4DV6L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 16
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv6L00
1IBMQ 2PNHA 4A3MH 4YY3L 1CSPA 5C0XJ 3I55A 1PH9A 2VUMG 3HOWH 2ALYB 2PQAA 2ZTCA 4C3JH 4LF6L 3NBHB 1E7ZA 2I0QA 4OWWB 1XPUA 4HJ7A 3TS2A 4A75A 3KJPA 1CUKA 4DR2Q 4GKJQ 4X64L 4A3JH 5C4XH 5FLXc 1Z9FA 5FJ8G 3GDEA 3UE0A 4BBRH 4YHHQ 3D0FA 1S72A 2VL6A 2ZM6Q 3KFUA 4HIMA 1KXLA 3UDGA 4AIMA 1E22A 1VQDA 1GM5A 4A3EG 1XNQL 3HOUH 2CQOA 3M7NA 1HNXL 4JV5L 4DNIA 1XTDA 2UXBL 2KBNA 2CFMA 3GTMH 5M3FH 1U0LA 5C44H 4IFDG 4GLVB 4QJFA 5IYDH 3CAMA 1E1OA 1OXXK 1YBYA 4FDBA 2ID0A 1K73C 3OYYA 2IX0A 4UP7A 1PH4A 4BXXH 3I7FA 1LTLA 3PO3H 2Q2IA 1Y14B 3PUVA 4OXPA 1RIPA 4LNQA 4DPGA 1UWVA 1VQ5A 2E2HH 4LFAL 4JI1L 5H1SE 3JAMc 2H5XA 2K5HA 3KJOA 4DKAC 1C9OA 4PZ8A 4AQYL 5C0XG 4PZ6A 1V9PA 2FXQA 1XPRA 1VQEA 3PCOB 3I4OA 3G71A 2I5HA 4O2DA 2OTLA 3CCLA 5IP7H 1KHIA 3CCVA 2JJQA 3W1BA 2AKWB 3KF8B 1J6QA 1NMGA 4DV7Q 4GLXA 2JA5G 2AWOA 4YCVA 4JI5Q 3I4MH 5J3BA 3S24A 5JEAG 2Z6KA 4A3CH 5JJIA 4KHZA 2JA8G 4LF4L 1VCIA 2IY5B 4YCUA 4K0KL 1JJGA 3GTQH 2K5VA 2UUCQ 3I56A 2HHHQ 5BR8L 1YIJA 3F2BA 4DV2L 4JI2L 3G4SA 1X56A 1WJJA 3ZJYC 3CCRA 4P72A 3J81c 2RHSB 1QVCA 3I2ZA 2MFIA 4JI8L 3T1YL 3K0XA 2F52A 4A3LH 4H02A 1M90C 1GVPA 2YTYA 2K52A 4JI4Q 4MNOA 2VUMH 1PH3A 2HIXA 3UDIA 1SFOH 1UE1A 4JI3L 1I94L 1YJ9A 5IE8A 1A62A 1N8RC 1Y1VH 1YHBA 1WI5A 1VQAA 1QVFA 5LMNL 4L5SA 4C3IH 2UUBQ 3DM3A 4IPDA 1I5FA 1X3FA 2UU9L 4LF7L 4DV6Q 3F8TA 3RLNA 4LF5Q 2JQOA 4OWTB 3T1HQ 1SMXA 4R1JA 2KCMA 3CXCA 1VQIA 3D31A 3BZCA 1L2FA 4A76A 3UE1A 1YJNA 1PYBA 3ERSX 1K0RA 1TWHH 4YCWA 1L0WA 4DR1Q 1ASZA 4JYAL 4HIDA 3J80i 4A3BH 1K8GA 2Y0SG 2ZTEA 4JI7L 4B3RQ 4BA1I 4AYBE 4A3KH 3S14H 2A1AA 2DGYA 4QGUA 2UUAQ 4GN4B 4DAMA 2K14A 1B7YB 3PUZA 1IBKL 4DV0L 4JOIC 2BH2A 4WJ4A 4HIOA 1EQRA 1PH6A 2YTVA 4JBJA 4DUZL 3U4ZA 4DR3Q 4BBSG 1FL0A 3U58A 4GKJL 2YYZA 3U50C 2UXCL 1VQLA 3HFZB 1KRSA 4YHHL 1P8LA 1HNZL 2A19A 3CP0A 1Q8KA 4OO1I 2QGQA 1VQHA 4B3MQ 4DR4Q 1A0IA 1HZCA 2D62A 4P71A 4JBMA 1XMOQ 3PSIA 1BKBA 1ASYA 3TQYA 3S15H 4DK6C 1HZBA 4DV4L 4GOPC 4X6AH 2WAQE 1VQCA 1IYJB 3EIVA 1NY4A 3STBD 2JA8H 1G291 3CCMA 4GN5A 2R7ZG 1HZ9A 3CCQA 3H15A 1QUQA 3HOYG 4GOPB 3AQQA 2R93H 4NXMQ 4JI6L 4X66Q 4LF9Q 4LFBQ 4GNXB 4DV3Q 3PIPA 2B3GA 1SRUA 4HJ9A 4EX5A 5HY6A 1L1OB 3A5UA 1MJCA 3CC4A 4JCVE 1O7IA 3GD7A 1X3EA 4A3IG 1N33Q 4RG1A 1OTCA 3S1MH 3EN2A 4NXNL 1VQ4A 2JEAI 1B70B 3E9IA 2NN6G 2R7FA 3M85A 1Z47A 1VQJA 1VQMA 1Q86C 4BY7G 2R7DA 1JE5A 2L15A 5GQOA 3H3VH 4DR6L 1PHJA 3K7AH 1YVCA 3PV0A 2NVQH 2HHHL 3GTKH 1W3SA 4LFCQ 3S2DH 3ER0A 1WYDA 4PMWA 3GTPH 2LXKA 2MO0A 3NENA 2E2IH 5IYBH 3PIOA 1N34Q 2E5LQ 1S3OA 2EXDA 2IHEA 3L7ZC 4NB3A 1KIXA 2WAQG 1TWAH 2I5MX 2BA1A 2MQHA 1XMQL 1N36L 4R4TA 3ULLA 2KENA 2K4KA 1IBLQ 1K83H 1EWIA 3ULPA 2HT1A 4P73A 1XNRQ 1KRTA 4X65L 3GO5A 4APVA 1AE2A 1CKNA 2JK8A 3I4NG 2HIVA 3CMEA 4BBSH 3FP9A 5AJ3Q 2B63G 1D7QA 4DR7L 1MIUA 1VQ9A 2ZJRA 4L5QA 4LWCA 3M3YH 5M5YH 3KF6B 3M9BA 4GN3B 1VQNA 5ELNA 4KLKA 1JJCB 3RLOA 5FLMG 3T1HL 1Q81C 3HKZE 4A3DG 2E8GA 1Q1EA 1A8VA 2AWNA 3S1RH 1G6PA 2F4VQ 1HJPA 1PFSA 4YWLA 3A74A 4B3RL 2RCNA 2Y0SE 3FKIG 4MTNA 5IT9c 3F2DA 1VQKA 4B3TQ 1N32L 4QL5A 1G51A 3M4OH 4P74A 3PUYA 2BH8A 4DUYL 2JA9A 2R7ZH 1SROA 4YY3Q 4DR3L 1C7YA 4LF8L 2NZOA 5LMUQ 3HOYH 1KC8C 2R92G 3WWVA 3Q8DA 4LF6Q 4B3SL 2UXDL 3GTOH 5GAEC 4A3FG 1JMCA 1PH1A 4GLAC 4X64Q 2WFWA 2YV5A 2VQFQ 4B3ML 4DR4L 1SN8A 1BBUA 2GN5A 5HGQA 1QZHA 5M5XH 3CCEA 4A3IH 1SE8A 4J15A 2DUDA 1NTGA 3NELA 3HKSA 4O0AA 3PF4A 1T9HA 4GS3A 2WB1G 2WP8J 3DLLA 1OXVA 3RZDH 5FJ8H 3CC7A 1PH5A 3HOVG 5M5WH 3HKZG 4ME3A 1FJGL 2VQEQ 2JA6G 4BY7H 1NBWA 2UXBQ 3TEHB 2VW9A 1KAWA 4UP9A 1TWGH 3CF5A 4A3EH 2Z6KC 4XTCS 3PF5A 1PH2A 3KLWA 4YWMA 1XPOA 1I3QH 2CWPA 4X66L 1PV4A 1IBML 1X55A 2N78A 2OWOA 2BA0A 3NEMA 3A0JA 1NMFA 4JI1Q 1E1TA 1K8AC 1WFQA 4C3HH 3CMAA 1Q1BA 1TXYA 4AQYQ 1EUJA 2Q2HA 1JB7A 5IP9G 1MKHA 4DR2L 4JI0Q 1N33L 3UDXA 1OXSC 4TQUS 5IWAQ 3CD6A 3I4NH 3E0EA 4R4QA 4HJ5A 4UPAA 2B63H 3STBC 1X6OA 3AFQA 4X62Q 1YEZA 3KDFA 2ZM6L 1YI2A 1HR0W 2OCEA 1HR0Q 5JJLA 1FGUA 3CCUA 4PZ7A 5FLMH 4GNXA 4A3DH 4Y52H 4KHPQ 3F1ZA 1I50H 4WJ3M 1H95A 1HNWQ 1L1OA 2ES2A 3AFPA 3LGJA 4LF4Q 2CWAA 4K0KQ 3S1QH 3MXNB 2JA5H 4GKKQ 1J5EQ 3KOJA 3JAMi 3FKIH 4R4CA 3PO3G 3S2HH 4DV2Q 4JI2Q 2ASBA 4R4IA 1UE6A 1JJ2A 1BBWA 4POGA 3UDFA 2MO1A 3GTGH 2PI2E 1Q46A 1D8LA 1WOCA 1FVIA 4XIGS 4AH6A 3BJUA 2MNAA 3BU2A 2RF4A 3L2PA 1PH7A 2R92H 1SR3A 3W5OA 1I94Q 2B29A 1TWCH 1OXTA 4A3FH 3BZKA 2OTJA 1WCMG 3A5ZB 5LMNQ 1B8AA 2JA7G 1EQQA 2IT1A 3RZOH 1EIYB 2UU9Q 4IFDJ 4OO1G 1UE7A 2K5NA 3H0GG 3TRZA 4TVAB 4DV7L 1E3PA 3W1GA 3E9HA 2QEXA 1CKMA 4JI5L 2KCTA 3J81i 1EOVA 1KL9A 4JC0A 3F2CA 1NE3A 3U4VA 4A93G 4DV5Q 1YHQA 4JYAQ 2AHOB 3HOVH 3HOZG 3J81j 4A3GG 3CPFA 3CPWA 1KD1C 4IFDI 2YTXA 2JA6H 2UUCL 4JI7Q 4IPHA 3KF6A 1YNXA 2EQSA 1LM0A 2Z0SA 4DK3C 5LMUL 1XNRL 2LXJA 2ZJPA 1IBKQ 1PH8A 2VZAA 4DV0Q 2EIFA 3GTLH 4DUZQ 1Y1VG 4JI4L 3RN5A 3J80c 4BA2I 4A4IA 1A63A 1X54A 5C0XI 2UXCQ 2VQFL 4LUVA 4RMFA 5JEAJ 1VQFA 3PUXA 5M3MG 3K8AA 1PYSB 5E7NA 2E2JH 4OX9Q 4P75A 4DR5Q 3JC66 3CCSA 1W2BA 1QUQB 5IP9H 4HJAA 1IXRA 1VQBA 1HNZQ 2UUBL 2I5LX 2OQKA 1V43A 5DLQE 4LW1A 1NJIC 4DV6L 2WB1E 4LF5L 1Y1WG 1HZAA 4A3BG 2IHFA 5K36G 2VQEL 1YJWA 1QVGA 3CCJA 2PQAB 4EQ5A 2JEBI 4DV1Q 4A3KG 4DV4Q 2VY3A 1TWFH 3GTJH 2Q2UA 4DR1L 1VQ6A 2NZHA 4BY1G 1X3GA 3RN2A 1HH2P 3CQZH 3TS0A 2ZJQA 3HOXG 4OONA 3S16H 1AH9A 2UUAL 1E24A 5IY0A 1C0AA 3PO2G 1LYLA 5C4JH 1I6HH 3TREA 1EYGA 3OTOQ 1V1QA 2V1CC 4IJLA 4JI6Q 2GVAA 1UE5A 1KQSA 1M1KC 5IYCG 4JBKA 4JI0L 1GD7A 5IWAL 4HJ8A 4LUOA 1VS0A 1X9NA 3SGIA 4X62L 4QY7A 4OWXB 5C3EG 3PUWA 3ICEA 1HR0L 2AMCB 4NXNQ 2XGTA 4Y7NH 2KHJA 2Q2TA 3H3VI 1WCMH 4IPGA 4IO9A 3RNUA 4POFA 4KHPL 1BVSA 2JA7H 1HNWL 1XMOL 3K7UC 1SLJA 1X65A 1PA6A 1U5KA 1CKNB 3H0GH 1Q82C 2A8VA 4DR6Q 3FHWA 1DGSA 1IL2A 2JE6I 4GKKL 1J5EL 1XNQQ 4A93H 2OQ0A 2ZTDA 1S40A 2XTIA 1HNXQ 4JOIA 4JV5Q 4IJHA 3K81C 4C2MH 3HOZH 2NVXH 4A3GH 2K75A 4A3MG 3AEVA 2NVYH 2D0OA 1UEBA 1XMQQ 2N3SA 1VQ7A 1N9WA 2RHQB 1N36Q 3HOWG 4L5RC 4NXML 3RLFA 4PG3A 4LF9L 1VQGA 2KHIA 1IZ6A 4X65Q 4LFBL 3G48A 4NPSA 2HQLA 4DV3L 4ALPA 4MZ9A 3J7ZC 1K3RA 3L0OA 3M4PA 3IRBA 4LFAQ 4A3JG 5C4XG 4IOAA 1VQOA 5JJKA 4BBRG 5ELOA 3S1NH 4DR7Q 2LSSA 4QQBX 5M3MH 4HIKA 5GAGC 1RL2A 1YITA 2NVTH 3OW2A 1OXUA 4GOPA 2C35B 3HOUG 1CSQA 1AE3A 4QIWE 4DV5L 4LUZA 1PVOA 4YWKA 1YZ6A 1LUZA 3M4QA 5IYBG 1Y1WH 2ATWA 2PMZE 4IOCA 5M3FG 3EBEA 1Q7YC 5C44G 2CKZB 3B6YA 4LFCL 1R9TH 1EFWA 1N32Q 2VNUD 2N8NA 5IYDG 1MJEA 3J7A5 1N34L 4JG2A 2E5LL 3PGZA 3G6EA 4BY1H 3CW2C 4BXXG 5GAHC 1GO3E 3K80C 3RR5A 5GADC 5GROA 3HOXH 5BR8Q 4DUYQ 2QA4A 1IBLL 3S17H 3PO2H 4LF8Q 2VS1A 1GKHA 1P16A 4UP8A 4IPCA 1EIFA 3T1YQ 4JBWA 4JI8Q 3CC2A 3KYHC 1VQPA 2YU9H 4DAYB 4B3SQ 2UXDQ 4KI0A 5EAYA 5IYCH 4OX9L 4DR5L 1XJVA 3AYHB 1YHAA 5AJ3L 2N49A 2PI2A 4JI3Q 1CKOA 3ULJA 4AYBG 5IP7G 4UY8C 2F3IA 2K50A 2NN6I 3I4MG 2R93G 4L5TA 5C3EH 5LMNW 2IX1A 4DV1L 4A3CG 1Q12A 2F4VL 4LF7Q 2D0PA 3VDYA 3MEFA 2R6GA 1QZGA 1VQ8A 2CCZA 1FJGQ 4B3TL 1JT8A 4GNXC 1K9MC 4R4OA 3OTOL 1L1OC 2GVBA 4A3LG 3KDFB
chains in the Genus database with same CATH superfamily
2F0FA 1RF2D 5M3MB 5FLXL 2ALYB 2PQAA 4C3JH 1E7ZA 2I0QA 4G7ZC 1EZ8A 1STEA 1TWHB 4HMJA 4U68A 1OO9B 3VR5A 5FJ8G 3EFXD 1RKNA 4DAVA 2O4XA 4CHTB 4HIMA 1KABA 3UDGA 4X3SA 1KXLA 5T1IA 1GM5A 2B39A 4J6HA 2J7ZA 4JV5L 2F0PA 4MHEA 3I8ZA 1R4QB 2A69D 3GTMH 1U0LA 3I91A 2LS01 4IFDG 5IYDH 3TSSA 1YBYA 4FDBA 4RFBA 1EY6A 2ID0A 1PH4A 2A6HD 2JSOA 4BXXH 3I7FA 1LTLA 2L11A 2RDGA 1Y14B 1X3QA 2TSSA 1UWVA 1VQ5A 4DNTB 4JI1L 4OIKA 3JAMc 2XNAC 1WTWA 4AQYL 1C9OA 4PZ8A 4RCOA 2HDLA 2MHVA 3CCLA 1KHIA 1CM9A 3CCVA 3W1BA 1NMGA 4RHSA 4YCVA 1EEFD 4A3CH 4KHZA 5A2QE 3MHBA 1IL8A 3FPUB 2IY5B 4CJ2C 5JVG3 3I56A 2B2VA 2MJ8A 4DV2L 4JI2L 1XNRQ 3H3VC 3S1MB 4P72A 2RHSB 3I2ZA 2MFIA 4JI8L 3HZXA 3URYA 3HGBA 2YTYA 4JI4Q 2CH4W 1XYIA 2HIXA 2KEDA 4J1MA 3UDIA 3VR6A 2HDMA 3IFTA 4K5XA 2A6ED 3MXNA 3HG9A 5LMNL 5ELDA 2NWGA 5CYUA 1TWAB 4DV6Q 3F8TA 3RLNA 1K83B 4OWTB 1SMXA 2EJMA 1LTSD 1EYCA 3BZCA 1YJNA 1PYBA 4DR1Q 1PZID 4HIDA 2ZTEA 2Z8LA 4AYBE 2A1AA 2UUAQ 4QGUA 3I72A 2K14A 4V0BA 3PUZA 3M3YB 4DV0L 4JOIC 1EQRA 1PH6A 4XDXA 4DR3Q 4BBSG 1NNXA 3T53B 3U58A 5FK9C 2R93B 5DAUA 5EBDA 4KY5A 5C5LA 1P8LA 1HNZL 5C0XH 1Q8KA 2QGQA 1X3PA 1EFID 2N55A 1ASYA 4PMBA 3FPPA 3PMFA 1PTOB 5J39A 5JEAH 2WAQE 1S5BD 2JA8H 4F87A 3HS0C 2OF1A 1A15A 4GOPB 3HOYG 3NQIA 5M5XB 1EQTA 3TBIB 4NXMQ 4B9XA 3D6WA 1SMYC 1ICWA 2L55A 1SRUA 4HJ9A 1GUWA 1KTKA 1L1OB 4R9WA 4YIJA 4JCVE 3CC4A 2DN8A 2B2TA 1JE4A 4KJNA 5CBAE 4A3IG 1N33Q 4RG1A 1OTCA 3IKJA 3QJYA 1I3QB 1DONA 3M85A 1VQJA 1VQMA 1WTRA 2L15A 4ZK9B 5GQOA 3H3VH 3H09A 1I4GA 2NVQH 1J8IA 1LACA 3GTKH 4C3HB 1WYDA 3GTPH 2DJGC 2SEBD 1N34Q 4XYQA 1KIXA 2WAQG 2B63B 2BA1A 1Z7TA 1T5XD 2K4KA 2EOTA 2KQ3A 4K2LA 3ULPA 2A5HA 3BZDB 3TDQA 5ELBA 4N8FA 2HIVA 3S15B 3TZDA 5IGBA 5EPJA 2JA5B 2F0MA 3KF6B 5FLMG 1Q81C 5BN4A 3GTGB 3CRKC 1ET9A 3S1RH 4KJOA 1CHQD 1JOOA 3LX0A 1DOMA 2A74C 3F2DA 4B3TQ 4MTNA 3OWEB 3D6CA 3LNNA 4LJZC 2F0VA 1II3A 2JA9A 4HEDA 4DR3L 5LMUQ 1JB3A 1KC8C 2AQ3B 3Q8DA 3JAME 3E6ZX 1C4QA 1UUPA 3SK8A 3E3XA 3HKZB 4X64Q 2Q8IB 2F0IA 2K05A 2FHTA 5HGQA 4NDXA 3NELA 3PF4A 4ZRZA 3HOVG 5CV8A 4R8NA 1EYAA 2UXBQ 3TEHB 4DXGA 1NR2A 2IW3A 4HR7B 1EY0A 1U4MA 4XTCS 1PV4A 1IBML 1TR5A 3OMCA 1NMFA 1E1TA 1WFQA 1EUJA 1N33L 1MKHA 2EPBA 3A7LA 4HJ5A 2EY2A 1EYDA 3CQZB 3STBC 1X6OA 1FNVA 4ZYSA 2ZM6L 4IZ8A 1HR0W 3V96A 