3T1HL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a human anti-codon stem loop (hasl) of transfer rna lysine 3 (trnalys3) bound to an mrna with an aaa-codon in the a-site and paromomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16s rRNA
publication title Human tRNA(Lys3)(UUU) Is Pre-Structured by Natural Modifications for Cognate and Wobble Codon Binding through Keto-Enol Tautomerism.
pubmed doi rcsb
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2011-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3t1hL00
1CSPA 4HIKA 1N33L 2AWNA 1J5EQ 1FJGL 3CAMA 4NB3A 1S72A 3K8AA 1B70B 3KOJA 1PH4A 1Y14B 1L0WA 3HOVG 4IPCA 2HHHQ 3GD7A 2ASBA 4OO1I 4IFDI 2HIVA 3KJOA 1XPUA 1OTCA 1FGUA 2B3GA 3HOZH 1N32L 2D0PA 1B8AA 5EAYA 4BY1G 5M3MH 1KIXA 4A75A 3TRZA 1PYBA 4JI4L 3J80i 1X56A 1J6QA 3J81j 3CMEA 1E22A 1K3RA 4LF4L 2WAQG 5M5YH 3F2DA 4X65Q 1E7ZA 2H5XA 4GN4B 4LFAQ 3S14H 3Q8DA 3A5UA 2UXDQ 4UPAA 4NXMQ 3IRBA 1Q7YC 4X64Q 3CC7A 3J7A5 1L1OB 5GADC 2B63H 4HJ8A 4R4TA 1LUZA 5C4JH 3UDFA 3GTKH 4IFDJ 2NVXH 4B3SQ 2I0QA 4A3KH 5K36G 2VQEL 2UUBL 1L2FA 4HJAA 1HNXL 1XTDA 2GVBA 1IBML 1A63A 1YNXA 1WCMG 3H0GH 1XMQL 1W3SA 2A8VA 3AEVA 1L1OC 3FHWA 1YHQA 3W1GA 4BXXG 1XPRA 4GLVB 1N36Q 3RLOA 4A3CG 2AMCB 4A93G 3PUVA 4J15A 3ZJYC 3G48A 2VQFL 1P16A 1HNWL 3S24A 1AH9A 4X66L 4K0KL 2UU9L 1L1OA 4JI1Q 4JC0A 2QEXA 4TQUS 4P73A 1KRTA 5HGQA 4PMWA 4B3ML 1OXUA 3PSIA 3CD6A 1HH2P 1Q46A 3S2HH 2ZTCA 1A62A 1R9TH 4AYBG 1PH3A 4Y52H 2VW9A 4DV5L 4A3IG 3HOYG 4OONA 1KXLA 2MO0A 4DV0L 4JI7L 2JA7G 4A3FG 3TS0A 4LF9Q 5IYBG 5IP9H 1UWVA 5ELNA 1VQ6A 1QVCA 1Z9FA 1VQ5A 2WP8J 2PI2E 4DR3L 4R4IA 4DV1Q 4JOIC 1UE5A 1YHAA 4LF5L 4LFCQ 2Z0SA 2ZTEA 3CCEA 3M4OH 5IWAQ 3PIOA 2VZAA 3HOWG 4YCVA 1VQAA 3K7AH 1OXTA 3WWVA 1NE3A 1ASYA 3S1NH 1VS0A 3KDFB 1SFOH 3AFPA 4JI5Q 1GO3E 3CCUA 4OO1G 4IPHA 3G4SA 3PGZA 4KLKA 2LSSA 4HJ5A 3U58A 4IFDG 4P74A 3H3VH 5IP7H 1HR0Q 3HOUG 1KL9A 1YJNA 1WCMH 1UE6A 5BR8L 1U5KA 3M9BA 1YJ9A 4A3GG 2CWAA 4A3CH 2E2HH 3CW2C 4A93H 3RZOH 1P8LA 3PO3G 1SLJA 4LUVA 1SROA 1X3GA 3CXCA 4IOCA 4BY7G 2LXJA 3KFUA 3I4NG 4YHHQ 3ERSX 1K83H 4LWCA 1GVPA 3S1QH 2D0OA 3W5OA 1JMCA 3KDFA 2R7ZH 4KHPQ 3HKSA 4P71A 5C4XH 4KHZA 4GOPB 5C44G 1UE1A 2JJQA 3CP0A 1RL2A 2DGYA 4A3IH 2IX1A 2YYZA 2E2IH 4OX9L 2K5HA 1JB7A 1V9PA 2Q2HA 5AJ3L 4A3FH 2IHEA 2E5LL 5IYBH 1X3FA 1QUQB 3J81i 4LF8Q 2NVYH 3K0XA 3F2CA 1PVOA 4DR5L 3A5ZB 3TQYA 1VQ7A 4GOPC 2VS1A 3OTOQ 3AQQA 2E8GA 4R4QA 4TVAB 1GKHA 4DV6L 4DR1Q 1I94L 3GTLH 5GAHC 3HOWH 5LMNL 3I56A 3NBHB 4Y7NH 3I4OA 4GOPA 1GM5A 2R6GA 4MNOA 2OTLA 1XMOL 1C7YA 2F3IA 3L7ZC 1M90C 2KHIA 1EWIA 3HOUH 3G71A 4A3EG 4RG1A 1XNRQ 1UEBA 4A3GH 2R7FA 2ZM6Q 3T1HL 4A3KG 1MIUA 4MZ9A 5M3FG 4JYAL 2JA9A 2GVAA 4JBJA 4L5SA 4BY7H 3EN2A 1N32Q 5GROA 4LFBL 1FVIA 1M1KC 2OCEA 4JI4Q 1PYSB 1Q86C 1B7YB 5C44H 1A0IA 4NXNL 4LF7L 1KD1C 3NENA 3PO2G 2HQLA 3KF6A 5LMUL 1PH7A 1WFQA 2KCMA 1WYDA 1Q1EA 4KI0A 3JAMi 1VQFA 3GO5A 1IBLL 1N34Q 1Q1BA 1A8VA 1SRUA 1Z47A 3PUXA 4A3LG 4DUZL 1Y1VH 2NVQH 4UP7A 5FLMG 2ID0A 4GKKL 2LXKA 3E0EA 1HZAA 1O7IA 4GN5A 4PZ7A 3NEMA 2JA5G 4AYBE 4YY3L 2RHSB 5IP9G 4AH6A 1PHJA 1HNXQ 3BZKA 1FL0A 3TEHB 1XMQQ 4IJLA 3E9HA 1I3QH 4X62Q 4A76A 1CUKA 4QY7A 1LTLA 2VQFQ 4A3EH 4L5TA 4YCWA 4K0KQ 1CKNB 4C2MH 4JI2L 2CFMA 4FDBA 4DV2L 4HIOA 4QL5A 2YTXA 2Q2IA 5M3FH 1NMFA 4POGA 5DLQE 3RN2A 4B3MQ 4DV4L 4DR6Q 5IP7G 1NTGA 1TWGH 4YWMA 1PH8A 4LF6Q 4B3TQ 2Z6KA 3AFQA 4ALPA 1K8AC 4DV5Q 2K75A 1X6OA 1K9MC 3FKIG 4WJ4A 5GAEC 3LGJA 1TWHH 2MNAA 3EBEA 3PO2H 2EQSA 2RCNA 2YTVA 1X3EA 3CPWA 2DUDA 1CKNA 4EQ5A 1KQSA 2R7ZG 4JBKA 1CKMA 3GTMH 2UUAQ 4LF5Q 5C4XG 3RZDH 1VQJA 4A3LH 2N78A 4LW1A 4LFAL 1W2BA 2FXQA 3OW2A 3I4MG 5FLMH 3CF5A 4NXML 2JA5H 1TXYA 1CKOA 2XTIA 2AHOB 2XGTA 3BJUA 4DR7Q 1YIJA 2PQAB 2BA1A 4APVA 4DR4Q 4AIMA 4DV3L 2CKZB 2D62A 2QA4A 4DR2Q 4OWTB 2F4VQ 2UXBQ 5IYDG 3DLLA 1MJCA 3UDGA 4R1JA 1U0LA 1HNZQ 1X54A 1PH1A 3H15A 2JEAI 4JBMA 1PH9A 3CCQA 3JC66 2MO1A 3CCMA 3BZCA 2AWOA 3F8TA 1XNQQ 3RR5A 3J80c 3B6YA 1EIYB 2NN6I 3GTPH 4JV5L 1PH2A 3K80C 2PQAA 3FKIH 2CCZA 4JI6Q 3CMAA 4OX9Q 2KCTA 3TS2A 5FJ8G 1VQEA 3I7FA 2E5LQ 1CSQA 2MFIA 4QJFA 4AQYL 2RHQB 1WI5A 2WB1G 3I55A 3S1RH 3T1YQ 4DKAC 1NY4A 2N8NA 1PV4A 4WJ3M 2NZOA 1LM0A 2EIFA 2R92G 2JA8H 2VUMG 4LF9L 4DNIA 1KRSA 3KJPA 4HJ7A 3I4MH 4A3MG 4A4IA 2ALYB 4RMFA 2OQ0A 3PV0A 2K14A 1YI2A 4UP9A 3RLNA 5IE8A 4JI0Q 4DV7Q 4DAMA 3RN5A 2CWPA 4LFCL 1X9NA 1IBKL 1I6HH 3HFZB 5IY0A 2ZJQA 5IWAL 4JI8Q 1Y1VG 1IL2A 1EQRA 1SE8A 2R93G 1VQNA 1S3OA 2ZJRA 4JI5L 2Q2TA 1D8LA 2Y0SG 3MEFA 4JG2A 3D31A 4C3JH 1K73C 2KBNA 5IYDH 1VQLA 4A3BG 5H1SE 1E3PA 1EIFA 3ER0A 1E24A 4IPDA 4LFBQ 1TWCH 3M4PA 2UUBQ 2YTYA 5M5XH 1N33Q 1FJGQ 1IZ6A 3PIPA 3KF6B 1AE2A 3D0FA 4QGUA 4NXNQ 1X55A 1T9HA 1JJ2A 4B3RL 5LMUQ 1QZGA 5FJ8H 4C3IH 4PZ6A 4KHPL 5LMNW 2ZJPA 1IBLQ 2JA6G 4OWWB 1E1TA 3EIVA 2R7DA 3STBC 4DUYL 4GKKQ 3KYHC 2B29A 4LF4Q 2K50A 1SMXA 2R92H 5JJKA 4OXPA 1EUJA 3F2BA 5IT9c 2VUMH 3DM3A 3ULPA 1SN8A 5C0XI 1VQGA 1X65A 3FP9A 4A3MH 2UXCL 3ULLA 1I5FA 4P75A 4HIMA 1BBWA 3PUYA 2OWOA 4JI3L 3J7ZC 1DGSA 1JJCB 3OTOL 3L0OA 4IOAA 1BVSA 1VCIA 1YBYA 4L5QA 1EQQA 3AYHB 4GKJL 2R93H 4JI2Q 1HZCA 2NN6G 4DV2Q 1JE5A 1VQMA 1K8GA 2VQEQ 5M5WH 4A3DG 2JEBI 2KENA 1YITA 4DV4Q 1Q81C 4A3BH 1IBMQ 2JQOA 2NVTH 3HKZE 3U4ZA 1VQBA 3VDYA 2UUCL 1IXRA 1YVCA 1XNRL 2PI2A 3TREA 3KF8B 1GD7A 4IJHA 2ZM6L 2WFWA 5ELOA 4POFA 2F52A 1HNWQ 4DK6C 4YWKA 1VQIA 1JT8A 4X66Q 1LYLA 5C0XJ 2UU9Q 3S16H 3U4VA 1IYJB 1RIPA 1PH5A 2Z6KC 5JJLA 5C3EG 1I50H 3SGIA 2QGQA 3U50C 1VQHA 1EYGA 3HOXG 1JJGA 2I5LX 1J5EL 1KAWA 4O0AA 3J81c 2JA6H 1OXSC 4P72A 5GQOA 4NPSA 3CCRA 1VQPA 2HHHL 3PF4A 3UE0A 4DV0Q 1QVGA 2K5NA 4JI7Q 4PZ8A 3G6EA 2KHJA 4L5RC 1OXXK 2CQOA 2N3SA 4EX5A 4BBSG 1WJJA 4H02A 3UDXA 3CCLA 4HJ9A 1N34L 3S1MH 4DR3Q 1H95A 3S15H 4XIGS 2WB1E 1YZ6A 4DV3Q 5IYCG 1VQ9A 4UY8C 4R4OA 4A3JH 1Y1WG 2JK8A 4X65L 3M7NA 1TWAH 4GLXA 2JA8G 4BA2I 4PG3A 2HT1A 1N9WA 4LUOA 4IPGA 1VQ8A 2UXDL 3HKZG 2HIXA 4X64L 4A3DH 2K52A 5J3BA 2AKWB 4X62L 1QVFA 4UP8A 5BR8Q 3PF5A 1G291 2PMZE 3A0JA 3PCOB 2E2JH 4BBRG 1ASZA 4B3SL 3HOVH 4JV5Q 2VNUD 1KHIA 1XPOA 1VQ4A 4DR6L 1AE3A 4O2DA 4AQYQ 5HY6A 3PUWA 2YV5A 2Y0SE 4MTNA 3CC2A 3ULJA 5C0XG 5C3EH 4B3TL 2VY3A 4BY1H 4DPGA 3JAMc 1C9OA 1BBUA 1N36L 3HOXH 3GTQH 2MQHA 1D7QA 1V1QA 2K5VA 1Q12A 4YWLA 3M85A 4JI1L 1WOCA 2ES2A 4DAYB 1MKHA 5AJ3Q 3S2DH 5JJIA 4BBSH 3E9IA 2UUAL 3CCVA 1IBKQ 2EXDA 3ICEA 5JEAJ 3PUZA 4DR5Q 4LUZA 4XTCS 4JOIA 3UDIA 5IYCH 1VQOA 4DV6Q 2OTJA 1I94Q 1Y1WH 1VQKA 1SR3A 4JBWA 2OQKA 5LMNQ 2V1CC 1HZBA 4OWXB 2C35B 3OYYA 1YHBA 4HIDA 1XMOQ 1PH6A 4DV1L 4DR7L 2L15A 4DR4L 3GTGH 1HJPA 3GDEA 4C3HH 1S40A 1MJEA 4BXXH 3RNUA 1EFWA 4DR2L 2RF4A 3CCSA 2F4VL 2UXBL 4YCUA 2K4KA 2A1AA 1KC8C 4B3RQ 1Q8KA 3T1HQ 4BBRH 2BH2A 1HNZL 4JYAQ 2IY5B 2BH8A 2Q2UA 1YEZA 1HR0L 4QQBX 2JE6I 2I5MX 1XNQL 1VQDA 2IHFA 3L2PA 3GTOH 2I5HA 1HZ9A 1VQCA 2PNHA 1UE7A 3CPFA 4DUYQ 1N8RC 3HOYH 1G6PA 4JI6L 4LF6L 1NMGA 2JA7H 3K7UC 4LF7Q 3BU2A 3H3VI 3HOZG 4YHHL 5M3MG 3T1YL 3CCJA 1OXVA 3KLWA 2UXCQ 1EOVA 1K0RA 1PFSA 4R4CA 2YU9H 1BKBA 3CQZH 3M3YH 4GNXB 1G51A 4JI3Q 1HR0W 3CC4A 3UE1A 4IO9A 2A19A 4DUZQ 4GS3A 3K81C 4GKJQ 2IT1A 5JEAG 2BA0A 3NELA 2WAQE 4JCVE 4LNQA 2ATWA 1TWFH 3RLFA 4YY3Q 4JI0L 1YJWA 2IX0A 3M4QA 4DV7L 1PA6A 2VL6A 4LF8L 5FLXc 2B63G 4DK3C 4X6AH 2UUCQ 5GAGC 4JI8L 1QZHA 1Q82C 4GNXC 3W1BA 3GTJH 3I2ZA 1QUQA 4DR1L 3STBD 4A3JG 5E7NA 3MXNB 1V43A 3A74A 4BA1I 1NJIC 2ZTDA 3S17H 3PO3H 1E1OA 4GNXA 4ME3A 1C0AA 4QIWE 3H0GG 3I4NH 2GN5A 4GLAC 1XJVA 3F1ZA 1NBWA 4GN3B 2N49A 2NZHA
chains in the Genus database with same CATH superfamily
1CSPA 2EYMA 4HIKA 1N33L 2AWNA 1SJHD 3K58A 3I8ZA 1ICFB 3D4RA 1YNJD 4IPCA 3HOVG 2NVXB 4A3KB 2HIVA 2L55A 3PIO3 3NK9A 4BY1G 2QEJC 2K32A 3EROA 5ISRA 1PYBA 2CQAA 5LL6X 3ND9A 1X56A 1J6QA 1RF2D 1E7ZA 4OEMB 1TY2A 5JEAH 2UXDQ 4UPAA 5JAVA 4OGQC 1CI3M 3OW7A 4HJ8A 1S5ED 4IFDJ 4DAPA 2NVXH 3UI2A 4A3KH 5K36G 2VQEL 2A6ED 1S4ZA 4FYDA 1FR3A 2FHTA 1IBML 2GVBA 1A63A 1XMQL 1W3SA 1SNDA 5I9PA 4A93G 1YNND 3RLOA 1AH9A 2VQFL 1P16A 4K0KL 2UU9L 1L1OA 3NQTA 4JC0A 2ZXOA 5HGQA 1OXUA 5IOCA 1PDQA 4ID6A 4DN4M 4AYBG 1PH3A 3HRZC 1KXLA 4A93B 3RZOB 4V0BA 2JA7G 1K28A 2PW7A 5IP9H 1UWVA 5ELNA 3S1QB 1VQ5A 2WP8J 2AUJD 5C4ZA 1UE5A 3IFTA 2B2WC 2B8GA 4NP5A 4LFCQ 5NUCA 1UEAB 4ZQ3A 3HOWG 1OXTA 2A6HC 1NE3A 3S1NH 1SFOH 3SE0A 5CV4A 5K36H 3CCUA 5CGKA 4OO1G 3U58A 1B53A 4IFDG 1FNVA 4QB4A 5IP7H 3H3VH 1YJNA 1UE6A 3D4DA 5C6AA 2KOLA 4A93H 3RZOH 3PO3G 5JOBA 1O7YA 1LTTD 1JR0D 2LXJA 3KFUA 3I4LA 4YHHQ 2H1EA 2XVSA 4LWCA 3S1QH 2D0OA 1XYIA 3KDFA 1I4PA 3CRKC 1IL8A 1BBXC 2B2YA 4QF4A 1C8CA 3HP3A 3NBIA 1S5FD 4OX9L 2K5HA 3MC0B 5CV7A 2KA7A 3DM1A 5IGBA 2OF1A 3EVQA 4RGNA 1A6XA 3N6RA 4C1NI 4TVAB 5GAHC 3HOWH 2QILA 1B3QA 3CKIB 1EOTA 3NBHB 3VYTA 2SNSA 2PQEA 3I90A 4KMUC 4OO1H 2F3IA 4IFDH 1M90C 2KVMA 3C1EA 2FMMA 1QWYA 5KIXA 2QDBA 1D2BA 5M3FG 2F0GA 2GVAA 4L5SA 1FVIA 2ZXRA 1IKMA 1QCBD 3SK6A 3MTSA 3U9SA 1EIHA 5ELCA 1A0IA 1GUSA 3I72A 3NENA 2HQLA 3KF6A 1PH7A 1WFQA 2KCMA 4YIJA 3JAMi 1VQFA 3Q22A 1IBLL 2D5DA 1Q1BA 2JA6B 1SYGA 1A8VA 3PUXA 4DUZL 2D2CC 4GKKL 4UP7A 1A2TA 2NBFA 1B2TA 1EY5A 3IFDA 4AYBE 3E0JA 5DAUA 2WIIB 3BZKA 3K5OA 3ZYYX 3AB9A 3E9HA 4X62Q 1JE4A 4A76A 1H9SA 2MUYA 4L5TA 2QF7A 3RZDB 2CFMA 4KK7A 2YTXA 5M3FH 2M9VA 4X3UA 4DV4L 4DR6Q 3I70A 1TWGH 1PH8A 3R3OA 4NMZA 2ENBA 1K8AC 4DV5Q 1X6OA 3FKIG 5GAEC 3LGJA 2EY6A 3EBEA 1RCVD 4EQ5A 2R7ZG 2UUAQ 2J7ZA 4LF5Q 1XTCD 3RZDH 2F0OA 4LW1A 3TZDA 2LKVA 3HG9A 3OW2A 1SEBD 3FKIB 3HS0C 4NXML 1HTPA 