5JAVA

Crystal structure of staphylococcal nuclease variant delta+phs y91d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLADIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5javA00
4K5XA 3QOLA 2F0VA 2RBMA 1SYBA 4KY6A 4DGZA 4EVOA 4KY7A 5C3WA 2NUCA 1EY6A 1F2MA 1SNCA 5C5MA 5IODA 3D4DA 1SNDA 5DEHA 1KDCA 4ODGA 4HTHA 4PMCA 4EQNA 4PNYA 1EZ6A 2F0TA 2KQ3A 3P75A 4K2KA 3TP6A 1RKNA 2EY1A 5F2DA 5J1ZA 3EROA 3OMCA 5C4ZA 1NSNS 2F0WA 3EVQA 5CV8A 5CGKA 3PMFA 1SYGA 2EYOA 1U9RA 4F7XA 1EZ8A 4K5VA 2F0LA 3DHQA 2PQEA 1KDAA 3ERQA 5E1FA 2F3VA 3C1FA 1A2TA 4ZUJA 5JOBA 3RUZA 2SNSA 4RKBA 1II3A 1NUCA 2M00A 5DAUA 2F0HA 3NQTA 2EYMA 5IGDA 2F0QA 1KABA 2SNMA 4G57A 3TP5A 3OWFA 4KJOA 4ME5A 3SK4A 5M9OA 2F0EA 2F0OA 2EXZA 1ENAA 2HQEA 4IUNA 3SK6A 5KGUA 4NKLA 4EQPA 5IGFA 3MVVA 2LKVA 2OF1A 4PMBA 1KDBA 2KHSA 4HMJA 1SYEA 1A3UA 3V2TA 4B9WA 1KAAA 1SNOA 1SNMA 2QDBA 4YIJA 1F2ZA 5ISRA 5I9PA 1SYDA 1IHZA 1EYAA 4KHVA 5EKLA 4I65A 4F8MA 2F0MA 2WACA 2PZUA 3TP8A 5KRUA 1JOQA 3NP8A 1JORA 3DMUA 2RDFA 2F0UA 3VA5A 4N9TA 4KD3A 3SR1A 2F0FA 2O4XA 2PW5A 2PW7A 1STBA 3H6MA 3MXPA 4WORA 3P1HA 3NXWA 4KD4A 5I6WA 2F0NA 5KIXA 1SNQA 5HGTA 5CV6A 3OMGA 2F0JA 4IZ8A 2EYPA 2F0GA 4EQOA 3HEJA 4ZUIA 1JOOA 1A3TA 3LX0A 5EKKA 3QOJA 3TP7A 3D4WA 4KV6A 1TR5A 5E3FA 5IGCA 2EY5A 1EQVA 2EY2A 2OEOA 1TQOA 3BDLA 3NK9A 1AEXA 5CV9A 4HMIA 4OL7A 3SHLA 1EY0A 3E5SA 5CV7A 3MHBA 5J22A 3EJIA 5C6AA 3MZ5A 5IIFA 3SK5A 4QF4A 2RKSA 2F0PA 3T16A 2EYFA 4J6HA 3D8GA 2OXPA 2F0IA 3QB3A 3U9OA 5J39A 4DU9A 5I6YA 1STHA 2EYJA 2PZTA 4TRDA 4DF7A 1A2UA 1STGA 4R8NA 5KYIA 3SXHA 2PZWA 4RKLA 4E6IA 5HURA 4DFAA 4KY5A 1EY7A 4NDXA 1SNPA 4K5WA 1EY8A 2EYLA 4MIUA 4K2LA 5C4HA 1EY5A 5EGTA 1A3VA 2F0SA 3TMEA 4IALA 1F2YA 3OSOA 4K8JA 3MEHA 4LAAA 5C5LA 4B9XA 4K14A 5IGEA 5K5PA 1STNA 1EYCA 3C1EA 1JOKA 1STAA 2SOBA 3NUCA 1STYA 2EY6A 4KTAA 5CV4A 5C3XA 5IOCA 5KYLA 3D6CA 3BDCA 4H7BA 4ZQ3A 2ENBA 4KJNA 2PYKA 4N9PA 5KEEA 4S3SA 2F0KA 5I9OA 5CC4A 5CV5A 4J1MA 2EYHA 1EY9A 1ENCA 4QMGA 2F3WA 5CR3A 1EYDA 1SYFA 3T13A 3R3OA 5NUCA 4WRDA 4K8IA 1SYCA 3ITPA 1TT2A 4K6DA 3HZXA 4NMZA 5JAVA 3SK8A 3S9WA 5IGBA 1EY4A 3NHHA 4QB4A 4ID6A 5IGGA 4NP5A 2F0DA
chains in the Genus database with same CATH superfamily
1KRSA 4IOAA 3CC2A 2A5HA 2F0VA 3GTMB 1TY2A 1Y14B 1YNJD 1F9PA 1E2ZA 3N6RA 4EQNA 3W5OA 1PZKD 2ID0A 1I6HH 1CI3M 1F9SA 4LFAL 2K6AA 5C4ZA 3CMAA 3S1MB 1QB5D 1SYGA 4C3HB 1PTOF 4R9WA 4NB3A 4ZUJA 3S1NB 3PCOB 5E1FA 2DNEA 4HIKA 3A55A 2ZJQA 5DAUA 2PQAA 2F0HA 5IT9c 2KBNA 1ESRA 4G57A 3TP5A 1TWFB 4JG2A 1Y69U 1VMCA 4GN3B 3ULJA 5A2QL 2UUAQ 4B3ML 4MTNA 2JA5B 2OTJA 1KAAA 4L6TB 1TWHH 1EQRA 2MHVA 4DUYQ 3VYTA 2YU9B 2DY8A 3Q23A 5FO9B 1PH1A 2BH8A 3OW7A 1CHQD 1SE2A 5C3EB 1PMRA 3GTLB 3NBIA 1LACA 1EFWA 2K5DA 1L1OB 1LABA 2BOSA 3I56A 3G6EA 3VR4A 4LF9L 1HNXQ 4A3GH 1GJXA 1AN8A 4LUZA 2EJFC 3OHXC 4OX9L 4B3MQ 3H15A 1SROA 1C7YA 2SEBD 4C3JG 2XRSD 3FMCA 2D62A 1VQBA 5C6AA 3E3XA 2F0PA 4QUFA 1RCVD 1ASZA 4OWTB 1UEBA 1Z7TA 1VQPA 5M5XB 3SXHA 2RSOA 5EQ0A 5JJKA 5ELOA 2B2UA 4UAIA 4JCVE 1EY8A 5C4HA 3H3VC 1HNXL 3A7AB 4BBRB 1S72A 1N32Q 4PG3A 5K5PA 3J80L 1STNA 4XT1B 1IBLQ 4O1NA 4H7BA 4A3FH 4GNXC 2FHTA 2QEJC 1DM0B 3IL8A 4V0BA 2B2UC 2WAQE 5NUCA 4IFDJ 3ND8A 1L0XB 3BVMA 2ICIA 4IFDH 1H9KA 4DAMA 1KLUD 1XPUA 1V43A 4DV2L 1QG7A 1PRTB 2Z1CA 4UP7A 2CFMA 4HTHA 4PNYA 3T1HL 3J81L 1TIID 3V05A 2Q8RE 4Y52H 1P8LA 2F0WA 2C9OA 2RA4A 1JJGA 3KJOA 1EZ8A 3S17H 1CKNB 1VQEA 3C1FA 4POGA 1CUKA 1QE6A 3K7AB 4RKBA 4C1NI 3G6JB 5IE8A 2F0QA 1KABA 4FYDA 3I4NG 3SK6A 1W6KA 2R7FA 1D2BA 3S1RB 1NR4A 3QIAA 2Z4IA 1HZ9A 2HDMA 2K75A 2E2IB 4DUYL 2B63B 3TRZA 2F0MA 1XWEA 4CKCA 3NTHA 4DR1Q 2L1BA 5DNFA 3CW2C 1S5ED 2XTIA 4YCWA 1HCZA 2XWBB 1B3QA 1M4VA 1J6QA 3PO3G 4LWCA 4GLAC 4IJLA 3S15H 5EBCA 1K8MA 4EQOA 1OTCA 2VQEQ 3LX0A 2F4VL 2EIFA 1K83H 2G9HD 4KV6A 4GKKQ 1WTWA 1AEXA 3GTOB 5M3FB 4R4TA 1WCMG 5CORA 1CSPA 2EZVA 1SAPA 2HCCA 2OXPA 3LWEA 5I6YA 3IFTA 2JEBI 4DNIA 1B1ZA 3EFXD 1KC8C 1PVOA 4DFAA 5DM63 3DM3A 1JE4A 4RGTA 2G5DA 1EY5A 4EX5A 1E1TA 4HCSA 3A5UA 1IYVA 1A3VA 2NWGA 4LMQD 2F03A 2V4DA 2KHJA 3MEHA 3QO2A 3M4PA 3S14B 1N32L 1XNRQ 1GUWA 5IOCA 1N33L 2Q2UA 2IHEA 1IBLL 3D6CA 4ZQ3A 3BZCA 3QR8A 1PH2A 5CC4A 1MSHA 2K01A 2MNAA 3GTQB 1PYBA 3B6YA 3A0JA 4K8IA 5H1SE 1Q82C 4MZ9A 2UUBL 2Q2TA 4ID6A 5IGGA 2K1BA 4DV4L 4AQYL 1TWGH 4GLVB 4DGZA 4KY6A 1SYBA 2K05A 1LT4D 2NUCA 1F2MA 1KDCA 2A68D 5JAVA 4QGUA 2UXBQ 1EU4A 1NSNS 2H4OA 2HIXA 3D0FA 1PH7A 2F1MA 1VQHA 2F0LA 3CQZH 3GQBA 3TSSA 2NTSA 2M2LA 4B3TQ 4NXMQ 1KTKA 1TY0A 1GUTA 5FLMH 1KIXA 3Q0AA 4DAVA 1UWVA 1MJEA 2RF4A 3NTKA 4AQYQ 4DXGA 5IP7H 1KDBA 3KF8B 4A3FG 2MUYA 1EWIA 4B9WA 1FNVA 2RCNA 4JI1Q 3LNNA 2N78A 4BWGB 4ZYSA 3TN2A 4Y7NB 1AE3A 3FPPA 5EPLA 4BXXG 2I5MX 4KKSA 4HJ8A 1BR9A 2L55A 1JORA 1YVCA 3MA2B 1SFOB 2B63G 1LTLA 3Q22A 4RCOA 4PZ7A 2RHQB 3WDNA 2C35B 1LUZA 2VL6A 5KIXA 3GTJH 5EJWA 4BY1G 3M85A 1DZ1A 3QOJA 4N8FA 4DV0Q 3P7JA 1EQVA 3J81c 2KOLA 2HHHL 1X3EA 1IBML 3E5SA 4A93H 1WFQA 2PI2E 3MHBA 3PO2B 4X66L 3T16A 1XNQL 1FVIA 2K5NA 1VQ9A 2LXJA 1BXTA 3UI2A 2Z0SA 5M3MG 2NVQB 1IBKQ 1RODA 1IW7D 4GOPB 1YHAA 4A3IB 1X32A 1D1IA 4M8AA 5C5LA 4K14A 1U4PA 1EYCA 3GO5A 4U68A 3KF8A 1KQSA 1STYA 5C3XA 2FFKB 5EAYA 2ENBA 4KJNA 3S2DB 1XMQL 2B39A 5CV5A 1HNZL 4QMGA 3CXCA 3EBEA 4WRDA 1Q86C 1VQCA 2MPMA 1BBWA 4LUVA 2DN8A 3DM1A 1IBKL 1B50A 1Y1VH 2QW7A 1QCBD 2AMCB 4A3EB 4F87A 1QILA 3D4DA 4BA1I 2ES2A 2LFNA 1EWCA 1MD2D 4KN7C 4FDBA 2UUAL 1E2VA 1ET9A 4RA8A 1Y1WG 2MO1A 3S1QH 1BBXC 1X6OA 4IUTA 2KHIA 3K5LA 1Y1WH 2A69C 4WFN3 1LTSD 5GAEC 4C3JB 1SSOA 1EWHA 2AKWB 2NN6I 2PO4A 4HIOA 3V2TA 1SNOA 1EYGA 2F52A 2O5JC 5ISRA 4YCVA 3HOWB 3G7LA 4FVMA 1EYAA 4F8MA 2G9DA 4JV5Q 1TS2A 1IZ6A 1NR2A 1CQFA 2WAQG 4R4CA 4HSVA 3J7AV 2OQ0A 3MXNA 1UE1A 3KJPA 4KHPQ 2E5LL 1Y8OB 3FPUB 5E4XA 1G2TA 2LY7A 4JBKA 1SNQA 3FKIH 4BS9A 4QY7A 1R9TB 2ALYB 2QA4A 1LT6D 3PGZA 4N8X1 1A3TA 1WJJA 2HCIA 3M4YA 1QVFA 3I4NB 5FLMG 1NMFA 3BDLA 1IKLA 4H13C 4CDCC 1Z6HA 2VQEL 3ND9A 1CSQA 4JW0A 2EYFA 2K28A 2D5DA 4KKUA 5ELNA 3U9OA 4JI7L 1XNQQ 1STHA 1C48A 2EYJA 5BN4A 1EIGA 3FRPB 1SJED 1I4PA 1GKHA 1I94L 3HFZB 4KY5A 1FNWA 5C0XG 2K50A 4RHSA 4GN5A 4BBRH 1FR3A 2CVRA 4Z9CB 4G7OC 2N49A 1ONLA 1WTPA 2SOBA 2GN5A 2K7VA 3NBHA 4OXPA 1PH9A 3CCMA 3HOVG 1JT8A 1PDQA 1QUQA 5C4JB 3I4MH 1JE5A 4ZLTF 1B70B 3T53B 2L5TA 2EYHA 4QL5A 3T13A 4IUVA 1SN8A 2BDOA 5EPJA 1G6PA 4KI0A 4CDFC 3HOVH 2B2WA 2UUCQ 2JXMB 4O2DA 3X3MA 2EXDA 2NN6G 1SJHD 5GROA 1MGSA 2MJ8A 4PZ8A 3E9IA 4IJHA 1X9NA 3HKZB 1VQKA 1G6ZA 1BCPC 2UUBQ 1SMXA 1OO9B 5M5WB 1SE4A 5F2DA 5M3MH 2OWOA 2E2DC 1Q3LA 2ATWA 3NTIA 1VQDA 5C4XG 4HIMA 4C3IH 3ULPA 2UXCQ 4C2MH 5M5YH 1MI2A 2NZ1D 5CMDA 1PYWD 2B3GA 3NSWA 5FJ8G 2YV5A 4AYBB 2E2HH 2I0QA 2A8VA 1J8IA 3I2ZA 4M1UB 2HD3A 1I3QB 1PH4A 4PV1C 1CA6A 2KCCA 4H44C 3KLWA 1PFBA 3S1RH 4DR4Q 2QDBA 3BYTB 4A3CG 1BCPF 1XMOL 1M1KC 5EKLA 2B63H 2XNAC 1AH9A 3TBIB 4LF4L 1G291 3HOUB 4APVA 1N36L 2NZHA 4JI1L 2Q8IB 1HJPA 4DR2Q 1GOZA 2KCMA 1DONA 2PW5A 1OXXK 3MXPA 4JI5L 2X6GA 3OOCA 1BOSA 4IZ8A 2GA4B 2D2CC 4LF6L 4FXKC 1BBUA 1IYJB 3TZUA 1LTRD 4A76A 3KOJA 4GOPC 1XPOA 2AUKA 2A6HC 2PNHA 3EJIA 1T5XD 3SDZA 1E2WA 2SDFA 1EEFD 2MFIA 2HHHQ 1I4HA 1L1OA 4BA2I 3C46A 1Z47A 5AJ3L 4X6AH 2KA7A 3W3AA 2RCFA 1MJCA 5KNDA 4K5WA 1E0BA 4JYAQ 4JK1C 5EGTA 1FJGL 4GKJL 3H09A 3T1YQ 3FP9A 1H95A 3NEMA 5D65A 3CCVA 3EA6A 1ZYRC 2PYKA 1MHWC 1AZQA 1EY9A 3Q8DA 5D14A 1GD7A 3V96A 1RD9D 3R3OA 3TEHB 2HUGA 1SYCA 3CRKC 3ITPA 1HNWL 4K6DA 1N34Q 4JI0L 3SK8A 2OTLA 4QB4A 2CQOA 3H91A 3E9HA 4K5XA 1RDPD 3ZYYX 5IODA 1TKWB 3VYRA 3URYA 1T9HA 1PLFA 4B3RQ 2JA8H 4DK6C 1GXDC 4UDUC 3PO3B 4LF8L 1U9RA 2R92H 4JOIA 3A56A 2H5XA 3DXJC 3J80E 2F3VA 3TREA 1SBBB 1IKMA 2VQFL 1CZWA 3BDOA 3M4OH 1N34L 4JI0Q 1YNND 3D31A 3DEOA 5IY0A 2VW9A 1BUVT 4UP9A 3M7GA 2QDLA 4LFBQ 2X69A 1I50B 5FLXc 3M4QA 5I9PA 4IFDG 3BJUA 4KHVA 1CKNA 2D0OA 2R93B 2PZUA 1JOQA 4K6LA 2N88A 1SFOH 1OXTA 1HXYD 4YWKA 1QZGA 1CTMA 5IYCG 1YI2A 2UU9L 4KD4A 1K3RA 1UEAB 3D4RA 1U4MA 2FINB 4IPHA 1HQMC 1PH6A 4BY1B 4DV3Q 4A3LG 1GUSA 3R2TA 3MXNB 3TP7A 2F4IA 1NTGA 2ZM6L 5IP9H 4OL7A 1VF7A 1C4QA 1PXUA 4A3JB 4DR3L 3NELA 1KHIA 2F0IA 2XIWA 4R8IA 3RNUA 2OT2A 2QF7A 1XMQQ 4I7ZC 1LLRD 2VB3X 3PUVA 4NDXA 5C44B 1S5CD 3QG1A 4R4OA 1PHJA 2K4KA 4A3IH 1FJGQ 4JBJA 1HR0L 3HOUG 3J81j 1WD1A 4TVAB 1JOKA 4RG1A 1ESFA 3NUCA 5JPMC 1S4ZA 3BDCA 3L3OC 2K5QA 2IW3A 1T5EA 2J0TD 1E22A 5BN5A 3R93A 1ML0D 1JJCB 4BBSH 4DV6Q 5IYCH 3U4ZA 2R7ZB 1HNWQ 3CKIB 3NHHA 1EQQA 4RGOS 1SLJA 4YY3Q 3QOLA 1PTOB 1NNXA 1CHPD 1DJRD 2A73B 3QJYA 4IUUA 1EZ6A 3P75A 2JA6B 2CH4W 5CGKA 2VUMH 2BDNA 2I5LX 3EQLC 5ELDA 3DHQA 2B2TC 1EL0A 3E0JA 1UE6A 2CQAA 4DV6L 1WVLA 2NB0A 3DEPA 