2K52A

Structure of uncharacterized protein mj1198 from methanocaldococcus jannaschii. northeast structural genomics target mjr117b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
MDVEPGKFYKGVVTRIEKYGAFINLNEQVRGLLRPRDMISLRLENLNVGDEIIVQAIDVRPEKREIDFKYIPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of uncharacterized protein MJ1198 from Methanocaldococcus jannaschii. Northeast Structural Genomics Target MjR117B
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein MJ1198
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k52A00
4PZ6A 4YCWA 2VQEL 1WJJA 4DPGA 1X55A 4DR2Q 5HGQA 4JI1Q 3T1YL 2E2JH 1SFOH 1N32Q 4KI0A 4GNXB 4LWCA 3UDFA 4X64L 1ASZA 4DR6Q 1GO3E 1E3PA 1NMFA 3BU2A 4IPDA 2QEXA 4PG3A 1IBLL 5BR8L 2JA5G 4GKJQ 4QQBX 3HOWG 3HOZH 2JJQA 3I4OA 1WOCA 1X6OA 2HHHQ 1VQFA 1W3SA 4JI4Q 4BA1I 4A3FG 1PH4A 4BY7G 2ZJQA 1WCMG 4DV1L 1PH7A 4RMFA 3CXCA 1X9NA 2ZJRA 5IYBH 4POGA 5J3BA 1CKNA 1CUKA 3K80C 1VQLA 2MO1A 1V43A 5IP9G 1M90C 1XPUA 1E22A 3E9IA 2BA0A 2Z0SA 1N33Q 1K9MC 4GS3A 3CCVA 2B29A 1VQKA 4B3ML 4QIWE 1OXTA 4KLKA 2F4VQ 4GOPC 1OXUA 4DV4Q 1Q46A 1PV4A 3AYHB 4GLVB 4B3SL 2E5LQ 3FKIG 3VDYA 2R7FA 2NN6I 3KDFB 3I4NG 1X54A 1NY4A 5LMNL 3AFPA 3PF5A 4A3DG 4RG1A 4Y52H 2Q2TA 2OTJA 2OWOA 1HNWL 3H3VI 2RHSB 3M9BA 4WJ4A 1Y1WG 3H15A 2HT1A 3I4MG 3TS2A 2D0PA 4LF8Q 3PIOA 3J81i 5JEAG 3F2CA 3KJOA 3K7AH 2NVTH 3SGIA 2VQFQ 1I6HH 2JA7H 4JI1L 2PI2A 1QUQB 4YWMA 1BVSA 1JJCB 2YTYA 4JC0A 4NB3A 4A3EG 4L5RC 1P8LA 1J6QA 2B3GA 2C35B 1NJIC 2UXCQ 3CW2C 3GTLH 5LMUQ 4YY3Q 2UUBQ 4PZ7A 2JA6G 5M3MH 1I3QH 3ULLA 4R4QA 2OQKA 4X62L 4B3MQ 4JI3L 1YZ6A 2EIFA 3RLOA 4DAYB 4DV5Q 2LXKA 2EXDA 1OXVA 4JCVE 2CQOA 1G291 1CKNB 4IJHA 4A3DH 2ZM6Q 3S1MH 1WFQA 5GAEC 3I2ZA 4DR3Q 1XNRQ 4R4IA 2JQOA 3CF5A 3HOVG 2NZHA 3CCEA 4IPCA 1N36L 1PHJA 1Z47A 2VY3A 2GVAA 3BZCA 4UP9A 1PH5A 1VQDA 4YHHQ 4HJ7A 1K73C 4JI0L 1FJGQ 4A3JH 1I5FA 4JI2Q 4A3KH 3S15H 2VW9A 1PH6A 3HOWH 4GKJL 1N34L 3K8AA 4IPGA 1HR0W 3G6EA 2NN6G 2IY5B 2K5NA 1HH2P 4HJ5A 3OW2A 4O2DA 4LF6Q 5AJ3Q 1BBUA 1CKOA 5FLXc 2UUAL 2QGQA 4ME3A 1X56A 3L2PA 2NVYH 4GOPB 4YY3L 3DLLA 1YJ9A 3PUWA 1V9PA 4APVA 1X3EA 3PO2H 2YU9H 1JE5A 1VQ7A 4QY7A 1TWGH 4DAMA 4LF6L 2R93H 3IRBA 3I56A 1HZBA 4JI7Q 2OTLA 1V1QA 4DV6Q 1K8AC 2QA4A 4DR1L 4LF5L 3KDFA 1XTDA 5FLMH 1VQ4A 1KXLA 1EOVA 1PFSA 4DV4L 2CFMA 4TQUS 1OXSC 5C3EG 4IO9A 3H3VH 4LFAQ 4BXXG 2Z6KC 4DV6L 1AH9A 2E2HH 5LMNW 1OXXK 4HJAA 4JI5L 1LYLA 5GAHC 1YIJA 1FGUA 1HNZQ 1HNXQ 3GTKH 4P72A 2PQAB 1E1TA 1K83H 5GROA 2JA8G 1AE3A 2Q2HA 3NBHB 4YWKA 4LFCL 4EQ5A 3G4SA 1SN8A 2AHOB 4JBJA 4AQYQ 2JA7G 2HQLA 1HJPA 2MFIA 5IYCG 3BZKA 3F8TA 3KF6A 4POFA 1EUJA 3M4QA 4NXMQ 4WJ3M 3D0FA 5IP7H 4HIKA 2RHQB 1N33L 3E0EA 4BBRH 1I94L 4R4TA 3A5UA 2HHHL 2KBNA 1E24A 5ELNA 5M3MG 1QVFA 1H95A 4A75A 2I5LX 4P73A 2VQFL 3CCQA 3TREA 1AE2A 1NMGA 2A1AA 5FLMG 1Q8KA 1YBYA 4UP7A 3TQYA 1YJNA 1MJEA 2B63G 5IWAQ 1Y1VG 1SE8A 3KLWA 1UE5A 2MO0A 4O0AA 4HIMA 1WYDA 1CSQA 1B70B 4JBMA 1KQSA 1FL0A 1N8RC 4DK3C 1PYBA 2I5MX 2VS1A 1TWAH 1KHIA 4DR3L 3JAMc 1XNRL 1Z9FA 2ZM6L 4NXNQ 3T1HQ 5FJ8H 4R4OA 4L5TA 2YTXA 1KD1C 2Q2UA 4MTNA 4A93G 1EQRA 4AIMA 1XJVA 1SRUA 1S3OA 1GVPA 2JE6I 4OWTB 2K14A 1IXRA 3M7NA 3PO3H 4GKKL 2KCMA 3UDXA 2WAQE 3BJUA 2IX0A 1L1OB 4JBWA 1PH1A 3LGJA 4HIOA 4DR7L 1IBML 4BBSH 3NELA 4LF4L 3D31A 3TS0A 4R1JA 1E7ZA 1EIYB 1PH8A 3HKZG 3CMEA 2UUCL 4HJ9A 1WI5A 3J7A5 3RNUA 4JI2L 1PVOA 1FJGL 4A3IG 1SLJA 4DUYL 3CD6A 1DGSA 2D0OA 1KIXA 4JI3Q 1N9WA 1QZHA 3U4ZA 2ZTCA 3GD7A 3W5OA 4ALPA 3ZJYC 3S24A 2JA6H 4P71A 1YVCA 1VQNA 5ELOA 4X64Q 4X65Q 1LUZA 4DV3L 2ATWA 3KF6B 2Z6KA 1TWFH 3I4NH 3PUXA 4B3RQ 3FP9A 4DR2L 4OO1I 4A3LH 1XNQQ 3PV0A 2JA8H 2R92G 3RLFA 1JT8A 1TWHH 3KOJA 3ER0A 1YI2A 2HIXA 4C3IH 1HR0Q 2R7ZG 4H02A 1NE3A 1RL2A 2R6GA 2ES2A 2I0QA 5IT9c 1XMQL 1ASYA 2AWOA 3J81c 4A3KG 4NXML 1UWVA 1VQGA 4QGUA 3PUZA 3ICEA 2OCEA 2D62A 4XTCS 4AQYL 2K50A 4DUYQ 4JG2A 4Y7NH 4MNOA 4AYBE 4JI8L 3HOVH 1YHAA 4JOIA 5H1SE 5C4XH 4DV2L 4DR5Q 1I50H 1MKHA 2CWAA 3RZOH 4IFDG 2H5XA 2N3SA 4A3JG 1R9TH 1FVIA 3HOZG 4K0KL 4A76A 3AQQA 1PYSB 4A3CG 3A5ZB 1QZGA 4EX5A 1VQCA 1VQOA 1IBMQ 3S1RH 4JI8Q 5GADC 4KHPQ 3RN2A 4MZ9A 1OTCA 3UDGA 1HR0L 3E9HA 3RLNA 4HIDA 1JJGA 3AEVA 4DR4L 4JI7L 3U4VA 4A3BG 3HKZE 2YV5A 1BBWA 1XNQL 1QUQA 2UUAQ 5AJ3L 1PA6A 3HOYG 1MIUA 3U50C 3T1HL 1KC8C 1HZCA 1UE1A 2A19A 3TRZA 3H0GG 2WAQG 2K4KA 2LSSA 4A3BH 1Q1BA 2KENA 5HY6A 3PCOB 4DKAC 3G71A 1K8GA 3CPFA 2A8VA 5GQOA 4C2MH 2UXBQ 1KRTA 3CQZH 3CC4A 5IYDH 3UE1A 4LF9L 2BH8A 4JYAL 1IZ6A 3PGZA 1TWCH 4GNXC 4JI6Q 4X66L 4A3CH 2N78A 3JAMi 3CC2A 2Y0SE 4B3TL 1N32L 1M1KC 3S1NH 4JV5Q 2JA5H 2UXBL 1E1OA 2I5HA 2VQEQ 1N36Q 1KL9A 4BY1G 2N49A 1U5KA 1A0IA 4LNQA 2K5VA 4A3GG 4DR4Q 1VQ8A 5DLQE 1XPOA 4IJLA 1VQHA 2OQ0A 2MNAA 3PIPA 3A74A 4YCVA 4NPSA 4LFCQ 3S14H 3MEFA 1Y1WH 5M3FG 2F3IA 4AYBG 4DV7Q 3I4MH 3M4PA 3CCSA 3W1BA 4A3MH 4JI5Q 1S72A 2RCNA 4DUZL 3S1QH 4K0KQ 3GTQH 1X3FA 2BH2A 3HOUH 2PI2E 3PF4A 5GAGC 1L2FA 3PUYA 4GOPA 1LM0A 4DV0Q 1J5EQ 3GDEA 4IFDJ 4BY7H 5IWAL 4P74A 3S17H 2JEBI 2XGTA 4GLAC 1VQEA 2WFWA 2WP8J 1YEZA 4OWWB 1GM5A 2Q2IA 4YWLA 1BKBA 4P75A 1EFWA 2VNUD 4DV5L 4A4IA 3M85A 5C44G 4A3IH 4OX9L 3KFUA 2K75A 4DNIA 1W2BA 1CSPA 5LMUL 2UUBL 1K3RA 2RF4A 2YTVA 3FKIH 3RR5A 3OTOL 4LFBL 2CWPA 4KHPL 3EIVA 4OO1G 3GTGH 3MXNB 3STBD 1IYJB 1SROA 4BBSG 1YHQA 1VQAA 3I55A 3HOXG 1JMCA 1N34Q 3EN2A 1Q7YC 4BA2I 2ID0A 4LW1A 1IL2A 3W1GA 4DV3Q 1KAWA 4JI0Q 5JJIA 5IP9H 4X65L 2Y0SG 1HNXL 5C0XJ 4A3GH 4C3JH 2E8GA 4KHZA 1VQPA 2VL6A 1KRSA 1RIPA 3GO5A 3CC7A 2IT1A 4LUZA 4IOAA 2R7ZH 2CCZA 3GTOH 1L1OA 5EAYA 5IYCH 1XMQQ 1YITA 4A3EH 4DR7Q 5IE8A 4X62Q 3CCMA 1HZ9A 1C7YA 1CKMA 4IOCA 4LUOA 5IYDG 1VQMA 3M4OH 1YHBA 2KHIA 2UXDQ 2AMCB 4OONA 2VZAA 5FJ8G 1QVCA 1IBKL 3K0XA 3H0GH 4IPHA 4J15A 3UE0A 1NTGA 5C3EH 2WB1E 4NXNL 1MJCA 1VS0A 3PSIA 3KJPA 1EYGA 3J7ZC 1GD7A 1VQ6A 2L15A 4X6AH 3TEHB 2JK8A 4UPAA 4LF7L 4UY8C 4TVAB 2E2IH 3L0OA 4LUVA 2UUCQ 2JEAI 4LF7Q 2B63H 5JJLA 2ZJPA 3CP0A 3S2HH 1UE6A 4UP8A 5M5WH 4JI6L 1YNXA 4A3MG 4BBRG 4BXXH 2E5LL 3UDIA 5IP7G 3I7FA 3CMAA 1VQBA 3F2BA 4B3SQ 1Q86C 3GTMH 3CCUA 4FDBA 2ZTDA 1L1OC 2R92H 2VUMH 1TXYA 2ASBA 2UXDL 3J80c 1A62A 2IX1A 3J81j 1S40A 2UXCL 3STBC 2DUDA 3KYHC 3ULJA 4L5SA 1WCMH 2PMZE 2YYZA 3EBEA 1LTLA 4R4CA 4DV7L 4GKKQ 1I94Q 2R93G 2F52A 5C4JH 2IHEA 2HIVA 3ERSX 3A0JA 3CPWA 1K0RA 4QL5A 1PH3A 1X65A 3B6YA 2GN5A 3HKSA 3HFZB 3CCRA 4LFBQ 1VQIA 5M5XH 4GN5A 3GTJH 4LF8L 3PUVA 1C0AA 5K36G 4JI4L 4GN4B 2IHFA 4JV5L 3U58A 3OYYA 5JJKA 3PO3G 1A8VA 1VCIA 3CCJA 4B3TQ 1Q1EA 4A93H 1HNWQ 4DK6C 5IYBG 1XMOQ 4BY1H 1G51A 2CKZB 5LMNQ 1X3GA 4GNXA 4DR6L 1SMXA 1JB7A 4LF9Q 2V1CC 2BA1A 4IFDI 3F1ZA 4JYAQ 1A63A 3PO2G 4OXPA 3T1YQ 1YJWA 1GKHA 4QJFA 5C4XG 3K81C 2DGYA 5E7NA 2PNHA 2N8NA 4GLXA 2F4VL 4DR1Q 4LF5Q 1EIFA 1XMOL 3L7ZC 1Q81C 3ULPA 2AKWB 4L5QA 3M3YH 5M5YH 3HOUG 1O7IA 4OX9Q 4B3RL 4GN3B 1U0LA 5IY0A 2UU9L 4OWXB 1UEBA 2GVBA 3HOXH 4XIGS 1EWIA 2UU9Q 1EQQA 2NZOA 3OTOQ 1UE7A 2LXJA 5M3FH 1NBWA 2EQSA 4A3FH 4DV1Q 2ZTEA 1P16A 1PH9A 3CCLA 2R7DA 3KF8B 1Y14B 2K5HA 1SR3A 4C3HH 3S2DH 3DM3A 3Q8DA 1QVGA 1Q82C 4A3LG 2ALYB 1HNZL 4HJ8A 5BR8Q 2VUMG 3GTPH 2KHJA 5C44H 4JOIC 3F2DA 2K52A 4X66Q 1C9OA 1D8LA 2XTIA 2PQAA 1IBLQ 1G6PA 3RN5A 4LFAL 4DUZQ 2NVXH 3K7UC 5C0XG 1PH2A 1Q12A 5C0XI 4DV0L 4YHHL 4DR5L 1J5EL 3FHWA 3JC66 4DV2Q 4LF4Q 2NVQH 4JBKA 1B7YB 3RZDH 1JJ2A 4PMWA 1VQJA 1B8AA 4YCUA 1XPRA 3WWVA 5JEAJ 1Y1VH 2AWNA 2MQHA 1VQ9A 1HZAA 2KCTA 3J80i 4AH6A 3CAMA 1L0WA 1IBKQ 1VQ5A 3S16H 3NEMA 2WB1G 3NENA 4PZ8A 2JA9A 1D7QA 2FXQA 1T9HA 3AFQA 3HOYH 3G48A
chains in the Genus database with same CATH superfamily
1WJJA 4G7HC 2A73B 4JI1Q 5HGQA 1PRTF 5J22A 2KOLA 3AMUA 1XTCD 1GO3E 1E3PA 1BQQT 2F0VA 1TWGB 3BU2A 3GTMB 4C2MB 2K1BA 2A6EC 2MJ8A 5KNDA 2JA5G 2F0OA 1KDAA 2HHHQ 2RDFA 4JI4Q 4BA1I 4A3FG 1G91A 1H9SB 4ZAIA 4DV1L 4LJZC 2O5IC 3K80C 1VQLA 2MO1A 1V43A 1T5EA 1M90C 1E22A 3E9IA 2BA0A 4ZUJA 1PYWD 1N33Q 3OPOA 4GS3A 1VQKA 1HXYD 1STAA 1OXTA 4KLKA 2B39A 1RF2D 4EQPA 3AYHB 4GLVB 4KK7A 3FKIG 4BS9A 3RZOB 2BE5D 3BYTB 3BDCA 1OO9B 3AFPA 3PF5A 1HTPA 4Y52H 2Q2TA 1HNWL 4L8JA 4X3SA 1GOZA 1JWUD 3H15A 2HT1A 3BZDB 4AYBB 4O1NA 1STNA 2D0PA 3CRLC 5CBAE 3K7AH 3K7AB 2JA7H 2A6HC 2K01A 2PI2A 1QUQB 4YWMA 4RHSA 4A3EG 3HOWB 3GTGB 1J6QA 2C35B 3I4MB 3CW2C 5M3MH 4B3MQ 4JI3L 1YZ6A 1LV9A 2ZXOA 4IJHA 2ZM6Q 1WFQA 4ZRZA 4R4IA 5LL6X 1PTOH 4IPCA 1Z47A 2X6LA 4UP9A 1KTKA 1VQDA 2WKCA 5M3FB 1H9SA 4JI2Q 4WRDA 4A3KH 1SYBA 5C6AA 1PH6A 3HOWH 5IGDA 2CVRA 3KUPA 4BBSB 2K5NA 5CR3A 2H4OA 1F9PA 1UAPA 3L3OC 1BBUA 1CKOA 2UUAL 1CTMA 2NVYH 3TBIB 3EA6A 1NCVA 3PUWA 1ILQA 1I4GA 4IQZA 5TSSA 1HFNA 1JE5A 1TWGH 1O80A 1QJOA 3OW7A 3IRBA 3I56A 4JI7Q 5EQ0A 2QA4A 1J9OA 3HEJA 4KN4C 4KY5A 1TWAB 1GHKA 3QG1A 1PFSA 1PRTB 4V0BA 1JOOA 1OXSC 4IO9A 3VYTA 2Z6KC 5EBDA 2E2HH 4F7XA 5LMNW 1G8ZD 2OEOA 4HJAA 1LYLA 1MD2D 2F0LA 2R7ZB 1HNZQ 3GTKH 4QUFA 4RGTA 2Q2HA 4EQ5A 4YWKA 3G4SA 1SN8A 2L5TA 4JBJA 4AQYQ 3QB3A 1HJPA 2MFIA 3F8TA 4POFA 4K14A 1ZKOA 1STBA 3D0FA 5IP7H 2RHQB 4BBRH 2HHHL 2K04A 4A75A 2VQFL 3TREA 1WVLA 4DK0A 4PNYA 1YBYA 4UP7A 1IW7C 1YJNA 2B63G 5IWAQ 1SE8A 3KLWA 2MO0A 1PRTC 1BXTA 2Q8TA 4HIMA 3URYA 2B2WC 2VS1A 1TWAH 1KHIA 4XXEA 1XNRL 3T1HQ 5FJ8H 1Y8NB 3HOYB 1EQRA 1B4OA 1S3OA 1GVPA 4OWTB 2DN8A 2JE6I 4GKKL 3PO3H 3PO3B 3UDXA 2K33A 3GTOB 4JBWA 1CZWA 2Z6BA 5EGTA 3LGJA 2V4DA 3K6OA 1IBML 3NELA 3D31A 4RKBA 3TS0A 3O13A 1PH8A 1W6KA 4UHVA 1WCMB 3I72A 1PVOA 4JI2L 4ZQ3A 1S5ED 5KRUA 2ICIA 4IUQA 1DGSA 4KHVA 1N9WA 3WDNA 1A3VA 1RDPD 3W2DA 3W5OA 5IGEA 