5JVG3 1WTPA 1B9NA 4HMJA 1CKOA 2XTIA 4ABNA 1YIJA 4XQQA 2BE5C 4AIMA 2CKZB 2ZT9C 1O7LA 2UXBQ 1Y1WB 2DJFC 3DLLA 3UDGA 3BVMA 4FXKC 1PH9A 2I46A 2ICEC 4F8MA 1ENCA 1J9OA 4C3HB 3BZCA 1D5ZC 3RR5A 3B6YA 1EIYB 1H9KA 2NN6I 5DM73 3K0YA 3FKIH 3P75A 5FJ8G 2E5LQ 1WI5A 2O2LD 3GTOB 4MTKA 1WD1A 2R92G 5KEEA 2VUMG 1PTOB 4DNIA 2FINB 3VA5A 4A4IA 1TY0A 2OQ0A 2K14A 2VB2X 4HSPA 4JI0Q 1Q3LA 2KHSA 2RQXA 2CWPA 1IBKL 1LT3D 2KCNA 1LLRD 1EQRA 1PTOF 3MXPA 2R93G 1PTOC 1D8LA 4JG2A 1K73C 4FP5D 1AN8A 4A3BG 2VUMB 3T16A 1EIFA 4IPDA 2A68D 1QOHA 3KF6B 1AE2A 1PTOH 1SYDA 5FOBB 1I4QA 2L5TA 1E2VA 5FJ8H 5M5WB 4GZYC 4KHPL 1JB3A 4OWWB 3W2DA 3NP8A 1AEXA 4M8AA 1B3AA 4DUYL 4LJZC 2R92H 3O13A 1ICWA 5IT9c 1HPCA 2VUMH 3S16B 1LT6D 1VQGA 3FP9A 1NNXA 5EPKA 3J7ZC 1DGSA 4IOAA 1PYWD 4RH6A 1EQQA 3BVZA 2R93H 4I65A 5C5MA 1L0XB 5M5WH 4QMGA 1CK1A 1YITA 2E2DC 3GV6A 4A3BH 2JQOA 2R3ZA 2UUCL 1YVCA 2L4NA 5IGGA 2EVBA 5ELOA 4ZYSA 2F52A 1HNWQ 1RD9D 4DK6C 3I3CA 4X66Q 5C0XJ 3S16H 1TWAB 5BN5A 1IYJB 2Z6BA 1KNEA 1RIPA 5EPJA 1PH5A 2QDLA 3W3AA 2QGQA 1WTOA 1EYGA 1JJGA 3NTHA 3J81c 2IX3A 1OXSC 4P72A 1HUMA 3PF4A 5C3XA 4L5RC 2K5NA 2KHJA 2B2UA 3HGBA 5EKIA 2WINB 5IGFA 4I7AA 1YZ6A 2M00A 3GTQB 4R4OA 5A35A 1D5MC 1TWAH 2WAQB 4MIUA 2IWHA 1BNZA 1VQ8A 1SE4A 2WV6D 4X64L 5J3BA 1CT1D 1TKWB 1GUOA 1IHZA 3IL8A 5BR8Q 1SBBB 4S3SA 3G6EA 4K6LA 3PCOB 4JV5Q 2VNUD 4RGTA 3J81L 3A7LA 4O2DA 2WKDA 4OIKA 2YV5A 3ULJA 5C0XG 4B3TL 1H9MA 3QJYA 4DPGA 1C9OA 3GTQH 1X32A 2MQHA 1NR4A 1Q12A 1HCZA 1TIID 3CCVA 3TP5A 1TQOA 2EXDA 3A55A 3ICEA 2N55A 4DR5Q 3SDZA 1MBYA 5I4DA 4IURA 4CBVA 5KNDA 3D4WA 1VQKA 1SR3A 2FFKB 2V1CC 2F3VA 2XWBB 4DR7L 3GDEA 1S40A 4CKCA 1M8AA 5A2QE 5IT9E 2K4KA 1VMCA 4L8JA 4B3RQ 1Q8KA 2BH2A 1VF7A 4JYAQ 1TWFB 1WTVA 3TP7A 2JE6I 3PMFA 5C0XH 2IHFA 1KDCA 1G6PA 4A3GB 2HD3A 3NWSA 3BYYB 4XXEA 3EA6A 3K7UC 3QOJA 4DU9A 4LF7Q 3HOZG 5FO8B 3T1YL 1OXVA 3I4NB 1EOVA 4R4CA 2C5CA 1U9RA 2PZTA 4IO9A 2A19A 3K81C 4FXGC 2BA0A 4LNQA 2WAQE 2ATWA 1TWFH 1YJWA 2IX0A 1STYA 1TU2B 3HOZB 4LF8L 1W6KA 5FLXc 4DK3C 1U4LA 4JI8L 3Q6SA 1Q82C 3I2ZA 1IKLA 4BA1I 3VR5A 5IGEA 4GNXA 4DNTB 4ME3A 2CW0D 4X3SA 1II3A 3I4NH 1DCZA 4FF4A 2NZHA 2ICIA 1FJGL 1A3VA 2B8FA 4NB3A 3BVGA 2HHHQ 1LABA 2ASBA 1FGUA 3E3XA 3VR2A 3HOZH 1N32L 5EAYA 5EQ0A 3TRZA 3KLRA 1BDOA 1D5XC 2RCFA 1Y8OB 3FVQA 5M5YH 5FLXL 2H5XA 4GN4B 4IUTA 3Q8DA 3A5UA 3PO2B 5C3WA 1SDFA 1Q7YC 1SNOA 1FYCA 1RDPD 4PQXA 1W6JA 3AU7A 2I0QA 4ZCKA 1CM9A 1UNSA 2FJ2A 2OXPA 2JA5B 1D6EC 2AQ3B 1XTDA 1EIGA 1SNQA 3AEVA 1YHQA 4A3CG 1XPRA 1N36Q 2AMCB 3PUVA 2A69D 2WKCA 3G48A 3ZJYC 4IQZA 3K7AB 2QEXA 2KQ3A 1KDAA 3QR8A 3LWUA 4F7XA 4DK0A 1NAPA 3K5NA 4KKTA 2HCIA 4A3IG 3HOYG 4OONA 2MO0A 4JI7L 5L37A 5K5PA 1EY0A 1KABA 1STBA 4DR3L 4R4IA 4XT1B 1YHAA 1ESFA 2Z0SA 3CCEA 3PIOA 1QNUA 3K7AH 2B2WA 1EY8A 3I4MB 1GO3E 2E2IB 4XQJA 3G4SA 4P74A 3HOUG 1HR0Q 3BZDB 3T51B 4A3CH 2E2HH 3CW2C 3X3MA 1SLJA 4LUVA 1X3GA 3DMUA 4IOCA 4OL7A 1S5DD 1GVPA 1LTGD 3P20A 1AZPA 3A8IE 1R4QB 3HOUB 2F0JA 4GOPB 2IW3A 4OELB 3CHBD 4A3IH 1S5CD 4XYOA 5F2DA 2IX1A 2JXMB 3TDQA 2YYZA 4U673 2E2IH 5AJ3L 3KLSX 2H4OA 2J4XA 1X3FA 2Z8LA 3J81i 5FO9B 2BDNA 3K0XA 4IALA 3A5ZB 1QB5D 3ND8A 4GOPC 2RBMA 3OTOQ 4DV6L 1I94L 2Z4HA 1CHPD 3D6CA 4IUNA 3H91A 4PMBA 4MNOA 4KY7A 4A3MB 1XMOL 4LMQD 4CKEA 4J6HA 2F0VA 1EWIA 3HOUH 4A3EG 2NTTA 1XNRQ 1UEBA 3S9WA 4IUQA 2NVQB 3T1HL 4A3KG 1MIUA 3CRLC 2L12A 1SNCA 1WTXA 2JA9A 1TR5A 1A2UA 2F0KA 4H44C 5KNBA 2OCEA 3NBHA 3Q0AA 1I3QB 1B7YB 1S5BD 1IW7C 4A3EB 3T4AC 1KD1C 3T13A 5D3IB 3N52A 1Q8IA 5TSSA 1Z47A 5JVH3 4A3LG 1YNJC 2NVQH 5FLMG 2LXKA 3NE5B 3D6WA 4RHSA 1WD0A 5IP9G 2HCCA 1PHJA 1LTSD 1PZID 3TEHB 1XMQQ 2IPKD 1I3QH 4RGOS 4QY7A 1LTLA 2VQFQ 4A3EH 2K6AA 4YCWA 4J1MA 4K0KQ 1CKNB 4JI2L 1DYQA 4DV2L 4HSVA 4POGA 1SSOA 5AFWA 5IP7G 1NUCA 4ZK9B 2Z6KA 4XDXA 3AFQA 4ALPA 1G91A 1FNUA 1K9MC 5T1GA 2E2JB 2A6EC 2IL8A 4KD4A 2YTVA 1X3EA 3VR3A 2DUDA 1NCVA 1MSGA 5C3EB 3J80E 1QG7A 1I4RA 3VR6A 3M7GA 4A3LH 1W2BA 3GTPB 5FLMH 1JOQA 2NN6H 2F0PA 1TXYA 4IUVA 3R2IA 1SYEA 2AHOB 1PFMA 4I7ZC 3HZXA 5JPNC 4DV3L 2LS01 2LFNA 4OIJA 4OWTB 2F4VQ 4QIWB 1WTWA 2MGSA 4K5XA 1HNZQ 1PH1A 2JEAI 3HKZB 3NHHA 4JBMA 3CCQA 2MO1A 3CCMA 4DA2A 3F8TA 1XNQQ 3GTPH 1D1IA 2A6HD 4G57A 1PH2A 3K80C 2CCZA 4ZAIA 4JI6Q 3TS2A 3FMCA 4TSSA 4OX9Q 3J7AV 1QNKA 4AQYL 5CR3A 3T56B 1NY4A 4G7HC 4WJ3M 2NZOA 1LM0A 4M1UB 4HJ7A 2ALYB 4RMFA 1I4XA 4UP9A 4DV7Q 4LFCL 3M3YB 3HFZB 1STGA 1VQNA 5E3FA 3TSSA 3D31A 5H1SE 2UUBQ 1GJXA 3TZUA 1GUTA 4K2LA 2NZ1D 4ZUIA 1CFMA 3D0FA 2IJ0A 1T9HA 2HDMA 5IIFA 3J7AF 2ZJPA 1IBLQ 2JA6G 4TKOB 1E1TA 3STBC 4GKKQ 3KYHC 4LF4Q 4ZRZA 1CHQD 3F2BA 1CTMA 4Q5VA 2UXCL 2D9UA 2Z4IA 4P75A 3LNNA 1BBWA 2OWOA 1ZEQX 4HEDA 2LMCB 4R8IA 1BVSA 2XN9C 2L0CA 4L5QA 1LT4D 1XX8A 3AYHB 4GKJL 1CZWA 4K2KA 4P2CB 1JOKA 1SE2A 2JEBI 3SK4A 4KKUA 1LTBD 4DV4Q 1Q81C 3HKZE 3U4ZA 1VQBA 2PI2A 1GHKA 3KF8B 4IJHA 4H0LC 4YWKA 1VQIA 5E4WC 1LTRD 2FMCA 4HCEA 1ESRA 3KBGA 3NUCA 3J7YW 2Z6KC 5JJLA 2B2TA 4UHVA 2I5LX 1J5EL 4O0AA 2JA6H 3H09A 1EFID 4F87A 3CCRA 4R8NA 1K8OA 3VYSA 4DV0Q 2N3SA 4BBSG 3RUZA 3DXJC 4H02A 4X3KA 3UDXA 3Q23A 2RA4A 3H94A 5IYCG 3GP7A 1Y1WG 4X65L 3Q24A 1EYAA 1EWCA 4PG3A 4PMCA 1IYVA 1N9WA 4RKLA 2F4IA 2K52A 4X62L 4BBSB 4C3HG 2BOSA 2F0HA 4UP8A 3A8JE 3PF5A 4XYQA 5D3DA 1G291 3A0JA 4B3SL 1JICA 5KYIA 1XPOA 1O78A 4DR6L 2SOBA 4MTNA 2DY7A 1NSNS 2F0LA 4PV1C 3MZ5A 1D7QA 4YWLA 4JI1L 4G7OC 4LK1C 1MKHA 4BBSH 1HTLD 2UUAL 1IBKQ 4K5VA 3PUZA 4LUZA 4XTCS 4JOIA 5IYCH 1VQOA 1HFNA 4UDUC 1Y1WH 1AFPA 5LMNQ 1KAAA 1G8ZD 5KGUA 4FF1A 4OWXB 3D8GA 3OYYA 2VXWA 1DD2A 2NVYB 4DV1L 1SE3A 2YU9B 1U4RA 4C3HH 4BXXH 2F03A 4N9PA 1EFWA 3CU7A 2UXBL 3GTLB 1RJTA 3T53B 4Y7NB 1ZKOA 2LY7A 3RD4A 2B39A 2HUGA 1EEFD 3ITPA 2I5MX 3QB3A 3GTOH 2I5HA 1KDBA 4WORA 1VQCA 2K5QA 2GA4B 2QCPX 4DUYQ 1N8RC 1ILQA 4IUUA 3S17B 3H3VI 4KHVA 2EYPA 1Y8NB 5E4XA 1K0RA 4KN7C 2YU9H 2K5WA 2QW7A 5FO7B 1HR0W 3UE1A 2KEEA 4BS9A 1DXMA 2IT1A 1X3QA 4YY3Q 4JI0L 2VL6A 2X69A 4KV6A 2B63G 2UUCQ 5GAGC 1QZHA 1ENFA 1BUVT 1QUQA 3VR4A 4DR1L 5E7NA 3TBIB 1AZQA 3MXNB 3S17H 3ONAB 4FNFA 1SMYD 3DEPA 3E5SA 1F9RA 1C0AA 2K04A 3H0GG 3S14B 1XJVA 2N49A 4EVOA 2B63B 3K8AA 4MHEA 1PH4A 1QILA 1L0WA 3GD7A 4C2MB 4ZKBB 2B2TC 2CHBD 4OO1I 4IFDI 1XPUA 2ZXPA 1OTCA 1STAA 2B3GA 4WRDA 1B8AA 4DXGA 4JPBW 4MN3A 1KIXA 4A75A 3H0GB 1F2MA 4JI4L 1WVLA 3CMEA 1E22A 5A2QL 5IT9L 1K3RA 2WAQG 1JC7A 3F2DA 2EY5A 4LFAQ 5CV6A 1K3BC 3S14H 4K14A 4WFN3 1DZ1A 1G2SA 3IRBA 3OWEB 4X64Q 3SEBA 3CC7A 3J7A5 5GADC 4N9TA 2B63H 4FF2A 3A7AB 1R9TB 1I4GA 1TS4A 3MWYW 1L2FA 1HNXL 1YNXA 3H0GH 2A8VA 3OHXC 4GLVB 4OHJA 1HNWL 1STNA 4X66L 4TQUS 3ERQA 1BCPB 1KRTA 2X6GA 4PMWA 4B3ML 3PSIA 1ZXTA 3CD6A 1PRTD 1HH2P 3K5MA 2K01A 1R9TH 4Y52H 4EGVA 4RKBA 2F0FA 1A3UA 1BCPF 5DEHA 4A3FG 1BCPC 4N8X1 4LF9Q 5CORA 5IYBG 1QVCA 3S1RB 1K83B 3MHBA 2PI2E 5HGTA 2F0MA 4JOIC 1F77A 2Z1CA 1ILPA 2ZTEA 5IWAQ 5C4XB 2VZAA 4RFBA 5CC4A 3A56A 1VQAA 3WWVA 1AW7A 1VS0A 3AFPA 4JI5Q 4IPHA 2LSSA 4A3FB 1TT2A 1I6HB 1Y69U 5BR8L 4CDEC 1U5KA 3M9BA 3VA7A 4A3GG 2RDFA 1P8LA 1RHPA 3S15B 1SROA 4BY7G 1HUNA 2KCCA 3I4NG 3ERSX 1K83H 1QE6A 3W5OA 1JMCA 1GUNA 4P71A 5C4XH 3CP0A 2PO4A 1B4OA 4K8IA 4RCOA 2DGYA 1ZYRC 5IGCA 1V9PA 4A3FH 2AUKA 2IHEA 5IYBH 4BY7B 1QUQB 4LF8Q 1PVOA 1F2ZA 5KRUA 4DR5L 3TQYA 3S15H 2E8GA 3NWTA 1GKHA 1VMPA 3NXWA 2PPBC 3AMUA 1F9QA 4GOPA 1GM5A 2OTLA 1C7YA 1K8MA 2KHIA 2HDLA 4RG1A 4A3GH 2R7FA 2ZM6Q 1Y1VB 2KECA 4J8QA 5EJWA 4JYAL 4ZLTF 2Y0SB 4BY7H 1LTID 2RKSA 3EN2A 1K0SA 1N32Q 3IAYA 4HN7A 4LFBL 1M1KC 1Q86C 1IYUA 1SNPA 1PXUA 2N88A 3K5LA 4IZ8A 3V96A 4KTAA 3BS1A 4NXNL 3QOLA 3C2PA 4LF7L 3PO2G 5LMUL 5LHY1 4KI0A 2F0DA 3GO5A 1N34Q 2F0UA 2KUMA 3R8BA 1Y1VH 2B2VC 3LX0A 1HFGA 3E0EA 1HZAA 1O7IA 4GN5A 4PZ7A 1NR2A 2JA5G 3BDOA 1MHWC 2RHSB 4AH6A 1TWHB 2EYFA 5ELFA 1EYDA 1FL0A 1M4VA 2V4DA 4RGMA 2Q8TA 4IJLA 2TMPA 3MFYA 2J0TD 4RCNA 5CYUA 3SR1A 4BWGB 2KEDA 2EXZA 2Q2IA 1NMFA 5DLQE 1SYCA 1NTGA 4LF6Q 3OOCA 1EU3A 1CA6A 5D65A 4K5WA 5C5LA 4WJ4A 3SXHA 3MXUA 1TWHH 1CQVA 3PO2H 2EQSA 1MD2D 1CKNA 4JBKA 1CKMA 4XT3B 5I2XA 2A69C 4KD3A 1VQJA 1LV9A 2FXQA 3I4MG 4Q0FA 4G4KA 2VB3X 2JA5H 4JW0A 3S2DB 4DNRB 3PIP3 3WOEA 3NQIA 2XGTA 2PQAB 5M9OA 2BA1A 4APVA 4DR4Q 1F2LA 2D62A 4DR2Q 4RHRA 1ML0D 2JA8B 4ULLA 5IGDA 1RKNA 2PNRC 1U0LA 1X54A 3OSOA 3H15A 1AP0A 4KY5A 2O5IC 1DJRD 1T5XD 1GUWA 3J80c 4FXDA 3OWFA 3CMAA 1RTNA 2RSOA 1VQEA 4C3IG 4C3JB 5EKKA 2RHQB 1KTKA 4DKAC 1GOZA 1TWCB 2N8NA 1PV4A 3MEHA 2EIFA 4CDDC 1EY9A 2DY8A 2JA8H 1KRSA 3I4MH 4A3MG 4CDFC 1YI2A 3PV0A 2RDHA 3RLNA 5I9OA 5IE8A 5ELDA 4C3IB 4DAMA 3RN5A 1A15A 1X9NA 3HEJA 2ZJQA 3KUPA 3K57A 1IL2A 1DOLA 1E0BA 2O4XA 2ZJRA 3TP8A 2Q2TA 1V8QA 4C3JH 1F9PA 1T5EA 3TN2A 5E1FA 3J80L 1E3PA 1E24A 1BOSA 1TWCH 2EYLA 4KY6A 2JSOA 2YTYA 5J39A 1O7ZA 1N33Q 1IZ6A 2L11A 2JN4A 4QGUA 2EE1A 1JWUD 2BDOA 4C3IH 4PZ6A 1JORA 5LMNW 1EZ6A 3MVVA 2NVTB 5G3LD 3QO2A 2EJFC 3EIVA 5COYA 2EJGC 3A54A 5JJKA 4OXPA 2K7VA 3DM3A 2EY2A 3DWQA 4A3MH 5C0XI 5JPMC 3OIQA 3ULLA 1I5FA 4HIMA 4JI3L 3OTOL 1IW7D 1HXYD 1JQYD 3OMCA 2TSSA 4JI2Q 1HZCA 2NN6G 4DV2Q 1VQMA 1K8GA 2VQEQ 2F1MA 2KENA 1IBMQ 1XXGA 2NVTH 1BXTA 4CJ2C 1IXRA 3S1MB 1XNRL 2F0IA 1PFBA 1V1OA 3TREA 1TS2A 2WFWA 4POFA 2RVLA 5T1IA 4A3JB 1LYLA 2UU9Q 5D14A 3U4VA 5C3EG 3U50C 3HOXG 1KAWA 2K5DA 5CV8A 5GQOA 3BDLA 4NPSA 1VQPA 3HOVB 4FO2A 1GUGA 4PZ8A 3KF8A 1OXXK 2CQOA 4EX5A 3JAME 2QKIC 1EY4A 1WJJA 2JP1A 3S1MH 4BY1B 1FNWA 2XWJB 1H95A 1YNNC 4JK1C 1C48A 4DV3Q 3HOXB 4A3JH 3E6ZX 4BA2I 4LUOA 4IPGA 2UXDL 3HKZG 2HIXA 1DONA 2AQ2B 2AKWB 2PZWA 4C56C 1J8IA 3R93A 3C3LA 