2K52A

Structure of uncharacterized protein mj1198 from methanocaldococcus jannaschii. northeast structural genomics target mjr117b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
b'MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ1198
publication title Structure of uncharacterized protein MJ1198 from Methanocaldococcus jannaschii. Northeast Structural Genomics Target MjR117B
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k52A00
3W5OA 3CCMA 3F8TA 1DGSA 2BA1A 3J7ZC 3GTGH 4A3CG 3HOYG 3HOUG 2ZM6Q 1PH5A 1X55A 2AHOB 4P74A 1VQ4A 1VQ6A 1VQIA 1WJJA 1QZGA 3FHWA 4JI8Q 4LFCQ 5M3MG 1P8LA 4LFAL 1B7YB 5IP7G 1HZCA 1Q8KA 3CMAA 3KDFB 2I5LX 1MKHA 5FLXc 5C0XG 1OXXK 1E1TA 1G51A 3S24A 1Q82C 2UUBQ 5LMNQ 1PA6A 1X3EA 2ATWA 2IHEA 2ZTEA 4LF7L 4IJLA 4X62L 3RZDH 2R92H 3UDFA 4OWTB 4JI3L 3J81j 3OTOQ 2OTLA 1EQRA 1U0LA 1SR3A 3MEFA 2YU9H 3PIOA 4JI0Q 4XIGS 4OX9Q 2UXDQ 4X6AH 1VQ8A 2R93H 4A3LH 4B3MQ 2UUAQ 1W2BA 2JA6G 4GLXA 1HNZL 1SRUA 1PFSA 3G4SA 4HIKA 4HJ8A 1X9NA 4JI7L 4TVAB 1Q1BA 1OTCA 4R4OA 3L2PA 3K7AH 3PF4A 1L1OB 1I5FA 4LUOA 3STBD 1CSPA 1MJCA 2YV5A 4LW1A 3JAMi 3T1YL 1J5EL 2KHIA 4GNXC 1WCMH 1GD7A 5JEAJ 2HIVA 3AFQA 1LTLA 3J80c 1SE8A 1KC8C 4A3GG 4R4CA 1PH3A 2H5XA 2ZTCA 3RLOA 4HJ7A 1YJ9A 4A93H 2JA7H 2UXBQ 5C3EG 1FGUA 4R4TA 4PMWA 2EXDA 2IHFA 5IYBH 4GNXA 3HOYH 5FLMG 4DV0Q 3G48A 2R7FA 1YHAA 4J15A 3HOUH 4YHHQ 3AQQA 3KOJA 3GTMH 4IFDJ 1HNXL 1XTDA 1WYDA 5M3FH 5J3BA 5M3MH 3ER0A 2Y0SG 5IP7H 4LFCL 4QL5A 5M5WH 4Y7NH 3HOVG 3TS2A 4OO1I 1QUQB 1Y14B 2FXQA 4DUYQ 4LF9L 2MO0A 4POFA 4JV5L 4A3DG 3JAMc 1NTGA 3RLNA 3I56A 2B63G 1EQQA 1PH2A 2E8GA 2GVAA 1HZAA 3VDYA 4JI1Q 4GKJQ 1X3FA 1VQBA 4A3EH 1PH8A 1UE7A 3OTOL 4JBKA 1FVIA 1VQNA 2VNUD 2XGTA 3NBHB 1SROA 4LUZA 3S1RH 1JB7A 2ZJQA 4HJ9A 4DV7Q 4UP8A 4OX9L 3PUWA 2VUMG 4KHPL 1TWCH 3S2HH 2HT1A 4LF4Q 1VQKA 5JJKA 2RHQB 5LMUQ 1QUQA 2OCEA 5IT9c 5C4JH 1E3PA 2EQSA 4P71A 4KI0A 3D31A 4DR1Q 1E7ZA 4X66L 3CPWA 4WJ4A 1BBWA 2HQLA 2QA4A 1Q86C 1YHBA 4A3GH 3W1GA 3A74A 2VS1A 3WWVA 2AKWB 2IT1A 2VW9A 2AWOA 5C3EH 3CCUA 2LXJA 1EYGA 4GOPC 1Z9FA 2K52A 5FLMH 5C44G 4A3FG 3UDGA 1Z47A 2Y0SE 1A0IA 3E9IA 4GN4B 4DR4L 1HH2P 1VQFA 3CC4A 4DR6L 1NMFA 3CCQA 4LWCA 2R7DA 4DV4Q 4BBRG 2VY3A 4YCVA 4P75A 4GOPA 2AWNA 3HOVH 3OYYA 4UP7A 2HIXA 2R92G 2D62A 1PYBA 1L2FA 4OXPA 3U4VA 1I3QH 3UE0A 5GAHC 4DV5L 2B63H 2B29A 5C0XJ 5IYDG 2F4VQ 2WAQG 2N3SA 3AFPA 4LF5Q 1IBLL 3ZJYC 4EQ5A 2D0PA 1UE5A 1VCIA 4LF8Q 4HIMA 4QY7A 4NPSA 3CCEA 3RN2A 3T1HL 5IE8A 4YY3L 4GKKQ 4FDBA 1YITA 3NELA 1YJWA 2UU9L 2E5LL 3S1MH 4PZ7A 4DV6L 4PG3A 4QJFA 4GLAC 3I4MG 1VQGA 1GVPA 3STBC 1Q81C 3GTJH 1XJVA 2I0QA 4IPCA 4APVA 3Q8DA 3HKZE 1U5KA 4NXNQ 2PI2A 5IYBG 3H15A 3GTOH 3M85A 1M1KC 3NEMA 2QGQA 1XMQL 2N8NA 3TREA 5C44H 4LFBL 2KCTA 4A3FH 1ASZA 2R6GA 4YCUA 4HJAA 1K9MC 3I4NG 3CCJA 3PF5A 1XPUA 1UE1A 3D0FA 2R7ZG 3FP9A 4BBSH 4JI5Q 5M3FG 3J80i 3OW2A 1XNRL 2UXCQ 4BBRH 3I7FA 2N78A 5GADC 4MTNA 4AQYQ 3CP0A 3ULPA 4WJ3M 2JA9A 1YVCA 1PH7A 2WAQE 1L0WA 3TQYA 3BU2A 5GROA 4YWLA 3TEHB 4DNIA 2CFMA 2CWPA 2MFIA 3LGJA 4A3EG 5IYDH 1X3GA 2ZTDA 2HHHL 4B3SL 4LF6L 3RR5A 1CUKA 2VQEL 1IBKQ 4DR2L 1ASYA 1HNWQ 3A0JA 1YI2A 4GNXB 4A3MH 2NVYH 5E7NA 4IOAA 2YTYA 2Q2HA 1B8AA 1D8LA 2C35B 3E0EA 4JBJA 4O0AA 3KJPA 1XNQL 4IJHA 2CWAA 1JJCB 2OWOA 1SN8A 3CW2C 3F1ZA 2KHJA 3DLLA 1HR0W 3U50C 1VQLA 3PO3H 2JA8G 3I4MH 4IO9A 1O7IA 3HOXG 4JI6Q 1KRSA 2JK8A 3HOZG 1VQJA 3F2CA 4B3TQ 3HFZB 2E2JH 1VQOA 3S17H 4JI4Q 3L7ZC 4K0KQ 2Q2IA 2PQAA 5BR8Q 3G71A 1I94Q 4PZ8A 4OO1G 1PH1A 3K7UC 3CCLA 3PGZA 4NB3A 3I4NH 1B70B 2ZM6L 3F2DA 2R7ZH 1VQPA 1GKHA 2BH8A 2K5VA 5IP9G 5IYCH 4JYAQ 2F52A 1VQHA 3CC2A 4DV2Q 4JI8L 1S40A 1JJGA 1WOCA 3M9BA 2RCNA 4X64Q 3E9HA 1QVFA 2V1CC 1EOVA 2K50A 3EIVA 3U4ZA 2JEAI 2UUBL 4A4IA 5LMNL 1P16A 1BKBA 1SLJA 5ELNA 4NXMQ 1N33Q 2K5NA 2I5HA 3H3VI 4X65Q 4DK3C 4PZ6A 4DUZQ 1OXVA 3F2BA 4L5SA 2BH2A 3PUYA 1Y1WH 4JI0L 2UXDL 3MXNB 4B3ML 4MZ9A 1YHQA 2UUAL 4OONA 3S15H 4JOIA 1VQ5A 3M4OH 4LNQA 5HY6A 4Y52H 1N32Q 4DKAC 4DR3Q 1HR0Q 2CQOA 2ALYB 4ME3A 5M5YH 1GO3E 2JA8H 3J81c 4GOPB 4RMFA 1W3SA 4C3IH 3HOXH 3J7A5 1N34Q 1FJGQ 3HOZH 2KBNA 4AH6A 4DR7Q 1H95A 1A62A 5M5XH 4JI6L 4DV1Q 3CCRA 1Q7YC 3FKIG 2JA5G 2UXBL 1NMGA 3HKZG 1I6HH 4JI4L 1I94L 3UDXA 2I5MX 3K0XA 2NZHA 2WB1G 2ZJPA 4DV0L 4BBSG 4A3BH 4YHHL 3M4QA 5IP9H 5K36G 2Q2UA 1KL9A 1LYLA 4A3KG 5AJ3Q 3EBEA 2MQHA 1QZHA 4UP9A 1X56A 5GQOA 2CCZA 1MIUA 3CC7A 1SMXA 1T9HA 2L15A 2HHHQ 1OXTA 1V1QA 4DUYL 2F3IA 1LUZA 5FJ8H 3KF6A 1QVGA 4P73A 4GKJL 4DV3Q 1YBYA 3UE1A 3B6YA 2E2IH 1TWFH 4JI1L 1RIPA 3RNUA 4NXML 5GAGC 5JJLA 3BJUA 4X65L 1K0RA 1KAWA 4A3MG 1X6OA 4DUZL 1HZ9A 4LFAQ 3KLWA 1A8VA 1YNXA 3UDIA 3CF5A 4DV7L 1R9TH 1PH6A 1G6PA 3G6EA 4DAYB 1NY4A 1YZ6A 3CQZH 4C3JH 4A3IH 4XTCS 4LF4L 1VQ7A 2OQKA 3M7NA 5LMUL 4IFDI 4X62Q 1JT8A 3PO3G 4YWMA 4DR1L 3S14H 2DGYA 2ID0A 3K81C 1PYSB 3I4OA 1CKOA 1UEBA 2PNHA 4L5QA 1BBUA 1VQ9A 3GTQH 4KLKA 1HJPA 2EIFA 2VZAA 1E22A 3GD7A 3GDEA 1KRTA 1AE2A 2WB1E 3FKIH 2VQFQ 2JQOA 1YEZA 2JA5H 2PI2E 4DV1L 1NE3A 4GLVB 4A75A 4IOCA 4LUVA 2BA0A 4A76A 1J5EQ 3T1YQ 1VQDA 2WP8J 5IYCG 4RG1A 2DUDA 4L5TA 1UE6A 4A3KH 5C4XG 4KHZA 1Q1EA 1HZBA 4DV4L 1D7QA 1AE3A 1KHIA 1V43A 2PMZE 3DM3A 1CKNB 2NN6I 1KQSA 4A3JG 4DR5Q 2B3GA 2Q2TA 2IY5B 3RLFA 2WFWA 3BZKA 1C7YA 3S1QH 3ULJA 4IPDA 4QIWE 5ELOA 1VQCA 1Y1WG 1HNXQ 2F4VL 4LF5L 5GAEC 4DV3L 1C0AA 2PQAB 3RN5A 3ULLA 1TXYA 2MNAA 3H0GG 3KF8B 1S72A 1K73C 1GM5A 1K8GA 2NZOA 3TS0A 4LF8L 4BY1G 2Z0SA 1E1OA 3PO2G 3A5ZB 3EN2A 4JI2Q 4LF9Q 3U58A 4JV5Q 1CKNA 4GKKL 2A19A 1IXRA 4HJ5A 1CSQA 1X54A 1KXLA 3ICEA 2KENA 4IPHA 4O2DA 2ASBA 4H02A 4UY8C 1KD1C 4JBMA 4KHPQ 4UPAA 3S1NH 1TWHH 1UWVA 4NXNL 5C0XI 2OTJA 1N9WA 5IWAQ 4P72A 4B3RQ 2VQFL 1EUJA 1OXSC 4GN3B 4DK6C 4A3BG 3IRBA 2K5HA 3KDFA 4X66Q 1Y1VG 1TWAH 5EAYA 1V9PA 4OWWB 3K8AA 3J81i 1PV4A 4JC0A 3PUXA 1Q46A 4JI5L 5C4XH 4L5RC 2JE6I 3I55A 2UXCL 1N36Q 3HOWG 4YCWA 4DAMA 4GN5A 1PH9A 1L1OC 1VQAA 3JC66 4AQYL 1PH4A 3KYHC 4A3JH 2JJQA 3HKSA 4OWXB 4C3HH 5FJ8G 4JOIC 1XMOQ 2E2HH 3S16H 2UUCQ 2K14A 4DR5L 4A3CH 1XPRA 2AMCB 3CCSA 4DR4Q 1L1OA 2NVQH 4DR6Q 3W1BA 1IBKL 1NBWA 1YJNA 1HNWL 1SFOH 3H0GH 3PO2H 4BY1H 2Z6KC 4A3IG 3M4PA 2A8VA 1JJ2A 3TRZA 3AEVA 1S3OA 5HGQA 1TWGH 4JI2L 2GVBA 2RHSB 5H1SE 4AYBG 4DV5Q 1IZ6A 3GTLH 4HIDA 3CCVA 4JBWA 1M90C 3S2DH 2Z6KA 1IBLQ 1X65A 1IYJB 1I50H 2XTIA 3I2ZA 2IX0A 1FL0A 1PVOA 3KFUA 4B3TL 4R1JA 1C9OA 3CAMA 2K4KA 1Q12A 1K8AC 3GTKH 3KF6B 3PSIA 4TQUS 2JA6H 1EFWA 4K0KL 3T1HQ 5BR8L 1IBMQ 1VQEA 1G291 1J6QA 4YY3Q 5JEAG 2LXKA 5DLQE 2UU9Q 5IWAL 4BA1I 1KIXA 5IY0A 2E5LQ 4B3RL 4DV6Q 1Y1VH 2KCMA 2MO1A 2NVTH 2N49A 3CD6A 3H3VH 5JJIA 1RL2A 4BA2I 3PUZA 2YTXA 4JG2A 2LSSA 2OQ0A 2ES2A 3SGIA 4DPGA 4JYAL 2RF4A 1K83H 4DV2L 3HOWH 2IX1A 4JCVE 4QGUA 4X64L 3A5UA 1N36L 1K3RA 2GN5A 4BY7G 2K75A 3BZCA 1XMQQ 4BXXG 1OXUA 1E24A 4LFBQ 1YIJA 4IFDG 3PUVA 4MNOA 1XMOL 1N33L 1A63A 2YYZA 2UUCL 3K80C 1AH9A 4YWKA 2A1AA 1XNRQ 1EIYB 1EIFA 3ERSX 3PCOB 1WFQA 1EWIA 4AYBE 2JEBI 2CKZB 4LF7Q 1N32L 4DR3L 4R4IA 1JMCA 2QEXA 1HR0L 4JI3Q 4QQBX 1MJEA 1JE5A 2VL6A 3GO5A 4IPGA 5LMNW 4A3DH 4POGA 2D0OA 4B3SQ 4LF6Q 1BVSA 4EX5A 2VQEQ 4DR2Q 1HNZQ 1CKMA 4ALPA 4HIOA 4AIMA 1XPOA 1N34L 2ZJRA 1FJGL 4A3LG 2R93G 1PHJA 4DR7L 3M3YH 4JI7Q 3AYHB 2VUMH 3CXCA 1N8RC 1IL2A 1XNQQ 2NN6G 2YTVA 3NENA 1VS0A 1LM0A 1QVCA 3PIPA 3CMEA 1IBML 3CPFA 4C2MH 3GTPH 1WI5A 1WCMG 4GS3A 2NVXH 5AJ3L 3RZOH 3KJOA 1NJIC 1VQMA 4BY7H 4BXXH 4A93G 3L0OA 2JA7G 4R4QA 3PV0A
chains in the Genus database with same CATH superfamily
3W5OA 3GTGH 3K6OA 2BA1A 3HOYG 1RDPD 1TKWB 2WV6D 3HOUG 1PH5A 1QNKA 2AHOB 2CW0C 1P8LA 1V1PB 1GUTA 3CRKC 4K2KA 4NMZA 3I4MB 1ZEQX 1HZCA 3CMAA 1STHA 5C0XG 5EPJA 2RDHA 3VYRA 5LMNQ 3MWYW 4LF7L 1TQOA 3A55A 4OWTB 4JI3L 2VB2X 2OTLA 5A35A 1Y8NB 3TZUA 2BDOA 3MFYA 1EWCA 4HTHA 3SHLA 2R93H 4B3MQ 4GLXA 2KVMA 3P20A 1SRUA 4HIKA 3H09A 1E2VA 4Y7NB 1TS5A 4TVAB 1Q1BA 5E3FA 4EQOA 3L2PA 1OTCA 3PF4A 4G7OC 2L1BA 4G57A 1CSPA 1MJCA 2YV5A 4LW1A 3JAMi 1Q90A 2B2YA 4RWSC 2NBFA 4A3GG 4R4CA 4WFN3 2ZTCA 1TVXA 2UXBQ 2JA7H 5ELBA 1FGUA 2F0DA 2EXDA 5IYBH 4K8JA 5FLMG 1Q8IA 4ZKBB 1HNXL 1WYDA 5J3BA 3ER0A 2FINB 4LFCL 3TS2A 1QUQB 2FXQA 1Q3LA 4POFA 5M5XB 2V4DA 3RLNA 1EQQA 1PH2A 2E8GA 4ZK9B 1HZAA 3J80L 3VDYA 1WTHA 1VQBA 4A3EH 1PH8A 3DWPA 2B2TC 2O5JC 1FVIA 3NBHB 1JB7A 4HJ9A 4UP8A 1I6VC 4UAIA 3FEWX 1QUQA 2OCEA 5IT9c 1E3PA 2B2TA 5CV8A 4KI0A 4FNFA 2PYKA 4X66L 2SNMA 2HQLA 3KBXA 2QA4A 1YHBA 3WWVA 4I65A 2EVBA 2IT1A 3P75A 4CKCA 2AWOA 4ZKCB 1B50A 1IHZA 2XWBB 5KNCA 1EWHA 4GOPC 5C44G 4IUQA 5I2YA 2KJXA 1A0IA 4ZYSA 3CCQA 2OF1A 2EYFA 3OOCA 4P75A 2WACA 4GOPA 3GTJB 1Z6HA 2AWNA 1B53A 2OEOA 3NHHA 4FYDA 1JR0D 2KEEA 2XN9C 4RKLA 1QJOA 1PYBA 4DV5L 3I4LA 5IYDG 4LF5Q 5FOBB 5EKIA 1VCIA 4QY7A 4LJZC 4OEMB 2AQ3B 3L3OC 5AFWA 4YY3L 1GUWA 1STNA 1YJWA 4QUCA 2UU9L 5KNDA 2KEDA 4LMQD 4JK1C 3S1QB 1GVPA 3STBC 1AFPA 1XJVA 2DY7A 1U4PA 3HKZE 2PI2A 5IYBG 3H15A 4A3MB 3GTOH 1XMQL 1HHVA 2LKVA 1W6JA 2KCTA 1D5XC 1I4XA 2R7ZG 2NYZD 3FP9A 1PRTD 1G8ZD 3J80i 3OW2A 1EL0A 4OGQC 4BBRH 3DUZA 3I7FA 5GADC 2KECA 4MTNA 3E3XA 2E2JB 2JA9A 3S9WA 2EYPA 4DNIA 1SYBA 4A3EG 3L9AX 2K7VA 1EZ8A 3F2UA 3RR5A 1IBKQ 1EY7A 3OWEB 4E6IA 5IGGA 1EQVA 2Q2HA 1B8AA 4XDXA 1XNQL 3I70A 3KJPA 2FHTA 2M9VA 3F1ZA 2KHJA 2NZ1D 4C3HB 3ITPA 1ICFB 1X32A 1ICWA 3I4MH 1CQFA 3HOXG 1SBBB 1VMPA 2JK8A 3HOZG 5CV6A 1VQJA 2BE5C 4C56C 1Y1WB 3K0YA 2Q2IA 5BR8Q 3I73A 1I94Q 4PZ8A 2IWHA 3H0GB 2EY6A 2TMPA 3F2DA 2K5VA 2QCPX 2JA8B 4JYAQ 5CV4A 2XIWA 3CU7A 4DV2Q 3M9BA 1HTPA 2B8GA 