5JAVA

Crystal structure of staphylococcal nuclease variant delta+phs y91d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLADIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5javA00
1STHA 2F0NA 1JOKA 4ODGA 4ZUJA 4NP5A 3TP5A 2PW5A 1SYBA 1KDAA 2F0FA 3OWFA 5IGBA 4WRDA 3SK5A 1STBA 4WORA 4K8IA 2F0VA 4EQPA 2F0QA 2PZWA 2SNSA 3R3OA 3V2TA 5IGCA 1II3A 4S3SA 3D4DA 4KHVA 3ITPA 1ENCA 1EYDA 2SOBA 4NKLA 4TRDA 4K8JA 1A2UA 4B9WA 1AEXA 1JOOA 1SNOA 2F0EA 4NMZA 5CR3A 1STGA 2O4XA 5C6AA 1TT2A 4ID6A 2PYKA 4N9PA 3SR1A 2PZTA 2F0TA 4HMJA 4IALA 4N9TA 5J1ZA 2RBMA 2OXPA 1KDBA 1ENAA 2EY5A 4F8MA 4ZUIA 2OEOA 3TP7A 2PW7A 5I6YA 4K5VA 2RDFA 1NUCA 4DFAA 4G57A 5C4HA 5F2DA 5CV9A 1F2YA 4KTAA 3D4WA 1SNMA 1F2MA 2EY6A 3QOLA 5EGTA 5IOCA 3U9OA 2RKSA 2LKVA 4R8NA 2EYPA 3DMUA 2F0OA 2F0LA 1A3UA 5I9PA 2F0HA 1SNQA 4YIJA 5NUCA 4KY6A 3PMFA 1EQVA 2SNMA 3S9WA 5HURA 3E5SA 4IZ8A 5J22A 2F0JA 2F0SA 3D6CA 3HZXA 3NHHA 4PNYA 5E3FA 5DEHA 4DU9A 4EQOA 3TP6A 1JORA 4EVOA 2F0KA 1SYDA 1EZ8A 4QMGA 3T16A 5JAVA 3SXHA 5DAUA 1EZ6A 3HEJA 3EJIA 5C3XA 1EY6A 3DHQA 3C1FA 4K14A 4RKBA 5IODA 5CV5A 2F0PA 3RUZA 2EYMA 2F0UA 1SYFA 1STNA 4E6IA 5IGGA 1JOQA 5KRUA 1SYCA 5J39A 1A3TA 4KJOA 3SK4A 2EYOA 3OMCA 1IHZA 4J1MA 1KDCA 3OMGA 4QF4A 1EY8A 5ISRA 2EYFA 3MZ5A 3MVVA 1EYCA 1STYA 5K5PA 2NUCA 5C4ZA 3EVQA 4HMIA 2PZUA 3SK6A 3OSOA 2F3VA 3P75A 1SNDA 4DF7A 4K2KA 4KJNA 2KQ3A 5CV4A 5C5MA 3NQTA 5CV6A 2EYJA 3SK8A 5KYIA 4QB4A 4HTHA 5EKLA 1SYGA 4RKLA 4K6DA 1SNCA 1STAA 4MIUA 2EY1A 4KY7A 4I65A 3MXPA 4H7BA 5HGTA 3NP8A 4PMCA 2EXZA 1TR5A 5KIXA 1TQOA 4OL7A 5EKKA 5I9OA 5IGFA 1F2ZA 3P1HA 4K2LA 2F0WA 3LX0A 5CV7A 2ENBA 3T13A 4ME5A 1EYAA 4DGZA 5M9OA 1RKNA 2HQEA 2F0IA 5KYLA 5E1FA 2EYHA 1EY0A 4KD3A 5C3WA 2EY2A 4KD4A 5IGEA 3H6MA 4K5XA 1U9RA 2EYLA 3NXWA 4J6HA 3TMEA 5C5LA 5KEEA 2F0MA 3QOJA 5CV8A 3VA5A 1SNPA 3C1EA 4NDXA 4EQNA 3BDLA 5KGUA 1SYEA 1KAAA 3MHBA 2F0GA 2OF1A 3QB3A 4IUNA 1EY5A 5CGKA 2QDBA 1A3VA 3BDCA 3SHLA 4PMBA 1NSNS 3NK9A 5JOBA 2WACA 3D8GA 3NUCA 2M00A 4KY5A 3TP8A 1KABA 4KV6A 2F0DA 1EY9A 3EROA 2F3WA 4LAAA 2KHSA 4ZQ3A 4B9XA 5IGDA 5IIFA 5CC4A 3MEHA 1EY4A 4F7XA 3ERQA 4K5WA 1EY7A 2PQEA 5I6WA 1A2TA
chains in the Genus database with same CATH superfamily
1H9JA 3K6OA 4KN7C 4R4CA 4ZUJA 1N36L 4WJ4A 4DAYA 2K52A 1PFBA 1E2ZA 2F1MA 2K28A 1CM9A 2NVXH 1OXSC 2IW3A 3T53B 1IXRA 2BH2A 1VQ4A 2MGSA 2HQLA 4IQZA 4HCSA 4AYBE 2K05A 2N78A 1X3QA 3TSSA 4XTCS 4CDFC 4BBSH 1H9KA 1WTOA 1XTCD 1ET6A 1D6EC 2UUBL 5CBAE 4YWMA 3CCJA 4PQXA 1BCPF 1KDBA 1AW7A 4JI3Q 1U4PA 2L9HA 1XXGA 1FGUA 1STEA 2A6HD 1Q3LA 4ZYSA 2EY6A 5EGTA 1H9MA 1SFOH 2F0HA 2XRQD 3ONAB 1GUTA 2E76C 1XNQQ 2K32A 5HURA 3NELA 2NBFA 2YU9H 3H3VC 2F4VL 2D0OA 2V4DA 3S17B 1GKHA 1Y1VG 1J6QA 5K36H 3RUZA 1IL2A 4LFAL 4K6LA 3NBIA 2RHQB 5C0XH 1N34L 1B44D 1BBUA 1V1OA 4DAVA 1SNDA 1KLGD 4DR7Q 2PO4A 4YY3L 3RD4A 1MHWC 4RKLA 5IYDH 3BVZA 4K6DA 1J5EQ 2B2UA 3CCEA 1QVCA 2VQFQ 1QOHA 2JA5H 1QVGA 3S24A 2E2HH 3C46A 5EKKA 2BCOA 3PO3H 1SEBD 3IL8A 1VDZA 1VQ8A 2KBNA 3U50C 2PNHA 4PZ6A 4QIWB 2YYZA 3Q6SA 4XXEA 4CJ1B 5LMNQ 3BZCA 3K59A 1BBXC 2B2VA 5KNBA 1CZGA 1Q46A 3BDLA 2DGYA 4XYOA 2JEBI 3PF4A 1B3QA 3KF8B 2IHFA 4A3KB 4UY8C 1W2BA 4JI0Q 3DWQA 3EROA 1PH4A 2KJXA 3K5MA 5IGDA 4DPGA 1I4RA 4FNFA 3AFQA 3T1YL 3FHWA 1YHQA 4QGUA 4DAMA 3A74A 2K5HA 1ZYRC 4KMUC 1CSPA 4H44C 5IGCA 3VR3A 1K83H 1AFPA 4YHHQ 1XNRL 3PCOB 1HTLD 3I7FA 2QKIC 4HMJA 4N9TA 2PI2A 2A69D 3TP7A 2X6GA 2K6AA 5C4HA 3GTMH 5M5YH 5IT9c 2I0QA 2C35B 3FP9A 3NWSA 3IAYA 1DM0B 2M2LA 5TSSA 1AZQA 1EEFD 1IYJB 4JOIC 4YCVA 4DV2L 2JA8B 2ZJQA 4DV7Q 1JC7A 3CC2A 4R9WA 2R6GA 2QGQA 4KK7A 4A3DH 4LF8Q 1CA5A 2F0UA 2DN8A 4B08A 4BA1I 1TWGH 2EQSA 3FPPA 2OQKA 4BY7H 2K1BA 4ZLTF 3V96A 3HOXH 1D7QA 3D4RA 3H94A 3OSOA 2F3VA 2ZJRA 1JJGA 5CBEE 4K2KA 2E2DC 2KQ3A 3UDFA 1N36Q 3HG9A 3BU2A 4JBWA 5JJLA 4IJLA 1TVXA 1FNWA 1FD7D 1HNZQ 4TVAB 3C2PA 4GN5A 1I4HA 1H9SA 1TQOA 4A3KG 2Z6BA 2N8NA 5JEAH 2A8VA 5CV7A 2UUBQ 1YHBA 5J3BA 1VMCA 1XMOL 4KD3A 4UAIA 1CTMA 4OO1H 1R4PB 5C5LA 3MFYA 1HPCA 1U4MA 2FHTA 3JAMc 1SBBB 2CQAA 3E6ZX 4RFBA 3G4SA 1SMXA 1HZCA 5JPMC 3EN2A 3M4OB 5LMUL 1ZXTA 4KY5A 1GJXA 3TP8A 1KD1C 3HOYB 3KK7A 2WINB 1PTOB 1F77A 2FXQA 4B9XA 2F4VQ 3ERQA 2PQEA 4Y52H 1I4GA 1HFGA 1KDAA 2F0FA 4X3SA 4LFAQ 2RSNA 4LUOA 2NVTH 3HKZG 1PZJD 1BCPC 5GROA 1EYGA 2CWAA 1VQCA 1N34Q 3GTOB 5FLXL 1LTSD 2K5NA 4JI2L 3WOFA 5JJZA 4HIDA 4YY3Q 2Z6KC 2HDMA 3S1RB 1WCMB 3F2DA 3GTGB 2R3ZA 2DNCA 1CKOA 4FF4A 1CSQA 1E22A 4RAUC 2K5DA 4A3EB 4LF7L 4U673 1EL0A 1CKNB 1CT1D 3TBIB 4R4QA 1FGBD 5IOCA 2HDLA 1LYLA 3DMUA 2F0OA 2RCNA 1R9TB 4M8AA 4NXNL 1C7YA 3PMFA 1E2WA 1HZAA 2X69A 2R7ZH 4IPGA 2E2IH 4C3IB 3CAMA 3TP6A 4H13C 3UDXA 3SXHA 3GTQH 2VB3X 2K75A 3WWVA 1N33L 2JA6B 5I2XA 1GUOA 2WKCA 4KLKA 5C0XI 1HR0L 1PH1A 5IP9G 1V1QA 2B2WA 1L0YB 5C4JB 2NUCA 1PZKD 1TIID 3SK6A 4PV1C 2IX1A 1ZKOA 5BN4A 4JI6Q 2R92B 4J15A 2IX3A 2UUAL 2JA7G 1TR5A 3S1QH 3E9IA 3HOYG 1E7ZA 1XNRQ 4DV4L 4BBRG 5KYLA 1VCIA 5E1FA 3STBD 1VS0A 1VQIA 5CV8A 3K5LA 4NDXA 1DOKA 2G9HD 3A8KE 1K0SA 4IUNA 4RHSA 1RTNA 5A2QE 1IKLA 2K7VA 3BDCA 5EPKA 5JOBA 1EIGA 1SROA 3NUCA 1VQMA 3L3OC 4OEMB 1X32A 3MAQA 3RMHA 1EY4A 1OXUA 1WCMG 5I4DA 1J9OA 1E0BA 2QCPX 1JOKA 3BG3A 3EA6A 1PTOF 2HHHL 1E2VA 1TY0A 4K8IA 1Z7TA 3PO2G 1VQDA 4XT3B 1Y8OB 3RLOA 4TRDA 3CCMA 4B9WA 3M4QA 1F9PA 4C3IG 4ID6A 5C3EB 2HT1A 4A3BB 4A3CG 1Y1VH 1UEBA 2H1EA 2RDFA 2ZTEA 1B1ZA 3QOLA 1QUQB 3U9OA 4L5SA 4TKOB 3NBHA 1SNQA 4RGNA 3A5ZB 1XMOQ 4RWSC 1SXTA 4KY6A 2Z0SA 5LL6X 1MJEA 2OQ0A 4APVA 1RHPA 2EJFC 2E75C 2MHVA 1A8VA 2WAQG 5CMDA 1RTOA 3K0YA 1EY6A 2WV6D 4TQUS 1TWCH 2XWBB 5LMUQ 3BJUA 4DAYB 3CMEA 1HH2P 1Q90A 1CHQD 3BZDB 4OIKA 1GUSA 4KJNA 2KVMA 2CKZB 5KYIA 3QJYA 1KLUD 2MJ8A 3PIP3 2TSSA 3KDFA 4I65A 2JA9A 3I4NB 2QILA 1PH9A 2K01A 4GOPA 4FP5D 1XWEA 3SE0A 4B3SQ 1QILA 1MKHA 5IGFA 2QEXA 3A56A 1B7YB 4GKJL 1RKNA 2K33A 4DV0L 2VY3A 2UXBL 2EY2A 2XN9C 4J6HA 4QIWE 4LF7Q 3BS1A 2Z4HA 3VA5A 5KGUA 4CHTB 4UHVA 4CKCA 1K73C 3J80L 1RDPD 1ILPA 1IW7C 2QA4A 4PMBA 1NTGA 4NXNQ 1GUNA 5GQOA 4OHJA 2XWJB 4NB3A 2VUMB 5C3EG 3KF6A 4UDUC 3S17H 3HOXG 1A2TA 3SK8A 2V1CC 3L9AX 2RA4A 1N33Q 2O5JC 1B9MA 3TP5A 4M1UB 4JK1C 1HR0Q 3TEHB 2B2TA 2UXCL 4PZ7A 1C0AA 3OW7A 1VF7A 2R7DA 3K7AB 1WTHA 3QO2A 1GHJA 2C5CA 3BZKA 1L0WA 1YBYA 2WIIB 1XPRA 1HNWL 5D65A 1STGA 3MXGA 1C8CA 4U68A 5JEAG 4WJWA 4ZK9B 1S5DD 3S16H 1G2SA 2EJGC 1ENAA 2UUAQ 4AQYL 3W2DA 5BR8L 2PNRC 2KCNA 3D6WA 2GVBA 2LMCB 1F2MA 4DV4Q 3HKZE 2VL6A 4FF3A 3MXNA 3I3CA 2N49A 2E2JH 3E5SA 1H9RA 1SR3A 2K14A 5DEHA 2D9UA 3E9HA 3N52A 3NTIA 4A3IB 1XPOA 4P2CB 1OO9B 3O13A 3GTJH 4AH6A 2RHSB 3I4NG 2RCFA 3T1HL 3PIO3 5EPLA 1K8AC 1AE2A 4G7ZC 3TZDA 4A3KH 1ONLA 2VS1A 3VYRA 1KHIA 3R2IA 1PH2A 5HY6A 3KFUA 3ULPA 3L7ZC 1M8AA 3URYA 4A3LG 1A15A 2P5ZX 2HHHQ 2Z9HA 4MIUA 1X3PA 1E1TA 2Y0SB 3HOVG 4IFDJ 1QB5D 2CH4A 4JV5L 3HRZC 2I07B 1PZID 1JICA 5M9OA 4KD4A 3CW2C 5BN5A 4O0AA 1KAWA 3G71A 1PTOC 3KJOA 1QNUA 1MSGA 2E5LL 4RHRA 1SJHD 3S2DB 1UEAB 4F88A 1LTID 1QE6A 1MGSA 1EY7A 4P71A 1BKBA 1S3OA 1UAPA 2J0TD 4JBMA 2KUMA 4IOAA 1G291 3ULLA 3A0JA 3F1ZA 1O7LA 4JI8L 1IKMA 1G51A 1PDQA 3S2HB 3I55A 1CZWA 1II3A 1IBKL 3H0GB 1K8MA 3FKIG 1EYDA 5E4WC 2ZXPA 2ICIA 1H9SB 5CR3A 5H1SE 2ICEC 4A3IG 2AQ1B 5JVG3 3F8TA 4C3HG 4F8MA 1B3AA 2B29A 3KBGA 2D2CC 2MFIA 3CC4A 5IP9H 4A3GB 1OXVA 1TS4A 4GKJQ 2MO1A 1A3UA 4DV0Q 4X3UA 1D2BA 4YIJA 2UXBQ 2UXDQ 3SDZA 1GXDC 1N9WA 3S9WA 2C9OA 5ELEA 2CH4W 1S72A 1WTQA 4PNYA 5FLXE 2K5WA 3FEWX 2L1BA 3A5UA 2IY5B 3C1FA 1TS2A 2DY7A 2JA7H 5KRUA 3HOYH 1D5MC 3AEVA 1OXXK 4BBRH 5C4ZA 1I4XA 1K3BC 3P75A 1LTRD 3NQIA 1ICFB 1ZYRD 3AMUA 5IT9L 2UXCQ 1LO5D 2WAQE 1EIFA 4PMCA 1CUKA 5KIXA 3GTOH 2UUCQ 5I9OA 3G6EA 4N8FA 1F2ZA 1HNWQ 3DUZA 4LFBL 3T13A 3DWPA 3I8ZA 4Y7NB 3S1RH 4IFDG 2F0IA 3A55A 1WCMH 3GO5A 3GTGH 4X62L 4LFCL 1ML0D 4JBJA 3TMEA 4LWCA 3Q24A 1VQLA 4AQYQ 1TXYA 2F0MA 5BR8Q 3TS0A 1PH3A 1LT3D 2B63B 4OONA 3GD7A 3PO2H 4CDCC 2NN6H 2ATWA 1NSNS 3H0GG 3PUWA 4FF1A 2XVSA 4N8X1 2RDHA 2A68C 1L1OA 1MD2D 1L2FA 4IUVA 5IIFA 2KHIA 1DYQA 3CCSA 1X6OA 4C3IH 2YV5A 4HJ9A 1BVSA 4DV6L 2F0NA 4ODGA 4A3CH 3T1HQ 2MPMA 3GTLB 3ICEA 1M4VA 4ABNA 4CDEC 1T5EA 4I7AA 3D4DA 2PMZB 1K3RA 4NKLA 1YJ9A 1A2UA 1YJNA 3TQYA 1EIHA 1CK1A 1D5ZC 1B9NA 2J7ZA 1MJCA 3JAML 5LL6S 2PYKA 2PZTA 2ES2A 1JCKB 2I5LX 4KKTA 3UE0A 4DAPA 1GHKA 2B2YA 3JC66 1CKMA 2ZM6L 5E4XA 2LFNA 1XPUA 1UUPA 5A35A 1V1PB 1I4PA 1RODA 4JV5Q 1F2YA 1NAPA 3H3VH 1BO0A 1QWYA 1AE3A 3GTKH 2O5IC 3S14B 2A74C 2SNMA 4QJFA 3PF5A 1GVPA 3W5OA 5FLMG 2F52A 5IYBG 1XYIA 3HZXA 5M3MB 4UPAA 4DUZL 1PRTB 3T16A 4DV1L 5L37A 2DJFC 1NNXA 2NB0A 3J7AV 5C4XB 2D62A 3GV6A 4HN7A 3PUVA 1STNA 5FKAC 4JI1L 5KNCA 2E5LQ 2HUGA 