5JAVA

Crystal structure of staphylococcal nuclease variant delta+phs y91d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLADIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5javA00
4K5XA 5ISRA 4ODGA 3NP8A 5EKLA 2KQ3A 3NHHA 2ENBA 3NQTA 2F0MA 3R3OA 4KY5A 3MZ5A 1SYBA 3OWFA 4K14A 3C1FA 4ZQ3A 3SK6A 4G57A 1EY4A 4I65A 1EY7A 1STHA 2EY6A 2F0IA 3EROA 3LX0A 5I6YA 1II3A 4HMIA 1KAAA 4RKLA 3P1HA 5IGEA 4KJNA 1A2TA 4PMBA 4WORA 2EYFA 2F0PA 5F2DA 1EY5A 1EYCA 2OF1A 3E5SA 4KJOA 5HGTA 4KV6A 5KEEA 2PYKA 1KDAA 3MEHA 2F0KA 1EYDA 3TMEA 4J1MA 3TP5A 5JAVA 3HEJA 2F0FA 3P75A 4K5WA 3TP7A 1AEXA 1SNMA 3T13A 1SNCA 5C3WA 1STAA 3QOJA 2WACA 1EY8A 2F0JA 3S9WA 2OEOA 5CV9A 3U9OA 2F0UA 1A3UA 4EQOA 3QOLA 1U9RA 1STGA 1KDCA 5DEHA 2RBMA 2EY5A 3C1EA 1EZ8A 4OL7A 1EY6A 3D6CA 5CV8A 5EGTA 2M00A 5KGUA 1JOKA 5J22A 3MHBA 5I9PA 2NUCA 1TR5A 4QMGA 2SNMA 1SYFA 5CV6A 5M9OA 2F0OA 4NKLA 4KY7A 4TRDA 5J39A 1SNQA 4E6IA 5CV7A 2F0HA 3DHQA 2F0WA 2SOBA 5CC4A 1F2ZA 2F0SA 2F3VA 2PZWA 3OSOA 5CGKA 3SK4A 1NUCA 4J6HA 3SR1A 3VA5A 2F0QA 5IGBA 2QDBA 5C6AA 5I6WA 2EY1A 1TT2A 1SNPA 3H6MA 3MXPA 5CV5A 4K8IA 5KRUA 1F2MA 4B9XA 4N9TA 3V2TA 1JOOA 1STYA 3EVQA 4ID6A 4K8JA 4DF7A 1NSNS 3PMFA 5C5MA 1SYCA 5C3XA 1TQOA 2EYHA 2PZTA 1STNA 4K6DA 3SXHA 3BDCA 4K2KA 5CR3A 1KDBA 3QB3A 5J1ZA 5E1FA 4QF4A 4YIJA 4K2LA 4DFAA 4IZ8A 5HURA 1SYGA 2F0GA 2EYLA 3NXWA 2RDFA 4HTHA 5K5PA 4ME5A 4DGZA 1SYEA 3ITPA 3OMCA 1F2YA 4NMZA 4ZUIA 1ENCA 1SNDA 4PMCA 2OXPA 5NUCA 5IGFA 5IODA 2KHSA 5IGGA 5I9OA 5KYLA 4N9PA 3EJIA 5C4ZA 3MVVA 3BDLA 4KD4A 1JORA 3TP6A 5KYIA 4R8NA 5DAUA 1ENAA 4B9WA 2EYOA 1A3VA 4QB4A 3D4WA 3RUZA 3SHLA 1JOQA 4NP5A 2RKSA 1STBA 5JOBA 4WRDA 4EVOA 1A3TA 4KY6A 1EY0A 2F3WA 4PNYA 3NUCA 4H7BA 4K5VA 1KABA 2F0DA 3ERQA 2HQEA 4DU9A 2F0TA 2F0NA 2EYPA 3NK9A 4KHVA 2LKVA 4RKBA 1SNOA 4EQPA 5IIFA 5E3FA 4ZUJA 4HMJA 1RKNA 3D4DA 4KD3A 4F7XA 2PW7A 5IOCA 1EY9A 4NDXA 1EZ6A 5C5LA 2F0LA 3D8GA 2F0VA 4IALA 4EQNA 5IGCA 1EQVA 2EXZA 4LAAA 4S3SA 3TP8A 2EYJA 1EYAA 2O4XA 4F8MA 5KIXA 2PQEA 4IUNA 5CV4A 1A2UA 5IGDA 1IHZA 2EY2A 2EYMA 2PZUA 2SNSA 3HZXA 3SK5A 3SK8A 1SYDA 4MIUA 5EKKA 4KTAA 5C4HA 3OMGA 3DMUA 2PW5A 3T16A 2F0EA
chains in the Genus database with same CATH superfamily
1RD9D 4RG1A 1Z6HA 3T51B 1E2ZA 5M5XB 4FVMA 5I6YA 3V05A 2B2TA 3J81j 1B70B 5FKAC 4HJAA 3F2UA 4DV6L 4RGTA 1EY5A 1NR2A 5IY0A 5M5WH 4L5RC 5L37A 4FF3A 1KL9A 1GOZA 3P75A 4B3ML 1AEXA 1H9SA 1JC7A 2BDNA 3HOZG 4DA2A 2OEOA 3PGZA 4JC0A 1Y8OB 4O42A 2J0TD 4B9WA 3S17H 4GKKQ 1EY6A 1SJED 1LM0A 1XJVA 3DM3A 3HOWG 4A3FB 1DGSA 1E3PA 4R1JA 2VW9A 2QW7A 4UP9A 3WOFA 2EJGC 4BBSH 5EAYA 4DK3C 1R9TB 4JI4L 3GTOB 2NVQB 2K75A 4K8IA 3QJYA 1FL0A 4OO1H 3BDOA 3GTGB 4FDBA 1YNND 1N33L 3PMFA 4HCEA 4OGQC 5C4JH 2A69C 1STNA 3SXHA 1QZHA 1HTLD 3LWUA 4JCVE 2DNCA 3NPPA 3TSSA 4ME5A 4DAPA 3ER0A 3QO2A 2NN6G 1K8MA 1VQHA 2IPKD 5I4DA 3MVVA 5ELDA 2D2CC 2A6HD 3SEBA 3VYTA 4JI7L 1O80A 2JN4A 3E3XA 3K5OA 2K14A 3VDYA 1YNXA 2LY7A 3HOUB 2MJ8A 2XSCA 4A93H 1SSOA 5E7NA 5DM63 4HEDA 1W6JA 4BWGB 5M3FH 3OW2A 4DR6Q 1RKNA 1M4VA 5FLMG 1E1TA 3F2CA 1VQCA 3S1MH 4LAAA 4X66L 3PIP3 3QIAA 4A3DG 5HY6A 2N55A 2WFWA 1I4QA 3RZDH 2K5NA 2N78A 3S1RB 3D0FA 2VUMH 4OONA 3K7UC 1ESRA 4LF4Q 4XT1B 3A55A 4RKLA 4KHPL 1IL8A 3I70A 4YWMA 4CKBA 4JYAL 2K5DA 1IBLQ 3MFYA 4A3JB 2L55A 3H91A 5M5WB 1STAA 1SAPA 2DN8A 2WACA 4M8AA 2QILA 1KTKA 1M1KC 3AYHB 3P7JA 3BS1A 4C3IH 4PZ7A 3JAME 4C3IG 5CV8A 1OXVA 1A8VA 2M00A 3HOYG 4AIMA 2DNEA 1LT4D 4DAYB 5M9OA 1TR5A 4QGUA 2WAQG 2IHFA 2E2JB 4K6LA 2ZJRA 3GTKB 5K36G 3J7AF 4DV7L 2WIIB 3OTOL 3VR4A 2R7ZG 1CHQD 1LTTD 3CCVA 1TU2B 2Z6BA 1EWIA 1FYCA 1D5MC 3T1HQ 3PUVA 3EN2A 3OTOQ 1QILA 4MN3A 5H1SE 4Y52H 1V1PA 4K8JA 4JI4Q 1XNQQ 1EL0A 3BZKA 4HSPA 4L5QA 3AU7A 3TREA 2HHHL 1ET9A 1E0BA 1X65A 1Q12A 5IYCH 2EVBA 4DV2Q 5BR8Q 2L12A 4TVAB 4DGZA 3I55A 1ENCA 1RTNA 3EFXD 4OWWB 4OO1I 2ES2A 4ZK9B 1D5XC 1V9PA 3IL8A 2JXMB 1UE6A 4R8NA 3H0GG 1A3VA 3TRZA 2DJGC 4ZCKA 4EVOA 3H3VH 1JCKB 5IYBH 1PLFA 1TXYA 4BY1B 4EQ5A 4DR5L 4Q0FA 1HUNA 2NN6H 4YY3Q 4HAEA 2R93B 1F77A 5M3MB 2IWHA 4KD3A 4BBSB 4UP7A 1YNJC 3S2HB 4RH6A 3CCUA 1EQVA 2RHQB 4POFA 3J81E 1PH9A 5GAEC 3G4SA 5T1IA 1VQIA 2NTSA 1PH1A 2NVXH 3S15B 1VDZA 4K5XA 3PCOB 4X64Q 1U4PA 4H02A 2NVTH 1HUMA 1XTCD 4A93G 2KOLA 2I46A 2Z4HA 4ZQ3A 4KKUA 4DNIA 3CC7A 2VB3X 4A75A 3CKIB 3JC66 1X3GA 1DJRD 1V1OA 4OX9L 3G7LA 5ELFA 1FNUA 3S2DB 1QB5D 2B2UA 3N6RA 1VS0A 3TMEA 1PTOD 2B2VA 2NTTA 2R92G 1HNWQ 1GHKA 1JICA 3QOJA 1XTDA 3VR3A 1JWSD 3HOWH 1JWMD 3PO2B 4OL7A 3A56A 3E0JA 5I9PA 1VQAA 2UXBL 3S1NH 4IUUA 3NBHA 1QVFA 3HKZB 1DD2A 5CC4A 4RGNA 4CHTB 1Q1EA 5CGKA 4J6HA 2F3IA 5C0XI 1EOVA 5T1GA 4C3HB 4YCWA 3KLRA 1WYDA 1I4HA 1Y14B 1FD7D 4A3IB 3L0OA 1JOOA 3V2TA 1STYA 3EVQA 2NZOA 1WTHA 4CJ1B 1PTOB 5E1FA 1TVXA 2A1AA 3A7AB 4X3KA 3JAMc 3H15A 2K5WA 1K9MC 3HOZH 1QE6A 5EBCA 4HTHA 4ZLTF 4DAVA 2UXBQ 1CZGA 2OXPA 2Z4IA 3FHWA 1BBWA 2E2DC 1YBYA 1PZID 4CBVA 3HOZB 3EJIA 1MGSA 4KD4A 4R4IA 2RCNA 3CPFA 1G51A 1SLJA 1U4RA 3GTKH 1JOQA 4R4TA 4DPGA 3MXGA 3GTPH 1ZYRC 1VMCA 2B39A 1NTGA 1A6XA 5J3BA 1HJPA 1PYBA 4POGA 1HZAA 2PMZE 1LT5D 4ZKBB 2ZM6L 2VQFQ 2EXZA 1K3RA 2PQEA 4Q5VA 3G6JB 4X3UA 4C3JH 4GN5A 3J81L 1N8RC 1XNRQ 3HFZB 1HRJA 4U673 1E2VA 1H95A 4IPGA 3RZDB 1XPUA 3PUWA 1PRTF 4DUZQ 4A4IA 1VQJA 4DNTB 5EKIA 1YNNC 1CUKA 2L1BA 2JE6I 3T1YQ 1HNXL 1U0LA 3ULJA 3DWPA 5JAVA 1EOTA 3U9SA 4BY7G 3MXNB 3H3VI 2K4KA 4HJ5A 1F2LA 3MXNA 2JA8H 3GTLH 4L8JA 5ELEA 1EZ8A 3HOUG 3U50C 2K28A 1IW7D 1SYFA 2UUAL 1T5XD 3GDEA 3M85A 4R8IA 3A74A 5CMDA 5D65A 1T9HA 3QWNA 5I2YA 1MD2D 4FF1A 1SNPA 2N8NA 2I5HA 3AFQA 4IJLA 2HDMA 4BS9A 1Q90A 3BZCA 4DF7A 1I6HB 1YNJD 3I91A 1FNWA 3ZYYX 5C3XA 3UI2A 4DKAC 4LF6Q 2XTIA 3ND9A 1ILPA 1EIGA 3PF4A 2M9VA 3A7LA 1H9MA 3OWEB 2EZVA 1GUNA 1F2YA 2O5IC 3K7AB 1MSHA 3D3RA 1F9PA 2KCCA 4CGYB 3A5UA 1K83H 4A3BB 3OYYA 2EXDA 4QB4A 2PPBC 1K8OA 3QR8A 4DAMA 4XQJA 1HQMC 3HOYB 3MFGA 2F1MA 4H7BA 1HR0L 4FP5D 3EBEA 4JV5L 2I0QA 4LF6L 3CQZB 1YITA 2OQKA 1XNRL 2JEBI 2KA7A 4IALA 1UEBA 2R61A 2EYJA 3RR5A 4GKJL 5CV4A 5IGDA 1A2UA 1R9TH 1K3BC 1I6VC 3BJUA 1KIXA 2R7DA 1WTVA 3FPUB 4ODGA 4XT3B 1RIPA 2KQ3A 3S16H 3EROA 1N36Q 1R4PB 3UDIA 1EFWA 1ZKOA 4DR6L 4HMIA 3P1HA 4KJNA 1EU4A 4RFBA 4WORA 4JI6Q 1EYCA 3I4LA 4QUCA 2ZXPA 3CW2C 4HSVA 5LMUL 4J1MA 4LF5Q 4CKEA 3HEJA 3F2DA 4A3GH 1N32Q 2KCNA 4A3CH 4A3KH 5LMUQ 1TWAB 1XXGA 3K59A 2BE5D 1ESFA 2FINB 1W6KA 3IFTA 4RGOS 1AW7A 3NBHB 5KGUA 4DV4L 4B3TL 1CKOA 4QMGA 2BH8A 1DOLA 4FO2A 4BY1G 1PXUA 4TRDA 4R4QA 2FFKB 4E6IA 1G6ZA 1QOHA 4BA1I 1VQMA 1VQ8A 3M3YB 3GD7A 1U5KA 5M3FB 1JJCB 1WTXA 2EJMA 3MAQA 5CV5A 2AUKA 1I50H 4JG2A 5FLXc 1PFMA 3I4MG 3HOUH 3CF5A 1I4RA 4F88A 2PO4A 1SBBB 1I6HH 3ULLA 2KENA 1K28A 4LFAL 5C4XB 1QNKA 1H9KA 2K04A 1MHWC 3FKIB 2H5XA 3RD4A 1K8AC 5IYDG 1D1KA 2L0CA 1PA6A 4GNXB 2WV6D 1F9SA 1ET6A 4QJFA 1O7ZA 3IAYA 2O2LD 1RTOA 1SMYC 2A74C 4UDUC 1R4QB 3TZDA 2BCOA 1XMQQ 1Y1WG 3S24A 4JK1C 1A0IA 4PMCA 1GUOA 3O13A 4CJ2C 1J8IA 1LTRD 1D8LA 1ENAA 1PH5A 4CDEC 2UU9Q 5AJ3Q 4LF4L 4GLXA 2JA7G 5C3EB 4FXDA 2BH2A 1WD0A 1J5EL 1VMPA 4RKBA 1SNOA 2K01A 4LUVA 4ZUJA 5BR8L 1HZ9A 3AQQA 3IFDA 2PW7A 1WTQA 1CKNB 4S3SA 2OQ0A 1HPCA 4X66Q 5EPLA 3DMUA 2PW5A 2IY5B 1ICWA 1UE7A 4JI2Q 1RL2A 1QZGA 1EFID 1SE3A 1V1QA 2ICIA 4G57A 4I65A 5IYDH 1QJOA 1SR3A 1VQ4A 4LNQA 4DNRB 2G5DA 5A2QL 2E2HH 2N49A 4XDXA 4G7OC 2WINB 5C0XH 4WJWA 2B2YC 2F0PA 4H44C 1SMYD 5BN5A 5IE8A 1TWCB 5FJ8H 2RSNA 2F0KA 5JVH3 4RHRA 4X62Q 2L4NA 2F0UA 1A3UA 3OIQA 1KDCA 4NPSA 4QUFA 1PH3A 1B9NA 3T1YL 1NNXA 1KLUD 5CV6A 4BY1H 3K5MA 4OX9Q 1LTGD 1SNQA 3AFPA 3L7ZC 1E1OA 1GUTA 3SGIA 4R9WA 4DR1L 3CQZH 3OSOA 1EQRA 3RMHA 4KHPQ 1OXXK 1XMOQ 4A3GG 1PFBA 1X3PA 2EY1A 2JA6B 3MXPA 5I2XA 4DV1L 4AYBB 1SDFA 3S1QB 3RZOB 1ASZA 4QQBX 1NSNS 2A69D 1Q86C 2MUYA 2JK8A 3OIPA 2R92H 3AMUA 2F4VL 4EX5A 5HURA 3I7FA 4F8MA 1XPRA 1SYEA 4P74A 1RCVD 2PQAA 1JB3A 4HR7B 4FXKC 3BDLA 1KC8C 3KLSA 4QIWE 2OWOA 2EYOA 3L3OC 3D4WA 4OHJA 4C1NK 4DV2L 3HOWB 3KLWA 2KJXA 2Z8LA 1SE2A 1X3FA 2CH4A 2WKCA 2V4DA 2Y0SE 2PNHA 3PO2H 3T4AC 3U4ZA 1NCVA 3CC2A 3IKJA 4OXPA 3TBIB 2HT1A 1NAPA 3HZXA 3SK5A 4AYBE 1S40A 1EIHA 2NZ1D 3E5SA 1C0AA 3R3OA 3K8AA 4KY5A 4DR4L 4FF4A 2EDGA 2I5MX 1L1OB 3BG3A 1EWCA 1XPOA 2EY6A 1UEAB 1PH6A 1J9OA 4DXFA 3UDGA 5BN4A 3E0EA 1LYLA 5IYCG 4KJOA 1X3QA 2Q8IB 4AQYL 4L6TB 5EBDA 3B6YA 1SNCA 1YIJA 4JI3L 2JP1A 4NW2A 2NVYB 2HIVA 4AQYQ 2RBMA 2A5HA 2SNMA 4JI1L 3WWVA 5J39A 4C56C 3MTSA 1LT6D 1CFMA 5E4WC 1XWEA 2PMZB 5EJWA 3KF6A 2ZTEA 1RF2D 3DWAA 2UXCQ 1LTSD 3BYYB 1BOSA 1TT2A 4X3TA 4MTNA 5GAHC 4O0AA 4B08A 4A3DB 5LL6X 2B63H 3ERSX 2F4IA 3E6ZX 3UE1A 4MNOA 2IX3A 2XGTA 4GNXA 1UE5A 3S1QH 1QUQA 1GKHA 2B63B 3EA6A 2A6HC 