3MFGA 4C3JH 4IFDI 3HGBA 2EJMA 1HTLD 1XTDA 4KHPL 1R4QB 2LKVA 2JA5G 1UE7A 1A0IA 5C4XH 4JC0A 3K5OA 4POFA 5JVG3 5D3IB 1KD1C 3KLRA 1F2ZA 1DYQA 3HOWH 3PF4A 1IHZA 1X54A 1QUQB 2QILA 3K7UC 4ALPA 1SE8A 3MTSA 3GTKB 2B2VA 3NWTA 4P75A 2F0FA 4G7HC 4AYBE 4RGMA 3I72A 2JQOA 3FKIB 1GUGA 1XX8A 2L11A 4DV3L 2B2YC 2ZTCA 1I94Q 2K5VA 1VQFA 3I4NH 4MNOA 5KNCA 3A8KE 1EY0A 1S40A 1CA5A 2JA9A 5CBEE 5C0XH 1BNZA 4TRDA 1STGA 1WTOA 4O42A 2B2TA 4IUQA 1ZYRD 1EY7A 2CH4A 2N8NA 4X64Q 1XYIA 3KDFA 3JAME 5GAHC 4JBMA 2IX0A 5T1IA 4MN3A 1B4OA 1CKOA 4DR7L 5BR8L 1STAA 4A3DH 3J80i 3I4MB 4OIKA 3FEWX 2CKZB 2Z4HA 3H3VH 1PZJD 3ICEA 5CR3A 1WD0A 1FNUA 3C3LA 4XT3B 2L9HA 2JSOA 4A3BB 1AZPA 1XNRL 1TS5A 3J7AF 2N3SA 1A63A 4IPCA 2K52A 1EQTA 2A74C 4J8QA 3CRLC 3HS0C 4NXNQ 5JEAH 5M3MB 1M90C 2B2YA 1BCPB 2IWHA 2TMPA 1HA6A 5IYDG 4G7ZC 3PQIA 2YYZA 1W6JA 1QZHA 4C3IB 3HOXH 3ERQA 4JI2L 3MFYA 3S1NH 4DV7L 4B3SL 2M00A 4A3MG 3HOZG 1B44D 4ME5A 1N9WA 1FGUA 1C9OA 1TWFH 5FLXE 2F0EA 2HQEA 2E74C 1HZBA 4C3IG 1I3QH 1HR0W 5LMNW 2JA5H 1SYEA 1A3UA 1V1PA 3M3YH 1FL0A 4DAYA 4JI5Q 1O7LA 1TWHB 3K5NA 4LF6Q 4I65A 1CKMA 2K32A 2WACA 2ZXRA 4KHZA 4OO1H 5ELCA 1WTHA 2BH2A 2E8GA 1OXUA 3GTLH 4YCUA 1F9RA 4RMFA 3SR1A 1PH8A 1JJ2A 3L0OA 1KNAA 5JJIA 3HKSA 5E4WC 2VXWA 3CD6A 3OMGA 5LL6S 2NTTA 2F0GA 1I4XA 5KNBA 1LM0A 1TR5A 5E3FA 3VR6A 1D6EC 1DCZA 2PQAB 4GS3A 5M3FG 4WJ4A 3SHLA 3DWPA 2BCOA 3HOZB 4BBRG 1JICA 3MZ5A 1GUNA 2MO0A 1O7IA 1YITA 2JA7H 1J9OA 3VR5A 2PZTA 2MQHA 2O5IC 2QCPX 4XQQA 3I3CA 5HURA 1YBYA 1SNPA 3O13A 3W1BA 4DK0A 2B8GA 3H94A 1IL8A 4X66Q 5IGEA 4B9XA 2QEXA 2ZTDA 5E7NA 1PV4A 2XWJB 3LGJA 3KUPA 4DR7Q 2A69D 1LTAD 5KYLA 1HR0Q 2RSNA 1ZXTA 3CCRA 1G2SA 5DM73 1JWUD 3FKIG 1ENCA 2F3WA 3GV3A 4X65L 2EVBA 5EKIA 4XQNA 4K0KQ 2ZJRA 1PFNA 3S9WA 4DA2A 1MBYA 1SEBD 2F0DA 4OGQC 3J81i 1B9MA 1E1OA 3RZDB 3C2PA 1ZEQX 1QVGA 1EY6A 4X3KA 1I4RA 1HHVA 2PNRC 1NE3A 1CQVA 1NAPA 4QUCA 1XTCD 4LFCQ 2JA8B 3OMCA 3EVQA 4AIMA 4CKEA 4JI6L 2K04A 1KL9A 1U5KA 4LJZC 4JI2Q 1K9MC 4UY8C 3K7AH 5A35A 1H9RA 4A3DG 1BKBA 4H02A 4LF9Q 3SK4A 3U9SA 3NWSA 3VDYA 3MVVA 4JVZA 1RTOA 4XIGS 3N52A 1VQ4A 4OX9Q 1Q7YC 1X55A 2AQ1B 1I50H 5I4DA 4LFCL 4A3MH 2E2IH 3R2IA 1AFPA 4KK7A 1HUMA 3F2UA 1SXTA 3BZDB 1U4LA 2I07B 3BVZA 4N9TA 4WJWA 2K33A 3PIO3 1V1OA 1EOTA 3GTPB 1SR3A 3RN2A 3S2HB 1X3FA 1GUOA 3I8ZA 2WKDA 3QWNA 3HOYG 4A3JG 3PUXA 4OIJA 1E3PA 2VY3A 4A3JH 1B9NA 1F77A 1UNSA 3RN5A 2IPKD 2ZXPA 2GVAA 3CPFA 4ZAIA 5J39A 1ENFA 3HOWG 5GQOA 4LW1A 4GNXA 4PMWA 1HQRD 4FXGC 1C8CA 1JQYD 2DUDA 1B53A 1TWAH 3OIQA 1YJ9A 5FKAC 4K8JA 4OEMB 3HKZE 1BDOA 3CCQA 1IXRA 2R7ZG 3ONAB 1D5ZC 2D9UA 4CKBA 5J3BA 4J1MA 1VQNA 1SRUA 1TU2B 1I4GA 4A3KB 4HIDA 2E2JH 4L5RC 5IP9G 1GVPA 4K0KL 3UDIA 5IWAQ 1PTOH 2NYZD 4R1JA 5C3WA 1SNCA 5IYBG 1HA5A 1U0LA 1EIFA 2KVMA 2JA6H 4BBSG 3RZOH 3G71A 4QQBX 5IP7G 4FP5D 5IYBH 2IHFA 5I2YA 2R3ZA 4HCEA 3CQZB 1HFGA 1EU3A 4YWLA 1KNEA 2FJ2A 3OPOA 5KGUA 5IGFA 5IWAL 3OW2A 5TSSA 4JV5L 3PUYA 1TXYA 3K8AA 2EOTA 1M8AA 1GHKA 2YU9H 2NVTH 2E5LQ 3VYSA 2AQ3B 3L7ZC 5C3EH 4RH6A 4JI8Q 5GAGC 1EEID 4KD3A 3LWUA 1S5FD 2WB1E 1WYDA 3P1HA 4WORA 3K5MA 1XXGA 1FYCA 2CW0D 4P74A 3GTJB 4A3GB 2EYPA 4U673 2JA7G 4RWSC 1KLGD 1HFNA 2EY5A 1ZKOA 1CFMA 3DUZA 4DR2L 4UPAA 1AP0A 1JWMD 1PRTC 2A1AA 2DGYA 4QF4A 4XYOA 4DR1L 4L63B 1I5FA 5IT9E 1A2UA 1DD2A 4LF5Q 1EFID 2WKCA 3NBHB 4MIUA 1IL2A 3KDFB 2B8FA 4V190 1F2LA 5C3EG 3DLLA 3SEBA 1L2FA 1MSGA 2XVSA 5K36H 3Q6SA 4ZRZA 4LUOA 4A3FB 2UUCL 2HIVA 3AEVA 1HZAA 1UUPA 1O80A 1K8AC 1QNUA 2VB2X 1K8GA 3K0XA 1V9PA 2L12A 5T1GA 1VQJA 2AWOA 5I2XA 3U58A 1EY4A 4RCNA 2PMZE 4EQ5A 4A3KG 1TS4A 4DV7Q 2RBMA 3FVQA 3GDEA 3FHWA 4DV2Q 1ICWA 5LL6X 5DEHA 4PMCA 1LT5D 1HUNA 2KQ3A 1Q8IA 3T1HQ 2LXKA 3IAYA 2AUJD 3MAQA 4TQUS 4K5VA 4QJFA 4DNRB 3HOXB 1KDAA 3E6ZX 1K8OA 1A2TA 4LFAQ 3PO2G 2M9VA 2N55A 4AYBG 1LTGD 1WTRA 2LSSA 1GM5A 1Z9FA 4B3RL 2Y0SE 4NKLA 2OQKA 4QCLA 2Y0SB 5G3LD 1S3OA 1ASYA 1TWCH 5LMUQ 2ZJPA 3KF6A 1OXSC 3HP3A 1H9MA 3IFDA 1SNMA 4L5SA 3RD4A 1VF5C 3KYHC 2RVLA 1VS0A 2EE1A 3JAMc 1MIUA 3I7FA 1NY4A 1RF2D 5A2QE 3CU7A 2WB1B 2ASBA 3A8IE 4CJ2C 1JC7A 4B3TL 4NXML 4LFBL 1D8LA 1K3BC 2YTVA 2HQLA 3IKJA 2L0CA 2PMZB 3CF5A 4ABNA 1R9TH 3R8BA 1PH5A 4B08A 1JR0D 3HEJA 1L0WA 1D5XC 4X3TA 1YJNA 1PA6A 1K83B 3CHBD 3GTGB 3CCEA 2JJQA 2EY2A 1GHJA 1O7ZA 1VMPA 1BO0A 3J7ZC 5M3FH 5J22A 4OONA 1QVCA 1X56A 5JVH3 1ET6A 1KAWA 4JYAL 2JA7B 4WJ3M 5KYIA 4PZ6A 4DV5Q 1X3GA 2A6HD 3I73A 3E0EA 4DK1A 4X65Q 3H0GB 1NCVA 1ILQA 1WI5A 1F2YA 4BY7B 4P72A 4IURA 3S14H 1EIYB 4AH6A 5FJ8H 3C1EA 4DAPA 3KF6B 5ELFA 3Q24A 3EIVA 3I4OA 3PUZA 1N33Q 5C4JH 1IBMQ 3RMHA 1DOLA 1CM9A 3UE1A 1Y8PB 1SYFA 4X3UA 2IX1A 1LT3D 3GTQH 2IX3A 1VQ6A 3NPPA 5IGBA 4DV5L 4KY7A 2JE6I 4CDEC 1K28A 1V1PB 3A5ZB 2J7ZA 3VR2A 2UXBL 4HEDA 4F7XA 2VQFQ 1LYLA 1PRTF 5G3LF 2RDHA 3STBC 4O0AA 2UXCL 1HNZQ 1FGBD 4C2MB 5M5YB 3K0YA 2JN4A 4YY3L 4DPGA 1TVXA 3ER0A 4A4IA 5ELBA 1HTPA 1TS3A 1SMYD 3U4VA 3GD7A 2OF1A 3F2BA 4HMJA 3DWQA 4ME3A 4ULLA 1IW7C 2KEEA 2DNCA 1LTTD 3I55A 1O7YA 3KLSA 4IUPA 4A3MB 1AE2A 2CW0C 2KJXA 2B2WC 3HOUH 1D1KA 1GO3E 1VCIA 2RDFA 2QGQA 2JYOA 4DR6Q 3NE5B 1K73C 1H9SB 1VQGA 1BCPD 2NVXH 4JI4Q 4JI8L 3GTPH 5FOBB 2ZM6Q 2RHSB 4Q0FA 5COYA 4HJ9A 3NQIA 3RR5A 4DR3Q 3S2HH 4XYQA 2NN6H 4DV0L 1TQOA 5CV9A 3T4AC 2A6EC 4J15A 1CK1A 4A93B 2F4VQ 3PO2H 3SVMA 3SK5A 3D8GA 1Q90A 4A3LH 4R4QA 5AJ3Q 5C0XJ 4HN7A 2CHBD 2PZWA 5HGQA 1Y8NB 1Q46A 1A15A 1VDZA 1SDFA 1YJWA 2L4NA 2HDLA 1TWAB 1PRTD 2F0SA 4RAUC 4LK1C 1J5EL 1E7ZA 1U4RA 1YNXA 4R4IA 1R4PB 2EY6A 2VZAA 4DXFA 4N9PA 2Z6KA 2Q8TA 2VNUD 3JAML 3P20A 4RHRA 1W2BA 3MXGA 1A6XA 1EYDA 2BE5D 4CBVA 2WAQB 1W3SA 1X65A 2KECA 3TS0A 5C0XI 1VQMA 2EJGC 2E2JB 4NMZA 5K36G 2R7DA 5LHY1 4FF4A 3CC7A 4ZKCB 1Y1VB 4JBWA 4A3EH 3F1ZA 1J5EQ 3K58A 3G48A 3PO3H 3J7YW 3S16B 4FF3A 2AHOB 5CV8A 3RZOB 1XJVA 4HAEA 1H9SA 2R61A 4LF4Q 3S1QB 3H3VI 1Y1WB 2X6LA 2XRQD 3HOYB 5IGDA 1LTID 3D3RA 3OWFA 2EQSA 1ENAA 2F0OA 3VR3A 4NXNL 3KBXA 3K80C 5ELEA 4EQPA 3TDQA 1DOKA 5JPNC 4PMBA 3BU2A 3J80c 1VQIA 5FK9C 3WOEA 1SYDA 2IJ0A 4B3SQ 2AWNA 5LMUL 2NVTB 3J7A5 2R93H 4GKKL 3NP8A 4DK3C 3PSIA 1G51A 3I90A 3VA5A 1PFMA 5CYUA 2UU9Q 2WV6D 2PW7A 1STBA 2JK8A 4JI4L 1G91A 5HGTA 5CV6A 4BY1H 2QKIC 2KEDA 1DGSA 1Y1VG 4IPGA 1JCKB 2V1CC 2JP1A 3BYYB 4DKAC 3D4WA 4DR5Q 2LS01 1V8QA 2OEOA 1WCMB 2F3IA 4HMIA 1YNNC 1XMOQ 4TKOB 5IIFA 3SGIA 3QB3A 5C44G 1N36Q 4DF7A 3L2PA 5IT9L 3TS2A 2JA6G 3KK7A 4RKLA 3J81E 1YHQA 3DWAA 1X3PA 5FO7B 4K2LA 1PTOD 1NJIC 3TMEA 1VQ8A 1HRJA 4I7AA 5EBDA 3T51B 1L0YB 4DV4Q 1I6VC 5CV4A 4CGYB 4CJ1B 4FF2A 1AW7A 1Q8KA 4A3CH 4X62Q 1SE3A 3HOVB 2K5WA 2NVYH 4YHHL 2KUMA 4BBSB 4A75A 3CP0A 3VYUA 4CDDC 4A3BG 3KBGA 2DY7A 2L15A 5FO8B 2R7ZH 1RHPA 4KTAA 4NP5A 1UE5A 2WB1G 1RL2A 3GTMH 5C5MA 4GKJQ 2R92G 3CPWA 5M5WH 5GADC 4K2KA 3FDTA 4C56C 1I6HB 4LNQA 2AQ2B 2JA8G 3S1MH 4IPDA 1SMYC 2EYOA 3CCLA 3BG3A 4C3HH 4BY7G 1WTQA 2CCZA 3AYHB 1LV9A 3A7LA 4X62L 1NUCA 2WINB 2Z8LA 1F9QA 4IOCA 2SNMA 2E2HB 4GLXA 3A8JE 3PIP3 1TWCB 5C4XB 2YTXA 4ZK9B 3IRBA 3OIPA 3UDFA 1YIJA 2UXDL 1B8AA 4GN4B 2K5HA 1EOVA 3WWVA 5KRUA 3CC4A 3GTKH 1E24A 1YZ6A 1Q81C 1JMCA 2F0UA 2A68C 4ILWA 3G4SA 2ICEC 3NXWA 2I46A 2B2VC 2KCTA 2WP8J 1JOOA 5EKKA 1CZGA 1H9JA 3GTGH 5IGCA 1C0AA 1PH3A 2E75C 3W1GA 3T56B 3NK9A 1LTBD 3U50C 4IO9A 3H0GG 3AU7A 4DUZQ 2NZOA 5DLQE 4J6HA 4YWMA 2WFWA 1VQAA 2VS1A 2ZXOA 1A62A 4P2CB 2WIIB 5M5XH 4E6IA 1RTNA 2BA0A 2J4XA 4OHJA 5AFWA 4CJ0B 2NBFA 5D3DA 4JI7Q 2EYLA 3OWEB 3H0GH 5LMNL 4DV1L 2Y0SG 2Q2IA 2RQXA 3BZKA 1QNKA 4LAAA 1WOCA 4C3HG 4BY7H 3BVGA 3AMUA 4DAYB 3JAMi 4GNXB 4ZKBB 2DJFC 2IT1A 3JC66 4A3DB 3L9AX 4H0LC 3I4LA 1X3QA 4S3SA 4OWXB 1YNJC 3X3NA 4A3EG 4FXDA 1P16A 3CMEA 2A19A 3A54A 3I91A 1TT2A 2K14A 1PZID 4A3BH 3GP7A 4Q5VA 5L37A 4DN4M 1KRTA 3AFPA 4RGNA 1WTXA 1OXVA 4EVOA 2B29A 3CCUA 3SE0A 4IN3A 5LMNQ 1XPRA 4DV1Q 1SNDA 2HT1A 2VUMG 4XQJA 4NPSA 1LO5D 3TP6A 1RKNA 2EY1A 5J1ZA 4UHVA 4OELB 1QOHA 4L8JA 1QJOA 1BF4A 2R92B 3S17B 3K57A 3OTOL 2MP1A 4HJ7A 1B7YB 4HJ5A 3VA7A 1K0RA 3NQTA 3M4OB 1DOMA 2EXZA 2K03A 2I5HA 4DR6L 1PYSB 1G8ZD 1VQ5A 1I4QA 4F88A 1MKHA 1KXLA 3M3YB 4XTCS 4YIJA 4UP8A 3PF5A 3UDGA 3BS1A 4A3IG 4MHEA 4X3SA 4ZCKA 1NMGA 2XN9C 1UAPA 4JOIC 5HY6A 3H6MA 4DNTB 2PI2A 4MTKA 2NVXB 3PUWA 2FXQA 4C1NK 2F0JA 3S15B 4A3GG 1FD7D 2R93G 4XDXA 1JB3A 4A93G 2Q2HA 3GTOH 4JI3Q 3GV6A 1D5MC 1YHBA 4TSSA 5CV7A 3HOZH 1PTOC 4DR5L 2RKSA 1Q12A 1HPCA 4FF1A 3NENA 4DU9A 1A8VA 3CCJA 1NBWA 4XXEA 1RJTA 5C44H 2PCFB 3AQQA 3KFUA 4CHTB 1STEA 3K81C 1Q1BA 3AFQA 3M7NA 2JEAI 2BA1A 4FNFA 2CWAA 5FLXL 3ULLA 3S24A 2DJGC 4KN4C 5CBAE 3MC0B 2XSCA 4L5TA 3T1YL 2IL8A 4JI3L 3WOFA 5I9OA 4LF5L 3W2DA 3MXUA 2Z6BA 3PIOA 1VQLA 4KKTA 1JB7A 3HKZG 2IY5B 2GVBA 4OO1G 2C5CA 3K59A 1VQOA 4HR7B 3F8TA 2OCEA 3D6WA 1PFSA 3HZXA 4JPBW 3I70A 1DXMA 1TWGB 2A6ED 3RZDH 4X64L 2RDGA 4HSPA 1ILPA 4ODGA 1YEZA 2F0TA 5KEEA 5JJLA 5BR8Q 4JI6Q 3EROA 3RLFA 3S16H 1HZCA 1IYUA 4NW2A 3PV0A 3EN2A 3PMFA 3ZJYC 2E76C 4OO1I 2VUMB 2R6GA 2LMCB 2PPBC 1Q1EA 2PQEA 2ZTEA 2XGTA 5JOBA 3F2CA 4DR4L 1JWSD 3OTOQ 4PQXA 2SNSA 2TSSA 1II3A 3RUZA 3HOXG 1ICFB 1CT1D 1RIPA 2EDGA 4LF7L 3HOYH 5IYDH 4EGVA 2EYMA 5M9OA 4KJOA 4IQZA 1BVSA 3ERSX 4IUNA 5JEAG 3A74A 3RLNA 1B3AA 2KENA 2KHSA 3I4MG 1WTVA 2Z6KC 4L5QA 2BE5C 1S5BD 1EUJA 3UDXA 4GZYC 4Y7NH 3PIPA 2P5ZX 1D7QA 4FO2A 3TP8A 2KCNA 3DMUA 2UXDQ 3CAMA 1HH2P 2O4XA 3TZDA 4LF7Q 4RFBA 5I6WA 3AB9A 2F0NA 2MGSA 3F2DA 3OYYA 1S5DD 2YTYA 2EPBA 1V1QA 2D0PA 4P71A 4ZUIA 1O78A 2H1EA 3CCSA 4QIWE 1WCMH 4KMUC 3HRZC 2ZT9C 4GOPA 3MEFA 3K6OA 5EPKA 2FMCA 2Z9HA 3TQYA 4QIWB 2NVQH 4R8NA 4DUZL 3RLOA 5JEAJ 1BQQT 1L1OC 1N8RC 5BN3A 4YHHQ 1EIHA 4IALA 3STBD 3OSOA 4OWWB 1QWYA 4BXXH 2CWPA 4KLKA 3MWYW 4G4KA 4P73A 3S2DH 2F0KA 3M9BA 3UE0A 1K0SA 3KLSX 1VQ7A 3HG9A 2NVYB 4A3KH 4LF8Q 1B2TA 2FMMA 5JJZA 4HJAA 2O2LD