4K6DA 2JA6B 3T56B 4X64Q 5IODA 1G2SA 3I4NH 3PUXA 1I4RA 1PZJD 3A8JE 4K8IA 4DR2L 1XNQQ 2R92G 1C4QA 5JJZA 1HR0Q 3GTKB 1Z6HA 2R6GA 5CBEE 1Y8OB 3J81c 4A3KG 1VQGA 2TSSA 4KD4A 2K50A 1LABA 1I4QA 4AYBE 1YHAA 2L1BA 4DV2L 2EJMA 4DR5Q 1LT6D 4B08A 3GV6A 2EZVA 3H0GB 1R9TH 1FVIA 1TR5A 3AQQA 4G7OC 1F9QA 2VB2X 4A3CG 5C3WA 1VQCA 1RTNA 1GXDC 1IKLA 4YIJA 5CV8A 1ESRA 1SNPA 3E9HA 3AEVA 1ICFB 2LFNA 3U4VA 4A3BG 3HKZE 5ELCA 5J1ZA 1F2YA 1ONLA 1PFNA 5NUCA 1DD2A 1HZCA 2A19A 1H9KA 3TRZA 3H0GG 1TS5A 2PYKA 4H13C 2AQ3B 2K4KA 4K5WA 2LSSA 5HY6A 1K8GA 4DKAC 2B2TC 3CQZH 3UE1A 1BCPC 2BH8A 2OXPA 4A3CH 1V1PA 2N78A 3CC2A 1M1KC 2I5HA 2PW5A 4LNQA 1A0IA 4K6LA 4NMZA 2OQ0A 1GUTA 3PIPA 4CJ0B 2M9VA 2JYOA 4NPSA 3J80L 5M3FG 1V8QA 4DV7Q 3M4PA 1PTOF 3W1BA 4A3MH 1BF4A 1QWYA 4EQOA 3HOUH 4HSPA 5FKAC 1HA6A 4OL7A 1WTRA 5GAGC 4MHEA 1LT3D 1STGA 1HHVA 4P74A 4EVOA 2XGTA 4FP5D 2WP8J 1O78A 3NTKA 1QNKA 1BR9A 4J8QA 2VNUD 4C3IG 1NR2A 1VF7A 1W2BA 4HMIA 1CSPA 1R4QB 2RF4A 3RR5A 1ENFA 1B2TA 1D1KA 2G5DA 4P2CB 3STBD 1BO0A 2SOBA 1VQAA 1JMCA 2O2LD 1N34Q 2E76C 4F88A 3IL8A 3J7AV 1Q7YC 2X6GA 4BA2I 2ID0A 5JJIA 1KAWA 1A2UA 1SNCA 3QOLA 1BDOA 2RKSA 1HCZA 4A93B 1AP0A 5C4ZA 4ILWA 3CC7A 5M9OA 2IT1A 1CM9A 2R7ZH 4FF1A 1L1OA 2XNAC 4PV1C 4DR7Q 4A3EH 4WORA 1X3QA 1C7YA 2AUJD 5L37A 5IYDG 3M4OH 1I6VC 4N9PA 2HD3A 2RQXA 2N88A 4B9XA 5I4DA 1NTGA 1UUPA 3J7AF 3T13A 4G4KA 5C4JB 2QKIC 2L12A 1EYGA 3J7ZC 4M8AA 4BBRB 1GD7A 1QG7A 1ZEQX 3MXNA 3WOEA 2NVXB 1PZID 1II3A 1PLFA 4U673 2XRQD 2UUCQ 5A35A 4LF7Q 3CP0A 4UP8A 2J0TD 4DAYA 2KECA 4C1NI 1K0SA 1VQBA 2PPBC 3T16A 2M00A 2A68D 2EYMA 2ASBA 2IX1A 2UXCL 1LT4D 4L5SA 2DUDA 2Y0SB 4GKKQ 4DV7L 2NB0A 3GTLB 4QL5A 1U9RA 1X65A 2GN5A 3CCRA 1VQIA 3GTJH 4C56C 2DNCA 4LF8L 4JI4L 5F2DA 2IHFA 1A2TA 1VCIA 1HNWQ 3MA2B 4RCNA 3HRZC 4DK6C 2YU9B 1T5XD 4DR6L 1X3GA 2JA7B 1L0XB 4IFDI 3P1HA 5CV4A 2PNHA 1J8IA 4DR1Q 4LF5Q 1EIFA 2RDHA 3S14B 4RGNA 4MN3A 5DAUA 4OX9Q 3K5LA 1UEBA 3HOXH 4XIGS 1EWIA 2MHVA 4ZCKA 1UE7A 3SVMA 1P16A 3RMHA 4QB4A 3CCLA 2R7DA 1PZKD 1Y14B 3S2DH 4FXKC 5C3XA 3DM3A 1Q82C 4A3LG 2R61A 2LKVA 2QW7A 4HJ8A 5JAVA 4HCEA 3F2DA 4X66Q 2XTIA 4DUZQ 4DR5L 4YHHL 4ZK9B 3JC66 3DWAA 2DY7A 3S9WA 5EPJA 1GJXA 1JJ2A 1VQJA 4L63B 1XPRA 1QNUA 5C4HA 1VQ9A 1QOHA 1Y1VH 2MQHA 3CAMA 2WB1G 3AFQA 1Y1WB 4ODGA 1SJED 4N8X1 4DPGA 4DR2Q 3T1YL 1CHPD 4PQXA 1SFOH 2EVBA 2M2LA 4LWCA 5K5PA 4X64L 1CT1D 1ASZA 4DR6Q 1E0BA 1ILPA 1NMFA 2QEXA 4Y7NB 1SSOA 5BR8L 4GKJQ 3BDOA 4KKTA 3HOWG 1K8OA 1X6OA 1KDBA 3C3LA 2GA4B 3IKJA 1DXMA 3EJIA 1PH7A 4FO2A 3NTIA 3CXCA 5FO9B 1K9MC 5EPKA 3CCVA 2I46A 1K83B 3MVVA 2WACA 4CKCA 2F4VQ 1OXUA 3SK8A 1Q46A 1G6PA 1EFID 1ESFA 2E5LQ 3VDYA 3KDFB 1RD9D 1I50B 3NE5B 1ICWA 1U4RA 4A3DG 3CKIB 1TT2A 1I6HB 2OWOA 3H3VI 1CA6A 3NBHA 4LF8Q 2DY8A 1S5CD 3J81i 3F2CA 2F0NA 3KJOA 1PTOC 2VQFQ 1I6HH 4JI1L 1BVSA 4JC0A 4NB3A 4L5RC 2B3GA 2UXCQ 5LMUQ 2UUBQ 3S1NB 2Z4HA 4R4QA 4XYOA 1KAAA 1B50A 1YNNC 2EIFA 2LXKA 2CQOA 1G291 2EYLA 5GAEC 1EYDA 3CF5A 3I70A 4HMJA 3CCEA 4JW0A 3TP6A 2VY3A 3M3YB 1PH5A 2JN4A 4JI0L 2Z9HA 4HJ7A 1FJGQ 1I5FA 5KEEA 2R92B 1O7ZA 1L0YB 3SEBA 4IPGA 5IGFA 1ZYRC 5BN5A 4O2DA 1E2WA 1LTID 4A3MB 1D2BA 2SNMA 4GOPB 3FDTA 1YJ9A 1JE4A 5I6WA 2C9OA 1X3EA 4KMUC 4QIWB 1VQ7A 2R93H 1X32A 5FLXL 2OTLA 1V1QA 4DV6Q 3OSOA 4RAUC 2A68C 1XTDA 3DXJC 4TQUS 4DK1A 3CQZB 4DV6L 4QF4A 4OO1H 4P72A 1K83H 1D5MC 2AHOB 2JA7G 2HQLA 4KKUA 3PIO3 1MGSA 1Q3LA 2CQAA 3HOZB 3M4QA 4WJ3M 1I94L 5M3MG 1QVFA 3CCQA 4IUNA 2A69C 2EYJA 4OELB 1Q8KA 3TQYA 2QCPX 1F77A 1TS2A 1UE5A 4O0AA 1R9TB 5IGBA 1EQVA 4Q5VA 3OWFA 3G6JB 4ABNA 2NYZD 1TKWB 4L5TA 2SEBD 5I9OA 1EY8A 1XJVA 1SRUA 4FF3A 3BYYB 1IXRA 3HKZB 3M7NA 2KCMA 2WAQE 1PH1A 3EROA 3C46A 1EY0A 1PRTD 4LF4L 3Q0AA 1EIHA 3NUCA 1EU4A 3CMEA 3J7A5 1BNZA 3RNUA 1SLJA 2FHTA 3CD6A 2D0OA 2P5ZX 3E5SA 4Z9CB 3U4ZA 2OF1A 3I90A 3ZJYC 4RCOA 1VQNA 4JK1C 4X65Q 2F0QA 5T1GA 4OO1I 2F1MA 3PV0A 2JA8H 2L11A 3RLFA 1JT8A 1TWHH 1YI2A 2HIXA 3K58A 2ES2A 2I0QA 5IT9c 1XMQL 2QDLA 1TU2B 1ASYA 2AWOA 2SNSA 1F9SA 4XTCS 2OT2A 4MNOA 3HOVH 2A74C 5M5XB 3MXGA 1NNXA 2XIWA 3J81L 2QILA 1GUGA 4A3JG 3HOZG 4A3EB 4DN4M 4EX5A 2K5DA 4DA2A 3S1RH 5GADC 1IBMQ 5IGGA 3T4AC 1ENAA 3RN2A 4HIDA 4DR4L 4RKLA 4CDCC 2IJ0A 4S3SA 5JEAH 3HOYG 3FPUB 2EXZA 1V1OA 5IIFA 2JA8B 4F8MA 3K0YA 4A3JB 2WAQG 3K57A 3VR5A 4A3BH 4A3BB 3PCOB 1C8CA 1TQOA 5GQOA 2D5DA 1I4XA 1IHZA 3CC4A 1ZXTA 2F0IA 3S1MB 3MXPA 3AB9A 3E3XA 2NN6H 4GNXC 3P75A 3WOFA 4C3HB 3JAMi 1B3AA 2Y0SE 1N32L 3A56A 4JV5Q 2JA5H 2UXBL 1E1OA 3DMUA 1N36Q 1IYUA 4ZUIA 4BY1G 4A3GG 2K5VA 4DR4Q 3SHLA 1VQ8A 5DLQE 1VQHA 4YCVA 3TP5A 1WTWA 3MEFA 2F3IA 5CC4A 3I4MH 5FO7B 3FVQA 3A54A 1BCPF 1STYA 3PF4A 2X69A 4IFDJ 4A3KB 2JEBI 4GZYC 1WD1A 2O5JC 2WFWA 3LX0A 4IUUA 1GM5A 2Q2IA 5BN3A 1BKBA 4P75A 1EFWA 1WTHA 4DV5L 4A4IA 5HURA 2VB3X 5C44G 4A3IH 4OX9L 2CW0C 5KNBA 1XXGA 3FKIH 4LFBL 2CWPA 1D6EC 1H9MA 4OO1G 3GTGH 1TWCB 1PTOD 1IYJB 1KLGD 4BBSG 1MI2A 4Q0FA 1YHQA 3SK4A 5C0XH 2B2VC 4FF4A 1IL2A 3W1GA 5CV7A 1B3QA 3S1QB 2Y0SG 5C0XJ 4RA8A 4A3GH 3D6CA 2E8GA 2EJFC 2Z8LA 4KJOA 1VQPA 1KRSA 4IZ8A 2E75C 4IOAA 2CCZA 3PMFA 1EL0A 5EAYA 1XMQQ 1YITA 1HZ9A 2A6ED 3ND9A 4IOCA 1VQMA 1YHBA 2KHIA 3KK7A 4KV6A 2UXDQ 3E6ZX 4OONA 2RBMA 4L6TB 1TS3A 2VZAA 4FNFA 5FJ8G 3D4DA 1IBKL 4IPHA 4J15A 3C1EA 3KLRA 5C3EH 3Q23A 5JVG3 2WB1E 4IUPA 2SDFA 3KJPA 2NUCA 1NSNS 1VQ6A 3TEHB 2JK8A 2F3WA 3L0OA 5C5LA 5JJLA 3S2HH 2PNRC 1FR3A 4WFN3 2MGSA 5IP7G 3I7FA 3F2BA 3GTMH 2ZTDA 3VR2A 4IUTA 1TXYA 2UXDL 3J80c 2F0UA 4R9WA 1M8AA 5IT9E 1S40A 3STBC 2FMCA 1WCMH 3EBEA 2YYZA 4R4CA 2F52A 2IPKD 3A0JA 3ERSX 3CPWA 3HFZB 2H1EA 3OWEB 4M1UB 5K36G 4U68A 4IALA 4GN4B 4JV5L 3ERQA 3OYYA 1A8VA 4B3TQ 2F0MA 4RH6A 5IYBG 1XMOQ 5LMNQ 2CKZB 4GNXA 1BUVT 1SMXA 1SXTA 4LF9Q 4JYAQ 4OXPA 3T1YQ 3X3NA 4C3JB 5ELEA 2F4VL 2EY5A 1O7YA 3K59A 1S5FD 2Z4IA 3L7ZC 1XMOL 1Q81C 1LTGD 2ZT9C 3BVZA 1O7IA 2ZXRA 4GN3B 2EY2A 5IY0A 3R2IA 2GVBA 5CORA 2VUMB 1SNDA 1STHA 2JA5B 4A3FH 2ZTEA 4KY6A 2EYPA 3GV3A 4DGZA 3KF8B 3MTSA 1SR3A 4C3HH 3W3AA 1QVGA 1QE6A 2ALYB 2PZTA 3GTPH 2KHJA 1PMRA 1C9OA 1D8LA 2F0DA 4LFAL 1RHPA 5C0XG 1QCBD 1PH2A 5JPMC 5C0XI 3R2TA 4DV2Q 3BDLA 3H94A 4K2LA 1MHWC 3RZDH 2RA4A 2B2UC 1A15A 2F0SA 2K28A 4XQNA 5IT9L 3GTQB 4AH6A 1L0WA 4DXGA 1V1PB 3NENA 5T1IA 2JA9A 4E6IA 2FXQA 2PZWA 3HOYH 4CGYB 4PZ6A 3EFXD 3SR1A 2B2VA 1X55A 3R93A 5DEHA 2E2JH 2J4XA 3NTHA 4KI0A 4GNXB 3UDFA 3F2UA 1FGBD 4IPDA 4PMCA 4PG3A 1HTLD 3MEHA 3I73A 4QQBX 3I4OA 5CMDA 1W3SA 1JR0D 4BY7G 2D9UA 1X9NA 1X3PA 3V2TA 1CUKA 4FXDA 3S2HB 5EBCA 1UEAB 1ZYRD 4B3ML 2B29A 4ME5A 3KF8A 4QIWE 3S1RB 1WD0A 1EY5A 2BOSA 4GOPC 4DV4Q 2HDMA 3M7GA 2NN6I 1TS4A 3TP7A 1LTRD 4BY7B 1HFGA 2IW3A 4R8NA 4JPBW 2CHBD 4XQQA 5E4WC 2D2CC 3TS2A 1XWEA 3DWPA 3DEPA 3PIOA 2HUGA 5JEAG 2NVTH 3SGIA 5I6YA 1JJCB 2YTYA 3BG3A 1K28A 1NJIC 3GTLH 2F0GA 4YY3Q 2CH4W 4TSSA 2OQKA 4DAYB 2EXDA 1OXVA 3EVQA 1AW7A 1CKNB 3I2ZA 1MBYA 4ID6A 4DR3Q 3S2DB 3Q22A 1N36L 1PHJA 1AN8A 2GVAA 4CHTB 4YHHQ 3U9OA 1K73C 4QCLA 2EJGC 3S15H 2DJFC 4DU9A 1N34L 3HOXB 3K8AA 3VA5A 3G6EA 2NN6G 2IY5B 5M3MB 1HH2P 4MTKA 4HJ5A 2XWBB 3Q6SA 3I3CA 2WAQB 4HCSA 4ME3A 2B63B 1X56A 3L2PA 4YY3L 2XSCA 1V9PA 2K05A 1EY7A 3IFTA 4N9TA 2YU9H 4DAMA 4IFDH 1BBXC 3A8KE 4DNRB 1HZBA 1K8AC 5C4XB 4DR1L 4LF5L 4KN7C 4RFBA 1VQ4A 1KXLA 2F0EA 5D3DA 1EQTA 4G7ZC 2CFMA 3H3VH 1IKMA 2FMMA 4LFAQ 3H3VC 1AH9A 1OXXK 3G7LA 4JI5L 4HR7B 5GAHC 1FGUA 2JA8G 1AE3A 4LFCL 1A3TA 2HQEA 5IYCG 3BZKA 3KF6A 1E2VA 3GP7A 1DOMA 3L9AX 3TP8A 1DM0B 4HIKA 2EYOA 4R4TA 3A5UA 2KBNA 5JPNC 5LHY1 4P73A 3GTPB 1YNJC 1B44D 1NMGA 5J39A 3JAML 5G3LD 1Y1VG 1XYIA 1Q8IA 2K6AA 4CDEC 5AFWA 4B9WA 1B70B 1FL0A 1DCZA 1N8RC 1F9RA 3NSWA 3JAMc 2DJGC 4R4OA 2YTXA 4H0LC 4MTNA 5C5MA 4AIMA 1U4PA 2PZUA 1QB5D 2KA7A 3D8GA 2B2TA 2F0FA 1CHQD 5D3IB 4HIOA 2JP1A 3NWSA 2A6HD 3NK9A 5EKKA 1E7ZA 3HKZG 2PO4A 4HJ9A 1WI5A 3DUZA 2WV6D 1FJGL 5C44B 3DWQA 3FMCA 4JI3Q 4HSVA 5E4XA 1U4MA 1NAPA 2ZTCA 3GD7A 5KNCA 2B2YC 2BE5C 3SK6A 1LUZA 3MWYW 3KF6B 1TWFH 4B3RQ 3FP9A 4A3LH 4UDUC 1K8MA 2K03A 3KOJA 3ER0A 4XQJA 2R7ZG 2RSOA 1NE3A 1RL2A 4H02A 2HCIA 4XT1B 3R8BA 1B9NA 1WTOA 3Q24A 4NXML 1EY9A 3CHBD 4O42A 1UWVA 1PXUA 3C2PA 5FLXE 1ET6A 2OCEA 3JAME 5G3LF 4DUYQ 4JG2A 5CV5A 5IOCA 4Y7NH 4BY1B 4JOIA 5C4XH 1CFMA 1I50H 1MKHA 4IFDG 2H5XA 3P7JA 3SE0A 3OIPA 4A76A 2F0HA 1D5ZC 2HCCA 1PYSB 1QZGA 1VQOA 2B2YA 4OIJA 1TY2A 1RCVD 3D4WA 3UDGA 2EPBA 3C1FA 4JI7L 1SYFA 1ENCA 1Y1VB 3MXUA 1XNQL 1EEFD 5I2XA 1SBBB 1E2ZA 3HS0C 1KC8C 4A3GB 2CW0D 4OEMB 3I4LA 3KLSX 5HGTA 1SYDA 1Q1BA 2KENA 3G71A 3CPFA 3DEOA 5ISRA 4LF9L 4JYAL 1XX8A 3PGZA 1TWCH 5CGKA 4JI6Q 2QF7A 1SEBD 1I4PA 2Q8IB 1GUWA 3FKIB 1VMPA 3IAYA 3A55A 4H44C 3S17B 1KL9A 2N49A 1CI3M 1XPOA 4IJLA 2MNAA 3M4YA 2PW7A 5E3FA 1SE4A 1I3QB 1I4HA 4LFCQ 1AFPA 3S14H 1O7LA 4AYBG 2JXMB 4JI5Q 4ZKCB 1S72A 4DUZL 3S1QH 4K0KQ 5EJWA 3GTQH 1X3FA 3ONAB 1SNQA 2PI2E 4X3UA 1L2FA 3PUYA 2L9HA 4GOPA 4DV0Q 1J5EQ 3GDEA 4BY7H 1YNJD 4DFAA 1EY4A 1VQEA 4DAVA 1JOKA 3BVGA 3SDZA 3M85A 4A3IB 3KFUA 4H7BA 1K3RA 2YTVA 4ZYSA 4KHPL 3MHBA 3EIVA 2B8GA 1LTTD 1SROA 2E74C 1C48A 2EYFA 3KBGA 4QMGA 4LW1A 3NP8A 4XYQA 2E2HB 2LY7A 1HNXL 4C3JH 1JWMD 4KHZA 1SDFA 2VL6A 3BS1A 1RIPA 2KCCA 3GTOH 2AUKA 5IYCH 3CCMA 1CKMA 4KY7A 4C3HG 1QVCA 3UE0A 4CKBA 2NVYB 2RCFA 4NXNL 1MJCA 1VS0A 1WTXA 2L15A 4X6AH 2FJ2A 3OHXC 1HPCA 3HZXA 4C3IB 2F0KA 4TVAB 5KYLA 2B63H 2K5WA 5M5WH 1EWCA 3LWUA 4BBRG 4BXXH 2K32A 3UDIA 2EOTA 2E5LL 1DYQA 4B3SQ 1Q86C 1LO5D 3CCUA 1PTOB 1IYVA 4FDBA 5CYUA 3PIP3 5KGUA 2VUMH 1FD7D 1A62A 2XVSA 1SJHD 3ULJA 4HEDA 5FO8B 2PMZE 