4YHHQ 3DEOA 4DV5Q 4I7ZC 4V0BA 1BO0A 2LSSA 4C3JG 2ZTCA 1BCPD 4IOCA 2L15A 3I2ZA 2IX0A 3GP7A 4FF2A 3HKSA 5IT9E 3M7GA 2UXDQ 5DAUA 4XTCS 1TWHB 2Q2HA 3TEHB 4C2MB 1T5EA 4J8QA 5M5YH 1I4PA 3I4OA 2EE1A 1KABA 3CXCA 2F0NA 2HUGA 4C1NI 1LLRD 4IUTA 2ZXOA 3DWQA 4X65Q 4A3KB 4G7ZC 1I94Q 5M3FG 2F0VA 2R7ZB 4JBJA 1TY0A 4G7HC 4C3HH 5JJKA 2O4XA 2JA5B 4DR4Q 4HIOA 3S14B 3CU7A 1IHZA 2SNSA 3SK8A 2YTVA 5KNDA 2RA4A 1DZ1A 1RHPA 4P72A 1Y8NB 2RCFA 3OWFA 1PH8A 1HR0Q 3FKIG 4LF7Q 1JJGA 4OEMB 1DM0B 2B2WC 4ILWA 5IP9H 1II3A 1TS5A 2VUMB 4RCOA 2NVYH 4JI8Q 3R93A 4APVA 2UXDL 2OF1A 4LFCQ 2VZAA 1D1IA 2C9OA 4XYQA 3CCQA 3F8TA 4A3JH 1HH2P 3S1MB 2FJ2A 2MHVA 5FLXL 1CM9A 4EQOA 1IL2A 3CMEA 2K52A 3WOEA 2JA7B 2CWAA 5JJIA 2M2LA 2OTJA 2I07B 3KUPA 1RODA 2BE5C 2EQSA 3DHQA 3KDFA 2F0WA 2KHIA 4DV0L 1VQEA 3HRZC 4BBSG 4CKCA 5CBEE 5G3LF 1G291 2L9HA 3BU2A 3H6MA 3M4QA 1JQYD 2K6AA 3TQYA 2B2YA 5IP9G 1MJEA 2WB1E 3GTPB 4GKJQ 3OW7A 4JI0L 4Y7NB 1VQFA 4K0KL 3RZOH 2EYHA 4KN4C 5JPMC 2Q2TA 1UUPA 3MEFA 3J7A5 2PI2A 5CR3A 4KKTA 3QB3A 5J1ZA 4QF4A 4DR3L 3CD6A 4UPAA 5DNFA 1B7YB 2TMPA 2KHSA 2NVQH 3MC0B 2E2JH 3K0YA 4LFCL 1K0SA 3PO2G 1X32A 3RUZA 5ELBA 3CMAA 4HJ9A 1I5FA 2MQHA 2JEAI 1A3TA 4GZYC 4OELB 1KLGD 1QVCA 2F3WA 4JYAQ 3LWEA 4K5VA 2F0DA 1DOKA 1U4MA 4KHVA 3NK9A 3HKZG 4A3MB 4JI5Q 4L5TA 4IPCA 1EEID 1TWFH 3C2PA 1TWAH 3D4DA 1W2BA 1CKNA 4O1NA 4HJ8A 1G2TA 1OO9B 2DUDA 1B8AA 2F0LA 4BBRH 1E7ZA 3J7AV 4A3GB 2JA6H 4LJZC 5KIXA 3NENA 3A54A 2XRSD 5C4HA 1DONA 2SEBD 2D0PA 3HOXB 1Q8IA 2YYZA 1Q82C 3M4OB 3M7NA 1C8CA 4K14A 1BUVT 4DUYL 5JEAJ 1PYWD 5LHY1 2UXCL 3OOCA 3W1GA 1GUWA 2J7ZA 2HD3A 4YY3L 2A6ED 3MEHA 3D6WA 3STBD 3GO5A 2R6GA 2CFMA 2F0FA 3Q6SA 3HKZE 3HP3A 3R2TA 3J81c 2TSSA 1SXTA 3RN2A 4RAUC 3S1RH 2CVRA 5K36H 4DV5L 3C1EA 3I4NH 3S15H 3D6CA 3LGJA 1JOKA 4DV6Q 2WP8J 4PMWA 1G8ZD 2HCCA 3C46A 1QNUA 1PDQA 3ND8A 2A68C 2RQXA 4HJ7A 4IFDG 2K5HA 3FRPB 4C2MH 4DUYQ 2PZWA 5ELCA 3MWYW 4CJ0B 1EWHA 1FVIA 5GAGC 2QDBA 1VQ6A 3UDXA 1D6EC 2G9DA 3GTJB 4QL5A 4XQNA 3N52A 1B44D 1PZKD 1FJGL 4DV7Q 2QF7A 5LMNW 5C0XG 2VQFL 1IYVA 3E9HA 1FR3A 2RDHA 1PH7A 4NXNL 1OTCA 2L11A 1XMOL 1HFNA 1F9QA 4K2KA 4XYOA 1X9NA 1JT8A 2KEEA 1YHBA 3CP0A 2PQAB 5HGQA 4AH6A 3PO3H 1X55A 1N34Q 4NMZA 4HCSA 5IGGA 3FPPA 5LMNL 1JMCA 1N9WA 4IPHA 5FK9C 3P20A 1BKBA 5FLMH 1E24A 1X3EA 3AEVA 4LF5L 4IOAA 1V1PB 1IBLL 1KRSA 3Q22A 1Q3LA 4GLAC 3ERQA 1KAWA 1VQPA 1PRTD 2NBFA 1UWVA 3KLSX 2UUBL 2QDLA 4L63B 2L5TA 2MPMA 1C4QA 2Z0SA 1CQVA 4L5SA 4DR2L 1H9SB 3X3MA 3NWSA 1GD7A 2DY7A 3FMCA 2VY3A 1S5FD 4M1UB 4FXGC 1TS2A 1TKWB 4JPBW 1VF7A 5M5XH 5E4XA 4LF8Q 4I7AA 1C48A 2DJFC 1CSPA 3W1BA 1L1OA 3M4OH 3FEWX 3C1FA 4A3FH 3SK6A 1IZ6A 2IL8A 1PTOC 5GROA 3AB9A 1FNVA 2B2TC 4C3JB 1KDAA 1V8QA 5LMNQ 3TZUA 1PZJD 2FHTA 2CQOA 1EY8A 4A3LH 2NZHA 3ULPA 3PUXA 1STGA 1U9RA 2EY5A 2BA0A 4JBWA 1DOMA 1S4ZA 1MKHA 5ELOA 2F4VQ 1HNWL 2NB0A 1RDPD 1N34L 1TWGH 2ZT9C 4PV1C 2CHBD 3KJOA 4QY7A 2LFNA 2EJFC 1C7YA 1BVSA 1SE4A 5FJ8G 3GTQH 1X6OA 2F3VA 2B3GA 4TQUS 4A3KG 1ASYA 1FJGQ 2FXQA 3PIPA 5IGBA 2IJ0A 2O5JC 2K50A 4JOIC 3HOVG 5C6AA 3URYA 3HOVH 1YHQA 1PMRA 2YTXA 4MTKA 1WVLA 1SROA 1WI5A 5DLQE 1U4LA 3NSWA 3DUZA 1GVPA 1G91A 5M5YB 3J7ZC 4K6DA 1VQBA 1WD1A 3PF5A 1QWYA 2ZTDA 3EIVA 4GKKL 3FDTA 1PHJA 4ZAIA 1Y69U 2XVSA 1B3QA 2EYLA 1Z9FA 5G3LD 1NJIC 3RLNA 1SNDA 4ZRZA 3K58A 3KBXA 2CKZB 2SDFA 4N9PA 2GN5A 3PSIA 1KRTA 1X56A 4A3EG 2JA7H 3CCLA 1CI3M 1Q81C 2RKSA 2QEXA 1B1ZA 2D9UA 2OTLA 1S3OA 2KUMA 4PNYA 3A8JE 5FO9B 2F0TA 2EYPA 5IIFA 3G6EA 2VQEL 3VR6A 2J4XA 1VF5C 4CDDC 4PZ8A 2E2IB 3I8ZA 1EQTA 3VYSA 1L0YB 3X3NA 2PZUA 5EPKA 5IYBG 3K0XA 4MZ9A 3I4MB 5IT9c 2XWBB 2D62A 5JJLA 1LT3D 3MZ5A 3I4MH 4DV1Q 2F0IA 4DK6C 3JAML 3E9IA 4X65L 5C44H 3TS2A 1KAAA 2KECA 1QG7A 4UP8A 1VQ5A 4JV5Q 1NBWA 1M90C 1CT1D 4PQXA 1Y1WB 5KEEA 1GXDC 2VB2X 1V43A 1HZCA 2WAQE 2WB1G 1LTBD 1YJNA 3A0JA 3PO3G 2MNAA 1I3QH 1PRTB 4X62L 3S2HH 3S16B 3S2DH 3NTHA 4DR7L 1B3AA 4IQZA 2R7FA 2K33A 3I4NG 2R93H 1BXTA 3L2PA 1L2FA 5C3EG 2JSOA 4HIKA 2F0OA 1TS4A 1DXMA 1P16A 4KY7A 3GTMH 3A5ZB 4LFBL 2N3SA 4BBRB 1LO5D 3I90A 2EOTA 2JA8G 2NWGA 2ID0A 2F0QA 1JJ2A 4A3MH 2AKWB 3PV0A 3I72A 1PTOH 1FGBD 2DY8A 5COYA 3CCEA 1SJHD 2QGQA 5M3MH 3CRKC 4IFDH 4F87A 3BYTB 4KMUC 3CCJA 1STEA 1EUJA 4YWKA 5JEAH 2RDGA 4DV4Q 4B3TQ 4DV0Q 4DV3Q 1Q8KA 5C4XH 1Q7YC 1BBUA 4GLVB 4LUZA 1SYGA 2E75C 1BNZA 3A8IE 3NEMA 4FYDA 2RDFA 3ITPA 2UUAQ 4B3MQ 1J6QA 1NY4A 1PVOA 1OXTA 1LACA 4GOPA 3NE5B 5I9OA 2K03A 1B4OA 4JI6L 3TP6A 1HHVA 2Q8RE 4JI3Q 3GTQB 2LXJA 5GQOA 3CCRA 1STBA 2OCEA 5JOBA 1F9RA 2B2WA 2K5VA 1DYQA 5JPNC 3H3VC 2JQOA 1L0XB 2Q2IA 4XQQA 3J81i 2R3ZA 1XNQL 4IFDI 1AZQA 3D8GA 2AQ3B 4EQNA 3CPWA 2JA6G 4OWXB 1PV4A 2EYMA 2A19A 4QIWB 1SYDA 4RMFA 1D5ZC 1NMFA 1HA5A 2AUJD 2F0EA 4KN7C 4JI0Q 5EKLA 5C5LA 4UHVA 1HXYD 1ZXTA 3VYRA 1IBML 4XXEA 1YVCA 4N8FA 5D14A 3R2IA 1IW7C 1LTLA 1P8LA 1IKMA 1BQQT 1E2WA 5C44B 4LF9L 1EQQA 4O2DA 3TP7A 3UE0A 2XIWA 2F0JA 2PNRC 4N8X1 1GO3E 1O7YA 3QOLA 1SRUA 3HGBA 2LS01 2KCTA 4JVZA 3MHBA 2F52A 4BY7H 2KVMA 2NYZD 2KEDA 1VQ7A 2E2IH 5I6WA 1I4GA 1UAPA 2K1BA 1GUSA 5IWAQ 3U58A 1TIID 3M4YA 4IN3A 1AE2A 4N9TA 3SDZA 4JBMA 1MBYA 4R4CA 3WDNA 3KBGA 1VQKA 1SYCA 2MFIA 4B3RL 3H94A 2PZTA 1ONLA 3F1ZA 2UUCQ 3CC4A 3NBIA 3BDCA 1KNEA 5JVG3 2IX1A 5D3DA 3JAMi 1NMGA 1HZBA 3ONAB 2K7VA 4IZ8A 4DR7Q 2CH4W 2Q2UA 3GV3A 2XNAC 4TKOB 2Z9HA 4ZUIA 5IGFA 4A3JG 4MHEA 5AFWA 1SEBD 1Y1VG 4IUPA 4RCNA 2Z6KC 2VNUD 4IUVA 2P5ZX 4NP5A 3S17B 1YI2A 2NN6I 4KLKA 3FKIH 3Q8DA 1M8AA 1O7IA 2HQEA 3J80L 1EEFD 4HIMA 4EGVA 2DGYA 4HMJA 4B3RQ 1JR0D 2AWNA 1WTPA 2RHSB 1LUZA 3GTMB 3HOVB 1CA5A 4BXXG 2E5LL 5IWAL 2H1EA 2QCPX 2UUCL 2OT2A 1BR9A 1BDOA 4KKSA 4LF8L 4KTAA 1XX8A 1I4XA 3T53B 5EQ0A 2QKIC 4R4OA 4X3SA 2B63G 3F2BA 1Y1VH 1STHA 3SVMA 1HTPA 3DXJC 1BF4A 3G71A 1A2TA 4PMBA 5F2DA 4IJHA 4KV6A 1QCBD 2PYKA 1KHIA 2HDLA 1IXRA 1OXUA 2A73B 4ULLA 1MSGA 4K5WA 1G2SA 4JI7Q 2R7ZH 1RJTA 3PUZA 2CWPA 1SFOB 3H09A 1YJ9A 2E74C 1VQLA 2NUCA 1S5ED 3KOJA 1B2TA 1H9RA 3DM1A 3HOYH 5M3MG 1WFQA 1KNAA 3J80c 1AH9A 1HR0W 1HCZA 3I3CA 5KNBA 1VQDA 3SK4A 3STBC 5FO8B 2PCFB 4DUZL 2JA5G 1MIUA 1GJXA 1WJJA 1NE3A 2MGSA 1F2MA 1TWFB 2AHOB 1CQFA 3FP9A 1EU3A 4LK1C 1B50A 2HCIA 4PZ6A 4U68A 1SN8A 1K0RA 1O78A 5C3EH 1FGUA 1AZPA 1E22A 1LABA 2VUMG 1YJWA 2ZM6Q 2LXKA 4A3IH 3UDFA 2F0GA 1IYJB 1HQRD 3I73A 2AQ1B 3KJPA 4A3DH 3M3YH 2D5DA 5EPJA 1HNZQ 1KXLA 5KYLA 2EPBA 5C4JB 2ICEC 4BA2I 4LMQD 3I4NB 2CQAA 4ALPA 3H0GH 4IURA 3RN5A 4DU9A 2AQ2B 2LKVA 2JJQA 1AFPA 1WOCA 5E3FA 5FO7B 3CAMA 3GTGH 1WCMB 3GTLB 2JA8B 4YCUA 5IOCA 1EY9A 4NDXA 2V1CC 4RGMA 2B8GA 4IFDJ 2G9HD 3GTOH 2MO0A 4OIKA 1D7QA 2X6LA 1TWGB 3GQBA 5K5PA 2EY2A 3R8BA 1NR4A 4MIUA 1LV9A 5EKKA 4GNXC 3OMGA 2Y0SB 4A3IG 3NP8A 4LWCA 4X6AH 2ENBA 3PQIA 2F0MA 2X6GA 4DN4M 4DR2Q 1EY4A 1EY7A 1HA6A 3D4RA 1DCZA 3G48A 2IW3A 2A68D 2H4OA 3KF8A 1VQNA 2UU9L 4A3EH 1JWUD 3KF8B 1SMXA 5HGTA 2GA4B 1AN8A 3BVMA 1ZYRD 1HNZL 3TP5A 1EYGA 2K05A 5JEAG 4WFN3 5AJ3L 2JA5H 3NWTA 3T13A 3NQIA 4ABNA 4IUQA 1PRTC 5CV9A 3D31A 3GV6A 5IODA 1HNXQ 2A6EC 1CK1A 4NKLA 3K7AH 1YEZA 1GUGA 2RSOA 1GM5A 2KCMA 4LFAQ 5CV7A 4A3MG 2HIXA 2SOBA 4YWLA 1F2ZA 1NUCA 3QG1A 3VA5A 4X64L 2D0OA 1K73C 2E8GA 3FVQA 1CHPD 1XYIA 4B9XA 1BCPF 2K5QA 3HOXG 3BVZA 2YV5A 4GN4B 4ID6A 4CDCC 2XWJB 2JYOA 1K83B 4A3BH 4NB3A 2F03A 1KDBA 1VQOA 1VQGA 4DR5Q 2BOSA 3L9AX 2AMCB 2B29A 2GVAA 1Z7TA 5C0XJ 4P73A 2UUBQ 5C44G 5NUCA 2ALYB 4P71A 3T56B 5JJZA 2YU9B 2K32A 4BXXH 4BY7B 4JOIA 1CSQA 1JORA 1ICFB 4GOPC 4NXML 1IBKQ 4UY8C 3SHLA 1K8GA 3VYUA 3NTIA 4A3FG 4P2CB 1N36L 3NUCA 3M9BA 5IP7G 3PIO3 4DV3L 3K5LA 1IKLA 1IYUA 2HHHQ 1H9JA 2RF4A 3Q24A 4DXGA 1CKMA 5CYUA 1Y1WH 2LMCB 1BCPC 1EZ6A 2ZJPA 1KD1C 4LF7L 1I3QB 3LNNA 5IGCA 3TP8A 2Q8TA 2X69A 3OPOA 3A8KE 4QCLA 5IP7H 1ENFA 5C3WA 1TY2A 1YHAA 1ILQA 1ZEQX 3J80E 1SYBA 2NVXB 4Z9CB 2IHEA 1J5EQ 4OO1G 5ELNA 3PIOA 4JI5L 1PH4A 5FOBB 2EYFA 3HS0C 2XRQD 3W3AA 4TSSA 4LW1A 1A62A 1WTWA 1EYDA 5LL6S 3OHXC 1AP0A 1Y1VB 4CDFC 1SNMA 5FLXE 3KYHC 3K81C 2CW0C 3KFUA 4A3BG 3U9OA 4HIDA 1UE1A 3K57A 1WCMH 4H13C 3HOXH 1Y8PB 4DR3Q 3I56A 2XN9C 5J22A 2YTYA 1BCPB 1JE5A 3RLOA 3S14H 1WTRA 2NVTB 4NXNQ 4YCVA 2CW0D 1JB7A 4DK0A 1N33Q 2F0HA 2F0SA 4V190 2FMCA 1S5BD 2QEJC 1A15A 2WKDA 3C3LA 3K5NA 2QA4A 1B9MA 3RLFA 3TDQA 2VL6A 2ATWA 3TN2A 1PTOF 2IT1A 3ZJYC 2N88A 3V96A 5KNCA 1LTAD 2I5LX 4A3LG 1TQOA 3KK7A 3K80C 3CCMA 4DFAA 4YIJA 5CORA 4A3CG 2RVLA 4ME3A 3KDFB 3NXWA 1WTOA 2E76C 3OMCA 1IBKL 2YU9H 4GS3A 1PH2A 4ZKCB 4LF9Q 3S1NB 4H0LC 3PUYA 2ASBA 5C4ZA 1CZWA 1PFSA 5KYIA 4WJ3M 2EIFA 4XIGS 2B8FA 4Y7NH 4C3IB 1XMQL 4WRDA 1Q1BA 4LUOA 4KY6A 5TSSA 2WAQB 3NELA 4KHZA 3VA7A 3HG9A 3J80i 2HQLA 4EQPA 1S5DD 4GN3B 4F7XA 1HFGA 2E2HB 4DK1A 1VQ9A 4IUNA 3DLLA 4UAIA 1TWCH 3T1HL 1SE8A 1LTID 2CCZA 3T16A 3ICEA 1EIFA 4JW0A 5ISRA 5GADC 3RNUA 3NHHA 3NQTA 1S72A 4IO9A 4B3SL 3Q23A 5C4XG 3CRLC 2AWOA 2VXWA 4IPDA 1I94L 1BBXC 3LX0A 4J15A 5IGEA 1CA6A 1Z47A 1PYSB 1C9OA 4WJ4A 2B2UC 2JA9A 1N32L 4NXMQ 3BZDB 3S9WA 4A3EB 1W3SA 3H0GB 4HN7A 3MA2B 5D3IB 5CBAE 5DEHA 4OIJA 3CCSA 1QUQB 5EGTA 3M4PA 1D2BA 1OXSC 3K6OA 1MJCA 1S5CD 4KK7A 2BA1A 4DAYA 3EQLC 2R93G 2KBNA 4RHSA 1WCMG 2PI2E 3MXUA 4JI2L 1G6PA 2Z1CA 3SR1A 2B2VC 4P75A 2BDOA 2Z6KA 2FMMA 5KRUA 5A2QE 4RA8A 3W5OA 2E5LQ 2Y0SG 4B3SQ 2GVBA 1TWHH 5DM73 2ZJQA 1AE3A 1JE4A 5C5MA 1KQSA 2KHJA 4JBKA 4A93B 3Q0AA 1Q46A 2VS1A 4ZYSA 1GHJA 3BVGA 4DR1Q 1MI2A 4FNFA 3KF6B 4K2LA 1ML0D 4LFBQ 4GOPB 3NTKA 4PG3A 4RWSC 4JI1Q 4A76A 1I50B 4KI0A 3DEPA 1VCIA 3GTJH 2WB1B 2R92B 3PO3B 1X54A 5IT9L 2MP1A 3J7YW 2A8VA 3U4VA 1QVGA 4JI8L 1TS3A 3CHBD 1EY0A 5BN3A 1O7LA 1IBMQ 1YZ6A 1PFNA 3TS0A 1L0WA 4BBRG 4OWTB 1CTMA 1EIYB 2C35B 2MO1A 4G4KA 2ZXRA 3W2DA 1SFOH 4K0KQ 1UNSA 3IRBA 4C3HG 4YHHL 1EYAA 5A35A 1L1OC 4AYBG 2C5CA 1B53A 3VR2A 3SE0A 1A63A 3VR5A 2VQEQ