chains in the Genus database with same CATH topology
2A5HA 2F0VA 3GTMB 1TY2A 1YNJD 1F9PA 1E2ZA 3N6RA 4EQNA 1PZKD 2ID0A 1CI3M 1F9SA 2K6AA 5C4ZA 3S1MB 1QB5D 1SYGA 4C3HB 1PTOF 4R9WA 4ZUJA 3S1NB 5E1FA 2DNEA 3A55A 5DAUA 2F0HA 1ESRA 4G57A 3TP5A 1TWFB 1Y69U 1VMCA 5A2QL 2JA5B 1KAAA 4L6TB 2MHVA 3VYTA 2YU9B 2DY8A 3Q23A 5FO9B 3OW7A 1CHQD 1SE2A 5C3EB 1PMRA 3GTLB 3NBIA 1LACA 2K5DA 1LABA 2BOSA 3VR4A 1GJXA 1AN8A 2EJFC 3OHXC 2SEBD 4C3JG 2XRSD 3FMCA 2D62A 5C6AA 2F0PA 4QUFA 1RCVD 1Z7TA 5M5XB 3SXHA 2RSOA 5EQ0A 2B2UA 4UAIA 1EY8A 5C4HA 3H3VC 3A7AB 4BBRB 5K5PA 3J80L 1STNA 4XT1B 4O1NA 4H7BA 2FHTA 2QEJC 1DM0B 3IL8A 4V0BA 2B2UC 5NUCA 4IFDJ 3ND8A 1L0XB 3BVMA 2ICIA 4IFDH 1H9KA 1KLUD 1V43A 1QG7A 1PRTB 2Z1CA 4HTHA 4PNYA 3J81L 1TIID 3V05A 2Q8RE 2F0WA 2C9OA 2RA4A 1EZ8A 3C1FA 1QE6A 3K7AB 4RKBA 4C1NI 3G6JB 2F0QA 1KABA 4FYDA 3SK6A 1W6KA 1D2BA 3S1RB 1NR4A 3QIAA 2Z4IA 2HDMA 2E2IB 2B63B 2F0MA 1XWEA 4CKCA 3NTHA 2L1BA 5DNFA 1S5ED 1HCZA 2XWBB 1M4VA 5EBCA 1K8MA 4EQOA 3LX0A 2G9HD 4KV6A 1WTWA 1AEXA 3GTOB 5M3FB 5CORA 2EZVA 1SAPA 2HCCA 2OXPA 3LWEA 5I6YA 3IFTA 2JEBI 1B1ZA 3EFXD 4DFAA 5DM63 4RGTA 1JE4A 1EY5A 4HCSA 1IYVA 1A3VA 2NWGA 4LMQD 2F03A 2V4DA 3MEHA 3QO2A 3S14B 1GUWA 5IOCA 3D6CA 4ZQ3A 5CC4A 1MSHA 2K01A 3GTQB 4K8IA 4ID6A 5IGGA 2K1BA 4DGZA 4KY6A 1SYBA 2K05A 1LT4D 2NUCA 1F2MA 1KDCA 2A68D 5JAVA 1EU4A 1NSNS 2H4OA 2F1MA 2F0LA 3GQBA 3TSSA 2NTSA 2M2LA 1KTKA 1TY0A 1GUTA 3Q0AA 4DAVA 3NTKA 4DXGA 1KDBA 2MUYA 4B9WA 1FNVA 3LNNA 4BWGB 4ZYSA 4Y7NB 3TN2A 3FPPA 5EPLA 4KKSA 1BR9A 2L55A 1JORA 3MA2B 1SFOB 3Q22A 4RCOA 3WDNA 5KIXA 5EJWA 3M85A 1DZ1A 3QOJA 3P7JA 1EQVA 2KOLA 3E5SA 3MHBA 3PO2B 3T16A 1BXTA 3UI2A 2NVQB 1RODA 1IW7D 4A3IB 1X32A 1D1IA 4M8AA 5C5LA 4K14A 1U4PA 1EYCA 3GO5A 4U68A 3KF8A 1STYA 5C3XA 2FFKB 2ENBA 4KJNA 3S2DB 2B39A 5CV5A 4QMGA 4WRDA 2MPMA 2DN8A 3DM1A 1B50A 1QCBD 4A3EB 4F87A 1QILA 3D4DA 4BA1I 2LFNA 1EWCA 1MD2D 4KN7C 1E2VA 1ET9A 4RA8A 1BBXC 4IUTA 3K5LA 2A69C 4WFN3 1LTSD 4C3JB 1SSOA 1EWHA 2NN6I 2PO4A 3V2TA 1SNOA 2O5JC 5ISRA 3HOWB 3G7LA 4FVMA 1EYAA 4F8MA 2G9DA 1TS2A 1NR2A 1CQFA 4HSVA 3J7AV 3MXNA 1Y8OB 3FPUB 5E4XA 1G2TA 2LY7A 1SNQA 4BS9A 1R9TB 1LT6D 1A3TA 2HCIA 3M4YA 3I4NB 3BDLA 1IKLA 4H13C 1Z6HA 3ND9A 2EYFA 2K28A 2D5DA 4KKUA 3U9OA 1STHA 1C48A 2EYJA 5BN4A 1EIGA 3FRPB 1SJED 1I4PA 4KY5A 1FNWA 5C0XG 4RHSA 1FR3A 2CVRA 4Z9CB 4G7OC 1ONLA 1WTPA 2SOBA 2K7VA 3NBHA 1PDQA 5C4JB 4ZLTF 3T53B 2L5TA 3T13A 2EYHA 4IUVA 2BDOA 5EPJA 4KI0A 2B2WA 2JXMB 3X3MA 2NN6G 1SJHD 1MGSA 2MJ8A 3HKZB 1G6ZA 1BCPC 1OO9B 5M5WB 1SE4A 5F2DA 2E2DC 1Q3LA 3NTIA 1MI2A 2NZ1D 5CMDA 1PYWD 3NSWA 4AYBB 1J8IA 4M1UB 1I3QB 1CA6A 4PV1C 2KCCA 4H44C 1PFBA 2QDBA 3BYTB 1BCPF 5EKLA 2XNAC 3TBIB 1G291 3HOUB 2Q8IB 1GOZA 1DONA 2PW5A 1OXXK 3MXPA 2X6GA 3OOCA 1BOSA 4IZ8A 2GA4B 2D2CC 4FXKC 3TZUA 1LTRD 2AUKA 2A6HC 3EJIA 1T5XD 3SDZA 1E2WA 2SDFA 1EEFD 1I4HA 4BA2I 3C46A 1Z47A 2KA7A 3W3AA 5KNDA 4K5WA 1E0BA 4JK1C 5EGTA 3H09A 5D65A 3EA6A 1ZYRC 2PYKA 1AZQA 1EY9A 5D14A 3V96A 1RD9D 3R3OA 2HUGA 1SYCA 3CRKC 3ITPA 4K6DA 3SK8A 4QB4A 3H91A 4K5XA 1RDPD 3ZYYX 5IODA 1TKWB 3VYRA 3URYA 1PLFA 1GXDC 4UDUC 3PO3B 1U9RA 3A56A 3DXJC 3J80E 2F3VA 1SBBB 1IKMA 1CZWA 3BDOA 1YNND 3D31A 3DEOA 1BUVT 3M7GA 2X69A 1I50B 5I9PA 4IFDG 4KHVA 2R93B 2PZUA 1JOQA 4K6LA 2N88A 1OXTA 1HXYD 1CTMA 4KD4A 1UEAB 3D4RA 1U4MA 2FINB 1HQMC 4BY1B 1GUSA 3R2TA 3TP7A 2F4IA 4OL7A 1VF7A 1C4QA 1PXUA 4A3JB 2F0IA 2XIWA 4R8IA 2OT2A 2QF7A 4I7ZC 1LLRD 2VB3X 3PUVA 4NDXA 5C44B 1S5CD 3QG1A 1WD1A 1JOKA 1ESFA 3NUCA 5JPMC 1S4ZA 3BDCA 3L3OC 2K5QA 2IW3A 1T5EA 2J0TD 5BN5A 3R93A 1ML0D 2R7ZB 3CKIB 3NHHA 4RGOS 1PTOB 3QOLA 1CHPD 1DJRD 2A73B 3QJYA 4IUUA 1EZ6A 3P75A 2JA6B 5CGKA 2BDNA 3EQLC 5ELDA 3DHQA 2B2TC 1EL0A 3E0JA 2CQAA 1WVLA 2NB0A 3DEPA 3MFGA 4IFDI 3HGBA 2EJMA 1HTLD 1R4QB 2LKVA 3K5OA 5JVG3 5D3IB 3KLRA 1F2ZA 1DYQA 1IHZA 2QILA 3MTSA 3GTKB 2B2VA 3NWTA 2F0FA 4G7HC 4RGMA 3I72A 3FKIB 1GUGA 1XX8A 2L11A 2B2YC 5KNCA 3A8KE 1EY0A 1CA5A 5CBEE 5C0XH 1BNZA 4TRDA 1STGA 1WTOA 4O42A 2B2TA 4IUQA 1ZYRD 1EY7A 1XYIA 3JAME 2IX0A 5T1IA 4MN3A 1B4OA 1STAA 3I4MB 4OIKA 3FEWX 2Z4HA 1PZJD 5CR3A 1WD0A 1FNUA 3C3LA 4XT3B 2L9HA 2JSOA 4A3BB 1AZPA 1TS5A 3J7AF 4J8QA 1EQTA 2A74C 3CRLC 3HS0C 5JEAH 5M3MB 2B2YA 1BCPB 2IWHA 2TMPA 1HA6A 4G7ZC 2YYZA 1W6JA 4C3IB 3ERQA 3MFYA 2M00A 1B44D 4ME5A 5FLXE 2F0EA 2HQEA 2E74C 4C3IG 1SYEA 1A3UA 1V1PA 4DAYA 1O7LA 1TWHB 3K5NA 4I65A 2K32A 2WACA 2ZXRA 4KHZA 4OO1H 5ELCA 1OXUA 1F9RA 3SR1A 1KNAA 5E4WC 2VXWA 3OMGA 5LL6S 2NTTA 2F0GA 1I4XA 5KNBA 1TR5A 5E3FA 3VR6A 1D6EC 1DCZA 3SHLA 3DWPA 2BCOA 3HOZB 1JICA 3MZ5A 1GUNA 1J9OA 3VR5A 2PZTA 2O5IC 2QCPX 4XQQA 3I3CA 5HURA 1SNPA 3O13A 4DK0A 2B8GA 3H94A 1IL8A 5IGEA 4B9XA 2XWJB 3KUPA 2A69D 1LTAD 5KYLA 2RSNA 1ZXTA 1G2SA 5DM73 1JWUD 1ENCA 2F3WA 3GV3A 2EVBA 5EKIA 4XQNA 1PFNA 3S9WA 4DA2A 1MBYA 1SEBD 2F0DA 4OGQC 1B9MA 3RZDB 3C2PA 1ZEQX 1EY6A 4X3KA 1I4RA 1HHVA 2PNRC 1CQVA 1NAPA 4QUCA 1XTCD 2JA8B 3OMCA 3EVQA 4CKEA 2K04A 4LJZC 5A35A 1H9RA 3SK4A 3U9SA 3NWSA 3MVVA 1RTOA 4XIGS 3N52A 2AQ1B 5I4DA 3R2IA 1AFPA 4KK7A 1HUMA 3F2UA 1SXTA 3BZDB 1U4LA 2I07B 3BVZA 4N9TA 4WJWA 2K33A 3PIO3 1V1OA 1EOTA 3GTPB 3S2HB 1GUOA 3I8ZA 2WKDA 3QWNA 3PUXA 4OIJA 1B9NA 1F77A 1UNSA 2IPKD 2ZXPA 4ZAIA 5J39A 1ENFA 4PMWA 1HQRD 4FXGC 1C8CA 1JQYD 1B53A 3OIQA 5FKAC 4K8JA 1BDOA 3ONAB 1D5ZC 2D9UA 4CKBA 4J1MA 1TU2B 4A3KB 1I4GA 1PTOH 2NYZD 5C3WA 1SNCA 1HA5A 2KVMA 4FP5D 5I2YA 2R3ZA 4HCEA 3CQZB 1HFGA 1EU3A 1KNEA 2FJ2A 3OPOA 5KGUA 5IGFA 5TSSA 3PUYA 2EOTA 1M8AA 1GHKA 3VYSA 2AQ3B 3L7ZC 4RH6A 1EEID 4KD3A 3LWUA 1S5FD 4WORA 3P1HA 3K5MA 1XXGA 1FYCA 2CW0D 3GTJB 4A3GB 2EYPA 4U673 4RWSC 1KLGD 1HFNA 2EY5A 1ZKOA 1CFMA 3DUZA 1AP0A 1JWMD 1PRTC 4QF4A 4XYOA 4L63B 5IT9E 1A2UA 1DD2A 1EFID 2WKCA 4MIUA 2B8FA 4V190 1F2LA 3SEBA 1MSGA 2XVSA 5K36H 3Q6SA 4ZRZA 4A3FB 1UUPA 1O80A 1QNUA 2VB2X 2L12A 5T1GA 2AWOA 5I2XA 1EY4A 4RCNA 1TS4A 2RBMA 3FVQA 1ICWA 5LL6X 5DEHA 4PMCA 1LT5D 1HUNA 2KQ3A 1Q8IA 3IAYA 2AUJD 3MAQA 4TQUS 4K5VA 4DNRB 3HOXB 1KDAA 3E6ZX 1K8OA 1A2TA 2M9VA 2N55A 1LTGD 1WTRA 4QCLA 4NKLA 2Y0SB 5G3LD 1OXSC 3HP3A 1H9MA 3IFDA 1SNMA 3RD4A 1VF5C 2RVLA 2EE1A 1RF2D 5A2QE 3CU7A 2WB1B 3A8IE 4CJ2C 1JC7A 3IKJA 2L0CA 2PMZB 4ABNA 3R8BA 4B08A 1JR0D 3HEJA 1D5XC 4X3TA 3GTGB 1K83B 3CHBD 2EY2A 1GHJA 1O7ZA 1VMPA 1BO0A 5J22A 5JVH3 1ET6A 2JA7B 5KYIA 2A6HD 3I73A 4DK1A 3H0GB 1NCVA 1ILQA 1F2YA 4BY7B 4IURA 3C1EA 4DAPA 5ELFA 3Q24A 3PUZA 3RMHA 1DOLA 1CM9A 1Y8PB 1SYFA 4X3UA 2IX1A 1LT3D 2IX3A 3NPPA 5IGBA 4KY7A 2JE6I 1V1PB 2J7ZA 3VR2A 4HEDA 4F7XA 1PRTF 5G3LF 2RDHA 1FGBD 4C2MB 5M5YB 3K0YA 1TVXA 5ELBA 1HTPA 1TS3A 1SMYD 3GD7A 2OF1A 4HMJA 3DWQA 4ULLA 1IW7C 2KEEA 2DNCA 1LTTD 1O7YA 3KLSA 4IUPA 4A3MB 2CW0C 2KJXA 2B2WC 1D1KA 1VCIA 2RDFA 2JYOA 3NE5B 1H9SB 1BCPD 5FOBB 4Q0FA 5COYA 3NQIA 4XYQA 2NN6H 1TQOA 5CV9A 3T4AC 2A6EC 1CK1A 4A93B 3SVMA 3SK5A 3D8GA 1Q90A 5C0XJ 4HN7A 2CHBD 2PZWA 1Y8NB 1A15A 1VDZA 1SDFA 2L4NA 2HDLA 1TWAB 1PRTD 2F0SA 4RAUC 4LK1C 1U4RA 1R4PB 2EY6A 4DXFA 4N9PA 2Q8TA 2VNUD 3JAML 3P20A 4RHRA 3MXGA 1A6XA 1EYDA 2BE5D 4CBVA 2WAQB 2KECA 5C0XI 2EJGC 2E2JB 4NMZA 5K36G 5LHY1 4FF4A 4ZKCB 1Y1VB 4JBWA 3K58A 3J7YW 3S16B 4FF3A 5CV8A 3RZOB 4HAEA 1H9SA 2R61A 3S1QB 1Y1WB 2X6LA 2XRQD 3HOYB 5IGDA 1LTID 3D3RA 3OWFA 2F0OA 1ENAA 3VR3A 3KBXA 5ELEA 4EQPA 3TDQA 1DOKA 5JPNC 4PMBA 5FK9C 3WOEA 1SYDA 2IJ0A 2AWNA 2NVTB 3NP8A 3I90A 3VA5A 1PFMA 5CYUA 2WV6D 2PW7A 1STBA 1G91A 5HGTA 5CV6A 2QKIC 2KEDA 1JCKB 2JP1A 3BYYB 3D4WA 2LS01 1V8QA 2OEOA 1WCMB 4HMIA 1YNNC 4TKOB 5IIFA 3QB3A 4DF7A 5IT9L 3KK7A 