3J80L

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 20
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j80L00
5FLXL 5IT9L 5A2QL 3J81L 3J80L 3J7AV 5LL6X 3JAML
chains in the Genus database with same CATH superfamily
3OMGA 1KNAA 4NPSA 3M4QA 3MEFA 4AIMA 1EYCA 2E8GA 2KEDA 4XXEA 3M3YB 4KLKA 5C3EH 4ZUJA 1OXSC 3HKZE 3J80c 4TKOB 4JI6Q 1QVCA 2KQ3A 3SHLA 2VS1A 2LKVA 2A6ED 2QF7A 2WACA 1N32L 4DR6Q 1G91A 1HUMA 2O4XA 3CCJA 3E0EA 1BO0A 3I55A 3MHBA 3ERSX 5C4XB 3Q22A 2J7ZA 4ZCKA 2SNMA 3M85A 2A6HC 3HOZB 1QUQB 1B9NA 1R4PB 2A8VA 2WFWA 1X55A 3LWUA 5C0XJ 1G2SA 3HFZB 1U9RA 1G8ZD 4L5TA 5ELBA 1YJNA 5DNFA 1NE3A 3NQIA 4AYBG 3P1HA 3PO3H 1SNMA 2XIWA 1LT6D 3R2TA 1GHJA 4KHVA 3HOYB 1SYBA 2KCTA 3GTMH 2TSSA 1YNNC 2J0TD 4DV6Q 4BY1H 5IP7G 3RUZA 1PTOB 4C2MB 4FVMA 3RLOA 4DU9A 1J9OA 4X66Q 2IPKD 1X3GA 3KYHC 4K0KL 3M4OH 1SDFA 3U9OA 2QEXA 4JYAL 5A2QE 1E1OA 1J8IA 1CSPA 4X62L 3BYYB 2K5HA 4MTKA 3NSWA 4QMGA 5FJ8G 1W2BA 4JI0Q 1MHWC 4JI2L 1ESFA 1K8AC 1UE7A 2PCFB 3KBXA 4C1NK 3J7AV 1TVXA 4XTCS 3ND8A 2L12A 3V05A 2JA5H 2L55A 1EY9A 3C46A 2VW9A 2Q2HA 2Q2UA 2A68C 1KLGD 1FVIA 5IYCG 4HR7B 2F0VA 5C44H 2B29A 3EROA 1K8OA 3E3XA 1HQRD 4DV0L 3BZDB 4PZ8A 3A0JA 4H02A 1STYA 2ZTDA 4Z9CB 3FEWX 1I4PA 3RR5A 5JPMC 5JJLA 3NTHA 3S1RB 5M5WH 2Q2TA 1Z9FA 1C48A 2PQAA 4LUZA 2F0PA 5A35A 3PV0A 2H4OA 2L5TA 4OELB 1LT3D 1D5ZC 2UUBQ 5AFWA 1IYUA 4B3ML 2MP1A 3EBEA 3UE1A 4OO1I 1WTXA 4IUTA 5LHY1 3WOEA 2HHHL 4J8QA 1M90C 3PO2H 1JOKA 2Z6KC 1HPCA 2F0KA 2E2JB 4ODGA 4R4CA 4YWMA 5C6AA 3H09A 4IOAA 2BOSA 2L15A 1E0BA 1S3OA 4FDBA 2EXDA 4ZK9B 1NMGA 1KRTA 3W1BA 4GN5A 1SE4A 2UXDL 4FF3A 3RN5A 2PI2A 3CCSA 2NUCA 5FO7B 5CR3A 1NNXA 4R9WA 3E0JA 4HJAA 4YWKA 2R92B 2ICEC 2RA4A 3HKZG 1JB3A 4C3JG 1G6PA 3VYUA 1V9PA 3MXGA 3GTQB 3I4MH 2PZUA 1ET9A 4DXFA 1KDCA 4YHHQ 5M5XB 2RDGA 1IHZA 4JI8L 3NHHA 2NTTA 5EPJA 4IUNA 1IYVA 1KHIA 2Q2IA 1SFOB 4DV2Q 3DMUA 1HNWL 5CV8A 3UI2A 5HGQA 1C8CA 3MA2B 4JW0A 2HIXA 4CKCA 1WCMB 1DM0B 1VF7A 2JJQA 2N49A 1HCZA 1TU2B 4A3JH 1XNRL 4RHRA 2KECA 3CC4A 2RVLA 2C5CA 4JBJA 4BBRH 4PZ6A 5EKKA 1B70B 1YHAA 3K7AB 4LF6Q 4XYOA 4M1UB 1LTTD 4XQJA 3EFXD 1LT5D 2G9DA 4OX9L 4HSPA 1NSNS 2K33A 1CT1D 3M4YA 2X6LA 1E2ZA 1CI3M 4B3SQ 4DFAA 1PFBA 1JQYD 1JWUD 2UUCQ 4DR2L 1I4RA 3IFDA 3M7NA 4R4OA 1WTHA 2VXWA 1P16A 1B4OA 1QJOA 1E2VA 1QCBD 1CKMA 2VUMH 1VQFA 2SNSA 3NXWA 4JVZA 3FP9A 5C4XG 4XT3B 1HUNA 5LL6S 1PTOD 5FLMH 1CHPD 1J5EQ 2NVXB 2K03A 3I70A 2B2VA 3QO2A 1OXUA 1B50A 4WJWA 1VQKA 3K0XA 5FLXL 3RZDB 3I4OA 1CKNB 2NZHA 1X3EA 2Z1CA 3AU7A 1PH5A 4B3TL 1F9SA 1VQ6A 3ND9A 5I2YA 3HOYG 3CMAA 3PO3B 2BCOA 5G3LD 1WTVA 3GTKH 4PQXA 4FP5D 4LF5L 2UXCQ 2ZJPA 2MPMA 5EBCA 3CPWA 1F2LA 3A8IE 3MAQA 1V1PA 1ASZA 1JB7A 1IBMQ 4A4IA 3FKIB 2E2IB 1UE5A 3PF5A 2FINB 3KF6B 3RLFA 4UPAA 3DHQA 4GLAC 2E5LQ 2WINB 5K5PA 1H9SB 4FO2A 3U58A 5LMNW 2EYJA 2EY6A 4F7XA 3QIAA 1V1OA 1FJGQ 1WTRA 3MXUA 3L3OC 4G7HC 4KKSA 1X3PA 5K36H 4A3KB 5NUCA 1EQRA 3VR5A 1HZCA 4BY7B 4AH6A 1NMFA 1U0LA 1X6OA 3RMHA 2C35B 3AQQA 2RDFA 4GN3B 2CQAA 1RTOA 2NTSA 1TR5A 4OONA 1K83H 3V2TA 3W2DA 4DAYA 4DR4L 2D9UA 5IWAL 3F2CA 4HMIA 3GTPB 1GXDC 2EY1A 4GLXA 1Y1VB 4DR7Q 5I6WA 3URYA 3A54A 4UAIA 5FOBB 3PIO3 3H15A 4V0BA 2XWBB 3HGBA 4RCNA 3PMFA 4TQUS 1Q8IA 4J1MA 5BN4A 3FPPA 3KK7A 4C56C 1JICA 2GA4B 2MGSA 1S5FD 5FKAC 3Q24A 1SYEA 1K73C 1IW7C 1ONLA 2KOLA 3SK8A 2D5DA 2NVQB 4NMZA 2SDFA 1TIID 2A19A 3UDIA 3PGZA 1D5MC 2TMPA 1EYAA 4JI3L 3GD7A 3MEHA 5EPKA 1LT4D 5IYDG 1X9NA 2VL6A 3CQZB 3CU7A 2NBFA 4DR1Q 4LF9L 1F2MA 1D1KA 3DEPA 2Q8TA 2NVTB 2Z6KA 4JI1Q 1XYIA 4NDXA 3KDFB 3VR6A 3CF5A 1F77A 5KEEA 2JA7B 1OXVA 4L5SA 2R92G 2NVYB 4A3BB 5IGGA 1XMOL 3HOUH 2JEBI 5JPNC 3T1YL 1K8MA 4A76A 1EIFA 4K8IA 4JI5Q 4IFDJ 2FFKB 4BA1I 2EJFC 1TWHH 4LFCL 4ME5A 1HZ9A 4LF8Q 1WCMG 4O0AA 3H3VC 4O42A 2DJFC 5M3MH 2JA6G 2E74C 1MSHA 2XNAC 1Q90A 3HKSA 2G9HD 3NWSA 3G71A 5FO9B 2E2HB 1VCIA 2WB1E 1L0WA 4BBRB 5KNDA 1SE3A 1JWSD 5CGKA 4DV3L 4NXNQ 2ID0A 2A6HD 2JEAI 3SEBA 4A3EB 2ZTCA 2M2LA 1JJ2A 1CUKA 3FPUB 5FLXE 3OSOA 4A3FB 4QB4A 2AQ1B 1LO5D 4QQBX 5C3EG 1VQNA 4U673 3T53B 1WTPA 2HD3A 5EQ0A 4CKBA 4XIGS 3IRBA 2D62A 2Z0SA 2PZWA 2AKWB 1CQVA 5EKLA 1YNND 1RL2A 4OWXB 2R93H 4L6TB 1WTOA 3HOWH 4CHTB 4KHPQ 5T1IA 2EXZA 2Z4HA 5FO8B 1VQHA 3S16H 1GUTA 2F4VL 2ATWA 4JV5Q 4KV6A 2EYLA 3CXCA 4OIJA 3FHWA 2XVSA 3F2BA 3QJYA 1TS3A 1SBBB 2K5VA 5IP9H 3OW7A 3M9BA 1F2YA 3S1MH 3E9IA 1EIYB 1YIJA 3NP8A 1IL8A 1Q1EA 1LLRD 3H94A 1OTCA 2A69C 3OIPA 3PO3G 1JJCB 3J7ZC 1GJXA 2ES2A 2ICIA 1XTCD 1SNQA 1SJED 1A63A 3JC66 3K80C 3CW2C 2MO1A 3HZXA 5BR8Q 4A3MH 1TXYA 3FKIG 1HR0Q 5JJZA 4QJFA 2K6AA 4KY5A 2N88A 3A7AB 3CRLC 1O7YA 2CCZA 2CH4A 2IX1A 3Q0AA 5JVG3 4A3GB 5ISRA 5J39A 1YJWA 1XPOA 3NK9A 3A5ZB 4E6IA 1N36L 1R9TH 3GTJB 3J81c 2L4NA 2P5ZX 1KDAA 4A3KG 1U4RA 5LL6X 1XPUA 3PUWA 2MUYA 3AB9A 2Z8LA 3OHXC 2K50A 1CSQA 1I94L 2OF1A 4CGYB 1MGSA 4N8FA 5T1GA 1A15A 5C44G 3V96A 2ZTEA 1PVOA 4BBSH 2DUDA 1VQEA 2K52A 1Y1VG 5H1SE 2R7ZB 3G4SA 4IUVA 5EJWA 2B2WC 3D6WA 2CH4W 4CDEC 1C7YA 4R4TA 2MJ8A 3MFGA 4YIJA 1Q82C 3D6CA 2OWOA 5CORA 4LJZC 2RCNA 4K2KA 3RLNA 1PH8A 2PZTA 4OEMB 1N33L 1SMXA 4LFBQ 1PFNA 3U4VA 2LS01 2XGTA 1T9HA 4P71A 3S2DB 1CFMA 2B63B 3DWQA 4ILWA 3SE0A 1KAAA 1Y1WH 1PFMA 3IKJA 4RGTA 1I50H 3PO2G 3OPOA 2C9OA 4KMUC 3S1QB 2AMCB 4KY7A 1F9PA 1A6XA 1UE1A 2EQSA 4JOIC 4AQYL 4GKKQ 2WB1G 3NBHB 4A3CH 2HQLA 4JC0A 1STHA 2KBNA 1MI2A 1TKWB 1CZWA 3I91A 4A3LG 1NUCA 4A3BG 5DLQE 1FYCA 1HFGA 2K32A 1YHQA 1UEAB 3IL8A 1SE2A 2F1MA 2KJXA 4HIMA 2F0JA 3GTLH 1LTID 5EKIA 1AE3A 3HOUB 1WVLA 4NXMQ 2HCIA 3I4MG 3GTGB 1PZKD 4RKBA 1SEBD 2F03A 2DGYA 1I3QH 4WORA 5C0XH 3SDZA 2VY3A 1GM5A 3F2DA 4HMJA 5C4JB 4A3IH 1MKHA 1QZGA 1I6VC 4WJ3M 1BDOA 3CKIB 3MXNA 2UXBL 3TP8A 3VYTA 4A3JG 4UP7A 1IBLL 1Z7TA 4G57A 1SNOA 5L37A 1G291 4OO1H 4XDXA 3NQTA 1BNZA 4MN3A 1KLUD 4BBRG 2LXJA 1TWFB 4WRDA 5C4ZA 4JK1C 2F0WA 1KQSA 4APVA 4KJOA 4A3EG 4K5VA 3VDYA 5C3XA 3ITPA 1K8GA 3S1NB 3FDTA 3VA7A 4DNTB 1DGSA 4A3FG 1I6HH 2DJGC 3OTOL 2YU9H 2HDLA 1TWGH 2Q8RE 2D0PA 2ZM6Q 1L0YB 4P73A 2RDHA 2HUGA 3X3NA 3P7JA 4IUUA 4JCVE 4EGVA 1I4HA 1UNSA 3TP5A 3IAYA 4A3DH 3S14B 3O13A 2JA8H 5KNBA 2Z6BA 3H0GH 3AYHB 1K0RA 2UUAL 1O7ZA 1V1QA 2K14A 1MJEA 5I2XA 3PCOB 2B2UA 3HS0C 1RD9D 3CC7A 4HJ5A 3KBGA 1BCPF 2A5HA 2O5JC 3S16B 1TWCH 2I5LX 4OGQC 3KLSA 2R3ZA 2JSOA 4X62Q 1A2TA 3KF8A 1QUQA 1K3RA 4JI2Q 1NJIC 4JI6L 1HZBA 1HR0W 3PIPA 2WAQE 1GUOA 5E1FA 4GN4B 1PYWD 1GUGA 3BS1A 4A3GG 3A7LA 2E2DC 3ZYYX 4DV0Q 3KLSX 4BA2I 3S15H 3FVQA 4CJ1B 4XYQA 1LABA 1O78A 3U9SA 1EWCA 5EGTA 1E24A 1U4MA 4KN4C 2IW3A 5M5YH 3JAMc 3CC2A 2KVMA 1TWAB 1IW7D 5I6YA 1GKHA 4B3RQ 1F9RA 1U4LA 4LNQA 1EFWA 4POFA 4B3MQ 3PUXA 2D0OA 2F0FA 4MNOA 3RD4A 1EEFD 3CCQA 4Y7NH 1PLFA 2R7ZG 4ZUIA 1YZ6A 3AFPA 1O80A 3RZOB 1KTKA 3PUZA 4K6DA 3BVGA 4S3SA 4RWSC 3T1HL 1YITA 4OXPA 2M9VA 3OW2A 2NN6I 1N8RC 4GOPB 2UXDQ 5D3IB 3QR8A 2N8NA 3F1ZA 1N34L 5LMNL 1EFID 1NR2A 5IE8A 4HJ7A 4A93B 1AH9A 1FD7D 2RBMA 2X6GA 3HOXH 2LXKA 1DONA 2B63G 2AUJD 2K5QA 1KRSA 5ELFA 4X6AH 3QWNA 4HSVA 1BOSA 1D5XC 4DK0A 1DOMA 2HT1A 3FRPB 5M3FH 1PH4A 1JCKB 2F4IA 3TREA 1EQTA 3CRKC 1Y1WB 1FGBD 3VA5A 5KYIA 1GUSA 3TQYA 2UU9L 2SEBD 4JI8Q 2PQEA 3N6RA 1STGA 3QG1A 4LF7L 4ID6A 4H44C 4CBVA 1B1ZA 1PZJD 4TSSA 1XJVA 1SYDA 5IYBH 3SK4A 1KNEA 2WKCA 4MIUA 1BUVT 3GTOB 1E3PA 4DR5L 2IJ0A 4JG2A 3HOUG 1STAA 3L0OA 3BDOA 1QILA 4YWLA 2H5XA 2NB0A 1LTAD 4OX9Q 5ELOA 1YJ9A 3HRZC 1IKLA 1A8VA 1IXRA 5JEAJ 3HOVH 2EDGA 2K5WA 2JA6B 3CPFA 3TZUA 3A5UA 4DR2Q 1PH6A 4GKJQ 2IWHA 1SAPA 1HA6A 5M3MG 3AMUA 4DA2A 4DV1Q 2BA1A 3S17H 1EEID 4UP8A 1L2FA 2PI2E 4X65Q 3D4WA 4FF4A 4P75A 4QCLA 1XNQL 1VQDA 4YY3L 3E5SA 4PZ7A 3G48A 4NW2A 2LMCB 4RKLA 2CHBD 5C3EB 1HXYD 2LY7A 2WAQG 3S24A 3OWFA 2A69D 1RTNA 3DWAA 4DV2L 4B3TQ 3PF4A 2IT1A 3VYRA 1Q7YC 1TY2A 2DN8A 1M1KC 1IBKL 4K2LA 2AWOA 1GO3E 4I65A 4LF5Q 2R93G 5JJKA 1EY4A 1A0IA 3K58A 1GOZA 1D8LA 5LMUQ 1LV9A 2F0QA 4R8NA 1QE6A 2MHVA 4F88A 3QOJA 3M7GA 2MFIA 4N9PA 3CCRA 1KL9A 1MD2D 4LW1A 1SR3A 1QVGA 4JI4Q 3TZDA 3EN2A 2MNAA 2VNUD 1CTMA 4ABNA 5IIFA 1NR4A 3LWEA 5F2DA 4B3SL 