1AZQA

Hyperthermophile chromosomal protein sac7d bound with kinked dna duplex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3')
publication title The hyperthermophile chromosomal protein Sac7d sharply kinks DNA.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1997-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1azqA00
1RTNA 2B2VA 1ESRA 1ML0D 1RJTA 2B2YC 5CBAE 4DN4M 2EPBA 4IUQA 1QNKA 4X3UA 5COYA 3FDTA 3H91A 1RHPA 5EQ0A 2DY7A 2K1BA 1HUNA 2L9HA 2B2TA 2M2LA 1BO0A 2B2TC 1PFBA 2MJ8A 1PLFA 1X3PA 1X3QA 2J7ZA 1A15A 2R3ZA 3FPUB 4NW2A 1CA5A 1G91A 4XT1B 1IL8A 2X6GA 1F9SA 1G6ZA 2IL8A 4ZKCB 1SDFA 1EIHA 1HFNA 1G2SA 4X3KA 2HCCA 1WVLA 3F2UA 1EOTA 1G2TA 3IL8A 4ZLTF 1WD0A 1DOKA 2RA4A 3I90A 1B50A 1CA6A 4XT3B 2JYOA 3LWEA 1EQTA 1WTOA 1ZXTA 5D65A 3I3CA 2KECA 3IFDA 2B2YA 1MGSA 1XX8A 2CVRA 4IURA 1O7ZA 5EJWA 5EPLA 1WTRA 2FJ2A 1HFGA 4IUVA 5CORA 1B3AA 1HHVA 4O42A 1LV9A 1JICA 4ZKBB 2KEEA 1ICWA 1NAPA 2HDMA 3I8ZA 1HRJA 4XDXA 1O7YA 1DZ1A 4IUPA 2JP1A 2MGSA 3D6WA 2VXWA 1F9RA 2D9UA 1VMCA 3KBXA 4X3SA 3TN2A 1QE6A 5T1IA 2RVLA 2B2UA 1IKMA 2RSNA 2B2UC 4ZK9B 1WTXA 3MWYW 3N52A 1PDQA 1RTOA 1X32A 4U68A 3GV6A 4HEDA 1M8AA 5DNFA 2Q8RE 1J8IA 2B2WA 2SDFA 3SVMA 4R9WA 4RWSC 1BNZA 1ILPA 1U4LA 2B2WC 2EE1A 2L12A 1MI2A 1HA6A 1F9PA 2EOTA 2Q8TA 4HSVA 1ILQA 1F9QA 3TZDA 1EIGA 4IUTA 1E0BA 1F2LA 1Q3LA 2HCIA 4RAUC 2KOLA 2X6LA 1WTWA 1U4MA 2K05A 3Q6SA 1SSOA 2N55A 1XYIA 2K03A 4QUCA 1TVXA 2KUMA 5CMDA 1WTPA 2NYZD 1DOLA 1SAPA 4IUUA 1J9OA 1IKLA 1GUWA 4LMQD 1PFMA 2K04A 1PFNA 3DEOA 4UAIA 2FHTA 1KNAA 4HCSA 5E4XA 4ZAIA 2L4NA 2NZ1D 4HAEA 1WD1A 5AFWA 2FINB 4CJ1B 1B4OA 2NWGA 1B53A 2K28A 5T1GA 1CM9A 2KVMA 1VMPA 2FMMA 1QG7A 1S4ZA 2HDLA 3ONAB 3UI2A 1U4PA 3I91A 2B2VC 2MP1A 4MHEA 1WTVA 2N88A 2HUGA 4OIJA 1BF4A 2BDNA 5EKIA 3R93A 4MN3A 2FFKB 1WTQA 3QO2A 5EPJA 5E4WC 2XIWA 3KUPA 2MPMA 4CJ0B 1DONA 1DOMA 3HP3A 1KNEA 2K01A 1MSGA 1EL0A 2L11A 2L1BA 2X69A 1B2TA 4RA8A 1O80A 2DY8A 4OIKA 3P7JA 1JE4A 4X3TA 1AZPA 1BBXC 2RSOA 1C8CA 3MTSA 3G7LA 5JJZA 4CJ2C 1RODA 3DM1A 4QUFA 1NR2A 1AP0A 1NCVA 3DEPA 3GV3A 5EPKA 4R8IA 1MSHA 1HUMA 1U4RA 2H1EA 1AZQA 5D14A 5CBEE 2KEDA 1NR4A
chains in the Genus database with same CATH superfamily
4G7OC 4AYBG 2IX0A 3NSWA 3E0EA 4DV4Q 1NE3A 1SXTA 4R4IA 3K57A 2ZJQA 1OXSC 3V05A 2B8FA 2R61A 4K8IA 3JAMi 3FPUB 3C1FA 5CV7A 1S40A 1QVGA 4BA1I 3UDFA 3PUYA 1G6ZA 2XVSA 5JEAG 3RD4A 3WWVA 2WB1B 4FF1A 4DGZA 3OWFA 4DR5Q 3SK4A 3S9WA 2E76C 3H6MA 3RN2A 1PA6A 1EUJA 2KCTA 3EN2A 4R4OA 4LFCL 1O7ZA 1KDCA 1TWFB 5EPLA 1K8AC 4MTKA 4JCVE 4O42A 4XYOA 1Z47A 5I2XA 4ME5A 4DV1Q 1GD7A 1ET9A 4KY7A 1EY9A 4DV2Q 4DV7Q 2JA5H 3HOWH 1RL2A 3CW2C 1GXDC 1VMCA 2EY1A 3VYSA 5F2DA 2KHSA 3J81c 2ZM6Q 5KYLA 2I5HA 3T16A 4KHZA 1N32Q 4KHPL 4LF8L 1JJGA 2LY7A 2PNRC 4N8X1 1PRTD 3LNNA 1J8IA 1ILPA 3IFTA 3EJIA 1K3RA 1OXVA 2HQLA 2SNSA 4A3BH 2ZXRA 1VQFA 1RIPA 1K83B 4JI5L 1DOLA 1QNUA 2RDFA 5A2QE 1B3QA 4EVOA 5JPMC 2UUBL 1R4QB 5KNBA 1Z6HA 2NZ1D 3J80L 3CU7A 4A3MG 1B4OA 3V96A 3HFZB 3VR3A 2K28A 3DLLA 3I4NG 2F0SA 2Z1CA 3ONAB 1YZ6A 3I4MH 3GTGH 3C1EA 4NDXA 1EWHA 2Z6KC 2K5NA 3VYUA 4NPSA 1KAWA 3R93A 4BBRG 3MXPA 1ASZA 1BXTA 4F87A 4WJWA 4OO1H 2K5WA 1KNEA 1QWYA 4KY6A 3KBGA 3IRBA 4TRDA 2H4OA 4Y52H 3UE1A 2MO0A 4OGQC 1I4PA 1NBWA 5ELNA 3J81L 5GADC 2RSOA 3AYHB 3DWAA 5JPNC 1L1OB 2E75C 5FJ8H 1AZQA 1CQFA 1WI5A 1JR0D 4HMJA 3PIPA 4A3GG 3M4OH 2Q8IB 5CBAE 2Z6KA 1VQOA 4PMCA 4B9WA 2B3GA 2K5VA 5J3BA 4PQXA 3HOYB 4KY5A 4QCLA 4QQBX 3GTPH 2IY5B 2E2JB 1A3VA 5C44G 4HTHA 2BCOA 3NE5B 5CV9A 4JI6L 3HS0C 3Q24A 4WJ3M 2VW9A 3S2DH 3AEVA 3K80C 2I0QA 5KGUA 3QB3A 4ZKCB 4DR6Q 1I5FA 4HJAA 4DR7L 1X56A 5CV5A 3AMUA 1SYCA 1G2TA 4LFCQ 1A62A 1SFOB 1DOKA 1HTPA 2OT2A 3BU2A 2R92G 3MFGA 3GTJB 4A93G 3IFDA 4IURA 2CVRA 3U9OA 3NBHB 1TWHH 1PRTF 3K7AB 4RH6A 4ZKBB 2EY5A 4I7AA 3PSIA 3FP9A 1ASYA 3A74A 4B3TQ 1IL2A 4KKSA 1B9NA 1LTGD 4IN3A 1CKNA 2A6HC 3S1MH 1ESFA 2VXWA 2HIVA 4X3SA 2PCFB 1YEZA 2F0WA 5T1IA 2PZTA 1H9JA 3V2TA 4LFAL 2PI2E 3FPPA 3MC0B 5JJIA 3N52A 4WJ4A 1I6HB 2EE1A 5CC4A 2GN5A 1HA6A 4HSVA 4JI0Q 4B3ML 1WJJA 1A0IA 4RAUC 3DWQA 3J7YW 4YCVA 3STBD 4FDBA 5CMDA 2XWJB 1ET6A 2DJFC 1SAPA 2UUBQ 2RCFA 1C0AA 5C4JH 2ICEC 1VQPA 1VQ6A 4JI4L 3A56A 4UAIA 5JOBA 4LF5Q 1PH9A 1NNXA 3NP8A 2PMZE 3NQIA 4B9XA 2SOBA 1D1KA 5GAHC 3Q22A 5IE8A 3A8KE 3HEJA 1VQLA 3CKIB 4C1NK 2BDNA 3RZDH 3S2HB 2E74C 5E4WC 1FYCA 2XN9C 1CFMA 3J81i 3J81j 4DUZL 2F0QA 4A75A 5IIFA 2L11A 1X3GA 4JI7L 4DAYA 5C4XG 4DF7A 4YWMA 1CHQD 5EKKA 1J5EL 1Y1VH 1K8GA 3GP7A 2A74C 3HOVH 3GV3A 5DM63 1X65A 2NVYB 1Q81C 2B2YC 2KQ3A 2R7ZH 4DN4M 1BCPD 1EYAA 1CKOA 3H91A 2QA4A 1YHBA 1M1KC 2UXCQ 4JK1C 1CHPD 1I4HA 2N8NA 1PH2A 1FJGQ 1PFBA 4QIWE 1X3PA 4DAPA 1N36L 5CV4A 2IX1A 1XTCD 4A3EH 4OELB 2A73B 4AH6A 1F9SA 4HIDA 4XQQA 2JE6I 5FJ8G 1YVCA 1STGA 1SE4A 1K8MA 3ND9A 3F8TA 2ALYB 1UWVA 1T9HA 2EYFA 3M7NA 2B2YA 1H9SB 2YU9H 2FJ2A 3A55A 1LTID 1B44D 4UP9A 5C4ZA 1A63A 5M3FB 1HHVA 2WFWA 1MJCA 3RZOB 1T5EA 1O7YA 4JI3Q 4BBSB 2JP1A 1R9TB 3OSOA 1PXUA 4OX9Q 2LSSA 4AQYQ 4K5WA 4JG2A 1Q1EA 1K3BC 3FMCA 5FO7B 1WTXA 5ELDA 4HJ9A 3EFXD 4JYAL 1U4LA 2AWNA 4P71A 5M5XH 3HOYG 1LACA 4KN4C 1JCKB 1U0LA 4E6IA 2JA8B 1CKMA 3KDFB 1SJHD 4LF7L 4GLVB 1XNRQ 3CQZB 1BDOA 1SYFA 2BH8A 3TSSA 3H0GB 4HAEA 4O2DA 4XQJA 3M4PA 3U4VA 5AJ3Q 4Q5VA 3MEFA 1EZ6A 1D6EC 5IGCA 4DV0L 1CKNB 1CTMA 1Q8IA 2K4KA 4OIJA 1CZWA 1GJXA 4R4CA 4QJFA 4IFDG 3CC7A 4CJ0B 2K32A 4LNQA 1G51A 1T5XD 5C3XA 1JOOA 2K5QA 2A8VA 5IGDA 5IWAQ 1BKBA 3DEPA 5C4HA 4POGA 2VB2X 1WYDA 2C35B 1BBUA 2BDOA 2BA1A 5J22A 2CWPA 1QNKA 2DGYA 3D4DA 4HJ8A 4C3IB 5EGTA 2B63G 3ULLA 3HOZB 4GKJL 1XPOA 4IOAA 4ILWA 1A3UA 1X3QA 1CA5A 1BR9A 4QGUA 1HNZQ 3UDIA 2IL8A 4APVA 1GUNA 1HFNA 3G4SA 3K0YA 5FLMG 1WVLA 1FGUA 3A8JE 1IBLQ 3ICEA 1TWAB 2V1CC 5D65A 3I3CA 2KECA 4GKKL 3TP6A 3CPWA 4DAYB 1SYEA 3BZDB 3GTMH 3UE0A 2ENBA 4DFAA 4PG3A 3K7UC 1HRJA 1V1OA 4X62Q 4H44C 1A6XA 1PTOC 1XMOL 5IYCG 1JQYD 5G3LD 1F2YA 1QE6A 1UE7A 2A6HD 1KXLA 3I55A 1PDQA 3K8AA 1X32A 3GV6A 4HEDA 3AFQA 2SDFA 5BN3A 2VUMH 4MTNA 2JK8A 4F8MA 4BY7B 1S5BD 4A4IA 1Q12A 4C2MH 2KOLA 4AIMA 3TP7A 1SSOA 3S17B 3S15H 1J6QA 4IUUA 1IKLA 4DR4Q 1H95A 3TEHB 5EBDA 5E4XA 4EQPA 4C3HH 5M5YB 5IP7H 1FNUA 1TWGB 2NWGA 3PQIA 5M3FG 1UE6A 1VQCA 2FMCA 2MP1A 4V190 3CPFA 1NUCA 5EKIA 5IGEA 4IFDI 4X64Q 3GD7A 3QIAA 5C5LA 1WTQA 4A76A 2CH4W 1GUGA 1S5DD 4CGYB 4BXXG 2K01A 3HRZC 3BVZA 2ICIA 1MKHA 5KNCA 1O80A 3L2PA 1GKHA 4P72A 1YNJD 1TXYA 5I9PA 2KA7A 3BJUA 5ISRA 1GVPA 1OXXK 4FNFA 1IYUA 4X66L 1I94L 4MIUA 3D4RA 5EQ0A 3S1QH 3K6OA 2JJQA 2YTYA 2K1BA 1CT1D 2C9OA 1KLUD 3SGIA 4DK6C 5C0XH 3S14H 5JJKA 4K2KA 3H0GG 1WTHA 3PIO3 2KCNA 1JJ2A 1VQJA 1XNQQ 1SN8A 3EVQA 2JA7H 4BA2I 3CRKC 4L8JA 2HCCA 1PYBA 3U9SA 2OF1A 3M85A 1DJRD 4DR2L 1SEBD 1SYBA 3H15A 2OEOA 1SYGA 1EQVA 2IT1A 4GN3B 4ZCKA 1OO9B 2OTJA 1XX8A 1STBA 4JI1Q 1TY2A 3W5OA 2NVQB 4LF9L 4DKAC 1VQ7A 2QDLA 3TMEA 5IOCA 5FKAC 1HQMC 5IYDG 1TQOA 3G6EA 3EIVA 4NP5A 3TQYA 1D1IA 1ZYRD 1Q7YC 1IBMQ 2ZJPA 3JAML 2WAQE 5FLXc 3T13A 1RTOA 1N33L 2Q8RE 3AB9A 4C3IG 1MI2A 3L9AX 1EY8A 2KHJA 4A3MB 1E2ZA 1LLRD 4DV3L 1L1OC 2X6LA 4LUOA 3I4NB 3SE0A 4S3SA 3S1RH 4BY1H 3W3AA 1TU2B 3RMHA 4KLKA 1YNNC 2J4XA 1RD9D 4RHRA 1L2FA 4YWLA 4ODGA 4BBRB 4UP8A 5C3EG 1PH5A 1EYGA 1VMPA 4JW0A 4LUVA 4MHEA 1F2ZA 3J81E 3HOUH 3T51B 1W2BA 2HUGA 3H94A 1K0SA 4LF6L 4MN3A 3OMGA 2YV5A 4YWKA 2KCCA 2UXBL 4FYDA 1DONA 4G57A 4CDDC 5FO8B 2G9HD 2BH2A 4ZRZA 1MJEA 4C3HG 3W1BA 4X3TA 5IP7G 2A19A 3K58A 3T53B 2D62A 2K7VA 1SE8A 1NR2A 1X6OA 1I94Q 1U4RA 5FLXL 5D14A 5C5MA 3MHBA 3M4QA 1GHJA 1EEFD 1TKWB 3KF6B 1K9MC 2F4VL 3CCJA 1O78A 1PZID 3T1HQ 2CW0D 4A93B 2K5HA 3OMCA 3H3VC 2NN6G 3NBHA 3E3XA 2EYJA 2M00A 4KV6A 2JEAI 2RA4A 3VR2A 4KJOA 2NZHA 1ZXTA 3JC66 4HJ5A 3CCLA 5M5WH 2R93H 5ELCA 2RF4A 4A3KH 4FXGC 1VQMA 1WCMH 4XXEA 3GTQH 1R4PB 3CC2A 1HZ9A 1LT6D 4DR1L 1N8RC 1BVSA 4Y7NH 2JA5B 3EA6A 2IHEA 2RVLA 3HOWB 1PTOD 1YHQA 4WFN3 1PTOH 5I2YA 4P73A 4IOCA 5JVG3 3PMFA 3OTOL 3I72A 1U9RA 4K6LA 1AE2A 2E8GA 2CHBD 3VA5A 1MD2D 3ITPA 4YHHQ 4I65A 2O4XA 3SDZA 1WTWA 1EYDA 3Q6SA 2GVBA 3PO3H 3FEWX 2Z4IA 4NMZA 5C0XJ 4A3BB 2AWOA 4QL5A 2F0GA 1Y1WH 3CCMA 1D7QA 1DD2A 2XRSD 2B39A 4CJ1B 1CI3M 3NQTA 5KYIA 5C4XB 2UU9Q 4LF6Q 3TS2A 2MNAA 2UXBQ 1PYWD 4DXGA 3I4MB 3J7AF 4EQ5A 1N9WA 3GTGB 2R6GA 1G291 4GNXB 1BUVT 4K0KL 2BE5C 1TWCB 2X69A 1LT3D 4GOPB 1NTGA 2L5TA 1EZ8A 3P7JA 3C46A 3L3OC 1EFWA 3G7LA 5DLQE 3F2CA 2A6EC 2E5LL 2A69D 1UEBA 1TWFH 4H0LC 3F2BA 2UUAQ 3IAYA 1JB3A 2L15A 3M4OB 1VF7A 2P5ZX 2NN6I 3K59A 2B2TA 4C3JG 5LMNL 3GDEA 2R3ZA 2F0EA 1H9SA 1BQQT 1DXMA 5IGGA 5IYBG 3GTPB 4A3FG 4X3KA 4O1NA 2KHIA 4HR7B 5KRUA 