1LTLA 1LTSD 3MAQA 1M4VA 5A2QL 1U4LA 3B6YA 3H91A 3HKSA 5C3EB 3ND8A 5M5XH 4RWSC 2AQ2B 1JICA 3PUVA 1C0AA 2B8FA 4KTAA 4CJ2C 2FINB 2I07B 4I7AA 3U58A 5JJKA 3PO3G 4A93H 1Q1EA 4DXFA 1F2LA 1JQYD 5K36H 1BOSA 2DNEA 2V1CC 1A63A 3F1ZA 1GKHA 1D5XC 4QJFA 1FNWA 1DJRD 1WTVA 2KVMA 3K81C 4GLXA 2N8NA 5EKIA 3ULPA 1DONA 4QUCA 2EY6A 3ITPA 4RGMA 1UNSA 5M5YH 3HOUG 4B3RL 3NHHA 1R4PB 2UU9L 1TIID 1IL8A 1EQQA 2NZOA 3OTOQ 5M3FH 1NBWA 2BCOA 4DV1Q 1PH9A 3KBXA 5M5YB 2K5HA 1STEA 5BR8Q 2VUMG 4JOIC 2F3VA 1EYAA 2PQAA 1IBLQ 4DF7A 3OIQA 1HUMA 3NPPA 3V05A 3K7UC 4DV0L 1J5EL 3DHQA 2XN9C 2NVQH 4JBKA 1CQFA 1JORA 1Z7TA 3D3RA 3VYUA 4YCUA 1PFBA 1EY6A 3WWVA 1WTPA 5JEAJ 2AWNA 2F4IA 2IX3A 1HZAA 2KCTA 1IBKQ 1VQ5A 4HN7A 3S16H 3NEMA 2LMCB 4G57A 1D7QA 1T9HA 4PMBA 1A6XA 2E2JB 2O4XA 2K7VA 1AZPA 4YCWA 3OOCA 1BCPD 2VQEL 1N32Q 1IBLL 2R93B 4C1NK 3QWNA 3HOZH 2F0JA 2JJQA 5DM73 1WOCA 1VQFA 3T51B 1SYGA 5I9PA 1PH4A 2ZJQA 2A69D 1WCMG 4RMFA 2ZJRA 1DZ1A 5IYBH 4POGA 5J3BA 1GUOA 1YNND 1CKNA 1XPUA 5IP9G 2BDNA 3TZUA 2Z0SA 4A3DB 1RODA 3K5OA 2C5CA 1PV4A 1RTOA 1H9RA 3VA7A 4B3SL 4DAPA 2R7FA 2PCFB 2IWHA 3I4NG 3NWTA 1X54A 1NY4A 5LMNL 2NTTA 5EKLA 4RG1A 2OTJA 2RHSB 1EEID 3M9BA 4WJ4A 3VR6A 1Y1WG 4ULLA 2EE1A 3I4MG 2KCNA 4NDXA 3HOVB 1A3UA 1P8LA 4PZ7A 2JA6G 1I3QH 1DOKA 3ULLA 4X62L 2F0PA 3RLOA 4DV5Q 3RUZA 1SE3A 3KLSA 4A3FB 4JCVE 4A3DH 3S1MH 4CKEA 1XNRQ 4K8JA 1EOTA 2F0TA 2JQOA 3HOVG 2B2WA 2NZHA 3FEWX 2MP1A 2HDLA 3BZCA 1H9JA 5KYIA 4A3JH 2L0CA 2XWJB 2VW9A 4GKJL 3X3MA 1HR0W 3QJYA 1S5BD 3DM1A 3OW2A 1PFMA 4LF6Q 1RKNA 5AJ3Q 5FLXc 2QGQA 3DLLA 2F03A 4APVA 1FYCA 3PO2H 4I65A 4QY7A 4LF6L 1FNUA 5FOBB 4K2KA 3AU7A 3TDQA 2WINB 3E0JA 4EGVA 3KDFA 5FLMH 2K5QA 1EOVA 5I2YA 3V96A 4DV4L 4TRDA 1JC7A 5C3EG 3K5MA 4BXXG 2NVQB 1YIJA 2B2UA 1HNXQ 2PQAB 1E1TA 1BCPB 5GROA 3NBHB 1TWHB 1CK1A 1JOQA 4NW2A 3OMGA 1EUJA 1AEXA 3RD4A 4NXMQ 1JCKB 1N33L 3E0EA 1H95A 5ELNA 1E24A 4C3JG 2I5LX 2F0WA 2E2IB 3NBIA 1SFOB 3NXWA 1AE2A 2A1AA 5FLMG 1MJEA 2J7ZA 1Y69U 1S5DD 1WYDA 1CSQA 3N6RA 4CBVA 4JBMA 1KABA 3A7LA 1KQSA 4FVMA 4DK3C 1MSGA 1PYBA 2I5MX 4JVZA 4DR3L 1Z9FA 2ZM6L 1EU3A 4NXNQ 2XRSD 1KD1C 2BDOA 2Q2UA 4A93G 1PDQA 2LS01 2K14A 3BJUA 2IX0A 1L1OB 1GHJA 2ICEC 4DR7L 4BBSH 1G6ZA 4KJNA 3J80E 4R1JA 3K5NA 3D6WA 1EIYB 1EIGA 1GUNA 3OMCA 4IN3A 3VR3A 1SAPA 2L55A 4A3IG 4DUYL 4HAEA 4CDFC 1KIXA 3TSSA 1QZHA 1TY0A 3I8ZA 5BN4A 4ALPA 4V190 2A5HA 3S24A 2JA6H 4P71A 1YVCA 5ELOA 4DV3L 2ATWA 2Z6KA 2L4NA 5A2QE 4OIKA 4C3IH 1B9MA 2FFKB 4DNTB 4K5VA 4QGUA 3GQBA 3PUZA 3SK5A 3ICEA 5ELFA 2D62A 4AQYL 2EDGA 1KNEA 2WIIB 4JI8L 3GTJB 5H1SE 3RZOH 2RSNA 2CWAA 3HP3A 2KQ3A 4J6HA 2WB1B 2N3SA 4FYDA 1KDCA 2NTSA 1SYCA 3T53B 4K0KL 3ZYYX 3I91A 3A5ZB 1VMCA 1NUCA 4NKLA 4JI8Q 1QILA 5ELDA 4KHPQ 3RZDB 4MZ9A 1OTCA 3D4RA 4CJ1B 1HR0L 3RLNA 2WKDA 1LT5D 3BVMA 3VYRA 1JJGA 1EZ8A 3TMEA 2YV5A 1BBWA 1VDZA 2RVLA 4XT3B 1QUQA 2UUAQ 2NBFA 1MSHA 5AJ3L 1PA6A 3NQIA 1MIUA 2QDBA 3U50C 3H6MA 2VXWA 2ZXPA 4R8IA 5CV6A 5CV9A 3T1HL 2CH4A 1KLUD 1UE1A 5JOBA 2IL8A 4OHJA 2UXBQ 2EYHA 2A8VA 4C2MH 5M5WB 1KRTA 5IYDH 2NZ1D 1IZ6A 1RJTA 3H09A 3P20A 4X66L 5KIXA 2PMZB 4B3TL 1SYEA 3S1NH 1HQMC 3QOJA 2VQEQ 4J1MA 1U5KA 3CRKC 3CU7A 4FF2A 2EY1A 2N55A 3VYSA 3A74A 1SMYD 2KHSA 4NP5A 1Y1WH 1S4ZA 3CCSA 4KD3A 2RCNA 3J7YW 3QO2A 4IUVA 2BH2A 3QR8A 2Z1CA 4LMQD 1JWSD 1LLRD 4LAAA 1LM0A 1JB3A 2MUYA 3LWEA 5IWAL 3S15B 3S17H 3FRPB 4GLAC 2E2DC 1YEZA 2AQ1B 2G9DA 4OWWB 1GUSA 1ET9A 1LTBD 3TN2A 4YWLA 4LK1C 3PQIA 1SNMA 2K75A 5DNFA 4DNIA 4X3TA 4EQNA 5LMUL 2UUBL 3OTOL 5ELBA 1VF5C 2ENBA 3MXNB 2RDGA 2TMPA 3HOXG 3I55A 5IGCA 3EN2A 1B1ZA 2NVTB 3IFDA 3HOUB 1SE2A 4DV3Q 4JI0Q 3U9SA 5IP9H 4X65L 4I7ZC 1F2MA 2QEJC 3J81E 3GO5A 1EYCA 4LUZA 3TZDA 2NWGA 3N52A 5IE8A 1HRJA 4X62Q 3MFGA 2MPMA 3UI2A 4MIUA 4LUOA 2KJXA 2AMCB 3PO2B 4ZKBB 5JVH3 3K0XA 3MZ5A 3H0GH 1HA5A 3MFYA 1KNAA 3A7AB 3PSIA 1HQRD 1CQVA 3HGBA 4UPAA 4LF7L 4UY8C 2E2IH 4LUVA 2JEAI 2ZJPA 1HUNA 1UE6A 1TWFB 1D1IA 4JI6L 1YNXA 4A3MG 4K5XA 3CMAA 3MC0B 3QIAA 1L1OC 2R92H 1B53A 2KUMA 3J81j 3KYHC 2R93G 1EWHA 1I94Q 5C4JH 2IHEA 2HIVA 1EZ6A 2JSOA 4FXGC 1K0RA 4BWGB 1PH3A 4LFBQ 3SXHA 3R3OA 4GN5A 4RGOS 1IW7D 3HG9A 1SMYC 5D65A 4CDDC 2KEEA 2KEDA 3CCJA 4ZLTF 1Y8PB 3FPPA 4BY1H 1G51A 1WTQA 1JB7A 1LTAD 2BA1A 4F87A 3PO2G 5DM63 1YJWA 3A8IE 5FK9C 5C4XG 5E7NA 2DGYA 5E1FA 3I4NB 3LNNA 2AKWB 4L5QA 3M3YH 4TKOB 4KKSA 1ML0D 1G2TA 1U0LA 2Q8RE 4OWXB 1W6JA 3VR4A 4OGQC 2UU9Q 2LXJA 2EQSA 2R3ZA 4RHRA 1F2ZA 1AZQA 3Q8DA 5COYA 1TVXA 5D14A 1HNZL 1K3BC 1SNOA 5C44H 2K52A 2G9HD 1Q90A 3RN5A 1CA5A 5LL6S 1LACA 4XDXA 4WJWA 2NVXH 2UUCL 1Q12A 4LF4Q 3FHWA 1FNVA 2PQEA 1B7YB 4N8FA 4PMWA 5EPLA 1B8AA 1NR4A 3NQTA 4X3KA 1DOLA 3J80i 4IURA 3M4OB 4PZ8A 3EQLC 4HTHA 1CZGA 4UAIA 3G48A 3S16B
chains in the Genus database with same CATH topology
4PZ6A 4YCWA 2VQEL 1WJJA 4DPGA 1X55A 4DR2Q 5HGQA 4JI1Q 3T1YL 2E2JH 1SFOH 1N32Q 4KI0A 4GNXB 4LWCA 3UDFA 4X64L 1ASZA 4DR6Q 1GO3E 1E3PA 1NMFA 3BU2A 4IPDA 2QEXA 4PG3A 1IBLL 5BR8L 2JA5G 4GKJQ 4QQBX 3HOWG 3HOZH 2JJQA 3I4OA 1WOCA 1X6OA 2HHHQ 1VQFA 1W3SA 4JI4Q 4BA1I 4A3FG 1PH4A 4BY7G 2ZJQA 1WCMG 4DV1L 1PH7A 4RMFA 3CXCA 1X9NA 2ZJRA 5IYBH 4POGA 5J3BA 1CKNA 1CUKA 3K80C 1VQLA 2MO1A 1V43A 5IP9G 1M90C 1XPUA 1E22A 3E9IA 2BA0A 2Z0SA 1N33Q 1K9MC 4GS3A 3CCVA 2B29A 1VQKA 4B3ML 4QIWE 1OXTA 4KLKA 2F4VQ 4GOPC 1OXUA 4DV4Q 1Q46A 1PV4A 3AYHB 4GLVB 4B3SL 2E5LQ 3FKIG 3VDYA 2R7FA 2NN6I 3KDFB 3I4NG 1X54A 1NY4A 5LMNL 3AFPA 3PF5A 4A3DG 4RG1A 4Y52H 2Q2TA 2OTJA 2OWOA 1HNWL 3H3VI 2RHSB 3M9BA 4WJ4A 1Y1WG 3H15A 2HT1A 3I4MG 3TS2A 2D0PA 4LF8Q 3PIOA 3J81i 5JEAG 3F2CA 3KJOA 3K7AH 2NVTH 3SGIA 2VQFQ 1I6HH 2JA7H 4JI1L 2PI2A 1QUQB 4YWMA 1BVSA 1JJCB 2YTYA 4JC0A 4NB3A 4A3EG 4L5RC 1P8LA 1J6QA 2B3GA 2C35B 1NJIC 2UXCQ 3CW2C 3GTLH 5LMUQ 4YY3Q 2UUBQ 4PZ7A 2JA6G 5M3MH 1I3QH 3ULLA 4R4QA 2OQKA 4X62L 4B3MQ 4JI3L 1YZ6A 2EIFA 3RLOA 4DAYB 4DV5Q 2LXKA 2EXDA 1OXVA 4JCVE 2CQOA 1G291 1CKNB 4IJHA 4A3DH 2ZM6Q 3S1MH 1WFQA 5GAEC 3I2ZA 4DR3Q 1XNRQ 4R4IA 2JQOA 3CF5A 3HOVG 2NZHA 3CCEA 4IPCA 1N36L 1PHJA 1Z47A 2VY3A 2GVAA 3BZCA 4UP9A 1PH5A 1VQDA 4YHHQ 4HJ7A 1K73C 4JI0L 1FJGQ 4A3JH 1I5FA 4JI2Q 4A3KH 3S15H 2VW9A 1PH6A 3HOWH 4GKJL 1N34L 3K8AA 4IPGA 1HR0W 3G6EA 2NN6G 2IY5B 2K5NA 1HH2P 4HJ5A 3OW2A 4O2DA 4LF6Q 5AJ3Q 1BBUA 1CKOA 5FLXc 2UUAL 2QGQA 4ME3A 1X56A 3L2PA 2NVYH 4GOPB 4YY3L 3DLLA 1YJ9A 3PUWA 1V9PA 4APVA 1X3EA 3PO2H 2YU9H 1JE5A 1VQ7A 4QY7A 1TWGH 4DAMA 4LF6L 2R93H 3IRBA 3I56A 1HZBA 4JI7Q 2OTLA 1V1QA 4DV6Q 1K8AC 2QA4A 4DR1L 4LF5L 3KDFA 1XTDA 5FLMH 1VQ4A 1KXLA 1EOVA 1PFSA 4DV4L 2CFMA 4TQUS 1OXSC 5C3EG 4IO9A 3H3VH 4LFAQ 4BXXG 2Z6KC 4DV6L 1AH9A 2E2HH 5LMNW 1OXXK 4HJAA 4JI5L 1LYLA 5GAHC 1YIJA 1FGUA 1HNZQ 1HNXQ 3GTKH 4P72A 2PQAB 1E1TA 1K83H 5GROA 2JA8G 1AE3A 2Q2HA 3NBHB 4YWKA 4LFCL 4EQ5A 3G4SA 1SN8A 2AHOB 4JBJA 4AQYQ 2JA7G 2HQLA 1HJPA 2MFIA 5IYCG 3BZKA 3F8TA 3KF6A 4POFA 1EUJA 3M4QA 4NXMQ 4WJ3M 3D0FA 5IP7H 4HIKA 2RHQB 1N33L 3E0EA 4BBRH 1I94L 4R4TA 3A5UA 2HHHL 2KBNA 1E24A 5ELNA 5M3MG 1QVFA 1H95A 4A75A 2I5LX 4P73A 2VQFL 3CCQA 3TREA 1AE2A 1NMGA 2A1AA 5FLMG 1Q8KA 1YBYA 4UP7A 3TQYA 1YJNA 1MJEA 2B63G 5IWAQ 1Y1VG 1SE8A 3KLWA 1UE5A 2MO0A 4O0AA 4HIMA 1WYDA 1CSQA 1B70B 4JBMA 1KQSA 1FL0A 1N8RC 4DK3C 1PYBA 2I5MX 2VS1A 1TWAH 1KHIA 4DR3L 3JAMc 1XNRL 1Z9FA 2ZM6L 4NXNQ 3T1HQ 5FJ8H 4R4OA 4L5TA 2YTXA 1KD1C 2Q2UA 4MTNA 4A93G 1EQRA 4AIMA 1XJVA 1SRUA 1S3OA 1GVPA 2JE6I 4OWTB 2K14A 1IXRA 3M7NA 3PO3H 4GKKL 2KCMA 3UDXA 2WAQE 3BJUA 2IX0A 1L1OB 4JBWA 1PH1A 3LGJA 4HIOA 4DR7L 1IBML 4BBSH 3NELA 4LF4L 3D31A 3TS0A 4R1JA 1E7ZA 1EIYB 1PH8A 3HKZG 3CMEA 2UUCL 4HJ9A 1WI5A 3J7A5 3RNUA 4JI2L 1PVOA 1FJGL 4A3IG 1SLJA 4DUYL 3CD6A 1DGSA 2D0OA 1KIXA 4JI3Q 1N9WA 1QZHA 3U4ZA 2ZTCA 3GD7A 3W5OA 4ALPA 3ZJYC 3S24A 2JA6H 4P71A 1YVCA 1VQNA 5ELOA 4X64Q 4X65Q 1LUZA 4DV3L 2ATWA 3KF6B 2Z6KA 1TWFH 3I4NH 3PUXA 4B3RQ 3FP9A 4DR2L 4OO1I 4A3LH 1XNQQ 3PV0A 2JA8H 2R92G 3RLFA 1JT8A 1TWHH 3KOJA 3ER0A 1YI2A 2HIXA 4C3IH 1HR0Q 2R7ZG 4H02A 1NE3A 1RL2A 2R6GA 2ES2A 2I0QA 5IT9c 1XMQL 1ASYA 2AWOA 3J81c 4A3KG 4NXML 1UWVA 1VQGA 4QGUA 3PUZA 3ICEA 2OCEA 2D62A 4XTCS 4AQYL 2K50A 4DUYQ 4JG2A 4Y7NH 4MNOA 4AYBE 4JI8L 3HOVH 1YHAA 4JOIA 5H1SE 5C4XH 4DV2L 4DR5Q 1I50H 1MKHA 2CWAA 3RZOH 4IFDG 2H5XA 2N3SA 4A3JG 1R9TH 1FVIA 3HOZG 4K0KL 4A76A 3AQQA 1PYSB 4A3CG 3A5ZB 1QZGA 4EX5A 1VQCA 1VQOA 1IBMQ 3S1RH 4JI8Q 5GADC 4KHPQ 3RN2A 4MZ9A 1OTCA 3UDGA 1HR0L 3E9HA 3RLNA 4HIDA 1JJGA 3AEVA 4DR4L 4JI7L 3U4VA 4A3BG 3HKZE 2YV5A 1BBWA 1XNQL 1QUQA 2UUAQ 5AJ3L 1PA6A 3HOYG 1MIUA 3U50C 3T1HL 1KC8C 1HZCA 1UE1A 2A19A 3TRZA 3H0GG 2WAQG 2K4KA 2LSSA 4A3BH 1Q1BA 2KENA 5HY6A 3PCOB 4DKAC 3G71A 1K8GA 3CPFA 2A8VA 5GQOA 4C2MH 2UXBQ 1KRTA 3CQZH 3CC4A 5IYDH 3UE1A 4LF9L 2BH8A 4JYAL 1IZ6A 3PGZA 1TWCH 4GNXC 4JI6Q 4X66L 4A3CH 2N78A 3JAMi 3CC2A 2Y0SE 4B3TL 1N32L 1M1KC 3S1NH 4JV5Q 2JA5H 2UXBL 1E1OA 2I5HA 2VQEQ 1N36Q 1KL9A 4BY1G 2N49A 1U5KA 1A0IA 4LNQA 2K5VA 4A3GG 4DR4Q 1VQ8A 5DLQE 1XPOA 4IJLA 1VQHA 2OQ0A 2MNAA 3PIPA 3A74A 4YCVA 4NPSA 4LFCQ 3S14H 3MEFA 1Y1WH 5M3FG 2F3IA 4AYBG 4DV7Q 3I4MH 3M4PA 3CCSA 3W1BA 4A3MH 4JI5Q 1S72A 2RCNA 4DUZL 3S1QH 4K0KQ 3GTQH 1X3FA 2BH2A 3HOUH 2PI2E 3PF4A 5GAGC 1L2FA 3PUYA 4GOPA 1LM0A 4DV0Q 1J5EQ 3GDEA 4IFDJ 4BY7H 5IWAL 4P74A 3S17H 2JEBI 2XGTA 4GLAC 1VQEA 2WFWA 2WP8J 1YEZA 4OWWB 1GM5A 2Q2IA 4YWLA 1BKBA 4P75A 1EFWA 2VNUD 4DV5L 4A4IA 3M85A 5C44G 4A3IH 4OX9L 3KFUA 2K75A 4DNIA 1W2BA 1CSPA 5LMUL 2UUBL 1K3RA 2RF4A 2YTVA 3FKIH 3RR5A 3OTOL 4LFBL 2CWPA 4KHPL 3EIVA 4OO1G 3GTGH 3MXNB 3STBD 1IYJB 1SROA 