2K52A

Structure of uncharacterized protein mj1198 from methanocaldococcus jannaschii. northeast structural genomics target mjr117b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ1198
publication title Structure of uncharacterized protein MJ1198 from Methanocaldococcus jannaschii. Northeast Structural Genomics Target MjR117B
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k52A00
2N78A 2YV5A 3PO3G 4X62L 2K75A 1VQBA 3OTOQ 2JA6G 1VQ7A 3J81c 1E22A 2VY3A 4C2MH 3HOVG 4P73A 1XPRA 1L1OB 1W2BA 1E1OA 2Y0SE 1N32L 3PUWA 1K8AC 3M4QA 4DV4Q 4JI2L 3LGJA 4A75A 1HZBA 2Z6KC 1AH9A 2R7DA 1YHQA 1Q46A 1UE5A 2CKZB 1WFQA 4JC0A 4DK3C 2R6GA 2JA8G 4GS3A 2RF4A 3F8TA 1WJJA 3E0EA 3S16H 4R4OA 4LUOA 3RN2A 3TQYA 1XJVA 3RZDH 4DK6C 1JE5A 2CWAA 3J80c 2I5LX 1PV4A 1HNXQ 2B63H 1YJ9A 1SE8A 2VUMG 4KHPL 3J81j 5IWAQ 3CXCA 5DLQE 1SROA 3CP0A 1J5EQ 2GVBA 1ASYA 4OONA 4P71A 4PZ7A 1VQPA 3SGIA 4DR1Q 1IBML 2ZTDA 4IPDA 3A5UA 1XNRL 2K5VA 3HOWG 1XNQL 2GN5A 4A3KH 3S1RH 2OTLA 2F52A 2PI2A 4GKJL 4A3LG 2IY5B 4DR2Q 1PH5A 1BBWA 1I94Q 3HOUH 5C4XG 1Z9FA 5LMNQ 1QVFA 1D8LA 3I2ZA 3BJUA 1L1OA 3CCUA 1UE7A 2E5LL 1HZAA 1LYLA 3KJOA 4YCWA 4NXNQ 2K4KA 1B8AA 5EAYA 3UDFA 4A3BH 2R92G 4UP9A 3UE0A 5AJ3L 4L5SA 1ASZA 4IOCA 3GTQH 2BH8A 2V1CC 1XMQL 3K7UC 3WWVA 4BBRH 4A3EH 1YHAA 2UUBQ 1A0IA 3I4NH 3GTGH 4P72A 3S1NH 2LSSA 3VDYA 4WJ4A 3K8AA 4JI1Q 3ULLA 4DR3Q 1N9WA 1NJIC 5GAEC 2PI2E 3CMAA 1OXUA 3L0OA 5IP9H 2JEBI 4GN3B 3PO2G 3CCEA 2NVTH 1SR3A 1TXYA 1UEBA 5M5YH 3J81i 4IO9A 2UXBQ 3BZCA 4DUYQ 4NPSA 1TWHH 1V43A 1V9PA 3M9BA 2AMCB 4L5TA 4QJFA 4X62Q 4X65L 4DV5L 1FJGL 5GAHC 1UE6A 1X9NA 1KHIA 3CCLA 3HKSA 1VCIA 3JC66 4OWWB 5C3EH 2PNHA 2Z0SA 1CKMA 4JOIA 3S1MH 2B63G 3KJPA 1N32Q 4LF6L 4JI2Q 4DV3L 4IFDI 3E9IA 1GM5A 1K83H 4IFDG 3U58A 1PHJA 3CPFA 3H15A 3BZKA 1NBWA 5GQOA 3I4MH 4PZ8A 5JJIA 2AWOA 2PMZE 2K50A 4LFAL 5ELNA 3D0FA 1BVSA 2HIVA 3J80i 3OW2A 4PG3A 4IFDJ 4LUZA 2CFMA 3GTKH 4LNQA 1UE1A 2WAQE 3GDEA 1JJ2A 3HOUG 3RLFA 4POGA 2VL6A 1VQ6A 4KHPQ 1PH7A 2VS1A 4B3SL 4B3RL 4KLKA 4DR5L 1X6OA 3HOYG 4X6AH 4A3DH 1O7IA 1WYDA 2R7FA 3HOXH 1PH8A 2VW9A 4P74A 1IBMQ 2ES2A 4YY3L 1XNRQ 1XNQQ 3E9HA 2R93G 1FL0A 2PQAB 2ALYB 5C44H 3I4NG 3PF5A 1PH4A 2MO1A 4KHZA 2NVQH 3CD6A 4R1JA 4LF4L 2OQKA 2YTVA 4GOPC 3RNUA 3ER0A 1N8RC 5IYBH 4H02A 4A4IA 1YVCA 2E5LQ 4HJ8A 4DR7L 1K3RA 2VUMH 2I5MX 3G48A 5AJ3Q 3M85A 3UDIA 1HZ9A 1YI2A 3AEVA 3M7NA 1GD7A 4APVA 1XMQQ 3S2HH 1VQNA 4GNXC 4QY7A 2E2JH 5C3EG 2DGYA 3MXNB 3I4OA 3D31A 1OXXK 2K5NA 5FLXc 4HIKA 2JA9A 2WB1G 1KAWA 5M5XH 1L0WA 4YWMA 5M3MG 3RZOH 3HKZG 2BA0A 3PV0A 4OWXB 2YTYA 4JI1L 3I4MG 4GLXA 5LMUL 2Y0SG 1PH6A 1I6HH 5C0XG 2MNAA 1A62A 3A5ZB 4GN5A 3U50C 5IYDG 1Z47A 4UPAA 4X65Q 2VQEQ 4JBWA 5M3FH 4DV5Q 1FJGQ 2UXBL 1VQJA 4B3ML 4LF7L 3L7ZC 2I0QA 2DUDA 2PQAA 2NVYH 4TQUS 3RLNA 2UU9L 5C0XJ 5J3BA 4DPGA 3CCMA 2WB1E 3T1HL 4LF6Q 4DV3Q 3HKZE 3GTMH 4O0AA 3UDXA 2ZM6L 4DV1L 3KF6B 3HOXG 4A3DG 1JT8A 1BKBA 4LFAQ 3ULPA 1QZGA 3PO2H 1E3PA 3J7ZC 4LF8L 3M4OH 1JJCB 3M3YH 3S1QH 5C44G 1NTGA 4BXXH 2HT1A 1KD1C 1K0RA 4R4CA 4LF9Q 5LMNW 1B70B 2D0OA 4HIMA 3F1ZA 1MJCA 4KI0A 3STBC 4QQBX 4OX9L 4JYAL 5IYBG 2QA4A 2JA5H 4B3SQ 1L2FA 4DR5Q 4B3RQ 1OXVA 3HFZB 4IPCA 1YIJA 2Q2IA 3AFPA 3F2BA 1E1TA 4GOPB 4B3TL 1G51A 4YWKA 4JI8L 4YY3Q 4JCVE 1PH3A 5IE8A 2ZJRA 2AHOB 3ZJYC 2JA7G 4LF4Q 4IJLA 3CMEA 4DV2L 4K0KL 4LWCA 4HJ5A 3TREA 1X3EA 1Q81C 1WCMH 1P8LA 1VQIA 4NB3A 2A1AA 4LF5Q 2YU9H 4GNXB 3B6YA 4AQYQ 4DR7Q 1PYSB 1Y1WH 4A3KG 1Q12A 5M3FG 2ZTCA 3KF6A 3HOZH 3HOYH 3UE1A 1HH2P 1DGSA 3STBD 3TEHB 1U0LA 3CW2C 1CSQA 1VS0A 3ERSX 1PH9A 5H1SE 4L5QA 2NZOA 2R93H 2MO0A 1FGUA 2ID0A 1Q82C 3UDGA 4JI7L 3TRZA 1TWGH 4QGUA 2EIFA 1UWVA 4EQ5A 1JB7A 4JBKA 2FXQA 1GO3E 2K5HA 4EX5A 5LMUQ 1EWIA 1N33L 1PVOA 1YBYA 1XTDA 2I5HA 3ULJA 1N34L 1YJNA 4GOPA 3EN2A 1SMXA 1Y14B 2IX0A 1PA6A 1D7QA 4B3MQ 4LF7Q 4BXXG 1TWCH 1X55A 4DAYB 2VQEL 3JAMc 1JJGA 2UU9Q 4BBSH 4PZ6A 2UUAL 4IJHA 3T1HQ 3PIPA 3GO5A 2JA5G 4QL5A 1Q1EA 3EIVA 2WAQG 4A3GH 4AH6A 2ZM6Q 4DV1Q 1IZ6A 3PUYA 4A3MH 4R4QA 5FLMH 4GNXA 3S17H 2HQLA 5M3MH 1A8VA 3T1YL 1R9TH 5K36G 3CCRA 4LF8Q 2E8GA 1WOCA 3NEMA 2VQFL 5IYDH 1BBUA 4A3FG 1S3OA 4MNOA 4OX9Q 3H3VH 4JYAQ 1WCMG 1Y1VG 1YITA 5IT9c 4LF9L 4DAMA 2UUCL 5HY6A 2HHHL 1EFWA 2ZJPA 2MQHA 1Y1WG 3FP9A 2B3GA 4B3TQ 4JI8Q 1HZCA 2EXDA 3HOZG 2RCNA 1HJPA 2IHEA 4BY1G 3DLLA 1K9MC 1RL2A 4IOAA 3CPWA 4DV2Q 4K0KQ 4A3JH 1CKOA 3W1GA 2JQOA 1IYJB 1G6PA 2KHJA 2A19A 1A63A 4HJ7A 2Z6KA 4WJ3M 4A3IH 2H5XA 2F3IA 4MTNA 3GD7A 4FDBA 1RIPA 4ME3A 4Y7NH 1HR0L 1I5FA 4LF5L 4LFBL 4AQYL 2VZAA 1C0AA 2CCZA 3K80C 2LXKA 1YJWA 1SLJA 1IBKL 1I3QH 5GADC 1VQAA 4BBSG 4A3CH 2JEAI 4GKKL 1YHBA 2A8VA 4JI7Q 3KLWA 1GVPA 2JA7H 2B29A 1CUKA 1VQFA 5BR8L 4TVAB 4A3GG 1HNZL 4XTCS 4A3MG 4DR4L 1N33Q 5FLMG 4BA1I 2UXDL 2CQOA 1VQ4A 3JAMi 4JI6L 1N34Q 3KFUA 3Q8DA 1OXTA 1XMOL 1C7YA 5C0XI 5E7NA 4GN4B 1EQQA 1Q8KA 2IX1A 1TWFH 2UUAQ 4DV6Q 3H3VI 1KL9A 2JK8A 1Q7YC 2Q2TA 1SRUA 3S15H 4LW1A 4JOIC 2RHQB 4UY8C 1HNWL 2KCTA 4R4TA 1KRTA 3T1YQ 1X3GA 2KENA 3CAMA 4OXPA 2K14A 3RN5A 1Q86C 1XPUA 2AWNA 3GTJH 2VQFQ 5C4JH 2C35B 1M1KC 1TWAH 4AYBG 5FJ8H 3GTPH 3CF5A 1V1QA 1J6QA 3PCOB 3NENA 4A3JG 1HR0W 1K8GA 1VQKA 3S24A 1QZHA 3FHWA 1W3SA 5IP7H 5M5WH 2UUCQ 2HHHQ 4A3IG 4PMWA 3M4PA 4DUZL 1MKHA 4DR6L 2E2HH 5IY0A 2ATWA 1YEZA 4JI5L 1XPOA 4AYBE 4NXML 4LUVA 4YCVA 1JMCA 2D0PA 1GKHA 4LFCL 1X54A 2N3SA 4AIMA 4X64L 2K52A 1VQMA 4A3CG 3G71A 3H0GH 1EYGA 4RG1A 1QUQB 4JBJA 4RMFA 1WI5A 4ALPA 5ELOA 4A3FH 1E24A 4X66L 5IYCH 1LUZA 4BA2I 3L2PA 4POFA 1Y1VH 4IPHA 3PF4A 3NBHB 1HR0Q 1T9HA 4LFBQ 3PUXA 3A74A 4HJ9A 1VQ5A 1H95A 5GROA 1S72A 1IBKQ 1PH2A 2E2IH 4JV5Q 1VQ8A 2R92H 1KRSA 3DM3A 3K0XA 1AE2A 4GKKQ 4BY1H 5JJKA 3CCSA 2OQ0A 3PSIA 4J15A 4MZ9A 2YYZA 3S2DH 2GVAA 5BR8Q 4JI3L 1AE3A 1HNZQ 4DR4Q 2UXDQ 1NY4A 4JI6Q 2UXCL 3AQQA 2ZJQA 1B7YB 2AKWB 4DV7L 1KIXA 4A93H 4JBMA 5JEAG 1XMOQ 3KYHC 3PUVA 1LTLA 3KDFB 5FJ8G 3AYHB 3KOJA 3I55A 1EQRA 1CKNB 3S14H 3GTLH 3J7A5 3TS2A 5JEAJ 5IP7G 2WP8J 3CCJA 1U5KA 1N36L 4JI4L 1SFOH 1QUQA 4C3IH 4DV6L 1X56A 3I7FA 4O2DA 3U4ZA 1HNWQ 1VQDA 1EIYB 2R7ZH 2NZHA 4DKAC 4DV0L 4GLAC 1K73C 3F2CA 1YZ6A 3GTOH 2NN6I 2NN6G 2CWPA 3H0GG 3PGZA 4P75A 1QVGA 1MJEA 3A0JA 1G291 4C3JH 5IYCG 1IL2A 2HIXA 2QGQA 1IXRA 1LM0A 4YHHL 3K81C 4DUZQ 4DR6Q 4YCUA 1X3FA 4JI0L 4BY7H 1YNXA 2EQSA 1VQLA 4JI5Q 3MEFA 1KQSA 2F4VL 3ICEA 1PYBA 4DNIA 1QVCA 3U4VA 2YTXA 1IBLL 4NXMQ 2XGTA 2L15A 4X64Q 4LFCQ 3KDFA 1Q1BA 1VQHA 3OTOL 3TS0A 1CKNA 4HIOA 1VQ9A 3CC7A 3FKIH 2VNUD 1FVIA 1PFSA 4X66Q 4GLVB 4DV4L 3KF8B 1EOVA 3CQZH 4A93G 1SN8A 1L1OC 1I50H 1KC8C 2IHFA 2JE6I 3PO3H 2OCEA 2RHSB 3BU2A 2JA6H 4JV5L 1KXLA 2NVXH 2Q2UA 4HIDA 2Q2HA 2D62A 2XTIA 1OXSC 3HOVH 3IRBA 2ASBA 1S40A 3AFQA 1IBLQ 2ZTEA 2KHIA 1HNXL 1EIFA 4JI3Q 4L5RC 4A3BG 3I56A 5IWAL 3G6EA 3F2DA 4A76A 4OO1G 4OO1I 2UXCQ 2MFIA 1EUJA 2R7ZG 4DV7Q 2QEXA 2N8NA 4BBRG 1J5EL 5GAGC 4A3EG 2OTJA 2OWOA 1C9OA 3K7AH 4DR1L 2N49A 3W1BA 2JA8H 2KBNA 1E7ZA 4QIWE 5IP9G 2WFWA 4DR2L 3EBEA 1M90C 2BH2A 4IPGA 1N36Q 4JI4Q 1I94L 3CCQA 1VQCA 3CC4A 5LMNL 2KCMA 2JJQA 1MIUA 3OYYA 2LXJA 1NMGA 1OTCA 1NMFA 4BY7G 4NXNL 2IT1A 4XIGS 4UP7A 4DV0Q 3CCVA 1VQGA 3HOWH 4YWLA 1VQOA 2UUBL 3CC2A 4UP8A 3PUZA 4A3LH 4R4IA 3FKIG 5HGQA 4HJAA 3RLOA 3RR5A 4Y52H 5JJLA 2BA1A 5C4XH 3PIOA 4DR3L 1VQEA 4OWTB 3NELA 4YHHQ 4C3HH 1CSPA 3G4SA 3W5OA 1PH1A 4JI0Q 1X65A 2F4VQ 1NE3A 4GKJQ 4DUYL 4JG2A 1P16A
chains in the Genus database with same CATH superfamily
3PO3G 3TP8A 2JA6G 4EGVA 4C2MH 3HOVG 4P73A 1L1OB 1E1OA 3PUWA 4JI2L 5CV8A 4G57A 1HZBA 2Z6KC 4KKTA 1Q46A 2HQEA 4JC0A 2JA8G 4FXDA 5CORA 3OMCA 3S16H 4R4OA 2NB0A 4X3KA 3LX0A 4K8JA 3WOFA 2XIWA 2I5LX 1H9SB 1PV4A 1YJ9A 4KHPL 3J81j 1IW7D 4IFDH 4LJZC 3RZDB 3MTSA 4P71A 4DR1Q 5IIFA 2B63B 1XNQL 2PI2A 2A69C 3BJUA 4RKBA 1AP0A 1E0BA 5AFWA 3ND9A 1UE7A 4KHVA 4PV1C 3KLSX 4A3BH 3HOUB 4UP9A 3T56B 3UE0A 4L5SA 3GTQH 1XMQL 3FMCA 1UAPA 3K7UC 4HAEA 3VYRA 1YHAA 3WWVA 4A3EH 3GTGH 2XWBB 2LSSA 3S1NH 3VDYA 2ZXRA 1CK1A 4JI1Q 3MFGA 4DR3Q 5GAEC 3CMAA 3L0OA 4BBRB 1MD2D 5A35A 1IL8A 1FD7D 4H0LC 1V43A 2AQ2B 4L5TA 4QJFA 4X62Q 5GAHC 4HN7A 1HA5A 3CCLA 5IGCA 5C3EH 2PNHA 4J6HA 4JVZA 1CKMA 1MSGA 1N32Q 1LT6D 3GQBA 4LF6L 2AQ3B 4IFDI 1GM5A 1PHJA 3H15A 5GQOA 5JJIA 2K50A 5ELNA 2F0IA 2WB1B 3V2TA 2HIVA 2EYJA 2DN8A 1GUGA 2C9OA 1UE1A 1F2LA 1ONLA 2Y0SB 4NDXA 3NHHA 4POGA 3KUPA 1D5XC 5CYUA 3P1HA 4B3SL 4HSPA 2K5WA 4A3DH 2O4XA 2VW9A 4P74A 2B8GA 1WTXA 1XNRQ 2HCCA 2WINB 3E9HA 4LAAA 2F0TA 2ALYB 3I4NG 4G4KA 1PH4A 2NVQH 1G2SA 3HOXB 3OMGA 4GOPC 4H02A 5IT9L 4A4IA 3K57A 2E5LQ 2VUMH 1YI2A 1SMYC 5CV7A 5FK9C 3S2HH 5CR3A 4GNXC 2E75C 5F2DA 1EWHA 2DGYA 3MXNB 4RA8A 4HIKA 2KCNA 2C5CA 3R2TA 3P75A 3RZOH 3C46A 4LK1C 2YTYA 1B9MA 5LMUL 2E2JB 1PH6A 4NKLA 2MNAA 2A6HC 4GN5A 5IYDG 4UY8C 2VQEQ 5M5XB 1EY8A 1C8CA 2B39A 4B3ML 1Q3LA 4LF7L 2DUDA 2PQAA 3RLNA 1ZXTA 1I6HB 5C0XJ 1TY2A 2WB1E 2QKIC 1GOZA 1PTOF 4FXGC 3TP5A 4O0AA 3KF6B 2Q8IB 1FYCA 1LO5D 1E3PA 2DJGC 5C44G 4BXXH 5IODA 1KD1C 2H1EA 4DGZA 4IUVA 1ESFA 3STBC 4JYAL 1Y8NB 3S1QB 1VF5C 1OXVA 4IPCA 3F2BA 1ET9A 4YWKA 4JI8L 3GV6A 4KV6A 4YY3Q 2EDGA 3A54A 3DEPA 2KUMA 2WAQB 2JA7G 5BN3A 4DV2L 3HP3A 3H3VC 3TREA 1X3EA 1Q81C 5A2QE 1VMCA 2BDOA 4NB3A 4LF5Q 4IZ8A 5I4DA 3WDNA 1KLUD 4A3KG 3FEWX 4G7ZC 1U4LA 3HOYH 1BR9A 3UE1A 1DGSA 2QDBA 1VS0A 3MHBA 3ERSX 1FNUA 4L5QA 2R93H 3U9OA 1Q82C 4JI7L 3TRZA 1IYUA 4QGUA 1XXGA 2PNRC 4JBKA 4DK1A 1GO3E 4K5XA 2VB3X 1LTSD 1QG7A 4FYDA 2I5HA 2RA4A 1YJNA 4GOPA 1TWGB 1FNVA 2EYLA 2AQ1B 2IX0A 3MXPA 