3S2DB 4L6TB 1I50B 1QVFA 4FF4A 1LT5D 3EIVA 2JEAI 2EY5A 3TP5A 3VA7A 2MP1A 4A4IA 2JXMB 1P16A 5LMNL 1I6HB 5ELNA 2F0OA 2I5HA 2L9HA 3QJYA 2PO4A 4A3BB 5E4WC 1EIHA 5CC4A 3I72A 4B3ML 4LNQA 5HY6A 4Y52H 1N32Q 2F3VA 4JW0A 4OELB 1I4HA 2A74C 5C3XA 2A69D 3N52A 3J81c 4FVMA 4RMFA 3W3AA 1LTBD 1N34Q 4DR7Q 5M5XH 2UXBL 4JI4L 1M8AA 2A6EC 4X3SA 5IP9H 5K36G 2Q2UA 1LYLA 2B8FA 4A3KG 2FMCA 3VR2A 1MIUA 1SMXA 3X3NA 2B2UA 3DM1A 4P73A 1YBYA 4NXML 4NKLA 4C2MB 1KAWA 4DUZL 1HZ9A 4LFAQ 2A68D 4KD4A 3IFDA 1YZ6A 3CQZH 4XTCS 2OQKA 3EJIA 4X62Q 1JT8A 2O2LD 2Z1CA 4MIUA 5CV7A 1CKOA 3GTQH 4PMCA 1BBUA 3TMEA 2KHSA 1HJPA 1RCVD 2DJGC 2VZAA 3D6WA 2RA4A 3Q6SA 3CC2A 3FKIH 2VQFQ 2JA5H 4DXGA 1A3TA 2K5QA 1NE3A 4GLVB 4IOCA 3T1YQ 1H9KA 3ND9A 3QIAA 3SDZA 3VYSA 5C4XG 3RZDB 1D7QA 4ZAIA 3T4AC 1V43A 1RHPA 1L0YB 2NN6I 2RSNA 2XRQD 5J1ZA 1TWHB 1YNJC 1ZYRC 2IY5B 3S1QH 3ULJA 4FO2A 3MHBA 2F0UA 3NP8A 5LHY1 4LF5L 3MTSA 4DFAA 1J8IA 2PQAB 3ULLA 1TXYA 2JN4A 3KF8B 1K73C 1E1OA 4FF1A 3VR3A 5KRUA 5G3LD 1ML0D 4WRDA 1KDAA 1TR5A 3QOJA 4FP5D 3MZ5A 2KENA 1H9SB 3HOYB 4O2DA 1PDQA 2X6LA 4UY8C 3A8KE 3KF8A 1O80A 2F0IA 4X3UA 4DNTB 1D5ZC 1TY0A 1HQRD 1PV4A 3PUXA 1IL8A 3MXUA 2JE6I 2M00A 4CKEA 1STYA 1SNPA 2JJQA 4C3HH 5EPKA 1NUCA 1BNZA 3S2HB 2K14A 1XPRA 2E2DC 4DR4Q 3W1BA 1IBKL 1NBWA 4KJNA 1YJNA 1SFOH 3H0GH 3WDNA 3FDTA 2N55A 4A3GB 1CTMA 1K3BC 3AEVA 1XWEA 4JI2L 2Z4HA 1QCBD 1M90C 3S2DH 1IBLQ 1X65A 1I50H 2XTIA 2N88A 3KFUA 4R1JA 1C9OA 3CAMA 1QG7A 3KF6B 1IBMQ 5BR8L 5JEAG 3EQLC 2E75C 4BA1I 2EYMA 4DV6Q 2MO1A 5JJIA 1C4QA 4JG2A 3D6CA 4JYAL 1K83H 4DV2L 5A2QE 3A5UA 1QILA 1N36L 1K3RA 1ZKOA 1EQTA 1GJXA 2DNCA 4IFDG 4LFBQ 2G9DA 1XMOL 2UUCL 3C2PA 4YWKA 2A1AA 1XNRQ 4XYQA 2R3ZA 1B3AA 3CHBD 5CBAE 1WFQA 2CKZB 4ZQ3A 4LF7Q 1N32L 5JPMC 1WTWA 4JI3Q 3GTGB 1SNMA 1JE5A 1MJEA 2H1EA 4LF6Q 5C44B 4EX5A 4KKSA 4RGTA 1CKMA 4AIMA 4HN7A 2KUMA 2ZJRA 1N34L 1TS2A 2B39A 4DR7L 3AYHB 1IL2A 1N8RC 3T16A 3MC0B 1M4VA 2YTVA 1VS0A 2K03A 5F2DA 4XQJA 4C2MH 2Q8RE 5E1FA 1WCMG 4Q0FA 4GS3A 1S5CD 5KYLA 5C4HA 3KJOA 1FGBD 3Q23A 4BXXH 4R4QA 5M5WH 3DMUA 3JAME 2EY2A 3F8TA 2F0PA 5I6YA 4P74A 3KLRA 4CJ1B 4LFCQ 4LFAL 2C9OA 3C46A 2I5LX 3E0JA 2UUBQ 1E1TA 5CV9A 3S24A 1EZ6A 3K5NA 1F2MA 2IHEA 2ZTEA 4IJLA 4X62L 5IGBA 3RZDH 3UDFA 4RHSA 1EFID 1SR3A 1U0LA 3MEFA 3PIOA 4JI0Q 3T13A 1CZGA 2R7ZB 4CDCC 1HNZL 4MHEA 3IL8A 2F0JA 2HCIA 4R4OA 1L1OB 4IN3A 1HUMA 4LUOA 3STBD 4XQQA 2P5ZX 3T1YL 3IAYA 4F8MA 1GD7A 2KA7A 3J80c 1OO9B 1SE8A 2B2VC 2JP1A 1KC8C 4A3EB 2H5XA 5A2QL 2PW7A 1ESFA 5C3EG 2SEBD 4OHJA 3GV6A 2B2VA 3HOYH 3HOUH 3V2TA 3R2TA 4YHHQ 1T5XD 1DD2A 1STGA 1STBA 5EBDA 1EYDA 3BZDB 5M3FH 2I46A 4K8IA 2Y0SG 1LACA 3NXWA 1K8MA 4OO1I 3TDQA 1TS4A 5C0XH 1TT2A 2NB0A 3PMFA 1NTGA 2B63G 1PFMA 2GVAA 4M8AA 1F2YA 4JBKA 2VNUD 5DAUA 3PUWA 1F9SA 5L37A 3S2HH 1SYCA 4LF4Q 5JJKA 3R93A 2F4IA 4KK7A 1Q86C 1KNEA 1D2BA 4A3GH 3A74A 2VS1A 2AKWB 3JAML 4I7ZC 4J8QA 5J22A 2K52A 5FLMH 3K58A 2Y0SE 3E9IA 4DR4L 4ID6A 1JE4A 4LWCA 4YCVA 1G2SA 4H0LC 3OYYA 2F0KA 1YNNC 2D62A 3UE0A 1L2FA 1SE4A 5C0XJ 2F4VQ 3AFPA 3SK6A 4CBVA 4F88A 1IBLL 3ZJYC 1DCZA 1JICA 4EQ5A 1UE5A 1I4QA 4KY7A 4LF8Q 1UNSA 4HIMA 4A3KB 1RF2D 1IW7C 4CGYB 3HEJA 4GKKQ 1V8QA 4FDBA 1YITA 1Y69U 4K14A 2F0GA 4PZ7A 2Q8TA 4DV6L 3BYTB 4KJOA 1VQGA 2LS01 2WIIB 1SEBD 3DWAA 4IPCA 4APVA 1PTOB 2L55A 3NEMA 2A6ED 5DM63 3TREA 3KUPA 2EYOA 5C44H 4LFBL 1FNWA 1ASZA 5IODA 4DAYA 1PTOC 3I4NG 1XPUA 1UE1A 1D6EC 4QUFA 4BBSH 1L0XB 5D3DA 5M3FG 4ILWA 1XNRL 3A8IE 1K0SA 2N78A 2KCCA 1PH7A 1CA5A 3BU2A 1EOTA 4YWLA 3VYUA 2CFMA 1JOOA 5IYDH 1X3GA 1X3QA 4LF6L 2QDBA 2PZUA 1HNWQ 3I8ZA 4OL7A 1RTOA 3A0JA 3QR8A 2AUKA 1U4RA 2B2YC 1ET6A 1ET9A 4QF4A 5E7NA 1D8LA 2C35B 4QB4A 5C3WA 1Z7TA 2XSCA 3PQIA 1BOSA 1BCPB 4KKTA 3PO3H 4C1NI 4IO9A 2OXPA 1KRSA 1NAPA 5EQ0A 2WKDA 1E2WA 1VQOA 1BCPC 4JI4Q 2KCNA 3G71A 3K7UC 1EEID 3PGZA 1HTLD 1B70B 2R7ZH 1VQPA 3SVMA 1VQHA 2LMCB 1ZYRD 1YNJD 2MGSA 3MFGA 3C1FA 1KDCA 2UUBL 2F0SA 1SJHD 4UDUC 4RFBA 1SLJA 4NXMQ 3H3VI 4DUZQ 3F2BA 4L5SA 2BH2A 4JI0L 1NR4A 2NVTB 1B4OA 1YHQA 4ME3A 3VR6A 2EYLA 5M5YH 4N8FA 2DJFC 4HEDA 4GOPB 3PIO3 1W3SA 2XNAC 3HOXH 3E6ZX 3HOZH 4AH6A 3WOFA 1A62A 1I4RA 3HKZG 4DA2A 5I6WA 1C8CA 3CQZB 5FK9C 3UDXA 2WB1G 5DNFA 4BBSG 1PXUA 4YHHL 3EBEA 2FFKB 5D14A 1QZHA 3AB9A 1AEXA 1X56A 5CR3A 1C48A 3GTQB 1A15A 3AU7A 2G9HD 3CC7A 1T9HA 3URYA 5BN4A 1B44D 3FKIB 2JA5B 3OSOA 4UHVA 1J9OA 4OIKA 3MVVA 5JAVA 1ILPA 3GTPB 4BS9A 5JPNC 1HUNA 3KLWA 1A8VA 1YNXA 4A3IH 3NQIA 4LF4L 2EJMA 2QW7A 1DJRD 5EBCA 3PO3G 4YWMA 3BDOA 1SYDA 4HMIA 1PYSB 1UEBA 2PNHA 2EXZA 4I7AA 1LABA 2F0WA 4CJ2C 3DEPA 2E74C 4HMJA 3GDEA 1GOZA 2WB1E 2JQOA 1YEZA 1CK1A 2RDGA 4LUVA 1EYAA 1J5EQ 2VXWA 2WP8J 3BVZA 5C5MA 3LWUA 1KABA 3MAQA 3V96A 5K36H 3E5SA 2KQ3A 4DAVA 4A3KH 4KHZA 1KHIA 2YU9B 3OHXC 4A3JG 4IUPA 4IPDA 2ZT9C 2PQEA 4G7ZC 1PTOH 2F4VL 5GAEC 4FXDA 5C6AA 4ZUJA 1NSNS 1S72A 1BR9A 1WCMB 3H6MA 4LF8L 3TP7A 4BY1G 5FO9B 3EN2A 4JI2Q 1KLUD 2TSSA 1T5EA 5IGDA 4JV5Q 2F0HA 2IJ0A 4GKKL 2A19A 2CVRA 4HJ5A 4Z9CB 5EPLA 1EY4A 4RA8A 4IQZA 4FXKC 1MBYA 2EY1A 4RGNA 4DAPA 4H02A 5LL6S 1KD1C 3GTMB 1NNXA 4KHPQ 4UPAA 1SFOB 2NTTA 1UWVA 4C1NK 1N9WA 2Z6BA 1OXSC 5COYA 3IRBA 2K5HA 3KDFA 1TWAH 4KY6A 4JC0A 1Q46A 4KMUC 3SK5A 5C4XH 4L5RC 5T1GA 3SEBA 3I55A 1N36Q 3HOWG 4YCWA 4DAMA 1PH9A 3HKSA 3NBIA 3S16H 1XMOQ 1A3UA 2E2HH 2UUCQ 1TWCB 1GUOA 4A3CH 1CA6A 1LT6D 4H7BA 3CCSA 4DR6Q 2MJ8A 1HNWL 2WINB 3K5MA 1RODA 2Z6KC 4A3IG 1SNDA 1K83B 3TRZA 2D2CC 1G91A 2GVBA 5C3EB 5H1SE 4AYBG 4HIDA 3CCVA 2Z6KA 1WTXA 4MTKA 3I2ZA 5KNBA 3ERQA 2IX0A 4DK0A 1FL0A 3M7GA 1SMYD 3PSIA 4X3KA 3T1HQ 4ODGA 5IGEA 2Y0SB 2LXKA 3ONAB 3C3LA 1KIXA 2EYHA 5KEEA 2E5LQ 1F77A 2B2UC 1MD2D 2KCMA 2NVTH 2N49A 1RL2A 2C5CA 5ISRA 2B63B 2ES2A 3SGIA 4DPGA 2F1MA 2RF4A 1WTPA 4R9WA 4JCVE 5FLXE 4BY7G 2GN5A 3BZCA 2F0EA 1I4PA 3G7LA 3VA5A 2Q8IB 4U68A 2HDMA 3HS0C 3S1MB 1UEAB 2AUJD 3Q22A 1EIFA 3K59A 1EEFD 4AYBE 1DOMA 1S5ED 2MPMA 4CDDC 5M5WB 2QEXA 4RCOA 5E4XA 2HUGA 2D0OA 4B3SQ 1STEA 4ABNA 3NSWA 4DR2Q 1HNZQ 2CH4W 1XPOA 4RKBA 2SDFA 4A3LG 2PCFB 3OIQA 2NN6G 1H9JA 5JEAH 1LM0A 5ELEA 3CPFA 3GTPH 1W6KA 4RAUC 5IOCA 3OMGA 4XT3B 1JB3A 1SDFA 1D1KA 4A93G 3L0OA 3TP8A 2O5IC 1DGSA 3J7ZC 2NVYB 4A3CG 4IFDH 4Q5VA 3U9OA 1HRJA 2HD3A 2ZM6Q 1X55A 4HAEA 5C5LA 3HZXA 3QWNA 3FHWA 4JI8Q 5M3MG 1B7YB 5IP7G 1B9NA 1PZJD 4DXFA 1Q82C 2EYJA 1G51A 3S17B 1X3EA 1SNCA 4P2CB 4B9XA 3R3OA 3HOUB 1EQRA 1WD0A 2YU9H 3QO2A 3I4NB 4NW2A 4X6AH 4FF2A 2UUAQ 1W2BA 5M3FB 3G4SA 1PFSA 4R8NA 2RKSA 4HJ8A 1X9NA 4JI7L 3SR1A 1I5FA 3QB3A 2PW5A 1J5EL 4GNXC 1WCMH 5JEAJ 1PZID 3DXJC 1LTLA 5HURA 1SE3A 4HJ7A 5FLXL 1YJ9A 4R4TA 4PMWA 1SAPA 4GNXA 4X3TA 2CW0D 3S15B 3M4OB 1YHAA 1H9MA 3PIP3 3KOJA 3GTMH 4IFDJ 2L4NA 4KN4C 1RKNA 1JORA 3CRLC 3TBIB 3N6RA 2QKIC 1LTID 2H4OA 3HOVG 2L11A 2SNSA 5HGTA 4JV5L 3JAMc 3I56A 2X6GA 1X3FA 1XTCD 3OTOL 4L8JA 1VQNA 2XGTA 3S1RH 1SROA 2ICIA 4DV7Q 4OX9L 4KHPL 1LO5D 1TWCH 1NCVA 2HT1A 5LMUQ 3D31A 1B2TA 3W1GA 1WVLA 3D4RA 1EY9A 5T1IA 2E2IB 4O42A 1MSHA 3M4YA 3HRZC 5C3EH 3TN2A 2VW9A 3CCUA 2LXJA 1EYCA 2EPBA 3MXNA 3BDCA 3CKIB 5FKAC 1R9TB 2ZXOA 4A3FG 3UDGA 4QMGA 1HH2P 1VQFA 4RHRA 4DR6L 2X69A 1D5MC 2QILA 1GHJA 3NUCA 2F0LA 3I90A 4BWGB 2HIXA 1KDBA 2KOLA 1ONLA 1KXLA 2B63H 3HKZB 2N3SA 1KTKA 3VR4A 4BBSB 2HQEA 3RN2A 3T1HL 2MUYA 5IE8A 1RTNA 2E5LL 3S1MH 4R8IA 3K57A 3EFXD 4QJFA 2I0QA 4XYOA 5EGTA 3FVQA 3M85A 2QGQA 1S5BD 1EY8A 2K33A 2R6GA 4YCUA 1U9RA 3CCJA 3PF5A 3DWQA 4EGVA 4IZ8A 3PO3B 1GUGA 1F2LA 1RD9D 3OPOA 5EKLA 3CP0A 2O4XA 3ULPA 2F0VA 1L0WA 3TQYA 5GROA 2CWPA 2MFIA 1F9PA 3LGJA 4N8X1 4B3SL 1CUKA 1ASYA 4DR2L 2SOBA 1YI2A 4ZRZA 2NVYH 4IOAA 2K01A 2VB3X 2YTYA 4IUNA 3E0EA 4JBJA 4O0AA 2F0MA 4IJHA 1SN8A 3CW2C 3SXHA 3DLLA 1HR0W 3U50C 1PTOF 2JA8G 4HR7B 1WTOA 1O7IA 4CDFC 2A69C 3HFZB 3S17H 3RMHA 3L7ZC 4OO1G 1PH1A 4BY1B 4HCEA 3RUZA 3CCLA 4EQNA 4NB3A 3I4NH 2Z4IA 5M5YB 2ZM6L 2BH8A 3SE0A 4EQPA 5IYCH 3GTLB 1WTRA 4JI8L 1JJGA 1WOCA 2RCNA 2XWJB 4X64Q 3E9HA 3HOXB 3HOZB 3BG3A 4EVOA 1EOVA 4ME5A 3AMUA 1IKLA 2LFNA 3KK7A 1BKBA 3NWTA 1N33Q 2K5NA 1H9RA 2QEJC 4DK3C 4PZ6A 1OXVA 1WD1A 4PNYA 3DHQA 1XYIA 5JVG3 2UUAL 3S15H 4JOIA 5CMDA 2QDLA 3M4OH 1BCPF 5CV5A 4PV1C 3VYTA 4DKAC 4DR3Q 2Z9HA 3HOWB 2ALYB 3GQBA 1O7ZA 5EJWA 1GO3E 2BE5D 5TSSA 4K5XA 4C3IH 1EY6A 2AQ2B 4JI6L 5I9OA 1Q7YC 4RH6A 3FPUB 3RD4A 1NMGA 3P7JA 2QF7A 2DN8A 4A3IB 5ELFA 4IUTA 2ZJPA 3KBGA 1B1ZA 1G6ZA 2E76C 2PZWA 5JVH3 2F0FA 1MI2A 1V1QA 4NDXA 1JWUD 1LUZA 1QVGA 1DXMA 3HG9A 2IW3A 3UE1A 2E2IH 3RNUA 1BO0A 5GAGC 3BJUA 3U9SA 4X65L 1K0RA 1X6OA 5IGFA 3A7LA 1SYEA 3CF5A 3UDIA 4DV7L 1R9TH 4J6HA 1PH6A 1G6PA 2GA4B 2NVXB 4DAYB 4C3JH 3M7NA 2K32A 1VQ7A 5LMUL 2RSOA 3S14H 2ID0A 3K81C 1VQ9A 3I4OA 4L5QA 2JYOA 1BF4A 4GZYC 4KLKA 4N9TA 5DM73 2EIFA 3GD7A 1AE2A 2LY7A 1JC7A 4DV1L 3OIPA 1GXDC 3K5OA 1IKMA 2F0NA 1VQDA 5IYCG 4RG1A 2DUDA 4L5TA 1UE6A 1F2ZA 1Q1EA 1HZBA 4WJWA 5KYIA 2PMZE 1KQSA 1CKNB 4CHTB 1FD7D 2HCCA 4KD3A 1D1IA 2J4XA 3BZKA 4QIWE 1VQCA 3TP6A 4B9WA 3I91A 3K7AB 2RQXA 2J7ZA 1TWAB 4DV3L 1C0AA 4TRDA 2MNAA 5C4XB 3PO2G 3EROA 3NTHA 3TS0A 1EIGA 2Z0SA 3A5ZB 2IPKD 2RDFA 3OW7A 4LF9Q 3U58A 1CKNA 1KLGD 5CGKA 4A93B 3FPPA 5EKKA 1IXRA 3S16B 2E2HB 1X54A 1EU4A 4TSSA 4C3IG 2I07B 3SK4A 3S1NH 2ICEC 3BVMA 2OTJA 5C0XI 5M3MB 1V1PA 4P72A 4GN3B 1AZPA 1Y1VG 5EAYA 4HCSA 4OWWB 3K8AA 2DY8A 1NR2A 4GN5A 3QOLA 2JSOA 1PH4A 4A3JH 4OWXB 4KTAA 1K8OA 4DR5L 5C4JB 1LT3D 3MXGA 4BY1H 4C3JG 1CI3M 3M4PA 2D5DA 1S3OA 5HGQA 4XT1B 1TWGH 1WTQA 1IZ6A 3GTLH 4CKBA 3EA6A 5D65A 1ENAA 1PVOA 2EDGA 5LL6X 1Q12A 