3I4OA

Crystal structure of translation initiation factor 1 from mycobacterium tuberculosis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
68
structure length
68
Chain Sequence
GAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor IF-1
publication title Structure of translation initiation factor 1 from Mycobacterium tuberculosis and inferred binding to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 16
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4oA00
2I5MX 4A3BG 1KL9A 5JJIA 2F3IA 3IRBA 4K0KQ 2CCZA 4IJLA 1EQQA 4QY7A 4UPAA 4JI3Q 3PUXA 3HOXH 3A74A 2JA6G 1D7QA 1YHQA 4BXXG 1WCMG 1G291 1A8VA 2E2IH 3PF4A 4LF5Q 1YJNA 4XIGS 2I5HA 4LF4L 1JT8A 2OTLA 4X62L 4A3JH 1PH4A 3CC2A 5IYBH 5LMUL 1YEZA 4GLXA 2JEBI 4GS3A 1BBWA 1V9PA 3HOWH 4KHPQ 1HZAA 2MFIA 3J81i 2FXQA 4X66Q 2UU9L 4GOPA 1HNZL 4IPGA 2CFMA 2NZHA 4R1JA 1TWCH 2R93H 1YJ9A 2MQHA 3CXCA 2ALYB 4R4OA 4JI0L 4JI8L 4DV5L 1LUZA 1NY4A 4IFDJ 1Z9FA 3K0XA 2UUCL 3PO2G 3F8TA 4DV1L 4DR3L 5M5XH 4QJFA 1R9TH 1VQLA 1Q1EA 4A3MH 2KCMA 1V1QA 4NPSA 5C3EH 4X6AH 1HZ9A 3DM3A 3E9IA 1B70B 1YZ6A 4DR1Q 4IFDI 1K8GA 5GADC 5J3BA 3PF5A 1EIFA 2WB1G 2YU9H 4ALPA 2Y0SG 1XNRQ 3FKIH 3CPWA 4A3KH 3HKZG 2K75A 3J7ZC 1UWVA 3ULJA 1NE3A 2AHOB 1EQRA 2KCTA 2BH8A 3CC7A 4LF8Q 2R92G 3PV0A 2WB1E 2WP8J 4DUYL 2AMCB 1A63A 3AFQA 4NB3A 4GNXB 3HKZE 2OQKA 5HY6A 2F4VQ 4A3CH 1DGSA 1FL0A 2IY5B 2N8NA 4C3IH 3PO3G 3S1MH 2BA1A 4A3IH 1YITA 4TQUS 3A0JA 5M5WH 1OXSC 2GVBA 4L5QA 2Q2IA 4DK6C 3CMAA 3TS0A 4LF6Q 4HJ9A 2GN5A 1N33Q 5FLMG 1HNWL 4A3LH 4JOIA 2BH2A 2JA7H 1WJJA 1UE5A 4R4IA 2QGQA 5IYCG 3H3VH 4C3HH 2PQAB 4A3BH 4DPGA 4P73A 5IY0A 4UP8A 3KJOA 3W5OA 1VQPA 1P16A 3B6YA 3M3YH 2HT1A 2JA6H 3KOJA 4HJ5A 2Q2UA 1HJPA 1WCMH 3KDFA 5IP9G 1L1OC 3L0OA 1XNQL 3S16H 3CQZH 2B29A 1QUQB 2ZTDA 4P72A 3W1GA 3KJPA 5IWAL 2C35B 1PH6A 1VQ4A 3S2DH 3TS2A 2WFWA 2R7ZG 3T1YL 1IBLL 1X3EA 4DV2L 3I7FA 1PV4A 3GTKH 4NXMQ 3CCLA 1YNXA 4JYAL 5IE8A 3ER0A 3UE1A 4YY3L 1PH8A 4JBKA 4JI4Q 1AH9A 1K3RA 1VQEA 4BBSH 4YCVA 3SGIA 3CCUA 1PFSA 4IOAA 3PO2H 3G6EA 3K7UC 4DV7Q 3AQQA 4DR6L 4A3DG 2MO1A 4LNQA 4B3TL 3J81c 4DUZQ 1Q7YC 3PUVA 3T1HQ 2E5LQ 4EQ5A 1HNXQ 3M7NA 5IYDG 4PMWA 4BY1H 1LYLA 1SMXA 1U0LA 3KDFB 3J7A5 1VQ8A 3RZOH 3CAMA 1GO3E 4NXNL 4QL5A 3TREA 4DKAC 3PCOB 1E24A 4L5SA 1N36L 4X64Q 4YHHL 4WJ4A 1N32Q 3RN5A 4DV0L 3AEVA 1LM0A 5M5YH 2NVYH 2ZM6Q 1Q82C 1A62A 5C44H 3I2ZA 2RHQB 1SLJA 3K8AA 4A3IG 3BU2A 3CPFA 1OXTA 4GN3B 1V43A 2Q2HA 3W1BA 1HR0L 1FJGQ 1XMOQ 1EYGA 3PO3H 2UUAL 1XPOA 1O7IA 4DV6L 2HIXA 1VS0A 3U50C 2NVXH 4A3LG 2UXBQ 1TWHH 2KHJA 4AYBE 3A5ZB 3KF6B 4YWMA 4UP7A 4LFBQ 2WAQG 3RLOA 1IZ6A 2VZAA 2D0OA 1XMQQ 1XJVA 3BZKA 5AJ3Q 2JJQA 5FLMH 5C0XG 4XTCS 3CCVA 4AQYQ 1CUKA 2XTIA 1CKOA 3RR5A 4MZ9A 2HQLA 2NVTH 1A0IA 5IYCH 4DV3L 2EQSA 4GNXC 3S24A 4DR2Q 1IBML 2CWPA 2V1CC 3CCEA 3M4PA 4OWWB 1U5KA 3JC66 3K7AH 4LFCL 1ASYA 1HH2P 5HGQA 5LMNW 1VQNA 2RF4A 2A1AA 3BJUA 1QZGA 4LF7Q 4DUZL 4GKKQ 1WYDA 1PH7A 4GKJQ 3PUWA 5IP9H 3F2DA 3HOUG 2VW9A 4IPHA 3NBHB 2R7FA 4LWCA 1VQJA 4OX9Q 3RZDH 2UUBL 2VQFL 4BBSG 4JI6L 2R7ZH 2A19A 2UXCQ 1Q12A 2IT1A 3PUYA 5C0XJ 1G6PA 2AKWB 1IYJB 5ELOA 3U4VA 1PYSB 2RCNA 1J5EQ 4LF9L 4JG2A 3OTOL 1NMFA 1TXYA 1PA6A 4DR4Q 4JC0A 4LFAL 3OW2A 2Z0SA 1VQ6A 4BY1G 3H3VI 3PUZA 1FJGL 5C0XI 3S1QH 2VQEL 3PSIA 4A3DH 4GLVB 1NMGA 4YWLA 4BA1I 1SR3A 3AYHB 3KLWA 4JI7L 4O2DA 3GD7A 5IYDH 2D0PA 5EAYA 2N49A 3UDIA 5FLXc 5C44G 4GN5A 1I94L 3I55A 2B63G 1JE5A 2DUDA 3S1RH 1KRSA 1KAWA 4PZ7A 2UXDQ 2Y0SE 2JK8A 3J80i 2KBNA 1VQAA 5IP7G 4GOPB 2ZJRA 4K0KL 5BR8Q 4JI3L 3M4OH 3TEHB 1JJGA 1KD1C 1H95A 4A76A 1Q86C 1IBKQ 4A93H 3CCMA 4LF5L 4JV5Q 3GTLH 4QIWE 1Q1BA 1Y14B 1VCIA 2PI2E 4GN4B 3GO5A 1MJCA 4DR7Q 4IPDA 1P8LA 3A5UA 4KHPL 4OWXB 3H15A 4IO9A 2HHHQ 1PH5A 2RHSB 1W2BA 2NVQH 2OCEA 2AWOA 2Z6KC 4X66L 3HOZG 3I4MG 4LUZA 3GDEA 1CSQA 4DV4Q 2JA8H 2NZOA 1GVPA 2MO0A 1CKMA 2K4KA 4RMFA 1K73C 4R4CA 3HOYG 1AE2A 1E7ZA 2VY3A 1C0AA 1TWGH 4X65Q 1RIPA 1PHJA 1YHBA 3K80C 2YYZA 4DR1L 1C7YA 1JMCA 4DR5Q 1PYBA 1VQBA 2YTVA 1XNRL 2VL6A 4KHZA 2EXDA 3L7ZC 3J81j 4IPCA 3KFUA 4IOCA 4JI1Q 3HOUH 1N34Q 4LUVA 4YWKA 1YI2A 1I3QH 4LF8L 2KENA 