2RBMA 3DHQA 4CKCA 4BBSH 1PFBA 1BBXC 1Q1EA 5E4XA 2EYOA 3DMUA 3G7LA 2BE5C 4CJ0B 2ZM6Q 2XRSD 3S17H 4GNXA 1HTLD 3P7JA 5M3MH 5K36G 2M9VA 3NEMA 3PMFA 5CV5A 4CDEC 2XNAC 4X3SA 4DXFA 4OX9Q 4KKUA 1Q8IA 1WCMG 2V4DA 5IT9c 2MQHA 1B9NA 1L0YB 1HZCA 2EXDA 2RCNA 4UDUC 2IHEA 1X3PA 3CPWA 3QB3A 4DAYA 4TSSA 2F0QA 1IYJB 3I70A 2XVSA 1ZKOA 1SNMA 5CGKA 4WJ3M 2NUCA 2F3IA 4MTNA 4DK0A 4FDBA 3D4WA 1PTOD 1I5FA 1M4VA 1EIHA 4LFBL 4IQZA 4AQYL 1YJWA 1IBKL 1I3QH 5GADC 3QWNA 4GKKL 2LMCB 3MZ5A 3AB9A 3KLWA 2B29A 1RD9D 2EYHA 5BN4A 1EY5A 4XTCS 4A3MG 4DR4L 1N33Q 1VQ4A 3JAMi 1N34Q 4DA2A 1OXTA 2JA7B 1XMOL 5E7NA 4GN4B 1BCPB 2WIIB 3EJIA 2IX1A 1KL9A 1EYAA 5JPMC 4HTHA 4A3KB 3S15H 3K59A 2RDHA 1LT5D 5ELCA 2RHQB 1TWFB 4R4TA 1DOMA 1X3GA 1SNDA 5JEAH 3GTJH 2VQFQ 2C35B 3K5MA 1J6QA 5G3LF 4A3JG 1BF4A 5C5LA 1MBYA 3D3RA 5ELEA 5LL6X 1SYCA 1QZHA 1ENCA 5C4JB 1PZID 3BDCA 3GTPB 2UUCQ 4A3IG 5JVG3 3OSOA 3VYUA 5M5WB 1KLGD 4AYBE 1NAPA 4AIMA 1X54A 4A3CG 2E2HB 1K28A 1EYGA 5KNCA 1EY9A 5ELOA 1E24A 5C6AA 1Y1VH 3NBHB 3H0GB 1HR0Q 1T9HA 2FFKB 5GROA 2E2IH 3K0XA 4BY1H 2NZ1D 2OXPA 4J15A 2YYZA 3S2DH 2GVAA 1SYEA 5BR8Q 1AE3A 4QMGA 2R61A 1CI3M 3I91A 4JI6Q 4DV7L 3OIPA 4JBMA 1LTLA 3E3XA 4RGNA 1CKNB 3GTLH 4A93B 2WP8J 2F0VA 1NR2A 1DYQA 4C3IH 2NYZD 1X56A 1EIYB 4ABNA 1SFOB 2EJGC 4N8FA 2EYPA 1TY0A 3PGZA 5L37A 3A0JA 1LM0A 2ICIA 4DR6Q 2RCFA 1KQSA 1C48A 4C3JB 1O78A 4X64Q 3KDFA 1RHPA 1TS4A 3CC7A 3FKIH 1FVIA 4KD4A 3J81E 4X66Q 1GHJA 5IGGA 3CQZH 1RODA 1I50H 1KC8C 2JE6I 3JAML 1BNZA 1ICWA 1DJRD 2F0HA 2MHVA 4HIDA 1E2WA 1PMRA 1LABA 2KHIA 5FO8B 4A3BG 5CMDA 3G6EA 2UXCQ 3J80E 4FP5D 2N8NA 5GAGC 4A3EG 2OWOA 4DR1L 2B8FA 1B3AA 1KNAA 2KBNA 1E7ZA 4QIWE 2IL8A 2HCIA 1M90C 1N36Q 2VB2X 2KCMA 3OYYA 1NMGA 5I2XA 2RDFA 1F9RA 4BWGB 5A2QL 3HOWH 1CQVA 2FJ2A 4RCOA 3RLOA 3F2UA 3L3OC 3RR5A 5C4XH 4DR3L 4PMCA 4K6LA 1SE4A 4C3HH 1PH1A 3NBIA 4IN3A 2F4VQ 1IW7C 1P16A 1H9MA 4MN3A 1IBLQ 4X62L 3BVMA 1MI2A 1XTCD 1BDOA 2R92B 4KN7C 1EL0A 1N32L 4DNTB 1PZJD 1GUSA 4C2MB 2CKZB 1WFQA 1G2TA 4DK3C 2R6GA 1F2YA 4GS3A 2RF4A 1WJJA 1RJTA 3E5SA 1O7YA 4LUOA 3RN2A 3TQYA 4EQOA 4DK6C 4R8IA 3W2DA 2CWAA 3D8GA 1SE8A 2VUMG 3S16B 3M7NA 4IPDA 1XNRL 3S1RH 1WTOA 1PH5A 4UAIA 1Z9FA 1QVFA 1D8LA 2TMPA 4YIJA 2EJFC 4C1NK 2E5LL 4ID6A 5EAYA 1V1PA 1U9RA 1PYWD 2F0KA 1GJXA 5JPNC 2V1CC 1ZYRD 4A3BB 3SK6A 2F0OA 4WORA 3GTQB 1CM9A 5C3XA 4A3EB 1JQYD 3MWYW 2I07B 3S1NB 2J0TD 2K28A 1SR3A 2NVTH 1PRTB 1UEBA 5M5YH 4CDDC 3J81i 1BUVT 4IO9A 4DUYQ 1TWHH 2L11A 2AMCB 3M9BA 3MA2B 1NNXA 1U4PA 1X9NA 1HFNA 2DJFC 3HKSA 3E0JA 3BG3A 3S1MH 2B63G 3E9IA 3K5LA 1K83H 4JPBW 3U58A 3I4MH 5C3EB 3SR1A 2AWOA 2EY2A 3D0FA 3J80i 3HKZB 1NR4A 4LNQA 1GUTA 2D9UA 3GDEA 1JJ2A 3HOUG 4XYQA 2VL6A 1VQ6A 1PH7A 4ZAIA 2VS1A 4KLKA 4X6AH 3HOYG 3TP7A 1B50A 1MHWC 1UNSA 1O7IA 1IBMQ 4YY3L 1S5ED 1H9JA 5C3WA 2QW7A 1FL0A 2R93G 2LS01 2MP1A 4A3DB 4Z9CB 4R1JA 3DM1A 1JOOA 3EFXD 2RKSA 1YVCA 2NVQB 1F9QA 4HJ8A 1K3RA 1MGSA 1UEAB 3MFYA 5AJ3Q 5DNFA 3M85A 1HZ9A 1F2MA 5EBCA 4U673 1NCVA 4IURA 2VUMB 2JXMB 4QY7A 2K33A 3I4OA 2IPKD 5FLXc 2JA9A 2WB1G 4KTAA 3S2HB 1QCBD 1L0WA 3MEHA 5M3MG 2RDGA 2Y0SG 3A5ZB 5M3FH 3U50C 4DV5Q 2X69A 3RZOB 2XRQD 2PW5A 3ND8A 2UXBL 1ICFB 5J3BA 2AUKA 4DV3Q 3HKZE 3CHBD 3U9SA 2ZM6L 1S5DD 3HOXG 3HGBA 1BKBA 3A8KE 3WOEA 2PQEA 1JJCB 3A7LA 3KK7A 5ELBA 1K0RA 4LF9Q 5LMNW 1B70B 3HG9A 3SK4A 4OX9L 5IYBG 2QA4A 3KLSA 4XQNA 2JA5H 1X32A 1L2FA 4DR5Q 4B3RQ 5JVH3 3HFZB 3I8ZA 1CZGA 1E1TA 3TP6A 4OGQC 1G51A 2RVLA 4JCVE 4XDXA 2ZJRA 4IUQA 4XYOA 3ZJYC 5D3DA 4LF4Q 1HFGA 2DNEA 2A6ED 1A15A 1EU3A 4LWCA 4OELB 3MXUA 2F03A 1P8LA 3O13A 2A1AA 1LTID 4DR7Q 4K2KA 1Y1WH 5EKLA 3HOZH 2Q8RE 4K5WA 3J81L 1U0LA 1PH9A 1CSQA 5H1SE 2B2UC 2DNCA 2F0LA 1FGUA 3HOYB 1UWVA 2FXQA 1D2BA 3I4LA 1N33L 2R93B 1YBYA 1N34L 5NUCA 3NP8A 1TWCH 1JJGA 3J80L 3T1HQ 2WAQG 4A3GH 2CQAA 4BBSB 1H9RA 3UI2A 4R4QA 5FLMH 2ZT9C 1R9TH 3PIP3 1W6KA 4IUTA 2VQFL 1PTOC 2BCOA 3S17B 5M3MB 3P20A 3H3VH 1Y1VG 2UUCL 1VF7A 1EFWA 1ET6A 4XQJA 1D6EC 2NWGA 4B3TQ 3GTKB 4IUPA 4BY1G 1RL2A 1QE6A 1ML0D 2PYKA 4K0KQ 2NTTA 2WKCA 1RTNA 1BCPD 3OOCA 1CKOA 3N6RA 1HCZA 3NE5B 2D5DA 2A19A 4DFAA 1GUOA 5JJZA 2Z6KA 4HJ7A 4RCNA 2H5XA 1F9PA 4JW0A 1IKLA 2A5HA 3GD7A 1HR0L 1AZQA 3NSWA 2HUGA 2KVMA 1B4OA 4CGYB 3K80C 1KTKA 1SLJA 3K5OA 1SNQA 4K5VA 3C2PA 4C3IG 1QILA 1GVPA 1STNA 3H09A 1I3QB 5C4ZA 5BR8L 2G9HD 1SSOA 3LWEA 4K8IA 4JI6L 2KA7A 3Q6SA 3KFUA 1B2TA 3Q8DA 5DAUA 5JAVA 2RSOA 1C7YA 3K6OA 4J8QA 2KEEA 1Q8KA 5D65A 5IGFA 3H3VI 3I90A 2JK8A 1XYIA 1EQVA 2G9DA 1SRUA 3TZUA 2Q2TA 4JOIC 4F87A 2KCTA 2QEJC 1KRTA 3T1YQ 3NQTA 4OXPA 2B2UA 2K14A 3T4AC 1XPUA 3S15B 4ZRZA 5FJ8H 4AYBG 1V1QA 1ENAA 1I4RA 3S24A 1WTQA 1O7LA 2LY7A 4R9WA 5IP7H 3GTJB 2B2YC 4HCEA 5LL6S 2HHHQ 4PMWA 3C3LA 3M4PA 4TKOB 4DR6L 2M00A 1KDAA 2CH4W 2Z4IA 2EZVA 3D4RA 5IY0A 1JMCA 1EYCA 2D0PA 4X64L 1CQFA 4LMQD 1VQMA 2K52A 3Q0AA 1SDFA 4JK1C 2Z6BA 5FKAC 1TT2A 3CKIB 4A3FH 4X66L 1LUZA 2MJ8A 4POFA 4KK7A 2JSOA 3TSSA 3PUXA 4RWSC 4HJ9A 2J4XA 4JV5Q 1PH2A 4OL7A 3DUZA 1VQ8A 1QNUA 1KRSA 1Y1VB 2Z8LA 3DM3A 5JJKA 3CCSA 5EPLA 3PSIA 2KQ3A 2GA4B 2E2IB 5DM73 3VR3A 3VR2A 3L9AX 1HNZQ 2UXDQ 5HURA 4BY1B 2UXCL 5I9PA 2ZJQA 1B7YB 3PUVA 3OIQA 3I55A 1EQRA 1I4PA 2LKVA 3DWQA 3S14H 5D3IB 1N36L 1QUQA 4KKSA 4DV6L 1C4QA 1DCZA 4O2DA 3A7AB 5KYIA 3GTLB 1BQQT 2R7ZH 4DKAC 4C3IB 5KNBA 1K73C 3GTOH 2NN6G 1ENFA 3H0GG 2F0EA 4P75A 5FLXE 1QVGA 5IYCG 1IL2A 2MPMA 1IXRA 4DUZQ 3VA7A 3TDQA 2EOTA 4BY7H 3VYSA 4JI5Q 3MEFA 2F4VL 1IBLL 2XGTA 4LFCQ 4NMZA 1Q1BA 2RQXA 1I6VC 1F9SA 4ILWA 4HIOA 1VQ9A 1A3UA 3VR6A 1PFSA 3FPPA 3FDTA 1TQOA 3H94A 1HUNA 2OF1A 2CW0D 4AYBB 4A93G 3FKIB 3V05A 1NSNS 1SN8A 1L1OC 4NP5A 2K05A 3PO3H 1TKWB 2RHSB 2B2YA 1V8QA 2JA6H 3CQZB 1KXLA 1PLFA 2Q2UA 2D62A 1I50B 1STHA 2KHSA 2XTIA 3HOVH 3AFQA 4JI3Q 4L5RC 3I56A 4PMBA 4C1NI 3F2DA 4A76A 4OO1G 2MFIA 1C9OA 2N49A 3W1BA 2JA8H 1I4QA 3SEBA 3M4YA 3DXJC 3EBEA 3HRZC 4JI4Q 1VQCA 1AN8A 4C3JG 1KNEA 1TVXA 3BDOA 1NMFA 3KF8A 1VDZA 4DV0Q 2P5ZX 4FF2A 1VQGA 1VQOA 2IJ0A 2F0WA 5HGQA 2CH4A 2BA1A 3PIOA 1VQEA 3HOWB 1JC7A 4YHHQ 2RSNA 3G4SA 3W5OA 1WTHA 5ELDA 2O5IC 4DUYL 5C4XB 1G6ZA 2K75A 1VQBA 4C3HB 3GP7A 3OTOQ 4K14A 2PPBC 2K5DA 3SDZA 1SYFA 5FO9B 3QJYA 1U4RA 1XPRA 1W2BA 3Q24A 1Q90A 1X3QA 4A75A 2DY8A 1AH9A 2R7DA 1RDPD 1I4XA 1II3A 2MGSA 3E0EA 3T16A 5KNDA 4FF4A 4WJWA 1JE5A 1ZYRC 4ZCKA 1HNXQ 5IWAQ 1G91A 3C1EA 1SROA 3CP0A 2GVBA 1WD1A 1R4PB 1IBML 3A5UA 1PRTD 2K5VA 3H6MA 3SXHA 2F52A 3A8JE 4A3LG 5DM63 1B3QA 1BBWA 4V190 2F0PA 5LMNQ 3I2ZA 1L1OA 2DY7A 2JYOA 3S1RB 3CCUA 3NXWA 4K2LA 1LYLA 4NXNQ 2F0GA 3UDFA 2R92G 5AJ3L 1ASZA 5HGTA 4QIWB 1SJED 1A0IA 3I4NH 4P72A 1CFMA 3ULLA 5IGBA 4FF1A 1NJIC 2PI2E 5IP9H 4U68A 2L4NA 1H9SA 1FGBD 2A68D 2FHTA 1ILPA 1GUWA 1HPCA 4DAVA 4NPSA 1V9PA 4DV5L 1EU4A 3MVVA 3ONAB 2K32A 4QCLA 1JORA 1UE6A 4C56C 1KHIA 2PZWA 2NVTB 5M5YB 3JC66 5EJWA 4OWWB 1TWHB 2F3WA 3BZDB 3KJPA 1CA5A 4DV3L 4IFDG 2QCPX 3Q23A 3BZKA 2F3VA 5CV9A 3S1MB 3NWTA 3OW2A 4PG3A 2CFMA 1SYBA 1RCVD 1SXTA 3TBIB 5FOBB 3AMUA 3RLFA 4EVOA 4B3RL 4DR5L 1X6OA 4EQPA 4RHSA 3IAYA 4ZK9B 2NVXB 1PZKD 2KCCA 4IUNA 1E2ZA 2PQAB 5C44H 4N9TA 3PF5A 4KHZA 5IGEA 1KDBA 3CD6A 4LF4L 2H4OA 1K3BC 2OT2A 2KJXA 2L12A 4DR7L 5K5PA 2I5MX 3G48A 3AEVA 3NUCA 2WKDA 1VQNA 1NUCA 1TU2B 3QIAA 5C3EG 1OXXK 2K5NA 4ODGA 4YWMA 2FINB 3HKZG 2BA0A 4OWXB 4JI1L 4GLXA 1S5BD 2SNMA 1A62A 4A3KH 4X65Q 2EY5A 3C1FA 4JBWA 1FJGQ 4CKBA 3MAQA 2I0QA 2NVYH 2Z1CA 5E3FA 4DPGA 5BN5A 5M3FB 3CCMA 3T1HL 1L0XB 3Q22A 1H9KA 3RD4A 2A6EC 3G6JB 3A55A 3GTMH 2ICEC 3UDXA 4A3DG 4KJNA 1JT8A 2QDLA 4LFAQ 3ULPA 1QZGA 3PO2H 2HDMA 3J7ZC 3M4OH 3M3YH 1NTGA 2HT1A 2IX3A 4UHVA 4HIMA 3F1ZA 4F7XA 1S5CD 3MXNA 4HMIA 2XSCA 3OHXC 1T5EA 4I7AA 4IUUA 2K5QA 1UUPA 4KJOA 3KBXA 5IT9E 1YIJA 2Q2IA 4GOPB 1QB5D 4B3TL 4CJ2C 5K36H 2PZTA 2JA5B 5C5MA 5IE8A 2ZXPA 4S3SA 1SYDA 4K0KL 2SOBA 1WCMH 1AZPA 3NK9A 1VQIA 2YU9H 1LV9A 4GNXB 3B6YA 4AQYQ 1BO0A 1Q12A 1RKNA 2ZTCA 3KF6A 3AU7A 1XWEA 2O2LD 1EZ8A 3TEHB 3CW2C 1HA6A 5E1FA 5EQ0A 5ISRA 3K58A 3HOZB 1HRJA 3UDGA 4EQNA 2SNSA 4OIJA 2EIFA 4EQ5A 4QF4A 2K5HA 2XN9C 4F8MA 3GTGB 1YNND 1D7QA 1ESRA 1PA6A 4BXXG 1X55A 4IALA 4DAYB 3JAMc 2VQEL 1EZ6A 2UU9Q 3CU7A 2SDFA 4IJHA 3GO5A 4QL5A 1TWCB 1BCPC 1QJOA 2CHBD 4DV1Q 4A3MH 1IZ6A 1A8VA 3T1YL 3QOLA 3CCRA 4LF8Q 1YNJD 1WOCA 4A3GB 5C0XH 3LNNA 2F0MA 3MC0B 2I46A 1BBUA 2B2TC 1R9TB 4A3FG 4MNOA 1JCKB 3V96A 2KECA 1QOHA 4L6TB 4RGOS 5I6WA 2HHHL 2A74C 2ZJPA 3FP9A 1PXUA 2B3GA 1HJPA 4FNFA 3SE0A 3CRKC 4IOAA 2A73B 1SNOA 2K7VA 1O7ZA 2EE1A 1EY4A 4A3JH 1WTRA 4RAUC 2EY1A 4A3IH 3MXGA 4Y7NH 4LF5L 4CKEA 1VQAA 4BBSG 4A3CH 1QWYA 2JEAI 1Y69U 2A8VA 1B53A 1LTAD 1TS3A 1VQFA 4TVAB 1HNZL 2UXDL 4FF3A 1EEID 5C0XI 2O5JC 1DZ1A 1PTOH 4FVMA 2F0DA 5DEHA 1BCPF 2UUAQ 1EYDA 1Q7YC 1Z6HA 4TRDA 4LW1A 1EIGA 2K01A 3RN5A 1Q86C 2AWNA 3OWEB 1TWAH 1Y8PB 3CF5A 1F2ZA 1HQMC 1HR0W 4RGTA 1K8GA 2QF7A 2F0SA 1PFMA 1GUNA 1EEFD 2TSSA 3VR5A 4DUZL 4E6IA 3KLRA 4GZYC 4JI5L 1A6XA 1S4ZA 4LUVA 4YCVA 2PO4A 4LFCL 1AFPA 3VA5A 5COYA 1D5MC 4BA2I 1HTPA 3L2PA 3PF4A 4L63B 3J7AV 4Q0FA 5CBAE 2B2TA 1H95A 1VQ5A 1S72A 4A3FB 5J39A 2KOLA 1AE2A 2EYMA 2Z9HA 5LHY1 1JWMD 4N9PA 4MZ9A 4JI3L 4DN4M 4OHJA 4P2CB 4ZKBB 3AQQA 1KIXA 2AKWB 1D1IA 3EQLC 5JEAG 3KYHC 3KDFB 1A3VA 3AYHB 3KOJA 1A3TA 1U5KA 4JI4L 4HEDA 1Z7TA 3IFDA 3I7FA 3S14B 3U4ZA 1HNWQ 2G5DA 1VQDA 3X3NA 2NZHA 3NBHA 4DV0L 4ZUIA 4HR7B 2CW0C 1YZ6A 3S9WA 5M9OA 1SE2A 2CWPA 2R7ZB 2F0NA 4K6DA 3R3OA 4Q5VA 3GTOB 1BOSA 4YHHL 3BYYB 4M8AA 2F4IA 2X6GA 4YCUA 1CHQD 1YNXA 1LTTD 2B2VC 2EQSA 4DNRB 3ICEA 