3J80L

Cryoem structure of 40s-eif1-eif1a preinitiation complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
155
structure length
155
Chain Sequence
STELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEKRHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 20
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00366 Ribosomal_S17 Ribosomal protein S17
L PF16205 Ribosomal_S17_N Ribosomal_S17 N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1000 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j80L00
3J7AV 3J81L 3J80L 5FLXL 5IT9L 5LL6X 5A2QL 3JAML
chains in the Genus database with same CATH superfamily
4GNXC 2R7FA 3NWTA 5IOCA 1JOOA 2CH4A 2LMCB 4DA2A 1RTOA 2KA7A 2ZXRA 3DEPA 1EU3A 1MI2A 3DXJC 1HR0Q 4IOAA 3SHLA 1HA5A 4H44C 2ICEC 1YITA 4JI1L 4GOPA 2K03A 4PQXA 1BCPD 3GTOB 2E2IB 4A3MB 4LFBQ 1TWGH 3E0JA 1H9SB 4X64L 5AFWA 2DGYA 1YNJC 3MTSA 3ULJA 1XJVA 1J5EQ 1XWEA 4K8JA 1FL0A 1SRUA 1Y8OB 1ESRA 4YCUA 3U50C 3BDOA 1EWHA 1Q12A 5JEAG 4JV5Q 5LMUL 2ICIA 4MTKA 4KLKA 1LM0A 3TP7A 3HOUB 3SK8A 2K5WA 3D8GA 1HNXQ 4DV5L 1X32A 1Q81C 3M4OB 2OCEA 1G2SA 3F2DA 2JYOA 3FP9A 3HKSA 2EYPA 4CKBA 3T16A 2KEEA 4LF9Q 4R9WA 2R93B 1C0AA 1B70B 1QILA 4NXNL 4AQYL 1VQAA 2G5DA 2N78A 5M3MB 1N34Q 1EYAA 1RCVD 5M5WB 3GTLH 1V1PA 5C4HA 3CCUA 1J8IA 2HQLA 3EJIA 5T1GA 1S5DD 2YV5A 1YEZA 1Y8PB 1WTXA 5J3BA 4UP9A 4O2DA 1TVXA 3P75A 3D31A 1SMYC 4X3UA 5IGCA 4DXGA 2MQHA 5LHY1 2L12A 1KC8C 1XNRL 1TWCB 2RDGA 3IKJA 1SMXA 4DK1A 3PF4A 2B2VC 4LF5L 4YCWA 1O78A 2CQOA 2HHHQ 1V43A 2VQFQ 2I46A 3DWPA 3C46A 2WP8J 4XT1B 3HS0C 4G7ZC 1ESFA 1HJPA 1YI2A 3HOVH 1ENAA 2MO1A 4JI0Q 1HRJA 4A3KG 3WOEA 3IL8A 3SVMA 4ZRZA 3I91A 2WB1E 2H1EA 3U4VA 2VQEL 4A76A 5EKLA 4GKJQ 3J7ZC 1WTWA 5JPMC 3HOUH 3PO2H 4B3TL 3S16B 5G3LD 3OOCA 3T51B 4DR4L 2NUCA 2KCTA 1TY2A 2IHFA 4K14A 2NN6I 2IX0A 3HOYH 4B3TQ 1I50B 4XYOA 1L0YB 4YWKA 2K4KA 4CGYB 2F0UA 3TSSA 4HEDA 5CV6A 1EU4A 4XYQA 2ZJPA 4ZAIA 3K0YA 1WI5A 2MP1A 2QKIC 5M3FG 1X9NA 3Q23A 3TS2A 2WFWA 1FR3A 4XIGS 2UXCQ 4LFAL 2EYHA 2SEBD 1MBYA 5EPJA 4A3LG 4AYBE 1B44D 2E76C 2UUBL 1HFGA 3G7LA 4YY3Q 2IPKD 2WINB 3ND9A 3CF5A 1D1KA 4DV0Q 3T56B 1IW7D 3W5OA 3KF6B 4OIJA 5IP7H 1A2UA 3CD6A 1RDPD 5CV5A 1BCPB 2HCCA 3RZOH 2Z6KC 3EN2A 1B7YB 1CHPD 2F4VL 4NXMQ 1VQFA 4C3JH 4TRDA 4KI0A 2JA5H 4FXGC 3AFQA 3UDXA 5ELFA 1NMGA 4OL7A 5D65A 4LUVA 2G9DA 4NXNQ 3KLWA 2N8NA 2A8VA 4RMFA 1EQQA 2HQEA 4KV6A 3QB3A 4ZQ3A 1AN8A 3PUXA 4BBRG 5IWAQ 1FD7D 1TWHH 1X6OA 4IUTA 2RSOA 4ODGA 4NPSA 1PLFA 1KNEA 1GXDC 3ZYYX 5I6YA 1HNXL 4CJ0B 3I72A 2CH4W 1IHZA 2L55A 3G6JB 1MD2D 3I4NG 4QMGA 1A8VA 4BBRH 2EY2A 1U4RA 1SN8A 2Y0SE 3W3AA 3KK7A 5J39A 4PMCA 2BA0A 3S1NB 4G57A 3PCOB 2JA7H 4JI1Q 1Z9FA 3I4MG 4PZ7A 4GNXB 4N8FA 1QZHA 1WOCA 3PO3B 1HA6A 1KRTA 1HTPA 3KLRA 3GTPB 4BXXH 3CRKC 4ZUJA 1EIHA 4FF1A 3OWFA 2QA4A 2K28A 4R4CA 3H3VC 1JWUD 1YJWA 1WCMB 3GTMB 5AJ3L 4IO9A 1DXMA 3A8JE 3M4PA 1D5ZC 2Q8TA 1JJGA 1TQOA 4R8NA 4JI8L 1JJ2A 1B8AA 4A93H 2XN9C 2OQ0A 4QCLA 3CP0A 2PNRC 4Q0FA 5C3WA 3HOZB 2CHBD 4FNFA 1XPOA 1QG7A 4NDXA 4HR7B 1AE2A 1SEBD 1SR3A 3VYSA 1WTHA 4LMQD 2GVAA 1BF4A 4X3TA 5LMNL 3HFZB 4P74A 1GVPA 4R4IA 4GNXA 3E9IA 4NW2A 1KAAA 4HJ5A 2B63G 1O7LA 4KHVA 2UUCQ 1D1IA 4V190 2CWAA 2J7ZA 1IXRA 2I0QA 4OIKA 3V05A 3DLLA 1TWFH 1STNA 4ILWA 3GTJH 1PV4A 3EA6A 1SAPA 3J80c 1WCMG 1Y1WB 4H02A 1TKWB 1K8OA 2K6AA 5IP7G 1NR2A 1RD9D 2R61A 2QF7A 2F0GA 3MEHA 4EQPA 4JC0A 1K0SA 1F2MA 4JBKA 1N34L 2IX1A 2SNSA 4DPGA 5DM63 4WJWA 4EQOA 3GTLB 4X62Q 5M3MH 4JBJA 3PIPA 2NVYB 1KTKA 2I5LX 3C2PA 3M4YA 4M8AA 2VUMG 1Q3LA 3L9AX 1VQ6A 2X6GA 3FVQA 5CV9A 5ELEA 5C3EH 5ELDA 1Y8NB 4C1NI 1ZKOA 4A93B 1EYGA 1Q8IA 4QJFA 4O0AA 1GUOA 4X65L 4QF4A 4KY5A 5GAHC 4DR1Q 4BA1I 2ZTEA 3CC4A 4HMJA 1ICFB 4A3EB 1STEA 4JI5Q 1LACA 1VQBA 1VQMA 3U9OA 3I4NH 2B2TC 2EJFC 1WJJA 1H9KA 4A3JH 4A3MG 4JI6L 1VQPA 4B3MQ 2PZTA 1D7QA 3M4QA 3GTGB 1U0LA 1IBKQ 1XNQQ 3PO2G 4C3IG 2XRQD 2PZUA 1B3QA 1PH1A 1HR0L 1CKNA 3I4MB 4A3MH 4WORA 1Q1EA 3S24A 4K0KL 1K3BC 2F1MA 1CZGA 2PYKA 1EYCA 1X56A 1QJOA 3MC0B 4YWMA 5JOBA 2F4VQ 2UXDQ 3JAME 2K04A 4JI4Q 1E2WA 4GN3B 1E2VA 3EIVA 2B2TA 4HSPA 1SE4A 1RJTA 1S4ZA 4C3HB 1DONA 4J8QA 1XTCD 3S14H 3RN5A 2EYMA 2EYFA 4JBWA 4APVA 2MHVA 3S9WA 2QDLA 1JR0D 3GQBA 3CHBD 4IPGA 2EPBA 5EPKA 1JB3A 2F0QA 4K2LA 4L5RC 3J81L 3I55A 1PRTB 1HUMA 4XQJA 4GKKL 4PNYA 1GD7A 5GAEC 3Q24A 2B63B 2IX3A 5C4JH 4LF8Q 5C4JB 5I2YA 3SGIA 4DR3L 2B63H 5JEAJ 4G7HC 4Y52H 5I9PA 3R3OA 1G6PA 4GZYC 4K6DA 1STAA 2DJFC 4ALPA 4HN7A 3UI2A 3HGBA 1KNAA 2Q2HA 1JORA 1WCMH 3GTMH 1XYIA 1P16A 4MIUA 5EQ0A 5H1SE 1JWSD 3VA5A 3EQLC 3NHHA 5J1ZA 1WTOA 3NE5B 2F0TA 2E2JB 1X3EA 3GTKH 1L2FA 4LF7Q 3HOZH 1L0XB 1I4QA 3HOUG 3HKZB 1NJIC 2QCPX 1QVGA 4JVZA 1C8CA 5C4XH 2MFIA 3PV0A 1SNQA 2NB0A 1PXUA 4JI3L 4RKLA 1TS3A 1DCZA 3ULLA 5C3EG 3S1MB 2NN6G 5IY0A 1N9WA 2BDOA 4RG1A 4GS3A 1JJCB 4KKUA 1Y1VB 1EZ6A 2AUJD 1S40A 3ND8A 3TZUA 1WTRA 3S15H 1ILQA 3MWYW 4L63B 2F0HA 4IPHA 5IYDG 4HIKA 4LF4Q 4EQ5A 1HNZQ 3JC66 1KXLA 3PO2B 3CCRA 4JBMA 2EQSA 1II3A 3DHQA 1G8ZD 4FO2A 4A3LH 2YTXA 1VF5C 4EVOA 3HOVB 1FNVA 5M9OA 2GN5A 4JI7L 1GOZA 1I50H 2AHOB 3J81i 4JW0A 4KY6A 3EBEA 2KENA 1DJRD 2LXKA 1UE1A 1EFWA 1NNXA 4OX9L 2TSSA 4DV5Q 2O5JC 2E2JH 4OWTB 2EZVA 1YNND 2MPMA 5HGTA 3S16H 2A19A 4KTAA 1Z6HA 3CCSA 2HUGA 4DAYA 1A2TA 3M3YB 4IFDJ 1HZCA 3GV6A 4BBSG 1TT2A 3BG3A 4YCVA 3JAMi 3VA7A 1DGSA 2HDMA 2JA6G 2K7VA 2SNMA 3MXGA 4LFBL 1HUNA 4DV7L 4DV4Q 4B9XA 3KJOA 2VXWA 4DR5Q 2E75C 2ZJQA 1FVIA 4HCSA 2PCFB 1CQFA 2WAQE 5D3DA 4F88A 4RWSC 2MGSA 1U9RA 4ZLTF 1VQKA 1EQTA 1NE3A 4OONA 4OO1I 3NWSA 2JA8B 2RCFA 3M7GA 3A5ZB 1EEFD 5FJ8H 2CCZA 3QR8A 3BYTB 5KRUA 2ZM6L 5GQOA 4OO1G 4RHSA 1KL9A 2F0NA 3I90A 1BR9A 4KKSA 5C0XH 5FLXc 4OWWB 3RMHA 1EY0A 3E9HA 1L1OA 3FKIH 3AEVA 2AMCB 2QILA 2B2UC 3CQZB 5FK9C 1HTLD 1CHQD 2RDFA 3D0FA 3BDCA 2A6ED 2RQXA 3PQIA 2P5ZX 2PO4A 4N8X1 2KCNA 4I65A 4HMIA 5COYA 5CBAE 2XGTA 3M4OH 1C9OA 2B3GA 1I6VC 3OIPA 3GDEA 2B2VA 3CKIB 4C3IH 1O80A 1CI3M 1GHKA 2DUDA 3QJYA 1RIPA 3ER0A 1R9TB 2EYJA 2B8GA 5FO7B 1N32L 5C44H 2K75A 4UP8A 3J7AV 1E7ZA 3AB9A 3PIO3 1UEBA 4DV6L 5KNCA 4AYBB 2F0KA 4DV2Q 4UY8C 1ZEQX 2AKWB 3G4SA 3P7JA 1W2BA 5KIXA 4ZUIA 3K7AH 2V4DA 5E7NA 3RLNA 2JJQA 4LF6L 3CRLC 2OF1A 2C35B 1BBXC 1I4XA 4RGOS 4DAMA 5C3EB 4ZK9B 1NMFA 3OMGA 5C4ZA 2JEBI 4QQBX 2RF4A 1I6HH 1AZPA 4ULLA 1VQIA 1PRTD 1QVCA 2EE1A 2QGQA 4X65Q 4FYDA 2R7ZH 3MAQA 3DWAA 3F2BA 4LUOA 4DUZL 3HOWB 3CCQA 3A54A 4LWCA 4IN3A 4IUPA 2WKDA 4CDCC 2N3SA 3Q22A 4P73A 4FDBA 3NSWA 1BNZA 4BY1H 1S5CD 3I8ZA 2UXBL 2WB1G 2UXCL 2CKZB 2KEDA 4B3SL 2ENBA 1PH6A 1SLJA 3SE0A 5CV7A 3H09A 5E3FA 5D14A 2F3IA 1CKOA 1BKBA 3KBGA 5FO9B 2FJ2A 4JK1C 2JA5G 1UWVA 3L3OC 1RL2A 2BH8A 5M3FB 3KJPA 1K83B 3D4DA 4DR4Q 4U673 2F0PA 2F0IA 3STBC 1EEID 1WVLA 1WFQA 4Y7NH 4GKJL 3BVGA 4A3GH 4U68A 5KNDA 4CKCA 3OWEB 2CQAA 3X3MA 3KLSA 1VQJA 5LMNQ 4QGUA 4LNQA 3G6EA 4F87A 1MHWC 3CAMA 3S1NH 2I5HA 4ABNA 4DF7A 3P20A 3D3RA 4RAUC 2VQFL 3FPUB 3FRPB 1EIGA 1F2LA 1B9NA 3T13A 4P75A 4TQUS 2LFNA 1PYWD 4JPBW 1NTGA 1XNRQ 3H0GB 1CSQA 5CMDA 3D6WA 3HOYG 3I4MH 3E5SA 4KHPL 1K8MA 4A3EG 1HZ9A 2LY7A 4GLVB 3K59A 4Y7NB 1KDBA 2E8GA 4JOIA 3IAYA 4J1MA 1HNWL 3W2DA 2F0OA 5IGFA 1SSOA 4POFA 2HCIA 4X3SA 3C1FA 3S1QB 1QOHA 3RR5A 3VYRA 2PW7A 1K83H 2DJGC 4L8JA 4RCNA 1LTSD 2XNAC 5IYBH 4X66Q 1AW7A 4HIDA 3FKIB 1A3VA 1LLRD 3CMAA 5IE8A 1UAPA 4IUUA 2WAQG 3Q8DA 3JAMc 3OW7A 2KVMA 2K33A 3HZXA 5D3IB 5IYBG 2B39A 1SYGA 1PA6A 2K01A 5LMUQ 2JA9A 3T4AC 1B2TA 1M4VA 1EZ8A 1KDCA 3UDFA 5IWAL 1JICA 1J5EL 2JK8A 3TN2A 2R92G 1SNOA 2AWOA 1DOMA 4TVAB 4X64Q 3K81C 3NELA 3UE0A 1OXUA 1STGA 3RZOB 5JJIA 3S17H 3TREA 4BS9A 4QIWE 1A3UA 5C4XG 2BA1A 3K58A 1WTQA 1XMQQ 1MKHA 2L4NA 4IFDI 3S1MH 3NP8A 1F2YA 4IZ8A 1JT8A 2RVLA 2NVTH 4MTNA 3DMUA 5IP9H 4Q5VA 1XPUA 1NBWA 1IBLL 1WD1A 2SOBA 3FPPA 3N52A 1TWAH 3AFPA 2NTTA 1XMOL 4H13C 1V1OA 2XTIA 1ASZA 4A3GG 2XIWA 4NMZA 5K5PA 3HP3A 2ZTDA 4KJOA 4C3JB 2Q2IA 1YJNA 4P72A 4LFAQ 2B2YC 4CKEA 3VR2A 1VQ5A 4KN7C 2EDGA 2KCCA 2PQAA 4A4IA 5HY6A 5GADC 4KJNA 5KGUA 1MJEA 5DNFA 1VDZA 2Z0SA 4ID6A 2MO0A 5IT9E 4I7ZC 4LFCL 3S15B 2VB3X 