4DV6L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 16
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv6L00
3EN2A 3KDFA 4BBRH 4DV2Q 1VQ7A 3ICEA 4DR4Q 2JA8H 4BXXG 1PH8A 4AIMA 1K73C 4B3RL 1VQ4A 1HNZQ 4B3RQ 4PZ7A 1IL2A 4LFBQ 1S72A 4OWWB 3UDGA 4DUYQ 4ME3A 1MKHA 1QVCA 2ATWA 3KF6B 4KHPQ 2NZOA 4YHHL 3W5OA 3KJPA 4A3JH 4LF8L 1EUJA 2BA1A 3CPFA 4JBKA 4LF8Q 1PH3A 2K4KA 3KDFB 2ZJRA 1GM5A 3PGZA 2OQ0A 4A3CH 4LF7L 2R93H 3ULJA 3CD6A 2AHOB 2UXCQ 2CQOA 4P74A 4LF7Q 4A93H 4DNIA 4MNOA 4X6AH 2ALYB 1JB7A 2PI2A 4P71A 2Y0SE 2LSSA 5IY0A 1XTDA 4DR5L 2JA5G 3F8TA 3IRBA 4GNXA 1PH5A 2MO0A 4FDBA 2Z0SA 1AE2A 2ZTEA 3H0GG 2AMCB 4DR5Q 4L5RC 4QIWE 4OONA 3G71A 1HNWL 2Q2UA 1X6OA 2Z6KC 4BBSH 3PUXA 4O0AA 4QY7A 2K5HA 1I5FA 2D0PA 2VY3A 5E7NA 5AJ3L 3TS0A 2HIXA 4A3EG 3WWVA 1KQSA 1C7YA 2AWNA 3ZJYC 5M3MG 1XPOA 4Y52H 1VQ6A 4YWLA 3I4MH 4A3GH 1ASZA 1Y1VH 5C44H 4GNXB 1N32L 1B8AA 1S40A 1EIFA 3CCRA 4DV3Q 1IBLQ 4A3IH 1X56A 1Z47A 3U58A 1KRSA 3T1HL 3GTQH 1Q8KA 4BY7G 4IFDG 2D62A 4JC0A 2AWOA 3T1HQ 2NVQH 1X55A 4GKKL 3M4PA 1P8LA 1I3QH 4APVA 1MJEA 3SGIA 1B7YB 5IP7H 4AYBE 1QUQA 2ASBA 1HZ9A 4LUOA 5LMNL 2L15A 2Q2IA 4NPSA 4RMFA 3TS2A 2K52A 2D0OA 4R1JA 5LMNQ 4L5SA 3DM3A 3HOUH 3LGJA 4JV5L 2IX0A 1X3GA 4C2MH 4X65Q 1VQEA 1GVPA 3PV0A 2HIVA 1E22A 4IJHA 1UE7A 5GROA 3STBC 1QZGA 4BA2I 4BA1I 1QVGA 4JI2L 1LM0A 1WCMG 3F2BA 3PF4A 3M3YH 1KHIA 4R4IA 1A62A 4JI2Q 1EYGA 3PO2G 1AH9A 3PO3H 3CF5A 4GOPA 1NY4A 1V43A 1QUQB 2AKWB 2K50A 4YY3L 4JI5L 2F4VQ 4YY3Q 2Z6KA 4P72A 3HKSA 4JI5Q 1BBWA 2C35B 1PYBA 5IP9H 3NENA 2UXDL 3RNUA 3RLOA 3I2ZA 1VQKA 2KBNA 2K14A 4A3BG 2UXDQ 1Y1WH 3OTOL 4LUVA 1HJPA 3CPWA 4HJ8A 4JI6L 4PMWA 2VUMG 1WJJA 5GAHC 4BY1G 5C3EH 2UUAQ 4Y7NH 3HOWG 4YCWA 4GOPB 1PH7A 4KLKA 5IWAL 4LF6L 3W1BA 5IWAQ 4DV0L 3RN5A 2YTXA 4A3KG 2VZAA 1W2BA 4GLVB 4IJLA 1NBWA 4J15A 3VDYA 3PIOA 4DR3Q 3FKIH 2R92G 1K8GA 3D0FA 4DKAC 1SRUA 1XNQL 3HOXH 1NTGA 4A3DG 1VQPA 2E2JH 2MQHA 1TWFH 1XNQQ 3GTOH 2PQAB 4A3FH 3UE1A 4A75A 2N3SA 3J80i 1XMOL 2MFIA 1PH1A 3HOVH 3HOZH 4GNXC 4LUZA 1PH9A 2ID0A 1EQRA 4JYAQ 4JI7L 3T1YQ 3M4QA 3S24A 4AYBG 3S17H 1LTLA 2WFWA 3F2DA 1PV4A 2UUCL 1V1QA 4JI7Q 3U4VA 3EBEA 5C0XI 1I94L 2UUCQ 1C9OA 1CUKA 2VS1A 3PCOB 4DV4L 1I94Q 4DR6L 1A8VA 1UE1A 2LXJA 2VL6A 1PYSB 4PZ6A 2WB1E 4GN5A 2E2HH 2E2IH 5JJIA 4JBWA 1YHQA 3GO5A 3ULPA 3HOYH 3K0XA 4LF5Q 3KFUA 4R4QA 5FJ8H 3OYYA 1KC8C 1SE8A 5EAYA 2JA7G 1CKMA 1WI5A 5M3FG 2NVXH 5H1SE 1SN8A 2R7DA 4DUZL 3K80C 2JEAI 4O2DA 4R4OA 1MJCA 4HJ7A 2B63G 1GD7A 2CWPA 3STBD 4HIDA 1EQQA 3TEHB 1GO3E 3BU2A 1HR0L 1OXXK 4YHHQ 3S1RH 4LF9L 2VQFL 4BXXH 1JJGA 2IHEA 2ZTDA 4LF9Q 2VQFQ 4B3ML 1TXYA 4DR7L 3J81c 2B29A 4B3MQ 3RLFA 3GD7A 1L0WA 4DV6L 4JI8L 4JI4L 1N9WA 4DV6Q 1E1OA 2UUBL 5GAEC 4JI8Q 1J6QA 5LMNW 4ALPA 1DGSA 3L0OA 4GOPC 1PHJA 2HT1A 3I7FA 4WJ3M 5LMUL 4UP8A 2N8NA 3MEFA 4IFDJ 4NXNL 5LMUQ 1HNWQ 1U0LA 2JK8A 2RHSB 4DR1L 4NXNQ 4NXML 1NMGA 1YNXA 3E0EA 4DR1Q 1L1OC 4JCVE 3NBHB 1D8LA 1TWHH 2JA5H 2OWOA 1CSPA 2A8VA 5AJ3Q 2MO1A 4PG3A 4DAYB 3H0GH 1JE5A 2IY5B 3S1MH 5IYBG 1PH6A 2JA6G 3K8AA 1N32Q 2KCMA 1Q86C 3D31A 3U4ZA 1PFSA 4QL5A 5IYCG 4EQ5A 1EFWA 4A3EH 2R7ZG 1IYJB 4UP7A 5GQOA 1Z9FA 2F3IA 5M3MH 2WB1G 2YYZA 3J7ZC 4X62L 2PNHA 1K83H 5JEAG 4JI1L 4X62Q 4GKKQ 3S2DH 1A63A 4UPAA 3HKZE 4RG1A 4JI1Q 2GN5A 1BKBA 2MNAA 1SMXA 4IPGA 1TWCH 2ZTCA 3A5UA 4DR2L 1T9HA 1TWGH 4DV7L 1N36L 3H3VH 4QJFA 4DR2Q 1WFQA 5FLMH 2UU9L 4BY7H 1HZAA 4JV5Q 2BH8A 4AQYL 4X64L 1B70B 2XGTA 3I55A 2CKZB 3CMEA 1VQIA 3CAMA 3Q8DA 4YCVA 1HZCA 1YITA 3ERSX 3H15A 1KAWA 2ZJQA 1YHAA 1FGUA 2VQEL 4PZ8A 5BR8L 3JAMc 1E24A 4LFAL 3I56A 1OXTA 1X3FA 3K7AH 5M5YH 1PVOA 3S16H 1L1OA 3I4NG 4B3TL 3PUVA 4JI3L 3PO2H 1KXLA 3KF8B 1K3RA 1VQCA 3M4OH 1FL0A 4MTNA 2F52A 3OTOQ 1OXVA 4JI6Q 4OWXB 5DLQE 1JT8A 1VQHA 1PH2A 4R4CA 1W3SA 4QGUA 1ASYA 1Q12A 3PUYA 4LF6Q 2PQAA 4DV0Q 5C4JH 1UE6A 1JMCA 4A3MG 4A3BH 1L1OB 2VUMH 4NB3A 1EIYB 2UXBL 1VQNA 1VQBA 4BY1H 3HOWH 3KYHC 4QQBX 4X66L 2JJQA 2Q2HA 1SROA 3NEMA 4OWTB 1VQGA 4X66Q 1FJGL 1EWIA 4POGA 3CCQA 4A3KH 4HIMA 5IYDH 1GKHA 4GN3B 2NN6I 2K75A 1HR0W 3CCMA 5K36G 1XMOQ 1IBML 3RZOH 1CKOA 2R92H 3OW2A 2B3GA 3HKZG 4KHZA 2I5MX 1VQ8A 4B3SL 3B6YA 4OO1I 3AFPA 2KCTA 1VQFA 2PI2E 3BZKA 4A3DH 4K0KL 1H95A 4GN4B 1G51A 4L5QA 5C0XG 4IPHA 4A3LG 2CCZA 4DV4Q 4K0KQ 3FP9A 4C3IH 4DR6Q 1VCIA 3K7UC 1YVCA 1YZ6A 3S15H 4GS3A 5C4XG 1EOVA 3BJUA 1RL2A 2NZHA 5HY6A 4POFA 1YIJA 1VQLA 5HGQA 2ZM6L 1XPUA 1K9MC 1Q82C 4DV1L 3A74A 1LYLA 4DV1Q 4DUZQ 2KHJA 1R9TH 5JJLA 1VQ9A 3RZDH 2GVBA 5GAGC 4HJ5A 3AFQA 4BBRG 1E3PA 3TQYA 2JA8G 1JJCB 1N33L 3CCJA 2JA7H 4R4TA 3E9IA 2DUDA 5M3FH 1HR0Q 1N33Q 4IOAA 3ER0A 3S1NH 4LFCL 4DV5L 2HQLA 3PF5A 4LFCQ 1QVFA 4A76A 2I5LX 1XJVA 1M1KC 4DR4L 4HJ9A 2B63H 1UWVA 1S3OA 4A3JG 4UP9A 3FHWA 1KIXA 1HNZL 4JI4Q 4LNQA 2CFMA 5IE8A 1SFOH 2UUBQ 3S14H 4A3CG 4LFBL 2R93G 2EIFA 1YEZA 1XMQL 4KI0A 4DUYL 5ELOA 4LF4L 1D7QA 1Q81C 3PSIA 4A93G 3A5ZB 1XMQQ 1Q1BA 1HNXL 4LF4Q 4L5TA 4A4IA 4TVAB 2E8GA 4KHPL 1OTCA 3GTKH 1HNXQ 1PH4A 4DK6C 2QEXA 3CCSA 1O7IA 5FLXc 3J81i 3GTMH 5JEAJ 4NXMQ 3CC2A 3G6EA 2PMZE 3CP0A 3F1ZA 3TREA 1IZ6A 2K5NA 1Q46A 3GDEA 4JOIA 1YJNA 2UXCL 3JC66 4GLXA 3TRZA 4BBSG 3CCLA 2LXKA 3AYHB 1HZBA 1IXRA 1E7ZA 4C3JH 1OXUA 1NJIC 2QGQA 1V9PA 1OXSC 1PA6A 1KL9A 3L2PA 1IBKL 4JG2A 3S2HH 1I50H 3I4MG 1IBKQ 4A3GG 3NELA 2DGYA 1Y1VG 2KHIA 2IHFA 5C44G 4IO9A 1NE3A 3MXNB 2OCEA 5IYBH 2WP8J 3J81j 2JA6H 1SLJA 3UDXA 5M5XH 4A3IG 2BA0A 1I6HH 5IYCH 1JJ2A 4JBMA 2IT1A 1BVSA 4P75A 4AH6A 2FXQA 4DR7Q 1N36Q 2R7ZH 1YJWA 4DV7Q 2HHHL 3CCEA 1UEBA 2UU9Q 2A1AA 1X65A 2OTJA 2WAQE 1C0AA 1Y14B 2HHHQ 5IP7G 1HH2P 3H3VI 3L7ZC 4DV3L 3A0JA 1IBLL 3GTGH 4AQYQ 4IFDI 4X64Q 1MIUA 5IT9c 5FLMG 4OX9L 3UDIA 3HOUG 3I4OA 3CCUA 1P16A 4OX9Q 2OQKA 3G48A 4EX5A 4JBJA 2VQEQ 2R6GA 1X9NA 4OXPA 3CW2C 5BR8Q 1VQJA 4P73A 4C3HH 3CCVA 4LFAQ 1A0IA 2ES2A 1WCMH 3CC4A 3GTPH 3PO3G 2GVAA 1YI2A 1YBYA 4X65L 1L2FA 4B3TQ 2IX1A 3M7NA 3RN2A 4JI3Q 4YWKA 5M5WH 4UY8C 1XPRA 3HFZB 2OTLA 3S1QH 3CXCA 5IP9G 1VQDA 1N34L 4HIKA 1N34Q 3BZCA 2H5XA 5ELNA 3CMAA 3ULLA 3JAMi 1Y1WG 3I4NH 3EIVA 2F4VL 4JI0L 1K0RA 3RLNA 5C3EG 4MZ9A 1CKNA 2K5VA 1TWAH 1KD1C 2I0QA 1VS0A 3CQZH 4JI0Q 4LWCA 3GTJH 3KOJA 2UXBQ 1VQOA 2YU9H 3GTLH 3DLLA 5C0XJ 4IOCA 1SR3A 1K8AC 2Y0SG 2YV5A 1FJGQ 1FVIA 3UE0A 1WYDA 2UUAL 3J7A5 1XNRL 4A3MH 2EQSA 1BBUA 3KJOA 3E9HA 2E5LL 2JEBI 3FKIG 1XNRQ 1U5KA 4WJ4A 2NN6G 1E1TA 1VQ5A 2E5LQ 4IPCA 1CKNB 2BH2A 3PUZA 2XTIA 1RIPA 4XTCS 3J80c 1YHBA 5GADC 3HOXG 1IBMQ 3M9BA 3K81C 4DPGA 4YWMA 5IYDG 1J5EL 4A3FG 3G4SA 3HOVG 4DR3L 1J5EQ 4B3SQ 2NVTH 3AEVA 3HOZG 4OO1G 4HIOA 2VNUD 3PIPA 1X3EA 2VW9A 1N8RC 2WAQG 4JOIC 4GKJL 2RHQB 2N78A 3W1GA 4H02A 2Q2TA 4GKJQ 2QA4A 1NMFA 1AE3A 2V1CC 2N49A 2NVYH 3F2CA 1VQMA 2JE6I 4XIGS 1YJ9A 4LW1A 1M90C 1KRTA 2ZJPA 1Q7YC 1G291 2ZM6Q 4JYAL 1G6PA 3UDFA 3T1YL 4DK3C 4A3LH 4DAMA 5JJKA 3HOYG 2I5HA 3CC7A 1Q1EA 4YCUA 3U50C 5FJ8G 4GLAC 5C4XH 2KENA 2JQOA 4HJAA 2CWAA 3AQQA 3RR5A 2YTVA 2RF4A 1UE5A 1CSQA 1X54A 2RCNA 2EXDA 4TQUS 1QZHA 5J3BA 2A19A 4LF5L 3PUWA 3M85A 3KF6A 1WOCA 1VQAA 2YTYA 4DV5Q 2JA9A 3KLWA 4IPDA 2R7FA 4DV2L 1LUZA
chains in the Genus database with same CATH superfamily
3EN2A 4DV2Q 3ICEA 4B3RL 1SFOB 2EJMA 4B3RQ 3KK7A 1SNPA 3UDGA 3MZ5A 1MKHA 2ATWA 3KF6B 4KHPQ 2NZOA 4A3JH 4DA2A 4LF8L 3CPFA 5BN5A 2LFNA 4LF8Q 2HCCA 2K4KA 2NTSA 2ZJRA 1K8OA 3BVZA 3CD6A 2UXCQ 2Z9HA 4DNIA 3DEOA 4KKUA 4P71A 1RCVD 2LSSA 3F8TA 2B2WA 1RHPA 1H9MA 3NQIA 1LTTD 1X6OA 2QW7A 1SBBB 4J8QA 2ZXRA 1I5FA 2D0PA 4A3EG 5C6AA 1C7YA 2RSOA 5M3MG 1PRTD 2RVLA 1PZID 1I6VC 1S40A 4K5WA 3U9OA 5D14A 3MHBA 5I9PA 5IGFA 4DV3Q 2XWBB 1X56A 1Z47A 4IFDG 2EXZA 2BDNA 1LT5D 2EPBA 4APVA 1B7YB 5IP7H 4AYBE 4LUOA 3OWEB 2Q2IA 1LTSD 2NUCA 4NPSA 1EYAA 3DM3A 3E3XA 4JV5L 4X65Q 1VQEA 3CRKC 3PV0A 2HIVA 4IJHA 3STBC 3S1QB 1QZGA 4BA2I 3PF4A 4JI2L 1LM0A 2K28A 3M3YH 3M3YB 4JI2Q 1EYGA 1MSHA 3VYUA 3CF5A 2K50A 1TWAB 2Z6KA 1VDZA 3BYYB 4DF7A 3TP6A 3I3CA 2PO4A 2LKVA 1PYBA 3CKIB 3DWPA 2K14A 4F8MA 1B9NA 1PTOF 1STBA 1HJPA 4HJ8A 4PMWA 3T53B 3HOWG 1EEFD 1PH7A 4KLKA 2B2TA 3MVVA 4DV0L 1SYFA 3RN5A 2MGSA 2MJ8A 2QDBA 4H13C 3PIOA 1EFID 2DNCA 3FKIH 1CK1A 2R92G 2EY6A 1JC7A 4S3SA 2N3SA 4A75A 3A54A 4GNXC 1K28A 1PH9A 4KJOA 1S5ED 2K6AA 3M4QA 4AYBG 1PV4A 1ET9A 2F0JA 5C0XI 1EIHA 1A2UA 1J8IA 4K5VA 1UE1A 2EYMA 2WB1E 3RMHA 2DY7A 1HFNA 2NTTA 1YHQA 1DZ1A 3GO5A 5DAUA 3ULPA 2L5TA 1BCPC 4LF5Q 2NVXH 2KVMA 2NVXB 2KEEA 3K80C 2B63G 1LTRD 4HIDA 3BU2A 3S1RH 1QNKA 3S1RB 2ZTDA 1LV9A 4B3ML 1TXYA 3NXWA 2B29A 4B3MQ 1O7ZA 1L0WA 4FF4A 3NBHA 1N9WA 3IFTA 2CQAA 3E0JA 1DGSA 4GOPC 5I4DA 3I7FA 5LMUL 3P1HA 3MEFA 3MC0B 5LMUQ 4MTKA 1ML0D 3VR6A 5IGDA 3E0EA 1YNXA 1L1OC 4PV1C 4JCVE 5AJ3Q 1XX8A 5KNDA 3A55A 1KNEA 2IY5B 2HCIA 4B9XA 5IYBG 2LMCB 1SNOA 1ILQA 3A8IE 1N32Q 4A3EH 5EPKA 4A3EB 1IYJB 1IW7D 4UP7A 1Z9FA 5GQOA 5M3MH 2WB1G 2YYZA 3K0YA 4IUPA 4X62L 1FR3A 4X62Q 5DM63 2GN5A 1SMXA 3A5UA 3J7AV 1WFQA 3NHHA 4IFDH 3EVQA 2R3ZA 3K6OA 3FPUB 2KA7A 2SDFA 4X64L 3GV6A 1LACA 3CAMA 3Q8DA 2J7ZA 2Q8IB 1HZCA 1I4PA 1FGUA 3M4YA 2F03A 1GUWA 4PZ8A 5BR8L 3JAMc 5ELEA 1OXTA 1X3FA 2G9HD 3S16H 4B3TL 3S16B 5CC4A 5IGGA 2OF1A 4LK1C 1VQCA 3OTOQ 4IUTA 4IUUA 4K2LA 1A15A 3J81E 4LF6Q 4FF3A 5C4JH 1UE6A 5C4JB 1TS3A 2F0KA 2UXBL 3AB9A 1VQBA 5M9OA 3HOWH 4K6LA 4QQBX 4X66L 3HOWB 1LT6D 1SROA 2FJ2A 4X66Q 1EWIA 3PIO3 1EYCA 1LO5D 2E2JB 4CKCA 1CT1D 3CCMA 4B08A 3HOZB 1C4QA 5C5LA 2R92H 4QCLA 2B3GA 2R92B 2V4DA 4KHZA 2MUYA 4CGYB 2A73B 4OO1I 3AFPA 2PI2E 3IKJA 