3PUZA 1DZ1A 4CJ0B 1D5XC 4GN3B 1EYCA 1Z47A 1VQPA 2EIFA 3DEOA 2XSCA 1Z6HA 2L4NA 1SDFA 1HUNA 3PIOA 2R7FA 3AQQA 5EKLA 2EY1A 3DXJC 1BCPD 3I56A 2NZHA 4RMFA 1TWAB 2FMCA 4ZAIA 4DR5L 3L2PA 1IBKQ 2VZAA 3VR5A 3L0OA 1U0LA 5JVH3 4GLXA 1BNZA 3R93A 1EEID 1IYVA 2L0CA 1MIUA 2BOSA 1EY0A 1N8RC 5C3EH 4P74A 5FK9C 4NXML 2H4OA 5AFWA 3TDQA 3QR8A 3NBHB 1OTCA 4B3TQ 5ELCA 4IURA 4DNIA 1GUGA 1SJED 1SMYC 2QDBA 1JQYD 1I50B 1A3VA 1GUWA 2M00A 2N3SA 1TWHB 4DR6L 4JC0A 4RGOS 3I72A 3V05A 2KCCA 3D3RA 4NPSA 1NE3A 1ASYA 1SYBA 3OWFA 4H02A 2B2UC 1F9QA 5T1GA 1ASZA 2GVAA 4ZRZA 2WFWA 3ZYYX 3CF5A 1K28A 3KDFB 4WFN3 4GKKL 2FJ2A 4P72A 4K8JA 3J80E 4GOPB 1AEXA 2NVQH 3I91A 4LF4L 1JWSD 4RH6A 3OWEB 1NCVA 2B2VC 4IN3A 1HQMC 4QY7A 2NVXB 2EE1A 3I4NH 1N32L 1AP0A 1O7IA 4K5VA 4IPCA 1LUZA 4JI4L 4LFBQ 4BBSB 2RKSA 2B8FA 1LT5D 4R8NA 3A8IE 3A8JE 4X62Q 1PMRA 4LFCQ 4HSVA 4EX5A 5IP7G 2F0JA 3NE5B 4JVZA 5E3FA 2I46A 4UP8A 5LMNW 1QVFA 2JA8G 3HOZB 4A3LH 4RG1A 4K0KL 3HEJA 2ZT9C 1J8IA 1YHAA 5CV5A 4ZKBB 3SVMA 3KF6B 1TWFB 4TSSA 4HIOA 1SFOB 3HOVH 1SYCA 1PRTF 4IUQA 3SEBA 4A3MB 1VQ9A 3X3MA 1F9RA 1VQFA 5I2YA 4XQQA 4XIGS 2YU9B 2MP1A 3CRKC 5FOBB 4DV6Q 1EQQA 4L5RC 4R4OA 2A6EC 5EKIA 2HCCA 5FO9B 1V9PA 1S5BD 1E1OA 4HAEA 3WDNA 1KTKA 4DR3L 1O80A 1GO3E 1Q8KA 1DCZA 4G7OC 1FNVA 2F0WA 3S1NH 4EGVA 1XMQL 5JJKA 3W3AA 4HEDA 1MBYA 1QG7A 3MTSA 3VYUA 5M5XH 4A75A 3GDEA 3MXNB 3T1YQ 5FJ8G 3FRPB 4GLVB 3T4AC 1Y8PB 1LTAD 2JEAI 2K50A 2PCFB 4R4IA 2Q8IB 2F0GA 3PO3B 4V0BA 4A76A 2HD3A 2QEJC 3G7LA 4DXGA 4DK3C 3K58A 3FKIH 1PH5A 4C3JB 4IUPA 4LAAA 2N88A 1NR2A 4X6AH 4DUZQ 4A3IH 1LACA 2EPBA 2F4IA 3LNNA 4C3HH 2DNEA 4JI7L 4FF2A 2PQAA 4JI1Q 4LUZA 5JPNC 2KOLA 1RCVD 1QNKA 3CC7A 1R4QB 2SNSA 3R3OA 5C44B 1WVLA 4S3SA 2GN5A 2EDGA 4MTKA 3J7ZC 3TREA 2CVRA 2SOBA 2KCMA 1YIJA 1UE1A 3BVMA 1Q82C 5C6AA 4R8IA 4DV2Q 3HOZG 3DM1A 1Q8IA 2JN4A 4ZUIA 3H3VI 4DR5Q 5HGQA 1ZEQX 4IOCA 3K81C 2ZJPA 5KNDA 4A3MG 4A3EG 5I9PA 2EOTA 1EIYB 4NXMQ 2NN6G 3U58A 4DU9A 1YNXA 3QIAA 3C3LA 1EU3A 1SYDA 3J81c 1Z9FA 1I3QH 5DAUA 3GTMB 4FVMA 3CXCA 3I4OA 2F0PA 2EYMA 3HOWB 4GN4B 1IL8A 1XJVA 3OTOL 2EYOA 2JA6G 4DR6Q 3CP0A 1WYDA 3VR2A 1KNAA 4FDBA 3MZ5A 5K5PA 4IFDH 1RF2D 2NVYH 3M4YA 4OX9L 1X3FA 1CHPD 5CV6A 4KI0A 5DLQE 1STAA 3S1MH 1TWGB 3S2HH 4GKKQ 4Q0FA 3E0JA 3H0GH 2R92G 4XDXA 1HJPA 1CFMA 4C3JG 1NJIC 2AQ3B 1KRTA 4LF4Q 3IRBA 4JG2A 1FNUA 3A7AB 2BE5D 5EQ0A 5M5WB 1U9RA 1N32Q 4EQNA 4DKAC 1VQ6A 4JI4Q 1G2TA 3QB3A 1WJJA 5CGKA 1DGSA 5C44G 3SHLA 5IT9E 4IPHA 2B2WC 3PGZA 1S5ED 3ZJYC 4JI2Q 3EBEA 4LF5L 2QF7A 4OWXB 4K0KQ 4HJAA 4DR2L 1VQHA 3DM3A 4OO1I 1B2TA 1CQFA 4B3RL 4WRDA 1GOZA 3Q22A 4ULLA 3V2TA 1JE5A 2OTJA 1ENCA 4G4KA 2R93B 3KOJA 5FLMH 5IYBH 2AUKA 1S5CD 4I7ZC 2ID0A 4CKBA 2AUJD 1Q86C 4BWGB 2NVTB 3J80i 4DR3Q 3HOWG 4LF9L 1U4RA 4A3BG 1BF4A 3S15B 3NPPA 4GNXA 4X3TA 3RN2A 2GA4B 4OIJA 1XMQQ 2A5HA 4Y7NH 1PRTC 1I6HB 5J22A 2A19A 4QCLA 1JMCA 1L1OB 4JI3L 4QMGA 3W1BA 2B63H 2RDGA 1EZ6A 2ZTCA 5IODA 3PUYA 2AKWB 1RJTA 3HGBA 1PTOD 1Y14B 3UE1A 1X55A 2NTSA 3JAME 3CCLA 4WJ3M 1A3TA 3RN5A 4QF4A 4HSPA 1UWVA 3MVVA 1VQGA 3H91A 3E3XA 3VA7A 5GAHC 3AFPA 4JI7Q 1K8OA 3K8AA 1QZHA 1FL0A 4RCNA 2RSOA 4QB4A 1X3GA 3GTLH 3I4MB 1I4QA 4B3ML 3I2ZA 4KY7A 2EXZA 1UE5A 3HS0C 3LGJA 1ICWA 3M3YB 1EFWA 2A1AA 4YCWA 4DR7L 1C4QA 3FVQA 1HTPA 4HCEA 1QCBD 3K5OA 2H5XA 3OPOA 2NTTA 2KENA 1Y69U 3K5NA 2KEEA 2WACA 3S14H 1T5XD 2R93G 4OWWB 4IPDA 5LMNL 1O7ZA 5M3MH 1JB3A 3FPUB 4YCUA 4L5QA 4X64L 4A3JB 4NP5A 2I5HA 2PW5A 2VUMG 1G91A 1YNJC 5DM73 1YVCA 1Y1WB 1D1IA 1BBWA 3CCRA 3SK5A 1HA5A 2HIXA 3NTKA 3M85A 1XTDA 5DM63 2X6LA 4GOPC 4AIMA 2KECA 3P7JA 2Q2HA 4OX9Q 2BDNA 2FMMA 5IP7H 4R1JA 2AMCB 1WOCA 2ZTDA 3M7NA 3SR1A 2JA8H 4O2DA 2JSOA 2OEOA 3EQLC 4XT1B 4DFAA 4Z9CB 5F2DA 1HA6A 1FR3A 5GAEC 2FFKB 2L55A 2EYPA 3TN2A 2OT2A 2FINB 5ELNA 3F2UA 3NSWA 4IZ8A 1LM0A 1SRUA 1JORA 1Y1VB 4A93B 2EVBA 2F0KA 2Q2IA 4UP7A 3I4MG 1SSOA 1K0RA 4DK0A 1D1KA 5D14A 2B2TC 5IGGA 1WTRA 3EIVA 2A68D 3LWUA 3OMCA 2B3GA 1YNNC 4LF5Q 1KL9A 1YEZA 4HMIA 4H0LC 4DR2Q 1VQ7A 1MI2A 5IYCG 1U5KA 2JXMB 1PYWD 4DV5L 3KYHC 2EYJA 4ILWA 5FJ8H 4HTHA 1TWCB 2E8GA 4RA8A 1HFNA 3P20A 4H7BA 2CQOA 2VQEL 1HR0W 3TRZA 1OXTA 1SN8A 2Y0SG 4ME3A 2L12A 2ENBA 1EYAA 3M4OH 1FVIA 3J81E 1PTOH 1Y8NB 1DXMA 1HQRD 1JE4A 3R2TA 4A3JG 2KEDA 3T51B 3I4LA 3KUPA 4LF9Q 2LS01 4DUYL 1HNZL 1RIPA 2L15A 3QOJA 1Y1WG 3RZOB 1SNPA 3C1EA 1B50A 1JJCB 1H95A 1KXLA 3UDIA 1WI5A 4C1NI 3R8BA 2F3WA 4JOIA 3MEHA 3OIPA 1XX8A 4K5WA 3HOZH 1STHA 1CQVA 2QDLA 2OCEA 3PIPA 1WTXA 1EU4A 1TWFH 4A3FB 4HJ5A 1WTPA 1STBA 1UE7A 4EQPA 4A3MH 4A3EH 1EWCA 2E74C 3MXUA 1AH9A 1SNOA 1R9TH 2CFMA 4A93G 3CU7A 4MZ9A 4LF6L 4B3MQ 1S5FD 2G5DA 3CQZB 4QL5A 5I6YA 3EFXD 5ELDA 4CKEA 2JA6H 3D4WA 4C2MB 4IUTA 2WP8J 1YI2A 3MC0B 4KKSA 4A3GG 2NYZD 4QUFA 1LLRD 5NUCA 1KC8C 1MSHA 3H09A 5C4JH 3S16B 3NHHA 3OOCA 4IUUA 4EVOA 4P73A 2IL8A 2CW0C 4XQJA 1SMYD 4K14A 3CCUA 4KHPL 3Q8DA 1JOQA 2PQAB 3A7LA 4KJOA 2R92H 3GTPB 2XRSD 4C3JH 4OGQC 1GD7A 4GZYC 4X66L 2E2JB 3RLNA 3JAMi 1VQOA 5JJIA 3OHXC 2UU9L 3DWAA 4CDDC 2Z4IA 1KNEA 3MWYW 4DF7A 4X64Q 3GTJB 3NQTA 1SYGA 2ALYB 3KJPA 1HUMA 2LSSA 3T56B 5T1IA 5C44H 1BR9A 4DV3L 2LXJA 4DK1A 2A6HC 2MQHA 2HQEA 2Z6KA 3DEPA 3RZDB 3HOUB 3WOEA 2BH8A 5C3WA 1I5FA 4HJ8A 4JI6L 5G3LF 4JYAL 1NMFA 4A3FG 1RL2A 3M7GA 1SE4A 5ELOA 4JI8Q 1TKWB 2B63G 3NK9A 1TY2A 2YTXA 3B6YA 3D8GA 4BS9A 4OELB 4FXKC 1EY9A 2F03A 3K7UC 1KIXA 1EWIA 3J7AF 1WTVA 2HIVA 1EWHA 1Q7YC 3G48A 4UP9A 3HKZB 4ALPA 4DNTB 3HOWH 1PA6A 4A3BH 1HRJA 2XTIA 3HFZB 4YWLA 1YJWA 2LXKA 2L11A 4KHVA 2VXWA 2A6ED 4DV5Q 4BY1B 5IWAL 4IALA 2VQEQ 2EY5A 2R61A 4FYDA 2KHJA 4KTAA 3GV3A 1SNMA 1B70B 1Q1EA 3VR6A 4DR1L 2RQXA 4MHEA 3MEFA 1L1OC 1NR4A 2NWGA 1WD1A 5M3FB 5IY0A 1C9OA 2AWOA 5M5WH 1A62A 3CRLC 4DUYQ 5COYA 4NW2A 3D0FA 4LK1C 1V43A 1W6JA 5C3XA 4RKBA 5M3MG 1EOTA 2L5TA 3KBXA 5AJ3L 1SYFA 1QJOA 4O1NA 1HZ9A 5C4XG 1RD9D 4BXXG 1NBWA 3EVQA 3HOUG 2IT1A 1I94L 1HXYD 5CV4A 3UDGA 1G8ZD 3I90A 1AZPA 4GS3A 2WB1B 3CCVA 4L5TA 2NZ1D 2HCIA 4HIMA 2JA7B 2B2YC 1FYCA 3K80C 3OW2A 4KKUA 2A69C 3ND9A 5C0XJ 5D3DA 4JCVE 4BBRB 2OTLA 3NTHA 2R93H 3MA2B 2PPBC 3LX0A 2KA7A 1TS5A 2WKDA 4GNXB 4J8QA 4O42A 4LF6Q 2DY8A 3J81L 1PFMA 5BN3A 3MFGA 2VUMH 1I6VC 4DK6C 4EQ5A 1E3PA 3Q0AA 2ZXRA 5EBDA 3RNUA 3S15H 2CHBD 4KN4C 3J81i 1JT8A 4B3SL 1EY5A 1PXUA 4JI5L 1BXTA 4MN3A 2VNUD 1B4OA 1I6HH 1KABA 4BA2I 4BY1G 1HNXL 3K7AH 5G3LD 2Y0SE 5CORA 1U4LA 1JR0D 2PI2E 3VDYA 1IBML 5I6WA 4OWTB 1LT6D 1G6PA 1ET9A 2N55A 4KHPQ 3PO2B 3F2BA 3TZUA 2D5DA 1EQRA 2MUYA 4WORA 2ZM6Q 2F0VA 1ESRA 3QWNA 2F0QA 4AYBB 1A63A 4X66Q 2JA5B 1IBLL 1P16A 4LJZC 3DLLA 2E2HB 1SE3A 2NN6I 1EFID 3ITPA 2UU9Q 5M3FG 4X65L 5EPJA 1VQ5A 4DR4L 4N9PA 4MTNA 3I4MH 1EQTA 1QZGA 4IO9A 3VYTA 2EJMA 2IX0A 2PW7A 4DV1Q 4F87A 1Q1BA 3KLWA 4G57A 4Q5VA 4DV3Q 4HIKA 3M3YH 1PYBA 5EBCA 1EOVA 2IPKD 2LKVA 1TU2B 4A4IA 2MNAA 4RGTA 4BBSG 5IYCH 2WAQB 3ND8A 3J7YW 4JYAQ 1BUVT 1A0IA 2OWOA 1VQBA 1X56A 2O2LD 1VQAA 2CCZA 4JW0A 2WB1G 2BDOA 4IJHA 1F9SA 4FXGC 3EJIA 3DHQA 3KF8A 4OXPA 1X54A 2DUDA 1G6ZA 3D31A 3KLSX 3PUXA 1V8QA 5J39A 1Q81C 2K03A 3CPFA 1SE8A 3CD6A 1KDCA 3OMGA 3GTKB 1EY8A 1V1PA 3CCQA 1S40A 2Q8TA 2VW9A 2I5MX 1K83B 4A3JH 2AQ2B 3NWTA 4POGA 3HP3A 1Y1WH 3AYHB 3HKSA 1O78A 2A73B 5K36G 4KHZA 5D3IB 4OL7A 5M5YB 1HCZA 4QUCA 1VQJA 1IW7D 5C0XG 4K2LA 3FMCA 2Q2UA 5IWAQ 4DGZA 2JK8A 2EYHA 1M90C 2IJ0A 5FLXc 3S2DH 4GLAC 2YTYA 1ILQA 2EYLA 3NENA 3NXWA 1DOMA 4K5XA 3RLFA 1FJGL 5KEEA 5IYDG 4X3KA 1SYEA 4A3DB 3MHBA 5ELBA 2OF1A 4AYBG 5JEAJ 2JA5G 1SAPA 1F2LA 4DR1Q 1BQQT 1PRTD 2K5VA 3PO3G 3BVGA 3CHBD 2K04A 2F0DA 4BY7B 4LNQA 4ZQ3A 3HOXB 5CC4A 4A93H 1YZ6A 2AWNA 1EZ8A 1KRSA 4RCOA 5GADC 1LTTD 3TS2A 1W6KA 1TS3A 3SGIA 5AJ3Q 2RF4A 5E7NA 2JP1A 2VB2X 2NZOA 1UE6A 4HR7B 3I70A 1SE2A 3G6JB 4A3GH 1I94Q 1PFSA 1JOOA 4NMZA 4FO2A 4V190 2O4XA 2IHEA 1TT2A 2Z1CA 2F0TA 4L63B 5J1ZA 2D0PA 3ER0A 1HZBA 2RBMA 3ERSX 2OXPA 3STBC 1JWMD 2K5QA 4C56C 1X65A 1LTGD 4PMWA 3ULJA 3J7A5 5CV9A 3BYYB 1PYSB 1S4ZA 1A6XA 2K4KA 1PFNA 1CA6A 4CGYB 4JPBW 3U4ZA 2NVQB 2XIWA 4DA2A 1D8LA 4MNOA 3BYTB 1EQVA 3IFTA 4DXFA 1L0XB 4EQOA 1M1KC 3RZOH 1Q12A 5ELFA 4P75A 1PH6A 2PMZE 3KLRA 4JI5Q 5IE8A 3SK4A 1O7YA 2JQOA 1IHZA 2ZXOA 3J81j 1PHJA 2IWHA 1HNXQ 3K0XA 2UXDL 2XGTA 4LMQD 2PZUA 1IBMQ 5FO7B 5GAGC 3M4PA 3OYYA 1YNJD 2DJGC 1KQSA 4A3FH 5DNFA 5EAYA 4ZCKA 2F3IA 2YTVA 4A3DG 3HOVB 2ASBA 3IKJA 1PH7A 3MXPA 1VQEA 1IBLQ 1GM5A 4X65Q 5FO8B 3U4VA 4BY7G 3AU7A 1K8GA 1PH8A 4DR4Q 3GQBA 1EUJA 1NMGA 1HHVA 1XNQL 1CKNA 3FDTA 2R7ZB 4C1NK 2J4XA 3CQZH 3A54A 2E2IB 1CI3M 2JJQA 4POFA 1KAAA 1LTLA 3GTQB 4C2MH 2UUCL 1WFQA 1B53A 2B39A 3VYSA 4G7HC 3X3NA 1NY4A 3AB9A 4R4TA 4DNRB 1JWUD 3S1NB 2TMPA 1WD0A 4JBKA 1LABA 1YITA 2KHSA 5M5XB 2BE5C 3H15A 1JB7A 4LUVA 3E0EA 3CPWA 1JJ2A 4OO1G 4PZ8A 2BA0A 5IGBA 2Q8RE 1J5EL 3GTPH 3LWEA 4CJ2C 4XQNA 2PZWA 3FKIB 2VQFL 1YNND 3PV0A 2BA1A 3S1QB 2EXDA 3NEMA 1BCPB 1E24A 4YWKA 3OIQA 3CKIB 2JYOA 4PG3A 4C3HB 1LV9A 1VF5C 2F0EA 2B8GA 5CYUA 3Q23A 1P8LA 1X9NA 4QQBX 2XNAC 2EZVA 1B8AA 1ESFA 1NUCA 5C4XH 1PV4A 1C48A 4BXXH 2RVLA 4LW1A 5LHY1 3OTOQ 2JE6I 2F0LA 1K9MC 3RZDH 1BOSA 3HOUH 4JI0L 1SLJA 2CWPA 2Z8LA 4HJ7A 1AN8A 1FJGQ 2F0SA 3D6CA 3I73A 2SEBD 5JAVA 3F2CA 3N6RA 1DD2A 1WTWA 4RGMA 4E6IA 3U9SA 2QW7A 4J1MA 2LY7A 1PLFA 1TWAH 3GP7A 5ISRA 5EJWA 2EYFA 3J80c 1STYA 4L6TB 3K57A 2R7ZG 4YHHL 3BDOA 5C5MA 1I3QB 3UI2A 5A2QL 2Q2TA 3QG1A 1SNCA 1T9HA 2G9DA 1ENFA 1LTBD 2WB1E 1IZ6A 5HGTA 3NP8A 3CMAA 1VMPA 4GNXC 2NVYB 3M9BA 2SDFA 3PSIA 2MO0A 3P1HA 3VR4A 1VQKA 1I50H 1X3EA 4BY1H 4ME5A 1DJRD 4IFDI 1TWHH 3PQIA 1LT4D 5IGEA 3KLSA 3H6MA 3W1GA 3S1MB 4ZKCB 4DV7L 1PVOA 4CBVA 1QUQA 4XYQA 1VQNA 4LF8L 1DOLA 2M9VA 4B3RQ 1BDOA 2AHOB 5M3FH 1DONA 4KV6A 3IFDA 2KCTA 3RR5A 1IYUA 1W3SA 4FXDA 4L8JA 4DN4M 4F7XA 4B3TL 2CW0D 1UNSA