1PYBA 2BOSA 4DNIA 4NXMQ 1VQHA 2F0UA 3OTOL 4BY7B 1E2VA 1CKNA 3GV3A 1D5ZC 2VNUD 3TN2A 4GLVB 5CBEE 1EY6A 2L0CA 2L55A 1TS5A 4PNYA 1W6JA 2IHFA 4HCSA 5I2YA 1STYA 1EOTA 4ZQ3A 4H13C 1IYVA 1WTPA 2Q2HA 4N8X1 1JWUD 1S40A 3PQIA 5EKKA 2ZTEA 1HNXL 3PO3B 2IW3A 3RUZA 2JA6B 1KAAA 5IWAL 1EUJA 3HOVB 2OTJA 3K7AH 4DXGA 3NQIA 4CJ1B 1FNWA 3I3CA 1SBBB 3NWSA 5IP9G 2WFWA 4CHTB 2BH2A 4IPGA 4XXEA 5KYLA 3CCQA 3CC4A 5LMNL 2JA8B 5IGDA 4L8JA 1MIUA 2LXJA 4MTKA 4CDFC 4NXNL 3HZXA 2J7ZA 3NPPA 3ITPA 3CC2A 1AW7A 3PUZA 5J22A 1STAA 4R4IA 3FKIG 4B08A 4Y52H 5JJLA 1T5XD 1LACA 1ILQA 4OWTB 2EY6A 2LFNA 1Y8OB 1DXMA 4JI0Q 1SJHD 4GKJQ 1NE3A 2EXZA 4RG1A 1GXDC 1STBA 5D14A 2N78A 1VQLA 2YV5A 1PDQA 4XT1B 1VQ7A 3J81c 2K6AA 3JAME 1E22A 2VY3A 1PRTC 4DF7A 4MHEA 2D2CC 1JB3A 2Y0SE 1K8AC 3M4QA 4DV4Q 3LGJA 4KD3A 1WVLA 1V1PB 3K0YA 1YHQA 1UE5A 1G8ZD 1K0SA 3F8TA 2XWJB 4ZKCB 1XJVA 3RZDH 2MUYA 1LTGD 5T1IA 3J80c 1MSHA 2B2VA 2PMZB 2B63H 2K04A 3CXCA 5DLQE 2SEBD 3T53B 1J5EQ 1ASYA 4OONA 4PZ7A 1VQPA 1A2UA 2A68C 3SGIA 2ZTDA 4G7OC 3HOWG 2GN5A 3S2DB 2OTLA 2L9HA 2WACA 3D4DA 2IY5B 4DR2Q 1I94Q 3HOUH 5C4XG 2K1BA 4C3HG 1JOKA 1TIID 4OEMB 1HZAA 3KJOA 4YCWA 2K4KA 1B8AA 4F88A 1V1OA 1VMPA 4IOCA 1J8IA 2BH8A 1CHPD 4BBRH 2UUBQ 5EGTA 1S5FD 3K5NA 4WJ4A 3K8AA 1N9WA 1OXUA 1PFNA 3I4NB 2JEBI 4GN3B 1CTMA 3CCEA 3PO2G 1TXYA 2UXBQ 3BZCA 4G7HC 1PRTF 4X65L 1GHKA 2A69D 1FJGL 1SAPA 1I4GA 2QILA 1VCIA 2Z0SA 4JOIA 4JI2Q 3NTHA 4XQQA 3CPFA 5I9OA 1NBWA 4PZ8A 1RTOA 2PMZE 4LFAL 1BVSA 4IFDJ 4LUZA 1SNPA 3GTKH 5JOBA 1LTRD 2R3ZA 3DWAA 2IWHA 2WAQE 4CDCC 3A56A 1QNKA 4KHPQ 4KY5A 2HDLA 3BDLA 3DEOA 4R8NA 1WYDA 2R7FA 1BXTA 1TS2A 3HOXH 3NTIA 4MIUA 1PH8A 2ES2A 1FR3A 1XNQQ 5ELFA 1SE3A 3BVGA 2MO1A 3HS0C 4RKLA 2OQKA 2YTVA 3RNUA 3ER0A 4CBVA 5FO7B 1N8RC 4ME5A 5IYBH 1EY0A 5C44B 4O1NA 3LWUA 1HUMA 3URYA 3UDIA 1DOKA 1GD7A 4APVA 1XMQQ 2Q8TA 5C4HA 2KEDA 2E2JH 3D31A 3SK8A 5M5XH 1KAWA 3TMEA 3OWFA 3PV0A 2EYFA 3VR4A 3I4MG 1R4QB 1I6HH 3RMHA 5C0XG 3EVQA 1Z47A 4UPAA 3H91A 3HEJA 1JICA 1VQJA 1U4MA 3BVZA 3L7ZC 5EBDA 4TQUS 2UU9L 4LF6Q 3NTKA 5T1GA 2NVYB 1SMYD 4DV1L 4O42A 1XX8A 4LF8L 3S1QH 4H7BA 3SVMA 3GTMB 4R4CA 3CRLC 1OO9B 2E76C 2D0OA 2M2LA 1MJCA 1ZEQX 4KI0A 4NW2A 3PO2B 4QQBX 3M4OB 3M3YB 2VXWA 4B3SQ 2A6HD 4KN4C 4QUFA 3M7GA 4BS9A 3EROA 4DU9A 3AFPA 1PH3A 1EFID 2AHOB 3QR8A 1LLRD 1YNNC 4IJLA 3CMEA 5TSSA 1DD2A 4HJ5A 4FXKC 1STGA 1JR0D 2F0FA 4B9XA 1AEXA 1PYSB 3D6WA 5E4WC 2PZUA 5M3FG 1K8OA 1I4HA 1WCMB 1HH2P 3STBD 2YU9B 2BDNA 2EVBA 2K03A 1RF2D 1YNJC 2NZOA 2MO0A 2ID0A 4J1MA 1K8MA 1TWGH 1HQRD 1JB7A 4EX5A 5IOCA 1EWIA 5LMUQ 1PVOA 1XTDA 3ULJA 2ZXOA 5I6YA 3EN2A 1SMXA 1Y14B 3QG1A 4B3MQ 4LF7Q 4PZ6A 2UUAL 3PIPA 3FVQA 2JA5G 3EIVA 3T13A 3N52A 4XT3B 4AH6A 3PUYA 4ZYSA 3X3MA 2HQLA 2E74C 1EWCA 2E8GA 5IYDH 4B9WA 4A3MB 5CV6A 1K83B 5CV4A 4ZUJA 1S3OA 3I4MB 4JYAQ 1YITA 4LF9L 1SEBD 4DAMA 5HY6A 4WRDA 1Y1WG 4JI8Q 3HOZG 3DLLA 1K9MC 4RHRA 4DV2Q 2JN4A 2BE5D 3D6CA 1STEA 3W1GA 2JQOA 1G6PA 2KHJA 1A63A 5KIXA 4A3JB 1RIPA 4ME3A 1LTBD 1O80A 2VZAA 1F77A 1C0AA 2CCZA 2LXKA 4A3IB 4Y7NB 4RFBA 5G3LD 1B1ZA 1YHBA 4JI7Q 1SNCA 2B2WC 2JA7H 1CUKA 4A3GG 5FLMG 4BA1I 2CQOA 4HSVA 1CT1D 1EQQA 2F0JA 1TWFH 4DV6Q 1KDCA 5J1ZA 1PTOB 2X6LA 4I65A 3OPOA 1HNWL 1WD0A 1M8AA 3IFTA 2KENA 1CZWA 3CAMA 2EJMA 1M1KC 5C4JH 3BS1A 3GTPH 4H44C 3QOJA 3PCOB 3NENA 5KGUA 3E6ZX 1VQKA 3FHWA 1W3SA 5M5WH 2NBFA 1LT4D 1TWAB 3R93A 2PW7A 1MKHA 4DAPA 2JP1A 2E2HH 2NTSA 3QO2A 1YEZA 4WFN3 1WTVA 2ATWA 1HHVA 1XPOA 3SK5A 4NXML 3IL8A 1GKHA 2N3SA 2NN6H 5FLXL 3G71A 3H0GH 4KY7A 5KRUA 4RH6A 1QUQB 4JBJA 4RMFA 1WI5A 4ALPA 1A2TA 2N88A 1B44D 1TR5A 3ZYYX 5IYCH 4RGMA 3TZDA 4IPHA 4ZLTF 4LFBQ 4OIKA 3A74A 1IBKQ 4GKKQ 2CVRA 2OQ0A 1Y1WB 4FO2A 3J7AF 4DR4Q 4X3UA 1HXYD 1NY4A 1LT3D 1SYGA 4KMUC 4A93H 3T51B 1XMOQ 4PQXA 5FJ8G 3I72A 3VYTA 3J7A5 3TS2A 5JEAJ 4M1UB 5IP7G 3CCJA 1SFOH 1DOLA 2L5TA 4X3TA 4OO1H 2F1MA 4QB4A 3R2IA 4GLAC 2B2WA 3F2CA 2NN6I 3J7YW 5EPKA 1MJEA 1G291 4C3JH 2FMCA 3FPUB 2HIXA 2QGQA 1CA6A 3K81C 3KBGA 3A8IE 1X3FA 2L1BA 4JI0L 5EPJA 2EPBA 4GKJL 1QVCA 3U4VA 2YTXA 2L15A 3BYTB 3FRPB 3TS0A 1J9OA 4QUCA 5EKIA 2ENBA 4DV4L 3KF8B 3SHLA 4ULLA 1EOVA 1JE4A 2FMMA 4KY6A 3W3AA 2OCEA 3BU2A 1EQTA 2AUJD 4JV5L 1JOQA 2NVXH 3IKJA 1OXSC 3IRBA 2ASBA 2WV6D 1EIFA 4OO1I 3DWPA 2E2DC 5CC4A 2R7ZG 4DV7Q 2QEXA 4BBRG 1J5EL 4V0BA 1IKMA 1WTWA 1KABA 2HD3A 3I73A 4I7ZC 2N55A 4DR2L 3K7AB 1I94L 2Z4HA 1DONA 2JJQA 1DM0B 1OTCA 1JWSD 2PCFB 4BY7G 1D1KA 3EA6A 3R8BA 2IT1A 4XIGS 4UP7A 1IHZA 3CCVA 5KEEA 4HMJA 4YWLA 2UUBL 4UP8A 3OW7A 4A3LH 4HJAA 1EY7A 3NELA 2OEOA 1CSPA 1X65A 3ERQA 2R92H 4JG2A 3PIO3
chains in the Genus database with same CATH topology
2N78A 2YV5A 3PO3G 4X62L 2K75A 1VQBA 3OTOQ 2JA6G 1VQ7A 3J81c 1E22A 2VY3A 4C2MH 3HOVG 4P73A 1XPRA 1L1OB 1W2BA 1E1OA 2Y0SE 1N32L 3PUWA 1K8AC 3M4QA 4DV4Q 4JI2L 3LGJA 4A75A 1HZBA 2Z6KC 1AH9A 2R7DA 1YHQA 1Q46A 1UE5A 2CKZB 1WFQA 4JC0A 4DK3C 2R6GA 2JA8G 4GS3A 2RF4A 3F8TA 1WJJA 3E0EA 3S16H 4R4OA 4LUOA 3RN2A 3TQYA 1XJVA 3RZDH 4DK6C 1JE5A 2CWAA 3J80c 2I5LX 1PV4A 1HNXQ 2B63H 1YJ9A 1SE8A 2VUMG 4KHPL 3J81j 5IWAQ 3CXCA 5DLQE 1SROA 3CP0A 1J5EQ 2GVBA 1ASYA 4OONA 4P71A 4PZ7A 1VQPA 3SGIA 4DR1Q 1IBML 2ZTDA 4IPDA 3A5UA 1XNRL 2K5VA 3HOWG 1XNQL 2GN5A 4A3KH 3S1RH 2OTLA 2F52A 2PI2A 4GKJL 4A3LG 2IY5B 4DR2Q 1PH5A 1BBWA 1I94Q 3HOUH 5C4XG 1Z9FA 5LMNQ 1QVFA 1D8LA 3I2ZA 3BJUA 1L1OA 3CCUA 1UE7A 2E5LL 1HZAA 1LYLA 3KJOA 4YCWA 4NXNQ 2K4KA 1B8AA 5EAYA 3UDFA 4A3BH 2R92G 4UP9A 3UE0A 5AJ3L 4L5SA 1ASZA 4IOCA 3GTQH 2BH8A 2V1CC 1XMQL 3K7UC 3WWVA 4BBRH 4A3EH 1YHAA 2UUBQ 1A0IA 3I4NH 3GTGH 4P72A 3S1NH 2LSSA 3VDYA 4WJ4A 3K8AA 4JI1Q 3ULLA 4DR3Q 1N9WA 1NJIC 5GAEC 2PI2E 3CMAA 1OXUA 3L0OA 5IP9H 2JEBI 4GN3B 3PO2G 3CCEA 2NVTH 1SR3A 1TXYA 1UEBA 5M5YH 3J81i 4IO9A 2UXBQ 3BZCA 4DUYQ 4NPSA 1TWHH 1V43A 1V9PA 3M9BA 2AMCB 4L5TA 4QJFA 4X62Q 4X65L 4DV5L 1FJGL 5GAHC 1UE6A 1X9NA 1KHIA 3CCLA 3HKSA 1VCIA 3JC66 4OWWB 5C3EH 2PNHA 2Z0SA 1CKMA 4JOIA 3S1MH 2B63G 3KJPA 1N32Q 4LF6L 4JI2Q 4DV3L 4IFDI 3E9IA 1GM5A 1K83H 4IFDG 3U58A 1PHJA 3CPFA 3H15A 3BZKA 1NBWA 5GQOA 3I4MH 4PZ8A 5JJIA 2AWOA 2PMZE 2K50A 4LFAL 5ELNA 3D0FA 1BVSA 2HIVA 3J80i 3OW2A 4PG3A 4IFDJ 4LUZA 2CFMA 3GTKH 4LNQA 1UE1A 2WAQE 3GDEA 1JJ2A 3HOUG 3RLFA 4POGA 2VL6A 1VQ6A 4KHPQ 1PH7A 2VS1A 4B3SL 4B3RL 4KLKA 4DR5L 1X6OA 3HOYG 4X6AH 4A3DH 1O7IA 1WYDA 2R7FA 3HOXH 1PH8A 2VW9A 4P74A 1IBMQ 2ES2A 4YY3L 1XNRQ 1XNQQ 3E9HA 2R93G 1FL0A 2PQAB 2ALYB 5C44H 3I4NG 3PF5A 1PH4A 2MO1A 4KHZA 2NVQH 3CD6A 4R1JA 4LF4L 2OQKA 2YTVA 4GOPC 3RNUA 3ER0A 1N8RC 5IYBH 4H02A 4A4IA 1YVCA 2E5LQ 4HJ8A 4DR7L 1K3RA 2VUMH 2I5MX 3G48A 5AJ3Q 3M85A 3UDIA 1HZ9A 1YI2A 3AEVA 3M7NA 1GD7A 4APVA 1XMQQ 3S2HH 1VQNA 4GNXC 4QY7A 2E2JH 5C3EG 2DGYA 3MXNB 3I4OA 3D31A 1OXXK 2K5NA 5FLXc 4HIKA 2JA9A 2WB1G 1KAWA 5M5XH 1L0WA 4YWMA 5M3MG 3RZOH 3HKZG 2BA0A 3PV0A 4OWXB 2YTYA 4JI1L 3I4MG 4GLXA 5LMUL 2Y0SG 1PH6A 1I6HH 5C0XG 2MNAA 1A62A 3A5ZB 4GN5A 3U50C 5IYDG 1Z47A 4UPAA 4X65Q 2VQEQ 4JBWA 5M3FH 4DV5Q 1FJGQ 2UXBL 1VQJA 4B3ML 4LF7L 3L7ZC 2I0QA 2DUDA 2PQAA 2NVYH 4TQUS 3RLNA 2UU9L 5C0XJ 5J3BA 4DPGA 3CCMA 2WB1E 3T1HL 4LF6Q 4DV3Q 3HKZE 3GTMH 4O0AA 3UDXA 2ZM6L 4DV1L 3KF6B 3HOXG 4A3DG 1JT8A 1BKBA 4LFAQ 3ULPA 1QZGA 3PO2H 1E3PA 3J7ZC 4LF8L 3M4OH 1JJCB 3M3YH 3S1QH 5C44G 1NTGA 4BXXH 2HT1A 1KD1C 1K0RA 4R4CA 4LF9Q 5LMNW 1B70B 2D0OA 4HIMA 3F1ZA 1MJCA 4KI0A 3STBC 4QQBX 4OX9L 4JYAL 5IYBG 2QA4A 2JA5H 4B3SQ 1L2FA 4DR5Q 4B3RQ 1OXVA 3HFZB 4IPCA 1YIJA 2Q2IA 3AFPA 3F2BA 1E1TA 4GOPB 4B3TL 1G51A 4YWKA 4JI8L 4YY3Q 4JCVE 1PH3A 5IE8A 2ZJRA 2AHOB 3ZJYC 2JA7G 4LF4Q 4IJLA 3CMEA 4DV2L 4K0KL 4LWCA 4HJ5A 3TREA 1X3EA 1Q81C 1WCMH 1P8LA 1VQIA 4NB3A 2A1AA 4LF5Q 2YU9H 4GNXB 3B6YA 4AQYQ 4DR7Q 1PYSB 1Y1WH 4A3KG 1Q12A 5M3FG 2ZTCA 3KF6A 3HOZH 3HOYH 3UE1A 1HH2P 1DGSA 3STBD 3TEHB 1U0LA 3CW2C 1CSQA 1VS0A 3ERSX 1PH9A 5H1SE 4L5QA 2NZOA 2R93H 2MO0A 1FGUA 2ID0A 1Q82C 3UDGA 4JI7L 3TRZA 1TWGH 4QGUA 2EIFA 1UWVA 4EQ5A 1JB7A 4JBKA 2FXQA 1GO3E 2K5HA 4EX5A 5LMUQ 1EWIA 1N33L 1PVOA 1YBYA 1XTDA 2I5HA 3ULJA 1N34L 1YJNA 4GOPA 3EN2A 1SMXA 1Y14B 2IX0A 1PA6A 1D7QA 4B3MQ 4LF7Q 4BXXG 1TWCH 1X55A 4DAYB 2VQEL 3JAMc 1JJGA 2UU9Q 4BBSH 4PZ6A 2UUAL 4IJHA 3T1HQ 3PIPA 3GO5A 2JA5G 4QL5A 1Q1EA 3EIVA 2WAQG 4A3GH 4AH6A 2ZM6Q 4DV1Q 1IZ6A 3PUYA 4A3MH 4R4QA 5FLMH 4GNXA 3S17H 2HQLA 5M3MH 1A8VA 3T1YL 1R9TH 5K36G 3CCRA 4LF8Q 2E8GA 1WOCA 3NEMA 2VQFL 5IYDH 1BBUA 4A3FG 1S3OA 4MNOA 4OX9Q 3H3VH 4JYAQ 1WCMG 1Y1VG 1YITA 5IT9c 4LF9L 4DAMA 2UUCL 5HY6A 2HHHL 1EFWA 2ZJPA 2MQHA 1Y1WG 3FP9A 2B3GA 4B3TQ 4JI8Q 1HZCA 2EXDA 3HOZG 2RCNA 1HJPA 2IHEA 4BY1G 3DLLA 1K9MC 1RL2A 4IOAA 3CPWA 4DV2Q 4K0KQ 4A3JH 1CKOA 3W1GA 2JQOA 1IYJB 1G6PA 2KHJA 2A19A 1A63A 4HJ7A 2Z6KA 4WJ3M 4A3IH 2H5XA 2F3IA 4MTNA 3GD7A 4FDBA 1RIPA 4ME3A 4Y7NH 1HR0L 1I5FA 4LF5L 4LFBL 4AQYL 2VZAA 1C0AA 2CCZA 3K80C 2LXKA 1YJWA 1SLJA 1IBKL 1I3QH 5GADC 1VQAA 4BBSG 4A3CH 2JEAI 4GKKL 1YHBA 2A8VA 4JI7Q 3KLWA 1GVPA 2JA7H 2B29A 1CUKA 1VQFA 5BR8L 4TVAB 4A3GG 1HNZL 4XTCS 4A3MG 4DR4L 1N33Q 5FLMG 4BA1I 2UXDL 2CQOA 1VQ4A 3JAMi 4JI6L 1N34Q 3KFUA 3Q8DA 1OXTA 1XMOL 1C7YA 5C0XI 5E7NA 4GN4B 1EQQA 1Q8KA 2IX1A 1TWFH 2UUAQ 4DV6Q 3H3VI 1KL9A 2JK8A 1Q7YC 2Q2TA 1SRUA 3S15H 4LW1A 4JOIC 2RHQB 4UY8C 1HNWL 2KCTA 4R4TA 1KRTA 3T1YQ 1X3GA 2KENA 3CAMA 4OXPA 2K14A 3RN5A 1Q86C 1XPUA 2AWNA 3GTJH 2VQFQ 5C4JH 2C35B 1M1KC 1TWAH 4AYBG 5FJ8H 3GTPH 3CF5A 1V1QA 1J6QA 3PCOB 3NENA 4A3JG 1HR0W 1K8GA 1VQKA 3S24A 1QZHA 3FHWA 1W3SA 5IP7H 5M5WH 2UUCQ 2HHHQ 4A3IG 4PMWA 3M4PA 