2K52A

Structure of uncharacterized protein mj1198 from methanocaldococcus jannaschii. northeast structural genomics target mjr117b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein MJ1198
publication title Structure of uncharacterized protein MJ1198 from Methanocaldococcus jannaschii. Northeast Structural Genomics Target MjR117B
rcsb
source organism Methanocaldococcus jannaschii
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k52A00
2E2JH 3J81c 2YYZA 3K7UC 3L0OA 3RLOA 2UXBL 4A3IH 4R4CA 4DV4L 4DAMA 3DLLA 4JI3Q 2KBNA 5JJIA 1MIUA 1YEZA 3PV0A 4DR5L 2IHFA 4IFDG 2WAQE 1WOCA 2L15A 3BJUA 1N9WA 3JAMi 1IBMQ 1NE3A 1L1OC 3KJPA 1KIXA 4PZ6A 4Y7NH 2ASBA 2ATWA 2VQFL 1TXYA 5LMUL 2WB1G 3AFPA 2K5HA 5EAYA 2N8NA 2VL6A 3NEMA 5GQOA 3H15A 4HJ8A 1J5EQ 5AJ3L 3S1RH 5FLXc 1PH2A 4A75A 1NMFA 1C7YA 3PO2G 5IP7G 1VCIA 2MFIA 4A76A 2V1CC 1K83H 2UXDL 3OYYA 2F4VQ 2Y0SE 1K8AC 2B29A 4DUZL 2JEAI 3PO2H 1Q82C 1N32L 1CSPA 1CKMA 5C0XJ 1LTLA 3I2ZA 5JEAG 4DR3L 4PZ7A 1FJGL 2K50A 3BU2A 1HNWL 4DV7Q 4NXNQ 1A62A 1ASZA 3J80i 4IO9A 1TWCH 1UE6A 1TWFH 5ELOA 4GLAC 2HHHL 3BZKA 1KHIA 3CF5A 4QQBX 3KDFA 4LUVA 2RF4A 1KC8C 3SGIA 2BH2A 2IT1A 1Y1VH 1VQ9A 1VQJA 1EWIA 1VQDA 2B3GA 3J81j 2NVTH 3PUVA 4J15A 3JC66 3G48A 3GTOH 4X66Q 2DGYA 5M3MG 3RN2A 1JMCA 2IHEA 4DV6Q 1S3OA 3S1MH 3S2HH 4TQUS 1KXLA 1WJJA 2OQKA 5IYBG 2UUCQ 2HT1A 2PQAA 1VQEA 5C44G 1VQHA 4WJ4A 5M3MH 4JYAQ 5GADC 4LF7Q 3M3YH 4UP8A 5IYBH 4BY7H 2B63G 5C0XI 5C44H 1VQ7A 1NTGA 4JI0Q 3S1QH 3JAMc 3E9IA 5HY6A 4HJAA 4GOPC 1QZGA 4DV5L 2RCNA 1RIPA 4A93G 2MO0A 3CQZH 3CW2C 4JI1Q 4B3SQ 1S72A 3TREA 3CCEA 3EIVA 1JJ2A 4EQ5A 2KHIA 2A8VA 1NBWA 4RMFA 3UDXA 2PI2E 1UEBA 4YY3Q 4LF4L 4NXML 4A93H 4DR2L 1PYSB 2JA5G 4DR1L 1LUZA 4A3MG 1LM0A 4TVAB 1I5FA 2CCZA 4JI6L 4LF8Q 3CC7A 3U4ZA 4DV1Q 1E3PA 2UUBL 4KHPL 3CCUA 2JA5H 3K0XA 1HZ9A 2I5HA 2ZJRA 1I94L 3TS2A 1YHQA 2LXJA 1XNQQ 2BA0A 2CFMA 4DK3C 5H1SE 4X65Q 2JEBI 4MNOA 5C0XG 1P16A 3UDGA 4C3HH 4R4QA 2UUAQ 4YWMA 4JBKA 3E9HA 1KAWA 4GS3A 4BBRG 1HZCA 1OXUA 2R92G 3U4VA 1HNZQ 1XPUA 3OTOQ 4HJ5A 3H3VI 1AH9A 1XPOA 3HFZB 3G4SA 3T1HQ 1N34Q 1D8LA 1VQLA 1Q46A 4LF5Q 2JA8H 4BBRH 2FXQA 2VUMG 3AFQA 4YWKA 5GAEC 1H95A 4O2DA 1YJWA 4JBWA 5M5XH 1VQ4A 3KF8B 1N36L 3KLWA 1AE2A 1LYLA 2RHQB 2CWPA 2DUDA 3KOJA 2EQSA 1Q86C 4JBMA 2VUMH 4P73A 1KD1C 3S1NH 3S2DH 1SMXA 4A3LG 1HZBA 2Q2UA 4QJFA 3LGJA 1X3EA 1NMGA 2OQ0A 3CCMA 1OXVA 4KI0A 3CCVA 4LFCQ 2ZM6L 1MJCA 3ERSX 3HKZE 2NZHA 3ICEA 5C4JH 2R7FA 1EOVA 3I4NG 4A3DH 4A3LH 4DKAC 2YV5A 3M4PA 4A3FG 4JV5L 2D62A 2F4VL 1HR0W 1HR0Q 4YCVA 4JI2Q 2EIFA 3PO3G 4BA2I 1Q12A 3F1ZA 1A0IA 1X56A 3I7FA 2KCTA 3NENA 4QIWE 2ZTDA 2JA7H 4NXNL 4DV7L 2CQOA 1UE1A 2YTVA 3U50C 5IWAQ 3PF5A 4LFBQ 4GLXA 3PO3H 4BXXG 3CC4A 3GDEA 3K81C 3H3VH 3K8AA 1OXTA 4A3JG 1PH1A 3AQQA 3FKIH 3A5ZB 4DR6Q 3RZDH 4IJHA 1X54A 4BXXH 4X66L 1MKHA 4JOIA 4OX9L 4A3JH 4DV6L 1ASYA 4A4IA 1I50H 5M5WH 3PGZA 1X6OA 3CPWA 2UUCL 3GTJH 3E0EA 5JJLA 5GROA 4JYAL 4LF7L 4IOCA 2Z6KC 3CCJA 3IRBA 2VQEQ 1QVFA 1PFSA 4GNXC 3PUYA 4AYBG 1HH2P 4LW1A 1SLJA 1TWAH 4JI5L 3KFUA 1Y1VG 3KF6B 2NVXH 4JI0L 3AEVA 4GKJL 1CSQA 4LFAQ 2MO1A 1XMQL 2VZAA 1IBLL 4P72A 4B3SL 4B3RQ 5K36G 1Q81C 1KRSA 3TRZA 3STBC 3D0FA 2AWNA 3TQYA 2E2HH 3H0GG 1PH4A 1SRUA 4MTNA 1YZ6A 4YY3L 1N33Q 3F2CA 3ULPA 4IJLA 4PMWA 3M7NA 1EUJA 1V1QA 3H0GH 4LF8L 2XTIA 4DV1L 1XMOQ 4BY7G 1EIYB 1IYJB 1EIFA 3HKSA 2NVQH 3A0JA 4L5RC 1EQQA 1UE5A 1PA6A 4UY8C 3HOVG 1KL9A 1S40A 1L2FA 1XNQL 4HIOA 4P75A 4X65L 2A1AA 4LUZA 4UP9A 2E5LL 1BBUA 4IPDA 4POGA 3HOVH 2MNAA 2KHJA 2ZJPA 2Q2IA 1QVGA 1PVOA 3W1BA 3K7AH 2K75A 3G6EA 3UE0A 3CCQA 3TS0A 3PUXA 2VQFQ 1VQNA 4ME3A 1L1OB 4K0KQ 4QL5A 1IZ6A 4A3CH 5LMNW 2R7DA 1VQGA 5LMNQ 1HNZL 5IYDG 3OTOL 3KJOA 2Q2TA 4LF9L 3RZOH 3GTLH 1N34L 1I3QH 1YBYA 4DV3L 1VQOA 1BBWA 2PMZE 1V43A 2WAQG 3B6YA 2QA4A 4LF5L 3GTQH 2UXDQ 2AMCB 3UDFA 4AH6A 4OO1I 3ULLA 4DPGA 1UE7A 1N32Q 1JE5A 5IT9c 2Z0SA 4LF6Q 5IYDH 1CUKA 4HJ7A 5C4XG 4A3BH 1R9TH 4P71A 4DV0Q 5FLMG 4QGUA 4O0AA 3J80c 1YITA 2E8GA 1WYDA 4AQYQ 1GVPA 1KQSA 4QY7A 4JCVE 2GVBA 5C4XH 1YVCA 3KF6A 4DR7Q 2Y0SG 3F8TA 4X62Q 4B3MQ 1QUQB 1VQ6A 5FLMH 4IPCA 1A63A 4KHZA 3FP9A 5IP9G 2JA8G 1N8RC 1HR0L 4DNIA 1E1OA 4BBSG 2HQLA 1HZAA 2JK8A 1YNXA 1E7ZA 1X3GA 2PI2A 1U5KA 4JC0A 4YCUA 3HOUG 4IFDJ 2VNUD 3W1GA 1K0RA 3RR5A 3J81i 4P74A 5IP9H 5IWAL 1B8AA 2WB1E 2HIXA 3RLFA 5M3FH 2YU9H 2UU9Q 2I5MX 3S14H 4BBSH 4OONA 4JI3L 3I55A 4OO1G 2WFWA 3GD7A 4IOAA 3Q8DA 4OWTB 2NZOA 3HOUH 2YTXA 2R7ZG 5IY0A 1SE8A 1WCMG 1X55A 2CWAA 2XGTA 1IBML 1TWGH 1VQIA 4BY1H 1XNRQ 2JA6G 3S17H 4A3DG 3U58A 1YHBA 3K80C 4XIGS 2NN6I 5BR8Q 1W2BA 4OWWB 4DV5Q 1TWHH 2R7ZH 4H02A 1IBKQ 1NY4A 1J5EL 1WCMH 2JE6I 3GO5A 5JEAJ 1YI2A 1MJEA 1Q1EA 2JA6H 3PUWA 2JA7G 1L1OA 1G51A 2HIVA 2N49A 3PIOA 1FL0A 1VQPA 1QZHA 1PHJA 1HNXQ 4LF4Q 3F2DA 2OCEA 2GN5A 1X3FA 1VQ5A 4NPSA 3W5OA 1W3SA 4JBJA 4DV2Q 3VDYA 4JI4Q 4JI6Q 3CMAA 3CPFA 3M85A 3PF4A 1VQ8A 4GKKQ 1XTDA 3FKIG 1CKNA 2BH8A 4DR4Q 2IX0A 2GVAA 2Z6KA 2E2IH 4B3RL 3T1YQ 1FGUA 4HIMA 1C9OA 4R4IA 3I4MH 2OTJA 4PG3A 1X9NA 2D0PA 1GM5A 1N33L 4IPGA 2K5VA 2NN6G 3A74A 4NB3A 3HOXH 3NELA 3UE1A 2AWOA 3CCLA 1QUQA 3CXCA 1K3RA 1G6PA 2AHOB 4GLVB 3EN2A 4LNQA 1EQRA 5C3EG 1XPRA 1WFQA 2ID0A 4L5SA 1E22A 3KYHC 1PV4A 1Z9FA 3PSIA 2Q2HA 4L5QA 3RN5A 1E1TA 3UDIA 4UP7A 1VQKA 1Q1BA 5C3EH 1N36Q 4JG2A 4JI7Q 4DUYQ 3DM3A 1X65A 1SROA 3M9BA 1FVIA 4X64Q 1Q8KA 1PH8A 4K0KL 3CC2A 5FJ8G 2WP8J 3EBEA 4JI1L 4X6AH 4IPHA 2I0QA 1D7QA 2ZM6Q 5LMNL 4LWCA 3ER0A 4JI8Q 3I56A 2UXCQ 2ZTCA 4DR4L 1B7YB 4EX5A 3L2PA 1VS0A 3GTPH 4GOPA 4JV5Q 5FJ8H 1VQMA 3S15H 1YJ9A 4YHHQ 1IXRA 1WI5A 4ALPA 4B3TQ 4LF6L 5J3BA 3CP0A 3MEFA 5IP7H 5DLQE 2KCMA 1K8GA 3HKZG 4YWLA 4DAYB 4DV0L 2UXBQ 4DV4Q 2N78A 1YJNA 4JOIC 1M90C 4AQYL 2ALYB 1IL2A 2ZTEA 1YHAA 4DR5Q 4DR7L 4A3CG 4X62L 4A3KG 4B3ML 3BZCA 1JT8A 4GN5A 4C2MH 1GKHA 1PH3A 2UUAL 3I4OA 1PH5A 3GTMH 3F2BA 4OX9Q 1QVCA 4R4OA 5LMUQ 1VQBA 2BA1A 4A3KH 5AJ3Q 1Z47A 4BA1I 5E7NA 3T1HL 1HJPA 2K14A 3PIPA 1OXXK 5IYCG 3HOYG 4A3BG 4L5TA 3RLNA 2KENA 1PYBA 2UU9L 2YTYA 3S24A 4R4TA 4DUZQ 1CKNB 2MQHA 4HIDA 2JA9A 4DR3Q 1EFWA 2OWOA 1FJGQ 3HOYH 5GAHC 5IYCH 4JI5Q 1HNWQ 4GNXB 4XTCS 3CD6A 1C0AA 1XNRL 1SFOH 2HHHQ 4GKJQ 2K5NA 3CAMA 1JB7A 2OTLA 3D31A 1XMQQ 1XJVA 5BR8L 4LFCL 1IBLQ 1L0WA 3HOWG 1V9PA 2AKWB 4GN4B 5HGQA 1IBKL 3ULJA 2LXKA 2B63H 1A8VA 1Y14B 4YCWA 5ELNA 4HJ9A 4AIMA 1U0LA 1UWVA 2RHSB 3G71A 3GTGH 3HOWH 1HNXL 1VQAA 3CCRA 5M5YH 5M3FG 4JI2L 1O7IA 1PH7A 4LUOA 1K73C 4DV2L 4JI4L 1I6HH 4A3GG 1P8LA 1VQFA 1Y1WG 4OXPA 2A19A 1PH9A 3M4OH 4GKKL 2ES2A 4APVA 4LFBL 2K52A 2VW9A 4BY1G 1OXSC 3FHWA 3MXNB 4C3IH 4A3MH 4A3GH 1K9MC 1Y1WH 2R93G 3T1YL 2F52A 2R6GA 4KLKA 1KRTA 4R1JA 1T9HA 1E24A 2E5LQ 4DR6L 3WWVA 4PZ8A 4POFA 2N3SA 4AYBE 2R93H 4WJ3M 1RL2A 2LSSA 1VQCA 3J7ZC 3CMEA 4GOPB 3S16H 4RG1A 1JJGA 4MZ9A 4A3EG 2IX1A 5IE8A 3A5UA 3RNUA 5JJKA 4LF9Q 3PUZA 2C35B 2QEXA 4DV3Q 3NBHB 3ZJYC 1JJCB 4NXMQ 1PH6A 4DR2Q 2K4KA 3CCSA 4DR1Q 4A3EH 1SN8A 4HIKA 2VQEL 5GAGC 1Q7YC 1DGSA 2R92H 2VS1A 1AE3A 3L7ZC 3TEHB 4C3JH 1OTCA 2ZJQA 4JI7L 4IFDI 4DUYL 3I4MG 3KDFB 2CKZB 2UUBQ 1CKOA 2F3IA 1M1KC 4KHPQ 2EXDA 4OWXB 4DK6C 4LFAL 4X64L 1I94Q 4UPAA 3PCOB 2H5XA 3HOXG 3M4QA 2D0OA 1YIJA 2NVYH 1NJIC 1EYGA 4GNXA 3GTKH 1BVSA 3AYHB 4JI8L 1J6QA 2IY5B 3STBD 2UXCL 1BKBA 1B70B 4GN3B 3HOZG 2PNHA 2QGQA 3J7A5 4Y52H 2JQOA 2PQAB 4FDBA 1SR3A 2VY3A 1G291 4YHHL 3OW2A 1GO3E 4A3IG 4B3TL 1GD7A 2JJQA 3I4NH 2I5LX 1XMOL 3HOZH 4A3FH
chains in the Genus database with same CATH superfamily
1SNCA 4KKTA 2E2JH 2UXBL 4A3IH 3I73A 3DLLA 2KBNA 1MIUA 1YEZA 1V1PB 1I6VC 5J22A 1DOMA 3VR2A 3V96A 2ATWA 4X3KA 3VR6A 1A3TA 4DNTB 5EAYA 2N8NA 3NEMA 5GQOA 5HGTA 4HJ8A 1JCKB 5AJ3L 2PMZB 3C46A 1VCIA 4IUVA 4KHVA 5TSSA 2MFIA 3SE0A 1K83H 5DNFA 3OYYA 3EJIA 2Y0SE 1K8AC 4A3FB 1N32L 4M1UB 3IKJA 3HZXA 5C0XJ 5JEAG 1F9PA 1ASZA 4Q5VA 3KF8A 1KHIA 1WTXA 3CF5A 3Q0AA 4QQBX 1UEAB 4LUVA 1KC8C 3NPPA 4Y7NB 2BH2A 1U9RA 1LACA 1VQDA 3J81j 3PUVA 4J15A 2F0JA 4YIJA 3BYYB 2AQ3B 4FXKC 3KUPA 4JPBW 3S2HH 1KXLA 1WJJA 1YNJC 2PQAA 5C44G 5M3MH 4HMIA 3M3YH 4NP5A 3A8JE 2EXZA 2WKDA 4BY7H 4NKLA 2FINB 1S4ZA 2B2WC 1V1PA 1QZGA 5HY6A 4DNRB 1RIPA 4A93G 2MGSA 3CQZH 4B3SQ 2NVTB 1S5FD 3EIVA 4OIKA 1O7YA 4RMFA 4N8X1 4DR2L 1EY9A 2PPBC 1BR9A 1L0YB 2CCZA 2B2YA 1EU4A 3Q22A 4ABNA 4DV1Q 3CCUA 3NWTA 5LL6X 3JAML 4X65Q 5C0XG 1HFGA 3D4DA 1LTRD 4KN7C 4C3HH 1TKWB 2UUAQ 2RDFA 3J81E 4GS3A 4BBRG 1OXUA 4WJWA 3BDOA 4HTHA 3U4VA 1HNZQ 4HJ5A 3HFZB 3G4SA 1N34Q 3GP7A 4R9WA 2JA8H 5GAEC 3VA7A 4O2DA 1JR0D 4DU9A 2JA5B 3H6MA 4JBMA 2EQSA 4A3LG 4FXGC 4QJFA 3LGJA 1O80A 5EBCA 1H9JA 1NMGA 4LFCQ 3X3NA 4KV6A 1EOVA 5DEHA 4A3FG 5G3LD 2F4VL 1HR0Q 4YCVA 4JI2Q 3PO3G 4FP5D 1Q12A 3IL8A 2KCTA 4QIWE 3KK7A 2ZTDA 4DV7L 2CQOA 3PF5A 2H4OA 1HHVA 2K1BA 4BWGB 4BXXG 3K81C 3SK8A 3S2DB 3K8AA 2MPMA 3J7YW 3S1NB 1BO0A 4A3JG 1DYQA 3A5ZB 1F77A 2E75C 3DWQA 5C4JB 2XIWA 4OX9L 4A4IA 1I50H 2UUCL 3CPWA 4B9WA 1YNND 1GUSA 2EY1A 3IRBA 5A2QL 1QVFA 4GZYC 5KRUA 4AYBG 3KLSA 4LW1A 2A68C 2IPKD 3KF6B 2VZAA 1PFBA 5K36G 3QOJA 2RSNA 2AWNA 1PH4A 1G6ZA 1YZ6A 4YY3L 3TN2A 4K14A 4PMWA 2D5DA 1EUJA 5JPNC 4H13C 4QMGA 1TVXA 1EIFA 4ZUIA 4KK7A 3A0JA 1STEA 5BN5A 3K58A 1F2MA 1EOTA 1TWAB 3NTKA 3PIO3 5CV9A 3OMCA 2Q8TA 2XWJB 4LUZA 1BBUA 1ENFA 4S3SA 3HOVH 1HPCA 2MNAA 2OXPA 1PVOA 3SHLA 3TS0A 1VQNA 4K0KQ 3E3XA 3KLRA 1CI3M 1QILA 4OHJA 3OTOL 5LMNQ 1D5ZC 5JJKA 3GTLH 4LF5L 1M8AA 2EOTA 3H0GB 5IODA 4K5XA 4OO1I 4DPGA 2NVQB 1GUOA 1N32Q 1PTOH 1K8OA 1ICFB 5C4XG 1B3QA 3A8IE 2NYZD 