3GTKH 2JA6H 1CT1D 5DLQE 3HOVB 5IWAL 4NP5A 5IY0A 4F87A 4B3RL 1PMRA 1DONA 1I3QB 3KLSA 3LX0A 3HOWH 1QWYA 2IX1A 1HFNA 4QGUA 4X64L 2K75A 3NBHA 3BYYB 1E24A 2DNEA 1G2TA 4MNOA 5I2XA 1N33L 2YYZA 1CM9A 1A2UA 1EIYB 1DM0B 3H91A 3ERSX 1O78A 1MSGA 5J39A 2A5HA 4ZLTF 4DR3L 4R4IA 3NE5B 1JCKB 4A3DH 4IPGA 3GO5A 5LMNW 4POGA 1BVSA 2VQEQ 4A3FB 4XQNA 4DF7A 2R93G 2L0CA 4JI7Q 2VUMH 3NENA 3GV3A 3PIPA 1WI5A 2EJGC 2CHBD 4IURA 1SYGA 3J7AF 2NVXH 3RZOH 2A73B 1NJIC 1VQMA 4BY7H 1DOKA 3NQTA 2JA7G 3PV0A 4LAAA 3CCMA 1SNQA 1HCZA 1LT4D 4HSPA 2PPBC 4RCNA 1VQ4A 1VQ6A 1VQIA 1O7YA 1WJJA 1QZGA 1PZKD 1FYCA 3V05A 3G6JB 1Q8KA 3KDFB 5IT9E 5I4DA 3DEOA 1MKHA 4KN7C 5FLXc 1OXXK 1JOKA 2A6HC 1PA6A 2ATWA 1PYWD 2BOSA 3J81j 3OTOQ 2R92H 3Q0AA 4XIGS 4OX9Q 4WORA 2UXDQ 1VQ8A 3BDLA 4A3LH 3LNNA 3H94A 2JA6G 4B08A 4S3SA 2K5WA 2NN6H 2K6AA 4PQXA 3K7AH 1HA5A 1JQYD 4YIJA 2KHIA 2HIVA 3AFQA 4FF3A 3D3RA 3D4WA 1PH3A 1MHWC 1CFMA 3RLOA 3S1RB 1QB5D 2EOTA 4A93H 1ILQA 1A3VA 1JOQA 2IHFA 4CDEC 1VMCA 2FJ2A 1EY5A 3BVGA 3FMCA 4IUVA 1S4ZA 3G48A 2R7FA 4DV0Q 4J15A 1BDOA 1TU2B 1E2ZA 5CORA 3AQQA 4U673 1XTDA 4KKUA 1CHPD 5M3MH 2HDLA 5IP7H 4QL5A 4Y7NH 4DUYQ 1Y14B 4K5WA 4LF9L 2MO0A 4A3DG 2B2WC 1I4GA 4GKJQ 5FO7B 4JI1Q 1UUPA 5BN5A 1UE7A 4LUZA 2ZJQA 3A54A 4HSVA 2VUMG 2B2WA 4QCLA 1VQKA 2RHQB 3J7YW 5C4JH 2EQSA 4P71A 4DR1Q 1E7ZA 3CPWA 4WJ4A 1BBWA 1TWFB 4ULLA 1BQQT 2MHVA 1SYFA 1EYGA 1Z9FA 1HQMC 1Z47A 3IFTA 3QG1A 4GN4B 3A7AB 3CC4A 3D4DA 1NMFA 4DV4Q 2R7DA 4BBRG 2VY3A 2EZVA 3HOVH 1HFGA 5IT9L 4UP7A 4TKOB 1II3A 4ZCKA 2R92G 3LWEA 4OXPA 3U4VA 5GAHC 1I3QH 4J1MA 2B29A 1U4MA 2WAQG 3UI2A 1SNOA 2BDNA 4V190 2D0PA 5DEHA 3MEHA 1A2TA 1ESRA 4NPSA 3CCEA 1AP0A 1SE2A 2FMMA 2RCFA 2K05A 3NELA 2CQAA 3Q24A 4PG3A 4IUUA 4GLAC 3I4MG 2PMZB 1BXTA 1U4LA 3GTJH 1Q81C 5KGUA 3NWSA 3Q8DA 1U5KA 4NXNQ 4QIWB 1M1KC 2N8NA 1PRTF 2PZTA 4A3FH 1K9MC 4HJAA 5FO8B 1DOLA 2K28A 3D0FA 2NTSA 5K5PA 4JI5Q 3X3MA 1EY0A 1YNND 2UXCQ 1QNUA 2IL8A 3OMCA 1AN8A 1QE6A 2Z8LA 4AQYQ 4WJ3M 1GUSA 1YVCA 2WAQE 4N9PA 1ENCA 3TEHB 3J81E 2ZTDA 1IW7D 1PFBA 2VQEL 4KHVA 4K6LA 4GNXB 4A3MH 2XRSD 1GHKA 3T56B 4JPBW 2CWAA 1JJCB 2OWOA 1SSOA 1VQLA 1JWSD 4KY5A 4JI6Q 4K2LA 5NUCA 4RGMA 3F2CA 4B3TQ 1QOHA 2XVSA 2E2JH 2NVQB 1PTOD 1S5DD 4DU9A 4F7XA 4K0KQ 5C4ZA 2PQAA 2OT2A 3TZDA 3PO2B 1DZ1A 1WTVA 2ZXRA 3J7AV 1GKHA 5IP9G 4M1UB 2F52A 1B3QA 1S40A 1H9SA 4C3IB 3HP3A 2NUCA 3P1HA 3O13A 2V1CC 2ENBA 2K50A 3U4ZA 2RVLA 1ZXTA 3EVQA 4X65Q 3NTIA 4JVZA 3R8BA 3PUYA 1Y1WH 1Y1VB 2UXDL 3MXNB 2F0TA 1LTGD 4MZ9A 1LV9A 4OONA 1VQ5A 1BUVT 2BCOA 1HR0Q 2CQOA 4O1NA 3H3VC 1IYUA 2IX3A 1BCPD 1FNUA 2JA8H 2WKCA 3J7A5 1KAAA 1FJGQ 2KBNA 3T53B 1H95A 1FR3A 4DV1Q 3CCRA 3FKIG 2JA5G 4DGZA 4OO1H 3W2DA 1I6HH 4C3JB 1S5FD 2EE1A 1I94L 2I5MX 3K0XA 1PRTB 2NZHA 4DV0L 4A3BH 3M4QA 2K1BA 1PFNA 1K28A 4V0BA 1KL9A 3S14B 5AJ3Q 2MQHA 4UP9A 5GQOA 1PRTC 2CCZA 2L15A 2HHHQ 1OXTA 4DUYL 2F3IA 1KNAA 3M3YB 1LTTD 3KF6A 5FJ8H 3J81L 4GKJL 4DV3Q 3B6YA 1EU3A 1UAPA 1TWFH 2WB1B 1LLRD 1RIPA 4JI1L 5JJLA 2F03A 4A3MG 3D8GA 3KLSX 1LTSD 3G6EA 2F3WA 1A6XA 1NY4A 3BS1A 3ND8A 4IFDI 5D3IB 3R2IA 1E0BA 4DR1L 5BN3A 3K5LA 4OIJA 3OWFA 1MGSA 1TY2A 2DGYA 2L12A 1E22A 1XX8A 1KRTA 3TSSA 2ZXPA 2PI2E 4A75A 5IGCA 1Y8PB 2G5DA 2BA0A 4A76A 1IYVA 2K5DA 3WOEA 1LTAD 4DV4L 1AE3A 3DM3A 3I3CA 4RGOS 1O7LA 1B9MA 3S1NB 4DR5Q 2B3GA 4C3HG 2Q2TA 2R93B 3RLFA 2WFWA 1C7YA 3NPPA 5ELOA 4XXEA 5JJZA 4DNRB 1Y1WG 1HNXQ 1BBXC 3RN5A 5G3LF 1K8GA 3H0GG 1GM5A 2NZOA 1F9RA 1JWMD 1ENFA 4A3JB 4KV6A 2JA7B 2PNRC 1CSQA 2J0TD 1X3PA 3ICEA 4IPHA 1HA6A 2EJFC 2L5TA 2R61A 1TIID 2ASBA 4H13C 4JBMA 1VDZA 2NWGA 3A8JE 4PMBA 1TWHH 4NXNL 2D9UA 1SJED 4LK1C 5IWAQ 4B3RQ 2VQFL 1EUJA 4K5VA 3A56A 4DK6C 4A3BG 3SK8A 4X66Q 5I9PA 1SMYC 1TWGB 5CBEE 1V9PA 4CJ0B 3J81i 1TS3A 4JI5L 4FXGC 1VF5C 1HPCA 2AQ1B 2UXCL 1RJTA 1L1OC 1VQAA 2RBMA 3JC66 4AQYL 3KYHC 1F9QA 3GTKB 5FJ8G 2JA6B 1SXTA 4JOIC 4G4KA 1STAA 4MN3A 1Y8OB 2AMCB 1AZQA 1L1OA 3VR5A 2NVQH 3MXPA 3PO2H 2A6HD 4DK1A 1DYQA 2A8VA 1JJ2A 2A68C 2RHSB 3T51B 4DV5Q 5ELCA 4JBWA 1IYJB 1V1OA 3IKJA 4B3TL 2K4KA 1K8AC 4TQUS 4K0KL 1EFWA 1VQEA 1R4PB 1G291 1J6QA 4YY3Q 1HXYD 3NK9A 2UU9Q 4DN4M 1Y1VH 5M9OA 1CQVA 3CD6A 3H3VH 4AYBB 3FRPB 4BA2I 3PUZA 1LTRD 4A3DB 2YTXA 2LSSA 2OQ0A 1GUNA 4BXXG 1XMQQ 1OXUA 1VF7A 2VUMB 1YIJA 3PUVA 5JOBA 1A63A 4K6DA 3K80C 3MA2B 2K04A 1AH9A 3GP7A 2M2LA 3C1EA 4L63B 3RZOB 3ZYYX 3PCOB 1EWIA 2JEBI 4BY7B 1CHQD 2F0QA 1R4QB 5KIXA 1AW7A 1HR0L 1JMCA 4QQBX 3GTOB 2VL6A 1PLFA 2CH4A 3J80E 4IALA 1FNVA 4ALPA 4HIOA 1FJGL 5CYUA 1PHJA 3M3YH 3CXCA 1XNQQ 4BBRB 5IIFA 1QVCA 3CMEA 1IBML 4G7HC 3HGBA 1XXGA 5ELDA 1CZWA 3NTKA 2R92B 5AJ3L 4ZUIA 2WAQB 4H44C 2HHHL
chains in the Genus database with same CATH topology
3W5OA 3CCMA 3F8TA 1DGSA 2BA1A 3J7ZC 3GTGH 4A3CG 3HOYG 3HOUG 2ZM6Q 1PH5A 1X55A 2AHOB 4P74A 1VQ4A 1VQ6A 1VQIA 1WJJA 1QZGA 3FHWA 4JI8Q 4LFCQ 5M3MG 1P8LA 4LFAL 1B7YB 5IP7G 1HZCA 1Q8KA 3CMAA 3KDFB 2I5LX 1MKHA 5FLXc 5C0XG 1OXXK 1E1TA 1G51A 3S24A 1Q82C 2UUBQ 5LMNQ 1PA6A 1X3EA 2ATWA 2IHEA 2ZTEA 4LF7L 4IJLA 4X62L 3RZDH 2R92H 3UDFA 4OWTB 4JI3L 3J81j 3OTOQ 2OTLA 1EQRA 1U0LA 1SR3A 3MEFA 2YU9H 3PIOA 4JI0Q 4XIGS 4OX9Q 2UXDQ 4X6AH 1VQ8A 2R93H 4A3LH 4B3MQ 2UUAQ 1W2BA 2JA6G 4GLXA 1HNZL 1SRUA 1PFSA 3G4SA 4HIKA 4HJ8A 1X9NA 4JI7L 4TVAB 1Q1BA 1OTCA 4R4OA 3L2PA 3K7AH 3PF4A 1L1OB 1I5FA 4LUOA 3STBD 1CSPA 1MJCA 2YV5A 4LW1A 3JAMi 3T1YL 1J5EL 2KHIA 4GNXC 1WCMH 1GD7A 5JEAJ 2HIVA 3AFQA 1LTLA 3J80c 1SE8A 1KC8C 4A3GG 4R4CA 1PH3A 2H5XA 2ZTCA 3RLOA 4HJ7A 1YJ9A 4A93H 2JA7H 2UXBQ 5C3EG 1FGUA 4R4TA 4PMWA 2EXDA 2IHFA 5IYBH 4GNXA 3HOYH 5FLMG 4DV0Q 3G48A 2R7FA 1YHAA 4J15A 3HOUH 4YHHQ 3AQQA 3KOJA 3GTMH 4IFDJ 1HNXL 1XTDA 1WYDA 5M3FH 5J3BA 5M3MH 3ER0A 2Y0SG 5IP7H 4LFCL 4QL5A 5M5WH 4Y7NH 3HOVG 3TS2A 4OO1I 1QUQB 1Y14B 2FXQA 4DUYQ 4LF9L 2MO0A 4POFA 4JV5L 4A3DG 3JAMc 1NTGA 3RLNA 3I56A 2B63G 1EQQA 1PH2A 2E8GA 2GVAA 1HZAA 3VDYA 4JI1Q 4GKJQ 1X3FA 1VQBA 4A3EH 1PH8A 1UE7A 3OTOL 4JBKA 1FVIA 1VQNA 2VNUD 2XGTA 3NBHB 1SROA 4LUZA 3S1RH 1JB7A 2ZJQA 4HJ9A 4DV7Q 4UP8A 4OX9L 3PUWA 2VUMG 4KHPL 1TWCH 3S2HH 2HT1A 4LF4Q 1VQKA 5JJKA 2RHQB 5LMUQ 1QUQA 2OCEA 5IT9c 5C4JH 1E3PA 2EQSA 4P71A 4KI0A 3D31A 4DR1Q 1E7ZA 4X66L 3CPWA 4WJ4A 1BBWA 2HQLA 2QA4A 1Q86C 1YHBA 4A3GH 3W1GA 3A74A 2VS1A 3WWVA 2AKWB 2IT1A 2VW9A 2AWOA 5C3EH 3CCUA 2LXJA 1EYGA 4GOPC 1Z9FA 2K52A 5FLMH 5C44G 4A3FG 3UDGA 1Z47A 2Y0SE 1A0IA 3E9IA 4GN4B 4DR4L 1HH2P 1VQFA 3CC4A 4DR6L 1NMFA 3CCQA 4LWCA 2R7DA 4DV4Q 4BBRG 2VY3A 4YCVA 4P75A 4GOPA 2AWNA 3HOVH 3OYYA 4UP7A 2HIXA 2R92G 2D62A 1PYBA 1L2FA 4OXPA 3U4VA 1I3QH 3UE0A 5GAHC 4DV5L 2B63H 2B29A 5C0XJ 5IYDG 2F4VQ 2WAQG 2N3SA 3AFPA 4LF5Q 1IBLL 3ZJYC 4EQ5A 2D0PA 1UE5A 1VCIA 4LF8Q 4HIMA 4QY7A 4NPSA 3CCEA 3RN2A 3T1HL 5IE8A 4YY3L 4GKKQ 4FDBA 1YITA 3NELA 1YJWA 2UU9L 2E5LL 3S1MH 4PZ7A 4DV6L 4PG3A 4QJFA 4GLAC 3I4MG 1VQGA 1GVPA 3STBC 1Q81C 3GTJH 1XJVA 2I0QA 4IPCA 4APVA 3Q8DA 3HKZE 1U5KA 4NXNQ 2PI2A 5IYBG 3H15A 3GTOH 3M85A 1M1KC 3NEMA 2QGQA 1XMQL 2N8NA 3TREA 5C44H 4LFBL 2KCTA 4A3FH 1ASZA 2R6GA 4YCUA 4HJAA 1K9MC 3I4NG 3CCJA 3PF5A 1XPUA 1UE1A 3D0FA 2R7ZG 3FP9A 4BBSH 4JI5Q 5M3FG 3J80i 3OW2A 1XNRL 2UXCQ 4BBRH 3I7FA 2N78A 5GADC 4MTNA 4AQYQ 3CP0A 3ULPA 4WJ3M 2JA9A 1YVCA 1PH7A 2WAQE 1L0WA 3TQYA 3BU2A 5GROA 4YWLA 3TEHB 4DNIA 2CFMA 2CWPA 2MFIA 3LGJA 4A3EG 5IYDH 1X3GA 2ZTDA 2HHHL 4B3SL 4LF6L 3RR5A 1CUKA 2VQEL 1IBKQ 4DR2L 1ASYA 1HNWQ 3A0JA 1YI2A 4GNXB 4A3MH 2NVYH 5E7NA 4IOAA 2YTYA 2Q2HA 1B8AA 1D8LA 2C35B 3E0EA 4JBJA 4O0AA 3KJPA 1XNQL 4IJHA 2CWAA 1JJCB 2OWOA 1SN8A 3CW2C 3F1ZA 2KHJA 3DLLA 1HR0W 3U50C 1VQLA 3PO3H 2JA8G 3I4MH 4IO9A 1O7IA 3HOXG 4JI6Q 1KRSA 2JK8A 3HOZG 1VQJA 3F2CA 4B3TQ 3HFZB 2E2JH 1VQOA 3S17H 4JI4Q 3L7ZC 4K0KQ 2Q2IA 2PQAA 5BR8Q 3G71A 1I94Q 4PZ8A 4OO1G 1PH1A 3K7UC 3CCLA 3PGZA 4NB3A 3I4NH 1B70B 2ZM6L 3F2DA 2R7ZH 1VQPA 1GKHA 2BH8A 2K5VA 5IP9G 5IYCH 4JYAQ 2F52A 1VQHA 3CC2A 4DV2Q 4JI8L 1S40A 1JJGA 1WOCA 3M9BA 2RCNA 4X64Q 3E9HA 1QVFA 2V1CC 1EOVA 2K50A 3EIVA 3U4ZA 2JEAI 2UUBL 4A4IA 5LMNL 1P16A 1BKBA 1SLJA 5ELNA 4NXMQ 1N33Q 2K5NA 2I5HA 3H3VI 4X65Q 4DK3C 4PZ6A 4DUZQ 1OXVA 3F2BA 4L5SA 2BH2A 3PUYA 1Y1WH 4JI0L 2UXDL 3MXNB 4B3ML 4MZ9A 1YHQA 2UUAL 4OONA 3S15H 4JOIA 1VQ5A 3M4OH 4LNQA 5HY6A 4Y52H 1N32Q 4DKAC 4DR3Q 1HR0Q 2CQOA 2ALYB 4ME3A 5M5YH 1GO3E 2JA8H 3J81c 4GOPB 4RMFA 1W3SA 4C3IH 3HOXH 3J7A5 1N34Q 1FJGQ 3HOZH 2KBNA 4AH6A 4DR7Q 1H95A 1A62A 5M5XH 4JI6L 4DV1Q 3CCRA 1Q7YC 3FKIG 2JA5G 2UXBL 1NMGA 3HKZG 1I6HH 4JI4L 1I94L 3UDXA 2I5MX 3K0XA 2NZHA 2WB1G 2ZJPA 4DV0L 4BBSG 4A3BH 4YHHL 3M4QA 5IP9H 5K36G 2Q2UA 1KL9A 1LYLA 4A3KG 5AJ3Q 3EBEA 2MQHA 1QZHA 4UP9A 1X56A 5GQOA 2CCZA 1MIUA 3CC7A 1SMXA 1T9HA 2L15A 2HHHQ 1OXTA 1V1QA 4DUYL 2F3IA 1LUZA 5FJ8H 3KF6A 1QVGA 4P73A 4GKJL 4DV3Q 1YBYA 3UE1A 3B6YA 2E2IH 1TWFH 4JI1L 1RIPA 3RNUA 4NXML 5GAGC 5JJLA 3BJUA 4X65L 1K0RA 1KAWA 4A3MG 1X6OA 4DUZL 1HZ9A 4LFAQ 3KLWA 1A8VA 1YNXA 3UDIA 3CF5A 4DV7L 1R9TH 1PH6A 1G6PA 3G6EA 4DAYB 1NY4A 1YZ6A 3CQZH 4C3JH 4A3IH 4XTCS 4LF4L 1VQ7A 2OQKA 3M7NA 5LMUL 4IFDI 4X62Q 1JT8A 3PO3G 4YWMA 4DR1L 3S14H 2DGYA 2ID0A 3K81C 1PYSB 3I4OA 1CKOA 1UEBA 2PNHA 4L5QA 1BBUA 1VQ9A 3GTQH 4KLKA 1HJPA 2EIFA 2VZAA 1E22A 3GD7A 3GDEA 1KRTA 1AE2A 2WB1E 3FKIH 2VQFQ 2JQOA 1YEZA 2JA5H 2PI2E 4DV1L 1NE3A 4GLVB 4A75A 4IOCA 4LUVA 2BA0A 4A76A 1J5EQ 3T1YQ 1VQDA 2WP8J 5IYCG 4RG1A 2DUDA 4L5TA 1UE6A 4A3KH 5C4XG 4KHZA 1Q1EA 1HZBA 4DV4L 1D7QA 1AE3A 1KHIA 1V43A 2PMZE 3DM3A 1CKNB 2NN6I 1KQSA 4A3JG 4DR5Q 2B3GA 2Q2TA 2IY5B 3RLFA 2WFWA 3BZKA 1C7YA 