4I7AA 3C2PA 3VA7A 1G51A 5C0XG 3HRZC 4CDDC 1PYWD 2E2HB 2E2IB 1HCZA 3OIPA 3S15H 4K2KA 1O80A 2BE5D 3S15B 3BJUA 4UAIA 4AYBB 4U673 1EEID 2A69C 5HGQA 3MA2B 5KYLA 2ZM6L 4N9TA 4TRDA 3AU7A 3ND8A 4HJ5A 1PLFA 4WRDA 1E3PA 3TQYA 4OIJA 3OOCA 3E9IA 3ITPA 2F0MA 1PTOH 3K57A 2PPBC 3S1NH 2HQLA 4R9WA 2G9DA 2F0LA 3TN2A 3V2TA 1QVFA 3T16A 2DY8A 2B63H 2B63B 3FHWA 4KN7C 4JI4Q 2KCCA 2CFMA 5IE8A 3S14H 4A3CG 3OSOA 3S14B 5A2QL 1IYVA 1MD2D 4A93G 3A5ZB 1WVLA 1GUSA 4L5TA 1PH4A 4DK6C 2QEXA 1AZQA 5FLXc 4R8IA 2Z1CA 5JEAJ 4NXMQ 3CC2A 3G6EA 2CW0C 3TREA 1Q46A 3BDCA 2JA5B 2A68D 4FP5D 4YIJA 4BBSG 1DOMA 2X6GA 2Q8RE 1NJIC 3HP3A 4CDCC 1PA6A 5JPMC 3HS0C 1ENFA 1YNNC 4JG2A 1I50H 3Q22A 4O1NA 1I50B 2NBFA 3NELA 3I4MG 1Y1VG 5C44G 4IO9A 2EJGC 1JQYD 4N8FA 3G6JB 5IYBH 1SLJA 4A3IG 5M5XH 2Z6BA 5M5XB 2PCFB 4P75A 5A35A 2FXQA 1WTOA 2RSNA 4CHTB 1WTRA 2A1AA 2WAQE 2WB1B 1Y14B 2B8GA 4RGOS 3LX0A 1IBLL 4AQYQ 1R4QB 1B50A 1MIUA 2PW7A 3UDIA 3CCUA 2F0PA 1P16A 5T1IA 2OQKA 3G48A 4EX5A 3KBXA 1WTVA 4KD4A 1X9NA 4OXPA 3CCVA 2ES2A 3CC4A 1T5EA 1YBYA 1U4PA 1STEA 1SJED 3HGBA 4JI3Q 1ZEQX 1XPRA 2OTLA 3CXCA 1U4MA 4HAEA 4KKTA 5IP9G 4HSPA 4PMCA 1LTAD 4WJWA 5ELNA 1Q8IA 1Y1WG 1CKNA 2K5VA 1KD1C 1VQOA 2EE1A 4K8JA 4JPBW 4H44C 2YV5A 2O5JC 2IJ0A 1WYDA 1XNRL 1XNRQ 3E9HA 2E5LL 3FDTA 4WJ4A 1CQFA 1U5KA 2E5LQ 1EOTA 2XTIA 1RIPA 3TBIB 5GADC 5IIFA 3HOXG 1IBMQ 3K81C 5IYDG 1PRTC 3G4SA 4B3SQ 1SYGA 4RHRA 2NVTH 3I90A 2PNRC 4OO1G 2NVTB 3DWAA 2WAQG 4JOIC 5JOBA 1HA5A 4H02A 4WFN3 4CJ0B 2KHSA 5G3LF 5FOBB 2N49A 2NVYH 1VQMA 2NVYB 1YJ9A 2FHTA 1KRTA 4JYAL 2B2WC 5C3WA 5C0XH 5E1FA 2I5HA 5FJ8G 3VA5A 4HJAA 2YTVA 1LTGD 1OO9B 3PUWA 3KF6A 1WOCA 2A5HA 4EQPA 2H1EA 1M4VA 4IPDA 3SK4A 2OEOA 1LUZA 3QO2A 4X3KA 2EY2A 1VQ4A 3RD4A 4LFBQ 1EQTA 3HG9A 3WOEA 3SK6A 4XYQA 2ICIA 4NMZA 3QIAA 4YHHL 4L8JA 2QCPX 4N8X1 2BA1A 1A6XA 1Y8PB 4JBKA 3N6RA 3GTMB 1PH3A 3KDFB 4A3CH 1GM5A 3PGZA 1Q90A 4LF7L 1EZ6A 2HDLA 4LF7Q 2PQEA 4A93H 2E2DC 3OIQA 4G7ZC 3D6WA 1JB7A 1I4GA 4C3JB 1XTDA 4IALA 3IRBA 4FDBA 1AE2A 3H0GG 5CV6A 2AMCB 4L5RC 4FF1A 4OONA 5BN3A 1HNWL 5G3LD 4P2CB 2Z6KC 4BBSH 3PUXA 4QY7A 2JA6B 5E7NA 2HIXA 3WWVA 4RGMA 2O2LD 3IL8A 3I4MH 3I4MB 1Y1VH 3X3MA 5C44H 4GNXB 1Y1VB 1EIFA 2RKSA 3CCRA 4A3IH 1KRSA 3GTQH 1Q8KA 1EY0A 2D62A 4JC0A 2AWOA 1SSOA 2NVQH 4GKKL 2MPMA 3M4PA 3T4AC 1P8LA 1EWCA 1I3QH 1O78A 1IKLA 3VR3A 2RBMA 2DJGC 3GTPB 2D0OA 3K59A 1LABA 2GA4B 4C2MH 4C2MB 1NSNS 2HQEA 5GROA 1QVGA 1WCMG 4R4IA 5COYA 1K3BC 1E2WA 4K14A 3PO2G 5FKAC 1V43A 2EYPA 2F4VQ 3MFYA 4LJZC 1SMYD 2N88A 4OEMB 5IP9H 3QOLA 1HTPA 2KBNA 2F0TA 1Y1WH 3CPWA 4JI6L 1Y1WB 1WJJA 4BY1G 2UUAQ 4FVMA 4GOPB 2WINB 1SE3A 3NWTA 2YTXA 2VZAA 2DJFC 3R2IA 1W2BA 4EGVA 4MN3A 3NQTA 4J15A 3F2UA 1WTHA 1G8ZD 2RCFA 1NAPA 1IW7C 3HOXH 3QOJA 3HOXB 4A3DG 1HXYD 2IL8A 1TWFH 2MQHA 3QR8A 1TWFB 4C1NK 3J80i 4C3IG 2MFIA 4OO1H 2B39A 2ID0A 1EQRA 3MXUA 4JI7L 3T1YQ 1IYUA 3F2DA 4JI7Q 3DHQA 5C4XB 1TQOA 4DV4L 3PCOB 4DR6L 2VL6A 4PZ6A 1PZJD 4GN5A 1EY7A 4JBWA 2IX3A 1F9QA 4R4QA 5IT9L 5FJ8H 2O4XA 1KC8C 5EAYA 3MXGA 3MXPA 4G7HC 2JA7G 3M7GA 1ZXTA 5KIXA 1XYIA 1ZKOA 3I73A 1RODA 2EYJA 2L1BA 1CHPD 2F0WA 3Q6SA 1EQQA 1VMPA 1JICA 5T1GA 1HR0L 4A3JB 1JJGA 3L3OC 2IHEA 4ZKCB 1SXTA 1JOQA 4RHSA 5C3XA 5GAEC 5LMNW 1W6KA 3EROA 2HDMA 4WJ3M 1NCVA 3ND9A 2AQ2B 2N8NA 4ZYSA 4EVOA 4J6HA 4ZQ3A 2PZTA 1QNUA 3BS1A 1KTKA 1I4XA 1ESRA 1GXDC 2RQXA 4DAYB 3H0GH 3H0GB 1BOSA 3J80L 5I6WA 1RF2D 4IN3A 5IYCG 3U4ZA 1B3AA 2CHBD 2F0SA 1DCZA 1DOLA 4EQ5A 1EFWA 1D2BA 1KNAA 3CHBD 3R3OA 3Q0AA 2BE5C 3J7ZC 1STHA 2K1BA 1K83H 2N55A 5JEAG 1K83B 4ZKBB 1BKBA 2L4NA 5J1ZA 1TWCH 4DR2L 4DV7L 4DR2Q 2UU9L 2EZVA 4QUFA 1HZAA 3BZDB 3MAQA 1EZ8A 4JV5Q 1ZYRD 1ET6A 4C3HG 2Z4HA 1AN8A 1FNVA 1VQIA 4ABNA 4HMIA 1X3PA 2OT2A 2JXMB 1YITA 3ERSX 3H15A 2ZJQA 1UAPA 2A6ED 3KBGA 3FEWX 1S5CD 3I4NG 3PUVA 2JSOA 3PO2H 3PO2B 1FL0A 1WTPA 4OWXB 5DLQE 3TZDA 1VQHA 1KABA 1Q12A 3PUYA 3C3LA 2PQAA 4DV0Q 1EIGA 4A3MG 5BN4A 3KUPA 2IW3A 4M1UB 4BY1H 4IZ8A 1RD9D 4BY1B 3FVQA 3FKIB 1FJGL 2F3VA 5JPNC 3CCQA 1MI2A 3K5LA 2LY7A 1I4HA 2D9UA 2KCNA 2K75A 4QF4A 1JB3A 3D4DA 1CZGA 1JOOA 3RZOH 1CKOA 3T51B 1ONLA 3RZOB 3H94A 2KCTA 4A3DH 1VQFA 5EBCA 2L55A 2CCZA 3FP9A 4C3IH 1M8AA 4C3IB 3QWNA 3I8ZA 5ISRA 1JWSD 1EOVA 5F2DA 2NZHA 4POFA 1PFMA 5E4WC 4CDFC 1K9MC 1Q82C 4ME5A 3NPPA 1TY0A 2JP1A 4ZCKA 1R9TH 2B2YC 1R9TB 3OMGA 2M00A 4BBRG 2JA8G 3CCJA 2JA7H 4KHVA 4IOAA 2JA7B 2EDGA 5J39A 2I5LX 1M1KC 5E4XA 4DR4L 4CDEC 4UP9A 1KIXA 3TZUA 1HNZL 3CU7A 2AUKA 4DUYL 1EY4A 1Q1BA 1HNXL 1H9JA 2E8GA 1OTCA 3GTKH 1HNXQ 3C1EA 3CCSA 1PFBA 3L9AX 2PMZE 3CP0A 3F1ZA 4XDXA 2JYOA 2K5NA 3DMUA 5IODA 1A3UA 5CBAE 1YJNA 2F0OA 1E2VA 2IWHA 1IXRA 1E7ZA 1OXUA 3L2PA 2DNEA 2OXPA 4A3GG 3GP7A 2DGYA 2IHFA 5M3MB 3MXNB 3G7LA 2EOTA 5D65A 5ELBA 3NP8A 3R93A 1TU2B 3J81j 1B2TA 2BA0A 4HR7B 5IYCH 1JJ2A 4CBVA 4FYDA 3VR4A 2HHHL 4E6IA 1UEBA 1X65A 1HRJA 1GUGA 2HHHQ 5JEAH 4X64Q 2M9VA 5FLMG 3HOUG 4IQZA 2K03A 3K5OA 3CW2C 5BR8Q 4C3HH 1A0IA 4C3HB 5JVG3 1AFPA 2GVAA 1YI2A 1L2FA 4B3TQ 3M7NA 4YWKA 3SEBA 4UY8C 2CVRA 3HFZB 1STNA 2KEDA 1DONA 4O42A 3ULLA 3JAMi 3I4NH 1SYBA 4UHVA 5KNCA 3A8KE 1MGSA 5C3EG 2I0QA 1VS0A 1RJTA 5CORA 2LS01 2UXBQ 4FXGC 1FGBD 2YU9H 3N52A 2B2UC 4IOCA 1QCBD 1K8AC 2Y0SG 4G7OC 5FO8B 4A3MH 2EQSA 4BS9A 4DNTB 1ENCA 1QILA 4HTHA 4HN7A 4IPCA 5J22A 2XRSD 2MP1A 5AFWA 4KMUC 2EYLA 4DPGA 4HEDA 5CGKA 3DXJC 3HOVG 4DR3L 3OWFA 1JE4A 1QE6A 4EQOA 1X3EA 2VW9A 4GKJL 1GUTA 2E76C 3W1GA 3D4RA 3QB3A 5EQ0A 3OW7A 2Q2TA 4GKJQ 2QA4A 5I2XA 3VYTA 3F2CA 3PIP3 1EY6A 2F0FA 4KK7A 4XIGS 4LW1A 4MIUA 1G291 2ZM6Q 1UNSA 2F0QA 4ULLA 4DAMA 1CA6A 5IGEA 3HOYG 4RFBA 5EPJA 3CC7A 4YCUA 4V0BA 1J9OA 1AP0A 1TS4A 2RF4A 1CSQA 1X54A 2A19A 1GHKA 1PTOB 3M85A 3S1NB 1S5BD 3K5MA 5C4ZA 3KLWA 2R7FA 3KDFA 4BBRH 1VQ7A 4BBRB 1DOKA 2C9OA 2JA8H 1SMYC 2JA8B 3JAML 1LLRD 4PZ7A 1IL2A 1EY8A 1S72A 4OWWB 4ME3A 3OHXC 5EGTA 1QJOA 1QVCA 3W5OA 3KJPA 2F4IA 1ILPA 1V1OA 3KLSA 1KLUD 3ULJA 1B53A 4KD3A 2CQOA 3J7AF 1PFNA 4MNOA 1PXUA 4FXKC 4X6AH 3NTKA 2RA4A 2PI2A 5IY0A 2JN4A 2FFKB 1PH5A 4GNXA 1SNQA 2MO0A 3VR5A 4CJ1B 2PYKA 5ELCA 1D6EC 5HGTA 2Q2UA 5CV4A 5LHY1 2K5HA 3J80E 5CBEE 4Y52H 3ZJYC 1XPOA 1H9RA 4A3GH 1ASZA 4A3GB 1ICFB 4DGZA 3PQIA 4X3SA 4EQNA 5I2YA 3EQLC 4RA8A 1AEXA 1IBLQ 3U58A 4F87A 3T1HL 1X32A 3T1HQ 1F2LA 3MWYW 4K8IA 1X55A 2VB3X 3D4WA 4ODGA 3FPPA 3TS2A 4L5SA 4FF2A 3HOUH 3I4LA 4L6TB 1GVPA 1TKWB 4JK1C 1STAA 1KHIA 1A62A 1TY2A 1L0YB 3DUZA 4GOPA 2AKWB 1QUQB 4YY3L 4YY3Q 4G4KA 4P72A 3HKSA 2C35B 1TVXA 4L63B 3NENA 5KEEA 2UXDL 2Z8LA 1VQKA 3I2ZA 1QG7A 3EJIA 4A3BG 2UXDQ 3NTHA 2VUMG 1STYA 4LUVA 5C3EH 2PMZB 4YCWA 5IWAL 5L37A 3W1BA 5IWAQ 2QDLA 5FLXL 1I4RA 1XTCD 4A3KG 4GLVB 1NBWA 3VDYA 1HA6A 1F77A 2VB2X 3D0FA 4DKAC 1SRUA 1XNQL 5D3DA 1XNQQ 1PH1A 4Z9CB 1XMOL 3HOVH 2EVBA 3LNNA 1KDCA 4RGNA 4JYAQ 4CKBA 3V05A 1V1QA 3U4VA 1CQVA 3EBEA 3A56A 5LL6X 3UI2A 1CUKA 2FMMA 2VS1A 1ZYRC 2LXJA 4B9WA 1PYSB 4RH6A 5EBDA 4NKLA 3HOYH 3KFUA 2K7VA 2A6EC 4H0LC 2C5CA 3SHLA 3QG1A 3OYYA 1SE8A 1WI5A 2XRQD 2VXWA 4DUZL 1F2YA 4I7ZC 2XN9C 2JEAI 1B3QA 2SNSA 3BYTB 1MJCA 4KKSA 4O2DA 2F0EA 2CWPA 3TEHB 1BF4A 1CFMA 1GO3E 4YHHQ 4LF9L 4LF9Q 1B1ZA 3CRLC 3J81c 2I07B 2G5DA 1FNWA 3RLFA 4DV6L 5D3IB 1WD0A 2XVSA 4A93B 4JI8L 4DV6Q 1E1OA 2UUBL 4KTAA 1O7LA 4JI8Q 2AQ1B 1MSGA 4IUNA 1HNWQ 2JK8A 2RHSB 4BBSB 4DR1L 4NW2A 4DR1Q 1IHZA 1LT4D 1D8LA 2F1MA 2OWOA 1CSPA 2J4XA 5DM73 4PG3A 1Z6HA 1JE5A 2E74C 5CR3A 3C46A 5C44B 1JWUD 3K8AA 2B2TC 1Q86C 2F0HA 4QL5A 3BDLA 2R7ZG 4A3IB 3WDNA 2F3IA 4C1NI 3GTQB 4RWSC 4HCSA 1VMCA 1XWEA 2NVQB 4JI1L 1S4ZA 4GKKQ 3S2DH 1A63A 4UPAA 1I3QB 1Y8OB 3HKZE 4JI1Q 1BCPB 4DR7L 4IPGA 1N36L 3NBIA 4DN4M 1SNMA 2NB0A 4RKLA 3RUZA 1U4RA 2BH8A 2XGTA 3I55A 1BQQT 1STGA 2WKCA 3HEJA 3FMCA 2VQEL 4X3UA 1V1PB 1CI3M 1E24A 4LFAL 3SXHA 3I56A 3KF8B 5JJZA 3M4OH 2F52A 2F3WA 4JI6Q 3BVGA 3H09A 3EFXD 1JT8A 1ASYA 4OIKA 4QGUA 3H91A 1JMCA 2AQ3B 4A3BH 5EJWA 2A6HD 1L1OB 2VUMH 4NB3A 3J81L 2VUMB 4XT3B 3TP8A 1AZPA 3NK9A 1CTMA 2L11A 3T56B 3DM1A 5C4HA 2Q2HA 4OWTB 1CHQD 4A3KH 4HIMA 2X6LA 5IYDH 4A3KB 1SDFA 2NN6I 4DXFA 3W3AA 5K36G 3IAYA 1G2SA 4HCEA 1SAPA 3HKZG 2WAQB 1SEBD 3B6YA 5ELDA 1H95A 2FMCA 4GN4B 4L5QA 4PQXA 4IPHA 4A3LG 4DV4Q 4DR6Q 1F9SA 3K7UC 1YVCA 1YZ6A 3QJYA 4GS3A 4OELB 5HY6A 1RL2A 1VQLA 2EJFC 3H3VC 5KRUA 1XPUA 2F0UA 2R61A 5C5MA 2RDFA 1LYLA 2KHJA 2BOSA 1RDPD 5JJLA 3RZDH 3RZDB 3AFQA 1JJCB 4R4TA 3TP7A 1HR0Q 2EYOA 4RKBA 1Z7TA 3ZYYX 1WTXA 2D2CC 4DV5L 1WD1A 3J7YW 3PF5A 3X3NA 1HUNA 5EKIA 4DAVA 4HJ9A 1S3OA 5A2QE 2J0TD 4LNQA 1SFOH 2R93G 1XMQL 4KI0A 5ELOA 4LF4L 3Q24A 1Q81C 3PSIA 1XMQQ 4LF4Q 4KHPL 4A4IA 3A7AB 2KQ3A 3K5NA 1O7IA 3O13A 4QUCA 1I4QA 3MXNA 4JOIA 4KJNA 2K04A 2UXCL 1D5MC 3TRZA 3CCLA 2WIIB 2LXKA 3AYHB 1SYEA 1DM0B 1G91A 5HURA 2QGQA 1V9PA 5DNFA 2QILA 1KL9A 1IBKL 3SK8A 1IBKQ 4NDXA 1C8CA 2KHIA 3NTIA 1T5XD 1NE3A 1V8QA 2EY1A 3C1FA 2XWJB 1S5DD 1F2ZA 1I6HH 4HMJA 4JBMA 1I6HB 1TWCB 1VF5C 1WTWA 2R7ZH 2R7ZB 4DV7Q 1IKMA 3CCEA 2OTJA 1H9SB 2UU9Q 3H3VI 3L7ZC 4DV3L 3A0JA 3GTGH 3GTGB 3D6CA 1A3VA 2L12A 2WKDA 3I4OA 4IUQA 4OL7A 2Q8TA 4JBJA 1VQJA 4P73A 5CMDA 4KV6A 1TS2A 1WCMH 3PO3G 1BBXC 1WCMB 2K32A 1BXTA 1DXMA 4X65L 2IX1A 2F0IA 5M5WH 3S1QH 3PMFA 4ZUIA 5KNBA 5M5WB 1N34L 4HIKA 1N34Q 1D5ZC 2H5XA 3CMAA 4QMGA 3EIVA 1KLGD 4JI0L 1SNDA 2B2VA 4BWGB 3RLNA 4UDUC 2A68C 4MZ9A 1TWAH 4JI0Q 4DXGA 5FO9B 4LWCA 3GTJH 3P20A 3GTJB 3GTLH 3DLLA 1KDBA 3GTLB 5I9OA 1FD7D 1SR3A 1CA5A 3I91A 4KY5A 1FJGQ 1FVIA 5FLXE 1YNJD 3KJOA 2JEBI 4ILWA 