1HR0Q 2Z9HA 3ITPA 4PZ7A 4A3DH 4Y52H 1H95A 1HPCA 3N52A 1YNND 3LGJA 1I4XA 1J5EQ 3JAMi 4R4CA 3PO3G 3BVGA 3S2HH 1LO5D 1EOTA 4OELB 3X3MA 3Q6SA 1BBWA 4Y7NB 2MO1A 4R8IA 1WCMB 1D8LA 2QEJC 1FVIA 4XIGS 4AH6A 1SYBA 1VF7A 1YNJD 2CHBD 4LK1C 3GV3A 3L2PA 2R92H 1F2ZA 4A3FH 2PMZB 1B8AA 2D9UA 2IT1A 2FMMA 4OO1G 3H0GG 2F3WA 4N8X1 1WD1A 3W1GA 3E9HA 2QEXA 1CKMA 4C1NK 3K5NA 2O2LD 2IWHA 2ZT9C 4L6TB 4JYAQ 4DF7A 3J81j 1I4PA 4KMUC 2A68D 2E74C 2K03A 4IFDI 2JA6H 4JI7Q 1NUCA 3J7YW 1EIGA 5LMUL 2EQSA 1LM0A 2Z0SA 1IBKQ 2NVTB 2RKSA 4CDCC 3BDOA 2EIFA 1SXTA 1PFBA 4DUZQ 3SK6A 3RN5A 3J80c 2J4XA 1X54A 2RCFA 4LUVA 5JEAJ 3PUXA 1VQFA 5M3MG 5E7NA 2QILA 4P75A 5L37A 5IP9H 4HJAA 1VQBA 4BY1B 1V43A 5DLQE 4LW1A 2B2TC 4EQ5A 4DV1Q 3GTJH 3U9OA 1VQ6A 2NZHA 1ENFA 1RTNA 1AH9A 1E24A 5IY0A 1C0AA 3PO2G 5C4JH 1DD2A 4PQXA 5C3EB 3BVZA 2GVAA 1KQSA 4KN7C 1F9RA 4F88A 1EQVA 2NB0A 3SGIA 4QY7A 4OWXB 3ICEA 1HR0L 5FO8B 3DUZA 1ZXTA 2ZXOA 1SE3A 1GHKA 2JA7H 2LMCB 1Q82C 3FHWA 4C3JB 2MPMA 3VA7A 3NK9A 1J5EL 3K58A 1XNQQ 2ZTDA 4OL7A 1HRJA 4XQJA 3HOZH 1J9OA 3NHHA 1QG7A 4KTAA 2D5DA 2N3SA 2EJFC 3HOWG 3T56B 4L5RC 4PG3A 4LF9L 1K28A 4ZLTF 4X65Q 2HQLA 4MZ9A 3J7ZC 1K3RA 3L0OA 3IRBA 5C4XG 1JICA 1GOZA 4WJWA 3GTMB 1ESRA 1D2BA 5GAGC 1RL2A 1YITA 3OW2A 3SVMA 1AE3A 2VXWA 4XQQA 3OHXC 2F0UA 2KA7A 2Z6BA 1V1PB 3EBEA 1Q7YC 5C44G 3B6YA 2VB2X 2VNUD 1N32Q 3ND8A 2N8NA 2L9HA 1GUNA 3DHQA 4JG2A 2XN9C 1ZYRD 5GAHC 2CW0D 4UP8A 4IPCA 4JBWA 3CC2A 1IKMA 2YU9H 4DAYB 5IYCH 2PW5A 2QDLA 2K50A 2R93G 3GP7A 4L5TA 4K2KA 3DXJC 3DEOA 5J1ZA 3A54A 2IX1A 1HFNA 1KAAA 4DV1L 1EU4A 5LL6S 4AYBB 2R61A 4CKEA 1F2LA 1QZGA 1B9MA 3MEFA 1VQ8A 2CCZA 4ZCKA 2WINB 4RKLA 3AB9A 1MD2D 4IUTA 3D4DA 3T16A 1K9MC 4R4OA 5I9OA 1D1IA 2K33A 4UAIA 2GVBA 1RHPA 4A3LG 3MZ5A 5CR3A 4YY3L 4A3MH 3I55A 3OPOA 4ZUIA 1KDBA 4LF6L 2DNCA 3DWAA 3TS2A 1CUKA 4P2CB 5IGFA 1BOSA 4DR2Q 1EY8A 5FLXc 3C3LA 1Z9FA 2SNMA 3UE0A 1SAPA 2VL6A 3KFUA 3T51B 4AIMA 1PZJD 2WACA 5KYIA 1XNQL 1K3BC 3HOUH 1EU3A 4DNIA 2KBNA 4TRDA 5M3FH 2LFNA 4QJFA 3EROA 5BN5A 1E1OA 1OXXK 1K73C 1CQFA 4C3HG 3QG1A 2Q2IA 4OXPA 3J80E 1RIPA 2P5ZX 1EWHA 4DPGA 1WTPA 2E2HH 5H1SE 2K5HA 1ICFB 5KNDA 3Q22A 4PZ6A 5IT9L 1EL0A 3CU7A 1TS2A 1XPRA 3VR2A 1VQEA 1BCPF 3I4OA 3G71A 5IP7H 1LT5D 1ILPA 1JOQA 5FO7B 1E0BA 2DY8A 4DV7Q 2AKWB 3KF8B 4GLXA 2JA5G 3I4MH 2CH4A 5JJIA 4RAUC 5ELCA 1BR9A 3A56A 1E2WA 2E75C 1F2MA 1SNMA 2HHHQ 1YIJA 1EWCA 1X56A 3ZJYC 3CCRA 3CD6A 1QVCA 3RD4A 3K0XA 2F52A 1M90C 1GVPA 1PZKD 1UE1A 2NVQB 2L12A 3CHBD 3GTKB 5CV9A 1CA5A 3GTPB 1HA5A 1WI5A 1VQAA 3P1HA 1HTPA 5G3LD 4C3IH 5KYLA 3R2TA 4LF5Q 2JQOA 3ONAB 1RD9D 4R1JA 1SNOA 1L2FA 4A76A 3UE1A 4FXGC 1B50A 5IGGA 1FNWA 2BDOA 2SDFA 3J80i 5JPNC 2XRQD 4A3BH 4A3KH 5CV7A 1H9MA 3S14H 3BG3A 3QB3A 4IFDH 4WJ4A 4HIOA 1WTVA 4JBJA 3QO2A 3S1RB 1CA6A 1BCPC 2UXCL 1DZ1A 4L8JA 1JWMD 1XXGA 4XT1B 4FXDA 2A19A 2NBFA 4OO1I 1STGA 1HZCA 1SJHD 4ZQ3A 1XMOQ 4S3SA 3MA2B 3SK4A 4DV4L 1IYJB 2AUJD 4NKLA 1G291 1PRTD 1DJRD 4GN5A 2R7ZG 1HZ9A 1QUQA 3AQQA 3FVQA 4XXEA 1G8ZD 4LFBQ 2JN4A 1SNDA 4DV3Q 3PIPA 1H9KA 4N9PA 1BXTA 2BCOA 4NXNL 1VQ4A 1WTQA 1B70B 2R7FA 1Z47A 4BY7G 1U9RA 4DR6L 1L0YB 1STBA 4ZKCB 2HHHL 4LFCQ 2LXKA 2E2IH 4CJ1B 2E5LQ 2EXDA 5KNCA 1XMQL 3NBIA 2I5MX 2K5DA 1N36L 1IBLQ 3T13A 1KRTA 2PZUA 1BNZA 4NMZA 4A3DB 3QOLA 2JK8A 1CKNA 3I4NG 4BBSH 1STHA 1Y8NB 2KJXA 1ML0D 1E2VA 5TSSA 1D7QA 5FLXE 1VQ9A 4DR7L 4KK7A 4LWCA 3S2HB 5M5YH 3M9BA 1IHZA 1JJCB 1Q3LA 3RLOA 1CK1A 2EY1A 1DYQA 2AWNA 5I2YA 2F4VQ 3VYSA 2F0LA 5C6AA 4YWLA 3VR3A 3R8BA 3FKIG 2R92B 1GJXA 1GUSA 1VQKA 1SDFA 1KDAA 1G51A 3M4OH 4P74A 4A3FB 1CT1D 4LF8L 1V1OA 3HOYH 3NP8A 4RWSC 1I4QA 2C5CA 1FR3A 2UXDL 4LAAA 5GAEC 1JMCA 1MHWC 2YV5A 2JA6B 2VQFQ 1K8MA 1QZHA 1UEAB 3D4WA 1NAPA 4M1UB 3CCEA 2DUDA 4A3IH 2G5DA 3HKSA 2Y0SB 2WB1G 3H91A 3DLLA 3RZDH 2FINB 2V4DA 5M5WH 1FJGL 5EKKA 4IN3A 4WFN3 4KN4C 4UP9A 1TWGH 4A3EH 2ZXRA 5C4ZA 1PH2A 1XPOA 2EY5A 3TP7A 1X55A 2SNSA 5EPKA 3K5MA 3CMAA 3O13A 1Q1BA 3GTJB 1HA6A 3OSOA 2OT2A 3E0EA 4UPAA 4H7BA 5E1FA 5CV4A 1YEZA 2EXZA 4RH6A 5C4JB 1YI2A 1RJTA 3R3OA 3WDNA 5FLMH 4TKOB 4WJ3M 3F1ZA 1I50H 2XRSD 2F0WA 4J8QA 1L1OA 4LF4Q 4K0KQ 3S1QH 3MXNB 2EYFA 3NE5B 4GKKQ 5D14A 1HUMA 1UE6A 1JJ2A 4HN7A 1Q46A 1QNKA 2JA7B 1WOCA 3PIO3 2RQXA 2X6LA 1I94Q 2B29A 2GA4B 3H6MA 2OTJA 1AZPA 5IGEA 1EY9A 3RZOH 4IFDJ 2UU9Q 1VDZA 1E3PA 4POGA 1H9RA 4IURA 4A93G 1IW7D 3U4VA 1MGSA 2AHOB 1FGBD 3HOVH 4A3GG 1KD1C 1KLGD 3KF6A 1TS4A 3NTIA 3PQIA 1XNRL 4KHVA 3L3OC 4FF2A 1PH8A 3D4RA 3GTLH 2X69A 4JI4L 4BA2I 4A4IA 4ZAIA 3DWPA 1TIID 1MBYA 2VQFL 5FO9B 2E2JH 4OX9Q 1D5MC 3JC66 3CCSA 1W2BA 5ISRA 4DNRB 4FF4A 4B08A 4DV6L 1Y1WG 1HZAA 5K36G 1W6KA 4E6IA 2PCFB 1SE2A 1U4RA 2JEBI 1TWFH 2VY3A 2YU9B 4DR1L 3IL8A 4K6DA 1HH2P 2ZJQA 3HOXG 2F0TA 4OONA 3S16H 2UUAL 3I73A 2B2YC 5EJWA 2K01A 3TREA 3MC0B 1V1QA 2V1CC 1CZWA 1MSGA 3I3CA 4IJLA 4JI6Q 1M1KC 4CDDC 4JBKA 4NP5A 1SSOA 4LUOA 4HSPA 4IUUA 3A55A 1Y8PB 2PZWA 4KD3A 3A8IE 3PUWA 2G9HD 2AMCB 2KHJA 4IPGA 2QDBA 1F9PA 1BVSA 1PTOF 2LKVA 4ULLA 4A3MB 3NTHA 1BF4A 4ODGA 3TP8A 1X65A 1U5KA 3H0GH 4OO1H 1IL2A 4GKKL 2OQ0A 3ZYYX 1LABA 5E4XA 1HNXQ 3FDTA 4MN3A 1KNAA 4C2MH 2B8FA 3AEVA 1JOKA 1F9SA 1N9WA 2RHQB 1VQ7A 4NXML 5IGDA 4CDFC 4NPSA 4ALPA 3HOUB 3M4PA 1VMPA 4A3JG 4IOAA 1VQOA 4BBRG 3S1NH 5M3FB 1IKLA 5M3MH 1EEID 3BS1A 1OXUA 2CW0C 2K7VA 2C35B 4QIWE 4YWKA 1D5ZC 1LUZA 1YZ6A 1QWYA 2E2HB 4DGZA 3MXGA 1PRTB 1N34L 1SEBD 4X3UA 5I4DA 1LLRD 4H13C 4DUYQ 3S17H 3SE0A 2PQEA 3PO2H 5HGTA 3T1YQ 3I4MB 2F0JA 5I9PA 1VQPA 4B3SQ 5JJZA 2H1EA 4OX9L 1WTOA 2BE5C 3AYHB 2N49A 1LT6D 4Q0FA 1PTOC 4UY8C 5CMDA 2WIIB 3OMGA 2LY7A 3U9SA 4IUQA 1Z6HA 4U673 4LF7Q 4UHVA 2D0PA 1G91A 3FEWX 4X3TA 4B3TL 4OIJA 1CI3M 3NWSA 3QWNA 1L1OC 2WKCA 1NR4A 4C3IB 4G57A 3WOEA 5C0XJ 1PH9A 2VUMG 3HOWH 2ZTCA 1DXMA 1K0SA 3NBHB 4RGTA 4HTHA 4IQZA 4OWWB 1XPUA 4HJ7A 1UNSA 3S9WA 3G7LA 1CQVA 3KJPA 4A75A 4GKJQ 4X64L 4A3BB 3KBXA 5C4XH 4A3KB 2AQ2B 3S14B 1S72A 1S5CD 1SMYD 1E22A 1LTAD 2CQOA 4PNYA 1HNXL 1LTRD 2UXBL 1XTDA 3MWYW 3VYRA 2F03A 5C44H 4C56C 1ONLA 2B2UA 2IX0A 4UP7A 2K1BA 3J7AV 4JW0A 3C1EA 3KJOA 4DKAC 3V2TA 4O1NA 5A35A 4O2DA 2OTLA 5LL6X 5AFWA 2R93H 2L1BA 5DNFA 4JI5Q 1T5EA 2Z6KA 3J81L 1SYEA 1VCIA 1EY7A 3P7JA 3GV6A 3GTQH 1IYUA 2K5VA 2UUCQ 3F2BA 2HUGA 3CKIB 2B2WA 2OXPA 3T1YL 1PYWD 1F9QA 4A3LH 1PTOH 2K52A 4CKBA 1YJ9A 1TS5A 1A62A 1Y1VH 1H9SB 2F3VA 3C1FA 4KKSA 4OHJA 2E2IB 1QVFA 1CFMA 2TMPA 2UUBQ 3DM3A 4IPDA 1X3FA 4LF7L 2FJ2A 3D3RA 2EZVA 3T1HQ 1VQIA 4DAYA 3ERSX 1ASZA 4JYAL 3NTKA 4I65A 2ICEC 2Y0SG 4HAEA 1K8GA 4HCSA 4BBSB 4JI7L 4BA1I 3P75A 2DGYA 4GN4B 1IBKL 2JP1A 1TVXA 2YTVA 3G6JB 4DUZL 4GKJL 2YYZA 3U50C 3E0JA 1VQLA 1SJED 3HFZB 3M4OB 2IX3A 1A2TA 3CP0A 1CTMA 1H9JA 1A0IA 2L4NA 2D62A 4P71A 3S15H 3PSIA 1BKBA 3HOYB 3TQYA 3SDZA 4DK6C 2KECA 1HZBA 4JVZA 1I4HA 1NSNS 3J7AF 1K8OA 1VQCA 3STBD 1NY4A 3CCMA 2EDGA 1D5XC 1TU2B 2L0CA 3H15A 1D1KA 3Q24A 3KLSA 1WTHA 3ERQA 1A6XA 1O7ZA 2BDNA 2QCPX 2RSOA 4GNXB 3RZDB 2B3GA 5M5WB 4EX5A 5HY6A 4FYDA 1MJCA 1O7IA 2I07B 3GD7A 1TWGB 4A3EB 1SYFA 2A73B 2A69C 3EN2A 3E9IA 2Q8TA 2NN6G 5C5MA 3SK5A 2WAQB 3TN2A 1Q86C 4QCLA 2A6HC 1B2TA 1PHJA 3K7AH 3S2DH 1W3SA 4PMWA 3NENA 5IYBH 3NWTA 2IHEA 1EY5A 2MQHA 1S5FD 3ULLA 2C9OA 1RDPD 1EWIA 3KF8A 5KGUA 4P73A 4X65L 1I50B 3GO5A 1AE2A 2R3ZA 2KEEA 3OW7A 5LHY1 3FP9A 5AJ3Q 1PMRA 2B63G 3S1QB 3NUCA 5BN3A 4RKBA 2XIWA 2ZJRA 2JYOA 2PNRC 3BVMA 1VQNA 1CHPD 5ELNA 3T1HL 5EBCA 2JA8B 3HKZE 1ZEQX 2E8GA 1Q1EA 3NPPA 1SYGA 4DK0A 1HFGA 2F0HA 1B4OA 3NXWA 1O78A 3TP6A 1N32L 3C46A 2RVLA 3P20A 5COYA 4RGMA 2A6EC 2BH8A 3K59A 4ILWA 2R7ZH 5CGKA 3RZOB 1C7YA 3T4AC 4C1NI 2DY7A 5IOCA 2B2UC 3BYTB 3GTOH 5F2DA 3HOVB 1PH1A 1M4VA 1Y8OB 4K5VA 1BBUA 1SN8A 2PYKA 4X3KA 1SE8A 4J15A 4RA8A 1NTGA 2F0QA 4CJ0B 1T9HA 4GS3A 2WP8J 5IT9E 3GTLB 5FJ8H 3CC7A 2HCCA 5JAVA 1PH5A 4EQNA 3HKZG 1B1ZA 1KLUD 3MXUA 4BY7H 1NBWA 2F4IA 4DK1A 2VW9A 1KAWA 2MGSA 2E2JB 3CF5A 1GHJA 2XSCA 2Z6KC 3Q0AA 1PDQA 3KLWA 2CWPA 1BBXC 1QJOA 4Z9CB 2BA0A 2B2WC 1WD0A 4FP5D 4JI1Q 1K8AC 2EYPA 1TWFB 3KLRA 4AQYQ 2Q2HA 4JI0Q 2G9DA 4DR2L 1HTLD 1OXSC 4TQUS 2E76C 3I4NH 1B44D 3S16B 4X62Q 3KDFA 5JJLA 1FGUA 2F0EA 4KHPQ 1HNWQ 1ESFA 2ES2A 3AFPA 3BDLA 1D6EC 1LTGD 3FKIH 1B3QA 3R2IA 4DV2Q 4JI2Q 2O5IC 2K28A 2SOBA 5CV6A 1RTOA 2XWBB 1IW7C 3BJUA 3H0GB 4RCNA 2WKDA 4WRDA 1I6VC 1SR3A 3A7AB 2FMCA 1TWCH 1XX8A 1KNEA 1OXTA 1VF5C 2F1MA 3EVQA 3NSWA 4IALA 1WCMG 3A5ZB 5LMNQ 1B53A 3TRZA 4TVAB 1I4RA 4DV7L 1JORA 2KCTA 1G2SA 1NE3A 4ABNA 4ZKBB 4DV5Q 3CPWA 2YTXA 2B2YA 4IPHA 2B8GA 3S1NB 1VMCA 3D8GA 2ENBA 2EJGC 4DK3C 2ZJPA 1HXYD 2VZAA 4DV0Q 1E2ZA 4I7AA 1A63A 4C3IG 1HCZA 3HRZC 3N6RA 2KUMA 1FNUA 3K8AA 1PYSB 3K5OA 3OOCA 4ME5A 4DR5Q 1GUOA 1QUQB 1HNZQ 1IXRA 5A2QL 2I5LX 2OQKA 4DAPA 1LV9A 1NJIC 3S17B 2WB1E 4LF5L 1JR0D 3DEPA 1AEXA 4A3BG 3PO2B 3I90A 4DA2A 1QVGA 3CCJA 2PQAB 4A3KG 3MFGA 2Q2UA 1CZGA 4BY1G 1X3GA 3RN2A 3QOJA 4HMIA 1ENCA 1HQRD 3TS0A 2IPKD 1I6HH 1EYGA 1DCZA 1UE5A 4B9WA 1F2YA 4JI0L 2EY6A 4HJ8A 4G7OC 4X62L 4TSSA 3QIAA 5C3EG 1LT4D 2Q2TA 4KHPL 4IO9A 3RNUA 1QB5D 1HNWL 1XMOL 1LTID 3K7UC 4QF4A 1PA6A 3HOWB 2A8VA 1CKNB 2RSNA 1STAA 2F0OA 4A93H 4MTKA 1S40A 4H0LC 1SYCA 2XTIA 3H94A 1LTBD 4IJHA 3K81C 4QMGA 4A3GH 2NVXH 2K75A 3KBGA 2NVYH 5C4XB 1UEBA 2EYLA 4C3JG 3RLFA 1SYDA 1VQGA 5EKIA 1IZ6A 4LFBL 3FRPB 4DV3L 1HHVA 4LFAQ 1YNNC 2LSSA 4QQBX 5C44B 4HIKA 4FNFA 2M2LA 5JPMC 3CRLC 3OWFA 3LWEA 4GOPA 1AZQA 4DV5L 4LUZA 3M4QA 1UAPA 1Y1WH 2ATWA 5K36H 4IOCA 2CKZB 2EYHA 4LFCL 1R9TH 