4RKLA 3J81E 3DWAA 1X3PA 5FO7B 4K2LA 1PTOD 3TMEA 1HRJA 5EBDA 3T51B 1L0YB 1I6VC 5CV4A 4CGYB 4CJ1B 4FF2A 1AW7A 1SE3A 3HOVB 2K5WA 4BBSB 2KUMA 3VYUA 3KBGA 2DY7A 5FO8B 1RHPA 4KTAA 4NP5A 5C5MA 4K2KA 3FDTA 4C56C 1I6HB 2AQ2B 1SMYC 2EYOA 3BG3A 1WTQA 1LV9A 3A7LA 1NUCA 2WINB 2Z8LA 1F9QA 2SNMA 2E2HB 3A8JE 3PIP3 1TWCB 5C4XB 4ZK9B 3OIPA 5KRUA 2F0UA 2A68C 4ILWA 2ICEC 3NXWA 2I46A 2B2VC 2WP8J 1JOOA 5EKKA 1CZGA 1H9JA 5IGCA 2E75C 3T56B 3NK9A 1LTBD 3AU7A 4J6HA 2ZXOA 4P2CB 2WIIB 4E6IA 1RTNA 2BA0A 2J4XA 4CJ0B 4OHJA 5AFWA 2NBFA 5D3DA 2EYLA 3OWEB 2RQXA 1QNKA 4LAAA 4C3HG 3BVGA 3AMUA 4ZKBB 2IT1A 4A3DB 3L9AX 4H0LC 3I4LA 1X3QA 4S3SA 1YNJC 3X3NA 4FXDA 3I91A 3A54A 1TT2A 1PZID 3GP7A 4Q5VA 4DN4M 4RGNA 1WTXA 1OXVA 4EVOA 3SE0A 4IN3A 1SNDA 4XQJA 1LO5D 3TP6A 1RKNA 2EY1A 5J1ZA 1QOHA 4L8JA 1QJOA 1BF4A 2R92B 3S17B 3K57A 2MP1A 3VA7A 3NQTA 3M4OB 1DOMA 2EXZA 2K03A 1G8ZD 1I4QA 4F88A 3M3YB 4XTCS 4YIJA 3BS1A 4MHEA 4X3SA 2XN9C 1UAPA 3H6MA 4DNTB 2NVXB 3PUWA 4C1NK 2F0JA 3S15B 1FD7D 4XDXA 1JB3A 3GV6A 1D5MC 4TSSA 5CV7A 1PTOC 2RKSA 1Q12A 1HPCA 4FF1A 4DU9A 4XXEA 1RJTA 2PCFB 4CHTB 1STEA 1Q1BA 3M7NA 2JEAI 2BA1A 4FNFA 5FLXL 5CBAE 4KN4C 3MC0B 2XSCA 2IL8A 3WOFA 5I9OA 3W2DA 3MXUA 4KKTA 4OO1G 2C5CA 3K59A 4HR7B 3D6WA 3HZXA 3I70A 1DXMA 1TWGB 2A6ED 2RDGA 4HSPA 1ILPA 4ODGA 2F0TA 5KEEA 3EROA 3RLFA 1IYUA 4NW2A 3PV0A 2VUMB 3PMFA 2E76C 4OO1I 2PPBC 2R6GA 2LMCB 1Q1EA 2PQEA 5JOBA 1JWSD 4PQXA 2SNSA 2TSSA 1II3A 3RUZA 1CT1D 2EDGA 4EGVA 2EYMA 5M9OA 4KJOA 4IQZA 4IUNA 5JEAG 1B3AA 2KHSA 1WTVA 2BE5C 1S5BD 4GZYC 4FO2A 3TP8A 2KCNA 3DMUA 2O4XA 3TZDA 4RFBA 5I6WA 3AB9A 2F0NA 2MGSA 1S5DD 2EPBA 4ZUIA 1O78A 2H1EA 4KMUC 3HRZC 2ZT9C 3K6OA 5EPKA 2FMCA 4QIWB 4R8NA 5JEAJ 1BQQT 5BN3A 1EIHA 4IALA 3OSOA 1QWYA 3MWYW 4G4KA 2F0KA 3KLSX 3HG9A 2NVYB 1B2TA 2FMMA 5JJZA 2O2LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5X A;  3QOL A;  2F0V A;  2RBM A;  1SYB A;  4KY6 A;  4DGZ A;  4EVO A;  4KY7 A;  5C3W A;  2NUC A;  1EY6 A;  1F2M A;  1SNC A;  5C5M A;  5IOD A;  3D4D A;  1SND A;  5DEH A;  1KDC A;  4ODG A;  4HTH A;  4PMC A;  4EQN A;  4PNY A;  1EZ6 A;  2F0T A;  2KQ3 A;  3P75 A;  4K2K A;  3TP6 A;  1RKN A;  2EY1 A;  5F2D A;  5J1Z A;  3ERO A;  3OMC A;  5C4Z A;  1NSN S;  2F0W A;  3EVQ A;  5CV8 A;  5CGK A;  3PMF A;  1SYG A;  2EYO A;  1U9R A;  4F7X A;  1EZ8 A;  4K5V A;  2F0L A;  3DHQ A;  2PQE A;  1KDA A;  3ERQ A;  5E1F A;  2F3V A;  3C1F A;  1A2T A;  4ZUJ A;  5JOB A;  3RUZ A;  2SNS A;  4RKB A;  1II3 A;  1NUC A;  2M00 A;  5DAU A;  2F0H A;  3NQT A;  2EYM A;  5IGD A;  2F0Q A;  1KAB A;  2SNM A;  4G57 A;  3TP5 A;  3OWF A;  4KJO A;  4ME5 A;  3SK4 A;  5M9O A;  2F0E A;  2F0O A;  2EXZ A;  1ENA A;  2HQE A;  4IUN A;  3SK6 A;  5KGU A;  4NKL A;  4EQP A;  5IGF A;  3MVV A;  2LKV A;  2OF1 A;  4PMB A;  1KDB A;  2KHS A;  4HMJ A;  1SYE A;  1A3U A;  3V2T A;  4B9W A;  1KAA A;  1SNO A;  1SNM A;  2QDB A;  4YIJ A;  1F2Z A;  5ISR A;  5I9P A;  1SYD A;  1IHZ A;  1EYA A;  4KHV A;  5EKL A;  4I65 A;  4F8M A;  2F0M A;  2WAC A;  2PZU A;  3TP8 A;  5KRU A;  1JOQ A;  3NP8 A;  1JOR A;  3DMU A;  2RDF A;  2F0U A;  3VA5 A;  4N9T A;  4KD3 A;  3SR1 A;  2F0F A;  2O4X A;  2PW5 A;  2PW7 A;  1STB A;  3H6M A;  3MXP A;  4WOR A;  3P1H A;  3NXW A;  4KD4 A;  5I6W A;  2F0N A;  5KIX A;  1SNQ A;  5HGT A;  5CV6 A;  3OMG A;  2F0J A;  4IZ8 A;  2EYP A;  2F0G A;  4EQO A;  3HEJ A;  4ZUI A;  1JOO A;  1A3T A;  3LX0 A;  5EKK A;  3QOJ A;  3TP7 A;  3D4W A;  4KV6 A;  1TR5 A;  5E3F A;  5IGC A;  2EY5 A;  1EQV A;  2EY2 A;  2OEO A;  1TQO A;  3BDL A;  3NK9 A;  1AEX A;  5CV9 A;  4HMI A;  4OL7 A;  3SHL A;  1EY0 A;  3E5S A;  5CV7 A;  3MHB A;  5J22 A;  3EJI A;  5C6A A;  3MZ5 A;  5IIF A;  3SK5 A;  4QF4 A;  2RKS A;  2F0P A;  3T16 A;  2EYF A;  4J6H A;  3D8G A;  2OXP A;  2F0I A;  3QB3 A;  3U9O A;  5J39 A;  4DU9 A;  5I6Y A;  1STH A;  2EYJ A;  2PZT A;  4TRD A;  4DF7 A;  1A2U A;  1STG A;  4R8N A;  5KYI A;  3SXH A;  2PZW A;  4RKL A;  4E6I A;  5HUR A;  4DFA A;  4KY5 A;  1EY7 A;  4NDX A;  1SNP A;  4K5W A;  1EY8 A;  2EYL A;  4MIU A;  4K2L A;  5C4H A;  1EY5 A;  5EGT A;  1A3V A;  2F0S A;  3TME A;  4IAL A;  1F2Y A;  3OSO A;  4K8J A;  3MEH A;  4LAA A;  5C5L A;  4B9X A;  4K14 A;  5IGE A;  5K5P A;  1STN A;  1EYC A;  3C1E A;  1JOK A;  1STA A;  2SOB A;  3NUC A;  1STY A;  2EY6 A;  4KTA A;  5CV4 A;  5C3X A;  5IOC A;  5KYL A;  3D6C A;  3BDC A;  4H7B A;  4ZQ3 A;  2ENB A;  4KJN A;  2PYK A;  4N9P A;  5KEE A;  4S3S A;  2F0K A;  5I9O A;  5CC4 A;  5CV5 A;  4J1M A;  2EYH A;  1EY9 A;  1ENC A;  4QMG A;  2F3W A;  5CR3 A;  1EYD A;  1SYF A;  3T13 A;  3R3O A;  5NUC A;  4WRD A;  4K8I A;  1SYC A;  3ITP A;  1TT2 A;  4K6D A;  3HZX A;  4NMZ A;  5JAV A;  3SK8 A;  3S9W A;  5IGB A;  1EY4 A;  3NHH A;  4QB4 A;  4ID6 A;  5IGG A;  4NP5 A;  2F0D A; 
#chains in the Genus database with same CATH topology
 1KRS A;  4IOA A;  3CC2 A;  2A5H A;  2F0V A;  3GTM B;  1TY2 A;  1Y14 B;  1YNJ D;  1F9P A;  1E2Z A;  3N6R A;  4EQN A;  3W5O A;  1PZK D;  2ID0 A;  1I6H H;  1CI3 M;  1F9S A;  4LFA L;  2K6A A;  5C4Z A;  3CMA A;  3S1M B;  1QB5 D;  1SYG A;  4C3H B;  1PTO F;  4R9W A;  4NB3 A;  4ZUJ A;  3S1N B;  3PCO B;  5E1F A;  2DNE A;  4HIK A;  3A55 A;  2ZJQ A;  5DAU A;  2PQA A;  2F0H A;  5IT9 c;  2KBN A;  1ESR A;  4G57 A;  3TP5 A;  1TWF B;  4JG2 A;  1Y69 U;  1VMC A;  4GN3 B;  3ULJ A;  5A2Q L;  2UUA Q;  4B3M L;  4MTN A;  2JA5 B;  2OTJ A;  1KAA A;  4L6T B;  1TWH H;  1EQR A;  2MHV A;  4DUY Q;  3VYT A;  2YU9 B;  2DY8 A;  3Q23 A;  5FO9 B;  1PH1 A;  2BH8 A;  3OW7 A;  1CHQ D;  1SE2 A;  5C3E B;  1PMR A;  3GTL B;  3NBI A;  1LAC A;  1EFW A;  2K5D A;  1L1O B;  1LAB A;  2BOS A;  3I56 A;  3G6E A;  3VR4 A;  4LF9 L;  1HNX Q;  4A3G H;  1GJX A;  1AN8 A;  4LUZ A;  2EJF C;  3OHX C;  4OX9 L;  4B3M Q;  3H15 A;  1SRO A;  1C7Y A;  2SEB D;  4C3J G;  2XRS D;  3FMC A;  2D62 A;  1VQB A;  5C6A A;  3E3X A;  2F0P A;  4QUF A;  1RCV D;  1ASZ A;  4OWT B;  1UEB A;  1Z7T A;  1VQP A;  5M5X B;  3SXH A;  2RSO A;  5EQ0 A;  5JJK A;  5ELO A;  2B2U A;  4UAI A;  4JCV E;  1EY8 A;  5C4H A;  3H3V C;  1HNX L;  3A7A B;  4BBR B;  1S72 A;  1N32 Q;  4PG3 A;  5K5P A;  3J80 L;  1STN A;  4XT1 B;  1IBL Q;  4O1N A;  4H7B A;  4A3F H;  4GNX C;  2FHT A;  2QEJ C;  1DM0 B;  3IL8 A;  4V0B A;  2B2U C;  2WAQ E;  5NUC A;  4IFD J;  3ND8 A;  1L0X B;  3BVM A;  2ICI A;  4IFD H;  1H9K A;  4DAM A;  1KLU D;  1XPU A;  1V43 A;  4DV2 L;  1QG7 A;  1PRT B;  2Z1C A;  4UP7 A;  2CFM A;  4HTH A;  4PNY A;  3T1H L;  3J81 L;  1TII D;  3V05 A;  2Q8R E;  4Y52 H;  1P8L A;  2F0W A;  2C9O A;  2RA4 A;  1JJG A;  3KJO A;  1EZ8 A;  3S17 H;  1CKN B;  1VQE A;  3C1F A;  4POG A;  1CUK A;  1QE6 A;  3K7A B;  4RKB A;  4C1N I;  3G6J B;  5IE8 A;  2F0Q A;  1KAB A;  4FYD A;  3I4N G;  3SK6 A;  1W6K A;  2R7F A;  1D2B A;  3S1R B;  1NR4 A;  3QIA A;  2Z4I A;  1HZ9 A;  2HDM A;  2K75 A;  2E2I B;  4DUY L;  2B63 B;  3TRZ A;  2F0M A;  1XWE A;  4CKC A;  3NTH A;  4DR1 Q;  2L1B A;  5DNF A;  3CW2 C;  1S5E D;  2XTI A;  4YCW A;  1HCZ A;  2XWB B;  1B3Q A;  1M4V A;  1J6Q A;  3PO3 G;  4LWC A;  4GLA C;  4IJL A;  3S15 H;  5EBC A;  1K8M A;  4EQO A;  1OTC A;  2VQE Q;  3LX0 A;  2F4V L;  2EIF A;  1K83 H;  2G9H D;  4KV6 A;  4GKK Q;  1WTW A;  1AEX A;  3GTO B;  5M3F B;  4R4T A;  1WCM G;  5COR A;  1CSP A;  2EZV A;  1SAP A;  2HCC A;  2OXP A;  3LWE A;  5I6Y A;  3IFT A;  2JEB I;  4DNI A;  1B1Z A;  3EFX D;  1KC8 C;  1PVO A;  4DFA A;  5DM6 3;  3DM3 A;  1JE4 A;  4RGT A;  2G5D A;  1EY5 A;  4EX5 A;  1E1T A;  4HCS A;  3A5U A;  1IYV A;  1A3V A;  2NWG A;  4LMQ D;  2F03 A;  2V4D A;  2KHJ A;  3MEH A;  3QO2 A;  3M4P A;  3S14 B;  1N32 L;  1XNR Q;  1GUW A;  5IOC A;  1N33 L;  2Q2U A;  2IHE A;  1IBL L;  3D6C A;  4ZQ3 A;  3BZC A;  3QR8 A;  1PH2 A;  5CC4 A;  1MSH A;  2K01 A;  2MNA A;  3GTQ B;  1PYB A;  3B6Y A;  3A0J A;  4K8I A;  5H1S E;  1Q82 C;  4MZ9 A;  2UUB L;  2Q2T A;  4ID6 A;  5IGG A;  2K1B A;  4DV4 L;  4AQY L;  1TWG H;  4GLV B;  4DGZ A;  4KY6 A;  1SYB A;  2K05 A;  1LT4 D;  2NUC A;  1F2M A;  1KDC A;  2A68 D;  5JAV A;  4QGU A;  2UXB Q;  1EU4 A;  1NSN S;  2H4O A;  2HIX A;  3D0F A;  1PH7 A;  2F1M A;  1VQH A;  2F0L A;  3CQZ H;  3GQB A;  3TSS A;  2NTS A;  2M2L A;  4B3T Q;  4NXM Q;  1KTK A;  1TY0 A;  1GUT A;  5FLM H;  1KIX A;  3Q0A A;  4DAV A;  1UWV A;  1MJE A;  2RF4 A;  3NTK A;  4AQY Q;  4DXG A;  5IP7 H;  1KDB A;  3KF8 B;  4A3F G;  2MUY A;  1EWI A;  4B9W A;  1FNV A;  2RCN A;  4JI1 Q;  3LNN A;  2N78 A;  4BWG B;  4ZYS A;  3TN2 A;  4Y7N B;  1AE3 A;  3FPP A;  5EPL A;  4BXX G;  2I5M X;  