4EQPA

Crystal structure of staphylococcal nuclease variant delta+phs i72d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKDEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4eqpA00
1EY6A 2F0QA 1EYCA 2F0EA 2EYMA 2F0IA 1SYEA 3HEJA 4B9XA 5IGCA 2EXZA 4EQOA 4QMGA 5KYLA 2KHSA 3NQTA 2PQEA 4DF7A 1TQOA 2F0NA 4PMCA 5EGTA 2EYLA 3MXPA 2F0PA 1EZ8A 1STAA 2M00A 1EY9A 2F0WA 3D8GA 3QOLA 2SOBA 4ID6A 4RKLA 4QF4A 5DAUA 3SXHA 2PZUA 1F2ZA 5CR3A 3SR1A 1SNQA 2EYFA 2F0LA 5CGKA 5KIXA 5EKLA 3TP8A 4K5VA 4NP5A 4WRDA 4DU9A 1EZ6A 5J39A 5CV7A 5IGBA 2ENBA 2EY1A 2F0VA 4K5WA 1A2UA 4PMBA 3EVQA 5EKKA 5C5LA 5IIFA 5CV8A 4PNYA 2OEOA 2RBMA 5C6AA 2WACA 5HURA 3SK6A 1NUCA 4IUNA 3P75A 1STHA 3OMCA 2F0SA 1EQVA 2F0TA 3BDCA 3QOJA 4J6HA 1TR5A 2EYJA 2F0KA 2F0JA 1KDCA 1SNDA 2F0GA 4IALA 1F2YA 4KD3A 5JAVA 4R8NA 3EROA 3OWFA 4K14A 3SHLA 4EQPA 5KGUA 4K6DA 3BDLA 2O4XA 4KV6A 5C4HA 5M9OA 1U9RA 5I6YA 1A3TA 1KABA 2EYHA 4I65A 1STBA 3C1EA 4G57A 5CV5A 2EY5A 2F3VA 3D6CA 3NUCA 4K5XA 1EY4A 5IGDA 4E6IA 3ITPA 5IGEA 1EYAA 2EY6A 2F0OA 3H6MA 5CV9A 1SYCA 5I6WA 5IOCA 5KYIA 3ERQA 5KEEA 3MVVA 2PW5A 1A2TA 3S9WA 3LX0A 1EY8A 1STNA 4KY7A 5E1FA 4K8JA 4ZQ3A 3TP5A 1STGA 3MZ5A 3PMFA 5F2DA 5J1ZA 5C4ZA 3NHHA 3QB3A 5I9OA 2OXPA 3D4WA 3OSOA 1SNOA 3E5SA 5CV4A 3TMEA 4TRDA 1SYBA 3NK9A 3V2TA 4ZUIA 1JOKA 2EYOA 4KD4A 4RKBA 5JOBA 1SNMA 3SK4A 5I9PA 1ENAA 4NDXA 4WORA 4MIUA 4N9PA 2F0HA 3P1HA 4QB4A 4B9WA 2PZTA 3SK8A 1AEXA 2OF1A 4HMJA 4IZ8A 1SYGA 4HMIA 2QDBA 5IGGA 3MEHA 5CV6A 1EY5A 4F7XA 4ODGA 3NXWA 1RKNA 4LAAA 4S3SA 3T13A 2NUCA 5IGFA 4F8MA 4KHVA 2SNSA 3SK5A 2F0MA 2F0DA 4ME5A 4ZUJA 1JORA 5C3XA 4KY5A 4KY6A 1SYFA 5C5MA 2PYKA 1JOQA 4KJNA 3C1FA 4KTAA 4HTHA 2EYPA 1STYA 4K2LA 1SYDA 5E3FA 4DGZA 3VA5A 2KQ3A 3R3OA 5J22A 5DEHA 1EYDA 3DMUA 2EY2A 2F0FA 1EY7A 4H7BA 5IODA 1JOOA 2F3WA 3D4DA 1NSNS 3OMGA 1EY0A 1F2MA 2F0UA 2RDFA 5K5PA 2HQEA 1SNCA 4YIJA 1A3UA 3TP6A 2PW7A 4J1MA 4K8IA 4N9TA 2LKVA 3HZXA 4DFAA 4NKLA 2SNMA 2PZWA 4EQNA 5CC4A 3TP7A 5HGTA 5C3WA 3DHQA 1KDBA 1TT2A 5NUCA 3T16A 2RKSA 5KRUA 3U9OA 1IHZA 3EJIA 4K2KA 4KJOA 1II3A 4NMZA 1SNPA 5ISRA 4OL7A 3RUZA 3MHBA 4EVOA 3NP8A 1KAAA 1KDAA 1A3VA 1ENCA
chains in the Genus database with same CATH superfamily
4KKSA 2F0IA 2DUDA 2YTYA 2RQXA 1SE8A 1I94L 2EQSA 1C9OA 2R7DA 1B8AA 2D0PA 3I8ZA 3BDOA 2PZUA 1WFQA 1WTXA 5IYCH 3SR1A 3TP8A 3CCUA 2KOLA 4BY7H 4X3TA 3L2PA 1F9PA 1QZHA 3UDGA 1KRTA 4IUPA 1YJWA 1HH2P 4BXXH 2FMMA 5G3LD 2B2YC 5EPLA 4B3SQ 5EQ0A 3QOJA 2EYJA 1SNDA 2F0JA 4FXGC 3GQBA 4OGQC 5C3EG 3UDIA 4GLXA 3PO2G 3L7ZC 1VQ8A 3NTKA 4DUYL 3AEVA 3MXUA 1KNEA 4JI7Q 1PH2A 3F2DA 4H13C 1YBYA 5JJIA 3NEMA 3I4MB 3MVVA 1WVLA 1HQRD 3TP5A 2JA8G 1TVXA 2UU9L 2KEEA 2OTJA 3PIP3 3G48A 4CJ1B 1I50H 2B63H 1SJHD 4C3JH 2TSSA 5G3LF 2MO1A 1IW7D 2I0QA 2PZTA 3H91A 2DN8A 3GV6A 4A3BH 1FR3A 2WAQG 3MFGA 2AKWB 1B7YB 1EUJA 1PTOC 4KHVA 2MPMA 2VUMB 3S16B 3RZOB 4B08A 1KD1C 1X6OA 4DUZQ 1SYDA 2E2JB 2UUCL 5ELFA 3X3MA 4HJ7A 3A55A 3VDYA 3OPOA 3VR2A 3AU7A 1L0WA 3CXCA 2JSOA 4BBRB 1IYUA 5EBCA 3CMAA 3D31A 2RF4A 1CKNB 2K75A 4RCOA 3C46A 3HZXA 3GTOH 4DKAC 4NB3A 2P5ZX 1NCVA 3TP7A 4DAMA 3K5LA 1Q86C 3W2DA 2EIFA 3FKIB 2NYZD 3CC2A 4YWLA 3J7AV 1SNPA 1WCMB 4RFBA 4F88A 3M4OB 1IL8A 3A0JA 1HR0Q 3I4NH 2LSSA 2RSOA 4DK3C 4EQOA 5KYLA 1K3BC 1Z9FA 2VZAA 4FXDA 3CQZH 4IUQA 3SGIA 3BYYB 1BKBA 3QIAA 4IUUA 4A3EG 4C3IB 3PUVA 1NR4A 2N55A 3K57A 4IFDJ 3DUZA 5JVH3 3EN2A 5AFWA 3M4YA 1K3RA 1LTID 4OIKA 2CWPA 4B3SL 4BA2I 2B29A 1S3OA 2KCMA 2HDLA 3T1YQ 2RBMA 2XSCA 2K7VA 4IFDH 2E2HB 2F0SA 1GVPA 4X6AH 3I2ZA 1DONA 1LV9A 4YCVA 4UP7A 5TSSA 3SHLA 1EQRA 1R9TH 4EQPA 1NNXA 1DM0B 1DOMA 2R93B 3QO2A 1CTMA 1LO5D 3KK7A 3ITPA 1PH1A 2DY8A 4JI5Q 4JBWA 3GP7A 4V0BA 2XNAC 1AW7A 2XVSA 2PW5A 2WIIB 1X3PA 1Q3LA 1VCIA 1HTLD 2NN6I 1I4RA 3D4WA 1QUQA 2LS01 2UXDQ 4YCWA 4L5TA 4HR7B 2IW3A 2NTSA 1DCZA 1HZCA 3WWVA 3A5UA 1WI5A 2FHTA 4P2CB 4QB4A 3S1MH 4OELB 3GTMH 3F1ZA 4A3IG 3T4AC 4DUZL 1ILPA 3PUYA 3MEFA 4OO1I 1PXUA 3PCOB 3IRBA 4QGUA 5A35A 5ELOA 2PNRC 3VR4A 2NVQB 2QGQA 2KBNA 3GTKB 3R3OA 4HJ5A 2A69D 2F3WA 2F0UA 2RDFA 4IJHA 3PQIA 1LTRD 2VUMG 1K8GA 5HGTA 3GV3A 1JB3A 5M3MB 3HOYH 1F9SA 4XIGS 4NPSA 4N8X1 1CM9A 4RCNA 1W6JA 3I55A 4C2MB 4EVOA 1X55A 3G7LA 1KLUD 2B2VC 1N33L 4R4TA 1A6XA 3STBD 5M5YH 4RKLA 2SOBA 4RH6A 4GN5A 4JYAL 3HOZG 4OXPA 3T1HQ 3E9HA 4J15A 4XT3B 3T1YL 4K5VA 2R7FA 3S1RH 4Y7NB 2K52A 1LTAD 1QUQB 2EY1A 5C44B 1HNZL 4NXNQ 4B3ML 4PNYA 3MFYA 3CCQA 5FO9B 1BO0A 4KN7C 4C3IG 5ELEA 2R7ZH 4ULLA 4DXFA 3BZKA 5M3FG 4GN3B 1ZXTA 4JI5L 1BBWA 4KV6A 2O4XA 3TN2A 4LF7Q 4CDCC 5M9OA 1WTWA 2L1BA 1K8OA 4IQZA 2LXKA 1G2TA 3LGJA 3C1EA 1TWCB 1EEID 2WFWA 2UXDL 4A3GG 3KFUA 2B2YA 2Z1CA 1WTOA 1X56A 5J1ZA 3QB3A 1JWSD 3M7GA 2CW0D 5IWAQ 1CFMA 3I4OA 5ELDA 1RDPD 2X6LA 1ENAA 3M85A 2OCEA 3P1HA 1NY4A 4R1JA 2K1BA 3J7A5 2FINB 4HMIA 2QDBA 1I6HB 3ZYYX 2CH4A 1YI2A 1RKNA 4AH6A 1ET9A 3PGZA 1TS3A 2D62A 1SSOA 4CKCA 3PF4A 2Q8TA 5FLMH 4ME5A 1JORA 4C3HB 3K7AH 3K6OA 4KY6A 1D1KA 4DR7Q 5C5MA 2PYKA 4HTHA 4AYBE 4DR3Q 4K2LA 4DV7Q 2NZHA 1I4HA 1JWUD 3M3YH 4GNXA 1EY7A 2NN6G 3WOFA 5IODA 2JA6G 4GKKQ 1HNWL 2A8VA 4LF6Q 4KHPL 1YNJC 1OO9B 4A3KH 4A4IA 3TZUA 2VQFL 1XMQQ 4EQNA 2AWNA 2MO0A 4LJZC 5K36H 2XWBB 4WFN3 5ISRA 4A3LG 4X3SA 5JJKA 1YHAA 1F2LA 1PH8A 3EIVA 1VQKA 3GTJB 4OO1H 2F0EA 2K5VA 4HAEA 3T1HL 3HOUB 2KA7A 4A93B 2PQEA 1TWHH 3BVMA 5M3MG 1EWCA 1EY9A 3GTPH 1TWFB 3S15B 1PYBA 1B1ZA 2ZTCA 4Y7NH 1Y1VH 1TS4A 2F0LA 4A75A 5IYBG 1I5FA 3AMUA 4JI2Q 1LTGD 1SN8A 4A3MG 3O13A 4LF7L 2OT2A 1B50A 2L9HA 1MHWC 3DWQA 1LT6D 2KVMA 4X64Q 5EAYA 4OIJA 4UAIA 3PO3H 2LY7A 1N8RC 1Y1WB 1RODA 1X3QA 3ZJYC 1E22A 1X3GA 3EA6A 2HIXA 1STBA 4DAVA 1MJEA 3S1QB 1GUSA 2EY6A 5KNCA 5IWAL 4K0KQ 4Y52H 1E2VA 3MA2B 5H1SE 1EY8A 5CMDA 1ONLA 3V96A 1VQPA 2H4OA 1A8VA 1VQBA 4HIMA 2BE5C 4QQBX 1AP0A 2EZVA 1PMRA 2RDGA 4YWMA 1BDOA 4JOIA 1AH9A 4QIWB 4ZAIA 4DR7L 3MEHA 5LMNW 2JN4A 1YNND 3QJYA 1N36Q 5I2XA 3NXWA 2BOSA 4DR3L 4FVMA 1S5BD 2L0CA 4HJAA 4DV7L 2WB1E 4GKKL 4L5RC 1WTHA 5C4XB 1SEBD 1QILA 5LMNQ 1PZKD 1WD1A 1SMXA 2IPKD 4DV5Q 4EQ5A 4POFA 4KMUC 1XMQL 3MWYW 1JMCA 5FLXc 3I3CA 5GROA 1ZYRC 4P71A 2K5HA 2MUYA 4N9TA 1TS5A 4DR2Q 3GO5A 5C0XG 3AB9A 2K04A 3A5ZB 3EJIA 4LF8L 3Q22A 2GVBA 1T5EA 4BY1H 4QCLA 4RGNA 3DEOA 3TQYA 1EY6A 4A3FH 2EYMA 3HEJA 2HIVA 3HOWG 2KCCA 3AQQA 3KLSA 4DAPA 2NTTA 4ID6A 3SXHA 1Y69U 1AZQA 4JI2L 5LHY1 3K5MA 4G4KA 4PQXA 3CCVA 4WJ3M 1YNXA 2EYFA 4FO2A 5KIXA 1SFOH 3KF6A 4JK1C 2PMZE 2NBFA 4XQJA 3HOUG 5CV7A 1FYCA 4X62Q 1XTDA 1MBYA 1XX8A 4HIKA 1A62A 4JI1Q 5HURA 5FLXE 1FGUA 2K5NA 2K28A 4LF9Q 3BDCA 4J6HA 5CBEE 2R3ZA 3HOXB 2WKCA 2ZJPA 4BBSH 3I72A 3CKIB 1YIJA 4QJFA 2L11A 1GD7A 4R8IA 2JP1A 4K5XA 1EIFA 2K5QA 2RCFA 3HP3A 5GQOA 3VA7A 3ERSX 1TWAH 5KYIA 1K0SA 1VQCA 3R93A 1K28A 1BVSA 3K5OA 4BY7B 2Z0SA 3PMFA 1Y1WG 2I5LX 2KHIA 1B3QA 1BR9A 1Q1EA 2OXPA 4JI8Q 4JV5L 3TS0A 2XGTA 1KTKA 3Q6SA 1GUTA 4CKEA 1BBXC 3ICEA 4C1NK 1K9MC 2OF1A 1IBKQ 1V1PA 1SE2A 4F7XA 5LMNL 2E74C 2L5TA 1CZGA 4LAAA 4GOPA 4A3JH 4WJWA 2ZM6L 4ZKCB 3PIOA 1DXMA 1YITA 2C9OA 2MHVA 2HDMA 4R4OA 3OTOQ 1HNXQ 2RVLA 3HRZC 3VYUA 2M9VA 1H9JA 1UEBA 2PO4A 2NZ1D 5BR8Q 2CFMA 1S5CD 4DNRB 4AIMA 1VQNA 2LKVA 2WINB 1HXYD 2MJ8A 1I50B 1I6VC 4KK7A 2B63B 4C3JB 3U50C 5NUCA 4P74A 2I46A 4HCEA 1EFWA 1OXXK 4A3BB 2N49A 2D5DA 1KAAA 1PHJA 2F0QA 1EYCA 5DM73 3KJOA 3F2CA 4DV0Q 1AFPA 4C56C 5GADC 4DK0A 4X62L 3DM3A 5IP7G 1K8AC 3HOVH 1ICFB 2VXWA 3CD6A 3K0XA 4U68A 4LF9L 4J8QA 3S2HH 3GTOB 2KCNA 4XYQA 4KN4C 2H5XA 2A6HD 4IPDA 1S4ZA 2Q2TA 4ABNA 1SRUA 1CQVA 1HHVA 3P75A 3G71A 1SDFA 1Y8OB 1XNRQ 1V1PB 3T13A 3K81C 4IALA 2EXDA 3PUZA 4CDDC 3OW7A 2Y0SG 3I4NB 4R8NA 4GOPB 2A19A 1PH9A 2ASBA 3URYA 2YYZA 1ESFA 4HSPA 4PZ7A 4I65A 1LM0A 3K59A 3CQZB 1P8LA 4JI8L 3DEPA 1CKNA 2JA7G 1PRTB 3ERQA 1LACA 3S9WA 4DR6Q 3OIQA 3FHWA 4KY7A 5KRUA 2D2CC 3H3VC 1Q90A 3NHHA 3IFDA 2BA0A 5A2QE 4UP8A 4RKBA 1VQLA 1XJVA 2F0HA 4B9WA 1J9OA 1AN8A 5C3EH 3PO2H 3BYTB 4MTKA 3K58A 2ZXPA 4ILWA 4IOCA 1HNXL 1U4MA 1R9TB 4P73A 2OTLA 1FGBD 1U4PA 2I5MX 1JICA 3HKZB 1VQ9A 5GAEC 2HQLA 1BCPB 1KHIA 5IY0A 5T1IA 4PMWA 2UXCQ 2AUJD 1Q46A 2JA8H 3CRKC 3RLFA 3BZDB 1IBMQ 3A7AB 3KJPA 3W1GA 1O80A 3D4DA 1NSNS 2CCZA 4K8IA 2G5DA 2G9HD 2HCIA 3VR6A 4GNXC 4LUOA 3L9AX 3UDFA 1XNQQ 3S1MB 3GTMB 2JXMB 1WTPA 1LT3D 2ZTDA 1E1OA 2CVRA 1YEZA 4DV0L 3NP8A 1O7IA 4JI6Q 1BNZA 4B9XA 2FJ2A 4C3JG 4R4CA 4U673 2N3SA 3BZCA 5CV4A 3D8GA 2QCPX 5DAUA 2NVTH 2PI2E 2PPBC 1SNQA 2L4NA 4POGA 1HR0W 3KDFB 3OHXC 1SXTA 1G2SA 1XNRL 1JE4A 5D3IB 1Y8NB 3FDTA 3HOYB 4JC0A 2VY3A 2MGSA 4IUTA 1HA6A 1GJXA 2GVAA 1QOHA 4KD3A 3U58A 3GD7A 3ND8A 3BDLA 1LABA 1VQHA 3BVZA 5M5YB 1WTVA 1XTCD 3NUCA 2HD3A 4IPCA 4RGOS 