4N9PA 3VR2A 2NN6G 3I72A 5KYIA 2BH2A 4XTCS 1YHBA 3M9BA 2KECA 1J5EL 1DYQA 5FK9C 4A3FG 1J5EQ 4A3DB 3HOZG 3PIPA 5K36H 1N8RC 4R8NA 1CZWA 4IURA 3HKZB 2JE6I 1KAAA 4F88A 4A3LH 4DK3C 3U50C 5JAVA 5NUCA 2KENA 2JQOA 2CWAA 3RR5A 3GQBA 1C48A 2EXDA 1QZHA 5J3BA 4LF5L 1JWMD 1LTBD 2YTYA 3MEHA 2JA9A 4Q5VA 4DR4Q 4ZUJA 1FNUA 4BXXG 1PH8A 4AIMA 1D1KA 1K73C 1HNZQ 1EU3A 1D1IA 2K33A 4DUYQ 1PTOD 1B9MA 4XXEA 1F9PA 3GTKB 3P7JA 1EUJA 1QWYA 1A3TA 2XNAC 1EL0A 2R93H 1SE4A 2OQ0A 2R93B 3MTSA 2AHOB 4P74A 2TSSA 4NP5A 2ALYB 2F0NA 3A7LA 4CKEA 2Y0SE 2PW5A 4K6DA 4DR5L 1PRTB 2JA5G 1LT3D 4RCOA 5IGBA 4DR5Q 2Z0SA 2ZTEA 2MHVA 4ZAIA 1HHVA 4QIWE 3G71A 1RTNA 4O0AA 2F0DA 2VY3A 5AJ3L 3TS0A 1KQSA 1EU4A 2AWNA 1VQ6A 1U4LA 4YWLA 1N32L 1RKNA 1B8AA 5CV7A 3LWEA 4BY7G 4F7XA 5E3FA 1MJEA 3SGIA 1QUQA 2ASBA 1HZ9A 5LMNL 2L15A 4RMFA 2K52A 4R1JA 4RGTA 1TR5A 5LMNQ 3LGJA 2IX0A 1X3GA 1BO0A 4PNYA 2K05A 4C56C 1E22A 4ZRZA 1UE7A 1EWHA 4BA1I 1E2ZA 3F2BA 4XQNA 1AH9A 3A8JE 3PO3H 1IL8A 2KUMA 3PO3B 1NY4A 3I4NB 1GHJA 3NUCA 4JI5L 1KDAA 4JI5Q 1BBWA 2YU9B 1HPCA 3SR1A 3RNUA 3RLOA 1PMRA 2QKIC 2RDHA 3OTOL 1GJXA 2TMPA 4JW0A 5GAHC 1BUVT 3DEPA 4A3MB 4Y7NH 4Y7NB 4LF6L 1FYCA 1TIID 1RTOA 2RDGA 4IJLA 3WOFA 4KY6A 4DR3Q 2NN6H 5JVH3 1K8GA 4FXDA 2KOLA 1NTGA 1VQPA 2E2JH 3TDQA 3GTOH 2PQAB 3W2DA 3UE1A 4A3FH 3GTOB 4A3FB 3HOZH 4LUZA 4G57A 3FRPB 3S24A 3S17H 4PMBA 1LTLA 1GOZA 2WFWA 2X69A 3LWUA 2UUCL 3S17B 1I94L 2UUCQ 1C9OA 2Z4IA 1I94Q 4DK0A 1A8VA 1EQVA 5IT9E 2E2HH 2E2IH 5JJIA 3K0XA 4HSVA 1ESFA 1HQMC 1E0BA 1CKMA 5M3FG 4XYOA 5KGUA 5H1SE 1SN8A 2R7DA 2PZUA 4R4OA 4HJ7A 1PDQA 2H4OA 1GD7A 1NUCA 3STBD 1OXXK 2VQFL 3KLRA 4BXXH 2EY5A 1DD2A 1BCPF 5EKKA 2VQFQ 1B44D 5CYUA 4WORA 2EYHA 1S5FD 3GD7A 3ERQA 2EYFA 3S9WA 2A6HC 4JI4L 3HZXA 4XT1B 1J6QA 4ALPA 4TKOB 1K8MA 2BDOA 3L0OA 1PHJA 2HT1A 4UP8A 1QOHA 4OGQC 5I6YA 4IFDJ 4NXNL 1U0LA 4C3JG 4NXNQ 2ZXPA 4NXML 3Q23A 1NMGA 5EPLA 3NBHB 3GV3A 1TWHH 2JA5H 2HUGA 1Y69U 1TWHB 2A8VA 2MO1A 1HTLD 2XIWA 1SYDA 3S1MH 1PH6A 3P75A 3ONAB 2JA6G 3S1MB 2KCMA 3D31A 1PFSA 4JVZA 2SOBA 1MBYA 4GZYC 2B2YA 2PNHA 5DEHA 2AUJD 2A74C 4LAAA 4RG1A 4DK1A 2XSCA 1AW7A 1GUOA 2MNAA 2ZTCA 1V1PA 1T9HA 1TWGH 3H3VH 1JCKB 1TWGB 4QJFA 5FLMH 4K5XA 3IFDA 4BY7H 3HOUB 3VYSA 1B4OA 4BY7B 2CH4A 4AQYL 3H6MA 1B70B 4IUVA 2CKZB 3TP5A 3KF8A 3CMEA 1G2TA 4YCVA 3V96A 1BCPD 1KAWA 2F0VA 1YHAA 2SNMA 3OPOA 2NZ1D 3NWSA 3K7AH 5M5YH 1PVOA 1G6ZA 2B8FA 1QB5D 3K7AB 1L1OA 5M5YB 4JI3L 1KXLA 1K3RA 4ZK9B 4MTNA 5LL6S 1EYDA 1OXVA 5C3EB 1BDOA 1II3A 1PH2A 4R4CA 1W3SA 3D8GA 4Q0FA 4XQJA 4RAUC 2IPKD 5CV5A 2Y0SB 3SVMA 3TSSA 1EIYB 1SE2A 1VQNA 1JR0D 3KYHC 4QIWB 5CV8A 3U9SA 2JJQA 1D5XC 3NEMA 1VQGA 3MFGA 1R4PB 3R8BA 4POGA 1UUPA 4OHJA 5TSSA 1GKHA 4GN3B 1HR0W 1SJHD 3I70A 2CH4W 1U9RA 3HOVB 1XMOQ 1IBML 2ENBA 1SYCA 3OW2A 4DNRB 2I5MX 1VQ8A 1Y8NB 4B3SL 2P5ZX 3BZKA 4K0KL 1Q3LA 1HUMA 3AMUA 4K0KQ 1NR2A 1BR9A 1VCIA 2PZWA 4LMQD 1F2MA 5C4XG 3HOYB 1L0XB 1YIJA 1NNXA 2NWGA 3NE5B 4FO2A 4RCNA 4H7BA 1SNCA 5FO7B 4DV1L 3A74A 4DV1Q 4DUZQ 1MHWC 1VQ9A 2GVBA 5GAGC 3E6ZX 1XXGA 2I46A 1N33L 2DN8A 5M3FH 2DUDA 1N33Q 5M3FB 3ER0A 4LFCL 2B2UA 4LFCQ 4A76A 1XJVA 1VF7A 1O7YA 4V190 1UWVA 2F0GA 4A3JG 4KN4C 4DAYA 2FINB 3BDOA 5CV9A 2UUBQ 1UEAB 4LFBL 1EY9A 2EIFA 1YEZA 1LTID 1D7QA 2M2LA 4TVAB 1JOKA 5K5PA 1A2TA 1HQRD 1YNJC 3J81i 3GTMH 1IZ6A 3GDEA 2K5DA 3JC66 3OMCA 4GLXA 5IGCA 2ZXOA 1HZBA 2K01A 2QF7A 4C3JH 1PZKD 2NYZD 1OXSC 1H9SA 2SEBD 4U68A 3S2HH 3S2HB 2B2VC 5EKLA 2OCEA 1GUNA 1X3QA 2WP8J 5ELFA 2JA6H 3S2DB 3UDXA 1HFGA 2IT1A 1BVSA 1DJRD 4AH6A 2K5QA 4DR7Q 3EA6A 1N36Q 1YJWA 4TSSA 2D5DA 1C0AA 5IP7G 1HH2P 1TS5A 1WTQA 4IFDI 2WV6D 5IOCA 5IT9c 4XQQA 4OX9L 4OX9Q 4MHEA 2A69D 1EY5A 2VQEQ 2R6GA 1CM9A 1ICWA 4LFAQ 3SK5A 3GTPH 1H9KA 4J1MA 1F9RA 3RN2A 4FNFA 3M4OB 4QB4A 1PTOC 2QEJC 3TMEA 1VQDA 3NSWA 3BZCA 2K5WA 2F4VL 1K0RA 2L9HA 2ZT9C 4DU9A 4A3BB 3CQZH 4I65A 4X3TA 3CQZB 3KOJA 5C0XJ 4CJ2C 4ZLTF 1JORA 3UE0A 2UUAL 3J7A5 1BBUA 2HD3A 3FKIG 1E1TA 2CW0D 1VQ5A 1CKNB 3PUZA 3J80c 2E75C 4YWMA 4KY7A 1ENAA 2BCOA 2WACA 3AEVA 4DAPA 4HIOA 2VNUD 1YNND 2RHQB 2N78A 3R2TA 2O5IC 1NMFA 1AE3A 3T13A 2V1CC 2L0CA 3DWQA 1M90C 2ZJPA 3E5SA 3KLSX 1Q7YC 1G6PA 3UDFA 3T1YL 5JJKA 1TT2A 1PRTF 1Q1EA 1K0SA 3K58A 4GLAC 5C4XH 3URYA 3VYRA 3SDZA 2ICEC 3AQQA 3D3RA 3BVMA 1UE5A 3BG3A 2RCNA 4TQUS 4DFAA 4ID6A 4M8AA 1NR4A 3SE0A 1VQAA 4DV5Q 1W6JA 2KJXA 3JAME 4DV2L 1BNZA
chains in the Genus database with same CATH topology
3EN2A 3KDFA 4BBRH 4DV2Q 1VQ7A 3ICEA 4DR4Q 2JA8H 4BXXG 1PH8A 4AIMA 1K73C 4B3RL 1VQ4A 1HNZQ 4B3RQ 4PZ7A 1IL2A 4LFBQ 1S72A 4OWWB 3UDGA 4DUYQ 4ME3A 1MKHA 1QVCA 2ATWA 3KF6B 4KHPQ 2NZOA 4YHHL 3W5OA 3KJPA 4A3JH 4LF8L 1EUJA 2BA1A 3CPFA 4JBKA 4LF8Q 1PH3A 2K4KA 3KDFB 2ZJRA 1GM5A 3PGZA 2OQ0A 4A3CH 4LF7L 2R93H 3ULJA 3CD6A 2AHOB 2UXCQ 2CQOA 4P74A 4LF7Q 4A93H 4DNIA 4MNOA 4X6AH 2ALYB 1JB7A 2PI2A 4P71A 2Y0SE 2LSSA 5IY0A 1XTDA 4DR5L 2JA5G 3F8TA 3IRBA 4GNXA 1PH5A 2MO0A 4FDBA 2Z0SA 1AE2A 2ZTEA 3H0GG 2AMCB 4DR5Q 4L5RC 4QIWE 4OONA 3G71A 1HNWL 2Q2UA 1X6OA 2Z6KC 4BBSH 3PUXA 4O0AA 4QY7A 2K5HA 1I5FA 2D0PA 2VY3A 5E7NA 5AJ3L 3TS0A 2HIXA 4A3EG 3WWVA 1KQSA 1C7YA 2AWNA 3ZJYC 5M3MG 1XPOA 4Y52H 1VQ6A 4YWLA 3I4MH 4A3GH 1ASZA 1Y1VH 5C44H 4GNXB 1N32L 1B8AA 1S40A 1EIFA 3CCRA 4DV3Q 1IBLQ 4A3IH 1X56A 1Z47A 3U58A 1KRSA 3T1HL 3GTQH 1Q8KA 4BY7G 4IFDG 2D62A 4JC0A 2AWOA 3T1HQ 2NVQH 1X55A 4GKKL 3M4PA 1P8LA 1I3QH 4APVA 1MJEA 3SGIA 1B7YB 5IP7H 4AYBE 1QUQA 2ASBA 1HZ9A 4LUOA 5LMNL 2L15A 2Q2IA 4NPSA 4RMFA 3TS2A 2K52A 2D0OA 4R1JA 5LMNQ 4L5SA 3DM3A 3HOUH 3LGJA 4JV5L 2IX0A 1X3GA 4C2MH 4X65Q 1VQEA 1GVPA 3PV0A 2HIVA 1E22A 4IJHA 1UE7A 5GROA 3STBC 1QZGA 4BA2I 4BA1I 1QVGA 4JI2L 1LM0A 1WCMG 3F2BA 3PF4A 3M3YH 1KHIA 4R4IA 1A62A 4JI2Q 1EYGA 3PO2G 1AH9A 3PO3H 3CF5A 4GOPA 1NY4A 1V43A 1QUQB 2AKWB 2K50A 4YY3L 4JI5L 2F4VQ 4YY3Q 2Z6KA 4P72A 3HKSA 4JI5Q 1BBWA 2C35B 1PYBA 5IP9H 3NENA 2UXDL 3RNUA 3RLOA 3I2ZA 1VQKA 2KBNA 2K14A 4A3BG 2UXDQ 1Y1WH 3OTOL 4LUVA 1HJPA 3CPWA 4HJ8A 4JI6L 4PMWA 2VUMG 1WJJA 5GAHC 4BY1G 5C3EH 2UUAQ 4Y7NH 3HOWG 4YCWA 4GOPB 1PH7A 4KLKA 5IWAL 4LF6L 3W1BA 5IWAQ 4DV0L 3RN5A 2YTXA 4A3KG 2VZAA 1W2BA 4GLVB 4IJLA 1NBWA 4J15A 3VDYA 3PIOA 4DR3Q 3FKIH 2R92G 1K8GA 3D0FA 4DKAC 1SRUA 1XNQL 3HOXH 1NTGA 4A3DG 1VQPA 2E2JH 2MQHA 1TWFH 1XNQQ 3GTOH 2PQAB 4A3FH 3UE1A 4A75A 2N3SA 3J80i 1XMOL 2MFIA 1PH1A 3HOVH 3HOZH 4GNXC 4LUZA 1PH9A 2ID0A 1EQRA 4JYAQ 4JI7L 3T1YQ 3M4QA 3S24A 4AYBG 3S17H 1LTLA 2WFWA 3F2DA 1PV4A 2UUCL 1V1QA 4JI7Q 3U4VA 3EBEA 5C0XI 1I94L 2UUCQ 1C9OA 1CUKA 2VS1A 3PCOB 4DV4L 1I94Q 4DR6L 1A8VA 1UE1A 2LXJA 2VL6A 1PYSB 4PZ6A 2WB1E 4GN5A 2E2HH 2E2IH 5JJIA 4JBWA 1YHQA 3GO5A 3ULPA 3HOYH 3K0XA 4LF5Q 3KFUA 4R4QA 5FJ8H 3OYYA 1KC8C 1SE8A 5EAYA 2JA7G 1CKMA 1WI5A 5M3FG 2NVXH 5H1SE 1SN8A 2R7DA 4DUZL 3K80C 2JEAI 4O2DA 4R4OA 1MJCA 4HJ7A 2B63G 1GD7A 2CWPA 3STBD 4HIDA 1EQQA 3TEHB 1GO3E 3BU2A 1HR0L 1OXXK 4YHHQ 3S1RH 4LF9L 2VQFL 4BXXH 1JJGA 2IHEA 2ZTDA 4LF9Q 2VQFQ 4B3ML 1TXYA 4DR7L 3J81c 2B29A 4B3MQ 3RLFA 3GD7A 1L0WA 4DV6L 4JI8L 4JI4L 1N9WA 4DV6Q 1E1OA 2UUBL 5GAEC 4JI8Q 1J6QA 5LMNW 4ALPA 1DGSA 3L0OA 4GOPC 1PHJA 2HT1A 3I7FA 4WJ3M 5LMUL 4UP8A 2N8NA 3MEFA 4IFDJ 4NXNL 5LMUQ 1HNWQ 1U0LA 2JK8A 2RHSB 4DR1L 4NXNQ 4NXML 1NMGA 1YNXA 3E0EA 4DR1Q 1L1OC 4JCVE 3NBHB 1D8LA 1TWHH 2JA5H 2OWOA 1CSPA 2A8VA 5AJ3Q 2MO1A 4PG3A 4DAYB 3H0GH 1JE5A 2IY5B 3S1MH 5IYBG 1PH6A 2JA6G 3K8AA 1N32Q 2KCMA 1Q86C 3D31A 3U4ZA 1PFSA 4QL5A 5IYCG 4EQ5A 1EFWA 4A3EH 2R7ZG 1IYJB 4UP7A 5GQOA 1Z9FA 2F3IA 5M3MH 2WB1G 2YYZA 3J7ZC 4X62L 2PNHA 1K83H 5JEAG 4JI1L 4X62Q 4GKKQ 3S2DH 1A63A 4UPAA 3HKZE 4RG1A 4JI1Q 2GN5A 1BKBA 2MNAA 1SMXA 4IPGA 1TWCH 2ZTCA 3A5UA 4DR2L 1T9HA 1TWGH 4DV7L 1N36L 3H3VH 4QJFA 4DR2Q 1WFQA 5FLMH 2UU9L 4BY7H 1HZAA 4JV5Q 2BH8A 4AQYL 4X64L 1B70B 2XGTA 3I55A 2CKZB 3CMEA 1VQIA 3CAMA 3Q8DA 4YCVA 1HZCA 1YITA 3ERSX 3H15A 1KAWA 2ZJQA 1YHAA 1FGUA 2VQEL 4PZ8A 5BR8L 3JAMc 1E24A 4LFAL 3I56A 1OXTA 1X3FA 3K7AH 5M5YH 1PVOA 3S16H 1L1OA 3I4NG 4B3TL 3PUVA 4JI3L 3PO2H 1KXLA 3KF8B 1K3RA 1VQCA 3M4OH 1FL0A 4MTNA 2F52A 3OTOQ 1OXVA 4JI6Q 4OWXB 5DLQE 1JT8A 1VQHA 1PH2A 4R4CA 1W3SA 4QGUA 1ASYA 1Q12A 3PUYA 4LF6Q 2PQAA 4DV0Q 5C4JH 1UE6A 1JMCA 4A3MG 4A3BH 1L1OB 2VUMH 4NB3A 1EIYB 2UXBL 1VQNA 1VQBA 4BY1H 3HOWH 3KYHC 4QQBX 4X66L 2JJQA 2Q2HA 1SROA 3NEMA 4OWTB 1VQGA 4X66Q 1FJGL 1EWIA 4POGA 3CCQA 4A3KH 4HIMA 5IYDH 1GKHA 4GN3B 2NN6I 2K75A 1HR0W 3CCMA 5K36G 1XMOQ 1IBML 3RZOH 1CKOA 2R92H 3OW2A 2B3GA 3HKZG 4KHZA 2I5MX 1VQ8A 4B3SL 3B6YA 4OO1I 3AFPA 2KCTA 1VQFA 2PI2E 3BZKA 4A3DH 4K0KL 1H95A 4GN4B 1G51A 4L5QA 5C0XG 4IPHA 4A3LG 2CCZA 4DV4Q 4K0KQ 3FP9A 4C3IH 4DR6Q 1VCIA 3K7UC 1YVCA 1YZ6A 3S15H 4GS3A 5C4XG 1EOVA 3BJUA 1RL2A 2NZHA 5HY6A 4POFA 1YIJA 1VQLA 5HGQA 2ZM6L 1XPUA 1K9MC 1Q82C 4DV1L 3A74A 1LYLA 4DV1Q 4DUZQ 2KHJA 1R9TH 5JJLA 1VQ9A 3RZDH 2GVBA 5GAGC 4HJ5A 3AFQA 4BBRG 1E3PA 3TQYA 2JA8G 1JJCB 1N33L 3CCJA 2JA7H 4R4TA 3E9IA 2DUDA 5M3FH 1HR0Q 1N33Q 4IOAA 3ER0A 3S1NH 4LFCL 4DV5L 2HQLA 3PF5A 4LFCQ 1QVFA 4A76A 2I5LX 1XJVA 1M1KC 4DR4L 4HJ9A 2B63H 1UWVA 1S3OA 4A3JG 4UP9A 3FHWA 1KIXA 1HNZL 4JI4Q 4LNQA 2CFMA 5IE8A 1SFOH 2UUBQ 3S14H 4A3CG 4LFBL 2R93G 2EIFA 1YEZA 1XMQL 4KI0A 4DUYL 5ELOA 4LF4L 1D7QA 1Q81C 3PSIA 4A93G 3A5ZB 1XMQQ 1Q1BA 1HNXL 4LF4Q 4L5TA 4A4IA 4TVAB 2E8GA 4KHPL 1OTCA 3GTKH 1HNXQ 1PH4A 4DK6C 2QEXA 3CCSA 1O7IA 5FLXc 3J81i 3GTMH 5JEAJ 4NXMQ 3CC2A 3G6EA 2PMZE 3CP0A 3F1ZA 3TREA 1IZ6A 2K5NA 1Q46A 3GDEA 4JOIA 1YJNA 2UXCL 3JC66 