chains in the Genus database with same CATH topology
1H9JA 3K6OA 4KN7C 4ZUJA 4DAYA 1PFBA 1E2ZA 2F1MA 2K28A 1CM9A 1OXSC 2IW3A 3T53B 2MGSA 4IQZA 4HCSA 2K05A 1X3QA 3TSSA 4XTCS 1H9KA 1WTOA 1XTCD 1ET6A 1D6EC 5CBAE 4PQXA 1BCPF 1KDBA 1AW7A 1U4PA 2L9HA 1XXGA 1STEA 2A6HD 1Q3LA 4ZYSA 2EY6A 5EGTA 1H9MA 2F0HA 2XRQD 3ONAB 1GUTA 2E76C 2K32A 5HURA 2NBFA 3H3VC 2V4DA 3S17B 5K36H 3RUZA 4K6LA 3NBIA 5C0XH 1B44D 1V1OA 4DAVA 1SNDA 1KLGD 2PO4A 3RD4A 4RKLA 3BVZA 4K6DA 2B2UA 1QOHA 3C46A 5EKKA 2BCOA 1SEBD 3IL8A 1VDZA 4QIWB 2YYZA 3Q6SA 4XXEA 4CJ1B 3K59A 1BBXC 2B2VA 5KNBA 1CZGA 3BDLA 4XYOA 2JEBI 4A3KB 3DWQA 3EROA 2KJXA 3K5MA 5IGDA 1I4RA 4FNFA 1ZYRC 4KMUC 4H44C 5IGCA 3VR3A 1AFPA 1HTLD 2QKIC 4HMJA 4N9TA 2A69D 3TP7A 2X6GA 2K6AA 5C4HA 3NWSA 3IAYA 1DM0B 2M2LA 5TSSA 1AZQA 1EEFD 2JA8B 1JC7A 4R9WA 2R6GA 4KK7A 1CA5A 2F0UA 2DN8A 4B08A 4BA1I 3FPPA 2K1BA 4ZLTF 3V96A 3D4RA 3H94A 3OSOA 2F3VA 5CBEE 4K2KA 2E2DC 2KQ3A 3HG9A 4JBWA 1TVXA 1FNWA 1FD7D 3C2PA 1I4HA 1H9SA 1TQOA 5JEAH 5CV7A 1VMCA 4KD3A 4UAIA 1CTMA 4OO1H 1R4PB 5C5LA 3MFYA 1HPCA 1U4MA 2FHTA 1SBBB 2CQAA 3E6ZX 4RFBA 5JPMC 3M4OB 4KY5A 1ZXTA 1GJXA 3TP8A 3HOYB 3KK7A 2WINB 1PTOB 1F77A 4B9XA 3ERQA 2PQEA 1I4GA 1HFGA 1KDAA 2F0FA 4X3SA 2RSNA 1PZJD 1BCPC 3GTOB 5FLXL 1LTSD 3WOFA 5JJZA 2HDMA 3S1RB 1WCMB 3GTGB 2R3ZA 2DNCA 4FF4A 4RAUC 2K5DA 4A3EB 4U673 1EL0A 1CT1D 3TBIB 1FGBD 5IOCA 2HDLA 3DMUA 2F0OA 1R9TB 4M8AA 3PMFA 1E2WA 2X69A 4C3IB 3TP6A 4H13C 3SXHA 2VB3X 2JA6B 5I2XA 1GUOA 2WKCA 5C0XI 2B2WA 1L0YB 5C4JB 2NUCA 1PZKD 1TIID 3SK6A 4PV1C 2IX1A 1ZKOA 5BN4A 2R92B 2IX3A 1TR5A 5KYLA 1VCIA 5E1FA 5CV8A 3K5LA 4NDXA 1DOKA 2G9HD 3A8KE 4IUNA 4RHSA 1RTNA 5A2QE 1IKLA 2K7VA 3BDCA 5EPKA 5JOBA 1EIGA 3NUCA 3L3OC 1X32A 3MAQA 3RMHA 1EY4A 1OXUA 5I4DA 1J9OA 1E0BA 2QCPX 1JOKA 3BG3A 3EA6A 1PTOF 1E2VA 1TY0A 4K8IA 1Z7TA 4XT3B 1Y8OB 4TRDA 4B9WA 1F9PA 4C3IG 4ID6A 5C3EB 4A3BB 2H1EA 2RDFA 1B1ZA 3QOLA 3U9OA 4TKOB 3NBHA 1SNQA 4RGNA 4RWSC 1SXTA 4KY6A 5LL6X 1RHPA 2EJFC 2E75C 2MHVA 5CMDA 1RTOA 3K0YA 1EY6A 2WV6D 4TQUS 2XWBB 1Q90A 1CHQD 3BZDB 4OIKA 1GUSA 4KJNA 2KVMA 5KYIA 3QJYA 1KLUD 2MJ8A 3PIP3 2TSSA 4I65A 3I4NB 2QILA 2K01A 4FP5D 1XWEA 3SE0A 1QILA 5IGFA 3A56A 1RKNA 2K33A 2EY2A 2XN9C 4J6HA 3BS1A 2Z4HA 3VA5A 5KGUA 4CHTB 4CKCA 3J80L 1RDPD 1ILPA 1IW7C 4PMBA 1GUNA 4OHJA 2XWJB 2VUMB 4UDUC 3SK8A 1A2TA 3L9AX 2RA4A 2O5JC 1B9MA 3TP5A 4M1UB 4JK1C 2B2TA 3OW7A 1VF7A 3K7AB 3QO2A 1GHJA 2C5CA 2WIIB 5D65A 1STGA 3MXGA 1C8CA 4U68A 5JEAG 4WJWA 4ZK9B 1S5DD 1G2SA 2EJGC 1ENAA 3W2DA 2PNRC 2KCNA 3D6WA 2LMCB 1F2MA 4FF3A 3MXNA 3I3CA 3E5SA 1H9RA 5DEHA 2D9UA 3NTIA 3N52A 4A3IB 4P2CB 1OO9B 3O13A 3PIO3 5EPLA 4G7ZC 3TZDA 1ONLA 3VYRA 3R2IA 3L7ZC 1M8AA 3URYA 1A15A 4MIUA 1X3PA 2Y0SB 4IFDJ 1QB5D 3HRZC 2I07B 1PZID 1JICA 5M9OA 4KD4A 5BN5A 1PTOC 1QNUA 1MSGA 4RHRA 1SJHD 3S2DB 1UEAB 4F88A 1LTID 1QE6A 1MGSA 1EY7A 1UAPA 2J0TD 2KUMA 1G291 1O7LA 1IKMA 1PDQA 3S2HB 1CZWA 1II3A 3H0GB 1K8MA 1EYDA 5E4WC 2ZXPA 2ICIA 1H9SB 5CR3A 2ICEC 2AQ1B 5JVG3 4C3HG 4F8MA 1B3AA 3KBGA 2D2CC 4A3GB 1OXVA 1TS4A 1A3UA 4X3UA 1D2BA 4YIJA 3SDZA 1GXDC 3S9WA 2C9OA 5ELEA 1WTQA 4PNYA 5FLXE 2K5WA 3FEWX 2L1BA 3C1FA 1TS2A 2DY7A 5KRUA 1D5MC 1OXXK 5C4ZA 1I4XA 3P75A 1LTRD 3NQIA 1ZYRD 3AMUA 5IT9L 1LO5D 4PMCA 5KIXA 5I9OA 1F2ZA 3DUZA 3T13A 3DWPA 3I8ZA 4Y7NB 4IFDG 2F0IA 3A55A 3GO5A 1ML0D 3TMEA 3Q24A 2F0MA 1LT3D 2B63B 3GD7A 2NN6H 1NSNS 4FF1A 3PUWA 2XVSA 2RDHA 2A68C 1MD2D 4IUVA 5IIFA 1DYQA 2F0NA 4ODGA 2MPMA 3GTLB 1M4VA 4ABNA 1T5EA 3D4DA 2PMZB 4NKLA 1EIHA 1A2UA 1CK1A 1D5ZC 1B9NA 2J7ZA 3JAML 5LL6S 2PYKA 2PZTA 1JCKB 1GHKA 4KKTA 4DAPA 2B2YA 5E4XA 2LFNA 1UUPA 5A35A 1V1PB 1I4PA 1RODA 1F2YA 1NAPA 1BO0A 1QWYA 3S14B 2O5IC 2A74C 2SNMA 1XYIA 3HZXA 5M3MB 1PRTB 3T16A 2NB0A 5C4XB 3J7AV 2D62A 3GV6A 4HN7A 3PUVA 1STNA 5FKAC 5KNCA 2HUGA 3PUZA 1DZ1A 4CJ0B 1D5XC 1EYCA 1Z47A 3DEOA 2XSCA 1Z6HA 2L4NA 1SDFA 1HUNA 5EKLA 2EY1A 3DXJC 1BCPD 1TWAB 2FMCA 4ZAIA 3VR5A 5JVH3 1BNZA 3R93A 1EEID 1IYVA 2L0CA 2BOSA 1EY0A 5FK9C 2H4OA 3TDQA 5AFWA 5ELCA 4IURA 1GUGA 1SJED 1SMYC 2QDBA 1JQYD 1I50B 1A3VA 1GUWA 2M00A 1TWHB 4RGOS 3I72A 3V05A 2KCCA 3D3RA 1SYBA 3OWFA 2B2UC 1F9QA 5T1GA 4ZRZA 3ZYYX 4WFN3 2FJ2A 4K8JA 3J80E 1AEXA 3I91A 1JWSD 4RH6A 3OWEB 1NCVA 2B2VC 4IN3A 1HQMC 2NVXB 2EE1A 1AP0A 4K5VA 4BBSB 2RKSA 2B8FA 1LT5D 4R8NA 3A8IE 3A8JE 1PMRA 4HSVA 2F0JA 3NE5B 5E3FA 2I46A 3HOZB 3HEJA 2ZT9C 1J8IA 4ZKBB 5CV5A 3SVMA 1TWFB 4TSSA 1SFOB 1SYCA 1PRTF 4IUQA 3SEBA 4A3MB 3X3MA 1F9RA 5I2YA 4XQQA 4XIGS 2YU9B 2MP1A 3CRKC 5FOBB 2A6EC 5EKIA 2HCCA 5FO9B 1S5BD 4HAEA 3WDNA 1KTKA 1O80A 1DCZA 4G7OC 1FNVA 2F0WA 4EGVA 3W3AA 4HEDA 1MBYA 1QG7A 3MTSA 3VYUA 3FRPB 3T4AC 1Y8PB 1LTAD 2JEAI 2PCFB 2Q8IB 2F0GA 3PO3B 4V0BA 2QEJC 3G7LA 4DXGA 3K58A 4C3JB 4IUPA 4LAAA 2N88A 1NR2A 1LACA 2EPBA 2F4IA 3LNNA 2DNEA 4FF2A 5JPNC 2KOLA 1RCVD 1QNKA 1R4QB 2SNSA 3R3OA 5C44B 1WVLA 4S3SA 2EDGA 2CVRA 2SOBA 3BVMA 5C6AA 4R8IA 3DM1A 1Q8IA 4ZUIA 1ZEQX 5KNDA 5I9PA 2EOTA 2NN6G 4DU9A 3QIAA 3C3LA 1EU3A 1SYDA 5DAUA 3GTMB 4FVMA 2F0PA 2EYMA 3HOWB 1IL8A 2EYOA 3VR2A 1KNAA 3MZ5A 5K5PA 4IFDH 1RF2D 3M4YA 1CHPD 5CV6A 4KI0A 1STAA 1TWGB 4Q0FA 3E0JA 4XDXA 1CFMA 4C3JG 2AQ3B 1FNUA 3A7AB 2BE5D 5EQ0A 5M5WB 1U9RA 4EQNA 1G2TA 3QB3A 5CGKA 3SHLA 5IT9E 2B2WC 1S5ED 2QF7A 4OO1I 1B2TA 1CQFA 4WRDA 1GOZA 3Q22A 4ULLA 3V2TA 1ENCA 4G4KA 2R93B 2AUKA 1S5CD 4I7ZC 2ID0A 4CKBA 2AUJD 4BWGB 2NVTB 1U4RA 1BF4A 3S15B 3NPPA 4X3TA 2GA4B 4OIJA 2A5HA 1PRTC 1I6HB 5J22A 4QCLA 4QMGA 2RDGA 1EZ6A 5IODA 3PUYA 1RJTA 3HGBA 1PTOD 3JAME 2NTSA 1A3TA 4QF4A 4HSPA 3MVVA 3H91A 3VA7A 1K8OA 4RCNA 2RSOA 4QB4A 3I4MB 1I4QA 4KY7A 2EXZA 3HS0C 1ICWA 3M3YB 1C4QA 3FVQA 1HTPA 4HCEA 1QCBD 3K5OA 3OPOA 2NTTA 1Y69U 3K5NA 2KEEA 2WACA 1T5XD 1O7ZA 1JB3A 3FPUB 4A3JB 4NP5A 2PW5A 1G91A 1YNJC 5DM73 1Y1WB 1D1IA 3SK5A 1HA5A 3NTKA 3M85A 5DM63 2X6LA 2KECA 3P7JA 2BDNA 2FMMA 3M7NA 3SR1A 2JSOA 2OEOA 3EQLC 4XT1B 4DFAA 4Z9CB 5F2DA 1HA6A 1FR3A 2FFKB 2L55A 2EYPA 3TN2A 2OT2A 2FINB 3F2UA 3NSWA 4IZ8A 1JORA 1Y1VB 4A93B 2EVBA 2F0KA 1SSOA 4DK0A 1D1KA 5D14A 2B2TC 5IGGA 1WTRA 2A68D 3LWUA 3OMCA 1YNNC 4HMIA 4H0LC 1MI2A 2JXMB 1PYWD 2EYJA 4ILWA 4HTHA 1TWCB 4RA8A 1HFNA 3P20A 4H7BA 1OXTA 2L12A 2ENBA 1EYAA 3J81E 1PTOH 1Y8NB 1DXMA 1HQRD 1JE4A 3R2TA 2KEDA 3T51B 3I4LA 3KUPA 2LS01 3RZOB 3QOJA 1SNPA 3C1EA 1B50A 4C1NI 3R8BA 2F3WA 3MEHA 3OIPA 1XX8A 4K5WA 1STHA 1CQVA 1WTXA 1EU4A 4A3FB 1WTPA 1STBA 4EQPA 1EWCA 2E74C 3MXUA 1SNOA 3CU7A 1S5FD 3CQZB 5I6YA 3EFXD 5ELDA 4CKEA 3D4WA 4C2MB 4IUTA 2WP8J 3MC0B 4KKSA 2NYZD 4QUFA 1LLRD 5NUCA 1MSHA 3H09A 3S16B 3NHHA 3OOCA 4IUUA 4EVOA 2IL8A 2CW0C 4XQJA 1SMYD 4K14A 1JOQA 3A7LA 4KJOA 3GTPB 2XRSD 4OGQC 4GZYC 2E2JB 3OHXC 3DWAA 2Z4IA 1KNEA 3MWYW 4DF7A 3GTJB 3NQTA 1SYGA 1HUMA 3T56B 5T1IA 1BR9A 4DK1A 2A6HC 2HQEA 3DEPA 3RZDB 3HOUB 3WOEA 5C3WA 5G3LF 3M7GA 1SE4A 1TKWB 1TY2A 3NK9A 4BS9A 3D8GA 4FXKC 1EY9A 2F03A 3J7AF 1WTVA 1EWHA 3HKZB 4DNTB 1HRJA 2L11A 4KHVA 2VXWA 2A6ED 4BY1B 4IALA 2EY5A 2R61A 4FYDA 4KTAA 3GV3A 1SNMA 1Q1EA 3VR6A 2RQXA 4MHEA 1NR4A 2NWGA 1WD1A 5M3FB 2AWOA 3CRLC 5COYA 4NW2A 4LK1C 1V43A 1W6JA 5C3XA 4RKBA 1EOTA 2L5TA 3KBXA 1SYFA 1QJOA 4O1NA 1RD9D 3EVQA 2IT1A 1HXYD 5CV4A 1G8ZD 3I90A 1AZPA 2WB1B 2NZ1D 2HCIA 2JA7B 2B2YC 1FYCA 4KKUA 2A69C 3ND9A 5C0XJ 5D3DA 4BBRB 3NTHA 3MA2B 2PPBC 3LX0A 2KA7A 1TS5A 2WKDA 4J8QA 4O42A 2DY8A 3J81L 1PFMA 5BN3A 3MFGA 1I6VC 3Q0AA 2ZXRA 5EBDA 2CHBD 4KN4C 1EY5A 1PXUA 1BXTA 4MN3A 2VNUD 1B4OA 1KABA 4BA2I 5G3LD 5CORA 1U4LA 1JR0D 5I6WA 1LT6D 1ET9A 2N55A 3PO2B 3TZUA 2D5DA 4WORA 2MUYA 2F0VA 