chains in the Genus database with same CATH topology
1RD9D 1Z6HA 3T51B 1E2ZA 5M5XB 4FVMA 5I6YA 3V05A 2B2TA 5FKAC 3F2UA 4RGTA 1EY5A 1NR2A 4FF3A 1GOZA 3P75A 1AEXA 1H9SA 1JC7A 2BDNA 4DA2A 2OEOA 4O42A 1Y8OB 2J0TD 4B9WA 1EY6A 1SJED 4A3FB 3WOFA 2EJGC 1R9TB 3GTOB 2NVQB 4K8IA 3QJYA 4OO1H 3BDOA 3GTGB 1YNND 3PMFA 4HCEA 4OGQC 2A69C 1STNA 3SXHA 1HTLD 3LWUA 2DNCA 3NPPA 3TSSA 4ME5A 4DAPA 3QO2A 2NN6G 1K8MA 2IPKD 5I4DA 3MVVA 5ELDA 2D2CC 2A6HD 3SEBA 3VYTA 1O80A 3K5OA 2LY7A 3HOUB 2MJ8A 2XSCA 1SSOA 5DM63 1W6JA 4HEDA 4BWGB 1RKNA 1M4VA 4LAAA 3PIP3 3QIAA 2N55A 1I4QA 3S1RB 1ESRA 4XT1B 3A55A 4RKLA 1IL8A 3I70A 4CKBA 2K5DA 3MFYA 4A3JB 2L55A 3H91A 5M5WB 1STAA 1SAPA 2DN8A 2WACA 4M8AA 2QILA 1KTKA 3P7JA 3BS1A 3JAME 4C3IG 5CV8A 1OXVA 2M00A 2DNEA 1LT4D 5M9OA 1TR5A 2E2JB 4K6LA 3GTKB 5K36G 3J7AF 2WIIB 3VR4A 1CHQD 1LTTD 1TU2B 1FYCA 1D5MC 3PUVA 1QILA 4MN3A 1V1PA 4K8JA 1EL0A 4HSPA 3AU7A 1ET9A 1E0BA 1Q12A 2EVBA 2L12A 4DGZA 1ENCA 1RTNA 3EFXD 4OO1I 4ZK9B 1D5XC 3IL8A 2JXMB 4R8NA 1A3VA 4EVOA 1JCKB 1PLFA 4BY1B 4Q0FA 1HUNA 2NN6H 4HAEA 2R93B 1F77A 5M3MB 2IWHA 4KD3A 4BBSB 1YNJC 3S2HB 4RH6A 1EQVA 3J81E 5T1IA 2NTSA 3S15B 1VDZA 4K5XA 1U4PA 1HUMA 1XTCD 2KOLA 2I46A 2Z4HA 4ZQ3A 4KKUA 2VB3X 3CKIB 1DJRD 1V1OA 3G7LA 5ELFA 1FNUA 3S2DB 1QB5D 2B2UA 3N6RA 3TMEA 1PTOD 2B2VA 2NTTA 1GHKA 1JICA 3QOJA 3VR3A 1JWSD 1JWMD 3PO2B 4OL7A 3A56A 3E0JA 5I9PA 4IUUA 3NBHA 3HKZB 1DD2A 5CC4A 4RGNA 4CHTB 1Q1EA 5CGKA 4J6HA 5C0XI 5T1GA 4C3HB 3KLRA 1I4HA 1FD7D 4A3IB 3V2TA 1JOOA 1STYA 3EVQA 4CJ1B 1PTOB 5E1FA 1TVXA 3A7AB 4X3KA 2K5WA 1QE6A 5EBCA 4HTHA 4ZLTF 4DAVA 1CZGA 2OXPA 2Z4IA 2E2DC 1PZID 4CBVA 3HOZB 3EJIA 1MGSA 4KD4A 1U4RA 1JOQA 3MXGA 1ZYRC 1VMCA 2B39A 1A6XA 1LT5D 4ZKBB 2EXZA 2PQEA 4Q5VA 3G6JB 4X3UA 3J81L 1HRJA 4U673 1E2VA 3RZDB 3PUWA 1PRTF 4DNTB 5EKIA 1YNNC 2L1BA 2JE6I 5JAVA 3DWPA 1EOTA 3U9SA 1F2LA 3MXNA 4L8JA 5ELEA 1EZ8A 2K28A 1IW7D 1SYFA 1T5XD 3M85A 4R8IA 5CMDA 5D65A 3QWNA 5I2YA 1MD2D 4FF1A 1SNPA 2HDMA 4BS9A 1Q90A 4DF7A 1I6HB 1YNJD 3I91A 1FNWA 3ZYYX 5C3XA 3UI2A 3ND9A 1ILPA 1EIGA 2M9VA 3A7LA 1H9MA 3OWEB 2EZVA 1GUNA 1F2YA 2O5IC 3K7AB 1MSHA 3D3RA 1F9PA 2KCCA 4CGYB 4A3BB 4QB4A 2PPBC 1K8OA 4XQJA 1HQMC 3HOYB 3MFGA 2F1MA 4H7BA 4FP5D 3CQZB 2JEBI 2KA7A 4IALA 2R61A 2EYJA 5CV4A 5IGDA 1A2UA 1I6VC 1WTVA 3FPUB 4ODGA 4XT3B 2KQ3A 3EROA 1R4PB 1ZKOA 4HMIA 3P1HA 4KJNA 1EU4A 4RFBA 4WORA 1EYCA 3I4LA 4QUCA 2ZXPA 4HSVA 4J1MA 4CKEA 3HEJA 2KCNA 1TWAB 1XXGA 3K59A 2BE5D 1ESFA 2FINB 1W6KA 3IFTA 4RGOS 1AW7A 5KGUA 4QMGA 1DOLA 4FO2A 1PXUA 4TRDA 1G6ZA 2FFKB 4E6IA 1QOHA 4BA1I 3M3YB 3GD7A 5M3FB 1WTXA 2EJMA 3MAQA 5CV5A 2AUKA 1PFMA 1I4RA 4F88A 2PO4A 1SBBB 5C4XB 1QNKA 1H9KA 2K04A 3FKIB 3RD4A 1D1KA 2L0CA 2WV6D 1F9SA 1ET6A 1O7ZA 3IAYA 2O2LD 1RTOA 1SMYC 2A74C 4UDUC 1R4QB 3TZDA 2BCOA 4JK1C 4PMCA 1GUOA 3O13A 4CJ2C 1J8IA 1LTRD 1ENAA 5C3EB 4FXDA 1WD0A 1VMPA 4RKBA 1SNOA 2K01A 4ZUJA 3IFDA 2PW7A 1WTQA 4S3SA 1HPCA 5EPLA 3DMUA 2PW5A 1ICWA 1EFID 1SE3A 2ICIA 4G57A 4I65A 1QJOA 4DNRB 5A2QL 4XDXA 4G7OC 2WINB 5C0XH 4WJWA 2B2YC 2F0PA 4H44C 1SMYD 5BN5A 1TWCB 2RSNA 2F0KA 5JVH3 4RHRA 2L4NA 2F0UA 1A3UA 3OIQA 1KDCA 4QUFA 1B9NA 1KLUD 5CV6A 3K5MA 1LTGD 1SNQA 3L7ZC 1GUTA 4R9WA 3OSOA 3RMHA 1OXXK 1PFBA 1X3PA 2EY1A 2JA6B 3MXPA 5I2XA 4AYBB 1SDFA 3S1QB 3RZOB 1NSNS 2A69D 2MUYA 3OIPA 3AMUA 5HURA 4F8MA 1SYEA 1RCVD 1JB3A 4HR7B 4FXKC 3BDLA 3KLSA 2EYOA 3L3OC 3D4WA 4OHJA 4C1NK 3HOWB 2KJXA 2Z8LA 1SE2A 2WKCA 2V4DA 3T4AC 1NCVA 3IKJA 3TBIB 1NAPA 3HZXA 3SK5A 1EIHA 2NZ1D 3E5SA 3R3OA 4KY5A 4FF4A 2EDGA 3BG3A 1EWCA 2EY6A 1UEAB 1J9OA 4DXFA 5BN4A 4KJOA 1X3QA 2Q8IB 4L6TB 5EBDA 1SNCA 2JP1A 4NW2A 2NVYB 2RBMA 2A5HA 2SNMA 5J39A 4C56C 3MTSA 1LT6D 1CFMA 5E4WC 1XWEA 2PMZB 5EJWA 1RF2D 3DWAA 1LTSD 3BYYB 1BOSA 1TT2A 4X3TA 4B08A 4A3DB 5LL6X 2F4IA 3E6ZX 2IX3A 2B63B 3EA6A 2A6HC 3DEOA 4I7ZC 4V0BA 1BO0A 4C3JG 1BCPD 2IX0A 3GP7A 4FF2A 5IT9E 3M7GA 5DAUA 4XTCS 1TWHB 4C2MB 1T5EA 4J8QA 1I4PA 2EE1A 1KABA 2F0NA 2HUGA 4C1NI 1LLRD 4IUTA 2ZXOA 3DWQA 4A3KB 4G7ZC 2F0VA 2R7ZB 1TY0A 4G7HC 2O4XA 2JA5B 3S14B 3CU7A 1IHZA 2SNSA 3SK8A 5KNDA 2RA4A 1DZ1A 1RHPA 1Y8NB 3OWFA 1DM0B 2B2WC 4ILWA 1II3A 1TS5A 2VUMB 4RCOA 3R93A 2OF1A 1D1IA 2C9OA 4XYQA 3S1MB 2FJ2A 2MHVA 5FLXL 1CM9A 4EQOA 3WOEA 2JA7B 2M2LA 2I07B 3KUPA 1RODA 2BE5C 3DHQA 2F0WA 3HRZC 4CKCA 5CBEE 5G3LF 1G291 2L9HA 3H6MA 1JQYD 2K6AA 2B2YA 3GTPB 3OW7A 4Y7NB 2EYHA 4KN4C 5JPMC 1UUPA 5CR3A 4KKTA 3QB3A 5J1ZA 4QF4A 5DNFA 2TMPA 2KHSA 3MC0B 3K0YA 1X32A 3RUZA 5ELBA 2JEAI 1A3TA 4GZYC 1KLGD 2F3WA 3LWEA 4K5VA 2F0DA 1DOKA 1U4MA 4KHVA 3NK9A 4A3MB 1EEID 3C2PA 3D4DA 4O1NA 1G2TA 1OO9B 2F0LA 3J7AV 4A3GB 4LJZC 5KIXA 3A54A 2XRSD 5C4HA 1DONA 2SEBD 3HOXB 1Q8IA 2YYZA 3M4OB 3M7NA 1C8CA 4K14A 1BUVT 5JEAJ 1PYWD 5LHY1 3OOCA 1GUWA 2J7ZA 2A6ED 3MEHA 3D6WA 3GO5A 2R6GA 2F0FA 3Q6SA 3HP3A 3R2TA 2TSSA 1SXTA 4RAUC 2CVRA 5K36H 3C1EA 3D6CA 1JOKA 2WP8J 4PMWA 1G8ZD 2HCCA 3C46A 1QNUA 1PDQA 3ND8A 2A68C 2RQXA 4IFDG 3FRPB 2PZWA 5ELCA 3MWYW 4CJ0B 1EWHA 2QDBA 1D6EC 2G9DA 3GTJB 4XQNA 3N52A 1B44D 1PZKD 2QF7A 5C0XG 1IYVA 1FR3A 2RDHA 2L11A 1HFNA 1F9QA 4K2KA 4XYOA 2KEEA 4NMZA 4HCSA 5IGGA 3FPPA 5FK9C 3P20A 1V1PB 3Q22A 1Q3LA 3ERQA 1PRTD 2NBFA 3KLSX 4L63B 2L5TA 2MPMA 1C4QA 1CQVA 1H9SB 3X3MA 3NWSA 2DY7A 3FMCA 1S5FD 4M1UB 4FXGC 1TS2A 1TKWB 1VF7A 5E4XA 1C48A 3FEWX 3C1FA 3SK6A 2IL8A 1PTOC 3AB9A 1FNVA 2B2TC 4C3JB 1KDAA 1V8QA 3TZUA 1PZJD 2FHTA 1EY8A 3PUXA 1STGA 1U9RA 2EY5A 2BA0A 4JBWA 1DOMA 1S4ZA 2NB0A 1RDPD 2ZT9C 4PV1C 2CHBD 2LFNA 2EJFC 1SE4A 2F3VA 4TQUS 5IGBA 2IJ0A 2O5JC 5C6AA 3URYA 1PMRA 1WVLA 1U4LA 3NSWA 3DUZA 1G91A 5M5YB 4K6DA 1WD1A 1QWYA 3FDTA 4ZAIA 1Y69U 2XVSA 2EYLA 5G3LD 1SNDA 4ZRZA 3K58A 3KBXA 2SDFA 4N9PA 1CI3M 2RKSA 1B1ZA 2D9UA 2KUMA 4PNYA 3A8JE 5FO9B 2F0TA 2EYPA 5IIFA 3VR6A 2J4XA 1VF5C 2E2IB 3I8ZA 1EQTA 3VYSA 1L0YB 3X3NA 2PZUA 5EPKA 3I4MB 2XWBB 2D62A 1LT3D 3MZ5A 2F0IA 3JAML 1KAAA 2KECA 1QG7A 1CT1D 4PQXA 1Y1WB 5KEEA 1GXDC 2VB2X 1V43A 1LTBD 1PRTB 3S16B 3NTHA 1B3AA 4IQZA 2K33A 1BXTA 2JSOA 2F0OA 1TS4A 1DXMA 4KY7A 4BBRB 1LO5D 3I90A 2EOTA 2NWGA 2ID0A 2F0QA 3PV0A 3I72A 1PTOH 1FGBD 2DY8A 5COYA 1SJHD 3CRKC 4IFDH 4F87A 3BYTB 4KMUC 1STEA 5JEAH 2RDGA 1SYGA 2E75C 1BNZA 3A8IE 4FYDA 2RDFA 3ITPA 1OXTA 1LACA 3NE5B 5I9OA 2K03A 1B4OA 3TP6A 1HHVA 2Q8RE 3GTQB 1STBA 5JOBA 1F9RA 2B2WA 1DYQA 5JPNC 3H3VC 1L0XB 4XQQA 4IFDI 2R3ZA 1AZQA 3D8GA 2AQ3B 4EQNA 2EYMA 4QIWB 1SYDA 1D5ZC 1HA5A 2AUJD 2F0EA 4KN7C 5EKLA 5C5LA 1HXYD 1ZXTA 3VYRA 4XXEA 5D14A 3R2IA 1IW7C 1IKMA 1BQQT 1E2WA 5C44B 3TP7A 2XIWA 2F0JA 2PNRC 1O7YA 3QOLA 3HGBA 2LS01 3MHBA 2KVMA 2NYZD 2KEDA 5I6WA 1I4GA 1UAPA 2K1BA 1GUSA 1TIID 3M4YA 4IN3A 4N9TA 3SDZA 1MBYA 3WDNA 3KBGA 1SYCA 3H94A 2PZTA 1ONLA 3NBIA 3BDCA 1KNEA 5JVG3 2IX1A 5D3DA 3ONAB 2K7VA 4IZ8A 3GV3A 2XNAC 4TKOB 4ZUIA 5IGFA 4MHEA 5AFWA 1SEBD 4IUPA 4RCNA 2VNUD 4IUVA 4NP5A 3S17B 2NN6I 1M8AA 2HQEA 3J80L 1EEFD 4EGVA 4HMJA 1JR0D 2AWNA 1WTPA 3GTMB 3HOVB 1CA5A 2H1EA 2QCPX 2OT2A 1BR9A 1BDOA 4KKSA 4KTAA 1XX8A 1I4XA 3T53B 5EQ0A 2QKIC 4X3SA 1STHA 3SVMA 1HTPA 3DXJC 1BF4A 1A2TA 4PMBA 5F2DA 4KV6A 1QCBD 2PYKA 2HDLA 1OXUA 2A73B 4ULLA 1MSGA 4K5WA 1G2SA 1RJTA 3PUZA 1SFOB 3H09A 2E74C 2NUCA 1S5ED 1B2TA 1H9RA 3DM1A 1KNAA 1HCZA 3I3CA 5KNBA 3SK4A 5FO8B 2PCFB 1GJXA 2MGSA 1F2MA 1TWFB 1CQFA 1EU3A 4LK1C 1B50A 2HCIA 4U68A 1O78A 1AZPA 1LABA 2F0GA 1HQRD 3I73A 2AQ1B 2D5DA 5EPJA 5KYLA 2EPBA 5C4JB 2ICEC 4BA2I 4LMQD 3I4NB 2CQAA 4IURA 4DU9A 2AQ2B 2LKVA 1AFPA 5E3FA 5FO7B 1WCMB 2JA8B 3GTLB 5IOCA 1EY9A 4NDXA 4RGMA 2B8GA 4IFDJ 2G9HD 4OIKA 2X6LA 