4BBSG 1YHQA 1VQAA 3I55A 3HOXG 1JMCA 1N34Q 3EN2A 1Q7YC 4BA2I 2ID0A 4LW1A 1IL2A 3W1GA 4DV3Q 1KAWA 4JI0Q 5JJIA 5IP9H 4X65L 2Y0SG 1HNXL 5C0XJ 4A3GH 4C3JH 2E8GA 4KHZA 1VQPA 2VL6A 1KRSA 1RIPA 3GO5A 3CC7A 2IT1A 4LUZA 4IOAA 2R7ZH 2CCZA 3GTOH 1L1OA 5EAYA 5IYCH 1XMQQ 1YITA 4A3EH 4DR7Q 5IE8A 4X62Q 3CCMA 1HZ9A 1C7YA 1CKMA 4IOCA 4LUOA 5IYDG 1VQMA 3M4OH 1YHBA 2KHIA 2UXDQ 2AMCB 4OONA 2VZAA 5FJ8G 1QVCA 1IBKL 3K0XA 3H0GH 4IPHA 4J15A 3UE0A 1NTGA 5C3EH 2WB1E 4NXNL 1MJCA 1VS0A 3PSIA 3KJPA 1EYGA 3J7ZC 1GD7A 1VQ6A 2L15A 4X6AH 3TEHB 2JK8A 4UPAA 4LF7L 4UY8C 4TVAB 2E2IH 3L0OA 4LUVA 2UUCQ 2JEAI 4LF7Q 2B63H 5JJLA 2ZJPA 3CP0A 3S2HH 1UE6A 4UP8A 5M5WH 4JI6L 1YNXA 4A3MG 4BBRG 4BXXH 2E5LL 3UDIA 5IP7G 3I7FA 3CMAA 1VQBA 3F2BA 4B3SQ 1Q86C 3GTMH 3CCUA 4FDBA 2ZTDA 1L1OC 2R92H 2VUMH 1TXYA 2ASBA 2UXDL 3J80c 1A62A 2IX1A 3J81j 1S40A 2UXCL 3STBC 2DUDA 3KYHC 3ULJA 4L5SA 1WCMH 2PMZE 2YYZA 3EBEA 1LTLA 4R4CA 4DV7L 4GKKQ 1I94Q 2R93G 2F52A 5C4JH 2IHEA 2HIVA 3ERSX 3A0JA 3CPWA 1K0RA 4QL5A 1PH3A 1X65A 3B6YA 2GN5A 3HKSA 3HFZB 3CCRA 4LFBQ 1VQIA 5M5XH 4GN5A 3GTJH 4LF8L 3PUVA 1C0AA 5K36G 4JI4L 4GN4B 2IHFA 4JV5L 3U58A 3OYYA 5JJKA 3PO3G 1A8VA 1VCIA 3CCJA 4B3TQ 1Q1EA 4A93H 1HNWQ 4DK6C 5IYBG 1XMOQ 4BY1H 1G51A 2CKZB 5LMNQ 1X3GA 4GNXA 4DR6L 1SMXA 1JB7A 4LF9Q 2V1CC 2BA1A 4IFDI 3F1ZA 4JYAQ 1A63A 3PO2G 4OXPA 3T1YQ 1YJWA 1GKHA 4QJFA 5C4XG 3K81C 2DGYA 5E7NA 2PNHA 2N8NA 4GLXA 2F4VL 4DR1Q 4LF5Q 1EIFA 1XMOL 3L7ZC 1Q81C 3ULPA 2AKWB 4L5QA 3M3YH 5M5YH 3HOUG 1O7IA 4OX9Q 4B3RL 4GN3B 1U0LA 5IY0A 2UU9L 4OWXB 1UEBA 2GVBA 3HOXH 4XIGS 1EWIA 2UU9Q 1EQQA 2NZOA 3OTOQ 1UE7A 2LXJA 5M3FH 1NBWA 2EQSA 4A3FH 4DV1Q 2ZTEA 1P16A 1PH9A 3CCLA 2R7DA 3KF8B 1Y14B 2K5HA 1SR3A 4C3HH 3S2DH 3DM3A 3Q8DA 1QVGA 1Q82C 4A3LG 2ALYB 1HNZL 4HJ8A 5BR8Q 2VUMG 3GTPH 2KHJA 5C44H 4JOIC 3F2DA 2K52A 4X66Q 1C9OA 1D8LA 2XTIA 2PQAA 1IBLQ 1G6PA 3RN5A 4LFAL 4DUZQ 2NVXH 3K7UC 5C0XG 1PH2A 1Q12A 5C0XI 4DV0L 4YHHL 4DR5L 1J5EL 3FHWA 3JC66 4DV2Q 4LF4Q 2NVQH 4JBKA 1B7YB 3RZDH 1JJ2A 4PMWA 1VQJA 1B8AA 4YCUA 1XPRA 3WWVA 5JEAJ 1Y1VH 2AWNA 2MQHA 1VQ9A 1HZAA 2KCTA 3J80i 4AH6A 3CAMA 1L0WA 1IBKQ 1VQ5A 3S16H 3NEMA 2WB1G 3NENA 4PZ8A 2JA9A 1D7QA 2FXQA 1T9HA 3AFQA 3HOYH 3G48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZ6 A;  4YCW A;  2VQE L;  1WJJ A;  4DPG A;  1X55 A;  4DR2 Q;  5HGQ A;  4JI1 Q;  3T1Y L;  2E2J H;  1SFO H;  1N32 Q;  4KI0 A;  4GNX B;  4LWC A;  3UDF A;  4X64 L;  1ASZ A;  4DR6 Q;  1GO3 E;  1E3P A;  1NMF A;  3BU2 A;  4IPD A;  2QEX A;  4PG3 A;  1IBL L;  5BR8 L;  2JA5 G;  4GKJ Q;  4QQB X;  3HOW G;  3HOZ H;  2JJQ A;  3I4O A;  1WOC A;  1X6O A;  2HHH Q;  1VQF A;  1W3S A;  4JI4 Q;  4BA1 I;  4A3F G;  1PH4 A;  4BY7 G;  2ZJQ A;  1WCM G;  4DV1 L;  1PH7 A;  4RMF A;  3CXC A;  1X9N A;  2ZJR A;  5IYB H;  4POG A;  5J3B A;  1CKN A;  1CUK A;  3K80 C;  1VQL A;  2MO1 A;  1V43 A;  5IP9 G;  1M90 C;  1XPU A;  1E22 A;  3E9I A;  2BA0 A;  2Z0S A;  1N33 Q;  1K9M C;  4GS3 A;  3CCV A;  2B29 A;  1VQK A;  4B3M L;  4QIW E;  1OXT A;  4KLK A;  2F4V Q;  4GOP C;  1OXU A;  4DV4 Q;  1Q46 A;  1PV4 A;  3AYH B;  4GLV B;  4B3S L;  2E5L Q;  3FKI G;  3VDY A;  2R7F A;  2NN6 I;  3KDF B;  3I4N G;  1X54 A;  1NY4 A;  5LMN L;  3AFP A;  3PF5 A;  4A3D G;  4RG1 A;  4Y52 H;  2Q2T A;  2OTJ A;  2OWO A;  1HNW L;  3H3V I;  2RHS B;  3M9B A;  4WJ4 A;  1Y1W G;  3H15 A;  2HT1 A;  3I4M G;  3TS2 A;  2D0P A;  4LF8 Q;  3PIO A;  3J81 i;  5JEA G;  3F2C A;  3KJO A;  3K7A H;  2NVT H;  3SGI A;  2VQF Q;  1I6H H;  2JA7 H;  4JI1 L;  2PI2 A;  1QUQ B;  4YWM A;  1BVS A;  1JJC B;  2YTY A;  4JC0 A;  4NB3 A;  4A3E G;  4L5R C;  1P8L A;  1J6Q A;  2B3G A;  2C35 B;  1NJI C;  2UXC Q;  3CW2 C;  3GTL H;  5LMU Q;  4YY3 Q;  2UUB Q;  4PZ7 A;  2JA6 G;  5M3M H;  1I3Q H;  3ULL A;  4R4Q A;  2OQK A;  4X62 L;  4B3M Q;  4JI3 L;  1YZ6 A;  2EIF A;  3RLO A;  4DAY B;  4DV5 Q;  2LXK A;  2EXD A;  1OXV A;  4JCV E;  2CQO A;  1G29 1;  1CKN B;  4IJH A;  4A3D H;  2ZM6 Q;  3S1M H;  1WFQ A;  5GAE C;  3I2Z A;  4DR3 Q;  1XNR Q;  4R4I A;  2JQO A;  3CF5 A;  3HOV G;  2NZH A;  3CCE A;  4IPC A;  1N36 L;  1PHJ A;  1Z47 A;  2VY3 A;  2GVA A;  3BZC A;  4UP9 A;  1PH5 A;  1VQD A;  4YHH Q;  4HJ7 A;  1K73 C;  4JI0 L;  1FJG Q;  4A3J H;  1I5F A;  4JI2 Q;  4A3K H;  3S15 H;  2VW9 A;  1PH6 A;  3HOW H;  4GKJ L;  1N34 L;  3K8A A;  4IPG A;  1HR0 W;  3G6E A;  2NN6 G;  2IY5 B;  2K5N A;  1HH2 P;  4HJ5 A;  3OW2 A;  4O2D A;  4LF6 Q;  5AJ3 Q;  1BBU A;  1CKO A;  5FLX c;  2UUA L;  2QGQ A;  4ME3 A;  1X56 A;  3L2P A;  2NVY H;  4GOP B;  4YY3 L;  3DLL A;  1YJ9 A;  3PUW A;  1V9P A;  4APV A;  1X3E A;  3PO2 H;  2YU9 H;  1JE5 A;  1VQ7 A;  4QY7 A;  1TWG H;  4DAM A;  4LF6 L;  2R93 H;  3IRB A;  3I56 A;  1HZB A;  4JI7 Q;  2OTL A;  1V1Q A;  4DV6 Q;  1K8A C;  2QA4 A;  4DR1 L;  4LF5 L;  3KDF A;  1XTD A;  5FLM H;  1VQ4 A;  1KXL A;  1EOV A;  1PFS A;  4DV4 L;  2CFM A;  4TQU S;  1OXS C;  5C3E G;  4IO9 A;  3H3V H;  4LFA Q;  4BXX G;  2Z6K C;  4DV6 L;  1AH9 A;  2E2H H;  5LMN W;  1OXX K;  4HJA A;  4JI5 L;  1LYL A;  5GAH C;  1YIJ A;  1FGU A;  1HNZ Q;  1HNX Q;  3GTK H;  4P72 A;  2PQA B;  1E1T A;  1K83 H;  5GRO A;  2JA8 G;  1AE3 A;  2Q2H A;  3NBH B;  4YWK A;  4LFC L;  4EQ5 A;  3G4S A;  1SN8 A;  2AHO B;  4JBJ A;  4AQY Q;  2JA7 G;  2HQL A;  1HJP A;  2MFI A;  5IYC G;  3BZK A;  3F8T A;  3KF6 A;  4POF A;  1EUJ A;  3M4Q A;  4NXM Q;  4WJ3 M;  3D0F A;  5IP7 H;  4HIK A;  2RHQ B;  1N33 L;  3E0E A;  4BBR H;  1I94 L;  4R4T A;  3A5U A;  2HHH L;  2KBN A;  1E24 A;  5ELN A;  5M3M G;  1QVF A;  1H95 A;  4A75 A;  2I5L X;  4P73 A;  2VQF L;  3CCQ A;  3TRE A;  1AE2 A;  1NMG A;  2A1A A;  5FLM G;  1Q8K A;  1YBY A;  4UP7 A;  3TQY A;  1YJN A;  1MJE A;  2B63 G;  5IWA Q;  1Y1V G;  1SE8 A;  3KLW A;  1UE5 A;  2MO0 A;  4O0A A;  4HIM A;  1WYD A;  1CSQ A;  1B70 B;  4JBM A;  1KQS A;  1FL0 A;  1N8R C;  4DK3 C;  1PYB A;  2I5M X;  2VS1 A;  1TWA H;  1KHI A;  4DR3 L;  3JAM c;  1XNR L;  1Z9F A;  2ZM6 L;  4NXN Q;  3T1H Q;  5FJ8 H;  4R4O A;  4L5T A;  2YTX A;  1KD1 C;  2Q2U A;  4MTN A;  4A93 G;  1EQR A;  4AIM A;  1XJV A;  1SRU A;  1S3O A;  1GVP A;  2JE6 I;  4OWT B;  2K14 A;  1IXR A;  3M7N A;  3PO3 H;  4GKK L;  2KCM A;  3UDX A;  2WAQ E;  3BJU A;  2IX0 A;  1L1O B;  4JBW A;  1PH1 A;  3LGJ A;  4HIO A;  4DR7 L;  1IBM L;  4BBS H;  3NEL A;  4LF4 L;  3D31 A;  3TS0 A;  4R1J A;  1E7Z A;  1EIY B;  1PH8 A;  3HKZ G;  3CME A;  2UUC L;  4HJ9 A;  1WI5 A;  3J7A 5;  3RNU A;  4JI2 L;  1PVO A;  1FJG L;  4A3I G;  1SLJ A;  4DUY L;  3CD6 A;  1DGS A;  2D0O A;  1KIX A;  4JI3 Q;  1N9W A;  1QZH A;  3U4Z A;  2ZTC A;  3GD7 A;  3W5O A;  4ALP A;  3ZJY C;  3S24 A;  2JA6 H;  4P71 A;  1YVC A;  1VQN A;  5ELO A;  4X64 Q;  4X65 Q;  1LUZ A;  4DV3 L;  2ATW A;  3KF6 B;  2Z6K A;  1TWF H;  3I4N H;  3PUX A;  4B3R Q;  3FP9 A;  4DR2 L;  4OO1 I;  4A3L H;  1XNQ Q;  3PV0 A;  2JA8 H;  2R92 G;  3RLF A;  1JT8 A;  1TWH H;  3KOJ A;  3ER0 A;  1YI2 A;  2HIX A;  4C3I H;  1HR0 Q;  2R7Z G;  4H02 A;  1NE3 A;  1RL2 A;  2R6G A;  2ES2 A;  2I0Q A;  5IT9 c;  1XMQ L;  1ASY A;  2AWO A;  3J81 c;  4A3K G;  4NXM L;  1UWV A;  1VQG A;  4QGU A;  3PUZ A;  3ICE A;  2OCE A;  2D62 A;  4XTC S;  4AQY L;  2K50 A;  4DUY Q;  4JG2 A;  4Y7N H;  4MNO A;  4AYB E;  4JI8 L;  3HOV H;  1YHA A;  4JOI A;  5H1S E;  5C4X H;  4DV2 L;  4DR5 Q;  1I50 H;  1MKH A;  2CWA A;  3RZO H;  4IFD G;  2H5X A;  2N3S A;  4A3J G;  1R9T H;  1FVI A;  3HOZ G;  4K0K L;  4A76 A;  3AQQ A;  1PYS B;  4A3C G;  3A5Z B;  1QZG A;  4EX5 A;  1VQC A;  1VQO A;  1IBM Q;  3S1R H;  4JI8 Q;  5GAD C;  4KHP Q;  3RN2 A;  4MZ9 A;  1OTC A;  3UDG A;  1HR0 L;  3E9H A;  3RLN A;  4HID A;  1JJG A;  3AEV A;  4DR4 L;  4JI7 L;  3U4V A;  4A3B G;  3HKZ E;  2YV5 A;  1BBW A;  1XNQ L;  1QUQ A;  2UUA Q;  5AJ3 L;  1PA6 A;  3HOY G;  1MIU A;  3U50 C;  3T1H L;  1KC8 C;  1HZC A;  1UE1 A;  2A19 A;  3TRZ A;  3H0G G;  2WAQ G;  2K4K A;  2LSS A;  4A3B H;  1Q1B A;  2KEN A;  5HY6 A;  3PCO B;  4DKA C;  3G71 A;  1K8G A;  3CPF A;  2A8V A;  5GQO A;  4C2M H;  2UXB Q;  1KRT A;  3CQZ H;  3CC4 A;  5IYD H;  3UE1 A;  4LF9 L;  2BH8 A;  4JYA L;  1IZ6 A;  3PGZ A;  1TWC H;  4GNX C;  4JI6 Q;  4X66 L;  4A3C H;  2N78 A;  3JAM i;  3CC2 A;  2Y0S E;  4B3T L;  1N32 L;  1M1K C;  3S1N H;  4JV5 Q;  2JA5 H;  2UXB L;  1E1O A;  2I5H A;  2VQE Q;  1N36 Q;  1KL9 A;  4BY1 G;  2N49 A;  1U5K A;  1A0I A;  4LNQ A;  2K5V A;  4A3G G;  4DR4 Q;  1VQ8 A;  5DLQ E;  1XPO A;  4IJL A;  1VQH A;  2OQ0 A;  2MNA A;  3PIP A;  3A74 A;  4YCV A;  4NPS A;  4LFC Q;  3S14 H;  3MEF A;  1Y1W H;  5M3F G;  2F3I A;  4AYB G;  4DV7 Q;  3I4M H;  3M4P A;  3CCS A;  3W1B A;  4A3M H;  4JI5 Q;  1S72 A;  2RCN A;  4DUZ L;  3S1Q H;  4K0K Q;  3GTQ H;  1X3F A;  2BH2 A;  3HOU H;  2PI2 E;  3PF4 A;  5GAG C;  1L2F A;  3PUY A;  4GOP A;  1LM0 A;  4DV0 Q;  1J5E Q;  3GDE A;  4IFD J;  4BY7 H;  5IWA L;  4P74 A;  3S17 H;  2JEB I;  2XGT A;  4GLA C;  1VQE A;  2WFW A;  2WP8 J;  1YEZ A;  4OWW B;  1GM5 A;  2Q2I A;  4YWL A;  1BKB A;  4P75 A;  1EFW A;  2VNU D;  4DV5 L;  4A4I A;  3M85 A;  5C44 G;  4A3I H;  4OX9 L;  3KFU A;  2K75 A;  4DNI A;  1W2B A;  1CSP A;  5LMU L;  2UUB L;  1K3R A;  2RF4 A;  2YTV A;  3FKI H;  3RR5 A;  3OTO L;  4LFB L;  2CWP A;  4KHP L;  3EIV A;  4OO1 G;  3GTG H;  3MXN B;  3STB D;  1IYJ B;  1SRO A;  4BBS G;  1YHQ A;  1VQA A;  3I55 A;  3HOX G;  1JMC A;  1N34 Q;  3EN2 A;  1Q7Y C;  4BA2 I;  2ID0 A;  4LW1 A;  1IL2 A;  3W1G A;  