3J80L

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 20
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j80L00
3J81L 3J7AV 5IT9L 5FLXL 3J80L 3JAML 5LL6X 5A2QL
chains in the Genus database with same CATH superfamily
1ET6A 2KECA 4JI4Q 1Q8IA 3HOYH 1XYIA 4U68A 3RUZA 2WAQE 3Q0AA 2X69A 3HOUH 3HOZG 4HIKA 4FXDA 2LFNA 3BZDB 4TSSA 3RZDH 1XWEA 5C4ZA 1U9RA 4XDXA 1VQNA 1STAA 3RLNA 1VQCA 3V05A 3HOVG 4WJ3M 3OIPA 1JB3A 2OCEA 1TS3A 2SEBD 2E2HB 3CAMA 1A6XA 5GADC 3OW7A 4IUNA 3S24A 4K6DA 1AZPA 1E2ZA 1MHWC 4X62L 1BO0A 5GAEC 4TKOB 3S1RH 4R4TA 1UAPA 2I5MX 4IUUA 2M9VA 2QDLA 2QGQA 5ELCA 3R93A 5CC4A 2MJ8A 4IALA 2DY7A 5FOBB 3I4MH 1Z7TA 2F0NA 4KD4A 5T1IA 4EVOA 2B63B 4KJOA 3RNUA 3J81E 5EQ0A 1TWHB 1K9MC 4K6LA 1VQPA 4HJAA 1B9NA 2Z6KA 1HZAA 2KHIA 3V96A 4EQPA 3PO3G 4ZRZA 1EQQA 5E3FA 3K6OA 1S5FD 1BNZA 3GTMB 3C1FA 2IX3A 2F4IA 1BKBA 2EIFA 2F0JA 3QR8A 2VW9A 1N36Q 2F0IA 4MN3A 1N36L 4A3JH 1VQBA 3DWPA 1WCMG 4LF4Q 1A3VA 4LF4L 1JJGA 5JVG3 5IGFA 4PQXA 4CBVA 2F52A 4MTKA 1EZ8A 3F1ZA 3CCRA 1W6JA 3PCOB 1MSHA 5D65A 3I7FA 1EIFA 3P75A 1D1IA 3MXGA 3L2PA 1TS2A 2PPBC 5IWAQ 1PFNA 2EY5A 5HGTA 5IWAL 3H3VI 5K36H 1XPRA 2CQOA 2R6GA 3FKIH 2K32A 3JAMc 1MD2D 1G51A 1BBWA 4O0AA 1Y1WH 4LWCA 2K14A 2NN6I 4L5RC 2G5DA 2R92G 4UHVA 2BA1A 5IE8A 3L0OA 1C7YA 4C3HB 2Z8LA 2IHFA 4K5XA 4ILWA 2K04A 1H9JA 4ZYSA 4OONA 4BS9A 4LFAQ 5FLXc 1X9NA 4LFAL 3EQLC 4HIOA 1K8GA 1FYCA 2JXMB 2WACA 3MAQA 4DV2Q 4DV2L 3MXNB 4JOIC 3CQZH 2HD3A 2A69C 5M5YB 4IPHA 3H15A 1QB5D 2IY5B 2L12A 1JE4A 4JCVE 3KF8A 4UP7A 1LTGD 4X3KA 3VYSA 3UDFA 2YTXA 4JK1C 4JI5Q 2ASBA 4JI5L 2EJGC 1KHIA 5IGBA 2WKDA 5EPKA 4BY1H 1GKHA 4JI1Q 4L6TB 4JI1L 1K83B 2F0QA 2B2TA 2RQXA 1D6EC 3H3VH 4DXFA 4L5TA 1NMGA 4CKBA 1F2LA 2F0VA 1SJHD 1VQ7A 1RIPA 4DV7Q 4DV7L 1EY9A 4A3EG 4OO1I 3LWEA 1QVFA 2NN6H 2YTVA 4I65A 4RGNA 1VMCA 2OWOA 5DM73 1AH9A 4L63B 4GN5A 1W6KA 1ASZA 1HA6A 2F03A 4FYDA 2YU9B 3OIQA 4N8FA 1F2MA 5HY6A 1HQRD 4LUOA 3I4NH 1DZ1A 2MPMA 4B3SQ 2XWJB 2B63G 4C3IB 1PH4A 4B3SL 4ID6A 1WOCA 4GLAC 4JBMA 3HRZC 3OWFA 4KLKA 3NWSA 1C4QA 1X65A 1PH2A 4JV5Q 5IY0A 1XX8A 5IYCH 2CHBD 4JV5L 3MWYW 2NZHA 2OF1A 5EKKA 1Q81C 4X3TA 1KRTA 3T13A 3S1NB 2F0PA 2IPKD 1CHQD 3U4VA 2D62A 3JAME 5KEEA 2NVTB 2EE1A 4YY3L 5BR8Q 5IIFA 1CFMA 5BR8L 3G48A 2I5HA 1T5EA 3UDXA 2B2VC 2LXJA 4QB4A 3MXPA 4CJ1B 1CM9A 3AQQA 2OTLA 1UEAB 3C1EA 1X6OA 5IT9c 3KBXA 3VYUA 1NR2A 1GUNA 2B8GA 5FLXE 1ET9A 1GUSA 3NBHB 2ES2A 3S1QB 2F3WA 3M3YH 1E3PA 4QGUA 1MIUA 2OEOA 1B3QA 3EVQA 4O1NA 3D8GA 4JYAQ 5JEAG 4JYAL 1H9KA 3B6YA 5GROA 4OIJA 5CV5A 1YNXA 3W5OA 1NNXA 2VUMH 2DUDA 3W2DA 3T16A 3PO2H 3NK9A 4QMGA 1PRTD 1PYWD 3H0GB 4DFAA 1EQVA 1WTXA 3VYRA 1OXSC 3TBIB 4CDDC 2JSOA 4QCLA 2AQ2B 1NE3A 1LV9A 1YBYA 2R7ZG 3EIVA 1UE6A 2F4VQ 3S14H 4BXXH 2F4VL 1TY0A 4DK6C 1C8CA 2AQ3B 2E2HH 1I50H 5IGDA 2V4DA 4PMBA 1FNVA 2EJMA 4DAVA 1MJEA 4IPGA 2ENBA 1D5XC 1VCIA 2LSSA 1ML0D 2R93B 2SOBA 1NAPA 4OELB 2HDLA 4XQQA 4KY5A 2F0LA 1CKNB 2ALYB 4R1JA 1J6QA 2N88A 2Z4HA 3AMUA 2F0UA 2EYPA 1KAAA 2B2WA 3HOXH 3GTOB 4A3BB 2K1BA 4A3GG 4A3CG 3QWNA 2K28A 1S72A 4DV6Q 1W3SA 3CMEA 2R7FA 4DV6L 3GTMH 1X54A 3HOYB 1L1OA 2OQKA 3D6WA 3JAML 1NSNS 4KY7A 2JA5B 4LUZA 1HZCA 3RZDB 3I8ZA 1Y8OB 2VQEQ 2JA7H 2IJ0A 2RDGA 1PRTC 1E22A 1E1TA 2KHJA 4HMIA 1IL2A 2MUYA 4IFDI 5FLXL 1N8RC 1ICFB 5C0XI 1KTKA 4OWWB 2ZXRA 5F2DA 3T56B 4H02A 4IUQA 4GZYC 3HKZG 2RVLA 1Y8NB 3U9OA 5FO8B 5IT9E 1EOTA 3UI2A 1FVIA 3A8JE 1HQMC 1CSQA 3QIAA 2N49A 3PGZA 2ZTCA 1VF5C 3RN2A 1EY0A 2M00A 1X55A 1K73C 1E0BA 1QE6A 5T1GA 1JOKA 4J1MA 3S2HH 2Q2HA 1G6ZA 3U50C 1IW7D 3D4DA 5CBEE 3OTOQ 3OTOL 1LT4D 2JA9A 4J15A 1SNCA 4OHJA 4M1UB 5DM63 1SNOA 1BBXC 1SNPA 2D0PA 3DHQA 3SHLA 3K0XA 1LTAD 1GHJA 1B44D 4EQNA 1XPUA 4JBWA 1Q86C 3MZ5A 3OWEB 1U4RA 3TN2A 4Z9CB 4LF7Q 4LF7L 2L9HA 1BDOA 3M4PA 4KMUC 4A3JB 1TU2B 2A74C 1TWGH 1HJPA 1QZGA 2QW7A 1RF2D 2RCNA 3K0YA 3NBIA 3QJYA 3K58A 2RHQB 1RCVD 1A2UA 5C0XH 5M3FB 3D4RA 5JJLA 1Q1BA 4RCOA 1MSGA 2HIXA 4ZLTF 1LT6D 5BN3A 4A76A 4XT1B 4LNQA 3H0GG 2SDFA 3FKIB 3MFYA 1QCBD 1B3AA 4H13C 3PUXA 2BH2A 4MHEA 2NWGA 5D3IB 3BG3A 1ZXTA 1Y1VB 1Y1WB 4H44C 4RGMA 4CJ2C 3GTLB 1E2WA 3TS2A 1R9TB 1EEFD 1JWSD 1SNDA 5GAGC 4R4IA 1G6PA 4XTCS 1YJ9A 2B2UC 3A7AB 1I94Q 1I94L 2A6ED 4A93G 1HPCA 2F3VA 2D2CC 1NUCA 1F2YA 1F9PA 1STEA 1IW7C 2KOLA 2L1BA 2R93G 5EPLA 1LYLA 3I73A 3HS0C 2K52A 2HDMA 4IURA 3CQZB 5IYDH 4NP5A 2IW3A 4C3JG 4DAYA 4CHTB 4A3IH 4LK1C 2H4OA 3FEWX 1WD1A 2HT1A 1FGBD 3ERSX 3T51B 4BBSB 1ENCA 1UEBA 4KKUA 5IP7G 1VQGA 1JE5A 1XTCD 1IHZA 1FR3A 1B7YB 1YI2A 1XNRQ 5I6WA 1GUWA 2BA0A 2QKIC 3M4OB 3CC7A 4BY1B 3FDTA 3ULLA 4A3DB 2MGSA 3HOYG 1KQSA 4ZKBB 1QJOA 2FINB 1EYCA 4NXNQ 3HOUG 2EPBA 4NXNL 3MHBA 4LMQD 3M7GA 3T1YQ 1PH8A 4DXGA 3T1YL 2DJGC 2EQSA 5CV8A 1IYVA 5C3XA 2NTSA 4RG1A 2K4KA 3PQIA 3VR6A 2UUCL 2UUCQ 1IKLA 1H9RA 1KNEA 3C2PA 3S16B 1MI2A 4OIKA 3KF6B 3G4SA 1B8AA 2JEBI 3EROA 3P1HA 1DM0B 2WIIB 3T1HQ 1AZQA 2Z0SA 3T1HL 3SE0A 4PZ8A 1II3A 3BJUA 1ESFA 1XMOQ 1B4OA 1XMOL 1NY4A 2A6EC 2GVAA 2KVMA 1RHPA 1WTOA 3I4NB 4JOIA 2EZVA 3MEFA 1M4VA 3I4MG 1LT3D 5GQOA 3CC2A 1EUJA 2K03A 1EY8A 1HUMA 2RDHA 3KLSX 1QUQB 4GKJQ 5KYIA 4GKJL 1NCVA 2NUCA 4IUPA 4FF3A 1KXLA 3LX0A 1I4HA 4X3SA 3TP6A 1CKMA 1A3UA 5JJZA 4RGOS 4XQJA 2NZOA 1VQLA 3KDFA 4Y7NB 1PXUA 4A3MG 1EWCA 3NQTA 3RR5A 2HQLA 4A3JG 4ME5A 3RMHA 3NUCA 2L5TA 3D6CA 1IBKQ 2L4NA 4AIMA 4IJLA 1GXDC 1IBKL 1AP0A 3HZXA 1SE8A 3OPOA 3J7AV 2JA8H 2EOTA 1K8AC 1SBBB 4HJ8A 2KENA 4K5WA 4DV0Q 4DV0L 3J80i 4A3BH 2VNUD 3H3VC 2JJQA 4UP8A 3GV3A 2Q2TA 1MBYA 4H0LC 3FKIG 3Q24A 2L11A 2E2DC 4JI4L 4ULLA 1S4ZA 2ICEC 4OWXB 2VUMB 2F3IA 1Y1WG 2PNRC 3PO2B 4HN7A 2JA5H 1IYJB 5M3MH 4EQOA 3KLWA 1I3QH 3G7LA 2R3ZA 2CQAA 3BYYB 4HCEA 5A35A 3CCVA 1A15A 4GNXB 1PYBA 2ID0A 3S14B 3PUWA 1TIID 2Z4IA 4B3RQ 4B3RL 1STGA 1I50B 1LACA 3GTJH 2L0CA 3S9WA 2EYOA 2KJXA 4F88A 1TQOA 3MXNA 5E7NA 4IQZA 1PH6A 1LO5D 4L5SA 2K5QA 4YCWA 5FO9B 3I4LA 2RHSB 1OXUA 1PMRA 2C5CA 1XMQQ 2B2VA 1XMQL 2K50A 4DAMA 3A5UA 3I3CA 3A8IE 4EX5A 1JQYD 1VQIA 4A3KH 2MNAA 4BY1G 1GD7A 2PQEA 4YWLA 2PQAB 2AWNA 3SR1A 4XIGS 3HOXB 4JC0A 2OT2A 3BDOA 4L8JA 5C4JH 3P20A 1SROA 1O80A 4KY6A 4X65Q 1A62A 4X65L 3PIPA 5HURA 3WWVA 4AYBE 1YZ6A 5AFWA 1NTGA 3J7A5 4IN3A 1O7IA 4DNTB 1K3RA 1EY5A 2RCFA 2JA7B 1WTRA 4LJZC 1D1KA 3IRBA 1JC7A 5C44H 1AEXA 3ER0A 3PIP3 1DOKA 1UE5A 1GUGA 2K01A 3E5SA 1VQDA 3K5OA 3PIO3 3UE0A 3Q6SA 1MJCA 2K5NA 5M3FH 4ABNA 1I4GA 3A74A 5K5PA 2NYZD 2UXCQ 4R4QA 3FPUB 1JMCA 3I4NG 2UXCL 1YNND 1EQTA 4IOAA 2JP1A 5A2QL 4OWTB 2UUBQ 2UUBL 4DR5Q 1PTOF 1Y1VH 4DR5L 4K2KA 5LMUQ 4BBRB 3GTLH 5LMUL 4GNXC 1F2ZA 5G3LF 4GN4B 1R9TH 1N34Q 1HTLD 4GS3A 4DV1Q 1N34L 1STBA 3ND9A 3S2HB 5FJ8H 2ZJRA 4WRDA 1AN8A 2A8VA 4RCNA 1ILPA 5IODA 1PTOB 3IKJA 1OO9B 4RWSC 1BVSA 1X3QA 1ASYA 3TEHB 1YVCA 1XJVA 1EEID 4LW1A 2PZWA 2KEEA 1JCKB 1STNA 2G9DA 3E0EA 1QNUA 4ZAIA 4PMWA 4BBSH 4A75A 2XWBB 1TWGB 5G3LD 3KFUA 3DWQA 3DLLA 3DWAA 4ZUJA 4LFBQ 1U4LA 4LFBL 2UUAQ 3DEPA 2UUAL 3M4OH 3GD7A 3G6EA 4A3DH 2X6LA 2VUMG 1SYGA 3SK4A 4E6IA 2V1CC 4DUZQ 5M5XB 4O42A 1CKOA 4KV6A 4ZUIA 4DUZL 3PO2G 3CPFA 3J80c 2CW0D 3TP5A 3K7AB 4GOPB 1YNNC 1A0IA 1LTTD 1X32A 2KCMA 3ERQA 3HFZB 4P75A 1QNKA 3SDZA 3S16H 2A6HD 1AFPA 2F0SA 4BXXG 1SFOH 3GDEA 1S3OA 2OQ0A 4YIJA 5CV9A 1H9SA 3J7ZC 5IOCA 3JC66 1GOZA 3W3AA 1CQVA 2KQ3A 1WVLA 3PV0A 2R61A 4G7OC 2EYMA 2XNAC 3TZDA 4QY7A 2N55A 4JPBW 2JK8A 2WKCA 2DNCA 1N33Q 4FF1A 1N33L 1VQEA 2I5LX 3CCLA 4A3IB 1O7ZA 3A55A 2FMMA 4DNRB 2NVXB 3NPPA 3HOXG 1V43A 1DYQA 1MKHA 3D3RA 1ESRA 1F9QA 1D5ZC 2WFWA 3N52A 1SYBA 4KHPQ 4KHPL 1SEBD 4JI7Q 3I91A 4X64Q 1I6VC 4JI7L 1Y14B 1KLGD 4X64L 4Y7NH 4A3FB 4FO2A 1MGSA 2D0OA 3RD4A 4FVMA 1BR9A 2YTYA 5E1FA 3S15B 2VB2X 4OO1H 3OMCA 1GO3E 2K5DA 3EA6A 4IPCA 4DN4M 5KIXA 3S17B 2CW0C 3TRZA 2AKWB 5C3EB 1SE2A 4ZQ3A 1HZ9A 2A6HC 2B2UA 2KA7A 1EY6A 1VQAA 2KEDA 4X6AH 3D31A 3M4YA 4KN7C 1GUTA 1BBUA 1TT2A 2PI2E 4GOPC 4RHRA 1SLJA 3H91A 3NTKA 4LF6Q 1ZYRD 4J8QA 4NB3A 5JOBA 4LF6L 4WJ4A 3F2CA 4N8X1 3ICEA 4C3HG 3D0FA 2Z6KC 4HSPA 4QUCA 4APVA 3VR4A 1XTDA 4IUTA 3W1GA 1B70B 5ELBA 