3S2DB 2V4DA 5I6WA 1Q46A 3A5ZB 2K50A 2E2HB 1FD7D 3NTIA 1A3TA 2UUCL 1I3QH 5J39A 1PTOF 4UY8C 5IP9G 3R8BA 4IQZA 3QG1A 2N49A 1Z7TA 4J15A 1MBYA 1IYVA 2PO4A 1TWHB 1LTBD 2ZT9C 4KN7C 2JEBI 3T1YL 3KBXA 4FXDA 4ULLA 3S1MB 2B2UA 3U50C 4A3IH 2F0DA 1D5XC 5D3IB 5LL6S 3KDFA 4CDEC 3SK5A 5BN4A 4IJHA 4JOIA 5CGKA 4CDFC 2DUDA 4NXML 2F4IA 2D5DA 4A3CH 1BBWA 1VQHA 3RLNA 2E2IB 1JE5A 4XTCS 1ZKOA 1FL0A 2R7FA 3BDCA 4EQOA 2K04A 4LF8Q 1EWIA 3KLWA 4KHPQ 5C4JB 2EYOA 4YY3L 3CCQA 1B53A 2N3SA 4IZ8A 1S4ZA 1QILA 1U4PA 5I4DA 2ZJRA 1I4GA 3R3OA 2N88A 1D5MC 4K0KQ 3W1GA 4JI5Q 2E2JH 4KD3A 1Y8PB 2JA5G 4J1MA 2MPMA 3S16H 1JB7A 2IWHA 3HOWG 4OWXB 3T4AC 3GTLH 1I50H 2ZTEA 3QOLA 2WAQG 3OW7A 1PH4A 4K2LA 3KOJA 2B63B 1SFOH 1SE3A 1VQ4A 1BBXC 4N9TA 3GTJH 3A7AB 3TP5A 2D2CC 2Y0SE 1IBKL 1PVOA 5ELFA 2DN8A 2WINB 1IZ6A 1ESRA 1JOQA 4A3BG 3Q0AA 1VQGA 2R7ZB 1HR0L 2L9HA 2XWBB 2I5MX 3DWPA 3CCSA 1BCPB 2K52A 3HZXA 1BO0A 3E5SA 1MHWC 1PLFA 1QCBD 4UP7A 5CYUA 2YYZA 4XT1B 5NUCA 4DNIA 2X6GA 4A3JH 1QVCA 2I5LX 3H3VH 3VR4A 5ELEA 4A3EB 5IT9c 2NZOA 3DUZA 5C3WA 2UUCQ 2JA6H 3I4MG 2JA9A 1XTDA 1SROA 2JYOA 3P1HA 4HMIA 1HFGA 2D0OA 4OO1G 1S5FD 1LABA 1JICA 2YU9B 1VQBA 1NAPA 2RQXA 4XDXA 4JI6Q 4RFBA 4H13C 4DR7Q 1HCZA 3QJYA 5FK9C 2PPBC 4A3DH 1VF5C 5BR8L 2B8GA 1I6VC 5E1FA 3S2HH 4GLAC 4X65L 1YNXA 2F3IA 3TZDA 3PIP3 1Q3LA 5M5XB 3KJOA 5K36H 2N78A 4TSSA 1NJIC 1HPCA 4JI8L 1E2VA 1KTKA 1KD1C 4LFAQ 1W6KA 3OW2A 3M3YB 3MEHA 3GTOH 5A35A 1AEXA 1CUKA 4IALA 4DNTB 4HIMA 3QR8A 5IT9L 2HDLA 4B3MQ 1IXRA 1SMXA 1KIXA 2PYKA 5ELBA 4N9PA 1NMGA 3CHBD 3HKSA 3NENA 3WOFA 2VQEL 4JBMA 2F0KA 3ZJYC 2XIWA 2QDBA 2LFNA 1VQAA 5LMUL 4JI4Q 1PH3A 4FO2A 4G4KA 5JJZA 3J7A5 3TS0A 3HG9A 4KJNA 2PMZB 4WRDA 1ML0D 4IUQA 5DM73 2Z0SA 1GUSA 1RHPA 4BBSH 4JC0A 1R9TH 1S72A 4DUZQ 3I4LA 4CKBA 4JI7Q 2JXMB 1D5ZC 1E1OA 3VA7A 1J5EQ 1C9OA 1Q8KA 4L5RC 2L0CA 3FKIH 2LKVA 3OIPA 3BZKA 4XT3B 3PO2H 1I4QA 1WTOA 4PZ6A 2J0TD 2R7DA 4KKUA 2NUCA 4HJ7A 2JA8H 1MGSA 4OO1I 1TS3A 3JAME 1LUZA 2RDHA 2KENA 4AYBE 3NUCA 2Z8LA 4PZ7A 3CQZH 1HNXL 3PUWA 2HDMA 1N36Q 1PYSB 1JJCB 3GTMB 1DZ1A 1JWMD 1UNSA 2EQSA 2OWOA 3KLSA 2D9UA 3TN2A 1JOKA 1Y1VG 4QIWB 4HIOA 5GQOA 3O13A 3HOVG 3VR5A 2LS01 4PMBA 3HOXH 1W3SA 4LAAA 2B2WA 1Y69U 2R7ZG 1EY4A 2D0PA 3URYA 4Q0FA 4JBKA 1EIGA 4RHSA 2HCIA 1LO5D 4KD4A 5C3EB 3X3NA 1SRUA 2KUMA 4C2MB 1WTPA 2AUKA 4A3EG 3K5NA 4RG1A 1EU4A 2SNMA 2HT1A 3CP0A 4X6AH 4JYAQ 2FINB 2VNUD 3E0JA 4RKBA 1Q1BA 4C3HB 1STYA 2ZXOA 1ICFB 2QGQA 4JPBW 4LK1C 3KF8B 1BF4A 3RNUA 2MUYA 4GLXA 3KLSX 4PV1C 3I73A 5FLXE 2O2LD 5EPJA 4LF7Q 1X54A 2CQOA 4G7HC 2OCEA 4K8JA 3AU7A 3KF6A 4DV6L 4K5VA 1FNVA 1W6JA 3ERQA 2HHHL 4B3RL 2CFMA 4R8IA 1VQ5A 1MSHA 4DV0Q 1V1PB 1Z9FA 4CHTB 2NVTB 1NY4A 1RJTA 1C48A 1KABA 3FDTA 4A3LH 1C4QA 5E7NA 1LTTD 2OXPA 1QOHA 3S1QB 4K5XA 3DXJC 3ER0A 4FVMA 2QCPX 1STHA 2RHSB 3NEMA 3HKZE 3S14B 3NK9A 3C2PA 1B9MA 1UEAB 1HTLD 2QKIC 4BY7H 3I90A 1B70B 5GAEC 4JV5L 5M3MH 1P8LA 3S17H 4DV5L 1WTRA 4GKJQ 3MFYA 3BZCA 3I2ZA 1IHZA 4DR3L 3ULPA 5I9OA 2WP8J 2EJMA 4LFBL 2LXKA 1NSNS 1STAA 2PW5A 4GNXC 1SJED 4DU9A 4GKKQ 2AQ1B 2EY2A 5I6YA 1BNZA 2EOTA 5IY0A 4MNOA 3K81C 1HQRD 1WOCA 3S24A 1XMOQ 1LM0A 5HGTA 3K5OA 1YJNA 4BY1B 4OXPA 2F0MA 3TRZA 2UXDL 2KCMA 1SBBB 3M9BA 2KBNA 4GNXA 4L5TA 4TVAB 3E9HA 5LHY1 2FMMA 1KAAA 4GOPA 4XYQA 4P2CB 1WTVA 4B3SL 3OPOA 4EGVA 3S1NH 4DV4L 4PNYA 4GZYC 4LUZA 1FGBD 1DOMA 3CXCA 2AMCB 4B3RQ 1KLGD 3PGZA 3GTKB 1V1QA 2DY8A 3CCVA 1ENCA 1KDAA 1JE4A 1AP0A 1HZCA 1XPRA 1GOZA 2M9VA 1C8CA 2WB1E 4C3JB 4P75A 5EPKA 2VUMG 1ONLA 4RGMA 2YTVA 1CSQA 4R4QA 4IPHA 3BYYB 3DHQA 3Q8DA 3AQQA 4DR5L 4A3FB 3MZ5A 1X3FA 2WKDA 1K0RA 2O5IC 3L7ZC 5FO9B 4DV1L 2RHQB 3PUXA 1IYJB 1S3OA 1PV4A 2DNCA 4DV7L 4DV2L 3A54A 3SK6A 4KI0A 1IL8A 4YCUA 2VZAA 4M8AA 3KFUA 2QF7A 3AFPA 2ZM6L 4X66Q 5JJLA 1N32L 4FF3A 1OXUA 4A3MH 1VS0A 2AUJD 2K14A 3PCOB 3STBC 3I4NH 2F0NA 1V9PA 4KMUC 4IUVA 5CORA 3G48A 4BBRH 1UE1A 5LL6X 5M5WB 2R93B 4GS3A 3CMAA 1QZHA 3J7ZC 1JC7A 1LT4D 2VL6A 3EQLC 1IKMA 2RSNA 4DR2Q 1OTCA 1LT5D 5IGBA 4LF9Q 1QJOA 4A3GH 1ILQA 1L0WA 1JMCA 5C0XG 1XYIA 3J7AV 3K0XA 1V8QA 2NVXH 1GUWA 1J9OA 4PZ8A 1X9NA 3PO3B 3RUZA 2K6AA 2JA7G 2PQAB 1PFMA 5C44H 3MXNB 2JQOA 1N33Q 2IPKD 4H02A 3RLOA 1BCPC 1M90C 3R2IA 2IW3A 2WAQB 1EYCA 3UI2A 5M9OA 2F0OA 2VY3A 2B2VC 1JWUD 4DV3Q 2R92H 4A93H 1SLJA 2AHOB 1D8LA 1PRTB 1VQEA 2MHVA 2MO1A 1TT2A 3WDNA 2ASBA 2A1AA 2KJXA 2I46A 3HP3A 2EYMA 2QILA 1SMYC 3MXUA 1E2WA 2NB0A 4DPGA 1B2TA 3J80c 1VQIA 1PH7A 4BS9A 1VCIA 3MTSA 1YJ9A 1AH9A 4CJ2C 4QUFA 4OWTB 2PZWA 3NELA 4DR6L 2CWAA 3D4WA 3BDOA 1GM5A 2F0JA 1EIFA 2B2VA 2EY6A 1SNDA 3F1ZA 2EXDA 4BY1G 5KNDA 1STEA 2RDGA 3BG3A 2B2TC 3E9IA 4B3TL 3A5UA 2PW7A 5CV6A 2GA4B 2A68C 2NTSA 2F3VA 5JEAJ 4IO9A 1HJPA 3HOUG 3LWEA 2F4VQ 1AN8A 4BWGB 1G6PA 4JI0L 1KRSA 1GHKA 1I3QB 4ZUIA 2F03A 4JBJA 3TBIB 2F3WA 3SHLA 5C4XH 1VQKA 1TS2A 2B2UC 1P16A 4LF5L 4WORA 4U68A 1M8AA 4A3IB 1YBYA 2EYLA 2L12A 4JOIC 2Q2UA 2Q8TA 3SEBA 5C0XI 1K83H 4J6HA 2CH4A 1TWCH 1EQQA 2PI2A 2Q2IA 4FP5D 3HKZG 4DR1Q 3RLFA 1IW7C 5IT9E 3NBIA 1O7LA 4GN4B 4UHVA 1PZJD 2F52A 1WFQA 1YJWA 1EEID 2RBMA 4U673 3TZUA 3OTOQ 1OXTA 3A0JA 1YITA 1KL9A 2R93G 3OYYA 4A3KG 3CF5A 1WCMG 1SNMA 3QO2A 1QUQA 3KUPA 2Q2TA 1ENAA 4RGNA 1DYQA 2UXCL 4CDCC 5K5PA 3S16B 2DJGC 1I4RA 1FJGL 3GTLB 2HIXA 3MA2B 1I50B 1AZPA 4DK3C 4L5QA 1YNND 2E2HH 1UUPA 1JWSD 2F0UA 4DUYL 1AFPA 2KEDA 3I70A 1K73C 1RTNA 3NTHA 3BS1A 4EX5A 2ZXPA 4ID6A 4C1NI 4X3UA 3HOYH 2IX3A 3PO3G 1Q86C 1B8AA 2XSCA 2ZTDA 1DCZA 3KYHC 1HNWL 3TREA 1FR3A 5KEEA 3DMUA 2M2LA 1FVIA 1VQNA 1Y1WG 1G91A 1A15A 3CMEA 1XWEA 1RCVD 3RZDB 2YTXA 4JI3L 3TDQA 2E5LQ 4OX9L 1E7ZA 4AQYL 4KKTA 4CBVA 4POFA 1YIJA 1G2SA 1SE2A 1KHIA 1EOTA 4A3JB 4ZLTF 1GUOA 1QB5D 1Y1VB 2F0TA 1SYDA 3P20A 1SNPA 3FVQA 4F7XA 1XXGA 3HOVB 3K7AH 2JA6B 1VDZA 1SNCA 2E2IH 1B3AA 1YI2A 5LMNQ 4LJZC 3W2DA 1HXYD 4JVZA 4IFDH 5LMNW 4IUPA 3D6CA 3FRPB 2WB1G 3J80i 1SR3A 4IUNA 1QZGA 1F77A 1B7YB 5C6AA 1TS5A 1B1ZA 1XNRL 3PF4A 2EXZA 5E3FA 1I6HH 1I4XA 2G5DA 4R4TA 5DNFA 2EJFC 3OWEB 4L5SA 2CQAA 5AJ3L 4A3DB 3UDXA 5HURA 4IUTA 5D3DA 2K05A 1A8VA 1DGSA 2B63H 3T1YQ 4RGOS 2NYZD 3RN5A 2NBFA 3M7GA 1YNJC 5IGFA 3KF8A 2XGTA 3HGBA 1AE3A 3EBEA 4G7ZC 4KTAA 3MAQA 2L4NA 4TQUS 2O5JC 5IWAL 3GTOB 5T1GA 5KIXA 5FLMH 1CM9A 2F0PA 2HQEA 2OQ0A 2WIIB 1V43A 3G71A 4NXMQ 2MFIA 1II3A 1PMRA 1H9MA 1SNOA 5A2QL 2IHFA 2JN4A 1V1PA 2XNAC 1Q82C 2LXJA 1MSGA 4UPAA 1CSPA 2XRQD 1K8OA 4RGTA 3Q23A 4ZUJA 1XJVA 4RA8A 4A3IG 4DUYQ 1CZGA 4YY3Q 5IYCH 2BA0A 1L0XB 1SMYD 2RCNA 1HNZL 2NVYH 1PFSA 1LYLA 3NWTA 1IBLL 1HNWQ 2EPBA 1E3PA 5COYA 2Z4HA 3KJPA 4A3CG 2DY7A 1ZYRC 1HUNA 2PNHA 1TY0A 2EVBA 1U5KA 1YHAA 3PUZA 1ZEQX 5HGQA 1E22A 4KHVA 4X62L 4RMFA 4IPDA 5JAVA 3B6YA 1IBKQ 1SDFA 2BE5D 3I4OA 5ELOA 3F2UA 3IL8A 1QUQB 1B50A 4OHJA 2A68D 1CA6A 3FKIB 3OHXC 3F2DA 2Y0SB 4HCEA 5IODA 2A6ED 3SR1A 3VYTA 5M3FH 3K5LA 3PO2B 3D3RA 1HR0Q 4PMWA 3RZOH 4B08A 4FF2A 1HR0W 2KEEA 3M3YH 2A5HA 1S5ED 4BXXH 1G8ZD 1F9RA 1ENFA 2ES2A 1PHJA 4DR4L 4UDUC 4NB3A 2EJGC 4N8FA 1UAPA 3LX0A 2L55A 2B2WC 4HSPA 3HOXB 2WKCA 4NKLA 1F9PA 4FF4A 2CKZB 3CD6A 2QEXA 3K5MA 1E0BA 2AQ3B 3BYTB 3D0FA 3T56B 1U4MA 2VQFL 4QUCA 4X64L 3PIOA 4DAMA 1GO3E 4IPGA 3SXHA 2E2DC 5EAYA 1BCPF 3LWUA 4OONA 4A3JG 2PQEA 1IW7D 3H0GH 1PH8A 1PFNA 1N34L 1KNAA 5BR8Q 1UE5A 1WD1A 2JA6G 1TS4A 4X65Q 1X55A 4IPCA 2CW0C 2F0HA 2JSOA 3I7FA 3SK8A 3DM3A 5EKLA 3IKJA 2VUMB 2QW7A 1EQRA 1EY6A 1RKNA 4JI8Q 4C56C 4IFDJ 1EU3A 1EL0A 2K33A 4ALPA 5IYDH 4JBWA 2C5CA 1XMQL 3S15B 3ERSX 1Y8NB 5L37A 4A3DG 3DM1A 1XNQL 1L0YB 3NTKA 1LTRD 1JT8A 2H1EA 1HUMA 4M1UB 4LWCA 1NR4A 3C3LA 2G9DA 4C3IH 2PZUA 2VQEQ 2Z9HA 3HOZH 5CV8A 5DEHA 1LTLA 1KC8C 5K36G 5LMUQ 4JI1L 3NXWA 5DAUA 4R8NA 1VQDA 5TSSA 1PZKD 1RF2D 2MJ8A 4NW2A 4HIKA 2J7ZA 2AKWB 5EBCA 4LF4L 3CC4A 1A2TA 4JI2L 3MVVA 1EIHA 3LGJA 1TWAH 2AQ2B 5FOBB 1DM0B 1EIYB 1IBML 5H1SE 5C3EH 3CCEA 5CR3A 3PUVA 5EJWA 2OQKA 4QMGA 4P74A 5M3MB 4YIJA 2XTIA 1E1TA 1ICWA 3OOCA 3I8ZA 2F0FA 1Y8OB 3QWNA 2MGSA 4DK0A 3D6WA 4I7ZC 3UDGA 1PRTC 2SEBD 3BDLA 2OTLA 3MWYW 3VR6A 4K14A 2MQHA 1NMFA 4L6TB 5BN5A 1H9KA 4FXKC 3SVMA 4R9WA 2JA7B 2F0IA 1Q90A 2PQAA 3CAMA 1HNXQ 1F9QA 3RR5A 3NHHA 4BBSG 3G6JB 3MXNA 2VQFQ 2QEJC 1F2LA 1EY7A 1H9RA 4AYBB 5J1ZA 2N55A 2I07B 3BVMA 3ULJA 4NXNL 1TVXA 2ZTCA 1N34Q 4F88A 3NPPA 3H3VI 2Q2HA 2A69C 4LMQD 2NN6H 5M5YH 3JAMc 1PH6A 3PF5A 3DEOA 3FKIG 1TWGH 3A8IE 2Y0SG 3FHWA 4XQNA 4YCWA 2NVTH 3PO2G 1Y14B 1CK1A 2KVMA 3MXGA 2JA8G 2EDGA 4KK7A 3U4ZA 3I91A 2FXQA 4GOPC 2VB3X 5GROA 4RCOA 1F2MA 2FFKB 1TIID 2ID0A 2WACA 2BOSA 4EQNA 3T1HL 4CKCA 1XMQQ 1C7YA 4DNRB 3S1NB 2IJ0A 3A7LA 3P75A 2Z6BA 3VDYA 2LMCB 4QY7A 3S1RB 3R2TA 1AW7A 4OIKA 4QB4A 1K28A 4O0AA 3TP8A 3HOXG 3GQBA 5JEAH 1QVFA 1KQSA 5CBEE 3KK7A 4RCNA 1VQ8A 5G3LF 1KRTA 1KDBA 1RDPD 3CRLC 5JVH3 3QOJA 3WOEA 3HOUB 2F1MA 3OIQA 4DA2A 4LF4Q 4DV6Q 2F0VA 4JI2Q 3CCRA 3ZYYX 4K6DA 2WV6D 2EYPA 2HHHQ 2TMPA 2GVAA 4OEMB 1PH1A 3VYRA 2HD3A 1WD0A 1JORA 1EQTA 2NVQH 2F0LA 3HOZG 2EIFA 1VQ9A 4OL7A 1EFID 3J80E 1EY0A 4V0BA 4CKEA 4LW1A 3M4YA 1O7IA 3CCUA 1LV9A 2VS1A 4ME3A 4YHHL 4QF4A 3GO5A 1S5CD 4DK1A 3I56A 1MIUA 3D8GA 3HKZB 3L0OA 4RKLA 1HA5A 1XPUA 2EYHA 4ZK9B 1EY5A 4HN7A 4JV5Q 1X3EA 1EOVA 2K75A 4ZYSA 4RWSC 4DV5Q 1D2BA 1LTSD 2CCZA 2TSSA 4A3LG 2UU9L 3U58A 1HH2P 4NXNQ 1L1OA 4DAVA 3BVGA 2K5DA 4A3GB 4TKOB 3X3MA 4DR3Q 3GTKH 3D31A 2K03A 2B29A 4ZQ3A 2RKSA 4OWWB 4LFBQ 4A3KB 4C3JH 1WCMB 1HZBA 3GTQB 1A2UA 2NVXB 1TR5A 2FHTA 4HCSA 2NTTA 5HY6A 5IYBH 1EWCA 4DXFA 1M4VA 4ZAIA 4BY7G 1STNA 5AFWA 5C44B 4Y7NB 3ND8A 4A3FH 1CQVA 2DNEA 5M3MG 4GN5A 1QG7A 1PTOB 1LTAD 1HZAA 1SNQA 3EROA 4Z9CB 2UUAL 2R92B 5IP9H 3NWSA 1BOSA 3E6ZX 3PV0A 2UXDQ 2L1BA 2EZVA 1E24A 3KLRA 4XIGS 4J8QA 5GAGC 1GUTA 3N6RA 4R1JA 2ATWA 1RODA 1FNWA 4L63B 4H7BA 1NCVA 2H5XA 4MZ9A 4ABNA 1Y1WB 4IJLA 4B3SQ 3H09A