2N49A 1TS2A 5CBEE 4A3IH 3VR6A 1JOQA 5T1IA 1FJGQ 3PGZA 2A6EC 2EY5A 1S72A 2KJXA 1Q46A 2Z6KA 1GM5A 3H6MA 1CK1A 4WRDA 3NXWA 2KCMA 2ALYB 1MIUA 4DXFA 5JJLA 2JA6H 4DV1Q 3DWQA 2DY8A 4JI0L 2K5DA 1IL8A 3GTKB 3IFDA 2R7ZG 4XTCS 1TWCH 1JWMD 4DV3Q 1VQCA 5EAYA 1PFSA 5C0XJ 1ENCA 3U58A 1ZXTA 2CFMA 1VQ7A 1GUWA 5FLMH 4A3JB 1LT3D 2Y0SB 2ZTCA 5GROA 3F2UA 5IYCG 4PZ6A 3I4OA 1PZJD 2ID0A 2WB1B 3RNUA 2LS01 2KHJA 4ZKBB 4YIJA 4NB3A 1HR0W 4QIWB 4LJZC 1S3OA 2F52A 1CT1D 1PRTF 5F2DA 2R93G 2XWBB 1PZID 3CPFA 3MXUA 2RCNA 2YYZA 4DK6C 3VYUA 4LF6Q 3SEBA 5EKKA 2K5QA 4DV2L 4GLAC 1G51A 3KUPA 2A5HA 1T9HA 2F0LA 4F7XA 5CYUA 2ASBA 1K0RA 3C3LA 1S5FD 1PH2A 3I70A 2F03A 1Y14B 3T1HQ 5JJKA 3FHWA 2F4IA 2EY1A 2JXMB 3DEOA 1QUQB 2UU9Q 1V1PB 3T1YL 1AP0A 2QW7A 3LWEA 2B2UA 1LTTD 1SJED 5E1FA 2NVYH 1DD2A 4HJ8A 5JVG3 4L5SA 5J22A 5CGKA 3KYHC 2PQEA 4M1UB 3K7UC 2NN6H 1A62A 2BCOA 3OYYA 1V8QA 5LMNW 1T5XD 4A3IB 5EKIA 1EY5A 2Z9HA 3EVQA 3ONAB 1ET6A 1B4OA 2A74C 3IRBA 1K73C 1Z47A 3GTGH 3B6YA 1KQSA 3TQYA 4DR2Q 2D0PA 3TRZA 1MSGA 1ONLA 2WKCA 1SROA 1X3FA 4LAAA 2HT1A 4KHPQ 4A3GB 3J80i 3G71A 4EQNA 1UE6A 2QEJC 2BDNA 4IJHA 1CQVA 4PZ8A 3S1RH 4CDEC 2B8FA 1QNUA 3I2ZA 3TP6A 4UAIA 3T53B 4DV4L 1RHPA 4RA8A 1Q90A 3UDIA 1K28A 5E4WC 4HJAA 2UUAL 1YNJD 1F9RA 1HQRD 2WAQB 4EX5A 2YTVA 1VS0A 4A3CH 1SNDA 1Q7YC 2DNCA 1PTOF 3MHBA 1NY4A 3A7LA 3L2PA 1S5ED 1TR5A 2B29A 2ATWA 4CDFC 2YTYA 1BBUA 4UHVA 4ME3A 1QCBD 1UNSA 4N9PA 1SYBA 5IT9L 3J81j 1DM0B 2L11A 2PI2A 3CCJA 3D4WA 2D62A 4JI2Q 3I3CA 2NVXH 2BOSA 2R93H 5G3LF 4CJ2C 2Q2UA 2K5VA 3ULPA 3CCMA 1B3AA 1U4PA 1Q1BA 3QWNA 2F0FA 3STBD 3KF8A 1Z7TA 5IP9G 1QE6A 1SXTA 3CMEA 4NP5A 4IUNA 3NENA 1ENFA 2C5CA 2RSNA 2UXBQ 1BQQT 3H0GG 3HOXH 1K8AC 1VF7A 3I7FA 4O42A 1PZKD 4G4KA 2ZT9C 3D4RA 3I56A 4JI3Q 4BXXG 2OXPA 2PI2E 1EFID 4C3IB 2NVTB 3PUWA 2Q8IB 5JPNC 4WJ3M 4LUZA 4A3FB 4DV3L 2X6LA 4DR7L 3BYYB 1E1TA 1O7YA 3K6OA 3AYHB 3CU7A 3BZDB 1SMYD 4RGMA 1M1KC 3PUYA 3HRZC 1WTPA 1HFNA 4IQZA 1U4MA 3MEFA 3J80E 1EOTA 3EROA 3VDYA 2JA5B 3RLOA 1ZYRC 1IKLA 3K57A 3X3NA 1H9MA 3RUZA 3W1BA 1TS5A 4KD4A 1K8GA 1E1OA 2ZJRA 4B3RQ 1XPRA 4C2MH 1N33Q 4JI2L 2PW5A 1SDFA 1I3QH 1L0WA 1PH5A 5I6WA 4LFCQ 1F9QA 2E2HH 4DN4M 1JC7A 5IGBA 4C3HH 5A35A 4ZCKA 4YHHQ 2H4OA 2JP1A 3H15A 5EGTA 4A3BG 1NAPA 1H9SA 4FP5D 3OIQA 1G291 5A2QL 2VZAA 3KLSX 1X3PA 3FMCA 3S1QH 1VMCA 3TDQA 5M5XH 3UDGA 4J15A 3MA2B 2KHIA 4K5XA 1XMOQ 1CKNB 1Y1VG 1ML0D 2R7ZB 4A3DB 1R4PB 3J7A5 4AYBG 1L1OC 1ICWA 2K50A 3MFYA 1J9OA 3A56A 3MVVA 3QOJA 2UXDL 4QUCA 4KKTA 3F1ZA 3QG1A 5IIFA 1N33L 5DEHA 1K9MC 1Y1VH 5C6AA 1CM9A 3K7AB 4I7AA 1KDAA 3LX0A 2NVQH 4XQNA 1PH8A 1EWIA 1TIID 1PVOA 3NK9A 3HOVG 5C3XA 3HOWG 4RGNA 1D5MC 2K5HA 3K80C 3MFGA 5KEEA 4R4TA 5C4XB 1SBBB 1HH2P 3NTHA 2PMZE 4DK0A 1OO9B 3PUZA 4K2KA 4DFAA 3SXHA 1T5EA 3PIOA 2MNAA 1VQLA 2EXZA 5KYIA 2BH2A 2QDBA 3S14B 4KY7A 1O7IA 2A68C 2QEXA 5FKAC 3GTQH 2NZHA 2UU9L 4P2CB 1GHJA 1IBMQ 1HCZA 4FF4A 3SK5A 3CC7A 2LSSA 4X66L 1YNNC 3TZDA 4X3KA 2KQ3A 5CORA 4FF3A 3BZKA 4RGTA 5TSSA 1EIYB 1NR4A 4LF4L 1HHVA 4C1NK 1IZ6A 4LK1C 5BN3A 1HNWQ 4N9TA 1OXSC 5IYCH 3CCEA 5IT9c 1JE5A 1CUKA 3HEJA 2IT1A 3F2CA 1TY0A 4K5VA 5BR8Q 5EJWA 4BBSH 3CQZH 2D9UA 4C3JG 1BVSA 1CA6A 3BDLA 3TBIB 3E6ZX 3L7ZC 2N55A 1UE7A 5E4XA 1KRSA 2HIVA 1TWGB 1EYDA 1PFNA 1FGBD 2D0OA 2ZXPA 2JA8G 2N88A 4UPAA 1I94L 1X55A 1SYDA 2Z4HA 3KFUA 1E22A 4BWGB 4JI8Q 3LWUA 2JEAI 4R1JA 1GKHA 2CWPA 2Y0SG 2R92H 4J6HA 5GAGC 1OXXK 3A0JA 2HDLA 2A6HD 4L6TB 1VQ4A 1VQGA 1Q82C 1SJHD 3NQTA 2PZWA 4DAYB 1BCPF 3S1RB 2F3WA 4CHTB 4HCEA 4MZ9A 3H3VI 2AQ2B 1OXTA 1PRTC 2NWGA 3FKIG 1TWFB 1M90C 1FYCA 4LF8L 4V0BA 1HZBA 3R93A 4PMBA 3KDFA 1H9JA 1SYFA 2J4XA 4GKKQ 4BY1B 5ELBA 2CW0C 4AH6A 1A63A 2L9HA 1VQEA 1WTVA 1SNPA 4HJ7A 3HOWH 2PMZB 3CCLA 4JCVE 2I07B 2F3VA 2WV6D 4TKOB 4GN4B 3OTOL 3FDTA 1F9PA 1EOVA 4DUZQ 2Z1CA 3ICEA 4UP7A 4DR6Q 3MXPA 4A3EH 4A3KB 1IL2A 3P1HA 2K1BA 4HIOA 5KYLA 2JE6I 2RHSB 4RH6A 1Q8KA 3NTIA 1DZ1A 2NVXB 1F2ZA 3RZDB 3DUZA 2A1AA 2VW9A 3T1HL 3C1EA 1JCKB 2O4XA 5DAUA 4K0KQ 1KAWA 4IUVA 3KDFB 1E2ZA 1SFOB 4A3IG 2K52A 1PYBA 1PHJA 5LL6S 1D2BA 3J81E 1N32Q 5C5LA 2IY5B 4GOPB 1EWCA 4KN4C 4CJ1B 2FHTA 1P8LA 3U9SA 2MJ8A 1DOLA 3K5LA 4B3ML 4BY7B 2ES2A 4JI6Q 3QOLA 1N8RC 4HTHA 1EIFA 1YNXA 4DR7Q 1LO5D 1GUSA 2A69C 1PFMA 5CV4A 4DV0L 4BA2I 3BVZA 3V2TA 1EY7A 1QUQA 1GJXA 4YY3L 4CBVA 2UUBQ 1BCPC 1YVCA 2B2YA 3K8AA 4BBSB 3OTOQ 2HIXA 3Q0AA 1I4GA 3JAML 3CCVA 5K36G 2GA4B 2E2HB 4NKLA 3S2HB 2FMMA 3SK6A 4QY7A 4RHRA 4OO1H 2A73B 3A7AB 2R7DA 3S2HH 1LTAD 2NTSA 4K5WA 2E74C 1Y69U 3K5MA 5M5XB 1FNWA 1X54A 1A0IA 2OTLA 1LT6D 1W6KA 5M3MG 4DV1L 2NZOA 3VR5A 2X69A 1RKNA 1JB7A 2JA8H 5C0XI 1A6XA 2OTJA 3MXNB 2ZM6Q 2AWNA 1V9PA 4HIMA 1B1ZA 3TS0A 3URYA 5IGEA 1X65A 1FJGL 3OW2A 1LTLA 3M9BA 2VL6A 4B08A 1FNUA 1SNCA 1VQDA 1VCIA 4QUFA 1RODA 3GTQB 4BBRB 4A3JG 1WD0A 4JOIC 2UUCL 5IGGA 2VQEQ 5DM73 3PO3G 3WOFA 2L15A 1W3SA 2RDHA 4E6IA 2F0MA 2KOLA 1PTOH 3KBXA 3BS1A 4S3SA 4DAVA 5JEAH 1I94Q 2M2LA 4FVMA 1I4HA 4K8IA 4FXDA 4YWLA 3GV3A 3KOJA 2JA7B 2DY7A 3SR1A 1RTNA 2HHHL 3ZJYC 5A2QE 1AFPA 1NCVA 1BDOA 2OT2A 3KF8B 3MXNA 4OWXB 1QNKA 1IBLQ 1UE5A 3A8KE 1BUVT 2KUMA 5BR8L 5I2XA 5I9OA 4DKAC 1UUPA 3PIP3 2R6GA 5I4DA 1OTCA 3VYTA 3A74A 3NBHA 1XMQL 4DR2L 4QB4A 2YU9B 1STBA 2FFKB 3W1GA 2M9VA 3AQQA 1I3QB 2XSCA 2XRSD 3CXCA 2SDFA 4AQYQ 1B9MA 3MZ5A 2FMCA 5ELOA 1S5BD 5EPLA 1K3RA 1IYVA 1AEXA 1EY6A 2Z4IA 5ELCA 5FOBB 5FO8B 1VQ8A 2L1BA 1X3GA 3VR3A 3J80L 2CVRA 1U5KA 4KMUC 4RCOA 3AU7A 4IURA 1B53A 2JA6B 1SYCA 4F8MA 4ME5A 1I6HB 3M85A 1BO0A 1M8AA 3PMFA 3T1YQ 1W6JA 3NBIA 4OELB 4GOPC 5NUCA 4A3FH 3LNNA 2F0VA 1V1QA 2L5TA 4LW1A 1GUGA 3RLFA 4DNTB 5K36H 5M5YB 1STYA 1EY9A 2TMPA 2FINB 1ASYA 2VNUD 5C44B 2EJMA 3M7NA 4HSVA 1MSHA 1R9TH 1G6ZA 4TSSA 4IFDG 1LT5D 1LABA 3A8IE 4DAPA 4P71A 5JVH3 1LTID 2B2WC 2JA7G 1JE4A 1PYSB 4OHJA 1EUJA 4XT3B 2XVSA 4NXML 2EYOA 4BY7H 4JG2A 4IALA 3RN2A 1VQOA 2XWJB 4UDUC 5M3FH 5L37A 4H7BA 4QL5A 5HURA 1GO3E 4DR6L 1TXYA 1TWAB 1PH3A 3H0GH 3HOXG 1IYUA 2RA4A 1Q86C 5ELNA 4IOCA 2JSOA 4RFBA 1C4QA 2R3ZA 2M00A 5KNBA 2DNEA 4R4QA 3TP5A 2RHQB 2O5IC 3NUCA 2FXQA 2A68D 1PH9A 2OEOA 3K5NA 3SK4A 2EOTA 3R8BA 1Y1WH 4K6LA 1A15A 3S2DH 3BVMA 1LTBD 3H91A 5FLXL 1F9SA 3WWVA 1KLGD 1SNMA 2K14A 1MJCA 4JYAQ 2AUKA 2GVBA 1VQHA 1QZGA 2K05A 1QB5D 3HKZG 4B3RL 1CKMA 3DM1A 5JJZA 3N6RA 2OWOA 2NVQB 4KD3A 4L5QA 3I4LA 1KHIA 2Q8RE 4DV7Q 2I5MX 2AQ1B 4A3CG 1IBKL 3BZCA 1ET9A 1XNQL 4B3SQ 3L0OA 2Z6BA 2IWHA 4C3HG 2E2DC 5DLQE 1VMPA 1TU2B 1E3PA 2K32A 4R4OA 2PQAB 2RKSA 4MHEA 4DR1L 1KD1C 3E3XA 3SDZA 4LF5Q 1XX8A 2IL8A 1D8LA 1CZWA 1ZYRD 1ILPA 3KF6A 1R4QB 3OMCA 2PNHA 3CC2A 1E24A 1GUNA 5EBDA 4HJ9A 1PTOD 4DGZA 5C0XG 2A6HC 1I4PA 1SFOH 1E0BA 3GP7A 2F0EA 2IHEA 1LV9A 1J6QA 3OPOA 5IODA 1TS4A 1PTOC 4FF2A 3RD4A 1H9RA 1A3TA 1VQ9A 1STHA 2VS1A 5CV8A 3HOYB 4LF9L 3ERQA 4A3KH 3GO5A 5IYDH 2EJGC 3TMEA 3S17B 1DOKA 3PF5A 3GTPH 1IBML 2Q2TA 4DNRB 3PO3H 5LL6X 4L5TA 2EVBA 1NSNS 3QO2A 1N36Q 4A93G 3G48A 2CW0D 5FLXE 2H5XA 2C9OA 3NTKA 1G2TA 3QIAA 1PDQA 2F0SA 3E0EA 3NQIA 4H0LC 4JV5L 3VR4A 2BE5C 3ERSX 1H95A 2F0DA 2D5DA 2VY3A 4IPDA 3R2IA 1XXGA 3I4NB 4FXKC 4Z9CB 1OXVA 1KABA 2UUAQ 2VB2X 3H3VH 1SE8A 4DNIA 1O7ZA 1QVFA 3M3YH 3Q6SA 3BU2A 1IW7C 2G9HD 5HGQA 1X3QA 4DUYL 4PMWA 1JMCA 1BXTA 2L0CA 1YBYA 1VQNA 3WDNA 1L1OB 5CR3A 5AJ3Q 3CPWA 5BN4A 2IJ0A 2JQOA 4OEMB 5FLMG 2R92B 2DN8A 1SE3A 2ZXOA 1YJ9A 4C56C 4RKBA 2MUYA 4BY1G 4WJ4A 4IUQA 2J0TD 4EGVA 1EQVA 4DR5L 4IJLA 4A3BH 4GLXA 1LYLA 1GUTA 4DUYQ 4O1NA 1HQMC 1UEAB 4PG3A 3BJUA 3A55A 3J81c 2A69D 3IFTA 5IGDA 2V1CC 1AE3A 2EIFA 1I4RA 1F77A 4YHHL 3HOZG 4MNOA 3H94A 4A3FG 1EQRA 3K5OA 1D5XC 4OX9Q 1RF2D 1KIXA 1JQYD 1N36L 1BOSA 3A5UA 3AMUA 2BE5D 2OQKA 1IYJB 4JI7Q 5BN5A 2E5LL 2IW3A 1FGUA 3PSIA 2LXJA 1LTRD 2AQ3B 4CDDC 4GN5A 2PPBC 3GTOH 3R2TA 1HZAA 1LT4D 1AZQA 3GD7A 4DK3C 2Z8LA 3OSOA 4BY7G 1HNZL 1YZ6A 3NPPA 5JAVA 2K5NA 2B2WA 1YIJA 5EBCA 5C44G 4OXPA 1PTOB 4JI5L 4C2MB 1PMRA 3HOXB 3F8TA 3HKZE 1NUCA 4WFN3 3J7YW 2NBFA 5ISRA 1XTDA 3RZDH 3I73A 4AIMA 1YHBA 2RBMA 1AH9A 2KHSA 1DYQA 3FEWX 1YHAA 1PH7A 4IPCA 4ZYSA 1Y1WG 4LF7L 3UE1A 4POGA 3J7AF 4DU9A 2KECA 4PV1C 4X62L 4A3DG 4MN3A 1HXYD 1U4LA 2D2CC 2KBNA 3LGJA 4DV6Q 3PUVA 1EL0A 4A75A 1C7YA 5C5MA 3DM3A 3GTJB 4KHZA 2LKVA 1YHQA 1KLUD 4OGQC 1QWYA 1SE2A 1TWHB 4A3DH 1PH4A 2EY6A 4ZKCB 2E5LQ 4A3BB 2F0WA 4XXEA 4JYAL 2EXDA 5CC4A 1CSPA 1G91A 4DR3Q 2HD3A 2YU9H 4X6AH 1JOKA 3V96A 4KK7A 4B9WA 5FJ8G 1EY4A 3OHXC 4G7OC 1C48A 4R8IA 1LTGD 2F0JA 3CW2C 2O2LD 1SYEA 2E2IH 2NZ1D 3TP8A 4IFDH 2NYZD 3D6CA 3K0XA 2WIIB 3S2DB 2JN4A 3NBHB 3U4ZA 3O13A 1CA5A 1B50A 1CFMA 3ITPA 3TEHB 1MGSA 1EY8A 1PFBA 1HPCA 1LUZA 1WYDA 3HG9A 3EFXD 4XQQA 4HAEA 1I5FA 2EYLA 3NEMA 2VUMH 4XDXA 1CTMA 2VUMB 1D6EC 4JI4L 5M5YH 2WACA 1BBWA 1IKMA 5M5WH