1G2TA 1WTHA 2E2JH 3S1NB 3PQIA 4BBRG 3K6OA 1SFOB 5DM63 2WACA 5EBCA 1ASZA 3HOVH 1TS3A 4AQYQ 1TS5A 5HY6A 4BY1H 3WOFA 5C3EH 1Z7TA 2VY3A 3HOXH 1V1QA 2K5VA 2ES2A 4DAYB 4L6TB 4CHTB 4BBRB 1QJOA 4K8JA 3TP6A 5JJIA 4B9XA 3E9IA 3H3VC 1DOKA 4R9WA 3UDIA 4AYBB 3FPPA 1EY7A 2E76C 1SNMA 3FEWX 1BO0A 4JBWA 2JA7B 4DK1A 1CQFA 3C1FA 1YHBA 3RMHA 4HIDA 1PH6A 1MI2A 1HJPA 3CQZB 4NKLA 3RNUA 2RF4A 2F4VL 3HOWB 4BBRH 1HNZL 2BH8A 4ILWA 1GXDC 2RDGA 1FD7D 1JCKB 1JOOA 4CKBA 1XNQL 4JVZA 3L2PA 2PNHA 3GTJB 3EFXD 1UE7A 3CPFA 2EZVA 2SEBD 4ZKCB 4JI6L 3PO3B 2JA7H 5KYLA 1E2WA 2F0NA 3BU2A 1O80A 4YHHL 5M3MG 2UXCQ 3F2UA 1B9MA 1PFSA 5BN3A 1BKBA 3CQZH 3M3YH 1G51A 3CC4A 4DUZQ 4GS3A 4GKJQ 1F2YA 3NELA 3OMGA 3RLFA 3M4QA 4DV7L 1PA6A 2EOTA 1JWSD 1LT5D 1ENAA 1LTAD 5M3MB 1JWMD 2L9HA 1STEA 5I6YA 3P7JA 3W1BA 2O5JC 3GTJH 1DM0B 1PMRA 3STBD 3PO3H 3A74A 1E1OA 4QIWE 2GN5A 4GLAC 1PFNA 4QUCA 4GN3B 1WYDA 2UUBL 5FK9C 1D1KA 1J5EQ 3CAMA 1S72A 3EQLC 5C4JB 1B70B 3KOJA 2MP1A 3GTKB 1Y14B 5IODA 3I73A 4L63B 4G7ZC 5M3FB 4KJNA 3KJOA 2F0EA 1KLGD 2D0PA 3MXNA 4PNYA 4X3TA 4DFAA 5M3MH 5ELBA 1TWGB 1KLUD 2JYOA 3J80i 3J81j 4LF4L 2CVRA 1HHVA 4X65Q 3QWNA 3V05A 3SK5A 5DNFA 3LWEA 4NXMQ 1STHA 2I07B 1L1OB 3S2HB 4R4TA 4TRDA 1LUZA 2A5HA 1H9RA 2SDFA 3UDFA 5C4JH 3GTKH 4ZUJA 4B3SQ 4DGZA 4V190 3SK8A 4HJAA 2AQ1B 4LAAA 1WCMG 1PZKD 1L1OC 3FHWA 3X3NA 3W1GA 4BXXG 1L0YB 4J15A 3M4OB 1ET6A 3S24A 4JI1Q 2P5ZX 2NUCA 4P73A 1CZGA 3FPUB 3S2HH 1Q46A 2ZTCA 1A62A 1WCMB 2VW9A 2OT2A 4DV5L 2BE5D 1Q90A 4DV0L 4H7BA 2K33A 3TS0A 4EQPA 1VQ6A 1HA5A 1UAPA 1Z9FA 2G9HD 4DV1Q 2R7ZB 2C9OA 4LF5L 3M4OH 4YCVA 1ASYA 4ODGA 3R2TA 3KDFB 4DF7A 5ELEA 3PGZA 4KLKA 4HJ5A 2EJMA 1KL9A 2PZUA 1WCMH 1HQMC 4QUFA 3URYA 1YJ9A 2CWAA 1VF5C 2E74C 2L1BA 4HTHA 2CH4W 1B1ZA 3EJIA 3CXCA 2F0SA 5I2YA 2NWGA 2B2YC 5CV5A 2R7ZH 2F3WA 2X6LA 4O42A 4KHPQ 3HKSA 1I6VC 5JJZA 1OO9B 3DHQA 4KHZA 5C44G 1UE1A 2JJQA 2A73B 2XNAC 1RL2A 5CBEE 2K1BA 1JB7A 1PTOD 3QIAA 2Q2HA 2E5LL 2XRQD 2NVYH 3F2CA 3WDNA 2HQEA 2A68C 3G6JB 4FF3A 1VQ7A 3D3RA 2VS1A 3AQQA 4DR1Q 4R4QA 2DJGC 3GTLH 2R92B 5C44B 5LMNL 3I56A 5CMDA 4Y7NH 3I4OA 3KK7A 2R6GA 1UUPA 4HMIA 3L7ZC 3G71A 2R93B 4MZ9A 1WTRA 4JBJA 3FDTA 5EKLA 5GROA 4A3BB 4JI4Q 1PYSB 2G5DA 3BG3A 1EQVA 2MHVA 2XIWA 5C44H 1SMYC 4NDXA 1Q1EA 1DOMA 1H9SB 2K28A 1SRUA 3DEOA 2ID0A 4CDCC 1LACA 3NEMA 1WTQA 3GV3A 4YY3L 2B2VA 1HNXQ 3GTMB 1HQRD 1CUKA 1FGBD 1KNAA 1LO5D 1SAPA 2Q8IB 4C2MH 1A3TA 4FDBA 5I6WA 3BYTB 1SJED 4HIOA 4QL5A 3RN2A 4B3MQ 4YWMA 2RSNA 4B3TQ 2BCOA 2K75A 2MNAA 1PRTB 2RCNA 3CPWA 1KQSA 1I4HA 3GTMH 2A74C 4RAUC 1V1PA 5FKAC 5C4XG 1PZJD 2N78A 4LFAL 1VDZA 4IUPA 3CF5A 4K6DA 1PRTF 1R4PB 1PRTC 4HCSA 3BJUA 4DR7Q 4EQOA 3L3OC 2QA4A 5IYDG 1BCPD 1MJCA 4R1JA 3JC66 3FRPB 2AWOA 4IN3A 4JV5L 2PQAA 2KCTA 1BR9A 3I7FA 1CSQA 2MFIA 2KJXA 4QJFA 3I55A 3S1RH 2WB1G 5EBDA 3L9AX 3T1YQ 3OPOA 2Z9HA 2F0QA 5M5XB 2PW5A 3U9OA 2CH4A 4FVMA 3KJPA 4LF9L 5EGTA 5KNCA 3I91A 1I6HH 2NTSA 2WB1B 2EYOA 5IY0A 5IWAL 4JI8Q 1Y1VG 2PCFB 1SE8A 4CJ1B 1S3OA 3QG1A 1ZYRD 2OEOA 4JI5L 2Y0SG 3MEFA 4CJ0B 2KBNA 5IYDH 2EPBA 1VQLA 5CV9A 3ER0A 4LFBQ 2XSCA 3M4PA 5M5XH 4WJWA 1FJGQ 1H9JA 3SVMA 3PIPA 2PMZB 3DWPA 1RTOA 4NXNQ 1X55A 1EZ8A 1JJ2A 4B3RL 1HA6A 1U4PA 2NYZD 5LMUQ 1QZGA 1TVXA 3M4YA 1EL0A 1EY6A 2R61A 2R7DA 1GHJA 1EWHA 2B29A 4HAEA 2K50A 1SMXA 4NW2A 5LL6S 3MAQA 4KJOA 4N8FA 1EUJA 2CW0C 2PYKA 3ULPA 3J81E 1SN8A 3V2TA 1X65A 1EU4A 1X3PA 2NB0A 1I50B 3PUYA 5EPLA 3MA2B 3KBXA 1JJCB 3L0OA 2M2LA 4H13C 4KKSA 1VCIA 5M5YB 2SNMA 1YBYA 4KN4C 1F9SA 1JE5A 1G6ZA 4A3DG 3K59A 2DNEA 4QCLA 2DNCA 3MXGA 3VDYA 4ME5A 2EYJA 2ZM6L 1GD7A 3SHLA 1JT8A 2MPMA 3C46A 3VYUA 3VYRA 1EQTA 1V1PB 1SYBA 1I50H 3SGIA 3NSWA 1VQHA 4A3DB 4B08A 4CGYB 3A8KE 2B2UC 1PLFA 2HHHL 1ONLA 3MFGA 3UE0A 1SYFA 1QVGA 4JI7Q 1U4MA 5CBAE 3CCLA 4HJ9A 1MGSA 1N34L 4DR3Q 4XIGS 4HR7B 2WB1E 3H6MA 1VQ9A 4UY8C 4RWSC 2E75C 1MSHA 2JK8A 3M7NA 4GLXA 2JA8G 2HT1A 4RA8A 4EQNA 3G7LA 1E2ZA 2MJ8A 5J1ZA 4A3DH 4U68A 1QVFA 1HRJA 3DUZA 4C1NK 2PMZE 3NTIA 3IKJA 4C3JG 1KHIA 1VQ4A 1AE3A 3PUWA 3CC2A 2Y0SE 4Z9CB 2F0WA 4LF6L 3JAMc 1BBUA 1N36L 3GTGB 2E2HB 2EY1A 3M85A 1WOCA 3DWAA 5AJ3Q 3S2DH 5BN4A 1Z6HA 5JEAJ 4DAVA 3BDCA 5J22A 3OIPA 4A3IB 4DV6Q 3HOYB 1I94Q 2OTJA 2G9DA 5C4HA 2OQKA 1HZBA 2C35B 1BQQT 1B44D 3GQBA 4B9WA 1XMOQ 4DAYA 2L15A 3KLSA 4DR4L 3GTGH 1MJEA 3TMEA 2XRSD 3NTKA 4DR2L 3CCSA 1Y8PB 4YCUA 1XWEA 2A1AA 1KC8C 3JAML 5FLXE 3T1HQ 2IY5B 2Q2UA 1YEZA 1HR0L 4QQBX 4XQNA 1VQDA 5HURA 3NPPA 1HZ9A 3HOYH 1RODA 1NMGA 4O1NA 2F0TA 2K03A 3CCJA 3KLWA 4UAIA 4GNXB 4JI3Q 4E6IA 1CA5A 1BF4A 2K05A 5JEAG 4JCVE 4DXFA 5G3LF 2Q8RE 1EEID 1SXTA 2DN8A 4X6AH 1C4QA 1ET9A 4F88A 4GNXC 4A3JG 1EYCA 2EYHA 3P1HA 1V43A 1NJIC 2ZTDA 2EDGA 1B50A 3F1ZA 1NBWA
chains in the Genus database with same CATH topology
1CSPA 4HIKA 1N33L 2AWNA 1J5EQ 1FJGL 3CAMA 4NB3A 1S72A 3K8AA 1B70B 3KOJA 1PH4A 1Y14B 1L0WA 3HOVG 4IPCA 2HHHQ 3GD7A 2ASBA 4OO1I 4IFDI 2HIVA 3KJOA 1XPUA 1OTCA 1FGUA 2B3GA 3HOZH 1N32L 2D0PA 1B8AA 5EAYA 4BY1G 5M3MH 1KIXA 4A75A 3TRZA 1PYBA 4JI4L 3J80i 1X56A 1J6QA 3J81j 3CMEA 1E22A 1K3RA 4LF4L 2WAQG 5M5YH 3F2DA 4X65Q 1E7ZA 2H5XA 4GN4B 4LFAQ 3S14H 3Q8DA 3A5UA 2UXDQ 4UPAA 4NXMQ 3IRBA 1Q7YC 4X64Q 3CC7A 3J7A5 1L1OB 5GADC 2B63H 4HJ8A 4R4TA 1LUZA 5C4JH 3UDFA 3GTKH 4IFDJ 2NVXH 4B3SQ 2I0QA 4A3KH 5K36G 2VQEL 2UUBL 1L2FA 4HJAA 1HNXL 1XTDA 2GVBA 1IBML 1A63A 1YNXA 1WCMG 3H0GH 1XMQL 1W3SA 2A8VA 3AEVA 1L1OC 3FHWA 1YHQA 3W1GA 4BXXG 1XPRA 4GLVB 1N36Q 3RLOA 4A3CG 2AMCB 4A93G 3PUVA 4J15A 3ZJYC 3G48A 2VQFL 1P16A 1HNWL 3S24A 1AH9A 4X66L 4K0KL 2UU9L 1L1OA 4JI1Q 4JC0A 2QEXA 4TQUS 4P73A 1KRTA 5HGQA 4PMWA 4B3ML 1OXUA 3PSIA 3CD6A 1HH2P 1Q46A 3S2HH 2ZTCA 1A62A 1R9TH 4AYBG 1PH3A 4Y52H 2VW9A 4DV5L 4A3IG 3HOYG 4OONA 1KXLA 2MO0A 4DV0L 4JI7L 2JA7G 4A3FG 3TS0A 4LF9Q 5IYBG 5IP9H 1UWVA 5ELNA 1VQ6A 1QVCA 1Z9FA 1VQ5A 2WP8J 2PI2E 4DR3L 4R4IA 4DV1Q 4JOIC 1UE5A 1YHAA 4LF5L 4LFCQ 2Z0SA 2ZTEA 3CCEA 3M4OH 5IWAQ 3PIOA 2VZAA 3HOWG 4YCVA 1VQAA 3K7AH 1OXTA 3WWVA 1NE3A 1ASYA 3S1NH 1VS0A 3KDFB 1SFOH 3AFPA 4JI5Q 1GO3E 3CCUA 4OO1G 4IPHA 3G4SA 3PGZA 4KLKA 2LSSA 4HJ5A 3U58A 4IFDG 4P74A 3H3VH 5IP7H 1HR0Q 3HOUG 1KL9A 1YJNA 1WCMH 1UE6A 5BR8L 1U5KA 3M9BA 1YJ9A 4A3GG 2CWAA 4A3CH 2E2HH 3CW2C 4A93H 3RZOH 1P8LA 3PO3G 1SLJA 4LUVA 1SROA 1X3GA 3CXCA 4IOCA 4BY7G 2LXJA 3KFUA 3I4NG 4YHHQ 3ERSX 1K83H 4LWCA 1GVPA 3S1QH 2D0OA 3W5OA 1JMCA 3KDFA 2R7ZH 4KHPQ 3HKSA 4P71A 5C4XH 4KHZA 4GOPB 5C44G 1UE1A 2JJQA 3CP0A 1RL2A 2DGYA 4A3IH 2IX1A 2YYZA 2E2IH 4OX9L 2K5HA 1JB7A 1V9PA 2Q2HA 5AJ3L 4A3FH 2IHEA 2E5LL 5IYBH 1X3FA 1QUQB 3J81i 4LF8Q 2NVYH 3K0XA 3F2CA 1PVOA 4DR5L 3A5ZB 3TQYA 1VQ7A 4GOPC 2VS1A 3OTOQ 3AQQA 2E8GA 4R4QA 4TVAB 1GKHA 4DV6L 4DR1Q 1I94L 3GTLH 5GAHC 3HOWH 5LMNL 3I56A 3NBHB 4Y7NH 3I4OA 4GOPA 1GM5A 2R6GA 4MNOA 2OTLA 1XMOL 1C7YA 2F3IA 3L7ZC 1M90C 2KHIA 1EWIA 3HOUH 3G71A 4A3EG 4RG1A 1XNRQ 1UEBA 4A3GH 2R7FA 2ZM6Q 3T1HL 4A3KG 1MIUA 4MZ9A 5M3FG 4JYAL 2JA9A 2GVAA 4JBJA 4L5SA 4BY7H 3EN2A 1N32Q 5GROA 4LFBL 1FVIA 1M1KC 2OCEA 4JI4Q 1PYSB 1Q86C 1B7YB 5C44H 1A0IA 4NXNL 4LF7L 1KD1C 3NENA 3PO2G 2HQLA 3KF6A 5LMUL 1PH7A 1WFQA 2KCMA 1WYDA 1Q1EA 4KI0A 3JAMi 1VQFA 3GO5A 1IBLL 1N34Q 1Q1BA 1A8VA 1SRUA 1Z47A 3PUXA 4A3LG 4DUZL 1Y1VH 2NVQH 4UP7A 5FLMG 2ID0A 4GKKL 2LXKA 3E0EA 1HZAA 1O7IA 4GN5A 4PZ7A 3NEMA 2JA5G 4AYBE 4YY3L 2RHSB 5IP9G 4AH6A 1PHJA 1HNXQ 3BZKA 1FL0A 3TEHB 1XMQQ 4IJLA 3E9HA 1I3QH 4X62Q 4A76A 1CUKA 4QY7A 1LTLA 2VQFQ 4A3EH 4L5TA 4YCWA 4K0KQ 1CKNB 4C2MH 4JI2L 2CFMA 4FDBA 4DV2L 4HIOA 4QL5A 2YTXA 2Q2IA 5M3FH 1NMFA 4POGA 5DLQE 3RN2A 4B3MQ 4DV4L 4DR6Q 5IP7G 1NTGA 1TWGH 4YWMA 1PH8A 4LF6Q 4B3TQ 2Z6KA 3AFQA 4ALPA 1K8AC 4DV5Q 2K75A 1X6OA 1K9MC 3FKIG 4WJ4A 5GAEC 3LGJA 1TWHH 2MNAA 3EBEA 3PO2H 2EQSA 2RCNA 2YTVA 1X3EA 3CPWA 2DUDA 1CKNA 4EQ5A 1KQSA 2R7ZG 4JBKA 1CKMA 3GTMH 2UUAQ 4LF5Q 5C4XG 3RZDH 1VQJA 4A3LH 2N78A 4LW1A 4LFAL 1W2BA 2FXQA 3OW2A 3I4MG 5FLMH 3CF5A 4NXML 2JA5H 1TXYA 1CKOA 2XTIA 2AHOB 2XGTA 3BJUA 4DR7Q 1YIJA 2PQAB 2BA1A 4APVA 4DR4Q 4AIMA 4DV3L 2CKZB 2D62A 2QA4A 4DR2Q 4OWTB 2F4VQ 2UXBQ 5IYDG 3DLLA 1MJCA 3UDGA 4R1JA 1U0LA 1HNZQ 1X54A 1PH1A 3H15A 2JEAI 4JBMA 1PH9A 3CCQA 3JC66 2MO1A 3CCMA 3BZCA 2AWOA 3F8TA 1XNQQ 3RR5A 3J80c 3B6YA 1EIYB 2NN6I 3GTPH 4JV5L 1PH2A 3K80C 2PQAA 3FKIH 2CCZA 4JI6Q 3CMAA 4OX9Q 2KCTA 3TS2A 5FJ8G 1VQEA 3I7FA 2E5LQ 1CSQA 2MFIA 4QJFA 4AQYL 2RHQB 1WI5A 2WB1G 3I55A 3S1RH 3T1YQ 4DKAC 1NY4A 2N8NA 1PV4A 4WJ3M 2NZOA 1LM0A 2EIFA 2R92G 2JA8H 2VUMG 4LF9L 4DNIA 1KRSA 3KJPA 4HJ7A 3I4MH 4A3MG 4A4IA 2ALYB 4RMFA 2OQ0A 3PV0A 2K14A 1YI2A 4UP9A 3RLNA 5IE8A 4JI0Q 4DV7Q 4DAMA 3RN5A 2CWPA 4LFCL 1X9NA 1IBKL 1I6HH 3HFZB 5IY0A 2ZJQA 5IWAL 4JI8Q 1Y1VG 1IL2A 1EQRA 1SE8A 2R93G 1VQNA 1S3OA 2ZJRA 4JI5L 2Q2TA 1D8LA 2Y0SG 3MEFA 4JG2A 3D31A 4C3JH 1K73C 2KBNA 5IYDH 1VQLA 4A3BG 5H1SE 1E3PA 1EIFA 3ER0A 1E24A 4IPDA 4LFBQ 1TWCH 3M4PA 2UUBQ 2YTYA 5M5XH 1N33Q 1FJGQ 1IZ6A 3PIPA 3KF6B 1AE2A 3D0FA 4QGUA 4NXNQ 1X55A 1T9HA 1JJ2A 4B3RL 5LMUQ 1QZGA 5FJ8H 4C3IH 4PZ6A 4KHPL 5LMNW 2ZJPA 1IBLQ 2JA6G 4OWWB 1E1TA 3EIVA 2R7DA 3STBC 4DUYL 4GKKQ 3KYHC 2B29A 4LF4Q 2K50A 1SMXA 2R92H 5JJKA 4OXPA 1EUJA 3F2BA 5IT9c 2VUMH 3DM3A 3ULPA 1SN8A 5C0XI 1VQGA 1X65A 3FP9A 4A3MH 2UXCL 3ULLA 1I5FA 4P75A 4HIMA 1BBWA 3PUYA 2OWOA 4JI3L 3J7ZC 1DGSA 1JJCB 3OTOL 3L0OA 4IOAA 1BVSA 1VCIA 1YBYA 4L5QA 1EQQA 3AYHB 4GKJL 2R93H 4JI2Q 1HZCA 2NN6G 4DV2Q 1JE5A 1VQMA 1K8GA 2VQEQ 5M5WH 4A3DG 2JEBI 2KENA 1YITA 4DV4Q 1Q81C 4A3BH 1IBMQ 2JQOA 2NVTH 3HKZE 3U4ZA 1VQBA 3VDYA 2UUCL 1IXRA 