1EFWA 1YNJC 1JWSD 5C3XA 5IYDG 3J7A5 4CGYB 2E5LL 3G6EA 1B3AA 4BXXG 3RR5A 5GADC 5GROA 1SE4A 5BR8Q 3HOXH 2QA4A 1IBLL 4QUFA 2IL8A 1FD7D 3KYHC 1QE6A 4KI0A 5EAYA 4DR5L 4OEMB 3A8KE 2PI2A 4FXKC 3V05A 3GTQB 3TP5A 4JI3Q 3ULJA 1LT3D 2F3IA 2A68C 2MUYA 1O80A 2NN6I 4CDEC 3HOZB 1O7YA 3OIQA 4A3CG 1BCPD 2F4VL 5D3IB 3VDYA 2R6GA 4EQOA 2DNEA 1Y1VB 5CC4A 4AYBG 3HP3A 2F0NA 1SNQA 1IBMQ 2PNHA 1RODA 1TY0A 1PLFA 5J22A 1A3TA 1CSPA 2M9VA 1DOKA 3R93A 1QCBD 1S4ZA 1BDOA 2X6GA 4CBVA 4A3JH 1QOHA 3GDEA 4BBRH 4YHHQ 3D0FA 2ZM6Q 2XVSA 1VQDA 4A3EG 2FFKB 3M7NA 4V190 4KV6A 3GQBA 4DFAA 2CFMA 5E4WC 4NW2A 3JAML 4GLVB 1ENAA 3CAMA 2EVBA 3OYYA 3RMHA 3PO3H 3M4YA 3PUVA 4LNQA 4LFAL 5ELEA 2H5XA 3NQTA 3K0YA 5C0XG 1V9PA 2FXQA 3PCOB 1A3UA 2I5HA 5I6WA 1C8CA 3KK7A 2JJQA 1J6QA 1TS3A 4H44C 2AWOA 1SNPA 5J3BA 3S24A 5KNBA 5JEAG 1WTXA 2JA8G 4LF4L 4YCUA 2ICIA 5DM73 4FF1A 4K0KL 5IGCA 2KOLA 1JJGA 4K8JA 2EYOA 3HEJA 5BR8L 4QUCA 3G4SA 1WJJA 3J81c 1JC7A 2NZ1D 1HUNA 4H02A 2KCCA 4MNOA 2VUMH 2QF7A 1SFOH 3VA5A 1PH3A 2VB3X 2K04A 2J0TD 2Z1CA 3K7AB 4JI3L 1I94L 3S2DB 5IE8A 1N8RC 1YHBA 4KKTA 4L5SA 1U4LA 2EE1A 2OEOA 1I5FA 2UU9L 1ZYRC 3MEHA 2D2CC 2AQ1B 2KCMA 3CXCA 3D31A 5EGTA 1K0RA 1TWHH 4YCWA 1L0WA 1RCVD 4B3RQ 5CBEE 2HQEA 4G4KA 3F2UA 2B2VC 4DAMA 1B7YB 2AUKA 2EYMA 5DM63 1EIHA 2BH2A 1STNA 1A2UA 1Q8IA 5I6YA 3U4ZA 4EVOA 1FL0A 5CORA 3KLSX 3AMUA 5FKAC 1PFMA 2HCIA 5D3DA 4G7HC 1KRSA 4YHHL 1FYCA 1DM0B 3VR4A 5JVH3 5ELFA 1BQQT 1VQHA 4B3MQ 4DR4Q 3ND9A 2R7ZB 3L9AX 4XQNA 4JBMA 5IIFA 1KDCA 3NBHA 2CQAA 3KUPA 4GOPC 4X6AH 3GTOB 3EIVA 2WV6D 3CCQA 5T1GA 3SEBA 1PFNA 4JI6L 4X66Q 4LF9Q 5M9OA 1AP0A 4RHRA 5G3LF 1QNUA 4BY7B 3A5UA 1X3EA 1NCVA 1AW7A 4IUVA 3S1MH 2JEAI 2EYJA 2XWJB 2IJ0A 3DWQA 2R7DA 5CV5A 1JE5A 1YVCA 3PV0A 4KY7A 3ER0A 1GUTA 2MO0A 3PIOA 3I4NB 1S3OA 4NB3A 3L7ZC 1TWAH 2ZXPA 4R4TA 5C4HA 2KENA 2K5WA 4XYOA 1U4PA 1K83H 3RUZA 4FF3A 3EA6A 2HT1A 3MVVA 1L0XB 4KY6A 4RGNA 2Z4HA 4APVA 2JXMB 3MXPA 3AU7A 3CMEA 3K6OA 1XWEA 5I2XA 1PXUA 1MIUA 3FKIB 4L5QA 3M3YH 5NUCA 4GN3B 1S5ED 2I46A 4KLKA 5K5PA 1ZKOA 3BYYB 4A3DG 3SXHA 4FVMA 3QR8A 2KCNA 1A8VA 1G6PA 1HJPA 1PFSA 2CVRA 3LWUA 1PRTF 3A74A 5JOBA 4B3RL 2RCNA 2Y0SE 5IT9c 3X3NA 1MSHA 1H9SA 5DEHA 4QL5A 1TWCB 3PUYA 1O7LA 3DMUA 4CKCA 1TY2A 4DUYL 3FMCA 1SROA 4YY3Q 2NZOA 4DXFA 1AN8A 2R92G 4UDUC 3WWVA 3I4LA 4LF6Q 4B3SL 4K14A 2WB1B 4EGVA 4A3FG 1V1PA 1STYA 1SNCA 4GLAC 2WFWA 4B3ML 4DR4L 1TT2A 2GN5A 1F77A 1ILQA 5M5XH 1Y69U 2O5JC 2NTTA 4O0AA 3WOFA 1A3VA 2Z4IA 1OXVA 3UI2A 2NN6H 1AFPA 4ME3A 2VQEQ 2JA6G 2RA4A 4F8MA 2F0KA 4EQPA 3PF5A 4YWMA 3J81E 1I3QH 4X66L 1JCKB 2N88A 2N78A 5M5YB 2OWOA 3NEMA 3TMEA 4QB4A 4PV1C 3A0JA 1EY4A 1JB7A 4C3HH 1EIYB 1JWUD 1TXYA 5IP9G 5IODA 3UDXA 3MFYA 5IWAQ 4R4QA 4DN4M 2B63H 3AFQA 1I6HB 1PRTC 3PIP3 1JQYD 2KHSA 4GZYC 2OCEA 2RDFA 1BCPB 3CCUA 2RBMA 4DU9A 3K5LA 4GNXA 2MP1A 2CWAA 2JA5H 4IUPA 3KOJA 1S5DD 4KD4A 4KKUA 2ASBA 4R4IA 3TZUA 4I7ZC 3UDFA 3GTGH 3SR1A 2PI2E 1R4PB 4A3IB 1BO0A 2MNAA 3W3AA 4K8IA 3BU2A 2RF4A 1PH7A 3W5OA 4A93B 4XT3B 3BZKA 4A3GB 2NVXB 2JA7G 1IYVA 2K32A 1EQQA 2NVYB 4K5WA 1UE7A 2K5NA 3A8JE 3F2CA 4JI5L 3J81i 2RDHA 1EOVA 1KL9A 4JC0A 2BE5D 4WORA 1YHQA 3HOZG 1PTOD 2QKIC 3CPFA 3J80L 2UUCL 2F0GA 2HD3A 1YNXA 3I70A 2LXJA 3VYTA 2NUCA 4K6LA 2Q8RE 4Q5VA 1Y1VG 5KRUA 1G2TA 1TKWB 1Y1WB 2PZTA 5C0XI 4HCEA 2UXCQ 4RMFA 3MTSA 1R9TB 1GXDC 1W6JA 2UUBL 3HOXB 3VYUA 1SBBB 2IHFA 2VQEL 1YJWA 1LTTD 4DV4Q 3Q23A 3CQZH 3IFDA 2KVMA 1LYLA 3OTOQ 3C2PA 4N9TA 5IYCG 1C48A 1QILA 1GD7A 5IWAL 3M7GA 1VS0A 1DOLA 1HQMC 1X9NA 4L63B 3E5SA 1WVLA 4NXNQ 2XGTA 5KIXA 4Y7NH 1BUVT 3H3VI 1WCMH 5FOBB 4MIUA 4POFA 5C3WA 1SLJA 4OGQC 4DR6Q 1DGSA 2JE6I 1MI2A 5HURA 4JV5Q 4JOIA 2DJFC 1V8QA 4A3MG 4A3JB 2D0OA 1EZ6A 1XMQQ 1XTCD 4BBRB 1N36Q 2PW7A 2H4OA 2KHIA 3G48A 5EQ0A 4LMQD 1Q90A 2L5TA 3IAYA 3DM1A 5JJKA 5ELOA 4DR7Q 2M00A 4M8AA 1TQOA 2NVTH 4RGOS 3K57A 4ZUJA 3HOUG 1CSQA 1PVOA 3BDCA 4PMCA 3PO3B 4BS9A 5IYBG 5D65A 1G6ZA 4BWGB 2PMZE 5M3FG 5EKLA 2BOSA 2PPBC 2PO4A 4FO2A 1MJEA 1M8AA 3PGZA 1X32A 4O42A 4BY1H 2NTSA 3CW2C 5E3FA 1GO3E 3K80C 2F0DA 3EQLC 4IUNA 4LF8Q 1GKHA 1P16A 2VS1A 3W2DA 1EIFA 2F0SA 4JI8Q 1GUGA 4ID6A 5KEEA 3MAQA 2UXDQ 1XJVA 1ET6A 1YHAA 5AJ3L 2QW7A 1CKOA 4JPBW 4QIWB 5IP7G 1B9NA 5EPLA 3I4MG 4C2MB 5C3EH 5LMNW 1Q12A 4F7XA 3EJIA 2NYZD 2K5QA 3SHLA 2VUMB 2K6AA 1FJGQ 1SFOB 4JK1C 4GNXC 2E2DC 1JT8A 3OIPA 4HSVA 3OTOL 3KDFB
chains in the Genus database with same CATH topology
1IBMQ 2PNHA 4A3MH 4YY3L 1CSPA 5C0XJ 3I55A 1PH9A 2VUMG 3HOWH 2ALYB 2PQAA 2ZTCA 4C3JH 4LF6L 3NBHB 1E7ZA 2I0QA 4OWWB 1XPUA 4HJ7A 3TS2A 4A75A 3KJPA 1CUKA 4DR2Q 4GKJQ 4X64L 4A3JH 5C4XH 5FLXc 1Z9FA 5FJ8G 3GDEA 3UE0A 4BBRH 4YHHQ 3D0FA 1S72A 2VL6A 2ZM6Q 3KFUA 4HIMA 1KXLA 3UDGA 4AIMA 1E22A 1VQDA 1GM5A 4A3EG 1XNQL 3HOUH 2CQOA 3M7NA 1HNXL 4JV5L 4DNIA 1XTDA 2UXBL 2KBNA 2CFMA 3GTMH 5M3FH 1U0LA 5C44H 4IFDG 4GLVB 4QJFA 5IYDH 3CAMA 1E1OA 1OXXK 1YBYA 4FDBA 2ID0A 1K73C 3OYYA 2IX0A 4UP7A 1PH4A 4BXXH 3I7FA 1LTLA 3PO3H 2Q2IA 1Y14B 3PUVA 4OXPA 1RIPA 4LNQA 4DPGA 1UWVA 1VQ5A 2E2HH 4LFAL 4JI1L 5H1SE 3JAMc 2H5XA 2K5HA 3KJOA 4DKAC 1C9OA 4PZ8A 4AQYL 5C0XG 4PZ6A 1V9PA 2FXQA 1XPRA 1VQEA 3PCOB 3I4OA 3G71A 2I5HA 4O2DA 2OTLA 3CCLA 5IP7H 1KHIA 3CCVA 2JJQA 3W1BA 2AKWB 3KF8B 1J6QA 1NMGA 4DV7Q 4GLXA 2JA5G 2AWOA 4YCVA 4JI5Q 3I4MH 5J3BA 3S24A 5JEAG 2Z6KA 4A3CH 5JJIA 4KHZA 2JA8G 4LF4L 1VCIA 2IY5B 4YCUA 4K0KL 1JJGA 3GTQH 2K5VA 2UUCQ 3I56A 2HHHQ 5BR8L 1YIJA 3F2BA 4DV2L 4JI2L 3G4SA 1X56A 1WJJA 3ZJYC 3CCRA 4P72A 3J81c 2RHSB 1QVCA 3I2ZA 2MFIA 4JI8L 3T1YL 3K0XA 2F52A 4A3LH 4H02A 1M90C 1GVPA 2YTYA 2K52A 4JI4Q 4MNOA 2VUMH 1PH3A 2HIXA 3UDIA 1SFOH 1UE1A 4JI3L 1I94L 1YJ9A 5IE8A 1A62A 1N8RC 1Y1VH 1YHBA 1WI5A 1VQAA 1QVFA 5LMNL 4L5SA 4C3IH 2UUBQ 3DM3A 4IPDA 1I5FA 1X3FA 2UU9L 4LF7L 4DV6Q 3F8TA 3RLNA 4LF5Q 2JQOA 4OWTB 3T1HQ 1SMXA 4R1JA 2KCMA 3CXCA 1VQIA 3D31A 3BZCA 1L2FA 4A76A 3UE1A 1YJNA 1PYBA 3ERSX 1K0RA 1TWHH 4YCWA 1L0WA 4DR1Q 1ASZA 4JYAL 4HIDA 3J80i 4A3BH 1K8GA 2Y0SG 2ZTEA 4JI7L 4B3RQ 4BA1I 4AYBE 4A3KH 3S14H 2A1AA 2DGYA 4QGUA 2UUAQ 4GN4B 4DAMA 2K14A 1B7YB 3PUZA 1IBKL 4DV0L 4JOIC 2BH2A 4WJ4A 4HIOA 1EQRA 1PH6A 2YTVA 4JBJA 4DUZL 3U4ZA 4DR3Q 4BBSG 1FL0A 3U58A 4GKJL 2YYZA 3U50C 2UXCL 1VQLA 3HFZB 1KRSA 4YHHL 1P8LA 1HNZL 2A19A 3CP0A 1Q8KA 4OO1I 2QGQA 1VQHA 4B3MQ 4DR4Q 1A0IA 1HZCA 2D62A 4P71A 4JBMA 1XMOQ 3PSIA 1BKBA 1ASYA 3TQYA 3S15H 4DK6C 1HZBA 4DV4L 4GOPC 4X6AH 2WAQE 1VQCA 1IYJB 3EIVA 1NY4A 3STBD 2JA8H 1G291 3CCMA 4GN5A 2R7ZG 1HZ9A 3CCQA 3H15A 1QUQA 3HOYG 4GOPB 3AQQA 2R93H 4NXMQ 4JI6L 4X66Q 4LF9Q 4LFBQ 4GNXB 4DV3Q 3PIPA 2B3GA 1SRUA 4HJ9A 4EX5A 5HY6A 1L1OB 3A5UA 1MJCA 3CC4A 4JCVE 1O7IA 3GD7A 1X3EA 4A3IG 1N33Q 4RG1A 1OTCA 3S1MH 3EN2A 4NXNL 1VQ4A 2JEAI 1B70B 3E9IA 2NN6G 2R7FA 3M85A 1Z47A 1VQJA 1VQMA 1Q86C 4BY7G 2R7DA 1JE5A 2L15A 5GQOA 3H3VH 4DR6L 1PHJA 3K7AH 1YVCA 3PV0A 2NVQH 2HHHL 3GTKH 1W3SA 4LFCQ 3S2DH 3ER0A 1WYDA 4PMWA 3GTPH 2LXKA 2MO0A 3NENA 2E2IH 5IYBH 3PIOA 1N34Q 2E5LQ 1S3OA 2EXDA 2IHEA 3L7ZC 4NB3A 1KIXA 2WAQG 1TWAH 2I5MX 2BA1A 2MQHA 1XMQL 1N36L 4R4TA 3ULLA 2KENA 2K4KA 1IBLQ 1K83H 1EWIA 3ULPA 2HT1A 4P73A 1XNRQ 1KRTA 4X65L 3GO5A 4APVA 1AE2A 1CKNA 2JK8A 3I4NG 2HIVA 3CMEA 4BBSH 3FP9A 5AJ3Q 2B63G 1D7QA 4DR7L 1MIUA 1VQ9A 2ZJRA 4L5QA 4LWCA 3M3YH 5M5YH 3KF6B 3M9BA 4GN3B 1VQNA 5ELNA 4KLKA 1JJCB 3RLOA 5FLMG 3T1HL 1Q81C 3HKZE 4A3DG 2E8GA 1Q1EA 1A8VA 2AWNA 3S1RH 1G6PA 2F4VQ 1HJPA 1PFSA 4YWLA 3A74A 4B3RL 2RCNA 2Y0SE 3FKIG 4MTNA 5IT9c 3F2DA 1VQKA 4B3TQ 1N32L 4QL5A 1G51A 3M4OH 4P74A 3PUYA 2BH8A 4DUYL 2JA9A 2R7ZH 1SROA 4YY3Q 4DR3L 1C7YA 4LF8L 2NZOA 5LMUQ 3HOYH 1KC8C 2R92G 3WWVA 3Q8DA 4LF6Q 4B3SL 2UXDL 3GTOH 5GAEC 4A3FG 1JMCA 1PH1A 4GLAC 4X64Q 2WFWA 2YV5A 2VQFQ 4B3ML 4DR4L 1SN8A 1BBUA 2GN5A 5HGQA 1QZHA 5M5XH 3CCEA 4A3IH 1SE8A 4J15A 2DUDA 1NTGA 3NELA 3HKSA 4O0AA 3PF4A 1T9HA 4GS3A 2WB1G 2WP8J 3DLLA 1OXVA 3RZDH 5FJ8H 3CC7A 1PH5A 3HOVG 5M5WH 3HKZG 4ME3A 1FJGL 2VQEQ 2JA6G 4BY7H 1NBWA 2UXBQ 3TEHB 2VW9A 1KAWA 4UP9A 1TWGH 3CF5A 4A3EH 2Z6KC 4XTCS 3PF5A 1PH2A 3KLWA 4YWMA 1XPOA 1I3QH 2CWPA 4X66L 1PV4A 1IBML 1X55A 2N78A 2OWOA 2BA0A 3NEMA 3A0JA 1NMFA 4JI1Q 1E1TA 1K8AC 1WFQA 4C3HH 3CMAA 1Q1BA 1TXYA 4AQYQ 1EUJA 2Q2HA 1JB7A 5IP9G 1MKHA 4DR2L 4JI0Q 1N33L 3UDXA 1OXSC 4TQUS 5IWAQ 3CD6A 3I4NH 3E0EA 4R4QA 4HJ5A 4UPAA 2B63H 3STBC 1X6OA 3AFQA 4X62Q 1YEZA 3KDFA 2ZM6L 1YI2A 1HR0W 2OCEA 1HR0Q 5JJLA 1FGUA 3CCUA 4PZ7A 5FLMH 4GNXA 4A3DH 4Y52H 4KHPQ 3F1ZA 1I50H 4WJ3M 1H95A 1HNWQ 1L1OA 2ES2A 3AFPA 3LGJA 4LF4Q 2CWAA 4K0KQ 3S1QH 3MXNB 2JA5H 4GKKQ 1J5EQ 3KOJA 3JAMi 3FKIH 4R4CA 3PO3G 3S2HH 4DV2Q 4JI2Q 2ASBA 4R4IA 1UE6A 1JJ2A 1BBWA 4POGA 3UDFA 2MO1A 3GTGH 2PI2E 1Q46A 1D8LA 1WOCA 1FVIA 4XIGS 4AH6A 3BJUA 2MNAA 3BU2A 2RF4A 3L2PA 1PH7A 2R92H 1SR3A 3W5OA 1I94Q 2B29A 1TWCH 1OXTA 4A3FH 3BZKA 2OTJA 1WCMG 3A5ZB 5LMNQ 1B8AA 2JA7G 1EQQA 2IT1A 3RZOH 1EIYB 2UU9Q 4IFDJ 4OO1G 1UE7A 2K5NA 3H0GG 3TRZA 4TVAB 4DV7L 1E3PA 3W1GA 3E9HA 2QEXA 1CKMA 4JI5L 2KCTA 3J81i 1EOVA 1KL9A 4JC0A 3F2CA 1NE3A 3U4VA 4A93G 4DV5Q 1YHQA 4JYAQ 2AHOB 3HOVH 3HOZG 3J81j 4A3GG 3CPFA 3CPWA 1KD1C 4IFDI 2YTXA 2JA6H 2UUCL 4JI7Q 4IPHA 3KF6A 1YNXA 2EQSA 1LM0A 2Z0SA 4DK3C 5LMUL 1XNRL 2LXJA 2ZJPA 1IBKQ 1PH8A 2VZAA 4DV0Q 2EIFA 3GTLH 4DUZQ 1Y1VG 4JI4L 3RN5A 3J80c 4BA2I 4A4IA 1A63A 1X54A 5C0XI 2UXCQ 2VQFL 4LUVA 4RMFA 5JEAJ 1VQFA 3PUXA 5M3MG 3K8AA 1PYSB 5E7NA 2E2JH 4OX9Q 4P75A 4DR5Q 3JC66 3CCSA 1W2BA 1QUQB 5IP9H 4HJAA 1IXRA 1VQBA 