4DR4Q 3PUYA 3QO2A 4DR4L 5EKLA 1B2TA 2HIVA 5IYBH 2ZM6Q 4ME3A 2ZM6L 3J80E 1E2VA 1PH9A 4Q5VA 2BDOA 2EY2A 2WB1B 2PW5A 1BCPF 3KJPA 4CJ0B 4CKEA 2F0DA 2ZXOA 3CRKC 1HNWQ 1HNWL 4JI3Q 2I07B 3F2BA 4JI3L 2WV6D 2XVSA 2LS01 1Q8KA 4FDBA 4B9WA 5ELEA 1YNJD 3CPWA 1ILQA 2FXQA 3HOWB 3L3OC 1Z9FA 1EIHA 1BCPB 2JA8B 3D4WA 1K3BC 5IGGA 5C0XG 4DR2Q 2VY3A 4DR2L 1D8LA 2LXKA 4DGZA 4M8AA 1X3EA 2EYHA 3O13A 1VQ6A 1TVXA 1BXTA 1RL2A 1JJCB 3FHWA 2B8FA 5ELOA 4NPSA 1TWFB 1LT5D 5EAYA 4Q0FA 1JOQA 3BDLA 1Y8PB 5M3MB 3MTSA 4IZ8A 1ZYRC 1FJGQ 2VQEL 2D9UA 4K8JA 1I3QB 1FJGL 2ATWA 5JJKA 4V190 2EYJA 3SGIA 5I9OA 3F2UA 1F77A 1LTBD 1TY2A 1B53A 3TZUA 4OL7A 2A68D 4GLVB 4TQUS 1EYAA 3GTJB 1V8QA 4DUYQ 5M5WH 4DUYL 4FF2A 1WTQA 3OSOA 5IYDG 1RKNA 1Y69U 3R2TA 4C3IG 2Y0SB 4A3IG 1CZGA 5COYA 1PH3A 4P73A 2KCTA 1V9PA 2Q2UA 1PLFA 2RSNA 2EJFC 2K5VA 4BBRH 1SN8A 5C3WA 4OXPA 2XIWA 5FLMH 1F9SA 2EY1A 1I4PA 1KDCA 1WFQA 3K7UC 4A3KB 4RKLA 1IYUA 2PCFB 1SSOA 2E76C 1PTOH 2F0TA 1TKWB 5BN4A 3U58A 2PYKA 5C4JB 3RZOH 4FXKC 4AYBB 4NDXA 4WJWA 3TREA 5I2XA 3J80L 1TWCH 3DM3A 3VDYA 4MNOA 1RD9D 1S40A 2F0EA 2NBFA 1EL0A 4DF7A 1F9RA 4WFN3 4I7AA 1LTRD 1PH1A 2E2JB 5BN5A 4NW2A 5D14A 1E7ZA 5C44B 3H09A 3HGBA 3FP9A 3K59A 4BY7B 4B08A 2IT1A 4QQBX 2AWOA 1B1ZA 4IFDH 1R4QB 4K2LA 4UPAA 1IZ6A 2PO4A 1LTID 2EXDA 2GA4B 3NQIA 2J7ZA 2A68C 4UY8C 3VR5A 5M5XH 1LTSD 5ISRA 1PFSA 1LTLA 4N9TA 3K7AH 3K5MA 1QUQA 4HR7B 1A3TA 1VQHA 5GAHC 1YHAA 1ZKOA 2MO0A 3KUPA 5C5MA 2MO1A 3F2DA 2IX1A 1HTPA 1RJTA 1IXRA 1V1OA 4BA2I 2CFMA 1BOSA 5D3DA 1U4PA 4FP5D 2TMPA 5C4XB 2WB1G 3F8TA 1KDAA 4YCUA 1L1OB 3NHHA 2E75C 1Q1EA 2A1AA 4L5QA 2PNHA 1GHKA 5I9PA 4AQYQ 1QVGA 4LF8Q 4AQYL 1JWMD 4LF8L 4DKAC 4POFA 2ZTEA 4DR3Q 2JA6H 4DR3L 2VZAA 2JA8G 2XSCA 2IL8A 4ZK9B 3TP8A 2NVXH 1PVOA 1M90C 3WDNA 2NTTA 5J39A 4KKSA 4A3BG 3RN5A 2E74C 3PMFA 1XNRL 3X3NA 3CKIB 4N9PA 1O78A 5C4HA 4IJHA 3OMGA 1KIXA 1JWUD 1WTHA 1NMFA 3CCUA 1PFMA 4A3FH 4IPDA 1WJJA 1L0YB 1STYA 2NVQH 2A5HA 2JA5G 3K57A 4PZ6A 5M3MG 5KNDA 1VS0A 2SNSA 5IP9H 3S15H 2Z6BA 1KRSA 1Q90A 3S17H 3IL8A 2MP1A 4GNXA 5E4XA 1KAWA 1SFOB 3KOJA 3SVMA 1C0AA 5C3EH 1CHPD 3E9IA 2TSSA 1RTOA 2CH4A 2WINB 5M9OA 1PV4A 3GTQH 4A4IA 1K8OA 1SYDA 4XXEA 4RHSA 3CW2C 5KGUA 5LMNW 1FNUA 2AUKA 3TMEA 1A63A 2FFKB 1WCMB 2K7VA 3QOJA 2PZTA 4DPGA 3GO5A 4A3KG 4JG2A 3H94A 3A5ZB 1AE2A 1V1PB 1GVPA 4HJ9A 5C5LA 3KLSA 5TSSA 5CMDA 1LUZA 1S5CD 1I5FA 2BH8A 3CXCA 1AW7A 4AYBG 4QJFA 3C3LA 4O2DA 2PMZB 2O2LD 5J1ZA 5JAVA 2CWPA 2WB1E 5CV6A 1IBLQ 4Y52H 1IBLL 3T53B 2IHEA 2LKVA 4RKBA 4JI8Q 1QG7A 1SYFA 2K6AA 4OGQC 4JI8L 2BE5D 4G7ZC 2F0MA 5J22A 5C44G 5E4WC 4ODGA 4KHVA 3HOWH 5EGTA 4RAUC 2J0TD 3AYHB 3HP3A 3X3MA 1YEZA 4CDCC 5M3FG 1STHA 2QEXA 3DUZA 1EOVA 1EU4A 5K36G 2HCCA 3KYHC 3SK6A 2QILA 2MQHA 5A2QE 3CC4A 3GTKB 5I2YA 4TRDA 1VF7A 4OEMB 3NTHA 3OHXC 3G71A 3BDCA 3VA5A 1Y1VG 2DY8A 1PHJA 1C48A 1DCZA 3ND8A 3DMUA 4NMZA 4CDFC 1TWFH 1U5KA 2HUGA 4HCSA 2NVYH 2XN9C 4HTHA 4IFDJ 1VMPA 1FNWA 4ZCKA 5FJ8G 5C0XJ 3S2DB 4A3LH 2MFIA 3E3XA 1TS4A 4XQNA 2EXZA 5KYLA 4NKLA 4X3UA 2ZJPA 2ICIA 2B2YC 2UXDQ 3FVQA 1I4QA 2UXDL 4KK7A 4U673 2KCCA 1G91A 4JBKA 2K05A 1G2SA 2VB3X 1HZBA 2I46A 1ICWA 2Q2IA 1BUVT 2QCPX 4R8NA 2ZXPA 2EY6A 5KNBA 2EYLA 5CBAE 4A3EB 2CVRA 1CK1A 2L55A 2YV5A 4TVAB 2Y0SE 4JBJA 1H95A 2CKZB 4BBSG 1HXYD 1CT1D 1Q12A 1YJNA 4P71A 3J81j 4DK3C 4JVZA 2JN4A 3R8BA 2BE5C 2XRSD 3TQYA 1JOOA 5LMNQ 1HA5A 2NZ1D 1DXMA 4A3DG 5LMNL 4X62Q 1NBWA 2F0OA 1WTPA 3PUVA 1XPOA 3IFTA 3TS0A 3PUZA 4G57A 3GTGH 4GOPA 4DV5Q 2OXPA 4DV5L 1EU3A 5CV4A 1EYDA 1RDPD 2NN6G 3MXUA 3PIOA 1S5BD 4JI0Q 4YCVA 4JI0L 1YHQA 2QEJC 4WORA 2E2JH 3R2IA 4HJ5A 1U4MA 5EBCA 1RODA 1I6HB 2A69D 4BY7H 1SMXA 1LM0A 2IWHA 1KD1C 4OX9Q 2B39A 1HCZA 4OX9L 4HEDA 1PH7A 3NSWA 3KDFB 5CGKA 4UAIA 2Q8IB 5M5WB 4A3MH 4R4CA 3C46A 3AU7A 1JR0D 2X6GA 3URYA 2AHOB 3CCMA 4R4OA 2EVBA 4DK1A 3IFDA 3A8KE 1HR0W 4FF4A 1VQMA 2WP8J 1VQ4A 3T4AC 5IYCG 4KI0A 5KNCA 4DV1L 3CF5A 2AMCB 2J4XA 4I7ZC 1PA6A 1KDBA 2QA4A 4J6HA 1Z47A 5C4XH 1FD7D 4DAPA 1QILA 4YWMA 1GJXA 5EKIA 1Q3LA 3L9AX 2C9OA 1JT8A 4C2MH 1D2BA 3TP7A 3HOZH 3RZOB 4DV4Q 4DV4L 4OO1G 5LL6X 1TWCB 2F0GA 4K5VA 3I4OA 2Z1CA 3CRLC 1PTOD 5JVH3 4RMFA 3HOVH 3NBHA 3MVVA 3BVGA 1XXGA 2VS1A 2R7ZB 4K0KQ 1B50A 4QIWE 4K0KL 2K33A 2FHTA 2B3GA 1VQOA 2JYOA 5JJIA 2E8GA 2E2IH 1OXVA 3S1MH 1Q46A 3NELA 4LFCQ 4LFCL 1UUPA 2XRQD 3V2TA 2BDNA 3NENA 2N8NA 2VL6A 1VQKA 2EYFA 2DGYA 5JPMC 4B3MQ 1X3GA 4B3ML 5NUCA 3J81L 5DEHA 2JQOA 1T5XD 3MEHA 1SRUA 3GV6A 5IYBG 3EJIA 3CCSA 1KL9A 3OW2A 4A3GB 2O5JC 3BS1A 2F1MA 3PO3H 1G291 2QF7A 1WTVA 2PW7A 4G4KA 1A8VA 4FNFA 4JW0A 3CCEA 1W2BA 1PZJD 3NXWA 1HH2P 2RDFA 1DONA 3DEOA 4JI2Q 4RH6A 1PZKD 4JI2L 3NEMA 3Q22A 1CKNA 3AEVA 4IUVA 1WCMH 3M7NA 2JA6B 1BF4A 4LF5Q 3QG1A 4LF5L 1EIYB 1PTOC 3GP7A 3BU2A 2SNMA 3TSSA 1VDZA 4EQ5A 1HR0Q 1HR0L 3HKZB 1VQJA 3K5NA 4DA2A 1HRJA 3R3OA 5CYUA 2GN5A 4QL5A 2PMZE 2JE6I 1X3PA 3ITPA 2P5ZX 1IBMQ 2NVQB 1B9MA 1C9OA 1K0RA 1IBML 2KHSA 1HHVA 4K8IA 3UE1A 2FMCA 2JA7G 5CORA 2AUJD 2R92H 1QWYA 3U9SA 3Q23A 3GQBA 5IGCA 1P16A 1SE3A 2OTJA 1X56A 1D7QA 4YY3Q 1JB7A 5DNFA 3LGJA 2HHHQ 3E6ZX 1SAPA 2ZTDA 2HHHL 2HQEA 1PRTF 2EDGA 4JI6Q 3GTKH 4JI6L 3GTQB 3PF4A 1WYDA 2O5IC 1O7LA 1UE7A 4BBRG 4C56C 2KCNA 3KBGA 3H6MA 4PNYA 5ELNA 4KN4C 3GTPH 3M85A 5FLMG 3PSIA 2Q8TA 3KF8B 3SXHA 3VR3A 4HAEA 3W1BA 1UE1A 4S3SA 4XYOA 1PRTB 4EGVA 1CA5A 3S2DH 4C1NI 4DV3Q 4DV3L 3QOLA 3SK8A 4X66Q 1Q82C 2CWAA 4DK0A 1SDFA 4X66L 2BCOA 1I4XA 3FRPB 1TWAB 4QF4A 4F8MA 1A2TA 1KABA 2XTIA 3ZJYC 3NWTA 3NE5B 4A3EH 1EY7A 2KUMA 1Q7YC 4HJ7A 5H1SE 3RLOA 4ALPA 3K81C 5CR3A 3DXJC 3KK7A 3A56A 2F0HA 2CH4W 2D5DA 1PH5A 3J7YW 4CDEC 3N6RA 5FK9C 4DR6Q 4DR6L 2H1EA 1H9SB 1JICA 1HNXQ 1HNXL 4IFDG 3I90A 1YITA 4A93B 3CHBD 3I55A 3K8AA 2HCIA 5HGQA 3NTIA 2JEAI 4K14A 2B29A 2YYZA 5LHY1 1L0XB 4ZKCB 2B63H 1BCPD 1GUOA 3TDQA 4C3JB 5KRUA 3ULPA 1CA6A 1TWHH 5FO7B 2NVYB 3FPPA 3HEJA 1ENAA 2DN8A 3VA7A 3WOEA 4DR1Q 1I6HH 4DR1L 4H7BA 1CUKA 4AH6A 4MIUA 4RGTA 3RLFA 2QDBA 1CZWA 1Z6HA 3K5LA 1PZID 2WAQB 1JORA 1TS5A 2N78A 4GN3B 4KJNA 1SNMA 3HOUB 4FXGC 4B9XA 1KC8C 3EN2A 2N3SA 3J81i 1NR4A 4LF9Q 4LF9L 3AFPA 2JA6G 1EWIA 1O7YA 2LMCB 4PMCA 1FGUA 1V1QA 5C6AA 2UXBQ 1KLUD 2UXBL 2O4XA 1SMYD 5DAUA 2VXWA 3VYTA 1YNJC 2ZJQA 2B2TC 3DM1A 1RTNA 1UNSA 4F87A 2A19A 1N32L 1N32Q 2C35B 3U4ZA 2K5HA 2LY7A 5JEAH 1J8IA 3LWUA 3S1RB 3EFXD 1YIJA 4A3FG 1PDQA 1IKMA 1EQRA 5CV7A 5DLQE 4P72A 3GTGB 2RA4A 5IP9G 4BWGB 3I4MB 4RA8A 5ELDA 1IL8A 3Q8DA 1EFWA 4RFBA 4C3HH 3KF6A 3ZYYX 3MA2B 1BCPC 1DJRD 2A73B 5C3EG 4XT3B 1XNQQ 1XNQL 1E1OA 2R7ZH 5L37A 2Z9HA 1SXTA 1HUNA 1NJIC 2B2YA 5LL6S 1K28A 3BVZA 1S5DD 4R8IA 1CSPA 3G6JB 5JPNC 4HIDA 5M5YH 1VQ8A 1EFID 1EYGA 1PYSB 1M8AA 4A3MB 1WI5A 2GVBA 3A7LA 2RKSA 4F7XA 2RSOA 3E0JA 1J5EQ 3I72A 1YJWA 1J5EL 1CQFA 4MZ9A 1VQ5A 2AQ1B 1I4RA 1EY4A 1V1PA 2G9HD 3P7JA 5EPJA 1DGSA 1LABA 3I70A 3HG9A 3LNNA 4CGYB 5AJ3Q 1SYCA 5AJ3L 1OXTA 2ZT9C 3J7AF 3UDGA 1K83H 3EBEA 4GKKQ 4GKKL 4A3CH 4A3GH 1P8LA 1SMYC 1HFGA 3KJOA 5I6YA 1VQFA 3KLRA 2R7DA 5EBDA 3UDIA 4NXMQ 4C2MB 4NXML 1AE3A 4P2CB 2UU9Q 2UU9L 1DOMA 3HOZB 2DJFC 4YWKA 3QB3A 1EWHA 3K80C 3HOWG 2XGTA 3HOVB 1SNQA 4B3TQ 4QIWB 4B3TL 2K5WA 2YU9H 3E9HA 4LAAA 1CTMA 4YHHQ 1WTWA 4HSVA 4YHHL 4XYQA 4PV1C 3STBD 2PI2A 4V0BA 4HMJA 1ENFA 4PZ7A 3I56A 1VQ9A 3CMAA 2E2IB 1CI3M 1UWVA 1QVCA 5FKAC 4C3IH 3HKZE 2RF4A 3BZCA 5EJWA 3S1MB 3ULJA 4POGA 5IT9L 1OXXK 1KNAA 1SE4A 1DOLA 3SEBA 3BZKA 3HKSA 4A3LG 2F0WA 5J3BA 3S1NH 1ZEQX 1EZ6A 3VR2A 2NB0A 5ELFA 4KD3A 4IOCA 3FMCA 3AB9A 2WAQG 1YHBA 2MHVA 2NVTH 1E24A 4IO9A 3OYYA 3PO3B 1S5ED 1OTCA 1DD2A 2Y0SG 1WD0A 3OOCA 3CD6A 1G8ZD 3ONAB 2E5LQ 3CU7A 2E5LL 2K75A 2L15A 3A0JA 4C1NK 4LUVA 3CCQA 3S1QH 2B2WC 3WOFA 1SYEA 1HFNA 3J81c 3AFQA 2PQAA 3JAMi 1BQQT 4CKCA 2VQFQ 1GM5A 2VQFL 1TWAH 4PG3A 4DR7Q 2DNEA 1EIGA 4DR7L 1L1OC 1JJ2A 4BA1I 1SJED 4HIMA 2Q8RE 1HNZQ 4DU9A 3I2ZA 1HNZL 4KKTA 3STBC 3CP0A 3H0GH 4QUFA 3M4QA 3NP8A 4UP9A 3L7ZC 2FJ2A 3MFGA 4KTAA 1M1KC 1D5MC 4UDUC 2R92B 3CCJA 2BOSA 3M9BA 5JEAJ 4GLXA 1L2FA 1QZHA 4BY7G 2F0KA 2IX0A 4A93H 5IGEA 1SR3A 1K0SA 1U0LA 4P74A 1ONLA 2KBNA 2PZUA 2R93H 4DNIA 4G7HC 1TR5A 2M2LA 3BVMA 1LLRD 1N9WA 3SK5A 1H9MA 3A54A 4KHZA 5I4DA 3MC0B 1TXYA 1X3FA 4C3JH 4DAYB 1T9HA 4R9WA 4MTNA 2H5XA 3GTPB 1L0WA 2F0FA 3BYTB 1FL0A 5IP7H 1K8MA 1PFBA 3M3YB 2I0QA 3GTOH 1G2TA 2RBMA 2CCZA 1QOHA 3IAYA 5C4XG 1R4PB 3PF5A 1J9OA