4DV3 Q;  1KAW A;  4JI0 Q;  5JJI A;  5IP9 H;  4X65 L;  2Y0S G;  1HNX L;  5C0X J;  4A3G H;  4C3J H;  2E8G A;  4KHZ A;  1VQP A;  2VL6 A;  1KRS A;  1RIP A;  3GO5 A;  3CC7 A;  2IT1 A;  4LUZ A;  4IOA A;  2R7Z H;  2CCZ A;  3GTO H;  1L1O A;  5EAY A;  5IYC H;  1XMQ Q;  1YIT A;  4A3E H;  4DR7 Q;  5IE8 A;  4X62 Q;  3CCM A;  1HZ9 A;  1C7Y A;  1CKM A;  4IOC A;  4LUO A;  5IYD G;  1VQM A;  3M4O H;  1YHB A;  2KHI A;  2UXD Q;  2AMC B;  4OON A;  2VZA A;  5FJ8 G;  1QVC A;  1IBK L;  3K0X A;  3H0G H;  4IPH A;  4J15 A;  3UE0 A;  1NTG A;  5C3E H;  2WB1 E;  4NXN L;  1MJC A;  1VS0 A;  3PSI A;  3KJP A;  1EYG A;  3J7Z C;  1GD7 A;  1VQ6 A;  2L15 A;  4X6A H;  3TEH B;  2JK8 A;  4UPA A;  4LF7 L;  4UY8 C;  4TVA B;  2E2I H;  3L0O A;  4LUV A;  2UUC Q;  2JEA I;  4LF7 Q;  2B63 H;  5JJL A;  2ZJP A;  3CP0 A;  3S2H H;  1UE6 A;  4UP8 A;  5M5W H;  4JI6 L;  1YNX A;  4A3M G;  4BBR G;  4BXX H;  2E5L L;  3UDI A;  5IP7 G;  3I7F A;  3CMA A;  1VQB A;  3F2B A;  4B3S Q;  1Q86 C;  3GTM H;  3CCU A;  4FDB A;  2ZTD A;  1L1O C;  2R92 H;  2VUM H;  1TXY A;  2ASB A;  2UXD L;  3J80 c;  1A62 A;  2IX1 A;  3J81 j;  1S40 A;  2UXC L;  3STB C;  2DUD A;  3KYH C;  3ULJ A;  4L5S A;  1WCM H;  2PMZ E;  2YYZ A;  3EBE A;  1LTL A;  4R4C A;  4DV7 L;  4GKK Q;  1I94 Q;  2R93 G;  2F52 A;  5C4J H;  2IHE A;  2HIV A;  3ERS X;  3A0J A;  3CPW A;  1K0R A;  4QL5 A;  1PH3 A;  1X65 A;  3B6Y A;  2GN5 A;  3HKS A;  3HFZ B;  3CCR A;  4LFB Q;  1VQI A;  5M5X H;  4GN5 A;  3GTJ H;  4LF8 L;  3PUV A;  1C0A A;  5K36 G;  4JI4 L;  4GN4 B;  2IHF A;  4JV5 L;  3U58 A;  3OYY A;  5JJK A;  3PO3 G;  1A8V A;  1VCI A;  3CCJ A;  4B3T Q;  1Q1E A;  4A93 H;  1HNW Q;  4DK6 C;  5IYB G;  1XMO Q;  4BY1 H;  1G51 A;  2CKZ B;  5LMN Q;  1X3G A;  4GNX A;  4DR6 L;  1SMX A;  1JB7 A;  4LF9 Q;  2V1C C;  2BA1 A;  4IFD I;  3F1Z A;  4JYA Q;  1A63 A;  3PO2 G;  4OXP A;  3T1Y Q;  1YJW A;  1GKH A;  4QJF A;  5C4X G;  3K81 C;  2DGY A;  5E7N A;  2PNH A;  2N8N A;  4GLX A;  2F4V L;  4DR1 Q;  4LF5 Q;  1EIF A;  1XMO L;  3L7Z C;  1Q81 C;  3ULP A;  2AKW B;  4L5Q A;  3M3Y H;  5M5Y H;  3HOU G;  1O7I A;  4OX9 Q;  4B3R L;  4GN3 B;  1U0L A;  5IY0 A;  2UU9 L;  4OWX B;  1UEB A;  2GVB A;  3HOX H;  4XIG S;  1EWI A;  2UU9 Q;  1EQQ A;  2NZO A;  3OTO Q;  1UE7 A;  2LXJ A;  5M3F H;  1NBW A;  2EQS A;  4A3F H;  4DV1 Q;  2ZTE A;  1P16 A;  1PH9 A;  3CCL A;  2R7D A;  3KF8 B;  1Y14 B;  2K5H A;  1SR3 A;  4C3H H;  3S2D H;  3DM3 A;  3Q8D A;  1QVG A;  1Q82 C;  4A3L G;  2ALY B;  1HNZ L;  4HJ8 A;  5BR8 Q;  2VUM G;  3GTP H;  2KHJ A;  5C44 H;  4JOI C;  3F2D A;  2K52 A;  4X66 Q;  1C9O A;  1D8L A;  2XTI A;  2PQA A;  1IBL Q;  1G6P A;  3RN5 A;  4LFA L;  4DUZ Q;  2NVX H;  3K7U C;  5C0X G;  1PH2 A;  1Q12 A;  5C0X I;  4DV0 L;  4YHH L;  4DR5 L;  1J5E L;  3FHW A;  3JC6 6;  4DV2 Q;  4LF4 Q;  2NVQ H;  4JBK A;  1B7Y B;  3RZD H;  1JJ2 A;  4PMW A;  1VQJ A;  1B8A A;  4YCU A;  1XPR A;  3WWV A;  5JEA J;  1Y1V H;  2AWN A;  2MQH A;  1VQ9 A;  1HZA A;  2KCT A;  3J80 i;  4AH6 A;  3CAM A;  1L0W A;  1IBK Q;  1VQ5 A;  3S16 H;  3NEM A;  2WB1 G;  3NEN A;  4PZ8 A;  2JA9 A;  1D7Q A;  2FXQ A;  1T9H A;  3AFQ A;  3HOY H;  3G48 A; 
#chains in the Genus database with same CATH topology
 1WJJ A;  4G7H C;  2A73 B;  4JI1 Q;  5HGQ A;  1PRT F;  5J22 A;  2KOL A;  3AMU A;  1XTC D;  1GO3 E;  1E3P A;  1BQQ T;  2F0V A;  1TWG B;  3BU2 A;  3GTM B;  4C2M B;  2K1B A;  2A6E C;  2MJ8 A;  5KND A;  2JA5 G;  2F0O A;  1KDA A;  2HHH Q;  2RDF A;  4JI4 Q;  4BA1 I;  4A3F G;  1G91 A;  1H9S B;  4ZAI A;  4DV1 L;  4LJZ C;  2O5I C;  3K80 C;  1VQL A;  2MO1 A;  1V43 A;  1T5E A;  1M90 C;  1E22 A;  3E9I A;  2BA0 A;  4ZUJ A;  1PYW D;  1N33 Q;  3OPO A;  4GS3 A;  1VQK A;  1HXY D;  1STA A;  1OXT A;  4KLK A;  2B39 A;  1RF2 D;  4EQP A;  3AYH B;  4GLV B;  4KK7 A;  3FKI G;  4BS9 A;  3RZO B;  2BE5 D;  3BYT B;  3BDC A;  1OO9 B;  3AFP A;  3PF5 A;  1HTP A;  4Y52 H;  2Q2T A;  1HNW L;  4L8J A;  4X3S A;  1GOZ A;  1JWU D;  3H15 A;  2HT1 A;  3BZD B;  4AYB B;  4O1N A;  1STN A;  2D0P A;  3CRL C;  5CBA E;  3K7A H;  3K7A B;  2JA7 H;  2A6H C;  2K01 A;  2PI2 A;  1QUQ B;  4YWM A;  4RHS A;  4A3E G;  3HOW B;  3GTG B;  1J6Q A;  2C35 B;  3I4M B;  3CW2 C;  5M3M H;  4B3M Q;  4JI3 L;  1YZ6 A;  1LV9 A;  2ZXO A;  4IJH A;  2ZM6 Q;  1WFQ A;  4ZRZ A;  4R4I A;  5LL6 X;  1PTO H;  4IPC A;  1Z47 A;  2X6L A;  4UP9 A;  1KTK A;  1VQD A;  2WKC A;  5M3F B;  1H9S A;  4JI2 Q;  4WRD A;  4A3K H;  1SYB A;  5C6A A;  1PH6 A;  3HOW H;  5IGD A;  2CVR A;  3KUP A;  4BBS B;  2K5N A;  5CR3 A;  2H4O A;  1F9P A;  1UAP A;  3L3O C;  1BBU A;  1CKO A;  2UUA L;  1CTM A;  2NVY H;  3TBI B;  3EA6 A;  1NCV A;  3PUW A;  1ILQ A;  1I4G A;  4IQZ A;  5TSS A;  1HFN A;  1JE5 A;  1TWG H;  1O80 A;  1QJO A;  3OW7 A;  3IRB A;  3I56 A;  4JI7 Q;  5EQ0 A;  2QA4 A;  1J9O A;  3HEJ A;  4KN4 C;  4KY5 A;  1TWA B;  1GHK A;  3QG1 A;  1PFS A;  1PRT B;  4V0B A;  1JOO A;  1OXS C;  4IO9 A;  3VYT A;  2Z6K C;  5EBD A;  2E2H H;  4F7X A;  5LMN W;  1G8Z D;  2OEO A;  4HJA A;  1LYL A;  1MD2 D;  2F0L A;  2R7Z B;  1HNZ Q;  3GTK H;  4QUF A;  4RGT A;  2Q2H A;  4EQ5 A;  4YWK A;  3G4S A;  1SN8 A;  2L5T A;  4JBJ A;  4AQY Q;  3QB3 A;  1HJP A;  2MFI A;  3F8T A;  4POF A;  4K14 A;  1ZKO A;  1STB A;  3D0F A;  5IP7 H;  2RHQ B;  4BBR H;  2HHH L;  2K04 A;  4A75 A;  2VQF L;  3TRE A;  1WVL A;  4DK0 A;  4PNY A;  1YBY A;  4UP7 A;  1IW7 C;  1YJN A;  2B63 G;  5IWA Q;  1SE8 A;  3KLW A;  2MO0 A;  1PRT C;  1BXT A;  2Q8T A;  4HIM A;  3URY A;  2B2W C;  2VS1 A;  1TWA H;  1KHI A;  4XXE A;  1XNR L;  3T1H Q;  5FJ8 H;  1Y8N B;  3HOY B;  1EQR A;  1B4O A;  1S3O A;  1GVP A;  4OWT B;  2DN8 A;  2JE6 I;  4GKK L;  3PO3 H;  3PO3 B;  3UDX A;  2K33 A;  3GTO B;  4JBW A;  1CZW A;  2Z6B A;  5EGT A;  3LGJ A;  2V4D A;  3K6O A;  1IBM L;  3NEL A;  3D31 A;  4RKB A;  3TS0 A;  3O13 A;  1PH8 A;  1W6K A;  4UHV A;  1WCM B;  3I72 A;  1PVO A;  4JI2 L;  4ZQ3 A;  1S5E D;  5KRU A;  2ICI A;  4IUQ A;  1DGS A;  4KHV A;  1N9W A;  3WDN A;  1A3V A;  1RDP D;  3W2D A;  3W5O A;  5IGE A;  4K6D A;  2JA6 B;  3T56 B;  4X64 Q;  5IOD A;  1G2S A;  3I4N H;  3PUX A;  1I4R A;  1PZJ D;  3A8J E;  4K8I A;  4DR2 L;  1XNQ Q;  2R92 G;  1C4Q A;  5JJZ A;  1HR0 Q;  3GTK B;  1Z6H A;  2R6G A;  5CBE E;  1Y8O B;  3J81 c;  4A3K G;  1VQG A;  2TSS A;  4KD4 A;  2K50 A;  1LAB A;  1I4Q A;  4AYB E;  1YHA A;  2L1B A;  4DV2 L;  2EJM A;  4DR5 Q;  1LT6 D;  4B08 A;  3GV6 A;  2EZV A;  3H0G B;  1R9T H;  1FVI A;  1TR5 A;  3AQQ A;  4G7O C;  1F9Q A;  2VB2 X;  4A3C G;  5C3W A;  1VQC A;  1RTN A;  1GXD C;  1IKL A;  4YIJ A;  5CV8 A;  1ESR A;  1SNP A;  3E9H A;  3AEV A;  1ICF B;  2LFN A;  3U4V A;  4A3B G;  3HKZ E;  5ELC A;  5J1Z A;  1F2Y A;  1ONL A;  1PFN A;  5NUC A;  1DD2 A;  1HZC A;  2A19 A;  1H9K A;  3TRZ A;  3H0G G;  1TS5 A;  2PYK A;  4H13 C;  2AQ3 B;  2K4K A;  4K5W A;  2LSS A;  5HY6 A;  1K8G A;  4DKA C;  2B2T C;  3CQZ H;  3UE1 A;  1BCP C;  2BH8 A;  2OXP A;  4A3C H;  1V1P A;  2N78 A;  3CC2 A;  1M1K C;  2I5H A;  2PW5 A;  4LNQ A;  1A0I A;  4K6L A;  4NMZ A;  2OQ0 A;  1GUT A;  3PIP A;  4CJ0 B;  2M9V A;  2JYO A;  4NPS A;  3J80 L;  5M3F G;  1V8Q A;  4DV7 Q;  3M4P A;  1PTO F;  3W1B A;  4A3M H;  1BF4 A;  1QWY A;  4EQO A;  3HOU H;  4HSP A;  5FKA C;  1HA6 A;  4OL7 A;  1WTR A;  5GAG C;  4MHE A;  1LT3 D;  1STG A;  1HHV A;  4P74 A;  4EVO A;  2XGT A;  4FP5 D;  2WP8 J;  1O78 A;  3NTK A;  1QNK A;  1BR9 A;  4J8Q A;  2VNU D;  4C3I G;  1NR2 A;  1VF7 A;  1W2B A;  4HMI A;  1CSP A;  1R4Q B;  2RF4 A;  3RR5 A;  1ENF A;  1B2T A;  1D1K A;  2G5D A;  4P2C B;  3STB D;  1BO0 A;  2SOB A;  1VQA A;  1JMC A;  2O2L D;  1N34 Q;  2E76 C;  4F88 A;  3IL8 A;  3J7A V;  1Q7Y C;  2X6G A;  4BA2 I;  2ID0 A;  5JJI A;  1KAW A;  1A2U A;  1SNC A;  3QOL A;  1BDO A;  2RKS A;  1HCZ A;  4A93 B;  1AP0 A;  5C4Z A;  4ILW A;  3CC7 A;  5M9O A;  2IT1 A;  1CM9 A;  2R7Z H;  4FF1 A;  1L1O A;  2XNA C;  4PV1 C;  4DR7 Q;  4A3E H;  4WOR A;  1X3Q A;  1C7Y A;  2AUJ D;  5L37 A;  5IYD G;  3M4O H;  1I6V C;  4N9P A;  2HD3 A;  2RQX A;  2N88 A;  4B9X A;  5I4D A;  1NTG A;  1UUP A;  3J7A F;  3T13 A;  4G4K A;  5C4J B;  2QKI C;  2L12 A;  1EYG A;  3J7Z C;  4M8A A;  4BBR B;  1GD7 A;  1QG7 A;  1ZEQ X;  3MXN A;  3WOE A;  2NVX B;  1PZI D;  1II3 A;  1PLF A;  4U67 3;  2XRQ D;  2UUC Q;  5A35 A;  4LF7 Q;  3CP0 A;  4UP8 A;  2J0T D;  4DAY A;  2KEC A;  4C1N I;  1K0S A;  1VQB A;  2PPB C;  3T16 A;  2M00 A;  2A68 D;  2EYM A;  2ASB A;  2IX1 A;  2UXC L;  1LT4 D;  4L5S A;  2DUD A;  2Y0S B;  4GKK Q;  4DV7 L;  2NB0 A;  3GTL B;  4QL5 A;  1U9R A;  1X65 A;  2GN5 A;  3CCR A;  1VQI A;  3GTJ H;  4C56 C;  2DNC A;  4LF8 L;  4JI4 L;  5F2D A;  2IHF A;  1A2T A;  1VCI A;  1HNW Q;  3MA2 B;  4RCN A;  3HRZ C;  4DK6 C;  2YU9 B;  1T5X D;  4DR6 L;  1X3G A;  2JA7 B;  1L0X B;  4IFD I;  3P1H A;  5CV4 A;  2PNH A;  1J8I A;  4DR1 Q;  4LF5 Q;  1EIF A;  2RDH A;  3S14 B;  4RGN A;  4MN3 A;  5DAU A;  4OX9 Q;  3K5L A;  1UEB A;  3HOX H;  4XIG S;  1EWI A;  2MHV A;  4ZCK A;  1UE7 A;  3SVM A;  1P16 A;  3RMH A;  4QB4 A;  3CCL A;  2R7D A;  1PZK D;  1Y14 B;  3S2D H;  4FXK C;  5C3X A;  3DM3 A;  1Q82 C;  4A3L G;  2R61 A;  2LKV A;  2QW7 A;  4HJ8 A;  5JAV A;  4HCE A;  3F2D A;  4X66 Q;  2XTI A;  4DUZ Q;  4DR5 L;  4YHH L;  4ZK9 B;  3JC6 6;  3DWA A;  2DY7 A;  3S9W A;  5EPJ A;  1GJX A;  1JJ2 A;  1VQJ A;  4L63 B;  1XPR A;  1QNU A;  5C4H A;  1VQ9 A;  