1B53A 5FLMG 3J80c 1JICA 1GVPA 3QIAA 3KF6A 2Y0SG 5CR3A 1VQ6A 2EJGC 4IURA 1I4GA 1VF5C 4KHZA 3FP9A 5KNDA 1HUNA 1IKLA 1LT3D 1E7ZA 2XRQD 1LO5D 3TBIB 4C56C 4V0BA 2WB1E 2YU9H 1SNMA 4BBSH 4OONA 3I55A 3Q8DA 3HOUH 2YTXA 1R9TB 2R7ZG 2ZT9C 3I8ZA 2CW0C 2AUJD 1SE8A 4MTKA 3S17H 1IBML 2QDBA 3IFDA 5I9OA 3SXHA 3NTIA 4H02A 1NY4A 1J5EL 1WCMH 2K7VA 1MJEA 1D5XC 1VDZA 4UDUC 2O2LD 2HIVA 2N49A 1HNXQ 4DV2Q 3CMAA 1EYAA 1X32A 3QO2A 3M85A 5C5MA 1XTDA 2IX0A 2E2IH 3MHBA 3T1YQ 1FGUA 4BY1B 4R4IA 1STYA 1KABA 4IPGA 4NB3A 3A74A 3Q23A 1D1KA 3DUZA 2JA6B 3VA5A 1Q8IA 2KA7A 1BUVT 1WTRA 4LNQA 2NN6H 1WFQA 4L5SA 2F0NA 2EYHA 4L8JA 4FO2A 4WFN3 3NQIA 5ELFA 4JI7Q 5C3EH 4EQOA 1CA5A 4DUYQ 2ENBA 3GV6A 3M9BA 3A56A 1PH8A 3CC2A 3K5OA 2WP8J 4JI1L 1ILPA 4IPHA 3I56A 3HOXB 2K01A 2ZTCA 4DR4L 3E6ZX 3L2PA 5FJ8H 1VQMA 5KYIA 4YHHQ 1IXRA 4NDXA 4U673 4LF6L 4TRDA 4WRDA 5JAVA 4RAUC 4C1NK 4DV0L 4CKBA 4DV4Q 1YJNA 1QJOA 2MP1A 4F7XA 5C4HA 1IL2A 3DMUA 4DR7L 1SNDA 4X62L 5C5LA 4B3ML 3BZCA 4UHVA 4DXFA 2A74C 2LY7A 3TP8A 1EYCA 2X6GA 3MC0B 2CH4A 1EIGA 4OX9Q 4R4OA 1O78A 5LMUQ 3KLSX 1EY0A 2M9VA 5E7NA 3T1HL 1HJPA 3PIPA 2EE1A 1PYBA 2RBMA 2YTYA 4R4TA 4HIDA 2JA9A 1EFWA 2K03A 4RGNA 1JB7A 3D31A 2A69D 5FO8B 1B1ZA 2LXKA 1Y14B 4K2LA 1UWVA 1HA5A 3HOWH 5L37A 4A3KB 3DM1A 5M5YH 5D3DA 4XQQA 1VQFA 4OXPA 3M4OH 1PLFA 3V05A 4KMUC 4APVA 4LFBL 1SYBA 4BY1G 1OXSC 3MXNB 2EJFC 3HOYB 1HTPA 2XNAC 1K9MC 2R6GA 1KRTA 4R1JA 4DR6L 2LMCB 1AW7A 4K5VA 1Y8NB 2N3SA 4RA8A 3J7ZC 5EKKA 1JJGA 1AZPA 3NUCA 2AUKA 2H1EA 1MHWC 2NB0A 1QNUA 3SEBA 4NXMQ 1PH6A 2K4KA 4A3EH 1LTTD 5GAGC 1W6KA 2HUGA 5ISRA 4C3IB 5JPMC 4A3MB 3KDFB 5CV7A 4A3GB 4XQJA 4KHPQ 1VMCA 1FYCA 1EYGA 2H5XA 3HOXG 3AMUA 3R3OA 4JI8L 3NQTA 4ME5A 3R2TA 4GN3B 3J7A5 4HSVA 2F0SA 2F1MA 2JQOA 4FDBA 1SR3A 2M00A 2NUCA 3OPOA 2EY2A 2I5LX 1LTGD 2NWGA 5EQ0A 3QWNA 3LX0A 4A3FH 3K7UC 3GQBA 2BOSA 4C3JB 2F0UA 5JJIA 2EYMA 2QKIC 2WAQE 2F03A 2L15A 3MXNA 2NVYB 3A55A 1IBMQ 4Y7NH 2ASBA 5C4ZA 3OW7A 3QG1A 3R2IA 4JW0A 4IFDH 5FO7B 2WB1G 2DJGC 3AFPA 1J5EQ 1EIHA 5IGFA 3PO2G 5EBDA 1C7YA 1I4QA 3J81L 3I4NB 1T5EA 1D2BA 2B29A 3HOZB 1EY8A 1FR3A 1ET9A 1CSPA 1B9NA 1CKMA 4DR3L 4PZ7A 4KJNA 3BU2A 1HNWL 1A62A 3PMFA 4LJZC 4IO9A 4GLAC 1E2WA 2KCNA 4FF2A 4RCOA 1BCPF 1CM9A 1F9RA 3KDFA 4KD3A 2RF4A 3SGIA 2IT1A 3IFTA 5FLXL 1VQ9A 1EWIA 2NVTH 1SBBB 3JC66 3T56B 1C4QA 3S1RB 5M5WB 4ZUJA 3M4YA 1WTQA 5K36H 4DV6Q 1S3OA 4TQUS 5IYBG 2HT1A 2EZVA 2KHSA 4KN4C 1VQEA 2MHVA 1VQHA 4WJ4A 1EL0A 4JYAQ 1RD9D 1PTOF 1RODA 3VYSA 1TWFB 1NR4A 1WTHA 2HCCA 5IGBA 4KD4A 3E9IA 4GOPC 2NZ1D 1HRJA 1J9OA 2MO0A 4JI1Q 3TREA 3GTOB 1JJ2A 3D6CA 1EYDA 2A8VA 2NBFA 4Z9CB 1UEBA 4LF4L 1LTBD 1NR2A 5IGDA 5FO9B 4A3MG 4JI6L 4RHSA 4LF8Q 3CC7A 2KEEA 4RKLA 3EFXD 4IUTA 1CQFA 2B2VC 5CMDA 3HP3A 2JA5H 3K0XA 1HTLD 1HZ9A 5C44B 1TS3A 1YHQA 2BA0A 5H1SE 5IIFA 2EY5A 1P16A 1EZ6A 3M7GA 4OELB 5EKLA 1GHJA 4YWMA 2QW7A 2B2TA 3ND8A 4LK1C 5E4WC 1HZCA 1O7LA 3NK9A 1F2ZA 4G7HC 2B2UC 1W6JA 1AH9A 3A8KE 4A93B 3HS0C 1XPOA 2L12A 3T1HQ 3MVVA 2VUMG 3OWEB 1H95A 2RVLA 5M5XH 3Q6SA 3KF8B 1KLGD 3QB3A 1AE2A 1LYLA 2RHQB 2CWPA 4ZKBB 3S2DH 3I3CA 3S1NH 1KD1C 1HZBA 2Q2UA 1DXMA 3CCMA 1OXVA 2F0MA 3HKZE 2NZHA 5C4JH 3I4NG 4DKAC 4JV5L 1HA6A 1IYVA 1FGBD 4BBRB 4NXNL 4X3SA 3P7JA 3U50C 4LFBQ 2CQAA 1GUWA 1FNUA 4GLXA 3CC4A 4FVMA 1PH1A 3AQQA 1QCBD 4DR6Q 1TWHB 1X54A 5KGUA 4X66L 1SDFA 1A6XA 4A3DB 2BE5D 2TMPA 3PGZA 2E74C 4JK1C 1MBYA 1X6OA 3E0EA 4LF7L 3CCJA 2L55A 1B50A 4GNXC 1HH2P 3PO3B 1TWAH 1ONLA 4CJ0B 2RDGA 4JI0L 2F4IA 2MO1A 1XMQL 1IBLL 3FKIB 3HGBA 3RZDB 4B3RQ 1Q81C 2D2CC 3PQIA 4IALA 4RCNA 2X69A 4A3JB 4MTNA 1N33Q 4IJLA 4EVOA 4L6TB 3M7NA 1V1QA 1JOOA 5IGCA 3DXJC 3H0GH 2XTIA 1D6EC 3HKSA 2DY8A 2NVQH 3HRZC 1KNAA 4K6LA 1KL9A 3NWSA 3FVQA 1EZ8A 2KVMA 1S40A 1DOKA 1L2FA 1XNQL 2F0GA 3NBIA 4UP9A 2KOLA 2FFKB 4IPDA 2KHJA 4AYBB 2Q2IA 2B2VA 3W1BA 1HFNA 4CHTB 1STHA 4QL5A 2Q2TA 2Z1CA 5IYDG 3KJOA 3Q24A 2IL8A 1YBYA 3B6YA 1V43A 2WAQG 2OT2A 2QA4A 1GXDC 2AMCB 3UDFA 2XN9C 2QCPX 4CDCC 5IT9c 2Z0SA 1ZKOA 1ML0D 2G9DA 5DAUA 1PRTF 1R9TH 4P71A 3D4WA 2JXMB 2BDNA 1IW7D 1YITA 1WYDA 1C48A 3OSOA 4PV1C 3K7AB 3QJYA 5CV5A 5IP9G 1TT2A 2Z4IA 5EKIA 1I3QB 5CV8A 1YNXA 1ZXTA 1X3GA 2OEOA 1U5KA 3GTQB 4IFDJ 1AP0A 3OHXC 3W1GA 1K0RA 3J81i 1H9MA 5IWAL 2WINB 1B8AA 2UU9Q 2I5MX 4OO1G 4JI3L 1SJHD 4A3BB 4OWTB 4DAYA 1XNRQ 5FLXE 4BY1H 1VQIA 2EDGA 4A3DG 2SNMA 1TR5A 5C4XB 3K80C 4XIGS 2NN6I 1W2BA 1S5BD 1IBKQ 1M4VA 3C3LA 3P20A 3GO5A 4HR7B 2JA6H 3K5MA 2Y0SB 3QR8A 1S5CD 3PIOA 2A6EC 1PHJA 1FL0A 1VQPA 1V1OA 4LF4Q 3F2DA 2FMMA 4NPSA 3W5OA 1W3SA 4JI4Q 3VDYA 4JI6Q 3CPFA 1R4QB 3MFGA 4GKKQ 3FKIG 2BH8A 2GVAA 2CVRA 1CK1A 2VB3X 1TWGB 2LFNA 1DONA 1GHKA 1SYCA 4PG3A 1X9NA 2R7ZB 1EY5A 3HOXH 5D65A 2AWOA 1UAPA 3CXCA 2ICIA 5JOBA 4GLVB 4NMZA 1EQRA 2Z9HA 2ID0A 1E22A 1YNJD 1SE2A 1PV4A 3W3AA 1LTID 2Q2HA 2B39A 1MGSA 2RSOA 5IOCA 1VQKA 5DM63 5D3IB 1X65A 4ULLA 3DEPA 4X64Q 2EPBA 3EBEA 1F2YA 3FRPB 1B7YB 2B2WA 4EX5A 1VS0A 2JP1A 4JV5Q 2KCCA 3EA6A 1MD2D 1YJ9A 4J6HA 3J80E 3VYRA 2MJ8A 3HKZG 2EYLA 4YWLA 2UXBQ 4JOIC 1I4HA 2ALYB 4AQYL 2ZTEA 1BQQT 4HAEA 4I65A 4EQPA 1JT8A 4CDFC 1PH3A 3DWPA 3I4OA 4XQNA 1PH5A 2BDOA 4TKOB 1QVCA 1EFID 1QOHA 1VQBA 2BA1A 4OGQC 5LHY1 4A3KH 5AJ3Q 4IZ8A 3S15B 1RF2D 2K5QA 5IYCG 4FF4A 4A3BG 4L5TA 3RLNA 3W2DA 2F0IA 4PMBA 1CHQD 2MQHA 2DY7A 3HOYH 4CKCA 4IUPA 4J1MA 4XTCS 3CD6A 1XMQQ 1XJVA 5BR8L 1IBLQ 2F0LA 5FK9C 4GN4B 4C2MB 4YCWA 4AIMA 3GTMB 1QNKA 3I91A 5D14A 1PMRA 4X3TA 2RHSB 3T4AC 3V2TA 2QEJC 4R8IA 4RGMA 1PH7A 4QIWB 3D6WA 1Y1WG 3EVQA 3SR1A 1QG7A 4C3IH 4A3MH 4A3GH 3MAQA 1A3VA 5KEEA 2R93G 4F8MA 4KLKA 3KBGA 1E24A 1G8ZD 4ZKCB 4PZ8A 4POFA 1ESFA 4WJ3M 1SE4A 2LSSA 1VQCA 3BG3A 3CMEA 2IX1A 3GTGB 3A5UA 4PNYA 2N88A 5CGKA 2C35B 2QEXA 3NBHB 1ET6A 3OOCA 4DR2Q 3CCSA 4RH6A 4HIKA 1Q7YC 5K5PA 2VS1A 1Y8OB 1AE3A 4C3JH 4IFDI 5IGEA 5KNBA 2CKZB 1CKOA 2A68D 3A7AB 4LFAL 4K6DA 1YIJA 1X3QA 2NVYH 2X6LA 1FNVA 2MUYA 1EQVA 5KNCA 1J6QA 2UXCL 1E0BA 2L1BA 3TP7A 2QGQA 1NCVA 1I4PA 4A3IG 3OW2A 4B3TL 1GD7A 4EQNA 4G57A 4CJ2C 3I4NH 1O7ZA 1XMOL 3HOZH 3BDLA 2YYZA 2R92B 2F0EA 3RLOA 4R4CA 2L5TA 3CKIB 4DAMA 1K3BC 4JI3Q 3PV0A 1HUMA 2FMCA 3E5SA 4DR5L 2IHFA 1WOCA 5EPLA 3G7LA 5I2YA 3BJUA 3JAMi 1NE3A 1L1OC 1KIXA 3GTKB 2VQFL 2K5HA 1Z6HA 2VL6A 2O5JC 3H15A 2DJFC 1PH2A 3S1RH 3G6JB 4A75A 2K32A 3OIQA 3MEHA 2F0VA 2V1CC 3NXWA 3FPPA 4XYOA 2F4VQ 3ZYYX 4DUZL 3H09A 2TSSA 3HEJA 3K59A 1LTLA 3NBHA 1FJGL 1BCPC 4DV7Q 1JB3A 2XVSA 3ONAB 1UE6A 2HHHL 1TWFH 5KIXA 4LAAA 4I7ZC 5JEAH 2GA4B 4N8FA 1SAPA 1EWCA 1H9SB 1VQJA 1TY2A 3GTOH 3G48A 5J1ZA 2DGYA 5M3MG 3RN2A 2QF7A 2N55A 5CBEE 2OQKA 1PTOC 2WB1B 3SK6A 2UUCQ 4FF3A 4HEDA 3PO2B 3IAYA 5GADC 4CJ1B 4UP8A 1TWCB 5C44H 2EVBA 4RWSC 2CW0D 1VQ7A 1NTGA 3TP5A 3JAMc 1GUTA 1K28A 1SXTA 1Y1VB 4DV5L 1QWYA 3CW2C 2DN8A 2SOBA 3TMEA 1S72A 2R3ZA 4K2KA 2E76C 4EQ5A 1NBWA 4YY3Q 3S1MB 4A93H 4DXGA 1PYSB 5ELEA 4DR1L 1LUZA 3U4ZA 2UUBL 4C3HG 1CTMA 4ID6A 3P75A 1I94L 1B9MA 3TS2A 4L63B 3S1QB 3N6RA 2C9OA 2OF1A 4MNOA 3SVMA 4CDDC 4R4QA 2D9UA 5CORA 4ZK9B 4JBKA 3K6OA 4E6IA 1LV9A 1BF4A 5C0XH 2KUMA 1H9SA 1A15A 2RA4A 2R92G 1I4XA 1KDAA 3OTOQ 2Z6BA 4PQXA 1VQLA 1D8LA 4LF5Q 1E2VA 4BBRH 2FXQA 3AFQA 4YWKA 4QF4A 1QE6A 1K0SA 4JBWA 1PXUA 1VQ4A 3KLWA 4JVZA 2DUDA 3KOJA 4P73A 1NNXA 1X3EA 4KTAA 1SMYC 4DK0A 1MJCA 3ERSX 5E3FA 2PZUA 1GOZA 4A3LH 4A3DH 1BOSA 1HCZA 5BN4A 1HR0W 2ZXPA 4F87A 4ZLTF 3I7FA 3C2PA 3NENA 2YTVA 1TQOA 3PO3H 2VUMB 3GDEA 4DAVA 3H3VH 4ZRZA 5IGGA 2FHTA 1GUNA 3FKIH 3RZDH 4IJHA 4BXXH 1RHPA 2A6HC 3F2UA 4A3JH 1ASYA 1RJTA 2IJ0A 1VMPA 2Q8IB 5T1IA 5C3WA 5GROA 2L9HA 1TS2A 4IOCA 4DN4M 2JA7B 3CRKC 1PFSA 3PUYA 1SLJA 2SNSA 1L0XB 4JI5L 3U9SA 1Y1VG 3AEVA 4P2CB 4LFAQ 4UAIA 4P72A 4B3SL 1II3A 1KRSA 3TRZA 3STBC 3D0FA 2M2LA 2SEBD 1SRUA 1DD2A 1PFMA 3BVGA 4KKSA 3GTJB 5EPJA 3KBXA 4DV1L 1XMOQ 1EIYB 1IL8A 2XWBB 4HMJA 4UY8C 3HOVG 2HD3A 5I9PA 1I4RA 1ENCA 2HCIA 3QOLA 4X65L 2NVXB 4ZCKA 2PCFB 3I72A 1EEFD 2ZJPA 2G9HD 1QVGA 1A2UA 3K7AH 3G6EA 3UE0A 2E2HB 2VQFQ 3EQLC 4ME3A 1JOQA 1IZ6A 4H7BA 5LMNW 4IN3A 1VQGA 1HNZL 5BN3A 5CC4A 3VYUA 1N34L 1I3QH 1VQOA 4DR4Q 3GTQH 1BBWA 2PMZE 2C5CA 1R4PB 2QILA 3LWUA 1SEBD 4AH6A 1PRTC 1UE7A 1JE5A 4LF6Q 2RCFA 4RKBA 4A3BH 4DV0Q 4QY7A 4JCVE 2GVBA 1TY0A 5C4XH 1YVCA 3K57A 4DR7Q 1STAA 3F8TA 4X62Q 4B3MQ 5FLMH 4N9PA 4IPCA 2HDMA 1A63A 1TS5A 1HR0L 3RZOB 4BBSG 2HQLA 1HZAA 4J8QA 3HOUG 2L4NA 1UNSA 1U4MA 2HIXA 1CZGA 3BZDB 1E2ZA 1G6PA 3J80L 4IOAA 2WAQB 5IY0A 1HQMC 2F0WA 1WCMG 1TWGH 2R61A 3O13A 5AFWA 1CT1D 2NTTA 2R7ZH 3I90A 4DV5Q 5C6AA 2B2YC 1KNEA 1A2TA 5JEAJ 3RUZA 2K5WA 5M5YB 1Q1EA 3PUWA 2JA7G 1G51A 5CYUA 1QZHA 2GN5A 1X3FA 4U68A 3M4OB 5I6WA 5M3FB 3S14B 1ILQA 5M9OA 1CKNA 3MFYA 4LMQD 4M8AA 1GJXA 3TZUA 5J39A 1C9OA 2OTJA 1GM5A 2K5VA 1PFNA 2NN6G 1EWHA 1PZJD 3I4LA 3NELA 3CU7A 3CCLA 5HURA 1K3RA 3P1HA 5C3EG 2O4XA 3KYHC 2HDLA 4L5QA 2B8FA 1JWSD 4JG2A 5ELCA 4ILWA 3H94A 2NTSA 1WTOA 3U9OA 1FVIA 3I4MB 3MA2B 2VXWA 1Q8KA 4K0KL 5FJ8G 1D7QA 5LMNL 2Z8LA 4LWCA 4OIJA 4JI8Q 5KYLA 5IT9E 1LT6D 3BVMA 4XT3B 2JSOA 4GOPA 3S15H 2RQXA 1JOKA 1PRTD 3CP0A 5COYA 4HCEA 1WVLA 2KCMA 1K8GA 1KAAA 4KY7A 4DAYB 1CHPD 2N78A 2WACA 5I6YA 3BS1A 1YHAA 2XSCA 1K8MA 4A3CG 1XTCD 4C2MH 1GKHA 1NAPA 2KJXA 3GTMH 3BDCA 1TIID 5EPKA 2A73B 2O5IC 3GTPB 1AZQA 1STGA 1Z47A 4RHRA 4BA1I 2K14A 1YNNC 3ERQA 1OXXK 1EEID 2B2UA 4DR3Q 2OWOA 2F0TA 5GAHC 4JI5Q 1HNWQ 4GNXB 2K5DA 2OTLA 3HOWG 3HKZB 1L0WA 4EGVA 2K33A 2F0OA 1LABA 2DNCA 1ESRA 1PZID 3G71A 3C1FA 3GTGH 3L3OC 1HNXL 5M3FG 1RDPD 1WD1A 2L0CA 3VYTA 3MXPA 