3K8AA 1TU2B 1EU3A 1TY2A 1ZEQX 3S1RB 1N9WA 5IE8A 5M5WH 1MD2D 3T51B 2ZXOA 2R61A 3FMCA 4JI7L 3DXJC 3ULLA 4X3UA 4YY3Q 2R7ZB 4IZ8A 2BDNA 2VB3X 4JOIC 1IBML 1RF2D 4DV6Q 4LFBQ 2OQKA 3SK5A 4IURA 3LWEA 2Z6KC 1NTGA 1S72A 5D14A 1Z47A 3J80c 4KJNA 2RSNA 4DV3Q 4DV1Q 2KQ3A 1W2BA 1MSHA 3J80i 2XWJB 1G51A 3EFXD 3PUWA 1WTRA 4FP5D 3HKZG 1D5XC 2NVXH 3J81c 4A3IH 3I4MG 5LL6X 4A3CG 4JI6L 4DXGA 4L8JA 3J81i 3I7FA 4JI3Q 1MIUA 2E2IH 4ZRZA 5FK9C 3S2DH 2VNUD 1C4QA 3TSSA 4Q0FA 5CYUA 1EIHA 4L5QA 1SYEA 4JCVE 4HJ9A 3K7AB 3NQTA 1VS0A 4M1UB 4ZKBB 4CJ0B 2YTVA 3CPWA 4JI4Q 2IL8A 1SLJA 3M3YB 2H1EA 2A68C 1H9KA 1HR0L 4DU9A 4A3KB 2O5JC 4KKTA 4K5WA 2JQOA 4UY8C 3EVQA 2Y0SE 1XXGA 4HEDA 3J80E 1DYQA 4B3RQ 1N32Q 1D7QA 1VQFA 4BBRG 1VQDA 2N78A 2AQ2B 1Y14B 1JB7A 2XIWA 3MXNA 3K5NA 1TR5A 2F0GA 2F0KA 3T53B 5JAVA 3IAYA 1SE4A 3KYHC 4DN4M 2DNCA 3S14H 3J81E 3FKIG 1GO3E 4K14A 3G4SA 4K6DA 3HOZH 2PNHA 1TWHB 1WCMG 1VQ7A 1W6KA 3GTPB 5LMUQ 4Z9CB 1T5XD 2E8GA 3FVQA 1Y1VB 4QL5A 1Q8KA 1Q82C 3Q0AA 1STGA 2Q2UA 4YY3L 4R9WA 4LF5Q 3PV0A 5KNDA 1SYBA 2B8FA 4PG3A 5M3FH 1J6QA 1NE3A 4NDXA 1B53A 4DV6L 2OQ0A 4MIUA 4LFBL 3UI2A 2JJQA 1F9RA 3I90A 2JYOA 3N52A 1JJCB 3JAMc 1C8CA 1WTQA 3PO3B 1EFID 1EY5A 4FXKC 4LUZA 4XQNA 2WKDA 4ODGA 1IL2A 1JWMD 1IYJB 3H09A 3JAMi 3H0GB 4O2DA 4A3GH 4IO9A 5C3XA 2K33A 1ASYA 4MHEA 3C1FA 1OXSC 2YTXA 4GOPC 1G6ZA 3I91A 2IJ0A 1Q12A 2R93G 2WAQE 4B3TQ 1CSPA 5IP9G 1OXTA 4KHZA 1RD9D 1QZGA 4ZLTF 1EY0A 4X65Q 5C0XI 1BBUA 1L2FA 4JI3L 1B3AA 4G7ZC 2Q2HA 1PRTC 3E3XA 1RJTA 1TT2A 1ASZA 2RKSA 4LF4Q 1GOZA 4K2KA 1VQMA 4JPBW 5E7NA 4NMZA 3W5OA 3MXNB 2QILA 3RNUA 3MTSA 3KF8B 4DV4Q 1SBBB 2BDOA 1DOLA 3M9BA 2EXZA 2K6AA 3CP0A 4O0AA 2EYLA 5IGGA 1HRJA 1UAPA 2NN6H 2JA6H 2Z4IA 5J3BA 2IHFA 1QB5D 1N32L 1BCPC 1Z6HA 4GS3A 5LL6S 2LMCB 4A3DB 2DGYA 5EKKA 3RR5A 5IIFA 1TKWB 1HCZA 4A3LH 4MNOA 1H9MA 1NAPA 2OEOA 1CHQD 4LFAQ 3C2PA 2SDFA 4XDXA 5CV8A 4BY1B 4AQYQ 3E9IA 1F2YA 1E2ZA 4A3FB 2F03A 4NXNL 2X6GA 2RDHA 5IYBH 3CCMA 5I2YA 1IKLA 1EYAA 4H02A 4LF5L 1CKOA 1SYCA 4JBJA 5I6WA 1S40A 1XWEA 4DA2A 1SFOB 1HZBA 4JW0A 2JA5H 3JC66 4A3MH 1HA5A 3A8JE 3I4LA 2XRQD 2RHSB 2EYOA 2ZJRA 3TBIB 4BS9A 1EYGA 4IPHA 2CWAA 2YU9H 1HFNA 3M7NA 5C44G 4IOAA 1TWGH 3H0GH 1ESRA 1FL0A 3H15A 4OX9Q 4X3KA 4YHHQ 1UE1A 3WOEA 3FP9A 4P72A 5IGFA 4F8MA 4BBSB 1Z7TA 5BN3A 1A63A 2F0DA 4L63B 4B3TL 3HG9A 4DNTB 5FKAC 4ME3A 2EYPA 3KBGA 5JPMC 1TWAB 3VA5A 5IT9c 5FLXL 5DEHA 3FEWX 3PO3G 1GXDC 1YNJD 2D9UA 3OMGA 4LF4L 2BCOA 5DNFA 1L0XB 4DAYB 1J5EQ 2Z6BA 4FF4A 1Q1BA 2Z6KA 1B2TA 1PFBA 5C3WA 1CUKA 3W1BA 5T1GA 5JEAG 3U9OA 4UP9A 3GTQH 1X65A 5AJ3Q 1NJIC 1ENCA 3I56A 4LF6L 4A3JB 4C1NI 1PH3A 4JBMA 5C0XJ 2DJGC 3U4VA 1TQOA 3HFZB 4R4IA 3X3NA 3U9SA 1X54A 4LMQD 4A3DH 1MJCA 4C3HG 1PH5A 2KJXA 5C0XH 4LFAL 3F2BA 1KC8C 5J39A 2JEAI 1KRSA 2HT1A 2F4IA 4LWCA 4PMBA 3SE0A 2IY5B 1KL9A 2J0TD 5IYDG 5IT9E 3SK6A 1HTPA 1TIID 1QVGA 3HOWH 3S17H 1IYVA 4DR5Q 2BH8A 1I3QH 4IJLA 3CPFA 4DNIA 1BF4A 3H94A 3OWFA 4FNFA 4X66Q 3PUXA 4O1NA 4MZ9A 2K32A 2EYHA 1IXRA 5IGDA 1XYIA 1X32A 1M90C 5IGEA 1QE6A 2EJGC 2EE1A 3HOVB 4WJ4A 1G91A 4GKJQ 4BY1G 4A93G 4X64L 4K8JA 1U0LA 1V8QA 1QVFA 2BE5D 3S2HB 1O7ZA 3OOCA 3CRLC 1SNOA 2LFNA 3S1NH 1JC7A 4OX9L 1SMYC 1HJPA 1VQAA 4DR4Q 2XN9C 1XMOQ 5JJLA 1ML0D 4N9PA 4K0KL 1SROA 2SEBD 3A8IE 3OWEB 2M2LA 2J4XA 2R92H 3PSIA 1XPOA 4CBVA 1LTTD 2D0OA 2B2WA 2VQEQ 2QW7A 4G7HC 1OTCA 1STEA 5E3FA 2ZT9C 4ZYSA 2IX3A 1EYDA 1ZYRD 3DMUA 2ICIA 4EGVA 1N36L 1CA5A 1IBLQ 1I4PA 2JK8A 2CH4W 3PIPA 3UDXA 3NENA 4R4QA 1IKMA 1QCBD 5AJ3L 2RHQB 2Z9HA 4QUCA 5C3EB 1JR0D 1MKHA 1UE5A 3A56A 4DV5L 3PO2B 1PTOH 1VQJA 1EIGA 2A5HA 4OL7A 1MSGA 2ICEC 3KBXA 3QR8A 4DR2L 3CW2C 1FNVA 2HCCA 1O78A 1CI3M 5A2QL 1STAA 2NVYH 2A6ED 2JA8B 1F2ZA 3RLOA 1QNUA 2K5DA 4NXMQ 5CGKA 1YHQA 1D1IA 4WRDA 5C4XG 4A3JG 2KCTA 3TEHB 2K05A 1G6PA 4QY7A 3KLSX 1A2UA 4DUYQ 1WJJA 4DR5L 4GLVB 3CU7A 4X66L 1SE3A 1I4QA 3CF5A 3A7LA 2K5WA 2B2TA 1VQ5A 1EOVA 2CQAA 1K0RA 2EJMA 1KDCA 4F87A 2B39A 2UU9Q 3EROA 3N6RA 1VDZA 1EQQA 3CC4A 2PQAB 3T56B 3NBIA 2K01A 1BXTA 5M5XH 4JI1L 1L1OA 1NBWA 2NVTB 4DK6C 2N88A 4AYBB 4TQUS 4DR4L 2HUGA 4TVAB 1XMOL 1BQQT 2QEJC 2X69A 5I9OA 1MGSA 3OSOA 1FJGQ 3D0FA 1IZ6A 3NK9A 3V2TA 3G6EA 1JOKA 4KD4A 1PFSA 4WORA 5C4JH 2QEXA 4KLKA 1LUZA 3NPPA 4LK1C 1SYGA 1IW7C 4HJ8A 2Q8IB 2ZTEA 1PLFA 5FJ8G 2E5LQ 1RTOA 2WV6D 4DK1A 4IFDI 1ZKOA 2EOTA 3FPPA 2JA7H 4RG1A 2IX0A 2IT1A 3KOJA 3HOXG 4M8AA 4KTAA 1IBLL 2E76C 3KDFA 4DGZA 1B70B 3UE0A 1JCKB 1L0YB 1IBKL 5M5WB 1SAPA 1E2WA 3E6ZX 1G8ZD 2MQHA 3IL8A 5IYCG 2PCFB 4DFAA 3GTLH 1Q8IA 3D4RA 4RHRA 4BY7G 3OTOL 3CAMA 3J7YW 1HZAA 4A76A 1QJOA 2NZOA 1VMPA 4BWGB 1UEAB 1TS2A 1H9SA 5I4DA 5BR8L 4BXXG 1WOCA 4NXML 3HKSA 1GHJA 5FO7B 3TRZA 5ELCA 1GKHA 3OIPA 3QOLA 1L1OB 4ZK9B 3GTGH 1GUOA 2K03A 1EWIA 1U4RA 4LW1A 3MAQA 3NBHB 3KUPA 3P7JA 4OWTB 1LYLA 4TKOB 3MXGA 2NVXB 1CKMA 3NELA 4A3IB 2I5HA 2BA1A 1NMFA 4JBKA 4IUVA 3TREA 2ES2A 2E2IB 1VQ6A 3S2DB 2QA4A 3IKJA 2B63G 5D65A 1DZ1A 2L12A 4OEMB 4PZ6A 3W3AA 1VQGA 1AE2A 5I6YA 3PIO3 1KABA 4HIDA 4LFCQ 4A3BG 5CV5A 1RTNA 2WB1B 4JI0Q 2QKIC 1EY4A 4E6IA 1FJGL 1E0BA 5DM63 2F4VQ 1KXLA 1AZPA 5E4WC 4OHJA 1PZJD 1WYDA 5E1FA 1I4GA 5F2DA 3RZDH 2QDLA 1NMGA 1TY0A 1K83H 3E5SA 4OWWB 1PFNA 3CMEA 3M4PA 1SNMA 2ALYB 2E5LL 1M4VA 2J7ZA 2AWOA 4L6TB 2KUMA 4AYBG 5FO8B 2FFKB 3NWSA 4A3EH 5CV6A 4FF3A 4DR6L 3S14B 1H9SB 3J7AF 3NWTA 3QWNA 1G291 2B2UA 2NUCA 3HOZB 2QF7A 3AFQA 3EBEA 3RN2A 1KAWA 4KY5A 5GAHC 3J80L 1PV4A 3I4NG 1S5DD 3OW2A 1OXUA 4FDBA 3Q23A 1JE5A 1S5FD 2Q8RE 5CORA 3D3RA 3FRPB 1A15A 1JT8A 1EEFD 1SNCA 3BG3A 4RGMA 3J81L 4XYOA 1N33Q 2A69C 2EJFC 2PMZB 1SR3A 2SNMA 5M3FB 3J81j 2UXCL 3SDZA 2AUKA 1PTOD 3EQLC 4QIWE 3VYSA 2I07B 3T16A 4CDFC 4JYAQ 1IHZA 1RL2A 1H9RA 2IX1A 3OMCA 1X3FA 5KNBA 2K4KA 4IFDG 4K6LA 3CCSA 4A3GB 1HNZQ 4QMGA 2AQ1B 1GHKA 3CC7A 4DF7A 2F0NA 1HZ9A 4B3MQ 5C5LA 1XNQL 1EZ8A 2M00A 4L5SA 1EU4A 4GN4B 3HGBA 3STBC 1UUPA 4HN7A 3V05A 5CR3A 3RN5A 3D6WA 4FF1A 1U5KA 3I4MH 4A3CH 1E3PA 4NP5A 1JJGA 3NQIA 4UDUC 1BOSA 5IGBA 4UPAA 1LT4D 3A54A 4CDEC 1PTOF 1B9MA 1V1QA 2L55A 2VS1A 3I73A 1Q7YC 1SJED 1NUCA 5D3DA 2IWHA 2VB2X 3A8KE 4LFCL 5EJWA 4YCUA 4JI0L 2GN5A 1QWYA 5C4HA 2F4VL 3NE5B 4RWSC 1LTSD 2Z4HA 1A3TA 3J7ZC 3AYHB 2JA6B 2VUMH 2AMCB 3RZOH 3S16H 1J8IA 4DR1Q 3H6MA 1XPRA 5CV9A 4GLAC 2E2JH 4O42A 5KEEA 1A2TA 3Q8DA 4ZQ3A 2F1MA 4BBRH 1UWVA 3BS1A 1V43A 2YV5A 1VQOA 2WB1G 4ZUIA 2EPBA 4NW2A 3KF8A 2CW0C 3SK4A 1M1KC 3E0EA 3CCRA 3FKIH 3JAML 1CSQA 4BA1I 4HMJA 1A0IA 1C7YA 3HS0C 3HOYG 1WCMH 1HNWQ 1RCVD 4CKBA 3M4OH 1OXVA 4P75A 4KHPQ 4MN3A 4UHVA 2VQFQ 4ZUJA 3TDQA 1LT5D 3DWPA 1T9HA 3I70A 4I7ZC 4C3IH 4CGYB 4OWXB 2B2WC 3R8BA 2JA5B 1F2MA 4A3MB 1EOTA 1A3UA 1C48A 4J1MA 5COYA 5BN5A 4RHSA 1Q81C 1P16A 5EBDA 2EDGA 4DV3L 2MNAA 2YU9B 4DV1L 2ZJQA 2E2HH 1TWGB 1O7YA 3BJUA 5ELNA 2A1AA 4XTCS 1VQEA 2R7ZG 2R93H 3AFPA 5EGTA 3MXPA 5IP9H 2F0PA 3LNNA 2A68D 1LTBD 3L0OA 1DGSA 3ND9A 4V190 1PH4A 2PI2A 1MI2A 1VQ4A 1R4PB 2FMCA 1PH7A 1EZ6A 3UE1A 1YJ9A 1H95A 4OONA 3TZDA 2EVBA 3BU2A 3GDEA 1D2BA 1KLGD 2WACA 2DY7A 4JI4L 2DJFC 5EKIA 3NTHA 5CBAE 3P20A 1STHA 1HQMC 3GTQB 3F8TA 4XT1B 4XXEA 3U4ZA 4DR1L 4FF2A 5FOBB 2O5IC 1PVOA 3JAME 1U9RA 3R2IA 2B2TC 4FYDA 1JQYD 4B3RL 4PZ8A 4LNQA 2N8NA 1KIXA 1DD2A 1EWHA 4RAUC 2F0OA 2MP1A 2NVQH 1U4LA 4DAYA 5FLMG 5IOCA 3GTKH 3H3VI 2JA9A 2A73B 1HFGA 1D8LA 4HCSA 1PYWD 3RD4A 3LX0A 5E4XA 1L1OC 4TSSA 3BVGA 1PZID 1ICWA 2A74C 3ONAB 2L15A 4N8FA 5JOBA 5LMUL 5M3MH 5BN4A 4A3KG 4RA8A 5HGQA 5L37A 3HOWB 3S17B 3CCEA 1PA6A 1I3QB 3VYTA 5K36G 4DPGA 3VYRA 4C2MH 2C35B 4CJ2C 1NR2A 1YNNC 4H0LC 2F0MA 2OWOA 4OO1G 1JOQA 2RA4A 2VL6A 5IT9L 4LF8Q 2UUBQ 5J22A 3FPUB 2EY2A 2F0FA 4H7BA 2E75C 1JOOA 2Z8LA 1PRTD 4LUVA 5K5PA 1S5ED 3TP6A 3SVMA 2PW7A 4DV2Q 1B9NA 2V1CC 1VF7A 3S1NB 1Y1VG 1FNUA 5C44H 5CC4A 3TS2A 3CHBD 3DHQA 2XTIA 1VF5C 4KJOA 2C5CA 3A74A 3RUZA 4HSVA 3K7UC 2JA5G 3HKZE 1ILQA 1V9PA 1GUGA 2R92B 4X65L 1FNWA 2JEBI 3E0JA 1FVIA 2TMPA 5IGCA 1YHBA 3R2TA 2AHOB 1N34Q 1QNKA 5JEAJ 4PMCA 1CQFA 5EPKA 3F2UA 2F0WA 1TWCH 1BCPD 1VQIA 3H0GG 3KLWA 1XPUA 1PRTF 2VW9A 5EKLA 4DV4L 2V4DA 5JEAH 3DM1A 2F0VA 3Q24A 2IHEA 4JVZA 4GNXB 2K14A 2KENA 1YJNA 5C6AA 1PTOB 4IUNA 1EQVA 2G9DA 3LWUA 1I6HH 4RMFA 4Q5VA 2BH2A 4JV5Q 2E2DC 2MFIA 1BUVT 1F77A 2AQ3B 3QG1A 1ET6A 1AE3A 2NVYB 4C3HH 4G57A 5EPJA 2EY5A 3D6CA 1BCPF 4H44C 3VR5A 2KEDA 3CCJA 1STNA 4AQYL 1D6EC 2CHBD 4YWKA 5C4ZA 1D5ZC 2UUAQ 5IYDH 4RGTA 1F9QA 3TMEA 1ENFA 2ZM6Q 4TRDA 1YVCA 2ATWA 1LLRD 2WP8J 4A3DG 5DLQE 3SK8A 1DJRD 3DLLA 4JG2A 1KNAA 1PH6A 1DOKA 4S3SA 2UUBL 3GTJH 2F3IA 2Q2IA 2SNSA 3VR3A 3HOUH 1B4OA 1YZ6A 5M5XB 4A93H 2JE6I 4A3FG 1STYA 1TWFH 1RIPA 2B2UC 4DV2L 3H3VH 3S15H 2NWGA 2RCNA 3S24A 1R4QB 1K8MA 1PYSB 3B6YA 4YHHL 1WD0A 1PFMA 1RHPA 2HQEA 2A6EC 1W3SA 1QG7A 2GA4B 2B3GA 2Y0SB 1KDBA 5C4JB 2B2VA 2CKZB 2R6GA 1N34L 4KKUA 2PQAA 4I7AA 4EX5A 4IPGA 4APVA 2HHHQ 1TXYA 2NB0A 1E7ZA 2UXBQ 5JJZA 2JA7B 1Y1WH 1J5EL 1V1OA 2KECA 2KHSA 3MC0B 2LXJA 3K0YA 4PV1C 4QF4A 3S1QH 5HY6A 4BBSG 1X9NA 1UNSA 1I94Q 4ZCKA 1UE6A 2ZXRA 1UE7A 1JJ2A 4IN3A 3SEBA 2R92G 4HIOA 3M4QA 3IFTA 4G7OC 2ENBA 3GTLB 1CT1D 2DNEA 3L3OC 1GM5A 2K50A 4QUFA 2A6HC 2F52A 2XRSD 2F0TA 2FXQA 1KQSA 3C3LA 1GUWA 5JVG3 5KGUA 1CK1A 5GAGC 3G6JB 1QVCA 1M8AA 3ER0A 3ULPA 2UUAL 2F3VA 1CHPD 3GTGB 3ULJA 1X3EA 3RMHA 5C4XH 2ID0A 1GUNA 3DWAA 3WDNA 1EQTA 4ALPA 2WAQB 3MZ5A 1SMYD 3CCLA 4MTNA 1C0AA 3KF6B 1HUNA 1O7LA 3NSWA 5I9PA 1CA6A 1CZWA 2KHJA 1AEXA 4GKJL 5IP7H 3KLRA 3K80C 3NBHA 4CHTB 1SYFA 2O2LD 3NTIA 4GZYC 1LTLA 1FD7D 1EIYB 3OYYA 3PF5A 1HUMA 3RZDB 4XQQA 5JPNC 1D5MC 1E1TA 5ELBA 1K83B 4YIJA 3HOVG 1VMCA 2UUCQ 1I4XA 4KI0A 4NKLA 2CQOA 1B44D 1PDQA 2PZWA 2HHHL 2VQEL 2UXBL 1HPCA 1K73C 5FJ8H 1II3A 1EL0A 1E24A 4A3EB 2B8GA 3RLNA 1Y8PB 3MHBA 1KDAA 1A3VA 3HOXH