3GTMB 1CKNA 1HZAA 3BVZA 3KJPA 2R7FA 5GAEC 1L1OB 2CW0D 4BY1B 3WWVA 1V1PB 5EBDA 3K7UC 4A3MG 3WOFA 3M4OB 2J4XA 4DF7A 2FMMA 4DR4Q 2R6GA 3A8KE 3RNUA 3ICEA 1CK1A 4DR3Q 1EWHA 3UE0A 1VQIA 3MFYA 1Q8KA 2I46A 2KHJA 2K01A 2OQ0A 3A8JE 5DM73 1VQ4A 2VQEL 1ASYA 2YTVA 3SK5A 1YNXA 3T13A 1D7QA 2JA5B 1H9SA 1NTGA 3EJIA 4RGNA 4B9WA 2NWGA 4HIDA 2RHQB 3EVQA 4K6LA 1SRUA 5C44B 5EAYA 1FNVA 3S2HH 2B2YC 2UXCL 1XMQQ 3S9WA 4NB3A 4BBSG 5IYCH 1IBML 4Y7NB 1SJHD 1KABA 4IFDH 4DUYL 2V4DA 2EYFA 1QNUA 3AFQA 4JI3Q 3TEHB 1BBWA 5E4WC 4C3HH 4KK7A 4XT1B 1WTWA 1GUNA 3ULJA 5M5WB 2ASBA 4DPGA 3BZCA 1WD0A 1SNPA 3UDXA 4LF9Q 3PIP3 2CWAA 3BJUA 1A2UA 4KD3A 3U4ZA 4A93G 3MZ5A 1FJGL 1SYFA 1U4PA 1NBWA 1VQGA 3I4NH 4YCVA 2A73B 1ILQA 5IGDA 3K59A 3PO2B 1TS5A 4N9TA 1Y1WG 3T1YQ 2FMCA 3TRZA 2FJ2A 2F0GA 4RMFA 1SNCA 2JE6I 3Q6SA 5GROA 3BDLA 1R4QB 2RKSA 2WB1B 3A74A 3BVMA 4ZLTF 1JC7A 2XRQD 3IFTA 3STBC 4GNXB 1K28A 4R4IA 2A74C 4ULLA 2QKIC 2EJGC 4DV7Q 4LK1C 4V190 2X69A 1JWMD 1AFPA 1A3TA 3KDFA 1FGUA 1Q1BA 4NKLA 1RCVD 2K4KA 3I4MB 1BCPB 4KY6A 2MO0A 4LMQD 1ESRA 5BN3A 3C1FA 2HIVA 4C3JH 2HQEA 2A1AA 3I2ZA 1BR9A 1PYSB 1SLJA 2EE1A 5C0XG 4QIWE 3J80L 1HFNA 4A3IG 1I5FA 2PNRC 3B6YA 3G6JB 4YCWA 3K57A 4A3JB 2ENBA 4DV5Q 1DZ1A 1RJTA 1X65A 4KTAA 2CVRA 4JI1L 3OOCA 1XX8A 3D4DA 3H3VH 2L1BA 4ZKCB 1SYCA 2YV5A 4MZ9A 4PMBA 5GAGC 1JT8A 1F2ZA 4CJ2C 1SXTA 4QUCA 1GD7A 2F4VQ 1PYBA 2K5DA 5IODA 4BWGB 1DXMA 1PRTB 2IY5B 4G4KA 4HEDA 4RH6A 2JYOA 5E7NA 3C3LA 4DAMA 4HCSA 3M3YH 2ZJQA 4UY8C 4A3DG 3T4AC 3L7ZC 4LF8L 2JA8G 3J81E 2VUMB 1D1IA 2PO4A 3DEOA 3H0GG 1Q46A 2PNHA 2F52A 3DUZA 4K8JA 1M4VA 2OXPA 4PG3A 1EIGA 1S5BD 1ZKOA 2K5NA 1LYLA 3I7FA 5D14A 1X32A 1JMCA 4N8X1 3HOZH 3R8BA 5CC4A 1PH2A 4PMWA 2IX0A 1RODA 2JK8A 4DN4M 4ZYSA 2R7DA 3GTKB 2JQOA 2DY7A 2EYPA 2JN4A 4BY1G 2K28A 3NTIA 5AJ3Q 4R4QA 3JAML 1GVPA 2YYZA 4OWTB 4JBKA 3HOYH 3VYSA 1IKMA 1S5DD 4QF4A 5DM63 1AN8A 1HNXQ 2F0UA 2F3IA 2VQFQ 1PTOH 1EOVA 4C2MH 1LTBD 1G2TA 4JV5L 1S40A 1W6KA 4LFAL 4IO9A 2BE5C 4HAEA 3E6ZX 1PXUA 3D4RA 1QOHA 1HTPA 5IOCA 2JA5G 1T5XD 2CW0C 1KC8C 1PH9A 4X64Q 5IGFA 4H0LC 3J81j 1CA5A 3P75A 1N33Q 3CD6A 2CFMA 4FXGC 1K83B 4EQPA 3R3OA 2OEOA 1K3BC 4OHJA 1HR0L 5KGUA 2XTIA 4KN7C 1Z47A 1RDPD 2XN9C 1SROA 4GOPC 2B2YA 2JP1A 3VR3A 3FMCA 5JAVA 1VDZA 2I5MX 4DV4Q 3OWEB 2OQKA 2Z4IA 1S4ZA 2VB3X 1PMRA 3S1RH 1TS2A 4IQZA 2NZOA 2OCEA 1VQMA 4WFN3 4LF4Q 5ELDA 2PPBC 2B2TC 3KUPA 4X3SA 1ZYRC 4PV1C 2GVBA 1STEA 3GV6A 5IT9c 1STNA 4EQNA 1PA6A 1T5EA 3K5OA 4F87A 2EOTA 1BVSA 2PW7A 4IJLA 4LUOA 4RGMA 2ZJRA 2E2JH 3G7LA 3I3CA 1BBUA 3CCVA 3J80E 2VB2X 4P72A 1EQQA 2F0SA 1QZHA 1A62A 1AEXA 2FXQA 2AUKA 4DAVA 1WJJA 3KLWA 3NBHA 1EYDA 4ZRZA 2R61A 1E1TA 4LFBL 4BXXH 4MTNA 2R92H 1STBA 1PZID 1N9WA 5C5MA 1HNZL 1EU4A 2O2LD 5ELEA 1TWHB 1EUJA 3GTQH 1WYDA 1EQVA 5M5XH 3T51B 5DAUA 3CCMA 4RG1A 2NN6H 2OTLA 4DK1A 3AEVA 2MQHA 1BQQT 2I5HA 1N32Q 5M3MB 4GKKL 4DUZL 2K05A 4GZYC 1WCMH 2QA4A 2F0MA 1NAPA 4B9XA 4DK3C 2UUAQ 5EPLA 4FF2A 4XQQA 4FNFA 5J1ZA 3K7AH 2KA7A 1Y69U 1B53A 2WAQB 2EY2A 1MSGA 2KCMA 1ENAA 5ELNA 5COYA 1SN8A 4J15A 3NEMA 1UE6A 1X56A 1AE2A 1KXLA 1W3SA 3G6EA 1SMYC 3D0FA 2VUMG 5M9OA 2EVBA 3JAME 1HQMC 1HRJA 1PHJA 1EY8A 2R93B 5FLMG 1PH1A 4CJ0B 3HOWB 5GADC 5DEHA 4JI7L 4K0KQ 2B2VC 2HDMA 1EZ6A 1XTDA 4FXDA 1X54A 4JYAQ 1JE5A 1WI5A 4R8IA 1CZGA 4X3KA 2NVXH 3S1MB 3KLRA 1FNUA 3KF8B 2ZXPA 4RAUC 3SR1A 1LUZA 2EYMA 3RZDH 2ZM6L 4IN3A 1L1OC 1D6EC 4G7ZC 4DR6L 3K5MA 2QW7A 1H95A 2OT2A 3CCEA 4HCEA 2RSNA 4A3MB 4IOCA 4IPHA 3GQBA 5CV4A 3I4LA 1EZ8A 3PIOA 1PRTF 1YVCA 5GQOA 1GHKA 2KCNA 4H13C 3K6OA 5I9PA 3FKIH 3GP7A 2E2IH 1JE4A 3F8TA 2AQ2B 2K75A 2RSOA 4L63B 1EY7A 3ULLA 4C1NI 1CA6A 1R9TB 1SNDA 3T1HQ 3TN2A 5K36G 4RGOS 4PMCA 3L9AX 1MBYA 5I9OA 2KENA 1KD1C 3P20A 1BXTA 4DV6L 1N34Q 5LMNQ 2F0EA 1I4XA 2HHHQ 4A3KH 1H9MA 3BU2A 3A56A 4BBSB 4BY7H 4X66L 1UAPA 3HP3A 3W5OA 1VQ5A 1TY0A 4GLVB 4RA8A 4IFDG 4I7AA 4L8JA 3GTPH 2HCCA 4JI0L 1CHQD 1PDQA 4DK6C 3CMEA 3NENA 4C3HG 5J22A 2PQAB 1Y1VH 4MHEA 3KJOA 2UU9Q 3STBD 3OIQA 4CDCC 2B2WA 2XRSD 4I7ZC 1AZPA 5JEAH 4LF7Q 4Q0FA 4P74A 3DM1A 3SXHA 4HJ8A 1Y14B 2M00A 3E9HA 1FL0A 5C0XI 4UHVA 1EIHA 2ZXOA 4GOPA 5HGTA 3I4NG 3W1GA 4B3RL 1I50B 2K1BA 4DR5Q 2NVQH 1EY5A 4RFBA 4QL5A 5KRUA 2DNCA 5BN5A 3KOJA 1HNWQ 4IPCA 2KCCA 4GNXC 4CDDC 2B2TA 5GAHC 1FNWA 3C1EA 3CCUA 4FF1A 1YNJD 2EIFA 3CQZH 1XNRQ 1I4GA 4FXKC 2BDOA 2SOBA 4JOIA 1Y8NB 1KDBA 2ZXRA 2NVTH 4J6HA 2UUBL 4CDFC 2EYHA 2JA7H 2QEJC 3GTLB 1Q81C 1TT2A 1BCPC 1B2TA 2NVYH 4IUPA 4A3LH 4U68A 4A3BH 3DWPA 1ENFA 3T56B 3Q8DA 1I3QB 4TRDA 1XNQQ 2O5IC 4YY3Q 3BG3A 4IPDA 2QDLA 3LGJA 1OXXK 5TSSA 2RHSB 4A3IB 3EA6A 3CHBD 2XSCA 1CM9A 5CV6A 4PNYA 4QY7A 1Y8OB 4HTHA 5JJIA 1XXGA 1HA5A 3DM3A 1IBKQ 1WOCA 2V1CC 4C3IH 5ELCA 2Z9HA 1ET6A 2IHEA 2FHTA 4O1NA 2E2HH 1PRTC 3OMCA 1I6HB 4YHHL 3HEJA 2YU9B 1LTLA 4IUQA 1TWGB 1B8AA 2G5DA 1MJCA 1SYGA 4A3EH 3QB3A 1VQLA 1ZEQX 4A3FH 3TSSA 1Q3LA 4A3DB 1MIUA 3LX0A 2JA8B 1W6JA 4L5RC 2KEEA 2E76C 3H0GB 3K5NA 1EL0A 3HOWG 1HH2P 2I0QA 5D65A 1E2WA 1B9MA 4GKJL 1YI2A 5J3BA 3F2UA 1I4QA 4LF6L 1PH7A 4DGZA 1KAWA 2L0CA 5C5LA 1TWCB 5IP9G 4DV1L 1VQ8A 1M8AA 2CQOA 4X65L 2CWPA 4NP5A 3D8GA 5CV9A 3HOZG 2BE5D 1B7YB 1ICWA 3I8ZA 1RIPA 1YBYA 2UUCL 2BDNA 3J81L 2VQEQ 3BZKA 1VF5C 1HTLD 4KKTA 5I4DA 3PUYA 1RHPA 2N78A 1AZQA 2A6EC 1B3AA 4EQ5A 1ILPA 1OXTA 3I73A 3WDNA 1AP0A 5IGCA 2IHFA 5IP7H 1FR3A 5IWAQ 2JXMB 1J5EL 1DJRD 1L1OA 4HIOA 2E75C 3ERQA 4KI0A 3Q23A 3S15B 5JVH3 3KF6A 2BH2A 5LMUL 3K81C 4DUYQ 1K0SA 3NELA 2F0TA 5FJ8H 2BH8A 4A3GH 3R2IA 3NWTA 3NTKA 5M5YB 5C3WA 4ME3A 4IPGA 4JI4L 1VQ7A 3GTJH 4P2CB 3PUVA 2KUMA 2BA0A 1E7ZA 4DAYB 1VQCA 2Y0SB 3TP6A 2AQ3B 2YTXA 1ZYRD 4ZQ3A 4CKEA 4K5XA 1VQPA 2F0HA 2I07B 4KHZA 3I72A 5IT9L 4OL7A 2E5LL 4LWCA 3J81i 3EIVA 2R7ZH 1BKBA 3SGIA 4IALA 3TDQA 4EVOA 1L0XB 4DR3L 5D3DA 4QGUA 4R1JA 4POGA 5FK9C 2ZT9C 1ENCA 3ONAB 3TMEA 4KD4A 4GS3A 3UDGA 4TVAB 1VQOA 3HOXB 5E4XA 5IGBA 4QIWB 3VR2A 4F8MA 1XMOQ 3TBIB 3H91A 3UDFA 2H1EA 1SSOA 3MTSA 1PTOF 5IY0A 5M3FB 3PQIA 3S2DH 1TQOA 5JOBA 1XMQL 1G51A 2B39A 2WKDA 2B63H 3HG9A 4DR7L 2VZAA 2Y0SE 1LM0A 2KHIA 4LFCQ 2OTJA 4A3CG 3CP0A 3X3MA 3S1QH 4RCOA 4DNRB 1IL2A 1S5ED 3GV3A 1AW7A 1XPRA 1H9KA 2YTYA 5G3LF 2RQXA 1H9JA 1LTRD 3I90A 1JJGA 4GNXA 1DCZA 3MWYW 3QOLA 4DV3Q 1CKOA 2QDBA 1VMPA 4BXXG 1QVFA 3H6MA 1A3VA 1DD2A 3RN2A 2XWJB 1LTSD 4X3UA 1VS0A 4LAAA 3L2PA 1YNJC 3MVVA 1ZXTA 1P8LA 5KIXA 3GTGH 1NY4A 5HURA 3PSIA 4IURA 4DR1L 3HOVB 1VQJA 2NN6G 2F0DA 1YHBA 1BBXC 4EX5A 1SMYD 5C4JH 4OO1G 3ULPA 4HIKA 3S17B 4OWWB 2IL8A 1WD1A 4DV7L 2B3GA 2EZVA 4C3IB 3NPPA 2F0NA 5CYUA 1TWFH 4JI5L 4HJ9A 2F3WA 1A3UA 3TS0A 3S1NH 4UDUC 5KNCA 5IGEA 2F0IA 2LFNA 2CKZB 1IYJB 1XWEA 4RHSA 1ML0D 4JBMA 2DNEA 4ZKBB 2PYKA 2WP8J 5C4HA 2NYZD 1Y8PB 1VQBA 2B8FA 1LACA 3S14H 2EY5A 3I56A 2B2UC 3MC0B 4DV5L 3A55A 5C4XH 3J80i 3KFUA 4BS9A 1UUPA 3M4PA 4NXNL 3R93A 1EY0A 4H7BA 3ZJYC 3D3RA 1H9RA 2GN5A 3SK6A 3J7AF 3SVMA 1UWVA 1N36Q 4HN7A 4YCUA 4LFAQ 1E22A 3LNNA 3DLLA 2QGQA 3NUCA 1JR0D 4IFDI 4AYBB 2KHSA 4LUVA 1KIXA 1I94Q 1HHVA 5CMDA 4L5QA 3CAMA 3N52A 1QG7A 3MXPA 3TS2A 4KHPL 1YEZA 4Y52H 3T16A 3OYYA 3J7YW 1PTOC 1PV4A 1C4QA 2A68D 5IT9E 2PMZB 1G6ZA 4KKUA 5FLXc 1V43A 4FYDA 2N3SA 1DOKA 2QILA 1U5KA 1VQAA 1K9MC 2WV6D 4IJHA 5CV7A 2L11A 3C2PA 5CBAE 2PW5A 1EY6A 3J7A5 1O7IA 1ICFB 1TS4A 2D2CC 2LSSA 2Y0SG 3BDCA 1JORA 2EJMA 1TWAH 3S2HB 1X3QA 2RF4A 2K7VA 5BR8L 3K5LA 5AJ3L 4AYBE 3EQLC 4BY7G 1S72A 4JBWA 4DNIA 4O2DA 4G7OC 1B44D 1HNXL 1CQFA 4WJ4A 1EYGA 4C3HB 2VQFL 3U50C 3JAMi 4AQYQ 5A2QL 2F3VA 2IX3A 3RZOH 1EOTA 4UP9A 2K04A 1PFSA 5CV5A 2PMZE 4DXGA 5JEAG 3GO5A 3HOXG 1S5CD 5CBEE 3DXJC 1B3QA 1DYQA 4X64L 4JPBW 1QNKA 5HY6A 1EU3A 3I4NB 1Z6HA 2GVAA 2WIIB 4QUFA 1BCPD 1VQ9A 4A93H 1O7LA 1D2BA 2QCPX 5M3FG 1II3A 3CCLA 3K8AA 1QB5D 1HNZQ 1UEBA 4K14A 3H3VI 2EYOA 2B8GA 3GDEA 3K0YA 1Q86C 4ZAIA 4Q5VA 5IYDH 4KJNA 2UXBQ 1V8QA 2Q8IB 1RKNA 4X3TA 1BF4A 1NCVA 1DOLA 2F0OA 1WTQA 5IYBG 3W3AA 1IBLQ 1VMCA 4DV4L 1HJPA 1JOQA 1LTGD 4DUZQ 1IZ6A 1EWIA 1PH3A 1OO9B 2JA7G 3BYTB 4K5WA 2L9HA 2EPBA 1WFQA 3GTOH 1JOOA 1PRTD 3HKZB 3NBIA 4LF4L 4C3JB 3OTOQ 1F9QA 1QWYA 3TP7A 4A75A 1C9OA 2N55A 3MXNB 2RCFA 3HOVG 1SFOH 1J6QA 2ALYB 4M8AA 1RF2D 2AWNA 1X3FA 2F0LA 4XQNA 4EQOA 1SE8A 1Q12A 4ALPA 2JA6H 5E3FA 4OIKA 2DY8A 4DAPA 2NZ1D 3ER0A 3D31A 2AHOB 4DKAC 2JA9A 4C3IG 4B08A 3NE5B 4IZ8A 4JI7Q 1GUWA 4NXML 5KYLA 1C0AA 3VR4A