chains in the Genus database with same CATH topology
4G7OC 2IX0A 3NSWA 1SXTA 3K57A 1OXSC 3V05A 2B8FA 2R61A 4K8IA 3FPUB 3C1FA 5CV7A 4BA1I 3PUYA 1G6ZA 2XVSA 5JEAG 3RD4A 2WB1B 4FF1A 4DGZA 3OWFA 3SK4A 3S9WA 2E76C 3H6MA 1O7ZA 1KDCA 1TWFB 5EPLA 4O42A 4XYOA 1Z47A 5I2XA 4ME5A 1ET9A 4KY7A 1EY9A 3VYSA 1GXDC 1VMCA 2EY1A 5F2DA 2KHSA 5KYLA 3T16A 4KHZA 2LY7A 2PNRC 1PRTD 3LNNA 1J8IA 1ILPA 3IFTA 3EJIA 1OXVA 2SNSA 2ZXRA 1K83B 1DOLA 1QNUA 2RDFA 5A2QE 4EVOA 5JPMC 1R4QB 5KNBA 1Z6HA 2NZ1D 3J80L 3CU7A 1B4OA 3V96A 3VR3A 2K28A 2F0SA 2Z1CA 3ONAB 3C1EA 4NDXA 1EWHA 3VYUA 3R93A 3MXPA 1BXTA 4F87A 4WJWA 4OO1H 2K5WA 1KNEA 1QWYA 4KY6A 3KBGA 4TRDA 2H4OA 4OGQC 1I4PA 3J81L 2RSOA 3DWAA 5JPNC 2E75C 1AZQA 1CQFA 1JR0D 4HMJA 2Q8IB 5CBAE 4PMCA 4B9WA 4PQXA 3HOYB 4KY5A 4QCLA 2E2JB 1A3VA 4HTHA 2BCOA 3NE5B 5CV9A 3HS0C 3Q24A 5KGUA 3QB3A 4ZKCB 5CV5A 3AMUA 1SYCA 1G2TA 1SFOB 1DOKA 1HTPA 2OT2A 3MFGA 3GTJB 3IFDA 4IURA 2CVRA 3U9OA 1PRTF 3K7AB 4RH6A 4ZKBB 2EY5A 4KKSA 1B9NA 1LTGD 4IN3A 2A6HC 1ESFA 2VXWA 4X3SA 2PCFB 2F0WA 5T1IA 2PZTA 1H9JA 3V2TA 3FPPA 3MC0B 3N52A 1I6HB 2EE1A 5CC4A 1HA6A 4HSVA 4RAUC 3DWQA 3J7YW 5CMDA 2XWJB 1ET6A 1SAPA 2ICEC 3A56A 4UAIA 5JOBA 3NP8A 3NQIA 4B9XA 2SOBA 1D1KA 3Q22A 3A8KE 3HEJA 3CKIB 4C1NK 2BDNA 3S2HB 2E74C 5E4WC 1FYCA 2XN9C 1CFMA 2F0QA 5IIFA 2L11A 4DAYA 4DF7A 5EKKA 1CHQD 3GP7A 2A74C 3GV3A 5DM63 2NVYB 2B2YC 2KQ3A 4DN4M 1BCPD 1EYAA 3H91A 4JK1C 1CHPD 1I4HA 1PFBA 1X3PA 4DAPA 5CV4A 2IX1A 1XTCD 2A73B 1F9SA 4XQQA 2JE6I 1STGA 1SE4A 1K8MA 3ND9A 2EYFA 3M7NA 2B2YA 1H9SB 2FJ2A 3A55A 1LTID 1B44D 5C4ZA 5M3FB 1HHVA 3RZOB 1T5EA 1O7YA 4BBSB 2JP1A 1R9TB 3OSOA 1PXUA 4K5WA 1Q1EA 5FO7B 3FMCA 1WTXA 5ELDA 3EFXD 1U4LA 2AWNA 1LACA 4KN4C 1JCKB 4E6IA 2JA8B 1SJHD 3CQZB 1BDOA 1SYFA 3TSSA 3H0GB 4HAEA 4XQJA 4Q5VA 1EZ6A 1D6EC 5IGCA 1CTMA 1Q8IA 4OIJA 1CZWA 1GJXA 4IFDG 4CJ0B 2K32A 1T5XD 5C3XA 1JOOA 2K5QA 5IGDA 3DEPA 5C4HA 2VB2X 2BDOA 2BA1A 5J22A 1QNKA 3D4DA 4C3IB 5EGTA 3HOZB 4ILWA 1A3UA 1X3QA 1CA5A 1BR9A 2IL8A 1GUNA 1HFNA 3K0YA 1WVLA 3A8JE 1TWAB 5D65A 3I3CA 2KECA 3TP6A 1SYEA 3BZDB 4DFAA 2ENBA 1HRJA 1V1OA 4H44C 1A6XA 1PTOC 1JQYD 5G3LD 1F2YA 1QE6A 2A6HD 1PDQA 1X32A 3GV6A 4HEDA 2SDFA 5BN3A 4F8MA 4BY7B 1S5BD 1Q12A 2KOLA 3TP7A 1SSOA 3S17B 4IUUA 1IKLA 5EBDA 5E4XA 4EQPA 5M5YB 1FNUA 1TWGB 2NWGA 2FMCA 2MP1A 4V190 1NUCA 5EKIA 5IGEA 4IFDI 1WTQA 3GD7A 3QIAA 5C5LA 4CGYB 1S5DD 1GUGA 2K01A 3HRZC 3BVZA 2ICIA 5KNCA 1O80A 1YNJD 5I9PA 2KA7A 5ISRA 1OXXK 4FNFA 1IYUA 4MIUA 3D4RA 5EQ0A 3K6OA 2K1BA 1CT1D 2C9OA 1KLUD 5C0XH 4K2KA 3PIO3 2KCNA 3EVQA 4BA2I 3CRKC 4L8JA 2HCCA 3U9SA 2OF1A 3M85A 1DJRD 1SEBD 1SYBA 2OEOA 1SYGA 1EQVA 2IT1A 1OO9B 1XX8A 1STBA 1TY2A 2NVQB 3TMEA 5IOCA 5FKAC 1HQMC 1TQOA 4NP5A 1D1IA 1ZYRD 3JAML 3T13A 1RTOA 2Q8RE 3AB9A 4C3IG 1MI2A 3L9AX 1EY8A 4A3MB 1E2ZA 1LLRD 2X6LA 3I4NB 3SE0A 4S3SA 3W3AA 1TU2B 3RMHA 1YNNC 2J4XA 1RD9D 4RHRA 4ODGA 4BBRB 1VMPA 4MHEA 1F2ZA 3J81E 3T51B 2HUGA 3H94A 4MN3A 3OMGA 2KCCA 4FYDA 1DONA 4G57A 5FO8B 2G9HD 4ZRZA 4C3HG 4X3TA 3K58A 3T53B 2D62A 2K7VA 1NR2A 1U4RA 5FLXL 5D14A 5C5MA 3MHBA 1GHJA 1EEFD 1TKWB 1O78A 1PZID 2CW0D 4A93B 3OMCA 3H3VC 2NN6G 3NBHA 2EYJA 2M00A 4KV6A 2JEAI 2RA4A 3VR2A 4KJOA 1ZXTA 5ELCA 4FXGC 4XXEA 1R4PB 1LT6D 2JA5B 3EA6A 2RVLA 3HOWB 1PTOD 4WFN3 1PTOH 5I2YA 5JVG3 3PMFA 3I72A 1U9RA 4K6LA 2CHBD 3VA5A 1MD2D 3ITPA 4I65A 2O4XA 3SDZA 1WTWA 1EYDA 3Q6SA 3FEWX 2Z4IA 4NMZA 5C0XJ 4A3BB 2AWOA 2F0GA 1DD2A 2XRSD 2B39A 4CJ1B 1CI3M 3NQTA 5KYIA 5C4XB 1PYWD 4DXGA 3I4MB 3J7AF 3GTGB 2R6GA 1G291 1BUVT 2BE5C 1TWCB 2X69A 1LT3D 2L5TA 1EZ8A 3P7JA 3C46A 3L3OC 3G7LA 2A6EC 2A69D 4H0LC 3IAYA 1JB3A 3M4OB 1VF7A 2NN6I 3K59A 2B2TA 4C3JG 2R3ZA 2F0EA 1H9SA 1BQQT 5IGGA 1DXMA 3GTPB 4X3KA 4O1NA 4HR7B 5KRUA 3S2DB 2V4DA 5I6WA 2E2HB 1FD7D 3NTIA 1A3TA 5J39A 1PTOF 3R8BA 4IQZA 3QG1A 1Z7TA 1MBYA 1IYVA 2PO4A 1TWHB 1LTBD 2ZT9C 4KN7C 2JEBI 3KBXA 4FXDA 4ULLA 3S1MB 2B2UA 2F0DA 1D5XC 5D3IB 5LL6S 5BN4A 3SK5A 5CGKA 2F4IA 2D5DA 2E2IB 4XTCS 1ZKOA 3BDCA 4EQOA 2K04A 5C4JB 2EYOA 1B53A 4IZ8A 1S4ZA 1QILA 1U4PA 5I4DA 1I4GA 2N88A 3R3OA 1D5MC 4KD3A 1Y8PB 4J1MA 2MPMA 2IWHA 3T4AC 3QOLA 3OW7A 4K2LA 2B63B 1SE3A 1BBXC 4N9TA 3A7AB 3TP5A 2D2CC 5ELFA 2DN8A 2WINB 1ESRA 1JOQA 3Q0AA 2R7ZB 2L9HA 2XWBB 3DWPA 1BCPB 3HZXA 1BO0A 3E5SA 1PLFA 1QCBD 5CYUA 2YYZA 4XT1B 5NUCA 2X6GA 3VR4A 5ELEA 4A3EB 3DUZA 5C3WA 2JYOA 3P1HA 4HMIA 1HFGA 4OO1G 1S5FD 1LABA 1JICA 2YU9B 1NAPA 2RQXA 4XDXA 4RFBA 4H13C 1HCZA 3QJYA 5FK9C 2PPBC 1VF5C 2B8GA 1I6VC 5E1FA 3TZDA 3PIP3 1Q3LA 5M5XB 5K36H 4TSSA 1HPCA 1E2VA 1KTKA 1W6KA 3M3YB 3MEHA 5A35A 1AEXA 4IALA 4DNTB 5IT9L 2HDLA 2PYKA 5ELBA 4N9PA 3CHBD 3WOFA 2F0KA 2XIWA 2QDBA 2LFNA 4FO2A 4G4KA 5JJZA 3HG9A 4KJNA 2PMZB 4WRDA 1ML0D 4IUQA 5DM73 1GUSA 1RHPA 3I4LA 4CKBA 2JXMB 1D5ZC 3VA7A 2L0CA 2LKVA 3OIPA 4XT3B 1I4QA 1WTOA 2J0TD 4KKUA 2NUCA 1MGSA 4OO1I 1TS3A 3JAME 2RDHA 3NUCA 2Z8LA 3PUWA 2HDMA 3GTMB 1DZ1A 1JWMD 1UNSA 3KLSA 2D9UA 3TN2A 1JOKA 4QIWB 3O13A 3VR5A 2LS01 4PMBA 4LAAA 2B2WA 1Y69U 1EY4A 3URYA 4Q0FA 1EIGA 4RHSA 2HCIA 1LO5D 4KD4A 5C3EB 3X3NA 2KUMA 4C2MB 1WTPA 2AUKA 3K5NA 1EU4A 2SNMA 2FINB 2VNUD 3E0JA 4RKBA 1Q1BA 4C3HB 1STYA 2ZXOA 4LK1C 1BF4A 2MUYA 3KLSX 4PV1C 3I73A 5FLXE 2O2LD 5EPJA 4G7HC 4K8JA 3AU7A 4K5VA 1FNVA 1W6JA 3ERQA 4R8IA 1MSHA 1V1PB 4CHTB 2NVTB 1RJTA 1C48A 1KABA 3FDTA 1C4QA 1LTTD 2OXPA 1QOHA 3S1QB 4K5XA 3DXJC 4FVMA 2QCPX 1STHA 3S14B 3NK9A 3C2PA 1B9MA 1UEAB 1HTLD 2QKIC 3I90A 1WTRA 3MFYA 1IHZA 5I9OA 2WP8J 2EJMA 1NSNS 1STAA 2PW5A 1SJED 4DU9A 2AQ1B 2EY2A 5I6YA 1BNZA 2EOTA 1HQRD 5HGTA 3K5OA 4BY1B 2F0MA 1SBBB 5LHY1 2FMMA 1KAAA 4XYQA 4P2CB 1WTVA 3OPOA 4EGVA 4PNYA 4GZYC 1FGBD 1DOMA 1KLGD 3GTKB 2DY8A 1ENCA 1KDAA 1JE4A 1AP0A 1GOZA 2M9VA 1C8CA 4C3JB 5EPKA 1ONLA 4RGMA 3BYYB 3DHQA 4A3FB 3MZ5A 2WKDA 2O5IC 3L7ZC 5FO9B 3PUXA 2DNCA 3A54A 3SK6A 4KI0A 1IL8A 4M8AA 2QF7A 4FF3A 1OXUA 2AUJD 2F0NA 4KMUC 4IUVA 5CORA 5LL6X 5M5WB 2R93B 1JC7A 1LT4D 3EQLC 1IKMA 2RSNA 1LT5D 5IGBA 1QJOA 1ILQA 5C0XG 1XYIA 3J7AV 1V8QA 1GUWA 1J9OA 3PO3B 3RUZA 2K6AA 1PFMA 2IPKD 1BCPC 2IW3A 2WAQB 3R2IA 1EYCA 3UI2A 5M9OA 2F0OA 2B2VC 1JWUD 1PRTB 2MHVA 1TT2A 3WDNA 2KJXA 2I46A 3HP3A 2EYMA 2QILA 1SMYC 3MXUA 1E2WA 2NB0A 1B2TA 4BS9A 1VCIA 3MTSA 4CJ2C 4QUFA 2PZWA 3D4WA 3BDOA 2F0JA 2B2VA 2EY6A 1SNDA 5KNDA 1STEA 2RDGA 3BG3A 2B2TC 2PW7A 5CV6A 2GA4B 2A68C 2NTSA 2F3VA 5JEAJ 3LWEA 1AN8A 4BWGB 1GHKA 1I3QB 4ZUIA 2F03A 3TBIB 2F3WA 3SHLA 1TS2A 2B2UC 4WORA 4U68A 1M8AA 4A3IB 2EYLA 2L12A 2Q8TA 3SEBA 5C0XI 4J6HA 4FP5D 3RLFA 1IW7C 5IT9E 3NBIA 1O7LA 1PZJD 1EEID 2RBMA 4U673 3TZUA 1OXTA 1SNMA 3QO2A 3KUPA 1ENAA 4RGNA 1DYQA 5K5PA 3S16B 1I4RA 3GTLB 3MA2B 1I50B 1AZPA 1YNND 1UUPA 1JWSD 2F0UA 1AFPA 2KEDA 3I70A 1RTNA 3NTHA 3BS1A 2ZXPA 4ID6A 4C1NI 4X3UA 2IX3A 2XSCA 1DCZA 1FR3A 5KEEA 3DMUA 2M2LA 1G91A 1A15A 3RZDB 1XWEA 1RCVD 3TDQA 4KKTA 4CBVA 1G2SA 1SE2A 1EOTA 4A3JB 4ZLTF 1GUOA 1QB5D 1Y1VB 2F0TA 1SYDA 3P20A 1SNPA 3FVQA 4F7XA 1XXGA 3HOVB 2JA6B 1VDZA 1SNCA 1B3AA 4LJZC 3W2DA 1HXYD 4IFDH 4IUPA 3D6CA 3FRPB 4IUNA 1F77A 5C6AA 1TS5A 1B1ZA 2EXZA 5E3FA 1I4XA 5DNFA 2EJFC 3OWEB 2CQAA 4A3DB 5HURA 4IUTA 5D3DA 2K05A 4RGOS 2NYZD 2NBFA 3M7GA 1YNJC 5IGFA 3KF8A 3HGBA 4G7ZC 4KTAA 3MAQA 2L4NA 4TQUS 2O5JC 3GTOB 5T1GA 5KIXA 1CM9A 2F0PA 2HQEA 2WIIB 1V43A 1II3A 1PMRA 1H9MA 1SNOA 5A2QL 1V1PA 2XNAC 1MSGA 2XRQD 1K8OA 4RGTA 3Q23A 4ZUJA 4RA8A 1CZGA 2BA0A 1L0XB 1SMYD 3NWTA 2EPBA 5COYA 2Z4HA 2DY7A 1ZYRC 1HUNA 1TY0A 2EVBA 