1YVCA 1XNRL 2PI2A 3TREA 3KF8B 1GD7A 4IJHA 2ZM6L 2WFWA 5ELOA 4POFA 2F52A 1HNWQ 4DK6C 4YWKA 1VQIA 1JT8A 4X66Q 1LYLA 5C0XJ 2UU9Q 3S16H 3U4VA 1IYJB 1RIPA 1PH5A 2Z6KC 5JJLA 5C3EG 1I50H 3SGIA 2QGQA 3U50C 1VQHA 1EYGA 3HOXG 1JJGA 2I5LX 1J5EL 1KAWA 4O0AA 3J81c 2JA6H 1OXSC 4P72A 5GQOA 4NPSA 3CCRA 1VQPA 2HHHL 3PF4A 3UE0A 4DV0Q 1QVGA 2K5NA 4JI7Q 4PZ8A 3G6EA 2KHJA 4L5RC 1OXXK 2CQOA 2N3SA 4EX5A 4BBSG 1WJJA 4H02A 3UDXA 3CCLA 4HJ9A 1N34L 3S1MH 4DR3Q 1H95A 3S15H 4XIGS 2WB1E 1YZ6A 4DV3Q 5IYCG 1VQ9A 4UY8C 4R4OA 4A3JH 1Y1WG 2JK8A 4X65L 3M7NA 1TWAH 4GLXA 2JA8G 4BA2I 4PG3A 2HT1A 1N9WA 4LUOA 4IPGA 1VQ8A 2UXDL 3HKZG 2HIXA 4X64L 4A3DH 2K52A 5J3BA 2AKWB 4X62L 1QVFA 4UP8A 5BR8Q 3PF5A 1G291 2PMZE 3A0JA 3PCOB 2E2JH 4BBRG 1ASZA 4B3SL 3HOVH 4JV5Q 2VNUD 1KHIA 1XPOA 1VQ4A 4DR6L 1AE3A 4O2DA 4AQYQ 5HY6A 3PUWA 2YV5A 2Y0SE 4MTNA 3CC2A 3ULJA 5C0XG 5C3EH 4B3TL 2VY3A 4BY1H 4DPGA 3JAMc 1C9OA 1BBUA 1N36L 3HOXH 3GTQH 2MQHA 1D7QA 1V1QA 2K5VA 1Q12A 4YWLA 3M85A 4JI1L 1WOCA 2ES2A 4DAYB 1MKHA 5AJ3Q 3S2DH 5JJIA 4BBSH 3E9IA 2UUAL 3CCVA 1IBKQ 2EXDA 3ICEA 5JEAJ 3PUZA 4DR5Q 4LUZA 4XTCS 4JOIA 3UDIA 5IYCH 1VQOA 4DV6Q 2OTJA 1I94Q 1Y1WH 1VQKA 1SR3A 4JBWA 2OQKA 5LMNQ 2V1CC 1HZBA 4OWXB 2C35B 3OYYA 1YHBA 4HIDA 1XMOQ 1PH6A 4DV1L 4DR7L 2L15A 4DR4L 3GTGH 1HJPA 3GDEA 4C3HH 1S40A 1MJEA 4BXXH 3RNUA 1EFWA 4DR2L 2RF4A 3CCSA 2F4VL 2UXBL 4YCUA 2K4KA 2A1AA 1KC8C 4B3RQ 1Q8KA 3T1HQ 4BBRH 2BH2A 1HNZL 4JYAQ 2IY5B 2BH8A 2Q2UA 1YEZA 1HR0L 4QQBX 2JE6I 2I5MX 1XNQL 1VQDA 2IHFA 3L2PA 3GTOH 2I5HA 1HZ9A 1VQCA 2PNHA 1UE7A 3CPFA 4DUYQ 1N8RC 3HOYH 1G6PA 4JI6L 4LF6L 1NMGA 2JA7H 3K7UC 4LF7Q 3BU2A 3H3VI 3HOZG 4YHHL 5M3MG 3T1YL 3CCJA 1OXVA 3KLWA 2UXCQ 1EOVA 1K0RA 1PFSA 4R4CA 2YU9H 1BKBA 3CQZH 3M3YH 4GNXB 1G51A 4JI3Q 1HR0W 3CC4A 3UE1A 4IO9A 2A19A 4DUZQ 4GS3A 3K81C 4GKJQ 2IT1A 5JEAG 2BA0A 3NELA 2WAQE 4JCVE 4LNQA 2ATWA 1TWFH 3RLFA 4YY3Q 4JI0L 1YJWA 2IX0A 3M4QA 4DV7L 1PA6A 2VL6A 4LF8L 5FLXc 2B63G 4DK3C 4X6AH 2UUCQ 5GAGC 4JI8L 1QZHA 1Q82C 4GNXC 3W1BA 3GTJH 3I2ZA 1QUQA 4DR1L 3STBD 4A3JG 5E7NA 3MXNB 1V43A 3A74A 4BA1I 1NJIC 2ZTDA 3S17H 3PO3H 1E1OA 4GNXA 4ME3A 1C0AA 4QIWE 3H0GG 3I4NH 2GN5A 4GLAC 1XJVA 3F1ZA 1NBWA 4GN3B 2N49A 2NZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSP A;  4HIK A;  1N33 L;  2AWN A;  1J5E Q;  1FJG L;  3CAM A;  4NB3 A;  1S72 A;  3K8A A;  1B70 B;  3KOJ A;  1PH4 A;  1Y14 B;  1L0W A;  3HOV G;  4IPC A;  2HHH Q;  3GD7 A;  2ASB A;  4OO1 I;  4IFD I;  2HIV A;  3KJO A;  1XPU A;  1OTC A;  1FGU A;  2B3G A;  3HOZ H;  1N32 L;  2D0P A;  1B8A A;  5EAY A;  4BY1 G;  5M3M H;  1KIX A;  4A75 A;  3TRZ A;  1PYB A;  4JI4 L;  3J80 i;  1X56 A;  1J6Q A;  3J81 j;  3CME A;  1E22 A;  1K3R A;  4LF4 L;  2WAQ G;  5M5Y H;  3F2D A;  4X65 Q;  1E7Z A;  2H5X A;  4GN4 B;  4LFA Q;  3S14 H;  3Q8D A;  3A5U A;  2UXD Q;  4UPA A;  4NXM Q;  3IRB A;  1Q7Y C;  4X64 Q;  3CC7 A;  3J7A 5;  1L1O B;  5GAD C;  2B63 H;  4HJ8 A;  4R4T A;  1LUZ A;  5C4J H;  3UDF A;  3GTK H;  4IFD J;  2NVX H;  4B3S Q;  2I0Q A;  4A3K H;  5K36 G;  2VQE L;  2UUB L;  1L2F A;  4HJA A;  1HNX L;  1XTD A;  2GVB A;  1IBM L;  1A63 A;  1YNX A;  1WCM G;  3H0G H;  1XMQ L;  1W3S A;  2A8V A;  3AEV A;  1L1O C;  3FHW A;  1YHQ A;  3W1G A;  4BXX G;  1XPR A;  4GLV B;  1N36 Q;  3RLO A;  4A3C G;  2AMC B;  4A93 G;  3PUV A;  4J15 A;  3ZJY C;  3G48 A;  2VQF L;  1P16 A;  1HNW L;  3S24 A;  1AH9 A;  4X66 L;  4K0K L;  2UU9 L;  1L1O A;  4JI1 Q;  4JC0 A;  2QEX A;  4TQU S;  4P73 A;  1KRT A;  5HGQ A;  4PMW A;  4B3M L;  1OXU A;  3PSI A;  3CD6 A;  1HH2 P;  1Q46 A;  3S2H H;  2ZTC A;  1A62 A;  1R9T H;  4AYB G;  1PH3 A;  4Y52 H;  2VW9 A;  4DV5 L;  4A3I G;  3HOY G;  4OON A;  1KXL A;  2MO0 A;  4DV0 L;  4JI7 L;  2JA7 G;  4A3F G;  3TS0 A;  4LF9 Q;  5IYB G;  5IP9 H;  1UWV A;  5ELN A;  1VQ6 A;  1QVC A;  1Z9F A;  1VQ5 A;  2WP8 J;  2PI2 E;  4DR3 L;  4R4I A;  4DV1 Q;  4JOI C;  1UE5 A;  1YHA A;  4LF5 L;  4LFC Q;  2Z0S A;  2ZTE A;  3CCE A;  3M4O H;  5IWA Q;  3PIO A;  2VZA A;  3HOW G;  4YCV A;  1VQA A;  3K7A H;  1OXT A;  3WWV A;  1NE3 A;  1ASY A;  3S1N H;  1VS0 A;  3KDF B;  1SFO H;  3AFP A;  4JI5 Q;  1GO3 E;  3CCU A;  4OO1 G;  4IPH A;  3G4S A;  3PGZ A;  4KLK A;  2LSS A;  4HJ5 A;  3U58 A;  4IFD G;  4P74 A;  3H3V H;  5IP7 H;  1HR0 Q;  3HOU G;  1KL9 A;  1YJN A;  1WCM H;  1UE6 A;  5BR8 L;  1U5K A;  3M9B A;  1YJ9 A;  4A3G G;  2CWA A;  4A3C H;  2E2H H;  3CW2 C;  4A93 H;  3RZO H;  1P8L A;  3PO3 G;  1SLJ A;  4LUV A;  1SRO A;  1X3G A;  3CXC A;  4IOC A;  4BY7 G;  2LXJ A;  3KFU A;  3I4N G;  4YHH Q;  3ERS X;  1K83 H;  4LWC A;  1GVP A;  3S1Q H;  2D0O A;  3W5O A;  1JMC A;  3KDF A;  2R7Z H;  4KHP Q;  3HKS A;  4P71 A;  5C4X H;  4KHZ A;  4GOP B;  5C44 G;  1UE1 A;  2JJQ A;  3CP0 A;  1RL2 A;  2DGY A;  4A3I H;  2IX1 A;  2YYZ A;  2E2I H;  4OX9 L;  2K5H A;  1JB7 A;  1V9P A;  2Q2H A;  5AJ3 L;  4A3F H;  2IHE A;  2E5L L;  5IYB H;  1X3F A;  1QUQ B;  3J81 i;  4LF8 Q;  2NVY H;  3K0X A;  3F2C A;  1PVO A;  4DR5 L;  3A5Z B;  3TQY A;  1VQ7 A;  4GOP C;  2VS1 A;  3OTO Q;  3AQQ A;  2E8G A;  4R4Q A;  4TVA B;  1GKH A;  4DV6 L;  4DR1 Q;  1I94 L;  3GTL H;  5GAH C;  3HOW H;  5LMN L;  3I56 A;  3NBH B;  4Y7N H;  3I4O A;  4GOP A;  1GM5 A;  2R6G A;  4MNO A;  2OTL A;  1XMO L;  1C7Y A;  2F3I A;  3L7Z C;  1M90 C;  2KHI A;  1EWI A;  3HOU H;  3G71 A;  4A3E G;  4RG1 A;  1XNR Q;  1UEB A;  4A3G H;  2R7F A;  2ZM6 Q;  3T1H L;  4A3K G;  1MIU A;  4MZ9 A;  5M3F G;  4JYA L;  2JA9 A;  2GVA A;  4JBJ A;  4L5S A;  4BY7 H;  3EN2 A;  1N32 Q;  5GRO A;  4LFB L;  1FVI A;  1M1K C;  2OCE A;  4JI4 Q;  1PYS B;  1Q86 C;  1B7Y B;  5C44 H;  1A0I A;  4NXN L;  4LF7 L;  1KD1 C;  3NEN A;  3PO2 G;  2HQL A;  3KF6 A;  5LMU L;  1PH7 A;  1WFQ A;  2KCM A;  1WYD A;  1Q1E A;  4KI0 A;  3JAM i;  1VQF A;  3GO5 A;  1IBL L;  1N34 Q;  1Q1B A;  1A8V A;  1SRU A;  1Z47 A;  3PUX A;  4A3L G;  4DUZ L;  1Y1V H;  2NVQ H;  4UP7 A;  5FLM G;  2ID0 A;  4GKK L;  2LXK A;  3E0E A;  1HZA A;  1O7I A;  4GN5 A;  4PZ7 A;  3NEM A;  2JA5 G;  4AYB E;  4YY3 L;  2RHS B;  5IP9 G;  4AH6 A;  1PHJ A;  1HNX Q;  3BZK A;  1FL0 A;  3TEH B;  1XMQ Q;  4IJL A;  3E9H A;  1I3Q H;  4X62 Q;  4A76 A;  1CUK A;  4QY7 A;  1LTL A;  2VQF Q;  4A3E H;  4L5T A;  4YCW A;  4K0K Q;  1CKN B;  4C2M H;  4JI2 L;  2CFM A;  4FDB A;  4DV2 L;  4HIO A;  4QL5 A;  2YTX A;  2Q2I A;  5M3F H;  1NMF A;  4POG A;  5DLQ E;  3RN2 A;  4B3M Q;  4DV4 L;  4DR6 Q;  5IP7 G;  1NTG A;  1TWG H;  4YWM A;  1PH8 A;  4LF6 Q;  4B3T Q;  2Z6K A;  3AFQ A;  4ALP A;  1K8A C;  4DV5 Q;  2K75 A;  1X6O A;  1K9M C;  3FKI G;  4WJ4 A;  5GAE C;  3LGJ A;  1TWH H;  2MNA A;  3EBE A;  3PO2 H;  2EQS A;  2RCN A;  2YTV A;  1X3E A;  3CPW A;  2DUD A;  1CKN A;  4EQ5 A;  1KQS A;  2R7Z G;  4JBK A;  1CKM A;  3GTM H;  2UUA Q;  4LF5 Q;  5C4X G;  3RZD H;  1VQJ A;  4A3L H;  2N78 A;  4LW1 A;  4LFA L;  1W2B A;  2FXQ A;  3OW2 A;  3I4M G;  5FLM H;  3CF5 A;  4NXM L;  2JA5 H;  1TXY A;  1CKO A;  2XTI A;  2AHO B;  2XGT A;  3BJU A;  4DR7 Q;  1YIJ A;  2PQA B;  2BA1 A;  4APV A;  4DR4 Q;  4AIM A;  4DV3 L;  2CKZ B;  2D62 A;  2QA4 A;  4DR2 Q;  4OWT B;  2F4V Q;  2UXB Q;  5IYD G;  3DLL A;  1MJC A;  3UDG A;  4R1J A;  1U0L A;  1HNZ Q;  1X54 A;  1PH1 A;  3H15 A;  2JEA I;  4JBM A;  1PH9 A;  3CCQ A;  3JC6 6;  2MO1 A;  3CCM A;  3BZC A;  2AWO A;  3F8T A;  1XNQ Q;  3RR5 A;  3J80 c;  3B6Y A;  1EIY B;  2NN6 I;  3GTP H;  4JV5 L;  1PH2 A;  3K80 C;  2PQA A;  3FKI H;  2CCZ A;  4JI6 Q;  3CMA A;  4OX9 Q;  2KCT A;  3TS2 A;  5FJ8 G;  1VQE A;  3I7F A;  2E5L Q;  1CSQ A;  2MFI A;  4QJF A;  4AQY L;  2RHQ B;  1WI5 A;  2WB1 G;  3I55 A;  3S1R H;  3T1Y Q;  4DKA C;  1NY4 A;  2N8N A;  1PV4 A;  4WJ3 M;  2NZO A;  1LM0 A;  2EIF A;  2R92 G;  2JA8 H;  2VUM G;  4LF9 L;  4DNI A;  1KRS A;  3KJP A;  4HJ7 A;  3I4M H;  4A3M G;  4A4I A;  2ALY B;  4RMF A;  2OQ0 A;  3PV0 A;  2K14 A;  1YI2 A;  4UP9 A;  3RLN A;  5IE8 A;  4JI0 Q;  4DV7 Q;  4DAM A;  3RN5 A;  2CWP A;  4LFC L;  1X9N A;  1IBK L;  1I6H H;  3HFZ B;  5IY0 A;  2ZJQ A;  5IWA L;  4JI8 Q;  1Y1V G;  1IL2 A;  1EQR A;  1SE8 A;  2R93 G;  1VQN A;  1S3O A;  2ZJR A;  4JI5 L;  2Q2T A;  1D8L A;  2Y0S G;  3MEF A;  4JG2 A;  3D31 A;  4C3J H;  1K73 C;  2KBN A;  5IYD H;  1VQL A;  4A3B G;  5H1S E;  1E3P A;  1EIF A;  3ER0 A;  1E24 A;  4IPD A;  4LFB Q;  1TWC H;  3M4P A;  2UUB Q;  2YTY A;  5M5X H;  1N33 Q;  1FJG Q;  1IZ6 A;  3PIP A;  3KF6 B;  1AE2 A;  3D0F A;  4QGU A;  4NXN Q;  1X55 A;  1T9H A;  1JJ2 A;  4B3R L;  5LMU Q;  1QZG A;  5FJ8 H;  4C3I H;  4PZ6 A;  4KHP L;  5LMN W;  2ZJP A;  1IBL Q;  2JA6 G;  4OWW B;  1E1T A;  3EIV A;  2R7D A;  3STB C;  4DUY L;  4GKK Q;  3KYH C;  2B29 A;  4LF4 Q;  2K50 A;  1SMX A;  2R92 H;  5JJK A;  4OXP A;  1EUJ A;  3F2B A;  5IT9 c;  2VUM H;  3DM3 A;  3ULP A;  1SN8 A;  5C0X I;  1VQG A;  1X65 A;  3FP9 A;  4A3M H;  2UXC L;  3ULL A;  1I5F A;  4P75 A;  4HIM A;  1BBW A;  3PUY A;  2OWO A;  4JI3 L;  3J7Z C;  1DGS A;  1JJC B;  3OTO L;  3L0O A;  4IOA A;  1BVS A;  1VCI A;  1YBY A;  4L5Q A;  1EQQ A;  3AYH B;  4GKJ L;  2R93 H;  4JI2 Q;  1HZC A;  2NN6 G;  4DV2 Q;  1JE5 A;  1VQM A;  1K8G A;  2VQE Q;  5M5W H;  4A3D G;  2JEB I;  2KEN A;  1YIT A;  4DV4 Q;  1Q81 C;  4A3B H;  1IBM Q;  2JQO A;  2NVT H;  3HKZ E;  3U4Z A;  1VQB A;  3VDY A;  2UUC L;  1IXR A;  1YVC A;  1XNR L;  2PI2 A;  3TRE A;  3KF8 B;  1GD7 A;  4IJH A;  2ZM6 L;  2WFW A;  5ELO A;  4POF A;  2F52 A;  1HNW Q;  4DK6 