1QOH A;  1Y1V H;  2MQH A;  3CAM A;  2WB1 G;  3AFQ A;  1Y1W B;  4ODG A;  1SJE D;  4N8X 1;  4DPG A;  4DR2 Q;  3T1Y L;  1CHP D;  4PQX A;  1SFO H;  2EVB A;  2M2L A;  4LWC A;  5K5P A;  4X64 L;  1CT1 D;  1ASZ A;  4DR6 Q;  1E0B A;  1ILP A;  1NMF A;  2QEX A;  4Y7N B;  1SSO A;  5BR8 L;  4GKJ Q;  3BDO A;  4KKT A;  3HOW G;  1K8O A;  1X6O A;  1KDB A;  3C3L A;  2GA4 B;  3IKJ A;  1DXM A;  3EJI A;  1PH7 A;  4FO2 A;  3NTI A;  3CXC A;  5FO9 B;  1K9M C;  5EPK A;  3CCV A;  2I46 A;  1K83 B;  3MVV A;  2WAC A;  4CKC A;  2F4V Q;  1OXU A;  3SK8 A;  1Q46 A;  1G6P A;  1EFI D;  1ESF A;  2E5L Q;  3VDY A;  3KDF B;  1RD9 D;  1I50 B;  3NE5 B;  1ICW A;  1U4R A;  4A3D G;  3CKI B;  1TT2 A;  1I6H B;  2OWO A;  3H3V I;  1CA6 A;  3NBH A;  4LF8 Q;  2DY8 A;  1S5C D;  3J81 i;  3F2C A;  2F0N A;  3KJO A;  1PTO C;  2VQF Q;  1I6H H;  4JI1 L;  1BVS A;  4JC0 A;  4NB3 A;  4L5R C;  2B3G A;  2UXC Q;  5LMU Q;  2UUB Q;  3S1N B;  2Z4H A;  4R4Q A;  4XYO A;  1KAA A;  1B50 A;  1YNN C;  2EIF A;  2LXK A;  2CQO A;  1G29 1;  2EYL A;  5GAE C;  1EYD A;  3CF5 A;  3I70 A;  4HMJ A;  3CCE A;  4JW0 A;  3TP6 A;  2VY3 A;  3M3Y B;  1PH5 A;  2JN4 A;  4JI0 L;  2Z9H A;  4HJ7 A;  1FJG Q;  1I5F A;  5KEE A;  2R92 B;  1O7Z A;  1L0Y B;  3SEB A;  4IPG A;  5IGF A;  1ZYR C;  5BN5 A;  4O2D A;  1E2W A;  1LTI D;  4A3M B;  1D2B A;  2SNM A;  4GOP B;  3FDT A;  1YJ9 A;  1JE4 A;  5I6W A;  2C9O A;  1X3E A;  4KMU C;  4QIW B;  1VQ7 A;  2R93 H;  1X32 A;  5FLX L;  2OTL A;  1V1Q A;  4DV6 Q;  3OSO A;  4RAU C;  2A68 C;  1XTD A;  3DXJ C;  4TQU S;  4DK1 A;  3CQZ B;  4DV6 L;  4QF4 A;  4OO1 H;  4P72 A;  1K83 H;  1D5M C;  2AHO B;  2JA7 G;  2HQL A;  4KKU A;  3PIO 3;  1MGS A;  1Q3L A;  2CQA A;  3HOZ B;  3M4Q A;  4WJ3 M;  1I94 L;  5M3M G;  1QVF A;  3CCQ A;  4IUN A;  2A69 C;  2EYJ A;  4OEL B;  1Q8K A;  3TQY A;  2QCP X;  1F77 A;  1TS2 A;  1UE5 A;  4O0A A;  1R9T B;  5IGB A;  1EQV A;  4Q5V A;  3OWF A;  3G6J B;  4ABN A;  2NYZ D;  1TKW B;  4L5T A;  2SEB D;  5I9O A;  1EY8 A;  1XJV A;  1SRU A;  4FF3 A;  3BYY B;  1IXR A;  3HKZ B;  3M7N A;  2KCM A;  2WAQ E;  1PH1 A;  3ERO A;  3C46 A;  1EY0 A;  1PRT D;  4LF4 L;  3Q0A A;  1EIH A;  3NUC A;  1EU4 A;  3CME A;  3J7A 5;  1BNZ A;  3RNU A;  1SLJ A;  2FHT A;  3CD6 A;  2D0O A;  2P5Z X;  3E5S A;  4Z9C B;  3U4Z A;  2OF1 A;  3I90 A;  3ZJY C;  4RCO A;  1VQN A;  4JK1 C;  4X65 Q;  2F0Q A;  5T1G A;  4OO1 I;  2F1M A;  3PV0 A;  2JA8 H;  2L11 A;  3RLF A;  1JT8 A;  1TWH H;  1YI2 A;  2HIX A;  3K58 A;  2ES2 A;  2I0Q A;  5IT9 c;  1XMQ L;  2QDL A;  1TU2 B;  1ASY A;  2AWO A;  2SNS A;  1F9S A;  4XTC S;  2OT2 A;  4MNO A;  3HOV H;  2A74 C;  5M5X B;  3MXG A;  1NNX A;  2XIW A;  3J81 L;  2QIL A;  1GUG A;  4A3J G;  3HOZ G;  4A3E B;  4DN4 M;  4EX5 A;  2K5D A;  4DA2 A;  3S1R H;  5GAD C;  1IBM Q;  5IGG A;  3T4A C;  1ENA A;  3RN2 A;  4HID A;  4DR4 L;  4RKL A;  4CDC C;  2IJ0 A;  4S3S A;  5JEA H;  3HOY G;  3FPU B;  2EXZ A;  1V1O A;  5IIF A;  2JA8 B;  4F8M A;  3K0Y A;  4A3J B;  2WAQ G;  3K57 A;  3VR5 A;  4A3B H;  4A3B B;  3PCO B;  1C8C A;  1TQO A;  5GQO A;  2D5D A;  1I4X A;  1IHZ A;  3CC4 A;  1ZXT A;  2F0I A;  3S1M B;  3MXP A;  3AB9 A;  3E3X A;  2NN6 H;  4GNX C;  3P75 A;  3WOF A;  4C3H B;  3JAM i;  1B3A A;  2Y0S E;  1N32 L;  3A56 A;  4JV5 Q;  2JA5 H;  2UXB L;  1E1O A;  3DMU A;  1N36 Q;  1IYU A;  4ZUI A;  4BY1 G;  4A3G G;  2K5V A;  4DR4 Q;  3SHL A;  1VQ8 A;  5DLQ E;  1VQH A;  4YCV A;  3TP5 A;  1WTW A;  3MEF A;  2F3I A;  5CC4 A;  3I4M H;  5FO7 B;  3FVQ A;  3A54 A;  1BCP F;  1STY A;  3PF4 A;  2X69 A;  4IFD J;  4A3K B;  2JEB I;  4GZY C;  1WD1 A;  2O5J C;  2WFW A;  3LX0 A;  4IUU A;  1GM5 A;  2Q2I A;  5BN3 A;  1BKB A;  4P75 A;  1EFW A;  1WTH A;  4DV5 L;  4A4I A;  5HUR A;  2VB3 X;  5C44 G;  4A3I H;  4OX9 L;  2CW0 C;  5KNB A;  1XXG A;  3FKI H;  4LFB L;  2CWP A;  1D6E C;  1H9M A;  4OO1 G;  3GTG H;  1TWC B;  1PTO D;  1IYJ B;  1KLG D;  4BBS G;  1MI2 A;  4Q0F A;  1YHQ A;  3SK4 A;  5C0X H;  2B2V C;  4FF4 A;  1IL2 A;  3W1G A;  5CV7 A;  1B3Q A;  3S1Q B;  2Y0S G;  5C0X J;  4RA8 A;  4A3G H;  3D6C A;  2E8G A;  2EJF C;  2Z8L A;  4KJO A;  1VQP A;  1KRS A;  4IZ8 A;  2E75 C;  4IOA A;  2CCZ A;  3PMF A;  1EL0 A;  5EAY A;  1XMQ Q;  1YIT A;  1HZ9 A;  2A6E D;  3ND9 A;  4IOC A;  1VQM A;  1YHB A;  2KHI A;  3KK7 A;  4KV6 A;  2UXD Q;  3E6Z X;  4OON A;  2RBM A;  4L6T B;  1TS3 A;  2VZA A;  4FNF A;  5FJ8 G;  3D4D A;  1IBK L;  4IPH A;  4J15 A;  3C1E A;  3KLR A;  5C3E H;  3Q23 A;  5JVG 3;  2WB1 E;  4IUP A;  2SDF A;  3KJP A;  2NUC A;  1NSN S;  1VQ6 A;  3TEH B;  2JK8 A;  2F3W A;  3L0O A;  5C5L A;  5JJL A;  3S2H H;  2PNR C;  1FR3 A;  4WFN 3;  2MGS A;  5IP7 G;  3I7F A;  3F2B A;  3GTM H;  2ZTD A;  3VR2 A;  4IUT A;  1TXY A;  2UXD L;  3J80 c;  2F0U A;  4R9W A;  1M8A A;  5IT9 E;  1S40 A;  3STB C;  2FMC A;  1WCM H;  3EBE A;  2YYZ A;  4R4C A;  2F52 A;  2IPK D;  3A0J A;  3ERS X;  3CPW A;  3HFZ B;  2H1E A;  3OWE B;  4M1U B;  5K36 G;  4U68 A;  4IAL A;  4GN4 B;  4JV5 L;  3ERQ A;  3OYY A;  1A8V A;  4B3T Q;  2F0M A;  4RH6 A;  5IYB G;  1XMO Q;  5LMN Q;  2CKZ B;  4GNX A;  1BUV T;  1SMX A;  1SXT A;  4LF9 Q;  4JYA Q;  4OXP A;  3T1Y Q;  3X3N A;  4C3J B;  5ELE A;  2F4V L;  2EY5 A;  1O7Y A;  3K59 A;  1S5F D;  2Z4I A;  3L7Z C;  1XMO L;  1Q81 C;  1LTG D;  2ZT9 C;  3BVZ A;  1O7I A;  2ZXR A;  4GN3 B;  2EY2 A;  5IY0 A;  3R2I A;  2GVB A;  5COR A;  2VUM B;  1SND A;  1STH A;  2JA5 B;  4A3F H;  2ZTE A;  4KY6 A;  2EYP A;  3GV3 A;  4DGZ A;  3KF8 B;  3MTS A;  1SR3 A;  4C3H H;  3W3A A;  1QVG A;  1QE6 A;  2ALY B;  2PZT A;  3GTP H;  2KHJ A;  1PMR A;  1C9O A;  1D8L A;  2F0D A;  4LFA L;  1RHP A;  5C0X G;  1QCB D;  1PH2 A;  5JPM C;  5C0X I;  3R2T A;  4DV2 Q;  3BDL A;  3H94 A;  4K2L A;  1MHW C;  3RZD H;  2RA4 A;  2B2U C;  1A15 A;  2F0S A;  2K28 A;  4XQN A;  5IT9 L;  3GTQ B;  4AH6 A;  1L0W A;  4DXG A;  1V1P B;  3NEN A;  5T1I A;  2JA9 A;  4E6I A;  2FXQ A;  2PZW A;  3HOY H;  4CGY B;  4PZ6 A;  3EFX D;  3SR1 A;  2B2V A;  1X55 A;  3R93 A;  5DEH A;  2E2J H;  2J4X A;  3NTH A;  4KI0 A;  4GNX B;  3UDF A;  3F2U A;  1FGB D;  4IPD A;  4PMC A;  4PG3 A;  1HTL D;  3MEH A;  3I73 A;  4QQB X;  3I4O A;  5CMD A;  1W3S A;  1JR0 D;  4BY7 G;  2D9U A;  1X9N A;  1X3P A;  3V2T A;  1CUK A;  4FXD A;  3S2H B;  5EBC A;  1UEA B;  1ZYR D;  4B3M L;  2B29 A;  4ME5 A;  3KF8 A;  4QIW E;  3S1R B;  1WD0 A;  1EY5 A;  2BOS A;  4GOP C;  4DV4 Q;  2HDM A;  3M7G A;  2NN6 I;  1TS4 A;  3TP7 A;  1LTR D;  4BY7 B;  1HFG A;  2IW3 A;  4R8N A;  4JPB W;  2CHB D;  4XQQ A;  5E4W C;  2D2C C;  3TS2 A;  1XWE A;  3DWP A;  3DEP A;  3PIO A;  2HUG A;  5JEA G;  2NVT H;  3SGI A;  5I6Y A;  1JJC B;  2YTY A;  3BG3 A;  1K28 A;  1NJI C;  3GTL H;  2F0G A;  4YY3 Q;  2CH4 W;  4TSS A;  2OQK A;  4DAY B;  2EXD A;  1OXV A;  3EVQ A;  1AW7 A;  1CKN B;  3I2Z A;  1MBY A;  4ID6 A;  4DR3 Q;  3S2D B;  3Q22 A;  1N36 L;  1PHJ A;  1AN8 A;  2GVA A;  4CHT B;  4YHH Q;  3U9O A;  1K73 C;  4QCL A;  2EJG C;  3S15 H;  2DJF C;  4DU9 A;  1N34 L;  3HOX B;  3K8A A;  3VA5 A;  3G6E A;  2NN6 G;  2IY5 B;  5M3M B;  1HH2 P;  4MTK A;  4HJ5 A;  2XWB B;  3Q6S A;  3I3C A;  2WAQ B;  4HCS A;  4ME3 A;  2B63 B;  1X56 A;  3L2P A;  4YY3 L;  2XSC A;  1V9P A;  2K05 A;  1EY7 A;  3IFT A;  4N9T A;  2YU9 H;  4DAM A;  4IFD H;  1BBX C;  3A8K E;  4DNR B;  1HZB A;  1K8A C;  5C4X B;  4DR1 L;  4LF5 L;  4KN7 C;  4RFB A;  1VQ4 A;  1KXL A;  2F0E A;  5D3D A;  1EQT A;  4G7Z C;  2CFM A;  3H3V H;  1IKM A;  2FMM A;  4LFA Q;  3H3V C;  1AH9 A;  1OXX K;  3G7L A;  4JI5 L;  4HR7 B;  5GAH C;  1FGU A;  2JA8 G;  1AE3 A;  4LFC L;  1A3T A;  2HQE A;  5IYC G;  3BZK A;  3KF6 A;  1E2V A;  3GP7 A;  1DOM A;  3L9A X;  3TP8 A;  1DM0 B;  4HIK A;  2EYO A;  4R4T A;  3A5U A;  2KBN A;  5JPN C;  5LHY 1;  4P73 A;  3GTP B;  1YNJ C;  1B44 D;  1NMG A;  5J39 A;  3JAM L;  5G3L D;  1Y1V G;  1XYI A;  1Q8I A;  2K6A A;  4CDE C;  5AFW A;  4B9W A;  1B70 B;  1FL0 A;  1DCZ A;  1N8R C;  1F9R A;  3NSW A;  3JAM c;  2DJG C;  4R4O A;  2YTX A;  4H0L C;  4MTN A;  5C5M A;  4AIM A;  1U4P A;  2PZU A;  1QB5 D;  2KA7 A;  3D8G A;  2B2T A;  2F0F A;  1CHQ D;  5D3I B;  4HIO A;  2JP1 A;  3NWS A;  2A6H D;  3NK9 A;  5EKK A;  1E7Z A;  3HKZ G;  2PO4 A;  4HJ9 A;  1WI5 A;  3DUZ A;  2WV6 D;  1FJG L;  5C44 B;  3DWQ A;  3FMC A;  4JI3 Q;  4HSV A;  5E4X A;  1U4M A;  1NAP A;  2ZTC A;  3GD7 A;  5KNC A;  2B2Y C;  2BE5 C;  3SK6 A;  1LUZ A;  3MWY W;  3KF6 B;  1TWF H;  4B3R Q;  3FP9 A;  4A3L H;  4UDU C;  1K8M A;  2K03 A;  3KOJ A;  3ER0 A;  4XQJ A;  2R7Z G;  2RSO A;  1NE3 A;  1RL2 A;  4H02 A;  2HCI A;  4XT1 B;  3R8B A;  1B9N A;  1WTO A;  3Q24 A;  4NXM L;  1EY9 A;  3CHB D;  4O42 A;  1UWV A;  1PXU A;  3C2P A;  5FLX E;  1ET6 A;  2OCE A;  3JAM E;  5G3L F;  4DUY Q;  4JG2 A;  5CV5 A;  5IOC A;  4Y7N H;  4BY1 B;  4JOI A;  5C4X H;  1CFM A;  1I50 H;  1MKH A;  4IFD G;  2H5X A;  3P7J A;  3SE0 A;  3OIP A;  4A76 A;  2F0H A;  1D5Z C;  2HCC A;  1PYS B;  1QZG A;  1VQO A;  2B2Y A;  4OIJ A;  1TY2 A;  1RCV D;  3D4W A;  3UDG A;  2EPB A;  3C1F A;  4JI7 L;  1SYF A;  1ENC A;  1Y1V B;  3MXU A;  1XNQ L;  1EEF D;  5I2X A;  1SBB B;  1E2Z A;  3HS0 C;  1KC8 C;  4A3G B;  2CW0 D;  4OEM B;  3I4L A;  3KLS X;  5HGT A;  1SYD A;  1Q1B A;  2KEN A;  3G71 A;  3CPF A;  3DEO A;  5ISR A;  4LF9 L;  4JYA L;  1XX8 A;  3PGZ A;  1TWC H;  5CGK A;  4JI6 Q;  2QF7 A;  1SEB D;  1I4P A;  2Q8I B;  1GUW A;  