1S3OA 1GKHA 1KQSA 2ID0A 3G48A 4HJAA 1Q46A 3VDYA 2YTYA 5LMNQ 4L5TA 4R4TA 3FP9A 2F4VL 3HOVH 4B3RQ 2R93G 2LXJA 4P71A 1XTDA 3F2BA 3S15H 5JJLA 1CKNA 2ZTCA 1PH3A 2JA5G 1J6QA 2JA9A 3MXNB 4JI5Q 3JAMi 1VQCA 1E1OA 5C4XG 2MNAA 3FHWA 3ULPA 1GM5A 1JJ2A 4LF6L 4B3SQ 1N33L 2K52A 1HZBA 4A3GG 2E8GA 3CCJA 3CC4A 5JEAG 2N78A 4C2MH 2B63H 3GTQH 3UE0A 3U58A 4TVAB 2OQ0A 4A75A 3UDFA 4A3EH 4A93G 5M3FH 1X3GA 4R4QA 3CCRA 1L1OA 3RNUA 5IP7H 3PIOA 1Y1WH 4A3FG 4LF4Q 1VQFA 4X62Q 1FGUA 1X54A 5LMUQ 3HFZB 5GROA 2LSSA 3EBEA 3J80c 2K50A 1T9HA 2UU9Q 1HNZQ 2PI2A 4KLKA 1JJCB 1KIXA 2JA8G 1ASZA 4JI0Q 4DV5Q 1SRUA 4NXML 4DV1Q 1KC8C 4DR3Q 2H5XA 4DNIA 1BVSA 3EIVA 1PH1A 4L5RC 2ZTEA 4MTNA 4OXPA 4RG1A 4GOPC 3GTPH 3I4MH 3HOZH 2WAQE 4JI4L 2JE6I 3BZCA 1E3PA 3UDGA 3M85A 2VUMH 3RN2A 1E1TA 3RLNA 5E7NA 3S17H 4DV7L 4BBRH 1D8LA 1L1OB 1CSPA 1HR0W 3HOYH 1AE3A 1X3FA 3D31A 3T1HL 2E5LL 5GAEC 1VQMA 1HNXL 1B8AA 1YBYA 1QVGA 1XPUA 2R7DA 1KXLA 4HIMA 3PIPA 3MEFA 1FVIA 4C3JH 1OXXK 3NEMA 1N9WA 3GTJH 4DUYQ 4X64L 3S2HH 1SROA 1N32L 1X6OA 1BKBA 4APVA 4JBJA 4JCVE 2ATWA 2ZM6L 3S14H 3HOVG 1Y1VH 2I0QA 4LUOA 2KHIA 2EIFA 4HJ8A 3GTOH 1UE6A 3STBC 2CWAA 4DAYB 4POFA 3G71A 2IX0A 4HIKA 5M3MG 4POGA 2HIVA 4BY7G 2L15A 2XGTA 1TWAH 3ERSX 3H0GH 1XMOL 1K8AC 1I50H 4LW1A 2E2JH 3ULLA 1GD7A 1PH9A 2JEAI 1HNWQ 4KI0A 2UXBL 1I6HH 1EOVA 2JA5H 1MIUA 4LFBL 3NELA 5C4XH 1N8RC 4GNXA 4A3EG 3I56A 1VQGA 2K14A 4PZ8A 5M3FG 1VQOA 1XMQL 3NENA 5AJ3L 1M90C 4A3GH 3PGZA 4JOIC 4AQYL 1OTCA 1WI5A 2D62A 2I5LX 1Y1WG 1QVCA 1MJEA 2AWNA 2VS1A 4JBWA 3JAMc 3ICEA 1EUJA 2CKZB 1IL2A 2JQOA 1KHIA 4DR2L 1QZHA 5K36G 2YV5A 1XNQQ 5FJ8G 3KF8B 4P75A 1UE7A 1VQKA 4A3FH 2IHFA 5IWAQ 1K83H 4LF7L 4GKKL 3M4QA 4YCWA 3T1YQ 1PVOA 4GKJL 1IBLQ 4DV2Q 3STBD 2DGYA 4JYAQ 2PQAA 4AIMA 5GAHC 1K0RA 1SN8A 2R6GA 4YY3Q 1B7YB 1S40A 2ZJQA 4OX9L 2UXCL 1X9NA 4HJ7A 2VUMG 2ZJPA 1VQ9A 3GTGH 2N3SA 4PZ6A 4BBRG 3CCSA 2PMZE 2BA0A 1J5EL 4FDBA 4B3MQ 3CD6A 4DR6Q 3OYYA 4H02A 1NJIC 4B3TQ 1QUQA 3I4NG 4DR4L 1WOCA 4MNOA 3HKSA 2Q2TA 4WJ3M 4Y7NH 2E2HH 2A8VA 4BA2I 1C9OA 4NXNQ 3WWVA 2OWOA 4O0AA 1PH2A 1EIYB 1W3SA 1Q81C 1N36Q 1VQIA 3U4ZA 4YHHQ 1L0WA 3RLFA 4DV0Q 2IHEA 1S72A 4JI2Q 1L2FA 2VNUD 3UDXA 3HOXG 1Y1VG 1VQ5A 1YHAA 2UXDL 2ASBA 3TRZA 3TQYA 1YJWA 1XPRA 4QQBX 1UEBA 3K81C 3ZJYC 5BR8L 4A3JG 3H0GG 1HR0Q 1WFQA 5IYBG 4OO1G 5IT9c 4P74A 1VQDA 1EFWA 2UUAQ 4BXXH 4DV6Q 2OTJA 2ES2A 1YIJA 1IBKL 1MKHA 3HOWG 3CP0A 1I5FA 4PG3A 3CF5A 4JV5L 4EX5A 5M3MH 2NN6G 1QVFA 2B3GA 2K5NA 2Z6KA 4BY7H 2K5VA 4DR7L 1SFOH 3M9BA 1KRTA 1M1KC 1G51A 4DAMA 1IXRA 3EN2A 1X56A 1NTGA 2GVAA 2K5HA 2HHHL 1VQHA 3L2PA 1OXUA 1SE8A 4JBMA 4DV3Q 4A3MG 4OWTB 5C3EG 4DV4L 1NBWA 1IBMQ 5ELNA 2F52A 1OXVA 2CQOA 5H1SE 2LXKA 3GTMH 2PNHA 1UE1A 4QGUA 4B3ML 4LFCQ 4DK3C 1E22A 3FKIG 3KF6A 4A3KG 2IX1A 4OONA 4X65L 3E0EA 4A4IA 2QA4A 3DLLA 3F1ZA 1K9MC 5FJ8H 5C4JH 4ME3A 2YTXA 3LGJA 1CKNB 4DR5L 3I4OA 1JB7A 1VQ7A 2UUBQ 1LTLA 3D0FA 2VQFQ 4JI6Q 3Q8DA 1RL2A 4JI8Q 4JI2L 1HZCA 4OO1I 4JI1L 2UUCQ 1N34L 4A3CG 5GAGC 3S1NH 4LF9Q 5DLQE 5JEAJ 3OTOQ 2R92H 3F2CA 1YVCA 4AYBG 4HIOA 2NN6I 4LFAQ 3E9HA 1TWFH 4IJHA 3AFPA 4UY8C 1X55A 3CW2C 5LMNL 3G4SA 1Q8KA 2QEXA 4HIDA 4B3RL 3KYHC 4UP9A 2VQEQ 4AH6A 1EWIA 3I4NH 1Z47A 4J15A 3CMEA 1X65A 3CCQA 4JI7Q 4JI5L 2JA7G 5JJKA 1I94Q 1BBUA 4YCUA 5GQOA 4GLAC 4Y52H 4B3SL 4IFDG
chains in the Genus database with same CATH superfamily
4DAVA 4A3BG 5JJIA 3FPPA 3DMUA 3NXWA 3T51B 1EQQA 2MHVA 4UPAA 3PUXA 3V96A 1TWHB 2F0JA 4WRDA 4XIGS 4LF4L 1JT8A 4X62L 1K8MA 5DAUA 4GLXA 4GS3A 5FO7B 3GTPB 2NN6H 2FXQA 3I4MB 2NZHA 1EY0A 1STNA 2MQHA 2PYKA 1TU2B 4R4OA 1LUZA 2UUCL 3F8TA 4BBRB 3Q24A 1R9TH 4QF4A 1Q1EA 1CA6A 4A3MH 2WACA 2KCMA 3I73A 1S5BD 3I8ZA 5IT9L 2XIWA 5KYLA 3HZXA 3CPWA 1JC7A 4IUVA 3J7ZC 4A3KH 3S14B 4IUNA 1H9RA 1Y1VB 4LF8Q 3DWQA 2M2LA 3GTOB 4DUYL 1SEBD 2JP1A 4CKEA 1O7LA 4ZLTF 1DYQA 1FL0A 4C3IH 1SNPA 2BA1A 1QNKA 1A2TA 4A3IH 2WIIB 1OXSC 3TS0A 1A15A 4LF6Q 1Y8PB 5COYA 1HNWL 4RAUC 4RHSA 4DXFA 4IQZA 3K6OA 1A6XA 4ID6A 4NKLA 1JWMD 4JK1C 4R4IA 1STYA 1I4XA 5IGBA 3H3VH 4A3BH 3LNNA 4DPGA 1Y8NB 1B2TA 1T5EA 4UP8A 4A3FB 3W5OA 2A74C 1CZGA 4HJ5A 1JICA 1HJPA 