1AZQA

Hyperthermophile chromosomal protein sac7d bound with kinked dna duplex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3')
publication title The hyperthermophile chromosomal protein Sac7d sharply kinks DNA.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1997-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1azqA00
3UI2A 2Q8RE 1EIHA 2B2VC 2IL8A 4IUVA 4MHEA 2L4NA 1WD0A 2B2WA 2Q8TA 3HP3A 1DOMA 2SDFA 1F2LA 2KEEA 1QE6A 1XYIA 1AZPA 2VXWA 1F9QA 1WTVA 1CA6A 4UAIA 2X69A 5COYA 4ZKCB 1NAPA 4ZLTF 1SDFA 2M2LA 1PLFA 4IUTA 1SAPA 1HHVA 1B50A 1ILPA 1O7ZA 4CJ0B 5E4XA 1RHPA 1SSOA 1HRJA 4X3TA 5CMDA 3I91A 4X3SA 2L1BA 2K28A 2RA4A 4HEDA 4QUCA 5CORA 1KNEA 1VMCA 2FFKB 4DN4M 4R8IA 1WTQA 1ML0D 5E4WC 1DONA 1HA6A 1B3AA 1PFNA 3H91A 1J8IA 2B2YA 1KNAA 1U4LA 4XDXA 1X3PA 2DY8A 2K04A 1X3QA 2HCCA 1XX8A 2B2VA 2MJ8A 1HUNA 4HCSA 1JE4A 2KECA 1WD1A 2FJ2A 2KOLA 3QO2A 1DZ1A 2EPBA 1CM9A 2J7ZA 1F9RA 1AP0A 1HFNA 5EQ0A 1PFMA 2D9UA 2KEDA 3DM1A 2NWGA 4RA8A 1EOTA 1B53A 1MGSA 3GV3A 5D65A 1DOLA 3D6WA 3DEPA 5CBAE 2DY7A 4RAUC 2L9HA 4OIKA 2B2TC 1IKLA 1HUMA 2MGSA 1G91A 3KBXA 1U4RA 1WTPA 2HDMA 3DEOA 1BF4A 2EOTA 2L11A 2B2UC 3I90A 1WTWA 5EPJA 3I8ZA 1O7YA 4IUQA 1Q3LA 1VMPA 4QUFA 1EL0A 2X6LA 1CA5A 1PDQA 2B2WC 1ESRA 3I3CA 1E0BA 1F9PA 1M8AA 2X6GA 1LV9A 5EPKA 2H1EA 1QG7A 2MPMA 3IFDA 3MTSA 1IL8A 4OIJA 1TVXA 1HFGA 3P7JA 1G2SA 3R93A 4CJ2C 2K01A 4LMQD 3G7LA 4IURA 1AZQA 1BNZA 2FHTA 2FINB 5AFWA 1IKMA 5T1GA 2KUMA 4CJ1B 2JYOA 5JJZA 2MP1A 4NW2A 4ZK9B 2K03A 5DNFA 3TZDA 1B2TA 1RTOA 1J9OA 1S4ZA 1B4OA 2CVRA 4ZAIA 2RVLA 2B2TA 3ONAB 1RJTA 4MN3A 2BDNA 1RODA 2NZ1D 2R3ZA 2B2YC 3FPUB 4U68A 1MSGA 1GUWA 1NCVA 1QNKA 4X3UA 1F9SA 1NR2A 2K1BA 5EPLA 1A15A 3SVMA 1U4MA 2L12A 1MSHA 4IUUA 1BBXC 1EQTA 1JICA 1WTRA 2HDLA 1DOKA 1ZXTA 3GV6A 2RSOA 3F2UA 5EKIA 1X32A 1BO0A 1WTOA 2RSNA 4O42A 3MWYW 4RWSC 4X3KA 5EJWA 2K05A 2JP1A 5CBEE 3N52A 1NR4A 2N88A 3IL8A 1U4PA 1MI2A 2FMMA 5D14A 3KUPA 2HCIA 1PFBA 1G6ZA 3FDTA 2HUGA 1WVLA 1EIGA 4IUPA 1G2TA 1ILQA 2N55A 2EE1A 3Q6SA 1WTXA 1O80A 3TN2A 2XIWA 2KVMA 2NYZD 4XT3B 5T1IA 4ZKBB 1C8CA 4HAEA 4HSVA 2B2UA 4R9WA 1RTNA 4XT1B 1ICWA 3LWEA
chains in the Genus database with same CATH superfamily
3UI2A 1EIHA 1JJGA 3GP7A 3AFPA 3HP3A 1OTCA 4K6LA 2KBNA 1J5EL 1PH5A 4IOCA 4IZ8A 2M2LA 5IP9G 1B44D 1PRTB 3BJUA 3K8AA 4XQQA 4GLVB 4V0BA 4BY7H 4GN4B 1MJEA 2K7VA 4LFAL 4A3LH 2Y0SE 2F0QA 2Z8LA 4HSPA 1X3QA 2B2VA 1B3QA 1VQFA 1HUNA 3GQBA 3A5UA 2KECA 3PIP3 1SFOB 2HQEA 2B29A 1STAA 4UP8A 1HQRD 4B3TL 1HFNA 4DU9A 4DV1L 4DV6Q 2A74C 5L37A 1FNVA 4K2LA 1CK1A 1UE7A 3U4VA 4XQNA 4RGMA 3L3OC 1SYCA 1Q90A 3PIO3 2Z6BA 1Z7TA 3T1YL 1ET9A 1EWCA 1O7LA 5GROA 1V9PA 4ID6A 2BE5D 2VUMG 1CI3M 3HOZH 4CJ2C 1PV4A 3NPPA 1K8GA 1N33Q 3S2DH 4CDDC 5IYBG 1LTTD 3A5ZB 5CC4A 4JI6Q 2CVRA 1PRTC 4MN3A 1PRTF 1ZYRD 5IIFA 1S5DD 3FEWX 3MC0B 3M4QA 1Z47A 1VQOA 1G291 1O78A 3A7AB 1EQQA 4IUUA 1A63A 3BDLA 1EQRA 3HEJA 2HIXA 4AYBE 4QCLA 2F0WA 4K5WA 1IBML 3UDFA 4JW0A 2UXDQ 4IO9A 1MJCA 5LHY1 3LNNA 1SNPA 2F0HA 3KJPA 4A3KB 1PFBA 2F0KA 1LABA 3BVMA 2OTLA 1CTMA 2Z0SA 4R8NA 2ZTDA 3A7LA 4P71A 3CXCA 5TSSA 3HOUB 2WINB 4KN7C 4YCWA 5IP9H 4CKBA 2JEAI 2IL8A 2DNEA 2I07B 5FJ8G 1S5BD 4MHEA 2L4NA 4DNIA 1T5XD 2Q8TA 1YJ9A 3MFGA 1XMQQ 3O13A 4IPHA 3GTJH 1NAPA 4DF7A 2UUCL 1Y14B 2PQEA 1ILPA 4EX5A 4CJ0B 3RLFA 4A3BB 2AHOB 2UXCL 4QUCA 5D3DA 4R8IA 2TMPA 1ML0D 1KNAA 4XDXA 2A19A 1VQ5A 2PW5A 5DM73 1A62A 1K8OA 4DR4Q 1LO5D 2IWHA 3SE0A 4B9XA 4DV0Q 4J1MA 1F9RA 1QILA 4B3MQ 2CWPA 1PH8A 3ER0A 2VUMH 3S1RH 3DHQA 1VQIA 2EYMA 4A4IA 3GD7A 3CCLA 2QDBA 3EN2A 4DR6Q 2F0PA 4V190 2I5MX 1UEAB 3K5NA 4RFBA 3SDZA 5IYBH 1SE4A 2A6ED 4X65Q 5M5XH 2K6AA 1F77A 1IYJB 3K5MA 2K32A 4OO1I 2FHTA 3KLSX 4RGTA 2KUMA 3DXJC 3N6RA 1EY5A 4LUZA 4FVMA 3PO2G 4JBKA 2HHHQ 1PH6A 5ELNA 4JYAL 4GLAC 1TWFH 3NBIA 4JG2A 2B2TA 3STBD 4F88A 4K0KQ 1B8AA 2BDNA 5FLXL 2XGTA 2NVTB 1KD1C 5HURA 2R7ZB 1P8LA 4KTAA 3ND9A 1E7ZA 5C5MA 1I4QA 1U4PA 1H9MA 1UE1A 2B8GA 5GADC 3RNUA 5FJ8H 4H7BA 1I94Q 2AQ1B 2OEOA 1UUPA 5HY6A 4EQNA 3CCUA 5I4DA 4L5QA 2M00A 2KVMA 1LTAD 5JJLA 2CWAA 2OF1A 3S1QH 1RD9D 1JMCA 2VQFQ 5K5PA 2Q8RE 2HHHL 2YTXA 3NK9A 4N8X1 4R4CA 2MO0A 4FXGC 2E2IH 3DWPA 3VR4A 4JV5Q 1ENCA 3BZCA 3R2TA 1PYWD 3K0XA 4K0KL 4O1NA 1SXTA 2RKSA 2PMZE 1ZEQX 4DXGA 2EXZA 5EKKA 4DR2Q 2E5LL 2IY5B 2K33A 4YCUA 1S40A 4OELB 4HMJA 2UUBQ 4BY1B 4UDUC 2A73B 4YCVA 1X56A 1A3TA 1LTID 2HCCA 2EY1A 1BXTA 1XX8A 1JOOA 3VYTA 4HCEA 4MZ9A 2CQAA 5M3FB 1ASZA 4DV7L 3EROA 4DV3L 4CDFC 3MXNB 1B9MA 2WKDA 1UAPA 4NXNQ 1SE2A 4A3EB 1PFMA 4IJLA 2DUDA 1CT1D 5FLXE 3M85A 3MXNA 1KAAA 1CUKA 4RAUC 4ZUJA 4JV5L 1G91A 3K5LA 3PF4A 4MNOA 3VDYA 1CFMA 3VA7A 4ME3A 2ALYB 2L5TA 3HS0C 4MTKA 2N3SA 3PUZA 2AWOA 4QL5A 4GNXB 4ALPA 1AZQA 1L1OB 4ZCKA 2WFWA 1EWHA 1D6EC 4NKLA 3V2TA 5IGGA 2K03A 4O0AA 1L1OA 1RTOA 3I4MB 2BA1A 1D5ZC 3DLLA 4DAYB 3RMHA 3V96A 2R3ZA 1N32Q 1NE3A 2JXMB 2ZT9C 2K52A 5IYDH 4BY7B 3J80c 1LT4D 2DJFC 4KY6A 5ISRA 5JPNC 1SJED 2K5QA 2UU9Q 4JI1L 3ERSX 1HNZQ 4GZYC 1QZGA 1QVGA 1XNRQ 2F52A 3NHHA 4EVOA 1D2BA 3I56A 3WOFA 5IWAL 4YY3Q 2N88A 3HOXG 1TS4A 1EY0A 3RUZA 5CV8A 3X3MA 1Q82C 5C3WA 3I4NG 3RZOH 3Q6SA 2WB1B 1OXXK 5T1IA 3TN2A 4A3BG 4A3CG 5IOCA 1KIXA 3TQYA 2QW7A 5ELEA 4MIUA 3OIPA 4JVZA 5C0XJ 1X55A 2QGQA 4JPBW 1YNXA 1IYUA 4M1UB 2VZAA 2NN6G 3HOWB 3RR5A 1HHVA 4WFN3 2CH4W 1L1OC 1DYQA 4WRDA 3WWVA 2EYPA 2CH4A 2PO4A 1KXLA 4C1NK 1XMOQ 2AWNA 1WTQA 5LMNW 3S2DB 4JBJA 4GKKL 1IW7C 2RBMA 1V1PA 1KDAA 1SNMA 4LF7Q 1E1OA 4JCVE 3JAMc 4DUZQ 4EQPA 3S15H 3HOVG 3QO2A 1Y8OB 2K14A 4YWKA 1SYEA 2WIIB 4C2MH 1TR5A 2F4VL 2KEDA 3DM1A 3CD6A 1LTSD 4X6AH 3GV3A 5CBAE 2DY7A 4IFDH 4FF2A 1Q7YC 1U4RA 1YJWA 4POFA 3SHLA 1TS3A 3SGIA 3T1HL 2LXJA 1O7YA 2X6LA 3NUCA 3Q0AA 1TS2A 2Y0SG 4GKJQ 1LV9A 2E2DC 1IL8A 1GXDC 1STGA 3G6JB 1P16A 1W3SA 2A8VA 2R7ZG 3DM3A 1DD2A 2MP1A 4LF7L 3CQZB 3HOUH 4R1JA 4DUZL 3BU2A 3U9OA 1I6VC 1KRSA 1HA5A 2R93G 3OMCA 1RJTA 2F0IA 2Q2HA 4KI0A 3I55A 4BXXG 3R8BA 3VR6A 4HJ9A 1KC8C 3S1MH 3SK8A 1CKOA 3GDEA 2XTIA 3I4NH 1AE3A 4I7ZC 4A76A 1VQKA 2UUAL 1BOSA 4K8JA 4A3BH 4A3CH 3LX0A 3DUZA 1VQHA 2QDLA 3FMCA 4FF1A 2I5HA 3OWEB 2RCFA 1OXVA 3T4AC 1QNUA 4KHVA 1I4XA 2F0EA 4F7XA 1IL2A 4DK3C 4GKJL 1G6ZA 4JI4L 4FO2A 5C0XI 4XT3B 2IX0A 1K83B 3NBHB 2VUMB 3S1RB 3RD4A 3NTKA 4IUVA 5FLMG 1PH4A 5DLQE 3D4DA 4L5RC 3T51B 1VF7A 1HCZA 1HNXQ 4XXEA 2F0MA 4IUTA 4AYBG 5M5XB 2JA5B 4A3EG 1A6XA 3BZKA 2MNAA 2NVYB 2RA4A 3M3YB 2EY5A 4DK1A 5JVH3 3QWNA 2JQOA 2F0JA 1XTDA 1GKHA 5C44G 2L15A 1K9MC 4ILWA 3GTGB 2KOLA 3H0GG 3HKZB 2EPBA 2ZM6L 3URYA 3A0JA 3EJIA 1GHJA 1J6QA 2CCZA 3HZXA 2PNRC 3C2PA 2BH8A 2R7ZH 3ND8A 2AQ2B 1S5FD 3KF8A 2B39A 4GOPB 4DUYQ 1CA5A 1ESRA 4QIWB 2X6GA 4L5SA 3MTSA 2R93H 4BA1I 3GTOH 2XN9C 1WTHA 2ASBA 3S1QB 4GOPA 2FINB 4BXXH 4I7AA 1K8AC 1CSPA 3LGJA 5JJZA 1IBLL 3MA2B 5M5YB 2AUJD 3NWSA 3CW2C 1K0SA 3KYHC 4H13C 2I0QA 3CF5A 2OXPA 2JA9A 3S1NB 1RODA 3IKJA 5AJ3L 1E1TA 2VW9A 3L0OA 2B8FA 5C4HA 1A15A 4G4KA 3RLOA 2MQHA 1Z9FA 2JA6G 3F2UA 1PTOD 4POGA 4B3SQ 2F0NA 1CZWA 3BG3A 4N9PA 1BKBA 3W2DA 4IFDI 5KYLA 3MAQA 1NR4A 1XJVA 1SMYD 5BR8L 2K5VA 3QR8A 5FLMH 3F1ZA 4DUYL 3S9WA 2K4KA 5M5WB 3HOWG 2A68D 1FL0A 3FPPA 1K28A 1L0YB 1ONLA 1ET6A 4KHZA 3PO3B 4QF4A 5LMUQ 3LWEA 3K58A 3ZYYX 5A35A 4A3EH 1WD0A 1NJIC 2Q2TA 2SOBA 1SBBB 4N9TA 4GOPC 4X64L 3PO2B 1VQAA 4RKBA 3UDIA 3CKIB 3TP8A 1D8LA 1G6PA 4CKEA 2NBFA 2PQAB 4KN4C 3H0GH 2A6HD 1FVIA 2NTTA 1DONA 4CKCA 1EYGA 1HXYD 1JT8A 3I73A 4RGNA 5JAVA 2K50A 3V05A 2MJ8A 3PMFA 4IN3A 4OHJA 3ULLA 4KK7A 5D3IB 3SK5A 1CM9A 3NP8A 2RHSB 3I4MH 5ELCA 4FF4A 2MO1A 2BE5C 5EQ0A 1OXSC 2F3IA 1UEBA 5LMUL 2D5DA 2CQOA 3EIVA 3I4OA 2PI2E 1EY8A 1FD7D 4KHPL 1SRUA 1XXGA 1KQSA 1BDOA 2EYOA 5ELDA 4RGOS 3E9IA 5C4XG 4QQBX 1Q3LA 4DGZA 2VQEL 5LL6X 3J7A5 3KOJA 1ZYRC 3TMEA 1VQ7A 3RZOB 5EPKA 1TXYA 3IFDA 2E75C 1AN8A 4HTHA 4QGUA 2QILA 1TVXA 3QIAA 3HOYG 3A8JE 2F0OA 3AU7A 1SROA 5FK9C 4A3IG 1U5KA 4IPGA 2IHFA 3K81C 3PUYA 3MEFA 4LUOA 2JA6H 3PGZA 1B4OA 3AB9A 3TP5A 2JA7B 4CHTB 1NCVA 1STNA 1QZHA 1U4MA 2WV6D 3TP7A 3HOWH 5A2QL 2D0OA 3Q22A 4TKOB 5EKIA 4MTNA 4X3KA 1GO3E 4O2DA 4HMIA 1ENAA 3S15B 5KNCA 3A8KE 1SYGA 4FXKC 1FNWA 2ZTCA 1VQPA 4C2MB 1PZJD 2R61A 3ERQA 1Q8KA 4XIGS 4JI7Q 1VQ8A 3VYRA 2JA5G 1E24A 3S2HB 4FF3A 4DV6L 5JEAG 1ICWA 4GN3B 4CDCC 2B2VC 4LK1C 1SEBD 2E2HB 2YTYA 3D4RA 2LS01 4FYDA 2IX1A 1M4VA 3ITPA 3PUVA 1SLJA 2WKCA 4QJFA 1EZ6A 2EVBA 3K80C 3GTQB 1LACA 3OMGA 3HKZG 5KIXA 1Q8IA 4LF8Q 5E1FA 1B50A 1OXTA 1K73C 2LKVA 4PZ6A 4BBSG 4C56C 4Y7NB 3CCQA 3EQLC 1B3AA 3H91A 2KCCA 2G5DA 1WI5A 1N33L 2PNHA 3C3LA 2ZXPA 2UXBQ 3H3VC 4C3IG 5EBCA 1Y69U 3UE0A 4UP7A 3NTIA 