4LUOA 4DV2L 1K73C 1BNZA 1D1IA 1P8LA 3D8GA 1PH9A 5ELBA 2ES2A 2K52A 2VW9A 3FHWA 4QCLA 5LL6S 3T1YL 1SFOB 2F52A 1B3AA 4V190 3WWVA 4IUNA 2B63B 2ZXOA 1EQTA 3TDQA 5NUCA 4A3EG 1KLUD 5IE8A 3RNUA 3PUZA 1MI2A 2J7ZA 3NTHA 4DGZA 2KECA 5ELDA 1I6HB 3ZJYC 1JJCB 1SN8A 5FOBB 1IHZA 2VQEL 2R92H 3X3MA 2PYKA 3TEHB 4JI7L 1F2LA 1PDQA 4DUYL 1DM0B 3I4MG 2F3IA 1M1KC 1Y1WB 4DAPA 4OWXB 4DK6C 3S9WA 1NJIC 2IW3A 2D0OA 1KDBA 3M4QA 4GNXA 3GTKH 1BVSA 1CFMA 2I07B 2JN4A 3AYHB 4H44C 2R93B 1CQVA 3MZ5A 3S16B 1BKBA 2PNHA 1F9SA 4ODGA 4YHHL 2JJQA 1NUCA 3FPUB 2EYJA 3J81c 5M5XB 3L0OA 2AQ2B 4DV4L 3K5NA 1CA6A 5EGTA 3H91A 4IFDG 1X3PA 1T5XD 1N9WA 3KJPA 1D5MC 4PZ6A 3MTSA 2EJMA 5DM73 1TXYA 5LMUL 1ZYRC 2PW5A 5FLXc 1NMFA 5IP7G 3AU7A 4CBVA 4A76A 1IYUA 2UXDL 2F3WA 2JEAI 3PO2H 1Q82C 2E2JB 3R8BA 5G3LF 3I2ZA 4A3IB 3NE5B 2K50A 1AEXA 1Z7TA 4NXNQ 2PW7A 4OL7A 3VR4A 3J80i 1TWCH 5ELOA 4QUCA 3BZKA 1U4RA 1AFPA 5FKAC 1BBXC 4K8JA 3NHHA 1Y1VH 2EYFA 2PZWA 2B3GA 1F9QA 4X66Q 1JMCA 1S5ED 2IHEA 2I46A 2P5ZX 3S1MH 3OWFA 1K83B 1KDCA 1BXTA 1NSNS 1SYEA 3WDNA 4HN7A 1OO9B 4LF7Q 2XRSD 5IYBH 2B63G 5C0XI 1CZWA 4O42A 4JI0Q 3S1QH 5EJWA 3SDZA 3MWYW 4HJAA 2F0KA 2RCNA 4O1NA 2EYOA 2LS01 3CCEA 2KHIA 3UDXA 2PI2E 4NXML 3S2HB 1EU3A 2JA5G 2A6ED 1LM0A 4TVAB 1I5FA 1KTKA 2J4XA 5M3MB 2F0HA 3M3YB 1E3PA 1DCZA 2PQEA 1SNOA 4KHPL 4BY7B 1PZKD 2I5HA 2ZJRA 2LXJA 1XNQQ 2CFMA 4DK3C 2L11A 2JEBI 2AQ1B 3A7LA 3UDGA 3D3RA 3CQZB 3E9HA 1KAWA 3J7AF 3VR5A 4C1NI 4RFBA 1XPUA 3H3VI 4ZYSA 1BDOA 1HQRD 1Q46A 1JWMD 1YJWA 1J8IA 1H9KA 1N36L 1Q86C 2VUMH 1SMXA 1DZ1A 2A69C 1MSHA 2OQ0A 4C3HB 4KI0A 3CCVA 2ZM6L 3ICEA 1ZYRD 2R7FA 2YV5A 3M4PA 3T53B 2D62A 2JYOA 3ITPA 4WORA 2EIFA 4BA2I 3F1ZA 2JA8B 1A0IA 1X56A 4OEMB 2JA7H 1UE1A 1GUGA 5IWAQ 2K04A 4K5WA 3WOEA 3BYTB 1JC7A 4RGTA 1OXTA 2K28A 2K6AA 3K5LA 2WV6D 3J7AV 5C3XA 1MKHA 4JOIA 4DV6L 1LTAD 5JVH3 1HXYD 5M5WH 4FXDA 3GTJH 1WTWA 5JJLA 4JYAL 2Z6KC 2VQEQ 3JAME 1JQYD 4X3UA 2Z4HA 3KFUA 1Y8PB 2NVXH 5E4XA 4GKJL 1CSQA 4QUFA 3OIPA 3TQYA 2E2HH 3H0GG 2RKSA 3D4RA 5F2DA 4F88A 2CHBD 4MIUA 3F2CA 1I50B 3ULPA 4I7AA 1STNA 3RD4A 3WOFA 4LF8L 4BY7G 1IYJB 4L5RC 1EQQA 1UE5A 1PA6A 4DK1A 1MSGA 1SE3A 4HIOA 4H0LC 4P75A 4DFAA 4Q0FA 4NW2A 2A1AA 2E5LL 4POGA 1C8CA 2K75A 3FEWX 3CCQA 3PUXA 1SYGA 2DNEA 1L1OB 1WTVA 4A3CH 1EY6A 2R7DA 4LF9L 3RZOH 2RDHA 1Q3LA 3TZDA 1TS4A 4DV3L 4B08A 3CHBD 2UXDQ 1ENAA 3ULLA 1SYDA 5IYDH 1SNQA 1CUKA 4HJ7A 1DOLA 1EY4A 3MXUA 3RMHA 1BCPB 3LWEA 2EYPA 3T51B 4QGUA 4O0AA 2Q8RE 2E8GA 4AQYQ 1LLRD 1KQSA 3HOVB 3EROA 3HG9A 4XT1B 1QUQB 4CGYB 3TP6A 1FD7D 2JA8G 1N8RC 4DNIA 3GTLB 1E1OA 2JK8A 2PI2A 4JC0A 4KJOA 5IT9L 3FMCA 1G2SA 4YCUA 5A2QE 3RR5A 4HCSA 4KKUA 4P74A 5IP9H 5M3FH 4K8IA 3RLFA 1PTOB 1U4PA 3S14H 1Q90A 4B9XA 2WFWA 3GD7A 2NZOA 3FDTA 4HSPA 1SSOA 1X55A 2CWAA 2XGTA 4OO1H 2JA6G 3U58A 1YHBA 5BR8Q 4OWWB 1RKNA 1TWHH 4ZQ3A 3AB9A 1LT5D 2JE6I 1YI2A 2KQ3A 3CRLC 4PMCA 1L1OA 2QDLA 3T13A 2VNUD 1RTNA 2WIIB 2OCEA 2ICEC 1VQ5A 2PNRC 4JBJA 3K0YA 2PZTA 3NSWA 2YU9B 4BBSB 2SDFA 3PF4A 4FYDA 5I2XA 1VQ8A 3HOUB 1BCPD 4DA2A 2B2TC 3PIP3 1V8QA 2Z6KA 2FJ2A 3SK4A 3VR3A 3S17B 4B3RL 4HIMA 3I4MH 1WD0A 2J0TD 2D0PA 1B44D 3DEOA 3A54A 1N33L 1WCMB 3LNNA 1XYIA 3UE1A 1SNPA 2BCOA 1ICWA 1QUQA 4RGOS 2KEDA 2CH4W 3GV3A 1WTPA 2AHOB 3EN2A 4FNFA 2IX3A 1XPRA 1SJED 1PTOD 3SK5A 4XDXA 1A3UA 1Z9FA 3PSIA 4FF1A 3RN5A 1E1TA 3UDIA 4UP7A 1Q1BA 1N36Q 3DM3A 1Y69U 2E2IB 1SROA 2IWHA 3DWAA 3L9AX 4X6AH 4ZAIA 2G5DA 2I0QA 2ZM6Q 3E0JA 3ER0A 1H9RA 1U4LA 2UXCQ 4G7OC 2HQEA 3GTPH 3R93A 4N9TA 1WI5A 4ALPA 4B3TQ 2WKCA 5J3BA 1G91A 3MEFA 5IP7H 5JJZA 5DLQE 1AN8A 3C1EA 1XXGA 4MHEA 5C3EB 1M90C 3UI2A 4DF7A 4DR5Q 1STBA 4A3KG 4GN5A 2UUAL 2BE5C 4KY6A 1JE4A 3F2BA 2F0QA 5T1GA 3BVZA 2E2DC 3N52A 2F0FA 3HOYG 2LKVA 3T16A 2KENA 2UU9L 2F0PA 3S24A 2K05A 5I4DA 4DUZQ 1CKNB 4G4KA 1JORA 1RCVD 1B4OA 2F3VA 2V4DA 1FJGQ 5IYCH 1UUPA 5JVG3 1C0AA 1JWUD 1XNRL 1SFOH 2HHHQ 5A35A 2K5NA 3CAMA 4GKJQ 2ZXRA 4LFCL 2A5HA 1V9PA 2AKWB 5HGQA 1IBKL 1QB5D 3ULJA 2B63H 1A8VA 1SMYD 1S5DD 5ELNA 4HJ9A 4XYQA 1U0LA 1VQAA 4KY5A 3CCRA 3NP8A 4JI2L 1O7IA 4C3IG 4CKEA 4JI4L 1I6HH 1VF7A 4A3GG 1G2TA 2A19A 4GKKL 2PO4A 1SYFA 4G7ZC 3TSSA 1Y1WH 1FNWA 3URYA 2VB2X 1T9HA 2E5LQ 2B8GA 4AYBE 2R93H 1RL2A 3S16H 4GOPB 1LT4D 4RG1A 3ND9A 2A6HD 4MZ9A 4TSSA 3HOWB 1XWEA 2F0DA 4LF9Q 4C3JG 4DV3Q 4XXEA 5CBAE 4BS9A 3I70A 3OMGA 4DR1Q 1DGSA 1PRTB 3H3VC 3L7ZC 1OTCA 2ZJQA 4IUUA 5E1FA 2UUBQ 1PYWD 1IW7C 4CDEC 2EXDA 5CV4A 4X64L 1I94Q 4UPAA 3PCOB 4IUQA 1B2TA 3MXGA 1TU2B 1RTOA 2IY5B 3STBD 5CV6A 1EY7A 3DHQA 1B70B 3HOZG 4Y52H 1DJRD 2EY6A 2PQAB 1LTSD 1ZEQX 2VY3A 1G291 1GO3E 1IKMA 4MN3A 4R8NA 4QB4A 4IQZA 4A3EB 1XX8A
chains in the Genus database with same CATH topology
2E2JH 3J81c 2YYZA 3K7UC 3L0OA 3RLOA 2UXBL 4A3IH 4R4CA 4DV4L 4DAMA 3DLLA 4JI3Q 2KBNA 5JJIA 1MIUA 1YEZA 3PV0A 4DR5L 2IHFA 4IFDG 2WAQE 1WOCA 2L15A 3BJUA 1N9WA 3JAMi 1IBMQ 1NE3A 1L1OC 3KJPA 1KIXA 4PZ6A 4Y7NH 2ASBA 2ATWA 2VQFL 1TXYA 5LMUL 2WB1G 3AFPA 2K5HA 5EAYA 2N8NA 2VL6A 3NEMA 5GQOA 3H15A 4HJ8A 1J5EQ 5AJ3L 3S1RH 5FLXc 1PH2A 4A75A 1NMFA 1C7YA 3PO2G 5IP7G 1VCIA 2MFIA 4A76A 2V1CC 1K83H 2UXDL 3OYYA 2F4VQ 2Y0SE 1K8AC 2B29A 4DUZL 2JEAI 3PO2H 1Q82C 1N32L 1CSPA 1CKMA 5C0XJ 1LTLA 3I2ZA 5JEAG 4DR3L 4PZ7A 1FJGL 2K50A 3BU2A 1HNWL 4DV7Q 4NXNQ 1A62A 1ASZA 3J80i 4IO9A 1TWCH 1UE6A 1TWFH 5ELOA 4GLAC 2HHHL 3BZKA 1KHIA 3CF5A 4QQBX 3KDFA 4LUVA 2RF4A 1KC8C 3SGIA 2BH2A 2IT1A 1Y1VH 1VQ9A 1VQJA 1EWIA 1VQDA 2B3GA 3J81j 2NVTH 3PUVA 4J15A 3JC66 3G48A 3GTOH 4X66Q 2DGYA 5M3MG 3RN2A 1JMCA 2IHEA 4DV6Q 1S3OA 3S1MH 3S2HH 4TQUS 1KXLA 1WJJA 2OQKA 5IYBG 2UUCQ 2HT1A 2PQAA 1VQEA 5C44G 1VQHA 4WJ4A 5M3MH 4JYAQ 5GADC 4LF7Q 3M3YH 4UP8A 5IYBH 4BY7H 2B63G 5C0XI 5C44H 1VQ7A 1NTGA 4JI0Q 3S1QH 3JAMc 3E9IA 5HY6A 4HJAA 4GOPC 1QZGA 4DV5L 2RCNA 1RIPA 4A93G 2MO0A 3CQZH 3CW2C 4JI1Q 4B3SQ 1S72A 3TREA 3CCEA 3EIVA 1JJ2A 4EQ5A 2KHIA 2A8VA 1NBWA 4RMFA 3UDXA 2PI2E 1UEBA 4YY3Q 4LF4L 4NXML 4A93H 4DR2L 1PYSB 2JA5G 4DR1L 1LUZA 4A3MG 1LM0A 4TVAB 1I5FA 2CCZA 4JI6L 4LF8Q 3CC7A 3U4ZA 4DV1Q 1E3PA 2UUBL 4KHPL 3CCUA 2JA5H 3K0XA 1HZ9A 2I5HA 2ZJRA 1I94L 3TS2A 1YHQA 2LXJA 1XNQQ 2BA0A 2CFMA 4DK3C 5H1SE 4X65Q 2JEBI 4MNOA 5C0XG 1P16A 3UDGA 4C3HH 4R4QA 2UUAQ 4YWMA 4JBKA 3E9HA 1KAWA 4GS3A 4BBRG 1HZCA 1OXUA 2R92G 3U4VA 1HNZQ 1XPUA 3OTOQ 4HJ5A 3H3VI 1AH9A 1XPOA 3HFZB 3G4SA 3T1HQ 1N34Q 1D8LA 1VQLA 1Q46A 4LF5Q 2JA8H 4BBRH 2FXQA 2VUMG 3AFQA 4YWKA 5GAEC 1H95A 4O2DA 1YJWA 4JBWA 5M5XH 1VQ4A 3KF8B 1N36L 3KLWA 1AE2A 1LYLA 2RHQB 2CWPA 2DUDA 3KOJA 2EQSA 1Q86C 4JBMA 2VUMH 4P73A 1KD1C 3S1NH 3S2DH 1SMXA 4A3LG 1HZBA 2Q2UA 4QJFA 3LGJA 1X3EA 1NMGA 2OQ0A 3CCMA 1OXVA 4KI0A 3CCVA 4LFCQ 2ZM6L 1MJCA 3ERSX 3HKZE 2NZHA 3ICEA 5C4JH 2R7FA 1EOVA 3I4NG 4A3DH 4A3LH 4DKAC 2YV5A 3M4PA 4A3FG 4JV5L 2D62A 2F4VL 1HR0W 1HR0Q 4YCVA 4JI2Q 2EIFA 3PO3G 4BA2I 1Q12A 3F1ZA 1A0IA 1X56A 3I7FA 2KCTA 3NENA 4QIWE 2ZTDA 2JA7H 4NXNL 4DV7L 2CQOA 1UE1A 2YTVA 3U50C 5IWAQ 3PF5A 4LFBQ 4GLXA 3PO3H 4BXXG 3CC4A 3GDEA 3K81C 3H3VH 3K8AA 1OXTA 4A3JG 1PH1A 3AQQA 3FKIH 3A5ZB 4DR6Q 3RZDH 4IJHA 1X54A 4BXXH 4X66L 1MKHA 4JOIA 4OX9L 4A3JH 4DV6L 1ASYA 4A4IA 1I50H 5M5WH 3PGZA 1X6OA 3CPWA 2UUCL 3GTJH 3E0EA 5JJLA 5GROA 4JYAL 4LF7L 4IOCA 2Z6KC 3CCJA 3IRBA 2VQEQ 1QVFA 1PFSA 4GNXC 3PUYA 4AYBG 1HH2P 4LW1A 1SLJA 1TWAH 4JI5L 3KFUA 1Y1VG 3KF6B 2NVXH 4JI0L 3AEVA 4GKJL 1CSQA 4LFAQ 2MO1A 1XMQL 2VZAA 1IBLL 4P72A 4B3SL 4B3RQ 5K36G 1Q81C 1KRSA 3TRZA 3STBC 3D0FA 2AWNA 3TQYA 2E2HH 3H0GG 1PH4A 1SRUA 4MTNA 1YZ6A 4YY3L 1N33Q 3F2CA 3ULPA 4IJLA 4PMWA 3M7NA 1EUJA 1V1QA 3H0GH 4LF8L 2XTIA 4DV1L 1XMOQ 4BY7G 1EIYB 1IYJB 1EIFA 3HKSA 2NVQH 3A0JA 4L5RC 1EQQA 1UE5A 1PA6A 4UY8C 3HOVG 1KL9A 1S40A 1L2FA 1XNQL 4HIOA 4P75A 4X65L 2A1AA 4LUZA 4UP9A 2E5LL 1BBUA 4IPDA 4POGA 3HOVH 2MNAA 2KHJA 2ZJPA 2Q2IA 1QVGA 1PVOA 3W1BA 3K7AH 2K75A 3G6EA 3UE0A 3CCQA 3TS0A 3PUXA 2VQFQ 1VQNA 4ME3A 1L1OB 4K0KQ 4QL5A 1IZ6A 4A3CH 5LMNW 2R7DA 1VQGA 5LMNQ 1HNZL 5IYDG 3OTOL 3KJOA 2Q2TA 4LF9L 3RZOH 3GTLH 1N34L 1I3QH 1YBYA 4DV3L 1VQOA 1BBWA 2PMZE 1V43A 2WAQG 3B6YA 2QA4A 4LF5L 3GTQH 2UXDQ 2AMCB 3UDFA 4AH6A 4OO1I 3ULLA 4DPGA 1UE7A 1N32Q 1JE5A 5IT9c 2Z0SA 4LF6Q 5IYDH 1CUKA 4HJ7A 5C4XG 4A3BH 1R9TH 4P71A 4DV0Q 5FLMG 4QGUA 4O0AA 3J80c 1YITA 2E8GA 1WYDA 4AQYQ 1GVPA 1KQSA 4QY7A 4JCVE 2GVBA 5C4XH 1YVCA 3KF6A 4DR7Q 2Y0SG 3F8TA 4X62Q 4B3MQ 1QUQB 1VQ6A 5FLMH 4IPCA 1A63A 4KHZA 3FP9A 5IP9G 2JA8G 1N8RC 1HR0L 4DNIA 1E1OA 4BBSG 2HQLA 1HZAA 2JK8A 1YNXA 1E7ZA 1X3GA 2PI2A 1U5KA 4JC0A 4YCUA 3HOUG 4IFDJ 2VNUD 3W1GA 1K0RA 3RR5A 3J81i 4P74A 5IP9H 5IWAL 1B8AA 2WB1E 2HIXA 3RLFA 5M3FH 2YU9H 2UU9Q 2I5MX 3S14H 4BBSH 4OONA 4JI3L 3I55A 4OO1G 2WFWA 3GD7A 4IOAA 3Q8DA 4OWTB 2NZOA 3HOUH 2YTXA 2R7ZG 5IY0A 1SE8A 1WCMG 1X55A 2CWAA 2XGTA 1IBML 1TWGH 1VQIA 4BY1H 1XNRQ 2JA6G 3S17H 4A3DG 3U58A 1YHBA 3K80C 4XIGS 2NN6I 5BR8Q 1W2BA 4OWWB 4DV5Q 1TWHH 2R7ZH 4H02A 1IBKQ 1NY4A 1J5EL 1WCMH 2JE6I 3GO5A 5JEAJ 1YI2A 1MJEA 1Q1EA 2JA6H 3PUWA 2JA7G 1L1OA 1G51A 2HIVA 2N49A 3PIOA 1FL0A 1VQPA 1QZHA 1PHJA 1HNXQ 4LF4Q 3F2DA 2OCEA 2GN5A 1X3FA 1VQ5A 4NPSA 3W5OA 1W3SA 4JBJA 4DV2Q 3VDYA 4JI4Q 4JI6Q 3CMAA 3CPFA 3M85A 3PF4A 1VQ8A 4GKKQ 1XTDA 3FKIG 1CKNA 2BH8A 4DR4Q 2IX0A 2GVAA 2Z6KA 2E2IH 4B3RL 3T1YQ 1FGUA 4HIMA 1C9OA 4R4IA 3I4MH 2OTJA 4PG3A 1X9NA 2D0PA 1GM5A 1N33L 4IPGA 2K5VA 2NN6G 3A74A 4NB3A 3HOXH 3NELA 3UE1A 2AWOA 3CCLA 1QUQA 3CXCA 1K3RA 1G6PA 2AHOB 4GLVB 3EN2A 4LNQA 1EQRA 5C3EG 1XPRA 1WFQA 2ID0A 4L5SA 1E22A 3KYHC 1PV4A 1Z9FA 3PSIA 2Q2HA 4L5QA 