C;  4YWK A;  1VQI A;  1JT8 A;  4X66 Q;  1LYL A;  5C0X J;  2UU9 Q;  3S16 H;  3U4V A;  1IYJ B;  1RIP A;  1PH5 A;  2Z6K C;  5JJL A;  5C3E G;  1I50 H;  3SGI A;  2QGQ A;  3U50 C;  1VQH A;  1EYG A;  3HOX G;  1JJG A;  2I5L X;  1J5E L;  1KAW A;  4O0A A;  3J81 c;  2JA6 H;  1OXS C;  4P72 A;  5GQO A;  4NPS A;  3CCR A;  1VQP A;  2HHH L;  3PF4 A;  3UE0 A;  4DV0 Q;  1QVG A;  2K5N A;  4JI7 Q;  4PZ8 A;  3G6E A;  2KHJ A;  4L5R C;  1OXX K;  2CQO A;  2N3S A;  4EX5 A;  4BBS G;  1WJJ A;  4H02 A;  3UDX A;  3CCL A;  4HJ9 A;  1N34 L;  3S1M H;  4DR3 Q;  1H95 A;  3S15 H;  4XIG S;  2WB1 E;  1YZ6 A;  4DV3 Q;  5IYC G;  1VQ9 A;  4UY8 C;  4R4O A;  4A3J H;  1Y1W G;  2JK8 A;  4X65 L;  3M7N A;  1TWA H;  4GLX A;  2JA8 G;  4BA2 I;  4PG3 A;  2HT1 A;  1N9W A;  4LUO A;  4IPG A;  1VQ8 A;  2UXD L;  3HKZ G;  2HIX A;  4X64 L;  4A3D H;  2K52 A;  5J3B A;  2AKW B;  4X62 L;  1QVF A;  4UP8 A;  5BR8 Q;  3PF5 A;  1G29 1;  2PMZ E;  3A0J A;  3PCO B;  2E2J H;  4BBR G;  1ASZ A;  4B3S L;  3HOV H;  4JV5 Q;  2VNU D;  1KHI A;  1XPO A;  1VQ4 A;  4DR6 L;  1AE3 A;  4O2D A;  4AQY Q;  5HY6 A;  3PUW A;  2YV5 A;  2Y0S E;  4MTN A;  3CC2 A;  3ULJ A;  5C0X G;  5C3E H;  4B3T L;  2VY3 A;  4BY1 H;  4DPG A;  3JAM c;  1C9O A;  1BBU A;  1N36 L;  3HOX H;  3GTQ H;  2MQH A;  1D7Q A;  1V1Q A;  2K5V A;  1Q12 A;  4YWL A;  3M85 A;  4JI1 L;  1WOC A;  2ES2 A;  4DAY B;  1MKH A;  5AJ3 Q;  3S2D H;  5JJI A;  4BBS H;  3E9I A;  2UUA L;  3CCV A;  1IBK Q;  2EXD A;  3ICE A;  5JEA J;  3PUZ A;  4DR5 Q;  4LUZ A;  4XTC S;  4JOI A;  3UDI A;  5IYC H;  1VQO A;  4DV6 Q;  2OTJ A;  1I94 Q;  1Y1W H;  1VQK A;  1SR3 A;  4JBW A;  2OQK A;  5LMN Q;  2V1C C;  1HZB A;  4OWX B;  2C35 B;  3OYY A;  1YHB A;  4HID A;  1XMO Q;  1PH6 A;  4DV1 L;  4DR7 L;  2L15 A;  4DR4 L;  3GTG H;  1HJP A;  3GDE A;  4C3H H;  1S40 A;  1MJE A;  4BXX H;  3RNU A;  1EFW A;  4DR2 L;  2RF4 A;  3CCS A;  2F4V L;  2UXB L;  4YCU A;  2K4K A;  2A1A A;  1KC8 C;  4B3R Q;  1Q8K A;  3T1H Q;  4BBR H;  2BH2 A;  1HNZ L;  4JYA Q;  2IY5 B;  2BH8 A;  2Q2U A;  1YEZ A;  1HR0 L;  4QQB X;  2JE6 I;  2I5M X;  1XNQ L;  1VQD A;  2IHF A;  3L2P A;  3GTO H;  2I5H A;  1HZ9 A;  1VQC A;  2PNH A;  1UE7 A;  3CPF A;  4DUY Q;  1N8R C;  3HOY H;  1G6P A;  4JI6 L;  4LF6 L;  1NMG A;  2JA7 H;  3K7U C;  4LF7 Q;  3BU2 A;  3H3V I;  3HOZ G;  4YHH L;  5M3M G;  3T1Y L;  3CCJ A;  1OXV A;  3KLW A;  2UXC Q;  1EOV A;  1K0R A;  1PFS A;  4R4C A;  2YU9 H;  1BKB A;  3CQZ H;  3M3Y H;  4GNX B;  1G51 A;  4JI3 Q;  1HR0 W;  3CC4 A;  3UE1 A;  4IO9 A;  2A19 A;  4DUZ Q;  4GS3 A;  3K81 C;  4GKJ Q;  2IT1 A;  5JEA G;  2BA0 A;  3NEL A;  2WAQ E;  4JCV E;  4LNQ A;  2ATW A;  1TWF H;  3RLF A;  4YY3 Q;  4JI0 L;  1YJW A;  2IX0 A;  3M4Q A;  4DV7 L;  1PA6 A;  2VL6 A;  4LF8 L;  5FLX c;  2B63 G;  4DK3 C;  4X6A H;  2UUC Q;  5GAG C;  4JI8 L;  1QZH A;  1Q82 C;  4GNX C;  3W1B A;  3GTJ H;  3I2Z A;  1QUQ A;  4DR1 L;  3STB D;  4A3J G;  5E7N A;  3MXN B;  1V43 A;  3A74 A;  4BA1 I;  1NJI C;  2ZTD A;  3S17 H;  3PO3 H;  1E1O A;  4GNX A;  4ME3 A;  1C0A A;  4QIW E;  3H0G G;  3I4N H;  2GN5 A;  4GLA C;  1XJV A;  3F1Z A;  1NBW A;  4GN3 B;  2N49 A;  2NZH A; 
#chains in the Genus database with same CATH topology
 1CSP A;  2EYM A;  4HIK A;  1N33 L;  2AWN A;  1SJH D;  3K58 A;  3I8Z A;  1ICF B;  3D4R A;  1YNJ D;  4IPC A;  3HOV G;  2NVX B;  4A3K B;  2HIV A;  2L55 A;  3PIO 3;  3NK9 A;  4BY1 G;  2QEJ C;  2K32 A;  3ERO A;  5ISR A;  1PYB A;  2CQA A;  5LL6 X;  3ND9 A;  1X56 A;  1J6Q A;  1RF2 D;  1E7Z A;  4OEM B;  1TY2 A;  5JEA H;  2UXD Q;  4UPA A;  5JAV A;  4OGQ C;  1CI3 M;  3OW7 A;  4HJ8 A;  1S5E D;  4IFD J;  4DAP A;  2NVX H;  3UI2 A;  4A3K H;  5K36 G;  2VQE L;  2A6E D;  1S4Z A;  4FYD A;  1FR3 A;  2FHT A;  1IBM L;  2GVB A;  1A63 A;  1XMQ L;  1W3S A;  1SND A;  5I9P A;  4A93 G;  1YNN D;  3RLO A;  1AH9 A;  2VQF L;  1P16 A;  4K0K L;  2UU9 L;  1L1O A;  3NQT A;  4JC0 A;  2ZXO A;  5HGQ A;  1OXU A;  5IOC A;  1PDQ A;  4ID6 A;  4DN4 M;  4AYB G;  1PH3 A;  3HRZ C;  1KXL A;  4A93 B;  3RZO B;  4V0B A;  2JA7 G;  1K28 A;  2PW7 A;  5IP9 H;  1UWV A;  5ELN A;  3S1Q B;  1VQ5 A;  2WP8 J;  2AUJ D;  5C4Z A;  1UE5 A;  3IFT A;  2B2W C;  2B8G A;  4NP5 A;  4LFC Q;  5NUC A;  1UEA B;  4ZQ3 A;  3HOW G;  1OXT A;  2A6H C;  1NE3 A;  3S1N H;  1SFO H;  3SE0 A;  5CV4 A;  5K36 H;  3CCU A;  5CGK A;  4OO1 G;  3U58 A;  1B53 A;  4IFD G;  1FNV A;  4QB4 A;  5IP7 H;  3H3V H;  1YJN A;  1UE6 A;  3D4D A;  5C6A A;  2KOL A;  4A93 H;  3RZO H;  3PO3 G;  5JOB A;  1O7Y A;  1LTT D;  1JR0 D;  2LXJ A;  3KFU A;  3I4L A;  4YHH Q;  2H1E A;  2XVS A;  4LWC A;  3S1Q H;  2D0O A;  1XYI A;  3KDF A;  1I4P A;  3CRK C;  1IL8 A;  1BBX C;  2B2Y A;  4QF4 A;  1C8C A;  3HP3 A;  3NBI A;  1S5F D;  4OX9 L;  2K5H A;  3MC0 B;  5CV7 A;  2KA7 A;  3DM1 A;  5IGB A;  2OF1 A;  3EVQ A;  4RGN A;  1A6X A;  3N6R A;  4C1N I;  4TVA B;  5GAH C;  3HOW H;  2QIL A;  1B3Q A;  3CKI B;  1EOT A;  3NBH B;  3VYT A;  2SNS A;  2PQE A;  3I90 A;  4KMU C;  4OO1 H;  2F3I A;  4IFD H;  1M90 C;  2KVM A;  3C1E A;  2FMM A;  1QWY A;  5KIX A;  2QDB A;  1D2B A;  5M3F G;  2F0G A;  2GVA A;  4L5S A;  1FVI A;  2ZXR A;  1IKM A;  1QCB D;  3SK6 A;  3MTS A;  3U9S A;  1EIH A;  5ELC A;  1A0I A;  1GUS A;  3I72 A;  3NEN A;  2HQL A;  3KF6 A;  1PH7 A;  1WFQ A;  2KCM A;  4YIJ A;  3JAM i;  1VQF A;  3Q22 A;  1IBL L;  2D5D A;  1Q1B A;  2JA6 B;  1SYG A;  1A8V A;  3PUX A;  4DUZ L;  2D2C C;  4GKK L;  4UP7 A;  1A2T A;  2NBF A;  1B2T A;  1EY5 A;  3IFD A;  4AYB E;  3E0J A;  5DAU A;  2WII B;  3BZK A;  3K5O A;  3ZYY X;  3AB9 A;  3E9H A;  4X62 Q;  1JE4 A;  4A76 A;  1H9S A;  2MUY A;  4L5T A;  2QF7 A;  3RZD B;  2CFM A;  4KK7 A;  2YTX A;  5M3F H;  2M9V A;  4X3U A;  4DV4 L;  4DR6 Q;  3I70 A;  1TWG H;  1PH8 A;  3R3O A;  4NMZ A;  2ENB A;  1K8A C;  4DV5 Q;  1X6O A;  3FKI G;  5GAE C;  3LGJ A;  2EY6 A;  3EBE A;  1RCV D;  4EQ5 A;  2R7Z G;  2UUA Q;  2J7Z A;  4LF5 Q;  1XTC D;  3RZD H;  2F0O A;  4LW1 A;  3TZD A;  2LKV A;  3HG9 A;  3OW2 A;  1SEB D;  3FKI B;  3HS0 C;  4NXM L;  1HTP A;  5JVG 3;  1WTP A;  1B9N A;  4HMJ A;  1CKO A;  2XTI A;  4ABN A;  1YIJ A;  4XQQ A;  2BE5 C;  4AIM A;  2CKZ B;  2ZT9 C;  1O7L A;  2UXB Q;  1Y1W B;  2DJF C;  3DLL A;  3UDG A;  3BVM A;  4FXK C;  1PH9 A;  2I46 A;  2ICE C;  4F8M A;  1ENC A;  1J9O A;  4C3H B;  3BZC A;  1D5Z C;  3RR5 A;  3B6Y A;  1EIY B;  1H9K A;  2NN6 I;  5DM7 3;  3K0Y A;  3FKI H;  3P75 A;  5FJ8 G;  2E5L Q;  1WI5 A;  2O2L D;  3GTO B;  4MTK A;  1WD1 A;  2R92 G;  5KEE A;  2VUM G;  1PTO B;  4DNI A;  2FIN B;  3VA5 A;  4A4I A;  1TY0 A;  2OQ0 A;  2K14 A;  2VB2 X;  4HSP A;  4JI0 Q;  1Q3L A;  2KHS A;  2RQX A;  2CWP A;  1IBK L;  1LT3 D;  2KCN A;  1LLR D;  1EQR A;  1PTO F;  3MXP A;  2R93 G;  1PTO C;  1D8L A;  4JG2 A;  1K73 C;  4FP5 D;  1AN8 A;  4A3B G;  2VUM B;  3T16 A;  1EIF A;  4IPD A;  2A68 D;  1QOH A;  3KF6 B;  1AE2 A;  1PTO H;  1SYD A;  5FOB B;  1I4Q A;  2L5T A;  1E2V A;  5FJ8 H;  5M5W B;  4GZY C;  4KHP L;  1JB3 A;  4OWW B;  3W2D A;  3NP8 A;  1AEX A;  4M8A A;  1B3A A;  4DUY L;  4LJZ C;  2R92 H;  3O13 A;  1ICW A;  5IT9 c;  1HPC A;  2VUM H;  3S16 B;  1LT6 D;  1VQG A;  3FP9 A;  1NNX A;  5EPK A;  3J7Z C;  1DGS A;  4IOA A;  1PYW D;  4RH6 A;  1EQQ A;  3BVZ A;  2R93 H;  4I65 A;  5C5M A;  1L0X B;  5M5W H;  4QMG A;  1CK1 A;  1YIT A;  2E2D C;  3GV6 A;  4A3B H;  2JQO A;  2R3Z A;  2UUC L;  1YVC A;  2L4N A;  5IGG A;  2EVB A;  5ELO A;  4ZYS A;  2F52 A;  1HNW Q;  1RD9 D;  4DK6 C;  3I3C A;  4X66 Q;  5C0X J;  3S16 H;  1TWA B;  5BN5 A;  1IYJ B;  2Z6B A;  1KNE A;  1RIP A;  5EPJ A;  1PH5 A;  2QDL A;  3W3A A;  2QGQ A;  1WTO A;  1EYG A;  1JJG A;  3NTH A;  3J81 c;  2IX3 A;  1OXS C;  4P72 A;  1HUM A;  3PF4 A;  5C3X A;  4L5R C;  2K5N A;  2KHJ A;  2B2U A;  3HGB A;  5EKI A;  2WIN B;  5IGF A;  4I7A A;  1YZ6 A;  2M00 A;  3GTQ B;  4R4O A;  5A35 A;  1D5M C;  1TWA H;  2WAQ B;  4MIU A;  2IWH A;  1BNZ A;  1VQ8 A;  1SE4 A;  2WV6 D;  4X64 L;  5J3B A;  1CT1 D;  1TKW B;  1GUO A;  1IHZ A;  3IL8 A;  5BR8 Q;  1SBB B;  4S3S A;  3G6E A;  4K6L A;  3PCO B;  4JV5 Q;  2VNU D;  4RGT A;  3J81 L;  3A7L A;  4O2D A;  2WKD A;  4OIK A;  2YV5 A;  3ULJ A;  5C0X G;  4B3T L;  1H9M A;  3QJY A;  4DPG A;  1C9O A;  3GTQ H;  1X32 A;  2MQH A;  1NR4 A;  1Q12 A;  1HCZ A;  1TII D;  3CCV A;  3TP5 A;  1TQO A;  2EXD A;  3A55 A;  3ICE A;  2N55 A;  4DR5 Q;  3SDZ A;  1MBY A;  5I4D A;  4IUR A;  4CBV A;  5KND A;  3D4W A;  1VQK A;  1SR3 A;  2FFK B;  2V1C C;  2F3V A;  2XWB B;  4DR7 L;  3GDE A;  1S40 A;  4CKC A;  1M8A A;  5A2Q E;  5IT9 E;  2K4K A;  1VMC A;  4L8J A;  4B3R Q;  1Q8K A;  2BH2 A;  1VF7 A;  4JYA Q;  1TWF B;  1WTV A;  3TP7 A;  2JE6 I;  3PMF A;  5C0X H;  2IHF A;  1KDC A;  1G6P A;  4A3G B;  2HD3 A;  3NWS A;  3BYY B;  4XXE A;  3EA6 A;  3K7U C;  3QOJ A;  4DU9 A;  4LF7 Q;  3HOZ G;  5FO8 B;  3T1Y L;  1OXV A;  3I4N B;  1EOV A;  4R4C A;  2C5C A;  1U9R A;  2PZT A;  4IO9 A;  2A19 A;  3K81 C;  4FXG C;  2BA0 A;  4LNQ A;  2WAQ E;  2ATW A;  1TWF H;  1YJW A;  2IX0 A;  1STY A;  1TU2 B;  3HOZ B;  4LF8 L;  1W6K A;  5FLX c;  4DK3 C;  1U4L A;  4JI8 L;  3Q6S A;  1Q82 C;  3I2Z A;  1IKL A;  4BA1 I;  3VR5 A;  5IGE A;  4GNX A;  4DNT B;  4ME3 A;  2CW0 D;  4X3S A;  1II3 A;  3I4N H;  1DCZ A;  4FF4 A;  2NZH A;  2ICI A;  1FJG L;  1A3V A;  2B8F A;  4NB3 A;  3BVG A;  2HHH Q;  1LAB A;  2ASB A;  1FGU A;  3E3X A;  3VR2 A;  3HOZ H;  1N32 L;  5EAY A;  5EQ0 A;  3TRZ A;  3KLR A;  1BDO A;  1D5X C;  2RCF A;  1Y8O B;  3FVQ A;  5M5Y H;  5FLX L;  2H5X A;  4GN4 B;  4IUT A;  3Q8D A;  3A5U A;  3PO2 B;  5C3W A;  1SDF A;  1Q7Y C;  1SNO A;  1FYC A;  1RDP D;  4PQX A;  1W6J A;  3AU7 A;  2I0Q A;  4ZCK A;  1CM9 A;  1UNS A;  2FJ2 A;  2OXP A;  2JA5 B;  1D6E C;  2AQ3 B;  1XTD A;  1EIG A;  1SNQ A;  3AEV A;  1YHQ A;  4A3C G;  1XPR A;  1N36 Q;  2AMC B;  3PUV A;  2A69 D;  2WKC A;  3G48 A;  3ZJY C;  4IQZ A;  3K7A B;  2QEX A;  2KQ3 A;  1KDA A;  3QR8 A;  3LWU A;  4F7X A;  4DK0 A;  1NAP A;  3K5N A;  4KKT A;  2HCI A;  4A3I G;  3HOY G;  4OON A;  2MO0 A;  4JI7 L;  5L37 A;  5K5P A;  1EY0 A;  1KAB A;  1STB A;  4DR3 L;  4R4I A;  4XT1 B;  1YHA A;  1ESF A;  2Z0S A;  3CCE A;  3PIO A;  1QNU A;  3K7A H;  2B2W A;  1EY8 A;  3I4M B;  1GO3 E;  2E2I B;  4XQJ A;  3G4S A;  4P74 A;  3HOU G;  1HR0 Q;  3BZD B;  3T51 B;  4A3C H;  2E2H H;  3CW2 C;  3X3M A;  1SLJ A;  4LUV A;  1X3G A;  3DMU A;  4IOC A;  4OL7 A;  1S5D D;  1GVP A;  1LTG D;  3P20 A;  1AZP A;  3A8I E;  1R4Q B;  3HOU B;  2F0J A;  4GOP B;  2IW3 A;  4OEL B;  3CHB D;  4A3I H;  1S5C D;  4XYO A;  5F2D A;  2IX1 A;  2JXM B;  3TDQ A;  2YYZ A;  4U67 3;  2E2I H;  5AJ3 L;  3KLS X;  2H4O A;  2J4X A;  1X3F A;  2Z8L A;  3J81 i;  5FO9 B;  2BDN A;  3K0X A;  4IAL A;  3A5Z B;  1QB5 D;  3ND8 A;  4GOP C;  2RBM A;  3OTO Q;  4DV6 L;  1I94 L;  2Z4H A;  1CHP D;  3D6C A;  4IUN A;  3H91 A;  4PMB A;  4MNO A;  4KY7 A;  4A3M B;  1XMO L;  4LMQ D;  4CKE A;  4J6H A;  2F0V A;  1EWI A;  3HOU H;  4A3E G;  2NTT A;  1XNR Q;  1UEB A;  3S9W A;  4IUQ A;  2NVQ B;  3T1H L;  4A3K G;  1MIU A;  3CRL C;  2L12 A;  1SNC A;  1WTX A;  2JA9 A;  1TR5 A;  1A2U A;  2F0K A;  4H44 C;  5KNB A;  2OCE A;  3NBH A;  3Q0A A;  1I3Q B;  1B7Y B;  1S5B D;  1IW7 C;  4A3E B;  3T4A C;  1KD1 C;  3T13 A;  5D3I B;  3N52 A;  1Q8I A;  5TSS A;  1Z47 A;  5JVH 3;  4A3L G;  1YNJ C;  2NVQ H;  5FLM G;  2LXK A;  3NE5 B;  3D6W A;  4RHS A;  1WD0 A;  5IP9 G;  2HCC A;  1PHJ A;  1LTS D;  1PZI D;  3TEH B;  1XMQ Q;  2IPK D;  1I3Q H;  4RGO S;  4QY7 A;  1LTL A;  2VQF Q;  4A3E H;  2K6A A;  4YCW A;  4J1M A;  4K0K Q;  1CKN B;  4JI2 L;  1DYQ A;  4DV2 L;  4HSV A;  4POG A;  1SSO A;  5AFW A;  5IP7 G;  1NUC A;  4ZK9 B;  2Z6K A;  4XDX A;  3AFQ A;  4ALP A;  1G91 A;  1FNU A;  1K9M C;  5T1G A;  2E2J B;  2A6E C;  2IL8 A;  4KD4 A;  2YTV A;  1X3E A;  3VR3 A;  2DUD A;  1NCV A;  1MSG A;  5C3E B;  3J80 E;  1QG7 A;  1I4R A;  3VR6 A;  3M7G A;  4A3L H;  1W2B A;  3GTP B;  5FLM H;  1JOQ A;  2NN6 H;  2F0P A;  1TXY A;  4IUV A;  3R2I A;  1SYE A;  2AHO B;  1PFM A;  4I7Z C;  3HZX A;  5JPN C;  4DV3 L;  2LS0 1;  2LFN A;  4OIJ A;  4OWT B;  2F4V Q;  4QIW B;  1WTW A;  2MGS A;  4K5X A;  1HNZ Q;  1PH1 A;  2JEA I;  3HKZ B;  3NHH A;  4JBM A;  3CCQ A;  2MO1 A;  3CCM A;  4DA2 A;  3F8T A;  1XNQ Q;  3GTP H;  1D1I A;  2A6H D;  4G57 A;  1PH2 A;  3K80 C;  2CCZ A;  4ZAI A;  4JI6 Q;  3TS2 A;  3FMC A;  4TSS A;  4OX9 Q;  3J7A V;  1QNK A;  4AQY L;  5CR3 A;  3T56 B;  1NY4 A;  4G7H C;  4WJ3 M;  2NZO A;  1LM0 A;  4M1U B;  4HJ7 A;  2ALY B;  4RMF A;  1I4X A;  4UP9 A;  4DV7 Q;  4LFC L;  3M3Y B;  3HFZ B;  1STG A;  1VQN A;  5E3F A;  3TSS A;  3D31 A;  5H1S E;  2UUB Q;  1GJX A;  3TZU A;  1GUT A;  4K2L A;  2NZ1 D;  4ZUI A;  1CFM A;  3D0F A;  2IJ0 A;  1T9H A;  2HDM A;  5IIF A;  3J7A F;  2ZJP A;  1IBL Q;  2JA6 G;  4TKO B;  1E1T A;  3STB C;  4GKK Q;  3KYH C;  4LF4 Q;  4ZRZ A;  1CHQ D;  3F2B A;  1CTM A;  4Q5V A;  2UXC L;  2D9U A;  2Z4I A;  4P75 A;  3LNN A;  1BBW A;  2OWO A;  1ZEQ X;  4HED A;  2LMC B;  4R8I A;  1BVS A;  2XN9 C;  2L0C A;  4L5Q A;  1LT4 D;  1XX8 A;  3AYH B;  4GKJ L;  1CZW A;  4K2K A;  4P2C B;  1JOK A;  1SE2 A;  2JEB I;  3SK4 A;  4KKU A;  1LTB D;  4DV4 Q;  1Q81 C;  3HKZ E;  3U4Z A;  1VQB A;  2PI2 A;  1GHK A;  3KF8 B;  4IJH A;  4H0L C;  4YWK A;  1VQI A;  5E4W C;  1LTR D;  2FMC A;  4HCE A;  1ESR A;  3KBG A;  3NUC A;  3J7Y W;  2Z6K C;  5JJL A;  2B2T A;  4UHV A;  2I5L X;  1J5E L;  4O0A A;  2JA6 H;  3H09 A;  1EFI D;  4F87 A;  3CCR A;  4R8N A;  1K8O A;  3VYS A;  4DV0 Q;  2N3S A;  4BBS G;  3RUZ A;  3DXJ C;  4H02 A;  4X3K A;  3UDX A;  3Q23 A;  2RA4 A;  3H94 A;  5IYC G;  3GP7 A;  1Y1W G;  4X65 L;  3Q24 A;  1EYA A;  1EWC A;  4PG3 A;  4PMC A;  1IYV A;  1N9W A;  4RKL A;  2F4I A;  2K52 A;  4X62 L;  4BBS B;  4C3H G;  2BOS A;  2F0H A;  4UP8 A;  3A8J E;  3PF5 A;  4XYQ A;  5D3D A;  1G29 1;  3A0J A;  4B3S L;  1JIC A;  5KYI A;  1XPO A;  1O78 A;  4DR6 L;  2SOB A;  4MTN A;  2DY7 A;  1NSN S;  2F0L A;  4PV1 C;  3MZ5 A;  1D7Q A;  4YWL A;  4JI1 L;  4G7O C;  4LK1 C;  1MKH A;  4BBS H;  1HTL D;  2UUA L;  1IBK Q;  4K5V A;  3PUZ A;  4LUZ A;  4XTC S;  4JOI A;  5IYC H;  1VQO A;  1HFN A;  4UDU C;  1Y1W H;  1AFP A;  5LMN Q;  1KAA A;  1G8Z D;  5KGU A;  4FF1 A;  4OWX B;  3D8G A;  3OYY A;  2VXW A;  1DD2 A;  2NVY B;  4DV1 L;  1SE3 A;  2YU9 B;  1U4R A;  4C3H H;  4BXX H;  2F03 A;  4N9P A;  1EFW A;  3CU7 A;  2UXB L;  3GTL B;  1RJT A;  3T53 B;  4Y7N B;  1ZKO A;  2LY7 A;  3RD4 A;  2B39 A;  2HUG A;  1EEF D;  3ITP A;  2I5M X;  3QB3 A;  3GTO H;  2I5H A;  1KDB A;  4WOR A;  1VQC A;  2K5Q A;  2GA4 B;  2QCP X;  4DUY Q;  1N8R C;  1ILQ A;  4IUU A;  3S17 B;  3H3V I;  4KHV A;  2EYP A;  1Y8N B;  5E4X A;  1K0R A;  4KN7 C;  2YU9 H;  2K5W A;  2QW7 A;  5FO7 B;  1HR0 W;  3UE1 A;  2KEE A;  4BS9 A;  1DXM A;  2IT1 A;  1X3Q A;  4YY3 Q;  4JI0 L;  2VL6 A;  2X69 A;  4KV6 A;  2B63 G;  2UUC Q;  5GAG C;  1QZH A;  1ENF A;  1BUV T;  1QUQ A;  3VR4 A;  4DR1 L;  5E7N A;  3TBI B;  1AZQ A;  3MXN B;  3S17 H;  3ONA B;  4FNF A;  1SMY D;  3DEP A;  3E5S A;  1F9R A;  1C0A A;  2K04 A;  3H0G G;  3S14 B;  1XJV A;  2N49 A;  4EVO A;  2B63 B;  3K8A A;  4MHE A;  1PH4 A;  1QIL A;  1L0W A;  3GD7 A;  4C2M B;  4ZKB B;  2B2T C;  2CHB D;  4OO1 I;  4IFD I;  1XPU A;  2ZXP A;  1OTC A;  1STA A;  2B3G A;  4WRD A;  1B8A A;  4DXG A;  4JPB W;  4MN3 A;  1KIX A;  4A75 A;  3H0G B;  1F2M A;  4JI4 L;  1WVL A;  3CME A;  1E22 A;  5A2Q L;  5IT9 L;  1K3R A;  2WAQ G;  1JC7 A;  3F2D A;  2EY5 A;  4LFA Q;  5CV6 A;  1K3B C;  3S14 H;  4K14 A;  4WFN 3;  1DZ1 A;  1G2S A;  3IRB A;  3OWE B;  4X64 Q;  3SEB A;  3CC7 A;  3J7A 5;  5GAD C;  4N9T A;  2B63 H;  4FF2 A;  3A7A B;  1R9T B;  1I4G A;  1TS4 A;  3MWY W;  1L2F A;  1HNX L;  1YNX A;  3H0G H;  2A8V A;  3OHX C;  4GLV B;  4OHJ A;  1HNW L;  1STN A;  4X66 L;  4TQU S;  3ERQ A;  1BCP B;  1KRT A;  2X6G A;  4PMW A;  4B3M L;  3PSI A;  1ZXT A;  3CD6 A;  1PRT D;  1HH2 P;  3K5M A;  2K01 A;  1R9T H;  4Y52 H;  4EGV A;  4RKB A;  2F0F A;  1A3U A;  1BCP F;  5DEH A;  4A3F G;  1BCP C;  4N8X 1;  4LF9 Q;  5COR A;  5IYB G;  1QVC A;  3S1R B;  1K83 B;  3MHB A;  2PI2 E;  5HGT A;  2F0M A;  4JOI C;  1F77 A;  2Z1C A;  1ILP A;  2ZTE A;  5IWA Q;  5C4X B;  2VZA A;  4RFB A;  5CC4 A;  3A56 A;  1VQA A;  3WWV A;  1AW7 A;  1VS0 A;  3AFP A;  4JI5 Q;  4IPH A;  2LSS A;  4A3F B;  1TT2 A;  1I6H B;  1Y69 U;  5BR8 L;  4CDE C;  1U5K A;  3M9B A;  3VA7 A;  4A3G G;  2RDF A;  1P8L A;  1RHP A;  3S15 B;  1SRO A;  4BY7 G;  1HUN A;  2KCC A;  3I4N G;  3ERS X;  1K83 H;  1QE6 A;  3W5O A;  1JMC A;  1GUN A;  4P71 A;  5C4X H;  3CP0 A;  2PO4 A;  1B4O A;  4K8I A;  4RCO A;  2DGY A;  1ZYR C;  5IGC A;  1V9P A;  4A3F H;  2AUK A;  2IHE A;  5IYB H;  4BY7 B;  1QUQ B;  4LF8 Q;  1PVO A;  1F2Z A;  5KRU A;  4DR5 L;  3TQY A;  3S15 H;  2E8G A;  3NWT A;  1GKH A;  1VMP A;  3NXW A;  2PPB C;  3AMU A;  1F9Q A;  4GOP A;  1GM5 A;  2OTL A;  1C7Y A;  1K8M A;  2KHI A;  2HDL A;  4RG1 A;  4A3G H;  2R7F A;  2ZM6 Q;  1Y1V B;  2KEC A;  4J8Q A;  5EJW A;  4JYA L;  4ZLT F;  2Y0S B;  4BY7 H;  1LTI D;  2RKS A;  3EN2 A;  1K0S A;  1N32 Q;  3IAY A;  4HN7 A;  4LFB L;  1M1K C;  1Q86 C;  1IYU A;  1SNP A;  1PXU A;  2N88 A;  3K5L A;  4IZ8 A;  3V96 A;  4KTA A;  3BS1 A;  4NXN L;  3QOL A;  3C2P A;  4LF7 L;  3PO2 G;  5LMU L;  5LHY 1;  4KI0 A;  2F0D A;  3GO5 A;  1N34 Q;  2F0U A;  2KUM A;  3R8B A;  1Y1V H;  2B2V C;  3LX0 A;  1HFG A;  3E0E A;  1HZA A;  1O7I A;  4GN5 A;  4PZ7 A;  1NR2 A;  2JA5 G;  3BDO A;  1MHW C;  2RHS B;  4AH6 A;  1TWH B;  2EYF A;  5ELF A;  1EYD A;  1FL0 A;  1M4V A;  2V4D A;  4RGM A;  2Q8T A;  4IJL A;  2TMP A;  3MFY A;  2J0T D;  4RCN A;  5CYU A;  3SR1 A;  4BWG B;  2KED A;  2EXZ A;  2Q2I A;  1NMF A;  5DLQ E;  1SYC A;  1NTG A;  4LF6 Q;  3OOC A;  1EU3 A;  1CA6 A;  5D65 A;  4K5W A;  5C5L A;  4WJ4 A;  3SXH A;  3MXU A;  1TWH H;  1CQV A;  3PO2 H;  2EQS A;  1MD2 D;  1CKN A;  4JBK A;  1CKM A;  4XT3 B;  5I2X A;  2A69 C;  4KD3 A;  1VQJ A;  1LV9 A;  2FXQ A;  3I4M G;  4Q0F A;  4G4K A;  2VB3 X;  2JA5 H;  4JW0 A;  3S2D B;  4DNR B;  3PIP 3;  3WOE A;  3NQI A;  2XGT A;  2PQA B;  5M9O A;  2BA1 A;  4APV A;  4DR4 Q;  1F2L A;  2D62 A;  4DR2 Q;  4RHR A;  1ML0 D;  2JA8 B;  4ULL A;  5IGD A;  1RKN A;  2PNR C;  1U0L A;  1X54 A;  3OSO A;  3H15 A;  1AP0 A;  4KY5 A;  2O5I C;  1DJR D;  1T5X D;  1GUW A;  3J80 c;  4FXD A;  3OWF A;  3CMA A;  1RTN A;  2RSO A;  1VQE A;  4C3I G;  4C3J B;  5EKK A;  2RHQ B;  1KTK A;  4DKA C;  1GOZ A;  1TWC B;  2N8N A;  1PV4 A;  3MEH A;  2EIF A;  4CDD C;  1EY9 A;  2DY8 A;  2JA8 H;  1KRS A;  3I4M H;  4A3M G;  4CDF C;  1YI2 A;  3PV0 A;  2RDH A;  3RLN A;  5I9O A;  5IE8 A;  5ELD A;  4C3I B;  4DAM A;  3RN5 A;  1A15 A;  1X9N A;  3HEJ A;  2ZJQ A;  3KUP A;  3K57 A;  1IL2 A;  1DOL A;  1E0B A;  2O4X