2NYZD 3I70A 4IUPA 3J7AF 1JB3A 3CU7A 1Z6HA 5IWAL 3TS2A 2M00A 1IBLL 4H13C 5IE8A 3UE1A 1PH8A 4Y7NB 1LO5D 4PV1C 4HTHA 4DV7Q 2RBMA 3J81c 2F0VA 3PUVA 2E5LQ 1BF4A 5LL6S 4KK7A 1LYLA 1SMXA 3A8KE 1BR9A 3KDFB 1UUPA 1VQ8A 1GO3E 1SE3A 4E6IA 1VF7A 1N36L 5CBAE 4DV0L 1UEAB 3AEVA 5DM73 5M5YH 5C44H 1SLJA 3BG3A 3BU2A 5CR3A 4G4KA 1IYVA 4HMJA 1OXTA 1LT4D 3U9OA 4GN3B 5EJWA 3W1BA 2E2DC 1EYGA 1O7IA 4DV6L 2HIXA 3U50C 4A3LG 2O2LD 5A35A 2KHJA 3A5ZB 2KJXA 1KDBA 4UP7A 4C2MB 1KTKA 2QDBA 1RODA 5C0XG 4AQYQ 1CUKA 5NUCA 3RR5A 3GTMB 2NVTH 1A0IA 4DAYA 4DV3L 4RCOA 5AFWA 4V190 4DR2Q 4RKLA 2EXZA 1ASYA 3K7AH 4XQNA 1PZJD 2RF4A 2A1AA 1RJTA 4GKKQ 2HUGA 4OGQC 3F2DA 2EY6A 4G57A 3NBHB 3S1NB 4KD4A 4OIKA 1HXYD 4OX9Q 3E5SA 3EROA 2UXCQ 1TWFB 4UDUC 2IT1A 2VB2X 1J5EQ 4RGNA 2E75C 1NMFA 3I72A 3I4NB 4JC0A 4LFAL 5G3LF 2EY5A 3FEWX 3PSIA 3SR1A 1SYCA 1NMGA 4YWLA 3S2HB 1SR3A 4CJ2C 2L9HA 3UDIA 5FLXc 2K5DA 2LY7A 4I7AA 2UXDQ 3KBGA 1SE2A 1ML0D 2JK8A 5E4XA 5CV8A 1CHQD 1S5ED 5ELBA 1ZXTA 3K0YA 1H95A 1Q86C 4A93H 1XYIA 3HOWB 1VMPA 3CCMA 4H44C 4LF5L 1Y14B 4DR7Q 2EDGA 3TMEA 4IPDA 4OWXB 1SNQA 5CMDA 2HHHQ 1PH5A 3QOJA 3I4MG 4X66L 1CSQA 4DV4Q 2JA8H 4MN3A 1SJED 3C1FA 3VR2A 1K73C 3NQTA 2IJ0A 2YYZA 4DR1L 1G2TA 1VQBA 4B08A 4KHZA 1QNUA 3C46A 1N34Q 1I3QH 3KK7A 3MVVA 2KENA 1Y69U 4AYBB 1GKHA 5M5WB 4L5TA 1YNJC 3ND8A 3F2BA 1L0XB 5BN3A 1CKNA 2JA7B 3MXNB 1E1OA 1X3PA 3FHWA 1N33L 3GP7A 3MXGA 1YNNC 3CCJA 1RTNA 2N78A 2IPKD 3GTQH 3UE0A 4TVAB 4A3EH 4A75A 3UDFA 1PMRA 2IW3A 3N6RA 4A3FG 4LF4Q 4X62Q 1ONLA 1FGUA 5CORA 5G3LD 1X54A 3VYTA 4RKBA 5GROA 1R4QB 1SE4A 5JVH3 3J80c 2K50A 2NWGA 2FFKB 1KDAA 2K1BA 1JWSD 1JORA 1C8CA 1KLUD 1SRUA 4O42A 5IGFA 4NXML 3PO2B 4DNIA 5T1GA 3GTPH 2ZTEA 3I4MH 2CW0C 1EY6A 4R8NA 2JE6I 3GV6A 3H6MA 4OIJA 2QDLA 3M4YA 3RN2A 4BBRH 1L1OB 2Y0SB 2A68C 3D31A 3T1HL 1VQMA 1HNXL 1B8AA 1KNEA 3NEMA 3V05A 4DUYQ 1MI2A 4QIWB 4ZUJA 1O7ZA 5C6AA 2EJGC 4APVA 3S14H 1Y1VH 4DGZA 3PO3B 2EVBA 2IL8A 4LUOA 3C2PA 2NVXB 3U9SA 3GTOH 2X6GA 3STBC 4HIKA 2XGTA 3ERSX 4LW1A 3ULLA 1PH9A 2B2YC 1HNWQ 3O13A 2UXBL 1EOVA 2JYOA 5IOCA 1MIUA 3NELA 5BN5A 2ZXOA 1FD7D 1N8RC 4FVMA 1ZYRC 3I56A 4GNXA 2K14A 3PGZA 1WI5A 1X32A 2I5LX 1QVCA 2Z4HA 4K14A 4FNFA 1TT2A 1IL2A 2B2UA 4X3UA 3D6CA 1LABA 1EEID 1LT6D 4A3FH 4GZYC 5IWAQ 4X3KA 1BOSA 4ZK9B 1SYGA 1SNOA 3M4QA 4YCWA 2R7ZB 4RGTA 1IBLQ 4GKJL 1MD2D 2F0IA 1XXGA 1ENAA 2ZJPA 4XXEA 2N3SA 3IAYA 3P7JA 3OYYA 1NJIC 1QUQA 3I4NG 4DR4L 1ZKOA 4MNOA 3HKSA 4WJ3M 4XYOA 4Y7NH 1GUSA 1C9OA 3WWVA 1PH2A 1EIYB 1W3SA 3L9AX 1N36Q 1SAPA 4DV0Q 2CHBD 3X3MA 3DHQA 1KLGD 1PXUA 2E76C 2ASBA 4FF1A 3ZJYC 3P75A 2OTJA 4BXXH 4DV6Q 1IBKL 3HOWG 2HDMA 3CP0A 4F7XA 3OHXC 2NVQB 2WAQB 2Z6KA 1B9MA 1KRTA 2G9DA 2JXMB 5EBDA 1R4PB 2DNEA 2GVAA 1IL8A 5FO8B 3L2PA 4JBMA 4DV3Q 2SNSA 4OWTB 5ELNA 1H9KA 1ICFB 1OXVA 1EYCA 3GTMH 5ELDA 4B3ML 4DK0A 1MBYA 3KF6A 1MSHA 4X65L 5I4DA 1I4PA 2QA4A 4CDCC 3SE0A 2JSOA 1AW7A 1BQQT 3ZYYX 1LTLA 1PLFA 3VA5A 4OO1I 4JI8Q 4FF2A 3OPOA 3T56B 1D5XC 3S1NH 5JEAJ 4AYBG 5TSSA 5E3FA 4LFAQ 3E9HA 1TWFH 5I2XA 3AFPA 1NR4A 1X55A 5LMNL 1EWCA 2QEXA 4HIDA 1AP0A 3KYHC 5CV9A 3Q6SA 4XT3B 1EWIA 3I4NH 1HFGA 4J15A 1X65A 3ND9A 2JA7G 2F0UA 3HS0C 2O5IC 1BBUA 4YCUA 2A73B 5C44B 2B63B 3K57A 2PO4A 5M3FB 4IFDG 3HG9A 3H91A 5FLXE 5KRUA 4I7ZC 3DEOA 3H94A 3TP6A 2CCZA 4IJLA 2A6HD 1YHQA 4X3TA 1EQVA 3KLSA 4G7HC 1ET9A 4LF5Q 4CJ1B 2B2WA 5D65A 1PH4A 3LWUA 1CTMA 5LMUL 2JEBI 1BBWA 2RDGA 3HOWH 3T16A 3CKIB 3J81i 3TN2A 4X66Q 3HOZB 1HNZL 1B44D 3N52A 2ENBA 4R1JA 2ALYB 1QOHA 2PNRC 2VUMB 2PCFB 1Z9FA 3K0XA 5IGDA 3PO2G 3S17B 4RWSC 1B3AA 1VQLA 3HOYB 1V1QA 3E9IA 1ESRA 4DR1Q 4MHEA 1TQOA 2Y0SG 2A5HA 2RVLA 2L55A 1V1PB 4CHTB 3ULJA 3H3VC 1H9JA 3DWPA 4QCLA 2AHOB 2AQ1B 3HEJA 3NTHA 5FO9B 2RDHA 2WB1E 1A63A 4NB3A 1GHKA 1CQVA 2N8NA 2QKIC 3PO3G 3T13A 1TS2A 1YITA 4TQUS 3A0JA 3W3AA 4V0BA 5M5WH 5C4XB 4H7BA 4HJ9A 1N33Q 4XQQA 4JOIA 5ELEA 3RD4A 2BH2A 2JA7H 4KKTA 4ZKCB 2QGQA 2I07B 2FMMA 1H9MA 4A93B 2K33A 1DCZA 2PQAB 3NPPA 4P73A 1VQPA 2B8FA 1P16A 1E2WA 1HHVA 3KOJA 5KIXA 3H09A 4P72A 3W1GA 1JR0D 2WFWA 3BDLA 3J80E 2R7ZG 2JA8B 4DV2L 1PV4A 3G7LA 4NXMQ 1KAAA 1YNXA 4JYAL 3ER0A 