3RN5A 1E1TA 3UDIA 4UP7A 1VQKA 1Q1BA 5C3EH 1N36Q 4JG2A 4JI7Q 4DUYQ 3DM3A 1X65A 1SROA 3M9BA 1FVIA 4X64Q 1Q8KA 1PH8A 4K0KL 3CC2A 5FJ8G 2WP8J 3EBEA 4JI1L 4X6AH 4IPHA 2I0QA 1D7QA 2ZM6Q 5LMNL 4LWCA 3ER0A 4JI8Q 3I56A 2UXCQ 2ZTCA 4DR4L 1B7YB 4EX5A 3L2PA 1VS0A 3GTPH 4GOPA 4JV5Q 5FJ8H 1VQMA 3S15H 1YJ9A 4YHHQ 1IXRA 1WI5A 4ALPA 4B3TQ 4LF6L 5J3BA 3CP0A 3MEFA 5IP7H 5DLQE 2KCMA 1K8GA 3HKZG 4YWLA 4DAYB 4DV0L 2UXBQ 4DV4Q 2N78A 1YJNA 4JOIC 1M90C 4AQYL 2ALYB 1IL2A 2ZTEA 1YHAA 4DR5Q 4DR7L 4A3CG 4X62L 4A3KG 4B3ML 3BZCA 1JT8A 4GN5A 4C2MH 1GKHA 1PH3A 2UUAL 3I4OA 1PH5A 3GTMH 3F2BA 4OX9Q 1QVCA 4R4OA 5LMUQ 1VQBA 2BA1A 4A3KH 5AJ3Q 1Z47A 4BA1I 5E7NA 3T1HL 1HJPA 2K14A 3PIPA 1OXXK 5IYCG 3HOYG 4A3BG 4L5TA 3RLNA 2KENA 1PYBA 2UU9L 2YTYA 3S24A 4R4TA 4DUZQ 1CKNB 2MQHA 4HIDA 2JA9A 4DR3Q 1EFWA 2OWOA 1FJGQ 3HOYH 5GAHC 5IYCH 4JI5Q 1HNWQ 4GNXB 4XTCS 3CD6A 1C0AA 1XNRL 1SFOH 2HHHQ 4GKJQ 2K5NA 3CAMA 1JB7A 2OTLA 3D31A 1XMQQ 1XJVA 5BR8L 4LFCL 1IBLQ 1L0WA 3HOWG 1V9PA 2AKWB 4GN4B 5HGQA 1IBKL 3ULJA 2LXKA 2B63H 1A8VA 1Y14B 4YCWA 5ELNA 4HJ9A 4AIMA 1U0LA 1UWVA 2RHSB 3G71A 3GTGH 3HOWH 1HNXL 1VQAA 3CCRA 5M5YH 5M3FG 4JI2L 1O7IA 1PH7A 4LUOA 1K73C 4DV2L 4JI4L 1I6HH 4A3GG 1P8LA 1VQFA 1Y1WG 4OXPA 2A19A 1PH9A 3M4OH 4GKKL 2ES2A 4APVA 4LFBL 2K52A 2VW9A 4BY1G 1OXSC 3FHWA 3MXNB 4C3IH 4A3MH 4A3GH 1K9MC 1Y1WH 2R93G 3T1YL 2F52A 2R6GA 4KLKA 1KRTA 4R1JA 1T9HA 1E24A 2E5LQ 4DR6L 3WWVA 4PZ8A 4POFA 2N3SA 4AYBE 2R93H 4WJ3M 1RL2A 2LSSA 1VQCA 3J7ZC 3CMEA 4GOPB 3S16H 4RG1A 1JJGA 4MZ9A 4A3EG 2IX1A 5IE8A 3A5UA 3RNUA 5JJKA 4LF9Q 3PUZA 2C35B 2QEXA 4DV3Q 3NBHB 3ZJYC 1JJCB 4NXMQ 1PH6A 4DR2Q 2K4KA 3CCSA 4DR1Q 4A3EH 1SN8A 4HIKA 2VQEL 5GAGC 1Q7YC 1DGSA 2R92H 2VS1A 1AE3A 3L7ZC 3TEHB 4C3JH 1OTCA 2ZJQA 4JI7L 4IFDI 4DUYL 3I4MG 3KDFB 2CKZB 2UUBQ 1CKOA 2F3IA 1M1KC 4KHPQ 2EXDA 4OWXB 4DK6C 4LFAL 4X64L 1I94Q 4UPAA 3PCOB 2H5XA 3HOXG 3M4QA 2D0OA 1YIJA 2NVYH 1NJIC 1EYGA 4GNXA 3GTKH 1BVSA 3AYHB 4JI8L 1J6QA 2IY5B 3STBD 2UXCL 1BKBA 1B70B 4GN3B 3HOZG 2PNHA 2QGQA 3J7A5 4Y52H 2JQOA 2PQAB 4FDBA 1SR3A 2VY3A 1G291 4YHHL 3OW2A 1GO3E 4A3IG 4B3TL 1GD7A 2JJQA 3I4NH 2I5LX 1XMOL 3HOZH 4A3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2J H;  3J81 c;  2YYZ A;  3K7U C;  3L0O A;  3RLO A;  2UXB L;  4A3I H;  4R4C A;  4DV4 L;  4DAM A;  3DLL A;  4JI3 Q;  2KBN A;  5JJI A;  1MIU A;  1YEZ A;  3PV0 A;  4DR5 L;  2IHF A;  4IFD G;  2WAQ E;  1WOC A;  2L15 A;  3BJU A;  1N9W A;  3JAM i;  1IBM Q;  1NE3 A;  1L1O C;  3KJP A;  1KIX A;  4PZ6 A;  4Y7N H;  2ASB A;  2ATW A;  2VQF L;  1TXY A;  5LMU L;  2WB1 G;  3AFP A;  2K5H A;  5EAY A;  2N8N A;  2VL6 A;  3NEM A;  5GQO A;  3H15 A;  4HJ8 A;  1J5E Q;  5AJ3 L;  3S1R H;  5FLX c;  1PH2 A;  4A75 A;  1NMF A;  1C7Y A;  3PO2 G;  5IP7 G;  1VCI A;  2MFI A;  4A76 A;  2V1C C;  1K83 H;  2UXD L;  3OYY A;  2F4V Q;  2Y0S E;  1K8A C;  2B29 A;  4DUZ L;  2JEA I;  3PO2 H;  1Q82 C;  1N32 L;  1CSP A;  1CKM A;  5C0X J;  1LTL A;  3I2Z A;  5JEA G;  4DR3 L;  4PZ7 A;  1FJG L;  2K50 A;  3BU2 A;  1HNW L;  4DV7 Q;  4NXN Q;  1A62 A;  1ASZ A;  3J80 i;  4IO9 A;  1TWC H;  1UE6 A;  1TWF H;  5ELO A;  4GLA C;  2HHH L;  3BZK A;  1KHI A;  3CF5 A;  4QQB X;  3KDF A;  4LUV A;  2RF4 A;  1KC8 C;  3SGI A;  2BH2 A;  2IT1 A;  1Y1V H;  1VQ9 A;  1VQJ A;  1EWI A;  1VQD A;  2B3G A;  3J81 j;  2NVT H;  3PUV A;  4J15 A;  3JC6 6;  3G48 A;  3GTO H;  4X66 Q;  2DGY A;  5M3M G;  3RN2 A;  1JMC A;  2IHE A;  4DV6 Q;  1S3O A;  3S1M H;  3S2H H;  4TQU S;  1KXL A;  1WJJ A;  2OQK A;  5IYB G;  2UUC Q;  2HT1 A;  2PQA A;  1VQE A;  5C44 G;  1VQH A;  4WJ4 A;  5M3M H;  4JYA Q;  5GAD C;  4LF7 Q;  3M3Y H;  4UP8 A;  5IYB H;  4BY7 H;  2B63 G;  5C0X I;  5C44 H;  1VQ7 A;  1NTG A;  4JI0 Q;  3S1Q H;  3JAM c;  3E9I A;  5HY6 A;  4HJA A;  4GOP C;  1QZG A;  4DV5 L;  2RCN A;  1RIP A;  4A93 G;  2MO0 A;  3CQZ H;  3CW2 C;  4JI1 Q;  4B3S Q;  1S72 A;  3TRE A;  3CCE A;  3EIV A;  1JJ2 A;  4EQ5 A;  2KHI A;  2A8V A;  1NBW A;  4RMF A;  3UDX A;  2PI2 E;  1UEB A;  4YY3 Q;  4LF4 L;  4NXM L;  4A93 H;  4DR2 L;  1PYS B;  2JA5 G;  4DR1 L;  1LUZ A;  4A3M G;  1LM0 A;  4TVA B;  1I5F A;  2CCZ A;  4JI6 L;  4LF8 Q;  3CC7 A;  3U4Z A;  4DV1 Q;  1E3P A;  2UUB L;  4KHP L;  3CCU A;  2JA5 H;  3K0X A;  1HZ9 A;  2I5H A;  2ZJR A;  1I94 L;  3TS2 A;  1YHQ A;  2LXJ A;  1XNQ Q;  2BA0 A;  2CFM A;  4DK3 C;  5H1S E;  4X65 Q;  2JEB I;  4MNO A;  5C0X G;  1P16 A;  3UDG A;  4C3H H;  4R4Q A;  2UUA Q;  4YWM A;  4JBK A;  3E9H A;  1KAW A;  4GS3 A;  4BBR G;  1HZC A;  1OXU A;  2R92 G;  3U4V A;  1HNZ Q;  1XPU A;  3OTO Q;  4HJ5 A;  3H3V I;  1AH9 A;  1XPO A;  3HFZ B;  3G4S A;  3T1H Q;  1N34 Q;  1D8L A;  1VQL A;  1Q46 A;  4LF5 Q;  2JA8 H;  4BBR H;  2FXQ A;  2VUM G;  3AFQ A;  4YWK A;  5GAE C;  1H95 A;  4O2D A;  1YJW A;  4JBW A;  5M5X H;  1VQ4 A;  3KF8 B;  1N36 L;  3KLW A;  1AE2 A;  1LYL A;  2RHQ B;  2CWP A;  2DUD A;  3KOJ A;  2EQS A;  1Q86 C;  4JBM A;  2VUM H;  4P73 A;  1KD1 C;  3S1N H;  3S2D H;  1SMX A;  4A3L G;  1HZB A;  2Q2U A;  4QJF A;  3LGJ A;  1X3E A;  1NMG A;  2OQ0 A;  3CCM A;  1OXV A;  4KI0 A;  3CCV A;  4LFC Q;  2ZM6 L;  1MJC A;  3ERS X;  3HKZ E;  2NZH A;  3ICE A;  5C4J H;  2R7F A;  1EOV A;  3I4N G;  4A3D H;  4A3L H;  4DKA C;  2YV5 A;  3M4P A;  4A3F G;  4JV5 L;  2D62 A;  2F4V L;  1HR0 W;  1HR0 Q;  4YCV A;  4JI2 Q;  2EIF A;  3PO3 G;  4BA2 I;  1Q12 A;  3F1Z A;  1A0I A;  1X56 A;  3I7F A;  2KCT A;  3NEN A;  4QIW E;  2ZTD A;  2JA7 H;  4NXN L;  4DV7 L;  2CQO A;  1UE1 A;  2YTV A;  3U50 C;  5IWA Q;  3PF5 A;  4LFB Q;  4GLX A;  3PO3 H;  4BXX G;  3CC4 A;  3GDE A;  3K81 C;  3H3V H;  3K8A A;  1OXT A;  4A3J G;  1PH1 A;  3AQQ A;  3FKI H;  3A5Z B;  4DR6 Q;  3RZD H;  4IJH A;  1X54 A;  4BXX H;  4X66 L;  1MKH A;  4JOI A;  4OX9 L;  4A3J H;  4DV6 L;  1ASY A;  4A4I A;  1I50 H;  5M5W H;  3PGZ A;  1X6O A;  3CPW A;  2UUC L;  3GTJ H;  3E0E A;  5JJL A;  5GRO A;  4JYA L;  4LF7 L;  4IOC A;  2Z6K C;  3CCJ A;  3IRB A;  2VQE Q;  1QVF A;  1PFS A;  4GNX C;  3PUY A;  4AYB G;  1HH2 P;  4LW1 A;  1SLJ A;  1TWA H;  4JI5 L;  3KFU A;  1Y1V G;  3KF6 B;  2NVX H;  4JI0 L;  3AEV A;  4GKJ L;  1CSQ A;  4LFA Q;  2MO1 A;  1XMQ L;  2VZA A;  1IBL L;  4P72 A;  4B3S L;  4B3R Q;  5K36 G;  1Q81 C;  1KRS A;  3TRZ A;  3STB C;  3D0F A;  2AWN A;  3TQY A;  2E2H H;  3H0G G;  1PH4 A;  1SRU A;  4MTN A;  1YZ6 A;  4YY3 L;  1N33 Q;  3F2C A;  3ULP A;  4IJL A;  4PMW A;  3M7N A;  1EUJ A;  1V1Q A;  3H0G H;  4LF8 L;  2XTI A;  4DV1 L;  1XMO Q;  4BY7 G;  1EIY B;  1IYJ B;  1EIF A;  3HKS A;  2NVQ H;  3A0J A;  4L5R C;  1EQQ A;  1UE5 A;  1PA6 A;  4UY8 C;  3HOV G;  1KL9 A;  1S40 A;  1L2F A;  1XNQ L;  4HIO A;  4P75 A;  4X65 L;  2A1A A;  4LUZ A;  4UP9 A;  2E5L L;  1BBU A;  4IPD A;  4POG A;  3HOV H;  2MNA A;  2KHJ A;  2ZJP A;  2Q2I A;  1QVG A;  1PVO A;  3W1B A;  3K7A H;  2K75 A;  3G6E A;  3UE0 A;  3CCQ A;  3TS0 A;  3PUX A;  2VQF Q;  1VQN A;  4ME3 A;  1L1O B;  4K0K Q;  4QL5 A;  1IZ6 A;  4A3C H;  5LMN W;  2R7D A;  1VQG A;  5LMN Q;  1HNZ L;  5IYD G;  3OTO L;  3KJO A;  2Q2T A;  4LF9 L;  3RZO H;  3GTL H;  1N34 L;  1I3Q H;  1YBY A;  4DV3 L;  1VQO A;  1BBW A;  2PMZ E;  1V43 A;  2WAQ G;  3B6Y A;  2QA4 A;  4LF5 L;  3GTQ H;  2UXD Q;  2AMC B;  3UDF A;  4AH6 A;  4OO1 I;  3ULL A;  4DPG A;  1UE7 A;  1N32 Q;  1JE5 A;  5IT9 c;  2Z0S A;  4LF6 Q;  5IYD H;  1CUK A;  4HJ7 A;  5C4X G;  4A3B H;  1R9T H;  4P71 A;  4DV0 Q;  5FLM G;  4QGU A;  4O0A A;  3J80 c;  1YIT A;  2E8G A;  1WYD A;  4AQY Q;  1GVP A;  1KQS A;  4QY7 A;  4JCV E;  2GVB A;  5C4X H;  1YVC A;  3KF6 A;  4DR7 Q;  2Y0S G;  3F8T A;  4X62 Q;  4B3M Q;  1QUQ B;  1VQ6 A;  5FLM H;  4IPC A;  1A63 A;  4KHZ A;  3FP9 A;  5IP9 G;  2JA8 G;  1N8R C;  1HR0 L;  4DNI A;  1E1O A;  4BBS G;  2HQL A;  1HZA A;  2JK8 A;  1YNX A;  1E7Z A;  1X3G A;  2PI2 A;  1U5K A;  4JC0 A;  4YCU A;  3HOU G;  4IFD J;  2VNU D;  3W1G A;  1K0R A;  3RR5 A;  3J81 i;  4P74 A;  5IP9 H;  5IWA L;  1B8A A;  2WB1 E;  2HIX A;  3RLF A;  5M3F H;  2YU9 H;  2UU9 Q;  2I5M X;  3S14 H;  4BBS H;  4OON A;  4JI3 L;  3I55 A;  4OO1 G;  2WFW A;  3GD7 A;  4IOA A;  3Q8D A;  4OWT B;  2NZO A;  3HOU H;  2YTX A;  2R7Z G;  5IY0 A;  1SE8 A;  1WCM G;  1X55 A;  2CWA A;  2XGT A;  1IBM L;  1TWG H;  1VQI A;  4BY1 H;  1XNR Q;  2JA6 G;  3S17 H;  4A3D G;  3U58 A;  1YHB A;  3K80 C;  4XIG S;  2NN6 I;  5BR8 Q;  1W2B A;  4OWW B;  4DV5 Q;  1TWH H;  2R7Z H;  4H02 A;  1IBK Q;  1NY4 A;  1J5E L;  1WCM H;  2JE6 I;  3GO5 A;  5JEA J;  1YI2 A;  1MJE A;  1Q1E A;  2JA6 H;  3PUW A;  2JA7 G;  1L1O A;  1G51 A;  2HIV A;  2N49 A;  3PIO A;  1FL0 A;  1VQP A;  1QZH A;  1PHJ A;  1HNX Q;  4LF4 Q;  3F2D A;  2OCE A;  2GN5 A;  1X3F A;  1VQ5 A;  4NPS A;  3W5O A;  1W3S A;  4JBJ A;  4DV2 Q;  3VDY A;  4JI4 Q;  4JI6 Q;  3CMA A;  3CPF A;  3M85 A;  3PF4 A;  1VQ8 A;  4GKK Q;  1XTD A;  3FKI G;  1CKN A;  2BH8 A;  4DR4 Q;  2IX0 A;  2GVA A;  2Z6K A;  2E2I H;  4B3R L;  3T1Y Q;  1FGU A;  4HIM A;  1C9O A;  4R4I A;  3I4M H;  2OTJ A;  4PG3 A;  1X9N A;  2D0P A;  1GM5 A;  1N33 L;  4IPG A;  2K5V A;  2NN6 G;  3A74 A;  4NB3 A;  3HOX H;  3NEL A;  3UE1 A;  2AWO A;  3CCL A;  1QUQ A;  3CXC A;  1K3R A;  1G6P A;  2AHO B;  4GLV B;  3EN2 A;  4LNQ A;  1EQR A;  5C3E G;  1XPR A;  1WFQ A;  2ID0 A;  4L5S A;  1E22 A;  3KYH C;  1PV4 A;  1Z9F A;  3PSI A;  2Q2H A;  4L5Q A;  3RN5 A;  1E1T A;  3UDI A;  4UP7 A;  1VQK A;  1Q1B A;  5C3E H;  1N36 Q;  4JG2 A;  4JI7 