G B;  2NVQ B;  5J1Z A;  2WKC A;  4BWG B;  2O4X A;  3TP7 A;  1TVX A;  4NMZ A;  1A2T A;  4IQZ A;  2RDG A;  1SNO A;  5HGT A;  2B63 B;  1LTB D;  3FPP A;  3F2U A;  2LKV A;  1BNZ A;  3T13 A;  1QE6 A;  1HTL D;  5M3M B;  2A68 D;  3KLR A;  1X3Q A;  3SEB A;  4HSP A;  1IW7 D;  1TWG B;  3ERQ A;  4N9T A;  3M7G A;  3A56 A;  1STN A;  4OO1 I;  2H1E A;  1ZEQ X;  2K7V A;  1NSN S;  3VYU A;  1DON A;  2CW0 C;  2QIL A;  4DK0 A;  3S1M B;  4A3K B;  1J8I A;  1ZXT A;  5FO8 B;  5C4X B;  3FKI B;  1CK1 A;  2AUK A;  3HG9 A;  2F0P A;  1TWA B;  1Q12 A;  2AQ2 B;  5CBE E;  3T16 A;  4F8M A;  4XQJ A;  1EIH A;  1ESR A;  3GTK B;  1QJO A;  3UI2 A;  3M3Y B;  1FR3 A;  1SNC A;  2NTS A;  3MC0 B;  2VNU D;  1S5E D;  1ROD A;  1SNQ A;  2FJ2 A;  1EU4 A;  2IX0 A;  5E4W C;  4HCE A;  4WOR A;  4KN4 C;  4I7Z C;  1M8A A;  1A3U A;  1B2T A;  3OIP A;  3SXH A;  4G7H C;  2C5C A;  1WVL A;  1DM0 B;  1RJT A;  2AWN A;  3J81 E;  1QCB D;  1AN8 A;  2L1B A;  3A8K E;  5FO9 B;  3KBX A;  1TKW B;  1Y8N B;  4QB4 A;  3GTM B;  1DYQ A;  2K6A A;  1KDA A;  1BO0 A;  4LJZ C;  4DF7 A;  2PQE A;  4X3S A;  1TS4 A;  3Q0A A;  1CT1 D;  1C8C A;  2KUM A;  2BCO A;  2XNA C;  1BDO A;  1E2W A;  3DHQ A;  1VCI A;  2D9U A;  3OWE B;  2KQ3 A;  1PTO C;  4WJW A;  4U67 3;  1XWE A;  1CHQ D;  4C2M B;  2EXZ A;  4FF4 A;  4RFB A;  4H13 C;  3S16 B;  5G3L D;  3NQI A;  4BBS B;  2HQE A;  2PPB C;  4EVO A;  2DY7 A;  2PCF B;  3IFT A;  3K0Y A;  4G4K A;  3AB9 A;  3R2T A;  3J7A V;  2O2L D;  1F9S A;  2BE5 D;  4K2L A;  3MXU A;  1I6V C;  1CA6 A;  1JIC A;  1STY A;  2JA8 B;  1B50 A;  1PFB A;  2RKS A;  4FVM A;  5FOB B;  3ND8 A;  1ZYR D;  4S3S A;  1WTW A;  2F0I A;  1TU2 B;  5IOC A;  4Q0F A;  1H9S B;  3VA5 A;  3I91 A;  3NTI A;  1SXT A;  3PIP 3;  2B2Y C;  1A15 A;  4ME5 A;  4HED A;  4AYB B;  5EBD A;  1PFN A;  2B2T C;  4IN3 A;  1EWH A;  4K5W A;  2K5D A;  1QOH A;  1B1Z A;  1STE A;  4RGN A;  1WTP A;  1RD9 D;  5IIF A;  1AFP A;  1ML0 D;  1YNJ D;  3KK7 A;  1GUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...