1TWGB 3GQBA 5K5PA 2EY2A 3R8BA 1NR4A 4MIUA 1LV9A 5EKKA 3OMGA 2Y0SB 3NP8A 2ENBA 2F0MA 2X6GA 4DN4M 1EY4A 1EY7A 1HA6A 3D4RA 1DCZA 2IW3A 2A68D 2H4OA 3KF8A 1JWUD 5HGTA 2GA4B 1AN8A 3BVMA 1ZYRD 3TP5A 2K05A 5JEAG 4WFN3 3NWTA 3T13A 3NQIA 4ABNA 4IUQA 1PRTC 5CV9A 3D31A 3GV6A 5IODA 2A6EC 1CK1A 4NKLA 1GUGA 2RSOA 5CV7A 2SOBA 1F2ZA 1NUCA 3QG1A 3VA5A 3FVQA 1CHPD 1XYIA 4B9XA 1BCPF 2K5QA 3BVZA 4ID6A 2XWJB 2JYOA 1K83B 2F03A 1KDBA 2BOSA 3L9AX 1Z7TA 5C0XJ 5NUCA 3T56B 5JJZA 2YU9B 2K32A 4BY7B 1JORA 3SHLA 3VYUA 3NTIA 4P2CB 3NUCA 3PIO3 3K5LA 1IKLA 1IYUA 1H9JA 3Q24A 4DXGA 5CYUA 2LMCB 1BCPC 1EZ6A 1I3QB 3LNNA 5IGCA 3TP8A 2Q8TA 2X69A 3OPOA 3A8KE 4QCLA 1ENFA 5C3WA 1TY2A 1ILQA 1ZEQX 3J80E 1SYBA 2NVXB 4Z9CB 4OO1G 5FOBB 2EYFA 3HS0C 2XRQD 3W3AA 4TSSA 1WTWA 1EYDA 5LL6S 3OHXC 1AP0A 1Y1VB 1SNMA 5FLXE 2CW0C 3U9OA 3K57A 4H13C 1Y8PB 2XN9C 5J22A 1BCPB 1WTRA 2NVTB 2CW0D 4DK0A 2F0HA 2F0SA 4V190 2FMCA 1S5BD 2QEJC 1A15A 2WKDA 3C3LA 3K5NA 1B9MA 3RLFA 3TDQA 3TN2A 1PTOF 2IT1A 2N88A 3V96A 5KNCA 1LTAD 1TQOA 3KK7A 4DFAA 4YIJA 5CORA 2RVLA 3NXWA 1WTOA 2E76C 3OMCA 4ZKCB 3S1NB 4H0LC 3PUYA 5C4ZA 1CZWA 5KYIA 4XIGS 2B8FA 4C3IB 4WRDA 1Q1BA 4KY6A 5TSSA 2WAQB 4KHZA 3VA7A 3HG9A 4EQPA 1S5DD 4F7XA 1HFGA 2E2HB 4DK1A 4IUNA 4UAIA 1LTID 3T16A 5ISRA 3NHHA 3NQTA 3Q23A 3CRLC 2AWOA 2VXWA 1BBXC 3LX0A 5IGEA 1CA6A 1Z47A 2B2UC 3BZDB 3S9WA 4A3EB 3H0GB 4HN7A 3MA2B 5D3IB 5CBAE 5DEHA 4OIJA 5EGTA 1D2BA 1OXSC 3K6OA 1S5CD 4KK7A 2BA1A 4DAYA 3EQLC 4RHSA 3MXUA 2Z1CA 3SR1A 2B2VC 2BDOA 2FMMA 5KRUA 5A2QE 4RA8A 5DM73 1JE4A 5C5MA 4A93B 3Q0AA 4ZYSA 1GHJA 3BVGA 1MI2A 4FNFA 4K2LA 1ML0D 3NTKA 4RWSC 1I50B 4KI0A 3DEPA 1VCIA 2WB1B 2R92B 3PO3B 5IT9L 2MP1A 3J7YW 1TS3A 3CHBD 1EY0A 5BN3A 1O7LA 1PFNA 1CTMA 2ZXRA 4G4KA 3W2DA 1UNSA 4C3HG 1EYAA 5A35A 2C5CA 1B53A 3VR2A 3SE0A 3VR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5X A;  5ISR A;  4ODG A;  3NP8 A;  5EKL A;  2KQ3 A;  3NHH A;  2ENB A;  3NQT A;  2F0M A;  3R3O A;  4KY5 A;  3MZ5 A;  1SYB A;  3OWF A;  4K14 A;  3C1F A;  4ZQ3 A;  3SK6 A;  4G57 A;  1EY4 A;  4I65 A;  1EY7 A;  1STH A;  2EY6 A;  2F0I A;  3ERO A;  3LX0 A;  5I6Y A;  1II3 A;  4HMI A;  1KAA A;  4RKL A;  3P1H A;  5IGE A;  4KJN A;  1A2T A;  4PMB A;  4WOR A;  2EYF A;  2F0P A;  5F2D A;  1EY5 A;  1EYC A;  2OF1 A;  3E5S A;  4KJO A;  5HGT A;  4KV6 A;  5KEE A;  2PYK A;  1KDA A;  3MEH A;  2F0K A;  1EYD A;  3TME A;  4J1M A;  3TP5 A;  5JAV A;  3HEJ A;  2F0F A;  3P75 A;  4K5W A;  3TP7 A;  1AEX A;  1SNM A;  3T13 A;  1SNC A;  5C3W A;  1STA A;  3QOJ A;  2WAC A;  1EY8 A;  2F0J A;  3S9W A;  2OEO A;  5CV9 A;  3U9O A;  2F0U A;  1A3U A;  4EQO A;  3QOL A;  1U9R A;  1STG A;  1KDC A;  5DEH A;  2RBM A;  2EY5 A;  3C1E A;  1EZ8 A;  4OL7 A;  1EY6 A;  3D6C A;  5CV8 A;  5EGT A;  2M00 A;  5KGU A;  1JOK A;  5J22 A;  3MHB A;  5I9P A;  2NUC A;  1TR5 A;  4QMG A;  2SNM A;  1SYF A;  5CV6 A;  5M9O A;  2F0O A;  4NKL A;  4KY7 A;  4TRD A;  5J39 A;  1SNQ A;  4E6I A;  5CV7 A;  2F0H A;  3DHQ A;  2F0W A;  2SOB A;  5CC4 A;  1F2Z A;  2F0S A;  2F3V A;  2PZW A;  3OSO A;  5CGK A;  3SK4 A;  1NUC A;  4J6H A;  3SR1 A;  3VA5 A;  2F0Q A;  5IGB A;  2QDB A;  5C6A A;  5I6W A;  2EY1 A;  1TT2 A;  1SNP A;  3H6M A;  3MXP A;  5CV5 A;  4K8I A;  5KRU A;  1F2M A;  4B9X A;  4N9T A;  3V2T A;  1JOO A;  1STY A;  3EVQ A;  4ID6 A;  4K8J A;  4DF7 A;  1NSN S;  3PMF A;  5C5M A;  1SYC A;  5C3X A;  1TQO A;  2EYH A;  2PZT A;  1STN A;  4K6D A;  3SXH A;  3BDC A;  4K2K A;  5CR3 A;  1KDB A;  3QB3 A;  5J1Z A;  5E1F A;  4QF4 A;  4YIJ A;  4K2L A;  4DFA A;  4IZ8 A;  5HUR A;  1SYG A;  2F0G A;  2EYL A;  3NXW A;  2RDF A;  4HTH A;  5K5P A;  4ME5 A;  4DGZ A;  1SYE A;  3ITP A;  3OMC A;  1F2Y A;  4NMZ A;  4ZUI A;  1ENC A;  1SND A;  4PMC A;  2OXP A;  5NUC A;  5IGF A;  5IOD A;  2KHS A;  5IGG A;  5I9O A;  5KYL A;  4N9P A;  3EJI A;  5C4Z A;  3MVV A;  3BDL A;  4KD4 A;  1JOR A;  3TP6 A;  5KYI A;  4R8N A;  5DAU A;  1ENA A;  4B9W A;  2EYO A;  1A3V A;  4QB4 A;  3D4W A;  3RUZ A;  3SHL A;  1JOQ A;  4NP5 A;  2RKS A;  1STB A;  5JOB A;  4WRD A;  4EVO A;  1A3T A;  4KY6 A;  1EY0 A;  2F3W A;  4PNY A;  3NUC A;  4H7B A;  4K5V A;  1KAB A;  2F0D A;  3ERQ A;  2HQE A;  4DU9 A;  2F0T A;  2F0N A;  2EYP A;  3NK9 A;  4KHV A;  2LKV A;  4RKB A;  1SNO A;  4EQP A;  5IIF A;  5E3F A;  4ZUJ A;  4HMJ A;  1RKN A;  3D4D A;  4KD3 A;  4F7X A;  2PW7 A;  5IOC A;  1EY9 A;  4NDX A;  1EZ6 A;  5C5L A;  2F0L A;  3D8G A;  2F0V A;  4IAL A;  4EQN A;  5IGC A;  1EQV A;  2EXZ A;  4LAA A;  4S3S A;  3TP8 A;  2EYJ A;  1EYA A;  2O4X A;  4F8M A;  5KIX A;  2PQE A;  4IUN A;  5CV4 A;  1A2U A;  5IGD A;  1IHZ A;  2EY2 A;  2EYM A;  2PZU A;  2SNS A;  3HZX A;  3SK5 A;  3SK8 A;  1SYD A;  4MIU A;  5EKK A;  4KTA A;  5C4H A;  3OMG A;  3DMU A;  2PW5 A;  3T16 A;  2F0E A; 
#chains in the Genus database with same CATH topology
 1RD9 D;  4RG1 A;  1Z6H A;  3T51 B;  1E2Z A;  5M5X B;  4FVM A;  5I6Y A;  3V05 A;  2B2T A;  3J81 j;  1B70 B;  5FKA C;  4HJA A;  3F2U A;  4DV6 L;  4RGT A;  1EY5 A;  1NR2 A;  5IY0 A;  5M5W H;  4L5R C;  5L37 A;  4FF3 A;  1KL9 A;  1GOZ A;  3P75 A;  4B3M L;  1AEX A;  1H9S A;  1JC7 A;  2BDN A;  3HOZ G;  4DA2 A;  2OEO A;  3PGZ A;  4JC0 A;  1Y8O B;  4O42 A;  2J0T D;  4B9W A;  3S17 H;  4GKK Q;  1EY6 A;  1SJE D;  1LM0 A;  1XJV A;  3DM3 A;  3HOW G;  4A3F B;  1DGS A;  1E3P A;  4R1J A;  2VW9 A;  2QW7 A;  4UP9 A;  3WOF A;  2EJG C;  4BBS H;  5EAY A;  4DK3 C;  1R9T B;  4JI4 L;  3GTO B;  2NVQ B;  2K75 A;  4K8I A;  3QJY A;  1FL0 A;  4OO1 H;  3BDO A;  3GTG B;  4FDB A;  1YNN D;  1N33 L;  3PMF A;  4HCE A;  4OGQ C;  5C4J H;  2A69 C;  1STN A;  3SXH A;  1QZH A;  1HTL D;  3LWU A;  4JCV E;  2DNC A;  3NPP A;  3TSS A;  4ME5 A;  4DAP A;  3ER0 A;  3QO2 A;  2NN6 G;  1K8M A;  1VQH A;  2IPK D;  5I4D A;  3MVV A;  5ELD A;  2D2C C;  2A6H D;  3SEB A;  3VYT A;  4JI7 L;  1O80 A;  2JN4 A;  3E3X A;  3K5O A;  2K14 A;  3VDY A;  1YNX A;  2LY7 A;  3HOU B;  2MJ8 A;  2XSC A;  4A93 H;  1SSO A;  5E7N A;  5DM6 3;  4HED A;  1W6J A;  4BWG B;  5M3F H;  3OW2 A;  4DR6 Q;  1RKN A;  1M4V A;  5FLM G;  1E1T A;  3F2C A;  1VQC A;  3S1M H;  4LAA A;  4X66 L;  3PIP 3;  3QIA A;  4A3D G;  5HY6 A;  2N55 A;  2WFW A;  1I4Q A;  3RZD H;  2K5N A;  2N78 A;  3S1R B;  3D0F A;  2VUM H;  4OON A;  3K7U C;  1ESR A;  4LF4 Q;  4XT1 B;  3A55 A;  4RKL A;  4KHP L;  1IL8 A;  3I70 A;  4YWM A;  4CKB A;  4JYA L;  2K5D A;  1IBL Q;  3MFY A;  4A3J B;  2L55 A;  3H91 A;  5M5W B;  1STA A;  1SAP A;  2DN8 A;  2WAC A;  4M8A A;  2QIL A;  1KTK A;  1M1K C;  3AYH B;  3P7J A;  3BS1 A;  4C3I H;  4PZ7 A;  3JAM E;  4C3I G;  5CV8 A;  1OXV A;  1A8V A;  2M00 A;  3HOY G;  4AIM A;  2DNE A;  1LT4 D;  4DAY B;  5M9O A;  1TR5 A;  4QGU A;  2WAQ G;  2IHF A;  2E2J B;  4K6L A;  2ZJR A;  3GTK B;  5K36 G;  3J7A F;  4DV7 L;  2WII B;  3OTO L;  3VR4 A;  2R7Z G;  1CHQ D;  1LTT D;  3CCV A;  1TU2 B;  2Z6B A;  1EWI A;  1FYC A;  1D5M C;  3T1H Q;  3PUV A;  3EN2 A;  3OTO Q;  1QIL A;  4MN3 A;  5H1S E;  4Y52 H;  1V1P A;  4K8J A;  4JI4 Q;  1XNQ Q;  1EL0 A;  3BZK A;  4HSP A;  4L5Q A;  3AU7 A;  3TRE A;  2HHH L;  1ET9 A;  1E0B A;  1X65 A;  1Q12 A;  5IYC H;  2EVB A;  4DV2 Q;  5BR8 Q;  2L12 A;  4TVA B;  4DGZ A;  3I55 A;  1ENC A;  1RTN A;  3EFX D;  4OWW B;  4OO1 I;  2ES2 A;  4ZK9 B;  1D5X C;  1V9P A;  3IL8 A;  2JXM B;  1UE6 A;  4R8N A;  3H0G G;  1A3V A;  3TRZ A;  2DJG C;  4ZCK A;  4EVO A;  3H3V H;  1JCK B;  5IYB H;  1PLF A;  1TXY A;  4BY1 B;  4EQ5 A;  4DR5 L;  4Q0F A;  1HUN A;  2NN6 H;  4YY3 Q;  4HAE A;  2R93 B;  1F77 A;  5M3M B;  2IWH A;  4KD3 A;  4BBS B;  4UP7 A;  1YNJ C;  3S2H B;  4RH6 A;  3CCU A;  1EQV A;  2RHQ B;  4POF A;  3J81 E;  1PH9 A;  5GAE C;  3G4S A;  5T1I A;  1VQI A;  2NTS A;  1PH1 A;  2NVX H;  3S15 B;  1VDZ A;  4K5X A;  3PCO B;  4X64 Q;  1U4P A;  4H02 A;  2NVT H;  1HUM A;  1XTC D;  4A93 G;  2KOL A;  2I46 A;  2Z4H A;  4ZQ3 A;  4KKU A;  4DNI A;  3CC7 A;  2VB3 X;  4A75 A;  3CKI B;  3JC6 6;  1X3G A;  1DJR D;  1V1O A;  4OX9 L;  3G7L A;  5ELF A;  1FNU A;  3S2D B;  1QB5 D;  2B2U A;  3N6R A;  1VS0 A;  3TME A;  1PTO D;  2B2V A;  2NTT A;  2R92 G;  1HNW Q;  1GHK A;  1JIC A;  3QOJ A;  1XTD A;  3VR3 A;  1JWS D;  3HOW H;  1JWM D;  3PO2 B;  4OL7 A;  3A56 A;  3E0J A;  5I9P A;  1VQA A;  2UXB L;  3S1N H;  4IUU A;  3NBH A;  1QVF A;  3HKZ B;  1DD2 A;  5CC4 A;  4RGN A;  4CHT B;  1Q1E A;  5CGK A;  4J6H A;  2F3I A;  5C0X I;  1EOV A;  5T1G A;  4C3H B;  4YCW A;  3KLR A;  1WYD A;  1I4H A;  1Y14 B;  1FD7 D;  4A3I B;  3L0O A;  1JOO A;  3V2T A;  1STY A;  3EVQ A;  