2K03A 1CT1D 2WKCA 3HGBA 1STHA 1AH9A 1VQEA 4FXGC 4YCVA 5BN4A 3PO2H 4K5WA 1Q7YC 4DUZQ 3T1HQ 1J9OA 2KHSA 2RSOA 4EQ5A 4CDFC 1HNXQ 1U0LA 1I3QB 2EYJA 3J7A5 3CAMA 1SNDA 3TREA 4WJ4A 3PCOB 1E24A 4KJOA 4YHHL 1Q82C 1RF2D 4C3IG 3I2ZA 4A3IG 2KCCA 1RCVD 2Q2HA 1FJGQ 3PO3H 2UUAL 2NVXH 2DJFC 2UXBQ 4AYBE 4JVZA 2WAQG 2B2VA 2VZAA 1HA6A 4A3EB 1XJVA 2XRQD 3BZKA 5EGTA 2K5WA 1CKOA 3TSSA 2P5ZX 2VB3X 2WV6D 3DM1A 1IBML 2V1CC 5CV4A 5HGQA 5LMNW 3BJUA 1QZGA 3MZ5A 1HUMA 2K6AA 3HKZB 4GKJQ 3SDZA 1F2YA 3PUWA 5ELCA 4DA2A 2R7FA 2A6EC 2VQFL 2R7ZH 4IN3A 5C0XJ 1U9RA 1IYJB 2RCNA 1GUOA 2EE1A 2ICIA 2B2TC 1U4LA 4DR4Q 2F0HA 1VQ6A 3LWEA 5C4HA 2VQEL 3KLWA 1A2UA 1TKWB 1EYAA 4O2DA 5C44G 2B63G 2DUDA 4PZ7A 1KAWA 4IURA 1K28A 2Y0SE 3J80i 4GOPB 2ZJRA 1SYDA 4A3JB 4JI3L 3TEHB 2LFNA 1RTOA 1IBKQ 2ZT9C 4QIWE 2PI2E 3GO5A 5DNFA 1TWCB 1SYEA 1DOLA 3A5UA 3MA2B 4KHPL 1H9SA 3MXPA 3H15A 4IO9A 5M5XB 2RHSB 2NVQH 2AWOA 3HOZG 5C3EB 1GVPA 2DNCA 2XWBB 1S5FD 4J1MA 1SMYD 2K4KA 4RMFA 5M9OA 3HOYG 3FKIB 1L0YB 1C0AA 4OEMB 5JPMC 4KD3A 4X65Q 1DOKA 1YHBA 3K80C 3EVQA 1PYBA 1EIHA 1SSOA 2VL6A 2EXDA 2C5CA 4QUCA 2AQ2B 3RUZA 2KECA 4IOCA 1OO9B 4YWKA 3CHBD 1S3OA 1KQSA 3G48A 5KNCA 5LMNQ 2F4VL 1HCZA 3D3RA 5CYUA 4P71A 1EYDA 3S15H 2HQEA 1J6QA 2JA9A 1VQCA 5C4XG 2J7ZA 2K52A 4HSVA 4QB4A 3Q23A 1A3TA 2OXPA 4DF7A 1F2MA 1O7YA 1ILPA 1DJRD 3K5MA 1TY0A 3MEHA 3BYYB 4J6HA 4KMUC 3SK4A 2B63H 3VA7A 3EFXD 4WFN3 4A93G 5M3FH 4R4QA 3CCRA 4IUQA 4NW2A 3CQZB 2BE5D 3PIOA 4ZQ3A 1Y1WH 1VQFA 3S2DB 5LMUQ 4DFAA 3EBEA 1Q3LA 1NUCA 1T9HA 1HNZQ 4FO2A 4K5XA 4BBSB 2JA8G 3A7AB 1TVXA 1CI3M 3BDOA 1KDCA 1KC8C 3EIVA 2LS01 4GOPC 4G7OC 3HOZH 2WAQE 2K04A 3UDGA 2VUMH 2DY8A 3S17H 1D8LA 1B50A 2WB1B 1CSPA 3HOYH 3T53B 1AE3A 2BDNA 1XPUA 1YBYA 2NVYB 3VYUA 4HIMA 1OXXK 2H4OA 4X64L 5HURA 1X6OA 1BKBA 4F88A 4JBJA 2ATWA 1Q8IA 3E6ZX 2I0QA 2EIFA 3KF8A 4HJ8A 1UE6A 1O78A 2CWAA 5EKKA 2IX0A 2HIVA 4FXDA 2L15A 2NUCA 1GD7A 1AN8A 2J0TD 5JOBA 1TS3A 4LFBL 1EL0A 5C4XH 4A3EG 1VQGA 1M90C 5AJ3L 2D62A 1MGSA 1MJEA 2AWNA 2VS1A 4JBWA 4B9XA 1FNVA 2AQ3B 2EYFA 1B9NA 3R2IA 2KUMA 2IHFA 3FVQA 1AFPA 1PFBA 4DV2Q 3NUCA 5EPJA 5KNBA 4JYAQ 1B3QA 4AIMA 2EYHA 1PRTF 1BBXC 1X9NA 4HJ7A 4NDXA 3S1QB 4BBRG 2BA0A 4U673 4H02A 4KTAA 3AU7A 4HMIA 1VF5C 4BA2I 4O0AA 1G2SA 2KCNA 1VQIA 4YHHQ 2RCFA 2QF7A 1L2FA 2VNUD 1LTID 1Y1VG 2L12A 5LHY1 1VQ5A 2D5DA 4HCSA 3TQYA 1XPRA 2NB0A 4K8JA 4EQOA 3J7YW 3K81C 2RDFA 2K7VA 1C48A 5BR8L 4A3JG 1WD1A 2B39A 2PZTA 5IT9c 1VQDA 2UUAQ 1KABA 2ES2A 1QE6A 4XYQA 1QVFA 5IGCA 2K5NA 4ZUIA 3MWYW 4DAMA 1IXRA 3DWAA 1NTGA 2K5HA 2IWHA 5K5PA 1OXUA 1IKMA 2F3WA 1U4MA 1TWGB 4EGVA 5JAVA 5C3EG 1IBMQ 2CQOA 4KY7A 2LXKA 4ZRZA 5H1SE 2PNHA 4QGUA 5J1ZA 3FKIG 2X6LA 4K6LA 4ME5A 1XTCD 3OWEB 3OSOA 3WOEA 4A4IA 3F1ZA 2A6HC 1UNSA 2K01A 2YTXA 3LGJA 1BXTA 1STBA 1VQ7A 1BCPF 2VQFQ 2PQEA 4Q0FA 1ZEQX 3Q8DA 1PFMA 1RL2A 1PDQA 4JI2L 4JI1L 2UUCQ 1LTGD 4A3CG 2K05A 3HOVB 1WTWA 2R92H 4HSPA 2NN6I 2RSNA 2O5JC 2WKDA 1G6ZA 4UY8C 4NP5A 4K8IA 3G4SA 5FOBB 4B3RL 4FYDA 2VQEQ 5KGUA 3NBHA 4AH6A 1BUVT 4JI5L 2EZVA 5GQOA 4B3SL 2FINB 2F3VA 1PRTD 2F3IA 3NP8A 3IRBA 3IL8A 4RGMA 2RKSA 4QY7A 4JI3Q 3A74A 1D7QA 3TDQA 4BXXG 2K28A 1G291 1F2LA 1A8VA 3JAME 4PNYA 2E2IH 3PF4A 3RMHA 1F9QA 2I5HA 1B4OA 1O80A 2OTLA 4A3JH 4LMQD 3CC2A 2ZXRA 1V9PA 4RHRA 4KHPQ 2PMZB 2MFIA 2UU9L 3GV3A 1TWCH 1YJ9A 3SK6A 3CXCA 4IFDJ 4JI0L 3DEPA 4DV5L 2FHTA 4DR3L 5M5XH 4NPSA 3QOLA 5C3EH 4X6AH 1HZ9A 3DM3A 5I9OA 1JE4A 4C3JB 1K8GA 1JOKA 5GADC 1NSNS 1EIFA 2WB1G 3OIQA 2SNMA 3FKIH 4CDEC 1SYBA 5E1FA 1NE3A 1HQRD 1EQRA 3SVMA 3CC7A 3PV0A 3IFDA 1PZID 1JWUD 2WP8J 2AMCB 3AFQA 3HKZE 2OQKA 5HY6A 2F4VQ 4A3CH 1DGSA 1TWAB 2IY5B 2R93B 1I50B 1I4RA 2AUKA 1QWYA 2GVBA 4L5QA 4DK6C 3KBXA 3CMAA 5ELFA 1ESFA 2GN5A 1ENCA 2F0GA 5FLMG 3NTKA 4A3GB 5DEHA 1BCPD 1UE5A 4K2KA 5A2QE 4HN7A 3KJOA 2HT1A 5JJZA 3HP3A 3MXNA 5E4WC 2Q2UA 1L1OC 3SEBA 3CQZH 2B29A 2H1EA 2Z9HA 2C35B 2VXWA 1DONA 3VR5A 4CDDC 3S2DH 3BVZA 3T1YL 2F0LA 3L3OC 1X3EA 3I7FA 4CJ0B 1QJOA 3KUPA 3BS1A 1HRJA 1ILQA 4YY3L 3A56A 1EIGA 2L0CA 2LKVA 2KEEA 5CV7A 4BBSH 2QILA 1XWEA 2E2HB 3SGIA 1PFSA 1I4HA 4IOAA 4M8AA 3MFYA 4DR6L 2MO1A 1EWHA 