chains in the Genus database with same CATH topology
3NWTA 5IOCA 1JOOA 2LMCB 4DA2A 1RTOA 2KA7A 2ZXRA 3DEPA 1EU3A 1MI2A 3DXJC 3SHLA 1HA5A 4H44C 2ICEC 2K03A 4PQXA 1BCPD 3GTOB 2E2IB 4A3MB 3E0JA 1H9SB 5AFWA 1YNJC 3MTSA 1XWEA 4K8JA 1Y8OB 1ESRA 3BDOA 1EWHA 1Q12A 5JEAG 2ICIA 3TP7A 3HOUB 3SK8A 2K5WA 3D8GA 1X32A 3M4OB 1G2SA 2JYOA 2EYPA 4CKBA 3T16A 2KEEA 4R9WA 2R93B 1QILA 5M3MB 1EYAA 1RCVD 5M5WB 1V1PA 5C4HA 1J8IA 3EJIA 5T1GA 1S5DD 1Y8PB 1WTXA 1TVXA 3P75A 3D31A 1SMYC 4X3UA 5IGCA 4DXGA 5LHY1 2L12A 1TWCB 2RDGA 3IKJA 4DK1A 2B2VC 1O78A 1V43A 2I46A 3DWPA 3C46A 2WP8J 4XT1B 3HS0C 4G7ZC 1ESFA 1ENAA 1HRJA 3WOEA 3IL8A 3SVMA 4ZRZA 3I91A 2H1EA 5EKLA 1WTWA 5JPMC 3S16B 5G3LD 3OOCA 3T51B 2NUCA 1TY2A 4K14A 2NN6I 2IX0A 1I50B 4XYOA 1L0YB 4CGYB 2F0UA 3TSSA 4HEDA 5CV6A 1EU4A 4XYQA 4ZAIA 3K0YA 2MP1A 2QKIC 3Q23A 1FR3A 4XIGS 2EYHA 2SEBD 1MBYA 5EPJA 1B44D 2E76C 1HFGA 3G7LA 2IPKD 2WINB 3ND9A 1D1KA 3T56B 1IW7D 4OIJA 1A2UA 1RDPD 5CV5A 1BCPB 2HCCA 1CHPD 4TRDA 4KI0A 4FXGC 5ELFA 4OL7A 5D65A 2G9DA 2HQEA 4KV6A 3QB3A 4ZQ3A 1AN8A 3PUXA 1FD7D 4IUTA 2RSOA 4ODGA 1PLFA 1KNEA 1GXDC 3ZYYX 5I6YA 4CJ0B 3I72A 1IHZA 2L55A 3G6JB 1MD2D 4QMGA 2EY2A 1U4RA 3W3AA 3KK7A 5J39A 4PMCA 2BA0A 3S1NB 4G57A 3PO3B 1HA6A 1HTPA 3KLRA 3GTPB 3CRKC 4ZUJA 1EIHA 4FF1A 3OWFA 2K28A 3H3VC 1JWUD 1WCMB 3GTMB 1DXMA 3A8JE 1D5ZC 2Q8TA 1TQOA 4R8NA 2XN9C 4QCLA 2PNRC 4Q0FA 5C3WA 3HOZB 2CHBD 4FNFA 1QG7A 4NDXA 4HR7B 1SEBD 3VYSA 4LMQD 1BF4A 4X3TA 4NW2A 1KAAA 1O7LA 4KHVA 1D1IA 4V190 2J7ZA 4OIKA 3V05A 1STNA 4ILWA 3EA6A 1SAPA 1Y1WB 1TKWB 1K8OA 2K6AA 1NR2A 1RD9D 2R61A 2QF7A 2F0GA 3MEHA 4EQPA 1F2MA 2IX1A 2SNSA 5DM63 4WJWA 4EQOA 3GTLB 2NVYB 1KTKA 3C2PA 3M4YA 4M8AA 1Q3LA 3L9AX 2X6GA 3FVQA 5CV9A 5ELEA 5ELDA 1Y8NB 4C1NI 1ZKOA 4A93B 1Q8IA 1GUOA 4QF4A 4KY5A 4BA1I 4HMJA 4A3EB 1STEA 1LACA 3U9OA 2B2TC 2EJFC 1H9KA 2PZTA 3GTGB 4C3IG 2XRQD 2PZUA 3I4MB 4WORA 1Q1EA 2F1MA 1CZGA 2PYKA 1EYCA 5JOBA 1QJOA 3MC0B 3JAME 2K04A 1E2WA 1E2VA 2B2TA 4HSPA 1SE4A 1RJTA 1S4ZA 4C3HB 1DONA 4J8QA 1XTCD 2EYMA 2EYFA 4JBWA 2MHVA 3S9WA 3GQBA 1JR0D 3CHBD 2EPBA 5EPKA 1JB3A 2F0QA 4K2LA 3J81L 1PRTB 1HUMA 4XQJA 4PNYA 3Q24A 2B63B 2IX3A 5C4JB 5I2YA 5JEAJ 4G7HC 5I9PA 3R3OA 4GZYC 4K6DA 1STAA 4HN7A 3UI2A 3HGBA 1KNAA 1JORA 1XYIA 4MIUA 5EQ0A 1JWSD 3VA5A 3EQLC 3NHHA 5J1ZA 1WTOA 3NE5B 2F0TA 2E2JB 1L0XB 1I4QA 3HKZB 2QCPX 1C8CA 3PV0A 1SNQA 2NB0A 1PXUA 4RKLA 1TS3A 1DCZA 3S1MB 2NN6G 2BDOA 4KKUA 1Y1VB 1EZ6A 2AUJD 3ND8A 3TZUA 1WTRA 1ILQA 3MWYW 4L63B 2F0HA 3PO2B 1II3A 3DHQA 1G8ZD 4FO2A 1VF5C 4EVOA 3HOVB 1FNVA 5M9OA 1GOZA 4KY6A 1DJRD 2TSSA 2O5JC 2EZVA 1YNND 2MPMA 5HGTA 4KTAA 1Z6HA 2HUGA 4DAYA 1A2TA 3M3YB 4IFDJ 3GV6A 1TT2A 3BG3A 3VA7A 2HDMA 2K7VA 2SNMA 3MXGA 1HUNA 4B9XA 2VXWA 2E75C 4HCSA 2PCFB 1CQFA 5D3DA 4F88A 4RWSC 2MGSA 1U9RA 4ZLTF 1EQTA 4OO1I 3NWSA 2JA8B 3M7GA 1EEFD 3BYTB 5KRUA 4OO1G 4RHSA 2F0NA 3I90A 1BR9A 4KKSA 5C0XH 3RMHA 1EY0A 2QILA 2B2UC 3CQZB 5FK9C 1HTLD 1CHQD 2RDFA 3BDCA 2A6ED 2RQXA 2PO4A 2KCNA 4I65A 4HMIA 5COYA 5CBAE 1I6VC 3OIPA 2B2VA 3CKIB 1O80A 1CI3M 1GHKA 3QJYA 1R9TB 5FO7B 2EYJA 2B8GA 3J7AV 3AB9A 3PIO3 5KNCA 4AYBB 2F0KA 1ZEQX 3P7JA 5KIXA 4ZUIA 2V4DA 3CRLC 2OF1A 1BBXC 1I4XA 4RGOS 5C3EB 4ZK9B 3OMGA 5C4ZA 2JEBI 1AZPA 4ULLA 1PRTD 2EE1A 4FYDA 3MAQA 3DWAA 3HOWB 3A54A 4IN3A 4IUPA 2WKDA 3Q22A 3NSWA 1BNZA 1S5CD 3I8ZA 2KEDA 2ENBA 3SE0A 5CV7A 3H09A 5E3FA 5D14A 3KBGA 5FO9B 2FJ2A 4JK1C 3L3OC 5M3FB 1K83B 3D4DA 4U673 2F0PA 2F0IA 1EEID 1WVLA 3BVGA 4U68A 5KNDA 4CKCA 3OWEB 2CQAA 3X3MA 3KLSA 4F87A 4ABNA 4DF7A 3P20A 3D3RA 4RAUC 3FPUB 3FRPB 1EIGA 1F2LA 1B9NA 3T13A 4TQUS 2LFNA 1PYWD 3H0GB 5CMDA 3D6WA 3E5SA 1K8MA 2LY7A 3K59A 4Y7NB 1KDBA 3IAYA 4J1MA 3W2DA 2F0OA 5IGFA 1SSOA 2HCIA 4X3SA 3C1FA 3S1QB 1QOHA 3VYRA 2PW7A 4L8JA 4RCNA 1LTSD 2XNAC 1AW7A 3FKIB 1A3VA 1LLRD 1UAPA 4IUUA 3OW7A 2KVMA 2K33A 3HZXA 5D3IB 2B39A 1SYGA 2K01A 3T4AC 1B2TA 1M4VA 1EZ8A 1KDCA 1JICA 3TN2A 1SNOA 2AWOA 1DOMA 1OXUA 1STGA 3RZOB 4BS9A 1A3UA 2BA1A 3K58A 1WTQA 2L4NA 4IFDI 3NP8A 1F2YA 4IZ8A 2RVLA 3DMUA 4Q5VA 1WD1A 2SOBA 3FPPA 3N52A 2NTTA 4H13C 1V1OA 2XIWA 4NMZA 5K5PA 3HP3A 4C3JB 4KJOA 2B2YC 4CKEA 3VR2A 4KN7C 2EDGA 2KCCA 4KJNA 5KGUA 5DNFA 1VDZA 4ID6A 5IT9E 4I7ZC 3S15B 2VB3X 1TS2A 5CBEE 3VR6A 1JOQA 5T1IA 2A6EC 2EY5A 2KJXA 3H6MA 1CK1A 4WRDA 3NXWA 4DXFA 3DWQA 2DY8A 2K5DA 1IL8A 3GTKB 3IFDA 4XTCS 1JWMD 5C0XJ 1ENCA 1ZXTA 1GUWA 4A3JB 1LT3D 2Y0SB 3F2UA 1PZJD 2ID0A 2WB1B 2LS01 4ZKBB 4YIJA 4QIWB 4LJZC 1CT1D 1PRTF 5F2DA 2XWBB 1PZID 3MXUA 2YYZA 3VYUA 3SEBA 5EKKA 2K5QA 3KUPA 2A5HA 2F0LA 4F7XA 5CYUA 3C3LA 1S5FD 3I70A 2F03A 2F4IA 2EY1A 2JXMB 3DEOA 1V1PB 1AP0A 3LWEA 2B2UA 1LTTD 1SJED 5E1FA 1DD2A 5JVG3 5J22A 5CGKA 2PQEA 4M1UB 2NN6H 2BCOA 1V8QA 1T5XD 4A3IB 5EKIA 1EY5A 3EVQA 3ONAB 1ET6A 1B4OA 2A74C 1Z47A 1MSGA 1ONLA 2WKCA 4LAAA 4A3GB 4EQNA 2QEJC 2BDNA 1CQVA 2B8FA 1QNUA 3TP6A 4UAIA 3T53B 1RHPA 4RA8A 1Q90A 5E4WC 1YNJD 1F9RA 1HQRD 2WAQB 1SNDA 2DNCA 1PTOF 3MHBA 3A7LA 1S5ED 1TR5A 1QCBD 1UNSA 4N9PA 1SYBA 5IT9L 1DM0B 2L11A 3D4WA 2D62A 3I3CA 2BOSA 5G3LF 4CJ2C 1B3AA 1U4PA 1Q1BA 3QWNA 2F0FA 3KF8A 1Z7TA 1QE6A 1SXTA 4NP5A 4IUNA 1ENFA 2C5CA 2RSNA 1BQQT 1VF7A 4O42A 1PZKD 4G4KA 2ZT9C 3D4RA 2NVTB 2OXPA 1EFID 4C3IB 3PUWA 2Q8IB 5JPNC 4A3FB 2X6LA 3BYYB 1O7YA 3K6OA 3CU7A 3BZDB 4RGMA 1SMYD 3PUYA 3HRZC 1WTPA 1HFNA 4IQZA 1U4MA 3J80E 1EOTA 3EROA 2JA5B 1ZYRC 1IKLA 3K57A 3X3NA 1H9MA 3RUZA 1TS5A 4KD4A 2PW5A 1SDFA 5I6WA 1F9QA 4DN4M 1JC7A 5IGBA 5A35A 2H4OA 2JP1A 5EGTA 1NAPA 1H9SA 4FP5D 3OIQA 1G291 5A2QL 3KLSX 1X3PA 3FMCA 1VMCA 3TDQA 3MA2B 4K5XA 1ML0D 2R7ZB 4A3DB 1R4PB 1ICWA 3MFYA 1J9OA 3A56A 3MVVA 3QOJA 4QUCA 4KKTA 3QG1A 5IIFA 5DEHA 5C6AA 1CM9A 3K7AB 1KDAA 3LX0A 4XQNA 1TIID 3NK9A 5C3XA 4RGNA 1D5MC 3MFGA 5KEEA 5C4XB 1SBBB 4DK0A 3NTHA 1OO9B 3PUZA 4K2KA 4DFAA 3SXHA 1T5EA 2EXZA 5KYIA 2QDBA 3S14B 4KY7A 2A68C 5FKAC 4P2CB 1GHJA 1HCZA 4FF4A 3SK5A 1YNNC 3TZDA 4X3KA 2KQ3A 5CORA 4FF3A 4RGTA 5TSSA 1NR4A 1HHVA 4C1NK 4LK1C 5BN3A 4N9TA 1OXSC 3HEJA 2IT1A 1TY0A 4K5VA 5EJWA 2D9UA 4C3JG 1CA6A 3BDLA 3TBIB 3E6ZX 3L7ZC 2N55A 5E4XA 1TWGB 1EYDA 1PFNA 1FGBD 2ZXPA 2N88A 1SYDA 2Z4HA 4BWGB 3LWUA 2JEAI 4J6HA 1OXXK 2HDLA 2A6HD 4L6TB 1SJHD 3NQTA 2PZWA 1BCPF 3S1RB 2F3WA 4CHTB 4HCEA 2AQ2B 1OXTA 1PRTC 2NWGA 1TWFB 1FYCA 4V0BA 3R93A 4PMBA 1H9JA 1SYFA 2J4XA 4BY1B 5ELBA 2CW0C 2L9HA 1WTVA 1SNPA 2PMZB 2I07B 2F3VA 2WV6D 4TKOB 3FDTA 1F9PA 2Z1CA 3MXPA 4A3KB 3P1HA 2K1BA 5KYLA 2JE6I 4RH6A 3NTIA 1DZ1A 2NVXB 1F2ZA 3RZDB 3DUZA 3C1EA 1JCKB 2O4XA 5DAUA 4IUVA 1E2ZA 1SFOB 5LL6S 1D2BA 3J81E 5C5LA 1EWCA 4KN4C 4CJ1B 2FHTA 3U9SA 2MJ8A 1DOLA 3K5LA 4BY7B 3QOLA 4HTHA 1LO5D 1GUSA 2A69C 1PFMA 5CV4A 4BA2I 3BVZA 3V2TA 1EY7A 1GJXA 4CBVA 1BCPC 2B2YA 4BBSB 3Q0AA 1I4GA 3JAML 5K36G 2GA4B 2E2HB 4NKLA 3S2HB 2FMMA 3SK6A 4RHRA 4OO1H 2A73B 3A7AB 1LTAD 2NTSA 4K5WA 2E74C 1Y69U 3K5MA 5M5XB 1FNWA 1LT6D 1W6KA 3VR5A 2X69A 1RKNA 5C0XI 1A6XA 2AWNA 1B1ZA 3URYA 5IGEA 4B08A 1FNUA 1SNCA 1VCIA 4QUFA 1RODA 3GTQB 4BBRB 1WD0A 5IGGA 5DM73 3WOFA 2RDHA 4E6IA 2F0MA 2KOLA 1PTOH 3KBXA 3BS1A 4S3SA 4DAVA 5JEAH 2M2LA 4FVMA 1I4HA 4K8IA 4FXDA 3GV3A 2JA7B 2DY7A 3SR1A 1RTNA 5A2QE 1AFPA 1NCVA 1BDOA 2OT2A 3MXNA 1QNKA 3A8KE 1BUVT 2KUMA 5I2XA 5I9OA 1UUPA 3PIP3 2R6GA 5I4DA 3VYTA 3NBHA 4QB4A 2YU9B 1STBA 2FFKB 2M9VA 1I3QB 2XSCA 2XRSD 2SDFA 1B9MA 3MZ5A 2FMCA 1S5BD 5EPLA 1IYVA 1AEXA 1EY6A 2Z4IA 5ELCA 5FOBB 5FO8B 2L1BA 3VR3A 3J80L 2CVRA 4KMUC 4RCOA 3AU7A 4IURA 1B53A 2JA6B 1SYCA 4F8MA 4ME5A 1I6HB 3M85A 1BO0A 1M8AA 3PMFA 1W6JA 3NBIA 5NUCA 3LNNA 2F0VA 2L5TA 1GUGA 3RLFA 4DNTB 5K36H 5M5YB 1STYA 1EY9A 2TMPA 2FINB 2VNUD 5C44B 2EJMA 3M7NA 4HSVA 1MSHA 1G6ZA 4TSSA 4IFDG 1LT5D 1LABA 3A8IE 4DAPA 5JVH3 1LTID 2B2WC 1JE4A 4OHJA 4XT3B 2XVSA 2EYOA 4IALA 2XWJB 4UDUC 4H7BA 5HURA 1TWAB 1IYUA 2RA4A 2JSOA 4RFBA 1C4QA 2R3ZA 2M00A 5KNBA 2DNEA 3TP5A 2O5IC 3NUCA 2A68D 2OEOA 3K5NA 3SK4A 2EOTA 3R8BA 4K6LA 1A15A 3BVMA 1LTBD 3H91A 5FLXL 1F9SA 1KLGD 1SNMA 2AUKA 2K05A 1QB5D 3DM1A 5JJZA 3N6RA 2NVQB 4KD3A 3I4LA 2Q8RE 2AQ1B 1ET9A 2IWHA 4C3HG 2E2DC 1VMPA 1TU2B 2K32A 2RKSA 4MHEA 3SDZA 1XX8A 2IL8A 1CZWA 1ZYRD 1ILPA 1R4QB 3OMCA 1GUNA 5EBDA 1PTOD 4DGZA 5C0XG 2A6HC 1I4PA 1E0BA 3GP7A 2F0EA 1LV9A 3OPOA 5IODA 1TS4A 1PTOC 4FF2A 3RD4A 1H9RA 1A3TA 1STHA 5CV8A 3HOYB 3ERQA 3GO5A 2EJGC 3TMEA 3S17B 1DOKA 4DNRB 5LL6X 2EVBA 1NSNS 3QO2A 2CW0D 5FLXE 2C9OA 3NTKA 1G2TA 3QIAA 1PDQA 2F0SA 3NQIA 4H0LC 3VR4A 2BE5C 2F0DA 2D5DA 3R2IA 1XXGA 3I4NB 4FXKC 4Z9CB 1OXVA 1KABA 2VB2X 1O7ZA 3Q6SA 1IW7C 2G9HD 1X3QA 4PMWA 1BXTA 2L0CA 3WDNA 5CR3A 5BN4A 2IJ0A 2R92B 2DN8A 1SE3A 2ZXOA 4C56C 4RKBA 2MUYA 4IUQA 2J0TD 4EGVA 1EQVA 1GUTA 4O1NA 1HQMC 1UEAB 3A55A 2A69D 3IFTA 5IGDA 1I4RA 1F77A 3H94A 3K5OA 1D5XC 1RF2D 1JQYD 1BOSA 3AMUA 2BE5D 5BN5A 2IW3A 1LTRD 2AQ3B 2PPBC 3R2TA 1LT4D 1AZQA 3GD7A 2Z8LA 3OSOA 3NPPA 5JAVA 2B2WA 5EBCA 1PTOB 4C2MB 1PMRA 3HOXB 1NUCA 4WFN3 3J7YW 2NBFA 5ISRA 3I73A 2RBMA 2KHSA 1DYQA 3FEWX 4ZYSA 3J7AF 4DU9A 2KECA 4PV1C 4MN3A 1HXYD 1U4LA 2D2CC 3PUVA 1EL0A 5C5MA 3GTJB 4KHZA 2LKVA 1KLUD 4OGQC 1QWYA 1SE2A 1TWHB 2EY6A 4ZKCB 4A3BB 2F0WA 4XXEA 5CC4A 1G91A 1JOKA 3V96A 4KK7A 4B9WA 4G7OC 1EY4A 3OHXC 1C48A 4R8IA 1LTGD 2F0JA 2O2LD 1SYEA 2NZ1D 3TP8A 4IFDH 2NYZD 3D6CA 2WIIB 3S2DB 3O13A 1CA5A 1B50A 1CFMA 3ITPA 1MGSA 1EY8A 1PFBA 1HPCA 3HG9A 3EFXD 4XQQA 4HAEA 2EYLA 4XDXA 1CTMA 2VUMB 1D6EC 2WACA 1IKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A V;  3J81 L;  3J80 L;  5FLX L;  5IT9 L;  5LL6 X;  5A2Q L;  3JAM L; 
#chains in the Genus database with same CATH topology
 4GNX C;  2R7F A;  3NWT A;  5IOC A;  1JOO A;  2CH4 A;  2LMC B;  4DA2 A;  1RTO A;  2KA7 A;  2ZXR A;  3DEP A;  1EU3 A;  1MI2 A;  3DXJ C;  1HR0 Q;  4IOA A;  3SHL A;  1HA5 A;  4H44 C;  2ICE C;  1YIT A;  4JI1 L;  4GOP A;  2K03 A;  4PQX A;  1BCP D;  3GTO B;  2E2I B;  4A3M B;  4LFB Q;  1TWG H;  3E0J A;  1H9S B;  4X64 L;  5AFW A;  2DGY A;  1YNJ C;  3MTS A;  3ULJ A;  1XJV A;  1J5E Q;  1XWE A;  4K8J A;  1FL0 A;  1SRU A;  1Y8O B;  1ESR A;  4YCU A;  3U50 C;  3BDO A;  1EWH A;  1Q12 A;  5JEA G;  4JV5 Q;  5LMU L;  2ICI A;  4MTK A;  4KLK A;  1LM0 A;  3TP7 A;  3HOU B;  3SK8 A;  2K5W A;  3D8G A;  1HNX Q;  4DV5 L;  1X32 A;  1Q81 C;  3M4O B;  2OCE A;  1G2S A;  3F2D A;  2JYO A;  3FP9 A;  3HKS A;  2EYP A;  4CKB A;  3T16 A;  2KEE A;  4LF9 Q;  4R9W A;  2R93 B;  1C0A A;  1B70 B;  1QIL A;  4NXN L;  4AQY L;  1VQA A;  2G5D A;  2N78 A;  5M3M B;  1N34 Q;  1EYA A;  1RCV D;  5M5W B;  3GTL H;  1V1P A;  5C4H A;  3CCU A;  1J8I A;  2HQL A;  3EJI A;  5T1G A;  1S5D D;  2YV5 A;  1YEZ A;  1Y8P B;  1WTX A;  5J3B A;  4UP9 A;  4O2D A;  1TVX A;  3P75 A;  3D31 A;  1SMY C;  4X3U A;  5IGC A;  4DXG A;  2MQH A;  5LHY 1;  2L12 A;  1KC8 C;  1XNR L;  1TWC B;  2RDG A;  3IKJ A;  1SMX A;  4DK1 A;  3PF4 A;  2B2V C;  4LF5 L;  4YCW A;  1O78 A;  2CQO A;  2HHH Q;  1V43 A;  2VQF Q;  2I46 A;  3DWP A;  3C46 A;  2WP8 J;  4XT1 B;  3HS0 C;  4G7Z C;  1ESF A;  1HJP A;  1YI2 A;  3HOV H;  1ENA A;  2MO1 A;  4JI0 Q;  1HRJ A;  4A3K G;  3WOE A;  3IL8 A;  3SVM A;  4ZRZ A;  3I91 A;  2WB1 E;  2H1E A;  3U4V A;  2VQE L;  4A76 A;  5EKL A;  4GKJ Q;  3J7Z C;  1WTW A;  5JPM C;  3HOU H;  3PO2 H;  4B3T L;  3S16 B;  5G3L D;  3OOC A;  3T51 B;  4DR4 L;  2NUC A;  2KCT A;  1TY2 A;  2IHF A;  4K14 A;  2NN6 I;  2IX0 A;  3HOY H;  4B3T Q;  1I50 B;  4XYO A;  1L0Y B;  4YWK A;  2K4K A;  4CGY B;  2F0U A;  3TSS A;  4HED A;  5CV6 A;  1EU4 A;  4XYQ A;  2ZJP A;  4ZAI A;  3K0Y A;  1WI5 A;  2MP1 A;  2QKI C;  5M3F G;  1X9N A;  3Q23 A;  3TS2 A;  2WFW A;  1FR3 A;  4XIG S;  2UXC Q;  4LFA L;  2EYH A;  2SEB D;  1MBY A;  5EPJ A;  4A3L G;  4AYB E;  1B44 D;  2E76 C;  2UUB L;  1HFG A;  3G7L A;  4YY3 Q;  2IPK D;  2WIN B;  3ND9 A;  3CF5 A;  1D1K A;  4DV0 Q;  3T56 B;  1IW7 D;  3W5O A;  3KF6 B;  4OIJ A;  5IP7 H;  1A2U A;  3CD6 A;  1RDP D;  5CV5 A;  1BCP B;  2HCC A;  3RZO H;  2Z6K C;  3EN2 A;  1B7Y B;  1CHP D;  2F4V L;  4NXM Q;  1VQF A;  4C3J H;  4TRD A;  4KI0 A;  2JA5 H;  4FXG C;  3AFQ A;  3UDX A;  5ELF A;  1NMG A;  4OL7 A;  5D65 A;  4LUV A;  2G9D A;  4NXN Q;  3KLW A;  2N8N A;  2A8V A;  4RMF A;  1EQQ A;  2HQE A;  4KV6 A;  3QB3 A;  4ZQ3 A;  1AN8 A;  3PUX A;  4BBR G;  5IWA Q;  1FD7 D;  1TWH H;  1X6O A;  4IUT A;  2RSO A;  4ODG A;  4NPS A;  1PLF A;  1KNE A;  1GXD C;  3ZYY X;  5I6Y A;  1HNX L;  4CJ0 B;  3I72 A;  2CH4 W;  1IHZ A;  2L55 A;  3G6J B;  1MD2 D;  3I4N G;  4QMG A;  1A8V A;  4BBR H;  2EY2 A;  1U4R A;  1SN8 A;  2Y0S E;  3W3A A;  3KK7 A;  5J39 A;  4PMC A;  2BA0 A;  3S1N B;  4G57 A;  3PCO B;  2JA7 H;  4JI1 Q;  1Z9F A;  3I4M G;  4PZ7 A;  4GNX B;  4N8F A;  1QZH A;  1WOC A;  3PO3 B;  1HA6 A;  1KRT A;  1HTP A;  3KLR A;  3GTP B;  4BXX H;  3CRK C;  4ZUJ A;  1EIH A;  4FF1 A;  3OWF A;  2QA4 A;  2K28 A;  4R4C A;  3H3V C;  1JWU D;  1YJW A;  1WCM B;  3GTM B;  5AJ3 L;  4IO9 A;  1DXM A;  3A8J E;  3M4P A;  1D5Z C;  2Q8T A;  1JJG A;  1TQO A;  4R8N A;  4JI8 L;  1JJ2 A;  1B8A A;  4A93 H;  2XN9 C;  2OQ0 A;  4QCL A;  3CP0 A;  2PNR C;  4Q0F A;  5C3W A;  3HOZ B;  2CHB D;  4FNF A;  1XPO A;  1QG7 A;  4NDX A;  4HR7 B;  1AE2 A;  1SEB D;  1SR3 A;  3VYS A;  1WTH A;  4LMQ D;  2GVA A;  1BF4 A;  4X3T A;  5LMN L;  3HFZ B;  4P74 A;  1GVP A;  4R4I A;  4GNX A;  3E9I A;  4NW2 A;  1KAA A;  4HJ5 A;  2B63 G;  1O7L A;  4KHV A;  2UUC Q;  1D1I A;  4V19 0;  2CWA A;  2J7Z A;  1IXR A;  2I0Q A;  4OIK A;  3V05 A;  3DLL A;  1TWF H;  1STN A;  4ILW A;  3GTJ H;  1PV4 A;  3EA6 A;  1SAP A;  3J80 c;  1WCM G;  1Y1W B;  4H02 A;  1TKW B;  1K8O A;  2K6A A;  5IP7 G;  1NR2 A;  1RD9 D;  2R61 A;  2QF7 A;  2F0G A;  3MEH A;  4EQP A;  4JC0 A;  1K0S A;  1F2M A;  4JBK A;  1N34 L;  2IX1 A;  2SNS A;  4DPG A;  5DM6 3;  4WJW A;  4EQO A;  3GTL B;  4X62 Q;  5M3M H;  4JBJ A;  3PIP A;  2NVY B;  1KTK A;  2I5L X;  3C2P A;  3M4Y A;  4M8A A;  2VUM G;  1Q3L A;  3L9A X;  1VQ6 A;  2X6G A;  3FVQ A;  5CV9 A;  5ELE A;  5C3E H;  5ELD A;  1Y8N B;  4C1N I;  1ZKO A;  4A93 B;  1EYG A;  1Q8I A;  4QJF A;  4O0A A;  1GUO A;  4X65 L;  4QF4 A;  4KY5 A;  5GAH C;  4DR1 Q;  4BA1 I;  2ZTE A;  3CC4 A;  4HMJ A;  1ICF B;  4A3E B;  1STE A;  4JI5 Q;  1LAC A;  1VQB A;  1VQM A;  3U9O A;  3I4N H;  2B2T C;  2EJF C;  1WJJ A;  1H9K A;  4A3J H;  4A3M G;  4JI6 L;  1VQP A;  4B3M Q;  2PZT A;  1D7Q A;  3M4Q A;  3GTG B;  1U0L A;  1IBK Q;  1XNQ Q;  3PO2 G;  4C3I G;  2XRQ D;  2PZU A;  1B3Q A;  1PH1 A;  1HR0 L;  1CKN A;  3I4M B;  4A3M H;  4WOR A;  1Q1E A;  3S24 A;  4K0K L;  1K3B C;  2F1M A;  1CZG A;  2PYK A;  1EYC A;  1X56 A;  1QJO A;  3MC0 B;  4YWM A;  5JOB A;  2F4V Q;  2UXD Q;  3JAM E;  2K04 A;  4JI4 Q;  1E2W A;  4GN3 B;  1E2V A;  3EIV A;  2B2T A;  4HSP A;  1SE4 A;  1RJT A;  1S4Z A;  4C3H B;  1DON A;  4J8Q A;  1XTC D;  3S14 H;  3RN5 A;  2EYM A;  2EYF A;  4JBW A;  4APV A;  2MHV A;  3S9W A;  2QDL A;  1JR0 D;  3GQB A;  3CHB D;  4IPG A;  2EPB A;  5EPK A;  1JB3 A;  2F0Q A;  4K2L A;  4L5R C;  3J81 L;  3I55 A;  1PRT B;  1HUM A;  4XQJ A;  4GKK L;  4PNY A;  1GD7 A;  5GAE C;  3Q24 A;  2B63 B;  2IX3 A;  5C4J H;  4LF8 Q;  5C4J B;  5I2Y A;  3SGI A;  4DR3 L;  2B63 H;  5JEA J;  4G7H C;  4Y52 H;  5I9P A;  3R3O A;  1G6P A;  4GZY C;  4K6D A;  1STA A;  2DJF C;  4ALP A;  4HN7 A;  3UI2 A;  3HGB A;  1KNA A;  2Q2H A;  1JOR A;  1WCM H;  3GTM H;  1XYI A;  1P16 A;  4MIU A;  5EQ0 A;  5H1S E;  1JWS D;  3VA5 A;  3EQL C;  3NHH A;  5J1Z A;  1WTO A;  3NE5 B;  2F0T A;  2E2J B;  1X3E A;  3GTK H;  1L2F A;  