chains in the Genus database with same CATH topology
4KKSA 2F0IA 2RQXA 3I8ZA 3BDOA 2PZUA 1WTXA 3SR1A 3TP8A 2KOLA 4X3TA 1F9PA 4IUPA 2FMMA 5G3LD 2B2YC 5EPLA 5EQ0A 3QOJA 2EYJA 1SNDA 2F0JA 4FXGC 3GQBA 4OGQC 3L7ZC 3NTKA 3MXUA 1KNEA 4H13C 3I4MB 3MVVA 1WVLA 1HQRD 3TP5A 1TVXA 2KEEA 3PIP3 4CJ1B 1SJHD 2TSSA 5G3LF 1IW7D 2PZTA 3H91A 2DN8A 3GV6A 1FR3A 3MFGA 1PTOC 4KHVA 2MPMA 2VUMB 3S16B 3RZOB 4B08A 1SYDA 2E2JB 5ELFA 3X3MA 3A55A 3OPOA 3VR2A 3AU7A 2JSOA 4BBRB 1IYUA 5EBCA 3D31A 4RCOA 3C46A 3HZXA 3K5LA 3TP7A 1NCVA 3W2DA 3FKIB 2NYZD 3J7AV 1SNPA 1WCMB 4RFBA 4F88A 3M4OB 1IL8A 2RSOA 4EQOA 5KYLA 4FXDA 4IUQA 3BYYB 3QIAA 4IUUA 4C3IB 3PUVA 1NR4A 2N55A 3K57A 4IFDJ 3DUZA 5JVH3 5AFWA 3M4YA 4OIKA 1LTID 4BA2I 2HDLA 2RBMA 2XSCA 2K7VA 4IFDH 2E2HB 2F0SA 1DONA 1LV9A 5TSSA 3SHLA 4EQPA 1DM0B 1DOMA 2R93B 3QO2A 1CTMA 1LO5D 3KK7A 3ITPA 2DY8A 4JBWA 3GP7A 4V0BA 2XNAC 1AW7A 2XVSA 2PW5A 2WIIB 1X3PA 1Q3LA 1VCIA 1HTLD 2NN6I 1I4RA 3D4WA 2LS01 4HR7B 2IW3A 2NTSA 1DCZA 2FHTA 4QB4A 4P2CB 3T4AC 1ILPA 3PUYA 4OO1I 1PXUA 5A35A 2PNRC 3VR4A 2NVQB 3GTKB 3R3OA 2A69D 2F3WA 2F0UA 2RDFA 1LTRD 5HGTA 3GV3A 1JB3A 5M3MB 1F9SA 4XIGS 1CM9A 4RCNA 1W6JA 4C2MB 4EVOA 3G7LA 1KLUD 2B2VC 1A6XA 4RKLA 2SOBA 4RH6A 4XT3B 4K5VA 4Y7NB 1LTAD 2EY1A 5C44B 4PNYA 3MFYA 5FO9B 1BO0A 4KN7C 4C3IG 5ELEA 4ULLA 4DXFA 1ZXTA 4KV6A 2O4XA 3TN2A 5M9OA 1WTWA 2L1BA 1K8OA 4IQZA 1G2TA 3C1EA 1TWCB 1EEID 2B2YA 2Z1CA 1WTOA 5J1ZA 3QB3A 1JWSD 3M7GA 2CW0D 1CFMA 5ELDA 1RDPD 2X6LA 1ENAA 3M85A 3P1HA 2K1BA 2FINB 4HMIA 2QDBA 1I6HB 3ZYYX 1RKNA 1ET9A 1TS3A 2D62A 1SSOA 4CKCA 2Q8TA 4ME5A 1JORA 4C3HB 3K6OA 4KY6A 1D1KA 5C5MA 2PYKA 4HTHA 4K2LA 1I4HA 1JWUD 1EY7A 2NN6G 3WOFA 5IODA 1YNJC 1OO9B 3TZUA 4EQNA 2AWNA 4LJZC 5K36H 2XWBB 4WFN3 5ISRA 4X3SA 1F2LA 3GTJB 4OO1H 2F0EA 4HAEA 3HOUB 2KA7A 4A93B 2PQEA 3BVMA 1EWCA 1EY9A 1TWFB 3S15B 1B1ZA 1TS4A 2F0LA 3AMUA 1LTGD 3O13A 1B50A 2OT2A 2L9HA 3DWQA 1LT6D 2KVMA 4OIJA 4UAIA 2LY7A 1Y1WB 1RODA 1X3QA 3EA6A 1STBA 4DAVA 3S1QB 1GUSA 2EY6A 5KNCA 1E2VA 3MA2B 1EY8A 5CMDA 1ONLA 3V96A 2H4OA 2BE5C 1AP0A 2EZVA 1PMRA 2RDGA 1BDOA 4QIWB 4ZAIA 3MEHA 1YNND 3QJYA 5I2XA 3NXWA 2BOSA 4FVMA 1S5BD 2L0CA 5C4XB 1SEBD 1QILA 1PZKD 1WD1A 2IPKD 4KMUC 3MWYW 3I3CA 1ZYRC 2MUYA 4N9TA 1TS5A 3GO5A 5C0XG 3AB9A 2K04A 3EJIA 3Q22A 1T5EA 4QCLA 4RGNA 3DEOA 1EY6A 2EYMA 3HEJA 2KCCA 3KLSA 4DAPA 2NTTA 4ID6A 3SXHA 1Y69U 1AZQA 5LHY1 3K5MA 4G4KA 4PQXA 2EYFA 4FO2A 5KIXA 4JK1C 2NBFA 4XQJA 5CV7A 1FYCA 1MBYA 1XX8A 5HURA 5FLXE 2K28A 3BDCA 4J6HA 5CBEE 2R3ZA 3HOXB 2WKCA 3I72A 3CKIB 2L11A 4R8IA 2JP1A 4K5XA 2K5QA 3HP3A 3VA7A 5KYIA 3R93A 3K5OA 4BY7B 3PMFA 1Q1EA 1BR9A 2OXPA 1KTKA 3Q6SA 1GUTA 4CKEA 1BBXC 4C1NK 2OF1A 1V1PA 1SE2A 4F7XA 2E74C 2L5TA 1CZGA 4LAAA 4WJWA 4ZKCB 1DXMA 2C9OA 2MHVA 2HDMA 2RVLA 3HRZC 3VYUA 2M9VA 1H9JA 2PO4A 2NZ1D 1S5CD 4DNRB 2LKVA 2WINB 1HXYD 2MJ8A 1I50B 1I6VC 4KK7A 2B63B 4C3JB 5NUCA 2I46A 4HCEA 1OXXK 4A3BB 2D5DA 1KAAA 2F0QA 1EYCA 5DM73 1AFPA 4C56C 4DK0A 2VXWA 4U68A 4J8QA 3GTOB 2KCNA 4XYQA 4KN4C 2A6HD 1S4ZA 4ABNA 1CQVA 1HHVA 3P75A 1SDFA 1Y8OB 1V1PB 3T13A 4IALA 3PUZA 3OW7A 3I4NB 4R8NA 3URYA 2YYZA 1ESFA 4HSPA 4I65A 3K59A 3CQZB 3DEPA 1PRTB 3ERQA 1LACA 3S9WA 5KRUA 3OIQA 4KY7A 2D2CC 3H3VC 1Q90A 3NHHA 3IFDA 2BA0A 5A2QE 4RKBA 2F0HA 4B9WA 1J9OA 1AN8A 3BYTB 3K58A 2ZXPA 4ILWA 1U4MA 1R9TB 1FGBD 1U4PA 1JICA 3HKZB 1BCPB 5T1IA 4PMWA 2AUJD 3CRKC 3RLFA 3BZDB 3A7AB 1O80A 3D4DA 1NSNS 4K8IA 2G9HD 2HCIA 3VR6A 3L9AX 3S1MB 3GTMB 2JXMB 1WTPA 1LT3D 2CVRA 3NP8A 1BNZA 4B9XA 2FJ2A 4C3JG 4U673 5CV4A 3D8GA 2QCPX 5DAUA 2PPBC 1SNQA 2L4NA 1SXTA 3OHXC 1G2SA 1JE4A 5D3IB 1Y8NB 3FDTA 3HOYB 2MGSA 4IUTA 1HA6A 1GJXA 1QOHA 4KD3A 3GD7A 3BDLA 3ND8A 1LABA 3BVZA 5M5YB 1WTVA 1XTCD 3NUCA 4RGOS 1TU2B 1EU3A 1TY2A 1ZEQX 3S1RB 1MD2D 3T51B 2ZXOA 2R61A 3FMCA 3DXJC 4X3UA 2R7ZB 4IZ8A 2BDNA 2VB3X 1RF2D 3SK5A 4IURA 3LWEA 5D14A 1Z47A 4KJNA 2RSNA 2KQ3A 1MSHA 2XWJB 3EFXD 3PUWA 1WTRA 4FP5D 1D5XC 5LL6X 4DXGA 4L8JA 4ZRZA 5FK9C 2VNUD 1C4QA 3TSSA 4Q0FA 5CYUA 1EIHA 1SYEA 3K7AB 3NQTA 4M1UB 4ZKBB 4CJ0B 2IL8A 3M3YB 2H1EA 2A68C 1H9KA 4DU9A 4A3KB 2O5JC 4KKTA 4K5WA 3EVQA 3J80E 1XXGA 4HEDA 1DYQA 2AQ2B 2XIWA 3MXNA 3K5NA 1TR5A 2F0GA 2F0KA 3T53B 5JAVA 3IAYA 1SE4A 4DN4M 2DNCA 3J81E 4K14A 4K6DA 1TWHB 1W6KA 3GTPB 4Z9CB 1T5XD 3FVQA 1Y1VB 3Q0AA 1STGA 4R9WA 3PV0A 5KNDA 1SYBA 2B8FA 4NDXA 1B53A 4MIUA 3UI2A 3I90A 1F9RA 2JYOA 3N52A 1C8CA 1WTQA 3PO3B 1EFID 1EY5A 4FXKC 4XQNA 2WKDA 4ODGA 1JWMD 3H09A 3H0GB 5C3XA 2K33A 4MHEA 3C1FA 1OXSC 1G6ZA 3I91A 2IJ0A 1Q12A 1OXTA 4KHZA 1RD9D 4ZLTF 1EY0A 5C0XI 4G7ZC 1B3AA 1PRTC 1RJTA 1TT2A 2RKSA 1GOZA 4K2KA 4NMZA 2QILA 3MTSA 1SBBB 2BDOA 1DOLA 2EXZA 2K6AA 2EYLA 5IGGA 1HRJA 1UAPA 2NN6H 2Z4IA 1QB5D 1BCPC 1Z6HA 5LL6S 2LMCB 4A3DB 5EKKA 5IIFA 1TKWB 1HCZA 1H9MA 1NAPA 2OEOA 1CHQD 3C2PA 2SDFA 4XDXA 5CV8A 4BY1B 1F2YA 1E2ZA 4A3FB 2F03A 2X6GA 2RDHA 5I2YA 1IKLA 1EYAA 1SYCA 5I6WA 1XWEA 4DA2A 1SFOB 1HA5A 3A8JE 3I4LA 2XRQD 2EYOA 3TBIB 4BS9A 1HFNA 3M7NA 1ESRA 4X3KA 3WOEA 4BBSB 5IGFA 4F8MA 1Z7TA 5BN3A 2F0DA 4L63B 3HG9A 4DNTB 5FKAC 2EYPA 3KBGA 5JPMC 1TWAB 3VA5A 5FLXL 5DEHA 3FEWX 1GXDC 1YNJD 2D9UA 3OMGA 2BCOA 5DNFA 1L0XB 4FF4A 1Q1BA 1B2TA 1PFBA 5C3WA 5T1GA 5JEAG 3U9OA 1ENCA 4A3JB 4C1NI 5C0XJ 1TQOA 3X3NA 3U9SA 4LMQD 4C3HG 2KJXA 5C0XH 5J39A 2JEAI 2F4IA 4PMBA 3SE0A 2J0TD 5IT9E 3SK6A 1HTPA 1TIID 1IYVA 1BF4A 3H94A 3OWFA 4FNFA 3PUXA 4O1NA 2K32A 2EYHA 5IGDA 1XYIA 1X32A 5IGEA 1QE6A 2EJGC 2EE1A 3HOVB 1G91A 4K8JA 1V8QA 2BE5D 3S2HB 1O7ZA 3OOCA 3CRLC 1SNOA 2LFNA 1JC7A 1SMYC 2XN9C 1ML0D 4N9PA 2SEBD 3A8IE 3OWEB 2M2LA 2J4XA 4CBVA 1LTTD 2B2WA 4G7HC 1STEA 5E3FA 2ZT9C 4ZYSA 2IX3A 1EYDA 1ZYRD 3DMUA 2ICIA 4EGVA 1CA5A 1I4PA 1IKMA 1QCBD 4QUCA 5C3EB 1JR0D 3A56A 3PO2B 1PTOH 1EIGA 2A5HA 4OL7A 1MSGA 2ICEC 3KBXA 1FNVA 2HCCA 1O78A 1CI3M 5A2QL 1STAA 2JA8B 2A6ED 1F2ZA 1QNUA 2K5DA 5CGKA 1D1IA 4WRDA 2K05A 3KLSX 1A2UA 3CU7A 1SE3A 1I4QA 3A7LA 2K5WA 2B2TA 2CQAA 2EJMA 1KDCA 4F87A 2B39A 3EROA 3N6RA 1VDZA 3T56B 3NBIA 2K01A 1BXTA 2NVTB 2N88A 4AYBB 4TQUS 2HUGA 1BQQT 2QEJC 2X69A 5I9OA 1MGSA 3OSOA 3NK9A 3V2TA 1JOKA 4KD4A 4WORA 3NPPA 4LK1C 1SYGA 1IW7C 2Q8IB 1PLFA 4DK1A 1RTOA 2WV6D 4IFDI 1ZKOA 2EOTA 3FPPA 2IX0A 2IT1A 4M8AA 4KTAA 2E76C 4DGZA 1JCKB 1L0YB 5M5WB 1SAPA 1E2WA 3E6ZX 1G8ZD 3IL8A 2PCFB 4DFAA 1Q8IA 3D4RA 4RHRA 3J7YW 1QJOA 1VMPA 4BWGB 1UEAB 1TS2A 1H9SA 5I4DA 5FO7B 1GHJA 5ELCA 3OIPA 3QOLA 4ZK9B 1GUOA 2K03A 1U4RA 3MAQA 3KUPA 3P7JA 4TKOB 3MXGA 2NVXB 4A3IB 2BA1A 4IUVA 2E2IB 3S2DB 3IKJA 5D65A 1DZ1A 2L12A 3W3AA 5I6YA 3PIO3 1KABA 5CV5A 1RTNA 2WB1B 2QKIC 1EY4A 4E6IA 1E0BA 5DM63 1AZPA 5E4WC 4OHJA 1PZJD 5E1FA 1I4GA 5F2DA 1TY0A 3E5SA 1PFNA 1SNMA 1M4VA 2J7ZA 2AWOA 4L6TB 2KUMA 5FO8B 2FFKB 3NWSA 5CV6A 4FF3A 3S14B 1H9SB 3J7AF 3NWTA 3QWNA 1G291 2B2UA 2NUCA 3HOZB 2QF7A 4KY5A 3J80L 1S5DD 1OXUA 3Q23A 1S5FD 2Q8RE 5CORA 3D3RA 3FRPB 1A15A 1EEFD 1SNCA 3BG3A 4RGMA 3J81L 4XYOA 2A69C 2EJFC 2PMZB 2SNMA 5M3FB 3SDZA 2AUKA 1PTOD 3EQLC 3VYSA 2I07B 3T16A 1IHZA 1H9RA 2IX1A 3OMCA 5KNBA 4IFDG 4K6LA 4A3GB 4QMGA 2AQ1B 1GHKA 4DF7A 2F0NA 5C5LA 1EZ8A 2M00A 1EU4A 3HGBA 3V05A 1UUPA 4HN7A 5CR3A 3D6WA 4FF1A 4NP5A 3NQIA 4UDUC 1BOSA 5IGBA 1LT4D 3A54A 1PTOF 1B9MA 2L55A 3I73A 1SJED 1NUCA 5D3DA 2IWHA 2VB2X 3A8KE 5EJWA 1QWYA 5C4HA 3NE5B 4RWSC 1LTSD 2Z4HA 1A3TA 2JA6B 1J8IA 3H6MA 5CV9A 4O42A 5KEEA 1A2TA 4ZQ3A 2F1MA 3BS1A 1V43A 4ZUIA 2EPBA 4NW2A 3KF8A 2CW0C 3SK4A 3JAML 4BA1I 4HMJA 3HS0C 1RCVD 4CKBA 1OXVA 4MN3A 4ZUJA 3TDQA 1LT5D 3DWPA 3I70A 4I7ZC 4CGYB 2B2WC 3R8BA 2JA5B 1F2MA 