A;  2ZJR A;  3TP8 A;  2Q2T A;  1V8Q A;  4C3J H;  1F9P A;  1T5E A;  3TN2 A;  5E1F A;  3J80 L;  1E3P A;  1E24 A;  1BOS A;  1TWC H;  2EYL A;  4KY6 A;  2JSO A;  2YTY A;  5J39 A;  1O7Z A;  1N33 Q;  1IZ6 A;  2L11 A;  2JN4 A;  4QGU A;  2EE1 A;  1JWU D;  2BDO A;  4C3I H;  4PZ6 A;  1JOR A;  5LMN W;  1EZ6 A;  3MVV A;  2NVT B;  5G3L D;  3QO2 A;  2EJF C;  3EIV A;  5COY A;  2EJG C;  3A54 A;  5JJK A;  4OXP A;  2K7V A;  3DM3 A;  2EY2 A;  3DWQ A;  4A3M H;  5C0X I;  5JPM C;  3OIQ A;  3ULL A;  1I5F A;  4HIM A;  4JI3 L;  3OTO L;  1IW7 D;  1HXY D;  1JQY D;  3OMC A;  2TSS A;  4JI2 Q;  1HZC A;  2NN6 G;  4DV2 Q;  1VQM A;  1K8G A;  2VQE Q;  2F1M A;  2KEN A;  1IBM Q;  1XXG A;  2NVT H;  1BXT A;  4CJ2 C;  1IXR A;  3S1M B;  1XNR L;  2F0I A;  1PFB A;  1V1O A;  3TRE A;  1TS2 A;  2WFW A;  4POF A;  2RVL A;  5T1I A;  4A3J B;  1LYL A;  2UU9 Q;  5D14 A;  3U4V A;  5C3E G;  3U50 C;  3HOX G;  1KAW A;  2K5D A;  5CV8 A;  5GQO A;  3BDL A;  4NPS A;  1VQP A;  3HOV B;  4FO2 A;  1GUG A;  4PZ8 A;  3KF8 A;  1OXX K;  2CQO A;  4EX5 A;  3JAM E;  2QKI C;  1EY4 A;  1WJJ A;  2JP1 A;  3S1M H;  4BY1 B;  1FNW A;  2XWJ B;  1H95 A;  1YNN C;  4JK1 C;  1C48 A;  4DV3 Q;  3HOX B;  4A3J H;  3E6Z X;  4BA2 I;  4LUO A;  4IPG A;  2UXD L;  3HKZ G;  2HIX A;  1DON A;  2AQ2 B;  2AKW B;  2PZW A;  4C56 C;  1J8I A;  3R93 A;  3C3L A;  1G2T A;  1WTH A;  2E2J H;  3S1N B;  3PQI A;  4BBR G;  3K6O A;  1SFO B;  5DM6 3;  2WAC A;  5EBC A;  1ASZ A;  3HOV H;  1TS3 A;  4AQY Q;  1TS5 A;  5HY6 A;  4BY1 H;  3WOF A;  5C3E H;  1Z7T A;  2VY3 A;  3HOX H;  1V1Q A;  2K5V A;  2ES2 A;  4DAY B;  4L6T B;  4CHT B;  4BBR B;  1QJO A;  4K8J A;  3TP6 A;  5JJI A;  4B9X A;  3E9I A;  3H3V C;  1DOK A;  4R9W A;  3UDI A;  4AYB B;  3FPP A;  1EY7 A;  2E76 C;  1SNM A;  3FEW X;  1BO0 A;  4JBW A;  2JA7 B;  4DK1 A;  1CQF A;  3C1F A;  1YHB A;  3RMH A;  4HID A;  1PH6 A;  1MI2 A;  1HJP A;  3CQZ B;  4NKL A;  3RNU A;  2RF4 A;  2F4V L;  3HOW B;  4BBR H;  1HNZ L;  2BH8 A;  4ILW A;  1GXD C;  2RDG A;  1FD7 D;  1JCK B;  1JOO A;  4CKB A;  1XNQ L;  4JVZ A;  3L2P A;  2PNH A;  3GTJ B;  3EFX D;  1UE7 A;  3CPF A;  2EZV A;  2SEB D;  4ZKC B;  4JI6 L;  3PO3 B;  2JA7 H;  5KYL A;  1E2W A;  2F0N A;  3BU2 A;  1O80 A;  4YHH L;  5M3M G;  2UXC Q;  3F2U A;  1B9M A;  1PFS A;  5BN3 A;  1BKB A;  3CQZ H;  3M3Y H;  1G51 A;  3CC4 A;  4DUZ Q;  4GS3 A;  4GKJ Q;  1F2Y A;  3NEL A;  3OMG A;  3RLF A;  3M4Q A;  4DV7 L;  1PA6 A;  2EOT A;  1JWS D;  1LT5 D;  1ENA A;  1LTA D;  5M3M B;  1JWM D;  2L9H A;  1STE A;  5I6Y A;  3P7J A;  3W1B A;  2O5J C;  3GTJ H;  1DM0 B;  1PMR A;  3STB D;  3PO3 H;  3A74 A;  1E1O A;  4QIW E;  2GN5 A;  4GLA C;  1PFN A;  4QUC A;  4GN3 B;  1WYD A;  2UUB L;  5FK9 C;  1D1K A;  1J5E Q;  3CAM A;  1S72 A;  3EQL C;  5C4J B;  1B70 B;  3KOJ A;  2MP1 A;  3GTK B;  1Y14 B;  5IOD A;  3I73 A;  4L63 B;  4G7Z C;  5M3F B;  4KJN A;  3KJO A;  2F0E A;  1KLG D;  2D0P A;  3MXN A;  4PNY A;  4X3T A;  4DFA A;  5M3M H;  5ELB A;  1TWG B;  1KLU D;  2JYO A;  3J80 i;  3J81 j;  4LF4 L;  2CVR A;  1HHV A;  4X65 Q;  3QWN A;  3V05 A;  3SK5 A;  5DNF A;  3LWE A;  4NXM Q;  1STH A;  2I07 B;  1L1O B;  3S2H B;  4R4T A;  4TRD A;  1LUZ A;  2A5H A;  1H9R A;  2SDF A;  3UDF A;  5C4J H;  3GTK H;  4ZUJ A;  4B3S Q;  4DGZ A;  4V19 0;  3SK8 A;  4HJA A;  2AQ1 B;  4LAA A;  1WCM G;  1PZK D;  1L1O C;  3FHW A;  3X3N A;  3W1G A;  4BXX G;  1L0Y B;  4J15 A;  3M4O B;  1ET6 A;  3S24 A;  4JI1 Q;  2P5Z X;  2NUC A;  4P73 A;  1CZG A;  3FPU B;  3S2H H;  1Q46 A;  2ZTC A;  1A62 A;  1WCM B;  2VW9 A;  2OT2 A;  4DV5 L;  2BE5 D;  1Q90 A;  4DV0 L;  4H7B A;  2K33 A;  3TS0 A;  4EQP A;  1VQ6 A;  1HA5 A;  1UAP A;  1Z9F A;  2G9H D;  4DV1 Q;  2R7Z B;  2C9O A;  4LF5 L;  3M4O H;  4YCV A;  1ASY A;  4ODG A;  3R2T A;  3KDF B;  4DF7 A;  5ELE A;  3PGZ A;  4KLK A;  4HJ5 A;  2EJM A;  1KL9 A;  2PZU A;  1WCM H;  1HQM C;  4QUF A;  3URY A;  1YJ9 A;  2CWA A;  1VF5 C;  2E74 C;  2L1B A;  4HTH A;  2CH4 W;  1B1Z A;  3EJI A;  3CXC A;  2F0S A;  5I2Y A;  2NWG A;  2B2Y C;  5CV5 A;  2R7Z H;  2F3W A;  2X6L A;  4O42 A;  4KHP Q;  3HKS A;  1I6V C;  5JJZ A;  1OO9 B;  3DHQ A;  4KHZ A;  5C44 G;  1UE1 A;  2JJQ A;  2A73 B;  2XNA C;  1RL2 A;  5CBE E;  2K1B A;  1JB7 A;  1PTO D;  3QIA A;  2Q2H A;  2E5L L;  2XRQ D;  2NVY H;  3F2C A;  3WDN A;  2HQE A;  2A68 C;  3G6J B;  4FF3 A;  1VQ7 A;  3D3R A;  2VS1 A;  3AQQ A;  4DR1 Q;  4R4Q A;  2DJG C;  3GTL H;  2R92 B;  5C44 B;  5LMN L;  3I56 A;  5CMD A;  4Y7N H;  3I4O A;  3KK7 A;  2R6G A;  1UUP A;  4HMI A;  3L7Z C;  3G71 A;  2R93 B;  4MZ9 A;  1WTR A;  4JBJ A;  3FDT A;  5EKL A;  5GRO A;  4A3B B;  4JI4 Q;  1PYS B;  2G5D A;  3BG3 A;  1EQV A;  2MHV A;  2XIW A;  5C44 H;  1SMY C;  4NDX A;  1Q1E A;  1DOM A;  1H9S B;  2K28 A;  1SRU A;  3DEO A;  2ID0 A;  4CDC C;  1LAC A;  3NEM A;  1WTQ A;  3GV3 A;  4YY3 L;  2B2V A;  1HNX Q;  3GTM B;  1HQR D;  1CUK A;  1FGB D;  1KNA A;  1LO5 D;  1SAP A;  2Q8I B;  4C2M H;  1A3T A;  4FDB A;  5I6W A;  3BYT B;  1SJE D;  4HIO A;  4QL5 A;  3RN2 A;  4B3M Q;  4YWM A;  2RSN A;  4B3T Q;  2BCO A;  2K75 A;  2MNA A;  1PRT B;  2RCN A;  3CPW A;  1KQS A;  1I4H A;  3GTM H;  2A74 C;  4RAU C;  1V1P A;  5FKA C;  5C4X G;  1PZJ D;  2N78 A;  4LFA L;  1VDZ A;  4IUP A;  3CF5 A;  4K6D A;  1PRT F;  1R4P B;  1PRT C;  4HCS A;  3BJU A;  4DR7 Q;  4EQO A;  3L3O C;  2QA4 A;  5IYD G;  1BCP D;  1MJC A;  4R1J A;  3JC6 6;  3FRP B;  2AWO A;  4IN3 A;  4JV5 L;  2PQA A;  2KCT A;  1BR9 A;  3I7F A;  1CSQ A;  2MFI A;  2KJX A;  4QJF A;  3I55 A;  3S1R H;  2WB1 G;  5EBD A;  3L9A X;  3T1Y Q;  3OPO A;  2Z9H A;  2F0Q A;  5M5X B;  2PW5 A;  3U9O A;  2CH4 A;  4FVM A;  3KJP A;  4LF9 L;  5EGT A;  5KNC A;  3I91 A;  1I6H H;  2NTS A;  2WB1 B;  2EYO A;  5IY0 A;  5IWA L;  4JI8 Q;  1Y1V G;  2PCF B;  1SE8 A;  4CJ1 B;  1S3O A;  3QG1 A;  1ZYR D;  2OEO A;  4JI5 L;  2Y0S G;  3MEF A;  4CJ0 B;  2KBN A;  5IYD H;  2EPB A;  1VQL A;  5CV9 A;  3ER0 A;  4LFB Q;  2XSC A;  3M4P A;  5M5X H;  4WJW A;  1FJG Q;  1H9J A;  3SVM A;  3PIP A;  2PMZ B;  3DWP A;  1RTO A;  4NXN Q;  1X55 A;  1EZ8 A;  1JJ2 A;  4B3R L;  1HA6 A;  1U4P A;  2NYZ D;  5LMU Q;  1QZG A;  1TVX A;  3M4Y A;  1EL0 A;  1EY6 A;  2R61 A;  2R7D A;  1GHJ A;  1EWH A;  2B29 A;  4HAE A;  2K50 A;  1SMX A;  4NW2 A;  5LL6 S;  3MAQ A;  4KJO A;  4N8F A;  1EUJ A;  2CW0 C;  2PYK A;  3ULP A;  3J81 E;  1SN8 A;  3V2T A;  1X65 A;  1EU4 A;  1X3P A;  2NB0 A;  1I50 B;  3PUY A;  5EPL A;  3MA2 B;  3KBX A;  1JJC B;  3L0O A;  2M2L A;  4H13 C;  4KKS A;  1VCI A;  5M5Y B;  2SNM A;  1YBY A;  4KN4 C;  1F9S A;  1JE5 A;  1G6Z A;  4A3D G;  3K59 A;  2DNE A;  4QCL A;  2DNC A;  3MXG A;  3VDY A;  4ME5 A;  2EYJ A;  2ZM6 L;  1GD7 A;  3SHL A;  1JT8 A;  2MPM A;  3C46 A;  3VYU A;  3VYR A;  1EQT A;  1V1P B;  1SYB A;  1I50 H;  3SGI A;  3NSW A;  1VQH A;  4A3D B;  4B08 A;  4CGY B;  3A8K E;  2B2U C;  1PLF A;  2HHH L;  1ONL A;  3MFG A;  3UE0 A;  1SYF A;  1QVG A;  4JI7 Q;  1U4M A;  5CBA E;  3CCL A;  4HJ9 A;  1MGS A;  1N34 L;  4DR3 Q;  4XIG S;  4HR7 B;  2WB1 E;  3H6M A;  1VQ9 A;  4UY8 C;  4RWS C;  2E75 C;  1MSH A;  2JK8 A;  3M7N A;  4GLX A;  2JA8 G;  2HT1 A;  4RA8 A;  4EQN A;  3G7L A;  1E2Z A;  2MJ8 A;  5J1Z A;  4A3D H;  4U68 A;  1QVF A;  1HRJ A;  3DUZ A;  4C1N K;  2PMZ E;  3NTI A;  3IKJ A;  4C3J G;  1KHI A;  1VQ4 A;  1AE3 A;  3PUW A;  3CC2 A;  2Y0S E;  4Z9C B;  2F0W A;  4LF6 L;  3JAM c;  1BBU A;  1N36 L;  3GTG B;  2E2H B;  2EY1 A;  3M85 A;  1WOC A;  3DWA A;  5AJ3 Q;  3S2D H;  5BN4 A;  1Z6H A;  5JEA J;  4DAV A;  3BDC A;  5J22 A;  3OIP A;  4A3I B;  4DV6 Q;  3HOY B;  1I94 Q;  2OTJ A;  2G9D A;  5C4H A;  2OQK A;  1HZB A;  2C35 B;  1BQQ T;  1B44 D;  3GQB A;  4B9W A;  1XMO Q;  4DAY A;  2L15 A;  3KLS A;  4DR4 L;  3GTG H;  1MJE A;  3TME A;  2XRS D;  3NTK A;  4DR2 L;  3CCS A;  1Y8P B;  4YCU A;  1XWE A;  2A1A A;  1KC8 C;  3JAM L;  5FLX E;  3T1H Q;  2IY5 B;  2Q2U A;  1YEZ A;  1HR0 L;  4QQB X;  4XQN A;  1VQD A;  5HUR A;  3NPP A;  1HZ9 A;  3HOY H;  1ROD A;  1NMG A;  4O1N A;  2F0T A;  2K03 A;  3CCJ A;  3KLW A;  4UAI A;  4GNX B;  4JI3 Q;  4E6I A;  1CA5 A;  1BF4 A;  2K05 A;  5JEA G;  4JCV E;  4DXF A;  5G3L F;  2Q8R E;  1EEI D;  1SXT A;  2DN8 A;  4X6A H;  1C4Q A;  1ET9 A;  4F88 A;  4GNX C;  4A3J G;  1EYC A;  2EYH A;  3P1H A;  1V43 A;  1NJI C;  2ZTD A;  2EDG A;  1B50 A;  3F1Z A;  1NBW A; 
#chains in the Genus database with same CATH homology