chains in the Genus database with same CATH topology
3OMGA 1KNAA 1EYCA 2KEDA 4XXEA 3M3YB 4ZUJA 1OXSC 4TKOB 2KQ3A 3SHLA 2LKVA 2A6ED 2QF7A 2WACA 1G91A 1HUMA 2O4XA 1BO0A 3MHBA 5C4XB 3Q22A 2J7ZA 2SNMA 3M85A 2A6HC 3HOZB 1B9NA 1R4PB 3LWUA 5C0XJ 1G2SA 1U9RA 1G8ZD 5ELBA 5DNFA 3NQIA 3P1HA 1SNMA 2XIWA 1LT6D 3R2TA 1GHJA 4KHVA 3HOYB 1SYBA 2TSSA 1YNNC 2J0TD 3RUZA 1PTOB 4C2MB 4FVMA 4DU9A 1J9OA 2IPKD 1SDFA 3U9OA 5A2QE 1J8IA 3BYYB 3NSWA 4QMGA 1ESFA 2PCFB 3KBXA 4C1NK 3J7AV 1TVXA 4XTCS 3ND8A 2L12A 3V05A 2L55A 1EY9A 3C46A 2A68C 1KLGD 4HR7B 2F0VA 3EROA 1K8OA 1HQRD 3BZDB 1STYA 4Z9CB 3FEWX 1I4PA 5JPMC 3NTHA 3S1RB 1C48A 2F0PA 5A35A 3PV0A 2H4OA 2L5TA 1LT3D 1D5ZC 5AFWA 1IYUA 2MP1A 4OO1I 1WTXA 4IUTA 5LHY1 3WOEA 4J8QA 1JOKA 2E2JB 1HPCA 2F0KA 4ODGA 5C6AA 3H09A 2BOSA 1E0BA 4ZK9B 1SE4A 4FF3A 2NUCA 5FO7B 5CR3A 4R9WA 3E0JA 2R92B 2ICEC 2RA4A 1JB3A 4C3JG 3VYUA 3MXGA 3GTQB 2PZUA 1ET9A 4DXFA 1KDCA 5M5XB 2RDGA 1IHZA 3NHHA 2NTTA 5EPJA 4IUNA 1IYVA 1SFOB 3DMUA 5CV8A 3UI2A 1C8CA 3MA2B 4CKCA 1WCMB 1DM0B 1VF7A 1HCZA 1TU2B 4RHRA 2KECA 2RVLA 2C5CA 5EKKA 3K7AB 4XYOA 4M1UB 1LTTD 4XQJA 3EFXD 1LT5D 2G9DA 4HSPA 1NSNS 2K33A 1CT1D 3M4YA 2X6LA 1E2ZA 1CI3M 4DFAA 1PFBA 1JQYD 1JWUD 1I4RA 3IFDA 3M7NA 2VXWA 1B4OA 1QJOA 1E2VA 1QCBD 2SNSA 3NXWA 4XT3B 1HUNA 5LL6S 1PTOD 1CHPD 2NVXB 2K03A 3I70A 2B2VA 3QO2A 1OXUA 1B50A 4WJWA 5FLXL 3RZDB 2Z1CA 3AU7A 1F9SA 3ND9A 5I2YA 3PO3B 2BCOA 5G3LD 1WTVA 4PQXA 4FP5D 2MPMA 5EBCA 1F2LA 3A8IE 3MAQA 1V1PA 3FKIB 2E2IB 2FINB 3RLFA 3DHQA 2WINB 5K5PA 1H9SB 4FO2A 2EYJA 2EY6A 4F7XA 3QIAA 1V1OA 1WTRA 3MXUA 3L3OC 4G7HC 4KKSA 1X3PA 5K36H 4A3KB 5NUCA 3VR5A 4BY7B 3RMHA 2RDFA 2CQAA 1RTOA 2NTSA 1TR5A 4DAYA 3V2TA 3W2DA 2D9UA 4HMIA 3GTPB 1GXDC 2EY1A 1Y1VB 5I6WA 3URYA 3A54A 4UAIA 5FOBB 3PIO3 4V0BA 2XWBB 3HGBA 4RCNA 3PMFA 4TQUS 1Q8IA 4J1MA 5BN4A 3FPPA 3KK7A 4C56C 1JICA 2GA4B 2MGSA 1S5FD 5FKAC 3Q24A 1SYEA 1IW7C 1ONLA 2KOLA 3SK8A 2D5DA 2NVQB 4NMZA 2SDFA 1TIID 1D5MC 2TMPA 1EYAA 3GD7A 3MEHA 5EPKA 1LT4D 3CQZB 3CU7A 2NBFA 1F2MA 1D1KA 3DEPA 2Q8TA 2NVTB 1XYIA 4NDXA 3VR6A 1F77A 5KEEA 2JA7B 1OXVA 2NVYB 4A3BB 5IGGA 2JEBI 5JPNC 1K8MA 4K8IA 4IFDJ 2FFKB 4BA1I 2EJFC 4ME5A 3H3VC 4O42A 2E74C 1MSHA 2XNAC 1Q90A 2G9HD 3NWSA 5FO9B 2E2HB 1VCIA 5KNDA 4BBRB 1SE3A 1JWSD 5CGKA 2ID0A 2A6HD 2JEAI 3SEBA 4A3EB 2M2LA 3FPUB 5FLXE 3OSOA 4A3FB 4QB4A 2AQ1B 1LO5D 4U673 3T53B 1WTPA 5EQ0A 4CKBA 4XIGS 2D62A 2PZWA 1CQVA 5EKLA 1YNND 4L6TB 1WTOA 4CHTB 5T1IA 2EXZA 2Z4HA 5FO8B 1GUTA 4KV6A 2EYLA 4OIJA 2XVSA 3QJYA 1TS3A 1SBBB 3OW7A 1F2YA 3NP8A 1IL8A 1Q1EA 1LLRD 3H94A 2A69C 3OIPA 1GJXA 2ICIA 1XTCD 1SNQA 1SJED 3HZXA 5JJZA 2K6AA 4KY5A 2N88A 3A7AB 3CRLC 1O7YA 2IX1A 3Q0AA 5JVG3 4A3GB 5ISRA 5J39A 3NK9A 4E6IA 3GTJB 2L4NA 1KDAA 1U4RA 5LL6X 3PUWA 2MUYA 3AB9A 2Z8LA 3OHXC 2OF1A 4CGYB 1MGSA 5T1GA 1A15A 3V96A 2R7ZB 4IUVA 5EJWA 2B2WC 3D6WA 2MJ8A 3MFGA 4YIJA 3D6CA 5CORA 4LJZC 4K2KA 2PZTA 1PFNA 2LS01 3S2DB 1CFMA 2B63B 3DWQA 4ILWA 3SE0A 1KAAA 1PFMA 3IKJA 4RGTA 3OPOA 2C9OA 4KMUC 3S1QB 4KY7A 1F9PA 1A6XA 1STHA 1MI2A 1TKWB 1CZWA 3I91A 1NUCA 1FYCA 1HFGA 2K32A 1UEAB 3IL8A 1SE2A 2F1MA 2KJXA 2F0JA 1LTID 5EKIA 3HOUB 1WVLA 2HCIA 3GTGB 1PZKD 4RKBA 1SEBD 2F03A 4WORA 5C0XH 3SDZA 4HMJA 5C4JB 1I6VC 1BDOA 3CKIB 3MXNA 3TP8A 3VYTA 1Z7TA 4G57A 1SNOA 1G291 4OO1H 4XDXA 3NQTA 1BNZA 4MN3A 1KLUD 1TWFB 4WRDA 5C4ZA 4JK1C 2F0WA 4KJOA 4K5VA 5C3XA 3ITPA 3S1NB 3FDTA 3VA7A 4DNTB 2HDLA 2Q8RE 1L0YB 2RDHA 2HUGA 3X3NA 3P7JA 4IUUA 4EGVA 1I4HA 1UNSA 3TP5A 3IAYA 3S14B 3O13A 5KNBA 1O7ZA 5I2XA 2B2UA 3HS0C 1RD9D 3KBGA 1BCPF 2A5HA 2O5JC 3S16B 4OGQC 3KLSA 2R3ZA 2JSOA 1A2TA 3KF8A 1GUOA 5E1FA 1PYWD 1GUGA 3BS1A 3A7LA 2E2DC 3ZYYX 3KLSX 4BA2I 3FVQA 4CJ1B 4XYQA 1LABA 1O78A 3U9SA 1EWCA 5EGTA 1U4MA 4KN4C 2IW3A 2KVMA 1TWAB 1IW7D 5I6YA 1F9RA 1U4LA 3PUXA 2F0FA 3RD4A 1EEFD 1PLFA 4ZUIA 1O80A 3RZOB 1KTKA 3PUZA 4K6DA 3BVGA 4S3SA 4RWSC 2M9VA 2NN6I 5D3IB 1EFID 1NR2A 4A93B 1FD7D 2RBMA 2X6GA 1DONA 2AUJD 2K5QA 5ELFA 3QWNA 4HSVA 1BOSA 1D5XC 4DK0A 1DOMA 3FRPB 1JCKB 2F4IA 1EQTA 3CRKC 1Y1WB 1FGBD 3VA5A 5KYIA 1GUSA 2SEBD 2PQEA 3N6RA 1STGA 3QG1A 4ID6A 4H44C 4CBVA 1B1ZA 1PZJD 4TSSA 1SYDA 3SK4A 1KNEA 2WKCA 4MIUA 1BUVT 3GTOB 2IJ0A 1STAA 3BDOA 1QILA 2NB0A 1LTAD 3HRZC 1IKLA 5JEAJ 2EDGA 2K5WA 2JA6B 3TZUA 2IWHA 1SAPA 1HA6A 3AMUA 4DA2A 2BA1A 1EEID 3D4WA 4FF4A 4QCLA 3E5SA 4NW2A 2LMCB 4RKLA 2CHBD 5C3EB 1HXYD 2LY7A 3OWFA 2A69D 1RTNA 3DWAA 2IT1A 3VYRA 1TY2A 2DN8A 4K2LA 2AWOA 4I65A 1EY4A 3K58A 1GOZA 1LV9A 2F0QA 4R8NA 1QE6A 2MHVA 4F88A 3QOJA 3M7GA 4N9PA 1MD2D 3TZDA 2VNUD 1CTMA 4ABNA 5IIFA 1NR4A 3LWEA 5F2DA 3GTMB 3BVZA 2CW0D 4BY1B 1V1PB 5EBDA 3WOFA 3M4OB 4DF7A 2J4XA 2FMMA 2R6GA 3A8KE 1CK1A 1EWHA 3MFYA 2I46A 2K01A 3A8JE 5DM73 3SK5A 3T13A 2JA5B 1H9SA 3EJIA 4RGNA 4B9WA 2NWGA 3EVQA 4K6LA 5C44B 1FNVA 2B2YC 3S9WA 4Y7NB 1SJHD 1KABA 4IFDH 2V4DA 2EYFA 1QNUA 5E4WC 4KK7A 4XT1B 1WTWA 1GUNA 5M5WB 1WD0A 1SNPA 3PIP3 1A2UA 4KD3A 3MZ5A 1SYFA 1U4PA 2A73B 1ILQA 5IGDA 3K59A 3PO2B 1TS5A 4N9TA 2FMCA 2FJ2A 2F0GA 1SNCA 2JE6I 3Q6SA 3BDLA 1R4QB 2RKSA 2WB1B 3BVMA 4ZLTF 1JC7A 2XRQD 3IFTA 2A74C 4ULLA 2QKIC 2EJGC 4LK1C 4V190 2X69A 1JWMD 1AFPA 1A3TA 1Q1BA 4NKLA 1RCVD 3I4MB 1BCPB 4KY6A 4LMQD 1ESRA 5BN3A 3C1FA 2HQEA 1BR9A 2EE1A 5C0XG 3J80L 1HFNA 2PNRC 3G6JB 3K57A 4A3JB 2ENBA 1DZ1A 1RJTA 4KTAA 2CVRA 3OOCA 1XX8A 3D4DA 2L1BA 4ZKCB 1SYCA 4PMBA 1F2ZA 4CJ2C 1SXTA 4QUCA 2K5DA 5IODA 4BWGB 1DXMA 1PRTB 4G4KA 4HEDA 4RH6A 2JYOA 3C3LA 4HCSA 3T4AC 3L7ZC 3J81E 2VUMB 1D1IA 2PO4A 3DEOA 3DUZA 4K8JA 1M4VA 2OXPA 1EIGA 1S5BD 1ZKOA 5D14A 1X32A 3R8BA 5CC4A 4PMWA 2IX0A 1RODA 4DN4M 4ZYSA 3GTKB 2DY7A 2EYPA 2K28A 3NTIA 3JAML 2YYZA 3VYSA 1IKMA 1S5DD 4QF4A 5DM63 1AN8A 2F0UA 1PTOH 1LTBD 1G2TA 1W6KA 2BE5C 4HAEA 3E6ZX 1PXUA 3D4RA 1QOHA 1HTPA 5IOCA 1T5XD 2CW0C 5IGFA 4H0LC 1CA5A 3P75A 4FXGC 1K83B 4EQPA 3R3OA 2OEOA 4OHJA 5KGUA 4KN7C 1Z47A 1RDPD 2XN9C 2B2YA 2JP1A 3VR3A 3FMCA 5JAVA 1VDZA 3OWEB 2Z4IA 1S4ZA 2VB3X 1PMRA 1TS2A 4IQZA 4WFN3 5ELDA 2PPBC 2B2TC 3KUPA 4X3SA 1ZYRC 4PV1C 3GV6A 1STEA 1STNA 4EQNA 1T5EA 3K5OA 4F87A 2EOTA 2PW7A 4RGMA 3G7LA 3I3CA 3J80E 2VB2X 2F0SA 1AEXA 2AUKA 4DAVA 3NBHA 1EYDA 4ZRZA 2R61A 1STBA 1PZID 5C5MA 1EU4A 2O2LD 5ELEA 1TWHB 1EQVA 3T51B 5DAUA 2NN6H 4DK1A 1BQQT 5M3MB 2K05A 4GZYC 2F0MA 1NAPA 4B9XA 5EPLA 4FF2A 4XQQA 4FNFA 5J1ZA 2KA7A 1Y69U 1B53A 2WAQB 2EY2A 1MSGA 1ENAA 5COYA 1SMYC 5M9OA 2EVBA 3JAME 1HQMC 1HRJA 1EY8A 2R93B 3HOWB 4CJ0B 5DEHA 2B2VC 2HDMA 1EZ6A 4FXDA 4R8IA 1CZGA 4X3KA 3S1MB 3KLRA 1FNUA 4RAUC 2ZXPA 3SR1A 2EYMA 4IN3A 1D6EC 4G7ZC 3K5MA 2OT2A 4HCEA 2RSNA 4A3MB 3GQBA 5CV4A 3I4LA 1EZ8A 1PRTF 1GHKA 2KCNA 4H13C 3K6OA 5I9PA 3GP7A 1JE4A 2AQ2B 2RSOA 4L63B 1EY7A 1CA6A 4C1NI 1R9TB 1SNDA 3TN2A 5K36G 4RGOS 4PMCA 3L9AX 1MBYA 5I9OA 3P20A 1BXTA 2F0EA 1I4XA 1H9MA 3A56A 4BBSB 1UAPA 3HP3A 1TY0A 4RA8A 4IFDG 4L8JA 2HCCA 1CHQD 1PDQA 4C3HG 5J22A 4MHEA 3OIQA 2B2WA 2XRSD 4I7ZC 1AZPA 5JEAH 4Q0FA 3DM1A 3SXHA 2M00A 5C0XI 1EIHA 2ZXOA 5HGTA 1I50B 2K1BA 1EY5A 4RFBA 5KRUA 2DNCA 5BN5A 2KCCA 2B2TA 1FNWA 3C1EA 4FF1A 1YNJD 1I4GA 4FXKC 2BDOA 2SOBA 1Y8NB 1KDBA 2ZXRA 4J6HA 2EYHA 2QEJC 3GTLB 1TT2A 1BCPC 1B2TA 4IUPA 4U68A 3DWPA 1ENFA 3T56B 1I3QB 4TRDA 2O5IC 3BG3A 5TSSA 1OXXK 4A3IB 3EA6A 3CHBD 2XSCA 1CM9A 5CV6A 4PNYA 1Y8OB 4HTHA 1XXGA 1HA5A 5ELCA 1ET6A 2FHTA 4O1NA 1PRTC 3OMCA 1I6HB 3HEJA 2YU9B 4IUQA 1TWGB 1SYGA 3QB3A 1ZEQX 3TSSA 1Q3LA 4A3DB 3LX0A 2JA8B 1W6JA 2KEEA 2E76C 3H0GB 3K5NA 1EL0A 5D65A 1E2WA 1B9MA 3F2UA 1I4QA 4DGZA 2L0CA 5C5LA 1TWCB 1M8AA 4NP5A 3D8GA 5CV9A 2BE5D 1ICWA 3I8ZA 2BDNA 3J81L 1VF5C 1HTLD 4KKTA 5I4DA 3PUYA 1RHPA 1AZQA 2A6EC 1B3AA 1ILPA 1OXTA 3I73A 3WDNA 1AP0A 5IGCA 1FR3A 2JXMB 1DJRD 2E75C 3ERQA 