3PUZA 1ZEQX 4KHVA 5JAVA 1SDFA 2BE5D 3F2UA 3IL8A 1B50A 4OHJA 2A68D 1CA6A 3FKIB 3OHXC 2Y0SB 4HCEA 5IODA 2A6ED 3SR1A 3VYTA 3K5LA 3PO2B 3D3RA 4PMWA 4B08A 4FF2A 2KEEA 2A5HA 1S5ED 1G8ZD 1F9RA 1ENFA 4UDUC 2EJGC 1UAPA 3LX0A 2L55A 2B2WC 4HSPA 3HOXB 2WKCA 4NKLA 1F9PA 4FF4A 3K5MA 1E0BA 2AQ3B 3BYTB 3T56B 1U4MA 4QUCA 3SXHA 2E2DC 1BCPF 3LWUA 2PQEA 1IW7D 1PFNA 1KNAA 1WD1A 1TS4A 2CW0C 2F0HA 2JSOA 3SK8A 5EKLA 3IKJA 2VUMB 1RKNA 1EY6A 4C56C 4IFDJ 1EU3A 1EL0A 2K33A 4JBWA 2C5CA 3S15B 1Y8NB 3DM1A 1L0YB 3NTKA 1LTRD 2H1EA 1HUMA 4M1UB 1NR4A 3C3LA 2G9DA 2PZUA 5CV8A 5DEHA 5K36G 3NXWA 5DAUA 4R8NA 5TSSA 1PZKD 1RF2D 2MJ8A 4NW2A 2J7ZA 5EBCA 1A2TA 3MVVA 1EIHA 2AQ2B 5FOBB 1DM0B 5CR3A 3PUVA 5EJWA 4QMGA 5M3MB 4YIJA 1ICWA 3OOCA 3I8ZA 2F0FA 1Y8OB 3QWNA 2MGSA 4DK0A 3D6WA 4I7ZC 1PRTC 2SEBD 3BDLA 3MWYW 3VR6A 4K14A 4L6TB 5BN5A 1H9KA 4FXKC 3SVMA 4R9WA 2JA7B 2F0IA 1Q90A 1F9QA 3NHHA 3G6JB 3MXNA 2QEJC 1F2LA 1EY7A 1H9RA 4AYBB 5J1ZA 2N55A 2I07B 3BVMA 1TVXA 4F88A 3NPPA 2A69C 4LMQD 2NN6H 3DEOA 3A8IE 4XQNA 1CK1A 2KVMA 3MXGA 2EDGA 4KK7A 3I91A 2VB3X 4RCOA 1F2MA 2FFKB 1TIID 2ID0A 4EQNA 2BOSA 2WACA 4CKCA 3S1NB 4DNRB 2IJ0A 3A7LA 3P75A 2LMCB 3S1RB 3R2TA 1AW7A 4OIKA 4QB4A 3TP8A 3GQBA 5JEAH 5CBEE 3KK7A 4RCNA 5G3LF 1KDBA 1RDPD 3CRLC 5JVH3 3QOJA 3WOEA 3HOUB 2F1MA 3OIQA 4DA2A 2F0VA 3ZYYX 4K6DA 2WV6D 2EYPA 2TMPA 3VYRA 1WD0A 1JORA 1EQTA 2F0LA 4OL7A 1EFID 3J80E 1EY0A 4V0BA 4CKEA 3M4YA 1LV9A 4QF4A 3GO5A 1S5CD 4DK1A 3D8GA 3HKZB 4RKLA 1HA5A 2EYHA 4ZK9B 1EY5A 4HN7A 4ZYSA 4RWSC 1D2BA 1LTSD 2TSSA 4DAVA 3BVGA 2K5DA 4A3GB 4TKOB 3X3MA 3D31A 2K03A 4ZQ3A 2RKSA 4A3KB 1WCMB 3GTQB 1A2UA 2NVXB 1TR5A 2FHTA 4HCSA 2NTTA 1EWCA 4DXFA 1M4VA 4ZAIA 1STNA 5AFWA 5C44B 4Y7NB 3ND8A 1CQVA 2DNEA 1QG7A 1PTOB 1LTAD 1SNQA 3EROA 4Z9CB 2R92B 3NWSA 1BOSA 3E6ZX 3PV0A 2L1BA 2EZVA 4XIGS 3KLRA 4J8QA 1GUTA 3N6RA 1RODA 1FNWA 4L63B 4H7BA 1NCVA 4ABNA 1Y1WB 3H09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTN A;  2B2V A;  1ESR A;  1ML0 D;  1RJT A;  2B2Y C;  5CBA E;  4DN4 M;  2EPB A;  4IUQ A;  1QNK A;  4X3U A;  5COY A;  3FDT A;  3H91 A;  1RHP A;  5EQ0 A;  2DY7 A;  2K1B A;  1HUN A;  2L9H A;  2B2T A;  2M2L A;  1BO0 A;  2B2T C;  1PFB A;  2MJ8 A;  1PLF A;  1X3P A;  1X3Q A;  2J7Z A;  1A15 A;  2R3Z A;  3FPU B;  4NW2 A;  1CA5 A;  1G91 A;  4XT1 B;  1IL8 A;  2X6G A;  1F9S A;  1G6Z A;  2IL8 A;  4ZKC B;  1SDF A;  1EIH A;  1HFN A;  1G2S A;  4X3K A;  2HCC A;  1WVL A;  3F2U A;  1EOT A;  1G2T A;  3IL8 A;  4ZLT F;  1WD0 A;  1DOK A;  2RA4 A;  3I90 A;  1B50 A;  1CA6 A;  4XT3 B;  2JYO A;  3LWE A;  1EQT A;  1WTO A;  1ZXT A;  5D65 A;  3I3C A;  2KEC A;  3IFD A;  2B2Y A;  1MGS A;  1XX8 A;  2CVR A;  4IUR A;  1O7Z A;  5EJW A;  5EPL A;  1WTR A;  2FJ2 A;  1HFG A;  4IUV A;  5COR A;  1B3A A;  1HHV A;  4O42 A;  1LV9 A;  1JIC A;  4ZKB B;  2KEE A;  1ICW A;  1NAP A;  2HDM A;  3I8Z A;  1HRJ A;  4XDX A;  1O7Y A;  1DZ1 A;  4IUP A;  2JP1 A;  2MGS A;  3D6W A;  2VXW A;  1F9R A;  2D9U A;  1VMC A;  3KBX A;  4X3S A;  3TN2 A;  1QE6 A;  5T1I A;  2RVL A;  2B2U A;  1IKM A;  2RSN A;  2B2U C;  4ZK9 B;  1WTX A;  3MWY W;  3N52 A;  1PDQ A;  1RTO A;  1X32 A;  4U68 A;  3GV6 A;  4HED A;  1M8A A;  5DNF A;  2Q8R E;  1J8I A;  2B2W A;  2SDF A;  3SVM A;  4R9W A;  4RWS C;  1BNZ A;  1ILP A;  1U4L A;  2B2W C;  2EE1 A;  2L12 A;  1MI2 A;  1HA6 A;  1F9P A;  2EOT A;  2Q8T A;  4HSV A;  1ILQ A;  1F9Q A;  3TZD A;  1EIG A;  4IUT A;  1E0B A;  1F2L A;  1Q3L A;  2HCI A;  4RAU C;  2KOL A;  2X6L A;  1WTW A;  1U4M A;  2K05 A;  3Q6S A;  1SSO A;  2N55 A;  1XYI A;  2K03 A;  4QUC A;  1TVX A;  2KUM A;  5CMD A;  1WTP A;  2NYZ D;  1DOL A;  1SAP A;  4IUU A;  1J9O A;  1IKL A;  1GUW A;  4LMQ D;  1PFM A;  2K04 A;  1PFN A;  3DEO A;  4UAI A;  2FHT A;  1KNA A;  4HCS A;  5E4X A;  4ZAI A;  2L4N A;  2NZ1 D;  4HAE A;  1WD1 A;  5AFW A;  2FIN B;  4CJ1 B;  1B4O A;  2NWG A;  1B53 A;  2K28 A;  5T1G A;  1CM9 A;  2KVM A;  1VMP A;  2FMM A;  1QG7 A;  1S4Z A;  2HDL A;  3ONA B;  3UI2 A;  1U4P A;  3I91 A;  2B2V C;  2MP1 A;  4MHE A;  1WTV A;  2N88 A;  2HUG A;  4OIJ A;  1BF4 A;  2BDN A;  5EKI A;  3R93 A;  4MN3 A;  2FFK B;  1WTQ A;  3QO2 A;  5EPJ A;  5E4W C;  2XIW A;  3KUP A;  2MPM A;  4CJ0 B;  1DON A;  1DOM A;  3HP3 A;  1KNE A;  2K01 A;  1MSG A;  1EL0 A;  2L11 A;  2L1B A;  2X69 A;  1B2T A;  4RA8 A;  1O80 A;  2DY8 A;  4OIK A;  3P7J A;  1JE4 A;  4X3T A;  1AZP A;  1BBX C;  2RSO A;  1C8C A;  3MTS A;  3G7L A;  5JJZ A;  4CJ2 C;  1ROD A;  3DM1 A;  4QUF A;  1NR2 A;  1AP0 A;  1NCV A;  3DEP A;  3GV3 A;  5EPK A;  4R8I A;  1MSH A;  1HUM A;  1U4R A;  2H1E A;  1AZQ A;  5D14 A;  5CBE E;  2KED A;  1NR4 A; 
#chains in the Genus database with same CATH topology
 4G7O C;  4AYB G;  2IX0 A;  3NSW A;  3E0E A;  4DV4 Q;  1NE3 A;  1SXT A;  4R4I A;  3K57 A;  2ZJQ A;  1OXS C;  3V05 A;  2B8F A;  2R61 A;  4K8I A;  3JAM i;  3FPU B;  3C1F A;  5CV7 A;  1S40 A;  1QVG A;  4BA1 I;  3UDF A;  3PUY A;  1G6Z A;  2XVS A;  5JEA G;  3RD4 A;  3WWV A;  2WB1 B;  4FF1 A;  4DGZ A;  3OWF A;  4DR5 Q;  3SK4 A;  3S9W A;  2E76 C;  3H6M A;  3RN2 A;  1PA6 A;  1EUJ A;  2KCT A;  3EN2 A;  4R4O A;  4LFC L;  1O7Z A;  1KDC A;  1TWF B;  5EPL A;  1K8A C;  4MTK A;  4JCV E;  4O42 A;  4XYO A;  1Z47 A;  5I2X A;  4ME5 A;  4DV1 Q;  1GD7 A;  1ET9 A;  4KY7 A;  1EY9 A;  4DV2 Q;  4DV7 Q;  2JA5 H;  3HOW H;  1RL2 A;  3CW2 C;  1GXD C;  1VMC A;  2EY1 A;  3VYS A;  5F2D A;  2KHS A;  3J81 c;  2ZM6 Q;  5KYL A;  2I5H A;  3T16 A;  4KHZ A;  1N32 Q;  4KHP L;  4LF8 L;  1JJG A;  2LY7 A;  2PNR C;  4N8X 1;  1PRT D;  3LNN A;  1J8I A;  1ILP A;  3IFT A;  3EJI A;  1K3R A;  1OXV A;  2HQL A;  2SNS A;  4A3B H;  2ZXR A;  1VQF A;  1RIP A;  1K83 B;  4JI5 L;  1DOL A;  1QNU A;  2RDF A;  5A2Q E;  1B3Q A;  4EVO A;  5JPM C;  2UUB L;  1R4Q B;  5KNB A;  1Z6H A;  2NZ1 D;  3J80 L;  3CU7 A;  4A3M G;  1B4O A;  3V96 A;  3HFZ B;  3VR3 A;  2K28 A;  3DLL A;  3I4N G;  2F0S A;  2Z1C A;  3ONA B;  1YZ6 A;  3I4M H;  3GTG H;  3C1E A;  4NDX A;  1EWH A;  2Z6K C;  2K5N A;  3VYU A;  4NPS A;  1KAW A;  3R93 A;  4BBR G;  3MXP A;  1ASZ A;  1BXT A;  4F87 A;  4WJW A;  4OO1 H;  2K5W A;  1KNE A;  1QWY A;  4KY6 A;  3KBG A;  3IRB A;  4TRD A;  2H4O A;  4Y52 H;  3UE1 A;  2MO0 A;  4OGQ C;  1I4P A;  1NBW A;  5ELN A;  3J81 L;  5GAD C;  2RSO A;  3AYH B;  3DWA A;  5JPN C;  1L1O B;  2E75 C;  5FJ8 H;  1AZQ A;  1CQF A;  1WI5 A;  1JR0 D;  4HMJ A;  3PIP A;  4A3G G;  3M4O H;  2Q8I B;  5CBA E;  2Z6K A;  1VQO A;  4PMC A;  4B9W A;  2B3G A;  2K5V A;  5J3B A;  4PQX A;  3HOY B;  4KY5 A;  4QCL A;  4QQB X;  3GTP H;  2IY5 B;  2E2J B;  1A3V A;  5C44 G;  4HTH A;  2BCO A;  3NE5 B;  5CV9 A;  4JI6 L;  3HS0 C;  3Q24 A;  4WJ3 M;  2VW9 A;  3S2D H;  3AEV A;  3K80 C;  2I0Q A;  5KGU A;  3QB3 A;  4ZKC B;  4DR6 Q;  1I5F A;  4HJA A;  4DR7 L;  1X56 A;  5CV5 A;  3AMU A;  1SYC A;  1G2T A;  4LFC Q;  1A62 A;  1SFO B;  1DOK A;  1HTP A;  2OT2 A;  3BU2 A;  2R92 G;  3MFG A;  3GTJ B;  4A93 G;  3IFD A;  4IUR A;  2CVR A;  3U9O A;  3NBH B;  1TWH H;  1PRT F;  3K7A B;  4RH6 A;  4ZKB B;  2EY5 A;  4I7A A;  3PSI A;  3FP9 A;  1ASY A;  3A74 A;  4B3T Q;  1IL2 A;  4KKS A;  1B9N A;  1LTG D;  4IN3 A;  1CKN A;  2A6H C;  3S1M H;  1ESF A;  2VXW A;  2HIV A;  4X3S A;  2PCF B;  1YEZ A;  2F0W A;  5T1I A;  2PZT A;  1H9J A;  3V2T A;  4LFA L;  2PI2 E;  3FPP A;  3MC0 B;  5JJI A;  3N52 A;  4WJ4 A;  1I6H B;  2EE1 A;  5CC4 A;  2GN5 A;  1HA6 A;  4HSV A;  4JI0 Q;  4B3M L;  1WJJ A;  1A0I A;  4RAU C;  3DWQ A;  3J7Y W;  4YCV A;  3STB D;  4FDB A;  5CMD A;  2XWJ B;  1ET6 A;  2DJF C;  1SAP A;  2UUB Q;  2RCF A;  1C0A A;  5C4J H;  2ICE C;  1VQP A;  1VQ6 A;  4JI4 L;  3A56 A;  4UAI A;  5JOB A;  4LF5 Q;  1PH9 A;  1NNX A;  3NP8 A;  2PMZ E;  3NQI A;  4B9X A;  2SOB A;  1D1K A;  5GAH C;  3Q22 A;  5IE8 A;  3A8K E;  3HEJ A;  1VQL A;  3CKI B;  4C1N K;  2BDN A;  3RZD H;  3S2H B;  2E74 C;  5E4W C;  1FYC A;  2XN9 C;  1CFM A;  3J81 i;  3J81 j;  4DUZ L;  2F0Q A;  4A75 A;  5IIF A;  2L11 A;  1X3G A;  4JI7 L;  4DAY A;  5C4X G;  4DF7 A;  4YWM A;  1CHQ D;  5EKK A;  1J5E L;  1Y1V H;  1K8G A;  3GP7 A;  2A74 C;  3HOV H;  3GV3 A;  5DM6 3;  1X65 A;  2NVY B;  1Q81 C;  2B2Y C;  2KQ3 A;  2R7Z H;  4DN4 M;  1BCP D;  1EYA A;  1CKO A;  3H91 A;  2QA4 A;  1YHB A;  1M1K C;  2UXC Q;  4JK1 C;  1CHP D;  1I4H A;  2N8N A;  1PH2 A;  1FJG Q;  1PFB A;  4QIW E;  1X3P A;  4DAP A;  1N36 L;  5CV4 A;  2IX1 A;  1XTC D;  4A3E H;  4OEL B;  2A73 B;  4AH6 A;  1F9S A;  4HID A;  4XQQ A;  2JE6 I;  5FJ8 G;  1YVC A;  1STG A;  1SE4 A;  