Q;  4DUY Q;  3DM3 A;  1X65 A;  1SRO A;  3M9B A;  1FVI A;  4X64 Q;  1Q8K A;  1PH8 A;  4K0K L;  3CC2 A;  5FJ8 G;  2WP8 J;  3EBE A;  4JI1 L;  4X6A H;  4IPH A;  2I0Q A;  1D7Q A;  2ZM6 Q;  5LMN L;  4LWC A;  3ER0 A;  4JI8 Q;  3I56 A;  2UXC Q;  2ZTC A;  4DR4 L;  1B7Y B;  4EX5 A;  3L2P A;  1VS0 A;  3GTP H;  4GOP A;  4JV5 Q;  5FJ8 H;  1VQM A;  3S15 H;  1YJ9 A;  4YHH Q;  1IXR A;  1WI5 A;  4ALP A;  4B3T Q;  4LF6 L;  5J3B A;  3CP0 A;  3MEF A;  5IP7 H;  5DLQ E;  2KCM A;  1K8G A;  3HKZ G;  4YWL A;  4DAY B;  4DV0 L;  2UXB Q;  4DV4 Q;  2N78 A;  1YJN A;  4JOI C;  1M90 C;  4AQY L;  2ALY B;  1IL2 A;  2ZTE A;  1YHA A;  4DR5 Q;  4DR7 L;  4A3C G;  4X62 L;  4A3K G;  4B3M L;  3BZC A;  1JT8 A;  4GN5 A;  4C2M H;  1GKH A;  1PH3 A;  2UUA L;  3I4O A;  1PH5 A;  3GTM H;  3F2B A;  4OX9 Q;  1QVC A;  4R4O A;  5LMU Q;  1VQB A;  2BA1 A;  4A3K H;  5AJ3 Q;  1Z47 A;  4BA1 I;  5E7N A;  3T1H L;  1HJP A;  2K14 A;  3PIP A;  1OXX K;  5IYC G;  3HOY G;  4A3B G;  4L5T A;  3RLN A;  2KEN A;  1PYB A;  2UU9 L;  2YTY A;  3S24 A;  4R4T A;  4DUZ Q;  1CKN B;  2MQH A;  4HID A;  2JA9 A;  4DR3 Q;  1EFW A;  2OWO A;  1FJG Q;  3HOY H;  5GAH C;  5IYC H;  4JI5 Q;  1HNW Q;  4GNX B;  4XTC S;  3CD6 A;  1C0A A;  1XNR L;  1SFO H;  2HHH Q;  4GKJ Q;  2K5N A;  3CAM A;  1JB7 A;  2OTL A;  3D31 A;  1XMQ Q;  1XJV A;  5BR8 L;  4LFC L;  1IBL Q;  1L0W A;  3HOW G;  1V9P A;  2AKW B;  4GN4 B;  5HGQ A;  1IBK L;  3ULJ A;  2LXK A;  2B63 H;  1A8V A;  1Y14 B;  4YCW A;  5ELN A;  4HJ9 A;  4AIM A;  1U0L A;  1UWV A;  2RHS B;  3G71 A;  3GTG H;  3HOW H;  1HNX L;  1VQA A;  3CCR A;  5M5Y H;  5M3F G;  4JI2 L;  1O7I A;  1PH7 A;  4LUO A;  1K73 C;  4DV2 L;  4JI4 L;  1I6H H;  4A3G G;  1P8L A;  1VQF A;  1Y1W G;  4OXP A;  2A19 A;  1PH9 A;  3M4O H;  4GKK L;  2ES2 A;  4APV A;  4LFB L;  2K52 A;  2VW9 A;  4BY1 G;  1OXS C;  3FHW A;  3MXN B;  4C3I H;  4A3M H;  4A3G H;  1K9M C;  1Y1W H;  2R93 G;  3T1Y L;  2F52 A;  2R6G A;  4KLK A;  1KRT A;  4R1J A;  1T9H A;  1E24 A;  2E5L Q;  4DR6 L;  3WWV A;  4PZ8 A;  4POF A;  2N3S A;  4AYB E;  2R93 H;  4WJ3 M;  1RL2 A;  2LSS A;  1VQC A;  3J7Z C;  3CME A;  4GOP B;  3S16 H;  4RG1 A;  1JJG A;  4MZ9 A;  4A3E G;  2IX1 A;  5IE8 A;  3A5U A;  3RNU A;  5JJK A;  4LF9 Q;  3PUZ A;  2C35 B;  2QEX A;  4DV3 Q;  3NBH B;  3ZJY C;  1JJC B;  4NXM Q;  1PH6 A;  4DR2 Q;  2K4K A;  3CCS A;  4DR1 Q;  4A3E H;  1SN8 A;  4HIK A;  2VQE L;  5GAG C;  1Q7Y C;  1DGS A;  2R92 H;  2VS1 A;  1AE3 A;  3L7Z C;  3TEH B;  4C3J H;  1OTC A;  2ZJQ A;  4JI7 L;  4IFD I;  4DUY L;  3I4M G;  3KDF B;  2CKZ B;  2UUB Q;  1CKO A;  2F3I A;  1M1K C;  4KHP Q;  2EXD A;  4OWX B;  4DK6 C;  4LFA L;  4X64 L;  1I94 Q;  4UPA A;  3PCO B;  2H5X A;  3HOX G;  3M4Q A;  2D0O A;  1YIJ A;  2NVY H;  1NJI C;  1EYG A;  4GNX A;  3GTK H;  1BVS A;  3AYH B;  4JI8 L;  1J6Q A;  2IY5 B;  3STB D;  2UXC L;  1BKB A;  1B70 B;  4GN3 B;  3HOZ G;  2PNH A;  2QGQ A;  3J7A 5;  4Y52 H;  2JQO A;  2PQA B;  4FDB A;  1SR3 A;  2VY3 A;  1G29 1;  4YHH L;  3OW2 A;  1GO3 E;  4A3I G;  4B3T L;  1GD7 A;  2JJQ A;  3I4N H;  2I5L X;  1XMO L;  3HOZ H;  4A3F H; 
#chains in the Genus database with same CATH topology
 1SNC A;  4KKT A;  2E2J H;  2UXB L;  4A3I H;  3I73 A;  3DLL A;  2KBN A;  1MIU A;  1YEZ A;  1V1P B;  1I6V C;  5J22 A;  1DOM A;  3VR2 A;  3V96 A;  2ATW A;  4X3K A;  3VR6 A;  1A3T A;  4DNT B;  5EAY A;  2N8N A;  3NEM A;  5GQO A;  5HGT A;  4HJ8 A;  1JCK B;  5AJ3 L;  2PMZ B;  3C46 A;  1VCI A;  4IUV A;  4KHV A;  5TSS A;  2MFI A;  3SE0 A;  1K83 H;  5DNF A;  3OYY A;  3EJI A;  2Y0S E;  1K8A C;  4A3F B;  1N32 L;  4M1U B;  3IKJ A;  3HZX A;  5C0X J;  5JEA G;  1F9P A;  1ASZ A;  4Q5V A;  3KF8 A;  1KHI A;  1WTX A;  3CF5 A;  3Q0A A;  4QQB X;  1UEA B;  4LUV A;  1KC8 C;  3NPP A;  4Y7N B;  2BH2 A;  1U9R A;  1LAC A;  1VQD A;  3J81 j;  3PUV A;  4J15 A;  2F0J A;  4YIJ A;  3BYY B;  2AQ3 B;  4FXK C;  3KUP A;  4JPB W;  3S2H H;  1KXL A;  1WJJ A;  1YNJ C;  2PQA A;  5C44 G;  5M3M H;  4HMI A;  3M3Y H;  4NP5 A;  3A8J E;  2EXZ A;  2WKD A;  4BY7 H;  4NKL A;  2FIN B;  1S4Z A;  2B2W C;  1V1P A;  1QZG A;  5HY6 A;  4DNR B;  1RIP A;  4A93 G;  2MGS A;  3CQZ H;  4B3S Q;  2NVT B;  1S5F D;  3EIV A;  4OIK A;  1O7Y A;  4RMF A;  4N8X 1;  4DR2 L;  1EY9 A;  2PPB C;  1BR9 A;  1L0Y B;  2CCZ A;  2B2Y A;  1EU4 A;  3Q22 A;  4ABN A;  4DV1 Q;  3CCU A;  3NWT A;  5LL6 X;  3JAM L;  4X65 Q;  5C0X G;  1HFG A;  3D4D A;  1LTR D;  4KN7 C;  4C3H H;  1TKW B;  2UUA Q;  2RDF A;  3J81 E;  4GS3 A;  4BBR G;  1OXU A;  4WJW A;  3BDO A;  4HTH A;  3U4V A;  1HNZ Q;  4HJ5 A;  3HFZ B;  3G4S A;  1N34 Q;  3GP7 A;  4R9W A;  2JA8 H;  5GAE C;  3VA7 A;  4O2D A;  1JR0 D;  4DU9 A;  2JA5 B;  3H6M A;  4JBM A;  2EQS A;  4A3L G;  4FXG C;  4QJF A;  3LGJ A;  1O80 A;  5EBC A;  1H9J A;  1NMG A;  4LFC Q;  3X3N A;  4KV6 A;  1EOV A;  5DEH A;  4A3F G;  5G3L D;  2F4V L;  1HR0 Q;  4YCV A;  4JI2 Q;  3PO3 G;  4FP5 D;  1Q12 A;  3IL8 A;  2KCT A;  4QIW E;  3KK7 A;  2ZTD A;  4DV7 L;  2CQO A;  3PF5 A;  2H4O A;  1HHV A;  2K1B A;  4BWG B;  4BXX G;  3K81 C;  3SK8 A;  3S2D B;  3K8A A;  2MPM A;  3J7Y W;  3S1N B;  1BO0 A;  4A3J G;  1DYQ A;  3A5Z B;  1F77 A;  2E75 C;  3DWQ A;  5C4J B;  2XIW A;  4OX9 L;  4A4I A;  1I50 H;  2UUC L;  3CPW A;  4B9W A;  1YNN D;  1GUS A;  2EY1 A;  3IRB A;  5A2Q L;  1QVF A;  4GZY C;  5KRU A;  4AYB G;  3KLS A;  4LW1 A;  2A68 C;  2IPK D;  3KF6 B;  2VZA A;  1PFB A;  5K36 G;  3QOJ A;  2RSN A;  2AWN A;  1PH4 A;  1G6Z A;  1YZ6 A;  4YY3 L;  3TN2 A;  4K14 A;  4PMW A;  2D5D A;  1EUJ A;  5JPN C;  4H13 C;  4QMG A;  1TVX A;  1EIF A;  4ZUI A;  4KK7 A;  3A0J A;  1STE A;  5BN5 A;  3K58 A;  1F2M A;  1EOT A;  1TWA B;  3NTK A;  3PIO 3;  5CV9 A;  3OMC A;  2Q8T A;  2XWJ B;  4LUZ A;  1BBU A;  1ENF A;  4S3S A;  3HOV H;  1HPC A;  2MNA A;  2OXP A;  1PVO A;  3SHL A;  3TS0 A;  1VQN A;  4K0K Q;  3E3X A;  3KLR A;  1CI3 M;  1QIL A;  4OHJ A;  3OTO L;  5LMN Q;  1D5Z C;  5JJK A;  3GTL H;  4LF5 L;  1M8A A;  2EOT A;  3H0G B;  5IOD A;  4K5X A;  4OO1 I;  4DPG A;  2NVQ B;  1GUO A;  1N32 Q;  1PTO H;  1K8O A;  1ICF B;  5C4X G;  1B3Q A;  3A8I E;  2NYZ D;  1B53 A;  5FLM G;  3J80 c;  1JIC A;  1GVP A;  3QIA A;  3KF6 A;  2Y0S G;  5CR3 A;  1VQ6 A;  2EJG C;  4IUR A;  1I4G A;  1VF5 C;  4KHZ A;  3FP9 A;  5KND A;  1HUN A;  1IKL A;  1LT3 D;  1E7Z A;  2XRQ D;  1LO5 D;  3TBI B;  4C56 C;  4V0B A;  2WB1 E;  2YU9 H;  1SNM A;  4BBS H;  4OON A;  3I55 A;  3Q8D A;  3HOU H;  2YTX A;  1R9T B;  2R7Z G;  2ZT9 C;  3I8Z A;  2CW0 C;  2AUJ D;  1SE8 A;  4MTK A;  3S17 H;  1IBM L;  2QDB A;  3IFD A;  5I9O A;  3SXH A;  3NTI A;  4H02 A;  1NY4 A;  1J5E L;  1WCM H;  2K7V A;  1MJE A;  1D5X C;  1VDZ A;  4UDU C;  2O2L D;  2HIV A;  2N49 A;  1HNX Q;  4DV2 Q;  3CMA A;  1EYA A;  1X32 A;  3QO2 A;  3M85 A;  5C5M A;  1XTD A;  2IX0 A;  2E2I H;  3MHB A;  3T1Y Q;  1FGU A;  4BY1 B;  4R4I A;  1STY A;  1KAB A;  4IPG A;  4NB3 A;  3A74 A;  3Q23 A;  1D1K A;  3DUZ A;  2JA6 B;  3VA5 A;  1Q8I A;  2KA7 A;  1BUV T;  1WTR A;  4LNQ A;  2NN6 H;  1WFQ A;  4L5S A;  2F0N A;  2EYH A;  4L8J A;  4FO2 A;  4WFN 3;  3NQI A;  5ELF A;  4JI7 Q;  5C3E H;  4EQO A;  1CA5 A;  4DUY Q;  2ENB A;  3GV6 A;  3M9B A;  3A56 A;  1PH8 A;  3CC2 A;  3K5O A;  2WP8 J;  4JI1 L;  1ILP A;  4IPH A;  3I56 A;  3HOX B;  2K01 A;  2ZTC A;  4DR4 L;  3E6Z X;  3L2P A;  5FJ8 H;  1VQM A;  5KYI A;  4YHH Q;  1IXR A;  4NDX A;  4U67 3;  4LF6 L;  4TRD A;  4WRD A;  5JAV A;  4RAU C;  4C1N K;  4DV0 L;  4CKB A;  4DV4 Q;  1YJN A;  1QJO A;  2MP1 A;  4F7X A;  5C4H A;  1IL2 A;  3DMU A;  4DR7 L;  1SND A;  4X62 L;  5C5L A;  4B3M L;  3BZC A;  4UHV A;  4DXF A;  2A74 C;  2LY7 A;  3TP8 A;  1EYC A;  2X6G A;  3MC0 B;  2CH4 A;  1EIG A;  4OX9 Q;  4R4O A;  1O78 A;  5LMU Q;  3KLS X;  1EY0 A;  2M9V A;  5E7N A;  3T1H L;  1HJP A;  3PIP A;  2EE1 A;  1PYB A;  2RBM A;  2YTY A;  4R4T A;  4HID A;  2JA9 A;  1EFW A;  2K03 A;  4RGN A;  1JB7 A;  3D31 A;  2A69 D;  5FO8 B;  1B1Z A;  2LXK A;  1Y14 B;  4K2L A;  1UWV A;  1HA5 A;  3HOW H;  5L37 A;  4A3K B;  3DM1 A;  5M5Y H;  5D3D A;  4XQQ A;  1VQF A;  4OXP A;  3M4O H;  1PLF A;  3V05 A;  4KMU C;  4APV A;  4LFB L;  1SYB A;  4BY1 G;  1OXS C;  3MXN B;  2EJF C;  3HOY B;  1HTP A;  2XNA C;  1K9M C;  2R6G A;  1KRT A;  4R1J A;  4DR6 L;  2LMC B;  1AW7 A;  4K5V A;  1Y8N B;  2N3S A;  4RA8 A;  3J7Z C;  5EKK A;  1JJG A;  1AZP A;  3NUC A;  2AUK A;  2H1E A;  1MHW C;  2NB0 A;  1QNU A;  3SEB A;  4NXM Q;  1PH6 A;  2K4K A;  4A3E H;  1LTT D;  5GAG C;  1W6K A;  2HUG A;  5ISR A;  4C3I B;  5JPM C;  4A3M B;  3KDF B;  5CV7 A;  4A3G B;  4XQJ A;  4KHP Q;  1VMC A;  1FYC A;  1EYG A;  2H5X A;  3HOX G;  3AMU A;  3R3O A;  4JI8 L;  3NQT A;  4ME5 A;  3R2T A;  4GN3 B;  3J7A 5;  4HSV A;  2F0S A;  2F1M A;  2JQO A;  4FDB A;  1SR3 A;  2M00 A;  2NUC A;  3OPO A;  2EY2 A;  2I5L X;  1LTG D;  2NWG A;  5EQ0 A;  3QWN A;  3LX0 A;  4A3F H;  3K7U C;  3GQB A;  2BOS A;  4C3J B;  2F0U A;  5JJI A;  2EYM A;  2QKI C;  2WAQ E;  2F03 A;  2L15 A;  3MXN A;  2NVY B;  3A55 A;  1IBM Q;  4Y7N H;  2ASB A;  5C4Z A;  3OW7 A;  3QG1 A;  3R2I A;  4JW0 A;  4IFD H;  5FO7 B;  2WB1 G;  2DJG C;  3AFP A;  1J5E Q;  1EIH A;  5IGF A;  3PO2 G;  5EBD A;  1C7Y A;  1I4Q A;  3J81 L;  3I4N B;  1T5E A;  1D2B A;  2B29 A;  3HOZ B;  1EY8 A;  1FR3 A;  1ET9 A;  1CSP A;  1B9N A;  1CKM A;  4DR3 L;  4PZ7 A;  4KJN A;  3BU2 A;  1HNW L;  