4DUZL 1MKHA 4DR6L 2E2HH 5IY0A 2ATWA 1YEZA 4JI5L 1XPOA 4AYBE 4NXML 4LUVA 4YCVA 1JMCA 2D0PA 1GKHA 4LFCL 1X54A 2N3SA 4AIMA 4X64L 2K52A 1VQMA 4A3CG 3G71A 3H0GH 1EYGA 4RG1A 1QUQB 4JBJA 4RMFA 1WI5A 4ALPA 5ELOA 4A3FH 1E24A 4X66L 5IYCH 1LUZA 4BA2I 3L2PA 4POFA 1Y1VH 4IPHA 3PF4A 3NBHB 1HR0Q 1T9HA 4LFBQ 3PUXA 3A74A 4HJ9A 1VQ5A 1H95A 5GROA 1S72A 1IBKQ 1PH2A 2E2IH 4JV5Q 1VQ8A 2R92H 1KRSA 3DM3A 3K0XA 1AE2A 4GKKQ 4BY1H 5JJKA 3CCSA 2OQ0A 3PSIA 4J15A 4MZ9A 2YYZA 3S2DH 2GVAA 5BR8Q 4JI3L 1AE3A 1HNZQ 4DR4Q 2UXDQ 1NY4A 4JI6Q 2UXCL 3AQQA 2ZJQA 1B7YB 2AKWB 4DV7L 1KIXA 4A93H 4JBMA 5JEAG 1XMOQ 3KYHC 3PUVA 1LTLA 3KDFB 5FJ8G 3AYHB 3KOJA 3I55A 1EQRA 1CKNB 3S14H 3GTLH 3J7A5 3TS2A 5JEAJ 5IP7G 2WP8J 3CCJA 1U5KA 1N36L 4JI4L 1SFOH 1QUQA 4C3IH 4DV6L 1X56A 3I7FA 4O2DA 3U4ZA 1HNWQ 1VQDA 1EIYB 2R7ZH 2NZHA 4DKAC 4DV0L 4GLAC 1K73C 3F2CA 1YZ6A 3GTOH 2NN6I 2NN6G 2CWPA 3H0GG 3PGZA 4P75A 1QVGA 1MJEA 3A0JA 1G291 4C3JH 5IYCG 1IL2A 2HIXA 2QGQA 1IXRA 1LM0A 4YHHL 3K81C 4DUZQ 4DR6Q 4YCUA 1X3FA 4JI0L 4BY7H 1YNXA 2EQSA 1VQLA 4JI5Q 3MEFA 1KQSA 2F4VL 3ICEA 1PYBA 4DNIA 1QVCA 3U4VA 2YTXA 1IBLL 4NXMQ 2XGTA 2L15A 4X64Q 4LFCQ 3KDFA 1Q1BA 1VQHA 3OTOL 3TS0A 1CKNA 4HIOA 1VQ9A 3CC7A 3FKIH 2VNUD 1FVIA 1PFSA 4X66Q 4GLVB 4DV4L 3KF8B 1EOVA 3CQZH 4A93G 1SN8A 1L1OC 1I50H 1KC8C 2IHFA 2JE6I 3PO3H 2OCEA 2RHSB 3BU2A 2JA6H 4JV5L 1KXLA 2NVXH 2Q2UA 4HIDA 2Q2HA 2D62A 2XTIA 1OXSC 3HOVH 3IRBA 2ASBA 1S40A 3AFQA 1IBLQ 2ZTEA 2KHIA 1HNXL 1EIFA 4JI3Q 4L5RC 4A3BG 3I56A 5IWAL 3G6EA 3F2DA 4A76A 4OO1G 4OO1I 2UXCQ 2MFIA 1EUJA 2R7ZG 4DV7Q 2QEXA 2N8NA 4BBRG 1J5EL 5GAGC 4A3EG 2OTJA 2OWOA 1C9OA 3K7AH 4DR1L 2N49A 3W1BA 2JA8H 2KBNA 1E7ZA 4QIWE 5IP9G 2WFWA 4DR2L 3EBEA 1M90C 2BH2A 4IPGA 1N36Q 4JI4Q 1I94L 3CCQA 1VQCA 3CC4A 5LMNL 2KCMA 2JJQA 1MIUA 3OYYA 2LXJA 1NMGA 1OTCA 1NMFA 4BY7G 4NXNL 2IT1A 4XIGS 4UP7A 4DV0Q 3CCVA 1VQGA 3HOWH 4YWLA 1VQOA 2UUBL 3CC2A 4UP8A 3PUZA 4A3LH 4R4IA 3FKIG 5HGQA 4HJAA 3RLOA 3RR5A 4Y52H 5JJLA 2BA1A 5C4XH 3PIOA 4DR3L 1VQEA 4OWTB 3NELA 4YHHQ 4C3HH 1CSPA 3G4SA 3W5OA 1PH1A 4JI0Q 1X65A 2F4VQ 1NE3A 4GKJQ 4DUYL 4JG2A 1P16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N78 A;  2YV5 A;  3PO3 G;  4X62 L;  2K75 A;  1VQB A;  3OTO Q;  2JA6 G;  1VQ7 A;  3J81 c;  1E22 A;  2VY3 A;  4C2M H;  3HOV G;  4P73 A;  1XPR A;  1L1O B;  1W2B A;  1E1O A;  2Y0S E;  1N32 L;  3PUW A;  1K8A C;  3M4Q A;  4DV4 Q;  4JI2 L;  3LGJ A;  4A75 A;  1HZB A;  2Z6K C;  1AH9 A;  2R7D A;  1YHQ A;  1Q46 A;  1UE5 A;  2CKZ B;  1WFQ A;  4JC0 A;  4DK3 C;  2R6G A;  2JA8 G;  4GS3 A;  2RF4 A;  3F8T A;  1WJJ A;  3E0E A;  3S16 H;  4R4O A;  4LUO A;  3RN2 A;  3TQY A;  1XJV A;  3RZD H;  4DK6 C;  1JE5 A;  2CWA A;  3J80 c;  2I5L X;  1PV4 A;  1HNX Q;  2B63 H;  1YJ9 A;  1SE8 A;  2VUM G;  4KHP L;  3J81 j;  5IWA Q;  3CXC A;  5DLQ E;  1SRO A;  3CP0 A;  1J5E Q;  2GVB A;  1ASY A;  4OON A;  4P71 A;  4PZ7 A;  1VQP A;  3SGI A;  4DR1 Q;  1IBM L;  2ZTD A;  4IPD A;  3A5U A;  1XNR L;  2K5V A;  3HOW G;  1XNQ L;  2GN5 A;  4A3K H;  3S1R H;  2OTL A;  2F52 A;  2PI2 A;  4GKJ L;  4A3L G;  2IY5 B;  4DR2 Q;  1PH5 A;  1BBW A;  1I94 Q;  3HOU H;  5C4X G;  1Z9F A;  5LMN Q;  1QVF A;  1D8L A;  3I2Z A;  3BJU A;  1L1O A;  3CCU A;  1UE7 A;  2E5L L;  1HZA A;  1LYL A;  3KJO A;  4YCW A;  4NXN Q;  2K4K A;  1B8A A;  5EAY A;  3UDF A;  4A3B H;  2R92 G;  4UP9 A;  3UE0 A;  5AJ3 L;  4L5S A;  1ASZ A;  4IOC A;  3GTQ H;  2BH8 A;  2V1C C;  1XMQ L;  3K7U C;  3WWV A;  4BBR H;  4A3E H;  1YHA A;  2UUB Q;  1A0I A;  3I4N H;  3GTG H;  4P72 A;  3S1N H;  2LSS A;  3VDY A;  4WJ4 A;  3K8A A;  4JI1 Q;  3ULL A;  4DR3 Q;  1N9W A;  1NJI C;  5GAE C;  2PI2 E;  3CMA A;  1OXU A;  3L0O A;  5IP9 H;  2JEB I;  4GN3 B;  3PO2 G;  3CCE A;  2NVT H;  1SR3 A;  1TXY A;  1UEB A;  5M5Y H;  3J81 i;  4IO9 A;  2UXB Q;  3BZC A;  4DUY Q;  4NPS A;  1TWH H;  1V43 A;  1V9P A;  3M9B A;  2AMC B;  4L5T A;  4QJF A;  4X62 Q;  4X65 L;  4DV5 L;  1FJG L;  5GAH C;  1UE6 A;  1X9N A;  1KHI A;  3CCL A;  3HKS A;  1VCI A;  3JC6 6;  4OWW B;  5C3E H;  2PNH A;  2Z0S A;  1CKM A;  4JOI A;  3S1M H;  2B63 G;  3KJP A;  1N32 Q;  4LF6 L;  4JI2 Q;  4DV3 L;  4IFD I;  3E9I A;  1GM5 A;  1K83 H;  4IFD G;  3U58 A;  1PHJ A;  3CPF A;  3H15 A;  3BZK A;  1NBW A;  5GQO A;  3I4M H;  4PZ8 A;  5JJI A;  2AWO A;  2PMZ E;  2K50 A;  4LFA L;  5ELN A;  3D0F A;  1BVS A;  2HIV A;  3J80 i;  3OW2 A;  4PG3 A;  4IFD J;  4LUZ A;  2CFM A;  3GTK H;  4LNQ A;  1UE1 A;  2WAQ E;  3GDE A;  1JJ2 A;  3HOU G;  3RLF A;  4POG A;  2VL6 A;  1VQ6 A;  4KHP Q;  1PH7 A;  2VS1 A;  4B3S L;  4B3R L;  4KLK A;  4DR5 L;  1X6O A;  3HOY G;  4X6A H;  4A3D H;  1O7I A;  1WYD A;  2R7F A;  3HOX H;  1PH8 A;  2VW9 A;  4P74 A;  1IBM Q;  2ES2 A;  4YY3 L;  1XNR Q;  1XNQ Q;  3E9H A;  2R93 G;  1FL0 A;  2PQA B;  2ALY B;  5C44 H;  3I4N G;  3PF5 A;  1PH4 A;  2MO1 A;  4KHZ A;  2NVQ H;  3CD6 A;  4R1J A;  4LF4 L;  2OQK A;  2YTV A;  4GOP C;  3RNU A;  3ER0 A;  1N8R C;  5IYB H;  4H02 A;  4A4I A;  1YVC A;  2E5L Q;  4HJ8 A;  4DR7 L;  1K3R A;  2VUM H;  2I5M X;  3G48 A;  5AJ3 Q;  3M85 A;  3UDI A;  1HZ9 A;  1YI2 A;  3AEV A;  3M7N A;  1GD7 A;  4APV A;  1XMQ Q;  3S2H H;  1VQN A;  4GNX C;  4QY7 A;  2E2J H;  5C3E G;  2DGY A;  3MXN B;  3I4O A;  3D31 A;  1OXX K;  2K5N A;  5FLX c;  4HIK A;  2JA9 A;  2WB1 G;  1KAW A;  5M5X H;  1L0W A;  4YWM A;  5M3M G;  3RZO H;  3HKZ G;  2BA0 A;  3PV0 A;  4OWX B;  2YTY A;  4JI1 L;  3I4M G;  4GLX A;  5LMU L;  2Y0S G;  1PH6 A;  1I6H H;  5C0X G;  2MNA A;  1A62 A;  3A5Z B;  4GN5 A;  3U50 C;  5IYD G;  1Z47 A;  4UPA A;  4X65 Q;  2VQE Q;  4JBW A;  5M3F H;  4DV5 Q;  1FJG Q;  2UXB L;  1VQJ A;  4B3M L;  4LF7 L;  3L7Z C;  2I0Q A;  2DUD A;  2PQA A;  2NVY H;  4TQU S;  3RLN A;  2UU9 L;  5C0X J;  5J3B A;  4DPG A;  3CCM A;  2WB1 E;  3T1H L;  4LF6 Q;  4DV3 Q;  3HKZ E;  3GTM H;  4O0A A;  3UDX A;  2ZM6 L;  4DV1 L;  3KF6 B;  3HOX G;  4A3D G;  1JT8 A;  1BKB A;  4LFA Q;  3ULP A;  1QZG A;  3PO2 H;  1E3P A;  3J7Z C;  4LF8 L;  3M4O H;  1JJC B;  3M3Y H;  3S1Q H;  5C44 G;  1NTG A;  4BXX H;  2HT1 A;  1KD1 C;  1K0R A;  4R4C A;  4LF9 Q;  5LMN W;  1B70 B;  2D0O A;  4HIM A;  3F1Z A;  1MJC A;  4KI0 A;  3STB C;  4QQB X;  4OX9 L;  4JYA L;  5IYB G;  2QA4 A;  2JA5 H;  4B3S Q;  1L2F A;  4DR5 Q;  4B3R Q;  1OXV A;  3HFZ B;  4IPC A;  1YIJ A;  2Q2I A;  3AFP A;  3F2B A;  1E1T A;  4GOP B;  4B3T L;  1G51 A;  4YWK A;  4JI8 L;  4YY3 Q;  4JCV E;  1PH3 A;  5IE8 A;  2ZJR A;  2AHO B;  3ZJY C;  2JA7 G;  4LF4 Q;  4IJL A;  3CME A;  4DV2 L;  4K0K L;  4LWC A;  4HJ5 A;  3TRE A;  1X3E A;  1Q81 C;  1WCM H;  1P8L A;  1VQI A;  4NB3 A;  2A1A A;  4LF5 Q;  2YU9 H;  4GNX B;  3B6Y A;  4AQY Q;  4DR7 Q;  1PYS B;  1Y1W H;  4A3K G;  1Q12 A;  5M3F G;  2ZTC A;  3KF6 A;  3HOZ H;  3HOY H;  3UE1 A;  1HH2 P;  1DGS A;  3STB D;  3TEH B;  1U0L A;  3CW2 C;  1CSQ A;  1VS0 A;  3ERS X;  1PH9 A;  5H1S E;  4L5Q A;  2NZO A;  2R93 H;  2MO0 A;  1FGU A;  2ID0 A;  1Q82 C;  3UDG A;  4JI7 L;  3TRZ A;  1TWG H;  4QGU A;  2EIF A;  1UWV A;  4EQ5 A;  1JB7 A;  4JBK A;  2FXQ A;  1GO3 E;  2K5H A;  4EX5 A;  5LMU Q;  1EWI A;  1N33 L;  1PVO A;  1YBY A;  1XTD A;  2I5H A;  3ULJ A;  1N34 L;  1YJN A;  4GOP A;  3EN2 A;  1SMX A;  1Y14 B;  2IX0 A;  1PA6 A;  1D7Q A;  4B3M Q;  4LF7 Q;  4BXX G;  1TWC H;  1X55 A;  4DAY B;  2VQE L;  3JAM c;  1JJG A;  2UU9 Q;  4BBS H;  4PZ6 A;  2UUA L;  4IJH A;  3T1H Q;  3PIP A;  3GO5 A;  2JA5 G;  4QL5 A;  1Q1E A;  3EIV A;  2WAQ G;  4A3G H;  4AH6 A;  2ZM6 Q;  4DV1 Q;  1IZ6 A;  3PUY A;  4A3M H;  4R4Q A;  5FLM H;  4GNX A;  3S17 H;  2HQL A;  5M3M H;  1A8V A;  3T1Y L;  1R9T H;  5K36 G;  3CCR A;  4LF8 Q;  2E8G A;  1WOC A;  3NEM A;  2VQF L;  5IYD H;  1BBU A;  4A3F G;  1S3O A;  4MNO A;  4OX9 Q;  3H3V H;  4JYA Q;  1WCM G;  1Y1V G;  1YIT A;  5IT9 c;  4LF9 L;  4DAM A;  2UUC L;  5HY6 A;  2HHH L;  1EFW A;  2ZJP A;  2MQH A;  1Y1W G;  3FP9 A;  2B3G A;  4B3T Q;  4JI8 Q;  1HZC A;  2EXD A;  3HOZ G;  2RCN A;  1HJP A;  2IHE A;  4BY1 G;  3DLL A;  1K9M C;  1RL2 A;  4IOA A;  3CPW A;  4DV2 Q;  4K0K Q;  4A3J H;  1CKO A;  3W1G A;  2JQO A;  1IYJ B;  1G6P A;  2KHJ A;  2A19 A;  1A63 A;  4HJ7 A;  2Z6K A;  4WJ3 M;  4A3I H;  2H5X A;  2F3I A;  4MTN A;  3GD7 A;  4FDB A;  1RIP A;  4ME3 A;  4Y7N H;  1HR0 L;  1I5F A;  4LF5 L;  4LFB L;  4AQY L;  2VZA A;  1C0A A;  2CCZ A;  3K80 C;  2LXK A;  1YJW A;  1SLJ A;  1IBK L;  1I3Q H;  5GAD C;  1VQA A;  4BBS G;  4A3C H;  2JEA I;  4GKK L;  1YHB A;  2A8V A;  4JI7 Q;  3KLW A;  1GVP A;  2JA7 H;  2B29 A;  1CUK A;  1VQF A;  5BR8 L;  4TVA B;  4A3G G;  1HNZ L;  4XTC S;  4A3M G;  4DR4 L;  1N33 Q;  5FLM G;  4BA1 I;  2UXD L;  2CQO A;  1VQ4 A;  3JAM i;  4JI6 L;  1N34 Q;  3KFU A;  3Q8D A;  1OXT A;  1XMO L;  1C7Y A;  5C0X I;  5E7N A;  4GN4 B;  1EQQ A;  1Q8K A;  2IX1 A;  1TWF H;  2UUA Q;  4DV6 Q;  3H3V I;  1KL9 A;  2JK8 A;  1Q7Y C;  2Q2T A;  1SRU A;  3S15 H;  4LW1 A;  4JOI C;  2RHQ B;  4UY8 C;  1HNW L;  2KCT A;  4R4T A;  1KRT A;  3T1Y Q;  1X3G A;  2KEN A;  3CAM A;  4OXP A;  2K14 A;  3RN5 A;  1Q86 C;  1XPU A;  2AWN A;  3GTJ H;  2VQF Q;  5C4J H;  2C35 B;  1M1K C;  1TWA H;  4AYB G;  5FJ8 H;  3GTP H;  3CF5 A;  1V1Q A;  1J6Q A;  3PCO B;  3NEN A;  4A3J G;  1HR0 W;  1K8G A;  1VQK A;  3S24 A;  1QZH A;  3FHW A;  1W3S A;  5IP7 H;  5M5W H;  2UUC Q;  2HHH Q;  4A3I G;  4PMW A;  3M4P A;  4DUZ L;  1MKH A;  4DR6 L;  2E2H H;  5IY0 A;  2ATW A;  1YEZ A;  4JI5 L;  1XPO A;  4AYB E;  4NXM L;  4LUV A;  4YCV A;  1JMC A;  2D0P A;  1GKH A;  4LFC L;  1X54 A;  2N3S A;  4AIM A;  4X64 L;  2K52 A;  1VQM A;  4A3C G;  3G71 A;  3H0G H;  1EYG A;  4RG1 A;  1QUQ B;  4JBJ A;  4RMF A;  1WI5 A;  4ALP A;  5ELO A;  4A3F H;  1E24 A;  4X66 L;  5IYC H;  1LUZ A;  4BA2 I;  3L2P A;  4POF A;  1Y1V H;  4IPH A;  3PF4 A;  3NBH B;  1HR0 Q;  1T9H A;  4LFB Q;  3PUX A;  3A74 A;  4HJ9 A;  1VQ5 A;  1H95 A;  5GRO A;  1S72 A;  1IBK Q;  1PH2 A;  2E2I H;  4JV5 Q;  1VQ8 A;  2R92 H;  1KRS A;  3DM3 A;  3K0X A;  1AE2 A;  4GKK Q;  4BY1 H;  5JJK A;  3CCS A;  2OQ0 A;  3PSI A;  4J15 A;  4MZ9 A;  2YYZ A;  3S2D H;  2GVA A;  5BR8 Q;  4JI3 L;  1AE3 A;  1HNZ Q;  4DR4 Q;  2UXD Q;  1NY4 A;  4JI6 Q;  2UXC L;  3AQQ A;  2ZJQ A;  1B7Y B;  2AKW B;  4DV7 L;  1KIX A;  4A93 H;  4JBM A;  5JEA G;  1XMO Q;  3KYH C;  3PUV A;  1LTL A;  3KDF B;  5FJ8 G;  3AYH B;  3KOJ A;  3I55 A;  1EQR A;  1CKN B;  3S14 H;  3GTL H;  3J7A 5;  3TS2 A;  5JEA J;  5IP7 G;  2WP8 J;  3CCJ A;  1U5K A;  1N36 L;  4JI4 L;  1SFO H;  1QUQ A;  4C3I H;  4DV6 L;  1X56 A;  3I7F A;  4O2D A;  3U4Z A;  1HNW Q;  1VQD A;  1EIY B;  2R7Z H;  2NZH A;  4DKA C;  4DV0 L;  4GLA C;  1K73 C;  3F2C A;  1YZ6 A;  3GTO H;  2NN6 I;  2NN6 G;  2CWP A;  3H0G G;  3PGZ A;  4P75 A;  1QVG A;  1MJE A;  3A0J A;  1G29 1;  4C3J H;  5IYC G;  1IL2 A;  2HIX A;  2QGQ A;  1IXR A;  1LM0 A;  4YHH L;  3K81 C;  4DUZ Q;  4DR6 Q;  4YCU A;  1X3F A;  4JI0 L;  4BY7 H;  1YNX A;  2EQS A;  1VQL A;  4JI5 Q;  3MEF A;  1KQS A;  2F4V L;  3ICE A;  1PYB A;  4DNI A;  1QVC A;  3U4V A;  2YTX A;  1IBL L;  4NXM Q;  2XGT A;  2L15 A;  4X64 Q;  4LFC Q;  3KDF A;  1Q1B A;  1VQH A;  3OTO L;  3TS0 A;  1CKN A;  4HIO A;  1VQ9 A;  3CC7 A;  3FKI H;  2VNU D;  1FVI A;  1PFS A;  4X66 Q;  4GLV B;  4DV4 L;  3KF8 B;  1EOV A;  3CQZ H;  4A93 G;  1SN8 A;  1L1O C;  1I50 H;  1KC8 C;  2IHF A;  2JE6 I;  3PO3 H;  2OCE A;  2RHS B;  3BU2 A;  2JA6 H;  4JV5 L;  1KXL A;  2NVX H;  2Q2U A;  4HID A;  2Q2H A;  2D62 A;  2XTI A;  1OXS C;  3HOV H;  3IRB A;  2ASB A;  1S40 A;  3AFQ A;  1IBL Q;  2ZTE A;  2KHI A;  1HNX L;  1EIF A;  4JI3 Q;  4L5R C;  4A3B G;  3I56 A;  5IWA L;  3G6E A;  3F2D A;  4A76 A;  4OO1 G;  4OO1 I;  2UXC Q;  2MFI A;  1EUJ A;  2R7Z G;  4DV7 Q;  2QEX A;  2N8N A;  4BBR G;  1J5E L;  5GAG C;  4A3E G;  2OTJ A;  2OWO A;  1C9O A;  3K7A H;  4DR1 L;  2N49 A;  3W1B A;  2JA8 H;  2KBN A;  1E7Z A;  4QIW E;  5IP9 G;  2WFW A;  4DR2 L;  3EBE A;  1M90 C;  2BH2 A;  4IPG A;  1N36 Q;  4JI4 Q;  1I94 L;  3CCQ A;  1VQC A;  3CC4 A;  5LMN L;  2KCM A;  2JJQ A;  1MIU A;  3OYY A;  2LXJ A;  1NMG A;  1OTC A;  1NMF A;  4BY7 G;  4NXN L;  2IT1 A;  4XIG S;  4UP7 A;  4DV0 Q;  3CCV A;  1VQG A;  3HOW H;  4YWL A;  1VQO A;  2UUB L;  3CC2 A;  4UP8 A;  3PUZ A;  4A3L H;  4R4I A;  3FKI G;  5HGQ A;  4HJA A;  3RLO A;  3RR5 A;  4Y52 H;  5JJL A;  2BA1 A;  5C4X H;  3PIO A;  4DR3 L;  1VQE A;  4OWT B;  3NEL A;  4YHH Q;  4C3H H;  1CSP A;  3G4S A;  3W5O A;  1PH1 A;  4JI0 Q;  1X65 A;  2F4V Q;  1NE3 A;  4GKJ Q;  4DUY L;  4JG2 A;  1P16 A; 
#chains in the Genus database with same CATH topology
 3PO3 G;  3TP8 A;  2JA6 G;  4EGV A;  4C2M H;  3HOV G;  4P73 A;  1L1O B;  1E1O A;  3PUW A;  4JI2 L;  5CV8 A;  4G57 A;  1HZB A;  2Z6K C;  4KKT A;  1Q46 A;  2HQE A;  4JC0 A;  2JA8 G;  4FXD A;  5COR A;  3OMC A;  3S16 H;  4R4O A;  2NB0 A;  4X3K A;  3LX0 A;  4K8J A;  3WOF A;  2XIW A;  2I5L X;  1H9S B;  1PV4 A;  1YJ9 A;  4KHP L;  3J81 j;  1IW7 D;  4IFD H;  4LJZ C;  3RZD B;  3MTS A;  4P71 A;  4DR1 Q;  5IIF A;  2B63 B;  1XNQ L;  2PI2 A;  2A69 C;  3BJU A;  4RKB A;  1AP0 A;  1E0B A;  5AFW A;  3ND9 A;  1UE7 A;  4KHV A;  4PV1 C;  3KLS X;  4A3B H;  3HOU B;  4UP9 A;  3T56 B;  3UE0 A;  4L5S A;  3GTQ H;  1XMQ L;  3FMC A;  1UAP A;  3K7U C;  4HAE A;  3VYR A;  1YHA A;  3WWV A;  4A3E H;  3GTG H;  2XWB B;  2LSS A;  3S1N H;  3VDY A;  2ZXR A;  1CK1 A;  4JI1 Q;  3MFG A;  4DR3 Q;  5GAE C;  3CMA A;  3L0O A;  4BBR B;  1MD2 D;  5A35 A;  1IL8 A;  1FD7 D;  4H0L C;  1V43 A;  2AQ2 B;  4L5T A;  4QJF A;  4X62 Q;  5GAH C;  4HN7 A;  1HA5 A;  3CCL A;  5IGC A;  5C3E H;  2PNH A;  4J6H A;  4JVZ A;  1CKM A;  1MSG A;  1N32 Q;  1LT6 D;  3GQB A;  4LF6 L;  2AQ3 B;  4IFD I;  1GM5 A;  1PHJ A;  3H15 A;  5GQO A;  5JJI A;  2K50 A;  5ELN A;  2F0I A;  2WB1 B;  3V2T A;  2HIV A;  2EYJ A;  2DN8 A;  1GUG A;  2C9O A;  1UE1 A;  1F2L A;  1ONL A;  2Y0S B;  4NDX A;  3NHH A;  4POG A;  3KUP A;  1D5X C;  5CYU A;  3P1H A;  4B3S L;  4HSP A;  2K5W A;  4A3D H;  2O4X A;  2VW9 A;  4P74 A;  2B8G A;  1WTX A;  1XNR Q;  2HCC A;  2WIN B;  3E9H A;  4LAA A;  2F0T A;  2ALY B;  3I4N G;  4G4K A;  1PH4 A;  2NVQ H;  1G2S A;  3HOX B;  3OMG A;  4GOP C;  4H02 A;  5IT9 L;  4A4I A;  3K57 A;  2E5L Q;  2VUM H;  1YI2 A;  1SMY C;  5CV7 A;  5FK9 C;  3S2H H;  5CR3 A;  4GNX C;  2E75 C;  5F2D A;  1EWH A;  2DGY A;  3MXN B;  4RA8 A;  4HIK A;  2KCN A;  2C5C A;  3R2T A;  3P75 A;  3RZO H;  3C46 A;  4LK1 C;  2YTY A;  1B9M A;  5LMU L;  2E2J B;  1PH6 A;  4NKL A;  2MNA A;  2A6H C;  4GN5 A;  5IYD G;  4UY8 C;  2VQE Q;  5M5X B;  1EY8 A;  1C8C A;  2B39 A;  4B3M L;  1Q3L A;  4LF7 L;  2DUD A;  2PQA A;  3RLN A;  1ZXT A;  1I6H B;  5C0X J;  1TY2 A;  2WB1 E;  2QKI C;  1GOZ A;  1PTO F;  4FXG C;  3TP5 A;  4O0A A;  3KF6 B;  2Q8I B;  1FYC A;  1LO5 D;  1E3P A;  2DJG C;  5C44 G;  4BXX H;  5IOD A;  1KD1 C;  2H1E A;  4DGZ A;  4IUV A;  1ESF A;  3STB C;  4JYA L;  1Y8N B;  3S1Q B;  1VF5 C;  1OXV A;  4IPC A;  3F2B A;  1ET9 A;  4YWK A;  4JI8 L;  3GV6 A;  4KV6 A;  4YY3 Q;  2EDG A;  3A54 A;  3DEP A;  2KUM A;  2WAQ B;  2JA7 G;  5BN3 A;  4DV2 L;  3HP3 A;  3H3V C;  3TRE A;  1X3E A;  1Q81 C;  5A2Q E;  1VMC A;  2BDO A;  4NB3 A;  4LF5 Q;  4IZ8 A;  5I4D A;  3WDN A;  1KLU D;  4A3K G;  3FEW X;  4G7Z C;  1U4L A;  3HOY H;  1BR9 A;  3UE1 A;  1DGS A;  2QDB A;  1VS0 A;  3MHB A;  3ERS X;  1FNU A;  4L5Q A;  2R93 H;  3U9O A;  1Q82 C;  4JI7 L;  3TRZ A;  1IYU A;  4QGU A;  1XXG A;  2PNR C;  4JBK A;  4DK1 A;  1GO3 E;  4K5X A;  2VB3 X;  1LTS D;  1QG7 A;  4FYD A;  2I5H A;  2RA4 A;  1YJN A;  4GOP A;  1TWG B;  1FNV A;  2EYL A;  2AQ1 B;  2IX0 A;  3MXP A;  2RBM A;  3DHQ A;  4CKC A;  4BBS H;  1PFB A;  1BBX C;  1Q1E A;  5E4X A;  2EYO A;  3DMU A;  3G7L A;  2BE5 C;  4CJ0 B;  2ZM6 Q;  2XRS D;  3S17 H;  4GNX A;  1HTL D;  3P7J A;  5M3M H;  5K36 G;  2M9V A;  3NEM A;  3PMF A;  5CV5 A;  4CDE C;  2XNA C;  4X3S A;  4DXF A;  4OX9 Q;  4KKU A;  1Q8I A;  1WCM G;  2V4D A;  5IT9 c;  2MQH A;  1B9N A;  1L0Y B;  1HZC A;  2EXD A;  2RCN A;  4UDU C;  2IHE A;  1X3P A;  3CPW A;  3QB3 A;  4DAY A;  4TSS A;  2F0Q A;  1IYJ B;  3I70 A;  2XVS A;  1ZKO A;  1SNM A;  5CGK A;  4WJ3 M;  2NUC A;  2F3I A;  4MTN A;  4DK0 A;  4FDB A;  3D4W A;  1PTO D;  1I5F A;  1M4V A;  1EIH A;  4LFB L;  4IQZ A;  4AQY L;  1YJW A;  1IBK L;  1I3Q H;  5GAD C;  3QWN A;  4GKK L;  2LMC B;  3MZ5 A;  3AB9 A;  3KLW A;  2B29 A;  1RD9 D;  2EYH A;  5BN4 A;  1EY5 A;  4XTC S;  4A3M G;  4DR4 L;  1N33 Q;  1VQ4 A;  3JAM i;  1N34 Q;  4DA2 A;  1OXT A;  2JA7 B;  1XMO L;  5E7N A;  4GN4 B;  1BCP B;  2WII B;  3EJI A;  2IX1 A;  1KL9 A;  1EYA A;  5JPM C;  4HTH A;  4A3K B;  3S15 H;  3K59 A;  2RDH A;  1LT5 D;  5ELC A;  2RHQ B;  1TWF B;  4R4T A;  1DOM A;  1X3G A;  1SND A;  5JEA H;  3GTJ H;  2VQF Q;  2C35 B;  3K5M A;  1J6Q A;  5G3L F;  4A3J G;  1BF4 A;  5C5L A;  1MBY A;  3D3R A;  5ELE A;  5LL6 X;  1SYC A;  1QZH A;  1ENC A;  5C4J B;  1PZI D;  3BDC A;  3GTP B;  2UUC Q;  4A3I G;  5JVG 3;  3OSO A;  3VYU A;  5M5W B;  1KLG D;  4AYB E;  1NAP A;  4AIM A;  1X54 A;  4A3C G;  2E2H B;  1K28 A;  1EYG A;  5KNC A;  1EY9 A;  5ELO A;  1E24 A;  5C6A A;  1Y1V H;  3NBH B;  3H0G B;  1HR0 Q;  1T9H A;  2FFK B;  5GRO A;  2E2I H;  3K0X A;  4BY1 H;  2NZ1 D;  2OXP A;  4J15 A;  2YYZ A;  3S2D H;  2GVA A;  1SYE A;  5BR8 Q;  1AE3 A;  4QMG A;  2R61 A;  1CI3 M;  3I91 A;  4JI6 Q;  4DV7 L;  3OIP A;  4JBM A;  1LTL A;  3E3X A;  4RGN A;  1CKN B;  3GTL H;  4A93 B;  2WP8 J;  2F0V A;  1NR2 A;  1DYQ A;  4C3I H;  2NYZ D;  1X56 A;  1EIY B;  4ABN A;  1SFO B;  2EJG C;  4N8F A;  2EYP A;  1TY0 A;  3PGZ A;  5L37 A;  3A0J A;  1LM0 A;  2ICI A;  4DR6 Q;  2RCF A;  1KQS A;  1C48 A;  4C3J B;  1O78 A;  4X64 Q;  3KDF A;  1RHP A;  1TS4 A;  3CC7 A;  3FKI H;  1FVI A;  4KD4 A;  3J81 E;  4X66 Q;  1GHJ A;  5IGG A;  3CQZ H;  1ROD A;  1I50 H;  1KC8 C;  2JE6 I;  3JAM L;  1BNZ A;  1ICW A;  1DJR D;  2F0H A;  2MHV A;  4HID A;  1E2W A;  1PMR A;  1LAB A;  2KHI A;  5FO8 B;  4A3B G;  5CMD A;  3G6E A;  2UXC Q;  3J80 E;  4FP5 D;  2N8N A;  5GAG C;  4A3E G;  2OWO A;  4DR1 L;  2B8F A;  1B3A A;  1KNA A;  2KBN A;  1E7Z A;  4QIW E;  2IL8 A;  2HCI A;  1M90 C;  1N36 Q;  2VB2 X;  2KCM A;  3OYY A;  1NMG A;  5I2X A;  2RDF A;  1F9R A;  4BWG B;  5A2Q L;  3HOW H;  1CQV A;  2FJ2 A;  4RCO A;  3RLO A;  3F2U A;  3L3O C;  3RR5 A;  5C4X H;  4DR3 L;  4PMC A;  4K6L A;  1SE4 A;  4C3H H;  1PH1 A;  3NBI A;  4IN3 A;  2F4V Q;  1IW7 C;  1P16 A;  1H9M A;  4MN3 A;  1IBL Q;  4X62 L;  3BVM A;  1MI2 A;  1XTC D;  1BDO A;  2R92 B;  4KN7 C;  1EL0 A;  1N32 L;  4DNT B;  1PZJ D;  1GUS A;  4C2M B;  2CKZ B;  1WFQ A;  1G2T A;  4DK3 C;  2R6G A;  1F2Y A;  4GS3 A;  2RF4 A;  1WJJ A;  1RJT A;  3E5S A;  1O7Y A;  4LUO A;  3RN2 A;  3TQY A;  4EQO A;  4DK6 C;  4R8I A;  3W2D A;  2CWA A;  3D8G A;  1SE8 A;  2VUM