chains in the Genus database with same CATH topology
1ET6A 2KECA 1Q8IA 1XYIA 4U68A 3RUZA 3Q0AA 2X69A 4FXDA 2LFNA 3BZDB 4TSSA 1XWEA 5C4ZA 1U9RA 4XDXA 1STAA 3V05A 3OIPA 1JB3A 1TS3A 2SEBD 2E2HB 1A6XA 3OW7A 4IUNA 4K6DA 1AZPA 1E2ZA 1BO0A 4TKOB 1UAPA 4IUUA 2M9VA 3R93A 5ELCA 5CC4A 2MJ8A 4IALA 2DY7A 5FOBB 1Z7TA 2F0NA 4KD4A 5T1IA 4EVOA 2B63B 4KJOA 3J81E 5EQ0A 1TWHB 4K6LA 1B9NA 3V96A 4EQPA 4ZRZA 5E3FA 3K6OA 1S5FD 1BNZA 3GTMB 3C1FA 2IX3A 2F4IA 2F0JA 2F0IA 4MN3A 3DWPA 1A3VA 5JVG3 5IGFA 4PQXA 4CBVA 1EZ8A 1W6JA 5D65A 1MSHA 3P75A 1D1IA 3MXGA 1TS2A 2PPBC 1PFNA 2EY5A 5HGTA 5K36H 2R6GA 2K32A 1MD2D 2NN6I 2BA1A 4C3HB 2Z8LA 4K5XA 4ILWA 2K04A 1H9JA 4ZYSA 4BS9A 3EQLC 1FYCA 2JXMB 2WACA 3MAQA 2A69C 5M5YB 1QB5D 2L12A 1JE4A 3KF8A 1LTGD 4X3KA 3VYSA 4JK1C 2EJGC 5IGBA 2WKDA 5EPKA 4L6TB 1K83B 2F0QA 2B2TA 2RQXA 1D6EC 4DXFA 4CKBA 1F2LA 2F0VA 1SJHD 1EY9A 4OO1I 3LWEA 2NN6H 4I65A 4RGNA 1VMCA 5DM73 4L63B 1W6KA 1HA6A 2F03A 4FYDA 2YU9B 3OIQA 1F2MA 1HQRD 1DZ1A 2MPMA 2XWJB 4C3IB 4ID6A 3HRZC 3OWFA 3NWSA 1C4QA 1XX8A 2CHBD 3MWYW 2OF1A 5EKKA 4X3TA 3T13A 3S1NB 2F0PA 2IPKD 1CHQD 2D62A 3JAME 5KEEA 2NVTB 2EE1A 5IIFA 1CFMA 1T5EA 2B2VC 4QB4A 3MXPA 4CJ1B 1CM9A 1UEAB 3C1EA 3KBXA 3VYUA 1NR2A 1GUNA 2B8GA 5FLXE 1ET9A 1GUSA 3S1QB 2F3WA 2OEOA 3EVQA 4O1NA 3D8GA 5JEAG 1H9KA 4OIJA 5CV5A 3W2DA 3T16A 3NK9A 4QMGA 1PRTD 1PYWD 3H0GB 4DFAA 1EQVA 1WTXA 3VYRA 1OXSC 3TBIB 2JSOA 4QCLA 2AQ2B 1LV9A 1TY0A 1C8CA 2AQ3B 5IGDA 2V4DA 4PMBA 1FNVA 2EJMA 4DAVA 2ENBA 1D5XC 1VCIA 1ML0D 2R93B 2SOBA 1NAPA 2HDLA 4XQQA 4KY5A 2F0LA 2N88A 2Z4HA 3AMUA 2F0UA 2EYPA 1KAAA 2B2WA 3GTOB 4A3BB 2K1BA 3QWNA 2K28A 3HOYB 3D6WA 3JAML 1NSNS 4KY7A 2JA5B 3RZDB 3I8ZA 1Y8OB 2IJ0A 2RDGA 1PRTC 4HMIA 2MUYA 4IFDI 5FLXL 5C0XI 1KTKA 2ZXRA 5F2DA 3T56B 4IUQA 4GZYC 2RVLA 1Y8NB 3U9OA 5FO8B 5IT9E 1EOTA 3UI2A 3A8JE 1HQMC 3QIAA 1VF5C 1EY0A 2M00A 1E0BA 1QE6A 5T1GA 1JOKA 4J1MA 1G6ZA 1IW7D 3D4DA 5CBEE 1LT4D 1SNCA 4OHJA 4M1UB 5DM63 1SNOA 1BBXC 1SNPA 3DHQA 3SHLA 1LTAD 1GHJA 1B44D 4EQNA 4JBWA 3MZ5A 3OWEB 1U4RA 3TN2A 4Z9CB 2L9HA 1BDOA 4KMUC 4A3JB 1TU2B 2A74C 1RF2D 3K0YA 3NBIA 3QJYA 3K58A 1RCVD 1A2UA 5C0XH 5M3FB 3D4RA 1Q1BA 4RCOA 1MSGA 4ZLTF 1LT6D 5BN3A 4XT1B 2SDFA 3FKIB 3MFYA 1QCBD 1B3AA 4H13C 3PUXA 5D3IB 4MHEA 2NWGA 1ZXTA 1Y1VB 3BG3A 1Y1WB 4H44C 4RGMA 4CJ2C 3GTLB 1E2WA 1R9TB 1EEFD 1JWSD 1SNDA 4XTCS 2B2UC 3A7AB 2A6ED 1HPCA 2F3VA 2D2CC 1NUCA 1F2YA 1F9PA 1STEA 1IW7C 2KOLA 2L1BA 5EPLA 3I73A 3HS0C 2HDMA 4IURA 3CQZB 4NP5A 2IW3A 4C3JG 4DAYA 4CHTB 4LK1C 2H4OA 3FEWX 1WD1A 1FGBD 3T51B 4BBSB 1ENCA 4KKUA 1XTCD 1IHZA 1FR3A 5I6WA 1GUWA 2BA0A 2QKIC 3M4OB 4BY1B 3FDTA 4A3DB 2MGSA 4ZKBB 1QJOA 2FINB 1EYCA 2EPBA 3MHBA 4LMQD 3M7GA 4DXGA 5CV8A 1IYVA 5C3XA 2NTSA 3VR6A 1IKLA 1H9RA 1KNEA 3C2PA 3S16B 1MI2A 4OIKA 2JEBI 3EROA 3P1HA 1DM0B 2WIIB 1AZQA 3SE0A 1II3A 1ESFA 1B4OA 2A6EC 2KVMA 1RHPA 1WTOA 3I4NB 2EZVA 1M4VA 1LT3D 2K03A 1EY8A 1HUMA 2RDHA 3KLSX 5KYIA 1NCVA 2NUCA 4IUPA 4FF3A 3LX0A 1I4HA 4X3SA 3TP6A 1A3UA 5JJZA 4RGOS 4XQJA 4Y7NB 1PXUA 1EWCA 3NQTA 4ME5A 3RMHA 3NUCA 2L5TA 3D6CA 2L4NA 1GXDC 1AP0A 3HZXA 3OPOA 3J7AV 2EOTA 1SBBB 4K5WA 2VNUD 3H3VC 3GV3A 1MBYA 4H0LC 3Q24A 2L11A 2E2DC 4ULLA 1S4ZA 2ICEC 2VUMB 2PNRC 3PO2B 4HN7A 4EQOA 3G7LA 2R3ZA 2CQAA 3BYYB 4HCEA 5A35A 1A15A 2ID0A 3S14B 3PUWA 1TIID 2Z4IA 1STGA 1I50B 1LACA 2L0CA 3S9WA 2EYOA 2KJXA 4F88A 1TQOA 3MXNA 4IQZA 1LO5D 2K5QA 5FO9B 3I4LA 1OXUA 1PMRA 2C5CA 2B2VA 3I3CA 3A8IE 1JQYD 2PQEA 3SR1A 2AWNA 4XIGS 3HOXB 2OT2A 3BDOA 4L8JA 3P20A 1O80A 4KY6A 5HURA 5AFWA 4IN3A 4DNTB 1EY5A 2JA7B 1WTRA 4LJZC 1D1KA 1JC7A 1AEXA 3PIP3 1DOKA 1GUGA 2K01A 3E5SA 3K5OA 3PIO3 3Q6SA 4ABNA 1I4GA 5K5PA 2NYZD 3FPUB 1YNND 1EQTA 2JP1A 5A2QL 1PTOF 4K2KA 4BBRB 1F2ZA 5G3LF 1HTLD 1STBA 3ND9A 3S2HB 4WRDA 1AN8A 4RCNA 1ILPA 5IODA 1PTOB 3IKJA 1OO9B 4RWSC 1X3QA 1EEID 2PZWA 2KEEA 1JCKB 1STNA 2G9DA 1QNUA 4ZAIA 4PMWA 2XWBB 1TWGB 5G3LD 3DWQA 3DWAA 4ZUJA 1U4LA 3DEPA 3GD7A 2X6LA 1SYGA 3SK4A 4E6IA 5M5XB 4O42A 4KV6A 4ZUIA 2CW0D 3TP5A 3K7AB 1YNNC 1LTTD 1X32A 3ERQA 1QNKA 3SDZA 2A6HD 1AFPA 2F0SA 4YIJA 5CV9A 1H9SA 5IOCA 1GOZA 3W3AA 1CQVA 2KQ3A 1WVLA 3PV0A 2R61A 4G7OC 2EYMA 2XNAC 3TZDA 2N55A 2WKCA 2DNCA 4FF1A 4A3IB 1O7ZA 3A55A 2FMMA 4DNRB 2NVXB 3NPPA 1V43A 1DYQA 3D3RA 1ESRA 1F9QA 1D5ZC 3N52A 1SYBA 1SEBD 3I91A 1I6VC 1KLGD 4A3FB 4FO2A 1MGSA 3RD4A 4FVMA 1BR9A 5E1FA 3S15B 2VB2X 4OO1H 3OMCA 2K5DA 3EA6A 4DN4M 5KIXA 3S17B 2CW0C 5C3EB 1SE2A 4ZQ3A 2A6HC 2B2UA 2KA7A 1EY6A 2KEDA 3D31A 3M4YA 4KN7C 1GUTA 1TT2A 4RHRA 3H91A 3NTKA 1ZYRD 4J8QA 5JOBA 4C3HG 4HSPA 4QUCA 3VR4A 4IUTA 5ELBA 3PUYA 3QO2A 5EKLA 1B2TA 3J80E 1E2VA 4Q5VA 2BDOA 2EY2A 2WB1B 2PW5A 1BCPF 4CJ0B 4CKEA 2F0DA 2ZXOA 3CRKC 2I07B 2WV6D 2XVSA 2LS01 4B9WA 5ELEA 1YNJD 1ILQA 3HOWB 3L3OC 1EIHA 1BCPB 2JA8B 3D4WA 5IGGA 5C0XG 4DGZA 4M8AA 2EYHA 3O13A 1TVXA 1BXTA 2B8FA 1TWFB 1LT5D 4Q0FA 1JOQA 3BDLA 1Y8PB 5M3MB 3MTSA 4IZ8A 1ZYRC 2D9UA 4K8JA 1I3QB 4V190 2EYJA 5I9OA 3F2UA 1F77A 1LTBD 1TY2A 1B53A 3TZUA 4OL7A 2A68D 4TQUS 1EYAA 3GTJB 1V8QA 4FF2A 1WTQA 3OSOA 1RKNA 1Y69U 3R2TA 4C3IG 2Y0SB 1CZGA 5COYA 1PLFA 2RSNA 2EJFC 5C3WA 2XIWA 1F9SA 2EY1A 1I4PA 1KDCA 4A3KB 4RKLA 1IYUA 2PCFB 1SSOA 2E76C 1PTOH 2F0TA 1TKWB 5BN4A 2PYKA 5C4JB 4FXKC 4AYBB 4NDXA 4WJWA 5I2XA 3J80L 1RD9D 2F0EA 2NBFA 1EL0A 4DF7A 1F9RA 4WFN3 1LTRD 2E2JB 5BN5A 4NW2A 5D14A 5C44B 3H09A 3HGBA 3K59A 4BY7B 4B08A 2IT1A 2AWOA 1B1ZA 4IFDH 1R4QB 4K2LA 2PO4A 1LTID 2GA4B 3NQIA 2J7ZA 2A68C 3VR5A 1LTSD 5ISRA 4N9TA 3K5MA 4HR7B 1A3TA 1ZKOA 3KUPA 5C5MA 2IX1A 1HTPA 1RJTA 1V1OA 4BA2I 1BOSA 5D3DA 1U4PA 4FP5D 2TMPA 5C4XB 1KDAA 3NHHA 2E75C 1Q1EA 1GHKA 5I9PA 1JWMD 2XSCA 2IL8A 4ZK9B 3TP8A 3WDNA 2NTTA 5J39A 4KKSA 2E74C 3PMFA 3X3NA 3CKIB 4N9PA 1O78A 5C4HA 3OMGA 1JWUD 1PFMA 1L0YB 1STYA 2A5HA 3K57A 5KNDA 2SNSA 1Q90A 3IL8A 2MP1A 5E4XA 1SFOB 3SVMA 1CHPD 2TSSA 1RTOA 2WINB 5M9OA 1K8OA 1SYDA 4XXEA 4RHSA 5KGUA 1FNUA 2AUKA 3TMEA 2FFKB 1WCMB 2K7VA 3QOJA 2PZTA 3GO5A 3H94A 1V1PB 5C5LA 3KLSA 5TSSA 5CMDA 1S5CD 1AW7A 3C3LA 2PMZB 2O2LD 5J1ZA 5JAVA 5CV6A 3T53B 2LKVA 4RKBA 1QG7A 1SYFA 2K6AA 4OGQC 4G7ZC 2BE5D 2F0MA 5J22A 5E4WC 4ODGA 4KHVA 5EGTA 4RAUC 2J0TD 3X3MA 3HP3A 1STHA 3DUZA 1EU4A 5K36G 2HCCA 3SK6A 2QILA 5A2QE 3GTKB 5I2YA 4TRDA 1VF7A 3NTHA 3OHXC 3BDCA 3VA5A 2DY8A 1C48A 1DCZA 3ND8A 3DMUA 4NMZA 2HUGA 4HCSA 2XN9C 4HTHA 4IFDJ 1VMPA 1FNWA 5C0XJ 3S2DB 1TS4A 4XQNA 2EXZA 5KYLA 4NKLA 4X3UA 2ICIA 2B2YC 3FVQA 1I4QA 4KK7A 4U673 2KCCA 1G91A 2K05A 1G2SA 2VB3X 2I46A 1ICWA 1BUVT 2QCPX 4R8NA 2ZXPA 2EY6A 5KNBA 2EYLA 5CBAE 4A3EB 2CVRA 1CK1A 2L55A 1HXYD 1CT1D 1Q12A 3R8BA 2BE5C 2XRSD 1JOOA 1HA5A 2NZ1D 1DXMA 2F0OA 1WTPA 3PUVA 3IFTA 3PUZA 4G57A 2OXPA 1EU3A 5CV4A 1EYDA 1RDPD 2NN6G 3MXUA 1S5BD 2QEJC 4WORA 3R2IA 1U4MA 5EBCA 1RODA 1I6HB 2A69D 2IWHA 2B39A 1HCZA 4HEDA 3NSWA 5CGKA 4UAIA 2Q8IB 5M5WB 3C46A 3AU7A 1JR0D 2X6GA 3URYA 2EVBA 4DK1A 3IFDA 3A8KE 4FF4A 2WP8J 3T4AC 4KI0A 5KNCA 2J4XA 4I7ZC 1KDBA 4J6HA 1Z47A 1FD7D 4DAPA 1QILA 1GJXA 5EKIA 1Q3LA 3L9AX 2C9OA 1D2BA 3TP7A 3RZOB 4OO1G 5LL6X 1TWCB 2F0GA 4K5VA 2Z1CA 3CRLC 1PTOD 5JVH3 3NBHA 3MVVA 3BVGA 1XXGA 2R7ZB 1B50A 2K33A 2FHTA 2JYOA 1OXVA 1UUPA 2XRQD 3V2TA 2BDNA 2EYFA 5JPMC 5NUCA 3J81L 5DEHA 1T5XD 3MEHA 3GV6A 3EJIA 2O5JC 4A3GB 3BS1A 2F1MA 1G291 2QF7A 1WTVA 2PW7A 4G4KA 4FNFA 1PZJD 3NXWA 2RDFA 1DONA 3DEOA 4RH6A 1PZKD 3Q22A 4IUVA 3M7NA 2JA6B 1BF4A 3QG1A 1PTOC 3GP7A 2SNMA 3TSSA 1VDZA 3HKZB 3K5NA 1HRJA 4DA2A 3R3OA 5CYUA 2JE6I 1X3PA 3ITPA 2NVQB 1B9MA 2KHSA 1HHVA 4K8IA 2FMCA 5CORA 2AUJD 1QWYA 3U9SA 3Q23A 3GQBA 5IGCA 1SE3A 5DNFA 3E6ZX 1SAPA 2HQEA 1PRTF 2EDGA 3GTQB 2O5IC 1O7LA 4C56C 2KCNA 3KBGA 3H6MA 4PNYA 4KN4C 3M85A 2Q8TA 3SXHA 3VR3A 4HAEA 