4IUUA 4TKOB 3M7NA 5IYDG 4BY1H 2Z8LA 4NXNL 4DKAC 1MHWC 1F9SA 2RA4A 3WOFA 4X64Q 1G91A 3RN5A 1LM0A 3P20A 2NVYH 3OIPA 1NR2A 3S15B 4U68A 3P1HA 3CPFA 2J4XA 3BVGA 5M3MB 1V43A 4H0LC 2KOLA 3C3LA 1FNUA 2R3ZA 1XPOA 1VS0A 4LFBQ 3RLOA 4KKUA 2D0OA 2G9HD 2C9OA 2JJQA 5FLMH 5AJ3Q 4XTCS 3CCVA 1Y1WB 4MZ9A 1V1OA 2HQLA 5T1IA 3OMGA 1ET6A 4RFBA 3TBIB 3S24A 1YNND 3BVMA 3CCEA 3M4PA 4OWWB 4DU9A 1U5KA 2X69A 5C4JB 1HUNA 5CV6A 1HH2P 1VQNA 1CFMA 1EU4A 1LT3D 5CBEE 5J39A 1B1ZA 3QO2A 1LLRD 4QMGA 2VW9A 2L4NA 2XVSA 4LWCA 1VQJA 2SEBD 2A19A 3PUYA 1G6PA 2AKWB 3U4VA 3AB9A 1PYSB 1NNXA 4LF9L 4JG2A 3OTOL 1PA6A 4ZYSA 4BS9A 2Z0SA 1BNZA 3PUZA 4ZKBB 5C0XI 3S1QH 1EZ6A 4GLVB 1PTOF 1WVLA 4BA1I 1NCVA 3AYHB 4O1NA 4JI7L 5IYDH 1SMYC 3GD7A 2D0PA 1I94L 1LT5D 2F0MA 2N49A 3HOXB 4OL7A 3I55A 1E0BA 3ITPA 1VQAA 5IP7G 3A7LA 4K0KL 5BR8Q 4EQPA 1IW7D 3I4LA 2NBFA 4RGOS 4DXGA 3A54A 5IT9E 4ZCKA 3J81L 1JCKB 1JQYD 1MJCA 5D3IB 1EY8A 2CQAA 2Z4IA 4EQNA 4KN4C 5KNDA 2A69D 4TRDA 1Z7TA 1W2BA 4LUZA 3GDEA 2NZOA 2FMCA 1CKMA 2YU9B 1AE2A 3J7AV 1E7ZA 3NHHA 1EFID 2FJ2A 2BDOA 3I90A 3E3XA 1TWGH 4F8MA 2XRSD 1RIPA 1PHJA 4ABNA 4B9WA 4C3JG 3PIO3 1JMCA 3I91A 2YTVA 1XNRL 3L7ZC 3MXUA 3J81j 2BE5C 1CQFA 4JI1Q 4LUVA 1YI2A 1H9SB 3K5OA 2BCOA 3VDYA 1Q46A 2YTYA 2K5QA 2KVMA 4B3RQ 5FKAC 3HOVH 2R93G 2LXJA 2EJMA 4XT1B 2PW5A 3A55A 3A8JE 4I65A 1E2ZA 4JI5Q 2KEDA 1GM5A 4B3SQ 4C3HB 4A3GG 1HZBA 2E8GA 3CC4A 5JEAG 2EYMA 3DXJC 3BDCA 3M3YB 2B2VC 5EQ0A 1CK1A 5EKIA 3VR4A 2JA6B 5I9PA 1WCMB 1SJHD 1X3GA 1LACA 3S16B 3D4WA 2MUYA 5IP7H 3QR8A 3K5NA 3WDNA 3NK9A 5K36H 1PTOD 2PZUA 2UU9Q 5EKLA 4KLKA 3VYRA 1JJCB 1KIXA 3A8IE 5FLXL 1ASZA 4JI0Q 4DV5Q 3VR3A 1KNAA 1LTTD 4DR3Q 4L5RC 4RG1A 2MJ8A 1SBBB 4JI4L 1Q90A 3M85A 3TP8A 3RZOB 1D6EC 1D2BA 4OHJA 3D8GA 1QVGA 5KEEA 1KXLA 1FVIA 3ONAB 4C3JH 2R92B 1N9WA 1SROA 1N32L 1GUTA 3VR6A 1PFNA 2MPMA 3TZUA 2ZM6L 2NTSA 2KHIA 4XDXA 1ICWA 1D5MC 1S5CD 2N55A 2NZ1D 4PMCA 3SK8A 4DAYB 5M3MG 1SDFA 1V1PA 1PRTB 3H0GH 4KV6A 1TWAH 2R93H 1NAPA 1XMOL 1I50H 2CVRA 3TZDA 1I6HH 2F0PA 5DM63 2N88A 4ZAIA 1XMQL 1VQOA 4PZ8A 5M3FG 4FF3A 4A3GH 2E2IB 1OTCA 4HEDA 5JEAH 1Y1WG 1GHJA 3JAMc 4EVOA 1KHIA 1QZHA 2TMPA 5FJ8G 3KF8B 4P75A 3RZDB 4LF7L 3CRLC 4LAAA 3T1YQ 1PVOA 4DNRB 2PQAA 1FNWA 5EBCA 2R6GA 2B2TA 3TP5A 4YY3Q 2ZJQA 3UI2A 2VUMG 3CRKC 4RA8A 3CCSA 4PZ6A 4B3MQ 2PMZE 4DR6Q 1IYUA 1STAA 4A3DB 1WOCA 3PQIA 5CV5A 2E2HH 2A8VA 1TS4A 4NXNQ 3S1RB 2OWOA 1I4QA 1Q81C 1EY9A 2F0QA 3J80L 4CGYB 1L0WA 2DY7A 3HOXG 3M4OB 1YHAA 4K6DA 4WORA 1YJWA 4QQBX 1CM9A 1UEBA 3SK5A 4XQJA 3GTLB 1EQTA 3MC0B 2XN9C 1BCPB 5IYBG 4OO1G 4P74A 1EFWA 4ODGA 1LV9A 4CBVA 1MKHA 1YIJA 4JV5L 3QB3A 5M3MH 5I6YA 2OF1A 1CA5A 1G51A 3EN2A 1X56A 2D2CC 2F52A 1SNCA 5I6WA 1UE1A 2Q8RE 1XX8A 4DK3C 1E22A 1PRTC 2IX1A 4OONA 3E0EA 1V8QA 3DLLA 2BOSA 3HOUB 4RCNA 5FJ8H 5C4JH 1PYWD 4ME3A 1CKNB 4DR5L 4K5VA 2L11A 4L6TB 3D0FA 3QG1A 4C1NI 3E0JA 1K3BC 5J22A 5GAGC 4LF9Q 5DLQE 2DJGC 3OTOQ 4CKBA 1YVCA 3F2CA 4IJHA 2M9VA 4BY1B 2MP1A 3CW2C 2F0NA 3Q22A 3CCQA 2GA4B 4JI7Q 1I94Q 4C3HG 2I5MX 3M7GA 1KL9A 3Q0AA 2R61A 3HRZC 5CGKA 4K0KQ 1B53A 3EQLC 3HOXH 4R8IA 2JA6G 1EY4A 1WCMG 4UAIA 1YJNA 5D14A 2OEOA 5IYBH 4OO1H 1YEZA 1HZAA 4JPBW 3R3OA 1FYCA 4Z9CB 4GOPA 4IPGA 2CFMA 1S4ZA 5L37A 3AMUA 4JI8L 1NY4A 3FPUB 4DV1L 4QJFA 2EY2A 3R93A 1G8ZD 3EJIA 1JOOA 1BCPC 1EU3A 4C56C 1HTLD 4JW0A 1B70B 1YZ6A 4DAPA 4IFDI 1TR5A 2F0SA 5J3BA 3PF5A 4L8JA 1A3UA 2YU9H 4ALPA 3GTJB 1XNRQ 3HKZG 2K75A 1UWVA 2KCTA 2BH8A 2R92G 2SOBA 4DNTB 1LTRD 4GNXB 1GUNA 2E2JB 3GTKB 3S1MH 2A6ED 2AUJD 5LL6X 2JA5B 4CKCA 2F0DA 2I46A 3FMCA 2Q2IA 4N8FA 3G6JB 4LK1C 1STGA 4A3LH 5C5LA 1WJJA 5IYCG 1WTRA 1DM0B 2L1BA 1STEA 4C3HH 1EOTA 5C0XH 4HAEA 5IY0A 1CHPD 3B6YA 3M3YH 1K83B 2JA6H 4PQXA 3D4RA 1WCMH 1DOMA 3KDFA 5IP9G 3L0OA 1XNQL 3S16H 4KJNA 2EJFC 1QUQB 2ZTDA 2CH4W 3KJPA 1PH6A 1VQ4A 4RH6A 1U4RA 4KHVA 4KY6A 5FK9C 5HGTA 1Y8OB 3GTGB 3CCLA 4JBKA 4JI4Q 1K3RA 4PMBA 1W6JA 3GQBA 3CCUA 1HPCA 3G6EA 3K7UC 3AQQA 4A3DG 1DZ1A 4LNQA 1GUGA 4B3TL 2EYOA 4X3SA 4PMWA 1K8OA 1RDPD 3RZOH 4QL5A 3LX0A 3SHLA 4L5SA 1BDOA 1N32Q 2ZM6Q 1A62A 3PIP3 2RHQB 4WJWA 3K8AA 4TSSA 1AEXA 4BY7B 4HCEA 