1ESRA 3QWNA 2F0QA 4AYBB 2JA5B 4LJZC 2E2HB 1SE3A 2NN6I 1EFID 3ITPA 5EPJA 4N9PA 1EQTA 3VYTA 2EJMA 2IX0A 2PW7A 4F87A 1Q1BA 4G57A 4Q5VA 5EBCA 2IPKD 2LKVA 1TU2B 4RGTA 2WAQB 3ND8A 3J7YW 1BUVT 2O2LD 2BDOA 1F9SA 4FXGC 3EJIA 3DHQA 3KF8A 1G6ZA 3D31A 3KLSX 3PUXA 1V8QA 5J39A 2K03A 1KDCA 3OMGA 3GTKB 1EY8A 1V1PA 2Q8TA 1K83B 2AQ2B 3NWTA 3HP3A 1O78A 2A73B 5K36G 4KHZA 5D3IB 4OL7A 5M5YB 1HCZA 4QUCA 1IW7D 5C0XG 4K2LA 3FMCA 4DGZA 2EYHA 2IJ0A 1ILQA 2EYLA 4K5XA 3NXWA 1DOMA 3RLFA 5KEEA 4X3KA 1SYEA 4A3DB 3MHBA 5ELBA 2OF1A 5JEAJ 1SAPA 1F2LA 1BQQT 1PRTD 3BVGA 3CHBD 2K04A 2F0DA 4BY7B 4ZQ3A 3HOXB 5CC4A 2AWNA 1EZ8A 4RCOA 1LTTD 1W6KA 1TS3A 2JP1A 2VB2X 4HR7B 3I70A 1SE2A 3G6JB 4NMZA 1JOOA 4V190 4FO2A 2O4XA 1TT2A 2Z1CA 2F0TA 4L63B 5J1ZA 2RBMA 2OXPA 1JWMD 2K5QA 4C56C 1LTGD 4PMWA 5CV9A 3BYYB 1S4ZA 1A6XA 1PFNA 1CA6A 4CGYB 2NVQB 2XIWA 4DA2A 3BYTB 1EQVA 3IFTA 4DXFA 1L0XB 4EQOA 1Q12A 5ELFA 3KLRA 3SK4A 1O7YA 1IHZA 2ZXOA 2IWHA 4LMQD 2PZUA 5FO7B 1YNJD 5DNFA 3HOVB 3IKJA 3MXPA 5FO8B 3AU7A 3GQBA 1HHVA 2R7ZB 3FDTA 4C1NK 2J4XA 3A54A 2E2IB 1CI3M 1KAAA 3GTQB 1B53A 2B39A 3VYSA 4G7HC 3X3NA 3AB9A 4DNRB 1JWUD 3S1NB 2TMPA 1WD0A 1LABA 2KHSA 5M5XB 2BE5C 4OO1G 2BA0A 5IGBA 2Q8RE 3LWEA 4CJ2C 4XQNA 2PZWA 3FKIB 1YNND 3PV0A 2BA1A 3S1QB 1BCPB 3OIQA 3CKIB 2JYOA 4C3HB 1LV9A 1VF5C 2F0EA 2B8GA 5CYUA 3Q23A 2XNAC 2EZVA 1ESFA 1NUCA 1C48A 2RVLA 5LHY1 2JE6I 2F0LA 1BOSA 2Z8LA 1AN8A 2F0SA 3D6CA 3I73A 2SEBD 5JAVA 3N6RA 1DD2A 1WTWA 4RGMA 4E6IA 3U9SA 4J1MA 2LY7A 1PLFA 3GP7A 5ISRA 5EJWA 2EYFA 1STYA 4L6TB 3K57A 3BDOA 5C5MA 1I3QB 3UI2A 5A2QL 3QG1A 1SNCA 2G9DA 1ENFA 1LTBD 5HGTA 3NP8A 1VMPA 2NVYB 2SDFA 3VR4A 3P1HA 4ME5A 1DJRD 4IFDI 1LT4D 5IGEA 3KLSA 3H6MA 3S1MB 4ZKCB 4CBVA 4XYQA 1DOLA 2M9VA 1BDOA 1DONA 4KV6A 3IFDA 1IYUA 4FXDA 4L8JA 4DN4M 4F7XA 2CW0D 1UNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STH A;  2F0N A;  1JOK A;  4ODG A;  4ZUJ A;  4NP5 A;  3TP5 A;  2PW5 A;  1SYB A;  1KDA A;  2F0F A;  3OWF A;  5IGB A;  4WRD A;  3SK5 A;  1STB A;  4WOR A;  4K8I A;  2F0V A;  4EQP A;  2F0Q A;  2PZW A;  2SNS A;  3R3O A;  3V2T A;  5IGC A;  1II3 A;  4S3S A;  3D4D A;  4KHV A;  3ITP A;  1ENC A;  1EYD A;  2SOB A;  4NKL A;  4TRD A;  4K8J A;  1A2U A;  4B9W A;  1AEX A;  1JOO A;  1SNO A;  2F0E A;  4NMZ A;  5CR3 A;  1STG A;  2O4X A;  5C6A A;  1TT2 A;  4ID6 A;  2PYK A;  4N9P A;  3SR1 A;  2PZT A;  2F0T A;  4HMJ A;  4IAL A;  4N9T A;  5J1Z A;  2RBM A;  2OXP A;  1KDB A;  1ENA A;  2EY5 A;  4F8M A;  4ZUI A;  2OEO A;  3TP7 A;  2PW7 A;  5I6Y A;  4K5V A;  2RDF A;  1NUC A;  4DFA A;  4G57 A;  5C4H A;  5F2D A;  5CV9 A;  1F2Y A;  4KTA A;  3D4W A;  1SNM A;  1F2M A;  2EY6 A;  3QOL A;  5EGT A;  5IOC A;  3U9O A;  2RKS A;  2LKV A;  4R8N A;  2EYP A;  3DMU A;  2F0O A;  2F0L A;  1A3U A;  5I9P A;  2F0H A;  1SNQ A;  4YIJ A;  5NUC A;  4KY6 A;  3PMF A;  1EQV A;  2SNM A;  3S9W A;  5HUR A;  3E5S A;  4IZ8 A;  5J22 A;  2F0J A;  2F0S A;  3D6C A;  3HZX A;  3NHH A;  4PNY A;  5E3F A;  5DEH A;  4DU9 A;  4EQO A;  3TP6 A;  1JOR A;  4EVO A;  2F0K A;  1SYD A;  1EZ8 A;  4QMG A;  3T16 A;  5JAV A;  3SXH A;  5DAU A;  1EZ6 A;  3HEJ A;  3EJI A;  5C3X A;  1EY6 A;  3DHQ A;  3C1F A;  4K14 A;  4RKB A;  5IOD A;  5CV5 A;  2F0P A;  3RUZ A;  2EYM A;  2F0U A;  1SYF A;  1STN A;  4E6I A;  5IGG A;  1JOQ A;  5KRU A;  1SYC A;  5J39 A;  1A3T A;  4KJO A;  3SK4 A;  2EYO A;  3OMC A;  1IHZ A;  4J1M A;  1KDC A;  3OMG A;  4QF4 A;  1EY8 A;  5ISR A;  2EYF A;  3MZ5 A;  3MVV A;  1EYC A;  1STY A;  5K5P A;  2NUC A;  5C4Z A;  3EVQ A;  4HMI A;  2PZU A;  3SK6 A;  3OSO A;  2F3V A;  3P75 A;  1SND A;  4DF7 A;  4K2K A;  4KJN A;  2KQ3 A;  5CV4 A;  5C5M A;  3NQT A;  5CV6 A;  2EYJ A;  3SK8 A;  5KYI A;  4QB4 A;  4HTH A;  5EKL A;  1SYG A;  4RKL A;  4K6D A;  1SNC A;  1STA A;  4MIU A;  2EY1 A;  4KY7 A;  4I65 A;  3MXP A;  4H7B A;  5HGT A;  3NP8 A;  4PMC A;  2EXZ A;  1TR5 A;  5KIX A;  1TQO A;  4OL7 A;  5EKK A;  5I9O A;  5IGF A;  1F2Z A;  3P1H A;  4K2L A;  2F0W A;  3LX0 A;  5CV7 A;  2ENB A;  3T13 A;  4ME5 A;  1EYA A;  4DGZ A;  5M9O A;  1RKN A;  2HQE A;  2F0I A;  5KYL A;  5E1F A;  2EYH A;  1EY0 A;  4KD3 A;  5C3W A;  2EY2 A;  4KD4 A;  5IGE A;  3H6M A;  4K5X A;  1U9R A;  2EYL A;  3NXW A;  4J6H A;  3TME A;  5C5L A;  5KEE A;  2F0M A;  3QOJ A;  5CV8 A;  3VA5 A;  1SNP A;  3C1E A;  4NDX A;  4EQN A;  3BDL A;  5KGU A;  1SYE A;  1KAA A;  3MHB A;  2F0G A;  2OF1 A;  3QB3 A;  4IUN A;  1EY5 A;  5CGK A;  2QDB A;  1A3V A;  3BDC A;  3SHL A;  4PMB A;  1NSN S;  3NK9 A;  5JOB A;  2WAC A;  3D8G A;  3NUC A;  2M00 A;  4KY5 A;  3TP8 A;  1KAB A;  4KV6 A;  2F0D A;  1EY9 A;  3ERO A;  2F3W A;  4LAA A;  2KHS A;  4ZQ3 A;  4B9X A;  5IGD A;  5IIF A;  5CC4 A;  3MEH A;  1EY4 A;  4F7X A;  3ERQ A;  4K5W A;  1EY7 A;  2PQE A;  5I6W A;  1A2T A; 
#chains in the Genus database with same CATH topology
 1H9J A;  3K6O A;  4KN7 C;  4R4C A;  4ZUJ A;  1N36 L;  4WJ4 A;  4DAY A;  2K52 A;  1PFB A;  1E2Z A;  2F1M A;  2K28 A;  1CM9 A;  2NVX H;  1OXS C;  2IW3 A;  3T53 B;  1IXR A;  2BH2 A;  1VQ4 A;  2MGS A;  2HQL A;  4IQZ A;  4HCS A;  4AYB E;  2K05 A;  2N78 A;  1X3Q A;  3TSS A;  4XTC S;  4CDF C;  4BBS H;  1H9K A;  1WTO A;  1XTC D;  1ET6 A;  1D6E C;  2UUB L;  5CBA E;  4YWM A;  3CCJ A;  4PQX A;  1BCP F;  1KDB A;  1AW7 A;  4JI3 Q;  1U4P A;  2L9H A;  1XXG A;  1FGU A;  1STE A;  2A6H D;  1Q3L A;  4ZYS A;  2EY6 A;  5EGT A;  1H9M A;  1SFO H;  2F0H A;  2XRQ D;  3ONA B;  1GUT A;  2E76 C;  1XNQ Q;  2K32 A;  5HUR A;  3NEL A;  2NBF A;  2YU9 H;  3H3V C;  2F4V L;  2D0O A;  2V4D A;  3S17 B;  1GKH A;  1Y1V G;  1J6Q A;  5K36 H;  3RUZ A;  1IL2 A;  4LFA L;  4K6L A;  3NBI A;  2RHQ B;  5C0X H;  1N34 L;  1B44 D;  1BBU A;  1V1O A;  4DAV A;  1SND A;  1KLG D;  4DR7 Q;  2PO4 A;  4YY3 L;  3RD4 A;  1MHW C;  4RKL A;  5IYD H;  3BVZ A;  4K6D A;  1J5E Q;  2B2U A;  3CCE A;  1QVC A;  2VQF Q;  1QOH A;  2JA5 H;  1QVG A;  3S24 A;  2E2H H;  3C46 A;  5EKK A;  2BCO A;  3PO3 H;  1SEB D;  3IL8 A;  1VDZ A;  1VQ8 A;  2KBN A;  3U50 C;  2PNH A;  4PZ6 A;  4QIW B;  2YYZ A;  3Q6S A;  4XXE A;  4CJ1 B;  5LMN Q;  3BZC A;  3K59 A;  1BBX C;  2B2V A;  5KNB A;  1CZG A;  1Q46 A;  3BDL A;  2DGY A;  4XYO A;  2JEB I;  3PF4 A;  1B3Q A;  3KF8 B;  2IHF A;  4A3K B;  4UY8 C;  1W2B A;  4JI0 Q;  3DWQ A;  3ERO A;  1PH4 A;  2KJX A;  3K5M A;  5IGD A;  4DPG A;  1I4R A;  4FNF A;  3AFQ A;  3T1Y L;  3FHW A;  1YHQ A;  4QGU A;  4DAM A;  3A74 A;  2K5H A;  1ZYR C;  4KMU C;  1CSP A;  4H44 C;  5IGC A;  3VR3 A;  1K83 H;  1AFP A;  4YHH Q;  1XNR L;  3PCO B;  1HTL D;  3I7F A;  2QKI C;  4HMJ A;  4N9T A;  2PI2 A;  2A69 D;  3TP7 A;  2X6G A;  2K6A A;  5C4H A;  3GTM H;  5M5Y H;  5IT9 c;  2I0Q A;  2C35 B;  3FP9 A;  3NWS A;  3IAY A;  1DM0 B;  2M2L A;  5TSS A;  1AZQ A;  1EEF D;  1IYJ B;  4JOI C;  4YCV A;  4DV2 L;  2JA8 B;  2ZJQ A;  4DV7 Q;  1JC7 A;  3CC2 A;  4R9W A;  2R6G A;  2QGQ A;  4KK7 A;  4A3D H;  4LF8 Q;  1CA5 A;  2F0U A;  2DN8 A;  4B08 A;  4BA1 I;  1TWG H;  2EQS A;  3FPP A;  2OQK A;  4BY7 H;  2K1B A;  4ZLT F;  3V96 A;  3HOX H;  1D7Q A;  3D4R A;  3H94 A;  3OSO A;  2F3V A;  2ZJR A;  1JJG A;  5CBE E;  4K2K A;  2E2D C;  2KQ3 A;  3UDF A;  1N36 Q;  3HG9 A;  3BU2 A;  4JBW A;  5JJL A;  4IJL A;  1TVX A;  1FNW A;  1FD7 D;  1HNZ Q;  4TVA B;  3C2P A;  4GN5 A;  1I4H A;  1H9S A;  1TQO A;  4A3K G;  2Z6B A;  2N8N A;  5JEA H;  2A8V A;  5CV7 A;  2UUB Q;  1YHB A;  5J3B A;  1VMC A;  1XMO L;  4KD3 A;  4UAI A;  1CTM A;  4OO1 H;  1R4P B;  5C5L A;  3MFY A;  1HPC A;  1U4M A;  2FHT A;  3JAM c;  1SBB B;  2CQA A;  3E6Z X;  4RFB A;  3G4S A;  1SMX A;  1HZC A;  5JPM C;  3EN2 A;  3M4O B;  5LMU L;  1ZXT A;  4KY5 A;  1GJX A;  3TP8 A;  1KD1 C;  3HOY B;  3KK7 A;  2WIN B;  1PTO B;  1F77 A;  2FXQ A;  4B9X A;  2F4V Q;  3ERQ A;  2PQE A;  4Y52 H;  1I4G A;  1HFG A;  1KDA A;  2F0F A;  4X3S A;  4LFA Q;  2RSN A;  4LUO A;  2NVT H;  3HKZ G;  1PZJ D;  1BCP C;  5GRO A;  1EYG A;  2CWA A;  1VQC A;  1N34 Q;  3GTO B;  5FLX L;  1LTS D;  2K5N A;  4JI2 L;  3WOF A;  5JJZ A;  4HID A;  4YY3 Q;  2Z6K C;  2HDM A;  3S1R B;  1WCM B;  3F2D A;  3GTG B;  2R3Z A;  2DNC A;  1CKO A;  4FF4 A;  1CSQ A;  1E22 A;  4RAU C;  2K5D A;  4A3E B;  4LF7 L;  4U67 3;  1EL0 A;  1CKN B;  1CT1 D;  3TBI B;  4R4Q A;  1FGB D;  5IOC A;  2HDL A;  1LYL A;  3DMU A;  2F0O A;  2RCN A;  1R9T B;  4M8A A;  4NXN L;  1C7Y A;  3PMF A;  1E2W A;  1HZA A;  2X69 A;  2R7Z H;  4IPG A;  2E2I H;  4C3I B;  3CAM A;  3TP6 A;  4H13 C;  3UDX A;  3SXH A;  3GTQ H;  2VB3 X;  2K75 A;  3WWV A;  1N33 L;  2JA6 B;  5I2X A;  