4S3SA 4XYOA 4EGVA 1PRTB 1CA5A 4C1NI 3QOLA 3SK8A 4DK0A 1SDFA 2BCOA 1I4XA 3FRPB 1TWAB 4QF4A 4F8MA 1A2TA 1KABA 3NWTA 3NE5B 1EY7A 2KUMA 5CR3A 3DXJC 3KK7A 3A56A 2F0HA 2D5DA 3J7YW 3N6RA 5FK9C 2H1EA 1H9SB 1JICA 4IFDG 4A93B 3I90A 3CHBD 2HCIA 3NTIA 2JEAI 4K14A 2YYZA 5LHY1 1L0XB 4ZKCB 1BCPD 1GUOA 3TDQA 4C3JB 5KRUA 1CA6A 5FO7B 2NVYB 3FPPA 3HEJA 1ENAA 2DN8A 3VA7A 3WOEA 4H7BA 4MIUA 4RGTA 3RLFA 2QDBA 1CZWA 1Z6HA 3K5LA 1PZID 2WAQB 1JORA 1TS5A 4KJNA 1SNMA 3HOUB 4FXGC 4B9XA 1NR4A 1O7YA 2LMCB 4PMCA 5C6AA 1KLUD 2O4XA 1SMYD 5DAUA 2VXWA 3VYTA 1YNJC 2B2TC 3DM1A 1RTNA 1UNSA 4F87A 1J8IA 2LY7A 5JEAH 3LWUA 3S1RB 3EFXD 1PDQA 1IKMA 5CV7A 3GTGB 2RA4A 4BWGB 3I4MB 4RA8A 5ELDA 1IL8A 4RFBA 3ZYYX 3MA2B 1BCPC 1DJRD 2A73B 4XT3B 1SXTA 1HUNA 2B2YA 5LL6S 3BVZA 1S5DD 4R8IA 3G6JB 5JPNC 1EFID 1M8AA 4A3MB 3A7LA 2RKSA 4F7XA 2RSOA 3E0JA 3I72A 1CQFA 2AQ1B 1I4RA 1EY4A 1V1PA 2G9HD 3P7JA 5EPJA 1LABA 3I70A 3HG9A 3LNNA 4CGYB 1SYCA 3J7AF 1OXTA 2ZT9C 1SMYC 1HFGA 5I6YA 3KLRA 5EBDA 4C2MB 4P2CB 1DOMA 3HOZB 3QB3A 1EWHA 3HOVB 1SNQA 4QIWB 2K5WA 4LAAA 1CTMA 1WTWA 4HSVA 4XYQA 4PV1C 4V0BA 4HMJA 1ENFA 2E2IB 1CI3M 5FKAC 5EJWA 3S1MB 5IT9L 1OXXK 1KNAA 1SE4A 1DOLA 3SEBA 2F0WA 1ZEQX 1EZ6A 3VR2A 2NB0A 5ELFA 4KD3A 3FMCA 3AB9A 2MHVA 3PO3B 1S5ED 1DD2A 1WD0A 3OOCA 1G8ZD 3ONAB 3CU7A 4C1NK 2B2WC 3WOFA 1SYEA 1HFNA 1BQQT 4CKCA 2DNEA 1EIGA 4BA1I 1SJED 2Q8RE 4DU9A 4KKTA 4QUFA 3NP8A 3L7ZC 2FJ2A 3MFGA 4KTAA 1D5MC 4UDUC 2R92B 2BOSA 5JEAJ 2F0KA 2IX0A 5IGEA 1ONLA 2PZUA 4G7HC 1TR5A 2M2LA 3BVMA 1LLRD 3SK5A 1H9MA 3A54A 4KHZA 5I4DA 3MC0B 4R9WA 3GTPB 2F0FA 3BYTB 1K8MA 1PFBA 3M3YB 1G2TA 2RBMA 1QOHA 3IAYA 1R4PB 1J9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 L;  3J7A V;  5IT9 L;  5FLX L;  3J80 L;  3JAM L;  5LL6 X;  5A2Q L; 
#chains in the Genus database with same CATH topology
 1ET6 A;  2KEC A;  4JI4 Q;  1Q8I A;  3HOY H;  1XYI A;  4U68 A;  3RUZ A;  2WAQ E;  3Q0A A;  2X69 A;  3HOU H;  3HOZ G;  4HIK A;  4FXD A;  2LFN A;  3BZD B;  4TSS A;  3RZD H;  1XWE A;  5C4Z A;  1U9R A;  4XDX A;  1VQN A;  1STA A;  3RLN A;  1VQC A;  3V05 A;  3HOV G;  4WJ3 M;  3OIP A;  1JB3 A;  2OCE A;  1TS3 A;  2SEB D;  2E2H B;  3CAM A;  1A6X A;  5GAD C;  3OW7 A;  4IUN A;  3S24 A;  4K6D A;  1AZP A;  1E2Z A;  1MHW C;  4X62 L;  1BO0 A;  5GAE C;  4TKO B;  3S1R H;  4R4T A;  1UAP A;  2I5M X;  4IUU A;  2M9V A;  2QDL A;  2QGQ A;  5ELC A;  3R93 A;  5CC4 A;  2MJ8 A;  4IAL A;  2DY7 A;  5FOB B;  3I4M H;  1Z7T A;  2F0N A;  4KD4 A;  5T1I A;  4EVO A;  2B63 B;  4KJO A;  3RNU A;  3J81 E;  5EQ0 A;  1TWH B;  1K9M C;  4K6L A;  1VQP A;  4HJA A;  1B9N A;  2Z6K A;  1HZA A;  2KHI A;  3V96 A;  4EQP A;  3PO3 G;  4ZRZ A;  1EQQ A;  5E3F A;  3K6O A;  1S5F D;  1BNZ A;  3GTM B;  3C1F A;  2IX3 A;  2F4I A;  1BKB A;  2EIF A;  2F0J A;  3QR8 A;  2VW9 A;  1N36 Q;  2F0I A;  4MN3 A;  1N36 L;  4A3J H;  1VQB A;  3DWP A;  1WCM G;  4LF4 Q;  1A3V A;  4LF4 L;  1JJG A;  5JVG 3;  5IGF A;  4PQX A;  4CBV A;  2F52 A;  4MTK A;  1EZ8 A;  3F1Z A;  3CCR A;  1W6J A;  3PCO B;  1MSH A;  5D65 A;  3I7F A;  1EIF A;  3P75 A;  1D1I A;  3MXG A;  3L2P A;  1TS2 A;  2PPB C;  5IWA Q;  1PFN A;  2EY5 A;  5HGT A;  5IWA L;  3H3V I;  5K36 H;  1XPR A;  2CQO A;  2R6G A;  3FKI H;  2K32 A;  3JAM c;  1MD2 D;  1G51 A;  1BBW A;  4O0A A;  1Y1W H;  4LWC A;  2K14 A;  2NN6 I;  4L5R C;  2G5D A;  2R92 G;  4UHV A;  2BA1 A;  5IE8 A;  3L0O A;  1C7Y A;  4C3H B;  2Z8L A;  2IHF A;  4K5X A;  4ILW A;  2K04 A;  1H9J A;  4ZYS A;  4OON A;  4BS9 A;  4LFA Q;  5FLX c;  1X9N A;  4LFA L;  3EQL C;  4HIO A;  1K8G A;  1FYC A;  2JXM B;  2WAC A;  3MAQ A;  4DV2 Q;  4DV2 L;  3MXN B;  4JOI C;  3CQZ H;  2HD3 A;  2A69 C;  5M5Y B;  4IPH A;  3H15 A;  1QB5 D;  2IY5 B;  2L12 A;  1JE4 A;  4JCV E;  3KF8 A;  4UP7 A;  1LTG D;  4X3K A;  3VYS A;  3UDF A;  2YTX A;  4JK1 C;  4JI5 Q;  2ASB A;  4JI5 L;  2EJG C;  1KHI A;  5IGB A;  2WKD A;  5EPK A;  4BY1 H;  1GKH A;  4JI1 Q;  4L6T B;  4JI1 L;  1K83 B;  2F0Q A;  2B2T A;  2RQX A;  1D6E C;  3H3V H;  4DXF A;  4L5T A;  1NMG A;  4CKB A;  1F2L A;  2F0V A;  1SJH D;  1VQ7 A;  1RIP A;  4DV7 Q;  4DV7 L;  1EY9 A;  4A3E G;  4OO1 I;  3LWE A;  1QVF A;  2NN6 H;  2YTV A;  4I65 A;  4RGN A;  1VMC A;  2OWO A;  5DM7 3;  1AH9 A;  4L63 B;  4GN5 A;  1W6K A;  1ASZ A;  1HA6 A;  2F03 A;  4FYD A;  2YU9 B;  3OIQ A;  4N8F A;  1F2M A;  5HY6 A;  1HQR D;  4LUO A;  3I4N H;  1DZ1 A;  2MPM A;  4B3S Q;  2XWJ B;  2B63 G;  4C3I B;  1PH4 A;  4B3S L;  4ID6 A;  1WOC A;  4GLA C;  4JBM A;  3HRZ C;  3OWF A;  4KLK A;  3NWS A;  1C4Q A;  1X65 A;  1PH2 A;  4JV5 Q;  5IY0 A;  1XX8 A;  5IYC H;  2CHB D;  4JV5 L;  3MWY W;  2NZH A;  2OF1 A;  5EKK A;  1Q81 C;  4X3T A;  1KRT A;  3T13 A;  3S1N B;  2F0P A;  2IPK D;  1CHQ D;  3U4V A;  2D62 A;  3JAM E;  5KEE A;  2NVT B;  2EE1 A;  4YY3 L;  5BR8 Q;  5IIF A;  1CFM A;  5BR8 L;  3G48 A;  2I5H A;  1T5E A;  3UDX A;  2B2V C;  2LXJ A;  4QB4 A;  3MXP A;  4CJ1 B;  1CM9 A;  3AQQ A;  2OTL A;  1UEA B;  3C1E A;  1X6O A;  5IT9 c;  3KBX A;  3VYU A;  1NR2 A;  1GUN A;  2B8G A;  5FLX E;  1ET9 A;  1GUS A;  3NBH B;  2ES2 A;  3S1Q B;  2F3W A;  3M3Y H;  1E3P A;  4QGU A;  1MIU A;  2OEO A;  1B3Q A;  3EVQ A;  4O1N A;  3D8G A;  4JYA Q;  5JEA G;  4JYA L;  1H9K A;  3B6Y A;  5GRO A;  4OIJ A;  5CV5 A;  1YNX A;  3W5O A;  1NNX A;  2VUM H;  2DUD A;  3W2D A;  3T16 A;  3PO2 H;  3NK9 A;  4QMG A;  1PRT D;  1PYW D;  3H0G B;  4DFA A;  1EQV A;  1WTX A;  3VYR A;  1OXS C;  3TBI B;  4CDD C;  2JSO A;  4QCL A;  2AQ2 B;  1NE3 A;  1LV9 A;  1YBY A;  2R7Z G;  3EIV A;  1UE6 A;  2F4V Q;  3S14 H;  4BXX H;  2F4V L;  1TY0 A;  4DK6 C;  1C8C A;  2AQ3 B;  2E2H H;  1I50 H;  5IGD A;  2V4D A;  4PMB A;  1FNV A;  2EJM A;  4DAV A;  1MJE A;  4IPG A;  2ENB A;  1D5X C;  1VCI A;  2LSS A;  1ML0 D;  2R93 B;  2SOB A;  1NAP A;  4OEL B;  2HDL A;  4XQQ A;  4KY5 A;  2F0L A;  1CKN B;  2ALY B;  4R1J A;  1J6Q A;  2N88 A;  2Z4H A;  3AMU A;  2F0U A;  2EYP A;  1KAA A;  2B2W A;  3HOX H;  3GTO B;  4A3B B;  2K1B A;  4A3G G;  4A3C G;  3QWN A;  2K28 A;  1S72 A;  4DV6 Q;  1W3S A;  3CME A;  2R7F A;  4DV6 L;  3GTM H;  1X54 A;  3HOY B;  1L1O A;  2OQK A;  3D6W A;  3JAM L;  1NSN S;  4KY7 A;  2JA5 B;  4LUZ A;  1HZC A;  3RZD B;  3I8Z A;  1Y8O B;  2VQE Q;  2JA7 H;  2IJ0 A;  2RDG A;  1PRT C;  1E22 A;  1E1T A;  2KHJ A;  4HMI A;  1IL2 A;  2MUY A;  4IFD I;  5FLX L;  1N8R C;  1ICF B;  5C0X I;  1KTK A;  4OWW B;  2ZXR A;  5F2D A;  3T56 B;  4H02 A;  4IUQ A;  4GZY C;  3HKZ G;  2RVL A;  1Y8N B;  3U9O A;  5FO8 B;  5IT9 E;  1EOT A;  3UI2 A;  1FVI A;  3A8J E;  1HQM C;  1CSQ A;  3QIA A;  2N49 A;  3PGZ A;  2ZTC A;  1VF5 C;  3RN2 A;  1EY0 A;  2M00 A;  1X55 A;  1K73 C;  1E0B A;  1QE6 A;  5T1G A;  1JOK A;  4J1M A;  3S2H H;  2Q2H A;  1G6Z A;  3U50 C;  1IW7 D;  3D4D A;  5CBE E;  3OTO Q;  3OTO L;  1LT4 D;  2JA9 A;  4J15 A;  1SNC A;  4OHJ A;  4M1U B;  5DM6 3;  1SNO A;  1BBX C;  1SNP A;  2D0P A;  3DHQ A;  3SHL A;  3K0X A;  1LTA D;  1GHJ A;  1B44 D;  4EQN A;  1XPU A;  4JBW A;  1Q86 C;  3MZ5 A;  3OWE B;  1U4R A;  3TN2 A;  4Z9C B;  4LF7 Q;  4LF7 L;  2L9H A;  1BDO A;  3M4P A;  4KMU C;  4A3J B;  1TU2 B;  2A74 C;  1TWG H;  1HJP A;  1QZG A;  2QW7 A;  1RF2 D;  2RCN A;  3K0Y A;  3NBI A;  3QJY A;  3K58 A;  2RHQ B;  1RCV D;  1A2U A;  5C0X H;  5M3F B;  3D4R A;  5JJL A;  1Q1B A;  4RCO A;  1MSG A;  2HIX A;  4ZLT F;  1LT6 D;  5BN3 A;  4A76 A;  4XT1 B;  4LNQ A;  3H0G G;  2SDF A;  3FKI B;  3MFY A;  1QCB D;  1B3A A;  4H13 C;  3PUX A;  2BH2 A;  4MHE A;  2NWG A;  5D3I B;  3BG3 A;  1ZXT A;  1Y1V B;  1Y1W B;  4H44 C;  4RGM A;  4CJ2 C;  3GTL B;  1E2W A;  3TS2 A;  1R9T B;  1EEF D;  1JWS D;  1SND A;  5GAG C;  4R4I A;  1G6P A;  4XTC S;  1YJ9 A;  2B2U C;  3A7A B;  1I94 Q;  1I94 L;  2A6E D;  4A93 G;  1HPC A;  2F3V A;  2D2C C;  1NUC A;  1F2Y A;  1F9P A;  1STE A;  1IW7 C;  2KOL A;  2L1B A;  2R93 G;  5EPL A;  1LYL A;  3I73 A;  3HS0 C;  2K52 A;  2HDM A;  4IUR A;  3CQZ B;  5IYD