1HNZQ 2UUBL 2I5LX 2OQKA 1V43A 5DLQE 4LW1A 1NJIC 4DV6L 2WB1E 4LF5L 1Y1WG 1HZAA 4A3BG 2IHFA 5K36G 2VQEL 1YJWA 1QVGA 3CCJA 2PQAB 4EQ5A 2JEBI 4DV1Q 4A3KG 4DV4Q 2VY3A 1TWFH 3GTJH 2Q2UA 4DR1L 1VQ6A 2NZHA 4BY1G 1X3GA 3RN2A 1HH2P 3CQZH 3TS0A 2ZJQA 3HOXG 4OONA 3S16H 1AH9A 2UUAL 1E24A 5IY0A 1C0AA 3PO2G 1LYLA 5C4JH 1I6HH 3TREA 1EYGA 3OTOQ 1V1QA 2V1CC 4IJLA 4JI6Q 2GVAA 1UE5A 1KQSA 1M1KC 5IYCG 4JBKA 4JI0L 1GD7A 5IWAL 4HJ8A 4LUOA 1VS0A 1X9NA 3SGIA 4X62L 4QY7A 4OWXB 5C3EG 3PUWA 3ICEA 1HR0L 2AMCB 4NXNQ 2XGTA 4Y7NH 2KHJA 2Q2TA 3H3VI 1WCMH 4IPGA 4IO9A 3RNUA 4POFA 4KHPL 1BVSA 2JA7H 1HNWL 1XMOL 3K7UC 1SLJA 1X65A 1PA6A 1U5KA 1CKNB 3H0GH 1Q82C 2A8VA 4DR6Q 3FHWA 1DGSA 1IL2A 2JE6I 4GKKL 1J5EL 1XNQQ 4A93H 2OQ0A 2ZTDA 1S40A 2XTIA 1HNXQ 4JOIA 4JV5Q 4IJHA 3K81C 4C2MH 3HOZH 2NVXH 4A3GH 2K75A 4A3MG 3AEVA 2NVYH 2D0OA 1UEBA 1XMQQ 2N3SA 1VQ7A 1N9WA 2RHQB 1N36Q 3HOWG 4L5RC 4NXML 3RLFA 4PG3A 4LF9L 1VQGA 2KHIA 1IZ6A 4X65Q 4LFBL 3G48A 4NPSA 2HQLA 4DV3L 4ALPA 4MZ9A 3J7ZC 1K3RA 3L0OA 3M4PA 3IRBA 4LFAQ 4A3JG 5C4XG 4IOAA 1VQOA 5JJKA 4BBRG 5ELOA 3S1NH 4DR7Q 2LSSA 4QQBX 5M3MH 4HIKA 5GAGC 1RL2A 1YITA 2NVTH 3OW2A 1OXUA 4GOPA 2C35B 3HOUG 1CSQA 1AE3A 4QIWE 4DV5L 4LUZA 1PVOA 4YWKA 1YZ6A 1LUZA 3M4QA 5IYBG 1Y1WH 2ATWA 2PMZE 4IOCA 5M3FG 3EBEA 1Q7YC 5C44G 2CKZB 3B6YA 4LFCL 1R9TH 1EFWA 1N32Q 2VNUD 2N8NA 5IYDG 1MJEA 3J7A5 1N34L 4JG2A 2E5LL 3PGZA 3G6EA 4BY1H 3CW2C 4BXXG 5GAHC 1GO3E 3K80C 3RR5A 5GADC 5GROA 3HOXH 5BR8Q 4DUYQ 2QA4A 1IBLL 3S17H 3PO2H 4LF8Q 2VS1A 1GKHA 1P16A 4UP8A 4IPCA 1EIFA 3T1YQ 4JBWA 4JI8Q 3CC2A 3KYHC 1VQPA 2YU9H 4DAYB 4B3SQ 2UXDQ 4KI0A 5EAYA 5IYCH 4OX9L 4DR5L 1XJVA 3AYHB 1YHAA 5AJ3L 2N49A 2PI2A 4JI3Q 1CKOA 3ULJA 4AYBG 5IP7G 4UY8C 2F3IA 2K50A 2NN6I 3I4MG 2R93G 4L5TA 5C3EH 5LMNW 2IX1A 4DV1L 4A3CG 1Q12A 2F4VL 4LF7Q 2D0PA 3VDYA 3MEFA 2R6GA 1QZGA 1VQ8A 2CCZA 1FJGQ 4B3TL 1JT8A 4GNXC 1K9MC 4R4OA 3OTOL 1L1OC 2GVBA 4A3LG 3KDFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM Q;  2PNH A;  4A3M H;  4YY3 L;  1CSP A;  5C0X J;  3I55 A;  1PH9 A;  2VUM G;  3HOW H;  2ALY B;  2PQA A;  2ZTC A;  4C3J H;  4LF6 L;  3NBH B;  1E7Z A;  2I0Q A;  4OWW B;  1XPU A;  4HJ7 A;  3TS2 A;  4A75 A;  3KJP A;  1CUK A;  4DR2 Q;  4GKJ Q;  4X64 L;  4A3J H;  5C4X H;  5FLX c;  1Z9F A;  5FJ8 G;  3GDE A;  3UE0 A;  4BBR H;  4YHH Q;  3D0F A;  1S72 A;  2VL6 A;  2ZM6 Q;  3KFU A;  4HIM A;  1KXL A;  3UDG A;  4AIM A;  1E22 A;  1VQD A;  1GM5 A;  4A3E G;  1XNQ L;  3HOU H;  2CQO A;  3M7N A;  1HNX L;  4JV5 L;  4DNI A;  1XTD A;  2UXB L;  2KBN A;  2CFM A;  3GTM H;  5M3F H;  1U0L A;  5C44 H;  4IFD G;  4GLV B;  4QJF A;  5IYD H;  3CAM A;  1E1O A;  1OXX K;  1YBY A;  4FDB A;  2ID0 A;  1K73 C;  3OYY A;  2IX0 A;  4UP7 A;  1PH4 A;  4BXX H;  3I7F A;  1LTL A;  3PO3 H;  2Q2I A;  1Y14 B;  3PUV A;  4OXP A;  1RIP A;  4LNQ A;  4DPG A;  1UWV A;  1VQ5 A;  2E2H H;  4LFA L;  4JI1 L;  5H1S E;  3JAM c;  2H5X A;  2K5H A;  3KJO A;  4DKA C;  1C9O A;  4PZ8 A;  4AQY L;  5C0X G;  4PZ6 A;  1V9P A;  2FXQ A;  1XPR A;  1VQE A;  3PCO B;  3I4O A;  3G71 A;  2I5H A;  4O2D A;  2OTL A;  3CCL A;  5IP7 H;  1KHI A;  3CCV A;  2JJQ A;  3W1B A;  2AKW B;  3KF8 B;  1J6Q A;  1NMG A;  4DV7 Q;  4GLX A;  2JA5 G;  2AWO A;  4YCV A;  4JI5 Q;  3I4M H;  5J3B A;  3S24 A;  5JEA G;  2Z6K A;  4A3C H;  5JJI A;  4KHZ A;  2JA8 G;  4LF4 L;  1VCI A;  2IY5 B;  4YCU A;  4K0K L;  1JJG A;  3GTQ H;  2K5V A;  2UUC Q;  3I56 A;  2HHH Q;  5BR8 L;  1YIJ A;  3F2B A;  4DV2 L;  4JI2 L;  3G4S A;  1X56 A;  1WJJ A;  3ZJY C;  3CCR A;  4P72 A;  3J81 c;  2RHS B;  1QVC A;  3I2Z A;  2MFI A;  4JI8 L;  3T1Y L;  3K0X A;  2F52 A;  4A3L H;  4H02 A;  1M90 C;  1GVP A;  2YTY A;  2K52 A;  4JI4 Q;  4MNO A;  2VUM H;  1PH3 A;  2HIX A;  3UDI A;  1SFO H;  1UE1 A;  4JI3 L;  1I94 L;  1YJ9 A;  5IE8 A;  1A62 A;  1N8R C;  1Y1V H;  1YHB A;  1WI5 A;  1VQA A;  1QVF A;  5LMN L;  4L5S A;  4C3I H;  2UUB Q;  3DM3 A;  4IPD A;  1I5F A;  1X3F A;  2UU9 L;  4LF7 L;  4DV6 Q;  3F8T A;  3RLN A;  4LF5 Q;  2JQO A;  4OWT B;  3T1H Q;  1SMX A;  4R1J A;  2KCM A;  3CXC A;  1VQI A;  3D31 A;  3BZC A;  1L2F A;  4A76 A;  3UE1 A;  1YJN A;  1PYB A;  3ERS X;  1K0R A;  1TWH H;  4YCW A;  1L0W A;  4DR1 Q;  1ASZ A;  4JYA L;  4HID A;  3J80 i;  4A3B H;  1K8G A;  2Y0S G;  2ZTE A;  4JI7 L;  4B3R Q;  4BA1 I;  4AYB E;  4A3K H;  3S14 H;  2A1A A;  2DGY A;  4QGU A;  2UUA Q;  4GN4 B;  4DAM A;  2K14 A;  1B7Y B;  3PUZ A;  1IBK L;  4DV0 L;  4JOI C;  2BH2 A;  4WJ4 A;  4HIO A;  1EQR A;  1PH6 A;  2YTV A;  4JBJ A;  4DUZ L;  3U4Z A;  4DR3 Q;  4BBS G;  1FL0 A;  3U58 A;  4GKJ L;  2YYZ A;  3U50 C;  2UXC L;  1VQL A;  3HFZ B;  1KRS A;  4YHH L;  1P8L A;  1HNZ L;  2A19 A;  3CP0 A;  1Q8K A;  4OO1 I;  2QGQ A;  1VQH A;  4B3M Q;  4DR4 Q;  1A0I A;  1HZC A;  2D62 A;  4P71 A;  4JBM A;  1XMO Q;  3PSI A;  1BKB A;  1ASY A;  3TQY A;  3S15 H;  4DK6 C;  1HZB A;  4DV4 L;  4GOP C;  4X6A H;  2WAQ E;  1VQC A;  1IYJ B;  3EIV A;  1NY4 A;  3STB D;  2JA8 H;  1G29 1;  3CCM A;  4GN5 A;  2R7Z G;  1HZ9 A;  3CCQ A;  3H15 A;  1QUQ A;  3HOY G;  4GOP B;  3AQQ A;  2R93 H;  4NXM Q;  4JI6 L;  4X66 Q;  4LF9 Q;  4LFB Q;  4GNX B;  4DV3 Q;  3PIP A;  2B3G A;  1SRU A;  4HJ9 A;  4EX5 A;  5HY6 A;  1L1O B;  3A5U A;  1MJC A;  3CC4 A;  4JCV E;  1O7I A;  3GD7 A;  1X3E A;  4A3I G;  1N33 Q;  4RG1 A;  1OTC A;  3S1M H;  3EN2 A;  4NXN L;  1VQ4 A;  2JEA I;  1B70 B;  3E9I A;  2NN6 G;  2R7F A;  3M85 A;  1Z47 A;  1VQJ A;  1VQM A;  1Q86 C;  4BY7 G;  2R7D A;  1JE5 A;  2L15 A;  5GQO A;  3H3V H;  4DR6 L;  1PHJ A;  3K7A H;  1YVC A;  3PV0 A;  2NVQ H;  2HHH L;  3GTK H;  1W3S A;  4LFC Q;  3S2D H;  3ER0 A;  1WYD A;  4PMW A;  3GTP H;  2LXK A;  2MO0 A;  3NEN A;  2E2I H;  5IYB H;  3PIO A;  1N34 Q;  2E5L Q;  1S3O A;  2EXD A;  2IHE A;  3L7Z C;  4NB3 A;  1KIX A;  2WAQ G;  1TWA H;  2I5M X;  2BA1 A;  2MQH A;  1XMQ L;  1N36 L;  4R4T A;  3ULL A;  2KEN A;  2K4K A;  1IBL Q;  1K83 H;  1EWI A;  3ULP A;  2HT1 A;  4P73 A;  1XNR Q;  1KRT A;  4X65 L;  3GO5 A;  4APV A;  1AE2 A;  1CKN A;  2JK8 A;  3I4N G;  2HIV A;  3CME A;  4BBS H;  3FP9 A;  5AJ3 Q;  2B63 G;  1D7Q A;  4DR7 L;  1MIU A;  1VQ9 A;  2ZJR A;  4L5Q A;  4LWC A;  3M3Y H;  5M5Y H;  3KF6 B;  3M9B A;  4GN3 B;  1VQN A;  5ELN A;  4KLK A;  1JJC B;  3RLO A;  5FLM G;  3T1H L;  1Q81 C;  3HKZ E;  4A3D G;  2E8G A;  1Q1E A;  1A8V A;  2AWN A;  3S1R H;  1G6P A;  2F4V Q;  1HJP A;  1PFS A;  4YWL A;  3A74 A;  4B3R L;  2RCN A;  2Y0S E;  3FKI G;  4MTN A;  5IT9 c;  3F2D A;  1VQK A;  4B3T Q;  1N32 L;  4QL5 A;  1G51 A;  3M4O H;  4P74 A;  3PUY A;  2BH8 A;  4DUY L;  2JA9 A;  2R7Z H;  1SRO A;  4YY3 Q;  4DR3 L;  1C7Y A;  4LF8 L;  2NZO A;  5LMU Q;  3HOY H;  1KC8 C;  2R92 G;  3WWV A;  3Q8D A;  4LF6 Q;  4B3S L;  2UXD L;  3GTO H;  5GAE C;  4A3F G;  1JMC A;  1PH1 A;  4GLA C;  4X64 Q;  2WFW A;  2YV5 A;  2VQF Q;  4B3M L;  4DR4 L;  1SN8 A;  1BBU A;  2GN5 A;  5HGQ A;  1QZH A;  5M5X H;  3CCE A;  4A3I H;  1SE8 A;  4J15 A;  2DUD A;  1NTG A;  3NEL A;  3HKS A;  4O0A A;  3PF4 A;  1T9H A;  4GS3 A;  2WB1 G;  2WP8 J;  3DLL A;  1OXV A;  3RZD H;  5FJ8 H;  3CC7 A;  1PH5 A;  3HOV G;  5M5W H;  3HKZ G;  4ME3 A;  1FJG L;  2VQE Q;  2JA6 G;  4BY7 H;  1NBW A;  2UXB Q;  3TEH B;  2VW9 A;  1KAW A;  4UP9 A;  1TWG H;  3CF5 A;  4A3E H;  2Z6K C;  4XTC S;  3PF5 A;  1PH2 A;  3KLW A;  4YWM A;  1XPO A;  1I3Q H;  2CWP A;  4X66 L;  1PV4 A;  1IBM L;  1X55 A;  2N78 A;  2OWO A;  2BA0 A;  3NEM A;  3A0J A;  1NMF A;  4JI1 Q;  1E1T A;  1K8A C;  1WFQ A;  4C3H H;  3CMA A;  1Q1B A;  1TXY A;  4AQY Q;  1EUJ A;  2Q2H A;  1JB7 A;  5IP9 G;  1MKH A;  4DR2 L;  4JI0 Q;  1N33 L;  3UDX A;  1OXS C;  4TQU S;  5IWA Q;  3CD6 A;  3I4N H;  3E0E A;  4R4Q A;  4HJ5 A;  4UPA A;  2B63 H;  3STB C;  1X6O A;  3AFQ A;  4X62 Q;  1YEZ A;  3KDF A;  2ZM6 L;  1YI2 A;  1HR0 W;  2OCE A;  1HR0 Q;  5JJL A;  1FGU A;  3CCU A;  4PZ7 A;  5FLM H;  4GNX A;  4A3D H;  4Y52 H;  4KHP Q;  3F1Z A;  1I50 H;  4WJ3 M;  1H95 A;  1HNW Q;  1L1O A;  2ES2 A;  3AFP A;  3LGJ A;  4LF4 Q;  2CWA A;  4K0K Q;  3S1Q H;  3MXN B;  2JA5 H;  4GKK Q;  1J5E Q;  3KOJ A;  3JAM i;  3FKI H;  4R4C A;  3PO3 G;  3S2H H;  4DV2 Q;  4JI2 Q;  2ASB A;  4R4I A;  1UE6 A;  1JJ2 A;  1BBW A;  4POG A;  3UDF A;  2MO1 A;  3GTG H;  2PI2 E;  1Q46 A;  1D8L A;  1WOC A;  1FVI A;  4XIG S;  4AH6 A;  3BJU A;  2MNA A;  3BU2 A;  2RF4 A;  3L2P A;  1PH7 A;  2R92 H;  1SR3 A;  3W5O A;  1I94 Q;  2B29 A;  1TWC H;  1OXT A;  4A3F H;  3BZK A;  2OTJ A;  1WCM G;  3A5Z B;  5LMN Q;  1B8A A;  2JA7 G;  1EQQ A;  2IT1 A;  3RZO H;  1EIY B;  2UU9 Q;  4IFD J;  4OO1 G;  1UE7 A;  2K5N A;  3H0G G;  3TRZ A;  4TVA B;  4DV7 L;  1E3P A;  3W1G A;  3E9H A;  2QEX A;  1CKM A;  4JI5 L;  2KCT A;  3J81 i;  1EOV A;  1KL9 A;  4JC0 A;  3F2C A;  1NE3 A;  3U4V A;  4A93 G;  4DV5 Q;  1YHQ A;  4JYA Q;  2AHO B;  3HOV H;  3HOZ G;  3J81 j;  4A3G G;  3CPF A;  3CPW A;  1KD1 C;  4IFD I;  2YTX A;  2JA6 H;  2UUC L;  4JI7 Q;  4IPH A;  3KF6 A;  1YNX A;  2EQS A;  1LM0 A;  2Z0S A;  4DK3 C;  5LMU L;  1XNR L;  2LXJ A;  2ZJP A;  1IBK Q;  1PH8 A;  2VZA A;  4DV0 Q;  2EIF A;  3GTL H;  4DUZ Q;  1Y1V G;  4JI4 L;  3RN5 A;  3J80 c;  4BA2 I;  4A4I A;  1A63 A;  1X54 A;  5C0X I;  2UXC Q;  2VQF L;  4LUV A;  4RMF A;  5JEA J;  1VQF A;  3PUX A;  5M3M G;  3K8A A;  1PYS B;  5E7N A;  2E2J H;  4OX9 Q;  4P75 A;  4DR5 Q;  3JC6 6;  3CCS