1GUO A;  2WKC A;  4KLK A;  5C0X I;  1HR0 L;  1PH1 A;  5IP9 G;  1V1Q A;  2B2W A;  1L0Y B;  5C4J B;  2NUC A;  1PZK D;  1TII D;  3SK6 A;  4PV1 C;  2IX1 A;  1ZKO A;  5BN4 A;  4JI6 Q;  2R92 B;  4J15 A;  2IX3 A;  2UUA L;  2JA7 G;  1TR5 A;  3S1Q H;  3E9I A;  3HOY G;  1E7Z A;  1XNR Q;  4DV4 L;  4BBR G;  5KYL A;  1VCI A;  5E1F A;  3STB D;  1VS0 A;  1VQI A;  5CV8 A;  3K5L A;  4NDX A;  1DOK A;  2G9H D;  3A8K E;  1K0S A;  4IUN A;  4RHS A;  1RTN A;  5A2Q E;  1IKL A;  2K7V A;  3BDC A;  5EPK A;  5JOB A;  1EIG A;  1SRO A;  3NUC A;  1VQM A;  3L3O C;  4OEM B;  1X32 A;  3MAQ A;  3RMH A;  1EY4 A;  1OXU A;  1WCM G;  5I4D A;  1J9O A;  1E0B A;  2QCP X;  1JOK A;  3BG3 A;  3EA6 A;  1PTO F;  2HHH L;  1E2V A;  1TY0 A;  4K8I A;  1Z7T A;  3PO2 G;  1VQD A;  4XT3 B;  1Y8O B;  3RLO A;  4TRD A;  3CCM A;  4B9W A;  3M4Q A;  1F9P A;  4C3I G;  4ID6 A;  5C3E B;  2HT1 A;  4A3B B;  4A3C G;  1Y1V H;  1UEB A;  2H1E A;  2RDF A;  2ZTE A;  1B1Z A;  3QOL A;  1QUQ B;  3U9O A;  4L5S A;  4TKO B;  3NBH A;  1SNQ A;  4RGN A;  3A5Z B;  1XMO Q;  4RWS C;  1SXT A;  4KY6 A;  2Z0S A;  5LL6 X;  1MJE A;  2OQ0 A;  4APV A;  1RHP A;  2EJF C;  2E75 C;  2MHV A;  1A8V A;  2WAQ G;  5CMD A;  1RTO A;  3K0Y A;  1EY6 A;  2WV6 D;  4TQU S;  1TWC H;  2XWB B;  5LMU Q;  3BJU A;  4DAY B;  3CME A;  1HH2 P;  1Q90 A;  1CHQ D;  3BZD B;  4OIK A;  1GUS A;  4KJN A;  2KVM A;  2CKZ B;  5KYI A;  3QJY A;  1KLU D;  2MJ8 A;  3PIP 3;  2TSS A;  3KDF A;  4I65 A;  2JA9 A;  3I4N B;  2QIL A;  1PH9 A;  2K01 A;  4GOP A;  4FP5 D;  1XWE A;  3SE0 A;  4B3S Q;  1QIL A;  1MKH A;  5IGF A;  2QEX A;  3A56 A;  1B7Y B;  4GKJ L;  1RKN A;  2K33 A;  4DV0 L;  2VY3 A;  2UXB L;  2EY2 A;  2XN9 C;  4J6H A;  4QIW E;  4LF7 Q;  3BS1 A;  2Z4H A;  3VA5 A;  5KGU A;  4CHT B;  4UHV A;  4CKC A;  1K73 C;  3J80 L;  1RDP D;  1ILP A;  1IW7 C;  2QA4 A;  4PMB A;  1NTG A;  4NXN Q;  1GUN A;  5GQO A;  4OHJ A;  2XWJ B;  4NB3 A;  2VUM B;  5C3E G;  3KF6 A;  4UDU C;  3S17 H;  3HOX G;  1A2T A;  3SK8 A;  2V1C C;  3L9A X;  2RA4 A;  1N33 Q;  2O5J C;  1B9M A;  3TP5 A;  4M1U B;  4JK1 C;  1HR0 Q;  3TEH B;  2B2T A;  2UXC L;  4PZ7 A;  1C0A A;  3OW7 A;  1VF7 A;  2R7D A;  3K7A B;  1WTH A;  3QO2 A;  1GHJ A;  2C5C A;  3BZK A;  1L0W A;  1YBY A;  2WII B;  1XPR A;  1HNW L;  5D65 A;  1STG A;  3MXG A;  1C8C A;  4U68 A;  5JEA G;  4WJW A;  4ZK9 B;  1S5D D;  3S16 H;  1G2S A;  2EJG C;  1ENA A;  2UUA Q;  4AQY L;  3W2D A;  5BR8 L;  2PNR C;  2KCN A;  3D6W A;  2GVB A;  2LMC B;  1F2M A;  4DV4 Q;  3HKZ E;  2VL6 A;  4FF3 A;  3MXN A;  3I3C A;  2N49 A;  2E2J H;  3E5S A;  1H9R A;  1SR3 A;  2K14 A;  5DEH A;  2D9U A;  3E9H A;  3N52 A;  3NTI A;  4A3I B;  1XPO A;  4P2C B;  1OO9 B;  3O13 A;  3GTJ H;  4AH6 A;  2RHS B;  3I4N G;  2RCF A;  3T1H L;  3PIO 3;  5EPL A;  1K8A C;  1AE2 A;  4G7Z C;  3TZD A;  4A3K H;  1ONL A;  2VS1 A;  3VYR A;  1KHI A;  3R2I A;  1PH2 A;  5HY6 A;  3KFU A;  3ULP A;  3L7Z C;  1M8A A;  3URY A;  4A3L G;  1A15 A;  2P5Z X;  2HHH Q;  2Z9H A;  4MIU A;  1X3P A;  1E1T A;  2Y0S B;  3HOV G;  4IFD J;  1QB5 D;  2CH4 A;  4JV5 L;  3HRZ C;  2I07 B;  1PZI D;  1JIC A;  5M9O A;  4KD4 A;  3CW2 C;  5BN5 A;  4O0A A;  1KAW A;  3G71 A;  1PTO C;  3KJO A;  1QNU A;  1MSG A;  2E5L L;  4RHR A;  1SJH D;  3S2D B;  1UEA B;  4F88 A;  1LTI D;  1QE6 A;  1MGS A;  1EY7 A;  4P71 A;  1BKB A;  1S3O A;  1UAP A;  2J0T D;  4JBM A;  2KUM A;  4IOA A;  1G29 1;  3ULL A;  3A0J A;  3F1Z A;  1O7L A;  4JI8 L;  1IKM A;  1G51 A;  1PDQ A;  3S2H B;  3I55 A;  1CZW A;  1II3 A;  1IBK L;  3H0G B;  1K8M A;  3FKI G;  1EYD A;  5E4W C;  2ZXP A;  2ICI A;  1H9S B;  5CR3 A;  5H1S E;  2ICE C;  4A3I G;  2AQ1 B;  5JVG 3;  3F8T A;  4C3H G;  4F8M A;  1B3A A;  2B29 A;  3KBG A;  2D2C C;  2MFI A;  3CC4 A;  5IP9 H;  4A3G B;  1OXV A;  1TS4 A;  4GKJ Q;  2MO1 A;  1A3U A;  4DV0 Q;  4X3U A;  1D2B A;  4YIJ A;  2UXB Q;  2UXD Q;  3SDZ A;  1GXD C;  1N9W A;  3S9W A;  2C9O A;  5ELE A;  2CH4 W;  1S72 A;  1WTQ A;  4PNY A;  5FLX E;  2K5W A;  3FEW X;  2L1B A;  3A5U A;  2IY5 B;  3C1F A;  1TS2 A;  2DY7 A;  2JA7 H;  5KRU A;  3HOY H;  1D5M C;  3AEV A;  1OXX K;  4BBR H;  5C4Z A;  1I4X A;  1K3B C;  3P75 A;  1LTR D;  3NQI A;  1ICF B;  1ZYR D;  3AMU A;  5IT9 L;  2UXC Q;  1LO5 D;  2WAQ E;  1EIF A;  4PMC A;  1CUK A;  5KIX A;  3GTO H;  2UUC Q;  5I9O A;  3G6E A;  4N8F A;  1F2Z A;  1HNW Q;  3DUZ A;  4LFB L;  3T13 A;  3DWP A;  3I8Z A;  4Y7N B;  3S1R H;  4IFD G;  2F0I A;  3A55 A;  1WCM H;  3GO5 A;  3GTG H;  4X62 L;  4LFC L;  1ML0 D;  4JBJ A;  3TME A;  4LWC A;  3Q24 A;  1VQL A;  4AQY Q;  1TXY A;  2F0M A;  5BR8 Q;  3TS0 A;  1PH3 A;  1LT3 D;  2B63 B;  4OON A;  3GD7 A;  3PO2 H;  4CDC C;  2NN6 H;  2ATW A;  1NSN S;  3H0G G;  3PUW A;  4FF1 A;  2XVS A;  4N8X 1;  2RDH A;  2A68 C;  1L1O A;  1MD2 D;  1L2F A;  4IUV A;  5IIF A;  2KHI A;  1DYQ A;  3CCS A;  1X6O A;  4C3I H;  2YV5 A;  4HJ9 A;  1BVS A;  4DV6 L;  2F0N A;  4ODG A;  4A3C H;  3T1H Q;  2MPM A;  3GTL B;  3ICE A;  1M4V A;  4ABN A;  4CDE C;  1T5E A;  4I7A A;  3D4D A;  2PMZ B;  1K3R A;  4NKL A;  1YJ9 A;  1A2U A;  1YJN A;  3TQY A;  1EIH A;  1CK1 A;  1D5Z C;  1B9N A;  2J7Z A;  1MJC A;  3JAM L;  5LL6 S;  2PYK A;  2PZT A;  2ES2 A;  1JCK B;  2I5L X;  4KKT A;  3UE0 A;  4DAP A;  1GHK A;  2B2Y A;  3JC6 6;  1CKM A;  2ZM6 L;  5E4X A;  2LFN A;  1XPU A;  1UUP A;  5A35 A;  1V1P B;  1I4P A;  1ROD A;  4JV5 Q;  1F2Y A;  1NAP A;  3H3V H;  1BO0 A;  1QWY A;  1AE3 A;  3GTK H;  2O5I C;  3S14 B;  2A74 C;  2SNM A;  4QJF A;  3PF5 A;  1GVP A;  3W5O A;  5FLM G;  2F52 A;  5IYB G;  1XYI A;  3HZX A;  5M3M B;  4UPA A;  4DUZ L;  1PRT B;  3T16 A;  4DV1 L;  5L37 A;  2DJF C;  1NNX A;  2NB0 A;  3J7A V;  5C4X B;  2D62 A;  3GV6 A;  4HN7 A;  3PUV A;  1STN A;  5FKA C;  4JI1 L;  5KNC A;  2E5L Q;  2HUG A;  3PUZ A;  1DZ1 A;  4CJ0 B;  1D5X C;  4GN3 B;  1EYC A;  1Z47 A;  1VQP A;  2EIF A;  3DEO A;  2XSC A;  1Z6H A;  2L4N A;  1SDF A;  1HUN A;  3PIO A;  2R7F A;  3AQQ A;  5EKL A;  2EY1 A;  3DXJ C;  1BCP D;  3I56 A;  2NZH A;  4RMF A;  1TWA B;  2FMC A;  4ZAI A;  4DR5 L;  3L2P A;  1IBK Q;  2VZA A;  3VR5 A;  3L0O A;  1U0L A;  5JVH 3;  4GLX A;  1BNZ A;  3R93 A;  1EEI D;  1IYV A;  2L0C A;  1MIU A;  2BOS A;  1EY0 A;  1N8R C;  5C3E H;  4P74 A;  5FK9 C;  4NXM L;  2H4O A;  5AFW A;  3TDQ A;  3QR8 A;  3NBH B;  1OTC A;  4B3T Q;  5ELC A;  4IUR A;  4DNI A;  1GUG A;  1SJE D;  1SMY C;  2QDB A;  1JQY D;  1I50 B;  1A3V A;  1GUW A;  2M00 A;  2N3S A;  1TWH B;  4DR6 L;  4JC0 A;  4RGO S;  3I72 A;  3V05 A;  2KCC A;  3D3R A;  4NPS A;  1NE3 A;  1ASY A;  1SYB A;  3OWF A;  4H02 A;  2B2U C;  1F9Q A;  5T1G A;  1ASZ A;  2GVA A;  4ZRZ A;  2WFW A;  3ZYY X;  3CF5 A;  1K28 A;  3KDF B;  4WFN 3;  4GKK L;  2FJ2 A;  4P72 A;  4K8J A;  3J80 E;  4GOP B;  1AEX A;  2NVQ H;  3I91 A;  4LF4 L;  1JWS D;  4RH6 A;  3OWE B;  1NCV A;  2B2V C;  4IN3 A;  1HQM C;  4QY7 A;  2NVX B;  2EE1 A;  3I4N H;  1N32 L;  1AP0 A;  1O7I A;  4K5V A;  4IPC A;  1LUZ A;  4JI4 L;  4LFB Q;  4BBS B;  2RKS A;  2B8F A;  1LT5 D;  4R8N A;  3A8I E;  3A8J E;  4X62 Q;  1PMR A;  4LFC Q;  4HSV A;  4EX5 A;  5IP7 G;  2F0J A;  3NE5 B;  4JVZ A;  5E3F A;  2I46 A;  4UP8 A;  5LMN W;  1QVF A;  2JA8 G;  3HOZ B;  4A3L H;  4RG1 A;  4K0K L;  3HEJ A;  2ZT9 C;  1J8I A;  1YHA A;  5CV5 A;  4ZKB B;  3SVM A;  3KF6 B;  1TWF B;  4TSS A;  4HIO A;  1SFO B;  3HOV H;  1SYC A;  1PRT F;  4IUQ A;  3SEB A;  4A3M B;  1VQ9 A;  3X3M A;  1F9R A;  1VQF A;  5I2Y A;  4XQQ A;  4XIG S;  2YU9 B;  2MP1 A;  3CRK C;  5FOB B;  4DV6 Q;  1EQQ A;  4L5R C;  4R4O A;  2A6E C;  5EKI A;  2HCC A;  5FO9 B;  1V9P A;  1S5B D;  1E1O A;  4HAE A;  3WDN A;  1KTK A;  4DR3 L;  1O80 A;  1GO3 E;  1Q8K A;  1DCZ A;  4G7O C;  1FNV A;  2F0W A;  3S1N H;  4EGV A;  1XMQ L;  5JJK A;  3W3A A;  4HED A;  1MBY A;  1QG7 A;  3MTS A;  3VYU A;  5M5X H;  4A75 A;  3GDE A;  3MXN B;  3T1Y Q;  5FJ8 G;  3FRP B;  4GLV B;  3T4A C;  1Y8P B;  1LTA D;  2JEA I;  2K50 A;  2PCF B;  4R4I A;  2Q8I B;  2F0G A;  3PO3 B;  4V0B A;  4A76 A;  2HD3 A;  2QEJ C;  3G7L A;  4DXG A;  4DK3 C;  3K58 A;  3FKI H;  1PH5 A;  4C3J B;  4IUP A;  4LAA A;  2N88 A;  1NR2 A;  4X6A H;  4DUZ Q;  4A3I H;  1LAC A;  2EPB A;  2F4I A;  3LNN A;  4C3H H;  2DNE A;  4JI7 L;  4FF2 A;  2PQA A;  4JI1 Q;  4LUZ A;  5JPN C;  2KOL A;  1RCV D;  1QNK A;  3CC7 A;  1R4Q B;  2SNS A;  3R3O A;  5C44 B;  1WVL A;  4S3S A;  2GN5 A;  2EDG A;  4MTK A;  3J7Z C;  3TRE A;  2CVR A;  2SOB A;  2KCM A;  1YIJ A;  1UE1 A;  3BVM A;  1Q82 C;  5C6A A;  4R8I A;  4DV2 Q;  3HOZ G;  3DM1 A;  1Q8I