H;  4NP5 A;  2IW3 A;  4C3J G;  4DAY A;  4CHT B;  4A3I H;  4LK1 C;  2H4O A;  3FEW X;  1WD1 A;  2HT1 A;  1FGB D;  3ERS X;  3T51 B;  4BBS B;  1ENC A;  1UEB A;  4KKU A;  5IP7 G;  1VQG A;  1JE5 A;  1XTC D;  1IHZ A;  1FR3 A;  1B7Y B;  1YI2 A;  1XNR Q;  5I6W A;  1GUW A;  2BA0 A;  2QKI C;  3M4O B;  3CC7 A;  4BY1 B;  3FDT A;  3ULL A;  4A3D B;  2MGS A;  3HOY G;  1KQS A;  4ZKB B;  1QJO A;  2FIN B;  1EYC A;  4NXN Q;  3HOU G;  2EPB A;  4NXN L;  3MHB A;  4LMQ D;  3M7G A;  3T1Y Q;  1PH8 A;  4DXG A;  3T1Y L;  2DJG C;  2EQS A;  5CV8 A;  1IYV A;  5C3X A;  2NTS A;  4RG1 A;  2K4K A;  3PQI A;  3VR6 A;  2UUC L;  2UUC Q;  1IKL A;  1H9R A;  1KNE A;  3C2P A;  3S16 B;  1MI2 A;  4OIK A;  3KF6 B;  3G4S A;  1B8A A;  2JEB I;  3ERO A;  3P1H A;  1DM0 B;  2WII B;  3T1H Q;  1AZQ A;  2Z0S A;  3T1H L;  3SE0 A;  4PZ8 A;  1II3 A;  3BJU A;  1ESF A;  1XMO Q;  1B4O A;  1XMO L;  1NY4 A;  2A6E C;  2GVA A;  2KVM A;  1RHP A;  1WTO A;  3I4N B;  4JOI A;  2EZV A;  3MEF A;  1M4V A;  3I4M G;  1LT3 D;  5GQO A;  3CC2 A;  1EUJ A;  2K03 A;  1EY8 A;  1HUM A;  2RDH A;  3KLS X;  1QUQ B;  4GKJ Q;  5KYI A;  4GKJ L;  1NCV A;  2NUC A;  4IUP A;  4FF3 A;  1KXL A;  3LX0 A;  1I4H A;  4X3S A;  3TP6 A;  1CKM A;  1A3U A;  5JJZ A;  4RGO S;  4XQJ A;  2NZO A;  1VQL A;  3KDF A;  4Y7N B;  1PXU A;  4A3M G;  1EWC A;  3NQT A;  3RR5 A;  2HQL A;  4A3J G;  4ME5 A;  3RMH A;  3NUC A;  2L5T A;  3D6C A;  1IBK Q;  2L4N A;  4AIM A;  4IJL A;  1GXD C;  1IBK L;  1AP0 A;  3HZX A;  1SE8 A;  3OPO A;  3J7A V;  2JA8 H;  2EOT A;  1K8A C;  1SBB B;  4HJ8 A;  2KEN A;  4K5W A;  4DV0 Q;  4DV0 L;  3J80 i;  4A3B H;  2VNU D;  3H3V C;  2JJQ A;  4UP8 A;  3GV3 A;  2Q2T A;  1MBY A;  4H0L C;  3FKI G;  3Q24 A;  2L11 A;  2E2D C;  4JI4 L;  4ULL A;  1S4Z A;  2ICE C;  4OWX B;  2VUM B;  2F3I A;  1Y1W G;  2PNR C;  3PO2 B;  4HN7 A;  2JA5 H;  1IYJ B;  5M3M H;  4EQO A;  3KLW A;  1I3Q H;  3G7L A;  2R3Z A;  2CQA A;  3BYY B;  4HCE A;  5A35 A;  3CCV A;  1A15 A;  4GNX B;  1PYB A;  2ID0 A;  3S14 B;  3PUW A;  1TII D;  2Z4I A;  4B3R Q;  4B3R L;  1STG A;  1I50 B;  1LAC A;  3GTJ H;  2L0C A;  3S9W A;  2EYO A;  2KJX A;  4F88 A;  1TQO A;  3MXN A;  5E7N A;  4IQZ A;  1PH6 A;  1LO5 D;  4L5S A;  2K5Q A;  4YCW A;  5FO9 B;  3I4L A;  2RHS B;  1OXU A;  1PMR A;  2C5C A;  1XMQ Q;  2B2V A;  1XMQ L;  2K50 A;  4DAM A;  3A5U A;  3I3C A;  3A8I E;  4EX5 A;  1JQY D;  1VQI A;  4A3K H;  2MNA A;  4BY1 G;  1GD7 A;  2PQE A;  4YWL A;  2PQA B;  2AWN A;  3SR1 A;  4XIG S;  3HOX B;  4JC0 A;  2OT2 A;  3BDO A;  4L8J A;  5C4J H;  3P20 A;  1SRO A;  1O80 A;  4KY6 A;  4X65 Q;  1A62 A;  4X65 L;  3PIP A;  5HUR A;  3WWV A;  4AYB E;  1YZ6 A;  5AFW A;  1NTG A;  3J7A 5;  4IN3 A;  1O7I A;  4DNT B;  1K3R A;  1EY5 A;  2RCF A;  2JA7 B;  1WTR A;  4LJZ C;  1D1K A;  3IRB A;  1JC7 A;  5C44 H;  1AEX A;  3ER0 A;  3PIP 3;  1DOK A;  1UE5 A;  1GUG A;  2K01 A;  3E5S A;  1VQD A;  3K5O A;  3PIO 3;  3UE0 A;  3Q6S A;  1MJC A;  2K5N A;  5M3F H;  4ABN A;  1I4G A;  3A74 A;  5K5P A;  2NYZ D;  2UXC Q;  4R4Q A;  3FPU B;  1JMC A;  3I4N G;  2UXC L;  1YNN D;  1EQT A;  4IOA A;  2JP1 A;  5A2Q L;  4OWT B;  2UUB Q;  2UUB L;  4DR5 Q;  1PTO F;  1Y1V H;  4DR5 L;  4K2K A;  5LMU Q;  4BBR B;  3GTL H;  5LMU L;  4GNX C;  1F2Z A;  5G3L F;  4GN4 B;  1R9T H;  1N34 Q;  1HTL D;  4GS3 A;  4DV1 Q;  1N34 L;  1STB A;  3ND9 A;  3S2H B;  5FJ8 H;  2ZJR A;  4WRD A;  1AN8 A;  2A8V A;  4RCN A;  1ILP A;  5IOD A;  1PTO B;  3IKJ A;  1OO9 B;  4RWS C;  1BVS A;  1X3Q A;  1ASY A;  3TEH B;  1YVC A;  1XJV A;  1EEI D;  4LW1 A;  2PZW A;  2KEE A;  1JCK B;  1STN A;  2G9D A;  3E0E A;  1QNU A;  4ZAI A;  4PMW A;  4BBS H;  4A75 A;  2XWB B;  1TWG B;  5G3L D;  3KFU A;  3DWQ A;  3DLL A;  3DWA A;  4ZUJ A;  4LFB Q;  1U4L A;  4LFB L;  2UUA Q;  3DEP A;  2UUA L;  3M4O H;  3GD7 A;  3G6E A;  4A3D H;  2X6L A;  2VUM G;  1SYG A;  3SK4 A;  4E6I A;  2V1C C;  4DUZ Q;  5M5X B;  4O42 A;  1CKO A;  4KV6 A;  4ZUI A;  4DUZ L;  3PO2 G;  3CPF A;  3J80 c;  2CW0 D;  3TP5 A;  3K7A B;  4GOP B;  1YNN C;  1A0I A;  1LTT D;  1X32 A;  2KCM A;  3ERQ A;  3HFZ B;  4P75 A;  1QNK A;  3SDZ A;  3S16 H;  2A6H D;  1AFP A;  2F0S A;  4BXX G;  1SFO H;  3GDE A;  1S3O A;  2OQ0 A;  4YIJ A;  5CV9 A;  1H9S A;  3J7Z C;  5IOC A;  3JC6 6;  1GOZ A;  3W3A A;  1CQV A;  2KQ3 A;  1WVL A;  3PV0 A;  2R61 A;  4G7O C;  2EYM A;  2XNA C;  3TZD A;  4QY7 A;  2N55 A;  4JPB W;  2JK8 A;  2WKC A;  2DNC A;  1N33 Q;  4FF1 A;  1N33 L;  1VQE A;  2I5L X;  3CCL A;  4A3I B;  1O7Z A;  3A55 A;  2FMM A;  4DNR B;  2NVX B;  3NPP A;  3HOX G;  1V43 A;  1DYQ A;  1MKH A;  3D3R A;  1ESR A;  1F9Q A;  1D5Z C;  2WFW A;  3N52 A;  1SYB A;  4KHP Q;  4KHP L;  1SEB D;  4JI7 Q;  3I91 A;  4X64 Q;  1I6V C;  4JI7 L;  1Y14 B;  1KLG D;  4X64 L;  4Y7N H;  4A3F B;  4FO2 A;  1MGS A;  2D0O A;  3RD4 A;  4FVM A;  1BR9 A;  2YTY A;  5E1F A;  3S15 B;  2VB2 X;  4OO1 H;  3OMC A;  1GO3 E;  2K5D A;  3EA6 A;  4IPC A;  4DN4 M;  5KIX A;  3S17 B;  2CW0 C;  3TRZ A;  2AKW B;  5C3E B;  1SE2 A;  4ZQ3 A;  1HZ9 A;  2A6H C;  2B2U A;  2KA7 A;  1EY6 A;  1VQA A;  2KED A;  4X6A H;  3D31 A;  3M4Y A;  4KN7 C;  1GUT A;  1BBU A;  1TT2 A;  2PI2 E;  4GOP C;  4RHR A;  1SLJ A;  3H91 A;  3NTK A;  4LF6 Q;  1ZYR D;  4J8Q A;  4NB3 A;  5JOB A;  4LF6 L;  4WJ4 A;  3F2C A;  4N8X 1;  3ICE A;  4C3H G;  3D0F A;  2Z6K C;  4HSP A;  4QUC A;  4APV A;  3VR4 A;  1XTD A;  4IUT A;  3W1G A;  1B70 B;  5ELB A;  4DR4 Q;  3PUY A;  3QO2 A;  4DR4 L;  5EKL A;  1B2T A;  2HIV A;  5IYB H;  2ZM6 Q;  4ME3 A;  2ZM6 L;  3J80 E;  1E2V A;  1PH9 A;  4Q5V A;  2BDO A;  2EY2 A;  2WB1 B;  2PW5 A;  1BCP F;  3KJP A;  4CJ0 B;  4CKE A;  2F0D A;  2ZXO A;  3CRK C;  1HNW Q;  1HNW L;  4JI3 Q;  2I07 B;  3F2B A;  4JI3 L;  2WV6 D;  2XVS A;  2LS0 1;  1Q8K A;  4FDB A;  4B9W A;  5ELE A;  1YNJ D;  3CPW A;  1ILQ A;  2FXQ A;  3HOW B;  3L3O C;  1Z9F A;  1EIH A;  1BCP B;  2JA8 B;  3D4W A;  1K3B C;  5IGG A;  5C0X G;  4DR2 Q;  2VY3 A;  4DR2 L;  1D8L A;  2LXK A;  4DGZ A;  4M8A A;  1X3E A;  2EYH A;  3O13 A;  1VQ6 A;  1TVX A;  1BXT A;  1RL2 A;  1JJC B;  3FHW A;  2B8F A;  5ELO A;  4NPS A;  1TWF B;  1LT5 D;  5EAY A;  4Q0F A;  1JOQ A;  3BDL A;  1Y8P B;  5M3M B;  3MTS A;  4IZ8 A;  1ZYR C;  1FJG Q;  2VQE L;  2D9U A;  4K8J A;  1I3Q B;  1FJG L;  2ATW A;  5JJK A;  4V19 0;  2EYJ A;  3SGI A;  5I9O A;  3F2U A;  1F77 A;  1LTB D;  1TY2 A;  1B53 A;  3TZU A;  4OL7 A;  2A68 D;  4GLV B;  4TQU S;  1EYA A;  3GTJ B;  1V8Q A;  4DUY Q;  5M5W H;  4DUY L;  4FF2 A;  1WTQ A;  3OSO A;  5IYD G;  1RKN A;  1Y69 U;  3R2T A;  4C3I G;  2Y0S B;  4A3I G;  1CZG A;  5COY A;  1PH3 A;  4P73 A;  2KCT A;  1V9P A;  2Q2U A;  1PLF A;  2RSN A;  2EJF C;  2K5V A;  4BBR H;  1SN8 A;  5C3W A;  4OXP A;  2XIW A;  5FLM H;  1F9S A;  2EY1 A;  1I4P A;  1KDC A;  1WFQ A;  3K7U C;  4A3K B;  4RKL A;  1IYU A;  2PCF B;  1SSO A;  2E76 C;  1PTO H;  2F0T A;  1TKW B;  5BN4 A;  3U58 A;  2PYK A;  5C4J B;  3RZO H;  4FXK C;  4AYB B;  4NDX A;  4WJW A;  3TRE A;  5I2X A;  3J80 L;  1TWC H;  3DM3 A;  3VDY A;  4MNO A;  1RD9 D;  1S40 A;  2F0E A;  2NBF A;  1EL0 A;  4DF7 A;  1F9R A;  4WFN 3;  4I7A A;  1LTR D;  1PH1 A;  2E2J B;  5BN5 A;  4NW2 A;  5D14 A;  1E7Z A;  5C44 B;  3H09 A;  3HGB A;  3FP9 A;  3K59 A;  4BY7 B;  4B08 A;  2IT1 A;  4QQB X;  2AWO A;  1B1Z A;  4IFD H;  1R4Q B;  4K2L A;  4UPA A;  1IZ6 A;  2PO4 A;  1LTI D;  2EXD A;  2GA4 B;  3NQI A;  2J7Z A;  2A68 C;  4UY8 C;  3VR5 A;  5M5X H;  1LTS D;  5ISR A;  1PFS A;  1LTL A;  4N9T A;  3K7A H;  3K5M A;  1QUQ A;  4HR7 B;  1A3T A;  1VQH A;  5GAH C;  1YHA A;  1ZKO A;  2MO0 A;  3KUP A;  5C5M A;  2MO1 A;  3F2D A;  2IX1 A;  1HTP A;  1RJT A;  1IXR A;  1V1O A;  4BA2 I;  2CFM A;  1BOS A;  5D3D A;  1U4P A;  4FP5 D;  2TMP A;  5C4X B;  2WB1 G;  3F8T A;  1KDA A;  4YCU A;  1L1O B;  3NHH A;  2E75 C;  1Q1E A;  2A1A A;  4L5Q A;  2PNH A;  1GHK A;  5I9P A;  4AQY Q;  1QVG A;  4LF8 Q;  4AQY L;  1JWM D;  4LF8 