4KI0A 3Q23A 3S15B 5JVH3 2F0TA 3R2IA 3NWTA 3NTKA 5M5YB 5C3WA 4P2CB 3PUVA 2KUMA 2BA0A 2Y0SB 3TP6A 2AQ3B 1ZYRD 4ZQ3A 4CKEA 4K5XA 2F0HA 2I07B 4KHZA 3I72A 5IT9L 4OL7A 4IALA 3TDQA 4EVOA 1L0XB 5D3DA 5FK9C 2ZT9C 1ENCA 3ONAB 3TMEA 4KD4A 3HOXB 5E4XA 5IGBA 4QIWB 3VR2A 4F8MA 3TBIB 3H91A 2H1EA 1SSOA 3MTSA 1PTOF 5M3FB 1TQOA 5JOBA 2WKDA 2B39A 3HG9A 3X3MA 4RCOA 4DNRB 1S5ED 3GV3A 1AW7A 1H9KA 5G3LF 2RQXA 1H9JA 1LTRD 3I90A 1DCZA 3MWYW 3QOLA 2QDBA 1VMPA 1DD2A 3H6MA 1A3VA 2XWJB 1LTSD 4X3UA 4LAAA 1YNJC 3MVVA 1ZXTA 5KIXA 5HURA 4IURA 3HOVB 2NN6G 2F0DA 1BBXC 1SMYD 4OO1G 3S17B 2IL8A 1WD1A 2EZVA 4C3IB 3NPPA 2F0NA 5CYUA 2F3WA 1A3UA 5KNCA 4UDUC 5IGEA 2F0IA 2LFNA 1XWEA 4RHSA 1ML0D 2DNEA 4ZKBB 2PYKA 2WP8J 5C4HA 2NYZD 1Y8PB 2B8FA 1LACA 2EY5A 2B2UC 3MC0B 3A55A 4BS9A 1UUPA 3R93A 1EY0A 4H7BA 3D3RA 1H9RA 3SK6A 3J7AF 3SVMA 4HN7A 3LNNA 3NUCA 1JR0D 4IFDI 4AYBB 2KHSA 1HHVA 5CMDA 3N52A 1QG7A 3MXPA 3T16A 3J7YW 1PTOC 1C4QA 2A68D 5IT9E 2PMZB 1G6ZA 4KKUA 1V43A 4FYDA 2QILA 1DOKA 2WV6D 5CV7A 2L11A 3C2PA 5CBAE 2PW5A 1EY6A 1TS4A 2D2CC 3BDCA 1JORA 2EJMA 3S2HB 1X3QA 3K5LA 2K7VA 3EQLC 4JBWA 4G7OC 1B44D 1CQFA 4C3HB 5A2QL 2F3VA 2IX3A 1EOTA 2K04A 5CV5A 4DXGA 5JEAG 3GO5A 1S5CD 5CBEE 3DXJC 1DYQA 1QNKA 1EU3A 3I4NB 1Z6HA 4QUFA 2WIIB 1BCPD 1O7LA 1D2BA 2QCPX 1II3A 1QB5D 4K14A 2EYOA 2B8GA 3K0YA 4ZAIA 4Q5VA 4KJNA 1V8QA 2Q8IB 1RKNA 4X3TA 1BF4A 1NCVA 1DOLA 2F0OA 1WTQA 3W3AA 1VMCA 1JOQA 1LTGD 1OO9B 3BYTB 4K5WA 2L9HA 2EPBA 1JOOA 1PRTD 3HKZB 3NBIA 4C3JB 1F9QA 1QWYA 3TP7A 2N55A 4M8AA 1RF2D 2AWNA 2F0LA 4XQNA 4EQOA 1Q12A 5E3FA 4OIKA 2DY8A 4DAPA 2NZ1D 3D31A 4C3IG 4B08A 3NE5B 4IZ8A 1GUWA 5KYLA 3VR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX L;  5IT9 L;  5A2Q L;  3J81 L;  3J80 L;  3J7A V;  5LL6 X;  3JAM L; 
#chains in the Genus database with same CATH topology
 3OMG A;  1KNA A;  4NPS A;  3M4Q A;  3MEF A;  4AIM A;  1EYC A;  2E8G A;  2KED A;  4XXE A;  3M3Y B;  4KLK A;  5C3E H;  4ZUJ A;  1OXS C;  3HKZ E;  3J80 c;  4TKO B;  4JI6 Q;  1QVC A;  2KQ3 A;  3SHL A;  2VS1 A;  2LKV A;  2A6E D;  2QF7 A;  2WAC A;  1N32 L;  4DR6 Q;  1G91 A;  1HUM A;  2O4X A;  3CCJ A;  3E0E A;  1BO0 A;  3I55 A;  3MHB A;  3ERS X;  5C4X B;  3Q22 A;  2J7Z A;  4ZCK A;  2SNM A;  3M85 A;  2A6H C;  3HOZ B;  1QUQ B;  1B9N A;  1R4P B;  2A8V A;  2WFW A;  1X55 A;  3LWU A;  5C0X J;  1G2S A;  3HFZ B;  1U9R A;  1G8Z D;  4L5T A;  5ELB A;  1YJN A;  5DNF A;  1NE3 A;  3NQI A;  4AYB G;  3P1H A;  3PO3 H;  1SNM A;  2XIW A;  1LT6 D;  3R2T A;  1GHJ A;  4KHV A;  3HOY B;  1SYB A;  2KCT A;  3GTM H;  2TSS A;  1YNN C;  2J0T D;  4DV6 Q;  4BY1 H;  5IP7 G;  3RUZ A;  1PTO B;  4C2M B;  4FVM A;  3RLO A;  4DU9 A;  1J9O A;  4X66 Q;  2IPK D;  1X3G A;  3KYH C;  4K0K L;  3M4O H;  1SDF A;  3U9O A;  2QEX A;  4JYA L;  5A2Q E;  1E1O A;  1J8I A;  1CSP A;  4X62 L;  3BYY B;  2K5H A;  4MTK A;  3NSW A;  4QMG A;  5FJ8 G;  1W2B A;  4JI0 Q;  1MHW C;  4JI2 L;  1ESF A;  1K8A C;  1UE7 A;  2PCF B;  3KBX A;  4C1N K;  3J7A V;  1TVX A;  4XTC S;  3ND8 A;  2L12 A;  3V05 A;  2JA5 H;  2L55 A;  1EY9 A;  3C46 A;  2VW9 A;  2Q2H A;  2Q2U A;  2A68 C;  1KLG D;  1FVI A;  5IYC G;  4HR7 B;  2F0V A;  5C44 H;  2B29 A;  3ERO A;  1K8O A;  3E3X A;  1HQR D;  4DV0 L;  3BZD B;  4PZ8 A;  3A0J A;  4H02 A;  1STY A;  2ZTD A;  4Z9C B;  3FEW X;  1I4P A;  3RR5 A;  5JPM C;  5JJL A;  3NTH A;  3S1R B;  5M5W H;  2Q2T A;  1Z9F A;  1C48 A;  2PQA A;  4LUZ A;  2F0P A;  5A35 A;  3PV0 A;  2H4O A;  2L5T A;  4OEL B;  1LT3 D;  1D5Z C;  2UUB Q;  5AFW A;  1IYU A;  4B3M L;  2MP1 A;  3EBE A;  3UE1 A;  4OO1 I;  1WTX A;  4IUT A;  5LHY 1;  3WOE A;  2HHH L;  4J8Q A;  1M90 C;  3PO2 H;  1JOK A;  2Z6K C;  1HPC A;  2F0K A;  2E2J B;  4ODG A;  4R4C A;  4YWM A;  5C6A A;  3H09 A;  4IOA A;  2BOS A;  2L15 A;  1E0B A;  1S3O A;  4FDB A;  2EXD A;  4ZK9 B;  1NMG A;  1KRT A;  3W1B A;  4GN5 A;  1SE4 A;  2UXD L;  4FF3 A;  3RN5 A;  2PI2 A;  3CCS A;  2NUC A;  5FO7 B;  5CR3 A;  1NNX A;  4R9W A;  3E0J A;  4HJA A;  4YWK A;  2R92 B;  2ICE C;  2RA4 A;  3HKZ G;  1JB3 A;  4C3J G;  1G6P A;  3VYU A;  1V9P A;  3MXG A;  3GTQ B;  3I4M H;  2PZU A;  1ET9 A;  4DXF A;  1KDC A;  4YHH Q;  5M5X B;  2RDG A;  1IHZ A;  4JI8 L;  3NHH A;  2NTT A;  5EPJ A;  4IUN A;  1IYV A;  1KHI A;  2Q2I A;  1SFO B;  4DV2 Q;  3DMU A;  1HNW L;  5CV8 A;  3UI2 A;  5HGQ A;  1C8C A;  3MA2 B;  4JW0 A;  2HIX A;  4CKC A;  1WCM B;  1DM0 B;  1VF7 A;  2JJQ A;  2N49 A;  1HCZ A;  1TU2 B;  4A3J H;  1XNR L;  4RHR A;  2KEC A;  3CC4 A;  2RVL A;  2C5C A;  4JBJ A;  4BBR H;  4PZ6 A;  5EKK A;  1B70 B;  1YHA A;  3K7A B;  4LF6 Q;  4XYO A;  4M1U B;  1LTT D;  4XQJ A;  3EFX D;  1LT5 D;  2G9D A;  4OX9 L;  4HSP A;  1NSN S;  2K33 A;  1CT1 D;  3M4Y A;  2X6L A;  1E2Z A;  1CI3 M;  4B3S Q;  4DFA A;  1PFB A;  1JQY D;  1JWU D;  2UUC Q;  4DR2 L;  1I4R A;  3IFD A;  3M7N A;  4R4O A;  1WTH A;  2VXW A;  1P16 A;  1B4O A;  1QJO A;  1E2V A;  1QCB D;  1CKM A;  2VUM H;  1VQF A;  2SNS A;  3NXW A;  4JVZ A;  3FP9 A;  5C4X G;  4XT3 B;  1HUN A;  5LL6 S;  1PTO D;  5FLM H;  1CHP D;  1J5E Q;  2NVX B;  2K03 A;  3I70 A;  2B2V A;  3QO2 A;  1OXU A;  1B50 A;  4WJW A;  1VQK A;  3K0X A;  5FLX L;  3RZD B;  3I4O A;  1CKN B;  2NZH A;  1X3E A;  2Z1C A;  3AU7 A;  1PH5 A;  4B3T L;  1F9S A;  1VQ6 A;  3ND9 A;  5I2Y A;  3HOY G;  3CMA A;  3PO3 B;  2BCO A;  5G3L D;  1WTV A;  3GTK H;  4PQX A;  4FP5 D;  4LF5 L;  2UXC Q;  2ZJP A;  2MPM A;  5EBC A;  3CPW A;  1F2L A;  3A8I E;  3MAQ A;  1V1P A;  1ASZ A;  1JB7 A;  1IBM Q;  4A4I A;  3FKI B;  2E2I B;  1UE5 A;  3PF5 A;  2FIN B;  3KF6 B;  3RLF A;  4UPA A;  3DHQ A;  4GLA C;  2E5L Q;  2WIN B;  5K5P A;  1H9S B;  4FO2 A;  3U58 A;  5LMN W;  2EYJ A;  2EY6 A;  4F7X A;  3QIA A;  1V1O A;  1FJG Q;  1WTR A;  3MXU A;  3L3O C;  4G7H C;  4KKS A;  1X3P A;  5K36 H;  4A3K B;  5NUC A;  1EQR A;  3VR5 A;  1HZC A;  4BY7 B;  4AH6 A;  1NMF A;  1U0L A;  1X6O A;  3RMH A;  2C35 B;  3AQQ A;  2RDF A;  4GN3 B;  2CQA A;  1RTO A;  2NTS A;  1TR5 A;  4OON A;  1K83 H;  3V2T A;  3W2D A;  4DAY A;  4DR4 L;  2D9U A;  5IWA L;  3F2C A;  4HMI A;  3GTP B;  1GXD C;  2EY1 A;  4GLX A;  1Y1V B;  4DR7 Q;  5I6W A;  3URY A;  3A54 A;  4UAI A;  5FOB B;  3PIO 3;  3H15 A;  4V0B A;  2XWB B;  3HGB A;  4RCN A;  3PMF A;  4TQU S;  1Q8I A;  4J1M A;  5BN4 A;  3FPP A;  3KK7 A;  4C56 C;  1JIC A;  2GA4 B;  2MGS A;  1S5F D;  5FKA C;  3Q24 A;  1SYE A;  1K73 C;  1IW7 C;  1ONL A;  2KOL A;  3SK8 A;  2D5D A;  2NVQ B;  4NMZ A;  2SDF A;  1TII D;  2A19 A;  3UDI A;  3PGZ A;  1D5M C;  2TMP A;  1EYA A;  4JI3 L;  3GD7 A;  3MEH A;  5EPK A;  1LT4 D;  5IYD G;  1X9N A;  2VL6 A;  3CQZ B;  3CU7 A;  2NBF A;  4DR1 Q;  4LF9 L;  1F2M A;  1D1K A;  3DEP A;  2Q8T A;  2NVT B;  2Z6K A;  4JI1 Q;  1XYI A;  4NDX A;  3KDF B;  3VR6 A;  3CF5 A;  1F77 A;  5KEE A;  2JA7 B;  1OXV A;  4L5S A;  2R92 G;  2NVY B;  4A3B B;  5IGG A;  1XMO L;  3HOU H;  2JEB I;  5JPN C;  3T1Y L;  1K8M A;  4A76 A;  1EIF A;  4K8I A;  4JI5 Q;  4IFD J;  2FFK B;  4BA1 I;  2EJF C;  1TWH H;  4LFC L;  4ME5 A;  1HZ9 A;  4LF8 Q;  1WCM G;  4O0A A;  3H3V C;  4O42 A;  2DJF C;  5M3M H;  2JA6 G;  2E74 C;  1MSH A;  2XNA C;  1Q90 A;  3HKS A;  2G9H D;  3NWS A;  3G71 A;  5FO9 B;  2E2H B;  1VCI A;  2WB1 E;  1L0W A;  4BBR B;  5KND A;  1SE3 A;  1JWS D;  5CGK A;  4DV3 L;  4NXN Q;  2ID0 A;  2A6H D;  2JEA I;  3SEB A;  4A3E B;  2ZTC A;  2M2L A;  1JJ2 A;  1CUK A;  3FPU B;  5FLX E;  3OSO A;  4A3F B;  4QB4 A;  2AQ1 B;  1LO5 D;  4QQB X;  5C3E G;  1VQN A;  4U67 3;  3T53 B;  1WTP A;  2HD3 A;  5EQ0 A;  4CKB A;  4XIG S;  3IRB A;  2D62 A;  2Z0S A;  2PZW A;  2AKW B;  1CQV A;  5EKL A;  1YNN D;  1RL2 A;  4OWX B;  2R93 H;  4L6T B;  1WTO A;  3HOW H;  4CHT B;  4KHP Q;  5T1I A;  2EXZ A;  2Z4H A;  5FO8 B;  1VQH A;  3S16 H;  1GUT A;  2F4V L;  2ATW A;  4JV5 Q;  4KV6 A;  2EYL A;  3CXC A;  4OIJ A;  3FHW A;  2XVS A;  3F2B A;  3QJY A;  1TS3 A;  1SBB B;  2K5V A;  5IP9 H;  3OW7 A;  3M9B A;  1F2Y