4A3MB 1EOTA 1A3UA 1C48A 4J1MA 5COYA 5BN5A 4RHSA 5EBDA 2EDGA 2YU9B 1TWGB 1O7YA 4XTCS 5EGTA 3MXPA 2F0PA 3LNNA 2A68D 1LTBD 3ND9A 4V190 1MI2A 1R4PB 2FMCA 1EZ6A 3TZDA 1D2BA 2EVBA 1KLGD 2WACA 2DY7A 5EKIA 3NTHA 5CBAE 3P20A 1STHA 1HQMC 3GTQB 4XT1B 4XXEA 4FF2A 5FOBB 2O5IC 3JAME 1U9RA 3R2IA 2B2TC 4FYDA 1JQYD 1DD2A 1EWHA 4RAUC 2F0OA 2MP1A 1U4LA 4DAYA 5IOCA 2A73B 1HFGA 4HCSA 1PYWD 3RD4A 3LX0A 5E4XA 4TSSA 3BVGA 1PZID 1ICWA 2A74C 3ONAB 5JOBA 5BN4A 4RA8A 3HOWB 3S17B 1I3QB 3VYTA 5K36G 3VYRA 4CJ2C 1NR2A 1YNNC 4H0LC 2F0MA 4OO1G 1JOQA 2RA4A 5IT9L 5J22A 3FPUB 2EY2A 2F0FA 4H7BA 2E75C 1JOOA 2Z8LA 1PRTD 5K5PA 1S5ED 3TP6A 3SVMA 2PW7A 1B9NA 3S1NB 1VF7A 1FNUA 5CC4A 3CHBD 3DHQA 1VF5C 4KJOA 2C5CA 3RUZA 4HSVA 1ILQA 1GUGA 2R92B 1FNWA 2JEBI 3E0JA 2TMPA 5IGCA 3R2TA 1QNKA 5JEAJ 4PMCA 1CQFA 5EPKA 3F2UA 2F0WA 1BCPD 1PRTF 5EKLA 2V4DA 5JEAH 3DM1A 2F0VA 3Q24A 5C6AA 1PTOB 4IUNA 1EQVA 2G9DA 3LWUA 4Q5VA 2E2DC 1BUVT 1F77A 2AQ3B 1ET6A 3QG1A 2NVYB 4G57A 5EPJA 2EY5A 3D6CA 1BCPF 4H44C 3VR5A 2KEDA 1STNA 1D6EC 2CHBD 5C4ZA 1D5ZC 4RGTA 1F9QA 3TMEA 1ENFA 4TRDA 1LLRD 2WP8J 3SK8A 1DJRD 1KNAA 1DOKA 4S3SA 2SNSA 3VR3A 1B4OA 5M5XB 2JE6I 1STYA 2B2UC 2NWGA 1R4QB 1K8MA 1WD0A 1RHPA 1PFMA 2HQEA 2A6EC 1QG7A 2GA4B 2Y0SB 1KDBA 5C4JB 2B2VA 2R6GA 4KKUA 2NB0A 5JJZA 2JA7B 1V1OA 2KECA 2KHSA 3MC0B 3K0YA 4PV1C 4QF4A 1UNSA 2ZXRA 4IN3A 3SEBA 3IFTA 4G7OC 2ENBA 3GTLB 1CT1D 2DNEA 3L3OC 4QUFA 2A6HC 2XRSD 2F0TA 3C3LA 1GUWA 5JVG3 5KGUA 1CK1A 3G6JB 1M8AA 2F3VA 1CHPD 3GTGB 3RMHA 2ID0A 1GUNA 3DWAA 3WDNA 1EQTA 2WAQB 3MZ5A 1SMYD 1HUNA 1O7LA 3NSWA 5I9PA 1CA6A 1CZWA 1AEXA 3KLRA 3NBHA 4CHTB 1SYFA 2O2LD 3NTIA 4GZYC 1FD7D 1HUMA 3RZDB 4XQQA 5JPNC 1D5MC 5ELBA 1K83B 4YIJA 1VMCA 1I4XA 4KI0A 4NKLA 2PZWA 1B44D 1PDQA 1HPCA 1II3A 1EL0A 4A3EB 2B8GA 1Y8PB 3MHBA 1KDAA 1A3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY6 A;  2F0Q A;  1EYC A;  2F0E A;  2EYM A;  2F0I A;  1SYE A;  3HEJ A;  4B9X A;  5IGC A;  2EXZ A;  4EQO A;  4QMG A;  5KYL A;  2KHS A;  3NQT A;  2PQE A;  4DF7 A;  1TQO A;  2F0N A;  4PMC A;  5EGT A;  2EYL A;  3MXP A;  2F0P A;  1EZ8 A;  1STA A;  2M00 A;  1EY9 A;  2F0W A;  3D8G A;  3QOL A;  2SOB A;  4ID6 A;  4RKL A;  4QF4 A;  5DAU A;  3SXH A;  2PZU A;  1F2Z A;  5CR3 A;  3SR1 A;  1SNQ A;  2EYF A;  2F0L A;  5CGK A;  5KIX A;  5EKL A;  3TP8 A;  4K5V A;  4NP5 A;  4WRD A;  4DU9 A;  1EZ6 A;  5J39 A;  5CV7 A;  5IGB A;  2ENB A;  2EY1 A;  2F0V A;  4K5W A;  1A2U A;  4PMB A;  3EVQ A;  5EKK A;  5C5L A;  5IIF A;  5CV8 A;  4PNY A;  2OEO A;  2RBM A;  5C6A A;  2WAC A;  5HUR A;  3SK6 A;  1NUC A;  4IUN A;  3P75 A;  1STH A;  3OMC A;  2F0S A;  1EQV A;  2F0T A;  3BDC A;  3QOJ A;  4J6H A;  1TR5 A;  2EYJ A;  2F0K A;  2F0J A;  1KDC A;  1SND A;  2F0G A;  4IAL A;  1F2Y A;  4KD3 A;  5JAV A;  4R8N A;  3ERO A;  3OWF A;  4K14 A;  3SHL A;  4EQP A;  5KGU A;  4K6D A;  3BDL A;  2O4X A;  4KV6 A;  5C4H A;  5M9O A;  1U9R A;  5I6Y A;  1A3T A;  1KAB A;  2EYH A;  4I65 A;  1STB A;  3C1E A;  4G57 A;  5CV5 A;  2EY5 A;  2F3V A;  3D6C A;  3NUC A;  4K5X A;  1EY4 A;  5IGD A;  4E6I A;  3ITP A;  5IGE A;  1EYA A;  2EY6 A;  2F0O A;  3H6M A;  5CV9 A;  1SYC A;  5I6W A;  5IOC A;  5KYI A;  3ERQ A;  5KEE A;  3MVV A;  2PW5 A;  1A2T A;  3S9W A;  3LX0 A;  1EY8 A;  1STN A;  4KY7 A;  5E1F A;  4K8J A;  4ZQ3 A;  3TP5 A;  1STG A;  3MZ5 A;  3PMF A;  5F2D A;  5J1Z A;  5C4Z A;  3NHH A;  3QB3 A;  5I9O A;  2OXP A;  3D4W A;  3OSO A;  1SNO A;  3E5S A;  5CV4 A;  3TME A;  4TRD A;  1SYB A;  3NK9 A;  3V2T A;  4ZUI A;  1JOK A;  2EYO A;  4KD4 A;  4RKB A;  5JOB A;  1SNM A;  3SK4 A;  5I9P A;  1ENA A;  4NDX A;  4WOR A;  4MIU A;  4N9P A;  2F0H A;  3P1H A;  4QB4 A;  4B9W A;  2PZT A;  3SK8 A;  1AEX A;  2OF1 A;  4HMJ A;  4IZ8 A;  1SYG A;  4HMI A;  2QDB A;  5IGG A;  3MEH A;  5CV6 A;  1EY5 A;  4F7X A;  4ODG A;  3NXW A;  1RKN A;  4LAA A;  4S3S A;  3T13 A;  2NUC A;  5IGF A;  4F8M A;  4KHV A;  2SNS A;  3SK5 A;  2F0M A;  2F0D A;  4ME5 A;  4ZUJ A;  1JOR A;  5C3X A;  4KY5 A;  4KY6 A;  1SYF A;  5C5M A;  2PYK A;  1JOQ A;  4KJN A;  3C1F A;  4KTA A;  4HTH A;  2EYP A;  1STY A;  4K2L A;  1SYD A;  5E3F A;  4DGZ A;  3VA5 A;  2KQ3 A;  3R3O A;  5J22 A;  5DEH A;  1EYD A;  3DMU A;  2EY2 A;  2F0F A;  1EY7 A;  4H7B A;  5IOD A;  1JOO A;  2F3W A;  3D4D A;  1NSN S;  3OMG A;  1EY0 A;  1F2M A;  2F0U A;  2RDF A;  5K5P A;  2HQE A;  1SNC A;  4YIJ A;  1A3U A;  3TP6 A;  2PW7 A;  4J1M A;  4K8I A;  4N9T A;  2LKV A;  3HZX A;  4DFA A;  4NKL A;  2SNM A;  2PZW A;  4EQN A;  5CC4 A;  3TP7 A;  5HGT A;  5C3W A;  3DHQ A;  1KDB A;  1TT2 A;  5NUC A;  3T16 A;  2RKS A;  5KRU A;  3U9O A;  1IHZ A;  3EJI A;  4K2K A;  4KJO A;  1II3 A;  4NMZ A;  1SNP A;  5ISR A;  4OL7 A;  3RUZ A;  3MHB A;  4EVO A;  3NP8 A;  1KAA A;  1KDA A;  1A3V A;  1ENC A; 
#chains in the Genus database with same CATH topology
 4KKS A;  2F0I A;  2DUD A;  2YTY A;  2RQX A;  1SE8 A;  1I94 L;  2EQS A;  1C9O A;  2R7D A;  1B8A A;  2D0P A;  3I8Z A;  3BDO A;  2PZU A;  1WFQ A;  1WTX A;  5IYC H;  3SR1 A;  3TP8 A;  3CCU A;  2KOL A;  4BY7 H;  4X3T A;  3L2P A;  1F9P A;  1QZH A;  3UDG A;  1KRT A;  4IUP A;  1YJW A;  1HH2 P;  4BXX H;  2FMM A;  5G3L D;  2B2Y C;  5EPL A;  4B3S Q;  5EQ0 A;  3QOJ A;  2EYJ A;  1SND A;  2F0J A;  4FXG C;  3GQB A;  4OGQ C;  5C3E G;  3UDI A;  4GLX A;  3PO2 G;  3L7Z C;  1VQ8 A;  3NTK A;  4DUY L;  3AEV A;  3MXU A;  1KNE A;  4JI7 Q;  1PH2 A;  3F2D A;  4H13 C;  1YBY A;  5JJI A;  3NEM A;  3I4M B;  3MVV A;  1WVL A;  1HQR D;  3TP5 A;  2JA8 G;  1TVX A;  2UU9 L;  2KEE A;  2OTJ A;  3PIP 3;  3G48 A;  4CJ1 B;  1I50 H;  2B63 H;  1SJH D;  4C3J H;  2TSS A;  5G3L F;  2MO1 A;  1IW7 D;  2I0Q A;  2PZT A;  3H91 A;  2DN8 A;  3GV6 A;  4A3B H;  1FR3 A;  2WAQ G;  3MFG A;  2AKW B;  1B7Y B;  1EUJ A;  1PTO C;  4KHV A;  2MPM A;  2VUM B;  3S16 B;  3RZO B;  4B08 A;  1KD1 C;  1X6O A;  4DUZ Q;  1SYD A;  2E2J B;  2UUC L;  5ELF A;  3X3M A;  4HJ7 A;  3A55 A;  3VDY A;  3OPO A;  3VR2 A;  3AU7 A;  1L0W A;  3CXC A;  2JSO A;  4BBR B;  1IYU A;  5EBC A;  3CMA A;  3D31 A;  2RF4 A;  1CKN B;  2K75 A;  4RCO A;  3C46 A;  3HZX A;  3GTO H;  4DKA C;  4NB3 A;  2P5Z X;  1NCV A;  3TP7 A;  4DAM A;  3K5L A;  1Q86 C;  3W2D A;  2EIF A;  3FKI B;  2NYZ D;  3CC2 A;  4YWL A;  3J7A V;  1SNP A;  1WCM B;  4RFB A;  4F88 A;  3M4O B;  1IL8 A;  3A0J A;  1HR0 Q;  3I4N H;  2LSS A;  2RSO A;  4DK3 C;  4EQO A;  5KYL A;  1K3B C;  1Z9F A;  2VZA A;  4FXD A;  3CQZ H;  4IUQ A;  3SGI A;  3BYY B;  1BKB A;  3QIA A;  4IUU A;  4A3E G;  4C3I B;  3PUV A;  1NR4 A;  2N55 A;  3K57 A;  4IFD J;  3DUZ A;  5JVH 3;  3EN2 A;  5AFW A;  3M4Y A;  1K3R A;  1LTI D;  4OIK A;  2CWP A;  4B3S L;  4BA2 I;  2B29 A;  1S3O A;  2KCM A;  2HDL A;  3T1Y Q;  2RBM A;  2XSC A;  2K7V A;  4IFD H;  2E2H B;  2F0S A;  1GVP A;  4X6A H;  3I2Z A;  1DON A;  1LV9 A;  4YCV A;  4UP7 A;  5TSS A;  3SHL A;  1EQR A;  1R9T H;  4EQP A;  1NNX A;  1DM0 B;  1DOM A;  2R93 B;  3QO2 A;  1CTM A;  1LO5 D;  3KK7 A;  3ITP A;  1PH1 A;  2DY8 A;  4JI5 Q;  4JBW A;  3GP7 A;  4V0B A;  2XNA C;  1AW7 A;  2XVS A;  2PW5 A;  2WII B;  1X3P A;  1Q3L A;  1VCI A;  1HTL D;  2NN6 I;  1I4R A;  3D4W A;  1QUQ A;  2LS0 1;  2UXD Q;  4YCW A;  4L5T A;  4HR7 B;  2IW3 A;  2NTS A;  1DCZ A;  1HZC A;  3WWV A;  3A5U A;  1WI5 A;  2FHT A;  4P2C B;  4QB4 A;  3S1M H;  4OEL B;  3GTM H;  3F1Z A;  4A3I G;  3T4A C;  4DUZ L;  1ILP A;  3PUY A;  3MEF A;  4OO1 I;  1PXU A;  3PCO B;  3IRB A;  4QGU A;  5A35 A;  5ELO A;  2PNR C;  3VR4 A;  2NVQ B;  2QGQ A;  2KBN A;  3GTK B;  3R3O A;  4HJ5 A;  2A69 D;  2F3W A;  2F0U A;  2RDF A;  4IJH A;  3PQI A;  1LTR D;  2VUM G;  1K8G A;  5HGT A;  3GV3 A;  1JB3 A;  5M3M B;  3HOY H;  1F9S A;  4XIG S;  4NPS A;  4N8X 1;  1CM9 A;  4RCN A;  1W6J A;  3I55 A;  4C2M B;  4EVO A;  1X55 A;  3G7L A;  1KLU D;  2B2V C;  1N33 L;  4R4T A;  1A6X A;  3STB D;  5M5Y H;  4RKL A;  2SOB A;  4RH6 A;  4GN5 A;  4JYA L;  3HOZ G;  4OXP A;  3T1H Q;  3E9H A;  4J15 A;  4XT3 B;  3T1Y L;  4K5V A;  2R7F A;  3S1R H;  4Y7N B;  2K52 A;  1LTA D;  1QUQ B;  2EY1 A;  5C44 B;  1HNZ L;  4NXN Q;  4B3M L;  4PNY A;  3MFY A;  3CCQ A;  5FO9 B;  1BO0 A;  4KN7 C;  4C3I G;  5ELE A;  2R7Z H;  4ULL A;  4DXF A;  3BZK A;  5M3F G;  4GN3 B;  1ZXT A;  4JI5 L;  1BBW A;  4KV6 A;  2O4X A;  3TN2 A;  4LF7 Q;  4CDC C;  5M9O A;  1WTW A;  2L1B A;  1K8O A;  4IQZ A;  2LXK A;  1G2T A;  3LGJ A;  3C1E A;  1TWC B;  1EEI D;  2WFW A;  2UXD L;  4A3G G;  3KFU A;  2B2Y A;  2Z1C A;  1WTO A;  1X56 A;  5J1Z A;  3QB3 A;  1JWS D;  3M7G A;  2CW0 D;  5IWA Q;  