A;  1W2B A;  1QUQ B;  5IP9 H;  4HJA A;  1IXR A;  1VQB A;  1HNZ Q;  2UUB L;  2I5L X;  2OQK A;  1V43 A;  5DLQ E;  4LW1 A;  1NJI C;  4DV6 L;  2WB1 E;  4LF5 L;  1Y1W G;  1HZA A;  4A3B G;  2IHF A;  5K36 G;  2VQE L;  1YJW A;  1QVG A;  3CCJ A;  2PQA B;  4EQ5 A;  2JEB I;  4DV1 Q;  4A3K G;  4DV4 Q;  2VY3 A;  1TWF H;  3GTJ H;  2Q2U A;  4DR1 L;  1VQ6 A;  2NZH A;  4BY1 G;  1X3G A;  3RN2 A;  1HH2 P;  3CQZ H;  3TS0 A;  2ZJQ A;  3HOX G;  4OON A;  3S16 H;  1AH9 A;  2UUA L;  1E24 A;  5IY0 A;  1C0A A;  3PO2 G;  1LYL A;  5C4J H;  1I6H H;  3TRE A;  1EYG A;  3OTO Q;  1V1Q A;  2V1C C;  4IJL A;  4JI6 Q;  2GVA A;  1UE5 A;  1KQS A;  1M1K C;  5IYC G;  4JBK A;  4JI0 L;  1GD7 A;  5IWA L;  4HJ8 A;  4LUO A;  1VS0 A;  1X9N A;  3SGI A;  4X62 L;  4QY7 A;  4OWX B;  5C3E G;  3PUW A;  3ICE A;  1HR0 L;  2AMC B;  4NXN Q;  2XGT A;  4Y7N H;  2KHJ A;  2Q2T A;  3H3V I;  1WCM H;  4IPG A;  4IO9 A;  3RNU A;  4POF A;  4KHP L;  1BVS A;  2JA7 H;  1HNW L;  1XMO L;  3K7U C;  1SLJ A;  1X65 A;  1PA6 A;  1U5K A;  1CKN B;  3H0G H;  1Q82 C;  2A8V A;  4DR6 Q;  3FHW A;  1DGS A;  1IL2 A;  2JE6 I;  4GKK L;  1J5E L;  1XNQ Q;  4A93 H;  2OQ0 A;  2ZTD A;  1S40 A;  2XTI A;  1HNX Q;  4JOI A;  4JV5 Q;  4IJH A;  3K81 C;  4C2M H;  3HOZ H;  2NVX H;  4A3G H;  2K75 A;  4A3M G;  3AEV A;  2NVY H;  2D0O A;  1UEB A;  1XMQ Q;  2N3S A;  1VQ7 A;  1N9W A;  2RHQ B;  1N36 Q;  3HOW G;  4L5R C;  4NXM L;  3RLF A;  4PG3 A;  4LF9 L;  1VQG A;  2KHI A;  1IZ6 A;  4X65 Q;  4LFB L;  3G48 A;  4NPS A;  2HQL A;  4DV3 L;  4ALP A;  4MZ9 A;  3J7Z C;  1K3R A;  3L0O A;  3M4P A;  3IRB A;  4LFA Q;  4A3J G;  5C4X G;  4IOA A;  1VQO A;  5JJK A;  4BBR G;  5ELO A;  3S1N H;  4DR7 Q;  2LSS A;  4QQB X;  5M3M H;  4HIK A;  5GAG C;  1RL2 A;  1YIT A;  2NVT H;  3OW2 A;  1OXU A;  4GOP A;  2C35 B;  3HOU G;  1CSQ A;  1AE3 A;  4QIW E;  4DV5 L;  4LUZ A;  1PVO A;  4YWK A;  1YZ6 A;  1LUZ A;  3M4Q A;  5IYB G;  1Y1W H;  2ATW A;  2PMZ E;  4IOC A;  5M3F G;  3EBE A;  1Q7Y C;  5C44 G;  2CKZ B;  3B6Y A;  4LFC L;  1R9T H;  1EFW A;  1N32 Q;  2VNU D;  2N8N A;  5IYD G;  1MJE A;  3J7A 5;  1N34 L;  4JG2 A;  2E5L L;  3PGZ A;  3G6E A;  4BY1 H;  3CW2 C;  4BXX G;  5GAH C;  1GO3 E;  3K80 C;  3RR5 A;  5GAD C;  5GRO A;  3HOX H;  5BR8 Q;  4DUY Q;  2QA4 A;  1IBL L;  3S17 H;  3PO2 H;  4LF8 Q;  2VS1 A;  1GKH A;  1P16 A;  4UP8 A;  4IPC A;  1EIF A;  3T1Y Q;  4JBW A;  4JI8 Q;  3CC2 A;  3KYH C;  1VQP A;  2YU9 H;  4DAY B;  4B3S Q;  2UXD Q;  4KI0 A;  5EAY A;  5IYC H;  4OX9 L;  4DR5 L;  1XJV A;  3AYH B;  1YHA A;  5AJ3 L;  2N49 A;  2PI2 A;  4JI3 Q;  1CKO A;  3ULJ A;  4AYB G;  5IP7 G;  4UY8 C;  2F3I A;  2K50 A;  2NN6 I;  3I4M G;  2R93 G;  4L5T A;  5C3E H;  5LMN W;  2IX1 A;  4DV1 L;  4A3C G;  1Q12 A;  2F4V L;  4LF7 Q;  2D0P A;  3VDY A;  3MEF A;  2R6G A;  1QZG A;  1VQ8 A;  2CCZ A;  1FJG Q;  4B3T L;  1JT8 A;  4GNX C;  1K9M C;  4R4O A;  3OTO L;  1L1O C;  2GVB A;  4A3L G;  3KDF B; 
#chains in the Genus database with same CATH topology
 2F0F A;  1RF2 D;  5M3M B;  5FLX L;  2ALY B;  2PQA A;  4C3J H;  1E7Z A;  2I0Q A;  4G7Z C;  1EZ8 A;  1STE A;  1TWH B;  4HMJ A;  4U68 A;  1OO9 B;  3VR5 A;  5FJ8 G;  3EFX D;  1RKN A;  4DAV A;  2O4X A;  4CHT B;  4HIM A;  1KAB A;  3UDG A;  4X3S A;  1KXL A;  5T1I A;  1GM5 A;  2B39 A;  4J6H A;  2J7Z A;  4JV5 L;  2F0P A;  4MHE A;  3I8Z A;  1R4Q B;  2A69 D;  3GTM H;  1U0L A;  3I91 A;  2LS0 1;  4IFD G;  5IYD H;  3TSS A;  1YBY A;  4FDB A;  4RFB A;  1EY6 A;  2ID0 A;  1PH4 A;  2A6H D;  2JSO A;  4BXX H;  3I7F A;  1LTL A;  2L11 A;  2RDG A;  1Y14 B;  1X3Q A;  2TSS A;  1UWV A;  1VQ5 A;  4DNT B;  4JI1 L;  4OIK A;  3JAM c;  2XNA C;  1WTW A;  4AQY L;  1C9O A;  4PZ8 A;  4RCO A;  2HDL A;  2MHV A;  3CCL A;  1KHI A;  1CM9 A;  3CCV A;  3W1B A;  1NMG A;  4RHS A;  4YCV A;  1EEF D;  4A3C H;  4KHZ A;  5A2Q E;  3MHB A;  1IL8 A;  3FPU B;  2IY5 B;  4CJ2 C;  5JVG 3;  3I56 A;  2B2V A;  2MJ8 A;  4DV2 L;  4JI2 L;  1XNR Q;  3H3V C;  3S1M B;  4P72 A;  2RHS B;  3I2Z A;  2MFI A;  4JI8 L;  3HZX A;  3URY A;  3HGB A;  2YTY A;  4JI4 Q;  2CH4 W;  1XYI A;  2HIX A;  2KED A;  4J1M A;  3UDI A;  3VR6 A;  2HDM A;  3IFT A;  4K5X A;  2A6E D;  3MXN A;  3HG9 A;  5LMN L;  5ELD A;  2NWG A;  5CYU A;  1TWA B;  4DV6 Q;  3F8T A;  3RLN A;  1K83 B;  4OWT B;  1SMX A;  2EJM A;  1LTS D;  1EYC A;  3BZC A;  1YJN A;  1PYB A;  4DR1 Q;  1PZI D;  4HID A;  2ZTE A;  2Z8L A;  4AYB E;  2A1A A;  2UUA Q;  4QGU A;  3I72 A;  2K14 A;  4V0B A;  3PUZ A;  3M3Y B;  4DV0 L;  4JOI C;  1EQR A;  1PH6 A;  4XDX A;  4DR3 Q;  4BBS G;  1NNX A;  3T53 B;  3U58 A;  5FK9 C;  2R93 B;  5DAU A;  5EBD A;  4KY5 A;  5C5L A;  1P8L A;  1HNZ L;  5C0X H;  1Q8K A;  2QGQ A;  1X3P A;  1EFI D;  2N55 A;  1ASY A;  4PMB A;  3FPP A;  3PMF A;  1PTO B;  5J39 A;  5JEA H;  2WAQ E;  1S5B D;  2JA8 H;  4F87 A;  3HS0 C;  2OF1 A;  1A15 A;  4GOP B;  3HOY G;  3NQI A;  5M5X B;  1EQT A;  3TBI B;  4NXM Q;  4B9X A;  3D6W A;  1SMY C;  1ICW A;  2L55 A;  1SRU A;  4HJ9 A;  1GUW A;  1KTK A;  1L1O B;  4R9W A;  4YIJ A;  4JCV E;  3CC4 A;  2DN8 A;  2B2T A;  1JE4 A;  4KJN A;  5CBA E;  4A3I G;  1N33 Q;  4RG1 A;  1OTC A;  3IKJ A;  3QJY A;  1I3Q B;  1DON A;  3M85 A;  1VQJ A;  1VQM A;  1WTR A;  2L15 A;  4ZK9 B;  5GQO A;  3H3V H;  3H09 A;  1I4G A;  2NVQ H;  1J8I A;  1LAC A;  3GTK H;  4C3H B;  1WYD A;  3GTP H;  2DJG C;  2SEB D;  1N34 Q;  4XYQ A;  1KIX A;  2WAQ G;  2B63 B;  2BA1 A;  1Z7T A;  1T5X D;  2K4K A;  2EOT A;  2KQ3 A;  4K2L A;  3ULP A;  2A5H A;  3BZD B;  3TDQ A;  5ELB A;  4N8F A;  2HIV A;  3S15 B;  3TZD A;  5IGB A;  5EPJ A;  2JA5 B;  2F0M A;  3KF6 B;  5FLM G;  1Q81 C;  5BN4 A;  3GTG B;  3CRK C;  1ET9 A;  3S1R H;  4KJO A;  1CHQ D;  1JOO A;  3LX0 A;  1DOM A;  2A74 C;  3F2D A;  4B3T Q;  4MTN A;  3OWE B;  3D6C A;  3LNN A;  4LJZ C;  2F0V A;  1II3 A;  2JA9 A;  4HED A;  4DR3 L;  5LMU Q;  1JB3 A;  1KC8 C;  2AQ3 B;  3Q8D A;  3JAM E;  3E6Z X;  1C4Q A;  1UUP A;  3SK8 A;  3E3X A;  3HKZ B;  4X64 Q;  2Q8I B;  2F0I A;  2K05 A;  2FHT A;  5HGQ A;  4NDX A;  3NEL A;  3PF4 A;  4ZRZ A;  3HOV G;  5CV8 A;  4R8N A;  1EYA A;  2UXB Q;  3TEH B;  4DXG A;  1NR2 A;  2IW3 A;  4HR7 B;  1EY0 A;  1U4M A;  4XTC S;  1PV4 A;  1IBM L;  1TR5 A;  3OMC A;  1NMF A;  1E1T A;  1WFQ A;  1EUJ A;  1N33 L;  1MKH A;  2EPB A;  3A7L A;  4HJ5 A;  2EY2 A;  1EYD A;  3CQZ B;  3STB C;  1X6O A;  1FNV A;  4ZYS A;  2ZM6 L;  4IZ8 A;  1HR0 W;  3V96 A;  1HR0 Q;  2Z9H A;  3ITP A;  4PZ7 A;  4A3D H;  4Y52 H;  1H95 A;  1HPC A;  3N52 A;  1YNN D;  3LGJ A;  1I4X A;  1J5E Q;  3JAM i;  4R4C A;  3PO3 G;  3BVG A;  3S2H H;  1LO5 D;  1EOT A;  4OEL B;  3X3M A;  3Q6S A;  1BBW A;  4Y7N B;  2MO1 A;  4R8I A;  1WCM B;  1D8L A;  2QEJ C;  1FVI A;  4XIG S;  4AH6 A;  1SYB A;  1VF7 A;  1YNJ D;  2CHB D;  4LK1 C;  3GV3 A;  3L2P A;  2R92 H;  1F2Z A;  4A3F H;  2PMZ B;  1B8A A;  2D9U A;  2IT1 A;  2FMM A;  4OO1 G;  3H0G G;  2F3W A;  4N8X 1;  1WD1 A;  3W1G A;  3E9H A;  2QEX A;  1CKM A;  4C1N K;  3K5N A;  2O2L D;  2IWH A;  2ZT9 C;  4L6T B;  4JYA Q;  4DF7 A;  3J81 j;  1I4P A;  4KMU C;  2A68 D;  2E74 C;  2K03 A;  4IFD I;  2JA6 H;  4JI7 Q;  1NUC A;  3J7Y W;  1EIG A;  5LMU L;  2EQS A;  1LM0 A;  2Z0S A;  1IBK Q;  2NVT B;  2RKS A;  4CDC C;  3BDO A;  2EIF A;  1SXT A;  1PFB A;  4DUZ Q;  3SK6 A;  3RN5 A;  3J80 c;  2J4X A;  1X54 A;  2RCF A;  4LUV A;  5JEA J;  3PUX A;  1VQF A;  5M3M G;  5E7N A;  2QIL A;  4P75 A;  5L37 A;  5IP9 H;  4HJA A;  1VQB A;  4BY1 B;  1V43 A;  5DLQ E;  4LW1 A;  2B2T C;  4EQ5 A;  4DV1 Q;  3GTJ H;  3U9O A;  1VQ6 A;  2NZH A;  1ENF A;  1RTN A;  1AH9 A;  1E24 A;  5IY0 A;  1C0A A;  3PO2 G;  5C4J H;  1DD2 A;  4PQX A;  5C3E B;  3BVZ A;  2GVA A;  1KQS A;  4KN7 C;  1F9R A;  4F88 A;  1EQV A;  2NB0 A;  3SGI A;  4QY7 A;  4OWX B;  3ICE A;  1HR0 L;  5FO8 B;  3DUZ A;  1ZXT A;  2ZXO A;  1SE3 A;  1GHK A;  2JA7 H;  2LMC B;  1Q82 C;  3FHW A;  4C3J B;  2MPM A;  3VA7 A;  3NK9 A;  1J5E L;  3K58 A;  1XNQ Q;  2ZTD A;  4OL7 A;  1HRJ A;  4XQJ A;  3HOZ H;  1J9O A;  3NHH A;  1QG7 A;  4KTA A;  2D5D A;  2N3S A;  2EJF C;  3HOW G;  3T56 B;  4L5R C;  4PG3 A;  4LF9 L;  1K28 A;  4ZLT F;  4X65 Q;  2HQL A;  4MZ9 A;  3J7Z C;  1K3R A;  3L0O A;  3IRB A;  5C4X G;  1JIC A;  1GOZ A;  4WJW A;  3GTM B;  1ESR A;  1D2B A;  5GAG C;  1RL2 A;  1YIT A;  3OW2 A;  3SVM A;  1AE3 A;  2VXW A;  4XQQ A;  3OHX C;  2F0U A;  2KA7 A;  2Z6B A;  1V1P B;  3EBE A;  1Q7Y C;  5C44 G;  3B6Y A;  2VB2 X;  2VNU D;  1N32 Q;  3ND8 A;  2N8N A;  2L9H A;  1GUN A;  3DHQ A;  4JG2 A;  2XN9 C;  1ZYR D;  5GAH C;  2CW0 D;  4UP8 A;  4IPC A;  4JBW A;  3CC2 A;  1IKM A;  2YU9 H;  4DAY B;  5IYC H;  2PW5 A;  2QDL A;  2K50 A;  2R93 G;  3GP7 A;  4L5T A;  4K2K A;  3DXJ C;  3DEO A;  5J1Z A;  3A54 A;  2IX1 A;  1HFN A;  1KAA A;  4DV1 L;  1EU4 A;  5LL6 S;  4AYB B;  2R61 A;  4CKE A;  1F2L A;  1QZG A;  1B9M A;  3MEF A;  1VQ8 A;  2CCZ A;  4ZCK A;  2WIN B;  4RKL A;  3AB9 A;  1MD2 D;  4IUT A;  3D4D A;  3T16 A;  1K9M C;  4R4O A;  5I9O A;  1D1I A;  2K33 A;  4UAI A;  2GVB A;  1RHP A;  4A3L G;  3MZ5 A;  5CR3 A;  4YY3 L;  4A3M H;  3I55 A;  3OPO A;  4ZUI A;  1KDB A;  4LF6 L;  2DNC A;  3DWA A;  3TS2 A;  1CUK A;  4P2C B;  5IGF A;  1BOS A;  4DR2 Q;  1EY8 A;  5FLX c;  3C3L A;  1Z9F A;  2SNM A;  3UE0 A;  1SAP A;  2VL6 A;  3KFU A;  3T51 B;  4AIM A;  1PZJ D;  2WAC A;  5KYI A;  