L;  4DKA C;  4POF A;  2ZTE A;  4DR3 Q;  2JA6 H;  4DR3 L;  2VZA A;  2JA8 G;  2XSC A;  2IL8 A;  4ZK9 B;  3TP8 A;  2NVX H;  1PVO A;  1M90 C;  3WDN A;  2NTT A;  5J39 A;  4KKS A;  4A3B G;  3RN5 A;  2E74 C;  3PMF A;  1XNR L;  3X3N A;  3CKI B;  4N9P A;  1O78 A;  5C4H A;  4IJH A;  3OMG A;  1KIX A;  1JWU D;  1WTH A;  1NMF A;  3CCU A;  1PFM A;  4A3F H;  4IPD A;  1WJJ A;  1L0Y B;  1STY A;  2NVQ H;  2A5H A;  2JA5 G;  3K57 A;  4PZ6 A;  5M3M G;  5KND A;  1VS0 A;  2SNS A;  5IP9 H;  3S15 H;  2Z6B A;  1KRS A;  1Q90 A;  3S17 H;  3IL8 A;  2MP1 A;  4GNX A;  5E4X A;  1KAW A;  1SFO B;  3KOJ A;  3SVM A;  1C0A A;  5C3E H;  1CHP D;  3E9I A;  2TSS A;  1RTO A;  2CH4 A;  2WIN B;  5M9O A;  1PV4 A;  3GTQ H;  4A4I A;  1K8O A;  1SYD A;  4XXE A;  4RHS A;  3CW2 C;  5KGU A;  5LMN W;  1FNU A;  2AUK A;  3TME A;  1A63 A;  2FFK B;  1WCM B;  2K7V A;  3QOJ A;  2PZT A;  4DPG A;  3GO5 A;  4A3K G;  4JG2 A;  3H94 A;  3A5Z B;  1AE2 A;  1V1P B;  1GVP A;  4HJ9 A;  5C5L A;  3KLS A;  5TSS A;  5CMD A;  1LUZ A;  1S5C D;  1I5F A;  2BH8 A;  3CXC A;  1AW7 A;  4AYB G;  4QJF A;  3C3L A;  4O2D A;  2PMZ B;  2O2L D;  5J1Z A;  5JAV A;  2CWP A;  2WB1 E;  5CV6 A;  1IBL Q;  4Y52 H;  1IBL L;  3T53 B;  2IHE A;  2LKV A;  4RKB A;  4JI8 Q;  1QG7 A;  1SYF A;  2K6A A;  4OGQ C;  4JI8 L;  2BE5 D;  4G7Z C;  2F0M A;  5J22 A;  5C44 G;  5E4W C;  4ODG A;  4KHV A;  3HOW H;  5EGT A;  4RAU C;  2J0T D;  3AYH B;  3HP3 A;  3X3M A;  1YEZ A;  4CDC C;  5M3F G;  1STH A;  2QEX A;  3DUZ A;  1EOV A;  1EU4 A;  5K36 G;  2HCC A;  3KYH C;  3SK6 A;  2QIL A;  2MQH A;  5A2Q E;  3CC4 A;  3GTK B;  5I2Y A;  4TRD A;  1VF7 A;  4OEM B;  3NTH A;  3OHX C;  3G71 A;  3BDC A;  3VA5 A;  1Y1V G;  2DY8 A;  1PHJ A;  1C48 A;  1DCZ A;  3ND8 A;  3DMU A;  4NMZ A;  4CDF C;  1TWF H;  1U5K A;  2HUG A;  4HCS A;  2NVY H;  2XN9 C;  4HTH A;  4IFD J;  1VMP A;  1FNW A;  4ZCK A;  5FJ8 G;  5C0X J;  3S2D B;  4A3L H;  2MFI A;  3E3X A;  1TS4 A;  4XQN A;  2EXZ A;  5KYL A;  4NKL A;  4X3U A;  2ZJP A;  2ICI A;  2B2Y C;  2UXD Q;  3FVQ A;  1I4Q A;  2UXD L;  4KK7 A;  4U67 3;  2KCC A;  1G91 A;  4JBK A;  2K05 A;  1G2S A;  2VB3 X;  1HZB A;  2I46 A;  1ICW A;  2Q2I A;  1BUV T;  2QCP X;  4R8N A;  2ZXP A;  2EY6 A;  5KNB A;  2EYL A;  5CBA E;  4A3E B;  2CVR A;  1CK1 A;  2L55 A;  2YV5 A;  4TVA B;  2Y0S E;  4JBJ A;  1H95 A;  2CKZ B;  4BBS G;  1HXY D;  1CT1 D;  1Q12 A;  1YJN A;  4P71 A;  3J81 j;  4DK3 C;  4JVZ A;  2JN4 A;  3R8B A;  2BE5 C;  2XRS D;  3TQY A;  1JOO A;  5LMN Q;  1HA5 A;  2NZ1 D;  1DXM A;  4A3D G;  5LMN L;  4X62 Q;  1NBW A;  2F0O A;  1WTP A;  3PUV A;  1XPO A;  3IFT A;  3TS0 A;  3PUZ A;  4G57 A;  3GTG H;  4GOP A;  4DV5 Q;  2OXP A;  4DV5 L;  1EU3 A;  5CV4 A;  1EYD A;  1RDP D;  2NN6 G;  3MXU A;  3PIO A;  1S5B D;  4JI0 Q;  4YCV A;  4JI0 L;  1YHQ A;  2QEJ C;  4WOR A;  2E2J H;  3R2I A;  4HJ5 A;  1U4M A;  5EBC A;  1ROD A;  1I6H B;  2A69 D;  4BY7 H;  1SMX A;  1LM0 A;  2IWH A;  1KD1 C;  4OX9 Q;  2B39 A;  1HCZ A;  4OX9 L;  4HED A;  1PH7 A;  3NSW A;  3KDF B;  5CGK A;  4UAI A;  2Q8I B;  5M5W B;  4A3M H;  4R4C A;  3C46 A;  3AU7 A;  1JR0 D;  2X6G A;  3URY A;  2AHO B;  3CCM A;  4R4O A;  2EVB A;  4DK1 A;  3IFD A;  3A8K E;  1HR0 W;  4FF4 A;  1VQM A;  2WP8 J;  1VQ4 A;  3T4A C;  5IYC G;  4KI0 A;  5KNC A;  4DV1 L;  3CF5 A;  2AMC B;  2J4X A;  4I7Z C;  1PA6 A;  1KDB A;  2QA4 A;  4J6H A;  1Z47 A;  5C4X H;  1FD7 D;  4DAP A;  1QIL A;  4YWM A;  1GJX A;  5EKI A;  1Q3L A;  3L9A X;  2C9O A;  1JT8 A;  4C2M H;  1D2B A;  3TP7 A;  3HOZ H;  3RZO B;  4DV4 Q;  4DV4 L;  4OO1 G;  5LL6 X;  1TWC B;  2F0G A;  4K5V A;  3I4O A;  2Z1C A;  3CRL C;  1PTO D;  5JVH 3;  4RMF A;  3HOV H;  3NBH A;  3MVV A;  3BVG A;  1XXG A;  2VS1 A;  2R7Z B;  4K0K Q;  1B50 A;  4QIW E;  4K0K L;  2K33 A;  2FHT A;  2B3G A;  1VQO A;  2JYO A;  5JJI A;  2E8G A;  2E2I H;  1OXV A;  3S1M H;  1Q46 A;  3NEL A;  4LFC Q;  4LFC L;  1UUP A;  2XRQ D;  3V2T A;  2BDN A;  3NEN A;  2N8N A;  2VL6 A;  1VQK A;  2EYF A;  2DGY A;  5JPM C;  4B3M Q;  1X3G A;  4B3M L;  5NUC A;  3J81 L;  5DEH A;  2JQO A;  1T5X D;  3MEH A;  1SRU A;  3GV6 A;  5IYB G;  3EJI A;  3CCS A;  1KL9 A;  3OW2 A;  4A3G B;  2O5J C;  3BS1 A;  2F1M A;  3PO3 H;  1G29 1;  2QF7 A;  1WTV A;  2PW7 A;  4G4K A;  1A8V A;  4FNF A;  4JW0 A;  3CCE A;  1W2B A;  1PZJ D;  3NXW A;  1HH2 P;  2RDF A;  1DON A;  3DEO A;  4JI2 Q;  4RH6 A;  1PZK D;  4JI2 L;  3NEM A;  3Q22 A;  1CKN A;  3AEV A;  4IUV A;  1WCM H;  3M7N A;  2JA6 B;  1BF4 A;  4LF5 Q;  3QG1 A;  4LF5 L;  1EIY B;  1PTO C;  3GP7 A;  3BU2 A;  2SNM A;  3TSS A;  1VDZ A;  4EQ5 A;  1HR0 Q;  1HR0 L;  3HKZ B;  1VQJ A;  3K5N A;  4DA2 A;  1HRJ A;  3R3O A;  5CYU A;  2GN5 A;  4QL5 A;  2PMZ E;  2JE6 I;  1X3P A;  3ITP A;  2P5Z X;  1IBM Q;  2NVQ B;  1B9M A;  1C9O A;  1K0R A;  1IBM L;  2KHS A;  1HHV A;  4K8I A;  3UE1 A;  2FMC A;  2JA7 G;  5COR A;  2AUJ D;  2R92 H;  1QWY A;  3U9S A;  3Q23 A;  3GQB A;  5IGC A;  1P16 A;  1SE3 A;  2OTJ A;  1X56 A;  1D7Q A;  4YY3 Q;  1JB7 A;  5DNF A;  3LGJ A;  2HHH Q;  3E6Z X;  1SAP A;  2ZTD A;  2HHH L;  2HQE A;  1PRT F;  2EDG A;  4JI6 Q;  3GTK H;  4JI6 L;  3GTQ B;  3PF4 A;  1WYD A;  2O5I C;  1O7L A;  1UE7 A;  4BBR G;  4C56 C;  2KCN A;  3KBG A;  3H6M A;  4PNY A;  5ELN A;  4KN4 C;  3GTP H;  3M85 A;  5FLM G;  3PSI A;  2Q8T A;  3KF8 B;  3SXH A;  3VR3 A;  4HAE A;  3W1B A;  1UE1 A;  4S3S A;  4XYO A;  1PRT B;  4EGV A;  1CA5 A;  3S2D H;  4C1N I;  4DV3 Q;  4DV3 L;  3QOL A;  3SK8 A;  4X66 Q;  1Q82 C;  2CWA A;  4DK0 A;  1SDF A;  4X66 L;  2BCO A;  1I4X A;  3FRP B;  1TWA B;  4QF4 A;  4F8M A;  1A2T A;  1KAB A;  2XTI A;  3ZJY C;  3NWT A;  3NE5 B;  4A3E H;  1EY7 A;  2KUM A;  1Q7Y C;  4HJ7 A;  5H1S E;  3RLO A;  4ALP A;  3K81 C;  5CR3 A;  3DXJ C;  3KK7 A;  3A56 A;  2F0H A;  2CH4 W;  2D5D A;  1PH5 A;  3J7Y W;  4CDE C;  3N6R A;  5FK9 C;  4DR6 Q;  4DR6 L;  2H1E A;  1H9S B;  1JIC A;  1HNX Q;  1HNX L;  4IFD G;  3I90 A;  1YIT A;  4A93 B;  3CHB D;  3I55 A;  3K8A A;  2HCI A;  5HGQ A;  3NTI A;  2JEA I;  4K14 A;  2B29 A;  2YYZ A;  5LHY 1;  1L0X B;  4ZKC B;  2B63 H;  1BCP D;  1GUO A;  3TDQ A;  4C3J B;  5KRU A;  3ULP A;  1CA6 A;  1TWH H;  5FO7 B;  2NVY B;  3FPP A;  3HEJ A;  1ENA A;  2DN8 A;  3VA7 A;  3WOE A;  4DR1 Q;  1I6H H;  4DR1 L;  4H7B A;  1CUK A;  4AH6 A;  4MIU A;  4RGT A;  3RLF A;  2QDB A;  1CZW A;  1Z6H A;  3K5L A;  1PZI D;  2WAQ B;  1JOR A;  1TS5 A;  2N78 A;  4GN3 B;  4KJN A;  1SNM A;  3HOU B;  4FXG C;  4B9X A;  1KC8 C;  3EN2 A;  2N3S A;  3J81 i;  1NR4 A;  4LF9 Q;  4LF9 L;  3AFP A;  2JA6 G;  1EWI A;  1O7Y A;  2LMC B;  4PMC A;  1FGU A;  1V1Q A;  5C6A A;  2UXB Q;  1KLU D;  2UXB L;  2O4X A;  1SMY D;  5DAU A;  2VXW A;  3VYT A;  1YNJ C;  2ZJQ A;  2B2T C;  3DM1 A;  1RTN A;  1UNS A;  4F87 A;  2A19 A;  1N32 L;  1N32 Q;  2C35 B;  3U4Z A;  2K5H A;  2LY7 A;  5JEA H;  1J8I A;  3LWU A;  3S1R B;  3EFX D;  1YIJ A;  4A3F G;  1PDQ A;  1IKM A;  1EQR A;  5CV7 A;  5DLQ E;  4P72 A;  3GTG B;  2RA4 A;  5IP9 G;  4BWG B;  3I4M B;  4RA8 A;  5ELD A;  1IL8 A;  3Q8D A;  1EFW A;  4RFB A;  4C3H H;  3KF6 A;  3ZYY X;  3MA2 B;  1BCP C;  1DJR D;  2A73 B;  5C3E G;  4XT3 B;  1XNQ Q;  1XNQ L;  1E1O A;  2R7Z H;  5L37 A;  2Z9H A;  1SXT A;  1HUN A;  1NJI C;  2B2Y A;  5LL6 S;  1K28 A;  3BVZ A;  1S5D D;  4R8I A;  1CSP A;  3G6J B;  5JPN C;  4HID A;  5M5Y H;  1VQ8 A;  1EFI D;  1EYG A;  1PYS B;  1M8A A;  4A3M B;  1WI5 A;  2GVB A;  3A7L A;  2RKS A;  4F7X A;  2RSO A;  3E0J A;  1J5E Q;  3I72 A;  1YJW A;  1J5E L;  1CQF A;  4MZ9 A;  1VQ5 A;  2AQ1 B;  1I4R A;  1EY4 A;  1V1P A;  2G9H D;  3P7J A;  5EPJ A;  1DGS A;  1LAB A;  3I70 A;  3HG9 A;  3LNN A;  4CGY B;  5AJ3 Q;  1SYC A;  5AJ3 L;  1OXT A;  2ZT9 C;  3J7A F;  3UDG A;  1K83 H;  3EBE A;  4GKK Q;  4GKK L;  4A3C H;  4A3G H;  1P8L A;  1SMY C;  1HFG A;  3KJO A;  5I6Y A;  1VQF A;  3KLR A;  2R7D A;  5EBD A;  3UDI A;  4NXM Q;  4C2M B;  4NXM L;  1AE3 A;  4P2C B;  2UU9 