4KKS A;  4HJ8 A;  1BR9 A;  2L55 A;  1JOR A;  1YVC A;  3MA2 B;  1SFO B;  2B63 G;  1LTL A;  3Q22 A;  4RCO A;  4PZ7 A;  2RHQ B;  3WDN A;  2C35 B;  1LUZ A;  2VL6 A;  5KIX A;  3GTJ H;  5EJW A;  4BY1 G;  3M85 A;  1DZ1 A;  3QOJ A;  4N8F A;  4DV0 Q;  3P7J A;  1EQV A;  3J81 c;  2KOL A;  2HHH L;  1X3E A;  1IBM L;  3E5S A;  4A93 H;  1WFQ A;  2PI2 E;  3MHB A;  3PO2 B;  4X66 L;  3T16 A;  1XNQ L;  1FVI A;  2K5N A;  1VQ9 A;  2LXJ A;  1BXT A;  3UI2 A;  2Z0S A;  5M3M G;  2NVQ B;  1IBK Q;  1ROD A;  1IW7 D;  4GOP B;  1YHA A;  4A3I B;  1X32 A;  1D1I A;  4M8A A;  5C5L A;  4K14 A;  1U4P A;  1EYC A;  3GO5 A;  4U68 A;  3KF8 A;  1KQS A;  1STY A;  5C3X A;  2FFK B;  5EAY A;  2ENB A;  4KJN A;  3S2D B;  1XMQ L;  2B39 A;  5CV5 A;  1HNZ L;  4QMG A;  3CXC A;  3EBE A;  4WRD A;  1Q86 C;  1VQC A;  2MPM A;  1BBW A;  4LUV A;  2DN8 A;  3DM1 A;  1IBK L;  1B50 A;  1Y1V H;  2QW7 A;  1QCB D;  2AMC B;  4A3E B;  4F87 A;  1QIL A;  3D4D A;  4BA1 I;  2ES2 A;  2LFN A;  1EWC A;  1MD2 D;  4KN7 C;  4FDB A;  2UUA L;  1E2V A;  1ET9 A;  4RA8 A;  1Y1W G;  2MO1 A;  3S1Q H;  1BBX C;  1X6O A;  4IUT A;  2KHI A;  3K5L A;  1Y1W H;  2A69 C;  4WFN 3;  1LTS D;  5GAE C;  4C3J B;  1SSO A;  1EWH A;  2AKW B;  2NN6 I;  2PO4 A;  4HIO A;  3V2T A;  1SNO A;  1EYG A;  2F52 A;  2O5J C;  5ISR A;  4YCV A;  3HOW B;  3G7L A;  4FVM A;  1EYA A;  4F8M A;  2G9D A;  4JV5 Q;  1TS2 A;  1IZ6 A;  1NR2 A;  1CQF A;  2WAQ G;  4R4C A;  4HSV A;  3J7A V;  2OQ0 A;  3MXN A;  1UE1 A;  3KJP A;  4KHP Q;  2E5L L;  1Y8O B;  3FPU B;  5E4X A;  1G2T A;  2LY7 A;  4JBK A;  1SNQ A;  3FKI H;  4BS9 A;  4QY7 A;  1R9T B;  2ALY B;  2QA4 A;  1LT6 D;  3PGZ A;  4N8X 1;  1A3T A;  1WJJ A;  2HCI A;  3M4Y A;  1QVF A;  3I4N B;  5FLM G;  1NMF A;  3BDL A;  1IKL A;  4H13 C;  4CDC C;  1Z6H A;  2VQE L;  3ND9 A;  1CSQ A;  4JW0 A;  2EYF A;  2K28 A;  2D5D A;  4KKU A;  5ELN A;  3U9O A;  4JI7 L;  1XNQ Q;  1STH A;  1C48 A;  2EYJ A;  5BN4 A;  1EIG A;  3FRP B;  1SJE D;  1I4P A;  1GKH A;  1I94 L;  3HFZ B;  4KY5 A;  1FNW A;  5C0X G;  2K50 A;  4RHS A;  4GN5 A;  4BBR H;  1FR3 A;  2CVR A;  4Z9C B;  4G7O C;  2N49 A;  1ONL A;  1WTP A;  2SOB A;  2GN5 A;  2K7V A;  3NBH A;  4OXP A;  1PH9 A;  3CCM A;  3HOV G;  1JT8 A;  1PDQ A;  1QUQ A;  5C4J B;  3I4M H;  1JE5 A;  4ZLT F;  1B70 B;  3T53 B;  2L5T A;  2EYH A;  4QL5 A;  3T13 A;  4IUV A;  1SN8 A;  2BDO A;  5EPJ A;  1G6P A;  4KI0 A;  4CDF C;  3HOV H;  2B2W A;  2UUC Q;  2JXM B;  4O2D A;  3X3M A;  2EXD A;  2NN6 G;  1SJH D;  5GRO A;  1MGS A;  2MJ8 A;  4PZ8 A;  3E9I A;  4IJH A;  1X9N A;  3HKZ B;  1VQK A;  1G6Z A;  1BCP C;  2UUB Q;  1SMX A;  1OO9 B;  5M5W B;  1SE4 A;  5F2D A;  5M3M H;  2OWO A;  2E2D C;  1Q3L A;  2ATW A;  3NTI A;  1VQD A;  5C4X G;  4HIM A;  4C3I H;  3ULP A;  2UXC Q;  4C2M H;  5M5Y H;  1MI2 A;  2NZ1 D;  5CMD A;  1PYW D;  2B3G A;  3NSW A;  5FJ8 G;  2YV5 A;  4AYB B;  2E2H H;  2I0Q A;  2A8V A;  1J8I A;  3I2Z A;  4M1U B;  2HD3 A;  1I3Q B;  1PH4 A;  4PV1 C;  1CA6 A;  2KCC A;  4H44 C;  3KLW A;  1PFB A;  3S1R H;  4DR4 Q;  2QDB A;  3BYT B;  4A3C G;  1BCP F;  1XMO L;  1M1K C;  5EKL A;  2B63 H;  2XNA C;  1AH9 A;  3TBI B;  4LF4 L;  1G29 1;  3HOU B;  4APV A;  1N36 L;  2NZH A;  4JI1 L;  2Q8I B;  1HJP A;  4DR2 Q;  1GOZ A;  2KCM A;  1DON A;  2PW5 A;  1OXX K;  3MXP A;  4JI5 L;  2X6G A;  3OOC A;  1BOS A;  4IZ8 A;  2GA4 B;  2D2C C;  4LF6 L;  4FXK C;  1BBU A;  1IYJ B;  3TZU A;  1LTR D;  4A76 A;  3KOJ A;  4GOP C;  1XPO A;  2AUK A;  2A6H C;  2PNH A;  3EJI A;  1T5X D;  3SDZ A;  1E2W A;  2SDF A;  1EEF D;  2MFI A;  2HHH Q;  1I4H A;  1L1O A;  4BA2 I;  3C46 A;  1Z47 A;  5AJ3 L;  4X6A H;  2KA7 A;  3W3A A;  2RCF A;  1MJC A;  5KND A;  4K5W A;  1E0B A;  4JYA Q;  4JK1 C;  5EGT A;  1FJG L;  4GKJ L;  3H09 A;  3T1Y Q;  3FP9 A;  1H95 A;  3NEM A;  5D65 A;  3CCV A;  3EA6 A;  1ZYR C;  2PYK A;  1MHW C;  1AZQ A;  1EY9 A;  3Q8D A;  5D14 A;  1GD7 A;  3V96 A;  1RD9 D;  3R3O A;  3TEH B;  2HUG A;  1SYC A;  3CRK C;  3ITP A;  1HNW L;  4K6D A;  1N34 Q;  4JI0 L;  3SK8 A;  2OTL A;  4QB4 A;  2CQO A;  3H91 A;  3E9H A;  4K5X A;  1RDP D;  3ZYY X;  5IOD A;  1TKW B;  3VYR A;  3URY A;  1T9H A;  1PLF A;  4B3R Q;  2JA8 H;  4DK6 C;  1GXD C;  4UDU C;  3PO3 B;  4LF8 L;  1U9R A;  2R92 H;  4JOI A;  3A56 A;  2H5X A;  3DXJ C;  3J80 E;  2F3V A;  3TRE A;  1SBB B;  1IKM A;  2VQF L;  1CZW A;  3BDO A;  3M4O H;  1N34 L;  4JI0 Q;  1YNN D;  3D31 A;  3DEO A;  5IY0 A;  2VW9 A;  1BUV T;  4UP9 A;  3M7G A;  2QDL A;  4LFB Q;  2X69 A;  1I50 B;  5FLX c;  3M4Q A;  5I9P A;  4IFD G;  3BJU A;  4KHV A;  1CKN A;  2D0O A;  2R93 B;  2PZU A;  1JOQ A;  4K6L A;  2N88 A;  1SFO H;  1OXT A;  1HXY D;  4YWK A;  1QZG A;  1CTM A;  5IYC G;  1YI2 A;  2UU9 L;  4KD4 A;  1K3R A;  1UEA B;  3D4R A;  1U4M A;  2FIN B;  4IPH A;  1HQM C;  1PH6 A;  4BY1 B;  4DV3 Q;  4A3L G;  1GUS A;  3R2T A;  3MXN B;  3TP7 A;  2F4I A;  1NTG A;  2ZM6 L;  5IP9 H;  4OL7 A;  1VF7 A;  1C4Q A;  1PXU A;  4A3J B;  4DR3 L;  3NEL A;  1KHI A;  2F0I A;  2XIW A;  4R8I A;  3RNU A;  2OT2 A;  2QF7 A;  1XMQ Q;  4I7Z C;  1LLR D;  2VB3 X;  3PUV A;  4NDX A;  5C44 B;  1S5C D;  3QG1 A;  4R4O A;  1PHJ A;  2K4K A;  4A3I H;  1FJG Q;  4JBJ A;  1HR0 L;  3HOU G;  3J81 j;  1WD1 A;  4TVA B;  1JOK A;  4RG1 A;  1ESF A;  3NUC A;  5JPM C;  1S4Z A;  3BDC A;  3L3O C;  2K5Q A;  2IW3 A;  1T5E A;  2J0T D;  1E22 A;  5BN5 A;  3R93 A;  1ML0 D;  1JJC B;  4BBS H;  4DV6 Q;  5IYC H;  3U4Z A;  2R7Z B;  1HNW Q;  3CKI B;  3NHH A;  1EQQ A;  4RGO S;  1SLJ A;  4YY3 Q;  3QOL A;  1PTO B;  1NNX A;  1CHP D;  1DJR D;  2A73 B;  3QJY A;  4IUU A;  1EZ6 A;  3P75 A;  2JA6 B;  2CH4 W;  5CGK A;  2VUM H;  2BDN A;  2I5L X;  3EQL C;  5ELD A;  3DHQ A;  2B2T C;  1EL0 A;  3E0J A;  1UE6 A;  2CQA A;  4DV6 L;  1WVL A;  2NB0 A;  3DEP A;  3MFG A;  4C3J H;  4IFD I;  3HGB A;  2EJM A;  1HTL D;  1XTD A;  4KHP L;  1R4Q B;  2LKV A;  2JA5 G;  1UE7 A;  1A0I A;  5C4X H;  4JC0 A;  3K5O A;  4POF A;  5JVG 3;  5D3I B;  1KD1 C;  3KLR A;  1F2Z A;  1DYQ A;  3HOW H;  3PF4 A;  1IHZ A;  1X54 A;  1QUQ B;  2QIL A;  3K7U C;  4ALP A;  1SE8 A;  3MTS A;  3GTK B;  2B2V A;  3NWT A;  4P75 A;  2F0F A;  4G7H C;  4AYB E;  4RGM A;  3I72 A;  2JQO A;  3FKI B;  1GUG A;  1XX8 A;  2L11 A;  4DV3 L;  2B2Y C;  2ZTC A;  1I94 Q;  2K5V A;  1VQF A;  3I4N H;  4MNO A;  5KNC A;  3A8K E;  1EY0 A;  1S40 A;  1CA5 A;  2JA9 A;  5CBE E;  5C0X H;  1BNZ A;  4TRD A;  1STG A;  1WTO A;  4O42 A;  2B2T A;  4IUQ A;  1ZYR D;  1EY7 A;  2CH4 A;  2N8N A;  4X64 Q;  1XYI A;  3KDF A;  3JAM E;  5GAH C;  4JBM A;  2IX0 A;  5T1I A;  4MN3 A;  1B4O A;  1CKO A;  4DR7 L;  5BR8 L;  1STA A;  4A3D H;  3J80 i;  3I4M B;  4OIK A;  3FEW X;  2CKZ B;  2Z4H A;  3H3V H;  1PZJ D;  3ICE A;  5CR3 A;  1WD0 A;  1FNU A;  3C3L A;  4XT3 B;  2L9H A;  2JSO A;  4A3B B;  1AZP A;  1XNR L;  1TS5 A;  3J7A F;  2N3S A;  1A63 A;  4IPC A;  2K52 A;  1EQT A;  2A74 C;  4J8Q A;  3CRL C;  3HS0 C;  4NXN Q;  5JEA H;  5M3M B;  1M90 C;  2B2Y A;  1BCP B;  2IWH A;  2TMP A;  1HA6 A;  5IYD G;  4G7Z C;  3PQI A;  2YYZ A;  1W6J A;  1QZH A;  4C3I B;  3HOX H;  3ERQ A;  4JI2 L;  3MFY A;  3S1N H;  4DV7 L;  4B3S L;  2M00 A;  4A3M G;  3HOZ G;  1B44 D;  4ME5 A;  1N9W A;  1FGU A;  1C9O A;  1TWF H;  5FLX E;  2F0E A;  2HQE A;  2E74 C;  1HZB A;  4C3I G;  1I3Q H;  1HR0 W;  5LMN W;  2JA5 H;  1SYE A;  1A3U A;  1V1P A;  3M3Y H;  1FL0 A;  4DAY A;  4JI5 Q;  1O7L A;  1TWH B;  3K5N A;  4LF6 Q;  4I65 A;  1CKM A;  2K32 A;  2WAC A;  2ZXR A;  4KHZ A;  4OO1 H;  5ELC A;  1WTH A;  2BH2 A;  2E8G A;  1OXU A;  3GTL H;  4YCU A;  1F9R A;  4RMF A;  3SR1 A;  1PH8 A;  1JJ2 A;  3L0O A;  1KNA A;  5JJI A;  3HKS A;  5E4W C;  2VXW A;  3CD6 A;  3OMG A;  5LL6 S;  2NTT A;  2F0G A;  1I4X A;  5KNB A;  1LM0 A;  1TR5 A;  5E3F A;  3VR6 A;  1D6E C;  1DCZ A;  2PQA B;  4GS3 A;  5M3F G;  4WJ4 A;  3SHL A;  3DWP A;  2BCO A;  3HOZ B;  4BBR G;  1JIC A;  3MZ5 A;  1GUN A;  2MO0 A;  1O7I A;  1YIT A;  2JA7 H;  1J9O A;  3VR5 A;  2PZT A;  2MQH A;  2O5I C;  2QCP X;  4XQQ A;  3I3C A;  5HUR A;  1YBY A;  1SNP A;  3O13 A;  3W1B A;  4DK0 A;  2B8G A;  3H94 A;  1IL8 A;  4X66 Q;  5IGE A;  4B9X A;  2QEX A;  2ZTD A;  5E7N A;  1PV4 A;  2XWJ B;  3LGJ A;  3KUP A;  4DR7 Q;  2A69 D;  1LTA D;  5KYL A;  1HR0 Q;  2RSN A;  1ZXT A;  3CCR A;  1G2S A;  5DM7 3;  1JWU D;  3FKI G;  1ENC A;  2F3W A;  3GV3 A;  4X65 L;  2EVB A;  5EKI A;  4XQN A;  4K0K Q;  2ZJR A;  1PFN A;  3S9W A;  4DA2 A;  1MBY A;  1SEB D;  2F0D A;  4OGQ C;  3J81 i;  1B9M A;  1E1O A;  3RZD B;  3C2P A;  1ZEQ X;  1QVG