1ASYA 3FKIB 1KDBA 3CQZH 4JI6L 1BCPB 3HOXB 2PPBC 3S1MB 5C4XH 2A6EC 1PH1A 1FJGQ 1QUQA 1M90C 4LFCQ 3I4NB 3D6WA 3UE1A 1HR0Q 5A2QE 4K5XA 2HDMA 2UXDL 3I90A 4A3IH 4NXMQ 5CV9A 4PG3A 3STBC 4K8IA 1BQQT 3M4OB 2H1EA 4OIJA 4TQUS 4YHHQ 2BH2A 1GUGA 4ME5A 2VB3X 3KLWA 4OO1G 1PH2A 1JOQA 1VQGA 1VQBA 4P74A 2KCNA 4DV2Q 3J7AF 5GAEC 1K83H 5JPMC 1RKNA 2OQKA 1GUNA 1XMQL 5IGCA 3HOVB 4LFCL 1H95A 3PO3G 1KHIA 1TQOA 2B3GA 4GLXA 2JA5H 2JA8G 1CKMA 2NVYH 3M3YH 2CKZB 2CHBD 5JEAH 4JI5Q 5BN5A 1MI2A 5IGBA 1F2YA 1EU3A 2PW7A 1QCBD 1BCPC 4PV1C 5KRUA 2EQSA 1BCPF 4DR4L 1V8QA 1C4QA 4YHHL 3QB3A 1KL9A 4DV0L 3GTGH 1RF2D 2F0UA 4LFBQ 4B3ML 3DWAA 4ULLA 2RDHA 4JI3Q 1YVCA 2AQ3B 2Y0SB 4RHRA 2NZOA 2ICEC 3TSSA 1XYIA 3WDNA 2KENA 3PIPA 1WTVA 2EJGC 1CA6A 1LTRD 2F3WA 3BS1A 4DR6L 1VQJA 2K5WA 4LJZC 2V4DA 1SYDA 1SAPA 1EUJA 2R93B 1S3OA 3GTOB 4HR7B 1SSOA 4C3HG 2N8NA 5NUCA 1KRTA 1WYDA 2R7FA 5CR3A 3GO5A 1SJHD 4X65L 1HA6A 2EDGA 1NY4A 2K04A 3NQIA 1PVOA 4Q0FA 3PIOA 3HKSA 2IJ0A 1YNJD 1GD7A 5KGUA 1DZ1A 1XWEA 5M5YH 2LSSA 1W2BA 5KNBA 5GAGC 4OWWB 3S1NH 2C5CA 4IALA 4K2KA 1XNQQ 2PZUA 3CU7A 5J1ZA 4ZYSA 2QEXA 4BA2I 5C3EB 2VY3A 2L9HA 4IJHA 2B2TC 4LWCA 5I9PA 1EEID 1VQCA 3BZDB 2QA4A 1BF4A 2H4OA 3OWFA 3I8ZA 3H09A 4R4QA 2JA7G 1NTGA 1LT6D 1PDQA 2ZXOA 3T13A 3AEVA 1DXMA 3I3CA 4P2CB 2F0GA 4PZ8A 2XWBB 3KK7A 1L2FA 1I94L 3G7LA 1AE2A 5M5WH 1ICFB 3OW7A 4KY5A 4AYBB 4DKAC 1EFWA 2EZVA 2VQFL 1K8MA 1HZBA 4QY7A 1K0RA 3PO3H 1N8RC 1S4ZA 1YHBA 4J15A 2RDGA 4KLKA 4KKSA 2JA8H 5C44B 1HH2P 2NVQH 1NR2A 3TRZA 4DR1Q 1IBKQ 3H0GB 4AH6A 3PO2H 4BS9A 4DR2L 5DM63 1TWGH 1DOKA 3CCSA 1GOZA 1H9JA 2DGYA 2UUBL 3P20A 4CDEC 4F87A 1HQMC 4O42A 1CKNA 3J81c 2JP1A 2J0TD 3CCRA 3IL8A 1A2UA 4OWTB 3F8TA 3B6YA 1FGBD 1TWAB 5FO7B 1KLGD 5IP7G 2XIWA 2YTVA 3NQTA 3A56A 1EWIA 4HSVA 4NXNL 1IHZA 1EY7A 1HNWQ 2RQXA 3S14B 2KEEA 2BCOA 1V1OA 1JB7A 3J7AV 4UAIA 3J81j 4IUNA 3FP9A 3FKIG 4L8JA 2A69D 4JK1C 1SE3A 5IGEA 2WAQE 5CMDA 4HEDA 4RKLA 1AFPA 2FFKB 5CV6A 4FDBA 3J80L 4YWLA 4X62Q 2DY8A 2JA6B 3CC2A 1E22A 3QG1A 1A8VA 1G51A 4HCSA 1C0AA 4DAMA 4HJ8A 2F1MA 4OX9Q 1H9SA 3E6ZX 1Y1VB 2ES2A 1EOVA 1VCIA 3C1FA 4S3SA 1YHQA 4XYOA 1PFSA 3NEMA 2N78A 1N32L 3E0EA 3CPWA 4RA8A 2JA7H 3H3VH 2GVAA 5G3LD 1B53A 1K3RA 1EEFD 2CW0D 2B63G 1DOLA 4OL7A 2K5NA 3TP6A 2UU9L 1V1PB 1HNZL 1STHA 1XNRL 3DEOA 3K5OA 2C9OA 4AQYQ 3SXHA 3D31A 5KYIA 4IUQA 1CZGA 4YY3L 4LF4Q 1E0BA 1WVLA 1X9NA 4PMWA 1JWMD 4NDXA 2YU9B 4QB4A 4K6DA 3UDGA 3ZJYC 1VS0A 2OQ0A 4X62L 1MKHA 3OHXC 5FKAC 4L63B 4NW2A 3SK6A 3S2HH 5IT9c 1J9OA 4C3JG 1V1QA 1ZKOA 1N9WA 3EFXD 3TREA 2E2HH 1II3A 1LUZA 3JAML 1QNKA 4X3UA 2K1BA 3QOJA 4LAAA 4EQ5A 3GTQH 1I50B 3HGBA 2HDLA 4A3DG 1QOHA 2FMCA 4H0LC 1TWHB 1BO0A 2JJQA 2E76C 5IP7H 1XMOL 2SNSA 4AQYL 1IZ6A 3J80E 4Y7NH 2JN4A 2Z9HA 3PQIA 5GAHC 1SMXA 2G9HD 4P75A 2PMZB 3BDCA 2VS1A 5M3MG 4ZRZA 5C4XB 2O2LD 4IUPA 2O5IC 1ILQA 1JWSD 1KLUD 1VQEA 1YNND 4HAEA 3J7ZC 1DJRD 3FKIH 4A3FG 3A74A 3J80i 2F0FA 3W1GA 3HOXH 3HOYB 4UHVA 1QVFA 1N36Q 2SDFA 4PMCA 4RH6A 4DR7Q 1PH3A 4A3IB 1PTOB 4DV4Q 1VF5C 1YJNA 1R9TB 1SDFA 1N34Q 1TY2A 1T5EA 3M7GA 1FGUA 1I3QB 1E2VA 1RHPA 4PNYA 1PH9A 4HN7A 4UP9A 4H02A 3I7FA 5CORA 2E74C 5E4WC 5E7NA 2RHQB 3C46A 2MHVA 1PFNA 3M4OH 1PZID 3LWUA 2NN6H 2H5XA 5C3EG 1X3PA 3HG9A 4APVA 2AKWB 2K75A 3OSOA 1SNOA 4DK0A 2B63H 2PYKA 1C7YA 3CRKC 4FNFA 3OIQA 4DAVA 3E9HA 2OTJA 2XNAC 3JAME 1STEA 1Z6HA 4PZ7A 4OEMB 5D65A 1Y1WG 3GTLH 2I5LX 1N36L 4Q5VA 3HOVH 2XSCA 2LFNA 1VQDA 1HUMA 4DV4L 4A3GG 4B08A 4E6IA 3KDFB 2L55A 2I46A 3JAMi 4C3JH 4KD4A 2HT1A 2ID0A 1KAWA 1QG7A 4G7OC 4FXDA 4DR3Q 1BNZA 1XPUA 3KDFA 5K36G 4ZQ3A 5AFWA 1IKMA 3M9BA 4LF6Q 3M4PA 3D6CA 4BBSB 1PTOC 5DNFA 1PXUA 3TZDA 1PTOF 4A3DH 4LNQA 4DA2A 1EY6A 2RVLA 3KF8B 1L0XB 3I4LA 2F4IA 3RZDB 4C3IB 1HNXL 1F9SA 2A68C 2QCPX 1MSHA 2R92G 1EQTA 1HTPA 4RCNA 1JICA 5M3MH 4UY8C 4RCOA 2MUYA 2TSSA 1JC7A 2RSNA 3CHBD 3MWYW 5EJWA 4BBRB 4JBWA 3GTMB 4IFDG 2ENBA 4A3FH 1TWCH 3KUPA 4WJ3M 4GN5A 1HZAA 5J3BA 2GVBA 1WTXA 5I2XA 4HIMA 1JWUD 2B2UA 4XT1B 2A6HC 2EIFA 1NMGA 4JI2Q 4B3RQ 1B70B 2ICIA 3QOLA 1F2LA 2AMCB 2NB0A 3R2IA 1Q1EA 2X69A 5COYA 4KD3A 1KTKA 4JI0Q 1Y1VG 5C3EH 3HFZB 1O7ZA 1JB3A 3RN2A 3R3OA 5E4XA 4X3TA 2FXQA 3CP0A 4HIOA 2ZTEA 3M4YA 1KNEA 2RDFA 2A1AA 1XTCD 3MZ5A 3BYYB 1Y1WH 4LF9Q 1A3VA 2JA8B 3UDXA 2C35B 2NVQB 3G4SA 4KJNA 2E2JB 4L5TA 1RCVD 2GA4B 4Z9CB 1CHPD 2NWGA 1U0LA 1TWGB 3IFTA 5EKLA 5C44H 1L0WA 4DFAA 5LL6S 1QWYA 3HOZG 3S16H 4HJ5A 1QVCA 1J5EQ 3CC7A 3S17H 1IXRA 3KF6A 1SNCA 1VQ6A 5K36H 2EOTA 2B2UC 4B3SL 4R4OA 1AEXA 1VMPA 3BYTB 2M9VA 5ELBA 3CAMA 3FRPB 1F9PA 4LFAQ 3RLNA 2PZTA 1HFGA 4XYQA 2Z4IA 3D8GA 4C3HB 1TWAH 1EYDA 5IY0A 1JR0D 1PMRA 1WCMB 2F0DA 4L6TB 5JJKA 1WFQA 4ZAIA 4B3TQ 2NUCA 4NB3A 3H15A 2NZ1D 4DV1Q 3MFYA 3S14H 1MSGA 3CMAA 1GUOA 2L12A 1C9OA 1Q12A 5JEAJ 2Q8IB 1LT3D 3T1YQ 3P75A 1YITA 1TIID 2FMMA 3G48A 1D5MC 2HCIA 2KHSA 2Z4HA 2HUGA 1JOKA 4WORA 4A3MB 3MVVA 1Y1VH 3AFQA 1X3EA 5IGDA 1Y8PB 4K14A 3I70A 1JORA 1B1ZA 1STYA 1X3GA 4KMUC 3NSWA 4YIJA 3VR3A 3D4WA 3JC66 3PF5A 4KY7A 1I5FA 2P5ZX 3K0YA 4IPDA 1I4HA 3CCJA 1Q1BA 3CCEA 1PLFA 1T9HA 1F2ZA 1FR3A 3J7YW 1G8ZD 3G71A 1KABA 3NTHA 3I91A 2L1BA 1IBMQ 3CC4A 1VMCA 1CSQA 1W6KA 4I65A 4U673 1YZ6A 2YU9H 4DR5Q 3TBIB 4LF5Q 4KKTA 2IT1A 1E3PA 3FHWA 2F03A 4A93G 2J7ZA 5LMNQ 1JCKB 2KCMA 2YV5A 4K5VA 3PCOB 1GUTA 5IE8A 1EOTA 1UE6A 2BA0A 3U58A 2F0VA 3DEPA 3OTOQ 2RF4A 5DEHA 4OIKA 5C3XA 3OYYA 1IKLA 4EGVA 2UUCQ 1I50H 4NP5A 2JK8A 2L11A 1D5XC 3CRLC 2WAQG 1TWHH 1RDPD 3E5SA 3OOCA 5C4JH 1NMFA 3OPOA 4H44C 2UXCQ 1S5ED 1U9RA 1BR9A 4CJ1B 2IX3A 1QUQB 2F3VA 5I6WA 4JI7L 2A5HA 4XQJA 2KQ3A 4DR5L 1ENFA 2KHJA 2BOSA 4BBRG 4LF5L 5I6YA 3GTKH 1X6OA 2O5JC 3W3AA 3RN5A 1EIFA 4N8FA 5HGQA 1BBUA 2N49A 1PZKD 1AW7A 4J8QA 3HOYH 2K5DA 1I6HB 5LMNL 2NTSA 1B9NA 1GUWA 3K57A 5EPLA 3U50C 4R4TA 1PTOH 4LF8L 4OGQC 1IYVA 2DN8A 3HRZC 5JVG3 1R9TH 3OTOL 1EZ8A 3C1EA 1I3QH 5E3FA 2JSOA 4DAPA 2B63B 4KJOA 3TDQA 2ZJQA 1S5CD 1PRTD 4HIKA 1MIUA 5J39A 2Q2IA 5D14A 3SK4A 1BUVT 2UXBL 5CYUA 1X65A 1FNUA 3D0FA 4P73A 2N55A 2EE1A 1C8CA 5IODA 4F8MA 4JOIA 3GTLB 1SE8A 3TS0A 3D3RA 1FJGL 4JYAQ 4B9WA 2B2WA 4ZKCB 1HR0L 1YNJC 1TU2B 3SR1A 2OCEA 4C3JB 5DAUA 4NXML 1TY0A 4LW1A 3TS2A 1EY9A 3OW2A 2MFIA 1HRJA 2WB1E 1K3BC 1E2WA 4A93H 2XVSA 1J8IA 4X3SA 2K28A 3VA5A 1UWVA 3QJYA 1H9KA 2IPKD 3G6EA 3CCVA 4A3DB 3TEHB 2DJGC 5FLXc 2YYZA 4TSSA 2PI2A 2FJ2A 2Q2UA 4DV2L 4BBSH 4M8AA 3AYHB 5M3MB 3RZDH 3KBGA 4C3IH 1EU4A 1TS5A 1DCZA 2F0LA 1CQVA 1EYAA 2MGSA 3GTPB 4A3FB 1TWCB 1WCMG 4JOIC 3K6OA 3MHBA 5EPJA 3PSIA 4QUFA 5EBDA 2E5LQ 4JI5L 4BBRH 4HJAA 3F2BA 1O7IA 2B2WC 3GTMH 2L0CA 4Y52H 1C48A 4IPCA 4A3JB 1VQ9A 2RCNA 2EXDA 5IYDG 4LFBL 3MXPA 1W6JA 4RHSA 4JI3L 3U4ZA 2E8GA 5EAYA 4DV7Q 1SNQA 4DV3Q 4ODGA 1GJXA 5CV7A 1EIYB 3W1BA 4DV5Q 4OO1H 4HJ7A 4LUVA 3BVZA 1LM0A 4A3MG 2NVXH 4WJ4A 1H9RA 1ZXTA 4DK6C 2HD3A 3VR2A 4RMFA 1BCPD 2G9DA 1Y1WB 3N52A 1DM0B 5GQOA 5C6AA 2HIVA 3ICEA 3VYSA 4A3GB 1UNSA 5IGFA 2V1CC 2EY6A 5JOBA 5C4ZA 1G2TA 2KHIA 1SYFA 2A69C 1B7YB 3MXUA 1GVPA 4ZKBB 1LT5D 4R9WA 1RL2A 1VQMA 2E2JH 3S16B 1EQVA 3S17B 1R4QB 1CKNB 1XNQL 1HZCA 1QE6A 2VXWA 1SYBA 1STBA 1X54A 4DV5L 4G7ZC 2LY7A 3K7AB 4JI1Q 3T53B 5JJIA 4WJWA 3E3XA 3X3NA 2EYJA 5EGTA 3U9SA 4IQZA 3F2CA 5G3LF 2R92B 2CW0C 5IWAQ 3H3VI 1HTLD 1WD1A 2XWJB 4C3HH 1JE5A 3TZUA 3J81L 1WCMH 1QB5D 1PH7A 3VR5A 3PUXA 3WOEA 5J22A 4GNXA 1JJCB 1EY4A 2VL6A 3NELA 4DR1L 1XPRA 1MGSA 1IBKL 2F0SA 3KBXA 4A3KG 1MD2D 1NBWA 4DNRB 1H9SB 4G57A 2VB2X 1WTWA 4EQOA 1GM5A 4DAYA 3HKZE 3HOUG 3A55A 2CFMA 5KEEA 2NZHA 4ZUIA 4AIMA 3P7JA 3R93A 2K01A 4LMQD 4GKKQ 1D7QA 2AUKA 2K5HA 5T1GA 4OWXB 4QMGA 4A3MH 4JC0A 5IYCG 1B2TA 3NE5B 1HNWL 4P72A 2Z6KA 2KCTA 1SFOH 2F4VQ 1Y8NB 4U68A 1E2ZA 2IHEA 4QIWE 1SNDA 2VNUD 1WJJA 2EJMA 3F2DA 3A8IE 4PMBA 1SR3A 3BVGA 2EYHA 1WTRA 4IOAA 1YNNC 2EJFC 1X32A 1LTGD 5FO9B 3T1HQ 1VDZA 1EFID 1I4GA 4GNXC 4RG1A 3HOZB 2R6GA 2BDOA 5FOBB 2LXKA 4OX9L 1NNXA 3H6MA 4GS3A 1EIGA 5I2YA 1CHQD 1I4PA 1KDCA 5CGKA 2KJXA 3J81E 1O80A 2NYZD 2PZWA 2JE6I 1X3FA 2OT2A 3EBEA 1S72A 2D2CC 4FP5D 1F2MA 5FO8B 4X66Q 2ZXRA 2NN6I 4DPGA 1ESFA 1YEZA 4ZLTF 5C4JB 5IT9L 3J81i 4OXPA 5C5LA 5BN3A 5M9OA 4BWGB 4LF4L 2Z6KC 3IRBA 2UUAQ 4CBVA 2B2YA 3GTKB 5C0XG 2D0PA 3H94A 2ZJRA 4JI4Q 1VQNA 1M1KC 4A3KH 1OO9B 1A0IA 3AQQA 1HR0W 2QEJC 2EYLA 3NWTA 3NXWA 1I6HH 4A3JG 2GN5A 1YIJA 4J6HA 1IW7D 3GTJB 5H1SE 1D1KA 2XRQD 2J4XA 4X66L 1NSNS 1CQFA 3EVQA 5IYCH 1I4RA 4XTCS 1LLRD 1M8AA 1AH9A 2ZJPA 1G2SA 2DNCA 1HJPA 4IURA 1YHAA 2PCFB 3MEHA 5F2DA 3PUWA 4ZK9B 4IFDJ 1BBWA 4TRDA 4PQXA 3SEBA 2ZM6Q 3ONAB 4DR7L 3K59A 1LTBD 3DWQA 2B2YC 3FPUB 4BY1G 3SVMA 3Q24A 3NENA 4A93B 5IT9E 5CV4A 5HGTA 1N34L 1A3UA 1PYSB 3NBHA 2RSOA 2WP8J 2Z1CA 5M3FG 1WOCA 1PHJA 1TKWB 1Q86C 3DMUA 1HPCA 1HZ9A 5ELFA 3VYUA 1Q46A 4KKUA 3ULJA 1V43A 2WACA 1TT2A 1MBYA 4YWMA 1SMYC 2WAQB 5BN4A 2JEBI 3CMEA 1IBLQ 1TWFB 1RTNA 3ULPA 3S24A 1WTPA 1AZPA 1DOMA 2KA7A 1YI2A 4TVAB 5KNDA 4CGYB 1F9QA 4JI8Q 1RIPA 3PV0A 5AJ3Q 1XPOA 3M7NA 4OONA 5C0XH 3I72A 3MXGA 3GTPH 2EY2A 4C1NI 3K7UC 2NVTH 1FYCA 1AP0A 4DN4M 3T16A 1PA6A 3I4MG 4DR3L 1JJ2A 3CPFA 3AMUA 1U4LA 5BR8Q 3KLRA 3L9AX 4LF6L 4A3JH 2O4XA 1JE4A 2EYFA 4BY7G 4NPSA 1UE5A 3FVQA 1EYCA 4A3LG 2QF7A 1VQLA 2D9UA 5ELOA 2NVXB 2E2IB 2XRSD 3EA6A 1YBYA 4X64Q 4JI8L 1Q81C 1PYBA 1EL0A 2LMCB 2WB1G 1MHWC 4DNTB 4KV6A 3KJOA 1VQ4A 3CCMA 2MPMA 2ATWA 1BVSA 1DGSA 4A3GH 1JQYD 2IW3A 4BY1H 2F0TA 3L7ZC 1R4PB 2JYOA 1NUCA 3I2ZA 3KF6B 1OXUA 3BDOA 4JI2L 4B3RL 1D1IA 4G7HC 3A54A 3T56B 4JBMA 3L2PA 5I9OA 2SNMA 5M3FH 2HQLA 3KLSA 2SEBD 2R7DA 1QJOA 4JI0L 2QKIC 1BBXC 4NMZA 3IAYA 1A2TA 3P1HA 3GV6A 1GUSA 4KHPQ 3Q23A 3K7AH 1WTOA 1GHKA 4RWSC 2K05A 5CBEE 2VQEQ 4A75A 2D62A 2R92H 3Q8DA 4LF9L 1LYLA 3FDTA 4DXFA 4HIDA 3W5OA 4R4IA 2PQAA 5CV5A 3KFUA 4UPAA 4ABNA 1LTLA 1SN8A 3E0JA 2OWOA