3S1QH 3ULJA 4IPDA 4QIWE 5ELOA 1VQCA 1Y1WG 1HNXQ 2F4VL 4LF5L 5GAEC 4DV3L 1C0AA 2PQAB 3RN5A 3ULLA 1TXYA 2MNAA 3H0GG 3KF8B 1S72A 1K73C 1GM5A 1K8GA 2NZOA 3TS0A 4LF8L 4BY1G 2Z0SA 1E1OA 3PO2G 3A5ZB 3EN2A 4JI2Q 4LF9Q 3U58A 4JV5Q 1CKNA 4GKKL 2A19A 1IXRA 4HJ5A 1CSQA 1X54A 1KXLA 3ICEA 2KENA 4IPHA 4O2DA 2ASBA 4H02A 4UY8C 1KD1C 4JBMA 4KHPQ 4UPAA 3S1NH 1TWHH 1UWVA 4NXNL 5C0XI 2OTJA 1N9WA 5IWAQ 4P72A 4B3RQ 2VQFL 1EUJA 1OXSC 4GN3B 4DK6C 4A3BG 3IRBA 2K5HA 3KDFA 4X66Q 1Y1VG 1TWAH 5EAYA 1V9PA 4OWWB 3K8AA 3J81i 1PV4A 4JC0A 3PUXA 1Q46A 4JI5L 5C4XH 4L5RC 2JE6I 3I55A 2UXCL 1N36Q 3HOWG 4YCWA 4DAMA 4GN5A 1PH9A 1L1OC 1VQAA 3JC66 4AQYL 1PH4A 3KYHC 4A3JH 2JJQA 3HKSA 4OWXB 4C3HH 5FJ8G 4JOIC 1XMOQ 2E2HH 3S16H 2UUCQ 2K14A 4DR5L 4A3CH 1XPRA 2AMCB 3CCSA 4DR4Q 1L1OA 2NVQH 4DR6Q 3W1BA 1IBKL 1NBWA 1YJNA 1HNWL 1SFOH 3H0GH 3PO2H 4BY1H 2Z6KC 4A3IG 3M4PA 2A8VA 1JJ2A 3TRZA 3AEVA 1S3OA 5HGQA 1TWGH 4JI2L 2GVBA 2RHSB 5H1SE 4AYBG 4DV5Q 1IZ6A 3GTLH 4HIDA 3CCVA 4JBWA 1M90C 3S2DH 2Z6KA 1IBLQ 1X65A 1IYJB 1I50H 2XTIA 3I2ZA 2IX0A 1FL0A 1PVOA 3KFUA 4B3TL 4R1JA 1C9OA 3CAMA 2K4KA 1Q12A 1K8AC 3GTKH 3KF6B 3PSIA 4TQUS 2JA6H 1EFWA 4K0KL 3T1HQ 5BR8L 1IBMQ 1VQEA 1G291 1J6QA 4YY3Q 5JEAG 2LXKA 5DLQE 2UU9Q 5IWAL 4BA1I 1KIXA 5IY0A 2E5LQ 4B3RL 4DV6Q 1Y1VH 2KCMA 2MO1A 2NVTH 2N49A 3CD6A 3H3VH 5JJIA 1RL2A 4BA2I 3PUZA 2YTXA 4JG2A 2LSSA 2OQ0A 2ES2A 3SGIA 4DPGA 4JYAL 2RF4A 1K83H 4DV2L 3HOWH 2IX1A 4JCVE 4QGUA 4X64L 3A5UA 1N36L 1K3RA 2GN5A 4BY7G 2K75A 3BZCA 1XMQQ 4BXXG 1OXUA 1E24A 4LFBQ 1YIJA 4IFDG 3PUVA 4MNOA 1XMOL 1N33L 1A63A 2YYZA 2UUCL 3K80C 1AH9A 4YWKA 2A1AA 1XNRQ 1EIYB 1EIFA 3ERSX 3PCOB 1WFQA 1EWIA 4AYBE 2JEBI 2CKZB 4LF7Q 1N32L 4DR3L 4R4IA 1JMCA 2QEXA 1HR0L 4JI3Q 4QQBX 1MJEA 1JE5A 2VL6A 3GO5A 4IPGA 5LMNW 4A3DH 4POGA 2D0OA 4B3SQ 4LF6Q 1BVSA 4EX5A 2VQEQ 4DR2Q 1HNZQ 1CKMA 4ALPA 4HIOA 4AIMA 1XPOA 1N34L 2ZJRA 1FJGL 4A3LG 2R93G 1PHJA 4DR7L 3M3YH 4JI7Q 3AYHB 2VUMH 3CXCA 1N8RC 1IL2A 1XNQQ 2NN6G 2YTVA 3NENA 1VS0A 1LM0A 1QVCA 3PIPA 3CMEA 1IBML 3CPFA 4C2MH 3GTPH 1WI5A 1WCMG 4GS3A 2NVXH 5AJ3L 3RZOH 3KJOA 1NJIC 1VQMA 4BY7H 4BXXH 4A93G 3L0OA 2JA7G 4R4QA 3PV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5O A;  3CCM A;  3F8T A;  1DGS A;  2BA1 A;  3J7Z C;  3GTG H;  4A3C G;  3HOY G;  3HOU G;  2ZM6 Q;  1PH5 A;  1X55 A;  2AHO B;  4P74 A;  1VQ4 A;  1VQ6 A;  1VQI A;  1WJJ A;  1QZG A;  3FHW A;  4JI8 Q;  4LFC Q;  5M3M G;  1P8L A;  4LFA L;  1B7Y B;  5IP7 G;  1HZC A;  1Q8K A;  3CMA A;  3KDF B;  2I5L X;  1MKH A;  5FLX c;  5C0X G;  1OXX K;  1E1T A;  1G51 A;  3S24 A;  1Q82 C;  2UUB Q;  5LMN Q;  1PA6 A;  1X3E A;  2ATW A;  2IHE A;  2ZTE A;  4LF7 L;  4IJL A;  4X62 L;  3RZD H;  2R92 H;  3UDF A;  4OWT B;  4JI3 L;  3J81 j;  3OTO Q;  2OTL A;  1EQR A;  1U0L A;  1SR3 A;  3MEF A;  2YU9 H;  3PIO A;  4JI0 Q;  4XIG S;  4OX9 Q;  2UXD Q;  4X6A H;  1VQ8 A;  2R93 H;  4A3L H;  4B3M Q;  2UUA Q;  1W2B A;  2JA6 G;  4GLX A;  1HNZ L;  1SRU A;  1PFS A;  3G4S A;  4HIK A;  4HJ8 A;  1X9N A;  4JI7 L;  4TVA B;  1Q1B A;  1OTC A;  4R4O A;  3L2P A;  3K7A H;  3PF4 A;  1L1O B;  1I5F A;  4LUO A;  3STB D;  1CSP A;  1MJC A;  2YV5 A;  4LW1 A;  3JAM i;  3T1Y L;  1J5E L;  2KHI A;  4GNX C;  1WCM H;  1GD7 A;  5JEA J;  2HIV A;  3AFQ A;  1LTL A;  3J80 c;  1SE8 A;  1KC8 C;  4A3G G;  4R4C A;  1PH3 A;  2H5X A;  2ZTC A;  3RLO A;  4HJ7 A;  1YJ9 A;  4A93 H;  2JA7 H;  2UXB Q;  5C3E G;  1FGU A;  4R4T A;  4PMW A;  2EXD A;  2IHF A;  5IYB H;  4GNX A;  3HOY H;  5FLM G;  4DV0 Q;  3G48 A;  2R7F A;  1YHA A;  4J15 A;  3HOU H;  4YHH Q;  3AQQ A;  3KOJ A;  3GTM H;  4IFD J;  1HNX L;  1XTD A;  1WYD A;  5M3F H;  5J3B A;  5M3M H;  3ER0 A;  2Y0S G;  5IP7 H;  4LFC L;  4QL5 A;  5M5W H;  4Y7N H;  3HOV G;  3TS2 A;  4OO1 I;  1QUQ B;  1Y14 B;  2FXQ A;  4DUY Q;  4LF9 L;  2MO0 A;  4POF A;  4JV5 L;  4A3D G;  3JAM c;  1NTG A;  3RLN A;  3I56 A;  2B63 G;  1EQQ A;  1PH2 A;  2E8G A;  2GVA A;  1HZA A;  3VDY A;  4JI1 Q;  4GKJ Q;  1X3F A;  1VQB A;  4A3E H;  1PH8 A;  1UE7 A;  3OTO L;  4JBK A;  1FVI A;  1VQN A;  2VNU D;  2XGT A;  3NBH B;  1SRO A;  4LUZ A;  3S1R H;  1JB7 A;  2ZJQ A;  4HJ9 A;  4DV7 Q;  4UP8 A;  4OX9 L;  3PUW A;  2VUM G;  4KHP L;  1TWC H;  3S2H H;  2HT1 A;  4LF4 Q;  1VQK A;  5JJK A;  2RHQ B;  5LMU Q;  1QUQ A;  2OCE A;  5IT9 c;  5C4J H;  1E3P A;  2EQS A;  4P71 A;  4KI0 A;  3D31 A;  4DR1 Q;  1E7Z A;  4X66 L;  3CPW A;  4WJ4 A;  1BBW A;  2HQL A;  2QA4 A;  1Q86 C;  1YHB A;  4A3G H;  3W1G A;  3A74 A;  2VS1 A;  3WWV A;  2AKW B;  2IT1 A;  2VW9 A;  2AWO A;  5C3E H;  3CCU A;  2LXJ A;  1EYG A;  4GOP C;  1Z9F A;  2K52 A;  5FLM H;  5C44 G;  4A3F G;  3UDG A;  1Z47 A;  2Y0S E;  1A0I A;  3E9I A;  4GN4 B;  4DR4 L;  1HH2 P;  1VQF A;  3CC4 A;  4DR6 L;  1NMF A;  3CCQ A;  4LWC A;  2R7D A;  4DV4 Q;  4BBR G;  2VY3 A;  4YCV A;  4P75 A;  4GOP A;  2AWN A;  3HOV H;  3OYY A;  4UP7 A;  2HIX A;  2R92 G;  2D62 A;  1PYB A;  1L2F A;  4OXP A;  3U4V A;  1I3Q H;  3UE0 A;  5GAH C;  4DV5 L;  2B63 H;  2B29 A;  5C0X J;  5IYD G;  2F4V Q;  2WAQ G;  2N3S A;  3AFP A;  4LF5 Q;  1IBL L;  3ZJY C;  4EQ5 A;  2D0P A;  1UE5 A;  1VCI A;  4LF8 Q;  4HIM A;  4QY7 A;  4NPS A;  3CCE A;  3RN2 A;  3T1H L;  5IE8 A;  4YY3 L;  4GKK Q;  4FDB A;  1YIT A;  3NEL A;  1YJW A;  2UU9 L;  2E5L L;  3S1M H;  4PZ7 A;  4DV6 L;  4PG3 A;  4QJF A;  4GLA C;  3I4M G;  1VQG A;  1GVP A;  3STB C;  1Q81 C;  3GTJ H;  1XJV A;  2I0Q A;  4IPC A;  4APV A;  3Q8D A;  3HKZ E;  1U5K A;  4NXN Q;  2PI2 A;  5IYB G;  3H15 A;  3GTO H;  3M85 A;  1M1K C;  3NEM A;  2QGQ A;  1XMQ L;  2N8N A;  3TRE A;  5C44 H;  4LFB L;  2KCT A;  4A3F H;  1ASZ A;  2R6G A;  4YCU A;  4HJA A;  1K9M C;  3I4N G;  3CCJ A;  3PF5 A;  1XPU A;  1UE1 A;  3D0F A;  2R7Z G;  3FP9 A;  4BBS H;  4JI5 Q;  5M3F G;  3J80 i;  3OW2 A;  1XNR L;  2UXC Q;  4BBR H;  3I7F A;  2N78 A;  5GAD C;  4MTN A;  4AQY Q;  3CP0 A;  3ULP A;  4WJ3 M;  2JA9 A;  1YVC A;  1PH7 A;  2WAQ E;  1L0W A;  3TQY A;  3BU2 A;  5GRO A;  4YWL A;  3TEH B;  4DNI A;  2CFM A;  2CWP A;  2MFI A;  3LGJ A;  4A3E G;  5IYD H;  1X3G A;  2ZTD A;  2HHH L;  4B3S L;  4LF6 L;  3RR5 A;  1CUK A;  2VQE L;  1IBK Q;  4DR2 L;  1ASY A;  1HNW Q;  3A0J A;  1YI2 A;  4GNX B;  4A3M H;  2NVY H;  5E7N A;  4IOA A;  2YTY A;  2Q2H A;  1B8A A;  1D8L A;  2C35 B;  3E0E A;  4JBJ A;  4O0A A;  3KJP A;  1XNQ L;  4IJH A;  2CWA A;  1JJC B;  2OWO A;  1SN8 A;  3CW2 C;  3F1Z A;  2KHJ A;  3DLL A;  1HR0 W;  3U50 C;  1VQL A;  3PO3 H;  2JA8 G;  3I4M H;  4IO9 A;  1O7I A;  3HOX G;  4JI6 Q;  1KRS A;  2JK8 A;  3HOZ G;  1VQJ A;  3F2C A;  4B3T Q;  3HFZ B;  2E2J H;  1VQO A;  3S17 H;  4JI4 Q;  3L7Z C;  4K0K Q;  2Q2I A;  2PQA A;  5BR8 Q;  3G71 A;  1I94 Q;  4PZ8 A;  4OO1 G;  1PH1 A;  3K7U C;  3CCL A;  3PGZ A;  4NB3 A;  3I4N H;  1B70 B;  2ZM6 L;  3F2D A;  2R7Z H;  1VQP A;  1GKH A;  2BH8 A;  2K5V A;  5IP9 G;  5IYC H;  4JYA Q;  2F52 A;  1VQH A;  3CC2 A;  4DV2 Q;  4JI8 L;  1S40 A;  1JJG A;  1WOC A;  3M9B A;  2RCN A;  4X64 Q;  3E9H A;  1QVF A;  2V1C C;  1EOV A;  2K50 A;  3EIV A;  3U4Z A;  2JEA I;  2UUB L;  4A4I A;  5LMN L;  1P16 A;  1BKB A;  1SLJ A;  5ELN A;  4NXM Q;  1N33 Q;  2K5N A;  2I5H A;  3H3V I;  4X65 Q;  4DK3 C;  4PZ6 A;  4DUZ Q;  1OXV A;  3F2B A;  4L5S A;  2BH2 A;  3PUY A;  1Y1W H;  4JI0 L;  2UXD L;  3MXN B;  4B3M L;  4MZ9 A;  1YHQ A;  2UUA L;  4OON A;  3S15 H;  4JOI A;  1VQ5 A;  3M4O H;  4LNQ A;  5HY6 A;  4Y52 H;  1N32 Q;  4DKA C;  4DR3 Q;  1HR0 Q;  2CQO A;  2ALY B;  4ME3 A;  5M5Y H;  1GO3 E;  2JA8 H;  3J81 c;  4GOP B;  4RMF A;  1W3S A;  4C3I H;  3HOX H;  3J7A 5;  1N34 Q;  1FJG Q;  3HOZ H;  2KBN A;  4AH6 A;  4DR7 Q;  1H95 A;  1A62 A;  5M5X H;  4JI6 L;  4DV1 Q;  3CCR A;  1Q7Y C;  3FKI G;  2JA5 G;  2UXB L;  1NMG A;  3HKZ G;  1I6H H;  4JI4 L;  1I94 L;  3UDX A;  2I5M X;  3K0X A;  2NZH A;  2WB1 G;  2ZJP A;  4DV0 L;  4BBS G;  4A3B H;  4YHH L;  3M4Q A;  5IP9 H;  5K36 G;  2Q2U A;  1KL9 A;  1LYL A;  4A3K G;  5AJ3 Q;  3EBE A;  2MQH A;  1QZH A;  4UP9 A;  1X56 A;  5GQO A;  2CCZ A;  1MIU A;  3CC7 A;  1SMX A;  1T9H A;  2L15 A;  2HHH Q;  1OXT A;  1V1Q A;  4DUY L;  2F3I A;  1LUZ A;  5FJ8 H;  3KF6 A;  1QVG A;  4P73 A;  4GKJ L;  4DV3 Q;  1YBY A;  3UE1 A;  3B6Y A;  2E2I H;  1TWF H;  4JI1 L;  1RIP A;  3RNU A;  4NXM L;  5GAG C;  5JJL A;  3BJU A;  4X65 L;  1K0R A;  1KAW A;  4A3M G;  1X6O A;  4DUZ L;  1HZ9 A;  4LFA Q;  3KLW A;  1A8V A;  1YNX A;  3UDI A;  3CF5 A;  4DV7 L;  1R9T H;  1PH6 A;  1G6P A;  3G6E A;  4DAY B;  1NY4 A;  1YZ6 A;  3CQZ H;  4C3J H;  4A3I H;  4XTC S;  4LF4 L;  1VQ7 A;  2OQK A;  3M7N A;  5LMU L;  4IFD I;  4X62 Q;  1JT8 A;  3PO3 G;  4YWM A;  4DR1 L;  3S14 H;  2DGY A;  2ID0 A;  3K81 C;  1PYS B;  3I4O A;  1CKO A;  1UEB A;  2PNH A;  4L5Q A;  1BBU A;  1VQ9 A;  3GTQ H;  4KLK A;  1HJP A;  2EIF A;  2VZA A;  1E22 A;  3GD7 A;  3GDE A;  1KRT A;  1AE2 A;  2WB1 E;  3FKI H;  2VQF Q;  2JQO A;  1YEZ A;  2JA5 H;  2PI2 E;  4DV1 L;  1NE3 A;  4GLV B;  4A75 A;  4IOC A;  4LUV A;  2BA0 A;  4A76 A;  1J5E Q;  3T1Y Q;  1VQD A;  2WP8 J;  5IYC G;  4RG1 A;  2DUD A;  4L5T A;  1UE6 A;  4A3K H;  5C4X G;  4KHZ A;  1Q1E A;  1HZB A;  4DV4 L;  1D7Q A;  1AE3 A;  1KHI A;  1V43 A;  2PMZ E;  3DM3 A;  1CKN B;  2NN6 I;  1KQS A;  4A3J G;  4DR5 Q;  2B3G A;  2Q2T A;  2IY5 B;  3RLF A;  2WFW A;  3BZK A;  1C7Y A;  3S1Q H;  3ULJ A;  4IPD A;  4QIW E;  5ELO A;  1VQC A;  1Y1W G;  1HNX Q;  2F4V L;  4LF5 