Q;  2UU9 L;  1DOM A;  3HOZ B;  2DJF C;  4YWK A;  3QB3 A;  1EWH A;  3K80 C;  3HOW G;  2XGT A;  3HOV B;  1SNQ A;  4B3T Q;  4QIW B;  4B3T L;  2K5W A;  2YU9 H;  3E9H A;  4LAA A;  1CTM A;  4YHH Q;  1WTW A;  4HSV A;  4YHH L;  4XYQ A;  4PV1 C;  3STB D;  2PI2 A;  4V0B A;  4HMJ A;  1ENF A;  4PZ7 A;  3I56 A;  1VQ9 A;  3CMA A;  2E2I B;  1CI3 M;  1UWV A;  1QVC A;  5FKA C;  4C3I H;  3HKZ E;  2RF4 A;  3BZC A;  5EJW A;  3S1M B;  3ULJ A;  4POG A;  5IT9 L;  1OXX K;  1KNA A;  1SE4 A;  1DOL A;  3SEB A;  3BZK A;  3HKS A;  4A3L G;  2F0W A;  5J3B A;  3S1N H;  1ZEQ X;  1EZ6 A;  3VR2 A;  2NB0 A;  5ELF A;  4KD3 A;  4IOC A;  3FMC A;  3AB9 A;  2WAQ G;  1YHB A;  2MHV A;  2NVT H;  1E24 A;  4IO9 A;  3OYY A;  3PO3 B;  1S5E D;  1OTC A;  1DD2 A;  2Y0S G;  1WD0 A;  3OOC A;  3CD6 A;  1G8Z D;  3ONA B;  2E5L Q;  3CU7 A;  2E5L L;  2K75 A;  2L15 A;  3A0J A;  4C1N K;  4LUV A;  3CCQ A;  3S1Q H;  2B2W C;  3WOF A;  1SYE A;  1HFN A;  3J81 c;  3AFQ A;  2PQA A;  3JAM i;  1BQQ T;  4CKC A;  2VQF Q;  1GM5 A;  2VQF L;  1TWA H;  4PG3 A;  4DR7 Q;  2DNE A;  1EIG A;  4DR7 L;  1L1O C;  1JJ2 A;  4BA1 I;  1SJE D;  4HIM A;  2Q8R E;  1HNZ Q;  4DU9 A;  3I2Z A;  1HNZ L;  4KKT A;  3STB C;  3CP0 A;  3H0G H;  4QUF A;  3M4Q A;  3NP8 A;  4UP9 A;  3L7Z C;  2FJ2 A;  3MFG A;  4KTA A;  1M1K C;  1D5M C;  4UDU C;  2R92 B;  3CCJ A;  2BOS A;  3M9B A;  5JEA J;  4GLX A;  1L2F A;  1QZH A;  4BY7 G;  2F0K A;  2IX0 A;  4A93 H;  5IGE A;  1SR3 A;  1K0S A;  1U0L A;  4P74 A;  1ONL A;  2KBN A;  2PZU A;  2R93 H;  4DNI A;  4G7H C;  1TR5 A;  2M2L A;  3BVM A;  1LLR D;  1N9W A;  3SK5 A;  1H9M A;  3A54 A;  4KHZ A;  5I4D A;  3MC0 B;  1TXY A;  1X3F A;  4C3J H;  4DAY B;  1T9H A;  4R9W A;  4MTN A;  2H5X A;  3GTP B;  1L0W A;  2F0F A;  3BYT B;  1FL0 A;  5IP7 H;  1K8M A;  1PFB A;  3M3Y B;  2I0Q A;  3GTO H;  1G2T A;  2RBM A;  2CCZ A;  1QOH A;  3IAY A;  5C4X G;  1R4P B;  3PF5 A;  1J9O A; 
#chains in the Genus database with same CATH homology
 1ET6 A;  2KEC A;  1Q8I A;  1XYI A;  4U68 A;  3RUZ A;  3Q0A A;  2X69 A;  4FXD A;  2LFN A;  3BZD B;  4TSS A;  1XWE A;  5C4Z A;  1U9R A;  4XDX A;  1STA A;  3V05 A;  3OIP A;  1JB3 A;  1TS3 A;  2SEB D;  2E2H B;  1A6X A;  3OW7 A;  4IUN A;  4K6D A;  1AZP A;  1E2Z A;  1BO0 A;  4TKO B;  1UAP A;  4IUU A;  2M9V A;  3R93 A;  5ELC A;  5CC4 A;  2MJ8 A;  4IAL A;  2DY7 A;  5FOB B;  1Z7T A;  2F0N A;  4KD4 A;  5T1I A;  4EVO A;  2B63 B;  4KJO A;  3J81 E;  5EQ0 A;  1TWH B;  4K6L A;  1B9N A;  3V96 A;  4EQP A;  4ZRZ A;  5E3F A;  3K6O A;  1S5F D;  1BNZ A;  3GTM B;  3C1F A;  2IX3 A;  2F4I A;  2F0J A;  2F0I A;  4MN3 A;  3DWP A;  1A3V A;  5JVG 3;  5IGF A;  4PQX A;  4CBV A;  1EZ8 A;  1W6J A;  5D65 A;  1MSH A;  3P75 A;  1D1I A;  3MXG A;  1TS2 A;  2PPB C;  1PFN A;  2EY5 A;  5HGT A;  5K36 H;  2R6G A;  2K32 A;  1MD2 D;  2NN6 I;  2BA1 A;  4C3H B;  2Z8L A;  4K5X A;  4ILW A;  2K04 A;  1H9J A;  4ZYS A;  4BS9 A;  3EQL C;  1FYC A;  2JXM B;  2WAC A;  3MAQ A;  2A69 C;  5M5Y B;  1QB5 D;  2L12 A;  1JE4 A;  3KF8 A;  1LTG D;  4X3K A;  3VYS A;  4JK1 C;  2EJG C;  5IGB A;  2WKD A;  5EPK A;  4L6T B;  1K83 B;  2F0Q A;  2B2T A;  2RQX A;  1D6E C;  4DXF A;  4CKB A;  1F2L A;  2F0V A;  1SJH D;  1EY9 A;  4OO1 I;  3LWE A;  2NN6 H;  4I65 A;  4RGN A;  1VMC A;  5DM7 3;  4L63 B;  1W6K A;  1HA6 A;  2F03 A;  4FYD A;  2YU9 B;  3OIQ A;  1F2M A;  1HQR D;  1DZ1 A;  2MPM A;  2XWJ B;  4C3I B;  4ID6 A;  3HRZ C;  3OWF A;  3NWS A;  1C4Q A;  1XX8 A;  2CHB D;  3MWY W;  2OF1 A;  5EKK A;  4X3T A;  3T13 A;  3S1N B;  2F0P A;  2IPK D;  1CHQ D;  2D62 A;  3JAM E;  5KEE A;  2NVT B;  2EE1 A;  5IIF A;  1CFM A;  1T5E A;  2B2V C;  4QB4 A;  3MXP A;  4CJ1 B;  1CM9 A;  1UEA B;  3C1E A;  3KBX A;  3VYU A;  1NR2 A;  1GUN A;  2B8G A;  5FLX E;  1ET9 A;  1GUS A;  3S1Q B;  2F3W A;  2OEO A;  3EVQ A;  4O1N A;  3D8G A;  5JEA G;  1H9K A;  4OIJ A;  5CV5 A;  3W2D A;  3T16 A;  3NK9 A;  4QMG A;  1PRT D;  1PYW D;  3H0G B;  4DFA A;  1EQV A;  1WTX A;  3VYR A;  1OXS C;  3TBI B;  2JSO A;  4QCL A;  2AQ2 B;  1LV9 A;  1TY0 A;  1C8C A;  2AQ3 B;  5IGD A;  2V4D A;  4PMB A;  1FNV A;  2EJM A;  4DAV A;  2ENB A;  1D5X C;  1VCI A;  1ML0 D;  2R93 B;  2SOB A;  1NAP A;  2HDL A;  4XQQ A;  4KY5 A;  2F0L A;  2N88 A;  2Z4H A;  3AMU A;  2F0U A;  2EYP A;  1KAA A;  2B2W A;  3GTO B;  4A3B B;  2K1B A;  3QWN A;  2K28 A;  3HOY B;  3D6W A;  3JAM L;  1NSN S;  4KY7 A;  2JA5 B;  3RZD B;  3I8Z A;  1Y8O B;  2IJ0 A;  2RDG A;  1PRT C;  4HMI A;  2MUY A;  4IFD I;  5FLX L;  5C0X I;  1KTK A;  2ZXR A;  5F2D A;  3T56 B;  4IUQ A;  4GZY C;  2RVL A;  1Y8N B;  3U9O A;  5FO8 B;  5IT9 E;  1EOT A;  3UI2 A;  3A8J E;  1HQM C;  3QIA A;  1VF5 C;  1EY0 A;  2M00 A;  1E0B A;  1QE6 A;  5T1G A;  1JOK A;  4J1M A;  1G6Z A;  1IW7 D;  3D4D A;  5CBE E;  1LT4 D;  1SNC A;  4OHJ A;  4M1U B;  5DM6 3;  1SNO A;  1BBX C;  1SNP A;  3DHQ A;  3SHL A;  1LTA D;  1GHJ A;  1B44 D;  4EQN A;  4JBW A;  3MZ5 A;  3OWE B;  1U4R A;  3TN2 A;  4Z9C B;  2L9H A;  1BDO A;  4KMU C;  4A3J B;  1TU2 B;  2A74 C;  1RF2 D;  3K0Y A;  3NBI A;  3QJY A;  3K58 A;  1RCV D;  1A2U A;  5C0X H;  5M3F B;  3D4R A;  1Q1B A;  4RCO A;  1MSG A;  4ZLT F;  1LT6 D;  5BN3 A;  4XT1 B;  2SDF A;  3FKI B;  3MFY A;  1QCB D;  1B3A A;  4H13 C;  3PUX A;  5D3I B;  4MHE A;  2NWG A;  1ZXT A;  1Y1V B;  3BG3 A;  1Y1W B;  4H44 C;  4RGM A;  4CJ2 C;  3GTL B;  1E2W A;  1R9T B;  1EEF D;  1JWS D;  1SND A;  4XTC S;  2B2U C;  3A7A B;  2A6E D;  1HPC A;  2F3V A;  2D2C C;  1NUC A;  1F2Y A;  1F9P A;  1STE A;  1IW7 C;  2KOL A;  2L1B A;  5EPL A;  3I73 A;  3HS0 C;  2HDM A;  4IUR A;  3CQZ B;  4NP5 A;  2IW3 A;  4C3J G;  4DAY A;  4CHT B;  4LK1 C;  2H4O A;  3FEW X;  1WD1 A;  1FGB D;  3T51 B;  4BBS B;  1ENC A;  4KKU A;  1XTC D;  1IHZ A;  1FR3 A;  5I6W A;  1GUW A;  2BA0 A;  2QKI C;  3M4O B;  4BY1 B;  3FDT A;  4A3D B;  2MGS A;  4ZKB B;  1QJO A;  2FIN B;  1EYC A;  2EPB A;  3MHB A;  4LMQ D;  3M7G A;  4DXG A;  5CV8 A;  1IYV A;  5C3X A;  2NTS A;  3VR6 A;  1IKL A;  1H9R A;  1KNE A;  3C2P A;  3S16 B;  1MI2 A;  4OIK A;  2JEB I;  3ERO A;  3P1H A;  1DM0 B;  2WII B;  1AZQ A;  3SE0 A;  1II3 A;  1ESF A;  1B4O A;  2A6E C;  2KVM A;  1RHP A;  1WTO A;  3I4N B;  2EZV A;  1M4V A;  1LT3 D;  2K03 A;  1EY8 A;  1HUM A;  2RDH A;  3KLS X;  5KYI A;  1NCV A;  2NUC A;  4IUP A;  4FF3 A;  3LX0 A;  1I4H A;  4X3S A;  3TP6 A;  1A3U A;  5JJZ A;  4RGO S;  4XQJ A;  4Y7N B;  1PXU A;  1EWC A;  3NQT A;  4ME5 A;  3RMH A;  3NUC A;  2L5T A;  3D6C A;  2L4N A;  1GXD C;  1AP0 A;  3HZX A;  3OPO A;  3J7A V;  2EOT A;  1SBB B;  4K5W A;  2VNU D;  3H3V C;  3GV3 A;  1MBY A;  4H0L C;  3Q24 A;  2L11 A;  2E2D C;  4ULL A;  1S4Z A;  2ICE C;  2VUM B;  2PNR C;  3PO2 B;  4HN7 A;  4EQO A;  3G7L A;  2R3Z A;  2CQA A;  3BYY B;  4HCE A;  5A35 A;  1A15 A;  2ID0 A;  3S14 B;  3PUW A;  1TII D;  2Z4I A;  1STG A;  1I50 B;  1LAC A;  2L0C A;  3S9W A;  2EYO A;  2KJX A;  4F88 A;  1TQO A;  3MXN A;  4IQZ A;  1LO5 D;  2K5Q A;  5FO9 B;  3I4L A;  1OXU A;  1PMR A;  2C5C A;  2B2V A;  3I3C A;  3A8I E;  1JQY D;  2PQE A;  3SR1 A;  2AWN A;  4XIG S;  3HOX B;  2OT2 A;  3BDO A;  4L8J A;  3P20 A;  1O80 A;  4KY6 A;  5HUR A;  5AFW A;  4IN3 A;  4DNT B;  1EY5 A;  2JA7 B;  1WTR A;  4LJZ C;  1D1K A;  1JC7 A;  1AEX A;  3PIP 3;  1DOK A;  1GUG A;  2K01 A;  3E5S A;  3K5O A;  3PIO 3;  3Q6S A;  4ABN A;  1I4G A;  5K5P A;  2NYZ D;  3FPU B;  1YNN D;  1EQT A;  2JP1 A;  5A2Q L;  1PTO F;  4K2K A;  4BBR B;  1F2Z A;  5G3L F;  1HTL D;  1STB A;  3ND9 A;  3S2H B;  4WRD A;  1AN8 A;  4RCN A;  1ILP A;  5IOD A;  1PTO B;  3IKJ A;  1OO9 B;  4RWS C;  1X3Q A;  1EEI D;  2PZW A;  2KEE A;  1JCK B;  1STN A;  2G9D A;  1QNU A;  4ZAI A;  4PMW A;  2XWB B;  1TWG B;  5G3L D;  3DWQ A;  3DWA A;  4ZUJ A;  1U4L A;  3DEP A;  3GD7 A;  2X6L A;  1SYG A;  3SK4 A;  4E6I A;  5M5X B;  4O42 A;  4KV6 A;  4ZUI A;  2CW0 D;  3TP5 A;  3K7A B;  1YNN C;  1LTT D;  1X32 A;  3ERQ A;  1QNK