1XNQ L;  1K3B C;  3HOU H;  1EU3 A;  4DNI A;  2KBN A;  4TRD A;  5M3F H;  2LFN A;  4QJF A;  3ERO A;  5BN5 A;  1E1O A;  1OXX K;  1K73 C;  1CQF A;  4C3H G;  3QG1 A;  2Q2I A;  4OXP A;  3J80 E;  1RIP A;  2P5Z X;  1EWH A;  4DPG A;  1WTP A;  2E2H H;  5H1S E;  2K5H A;  1ICF B;  5KND A;  3Q22 A;  4PZ6 A;  5IT9 L;  1EL0 A;  3CU7 A;  1TS2 A;  1XPR A;  3VR2 A;  1VQE A;  1BCP F;  3I4O A;  3G71 A;  5IP7 H;  1LT5 D;  1ILP A;  1JOQ A;  5FO7 B;  1E0B A;  2DY8 A;  4DV7 Q;  2AKW B;  3KF8 B;  4GLX A;  2JA5 G;  3I4M H;  2CH4 A;  5JJI A;  4RAU C;  5ELC A;  1BR9 A;  3A56 A;  1E2W A;  2E75 C;  1F2M A;  1SNM A;  2HHH Q;  1YIJ A;  1EWC A;  1X56 A;  3ZJY C;  3CCR A;  3CD6 A;  1QVC A;  3RD4 A;  3K0X A;  2F52 A;  1M90 C;  1GVP A;  1PZK D;  1UE1 A;  2NVQ B;  2L12 A;  3CHB D;  3GTK B;  5CV9 A;  1CA5 A;  3GTP B;  1HA5 A;  1WI5 A;  1VQA A;  3P1H A;  1HTP A;  5G3L D;  4C3I H;  5KYL A;  3R2T A;  4LF5 Q;  2JQO A;  3ONA B;  1RD9 D;  4R1J A;  1SNO A;  1L2F A;  4A76 A;  3UE1 A;  4FXG C;  1B50 A;  5IGG A;  1FNW A;  2BDO A;  2SDF A;  3J80 i;  5JPN C;  2XRQ D;  4A3B H;  4A3K H;  5CV7 A;  1H9M A;  3S14 H;  3BG3 A;  3QB3 A;  4IFD H;  4WJ4 A;  4HIO A;  1WTV A;  4JBJ A;  3QO2 A;  3S1R B;  1CA6 A;  1BCP C;  2UXC L;  1DZ1 A;  4L8J A;  1JWM D;  1XXG A;  4XT1 B;  4FXD A;  2A19 A;  2NBF A;  4OO1 I;  1STG A;  1HZC A;  1SJH D;  4ZQ3 A;  1XMO Q;  4S3S A;  3MA2 B;  3SK4 A;  4DV4 L;  1IYJ B;  2AUJ D;  4NKL A;  1G29 1;  1PRT D;  1DJR D;  4GN5 A;  2R7Z G;  1HZ9 A;  1QUQ A;  3AQQ A;  3FVQ A;  4XXE A;  1G8Z D;  4LFB Q;  2JN4 A;  1SND A;  4DV3 Q;  3PIP A;  1H9K A;  4N9P A;  1BXT A;  2BCO A;  4NXN L;  1VQ4 A;  1WTQ A;  1B70 B;  2R7F A;  1Z47 A;  4BY7 G;  1U9R A;  4DR6 L;  1L0Y B;  1STB A;  4ZKC B;  2HHH L;  4LFC Q;  2LXK A;  2E2I H;  4CJ1 B;  2E5L Q;  2EXD A;  5KNC A;  1XMQ L;  3NBI A;  2I5M X;  2K5D A;  1N36 L;  1IBL Q;  3T13 A;  1KRT A;  2PZU A;  1BNZ A;  4NMZ A;  4A3D B;  3QOL A;  2JK8 A;  1CKN A;  3I4N G;  4BBS H;  1STH A;  1Y8N B;  2KJX A;  1ML0 D;  1E2V A;  5TSS A;  1D7Q A;  5FLX E;  1VQ9 A;  4DR7 L;  4KK7 A;  4LWC A;  3S2H B;  5M5Y H;  3M9B A;  1IHZ A;  1JJC B;  1Q3L A;  3RLO A;  1CK1 A;  2EY1 A;  1DYQ A;  2AWN A;  5I2Y A;  2F4V Q;  3VYS A;  2F0L A;  5C6A A;  4YWL A;  3VR3 A;  3R8B A;  3FKI G;  2R92 B;  1GJX A;  1GUS A;  1VQK A;  1SDF A;  1KDA A;  1G51 A;  3M4O H;  4P74 A;  4A3F B;  1CT1 D;  4LF8 L;  1V1O A;  3HOY H;  3NP8 A;  4RWS C;  1I4Q A;  2C5C A;  1FR3 A;  2UXD L;  4LAA A;  5GAE C;  1JMC A;  1MHW C;  2YV5 A;  2JA6 B;  2VQF Q;  1K8M A;  1QZH A;  1UEA B;  3D4W A;  1NAP A;  4M1U B;  3CCE A;  2DUD A;  4A3I H;  2G5D A;  3HKS A;  2Y0S B;  2WB1 G;  3H91 A;  3DLL A;  3RZD H;  2FIN B;  2V4D A;  5M5W H;  1FJG L;  5EKK A;  4IN3 A;  4WFN 3;  4KN4 C;  4UP9 A;  1TWG H;  4A3E H;  2ZXR A;  5C4Z A;  1PH2 A;  1XPO A;  2EY5 A;  3TP7 A;  1X55 A;  2SNS A;  5EPK A;  3K5M A;  3CMA A;  3O13 A;  1Q1B A;  3GTJ B;  1HA6 A;  3OSO A;  2OT2 A;  3E0E A;  4UPA A;  4H7B A;  5E1F A;  5CV4 A;  1YEZ A;  2EXZ A;  4RH6 A;  5C4J B;  1YI2 A;  1RJT A;  3R3O A;  3WDN A;  5FLM H;  4TKO B;  4WJ3 M;  3F1Z A;  1I50 H;  2XRS D;  2F0W A;  4J8Q A;  1L1O A;  4LF4 Q;  4K0K Q;  3S1Q H;  3MXN B;  2EYF A;  3NE5 B;  4GKK Q;  5D14 A;  1HUM A;  1UE6 A;  1JJ2 A;  4HN7 A;  1Q46 A;  1QNK A;  2JA7 B;  1WOC A;  3PIO 3;  2RQX A;  2X6L A;  1I94 Q;  2B29 A;  2GA4 B;  3H6M A;  2OTJ A;  1AZP A;  5IGE A;  1EY9 A;  3RZO H;  4IFD J;  2UU9 Q;  1VDZ A;  1E3P A;  4POG A;  1H9R A;  4IUR A;  4A93 G;  1IW7 D;  3U4V A;  1MGS A;  2AHO B;  1FGB D;  3HOV H;  4A3G G;  1KD1 C;  1KLG D;  3KF6 A;  1TS4 A;  3NTI A;  3PQI A;  1XNR L;  4KHV A;  3L3O C;  4FF2 A;  1PH8 A;  3D4R A;  3GTL H;  2X69 A;  4JI4 L;  4BA2 I;  4A4I A;  4ZAI A;  3DWP A;  1TII D;  1MBY A;  2VQF L;  5FO9 B;  2E2J H;  4OX9 Q;  1D5M C;  3JC6 6;  3CCS A;  1W2B A;  5ISR A;  4DNR B;  4FF4 A;  4B08 A;  4DV6 L;  1Y1W G;  1HZA A;  5K36 G;  1W6K A;  4E6I A;  2PCF B;  1SE2 A;  1U4R A;  2JEB I;  1TWF H;  2VY3 A;  2YU9 B;  4DR1 L;  3IL8 A;  4K6D A;  1HH2 P;  2ZJQ A;  3HOX G;  2F0T A;  4OON A;  3S16 H;  2UUA L;  3I73 A;  2B2Y C;  5EJW A;  2K01 A;  3TRE A;  3MC0 B;  1V1Q A;  2V1C C;  1CZW A;  1MSG A;  3I3C A;  4IJL A;  4JI6 Q;  1M1K C;  4CDD C;  4JBK A;  4NP5 A;  1SSO A;  4LUO A;  4HSP A;  4IUU A;  3A55 A;  1Y8P B;  2PZW A;  4KD3 A;  3A8I E;  3PUW A;  2G9H D;  2AMC B;  2KHJ A;  4IPG A;  2QDB A;  1F9P A;  1BVS A;  1PTO F;  2LKV A;  4ULL A;  4A3M B;  3NTH A;  1BF4 A;  4ODG A;  3TP8 A;  1X65 A;  1U5K A;  3H0G H;  4OO1 H;  1IL2 A;  4GKK L;  2OQ0 A;  3ZYY X;  1LAB A;  5E4X A;  1HNX Q;  3FDT A;  4MN3 A;  1KNA A;  4C2M H;  2B8F A;  3AEV A;  1JOK A;  1F9S A;  1N9W A;  2RHQ B;  1VQ7 A;  4NXM L;  5IGD A;  4CDF C;  4NPS A;  4ALP A;  3HOU B;  3M4P A;  1VMP A;  4A3J G;  4IOA A;  1VQO A;  4BBR G;  3S1N H;  5M3F B;  1IKL A;  5M3M H;  1EEI D;  3BS1 A;  1OXU A;  2CW0 C;  2K7V A;  2C35 B;  4QIW E;  4YWK A;  1D5Z C;  1LUZ A;  1YZ6 A;  1QWY A;  2E2H B;  4DGZ A;  3MXG A;  1PRT B;  1N34 L;  1SEB D;  4X3U A;  5I4D A;  1LLR D;  4H13 C;  4DUY Q;  3S17 H;  3SE0 A;  2PQE A;  3PO2 H;  5HGT A;  3T1Y Q;  3I4M B;  2F0J A;  5I9P A;  1VQP A;  4B3S Q;  5JJZ A;  2H1E A;  4OX9 L;  1WTO A;  2BE5 C;  3AYH B;  2N49 A;  1LT6 D;  4Q0F A;  1PTO C;  4UY8 C;  5CMD A;  2WII B;  3OMG A;  2LY7 A;  3U9S A;  4IUQ A;  1Z6H A;  4U67 3;  4LF7 Q;  4UHV A;  2D0P A;  1G91 A;  3FEW X;  4X3T A;  4B3T L;  4OIJ A;  1CI3 M;  3NWS A;  3QWN A;  1L1O C;  2WKC A;  1NR4 A;  4C3I B;  4G57 A;  3WOE A;  5C0X J;  1PH9 A;  2VUM G;  3HOW H;  2ZTC A;  1DXM A;  1K0S A;  3NBH B;  4RGT A;  4HTH A;  4IQZ A;  4OWW B;  1XPU A;  4HJ7 A;  1UNS A;  3S9W A;  3G7L A;  1CQV A;  3KJP A;  4A75 A;  4GKJ Q;  4X64 L;  4A3B B;  3KBX A;  5C4X H;  4A3K B;  2AQ2 B;  3S14 B;  1S72 A;  1S5C D;  1SMY D;  1E22 A;  1LTA D;  2CQO A;  4PNY A;  1HNX L;  1LTR D;  2UXB L;  1XTD A;  3MWY W;  3VYR A;  2F03 A;  5C44 H;  4C56 C;  1ONL A;  2B2U A;  2IX0 A;  4UP7 A;  2K1B A;  3J7A V;  4JW0 A;  3C1E A;  3KJO A;  4DKA C;  3V2T A;  4O1N A;  5A35 A;  4O2D A;  2OTL A;  5LL6 X;  5AFW A;  2R93 H;  2L1B A;  5DNF A;  4JI5 Q;  1T5E A;  2Z6K A;  3J81 L;  1SYE A;  1VCI A;  1EY7 A;  3P7J A;  3GV6 A;  3GTQ H;  1IYU A;  2K5V A;  2UUC Q;  3F2B A;  2HUG A;  3CKI B;  2B2W A;  2OXP A;  3T1Y L;  1PYW D;  1F9Q A;  4A3L H;  1PTO H;  2K52 A;  4CKB A;  1YJ9 A;  1TS5 A;  1A62 A;  1Y1V H;  1H9S B;  2F3V A;  3C1F A;  4KKS A;  4OHJ A;  2E2I B;  1QVF A;  1CFM A;  2TMP A;  2UUB Q;  3DM3 A;  4IPD A;  1X3F A;  4LF7 L;  2FJ2 A;  3D3R A;  2EZV A;  3T1H Q;  1VQI A;  4DAY A;  3ERS X;  1ASZ A;  4JYA L;  3NTK A;  4I65 A;  2ICE C;  2Y0S G;  4HAE A;  1K8G A;  4HCS A;  4BBS B;  4JI7 L;  4BA1 I;  3P75 A;  2DGY A;  4GN4 B;  1IBK L;  2JP1 A;  1TVX A;  2YTV A;  3G6J B;  4DUZ L;  4GKJ L;  2YYZ A;  3U50 C;  3E0J A;  1VQL A;  1SJE D;  3HFZ B;  3M4O B;  2IX3 A;  1A2T A;  3CP0 A;  1CTM A;  1H9J A;  1A0I A;  2L4N A;  2D62 A;  4P71 A;  3S15 H;  3PSI A;  1BKB A;  3HOY B;  3TQY A;  3SDZ A;  4DK6 C;  2KEC A;  1HZB A;  4JVZ A;  1I4H A;  1NSN S;  3J7A F;  1K8O A;  1VQC A;  3STB D;  1NY4 A;  3CCM A;  2EDG A;  1D5X C;  1TU2 B;  2L0C A;  3H15 A;  1D1K A;  3Q24 A;  3KLS A;  1WTH A;  3ERQ A;  1A6X A;  1O7Z A;  2BDN A;  2QCP X;  2RSO A;  4GNX B;  3RZD B;  2B3G A;  5M5W B;  4EX5 A;  5HY6 A;  4FYD A;  1MJC A;  1O7I A;  2I07 B;  3GD7 A;  1TWG B;  4A3E B;  1SYF A;  2A73 B;  2A69 C;  3EN2 A;  3E9I A;  2Q8T A;  2NN6 G;  5C5M A;  3SK5 A;  2WAQ B;  3TN2 A;  1Q86 C;  4QCL A;  2A6H C;  1B2T A;  1PHJ A;  3K7A H;  3S2D H;  1W3S A;  4PMW A;  3NEN A;  5IYB H;  3NWT A;  2IHE A;  1EY5 A;  2MQH A;  1S5F D;  3ULL A;  2C9O A;  1RDP D;  1EWI A;  3KF8 A;  5KGU A;  4P73 A;  4X65 L;  1I50 B;  3GO5 A;  1AE2 A;  2R3Z A;  2KEE A;  3OW7 A;  5LHY 1;  3FP9 A;  5AJ3 Q;  1PMR A;  2B63 G;  3S1Q B;  3NUC A;  5BN3 A;  4RKB A;  2XIW A;  2ZJR A;  2JYO A;  2PNR C;  3BVM A;  1VQN A;  1CHP D;  5ELN A;  3T1H L;  5EBC A;  2JA8 B;  3HKZ E;  1ZEQ X;  2E8G A;  1Q1E A;  3NPP A;  1SYG A;  4DK0 A;  1HFG A;  2F0H A;  1B4O A;  3NXW A;  1O78 A;  3TP6 A;  1N32 L;  3C46 A;  2RVL A;  3P20 A;  5COY A;  4RGM A;  2A6E C;  2BH8 A;  3K59 A;  4ILW A;  2R7Z H;  5CGK A;  3RZO B;  1C7Y A;  3T4A C;  4C1N I;  2DY7 A;  5IOC A;  2B2U C;  3BYT B;  3GTO H;  5F2D A;  3HOV B;  1PH1 A;  1M4V A;  1Y8O B;  4K5V A;  1BBU A;  1SN8 A;  2PYK A;  4X3K A;  1SE8 A;  4J15 A;  4RA8 A;  1NTG A;  2F0Q A;  4CJ0 B;  1T9H A;  4GS3 A;  2WP8 J;  5IT9 E;  3GTL B;  5FJ8 H;  3CC7 A;  2HCC A;  5JAV A;  1PH5 A;  4EQN A;  3HKZ G;  1B1Z A;  1KLU D;  3MXU A;  4BY7 H;  1NBW A;  2F4I A;  4DK1 A;  2VW9 A;  1KAW A;  2MGS A;  2E2J B;  3CF5 A;  1GHJ A;  2XSC A;  2Z6K C;  3Q0A A;  1PDQ A;  3KLW A;  2CWP A;  1BBX C;  1QJO A;  4Z9C B;  2BA0 A;  2B2W C;  1WD0 A;  4FP5 D;  4JI1 Q;  1K8A C;  2EYP A;  1TWF B;  3KLR A;  4AQY Q;  2Q2H A;  4JI0 Q;  2G9D A;  4DR2 L;  1HTL D;  1OXS C;  4TQU S;  2E76 C;  3I4N H;  1B44 D;  3S16 B;  4X62 Q;  3KDF A;  5JJL A;  1FGU A;  2F0E A;  4KHP Q;  1HNW Q;  1ESF A;  2ES2 A;  3AFP A;  3BDL A;  1D6E C;  1LTG D;  3FKI H;  1B3Q A;  3R2I A;  4DV2 Q;  4JI2 Q;  2O5I C;  2K28 A;  2SOB A;  5CV6 A;  1RTO A;  2XWB B;  1IW7 C;  3BJU A;  3H0G B;  4RCN A;  