3FKI B;  1VMP A;  3IAY A;  3A55 A;  4H44 C;  3S17 B;  1KL9 A;  2N49 A;  1CI3 M;  1XPO A;  4IJL A;  2MNA A;  3M4Y A;  2PW7 A;  5E3F A;  1SE4 A;  1I3Q B;  1I4H A;  4LFC Q;  1AFP A;  3S14 H;  1O7L A;  4AYB G;  2JXM B;  4JI5 Q;  4ZKC B;  1S72 A;  4DUZ L;  3S1Q H;  4K0K Q;  5EJW A;  3GTQ H;  1X3F A;  3ONA B;  1SNQ A;  2PI2 E;  4X3U A;  1L2F A;  3PUY A;  2L9H A;  4GOP A;  4DV0 Q;  1J5E Q;  3GDE A;  4BY7 H;  1YNJ D;  4DFA A;  1EY4 A;  1VQE A;  4DAV A;  1JOK A;  3BVG A;  3SDZ A;  3M85 A;  4A3I B;  3KFU A;  4H7B A;  1K3R A;  2YTV A;  4ZYS A;  4KHP L;  3MHB A;  3EIV A;  2B8G A;  1LTT D;  1SRO A;  2E74 C;  1C48 A;  2EYF A;  3KBG A;  4QMG A;  4LW1 A;  3NP8 A;  4XYQ A;  2E2H B;  2LY7 A;  1HNX L;  4C3J H;  1JWM D;  4KHZ A;  1SDF A;  2VL6 A;  3BS1 A;  1RIP A;  2KCC A;  3GTO H;  2AUK A;  5IYC H;  3CCM A;  1CKM A;  4KY7 A;  4C3H G;  1QVC A;  3UE0 A;  4CKB A;  2NVY B;  2RCF A;  4NXN L;  1MJC A;  1VS0 A;  1WTX A;  2L15 A;  4X6A H;  2FJ2 A;  3OHX C;  1HPC A;  3HZX A;  4C3I B;  2F0K A;  4TVA B;  5KYL A;  2B63 H;  2K5W A;  5M5W H;  1EWC A;  3LWU A;  4BBR G;  4BXX H;  2K32 A;  3UDI A;  2EOT A;  2E5L L;  1DYQ A;  4B3S Q;  1Q86 C;  1LO5 D;  3CCU A;  1PTO B;  1IYV A;  4FDB A;  5CYU A;  3PIP 3;  5KGU A;  2VUM H;  1FD7 D;  1A62 A;  2XVS A;  1SJH D;  3ULJ A;  4HED A;  5FO8 B;  2PMZ E;  1LTL A;  1LTS D;  3MAQ A;  1M4V A;  5A2Q L;  1U4L A;  3B6Y A;  3H91 A;  3HKS A;  5C3E B;  3ND8 A;  5M5X H;  4RWS C;  2AQ2 B;  1JIC A;  3PUV A;  1C0A A;  2B8F A;  4KTA A;  4CJ2 C;  2FIN B;  2I07 B;  4I7A A;  3U58 A;  5JJK A;  3PO3 G;  4A93 H;  1Q1E A;  4DXF A;  1F2L A;  1JQY D;  5K36 H;  1BOS A;  2DNE A;  2V1C C;  1A63 A;  3F1Z A;  1GKH A;  1D5X C;  4QJF A;  1FNW A;  1DJR D;  1WTV A;  2KVM A;  3K81 C;  4GLX A;  2N8N A;  5EKI A;  3ULP A;  1DON A;  4QUC A;  2EY6 A;  3ITP A;  4RGM A;  1UNS A;  5M5Y H;  3HOU G;  4B3R L;  3NHH A;  1R4P B;  2UU9 L;  1TII D;  1IL8 A;  1EQQ A;  2NZO A;  3OTO Q;  5M3F H;  1NBW A;  2BCO A;  4DV1 Q;  1PH9 A;  3KBX A;  5M5Y B;  2K5H A;  1STE A;  5BR8 Q;  2VUM G;  4JOI C;  2F3V A;  1EYA A;  2PQA A;  1IBL Q;  4DF7 A;  3OIQ A;  1HUM A;  3NPP A;  3V05 A;  3K7U C;  4DV0 L;  1J5E L;  3DHQ A;  2XN9 C;  2NVQ H;  4JBK A;  1CQF A;  1JOR A;  1Z7T A;  3D3R A;  3VYU A;  4YCU A;  1PFB A;  1EY6 A;  3WWV A;  1WTP A;  5JEA J;  2AWN A;  2F4I A;  2IX3 A;  1HZA A;  2KCT A;  1IBK Q;  1VQ5 A;  4HN7 A;  3S16 H;  3NEM A;  2LMC B;  4G57 A;  1D7Q A;  1T9H A;  4PMB A;  1A6X A;  2E2J B;  2O4X A;  2K7V A;  1AZP A;  4YCW A;  3OOC A;  1BCP D;  2VQE L;  1N32 Q;  1IBL L;  2R93 B;  4C1N K;  3QWN A;  3HOZ H;  2F0J A;  2JJQ A;  5DM7 3;  1WOC A;  1VQF A;  3T51 B;  1SYG A;  5I9P A;  1PH4 A;  2ZJQ A;  2A69 D;  1WCM G;  4RMF A;  2ZJR A;  1DZ1 A;  5IYB H;  4POG A;  5J3B A;  1GUO A;  1YNN D;  1CKN A;  1XPU A;  5IP9 G;  2BDN A;  3TZU A;  2Z0S A;  4A3D B;  1ROD A;  3K5O A;  2C5C A;  1PV4 A;  1RTO A;  1H9R A;  3VA7 A;  4B3S L;  4DAP A;  2R7F A;  2PCF B;  2IWH A;  3I4N G;  3NWT A;  1X54 A;  1NY4 A;  5LMN L;  2NTT A;  5EKL A;  4RG1 A;  2OTJ A;  2RHS B;  1EEI D;  3M9B A;  4WJ4 A;  3VR6 A;  1Y1W G;  4ULL A;  2EE1 A;  3I4M G;  2KCN A;  4NDX A;  3HOV B;  1A3U A;  1P8L A;  4PZ7 A;  2JA6 G;  1I3Q H;  1DOK A;  3ULL A;  4X62 L;  2F0P A;  3RLO A;  4DV5 Q;  3RUZ A;  1SE3 A;  3KLS A;  4A3F B;  4JCV E;  4A3D H;  3S1M H;  4CKE A;  1XNR Q;  4K8J A;  1EOT A;  2F0T A;  2JQO A;  3HOV G;  2B2W A;  2NZH A;  3FEW X;  2MP1 A;  2HDL A;  3BZC A;  1H9J A;  5KYI A;  4A3J H;  2L0C A;  2XWJ B;  2VW9 A;  4GKJ L;  3X3M A;  1HR0 W;  3QJY A;  1S5B D;  3DM1 A;  3OW2 A;  1PFM A;  4LF6 Q;  1RKN A;  5AJ3 Q;  5FLX c;  2QGQ A;  3DLL A;  2F03 A;  4APV A;  1FYC A;  3PO2 H;  4I65 A;  4QY7 A;  4LF6 L;  1FNU A;  5FOB B;  4K2K A;  3AU7 A;  3TDQ A;  2WIN B;  3E0J A;  4EGV A;  3KDF A;  5FLM H;  2K5Q A;  1EOV A;  5I2Y A;  3V96 A;  4DV4 L;  4TRD A;  1JC7 A;  5C3E G;  3K5M A;  4BXX G;  2NVQ B;  1YIJ A;  2B2U A;  1HNX Q;  2PQA B;  1E1T A;  1BCP B;  5GRO A;  3NBH B;  1TWH B;  1CK1 A;  1JOQ A;  4NW2 A;  3OMG A;  1EUJ A;  1AEX A;  3RD4 A;  4NXM Q;  1JCK B;  1N33 L;  3E0E A;  1H95 A;  5ELN A;  1E24 A;  4C3J G;  2I5L X;  2F0W A;  2E2I B;  3NBI A;  1SFO B;  3NXW A;  1AE2 A;  2A1A A;  5FLM G;  1MJE A;  2J7Z A;  1Y69 U;  1S5D D;  1WYD A;  1CSQ A;  3N6R A;  4CBV A;  4JBM A;  1KAB A;  3A7L A;  1KQS A;  4FVM A;  4DK3 C;  1MSG A;  1PYB A;  2I5M X;  4JVZ A;  4DR3 L;  1Z9F A;  2ZM6 L;  1EU3 A;  4NXN Q;  2XRS D;  1KD1 C;  2BDO A;  2Q2U A;  4A93 G;  1PDQ A;  2LS0 1;  2K14 A;  3BJU A;  2IX0 A;  1L1O B;  1GHJ A;  2ICE C;  4DR7 L;  4BBS H;  1G6Z A;  4KJN A;  3J80 E;  4R1J A;  3K5N A;  3D6W A;  1EIY B;  1EIG A;  1GUN A;  3OMC A;  4IN3 A;  3VR3 A;  1SAP A;  2L55 A;  4A3I G;  4DUY L;  4HAE A;  4CDF C;  1KIX A;  3TSS A;  1QZH A;  1TY0 A;  3I8Z A;  5BN4 A;  4ALP A;  4V19 0;  2A5H A;  3S24 A;  2JA6 H;  4P71 A;  1YVC A;  5ELO A;  4DV3 L;  2ATW A;  2Z6K A;  2L4N A;  5A2Q E;  4OIK A;  4C3I H;  1B9M A;  2FFK B;  4DNT B;  4K5V A;  4QGU A;  3GQB A;  3PUZ A;  3SK5 A;  3ICE A;  5ELF A;  2D62 A;  4AQY L;  2EDG A;  1KNE A;  2WII B;  4JI8 L;  3GTJ B;  5H1S E;  3RZO H;  2RSN A;  2CWA A;  3HP3 A;  2KQ3 A;  4J6H A;  2WB1 B;  2N3S A;  4FYD A;  1KDC A;  2NTS A;  1SYC A;  3T53 B;  4K0K L;  3ZYY X;  3I91 A;  3A5Z B;  1VMC A;  1NUC A;  4NKL A;  4JI8 Q;  1QIL A;  5ELD A;  4KHP Q;  3RZD B;  4MZ9 A;  1OTC A;  3D4R A;  4CJ1 B;  1HR0 L;  3RLN A;  2WKD A;  1LT5 D;  3BVM A;  3VYR A;  1JJG A;  1EZ8 A;  3TME A;  2YV5 A;  1BBW A;  1VDZ A;  2RVL A;  4XT3 B;  1QUQ A;  2UUA Q;  2NBF A;  1MSH A;  5AJ3 L;  1PA6 A;  3NQI A;  1MIU A;  2QDB A;  3U50 C;  3H6M A;  2VXW A;  2ZXP A;  4R8I A;  5CV6 A;  5CV9 A;  3T1H L;  2CH4 A;  1KLU D;  1UE1 A;  5JOB A;  2IL8 A;  4OHJ A;  2UXB Q;  2EYH A;  2A8V A;  4C2M H;  5M5W B;  1KRT A;  5IYD H;  2NZ1 D;  1IZ6 A;  1RJT A;  3H09 A;  3P20 A;  4X66 L;  5KIX A;  2PMZ B;  4B3T L;  1SYE A;  3S1N H;  1HQM C;  3QOJ A;  2VQE Q;  4J1M A;  1U5K A;  3CRK C;  3CU7 A;  4FF2 A;  2EY1 A;  2N55 A;  3VYS A;  3A74 A;  1SMY D;  2KHS A;  4NP5 A;  1Y1W H;  1S4Z A;  3CCS A;  4KD3 A;  2RCN A;  3J7Y W;  3QO2 A;  4IUV A;  2BH2 A;  3QR8 A;  2Z1C A;  4LMQ D;  1JWS D;  1LLR D;  4LAA A;  1LM0 A;  1JB3 A;  2MUY A;  3LWE A;  5IWA L;  3S15 B;  3S17 H;  3FRP B;  4GLA C;  2E2D C;  1YEZ A;  2AQ1 B;  2G9D A;  4OWW B;  1GUS A;  1ET9 A;  1LTB D;  3TN2 A;  4YWL A;  4LK1 C;  3PQI A;  1SNM A;  2K75 A;  5DNF A;  4DNI A;  4X3T A;  4EQN A;  5LMU L;  2UUB L;  3OTO L;  5ELB A;  1VF5 C;  2ENB A;  3MXN B;  2RDG A;  2TMP A;  3HOX G;  3I55 A;  5IGC A;  3EN2 A;  1B1Z A;  2NVT B;  3IFD A;  3HOU B;  1SE2 A;  4DV3 Q;  4JI0 Q;  3U9S A;  5IP9 H;  4X65 L;  4I7Z C;  1F2M A;  2QEJ C;  3J81 E;  3GO5 A;  1EYC A;  4LUZ A;  3TZD A;  2NWG A;  3N52 A;  5IE8 A;  1HRJ A;  4X62 Q;  3MFG A;  2MPM A;  3UI2 A;  4MIU A;  4LUO A;  2KJX A;  2AMC B;  3PO2 B;  4ZKB B;  5JVH 3;  3K0X A;  3MZ5 A;  3H0G H;  1HA5 A;  3MFY A;  1KNA A;  3A7A B;  3PSI A;  1HQR D;  1CQV A;  3HGB A;  4UPA A;  4LF7 L;  4UY8 C;  2E2I H;  4LUV A;  2JEA I;  2ZJP A;  1HUN A;  1UE6 A;  1TWF B;  1D1I A;  4JI6 L;  1YNX A;  4A3M G;  4K5X A;  3CMA A;  3MC0 B;  3QIA A;  1L1O C;  2R92 H;  1B53 A;  2KUM A;  3J81 j;  3KYH C;  2R93 G;  1EWH A;  1I94 Q;  5C4J H;  2IHE A;  2HIV A;  1EZ6 A;  2JSO A;  4FXG C;  1K0R A;  4BWG B;  1PH3 A;  4LFB Q;  3SXH A;  3R3O A;  4GN5 A;  4RGO S;  1IW7 D;  3HG9 A;  1SMY C;  5D65 A;  4CDD C;  2KEE A;  2KED A;  3CCJ A;  4ZLT F;  1Y8P B;  3FPP A;  4BY1 H;  1G51 A;  1WTQ A;  1JB7 A;  1LTA D;  2BA1 A;  4F87 A;  3PO2 G;  5DM6 3;  1YJW A;  3A8I E;  5FK9 C;  5C4X G;  5E7N A;  2DGY A;  5E1F A;  3I4N B;  3LNN A;  2AKW B;  4L5Q A;  3M3Y H;  4TKO B;  4KKS A;  1ML0 D;  1G2T A;  1U0L A;  2Q8R E;  4OWX B;  1W6J A;  3VR4 A;  4OGQ C;  2UU9 Q;  2LXJ A;  2EQS A;  2R3Z A;  4RHR A;  1F2Z A;  1AZQ A;  3Q8D A;  5COY A;  1TVX A;  5D14 A;  1HNZ L;  1K3B C;  1SNO A;  5C44 H;  2K52 A;  2G9H D;  1Q90 A;  3RN5 A;  1CA5 A;  5LL6 S;  1LAC A;  4XDX A;  4WJW A;  2NVX H;  2UUC L;  1Q12 A;  4LF4 Q;  3FHW A;  1FNV A;  2PQE A;  1B7Y B;  4N8F A;  4PMW A;  5EPL A;  1B8A A;  1NR4 A;  3NQT A;  4X3K A;  1DOL A;  3J80 i;  4IUR A;  3M4O B;  4PZ8 A;  3EQL C;  4HTH A;  1CZG A;  4UAI A;  3G48 A;  3S16 B; 
#chains in the Genus database with same CATH homology