L;  5GAE C;  4DV3 L;  1C0A A;  2PQA B;  3RN5 A;  3ULL A;  1TXY A;  2MNA A;  3H0G G;  3KF8 B;  1S72 A;  1K73 C;  1GM5 A;  1K8G A;  2NZO A;  3TS0 A;  4LF8 L;  4BY1 G;  2Z0S A;  1E1O A;  3PO2 G;  3A5Z B;  3EN2 A;  4JI2 Q;  4LF9 Q;  3U58 A;  4JV5 Q;  1CKN A;  4GKK L;  2A19 A;  1IXR A;  4HJ5 A;  1CSQ A;  1X54 A;  1KXL A;  3ICE A;  2KEN A;  4IPH A;  4O2D A;  2ASB A;  4H02 A;  4UY8 C;  1KD1 C;  4JBM A;  4KHP Q;  4UPA A;  3S1N H;  1TWH H;  1UWV A;  4NXN L;  5C0X I;  2OTJ A;  1N9W A;  5IWA Q;  4P72 A;  4B3R Q;  2VQF L;  1EUJ A;  1OXS C;  4GN3 B;  4DK6 C;  4A3B G;  3IRB A;  2K5H A;  3KDF A;  4X66 Q;  1Y1V G;  1TWA H;  5EAY A;  1V9P A;  4OWW B;  3K8A A;  3J81 i;  1PV4 A;  4JC0 A;  3PUX A;  1Q46 A;  4JI5 L;  5C4X H;  4L5R C;  2JE6 I;  3I55 A;  2UXC L;  1N36 Q;  3HOW G;  4YCW A;  4DAM A;  4GN5 A;  1PH9 A;  1L1O C;  1VQA A;  3JC6 6;  4AQY L;  1PH4 A;  3KYH C;  4A3J H;  2JJQ A;  3HKS A;  4OWX B;  4C3H H;  5FJ8 G;  4JOI C;  1XMO Q;  2E2H H;  3S16 H;  2UUC Q;  2K14 A;  4DR5 L;  4A3C H;  1XPR A;  2AMC B;  3CCS A;  4DR4 Q;  1L1O A;  2NVQ H;  4DR6 Q;  3W1B A;  1IBK L;  1NBW A;  1YJN A;  1HNW L;  1SFO H;  3H0G H;  3PO2 H;  4BY1 H;  2Z6K C;  4A3I G;  3M4P A;  2A8V A;  1JJ2 A;  3TRZ A;  3AEV A;  1S3O A;  5HGQ A;  1TWG H;  4JI2 L;  2GVB A;  2RHS B;  5H1S E;  4AYB G;  4DV5 Q;  1IZ6 A;  3GTL H;  4HID A;  3CCV A;  4JBW A;  1M90 C;  3S2D H;  2Z6K A;  1IBL Q;  1X65 A;  1IYJ B;  1I50 H;  2XTI A;  3I2Z A;  2IX0 A;  1FL0 A;  1PVO A;  3KFU A;  4B3T L;  4R1J A;  1C9O A;  3CAM A;  2K4K A;  1Q12 A;  1K8A C;  3GTK H;  3KF6 B;  3PSI A;  4TQU S;  2JA6 H;  1EFW A;  4K0K L;  3T1H Q;  5BR8 L;  1IBM Q;  1VQE A;  1G29 1;  1J6Q A;  4YY3 Q;  5JEA G;  2LXK A;  5DLQ E;  2UU9 Q;  5IWA L;  4BA1 I;  1KIX A;  5IY0 A;  2E5L Q;  4B3R L;  4DV6 Q;  1Y1V H;  2KCM A;  2MO1 A;  2NVT H;  2N49 A;  3CD6 A;  3H3V H;  5JJI A;  1RL2 A;  4BA2 I;  3PUZ A;  2YTX A;  4JG2 A;  2LSS A;  2OQ0 A;  2ES2 A;  3SGI A;  4DPG A;  4JYA L;  2RF4 A;  1K83 H;  4DV2 L;  3HOW H;  2IX1 A;  4JCV E;  4QGU A;  4X64 L;  3A5U A;  1N36 L;  1K3R A;  2GN5 A;  4BY7 G;  2K75 A;  3BZC A;  1XMQ Q;  4BXX G;  1OXU A;  1E24 A;  4LFB Q;  1YIJ A;  4IFD G;  3PUV A;  4MNO A;  1XMO L;  1N33 L;  1A63 A;  2YYZ A;  2UUC L;  3K80 C;  1AH9 A;  4YWK A;  2A1A A;  1XNR Q;  1EIY B;  1EIF A;  3ERS X;  3PCO B;  1WFQ A;  1EWI A;  4AYB E;  2JEB I;  2CKZ B;  4LF7 Q;  1N32 L;  4DR3 L;  4R4I A;  1JMC A;  2QEX A;  1HR0 L;  4JI3 Q;  4QQB X;  1MJE A;  1JE5 A;  2VL6 A;  3GO5 A;  4IPG A;  5LMN W;  4A3D H;  4POG A;  2D0O A;  4B3S Q;  4LF6 Q;  1BVS A;  4EX5 A;  2VQE Q;  4DR2 Q;  1HNZ Q;  1CKM A;  4ALP A;  4HIO A;  4AIM A;  1XPO A;  1N34 L;  2ZJR A;  1FJG L;  4A3L G;  2R93 G;  1PHJ A;  4DR7 L;  3M3Y H;  4JI7 Q;  3AYH B;  2VUM H;  3CXC A;  1N8R C;  1IL2 A;  1XNQ Q;  2NN6 G;  2YTV A;  3NEN A;  1VS0 A;  1LM0 A;  1QVC A;  3PIP A;  3CME A;  1IBM L;  3CPF A;  4C2M H;  3GTP H;  1WI5 A;  1WCM G;  4GS3 A;  2NVX H;  5AJ3 L;  3RZO H;  3KJO A;  1NJI C;  1VQM A;  4BY7 H;  4BXX H;  4A93 G;  3L0O A;  2JA7 G;  4R4Q A;  3PV0 A; 
#chains in the Genus database with same CATH topology
 3W5O A;  3GTG H;  3K6O A;  2BA1 A;  3HOY G;  1RDP D;  1TKW B;  2WV6 D;  3HOU G;  1PH5 A;  1QNK A;  2AHO B;  2CW0 C;  1P8L A;  1V1P B;  1GUT A;  3CRK C;  4K2K A;  4NMZ A;  3I4M B;  1ZEQ X;  1HZC A;  3CMA A;  1STH A;  5C0X G;  5EPJ A;  2RDH A;  3VYR A;  5LMN Q;  3MWY W;  4LF7 L;  1TQO A;  3A55 A;  4OWT B;  4JI3 L;  2VB2 X;  2OTL A;  5A35 A;  1Y8N B;  3TZU A;  2BDO A;  3MFY A;  1EWC A;  4HTH A;  3SHL A;  2R93 H;  4B3M Q;  4GLX A;  2KVM A;  3P20 A;  1SRU A;  4HIK A;  3H09 A;  1E2V A;  4Y7N B;  1TS5 A;  4TVA B;  1Q1B A;  5E3F A;  4EQO A;  3L2P A;  1OTC A;  3PF4 A;  4G7O C;  2L1B A;  4G57 A;  1CSP A;  1MJC A;  2YV5 A;  4LW1 A;  3JAM i;  1Q90 A;  2B2Y A;  4RWS C;  2NBF A;  4A3G G;  4R4C A;  4WFN 3;  2ZTC A;  1TVX A;  2UXB Q;  2JA7 H;  5ELB A;  1FGU A;  2F0D A;  2EXD A;  5IYB H;  4K8J A;  5FLM G;  1Q8I A;  4ZKB B;  1HNX L;  1WYD A;  5J3B A;  3ER0 A;  2FIN B;  4LFC L;  3TS2 A;  1QUQ B;  2FXQ A;  1Q3L A;  4POF A;  5M5X B;  2V4D A;  3RLN A;  1EQQ A;  1PH2 A;  2E8G A;  4ZK9 B;  1HZA A;  3J80 L;  3VDY A;  1WTH A;  1VQB A;  4A3E H;  1PH8 A;  3DWP A;  2B2T C;  2O5J C;  1FVI A;  3NBH B;  1JB7 A;  4HJ9 A;  4UP8 A;  1I6V C;  4UAI A;  3FEW X;  1QUQ A;  2OCE A;  5IT9 c;  1E3P A;  2B2T A;  5CV8 A;  4KI0 A;  4FNF A;  2PYK A;  4X66 L;  2SNM A;  2HQL A;  3KBX A;  2QA4 A;  1YHB A;  3WWV A;  4I65 A;  2EVB A;  2IT1 A;  3P75 A;  4CKC A;  2AWO A;  4ZKC B;  1B50 A;  1IHZ A;  2XWB B;  5KNC A;  1EWH A;  4GOP C;  5C44 G;  4IUQ A;  5I2Y A;  2KJX A;  1A0I A;  4ZYS A;  3CCQ A;  2OF1 A;  2EYF A;  3OOC A;  4P75 A;  2WAC A;  4GOP A;  3GTJ B;  1Z6H A;  2AWN A;  1B53 A;  2OEO A;  3NHH A;  4FYD A;  1JR0 D;  2KEE A;  2XN9 C;  4RKL A;  1QJO A;  1PYB A;  4DV5 L;  3I4L A;  5IYD G;  4LF5 Q;  5FOB B;  5EKI A;  1VCI A;  4QY7 A;  4LJZ C;  4OEM B;  2AQ3 B;  3L3O C;  5AFW A;  4YY3 L;  1GUW A;  1STN A;  1YJW A;  4QUC A;  2UU9 L;  5KND A;  2KED A;  4LMQ D;  4JK1 C;  3S1Q B;  1GVP A;  3STB C;  1AFP A;  1XJV A;  2DY7 A;  1U4P A;  3HKZ E;  2PI2 A;  5IYB G;  3H15 A;  4A3M B;  3GTO H;  1XMQ L;  1HHV A;  2LKV A;  1W6J A;  2KCT A;  1D5X C;  1I4X A;  2R7Z G;  2NYZ D;  3FP9 A;  1PRT D;  1G8Z D;  3J80 i;  3OW2 A;  1EL0 A;  4OGQ C;  4BBR H;  3DUZ A;  3I7F A;  5GAD C;  2KEC A;  4MTN A;  3E3X A;  2E2J B;  2JA9 A;  3S9W A;  2EYP A;  4DNI A;  1SYB A;  4A3E G;  3L9A X;  2K7V A;  1EZ8 A;  3F2U A;  3RR5 A;  1IBK Q;  1EY7 A;  3OWE B;  4E6I A;  5IGG A;  1EQV A;  2Q2H A;  1B8A A;  4XDX A;  1XNQ L;  3I70 A;  3KJP A;  2FHT A;  2M9V A;  3F1Z A;  2KHJ A;  2NZ1 D;  4C3H B;  3ITP A;  1ICF B;  1X32 A;  1ICW A;  3I4M H;  1CQF A;  3HOX G;  1SBB B;  1VMP A;  2JK8 A;  3HOZ G;  5CV6 A;  1VQJ A;  2BE5 C;  4C56 C;  1Y1W B;  3K0Y A;  2Q2I A;  5BR8 Q;  3I73 A;  1I94 Q;  4PZ8 A;  2IWH A;  3H0G B;  2EY6 A;  2TMP A;  3F2D A;  2K5V A;  2QCP X;  2JA8 B;  4JYA Q;  5CV4 A;  2XIW A;  3CU7 A;  4DV2 Q;  3M9B A;  1HTP A;  2B8G A;  3S2D B;  4L6T B;  1I50 B;  1QVF A;  4FF4 A;  1LT5 D;  3EIV A;  2JEA I;  2EY5 A;  3TP5 A;  3VA7 A;  2MP1 A;  4A4I A;  2JXM B;  1P16 A;  5LMN L;  1I6H B;  5ELN A;  2F0O A;  2I5H A;  2L9H A;  3QJY A;  2PO4 A;  4A3B B;  5E4W C;  1EIH A;  5CC4 A;  3I72 A;  4B3M L;  4LNQ A;  5HY6 A;  4Y52 H;  1N32 Q;  2F3V A;  4JW0 A;  4OEL B;  1I4H A;  2A74 C;  5C3X A;  2A69 D;  3N52 A;  3J81 c;  4FVM A;  4RMF A;  3W3A A;  1LTB D;  1N34 Q;  4DR7 Q;  5M5X H;  2UXB L;  4JI4 L;  1M8A A;  2A6E C;  4X3S A;  5IP9 H;  5K36 G;  2Q2U A;  1LYL A;  2B8F A;  4A3K G;  2FMC A;  3VR2 A;  1MIU A;  1SMX A;  3X3N A;  2B2U A;  3DM1 A;  4P73 A;  1YBY A;  4NXM L;  4NKL A;  4C2M B;  1KAW A;  4DUZ L;  1HZ9 A;  4LFA Q;  2A68 D;  4KD4 A;  3IFD A;  1YZ6 A;  3CQZ H;  4XTC S;  2OQK A;  3EJI A;  4X62 Q;  1JT8 A;  2O2L D;  2Z1C A;  4MIU A;  5CV7 A;  1CKO A;  3GTQ H;  4PMC A;  1BBU A;  3TME A;  2KHS A;  1HJP A;  1RCV D;  2DJG C;  2VZA A;  3D6W A;  2RA4 A;  3Q6S A;  3CC2 A;  3FKI H;  2VQF Q;  2JA5 H;  4DXG A;  1A3T A;  2K5Q A;  1NE3 A;  4GLV B;  4IOC A;  3T1Y Q;  1H9K A;  3ND9 A;  3QIA A;  3SDZ A;  3VYS A;  5C4X G;  3RZD B;  1D7Q A;  4ZAI A;  3T4A C;  1V43 A;  1RHP A;  1L0Y B;  2NN6 I;  2RSN A;  2XRQ D;  5J1Z A;  1TWH B;  1YNJ C;  1ZYR C;  2IY5 B;  3S1Q H;  3ULJ A;  4FO2 A;  3MHB A;  2F0U A;  3NP8 A;  5LHY 1;  4LF5 L;  3MTS A;  4DFA A;  1J8I A;  2PQA B;  3ULL A;  1TXY A;  2JN4 A;  3KF8 B;  1K73 C;  1E1O A;  4FF1 A;  3VR3 A;  5KRU A;  5G3L D;  1ML0 D;  4WRD A;  1KDA A;  1TR5 A;  3QOJ A;  4FP5 D;  3MZ5 A;  2KEN A;  1H9S B;  3HOY B;  4O2D A;  1PDQ A;  2X6L A;  4UY8 C;  3A8K E;  3KF8 A;  1O80 A;  2F0I A;  4X3U A;  4DNT B;  1D5Z C;  1TY0 A;  1HQR D;  1PV4 A;  3PUX A;  1IL8 A;  3MXU A;  2JE6 I;  2M00 A;  4CKE A;  1STY A;  1SNP A;  2JJQ A;  4C3H H;  5EPK A;  1NUC A;  1BNZ A;  3S2H B;  2K14 A;  1XPR A;  2E2D C;  4DR4 Q;  3W1B A;  1IBK L;  1NBW A;  4KJN A;  1YJN A;  1SFO H;  3H0G H;  3WDN A;  3FDT A;  2N55 A;  4A3G B;  1CTM A;  1K3B C;  3AEV A;  1XWE A;  4JI2 L;  2Z4H A;  1QCB D;  1M90 C;  3S2D H;  1IBL Q;  1X65 A;  1I50 H;  2XTI A;  2N88 A;  3KFU A;  4R1J A;  1C9O A;  3CAM A;  1QG7 A;  3KF6 B;  1IBM Q;  5BR8 L;  5JEA G;  3EQL C;  2E75 C;  4BA1 I;  2EYM A;  4DV6 Q;  2MO1 A;  5JJI A;  1C4Q A;  4JG2 A;  3D6C A;  4JYA L;  1K83 H;  4DV2 L;  5A2Q E;  3A5U A;  1QIL A;  1N36 L;  1K3R A;  1ZKO A;  1EQT A;  1GJX A;  2DNC A;  4IFD G;  4LFB Q;  2G9D A;  1XMO L;  2UUC L;  3C2P A;  4YWK A;  2A1A A;  1XNR Q;  4XYQ A;  2R3Z A;  1B3A A;  3CHB D;  5CBA E;  1WFQ A;  2CKZ B;  4ZQ3 A;  4LF7 Q;  1N32 L;  5JPM C;  1WTW A;  4JI3 Q;  3GTG B;  1SNM A;  1JE5 A;  1MJE A;  2H1E A;  4LF6 Q;  5C44 B;  4EX5 A;  4KKS A;  4RGT A;  1CKM A;  4AIM A;  4HN7 A;  2KUM A;  2ZJR A;  1N34 L;  1TS2 A;  2B39 A;  4DR7 L;  3AYH B;  1IL2 A;  1N8R C;  3T16 A;  3MC0 B;  1M4V A;  2YTV A;  1VS0 A;  2K03 A;  5F2D A;  4XQJ A;  4C2M H;  2Q8R E;  5E1F A;  1WCM G;  4Q0F A;  4GS3 A;  1S5C D;  5KYL A;  5C4H A;  3KJO A;  1FGB D;  3Q23 A;  4BXX H;  4R4Q A;  5M5W H;  3DMU A;  3JAM E;  2EY2 A;  3F8T A;  2F0P A;  5I6Y A;  4P74 A;  3KLR A;  4CJ1 B;  4LFC Q;  4LFA L;  2C9O A;  3C46 A;  2I5L X;  3E0J A;  2UUB Q;  1E1T A;  