A;  3S1M H;  3E9I A;  1EIY B;  1YIJ A;  3NP8 A;  1IL8 A;  1Q1E A;  1LLR D;  3H94 A;  1OTC A;  2A69 C;  3OIP A;  3PO3 G;  1JJC B;  3J7Z C;  1GJX A;  2ES2 A;  2ICI A;  1XTC D;  1SNQ A;  1SJE D;  1A63 A;  3JC6 6;  3K80 C;  3CW2 C;  2MO1 A;  3HZX A;  5BR8 Q;  4A3M H;  1TXY A;  3FKI G;  1HR0 Q;  5JJZ A;  4QJF A;  2K6A A;  4KY5 A;  2N88 A;  3A7A B;  3CRL C;  1O7Y A;  2CCZ A;  2CH4 A;  2IX1 A;  3Q0A A;  5JVG 3;  4A3G B;  5ISR A;  5J39 A;  1YJW A;  1XPO A;  3NK9 A;  3A5Z B;  4E6I A;  1N36 L;  1R9T H;  3GTJ B;  3J81 c;  2L4N A;  2P5Z X;  1KDA A;  4A3K G;  1U4R A;  5LL6 X;  1XPU A;  3PUW A;  2MUY A;  3AB9 A;  2Z8L A;  3OHX C;  2K50 A;  1CSQ A;  1I94 L;  2OF1 A;  4CGY B;  1MGS A;  4N8F A;  5T1G A;  1A15 A;  5C44 G;  3V96 A;  2ZTE A;  1PVO A;  4BBS H;  2DUD A;  1VQE A;  2K52 A;  1Y1V G;  5H1S E;  2R7Z B;  3G4S A;  4IUV A;  5EJW A;  2B2W C;  3D6W A;  2CH4 W;  4CDE C;  1C7Y A;  4R4T A;  2MJ8 A;  3MFG A;  4YIJ A;  1Q82 C;  3D6C A;  2OWO A;  5COR A;  4LJZ C;  2RCN A;  4K2K A;  3RLN A;  1PH8 A;  2PZT A;  4OEM B;  1N33 L;  1SMX A;  4LFB Q;  1PFN A;  3U4V A;  2LS0 1;  2XGT A;  1T9H A;  4P71 A;  3S2D B;  1CFM A;  2B63 B;  3DWQ A;  4ILW A;  3SE0 A;  1KAA A;  1Y1W H;  1PFM A;  3IKJ A;  4RGT A;  1I50 H;  3PO2 G;  3OPO A;  2C9O A;  4KMU C;  3S1Q B;  2AMC B;  4KY7 A;  1F9P A;  1A6X A;  1UE1 A;  2EQS A;  4JOI C;  4AQY L;  4GKK Q;  2WB1 G;  3NBH B;  4A3C H;  2HQL A;  4JC0 A;  1STH A;  2KBN A;  1MI2 A;  1TKW B;  1CZW A;  3I91 A;  4A3L G;  1NUC A;  4A3B G;  5DLQ E;  1FYC A;  1HFG A;  2K32 A;  1YHQ A;  1UEA B;  3IL8 A;  1SE2 A;  2F1M A;  2KJX A;  4HIM A;  2F0J A;  3GTL H;  1LTI D;  5EKI A;  1AE3 A;  3HOU B;  1WVL A;  4NXM Q;  2HCI A;  3I4M G;  3GTG B;  1PZK D;  4RKB A;  1SEB D;  2F03 A;  2DGY A;  1I3Q H;  4WOR A;  5C0X H;  3SDZ A;  2VY3 A;  1GM5 A;  3F2D A;  4HMJ A;  5C4J B;  4A3I H;  1MKH A;  1QZG A;  1I6V C;  4WJ3 M;  1BDO A;  3CKI B;  3MXN A;  2UXB L;  3TP8 A;  3VYT A;  4A3J G;  4UP7 A;  1IBL L;  1Z7T A;  4G57 A;  1SNO A;  5L37 A;  1G29 1;  4OO1 H;  4XDX A;  3NQT A;  1BNZ A;  4MN3 A;  1KLU D;  4BBR G;  2LXJ A;  1TWF B;  4WRD A;  5C4Z A;  4JK1 C;  2F0W A;  1KQS A;  4APV A;  4KJO A;  4A3E G;  4K5V A;  3VDY A;  5C3X A;  3ITP A;  1K8G A;  3S1N B;  3FDT A;  3VA7 A;  4DNT B;  1DGS A;  4A3F G;  1I6H H;  2DJG C;  3OTO L;  2YU9 H;  2HDL A;  1TWG H;  2Q8R E;  2D0P A;  2ZM6 Q;  1L0Y B;  4P73 A;  2RDH A;  2HUG A;  3X3N A;  3P7J A;  4IUU A;  4JCV E;  4EGV A;  1I4H A;  1UNS A;  3TP5 A;  3IAY A;  4A3D H;  3S14 B;  3O13 A;  2JA8 H;  5KNB A;  2Z6B A;  3H0G H;  3AYH B;  1K0R A;  2UUA L;  1O7Z A;  1V1Q A;  2K14 A;  1MJE A;  5I2X A;  3PCO B;  2B2U A;  3HS0 C;  1RD9 D;  3CC7 A;  4HJ5 A;  3KBG A;  1BCP F;  2A5H A;  2O5J C;  3S16 B;  1TWC H;  2I5L X;  4OGQ C;  3KLS A;  2R3Z A;  2JSO A;  4X62 Q;  1A2T A;  3KF8 A;  1QUQ A;  1K3R A;  4JI2 Q;  1NJI C;  4JI6 L;  1HZB A;  1HR0 W;  3PIP A;  2WAQ E;  1GUO A;  5E1F A;  4GN4 B;  1PYW D;  1GUG A;  3BS1 A;  4A3G G;  3A7L A;  2E2D C;  3ZYY X;  4DV0 Q;  3KLS X;  4BA2 I;  3S15 H;  3FVQ A;  4CJ1 B;  4XYQ A;  1LAB A;  1O78 A;  3U9S A;  1EWC A;  5EGT A;  1E24 A;  1U4M A;  4KN4 C;  2IW3 A;  5M5Y H;  3JAM c;  3CC2 A;  2KVM A;  1TWA B;  1IW7 D;  5I6Y A;  1GKH A;  4B3R Q;  1F9R A;  1U4L A;  4LNQ A;  1EFW A;  4POF A;  4B3M Q;  3PUX A;  2D0O A;  2F0F A;  4MNO A;  3RD4 A;  1EEF D;  3CCQ A;  4Y7N H;  1PLF A;  2R7Z G;  4ZUI A;  1YZ6 A;  3AFP A;  1O80 A;  3RZO B;  1KTK A;  3PUZ A;  4K6D A;  3BVG A;  4S3S A;  4RWS C;  3T1H L;  1YIT A;  4OXP A;  2M9V A;  3OW2 A;  2NN6 I;  1N8R C;  4GOP B;  2UXD Q;  5D3I B;  3QR8 A;  2N8N A;  3F1Z A;  1N34 L;  5LMN L;  1EFI D;  1NR2 A;  5IE8 A;  4HJ7 A;  4A93 B;  1AH9 A;  1FD7 D;  2RBM A;  2X6G A;  3HOX H;  2LXK A;  1DON A;  2B63 G;  2AUJ D;  2K5Q A;  1KRS A;  5ELF A;  4X6A H;  3QWN A;  4HSV A;  1BOS A;  1D5X C;  4DK0 A;  1DOM A;  2HT1 A;  3FRP B;  5M3F H;  1PH4 A;  1JCK B;  2F4I A;  3TRE A;  1EQT A;  3CRK C;  1Y1W B;  1FGB D;  3VA5 A;  5KYI A;  1GUS A;  3TQY A;  2UU9 L;  2SEB D;  4JI8 Q;  2PQE A;  3N6R A;  1STG A;  3QG1 A;  4LF7 L;  4ID6 A;  4H44 C;  4CBV A;  1B1Z A;  1PZJ D;  4TSS A;  1XJV A;  1SYD A;  5IYB H;  3SK4 A;  1KNE A;  2WKC A;  4MIU A;  1BUV T;  3GTO B;  1E3P A;  4DR5 L;  2IJ0 A;  4JG2 A;  3HOU G;  1STA A;  3L0O A;  3BDO A;  1QIL A;  4YWL A;  2H5X A;  2NB0 A;  1LTA D;  4OX9 Q;  5ELO A;  1YJ9 A;  3HRZ C;  1IKL A;  1A8V A;  1IXR A;  5JEA J;  3HOV H;  2EDG A;  2K5W A;  2JA6 B;  3CPF A;  3TZU A;  3A5U A;  4DR2 Q;  1PH6 A;  4GKJ Q;  2IWH A;  1SAP A;  1HA6 A;  5M3M G;  3AMU A;  4DA2 A;  4DV1 Q;  2BA1 A;  3S17 H;  1EEI D;  4UP8 A;  1L2F A;  2PI2 E;  4X65 Q;  3D4W A;  4FF4 A;  4P75 A;  4QCL A;  1XNQ L;  1VQD A;  4YY3 L;  3E5S A;  4PZ7 A;  3G48 A;  4NW2 A;  2LMC B;  4RKL A;  2CHB D;  5C3E B;  1HXY D;  2LY7 A;  2WAQ G;  3S24 A;  3OWF A;  2A69 D;  1RTN A;  3DWA A;  4DV2 L;  4B3T Q;  3PF4 A;  2IT1 A;  3VYR A;  1Q7Y C;  1TY2 A;  2DN8 A;  1M1K C;  1IBK L;  4K2L A;  2AWO A;  1GO3 E;  4I65 A;  4LF5 Q;  2R93 G;  5JJK A;  1EY4 A;  1A0I A;  3K58 A;  1GOZ A;  1D8L A;  5LMU Q;  1LV9 A;  2F0Q A;  4R8N A;  1QE6 A;  2MHV A;  4F88 A;  3QOJ A;  3M7G A;  2MFI A;  4N9P A;  3CCR A;  1KL9 A;  1MD2 D;  4LW1 A;  1SR3 A;  1QVG A;  4JI4 Q;  3TZD A;  3EN2 A;  2MNA A;  2VNU D;  1CTM A;  4ABN A;  5IIF A;  1NR4 A;  3LWE A;  5F2D A;  4B3S L;  3GTM B;  1CKN A;  1HZA A;  3BVZ A;  3KJP A;  2R7F A;  5GAE C;  1L1O B;  2CW0 D;  4BY1 B;  3WWV A;  1V1P B;  5EBD A;  3K7U C;  4A3M G;  3WOF A;  3M4O B;  2J4X A;  4DF7 A;  2FMM A;  4DR4 Q;  2R6G A;  3A8K E;  3RNU A;  3ICE A;  1CK1 A;  4DR3 Q;  1EWH A;  3UE0 A;  1VQI A;  3MFY A;  1Q8K A;  2I46 A;  2KHJ A;  2K01 A;  2OQ0 A;  3A8J E;  5DM7 3;  1VQ4 A;  2VQE L;  1ASY A;  2YTV A;  3SK5 A;  1YNX A;  3T13 A;  1D7Q A;  2JA5 B;  1H9S A;  1NTG A;  3EJI A;  4RGN A;  4B9W A;  2NWG A;  4HID A;  2RHQ B;  3EVQ A;  4K6L A;  1SRU A;  5C44 B;  5EAY A;  1FNV A;  3S2H H;  2B2Y C;  2UXC L;  1XMQ Q;  3S9W A;  4NB3 A;  4BBS G;  5IYC H;  1IBM L;  4Y7N B;  1SJH D;  1KAB A;  4IFD H;  4DUY L;  2V4D A;  2EYF A;  1QNU A;  3AFQ A;  4JI3 Q;  3TEH B;  1BBW A;  5E4W C;  4C3H H;  4KK7 A;  4XT1 B;  1WTW A;  1GUN A;  3ULJ A;  5M5W B;  2ASB A;  4DPG A;  3BZC A;  1WD0 A;  1SNP A;  3UDX A;  4LF9 Q;  3PIP 3;  2CWA A;  3BJU A;  1A2U A;  4KD3 A;  3U4Z A;  4A93 G;  3MZ5 A;  1FJG L;  1SYF A;  1U4P A;  1NBW A;  1VQG A;  3I4N H;  4YCV A;  2A73 B;  1ILQ A;  5IGD A;  3K59 A;  3PO2 B;  1TS5 A;  4N9T A;  1Y1W G;  3T1Y Q;  2FMC A;  3TRZ A;  2FJ2 A;  2F0G A;  4RMF A;  1SNC A;  2JE6 I;  3Q6S A;  5GRO A;  3BDL A;  1R4Q B;  2RKS A;  2WB1 B;  3A74 A;  3BVM A;  4ZLT F;  1JC7 A;  2XRQ D;  3IFT A;  3STB C;  4GNX B;  1K28 A;  4R4I A;  2A74 C;  4ULL A;  2QKI C;  2EJG C;  4DV7 Q;  4LK1 C;  4V19 0;  2X69 A;  1JWM D;  1AFP A;  1A3T A;  3KDF A;  1FGU A;  1Q1B A;  4NKL A;  1RCV D;  2K4K A;  3I4M B;  1BCP B;  4KY6 A;  2MO0 A;  4LMQ D;  1ESR A;  5BN3 A;  3C1F A;  2HIV A;  4C3J H;  2HQE A;  2A1A A;  3I2Z A;  1BR9 A;  1PYS B;  1SLJ A;  2EE1 A;  5C0X G;  4QIW E;  3J80 L;  1HFN A;  4A3I G;  1I5F A;  2PNR C;  3B6Y A;  3G6J B;  4YCW A;  3K57 A;  4A3J B;  2ENB A;  4DV5 Q;  1DZ1 A;  1RJT A;  1X65 A;  4KTA A;  2CVR A;  4JI1 L;  3OOC A;  1XX8 A;  3D4D A;  3H3V H;  2L1B A;  4ZKC B;  1SYC A;  2YV5 A;  4MZ9 A;  4PMB A;  5GAG C;  1JT8 A;  1F2Z A;  4CJ2 C;  1SXT A;  4QUC A;  1GD7 A;  2F4V Q;  1PYB A;  2K5D A;  5IOD A;  4BWG B;  1DXM A;  1PRT B;  2IY5 B;  4G4K A;  4HED A;  4RH6 A;  2JYO A;  5E7N A;  3C3L A;  4DAM A;  4HCS A;  3M3Y H;  2ZJQ A;  4UY8 C;  4A3D G;  3T4A C;  3L7Z C;  4LF8 L;  2JA8 G;  3J81 E;  2VUM B;  1D1I A;  2PO4 A;  3DEO A;  3H0G G;  1Q46 A;  2PNH A;  2F52 A;  3DUZ A;  4K8J A;  1M4V A;  2OXP A;  4PG3 A;  1EIG A;  1S5B D;  1ZKO A;  2K5N A;  1LYL A;  3I7F A;  5D14 A;  1X32 A;  1JMC A;  4N8X 1;  3HOZ H;  3R8B A;  5CC4 A;  1PH2 A;  4PMW A;  2IX0 A;  1ROD A;  2JK8 A;  4DN4 M;  4ZYS A;  2R7D A;  3GTK B;  2JQO A;  2DY7 A;  2EYP A;  2JN4 A;  4BY1 G;  2K28 A;  3NTI A;  5AJ3 Q;  4R4Q A;  3JAM L;  1GVP A;  2YYZ A;  4OWT B;  4JBK A;  3HOY H;  3VYS A;  1IKM A;  1S5D D;  4QF4 A;  5DM6 3;  1AN8 A;  1HNX Q;  2F0U A;  2F3I A;  2VQF Q;  1PTO H;  1EOV A;  4C2M H;  1LTB D;  1G2T A;  4JV5 L;  1S40 A;  1W6K A;  4LFA L;  4IO9 A;  2BE5 C;  4HAE A;  3E6Z X;  1PXU A;  3D4R A;  1QOH A;  1HTP A;  5IOC A;  2JA5 G;  1T5X D;  2CW0 C;  1KC8 C;  1PH9 A;  4X64 Q;  5IGF A;  4H0L C;  3J81 j;  1CA5 A;  3P75 A;  1N33 Q;  3CD6 A;  2CFM A;  4FXG C;  1K83 B;  4EQP A;  3R3O A;  2OEO A;  1K3B C;  4OHJ A;  1HR0 L;  5KGU A;  2XTI A;  4KN7 C;  1Z47 A;  1RDP D;  2XN9 C;  1SRO A;  4GOP C;  2B2Y A;  2JP1 A;  3VR3 A;  3FMC A;  5JAV A;  1VDZ A;  2I5M X;  4DV4 Q;  3OWE B;  2OQK A;  2Z4I A;  1S4Z A;  2VB3 X;  1PMR A;  3S1R H;  1TS2 A;  4IQZ A;  2NZO A;  2OCE A;  1VQM A;  4WFN 3;  4LF4 Q;  5ELD A;  2PPB C;  2B2T C;  3KUP A;  4X3S A;  1ZYR C;  4PV1 C;  2GVB A;  1STE A;  3GV6 A;  5IT9 c;  1STN A;  4EQN A;  1PA6 A;  1T5E A;  3K5O A;  4F87 A;  2EOT A;  1BVS A;  2PW7 A;  4IJL A;  4LUO A;  4RGM A;  2ZJR A;  2E2J H;  3G7L A;  3I3C A;  1BBU A;  3CCV A;  3J80 E;  2VB2 X;  4P72 A;  1EQQ A;  2F0S A;  1QZH A;  1A62 A;  1AEX A;  2FXQ A;  2AUK A;  4DAV A;  1WJJ A;  3KLW A;  3NBH A;  1EYD A;  4ZRZ A;  2R61 A;  1E1T A;  4LFB L;  4BXX H;  4MTN A;  2R92 H;  1STB A;  1PZI D;  1N9W A;  5C5M A;  1HNZ L;  1EU4 A;  2O2L D;  5ELE A;  1TWH B;  1EUJ A;  3GTQ H;  1WYD A;  1EQV A;  5M5X H;  3T51 B;  5DAU A;  3CCM A;  4RG1 A;  2NN6 H;  2OTL A;  4DK1 A;  3AEV A;  2MQH A;  1BQQ T;  2I5H A;  1N32 Q;  5M3M B;  4GKK L;  4DUZ L;  2K05 A;  4GZY C;  1WCM H;  2QA4 A;  2F0M A;  1NAP A;  4B9X A;  4DK3 C;  2UUA Q;  5EPL A;  4FF2 A;  4XQQ A;  4FNF A;  5J1Z A;  3K7A H;  2KA7 A;  1Y69 U;  1B53 A;  2WAQ B;  2EY2 A;  1MSG A;  2KCM A;  1ENA A;  5ELN A;  5COY A;  1SN8 A;  4J15 A;  3NEM A;  1UE6 A;  1X56 A;  1AE2 A;  1KXL A;  1W3S A;  3G6E A;  1SMY C;  3D0F A;  2VUM G;  5M9O A;  2EVB A;  3JAM E;  1HQM C;  1HRJ A;  1PHJ A;  1EY8 A;  2R93 B;  5FLM G;  1PH1 A;  4CJ0 B;  3HOW B;  5GAD C;  5DEH A;  4JI7 L;  4K0K Q;  2B2V C;  2HDM A;  1EZ6 A;  1XTD A;  4FXD A;  1X54 A;  4JYA Q;  1JE5 A;  1WI5 A;  4R8I A;  1CZG A;  4X3K A;  2NVX H;  3S1M B;  3KLR A;  1FNU A;  3KF8 B;  2ZXP A;  4RAU C;  3SR1 A;  1LUZ A;  2EYM A;  3RZD H;  2ZM6 L;  4IN3 A;  1L1O C;  1D6E C;  4G7Z C;  4DR6 L;  3K5M A;  2QW7 A;  1H95 A;  2OT2 A;  3CCE A;  4HCE A;  2RSN A;  4A3M B;  4IOC A;  4IPH A;  3GQB A;  5CV4 A;  3I4L A;  1EZ8 A;  3PIO A;  1PRT F;  1YVC A;  5GQO A;  1GHK A;  2KCN A;  4H13 C;  3K6O A;  5I9P A;  3FKI H;  3GP7 A;  2E2I H;  1JE4 A;  3F8T A;  2AQ2 B;  2K75 A;  2RSO A;  4L63 B;  1EY7 A;  3ULL A;  4C1N I;  1CA6 A;  1R9T B;  1SND A;  3T1H Q;  3TN2 A;  5K36 G;  4RGO S;  4PMC A;  3L9A X;  1MBY A;  5I9O A;  2KEN A;  1KD1 C;  3P20 A;  1BXT A;  4DV6 L;  1N34 Q;  5LMN Q;  2F0E A;  1I4X A;  2HHH Q;  4A3K H;  1H9M A;  3BU2 A;  3A56 A;  4BBS B;  4BY7 H;  4X66 L;  1UAP A;  3HP3 A;  3W5O A;  1VQ5 A;  1TY0 A;  4GLV B;  4RA8 A;  4IFD G;  4I7A A;  4L8J A;  3GTP H;  2HCC A;  4JI0 L;  1CHQ D;  1PDQ A;  4DK6 C;  3CME A;  3NEN A;  4C3H G;  5J22 A;  2PQA B;  1Y1V H;  4MHE A;  3KJO A;  2UU9 Q;  3STB D;  3OIQ A;  4CDC C;  2B2W A;  2XRS D;  4I7Z C;  1AZP A;  5JEA H;  4LF7 Q;  4Q0F A;  4P74 A;  3DM1 A;  3SXH A;  4HJ8 A;  1Y14 B;  2M00 A;  3E9H A;  1FL0 A;  5C0X I;  4UHV A;  1EIH A;  2ZXO A;  4GOP A;  5HGT A;  3I4N G;  3W1G A;  4B3R L;  1I50 B;  2K1B A;  4DR5 Q;  2NVQ H;  1EY5 A;  4RFB A;  4QL5 A;  5KRU A;  2DNC A;  5BN5 A;  3KOJ A;  1HNW Q;  4IPC A;  2KCC A;  4GNX C;  4CDD C;  2B2T A;  5GAH C;  1FNW A;  3C1E A;  3CCU A;  4FF1 A;  1YNJ D;  2EIF A;  3CQZ H;  1XNR Q;  1I4G A;  4FXK C;  2BDO A;  2SOB A;  4JOI A;  1Y8N B;  1KDB A;  2ZXR A;  2NVT H;  4J6H A;  2UUB L;  4CDF C;  2EYH A;  2JA7 H;  2QEJ C;  3GTL B;  1Q81 C;  1TT2 A;  1BCP C;  1B2T A;  2NVY H;  4IUP A;  4A3L H;  4U68 A;  4A3B H;  3DWP A;  1ENF A;  3T56 B;  3Q8D A;  1I3Q B;  4TRD A;  1XNQ Q;  2O5I C;  4YY3 Q;  3BG3 A;  4IPD A;  2QDL A;  3LGJ A;  1OXX K;  5TSS A;  2RHS B;  4A3I B;  3EA6 A;  3CHB D;  2XSC A;  1CM9 A;  5CV6 A;  4PNY A;  4QY7 A;  1Y8O B;  4HTH A;  5JJI A;  1XXG A;  1HA5 A;  3DM3 A;  1IBK Q;  1WOC A;  2V1C C;  4C3I H;  5ELC A;  2Z9H A;  1ET6 A;  2IHE A;  2FHT A;  4O1N A;  2E2H H;  1PRT C;  3OMC A;  1I6H B;  4YHH L;  3HEJ A;  2YU9 B;  1LTL A;  4IUQ A;  1TWG B;  1B8A A;  2G5D A;  1MJC A;  1SYG A;  4A3E H;  3QB3 A;  1VQL A;  1ZEQ X;  4A3F H;  3TSS A;  1Q3L A;  4A3D B;  1MIU A;  3LX0 A;  2JA8 B;  1W6J A;  4L5R C;  2KEE A;  2E76 C;  3H0G B;  3K5N A;  1EL0 A;  3HOW G;  1HH2 P;  2I0Q A;  5D65 A;  1E2W A;  1B9M A;  4GKJ L;  1YI2 A;  5J3B A;  3F2U A;  1I4Q A;  4LF6 L;  1PH7 A;  4DGZ A;  1KAW A;  2L0C A;  5C5L A;  1TWC B;  5IP9 G;  4DV1 L;  1VQ8 A;  1M8A A;  2CQO A;  4X65 L;  2CWP A;  4NP5 A;  3D8G A;  5CV9 A;  3HOZ G;  2BE5 D;  1B7Y B;  1ICW A;  3I8Z A;  1RIP A;  1YBY A;  2UUC L;  2BDN A;  3J81 L;  2VQE Q;  3BZK A;  1VF5 C;  1HTL D;  4KKT A;  5I4D A;  3PUY A;  1RHP A;  2N78 A;  1AZQ A;  2A6E C;  1B3A A;  4EQ5 A;  1ILP A;  1OXT A;  3I73 A;  3WDN A;  1AP0 A;  5IGC A;  2IHF A;  5IP7 H;  1FR3 A;  5IWA Q;  2JXM B;  1J5E L;  1DJR D;  1L1O A;  4HIO A;  2E75 C;  3ERQ A;  4KI0 A;  3Q23 A;  3S15 B;  5JVH 3;  3KF6 A;  2BH2 A;  5LMU L;  3K81 C;  4DUY Q;  1K0S A;  3NEL A;  2F0T A;  5FJ8 H;  2BH8 A;  4A3G H;  3R2I A;  3NWT A;  3NTK A;  5M5Y B;  5C3W A;  4ME3 A;  4IPG A;  4JI4 L;  1VQ7 A;  3GTJ H;  4P2C B;  3PUV A;  2KUM A;  2BA0 A;  1E7Z A;  4DAY B;  1VQC A;  2Y0S B;  3TP6 A;  2AQ3 B;  2YTX A;  1ZYR D;  4ZQ3 A;  4CKE A;  4K5X A;  1VQP A;  2F0H A;  2I07 B;  4KHZ A;  3I72 A;  5IT9 L;  4OL7 A;  2E5L L;  4LWC A;  3J81 i;  3EIV A;  2R7Z H;  1BKB A;  3SGI A;  4IAL A;  3TDQ A;  4EVO A;  1L0X B;  4DR3 L;  5D3D A;  4QGU A;  4R1J A;  4POG A;  5FK9 C;  2ZT9 C;  1ENC A;  3ONA B;  3TME A;  4KD4 A;  4GS3 A;  3UDG A;  4TVA B;  1VQO A;  3HOX B;  5E4X A;  5IGB A;  4QIW B;  3VR2 A;  4F8M A;  1XMO Q;  3TBI B;  3H91 A;  3UDF A;  2H1E A;  1SSO A;  3MTS A;  1PTO F;  5IY0 A;  5M3F B;  3PQI A;  3S2D H;  1TQO A;  5JOB A;  1XMQ L;  1G51 A;  2B39 A;  2WKD A;  2B63 H;  3HG9 A;  4DR7 L;  2VZA A;  2Y0S E;  1LM0 A;  2KHI A;  4LFC Q;  2OTJ A;  4A3C G;  3CP0 A;  3X3M A;  3S1Q H;  4RCO A;  4DNR B;  1IL2 A;  1S5E D;  3GV3 A;  1AW7 A;  1XPR A;  1H9K A;  2YTY A;  5G3L F;  2RQX A;  1H9J A;  1LTR D;  3I90 A;  1JJG A;  4GNX A;  1DCZ A;  3MWY W;  3QOL A;  4DV3 Q;  1CKO A;  2QDB A;  1VMP A;  4BXX G;  1QVF A;  3H6M A;  1A3V A;  1DD2 A;  3RN2 A;  2XWJ B;  1LTS D;  4X3U A;  1VS0 A;  4LAA A;  3L2P A;  1YNJ C;  3MVV A;  1ZXT A;  1P8L A;  5KIX A;  3GTG H;  1NY4 A;  5HUR A;  3PSI A;  4IUR A;  4DR1 L;  3HOV B;  1VQJ A;  2NN6 G;  2F0D A;  1YHB A;  1BBX C;  4EX5 A;  1SMY D;  5C4J H;  4OO1 G;  3ULP A;  4HIK A;  3S17 B;  4OWW B;  2IL8 A;  1WD1 A;  4DV7 L;  2B3G A;  2EZV A;  4C3I B;  3NPP A;  2F0N A;  5CYU A;  1TWF H;  4JI5 L;  4HJ9 A;  2F3W A;  1A3U A;  3TS0 A;  3S1N H;  4UDU C;  5KNC A;  5IGE A;  2F0I A;  2LFN A;  2CKZ B;  1IYJ B;  1XWE A;  4RHS A;  1ML0 D;  4JBM A;  2DNE A;  4ZKB B;  2PYK A;  2WP8 J;  5C4H A;  2NYZ D;  1Y8P B;  1VQB A;  2B8F A;  1LAC A;  3S14 H;  2EY5 A;  3I56 A;  2B2U C;  3MC0 B;  4DV5 L;  3A55 A;  5C4X H;  3J80 i;  3KFU A;  4BS9 A;  1UUP A;  3M4P A;  4NXN L;  3R93 A;  1EY0 A;  4H7B A;  3ZJY C;  3D3R A;  1H9R A;  2GN5 A;  3SK6 A;  3J7A F;  3SVM A;  1UWV A;  1N36 Q;  4HN7 A;  4YCU A;  4LFA Q;  1E22 A;  3LNN A;  3DLL A;  2QGQ A;  3NUC A;  1JR0 D;  4IFD I;  4AYB B;  2KHS A;  4LUV A;  1KIX A;  1I94 Q;  1HHV A;  5CMD A;  4L5Q A;  3CAM A;  3N52 A;  1QG7 