4GLXA 3TRZA 4BBSG 3CCLA 2LXKA 3AYHB 1HZBA 1IXRA 1E7ZA 4C3JH 1OXUA 1NJIC 2QGQA 1V9PA 1OXSC 1PA6A 1KL9A 3L2PA 1IBKL 4JG2A 3S2HH 1I50H 3I4MG 1IBKQ 4A3GG 3NELA 2DGYA 1Y1VG 2KHIA 2IHFA 5C44G 4IO9A 1NE3A 3MXNB 2OCEA 5IYBH 2WP8J 3J81j 2JA6H 1SLJA 3UDXA 5M5XH 4A3IG 2BA0A 1I6HH 5IYCH 1JJ2A 4JBMA 2IT1A 1BVSA 4P75A 4AH6A 2FXQA 4DR7Q 1N36Q 2R7ZH 1YJWA 4DV7Q 2HHHL 3CCEA 1UEBA 2UU9Q 2A1AA 1X65A 2OTJA 2WAQE 1C0AA 1Y14B 2HHHQ 5IP7G 1HH2P 3H3VI 3L7ZC 4DV3L 3A0JA 1IBLL 3GTGH 4AQYQ 4IFDI 4X64Q 1MIUA 5IT9c 5FLMG 4OX9L 3UDIA 3HOUG 3I4OA 3CCUA 1P16A 4OX9Q 2OQKA 3G48A 4EX5A 4JBJA 2VQEQ 2R6GA 1X9NA 4OXPA 3CW2C 5BR8Q 1VQJA 4P73A 4C3HH 3CCVA 4LFAQ 1A0IA 2ES2A 1WCMH 3CC4A 3GTPH 3PO3G 2GVAA 1YI2A 1YBYA 4X65L 1L2FA 4B3TQ 2IX1A 3M7NA 3RN2A 4JI3Q 4YWKA 5M5WH 4UY8C 1XPRA 3HFZB 2OTLA 3S1QH 3CXCA 5IP9G 1VQDA 1N34L 4HIKA 1N34Q 3BZCA 2H5XA 5ELNA 3CMAA 3ULLA 3JAMi 1Y1WG 3I4NH 3EIVA 2F4VL 4JI0L 1K0RA 3RLNA 5C3EG 4MZ9A 1CKNA 2K5VA 1TWAH 1KD1C 2I0QA 1VS0A 3CQZH 4JI0Q 4LWCA 3GTJH 3KOJA 2UXBQ 1VQOA 2YU9H 3GTLH 3DLLA 5C0XJ 4IOCA 1SR3A 1K8AC 2Y0SG 2YV5A 1FJGQ 1FVIA 3UE0A 1WYDA 2UUAL 3J7A5 1XNRL 4A3MH 2EQSA 1BBUA 3KJOA 3E9HA 2E5LL 2JEBI 3FKIG 1XNRQ 1U5KA 4WJ4A 2NN6G 1E1TA 1VQ5A 2E5LQ 4IPCA 1CKNB 2BH2A 3PUZA 2XTIA 1RIPA 4XTCS 3J80c 1YHBA 5GADC 3HOXG 1IBMQ 3M9BA 3K81C 4DPGA 4YWMA 5IYDG 1J5EL 4A3FG 3G4SA 3HOVG 4DR3L 1J5EQ 4B3SQ 2NVTH 3AEVA 3HOZG 4OO1G 4HIOA 2VNUD 3PIPA 1X3EA 2VW9A 1N8RC 2WAQG 4JOIC 4GKJL 2RHQB 2N78A 3W1GA 4H02A 2Q2TA 4GKJQ 2QA4A 1NMFA 1AE3A 2V1CC 2N49A 2NVYH 3F2CA 1VQMA 2JE6I 4XIGS 1YJ9A 4LW1A 1M90C 1KRTA 2ZJPA 1Q7YC 1G291 2ZM6Q 4JYAL 1G6PA 3UDFA 3T1YL 4DK3C 4A3LH 4DAMA 5JJKA 3HOYG 2I5HA 3CC7A 1Q1EA 4YCUA 3U50C 5FJ8G 4GLAC 5C4XH 2KENA 2JQOA 4HJAA 2CWAA 3AQQA 3RR5A 2YTVA 2RF4A 1UE5A 1CSQA 1X54A 2RCNA 2EXDA 4TQUS 1QZHA 5J3BA 2A19A 4LF5L 3PUWA 3M85A 3KF6A 1WOCA 1VQAA 2YTYA 4DV5Q 2JA9A 3KLWA 4IPDA 2R7FA 4DV2L 1LUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EN2 A;  3KDF A;  4BBR H;  4DV2 Q;  1VQ7 A;  3ICE A;  4DR4 Q;  2JA8 H;  4BXX G;  1PH8 A;  4AIM A;  1K73 C;  4B3R L;  1VQ4 A;  1HNZ Q;  4B3R Q;  4PZ7 A;  1IL2 A;  4LFB Q;  1S72 A;  4OWW B;  3UDG A;  4DUY Q;  4ME3 A;  1MKH A;  1QVC A;  2ATW A;  3KF6 B;  4KHP Q;  2NZO A;  4YHH L;  3W5O A;  3KJP A;  4A3J H;  4LF8 L;  1EUJ A;  2BA1 A;  3CPF A;  4JBK A;  4LF8 Q;  1PH3 A;  2K4K A;  3KDF B;  2ZJR A;  1GM5 A;  3PGZ A;  2OQ0 A;  4A3C H;  4LF7 L;  2R93 H;  3ULJ A;  3CD6 A;  2AHO B;  2UXC Q;  2CQO A;  4P74 A;  4LF7 Q;  4A93 H;  4DNI A;  4MNO A;  4X6A H;  2ALY B;  1JB7 A;  2PI2 A;  4P71 A;  2Y0S E;  2LSS A;  5IY0 A;  1XTD A;  4DR5 L;  2JA5 G;  3F8T A;  3IRB A;  4GNX A;  1PH5 A;  2MO0 A;  4FDB A;  2Z0S A;  1AE2 A;  2ZTE A;  3H0G G;  2AMC B;  4DR5 Q;  4L5R C;  4QIW E;  4OON A;  3G71 A;  1HNW L;  2Q2U A;  1X6O A;  2Z6K C;  4BBS H;  3PUX A;  4O0A A;  4QY7 A;  2K5H A;  1I5F A;  2D0P A;  2VY3 A;  5E7N A;  5AJ3 L;  3TS0 A;  2HIX A;  4A3E G;  3WWV A;  1KQS A;  1C7Y A;  2AWN A;  3ZJY C;  5M3M G;  1XPO A;  4Y52 H;  1VQ6 A;  4YWL A;  3I4M H;  4A3G H;  1ASZ A;  1Y1V H;  5C44 H;  4GNX B;  1N32 L;  1B8A A;  1S40 A;  1EIF A;  3CCR A;  4DV3 Q;  1IBL Q;  4A3I H;  1X56 A;  1Z47 A;  3U58 A;  1KRS A;  3T1H L;  3GTQ H;  1Q8K A;  4BY7 G;  4IFD G;  2D62 A;  4JC0 A;  2AWO A;  3T1H Q;  2NVQ H;  1X55 A;  4GKK L;  3M4P A;  1P8L A;  1I3Q H;  4APV A;  1MJE A;  3SGI A;  1B7Y B;  5IP7 H;  4AYB E;  1QUQ A;  2ASB A;  1HZ9 A;  4LUO A;  5LMN L;  2L15 A;  2Q2I A;  4NPS A;  4RMF A;  3TS2 A;  2K52 A;  2D0O A;  4R1J A;  5LMN Q;  4L5S A;  3DM3 A;  3HOU H;  3LGJ A;  4JV5 L;  2IX0 A;  1X3G A;  4C2M H;  4X65 Q;  1VQE A;  1GVP A;  3PV0 A;  2HIV A;  1E22 A;  4IJH A;  1UE7 A;  5GRO A;  3STB C;  1QZG A;  4BA2 I;  4BA1 I;  1QVG A;  4JI2 L;  1LM0 A;  1WCM G;  3F2B A;  3PF4 A;  3M3Y H;  1KHI A;  4R4I A;  1A62 A;  4JI2 Q;  1EYG A;  3PO2 G;  1AH9 A;  3PO3 H;  3CF5 A;  4GOP A;  1NY4 A;  1V43 A;  1QUQ B;  2AKW B;  2K50 A;  4YY3 L;  4JI5 L;  2F4V Q;  4YY3 Q;  2Z6K A;  4P72 A;  3HKS A;  4JI5 Q;  1BBW A;  2C35 B;  1PYB A;  5IP9 H;  3NEN A;  2UXD L;  3RNU A;  3RLO A;  3I2Z A;  1VQK A;  2KBN A;  2K14 A;  4A3B G;  2UXD Q;  1Y1W H;  3OTO L;  4LUV A;  1HJP A;  3CPW A;  4HJ8 A;  4JI6 L;  4PMW A;  2VUM G;  1WJJ A;  5GAH C;  4BY1 G;  5C3E H;  2UUA Q;  4Y7N H;  3HOW G;  4YCW A;  4GOP B;  1PH7 A;  4KLK A;  5IWA L;  4LF6 L;  3W1B A;  5IWA Q;  4DV0 L;  3RN5 A;  2YTX A;  4A3K G;  2VZA A;  1W2B A;  4GLV B;  4IJL A;  1NBW A;  4J15 A;  3VDY A;  3PIO A;  4DR3 Q;  3FKI H;  2R92 G;  1K8G A;  3D0F A;  4DKA C;  1SRU A;  1XNQ L;  3HOX H;  1NTG A;  4A3D G;  1VQP A;  2E2J H;  2MQH A;  1TWF H;  1XNQ Q;  3GTO H;  2PQA B;  4A3F H;  3UE1 A;  4A75 A;  2N3S A;  3J80 i;  1XMO L;  2MFI A;  1PH1 A;  3HOV H;  3HOZ H;  4GNX C;  4LUZ A;  1PH9 A;  2ID0 A;  1EQR A;  4JYA Q;  4JI7 L;  3T1Y Q;  3M4Q A;  3S24 A;  4AYB G;  3S17 H;  1LTL A;  2WFW A;  3F2D A;  1PV4 A;  2UUC L;  1V1Q A;  4JI7 Q;  3U4V A;  3EBE A;  5C0X I;  1I94 L;  2UUC Q;  1C9O A;  1CUK A;  2VS1 A;  3PCO B;  4DV4 L;  1I94 Q;  4DR6 L;  1A8V A;  1UE1 A;  2LXJ A;  2VL6 A;  1PYS B;  4PZ6 A;  2WB1 E;  4GN5 A;  2E2H H;  2E2I H;  5JJI A;  4JBW A;  1YHQ A;  3GO5 A;  3ULP A;  3HOY H;  3K0X A;  4LF5 Q;  3KFU A;  4R4Q A;  5FJ8 H;  3OYY A;  1KC8 C;  1SE8 A;  5EAY A;  2JA7 G;  1CKM A;  1WI5 A;  5M3F G;  2NVX H;  5H1S E;  1SN8 A;  2R7D A;  4DUZ L;  3K80 C;  2JEA I;  4O2D A;  4R4O A;  1MJC A;  4HJ7 A;  2B63 G;  1GD7 A;  2CWP A;  3STB D;  4HID A;  1EQQ A;  3TEH B;  1GO3 E;  3BU2 A;  1HR0 L;  1OXX K;  4YHH Q;  3S1R H;  4LF9 L;  2VQF L;  4BXX H;  1JJG A;  2IHE A;  2ZTD A;  4LF9 Q;  2VQF Q;  4B3M L;  1TXY A;  4DR7 L;  3J81 c;  2B29 A;  4B3M Q;  3RLF A;  3GD7 A;  1L0W A;  4DV6 L;  4JI8 L;  4JI4 L;  1N9W A;  4DV6 Q;  1E1O A;  2UUB L;  5GAE C;  4JI8 Q;  1J6Q A;  5LMN W;  4ALP A;  1DGS A;  3L0O A;  4GOP C;  1PHJ A;  2HT1 A;  3I7F A;  4WJ3 M;  5LMU L;  4UP8 A;  2N8N A;  3MEF A;  4IFD J;  4NXN L;  5LMU Q;  1HNW Q;  1U0L A;  2JK8 A;  2RHS B;  4DR1 L;  4NXN Q;  4NXM L;  1NMG A;  1YNX A;  3E0E A;  4DR1 Q;  1L1O C;  4JCV E;  3NBH B;  1D8L A;  1TWH H;  2JA5 H;  2OWO A;  1CSP A;  2A8V A;  5AJ3 Q;  2MO1 A;  4PG3 A;  4DAY B;  3H0G H;  1JE5 A;  2IY5 B;  3S1M H;  5IYB G;  1PH6 A;  2JA6 G;  3K8A A;  1N32 Q;  2KCM A;  1Q86 C;  3D31 A;  3U4Z A;  1PFS A;  4QL5 A;  5IYC G;  4EQ5 A;  1EFW A;  4A3E H;  2R7Z G;  1IYJ B;  4UP7 A;  5GQO A;  1Z9F A;  2F3I A;  5M3M H;  2WB1 G;  2YYZ A;  3J7Z C;  4X62 L;  2PNH A;  1K83 H;  5JEA G;  4JI1 L;  4X62 Q;  4GKK Q;  3S2D H;  1A63 A;  4UPA A;  3HKZ E;  4RG1 A;  4JI1 Q;  2GN5 A;  1BKB A;  2MNA A;  1SMX A;  4IPG A;  1TWC H;  2ZTC A;  3A5U A;  4DR2 L;  1T9H A;  1TWG H;  4DV7 L;  1N36 L;  3H3V H;  4QJF A;  4DR2 Q;  1WFQ A;  5FLM H;  2UU9 L;  4BY7 H;  1HZA A;  4JV5 Q;  2BH8 A;  4AQY L;  4X64 L;  1B70 B;  2XGT A;  3I55 A;  2CKZ B;  3CME A;  1VQI A;  3CAM A;  3Q8D A;  4YCV A;  1HZC A;  1YIT A;  3ERS X;  3H15 A;  1KAW A;  2ZJQ A;  1YHA A;  1FGU A;  2VQE L;  4PZ8 A;  5BR8 L;  3JAM c;  1E24 A;  4LFA L;  3I56 A;  1OXT A;  1X3F A;  3K7A H;  5M5Y H;  1PVO A;  3S16 H;  1L1O A;  3I4N G;  4B3T L;  3PUV A;  4JI3 L;  3PO2 H;  1KXL A;  3KF8 B;  1K3R A;  1VQC A;  3M4O H;  1FL0 A;  4MTN A;  2F52 A;  3OTO Q;  1OXV A;  4JI6 Q;  4OWX B;  5DLQ E;  1JT8 A;  1VQH A;  1PH2 A;  4R4C A;  1W3S A;  4QGU A;  1ASY A;  1Q12 A;  3PUY A;  4LF6 Q;  2PQA A;  4DV0 Q;  5C4J H;  1UE6 A;  1JMC A;  4A3M G;  4A3B H;  1L1O B;  2VUM H;  4NB3 A;  1EIY B;  2UXB L;  1VQN A;  1VQB A;  4BY1 H;  3HOW H;  3KYH C;  4QQB X;  4X66 L;  2JJQ A;  2Q2H A;  1SRO A;  3NEM A;  4OWT B;  1VQG A;  4X66 Q;  1FJG L;  1EWI A;  4POG A;  3CCQ A;  4A3K H;  4HIM A;  5IYD H;  1GKH A;  4GN3 B;  2NN6 I;  2K75 A;  1HR0 W;  3CCM A;  5K36 G;  1XMO Q;  1IBM L;  3RZO H;  1CKO A;  2R92 H;  3OW2 A;  2B3G A;  3HKZ G;  4KHZ A;  2I5M X;  1VQ8 A;  4B3S L;  3B6Y A;  4OO1 I;  3AFP A;  2KCT A;  1VQF A;  2PI2 E;  3BZK A;  4A3D H;  4K0K L;  1H95 A;  4GN4 B;  1G51 A;  4L5Q A;  5C0X G;  4IPH A;  4A3L G;  2CCZ A;  4DV4 Q;  4K0K Q;  3FP9 A;  4C3I H;  4DR6 Q;  1VCI A;  3K7U C;  1YVC A;  1YZ6 A;  3S15 H;  4GS3 A;  5C4X G;  1EOV A;  3BJU A;  1RL2 A;  2NZH A;  5HY6 A;  4POF A;  1YIJ A;  1VQL A;  5HGQ A;  2ZM6 L;  1XPU A;  1K9M C;  1Q82 C;  4DV1 L;  3A74 A;  1LYL A;  4DV1 Q;  4DUZ Q;  2KHJ A;  1R9T H;  5JJL A;  1VQ9 A;  3RZD H;  2GVB A;  5GAG C;  4HJ5 A;  3AFQ A;  4BBR G;  1E3P A;  3TQY A;  2JA8 G;  1JJC B;  1N33 L;  3CCJ A;  2JA7 H;  4R4T A;  3E9I A;  2DUD A;  5M3F H;  1HR0 Q;  1N33 Q;  4IOA A;  3ER0 A;  3S1N H;  4LFC L;  4DV5 L;  2HQL A;  3PF5 A;  4LFC Q;  1QVF A;  4A76 A;  2I5L X;  1XJV A;  1M1K C;  4DR4 L;  4HJ9 A;  2B63 H;  1UWV A;  1S3O A;  4A3J G;  4UP9 A;  3FHW A;  1KIX A;  1HNZ L;  4JI4 Q;  4LNQ A;  2CFM A;  5IE8 A;  1SFO H;  2UUB Q;  3S14 H;  4A3C G;  4LFB L;  2R93 G;  2EIF A;  1YEZ A;  1XMQ L;  4KI0 A;  4DUY L;  5ELO A;  4LF4 L;  1D7Q A;  1Q81 C;  3PSI A;  4A93 G;  3A5Z B;  1XMQ Q;  1Q1B A;  1HNX L;  4LF4 Q;  4L5T A;  4A4I A;  4TVA B;  2E8G A;  4KHP L;  1OTC A;  3GTK H;  1HNX Q;  1PH4 A;  4DK6 C;  2QEX A;  3CCS A;  1O7I A;  5FLX c;  3J81 i;  3GTM H;  5JEA J;  4NXM Q;  3CC2 A;  3G6E A;  2PMZ E;  3CP0 A;  3F1Z A;  3TRE A;  1IZ6 A;  2K5N