chains in the Genus database with same CATH topology
3UI2A 1EIHA 3GP7A 3HP3A 4K6LA 4IZ8A 2M2LA 1B44D 1PRTB 4XQQA 4V0BA 2K7VA 2F0QA 2Z8LA 4HSPA 1X3QA 2B2VA 1HUNA 3GQBA 2KECA 3PIP3 1SFOB 2HQEA 1STAA 1HQRD 1HFNA 4DU9A 2A74C 1FNVA 4K2LA 1CK1A 4XQNA 4RGMA 3L3OC 1SYCA 1Q90A 3PIO3 1Z7TA 1ET9A 1EWCA 1O7LA 4ID6A 2BE5D 1CI3M 4CJ2C 3NPPA 1LTTD 5CC4A 2CVRA 1PRTC 4MN3A 1PRTF 1ZYRD 5IIFA 1S5DD 3FEWX 3MC0B 1Z47A 1G291 1O78A 3A7AB 4IUUA 3BDLA 3HEJA 4QCLA 2F0WA 4K5WA 5LHY1 3LNNA 1SNPA 2F0HA 4A3KB 1PFBA 2F0KA 1LABA 3BVMA 1CTMA 4R8NA 3A7LA 5TSSA 3HOUB 2WINB 4KN7C 4CKBA 2JEAI 2IL8A 2DNEA 2I07B 1S5BD 4MHEA 2L4NA 1T5XD 2Q8TA 3MFGA 3O13A 1NAPA 4DF7A 2PQEA 1ILPA 4CJ0B 3RLFA 4A3BB 4QUCA 5D3DA 4R8IA 2TMPA 1ML0D 1KNAA 4XDXA 2PW5A 5DM73 1K8OA 1LO5D 2IWHA 3SE0A 4B9XA 4J1MA 1F9RA 1QILA 3DHQA 2EYMA 3GD7A 2QDBA 2F0PA 4V190 1UEAB 3K5NA 4RFBA 3SDZA 1SE4A 2A6ED 2K6AA 1F77A 3K5MA 2K32A 4OO1I 2FHTA 3KLSX 4RGTA 2KUMA 3DXJC 3N6RA 1EY5A 4FVMA 3NBIA 2B2TA 4F88A 2BDNA 5FLXL 2NVTB 5HURA 2R7ZB 4KTAA 3ND9A 5C5MA 1I4QA 1U4PA 1H9MA 2B8GA 4H7BA 2AQ1B 2OEOA 1UUPA 4EQNA 5I4DA 2M00A 2KVMA 1LTAD 2OF1A 1RD9D 5K5PA 2Q8RE 3NK9A 4FXGC 3DWPA 3VR4A 1ENCA 1PYWD 3R2TA 4O1NA 1SXTA 2RKSA 1ZEQX 4DXGA 2EXZA 5EKKA 2K33A 4HMJA 4BY1B 4UDUC 2A73B 1A3TA 1LTID 2HCCA 2EY1A 1BXTA 1XX8A 1JOOA 3VYTA 4HCEA 2CQAA 5M3FB 3EROA 1B9MA 2WKDA 1UAPA 1SE2A 4A3EB 1PFMA 5FLXE 1CT1D 3M85A 3MXNA 1KAAA 4RAUC 4ZUJA 1G91A 3K5LA 1CFMA 3VA7A 2L5TA 3HS0C 3PUZA 2AWOA 1AZQA 1EWHA 1D6EC 4NKLA 3V2TA 5IGGA 2K03A 1RTOA 3I4MB 2BA1A 1D5ZC 3RMHA 3V96A 2R3ZA 2JXMB 2ZT9C 4BY7B 1LT4D 4KY6A 5ISRA 5JPNC 1SJED 2K5QA 4GZYC 3NHHA 4EVOA 1D2BA 3WOFA 2N88A 1TS4A 1EY0A 3RUZA 5CV8A 3X3MA 5C3WA 3Q6SA 2WB1B 1OXXK 5T1IA 3TN2A 5IOCA 5ELEA 4MIUA 3OIPA 5C0XJ 1IYUA 4M1UB 2NN6G 3HOWB 1HHVA 4WFN3 1DYQA 4WRDA 2EYPA 2PO4A 4C1NK 2AWNA 1WTQA 3S2DB 1IW7C 2RBMA 1V1PA 1KDAA 1SNMA 4EQPA 3QO2A 1Y8OB 1SYEA 2WIIB 1TR5A 2KEDA 3DM1A 1LTSD 3GV3A 5CBAE 2DY7A 4FF2A 1U4RA 3SHLA 1TS3A 1O7YA 2X6LA 3NUCA 3Q0AA 1TS2A 1LV9A 2E2DC 1IL8A 1GXDC 1STGA 3G6JB 1DD2A 2MP1A 3CQZB 3U9OA 1I6VC 1HA5A 3OMCA 1RJTA 2F0IA 4KI0A 3R8BA 3VR6A 3SK8A 4I7ZC 1BOSA 4K8JA 3LX0A 3DUZA 3FMCA 4FF1A 3OWEB 1OXVA 3T4AC 1QNUA 4KHVA 1I4XA 2F0EA 4F7XA 1G6ZA 4FO2A 5C0XI 4XT3B 2IX0A 1K83B 2VUMB 3S1RB 3RD4A 3NTKA 4IUVA 3D4DA 3T51B 1VF7A 1HCZA 4XXEA 2F0MA 4IUTA 5M5XB 2JA5B 1A6XA 2NVYB 2RA4A 3M3YB 2EY5A 4DK1A 5JVH3 3QWNA 2F0JA 4ILWA 3GTGB 2KOLA 3HKZB 2EPBA 3URYA 3EJIA 1GHJA 3HZXA 2PNRC 3C2PA 3ND8A 2AQ2B 1S5FD 3KF8A 2B39A 1CA5A 1ESRA 4QIWB 2X6GA 3MTSA 4BA1I 2XN9C 3S1QB 2FINB 5JJZA 3MA2B 5M5YB 2AUJD 3NWSA 4H13C 2OXPA 3S1NB 1RODA 3IKJA 2B8FA 5C4HA 1A15A 4G4KA 3F2UA 1PTOD 2F0NA 1CZWA 3BG3A 4N9PA 3W2DA 4IFDI 5KYLA 3MAQA 1NR4A 1SMYD 3S9WA 5M5WB 2A68D 3FPPA 1L0YB 1ONLA 1ET6A 4KHZA 3PO3B 4QF4A 3LWEA 3K58A 3ZYYX 5A35A 1WD0A 2SOBA 1SBBB 4N9TA 3PO2B 4RKBA 3CKIB 3TP8A 4CKEA 2NBFA 4KN4C 2A6HD 2NTTA 1DONA 4CKCA 1HXYD 3I73A 4RGNA 5JAVA 3V05A 2MJ8A 3PMFA 4IN3A 4OHJA 4KK7A 5D3IB 3SK5A 1CM9A 3NP8A 5ELCA 4FF4A 2BE5C 5EQ0A 1OXSC 2D5DA 1EY8A 1FD7D 1XXGA 1BDOA 2EYOA 5ELDA 4RGOS 1Q3LA 4DGZA 5LL6X 1ZYRC 3TMEA 3RZOB 5EPKA 3IFDA 2E75C 1AN8A 4HTHA 2QILA 1TVXA 3QIAA 3A8JE 2F0OA 3AU7A 5FK9C 3PUYA 1B4OA 3AB9A 3TP5A 2JA7B 4CHTB 1NCVA 1STNA 1U4MA 2WV6D 3TP7A 5A2QL 3Q22A 4TKOB 5EKIA 4X3KA 4HMIA 1ENAA 3S15B 5KNCA 3A8KE 1SYGA 4FXKC 1FNWA 4C2MB 1PZJD 2R61A 3ERQA 4XIGS 3VYRA 3S2HB 4FF3A 5JEAG 1ICWA 2B2VC 4LK1C 1SEBD 2E2HB 3D4RA 2LS01 4FYDA 2IX1A 1M4VA 3ITPA 3PUVA 2WKCA 1EZ6A 2EVBA 3GTQB 1LACA 3OMGA 5KIXA 1Q8IA 5E1FA 1B50A 1OXTA 2LKVA 4C56C 4Y7NB 3EQLC 1B3AA 3H91A 2KCCA 3C3LA 2ZXPA 3H3VC 4C3IG 5EBCA 1Y69U 3NTIA 3FKIB 1KDBA 1BCPB 3HOXB 2PPBC 3S1MB 2A6EC 3I4NB 3D6WA 5A2QE 4K5XA 2HDMA 3I90A 5CV9A 4K8IA 1BQQT 3M4OB 2H1EA 4OIJA 4TQUS 1GUGA 4ME5A 2VB3X 4OO1G 1JOQA 2KCNA 3J7AF 5JPMC 1RKNA 1GUNA 5IGCA 3HOVB 1TQOA 5JEAH 2CHBD 5BN5A 1MI2A 5IGBA 1F2YA 1EU3A 2PW7A 1QCBD 1BCPC 4PV1C 5KRUA 1BCPF 1V8QA 1C4QA 3QB3A 1RF2D 2F0UA 3DWAA 4ULLA 2RDHA 2Y0SB 2AQ3B 4RHRA 2ICEC 3TSSA 1XYIA 3WDNA 1WTVA 1CA6A 2EJGC 1LTRD 2F3WA 3BS1A 2K5WA 4LJZC 2V4DA 1SYDA 1SAPA 2R93B 3GTOB 4HR7B 1SSOA 4C3HG 5NUCA 5CR3A 3GO5A 1SJHD 1HA6A 2EDGA 2K04A 3NQIA 4Q0FA 2IJ0A 1YNJD 5KGUA 1DZ1A 1XWEA 5KNBA 2C5CA 4IALA 4K2KA 2PZUA 3CU7A 5J1ZA 4ZYSA 4BA2I 5C3EB 2L9HA 2B2TC 5I9PA 1EEID 3BZDB 1BF4A 2H4OA 3OWFA 3I8ZA 3H09A 1LT6D 1PDQA 2ZXOA 3T13A 1DXMA 3I3CA 4P2CB 2F0GA 2XWBB 3KK7A 3G7LA 3OW7A 4KY5A 4AYBB 2EZVA 1K8MA 1S4ZA 2RDGA 4KKSA 5C44B 1NR2A 3H0GB 4BS9A 5DM63 1DOKA 1GOZA 1H9JA 3P20A 4F87A 1HQMC 4O42A 2JP1A 2J0TD 3IL8A 1A2UA 1FGBD 1TWAB 5FO7B 1KLGD 2XIWA 3NQTA 3A56A 4HSVA 1IHZA 1EY7A 2RQXA 3S14B 2KEEA 2BCOA 1V1OA 3J7AV 4UAIA 4IUNA 4L8JA 2A69D 4JK1C 1SE3A 5IGEA 5CMDA 4HEDA 4RKLA 1AFPA 2FFKB 5CV6A 3J80L 2DY8A 2JA6B 3QG1A 4HCSA 2F1MA 1H9SA 3E6ZX 1Y1VB 1VCIA 3C1FA 4S3SA 4XYOA 4RA8A 5G3LD 1B53A 1EEFD 2CW0D 1DOLA 4OL7A 3TP6A 1V1PB 1STHA 3DEOA 3K5OA 2C9OA 3SXHA 3D31A 5KYIA 4IUQA 1CZGA 1E0BA 1WVLA 4PMWA 1JWMD 4NDXA 2YU9B 4QB4A 4K6DA 3OHXC 5FKAC 4L63B 4NW2A 3SK6A 1J9OA 4C3JG 1ZKOA 3EFXD 1II3A 3JAML 1QNKA 4X3UA 2K1BA 3QOJA 4LAAA 1I50B 3HGBA 2HDLA 1QOHA 2FMCA 4H0LC 1TWHB 1BO0A 2E76C 2SNSA 3J80E 2G9HD 2PMZB 3BDCA 4ZRZA 5C4XB 2O2LD 4IUPA 2O5IC 1ILQA 1JWSD 1KLUD 1YNND 4HAEA 1DJRD 2F0FA 3HOYB 2SDFA 4PMCA 4RH6A 4A3IB 1PTOB 1VF5C 1R9TB 1SDFA 1TY2A 1T5EA 3M7GA 1I3QB 1E2VA 1RHPA 4PNYA 4HN7A 5CORA 2E74C 5E4WC 3C46A 2MHVA 1PFNA 1PZID 3LWUA 2NN6H 1X3PA 3HG9A 3OSOA 1SNOA 4DK0A 2PYKA 3CRKC 4FNFA 3OIQA 4DAVA 2XNAC 3JAME 1STEA 1Z6HA 5D65A 4Q5VA 2XSCA 2LFNA 1HUMA 4B08A 4E6IA 2L55A 2I46A 4KD4A 2ID0A 1QG7A 4G7OC 4FXDA 1BNZA 5K36G 4ZQ3A 5AFWA 1IKMA 3D6CA 4BBSB 1PTOC 5DNFA 1PXUA 3TZDA 1PTOF 4DA2A 1EY6A 2RVLA 1L0XB 3I4LA 2F4IA 3RZDB 4C3IB 1F9SA 2A68C 2QCPX 1MSHA 1EQTA 1HTPA 4RCNA 1JICA 4RCOA 2MUYA 2TSSA 1JC7A 2RSNA 3CHBD 3MWYW 4BBRB 5EJWA 4JBWA 3GTMB 4IFDG 2ENBA 3KUPA 1WTXA 5I2XA 1JWUD 2B2UA 4XT1B 2A6HC 2ICIA 3QOLA 1F2LA 2NB0A 3R2IA 1Q1EA 2X69A 5COYA 4KD3A 1KTKA 1O7ZA 1JB3A 3R3OA 5E4XA 4X3TA 3M4YA 1KNEA 2RDFA 1XTCD 3MZ5A 3BYYB 1A3VA 2JA8B 2NVQB 4KJNA 2E2JB 1RCVD 2GA4B 4Z9CB 1CHPD 2NWGA 1TWGB 3IFTA 5EKLA 4DFAA 5LL6S 1QWYA 1SNCA 5K36H 2EOTA 2B2UC 1AEXA 1VMPA 3BYTB 2M9VA 5ELBA 3FRPB 1F9PA 2PZTA 1HFGA 4XYQA 2Z4IA 3D8GA 4C3HB 1EYDA 1JR0D 1PMRA 1WCMB 2F0DA 4L6TB 4ZAIA 2NUCA 2NZ1D 3MFYA 1MSGA 1GUOA 2L12A 1Q12A 5JEAJ 2Q8IB 1LT3D 3P75A 1TIID 2FMMA 1D5MC 2HCIA 2KHSA 2Z4HA 2HUGA 1JOKA 4WORA 4A3MB 3MVVA 5IGDA 1Y8PB 4K14A 3I70A 1JORA 1B1ZA 1STYA 4KMUC 3NSWA 4YIJA 3VR3A 3D4WA 4KY7A 3K0YA 1I4HA 1Q1BA 1PLFA 3J7YW 1F2ZA 1FR3A 1G8ZD 1KABA 3NTHA 3I91A 2L1BA 1VMCA 1W6KA 4I65A 4U673 3TBIB 4KKTA 2IT1A 2F03A 2J7ZA 1JCKB 4K5VA 1GUTA 1EOTA 2BA0A 2F0VA 3DEPA 5DEHA 4OIKA 5C3XA 1IKLA 4EGVA 4NP5A 2L11A 1D5XC 3CRLC 1RDPD 3E5SA 3OOCA 3OPOA 4H44C 1S5ED 1U9RA 1BR9A 4CJ1B 2IX3A 5I6WA 2F3VA 2A5HA 4XQJA 2KQ3A 1ENFA 2BOSA 5I6YA 2O5JC 3W3AA 1PZKD 1AW7A 4J8QA 2K5DA 1I6HB 2NTSA 1B9NA 1GUWA 3K57A 5EPLA 1PTOH 4OGQC 1IYVA 2DN8A 3HRZC 5JVG3 1EZ8A 3C1EA 5E3FA 2JSOA 4DAPA 2B63B 4KJOA 3TDQA 1S5CD 1PRTD 5J39A 5D14A 3SK4A 1BUVT 5CYUA 1FNUA 2N55A 2EE1A 1C8CA 5IODA 4F8MA 3GTLB 3D3RA 4B9WA 2B2WA 4ZKCB 1YNJC 1TU2B 3SR1A 4C3JB 5DAUA 1TY0A 1EY9A 1HRJA 1E2WA 2XVSA 1J8IA 4X3SA 2K28A 3VA5A 3QJYA 1H9KA 2IPKD 4A3DB 2YYZA 4TSSA 2FJ2A 4M8AA 5M3MB 3KBGA 1EU4A 1TS5A 1DCZA 2F0LA 