4LF7 Q;  3HOZ H;  1L0X B;  1I4Q A;  3HOU G;  3HKZ B;  1NJI C;  2QCP X;  1QVG A;  4JVZ A;  1C8C A;  5C4X H;  2MFI A;  3PV0 A;  1SNQ A;  2NB0 A;  1PXU A;  4JI3 L;  4RKL A;  1TS3 A;  1DCZ A;  3ULL A;  5C3E G;  3S1M B;  2NN6 G;  5IY0 A;  1N9W A;  2BDO A;  4RG1 A;  4GS3 A;  1JJC B;  4KKU A;  1Y1V B;  1EZ6 A;  2AUJ D;  1S40 A;  3ND8 A;  3TZU A;  1WTR A;  3S15 H;  1ILQ A;  3MWY W;  4L63 B;  2F0H A;  4IPH A;  5IYD G;  4HIK A;  4LF4 Q;  4EQ5 A;  1HNZ Q;  3JC6 6;  1KXL A;  3PO2 B;  3CCR A;  4JBM A;  2EQS A;  1II3 A;  3DHQ A;  1G8Z D;  4FO2 A;  4A3L H;  2YTX A;  1VF5 C;  4EVO A;  3HOV B;  1FNV A;  5M9O A;  2GN5 A;  4JI7 L;  1GOZ A;  1I50 H;  2AHO B;  3J81 i;  4JW0 A;  4KY6 A;  3EBE A;  2KEN A;  1DJR D;  2LXK A;  1UE1 A;  1EFW A;  1NNX A;  4OX9 L;  2TSS A;  4DV5 Q;  2O5J C;  2E2J H;  4OWT B;  2EZV A;  1YNN D;  2MPM A;  5HGT A;  3S16 H;  2A19 A;  4KTA A;  1Z6H A;  3CCS A;  2HUG A;  4DAY A;  1A2T A;  3M3Y B;  4IFD J;  1HZC A;  3GV6 A;  4BBS G;  1TT2 A;  3BG3 A;  4YCV A;  3JAM i;  3VA7 A;  1DGS A;  2HDM A;  2JA6 G;  2K7V A;  2SNM A;  3MXG A;  4LFB L;  1HUN A;  4DV7 L;  4DV4 Q;  4B9X A;  3KJO A;  2VXW A;  4DR5 Q;  2E75 C;  2ZJQ A;  1FVI A;  4HCS A;  2PCF B;  1CQF A;  2WAQ E;  5D3D A;  4F88 A;  4RWS C;  2MGS A;  1U9R A;  4ZLT F;  1VQK A;  1EQT A;  1NE3 A;  4OON A;  4OO1 I;  3NWS A;  2JA8 B;  2RCF A;  3M7G A;  3A5Z B;  1EEF D;  5FJ8 H;  2CCZ A;  3QR8 A;  3BYT B;  5KRU A;  2ZM6 L;  5GQO A;  4OO1 G;  4RHS A;  1KL9 A;  2F0N A;  3I90 A;  1BR9 A;  4KKS A;  5C0X H;  5FLX c;  4OWW B;  3RMH A;  1EY0 A;  3E9H A;  1L1O A;  3FKI H;  3AEV A;  2AMC B;  2QIL A;  2B2U C;  3CQZ B;  5FK9 C;  1HTL D;  1CHQ D;  2RDF A;  3D0F A;  3BDC A;  2A6E D;  2RQX A;  3PQI A;  2P5Z X;  2PO4 A;  4N8X 1;  2KCN A;  4I65 A;  4HMI A;  5COY A;  5CBA E;  2XGT A;  3M4O H;  1C9O A;  2B3G A;  1I6V C;  3OIP A;  3GDE A;  2B2V A;  3CKI B;  4C3I H;  1O80 A;  1CI3 M;  1GHK A;  2DUD A;  3QJY A;  1RIP A;  3ER0 A;  1R9T B;  2EYJ A;  2B8G A;  5FO7 B;  1N32 L;  5C44 H;  2K75 A;  4UP8 A;  3J7A V;  1E7Z A;  3AB9 A;  3PIO 3;  1UEB A;  4DV6 L;  5KNC A;  4AYB B;  2F0K A;  4DV2 Q;  4UY8 C;  1ZEQ X;  2AKW B;  3G4S A;  3P7J A;  1W2B A;  5KIX A;  4ZUI A;  3K7A H;  2V4D A;  5E7N A;  3RLN A;  2JJQ A;  4LF6 L;  3CRL C;  2OF1 A;  2C35 B;  1BBX C;  1I4X A;  4RGO S;  4DAM A;  5C3E B;  4ZK9 B;  1NMF A;  3OMG A;  5C4Z A;  2JEB I;  4QQB X;  2RF4 A;  1I6H H;  1AZP A;  4ULL A;  1VQI A;  1PRT D;  1QVC A;  2EE1 A;  2QGQ A;  4X65 Q;  4FYD A;  2R7Z H;  3MAQ A;  3DWA A;  3F2B A;  4LUO A;  4DUZ L;  3HOW B;  3CCQ A;  3A54 A;  4LWC A;  4IN3 A;  4IUP A;  2WKD A;  4CDC C;  2N3S A;  3Q22 A;  4P73 A;  4FDB A;  3NSW A;  1BNZ A;  4BY1 H;  1S5C D;  3I8Z A;  2UXB L;  2WB1 G;  2UXC L;  2CKZ B;  2KED A;  4B3S L;  2ENB A;  1PH6 A;  1SLJ A;  3SE0 A;  5CV7 A;  3H09 A;  5E3F A;  5D14 A;  2F3I A;  1CKO A;  1BKB A;  3KBG A;  5FO9 B;  2FJ2 A;  4JK1 C;  2JA5 G;  1UWV A;  3L3O C;  1RL2 A;  2BH8 A;  5M3F B;  3KJP A;  1K83 B;  3D4D A;  4DR4 Q;  4U67 3;  2F0P A;  2F0I A;  3STB C;  1EEI D;  1WVL A;  1WFQ A;  4Y7N H;  4GKJ L;  3BVG A;  4A3G H;  4U68 A;  5KND A;  4CKC A;  3OWE B;  2CQA A;  3X3M A;  3KLS A;  1VQJ A;  5LMN Q;  4QGU A;  4LNQ A;  3G6E A;  4F87 A;  1MHW C;  3CAM A;  3S1N H;  2I5H A;  4ABN A;  4DF7 A;  3P20 A;  3D3R A;  4RAU C;  2VQF L;  3FPU B;  3FRP B;  1EIG A;  1F2L A;  1B9N A;  3T13 A;  4P75 A;  4TQU S;  2LFN A;  1PYW D;  4JPB W;  1NTG A;  1XNR Q;  3H0G B;  1CSQ A;  5CMD A;  3D6W A;  3HOY G;  3I4M H;  3E5S A;  4KHP L;  1K8M A;  4A3E G;  1HZ9 A;  2LY7 A;  4GLV B;  3K59 A;  4Y7N B;  1KDB A;  2E8G A;  4JOI A;  3IAY A;  4J1M A;  1HNW L;  3W2D A;  2F0O A;  5IGF A;  1SSO A;  4POF A;  2HCI A;  4X3S A;  3C1F A;  3S1Q B;  1QOH A;  3RR5 A;  3VYR A;  2PW7 A;  1K83 H;  2DJG C;  4L8J A;  4RCN A;  1LTS D;  2XNA C;  5IYB H;  4X66 Q;  1AW7 A;  4HID A;  3FKI B;  1A3V A;  1LLR D;  3CMA A;  5IE8 A;  1UAP A;  4IUU A;  2WAQ G;  3Q8D A;  3JAM c;  3OW7 A;  2KVM A;  2K33 A;  3HZX A;  5D3I B;  5IYB G;  2B39 A;  1SYG A;  1PA6 A;  2K01 A;  5LMU Q;  2JA9 A;  3T4A C;  1B2T A;  1M4V A;  1EZ8 A;  1KDC A;  3UDF A;  5IWA L;  1JIC A;  1J5E L;  2JK8 A;  3TN2 A;  2R92 G;  1SNO A;  2AWO A;  1DOM A;  4TVA B;  4X64 Q;  3K81 C;  3NEL A;  3UE0 A;  1OXU A;  1STG A;  3RZO B;  5JJI A;  3S17 H;  3TRE A;  4BS9 A;  4QIW E;  1A3U A;  5C4X G;  2BA1 A;  3K58 A;  1WTQ A;  1XMQ Q;  1MKH A;  2L4N A;  4IFD I;  3S1M H;  3NP8 A;  1F2Y A;  4IZ8 A;  1JT8 A;  2RVL A;  2NVT H;  4MTN A;  3DMU A;  5IP9 H;  4Q5V A;  1XPU A;  1NBW A;  1IBL L;  1WD1 A;  2SOB A;  3FPP A;  3N52 A;  1TWA H;  3AFP A;  2NTT A;  1XMO L;  4H13 C;  1V1O A;  2XTI A;  1ASZ A;  4A3G G;  2XIW A;  4NMZ A;  5K5P A;  3HP3 A;  2ZTD A;  4KJO A;  4C3J B;  2Q2I A;  1YJN A;  4P72 A;  4LFA Q;  2B2Y C;  4CKE A;  3VR2 A;  1VQ5 A;  4KN7 C;  2EDG A;  2KCC A;  2PQA A;  4A4I A;  5HY6 A;  5GAD C;  4KJN A;  5KGU A;  1MJE A;  5DNF A;  1VDZ A;  2Z0S A;  4ID6 A;  2MO0 A;  5IT9 E;  4I7Z C;  4LFC L;  3S15 B;  2VB3 X;  2N49 A;  1TS2 A;  5CBE E;  4A3I H;  3VR6 A;  1JOQ A;  5T1I A;  1FJG Q;  3PGZ A;  2A6E C;  2EY5 A;  1S72 A;  2KJX A;  1Q46 A;  2Z6K A;  1GM5 A;  3H6M A;  1CK1 A;  4WRD A;  3NXW A;  2KCM A;  2ALY B;  1MIU A;  4DXF A;  5JJL A;  2JA6 H;  4DV1 Q;  3DWQ A;  2DY8 A;  4JI0 L;  2K5D A;  1IL8 A;  3GTK B;  3IFD A;  2R7Z G;  4XTC S;  1TWC H;  1JWM D;  4DV3 Q;  1VQC A;  5EAY A;  1PFS A;  5C0X J;  1ENC A;  3U58 A;  1ZXT A;  2CFM A;  1VQ7 A;  1GUW A;  5FLM H;  4A3J B;  1LT3 D;  2Y0S B;  2ZTC A;  5GRO A;  3F2U A;  5IYC G;  4PZ6 A;  3I4O A;  1PZJ D;  2ID0 A;  2WB1 B;  3RNU A;  2LS0 1;  2KHJ A;  4ZKB B;  4YIJ A;  4NB3 A;  1HR0 W;  4QIW B;  4LJZ C;  1S3O A;  2F52 A;  1CT1 D;  1PRT F;  5F2D A;  2R93 G;  2XWB B;  1PZI D;  3CPF A;  3MXU A;  2RCN A;  2YYZ A;  4DK6 C;  3VYU A;  4LF6 Q;  3SEB A;  5EKK A;  2K5Q A;  4DV2 L;  4GLA C;  1G51 A;  3KUP A;  2A5H A;  1T9H A;  2F0L A;  4F7X A;  5CYU A;  2ASB A;  1K0R A;  3C3L A;  1S5F D;  1PH2 A;  3I70 A;  2F03 A;  1Y14 B;  3T1H Q;  5JJK A;  3FHW A;  2F4I A;  2EY1 A;  2JXM B;  3DEO A;  1QUQ B;  2UU9 Q;  1V1P B;  3T1Y L;  1AP0 A;  2QW7 A;  3LWE A;  2B2U A;  1LTT D;  1SJE D;  5E1F A;  2NVY H;  1DD2 A;  4HJ8 A;  5JVG 3;  4L5S A;  5J22 A;  5CGK A;  3KYH C;  2PQE A;  4M1U B;  3K7U C;  2NN6 H;  1A62 A;  2BCO A;  3OYY A;  1V8Q A;  5LMN W;  1T5X D;  4A3I B;  5EKI A;  1EY5 A;  2Z9H A;  3EVQ A;  3ONA B;  1ET6 A;  1B4O A;  2A74 C;  3IRB A;  1K73 C;  1Z47 A;  3GTG H;  3B6Y A;  1KQS A;  3TQY A;  4DR2 Q;  2D0P A;  3TRZ A;  1MSG A;  1ONL A;  2WKC A;  1SRO A;  1X3F A;  4LAA A;  2HT1 A;  4KHP Q;  4A3G B;  3J80 i;  3G71 A;  4EQN A;  1UE6 A;  2QEJ C;  2BDN A;  4IJH A;  1CQV A;  4PZ8 A;  3S1R H;  4CDE C;  2B8F A;  1QNU A;  3I2Z A;  3TP6 A;  4UAI A;  3T53 B;  4DV4 L;  1RHP A;  4RA8 A;  1Q90 A;  3UDI A;  1K28 A;  5E4W C;  4HJA A;  2UUA L;  1YNJ D;  1F9R A;  1HQR D;  2WAQ B;  4EX5 A;  2YTV A;  1VS0 A;  4A3C H;  1SND A;  1Q7Y C;  2DNC A;  1PTO F;  3MHB A;  1NY4 A;  3A7L A;  3L2P A;  1S5E D;  1TR5 A;  2B29 A;  2ATW A;  4CDF C;  2YTY A;  1BBU A;  4UHV A;  4ME3 A;  1QCB D;  1UNS A;  4N9P A;  1SYB A;  5IT9 L;  3J81 j;  1DM0 B;  2L11 A;  2PI2 A;  3CCJ A;  3D4W A;  2D62 A;  4JI2 Q;  3I3C A;  2NVX H;  2BOS A;  2R93 H;  5G3L F;  4CJ2 C;  2Q2U A;  2K5V A;  3ULP A;  3CCM A;  1B3A A;  1U4P A;  1Q1B A;  3QWN A;  2F0F A;  3STB D;  3KF8 A;  1Z7T A;  5IP9 G;  1QE6 A;  1SXT A;  3CME A;  4NP5 A;  4IUN A;  3NEN A;  1ENF A;  2C5C A;  2RSN A;  2UXB Q;  1BQQ T;  3H0G G;  3HOX H;  1K8A C;  1VF7 A;  3I7F A;  4O42 A;  1PZK D;  4G4K A;  2ZT9 C;  3D4R A;  3I56 A;  4JI3 Q;  4BXX G;  2OXP A;  2PI2 E;  1EFI D;  4C3I B;  2NVT B;  3PUW A;  2Q8I B;  5JPN C;  4WJ3 M;  4LUZ A;  4A3F B;  4DV3 L;  2X6L A;  4DR7 L;  3BYY B;  1E1T A;  1O7Y A;  3K6O A;  3AYH B;  3CU7 A;  3BZD B;  1SMY D;  4RGM A;  1M1K C;  3PUY A;  3HRZ C;  1WTP