A;  3MXP A;  3TS2 A;  4KHP L;  1YEZ A;  4Y52 H;  3T16 A;  3OYY A;  3J7Y W;  1PTO C;  1PV4 A;  1C4Q A;  2A68 D;  5IT9 E;  2PMZ B;  1G6Z A;  4KKU A;  5FLX c;  1V43 A;  4FYD A;  2N3S A;  1DOK A;  2QIL A;  1U5K A;  1VQA A;  1K9M C;  2WV6 D;  4IJH A;  5CV7 A;  2L11 A;  3C2P A;  5CBA E;  2PW5 A;  1EY6 A;  3J7A 5;  1O7I A;  1ICF B;  1TS4 A;  2D2C C;  2LSS A;  2Y0S G;  3BDC A;  1JOR A;  2EJM A;  1TWA H;  3S2H B;  1X3Q A;  2RF4 A;  2K7V A;  5BR8 L;  3K5L A;  5AJ3 L;  4AYB E;  3EQL C;  4BY7 G;  1S72 A;  4JBW A;  4DNI A;  4O2D A;  4G7O C;  1B44 D;  1HNX L;  1CQF A;  4WJ4 A;  1EYG A;  4C3H B;  2VQF L;  3U50 C;  3JAM i;  4AQY Q;  5A2Q L;  2F3V A;  2IX3 A;  3RZO H;  1EOT A;  4UP9 A;  2K04 A;  1PFS A;  5CV5 A;  2PMZ E;  4DXG A;  5JEA G;  3GO5 A;  3HOX G;  1S5C D;  5CBE E;  3DXJ C;  1B3Q A;  1DYQ A;  4X64 L;  4JPB W;  1QNK A;  5HY6 A;  1EU3 A;  3I4N B;  1Z6H A;  2GVA A;  2WII B;  4QUF A;  1BCP D;  1VQ9 A;  4A93 H;  1O7L A;  1D2B A;  2QCP X;  5M3F G;  1II3 A;  3CCL A;  3K8A A;  1QB5 D;  1HNZ Q;  1UEB A;  4K14 A;  3H3V I;  2EYO A;  2B8G A;  3GDE A;  3K0Y A;  1Q86 C;  4ZAI A;  4Q5V A;  5IYD H;  4KJN A;  2UXB Q;  1V8Q A;  2Q8I B;  1RKN A;  4X3T A;  1BF4 A;  1NCV A;  1DOL A;  2F0O A;  1WTQ A;  5IYB G;  3W3A A;  1IBL Q;  1VMC A;  4DV4 L;  1HJP A;  1JOQ A;  1LTG D;  4DUZ Q;  1IZ6 A;  1EWI A;  1PH3 A;  1OO9 B;  2JA7 G;  3BYT B;  4K5W A;  2L9H A;  2EPB A;  1WFQ A;  3GTO H;  1JOO A;  1PRT D;  3HKZ B;  3NBI A;  4LF4 L;  4C3J B;  3OTO Q;  1F9Q A;  1QWY A;  3TP7 A;  4A75 A;  1C9O A;  2N55 A;  3MXN B;  2RCF A;  3HOV G;  1SFO H;  1J6Q A;  2ALY B;  4M8A A;  1RF2 D;  2AWN A;  1X3F A;  2F0L A;  4XQN A;  4EQO A;  1SE8 A;  1Q12 A;  4ALP A;  2JA6 H;  5E3F A;  4OIK A;  2DY8 A;  4DAP A;  2NZ1 D;  3ER0 A;  3D31 A;  2AHO B;  4DKA C;  2JA9 A;  4C3I G;  4B08 A;  3NE5 B;  4IZ8 A;  4JI7 Q;  1GUW A;  4NXM L;  5KYL A;  1C0A A;  3VR4 A; 
#chains in the Genus database with same CATH homology
 3OMG A;  1KNA A;  1EYC A;  2KED A;  4XXE A;  3M3Y B;  4ZUJ A;  1OXS C;  4TKO B;  2KQ3 A;  3SHL A;  2LKV A;  2A6E D;  2QF7 A;  2WAC A;  1G91 A;  1HUM A;  2O4X A;  1BO0 A;  3MHB A;  5C4X B;  3Q22 A;  2J7Z A;  2SNM A;  3M85 A;  2A6H C;  3HOZ B;  1B9N A;  1R4P B;  3LWU A;  5C0X J;  1G2S A;  1U9R A;  1G8Z D;  5ELB A;  5DNF A;  3NQI A;  3P1H A;  1SNM A;  2XIW A;  1LT6 D;  3R2T A;  1GHJ A;  4KHV A;  3HOY B;  1SYB A;  2TSS A;  1YNN C;  2J0T D;  3RUZ A;  1PTO B;  4C2M B;  4FVM A;  4DU9 A;  1J9O A;  2IPK D;  1SDF A;  3U9O A;  5A2Q E;  1J8I A;  3BYY B;  3NSW A;  4QMG A;  1ESF A;  2PCF B;  3KBX A;  4C1N K;  3J7A V;  1TVX A;  4XTC S;  3ND8 A;  2L12 A;  3V05 A;  2L55 A;  1EY9 A;  3C46 A;  2A68 C;  1KLG D;  4HR7 B;  2F0V A;  3ERO A;  1K8O A;  1HQR D;  3BZD B;  1STY A;  4Z9C B;  3FEW X;  1I4P A;  5JPM C;  3NTH A;  3S1R B;  1C48 A;  2F0P A;  5A35 A;  3PV0 A;  2H4O A;  2L5T A;  1LT3 D;  1D5Z C;  5AFW A;  1IYU A;  2MP1 A;  4OO1 I;  1WTX A;  4IUT A;  5LHY 1;  3WOE A;  4J8Q A;  1JOK A;  2E2J B;  1HPC A;  2F0K A;  4ODG A;  5C6A A;  3H09 A;  2BOS A;  1E0B A;  4ZK9 B;  1SE4 A;  4FF3 A;  2NUC A;  5FO7 B;  5CR3 A;  4R9W A;  3E0J A;  2R92 B;  2ICE C;  2RA4 A;  1JB3 A;  4C3J G;  3VYU A;  3MXG A;  3GTQ B;  2PZU A;  1ET9 A;  4DXF A;  1KDC A;  5M5X B;  2RDG A;  1IHZ A;  3NHH A;  2NTT A;  5EPJ A;  4IUN A;  1IYV A;  1SFO B;  3DMU A;  5CV8 A;  3UI2 A;  1C8C A;  3MA2 B;  4CKC A;  1WCM B;  1DM0 B;  1VF7 A;  1HCZ A;  1TU2 B;  4RHR A;  2KEC A;  2RVL A;  2C5C A;  5EKK A;  3K7A B;  4XYO A;  4M1U B;  1LTT D;  4XQJ A;  3EFX D;  1LT5 D;  2G9D A;  4HSP A;  1NSN S;  2K33 A;  1CT1 D;  3M4Y A;  2X6L A;  1E2Z A;  1CI3 M;  4DFA A;  1PFB A;  1JQY D;  1JWU D;  1I4R A;  3IFD A;  3M7N A;  2VXW A;  1B4O A;  1QJO A;  1E2V A;  1QCB D;  2SNS A;  3NXW A;  4XT3 B;  1HUN A;  5LL6 S;  1PTO D;  1CHP D;  2NVX B;  2K03 A;  3I70 A;  2B2V A;  3QO2 A;  1OXU A;  1B50 A;  4WJW A;  5FLX L;  3RZD B;  2Z1C A;  3AU7 A;  1F9S A;  3ND9 A;  5I2Y A;  3PO3 B;  2BCO A;  5G3L D;  1WTV A;  4PQX A;  4FP5 D;  2MPM A;  5EBC A;  1F2L A;  3A8I E;  3MAQ A;  1V1P A;  3FKI B;  2E2I B;  2FIN B;  3RLF A;  3DHQ A;  2WIN B;  5K5P A;  1H9S B;  4FO2 A;  2EYJ A;  2EY6 A;  4F7X A;  3QIA A;  1V1O A;  1WTR A;  3MXU A;  3L3O C;  4G7H C;  4KKS A;  1X3P A;  5K36 H;  4A3K B;  5NUC A;  3VR5 A;  4BY7 B;  3RMH A;  2RDF A;  2CQA A;  1RTO A;  2NTS A;  1TR5 A;  4DAY A;  3V2T A;  3W2D A;  2D9U A;  4HMI A;  3GTP B;  1GXD C;  2EY1 A;  1Y1V B;  5I6W A;  3URY A;  3A54 A;  4UAI A;  5FOB B;  3PIO 3;  4V0B A;  2XWB B;  3HGB A;  4RCN A;  3PMF A;  4TQU S;  1Q8I A;  4J1M A;  5BN4 A;  3FPP A;  3KK7 A;  4C56 C;  1JIC A;  2GA4 B;  2MGS A;  1S5F D;  5FKA C;  3Q24 A;  1SYE A;  1IW7 C;  1ONL A;  2KOL A;  3SK8 A;  2D5D A;  2NVQ B;  4NMZ A;  2SDF A;  1TII D;  1D5M C;  2TMP A;  1EYA A;  3GD7 A;  3MEH A;  5EPK A;  1LT4 D;  3CQZ B;  3CU7 A;  2NBF A;  1F2M A;  1D1K A;  3DEP A;  2Q8T A;  2NVT B;  1XYI A;  4NDX A;  3VR6 A;  1F77 A;  5KEE A;  2JA7 B;  1OXV A;  2NVY B;  4A3B B;  5IGG A;  2JEB I;  5JPN C;  1K8M A;  4K8I A;  4IFD J;  2FFK B;  4BA1 I;  2EJF C;  4ME5 A;  3H3V C;  4O42 A;  2E74 C;  1MSH A;  2XNA C;  1Q90 A;  2G9H D;  3NWS A;  5FO9 B;  2E2H B;  1VCI A;  5KND A;  4BBR B;  1SE3 A;  1JWS D;  5CGK A;  2ID0 A;  2A6H D;  2JEA I;  3SEB A;  4A3E B;  2M2L A;  3FPU B;  5FLX E;  3OSO A;  4A3F B;  4QB4 A;  2AQ1 B;  1LO5 D;  4U67 3;  3T53 B;  1WTP A;  5EQ0 A;  4CKB A;  4XIG S;  2D62 A;  2PZW A;  1CQV A;  5EKL A;  1YNN D;  4L6T B;  1WTO A;  4CHT B;  5T1I A;  2EXZ A;  2Z4H A;  5FO8 B;  1GUT A;  4KV6 A;  2EYL A;  4OIJ A;  2XVS A;  3QJY A;  1TS3 A;  1SBB B;  3OW7 A;  1F2Y A;  3NP8 A;  1IL8 A;  1Q1E A;  1LLR D;  3H94 A;  2A69 C;  3OIP A;  1GJX A;  2ICI A;  1XTC D;  1SNQ A;  1SJE D;  3HZX A;  5JJZ A;  2K6A A;  4KY5 A;  2N88 A;  3A7A B;  3CRL C;  1O7Y A;  2IX1 A;  3Q0A A;  5JVG 3;  4A3G B;  5ISR A;  5J39 A;  3NK9 A;  4E6I A;  3GTJ B;  2L4N A;  1KDA A;  1U4R A;  5LL6 X;  3PUW A;  2MUY A;  3AB9 A;  2Z8L A;  3OHX C;  2OF1 A;  4CGY B;  1MGS A;  5T1G A;  1A15 A;  3V96 A;  2R7Z B;  4IUV A;  5EJW A;  2B2W C;  3D6W A;  2MJ8 A;  3MFG A;  4YIJ A;  3D6C A;  5COR A;  4LJZ C;  4K2K A;  2PZT A;  1PFN A;  2LS0 1;  3S2D B;  1CFM A;  2B63 B;  3DWQ A;  4ILW A;  3SE0 A;  1KAA A;  1PFM A;  3IKJ A;  4RGT A;  3OPO A;  2C9O A;  4KMU C;  3S1Q B;  4KY7 A;  1F9P A;  1A6X A;  1STH A;  1MI2 A;  1TKW B;  1CZW A;  3I91 A;  1NUC A;  1FYC A;  1HFG A;  2K32 A;  1UEA B;  3IL8 A;  1SE2 A;  2F1M A;  2KJX A;  2F0J A;  1LTI D;  5EKI A;  3HOU B;  1WVL A;  2HCI A;  3GTG B;  1PZK D;  4RKB A;  1SEB D;  2F03 A;  4WOR A;  5C0X H;  3SDZ A;  4HMJ A;  5C4J B;  1I6V C;  1BDO A;  3CKI B;  3MXN A;  3TP8 A;  3VYT A;  1Z7T A;  4G57 A;  1SNO A;  1G29 1;  4OO1 H;  4XDX A;  3NQT A;  1BNZ A;  4MN3 A;  1KLU D;  1TWF B;  4WRD A;  5C4Z A;  4JK1 C;  2F0W A;  4KJO A;  4K5V A;  5C3X A;  3ITP A;  3S1N B;  3FDT A;  3VA7 A;  4DNT B;  2HDL A;  2Q8R E;  1L0Y B;  2RDH A;  2HUG A;  3X3N A;  3P7J A;  4IUU A;  4EGV A;  1I4H A;  1UNS A;  3TP5 A;  3IAY A;  3S14 B;  3O13 A;  5KNB A;  1O7Z A;  5I2X A;  2B2U A;  3HS0 C;  1RD9 D;  3KBG A;  1BCP F;  2A5H A;  2O5J C;  3S16 B;  4OGQ C;  3KLS A;  2R3Z A;  2JSO A;  1A2T A;  3KF8 A;  1GUO A;  5E1F A;  1PYW D;  1GUG A;  3BS1 A;  3A7L A;  2E2D C;  3ZYY X;  3KLS X;  4BA2 I;  3FVQ A;  4CJ1 B;  4XYQ A;  1LAB A;  1O78 A;  3U9S A;  1EWC A;  5EGT A;  1U4M A;  4KN4 C;  2IW3 A;  2KVM A;  1TWA B;  1IW7 D;  5I6Y A;  1F9R A;  1U4L A;  3PUX A;  2F0F A;  3RD4 A;  1EEF D;  1PLF A;  4ZUI A;  1O80 A;  3RZO B;  1KTK A;  3PUZ A;  4K6D A;  3BVG A;  4S3S A;  4RWS C;  2M9V A;  2NN6 I;  5D3I B;  1EFI D;  1NR2 A;  4A93 B;  1FD7 D;  2RBM A;  2X6G A;  1DON A;  2AUJ D;  2K5Q A;  5ELF A;  3QWN A;  4HSV A;  1BOS A;  1D5X C;  4DK0 A;  1DOM A;  3FRP B;  1JCK B;  2F4I A;  1EQT A;  3CRK C;  1Y1W B;  1FGB D;  3VA5 A;  5KYI A;  1GUS A;  2SEB D;  2PQE A;  3N6R A;  1STG A;  3QG1 A;  4ID6 A;  4H44 C;  4CBV A;  1B1Z A;  1PZJ D;  4TSS A;  1SYD A;  3SK4 A;  1KNE A;  2WKC A;  4MIU A;  1BUV T;  3GTO B;  2IJ0 A;  1STA A;  3BDO A;  1QIL A;  2NB0 A;  1LTA D;  3HRZ C;  1IKL A;  5JEA J;  2EDG A;  2K5W A;  2JA6 B;  3TZU A;  2IWH A;  1SAP A;  1HA6 A;  3AMU A;  4DA2 A;  2BA1 A;  1EEI D;  3D4W A;  4FF4 A;  4QCL A;  3E5S A;  4NW2 A;  2LMC B;  4RKL A;  2CHB D;  5C3E B;  1HXY D;  2LY7 A;  3OWF A;  2A69 D;  1RTN A;  3DWA A;  2IT1 A;  3VYR A;  1TY2 A;  2DN8 A;  4K2L A;  2AWO A;  4I65 A;  1EY4 A;  3K58 A;  1GOZ A;  1LV9 A;  2F0Q A;  4R8N A;  1QE6 A;  2MHV A;  4F88 A;  3QOJ A;  3M7G A;  4N9P A;  1MD2 D;  3TZD A;  2VNU D;  1CTM A;  4ABN A;  5IIF A;  1NR4 A;  3LWE A;  5F2D A;  3GTM B;  3BVZ A;  2CW0 D;  4BY1 B;  1V1P B;  5EBD A;  3WOF A;  3M4O B;  4DF7 A;  2J4X A;  2FMM A;  2R6G A;  3A8K E;  1CK1 A;  1EWH A;  3MFY A;  2I46 A;  2K01 A;  3A8J E;  5DM7 3;  3SK5 A;  3T13 A;  2JA5 B;  1H9S A;  3EJI A;  4RGN A;  4B9W A;  2NWG A;  3EVQ A;  4K6L A;  5C44 B;  1FNV A;  2B2Y C;  3S9W A;  4Y7N B;  1SJH D;  1KAB A;  4IFD H;  2V4D A;  2EYF A;  1QNU A;  5E4W C;  4KK7 A;  4XT1 B;  1WTW A;  1GUN A;  5M5W B;  1WD0 A;  1SNP A;  3PIP 3;  1A2U A;  4KD3 A;  3MZ5 A;  1SYF A;  1U4P A;  2A73 B;  1ILQ A;  5IGD A;  3K59 A;  3PO2 B;  1TS5 A;  4N9T A;  2FMC A;  2FJ2 A;  2F0G A;  1SNC A;  2JE6 I;  3Q6S A;  3BDL A;  1R4Q B;  2RKS A;  2WB1 B;  3BVM A;  4ZLT F;  1JC7 A;  2XRQ D;  3IFT A;  2A74 C;  4ULL A;  2QKI C;  2EJG C;  4LK1 C;  4V19 0;  2X69 A;  1JWM D;  1AFP A;  1A3T A;  1Q1B A;  4NKL A;  1RCV D;  3I4M B;  1BCP B;  4KY6 A;  4LMQ D;  1ESR A;  5BN3 A;  3C1F A;  2HQE A;  1BR9 A;  2EE1 A;  5C0X G;  3J80 L;  1HFN A;  2PNR C;  3G6J B;  3K57 A;  4A3J B;  2ENB A;  1DZ1 A;  1RJT A;  4KTA A;  2CVR A;  3OOC A;  1XX8 A;  3D4D A;  2L1B A;  4ZKC B;  1SYC A;  4PMB A;  1F2Z A;  4CJ2 C;  1SXT A;  4QUC A;  2K5D A;  5IOD A;  4BWG B;  1DXM A;  1PRT B;  4G4K A;  4HED A;  4RH6 A;  2JYO A;  3C3L A;  4HCS A;  3T4A C;  3L7Z C;  3J81 E;  2VUM B;  1D1I A;  2PO4 A;  3DEO A;  3DUZ A;  4K8J A;  1M4V A;  2OXP A;  1EIG A;  1S5B D;  1ZKO A;  5D14 A;  1X32 A;  3R8B A;  5CC4 A;  4PMW A;  2IX0 A;  1ROD A;  4DN4 M;  4ZYS A;  3GTK B;  2DY7 A;  2EYP A;  2K28 A;  3NTI A;  3JAM L;  2YYZ A;  3VYS A;  1IKM A;  1S5D D;  4QF4 A;  5DM6 3;  1AN8 A;  2F0U A;  1PTO H;  1LTB D;  1G2T A;  1W6K A;  2BE5 C;  4HAE A;  3E6Z X;  1PXU A;  3D4R A;  1QOH A;  1HTP A;  5IOC A;  1T5X D;  2CW0 C;  5IGF A;  4H0L C;  1CA5 A;  3P75 A;  4FXG C;  1K83 B;  4EQP A;  3R3O A;  2OEO A;  4OHJ A;  5KGU A;  4KN7 C;  1Z47 A;  1RDP D;  2XN9 C;  2B2Y A;  2JP1 A;  3VR3 A;  3FMC A;  5JAV A;  1VDZ A;  3OWE B;  2Z4I A;  1S4Z A;  2VB3 X;  1PMR A;  1TS2 A;  4IQZ A;  4WFN 3;  5ELD A;  2PPB C;  2B2T C;  3KUP A;  4X3S A;  1ZYR C;  4PV1 C;  3GV6 A;  1STE A;  1STN A;  4EQN A;  1T5E A;  3K5O A;  4F87 A;  2EOT A;  2PW7 A;  4RGM A;  3G7L A;  3I3C A;  3J80 E;  2VB2 X;  2F0S A;  1AEX A;  2AUK A;  4DAV A;  3NBH A;  1EYD A;  4ZRZ A;  2R61 A;  1STB A;  1PZI D;  5C5M A;  1EU4 A;  2O2L D;  5ELE A;  1TWH B;  1EQV A;  3T51 B;  5DAU A;  2NN6 H;  4DK1 A;  1BQQ T;  5M3M B;  2K05 A;  4GZY C;  2F0M A;  1NAP A;  4B9X A;  5EPL A;  4FF2 A;  4XQQ A;  4FNF A;  5J1Z A;  2KA7 A;  1Y69 U;  1B53 A;  2WAQ B;  2EY2 A;  1MSG A;  1ENA A;  5COY A;  1SMY C;  5M9O A;  2EVB A;  3JAM E;  1HQM C;  1HRJ A;  1EY8 A;  2R93 B;  3HOW B;  4CJ0 B;  5DEH A;  2B2V C;  2HDM A;  1EZ6 A;  4FXD A;  4R8I A;  1CZG A;  4X3K A;  3S1M B;  3KLR A;  1FNU A;  4RAU C;  2ZXP A;  3SR1 A;  2EYM A;  4IN3 A;  1D6E C;  4G7Z C;  3K5M A;  2OT2 A;  4HCE A;  2RSN A;  4A3M B;  3GQB A;  5CV4 A;  3I4L A;  1EZ8 A;  1PRT F;  1GHK A;  2KCN A;  4H13 C;  3K6O A;  5I9P A;  3GP7 A;  1JE4 A;  2AQ2 B;  2RSO A;  4L63 B;  1EY7 A;  1CA6 A;  4C1N I;  1R9T B;  1SND A;  3TN2 A;  5K36 G;  4RGO S;  4PMC A;  3L9A X;  1MBY A;  5I9O A;  3P20 A;  1BXT A;  2F0E A;  1I4X A;  1H9M A;  3A56 A;  4BBS B;  1UAP A;  3HP3 A;  1TY0 A;  4RA8 A;  4IFD G;  4L8J A;  2HCC A;  1CHQ D;  1PDQ A;  4C3H G;  5J22 A;  4MHE A;  3OIQ A;  2B2W A;  2XRS D;  4I7Z C;  1AZP A;  5JEA H;  4Q0F A;  3DM1 A;  3SXH A;  2M00 A;  5C0X I;  1EIH A;  2ZXO A;  5HGT A;  1I50 B;  2K1B A;  1EY5 A;  4RFB A;  5KRU A;  2DNC A;  5BN5 A;  2KCC A;  2B2T A;  1FNW A;  3C1E A;  4FF1 A;  1YNJ D;  1I4G A;  4FXK C;  2BDO A;  2SOB A;  1Y8N B;  1KDB A;  2ZXR A;  4J6H A;  2EYH A;  2QEJ C;  3GTL B;  1TT2 A;  1BCP C;  1B2T A;  4IUP A;  4U68 A;  3DWP A;  1ENF A;  3T56 B;  1I3Q B;  4TRD A;  2O5I C;  3BG3 A;  5TSS A;  1OXX K;  4A3I B;  3EA6 A;  3CHB D;  2XSC A;  1CM9 A;  5CV6 A;  4PNY A;  1Y8O B;  4HTH A;  1XXG A;  1HA5 A;  5ELC A;  1ET6 A;  2FHT A;  4O1N A;  1PRT C;  3OMC A;  1I6H B;  3HEJ A;  2YU9 B;  4IUQ A;  1TWG B;  1SYG A;  3QB3 A;  1ZEQ X;  3TSS A;  1Q3L A;  4A3D B;  3LX0 A;  2JA8 B;  1W6J A;  2KEE A;  2E76 C;  3H0G B;  3K5N A;  1EL0 A;  5D65 A;  1E2W A;  1B9M A;  3F2U A;  1I4Q A;  4DGZ A;  2L0C A;  5C5L A;  1TWC B;  1M8A A;  4NP5 A;  3D8G A;  5CV9 A;  2BE5 D;  1ICW A;  3I8Z A;  2BDN A;  3J81 L;  1VF5 C;  1HTL D;  4KKT A;  5I4D A;  3PUY A;  1RHP A;  1AZQ A;  2A6E C;  1B3A A;  1ILP A;  1OXT A;  3I73 A;  3WDN A;  1AP0 A;  5IGC A;  1FR3 A;  2JXM B;  1DJR D;  2E75 C;  3ERQ A;  4KI0 A;  3Q23 A;  3S15 B;  5JVH 3;  2F0T A;  3R2I A;  3NWT A;  3NTK A;  5M5Y B;  5C3W A;  4P2C B;  3PUV A;  2KUM A;  2BA0 A;  2Y0S B;  3TP6 A;  2AQ3 B;  1ZYR D;  4ZQ3 A;  4CKE A;  4K5X A;  2F0H A;  2I07 B;  4KHZ A;  3I72 A;  5IT9 L;  4OL7 A;  4IAL A;  3TDQ A;  4EVO A;  1L0X B;  5D3D A;  5FK9 C;  2ZT9 C;  1ENC A;  3ONA B;  3TME A;  4KD4 A;  3HOX B;  5E4X A;  5IGB A;  4QIW B;  3VR2 A;  4F8M A;  3TBI B;  3H91 A;  2H1E A;  1SSO A;  3MTS A;  1PTO F;  5M3F B;  1TQO A;  5JOB A;  2WKD A;  2B39 A;  3HG9 A;  3X3M A;  4RCO A;  4DNR B;  1S5E D;  3GV3 A;  1AW7 A;  1H9K A;  5G3L F;  2RQX A;  1H9J A;  1LTR D;  3I90 A;  1DCZ A;  3MWY W;  3QOL A;  2QDB A;  1VMP A;  1DD2 A;  3H6M A;  1A3V A;  2XWJ B;  1LTS D;  4X3U A;  4LAA A;  1YNJ C;  3MVV A;  1ZXT A;  5KIX A;  5HUR A;  4IUR A;  3HOV B;  2NN6 G;  2F0D A;  1BBX C;  1SMY D;  4OO1 G;  3S17 B;  2IL8 A;  1WD1 A;  2EZV A;  4C3I B;  3NPP A;  2F0N A;  5CYU A;  2F3W A;  1A3U A;  5KNC A;  4UDU C;  5IGE A;  2F0I A;  2LFN A;  1XWE A;  4RHS A;  1ML0 D;  2DNE A;  4ZKB B;  2PYK A;  2WP8 J;  5C4H A;  2NYZ D;  1Y8P B;  2B8F A;  1LAC A;  2EY5 A;  2B2U C;  3MC0 B;  3A55 A;  4BS9 A;  1UUP A;  3R93 A;  1EY0 A;  4H7B A;  3D3R A;  1H9R A;  3SK6 A;  3J7A F;  3SVM A;  4HN7 A;  3LNN A;  3NUC A;  1JR0 D;  4IFD I;  4AYB B;  2KHS A;  1HHV A;  5CMD A;  3N52 A;  1QG7 A;  3MXP A;  3T16 A;  3J7Y W;  1PTO C;  1C4Q A;  2A68 D;  5IT9 E;  2PMZ B;  1G6Z A;  4KKU A;  1V43 A;  4FYD A;  2QIL A;  1DOK A;  2WV6 D;  5CV7 A;  2L11 A;  3C2P A;  5CBA E;  2PW5 A;  1EY6 A;  1TS4 A;  2D2C C;  3BDC A;  1JOR A;  2EJM A;  3S2H B;  1X3Q A;  3K5L A;  2K7V A;  3EQL C;  4JBW A;  4G7O C;  1B44 D;  1CQF A;  4C3H B;  5A2Q L;  2F3V A;  2IX3 A;  1EOT A;  2K04 A;  5CV5 A;  4DXG A;  5JEA G;  3GO5 A;  1S5C D;  5CBE E;  3DXJ C;  1DYQ A;  1QNK A;  1EU3 A;  3I4N B;  1Z6H A;  4QUF A;  2WII B;  1BCP D;  1O7L A;  1D2B A;  2QCP X;  1II3 A;  1QB5 D;  4K14 A;  2EYO A;  2B8G A;  3K0Y A;  4ZAI A;  4Q5V A;  4KJN A;  1V8Q A;  2Q8I B;  1RKN A;  4X3T A;  1BF4 A;  1NCV A;  1DOL A;  2F0O A;  1WTQ A;  3W3A A;  1VMC A;  1JOQ A;  1LTG D;  1OO9 B;  3BYT B;  4K5W A;  2L9H A;  2EPB A;  1JOO A;  1PRT D;  3HKZ B;  3NBI A;  4C3J B;  1F9Q A;  1QWY A;  3TP7 A;  2N55 A;  4M8A A;  1RF2 D;  2AWN A;  2F0L A;  4XQN A;  4EQO A;  1Q12 A;  5E3F A;  4OIK A;  2DY8 A;  4DAP A;  2NZ1 D;  3D31 A;  4C3I G;  4B08 A;  3NE5 B;  4IZ8 A;  1GUW A;  5KYL A;  3VR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...