5CV9 A;  3S24 A;  1EZ6 A;  3K5N A;  1F2M A;  2IHE A;  2ZTE A;  4IJL A;  4X62 L;  5IGB A;  3RZD H;  3UDF A;  4RHS A;  1EFI D;  1SR3 A;  1U0L A;  3MEF A;  3PIO A;  4JI0 Q;  3T13 A;  1CZG A;  2R7Z B;  4CDC C;  1HNZ L;  4MHE A;  3IL8 A;  2F0J A;  2HCI A;  4R4O A;  1L1O B;  4IN3 A;  1HUM A;  4LUO A;  3STB D;  4XQQ A;  2P5Z X;  3T1Y L;  3IAY A;  4F8M A;  1GD7 A;  2KA7 A;  3J80 c;  1OO9 B;  1SE8 A;  2B2V C;  2JP1 A;  1KC8 C;  4A3E B;  2H5X A;  5A2Q L;  2PW7 A;  1ESF A;  5C3E G;  2SEB D;  4OHJ A;  3GV6 A;  2B2V A;  3HOY H;  3HOU H;  3V2T A;  3R2T A;  4YHH Q;  1T5X D;  1DD2 A;  1STG A;  1STB A;  5EBD A;  1EYD A;  3BZD B;  5M3F H;  2I46 A;  4K8I A;  2Y0S G;  1LAC A;  3NXW A;  1K8M A;  4OO1 I;  3TDQ A;  1TS4 A;  5C0X H;  1TT2 A;  2NB0 A;  3PMF A;  1NTG A;  2B63 G;  1PFM A;  2GVA A;  4M8A A;  1F2Y A;  4JBK A;  2VNU D;  5DAU A;  3PUW A;  1F9S A;  5L37 A;  3S2H H;  1SYC A;  4LF4 Q;  5JJK A;  3R93 A;  2F4I A;  4KK7 A;  1Q86 C;  1KNE A;  1D2B A;  4A3G H;  3A74 A;  2VS1 A;  2AKW B;  3JAM L;  4I7Z C;  4J8Q A;  5J22 A;  2K52 A;  5FLM H;  3K58 A;  2Y0S E;  3E9I A;  4DR4 L;  4ID6 A;  1JE4 A;  4LWC A;  4YCV A;  1G2S A;  4H0L C;  3OYY A;  2F0K A;  1YNN C;  2D62 A;  3UE0 A;  1L2F A;  1SE4 A;  5C0X J;  2F4V Q;  3AFP A;  3SK6 A;  4CBV A;  4F88 A;  1IBL L;  3ZJY C;  1DCZ A;  1JIC A;  4EQ5 A;  1UE5 A;  1I4Q A;  4KY7 A;  4LF8 Q;  1UNS A;  4HIM A;  4A3K B;  1RF2 D;  1IW7 C;  4CGY B;  3HEJ A;  4GKK Q;  1V8Q A;  4FDB A;  1YIT A;  1Y69 U;  4K14 A;  2F0G A;  4PZ7 A;  2Q8T A;  4DV6 L;  3BYT B;  4KJO A;  1VQG A;  2LS0 1;  2WII B;  1SEB D;  3DWA A;  4IPC A;  4APV A;  1PTO B;  2L55 A;  3NEM A;  2A6E D;  5DM6 3;  3TRE A;  3KUP A;  2EYO A;  5C44 H;  4LFB L;  1FNW A;  1ASZ A;  5IOD A;  4DAY A;  1PTO C;  3I4N G;  1XPU A;  1UE1 A;  1D6E C;  4QUF A;  4BBS H;  1L0X B;  5D3D A;  5M3F G;  4ILW A;  1XNR L;  3A8I E;  1K0S A;  2N78 A;  2KCC A;  1PH7 A;  1CA5 A;  3BU2 A;  1EOT A;  4YWL A;  3VYU A;  2CFM A;  1JOO A;  5IYD H;  1X3G A;  1X3Q A;  4LF6 L;  2QDB A;  2PZU A;  1HNW Q;  3I8Z A;  4OL7 A;  1RTO A;  3A0J A;  3QR8 A;  2AUK A;  1U4R A;  2B2Y C;  1ET6 A;  1ET9 A;  4QF4 A;  5E7N A;  1D8L A;  2C35 B;  4QB4 A;  5C3W A;  1Z7T A;  2XSC A;  3PQI A;  1BOS A;  1BCP B;  4KKT A;  3PO3 H;  4C1N I;  4IO9 A;  2OXP A;  1KRS A;  1NAP A;  5EQ0 A;  2WKD A;  1E2W A;  1VQO A;  1BCP C;  4JI4 Q;  2KCN A;  3G71 A;  3K7U C;  1EEI D;  3PGZ A;  1HTL D;  1B70 B;  2R7Z H;  1VQP A;  3SVM A;  1VQH A;  2LMC B;  1ZYR D;  1YNJ D;  2MGS A;  3MFG A;  3C1F A;  1KDC A;  2UUB L;  2F0S A;  1SJH D;  4UDU C;  4RFB A;  1SLJ A;  4NXM Q;  3H3V I;  4DUZ Q;  3F2B A;  4L5S A;  2BH2 A;  4JI0 L;  1NR4 A;  2NVT B;  1B4O A;  1YHQ A;  4ME3 A;  3VR6 A;  2EYL A;  5M5Y H;  4N8F A;  2DJF C;  4HED A;  4GOP B;  3PIO 3;  1W3S A;  2XNA C;  3HOX H;  3E6Z X;  3HOZ H;  4AH6 A;  3WOF A;  1A62 A;  1I4R A;  3HKZ G;  4DA2 A;  5I6W A;  1C8C A;  3CQZ B;  5FK9 C;  3UDX A;  2WB1 G;  5DNF A;  4BBS G;  1PXU A;  4YHH L;  3EBE A;  2FFK B;  5D14 A;  1QZH A;  3AB9 A;  1AEX A;  1X56 A;  5CR3 A;  1C48 A;  3GTQ B;  1A15 A;  3AU7 A;  2G9H D;  3CC7 A;  1T9H A;  3URY A;  5BN4 A;  1B44 D;  3FKI B;  2JA5 B;  3OSO A;  4UHV A;  1J9O A;  4OIK A;  3MVV A;  5JAV A;  1ILP A;  3GTP B;  4BS9 A;  5JPN C;  1HUN A;  3KLW A;  1A8V A;  1YNX A;  4A3I H;  3NQI A;  4LF4 L;  2EJM A;  2QW7 A;  1DJR D;  5EBC A;  3PO3 G;  4YWM A;  3BDO A;  1SYD A;  4HMI A;  1PYS B;  1UEB A;  2PNH A;  2EXZ A;  4I7A A;  1LAB A;  2F0W A;  4CJ2 C;  3DEP A;  2E74 C;  4HMJ A;  3GDE A;  1GOZ A;  2WB1 E;  2JQO A;  1YEZ A;  1CK1 A;  2RDG A;  4LUV A;  1EYA A;  1J5E Q;  2VXW A;  2WP8 J;  3BVZ A;  5C5M A;  3LWU A;  1KAB A;  3MAQ A;  3V96 A;  5K36 H;  3E5S A;  2KQ3 A;  4DAV A;  4A3K H;  4KHZ A;  1KHI A;  2YU9 B;  3OHX C;  4A3J G;  4IUP A;  4IPD A;  2ZT9 C;  2PQE A;  4G7Z C;  1PTO H;  2F4V L;  5GAE C;  4FXD A;  5C6A A;  4ZUJ A;  1NSN S;  1S72 A;  1BR9 A;  1WCM B;  3H6M A;  4LF8 L;  3TP7 A;  4BY1 G;  5FO9 B;  3EN2 A;  4JI2 Q;  1KLU D;  2TSS A;  1T5E A;  5IGD A;  4JV5 Q;  2F0H A;  2IJ0 A;  4GKK L;  2A19 A;  2CVR A;  4HJ5 A;  4Z9C B;  5EPL A;  1EY4 A;  4RA8 A;  4IQZ A;  4FXK C;  1MBY A;  2EY1 A;  4RGN A;  4DAP A;  4H02 A;  5LL6 S;  1KD1 C;  3GTM B;  1NNX A;  4KHP Q;  4UPA A;  1SFO B;  2NTT A;  1UWV A;  4C1N K;  1N9W A;  2Z6B A;  1OXS C;  5COY A;  3IRB A;  2K5H A;  3KDF A;  1TWA H;  4KY6 A;  4JC0 A;  1Q46 A;  4KMU C;  3SK5 A;  5C4X H;  4L5R C;  5T1G A;  3SEB A;  3I55 A;  1N36 Q;  3HOW G;  4YCW A;  4DAM A;  1PH9 A;  3HKS A;  3NBI A;  3S16 H;  1XMO Q;  1A3U A;  2E2H H;  2UUC Q;  1TWC B;  1GUO A;  4A3C H;  1CA6 A;  1LT6 D;  4H7B A;  3CCS A;  4DR6 Q;  2MJ8 A;  1HNW L;  2WIN B;  3K5M A;  1ROD A;  2Z6K C;  4A3I G;  1SND A;  1K83 B;  3TRZ A;  2D2C C;  1G91 A;  2GVB A;  5C3E B;  5H1S E;  4AYB G;  4HID A;  3CCV A;  2Z6K A;  1WTX A;  4MTK A;  3I2Z A;  5KNB A;  3ERQ A;  2IX0 A;  4DK0 A;  1FL0 A;  3M7G A;  1SMY D;  3PSI A;  4X3K A;  3T1H Q;  4ODG A;  5IGE A;  2Y0S B;  2LXK A;  3ONA B;  3C3L A;  1KIX A;  2EYH A;  5KEE A;  2E5L Q;  1F77 A;  2B2U C;  1MD2 D;  2KCM A;  2NVT H;  2N49 A;  1RL2 A;  2C5C A;  5ISR A;  2B63 B;  2ES2 A;  3SGI A;  4DPG A;  2F1M A;  2RF4 A;  1WTP A;  4R9W A;  4JCV E;  5FLX E;  4BY7 G;  2GN5 A;  3BZC A;  2F0E A;  1I4P A;  3G7L A;  3VA5 A;  2Q8I B;  4U68 A;  2HDM A;  3HS0 C;  3S1M B;  1UEA B;  2AUJ D;  3Q22 A;  1EIF A;  3K59 A;  1EEF D;  4AYB E;  1DOM A;  1S5E D;  2MPM A;  4CDD C;  5M5W B;  2QEX A;  4RCO A;  5E4X A;  2HUG A;  2D0O A;  4B3S Q;  1STE A;  4ABN A;  3NSW A;  4DR2 Q;  1HNZ Q;  2CH4 W;  1XPO A;  4RKB A;  2SDF A;  4A3L G;  2PCF B;  3OIQ A;  2NN6 G;  1H9J A;  5JEA H;  1LM0 A;  5ELE A;  3CPF A;  3GTP H;  1W6K A;  4RAU C;  5IOC A;  3OMG A;  4XT3 B;  1JB3 A;  1SDF A;  1D1K A;  4A93 G;  3L0O A;  3TP8 A;  2O5I C;  1DGS A;  3J7Z C;  2NVY B;  4A3C G;  4IFD H;  4Q5V A;  3U9O A;  1HRJ A;  2HD3 A;  2ZM6 Q;  1X55 A;  4HAE A;  5C5L A;  3HZX A;  3QWN A;  3FHW A;  4JI8 Q;  5M3M G;  1B7Y B;  5IP7 G;  1B9N A;  1PZJ D;  4DXF A;  1Q82 C;  2EYJ A;  1G51 A;  3S17 B;  1X3E A;  1SNC A;  4P2C B;  4B9X A;  3R3O A;  3HOU B;  1EQR A;  1WD0 A;  2YU9 H;  3QO2 A;  3I4N B;  4NW2 A;  4X6A H;  4FF2 A;  2UUA Q;  1W2B A;  5M3F B;  3G4S A;  1PFS A;  4R8N A;  2RKS A;  4HJ8 A;  1X9N A;  4JI7 L;  3SR1 A;  1I5F A;  3QB3 A;  2PW5 A;  1J5E L;  4GNX C;  1WCM H;  5JEA J;  1PZI D;  3DXJ C;  1LTL A;  5HUR A;  1SE3 A;  4HJ7 A;  5FLX L;  1YJ9 A;  4R4T A;  4PMW A;  1SAP A;  4GNX A;  4X3T A;  2CW0 D;  3S15 B;  3M4O B;  1YHA A;  1H9M A;  3PIP 3;  3KOJ A;  3GTM H;  4IFD J;  2L4N A;  4KN4 C;  1RKN A;  1JOR A;  3CRL C;  3TBI B;  3N6R A;  2QKI C;  1LTI D;  2H4O A;  3HOV G;  2L11 A;  2SNS A;  5HGT A;  4JV5 L;  3JAM c;  3I56 A;  2X6G A;  1X3F A;  1XTC D;  3OTO L;  4L8J A;  1VQN A;  2XGT A;  3S1R H;  1SRO A;  2ICI A;  4DV7 Q;  4OX9 L;  4KHP L;  1LO5 D;  1TWC H;  1NCV A;  2HT1 A;  5LMU Q;  3D31 A;  1B2T A;  3W1G A;  1WVL A;  3D4R A;  1EY9 A;  5T1I A;  2E2I B;  4O42 A;  1MSH A;  3M4Y A;  3HRZ C;  5C3E H;  3TN2 A;  2VW9 A;  3CCU A;  2LXJ A;  1EYC A;  2EPB A;  3MXN A;  3BDC A;  3CKI B;  5FKA C;  1R9T B;  2ZXO A;  4A3F G;  3UDG A;  4QMG A;  1HH2 P;  1VQF A;  4RHR A;  4DR6 L;  2X69 A;  1D5M C;  2QIL A;  1GHJ A;  3NUC A;  2F0L A;  3I90 A;  4BWG B;  2HIX A;  1KDB A;  2KOL A;  1ONL A;  1KXL A;  2B63 H;  3HKZ B;  2N3S A;  1KTK A;  3VR4 A;  4BBS B;  2HQE A;  3RN2 A;  3T1H L;  2MUY A;  5IE8 A;  1RTN A;  2E5L L;  3S1M H;  4R8I A;  3K57 A;  3EFX D;  4QJF A;  2I0Q A;  4XYO A;  5EGT A;  3FVQ A;  3M85 A;  2QGQ A;  1S5B D;  1EY8 A;  2K33 A;  2R6G A;  4YCU A;  1U9R A;  3CCJ A;  3PF5 A;  3DWQ A;  4EGV A;  4IZ8 A;  3PO3 B;  1GUG A;  1F2L A;  1RD9 D;  3OPO A;  5EKL A;  3CP0 A;  2O4X A;  3ULP A;  2F0V A;  1L0W A;  3TQY A;  5GRO A;  2CWP A;  2MFI A;  1F9P A;  3LGJ A;  4N8X 1;  4B3S L;  1CUK A;  1ASY A;  4DR2 L;  2SOB A;  1YI2 A;  4ZRZ A;  2NVY H;  4IOA A;  2K01 A;  2VB3 X;  2YTY A;  4IUN A;  3E0E A;  4JBJ A;  4O0A A;  2F0M A;  4IJH A;  1SN8 A;  3CW2 C;  3SXH A;  3DLL A;  1HR0 W;  3U50 C;  1PTO F;  2JA8 G;  4HR7 B;  1WTO A;  1O7I A;  4CDF C;  2A69 C;  3HFZ B;  3S17 H;  3RMH A;  3L7Z C;  4OO1 G;  1PH1 A;  4BY1 B;  4HCE A;  3RUZ A;  3CCL A;  4EQN A;  4NB3 A;  3I4N H;  2Z4I A;  5M5Y B;  2ZM6 L;  2BH8 A;  3SE0 A;  4EQP A;  5IYC H;  3GTL B;  1WTR A;  4JI8 L;  1JJG A;  1WOC A;  2RCN A;  2XWJ B;  4X64 Q;  3E9H A;  3HOX B;  3HOZ B;  3BG3 A;  4EVO A;  1EOV A;  4ME5 A;  3AMU A;  1IKL A;  2LFN A;  3KK7 A;  1BKB A;  3NWT A;  1N33 Q;  2K5N A;  1H9R A;  2QEJ C;  4DK3 C;  4PZ6 A;  1OXV A;  1WD1 A;  4PNY A;  3DHQ A;  1XYI A;  5JVG 3;  2UUA L;  3S15 H;  4JOI A;  5CMD A;  2QDL A;  3M4O H;  1BCP F;  5CV5 A;  4PV1 C;  3VYT A;  4DKA C;  4DR3 Q;  2Z9H A;  3HOW B;  2ALY B;  3GQB A;  1O7Z A;  5EJW A;  1GO3 E;  2BE5 D;  5TSS A;  4K5X A;  4C3I H;  1EY6 A;  2AQ2 B;  4JI6 L;  5I9O A;  1Q7Y C;  4RH6 A;  3FPU B;  3RD4 A;  1NMG A;  3P7J A;  2QF7 A;  2DN8 A;  4A3I B;  5ELF A;  4IUT A;  2ZJP A;  3KBG A;  1B1Z A;  1G6Z A;  2E76 C;  2PZW A;  5JVH 3;  2F0F A;  1MI2 A;  1V1Q A;  4NDX A;  1JWU D;  1LUZ A;  1QVG A;  1DXM A;  3HG9 A;  2IW3 A;  3UE1 A;  2E2I H;  3RNU A;  1BO0 A;  5GAG C;  3BJU A;  3U9S A;  4X65 L;  1K0R A;  1X6O A;  5IGF A;  3A7L A;  