A;  2JN4 A;  4ZUI A;  3H3V I;  4DR5 Q;  5HGQ A;  1ZEQ X;  4IOC A;  3K81 C;  2ZJP A;  5KND A;  4A3M G;  4A3E G;  5I9P A;  2EOT A;  1EIY B;  4NXM Q;  2NN6 G;  3U58 A;  4DU9 A;  1YNX A;  3QIA A;  3C3L A;  1EU3 A;  1SYD A;  3J81 c;  1Z9F A;  1I3Q H;  5DAU A;  3GTM B;  4FVM A;  3CXC A;  3I4O A;  2F0P A;  2EYM A;  3HOW B;  4GN4 B;  1IL8 A;  1XJV A;  3OTO L;  2EYO A;  2JA6 G;  4DR6 Q;  3CP0 A;  1WYD A;  3VR2 A;  1KNA A;  4FDB A;  3MZ5 A;  5K5P A;  4IFD H;  1RF2 D;  2NVY H;  3M4Y A;  4OX9 L;  1X3F A;  1CHP D;  5CV6 A;  4KI0 A;  5DLQ E;  1STA A;  3S1M H;  1TWG B;  3S2H H;  4GKK Q;  4Q0F A;  3E0J A;  3H0G H;  2R92 G;  4XDX A;  1HJP A;  1CFM A;  4C3J G;  1NJI C;  2AQ3 B;  1KRT A;  4LF4 Q;  3IRB A;  4JG2 A;  1FNU A;  3A7A B;  2BE5 D;  5EQ0 A;  5M5W B;  1U9R A;  1N32 Q;  4EQN A;  4DKA C;  1VQ6 A;  4JI4 Q;  1G2T A;  3QB3 A;  1WJJ A;  5CGK A;  1DGS A;  5C44 G;  3SHL A;  5IT9 E;  4IPH A;  2B2W C;  3PGZ A;  1S5E D;  3ZJY C;  4JI2 Q;  3EBE A;  4LF5 L;  2QF7 A;  4OWX B;  4K0K Q;  4HJA A;  4DR2 L;  1VQH A;  3DM3 A;  4OO1 I;  1B2T A;  1CQF A;  4B3R L;  4WRD A;  1GOZ A;  3Q22 A;  4ULL A;  3V2T A;  1JE5 A;  2OTJ A;  1ENC A;  4G4K A;  2R93 B;  3KOJ A;  5FLM H;  5IYB H;  2AUK A;  1S5C D;  4I7Z C;  2ID0 A;  4CKB A;  2AUJ D;  1Q86 C;  4BWG B;  2NVT B;  3J80 i;  4DR3 Q;  3HOW G;  4LF9 L;  1U4R A;  4A3B G;  1BF4 A;  3S15 B;  3NPP A;  4GNX A;  4X3T A;  3RN2 A;  2GA4 B;  4OIJ A;  1XMQ Q;  2A5H A;  4Y7N H;  1PRT C;  1I6H B;  5J22 A;  2A19 A;  4QCL A;  1JMC A;  1L1O B;  4JI3 L;  4QMG A;  3W1B A;  2B63 H;  2RDG A;  1EZ6 A;  2ZTC A;  5IOD A;  3PUY A;  2AKW B;  1RJT A;  3HGB A;  1PTO D;  1Y14 B;  3UE1 A;  1X55 A;  2NTS A;  3JAM E;  3CCL A;  4WJ3 M;  1A3T A;  3RN5 A;  4QF4 A;  4HSP A;  1UWV A;  3MVV A;  1VQG A;  3H91 A;  3E3X A;  3VA7 A;  5GAH C;  3AFP A;  4JI7 Q;  1K8O A;  3K8A A;  1QZH A;  1FL0 A;  4RCN A;  2RSO A;  4QB4 A;  1X3G A;  3GTL H;  3I4M B;  1I4Q A;  4B3M L;  3I2Z A;  4KY7 A;  2EXZ A;  1UE5 A;  3HS0 C;  3LGJ A;  1ICW A;  3M3Y B;  1EFW A;  2A1A A;  4YCW A;  4DR7 L;  1C4Q A;  3FVQ A;  1HTP A;  4HCE A;  1QCB D;  3K5O A;  2H5X A;  3OPO A;  2NTT A;  2KEN A;  1Y69 U;  3K5N A;  2KEE A;  2WAC A;  3S14 H;  1T5X D;  2R93 G;  4OWW B;  4IPD A;  5LMN L;  1O7Z A;  5M3M H;  1JB3 A;  3FPU B;  4YCU A;  4L5Q A;  4X64 L;  4A3J B;  4NP5 A;  2I5H A;  2PW5 A;  2VUM G;  1G91 A;  1YNJ C;  5DM7 3;  1YVC A;  1Y1W B;  1D1I A;  1BBW A;  3CCR A;  3SK5 A;  1HA5 A;  2HIX A;  3NTK A;  3M85 A;  1XTD A;  5DM6 3;  2X6L A;  4GOP C;  4AIM A;  2KEC A;  3P7J A;  2Q2H A;  4OX9 Q;  2BDN A;  2FMM A;  5IP7 H;  4R1J A;  2AMC B;  1WOC A;  2ZTD A;  3M7N A;  3SR1 A;  2JA8 H;  4O2D A;  2JSO A;  2OEO A;  3EQL C;  4XT1 B;  4DFA A;  4Z9C B;  5F2D A;  1HA6 A;  1FR3 A;  5GAE C;  2FFK B;  2L55 A;  2EYP A;  3TN2 A;  2OT2 A;  2FIN B;  5ELN A;  3F2U A;  3NSW A;  4IZ8 A;  1LM0 A;  1SRU A;  1JOR A;  1Y1V B;  4A93 B;  2EVB A;  2F0K A;  2Q2I A;  4UP7 A;  3I4M G;  1SSO A;  1K0R A;  4DK0 A;  1D1K A;  5D14 A;  2B2T C;  5IGG A;  1WTR A;  3EIV A;  2A68 D;  3LWU A;  3OMC A;  2B3G A;  1YNN C;  4LF5 Q;  1KL9 A;  1YEZ A;  4HMI A;  4H0L C;  4DR2 Q;  1VQ7 A;  1MI2 A;  5IYC G;  1U5K A;  2JXM B;  1PYW D;  4DV5 L;  3KYH C;  2EYJ A;  4ILW A;  5FJ8 H;  4HTH A;  1TWC B;  2E8G A;  4RA8 A;  1HFN A;  3P20 A;  4H7B A;  2CQO A;  2VQE L;  1HR0 W;  3TRZ A;  1OXT A;  1SN8 A;  2Y0S G;  4ME3 A;  2L12 A;  2ENB A;  1EYA A;  3M4O H;  1FVI A;  3J81 E;  1PTO H;  1Y8N B;  1DXM A;  1HQR D;  1JE4 A;  3R2T A;  4A3J G;  2KED A;  3T51 B;  3I4L A;  3KUP A;  4LF9 Q;  2LS0 1;  4DUY L;  1HNZ L;  1RIP A;  2L15 A;  3QOJ A;  1Y1W G;  3RZO B;  1SNP A;  3C1E A;  1B50 A;  1JJC B;  1H95 A;  1KXL A;  3UDI A;  1WI5 A;  4C1N I;  3R8B A;  2F3W A;  4JOI A;  3MEH A;  3OIP A;  1XX8 A;  4K5W A;  3HOZ H;  1STH A;  1CQV A;  2QDL A;  2OCE A;  3PIP A;  1WTX A;  1EU4 A;  1TWF H;  4A3F B;  4HJ5 A;  1WTP A;  1STB A;  1UE7 A;  4EQP A;  4A3M H;  4A3E H;  1EWC A;  2E74 C;  3MXU A;  1AH9 A;  1SNO A;  1R9T H;  2CFM A;  4A93 G;  3CU7 A;  4MZ9 A;  4LF6 L;  4B3M Q;  1S5F D;  2G5D A;  3CQZ B;  4QL5 A;  5I6Y A;  3EFX D;  5ELD A;  4CKE A;  2JA6 H;  3D4W A;  4C2M B;  4IUT A;  2WP8 J;  1YI2 A;  3MC0 B;  4KKS A;  4A3G G;  2NYZ D;  4QUF A;  1LLR D;  5NUC A;  1KC8 C;  1MSH A;  3H09 A;  5C4J H;  3S16 B;  3NHH A;  3OOC A;  4IUU A;  4EVO A;  4P73 A;  2IL8 A;  2CW0 C;  4XQJ A;  1SMY D;  4K14 A;  3CCU A;  4KHP L;  3Q8D A;  1JOQ A;  2PQA B;  3A7L A;  4KJO A;  2R92 H;  3GTP B;  2XRS D;  4C3J H;  4OGQ C;  1GD7 A;  4GZY C;  4X66 L;  2E2J B;  3RLN A;  3JAM i;  1VQO A;  5JJI A;  3OHX C;  2UU9 L;  3DWA A;  4CDD C;  2Z4I A;  1KNE A;  3MWY W;  4DF7 A;  4X64 Q;  3GTJ B;  3NQT A;  1SYG A;  2ALY B;  3KJP A;  1HUM A;  2LSS A;  3T56 B;  5T1I A;  5C44 H;  1BR9 A;  4DV3 L;  2LXJ A;  4DK1 A;  2A6H C;  2MQH A;  2HQE A;  2Z6K A;  3DEP A;  3RZD B;  3HOU B;  3WOE A;  2BH8 A;  5C3W A;  1I5F A;  4HJ8 A;  4JI6 L;  5G3L F;  4JYA L;  1NMF A;  4A3F G;  1RL2 A;  3M7G A;  1SE4 A;  5ELO A;  4JI8 Q;  1TKW B;  2B63 G;  3NK9 A;  1TY2 A;  2YTX A;  3B6Y A;  3D8G A;  4BS9 A;  4OEL B;  4FXK C;  1EY9 A;  2F03 A;  3K7U C;  1KIX A;  1EWI A;  3J7A F;  1WTV A;  2HIV A;  1EWH A;  1Q7Y C;  3G48 A;  4UP9 A;  3HKZ B;  4ALP A;  4DNT B;  3HOW H;  1PA6 A;  4A3B H;  1HRJ A;  2XTI A;  3HFZ B;  4YWL A;  1YJW A;  2LXK A;  2L11 A;  4KHV A;  2VXW A;  2A6E D;  4DV5 Q;  4BY1 B;  5IWA L;  4IAL A;  2VQE Q;  2EY5 A;  2R61 A;  4FYD A;  2KHJ A;  4KTA A;  3GV3 A;  1SNM A;  1B70 B;  1Q1E A;  3VR6 A;  4DR1 L;  2RQX A;  4MHE A;  3MEF A;  1L1O C;  1NR4 A;  2NWG A;  1WD1 A;  5M3F B;  5IY0 A;  1C9O A;  2AWO A;  5M5W H;  1A62 A;  3CRL C;  4DUY Q;  5COY A;  4NW2 A;  3D0F A;  4LK1 C;  1V43 A;  1W6J A;  5C3X A;  4RKB A;  5M3M G;  1EOT A;  2L5T A;  3KBX A;  5AJ3 L;  1SYF A;  1QJO A;  4O1N A;  1HZ9 A;  5C4X G;  1RD9 D;  4BXX G;  1NBW A;  3EVQ A;  3HOU G;  2IT1 A;  1I94 L;  1HXY D;  5CV4 A;  3UDG A;  1G8Z D;  3I90 A;  1AZP A;  4GS3 A;  2WB1 B;  3CCV A;  4L5T A;  2NZ1 D;  2HCI A;  4HIM A;  2JA7 B;  2B2Y C;  1FYC A;  3K80 C;  3OW2 A;  4KKU A;  2A69 C;  3ND9 A;  5C0X J;  5D3D A;  4JCV E;  4BBR B;  2OTL A;  3NTH A;  2R93 H;  3MA2 B;  2PPB C;  3LX0 A;  2KA7 A;  1TS5 A;  2WKD A;  4GNX B;  4J8Q A;  4O42 A;  4LF6 Q;  2DY8 A;  3J81 L;  1PFM A;  5BN3 A;  3MFG A;  2VUM H;  1I6V C;  4DK6 C;  4EQ5 A;  1E3P A;  3Q0A A;  2ZXR A;  5EBD A;  3RNU A;  3S15 H;  2CHB D;  4KN4 C;  3J81 i;  1JT8 A;  4B3S L;  1EY5 A;  1PXU A;  4JI5 L;  1BXT A;  4MN3 A;  2VNU D;  1B4O A;  1I6H H;  1KAB A;  4BA2 I;  4BY1 G;  1HNX L;  3K7A H;  5G3L D;  2Y0S E;  5COR A;  1U4L A;  1JR0 D;  2PI2 E;  3VDY A;  1IBM L;  5I6W A;  4OWT B;  1LT6 D;  1G6P A;  1ET9 A;  2N55 A;  4KHP Q;  3PO2 B;  3F2B A;  3TZU A;  2D5D A;  1EQR A;  2MUY A;  4WOR A;  2ZM6 Q;  2F0V A;  1ESR A;  3QWN A;  2F0Q A;  4AYB B;  1A63 A;  4X66 Q;  2JA5 B;  1IBL L;  1P16 A;  4LJZ C;  3DLL A;  2E2H B;  1SE3 A;  2NN6 I;  1EFI D;  3ITP A;  2UU9 Q;  5M3F G;  4X65 L;  5EPJ A;  1VQ5 A;  4DR4 L;  4N9P A;  4MTN A;  3I4M H;  1EQT A;  1QZG A;  4IO9 A;  3VYT A;  2EJM A;  2IX0 A;  2PW7 A;  4DV1 Q;  4F87 A;  1Q1B A;  3KLW A;  4G57 A;  4Q5V A;  4DV3 Q;  4HIK A;  3M3Y H;  1PYB A;  5EBC A;  1EOV A;  2IPK D;  2LKV A;  1TU2 B;  4A4I A;  2MNA A;  4RGT A;  4BBS G;  5IYC H;  2WAQ B;  3ND8 A;  3J7Y W;  4JYA Q;  1BUV T;  1A0I A;  2OWO A;  1VQB A;  1X56 A;  2O2L D;  1VQA A;  2CCZ A;  4JW0 A;  2WB1 G;  2BDO A;  4IJH A;  1F9S A;  4FXG C;  3EJI A;  3DHQ A;  3KF8 A;  4OXP A;  1X54 A;  2DUD A;  1G6Z A;  3D31 A;  3KLS X;  3PUX A;  1V8Q A;  5J39 A;  1Q81 C;  2K03 A;  3CPF A;  1SE8 A;  3CD6 A;  1KDC A;  3OMG A;  3GTK B;  1EY8 A;  1V1P A;  3CCQ A;  1S40 A;  2Q8T A;  2VW9 A;  2I5M X;  1K83 B;  4A3J H;  2AQ2 B;  3NWT A;  4POG A;  3HP3 A;  1Y1W H;  3AYH B;  3HKS A;  1O78 A;  2A73 B;  5K36 G;  4KHZ A;  5D3I B;  4OL7 A;  5M5Y B;  1HCZ A;  4QUC A;  1VQJ A;  1IW7 D;  5C0X G;  4K2L A;  3FMC A;  2Q2U A;  5IWA Q;  4DGZ A;  2JK8 A;  2EYH A;  1M90 C;  2IJ0 A;  5FLX c;  3S2D H;  4GLA C;  2YTY A;  1ILQ A;  2EYL A;  3NEN A;  3NXW A;  1DOM A;  4K5X A;  3RLF A;  1FJG L;  5KEE A;  5IYD G;  4X3K A;  1SYE A;  4A3D B;  3MHB A;  5ELB A;  2OF1 A;  4AYB G;  5JEA J;  2JA5 G;  1SAP A;  1F2L A;  4DR1 Q;  1BQQ T;  1PRT D;  2K5V A;  3PO3 G;  3BVG A;  3CHB D;  2K04 A;  2F0D A;  4BY7 B;  4LNQ A;  4ZQ3 A;  3HOX B;  5CC4 A;  4A93 H;  1YZ6 A;  2AWN A;  1EZ8 A;  1KRS A;  4RCO