1HR0L 1XMOQ 1SFOB 1QG7A 2OT2A 1HA5A 3BZDB 1TWHH 3KF6B 4YWMA 2EYLA 3NE5B 5F2DA 3S9WA 1IZ6A 2XWJB 1D1IA 3T4AC 1XMQQ 2F0EA 2TSSA 2XTIA 1PTOB 5IYCH 2EQSA 4C1NK 2Z6BA 4GNXC 1DD2A 2RQXA 1U4PA 2CWPA 4N9PA 3JC66 4LFCL 3SXHA 4LF7Q 4DUZL 1WYDA 2B2UC 1PH7A 1II3A 4G7ZC 3VYSA 3K58A 3HOUG 5IP9H 1IW7C 4IPHA 5D3DA 2CH4A 2XSCA 3RZDH 2UUBL 3MFGA 4BBSG 4JI6L 1Q12A 2L5TA 5JPNC 3NWTA 5ELOA 1GUWA 1TXYA 3OW2A 2A69C 1SYFA 4BY1G 2Q8TA 3H3VI 2Z1CA 5C5MA 1FJGL 4A3DH 3EA6A 1IKLA 3DUZA 3NWSA 4KKSA 5EAYA 4GN5A 1JE5A 1F9RA 1RKNA 1KRSA 3S1RH 2KBNA 3H0GB 2PPBC 3M4OH 1SXTA 1VMCA 4IUTA 1JJGA 1KD1C 4A76A 2B2YA 1I6HB 4JV5Q 3GTLH 1Q1BA 2NTTA 3D6WA 3NSWA 3C1EA 1VCIA 4GN4B 1EY7A 1FR3A 5C3XA 2EY1A 4S3SA 5EPKA 1P8LA 3FRPB 3K59A 4HR7B 4ILWA 2K32A 1R9TB 4FF4A 2OCEA 2Z6KC 4A3MB 1D1KA 2WINB 4J8QA 2MO0A 4ULLA 1J8IA 5CC4A 4R4CA 4P2CB 4A3KB 2VY3A 1I4GA 5IGGA 3F2UA 3J81E 3BYTB 1C7YA 4DR5Q 1HFNA 1TY2A 4IPCA 3KFUA 3HOUH 2F0OA 4C3IB 4LF8L 4BWGB 4A3IB 1PTOC 2ID0A 4HJAA 1X3QA 4R4TA 3FP9A 1K0SA 1XTDA 5JJLA 1PH3A 2ZTCA 2JA5G 1TS5A 3JAMi 2HD3A 2MNAA 3ULPA 1JJ2A 1PZKD 4LF6L 1DXMA 2E74C 4IZ8A 4A3BB 1S5DD 5JVG3 4N9TA 1E2VA 3X3NA 4C2MH 2HCCA 3PMFA 2KA7A 3U58A 2OQ0A 4N8X1 1T5XD 1L1OA 3RNUA 1RD9D 1MSGA 3HFZB 5IIFA 3D4DA 3W2DA 2LSSA 4YIJA 1EEFD 3KLRA 2B2WC 2PI2A 1YNJD 5I2YA 2KQ3A 1LTSD 3R8BA 3KLSX 4KY5A 4R9WA 4DV1Q 1WD0A 1PH1A 2H5XA 1BVSA 4MTNA 4OXPA 4LJZC 4F87A 1WTXA 2QCPX 3BZCA 1E3PA 1EY5A 3JAML 1E1TA 3RLNA 5E7NA 4M1UB 4DV7L 2F0WA 1HR0W 1UAPA 1X3FA 2E5LL 2G5DA 5GAEC 5M5YB 1FGBD 2HCIA 2R7DA 3PIPA 3MEFA 1CZWA 3GTJH 3IFTA 3S2HH 1QILA 1GXDC 1HTPA 1F9PA 3I3CA 4JCVE 2EPBA 1ENFA 1GJXA 3QWNA 3HOVG 2PW7A 1W6KA 4POFA 2ZXPA 4POGA 3G71A 2EYPA 1BO0A 4BY7G 1A3VA 1K8AC 2E2JH 3GTKH 2HDLA 2CW0D 2JEAI 1WTVA 4KI0A 2JA5H 4MTKA 1HQMC 3K5LA 2NVTB 1EZ8A 2SDFA 2A68D 3NENA 3TP7A 4JOIC 4AQYL 5C3WA 3K7AB 1WTPA 2JN4A 4K2LA 3ICEA 1EUJA 2CKZB 2JQOA 5IODA 4DR2L 2F0KA 5K36G 2YV5A 1XNQQ 1UE7A 2D9UA 1VQKA 3URYA 4QUFA 1K83H 3OWFA 4GKKL 4FP5D 3STBD 1AZPA 2DGYA 1F2ZA 3V2TA 5GAHC 1K0RA 1SN8A 1S40A 1B7YB 4OX9L 1SNMA 4Q5VA 2UXCL 5A2QL 1VQ9A 3GTGH 3CD6A 1J5EL 4FDBA 2F4IA 3ERQA 4B3TQ 2QW7A 1ZYRD 2Q2TA 1WTQA 2ICEC 3FDTA 2QEJC 2PZWA 2F0TA 1WTHA 4IALA 1GOZA 3U4ZA 3RLFA 1RHPA 2IHEA 1S72A 4JI2Q 1TIID 4FXKC 3NTIA 3UDXA 1LTBD 1JOQA 4MIUA 4UHVA 4OELB 3S1MB 2DN8A 2Q8IB 2UXDL 3TRZA 4IFDH 5ISRA 3NBIA 3R2TA 2F0FA 3H0GG 1HR0Q 1WFQA 3OMCA 3MAQA 1QCBD 1I5FA 2O4XA 3OW7A 4PG3A 3CF5A 4EX5A 3MHBA 2NN6G 5C4ZA 1WTOA 2B3GA 1IHZA 4BY7H 2K5VA 1QB5D 4DR7L 2F03A 1SFOH 3M9BA 1M1KC 3NQIA 2V4DA 4DK1A 4L63B 4KN7C 1M4VA 1VDZA 5IGEA 2HHHL 1VQHA 2F1MA 5EPLA 1SE8A 4A3MG 2MGSA 4DV4L 1NBWA 5KYIA 2XNAC 4LFCQ 1PTOH 2EOTA 4A3KG 2LMCB 1LTAD 1K9MC 3QIAA 1I6VC 3I4OA 1JB7A 2UUBQ 4JI6Q 3IKJA 1HZCA 1N34L 3OOCA 4NMZA 4HIOA 2B8GA 1C4QA 1F77A 1Q8KA 4UP9A 1M8AA 1D5ZC 1AZQA 1Z47A 3MTSA 4DN4M 3CMEA 3QJYA 5JJKA 4GLAC 3GTQB 4Y52H 2IX3A
chains in the Genus database with same CATH topology
2I5MX 4A3BG 1KL9A 5JJIA 2F3IA 3IRBA 4K0KQ 2CCZA 4IJLA 1EQQA 4QY7A 4UPAA 4JI3Q 3PUXA 3HOXH 3A74A 2JA6G 1D7QA 1YHQA 4BXXG 1WCMG 1G291 1A8VA 2E2IH 3PF4A 4LF5Q 1YJNA 4XIGS 2I5HA 4LF4L 1JT8A 2OTLA 4X62L 4A3JH 1PH4A 3CC2A 5IYBH 5LMUL 1YEZA 4GLXA 2JEBI 4GS3A 1BBWA 1V9PA 3HOWH 4KHPQ 1HZAA 2MFIA 3J81i 2FXQA 4X66Q 2UU9L 4GOPA 1HNZL 4IPGA 2CFMA 2NZHA 4R1JA 1TWCH 2R93H 1YJ9A 2MQHA 3CXCA 2ALYB 4R4OA 4JI0L 4JI8L 4DV5L 1LUZA 1NY4A 4IFDJ 1Z9FA 3K0XA 2UUCL 3PO2G 3F8TA 4DV1L 4DR3L 5M5XH 4QJFA 1R9TH 1VQLA 1Q1EA 4A3MH 2KCMA 1V1QA 4NPSA 5C3EH 4X6AH 1HZ9A 3DM3A 3E9IA 1B70B 1YZ6A 4DR1Q 4IFDI 1K8GA 5GADC 5J3BA 3PF5A 1EIFA 2WB1G 2YU9H 4ALPA 2Y0SG 1XNRQ 3FKIH 3CPWA 4A3KH 3HKZG 2K75A 3J7ZC 1UWVA 3ULJA 1NE3A 2AHOB 1EQRA 2KCTA 2BH8A 3CC7A 4LF8Q 2R92G 3PV0A 2WB1E 2WP8J 4DUYL 2AMCB 1A63A 3AFQA 4NB3A 4GNXB 3HKZE 2OQKA 5HY6A 2F4VQ 4A3CH 1DGSA 1FL0A 2IY5B 2N8NA 4C3IH 3PO3G 3S1MH 2BA1A 4A3IH 1YITA 4TQUS 3A0JA 5M5WH 1OXSC 2GVBA 4L5QA 2Q2IA 4DK6C 3CMAA 3TS0A 4LF6Q 4HJ9A 2GN5A 1N33Q 5FLMG 1HNWL 4A3LH 4JOIA 2BH2A 2JA7H 1WJJA 1UE5A 4R4IA 2QGQA 5IYCG 3H3VH 4C3HH 2PQAB 4A3BH 4DPGA 4P73A 5IY0A 4UP8A 