 1CSP A;  4HIK A;  1N33 L;  2AWN A;  1J5E Q;  1FJG L;  3CAM A;  4NB3 A;  1S72 A;  3K8A A;  1B70 B;  3KOJ A;  1PH4 A;  1Y14 B;  1L0W A;  3HOV G;  4IPC A;  2HHH Q;  3GD7 A;  2ASB A;  4OO1 I;  4IFD I;  2HIV A;  3KJO A;  1XPU A;  1OTC A;  1FGU A;  2B3G A;  3HOZ H;  1N32 L;  2D0P A;  1B8A A;  5EAY A;  4BY1 G;  5M3M H;  1KIX A;  4A75 A;  3TRZ A;  1PYB A;  4JI4 L;  3J80 i;  1X56 A;  1J6Q A;  3J81 j;  3CME A;  1E22 A;  1K3R A;  4LF4 L;  2WAQ G;  5M5Y H;  3F2D A;  4X65 Q;  1E7Z A;  2H5X A;  4GN4 B;  4LFA Q;  3S14 H;  3Q8D A;  3A5U A;  2UXD Q;  4UPA A;  4NXM Q;  3IRB A;  1Q7Y C;  4X64 Q;  3CC7 A;  3J7A 5;  1L1O B;  5GAD C;  2B63 H;  4HJ8 A;  4R4T A;  1LUZ A;  5C4J H;  3UDF A;  3GTK H;  4IFD J;  2NVX H;  4B3S Q;  2I0Q A;  4A3K H;  5K36 G;  2VQE L;  2UUB L;  1L2F A;  4HJA A;  1HNX L;  1XTD A;  2GVB A;  1IBM L;  1A63 A;  1YNX A;  1WCM G;  3H0G H;  1XMQ L;  1W3S A;  2A8V A;  3AEV A;  1L1O C;  3FHW A;  1YHQ A;  3W1G A;  4BXX G;  1XPR A;  4GLV B;  1N36 Q;  3RLO A;  4A3C G;  2AMC B;  4A93 G;  3PUV A;  4J15 A;  3ZJY C;  3G48 A;  2VQF L;  1P16 A;  1HNW L;  3S24 A;  1AH9 A;  4X66 L;  4K0K L;  2UU9 L;  1L1O A;  4JI1 Q;  4JC0 A;  2QEX A;  4TQU S;  4P73 A;  1KRT A;  5HGQ A;  4PMW A;  4B3M L;  1OXU A;  3PSI A;  3CD6 A;  1HH2 P;  1Q46 A;  3S2H H;  2ZTC A;  1A62 A;  1R9T H;  4AYB G;  1PH3 A;  4Y52 H;  2VW9 A;  4DV5 L;  4A3I G;  3HOY G;  4OON A;  1KXL A;  2MO0 A;  4DV0 L;  4JI7 L;  2JA7 G;  4A3F G;  3TS0 A;  4LF9 Q;  5IYB G;  5IP9 H;  1UWV A;  5ELN A;  1VQ6 A;  1QVC A;  1Z9F A;  1VQ5 A;  2WP8 J;  2PI2 E;  4DR3 L;  4R4I A;  4DV1 Q;  4JOI C;  1UE5 A;  1YHA A;  4LF5 L;  4LFC Q;  2Z0S A;  2ZTE A;  3CCE A;  3M4O H;  5IWA Q;  3PIO A;  2VZA A;  3HOW G;  4YCV A;  1VQA A;  3K7A H;  1OXT A;  3WWV A;  1NE3 A;  1ASY A;  3S1N H;  1VS0 A;  3KDF B;  1SFO H;  3AFP A;  4JI5 Q;  1GO3 E;  3CCU A;  4OO1 G;  4IPH A;  3G4S A;  3PGZ A;  4KLK A;  2LSS A;  4HJ5 A;  3U58 A;  4IFD G;  4P74 A;  3H3V H;  5IP7 H;  1HR0 Q;  3HOU G;  1KL9 A;  1YJN A;  1WCM H;  1UE6 A;  5BR8 L;  1U5K A;  3M9B A;  1YJ9 A;  4A3G G;  2CWA A;  4A3C H;  2E2H H;  3CW2 C;  4A93 H;  3RZO H;  1P8L A;  3PO3 G;  1SLJ A;  4LUV A;  1SRO A;  1X3G A;  3CXC A;  4IOC A;  4BY7 G;  2LXJ A;  3KFU A;  3I4N G;  4YHH Q;  3ERS X;  1K83 H;  4LWC A;  1GVP A;  3S1Q H;  2D0O A;  3W5O A;  1JMC A;  3KDF A;  2R7Z H;  4KHP Q;  3HKS A;  4P71 A;  5C4X H;  4KHZ A;  4GOP B;  5C44 G;  1UE1 A;  2JJQ A;  3CP0 A;  1RL2 A;  2DGY A;  4A3I H;  2IX1 A;  2YYZ A;  2E2I H;  4OX9 L;  2K5H A;  1JB7 A;  1V9P A;  2Q2H A;  5AJ3 L;  4A3F H;  2IHE A;  2E5L L;  5IYB H;  1X3F A;  1QUQ B;  3J81 i;  4LF8 Q;  2NVY H;  3K0X A;  3F2C A;  1PVO A;  4DR5 L;  3A5Z B;  3TQY A;  1VQ7 A;  4GOP C;  2VS1 A;  3OTO Q;  3AQQ A;  2E8G A;  4R4Q A;  4TVA B;  1GKH A;  4DV6 L;  4DR1 Q;  1I94 L;  3GTL H;  5GAH C;  3HOW H;  5LMN L;  3I56 A;  3NBH B;  4Y7N H;  3I4O A;  4GOP A;  1GM5 A;  2R6G A;  4MNO A;  2OTL A;  1XMO L;  1C7Y A;  2F3I A;  3L7Z C;  1M90 C;  2KHI A;  1EWI A;  3HOU H;  3G71 A;  4A3E G;  4RG1 A;  1XNR Q;  1UEB A;  4A3G H;  2R7F A;  2ZM6 Q;  3T1H L;  4A3K G;  1MIU A;  4MZ9 A;  5M3F G;  4JYA L;  2JA9 A;  2GVA A;  4JBJ A;  4L5S A;  4BY7 H;  3EN2 A;  1N32 Q;  5GRO A;  4LFB L;  1FVI A;  1M1K C;  2OCE A;  4JI4 Q;  1PYS B;  1Q86 C;  1B7Y B;  5C44 H;  1A0I A;  4NXN L;  4LF7 L;  1KD1 C;  3NEN A;  3PO2 G;  2HQL A;  3KF6 A;  5LMU L;  1PH7 A;  1WFQ A;  2KCM A;  1WYD A;  1Q1E A;  4KI0 A;  3JAM i;  1VQF A;  3GO5 A;  1IBL L;  1N34 Q;  1Q1B A;  1A8V A;  1SRU A;  1Z47 A;  3PUX A;  4A3L G;  4DUZ L;  1Y1V H;  2NVQ H;  4UP7 A;  5FLM G;  2ID0 A;  4GKK L;  2LXK A;  3E0E A;  1HZA A;  1O7I A;  4GN5 A;  4PZ7 A;  3NEM A;  2JA5 G;  4AYB E;  4YY3 L;  2RHS B;  5IP9 G;  4AH6 A;  1PHJ A;  1HNX Q;  3BZK A;  1FL0 A;  3TEH B;  1XMQ Q;  4IJL A;  3E9H A;  1I3Q H;  4X62 Q;  4A76 A;  1CUK A;  4QY7 A;  1LTL A;  2VQF Q;  4A3E H;  4L5T A;  4YCW A;  4K0K Q;  1CKN B;  4C2M H;  4JI2 L;  2CFM A;  4FDB A;  4DV2 L;  4HIO A;  4QL5 A;  2YTX A;  2Q2I A;  5M3F H;  1NMF A;  4POG A;  5DLQ E;  3RN2 A;  4B3M Q;  4DV4 L;  4DR6 Q;  5IP7 G;  1NTG A;  1TWG H;  4YWM A;  1PH8 A;  4LF6 Q;  4B3T Q;  2Z6K A;  3AFQ A;  4ALP A;  1K8A C;  4DV5 Q;  2K75 A;  1X6O A;  1K9M C;  3FKI G;  4WJ4 A;  5GAE C;  3LGJ A;  1TWH H;  2MNA A;  3EBE A;  3PO2 H;  2EQS A;  2RCN A;  2YTV A;  1X3E A;  3CPW A;  2DUD A;  1CKN A;  4EQ5 A;  1KQS A;  2R7Z G;  4JBK A;  1CKM A;  3GTM H;  2UUA Q;  4LF5 Q;  5C4X G;  3RZD H;  1VQJ A;  4A3L H;  2N78 A;  4LW1 A;  4LFA L;  1W2B A;  2FXQ A;  3OW2 A;  3I4M G;  5FLM H;  3CF5 A;  4NXM L;  2JA5 H;  1TXY A;  1CKO A;  2XTI A;  2AHO B;  2XGT A;  3BJU A;  4DR7 Q;  1YIJ A;  2PQA B;  2BA1 A;  4APV A;  4DR4 Q;  4AIM A;  4DV3 L;  2CKZ B;  2D62 A;  2QA4 A;  4DR2 Q;  4OWT B;  2F4V Q;  2UXB Q;  5IYD G;  3DLL A;  1MJC A;  3UDG A;  4R1J A;  1U0L A;  1HNZ Q;  1X54 A;  1PH1 A;  3H15 A;  2JEA I;  4JBM A;  1PH9 A;  3CCQ A;  3JC6 6;  2MO1 A;  3CCM A;  3BZC A;  2AWO A;  3F8T A;  1XNQ Q;  3RR5 A;  3J80 c;  3B6Y A;  1EIY B;  2NN6 I;  3GTP H;  4JV5 L;  1PH2 A;  3K80 C;  2PQA A;  3FKI H;  2CCZ A;  4JI6 Q;  3CMA A;  4OX9 Q;  2KCT A;  3TS2 A;  5FJ8 G;  1VQE A;  3I7F A;  2E5L Q;  1CSQ A;  2MFI A;  4QJF A;  4AQY L;  2RHQ B;  1WI5 A;  2WB1 G;  3I55 A;  3S1R H;  3T1Y Q;  4DKA C;  1NY4 A;  2N8N A;  1PV4 A;  4WJ3 M;  2NZO A;  1LM0 A;  2EIF A;  2R92 G;  2JA8 H;  2VUM G;  4LF9 L;  4DNI A;  1KRS A;  3KJP A;  4HJ7 A;  3I4M H;  4A3M G;  4A4I A;  2ALY B;  4RMF A;  2OQ0 A;  3PV0 A;  2K14 A;  1YI2 A;  4UP9 A;  3RLN A;  5IE8 A;  4JI0 Q;  4DV7 Q;  4DAM A;  3RN5 A;  2CWP A;  4LFC L;  1X9N A;  1IBK L;  1I6H H;  3HFZ B;  5IY0 A;  2ZJQ A;  5IWA L;  4JI8 Q;  1Y1V G;  1IL2 A;  1EQR A;  1SE8 A;  2R93 G;  1VQN A;  1S3O A;  2ZJR A;  4JI5 L;  2Q2T A;  1D8L A;  2Y0S G;  3MEF A;  4JG2 A;  3D31 A;  4C3J H;  1K73 C;  2KBN A;  5IYD H;  1VQL A;  4A3B G;  5H1S E;  1E3P A;  1EIF A;  3ER0 A;  1E24 A;  4IPD A;  4LFB Q;  1TWC H;  3M4P A;  2UUB Q;  2YTY A;  5M5X H;  1N33 Q;  1FJG Q;  1IZ6 A;  3PIP A;  3KF6 B;  1AE2 A;  3D0F A;  4QGU A;  4NXN Q;  1X55 A;  1T9H A;  1JJ2 A;  4B3R L;  5LMU Q;  1QZG A;  5FJ8 H;  4C3I H;  4PZ6 A;  4KHP L;  5LMN W;  2ZJP A;  1IBL Q;  2JA6 G;  4OWW B;  1E1T A;  3EIV A;  2R7D A;  3STB C;  4DUY L;  4GKK Q;  3KYH C;  2B29 A;  4LF4 Q;  2K50 A;  1SMX A;  2R92 H;  5JJK A;  4OXP A;  1EUJ A;  3F2B A;  5IT9 c;  2VUM H;  3DM3 A;  3ULP A;  1SN8 A;  5C0X I;  1VQG A;  1X65 A;  3FP9 A;  4A3M H;  2UXC L;  3ULL A;  1I5F A;  4P75 A;  4HIM A;  1BBW A;  3PUY A;  2OWO A;  4JI3 L;  3J7Z C;  1DGS A;  1JJC B;  3OTO L;  3L0O A;  4IOA A;  1BVS A;  1VCI A;  1YBY A;  4L5Q A;  1EQQ A;  3AYH B;  4GKJ L;  2R93 H;  4JI2 Q;  1HZC A;  2NN6 G;  4DV2 Q;  1JE5 A;  1VQM A;  1K8G A;  2VQE Q;  5M5W H;  4A3D G;  2JEB I;  2KEN A;  1YIT A;  4DV4 Q;  1Q81 C;  4A3B H;  1IBM Q;  2JQO A;  2NVT H;  3HKZ E;  3U4Z A;  1VQB A;  3VDY A;  2UUC L;  1IXR A;  1YVC A;  1XNR L;  2PI2 A;  3TRE A;  3KF8 B;  1GD7 A;  4IJH A;  2ZM6 L;  2WFW A;  5ELO A;  4POF A;  2F52 A;  1HNW Q;  4DK6 C;  4YWK A;  1VQI A;  1JT8 A;  4X66 Q;  1LYL A;  5C0X J;  2UU9 Q;  3S16 H;  3U4V A;  1IYJ B;  1RIP A;  1PH5 A;  2Z6K C;  5JJL A;  5C3E G;  1I50 H;  3SGI A;  2QGQ A;  3U50 C;  1VQH A;  1EYG A;  3HOX G;  1JJG A;  2I5L X;  1J5E L;  1KAW A;  4O0A A;  3J81 c;  2JA6 H;  1OXS C;  4P72 A;  5GQO A;  4NPS A;  3CCR A;  1VQP A;  2HHH L;  3PF4 A;  3UE0 A;  4DV0 Q;  1QVG A;  2K5N A;  4JI7 Q;  4PZ8 A;  3G6E A;  2KHJ A;  4L5R C;  1OXX K;  2CQO A;  2N3S A;  4EX5 A;  4BBS G;  1WJJ A;  4H02 A;  3UDX A;  3CCL A;  4HJ9 A;  1N34 L;  3S1M H;  4DR3 Q;  1H95 A;  3S15 H;  4XIG S;  2WB1 E;  1YZ6 A;  4DV3 Q;  5IYC G;  1VQ9 A;  4UY8 C;  4R4O A;  4A3J H;  1Y1W G;  2JK8 A;  4X65 L;  3M7N A;  1TWA H;  4GLX A;  2JA8 G;  4BA2 I;  4PG3 A;  2HT1 A;  1N9W A;  4LUO A;  4IPG A;  1VQ8 A;  2UXD L;  3HKZ G;  2HIX A;  4X64 L;  4A3D H;  2K52 A;  5J3B A;  2AKW B;  4X62 L;  1QVF A;  4UP8 A;  5BR8 Q;  3PF5 A;  1G29 1;  2PMZ E;  3A0J A;  3PCO B;  2E2J H;  4BBR G;  1ASZ A;  4B3S L;  3HOV H;  4JV5 Q;  2VNU D;  1KHI A;  1XPO A;  1VQ4 A;  4DR6 L;  1AE3 A;  4O2D A;  4AQY Q;  5HY6 A;  3PUW A;  2YV5 A;  2Y0S E;  4MTN A;  3CC2 A;  3ULJ A;  5C0X G;  5C3E H;  4B3T L;  2VY3 A;  4BY1 H;  4DPG A;  3JAM c;  1C9O A;  1BBU A;  1N36 L;  3HOX H;  3GTQ H;  2MQH A;  1D7Q A;  1V1Q A;  2K5V A;  1Q12 A;  4YWL A;  3M85 A;  4JI1 L;  1WOC A;  2ES2 A;  4DAY B;  1MKH A;  5AJ3 Q;  3S2D H;  5JJI A;  4BBS H;  3E9I A;  2UUA L;  3CCV A;  1IBK Q;  2EXD A;  3ICE A;  5JEA J;  3PUZ A;  4DR5 Q;  4LUZ A;  4XTC S;  4JOI A;  3UDI A;  5IYC H;  1VQO A;  4DV6 Q;  2OTJ A;  1I94 Q;  1Y1W H;  1VQK A;  1SR3 A;  4JBW A;  2OQK A;  5LMN Q;  2V1C C;  1HZB A;  4OWX B;  2C35 B;  3OYY A;  1YHB A;  4HID A;  1XMO Q;  1PH6 A;  4DV1 L;  4DR7 L;  2L15 A;  4DR4 L;  3GTG H;  1HJP A;  3GDE A;  4C3H H;  1S40 A;  1MJE A;  4BXX H;  3RNU A;  1EFW A;  4DR2 L;  2RF4 A;  3CCS A;  2F4V L;  2UXB L;  4YCU A;  2K4K A;  2A1A A;  1KC8 C;  4B3R Q;  1Q8K A;  3T1H Q;  4BBR H;  2BH2 A;  1HNZ L;  4JYA Q;  2IY5 B;  2BH8 A;  2Q2U A;  1YEZ A;  1HR0 L;  4QQB X;  2JE6 I;  2I5M X;  1XNQ L;  1VQD A;  2IHF A;  3L2P A;  3GTO H;  2I5H A;  1HZ9 A;  1VQC A;  2PNH A;  1UE7 A;  3CPF A;  4DUY Q;  1N8R C;  3HOY H;  1G6P A;  4JI6 L;  4LF6 L;  1NMG A;  2JA7 H;  3K7U C;  4LF7 Q;  3BU2 A;  3H3V I;  3HOZ G;  4YHH L;  5M3M G;  3T1Y L;  3CCJ A;  1OXV A;  3KLW A;  2UXC Q;  1EOV A;  1K0R A;  1PFS A;  4R4C A;  2YU9 H;  1BKB A;  3CQZ H;  3M3Y H;  4GNX B;  1G51 A;  4JI3 Q;  1HR0 W;  3CC4 A;  3UE1 A;  4IO9 A;  2A19 A;  4DUZ Q;  4GS3 A;  3K81 C;  4GKJ Q;  2IT1 A;  5JEA G;  2BA0 A;  3NEL A;  2WAQ E;  4JCV E;  4LNQ A;  2ATW A;  1TWF H;  3RLF A;  4YY3 Q;  4JI0 L;  1YJW A;  2IX0 A;  3M4Q A;  4DV7 L;  1PA6 A;  2VL6 A;  4LF8 L;  5FLX c;  2B63 G;  4DK3 C;  4X6A H;  2UUC Q;  5GAG C;  4JI8 L;  1QZH A;  1Q82 C;  4GNX C;  3W1B A;  3GTJ H;  3I2Z A;  1QUQ A;  4DR1 L;  3STB D;  4A3J G;  5E7N A;  3MXN B;  1V43 A;  3A74 A;  4BA1 I;  1NJI C;  2ZTD A;  3S17 H;  3PO3 H;  1E1O A;  4GNX A;  4ME3 A;  1C0A A;  4QIW E;  3H0G G;  3I4N H;  2GN5 A;  4GLA C;  1XJV A;  3F1Z A;  1NBW A;  4GN3 B;  2N49 A;  2NZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...