A;  1Q46 A;  3GDE A;  4JOI A;  1YJN A;  2UXC L;  3JC6 6;  4GLX A;  3TRZ A;  4BBS G;  3CCL A;  2LXK A;  3AYH B;  1HZB A;  1IXR A;  1E7Z A;  4C3J H;  1OXU A;  1NJI C;  2QGQ A;  1V9P A;  1OXS C;  1PA6 A;  1KL9 A;  3L2P A;  1IBK L;  4JG2 A;  3S2H H;  1I50 H;  3I4M G;  1IBK Q;  4A3G G;  3NEL A;  2DGY A;  1Y1V G;  2KHI A;  2IHF A;  5C44 G;  4IO9 A;  1NE3 A;  3MXN B;  2OCE A;  5IYB H;  2WP8 J;  3J81 j;  2JA6 H;  1SLJ A;  3UDX A;  5M5X H;  4A3I G;  2BA0 A;  1I6H H;  5IYC H;  1JJ2 A;  4JBM A;  2IT1 A;  1BVS A;  4P75 A;  4AH6 A;  2FXQ A;  4DR7 Q;  1N36 Q;  2R7Z H;  1YJW A;  4DV7 Q;  2HHH L;  3CCE A;  1UEB A;  2UU9 Q;  2A1A A;  1X65 A;  2OTJ A;  2WAQ E;  1C0A A;  1Y14 B;  2HHH Q;  5IP7 G;  1HH2 P;  3H3V I;  3L7Z C;  4DV3 L;  3A0J A;  1IBL L;  3GTG H;  4AQY Q;  4IFD I;  4X64 Q;  1MIU A;  5IT9 c;  5FLM G;  4OX9 L;  3UDI A;  3HOU G;  3I4O A;  3CCU A;  1P16 A;  4OX9 Q;  2OQK A;  3G48 A;  4EX5 A;  4JBJ A;  2VQE Q;  2R6G A;  1X9N A;  4OXP A;  3CW2 C;  5BR8 Q;  1VQJ A;  4P73 A;  4C3H H;  3CCV A;  4LFA Q;  1A0I A;  2ES2 A;  1WCM H;  3CC4 A;  3GTP H;  3PO3 G;  2GVA A;  1YI2 A;  1YBY A;  4X65 L;  1L2F A;  4B3T Q;  2IX1 A;  3M7N A;  3RN2 A;  4JI3 Q;  4YWK A;  5M5W H;  4UY8 C;  1XPR A;  3HFZ B;  2OTL A;  3S1Q H;  3CXC A;  5IP9 G;  1VQD A;  1N34 L;  4HIK A;  1N34 Q;  3BZC A;  2H5X A;  5ELN A;  3CMA A;  3ULL A;  3JAM i;  1Y1W G;  3I4N H;  3EIV A;  2F4V L;  4JI0 L;  1K0R A;  3RLN A;  5C3E G;  4MZ9 A;  1CKN A;  2K5V A;  1TWA H;  1KD1 C;  2I0Q A;  1VS0 A;  3CQZ H;  4JI0 Q;  4LWC A;  3GTJ H;  3KOJ A;  2UXB Q;  1VQO A;  2YU9 H;  3GTL H;  3DLL A;  5C0X J;  4IOC A;  1SR3 A;  1K8A C;  2Y0S G;  2YV5 A;  1FJG Q;  1FVI A;  3UE0 A;  1WYD A;  2UUA L;  3J7A 5;  1XNR L;  4A3M H;  2EQS A;  1BBU A;  3KJO A;  3E9H A;  2E5L L;  2JEB I;  3FKI G;  1XNR Q;  1U5K A;  4WJ4 A;  2NN6 G;  1E1T A;  1VQ5 A;  2E5L Q;  4IPC A;  1CKN B;  2BH2 A;  3PUZ A;  2XTI A;  1RIP A;  4XTC S;  3J80 c;  1YHB A;  5GAD C;  3HOX G;  1IBM Q;  3M9B A;  3K81 C;  4DPG A;  4YWM A;  5IYD G;  1J5E L;  4A3F G;  3G4S A;  3HOV G;  4DR3 L;  1J5E Q;  4B3S Q;  2NVT H;  3AEV A;  3HOZ G;  4OO1 G;  4HIO A;  2VNU D;  3PIP A;  1X3E A;  2VW9 A;  1N8R C;  2WAQ G;  4JOI C;  4GKJ L;  2RHQ B;  2N78 A;  3W1G A;  4H02 A;  2Q2T A;  4GKJ Q;  2QA4 A;  1NMF A;  1AE3 A;  2V1C C;  2N49 A;  2NVY H;  3F2C A;  1VQM A;  2JE6 I;  4XIG S;  1YJ9 A;  4LW1 A;  1M90 C;  1KRT A;  2ZJP A;  1Q7Y C;  1G29 1;  2ZM6 Q;  4JYA L;  1G6P A;  3UDF A;  3T1Y L;  4DK3 C;  4A3L H;  4DAM A;  5JJK A;  3HOY G;  2I5H A;  3CC7 A;  1Q1E A;  4YCU A;  3U50 C;  5FJ8 G;  4GLA C;  5C4X H;  2KEN A;  2JQO A;  4HJA A;  2CWA A;  3AQQ A;  3RR5 A;  2YTV A;  2RF4 A;  1UE5 A;  1CSQ A;  1X54 A;  2RCN A;  2EXD A;  4TQU S;  1QZH A;  5J3B A;  2A19 A;  4LF5 L;  3PUW A;  3M85 A;  3KF6 A;  1WOC A;  1VQA A;  2YTY A;  4DV5 Q;  2JA9 A;  3KLW A;  4IPD A;  2R7F A;  4DV2 L;  1LUZ A; 
#chains in the Genus database with same CATH topology
 3EN2 A;  4DV2 Q;  3ICE A;  4B3R L;  1SFO B;  2EJM A;  4B3R Q;  3KK7 A;  1SNP A;  3UDG A;  3MZ5 A;  1MKH A;  2ATW A;  3KF6 B;  4KHP Q;  2NZO A;  4A3J H;  4DA2 A;  4LF8 L;  3CPF A;  5BN5 A;  2LFN A;  4LF8 Q;  2HCC A;  2K4K A;  2NTS A;  2ZJR A;  1K8O A;  3BVZ A;  3CD6 A;  2UXC Q;  2Z9H A;  4DNI A;  3DEO A;  4KKU A;  4P71 A;  1RCV D;  2LSS A;  3F8T A;  2B2W A;  1RHP A;  1H9M A;  3NQI A;  1LTT D;  1X6O A;  2QW7 A;  1SBB B;  4J8Q A;  2ZXR A;  1I5F A;  2D0P A;  4A3E G;  5C6A A;  1C7Y A;  2RSO A;  5M3M G;  1PRT D;  2RVL A;  1PZI D;  1I6V C;  1S40 A;  4K5W A;  3U9O A;  5D14 A;  3MHB A;  5I9P A;  5IGF A;  4DV3 Q;  2XWB B;  1X56 A;  1Z47 A;  4IFD G;  2EXZ A;  2BDN A;  1LT5 D;  2EPB A;  4APV A;  1B7Y B;  5IP7 H;  4AYB E;  4LUO A;  3OWE B;  2Q2I A;  1LTS D;  2NUC A;  4NPS A;  1EYA A;  3DM3 A;  3E3X A;  4JV5 L;  4X65 Q;  1VQE A;  3CRK C;  3PV0 A;  2HIV A;  4IJH A;  3STB C;  3S1Q B;  1QZG A;  4BA2 I;  3PF4 A;  4JI2 L;  1LM0 A;  2K28 A;  3M3Y H;  3M3Y B;  4JI2 Q;  1EYG A;  1MSH A;  3VYU A;  3CF5 A;  2K50 A;  1TWA B;  2Z6K A;  1VDZ A;  3BYY B;  4DF7 A;  3TP6 A;  3I3C A;  2PO4 A;  2LKV A;  1PYB A;  3CKI B;  3DWP A;  2K14 A;  4F8M A;  1B9N A;  1PTO F;  1STB A;  1HJP A;  4HJ8 A;  4PMW A;  3T53 B;  3HOW G;  1EEF D;  1PH7 A;  4KLK A;  2B2T A;  3MVV A;  4DV0 L;  1SYF A;  3RN5 A;  2MGS A;  2MJ8 A;  2QDB A;  4H13 C;  3PIO A;  1EFI D;  2DNC A;  3FKI H;  1CK1 A;  2R92 G;  2EY6 A;  1JC7 A;  4S3S A;  2N3S A;  4A75 A;  3A54 A;  4GNX C;  1K28 A;  1PH9 A;  4KJO A;  1S5E D;  2K6A A;  3M4Q A;  4AYB G;  1PV4 A;  1ET9 A;  2F0J A;  5C0X I;  1EIH A;  1A2U A;  1J8I A;  4K5V A;  1UE1 A;  2EYM A;  2WB1 E;  3RMH A;  2DY7 A;  1HFN A;  2NTT A;  1YHQ A;  1DZ1 A;  3GO5 A;  5DAU A;  3ULP A;  2L5T A;  1BCP C;  4LF5 Q;  2NVX H;  2KVM A;  2NVX B;  2KEE A;  3K80 C;  2B63 G;  1LTR D;  4HID A;  3BU2 A;  3S1R H;  1QNK A;  3S1R B;  2ZTD A;  1LV9 A;  4B3M L;  1TXY A;  3NXW A;  2B29 A;  4B3M Q;  1O7Z A;  1L0W A;  4FF4 A;  3NBH A;  1N9W A;  3IFT A;  2CQA A;  3E0J A;  1DGS A;  4GOP C;  5I4D A;  3I7F A;  5LMU L;  3P1H A;  3MEF A;  3MC0 B;  5LMU Q;  4MTK A;  1ML0 D;  3VR6 A;  5IGD A;  3E0E A;  1YNX A;  1L1O C;  4PV1 C;  4JCV E;  5AJ3 Q;  1XX8 A;  5KND A;  3A55 A;  1KNE A;  2IY5 B;  2HCI A;  4B9X A;  5IYB G;  2LMC B;  1SNO A;  1ILQ A;  3A8I E;  1N32 Q;  4A3E H;  5EPK A;  4A3E B;  1IYJ B;  1IW7 D;  4UP7 A;  1Z9F A;  5GQO A;  5M3M H;  2WB1 G;  2YYZ A;  3K0Y A;  4IUP A;  4X62 L;  1FR3 A;  4X62 Q;  5DM6 3;  2GN5 A;  1SMX A;  3A5U A;  3J7A V;  1WFQ A;  3NHH A;  4IFD H;  3EVQ A;  2R3Z A;  3K6O A;  3FPU B;  2KA7 A;  2SDF A;  4X64 L;  3GV6 A;  1LAC A;  3CAM A;  3Q8D A;  2J7Z A;  2Q8I B;  1HZC A;  1I4P A;  1FGU A;  3M4Y A;  2F03 A;  1GUW A;  4PZ8 A;  5BR8 L;  3JAM c;  5ELE A;  1OXT A;  1X3F A;  2G9H D;  3S16 H;  4B3T L;  3S16 B;  5CC4 A;  5IGG A;  2OF1 A;  4LK1 C;  1VQC A;  3OTO Q;  4IUT A;  4IUU A;  4K2L A;  1A15 A;  3J81 E;  4LF6 Q;  4FF3 A;  5C4J H;  1UE6 A;  5C4J B;  1TS3 A;  2F0K A;  2UXB L;  3AB9 A;  1VQB A;  5M9O A;  3HOW H;  4K6L A;  4QQB X;  4X66 L;  3HOW B;  1LT6 D;  1SRO A;  2FJ2 A;  4X66 Q;  1EWI A;  3PIO 3;  1EYC A;  1LO5 D;  2E2J B;  4CKC A;  1CT1 D;  3CCM A;  4B08 A;  3HOZ B;  1C4Q A;  5C5L A;  2R92 H;  4QCL A;  2B3G A;  2R92 B;  2V4D A;  4KHZ A;  2MUY A;  4CGY B;  2A73 B;  4OO1 I;  3AFP A;  2PI2 E;  3IKJ A;  4I7A A;  3C2P A;  3VA7 A;  1G51 A;  5C0X G;  3HRZ C;  4CDD C;  1PYW D;  2E2H B;  2E2I B;  1HCZ A;  3OIP A;  3S15 H;  4K2K A;  1O80 A;  2BE5 D;  3S15 B;  3BJU A;  4UAI A;  4AYB B;  4U67 3;  1EEI D;  2A69 C;  5HGQ A;  3MA2 B;  5KYL A;  2ZM6 L;  4N9T A;  4TRD A;  3AU7 A;  3ND8 A;  4HJ5 A;  1PLF A;  4WRD A;  1E3P A;  3TQY A;  4OIJ A;  3OOC A;  3E9I A;  3ITP A;  2F0M A;  1PTO H;  3K57 A;  2PPB C;  3S1N H;  2HQL A;  4R9W A;  2G9D A;  2F0L A;  3TN2 A;  3V2T A;  1QVF A;  3T16 A;  2DY8 A;  2B63 H;  2B63 B;  3FHW A;  4KN7 C;  4JI4 Q;  2KCC A;  2CFM A;  5IE8 A;  3S14 H;  4A3C G;  3OSO A;  3S14 B;  5A2Q L;  1IYV A;  1MD2 D;  4A93 G;  3A5Z B;  1WVL A;  1GUS A;  4L5T A;  1PH4 A;  4DK6 C;  2QEX A;  1AZQ A;  5FLX c;  4R8I A;  2Z1C A;  5JEA J;  4NXM Q;  3CC2 A;  3G6E A;  2CW0 C;  3TRE A;  1Q46 A;  3BDC A;  2JA5 B;  2A68 D;  4FP5 D;  4YIJ A;  4BBS G;  1DOM A;  2X6G A;  2Q8R E;  1NJI C;  3HP3 A;  4CDC C;  1PA6 A;  5JPM C;  3HS0 C;  1ENF A;  1YNN C;  4JG2 A;  1I50 H;  3Q22 A;  4O1N A;  1I50 B;  2NBF A;  3NEL A;  3I4M G;  1Y1V G;  5C44 G;  4IO9 A;  2EJG C;  1JQY D;  4N8F A;  3G6J B;  5IYB H;  1SLJ A;  4A3I G;  5M5X H;  2Z6B A;  5M5X B;  2PCF B;  4P75 A;  5A35 A;  2FXQ A;  1WTO A;  2RSN A;  4CHT B;  1WTR A;  2A1A A;  2WAQ E;  2WB1 B;  1Y14 B;  2B8G A;  4RGO S;  3LX0 A;  1IBL L;  4AQY Q;  1R4Q B;  1B50 A;  1MIU A;  2PW7 A;  3UDI A;  3CCU A;  2F0P A;  1P16 A;  5T1I A;  2OQK A;  3G48 A;  4EX5 A;  3KBX A;  1WTV A;  4KD4 A;  1X9N A;  4OXP A;  3CCV A;  2ES2 A;  3CC4 A;  1T5E A;  1YBY A;  1U4P A;  1STE A;  1SJE D;  3HGB A;  4JI3 Q;  1ZEQ X;  1XPR A;  2OTL A;  3CXC A;  1U4M A;  4HAE A;  4KKT A;  5IP9 G;  4HSP A;  4PMC A;  1LTA D;  4WJW A;  5ELN A;  1Q8I A;  1Y1W G;  1CKN A;  2K5V A;  1KD1 C;  1VQO A;  2EE1 A;  4K8J A;  4JPB W;  4H44 C;  2YV5 A;  2O5J C;  2IJ0 A;  1WYD A;  1XNR L;  1XNR Q;  3E9H A;  2E5L L;  3FDT A;  4WJ4 A;  1CQF A;  1U5K A;  2E5L Q;  1EOT A;  2XTI A;  1RIP A;  3TBI B;  5GAD C;  5IIF A;  3HOX G;  1IBM Q;  3K81 C;  5IYD G;  1PRT C;  3G4S A;  4B3S Q;  1SYG A;  4RHR A;  2NVT H;  3I90 A;  2PNR C;  4OO1 G;  2NVT B;  3DWA A;  2WAQ G;  4JOI C;  5JOB A;  1HA5 A;  4H02 A;  4WFN 3;  4CJ0 B;  2KHS A;  5G3L F;  5FOB B;  2N49 A;  2NVY H;  1VQM A;  2NVY B;  1YJ9 A;  2FHT A;  1KRT A;  4JYA L;  2B2W C;  5C3W A;  5C0X H;  5E1F A;  2I5H A;  5FJ8 G;  3VA5 A;  4HJA A;  2YTV A;  1LTG D;  1OO9 B;  3PUW A;  3KF6 A;  1WOC A;  2A5H A;  4EQP A;  2H1E A;  1M4V A;  4IPD A;  3SK4 A;  2OEO A;  1LUZ A;  3QO2 A;  4X3K A;  2EY2 A;  1VQ4 A;  3RD4 A;  4LFB Q;  1EQT A;  3HG9 A;  3WOE A;  3SK6 A;  4XYQ A;  2ICI A;  4NMZ A;  3QIA A;  4YHH L;  4L8J A;  2QCP X;  4N8X 1;  2BA1 A;  1A6X A;  1Y8P B;  4JBK A;  3N6R A;  3GTM B;  1PH3 A;  3KDF B;  4A3C H;  1GM5 A;  3PGZ A;  1Q90 A;  4LF7 L;  1EZ6 A;  2HDL A;  4LF7 Q;  2PQE A;  4A93 H;  2E2D C;  3OIQ A;  4G7Z C;  3D6W A;  1JB7 A;  1I4G A;  4C3J B;  1XTD A;  4IAL A;  3IRB A;  4FDB A;  1AE2 A;  3H0G G;  5CV6 A;  2AMC B;  4L5R C;  4FF1 A;  4OON A;  5BN3 A;  1HNW L;  5G3L D;  4P2C B;  2Z6K C;  4BBS H;  3PUX A;  4QY7 A;  2JA6 B;  5E7N A;  2HIX A;  3WWV A;  4RGM A;  2O2L D;  3IL8 A;  3I4M H;  3I4M B;  1Y1V H;  3X3M A;  5C44 H;  4GNX B;  1Y1V B;  1EIF A;  2RKS A;  3CCR A;  4A3I H;  1KRS A;  3GTQ H;  1Q8K A;  1EY0 A;  2D62 A;  4JC0 A;  2AWO A;  1SSO A;  2NVQ H;  4GKK L;  2MPM A;  3M4P A;  3T4A C;  1P8L A;  1EWC A;  1I3Q H;  1O78 A;  1IKL A;  3VR3 A;  2RBM A;  2DJG C;  3GTP B;  2D0O A;  3K59 A;  1LAB A;  2GA4 B;  4C2M H;  4C2M B;  1NSN S;  2HQE A;  5GRO A;  1QVG A;  1WCM G;  4R4I A;  5COY A;  1K3B C;  1E2W A;  4K14 A;  3PO2 G;  5FKA C;  1V43 A;  2EYP A;  2F4V Q;  3MFY A;  4LJZ C;  1SMY D;  2N88 A;  4OEM B;  5IP9 H;  3QOL A;  1HTP A;  2KBN A;  2F0T A;  1Y1W H;  3CPW A;  4JI6 L;  1Y1W B;  1WJJ A;  4BY1 G;  2UUA Q;  4FVM A;  4GOP B;  2WIN B;  1SE3 A;  3NWT A;  2YTX A;  2VZA A;  2DJF C;  3R2I A;  1W2B A;  4EGV A;  4MN3 A;  3NQT A;  4J15 A;  3F2U A;  1WTH A;  1G8Z D;  2RCF A;  1NAP A;  1IW7 C;  3HOX H;  3QOJ A;  3HOX B;  4A3D G;  1HXY D;  2IL8 A;  1TWF H;  2MQH A;  3QR8 A;  1TWF B;  4C1N K;  3J80 i;  4C3I G;  2MFI A;  4OO1 H;  2B39 A;  2ID0 A;  1EQR A;  3MXU A;  4JI7 L;  3T1Y Q;  1IYU A;  3F2D A;  4JI7 Q;  3DHQ A;  5C4X B;  1TQO A;  4DV4 L;  3PCO B;  4DR6 L;  2VL6 A;  4PZ6 A;  1PZJ D;  4GN5 A;  1EY7 A;  4JBW A;  2IX3 A;  1F9Q A;  4R4Q A;  5IT9 L;  5FJ8 H;  2O4X A;  1KC8 C;  5EAY A;  3MXG A;  3MXP A;  4G7H C;  2JA7 G;  3M7G A;  1ZXT A;  5KIX A;  1XYI A;  1ZKO A;  3I73 A;  1ROD A;  2EYJ A;  2L1B A;  1CHP D;  2F0W A;  3Q6S A;  1EQQ A;  1VMP A;  1JIC A;  5T1G A;  1HR0 L;  4A3J B;  1JJG A;  3L3O C;  2IHE A;  4ZKC B;  1SXT A;  1JOQ A;  4RHS A;  5C3X A;  5GAE C;  5LMN W;  1W6K A;  3ERO A;  2HDM A;  4WJ3 M;  1NCV A;  3ND9 A;  2AQ2 B;  2N8N A;  4ZYS A;  4EVO A;  4J6H A;  4ZQ3 A;  2PZT A;  1QNU A;  3BS1 A;  1KTK A;  1I4X A;  1ESR A;  1GXD C;  2RQX A;  4DAY B;  3H0G H;  3H0G B;  1BOS A;  3J80 L;  5I6W A;  1RF2 D;  4IN3 A;  5IYC G;  3U4Z A;  1B3A A;  2CHB D;  2F0S A;  1DCZ A;  1DOL A;  4EQ5 A;  1EFW A;  1D2B A;  1KNA A;  3CHB D;  3R3O A;  3Q0A A;  2BE5 C;  3J7Z C;  1STH A;  2K1B A;  1K83 H;  2N55 A;  5JEA G;  1K83 B;  4ZKB B;  1BKB A;  2L4N A;  5J1Z A;  1TWC H;  4DR2 L;  4DV7 L;  4DR2 Q;  2UU9 L;  2EZV A;  4QUF A;  1HZA A;  3BZD B;  3MAQ A;  1EZ8 A;  4JV5 Q;  1ZYR D;  1ET6 A;  4C3H G;  2Z4H A;  1AN8 A;  1FNV A;  1VQI A;  4ABN A;  4HMI A;  1X3P A;  2OT2 A;  2JXM B;  1YIT A;  3ERS X;  3H15 A;  2ZJQ A;  1UAP A;  2A6E D;  3KBG A;  3FEW X;  1S5C D;  3I4N G;  3PUV A;  2JSO A;  3PO2 H;  3PO2 B;  1FL0 A;  1WTP A;  4OWX B;  5DLQ E;  3TZD A;  1VQH A;  1KAB A;  1Q12 A;  3PUY A;  3C3L A;  2PQA A;  4DV0 Q;  1EIG A;  4A3M G;  5BN4 A;  3KUP A;  2IW3 A;  4M1U B;  4BY1 H;  4IZ8 A;  1RD9 D;  4BY1 B;  3FVQ A;  3FKI B;  1FJG L;  2F3V A;  5JPN C;  3CCQ A;  1MI2 A;  3K5L A;  2LY7 A;  1I4H A;  2D9U A;  2KCN A;  2K75 A;  4QF4 A;  1JB3 A;  3D4D A;  1CZG A;  1JOO A;  3RZO H;  1CKO A;  3T51 B;  1ONL A;  3RZO B;  3H94 A;  2KCT A;  4A3D H;  1VQF A;  5EBC A;  2L55 A;  2CCZ A;  3FP9 A;  4C3I H;  1M8A A;  4C3I B;  3QWN A;  3I8Z A;  5ISR A;  1JWS D;  1EOV A;  5F2D A;  2NZH A;  4POF A;  1PFM A;  5E4W C;  4CDF C;  1K9M C;  1Q82 C;  4ME5 A;  3NPP A;  1TY0 A;  2JP1 A;  4ZCK A;  1R9T H;  2B2Y C;  1R9T B;  3OMG A;  2M00 A;  4BBR G;  2JA8 G;  3CCJ A;  2JA7 H;  4KHV A;  4IOA A;  2JA7 B;  2EDG A;  5J39 A;  2I5L X;  1M1K C;  5E4X A;  4DR4 L;  4CDE C;  4UP9 A;  1KIX A;  3TZU A;  1HNZ L;  3CU7 A;  2AUK A;  4DUY L;  1EY4 A;  1Q1B A;  1HNX L;  1H9J A;  2E8G A;  1OTC A;  3GTK H;  1HNX Q;  3C1E A;  3CCS A;  1PFB A;  3L9A X;  2PMZ E;  3CP0 A;  3F1Z A;  4XDX A;  2JYO A;  2K5N A;  3DMU A;  5IOD A;  1A3U A;  5CBA E;  1YJN A;  2F0O A;  1E2V A;  2IWH A;  1IXR A;  1E7Z A;  1OXU A;  3L2P A;  2DNE A;  2OXP A;  4A3G G;  3GP7 A;  2DGY A;  2IHF A;  5M3M B;  3MXN B;  3G7L A;  2EOT A;  5D65 A;  5ELB A;  3NP8 A;  3R93 A;  1TU2 B;  3J81 j;  1B2T A;  2BA0 A;  4HR7 B;  5IYC H;  1JJ2 A;  4CBV A;  4FYD A;  3VR4 A;  2HHH L;  4E6I A;  1UEB A;  1X65 A;  1HRJ A;  1GUG A;  2HHH Q;  5JEA H;  4X64 Q;  2M9V A;  5FLM G;  3HOU G;  4IQZ A;  2K03 A;  3K5O A;  3CW2 C;  5BR8 Q;  4C3H H;  1A0I A;  4C3H B;  5JVG 3;  1AFP A;  2GVA A;  1YI2 A;  1L2F A;  4B3T Q;  3M7N A;  4YWK A;  3SEB A;  4UY8 C;  2CVR A;  3HFZ B;  1STN A;  2KED A;  1DON A;  4O42 A;  3ULL A;  3JAM i;  3I4N H;  1SYB A;  4UHV A;  5KNC A;  3A8K E;  1MGS A;  5C3E G;  2I0Q A;  1VS0 A;  1RJT A;  5COR A;  2LS0 1;  2UXB Q;  4FXG C;  1FGB D;  2YU9 H;  3N52 A;  2B2U C;  4IOC A;  1QCB D;  1K8A C;  2Y0S G;  4G7O C;  5FO8 B;  4A3M H;  2EQS A;  4BS9 A;  4DNT B;  1ENC A;  1QIL A;  4HTH A;  4HN7 A;  4IPC A;  5J22 A;  2XRS D;  2MP1 A;  5AFW A;  4KMU C;  2EYL A;  4DPG A;  4HED A;  5CGK A;  3DXJ C;  3HOV G;  4DR3 L;  3OWF A;  1JE4 A;  1QE6 A;  4EQO A;  1X3E A;  2VW9 A;  4GKJ L;  1GUT A;  2E76 C;  3W1G A;  3D4R A;  3QB3 A;  5EQ0 A;  3OW7 A;  2Q2T A;  4GKJ Q;  2QA4 A;  5I2X A;  3VYT A;  3F2C A;  3PIP 3;  1EY6 A;  2F0F A;  4KK7 A;  4XIG S;  4LW1 A;  4MIU A;  1G29 1;  2ZM6 Q;  1UNS A;  2F0Q A;  4ULL A;  4DAM A;  1CA6 A;  5IGE A;  3HOY G;  4RFB A;  5EPJ A;  3CC7 A;  4YCU A;  4V0B A;  1J9O A;  1AP0 A;  1TS4 A;  2RF4 A;  1CSQ A;  1X54 A;  2A19 A;  1GHK A;  1PTO B;  3M85 A;  3S1N B;  1S5B D;  3K5M A;  5C4Z A;  3KLW A;  2R7F A;  3KDF A;  4BBR H;  1VQ7 A;  4BBR B;  1DOK A;  2C9O A;  2JA8 H;  1SMY C;  2JA8 B;  3JAM L;  1LLR D;  4PZ7 A;  1IL2 A;  1EY8 A;  1S72 A;  4OWW B;  4ME3 A;  3OHX C;  5EGT A;  1QJO A;  1QVC A;  3W5O A;  3KJP A;  2F4I A;  1ILP A;  1V1O A;  3KLS A;  1KLU D;  3ULJ A;  1B53 A;  4KD3 A;  2CQO A;  3J7A F;  1PFN A;  4MNO A;  1PXU A;  4FXK C;  4X6A H;  3NTK A;  2RA4 A;  2PI2 A;  5IY0 A;  2JN4 A;  2FFK B;  1PH5 A;  4GNX A;  1SNQ A;  2MO0 A;  3VR5 A;  4CJ1 B;  2PYK A;  5ELC A;  1D6E C;  5HGT A;  2Q2U A;  5CV4 A;  5LHY 1;  2K5H A;  3J80 E;  5CBE E;  4Y52 H;  3ZJY C;  1XPO A;  1H9R A;  4A3G H;  1ASZ A;  4A3G B;  1ICF B;  4DGZ A;  3PQI A;  4X3S A;  4EQN A;  5I2Y A;  3EQL C;  4RA8 A;  1AEX A;  1IBL Q;  3U58 A;  4F87 A;  3T1H L;  1X32 A;  3T1H Q;  1F2L A;  3MWY W;  4K8I A;  1X55 A;  2VB3 X;  3D4W A;  4ODG A;  3FPP A;  3TS2 A;  4L5S A;  4FF2 A;  3HOU H;  3I4L A;  4L6T B;  1GVP A;  1TKW B;  4JK1 C;  1STA A;  1KHI A;  1A62 A;  1TY2 A;  1L0Y B;  3DUZ A;  4GOP A;  2AKW B;  1QUQ B;  4YY3 L;  4YY3 Q;  4G4K A;  4P72 A;  3HKS A;  2C35 B;  1TVX A;  4L63 B;  3NEN A;  5KEE A;  2UXD L;  2Z8L A;  1VQK A;  3I2Z A;  1QG7 A;  3EJI A;  4A3B G;  2UXD Q;  3NTH A;  2VUM G;  1STY A;  4LUV A;  5C3E H;  2PMZ B;  4YCW A;  5IWA L;  5L37 A;  3W1B A;  5IWA Q;  2QDL A;  5FLX L;  1I4R A;  1XTC D;  4A3K G;  4GLV B;  1NBW A;  3VDY A;  1HA6 A;  1F77 A;  2VB2 X;  3D0F A;  4DKA C;  1SRU A;  1XNQ L;  5D3D A;  1XNQ Q;  1PH1 A;  4Z9C B;  1XMO L;  3HOV H;  2EVB A;  3LNN A;  1KDC A;  4RGN A;  4JYA Q;  4CKB A;  3V05 A;  1V1Q A;  3U4V A;  1CQV A;  3EBE A;  3A56 A;  5LL6 X;  3UI2 A;  1CUK A;  2FMM A;  2VS1 A;  1ZYR C;  2LXJ A;  4B9W A;  1PYS B;  4RH6 A;  5EBD A;  4NKL A;  3HOY H;  3KFU A;  2K7V A;  2A6E C;  4H0L C;  2C5C A;  3SHL A;  3QG1 A;  3OYY A;  1SE8 A;  1WI5 A;  2XRQ D;  2VXW A;  4DUZ L;  1F2Y A;  4I7Z C;  2XN9 C;  2JEA I;  1B3Q A;  2SNS A;  3BYT B;  1MJC A;  4KKS A;  4O2D A;  2F0E A;  2CWP A;  3TEH B;  1BF4 A;  1CFM A;  1GO3 E;  4YHH Q;  4LF9 L;  4LF9 Q;  1B1Z A;  3CRL C;  3J81 c;  2I07 B;  2G5D A;  1FNW A;  3RLF A;  4DV6 L;  5D3I B;  1WD0 A;  2XVS A;  4A93 B;  4JI8 L;  4DV6 Q;  1E1O A;  2UUB L;  4KTA A;  1O7L A;  4JI8 Q;  2AQ1 B;  1MSG A;  4IUN A;  1HNW Q;  2JK8 A;  2RHS B;  4BBS B;  4DR1 L;  4NW2 A;  4DR1 Q;  1IHZ A;  1LT4 D;  1D8L A;  2F1M A;  2OWO A;  1CSP A;  2J4X A;  5DM7 3;  4PG3 A;  1Z6H A;  1JE5 A;  2E74 C;  5CR3 A;  3C46 A;  5C44 B;  1JWU D;  3K8A A;  2B2T C;  1Q86 C;  2F0H A;  4QL5 A;  3BDL A;  2R7Z G;  4A3I B;  3WDN A;  2F3I A;  4C1N I;  3GTQ B;  4RWS C;  4HCS A;  1VMC A;  1XWE A;  2NVQ B;  4JI1 L;  1S4Z A;  4GKK Q;  3S2D H;  1A63 A;  4UPA A;  1I3Q B;  1Y8O B;  3HKZ E;  4JI1 Q;  1BCP B;  4DR7 L;  4IPG A;  1N36 L;  3NBI A;  4DN4 M;  1SNM A;  2NB0 A;  4RKL A;  3RUZ A;  1U4R A;  2BH8 A;  2XGT A;  3I55 A;  1BQQ T;  1STG A;  2WKC A;  3HEJ A;  3FMC A;  2VQE L;  4X3U A;  1V1P B;  1CI3 M;  1E24 A;  4LFA L;  3SXH A;  3I56 A;  3KF8 B;  5JJZ A;  3M4O H;  2F52 A;  2F3W A;  4JI6 Q;  3BVG A;  3H09 A;  3EFX D;  1JT8 A;  1ASY A;  4OIK A;  4QGU A;  3H91 A;  1JMC A;  2AQ3 B;  4A3B H;  5EJW A;  2A6H D;  1L1O B;  2VUM H;  4NB3 A;  3J81 L;  2VUM B;  4XT3 B;  3TP8 A;  1AZP A;  3NK9 A;  1CTM A;  2L11 A;  3T56 B;  3DM1 A;  5C4H A;  2Q2H A;  4OWT B;  1CHQ D;  4A3K H;  4HIM A;  2X6L A;  5IYD H;  4A3K B;  1SDF A;  2NN6 I;  4DXF A;  3W3A A;  5K36 G;  3IAY A;  1G2S A;  4HCE A;  1SAP A;  3HKZ G;  2WAQ B;  1SEB D;  3B6Y A;  5ELD A;  1H95 A;  2FMC A;  4GN4 B;  4L5Q A;  4PQX A;  4IPH A;  4A3L G;  4DV4 Q;  4DR6 Q;  1F9S A;  3K7U C;  1YVC A;  1YZ6 A;  3QJY A;  4GS3 A;  4OEL B;  5HY6 A;  1RL2 A;  1VQL A;  2EJF C;  3H3V C;  5KRU A;  1XPU A;  