1CQVA 1EYAA 2MGSA 3GTPB 4A3FB 1TWCB 3K6OA 3MHBA 5EPJA 4QUFA 5EBDA 2B2WC 2L0CA 1C48A 4A3JB 3MXPA 1W6JA 4RHSA 1SNQA 4ODGA 1GJXA 5CV7A 4OO1H 3BVZA 1H9RA 1ZXTA 3VR2A 1BCPD 2G9DA 1Y1WB 3N52A 1DM0B 5C6AA 3VYSA 4A3GB 1UNSA 5IGFA 5JOBA 2EY6A 5C4ZA 1G2TA 1SYFA 2A69C 3MXUA 4ZKBB 1LT5D 4R9WA 3S16B 1EQVA 3S17B 1R4QB 1QE6A 2VXWA 1SYBA 1STBA 4G7ZC 2LY7A 3K7AB 3T53B 4WJWA 3X3NA 2EYJA 5EGTA 3U9SA 4IQZA 2R92B 5G3LF 2CW0C 1HTLD 1WD1A 2XWJB 3TZUA 3J81L 1QB5D 3VR5A 3PUXA 3WOEA 5J22A 1EY4A 1MGSA 2F0SA 3KBXA 1MD2D 4DNRB 1H9SB 4G57A 2VB2X 1WTWA 4EQOA 4DAYA 3A55A 5KEEA 4ZUIA 3P7JA 3R93A 2K01A 4LMQD 2AUKA 5T1GA 4QMGA 1B2TA 3NE5B 1Y8NB 4U68A 1E2ZA 1SNDA 2VNUD 2EJMA 3A8IE 4PMBA 3BVGA 2EYHA 1WTRA 1YNNC 2EJFC 1X32A 1LTGD 5FO9B 1VDZA 1EFID 1I4GA 3HOZB 2R6GA 2BDOA 5FOBB 3H6MA 5I2YA 1EIGA 1CHQD 1I4PA 1KDCA 5CGKA 2KJXA 3J81E 1O80A 2NYZD 2PZWA 2JE6I 2OT2A 2D2CC 4FP5D 1F2MA 5FO8B 2ZXRA 2NN6I 1ESFA 4ZLTF 5C4JB 5IT9L 5C5LA 5BN3A 5M9OA 4BWGB 4CBVA 2B2YA 3GTKB 5C0XG 3H94A 1OO9B 2QEJC 2EYLA 3NWTA 3NXWA 4J6HA 1IW7D 3GTJB 1D1KA 2XRQD 2J4XA 1NSNS 1CQFA 3EVQA 1I4RA 4XTCS 1LLRD 1M8AA 1G2SA 2DNCA 4IURA 2PCFB 3MEHA 5F2DA 3PUWA 4ZK9B 4IFDJ 4TRDA 4PQXA 3SEBA 3ONAB 3K59A 1LTBD 3DWQA 2B2YC 3FPUB 3SVMA 3Q24A 4A93B 5IT9E 5CV4A 5HGTA 1A3UA 3NBHA 2RSOA 2WP8J 2Z1CA 1TKWB 3DMUA 1HPCA 5ELFA 3VYUA 4KKUA 1V43A 2WACA 1TT2A 1MBYA 1SMYC 5BN4A 2WAQB 2JEBI 1TWFB 1RTNA 1WTPA 1AZPA 1DOMA 2KA7A 5KNDA 4CGYB 1F9QA 3PV0A 3M7NA 5C0XH 3I72A 3MXGA 2EY2A 4C1NI 1FYCA 1AP0A 4DN4M 3T16A 3AMUA 1U4LA 3KLRA 3L9AX 2O4XA 1JE4A 2EYFA 3FVQA 1EYCA 2QF7A 2D9UA 2NVXB 2E2IB 2XRSD 3EA6A 1EL0A 2LMCB 4DNTB 4KV6A 2MPMA 1JQYD 2IW3A 2F0TA 3L7ZC 1R4PB 2JYOA 1NUCA 1OXUA 3BDOA 1D1IA 4G7HC 3A54A 3T56B 5I9OA 2SNMA 3KLSA 2SEBD 1QJOA 2QKIC 1BBXC 4NMZA 3IAYA 1A2TA 3P1HA 3GV6A 1GUSA 3Q23A 1WTOA 1GHKA 4RWSC 2K05A 5CBEE 2D62A 3FDTA 4DXFA 5CV5A 4ABNA 4IFDH 3E0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI2 A;  2Q8R E;  1EIH A;  2B2V C;  2IL8 A;  4IUV A;  4MHE A;  2L4N A;  1WD0 A;  2B2W A;  2Q8T A;  3HP3 A;  1DOM A;  2SDF A;  1F2L A;  2KEE A;  1QE6 A;  1XYI A;  1AZP A;  2VXW A;  1F9Q A;  1WTV A;  1CA6 A;  4UAI A;  2X69 A;  5COY A;  4ZKC B;  1NAP A;  4ZLT F;  1SDF A;  2M2L A;  1PLF A;  4IUT A;  1SAP A;  1HHV A;  1B50 A;  1ILP A;  1O7Z A;  4CJ0 B;  5E4X A;  1RHP A;  1SSO A;  1HRJ A;  4X3T A;  5CMD A;  3I91 A;  4X3S A;  2L1B A;  2K28 A;  2RA4 A;  4HED A;  4QUC A;  5COR A;  1KNE A;  1VMC A;  2FFK B;  4DN4 M;  4R8I A;  1WTQ A;  1ML0 D;  5E4W C;  1DON A;  1HA6 A;  1B3A A;  1PFN A;  3H91 A;  1J8I A;  2B2Y A;  1KNA A;  1U4L A;  4XDX A;  1X3P A;  2DY8 A;  2K04 A;  1X3Q A;  2HCC A;  1XX8 A;  2B2V A;  2MJ8 A;  1HUN A;  4HCS A;  1JE4 A;  2KEC A;  1WD1 A;  2FJ2 A;  2KOL A;  3QO2 A;  1DZ1 A;  2EPB A;  1CM9 A;  2J7Z A;  1F9R A;  1AP0 A;  1HFN A;  5EQ0 A;  1PFM A;  2D9U A;  2KED A;  3DM1 A;  2NWG A;  4RA8 A;  1EOT A;  1B53 A;  1MGS A;  3GV3 A;  5D65 A;  1DOL A;  3D6W A;  3DEP A;  5CBA E;  2DY7 A;  4RAU C;  2L9H A;  4OIK A;  2B2T C;  1IKL A;  1HUM A;  2MGS A;  1G91 A;  3KBX A;  1U4R A;  1WTP A;  2HDM A;  3DEO A;  1BF4 A;  2EOT A;  2L11 A;  2B2U C;  3I90 A;  1WTW A;  5EPJ A;  3I8Z A;  1O7Y A;  4IUQ A;  1Q3L A;  1VMP A;  4QUF A;  1EL0 A;  2X6L A;  1CA5 A;  1PDQ A;  2B2W C;  1ESR A;  3I3C A;  1E0B A;  1F9P A;  1M8A A;  2X6G A;  1LV9 A;  5EPK A;  2H1E A;  1QG7 A;  2MPM A;  3IFD A;  3MTS A;  1IL8 A;  4OIJ A;  1TVX A;  1HFG A;  3P7J A;  1G2S A;  3R93 A;  4CJ2 C;  2K01 A;  4LMQ D;  3G7L A;  4IUR A;  1AZQ A;  1BNZ A;  2FHT A;  2FIN B;  5AFW A;  1IKM A;  5T1G A;  2KUM A;  4CJ1 B;  2JYO A;  5JJZ A;  2MP1 A;  4NW2 A;  4ZK9 B;  2K03 A;  5DNF A;  3TZD A;  1B2T A;  1RTO A;  1J9O A;  1S4Z A;  1B4O A;  2CVR A;  4ZAI A;  2RVL A;  2B2T A;  3ONA B;  1RJT A;  4MN3 A;  2BDN A;  1ROD A;  2NZ1 D;  2R3Z A;  2B2Y C;  3FPU B;  4U68 A;  1MSG A;  1GUW A;  1NCV A;  1QNK A;  4X3U A;  1F9S A;  1NR2 A;  2K1B A;  5EPL A;  1A15 A;  3SVM A;  1U4M A;  2L12 A;  1MSH A;  4IUU A;  1BBX C;  1EQT A;  1JIC A;  1WTR A;  2HDL A;  1DOK A;  1ZXT A;  3GV6 A;  2RSO A;  3F2U A;  5EKI A;  1X32 A;  1BO0 A;  1WTO A;  2RSN A;  4O42 A;  3MWY W;  4RWS C;  4X3K A;  5EJW A;  2K05 A;  2JP1 A;  5CBE E;  3N52 A;  1NR4 A;  2N88 A;  3IL8 A;  1U4P A;  1MI2 A;  2FMM A;  5D14 A;  3KUP A;  2HCI A;  1PFB A;  1G6Z A;  3FDT A;  2HUG A;  1WVL A;  1EIG A;  4IUP A;  1G2T A;  1ILQ A;  2N55 A;  2EE1 A;  3Q6S A;  1WTX A;  1O80 A;  3TN2 A;  2XIW A;  2KVM A;  2NYZ D;  4XT3 B;  5T1I A;  4ZKB B;  1C8C A;  4HAE A;  4HSV A;  2B2U A;  4R9W A;  1RTN A;  4XT1 B;  1ICW A;  3LWE A; 
#chains in the Genus database with same CATH topology
 3UI2 A;  1EIH A;  1JJG A;  3GP7 A;  3AFP A;  3HP3 A;  1OTC A;  4K6L A;  2KBN A;  1J5E L;  1PH5 A;  4IOC A;  4IZ8 A;  2M2L A;  5IP9 G;  1B44 D;  1PRT B;  3BJU A;  3K8A A;  4XQQ A;  4GLV B;  4V0B A;  4BY7 H;  4GN4 B;  1MJE A;  2K7V A;  4LFA L;  4A3L H;  2Y0S E;  2F0Q A;  2Z8L A;  4HSP A;  1X3Q A;  2B2V A;  1B3Q A;  1VQF A;  1HUN A;  3GQB A;  3A5U A;  2KEC A;  3PIP 3;  1SFO B;  2HQE A;  2B29 A;  1STA A;  4UP8 A;  1HQR D;  4B3T L;  1HFN A;  4DU9 A;  4DV1 L;  4DV6 Q;  2A74 C;  5L37 A;  1FNV A;  4K2L A;  1CK1 A;  1UE7 A;  3U4V A;  4XQN A;  4RGM A;  3L3O C;  1SYC A;  1Q90 A;  3PIO 3;  2Z6B A;  1Z7T A;  3T1Y L;  1ET9 A;  1EWC A;  1O7L A;  5GRO A;  1V9P A;  4ID6 A;  2BE5 D;  2VUM G;  1CI3 M;  3HOZ H;  4CJ2 C;  1PV4 A;  3NPP A;  1K8G A;  1N33 Q;  3S2D H;  4CDD C;  5IYB G;  1LTT D;  3A5Z B;  5CC4 A;  4JI6 Q;  2CVR A;  1PRT C;  4MN3 A;  1PRT F;  1ZYR D;  5IIF A;  1S5D D;  3FEW X;  3MC0 B;  3M4Q A;  1Z47 A;  1VQO A;  1G29 1;  1O78 A;  3A7A B;  1EQQ A;  4IUU A;  1A63 A;  3BDL A;  1EQR A;  3HEJ A;  2HIX A;  4AYB E;  4QCL A;  2F0W A;  4K5W A;  1IBM L;  3UDF A;  4JW0 A;  2UXD Q;  4IO9 A;  1MJC A;  5LHY 1;  3LNN A;  1SNP A;  2F0H A;  3KJP A;  4A3K B;  1PFB A;  2F0K A;  1LAB A;  3BVM A;  2OTL A;  1CTM A;  2Z0S A;  4R8N A;  2ZTD A;  3A7L A;  4P71 A;  3CXC A;  5TSS A;  3HOU B;  2WIN B;  4KN7 C;  4YCW A;  5IP9 H;  4CKB A;  2JEA I;  2IL8 A;  2DNE A;  2I07 B;  5FJ8 G;  1S5B D;  4MHE A;  2L4N A;  4DNI A;  1T5X D;  2Q8T A;  1YJ9 A;  3MFG A;  1XMQ Q;  3O13 A;  4IPH A;  3GTJ H;  1NAP A;  4DF7 A;  2UUC L;  1Y14 B;  2PQE A;  1ILP A;  4EX5 A;  4CJ0 B;  3RLF A;  4A3B B;  2AHO B;  2UXC L;  4QUC A;  5D3D A;  4R8I A;  2TMP A;  1ML0 D;  1KNA A;  4XDX A;  2A19 A;  1VQ5 A;  2PW5 A;  5DM7 3;  1A62 A;  1K8O A;  4DR4 Q;  1LO5 D;  2IWH A;  3SE0 A;  4B9X A;  4DV0 Q;  4J1M A;  1F9R A;  1QIL A;  4B3M Q;  2CWP A;  1PH8 A;  3ER0 A;  2VUM H;  3S1R H;  3DHQ A;  1VQI A;  2EYM A;  4A4I A;  3GD7 A;  3CCL A;  2QDB A;  3EN2 A;  4DR6 Q;  2F0P A;  4V19 0;  2I5M X;  1UEA B;  3K5N A;  4RFB A;  3SDZ A;  5IYB H;  1SE4 A;  2A6E D;  4X65 Q;  5M5X H;  2K6A A;  1F77 A;  1IYJ B;  3K5M A;  2K32 A;  4OO1 I;  2FHT A;  3KLS X;  4RGT A;  2KUM A;  3DXJ C;  3N6R A;  1EY5 A;  4LUZ A;  4FVM A;  3PO2 G;  4JBK A;  2HHH Q;  1PH6 A;  5ELN A;  4JYA L;  4GLA C;  1TWF H;  3NBI A;  4JG2 A;  2B2T A;  3STB D;  4F88 A;  4K0K Q;  1B8A A;  2BDN A;  5FLX L;  2XGT A;  2NVT B;  1KD1 C;  5HUR A;  2R7Z B;  1P8L A;  4KTA A;  3ND9 A;  1E7Z A;  5C5M A;  1I4Q A;  1U4P A;  1H9M A;  1UE1 A;  2B8G A;  5GAD C;  3RNU A;  5FJ8 H;  4H7B A;  1I94 Q;  2AQ1 B;  2OEO A;  1UUP A;  5HY6 A;  4EQN A;  3CCU A;  5I4D A;  4L5Q A;  2M00 A;  2KVM A;  1LTA D;  5JJL A;  2CWA A;  2OF1 A;  3S1Q H;  1RD9 D;  1JMC A;  2VQF Q;  5K5P A;  2Q8R E;  2HHH L;  2YTX A;  3NK9 A;  4N8X 1;  4R4C A;  2MO0 A;  4FXG C;  2E2I H;  3DWP A;  3VR4 A;  4JV5 Q;  1ENC A;  3BZC A;  3R2T A;  1PYW D;  3K0X A;  4K0K L;  4O1N A;  1SXT A;  2RKS A;  2PMZ E;  1ZEQ X;  4DXG A;  2EXZ A;  5EKK A;  4DR2 Q;  2E5L L;  2IY5 B;  2K33 A;  4YCU A;  1S40 A;  4OEL B;  4HMJ A;  2UUB Q;  4BY1 B;  4UDU C;  2A73 B;  4YCV A;  1X56 A;  1A3T A;  1LTI D;  2HCC A;  2EY1 A;  1BXT A;  1XX8 A;  1JOO A;  3VYT A;  4HCE A;  4MZ9 A;  2CQA A;  5M3F B;  1ASZ A;  4DV7 L;  3ERO A;  4DV3 L;  4CDF C;  3MXN B;  1B9M A;  2WKD A;  1UAP A;  4NXN Q;  1SE2 A;  4A3E B;  1PFM A;  4IJL A;  2DUD A;  1CT1 D;  5FLX E;  3M85 A;  3MXN A;  1KAA A;  1CUK A;  4RAU C;  4ZUJ A;  4JV5 L;  1G91 A;  3K5L A;  3PF4 A;  4MNO A;  3VDY A;  1CFM A;  3VA7 A;  4ME3 A;  2ALY B;  2L5T A;  3HS0 C;  4MTK A;  2N3S A;  3PUZ A;  2AWO A;  4QL5 A;  4GNX B;  4ALP A;  1AZQ A;  1L1O B;  4ZCK A;  2WFW A;  1EWH A;  1D6E C;  4NKL A;  3V2T A;  5IGG A;  