1CFM A;  3I4O A;  5ELD A;  1RDP D;  2X6L A;  1ENA A;  3M85 A;  2OCE A;  3P1H A;  1NY4 A;  4R1J A;  2K1B A;  3J7A 5;  2FIN B;  4HMI A;  2QDB A;  1I6H B;  3ZYY X;  2CH4 A;  1YI2 A;  1RKN A;  4AH6 A;  1ET9 A;  3PGZ A;  1TS3 A;  2D62 A;  1SSO A;  4CKC A;  3PF4 A;  2Q8T A;  5FLM H;  4ME5 A;  1JOR A;  4C3H B;  3K7A H;  3K6O A;  4KY6 A;  1D1K A;  4DR7 Q;  5C5M A;  2PYK A;  4HTH A;  4AYB E;  4DR3 Q;  4K2L A;  4DV7 Q;  2NZH A;  1I4H A;  1JWU D;  3M3Y H;  4GNX A;  1EY7 A;  2NN6 G;  3WOF A;  5IOD A;  2JA6 G;  4GKK Q;  1HNW L;  2A8V A;  4LF6 Q;  4KHP L;  1YNJ C;  1OO9 B;  4A3K H;  4A4I A;  3TZU A;  2VQF L;  1XMQ Q;  4EQN A;  2AWN A;  2MO0 A;  4LJZ C;  5K36 H;  2XWB B;  4WFN 3;  5ISR A;  4A3L G;  4X3S A;  5JJK A;  1YHA A;  1F2L A;  1PH8 A;  3EIV A;  1VQK A;  3GTJ B;  4OO1 H;  2F0E A;  2K5V A;  4HAE A;  3T1H L;  3HOU B;  2KA7 A;  4A93 B;  2PQE A;  1TWH H;  3BVM A;  5M3M G;  1EWC A;  1EY9 A;  3GTP H;  1TWF B;  3S15 B;  1PYB A;  1B1Z A;  2ZTC A;  4Y7N H;  1Y1V H;  1TS4 A;  2F0L A;  4A75 A;  5IYB G;  1I5F A;  3AMU A;  4JI2 Q;  1LTG D;  1SN8 A;  4A3M G;  3O13 A;  4LF7 L;  2OT2 A;  1B50 A;  2L9H A;  1MHW C;  3DWQ A;  1LT6 D;  2KVM A;  4X64 Q;  5EAY A;  4OIJ A;  4UAI A;  3PO3 H;  2LY7 A;  1N8R C;  1Y1W B;  1ROD A;  1X3Q A;  3ZJY C;  1E22 A;  1X3G A;  3EA6 A;  2HIX A;  1STB A;  4DAV A;  1MJE A;  3S1Q B;  1GUS A;  2EY6 A;  5KNC A;  5IWA L;  4K0K Q;  4Y52 H;  1E2V A;  3MA2 B;  5H1S E;  1EY8 A;  5CMD A;  1ONL A;  3V96 A;  1VQP A;  2H4O A;  1A8V A;  1VQB A;  4HIM A;  2BE5 C;  4QQB X;  1AP0 A;  2EZV A;  1PMR A;  2RDG A;  4YWM A;  1BDO A;  4JOI A;  1AH9 A;  4QIW B;  4ZAI A;  4DR7 L;  3MEH A;  5LMN W;  2JN4 A;  1YNN D;  3QJY A;  1N36 Q;  5I2X A;  3NXW A;  2BOS A;  4DR3 L;  4FVM A;  1S5B D;  2L0C A;  4HJA A;  4DV7 L;  2WB1 E;  4GKK L;  4L5R C;  1WTH A;  5C4X B;  1SEB D;  1QIL A;  5LMN Q;  1PZK D;  1WD1 A;  1SMX A;  2IPK D;  4DV5 Q;  4EQ5 A;  4POF A;  4KMU C;  1XMQ L;  3MWY W;  1JMC A;  5FLX c;  3I3C A;  5GRO A;  1ZYR C;  4P71 A;  2K5H A;  2MUY A;  4N9T A;  1TS5 A;  4DR2 Q;  3GO5 A;  5C0X G;  3AB9 A;  2K04 A;  3A5Z B;  3EJI A;  4LF8 L;  3Q22 A;  2GVB A;  1T5E A;  4BY1 H;  4QCL A;  4RGN A;  3DEO A;  3TQY A;  1EY6 A;  4A3F H;  2EYM A;  3HEJ A;  2HIV A;  3HOW G;  2KCC A;  3AQQ A;  3KLS A;  4DAP A;  2NTT A;  4ID6 A;  3SXH A;  1Y69 U;  1AZQ A;  4JI2 L;  5LHY 1;  3K5M A;  4G4K A;  4PQX A;  3CCV A;  4WJ3 M;  1YNX A;  2EYF A;  4FO2 A;  5KIX A;  1SFO H;  3KF6 A;  4JK1 C;  2PMZ E;  2NBF A;  4XQJ A;  3HOU G;  5CV7 A;  1FYC A;  4X62 Q;  1XTD A;  1MBY A;  1XX8 A;  4HIK A;  1A62 A;  4JI1 Q;  5HUR A;  5FLX E;  1FGU A;  2K5N A;  2K28 A;  4LF9 Q;  3BDC A;  4J6H A;  5CBE E;  2R3Z A;  3HOX B;  2WKC A;  2ZJP A;  4BBS H;  3I72 A;  3CKI B;  1YIJ A;  4QJF A;  2L11 A;  1GD7 A;  4R8I A;  2JP1 A;  4K5X A;  1EIF A;  2K5Q A;  2RCF A;  3HP3 A;  5GQO A;  3VA7 A;  3ERS X;  1TWA H;  5KYI A;  1K0S A;  1VQC A;  3R93 A;  1K28 A;  1BVS A;  3K5O A;  4BY7 B;  2Z0S A;  3PMF A;  1Y1W G;  2I5L X;  2KHI A;  1B3Q A;  1BR9 A;  1Q1E A;  2OXP A;  4JI8 Q;  4JV5 L;  3TS0 A;  2XGT A;  1KTK A;  3Q6S A;  1GUT A;  4CKE A;  1BBX C;  3ICE A;  4C1N K;  1K9M C;  2OF1 A;  1IBK Q;  1V1P A;  1SE2 A;  4F7X A;  5LMN L;  2E74 C;  2L5T A;  1CZG A;  4LAA A;  4GOP A;  4A3J H;  4WJW A;  2ZM6 L;  4ZKC B;  3PIO A;  1DXM A;  1YIT A;  2C9O A;  2MHV A;  2HDM A;  4R4O A;  3OTO Q;  1HNX Q;  2RVL A;  3HRZ C;  3VYU A;  2M9V A;  1H9J A;  1UEB A;  2PO4 A;  2NZ1 D;  5BR8 Q;  2CFM A;  1S5C D;  4DNR B;  4AIM A;  1VQN A;  2LKV A;  2WIN B;  1HXY D;  2MJ8 A;  1I50 B;  1I6V C;  4KK7 A;  2B63 B;  4C3J B;  3U50 C;  5NUC A;  4P74 A;  2I46 A;  4HCE A;  1EFW A;  1OXX K;  4A3B B;  2N49 A;  2D5D A;  1KAA A;  1PHJ A;  2F0Q A;  1EYC A;  5DM7 3;  3KJO A;  3F2C A;  4DV0 Q;  1AFP A;  4C56 C;  5GAD C;  4DK0 A;  4X62 L;  3DM3 A;  5IP7 G;  1K8A C;  3HOV H;  1ICF B;  2VXW A;  3CD6 A;  3K0X A;  4U68 A;  4LF9 L;  4J8Q A;  3S2H H;  3GTO B;  2KCN A;  4XYQ A;  4KN4 C;  2H5X A;  2A6H D;  4IPD A;  1S4Z A;  2Q2T A;  4ABN A;  1SRU A;  1CQV A;  1HHV A;  3P75 A;  3G71 A;  1SDF A;  1Y8O B;  1XNR Q;  1V1P B;  3T13 A;  3K81 C;  4IAL A;  2EXD A;  3PUZ A;  4CDD C;  3OW7 A;  2Y0S G;  3I4N B;  4R8N A;  4GOP B;  2A19 A;  1PH9 A;  2ASB A;  3URY A;  2YYZ A;  1ESF A;  4HSP A;  4PZ7 A;  4I65 A;  1LM0 A;  3K59 A;  3CQZ B;  1P8L A;  4JI8 L;  3DEP A;  1CKN A;  2JA7 G;  1PRT B;  3ERQ A;  1LAC A;  3S9W A;  4DR6 Q;  3OIQ A;  3FHW A;  4KY7 A;  5KRU A;  2D2C C;  3H3V C;  1Q90 A;  3NHH A;  3IFD A;  2BA0 A;  5A2Q E;  4UP8 A;  4RKB A;  1VQL A;  1XJV A;  2F0H A;  4B9W A;  1J9O A;  1AN8 A;  5C3E H;  3PO2 H;  3BYT B;  4MTK A;  3K58 A;  2ZXP A;  4ILW A;  4IOC A;  1HNX L;  1U4M A;  1R9T B;  4P73 A;  2OTL A;  1FGB D;  1U4P A;  2I5M X;  1JIC A;  3HKZ B;  1VQ9 A;  5GAE C;  2HQL A;  1BCP B;  1KHI A;  5IY0 A;  5T1I A;  4PMW A;  2UXC Q;  2AUJ D;  1Q46 A;  2JA8 H;  3CRK C;  3RLF A;  3BZD B;  1IBM Q;  3A7A B;  3KJP A;  3W1G A;  1O80 A;  3D4D A;  1NSN S;  2CCZ A;  4K8I A;  2G5D A;  2G9H D;  2HCI A;  3VR6 A;  4GNX C;  4LUO A;  3L9A X;  3UDF A;  1XNQ Q;  3S1M B;  3GTM B;  2JXM B;  1WTP A;  1LT3 D;  2ZTD A;  1E1O A;  2CVR A;  1YEZ A;  4DV0 L;  3NP8 A;  1O7I A;  4JI6 Q;  1BNZ A;  4B9X A;  2FJ2 A;  4C3J G;  4R4C A;  4U67 3;  2N3S A;  3BZC A;  5CV4 A;  3D8G A;  2QCP X;  5DAU A;  2NVT H;  2PI2 E;  2PPB C;  1SNQ A;  2L4N A;  4POG A;  1HR0 W;  3KDF B;  3OHX C;  1SXT A;  1G2S A;  1XNR L;  1JE4 A;  5D3I B;  1Y8N B;  3FDT A;  3HOY B;  4JC0 A;  2VY3 A;  2MGS A;  4IUT A;  1HA6 A;  1GJX A;  2GVA A;  1QOH A;  4KD3 A;  3U58 A;  3GD7 A;  3ND8 A;  3BDL A;  1LAB A;  1VQH A;  3BVZ A;  5M5Y B;  1WTV A;  1XTC D;  3NUC A;  2HD3 A;  4IPC A;  4RGO S;  3K8A A;  1TU2 B;  1EU3 A;  1TY2 A;  1ZEQ X;  3S1R B;  1N9W A;  5IE8 A;  5M5W H;  1MD2 D;  3T51 B;  2ZXO A;  2R61 A;  3FMC A;  4JI7 L;  3DXJ C;  3ULL A;  4X3U A;  4YY3 Q;  2R7Z B;  4IZ8 A;  2BDN A;  2VB3 X;  4JOI C;  1IBM L;  1RF2 D;  4DV6 Q;  4LFB Q;  2OQK A;  3SK5 A;  4IUR A;  3LWE A;  2Z6K C;  1NTG A;  1S72 A;  5D14 A;  1Z47 A;  3J80 c;  4KJN A;  2RSN A;  4DV3 Q;  4DV1 Q;  2KQ3 A;  1W2B A;  1MSH A;  3J80 i;  2XWJ B;  1G51 A;  3EFX D;  3PUW A;  1WTR A;  4FP5 D;  3HKZ G;  1D5X C;  2NVX H;  3J81 c;  4A3I H;  3I4M G;  5LL6 X;  4A3C G;  4JI6 L;  4DXG A;  4L8J A;  3J81 i;  3I7F A;  4JI3 Q;  1MIU A;  2E2I H;  4ZRZ A;  5FK9 C;  3S2D H;  2VNU D;  1C4Q A;  3TSS A;  4Q0F A;  5CYU A;  1EIH A;  4L5Q A;  1SYE A;  4JCV E;  4HJ9 A;  3K7A B;  3NQT A;  1VS0 A;  4M1U B;  4ZKB B;  4CJ0 B;  2YTV A;  3CPW A;  4JI4 Q;  2IL8 A;  1SLJ A;  3M3Y B;  2H1E A;  2A68 C;  1H9K A;  1HR0 L;  4DU9 A;  4A3K B;  2O5J C;  4KKT A;  4K5W A;  2JQO A;  4UY8 C;  3EVQ A;  2Y0S E;  1XXG A;  4HED A;  3J80 E;  1DYQ A;  4B3R Q;  1N32 Q;  1D7Q A;  1VQF A;  4BBR G;  1VQD A;  2N78 A;  2AQ2 B;  1Y14 B;  1JB7 A;  2XIW A;  3MXN A;  3K5N A;  1TR5 A;  2F0G A;  2F0K A;  3T53 B;  5JAV A;  3IAY A;  1SE4 A;  3KYH C;  4DN4 M;  2DNC A;  3S14 H;  3J81 E;  3FKI G;  1GO3 E;  4K14 A;  3G4S A;  4K6D A;  3HOZ H;  2PNH A;  1TWH B;  1WCM G;  1VQ7 A;  1W6K A;  3GTP B;  5LMU Q;  4Z9C B;  1T5X D;  2E8G A;  3FVQ A;  1Y1V B;  4QL5 A;  1Q8K A;  1Q82 C;  3Q0A A;  1STG A;  2Q2U A;  4YY3 L;  4R9W A;  4LF5 Q;  3PV0 A;  5KND A;  1SYB A;  2B8F A;  4PG3 A;  5M3F H;  1J6Q A;  1NE3 A;  4NDX A;  1B53 A;  4DV6 L;  2OQ0 A;  4MIU A;  4LFB L;  3UI2 A;  2JJQ A;  1F9R A;  3I90 A;  2JYO A;  3N52 A;  1JJC B;  3JAM c;  1C8C A;  1WTQ A;  3PO3 B;  1EFI D;  1EY5 A;  4FXK C;  4LUZ A;  4XQN A;  2WKD A;  4ODG A;  1IL2 A;  1JWM D;  1IYJ B;  3H09 A;  3JAM i;  3H0G B;  4O2D A;  4A3G H;  4IO9 A;  5C3X A;  2K33 A;  1ASY A;  4MHE A;  3C1F A;  1OXS C;  2YTX A;  4GOP C;  1G6Z A;  3I91 A;  2IJ0 A;  1Q12 A;  2R93 G;  2WAQ E;  4B3T Q;  1CSP A;  5IP9 G;  1OXT A;  4KHZ A;  1RD9 D;  1QZG A;  4ZLT F;  1EY0 A;  4X65 Q;  5C0X I;  1BBU A;  1L2F A;  4JI3 L;  1B3A A;  4G7Z C;  2Q2H A;  1PRT C;  3E3X A;  1RJT A;  1TT2 A;  1ASZ A;  2RKS A;  4LF4 Q;  1GOZ A;  4K2K A;  1VQM A;  4JPB W;  5E7N A;  4NMZ A;  3W5O A;  3MXN B;  2QIL A;  3RNU A;  3MTS A;  3KF8 B;  4DV4 Q;  1SBB B;  2BDO A;  1DOL A;  3M9B A;  2EXZ A;  2K6A A;  3CP0 A;  4O0A A;  2EYL A;  5IGG A;  1HRJ A;  1UAP A;  2NN6 H;  2JA6 H;  2Z4I A;  5J3B A;  2IHF A;  1QB5 D;  1N32 L;  1BCP C;  1Z6H A;  4GS3 A;  5LL6 S;  2LMC B;  4A3D B;  2DGY A;  5EKK A;  3RR5 A;  5IIF A;  1TKW B;  1HCZ A;  4A3L H;  4MNO A;  1H9M