1A62 A;  3PMF A;  4LJZ C;  4IO9 A;  4GLA C;  1E2W A;  2KCN A;  4FF2 A;  4RCO A;  1BCP F;  1CM9 A;  1F9R A;  3KDF A;  4KD3 A;  2RF4 A;  3SGI A;  2IT1 A;  3IFT A;  5FLX L;  1VQ9 A;  1EWI A;  2NVT H;  1SBB B;  3JC6 6;  3T56 B;  1C4Q A;  3S1R B;  5M5W B;  4ZUJ A;  3M4Y A;  1WTQ A;  5K36 H;  4DV6 Q;  1S3O A;  4TQU S;  5IYB G;  2HT1 A;  2EZV A;  2KHS A;  4KN4 C;  1VQE A;  2MHV A;  1VQH A;  4WJ4 A;  1EL0 A;  4JYA Q;  1RD9 D;  1PTO F;  1ROD A;  3VYS A;  1TWF B;  1NR4 A;  1WTH A;  2HCC A;  5IGB A;  4KD4 A;  3E9I A;  4GOP C;  2NZ1 D;  1HRJ A;  1J9O A;  2MO0 A;  4JI1 Q;  3TRE A;  3GTO B;  1JJ2 A;  3D6C A;  1EYD A;  2A8V A;  2NBF A;  4Z9C B;  1UEB A;  4LF4 L;  1LTB D;  1NR2 A;  5IGD A;  5FO9 B;  4A3M G;  4JI6 L;  4RHS A;  4LF8 Q;  3CC7 A;  2KEE A;  4RKL A;  3EFX D;  4IUT A;  1CQF A;  2B2V C;  5CMD A;  3HP3 A;  2JA5 H;  3K0X A;  1HTL D;  1HZ9 A;  5C44 B;  1TS3 A;  1YHQ A;  2BA0 A;  5H1S E;  5IIF A;  2EY5 A;  1P16 A;  1EZ6 A;  3M7G A;  4OEL B;  5EKL A;  1GHJ A;  4YWM A;  2QW7 A;  2B2T A;  3ND8 A;  4LK1 C;  5E4W C;  1HZC A;  1O7L A;  3NK9 A;  1F2Z A;  4G7H C;  2B2U C;  1W6J A;  1AH9 A;  3A8K E;  4A93 B;  3HS0 C;  1XPO A;  2L12 A;  3T1H Q;  3MVV A;  2VUM G;  3OWE B;  1H95 A;  2RVL A;  5M5X H;  3Q6S A;  3KF8 B;  1KLG D;  3QB3 A;  1AE2 A;  1LYL A;  2RHQ B;  2CWP A;  4ZKB B;  3S2D H;  3I3C A;  3S1N H;  1KD1 C;  1HZB A;  2Q2U A;  1DXM A;  3CCM A;  1OXV A;  2F0M A;  3HKZ E;  2NZH A;  5C4J H;  3I4N G;  4DKA C;  4JV5 L;  1HA6 A;  1IYV A;  1FGB D;  4BBR B;  4NXN L;  4X3S A;  3P7J A;  3U50 C;  4LFB Q;  2CQA A;  1GUW A;  1FNU A;  4GLX A;  3CC4 A;  4FVM A;  1PH1 A;  3AQQ A;  1QCB D;  4DR6 Q;  1TWH B;  1X54 A;  5KGU A;  4X66 L;  1SDF A;  1A6X A;  4A3D B;  2BE5 D;  2TMP A;  3PGZ A;  2E74 C;  4JK1 C;  1MBY A;  1X6O A;  3E0E A;  4LF7 L;  3CCJ A;  2L55 A;  1B50 A;  4GNX C;  1HH2 P;  3PO3 B;  1TWA H;  1ONL A;  4CJ0 B;  2RDG A;  4JI0 L;  2F4I A;  2MO1 A;  1XMQ L;  1IBL L;  3FKI B;  3HGB A;  3RZD B;  4B3R Q;  1Q81 C;  2D2C C;  3PQI A;  4IAL A;  4RCN A;  2X69 A;  4A3J B;  4MTN A;  1N33 Q;  4IJL A;  4EVO A;  4L6T B;  3M7N A;  1V1Q A;  1JOO A;  5IGC A;  3DXJ C;  3H0G H;  2XTI A;  1D6E C;  3HKS A;  2DY8 A;  2NVQ H;  3HRZ C;  1KNA A;  4K6L A;  1KL9 A;  3NWS A;  3FVQ A;  1EZ8 A;  2KVM A;  1S40 A;  1DOK A;  1L2F A;  1XNQ L;  2F0G A;  3NBI A;  4UP9 A;  2KOL A;  2FFK B;  4IPD A;  2KHJ A;  4AYB B;  2Q2I A;  2B2V A;  3W1B A;  1HFN A;  4CHT B;  1STH A;  4QL5 A;  2Q2T A;  2Z1C A;  5IYD G;  3KJO A;  3Q24 A;  2IL8 A;  1YBY A;  3B6Y A;  1V43 A;  2WAQ G;  2OT2 A;  2QA4 A;  1GXD C;  2AMC B;  3UDF A;  2XN9 C;  2QCP X;  4CDC C;  5IT9 c;  2Z0S A;  1ZKO A;  1ML0 D;  2G9D A;  5DAU A;  1PRT F;  1R9T H;  4P71 A;  3D4W A;  2JXM B;  2BDN A;  1IW7 D;  1YIT A;  1WYD A;  1C48 A;  3OSO A;  4PV1 C;  3K7A B;  3QJY A;  5CV5 A;  5IP9 G;  1TT2 A;  2Z4I A;  5EKI A;  1I3Q B;  5CV8 A;  1YNX A;  1ZXT A;  1X3G A;  2OEO A;  1U5K A;  3GTQ B;  4IFD J;  1AP0 A;  3OHX C;  3W1G A;  1K0R A;  3J81 i;  1H9M A;  5IWA L;  2WIN B;  1B8A A;  2UU9 Q;  2I5M X;  4OO1 G;  4JI3 L;  1SJH D;  4A3B B;  4OWT B;  4DAY A;  1XNR Q;  5FLX E;  4BY1 H;  1VQI A;  2EDG A;  4A3D G;  2SNM A;  1TR5 A;  5C4X B;  3K80 C;  4XIG S;  2NN6 I;  1W2B A;  1S5B D;  1IBK Q;  1M4V A;  3C3L A;  3P20 A;  3GO5 A;  4HR7 B;  2JA6 H;  3K5M A;  2Y0S B;  3QR8 A;  1S5C D;  3PIO A;  2A6E C;  1PHJ A;  1FL0 A;  1VQP A;  1V1O A;  4LF4 Q;  3F2D A;  2FMM A;  4NPS A;  3W5O A;  1W3S A;  4JI4 Q;  3VDY A;  4JI6 Q;  3CPF A;  1R4Q B;  3MFG A;  4GKK Q;  3FKI G;  2BH8 A;  2GVA A;  2CVR A;  1CK1 A;  2VB3 X;  1TWG B;  2LFN A;  1DON A;  1GHK A;  1SYC A;  4PG3 A;  1X9N A;  2R7Z B;  1EY5 A;  3HOX H;  5D65 A;  2AWO A;  1UAP A;  3CXC A;  2ICI A;  5JOB A;  4GLV B;  4NMZ A;  1EQR A;  2Z9H A;  2ID0 A;  1E22 A;  1YNJ D;  1SE2 A;  1PV4 A;  3W3A A;  1LTI D;  2Q2H A;  2B39 A;  1MGS A;  2RSO A;  5IOC A;  1VQK A;  5DM6 3;  5D3I B;  1X65 A;  4ULL A;  3DEP A;  4X64 Q;  2EPB A;  3EBE A;  1F2Y A;  3FRP B;  1B7Y B;  2B2W A;  4EX5 A;  1VS0 A;  2JP1 A;  4JV5 Q;  2KCC A;  3EA6 A;  1MD2 D;  1YJ9 A;  4J6H A;  3J80 E;  3VYR A;  2MJ8 A;  3HKZ G;  2EYL A;  4YWL A;  2UXB Q;  4JOI C;  1I4H A;  2ALY B;  4AQY L;  2ZTE A;  1BQQ T;  4HAE A;  4I65 A;  4EQP A;  1JT8 A;  4CDF C;  1PH3 A;  3DWP A;  3I4O A;  4XQN A;  1PH5 A;  2BDO A;  4TKO B;  1QVC A;  1EFI D;  1QOH A;  1VQB A;  2BA1 A;  4OGQ C;  5LHY 1;  4A3K H;  5AJ3 Q;  4IZ8 A;  3S15 B;  1RF2 D;  2K5Q A;  5IYC G;  4FF4 A;  4A3B G;  4L5T A;  3RLN A;  3W2D A;  2F0I A;  4PMB A;  1CHQ D;  2MQH A;  2DY7 A;  3HOY H;  4CKC A;  4IUP A;  4J1M A;  4XTC S;  3CD6 A;  1XMQ Q;  1XJV A;  5BR8 L;  1IBL Q;  2F0L A;  5FK9 C;  4GN4 B;  4C2M B;  4YCW A;  4AIM A;  3GTM B;  1QNK A;  3I91 A;  5D14 A;  1PMR A;  4X3T A;  2RHS B;  3T4A C;  3V2T A;  2QEJ C;  4R8I A;  4RGM A;  1PH7 A;  4QIW B;  3D6W A;  1Y1W G;  3EVQ A;  3SR1 A;  1QG7 A;  4C3I H;  4A3M H;  4A3G H;  3MAQ A;  1A3V A;  5KEE A;  2R93 G;  4F8M A;  4KLK A;  3KBG A;  1E24 A;  1G8Z D;  4ZKC B;  4PZ8 A;  4POF A;  1ESF A;  4WJ3 M;  1SE4 A;  2LSS A;  1VQC A;  3BG3 A;  3CME A;  2IX1 A;  3GTG B;  3A5U A;  4PNY A;  2N88 A;  5CGK A;  2C35 B;  2QEX A;  3NBH B;  1ET6 A;  3OOC A;  4DR2 Q;  3CCS A;  4RH6 A;  4HIK A;  1Q7Y C;  5K5P A;  2VS1 A;  1Y8O B;  1AE3 A;  4C3J H;  4IFD I;  5IGE A;  5KNB A;  2CKZ B;  1CKO A;  2A68 D;  3A7A B;  4LFA L;  4K6D A;  1YIJ A;  1X3Q A;  2NVY H;  2X6L A;  1FNV A;  2MUY A;  1EQV A;  5KNC A;  1J6Q A;  2UXC L;  1E0B A;  2L1B A;  3TP7 A;  2QGQ A;  1NCV A;  1I4P A;  4A3I G;  3OW2 A;  4B3T L;  1GD7 A;  4EQN A;  4G57 A;  4CJ2 C;  3I4N H;  1O7Z A;  1XMO L;  3HOZ H;  3BDL A;  2YYZ A;  2R92 B;  2F0E A;  3RLO A;  4R4C A;  2L5T A;  3CKI B;  4DAM A;  1K3B C;  4JI3 Q;  3PV0 A;  1HUM A;  2FMC A;  3E5S A;  4DR5 L;  2IHF A;  1WOC A;  5EPL A;  3G7L A;  5I2Y A;  3BJU A;  3JAM i;  1NE3 A;  1L1O C;  1KIX A;  3GTK B;  2VQF L;  2K5H A;  1Z6H A;  2VL6 A;  2O5J C;  3H15 A;  2DJF C;  1PH2 A;  3S1R H;  3G6J B;  4A75 A;  2K32 A;  3OIQ A;  3MEH A;  2F0V A;  2V1C C;  3NXW A;  3FPP A;  4XYO A;  2F4V Q;  3ZYY X;  4DUZ L;  3H09 A;  2TSS A;  3HEJ A;  3K59 A;  1LTL A;  3NBH A;  1FJG L;  1BCP C;  4DV7 Q;  1JB3 A;  2XVS A;  3ONA B;  1UE6 A;  2HHH L;  1TWF H;  5KIX A;  4LAA A;  4I7Z C;  5JEA H;  2GA4 B;  4N8F A;  1SAP A;  1EWC A;  1H9S B;  1VQJ A;  1TY2 A;  3GTO H;  3G48 A;  5J1Z A;  2DGY A;  5M3M G;  3RN2 A;  2QF7 A;  2N55 A;  5CBE E;  2OQK A;  1PTO C;  2WB1 B;  3SK6 A;  2UUC Q;  4FF3 A;  4HED A;  3PO2 B;  3IAY A;  5GAD C;  4CJ1 B;  4UP8 A;  1TWC B;  5C44 H;  2EVB A;  4RWS C;  2CW0 D;  1VQ7 A;  1NTG A;  3TP5 A;  3JAM c;  1GUT A;  1K28 A;  1SXT A;  1Y1V B;  4DV5 L;  1QWY A;  3CW2 C;  2DN8 A;  2SOB A;  3TME A;  1S72 A;  2R3Z A;  4K2K A;  2E76 C;  4EQ5 A;  1NBW A;  4YY3 Q;  3S1M B;  4A93 H;  4DXG A;  1PYS B;  5ELE A;  4DR1 L;  1LUZ A;  3U4Z A;  2UUB L;  4C3H G;  1CTM A;  4ID6 A;  3P75 A;  1I94 L;  1B9M A;  3TS2 A;  4L63 B;  3S1Q B;  3N6R A;  2C9O A;  2OF1 A;  4MNO A;  3SVM A;  4CDD C;  4R4Q A;  2D9U A;  5COR A;  4ZK9 B;  4JBK A;  3K6O A;  4E6I A;  1LV9 A;  1BF4 A;  5C0X H;  2KUM A;  1H9S A;  1A15 A;  2RA4 A;  2R92 G;  1I4X A;  1KDA A;  3OTO Q;  2Z6B A;  4PQX A;  1VQL A;  1D8L A;  4LF5 Q;  1E2V A;  4BBR H;  2FXQ A;  3AFQ A;  4YWK A;  4QF4 A;  1QE6 A;  1K0S A;  4JBW A;  1PXU A;  1VQ4 A;  3KLW A;  4JVZ A;  2DUD A;  3KOJ A;  4P73 A;  1NNX A;  1X3E A;  4KTA A;  1SMY C;  4DK0 A;  1MJC A;  3ERS X;  5E3F A;  2PZU A;  1GOZ A;  4A3L H;  4A3D H;  1BOS A;  1HCZ A;  5BN4 A;  1HR0 W;  2ZXP A;  4F87 A;  4ZLT F;  3I7F A;  3C2P A;  3NEN A;  2YTV A;  1TQO A;  3PO3 H;  2VUM B;  3GDE A;  4DAV A;  3H3V H;  4ZRZ A;  5IGG A;  2FHT A;  1GUN A;  3FKI H;  3RZD H;  4IJH A;  4BXX H;  1RHP A;  2A6H C;  3F2U A;  4A3J H;  1ASY A;  1RJT A;  2IJ0 A;  1VMP A;  2Q8I B;  5T1I A;  5C3W A;  5GRO A;  2L9H A;  1TS2 A;  4IOC A;  4DN4 M;  2JA7 B;  3CRK C;  1PFS A;  3PUY A;  1SLJ A;  2SNS A;  1L0X B;  4JI5 L;  3U9S A;  1Y1V G;  3AEV A;  4P2C B;  4LFA Q;  4UAI A;  4P72 A;  4B3S L;  1II3 A;  1KRS A;  3TRZ A;  3STB C;  3D0F A;  2M2L A;  2SEB D;  1SRU A;  1DD2 A;  1PFM A;  3BVG A;  4KKS A;  3GTJ B;  5EPJ A;  3KBX A;  4DV1 L;  1XMO Q;  1EIY B;  1IL8 A;  2XWB B;  4HMJ A;  4UY8 C;  3HOV G;  2HD3 A;  5I9P A;  1I4R A;  1ENC A;  2HCI A;  3QOL A;  4X65 L;  2NVX B;  4ZCK A;  2PCF B;  3I72 A;  1EEF D;  2ZJP A;  2G9H D;  1QVG A;  1A2U A;  3K7A H;  3G6E A;  3UE0 A;  2E2H B;  2VQF Q;  3EQL C;  4ME3 A;  1JOQ A;  1IZ6 A;  4H7B A;  5LMN W;  4IN3 A;  1VQG A;  1HNZ L;  5BN3 A;  5CC4 A;  3VYU A;  1N34 L;  1I3Q H;  1VQO A;  4DR4 Q;  3GTQ H;  1BBW A;  2PMZ E;  2C5C A;  1R4P B;  2QIL A;  3LWU A;  1SEB D;  4AH6 A;  1PRT C;  1UE7 A;  1JE5 A;  4LF6 Q;  2RCF A;  4RKB A;  4A3B H;  4DV0 Q;  4QY7 A;  4JCV E;  2GVB A;  1TY0 A;  5C4X H;  1YVC A;  3K57 A;  4DR7 Q;  1STA A;  3F8T A;  4X62 Q;  4B3M Q;  5FLM H;  4N9P A;  4IPC A;  2HDM A;  1A63 A;  1TS5 A;  1HR0 L;  3RZO B;  4BBS G;  2HQL A;  1HZA A;  4J8Q A;  3HOU G;  2L4N A;  1UNS A;  1U4M A;  2HIX A;  1CZG A;  3BZD B;  1E2Z A;  1G6P A;  3J80 L;  4IOA A;  2WAQ B;  5IY0 A;  1HQM C;  2F0W A;  1WCM G;  1TWG H;  2R61 A;  3O13 A;  5AFW A;  1CT1 D;  2NTT A;  2R7Z H;  3I90 A;  4DV5 Q;  5C6A A;  2B2Y C;  1KNE A;  