A;  1HFN A;  4IQZ A;  1U4M A;  3MEF A;  3J80 E;  1EOT A;  3ERO A;  3VDY A;  2JA5 B;  3RLO A;  1ZYR C;  1IKL A;  3K57 A;  3X3N A;  1H9M A;  3RUZ A;  3W1B A;  1TS5 A;  4KD4 A;  1K8G A;  1E1O A;  2ZJR A;  4B3R Q;  1XPR A;  4C2M H;  1N33 Q;  4JI2 L;  2PW5 A;  1SDF A;  1I3Q H;  1L0W A;  1PH5 A;  5I6W A;  4LFC Q;  1F9Q A;  2E2H H;  4DN4 M;  1JC7 A;  5IGB A;  4C3H H;  5A35 A;  4ZCK A;  4YHH Q;  2H4O A;  2JP1 A;  3H15 A;  5EGT A;  4A3B G;  1NAP A;  1H9S A;  4FP5 D;  3OIQ A;  1G29 1;  5A2Q L;  2VZA A;  3KLS X;  1X3P A;  3FMC A;  3S1Q H;  1VMC A;  3TDQ A;  5M5X H;  3UDG A;  4J15 A;  3MA2 B;  2KHI A;  4K5X A;  1XMO Q;  1CKN B;  1Y1V G;  1ML0 D;  2R7Z B;  4A3D B;  1R4P B;  3J7A 5;  4AYB G;  1L1O C;  1ICW A;  2K50 A;  3MFY A;  1J9O A;  3A56 A;  3MVV A;  3QOJ A;  2UXD L;  4QUC A;  4KKT A;  3F1Z A;  3QG1 A;  5IIF A;  1N33 L;  5DEH A;  1K9M C;  1Y1V H;  5C6A A;  1CM9 A;  3K7A B;  4I7A A;  1KDA A;  3LX0 A;  2NVQ H;  4XQN A;  1PH8 A;  1EWI A;  1TII D;  1PVO A;  3NK9 A;  3HOV G;  5C3X A;  3HOW G;  4RGN A;  1D5M C;  2K5H A;  3K80 C;  3MFG A;  5KEE A;  4R4T A;  5C4X B;  1SBB B;  1HH2 P;  3NTH A;  2PMZ E;  4DK0 A;  1OO9 B;  3PUZ A;  4K2K A;  4DFA A;  3SXH A;  1T5E A;  3PIO A;  2MNA A;  1VQL A;  2EXZ A;  5KYI A;  2BH2 A;  2QDB A;  3S14 B;  4KY7 A;  1O7I A;  2A68 C;  2QEX A;  5FKA C;  3GTQ H;  2NZH A;  2UU9 L;  4P2C B;  1GHJ A;  1IBM Q;  1HCZ A;  4FF4 A;  3SK5 A;  3CC7 A;  2LSS A;  4X66 L;  1YNN C;  3TZD A;  4X3K A;  2KQ3 A;  5COR A;  4FF3 A;  3BZK A;  4RGT A;  5TSS A;  1EIY B;  1NR4 A;  4LF4 L;  1HHV A;  4C1N K;  1IZ6 A;  4LK1 C;  5BN3 A;  1HNW Q;  4N9T A;  1OXS C;  5IYC H;  3CCE A;  5IT9 c;  1JE5 A;  1CUK A;  3HEJ A;  2IT1 A;  3F2C A;  1TY0 A;  4K5V A;  5BR8 Q;  5EJW A;  4BBS H;  3CQZ H;  2D9U A;  4C3J G;  1BVS A;  1CA6 A;  3BDL A;  3TBI B;  3E6Z X;  3L7Z C;  2N55 A;  1UE7 A;  5E4X A;  1KRS A;  2HIV A;  1TWG B;  1EYD A;  1PFN A;  1FGB D;  2D0O A;  2ZXP A;  2JA8 G;  2N88 A;  4UPA A;  1I94 L;  1X55 A;  1SYD A;  2Z4H A;  3KFU A;  1E22 A;  4BWG B;  4JI8 Q;  3LWU A;  2JEA I;  4R1J A;  1GKH A;  2CWP A;  2Y0S G;  2R92 H;  4J6H A;  5GAG C;  1OXX K;  3A0J A;  2HDL A;  2A6H D;  4L6T B;  1VQ4 A;  1VQG A;  1Q82 C;  1SJH D;  3NQT A;  2PZW A;  4DAY B;  1BCP F;  3S1R B;  2F3W A;  4CHT B;  4HCE A;  4MZ9 A;  3H3V I;  2AQ2 B;  1OXT A;  1PRT C;  2NWG A;  3FKI G;  1TWF B;  1M90 C;  1FYC A;  4LF8 L;  4V0B A;  1HZB A;  3R93 A;  4PMB A;  3KDF A;  1H9J A;  1SYF A;  2J4X A;  4GKK Q;  4BY1 B;  5ELB A;  2CW0 C;  4AH6 A;  1A63 A;  2L9H A;  1VQE A;  1WTV A;  1SNP A;  4HJ7 A;  3HOW H;  2PMZ B;  3CCL A;  4JCV E;  2I07 B;  2F3V A;  2WV6 D;  4TKO B;  4GN4 B;  3OTO L;  3FDT A;  1F9P A;  1EOV A;  4DUZ Q;  2Z1C A;  3ICE A;  4UP7 A;  4DR6 Q;  3MXP A;  4A3E H;  4A3K B;  1IL2 A;  3P1H A;  2K1B A;  4HIO A;  5KYL A;  2JE6 I;  2RHS B;  4RH6 A;  1Q8K A;  3NTI A;  1DZ1 A;  2NVX B;  1F2Z A;  3RZD B;  3DUZ A;  2A1A A;  2VW9 A;  3T1H L;  3C1E A;  1JCK B;  2O4X A;  5DAU A;  4K0K Q;  1KAW A;  4IUV A;  3KDF B;  1E2Z A;  1SFO B;  4A3I G;  2K52 A;  1PYB A;  1PHJ A;  5LL6 S;  1D2B A;  3J81 E;  1N32 Q;  5C5L A;  2IY5 B;  4GOP B;  1EWC A;  4KN4 C;  4CJ1 B;  2FHT A;  1P8L A;  3U9S A;  2MJ8 A;  1DOL A;  3K5L A;  4B3M L;  4BY7 B;  2ES2 A;  4JI6 Q;  3QOL A;  1N8R C;  4HTH A;  1EIF A;  1YNX A;  4DR7 Q;  1LO5 D;  1GUS A;  2A69 C;  1PFM A;  5CV4 A;  4DV0 L;  4BA2 I;  3BVZ A;  3V2T A;  1EY7 A;  1QUQ A;  1GJX A;  4YY3 L;  4CBV A;  2UUB Q;  1BCP C;  1YVC A;  2B2Y A;  3K8A A;  4BBS B;  3OTO Q;  2HIX A;  3Q0A A;  1I4G A;  3JAM L;  3CCV A;  5K36 G;  2GA4 B;  2E2H B;  4NKL A;  3S2H B;  2FMM A;  3SK6 A;  4QY7 A;  4RHR A;  4OO1 H;  2A73 B;  3A7A B;  2R7D A;  3S2H H;  1LTA D;  2NTS A;  4K5W A;  2E74 C;  1Y69 U;  3K5M A;  5M5X B;  1FNW A;  1X54 A;  1A0I A;  2OTL A;  1LT6 D;  1W6K A;  5M3M G;  4DV1 L;  2NZO A;  3VR5 A;  2X69 A;  1RKN A;  1JB7 A;  2JA8 H;  5C0X I;  1A6X A;  2OTJ A;  3MXN B;  2ZM6 Q;  2AWN A;  1V9P A;  4HIM A;  1B1Z A;  3TS0 A;  3URY A;  5IGE A;  1X65 A;  1FJG L;  3OW2 A;  1LTL A;  3M9B A;  2VL6 A;  4B08 A;  1FNU A;  1SNC A;  1VQD A;  1VCI A;  4QUF A;  1ROD A;  3GTQ B;  4BBR B;  4A3J G;  1WD0 A;  4JOI C;  2UUC L;  5IGG A;  2VQE Q;  5DM7 3;  3PO3 G;  3WOF A;  2L15 A;  1W3S A;  2RDH A;  4E6I A;  2F0M A;  2KOL A;  1PTO H;  3KBX A;  3BS1 A;  4S3S A;  4DAV A;  5JEA H;  1I94 Q;  2M2L A;  4FVM A;  1I4H A;  4K8I A;  4FXD A;  4YWL A;  3GV3 A;  3KOJ A;  2JA7 B;  2DY7 A;  3SR1 A;  1RTN A;  2HHH L;  3ZJY C;  5A2Q E;  1AFP A;  1NCV A;  1BDO A;  2OT2 A;  3KF8 B;  3MXN A;  4OWX B;  1QNK A;  1IBL Q;  1UE5 A;  3A8K E;  1BUV T;  2KUM A;  5BR8 L;  5I2X A;  5I9O A;  4DKA C;  1UUP A;  3PIP 3;  2R6G A;  5I4D A;  1OTC A;  3VYT A;  3A74 A;  3NBH A;  1XMQ L;  4DR2 L;  4QB4 A;  2YU9 B;  1STB A;  2FFK B;  3W1G A;  2M9V A;  3AQQ A;  1I3Q B;  2XSC A;  2XRS D;  3CXC A;  2SDF A;  4AQY Q;  1B9M A;  3MZ5 A;  2FMC A;  5ELO A;  1S5B D;  5EPL A;  1K3R A;  1IYV A;  1AEX A;  1EY6 A;  2Z4I A;  5ELC A;  5FOB B;  5FO8 B;  1VQ8 A;  2L1B A;  1X3G A;  3VR3 A;  3J80 L;  2CVR A;  1U5K A;  4KMU C;  4RCO A;  3AU7 A;  4IUR A;  1B53 A;  2JA6 B;  1SYC A;  4F8M A;  4ME5 A;  1I6H B;  3M85 A;  1BO0 A;  1M8A A;  3PMF A;  3T1Y Q;  1W6J A;  3NBI A;  4OEL B;  4GOP C;  5NUC A;  4A3F H;  3LNN A;  2F0V A;  1V1Q A;  2L5T A;  4LW1 A;  1GUG A;  3RLF A;  4DNT B;  5K36 H;  5M5Y B;  1STY A;  1EY9 A;  2TMP A;  2FIN B;  1ASY A;  2VNU D;  5C44 B;  2EJM A;  3M7N A;  4HSV A;  1MSH A;  1R9T H;  1G6Z A;  4TSS A;  4IFD G;  1LT5 D;  1LAB A;  3A8I E;  4DAP A;  4P71 A;  5JVH 3;  1LTI D;  2B2W C;  2JA7 G;  1JE4 A;  1PYS B;  4OHJ A;  1EUJ A;  4XT3 B;  2XVS A;  4NXM L;  2EYO A;  4BY7 H;  4JG2 A;  4IAL A;  3RN2 A;  1VQO A;  2XWJ B;  4UDU C;  5M3F H;  5L37 A;  4H7B A;  4QL5 A;  5HUR A;  1GO3 E;  4DR6 L;  1TXY A;  1TWA B;  1PH3 A;  3H0G H;  3HOX G;  1IYU A;  2RA4 A;  1Q86 C;  5ELN A;  4IOC A;  2JSO A;  4RFB A;  1C4Q A;  2R3Z A;  2M00 A;  5KNB A;  2DNE A;  4R4Q A;  3TP5 A;  2RHQ B;  2O5I C;  3NUC A;  2FXQ A;  2A68 D;  1PH9 A;  2OEO A;  3K5N A;  3SK4 A;  2EOT A;  3R8B A;  1Y1W H;  4K6L A;  1A15 A;  3S2D H;  3BVM A;  1LTB D;  3H91 A;  5FLX L;  1F9S A;  3WWV A;  1KLG D;  1SNM A;  2K14 A;  1MJC A;  4JYA Q;  2AUK A;  2GVB A;  1VQH A;  1QZG A;  2K05 A;  1QB5 D;  3HKZ G;  4B3R L;  1CKM A;  3DM1 A;  5JJZ A;  3N6R A;  2OWO A;  2NVQ B;  4KD3 A;  4L5Q A;  3I4L A;  1KHI A;  2Q8R E;  4DV7 Q;  2I5M X;  2AQ1 B;  4A3C G;  1IBK L;  3BZC A;  1ET9 A;  1XNQ L;  4B3S Q;  3L0O A;  2Z6B A;  2IWH A;  4C3H G;  2E2D C;  5DLQ E;  1VMP A;  1TU2 B;  1E3P A;  2K32 A;  4R4O A;  2PQA B;  2RKS A;  4MHE A;  4DR1 L;  1KD1 C;  3E3X A;  3SDZ A;  4LF5 Q;  1XX8 A;  2IL8 A;  1D8L A;  1CZW A;  1ZYR D;  1ILP A;  3KF6 A;  1R4Q B;  3OMC A;  2PNH A;  3CC2 A;  1E24 A;  1GUN A;  5EBD A;  4HJ9 A;  1PTO D;  4DGZ A;  5C0X G;  2A6H C;  1I4P A;  1SFO H;  1E0B A;  3GP7 A;  2F0E A;  2IHE A;  1LV9 A;  1J6Q A;  3OPO A;  5IOD A;  1TS4 A;  1PTO C;  4FF2 A;  3RD4 A;  1H9R A;  1A3T A;  1VQ9 A;  1STH A;  2VS1 A;  5CV8 A;  3HOY B;  4LF9 L;  3ERQ A;  4A3K H;  3GO5 A;  5IYD H;  2EJG C;  3TME A;  3S17 B;  1DOK A;  3PF5 A;  3GTP H;  1IBM L;  2Q2T A;  4DNR B;  3PO3 H;  5LL6 X;  4L5T A;  2EVB A;  1NSN S;  3QO2 A;  1N36 Q;  4A93 G;  3G48 A;  2CW0 D;  5FLX E;  2H5X A;  2C9O A;  3NTK A;  1G2T A;  3QIA A;  1PDQ A;  2F0S A;  3E0E A;  3NQI A;  4H0L C;  4JV5 L;  3VR4 A;  2BE5 C;  3ERS X;  1H95 A;  2F0D A;  2D5D A;  2VY3 A;  4IPD A;  3R2I A;  1XXG A;  3I4N B;  4FXK C;  4Z9C B;  1OXV A;  1KAB A;  2UUA Q;  2VB2 X;  3H3V H;  1SE8 A;  4DNI A;  1O7Z A;  1QVF A;  3M3Y H;  3Q6S A;  3BU2 A;  1IW7 C;  2G9H D;  5HGQ A;  1X3Q A;  4DUY L;  4PMW A;  1JMC A;  1BXT A;  2L0C A;  1YBY A;  1VQN A;  3WDN A;  1L1O B;  5CR3 A;  5AJ3 Q;  3CPW A;  5BN4 A;  2IJ0 A;  2JQO A;  4OEM B;  5FLM G;  2R92 B;  2DN8 A;  1SE3 A;  2ZXO A;  1YJ9 A;  4C56 