1SYE A;  3CF5 A;  3UDI A;  4DV7 L;  1R9T H;  4J6H A;  1PH6 A;  1G6P A;  2GA4 B;  2NVX B;  4DAY B;  4C3J H;  3M7N A;  2K32 A;  1VQ7 A;  5LMU L;  2RSO A;  3S14 H;  2ID0 A;  3K81 C;  1VQ9 A;  3I4O A;  4L5Q A;  2JYO A;  1BF4 A;  4GZY C;  4KLK A;  4N9T A;  5DM7 3;  2EIF A;  3GD7 A;  1AE2 A;  2LY7 A;  1JC7 A;  4DV1 L;  3OIP A;  1GXD C;  3K5O A;  1IKM A;  2F0N A;  1VQD A;  5IYC G;  4RG1 A;  2DUD A;  4L5T A;  1UE6 A;  1F2Z A;  1Q1E A;  1HZB A;  4WJW A;  5KYI A;  2PMZ E;  1KQS A;  1CKN B;  4CHT B;  1FD7 D;  2HCC A;  4KD3 A;  1D1I A;  2J4X A;  3BZK A;  4QIW E;  1VQC A;  3TP6 A;  4B9W A;  3I91 A;  3K7A B;  2RQX A;  2J7Z A;  1TWA B;  4DV3 L;  1C0A A;  4TRD A;  2MNA A;  5C4X B;  3PO2 G;  3ERO A;  3NTH A;  3TS0 A;  1EIG A;  2Z0S A;  3A5Z B;  2IPK D;  2RDF A;  3OW7 A;  4LF9 Q;  3U58 A;  1CKN A;  1KLG D;  5CGK A;  4A93 B;  3FPP A;  5EKK A;  1IXR A;  3S16 B;  2E2H B;  1X54 A;  1EU4 A;  4TSS A;  4C3I G;  2I07 B;  3SK4 A;  3S1N H;  2ICE C;  3BVM A;  2OTJ A;  5C0X I;  5M3M B;  1V1P A;  4P72 A;  4GN3 B;  1AZP A;  1Y1V G;  5EAY A;  4HCS A;  4OWW B;  3K8A A;  2DY8 A;  1NR2 A;  4GN5 A;  3QOL A;  2JSO A;  1PH4 A;  4A3J H;  4OWX B;  4KTA A;  1K8O A;  4DR5 L;  5C4J B;  1LT3 D;  3MXG A;  4BY1 H;  4C3J G;  1CI3 M;  3M4P A;  2D5D A;  1S3O A;  5HGQ A;  4XT1 B;  1TWG H;  1WTQ A;  1IZ6 A;  3GTL H;  4CKB A;  3EA6 A;  5D65 A;  1ENA A;  1PVO A;  2EDG A;  5LL6 X;  1Q12 A;  3GTK H;  2JA6 H;  1CT1 D;  5DLQ E;  3HOV B;  5IWA L;  4NP5 A;  5IY0 A;  4F87 A;  4B3R L;  1PMR A;  1DON A;  1I3Q B;  3KLS A;  3LX0 A;  3HOW H;  1QWY A;  2IX1 A;  1HFN A;  4QGU A;  4X64 L;  2K75 A;  3NBH A;  3BYY B;  1E24 A;  2DNE A;  1G2T A;  4MNO A;  5I2X A;  1N33 L;  2YYZ A;  1CM9 A;  1A2U A;  1EIY B;  1DM0 B;  3H91 A;  3ERS X;  1O78 A;  1MSG A;  5J39 A;  2A5H A;  4ZLT F;  4DR3 L;  4R4I A;  3NE5 B;  1JCK B;  4A3D H;  4IPG A;  3GO5 A;  5LMN W;  4POG A;  1BVS A;  2VQE Q;  4A3F B;  4XQN A;  4DF7 A;  2R93 G;  2L0C A;  4JI7 Q;  2VUM H;  3NEN A;  3GV3 A;  3PIP A;  1WI5 A;  2EJG C;  2CHB D;  4IUR A;  1SYG A;  3J7A F;  2NVX H;  3RZO H;  2A73 B;  1NJI C;  1VQM A;  4BY7 H;  1DOK A;  3NQT A;  2JA7 G;  3PV0 A;  4LAA A;  3CCM A;  1SNQ A;  1HCZ A;  1LT4 D;  4HSP A;  2PPB C;  4RCN A;  1VQ4 A;  1VQ6 A;  1VQI A;  1O7Y A;  1WJJ A;  1QZG A;  1PZK D;  1FYC A;  3V05 A;  3G6J B;  1Q8K A;  3KDF B;  5IT9 E;  5I4D A;  3DEO A;  1MKH A;  4KN7 C;  5FLX c;  1OXX K;  1JOK A;  2A6H C;  1PA6 A;  2ATW A;  1PYW D;  2BOS A;  3J81 j;  3OTO Q;  2R92 H;  3Q0A A;  4XIG S;  4OX9 Q;  4WOR A;  2UXD Q;  1VQ8 A;  3BDL A;  4A3L H;  3LNN A;  3H94 A;  2JA6 G;  4B08 A;  4S3S A;  2K5W A;  2NN6 H;  2K6A A;  4PQX A;  3K7A H;  1HA5 A;  1JQY D;  4YIJ A;  2KHI A;  2HIV A;  3AFQ A;  4FF3 A;  3D3R A;  3D4W A;  1PH3 A;  1MHW C;  1CFM A;  3RLO A;  3S1R B;  1QB5 D;  2EOT A;  4A93 H;  1ILQ A;  1A3V A;  1JOQ A;  2IHF A;  4CDE C;  1VMC A;  2FJ2 A;  1EY5 A;  3BVG A;  3FMC A;  4IUV A;  1S4Z A;  3G48 A;  2R7F A;  4DV0 Q;  4J15 A;  1BDO A;  1TU2 B;  1E2Z A;  5COR A;  3AQQ A;  4U67 3;  1XTD A;  4KKU A;  1CHP D;  5M3M H;  2HDL A;  5IP7 H;  4QL5 A;  4Y7N H;  4DUY Q;  1Y14 B;  4K5W A;  4LF9 L;  2MO0 A;  4A3D G;  2B2W C;  1I4G A;  4GKJ Q;  5FO7 B;  4JI1 Q;  1UUP A;  5BN5 A;  1UE7 A;  4LUZ A;  2ZJQ A;  3A54 A;  4HSV A;  2VUM G;  2B2W A;  4QCL A;  1VQK A;  2RHQ B;  3J7Y W;  5C4J H;  2EQS A;  4P71 A;  4DR1 Q;  1E7Z A;  3CPW A;  4WJ4 A;  1BBW A;  1TWF B;  4ULL A;  1BQQ T;  2MHV A;  1SYF A;  1EYG A;  1Z9F A;  1HQM C;  1Z47 A;  3IFT A;  3QG1 A;  4GN4 B;  3A7A B;  3CC4 A;  3D4D A;  1NMF A;  4DV4 Q;  2R7D A;  4BBR G;  2VY3 A;  2EZV A;  3HOV H;  1HFG A;  5IT9 L;  4UP7 A;  4TKO B;  1II3 A;  4ZCK A;  2R92 G;  3LWE A;  4OXP A;  3U4V A;  5GAH C;  1I3Q H;  4J1M A;  2B29 A;  1U4M A;  2WAQ G;  3UI2 A;  1SNO A;  2BDN A;  4V19 0;  2D0P A;  5DEH A;  3MEH A;  1A2T A;  1ESR A;  4NPS A;  3CCE A;  1AP0 A;  1SE2 A;  2FMM A;  2RCF A;  2K05 A;  3NEL A;  2CQA A;  3Q24 A;  4PG3 A;  4IUU A;  4GLA C;  3I4M G;  2PMZ B;  1BXT A;  1U4L A;  3GTJ H;  1Q81 C;  5KGU A;  3NWS A;  3Q8D A;  1U5K A;  4NXN Q;  4QIW B;  1M1K C;  2N8N A;  1PRT F;  2PZT A;  4A3F H;  1K9M C;  4HJA A;  5FO8 B;  1DOL A;  2K28 A;  3D0F A;  2NTS A;  5K5P A;  4JI5 Q;  3X3M A;  1EY0 A;  1YNN D;  2UXC Q;  1QNU A;  2IL8 A;  3OMC A;  1AN8 A;  1QE6 A;  2Z8L A;  4AQY Q;  4WJ3 M;  1GUS A;  1YVC A;  2WAQ E;  4N9P A;  1ENC A;  3TEH B;  3J81 E;  2ZTD A;  1IW7 D;  1PFB A;  2VQE L;  4KHV A;  4K6L A;  4GNX B;  4A3M H;  2XRS D;  1GHK A;  3T56 B;  4JPB W;  2CWA A;  1JJC B;  2OWO A;  1SSO A;  1VQL A;  1JWS D;  4KY5 A;  4JI6 Q;  4K2L A;  5NUC A;  4RGM A;  3F2C A;  4B3T Q;  1QOH A;  2XVS A;  2E2J H;  2NVQ B;  1PTO D;  1S5D D;  4DU9 A;  4F7X A;  4K0K Q;  5C4Z A;  2PQA A;  2OT2 A;  3TZD A;  3PO2 B;  1DZ1 A;  1WTV A;  2ZXR A;  3J7A V;  1GKH A;  5IP9 G;  4M1U B;  2F52 A;  1B3Q A;  1S40 A;  1H9S A;  4C3I B;  3HP3 A;  2NUC A;  3P1H A;  3O13 A;  2V1C C;  2ENB A;  2K50 A;  3U4Z A;  2RVL A;  1ZXT A;  3EVQ A;  4X65 Q;  3NTI A;  4JVZ A;  3R8B A;  3PUY A;  1Y1W H;  1Y1V B;  2UXD L;  3MXN B;  2F0T A;  1LTG D;  4MZ9 A;  1LV9 A;  4OON A;  1VQ5 A;  1BUV T;  2BCO A;  1HR0 Q;  2CQO A;  4O1N A;  3H3V C;  1IYU A;  2IX3 A;  1BCP D;  1FNU A;  2JA8 H;  2WKC A;  3J7A 5;  1KAA A;  1FJG Q;  2KBN A;  3T53 B;  1H95 A;  1FR3 A;  4DV1 Q;  3CCR A;  3FKI G;  2JA5 G;  4DGZ A;  4OO1 H;  3W2D A;  1I6H H;  4C3J B;  1S5F D;  2EE1 A;  1I94 L;  2I5M X;  3K0X A;  1PRT B;  2NZH A;  4DV0 L;  4A3B H;  3M4Q A;  2K1B A;  1PFN A;  1K28 A;  4V0B A;  1KL9 A;  3S14 B;  5AJ3 Q;  2MQH A;  4UP9 A;  5GQO A;  1PRT C;  2CCZ A;  2L15 A;  2HHH Q;  1OXT A;  4DUY L;  2F3I A;  1KNA A;  3M3Y B;  1LTT D;  3KF6 A;  5FJ8 H;  3J81 L;  4GKJ L;  4DV3 Q;  3B6Y A;  1EU3 A;  1UAP A;  1TWF H;  2WB1 B;  1LLR D;  1RIP A;  4JI1 L;  5JJL A;  2F03 A;  4A3M G;  3D8G A;  3KLS X;  1LTS D;  3G6E A;  2F3W A;  1A6X A;  1NY4 A;  3BS1 A;  3ND8 A;  4IFD I;  5D3I B;  3R2I A;  1E0B A;  4DR1 L;  5BN3 A;  3K5L A;  4OIJ A;  3OWF A;  1MGS A;  1TY2 A;  2DGY A;  2L12 A;  1E22 A;  1XX8 A;  1KRT A;  3TSS A;  2ZXP A;  2PI2 E;  4A75 A;  5IGC A;  1Y8P B;  2G5D A;  2BA0 A;  4A76 A;  1IYV A;  2K5D A;  3WOE A;  1LTA D;  4DV4 L;  1AE3 A;  3DM3 A;  3I3C A;  4RGO S;  1O7L A;  1B9M A;  3S1N B;  4DR5 Q;  2B3G A;  4C3H G;  2Q2T A;  2R93 B;  3RLF A;  2WFW A;  1C7Y A;  3NPP A;  5ELO A;  4XXE A;  5JJZ A;  4DNR B;  1Y1W G;  1HNX Q;  1BBX C;  3RN5 A;  5G3L F;  1K8G A;  3H0G G;  1GM5 A;  2NZO A;  1F9R A;  1JWM D;  1ENF A;  4A3J B;  4KV6 A;  2JA7 B;  2PNR C;  1CSQ A;  2J0T D;  1X3P A;  3ICE A;  4IPH A;  1HA6 A;  2EJF C;  2L5T A;  2R61 A;  1TII D;  2ASB A;  4H13 C;  4JBM A;  1VDZ A;  2NWG A;  3A8J E;  4PMB A;  1TWH H;  4NXN L;  2D9U A;  1SJE D;  4LK1 C;  5IWA Q;  4B3R Q;  2VQF L;  1EUJ A;  4K5V A;  3A56 A;  4DK6 C;  4A3B G;  3SK8 A;  4X66 Q;  5I9P A;  1SMY C;  1TWG B;  5CBE E;  1V9P A;  4CJ0 B;  3J81 i;  1TS3 A;  4JI5 L;  4FXG C;  1VF5 C;  1HPC A;  2AQ1 B;  2UXC L;  1RJT A;  1L1O C;  1VQA A;  2RBM A;  3JC6 6;  4AQY L;  3KYH C;  1F9Q A;  3GTK B;  5FJ8 G;  2JA6 B;  1SXT A;  4JOI C;  4G4K A;  1STA A;  4MN3 A;  1Y8O B;  2AMC B;  1AZQ A;  1L1O A;  3VR5 A;  2NVQ H;  3MXP A;  3PO2 H;  2A6H D;  4DK1 A;  1DYQ A;  2A8V A;  1JJ2 A;  2A68 C;  2RHS B;  3T51 B;  4DV5 Q;  5ELC A;  4JBW A;  1IYJ B;  1V1O A;  3IKJ A;  4B3T L;  2K4K A;  1K8A C;  4TQU S;  4K0K L;  1EFW A;  1VQE A;  1R4P B;  1G29 1;  1J6Q A;  4YY3 Q;  1HXY D;  3NK9 A;  2UU9 Q;  4DN4 M;  1Y1V H;  5M9O A;  1CQV A;  3CD6 A;  3H3V H;  4AYB B;  3FRP B;  4BA2 I;  3PUZ A;  1LTR D;  4A3D B;  2YTX A;  2LSS A;  2OQ0 A;  1GUN A;  4BXX G;  1XMQ Q;  1OXU A;  1VF7 A;  2VUM B;  1YIJ A;  3PUV A;  5JOB A;  1A63 A;  4K6D A;  3K80 C;  3MA2 B;  2K04 A;  1AH9 A;  3GP7 A;  2M2L A;  3C1E A;  4L63 B;  3RZO B;  3ZYY X;  3PCO B;  1EWI A;  2JEB I;  4BY7 B;  1CHQ D;  2F0Q A;  1R4Q B;  5KIX A;  1AW7 A;  1HR0 L;  1JMC A;  4QQB X;  3GTO B;  2VL6 A;  1PLF A;  2CH4 A;  3J80 E;  4IAL A;  1FNV A;  4ALP A;  4HIO A;  1FJG L;  5CYU A;  1PHJ A;  3M3Y H;  3CXC A;  1XNQ Q;  4BBR B;  5IIF A;  1QVC A;  3CME A;  1IBM L;  4G7H C;  3HGB A;  1XXG A;  5ELD A;  1CZW A;  3NTK A;  2R92 B;  5AJ3 L;  4ZUI A;  2WAQ B;  4H44 C;  2HHH L; 
#chains in the Genus database with same CATH homology