A;  1EY6 A;  4X3K A;  1I4R A;  1HHV A;  2PNR C;  1NE3 A;  1CQV A;  1NAP A;  4QUC A;  1XTC D;  4LFC Q;  2JA8 B;  3OMC A;  3EVQ A;  4AIM A;  4CKE A;  4JI6 L;  2K04 A;  1KL9 A;  1U5K A;  4LJZ C;  4JI2 Q;  1K9M C;  4UY8 C;  3K7A H;  5A35 A;  1H9R A;  4A3D G;  1BKB A;  4H02 A;  4LF9 Q;  3SK4 A;  3U9S A;  3NWS A;  3VDY A;  3MVV A;  4JVZ A;  1RTO A;  4XIG S;  3N52 A;  1VQ4 A;  4OX9 Q;  1Q7Y C;  1X55 A;  2AQ1 B;  1I50 H;  5I4D A;  4LFC L;  4A3M H;  2E2I H;  3R2I A;  1AFP A;  4KK7 A;  1HUM A;  3F2U A;  1SXT A;  3BZD B;  1U4L A;  2I07 B;  3BVZ A;  4N9T A;  4WJW A;  2K33 A;  3PIO 3;  1V1O A;  1EOT A;  3GTP B;  1SR3 A;  3RN2 A;  3S2H B;  1X3F A;  1GUO A;  3I8Z A;  2WKD A;  3QWN A;  3HOY G;  4A3J G;  3PUX A;  4OIJ A;  1E3P A;  2VY3 A;  4A3J H;  1B9N A;  1F77 A;  1UNS A;  3RN5 A;  2IPK D;  2ZXP A;  2GVA A;  3CPF A;  4ZAI A;  5J39 A;  1ENF A;  3HOW G;  5GQO A;  4LW1 A;  4GNX A;  4PMW A;  1HQR D;  4FXG C;  1C8C A;  1JQY D;  2DUD A;  1B53 A;  1TWA H;  3OIQ A;  1YJ9 A;  5FKA C;  4K8J A;  4OEM B;  3HKZ E;  1BDO A;  3CCQ A;  1IXR A;  2R7Z G;  3ONA B;  1D5Z C;  2D9U A;  4CKB A;  5J3B A;  4J1M A;  1VQN A;  1SRU A;  1TU2 B;  1I4G A;  4A3K B;  4HID A;  2E2J H;  4L5R C;  5IP9 G;  1GVP A;  4K0K L;  3UDI A;  5IWA Q;  1PTO H;  2NYZ D;  4R1J A;  5C3W A;  1SNC A;  5IYB G;  1HA5 A;  1U0L A;  1EIF A;  2KVM A;  2JA6 H;  4BBS G;  3RZO H;  3G71 A;  4QQB X;  5IP7 G;  4FP5 D;  5IYB H;  2IHF A;  5I2Y A;  2R3Z A;  4HCE A;  3CQZ B;  1HFG A;  1EU3 A;  4YWL A;  1KNE A;  2FJ2 A;  3OPO A;  5KGU A;  5IGF A;  5IWA L;  3OW2 A;  5TSS A;  4JV5 L;  3PUY A;  1TXY A;  3K8A A;  2EOT A;  1M8A A;  1GHK A;  2YU9 H;  2NVT H;  2E5L Q;  3VYS A;  2AQ3 B;  3L7Z C;  5C3E H;  4RH6 A;  4JI8 Q;  5GAG C;  1EEI D;  4KD3 A;  3LWU A;  1S5F D;  2WB1 E;  1WYD A;  3P1H A;  4WOR A;  3K5M A;  1XXG A;  1FYC A;  2CW0 D;  4P74 A;  3GTJ B;  4A3G B;  2EYP A;  4U67 3;  2JA7 G;  4RWS C;  1KLG D;  1HFN A;  2EY5 A;  1ZKO A;  1CFM A;  3DUZ A;  4DR2 L;  4UPA A;  1AP0 A;  1JWM D;  1PRT C;  2A1A A;  2DGY A;  4QF4 A;  4XYO A;  4DR1 L;  4L63 B;  1I5F A;  5IT9 E;  1A2U A;  1DD2 A;  4LF5 Q;  1EFI D;  2WKC A;  3NBH B;  4MIU A;  1IL2 A;  3KDF B;  2B8F A;  4V19 0;  1F2L A;  5C3E G;  3DLL A;  3SEB A;  1L2F A;  1MSG A;  2XVS A;  5K36 H;  3Q6S A;  4ZRZ A;  4LUO A;  4A3F B;  2UUC L;  2HIV A;  3AEV A;  1HZA A;  1UUP A;  1O80 A;  1K8A C;  1QNU A;  2VB2 X;  1K8G A;  3K0X A;  1V9P A;  2L12 A;  5T1G A;  1VQJ A;  2AWO A;  5I2X A;  3U58 A;  1EY4 A;  4RCN A;  2PMZ E;  4EQ5 A;  4A3K G;  1TS4 A;  4DV7 Q;  2RBM A;  3FVQ A;  3GDE A;  3FHW A;  4DV2 Q;  1ICW A;  5LL6 X;  5DEH A;  4PMC A;  1LT5 D;  1HUN A;  2KQ3 A;  1Q8I A;  3T1H Q;  2LXK A;  3IAY A;  2AUJ D;  3MAQ A;  4TQU S;  4K5V A;  4QJF A;  4DNR B;  3HOX B;  1KDA A;  3E6Z X;  1K8O A;  1A2T A;  4LFA Q;  3PO2 G;  2M9V A;  2N55 A;  4AYB G;  1LTG D;  1WTR A;  2LSS A;  1GM5 A;  1Z9F A;  4B3R L;  2Y0S E;  4NKL A;  2OQK A;  4QCL A;  2Y0S B;  5G3L D;  1S3O A;  1ASY A;  1TWC H;  5LMU Q;  2ZJP A;  3KF6 A;  1OXS C;  3HP3 A;  1H9M A;  3IFD A;  1SNM A;  4L5S A;  3RD4 A;  1VF5 C;  3KYH C;  2RVL A;  1VS0 A;  2EE1 A;  3JAM c;  1MIU A;  3I7F A;  1NY4 A;  1RF2 D;  5A2Q E;  3CU7 A;  2WB1 B;  2ASB A;  3A8I E;  4CJ2 C;  1JC7 A;  4B3T L;  4NXM L;  4LFB L;  1D8L A;  1K3B C;  2YTV A;  2HQL A;  3IKJ A;  2L0C A;  2PMZ B;  3CF5 A;  4ABN A;  1R9T H;  3R8B A;  1PH5 A;  4B08 A;  1JR0 D;  3HEJ A;  1L0W A;  1D5X C;  4X3T A;  1YJN A;  1PA6 A;  1K83 B;  3CHB D;  3GTG B;  3CCE A;  2JJQ A;  2EY2 A;  1GHJ A;  1O7Z A;  1VMP A;  1BO0 A;  3J7Z C;  5M3F H;  5J22 A;  4OON A;  1QVC A;  1X56 A;  5JVH 3;  1ET6 A;  1KAW A;  4JYA L;  2JA7 B;  4WJ3 M;  5KYI A;  4PZ6 A;  4DV5 Q;  1X3G A;  2A6H D;  3I73 A;  3E0E A;  4DK1 A;  4X65 Q;  3H0G B;  1NCV A;  1ILQ A;  1WI5 A;  1F2Y A;  4BY7 B;  4P72 A;  4IUR A;  3S14 H;  1EIY B;  4AH6 A;  5FJ8 H;  3C1E A;  4DAP A;  3KF6 B;  5ELF A;  3Q24 A;  3EIV A;  3I4O A;  3PUZ A;  1N33 Q;  5C4J H;  1IBM Q;  3RMH A;  1DOL A;  1CM9 A;  3UE1 A;  1Y8P B;  1SYF A;  4X3U A;  2IX1 A;  1LT3 D;  3GTQ H;  2IX3 A;  1VQ6 A;  3NPP A;  5IGB A;  4DV5 L;  4KY7 A;  2JE6 I;  4CDE C;  1K28 A;  1V1P B;  3A5Z B;  2J7Z A;  3VR2 A;  2UXB L;  4HED A;  4F7X A;  2VQF Q;  1LYL A;  1PRT F;  5G3L F;  2RDH A;  3STB C;  4O0A A;  2UXC L;  1HNZ Q;  1FGB D;  4C2M B;  5M5Y B;  3K0Y A;  2JN4 A;  4YY3 L;  4DPG A;  1TVX A;  3ER0 A;  4A4I A;  5ELB A;  1HTP A;  1TS3 A;  1SMY D;  3U4V A;  3GD7 A;  2OF1 A;  3F2B A;  4HMJ A;  3DWQ A;  4ME3 A;  4ULL A;  1IW7 C;  2KEE A;  2DNC A;  1LTT D;  3I55 A;  1O7Y A;  3KLS A;  4IUP A;  4A3M B;  1AE2 A;  2CW0 C;  2KJX A;  2B2W C;  3HOU H;  1D1K A;  1GO3 E;  1VCI A;  2RDF A;  2QGQ A;  2JYO A;  4DR6 Q;  3NE5 B;  1K73 C;  1H9S B;  1VQG A;  1BCP D;  2NVX H;  4JI4 Q;  4JI8 L;  3GTP H;  5FOB B;  2ZM6 Q;  2RHS B;  4Q0F A;  5COY A;  4HJ9 A;  3NQI A;  3RR5 A;  4DR3 Q;  3S2H H;  4XYQ A;  2NN6 H;  4DV0 L;  1TQO A;  5CV9 A;  3T4A C;  2A6E C;  4J15 A;  1CK1 A;  4A93 B;  2F4V Q;  3PO2 H;  3SVM A;  3SK5 A;  3D8G A;  1Q90 A;  4A3L H;  4R4Q A;  5AJ3 Q;  5C0X J;  4HN7 A;  2CHB D;  2PZW A;  5HGQ A;  1Y8N B;  1Q46 A;  1A15 A;  1VDZ A;  1SDF A;  1YJW A;  2L4N A;  2HDL A;  1TWA B;  1PRT D;  2F0S A;  4RAU C;  4LK1 C;  1J5E L;  1E7Z A;  1U4R A;  1YNX A;  4R4I A;  1R4P B;  2EY6 A;  2VZA A;  4DXF A;  4N9P A;  2Z6K A;  2Q8T A;  2VNU D;  3JAM L;  3P20 A;  4RHR A;  1W2B A;  3MXG A;  1A6X A;  1EYD A;  2BE5 D;  4CBV A;  2WAQ B;  1W3S A;  1X65 A;  2KEC A;  3TS0 A;  5C0X I;  1VQM A;  2EJG C;  2E2J B;  4NMZ A;  5K36 G;  2R7D A;  5LHY 1;  4FF4 A;  3CC7 A;  4ZKC B;  1Y1V B;  4JBW A;  4A3E H;  3F1Z A;  1J5E Q;  3K58 A;  3G48 A;  3PO3 H;  3J7Y W;  3S16 B;  4FF3 A;  2AHO B;  5CV8 A;  3RZO B;  1XJV A;  4HAE A;  1H9S A;  2R61 A;  4LF4 Q;  3S1Q B;  3H3V I;  1Y1W B;  2X6L A;  2XRQ D;  3HOY B;  5IGD A;  1LTI D;  3D3R A;  3OWF A;  2EQS A;  1ENA A;  2F0O A;  3VR3 A;  4NXN L;  3KBX A;  3K80 C;  5ELE A;  4EQP A;  3TDQ A;  1DOK A;  5JPN C;  4PMB A;  3BU2 A;  3J80 c;  1VQI A;  5FK9 C;  3WOE A;  1SYD A;  2IJ0 A;  4B3S Q;  2AWN A;  5LMU L;  2NVT B;  3J7A 5;  2R93 H;  4GKK L;  3NP8 A;  4DK3 C;  3PSI A;  1G51 A;  3I90 A;  3VA5 A;  1PFM A;  5CYU A;  2UU9 Q;  2WV6 D;  2PW7 A;  1STB A;  2JK8 A;  4JI4 L;  1G91 A;  5HGT A;  5CV6 A;  4BY1 H;  2QKI C;  2KED A;  1DGS A;  1Y1V G;  4IPG A;  1JCK B;  2V1C C;  2JP1 A;  3BYY B;  4DKA C;  3D4W A;  4DR5 Q;  2LS0 1;  1V8Q A;  2OEO A;  1WCM B;  2F3I A;  4HMI A;  1YNN C;  1XMO Q;  4TKO B;  5IIF A;  3SGI A;  3QB3 A;  5C44 G;  1N36 Q;  4DF7 A;  3L2P A;  5IT9 L;  3TS2 A;  2JA6 G;  3KK7 A;  4RKL A;  3J81 E;  1YHQ A;  3DWA A;  1X3P A;  5FO7 B;  4K2L A;  1PTO D;  1NJI C;  3TME A;  1VQ8 A;  1HRJ A;  4I7A A;  5EBD A;  3T51 B;  1L0Y B;  4DV4 Q;  1I6V C;  5CV4 A;  4CGY B;  4CJ1 B;  4FF2 A;  1AW7 A;  1Q8K A;  4A3C H;  4X62 Q;  1SE3 A;  3HOV B;  2K5W A;  2NVY H;  4YHH L;  2KUM A;  4BBS B;  4A75 A;  3CP0 A;  3VYU A;  4CDD C;  4A3B G;  3KBG A;  2DY7 A;  2L15 A;  5FO8 B;  2R7Z H;  1RHP A;  4KTA A;  4NP5 A;  1UE5 A;  2WB1 G;  1RL2 A;  3GTM H;  5C5M A;  4GKJ Q;  2R92 G;  3CPW A;  5M5W H;  5GAD C;  4K2K A;  3FDT A;  4C56 C;  1I6H B;  4LNQ A;  2AQ2 B;  2JA8 G;  3S1M H;  4IPD A;  1SMY C;  2EYO A;  3CCL A;  3BG3 A;  4C3H H;  4BY7 G;  1WTQ A;  2CCZ A;  3AYH B;  1LV9 A;  3A7L A;  4X62 L;  1NUC A;  2WIN B;  2Z8L A;  1F9Q A;  4IOC A;  2SNM A;  2E2H B;  4GLX A;  3A8J E;  3PIP 3;  1TWC B;  5C4X B;  2YTX A;  4ZK9 B;  3IRB A;  3OIP A;  3UDF A;  1YIJ A;  2UXD L;  1B8A A;  4GN4 B;  2K5H A;  1EOV A;  3WWV A;  5KRU A;  3CC4 A;  3GTK H;  1E24 A;  1YZ6 A;  1Q81 C;  1JMC A;  2F0U A;  2A68 C;  4ILW A;  3G4S A;  2ICE C;  3NXW A;  2I46 A;  2B2V C;  2KCT A;  2WP8 J;  1JOO A;  5EKK A;  1CZG A;  1H9J A;  3GTG H;  5IGC A;  1C0A A;  1PH3 A;  2E75 C;  3W1G A;  3T56 B;  3NK9 A;  1LTB D;  3U50 C;  4IO9 A;  3H0G G;  3AU7 A;  4DUZ Q;  2NZO A;  5DLQ E;  4J6H A;  4YWM A;  2WFW A;  1VQA A;  2VS1 A;  2ZXO A;  1A62 A;  4P2C B;  2WII B;  5M5X H;  4E6I A;  1RTN A;  2BA0 A;  2J4X A;  4OHJ A;  5AFW A;  4CJ0 B;  2NBF A;  5D3D A;  4JI7 Q;  2EYL A;  3OWE B;  3H0G H;  5LMN L;  4DV1 L;  2Y0S G;  2Q2I A;  2RQX A;  3BZK A;  1QNK A;  4LAA A;  1WOC A;  4C3H G;  4BY7 H;  3BVG A;  3AMU A;  4DAY B;  3JAM i;  4GNX B;  4ZKB B;  2DJF C;  2IT1 A;  3JC6 6;  4A3D B;  3L9A X;  4H0L C;  3I4L A;  1X3Q A;  4S3S A;  4OWX B;  1YNJ C;  3X3N A;  4A3E G;  4FXD A;  1P16 