2NZO A;  1WTH A;  4CJ1 B;  1PTO B;  5E1F A;  1TVX A;  2A1A A;  3A7A B;  4X3K A;  3JAM c;  3H15 A;  2K5W A;  1K9M C;  3HOZ H;  1QE6 A;  5EBC A;  4HTH A;  4ZLT F;  4DAV A;  2UXB Q;  1CZG A;  2OXP A;  2Z4I A;  3FHW A;  1BBW A;  2E2D C;  1YBY A;  1PZI D;  4CBV A;  3HOZ B;  3EJI A;  1MGS A;  4KD4 A;  4R4I A;  2RCN A;  3CPF A;  1G51 A;  1SLJ A;  1U4R A;  3GTK H;  1JOQ A;  4R4T A;  4DPG A;  3MXG A;  3GTP H;  1ZYR C;  1VMC A;  2B39 A;  1NTG A;  1A6X A;  5J3B A;  1HJP A;  1PYB A;  4POG A;  1HZA A;  2PMZ E;  1LT5 D;  4ZKB B;  2ZM6 L;  2VQF Q;  2EXZ A;  1K3R A;  2PQE A;  4Q5V A;  3G6J B;  4X3U A;  4C3J H;  4GN5 A;  3J81 L;  1N8R C;  1XNR Q;  3HFZ B;  1HRJ A;  4U67 3;  1E2V A;  1H95 A;  4IPG A;  3RZD B;  1XPU A;  3PUW A;  1PRT F;  4DUZ Q;  4A4I A;  1VQJ A;  4DNT B;  5EKI A;  1YNN C;  1CUK A;  2L1B A;  2JE6 I;  3T1Y Q;  1HNX L;  1U0L A;  3ULJ A;  3DWP A;  5JAV A;  1EOT A;  3U9S A;  4BY7 G;  3MXN B;  3H3V I;  2K4K A;  4HJ5 A;  1F2L A;  3MXN A;  2JA8 H;  3GTL H;  4L8J A;  5ELE A;  1EZ8 A;  3HOU G;  3U50 C;  2K28 A;  1IW7 D;  1SYF A;  2UUA L;  1T5X D;  3GDE A;  3M85 A;  4R8I A;  3A74 A;  5CMD A;  5D65 A;  1T9H A;  3QWN A;  5I2Y A;  1MD2 D;  4FF1 A;  1SNP A;  2N8N A;  2I5H A;  3AFQ A;  4IJL A;  2HDM A;  4BS9 A;  1Q90 A;  3BZC A;  4DF7 A;  1I6H B;  1YNJ D;  3I91 A;  1FNW A;  3ZYY X;  5C3X A;  3UI2 A;  4DKA C;  4LF6 Q;  2XTI A;  3ND9 A;  1ILP A;  1EIG A;  3PF4 A;  2M9V A;  3A7L A;  1H9M A;  3OWE B;  2EZV A;  1GUN A;  1F2Y A;  2O5I C;  3K7A B;  1MSH A;  3D3R A;  1F9P A;  2KCC A;  4CGY B;  3A5U A;  1K83 H;  4A3B B;  3OYY A;  2EXD A;  4QB4 A;  2PPB C;  1K8O A;  3QR8 A;  4DAM A;  4XQJ A;  1HQM C;  3HOY B;  3MFG A;  2F1M A;  4H7B A;  1HR0 L;  4FP5 D;  3EBE A;  4JV5 L;  2I0Q A;  4LF6 L;  3CQZ B;  1YIT A;  2OQK A;  1XNR L;  2JEB I;  2KA7 A;  4IAL A;  1UEB A;  2R61 A;  2EYJ A;  3RR5 A;  4GKJ L;  5CV4 A;  5IGD A;  1A2U A;  1R9T H;  1K3B C;  1I6V C;  3BJU A;  1KIX A;  2R7D A;  1WTV A;  3FPU B;  4ODG A;  4XT3 B;  1RIP A;  2KQ3 A;  3S16 H;  3ERO A;  1N36 Q;  1R4P B;  3UDI A;  1EFW A;  1ZKO A;  4DR6 L;  4HMI A;  3P1H A;  4KJN A;  1EU4 A;  4RFB A;  4WOR A;  4JI6 Q;  1EYC A;  3I4L A;  4QUC A;  2ZXP A;  3CW2 C;  4HSV A;  5LMU L;  4J1M A;  4LF5 Q;  4CKE A;  3HEJ A;  3F2D A;  4A3G H;  1N32 Q;  2KCN A;  4A3C H;  4A3K H;  5LMU Q;  1TWA B;  1XXG A;  3K59 A;  2BE5 D;  1ESF A;  2FIN B;  1W6K A;  3IFT A;  4RGO S;  1AW7 A;  3NBH B;  5KGU A;  4DV4 L;  4B3T L;  1CKO A;  4QMG A;  2BH8 A;  1DOL A;  4FO2 A;  4BY1 G;  1PXU A;  4TRD A;  4R4Q A;  2FFK B;  4E6I A;  1G6Z A;  1QOH A;  4BA1 I;  1VQM A;  1VQ8 A;  3M3Y B;  3GD7 A;  1U5K A;  5M3F B;  1JJC B;  1WTX A;  2EJM A;  3MAQ A;  5CV5 A;  2AUK A;  1I50 H;  4JG2 A;  5FLX c;  1PFM A;  3I4M G;  3HOU H;  3CF5 A;  1I4R A;  4F88 A;  2PO4 A;  1SBB B;  1I6H H;  3ULL A;  2KEN A;  1K28 A;  4LFA L;  5C4X B;  1QNK A;  1H9K A;  2K04 A;  1MHW C;  3FKI B;  2H5X A;  3RD4 A;  1K8A C;  5IYD G;  1D1K A;  2L0C A;  1PA6 A;  4GNX B;  2WV6 D;  1F9S A;  1ET6 A;  4QJF A;  1O7Z A;  3IAY A;  2O2L D;  1RTO A;  1SMY C;  2A74 C;  4UDU C;  1R4Q B;  3TZD A;  2BCO A;  1XMQ Q;  1Y1W G;  3S24 A;  4JK1 C;  1A0I A;  4PMC A;  1GUO A;  3O13 A;  4CJ2 C;  1J8I A;  1LTR D;  1D8L A;  1ENA A;  1PH5 A;  4CDE C;  2UU9 Q;  5AJ3 Q;  4LF4 L;  4GLX A;  2JA7 G;  5C3E B;  4FXD A;  2BH2 A;  1WD0 A;  1J5E L;  1VMP A;  4RKB A;  1SNO A;  2K01 A;  4LUV A;  4ZUJ A;  5BR8 L;  1HZ9 A;  3AQQ A;  3IFD A;  2PW7 A;  1WTQ A;  1CKN B;  4S3S A;  2OQ0 A;  1HPC A;  4X66 Q;  5EPL A;  3DMU A;  2PW5 A;  2IY5 B;  1ICW A;  1UE7 A;  4JI2 Q;  1RL2 A;  1QZG A;  1EFI D;  1SE3 A;  1V1Q A;  2ICI A;  4G57 A;  4I65 A;  5IYD H;  1QJO A;  1SR3 A;  1VQ4 A;  4LNQ A;  4DNR B;  2G5D A;  5A2Q L;  2E2H H;  2N49 A;  4XDX A;  4G7O C;  2WIN B;  5C0X H;  4WJW A;  2B2Y C;  2F0P A;  4H44 C;  1SMY D;  5BN5 A;  5IE8 A;  1TWC B;  5FJ8 H;  2RSN A;  2F0K A;  5JVH 3;  4RHR A;  4X62 Q;  2L4N A;  2F0U A;  1A3U A;  3OIQ A;  1KDC A;  4NPS A;  4QUF A;  1PH3 A;  1B9N A;  3T1Y L;  1NNX A;  1KLU D;  5CV6 A;  4BY1 H;  3K5M A;  4OX9 Q;  1LTG D;  1SNQ A;  3AFP A;  3L7Z C;  1E1O A;  1GUT A;  3SGI A;  4R9W A;  4DR1 L;  3CQZ H;  3OSO A;  1EQR A;  3RMH A;  4KHP Q;  1OXX K;  1XMO Q;  4A3G G;  1PFB A;  1X3P A;  2EY1 A;  2JA6 B;  3MXP A;  5I2X A;  4DV1 L;  4AYB B;  1SDF A;  3S1Q B;  3RZO B;  1ASZ A;  4QQB X;  1NSN S;  2A69 D;  1Q86 C;  2MUY A;  2JK8 A;  3OIP A;  2R92 H;  3AMU A;  2F4V L;  4EX5 A;  5HUR A;  3I7F A;  4F8M A;  1XPR A;  1SYE A;  4P74 A;  1RCV D;  2PQA A;  1JB3 A;  4HR7 B;  4FXK C;  3BDL A;  1KC8 C;  3KLS A;  4QIW E;  2OWO A;  2EYO A;  3L3O C;  3D4W A;  4OHJ A;  4C1N K;  4DV2 L;  3HOW B;  3KLW A;  2KJX A;  2Z8L A;  1SE2 A;  1X3F A;  2CH4 A;  2WKC A;  2V4D A;  2Y0S E;  2PNH A;  3PO2 H;  3T4A C;  3U4Z A;  1NCV A;  3CC2 A;  3IKJ A;  4OXP A;  3TBI B;  2HT1 A;  1NAP A;  3HZX A;  3SK5 A;  4AYB E;  1S40 A;  1EIH A;  2NZ1 D;  3E5S A;  1C0A A;  3R3O A;  3K8A A;  4KY5 A;  4DR4 L;  4FF4 A;  2EDG A;  2I5M X;  1L1O B;  3BG3 A;  1EWC A;  1XPO A;  2EY6 A;  1UEA B;  1PH6 A;  1J9O A;  4DXF A;  3UDG A;  5BN4 A;  3E0E A;  1LYL A;  5IYC G;  4KJO A;  1X3Q A;  2Q8I B;  4AQY L;  4L6T B;  5EBD A;  3B6Y A;  1SNC A;  1YIJ A;  4JI3 L;  2JP1 A;  4NW2 A;  2NVY B;  2HIV A;  4AQY Q;  2RBM A;  2A5H A;  2SNM A;  4JI1 L;  3WWV A;  5J39 A;  4C56 C;  3MTS A;  1LT6 D;  1CFM A;  5E4W C;  1XWE A;  2PMZ B;  5EJW A;  3KF6 A;  2ZTE A;  1RF2 D;  3DWA A;  2UXC Q;  1LTS D;  3BYY B;  1BOS A;  1TT2 A;  4X3T A;  4MTN A;  5GAH C;  4O0A A;  4B08 A;  4A3D B;  5LL6 X;  2B63 H;  3ERS X;  2F4I A;  3E6Z X;  3UE1 A;  4MNO A;  2IX3 A;  2XGT A;  4GNX A;  1UE5 A;  3S1Q H;  1QUQ A;  1GKH A;  2B63 B;  3EA6 A;  2A6H C;  4YHH Q;  3DEO A;  4DV5 Q;  4I7Z C;  4V0B A;  1BO0 A;  2LSS A;  4C3J G;  2ZTC A;  1BCP D;  4IOC A;  2L15 A;  3I2Z A;  2IX0 A;  3GP7 A;  4FF2 A;  3HKS A;  5IT9 E;  3M7G A;  2UXD Q;  5DAU A;  4XTC S;  1TWH B;  2Q2H A;  3TEH B;  4C2M B;  1T5E A;  4J8Q A;  5M5Y H;  1I4P A;  3I4O A;  2EE1 A;  1KAB A;  3CXC A;  2F0N A;  2HUG A;  4C1N I;  1LLR D;  4IUT A;  2ZXO A;  3DWQ A;  4X65 Q;  4A3K B;  4G7Z C;  1I94 Q;  5M3F G;  2F0V A;  2R7Z B;  4JBJ A;  1TY0 A;  4G7H C;  4C3H H;  5JJK A;  2O4X A;  2JA5 B;  4DR4 Q;  4HIO A;  3S14 B;  3CU7 A;  1IHZ A;  2SNS A;  3SK8 A;  2YTV A;  5KND A;  2RA4 A;  1DZ1 A;  1RHP A;  4P72 A;  1Y8N B;  2RCF A;  3OWF A;  1PH8 A;  1HR0 Q;  3FKI G;  4LF7 Q;  1JJG A;  4OEM B;  1DM0 B;  2B2W C;  4ILW A;  5IP9 H;  1II3 A;  1TS5 A;  2VUM B;  4RCO A;  2NVY H;  4JI8 Q;  3R93 A;  4APV A;  2UXD L;  2OF1 A;  4LFC Q;  2VZA A;  1D1I A;  2C9O A;  4XYQ A;  3CCQ A;  3F8T A;  4A3J H;  1HH2 P;  3S1M B;  2FJ2 A;  2MHV A;  5FLX L;  1CM9 A;  4EQO A;  1IL2 A;  3CME A;  2K52 A;  3WOE A;  2JA7 B;  2CWA A;  5JJI A;  2M2L A;  2OTJ A;  2I07 B;  3KUP A;  1ROD A;  2BE5 C;  2EQS A;  3DHQ A;  3KDF A;  2F0W A;  2KHI A;  4DV0 L;  1VQE A;  3HRZ C;  4BBS G;  4CKC A;  5CBE E;  5G3L F;  1G29 1;  2L9H A;  3BU2 A;  3H6M A;  3M4Q A;  1JQY D;  2K6A A;  3TQY A;  2B2Y A;  5IP9 G;  1MJE A;  2WB1 E;  3GTP B;  4GKJ Q;  3OW7 A;  4JI0 L;  4Y7N B;  1VQF A;  4K0K L;  3RZO H;  2EYH A;  4KN4 C;  5JPM C;  2Q2T A;  1UUP A;  3MEF A;  3J7A 5;  2PI2 A;  5CR3 A;  4KKT A;  3QB3 A;  5J1Z A;  4QF4 A;  4DR3 L;  3CD6 A;  4UPA A;  5DNF A;  1B7Y B;  2TMP A;  2KHS A;  2NVQ H;  3MC0 B;  2E2J H;  3K0Y A;  4LFC L;  1K0S A;  3PO2 G;  1X32 A;  3RUZ A;  5ELB A;  3CMA A;  4HJ9 A;  1I5F A;  2MQH A;  2JEA I;  1A3T A;  4GZY C;  4OEL B;  1KLG D;  1QVC A;  2F3W A;  4JYA Q;  3LWE A;  4K5V A;  2F0D A;  1DOK A;  1U4M A;  4KHV A;  3NK9 A;  3HKZ G;  4A3M B;  4JI5 Q;  4L5T A;  4IPC A;  1EEI D;  1TWF H;  3C2P A;  1TWA H;  3D4D A;  1W2B A;  1CKN A;  4O1N A;  4HJ8 A;  1G2T A;  1OO9 B;  2DUD A;  1B8A A;  2F0L A;  4BBR H;  1E7Z A;  3J7A V;  4A3G B;  2JA6 H;  4LJZ C;  5KIX A;  3NEN A;  3A54 A;  2XRS D;  5C4H A;  1DON A;  2SEB D;  2D0P A;  3HOX B;  1Q8I A;  2YYZ A;  1Q82 C;  3M4O B;  3M7N A;  1C8C A;  4K14 A;  1BUV T;  4DUY L;  5JEA J;  1PYW D;  5LHY 1;  2UXC L;  3OOC A;  3W1G A;  1GUW A;  2J7Z A;  2HD3 A;  4YY3 L;  2A6E D;  3MEH A;  3D6W A;  3STB D;  3GO5 A;  2R6G A;  2CFM A;  2F0F A;  3Q6S A;  3HKZ E;  3HP3 A;  3R2T A;  3J81 c;  2TSS A;  1SXT A;  3RN2 A;  4RAU C;  3S1R H;  2CVR A;  5K36 H;  4DV5 L;  3C1E A;  3I4N H;  3S15 H;  3D6C A;  3LGJ A;  1JOK A;  4DV6 Q;  2WP8 J;  4PMW A;  1G8Z D;  2HCC A;  3C46 A;  1QNU A;  1PDQ A;  3ND8 A;  2A68 C;  2RQX A;  4HJ7 A;  4IFD G;  2K5H A;  3FRP B;  4C2M H;  4DUY Q;  2PZW A;  5ELC A;  3MWY W;  4CJ0 B;  1EWH A;  1FVI A;  5GAG C;  2QDB A;  1VQ6 A;  3UDX A;  1D6E C;  2G9D A;  3GTJ B;  4QL5 A;  4XQN A;  3N52 A;  1B44 D;  1PZK D;  1FJG L;  4DV7 Q;  2QF7 A;  5LMN W;  5C0X G;  2VQF L;  1IYV A;  3E9H A;  1FR3 A;  2RDH A;  1PH7 A;  4NXN L;  1OTC A;  2L11 A;  1XMO L;  1HFN A;  1F9Q A;  4K2K A;  4XYO A;  1X9N A;  1JT8 A;  2KEE A;  1YHB A;  3CP0 A;  2PQA B;  5HGQ A;  4AH6 A;  3PO3 H;  1X55 A;  1N34 Q;  4NMZ A;  4HCS A;  5IGG A;  3FPP A;  5LMN L;  1JMC A;  1N9W A;  4IPH A;  5FK9 C;  3P20 A;  1BKB A;  5FLM H;  1E24 A;  1X3E A;  3AEV A;  4LF5 L;  4IOA A;  1V1P B;  1IBL L;  1KRS A;  3Q22 A;  1Q3L A;  4GLA C;  3ERQ A;  1KAW A;  1VQP A;  1PRT D;  2NBF A;  1UWV A;  3KLS X;  2UUB L;  2QDL A;  4L63 B;  2L5T A;  2MPM A;  1C4Q A;  2Z0S A;  1CQV A;  4L5S A;  4DR2 L;  1H9S B;  3X3M A;  3NWS A;  1GD7 A;  2DY7 A;  3FMC A;  2VY3 A;  1S5F D;  4M1U B;  4FXG C;  1TS2 A;  1TKW B;  4JPB W;  1VF7 A;  5M5X H;  5E4X A;  4LF8 Q;  4I7A A;  1C48 A;  2DJF C;  1CSP A;  3W1B A;  1L1O A;  3M4O H;  3FEW X;  3C1F A;  4A3F H;  3SK6 A;  1IZ6 A;  2IL8 A;  1PTO C;  5GRO A;  3AB9 A;  1FNV A;  2B2T C;  4C3J B;  1KDA A;  1V8Q A;  5LMN Q;  3TZU A;  1PZJ D;  2FHT A;  2CQO A;  1EY8 A;  4A3L H;  2NZH A;  3ULP A;  3PUX A;  1STG A;  1U9R A;  2EY5 A;  2BA0 A;  4JBW A;  1DOM A;  1S4Z A;  1MKH A;  5ELO A;  2F4V Q;  1HNW L;  2NB0 A;  1RDP D;  1N34 L;  1TWG H;  2ZT9 C;  4PV1 C;  2CHB D;  3KJO A;  4QY7 A;  2LFN A;  2EJF C;  1C7Y A;  1BVS A;  1SE4 A;  5FJ8 G;  3GTQ H;  1X6O A;  2F3V A;  2B3G A;  4TQU S;  4A3K G;  1ASY A;  1FJG Q;  2FXQ A;  3PIP A;  5IGB A;  2IJ0 A;  2O5J C;  2K50 A;  4JOI C;  3HOV G;  5C6A A;  3URY A;  3HOV H;  1YHQ A;  1PMR A;  2YTX A;  4MTK A;  1WVL A;  1SRO A;  1WI5 A;  5DLQ E;  1U4L A;  3NSW A;  3DUZ A;  1GVP A;  1G91 A;  5M5Y B;  3J7Z C;  4K6D A;  1VQB A;  1WD1 A;  3PF5 A;  1QWY A;  2ZTD A;  3EIV A;  4GKK L;  3FDT A;  1PHJ A;  4ZAI A;  1Y69 U;  2XVS A;  1B3Q A;  2EYL A;  1Z9F A;  5G3L D;  1NJI C;  3RLN A;  1SND A;  4ZRZ A;  3K58 A;  3KBX A;  2CKZ B;  2SDF A;  4N9P A;  2GN5 A;  3PSI A;  1KRT A;  1X56 A;  4A3E G;  2JA7 H;  3CCL A;  1CI3 M;  1Q81 C;  2RKS A;  2QEX A;  1B1Z A;  2D9U A;  2OTL A;  1S3O A;  2KUM A;  4PNY A;  3A8J E;  5FO9 B;  2F0T A;  2EYP A;  5IIF A;  3G6E A;  2VQE L;  3VR6 A;  2J4X A;  1VF5 C;  4CDD C;  4PZ8 A;  2E2I B;  3I8Z A;  1EQT A;  3VYS A;  1L0Y B;  3X3N A;  2PZU A;  5EPK A;  5IYB G;  3K0X A;  4MZ9 A;  3I4M B;  5IT9 c;  2XWB B;  2D62 A;  5JJL A;  1LT3 D;  3MZ5 A;  3I4M H;  4DV1 Q;  2F0I A;  4DK6 C;  3JAM L;  3E9I A;  4X65 L;  5C44 H;  3TS2 A;  1KAA A;  2KEC A;  1QG7 A;  4UP8 A;  1VQ5 A;  4JV5 Q;  1NBW A;  1M90 C;  1CT1 D;  4PQX A;  1Y1W B;  5KEE A;  1GXD C;  2VB2 X;  1V43 A;  1HZC A;  2WAQ E;  2WB1 G;  1LTB D;  1YJN A;  3A0J A;  3PO3 G;  2MNA A;  1I3Q H;  1PRT B;  4X62 L;  3S2H H;  3S16 B;  3S2D H;  3NTH A;  4DR7 L;  1B3A A;  4IQZ A;  2R7F A;  2K33 A;  3I4N G;  2R93 H;  1BXT A;  3L2P A;  1L2F A;  5C3E G;  2JSO A;  4HIK A;  2F0O A;  1TS4 A;  1DXM A;  1P16 A;  4KY7 A;  3GTM H;  3A5Z B;  4LFB L;  2N3S A;  4BBR B;  1LO5 D;  3I90 A;  2EOT A;  2JA8 G;  2NWG A;  2ID0 A;  2F0Q A;  1JJ2 A;  4A3M H;  2AKW B;  3PV0 A;  3I72 A;  1PTO H;  1FGB D;  2DY8 A;  5COY A;  3CCE A;  1SJH D;  2QGQ A;  5M3M H;  3CRK C;  4IFD H;  4F87 A;  3BYT B;  4KMU C;  3CCJ A;  1STE A;  1EUJ A;  4YWK A;  5JEA H;  2RDG A;  4DV4 Q;  4B3T Q;  4DV0 Q;  4DV3 Q;  1Q8K A;  5C4X H;  1Q7Y C;  1BBU A;  4GLV B;  4LUZ A;  1SYG A;  2E75 C;  1BNZ A;  3A8I E;  3NEM A;  4FYD A;  2RDF A;  3ITP A;  2UUA Q;  4B3M Q;  1J6Q A;  1NY4 A;  1PVO A;  1OXT A;  1LAC A;  4GOP A;  3NE5 B;  5I9O A;  2K03 A;  1B4O A;  4JI6 L;  3TP6 A;  1HHV A;  2Q8R E;  4JI3 Q;  3GTQ B;  2LXJ A;  5GQO A;  3CCR A;  1STB A;  2OCE A;  5JOB A;  1F9R A;  2B2W A;  2K5V A;  1DYQ A;  5JPN C;  3H3V C;  2JQO A;  1L0X B;  2Q2I A;  4XQQ A;  3J81 i;  2R3Z A;  1XNQ L;  4IFD I;  1AZQ A;  3D8G A;  2AQ3 B;  4EQN A;  3CPW A;  2JA6 G;  4OWX B;  1PV4 A;  2EYM A;  2A19 A;  4QIW B;  1SYD A;  4RMF A;  1D5Z C;  1NMF A;  1HA5 A;  2AUJ D;  2F0E A;  4KN7 C;  4JI0 Q;  5EKL A;  5C5L A;  4UHV A;  1HXY D;  1ZXT A;  3VYR A;  1IBM L;  4XXE A;  1YVC A;  4N8F A;  5D14 A;  3R2I A;  1IW7 C;  1LTL A;  1P8L A;  1IKM A;  1BQQ T;  1E2W A;  5C44 B;  4LF9 L;  1EQQ A;  4O2D A;  3TP7 A;  3UE0 A;  2XIW A;  2F0J A;  2PNR C;  4N8X 1;  1GO3 E;  1O7Y A;  3QOL A;  1SRU A;  3HGB A;  2LS0 1;  2KCT A;  4JVZ A;  3MHB A;  2F52 A;  4BY7 H;  2KVM A;  2NYZ D;  2KED A;  1VQ7 A;  2E2I H;  5I6W A;  1I4G A;  1UAP A;  2K1B A;  1GUS A;  5IWA Q;  3U58 A;  1TII D;  3M4Y A;  4IN3 A;  1AE2 A;  4N9T A;  3SDZ A;  4JBM A;  1MBY A;  4R4C A;  3WDN A;  3KBG A;  1VQK A;  1SYC A;  2MFI A;  4B3R L;  3H94 A;  2PZT A;  1ONL A;  3F1Z A;  2UUC Q;  3CC4 A;  3NBI A;  3BDC A;  1KNE A;  5JVG 3;  2IX1 A;  5D3D A;  3JAM i;  1NMG A;  1HZB A;  3ONA B;  2K7V A;  4IZ8 A;  4DR7 Q;  2CH4 W;  2Q2U A;  3GV3 A;  2XNA C;  4TKO B;  2Z9H A;  4ZUI A;  5IGF A;  4A3J G;  4MHE A;  5AFW A;  1SEB D;  1Y1V G;  4IUP A;  4RCN A;  2Z6K C;  2VNU D;  4IUV A;  2P5Z X;  4NP5 A;  3S17 B;  1YI2 A;  2NN6 I;  4KLK A;  3FKI H;  3Q8D A;  1M8A A;  1O7I A;  2HQE A;  3J80 L;  1EEF D;  4HIM A;  4EGV A;  2DGY A;  4HMJ A;  4B3R Q;  1JR0 D;  2AWN A;  1WTP A;  2RHS B;  1LUZ A;  3GTM B;  3HOV B;  1CA5 A;  4BXX G;  2E5L L;  5IWA L;  2H1E A;  2QCP X;  2UUC L;  2OT2 A;  1BR9 A;  1BDO A;  4KKS A;  4LF8 L;  4KTA A;  1XX8 A;  1I4X A;  3T53 B;  5EQ0 A;  2QKI C;  4R4O A;  4X3S A;  2B63 G;  3F2B A;  1Y1V H;  1STH A;  3SVM A;  1HTP A;  3DXJ C;  1BF4 A;  3G71 A;  1A2T A;  4PMB A;  5F2D A;  4IJH A;  4KV6 A;  1QCB D;  2PYK A;  1KHI A;  2HDL A;  1IXR A;  1OXU A;  2A73 B;  4ULL A;  1MSG A;  4K5W A;  1G2S A;  4JI7 Q;  2R7Z H;  1RJT A;  3PUZ A;  2CWP A;  1SFO B;  3H09 A;  1YJ9 A;  2E74 C;  1VQL A;  2NUC A;  1S5E D;  3KOJ A;  1B2T A;  1H9R A;  3DM1 A;  3HOY H;  5M3M G;  1WFQ A;  1KNA A;  3J80 c;  1AH9 A;  1HR0 W;  1HCZ A;  3I3C A;  5KNB A;  1VQD A;  3SK4 A;  3STB C;  5FO8 B;  2PCF B;  4DUZ L;  2JA5 G;  1MIU A;  1GJX A;  1WJJ A;  1NE3 A;  2MGS A;  1F2M A;  1TWF B;  2AHO B;  1CQF A;  3FP9 A;  1EU3 A;  4LK1 C;  1B50 A;  2HCI A;  4PZ6 A;  4U68 A;  1SN8 A;  1K0R A;  1O78 A;  5C3E H;  1FGU A;  1AZP A;  1E22 A;  1LAB A;  2VUM G;  1YJW A;  2ZM6 Q;  2LXK A;  4A3I H;  3UDF A;  2F0G A;  1IYJ B;  1HQR D;  3I73 A;  2AQ1 B;  3KJP A;  4A3D H;  3M3Y H;  2D5D A;  5EPJ A;  1HNZ Q;  1KXL A;  5KYL A;  2EPB A;  5C4J B;  2ICE C;  4BA2 I;  4LMQ D;  3I4N B;  2CQA A;  4ALP A;  3H0G H;  4IUR A;  3RN5 A;  4DU9 A;  2AQ2 B;  2LKV A;  2JJQ A;  1AFP A;  1WOC A;  5E3F A;  5FO7 B;  3CAM A;  3GTG H;  1WCM B;  3GTL B;  2JA8 B;  4YCU A;  5IOC A;  1EY9 A;  4NDX A;  2V1C C;  4RGM A;  2B8G A;  4IFD J;  2G9H D;  3GTO H;  2MO0 A;  4OIK A;  1D7Q A;  2X6L A;  1TWG B;  3GQB A;  5K5P A;  2EY2 A;  3R8B A;  1NR4 A;  4MIU A;  1LV9 A;  5EKK A;  4GNX C;  3OMG A;  2Y0S B;  4A3I G;  3NP8 A;  4LWC A;  4X6A H;  2ENB A;  3PQI A;  2F0M A;  2X6G A;  4DN4 M;  4DR2 Q;  1EY4 A;  1EY7 A;  1HA6 A;  3D4R A;  1DCZ A;  3G48 A;  2IW3 A;  2A68 D;  2H4O A;  3KF8 A;  1VQN A;  2UU9 L;  4A3E H;  1JWU D;  3KF8 B;  1SMX A;  5HGT A;  2GA4 B;  1AN8 A;  3BVM A;  1ZYR D;  1HNZ L;  3TP5 A;  1EYG A;  2K05 A;  5JEA G;  4WFN 3;  5AJ3 L;  2JA5 H;  3NWT A;  3T13 A;  3NQI A;  4ABN A;  4IUQ A;  1PRT C;  5CV9 A;  3D31 A;  3GV6 A;  5IOD A;  1HNX Q;  2A6E C;  1CK1 A;  4NKL A;  3K7A H;  1YEZ A;  1GUG A;  2RSO A;  1GM5 A;  2KCM A;  4LFA Q;  5CV7 A;  4A3M G;  2HIX A;  2SOB A;  4YWL A;  1F2Z A;  1NUC A;  3QG1 A;  3VA5 A;  4X64 L;  2D0O A;  1K73 C;  2E8G A;  3FVQ A;  1CHP D;  1XYI A;  4B9X A;  1BCP F;  2K5Q A;  3HOX G;  3BVZ A;  2YV5 A;  4GN4 B;  4ID6 A;  4CDC C;  2XWJ B;  2JYO A;  1K83 B;  4A3B H;  4NB3 A;  2F03 A;  1KDB A;  1VQO A;  1VQG A;  4DR5 Q;  2BOS A;  3L9A X;  2AMC B;  2B29 A;  2GVA A;  1Z7T A;  5C0X J;  4P73 A;  2UUB Q;  5C44 G;  5NUC A;  2ALY B;  4P71 A;  3T56 B;  5JJZ A;  2YU9 B;  2K32 A;  4BXX H;  4BY7 B;  4JOI A;  1CSQ A;  1JOR A;  1ICF B;  4GOP C;  4NXM L;  1IBK Q;  4UY8 C;  3SHL A;  1K8G A;  3VYU A;  3NTI A;  4A3F G;  4P2C B;  1N36 L;  3NUC A;  3M9B A;  5IP7 G;  3PIO 3;  4DV3 L;  3K5L A;  1IKL A;  1IYU A;  2HHH Q;  1H9J A;  2RF4 A;  3Q24 A;  4DXG A;  1CKM A;  5CYU A;  1Y1W H;  2LMC B;  1BCP