3KJOA 3W5OA 1VQPA 1P16A 3B6YA 3M3YH 2HT1A 2JA6H 3KOJA 4HJ5A 2Q2UA 1HJPA 1WCMH 3KDFA 5IP9G 1L1OC 3L0OA 1XNQL 3S16H 3CQZH 2B29A 1QUQB 2ZTDA 4P72A 3W1GA 3KJPA 5IWAL 2C35B 1PH6A 1VQ4A 3S2DH 3TS2A 2WFWA 2R7ZG 3T1YL 1IBLL 1X3EA 4DV2L 3I7FA 1PV4A 3GTKH 4NXMQ 3CCLA 1YNXA 4JYAL 5IE8A 3ER0A 3UE1A 4YY3L 1PH8A 4JBKA 4JI4Q 1AH9A 1K3RA 1VQEA 4BBSH 4YCVA 3SGIA 3CCUA 1PFSA 4IOAA 3PO2H 3G6EA 3K7UC 4DV7Q 3AQQA 4DR6L 4A3DG 2MO1A 4LNQA 4B3TL 3J81c 4DUZQ 1Q7YC 3PUVA 3T1HQ 2E5LQ 4EQ5A 1HNXQ 3M7NA 5IYDG 4PMWA 4BY1H 1LYLA 1SMXA 1U0LA 3KDFB 3J7A5 1VQ8A 3RZOH 3CAMA 1GO3E 4NXNL 4QL5A 3TREA 4DKAC 3PCOB 1E24A 4L5SA 1N36L 4X64Q 4YHHL 4WJ4A 1N32Q 3RN5A 4DV0L 3AEVA 1LM0A 5M5YH 2NVYH 2ZM6Q 1Q82C 1A62A 5C44H 3I2ZA 2RHQB 1SLJA 3K8AA 4A3IG 3BU2A 3CPFA 1OXTA 4GN3B 1V43A 2Q2HA 3W1BA 1HR0L 1FJGQ 1XMOQ 1EYGA 3PO3H 2UUAL 1XPOA 1O7IA 4DV6L 2HIXA 1VS0A 3U50C 2NVXH 4A3LG 2UXBQ 1TWHH 2KHJA 4AYBE 3A5ZB 3KF6B 4YWMA 4UP7A 4LFBQ 2WAQG 3RLOA 1IZ6A 2VZAA 2D0OA 1XMQQ 1XJVA 3BZKA 5AJ3Q 2JJQA 5FLMH 5C0XG 4XTCS 3CCVA 4AQYQ 1CUKA 2XTIA 1CKOA 3RR5A 4MZ9A 2HQLA 2NVTH 1A0IA 5IYCH 4DV3L 2EQSA 4GNXC 3S24A 4DR2Q 1IBML 2CWPA 2V1CC 3CCEA 3M4PA 4OWWB 1U5KA 3JC66 3K7AH 4LFCL 1ASYA 1HH2P 5HGQA 5LMNW 1VQNA 2RF4A 2A1AA 3BJUA 1QZGA 4LF7Q 4DUZL 4GKKQ 1WYDA 1PH7A 4GKJQ 3PUWA 5IP9H 3F2DA 3HOUG 2VW9A 4IPHA 3NBHB 2R7FA 4LWCA 1VQJA 4OX9Q 3RZDH 2UUBL 2VQFL 4BBSG 4JI6L 2R7ZH 2A19A 2UXCQ 1Q12A 2IT1A 3PUYA 5C0XJ 1G6PA 2AKWB 1IYJB 5ELOA 3U4VA 1PYSB 2RCNA 1J5EQ 4LF9L 4JG2A 3OTOL 1NMFA 1TXYA 1PA6A 4DR4Q 4JC0A 4LFAL 3OW2A 2Z0SA 1VQ6A 4BY1G 3H3VI 3PUZA 1FJGL 5C0XI 3S1QH 2VQEL 3PSIA 4A3DH 4GLVB 1NMGA 4YWLA 4BA1I 1SR3A 3AYHB 3KLWA 4JI7L 4O2DA 3GD7A 5IYDH 2D0PA 5EAYA 2N49A 3UDIA 5FLXc 5C44G 4GN5A 1I94L 3I55A 2B63G 1JE5A 2DUDA 3S1RH 1KRSA 1KAWA 4PZ7A 2UXDQ 2Y0SE 2JK8A 3J80i 2KBNA 1VQAA 5IP7G 4GOPB 2ZJRA 4K0KL 5BR8Q 4JI3L 3M4OH 3TEHB 1JJGA 1KD1C 1H95A 4A76A 1Q86C 1IBKQ 4A93H 3CCMA 4LF5L 4JV5Q 3GTLH 4QIWE 1Q1BA 1Y14B 1VCIA 2PI2E 4GN4B 3GO5A 1MJCA 4DR7Q 4IPDA 1P8LA 3A5UA 4KHPL 4OWXB 3H15A 4IO9A 2HHHQ 1PH5A 2RHSB 1W2BA 2NVQH 2OCEA 2AWOA 2Z6KC 4X66L 3HOZG 3I4MG 4LUZA 3GDEA 1CSQA 4DV4Q 2JA8H 2NZOA 1GVPA 2MO0A 1CKMA 2K4KA 4RMFA 1K73C 4R4CA 3HOYG 1AE2A 1E7ZA 2VY3A 1C0AA 1TWGH 4X65Q 1RIPA 1PHJA 1YHBA 3K80C 2YYZA 4DR1L 1C7YA 1JMCA 4DR5Q 1PYBA 1VQBA 2YTVA 1XNRL 2VL6A 4KHZA 2EXDA 3L7ZC 3J81j 4IPCA 3KFUA 4IOCA 4JI1Q 3HOUH 1N34Q 4LUVA 4YWKA 1YI2A 1I3QH 4LF8L 2KENA 1S3OA 1GKHA 1KQSA 2ID0A 3G48A 4HJAA 1Q46A 3VDYA 2YTYA 5LMNQ 4L5TA 4R4TA 3FP9A 2F4VL 3HOVH 4B3RQ 2R93G 2LXJA 4P71A 1XTDA 3F2BA 3S15H 5JJLA 1CKNA 2ZTCA 1PH3A 2JA5G 1J6QA 2JA9A 3MXNB 4JI5Q 3JAMi 1VQCA 1E1OA 5C4XG 2MNAA 3FHWA 3ULPA 1GM5A 1JJ2A 4LF6L 4B3SQ 1N33L 2K52A 1HZBA 4A3GG 2E8GA 3CCJA 3CC4A 5JEAG 2N78A 4C2MH 2B63H 3GTQH 3UE0A 3U58A 4TVAB 2OQ0A 4A75A 3UDFA 4A3EH 4A93G 5M3FH 1X3GA 4R4QA 3CCRA 1L1OA 3RNUA 5IP7H 3PIOA 1Y1WH 4A3FG 4LF4Q 1VQFA 4X62Q 1FGUA 1X54A 5LMUQ 3HFZB 5GROA 2LSSA 3EBEA 3J80c 2K50A 1T9HA 2UU9Q 1HNZQ 2PI2A 4KLKA 1JJCB 1KIXA 2JA8G 1ASZA 4JI0Q 4DV5Q 1SRUA 4NXML 4DV1Q 1KC8C 4DR3Q 2H5XA 4DNIA 1BVSA 3EIVA 1PH1A 4L5RC 2ZTEA 4MTNA 4OXPA 4RG1A 4GOPC 3GTPH 3I4MH 3HOZH 2WAQE 4JI4L 2JE6I 3BZCA 1E3PA 3UDGA 3M85A 2VUMH 3RN2A 1E1TA 3RLNA 5E7NA 3S17H 4DV7L 4BBRH 1D8LA 1L1OB 1CSPA 1HR0W 3HOYH 1AE3A 1X3FA 3D31A 3T1HL 2E5LL 5GAEC 1VQMA 1HNXL 1B8AA 1YBYA 1QVGA 1XPUA 2R7DA 1KXLA 4HIMA 3PIPA 3MEFA 1FVIA 4C3JH 1OXXK 3NEMA 1N9WA 3GTJH 4DUYQ 4X64L 3S2HH 1SROA 1N32L 1X6OA 1BKBA 4APVA 4JBJA 4JCVE 2ATWA 2ZM6L 3S14H 3HOVG 1Y1VH 2I0QA 4LUOA 2KHIA 2EIFA 4HJ8A 3GTOH 1UE6A 3STBC 2CWAA 4DAYB 4POFA 3G71A 2IX0A 4HIKA 5M3MG 4POGA 2HIVA 4BY7G 2L15A 2XGTA 1TWAH 3ERSX 3H0GH 1XMOL 1K8AC 1I50H 4LW1A 2E2JH 3ULLA 1GD7A 1PH9A 2JEAI 1HNWQ 4KI0A 2UXBL 1I6HH 1EOVA 2JA5H 1MIUA 4LFBL 3NELA 5C4XH 1N8RC 4GNXA 4A3EG 3I56A 1VQGA 2K14A 4PZ8A 5M3FG 1VQOA 1XMQL 3NENA 5AJ3L 1M90C 4A3GH 3PGZA 4JOIC 4AQYL 1OTCA 1WI5A 2D62A 2I5LX 1Y1WG 1QVCA 1MJEA 2AWNA 2VS1A 4JBWA 3JAMc 3ICEA 1EUJA 2CKZB 1IL2A 2JQOA 1KHIA 4DR2L 1QZHA 5K36G 2YV5A 1XNQQ 5FJ8G 3KF8B 4P75A 1UE7A 1VQKA 4A3FH 