2F0U A;  2R61 A;  5C5M A;  2RDF A;  1LYL A;  2KHJ A;  2BOS A;  1RDP D;  5JJL A;  3RZD H;  3RZD B;  3AFQ A;  1JJC B;  4R4T A;  3TP7 A;  1HR0 Q;  2EYO A;  4RKB A;  1Z7T A;  3ZYY X;  1WTX A;  2D2C C;  4DV5 L;  1WD1 A;  3J7Y W;  3PF5 A;  3X3N A;  1HUN A;  5EKI A;  4DAV A;  4HJ9 A;  1S3O A;  5A2Q E;  2J0T D;  4LNQ A;  1SFO H;  2R93 G;  1XMQ L;  4KI0 A;  5ELO A;  4LF4 L;  3Q24 A;  1Q81 C;  3PSI A;  1XMQ Q;  4LF4 Q;  4KHP L;  4A4I A;  3A7A B;  2KQ3 A;  3K5N A;  1O7I A;  3O13 A;  4QUC A;  1I4Q A;  3MXN A;  4JOI A;  4KJN A;  2K04 A;  2UXC L;  1D5M C;  3TRZ A;  3CCL A;  2WII B;  2LXK A;  3AYH B;  1SYE A;  1DM0 B;  1G91 A;  5HUR A;  2QGQ A;  1V9P A;  5DNF A;  2QIL A;  1KL9 A;  1IBK L;  3SK8 A;  1IBK Q;  4NDX A;  1C8C A;  2KHI A;  3NTI A;  1T5X D;  1NE3 A;  1V8Q A;  2EY1 A;  3C1F A;  2XWJ B;  1S5D D;  1F2Z A;  1I6H H;  4HMJ A;  4JBM A;  1I6H B;  1TWC B;  1VF5 C;  1WTW A;  2R7Z H;  2R7Z B;  4DV7 Q;  1IKM A;  3CCE A;  2OTJ A;  1H9S B;  2UU9 Q;  3H3V I;  3L7Z C;  4DV3 L;  3A0J A;  3GTG H;  3GTG B;  3D6C A;  1A3V A;  2L12 A;  2WKD A;  3I4O A;  4IUQ A;  4OL7 A;  2Q8T A;  4JBJ A;  1VQJ A;  4P73 A;  5CMD A;  4KV6 A;  1TS2 A;  1WCM H;  3PO3 G;  1BBX C;  1WCM B;  2K32 A;  1BXT A;  1DXM A;  4X65 L;  2IX1 A;  2F0I A;  5M5W H;  3S1Q H;  3PMF A;  4ZUI A;  5KNB A;  5M5W B;  1N34 L;  4HIK A;  1N34 Q;  1D5Z C;  2H5X A;  3CMA A;  4QMG A;  3EIV A;  1KLG D;  4JI0 L;  1SND A;  2B2V A;  4BWG B;  3RLN A;  4UDU C;  2A68 C;  4MZ9 A;  1TWA H;  4JI0 Q;  4DXG A;  5FO9 B;  4LWC A;  3GTJ H;  3P20 A;  3GTJ B;  3GTL H;  3DLL A;  1KDB A;  3GTL B;  5I9O A;  1FD7 D;  1SR3 A;  1CA5 A;  3I91 A;  4KY5 A;  1FJG Q;  1FVI A;  5FLX E;  1YNJ D;  3KJO A;  2JEB I;  4ILW A;  4N9P A;  3VR2 A;  2NN6 G;  3I72 A;  5KYI A;  2BH2 A;  4XTC S;  1YHB A;  3M9B A;  2KEC A;  1J5E L;  1DYQ A;  5FK9 C;  4A3F G;  1J5E Q;  4A3D B;  3HOZ G;  3PIP A;  5K36 H;  1N8R C;  4R8N A;  1CZW A;  4IUR A;  3HKZ B;  2JE6 I;  1KAA A;  4F88 A;  4A3L H;  4DK3 C;  3U50 C;  5JAV A;  5NUC A;  2KEN A;  2JQO A;  2CWA A;  3RR5 A;  3GQB A;  1C48 A;  2EXD A;  1QZH A;  5J3B A;  4LF5 L;  1JWM D;  1LTB D;  2YTY A;  3MEH A;  2JA9 A;  4Q5V A;  4DR4 Q;  4ZUJ A;  1FNU A;  4BXX G;  1PH8 A;  4AIM A;  1D1K A;  1K73 C;  1HNZ Q;  1EU3 A;  1D1I A;  2K33 A;  4DUY Q;  1PTO D;  1B9M A;  4XXE A;  1F9P A;  3GTK B;  3P7J A;  1EUJ A;  1QWY A;  1A3T A;  2XNA C;  1EL0 A;  2R93 H;  1SE4 A;  2OQ0 A;  2R93 B;  3MTS A;  2AHO B;  4P74 A;  2TSS A;  4NP5 A;  2ALY B;  2F0N A;  3A7L A;  4CKE A;  2Y0S E;  2PW5 A;  4K6D A;  4DR5 L;  1PRT B;  2JA5 G;  1LT3 D;  4RCO A;  5IGB A;  4DR5 Q;  2Z0S A;  2ZTE A;  2MHV A;  4ZAI A;  1HHV A;  4QIW E;  3G71 A;  1RTN A;  4O0A A;  2F0D A;  2VY3 A;  5AJ3 L;  3TS0 A;  1KQS A;  1EU4 A;  2AWN A;  1VQ6 A;  1U4L A;  4YWL A;  1N32 L;  1RKN A;  1B8A A;  5CV7 A;  3LWE A;  4BY7 G;  4F7X A;  5E3F A;  1MJE A;  3SGI A;  1QUQ A;  2ASB A;  1HZ9 A;  5LMN L;  2L15 A;  4RMF A;  2K52 A;  4R1J A;  4RGT A;  1TR5 A;  5LMN Q;  3LGJ A;  2IX0 A;  1X3G A;  1BO0 A;  4PNY A;  2K05 A;  4C56 C;  1E22 A;  4ZRZ A;  1UE7 A;  1EWH A;  4BA1 I;  1E2Z A;  3F2B A;  4XQN A;  1AH9 A;  3A8J E;  3PO3 H;  1IL8 A;  2KUM A;  3PO3 B;  1NY4 A;  3I4N B;  1GHJ A;  3NUC A;  4JI5 L;  1KDA A;  4JI5 Q;  1BBW A;  2YU9 B;  1HPC A;  3SR1 A;  3RNU A;  3RLO A;  1PMR A;  2QKI C;  2RDH A;  3OTO L;  1GJX A;  2TMP A;  4JW0 A;  5GAH C;  1BUV T;  3DEP A;  4A3M B;  4Y7N H;  4Y7N B;  4LF6 L;  1FYC A;  1TII D;  1RTO A;  2RDG A;  4IJL A;  3WOF A;  4KY6 A;  4DR3 Q;  2NN6 H;  5JVH 3;  1K8G A;  4FXD A;  2KOL A;  1NTG A;  1VQP A;  2E2J H;  3TDQ A;  3GTO H;  2PQA B;  3W2D A;  3UE1 A;  4A3F H;  3GTO B;  4A3F B;  3HOZ H;  4LUZ A;  4G57 A;  3FRP B;  3S24 A;  3S17 H;  4PMB A;  1LTL A;  1GOZ A;  2WFW A;  2X69 A;  3LWU A;  2UUC L;  3S17 B;  1I94 L;  2UUC Q;  1C9O A;  2Z4I A;  1I94 Q;  4DK0 A;  1A8V A;  1EQV A;  5IT9 E;  2E2H H;  2E2I H;  5JJI A;  3K0X A;  4HSV A;  1ESF A;  1HQM C;  1E0B A;  1CKM A;  5M3F G;  4XYO A;  5KGU A;  5H1S E;  1SN8 A;  2R7D A;  2PZU A;  4R4O A;  4HJ7 A;  1PDQ A;  2H4O A;  1GD7 A;  1NUC A;  3STB D;  1OXX K;  2VQF L;  3KLR A;  4BXX H;  2EY5 A;  1DD2 A;  1BCP F;  5EKK A;  2VQF Q;  1B44 D;  5CYU A;  4WOR A;  2EYH A;  1S5F D;  3GD7 A;  3ERQ A;  2EYF A;  3S9W A;  2A6H C;  4JI4 L;  3HZX A;  4XT1 B;  1J6Q A;  4ALP A;  4TKO B;  1K8M A;  2BDO A;  3L0O A;  1PHJ A;  2HT1 A;  4UP8 A;  1QOH A;  4OGQ C;  5I6Y A;  4IFD J;  4NXN L;  1U0L A;  4C3J G;  4NXN Q;  2ZXP A;  4NXM L;  3Q23 A;  1NMG A;  5EPL A;  3NBH B;  3GV3 A;  1TWH H;  2JA5 H;  2HUG A;  1Y69 U;  1TWH B;  2A8V A;  2MO1 A;  1HTL D;  2XIW A;  1SYD A;  3S1M H;  1PH6 A;  3P75 A;  3ONA B;  2JA6 G;  3S1M B;  2KCM A;  3D31 A;  1PFS A;  4JVZ A;  2SOB A;  1MBY A;  4GZY C;  2B2Y A;  2PNH A;  5DEH A;  2AUJ D;  2A74 C;  4LAA A;  4RG1 A;  4DK1 A;  2XSC A;  1AW7 A;  1GUO A;  2MNA A;  2ZTC A;  1V1P A;  1T9H A;  1TWG H;  3H3V H;  1JCK B;  1TWG B;  4QJF A;  5FLM H;  4K5X A;  3IFD A;  4BY7 H;  3HOU B;  3VYS A;  1B4O A;  4BY7 B;  2CH4 A;  4AQY L;  3H6M A;  1B70 B;  4IUV A;  2CKZ B;  3TP5 A;  3KF8 A;  3CME A;  1G2T A;  4YCV A;  3V96 A;  1BCP D;  1KAW A;  2F0V A;  1YHA A;  2SNM A;  3OPO A;  2NZ1 D;  3NWS A;  3K7A H;  5M5Y H;  1PVO A;  1G6Z A;  2B8F A;  1QB5 D;  3K7A B;  1L1O A;  5M5Y B;  4JI3 L;  1KXL A;  1K3R A;  4ZK9 B;  4MTN A;  5LL6 S;  1EYD A;  1OXV A;  5C3E B;  1BDO A;  1II3 A;  1PH2 A;  4R4C A;  1W3S A;  3D8G A;  4Q0F A;  4XQJ A;  4RAU C;  2IPK D;  5CV5 A;  2Y0S B;  3SVM A;  3TSS A;  1EIY B;  1SE2 A;  1VQN A;  1JR0 D;  3KYH C;  4QIW B;  5CV8 A;  3U9S A;  2JJQ A;  1D5X C;  3NEM A;  1VQG A;  3MFG A;  1R4P B;  3R8B A;  4POG A;  1UUP A;  4OHJ A;  5TSS A;  1GKH A;  4GN3 B;  1HR0 W;  1SJH D;  3I70 A;  2CH4 W;  1U9R A;  3HOV B;  1XMO Q;  1IBM L;  2ENB A;  1SYC A;  3OW2 A;  4DNR B;  2I5M X;  1VQ8 A;  1Y8N B;  4B3S L;  2P5Z X;  3BZK A;  4K0K L;  1Q3L A;  1HUM A;  3AMU A;  4K0K Q;  1NR2 A;  1BR9 A;  1VCI A;  2PZW A;  4LMQ D;  1F2M A;  5C4X G;  3HOY B;  1L0X B;  1YIJ A;  1NNX A;  2NWG A;  3NE5 B;  4FO2 A;  4RCN A;  4H7B A;  1SNC A;  5FO7 B;  4DV1 L;  3A74 A;  4DV1 Q;  4DUZ Q;  1MHW C;  1VQ9 A;  2GVB A;  5GAG C;  3E6Z X;  1XXG A;  2I46 A;  1N33 L;  2DN8 A;  5M3F H;  2DUD A;  1N33 Q;  5M3F B;  3ER0 A;  4LFC L;  2B2U A;  4LFC Q;  4A76 A;  1XJV A;  1VF7 A;  1O7Y A;  4V19 0;  1UWV A;  2F0G A;  4A3J G;  4KN4 C;  4DAY A;  2FIN B;  3BDO A;  5CV9 A;  2UUB Q;  1UEA B;  4LFB L;  1EY9 A;  2EIF A;  1YEZ A;  1LTI D;  1D7Q A;  2M2L A;  4TVA B;  1JOK A;  5K5P A;  1A2T A;  1HQR D;  1YNJ C;  3J81 i;  3GTM H;  1IZ6 A;  3GDE A;  2K5D A;  3JC6 6;  3OMC A;  4GLX A;  5IGC A;  2ZXO A;  1HZB A;  2K01 A;  2QF7 A;  4C3J H;  1PZK D;  2NYZ D;  1OXS C;  1H9S A;  2SEB D;  4U68 A;  3S2H H;  3S2H B;  2B2V C;  5EKL A;  2OCE A;  1GUN A;  1X3Q A;  2WP8 J;  5ELF A;  2JA6 H;  3S2D B;  3UDX A;  1HFG A;  2IT1 A;  1BVS A;  1DJR D;  4AH6 A;  2K5Q A;  4DR7 Q;  3EA6 A;  1N36 Q;  1YJW A;  4TSS A;  2D5D A;  1C0A A;  5IP7 G;  1HH2 P;  1TS5 A;  1WTQ A;  4IFD I;  2WV6 D;  5IOC A;  5IT9 c;  4XQQ A;  4OX9 L;  4OX9 Q;  4MHE A;  2A69 D;  1EY5 A;  2VQE Q;  2R6G A;  1CM9 A;  1ICW A;  4LFA Q;  3SK5 A;  3GTP H;  1H9K A;  4J1M A;  1F9R A;  3RN2 A;  4FNF A;  3M4O B;  4QB4 A;  1PTO C;  2QEJ C;  3TME A;  1VQD A;  3NSW A;  3BZC A;  2K5W A;  2F4V L;  1K0R A;  2L9H A;  2ZT9 C;  4DU9 A;  4A3B B;  3CQZ H;  4I65 A;  4X3T A;  3CQZ B;  3KOJ A;  5C0X J;  4CJ2 C;  4ZLT F;  1JOR A;  3UE0 A;  2UUA L;  3J7A 5;  1BBU A;  2HD3 A;  3FKI G;  1E1T A;  2CW0 D;  1VQ5 A;  1CKN B;  3PUZ A;  3J80 c;  2E75 C;  4YWM A;  4KY7 A;  1ENA A;  2BCO A;  2WAC A;  3AEV A;  4DAP A;  4HIO A;  2VNU D;  1YNN D;  2RHQ B;  2N78 A;  3R2T A;  2O5I C;  1NMF A;  1AE3 A;  3T13 A;  2V1C C;  2L0C A;  3DWQ A;  1M90 C;  2ZJP A;  3E5S A;  3KLS X;  1Q7Y C;  1G6P A;  3UDF A;  3T1Y L;  5JJK A;  1TT2 A;  1PRT F;  1Q1E A;  1K0S A;  3K58 A;  4GLA C;  5C4X H;  3URY A;  3VYR A;  3SDZ A;  2ICE C;  3AQQ A;  3D3R A;  3BVM A;  1UE5 A;  3BG3 A;  2RCN A;  4TQU S;  4DFA A;  4ID6 A;  4M8A A;  1NR4 A;  3SE0 A;  1VQA A;  4DV5 Q;  1W6J A;  2KJX A;  3JAM E;  4DV2 L;  1BNZ A; 
#chains in the Genus database with same CATH homology