A;  3CME A;  2A19 A;  3A54 A;  3I91 A;  1TT2 A;  2K14 A;  1PZI D;  4A3B H;  3GP7 A;  4Q5V A;  5L37 A;  4DN4 M;  1KRT A;  3AFP A;  4RGN A;  1WTX A;  1OXV A;  4EVO A;  2B29 A;  3CCU A;  3SE0 A;  4IN3 A;  5LMN Q;  1XPR A;  4DV1 Q;  1SND A;  2HT1 A;  2VUM G;  4XQJ A;  4NPS A;  1LO5 D;  3TP6 A;  1RKN A;  2EY1 A;  5J1Z A;  4UHV A;  4OEL B;  1QOH A;  4L8J A;  1QJO A;  1BF4 A;  2R92 B;  3S17 B;  3K57 A;  3OTO L;  2MP1 A;  4HJ7 A;  1B7Y B;  4HJ5 A;  3VA7 A;  1K0R A;  3NQT A;  3M4O B;  1DOM A;  2EXZ A;  2K03 A;  2I5H A;  4DR6 L;  1PYS B;  1G8Z D;  1VQ5 A;  1I4Q A;  4F88 A;  1MKH A;  1KXL A;  3M3Y B;  4XTC S;  4YIJ A;  4UP8 A;  3PF5 A;  3UDG A;  3BS1 A;  4A3I G;  4MHE A;  4X3S A;  4ZCK A;  1NMG A;  2XN9 C;  1UAP A;  4JOI C;  5HY6 A;  3H6M A;  4DNT B;  2PI2 A;  4MTK A;  2NVX B;  3PUW A;  2FXQ A;  4C1N K;  2F0J A;  3S15 B;  4A3G G;  1FD7 D;  2R93 G;  4XDX A;  1JB3 A;  4A93 G;  2Q2H A;  3GTO H;  4JI3 Q;  3GV6 A;  1D5M C;  1YHB A;  4TSS A;  5CV7 A;  3HOZ H;  1PTO C;  4DR5 L;  2RKS A;  1Q12 A;  1HPC A;  4FF1 A;  3NEN A;  4DU9 A;  1A8V A;  3CCJ A;  1NBW A;  4XXE A;  1RJT A;  5C44 H;  2PCF B;  3AQQ A;  3KFU A;  4CHT B;  1STE A;  3K81 C;  1Q1B A;  3AFQ A;  3M7N A;  2JEA I;  2BA1 A;  4FNF A;  2CWA A;  5FLX L;  3ULL A;  3S24 A;  2DJG C;  4KN4 C;  5CBA E;  3MC0 B;  2XSC A;  4L5T A;  3T1Y L;  2IL8 A;  4JI3 L;  3WOF A;  5I9O A;  4LF5 L;  3W2D A;  3MXU A;  2Z6B A;  3PIO A;  1VQL A;  4KKT A;  1JB7 A;  3HKZ G;  2IY5 B;  2GVB A;  4OO1 G;  2C5C A;  3K59 A;  1VQO A;  4HR7 B;  3F8T A;  2OCE A;  3D6W A;  1PFS A;  3HZX A;  4JPB W;  3I70 A;  1DXM A;  1TWG B;  2A6E D;  3RZD H;  4X64 L;  2RDG A;  4HSP A;  1ILP A;  4ODG A;  1YEZ A;  2F0T A;  5KEE A;  5JJL A;  5BR8 Q;  4JI6 Q;  3ERO A;  3RLF A;  3S16 H;  1HZC A;  1IYU A;  4NW2 A;  3PV0 A;  3EN2 A;  3PMF A;  3ZJY C;  2E76 C;  4OO1 I;  2VUM B;  2R6G A;  2LMC B;  2PPB C;  1Q1E A;  2PQE A;  2ZTE A;  2XGT A;  5JOB A;  3F2C A;  4DR4 L;  1JWS D;  3OTO Q;  4PQX A;  2SNS A;  2TSS A;  1II3 A;  3RUZ A;  3HOX G;  1ICF B;  1CT1 D;  1RIP A;  2EDG A;  4LF7 L;  3HOY H;  5IYD H;  4EGV A;  2EYM A;  5M9O A;  4KJO A;  4IQZ A;  1BVS A;  3ERS X;  4IUN A;  5JEA G;  3A74 A;  3RLN A;  1B3A A;  2KEN A;  2KHS A;  3I4M G;  1WTV A;  2Z6K C;  4L5Q A;  2BE5 C;  1S5B D;  1EUJ A;  3UDX A;  4GZY C;  4Y7N H;  3PIP A;  2P5Z X;  1D7Q A;  4FO2 A;  3TP8 A;  2KCN A;  3DMU A;  2UXD Q;  3CAM A;  1HH2 P;  2O4X A;  3TZD A;  4LF7 Q;  4RFB A;  5I6W A;  3AB9 A;  2F0N A;  2MGS A;  3F2D A;  3OYY A;  1S5D D;  2YTY A;  2EPB A;  1V1Q A;  2D0P A;  4P71 A;  4ZUI A;  1O78 A;  2H1E A;  3CCS A;  4QIW E;  1WCM H;  4KMU C;  3HRZ C;  2ZT9 C;  4GOP A;  3MEF A;  3K6O A;  5EPK A;  2FMC A;  2Z9H A;  3TQY A;  4QIW B;  2NVQ H;  4R8N A;  4DUZ L;  3RLO A;  5JEA J;  1BQQ T;  1L1O C;  1N8R C;  5BN3 A;  4YHH Q;  1EIH A;  4IAL A;  3STB D;  3OSO A;  4OWW B;  1QWY A;  4BXX H;  2CWP A;  4KLK A;  3MWY W;  4G4K A;  4P73 A;  3S2D H;  2F0K A;  3M9B A;  3UE0 A;  1K0S A;  3KLS X;  1VQ7 A;  3HG9 A;  2NVY B;  4A3K H;  4LF8 Q;  1B2T A;  2FMM A;  5JJZ A;  4HJA A;  2O2L D; 
#chains in the Genus database with same CATH homology
 2A5H A;  2F0V A;  3GTM B;  1TY2 A;  1YNJ D;  1F9P A;  1E2Z A;  3N6R A;  4EQN A;  1PZK D;  2ID0 A;  1CI3 M;  1F9S A;  2K6A A;  5C4Z A;  3S1M B;  1QB5 D;  1SYG A;  4C3H B;  1PTO F;  4R9W A;  4ZUJ A;  3S1N B;  5E1F A;  2DNE A;  3A55 A;  5DAU A;  2F0H A;  1ESR A;  4G57 A;  3TP5 A;  1TWF B;  1Y69 U;  1VMC A;  5A2Q L;  2JA5 B;  1KAA A;  4L6T B;  2MHV A;  3VYT A;  2YU9 B;  2DY8 A;  3Q23 A;  5FO9 B;  3OW7 A;  1CHQ D;  1SE2 A;  5C3E B;  1PMR A;  3GTL B;  3NBI A;  1LAC A;  2K5D A;  1LAB A;  2BOS A;  3VR4 A;  1GJX A;  1AN8 A;  2EJF C;  3OHX C;  2SEB D;  4C3J G;  2XRS D;  3FMC A;  2D62 A;  5C6A A;  2F0P A;  4QUF A;  1RCV D;  1Z7T A;  5M5X B;  3SXH A;  2RSO A;  5EQ0 A;  2B2U A;  4UAI A;  1EY8 A;  5C4H A;  3H3V C;  3A7A B;  4BBR B;  5K5P A;  3J80 L;  1STN A;  4XT1 B;  4O1N A;  4H7B A;  2FHT A;  2QEJ C;  1DM0 B;  3IL8 A;  4V0B A;  2B2U C;  5NUC A;  4IFD J;  3ND8 A;  1L0X B;  3BVM A;  2ICI A;  4IFD H;  1H9K A;  1KLU D;  1V43 A;  1QG7 A;  1PRT B;  2Z1C A;  4HTH A;  4PNY A;  3J81 L;  1TII D;  3V05 A;  2Q8R E;  2F0W A;  2C9O A;  2RA4 A;  1EZ8 A;  3C1F A;  1QE6 A;  3K7A B;  4RKB A;  4C1N I;  3G6J B;  2F0Q A;  1KAB A;  4FYD A;  3SK6 A;  1W6K A;  1D2B A;  3S1R B;  1NR4 A;  3QIA A;  2Z4I A;  2HDM A;  2E2I B;  2B63 B;  2F0M A;  1XWE A;  4CKC A;  3NTH A;  2L1B A;  5DNF A;  1S5E D;  1HCZ A;  2XWB B;  1M4V A;  5EBC A;  1K8M A;  4EQO A;  3LX0 A;  2G9H D;  4KV6 A;  1WTW A;  1AEX A;  3GTO B;  5M3F B;  5COR A;  2EZV A;  1SAP A;  2HCC A;  2OXP A;  3LWE A;  5I6Y A;  3IFT A;  2JEB I;  1B1Z A;  3EFX D;  4DFA A;  5DM6 3;  4RGT A;  1JE4 A;  1EY5 A;  4HCS A;  1IYV A;  1A3V A;  2NWG A;  4LMQ D;  2F03 A;  2V4D A;  3MEH A;  3QO2 A;  3S14 B;  1GUW A;  5IOC A;  3D6C A;  4ZQ3 A;  5CC4 A;  1MSH A;  2K01 A;  3GTQ B;  4K8I A;  4ID6 A;  5IGG A;  2K1B A;  4DGZ A;  4KY6 A;  1SYB A;  2K05 A;  1LT4 D;  2NUC A;  1F2M A;  1KDC A;  2A68 D;  5JAV A;  1EU4 A;  1NSN S;  2H4O A;  2F1M A;  2F0L A;  3GQB A;  3TSS A;  2NTS A;  2M2L A;  1KTK A;  1TY0 A;  1GUT A;  3Q0A A;  4DAV A;  3NTK A;  4DXG A;  1KDB A;  2MUY A;  4B9W A;  1FNV A;  3LNN A;  4BWG B;  4ZYS A;  4Y7N B;  3TN2 A;  3FPP A;  5EPL A;  4KKS A;  1BR9 A;  2L55 A;  1JOR A;  3MA2 B;  1SFO B;  3Q22 A;  4RCO A;  3WDN A;  5KIX A;  5EJW A;  3M85 A;  1DZ1 A;  3QOJ A;  3P7J A;  1EQV A;  2KOL A;  3E5S A;  3MHB A;  3PO2 B;  3T16 A;  1BXT A;  3UI2 A;  2NVQ B;  1ROD A;  1IW7 D;  4A3I B;  1X32 A;  1D1I A;  4M8A A;  5C5L A;  4K14 A;  1U4P A;  1EYC A;  3GO5 A;  4U68 A;  3KF8 A;  1STY A;  5C3X A;  2FFK B;  2ENB A;  4KJN A;  3S2D B;  2B39 A;  5CV5 A;  4QMG A;  4WRD A;  2MPM A;  2DN8 A;  3DM1 A;  1B50 A;  1QCB D;  4A3E B;  4F87 A;  1QIL A;  3D4D A;  4BA1 I;  2LFN A;  1EWC A;  1MD2 D;  4KN7 C;  1E2V A;  1ET9 A;  4RA8 A;  1BBX C;  4IUT A;  3K5L A;  2A69 C;  4WFN 3;  1LTS D;  4C3J B;  1SSO A;  1EWH A;  2NN6 I;  2PO4 A;  3V2T A;  1SNO A;  2O5J C;  5ISR A;  3HOW B;  3G7L A;  4FVM A;  1EYA A;  4F8M A;  2G9D A;  1TS2 A;  1NR2 A;  1CQF A;  4HSV A;  3J7A V;  3MXN A;  1Y8O B;  3FPU B;  5E4X A;  1G2T A;  2LY7 A;  1SNQ A;  4BS9 A;  1R9T B;  1LT6 D;  1A3T A;  2HCI A;  3M4Y A;  3I4N B;  3BDL A;  1IKL A;  4H13 C;  1Z6H A;  3ND9 A;  2EYF A;  2K28 A;  2D5D A;  4KKU A;  3U9O A;  1STH A;  1C48 A;  2EYJ A;  5BN4 A;  1EIG A;  3FRP B;  1SJE D;  1I4P A;  4KY5 A;  1FNW A;  5C0X G;  4RHS A;  1FR3 A;  2CVR A;  4Z9C B;  4G7O C;  1ONL A;  1WTP A;  2SOB A;  2K7V A;  3NBH A;  1PDQ A;  5C4J B;  4ZLT F;  3T53 B;  2L5T A;  3T13 A;  2EYH A;  4IUV A;  2BDO A;  5EPJ A;  4KI0 A;  2B2W A;  2JXM B;  3X3M A;  2NN6 G;  1SJH D;  1MGS A;  2MJ8 A;  3HKZ B;  1G6Z A;  1BCP C;  1OO9 B;  5M5W B;  1SE4 A;  5F2D A;  2E2D C;  1Q3L A;  3NTI A;  1MI2 A;  2NZ1 D;  5CMD A;  1PYW D;  3NSW A;  4AYB B;  1J8I A;  4M1U B;  1I3Q B;  1CA6 A;  4PV1 C;  2KCC A;  4H44 C;  1PFB A;  2QDB A;  3BYT B;  1BCP F;  5EKL A;  2XNA C;  3TBI B;  1G29 1;  3HOU B;  2Q8I B;  1GOZ A;  1DON A;  2PW5 A;  1OXX K;  3MXP A;  2X6G A;  3OOC A;  1BOS A;  4IZ8 A;  2GA4 B;  2D2C C;  4FXK C;  3TZU A;  1LTR D;  2AUK A;  2A6H C;  3EJI A;  1T5X D;  3SDZ A;  1E2W A;  2SDF A;  1EEF D;  1I4H A;  4BA2 I;  3C46 A;  1Z47 A;  2KA7 A;  3W3A A;  5KND A;  4K5W A;  1E0B A;  4JK1 C;  5EGT A;  3H09 A;  5D65 A;  3EA6 A;  1ZYR C;  2PYK A;  1AZQ A;  1EY9 A;  5D14 A;  3V96 A;  1RD9 D;  3R3O A;  2HUG A;  1SYC A;  3CRK C;  3ITP A;  4K6D A;  3SK8 A;  4QB4 A;  3H91 A;  4K5X A;  1RDP D;  3ZYY X;  5IOD A;  1TKW B;  3VYR A;  3URY A;  1PLF A;  1GXD C;  4UDU C;  3PO3 B;  1U9R A;  3A56 A;  3DXJ C;  3J80 E;  2F3V A;  1SBB B;  1IKM A;  1CZW A;  3BDO A;  1YNN D;  3D31 A;  3DEO A;  1BUV T;  3M7G A;  2X69 A;  1I50 B;  5I9P A;  4IFD G;  4KHV A;  2R93 B;  2PZU A;  1JOQ A;  4K6L A;  2N88 A;  1OXT A;  1HXY D;  1CTM A;  4KD4 A;  1UEA B;  3D4R A;  1U4M A;  2FIN B;  1HQM C;  4BY1 B;  1GUS A;  3R2T A;  3TP7 A;  2F4I A;  4OL7 A;  1VF7 A;  1C4Q A;  1PXU A;  4A3J B;  2F0I A;  2XIW A;  4R8I A;  2OT2 A;  2QF7 A;  4I7Z C;  1LLR D;  2VB3 X;  3PUV A;  4NDX A;  5C44 B;  1S5C D;  3QG1 A;  1WD1 A;  1JOK A;  1ESF A;  3NUC A;  5JPM C;  1S4Z A;  3BDC A;  3L3O C;  2K5Q A;  2IW3 A;  1T5E A;  2J0T D;  5BN5 A;  3R93 A;  1ML0 D;  2R7Z B;  3CKI B;  3NHH A;  4RGO S;  1PTO B;  3QOL A;  1CHP D;  1DJR D;  2A73 