2WKD A;  4WRD A;  1I6V C;  1SR3 A;  3A7A B;  2FMC A;  1TWC H;  1XX8 A;  1KNE A;  1OXT A;  1VF5 C;  2F1M A;  3EVQ A;  3NSW A;  4IAL A;  1WCM G;  3A5Z B;  5LMN Q;  1B53 A;  3TRZ A;  4TVA B;  1I4R A;  4DV7 L;  1JOR A;  2KCT A;  1G2S A;  1NE3 A;  4ABN A;  4ZKB B;  4DV5 Q;  3CPW A;  2YTX A;  2B2Y A;  4IPH A;  2B8G A;  3S1N B;  1VMC A;  3D8G A;  2ENB A;  2EJG C;  4DK3 C;  2ZJP A;  1HXY D;  2VZA A;  4DV0 Q;  1E2Z A;  4I7A A;  1A63 A;  4C3I G;  1HCZ A;  3HRZ C;  3N6R A;  2KUM A;  1FNU A;  3K8A A;  1PYS B;  3K5O A;  3OOC A;  4ME5 A;  4DR5 Q;  1GUO A;  1QUQ B;  1HNZ Q;  1IXR A;  5A2Q L;  2I5L X;  2OQK A;  4DAP A;  1LV9 A;  1NJI C;  3S17 B;  2WB1 E;  4LF5 L;  1JR0 D;  3DEP A;  1AEX A;  4A3B G;  3PO2 B;  3I90 A;  4DA2 A;  1QVG A;  3CCJ A;  2PQA B;  4A3K G;  3MFG A;  2Q2U A;  1CZG A;  4BY1 G;  1X3G A;  3RN2 A;  3QOJ A;  4HMI A;  1ENC A;  1HQR D;  3TS0 A;  2IPK D;  1I6H H;  1EYG A;  1DCZ A;  1UE5 A;  4B9W A;  1F2Y A;  4JI0 L;  2EY6 A;  4HJ8 A;  4G7O C;  4X62 L;  4TSS A;  3QIA A;  5C3E G;  1LT4 D;  2Q2T A;  4KHP L;  4IO9 A;  3RNU A;  1QB5 D;  1HNW L;  1XMO L;  1LTI D;  3K7U C;  4QF4 A;  1PA6 A;  3HOW B;  2A8V A;  1CKN B;  2RSN A;  1STA A;  2F0O A;  4A93 H;  4MTK A;  1S40 A;  4H0L C;  1SYC A;  2XTI A;  3H94 A;  1LTB D;  4IJH A;  3K81 C;  4QMG A;  4A3G H;  2NVX H;  2K75 A;  3KBG A;  2NVY H;  5C4X B;  1UEB A;  2EYL A;  4C3J G;  3RLF A;  1SYD A;  1VQG A;  5EKI A;  1IZ6 A;  4LFB L;  3FRP B;  4DV3 L;  1HHV A;  4LFA Q;  1YNN C;  2LSS A;  4QQB X;  5C44 B;  4HIK A;  4FNF A;  2M2L A;  5JPM C;  3CRL C;  3OWF A;  3LWE A;  4GOP A;  1AZQ A;  4DV5 L;  4LUZ A;  3M4Q A;  1UAP A;  1Y1W H;  2ATW A;  5K36 H;  4IOC A;  2CKZ B;  2EYH A;  4LFC L;  1R9T H;  1EFW A;  1YNJ C;  1JWS D;  5C3X A;  5IYD G;  3J7A 5;  4CGY B;  2E5L L;  3G6E A;  1B3A A;  4BXX G;  3RR5 A;  5GAD C;  5GRO A;  1SE4 A;  5BR8 Q;  3HOX H;  2QA4 A;  1IBL L;  4QUF A;  2IL8 A;  1FD7 D;  3KYH C;  1QE6 A;  4KI0 A;  5EAY A;  4DR5 L;  4OEM B;  3A8K E;  2PI2 A;  4FXK C;  3V05 A;  3GTQ B;  3TP5 A;  4JI3 Q;  3ULJ A;  1LT3 D;  2F3I A;  2A68 C;  2MUY A;  1O80 A;  2NN6 I;  4CDE C;  3HOZ B;  1O7Y A;  3OIQ A;  4A3C G;  1BCP D;  2F4V L;  5D3I B;  3VDY A;  2R6G A;  4EQO A;  2DNE A;  1Y1V B;  5CC4 A;  4AYB G;  3HP3 A;  2F0N A;  1SNQ A;  1IBM Q;  2PNH A;  1ROD A;  1TY0 A;  1PLF A;  5J22 A;  1A3T A;  1CSP A;  2M9V A;  1DOK A;  3R93 A;  1QCB D;  1S4Z A;  1BDO A;  2X6G A;  4CBV A;  4A3J H;  1QOH A;  3GDE A;  4BBR H;  4YHH Q;  3D0F A;  2ZM6 Q;  2XVS A;  1VQD A;  4A3E G;  2FFK B;  3M7N A;  4V19 0;  4KV6 A;  3GQB A;  4DFA A;  2CFM A;  5E4W C;  4NW2 A;  3JAM L;  4GLV B;  1ENA A;  3CAM A;  2EVB A;  3OYY A;  3RMH A;  3PO3 H;  3M4Y A;  3PUV A;  4LNQ A;  4LFA L;  5ELE A;  2H5X A;  3NQT A;  3K0Y A;  5C0X G;  1V9P A;  2FXQ A;  3PCO B;  1A3U A;  2I5H A;  5I6W A;  1C8C A;  3KK7 A;  2JJQ A;  1J6Q A;  1TS3 A;  4H44 C;  2AWO A;  1SNP A;  5J3B A;  3S24 A;  5KNB A;  5JEA G;  1WTX A;  2JA8 G;  4LF4 L;  4YCU A;  2ICI A;  5DM7 3;  4FF1 A;  4K0K L;  5IGC A;  2KOL A;  1JJG A;  4K8J A;  2EYO A;  3HEJ A;  5BR8 L;  4QUC A;  3G4S A;  1WJJ A;  3J81 c;  1JC7 A;  2NZ1 D;  1HUN A;  4H02 A;  2KCC A;  4MNO A;  2VUM H;  2QF7 A;  1SFO H;  3VA5 A;  1PH3 A;  2VB3 X;  2K04 A;  2J0T D;  2Z1C A;  3K7A B;  4JI3 L;  1I94 L;  3S2D B;  5IE8 A;  1N8R C;  1YHB A;  4KKT A;  4L5S A;  1U4L A;  2EE1 A;  2OEO A;  1I5F A;  2UU9 L;  1ZYR C;  3MEH A;  2D2C C;  2AQ1 B;  2KCM A;  3CXC A;  3D31 A;  5EGT A;  1K0R A;  1TWH H;  4YCW A;  1L0W A;  1RCV D;  4B3R Q;  5CBE E;  2HQE A;  4G4K A;  3F2U A;  2B2V C;  4DAM A;  1B7Y B;  2AUK A;  2EYM A;  5DM6 3;  1EIH A;  2BH2 A;  1STN A;  1A2U A;  1Q8I A;  5I6Y A;  3U4Z A;  4EVO A;  1FL0 A;  5COR A;  3KLS X;  3AMU A;  5FKA C;  1PFM A;  2HCI A;  5D3D A;  4G7H C;  1KRS A;  4YHH L;  1FYC A;  1DM0 B;  3VR4 A;  5JVH 3;  5ELF A;  1BQQ T;  1VQH A;  4B3M Q;  4DR4 Q;  3ND9 A;  2R7Z B;  3L9A X;  4XQN A;  4JBM A;  5IIF A;  1KDC A;  3NBH A;  2CQA A;  3KUP A;  4GOP C;  4X6A H;  3GTO B;  3EIV A;  2WV6 D;  3CCQ A;  5T1G A;  3SEB A;  1PFN A;  4JI6 L;  4X66 Q;  4LF9 Q;  5M9O A;  1AP0 A;  4RHR A;  5G3L F;  1QNU A;  4BY7 B;  3A5U A;  1X3E A;  1NCV A;  1AW7 A;  4IUV A;  3S1M H;  2JEA I;  2EYJ A;  2XWJ B;  2IJ0 A;  3DWQ A;  2R7D A;  5CV5 A;  1JE5 A;  1YVC A;  3PV0 A;  4KY7 A;  3ER0 A;  1GUT A;  2MO0 A;  3PIO A;  3I4N B;  1S3O A;  4NB3 A;  3L7Z C;  1TWA H;  2ZXP A;  4R4T A;  5C4H A;  2KEN A;  2K5W A;  4XYO A;  1U4P A;  1K83 H;  3RUZ A;  4FF3 A;  3EA6 A;  2HT1 A;  3MVV A;  1L0X B;  4KY6 A;  4RGN A;  2Z4H A;  4APV A;  2JXM B;  3MXP A;  3AU7 A;  3CME A;  3K6O A;  1XWE A;  5I2X A;  1PXU A;  1MIU A;  3FKI B;  4L5Q A;  3M3Y H;  5NUC A;  4GN3 B;  1S5E D;  2I46 A;  4KLK A;  5K5P A;  1ZKO A;  3BYY B;  4A3D G;  3SXH A;  4FVM A;  3QR8 A;  2KCN A;  1A8V A;  1G6P A;  1HJP A;  1PFS A;  2CVR A;  3LWU A;  1PRT F;  3A74 A;  5JOB A;  4B3R L;  2RCN A;  2Y0S E;  5IT9 c;  3X3N A;  1MSH A;  1H9S A;  5DEH A;  4QL5 A;  1TWC B;  3PUY A;  1O7L A;  3DMU A;  4CKC A;  1TY2 A;  4DUY L;  3FMC A;  1SRO A;  4YY3 Q;  2NZO A;  4DXF A;  1AN8 A;  2R92 G;  4UDU C;  3WWV A;  3I4L A;  4LF6 Q;  4B3S L;  4K14 A;  2WB1 B;  4EGV A;  4A3F G;  1V1P A;  1STY A;  1SNC A;  4GLA C;  2WFW A;  4B3M L;  4DR4 L;  1TT2 A;  2GN5 A;  1F77 A;  1ILQ A;  5M5X H;  1Y69 U;  2O5J C;  2NTT A;  4O0A A;  3WOF A;  1A3V A;  2Z4I A;  1OXV A;  3UI2 A;  2NN6 H;  1AFP A;  4ME3 A;  2VQE Q;  2JA6 G;  2RA4 A;  4F8M A;  2F0K A;  4EQP A;  3PF5 A;  4YWM A;  3J81 E;  1I3Q H;  4X66 L;  1JCK B;  2N88 A;  2N78 A;  5M5Y B;  2OWO A;  3NEM A;  3TME A;  4QB4 A;  4PV1 C;  3A0J A;  1EY4 A;  1JB7 A;  4C3H H;  1EIY B;  1JWU D;  1TXY A;  5IP9 G;  5IOD A;  3UDX A;  3MFY A;  5IWA Q;  4R4Q A;  4DN4 M;  2B63 H;  3AFQ A;  1I6H B;  1PRT C;  3PIP 3;  1JQY D;  2KHS A;  4GZY C;  2OCE A;  2RDF A;  1BCP B;  3CCU A;  2RBM A;  4DU9 A;  3K5L A;  4GNX A;  2MP1 A;  2CWA A;  2JA5 H;  4IUP A;  3KOJ A;  1S5D D;  4KD4 A;  4KKU A;  2ASB A;  4R4I A;  3TZU A;  4I7Z C;  3UDF A;  3GTG H;  3SR1 A;  2PI2 E;  1R4P B;  4A3I B;  1BO0 A;  2MNA A;  3W3A A;  4K8I A;  3BU2 A;  2RF4 A;  1PH7 A;  3W5O A;  4A93 B;  4XT3 B;  3BZK A;  4A3G B;  2NVX B;  2JA7 G;  1IYV A;  2K32 A;  1EQQ A;  2NVY B;  4K5W A;  1UE7 A;  2K5N A;  3A8J E;  3F2C A;  4JI5 L;  3J81 i;  2RDH A;  1EOV A;  1KL9 A;  4JC0 A;  2BE5 D;  4WOR A;  1YHQ A;  3HOZ G;  1PTO D;  2QKI C;  3CPF A;  3J80 L;  2UUC L;  2F0G A;  2HD3 A;  1YNX A;  3I70 A;  2LXJ A;  3VYT A;  2NUC A;  4K6L A;  2Q8R E;  4Q5V A;  1Y1V G;  5KRU A;  1G2T A;  1TKW B;  1Y1W B;  2PZT A;  5C0X I;  4HCE A;  2UXC Q;  4RMF A;  3MTS A;  1R9T B;  1GXD C;  1W6J A;  2UUB L;  3HOX B;  3VYU A;  1SBB B;  2IHF A;  2VQE L;  1YJW A;  1LTT D;  4DV4 Q;  3Q23 A;  3CQZ H;  3IFD A;  2KVM A;  1LYL A;  3OTO Q;  3C2P A;  4N9T A;  5IYC G;  1C48 A;  1QIL A;  1GD7 A;  5IWA L;  3M7G A;  1VS0 A;  1DOL A;  1HQM C;  1X9N A;  4L63 B;  3E5S A;  1WVL A;  4NXN Q;  2XGT A;  5KIX A;  4Y7N H;  1BUV T;  3H3V I;  1WCM H;  5FOB B;  4MIU A;  4POF A;  5C3W A;  1SLJ A;  4OGQ C;  4DR6 Q;  1DGS A;  2JE6 I;  1MI2 A;  5HUR A;  4JV5 Q;  4JOI A;  2DJF C;  1V8Q A;  4A3M G;  4A3J B;  2D0O A;  1EZ6 A;  1XMQ Q;  1XTC D;  4BBR B;  1N36 Q;  2PW7 A;  2H4O A;  2KHI A;  3G48 A;  5EQ0 A;  4LMQ D;  1Q90 A;  2L5T A;  3IAY A;  3DM1 A;  5JJK A;  5ELO A;  4DR7 Q;  2M00 A;  4M8A A;  1TQO A;  2NVT H;  4RGO S;  3K57 A;  4ZUJ A;  3HOU G;  1CSQ A;  1PVO A;  3BDC A;  4PMC A;  3PO3 B;  4BS9 A;  5IYB G;  5D65 A;  1G6Z A;  4BWG B;  2PMZ E;  5M3F G;  5EKL A;  2BOS A;  2PPB C;  2PO4 A;  4FO2 A;  1MJE A;  1M8A A;  3PGZ A;  1X32 A;  4O42 A;  4BY1 H;  2NTS A;  3CW2 C;  5E3F A;  1GO3 E;  3K80 C;  2F0D A;  3EQL C;  4IUN A;  4LF8 Q;  1GKH A;  1P16 A;  2VS1 A;  3W2D A;  1EIF A;  2F0S A;  4JI8 Q;  1GUG A;  4ID6 A;  5KEE A;  3MAQ A;  2UXD Q;  1XJV A;  1ET6 A;  1YHA A;  5AJ3 L;  2QW7 A;  1CKO A;  4JPB W;  4QIW B;  5IP7 G;  1B9N A;  5EPL A;  3I4M G;  4C2M B;  5C3E H;  5LMN W;  1Q12 A;  4F7X A;  3EJI A;  2NYZ D;  2K5Q A;  3SHL A;  2VUM B;  2K6A A;  1FJG Q;  1SFO B;  4JK1 C;  4GNX C;  2E2D C;  1JT8 A;  3OIP A;  4HSV A;  3OTO L;  3KDF B; 
#chains in the Genus database with same CATH homology