1A2T A;  5JEA J;  3RUZ A;  2K5W A;  5M5Y B;  1Q1E A;  3PUW A;  2JA7 G;  1G51 A;  5CYU A;  1QZH A;  2GN5 A;  1X3F A;  4U68 A;  3M4O B;  5I6W A;  5M3F B;  3S14 B;  1ILQ A;  5M9O A;  1CKN A;  3MFY A;  4LMQ D;  4M8A A;  1GJX A;  3TZU A;  5J39 A;  1C9O A;  2OTJ A;  1GM5 A;  2K5V A;  1PFN A;  2NN6 G;  1EWH A;  1PZJ D;  3I4L A;  3NEL A;  3CU7 A;  3CCL A;  5HUR A;  1K3R A;  3P1H A;  5C3E G;  2O4X A;  3KYH C;  2HDL A;  4L5Q A;  2B8F A;  1JWS D;  4JG2 A;  5ELC A;  4ILW A;  3H94 A;  2NTS A;  1WTO A;  3U9O A;  1FVI A;  3I4M B;  3MA2 B;  2VXW A;  1Q8K A;  4K0K L;  5FJ8 G;  1D7Q A;  5LMN L;  2Z8L A;  4LWC A;  4OIJ A;  4JI8 Q;  5KYL A;  5IT9 E;  1LT6 D;  3BVM A;  4XT3 B;  2JSO A;  4GOP A;  3S15 H;  2RQX A;  1JOK A;  1PRT D;  3CP0 A;  5COY A;  4HCE A;  1WVL A;  2KCM A;  1K8G A;  1KAA A;  4KY7 A;  4DAY B;  1CHP D;  2N78 A;  2WAC A;  5I6Y A;  3BS1 A;  1YHA A;  2XSC A;  1K8M A;  4A3C G;  1XTC D;  4C2M H;  1GKH A;  1NAP A;  2KJX A;  3GTM H;  3BDC A;  1TII D;  5EPK A;  2A73 B;  2O5I C;  3GTP B;  1AZQ A;  1STG A;  1Z47 A;  4RHR A;  4BA1 I;  2K14 A;  1YNN C;  3ERQ A;  1OXX K;  1EEI D;  2B2U A;  4DR3 Q;  2OWO A;  2F0T A;  5GAH C;  4JI5 Q;  1HNW Q;  4GNX B;  2K5D A;  2OTL A;  3HOW G;  3HKZ B;  1L0W A;  4EGV A;  2K33 A;  2F0O A;  1LAB A;  2DNC A;  1ESR A;  1PZI D;  3G71 A;  3C1F A;  3GTG H;  3L3O C;  1HNX L;  5M3F G;  1RDP D;  1WD1 A;  2L0C A;  3VYT A;  3MXP A;  4LUO A;  4DV2 L;  1K73 C;  1BNZ A;  1D1I A;  1P8L A;  3D8G A;  1PH9 A;  5ELB A;  2ES2 A;  2K52 A;  2VW9 A;  3FHW A;  4QCL A;  5LL6 S;  3T1Y L;  1SFO B;  2F52 A;  1B3A A;  4V19 0;  3WWV A;  4IUN A;  2B63 B;  2ZXO A;  1EQT A;  3TDQ A;  5NUC A;  4A3E G;  1KLU D;  5IE8 A;  3RNU A;  3PUZ A;  1MI2 A;  2J7Z A;  3NTH A;  4DGZ A;  2KEC A;  5ELD A;  1I6H B;  3ZJY C;  1JJC B;  1SN8 A;  5FOB B;  1IHZ A;  2VQE L;  2R92 H;  3X3M A;  2PYK A;  3TEH B;  4JI7 L;  1F2L A;  1PDQ A;  4DUY L;  1DM0 B;  3I4M G;  2F3I A;  1M1K C;  1Y1W B;  4DAP A;  4OWX B;  4DK6 C;  3S9W A;  1NJI C;  2IW3 A;  2D0O A;  1KDB A;  3M4Q A;  4GNX A;  3GTK H;  1BVS A;  1CFM A;  2I07 B;  2JN4 A;  3AYH B;  4H44 C;  2R93 B;  1CQV A;  3MZ5 A;  3S16 B;  1BKB A;  2PNH A;  1F9S A;  4ODG A;  4YHH L;  2JJQ A;  1NUC A;  3FPU B;  2EYJ A;  3J81 c;  5M5X B;  3L0O A;  2AQ2 B;  4DV4 L;  3K5N A;  1CA6 A;  5EGT A;  3H91 A;  4IFD G;  1X3P A;  1T5X D;  1N9W A;  3KJP A;  1D5M C;  4PZ6 A;  3MTS A;  2EJM A;  5DM7 3;  1TXY A;  5LMU L;  1ZYR C;  2PW5 A;  5FLX c;  1NMF A;  5IP7 G;  3AU7 A;  4CBV A;  4A76 A;  1IYU A;  2UXD L;  2F3W A;  2JEA I;  3PO2 H;  1Q82 C;  2E2J B;  3R8B A;  5G3L F;  3I2Z A;  4A3I B;  3NE5 B;  2K50 A;  1AEX A;  1Z7T A;  4NXN Q;  2PW7 A;  4OL7 A;  3VR4 A;  3J80 i;  1TWC H;  5ELO A;  4QUC A;  3BZK A;  1U4R A;  1AFP A;  5FKA C;  1BBX C;  4K8J A;  3NHH A;  1Y1V H;  2EYF A;  2PZW A;  2B3G A;  1F9Q A;  4X66 Q;  1JMC A;  1S5E D;  2IHE A;  2I46 A;  2P5Z X;  3S1M H;  3OWF A;  1K83 B;  1KDC A;  1BXT A;  1NSN S;  1SYE A;  3WDN A;  4HN7 A;  1OO9 B;  4LF7 Q;  2XRS D;  5IYB H;  2B63 G;  5C0X I;  1CZW A;  4O42 A;  4JI0 Q;  3S1Q H;  5EJW A;  3SDZ A;  3MWY W;  4HJA A;  2F0K A;  2RCN A;  4O1N A;  2EYO A;  2LS0 1;  3CCE A;  2KHI A;  3UDX A;  2PI2 E;  4NXM L;  3S2H B;  1EU3 A;  2JA5 G;  2A6E D;  1LM0 A;  4TVA B;  1I5F A;  1KTK A;  2J4X A;  5M3M B;  2F0H A;  3M3Y B;  1E3P A;  1DCZ A;  2PQE A;  1SNO A;  4KHP L;  4BY7 B;  1PZK D;  2I5H A;  2ZJR A;  2LXJ A;  1XNQ Q;  2CFM A;  4DK3 C;  2L11 A;  2JEB I;  2AQ1 B;  3A7L A;  3UDG A;  3D3R A;  3CQZ B;  3E9H A;  1KAW A;  3J7A F;  3VR5 A;  4C1N I;  4RFB A;  1XPU A;  3H3V I;  4ZYS A;  1BDO A;  1HQR D;  1Q46 A;  1JWM D;  1YJW A;  1J8I A;  1H9K A;  1N36 L;  1Q86 C;  2VUM H;  1SMX A;  1DZ1 A;  2A69 C;  1MSH A;  2OQ0 A;  4C3H B;  4KI0 A;  3CCV A;  2ZM6 L;  3ICE A;  1ZYR D;  2R7F A;  2YV5 A;  3M4P A;  3T53 B;  2D62 A;  2JYO A;  3ITP A;  4WOR A;  2EIF A;  4BA2 I;  3F1Z A;  2JA8 B;  1A0I A;  1X56 A;  4OEM B;  2JA7 H;  1UE1 A;  1GUG A;  5IWA Q;  2K04 A;  4K5W A;  3WOE A;  3BYT B;  1JC7 A;  4RGT A;  1OXT A;  2K28 A;  2K6A A;  3K5L A;  2WV6 D;  3J7A V;  5C3X A;  1MKH A;  4JOI A;  4DV6 L;  1LTA D;  5JVH 3;  1HXY D;  5M5W H;  4FXD A;  3GTJ H;  1WTW A;  5JJL A;  4JYA L;  2Z6K C;  2VQE Q;  3JAM E;  1JQY D;  4X3U A;  2Z4H A;  3KFU A;  1Y8P B;  2NVX H;  5E4X A;  4GKJ L;  1CSQ A;  4QUF A;  3OIP A;  3TQY A;  2E2H H;  3H0G G;  2RKS A;  3D4R A;  5F2D A;  4F88 A;  2CHB D;  4MIU A;  3F2C A;  1I50 B;  3ULP A;  4I7A A;  1STN A;  3RD4 A;  3WOF A;  4LF8 L;  4BY7 G;  1IYJ B;  4L5R C;  1EQQ A;  1UE5 A;  1PA6 A;  4DK1 A;  1MSG A;  1SE3 A;  4HIO A;  4H0L C;  4P75 A;  4DFA A;  4Q0F A;  4NW2 A;  2A1A A;  2E5L L;  4POG A;  1C8C A;  2K75 A;  3FEW X;  3CCQ A;  3PUX A;  1SYG A;  2DNE A;  1L1O B;  1WTV A;  4A3C H;  1EY6 A;  2R7D A;  4LF9 L;  3RZO H;  2RDH A;  1Q3L A;  3TZD A;  1TS4 A;  4DV3 L;  4B08 A;  3CHB D;  2UXD Q;  1ENA A;  3ULL A;  1SYD A;  5IYD H;  1SNQ A;  1CUK A;  4HJ7 A;  1DOL A;  1EY4 A;  3MXU A;  3RMH A;  1BCP B;  3LWE A;  2EYP A;  3T51 B;  4QGU A;  4O0A A;  2Q8R E;  2E8G A;  4AQY Q;  1LLR D;  1KQS A;  3HOV B;  3ERO A;  3HG9 A;  4XT1 B;  1QUQ B;  4CGY B;  3TP6 A;  1FD7 D;  2JA8 G;  1N8R C;  4DNI A;  3GTL B;  1E1O A;  2JK8 A;  2PI2 A;  4JC0 A;  4KJO A;  5IT9 L;  3FMC A;  1G2S A;  4YCU A;  5A2Q E;  3RR5 A;  4HCS A;  4KKU A;  4P74 A;  5IP9 H;  5M3F H;  4K8I A;  3RLF A;  1PTO B;  1U4P A;  3S14 H;  1Q90 A;  4B9X A;  2WFW A;  3GD7 A;  2NZO A;  3FDT A;  4HSP A;  1SSO A;  1X55 A;  2CWA A;  2XGT A;  4OO1 H;  2JA6 G;  3U58 A;  1YHB A;  5BR8 Q;  4OWW B;  1RKN A;  1TWH H;  4ZQ3 A;  3AB9 A;  1LT5 D;  2JE6 I;  1YI2 A;  2KQ3 A;  3CRL C;  4PMC A;  1L1O A;  2QDL A;  3T13 A;  2VNU D;  1RTN A;  2WII B;  2OCE A;  2ICE C;  1VQ5 A;  2PNR C;  4JBJ A;  3K0Y A;  2PZT A;  3NSW A;  2YU9 B;  4BBS B;  2SDF A;  3PF4 A;  4FYD A;  5I2X A;  1VQ8 A;  3HOU B;  1BCP D;  4DA2 A;  2B2T C;  3PIP 3;  1V8Q A;  2Z6K A;  2FJ2 A;  3SK4 A;  3VR3 A;  3S17 B;  4B3R L;  4HIM A;  3I4M H;  1WD0 A;  2J0T D;  2D0P A;  1B44 D;  3DEO A;  3A54 A;  1N33 L;  1WCM B;  3LNN A;  1XYI A;  3UE1 A;  1SNP A;  2BCO A;  1ICW A;  1QUQ A;  4RGO S;  2KED A;  2CH4 W;  3GV3 A;  1WTP A;  2AHO B;  3EN2 A;  4FNF A;  2IX3 A;  1XPR A;  1SJE D;  1PTO D;  3SK5 A;  4XDX A;  1A3U A;  1Z9F A;  3PSI A;  4FF1 A;  3RN5 A;  1E1T A;  3UDI A;  4UP7 A;  1Q1B A;  1N36 Q;  3DM3 A;  1Y69 U;  2E2I B;  1SRO A;  2IWH A;  3DWA A;  3L9A X;  4X6A H;  4ZAI A;  2G5D A;  2I0Q A;  2ZM6 Q;  3E0J A;  3ER0 A;  1H9R A;  1U4L A;  2UXC Q;  4G7O C;  2HQE A;  3GTP H;  3R93 A;  4N9T A;  1WI5 A;  4ALP A;  4B3T Q;  2WKC A;  5J3B A;  1G91 A;  3MEF A;  5IP7 H;  5JJZ A;  5DLQ E;  1AN8 A;  3C1E A;  1XXG A;  4MHE A;  5C3E B;  1M90 C;  3UI2 A;  4DF7 A;  4DR5 Q;  1STB A;  4A3K G;  4GN5 A;  2UUA L;  2BE5 C;  4KY6 A;  1JE4 A;  3F2B A;  2F0Q A;  5T1G A;  3BVZ A;  2E2D C;  3N52 A;  2F0F A;  3HOY G;  2LKV A;  3T16 A;  2KEN A;  2UU9 L;  2F0P A;  3S24 A;  2K05 A;  5I4D A;  4DUZ Q;  1CKN B;  4G4K A;  1JOR A;  1RCV D;  1B4O A;  2F3V A;  2V4D A;  1FJG Q;  5IYC H;  1UUP A;  5JVG 3;  1C0A A;  1JWU D;  1XNR L;  1SFO H;  2HHH Q;  5A35 A;  2K5N A;  3CAM A;  4GKJ Q;  2ZXR A;  4LFC L;  2A5H A;  1V9P A;  2AKW B;  5HGQ A;  1IBK L;  1QB5 D;  3ULJ A;  2B63 H;  1A8V A;  1SMY D;  1S5D D;  5ELN A;  4HJ9 A;  4XYQ A;  1U0L A;  1VQA A;  4KY5 A;  3CCR A;  3NP8 A;  4JI2 L;  1O7I A;  4C3I G;  4CKE A;  4JI4 L;  1I6H H;  1VF7 A;  4A3G G;  1G2T A;  2A19 A;  4GKK L;  2PO4 A;  1SYF A;  4G7Z C;  3TSS A;  1Y1W H;  1FNW A;  3URY A;  2VB2 X;  1T9H A;  2E5L Q;  2B8G A;  4AYB E;  2R93 H;  1RL2 A;  3S16 H;  4GOP B;  1LT4 D;  4RG1 A;  3ND9 A;  2A6H D;  4MZ9 A;  4TSS A;  3HOW B;  1XWE A;  2F0D A;  4LF9 Q;  4C3J G;  4DV3 Q;  4XXE A;  5CBA E;  4BS9 A;  3I70 A;  3OMG A;  4DR1 Q;  1DGS A;  1PRT B;  3H3V C;  3L7Z C;  1OTC A;  2ZJQ A;  4IUU A;  5E1F A;  2UUB Q;  1PYW D;  1IW7 C;  4CDE C;  2EXD A;  5CV4 A;  4X64 L;  1I94 Q;  4UPA A;  3PCO B;  4IUQ A;  1B2T A;  3MXG A;  1TU2 B;  1RTO A;  2IY5 B;  3STB D;  5CV6 A;  1EY7 A;  3DHQ A;  1B70 B;  3HOZ G;  4Y52 H;  1DJR D;  2EY6 A;  2PQA B;  1LTS D;  1ZEQ X;  2VY3 A;  1G29 1;  1GO3 E;  1IKM A;  4MN3 A;  4R8N A;  4QB4 A;  4IQZ A;  4A3E B;  1XX8 A; 
#chains in the Genus database with same CATH homology