C;  1EZ6 A;  2ZJP A;  1KD1 C;  4LF7 L;  1I3Q B;  3LNN A;  5IGC A;  3TP8 A;  2Q8T A;  2X69 A;  3OPO A;  3A8K E;  4QCL A;  5IP7 H;  1ENF A;  5C3W A;  1TY2 A;  1YHA A;  1ILQ A;  1ZEQ X;  3J80 E;  1SYB A;  2NVX B;  4Z9C B;  2IHE A;  1J5E Q;  4OO1 G;  5ELN A;  3PIO A;  4JI5 L;  1PH4 A;  5FOB B;  2EYF A;  3HS0 C;  2XRQ D;  3W3A A;  4TSS A;  4LW1 A;  1A62 A;  1WTW A;  1EYD A;  5LL6 S;  3OHX C;  1AP0 A;  1Y1V B;  4CDF C;  1SNM A;  5FLX E;  3KYH C;  3K81 C;  2CW0 C;  3KFU A;  4A3B G;  3U9O A;  4HID A;  1UE1 A;  3K57 A;  1WCM H;  4H13 C;  3HOX H;  1Y8P B;  4DR3 Q;  3I56 A;  2XN9 C;  5J22 A;  2YTY A;  1BCP B;  1JE5 A;  3RLO A;  3S14 H;  1WTR A;  2NVT B;  4NXN Q;  4YCV A;  2CW0 D;  1JB7 A;  4DK0 A;  1N33 Q;  2F0H A;  2F0S A;  4V19 0;  2FMC A;  1S5B D;  2QEJ C;  1A15 A;  2WKD A;  3C3L A;  3K5N A;  2QA4 A;  1B9M A;  3RLF A;  3TDQ A;  2VL6 A;  2ATW A;  3TN2 A;  1PTO F;  2IT1 A;  3ZJY C;  2N88 A;  3V96 A;  5KNC A;  1LTA D;  2I5L X;  4A3L G;  1TQO A;  3KK7 A;  3K80 C;  3CCM A;  4DFA A;  4YIJ A;  5COR A;  4A3C G;  2RVL A;  4ME3 A;  3KDF B;  3NXW A;  1WTO A;  2E76 C;  3OMC A;  1IBK L;  2YU9 H;  4GS3 A;  1PH2 A;  4ZKC B;  4LF9 Q;  3S1N B;  4H0L C;  3PUY A;  2ASB A;  5C4Z A;  1CZW A;  1PFS A;  5KYI A;  4WJ3 M;  2EIF A;  4XIG S;  2B8F A;  4Y7N H;  4C3I B;  1XMQ L;  4WRD A;  1Q1B A;  4LUO A;  4KY6 A;  5TSS A;  2WAQ B;  3NEL A;  4KHZ A;  3VA7 A;  3HG9 A;  3J80 i;  2HQL A;  4EQP A;  1S5D D;  4GN3 B;  4F7X A;  1HFG A;  2E2H B;  4DK1 A;  1VQ9 A;  4IUN A;  3DLL A;  4UAI A;  1TWC H;  3T1H L;  1SE8 A;  1LTI D;  2CCZ A;  3T16 A;  3ICE A;  1EIF A;  4JW0 A;  5ISR A;  5GAD C;  3RNU A;  3NHH A;  3NQT A;  1S72 A;  4IO9 A;  4B3S L;  3Q23 A;  5C4X G;  3CRL C;  2AWO A;  2VXW A;  4IPD A;  1I94 L;  1BBX C;  3LX0 A;  4J15 A;  5IGE A;  1CA6 A;  1Z47 A;  1PYS B;  1C9O A;  4WJ4 A;  2B2U C;  2JA9 A;  1N32 L;  4NXM Q;  3BZD B;  3S9W A;  4A3E B;  1W3S A;  3H0G B;  4HN7 A;  3MA2 B;  5D3I B;  5CBA E;  5DEH A;  4OIJ A;  3CCS A;  1QUQ B;  5EGT A;  3M4P A;  1D2B A;  1OXS C;  3K6O A;  1MJC A;  1S5C D;  4KK7 A;  2BA1 A;  4DAY A;  3EQL C;  2R93 G;  2KBN A;  4RHS A;  1WCM G;  2PI2 E;  3MXU A;  4JI2 L;  1G6P A;  2Z1C A;  3SR1 A;  2B2V C;  4P75 A;  2BDO A;  2Z6K A;  2FMM A;  5KRU A;  5A2Q E;  4RA8 A;  3W5O A;  2E5L Q;  2Y0S G;  4B3S Q;  2GVB A;  1TWH H;  5DM7 3;  2ZJQ A;  1AE3 A;  1JE4 A;  5C5M A;  1KQS A;  2KHJ A;  4JBK A;  4A93 B;  3Q0A A;  1Q46 A;  2VS1 A;  4ZYS A;  1GHJ A;  3BVG A;  4DR1 Q;  1MI2 A;  4FNF A;  3KF6 B;  4K2L A;  1ML0 D;  4LFB Q;  4GOP B;  3NTK A;  4PG3 A;  4RWS C;  4JI1 Q;  4A76 A;  1I50 B;  4KI0 A;  3DEP A;  1VCI A;  3GTJ H;  2WB1 B;  2R92 B;  3PO3 B;  1X54 A;  5IT9 L;  2MP1 A;  3J7Y W;  2A8V A;  3U4V A;  1QVG A;  4JI8 L;  1TS3 A;  3CHB D;  1EY0 A;  5BN3 A;  1O7L A;  1IBM Q;  1YZ6 A;  1PFN A;  3TS0 A;  1L0W A;  4BBR G;  4OWT B;  1CTM A;  1EIY B;  2C35 B;  2MO1 A;  4G4K A;  2ZXR A;  3W2D A;  1SFO H;  4K0K Q;  1UNS A;  3IRB A;  4C3H G;  4YHH L;  1EYA A;  5A35 A;  1L1O C;  4AYB G;  2C5C A;  1B53 A;  3VR2 A;  3SE0 A;  1A63 A;  3VR5 A;  2VQE Q; 
#chains in the Genus database with same CATH homology
 1RD9 D;  1Z6H A;  3T51 B;  1E2Z A;  5M5X B;  4FVM A;  5I6Y A;  3V05 A;  2B2T A;  5FKA C;  3F2U A;  4RGT A;  1EY5 A;  1NR2 A;  4FF3 A;  1GOZ A;  3P75 A;  1AEX A;  1H9S A;  1JC7 A;  2BDN A;  4DA2 A;  2OEO A;  4O42 A;  1Y8O B;  2J0T D;  4B9W A;  1EY6 A;  1SJE D;  4A3F B;  3WOF A;  2EJG C;  1R9T B;  3GTO B;  2NVQ B;  4K8I A;  3QJY A;  4OO1 H;  3BDO A;  3GTG B;  1YNN D;  3PMF A;  4HCE A;  4OGQ C;  2A69 C;  1STN A;  3SXH A;  1HTL D;  3LWU A;  2DNC A;  3NPP A;  3TSS A;  4ME5 A;  4DAP A;  3QO2 A;  2NN6 G;  1K8M A;  2IPK D;  5I4D A;  3MVV A;  5ELD A;  2D2C C;  2A6H D;  3SEB A;  3VYT A;  1O80 A;  3K5O A;  2LY7 A;  3HOU B;  2MJ8 A;  2XSC A;  1SSO A;  5DM6 3;  1W6J A;  4HED A;  4BWG B;  1RKN A;  1M4V A;  4LAA A;  3PIP 3;  3QIA A;  2N55 A;  1I4Q A;  3S1R B;  1ESR A;  4XT1 B;  3A55 A;  4RKL A;  1IL8 A;  3I70 A;  4CKB A;  2K5D A;  3MFY A;  4A3J B;  2L55 A;  3H91 A;  5M5W B;  1STA A;  1SAP A;  2DN8 A;  2WAC A;  4M8A A;  2QIL A;  1KTK A;  3P7J A;  3BS1 A;  3JAM E;  4C3I G;  5CV8 A;  1OXV A;  2M00 A;  2DNE A;  1LT4 D;  5M9O A;  1TR5 A;  2E2J B;  4K6L A;  3GTK B;  5K36 G;  3J7A F;  2WII B;  3VR4 A;  1CHQ D;  1LTT D;  1TU2 B;  1FYC A;  1D5M C;  3PUV A;  1QIL A;  4MN3 A;  1V1P A;  4K8J A;  1EL0 A;  4HSP A;  3AU7 A;  1ET9 A;  1E0B A;  1Q12 A;  2EVB A;  2L12 A;  4DGZ A;  1ENC A;  1RTN A;  3EFX D;  4OO1 I;  4ZK9 B;  1D5X C;  3IL8 A;  2JXM B;  4R8N A;  1A3V A;  4EVO A;  1JCK B;  1PLF A;  4BY1 B;  4Q0F A;  1HUN A;  2NN6 H;  4HAE A;  2R93 B;  1F77 A;  5M3M B;  2IWH A;  4KD3 A;  4BBS B;  1YNJ C;  3S2H B;  4RH6 A;  1EQV A;  3J81 E;  5T1I A;  2NTS A;  3S15 B;  1VDZ A;  4K5X A;  1U4P A;  1HUM A;  1XTC D;  2KOL A;  2I46 A;  2Z4H A;  4ZQ3 A;  4KKU A;  2VB3 X;  3CKI B;  1DJR D;  1V1O A;  3G7L A;  5ELF A;  1FNU A;  3S2D B;  1QB5 D;  2B2U A;  3N6R A;  3TME A;  1PTO D;  2B2V A;  2NTT A;  1GHK A;  1JIC A;  3QOJ A;  3VR3 A;  1JWS D;  1JWM D;  3PO2 B;  4OL7 A;  3A56 A;  3E0J A;  5I9P A;  4IUU A;  3NBH A;  3HKZ B;  1DD2 A;  5CC4 A;  4RGN A;  4CHT B;  1Q1E A;  5CGK A;  4J6H A;  5C0X I;  5T1G A;  4C3H B;  3KLR A;  1I4H A;  1FD7 D;  4A3I B;  3V2T A;  1JOO A;  1STY A;  3EVQ A;  4CJ1 B;  1PTO B;  5E1F A;  1TVX A;  3A7A B;  4X3K A;  2K5W A;  1QE6 A;  5EBC A;  4HTH A;  4ZLT F;  4DAV A;  1CZG A;  2OXP A;  2Z4I A;  2E2D C;  1PZI D;  4CBV A;  3HOZ B;  3EJI A;  1MGS A;  4KD4 A;  1U4R A;  1JOQ A;  3MXG A;  1ZYR C;  1VMC A;  2B39 A;  1A6X A;  1LT5 D;  4ZKB B;  2EXZ A;  2PQE A;  4Q5V A;  3G6J B;  4X3U A;  3J81 L;  1HRJ A;  4U67 3;  1E2V A;  3RZD B;  3PUW A;  1PRT F;  4DNT B;  5EKI A;  1YNN C;  2L1B A;  2JE6 I;  5JAV A;  3DWP A;  1EOT A;  3U9S A;  1F2L A;  3MXN A;  4L8J A;  5ELE A;  1EZ8 A;  2K28 A;  1IW7 D;  1SYF A;  1T5X D;  3M85 A;  4R8I A;  5CMD A;  5D65 A;  3QWN A;  5I2Y A;  1MD2 D;  4FF1 A;  1SNP A;  2HDM A;  4BS9 A;  1Q90 A;  4DF7 A;  1I6H B;  1YNJ D;  3I91 A;  1FNW A;  3ZYY X;  5C3X A;  3UI2 A;  3ND9 A;  1ILP A;  1EIG A;  2M9V A;  3A7L A;  1H9M A;  3OWE B;  2EZV A;  1GUN A;  1F2Y A;  2O5I C;  3K7A B;  1MSH A;  3D3R A;  1F9P A;  2KCC A;  4CGY B;  4A3B B;  4QB4 A;  2PPB C;  1K8O A;  4XQJ A;  1HQM C;  3HOY B;  3MFG A;  2F1M A;  4H7B A;  4FP5 D;  3CQZ B;  2JEB I;  2KA7 A;  4IAL A;  2R61 A;  2EYJ A;  5CV4 A;  5IGD A;  1A2U A;  1I6V C;  1WTV A;  3FPU B;  4ODG A;  4XT3 B;  2KQ3 A;  3ERO A;  1R4P B;  1ZKO A;  4HMI A;  3P1H A;  4KJN A;  1EU4 A;  4RFB A;  4WOR A;  1EYC A;  3I4L A;  4QUC A;  2ZXP A;  4HSV A;  4J1M A;  4CKE A;  3HEJ A;  2KCN A;  1TWA B;  1XXG A;  3K59 A;  2BE5 D;  1ESF A;  2FIN B;  1W6K A;  3IFT A;  4RGO S;  1AW7 A;  5KGU A;  4QMG A;  1DOL A;  4FO2 A;  1PXU A;  4TRD A;  1G6Z A;  2FFK B;  4E6I A;  1QOH A;  4BA1 I;  3M3Y B;  3GD7 A;  5M3F B;  1WTX A;  2EJM A;  3MAQ A;  5CV5 A;  2AUK A;  1PFM A;  1I4R A;  4F88 A;  2PO4 A;  1SBB B;  5C4X B;  1QNK A;  1H9K A;  2K04 A;  3FKI B;  3RD4 A;  1D1K A;  2L0C A;  2WV6 D;  1F9S A;  1ET6 A;  1O7Z A;  3IAY A;  2O2L D;  1RTO A;  1SMY C;  2A74 C;  4UDU C;  1R4Q B;  3TZD A;  2BCO A;  4JK1 C;  4PMC A;  1GUO A;  3O13 A;  4CJ2 C;  1J8I A;  1LTR D;  1ENA A;  5C3E B;  4FXD A;  1WD0 A;  1VMP A;  4RKB A;  1SNO A;  2K01 A;  4ZUJ A;  3IFD A;  2PW7 A;  1WTQ A;  4S3S A;  1HPC A;  5EPL A;  3DMU A;  2PW5 A;  1ICW A;  1EFI D;  1SE3 A;  2ICI A;  4G57 A;  4I65 A;  1QJO A;  4DNR B;  5A2Q L;  4XDX A;  4G7O C;  2WIN B;  5C0X H;  4WJW A;  2B2Y C;  2F0P A;  4H44 C;  1SMY D;  5BN5 A;  1TWC B;  2RSN A;  2F0K A;  5JVH 3;  4RHR A;  2L4N A;  2F0U A;  1A3U A;  3OIQ A;  1KDC A;  4QUF A;  1B9N A;  1KLU D;  5CV6 A;  3K5M A;  1LTG D;  1SNQ A;  3L7Z C;  1GUT A;  4R9W A;  3OSO A;  3RMH A;  1OXX K;  1PFB A;  1X3P A;  2EY1 A;  2JA6 B;  3MXP A;  5I2X A;  4AYB B;  1SDF A;  3S1Q B;  3RZO B;  1NSN S;  2A69 D;  2MUY A;  3OIP A;  3AMU A;  5HUR A;  4F8M A;  1SYE A;  1RCV D;  1JB3 A;  4HR7 B;  4FXK C;  3BDL A;  3KLS A;  2EYO A;  3L3O C;  3D4W A;  4OHJ A;  4C1N K;  3HOW B;  2KJX A;  2Z8L A;  1SE2 A;  2WKC A;  2V4D A;  3T4A C;  1NCV A;  3IKJ A;  3TBI B;  1NAP A;  3HZX A;  3SK5 A;  1EIH A;  2NZ1 D;  3E5S A;  3R3O A;  4KY5 A;  4FF4 A;  2EDG A;  3BG3 A;  1EWC A;  2EY6 A;  1UEA B;  1J9O A;  4DXF A;  5BN4 A;  4KJO A;  1X3Q A;  2Q8I B;  4L6T B;  5EBD A;  1SNC A;  2JP1 A;  4NW2 A;  2NVY B;  2RBM