A;  5GAD C;  1LTT D;  3TS2 A;  1W6K A;  1TS3 A;  3SGI A;  5AJ3 Q;  2RF4 A;  5E7N A;  2JP1 A;  2VB2 X;  2NZO A;  1UE6 A;  4HR7 B;  3I70 A;  1SE2 A;  3G6J B;  4A3G H;  1I94 Q;  1PFS A;  1JOO A;  4NMZ A;  4FO2 A;  4V19 0;  2O4X A;  2IHE A;  1TT2 A;  2Z1C A;  2F0T A;  4L63 B;  5J1Z A;  2D0P A;  3ER0 A;  1HZB A;  2RBM A;  3ERS X;  2OXP A;  3STB C;  1JWM D;  2K5Q A;  4C56 C;  1X65 A;  1LTG D;  4PMW A;  3ULJ A;  3J7A 5;  5CV9 A;  3BYY B;  1PYS B;  1S4Z A;  1A6X A;  2K4K A;  1PFN A;  1CA6 A;  4CGY B;  4JPB W;  3U4Z A;  2NVQ B;  2XIW A;  4DA2 A;  1D8L A;  4MNO A;  3BYT B;  1EQV A;  3IFT A;  4DXF A;  1L0X B;  4EQO A;  1M1K C;  3RZO H;  1Q12 A;  5ELF A;  4P75 A;  1PH6 A;  2PMZ E;  3KLR A;  4JI5 Q;  5IE8 A;  3SK4 A;  1O7Y A;  2JQO A;  1IHZ A;  2ZXO A;  3J81 j;  1PHJ A;  2IWH A;  1HNX Q;  3K0X A;  2UXD L;  2XGT A;  4LMQ D;  2PZU A;  1IBM Q;  5FO7 B;  5GAG C;  3M4P A;  3OYY A;  1YNJ D;  2DJG C;  1KQS A;  4A3F H;  5DNF A;  5EAY A;  4ZCK A;  2F3I A;  2YTV A;  4A3D G;  3HOV B;  2ASB A;  3IKJ A;  1PH7 A;  3MXP A;  1VQE A;  1IBL Q;  1GM5 A;  4X65 Q;  5FO8 B;  3U4V A;  4BY7 G;  3AU7 A;  1K8G A;  1PH8 A;  4DR4 Q;  3GQB A;  1EUJ A;  1NMG A;  1HHV A;  1XNQ L;  1CKN A;  3FDT A;  2R7Z B;  4C1N K;  2J4X A;  3CQZ H;  3A54 A;  2E2I B;  1CI3 M;  2JJQ A;  4POF A;  1KAA A;  1LTL A;  3GTQ B;  4C2M H;  2UUC L;  1WFQ A;  1B53 A;  2B39 A;  3VYS A;  4G7H C;  3X3N A;  1NY4 A;  3AB9 A;  4R4T A;  4DNR B;  1JWU D;  3S1N B;  2TMP A;  1WD0 A;  4JBK A;  1LAB A;  1YIT A;  2KHS A;  5M5X B;  2BE5 C;  3H15 A;  1JB7 A;  4LUV A;  3E0E A;  3CPW A;  1JJ2 A;  4OO1 G;  4PZ8 A;  2BA0 A;  5IGB A;  2Q8R E;  1J5E L;  3GTP H;  3LWE A;  4CJ2 C;  4XQN A;  2PZW A;  3FKI B;  2VQF L;  1YNN D;  3PV0 A;  2BA1 A;  3S1Q B;  2EXD A;  3NEM A;  1BCP B;  1E24 A;  4YWK A;  3OIQ A;  3CKI B;  2JYO A;  4PG3 A;  4C3H B;  1LV9 A;  1VF5 C;  2F0E A;  2B8G A;  5CYU A;  3Q23 A;  1P8L A;  1X9N A;  4QQB X;  2XNA C;  2EZV A;  1B8A A;  1ESF A;  1NUC A;  5C4X H;  1PV4 A;  1C48 A;  4BXX H;  2RVL A;  4LW1 A;  5LHY 1;  3OTO Q;  2JE6 I;  2F0L A;  1K9M C;  3RZD H;  1BOS A;  3HOU H;  4JI0 L;  1SLJ A;  2CWP A;  2Z8L A;  4HJ7 A;  1AN8 A;  1FJG Q;  2F0S A;  3D6C A;  3I73 A;  2SEB D;  5JAV A;  3F2C A;  3N6R A;  1DD2 A;  1WTW A;  4RGM A;  4E6I A;  3U9S A;  2QW7 A;  4J1M A;  2LY7 A;  1PLF A;  1TWA H;  3GP7 A;  5ISR A;  5EJW A;  2EYF A;  3J80 c;  1STY A;  4L6T B;  3K57 A;  2R7Z G;  4YHH L;  3BDO A;  5C5M A;  1I3Q B;  3UI2 A;  5A2Q L;  2Q2T A;  3QG1 A;  1SNC A;  1T9H A;  2G9D A;  1ENF A;  1LTB D;  2WB1 E;  1IZ6 A;  5HGT A;  3NP8 A;  3CMA A;  1VMP A;  4GNX C;  2NVY B;  3M9B A;  2SDF A;  3PSI A;  2MO0 A;  3P1H A;  3VR4 A;  1VQK A;  1I50 H;  1X3E A;  4BY1 H;  4ME5 A;  1DJR D;  4IFD I;  1TWH H;  3PQI A;  1LT4 D;  5IGE A;  3KLS A;  3H6M A;  3W1G A;  3S1M B;  4ZKC B;  4DV7 L;  1PVO A;  4CBV A;  1QUQ A;  4XYQ A;  1VQN A;  4LF8 L;  1DOL A;  2M9V A;  4B3R Q;  1BDO A;  2AHO B;  5M3F H;  1DON A;  4KV6 A;  3IFD A;  2KCT A;  3RR5 A;  1IYU A;  1W3S A;  4FXD A;  4L8J A;  4DN4 M;  4F7X A;  4B3T L;  2CW0 D;  1UNS A; 
#chains in the Genus database with same CATH homology
 1H9J A;  3K6O A;  4KN7 C;  4ZUJ A;  4DAY A;  1PFB A;  1E2Z A;  2F1M A;  2K28 A;  1CM9 A;  1OXS C;  2IW3 A;  3T53 B;  2MGS A;  4IQZ A;  4HCS A;  2K05 A;  1X3Q A;  3TSS A;  4XTC S;  1H9K A;  1WTO A;  1XTC D;  1ET6 A;  1D6E C;  5CBA E;  4PQX A;  1BCP F;  1KDB A;  1AW7 A;  1U4P A;  2L9H A;  1XXG A;  1STE A;  2A6H D;  1Q3L A;  4ZYS A;  2EY6 A;  5EGT A;  1H9M A;  2F0H A;  2XRQ D;  3ONA B;  1GUT A;  2E76 C;  2K32 A;  5HUR A;  2NBF A;  3H3V C;  2V4D A;  3S17 B;  5K36 H;  3RUZ A;  4K6L A;  3NBI A;  5C0X H;  1B44 D;  1V1O A;  4DAV A;  1SND A;  1KLG D;  2PO4 A;  3RD4 A;  4RKL A;  3BVZ A;  4K6D A;  2B2U A;  1QOH A;  3C46 A;  5EKK A;  2BCO A;  1SEB D;  3IL8 A;  1VDZ A;  4QIW B;  2YYZ A;  3Q6S A;  4XXE A;  4CJ1 B;  3K59 A;  1BBX C;  2B2V A;  5KNB A;  1CZG A;  3BDL A;  4XYO A;  2JEB I;  4A3K B;  3DWQ A;  3ERO A;  2KJX A;  3K5M A;  5IGD A;  1I4R A;  4FNF A;  1ZYR C;  4KMU C;  4H44 C;  5IGC A;  3VR3 A;  1AFP A;  1HTL D;  2QKI C;  4HMJ A;  4N9T A;  2A69 D;  3TP7 A;  2X6G A;  2K6A A;  5C4H A;  3NWS A;  3IAY A;  1DM0 B;  2M2L A;  5TSS A;  1AZQ A;  1EEF D;  2JA8 B;  1JC7 A;  4R9W A;  2R6G A;  4KK7 A;  1CA5 A;  2F0U A;  2DN8 A;  4B08 A;  4BA1 I;  3FPP A;  2K1B A;  4ZLT F;  3V96 A;  3D4R A;  3H94 A;  3OSO A;  2F3V A;  5CBE E;  4K2K A;  2E2D C;  2KQ3 A;  3HG9 A;  4JBW A;  1TVX A;  1FNW A;  1FD7 D;  3C2P A;  1I4H A;  1H9S A;  1TQO A;  5JEA H;  5CV7 A;  1VMC A;  4KD3 A;  4UAI A;  1CTM A;  4OO1 H;  1R4P B;  5C5L A;  3MFY A;  1HPC A;  1U4M A;  2FHT A;  1SBB B;  2CQA A;  3E6Z X;  4RFB A;  5JPM C;  3M4O B;  4KY5 A;  1ZXT A;  1GJX A;  3TP8 A;  3HOY B;  3KK7 A;  2WIN B;  1PTO B;  1F77 A;  4B9X A;  3ERQ A;  2PQE A;  1I4G A;  1HFG A;  1KDA A;  2F0F A;  4X3S A;  2RSN A;  1PZJ D;  1BCP C;  3GTO B;  5FLX L;  1LTS D;  3WOF A;  5JJZ A;  2HDM A;  3S1R B;  1WCM B;  3GTG B;  2R3Z A;  2DNC A;  4FF4 A;  4RAU C;  2K5D A;  4A3E B;  4U67 3;  1EL0 A;  1CT1 D;  3TBI B;  1FGB D;  5IOC A;  2HDL A;  3DMU A;  2F0O A;  1R9T B;  4M8A A;  3PMF A;  1E2W A;  2X69 A;  4C3I B;  3TP6 A;  4H13 C;  3SXH A;  2VB3 X;  2JA6 B;  5I2X A;  1GUO A;  2WKC A;  5C0X I;  2B2W A;  1L0Y B;  5C4J B;  2NUC A;  1PZK D;  1TII D;  3SK6 A;  4PV1 C;  2IX1 A;  1ZKO A;  5BN4 A;  2R92 B;  2IX3 A;  1TR5 A;  5KYL A;  1VCI A;  5E1F A;  5CV8 A;  3K5L A;  4NDX A;  1DOK A;  2G9H D;  3A8K E;  4IUN A;  4RHS A;  1RTN A;  5A2Q E;  1IKL A;  2K7V A;  3BDC A;  5EPK A;  5JOB A;  1EIG A;  3NUC A;  3L3O C;  1X32 A;  3MAQ A;  3RMH A;  1EY4 A;  1OXU A;  5I4D A;  1J9O A;  1E0B A;  2QCP X;  1JOK A;  3BG3 A;  3EA6 A;  1PTO F;  1E2V A;  1TY0 A;  4K8I A;  1Z7T A;  4XT3 B;  1Y8O B;  4TRD A;  4B9W A;  1F9P A;  4C3I G;  4ID6 A;  5C3E B;  4A3B B;  2H1E A;  2RDF A;  1B1Z A;  3QOL A;  3U9O A;  4TKO B;  3NBH A;  1SNQ A;  4RGN A;  4RWS C;  1SXT A;  4KY6 A;  5LL6 X;  1RHP A;  2EJF C;  2E75 C;  2MHV A;  5CMD A;  1RTO A;  3K0Y A;  1EY6 A;  2WV6 D;  4TQU S;  2XWB B;  1Q90 A;  1CHQ D;  3BZD B;  4OIK A;  1GUS A;  4KJN A;  2KVM A;  5KYI A;  3QJY A;  1KLU D;  2MJ8 A;  3PIP 3;  2TSS A;  4I65 A;  3I4N B;  2QIL A;  2K01 A;  4FP5 D;  1XWE A;  3SE0 A;  1QIL A;  5IGF A;  3A56 A;  1RKN A;  2K33 A;  2EY2 A;  2XN9 C;  4J6H A;  3BS1 A;  2Z4H A;  3VA5 A;  5KGU A;  4CHT B;  4CKC A;  3J80 L;  1RDP D;  1ILP A;  1IW7 C;  4PMB A;  1GUN A;  4OHJ A;  2XWJ B;  2VUM B;  4UDU C;  3SK8 A;  1A2T A;  3L9A X;  2RA4 A;  2O5J C;  1B9M A;  3TP5 A;  4M1U B;  4JK1 C;  2B2T A;  3OW7 A;  1VF7 A;  3K7A B;  3QO2 A;  1GHJ A;  2C5C A;  2WII B;  5D65 A;  1STG A;  3MXG A;  1C8C A;  4U68 A;  5JEA G;  4WJW A;  4ZK9 B;  1S5D D;  1G2S A;  2EJG C;  1ENA A;  3W2D A;  2PNR C;  2KCN A;  3D6W A;  2LMC B;  1F2M A;  4FF3 A;  3MXN A;  3I3C A;  3E5S A;  1H9R A;  5DEH A;  2D9U A;  3NTI A;  3N52 A;  4A3I B;  4P2C B;  1OO9 B;  3O13 A;  3PIO 3;  5EPL A;  4G7Z C;  3TZD A;  1ONL A;  3VYR A;  3R2I A;  3L7Z C;  1M8A A;  3URY A;  1A15 A;  4MIU A;  1X3P A;  2Y0S B;  4IFD J;  1QB5 D;  3HRZ C;  2I07 B;  1PZI D;  1JIC A;  5M9O A;  4KD4 A;  5BN5 A;  1PTO C;  1QNU A;  1MSG A;  4RHR A;  1SJH D;  3S2D B;  1UEA B;  4F88 A;  1LTI D;  1QE6 A;  1MGS A;  1EY7 A;  1UAP A;  2J0T D;  2KUM A;  1G29 1;  1O7L A;  1IKM A;  1PDQ A;  3S2H B;  1CZW A;  1II3 A;  3H0G B;  1K8M A;  1EYD A;  5E4W C;  2ZXP A;  2ICI A;  1H9S B;  5CR3 A;  2ICE C;  2AQ1 B;  5JVG 3;  4C3H G;  4F8M A;  1B3A A;  3KBG A;  2D2C C;  4A3G B;  1OXV A;  1TS4 A;  1A3U A;  4X3U A;  1D2B A;  4YIJ A;  3SDZ A;  1GXD C;  3S9W A;  2C9O A;  5ELE A;  1WTQ A;  4PNY A;  5FLX E;  2K5W A;  3FEW X;  2L1B A;  3C1F A;  1TS2 A;  2DY7 A;  5KRU A;  1D5M C;  1OXX K;  5C4Z A;  1I4X A;  3P75 A;  1LTR D;  3NQI A;  1ZYR D;  3AMU A;  5IT9 L;  1LO5 D;  4PMC A;  5KIX A;  5I9O A;  1F2Z A;  3DUZ A;  3T13 A;  3DWP A;  3I8Z A;  4Y7N B;  4IFD G;  2F0I A;  3A55 A;  3GO5 A;  1ML0 D;  3TME A;  3Q24 A;  2F0M A;  1LT3 D;  2B63 B;  3GD7 A;  2NN6 H;  1NSN S;  4FF1 A;  3PUW A;  2XVS A;  2RDH A;  2A68 C;  1MD2 D;  4IUV A;  5IIF A;  1DYQ A;  2F0N A;  4ODG A;  2MPM A;  3GTL B;  1M4V A;  4ABN A;  1T5E A;  3D4D A;  2PMZ B;  4NKL A;  1EIH A;  1A2U A;  1CK1 A;  1D5Z C;  1B9N A;  2J7Z A;  3JAM L;  5LL6 S;  2PYK A;  2PZT A;  1JCK B;  1GHK A;  4KKT A;  4DAP A;  2B2Y A;  5E4X A;  2LFN A;  1UUP A;  5A35 A;  1V1P B;  1I4P