2K03 A;  4O0A A;  1L1O A;  1RTO A;  3I4M B;  2BA1 A;  1D5Z C;  3DLL A;  4DAY B;  3RMH A;  3V96 A;  2R3Z A;  1N32 Q;  1NE3 A;  2JXM B;  2ZT9 C;  2K52 A;  5IYD H;  4BY7 B;  3J80 c;  1LT4 D;  2DJF C;  4KY6 A;  5ISR A;  5JPN C;  1SJE D;  2K5Q A;  2UU9 Q;  4JI1 L;  3ERS X;  1HNZ Q;  4GZY C;  1QZG A;  1QVG A;  1XNR Q;  2F52 A;  3NHH A;  4EVO A;  1D2B A;  3I56 A;  3WOF A;  5IWA L;  4YY3 Q;  2N88 A;  3HOX G;  1TS4 A;  1EY0 A;  3RUZ A;  5CV8 A;  3X3M A;  1Q82 C;  5C3W A;  3I4N G;  3RZO H;  3Q6S A;  2WB1 B;  1OXX K;  5T1I A;  3TN2 A;  4A3B G;  4A3C G;  5IOC A;  1KIX A;  3TQY A;  2QW7 A;  5ELE A;  4MIU A;  3OIP A;  4JVZ A;  5C0X J;  1X55 A;  2QGQ A;  4JPB W;  1YNX A;  1IYU A;  4M1U B;  2VZA A;  2NN6 G;  3HOW B;  3RR5 A;  1HHV A;  4WFN 3;  2CH4 W;  1L1O C;  1DYQ A;  4WRD A;  3WWV A;  2EYP A;  2CH4 A;  2PO4 A;  1KXL A;  4C1N K;  1XMO Q;  2AWN A;  1WTQ A;  5LMN W;  3S2D B;  4JBJ A;  4GKK L;  1IW7 C;  2RBM A;  1V1P A;  1KDA A;  1SNM A;  4LF7 Q;  1E1O A;  4JCV E;  3JAM c;  4DUZ Q;  4EQP A;  3S15 H;  3HOV G;  3QO2 A;  1Y8O B;  2K14 A;  4YWK A;  1SYE A;  2WII B;  4C2M H;  1TR5 A;  2F4V L;  2KED A;  3DM1 A;  3CD6 A;  1LTS D;  4X6A H;  3GV3 A;  5CBA E;  2DY7 A;  4IFD H;  4FF2 A;  1Q7Y C;  1U4R A;  1YJW A;  4POF A;  3SHL A;  1TS3 A;  3SGI A;  3T1H L;  2LXJ A;  1O7Y A;  2X6L A;  3NUC A;  3Q0A A;  1TS2 A;  2Y0S G;  4GKJ Q;  1LV9 A;  2E2D C;  1IL8 A;  1GXD C;  1STG A;  3G6J B;  1P16 A;  1W3S A;  2A8V A;  2R7Z G;  3DM3 A;  1DD2 A;  2MP1 A;  4LF7 L;  3CQZ B;  3HOU H;  4R1J A;  4DUZ L;  3BU2 A;  3U9O A;  1I6V C;  1KRS A;  1HA5 A;  2R93 G;  3OMC A;  1RJT A;  2F0I A;  2Q2H A;  4KI0 A;  3I55 A;  4BXX G;  3R8B A;  3VR6 A;  4HJ9 A;  1KC8 C;  3S1M H;  3SK8 A;  1CKO A;  3GDE A;  2XTI A;  3I4N H;  1AE3 A;  4I7Z C;  4A76 A;  1VQK A;  2UUA L;  1BOS A;  4K8J A;  4A3B H;  4A3C H;  3LX0 A;  3DUZ A;  1VQH A;  2QDL A;  3FMC A;  4FF1 A;  2I5H A;  3OWE B;  2RCF A;  1OXV A;  3T4A C;  1QNU A;  4KHV A;  1I4X A;  2F0E A;  4F7X A;  1IL2 A;  4DK3 C;  4GKJ L;  1G6Z A;  4JI4 L;  4FO2 A;  5C0X I;  4XT3 B;  2IX0 A;  1K83 B;  3NBH B;  2VUM B;  3S1R B;  3RD4 A;  3NTK A;  4IUV A;  5FLM G;  1PH4 A;  5DLQ E;  3D4D A;  4L5R C;  3T51 B;  1VF7 A;  1HCZ A;  1HNX Q;  4XXE A;  2F0M A;  4IUT A;  4AYB G;  5M5X B;  2JA5 B;  4A3E G;  1A6X A;  3BZK A;  2MNA A;  2NVY B;  2RA4 A;  3M3Y B;  2EY5 A;  4DK1 A;  5JVH 3;  3QWN A;  2JQO A;  2F0J A;  1XTD A;  1GKH A;  5C44 G;  2L15 A;  1K9M C;  4ILW A;  3GTG B;  2KOL A;  3H0G G;  3HKZ B;  2EPB A;  2ZM6 L;  3URY A;  3A0J A;  3EJI A;  1GHJ A;  1J6Q A;  2CCZ A;  3HZX A;  2PNR C;  3C2P A;  2BH8 A;  2R7Z H;  3ND8 A;  2AQ2 B;  1S5F D;  3KF8 A;  2B39 A;  4GOP B;  4DUY Q;  1CA5 A;  1ESR A;  4QIW B;  2X6G A;  4L5S A;  3MTS A;  2R93 H;  4BA1 I;  3GTO H;  2XN9 C;  1WTH A;  2ASB A;  3S1Q B;  4GOP A;  2FIN B;  4BXX H;  4I7A A;  1K8A C;  1CSP A;  3LGJ A;  5JJZ A;  1IBL L;  3MA2 B;  5M5Y B;  2AUJ D;  3NWS A;  3CW2 C;  1K0S A;  3KYH C;  4H13 C;  2I0Q A;  3CF5 A;  2OXP A;  2JA9 A;  3S1N B;  1ROD A;  3IKJ A;  5AJ3 L;  1E1T A;  2VW9 A;  3L0O A;  2B8F A;  5C4H A;  1A15 A;  4G4K A;  3RLO A;  2MQH A;  1Z9F A;  2JA6 G;  3F2U A;  1PTO D;  4POG A;  4B3S Q;  2F0N A;  1CZW A;  3BG3 A;  4N9P A;  1BKB A;  3W2D A;  4IFD I;  5KYL A;  3MAQ A;  1NR4 A;  1XJV A;  1SMY D;  5BR8 L;  2K5V A;  3QR8 A;  5FLM H;  3F1Z A;  4DUY L;  3S9W A;  2K4K A;  5M5W B;  3HOW G;  2A68 D;  1FL0 A;  3FPP A;  1K28 A;  1L0Y B;  1ONL A;  1ET6 A;  4KHZ A;  3PO3 B;  4QF4 A;  5LMU Q;  3LWE A;  3K58 A;  3ZYY X;  5A35 A;  4A3E H;  1WD0 A;  1NJI C;  2Q2T A;  2SOB A;  1SBB B;  4N9T A;  4GOP C;  4X64 L;  3PO2 B;  1VQA A;  4RKB A;  3UDI A;  3CKI B;  3TP8 A;  1D8L A;  1G6P A;  4CKE A;  2NBF A;  2PQA B;  4KN4 C;  3H0G H;  2A6H D;  1FVI A;  2NTT A;  1DON A;  4CKC A;  1EYG A;  1HXY D;  1JT8 A;  3I73 A;  4RGN A;  5JAV A;  2K50 A;  3V05 A;  2MJ8 A;  3PMF A;  4IN3 A;  4OHJ A;  3ULL A;  4KK7 A;  5D3I B;  3SK5 A;  1CM9 A;  3NP8 A;  2RHS B;  3I4M H;  5ELC A;  4FF4 A;  2MO1 A;  2BE5 C;  5EQ0 A;  1OXS C;  2F3I A;  1UEB A;  5LMU L;  2D5D A;  2CQO A;  3EIV A;  3I4O A;  2PI2 E;  1EY8 A;  1FD7 D;  4KHP L;  1SRU A;  1XXG A;  1KQS A;  1BDO A;  2EYO A;  5ELD A;  4RGO S;  3E9I A;  5C4X G;  4QQB X;  1Q3L A;  4DGZ A;  2VQE L;  5LL6 X;  3J7A 5;  3KOJ A;  1ZYR C;  3TME A;  1VQ7 A;  3RZO B;  5EPK A;  1TXY A;  3IFD A;  2E75 C;  1AN8 A;  4HTH A;  4QGU A;  2QIL A;  1TVX A;  3QIA A;  3HOY G;  3A8J E;  2F0O A;  3AU7 A;  1SRO A;  5FK9 C;  4A3I G;  1U5K A;  4IPG A;  2IHF A;  3K81 C;  3PUY A;  3MEF A;  4LUO A;  2JA6 H;  3PGZ A;  1B4O A;  3AB9 A;  3TP5 A;  2JA7 B;  4CHT B;  1NCV A;  1STN A;  1QZH A;  1U4M A;  2WV6 D;  3TP7 A;  3HOW H;  5A2Q L;  2D0O A;  3Q22 A;  4TKO B;  5EKI A;  4MTN A;  4X3K A;  1GO3 E;  4O2D A;  4HMI A;  1ENA A;  3S15 B;  5KNC A;  3A8K E;  1SYG A;  4FXK C;  1FNW A;  2ZTC A;  1VQP A;  4C2M B;  1PZJ D;  2R61 A;  3ERQ A;  1Q8K A;  4XIG S;  4JI7 Q;  1VQ8 A;  3VYR A;  2JA5 G;  1E24 A;  3S2H B;  4FF3 A;  4DV6 L;  5JEA G;  1ICW A;  4GN3 B;  4CDC C;  2B2V C;  4LK1 C;  1SEB D;  2E2H B;  2YTY A;  3D4R A;  2LS0 1;  4FYD A;  2IX1 A;  1M4V A;  3ITP A;  3PUV A;  1SLJ A;  2WKC A;  4QJF A;  1EZ6 A;  2EVB A;  3K80 C;  3GTQ B;  1LAC A;  3OMG A;  3HKZ G;  5KIX A;  1Q8I A;  4LF8 Q;  5E1F A;  1B50 A;  1OXT A;  1K73 C;  2LKV A;  4PZ6 A;  4BBS G;  4C56 C;  4Y7N B;  3CCQ A;  3EQL C;  1B3A A;  3H91 A;  2KCC A;  2G5D A;  1WI5 A;  1N33 L;  2PNH A;  3C3L A;  2ZXP A;  2UXB Q;  3H3V C;  4C3I G;  5EBC A;  1Y69 U;  3UE0 A;  4UP7 A;  3NTI A;  1ASY A;  3FKI B;  1KDB A;  3CQZ H;  4JI6 L;  1BCP B;  3HOX B;  2PPB C;  3S1M B;  5C4X H;  2A6E C;  1PH1 A;  1FJG Q;  1QUQ A;  1M90 C;  4LFC Q;  3I4N B;  3D6W A;  3UE1 A;  1HR0 Q;  5A2Q E;  4K5X A;  2HDM A;  2UXD L;  3I90 A;  4A3I H;  4NXM Q;  5CV9 A;  4PG3 A;  3STB C;  4K8I A;  1BQQ T;  3M4O B;  2H1E A;  4OIJ A;  4TQU S;  4YHH Q;  2BH2 A;  1GUG A;  4ME5 A;  2VB3 X;  3KLW A;  4OO1 G;  1PH2 A;  1JOQ A;  1VQG A;  1VQB A;  4P74 A;  2KCN A;  4DV2 Q;  3J7A F;  5GAE C;  1K83 H;  5JPM C;  1RKN A;  2OQK A;  1GUN A;  1XMQ L;  5IGC A;  3HOV B;  4LFC L;  1H95 A;  3PO3 G;  1KHI A;  1TQO A;  2B3G A;  4GLX A;  2JA5 H;  2JA8 G;  1CKM A;  2NVY H;  3M3Y H;  2CKZ B;  2CHB D;  5JEA H;  4JI5 Q;  5BN5 A;  1MI2 A;  5IGB A;  1F2Y A;  1EU3 A;  2PW7 A;  1QCB D;  1BCP C;  4PV1 C;  5KRU A;  2EQS A;  1BCP F;  4DR4 L;  1V8Q A;  1C4Q A;  4YHH L;  3QB3 A;  1KL9 A;  4DV0 L;  3GTG H;  1RF2 D;  2F0U A;  4LFB Q;  4B3M L;  3DWA A;  4ULL A;  2RDH A;  4JI3 Q;  1YVC A;  2AQ3 B;  2Y0S B;  4RHR A;  2NZO A;  2ICE C;  3TSS A;  1XYI A;  3WDN A;  2KEN A;  3PIP A;  1WTV A;  2EJG C;  1CA6 A;  1LTR D;  2F3W A;  3BS1 A;  4DR6 L;  1VQJ A;  2K5W A;  4LJZ C;  2V4D A;  1SYD A;  1SAP A;  1EUJ A;  2R93 B;  1S3O A;  3GTO B;  4HR7 B;  1SSO A;  4C3H G;  2N8N A;  5NUC A;  1KRT A;  1WYD A;  2R7F A;  5CR3 A;  3GO5 A;  1SJH D;  4X65 L;  1HA6 A;  2EDG A;  1NY4 A;  2K04 A;  3NQI A;  1PVO A;  4Q0F A;  3PIO A;  3HKS A;  2IJ0 A;  1YNJ D;  1GD7 A;  5KGU A;  1DZ1 A;  1XWE A;  5M5Y H;  2LSS A;  1W2B A;  5KNB A;  5GAG C;  4OWW B;  3S1N H;  2C5C A;  4IAL A;  4K2K A;  1XNQ Q;  2PZU A;  3CU7 A;  5J1Z A;  4ZYS A;  2QEX A;  4BA2 I;  5C3E B;  2VY3 A;  2L9H A;  4IJH A;  2B2T C;  4LWC A;  5I9P A;  1EEI D;  1VQC A;  3BZD B;  2QA4 A;  1BF4 A;  2H4O A;  3OWF A;  3I8Z A;  3H09 A;  4R4Q A;  2JA7 G;  1NTG A;  1LT6 D;  1PDQ A;  2ZXO A;  3T13 A;  3AEV A;  1DXM A;  3I3C A;  4P2C B;  2F0G A;  4PZ8 A;  2XWB B;  3KK7 A;  1L2F A;  1I94 L;  3G7L A;  1AE2 A;  5M5W H;  1ICF B;  3OW7 A;  4KY5 A;  4AYB B;  4DKA C;  1EFW A;  2EZV A;  2VQF L;  1K8M A;  1HZB A;  4QY7 A;  1K0R A;  3PO3 H;  1N8R C;  1S4Z A;  1YHB A;  4J15 A;  2RDG A;  4KLK A;  4KKS A;  2JA8 H;  5C44 B;  1HH2 P;  2NVQ H;  1NR2 A;  3TRZ A;  4DR1 Q;  1IBK Q;  3H0G B;  4AH6 A;  3PO2 H;  4BS9 A;  4DR2 L;  5DM6 3;  1TWG H;  1DOK A;  3CCS A;  1GOZ A;  1H9J A;  2DGY A;  2UUB L;  3P20 A;  4CDE C;  4F87 A;  1HQM C;  4O42 A;  1CKN A;  3J81 c;  2JP1 A;  2J0T D;  3CCR A;  3IL8 A;  1A2U A;  4OWT B;  3F8T A;  3B6Y A;  1FGB D;  1TWA B;  5FO7 B;  1KLG D;  5IP7 G;  2XIW A;  2YTV A;  3NQT A;  3A56 A;  1EWI A;  4HSV A;  4NXN L;  1IHZ A;  1EY7 A;  1HNW Q;  2RQX A;  3S14 B;  2KEE A;  2BCO A;  1V1O A;  1JB7 A;  3J7A V;  4UAI A;  3J81 j;  4IUN A;  3FP9 A;  3FKI G;  4L8J A;  2A69 D;  4JK1 C;  1SE3 A;  5IGE A;  2WAQ E;  