A;  1NAP A;  2OEO A;  1CHQ D;  4LFA Q;  3C2P A;  2SDF A;  4XDX A;  5CV8 A;  4BY1 B;  4AQY Q;  3E9I A;  1F2Y A;  1E2Z A;  4A3F B;  2F03 A;  4NXN L;  2X6G A;  2RDH A;  5IYB H;  3CCM A;  5I2Y A;  1IKL A;  1EYA A;  4H02 A;  4LF5 L;  1CKO A;  1SYC A;  4JBJ A;  5I6W A;  1S40 A;  1XWE A;  4DA2 A;  1SFO B;  1HZB A;  4JW0 A;  2JA5 H;  3JC6 6;  4A3M H;  1HA5 A;  3A8J E;  3I4L A;  2XRQ D;  2RHS B;  2EYO A;  2ZJR A;  3TBI B;  4BS9 A;  1EYG A;  4IPH A;  2CWA A;  2YU9 H;  1HFN A;  3M7N A;  5C44 G;  4IOA A;  1TWG H;  3H0G H;  1ESR A;  1FL0 A;  3H15 A;  4OX9 Q;  4X3K A;  4YHH Q;  1UE1 A;  3WOE A;  3FP9 A;  4P72 A;  5IGF A;  4F8M A;  4BBS B;  1Z7T A;  5BN3 A;  1A63 A;  2F0D A;  4L63 B;  4B3T L;  3HG9 A;  4DNT B;  5FKA C;  4ME3 A;  2EYP A;  3KBG A;  5JPM C;  1TWA B;  3VA5 A;  5IT9 c;  5FLX L;  5DEH A;  3FEW X;  3PO3 G;  1GXD C;  1YNJ D;  2D9U A;  3OMG A;  4LF4 L;  2BCO A;  5DNF A;  1L0X B;  4DAY B;  1J5E Q;  2Z6B A;  4FF4 A;  1Q1B A;  2Z6K A;  1B2T A;  1PFB A;  5C3W A;  1CUK A;  3W1B A;  5T1G A;  5JEA G;  3U9O A;  4UP9 A;  3GTQ H;  1X65 A;  5AJ3 Q;  1NJI C;  1ENC A;  3I56 A;  4LF6 L;  4A3J B;  4C1N I;  1PH3 A;  4JBM A;  5C0X J;  2DJG C;  3U4V A;  1TQO A;  3HFZ B;  4R4I A;  3X3N A;  3U9S A;  1X54 A;  4LMQ D;  4A3D H;  1MJC A;  4C3H G;  1PH5 A;  2KJX A;  5C0X H;  4LFA L;  3F2B A;  1KC8 C;  5J39 A;  2JEA I;  1KRS A;  2HT1 A;  2F4I A;  4LWC A;  4PMB A;  3SE0 A;  2IY5 B;  1KL9 A;  2J0T D;  5IYD G;  5IT9 E;  3SK6 A;  1HTP A;  1TII D;  1QVG A;  3HOW H;  3S17 H;  1IYV A;  4DR5 Q;  2BH8 A;  1I3Q H;  4IJL A;  3CPF A;  4DNI A;  1BF4 A;  3H94 A;  3OWF A;  4FNF A;  4X66 Q;  3PUX A;  4O1N A;  4MZ9 A;  2K32 A;  2EYH A;  1IXR A;  5IGD A;  1XYI A;  1X32 A;  1M90 C;  5IGE A;  1QE6 A;  2EJG C;  2EE1 A;  3HOV B;  4WJ4 A;  1G91 A;  4GKJ Q;  4BY1 G;  4A93 G;  4X64 L;  4K8J A;  1U0L A;  1V8Q A;  1QVF A;  2BE5 D;  3S2H B;  1O7Z A;  3OOC A;  3CRL C;  1SNO A;  2LFN A;  3S1N H;  1JC7 A;  4OX9 L;  1SMY C;  1HJP A;  1VQA A;  4DR4 Q;  2XN9 C;  1XMO Q;  5JJL A;  1ML0 D;  4N9P A;  4K0K L;  1SRO A;  2SEB D;  3A8I E;  3OWE B;  2M2L A;  2J4X A;  2R92 H;  3PSI A;  1XPO A;  4CBV A;  1LTT D;  2D0O A;  2B2W A;  2VQE Q;  2QW7 A;  4G7H C;  1OTC A;  1STE A;  5E3F A;  2ZT9 C;  4ZYS A;  2IX3 A;  1EYD A;  1ZYR D;  3DMU A;  2ICI A;  4EGV A;  1N36 L;  1CA5 A;  1IBL Q;  1I4P A;  2JK8 A;  2CH4 W;  3PIP A;  3UDX A;  3NEN A;  4R4Q A;  1IKM A;  1QCB D;  5AJ3 L;  2RHQ B;  2Z9H A;  4QUC A;  5C3E B;  1JR0 D;  1MKH A;  1UE5 A;  3A56 A;  4DV5 L;  3PO2 B;  1PTO H;  1VQJ A;  1EIG A;  2A5H A;  4OL7 A;  1MSG A;  2ICE C;  3KBX A;  3QR8 A;  4DR2 L;  3CW2 C;  1FNV A;  2HCC A;  1O78 A;  1CI3 M;  5A2Q L;  1STA A;  2NVY H;  2A6E D;  2JA8 B;  1F2Z A;  3RLO A;  1QNU A;  2K5D A;  4NXM Q;  5CGK A;  1YHQ A;  1D1I A;  4WRD A;  5C4X G;  4A3J G;  2KCT A;  3TEH B;  2K05 A;  1G6P A;  4QY7 A;  3KLS X;  1A2U A;  4DUY Q;  1WJJ A;  4DR5 L;  4GLV B;  3CU7 A;  4X66 L;  1SE3 A;  1I4Q A;  3CF5 A;  3A7L A;  2K5W A;  2B2T A;  1VQ5 A;  1EOV A;  2CQA A;  1K0R A;  2EJM A;  1KDC A;  4F87 A;  2B39 A;  2UU9 Q;  3ERO A;  3N6R A;  1VDZ A;  1EQQ A;  3CC4 A;  2PQA B;  3T56 B;  3NBI A;  2K01 A;  1BXT A;  5M5X H;  4JI1 L;  1L1O A;  1NBW A;  2NVT B;  4DK6 C;  2N88 A;  4AYB B;  4TQU S;  4DR4 L;  2HUG A;  4TVA B;  1XMO L;  1BQQ T;  2QEJ C;  2X69 A;  5I9O A;  1MGS A;  3OSO A;  1FJG Q;  3D0F A;  1IZ6 A;  3NK9 A;  3V2T A;  3G6E A;  1JOK A;  4KD4 A;  1PFS A;  4WOR A;  5C4J H;  2QEX A;  4KLK A;  1LUZ A;  3NPP A;  4LK1 C;  1SYG A;  1IW7 C;  4HJ8 A;  2Q8I B;  2ZTE A;  1PLF A;  5FJ8 G;  2E5L Q;  1RTO A;  2WV6 D;  4DK1 A;  4IFD I;  1ZKO A;  2EOT A;  3FPP A;  2JA7 H;  4RG1 A;  2IX0 A;  2IT1 A;  3KOJ A;  3HOX G;  4M8A A;  4KTA A;  1IBL L;  2E76 C;  3KDF A;  4DGZ A;  1B70 B;  3UE0 A;  1JCK B;  1L0Y B;  1IBK L;  5M5W B;  1SAP A;  1E2W A;  3E6Z X;  1G8Z D;  2MQH A;  3IL8 A;  5IYC G;  2PCF B;  4DFA A;  3GTL H;  1Q8I A;  3D4R A;  4RHR A;  4BY7 G;  3OTO L;  3CAM A;  3J7Y W;  1HZA A;  4A76 A;  1QJO A;  2NZO A;  1VMP A;  4BWG B;  1UEA B;  1TS2 A;  1H9S A;  5I4D A;  5BR8 L;  4BXX G;  1WOC A;  4NXM L;  3HKS A;  1GHJ A;  5FO7 B;  3TRZ A;  5ELC A;  1GKH A;  3OIP A;  3QOL A;  1L1O B;  4ZK9 B;  3GTG H;  1GUO A;  2K03 A;  1EWI A;  1U4R A;  4LW1 A;  3MAQ A;  3NBH B;  3KUP A;  3P7J A;  4OWT B;  1LYL A;  4TKO B;  3MXG A;  2NVX B;  1CKM A;  3NEL A;  4A3I B;  2I5H A;  2BA1 A;  1NMF A;  4JBK A;  4IUV A;  3TRE A;  2ES2 A;  2E2I B;  1VQ6 A;  3S2D B;  2QA4 A;  3IKJ A;  2B63 G;  5D65 A;  1DZ1 A;  2L12 A;  4OEM B;  4PZ6 A;  3W3A A;  1VQG A;  1AE2 A;  5I6Y A;  3PIO 3;  1KAB A;  4HID A;  4LFC Q;  4A3B G;  5CV5 A;  1RTN A;  2WB1 B;  4JI0 Q;  2QKI C;  1EY4 A;  4E6I A;  1FJG L;  1E0B A;  5DM6 3;  2F4V Q;  1KXL A;  1AZP A;  5E4W C;  4OHJ A;  1PZJ D;  1WYD A;  5E1F A;  1I4G A;  5F2D A;  3RZD H;  2QDL A;  1NMG A;  1TY0 A;  1K83 H;  3E5S A;  4OWW B;  1PFN A;  3CME A;  3M4P A;  1SNM A;  2ALY B;  2E5L L;  1M4V A;  2J7Z A;  2AWO A;  4L6T B;  2KUM A;  4AYB G;  5FO8 B;  2FFK B;  3NWS A;  4A3E H;  5CV6 A;  4FF3 A;  4DR6 L;  3S14 B;  1H9S B;  3J7A F;  3NWT A;  3QWN A;  1G29 1;  2B2U A;  2NUC A;  3HOZ B;  2QF7 A;  3AFQ A;  3EBE A;  3RN2 A;  1KAW A;  4KY5 A;  5GAH C;  3J80 L;  1PV4 A;  3I4N G;  1S5D D;  3OW2 A;  1OXU A;  4FDB A;  3Q23 A;  1JE5 A;  1S5F D;  2Q8R E;  5COR A;  3D3R A;  3FRP B;  1A15 A;  1JT8 A;  1EEF D;  1SNC A;  3BG3 A;  4RGM A;  3J81 L;  4XYO A;  1N33 Q;  2A69 C;  2EJF C;  2PMZ B;  1SR3 A;  2SNM A;  5M3F B;  3J81 j;  2UXC L;  3SDZ A;  2AUK A;  1PTO D;  3EQL C;  4QIW E;  3VYS A;  2I07 B;  3T16 A;  4CDF C;  4JYA Q;  1IHZ A;  1RL2 A;  1H9R A;  2IX1 A;  3OMC A;  1X3F A;  5KNB A;  2K4K A;  4IFD G;  4K6L A;  3CCS A;  4A3G B;  1HNZ Q;  4QMG A;  2AQ1 B;  1GHK A;  3CC7 A;  4DF7 A;  2F0N A;  1HZ9 A;  4B3M Q;  5C5L A;  1XNQ L;  1EZ8 A;  2M00 A;  4L5S A;  1EU4 A;  4GN4 B;  3HGB A;  3STB C;  1UUP A;  4HN7 A;  3V05 A;  5CR3 A;  3RN5 A;  3D6W A;  4FF1 A;  1U5K A;  3I4M H;  4A3C H;  1E3P A;  4NP5 A;  1JJG A;  3NQI A;  4UDU C;  1BOS A;  5IGB A;  4UPA A;  1LT4 D;  3A54 A;  4CDE C;  1PTO F;  1B9M A;  1V1Q A;  2L55 A;  2VS1 A;  3I73 A;  1Q7Y C;  1SJE D;  1NUC A;  5D3D A;  2IWH A;  2VB2 X;  3A8K E;  4LFC L;  5EJW A;  4YCU A;  4JI0 L;  2GN5 A;  1QWY A;  5C4H A;  2F4V L;  3NE5 B;  4RWS C;  1LTS D;  2Z4H A;  1A3T A;  3J7Z C;  3AYH B;  2JA6 B;  2VUM H;  2AMC B;  3RZO H;  3S16 H;  1J8I A;  4DR1 Q;  3H6M A;  1XPR A;  5CV9 A;  4GLA C;  2E2J H;  4O42 A;  5KEE A;  1A2T A;  3Q8D A;  4ZQ3 A;  2F1M A;  4BBR H;  1UWV A;  3BS1 A;  1V43 A;  2YV5 A;  1VQO A;  2WB1 G;  4ZUI A;  2EPB A;  4NW2 A;  3KF8 A;  2CW0 C;  3SK4 A;  1M1K C;  3E0E A;  3CCR A;  3FKI H;  3JAM L;  1CSQ A;  4BA1 I;  4HMJ A;  1A0I A;  1C7Y A;  3HS0 C;  3HOY G;  1WCM H;  1HNW Q;  1RCV D;  4CKB A;  3M4O H;  1OXV A;  4P75 A;  4KHP Q;  4MN3 A;  4UHV A;  2VQF Q;  4ZUJ A;  3TDQ A;  1LT5 D;  3DWP A;  1T9H A;  3I70 A;  4I7Z C;  4C3I H;  4CGY B;  4OWX B;  2B2W C;  3R8B A;  2JA5 B;  1F2M A;  4A3M B;  1EOT A;  1A3U A;  1C48 A;  4J1M A;  5COY A;  5BN5 A;  4RHS A;  1Q81 C;  1P16 A;  5EBD A;  2EDG A;  4DV3 L;  2MNA A;  2YU9 B;  4DV1 L;  2ZJQ A;  2E2H H;  1TWG B;  1O7Y A;  3BJU A;  5ELN A;  2A1A A;  4XTC S;  1VQE A;  2R7Z G;  2R93 H;  3AFP A;  5EGT A;  3MXP A;  5IP9 H;  2F0P A;  3LNN A;  2A68 D;  1LTB D;  3L0O A;  1DGS A;  3ND9 A;  4V19 0;  1PH4 A;  2PI2 A;  1MI2 A;  1VQ4 A;  1R4P B;  2FMC A;  1PH7 A;  1EZ6 A;  3UE1 A;  1YJ9 A;  1H95 A;  4OON A;  3TZD A;  2EVB A;  3BU2 A;  3GDE A;  1D2B A;  1KLG D;  2WAC A;  2DY7 A;  4JI4 L;  2DJF C;  5EKI A;  3NTH A;  5CBA E;  3P20 A;  1STH A;  1HQM C;  3GTQ B;  3F8T A;  4XT1 B;  4XXE A;  3U4Z A;  4DR1 L;  4FF2 A;  5FOB B;  2O5I C;  1PVO A;  3JAM E;  1U9R A;  3R2I A;  2B2T C;  4FYD A;  1JQY D;  4B3R L;  4PZ8 A;  4LNQ A;  2N8N A;  1KIX A;  1DD2 A;  1EWH A;  4RAU C;  2F0O A;  2MP1 A;  2NVQ H;  1U4L A;  4DAY A;  5FLM G;  5IOC A;  3GTK H;  3H3V I;  2JA9 A;  2A73 B;  1HFG A;  1D8L A;  4HCS A;  1PYW D;  3RD4 A;  3LX0 A;  5E4X A;  1L1O C;  4TSS A;  3BVG A;  1PZI D;  1ICW A;  2A74 C;  3ONA B;  2L15 A;  4N8F A;  5JOB A;  5LMU L;  5M3M H;  5BN4 A;  4A3K G;  4RA8 A;  5HGQ A;  5L37 A;  3HOW B;  3S17 B;  3CCE A;  1PA6 A;  1I3Q B;  3VYT A;  5K36 G;  4DPG A;  3VYR A;  4C2M H;  2C35 B;  4CJ2 C;  1NR2 A;  1YNN C;  4H0L C;  2F0M A;  2OWO A;  4OO1 G;  1JOQ A;  2RA4 A;  2VL6 A;  5IT9 L;  4LF8 Q;  2UUB Q;  5J22 