1K8M A;  3ND9 A;  3F8T A;  2ALY B;  1UWV A;  1T9H A;  2EYF A;  3M7N A;  2B2Y A;  1H9S B;  2YU9 H;  2FJ2 A;  3A55 A;  1LTI D;  1B44 D;  4UP9 A;  5C4Z A;  1A63 A;  5M3F B;  1HHV A;  2WFW A;  1MJC A;  3RZO B;  1T5E A;  1O7Y A;  4JI3 Q;  4BBS B;  2JP1 A;  1R9T B;  3OSO A;  1PXU A;  4OX9 Q;  2LSS A;  4AQY Q;  4K5W A;  4JG2 A;  1Q1E A;  1K3B C;  3FMC A;  5FO7 B;  1WTX A;  5ELD A;  4HJ9 A;  3EFX D;  4JYA L;  1U4L A;  2AWN A;  4P71 A;  5M5X H;  3HOY G;  1LAC A;  4KN4 C;  1JCK B;  1U0L A;  4E6I A;  2JA8 B;  1CKM A;  3KDF B;  1SJH D;  4LF7 L;  4GLV B;  1XNR Q;  3CQZ B;  1BDO A;  1SYF A;  2BH8 A;  3TSS A;  3H0G B;  4HAE A;  4O2D A;  4XQJ A;  3M4P A;  3U4V A;  5AJ3 Q;  4Q5V A;  3MEF A;  1EZ6 A;  1D6E C;  5IGC A;  4DV0 L;  1CKN B;  1CTM A;  1Q8I A;  2K4K A;  4OIJ A;  1CZW A;  1GJX A;  4R4C A;  4QJF A;  4IFD G;  3CC7 A;  4CJ0 B;  2K32 A;  4LNQ A;  1G51 A;  1T5X D;  5C3X A;  1JOO A;  2K5Q A;  2A8V A;  5IGD A;  5IWA Q;  1BKB A;  3DEP A;  5C4H A;  4POG A;  2VB2 X;  1WYD A;  2C35 B;  1BBU A;  2BDO A;  2BA1 A;  5J22 A;  2CWP A;  1QNK A;  2DGY A;  3D4D A;  4HJ8 A;  4C3I B;  5EGT A;  2B63 G;  3ULL A;  3HOZ B;  4GKJ L;  1XPO A;  4IOA A;  4ILW A;  1A3U A;  1X3Q A;  1CA5 A;  1BR9 A;  4QGU A;  1HNZ Q;  3UDI A;  2IL8 A;  4APV A;  1GUN A;  1HFN A;  3G4S A;  3K0Y A;  5FLM G;  1WVL A;  1FGU A;  3A8J E;  1IBL Q;  3ICE A;  1TWA B;  2V1C C;  5D65 A;  3I3C A;  2KEC A;  4GKK L;  3TP6 A;  3CPW A;  4DAY B;  1SYE A;  3BZD B;  3GTM H;  3UE0 A;  2ENB A;  4DFA A;  4PG3 A;  3K7U C;  1HRJ A;  1V1O A;  4X62 Q;  4H44 C;  1A6X A;  1PTO C;  1XMO L;  5IYC G;  1JQY D;  5G3L D;  1F2Y A;  1QE6 A;  1UE7 A;  2A6H D;  1KXL A;  3I55 A;  1PDQ A;  3K8A A;  1X32 A;  3GV6 A;  4HED A;  3AFQ A;  2SDF A;  5BN3 A;  2VUM H;  4MTN A;  2JK8 A;  4F8M A;  4BY7 B;  1S5B D;  4A4I A;  1Q12 A;  4C2M H;  2KOL A;  4AIM A;  3TP7 A;  1SSO A;  3S17 B;  3S15 H;  1J6Q A;  4IUU A;  1IKL A;  4DR4 Q;  1H95 A;  3TEH B;  5EBD A;  5E4X A;  4EQP A;  4C3H H;  5M5Y B;  5IP7 H;  1FNU A;  1TWG B;  2NWG A;  3PQI A;  5M3F G;  1UE6 A;  1VQC A;  2FMC A;  2MP1 A;  4V19 0;  3CPF A;  1NUC A;  5EKI A;  5IGE A;  4IFD I;  4X64 Q;  3GD7 A;  3QIA A;  5C5L A;  1WTQ A;  4A76 A;  2CH4 W;  1GUG A;  1S5D D;  4CGY B;  4BXX G;  2K01 A;  3HRZ C;  3BVZ A;  2ICI A;  1MKH A;  5KNC A;  1O80 A;  3L2P A;  1GKH A;  4P72 A;  1YNJ D;  1TXY A;  5I9P A;  2KA7 A;  3BJU A;  5ISR A;  1GVP A;  1OXX K;  4FNF A;  1IYU A;  4X66 L;  1I94 L;  4MIU A;  3D4R A;  5EQ0 A;  3S1Q H;  3K6O A;  2JJQ A;  2YTY A;  2K1B A;  1CT1 D;  2C9O A;  1KLU D;  3SGI A;  4DK6 C;  5C0X H;  3S14 H;  5JJK A;  4K2K A;  3H0G G;  1WTH A;  3PIO 3;  2KCN A;  1JJ2 A;  1VQJ A;  1XNQ Q;  1SN8 A;  3EVQ A;  2JA7 H;  4BA2 I;  3CRK C;  4L8J A;  2HCC A;  1PYB A;  3U9S A;  2OF1 A;  3M85 A;  1DJR D;  4DR2 L;  1SEB D;  1SYB A;  3H15 A;  2OEO A;  1SYG A;  1EQV A;  2IT1 A;  4GN3 B;  4ZCK A;  1OO9 B;  2OTJ A;  1XX8 A;  1STB A;  4JI1 Q;  1TY2 A;  3W5O A;  2NVQ B;  4LF9 L;  4DKA C;  1VQ7 A;  2QDL A;  3TME A;  5IOC A;  5FKA C;  1HQM C;  5IYD G;  1TQO A;  3G6E A;  3EIV A;  4NP5 A;  3TQY A;  1D1I A;  1ZYR D;  1Q7Y C;  1IBM Q;  2ZJP A;  3JAM L;  2WAQ E;  5FLX c;  3T13 A;  1RTO A;  1N33 L;  2Q8R E;  3AB9 A;  4C3I G;  1MI2 A;  3L9A X;  1EY8 A;  2KHJ A;  4A3M B;  1E2Z A;  1LLR D;  4DV3 L;  1L1O C;  2X6L A;  4LUO A;  3I4N B;  3SE0 A;  4S3S A;  3S1R H;  4BY1 H;  3W3A A;  1TU2 B;  3RMH A;  4KLK A;  1YNN C;  2J4X A;  1RD9 D;  4RHR A;  1L2F A;  4YWL A;  4ODG A;  4BBR B;  4UP8 A;  5C3E G;  1PH5 A;  1EYG A;  1VMP A;  4JW0 A;  4LUV A;  4MHE A;  1F2Z A;  3J81 E;  3HOU H;  3T51 B;  1W2B A;  2HUG A;  3H94 A;  1K0S A;  4LF6 L;  4MN3 A;  3OMG A;  2YV5 A;  4YWK A;  2KCC A;  2UXB L;  4FYD A;  1DON A;  4G57 A;  4CDD C;  5FO8 B;  2G9H D;  2BH2 A;  4ZRZ A;  1MJE A;  4C3H G;  3W1B A;  4X3T A;  5IP7 G;  2A19 A;  3K58 A;  3T53 B;  2D62 A;  2K7V A;  1SE8 A;  1NR2 A;  1X6O A;  1I94 Q;  1U4R A;  5FLX L;  5D14 A;  5C5M A;  3MHB A;  3M4Q A;  1GHJ A;  1EEF D;  1TKW B;  3KF6 B;  1K9M C;  2F4V L;  3CCJ A;  1O78 A;  1PZI D;  3T1H Q;  2CW0 D;  4A93 B;  2K5H A;  3OMC A;  3H3V C;  2NN6 G;  3NBH A;  3E3X A;  2EYJ A;  2M00 A;  4KV6 A;  2JEA I;  2RA4 A;  3VR2 A;  4KJO A;  2NZH A;  1ZXT A;  3JC6 6;  4HJ5 A;  3CCL A;  5M5W H;  2R93 H;  5ELC A;  2RF4 A;  4A3K H;  4FXG C;  1VQM A;  1WCM H;  4XXE A;  3GTQ H;  1R4P B;  3CC2 A;  1HZ9 A;  1LT6 D;  4DR1 L;  1N8R C;  1BVS A;  4Y7N H;  2JA5 B;  3EA6 A;  2IHE A;  2RVL A;  3HOW B;  1PTO D;  1YHQ A;  4WFN 3;  1PTO H;  5I2Y A;  4P73 A;  4IOC A;  5JVG 3;  3PMF A;  3OTO L;  3I72 A;  1U9R A;  4K6L A;  1AE2 A;  2E8G A;  2CHB D;  3VA5 A;  1MD2 D;  3ITP A;  4YHH Q;  4I65 A;  2O4X A;  3SDZ A;  1WTW A;  1EYD A;  3Q6S A;  2GVB A;  3PO3 H;  3FEW X;  2Z4I A;  4NMZ A;  5C0X J;  4A3B B;  2AWO A;  4QL5 A;  2F0G A;  1Y1W H;  3CCM A;  1D7Q A;  1DD2 A;  2XRS D;  2B39 A;  4CJ1 B;  1CI3 M;  3NQT A;  5KYI A;  5C4X B;  2UU9 Q;  4LF6 Q;  3TS2 A;  2MNA A;  2UXB Q;  1PYW D;  4DXG A;  3I4M B;  3J7A F;  4EQ5 A;  1N9W A;  3GTG B;  2R6G A;  1G29 1;  4GNX B;  1BUV T;  4K0K L;  2BE5 C;  1TWC B;  2X69 A;  1LT3 D;  4GOP B;  1NTG A;  2L5T A;  1EZ8 A;  3P7J A;  3C46 A;  3L3O C;  1EFW A;  3G7L A;  5DLQ E;  3F2C A;  2A6E C;  2E5L L;  2A69 D;  1UEB A;  1TWF H;  4H0L C;  3F2B A;  2UUA Q;  3IAY A;  1JB3 A;  2L15 A;  3M4O B;  1VF7 A;  2P5Z X;  2NN6 I;  3K59 A;  2B2T A;  4C3J G;  5LMN L;  3GDE A;  2R3Z A;  2F0E A;  1H9S A;  1BQQ T;  1DXM A;  5IGG A;  5IYB G;  3GTP B;  4A3F G;  4X3K A;  4O1N A;  2KHI A;  4HR7 B;  5KRU A;  3S2D B;  2V4D A;  5I6W A;  1Q46 A;  3A5Z B;  2K50 A;  2E2H B;  1FD7 D;  3NTI A;  1A3T A;  2UUC L;  1I3Q H;  5J39 A;  1PTO F;  4UY8 C;  5IP9 G;  3R8B A;  4IQZ A;  3QG1 A;  2N49 A;  1Z7T A;  4J15 A;  1MBY A;  1IYV A;  2PO4 A;  1TWH B;  1LTB D;  2ZT9 C;  4KN7 C;  2JEB I;  3T1Y L;  3KBX A;  4FXD A;  4ULL A;  3S1M B;  2B2U A;  3U50 C;  4A3I H;  2F0D A;  1D5X C;  5D3I B;  5LL6 S;  3KDF A;  4CDE C;  3SK5 A;  5BN4 A;  4IJH A;  4JOI A;  5CGK A;  4CDF C;  2DUD A;  4NXM L;  2F4I A;  2D5D A;  4A3C H;  1BBW A;  1VQH A;  3RLN A;  2E2I B;  1JE5 A;  4XTC S;  1ZKO A;  1FL0 A;  2R7F A;  3BDC A;  4EQO A;  2K04 A;  4LF8 Q;  1EWI A;  3KLW A;  4KHP Q;  5C4J B;  2EYO A;  4YY3 L;  3CCQ A;  1B53 A;  2N3S A;  4IZ8 A;  1S4Z A;  1QIL A;  1U4P A;  5I4D A;  2ZJR A;  1I4G A;  3R3O A;  2N88 A;  1D5M C;  4K0K Q;  3W1G A;  4JI5 Q;  2E2J H;  4KD3 A;  1Y8P B;  2JA5 G;  4J1M A;  2MPM A;  3S16 H;  1JB7 A;  2IWH A;  3HOW G;  4OWX B;  3T4A C;  3GTL H;  1I50 H;  2ZTE A;  3QOL A;  2WAQ G;  3OW7 A;  1PH4 A;  4K2L A;  3KOJ A;  2B63 B;  1SFO H;  1SE3 A;  1VQ4 A;  1BBX C;  4N9T A;  3GTJ H;  3A7A B;  3TP5 A;  2D2C C;  2Y0S E;  1IBK L;  1PVO A;  5ELF A;  2DN8 A;  2WIN B;  1IZ6 A;  1ESR A;  1JOQ A;  4A3B G;  3Q0A A;  1VQG A;  2R7Z B;  1HR0 L;  2L9H A;  2XWB B;  2I5M X;  3DWP A;  3CCS A;  1BCP B;  2K52 A;  3HZX A;  1BO0 A;  3E5S A;  1MHW C;  1PLF A;  1QCB D;  4UP7 A;  5CYU A;  2YYZ A;  4XT1 B;  5NUC A;  4DNI A;  2X6G A;  4A3J H;  1QVC A;  2I5L X;  3H3V H;  3VR4 A;  5ELE A;  4A3E B;  5IT9 c;  2NZO A;  3DUZ A;  5C3W A;  2UUC Q;  2JA6 H;  3I4M G;  2JA9 A;  1XTD A;  1SRO A;  2JYO A;  3P1H A;  4HMI A;  1HFG A;  2D0O A;  4OO1 G;  1S5F D;  1LAB A;  1JIC A;  2YU9 B;  1VQB A;  1NAP A;  2RQX A;  4XDX A;  4JI6 Q;  4RFB A;  4H13 C;  4DR7 Q;  1HCZ A;  3QJY A;  5FK9 C;  2PPB C;  4A3D H;  1VF5 C;  5BR8 L;  2B8G A;  1I6V C;  5E1F A;  3S2H H;  4GLA C;  4X65 L;  1YNX A;  2F3I A;  3TZD A;  3PIP 3;  1Q3L A;  5M5X B;  3KJO A;  5K36 H;  2N78 A;  4TSS A;  1NJI C;  1HPC A;  4JI8 L;  1E2V A;  1KTK A;  1KD1 C;  4LFA Q;  1W6K A;  3OW2 A;  3M3Y B;  3MEH A;  3GTO H;  5A35 A;  1AEX A;  1CUK A;  4IAL A;  4DNT B;  4HIM A;  3QR8 A;  5IT9 L;  2HDL A;  4B3M Q;  1IXR A;  1SMX A;  1KIX A;  2PYK A;  5ELB A;  4N9P A;  1NMG A;  3CHB D;  3HKS A;  3NEN A;  3WOF A;  2VQE L;  4JBM A;  2F0K A;  3ZJY C;  2XIW A;  2QDB A;  2LFN A;  1VQA A;  5LMU L;  4JI4 Q;  1PH3 A;  4FO2 A;  4G4K A;  5JJZ A;  3J7A 5;  3TS0 A;  3HG9 A;  4KJN A;  2PMZ B;  4WRD A;  1ML0 D;  4IUQ A;  5DM7 3;  2Z0S A;  1GUS A;  1RHP A;  4BBS H;  4JC0 A;  1R9T H;  1S72 A;  4DUZ Q;  3I4L A;  4CKB A;  4JI7 Q;  2JXM B;  1D5Z C;  1E1O A;  3VA7 A;  1J5E Q;  1C9O A;  1Q8K A;  4L5R C;  2L0C A;  3FKI H;  2LKV A;  3OIP A;  3BZK A;  4XT3 B;  3PO2 H;  1I4Q A;  1WTO A;  4PZ6 A;  2J0T D;  2R7D A;  4KKU A;  