B;  3QJY A;  4IUU A;  1EZ6 A;  3P75 A;  2JA6 B;  5CGK A;  2BDN A;  3EQL C;  5ELD A;  3DHQ A;  2B2T C;  1EL0 A;  3E0J A;  2CQA A;  1WVL A;  2NB0 A;  3DEP A;  3MFG A;  4IFD I;  3HGB A;  2EJM A;  1HTL D;  1R4Q B;  2LKV A;  3K5O A;  5JVG 3;  5D3I B;  3KLR A;  1F2Z A;  1DYQ A;  1IHZ A;  2QIL A;  3MTS A;  3GTK B;  2B2V A;  3NWT A;  2F0F A;  4G7H C;  4RGM A;  3I72 A;  3FKI B;  1GUG A;  1XX8 A;  2L11 A;  2B2Y C;  5KNC A;  3A8K E;  1EY0 A;  1CA5 A;  5CBE E;  5C0X H;  1BNZ A;  4TRD A;  1STG A;  1WTO A;  4O42 A;  2B2T A;  4IUQ A;  1ZYR D;  1EY7 A;  1XYI A;  3JAM E;  2IX0 A;  5T1I A;  4MN3 A;  1B4O A;  1STA A;  3I4M B;  4OIK A;  3FEW X;  2Z4H A;  1PZJ D;  5CR3 A;  1WD0 A;  1FNU A;  3C3L A;  4XT3 B;  2L9H A;  2JSO A;  4A3B B;  1AZP A;  1TS5 A;  3J7A F;  4J8Q A;  1EQT A;  2A74 C;  3CRL C;  3HS0 C;  5JEA H;  5M3M B;  2B2Y A;  1BCP B;  2IWH A;  2TMP A;  1HA6 A;  4G7Z C;  2YYZ A;  1W6J A;  4C3I B;  3ERQ A;  3MFY A;  2M00 A;  1B44 D;  4ME5 A;  5FLX E;  2F0E A;  2HQE A;  2E74 C;  4C3I G;  1SYE A;  1A3U A;  1V1P A;  4DAY A;  1O7L A;  1TWH B;  3K5N A;  4I65 A;  2K32 A;  2WAC A;  2ZXR A;  4KHZ A;  4OO1 H;  5ELC A;  1OXU A;  1F9R A;  3SR1 A;  1KNA A;  5E4W C;  2VXW A;  3OMG A;  5LL6 S;  2NTT A;  2F0G A;  1I4X A;  5KNB A;  1TR5 A;  5E3F A;  3VR6 A;  1D6E C;  1DCZ A;  3SHL A;  3DWP A;  2BCO A;  3HOZ B;  1JIC A;  3MZ5 A;  1GUN A;  1J9O A;  3VR5 A;  2PZT A;  2O5I C;  2QCP X;  4XQQ A;  3I3C A;  5HUR A;  1SNP A;  3O13 A;  4DK0 A;  2B8G A;  3H94 A;  1IL8 A;  5IGE A;  4B9X A;  2XWJ B;  3KUP A;  2A69 D;  1LTA D;  5KYL A;  2RSN A;  1ZXT A;  1G2S A;  5DM7 3;  1JWU D;  1ENC A;  2F3W A;  3GV3 A;  2EVB A;  5EKI A;  4XQN A;  1PFN A;  3S9W A;  4DA2 A;  1MBY A;  1SEB D;  2F0D A;  4OGQ C;  1B9M A;  3RZD B;  3C2P A;  1ZEQ X;  1EY6 A;  4X3K A;  1I4R A;  1HHV A;  2PNR C;  1CQV A;  1NAP A;  4QUC A;  1XTC D;  2JA8 B;  3OMC A;  3EVQ A;  4CKE A;  2K04 A;  4LJZ C;  5A35 A;  1H9R A;  3SK4 A;  3U9S A;  3NWS A;  3MVV A;  1RTO A;  4XIG S;  3N52 A;  2AQ1 B;  5I4D A;  3R2I A;  1AFP A;  4KK7 A;  1HUM A;  3F2U A;  1SXT A;  3BZD B;  1U4L A;  2I07 B;  3BVZ A;  4N9T A;  4WJW A;  2K33 A;  3PIO 3;  1V1O A;  1EOT A;  3GTP B;  3S2H B;  1GUO A;  3I8Z A;  2WKD A;  3QWN A;  3PUX A;  4OIJ A;  1B9N A;  1F77 A;  1UNS A;  2IPK D;  2ZXP A;  4ZAI A;  5J39 A;  1ENF A;  4PMW A;  1HQR D;  4FXG C;  1C8C A;  1JQY D;  1B53 A;  3OIQ A;  5FKA C;  4K8J A;  1BDO A;  3ONA B;  1D5Z C;  2D9U A;  4CKB A;  4J1M A;  1TU2 B;  4A3K B;  1I4G A;  1PTO H;  2NYZ D;  5C3W A;  1SNC A;  1HA5 A;  2KVM A;  4FP5 D;  5I2Y A;  2R3Z A;  4HCE A;  3CQZ B;  1HFG A;  1EU3 A;  1KNE A;  2FJ2 A;  3OPO A;  5KGU A;  5IGF A;  5TSS A;  3PUY A;  2EOT A;  1M8A A;  1GHK A;  3VYS A;  2AQ3 B;  3L7Z C;  4RH6 A;  1EEI D;  4KD3 A;  3LWU A;  1S5F D;  4WOR A;  3P1H A;  3K5M A;  1XXG A;  1FYC A;  2CW0 D;  3GTJ B;  4A3G B;  2EYP A;  4U67 3;  4RWS C;  1KLG D;  1HFN A;  2EY5 A;  1ZKO A;  1CFM A;  3DUZ A;  1AP0 A;  1JWM D;  1PRT C;  4QF4 A;  4XYO A;  4L63 B;  5IT9 E;  1A2U A;  1DD2 A;  1EFI D;  2WKC A;  4MIU A;  2B8F A;  4V19 0;  1F2L A;  3SEB A;  1MSG A;  2XVS A;  5K36 H;  3Q6S A;  4ZRZ A;  4A3F B;  1UUP A;  1O80 A;  1QNU A;  2VB2 X;  2L12 A;  5T1G A;  2AWO A;  5I2X A;  1EY4 A;  4RCN A;  1TS4 A;  2RBM A;  3FVQ A;  1ICW A;  5LL6 X;  5DEH A;  4PMC A;  1LT5 D;  1HUN A;  2KQ3 A;  1Q8I A;  3IAY A;  2AUJ D;  3MAQ A;  4TQU S;  4K5V A;  4DNR B;  3HOX B;  1KDA A;  3E6Z X;  1K8O A;  1A2T A;  2M9V A;  2N55 A;  1LTG D;  1WTR A;  4QCL A;  4NKL A;  2Y0S B;  5G3L D;  1OXS C;  3HP3 A;  1H9M A;  3IFD A;  1SNM A;  3RD4 A;  1VF5 C;  2RVL A;  2EE1 A;  1RF2 D;  5A2Q E;  3CU7 A;  2WB1 B;  3A8I E;  4CJ2 C;  1JC7 A;  3IKJ A;  2L0C A;  2PMZ B;  4ABN A;  3R8B A;  4B08 A;  1JR0 D;  3HEJ A;  1D5X C;  4X3T A;  3GTG B;  1K83 B;  3CHB D;  2EY2 A;  1GHJ A;  1O7Z A;  1VMP A;  1BO0 A;  5J22 A;  5JVH 3;  1ET6 A;  2JA7 B;  5KYI A;  2A6H D;  3I73 A;  4DK1 A;  3H0G B;  1NCV A;  1ILQ A;  1F2Y A;  4BY7 B;  4IUR A;  3C1E A;  4DAP A;  5ELF A;  3Q24 A;  3PUZ A;  3RMH A;  1DOL A;  1CM9 A;  1Y8P B;  1SYF A;  4X3U A;  2IX1 A;  1LT3 D;  2IX3 A;  3NPP A;  5IGB A;  4KY7 A;  2JE6 I;  1V1P B;  2J7Z A;  3VR2 A;  4HED A;  4F7X A;  1PRT F;  5G3L F;  2RDH A;  1FGB D;  4C2M B;  5M5Y B;  3K0Y A;  1TVX A;  5ELB A;  1HTP A;  1TS3 A;  1SMY D;  3GD7 A;  2OF1 A;  4HMJ A;  3DWQ A;  4ULL A;  1IW7 C;  2KEE A;  2DNC A;  1LTT D;  1O7Y A;  3KLS A;  4IUP A;  4A3M B;  2CW0 C;  2KJX A;  2B2W C;  1D1K A;  1VCI A;  2RDF A;  2JYO A;  3NE5 B;  1H9S B;  1BCP D;  5FOB B;  4Q0F A;  5COY A;  3NQI A;  4XYQ A;  2NN6 H;  1TQO A;  5CV9 A;  3T4A C;  2A6E C;  1CK1 A;  4A93 B;  3SVM A;  3SK5 A;  3D8G A;  1Q90 A;  5C0X J;  4HN7 A;  2CHB D;  2PZW A;  1Y8N B;  1A15 A;  1VDZ A;  1SDF A;  2L4N A;  2HDL A;  1TWA B;  1PRT D;  2F0S A;  4RAU C;  4LK1 C;  1U4R A;  1R4P B;  2EY6 A;  4DXF A;  4N9P A;  2Q8T A;  2VNU D;  3JAM L;  3P20 A;  4RHR A;  3MXG A;  1A6X A;  1EYD A;  2BE5 D;  4CBV A;  2WAQ B;  2KEC A;  5C0X I;  2EJG C;  2E2J B;  4NMZ A;  5K36 G;  5LHY 1;  4FF4 A;  4ZKC B;  1Y1V B;  4JBW A;  3K58 A;  3J7Y W;  3S16 B;  4FF3 A;  5CV8 A;  3RZO B;  4HAE A;  1H9S A;  2R61 A;  3S1Q B;  1Y1W B;  2X6L A;  2XRQ D;  3HOY B;  5IGD A;  1LTI D;  3D3R A;  3OWF A;  2F0O A;  1ENA A;  3VR3 A;  3KBX A;  5ELE A;  4EQP A;  3TDQ A;  1DOK A;  5JPN C;  4PMB A;  5FK9 C;  3WOE A;  1SYD A;  2IJ0 A;  2AWN A;  2NVT B;  3NP8 A;  3I90 A;  3VA5 A;  1PFM A;  5CYU A;  2WV6 D;  2PW7 A;  1STB A;  1G91 A;  5HGT A;  5CV6 A;  2QKI C;  2KED A;  1JCK B;  2JP1 A;  3BYY B;  3D4W A;  2LS0 1;  1V8Q A;  2OEO A;  1WCM B;  4HMI A;  1YNN C;  4TKO B;  5IIF A;  3QB3 A;  4DF7 A;  5IT9 L;  3KK7 A;  4RKL A;  3J81 E;  3DWA A;  1X3P A;  5FO7 B;  4K2L A;  1PTO D;  3TME A;  1HRJ A;  5EBD A;  3T51 B;  1L0Y B;  1I6V C;  5CV4 A;  4CGY B;  4CJ1 B;  4FF2 A;  1AW7 A;  1SE3 A;  3HOV B;  2K5W A;  4BBS B;  2KUM A;  3VYU A;  3KBG A;  2DY7 A;  5FO8 B;  1RHP A;  4KTA A;  4NP5 A;  5C5M A;  4K2K A;  3FDT A;  4C56 C;  1I6H B;  2AQ2 B;  1SMY C;  2EYO A;  3BG3 A;  1WTQ A;  1LV9 A;  3A7L A;  1NUC A;  2WIN B;  2Z8L A;  1F9Q A;  2SNM A;  2E2H B;  3A8J E;  3PIP 3;  1TWC B;  5C4X B;  4ZK9 B;  3OIP A;  5KRU A;  2F0U A;  2A68 C;  4ILW A;  2ICE C;  3NXW A;  2I46 A;  2B2V C;  2WP8 J;  1JOO A;  5EKK A;  1CZG A;  1H9J A;  5IGC A;  2E75 C;  3T56 B;  3NK9 A;  1LTB D;  3AU7 A;  4J6H A;  2ZXO A;  4P2C B;  2WII B;  4E6I A;  1RTN A;  2BA0 A;  2J4X A;  4CJ0 B;  4OHJ A;  5AFW A;  2NBF A;  5D3D A;  2EYL A;  3OWE B;  2RQX A;  1QNK A;  4LAA A;  4C3H G;  3BVG A;  3AMU A;  4ZKB B;  2IT1 A;  4A3D B;  3L9A X;  4H0L C;  3I4L A;  1X3Q A;  4S3S A;  1YNJ C;  3X3N A;  4FXD A;  3I91 A;  3A54 A;  1TT2 A;  1PZI D;  3GP7 A;  4Q5V A;  4DN4 M;  4RGN A;  1WTX A;  1OXV A;  4EVO A;  3SE0 A;  4IN3 A;  1SND A;  4XQJ A;  1LO5 D;  3TP6 A;  1RKN A;  2EY1 A;  5J1Z A;  1QOH A;  4L8J A;  1QJO A;  1BF4 A;  2R92 B;  3S17 B;  3K57 A;  2MP1 A;  3VA7 A;  3NQT A;  3M4O B;  1DOM A;  2EXZ A;  2K03 A;  1G8Z D;  1I4Q A;  4F88 A;  3M3Y B;  4XTC S;  4YIJ A;  3BS1 A;  4MHE A;  4X3S A;  2XN9 C;  1UAP A;  3H6M A;  4DNT B;  2NVX B;  3PUW A;  4C1N K;  2F0J A;  3S15 B;  1FD7 D;  4XDX A;  1JB3 A;  3GV6 A;  1D5M C;  4TSS A;  5CV7 A;  1PTO C;  2RKS A;  1Q12 A;  1HPC A;  4FF1 A;  4DU9 A;  4XXE A;  1RJT A;  2PCF B;  4CHT B;  1STE A;  1Q1B A;  3M7N A;  2JEA I;  2BA1 A;  4FNF A;  5FLX L;  5CBA E;  4KN4 C;  3MC0 B;  2XSC A;  2IL8 A;  3WOF A;  5I9O A;  3W2D A;  3MXU A;  4KKT A;  4OO1 G;  2C5C A;  3K59 A;  4HR7 B;  3D6W A;  3HZX A;  3I70 A;  1DXM A;  1TWG B;  2A6E D;  2RDG A;  4HSP A;  1ILP A;  4ODG A;  2F0T A;  5KEE A;  3ERO A;  3RLF A;  1IYU A;  4NW2 A;  3PV0 A;  2VUM B;  3PMF A;  2E76 C;  4OO1 I;  2PPB C;  2R6G A;  2LMC B;  1Q1E A;  2PQE A;  5JOB A;  1JWS D;  4PQX A;  2SNS A;  2TSS A;  1II3 A;  3RUZ A;  1CT1 D;  2EDG A;  4EGV A;  2EYM A;  5M9O A;  4KJO A;  4IQZ A;  4IUN A;  5JEA G;  1B3A A;  2KHS A;  1WTV A;  2BE5 C;  1S5B D;  4GZY C;  4FO2 A;  3TP8 A;  2KCN A;  3DMU A;  2O4X A;  3TZD A;  4RFB A;  5I6W A;  3AB9 A;  2F0N A;  2MGS A;  1S5D D;  2EPB A;  4ZUI A;  1O78 A;  2H1E A;  4KMU C;  3HRZ C;  2ZT9 C;  3K6O A;  5EPK A;  2FMC A;  4QIW B;  4R8N A;  5JEA J;  1BQQ T;  5BN3 A;  1EIH A;  4IAL A;  3OSO A;  1QWY A;  3MWY W;  4G4K A;  2F0K A;  3KLS X;  3HG9 A;  2NVY B;  1B2T A;  2FMM A;  5JJZ A;  2O2L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...