 2E2J H;  3J81 c;  2YYZ A;  3K7U C;  3L0O A;  3RLO A;  2UXB L;  4A3I H;  4R4C A;  4DV4 L;  4DAM A;  3DLL A;  4JI3 Q;  2KBN A;  5JJI A;  1MIU A;  1YEZ A;  3PV0 A;  4DR5 L;  2IHF A;  4IFD G;  2WAQ E;  1WOC A;  2L15 A;  3BJU A;  1N9W A;  3JAM i;  1IBM Q;  1NE3 A;  1L1O C;  3KJP A;  1KIX A;  4PZ6 A;  4Y7N H;  2ASB A;  2ATW A;  2VQF L;  1TXY A;  5LMU L;  2WB1 G;  3AFP A;  2K5H A;  5EAY A;  2N8N A;  2VL6 A;  3NEM A;  5GQO A;  3H15 A;  4HJ8 A;  1J5E Q;  5AJ3 L;  3S1R H;  5FLX c;  1PH2 A;  4A75 A;  1NMF A;  1C7Y A;  3PO2 G;  5IP7 G;  1VCI A;  2MFI A;  4A76 A;  2V1C C;  1K83 H;  2UXD L;  3OYY A;  2F4V Q;  2Y0S E;  1K8A C;  2B29 A;  4DUZ L;  2JEA I;  3PO2 H;  1Q82 C;  1N32 L;  1CSP A;  1CKM A;  5C0X J;  1LTL A;  3I2Z A;  5JEA G;  4DR3 L;  4PZ7 A;  1FJG L;  2K50 A;  3BU2 A;  1HNW L;  4DV7 Q;  4NXN Q;  1A62 A;  1ASZ A;  3J80 i;  4IO9 A;  1TWC H;  1UE6 A;  1TWF H;  5ELO A;  4GLA C;  2HHH L;  3BZK A;  1KHI A;  3CF5 A;  4QQB X;  3KDF A;  4LUV A;  2RF4 A;  1KC8 C;  3SGI A;  2BH2 A;  2IT1 A;  1Y1V H;  1VQ9 A;  1VQJ A;  1EWI A;  1VQD A;  2B3G A;  3J81 j;  2NVT H;  3PUV A;  4J15 A;  3JC6 6;  3G48 A;  3GTO H;  4X66 Q;  2DGY A;  5M3M G;  3RN2 A;  1JMC A;  2IHE A;  4DV6 Q;  1S3O A;  3S1M H;  3S2H H;  4TQU S;  1KXL A;  1WJJ A;  2OQK A;  5IYB G;  2UUC Q;  2HT1 A;  2PQA A;  1VQE A;  5C44 G;  1VQH A;  4WJ4 A;  5M3M H;  4JYA Q;  5GAD C;  4LF7 Q;  3M3Y H;  4UP8 A;  5IYB H;  4BY7 H;  2B63 G;  5C0X I;  5C44 H;  1VQ7 A;  1NTG A;  4JI0 Q;  3S1Q H;  3JAM c;  3E9I A;  5HY6 A;  4HJA A;  4GOP C;  1QZG A;  4DV5 L;  2RCN A;  1RIP A;  4A93 G;  2MO0 A;  3CQZ H;  3CW2 C;  4JI1 Q;  4B3S Q;  1S72 A;  3TRE A;  3CCE A;  3EIV A;  1JJ2 A;  4EQ5 A;  2KHI A;  2A8V A;  1NBW A;  4RMF A;  3UDX A;  2PI2 E;  1UEB A;  4YY3 Q;  4LF4 L;  4NXM L;  4A93 H;  4DR2 L;  1PYS B;  2JA5 G;  4DR1 L;  1LUZ A;  4A3M G;  1LM0 A;  4TVA B;  1I5F A;  2CCZ A;  4JI6 L;  4LF8 Q;  3CC7 A;  3U4Z A;  4DV1 Q;  1E3P A;  2UUB L;  4KHP L;  3CCU A;  2JA5 H;  3K0X A;  1HZ9 A;  2I5H A;  2ZJR A;  1I94 L;  3TS2 A;  1YHQ A;  2LXJ A;  1XNQ Q;  2BA0 A;  2CFM A;  4DK3 C;  5H1S E;  4X65 Q;  2JEB I;  4MNO A;  5C0X G;  1P16 A;  3UDG A;  4C3H H;  4R4Q A;  2UUA Q;  4YWM A;  4JBK A;  3E9H A;  1KAW A;  4GS3 A;  4BBR G;  1HZC A;  1OXU A;  2R92 G;  3U4V A;  1HNZ Q;  1XPU A;  3OTO Q;  4HJ5 A;  3H3V I;  1AH9 A;  1XPO A;  3HFZ B;  3G4S A;  3T1H Q;  1N34 Q;  1D8L A;  1VQL A;  1Q46 A;  4LF5 Q;  2JA8 H;  4BBR H;  2FXQ A;  2VUM G;  3AFQ A;  4YWK A;  5GAE C;  1H95 A;  4O2D A;  1YJW A;  4JBW A;  5M5X H;  1VQ4 A;  3KF8 B;  1N36 L;  3KLW A;  1AE2 A;  1LYL A;  2RHQ B;  2CWP A;  2DUD A;  3KOJ A;  2EQS A;  1Q86 C;  4JBM A;  2VUM H;  4P73 A;  1KD1 C;  3S1N H;  3S2D H;  1SMX A;  4A3L G;  1HZB A;  2Q2U A;  4QJF A;  3LGJ A;  1X3E A;  1NMG A;  2OQ0 A;  3CCM A;  1OXV A;  4KI0 A;  3CCV A;  4LFC Q;  2ZM6 L;  1MJC A;  3ERS X;  3HKZ E;  2NZH A;  3ICE A;  5C4J H;  2R7F A;  1EOV A;  3I4N G;  4A3D H;  4A3L H;  4DKA C;  2YV5 A;  3M4P A;  4A3F G;  4JV5 L;  2D62 A;  2F4V L;  1HR0 W;  1HR0 Q;  4YCV A;  4JI2 Q;  2EIF A;  3PO3 G;  4BA2 I;  1Q12 A;  3F1Z A;  1A0I A;  1X56 A;  3I7F A;  2KCT A;  3NEN A;  4QIW E;  2ZTD A;  2JA7 H;  4NXN L;  4DV7 L;  2CQO A;  1UE1 A;  2YTV A;  3U50 C;  5IWA Q;  3PF5 A;  4LFB Q;  4GLX A;  3PO3 H;  4BXX G;  3CC4 A;  3GDE A;  3K81 C;  3H3V H;  3K8A A;  1OXT A;  4A3J G;  1PH1 A;  3AQQ A;  3FKI H;  3A5Z B;  4DR6 Q;  3RZD H;  4IJH A;  1X54 A;  4BXX H;  4X66 L;  1MKH A;  4JOI A;  4OX9 L;  4A3J H;  4DV6 L;  1ASY A;  4A4I A;  1I50 H;  5M5W H;  3PGZ A;  1X6O A;  3CPW A;  2UUC L;  3GTJ H;  3E0E A;  5JJL A;  5GRO A;  4JYA L;  4LF7 L;  4IOC A;  2Z6K C;  3CCJ A;  3IRB A;  2VQE Q;  1QVF A;  1PFS A;  4GNX C;  3PUY A;  4AYB G;  1HH2 P;  4LW1 A;  1SLJ A;  1TWA H;  4JI5 L;  3KFU A;  1Y1V G;  3KF6 B;  2NVX H;  4JI0 L;  3AEV A;  4GKJ L;  1CSQ A;  4LFA Q;  2MO1 A;  1XMQ L;  2VZA A;  1IBL L;  4P72 A;  4B3S L;  4B3R Q;  5K36 G;  1Q81 C;  1KRS A;  3TRZ A;  3STB C;  3D0F A;  2AWN A;  3TQY A;  2E2H H;  3H0G G;  1PH4 A;  1SRU A;  4MTN A;  1YZ6 A;  4YY3 L;  1N33 Q;  3F2C A;  3ULP A;  4IJL A;  4PMW A;  3M7N A;  1EUJ A;  1V1Q A;  3H0G H;  4LF8 L;  2XTI A;  4DV1 L;  1XMO Q;  4BY7 G;  1EIY B;  1IYJ B;  1EIF A;  3HKS A;  2NVQ H;  3A0J A;  4L5R C;  1EQQ A;  1UE5 A;  1PA6 A;  4UY8 C;  3HOV G;  1KL9 A;  1S40 A;  1L2F A;  1XNQ L;  4HIO A;  4P75 A;  4X65 L;  2A1A A;  4LUZ A;  4UP9 A;  2E5L L;  1BBU A;  4IPD A;  4POG A;  3HOV H;  2MNA A;  2KHJ A;  2ZJP A;  2Q2I A;  1QVG A;  1PVO A;  3W1B A;  3K7A H;  2K75 A;  3G6E A;  3UE0 A;  3CCQ A;  3TS0 A;  3PUX A;  2VQF Q;  1VQN A;  4ME3 A;  1L1O B;  4K0K Q;  4QL5 A;  1IZ6 A;  4A3C H;  5LMN W;  2R7D A;  1VQG A;  5LMN Q;  1HNZ L;  5IYD G;  3OTO L;  3KJO A;  2Q2T A;  4LF9 L;  3RZO H;  3GTL H;  1N34 L;  1I3Q H;  1YBY A;  4DV3 L;  1VQO A;  1BBW A;  2PMZ E;  1V43 A;  2WAQ G;  3B6Y A;  2QA4 A;  4LF5 L;  3GTQ H;  2UXD Q;  2AMC B;  3UDF A;  4AH6 A;  4OO1 I;  3ULL A;  4DPG A;  1UE7 A;  1N32 Q;  1JE5 A;  5IT9 c;  2Z0S A;  4LF6 Q;  5IYD H;  1CUK A;  4HJ7 A;  5C4X G;  4A3B H;  1R9T H;  4P71 A;  4DV0 Q;  5FLM G;  4QGU A;  4O0A A;  3J80 c;  1YIT A;  2E8G A;  1WYD A;  4AQY Q;  1GVP A;  1KQS A;  4QY7 A;  4JCV E;  2GVB A;  5C4X H;  1YVC A;  3KF6 A;  4DR7 Q;  2Y0S G;  3F8T A;  4X62 Q;  4B3M Q;  1QUQ B;  1VQ6 A;  5FLM H;  4IPC A;  1A63 A;  4KHZ A;  3FP9 A;  5IP9 G;  2JA8 G;  1N8R C;  1HR0 L;  4DNI A;  1E1O A;  4BBS G;  2HQL A;  1HZA A;  2JK8 A;  1YNX A;  1E7Z A;  1X3G A;  2PI2 A;  1U5K A;  4JC0 A;  4YCU A;  3HOU G;  4IFD J;  2VNU D;  3W1G A;  1K0R A;  3RR5 A;  3J81 i;  4P74 A;  5IP9 H;  5IWA L;  1B8A A;  2WB1 E;  2HIX A;  3RLF A;  5M3F H;  2YU9 H;  2UU9 Q;  2I5M X;  3S14 H;  4BBS H;  4OON A;  4JI3 L;  3I55 A;  4OO1 G;  2WFW A;  3GD7 A;  4IOA A;  3Q8D A;  4OWT B;  2NZO A;  3HOU H;  2YTX A;  2R7Z G;  5IY0 A;  1SE8 A;  1WCM G;  1X55 A;  2CWA A;  2XGT A;  1IBM L;  1TWG H;  1VQI A;  4BY1 H;  1XNR Q;  2JA6 G;  3S17 H;  4A3D G;  3U58 A;  1YHB A;  3K80 C;  4XIG S;  2NN6 I;  5BR8 Q;  1W2B A;  4OWW B;  4DV5 Q;  1TWH H;  2R7Z H;  4H02 A;  1IBK Q;  1NY4 A;  1J5E L;  1WCM H;  2JE6 I;  3GO5 A;  5JEA J;  1YI2 A;  1MJE A;  1Q1E A;  2JA6 H;  3PUW A;  2JA7 G;  1L1O A;  1G51 A;  2HIV A;  2N49 A;  3PIO A;  1FL0 A;  1VQP A;  1QZH A;  1PHJ A;  1HNX Q;  4LF4 Q;  3F2D A;  2OCE A;  2GN5 A;  1X3F A;  1VQ5 A;  4NPS A;  3W5O A;  1W3S A;  4JBJ A;  4DV2 Q;  3VDY A;  4JI4 Q;  4JI6 Q;  3CMA A;  3CPF A;  3M85 A;  3PF4 A;  1VQ8 A;  4GKK Q;  1XTD A;  3FKI G;  1CKN A;  2BH8 A;  4DR4 Q;  2IX0 A;  2GVA A;  2Z6K A;  2E2I H;  4B3R L;  3T1Y Q;  1FGU A;  4HIM A;  1C9O A;  4R4I A;  3I4M H;  2OTJ A;  4PG3 A;  1X9N A;  2D0P A;  1GM5 A;  1N33 L;  4IPG A;  2K5V A;  2NN6 G;  3A74 A;  4NB3 A;  3HOX H;  3NEL A;  3UE1 A;  2AWO A;  3CCL A;  1QUQ A;  3CXC A;  1K3R A;  1G6P A;  2AHO B;  4GLV B;  3EN2 A;  4LNQ A;  1EQR A;  5C3E G;  1XPR A;  1WFQ A;  2ID0 A;  4L5S A;  1E22 A;  3KYH C;  1PV4 A;  1Z9F A;  3PSI A;  2Q2H A;  4L5Q A;  3RN5 A;  1E1T A;  3UDI A;  4UP7 A;  1VQK A;  1Q1B A;  5C3E H;  1N36 Q;  4JG2 A;  4JI7 Q;  4DUY Q;  3DM3 A;  1X65 A;  1SRO A;  3M9B A;  1FVI A;  4X64 Q;  1Q8K A;  1PH8 A;  4K0K L;  3CC2 A;  5FJ8 G;  2WP8 J;  3EBE A;  4JI1 L;  4X6A H;  4IPH A;  2I0Q A;  1D7Q A;  2ZM6 Q;  5LMN L;  4LWC A;  3ER0 A;  4JI8 Q;  3I56 A;  2UXC Q;  2ZTC A;  4DR4 L;  1B7Y B;  4EX5 A;  3L2P A;  1VS0 A;  3GTP H;  4GOP A;  4JV5 Q;  5FJ8 H;  1VQM A;  3S15 H;  1YJ9 A;  4YHH Q;  1IXR A;  1WI5 A;  4ALP A;  4B3T Q;  4LF6 L;  5J3B A;  3CP0 A;  3MEF A;  5IP7 H;  5DLQ E;  2KCM A;  1K8G A;  3HKZ G;  4YWL A;  4DAY B;  4DV0 L;  2UXB Q;  4DV4 Q;  2N78 A;  1YJN A;  4JOI C;  1M90 C;  4AQY L;  2ALY B;  1IL2 A;  2ZTE A;  1YHA A;  4DR5 Q;  4DR7 L;  4A3C G;  4X62 L;  4A3K G;  4B3M L;  3BZC A;  1JT8 A;  4GN5 A;  4C2M H;  1GKH A;  1PH3 A;  2UUA L;  3I4O A;  1PH5 A;  3GTM H;  3F2B A;  4OX9 Q;  1QVC A;  4R4O A;  5LMU Q;  1VQB A;  2BA1 A;  4A3K H;  5AJ3 Q;  1Z47 A;  4BA1 I;  5E7N A;  3T1H L;  1HJP A;  2K14 A;  3PIP A;  1OXX K;  5IYC G;  3HOY G;  4A3B G;  4L5T A;  3RLN A;  2KEN A;  1PYB A;  2UU9 L;  2YTY A;  3S24 A;  4R4T A;  4DUZ Q;  1CKN B;  2MQH A;  4HID A;  2JA9 A;  4DR3 Q;  1EFW A;  2OWO A;  1FJG Q;  3HOY H;  5GAH C;  5IYC H;  4JI5 Q;  1HNW Q;  4GNX B;  4XTC S;  3CD6 A;  1C0A A;  1XNR L;  1SFO H;  2HHH Q;  4GKJ Q;  2K5N A;  3CAM A;  1JB7 A;  2OTL A;  3D31 A;  1XMQ Q;  1XJV A;  5BR8 L;  4LFC L;  1IBL Q;  1L0W A;  3HOW G;  1V9P A;  2AKW B;  4GN4 B;  5HGQ A;  1IBK L;  3ULJ A;  2LXK A;  2B63 H;  1A8V A;  1Y14 B;  4YCW A;  5ELN A;  4HJ9 A;  4AIM A;  1U0L A;  1UWV A;  2RHS B;  3G71 A;  3GTG H;  3HOW H;  1HNX L;  1VQA A;  3CCR A;  5M5Y H;  5M3F G;  4JI2 L;  1O7I A;  1PH7 A;  4LUO A;  1K73 C;  4DV2 L;  4JI4 L;  1I6H H;  4A3G G;  1P8L A;  1VQF A;  1Y1W G;  4OXP A;  2A19 A;  1PH9 A;  3M4O H;  4GKK L;  2ES2 A;  4APV A;  4LFB L;  2K52 A;  2VW9 A;  4BY1 G;  1OXS C;  3FHW A;  3MXN B;  4C3I H;  4A3M H;  4A3G H;  1K9M C;  1Y1W H;  2R93 G;  3T1Y L;  2F52 A;  2R6G A;  4KLK A;  1KRT A;  4R1J A;  1T9H A;  1E24 A;  2E5L Q;  4DR6 L;  3WWV A;  4PZ8 A;  4POF A;  2N3S A;  4AYB E;  2R93 H;  4WJ3 M;  1RL2 A;  2LSS A;  1VQC A;  3J7Z C;  3CME A;  4GOP B;  3S16 H;  4RG1 A;  1JJG A;  4MZ9 A;  4A3E G;  2IX1 A;  5IE8 A;  3A5U A;  3RNU A;  5JJK A;  4LF9 Q;  3PUZ A;  2C35 B;  2QEX A;  4DV3 Q;  3NBH B;  3ZJY C;  1JJC B;  4NXM Q;  1PH6 A;  4DR2 Q;  2K4K A;  3CCS A;  4DR1 Q;  4A3E H;  1SN8 A;  4HIK A;  2VQE L;  5GAG C;  1Q7Y C;  1DGS A;  2R92 H;  2VS1 A;  1AE3 A;  3L7Z C;  3TEH B;  4C3J H;  1OTC A;  2ZJQ A;  4JI7 L;  4IFD I;  4DUY L;  3I4M G;  3KDF B;  2CKZ B;  2UUB Q;  1CKO A;  2F3I A;  1M1K C;  4KHP Q;  2EXD A;  4OWX B;  4DK6 C;  4LFA L;  4X64 L;  1I94 Q;  4UPA A;  3PCO B;  2H5X A;  3HOX G;  3M4Q A;  2D0O A;  1YIJ A;  2NVY H;  1NJI C;  1EYG A;  4GNX A;  3GTK H;  1BVS A;  3AYH B;  4JI8 L;  1J6Q A;  2IY5 B;  3STB D;  2UXC L;  1BKB A;  1B70 B;  4GN3 B;  3HOZ G;  2PNH A;  2QGQ A;  3J7A 5;  4Y52 H;  2JQO A;  2PQA B;  4FDB A;  1SR3 A;  2VY3 A;  1G29 1;  4YHH L;  3OW2 A;  1GO3 E;  4A3I G;  4B3T L;  1GD7 A;  2JJQ A;  3I4N H;  2I5L X;  1XMO L;  3HOZ H;  4A3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...