2NUC A;  4HJ7 A;  2JA8 H;  1MGS A;  4OO1 I;  1TS3 A;  3JAM E;  1LUZ A;  2RDH A;  2KEN A;  4AYB E;  3NUC A;  2Z8L A;  4PZ7 A;  3CQZ H;  1HNX L;  3PUW A;  2HDM A;  1N36 Q;  1PYS B;  1JJC B;  3GTM B;  1DZ1 A;  1JWM D;  1UNS A;  2EQS A;  2OWO A;  3KLS A;  2D9U A;  3TN2 A;  1JOK A;  1Y1V G;  4QIW B;  4HIO A;  5GQO A;  3O13 A;  3HOV G;  3VR5 A;  2LS0 1;  4PMB A;  3HOX H;  1W3S A;  4LAA A;  2B2W A;  1Y69 U;  2R7Z G;  1EY4 A;  2D0P A;  3URY A;  4Q0F A;  4JBK A;  1EIG A;  4RHS A;  2HCI A;  1LO5 D;  4KD4 A;  5C3E B;  3X3N A;  1SRU A;  2KUM A;  4C2M B;  1WTP A;  2AUK A;  4A3E G;  3K5N A;  4RG1 A;  1EU4 A;  2SNM A;  2HT1 A;  3CP0 A;  4X6A H;  4JYA Q;  2FIN B;  2VNU D;  3E0J A;  4RKB A;  1Q1B A;  4C3H B;  1STY A;  2ZXO A;  1ICF B;  2QGQ A;  4JPB W;  4LK1 C;  3KF8 B;  1BF4 A;  3RNU A;  2MUY A;  4GLX A;  3KLS X;  4PV1 C;  3I73 A;  5FLX E;  2O2L D;  5EPJ A;  4LF7 Q;  1X54 A;  2CQO A;  4G7H C;  2OCE A;  4K8J A;  3AU7 A;  3KF6 A;  4DV6 L;  4K5V A;  1FNV A;  1W6J A;  3ERQ A;  2HHH L;  4B3R L;  2CFM A;  4R8I A;  1VQ5 A;  1MSH A;  4DV0 Q;  1V1P B;  1Z9F A;  4CHT B;  2NVT B;  1NY4 A;  1RJT A;  1C48 A;  1KAB A;  3FDT A;  4A3L H;  1C4Q A;  5E7N A;  1LTT D;  2OXP A;  1QOH A;  3S1Q B;  4K5X A;  3DXJ C;  3ER0 A;  4FVM A;  2QCP X;  1STH A;  2RHS B;  3NEM A;  3HKZ E;  3S14 B;  3NK9 A;  3C2P A;  1B9M A;  1UEA B;  1HTL D;  2QKI C;  4BY7 H;  3I90 A;  1B70 B;  5GAE C;  4JV5 L;  5M3M H;  1P8L A;  3S17 H;  4DV5 L;  1WTR A;  4GKJ Q;  3MFY A;  3BZC A;  3I2Z A;  1IHZ A;  4DR3 L;  3ULP A;  5I9O A;  2WP8 J;  2EJM A;  4LFB L;  2LXK A;  1NSN S;  1STA A;  2PW5 A;  4GNX C;  1SJE D;  4DU9 A;  4GKK Q;  2AQ1 B;  2EY2 A;  5I6Y A;  1BNZ A;  2EOT A;  5IY0 A;  4MNO A;  3K81 C;  1HQR D;  1WOC A;  3S24 A;  1XMO Q;  1LM0 A;  5HGT A;  3K5O A;  1YJN A;  4BY1 B;  4OXP A;  2F0M A;  3TRZ A;  2UXD L;  2KCM A;  1SBB B;  3M9B A;  2KBN A;  4GNX A;  4L5T A;  4TVA B;  3E9H A;  5LHY 1;  2FMM A;  1KAA A;  4GOP A;  4XYQ A;  4P2C B;  1WTV A;  4B3S L;  3OPO A;  4EGV A;  3S1N H;  4DV4 L;  4PNY A;  4GZY C;  4LUZ A;  1FGB D;  1DOM A;  3CXC A;  2AMC B;  4B3R Q;  1KLG D;  3PGZ A;  3GTK B;  1V1Q A;  2DY8 A;  3CCV A;  1ENC A;  1KDA A;  1JE4 A;  1AP0 A;  1HZC A;  1XPR A;  1GOZ A;  2M9V A;  1C8C A;  2WB1 E;  4C3J B;  4P75 A;  5EPK A;  2VUM G;  1ONL A;  4RGM A;  2YTV A;  1CSQ A;  4R4Q A;  4IPH A;  3BYY B;  3DHQ A;  3Q8D A;  3AQQ A;  4DR5 L;  4A3F B;  3MZ5 A;  1X3F A;  2WKD A;  1K0R A;  2O5I C;  3L7Z C;  5FO9 B;  4DV1 L;  2RHQ B;  3PUX A;  1IYJ B;  1S3O A;  1PV4 A;  2DNC A;  4DV7 L;  4DV2 L;  3A54 A;  3SK6 A;  4KI0 A;  1IL8 A;  4YCU A;  2VZA A;  4M8A A;  3KFU A;  2QF7 A;  3AFP A;  2ZM6 L;  4X66 Q;  5JJL A;  1N32 L;  4FF3 A;  1OXU A;  4A3M H;  1VS0 A;  2AUJ D;  2K14 A;  3PCO B;  3STB C;  3I4N H;  2F0N A;  1V9P A;  4KMU C;  4IUV A;  5COR A;  3G48 A;  4BBR H;  1UE1 A;  5LL6 X;  5M5W B;  2R93 B;  4GS3 A;  3CMA A;  1QZH A;  3J7Z C;  1JC7 A;  1LT4 D;  2VL6 A;  3EQL C;  1IKM A;  2RSN A;  4DR2 Q;  1OTC A;  1LT5 D;  5IGB A;  4LF9 Q;  1QJO A;  4A3G H;  1ILQ A;  1L0W A;  1JMC A;  5C0X G;  1XYI A;  3J7A V;  3K0X A;  1V8Q A;  2NVX H;  1GUW A;  1J9O A;  4PZ8 A;  1X9N A;  3PO3 B;  3RUZ A;  2K6A A;  2JA7 G;  2PQA B;  1PFM A;  5C44 H;  3MXN B;  2JQO A;  1N33 Q;  2IPK D;  4H02 A;  3RLO A;  1BCP C;  1M90 C;  3R2I A;  2IW3 A;  2WAQ B;  1EYC A;  3UI2 A;  5M9O A;  2F0O A;  2VY3 A;  2B2V C;  1JWU D;  4DV3 Q;  2R92 H;  4A93 H;  1SLJ A;  2AHO B;  1D8L A;  1PRT B;  1VQE A;  2MHV A;  2MO1 A;  1TT2 A;  3WDN A;  2ASB A;  2A1A A;  2KJX A;  2I46 A;  3HP3 A;  2EYM A;  2QIL A;  1SMY C;  3MXU A;  1E2W A;  2NB0 A;  4DPG A;  1B2T A;  3J80 c;  1VQI A;  1PH7 A;  4BS9 A;  1VCI A;  3MTS A;  1YJ9 A;  1AH9 A;  4CJ2 C;  4QUF A;  4OWT B;  2PZW A;  3NEL A;  4DR6 L;  2CWA A;  3D4W A;  3BDO A;  1GM5 A;  2F0J A;  1EIF A;  2B2V A;  2EY6 A;  1SND A;  3F1Z A;  2EXD A;  4BY1 G;  5KND A;  1STE A;  2RDG A;  3BG3 A;  2B2T C;  3E9I A;  4B3T L;  3A5U A;  2PW7 A;  5CV6 A;  2GA4 B;  2A68 C;  2NTS A;  2F3V A;  5JEA J;  4IO9 A;  1HJP A;  3HOU G;  3LWE A;  2F4V Q;  1AN8 A;  4BWG B;  1G6P A;  4JI0 L;  1KRS A;  1GHK A;  1I3Q B;  4ZUI A;  2F03 A;  4JBJ A;  3TBI B;  2F3W A;  3SHL A;  5C4X H;  1VQK A;  1TS2 A;  2B2U C;  1P16 A;  4LF5 L;  4WOR A;  4U68 A;  1M8A A;  4A3I B;  1YBY A;  2EYL A;  2L12 A;  4JOI C;  2Q2U A;  2Q8T A;  3SEB A;  5C0X I;  1K83 H;  4J6H A;  2CH4 A;  1TWC H;  1EQQ A;  2PI2 A;  2Q2I A;  4FP5 D;  3HKZ G;  4DR1 Q;  3RLF A;  1IW7 C;  5IT9 E;  3NBI A;  1O7L A;  4GN4 B;  4UHV A;  1PZJ D;  2F52 A;  1WFQ A;  1YJW A;  1EEI D;  2RBM A;  4U67 3;  3TZU A;  3OTO Q;  1OXT A;  3A0J A;  1YIT A;  1KL9 A;  2R93 G;  3OYY A;  4A3K G;  3CF5 A;  1WCM G;  1SNM A;  3QO2 A;  1QUQ A;  3KUP A;  2Q2T A;  1ENA A;  4RGN A;  1DYQ A;  2UXC L;  4CDC C;  5K5P A;  3S16 B;  2DJG C;  1I4R A;  1FJG L;  3GTL B;  2HIX A;  3MA2 B;  1I50 B;  1AZP A;  4DK3 C;  4L5Q A;  1YNN D;  2E2H H;  1UUP A;  1JWS D;  2F0U A;  4DUY L;  1AFP A;  2KED A;  3I70 A;  1K73 C;  1RTN A;  3NTH A;  3BS1 A;  4EX5 A;  2ZXP A;  4ID6 A;  4C1N I;  4X3U A;  3HOY H;  2IX3 A;  3PO3 G;  1Q86 C;  1B8A A;  2XSC A;  2ZTD A;  1DCZ A;  3KYH C;  1HNW L;  3TRE A;  1FR3 A;  5KEE A;  3DMU A;  2M2L A;  1FVI A;  1VQN A;  1Y1W G;  1G91 A;  1A15 A;  3CME A;  1XWE A;  1RCV D;  3RZD B;  2YTX A;  4JI3 L;  3TDQ A;  2E5L Q;  4OX9 L;  1E7Z A;  4AQY L;  4KKT A;  4CBV A;  4POF A;  1YIJ A;  1G2S A;  1SE2 A;  1KHI A;  1EOT A;  4A3J B;  4ZLT F;  1GUO A;  1QB5 D;  1Y1V B;  2F0T A;  1SYD A;  3P20 A;  1SNP A;  3FVQ A;  4F7X A;  1XXG A;  3HOV B;  3K7A H;  2JA6 B;  1VDZ A;  1SNC A;  2E2I H;  1B3A A;  1YI2 A;  5LMN Q;  4LJZ C;  3W2D A;  1HXY D;  4JVZ A;  4IFD H;  5LMN W;  4IUP A;  3D6C A;  3FRP B;  2WB1 G;  3J80 i;  1SR3 A;  4IUN A;  1QZG A;  1F77 A;  1B7Y B;  5C6A A;  1TS5 A;  1B1Z A;  1XNR L;  3PF4 A;  2EXZ A;  5E3F A;  1I6H H;  1I4X A;  2G5D A;  4R4T A;  5DNF A;  2EJF C;  3OWE B;  4L5S A;  2CQA A;  5AJ3 L;  4A3D B;  3UDX A;  5HUR A;  4IUT A;  5D3D A;  2K05 A;  1A8V A;  1DGS A;  2B63 H;  3T1Y Q;  4RGO S;  2NYZ D;  3RN5 A;  2NBF A;  3M7G A;  1YNJ C;  5IGF A;  3KF8 A;  2XGT A;  3HGB A;  1AE3 A;  3EBE A;  4G7Z C;  4KTA A;  3MAQ A;  2L4N A;  4TQU S;  2O5J C;  5IWA L;  3GTO B;  5T1G A;  5KIX A;  5FLM H;  1CM9 A;  2F0P A;  2HQE A;  2OQ0 A;  2WII B;  1V43 A;  3G71 A;  4NXM Q;  2MFI A;  1II3 A;  1PMR A;  1H9M A;  1SNO A;  5A2Q L;  2IHF A;  2JN4 A;  1V1P A;  2XNA C;  1Q82 C;  2LXJ A;  1MSG A;  4UPA A;  1CSP A;  2XRQ D;  1K8O A;  4RGT A;  3Q23 A;  4ZUJ A;  1XJV A;  4RA8 A;  4A3I G;  4DUY Q;  1CZG A;  4YY3 Q;  5IYC H;  2BA0 A;  1L0X B;  1SMY D;  2RCN A;  1HNZ L;  2NVY H;  1PFS A;  1LYL A;  3NWT A;  1IBL L;  1HNW Q;  2EPB A;  1E3P A;  5COY A;  2Z4H A;  3KJP A;  4A3C G;  2DY7 A;  1ZYR C;  1HUN A;  2PNH A;  1TY0 A;  2EVB A;  1U5K A;  1YHA A;  3PUZ A;  1ZEQ X;  5HGQ A;  1E22 A;  4KHV A;  4X62 L;  4RMF A;  4IPD A;  5JAV A;  3B6Y A;  1IBK Q;  1SDF A;  2BE5 D;  3I4O A;  5ELO A;  3F2U A;  3IL8 A;  1QUQ B;  1B50 A;  4OHJ A;  2A68 D;  1CA6 A;  3FKI B;  3OHX C;  3F2D A;  2Y0S B;  4HCE A;  5IOD A;  2A6E D;  3SR1 A;  3VYT A;  5M3F H;  3K5L A;  3PO2 B;  3D3R A;  1HR0 Q;  4PMW A;  3RZO H;  4B08 A;  4FF2 A;  1HR0 W;  2KEE A;  3M3Y H;  2A5H A;  1S5E D;  4BXX H;  1G8Z D;  1F9R A;  1ENF A;  2ES2 A;  1PHJ A;  4DR4 L;  4UDU C;  4NB3 A;  2EJG C;  4N8F A;  1UAP A;  3LX0 A;  2L55 A;  2B2W C;  4HSP A;  3HOX B;  2WKC A;  4NKL A;  1F9P A;  4FF4 A;  2CKZ B;  3CD6 A;  2QEX A;  3K5M A;  1E0B A;  2AQ3 B;  3BYT B;  3D0F A;  3T56 B;  1U4M A;  2VQF L;  4QUC A;  4X64 L;  3PIO A;  4DAM A;  1GO3 E;  4IPG A;  3SXH A;  2E2D C;  5EAY A;  1BCP F;  3LWU A;  4OON A;  4A3J G;  2PQE A;  1IW7 D;  3H0G H;  1PH8 A;  1PFN A;  1N34 L;  1KNA A;  5BR8 Q;  1UE5 A;  1WD1 A;  2JA6 G;  1TS4 A;  4X65 Q;  1X55 A;  4IPC A;  2CW0 C;  2F0H A;  2JSO A;  3I7F A;  3SK8 A;  3DM3 A;  5EKL A;  3IKJ A;  2VUM B;  2QW7 A;  1EQR A;  1EY6 A;  1RKN A;  4JI8 Q;  4C56 C;  4IFD J;  1EU3 A;  1EL0 A;  2K33 A;  4ALP A;  5IYD H;  4JBW A;  2C5C A;  1XMQ L;  3S15 B;  3ERS X;  1Y8N B;  5L37 A;  4A3D G;  3DM1 A;  1XNQ L;  1L0Y B;  3NTK A;  1LTR D;  1JT8 A;  2H1E A;  1HUM A;  4M1U B;  4LWC A;  1NR4 A;  3C3L A;  2G9D A;  4C3I H;  2PZU A;  2VQE Q;  2Z9H A;  3HOZ H;  5CV8 A;  5DEH A;  1LTL A;  1KC8 C;  5K36 G;  5LMU Q;  4JI1 L;  3NXW A;  5DAU A;  4R8N A;  1VQD A;  5TSS A;  1PZK D;  