G;  3S16 B;  3M7N A;  4IPD A;  1XNR L;  3S1R H;  1WTO A;  1PH5 A;  4UAI A;  1Z9F A;  1QVF A;  1D8L A;  2TMP A;  4YIJ A;  2EJF C;  4C1N K;  2E5L L;  4ID6 A;  5EAY A;  1V1P A;  1U9R A;  1PYW D;  2F0K A;  1GJX A;  5JPN C;  2V1C C;  1ZYR D;  4A3B B;  3SK6 A;  2F0O A;  4WOR A;  3GTQ B;  1CM9 A;  5C3X A;  4A3E B;  1JQY D;  3MWY W;  2I07 B;  3S1N B;  2J0T D;  2K28 A;  1SR3 A;  2NVT H;  1PRT B;  1UEB A;  5M5Y H;  4CDD C;  3J81 i;  1BUV T;  4IO9 A;  4DUY Q;  1TWH H;  2L11 A;  2AMC B;  3M9B A;  3MA2 B;  1NNX A;  1U4P A;  1X9N A;  1HFN A;  2DJF C;  3HKS A;  3E0J A;  3BG3 A;  3S1M H;  2B63 G;  3E9I A;  3K5L A;  1K83 H;  4JPB W;  3U58 A;  3I4M H;  5C3E B;  3SR1 A;  2AWO A;  2EY2 A;  3D0F A;  3J80 i;  3HKZ B;  1NR4 A;  4LNQ A;  1GUT A;  2D9U A;  3GDE A;  1JJ2 A;  3HOU G;  4XYQ A;  2VL6 A;  1VQ6 A;  1PH7 A;  4ZAI A;  2VS1 A;  4KLK A;  4X6A H;  3HOY G;  3TP7 A;  1B50 A;  1MHW C;  1UNS A;  1O7I A;  1IBM Q;  4YY3 L;  1S5E D;  1H9J A;  5C3W A;  2QW7 A;  1FL0 A;  2R93 G;  2LS0 1;  2MP1 A;  4A3D B;  4Z9C B;  4R1J A;  3DM1 A;  1JOO A;  3EFX D;  2RKS A;  1YVC A;  2NVQ B;  1F9Q A;  4HJ8 A;  1K3R A;  1MGS A;  1UEA B;  3MFY A;  5AJ3 Q;  5DNF A;  3M85 A;  1HZ9 A;  1F2M A;  5EBC A;  4U67 3;  1NCV A;  4IUR A;  2VUM B;  2JXM B;  4QY7 A;  2K33 A;  3I4O A;  2IPK D;  5FLX c;  2JA9 A;  2WB1 G;  4KTA A;  3S2H B;  1QCB D;  1L0W A;  3MEH A;  5M3M G;  2RDG A;  2Y0S G;  3A5Z B;  5M3F H;  3U50 C;  4DV5 Q;  2X69 A;  3RZO B;  2XRQ D;  2PW5 A;  3ND8 A;  2UXB L;  1ICF B;  5J3B A;  2AUK A;  4DV3 Q;  3HKZ E;  3CHB D;  3U9S A;  2ZM6 L;  1S5D D;  3HOX G;  3HGB A;  1BKB A;  3A8K E;  3WOE A;  2PQE A;  1JJC B;  3A7L A;  3KK7 A;  5ELB A;  1K0R A;  4LF9 Q;  5LMN W;  1B70 B;  3HG9 A;  3SK4 A;  4OX9 L;  5IYB G;  2QA4 A;  3KLS A;  4XQN A;  2JA5 H;  1X32 A;  1L2F A;  4DR5 Q;  4B3R Q;  5JVH 3;  3HFZ B;  3I8Z A;  1CZG A;  1E1T A;  3TP6 A;  4OGQ C;  1G51 A;  2RVL A;  4JCV E;  4XDX A;  2ZJR A;  4IUQ A;  4XYO A;  3ZJY C;  5D3D A;  4LF4 Q;  1HFG A;  2DNE A;  2A6E D;  1A15 A;  1EU3 A;  4LWC A;  4OEL B;  3MXU A;  2F03 A;  1P8L A;  3O13 A;  2A1A A;  1LTI D;  4DR7 Q;  4K2K A;  1Y1W H;  5EKL A;  3HOZ H;  2Q8R E;  4K5W A;  3J81 L;  1U0L A;  1PH9 A;  1CSQ A;  5H1S E;  2B2U C;  2DNC A;  2F0L A;  1FGU A;  3HOY B;  1UWV A;  2FXQ A;  1D2B A;  3I4L A;  1N33 L;  2R93 B;  1YBY A;  1N34 L;  5NUC A;  3NP8 A;  1TWC H;  1JJG A;  3J80 L;  3T1H Q;  2WAQ G;  4A3G H;  2CQA A;  4BBS B;  1H9R A;  3UI2 A;  4R4Q A;  5FLM H;  2ZT9 C;  1R9T H;  3PIP 3;  1W6K A;  4IUT A;  2VQF L;  1PTO C;  2BCO A;  3S17 B;  5M3M B;  3P20 A;  3H3V H;  1Y1V G;  2UUC L;  1VF7 A;  1EFW A;  1ET6 A;  4XQJ A;  1D6E C;  2NWG A;  4B3T Q;  3GTK B;  4IUP A;  4BY1 G;  1RL2 A;  1QE6 A;  1ML0 D;  2PYK A;  4K0K Q;  2NTT A;  2WKC A;  1RTN A;  1BCP D;  3OOC A;  1CKO A;  3N6R A;  1HCZ A;  3NE5 B;  2D5D A;  2A19 A;  4DFA A;  1GUO A;  5JJZ A;  2Z6K A;  4HJ7 A;  4RCN A;  2H5X A;  1F9P A;  4JW0 A;  1IKL A;  2A5H A;  3GD7 A;  1HR0 L;  1AZQ A;  3NSW A;  2HUG A;  2KVM A;  1B4O A;  4CGY B;  3K80 C;  1KTK A;  1SLJ A;  3K5O A;  1SNQ A;  4K5V A;  3C2P A;  4C3I G;  1QIL A;  1GVP A;  1STN A;  3H09 A;  1I3Q B;  5C4Z A;  5BR8 L;  2G9H D;  1SSO A;  3LWE A;  4K8I A;  4JI6 L;  2KA7 A;  3Q6S A;  3KFU A;  1B2T A;  3Q8D A;  5DAU A;  5JAV A;  2RSO A;  1C7Y A;  3K6O A;  4J8Q A;  2KEE A;  1Q8K A;  5D65 A;  5IGF A;  3H3V I;  3I90 A;  2JK8 A;  1XYI A;  1EQV A;  2G9D A;  1SRU A;  3TZU A;  2Q2T A;  4JOI C;  4F87 A;  2KCT A;  2QEJ C;  1KRT A;  3T1Y Q;  3NQT A;  4OXP A;  2B2U A;  2K14 A;  3T4A C;  1XPU A;  3S15 B;  4ZRZ A;  5FJ8 H;  4AYB G;  1V1Q A;  1ENA A;  1I4R A;  3S24 A;  1WTQ A;  1O7L A;  2LY7 A;  4R9W A;  5IP7 H;  3GTJ B;  2B2Y C;  4HCE A;  5LL6 S;  2HHH Q;  4PMW A;  3C3L A;  3M4P A;  4TKO B;  4DR6 L;  2M00 A;  1KDA A;  2CH4 W;  2Z4I A;  2EZV A;  3D4R A;  5IY0 A;  1JMC A;  1EYC A;  2D0P A;  4X64 L;  1CQF A;  4LMQ D;  1VQM A;  2K52 A;  3Q0A A;  1SDF A;  4JK1 C;  2Z6B A;  5FKA C;  1TT2 A;  3CKI B;  4A3F H;  4X66 L;  1LUZ A;  2MJ8 A;  4POF A;  4KK7 A;  2JSO A;  3TSS A;  3PUX A;  4RWS C;  4HJ9 A;  2J4X A;  4JV5 Q;  1PH2 A;  4OL7 A;  3DUZ A;  1VQ8 A;  1QNU A;  1KRS A;  1Y1V B;  2Z8L A;  3DM3 A;  5JJK A;  3CCS A;  5EPL A;  3PSI A;  2KQ3 A;  2GA4 B;  2E2I B;  5DM7 3;  3VR3 A;  3VR2 A;  3L9A X;  1HNZ Q;  2UXD Q;  5HUR A;  4BY1 B;  2UXC L;  5I9P A;  2ZJQ A;  1B7Y B;  3PUV A;  3OIQ A;  3I55 A;  1EQR A;  1I4P A;  2LKV A;  3DWQ A;  3S14 H;  5D3I B;  1N36 L;  1QUQ A;  4KKS A;  4DV6 L;  1C4Q A;  1DCZ A;  4O2D A;  3A7A B;  5KYI A;  3GTL B;  1BQQ T;  2R7Z H;  4DKA C;  4C3I B;  5KNB A;  1K73 C;  3GTO H;  2NN6 G;  1ENF A;  3H0G G;  2F0E A;  4P75 A;  5FLX E;  1QVG A;  5IYC G;  1IL2 A;  2MPM A;  1IXR A;  4DUZ Q;  3VA7 A;  3TDQ A;  2EOT A;  4BY7 H;  3VYS A;  4JI5 Q;  3MEF A;  2F4V L;  1IBL L;  2XGT A;  4LFC Q;  4NMZ A;  1Q1B A;  2RQX A;  1I6V C;  1F9S A;  4ILW A;  4HIO A;  1VQ9 A;  1A3U A;  3VR6 A;  1PFS A;  3FPP A;  3FDT A;  1TQO A;  3H94 A;  1HUN A;  2OF1 A;  2CW0 D;  4AYB B;  4A93 G;  3FKI B;  3V05 A;  1NSN S;  1SN8 A;  1L1O C;  4NP5 A;  2K05 A;  3PO3 H;  1TKW B;  2RHS B;  2B2Y A;  1V8Q A;  2JA6 H;  3CQZ B;  1KXL A;  1PLF A;  2Q2U A;  2D62 A;  1I50 B;  1STH A;  2KHS A;  2XTI A;  3HOV H;  3AFQ A;  4JI3 Q;  4L5R C;  3I56 A;  4PMB A;  4C1N I;  3F2D A;  4A76 A;  4OO1 G;  2MFI A;  1C9O A;  2N49 A;  3W1B A;  2JA8 H;  1I4Q A;  3SEB A;  3M4Y A;  3DXJ C;  3EBE A;  3HRZ C;  4JI4 Q;  1VQC A;  1AN8 A;  4C3J G;  1KNE A;  1TVX A;  3BDO A;  1NMF A;  3KF8 A;  1VDZ A;  4DV0 Q;  2P5Z X;  4FF2 A;  1VQG A;  1VQO A;  2IJ0 A;  2F0W A;  5HGQ A;  2CH4 A;  2BA1 A;  3PIO A;  1VQE A;  3HOW B;  1JC7 A;  4YHH Q;  2RSN A;  3G4S A;  3W5O A;  1WTH A;  5ELD A;  2O5I C;  4DUY L;  5C4X B;  1G6Z A;  2K75 A;  1VQB A;  4C3H B;  3GP7 A;  3OTO Q;  4K14 A;  2PPB C;  2K5D A;  3SDZ A;  1SYF A;  5FO9 B;  3QJY A;  1U4R A;  1XPR A;  1W2B A;  3Q24 A;  1Q90 A;  1X3Q A;  4A75 A;  2DY8 A;  1AH9 A;  2R7D A;  1RDP D;  1I4X A;  1II3 A;  2MGS A;  3E0E A;  3T16 A;  5KND A;  4FF4 A;  4WJW A;  1JE5 A;  1ZYR C;  4ZCK A;  1HNX Q;  5IWA Q;  1G91 A;  3C1E A;  1SRO A;  3CP0 A;  2GVB A;  1WD1 A;  1R4P B;  1IBM L;  3A5U A;  1PRT D;  2K5V A;  3H6M A;  3SXH A;  2F52 A;  3A8J E;  4A3L G;  5DM6 3;  1B3Q A;  1BBW A;  4V19 0;  2F0P A;  5LMN Q;  3I2Z A;  1L1O A;  2DY7 A;  2JYO A;  3S1R B;  3CCU A;  3NXW A;  4K2L A;  1LYL A;  4NXN Q;  2F0G A;  3UDF A;  2R92 G;  5AJ3 L;  1ASZ A;  5HGT A;  4QIW B;  1SJE D;  1A0I A;  3I4N H;  4P72 A;  1CFM A;  3ULL A;  5IGB A;  4FF1 A;  1NJI C;  2PI2 E;  5IP9 H;  4U68 A;  2L4N A;  1H9S A;  1FGB D;  2A68 D;  2FHT A;  1ILP A;  1GUW A;  1HPC A;  4DAV A;  4NPS A;  1V9P A;  4DV5 L;  1EU4 A;  3MVV A;  3ONA B;  2K32 A;  4QCL A;  1JOR A;  1UE6 A;  4C56 C;  1KHI A;  2PZW A;  2NVT B;  5M5Y B;  3JC6 6;  5EJW A;  4OWW B;  1TWH B;  2F3W A;  3BZD B;  3KJP A;  1CA5 A;  4DV3 L;  4IFD G;  2QCP X;  3Q23 A;  3BZK A;  2F3V A;  5CV9 A;  3S1M B;  3NWT A;  3OW2 A;  4PG3 A;  2CFM A;  1SYB A;  1RCV D;  1SXT A;  3TBI B;  5FOB B;  3AMU A;  3RLF A;  4EVO A;  4B3R L;  4DR5 L;  1X6O A;  4EQP A;  4RHS A;  3IAY A;  4ZK9 B;  2NVX B;  1PZK D;  2KCC A;  4IUN A;  1E2Z A;  2PQA B;  5C44 H;  4N9T A;  3PF5 A;  4KHZ A;  5IGE A;  1KDB A;  3CD6 A;  4LF4 L;  2H4O A;  1K3B C;  2OT2 A;  2KJX A;  2L12 A;  4DR7 L;  5K5P A;  2I5M X;  3G48 A;  3AEV A;  3NUC A;  2WKD A;  1VQN A;  1NUC A;  1TU2 B;  3QIA A;  5C3E G;  1OXX K;  2K5N A;  4ODG A;  4YWM A;  2FIN B;  3HKZ G;  2BA0 A;  4OWX B;  4JI1 L;  4GLX A;  1S5B D;  2SNM A;  1A62 A;  4A3K H;  4X65 Q;  2EY5 A;  3C1F A;  4JBW A;  1FJG Q;  4CKB A;  3MAQ A;  2I0Q A;  2NVY H;  2Z1C A;  5E3F A;  4DPG A;  5BN5 A;  5M3F B;  3CCM A;  3T1H L;  1L0X B;  3Q22 A;  1H9K A;  3RD4 A;  2A6E C;  3G6J B;  3A55 A;  3GTM H;  2ICE C;  3UDX A;  4A3D G;  4KJN A;  1JT8 A;  2QDL A;  4LFA Q;  3ULP A;  1QZG A;  3PO2 H;  2HDM A;  3J7Z C;  3M4O H;  3M3Y H;  1NTG A;  2HT1 A;  2IX3 A;  4UHV A;  4HIM A;  3F1Z A;  4F7X A;  1S5C D;  3MXN A;  4HMI A;  2XSC A;  3OHX C;  1T5E A;  4I7A A;  4IUU A;  2K5Q A;  1UUP A;  4KJO A;  3KBX A;  5IT9 E;  1YIJ A;  2Q2I A;  4GOP B;  1QB5 D;  4B3T L;  4CJ2 C;  5K36 H;  2PZT A;  2JA5 B;  5C5M A;  5IE8 A;  2ZXP A;  4S3S A;  1SYD A;  4K0K L;  2SOB A;  1WCM H;  1AZP A;  3NK9 A;  1VQI A;  2YU9 H;  1LV9 A;  4GNX B;  3B6Y A;  4AQY Q;  1BO0 A;  1Q12 A;  1RKN A;  2ZTC A;  3KF6 A;  3AU7 A;  1XWE A;  2O2L D;  1EZ8 A;  3TEH B;  3CW2 C;  1HA6 A;  5E1F A;  5EQ0 A;  5ISR A;  3K58 A;  3HOZ B;  1HRJ A;  3UDG A;  4EQN A;  2SNS A;  4OIJ A;  2EIF A;  4EQ5 A;  4QF4 A;  2K5H A;  2XN9 C;  4F8M A;  3GTG B;  1YNN D;  1D7Q A;  1ESR A;  1PA6 A;  4BXX G;  1X55 A;  4IAL A;  4DAY B;  3JAM c;  2VQE L;  1EZ6 A;  2UU9 Q;  3CU7 A;  2SDF A;  4IJH A;  3GO5 A;  4QL5 A;  1TWC B;  1BCP C;  1QJO A;  2CHB D;  4DV1 Q;  4A3M H;  1IZ6 A;  1A8V A;  3T1Y L;  3QOL A;  3CCR A;  4LF8 Q;  1YNJ D;  1WOC A;  4A3G B;  5C0X H;  3LNN A;  2F0M A;  3MC0 B;  2I46 A;  1BBU A;  2B2T C;  1R9T B;  4A3F G;  4MNO A;  1JCK B;  3V96 A;  2KEC A;  1QOH A;  4L6T B;  4RGO S;  5I6W A;  2HHH L;  2A74 C;  2ZJP A;  3FP9 A;  1PXU A;  2B3G A;  1HJP A;  4FNF A;  3SE0 A;  3CRK C;  4IOA A;  2A73 B;  1SNO A;  2K7V A;  1O7Z A;  2EE1 A;  1EY4 