A;  2A5H A;  2SNM A;  5J39 A;  4C56 C;  3MTS A;  1LT6 D;  1CFM A;  5E4W C;  1XWE A;  2PMZ B;  5EJW A;  1RF2 D;  3DWA A;  1LTS D;  3BYY B;  1BOS A;  1TT2 A;  4X3T A;  4B08 A;  4A3D B;  5LL6 X;  2F4I A;  3E6Z X;  2IX3 A;  2B63 B;  3EA6 A;  2A6H C;  3DEO A;  4I7Z C;  4V0B A;  1BO0 A;  4C3J G;  1BCP D;  2IX0 A;  3GP7 A;  4FF2 A;  5IT9 E;  3M7G A;  5DAU A;  4XTC S;  1TWH B;  4C2M B;  1T5E A;  4J8Q A;  1I4P A;  2EE1 A;  1KAB A;  2F0N A;  2HUG A;  4C1N I;  1LLR D;  4IUT A;  2ZXO A;  3DWQ A;  4A3K B;  4G7Z C;  2F0V A;  2R7Z B;  1TY0 A;  4G7H C;  2O4X A;  2JA5 B;  3S14 B;  3CU7 A;  1IHZ A;  2SNS A;  3SK8 A;  5KND A;  2RA4 A;  1DZ1 A;  1RHP A;  1Y8N B;  3OWF A;  1DM0 B;  2B2W C;  4ILW A;  1II3 A;  1TS5 A;  2VUM B;  4RCO A;  3R93 A;  2OF1 A;  1D1I A;  2C9O A;  4XYQ A;  3S1M B;  2FJ2 A;  2MHV A;  5FLX L;  1CM9 A;  4EQO A;  3WOE A;  2JA7 B;  2M2L A;  2I07 B;  3KUP A;  1ROD A;  2BE5 C;  3DHQ A;  2F0W A;  3HRZ C;  4CKC A;  5CBE E;  5G3L F;  1G29 1;  2L9H A;  3H6M A;  1JQY D;  2K6A A;  2B2Y A;  3GTP B;  3OW7 A;  4Y7N B;  2EYH A;  4KN4 C;  5JPM C;  1UUP A;  5CR3 A;  4KKT A;  3QB3 A;  5J1Z A;  4QF4 A;  5DNF A;  2TMP A;  2KHS A;  3MC0 B;  3K0Y A;  1X32 A;  3RUZ A;  5ELB A;  2JEA I;  1A3T A;  4GZY C;  1KLG D;  2F3W A;  3LWE A;  4K5V A;  2F0D A;  1DOK A;  1U4M A;  4KHV A;  3NK9 A;  4A3M B;  1EEI D;  3C2P A;  3D4D A;  4O1N A;  1G2T A;  1OO9 B;  2F0L A;  3J7A V;  4A3G B;  4LJZ C;  5KIX A;  3A54 A;  2XRS D;  5C4H A;  1DON A;  2SEB D;  3HOX B;  1Q8I A;  2YYZ A;  3M4O B;  3M7N A;  1C8C A;  4K14 A;  1BUV T;  5JEA J;  1PYW D;  5LHY 1;  3OOC A;  1GUW A;  2J7Z A;  2A6E D;  3MEH A;  3D6W A;  3GO5 A;  2R6G A;  2F0F A;  3Q6S A;  3HP3 A;  3R2T A;  2TSS A;  1SXT A;  4RAU C;  2CVR A;  5K36 H;  3C1E A;  3D6C A;  1JOK A;  2WP8 J;  4PMW A;  1G8Z D;  2HCC A;  3C46 A;  1QNU A;  1PDQ A;  3ND8 A;  2A68 C;  2RQX A;  4IFD G;  3FRP B;  2PZW A;  5ELC A;  3MWY W;  4CJ0 B;  1EWH A;  2QDB A;  1D6E C;  2G9D A;  3GTJ B;  4XQN A;  3N52 A;  1B44 D;  1PZK D;  2QF7 A;  5C0X G;  1IYV A;  1FR3 A;  2RDH A;  2L11 A;  1HFN A;  1F9Q A;  4K2K A;  4XYO A;  2KEE A;  4NMZ A;  4HCS A;  5IGG A;  3FPP A;  5FK9 C;  3P20 A;  1V1P B;  3Q22 A;  1Q3L A;  3ERQ A;  1PRT D;  2NBF A;  3KLS X;  4L63 B;  2L5T A;  2MPM A;  1C4Q A;  1CQV A;  1H9S B;  3X3M A;  3NWS A;  2DY7 A;  3FMC A;  1S5F D;  4M1U B;  4FXG C;  1TS2 A;  1TKW B;  1VF7 A;  5E4X A;  1C48 A;  3FEW X;  3C1F A;  3SK6 A;  2IL8 A;  1PTO C;  3AB9 A;  1FNV A;  2B2T C;  4C3J B;  1KDA A;  1V8Q A;  3TZU A;  1PZJ D;  2FHT A;  1EY8 A;  3PUX A;  1STG A;  1U9R A;  2EY5 A;  2BA0 A;  4JBW A;  1DOM A;  1S4Z A;  2NB0 A;  1RDP D;  2ZT9 C;  4PV1 C;  2CHB D;  2LFN A;  2EJF C;  1SE4 A;  2F3V A;  4TQU S;  5IGB A;  2IJ0 A;  2O5J C;  5C6A A;  3URY A;  1PMR A;  1WVL A;  1U4L A;  3NSW A;  3DUZ A;  1G91 A;  5M5Y B;  4K6D A;  1WD1 A;  1QWY A;  3FDT A;  4ZAI A;  1Y69 U;  2XVS A;  2EYL A;  5G3L D;  1SND A;  4ZRZ A;  3K58 A;  3KBX A;  2SDF A;  4N9P A;  1CI3 M;  2RKS A;  1B1Z A;  2D9U A;  2KUM A;  4PNY A;  3A8J E;  5FO9 B;  2F0T A;  2EYP A;  5IIF A;  3VR6 A;  2J4X A;  1VF5 C;  2E2I B;  3I8Z A;  1EQT A;  3VYS A;  1L0Y B;  3X3N A;  2PZU A;  5EPK A;  3I4M B;  2XWB B;  2D62 A;  1LT3 D;  3MZ5 A;  2F0I A;  3JAM L;  1KAA A;  2KEC A;  1QG7 A;  1CT1 D;  4PQX A;  1Y1W B;  5KEE A;  1GXD C;  2VB2 X;  1V43 A;  1LTB D;  1PRT B;  3S16 B;  3NTH A;  1B3A A;  4IQZ A;  2K33 A;  1BXT A;  2JSO A;  2F0O A;  1TS4 A;  1DXM A;  4KY7 A;  4BBR B;  1LO5 D;  3I90 A;  2EOT A;  2NWG A;  2ID0 A;  2F0Q A;  3PV0 A;  3I72 A;  1PTO H;  1FGB D;  2DY8 A;  5COY A;  1SJH D;  3CRK C;  4IFD H;  4F87 A;  3BYT B;  4KMU C;  1STE A;  5JEA H;  2RDG A;  1SYG A;  2E75 C;  1BNZ A;  3A8I E;  4FYD A;  2RDF A;  3ITP A;  1OXT A;  1LAC A;  3NE5 B;  5I9O A;  2K03 A;  1B4O A;  3TP6 A;  1HHV A;  2Q8R E;  3GTQ B;  1STB A;  5JOB A;  1F9R A;  2B2W A;  1DYQ A;  5JPN C;  3H3V C;  1L0X B;  4XQQ A;  4IFD I;  2R3Z A;  1AZQ A;  3D8G A;  2AQ3 B;  4EQN A;  2EYM A;  4QIW B;  1SYD A;  1D5Z C;  1HA5 A;  2AUJ D;  2F0E A;  4KN7 C;  5EKL A;  5C5L A;  1HXY D;  1ZXT A;  3VYR A;  4XXE A;  5D14 A;  3R2I A;  1IW7 C;  1IKM A;  1BQQ T;  1E2W A;  5C44 B;  3TP7 A;  2XIW A;  2F0J A;  2PNR C;  1O7Y A;  3QOL A;  3HGB A;  2LS0 1;  3MHB A;  2KVM A;  2NYZ D;  2KED A;  5I6W A;  1I4G A;  1UAP A;  2K1B A;  1GUS A;  1TII D;  3M4Y A;  4IN3 A;  4N9T A;  3SDZ A;  1MBY A;  3WDN A;  3KBG A;  1SYC A;  3H94 A;  2PZT A;  1ONL A;  3NBI A;  3BDC A;  1KNE A;  5JVG 3;  2IX1 A;  5D3D A;  3ONA B;  2K7V A;  4IZ8 A;  3GV3 A;  2XNA C;  4TKO B;  4ZUI A;  5IGF A;  4MHE A;  5AFW A;  1SEB D;  4IUP A;  4RCN A;  2VNU D;  4IUV A;  4NP5 A;  3S17 B;  2NN6 I;  1M8A A;  2HQE A;  3J80 L;  1EEF D;  4EGV A;  4HMJ A;  1JR0 D;  2AWN A;  1WTP A;  3GTM B;  3HOV B;  1CA5 A;  2H1E A;  2QCP X;  2OT2 A;  1BR9 A;  1BDO A;  4KKS A;  4KTA A;  1XX8 A;  1I4X A;  3T53 B;  5EQ0 A;  2QKI C;  4X3S A;  1STH A;  3SVM A;  1HTP A;  3DXJ C;  1BF4 A;  1A2T A;  4PMB A;  5F2D A;  4KV6 A;  1QCB D;  2PYK A;  2HDL A;  1OXU A;  2A73 B;  4ULL A;  1MSG A;  4K5W A;  1G2S A;  1RJT A;  3PUZ A;  1SFO B;  3H09 A;  2E74 C;  2NUC A;  1S5E D;  1B2T A;  1H9R A;  3DM1 A;  1KNA A;  1HCZ A;  3I3C A;  5KNB A;  3SK4 A;  5FO8 B;  2PCF B;  1GJX A;  2MGS A;  1F2M A;  1TWF B;  1CQF A;  1EU3 A;  4LK1 C;  1B50 A;  2HCI A;  4U68 A;  1O78 A;  1AZP A;  1LAB A;  2F0G A;  1HQR D;  3I73 A;  2AQ1 B;  2D5D A;  5EPJ A;  5KYL A;  2EPB A;  5C4J B;  2ICE C;  4BA2 I;  4LMQ D;  3I4N B;  2CQA A;  4IUR A;  4DU9 A;  2AQ2 B;  2LKV A;  1AFP A;  5E3F A;  5FO7 B;  1WCM B;  2JA8 B;  3GTL B;  5IOC A;  1EY9 A;  4NDX A;  4RGM A;  2B8G A;  4IFD J;  2G9H D;  4OIK A;  2X6L A;  1TWG B;  3GQB A;  5K5P A;  2EY2 A;  3R8B A;  1NR4 A;  4MIU A;  1LV9 A;  5EKK A;  3OMG A;  2Y0S B;  3NP8 A;  2ENB A;  2F0M A;  2X6G A;  4DN4 M;  1EY4 A;  1EY7 A;  1HA6 A;  3D4R A;  1DCZ A;  2IW3 A;  2A68 D;  2H4O A;  3KF8 A;  1JWU D;  5HGT A;  2GA4 B;  1AN8 A;  3BVM A;  1ZYR D;  3TP5 A;  2K05 A;  5JEA G;  4WFN 3;  3NWT A;  3T13 A;  3NQI A;  4ABN A;  4IUQ A;  1PRT C;  5CV9 A;  3D31 A;  3GV6 A;  5IOD A;  2A6E C;  1CK1 A;  4NKL A;  1GUG A;  2RSO A;  5CV7 A;  2SOB A;  1F2Z A;  1NUC A;  3QG1 A;  3VA5 A;  3FVQ A;  1CHP D;  1XYI A;  4B9X A;  1BCP F;  2K5Q A;  3BVZ A;  4ID6 A;  2XWJ B;  2JYO A;  1K83 B;  2F03 A;  1KDB A;  2BOS A;  3L9A X;  1Z7T A;  5C0X J;  5NUC A;  3T56 B;  5JJZ A;  2YU9 B;  2K32 A;  4BY7 B;  1JOR A;  3SHL A;  3VYU A;  3NTI A;  4P2C B;  3NUC A;  3PIO 3;  3K5L A;  1IKL A;  1IYU A;  1H9J A;  3Q24 A;  4DXG A;  5CYU A;  2LMC B;  1BCP C;  1EZ6 A;  1I3Q B;  3LNN A;  5IGC A;  3TP8 A;  2Q8T A;  2X69 A;  3OPO A;  3A8K E;  4QCL A;  1ENF A;  5C3W A;  1TY2 A;  1ILQ A;  1ZEQ X;  3J80 E;  1SYB A;  2NVX B;  4Z9C B;  4OO1 G;  5FOB B;  2EYF A;  3HS0 C;  2XRQ D;  3W3A A;  4TSS A;  1WTW A;  1EYD A;  5LL6 S;  3OHX C;  1AP0 A;  1Y1V B;  1SNM A;  5FLX E;  2CW0 C;  3U9O A;  3K57 A;  4H13 C;  1Y8P B;  2XN9 C;  5J22 A;  1BCP B;  1WTR A;  2NVT B;  2CW0 D;  4DK0 A;  2F0H A;  2F0S A;  4V19 0;  2FMC A;  1S5B D;  2QEJ C;  1A15 A;  2WKD A;  3C3L A;  3K5N A;  1B9M A;  3RLF A;  3TDQ A;  3TN2 A;  1PTO F;  2IT1 A;  2N88 A;  3V96 A;  5KNC A;  1LTA D;  1TQO A;  3KK7 A;  4DFA A;  4YIJ A;  5COR A;  2RVL A;  3NXW A;  1WTO A;  2E76 C;  3OMC A;  4ZKC B;  3S1N B;  4H0L C;  3PUY A;  5C4Z A;  1CZW A;  5KYI A;  4XIG S;  2B8F A;  4C3I B;  4WRD A;  1Q1B A;  4KY6 A;  5TSS A;  2WAQ B;  4KHZ A;  3VA7 A;  3HG9 A;  4EQP A;  1S5D D;  4F7X A;  1HFG A;  2E2H B;  4DK1 A;  4IUN A;  4UAI A;  1LTI D;  3T16 A;  5ISR A;  3NHH A;  3NQT A;  3Q23 A;  3CRL C;  2AWO A;  2VXW A;  1BBX C;  3LX0 A;  5IGE A;  1CA6 A;  1Z47 A;  2B2U C;  3BZD B;  3S9W A;  4A3E B;  3H0G B;  4HN7 A;  3MA2 B;  5D3I B;  5CBA E;  5DEH A;  4OIJ A;  5EGT A;  1D2B A;  1OXS C;  3K6O A;  1S5C D;  4KK7 A;  2BA1 A;  4DAY A;  3EQL C;  4RHS A;  3MXU A;  2Z1C A;  3SR1 A;  2B2V C;  2BDO A;  2FMM A;  5KRU A;  5A2Q E;  4RA8 A;  5DM7 3;  1JE4 A;  5C5M A;  4A93 B;  3Q0A A;  4ZYS A;  1GHJ A;  3BVG A;  1MI2 A;  4FNF A;  4K2L A;  1ML0 D;  3NTK A;  4RWS C;  1I50 B;  4KI0 A;  3DEP A;  1VCI A;  2WB1 B;  2R92 B;  3PO3 B;  5IT9 L;  2MP1 A;  3J7Y W;  1TS3 A;  3CHB D;  1EY0 A;  5BN3 A;  1O7L A;  1PFN A;  1CTM A;  2ZXR A;  4G4K A;  3W2D A;  1UNS A;  4C3H G;  1EYA A;  5A35 A;  2C5C A;  1B53 A;  3VR2 A;  3SE0 A;  3VR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...