5CMD A;  4HED A;  4RKL A;  1AFP A;  2FFK B;  5CV6 A;  4FDB A;  3J80 L;  4YWL A;  4X62 Q;  2DY8 A;  2JA6 B;  3CC2 A;  1E22 A;  3QG1 A;  1A8V A;  1G51 A;  4HCS A;  1C0A A;  4DAM A;  4HJ8 A;  2F1M A;  4OX9 Q;  1H9S A;  3E6Z X;  1Y1V B;  2ES2 A;  1EOV A;  1VCI A;  3C1F A;  4S3S A;  1YHQ A;  4XYO A;  1PFS A;  3NEM A;  2N78 A;  1N32 L;  3E0E A;  3CPW A;  4RA8 A;  2JA7 H;  3H3V H;  2GVA A;  5G3L D;  1B53 A;  1K3R A;  1EEF D;  2CW0 D;  2B63 G;  1DOL A;  4OL7 A;  2K5N A;  3TP6 A;  2UU9 L;  1V1P B;  1HNZ L;  1STH A;  1XNR L;  3DEO A;  3K5O A;  2C9O A;  4AQY Q;  3SXH A;  3D31 A;  5KYI A;  4IUQ A;  1CZG A;  4YY3 L;  4LF4 Q;  1E0B A;  1WVL A;  1X9N A;  4PMW A;  1JWM D;  4NDX A;  2YU9 B;  4QB4 A;  4K6D A;  3UDG A;  3ZJY C;  1VS0 A;  2OQ0 A;  4X62 L;  1MKH A;  3OHX C;  5FKA C;  4L63 B;  4NW2 A;  3SK6 A;  3S2H H;  5IT9 c;  1J9O A;  4C3J G;  1V1Q A;  1ZKO A;  1N9W A;  3EFX D;  3TRE A;  2E2H H;  1II3 A;  1LUZ A;  3JAM L;  1QNK A;  4X3U A;  2K1B A;  3QOJ A;  4LAA A;  4EQ5 A;  3GTQ H;  1I50 B;  3HGB A;  2HDL A;  4A3D G;  1QOH A;  2FMC A;  4H0L C;  1TWH B;  1BO0 A;  2JJQ A;  2E76 C;  5IP7 H;  1XMO L;  2SNS A;  4AQY L;  1IZ6 A;  3J80 E;  4Y7N H;  2JN4 A;  2Z9H A;  3PQI A;  5GAH C;  1SMX A;  2G9H D;  4P75 A;  2PMZ B;  3BDC A;  2VS1 A;  5M3M G;  4ZRZ A;  5C4X B;  2O2L D;  4IUP A;  2O5I C;  1ILQ A;  1JWS D;  1KLU D;  1VQE A;  1YNN D;  4HAE A;  3J7Z C;  1DJR D;  3FKI H;  4A3F G;  3A74 A;  3J80 i;  2F0F A;  3W1G A;  3HOX H;  3HOY B;  4UHV A;  1QVF A;  1N36 Q;  2SDF A;  4PMC A;  4RH6 A;  4DR7 Q;  1PH3 A;  4A3I B;  1PTO B;  4DV4 Q;  1VF5 C;  1YJN A;  1R9T B;  1SDF A;  1N34 Q;  1TY2 A;  1T5E A;  3M7G A;  1FGU A;  1I3Q B;  1E2V A;  1RHP A;  4PNY A;  1PH9 A;  4HN7 A;  4UP9 A;  4H02 A;  3I7F A;  5COR A;  2E74 C;  5E4W C;  5E7N A;  2RHQ B;  3C46 A;  2MHV A;  1PFN A;  3M4O H;  1PZI D;  3LWU A;  2NN6 H;  2H5X A;  5C3E G;  1X3P A;  3HG9 A;  4APV A;  2AKW B;  2K75 A;  3OSO A;  1SNO A;  4DK0 A;  2B63 H;  2PYK A;  1C7Y A;  3CRK C;  4FNF A;  3OIQ A;  4DAV A;  3E9H A;  2OTJ A;  2XNA C;  3JAM E;  1STE A;  1Z6H A;  4PZ7 A;  4OEM B;  5D65 A;  1Y1W G;  3GTL H;  2I5L X;  1N36 L;  4Q5V A;  3HOV H;  2XSC A;  2LFN A;  1VQD A;  1HUM A;  4DV4 L;  4A3G G;  4B08 A;  4E6I A;  3KDF B;  2L55 A;  2I46 A;  3JAM i;  4C3J H;  4KD4 A;  2HT1 A;  2ID0 A;  1KAW A;  1QG7 A;  4G7O C;  4FXD A;  4DR3 Q;  1BNZ A;  1XPU A;  3KDF A;  5K36 G;  4ZQ3 A;  5AFW A;  1IKM A;  3M9B A;  4LF6 Q;  3M4P A;  3D6C A;  4BBS B;  1PTO C;  5DNF A;  1PXU A;  3TZD A;  1PTO F;  4A3D H;  4LNQ A;  4DA2 A;  1EY6 A;  2RVL A;  3KF8 B;  1L0X B;  3I4L A;  2F4I A;  3RZD B;  4C3I B;  1HNX L;  1F9S A;  2A68 C;  2QCP X;  1MSH A;  2R92 G;  1EQT A;  1HTP A;  4RCN A;  1JIC A;  5M3M H;  4UY8 C;  4RCO A;  2MUY A;  2TSS A;  1JC7 A;  2RSN A;  3CHB D;  3MWY W;  5EJW A;  4BBR B;  4JBW A;  3GTM B;  4IFD G;  2ENB A;  4A3F H;  1TWC H;  3KUP A;  4WJ3 M;  4GN5 A;  1HZA A;  5J3B A;  2GVB A;  1WTX A;  5I2X A;  4HIM A;  1JWU D;  2B2U A;  4XT1 B;  2A6H C;  2EIF A;  1NMG A;  4JI2 Q;  4B3R Q;  1B70 B;  2ICI A;  3QOL A;  1F2L A;  2AMC B;  2NB0 A;  3R2I A;  1Q1E A;  2X69 A;  5COY A;  4KD3 A;  1KTK A;  4JI0 Q;  1Y1V G;  5C3E H;  3HFZ B;  1O7Z A;  1JB3 A;  3RN2 A;  3R3O A;  5E4X A;  4X3T A;  2FXQ A;  3CP0 A;  4HIO A;  2ZTE A;  3M4Y A;  1KNE A;  2RDF A;  2A1A A;  1XTC D;  3MZ5 A;  3BYY B;  1Y1W H;  4LF9 Q;  1A3V A;  2JA8 B;  3UDX A;  2C35 B;  2NVQ B;  3G4S A;  4KJN A;  2E2J B;  4L5T A;  1RCV D;  2GA4 B;  4Z9C B;  1CHP D;  2NWG A;  1U0L A;  1TWG B;  3IFT A;  5EKL A;  5C44 H;  1L0W A;  4DFA A;  5LL6 S;  1QWY A;  3HOZ G;  3S16 H;  4HJ5 A;  1QVC A;  1J5E Q;  3CC7 A;  3S17 H;  1IXR A;  3KF6 A;  1SNC A;  1VQ6 A;  5K36 H;  2EOT A;  2B2U C;  4B3S L;  4R4O A;  1AEX A;  1VMP A;  3BYT B;  2M9V A;  5ELB A;  3CAM A;  3FRP B;  1F9P A;  4LFA Q;  3RLN A;  2PZT A;  1HFG A;  4XYQ A;  2Z4I A;  3D8G A;  4C3H B;  1TWA H;  1EYD A;  5IY0 A;  1JR0 D;  1PMR A;  1WCM B;  2F0D A;  4L6T B;  5JJK A;  1WFQ A;  4ZAI A;  4B3T Q;  2NUC A;  4NB3 A;  3H15 A;  2NZ1 D;  4DV1 Q;  3MFY A;  3S14 H;  1MSG A;  3CMA A;  1GUO A;  2L12 A;  1C9O A;  1Q12 A;  5JEA J;  2Q8I B;  1LT3 D;  3T1Y Q;  3P75 A;  1YIT A;  1TII D;  2FMM A;  3G48 A;  1D5M C;  2HCI A;  2KHS A;  2Z4H A;  2HUG A;  1JOK A;  4WOR A;  4A3M B;  3MVV A;  1Y1V H;  3AFQ A;  1X3E A;  5IGD A;  1Y8P B;  4K14 A;  3I70 A;  1JOR A;  1B1Z A;  1STY A;  1X3G A;  4KMU C;  3NSW A;  4YIJ A;  3VR3 A;  3D4W A;  3JC6 6;  3PF5 A;  4KY7 A;  1I5F A;  2P5Z X;  3K0Y A;  4IPD A;  1I4H A;  3CCJ A;  1Q1B A;  3CCE A;  1PLF A;  1T9H A;  1F2Z A;  1FR3 A;  3J7Y W;  1G8Z D;  3G71 A;  1KAB A;  3NTH A;  3I91 A;  2L1B A;  1IBM Q;  3CC4 A;  1VMC A;  1CSQ A;  1W6K A;  4I65 A;  4U67 3;  1YZ6 A;  2YU9 H;  4DR5 Q;  3TBI B;  4LF5 Q;  4KKT A;  2IT1 A;  1E3P A;  3FHW A;  2F03 A;  4A93 G;  2J7Z A;  5LMN Q;  1JCK B;  2KCM A;  2YV5 A;  4K5V A;  3PCO B;  1GUT A;  5IE8 A;  1EOT A;  1UE6 A;  2BA0 A;  3U58 A;  2F0V A;  3DEP A;  3OTO Q;  2RF4 A;  5DEH A;  4OIK A;  5C3X A;  3OYY A;  1IKL A;  4EGV A;  2UUC Q;  1I50 H;  4NP5 A;  2JK8 A;  2L11 A;  1D5X C;  3CRL C;  2WAQ G;  1TWH H;  1RDP D;  3E5S A;  3OOC A;  5C4J H;  1NMF A;  3OPO A;  4H44 C;  2UXC Q;  1S5E D;  1U9R A;  1BR9 A;  4CJ1 B;  2IX3 A;  1QUQ B;  2F3V A;  5I6W A;  4JI7 L;  2A5H A;  4XQJ A;  2KQ3 A;  4DR5 L;  1ENF A;  2KHJ A;  2BOS A;  4BBR G;  4LF5 L;  5I6Y A;  3GTK H;  1X6O A;  2O5J C;  3W3A A;  3RN5 A;  1EIF A;  4N8F A;  5HGQ A;  1BBU A;  2N49 A;  1PZK D;  1AW7 A;  4J8Q A;  3HOY H;  2K5D A;  1I6H B;  5LMN L;  2NTS A;  1B9N A;  1GUW A;  3K57 A;  5EPL A;  3U50 C;  4R4T A;  1PTO H;  4LF8 L;  4OGQ C;  1IYV A;  2DN8 A;  3HRZ C;  5JVG 3;  1R9T H;  3OTO L;  1EZ8 A;  3C1E A;  1I3Q H;  5E3F A;  2JSO A;  4DAP A;  2B63 B;  4KJO A;  3TDQ A;  2ZJQ A;  1S5C D;  1PRT D;  4HIK A;  1MIU A;  5J39 A;  2Q2I A;  5D14 A;  3SK4 A;  1BUV T;  2UXB L;  5CYU A;  1X65 A;  1FNU A;  3D0F A;  4P73 A;  2N55 A;  2EE1 A;  1C8C A;  5IOD A;  4F8M A;  4JOI A;  3GTL B;  1SE8 A;  3TS0 A;  3D3R A;  1FJG L;  4JYA Q;  4B9W A;  2B2W A;  4ZKC B;  1HR0 L;  1YNJ C;  1TU2 B;  3SR1 A;  2OCE A;  4C3J B;  5DAU A;  4NXM L;  1TY0 A;  4LW1 A;  3TS2 A;  1EY9 A;  3OW2 A;  2MFI A;  1HRJ A;  2WB1 E;  1K3B C;  1E2W A;  4A93 H;  2XVS A;  1J8I A;  4X3S A;  2K28 A;  3VA5 A;  1UWV A;  3QJY A;  1H9K A;  2IPK D;  3G6E A;  3CCV A;  4A3D B;  3TEH B;  2DJG C;  5FLX c;  2YYZ A;  4TSS A;  2PI2 A;  2FJ2 A;  2Q2U A;  4DV2 L;  4BBS H;  4M8A A;  3AYH B;  5M3M B;  3RZD H;  3KBG A;  4C3I H;  1EU4 A;  1TS5 A;  1DCZ A;  2F0L A;  1CQV A;  1EYA A;  2MGS A;  3GTP B;  4A3F B;  1TWC B;  1WCM G;  4JOI C;  3K6O A;  3MHB A;  5EPJ A;  3PSI A;  4QUF A;  5EBD A;  2E5L Q;  4JI5 L;  4BBR H;  4HJA A;  3F2B A;  1O7I A;  2B2W C;  3GTM H;  2L0C A;  4Y52 H;  1C48 A;  4IPC A;  4A3J B;  1VQ9 A;  2RCN A;  2EXD A;  5IYD G;  4LFB L;  3MXP A;  1W6J A;  4RHS A;  4JI3 L;  3U4Z A;  2E8G A;  5EAY A;  4DV7 Q;  1SNQ A;  4DV3 Q;  4ODG A;  1GJX A;  5CV7 A;  1EIY B;  3W1B A;  4DV5 Q;  4OO1 H;  4HJ7 A;  4LUV A;  3BVZ A;  1LM0 A;  4A3M G;  2NVX H;  4WJ4 A;  1H9R A;  1ZXT A;  4DK6 C;  2HD3 A;  3VR2 A;  4RMF A;  1BCP D;  2G9D A;  1Y1W B;  3N52 A;  1DM0 B;  5GQO A;  5C6A A;  2HIV A;  3ICE A;  3VYS A;  4A3G B;  1UNS A;  5IGF A;  2V1C C;  2EY6 A;  5JOB A;  5C4Z A;  1G2T A;  2KHI A;  1SYF A;  2A69 C;  1B7Y B;  3MXU A;  1GVP A;  4ZKB B;  1LT5 D;  4R9W A;  1RL2 A;  1VQM A;  2E2J H;  3S16 B;  1EQV A;  3S17 B;  1R4Q B;  1CKN B;  1XNQ L;  1HZC A;  1QE6 A;  2VXW A;  1SYB A;  1STB A;  1X54 A;  4DV5 L;  4G7Z C;  2LY7 A;  3K7A B;  4JI1 Q;  3T53 B;  5JJI A;  4WJW A;  3E3X A;  3X3N A;  2EYJ A;  5EGT A;  3U9S A;  4IQZ A;  3F2C A;  5G3L F;  2R92 B;  2CW0 C;  5IWA Q;  3H3V I;  1HTL D;  1WD1 A;  2XWJ B;  4C3H H;  1JE5 A;  3TZU A;  3J81 L;  1WCM H;  1QB5 D;  1PH7 A;  3VR5 A;  3PUX A;  3WOE A;  5J22 A;  4GNX A;  1JJC B;  1EY4 A;  2VL6 A;  3NEL A;  4DR1 L;  1XPR A;  1MGS A;  1IBK L;  2F0S A;  3KBX A;  4A3K G;  1MD2 D;  1NBW A;  4DNR B;  1H9S B;  4G57 A;  2VB2 X;  1WTW A;  4EQO A;  1GM5 A;  4DAY A;  3HKZ E;  3HOU G;  3A55 A;  2CFM A;  5KEE A;  2NZH A;  4ZUI A;  4AIM A;  3P7J A;  3R93 A;  2K01 A;  4LMQ D;  4GKK Q;  1D7Q A;  2AUK A;  2K5H A;  5T1G A;  4OWX B;  4QMG A;  4A3M H;  4JC0 A;  5IYC G;  1B2T A;  3NE5 B;  1HNW L;  4P72 A;  2Z6K A;  2KCT A;  1SFO H;  2F4V Q;  1Y8N B;  4U68 A;  1E2Z A;  2IHE A;  4QIW E;  1SND A;  2VNU D;  1WJJ A;  2EJM A;  3F2D A;  3A8I E;  4PMB A;  1SR3 A;  3BVG A;  2EYH A;  1WTR A;  4IOA A;  1YNN C;  2EJF C;  1X32 A;  1LTG D;  5FO9 B;  3T1H Q;  1VDZ A;  1EFI D;  1I4G A;  4GNX C;  4RG1 A;  3HOZ B;  2R6G A;  2BDO A;  5FOB B;  2LXK A;  4OX9 L;  1NNX A;  3H6M A;  4GS3 A;  1EIG A;  5I2Y A;  1CHQ D;  1I4P A;  1KDC A;  5CGK A;  2KJX A;  3J81 E;  1O80 A;  2NYZ D;  2PZW A;  2JE6 I;  1X3F A;  2OT2 A;  3EBE A;  1S72 A;  2D2C C;  4FP5 D;  1F2M A;  5FO8 B;  4X66 Q;  2ZXR A;  2NN6 I;  4DPG A;  1ESF A;  1YEZ A;  4ZLT F;  5C4J B;  5IT9 L;  3J81 i;  4OXP A;  5C5L A;  5BN3 A;  5M9O A;  4BWG B;  4LF4 L;  2Z6K C;  3IRB A;  2UUA Q;  4CBV A;  2B2Y A;  3GTK B;  5C0X G;  2D0P A;  3H94 A;  2ZJR A;  4JI4 Q;  1VQN A;  1M1K C;  4A3K H;  1OO9 B;  1A0I A;  3AQQ A;  1HR0 W;  2QEJ C;  2EYL A;  3NWT A;  3NXW A;  1I6H H;  4A3J G;  2GN5 A;  1YIJ A;  4J6H A;  1IW7 D;  3GTJ B;  5H1S E;  1D1K A;  2XRQ D;  2J4X A;  4X66 L;  1NSN S;  1CQF A;  3EVQ A;  5IYC H;  1I4R A;  4XTC S;  1LLR D;  1M8A A;  1AH9 A;  2ZJP A;  1G2S A;  2DNC A;  1HJP A;  4IUR A;  1YHA A;  2PCF B;  3MEH A;  5F2D A;  3PUW A;  4ZK9 B;  4IFD J;  1BBW A;  4TRD A;  4PQX A;  3SEB A;  2ZM6 Q;  3ONA B;  4DR7 L;  3K59 A;  1LTB D;  3DWQ A;  2B2Y C;  3FPU B;  4BY1 G;  3SVM A;  3Q24 A;  3NEN A;  4A93 B;  5IT9 E;  5CV4 A;  5HGT A;  1N34 L;  1A3U A;  1PYS B;  3NBH A;  2RSO A;  2WP8 J;  2Z1C A;  5M3F G;  1WOC A;  1PHJ A;  1TKW B;  1Q86 C;  3DMU A;  1HPC A;  1HZ9 A;  5ELF A;  3VYU A;  1Q46 A;  4KKU A;  3ULJ A;  1V43 A;  2WAC A;  1TT2 A;  1MBY A;  4YWM A;  1SMY C;  2WAQ B;  5BN4 A;  2JEB I;  3CME A;  1IBL Q;  1TWF B;  1RTN A;  3ULP A;  3S24 A;  1WTP A;  1AZP A;  1DOM A;  2KA7 A;  1YI2 A;  4TVA B;  5KND A;  4CGY B;  1F9Q A;  4JI8 Q;  1RIP A;  3PV0 A;  5AJ3 Q;  1XPO A;  3M7N A;  4OON A;  5C0X H;  3I72 A;  3MXG A;  3GTP H;  2EY2 A;  4C1N I;  3K7U C;  2NVT H;  1FYC A;  1AP0 A;  4DN4 M;  3T16 A;  1PA6 A;  3I4M G;  4DR3 L;  1JJ2 A;  3CPF A;  3AMU A;  1U4L A;  5BR8 Q;  3KLR A;  3L9A X;  4LF6 L;  4A3J H;  2O4X A;  1JE4 A;  2EYF A;  4BY7 G;  4NPS A;  1UE5 A;  3FVQ A;  1EYC A;  4A3L G;  2QF7 A;  1VQL A;  2D9U A;  5ELO A;  2NVX B;  2E2I B;  2XRS D;  3EA6 A;  1YBY A;  4X64 Q;  4JI8 L;  1Q81 C;  1PYB A;  1EL0 A;  2LMC B;  2WB1 G;  1MHW C;  4DNT B;  4KV6 A;  3KJO A;  1VQ4 A;  3CCM A;  2MPM A;  2ATW A;  1BVS A;  1DGS A;  4A3G H;  1JQY D;  2IW3 A;  4BY1 H;  2F0T A;  3L7Z C;  1R4P B;  2JYO A;  1NUC A;  3I2Z A;  3KF6 B;  1OXU A;  3BDO A;  4JI2 L;  4B3R L;  1D1I A;  4G7H C;  3A54 A;  3T56 B;  4JBM A;  3L2P A;  5I9O A;  2SNM A;  5M3F H;  2HQL A;  3KLS A;  2SEB D;  2R7D A;  1QJO A;  4JI0 L;  2QKI C;  1BBX C;  4NMZ A;  3IAY A;  1A2T A;  3P1H A;  3GV6 A;  1GUS A;  4KHP Q;  3Q23 A;  3K7A H;  1WTO A;  1GHK A;  4RWS C;  2K05 A;  5CBE E;  2VQE Q;  4A75 A;  2D62 A;  2R92 H;  3Q8D A;  4LF9 L;  1LYL A;  3FDT A;  4DXF A;  4HID A;  3W5O A;  4R4I A;  2PQA A;  5CV5 A;  3KFU A;  4UPA A;  4ABN A;  1LTL A;  1SN8 A;  3E0J A;  2OWO A; 
#chains in the Genus database with same CATH homology
 3UI2 A;  1EIH A;  3GP7 A;  3HP3 A;  4K6L A;  4IZ8 A;  2M2L A;  1B44 D;  1PRT B;  4XQQ A;  4V0B A;  2K7V A;  2F0Q A;  2Z8L A;  4HSP A;  1X3Q A;  2B2V A;  1HUN A;  3GQB A;  2KEC A;  3PIP 3;  1SFO B;  2HQE A;  1STA A;  1HQR D;  1HFN A;  4DU9 A;  2A74 C;  1FNV A;  4K2L A;  1CK1 A;  4XQN A;  4RGM A;  3L3O C;  1SYC A;  1Q90 A;  3PIO 3;  1Z7T A;  1ET9 A;  1EWC A;  1O7L A;  4ID6 A;  2BE5 D;  1CI3 M;  4CJ2 C;  3NPP A;  1LTT D;  5CC4 A;  2CVR A;  1PRT C;  4MN3 A;  1PRT F;  1ZYR D;  5IIF A;  1S5D D;  3FEW X;  3MC0 B;  1Z47 A;  1G29 1;  1O78 A;  3A7A B;  4IUU A;  3BDL A;  3HEJ A;  4QCL A;  2F0W A;  4K5W A;  5LHY 1;  3LNN A;  1SNP A;  2F0H A;  4A3K B;  1PFB A;  2F0K A;  1LAB A;  3BVM A;  1CTM A;  4R8N A;  3A7L A;  5TSS A;  3HOU B;  2WIN B;  4KN7 C;  4CKB A;  2JEA I;  2IL8 A;  2DNE A;  2I07 B;  1S5B D;  4MHE A;  2L4N A;  1T5X D;  2Q8T A;  3MFG A;  3O13 A;  1NAP A;  4DF7 A;  2PQE A;  1ILP A;  4CJ0 B;  3RLF A;  4A3B B;  4QUC A;  5D3D A;  4R8I A;  2TMP A;  1ML0 D;  1KNA A;  4XDX A;  2PW5 A;  5DM7 3;  1K8O A;  1LO5 D;  2IWH A;  3SE0 A;  4B9X A;  4J1M A;  1F9R A;  1QIL A;  3DHQ A;  2EYM A;  3GD7 A;  2QDB A;  2F0P A;  4V19 0;  1UEA B;  3K5N A;  4RFB A;  3SDZ A;  1SE4 A;  2A6E D;  2K6A A;  1F77 A;  3K5M A;  2K32 A;  4OO1 I;  2FHT A;  3KLS X;  4RGT A;  2KUM A;  3DXJ C;  3N6R A;  1EY5 A;  4FVM A;  3NBI A;  2B2T A;  4F88 A;  2BDN A;  5FLX L;  2NVT B;  5HUR A;  2R7Z B;  4KTA A;  3ND9 A;  5C5M A;  1I4Q A;  1U4P A;  1H9M A;  2B8G A;  4H7B A;  2AQ1 B;  2OEO A;  1UUP A;  4EQN A;  5I4D A;  2M00 A;  2KVM A;  1LTA D;  2OF1 A;  1RD9 D;  5K5P A;  2Q8R E;  3NK9 A;  4FXG C;  3DWP A;  3VR4 A;  1ENC A;  1PYW D;  3R2T A;  4O1N A;  1SXT A;  2RKS A;  1ZEQ X;  4DXG A;  2EXZ A;  5EKK A;  2K33 A;  4HMJ A;  4BY1 B;  4UDU C;  2A73 B;  1A3T A;  1LTI D;  2HCC A;  2EY1 A;  1BXT A;  1XX8 A;  1JOO A;  3VYT A;  4HCE A;  2CQA A;  5M3F B;  3ERO A;  1B9M A;  2WKD A;  1UAP A;  1SE2 A;  4A3E B;  1PFM A;  5FLX E;  1CT1 D;  3M85 A;  3MXN A;  1KAA A;  4RAU C;  4ZUJ A;  1G91 A;  3K5L A;  1CFM A;  3VA7 A;  2L5T A;  3HS0 C;  3PUZ A;  2AWO A;  1AZQ A;  1EWH A;  1D6E C;  4NKL A;  3V2T A;  5IGG A;  2K03 A;  1RTO A;  3I4M B;  2BA1 A;  1D5Z C;  3RMH A;  3V96 A;  2R3Z A;  2JXM B;  2ZT9 C;  4BY7 B;  1LT4 D;  4KY6 A;  5ISR A;  5JPN C;  1SJE D;  2K5Q A;  4GZY C;  3NHH A;  4EVO A;  1D2B A;  3WOF A;  2N88 A;  1TS4 A;  1EY0 A;  3RUZ A;  5CV8 A;  3X3M A;  5C3W A;  3Q6S A;  2WB1 B;  1OXX K;  5T1I A;  3TN2 A;  5IOC A;  5ELE A;  4MIU A;  3OIP A;  5C0X J;  1IYU A;  4M1U B;  2NN6 G;  3HOW B;  1HHV A;  4WFN 3;  1DYQ A;  4WRD A;  2EYP A;  2PO4 A;  4C1N K;  2AWN A;  1WTQ A;  3S2D B;  1IW7 C;  2RBM A;  1V1P A;  1KDA A;  1SNM A;  4EQP A;  3QO2 A;  1Y8O B;  1SYE A;  2WII B;  1TR5 A;  2KED A;  3DM1 A;  1LTS D;  3GV3 A;  5CBA E;  2DY7 A;  4FF2 A;  1U4R A;  3SHL A;  1TS3 A;  1O7Y A;  2X6L A;  3NUC A;  3Q0A A;  1TS2 A;  1LV9 A;  2E2D C;  1IL8 A;  1GXD C;  1STG A;  3G6J B;  1DD2 A;  2MP1 A;  3CQZ B;  3U9O A;  1I6V C;  1HA5 A;  3OMC A;  1RJT A;  2F0I A;  4KI0 A;  3R8B A;  3VR6 A;  3SK8 A;  4I7Z C;  1BOS A;  4K8J A;  3LX0 A;  3DUZ A;  3FMC A;  4FF1 A;  3OWE B;  1OXV A;  3T4A C;  1QNU A;  4KHV A;  1I4X A;  2F0E A;  4F7X A;  1G6Z A;  4FO2 A;  5C0X I;  4XT3 B;  2IX0 A;  1K83 B;  2VUM B;  3S1R B;  3RD4 A;  3NTK A;  4IUV A;  3D4D A;  3T51 B;  1VF7 A;  1HCZ A;  4XXE A;  2F0M A;  4IUT A;  5M5X B;  2JA5 B;  1A6X A;  2NVY B;  2RA4 A;  3M3Y B;  2EY5 A;  4DK1 A;  5JVH 3;  3QWN A;  2F0J A;  4ILW A;  3GTG B;  2KOL A;  3HKZ B;  2EPB A;  3URY A;  3EJI A;  1GHJ A;  3HZX A;  2PNR C;  3C2P A;  3ND8 A;  2AQ2 B;  1S5F D;  3KF8 A;  2B39 A;  1CA5 A;  1ESR A;  4QIW B;  2X6G A;  3MTS A;  4BA1 I;  2XN9 C;  3S1Q B;  2FIN B;  5JJZ A;  3MA2 B;  5M5Y B;  2AUJ D;  3NWS A;  4H13 C;  2OXP A;  3S1N B;  1ROD A;  3IKJ A;  2B8F A;  5C4H A;  1A15 A;  4G4K A;  3F2U A;  1PTO D;  2F0N A;  1CZW A;  3BG3 A;  4N9P A;  3W2D A;  4IFD I;  5KYL A;  3MAQ A;  1NR4 A;  1SMY D;  3S9W A;  5M5W B;  2A68 D;  3FPP A;  1L0Y B;  1ONL A;  1ET6 A;  4KHZ A;  3PO3 B;  4QF4 A;  3LWE A;  3K58 A;  3ZYY X;  5A35 A;  1WD0 A;  2SOB A;  1SBB B;  4N9T A;  3PO2 B;  4RKB A;  3CKI B;  3TP8 A;  4CKE A;  2NBF A;  4KN4 C;  2A6H D;  2NTT A;  1DON A;  4CKC A;  1HXY D;  3I73 A;  4RGN A;  5JAV A;  3V05 A;  2MJ8 A;  3PMF A;  4IN3 A;  4OHJ A;  4KK7 A;  5D3I B;  3SK5 A;  1CM9 A;  3NP8 A;  5ELC A;  4FF4 A;  2BE5 C;  5EQ0 A;  1OXS C;  2D5D A;  1EY8 A;  1FD7 D;  1XXG A;  1BDO A;  2EYO A;  5ELD A;  4RGO S;  1Q3L A;  4DGZ A;  5LL6 X;  1ZYR C;  3TME A;  3RZO B;  5EPK A;  3IFD A;  2E75 C;  1AN8 A;  4HTH A;  2QIL A;  1TVX A;  3QIA A;  3A8J E;  2F0O A;  3AU7 A;  5FK9 C;  3PUY A;  1B4O A;  3AB9 A;  3TP5 A;  2JA7 B;  4CHT B;  1NCV A;  1STN A;  1U4M A;  2WV6 D;  3TP7 A;  5A2Q L;  3Q22 A;  4TKO B;  5EKI A;  4X3K A;  4HMI A;  1ENA A;  3S15 B;  5KNC A;  3A8K E;  1SYG A;  4FXK C;  1FNW A;  4C2M B;  1PZJ D;  2R61 A;  3ERQ A;  4XIG S;  3VYR A;  3S2H B;  4FF3 A;  5JEA G;  1ICW A;  2B2V C;  4LK1 C;  1SEB D;  2E2H B;  3D4R A;  2LS0 1;  4FYD A;  2IX1 A;  1M4V A;  3ITP A;  3PUV A;  2WKC A;  1EZ6 A;  2EVB A;  3GTQ B;  1LAC A;  3OMG A;  5KIX A;  1Q8I A;  5E1F A;  1B50 A;  1OXT A;  2LKV A;  4C56 C;  4Y7N B;  3EQL C;  1B3A A;  3H91 A;  2KCC A;  3C3L A;  2ZXP