A;  3FPU B;  2EY2 A;  2F0F A;  4H7B A;  2E75 C;  1JOO A;  2Z8L A;  1PRT D;  4LUV A;  5K5P A;  1S5E D;  3TP6 A;  3SVM A;  2PW7 A;  4DV2 Q;  1B9N A;  2V1C C;  1VF7 A;  3S1N B;  1Y1V G;  1FNU A;  5C44 H;  5CC4 A;  3TS2 A;  3CHB D;  3DHQ A;  2XTI A;  1VF5 C;  4KJO A;  2C5C A;  3A74 A;  3RUZ A;  4HSV A;  3K7U C;  2JA5 G;  3HKZ E;  1ILQ A;  1V9P A;  1GUG A;  2R92 B;  4X65 L;  1FNW A;  2JEB I;  3E0J A;  1FVI A;  2TMP A;  5IGC A;  1YHB A;  3R2T A;  2AHO B;  1N34 Q;  1QNK A;  5JEA J;  4PMC A;  1CQF A;  5EPK A;  3F2U A;  2F0W A;  1TWC H;  1BCP D;  1VQI A;  3H0G G;  3KLW A;  1XPU A;  1PRT F;  2VW9 A;  5EKL A;  4DV4 L;  2V4D A;  5JEA H;  3DM1 A;  2F0V A;  3Q24 A;  2IHE A;  4JVZ A;  4GNX B;  2K14 A;  2KEN A;  1YJN A;  5C6A A;  1PTO B;  4IUN A;  1EQV A;  2G9D A;  3LWU A;  1I6H H;  4RMF A;  4Q5V A;  2BH2 A;  4JV5 Q;  2E2D C;  2MFI A;  1BUV T;  1F77 A;  2AQ3 B;  3QG1 A;  1ET6 A;  1AE3 A;  2NVY B;  4C3H H;  4G57 A;  5EPJ A;  2EY5 A;  3D6C A;  1BCP F;  4H44 C;  3VR5 A;  2KED A;  3CCJ A;  1STN A;  4AQY L;  1D6E C;  2CHB D;  4YWK A;  5C4Z A;  1D5Z C;  2UUA Q;  5IYD H;  4RGT A;  1F9Q A;  3TME A;  1ENF A;  2ZM6 Q;  4TRD A;  1YVC A;  2ATW A;  1LLR D;  2WP8 J;  4A3D G;  5DLQ E;  3SK8 A;  1DJR D;  3DLL A;  4JG2 A;  1KNA A;  1PH6 A;  1DOK A;  4S3S A;  2UUB L;  3GTJ H;  2F3I A;  2Q2I A;  2SNS A;  3VR3 A;  3HOU H;  1B4O A;  1YZ6 A;  5M5X B;  4A93 H;  2JE6 I;  4A3F G;  1STY A;  1TWF H;  1RIP A;  2B2U C;  4DV2 L;  3H3V H;  3S15 H;  2NWG A;  2RCN A;  3S24 A;  1R4Q B;  1K8M A;  1PYS B;  3B6Y A;  4YHH L;  1WD0 A;  1PFM A;  1RHP A;  2HQE A;  2A6E C;  1W3S A;  1QG7 A;  2GA4 B;  2B3G A;  2Y0S B;  1KDB A;  5C4J B;  2B2V A;  2CKZ B;  2R6G A;  1N34 L;  4KKU A;  2PQA A;  4I7A A;  4EX5 A;  4IPG A;  4APV A;  2HHH Q;  1TXY A;  2NB0 A;  1E7Z A;  2UXB Q;  5JJZ A;  2JA7 B;  1Y1W H;  1J5E L;  1V1O A;  2KEC A;  2KHS A;  3MC0 B;  2LXJ A;  3K0Y A;  4PV1 C;  4QF4 A;  3S1Q H;  5HY6 A;  4BBS G;  1X9N A;  1UNS A;  1I94 Q;  4ZCK A;  1UE6 A;  2ZXR A;  1UE7 A;  1JJ2 A;  4IN3 A;  3SEB A;  2R92 G;  4HIO A;  3M4Q A;  3IFT A;  4G7O C;  2ENB A;  3GTL B;  1CT1 D;  2DNE A;  3L3O C;  1GM5 A;  2K50 A;  4QUF A;  2A6H C;  2F52 A;  2XRS D;  2F0T A;  2FXQ A;  1KQS A;  3C3L A;  1GUW A;  5JVG 3;  5KGU A;  1CK1 A;  5GAG C;  3G6J B;  1QVC A;  1M8A A;  3ER0 A;  3ULP A;  2UUA L;  2F3V A;  1CHP D;  3GTG B;  3ULJ A;  1X3E A;  3RMH A;  5C4X H;  2ID0 A;  1GUN A;  3DWA A;  3WDN A;  1EQT A;  4ALP A;  2WAQ B;  3MZ5 A;  1SMY D;  3CCL A;  4MTN A;  1C0A A;  3KF6 B;  1HUN A;  1O7L A;  3NSW A;  5I9P A;  1CA6 A;  1CZW A;  2KHJ A;  1AEX A;  4GKJ L;  5IP7 H;  3KLR A;  3K80 C;  3NBH A;  4CHT B;  1SYF A;  2O2L D;  3NTI A;  4GZY C;  1LTL A;  1FD7 D;  1EIY B;  3OYY A;  3PF5 A;  1HUM A;  3RZD B;  4XQQ A;  5JPN C;  1D5M C;  1E1T A;  5ELB A;  1K83 B;  4YIJ A;  3HOV G;  1VMC A;  2UUC Q;  1I4X A;  4KI0 A;  4NKL A;  2CQO A;  1B44 D;  1PDQ A;  2PZW A;  2HHH L;  2VQE L;  2UXB L;  1HPC A;  1K73 C;  5FJ8 H;  1II3 A;  1EL0 A;  1E24 A;  4A3E B;  2B8G A;  3RLN A;  1Y8P B;  3MHB A;  1KDA A;  1A3V A;  3HOX H; 
#chains in the Genus database with same CATH homology
 4KKS A;  2F0I A;  2RQX A;  3I8Z A;  3BDO A;  2PZU A;  1WTX A;  3SR1 A;  3TP8 A;  2KOL A;  4X3T A;  1F9P A;  4IUP A;  2FMM A;  5G3L D;  2B2Y C;  5EPL A;  5EQ0 A;  3QOJ A;  2EYJ A;  1SND A;  2F0J A;  4FXG C;  3GQB A;  4OGQ C;  3L7Z C;  3NTK A;  3MXU A;  1KNE A;  4H13 C;  3I4M B;  3MVV A;  1WVL A;  1HQR D;  3TP5 A;  1TVX A;  2KEE A;  3PIP 3;  4CJ1 B;  1SJH D;  2TSS A;  5G3L F;  1IW7 D;  2PZT A;  3H91 A;  2DN8 A;  3GV6 A;  1FR3 A;  3MFG A;  1PTO C;  4KHV A;  2MPM A;  2VUM B;  3S16 B;  3RZO B;  4B08 A;  1SYD A;  2E2J B;  5ELF A;  3X3M A;  3A55 A;  3OPO A;  3VR2 A;  3AU7 A;  2JSO A;  4BBR B;  1IYU A;  5EBC A;  3D31 A;  4RCO A;  3C46 A;  3HZX A;  3K5L A;  3TP7 A;  1NCV A;  3W2D A;  3FKI B;  2NYZ D;  3J7A V;  1SNP A;  1WCM B;  4RFB A;  4F88 A;  3M4O B;  1IL8 A;  2RSO A;  4EQO A;  5KYL A;  4FXD A;  4IUQ A;  3BYY B;  3QIA A;  4IUU A;  4C3I B;  3PUV A;  1NR4 A;  2N55 A;  3K57 A;  4IFD J;  3DUZ A;  5JVH 3;  5AFW A;  3M4Y A;  4OIK A;  1LTI D;  4BA2 I;  2HDL A;  2RBM A;  2XSC A;  2K7V A;  4IFD H;  2E2H B;  2F0S A;  1DON A;  1LV9 A;  5TSS A;  3SHL A;  4EQP A;  1DM0 B;  1DOM A;  2R93 B;  3QO2 A;  1CTM A;  1LO5 D;  3KK7 A;  3ITP A;  2DY8 A;  4JBW A;  3GP7 A;  4V0B A;  2XNA C;  1AW7 A;  2XVS A;  2PW5 A;  2WII B;  1X3P A;  1Q3L A;  1VCI A;  1HTL D;  2NN6 I;  1I4R A;  3D4W A;  2LS0 1;  4HR7 B;  2IW3 A;  2NTS A;  1DCZ A;  2FHT A;  4QB4 A;  4P2C B;  3T4A C;  1ILP A;  3PUY A;  4OO1 I;  1PXU A;  5A35 A;  2PNR C;  3VR4 A;  2NVQ B;  3GTK B;  3R3O A;  2A69 D;  2F3W A;  2F0U A;  2RDF A;  1LTR D;  5HGT A;  3GV3 A;  1JB3 A;  5M3M B;  1F9S A;  4XIG S;  1CM9 A;  4RCN A;  1W6J A;  4C2M B;  4EVO A;  3G7L A;  1KLU D;  2B2V C;  1A6X A;  4RKL A;  2SOB A;  4RH6 A;  4XT3 B;  4K5V A;  4Y7N B;  1LTA D;  2EY1 A;  5C44 B;  4PNY A;  3MFY A;  5FO9 B;  1BO0 A;  4KN7 C;  4C3I G;  5ELE A;  4ULL A;  4DXF A;  1ZXT A;  4KV6 A;  2O4X A;  3TN2 A;  5M9O A;  1WTW A;  2L1B A;  1K8O A;  4IQZ A;  1G2T A;  3C1E A;  1TWC B;  1EEI D;  2B2Y A;  2Z1C A;  1WTO A;  5J1Z A;  3QB3 A;  1JWS D;  3M7G A;  2CW0 D;  1CFM A;  5ELD A;  1RDP D;  2X6L A;  1ENA A;  3M85 A;  3P1H A;  2K1B A;  2FIN B;  4HMI A;  2QDB A;  1I6H B;  3ZYY X;  1RKN A;  1ET9 A;  1TS3 A;  2D62 A;  1SSO A;  4CKC A;  2Q8T A;  4ME5 A;  1JOR A;  4C3H B;  3K6O A;  4KY6 A;  1D1K A;  5C5M A;  2PYK A;  4HTH A;  4K2L A;  1I4H A;  1JWU D;  1EY7 A;  2NN6 G;  3WOF A;  5IOD A;  1YNJ C;  1OO9 B;  3TZU A;  4EQN A;  2AWN A;  4LJZ C;  5K36 H;  2XWB B;  4WFN 3;  5ISR A;  4X3S A;  1F2L A;  3GTJ B;  4OO1 H;  2F0E A;  4HAE A;  3HOU B;  2KA7 A;  4A93 B;  2PQE A;  3BVM A;  1EWC A;  1EY9 A;  1TWF B;  3S15 B;  1B1Z A;  1TS4 A;  2F0L A;  3AMU A;  1LTG D;  3O13 A;  1B50 A;  2OT2 A;  2L9H A;  3DWQ A;  1LT6 D;  2KVM A;  4OIJ A;  4UAI A;  2LY7 A;  1Y1W B;  1ROD A;  1X3Q A;  3EA6 A;  1STB A;  4DAV A;  3S1Q B;  1GUS A;  2EY6 A;  5KNC A;  1E2V A;  3MA2 B;  1EY8 A;  5CMD A;  1ONL A;  3V96 A;  2H4O A;  2BE5 C;  1AP0 A;  2EZV A;  1PMR A;  2RDG A;  1BDO A;  4QIW B;  4ZAI A;  3MEH A;  1YNN D;  3QJY A;  5I2X A;  3NXW A;  2BOS A;  4FVM A;  1S5B D;  2L0C A;  5C4X B;  1SEB D;  1QIL A;  1PZK D;  1WD1 A;  2IPK D;  4KMU C;  3MWY W;  3I3C A;  1ZYR C;  2MUY A;  4N9T A;  1TS5 A;  3GO5 A;  5C0X G;  3AB9 A;  2K04 A;  3EJI A;  3Q22 A;  1T5E A;  4QCL A;  4RGN A;  3DEO A;  1EY6 A;  2EYM A;  3HEJ A;  2KCC A;  3KLS A;  4DAP A;  2NTT A;  4ID6 A;  3SXH A;  1Y69 U;  1AZQ A;  5LHY 1;  3K5M A;  4G4K A;  4PQX A;  2EYF A;  4FO2 A;  5KIX A;  4JK1 C;  2NBF A;  4XQJ A;  5CV7 A;  1FYC A;  1MBY A;  1XX8 A;  5HUR A;  5FLX E;  2K28 A;  3BDC A;  4J6H A;  5CBE E;  2R3Z A;  3HOX B;  2WKC A;  3I72 A;  3CKI B;  2L11 A;  4R8I A;  2JP1 A;  4K5X A;  2K5Q A;  3HP3 A;  3VA7 A;  5KYI A;  3R93 A;  3K5O A;  4BY7 B;  3PMF A;  1Q1E A;  1BR9 A;  2OXP A;  1KTK A;  3Q6S A;  1GUT A;  4CKE A;  1BBX C;  4C1N K;  2OF1 A;  1V1P A;  1SE2 A;  4F7X A;  2E74 C;  2L5T A;  1CZG A;  4LAA A;  4WJW A;  4ZKC B;  1DXM A;  2C9O A;  2MHV A;  2HDM A;  2RVL A;  3HRZ C;  3VYU A;  2M9V A;  1H9J A;  2PO4 A;  2NZ1 D;  1S5C D;  4DNR B;  2LKV A;  2WIN B;  1HXY D;  2MJ8 A;  1I50 B;  1I6V C;  4KK7 A;  2B63 B;  4C3J B;  5NUC A;  2I46 A;  4HCE A;  1OXX K;  4A3B B;  2D5D A;  1KAA A;  2F0Q A;  1EYC A;  5DM7 3;  1AFP A;  4C56 C;  4DK0 A;  2VXW A;  4U68 A;  4J8Q A;  3GTO B;  2KCN A;  4XYQ A;  4KN4 C;  2A6H D;  1S4Z A;  4ABN A;  1CQV A;  1HHV A;  3P75 A;  1SDF A;  1Y8O B;  1V1P B;  3T13 A;  4IAL A;  3PUZ A;  3OW7 A;  3I4N B;  4R8N A;  3URY A;  2YYZ A;  1ESF A;  4HSP A;  4I65 A;  3K59 A;  3CQZ B;  3DEP A;  1PRT B;  3ERQ A;  1LAC A;  3S9W A;  5KRU A;  3OIQ A;  4KY7 A;  2D2C C;  3H3V C;  1Q90 A;  3NHH A;  3IFD A;  2BA0 A;  5A2Q E;  4RKB A;  2F0H A;  4B9W A;  1J9O A;  1AN8 A;  3BYT B;  3K58 A;  2ZXP A;  4ILW A;  1U4M A;  1R9T B;  1FGB D;  1U4P A;  1JIC A;  3HKZ B;  1BCP B;  5T1I A;  4PMW A;  2AUJ D;  3CRK C;  3RLF A;  3BZD B;  3A7A B;  1O80 A;  3D4D A;  1NSN S;  4K8I A;  2G9H D;  2HCI A;  3VR6 A;  3L9A X;  3S1M B;  3GTM B;  2JXM B;  1WTP A;  1LT3 D;  2CVR A;  3NP8 A;  1BNZ A;  4B9X A;  2FJ2 A;  4C3J G;  4U67 3;  5CV4 A;  3D8G A;  2QCP X;  5DAU A;  2PPB C;  1SNQ A;  2L4N A;  1SXT A;  3OHX C;  1G2S A;  1JE4 A;  5D3I B;  1Y8N B;  3FDT A;  3HOY B;  2MGS A;  4IUT