1RF2 D;  2MJ8 A;  4NW2 A;  4HIK A;  2J7Z A;  2AKW B;  5EBC A;  4LF4 L;  3CC4 A;  1A2T A;  4JI2 L;  3MVV A;  1EIH A;  3LGJ A;  1TWA H;  2AQ2 B;  5FOB B;  1DM0 B;  1EIY B;  1IBM L;  5H1S E;  5C3E H;  3CCE A;  5CR3 A;  3PUV A;  5EJW A;  2OQK A;  4QMG A;  4P74 A;  5M3M B;  4YIJ A;  2XTI A;  1E1T A;  1ICW A;  3OOC A;  3I8Z A;  2F0F A;  1Y8O B;  3QWN A;  2MGS A;  4DK0 A;  3D6W A;  4I7Z C;  3UDG A;  1PRT C;  2SEB D;  3BDL A;  2OTL A;  3MWY W;  3VR6 A;  4K14 A;  2MQH A;  1NMF A;  4L6T B;  5BN5 A;  1H9K A;  4FXK C;  3SVM A;  4R9W A;  2JA7 B;  2F0I A;  1Q90 A;  2PQA A;  3CAM A;  1HNX Q;  1F9Q A;  3RR5 A;  3NHH A;  4BBS G;  3G6J B;  3MXN A;  2VQF Q;  2QEJ C;  1F2L A;  1EY7 A;  1H9R A;  4AYB B;  5J1Z A;  2N55 A;  2I07 B;  3BVM A;  3ULJ A;  4NXN L;  1TVX A;  2ZTC A;  1N34 Q;  4F88 A;  3NPP A;  3H3V I;  2Q2H A;  2A69 C;  4LMQ D;  2NN6 H;  5M5Y H;  3JAM c;  1PH6 A;  3PF5 A;  3DEO A;  3FKI G;  1TWG H;  3A8I E;  2Y0S G;  3FHW A;  4XQN A;  4YCW A;  2NVT H;  3PO2 G;  1Y14 B;  1CK1 A;  2KVM A;  3MXG A;  2JA8 G;  2EDG A;  4KK7 A;  3U4Z A;  3I91 A;  2FXQ A;  4GOP C;  2VB3 X;  5GRO A;  4RCO A;  1F2M A;  2FFK B;  1TII D;  2ID0 A;  2WAC A;  2BOS A;  4EQN A;  3T1H L;  4CKC A;  1XMQ Q;  1C7Y A;  4DNR B;  3S1N B;  2IJ0 A;  3A7L A;  3P75 A;  2Z6B A;  3VDY A;  2LMC B;  4QY7 A;  3S1R B;  3R2T A;  1AW7 A;  4OIK A;  4QB4 A;  1K28 A;  4O0A A;  3TP8 A;  3HOX G;  3GQB A;  5JEA H;  1QVF A;  1KQS A;  5CBE E;  3KK7 A;  4RCN A;  1VQ8 A;  5G3L F;  1KRT A;  1KDB A;  1RDP D;  3CRL C;  5JVH 3;  3QOJ A;  3WOE A;  3HOU B;  2F1M A;  3OIQ A;  4DA2 A;  4LF4 Q;  4DV6 Q;  2F0V A;  4JI2 Q;  3CCR A;  3ZYY X;  4K6D A;  2WV6 D;  2EYP A;  2HHH Q;  2TMP A;  2GVA A;  4OEM B;  1PH1 A;  3VYR A;  2HD3 A;  1WD0 A;  1JOR A;  1EQT A;  2NVQ H;  2F0L A;  3HOZ G;  2EIF A;  1VQ9 A;  4OL7 A;  1EFI D;  3J80 E;  1EY0 A;  4V0B A;  4CKE A;  4LW1 A;  3M4Y A;  1O7I A;  3CCU A;  1LV9 A;  2VS1 A;  4ME3 A;  4YHH L;  4QF4 A;  3GO5 A;  1S5C D;  4DK1 A;  3I56 A;  1MIU A;  3D8G A;  3HKZ B;  3L0O A;  4RKL A;  1HA5 A;  1XPU A;  2EYH A;  4ZK9 B;  1EY5 A;  4HN7 A;  4JV5 Q;  1X3E A;  1EOV A;  2K75 A;  4ZYS A;  4RWS C;  4DV5 Q;  1D2B A;  1LTS D;  2CCZ A;  2TSS A;  4A3L G;  2UU9 L;  3U58 A;  1HH2 P;  4NXN Q;  1L1O A;  4DAV A;  3BVG A;  2K5D A;  4A3G B;  4TKO B;  3X3M A;  4DR3 Q;  3GTK H;  3D31 A;  2K03 A;  2B29 A;  4ZQ3 A;  2RKS A;  4OWW B;  4LFB Q;  4A3K B;  4C3J H;  1WCM B;  1HZB A;  3GTQ B;  1A2U A;  2NVX B;  1TR5 A;  2FHT A;  4HCS A;  2NTT A;  5HY6 A;  5IYB H;  1EWC A;  4DXF A;  1M4V A;  4ZAI A;  4BY7 G;  1STN A;  5AFW A;  5C44 B;  4Y7N B;  3ND8 A;  4A3F H;  1CQV A;  2DNE A;  5M3M G;  4GN5 A;  1QG7 A;  1PTO B;  1LTA D;  1HZA A;  1SNQ A;  3ERO A;  4Z9C B;  2UUA L;  2R92 B;  5IP9 H;  3NWS A;  1BOS A;  3E6Z X;  3PV0 A;  2UXD Q;  2L1B A;  2EZV A;  1E24 A;  3KLR A;  4XIG S;  4J8Q A;  5GAG C;  1GUT A;  3N6R A;  4R1J A;  2ATW A;  1ROD A;  1FNW A;  4L63 B;  4H7B A;  1NCV A;  2H5X A;  4MZ9 A;  4ABN A;  1Y1W B;  4IJL A;  4B3S Q;  3H09 A; 
#chains in the Genus database with same CATH homology
 4G7O C;  2IX0 A;  3NSW A;  1SXT A;  3K57 A;  1OXS C;  3V05 A;  2B8F A;  2R61 A;  4K8I A;  3FPU B;  3C1F A;  5CV7 A;  4BA1 I;  3PUY A;  1G6Z A;  2XVS A;  5JEA G;  3RD4 A;  2WB1 B;  4FF1 A;  4DGZ A;  3OWF A;  3SK4 A;  3S9W A;  2E76 C;  3H6M A;  1O7Z A;  1KDC A;  1TWF B;  5EPL A;  4O42 A;  4XYO A;  1Z47 A;  5I2X A;  4ME5 A;  1ET9 A;  4KY7 A;  1EY9 A;  3VYS A;  1GXD C;  1VMC A;  2EY1 A;  5F2D A;  2KHS A;  5KYL A;  3T16 A;  4KHZ A;  2LY7 A;  2PNR C;  1PRT D;  3LNN A;  1J8I A;  1ILP A;  3IFT A;  3EJI A;  1OXV A;  2SNS A;  2ZXR A;  1K83 B;  1DOL A;  1QNU A;  2RDF A;  5A2Q E;  4EVO A;  5JPM C;  1R4Q B;  5KNB A;  1Z6H A;  2NZ1 D;  3J80 L;  3CU7 A;  1B4O A;  3V96 A;  3VR3 A;  2K28 A;  2F0S A;  2Z1C A;  3ONA B;  3C1E A;  4NDX A;  1EWH A;  3VYU A;  3R93 A;  3MXP A;  1BXT A;  4F87 A;  4WJW A;  4OO1 H;  2K5W A;  1KNE A;  1QWY A;  4KY6 A;  3KBG A;  4TRD A;  2H4O A;  4OGQ C;  1I4P A;  3J81 L;  2RSO A;  3DWA A;  5JPN C;  2E75 C;  1AZQ A;  1CQF A;  1JR0 D;  4HMJ A;  2Q8I B;  5CBA E;  4PMC A;  4B9W A;  4PQX A;  3HOY B;  4KY5 A;  4QCL A;  2E2J B;  1A3V A;  4HTH A;  2BCO A;  3NE5 B;  5CV9 A;  3HS0 C;  3Q24 A;  5KGU A;  3QB3 A;  4ZKC B;  5CV5 A;  3AMU A;  1SYC A;  1G2T A;  1SFO B;  1DOK A;  1HTP A;  2OT2 A;  3MFG A;  3GTJ B;  3IFD A;  4IUR A;  2CVR A;  3U9O A;  1PRT F;  3K7A B;  4RH6 A;  4ZKB B;  2EY5 A;  4KKS A;  1B9N A;  1LTG D;  4IN3 A;  2A6H C;  1ESF A;  2VXW A;  4X3S A;  2PCF B;  2F0W A;  5T1I A;  2PZT A;  1H9J A;  3V2T A;  3FPP A;  3MC0 B;  3N52 A;  1I6H B;  2EE1 A;  5CC4 A;  1HA6 A;  4HSV A;  4RAU C;  3DWQ A;  3J7Y W;  5CMD A;  2XWJ B;  1ET6 A;  1SAP A;  2ICE C;  3A56 A;  4UAI A;  5JOB A;  3NP8 A;  3NQI A;  4B9X A;  2SOB A;  1D1K A;  3Q22 A;  3A8K E;  3HEJ A;  3CKI B;  4C1N K;  2BDN A;  3S2H B;  2E74 C;  5E4W C;  1FYC A;  2XN9 C;  1CFM A;  2F0Q A;  5IIF A;  2L11 A;  4DAY A;  4DF7 A;  5EKK A;  1CHQ D;  3GP7 A;  2A74 C;  3GV3 A;  5DM6 3;  2NVY B;  2B2Y C;  2KQ3 A;  4DN4 M;  1BCP D;  1EYA A;  3H91 A;  4JK1 C;  1CHP D;  1I4H A;  1PFB A;  1X3P A;  4DAP A;  5CV4 A;  2IX1 A;  1XTC D;  2A73 B;  1F9S A;  4XQQ A;  2JE6 I;  1STG A;  1SE4 A;  1K8M A;  3ND9 A;  2EYF A;  3M7N A;  2B2Y A;  1H9S B;  2FJ2 A;  3A55 A;  1LTI D;  1B44 D;  5C4Z A;  5M3F B;  1HHV A;  3RZO B;  1T5E A;  1O7Y A;  4BBS B;  2JP1 A;  1R9T B;  3OSO A;  1PXU A;  4K5W A;  1Q1E A;  5FO7 B;  3FMC A;  1WTX A;  5ELD A;  3EFX D;  1U4L A;  2AWN A;  1LAC A;  4KN4 C;  1JCK B;  4E6I A;  2JA8 B;  1SJH D;  3CQZ B;  1BDO A;  1SYF A;  3TSS A;  3H0G B;  4HAE A;  4XQJ A;  4Q5V A;  1EZ6 A;  1D6E C;  5IGC A;  1CTM A;  1Q8I A;  4OIJ A;  1CZW A;  1GJX A;  4IFD G;  4CJ0 B;  2K32 A;  1T5X D;  5C3X A;  1JOO A;  2K5Q A;  5IGD A;  3DEP A;  5C4H A;  2VB2 X;  2BDO A;  2BA1 A;  5J22 A;  1QNK A;  3D4D A;  4C3I B;  5EGT A;  3HOZ B;  4ILW A;  1A3U A;  1X3Q A;  1CA5 A;  1BR9 A;  2IL8 A;  1GUN A;  1HFN A;  3K0Y A;  1WVL A;  3A8J E;  1TWA B;  5D65 A;  3I3C A;  2KEC A;  3TP6 A;  1SYE A;  3BZD B;  4DFA A;  2ENB A;  1HRJ A;  1V1O A;  4H44 C;  1A6X A;  1PTO C;  1JQY D;  5G3L D;  1F2Y A;  1QE6 A;  2A6H D;  1PDQ A;  1X32 A;  3GV6 A;  4HED A;  2SDF A;  5BN3 A;  4F8M A;  4BY7 B;  1S5B D;  1Q12 A;  2KOL A;  3TP7 A;  1SSO A;  3S17 B;  4IUU A;  1IKL A;  5EBD A;  5E4X A;  4EQP A;  5M5Y B;  1FNU A;  1TWG B;  2NWG A;  2FMC A;  2MP1 A;  4V19 0;  1NUC A;  5EKI A;  5IGE A;  4IFD I;  1WTQ A;  3GD7 A;  3QIA A;  5C5L A;  4CGY B;  1S5D D;  1GUG A;  2K01 A;  3HRZ C;  3BVZ A;  2ICI A;  5KNC A;  1O80 A;  1YNJ D;  5I9P A;  2KA7 A;  5ISR A;  1OXX K;  4FNF A;  1IYU A;  4MIU A;  3D4R A;  5EQ0 A;  3K6O A;  2K1B A;  1CT1 D;  2C9O A;  1KLU D;  5C0X H;  4K2K A;  3PIO 3;  2KCN A;  3EVQ A;  4BA2 I;  3CRK C;  4L8J A;  2HCC A;  3U9S A;  2OF1 A;  3M85 A;  1DJR D;  1SEB D;  1SYB A;  2OEO A;  1SYG A;  1EQV A;  2IT1 A;  1OO9 B;  1XX8 A;  1STB A;  1TY2 A;  2NVQ B;  3TME A;  5IOC A;  5FKA C;  1HQM C;  1TQO A;  4NP5 A;  1D1I A;  1ZYR D;  3JAM L;  3T13 A;  1RTO A;  2Q8R E;  3AB9 A;  4C3I G;  1MI2 A;  3L9A X;  1EY8 A;  4A3M B;  1E2Z A;  1LLR D;  2X6L A;  3I4N B;  3SE0 A;  4S3S A;  3W3A A;  1TU2 B;  3RMH A;  1YNN C;  2J4X A;  1RD9 D;  4RHR A;  4ODG A;  4BBR B;  1VMP A;  4MHE A;  1F2Z A;  3J81 E;  3T51 B;  2HUG A;  3H94 A;  4MN3 A;  3OMG A;  2KCC A;  4FYD A;  1DON A;  4G57 A;  5FO8 B;  2G9H D;  4ZRZ A;  4C3H G;  4X3T A;  3K58 A;  3T53 B;  2D62 A;  2K7V A;  1NR2 A;  1U4R A;  5FLX L;  5D14 A;  5C5M A;  3MHB A;  1GHJ A;  1EEF D;  1TKW B;  1O78 A;  1PZI D;  2CW0 D;  4A93 B;  3OMC A;  3H3V C;  2NN6 G;  3NBH A;  2EYJ A;  2M00 A;  4KV6 A;  2JEA I;  2RA4 A;  3VR2 A;  4KJO A;  1ZXT A;  5ELC A;  4FXG C;  4XXE A;  1R4P B;  1LT6 D;  2JA5 B;  3EA6 A;  2RVL A;  3HOW B;  1PTO D;  4WFN 3;  1PTO H;  5I2Y A;  5JVG 3;  3PMF A;  3I72 A;  1U9R A;  4K6L A;  2CHB D;  3VA5 A;  1MD2 D;  3ITP A;  4I65 A;  2O4X A;  3SDZ A;  1WTW A;  1EYD A;  3Q6S A;  3FEW X;  2Z4I A;  4NMZ A;  5C0X J;  4A3B B;  2AWO A;  2F0G A;  1DD2 A;  2XRS D;  2B39 A;  4CJ1 B;  1CI3 M;  3NQT A;  5KYI A;  5C4X B;  1PYW D;  4DXG A;  3I4M B;  3J7A F;  3GTG B;  2R6G A;  1G29 1;  1BUV T;  2BE5 C;  1TWC B;  2X69 A;  1LT3 D;  2L5T A;  1EZ8 A;  3P7J A;  3C46 A;  3L3O C;  3G7L A;  2A6E C;  2A69 D;  4H0L C;  3IAY A;  1JB3 A;  3M4O B;  1VF7 A;  2NN6 I;  3K59 A;  2B2T