C;  4RKB A;  2MUY A;  4BY1 G;  4WJ4 A;  4IUQ A;  2J0T D;  4EGV A;  1EQV A;  4DR5 L;  4IJL A;  4A3B H;  4GLX A;  1LYL A;  1GUT A;  4DUY Q;  4O1N A;  1HQM C;  1UEA B;  4PG3 A;  3BJU A;  3A55 A;  3J81 c;  2A69 D;  3IFT A;  5IGD A;  2V1C C;  1AE3 A;  2EIF A;  1I4R A;  1F77 A;  4YHH L;  3HOZ G;  4MNO A;  3H94 A;  4A3F G;  1EQR A;  3K5O A;  1D5X C;  4OX9 Q;  1RF2 D;  1KIX A;  1JQY D;  1N36 L;  1BOS A;  3A5U A;  3AMU A;  2BE5 D;  2OQK A;  1IYJ B;  4JI7 Q;  5BN5 A;  2E5L L;  2IW3 A;  1FGU A;  3PSI A;  2LXJ A;  1LTR D;  2AQ3 B;  4CDD C;  4GN5 A;  2PPB C;  3GTO H;  3R2T A;  1HZA A;  1LT4 D;  1AZQ A;  3GD7 A;  4DK3 C;  2Z8L A;  3OSO A;  4BY7 G;  1HNZ L;  1YZ6 A;  3NPP A;  5JAV A;  2K5N A;  2B2W A;  1YIJ A;  5EBC A;  5C44 G;  4OXP A;  1PTO B;  4JI5 L;  4C2M B;  1PMR A;  3HOX B;  3F8T A;  3HKZ E;  1NUC A;  4WFN 3;  3J7Y W;  2NBF A;  5ISR A;  1XTD A;  3RZD H;  3I73 A;  4AIM A;  1YHB A;  2RBM A;  1AH9 A;  2KHS A;  1DYQ A;  3FEW X;  1YHA A;  1PH7 A;  4IPC A;  4ZYS A;  1Y1W G;  4LF7 L;  3UE1 A;  4POG A;  3J7A F;  4DU9 A;  2KEC A;  4PV1 C;  4X62 L;  4A3D G;  4MN3 A;  1HXY D;  1U4L A;  2D2C C;  2KBN A;  3LGJ A;  4DV6 Q;  3PUV A;  1EL0 A;  4A75 A;  1C7Y A;  5C5M A;  3DM3 A;  3GTJ B;  4KHZ A;  2LKV A;  1YHQ A;  1KLU D;  4OGQ C;  1QWY A;  1SE2 A;  1TWH B;  4A3D H;  1PH4 A;  2EY6 A;  4ZKC B;  2E5L Q;  4A3B B;  2F0W A;  4XXE A;  4JYA L;  2EXD A;  5CC4 A;  1CSP A;  1G91 A;  4DR3 Q;  2HD3 A;  2YU9 H;  4X6A H;  1JOK A;  3V96 A;  4KK7 A;  4B9W A;  5FJ8 G;  1EY4 A;  3OHX C;  4G7O C;  1C48 A;  4R8I A;  1LTG D;  2F0J A;  3CW2 C;  2O2L D;  1SYE A;  2E2I H;  2NZ1 D;  3TP8 A;  4IFD H;  2NYZ D;  3D6C A;  3K0X A;  2WII B;  3S2D B;  2JN4 A;  3NBH B;  3U4Z A;  3O13 A;  1CA5 A;  1B50 A;  1CFM A;  3ITP A;  3TEH B;  1MGS A;  1EY8 A;  1PFB A;  1HPC A;  1LUZ A;  1WYD A;  3HG9 A;  3EFX D;  4XQQ A;  4HAE A;  1I5F A;  2EYL A;  3NEM A;  2VUM H;  4XDX A;  1CTM A;  2VUM B;  1D6E C;  4JI4 L;  5M5Y H;  2WAC A;  1BBW A;  1IKM A;  5M5W H; 
#chains in the Genus database with same CATH homology
 3NWT A;  5IOC A;  1JOO A;  2LMC B;  4DA2 A;  1RTO A;  2KA7 A;  2ZXR A;  3DEP A;  1EU3 A;  1MI2 A;  3DXJ C;  3SHL A;  1HA5 A;  4H44 C;  2ICE C;  2K03 A;  4PQX A;  1BCP D;  3GTO B;  2E2I B;  4A3M B;  3E0J A;  1H9S B;  5AFW A;  1YNJ C;  3MTS A;  1XWE A;  4K8J A;  1Y8O B;  1ESR A;  3BDO A;  1EWH A;  1Q12 A;  5JEA G;  2ICI A;  3TP7 A;  3HOU B;  3SK8 A;  2K5W A;  3D8G A;  1X32 A;  3M4O B;  1G2S A;  2JYO A;  2EYP A;  4CKB A;  3T16 A;  2KEE A;  4R9W A;  2R93 B;  1QIL A;  5M3M B;  1EYA A;  1RCV D;  5M5W B;  1V1P A;  5C4H A;  1J8I A;  3EJI A;  5T1G A;  1S5D D;  1Y8P B;  1WTX A;  1TVX A;  3P75 A;  3D31 A;  1SMY C;  4X3U A;  5IGC A;  4DXG A;  5LHY 1;  2L12 A;  1TWC B;  2RDG A;  3IKJ A;  4DK1 A;  2B2V C;  1O78 A;  1V43 A;  2I46 A;  3DWP A;  3C46 A;  2WP8 J;  4XT1 B;  3HS0 C;  4G7Z C;  1ESF A;  1ENA A;  1HRJ A;  3WOE A;  3IL8 A;  3SVM A;  4ZRZ A;  3I91 A;  2H1E A;  5EKL A;  1WTW A;  5JPM C;  3S16 B;  5G3L D;  3OOC A;  3T51 B;  2NUC A;  1TY2 A;  4K14 A;  2NN6 I;  2IX0 A;  1I50 B;  4XYO A;  1L0Y B;  4CGY B;  2F0U A;  3TSS A;  4HED A;  5CV6 A;  1EU4 A;  4XYQ A;  4ZAI A;  3K0Y A;  2MP1 A;  2QKI C;  3Q23 A;  1FR3 A;  4XIG S;  2EYH A;  2SEB D;  1MBY A;  5EPJ A;  1B44 D;  2E76 C;  1HFG A;  3G7L A;  2IPK D;  2WIN B;  3ND9 A;  1D1K A;  3T56 B;  1IW7 D;  4OIJ A;  1A2U A;  1RDP D;  5CV5 A;  1BCP B;  2HCC A;  1CHP D;  4TRD A;  4KI0 A;  4FXG C;  5ELF A;  4OL7 A;  5D65 A;  2G9D A;  2HQE A;  4KV6 A;  3QB3 A;  4ZQ3 A;  1AN8 A;  3PUX A;  1FD7 D;  4IUT A;  2RSO A;  4ODG A;  1PLF A;  1KNE A;  1GXD C;  3ZYY X;  5I6Y A;  4CJ0 B;  3I72 A;  1IHZ A;  2L55 A;  3G6J B;  1MD2 D;  4QMG A;  2EY2 A;  1U4R A;  3W3A A;  3KK7 A;  5J39 A;  4PMC A;  2BA0 A;  3S1N B;  4G57 A;  3PO3 B;  1HA6 A;  1HTP A;  3KLR A;  3GTP B;  3CRK C;  4ZUJ A;  1EIH A;  4FF1 A;  3OWF A;  2K28 A;  3H3V C;  1JWU D;  1WCM B;  3GTM B;  1DXM A;  3A8J E;  1D5Z C;  2Q8T A;  1TQO A;  4R8N A;  2XN9 C;  4QCL A;  2PNR C;  4Q0F A;  5C3W A;  3HOZ B;  2CHB D;  4FNF A;  1QG7 A;  4NDX A;  4HR7 B;  1SEB D;  3VYS A;  4LMQ D;  1BF4 A;  4X3T A;  4NW2 A;  1KAA A;  1O7L A;  4KHV A;  1D1I A;  4V19 0;  2J7Z A;  4OIK A;  3V05 A;  1STN A;  4ILW A;  3EA6 A;  1SAP A;  1Y1W B;  1TKW B;  1K8O A;  2K6A A;  1NR2 A;  1RD9 D;  2R61 A;  2QF7 A;  2F0G A;  3MEH A;  4EQP A;  1F2M A;  2IX1 A;  2SNS A;  5DM6 3;  4WJW A;  4EQO A;  3GTL B;  2NVY B;  1KTK A;  3C2P A;  3M4Y A;  4M8A A;  1Q3L A;  3L9A X;  2X6G A;  3FVQ A;  5CV9 A;  5ELE A;  5ELD A;  1Y8N B;  4C1N I;  1ZKO A;  4A93 B;  1Q8I A;  1GUO A;  4QF4 A;  4KY5 A;  4BA1 I;  4HMJ A;  4A3E B;  1STE A;  1LAC A;  3U9O A;  2B2T C;  2EJF C;  1H9K A;  2PZT A;  3GTG B;  4C3I G;  2XRQ D;  2PZU A;  3I4M B;  4WOR A;  1Q1E A;  2F1M A;  1CZG A;  2PYK A;  1EYC A;  5JOB A;  1QJO A;  3MC0 B;  3JAM E;  2K04 A;  1E2W A;  1E2V A;  2B2T A;  4HSP A;  1SE4 A;  1RJT A;  1S4Z A;  4C3H B;  1DON A;  4J8Q A;  1XTC D;  2EYM A;  2EYF A;  4JBW A;  2MHV A;  3S9W A;  3GQB A;  1JR0 D;  3CHB D;  2EPB A;  5EPK A;  1JB3 A;  2F0Q A;  4K2L A;  3J81 L;  1PRT B;  1HUM A;  4XQJ A;  4PNY A;  3Q24 A;  2B63 B;  2IX3 A;  5C4J B;  5I2Y A;  5JEA J;  4G7H C;  5I9P A;  3R3O A;  4GZY C;  4K6D A;  1STA A;  4HN7 A;  3UI2 A;  3HGB A;  1KNA A;  1JOR A;  1XYI A;  4MIU A;  5EQ0 A;  1JWS D;  3VA5 A;  3EQL C;  3NHH A;  5J1Z A;  1WTO A;  3NE5 B;  2F0T A;  2E2J B;  1L0X B;  1I4Q A;  3HKZ B;  2QCP X;  1C8C A;  3PV0 A;  1SNQ A;  2NB0 A;  1PXU A;  4RKL A;  1TS3 A;  1DCZ A;  3S1M B;  2NN6 G;  2BDO A;  4KKU A;  1Y1V B;  1EZ6 A;  2AUJ D;  3ND8 A;  3TZU A;  1WTR A;  1ILQ A;  3MWY W;  4L63 B;  2F0H A;  3PO2 B;  1II3 A;  3DHQ A;  1G8Z D;  4FO2 A;  1VF5 C;  4EVO A;  3HOV B;  1FNV A;  5M9O A;  1GOZ A;  4KY6 A;  1DJR D;  2TSS A;  2O5J C;  2EZV A;  1YNN D;  2MPM A;  5HGT A;  4KTA A;  1Z6H A;  2HUG A;  4DAY A;  1A2T A;  3M3Y B;  4IFD J;  3GV6 A;  1TT2 A;  3BG3 A;  3VA7 A;  2HDM A;  2K7V A;  2SNM A;  3MXG A;  1HUN A;  4B9X A;  2VXW A;  2E75 C;  4HCS A;  2PCF B;  1CQF A;  5D3D A;  4F88 A;  4RWS C;  2MGS A;  1U9R A;  4ZLT F;  1EQT A;  4OO1 I;  3NWS A;  2JA8 B;  3M7G A;  1EEF D;  3BYT B;  5KRU A;  4OO1 G;  4RHS A;  2F0N A;  3I90 A;  1BR9 A;  4KKS A;  5C0X H;  3RMH A;  1EY0 A;  2QIL A;  2B2U C;  3CQZ B;  5FK9 C;  1HTL D;  1CHQ D;  2RDF A;  3BDC A;  2A6E D;  2RQX A;  2PO4 A;  2KCN A;  4I65 A;  4HMI A;  5COY A;  5CBA E;  1I6V C;  3OIP A;  2B2V A;  3CKI B;  1O80 A;  1CI3 M;  1GHK A;  3QJY A;  1R9T B;  5FO7 B;  2EYJ A;  2B8G A;  3J7A V;  3AB9 A;  3PIO 3;  5KNC A;  4AYB B;  2F0K A;  1ZEQ X;  3P7J A;  5KIX A;  4ZUI A;  2V4D A;  3CRL C;  2OF1 A;  1BBX C;  1I4X A;  4RGO S;  5C3E B;  4ZK9 B;  3OMG A;  5C4Z A;  2JEB I;  1AZP A;  4ULL A;  1PRT D;  2EE1 A;  4FYD A;  3MAQ A;  3DWA A;  3HOW B;  3A54 A;  4IN3 A;  4IUP A;  2WKD A;  3Q22 A;  3NSW A;  1BNZ A;  1S5C D;  3I8Z A;  2KED A;  2ENB A;  3SE0 A;  5CV7 A;  3H09 A;  5E3F A;  5D14 A;  3KBG A;  5FO9 B;  2FJ2 A;  4JK1 C;  3L3O C;  5M3F B;  1K83 B;  3D4D A;  4U67 3;  2F0P A;  2F0I A;  1EEI D;  1WVL A;  3BVG A;  4U68 A;  5KND A;  4CKC A;  3OWE B;  2CQA A;  3X3M A;  3KLS A;  4F87 A;  4ABN A;  4DF7 A;  3P20 A;  3D3R A;  4RAU C;  3FPU B;  3FRP B;  1EIG A;  1F2L A;  1B9N A;  3T13 A;  4TQU S;  2LFN A;  1PYW D;  3H0G B;  5CMD A;  3D6W A;  3E5S A;  1K8M A;  2LY7 A;  3K59 A;  4Y7N B;  1KDB A;  3IAY A;  4J1M A;  3W2D A;  2F0O A;  5IGF A;  1SSO A;  2HCI A;  4X3S A;  3C1F A;  3S1Q B;  1QOH A;  3VYR A;  2PW7 A;  4L8J A;  4RCN A;  1LTS D;  2XNA C;  1AW7 A;  3FKI B;  1A3V A;  1LLR D;  1UAP A;  4IUU A;  3OW7 A;  2KVM A;  2K33 A;  3HZX A;  5D3I B;  2B39 A;  1SYG A;  2K01 A;  3T4A C;  1B2T A;  1M4V A;  1EZ8 A;  1KDC A;  1JIC A;  3TN2 A;  1SNO A;  2AWO A;  1DOM A;  1OXU A;  1STG A;  3RZO B;  4BS9 A;  1A3U A;  2BA1 A;  3K58 A;  1WTQ A;  2L4N A;  4IFD I;  3NP8 A;  