 3EN2 A;  3KDF A;  4BBR H;  4DV2 Q;  1VQ7 A;  3ICE A;  4DR4 Q;  2JA8 H;  4BXX G;  1PH8 A;  4AIM A;  1K73 C;  4B3R L;  1VQ4 A;  1HNZ Q;  4B3R Q;  4PZ7 A;  1IL2 A;  4LFB Q;  1S72 A;  4OWW B;  3UDG A;  4DUY Q;  4ME3 A;  1MKH A;  1QVC A;  2ATW A;  3KF6 B;  4KHP Q;  2NZO A;  4YHH L;  3W5O A;  3KJP A;  4A3J H;  4LF8 L;  1EUJ A;  2BA1 A;  3CPF A;  4JBK A;  4LF8 Q;  1PH3 A;  2K4K A;  3KDF B;  2ZJR A;  1GM5 A;  3PGZ A;  2OQ0 A;  4A3C H;  4LF7 L;  2R93 H;  3ULJ A;  3CD6 A;  2AHO B;  2UXC Q;  2CQO A;  4P74 A;  4LF7 Q;  4A93 H;  4DNI A;  4MNO A;  4X6A H;  2ALY B;  1JB7 A;  2PI2 A;  4P71 A;  2Y0S E;  2LSS A;  5IY0 A;  1XTD A;  4DR5 L;  2JA5 G;  3F8T A;  3IRB A;  4GNX A;  1PH5 A;  2MO0 A;  4FDB A;  2Z0S A;  1AE2 A;  2ZTE A;  3H0G G;  2AMC B;  4DR5 Q;  4L5R C;  4QIW E;  4OON A;  3G71 A;  1HNW L;  2Q2U A;  1X6O A;  2Z6K C;  4BBS H;  3PUX A;  4O0A A;  4QY7 A;  2K5H A;  1I5F A;  2D0P A;  2VY3 A;  5E7N A;  5AJ3 L;  3TS0 A;  2HIX A;  4A3E G;  3WWV A;  1KQS A;  1C7Y A;  2AWN A;  3ZJY C;  5M3M G;  1XPO A;  4Y52 H;  1VQ6 A;  4YWL A;  3I4M H;  4A3G H;  1ASZ A;  1Y1V H;  5C44 H;  4GNX B;  1N32 L;  1B8A A;  1S40 A;  1EIF A;  3CCR A;  4DV3 Q;  1IBL Q;  4A3I H;  1X56 A;  1Z47 A;  3U58 A;  1KRS A;  3T1H L;  3GTQ H;  1Q8K A;  4BY7 G;  4IFD G;  2D62 A;  4JC0 A;  2AWO A;  3T1H Q;  2NVQ H;  1X55 A;  4GKK L;  3M4P A;  1P8L A;  1I3Q H;  4APV A;  1MJE A;  3SGI A;  1B7Y B;  5IP7 H;  4AYB E;  1QUQ A;  2ASB A;  1HZ9 A;  4LUO A;  5LMN L;  2L15 A;  2Q2I A;  4NPS A;  4RMF A;  3TS2 A;  2K52 A;  2D0O A;  4R1J A;  5LMN Q;  4L5S A;  3DM3 A;  3HOU H;  3LGJ A;  4JV5 L;  2IX0 A;  1X3G A;  4C2M H;  4X65 Q;  1VQE A;  1GVP A;  3PV0 A;  2HIV A;  1E22 A;  4IJH A;  1UE7 A;  5GRO A;  3STB C;  1QZG A;  4BA2 I;  4BA1 I;  1QVG A;  4JI2 L;  1LM0 A;  1WCM G;  3F2B A;  3PF4 A;  3M3Y H;  1KHI A;  4R4I A;  1A62 A;  4JI2 Q;  1EYG A;  3PO2 G;  1AH9 A;  3PO3 H;  3CF5 A;  4GOP A;  1NY4 A;  1V43 A;  1QUQ B;  2AKW B;  2K50 A;  4YY3 L;  4JI5 L;  2F4V Q;  4YY3 Q;  2Z6K A;  4P72 A;  3HKS A;  4JI5 Q;  1BBW A;  2C35 B;  1PYB A;  5IP9 H;  3NEN A;  2UXD L;  3RNU A;  3RLO A;  3I2Z A;  1VQK A;  2KBN A;  2K14 A;  4A3B G;  2UXD Q;  1Y1W H;  3OTO L;  4LUV A;  1HJP A;  3CPW A;  4HJ8 A;  4JI6 L;  4PMW A;  2VUM G;  1WJJ A;  5GAH C;  4BY1 G;  5C3E H;  2UUA Q;  4Y7N H;  3HOW G;  4YCW A;  4GOP B;  1PH7 A;  4KLK A;  5IWA L;  4LF6 L;  3W1B A;  5IWA Q;  4DV0 L;  3RN5 A;  2YTX A;  4A3K G;  2VZA A;  1W2B A;  4GLV B;  4IJL A;  1NBW A;  4J15 A;  3VDY A;  3PIO A;  4DR3 Q;  3FKI H;  2R92 G;  1K8G A;  3D0F A;  4DKA C;  1SRU A;  1XNQ L;  3HOX H;  1NTG A;  4A3D G;  1VQP A;  2E2J H;  2MQH A;  1TWF H;  1XNQ Q;  3GTO H;  2PQA B;  4A3F H;  3UE1 A;  4A75 A;  2N3S A;  3J80 i;  1XMO L;  2MFI A;  1PH1 A;  3HOV H;  3HOZ H;  4GNX C;  4LUZ A;  1PH9 A;  2ID0 A;  1EQR A;  4JYA Q;  4JI7 L;  3T1Y Q;  3M4Q A;  3S24 A;  4AYB G;  3S17 H;  1LTL A;  2WFW A;  3F2D A;  1PV4 A;  2UUC L;  1V1Q A;  4JI7 Q;  3U4V A;  3EBE A;  5C0X I;  1I94 L;  2UUC Q;  1C9O A;  1CUK A;  2VS1 A;  3PCO B;  4DV4 L;  1I94 Q;  4DR6 L;  1A8V A;  1UE1 A;  2LXJ A;  2VL6 A;  1PYS B;  4PZ6 A;  2WB1 E;  4GN5 A;  2E2H H;  2E2I H;  5JJI A;  4JBW A;  1YHQ A;  3GO5 A;  3ULP A;  3HOY H;  3K0X A;  4LF5 Q;  3KFU A;  4R4Q A;  5FJ8 H;  3OYY A;  1KC8 C;  1SE8 A;  5EAY A;  2JA7 G;  1CKM A;  1WI5 A;  5M3F G;  2NVX H;  5H1S E;  1SN8 A;  2R7D A;  4DUZ L;  3K80 C;  2JEA I;  4O2D A;  4R4O A;  1MJC A;  4HJ7 A;  2B63 G;  1GD7 A;  2CWP A;  3STB D;  4HID A;  1EQQ A;  3TEH B;  1GO3 E;  3BU2 A;  1HR0 L;  1OXX K;  4YHH Q;  3S1R H;  4LF9 L;  2VQF L;  4BXX H;  1JJG A;  2IHE A;  2ZTD A;  4LF9 Q;  2VQF Q;  4B3M L;  1TXY A;  4DR7 L;  3J81 c;  2B29 A;  4B3M Q;  3RLF A;  3GD7 A;  1L0W A;  4DV6 L;  4JI8 L;  4JI4 L;  1N9W A;  4DV6 Q;  1E1O A;  2UUB L;  5GAE C;  4JI8 Q;  1J6Q A;  5LMN W;  4ALP A;  1DGS A;  3L0O A;  4GOP C;  1PHJ A;  2HT1 A;  3I7F A;  4WJ3 M;  5LMU L;  4UP8 A;  2N8N A;  3MEF A;  4IFD J;  4NXN L;  5LMU Q;  1HNW Q;  1U0L A;  2JK8 A;  2RHS B;  4DR1 L;  4NXN Q;  4NXM L;  1NMG A;  1YNX A;  3E0E A;  4DR1 Q;  1L1O C;  4JCV E;  3NBH B;  1D8L A;  1TWH H;  2JA5 H;  2OWO A;  1CSP A;  2A8V A;  5AJ3 Q;  2MO1 A;  4PG3 A;  4DAY B;  3H0G H;  1JE5 A;  2IY5 B;  3S1M H;  5IYB G;  1PH6 A;  2JA6 G;  3K8A A;  1N32 Q;  2KCM A;  1Q86 C;  3D31 A;  3U4Z A;  1PFS A;  4QL5 A;  5IYC G;  4EQ5 A;  1EFW A;  4A3E H;  2R7Z G;  1IYJ B;  4UP7 A;  5GQO A;  1Z9F A;  2F3I A;  5M3M H;  2WB1 G;  2YYZ A;  3J7Z C;  4X62 L;  2PNH A;  1K83 H;  5JEA G;  4JI1 L;  4X62 Q;  4GKK Q;  3S2D H;  1A63 A;  4UPA A;  3HKZ E;  4RG1 A;  4JI1 Q;  2GN5 A;  1BKB A;  2MNA A;  1SMX A;  4IPG A;  1TWC H;  2ZTC A;  3A5U A;  4DR2 L;  1T9H A;  1TWG H;  4DV7 L;  1N36 L;  3H3V H;  4QJF A;  4DR2 Q;  1WFQ A;  5FLM H;  2UU9 L;  4BY7 H;  1HZA A;  4JV5 Q;  2BH8 A;  4AQY L;  4X64 L;  1B70 B;  2XGT A;  3I55 A;  2CKZ B;  3CME A;  1VQI A;  3CAM A;  3Q8D A;  4YCV A;  1HZC A;  1YIT A;  3ERS X;  3H15 A;  1KAW A;  2ZJQ A;  1YHA A;  1FGU A;  2VQE L;  4PZ8 A;  5BR8 L;  3JAM c;  1E24 A;  4LFA L;  3I56 A;  1OXT A;  1X3F A;  3K7A H;  5M5Y H;  1PVO A;  3S16 H;  1L1O A;  3I4N G;  4B3T L;  3PUV A;  4JI3 L;  3PO2 H;  1KXL A;  3KF8 B;  1K3R A;  1VQC A;  3M4O H;  1FL0 A;  4MTN A;  2F52 A;  3OTO Q;  1OXV A;  4JI6 Q;  4OWX B;  5DLQ E;  1JT8 A;  1VQH A;  1PH2 A;  4R4C A;  1W3S A;  4QGU A;  1ASY A;  1Q12 A;  3PUY A;  4LF6 Q;  2PQA A;  4DV0 Q;  5C4J H;  1UE6 A;  1JMC A;  4A3M G;  4A3B H;  1L1O B;  2VUM H;  4NB3 A;  1EIY B;  2UXB L;  1VQN A;  1VQB A;  4BY1 H;  3HOW H;  3KYH C;  4QQB X;  4X66 L;  2JJQ A;  2Q2H A;  1SRO A;  3NEM A;  4OWT B;  1VQG A;  4X66 Q;  1FJG L;  1EWI A;  4POG A;  3CCQ A;  4A3K H;  4HIM A;  5IYD H;  1GKH A;  4GN3 B;  2NN6 I;  2K75 A;  1HR0 W;  3CCM A;  5K36 G;  1XMO Q;  1IBM L;  3RZO H;  1CKO A;  2R92 H;  3OW2 A;  2B3G A;  3HKZ G;  4KHZ A;  2I5M X;  1VQ8 A;  4B3S L;  3B6Y A;  4OO1 I;  3AFP A;  2KCT A;  1VQF A;  2PI2 E;  3BZK A;  4A3D H;  4K0K L;  1H95 A;  4GN4 B;  1G51 A;  4L5Q A;  5C0X G;  4IPH A;  4A3L G;  2CCZ A;  4DV4 Q;  4K0K Q;  3FP9 A;  4C3I H;  4DR6 Q;  1VCI A;  3K7U C;  1YVC A;  1YZ6 A;  3S15 H;  4GS3 A;  5C4X G;  1EOV A;  3BJU A;  1RL2 A;  2NZH A;  5HY6 A;  4POF A;  1YIJ A;  1VQL A;  5HGQ A;  2ZM6 L;  1XPU A;  1K9M C;  1Q82 C;  4DV1 L;  3A74 A;  1LYL A;  4DV1 Q;  4DUZ Q;  2KHJ A;  1R9T H;  5JJL A;  1VQ9 A;  3RZD H;  2GVB A;  5GAG C;  4HJ5 A;  3AFQ A;  4BBR G;  1E3P A;  3TQY A;  2JA8 G;  1JJC B;  1N33 L;  3CCJ A;  2JA7 H;  4R4T A;  3E9I A;  2DUD A;  5M3F H;  1HR0 Q;  1N33 Q;  4IOA A;  3ER0 A;  3S1N H;  4LFC L;  4DV5 L;  2HQL A;  3PF5 A;  4LFC Q;  1QVF A;  4A76 A;  2I5L X;  1XJV A;  1M1K C;  4DR4 L;  4HJ9 A;  2B63 H;  1UWV A;  1S3O A;  4A3J G;  4UP9 A;  3FHW A;  1KIX A;  1HNZ L;  4JI4 Q;  4LNQ A;  2CFM A;  5IE8 A;  1SFO H;  2UUB Q;  3S14 H;  4A3C G;  4LFB L;  2R93 G;  2EIF A;  1YEZ A;  1XMQ L;  4KI0 A;  4DUY L;  5ELO A;  4LF4 L;  1D7Q A;  1Q81 C;  3PSI A;  4A93 G;  3A5Z B;  1XMQ Q;  1Q1B A;  1HNX L;  4LF4 Q;  4L5T A;  4A4I A;  4TVA B;  2E8G A;  4KHP L;  1OTC A;  3GTK H;  1HNX Q;  1PH4 A;  4DK6 C;  2QEX A;  3CCS A;  1O7I A;  5FLX c;  3J81 i;  3GTM H;  5JEA J;  4NXM Q;  3CC2 A;  3G6E A;  2PMZ E;  3CP0 A;  3F1Z A;  3TRE A;  1IZ6 A;  2K5N A;  1Q46 A;  3GDE A;  4JOI A;  1YJN A;  2UXC L;  3JC6 6;  4GLX A;  3TRZ A;  4BBS G;  3CCL A;  2LXK A;  3AYH B;  1HZB A;  1IXR A;  1E7Z A;  4C3J H;  1OXU A;  1NJI C;  2QGQ A;  1V9P A;  1OXS C;  1PA6 A;  1KL9 A;  3L2P A;  1IBK L;  4JG2 A;  3S2H H;  1I50 H;  3I4M G;  1IBK Q;  4A3G G;  3NEL A;  2DGY A;  1Y1V G;  2KHI A;  2IHF A;  5C44 G;  4IO9 A;  1NE3 A;  3MXN B;  2OCE A;  5IYB H;  2WP8 J;  3J81 j;  2JA6 H;  1SLJ A;  3UDX A;  5M5X H;  4A3I G;  2BA0 A;  1I6H H;  5IYC H;  1JJ2 A;  4JBM A;  2IT1 A;  1BVS A;  4P75 A;  4AH6 A;  2FXQ A;  4DR7 Q;  1N36 Q;  2R7Z H;  1YJW A;  4DV7 Q;  2HHH L;  3CCE A;  1UEB A;  2UU9 Q;  2A1A A;  1X65 A;  2OTJ A;  2WAQ E;  1C0A A;  1Y14 B;  2HHH Q;  5IP7 G;  1HH2 P;  3H3V I;  3L7Z C;  4DV3 L;  3A0J A;  1IBL L;  3GTG H;  4AQY Q;  4IFD I;  4X64 Q;  1MIU A;  5IT9 c;  5FLM G;  4OX9 L;  3UDI A;  3HOU G;  3I4O A;  3CCU A;  1P16 A;  4OX9 Q;  2OQK A;  3G48 A;  4EX5 A;  4JBJ A;  2VQE Q;  2R6G A;  1X9N A;  4OXP A;  3CW2 C;  5BR8 Q;  1VQJ A;  4P73 A;  4C3H H;  3CCV A;  4LFA Q;  1A0I A;  2ES2 A;  1WCM H;  3CC4 A;  3GTP H;  3PO3 G;  2GVA A;  1YI2 A;  1YBY A;  4X65 L;  1L2F A;  4B3T Q;  2IX1 A;  3M7N A;  3RN2 A;  4JI3 Q;  4YWK A;  5M5W H;  4UY8 C;  1XPR A;  3HFZ B;  2OTL A;  3S1Q H;  3CXC A;  5IP9 G;  1VQD A;  1N34 L;  4HIK A;  1N34 Q;  3BZC A;  2H5X A;  5ELN A;  3CMA A;  3ULL A;  3JAM i;  1Y1W G;  3I4N H;  3EIV A;  2F4V L;  4JI0 L;  1K0R A;  3RLN A;  5C3E G;  4MZ9 A;  1CKN A;  2K5V A;  1TWA H;  1KD1 C;  2I0Q A;  1VS0 A;  3CQZ H;  4JI0 Q;  4LWC A;  3GTJ H;  3KOJ A;  2UXB Q;  1VQO A;  2YU9 H;  3GTL H;  3DLL A;  5C0X J;  4IOC A;  1SR3 A;  1K8A C;  2Y0S G;  2YV5 A;  1FJG Q;  1FVI A;  3UE0 A;  1WYD A;  2UUA L;  3J7A 5;  1XNR L;  4A3M H;  2EQS A;  1BBU A;  3KJO A;  3E9H A;  2E5L L;  2JEB I;  3FKI G;  1XNR Q;  1U5K A;  4WJ4 A;  2NN6 G;  1E1T A;  1VQ5 A;  2E5L Q;  4IPC A;  1CKN B;  2BH2 A;  3PUZ A;  2XTI A;  1RIP A;  4XTC S;  3J80 c;  1YHB A;  5GAD C;  3HOX G;  1IBM Q;  3M9B A;  3K81 C;  4DPG A;  4YWM A;  5IYD G;  1J5E L;  4A3F G;  3G4S A;  3HOV G;  4DR3 L;  1J5E Q;  4B3S Q;  2NVT H;  3AEV A;  3HOZ G;  4OO1 G;  4HIO A;  2VNU D;  3PIP A;  1X3E A;  2VW9 A;  1N8R C;  2WAQ G;  4JOI C;  4GKJ L;  2RHQ B;  2N78 A;  3W1G A;  4H02 A;  2Q2T A;  4GKJ Q;  2QA4 A;  1NMF A;  1AE3 A;  2V1C C;  2N49 A;  2NVY H;  3F2C A;  1VQM A;  2JE6 I;  4XIG S;  1YJ9 A;  4LW1 A;  1M90 C;  1KRT A;  2ZJP A;  1Q7Y C;  1G29 1;  2ZM6 Q;  4JYA L;  1G6P A;  3UDF A;  3T1Y L;  4DK3 C;  4A3L H;  4DAM A;  5JJK A;  3HOY G;  2I5H A;  3CC7 A;  1Q1E A;  4YCU A;  3U50 C;  5FJ8 G;  4GLA C;  5C4X H;  2KEN A;  2JQO A;  4HJA A;  2CWA A;  3AQQ A;  3RR5 A;  2YTV A;  2RF4 A;  1UE5 A;  1CSQ A;  1X54 A;  2RCN A;  2EXD A;  4TQU S;  1QZH A;  5J3B A;  2A19 A;  4LF5 L;  3PUW A;  3M85 A;  3KF6 A;  1WOC A;  1VQA A;  2YTY A;  4DV5 Q;  2JA9 A;  3KLW A;  4IPD A;  2R7F A;  4DV2 L;  1LUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...