 1IBM Q;  2PNH A;  4A3M H;  4YY3 L;  1CSP A;  5C0X J;  3I55 A;  1PH9 A;  2VUM G;  3HOW H;  2ALY B;  2PQA A;  2ZTC A;  4C3J H;  4LF6 L;  3NBH B;  1E7Z A;  2I0Q A;  4OWW B;  1XPU A;  4HJ7 A;  3TS2 A;  4A75 A;  3KJP A;  1CUK A;  4DR2 Q;  4GKJ Q;  4X64 L;  4A3J H;  5C4X H;  5FLX c;  1Z9F A;  5FJ8 G;  3GDE A;  3UE0 A;  4BBR H;  4YHH Q;  3D0F A;  1S72 A;  2VL6 A;  2ZM6 Q;  3KFU A;  4HIM A;  1KXL A;  3UDG A;  4AIM A;  1E22 A;  1VQD A;  1GM5 A;  4A3E G;  1XNQ L;  3HOU H;  2CQO A;  3M7N A;  1HNX L;  4JV5 L;  4DNI A;  1XTD A;  2UXB L;  2KBN A;  2CFM A;  3GTM H;  5M3F H;  1U0L A;  5C44 H;  4IFD G;  4GLV B;  4QJF A;  5IYD H;  3CAM A;  1E1O A;  1OXX K;  1YBY A;  4FDB A;  2ID0 A;  1K73 C;  3OYY A;  2IX0 A;  4UP7 A;  1PH4 A;  4BXX H;  3I7F A;  1LTL A;  3PO3 H;  2Q2I A;  1Y14 B;  3PUV A;  4OXP A;  1RIP A;  4LNQ A;  4DPG A;  1UWV A;  1VQ5 A;  2E2H H;  4LFA L;  4JI1 L;  5H1S E;  3JAM c;  2H5X A;  2K5H A;  3KJO A;  4DKA C;  1C9O A;  4PZ8 A;  4AQY L;  5C0X G;  4PZ6 A;  1V9P A;  2FXQ A;  1XPR A;  1VQE A;  3PCO B;  3I4O A;  3G71 A;  2I5H A;  4O2D A;  2OTL A;  3CCL A;  5IP7 H;  1KHI A;  3CCV A;  2JJQ A;  3W1B A;  2AKW B;  3KF8 B;  1J6Q A;  1NMG A;  4DV7 Q;  4GLX A;  2JA5 G;  2AWO A;  4YCV A;  4JI5 Q;  3I4M H;  5J3B A;  3S24 A;  5JEA G;  2Z6K A;  4A3C H;  5JJI A;  4KHZ A;  2JA8 G;  4LF4 L;  1VCI A;  2IY5 B;  4YCU A;  4K0K L;  1JJG A;  3GTQ H;  2K5V A;  2UUC Q;  3I56 A;  2HHH Q;  5BR8 L;  1YIJ A;  3F2B A;  4DV2 L;  4JI2 L;  3G4S A;  1X56 A;  1WJJ A;  3ZJY C;  3CCR A;  4P72 A;  3J81 c;  2RHS B;  1QVC A;  3I2Z A;  2MFI A;  4JI8 L;  3T1Y L;  3K0X A;  2F52 A;  4A3L H;  4H02 A;  1M90 C;  1GVP A;  2YTY A;  2K52 A;  4JI4 Q;  4MNO A;  2VUM H;  1PH3 A;  2HIX A;  3UDI A;  1SFO H;  1UE1 A;  4JI3 L;  1I94 L;  1YJ9 A;  5IE8 A;  1A62 A;  1N8R C;  1Y1V H;  1YHB A;  1WI5 A;  1VQA A;  1QVF A;  5LMN L;  4L5S A;  4C3I H;  2UUB Q;  3DM3 A;  4IPD A;  1I5F A;  1X3F A;  2UU9 L;  4LF7 L;  4DV6 Q;  3F8T A;  3RLN A;  4LF5 Q;  2JQO A;  4OWT B;  3T1H Q;  1SMX A;  4R1J A;  2KCM A;  3CXC A;  1VQI A;  3D31 A;  3BZC A;  1L2F A;  4A76 A;  3UE1 A;  1YJN A;  1PYB A;  3ERS X;  1K0R A;  1TWH H;  4YCW A;  1L0W A;  4DR1 Q;  1ASZ A;  4JYA L;  4HID A;  3J80 i;  4A3B H;  1K8G A;  2Y0S G;  2ZTE A;  4JI7 L;  4B3R Q;  4BA1 I;  4AYB E;  4A3K H;  3S14 H;  2A1A A;  2DGY A;  4QGU A;  2UUA Q;  4GN4 B;  4DAM A;  2K14 A;  1B7Y B;  3PUZ A;  1IBK L;  4DV0 L;  4JOI C;  2BH2 A;  4WJ4 A;  4HIO A;  1EQR A;  1PH6 A;  2YTV A;  4JBJ A;  4DUZ L;  3U4Z A;  4DR3 Q;  4BBS G;  1FL0 A;  3U58 A;  4GKJ L;  2YYZ A;  3U50 C;  2UXC L;  1VQL A;  3HFZ B;  1KRS A;  4YHH L;  1P8L A;  1HNZ L;  2A19 A;  3CP0 A;  1Q8K A;  4OO1 I;  2QGQ A;  1VQH A;  4B3M Q;  4DR4 Q;  1A0I A;  1HZC A;  2D62 A;  4P71 A;  4JBM A;  1XMO Q;  3PSI A;  1BKB A;  1ASY A;  3TQY A;  3S15 H;  4DK6 C;  1HZB A;  4DV4 L;  4GOP C;  4X6A H;  2WAQ E;  1VQC A;  1IYJ B;  3EIV A;  1NY4 A;  3STB D;  2JA8 H;  1G29 1;  3CCM A;  4GN5 A;  2R7Z G;  1HZ9 A;  3CCQ A;  3H15 A;  1QUQ A;  3HOY G;  4GOP B;  3AQQ A;  2R93 H;  4NXM Q;  4JI6 L;  4X66 Q;  4LF9 Q;  4LFB Q;  4GNX B;  4DV3 Q;  3PIP A;  2B3G A;  1SRU A;  4HJ9 A;  4EX5 A;  5HY6 A;  1L1O B;  3A5U A;  1MJC A;  3CC4 A;  4JCV E;  1O7I A;  3GD7 A;  1X3E A;  4A3I G;  1N33 Q;  4RG1 A;  1OTC A;  3S1M H;  3EN2 A;  4NXN L;  1VQ4 A;  2JEA I;  1B70 B;  3E9I A;  2NN6 G;  2R7F A;  3M85 A;  1Z47 A;  1VQJ A;  1VQM A;  1Q86 C;  4BY7 G;  2R7D A;  1JE5 A;  2L15 A;  5GQO A;  3H3V H;  4DR6 L;  1PHJ A;  3K7A H;  1YVC A;  3PV0 A;  2NVQ H;  2HHH L;  3GTK H;  1W3S A;  4LFC Q;  3S2D H;  3ER0 A;  1WYD A;  4PMW A;  3GTP H;  2LXK A;  2MO0 A;  3NEN A;  2E2I H;  5IYB H;  3PIO A;  1N34 Q;  2E5L Q;  1S3O A;  2EXD A;  2IHE A;  3L7Z C;  4NB3 A;  1KIX A;  2WAQ G;  1TWA H;  2I5M X;  2BA1 A;  2MQH A;  1XMQ L;  1N36 L;  4R4T A;  3ULL A;  2KEN A;  2K4K A;  1IBL Q;  1K83 H;  1EWI A;  3ULP A;  2HT1 A;  4P73 A;  1XNR Q;  1KRT A;  4X65 L;  3GO5 A;  4APV A;  1AE2 A;  1CKN A;  2JK8 A;  3I4N G;  2HIV A;  3CME A;  4BBS H;  3FP9 A;  5AJ3 Q;  2B63 G;  1D7Q A;  4DR7 L;  1MIU A;  1VQ9 A;  2ZJR A;  4L5Q A;  4LWC A;  3M3Y H;  5M5Y H;  3KF6 B;  3M9B A;  4GN3 B;  1VQN A;  5ELN A;  4KLK A;  1JJC B;  3RLO A;  5FLM G;  3T1H L;  1Q81 C;  3HKZ E;  4A3D G;  2E8G A;  1Q1E A;  1A8V A;  2AWN A;  3S1R H;  1G6P A;  2F4V Q;  1HJP A;  1PFS A;  4YWL A;  3A74 A;  4B3R L;  2RCN A;  2Y0S E;  3FKI G;  4MTN A;  5IT9 c;  3F2D A;  1VQK A;  4B3T Q;  1N32 L;  4QL5 A;  1G51 A;  3M4O H;  4P74 A;  3PUY A;  2BH8 A;  4DUY L;  2JA9 A;  2R7Z H;  1SRO A;  4YY3 Q;  4DR3 L;  1C7Y A;  4LF8 L;  2NZO A;  5LMU Q;  3HOY H;  1KC8 C;  2R92 G;  3WWV A;  3Q8D A;  4LF6 Q;  4B3S L;  2UXD L;  3GTO H;  5GAE C;  4A3F G;  1JMC A;  1PH1 A;  4GLA C;  4X64 Q;  2WFW A;  2YV5 A;  2VQF Q;  4B3M L;  4DR4 L;  1SN8 A;  1BBU A;  2GN5 A;  5HGQ A;  1QZH A;  5M5X H;  3CCE A;  4A3I H;  1SE8 A;  4J15 A;  2DUD A;  1NTG A;  3NEL A;  3HKS A;  4O0A A;  3PF4 A;  1T9H A;  4GS3 A;  2WB1 G;  2WP8 J;  3DLL A;  1OXV A;  3RZD H;  5FJ8 H;  3CC7 A;  1PH5 A;  3HOV G;  5M5W H;  3HKZ G;  4ME3 A;  1FJG L;  2VQE Q;  2JA6 G;  4BY7 H;  1NBW A;  2UXB Q;  3TEH B;  2VW9 A;  1KAW A;  4UP9 A;  1TWG H;  3CF5 A;  4A3E H;  2Z6K C;  4XTC S;  3PF5 A;  1PH2 A;  3KLW A;  4YWM A;  1XPO A;  1I3Q H;  2CWP A;  4X66 L;  1PV4 A;  1IBM L;  1X55 A;  2N78 A;  2OWO A;  2BA0 A;  3NEM A;  3A0J A;  1NMF A;  4JI1 Q;  1E1T A;  1K8A C;  1WFQ A;  4C3H H;  3CMA A;  1Q1B A;  1TXY A;  4AQY Q;  1EUJ A;  2Q2H A;  1JB7 A;  5IP9 G;  1MKH A;  4DR2 L;  4JI0 Q;  1N33 L;  3UDX A;  1OXS C;  4TQU S;  5IWA Q;  3CD6 A;  3I4N H;  3E0E A;  4R4Q A;  4HJ5 A;  4UPA A;  2B63 H;  3STB C;  1X6O A;  3AFQ A;  4X62 Q;  1YEZ A;  3KDF A;  2ZM6 L;  1YI2 A;  1HR0 W;  2OCE A;  1HR0 Q;  5JJL A;  1FGU A;  3CCU A;  4PZ7 A;  5FLM H;  4GNX A;  4A3D H;  4Y52 H;  4KHP Q;  3F1Z A;  1I50 H;  4WJ3 M;  1H95 A;  1HNW Q;  1L1O A;  2ES2 A;  3AFP A;  3LGJ A;  4LF4 Q;  2CWA A;  4K0K Q;  3S1Q H;  3MXN B;  2JA5 H;  4GKK Q;  1J5E Q;  3KOJ A;  3JAM i;  3FKI H;  4R4C A;  3PO3 G;  3S2H H;  4DV2 Q;  4JI2 Q;  2ASB A;  4R4I A;  1UE6 A;  1JJ2 A;  1BBW A;  4POG A;  3UDF A;  2MO1 A;  3GTG H;  2PI2 E;  1Q46 A;  1D8L A;  1WOC A;  1FVI A;  4XIG S;  4AH6 A;  3BJU A;  2MNA A;  3BU2 A;  2RF4 A;  3L2P A;  1PH7 A;  2R92 H;  1SR3 A;  3W5O A;  1I94 Q;  2B29 A;  1TWC H;  1OXT A;  4A3F H;  3BZK A;  2OTJ A;  1WCM G;  3A5Z B;  5LMN Q;  1B8A A;  2JA7 G;  1EQQ A;  2IT1 A;  3RZO H;  1EIY B;  2UU9 Q;  4IFD J;  4OO1 G;  1UE7 A;  2K5N A;  3H0G G;  3TRZ A;  4TVA B;  4DV7 L;  1E3P A;  3W1G A;  3E9H A;  2QEX A;  1CKM A;  4JI5 L;  2KCT A;  3J81 i;  1EOV A;  1KL9 A;  4JC0 A;  3F2C A;  1NE3 A;  3U4V A;  4A93 G;  4DV5 Q;  1YHQ A;  4JYA Q;  2AHO B;  3HOV H;  3HOZ G;  3J81 j;  4A3G G;  3CPF A;  3CPW A;  1KD1 C;  4IFD I;  2YTX A;  2JA6 H;  2UUC L;  4JI7 Q;  4IPH A;  3KF6 A;  1YNX A;  2EQS A;  1LM0 A;  2Z0S A;  4DK3 C;  5LMU L;  1XNR L;  2LXJ A;  2ZJP A;  1IBK Q;  1PH8 A;  2VZA A;  4DV0 Q;  2EIF A;  3GTL H;  4DUZ Q;  1Y1V G;  4JI4 L;  3RN5 A;  3J80 c;  4BA2 I;  4A4I A;  1A63 A;  1X54 A;  5C0X I;  2UXC Q;  2VQF L;  4LUV A;  4RMF A;  5JEA J;  1VQF A;  3PUX A;  5M3M G;  3K8A A;  1PYS B;  5E7N A;  2E2J H;  4OX9 Q;  4P75 A;  4DR5 Q;  3JC6 6;  3CCS A;  1W2B A;  1QUQ B;  5IP9 H;  4HJA A;  1IXR A;  1VQB A;  1HNZ Q;  2UUB L;  2I5L X;  2OQK A;  1V43 A;  5DLQ E;  4LW1 A;  1NJI C;  4DV6 L;  2WB1 E;  4LF5 L;  1Y1W G;  1HZA A;  4A3B G;  2IHF A;  5K36 G;  2VQE L;  1YJW A;  1QVG A;  3CCJ A;  2PQA B;  4EQ5 A;  2JEB I;  4DV1 Q;  4A3K G;  4DV4 Q;  2VY3 A;  1TWF H;  3GTJ H;  2Q2U A;  4DR1 L;  1VQ6 A;  2NZH A;  4BY1 G;  1X3G A;  3RN2 A;  1HH2 P;  3CQZ H;  3TS0 A;  2ZJQ A;  3HOX G;  4OON A;  3S16 H;  1AH9 A;  2UUA L;  1E24 A;  5IY0 A;  1C0A A;  3PO2 G;  1LYL A;  5C4J H;  1I6H H;  3TRE A;  1EYG A;  3OTO Q;  1V1Q A;  2V1C C;  4IJL A;  4JI6 Q;  2GVA A;  1UE5 A;  1KQS A;  1M1K C;  5IYC G;  4JBK A;  4JI0 L;  1GD7 A;  5IWA L;  4HJ8 A;  4LUO A;  1VS0 A;  1X9N A;  3SGI A;  4X62 L;  4QY7 A;  4OWX B;  5C3E G;  3PUW A;  3ICE A;  1HR0 L;  2AMC B;  4NXN Q;  2XGT A;  4Y7N H;  2KHJ A;  2Q2T A;  3H3V I;  1WCM H;  4IPG A;  4IO9 A;  3RNU A;  4POF A;  4KHP L;  1BVS A;  2JA7 H;  1HNW L;  1XMO L;  3K7U C;  1SLJ A;  1X65 A;  1PA6 A;  1U5K A;  1CKN B;  3H0G H;  1Q82 C;  2A8V A;  4DR6 Q;  3FHW A;  1DGS A;  1IL2 A;  2JE6 I;  4GKK L;  1J5E L;  1XNQ Q;  4A93 H;  2OQ0 A;  2ZTD A;  1S40 A;  2XTI A;  1HNX Q;  4JOI A;  4JV5 Q;  4IJH A;  3K81 C;  4C2M H;  3HOZ H;  2NVX H;  4A3G H;  2K75 A;  4A3M G;  3AEV A;  2NVY H;  2D0O A;  1UEB A;  1XMQ Q;  2N3S A;  1VQ7 A;  1N9W A;  2RHQ B;  1N36 Q;  3HOW G;  4L5R C;  4NXM L;  3RLF A;  4PG3 A;  4LF9 L;  1VQG A;  2KHI A;  1IZ6 A;  4X65 Q;  4LFB L;  3G48 A;  4NPS A;  2HQL A;  4DV3 L;  4ALP A;  4MZ9 A;  3J7Z C;  1K3R A;  3L0O A;  3M4P A;  3IRB A;  4LFA Q;  4A3J G;  5C4X G;  4IOA A;  1VQO A;  5JJK A;  4BBR G;  5ELO A;  3S1N H;  4DR7 Q;  2LSS A;  4QQB X;  5M3M H;  4HIK A;  5GAG C;  1RL2 A;  1YIT A;  2NVT H;  3OW2 A;  1OXU A;  4GOP A;  2C35 B;  3HOU G;  1CSQ A;  1AE3 A;  4QIW E;  4DV5 L;  4LUZ A;  1PVO A;  4YWK A;  1YZ6 A;  1LUZ A;  3M4Q A;  5IYB G;  1Y1W H;  2ATW A;  2PMZ E;  4IOC A;  5M3F G;  3EBE A;  1Q7Y C;  5C44 G;  2CKZ B;  3B6Y A;  4LFC L;  1R9T H;  1EFW A;  1N32 Q;  2VNU D;  2N8N A;  5IYD G;  1MJE A;  3J7A 5;  1N34 L;  4JG2 A;  2E5L L;  3PGZ A;  3G6E A;  4BY1 H;  3CW2 C;  4BXX G;  5GAH C;  1GO3 E;  3K80 C;  3RR5 A;  5GAD C;  5GRO A;  3HOX H;  5BR8 Q;  4DUY Q;  2QA4 A;  1IBL L;  3S17 H;  3PO2 H;  4LF8 Q;  2VS1 A;  1GKH A;  1P16 A;  4UP8 A;  4IPC A;  1EIF A;  3T1Y Q;  4JBW A;  4JI8 Q;  3CC2 A;  3KYH C;  1VQP A;  2YU9 H;  4DAY B;  4B3S Q;  2UXD Q;  4KI0 A;  5EAY A;  5IYC H;  4OX9 L;  4DR5 L;  1XJV A;  3AYH B;  1YHA A;  5AJ3 L;  2N49 A;  2PI2 A;  4JI3 Q;  1CKO A;  3ULJ A;  4AYB G;  5IP7 G;  4UY8 C;  2F3I A;  2K50 A;  2NN6 I;  3I4M G;  2R93 G;  4L5T A;  5C3E H;  5LMN W;  2IX1 A;  4DV1 L;  4A3C G;  1Q12 A;  2F4V L;  4LF7 Q;  2D0P A;  3VDY A;  3MEF A;  2R6G A;  1QZG A;  1VQ8 A;  2CCZ A;  1FJG Q;  4B3T L;  1JT8 A;  4GNX C;  1K9M C;  4R4O A;  3OTO L;  1L1O C;  2GVB A;  4A3L G;  3KDF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...