1F2Y A;  4IZ8 A;  2RVL A;  3DMU A;  4Q5V A;  1WD1 A;  2SOB A;  3FPP A;  3N52 A;  2NTT A;  4H13 C;  1V1O A;  2XIW A;  4NMZ A;  5K5P A;  3HP3 A;  4C3J B;  4KJO A;  2B2Y C;  4CKE A;  3VR2 A;  4KN7 C;  2EDG A;  2KCC A;  4KJN A;  5KGU A;  5DNF A;  1VDZ A;  4ID6 A;  5IT9 E;  4I7Z C;  3S15 B;  2VB3 X;  1TS2 A;  5CBE E;  3VR6 A;  1JOQ A;  5T1I A;  2A6E C;  2EY5 A;  2KJX A;  3H6M A;  1CK1 A;  4WRD A;  3NXW A;  4DXF A;  3DWQ A;  2DY8 A;  2K5D A;  1IL8 A;  3GTK B;  3IFD A;  4XTC S;  1JWM D;  5C0X J;  1ENC A;  1ZXT A;  1GUW A;  4A3J B;  1LT3 D;  2Y0S B;  3F2U A;  1PZJ D;  2ID0 A;  2WB1 B;  2LS0 1;  4ZKB B;  4YIJ A;  4QIW B;  4LJZ C;  1CT1 D;  1PRT F;  5F2D A;  2XWB B;  1PZI D;  3MXU A;  2YYZ A;  3VYU A;  3SEB A;  5EKK A;  2K5Q A;  3KUP A;  2A5H A;  2F0L A;  4F7X A;  5CYU A;  3C3L A;  1S5F D;  3I70 A;  2F03 A;  2F4I A;  2EY1 A;  2JXM B;  3DEO A;  1V1P B;  1AP0 A;  3LWE A;  2B2U A;  1LTT D;  1SJE D;  5E1F A;  1DD2 A;  5JVG 3;  5J22 A;  5CGK A;  2PQE A;  4M1U B;  2NN6 H;  2BCO A;  1V8Q A;  1T5X D;  4A3I B;  5EKI A;  1EY5 A;  3EVQ A;  3ONA B;  1ET6 A;  1B4O A;  2A74 C;  1Z47 A;  1MSG A;  1ONL A;  2WKC A;  4LAA A;  4A3G B;  4EQN A;  2QEJ C;  2BDN A;  1CQV A;  2B8F A;  1QNU A;  3TP6 A;  4UAI A;  3T53 B;  1RHP A;  4RA8 A;  1Q90 A;  5E4W C;  1YNJ D;  1F9R A;  1HQR D;  2WAQ B;  1SND A;  2DNC A;  1PTO F;  3MHB A;  3A7L A;  1S5E D;  1TR5 A;  1QCB D;  1UNS A;  4N9P A;  1SYB A;  5IT9 L;  1DM0 B;  2L11 A;  3D4W A;  2D62 A;  3I3C A;  2BOS A;  5G3L F;  4CJ2 C;  1B3A A;  1U4P A;  1Q1B A;  3QWN A;  2F0F A;  3KF8 A;  1Z7T A;  1QE6 A;  1SXT A;  4NP5 A;  4IUN A;  1ENF A;  2C5C A;  2RSN A;  1BQQ T;  1VF7 A;  4O42 A;  1PZK D;  4G4K A;  2ZT9 C;  3D4R A;  2NVT B;  2OXP A;  1EFI D;  4C3I B;  3PUW A;  2Q8I B;  5JPN C;  4A3F B;  2X6L A;  3BYY B;  1O7Y A;  3K6O A;  3CU7 A;  3BZD B;  4RGM A;  1SMY D;  3PUY A;  3HRZ C;  1WTP A;  1HFN A;  4IQZ A;  1U4M A;  3J80 E;  1EOT A;  3ERO A;  2JA5 B;  1ZYR C;  1IKL A;  3K57 A;  3X3N A;  1H9M A;  3RUZ A;  1TS5 A;  4KD4 A;  2PW5 A;  1SDF A;  5I6W A;  1F9Q A;  4DN4 M;  1JC7 A;  5IGB A;  5A35 A;  2H4O A;  2JP1 A;  5EGT A;  1NAP A;  1H9S A;  4FP5 D;  3OIQ A;  1G29 1;  5A2Q L;  3KLS X;  1X3P A;  3FMC A;  1VMC A;  3TDQ A;  3MA2 B;  4K5X A;  1ML0 D;  2R7Z B;  4A3D B;  1R4P B;  1ICW A;  3MFY A;  1J9O A;  3A56 A;  3MVV A;  3QOJ A;  4QUC A;  4KKT A;  3QG1 A;  5IIF A;  5DEH A;  5C6A A;  1CM9 A;  3K7A B;  1KDA A;  3LX0 A;  4XQN A;  1TII D;  3NK9 A;  5C3X A;  4RGN A;  1D5M C;  3MFG A;  5KEE A;  5C4X B;  1SBB B;  4DK0 A;  3NTH A;  1OO9 B;  3PUZ A;  4K2K A;  4DFA A;  3SXH A;  1T5E A;  2EXZ A;  5KYI A;  2QDB A;  3S14 B;  4KY7 A;  2A68 C;  5FKA C;  4P2C B;  1GHJ A;  1HCZ A;  4FF4 A;  3SK5 A;  1YNN C;  3TZD A;  4X3K A;  2KQ3 A;  5COR A;  4FF3 A;  4RGT A;  5TSS A;  1NR4 A;  1HHV A;  4C1N K;  4LK1 C;  5BN3 A;  4N9T A;  1OXS C;  3HEJ A;  2IT1 A;  1TY0 A;  4K5V A;  5EJW A;  2D9U A;  4C3J G;  1CA6 A;  3BDL A;  3TBI B;  3E6Z X;  3L7Z C;  2N55 A;  5E4X A;  1TWG B;  1EYD A;  1PFN A;  1FGB D;  2ZXP A;  2N88 A;  1SYD A;  2Z4H A;  4BWG B;  3LWU A;  2JEA I;  4J6H A;  1OXX K;  2HDL A;  2A6H D;  4L6T B;  1SJH D;  3NQT A;  2PZW A;  1BCP F;  3S1R B;  2F3W A;  4CHT B;  4HCE A;  2AQ2 B;  1OXT A;  1PRT C;  2NWG A;  1TWF B;  1FYC A;  4V0B A;  3R93 A;  4PMB A;  1H9J A;  1SYF A;  2J4X A;  4BY1 B;  5ELB A;  2CW0 C;  2L9H A;  1WTV A;  1SNP A;  2PMZ B;  2I07 B;  2F3V A;  2WV6 D;  4TKO B;  3FDT A;  1F9P A;  2Z1C A;  3MXP A;  4A3K B;  3P1H A;  2K1B A;  5KYL A;  2JE6 I;  4RH6 A;  3NTI A;  1DZ1 A;  2NVX B;  1F2Z A;  3RZD B;  3DUZ A;  3C1E A;  1JCK B;  2O4X A;  5DAU A;  4IUV A;  1E2Z A;  1SFO B;  5LL6 S;  1D2B A;  3J81 E;  5C5L A;  1EWC A;  4KN4 C;  4CJ1 B;  2FHT A;  3U9S A;  2MJ8 A;  1DOL A;  3K5L A;  4BY7 B;  3QOL A;  4HTH A;  1LO5 D;  1GUS A;  2A69 C;  1PFM A;  5CV4 A;  4BA2 I;  3BVZ A;  3V2T A;  1EY7 A;  1GJX A;  4CBV A;  1BCP C;  2B2Y A;  4BBS B;  3Q0A A;  1I4G A;  3JAM L;  5K36 G;  2GA4 B;  2E2H B;  4NKL A;  3S2H B;  2FMM A;  3SK6 A;  4RHR A;  4OO1 H;  2A73 B;  3A7A B;  1LTA D;  2NTS A;  4K5W A;  2E74 C;  1Y69 U;  3K5M A;  5M5X B;  1FNW A;  1LT6 D;  1W6K A;  3VR5 A;  2X69 A;  1RKN A;  5C0X I;  1A6X A;  2AWN A;  1B1Z A;  3URY A;  5IGE A;  4B08 A;  1FNU A;  1SNC A;  1VCI A;  4QUF A;  1ROD A;  3GTQ B;  4BBR B;  1WD0 A;  5IGG A;  5DM7 3;  3WOF A;  2RDH A;  4E6I A;  2F0M A;  2KOL A;  1PTO H;  3KBX A;  3BS1 A;  4S3S A;  4DAV A;  5JEA H;  2M2L A;  4FVM A;  1I4H A;  4K8I A;  4FXD A;  3GV3 A;  2JA7 B;  2DY7 A;  3SR1 A;  1RTN A;  5A2Q E;  1AFP A;  1NCV A;  1BDO A;  2OT2 A;  3MXN A;  1QNK A;  3A8K E;  1BUV T;  2KUM A;  5I2X A;  5I9O A;  1UUP A;  3PIP 3;  2R6G A;  5I4D A;  3VYT A;  3NBH A;  4QB4 A;  2YU9 B;  1STB A;  2FFK B;  2M9V A;  1I3Q B;  2XSC A;  2XRS D;  2SDF A;  1B9M A;  3MZ5 A;  2FMC A;  1S5B D;  5EPL A;  1IYV A;  1AEX A;  1EY6 A;  2Z4I A;  5ELC A;  5FOB B;  5FO8 B;  2L1B A;  3VR3 A;  3J80 L;  2CVR A;  4KMU C;  4RCO A;  3AU7 A;  4IUR A;  1B53 A;  2JA6 B;  1SYC A;  4F8M A;  4ME5 A;  1I6H B;  3M85 A;  1BO0 A;  1M8A A;  3PMF A;  1W6J A;  3NBI A;  5NUC A;  3LNN A;  2F0V A;  2L5T A;  1GUG A;  3RLF A;  4DNT B;  5K36 H;  5M5Y B;  1STY A;  1EY9 A;  2TMP A;  2FIN B;  2VNU D;  5C44 B;  2EJM A;  3M7N A;  4HSV A;  1MSH A;  1G6Z A;  4TSS A;  4IFD G;  1LT5 D;  1LAB A;  3A8I E;  4DAP A;  5JVH 3;  1LTI D;  2B2W C;  1JE4 A;  4OHJ A;  4XT3 B;  2XVS A;  2EYO A;  4IAL A;  2XWJ B;  4UDU C;  4H7B A;  5HUR A;  1TWA B;  1IYU A;  2RA4 A;  2JSO A;  4RFB A;  1C4Q A;  2R3Z A;  2M00 A;  5KNB A;  2DNE A;  3TP5 A;  2O5I C;  3NUC A;  2A68 D;  2OEO A;  3K5N A;  3SK4 A;  2EOT A;  3R8B A;  4K6L A;  1A15 A;  3BVM A;  1LTB D;  3H91 A;  5FLX L;  1F9S A;  1KLG D;  1SNM A;  2AUK A;  2K05 A;  1QB5 D;  3DM1 A;  5JJZ A;  3N6R A;  2NVQ B;  4KD3 A;  3I4L A;  2Q8R E;  2AQ1 B;  1ET9 A;  2IWH A;  4C3H G;  2E2D C;  1VMP A;  1TU2 B;  2K32 A;  2RKS A;  4MHE A;  3SDZ A;  1XX8 A;  2IL8 A;  1CZW A;  1ZYR D;  1ILP A;  1R4Q B;  3OMC A;  1GUN A;  5EBD A;  1PTO D;  4DGZ A;  5C0X G;  2A6H C;  1I4P A;  1E0B A;  3GP7 A;  2F0E A;  1LV9 A;  3OPO A;  5IOD A;  1TS4 A;  1PTO C;  4FF2 A;  3RD4 A;  1H9R A;  1A3T A;  1STH A;  5CV8 A;  3HOY B;  3ERQ A;  3GO5 A;  2EJG C;  3TME A;  3S17 B;  1DOK A;  4DNR B;  5LL6 X;  2EVB A;  1NSN S;  3QO2 A;  2CW0 D;  5FLX E;  2C9O A;  3NTK A;  1G2T A;  3QIA A;  1PDQ A;  2F0S A;  3NQI A;  4H0L C;  3VR4 A;  2BE5 C;  2F0D A;  2D5D A;  3R2I A;  1XXG A;  3I4N B;  4FXK C;  4Z9C B;  1OXV A;  1KAB A;  2VB2 X;  1O7Z A;  3Q6S A;  1IW7 C;  2G9H D;  1X3Q A;  4PMW A;  1BXT A;  2L0C A;  3WDN A;  5CR3 A;  5BN4 A;  2IJ0 A;  2R92 B;  2DN8 A;  1SE3 A;  2ZXO A;  4C56 C;  4RKB A;  2MUY A;  4IUQ A;  2J0T D;  4EGV A;  1EQV A;  1GUT A;  4O1N A;  1HQM C;  1UEA B;  3A55 A;  2A69 D;  3IFT A;  5IGD A;  1I4R A;  1F77 A;  3H94 A;  3K5O A;  1D5X C;  1RF2 D;  1JQY D;  1BOS A;  3AMU A;  2BE5 D;  5BN5 A;  2IW3 A;  1LTR D;  2AQ3 B;  2PPB C;  3R2T A;  1LT4 D;  1AZQ A;  3GD7 A;  2Z8L A;  3OSO A;  3NPP A;  5JAV A;  2B2W A;  5EBC A;  1PTO B;  4C2M B;  1PMR A;  3HOX B;  1NUC A;  4WFN 3;  3J7Y W;  2NBF A;  5ISR A;  3I73 A;  2RBM A;  2KHS A;  1DYQ A;  3FEW X;  4ZYS A;  3J7A F;  4DU9 A;  2KEC A;  4PV1 C;  4MN3 A;  1HXY D;  1U4L A;  2D2C C;  3PUV A;  1EL0 A;  5C5M A;  3GTJ B;  4KHZ A;  2LKV A;  1KLU D;  4OGQ C;  1QWY A;  1SE2 A;  1TWH B;  2EY6 A;  4ZKC B;  4A3B B;  2F0W A;  4XXE A;  5CC4 A;  1G91 A;  1JOK A;  3V96 A;  4KK7 A;  4B9W A;  4G7O C;  1EY4 A;  3OHX C;  1C48 A;  4R8I A;  1LTG D;  2F0J A;  2O2L D;  1SYE A;  2NZ1 D;  3TP8 A;  4IFD H;  2NYZ D;  3D6C A;  2WII B;  3S2D B;  3O13 A;  1CA5 A;  1B50 A;  1CFM A;  3ITP A;  1MGS A;  1EY8 A;  1PFB A;  1HPC A;  3HG9 A;  3EFX D;  4XQQ A;  4HAE A;  2EYL A;  4XDX A;  1CTM A;  2VUM B;  1D6E C;  2WAC A;  1IKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...