A;  1HA6 A;  1GJX A;  1QOH A;  4KD3 A;  3GD7 A;  3BDL A;  3ND8 A;  1LAB A;  3BVZ A;  5M5Y B;  1WTV A;  1XTC D;  3NUC A;  4RGO S;  1TU2 B;  1EU3 A;  1TY2 A;  1ZEQ X;  3S1R B;  1MD2 D;  3T51 B;  2ZXO A;  2R61 A;  3FMC A;  3DXJ C;  4X3U A;  2R7Z B;  4IZ8 A;  2BDN A;  2VB3 X;  1RF2 D;  3SK5 A;  4IUR A;  3LWE A;  5D14 A;  1Z47 A;  4KJN A;  2RSN A;  2KQ3 A;  1MSH A;  2XWJ B;  3EFX D;  3PUW A;  1WTR A;  4FP5 D;  1D5X C;  5LL6 X;  4DXG A;  4L8J A;  4ZRZ A;  5FK9 C;  2VNU D;  1C4Q A;  3TSS A;  4Q0F A;  5CYU A;  1EIH A;  1SYE A;  3K7A B;  3NQT A;  4M1U B;  4ZKB B;  4CJ0 B;  2IL8 A;  3M3Y B;  2H1E A;  2A68 C;  1H9K A;  4DU9 A;  4A3K B;  2O5J C;  4KKT A;  4K5W A;  3EVQ A;  3J80 E;  1XXG A;  4HED A;  1DYQ A;  2AQ2 B;  2XIW A;  3MXN A;  3K5N A;  1TR5 A;  2F0G A;  2F0K A;  3T53 B;  5JAV A;  3IAY A;  1SE4 A;  4DN4 M;  2DNC A;  3J81 E;  4K14 A;  4K6D A;  1TWH B;  1W6K A;  3GTP B;  4Z9C B;  1T5X D;  3FVQ A;  1Y1V B;  3Q0A A;  1STG A;  4R9W A;  3PV0 A;  5KND A;  1SYB A;  2B8F A;  4NDX A;  1B53 A;  4MIU A;  3UI2 A;  3I90 A;  1F9R A;  2JYO A;  3N52 A;  1C8C A;  1WTQ A;  3PO3 B;  1EFI D;  1EY5 A;  4FXK C;  4XQN A;  2WKD A;  4ODG A;  1JWM D;  3H09 A;  3H0G B;  5C3X A;  2K33 A;  4MHE A;  3C1F A;  1OXS C;  1G6Z A;  3I91 A;  2IJ0 A;  1Q12 A;  1OXT A;  4KHZ A;  1RD9 D;  4ZLT F;  1EY0 A;  5C0X I;  4G7Z C;  1B3A A;  1PRT C;  1RJT A;  1TT2 A;  2RKS A;  1GOZ A;  4K2K A;  4NMZ A;  2QIL A;  3MTS A;  1SBB B;  2BDO A;  1DOL A;  2EXZ A;  2K6A A;  2EYL A;  5IGG A;  1HRJ A;  1UAP A;  2NN6 H;  2Z4I A;  1QB5 D;  1BCP C;  1Z6H A;  5LL6 S;  2LMC B;  4A3D B;  5EKK A;  5IIF A;  1TKW B;  1HCZ A;  1H9M A;  1NAP A;  2OEO A;  1CHQ D;  3C2P A;  2SDF A;  4XDX A;  5CV8 A;  4BY1 B;  1F2Y A;  1E2Z A;  4A3F B;  2F03 A;  2X6G A;  2RDH A;  5I2Y A;  1IKL A;  1EYA A;  1SYC A;  5I6W A;  1XWE A;  4DA2 A;  1SFO B;  1HA5 A;  3A8J E;  3I4L A;  2XRQ D;  2EYO A;  3TBI B;  4BS9 A;  1HFN A;  3M7N A;  1ESR A;  4X3K A;  3WOE A;  4BBS B;  5IGF A;  4F8M A;  1Z7T A;  5BN3 A;  2F0D A;  4L63 B;  3HG9 A;  4DNT B;  5FKA C;  2EYP A;  3KBG A;  5JPM C;  1TWA B;  3VA5 A;  5FLX L;  5DEH A;  3FEW X;  1GXD C;  1YNJ D;  2D9U A;  3OMG A;  2BCO A;  5DNF A;  1L0X B;  4FF4 A;  1Q1B A;  1B2T A;  1PFB A;  5C3W A;  5T1G A;  5JEA G;  3U9O A;  1ENC A;  4A3J B;  4C1N I;  5C0X J;  1TQO A;  3X3N A;  3U9S A;  4LMQ D;  4C3H G;  2KJX A;  5C0X H;  5J39 A;  2JEA I;  2F4I A;  4PMB A;  3SE0 A;  2J0T D;  5IT9 E;  3SK6 A;  1HTP A;  1TII D;  1IYV A;  1BF4 A;  3H94 A;  3OWF A;  4FNF A;  3PUX A;  4O1N A;  2K32 A;  2EYH A;  5IGD A;  1XYI A;  1X32 A;  5IGE A;  1QE6 A;  2EJG C;  2EE1 A;  3HOV B;  1G91 A;  4K8J A;  1V8Q A;  2BE5 D;  3S2H B;  1O7Z A;  3OOC A;  3CRL C;  1SNO A;  2LFN A;  1JC7 A;  1SMY C;  2XN9 C;  1ML0 D;  4N9P A;  2SEB D;  3A8I E;  3OWE B;  2M2L A;  2J4X A;  4CBV A;  1LTT D;  2B2W A;  4G7H C;  1STE A;  5E3F A;  2ZT9 C;  4ZYS A;  2IX3 A;  1EYD A;  1ZYR D;  3DMU A;  2ICI A;  4EGV A;  1CA5 A;  1I4P A;  1IKM A;  1QCB D;  4QUC A;  5C3E B;  1JR0 D;  3A56 A;  3PO2 B;  1PTO H;  1EIG A;  2A5H A;  4OL7 A;  1MSG A;  2ICE C;  3KBX A;  1FNV A;  2HCC A;  1O78 A;  1CI3 M;  5A2Q L;  1STA A;  2JA8 B;  2A6E D;  1F2Z A;  1QNU A;  2K5D A;  5CGK A;  1D1I A;  4WRD A;  2K05 A;  3KLS X;  1A2U A;  3CU7 A;  1SE3 A;  1I4Q A;  3A7L A;  2K5W A;  2B2T A;  2CQA A;  2EJM A;  1KDC A;  4F87 A;  2B39 A;  3ERO A;  3N6R A;  1VDZ A;  3T56 B;  3NBI A;  2K01 A;  1BXT A;  2NVT B;  2N88 A;  4AYB B;  4TQU S;  2HUG A;  1BQQ T;  2QEJ C;  2X69 A;  5I9O A;  1MGS A;  3OSO A;  3NK9 A;  3V2T A;  1JOK A;  4KD4 A;  4WOR A;  3NPP A;  4LK1 C;  1SYG A;  1IW7 C;  2Q8I B;  1PLF A;  4DK1 A;  1RTO A;  2WV6 D;  4IFD I;  1ZKO A;  2EOT A;  3FPP A;  2IX0 A;  2IT1 A;  4M8A A;  4KTA A;  2E76 C;  4DGZ A;  1JCK B;  1L0Y B;  5M5W B;  1SAP A;  1E2W A;  3E6Z X;  1G8Z D;  3IL8 A;  2PCF B;  4DFA A;  1Q8I A;  3D4R A;  4RHR A;  3J7Y W;  1QJO A;  1VMP A;  4BWG B;  1UEA B;  1TS2 A;  1H9S A;  5I4D A;  5FO7 B;  1GHJ A;  5ELC A;  3OIP A;  3QOL A;  4ZK9 B;  1GUO A;  2K03 A;  1U4R A;  3MAQ A;  3KUP A;  3P7J A;  4TKO B;  3MXG A;  2NVX B;  4A3I B;  2BA1 A;  4IUV A;  2E2I B;  3S2D B;  3IKJ A;  5D65 A;  1DZ1 A;  2L12 A;  3W3A A;  5I6Y A;  3PIO 3;  1KAB A;  5CV5 A;  1RTN A;  2WB1 B;  2QKI C;  1EY4 A;  4E6I A;  1E0B A;  5DM6 3;  1AZP A;  5E4W C;  4OHJ A;  1PZJ D;  5E1F A;  1I4G A;  5F2D A;  1TY0 A;  3E5S A;  1PFN A;  1SNM A;  1M4V A;  2J7Z A;  2AWO A;  4L6T B;  2KUM A;  5FO8 B;  2FFK B;  3NWS A;  5CV6 A;  4FF3 A;  3S14 B;  1H9S B;  3J7A F;  3NWT A;  3QWN A;  1G29 1;  2B2U A;  2NUC A;  3HOZ B;  2QF7 A;  4KY5 A;  3J80 L;  1S5D D;  1OXU A;  3Q23 A;  1S5F D;  2Q8R E;  5COR A;  3D3R A;  3FRP B;  1A15 A;  1EEF D;  1SNC A;  3BG3 A;  4RGM A;  3J81 L;  4XYO A;  2A69 C;  2EJF C;  2PMZ B;  2SNM A;  5M3F B;  3SDZ A;  2AUK A;  1PTO D;  3EQL C;  3VYS A;  2I07 B;  3T16 A;  1IHZ A;  1H9R A;  2IX1 A;  3OMC A;  5KNB A;  4IFD G;  4K6L A;  4A3G B;  4QMG A;  2AQ1 B;  1GHK A;  4DF7 A;  2F0N A;  5C5L A;  1EZ8 A;  2M00 A;  1EU4 A;  3HGB A;  3V05 A;  1UUP A;  4HN7 A;  5CR3 A;  3D6W A;  4FF1 A;  4NP5 A;  3NQI A;  4UDU C;  1BOS A;  5IGB A;  1LT4 D;  3A54 A;  1PTO F;  1B9M A;  2L55 A;  3I73 A;  1SJE D;  1NUC A;  5D3D A;  2IWH A;  2VB2 X;  3A8K E;  5EJW A;  1QWY A;  5C4H A;  3NE5 B;  4RWS C;  1LTS D;  2Z4H A;  1A3T A;  2JA6 B;  1J8I A;  3H6M A;  5CV9 A;  4O42 A;  5KEE A;  1A2T A;  4ZQ3 A;  2F1M A;  3BS1 A;  1V43 A;  4ZUI A;  2EPB A;  4NW2 A;  3KF8 A;  2CW0 C;  3SK4 A;  3JAM L;  4BA1 I;  4HMJ A;  3HS0 C;  1RCV D;  4CKB A;  1OXV A;  4MN3 A;  4ZUJ A;  3TDQ A;  1LT5 D;  3DWP A;  3I70 A;  4I7Z C;  4CGY B;  2B2W C;  3R8B A;  2JA5 B;  1F2M A;  4A3M B;  1EOT A;  1A3U A;  1C48 A;  4J1M A;  5COY A;  5BN5 A;  4RHS A;  5EBD A;  2EDG A;  2YU9 B;  1TWG B;  1O7Y A;  4XTC S;  5EGT A;  3MXP A;  2F0P A;  3LNN A;  2A68 D;  1LTB D;  3ND9 A;  4V19 0;  1MI2 A;  1R4P B;  2FMC A;  1EZ6 A;  3TZD A;  1D2B A;  2EVB A;  1KLG D;  2WAC A;  2DY7 A;  5EKI A;  3NTH A;  5CBA E;  3P20 A;  1STH A;  1HQM C;  3GTQ B;  4XT1 B;  4XXE A;  4FF2 A;  5FOB B;  2O5I C;  3JAM E;  1U9R A;  3R2I A;  2B2T C;  4FYD A;  1JQY D;  1DD2 A;  1EWH A;  4RAU C;  2F0O A;  2MP1 A;  1U4L A;  4DAY A;  5IOC A;  2A73 B;  1HFG A;  4HCS A;  1PYW D;  3RD4 A;  3LX0 A;  5E4X A;  4TSS A;  3BVG A;  1PZI D;  1ICW A;  2A74 C;  3ONA B;  5JOB A;  5BN4 A;  4RA8 A;  3HOW B;  3S17 B;  1I3Q B;  3VYT A;  5K36 G;  3VYR A;  4CJ2 C;  1NR2 A;  1YNN C;  4H0L C;  2F0M A;  4OO1 G;  1JOQ A;  2RA4 A;  5IT9 L;  5J22 A;  3FPU B;  2EY2 A;  2F0F A;  4H7B A;  2E75 C;  1JOO A;  2Z8L A;  1PRT D;  5K5P A;  1S5E D;  3TP6 A;  3SVM A;  2PW7 A;  1B9N A;  3S1N B;  1VF7 A;  1FNU A;  5CC4 A;  3CHB D;  3DHQ A;  1VF5 C;  4KJO A;  2C5C A;  3RUZ A;  4HSV A;  1ILQ A;  1GUG A;  2R92 B;  1FNW A;  2JEB I;  3E0J A;  2TMP A;  5IGC A;  3R2T A;  1QNK A;  5JEA J;  4PMC A;  1CQF A;  5EPK A;  3F2U A;  2F0W A;  1BCP D;  1PRT F;  5EKL A;  2V4D A;  5JEA H;  3DM1 A;  2F0V A;  3Q24 A;  5C6A A;  1PTO B;  4IUN A;  1EQV A;  2G9D A;  3LWU A;  4Q5V A;  2E2D C;  1BUV T;  1F77 A;  2AQ3 B;  1ET6 A;  3QG1 A;  2NVY B;  4G57 A;  5EPJ A;  2EY5 A;  3D6C A;  1BCP F;  4H44 C;  3VR5 A;  2KED A;  1STN A;  1D6E C;  2CHB D;  5C4Z A;  1D5Z C;  4RGT A;  1F9Q A;  3TME A;  1ENF A;  4TRD A;  1LLR D;  2WP8 J;  3SK8 A;  1DJR D;  1KNA A;  1DOK A;  4S3S A;  2SNS A;  3VR3 A;  1B4O A;  5M5X B;  2JE6 I;  1STY A;  2B2U C;  2NWG A;  1R4Q B;  1K8M A;  1WD0 A;  1RHP A;  1PFM A;  2HQE A;  2A6E C;  1QG7 A;  2GA4 B;  2Y0S B;  1KDB A;  5C4J B;  2B2V A;  2R6G A;  4KKU A;  2NB0 A;  5JJZ A;  2JA7 B;  1V1O A;  2KEC A;  2KHS A;  3MC0 B;  3K0Y A;  4PV1 C;  4QF4 A;  1UNS A;  2ZXR A;  4IN3 A;  3SEB A;  3IFT A;  4G7O C;  2ENB A;  3GTL B;  1CT1 D;  2DNE A;  3L3O C;  4QUF A;  2A6H C;  2XRS D;  2F0T A;  3C3L A;  1GUW A;  5JVG 3;  5KGU A;  1CK1 A;  3G6J B;  1M8A A;  2F3V A;  1CHP D;  3GTG B;  3RMH A;  2ID0 A;  1GUN A;  3DWA A;  3WDN A;  1EQT A;  2WAQ B;  3MZ5 A;  1SMY D;  1HUN A;  1O7L A;  3NSW A;  5I9P A;  1CA6 A;  1CZW A;  1AEX A;  3KLR A;  3NBH A;  4CHT B;  1SYF A;  2O2L D;  3NTI A;  4GZY C;  1FD7 D;  1HUM A;  3RZD B;  4XQQ A;  5JPN C;  1D5M C;  5ELB A;  1K83 B;  4YIJ A;  1VMC A;  1I4X A;  4KI0 A;  4NKL A;  2PZW A;  1B44 D;  1PDQ A;  1HPC A;  1II3 A;  1EL0 A;  4A3E B;  2B8G A;  1Y8P B;  3MHB A;  1KDA A;  1A3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...