A;  4C3J G;  2R3Z A;  2F0E A;  1H9S A;  1BQQ T;  5IGG A;  1DXM A;  3GTP B;  4X3K A;  4O1N A;  4HR7 B;  5KRU A;  3S2D B;  2V4D A;  5I6W A;  2E2H B;  1FD7 D;  3NTI A;  1A3T A;  5J39 A;  1PTO F;  3R8B A;  4IQZ A;  3QG1 A;  1Z7T A;  1MBY A;  1IYV A;  2PO4 A;  1TWH B;  1LTB D;  2ZT9 C;  4KN7 C;  2JEB I;  3KBX A;  4FXD A;  4ULL A;  3S1M B;  2B2U A;  2F0D A;  1D5X C;  5D3I B;  5LL6 S;  5BN4 A;  3SK5 A;  5CGK A;  2F4I A;  2D5D A;  2E2I B;  4XTC S;  1ZKO A;  3BDC A;  4EQO A;  2K04 A;  5C4J B;  2EYO A;  1B53 A;  4IZ8 A;  1S4Z A;  1QIL A;  1U4P A;  5I4D A;  1I4G A;  2N88 A;  3R3O A;  1D5M C;  4KD3 A;  1Y8P B;  4J1M A;  2MPM A;  2IWH A;  3T4A C;  3QOL A;  3OW7 A;  4K2L A;  2B63 B;  1SE3 A;  1BBX C;  4N9T A;  3A7A B;  3TP5 A;  2D2C C;  5ELF A;  2DN8 A;  2WIN B;  1ESR A;  1JOQ A;  3Q0A A;  2R7Z B;  2L9H A;  2XWB B;  3DWP A;  1BCP B;  3HZX A;  1BO0 A;  3E5S A;  1PLF A;  1QCB D;  5CYU A;  2YYZ A;  4XT1 B;  5NUC A;  2X6G A;  3VR4 A;  5ELE A;  4A3E B;  3DUZ A;  5C3W A;  2JYO A;  3P1H A;  4HMI A;  1HFG A;  4OO1 G;  1S5F D;  1LAB A;  1JIC A;  2YU9 B;  1NAP A;  2RQX A;  4XDX A;  4RFB A;  4H13 C;  1HCZ A;  3QJY A;  5FK9 C;  2PPB C;  1VF5 C;  2B8G A;  1I6V C;  5E1F A;  3TZD A;  3PIP 3;  1Q3L A;  5M5X B;  5K36 H;  4TSS A;  1HPC A;  1E2V A;  1KTK A;  1W6K A;  3M3Y B;  3MEH A;  5A35 A;  1AEX A;  4IAL A;  4DNT B;  5IT9 L;  2HDL A;  2PYK A;  5ELB A;  4N9P A;  3CHB D;  3WOF A;  2F0K A;  2XIW A;  2QDB A;  2LFN A;  4FO2 A;  4G4K A;  5JJZ A;  3HG9 A;  4KJN A;  2PMZ B;  4WRD A;  1ML0 D;  4IUQ A;  5DM7 3;  1GUS A;  1RHP A;  3I4L A;  4CKB A;  2JXM B;  1D5Z C;  3VA7 A;  2L0C A;  2LKV A;  3OIP A;  4XT3 B;  1I4Q A;  1WTO A;  2J0T D;  4KKU A;  2NUC A;  1MGS A;  4OO1 I;  1TS3 A;  3JAM E;  2RDH A;  3NUC A;  2Z8L A;  3PUW A;  2HDM A;  3GTM B;  1DZ1 A;  1JWM D;  1UNS A;  3KLS A;  2D9U A;  3TN2 A;  1JOK A;  4QIW B;  3O13 A;  3VR5 A;  2LS0 1;  4PMB A;  4LAA A;  2B2W A;  1Y69 U;  1EY4 A;  3URY A;  4Q0F A;  1EIG A;  4RHS A;  2HCI A;  1LO5 D;  4KD4 A;  5C3E B;  3X3N A;  2KUM A;  4C2M B;  1WTP A;  2AUK A;  3K5N A;  1EU4 A;  2SNM A;  2FIN B;  2VNU D;  3E0J A;  4RKB A;  1Q1B A;  4C3H B;  1STY A;  2ZXO A;  4LK1 C;  1BF4 A;  2MUY A;  3KLS X;  4PV1 C;  3I73 A;  5FLX E;  2O2L D;  5EPJ A;  4G7H C;  4K8J A;  3AU7 A;  4K5V A;  1FNV A;  1W6J A;  3ERQ A;  4R8I A;  1MSH A;  1V1P B;  4CHT B;  2NVT B;  1RJT A;  1C48 A;  1KAB A;  3FDT A;  1C4Q A;  1LTT D;  2OXP A;  1QOH A;  3S1Q B;  4K5X A;  3DXJ C;  4FVM A;  2QCP X;  1STH A;  3S14 B;  3NK9 A;  3C2P A;  1B9M A;  1UEA B;  1HTL D;  2QKI C;  3I90 A;  1WTR A;  3MFY A;  1IHZ A;  5I9O A;  2WP8 J;  2EJM A;  1NSN S;  1STA A;  2PW5 A;  1SJE D;  4DU9 A;  2AQ1 B;  2EY2 A;  5I6Y A;  1BNZ A;  2EOT A;  1HQR D;  5HGT A;  3K5O A;  4BY1 B;  2F0M A;  1SBB B;  5LHY 1;  2FMM A;  1KAA A;  4XYQ A;  4P2C B;  1WTV A;  3OPO A;  4EGV A;  4PNY A;  4GZY C;  1FGB D;  1DOM A;  1KLG D;  3GTK B;  2DY8 A;  1ENC A;  1KDA A;  1JE4 A;  1AP0 A;  1GOZ A;  2M9V A;  1C8C A;  4C3J B;  5EPK A;  1ONL A;  4RGM A;  3BYY B;  3DHQ A;  4A3F B;  3MZ5 A;  2WKD A;  2O5I C;  3L7Z C;  5FO9 B;  3PUX A;  2DNC A;  3A54 A;  3SK6 A;  4KI0 A;  1IL8 A;  4M8A A;  2QF7 A;  4FF3 A;  1OXU A;  2AUJ D;  2F0N A;  4KMU C;  4IUV A;  5COR A;  5LL6 X;  5M5W B;  2R93 B;  1JC7 A;  1LT4 D;  3EQL C;  1IKM A;  2RSN A;  1LT5 D;  5IGB A;  1QJO A;  1ILQ A;  5C0X G;  1XYI A;  3J7A V;  1V8Q A;  1GUW A;  1J9O A;  3PO3 B;  3RUZ A;  2K6A A;  1PFM A;  2IPK D;  1BCP C;  2IW3 A;  2WAQ B;  3R2I A;  1EYC A;  3UI2 A;  5M9O A;  2F0O A;  2B2V C;  1JWU D;  1PRT B;  2MHV A;  1TT2 A;  3WDN A;  2KJX A;  2I46 A;  3HP3 A;  2EYM A;  2QIL A;  1SMY C;  3MXU A;  1E2W A;  2NB0 A;  1B2T A;  4BS9 A;  1VCI A;  3MTS A;  4CJ2 C;  4QUF A;  2PZW A;  3D4W A;  3BDO A;  2F0J A;  2B2V A;  2EY6 A;  1SND A;  5KND A;  1STE A;  2RDG A;  3BG3 A;  2B2T C;  2PW7 A;  5CV6 A;  2GA4 B;  2A68 C;  2NTS A;  2F3V A;  5JEA J;  3LWE A;  1AN8 A;  4BWG B;  1GHK A;  1I3Q B;  4ZUI A;  2F03 A;  3TBI B;  2F3W A;  3SHL A;  1TS2 A;  2B2U C;  4WOR A;  4U68 A;  1M8A A;  4A3I B;  2EYL A;  2L12 A;  2Q8T A;  3SEB A;  5C0X I;  4J6H A;  4FP5 D;  3RLF A;  1IW7 C;  5IT9 E;  3NBI A;  1O7L A;  1PZJ D;  1EEI D;  2RBM A;  4U67 3;  3TZU A;  1OXT A;  1SNM A;  3QO2 A;  3KUP A;  1ENA A;  4RGN A;  1DYQ A;  5K5P A;  3S16 B;  1I4R A;  3GTL B;  3MA2 B;  1I50 B;  1AZP A;  1YNN D;  1UUP A;  1JWS D;  2F0U A;  1AFP A;  2KED A;  3I70 A;  1RTN A;  3NTH A;  3BS1 A;  2ZXP A;  4ID6 A;  4C1N I;  4X3U A;  2IX3 A;  2XSC A;  1DCZ A;  1FR3 A;  5KEE A;  3DMU A;  2M2L A;  1G91 A;  1A15 A;  3RZD B;  1XWE A;  1RCV D;  3TDQ A;  4KKT A;  4CBV A;  1G2S A;  1SE2 A;  1EOT A;  4A3J B;  4ZLT F;  1GUO A;  1QB5 D;  1Y1V B;  2F0T A;  1SYD A;  3P20 A;  1SNP A;  3FVQ A;  4F7X A;  1XXG A;  3HOV B;  2JA6 B;  1VDZ A;  1SNC A;  1B3A A;  4LJZ C;  3W2D A;  1HXY D;  4IFD H;  4IUP A;  3D6C A;  3FRP B;  4IUN A;  1F77 A;  5C6A A;  1TS5 A;  1B1Z A;  2EXZ A;  5E3F A;  1I4X A;  5DNF A;  2EJF C;  3OWE B;  2CQA A;  4A3D B;  5HUR A;  4IUT A;  5D3D A;  2K05 A;  4RGO S;  2NYZ D;  2NBF A;  3M7G A;  1YNJ C;  5IGF A;  3KF8 A;  3HGB A;  4G7Z C;  4KTA A;  3MAQ A;  2L4N A;  4TQU S;  2O5J C;  3GTO B;  5T1G A;  5KIX A;  1CM9 A;  2F0P A;  2HQE A;  2WII B;  1V43 A;  1II3 A;  1PMR A;  1H9M A;  1SNO A;  5A2Q L;  1V1P A;  2XNA C;  1MSG A;  2XRQ D;  1K8O A;  4RGT A;  3Q23 A;  4ZUJ A;  4RA8 A;  1CZG A;  2BA0 A;  1L0X B;  1SMY D;  3NWT A;  2EPB A;  5COY A;  2Z4H A;  2DY7 A;  1ZYR C;  1HUN A;  1TY0 A;  2EVB A;  3PUZ A;  1ZEQ X;  4KHV A;  5JAV A;  1SDF A;  2BE5 D;  3F2U A;  3IL8 A;  1B50 A;  4OHJ A;  2A68 D;  1CA6 A;  3FKI B;  3OHX C;  2Y0S B;  4HCE A;  5IOD A;  2A6E D;  3SR1 A;  3VYT A;  3K5L A;  3PO2 B;  3D3R A;  4PMW A;  4B08 A;  4FF2 A;  2KEE A;  2A5H A;  1S5E D;  1G8Z D;  1F9R A;  1ENF A;  4UDU C;  2EJG C;  1UAP A;  3LX0 A;  2L55 A;  2B2W C;  4HSP A;  3HOX B;  2WKC A;  4NKL A;  1F9P A;  4FF4 A;  3K5M A;  1E0B A;  2AQ3 B;  3BYT B;  3T56 B;  1U4M A;  4QUC A;  3SXH A;  2E2D C;  1BCP F;  3LWU A;  2PQE A;  1IW7 D;  1PFN A;  1KNA A;  1WD1 A;  1TS4 A;  2CW0 C;  2F0H A;  2JSO A;  3SK8 A;  5EKL A;  3IKJ A;  2VUM B;  1RKN A;  1EY6 A;  4C56 C;  4IFD J;  1EU3 A;  1EL0 A;  2K33 A;  4JBW A;  2C5C A;  3S15 B;  1Y8N B;  3DM1 A;  1L0Y B;  3NTK A;  1LTR D;  2H1E A;  1HUM A;  4M1U B;  1NR4 A;  3C3L A;  2G9D A;  2PZU A;  5CV8 A;  5DEH A;  5K36 G;  3NXW A;  5DAU A;  4R8N A;  5TSS A;  1PZK D;  1RF2 D;  2MJ8 A;  4NW2 A;  2J7Z A;  5EBC A;  1A2T A;  3MVV A;  1EIH A;  2AQ2 B;  5FOB B;  1DM0 B;  5CR3 A;  3PUV A;  5EJW A;  4QMG A;  5M3M B;  4YIJ A;  1ICW A;  3OOC A;  3I8Z A;  2F0F A;  1Y8O B;  3QWN A;  2MGS A;  4DK0 A;  3D6W A;  4I7Z C;  1PRT C;  2SEB D;  3BDL A;  3MWY W;  3VR6 A;  4K14 A;  4L6T B;  5BN5 A;  1H9K A;  4FXK C;  3SVM A;  4R9W A;  2JA7 B;  2F0I A;  1Q90 A;  1F9Q A;  3NHH A;  3G6J B;  3MXN A;  2QEJ C;  1F2L A;  1EY7 A;  1H9R A;  4AYB B;  5J1Z A;  2N55 A;  2I07 B;  3BVM A;  1TVX A;  4F88 A;  3NPP A;  2A69 C;  4LMQ D;  2NN6 H;  3DEO A;  3A8I E;  4XQN A;  1CK1 A;  2KVM A;  3MXG A;  2EDG A;  4KK7 A;  3I91 A;  2VB3 X;  4RCO A;  1F2M A;  2FFK B;  1TII D;  2ID0 A;  4EQN A;  2BOS A;  2WAC A;  4CKC A;  3S1N B;  4DNR B;  2IJ0 A;  3A7L A;  3P75 A;  2LMC B;  3S1R B;  3R2T A;  1AW7 A;  4OIK A;  4QB4 A;  3TP8 A;  3GQB A;  5JEA H;  5CBE E;  3KK7 A;  4RCN A;  5G3L F;  1KDB A;  1RDP D;  3CRL C;  5JVH 3;  3QOJ A;  3WOE A;  3HOU B;  2F1M A;  3OIQ A;  4DA2 A;  2F0V A;  3ZYY X;  4K6D A;  2WV6 D;  2EYP A;  2TMP A;  3VYR A;  1WD0 A;  1JOR A;  1EQT A;  2F0L A;  4OL7 A;  1EFI D;  3J80 E;  1EY0 A;  4V0B A;  4CKE A;  3M4Y A;  1LV9 A;  4QF4 A;  3GO5 A;  1S5C D;  4DK1 A;  3D8G A;  3HKZ B;  4RKL A;  1HA5 A;  2EYH A;  4ZK9 B;  1EY5 A;  4HN7 A;  4ZYS A;  4RWS C;  1D2B A;  1LTS D;  2TSS A;  4DAV A;  3BVG A;  2K5D A;  4A3G B;  4TKO B;  3X3M A;  3D31 A;  2K03 A;  4ZQ3 A;  2RKS A;  4A3K B;  1WCM B;  3GTQ B;  1A2U A;  2NVX B;  1TR5 A;  2FHT A;  4HCS A;  2NTT A;  1EWC A;  4DXF A;  1M4V A;  4ZAI A;  1STN A;  5AFW A;  5C44 B;  4Y7N B;  3ND8 A;  1CQV A;  2DNE A;  1QG7 A;  1PTO B;  1LTA D;  1SNQ A;  3ERO A;  4Z9C B;  2R92 B;  3NWS A;  1BOS A;  3E6Z X;  3PV0 A;  2L1B A;  2EZV A;  4XIG S;  3KLR A;  4J8Q A;  1GUT A;  3N6R A;  1ROD A;  1FNW A;  4L63 B;  4H7B A;  1NCV A;  4ABN A;  1Y1W B;  3H09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...