A;  4A3J H;  1WTR A;  4RAU C;  2EY1 A;  4A3I H;  3MXG A;  4Y7N H;  4LF5 L;  4CKE A;  1VQA A;  4BBS G;  4A3C H;  1QWY A;  2JEA I;  1Y69 U;  2A8V A;  1B53 A;  1LTA D;  1TS3 A;  1VQF A;  4TVA B;  1HNZ L;  2UXD L;  4FF3 A;  1EEI D;  5C0X I;  2O5J C;  1DZ1 A;  1PTO H;  4FVM A;  2F0D A;  5DEH A;  1BCP F;  2UUA Q;  1EYD A;  1Q7Y C;  1Z6H A;  4TRD A;  4LW1 A;  1EIG A;  2K01 A;  3RN5 A;  1Q86 C;  2AWN A;  3OWE B;  1TWA H;  1Y8P B;  3CF5 A;  1F2Z A;  1HQM C;  1HR0 W;  4RGT A;  1K8G A;  2QF7 A;  2F0S A;  1PFM A;  1GUN A;  1EEF D;  2TSS A;  3VR5 A;  4DUZ L;  4E6I A;  3KLR A;  4GZY C;  4JI5 L;  1A6X A;  1S4Z A;  4LUV A;  4YCV A;  2PO4 A;  4LFC L;  1AFP A;  3VA5 A;  5COY A;  1D5M C;  4BA2 I;  1HTP A;  3L2P A;  3PF4 A;  4L63 B;  3J7A V;  4Q0F A;  5CBA E;  2B2T A;  1H95 A;  1VQ5 A;  1S72 A;  4A3F B;  5J39 A;  2KOL A;  1AE2 A;  2EYM A;  2Z9H A;  5LHY 1;  1JWM D;  4N9P A;  4MZ9 A;  4JI3 L;  4DN4 M;  4OHJ A;  4P2C B;  4ZKB B;  3AQQ A;  1KIX A;  2AKW B;  1D1I A;  3EQL C;  5JEA G;  3KYH C;  3KDF B;  1A3V A;  3AYH B;  3KOJ A;  1A3T A;  1U5K A;  4JI4 L;  4HED A;  1Z7T A;  3IFD A;  3I7F A;  3S14 B;  3U4Z A;  1HNW Q;  2G5D A;  1VQD A;  3X3N A;  2NZH A;  3NBH A;  4DV0 L;  4ZUI A;  4HR7 B;  2CW0 C;  1YZ6 A;  3S9W A;  5M9O A;  1SE2 A;  2CWP A;  2R7Z B;  2F0N A;  4K6D A;  3R3O A;  4Q5V A;  3GTO B;  1BOS A;  4YHH L;  3BYY B;  4M8A A;  2F4I A;  2X6G A;  4YCU A;  1CHQ D;  1YNX A;  1LTT D;  2B2V C;  2EQS A;  4DNR B;  3ICE A;  1PYB A;  2BOS A;  4DNI A;  4NXM Q;  1VQH A;  2F0U A;  3OTO L;  4BY7 B;  1E2V A;  1CKN A;  3GV3 A;  1D5Z C;  2VNU D;  3TN2 A;  4GLV B;  5CBE E;  1EY6 A;  2L0C A;  2L55 A;  1TS5 A;  4PNY A;  1W6J A;  2IHF A;  4HCS A;  5I2Y A;  1STY A;  1EOT A;  4ZQ3 A;  4H13 C;  1IYV A;  1WTP A;  2Q2H A;  4N8X 1;  1JWU D;  1S40 A;  3PQI A;  5EKK A;  2ZTE A;  1HNX L;  3PO3 B;  2IW3 A;  3RUZ A;  2JA6 B;  1KAA A;  5IWA L;  1EUJ A;  3HOV B;  2OTJ A;  3K7A H;  4DXG A;  3NQI A;  4CJ1 B;  1FNW A;  3I3C A;  1SBB B;  3NWS A;  5IP9 G;  2WFW A;  4CHT B;  2BH2 A;  4IPG A;  4XXE A;  5KYL A;  3CCQ A;  3CC4 A;  5LMN L;  2JA8 B;  5IGD A;  4L8J A;  1MIU A;  2LXJ A;  4MTK A;  4CDF C;  4NXN L;  3HZX A;  2J7Z A;  3NPP A;  3ITP A;  3CC2 A;  1AW7 A;  3PUZ A;  5J22 A;  1STA A;  4R4I A;  3FKI G;  4B08 A;  4Y52 H;  5JJL A;  1T5X D;  1LAC A;  1ILQ A;  4OWT B;  2EY6 A;  2LFN A;  1Y8O B;  1DXM A;  4JI0 Q;  1SJH D;  4GKJ Q;  1NE3 A;  2EXZ A;  4RG1 A;  1GXD C;  1STB A;  5D14 A;  2N78 A;  1VQL A;  2YV5 A;  1PDQ A;  4XT1 B;  1VQ7 A;  3J81 c;  2K6A A;  3JAM E;  1E22 A;  2VY3 A;  1PRT C;  4DF7 A;  4MHE A;  2D2C C;  1JB3 A;  2Y0S E;  1K8A C;  3M4Q A;  4DV4 Q;  3LGJ A;  4KD3 A;  1WVL A;  1V1P B;  3K0Y A;  1YHQ A;  1UE5 A;  1G8Z D;  1K0S A;  3F8T A;  2XWJ B;  4ZKC B;  1XJV A;  3RZD H;  2MUY A;  1LTG D;  5T1I A;  3J80 c;  1MSH A;  2B2V A;  2PMZ B;  2B63 H;  2K04 A;  3CXC A;  5DLQ E;  2SEB D;  3T53 B;  1J5E Q;  1ASY A;  4OON A;  4PZ7 A;  1VQP A;  1A2U A;  2A68 C;  3SGI A;  2ZTD A;  4G7O C;  3HOW G;  2GN5 A;  3S2D B;  2OTL A;  2L9H A;  2WAC A;  3D4D A;  2IY5 B;  4DR2 Q;  1I94 Q;  3HOU H;  5C4X G;  2K1B A;  4C3H G;  1JOK A;  1TII D;  4OEM B;  1HZA A;  3KJO A;  4YCW A;  2K4K A;  1B8A A;  4F88 A;  1V1O A;  1VMP A;  4IOC A;  1J8I A;  2BH8 A;  1CHP D;  4BBR H;  2UUB Q;  5EGT A;  1S5F D;  3K5N A;  4WJ4 A;  3K8A A;  1N9W A;  1OXU A;  1PFN A;  3I4N B;  2JEB I;  4GN3 B;  1CTM A;  3CCE A;  3PO2 G;  1TXY A;  2UXB Q;  3BZC A;  4G7H C;  1PRT F;  4X65 L;  1GHK A;  2A69 D;  1FJG L;  1SAP A;  1I4G A;  2QIL A;  1VCI A;  2Z0S A;  4JOI A;  4JI2 Q;  3NTH A;  4XQQ A;  3CPF A;  5I9O A;  1NBW A;  4PZ8 A;  1RTO A;  2PMZ E;  4LFA L;  1BVS A;  4IFD J;  4LUZ A;  1SNP A;  3GTK H;  5JOB A;  1LTR D;  2R3Z A;  3DWA A;  2IWH A;  2WAQ E;  4CDC C;  3A56 A;  1QNK A;  4KHP Q;  4KY5 A;  2HDL A;  3BDL A;  3DEO A;  4R8N A;  1WYD A;  2R7F A;  1BXT A;  1TS2 A;  3HOX H;  3NTI A;  4MIU A;  1PH8 A;  2ES2 A;  1FR3 A;  1XNQ Q;  5ELF A;  1SE3 A;  3BVG A;  2MO1 A;  3HS0 C;  4RKL A;  2OQK A;  2YTV A;  3RNU A;  3ER0 A;  4CBV A;  5FO7 B;  1N8R C;  4ME5 A;  5IYB H;  1EY0 A;  5C44 B;  4O1N A;  3LWU A;  1HUM A;  3URY A;  3UDI A;  1DOK A;  1GD7 A;  4APV A;  1XMQ Q;  2Q8T A;  5C4H A;  2KED A;  2E2J H;  3D31 A;  3SK8 A;  5M5X H;  1KAW A;  3TME A;  3OWF A;  3PV0 A;  2EYF A;  3VR4 A;  3I4M G;  1R4Q B;  1I6H H;  3RMH A;  5C0X G;  3EVQ A;  1Z47 A;  4UPA A;  3H91 A;  3HEJ A;  1JIC A;  1VQJ A;  1U4M A;  3BVZ A;  3L7Z C;  5EBD A;  4TQU S;  2UU9 L;  4LF6 Q;  3NTK A;  5T1G A;  2NVY B;  1SMY D;  4DV1 L;  4O42 A;  1XX8 A;  4LF8 L;  3S1Q H;  4H7B A;  3SVM A;  3GTM B;  4R4C A;  3CRL C;  1OO9 B;  2E76 C;  2D0O A;  2M2L A;  1MJC A;  1ZEQ X;  4KI0 A;  4NW2 A;  3PO2 B;  4QQB X;  3M4O B;  3M3Y B;  2VXW A;  4B3S Q;  2A6H D;  4KN4 C;  4QUF A;  3M7G A;  4BS9 A;  3ERO A;  4DU9 A;  3AFP A;  1PH3 A;  1EFI D;  2AHO B;  3QR8 A;  1LLR D;  1YNN C;  4IJL A;  3CME A;  5TSS A;  1DD2 A;  4HJ5 A;  4FXK C;  1STG A;  1JR0 D;  2F0F A;  4B9X A;  1AEX A;  1PYS B;  3D6W A;  5E4W C;  2PZU A;  5M3F G;  1K8O A;  1I4H A;  1WCM B;  1HH2 P;  3STB D;  2YU9 B;  2BDN A;  2EVB A;  2K03 A;  1RF2 D;  1YNJ C;  2NZO A;  2MO0 A;  2ID0 A;  4J1M A;  1K8M A;  1TWG H;  1HQR D;  1JB7 A;  4EX5 A;  5IOC A;  1EWI A;  5LMU Q;  1PVO A;  1XTD A;  3ULJ A;  2ZXO A;  5I6Y A;  3EN2 A;  1SMX A;  1Y14 B;  3QG1 A;  4B3M Q;  4LF7 Q;  4PZ6 A;  2UUA L;  3PIP A;  3FVQ A;  2JA5 G;  3EIV A;  3T13 A;  3N52 A;  4XT3 B;  4AH6 A;  3PUY A;  4ZYS A;  3X3M A;  2HQL A;  2E74 C;  1EWC A;  2E8G A;  5IYD H;  4B9W A;  4A3M B;  5CV6 A;  1K83 B;  5CV4 A;  4ZUJ A;  1S3O A;  3I4M B;  4JYA Q;  1YIT A;  4LF9 L;  1SEB D;  4DAM A;  5HY6 A;  4WRD A;  1Y1W G;  4JI8 Q;  3HOZ G;  3DLL A;  1K9M C;  4RHR A;  4DV2 Q;  2JN4 A;  2BE5 D;  3D6C A;  1STE A;  3W1G A;  2JQO A;  1G6P A;  2KHJ A;  1A63 A;  5KIX A;  4A3J B;  1RIP A;  4ME3 A;  1LTB D;  1O80 A;  2VZA A;  1F77 A;  1C0A A;  2CCZ A;  2LXK A;  4A3I B;  4Y7N B;  4RFB A;  5G3L D;  1B1Z A;  1YHB A;  4JI7 Q;  1SNC A;  2B2W C;  2JA7 H;  1CUK A;  4A3G G;  5FLM G;  4BA1 I;  2CQO A;  4HSV A;  1CT1 D;  1EQQ A;  2F0J A;  1TWF H;  4DV6 Q;  1KDC A;  5J1Z A;  1PTO B;  2X6L A;  4I65 A;  3OPO A;  1HNW L;  1WD0 A;  1M8A A;  3IFT A;  2KEN A;  1CZW A;  3CAM A;  2EJM A;  1M1K C;  5C4J H;  3BS1 A;  3GTP H;  4H44 C;  3QOJ A;  3PCO B;  3NEN A;  5KGU A;  3E6Z X;  1VQK A;  3FHW A;  1W3S A;  5M5W H;  2NBF A;  1LT4 D;  1TWA B;  3R93 A;  2PW7 A;  1MKH A;  4DAP A;  2JP1 A;  2E2H H;  2NTS A;  3QO2 A;  1YEZ A;  4WFN 3;  1WTV A;  2ATW A;  1HHV A;  1XPO A;  3SK5 A;  4NXM L;  3IL8 A;  1GKH A;  2N3S A;  2NN6 H;  5FLX L;  3G71 A;  3H0G H;  4KY7 A;  5KRU A;  4RH6 A;  1QUQ B;  4JBJ A;  4RMF A;  1WI5 A;  4ALP A;  1A2T A;  2N88 A;  1B44 D;  1TR5 A;  3ZYY X;  5IYC H;  4RGM A;  3TZD A;  4IPH A;  4ZLT F;  4LFB Q;  4OIK A;  3A74 A;  1IBK Q;  4GKK Q;  2CVR A;  2OQ0 A;  1Y1W B;  4FO2 A;  3J7A F;  4DR4 Q;  4X3U A;  1HXY D;  1NY4 A;  1LT3 D;  1SYG A;  4KMU C;  4A93 H;  3T51 B;  1XMO Q;  4PQX A;  5FJ8 G;  3I72 A;  3VYT A;  3J7A 5;  3TS2 A;  5JEA J;  4M1U B;  5IP7 G;  3CCJ A;  1SFO H;  1DOL A;  2L5T A;  4X3T A;  4OO1 H;  2F1M A;  4QB4 A;  3R2I A;  4GLA C;  2B2W A;  3F2C A;  2NN6 I;  3J7Y W;  5EPK A;  1MJE A;  1G29 1;  4C3J H;  2FMC A;  3FPU B;  2HIX A;  2QGQ A;  1CA6 A;  3K81 C;  3KBG A;  3A8I E;  1X3F A;  2L1B A;  4JI0 L;  5EPJ A;  2EPB A;  4GKJ L;  1QVC A;  3U4V A;  2YTX A;  2L15 A;  3BYT B;  3FRP B;  3TS0 A;  1J9O A;  4QUC A;  5EKI A;  2ENB A;  4DV4 L;  3KF8 B;  3SHL A;  4ULL A;  1EOV A;  1JE4 A;  2FMM A;  4KY6 A;  3W3A A;  2OCE A;  3BU2 A;  1EQT A;  2AUJ D;  4JV5 L;  1JOQ A;  2NVX H;  3IKJ A;  1OXS C;  3IRB A;  2ASB A;  2WV6 D;  1EIF A;  4OO1 I;  3DWP A;  2E2D C;  5CC4 A;  2R7Z G;  4DV7 Q;  2QEX A;  4BBR G;  1J5E L;  4V0B A;  1IKM A;  1WTW A;  1KAB A;  2HD3 A;  3I73 A;  4I7Z C;  2N55 A;  4DR2 L;  3K7A B;  1I94 L;  2Z4H A;  1DON A;  2JJQ A;  1DM0 B;  1OTC A;  1JWS D;  2PCF B;  4BY7 G;  1D1K A;  3EA6 A;  3R8B A;  2IT1 A;  4XIG S;  4UP7 A;  1IHZ A;  3CCV A;  5KEE A;  4HMJ A;  4YWL A;  2UUB L;  4UP8 A;  3OW7 A;  4A3L H;  4HJA A;  1EY7 A;  3NEL A;  2OEO A;  1CSP A;  1X65 A;  3ERQ A;  2R92 H;  4JG2 A;  3PIO 3; 
#chains in the Genus database with same CATH homology