A;  3H3V C;  4C3I G;  5EBC A;  1Y69 U;  3NTI A;  3FKI B;  1KDB A;  1BCP B;  3HOX B;  2PPB C;  3S1M B;  2A6E C;  3I4N B;  3D6W A;  5A2Q E;  4K5X A;  2HDM A;  3I90 A;  5CV9 A;  4K8I A;  1BQQ T;  3M4O B;  2H1E A;  4OIJ A;  4TQU S;  1GUG A;  4ME5 A;  2VB3 X;  4OO1 G;  1JOQ A;  2KCN A;  3J7A F;  5JPM C;  1RKN A;  1GUN A;  5IGC A;  3HOV B;  1TQO A;  5JEA H;  2CHB D;  5BN5 A;  1MI2 A;  5IGB A;  1F2Y A;  1EU3 A;  2PW7 A;  1QCB D;  1BCP C;  4PV1 C;  5KRU A;  1BCP F;  1V8Q A;  1C4Q A;  3QB3 A;  1RF2 D;  2F0U A;  3DWA A;  4ULL A;  2RDH A;  2Y0S B;  2AQ3 B;  4RHR A;  2ICE C;  3TSS A;  1XYI A;  3WDN A;  1WTV A;  1CA6 A;  2EJG C;  1LTR D;  2F3W A;  3BS1 A;  2K5W A;  4LJZ C;  2V4D A;  1SYD A;  1SAP A;  2R93 B;  3GTO B;  4HR7 B;  1SSO A;  4C3H G;  5NUC A;  5CR3 A;  3GO5 A;  1SJH D;  1HA6 A;  2EDG A;  2K04 A;  3NQI A;  4Q0F A;  2IJ0 A;  1YNJ D;  5KGU A;  1DZ1 A;  1XWE A;  5KNB A;  2C5C A;  4IAL A;  4K2K A;  2PZU A;  3CU7 A;  5J1Z A;  4ZYS A;  4BA2 I;  5C3E B;  2L9H A;  2B2T C;  5I9P A;  1EEI D;  3BZD B;  1BF4 A;  2H4O A;  3OWF A;  3I8Z A;  3H09 A;  1LT6 D;  1PDQ A;  2ZXO A;  3T13 A;  1DXM A;  3I3C A;  4P2C B;  2F0G A;  2XWB B;  3KK7 A;  3G7L A;  3OW7 A;  4KY5 A;  4AYB B;  2EZV A;  1K8M A;  1S4Z A;  2RDG A;  4KKS A;  5C44 B;  1NR2 A;  3H0G B;  4BS9 A;  5DM6 3;  1DOK A;  1GOZ A;  1H9J A;  3P20 A;  4F87 A;  1HQM C;  4O42 A;  2JP1 A;  2J0T D;  3IL8 A;  1A2U A;  1FGB D;  1TWA B;  5FO7 B;  1KLG D;  2XIW A;  3NQT A;  3A56 A;  4HSV A;  1IHZ A;  1EY7 A;  2RQX A;  3S14 B;  2KEE A;  2BCO A;  1V1O A;  3J7A V;  4UAI A;  4IUN A;  4L8J A;  2A69 D;  4JK1 C;  1SE3 A;  5IGE A;  5CMD A;  4HED A;  4RKL A;  1AFP A;  2FFK B;  5CV6 A;  3J80 L;  2DY8 A;  2JA6 B;  3QG1 A;  4HCS A;  2F1M A;  1H9S A;  3E6Z X;  1Y1V B;  1VCI A;  3C1F A;  4S3S A;  4XYO A;  4RA8 A;  5G3L D;  1B53 A;  1EEF D;  2CW0 D;  1DOL A;  4OL7 A;  3TP6 A;  1V1P B;  1STH A;  3DEO A;  3K5O A;  2C9O A;  3SXH A;  3D31 A;  5KYI A;  4IUQ A;  1CZG A;  1E0B A;  1WVL A;  4PMW A;  1JWM D;  4NDX A;  2YU9 B;  4QB4 A;  4K6D A;  3OHX C;  5FKA C;  4L63 B;  4NW2 A;  3SK6 A;  1J9O A;  4C3J G;  1ZKO A;  3EFX D;  1II3 A;  3JAM L;  1QNK A;  4X3U A;  2K1B A;  3QOJ A;  4LAA A;  1I50 B;  3HGB A;  2HDL A;  1QOH A;  2FMC A;  4H0L C;  1TWH B;  1BO0 A;  2E76 C;  2SNS A;  3J80 E;  2G9H D;  2PMZ B;  3BDC A;  4ZRZ A;  5C4X B;  2O2L D;  4IUP A;  2O5I C;  1ILQ A;  1JWS D;  1KLU D;  1YNN D;  4HAE A;  1DJR D;  2F0F A;  3HOY B;  2SDF A;  4PMC A;  4RH6 A;  4A3I B;  1PTO B;  1VF5 C;  1R9T B;  1SDF A;  1TY2 A;  1T5E A;  3M7G A;  1I3Q B;  1E2V A;  1RHP A;  4PNY A;  4HN7 A;  5COR A;  2E74 C;  5E4W C;  3C46 A;  2MHV A;  1PFN A;  1PZI D;  3LWU A;  2NN6 H;  1X3P A;  3HG9 A;  3OSO A;  1SNO A;  4DK0 A;  2PYK A;  3CRK C;  4FNF A;  3OIQ A;  4DAV A;  2XNA C;  3JAM E;  1STE A;  1Z6H A;  5D65 A;  4Q5V A;  2XSC A;  2LFN A;  1HUM A;  4B08 A;  4E6I A;  2L55 A;  2I46 A;  4KD4 A;  2ID0 A;  1QG7 A;  4G7O C;  4FXD A;  1BNZ A;  5K36 G;  4ZQ3 A;  5AFW A;  1IKM A;  3D6C A;  4BBS B;  1PTO C;  5DNF A;  1PXU A;  3TZD A;  1PTO F;  4DA2 A;  1EY6 A;  2RVL A;  1L0X B;  3I4L A;  2F4I A;  3RZD B;  4C3I B;  1F9S A;  2A68 C;  2QCP X;  1MSH A;  1EQT A;  1HTP A;  4RCN A;  1JIC A;  4RCO A;  2MUY A;  2TSS A;  1JC7 A;  2RSN A;  3CHB D;  3MWY W;  4BBR B;  5EJW A;  4JBW A;  3GTM B;  4IFD G;  2ENB A;  3KUP A;  1WTX A;  5I2X A;  1JWU D;  2B2U A;  4XT1 B;  2A6H C;  2ICI A;  3QOL A;  1F2L A;  2NB0 A;  3R2I A;  1Q1E A;  2X69 A;  5COY A;  4KD3 A;  1KTK A;  1O7Z A;  1JB3 A;  3R3O A;  5E4X A;  4X3T A;  3M4Y A;  1KNE A;  2RDF A;  1XTC D;  3MZ5 A;  3BYY B;  1A3V A;  2JA8 B;  2NVQ B;  4KJN A;  2E2J B;  1RCV D;  2GA4 B;  4Z9C B;  1CHP D;  2NWG A;  1TWG B;  3IFT A;  5EKL A;  4DFA A;  5LL6 S;  1QWY A;  1SNC A;  5K36 H;  2EOT A;  2B2U C;  1AEX A;  1VMP A;  3BYT B;  2M9V A;  5ELB A;  3FRP B;  1F9P A;  2PZT A;  1HFG A;  4XYQ A;  2Z4I A;  3D8G A;  4C3H B;  1EYD A;  1JR0 D;  1PMR A;  1WCM B;  2F0D A;  4L6T B;  4ZAI A;  2NUC A;  2NZ1 D;  3MFY A;  1MSG A;  1GUO A;  2L12 A;  1Q12 A;  5JEA J;  2Q8I B;  1LT3 D;  3P75 A;  1TII D;  2FMM A;  1D5M C;  2HCI A;  2KHS A;  2Z4H A;  2HUG A;  1JOK A;  4WOR A;  4A3M B;  3MVV A;  5IGD A;  1Y8P B;  4K14 A;  3I70 A;  1JOR A;  1B1Z A;  1STY A;  4KMU C;  3NSW A;  4YIJ A;  3VR3 A;  3D4W A;  4KY7 A;  3K0Y A;  1I4H A;  1Q1B A;  1PLF A;  3J7Y W;  1F2Z A;  1FR3 A;  1G8Z D;  1KAB A;  3NTH A;  3I91 A;  2L1B A;  1VMC A;  1W6K A;  4I65 A;  4U67 3;  3TBI B;  4KKT A;  2IT1 A;  2F03 A;  2J7Z A;  1JCK B;  4K5V A;  1GUT A;  1EOT A;  2BA0 A;  2F0V A;  3DEP A;  5DEH A;  4OIK A;  5C3X A;  1IKL A;  4EGV A;  4NP5 A;  2L11 A;  1D5X C;  3CRL C;  1RDP D;  3E5S A;  3OOC A;  3OPO A;  4H44 C;  1S5E D;  1U9R A;  1BR9 A;  4CJ1 B;  2IX3 A;  5I6W A;  2F3V A;  2A5H A;  4XQJ A;  2KQ3 A;  1ENF A;  2BOS A;  5I6Y A;  2O5J C;  3W3A A;  1PZK D;  1AW7 A;  4J8Q A;  2K5D A;  1I6H B;  2NTS A;  1B9N A;  1GUW A;  3K57 A;  5EPL A;  1PTO H;  4OGQ C;  1IYV A;  2DN8 A;  3HRZ C;  5JVG 3;  1EZ8 A;  3C1E A;  5E3F A;  2JSO A;  4DAP A;  2B63 B;  4KJO A;  3TDQ A;  1S5C D;  1PRT D;  5J39 A;  5D14 A;  3SK4 A;  1BUV T;  5CYU A;  1FNU A;  2N55 A;  2EE1 A;  1C8C A;  5IOD A;  4F8M A;  3GTL B;  3D3R A;  4B9W A;  2B2W A;  4ZKC B;  1YNJ C;  1TU2 B;  3SR1 A;  4C3J B;  5DAU A;  1TY0 A;  1EY9 A;  1HRJ A;  1E2W A;  2XVS A;  1J8I A;  4X3S A;  2K28 A;  3VA5 A;  3QJY A;  1H9K A;  2IPK D;  4A3D B;  2YYZ A;  4TSS A;  2FJ2 A;  4M8A A;  5M3M B;  3KBG A;  1EU4 A;  1TS5 A;  1DCZ A;  2F0L A;  1CQV A;  1EYA A;  2MGS A;  3GTP B;  4A3F B;  1TWC B;  3K6O A;  3MHB A;  5EPJ A;  4QUF A;  5EBD A;  2B2W C;  2L0C A;  1C48 A;  4A3J B;  3MXP A;  1W6J A;  4RHS A;  1SNQ A;  4ODG A;  1GJX A;  5CV7 A;  4OO1 H;  3BVZ A;  1H9R A;  1ZXT A;  3VR2 A;  1BCP D;  2G9D A;  1Y1W B;  3N52 A;  1DM0 B;  5C6A A;  3VYS A;  4A3G B;  1UNS A;  5IGF A;  5JOB A;  2EY6 A;  5C4Z A;  1G2T A;  1SYF A;  2A69 C;  3MXU A;  4ZKB B;  1LT5 D;  4R9W A;  3S16 B;  1EQV A;  3S17 B;  1R4Q B;  1QE6 A;  2VXW A;  1SYB A;  1STB A;  4G7Z C;  2LY7 A;  3K7A B;  3T53 B;  4WJW A;  3X3N A;  2EYJ A;  5EGT A;  3U9S A;  4IQZ A;  2R92 B;  5G3L F;  2CW0 C;  1HTL D;  1WD1 A;  2XWJ B;  3TZU A;  3J81 L;  1QB5 D;  3VR5 A;  3PUX A;  3WOE A;  5J22 A;  1EY4 A;  1MGS A;  2F0S A;  3KBX A;  1MD2 D;  4DNR B;  1H9S B;  4G57 A;  2VB2 X;  1WTW A;  4EQO A;  4DAY A;  3A55 A;  5KEE A;  4ZUI A;  3P7J A;  3R93 A;  2K01 A;  4LMQ D;  2AUK A;  5T1G A;  4QMG A;  1B2T A;  3NE5 B;  1Y8N B;  4U68 A;  1E2Z A;  1SND A;  2VNU D;  2EJM A;  3A8I E;  4PMB A;  3BVG A;  2EYH A;  1WTR A;  1YNN C;  2EJF C;  1X32 A;  1LTG D;  5FO9 B;  1VDZ A;  1EFI D;  1I4G A;  3HOZ B;  2R6G A;  2BDO A;  5FOB B;  3H6M A;  5I2Y A;  1EIG A;  1CHQ D;  1I4P A;  1KDC A;  5CGK A;  2KJX A;  3J81 E;  1O80 A;  2NYZ D;  2PZW A;  2JE6 I;  2OT2 A;  2D2C C;  4FP5 D;  1F2M A;  5FO8 B;  2ZXR A;  2NN6 I;  1ESF A;  4ZLT F;  5C4J B;  5IT9 L;  5C5L A;  5BN3 A;  5M9O A;  4BWG B;  4CBV A;  2B2Y A;  3GTK B;  5C0X G;  3H94 A;  1OO9 B;  2QEJ C;  2EYL A;  3NWT A;  3NXW A;  4J6H A;  1IW7 D;  3GTJ B;  1D1K A;  2XRQ D;  2J4X A;  1NSN S;  1CQF A;  3EVQ A;  1I4R A;  4XTC S;  1LLR D;  1M8A A;  1G2S A;  2DNC A;  4IUR A;  2PCF B;  3MEH A;  5F2D A;  3PUW A;  4ZK9 B;  4IFD J;  4TRD A;  4PQX A;  3SEB A;  3ONA B;  3K59 A;  1LTB D;  3DWQ A;  2B2Y C;  3FPU B;  3SVM A;  3Q24 A;  4A93 B;  5IT9 E;  5CV4 A;  5HGT A;  1A3U A;  3NBH A;  2RSO A;  2WP8 J;  2Z1C A;  1TKW B;  3DMU A;  1HPC A;  5ELF A;  3VYU A;  4KKU A;  1V43 A;  2WAC A;  1TT2 A;  1MBY A;  1SMY C;  5BN4 A;  2WAQ B;  2JEB I;  1TWF B;  1RTN A;  1WTP A;  1AZP A;  1DOM A;  2KA7 A;  5KND A;  4CGY B;  1F9Q A;  3PV0 A;  3M7N A;  5C0X H;  3I72 A;  3MXG A;  2EY2 A;  4C1N I;  1FYC A;  1AP0 A;  4DN4 M;  3T16 A;  3AMU A;  1U4L A;  3KLR A;  3L9A X;  2O4X A;  1JE4 A;  2EYF A;  3FVQ A;  1EYC A;  2QF7 A;  2D9U A;  2NVX B;  2E2I B;  2XRS D;  3EA6 A;  1EL0 A;  2LMC B;  4DNT B;  4KV6 A;  2MPM A;  1JQY D;  2IW3 A;  2F0T A;  3L7Z C;  1R4P B;  2JYO A;  1NUC A;  1OXU A;  3BDO A;  1D1I A;  4G7H C;  3A54 A;  3T56 B;  5I9O A;  2SNM A;  3KLS A;  2SEB D;  1QJO A;  2QKI C;  1BBX C;  4NMZ A;  3IAY A;  1A2T A;  3P1H A;  3GV6 A;  1GUS A;  3Q23 A;  1WTO A;  1GHK A;  4RWS C;  2K05 A;  5CBE E;  2D62 A;  3FDT A;  4DXF A;  5CV5 A;  4ABN A;  4IFD H;  3E0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...