A;  1ROD A;  1F2Y A;  1NAP A;  1BO0 A;  1QWY A;  3S14 B;  2O5I C;  2A74 C;  2SNM A;  1XYI A;  3HZX A;  5M3M B;  1PRT B;  3T16 A;  2NB0 A;  5C4X B;  3J7A V;  2D62 A;  3GV6 A;  4HN7 A;  3PUV A;  1STN A;  5FKA C;  5KNC A;  2HUG A;  3PUZ A;  1DZ1 A;  4CJ0 B;  1D5X C;  1EYC A;  1Z47 A;  3DEO A;  2XSC A;  1Z6H A;  2L4N A;  1SDF A;  1HUN A;  5EKL A;  2EY1 A;  3DXJ C;  1BCP D;  1TWA B;  2FMC A;  4ZAI A;  3VR5 A;  5JVH 3;  1BNZ A;  3R93 A;  1EEI D;  1IYV A;  2L0C A;  2BOS A;  1EY0 A;  5FK9 C;  2H4O A;  3TDQ A;  5AFW A;  5ELC A;  4IUR A;  1GUG A;  1SJE D;  1SMY C;  2QDB A;  1JQY D;  1I50 B;  1A3V A;  1GUW A;  2M00 A;  1TWH B;  4RGO S;  3I72 A;  3V05 A;  2KCC A;  3D3R A;  1SYB A;  3OWF A;  2B2U C;  1F9Q A;  5T1G A;  4ZRZ A;  3ZYY X;  4WFN 3;  2FJ2 A;  4K8J A;  3J80 E;  1AEX A;  3I91 A;  1JWS D;  4RH6 A;  3OWE B;  1NCV A;  2B2V C;  4IN3 A;  1HQM C;  2NVX B;  2EE1 A;  1AP0 A;  4K5V A;  4BBS B;  2RKS A;  2B8F A;  1LT5 D;  4R8N A;  3A8I E;  3A8J E;  1PMR A;  4HSV A;  2F0J A;  3NE5 B;  5E3F A;  2I46 A;  3HOZ B;  3HEJ A;  2ZT9 C;  1J8I A;  4ZKB B;  5CV5 A;  3SVM A;  1TWF B;  4TSS A;  1SFO B;  1SYC A;  1PRT F;  4IUQ A;  3SEB A;  4A3M B;  3X3M A;  1F9R A;  5I2Y A;  4XQQ A;  4XIG S;  2YU9 B;  2MP1 A;  3CRK C;  5FOB B;  2A6E C;  5EKI A;  2HCC A;  5FO9 B;  1S5B D;  4HAE A;  3WDN A;  1KTK A;  1O80 A;  1DCZ A;  4G7O C;  1FNV A;  2F0W A;  4EGV A;  3W3A A;  4HED A;  1MBY A;  1QG7 A;  3MTS A;  3VYU A;  3FRP B;  3T4A C;  1Y8P B;  1LTA D;  2JEA I;  2PCF B;  2Q8I B;  2F0G A;  3PO3 B;  4V0B A;  2QEJ C;  3G7L A;  4DXG A;  3K58 A;  4C3J B;  4IUP A;  4LAA A;  2N88 A;  1NR2 A;  1LAC A;  2EPB A;  2F4I A;  3LNN A;  2DNE A;  4FF2 A;  5JPN C;  2KOL A;  1RCV D;  1QNK A;  1R4Q B;  2SNS A;  3R3O A;  5C44 B;  1WVL A;  4S3S A;  2EDG A;  2CVR A;  2SOB A;  3BVM A;  5C6A A;  4R8I A;  3DM1 A;  1Q8I A;  4ZUI A;  1ZEQ X;  5KND A;  5I9P A;  2EOT A;  2NN6 G;  4DU9 A;  3QIA A;  3C3L A;  1EU3 A;  1SYD A;  5DAU A;  3GTM B;  4FVM A;  2F0P A;  2EYM A;  3HOW B;  1IL8 A;  2EYO A;  3VR2 A;  1KNA A;  3MZ5 A;  5K5P A;  4IFD H;  1RF2 D;  3M4Y A;  1CHP D;  5CV6 A;  4KI0 A;  1STA A;  1TWG B;  4Q0F A;  3E0J A;  4XDX A;  1CFM A;  4C3J G;  2AQ3 B;  1FNU A;  3A7A B;  2BE5 D;  5EQ0 A;  5M5W B;  1U9R A;  4EQN A;  1G2T A;  3QB3 A;  5CGK A;  3SHL A;  5IT9 E;  2B2W C;  1S5E D;  2QF7 A;  4OO1 I;  1B2T A;  1CQF A;  4WRD A;  1GOZ A;  3Q22 A;  4ULL A;  3V2T A;  1ENC A;  4G4K A;  2R93 B;  2AUK A;  1S5C D;  4I7Z C;  2ID0 A;  4CKB A;  2AUJ D;  4BWG B;  2NVT B;  1U4R A;  1BF4 A;  3S15 B;  3NPP A;  4X3T A;  2GA4 B;  4OIJ A;  2A5H A;  1PRT C;  1I6H B;  5J22 A;  4QCL A;  4QMG A;  2RDG A;  1EZ6 A;  5IOD A;  3PUY A;  1RJT A;  3HGB A;  1PTO D;  3JAM E;  2NTS A;  1A3T A;  4QF4 A;  4HSP A;  3MVV A;  3H91 A;  3VA7 A;  1K8O A;  4RCN A;  2RSO A;  4QB4 A;  3I4M B;  1I4Q A;  4KY7 A;  2EXZ A;  3HS0 C;  1ICW A;  3M3Y B;  1C4Q A;  3FVQ A;  1HTP A;  4HCE A;  1QCB D;  3K5O A;  3OPO A;  2NTT A;  1Y69 U;  3K5N A;  2KEE A;  2WAC A;  1T5X D;  1O7Z A;  1JB3 A;  3FPU B;  4A3J B;  4NP5 A;  2PW5 A;  1G91 A;  1YNJ C;  5DM7 3;  1Y1W B;  1D1I A;  3SK5 A;  1HA5 A;  3NTK A;  3M85 A;  5DM6 3;  2X6L A;  2KEC A;  3P7J A;  2BDN A;  2FMM A;  3M7N A;  3SR1 A;  2JSO A;  2OEO A;  3EQL C;  4XT1 B;  4DFA A;  4Z9C B;  5F2D A;  1HA6 A;  1FR3 A;  2FFK B;  2L55 A;  2EYP A;  3TN2 A;  2OT2 A;  2FIN B;  3F2U A;  3NSW A;  4IZ8 A;  1JOR A;  1Y1V B;  4A93 B;  2EVB A;  2F0K A;  1SSO A;  4DK0 A;  1D1K A;  5D14 A;  2B2T C;  5IGG A;  1WTR A;  2A68 D;  3LWU A;  3OMC A;  1YNN C;  4HMI A;  4H0L C;  1MI2 A;  2JXM B;  1PYW D;  2EYJ A;  4ILW A;  4HTH A;  1TWC B;  4RA8 A;  1HFN A;  3P20 A;  4H7B A;  1OXT A;  2L12 A;  2ENB A;  1EYA A;  3J81 E;  1PTO H;  1Y8N B;  1DXM A;  1HQR D;  1JE4 A;  3R2T A;  2KED A;  3T51 B;  3I4L A;  3KUP A;  2LS0 1;  3RZO B;  3QOJ A;  1SNP A;  3C1E A;  1B50 A;  4C1N I;  3R8B A;  2F3W A;  3MEH A;  3OIP A;  1XX8 A;  4K5W A;  1STH A;  1CQV A;  1WTX A;  1EU4 A;  4A3F B;  1WTP A;  1STB A;  4EQP A;  1EWC A;  2E74 C;  3MXU A;  1SNO A;  3CU7 A;  1S5F D;  3CQZ B;  5I6Y A;  3EFX D;  5ELD A;  4CKE A;  3D4W A;  4C2M B;  4IUT A;  2WP8 J;  3MC0 B;  4KKS A;  2NYZ D;  4QUF A;  1LLR D;  5NUC A;  1MSH A;  3H09 A;  3S16 B;  3NHH A;  3OOC A;  4IUU A;  4EVO A;  2IL8 A;  2CW0 C;  4XQJ A;  1SMY D;  4K14 A;  1JOQ A;  3A7L A;  4KJO A;  3GTP B;  2XRS D;  4OGQ C;  4GZY C;  2E2J B;  3OHX C;  3DWA A;  2Z4I A;  1KNE A;  3MWY W;  4DF7 A;  3GTJ B;  3NQT A;  1SYG A;  1HUM A;  3T56 B;  5T1I A;  1BR9 A;  4DK1 A;  2A6H C;  2HQE A;  3DEP A;  3RZD B;  3HOU B;  3WOE A;  5C3W A;  5G3L F;  3M7G A;  1SE4 A;  1TKW B;  1TY2 A;  3NK9 A;  4BS9 A;  3D8G A;  4FXK C;  1EY9 A;  2F03 A;  3J7A F;  1WTV A;  1EWH A;  3HKZ B;  4DNT B;  1HRJ A;  2L11 A;  4KHV A;  2VXW A;  2A6E D;  4BY1 B;  4IAL A;  2EY5 A;  2R61 A;  4FYD A;  4KTA A;  3GV3 A;  1SNM A;  1Q1E A;  3VR6 A;  2RQX A;  4MHE A;  1NR4 A;  2NWG A;  1WD1 A;  5M3F B;  2AWO A;  3CRL C;  5COY A;  4NW2 A;  4LK1 C;  1V43 A;  1W6J A;  5C3X A;  4RKB A;  1EOT A;  2L5T A;  3KBX A;  1SYF A;  1QJO A;  4O1N A;  1RD9 D;  3EVQ A;  2IT1 A;  1HXY D;  5CV4 A;  1G8Z D;  3I90 A;  1AZP A;  2WB1 B;  2NZ1 D;  2HCI A;  2JA7 B;  2B2Y C;  1FYC A;  4KKU A;  2A69 C;  3ND9 A;  5C0X J;  5D3D A;  4BBR B;  3NTH A;  3MA2 B;  2PPB C;  3LX0 A;  2KA7 A;  1TS5 A;  2WKD A;  4J8Q A;  4O42 A;  2DY8 A;  3J81 L;  1PFM A;  5BN3 A;  3MFG A;  1I6V C;  3Q0A A;  2ZXR A;  5EBD A;  2CHB D;  4KN4 C;  1EY5 A;  1PXU A;  1BXT A;  4MN3 A;  2VNU D;  1B4O A;  1KAB A;  4BA2 I;  5G3L D;  5COR A;  1U4L A;  1JR0 D;  5I6W A;  1LT6 D;  1ET9 A;  2N55 A;  3PO2 B;  3TZU A;  2D5D A;  4WOR A;  2MUY A;  2F0V A;  1ESR A;  3QWN A;  2F0Q A;  4AYB B;  2JA5 B;  4LJZ C;  2E2H B;  1SE3 A;  2NN6 I;  1EFI D;  3ITP A;  5EPJ A;  4N9P A;  1EQT A;  3VYT A;  2EJM A;  2IX0 A;  2PW7 A;  4F87 A;  1Q1B A;  4G57 A;  4Q5V A;  5EBC A;  2IPK D;  2LKV A;  1TU2 B;  4RGT A;  2WAQ B;  3ND8 A;  3J7Y W;  1BUV T;  2O2L D;  2BDO A;  1F9S A;  4FXG C;  3EJI A;  3DHQ A;  3KF8 A;  1G6Z A;  3D31 A;  3KLS X;  3PUX A;  1V8Q A;  5J39 A;  2K03 A;  1KDC A;  3OMG A;  3GTK B;  1EY8 A;  1V1P A;  2Q8T A;  1K83 B;  2AQ2 B;  3NWT A;  3HP3 A;  1O78 A;  2A73 B;  5K36 G;  4KHZ A;  5D3I B;  4OL7 A;  5M5Y B;  1HCZ A;  4QUC A;  1IW7 D;  5C0X G;  4K2L A;  3FMC A;  4DGZ A;  2EYH A;  2IJ0 A;  1ILQ A;  2EYL A;  4K5X A;  3NXW A;  1DOM A;  3RLF A;  5KEE A;  4X3K A;  1SYE A;  4A3D B;  3MHB A;  5ELB A;  2OF1 A;  5JEA J;  1SAP A;  1F2L A;  1BQQ T;  1PRT D;  3BVG A;  3CHB D;  2K04 A;  2F0D A;  4BY7 B;  4ZQ3 A;  3HOX B;  5CC4 A;  2AWN A;  1EZ8 A;  4RCO A;  1LTT D;  1W6K A;  1TS3 A;  2JP1 A;  2VB2 X;  4HR7 B;  3I70 A;  1SE2 A;  3G6J B;  4NMZ A;  1JOO A;  4V19 0;  4FO2 A;  2O4X A;  1TT2 A;  2Z1C A;  2F0T A;  4L63 B;  5J1Z A;  2RBM A;  2OXP A;  1JWM D;  2K5Q A;  4C56 C;  1LTG D;  4PMW A;  5CV9 A;  3BYY B;  1S4Z A;  1A6X A;  1PFN A;  1CA6 A;  4CGY B;  2NVQ B;  2XIW A;  4DA2 A;  3BYT B;  1EQV A;  3IFT A;  4DXF A;  1L0X B;  4EQO A;  1Q12 A;  5ELF A;  3KLR A;  3SK4 A;  1O7Y A;  1IHZ A;  2ZXO A;  2IWH A;  4LMQ D;  2PZU A;  5FO7 B;  1YNJ D;  5DNF A;  3HOV B;  3IKJ A;  3MXP A;  5FO8 B;  3AU7 A;  3GQB A;  1HHV A;  2R7Z B;  3FDT A;  4C1N K;  2J4X A;  3A54 A;  2E2I B;  1CI3 M;  1KAA A;  3GTQ B;  1B53 A;  2B39 A;  3VYS A;  4G7H C;  3X3N A;  3AB9 A;  4DNR B;  1JWU D;  3S1N B;  2TMP A;  1WD0 A;  1LAB A;  2KHS A;  5M5X B;  2BE5 C;  4OO1 G;  2BA0 A;  5IGB A;  2Q8R E;  3LWE A;  4CJ2 C;  4XQN A;  2PZW A;  3FKI B;  1YNN D;  3PV0 A;  2BA1 A;  3S1Q B;  1BCP B;  3OIQ A;  3CKI B;  2JYO A;  4C3H B;  1LV9 A;  1VF5 C;  2F0E A;  2B8G A;  5CYU A;  3Q23 A;  2XNA C;  2EZV A;  1ESF A;  1NUC A;  1C48 A;  2RVL A;  5LHY 1;  2JE6 I;  2F0L A;  1BOS A;  2Z8L A;  1AN8 A;  2F0S A;  3D6C A;  3I73 A;  2SEB D;  5JAV A;  3N6R A;  1DD2 A;  1WTW A;  4RGM A;  4E6I A;  3U9S A;  4J1M A;  2LY7 A;  1PLF A;  3GP7 A;  5ISR A;  5EJW A;  2EYF A;  1STY A;  4L6T B;  3K57 A;  3BDO A;  5C5M A;  1I3Q B;  3UI2 A;  5A2Q L;  3QG1 A;  1SNC A;  2G9D A;  1ENF A;  1LTB D;  5HGT A;  3NP8 A;  1VMP A;  2NVY B;  2SDF A;  3VR4 A;  3P1H A;  4ME5 A;  1DJR D;  4IFD I;  1LT4 D;  5IGE A;  3KLS A;  3H6M A;  3S1M B;  4ZKC B;  4CBV A;  4XYQ A;  1DOL A;  2M9V A;  1BDO A;  1DON A;  4KV6 A;  3IFD A;  1IYU A;  4FXD A;  4L8J A;  4DN4 M;  4F7X A;  2CW0 D;  1UNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...