 4PZ6 A;  4YCW A;  2VQE L;  1WJJ A;  4DPG A;  1X55 A;  4DR2 Q;  5HGQ A;  4JI1 Q;  3T1Y L;  2E2J H;  1SFO H;  1N32 Q;  4KI0 A;  4GNX B;  4LWC A;  3UDF A;  4X64 L;  1ASZ A;  4DR6 Q;  1GO3 E;  1E3P A;  1NMF A;  3BU2 A;  4IPD A;  2QEX A;  4PG3 A;  1IBL L;  5BR8 L;  2JA5 G;  4GKJ Q;  4QQB X;  3HOW G;  3HOZ H;  2JJQ A;  3I4O A;  1WOC A;  1X6O A;  2HHH Q;  1VQF A;  1W3S A;  4JI4 Q;  4BA1 I;  4A3F G;  1PH4 A;  4BY7 G;  2ZJQ A;  1WCM G;  4DV1 L;  1PH7 A;  4RMF A;  3CXC A;  1X9N A;  2ZJR A;  5IYB H;  4POG A;  5J3B A;  1CKN A;  1CUK A;  3K80 C;  1VQL A;  2MO1 A;  1V43 A;  5IP9 G;  1M90 C;  1XPU A;  1E22 A;  3E9I A;  2BA0 A;  2Z0S A;  1N33 Q;  1K9M C;  4GS3 A;  3CCV A;  2B29 A;  1VQK A;  4B3M L;  4QIW E;  1OXT A;  4KLK A;  2F4V Q;  4GOP C;  1OXU A;  4DV4 Q;  1Q46 A;  1PV4 A;  3AYH B;  4GLV B;  4B3S L;  2E5L Q;  3FKI G;  3VDY A;  2R7F A;  2NN6 I;  3KDF B;  3I4N G;  1X54 A;  1NY4 A;  5LMN L;  3AFP A;  3PF5 A;  4A3D G;  4RG1 A;  4Y52 H;  2Q2T A;  2OTJ A;  2OWO A;  1HNW L;  3H3V I;  2RHS B;  3M9B A;  4WJ4 A;  1Y1W G;  3H15 A;  2HT1 A;  3I4M G;  3TS2 A;  2D0P A;  4LF8 Q;  3PIO A;  3J81 i;  5JEA G;  3F2C A;  3KJO A;  3K7A H;  2NVT H;  3SGI A;  2VQF Q;  1I6H H;  2JA7 H;  4JI1 L;  2PI2 A;  1QUQ B;  4YWM A;  1BVS A;  1JJC B;  2YTY A;  4JC0 A;  4NB3 A;  4A3E G;  4L5R C;  1P8L A;  1J6Q A;  2B3G A;  2C35 B;  1NJI C;  2UXC Q;  3CW2 C;  3GTL H;  5LMU Q;  4YY3 Q;  2UUB Q;  4PZ7 A;  2JA6 G;  5M3M H;  1I3Q H;  3ULL A;  4R4Q A;  2OQK A;  4X62 L;  4B3M Q;  4JI3 L;  1YZ6 A;  2EIF A;  3RLO A;  4DAY B;  4DV5 Q;  2LXK A;  2EXD A;  1OXV A;  4JCV E;  2CQO A;  1G29 1;  1CKN B;  4IJH A;  4A3D H;  2ZM6 Q;  3S1M H;  1WFQ A;  5GAE C;  3I2Z A;  4DR3 Q;  1XNR Q;  4R4I A;  2JQO A;  3CF5 A;  3HOV G;  2NZH A;  3CCE A;  4IPC A;  1N36 L;  1PHJ A;  1Z47 A;  2VY3 A;  2GVA A;  3BZC A;  4UP9 A;  1PH5 A;  1VQD A;  4YHH Q;  4HJ7 A;  1K73 C;  4JI0 L;  1FJG Q;  4A3J H;  1I5F A;  4JI2 Q;  4A3K H;  3S15 H;  2VW9 A;  1PH6 A;  3HOW H;  4GKJ L;  1N34 L;  3K8A A;  4IPG A;  1HR0 W;  3G6E A;  2NN6 G;  2IY5 B;  2K5N A;  1HH2 P;  4HJ5 A;  3OW2 A;  4O2D A;  4LF6 Q;  5AJ3 Q;  1BBU A;  1CKO A;  5FLX c;  2UUA L;  2QGQ A;  4ME3 A;  1X56 A;  3L2P A;  2NVY H;  4GOP B;  4YY3 L;  3DLL A;  1YJ9 A;  3PUW A;  1V9P A;  4APV A;  1X3E A;  3PO2 H;  2YU9 H;  1JE5 A;  1VQ7 A;  4QY7 A;  1TWG H;  4DAM A;  4LF6 L;  2R93 H;  3IRB A;  3I56 A;  1HZB A;  4JI7 Q;  2OTL A;  1V1Q A;  4DV6 Q;  1K8A C;  2QA4 A;  4DR1 L;  4LF5 L;  3KDF A;  1XTD A;  5FLM H;  1VQ4 A;  1KXL A;  1EOV A;  1PFS A;  4DV4 L;  2CFM A;  4TQU S;  1OXS C;  5C3E G;  4IO9 A;  3H3V H;  4LFA Q;  4BXX G;  2Z6K C;  4DV6 L;  1AH9 A;  2E2H H;  5LMN W;  1OXX K;  4HJA A;  4JI5 L;  1LYL A;  5GAH C;  1YIJ A;  1FGU A;  1HNZ Q;  1HNX Q;  3GTK H;  4P72 A;  2PQA B;  1E1T A;  1K83 H;  5GRO A;  2JA8 G;  1AE3 A;  2Q2H A;  3NBH B;  4YWK A;  4LFC L;  4EQ5 A;  3G4S A;  1SN8 A;  2AHO B;  4JBJ A;  4AQY Q;  2JA7 G;  2HQL A;  1HJP A;  2MFI A;  5IYC G;  3BZK A;  3F8T A;  3KF6 A;  4POF A;  1EUJ A;  3M4Q A;  4NXM Q;  4WJ3 M;  3D0F A;  5IP7 H;  4HIK A;  2RHQ B;  1N33 L;  3E0E A;  4BBR H;  1I94 L;  4R4T A;  3A5U A;  2HHH L;  2KBN A;  1E24 A;  5ELN A;  5M3M G;  1QVF A;  1H95 A;  4A75 A;  2I5L X;  4P73 A;  2VQF L;  3CCQ A;  3TRE A;  1AE2 A;  1NMG A;  2A1A A;  5FLM G;  1Q8K A;  1YBY A;  4UP7 A;  3TQY A;  1YJN A;  1MJE A;  2B63 G;  5IWA Q;  1Y1V G;  1SE8 A;  3KLW A;  1UE5 A;  2MO0 A;  4O0A A;  4HIM A;  1WYD A;  1CSQ A;  1B70 B;  4JBM A;  1KQS A;  1FL0 A;  1N8R C;  4DK3 C;  1PYB A;  2I5M X;  2VS1 A;  1TWA H;  1KHI A;  4DR3 L;  3JAM c;  1XNR L;  1Z9F A;  2ZM6 L;  4NXN Q;  3T1H Q;  5FJ8 H;  4R4O A;  4L5T A;  2YTX A;  1KD1 C;  2Q2U A;  4MTN A;  4A93 G;  1EQR A;  4AIM A;  1XJV A;  1SRU A;  1S3O A;  1GVP A;  2JE6 I;  4OWT B;  2K14 A;  1IXR A;  3M7N A;  3PO3 H;  4GKK L;  2KCM A;  3UDX A;  2WAQ E;  3BJU A;  2IX0 A;  1L1O B;  4JBW A;  1PH1 A;  3LGJ A;  4HIO A;  4DR7 L;  1IBM L;  4BBS H;  3NEL A;  4LF4 L;  3D31 A;  3TS0 A;  4R1J A;  1E7Z A;  1EIY B;  1PH8 A;  3HKZ G;  3CME A;  2UUC L;  4HJ9 A;  1WI5 A;  3J7A 5;  3RNU A;  4JI2 L;  1PVO A;  1FJG L;  4A3I G;  1SLJ A;  4DUY L;  3CD6 A;  1DGS A;  2D0O A;  1KIX A;  4JI3 Q;  1N9W A;  1QZH A;  3U4Z A;  2ZTC A;  3GD7 A;  3W5O A;  4ALP A;  3ZJY C;  3S24 A;  2JA6 H;  4P71 A;  1YVC A;  1VQN A;  5ELO A;  4X64 Q;  4X65 Q;  1LUZ A;  4DV3 L;  2ATW A;  3KF6 B;  2Z6K A;  1TWF H;  3I4N H;  3PUX A;  4B3R Q;  3FP9 A;  4DR2 L;  4OO1 I;  4A3L H;  1XNQ Q;  3PV0 A;  2JA8 H;  2R92 G;  3RLF A;  1JT8 A;  1TWH H;  3KOJ A;  3ER0 A;  1YI2 A;  2HIX A;  4C3I H;  1HR0 Q;  2R7Z G;  4H02 A;  1NE3 A;  1RL2 A;  2R6G A;  2ES2 A;  2I0Q A;  5IT9 c;  1XMQ L;  1ASY A;  2AWO A;  3J81 c;  4A3K G;  4NXM L;  1UWV A;  1VQG A;  4QGU A;  3PUZ A;  3ICE A;  2OCE A;  2D62 A;  4XTC S;  4AQY L;  2K50 A;  4DUY Q;  4JG2 A;  4Y7N H;  4MNO A;  4AYB E;  4JI8 L;  3HOV H;  1YHA A;  4JOI A;  5H1S E;  5C4X H;  4DV2 L;  4DR5 Q;  1I50 H;  1MKH A;  2CWA A;  3RZO H;  4IFD G;  2H5X A;  2N3S A;  4A3J G;  1R9T H;  1FVI A;  3HOZ G;  4K0K L;  4A76 A;  3AQQ A;  1PYS B;  4A3C G;  3A5Z B;  1QZG A;  4EX5 A;  1VQC A;  1VQO A;  1IBM Q;  3S1R H;  4JI8 Q;  5GAD C;  4KHP Q;  3RN2 A;  4MZ9 A;  1OTC A;  3UDG A;  1HR0 L;  3E9H A;  3RLN A;  4HID A;  1JJG A;  3AEV A;  4DR4 L;  4JI7 L;  3U4V A;  4A3B G;  3HKZ E;  2YV5 A;  1BBW A;  1XNQ L;  1QUQ A;  2UUA Q;  5AJ3 L;  1PA6 A;  3HOY G;  1MIU A;  3U50 C;  3T1H L;  1KC8 C;  1HZC A;  1UE1 A;  2A19 A;  3TRZ A;  3H0G G;  2WAQ G;  2K4K A;  2LSS A;  4A3B H;  1Q1B A;  2KEN A;  5HY6 A;  3PCO B;  4DKA C;  3G71 A;  1K8G A;  3CPF A;  2A8V A;  5GQO A;  4C2M H;  2UXB Q;  1KRT A;  3CQZ H;  3CC4 A;  5IYD H;  3UE1 A;  4LF9 L;  2BH8 A;  4JYA L;  1IZ6 A;  3PGZ A;  1TWC H;  4GNX C;  4JI6 Q;  4X66 L;  4A3C H;  2N78 A;  3JAM i;  3CC2 A;  2Y0S E;  4B3T L;  1N32 L;  1M1K C;  3S1N H;  4JV5 Q;  2JA5 H;  2UXB L;  1E1O A;  2I5H A;  2VQE Q;  1N36 Q;  1KL9 A;  4BY1 G;  2N49 A;  1U5K A;  1A0I A;  4LNQ A;  2K5V A;  4A3G G;  4DR4 Q;  1VQ8 A;  5DLQ E;  1XPO A;  4IJL A;  1VQH A;  2OQ0 A;  2MNA A;  3PIP A;  3A74 A;  4YCV A;  4NPS A;  4LFC Q;  3S14 H;  3MEF A;  1Y1W H;  5M3F G;  2F3I A;  4AYB G;  4DV7 Q;  3I4M H;  3M4P A;  3CCS A;  3W1B A;  4A3M H;  4JI5 Q;  1S72 A;  2RCN A;  4DUZ L;  3S1Q H;  4K0K Q;  3GTQ H;  1X3F A;  2BH2 A;  3HOU H;  2PI2 E;  3PF4 A;  5GAG C;  1L2F A;  3PUY A;  4GOP A;  1LM0 A;  4DV0 Q;  1J5E Q;  3GDE A;  4IFD J;  4BY7 H;  5IWA L;  4P74 A;  3S17 H;  2JEB I;  2XGT A;  4GLA C;  1VQE A;  2WFW A;  2WP8 J;  1YEZ A;  4OWW B;  1GM5 A;  2Q2I A;  4YWL A;  1BKB A;  4P75 A;  1EFW A;  2VNU D;  4DV5 L;  4A4I A;  3M85 A;  5C44 G;  4A3I H;  4OX9 L;  3KFU A;  2K75 A;  4DNI A;  1W2B A;  1CSP A;  5LMU L;  2UUB L;  1K3R A;  2RF4 A;  2YTV A;  3FKI H;  3RR5 A;  3OTO L;  4LFB L;  2CWP A;  4KHP L;  3EIV A;  4OO1 G;  3GTG H;  3MXN B;  3STB D;  1IYJ B;  1SRO A;  4BBS G;  1YHQ A;  1VQA A;  3I55 A;  3HOX G;  1JMC A;  1N34 Q;  3EN2 A;  1Q7Y C;  4BA2 I;  2ID0 A;  4LW1 A;  1IL2 A;  3W1G A;  4DV3 Q;  1KAW A;  4JI0 Q;  5JJI A;  5IP9 H;  4X65 L;  2Y0S G;  1HNX L;  5C0X J;  4A3G H;  4C3J H;  2E8G A;  4KHZ A;  1VQP A;  2VL6 A;  1KRS A;  1RIP A;  3GO5 A;  3CC7 A;  2IT1 A;  4LUZ A;  4IOA A;  2R7Z H;  2CCZ A;  3GTO H;  1L1O A;  5EAY A;  5IYC H;  1XMQ Q;  1YIT A;  4A3E H;  4DR7 Q;  5IE8 A;  4X62 Q;  3CCM A;  1HZ9 A;  1C7Y A;  1CKM A;  4IOC A;  4LUO A;  5IYD G;  1VQM A;  3M4O H;  1YHB A;  2KHI A;  2UXD Q;  2AMC B;  4OON A;  2VZA A;  5FJ8 G;  1QVC A;  1IBK L;  3K0X A;  3H0G H;  4IPH A;  4J15 A;  3UE0 A;  1NTG A;  5C3E H;  2WB1 E;  4NXN L;  1MJC A;  1VS0 A;  3PSI A;  3KJP A;  1EYG A;  3J7Z C;  1GD7 A;  1VQ6 A;  2L15 A;  4X6A H;  3TEH B;  2JK8 A;  4UPA A;  4LF7 L;  4UY8 C;  4TVA B;  2E2I H;  3L0O A;  4LUV A;  2UUC Q;  2JEA I;  4LF7 Q;  2B63 H;  5JJL A;  2ZJP A;  3CP0 A;  3S2H H;  1UE6 A;  4UP8 A;  5M5W H;  4JI6 L;  1YNX A;  4A3M G;  4BBR G;  4BXX H;  2E5L L;  3UDI A;  5IP7 G;  3I7F A;  3CMA A;  1VQB A;  3F2B A;  4B3S Q;  1Q86 C;  3GTM H;  3CCU A;  4FDB A;  2ZTD A;  1L1O C;  2R92 H;  2VUM H;  1TXY A;  2ASB A;  2UXD L;  3J80 c;  1A62 A;  2IX1 A;  3J81 j;  1S40 A;  2UXC L;  3STB C;  2DUD A;  3KYH C;  3ULJ A;  4L5S A;  1WCM H;  2PMZ E;  2YYZ A;  3EBE A;  1LTL A;  4R4C A;  4DV7 L;  4GKK Q;  1I94 Q;  2R93 G;  2F52 A;  5C4J H;  2IHE A;  2HIV A;  3ERS X;  3A0J A;  3CPW A;  1K0R A;  4QL5 A;  1PH3 A;  1X65 A;  3B6Y A;  2GN5 A;  3HKS A;  3HFZ B;  3CCR A;  4LFB Q;  1VQI A;  5M5X H;  4GN5 A;  3GTJ H;  4LF8 L;  3PUV A;  1C0A A;  5K36 G;  4JI4 L;  4GN4 B;  2IHF A;  4JV5 L;  3U58 A;  3OYY A;  5JJK A;  3PO3 G;  1A8V A;  1VCI A;  3CCJ A;  4B3T Q;  1Q1E A;  4A93 H;  1HNW Q;  4DK6 C;  5IYB G;  1XMO Q;  4BY1 H;  1G51 A;  2CKZ B;  5LMN Q;  1X3G A;  4GNX A;  4DR6 L;  1SMX A;  1JB7 A;  4LF9 Q;  2V1C C;  2BA1 A;  4IFD I;  3F1Z A;  4JYA Q;  1A63 A;  3PO2 G;  4OXP A;  3T1Y Q;  1YJW A;  1GKH A;  4QJF A;  5C4X G;  3K81 C;  2DGY A;  5E7N A;  2PNH A;  2N8N A;  4GLX A;  2F4V L;  4DR1 Q;  4LF5 Q;  1EIF A;  1XMO L;  3L7Z C;  1Q81 C;  3ULP A;  2AKW B;  4L5Q A;  3M3Y H;  5M5Y H;  3HOU G;  1O7I A;  4OX9 Q;  4B3R L;  4GN3 B;  1U0L A;  5IY0 A;  2UU9 L;  4OWX B;  1UEB A;  2GVB A;  3HOX H;  4XIG S;  1EWI A;  2UU9 Q;  1EQQ A;  2NZO A;  3OTO Q;  1UE7 A;  2LXJ A;  5M3F H;  1NBW A;  2EQS A;  4A3F H;  4DV1 Q;  2ZTE A;  1P16 A;  1PH9 A;  3CCL A;  2R7D A;  3KF8 B;  1Y14 B;  2K5H A;  1SR3 A;  4C3H H;  3S2D H;  3DM3 A;  3Q8D A;  1QVG A;  1Q82 C;  4A3L G;  2ALY B;  1HNZ L;  4HJ8 A;  5BR8 Q;  2VUM G;  3GTP H;  2KHJ A;  5C44 H;  4JOI C;  3F2D A;  2K52 A;  4X66 Q;  1C9O A;  1D8L A;  2XTI A;  2PQA A;  1IBL Q;  1G6P A;  3RN5 A;  4LFA L;  4DUZ Q;  2NVX H;  3K7U C;  5C0X G;  1PH2 A;  1Q12 A;  5C0X I;  4DV0 L;  4YHH L;  4DR5 L;  1J5E L;  3FHW A;  3JC6 6;  4DV2 Q;  4LF4 Q;  2NVQ H;  4JBK A;  1B7Y B;  3RZD H;  1JJ2 A;  4PMW A;  1VQJ A;  1B8A A;  4YCU A;  1XPR A;  3WWV A;  5JEA J;  1Y1V H;  2AWN A;  2MQH A;  1VQ9 A;  1HZA A;  2KCT A;  3J80 i;  4AH6 A;  3CAM A;  1L0W A;  1IBK Q;  1VQ5 A;  3S16 H;  3NEM A;  2WB1 G;  3NEN A;  4PZ8 A;  2JA9 A;  1D7Q A;  2FXQ A;  1T9H A;  3AFQ A;  3HOY H;  3G48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...