 2N78 A;  2YV5 A;  3PO3 G;  4X62 L;  2K75 A;  1VQB A;  3OTO Q;  2JA6 G;  1VQ7 A;  3J81 c;  1E22 A;  2VY3 A;  4C2M H;  3HOV G;  4P73 A;  1XPR A;  1L1O B;  1W2B A;  1E1O A;  2Y0S E;  1N32 L;  3PUW A;  1K8A C;  3M4Q A;  4DV4 Q;  4JI2 L;  3LGJ A;  4A75 A;  1HZB A;  2Z6K C;  1AH9 A;  2R7D A;  1YHQ A;  1Q46 A;  1UE5 A;  2CKZ B;  1WFQ A;  4JC0 A;  4DK3 C;  2R6G A;  2JA8 G;  4GS3 A;  2RF4 A;  3F8T A;  1WJJ A;  3E0E A;  3S16 H;  4R4O A;  4LUO A;  3RN2 A;  3TQY A;  1XJV A;  3RZD H;  4DK6 C;  1JE5 A;  2CWA A;  3J80 c;  2I5L X;  1PV4 A;  1HNX Q;  2B63 H;  1YJ9 A;  1SE8 A;  2VUM G;  4KHP L;  3J81 j;  5IWA Q;  3CXC A;  5DLQ E;  1SRO A;  3CP0 A;  1J5E Q;  2GVB A;  1ASY A;  4OON A;  4P71 A;  4PZ7 A;  1VQP A;  3SGI A;  4DR1 Q;  1IBM L;  2ZTD A;  4IPD A;  3A5U A;  1XNR L;  2K5V A;  3HOW G;  1XNQ L;  2GN5 A;  4A3K H;  3S1R H;  2OTL A;  2F52 A;  2PI2 A;  4GKJ L;  4A3L G;  2IY5 B;  4DR2 Q;  1PH5 A;  1BBW A;  1I94 Q;  3HOU H;  5C4X G;  1Z9F A;  5LMN Q;  1QVF A;  1D8L A;  3I2Z A;  3BJU A;  1L1O A;  3CCU A;  1UE7 A;  2E5L L;  1HZA A;  1LYL A;  3KJO A;  4YCW A;  4NXN Q;  2K4K A;  1B8A A;  5EAY A;  3UDF A;  4A3B H;  2R92 G;  4UP9 A;  3UE0 A;  5AJ3 L;  4L5S A;  1ASZ A;  4IOC A;  3GTQ H;  2BH8 A;  2V1C C;  1XMQ L;  3K7U C;  3WWV A;  4BBR H;  4A3E H;  1YHA A;  2UUB Q;  1A0I A;  3I4N H;  3GTG H;  4P72 A;  3S1N H;  2LSS A;  3VDY A;  4WJ4 A;  3K8A A;  4JI1 Q;  3ULL A;  4DR3 Q;  1N9W A;  1NJI C;  5GAE C;  2PI2 E;  3CMA A;  1OXU A;  3L0O A;  5IP9 H;  2JEB I;  4GN3 B;  3PO2 G;  3CCE A;  2NVT H;  1SR3 A;  1TXY A;  1UEB A;  5M5Y H;  3J81 i;  4IO9 A;  2UXB Q;  3BZC A;  4DUY Q;  4NPS A;  1TWH H;  1V43 A;  1V9P A;  3M9B A;  2AMC B;  4L5T A;  4QJF A;  4X62 Q;  4X65 L;  4DV5 L;  1FJG L;  5GAH C;  1UE6 A;  1X9N A;  1KHI A;  3CCL A;  3HKS A;  1VCI A;  3JC6 6;  4OWW B;  5C3E H;  2PNH A;  2Z0S A;  1CKM A;  4JOI A;  3S1M H;  2B63 G;  3KJP A;  1N32 Q;  4LF6 L;  4JI2 Q;  4DV3 L;  4IFD I;  3E9I A;  1GM5 A;  1K83 H;  4IFD G;  3U58 A;  1PHJ A;  3CPF A;  3H15 A;  3BZK A;  1NBW A;  5GQO A;  3I4M H;  4PZ8 A;  5JJI A;  2AWO A;  2PMZ E;  2K50 A;  4LFA L;  5ELN A;  3D0F A;  1BVS A;  2HIV A;  3J80 i;  3OW2 A;  4PG3 A;  4IFD J;  4LUZ A;  2CFM A;  3GTK H;  4LNQ A;  1UE1 A;  2WAQ E;  3GDE A;  1JJ2 A;  3HOU G;  3RLF A;  4POG A;  2VL6 A;  1VQ6 A;  4KHP Q;  1PH7 A;  2VS1 A;  4B3S L;  4B3R L;  4KLK A;  4DR5 L;  1X6O A;  3HOY G;  4X6A H;  4A3D H;  1O7I A;  1WYD A;  2R7F A;  3HOX H;  1PH8 A;  2VW9 A;  4P74 A;  1IBM Q;  2ES2 A;  4YY3 L;  1XNR Q;  1XNQ Q;  3E9H A;  2R93 G;  1FL0 A;  2PQA B;  2ALY B;  5C44 H;  3I4N G;  3PF5 A;  1PH4 A;  2MO1 A;  4KHZ A;  2NVQ H;  3CD6 A;  4R1J A;  4LF4 L;  2OQK A;  2YTV A;  4GOP C;  3RNU A;  3ER0 A;  1N8R C;  5IYB H;  4H02 A;  4A4I A;  1YVC A;  2E5L Q;  4HJ8 A;  4DR7 L;  1K3R A;  2VUM H;  2I5M X;  3G48 A;  5AJ3 Q;  3M85 A;  3UDI A;  1HZ9 A;  1YI2 A;  3AEV A;  3M7N A;  1GD7 A;  4APV A;  1XMQ Q;  3S2H H;  1VQN A;  4GNX C;  4QY7 A;  2E2J H;  5C3E G;  2DGY A;  3MXN B;  3I4O A;  3D31 A;  1OXX K;  2K5N A;  5FLX c;  4HIK A;  2JA9 A;  2WB1 G;  1KAW A;  5M5X H;  1L0W A;  4YWM A;  5M3M G;  3RZO H;  3HKZ G;  2BA0 A;  3PV0 A;  4OWX B;  2YTY A;  4JI1 L;  3I4M G;  4GLX A;  5LMU L;  2Y0S G;  1PH6 A;  1I6H H;  5C0X G;  2MNA A;  1A62 A;  3A5Z B;  4GN5 A;  3U50 C;  5IYD G;  1Z47 A;  4UPA A;  4X65 Q;  2VQE Q;  4JBW A;  5M3F H;  4DV5 Q;  1FJG Q;  2UXB L;  1VQJ A;  4B3M L;  4LF7 L;  3L7Z C;  2I0Q A;  2DUD A;  2PQA A;  2NVY H;  4TQU S;  3RLN A;  2UU9 L;  5C0X J;  5J3B A;  4DPG A;  3CCM A;  2WB1 E;  3T1H L;  4LF6 Q;  4DV3 Q;  3HKZ E;  3GTM H;  4O0A A;  3UDX A;  2ZM6 L;  4DV1 L;  3KF6 B;  3HOX G;  4A3D G;  1JT8 A;  1BKB A;  4LFA Q;  3ULP A;  1QZG A;  3PO2 H;  1E3P A;  3J7Z C;  4LF8 L;  3M4O H;  1JJC B;  3M3Y H;  3S1Q H;  5C44 G;  1NTG A;  4BXX H;  2HT1 A;  1KD1 C;  1K0R A;  4R4C A;  4LF9 Q;  5LMN W;  1B70 B;  2D0O A;  4HIM A;  3F1Z A;  1MJC A;  4KI0 A;  3STB C;  4QQB X;  4OX9 L;  4JYA L;  5IYB G;  2QA4 A;  2JA5 H;  4B3S Q;  1L2F A;  4DR5 Q;  4B3R Q;  1OXV A;  3HFZ B;  4IPC A;  1YIJ A;  2Q2I A;  3AFP A;  3F2B A;  1E1T A;  4GOP B;  4B3T L;  1G51 A;  4YWK A;  4JI8 L;  4YY3 Q;  4JCV E;  1PH3 A;  5IE8 A;  2ZJR A;  2AHO B;  3ZJY C;  2JA7 G;  4LF4 Q;  4IJL A;  3CME A;  4DV2 L;  4K0K L;  4LWC A;  4HJ5 A;  3TRE A;  1X3E A;  1Q81 C;  1WCM H;  1P8L A;  1VQI A;  4NB3 A;  2A1A A;  4LF5 Q;  2YU9 H;  4GNX B;  3B6Y A;  4AQY Q;  4DR7 Q;  1PYS B;  1Y1W H;  4A3K G;  1Q12 A;  5M3F G;  2ZTC A;  3KF6 A;  3HOZ H;  3HOY H;  3UE1 A;  1HH2 P;  1DGS A;  3STB D;  3TEH B;  1U0L A;  3CW2 C;  1CSQ A;  1VS0 A;  3ERS X;  1PH9 A;  5H1S E;  4L5Q A;  2NZO A;  2R93 H;  2MO0 A;  1FGU A;  2ID0 A;  1Q82 C;  3UDG A;  4JI7 L;  3TRZ A;  1TWG H;  4QGU A;  2EIF A;  1UWV A;  4EQ5 A;  1JB7 A;  4JBK A;  2FXQ A;  1GO3 E;  2K5H A;  4EX5 A;  5LMU Q;  1EWI A;  1N33 L;  1PVO A;  1YBY A;  1XTD A;  2I5H A;  3ULJ A;  1N34 L;  1YJN A;  4GOP A;  3EN2 A;  1SMX A;  1Y14 B;  2IX0 A;  1PA6 A;  1D7Q A;  4B3M Q;  4LF7 Q;  4BXX G;  1TWC H;  1X55 A;  4DAY B;  2VQE L;  3JAM c;  1JJG A;  2UU9 Q;  4BBS H;  4PZ6 A;  2UUA L;  4IJH A;  3T1H Q;  3PIP A;  3GO5 A;  2JA5 G;  4QL5 A;  1Q1E A;  3EIV A;  2WAQ G;  4A3G H;  4AH6 A;  2ZM6 Q;  4DV1 Q;  1IZ6 A;  3PUY A;  4A3M H;  4R4Q A;  5FLM H;  4GNX A;  3S17 H;  2HQL A;  5M3M H;  1A8V A;  3T1Y L;  1R9T H;  5K36 G;  3CCR A;  4LF8 Q;  2E8G A;  1WOC A;  3NEM A;  2VQF L;  5IYD H;  1BBU A;  4A3F G;  1S3O A;  4MNO A;  4OX9 Q;  3H3V H;  4JYA Q;  1WCM G;  1Y1V G;  1YIT A;  5IT9 c;  4LF9 L;  4DAM A;  2UUC L;  5HY6 A;  2HHH L;  1EFW A;  2ZJP A;  2MQH A;  1Y1W G;  3FP9 A;  2B3G A;  4B3T Q;  4JI8 Q;  1HZC A;  2EXD A;  3HOZ G;  2RCN A;  1HJP A;  2IHE A;  4BY1 G;  3DLL A;  1K9M C;  1RL2 A;  4IOA A;  3CPW A;  4DV2 Q;  4K0K Q;  4A3J H;  1CKO A;  3W1G A;  2JQO A;  1IYJ B;  1G6P A;  2KHJ A;  2A19 A;  1A63 A;  4HJ7 A;  2Z6K A;  4WJ3 M;  4A3I H;  2H5X A;  2F3I A;  4MTN A;  3GD7 A;  4FDB A;  1RIP A;  4ME3 A;  4Y7N H;  1HR0 L;  1I5F A;  4LF5 L;  4LFB L;  4AQY L;  2VZA A;  1C0A A;  2CCZ A;  3K80 C;  2LXK A;  1YJW A;  1SLJ A;  1IBK L;  1I3Q H;  5GAD C;  1VQA A;  4BBS G;  4A3C H;  2JEA I;  4GKK L;  1YHB A;  2A8V A;  4JI7 Q;  3KLW A;  1GVP A;  2JA7 H;  2B29 A;  1CUK A;  1VQF A;  5BR8 L;  4TVA B;  4A3G G;  1HNZ L;  4XTC S;  4A3M G;  4DR4 L;  1N33 Q;  5FLM G;  4BA1 I;  2UXD L;  2CQO A;  1VQ4 A;  3JAM i;  4JI6 L;  1N34 Q;  3KFU A;  3Q8D A;  1OXT A;  1XMO L;  1C7Y A;  5C0X I;  5E7N A;  4GN4 B;  1EQQ A;  1Q8K A;  2IX1 A;  1TWF H;  2UUA Q;  4DV6 Q;  3H3V I;  1KL9 A;  2JK8 A;  1Q7Y C;  2Q2T A;  1SRU A;  3S15 H;  4LW1 A;  4JOI C;  2RHQ B;  4UY8 C;  1HNW L;  2KCT A;  4R4T A;  1KRT A;  3T1Y Q;  1X3G A;  2KEN A;  3CAM A;  4OXP A;  2K14 A;  3RN5 A;  1Q86 C;  1XPU A;  2AWN A;  3GTJ H;  2VQF Q;  5C4J H;  2C35 B;  1M1K C;  1TWA H;  4AYB G;  5FJ8 H;  3GTP H;  3CF5 A;  1V1Q A;  1J6Q A;  3PCO B;  3NEN A;  4A3J G;  1HR0 W;  1K8G A;  1VQK A;  3S24 A;  1QZH A;  3FHW A;  1W3S A;  5IP7 H;  5M5W H;  2UUC Q;  2HHH Q;  4A3I G;  4PMW A;  3M4P A;  4DUZ L;  1MKH A;  4DR6 L;  2E2H H;  5IY0 A;  2ATW A;  1YEZ A;  4JI5 L;  1XPO A;  4AYB E;  4NXM L;  4LUV A;  4YCV A;  1JMC A;  2D0P A;  1GKH A;  4LFC L;  1X54 A;  2N3S A;  4AIM A;  4X64 L;  2K52 A;  1VQM A;  4A3C G;  3G71 A;  3H0G H;  1EYG A;  4RG1 A;  1QUQ B;  4JBJ A;  4RMF A;  1WI5 A;  4ALP A;  5ELO A;  4A3F H;  1E24 A;  4X66 L;  5IYC H;  1LUZ A;  4BA2 I;  3L2P A;  4POF A;  1Y1V H;  4IPH A;  3PF4 A;  3NBH B;  1HR0 Q;  1T9H A;  4LFB Q;  3PUX A;  3A74 A;  4HJ9 A;  1VQ5 A;  1H95 A;  5GRO A;  1S72 A;  1IBK Q;  1PH2 A;  2E2I H;  4JV5 Q;  1VQ8 A;  2R92 H;  1KRS A;  3DM3 A;  3K0X A;  1AE2 A;  4GKK Q;  4BY1 H;  5JJK A;  3CCS A;  2OQ0 A;  3PSI A;  4J15 A;  4MZ9 A;  2YYZ A;  3S2D H;  2GVA A;  5BR8 Q;  4JI3 L;  1AE3 A;  1HNZ Q;  4DR4 Q;  2UXD Q;  1NY4 A;  4JI6 Q;  2UXC L;  3AQQ A;  2ZJQ A;  1B7Y B;  2AKW B;  4DV7 L;  1KIX A;  4A93 H;  4JBM A;  5JEA G;  1XMO Q;  3KYH C;  3PUV A;  1LTL A;  3KDF B;  5FJ8 G;  3AYH B;  3KOJ A;  3I55 A;  1EQR A;  1CKN B;  3S14 H;  3GTL H;  3J7A 5;  3TS2 A;  5JEA J;  5IP7 G;  2WP8 J;  3CCJ A;  1U5K A;  1N36 L;  4JI4 L;  1SFO H;  1QUQ A;  4C3I H;  4DV6 L;  1X56 A;  3I7F A;  4O2D A;  3U4Z A;  1HNW Q;  1VQD A;  1EIY B;  2R7Z H;  2NZH A;  4DKA C;  4DV0 L;  4GLA C;  1K73 C;  3F2C A;  1YZ6 A;  3GTO H;  2NN6 I;  2NN6 G;  2CWP A;  3H0G G;  3PGZ A;  4P75 A;  1QVG A;  1MJE A;  3A0J A;  1G29 1;  4C3J H;  5IYC G;  1IL2 A;  2HIX A;  2QGQ A;  1IXR A;  1LM0 A;  4YHH L;  3K81 C;  4DUZ Q;  4DR6 Q;  4YCU A;  1X3F A;  4JI0 L;  4BY7 H;  1YNX A;  2EQS A;  1VQL A;  4JI5 Q;  3MEF A;  1KQS A;  2F4V L;  3ICE A;  1PYB A;  4DNI A;  1QVC A;  3U4V A;  2YTX A;  1IBL L;  4NXM Q;  2XGT A;  2L15 A;  4X64 Q;  4LFC Q;  3KDF A;  1Q1B A;  1VQH A;  3OTO L;  3TS0 A;  1CKN A;  4HIO A;  1VQ9 A;  3CC7 A;  3FKI H;  2VNU D;  1FVI A;  1PFS A;  4X66 Q;  4GLV B;  4DV4 L;  3KF8 B;  1EOV A;  3CQZ H;  4A93 G;  1SN8 A;  1L1O C;  1I50 H;  1KC8 C;  2IHF A;  2JE6 I;  3PO3 H;  2OCE A;  2RHS B;  3BU2 A;  2JA6 H;  4JV5 L;  1KXL A;  2NVX H;  2Q2U A;  4HID A;  2Q2H A;  2D62 A;  2XTI A;  1OXS C;  3HOV H;  3IRB A;  2ASB A;  1S40 A;  3AFQ A;  1IBL Q;  2ZTE A;  2KHI A;  1HNX L;  1EIF A;  4JI3 Q;  4L5R C;  4A3B G;  3I56 A;  5IWA L;  3G6E A;  3F2D A;  4A76 A;  4OO1 G;  4OO1 I;  2UXC Q;  2MFI A;  1EUJ A;  2R7Z G;  4DV7 Q;  2QEX A;  2N8N A;  4BBR G;  1J5E L;  5GAG C;  4A3E G;  2OTJ A;  2OWO A;  1C9O A;  3K7A H;  4DR1 L;  2N49 A;  3W1B A;  2JA8 H;  2KBN A;  1E7Z A;  4QIW E;  5IP9 G;  2WFW A;  4DR2 L;  3EBE A;  1M90 C;  2BH2 A;  4IPG A;  1N36 Q;  4JI4 Q;  1I94 L;  3CCQ A;  1VQC A;  3CC4 A;  5LMN L;  2KCM A;  2JJQ A;  1MIU A;  3OYY A;  2LXJ A;  1NMG A;  1OTC A;  1NMF A;  4BY7 G;  4NXN L;  2IT1 A;  4XIG S;  4UP7 A;  4DV0 Q;  3CCV A;  1VQG A;  3HOW H;  4YWL A;  1VQO A;  2UUB L;  3CC2 A;  4UP8 A;  3PUZ A;  4A3L H;  4R4I A;  3FKI G;  5HGQ A;  4HJA A;  3RLO A;  3RR5 A;  4Y52 H;  5JJL A;  2BA1 A;  5C4X H;  3PIO A;  4DR3 L;  1VQE A;  4OWT B;  3NEL A;  4YHH Q;  4C3H H;  1CSP A;  3G4S A;  3W5O A;  1PH1 A;  4JI0 Q;  1X65 A;  2F4V Q;  1NE3 A;  4GKJ Q;  4DUY L;  4JG2 A;  1P16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...