A;  3SDZ A;  2A6H D;  1AFP A;  2F0S A;  4YIJ A;  5CV9 A;  1H9S A;  5IOC A;  1GOZ A;  3W3A A;  1CQV A;  2KQ3 A;  1WVL A;  3PV0 A;  2R61 A;  4G7O C;  2EYM A;  2XNA C;  3TZD A;  2N55 A;  2WKC A;  2DNC A;  4FF1 A;  4A3I B;  1O7Z A;  3A55 A;  2FMM A;  4DNR B;  2NVX B;  3NPP A;  1V43 A;  1DYQ A;  3D3R A;  1ESR A;  1F9Q A;  1D5Z C;  3N52 A;  1SYB A;  1SEB D;  3I91 A;  1I6V C;  1KLG D;  4A3F B;  4FO2 A;  1MGS A;  3RD4 A;  4FVM A;  1BR9 A;  5E1F A;  3S15 B;  2VB2 X;  4OO1 H;  3OMC A;  2K5D A;  3EA6 A;  4DN4 M;  5KIX A;  3S17 B;  2CW0 C;  5C3E B;  1SE2 A;  4ZQ3 A;  2A6H C;  2B2U A;  2KA7 A;  1EY6 A;  2KED A;  3D31 A;  3M4Y A;  4KN7 C;  1GUT A;  1TT2 A;  4RHR A;  3H91 A;  3NTK A;  1ZYR D;  4J8Q A;  5JOB A;  4C3H G;  4HSP A;  4QUC A;  3VR4 A;  4IUT A;  5ELB A;  3PUY A;  3QO2 A;  5EKL A;  1B2T A;  3J80 E;  1E2V A;  4Q5V A;  2BDO A;  2EY2 A;  2WB1 B;  2PW5 A;  1BCP F;  4CJ0 B;  4CKE A;  2F0D A;  2ZXO A;  3CRK C;  2I07 B;  2WV6 D;  2XVS A;  2LS0 1;  4B9W A;  5ELE A;  1YNJ D;  1ILQ A;  3HOW B;  3L3O C;  1EIH A;  1BCP B;  2JA8 B;  3D4W A;  5IGG A;  5C0X G;  4DGZ A;  4M8A A;  2EYH A;  3O13 A;  1TVX A;  1BXT A;  2B8F A;  1TWF B;  1LT5 D;  4Q0F A;  1JOQ A;  3BDL A;  1Y8P B;  5M3M B;  3MTS A;  4IZ8 A;  1ZYR C;  2D9U A;  4K8J A;  1I3Q B;  4V19 0;  2EYJ A;  5I9O A;  3F2U A;  1F77 A;  1LTB D;  1TY2 A;  1B53 A;  3TZU A;  4OL7 A;  2A68 D;  4TQU S;  1EYA A;  3GTJ B;  1V8Q A;  4FF2 A;  1WTQ A;  3OSO A;  1RKN A;  1Y69 U;  3R2T A;  4C3I G;  2Y0S B;  1CZG A;  5COY A;  1PLF A;  2RSN A;  2EJF C;  5C3W A;  2XIW A;  1F9S A;  2EY1 A;  1I4P A;  1KDC A;  4A3K B;  4RKL A;  1IYU A;  2PCF B;  1SSO A;  2E76 C;  1PTO H;  2F0T A;  1TKW B;  5BN4 A;  2PYK A;  5C4J B;  4FXK C;  4AYB B;  4NDX A;  4WJW A;  5I2X A;  3J80 L;  1RD9 D;  2F0E A;  2NBF A;  1EL0 A;  4DF7 A;  1F9R A;  4WFN 3;  1LTR D;  2E2J B;  5BN5 A;  4NW2 A;  5D14 A;  5C44 B;  3H09 A;  3HGB A;  3K59 A;  4BY7 B;  4B08 A;  2IT1 A;  2AWO A;  1B1Z A;  4IFD H;  1R4Q B;  4K2L A;  2PO4 A;  1LTI D;  2GA4 B;  3NQI A;  2J7Z A;  2A68 C;  3VR5 A;  1LTS D;  5ISR A;  4N9T A;  3K5M A;  4HR7 B;  1A3T A;  1ZKO A;  3KUP A;  5C5M A;  2IX1 A;  1HTP A;  1RJT A;  1V1O A;  4BA2 I;  1BOS A;  5D3D A;  1U4P A;  4FP5 D;  2TMP A;  5C4X B;  1KDA A;  3NHH A;  2E75 C;  1Q1E A;  1GHK A;  5I9P A;  1JWM D;  2XSC A;  2IL8 A;  4ZK9 B;  3TP8 A;  3WDN A;  2NTT A;  5J39 A;  4KKS A;  2E74 C;  3PMF A;  3X3N A;  3CKI B;  4N9P A;  1O78 A;  5C4H A;  3OMG A;  1JWU D;  1PFM A;  1L0Y B;  1STY A;  2A5H A;  3K57 A;  5KND A;  2SNS A;  1Q90 A;  3IL8 A;  2MP1 A;  5E4X A;  1SFO B;  3SVM A;  1CHP D;  2TSS A;  1RTO A;  2WIN B;  5M9O A;  1K8O A;  1SYD A;  4XXE A;  4RHS A;  5KGU A;  1FNU A;  2AUK A;  3TME A;  2FFK B;  1WCM B;  2K7V A;  3QOJ A;  2PZT A;  3GO5 A;  3H94 A;  1V1P B;  5C5L A;  3KLS A;  5TSS A;  5CMD A;  1S5C D;  1AW7 A;  3C3L A;  2PMZ B;  2O2L D;  5J1Z A;  5JAV A;  5CV6 A;  3T53 B;  2LKV A;  4RKB A;  1QG7 A;  1SYF A;  2K6A A;  4OGQ C;  4G7Z C;  2BE5 D;  2F0M A;  5J22 A;  5E4W C;  4ODG A;  4KHV A;  5EGT A;  4RAU C;  2J0T D;  3X3M A;  3HP3 A;  1STH A;  3DUZ A;  1EU4 A;  5K36 G;  2HCC A;  3SK6 A;  2QIL A;  5A2Q E;  3GTK B;  5I2Y A;  4TRD A;  1VF7 A;  3NTH A;  3OHX C;  3BDC A;  3VA5 A;  2DY8 A;  1C48 A;  1DCZ A;  3ND8 A;  3DMU A;  4NMZ A;  2HUG A;  4HCS A;  2XN9 C;  4HTH A;  4IFD J;  1VMP A;  1FNW A;  5C0X J;  3S2D B;  1TS4 A;  4XQN A;  2EXZ A;  5KYL A;  4NKL A;  4X3U A;  2ICI A;  2B2Y C;  3FVQ A;  1I4Q A;  4KK7 A;  4U67 3;  2KCC A;  1G91 A;  2K05 A;  1G2S A;  2VB3 X;  2I46 A;  1ICW A;  1BUV T;  2QCP X;  4R8N A;  2ZXP A;  2EY6 A;  5KNB A;  2EYL A;  5CBA E;  4A3E B;  2CVR A;  1CK1 A;  2L55 A;  1HXY D;  1CT1 D;  1Q12 A;  3R8B A;  2BE5 C;  2XRS D;  1JOO A;  1HA5 A;  2NZ1 D;  1DXM A;  2F0O A;  1WTP A;  3PUV A;  3IFT A;  3PUZ A;  4G57 A;  2OXP A;  1EU3 A;  5CV4 A;  1EYD A;  1RDP D;  2NN6 G;  3MXU A;  1S5B D;  2QEJ C;  4WOR A;  3R2I A;  1U4M A;  5EBC A;  1ROD A;  1I6H B;  2A69 D;  2IWH A;  2B39 A;  1HCZ A;  4HED A;  3NSW A;  5CGK A;  4UAI A;  2Q8I B;  5M5W B;  3C46 A;  3AU7 A;  1JR0 D;  2X6G A;  3URY A;  2EVB A;  4DK1 A;  3IFD A;  3A8K E;  4FF4 A;  2WP8 J;  3T4A C;  4KI0 A;  5KNC A;  2J4X A;  4I7Z C;  1KDB A;  4J6H A;  1Z47 A;  1FD7 D;  4DAP A;  1QIL A;  1GJX A;  5EKI A;  1Q3L A;  3L9A X;  2C9O A;  1D2B A;  3TP7 A;  3RZO B;  4OO1 G;  5LL6 X;  1TWC B;  2F0G A;  4K5V A;  2Z1C A;  3CRL C;  1PTO D;  5JVH 3;  3NBH A;  3MVV A;  3BVG A;  1XXG A;  2R7Z B;  1B50 A;  2K33 A;  2FHT A;  2JYO A;  1OXV A;  1UUP A;  2XRQ D;  3V2T A;  2BDN A;  2EYF A;  5JPM C;  5NUC A;  3J81 L;  5DEH A;  1T5X D;  3MEH A;  3GV6 A;  3EJI A;  2O5J C;  4A3G B;  3BS1 A;  2F1M A;  1G29 1;  2QF7 A;  1WTV A;  2PW7 A;  4G4K A;  4FNF A;  1PZJ D;  3NXW A;  2RDF A;  1DON A;  3DEO A;  4RH6 A;  1PZK D;  3Q22 A;  4IUV A;  3M7N A;  2JA6 B;  1BF4 A;  3QG1 A;  1PTO C;  3GP7 A;  2SNM A;  3TSS A;  1VDZ A;  3HKZ B;  3K5N A;  1HRJ A;  4DA2 A;  3R3O A;  5CYU A;  2JE6 I;  1X3P A;  3ITP A;  2NVQ B;  1B9M A;  2KHS A;  1HHV A;  4K8I A;  2FMC A;  5COR A;  2AUJ D;  1QWY A;  3U9S A;  3Q23 A;  3GQB A;  5IGC A;  1SE3 A;  5DNF A;  3E6Z X;  1SAP A;  2HQE A;  1PRT F;  2EDG A;  3GTQ B;  2O5I C;  1O7L A;  4C56 C;  2KCN A;  3KBG A;  3H6M A;  4PNY A;  4KN4 C;  3M85 A;  2Q8T A;  3SXH A;  3VR3 A;  4HAE A;  4S3S A;  4XYO A;  4EGV A;  1PRT B;  1CA5 A;  4C1N I;  3QOL A;  3SK8 A;  4DK0 A;  1SDF A;  2BCO A;  1I4X A;  3FRP B;  1TWA B;  4QF4 A;  4F8M A;  1A2T A;  1KAB A;  3NWT A;  3NE5 B;  1EY7 A;  2KUM A;  5CR3 A;  3DXJ C;  3KK7 A;  3A56 A;  2F0H A;  2D5D A;  3J7Y W;  3N6R A;  5FK9 C;  2H1E A;  1H9S B;  1JIC A;  4IFD G;  4A93 B;  3I90 A;  3CHB D;  2HCI A;  3NTI A;  2JEA I;  4K14 A;  2YYZ A;  5LHY 1;  1L0X B;  4ZKC B;  1BCP D;  1GUO A;  3TDQ A;  4C3J B;  5KRU A;  1CA6 A;  5FO7 B;  2NVY B;  3FPP A;  3HEJ A;  1ENA A;  2DN8 A;  3VA7 A;  3WOE A;  4H7B A;  4MIU A;  4RGT A;  3RLF A;  2QDB A;  1CZW A;  1Z6H A;  3K5L A;  1PZI D;  2WAQ B;  1JOR A;  1TS5 A;  4KJN A;  1SNM A;  3HOU B;  4FXG C;  4B9X A;  1NR4 A;  1O7Y A;  2LMC B;  4PMC A;  5C6A A;  1KLU D;  2O4X A;  1SMY D;  5DAU A;  2VXW A;  3VYT A;  1YNJ C;  2B2T C;  3DM1 A;  1RTN A;  1UNS A;  4F87 A;  1J8I A;  2LY7 A;  5JEA H;  3LWU A;  3S1R B;  3EFX D;  1PDQ A;  1IKM A;  5CV7 A;  3GTG B;  2RA4 A;  4BWG B;  3I4M B;  4RA8 A;  5ELD A;  1IL8 A;  4RFB A;  3ZYY X;  3MA2 B;  1BCP C;  1DJR D;  2A73 B;  4XT3 B;  1SXT A;  1HUN A;  2B2Y A;  5LL6 S;  3BVZ A;  1S5D D;  4R8I A;  3G6J B;  5JPN C;  1EFI D;  1M8A A;  4A3M B;  3A7L A;  2RKS A;  4F7X A;  2RSO A;  3E0J A;  3I72 A;  1CQF A;  2AQ1 B;  1I4R A;  1EY4 A;  1V1P A;  2G9H D;  3P7J A;  5EPJ A;  1LAB A;  3I70 A;  3HG9 A;  3LNN A;  4CGY B;  1SYC A;  3J7A F;  1OXT A;  2ZT9 C;  1SMY C;  1HFG A;  5I6Y A;  3KLR A;  5EBD A;  4C2M B;  4P2C B;  1DOM A;  3HOZ B;  3QB3 A;  1EWH A;  3HOV B;  1SNQ A;  4QIW B;  2K5W A;  4LAA A;  1CTM A;  1WTW A;  4HSV A;  4XYQ A;  4PV1 C;  4V0B A;  4HMJ A;  1ENF A;  2E2I B;  1CI3 M;  5FKA C;  5EJW A;  3S1M B;  5IT9 L;  1OXX K;  1KNA A;  1SE4 A;  1DOL A;  3SEB A;  2F0W A;  1ZEQ X;  1EZ6 A;  3VR2 A;  2NB0 A;  5ELF A;  4KD3 A;  3FMC A;  3AB9 A;  2MHV A;  3PO3 B;  1S5E D;  1DD2 A;  1WD0 A;  3OOC A;  1G8Z D;  3ONA B;  3CU7 A;  4C1N K;  2B2W C;  3WOF A;  1SYE A;  1HFN A;  1BQQ T;  4CKC A;  2DNE A;  1EIG A;  4BA1 I;  1SJE D;  2Q8R E;  4DU9 A;  4KKT A;  4QUF A;  3NP8 A;  3L7Z C;  2FJ2 A;  3MFG A;  4KTA A;  1D5M C;  4UDU C;  2R92 B;  2BOS A;  5JEA J;  2F0K A;  2IX0 A;  5IGE A;  1ONL A;  2PZU A;  4G7H C;  1TR5 A;  2M2L A;  3BVM A;  1LLR D;  3SK5 A;  1H9M A;  3A54 A;  4KHZ A;  5I4D A;  3MC0 B;  4R9W A;  3GTP B;  2F0F A;  3BYT B;  1K8M A;  1PFB A;  3M3Y B;  1G2T A;  2RBM A;  1QOH A;  3IAY A;  1R4P B;  1J9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...