 3W5O A;  3CCM A;  3F8T A;  1DGS A;  2BA1 A;  3J7Z C;  3GTG H;  4A3C G;  3HOY G;  3HOU G;  2ZM6 Q;  1PH5 A;  1X55 A;  2AHO B;  4P74 A;  1VQ4 A;  1VQ6 A;  1VQI A;  1WJJ A;  1QZG A;  3FHW A;  4JI8 Q;  4LFC Q;  5M3M G;  1P8L A;  4LFA L;  1B7Y B;  5IP7 G;  1HZC A;  1Q8K A;  3CMA A;  3KDF B;  2I5L X;  1MKH A;  5FLX c;  5C0X G;  1OXX K;  1E1T A;  1G51 A;  3S24 A;  1Q82 C;  2UUB Q;  5LMN Q;  1PA6 A;  1X3E A;  2ATW A;  2IHE A;  2ZTE A;  4LF7 L;  4IJL A;  4X62 L;  3RZD H;  2R92 H;  3UDF A;  4OWT B;  4JI3 L;  3J81 j;  3OTO Q;  2OTL A;  1EQR A;  1U0L A;  1SR3 A;  3MEF A;  2YU9 H;  3PIO A;  4JI0 Q;  4XIG S;  4OX9 Q;  2UXD Q;  4X6A H;  1VQ8 A;  2R93 H;  4A3L H;  4B3M Q;  2UUA Q;  1W2B A;  2JA6 G;  4GLX A;  1HNZ L;  1SRU A;  1PFS A;  3G4S A;  4HIK A;  4HJ8 A;  1X9N A;  4JI7 L;  4TVA B;  1Q1B A;  1OTC A;  4R4O A;  3L2P A;  3K7A H;  3PF4 A;  1L1O B;  1I5F A;  4LUO A;  3STB D;  1CSP A;  1MJC A;  2YV5 A;  4LW1 A;  3JAM i;  3T1Y L;  1J5E L;  2KHI A;  4GNX C;  1WCM H;  1GD7 A;  5JEA J;  2HIV A;  3AFQ A;  1LTL A;  3J80 c;  1SE8 A;  1KC8 C;  4A3G G;  4R4C A;  1PH3 A;  2H5X A;  2ZTC A;  3RLO A;  4HJ7 A;  1YJ9 A;  4A93 H;  2JA7 H;  2UXB Q;  5C3E G;  1FGU A;  4R4T A;  4PMW A;  2EXD A;  2IHF A;  5IYB H;  4GNX A;  3HOY H;  5FLM G;  4DV0 Q;  3G48 A;  2R7F A;  1YHA A;  4J15 A;  3HOU H;  4YHH Q;  3AQQ A;  3KOJ A;  3GTM H;  4IFD J;  1HNX L;  1XTD A;  1WYD A;  5M3F H;  5J3B A;  5M3M H;  3ER0 A;  2Y0S G;  5IP7 H;  4LFC L;  4QL5 A;  5M5W H;  4Y7N H;  3HOV G;  3TS2 A;  4OO1 I;  1QUQ B;  1Y14 B;  2FXQ A;  4DUY Q;  4LF9 L;  2MO0 A;  4POF A;  4JV5 L;  4A3D G;  3JAM c;  1NTG A;  3RLN A;  3I56 A;  2B63 G;  1EQQ A;  1PH2 A;  2E8G A;  2GVA A;  1HZA A;  3VDY A;  4JI1 Q;  4GKJ Q;  1X3F A;  1VQB A;  4A3E H;  1PH8 A;  1UE7 A;  3OTO L;  4JBK A;  1FVI A;  1VQN A;  2VNU D;  2XGT A;  3NBH B;  1SRO A;  4LUZ A;  3S1R H;  1JB7 A;  2ZJQ A;  4HJ9 A;  4DV7 Q;  4UP8 A;  4OX9 L;  3PUW A;  2VUM G;  4KHP L;  1TWC H;  3S2H H;  2HT1 A;  4LF4 Q;  1VQK A;  5JJK A;  2RHQ B;  5LMU Q;  1QUQ A;  2OCE A;  5IT9 c;  5C4J H;  1E3P A;  2EQS A;  4P71 A;  4KI0 A;  3D31 A;  4DR1 Q;  1E7Z A;  4X66 L;  3CPW A;  4WJ4 A;  1BBW A;  2HQL A;  2QA4 A;  1Q86 C;  1YHB A;  4A3G H;  3W1G A;  3A74 A;  2VS1 A;  3WWV A;  2AKW B;  2IT1 A;  2VW9 A;  2AWO A;  5C3E H;  3CCU A;  2LXJ A;  1EYG A;  4GOP C;  1Z9F A;  2K52 A;  5FLM H;  5C44 G;  4A3F G;  3UDG A;  1Z47 A;  2Y0S E;  1A0I A;  3E9I A;  4GN4 B;  4DR4 L;  1HH2 P;  1VQF A;  3CC4 A;  4DR6 L;  1NMF A;  3CCQ A;  4LWC A;  2R7D A;  4DV4 Q;  4BBR G;  2VY3 A;  4YCV A;  4P75 A;  4GOP A;  2AWN A;  3HOV H;  3OYY A;  4UP7 A;  2HIX A;  2R92 G;  2D62 A;  1PYB A;  1L2F A;  4OXP A;  3U4V A;  1I3Q H;  3UE0 A;  5GAH C;  4DV5 L;  2B63 H;  2B29 A;  5C0X J;  5IYD G;  2F4V Q;  2WAQ G;  2N3S A;  3AFP A;  4LF5 Q;  1IBL L;  3ZJY C;  4EQ5 A;  2D0P A;  1UE5 A;  1VCI A;  4LF8 Q;  4HIM A;  4QY7 A;  4NPS A;  3CCE A;  3RN2 A;  3T1H L;  5IE8 A;  4YY3 L;  4GKK Q;  4FDB A;  1YIT A;  3NEL A;  1YJW A;  2UU9 L;  2E5L L;  3S1M H;  4PZ7 A;  4DV6 L;  4PG3 A;  4QJF A;  4GLA C;  3I4M G;  1VQG A;  1GVP A;  3STB C;  1Q81 C;  3GTJ H;  1XJV A;  2I0Q A;  4IPC A;  4APV A;  3Q8D A;  3HKZ E;  1U5K A;  4NXN Q;  2PI2 A;  5IYB G;  3H15 A;  3GTO H;  3M85 A;  1M1K C;  3NEM A;  2QGQ A;  1XMQ L;  2N8N A;  3TRE A;  5C44 H;  4LFB L;  2KCT A;  4A3F H;  1ASZ A;  2R6G A;  4YCU A;  4HJA A;  1K9M C;  3I4N G;  3CCJ A;  3PF5 A;  1XPU A;  1UE1 A;  3D0F A;  2R7Z G;  3FP9 A;  4BBS H;  4JI5 Q;  5M3F G;  3J80 i;  3OW2 A;  1XNR L;  2UXC Q;  4BBR H;  3I7F A;  2N78 A;  5GAD C;  4MTN A;  4AQY Q;  3CP0 A;  3ULP A;  4WJ3 M;  2JA9 A;  1YVC A;  1PH7 A;  2WAQ E;  1L0W A;  3TQY A;  3BU2 A;  5GRO A;  4YWL A;  3TEH B;  4DNI A;  2CFM A;  2CWP A;  2MFI A;  3LGJ A;  4A3E G;  5IYD H;  1X3G A;  2ZTD A;  2HHH L;  4B3S L;  4LF6 L;  3RR5 A;  1CUK A;  2VQE L;  1IBK Q;  4DR2 L;  1ASY A;  1HNW Q;  3A0J A;  1YI2 A;  4GNX B;  4A3M H;  2NVY H;  5E7N A;  4IOA A;  2YTY A;  2Q2H A;  1B8A A;  1D8L A;  2C35 B;  3E0E A;  4JBJ A;  4O0A A;  3KJP A;  1XNQ L;  4IJH A;  2CWA A;  1JJC B;  2OWO A;  1SN8 A;  3CW2 C;  3F1Z A;  2KHJ A;  3DLL A;  1HR0 W;  3U50 C;  1VQL A;  3PO3 H;  2JA8 G;  3I4M H;  4IO9 A;  1O7I A;  3HOX G;  4JI6 Q;  1KRS A;  2JK8 A;  3HOZ G;  1VQJ A;  3F2C A;  4B3T Q;  3HFZ B;  2E2J H;  1VQO A;  3S17 H;  4JI4 Q;  3L7Z C;  4K0K Q;  2Q2I A;  2PQA A;  5BR8 Q;  3G71 A;  1I94 Q;  4PZ8 A;  4OO1 G;  1PH1 A;  3K7U C;  3CCL A;  3PGZ A;  4NB3 A;  3I4N H;  1B70 B;  2ZM6 L;  3F2D A;  2R7Z H;  1VQP A;  1GKH A;  2BH8 A;  2K5V A;  5IP9 G;  5IYC H;  4JYA Q;  2F52 A;  1VQH A;  3CC2 A;  4DV2 Q;  4JI8 L;  1S40 A;  1JJG A;  1WOC A;  3M9B A;  2RCN A;  4X64 Q;  3E9H A;  1QVF A;  2V1C C;  1EOV A;  2K50 A;  3EIV A;  3U4Z A;  2JEA I;  2UUB L;  4A4I A;  5LMN L;  1P16 A;  1BKB A;  1SLJ A;  5ELN A;  4NXM Q;  1N33 Q;  2K5N A;  2I5H A;  3H3V I;  4X65 Q;  4DK3 C;  4PZ6 A;  4DUZ Q;  1OXV A;  3F2B A;  4L5S A;  2BH2 A;  3PUY A;  1Y1W H;  4JI0 L;  2UXD L;  3MXN B;  4B3M L;  4MZ9 A;  1YHQ A;  2UUA L;  4OON A;  3S15 H;  4JOI A;  1VQ5 A;  3M4O H;  4LNQ A;  5HY6 A;  4Y52 H;  1N32 Q;  4DKA C;  4DR3 Q;  1HR0 Q;  2CQO A;  2ALY B;  4ME3 A;  5M5Y H;  1GO3 E;  2JA8 H;  3J81 c;  4GOP B;  4RMF A;  1W3S A;  4C3I H;  3HOX H;  3J7A 5;  1N34 Q;  1FJG Q;  3HOZ H;  2KBN A;  4AH6 A;  4DR7 Q;  1H95 A;  1A62 A;  5M5X H;  4JI6 L;  4DV1 Q;  3CCR A;  1Q7Y C;  3FKI G;  2JA5 G;  2UXB L;  1NMG A;  3HKZ G;  1I6H H;  4JI4 L;  1I94 L;  3UDX A;  2I5M X;  3K0X A;  2NZH A;  2WB1 G;  2ZJP A;  4DV0 L;  4BBS G;  4A3B H;  4YHH L;  3M4Q A;  5IP9 H;  5K36 G;  2Q2U A;  1KL9 A;  1LYL A;  4A3K G;  5AJ3 Q;  3EBE A;  2MQH A;  1QZH A;  4UP9 A;  1X56 A;  5GQO A;  2CCZ A;  1MIU A;  3CC7 A;  1SMX A;  1T9H A;  2L15 A;  2HHH Q;  1OXT A;  1V1Q A;  4DUY L;  2F3I A;  1LUZ A;  5FJ8 H;  3KF6 A;  1QVG A;  4P73 A;  4GKJ L;  4DV3 Q;  1YBY A;  3UE1 A;  3B6Y A;  2E2I H;  1TWF H;  4JI1 L;  1RIP A;  3RNU A;  4NXM L;  5GAG C;  5JJL A;  3BJU A;  4X65 L;  1K0R A;  1KAW A;  4A3M G;  1X6O A;  4DUZ L;  1HZ9 A;  4LFA Q;  3KLW A;  1A8V A;  1YNX A;  3UDI A;  3CF5 A;  4DV7 L;  1R9T H;  1PH6 A;  1G6P A;  3G6E A;  4DAY B;  1NY4 A;  1YZ6 A;  3CQZ H;  4C3J H;  4A3I H;  4XTC S;  4LF4 L;  1VQ7 A;  2OQK A;  3M7N A;  5LMU L;  4IFD I;  4X62 Q;  1JT8 A;  3PO3 G;  4YWM A;  4DR1 L;  3S14 H;  2DGY A;  2ID0 A;  3K81 C;  1PYS B;  3I4O A;  1CKO A;  1UEB A;  2PNH A;  4L5Q A;  1BBU A;  1VQ9 A;  3GTQ H;  4KLK A;  1HJP A;  2EIF A;  2VZA A;  1E22 A;  3GD7 A;  3GDE A;  1KRT A;  1AE2 A;  2WB1 E;  3FKI H;  2VQF Q;  2JQO A;  1YEZ A;  2JA5 H;  2PI2 E;  4DV1 L;  1NE3 A;  4GLV B;  4A75 A;  4IOC A;  4LUV A;  2BA0 A;  4A76 A;  1J5E Q;  3T1Y Q;  1VQD A;  2WP8 J;  5IYC G;  4RG1 A;  2DUD A;  4L5T A;  1UE6 A;  4A3K H;  5C4X G;  4KHZ A;  1Q1E A;  1HZB A;  4DV4 L;  1D7Q A;  1AE3 A;  1KHI A;  1V43 A;  2PMZ E;  3DM3 A;  1CKN B;  2NN6 I;  1KQS A;  4A3J G;  4DR5 Q;  2B3G A;  2Q2T A;  2IY5 B;  3RLF A;  2WFW A;  3BZK A;  1C7Y A;  3S1Q H;  3ULJ A;  4IPD A;  4QIW E;  5ELO A;  1VQC A;  1Y1W G;  1HNX Q;  2F4V L;  4LF5 L;  5GAE C;  4DV3 L;  1C0A A;  2PQA B;  3RN5 A;  3ULL A;  1TXY A;  2MNA A;  3H0G G;  3KF8 B;  1S72 A;  1K73 C;  1GM5 A;  1K8G A;  2NZO A;  3TS0 A;  4LF8 L;  4BY1 G;  2Z0S A;  1E1O A;  3PO2 G;  3A5Z B;  3EN2 A;  4JI2 Q;  4LF9 Q;  3U58 A;  4JV5 Q;  1CKN A;  4GKK L;  2A19 A;  1IXR A;  4HJ5 A;  1CSQ A;  1X54 A;  1KXL A;  3ICE A;  2KEN A;  4IPH A;  4O2D A;  2ASB A;  4H02 A;  4UY8 C;  1KD1 C;  4JBM A;  4KHP Q;  4UPA A;  3S1N H;  1TWH H;  1UWV A;  4NXN L;  5C0X I;  2OTJ A;  1N9W A;  5IWA Q;  4P72 A;  4B3R Q;  2VQF L;  1EUJ A;  1OXS C;  4GN3 B;  4DK6 C;  4A3B G;  3IRB A;  2K5H A;  3KDF A;  4X66 Q;  1Y1V G;  1TWA H;  5EAY A;  1V9P A;  4OWW B;  3K8A A;  3J81 i;  1PV4 A;  4JC0 A;  3PUX A;  1Q46 A;  4JI5 L;  5C4X H;  4L5R C;  2JE6 I;  3I55 A;  2UXC L;  1N36 Q;  3HOW G;  4YCW A;  4DAM A;  4GN5 A;  1PH9 A;  1L1O C;  1VQA A;  3JC6 6;  4AQY L;  1PH4 A;  3KYH C;  4A3J H;  2JJQ A;  3HKS A;  4OWX B;  4C3H H;  5FJ8 G;  4JOI C;  1XMO Q;  2E2H H;  3S16 H;  2UUC Q;  2K14 A;  4DR5 L;  4A3C H;  1XPR A;  2AMC B;  3CCS A;  4DR4 Q;  1L1O A;  2NVQ H;  4DR6 Q;  3W1B A;  1IBK L;  1NBW A;  1YJN A;  1HNW L;  1SFO H;  3H0G H;  3PO2 H;  4BY1 H;  2Z6K C;  4A3I G;  3M4P A;  2A8V A;  1JJ2 A;  3TRZ A;  3AEV A;  1S3O A;  5HGQ A;  1TWG H;  4JI2 L;  2GVB A;  2RHS B;  5H1S E;  4AYB G;  4DV5 Q;  1IZ6 A;  3GTL H;  4HID A;  3CCV A;  4JBW A;  1M90 C;  3S2D H;  2Z6K A;  1IBL Q;  1X65 A;  1IYJ B;  1I50 H;  2XTI A;  3I2Z A;  2IX0 A;  1FL0 A;  1PVO A;  3KFU A;  4B3T L;  4R1J A;  1C9O A;  3CAM A;  2K4K A;  1Q12 A;  1K8A C;  3GTK H;  3KF6 B;  3PSI A;  4TQU S;  2JA6 H;  1EFW A;  4K0K L;  3T1H Q;  5BR8 L;  1IBM Q;  1VQE A;  1G29 1;  1J6Q A;  4YY3 Q;  5JEA G;  2LXK A;  5DLQ E;  2UU9 Q;  5IWA L;  4BA1 I;  1KIX A;  5IY0 A;  2E5L Q;  4B3R L;  4DV6 Q;  1Y1V H;  2KCM A;  2MO1 A;  2NVT H;  2N49 A;  3CD6 A;  3H3V H;  5JJI A;  1RL2 A;  4BA2 I;  3PUZ A;  2YTX A;  4JG2 A;  2LSS A;  2OQ0 A;  2ES2 A;  3SGI A;  4DPG A;  4JYA L;  2RF4 A;  1K83 H;  4DV2 L;  3HOW H;  2IX1 A;  4JCV E;  4QGU A;  4X64 L;  3A5U A;  1N36 L;  1K3R A;  2GN5 A;  4BY7 G;  2K75 A;  3BZC A;  1XMQ Q;  4BXX G;  1OXU A;  1E24 A;  4LFB Q;  1YIJ A;  4IFD G;  3PUV A;  4MNO A;  1XMO L;  1N33 L;  1A63 A;  2YYZ A;  2UUC L;  3K80 C;  1AH9 A;  4YWK A;  2A1A A;  1XNR Q;  1EIY B;  1EIF A;  3ERS X;  3PCO B;  1WFQ A;  1EWI A;  4AYB E;  2JEB I;  2CKZ B;  4LF7 Q;  1N32 L;  4DR3 L;  4R4I A;  1JMC A;  2QEX A;  1HR0 L;  4JI3 Q;  4QQB X;  1MJE A;  1JE5 A;  2VL6 A;  3GO5 A;  4IPG A;  5LMN W;  4A3D H;  4POG A;  2D0O A;  4B3S Q;  4LF6 Q;  1BVS A;  4EX5 A;  2VQE Q;  4DR2 Q;  1HNZ Q;  1CKM A;  4ALP A;  4HIO A;  4AIM A;  1XPO A;  1N34 L;  2ZJR A;  1FJG L;  4A3L G;  2R93 G;  1PHJ A;  4DR7 L;  3M3Y H;  4JI7 Q;  3AYH B;  2VUM H;  3CXC A;  1N8R C;  1IL2 A;  1XNQ Q;  2NN6 G;  2YTV A;  3NEN A;  1VS0 A;  1LM0 A;  1QVC A;  3PIP A;  3CME A;  1IBM L;  3CPF A;  4C2M H;  3GTP H;  1WI5 A;  1WCM G;  4GS3 A;  2NVX H;  5AJ3 L;  3RZO H;  3KJO A;  1NJI C;  1VQM A;  4BY7 H;  4BXX H;  4A93 G;  3L0O A;  2JA7 G;  4R4Q A;  3PV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...