2IHFA 5IWAQ 1K83H 4LF7L 4GKKL 3M4QA 4YCWA 3T1YQ 1PVOA 4GKJL 1IBLQ 4DV2Q 3STBD 2DGYA 4JYAQ 2PQAA 4AIMA 5GAHC 1K0RA 1SN8A 2R6GA 4YY3Q 1B7YB 1S40A 2ZJQA 4OX9L 2UXCL 1X9NA 4HJ7A 2VUMG 2ZJPA 1VQ9A 3GTGH 2N3SA 4PZ6A 4BBRG 3CCSA 2PMZE 2BA0A 1J5EL 4FDBA 4B3MQ 3CD6A 4DR6Q 3OYYA 4H02A 1NJIC 4B3TQ 1QUQA 3I4NG 4DR4L 1WOCA 4MNOA 3HKSA 2Q2TA 4WJ3M 4Y7NH 2E2HH 2A8VA 4BA2I 1C9OA 4NXNQ 3WWVA 2OWOA 4O0AA 1PH2A 1EIYB 1W3SA 1Q81C 1N36Q 1VQIA 3U4ZA 4YHHQ 1L0WA 3RLFA 4DV0Q 2IHEA 1S72A 4JI2Q 1L2FA 2VNUD 3UDXA 3HOXG 1Y1VG 1VQ5A 1YHAA 2UXDL 2ASBA 3TRZA 3TQYA 1YJWA 1XPRA 4QQBX 1UEBA 3K81C 3ZJYC 5BR8L 4A3JG 3H0GG 1HR0Q 1WFQA 5IYBG 4OO1G 5IT9c 4P74A 1VQDA 1EFWA 2UUAQ 4BXXH 4DV6Q 2OTJA 2ES2A 1YIJA 1IBKL 1MKHA 3HOWG 3CP0A 1I5FA 4PG3A 3CF5A 4JV5L 4EX5A 5M3MH 2NN6G 1QVFA 2B3GA 2K5NA 2Z6KA 4BY7H 2K5VA 4DR7L 1SFOH 3M9BA 1KRTA 1M1KC 1G51A 4DAMA 1IXRA 3EN2A 1X56A 1NTGA 2GVAA 2K5HA 2HHHL 1VQHA 3L2PA 1OXUA 1SE8A 4JBMA 4DV3Q 4A3MG 4OWTB 5C3EG 4DV4L 1NBWA 1IBMQ 5ELNA 2F52A 1OXVA 2CQOA 5H1SE 2LXKA 3GTMH 2PNHA 1UE1A 4QGUA 4B3ML 4LFCQ 4DK3C 1E22A 3FKIG 3KF6A 4A3KG 2IX1A 4OONA 4X65L 3E0EA 4A4IA 2QA4A 3DLLA 3F1ZA 1K9MC 5FJ8H 5C4JH 4ME3A 2YTXA 3LGJA 1CKNB 4DR5L 3I4OA 1JB7A 1VQ7A 2UUBQ 1LTLA 3D0FA 2VQFQ 4JI6Q 3Q8DA 1RL2A 4JI8Q 4JI2L 1HZCA 4OO1I 4JI1L 2UUCQ 1N34L 4A3CG 5GAGC 3S1NH 4LF9Q 5DLQE 5JEAJ 3OTOQ 2R92H 3F2CA 1YVCA 4AYBG 4HIOA 2NN6I 4LFAQ 3E9HA 1TWFH 4IJHA 3AFPA 4UY8C 1X55A 3CW2C 5LMNL 3G4SA 1Q8KA 2QEXA 4HIDA 4B3RL 3KYHC 4UP9A 2VQEQ 4AH6A 1EWIA 3I4NH 1Z47A 4J15A 3CMEA 1X65A 3CCQA 4JI7Q 4JI5L 2JA7G 5JJKA 1I94Q 1BBUA 4YCUA 5GQOA 4GLAC 4Y52H 4B3SL 4IFDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5M X;  4A3B G;  1KL9 A;  5JJI A;  2F3I A;  3IRB A;  4K0K Q;  2CCZ A;  4IJL A;  1EQQ A;  4QY7 A;  4UPA A;  4JI3 Q;  3PUX A;  3HOX H;  3A74 A;  2JA6 G;  1D7Q A;  1YHQ A;  4BXX G;  1WCM G;  1G29 1;  1A8V A;  2E2I H;  3PF4 A;  4LF5 Q;  1YJN A;  4XIG S;  2I5H A;  4LF4 L;  1JT8 A;  2OTL A;  4X62 L;  4A3J H;  1PH4 A;  3CC2 A;  5IYB H;  5LMU L;  1YEZ A;  4GLX A;  2JEB I;  4GS3 A;  1BBW A;  1V9P A;  3HOW H;  4KHP Q;  1HZA A;  2MFI A;  3J81 i;  2FXQ A;  4X66 Q;  2UU9 L;  4GOP A;  1HNZ L;  4IPG A;  2CFM A;  2NZH A;  4R1J A;  1TWC H;  2R93 H;  1YJ9 A;  2MQH A;  3CXC A;  2ALY B;  4R4O A;  4JI0 L;  4JI8 L;  4DV5 L;  1LUZ A;  1NY4 A;  4IFD J;  1Z9F A;  3K0X A;  2UUC L;  3PO2 G;  3F8T A;  4DV1 L;  4DR3 L;  5M5X H;  4QJF A;  1R9T H;  1VQL A;  1Q1E A;  4A3M H;  2KCM A;  1V1Q A;  4NPS A;  5C3E H;  4X6A H;  1HZ9 A;  3DM3 A;  3E9I A;  1B70 B;  1YZ6 A;  4DR1 Q;  4IFD I;  1K8G A;  5GAD C;  5J3B A;  3PF5 A;  1EIF A;  2WB1 G;  2YU9 H;  4ALP A;  2Y0S G;  1XNR Q;  3FKI H;  3CPW A;  4A3K H;  3HKZ G;  2K75 A;  3J7Z C;  1UWV A;  3ULJ A;  1NE3 A;  2AHO B;  1EQR A;  2KCT A;  2BH8 A;  3CC7 A;  4LF8 Q;  2R92 G;  3PV0 A;  2WB1 E;  2WP8 J;  4DUY L;  2AMC B;  1A63 A;  3AFQ A;  4NB3 A;  4GNX B;  3HKZ E;  2OQK A;  5HY6 A;  2F4V Q;  4A3C H;  1DGS A;  1FL0 A;  2IY5 B;  2N8N A;  4C3I H;  3PO3 G;  3S1M H;  2BA1 A;  4A3I H;  1YIT A;  4TQU S;  3A0J A;  5M5W H;  1OXS C;  2GVB A;  4L5Q A;  2Q2I A;  4DK6 C;  3CMA A;  3TS0 A;  4LF6 Q;  4HJ9 A;  2GN5 A;  1N33 Q;  5FLM G;  1HNW L;  4A3L H;  4JOI A;  2BH2 A;  2JA7 H;  1WJJ A;  1UE5 A;  4R4I A;  2QGQ A;  5IYC G;  3H3V H;  4C3H H;  2PQA B;  4A3B H;  4DPG A;  4P73 A;  5IY0 A;  4UP8 A;  3KJO A;  3W5O A;  1VQP A;  1P16 A;  3B6Y A;  3M3Y H;  2HT1 A;  2JA6 H;  3KOJ A;  4HJ5 A;  2Q2U A;  1HJP A;  1WCM H;  3KDF A;  5IP9 G;  1L1O C;  3L0O A;  1XNQ L;  3S16 H;  3CQZ H;  2B29 A;  1QUQ B;  2ZTD A;  4P72 A;  3W1G A;  3KJP A;  5IWA L;  2C35 B;  1PH6 A;  1VQ4 A;  3S2D H;  3TS2 A;  2WFW A;  2R7Z G;  3T1Y L;  1IBL L;  1X3E A;  4DV2 L;  3I7F A;  1PV4 A;  3GTK H;  4NXM Q;  3CCL A;  1YNX A;  4JYA L;  5IE8 A;  3ER0 A;  3UE1 A;  4YY3 L;  1PH8 A;  4JBK A;  4JI4 Q;  1AH9 A;  1K3R A;  1VQE A;  4BBS H;  4YCV A;  3SGI A;  3CCU A;  1PFS A;  4IOA A;  3PO2 H;  3G6E A;  3K7U C;  4DV7 Q;  3AQQ A;  4DR6 L;  4A3D G;  2MO1 A;  4LNQ A;  4B3T L;  3J81 c;  4DUZ Q;  1Q7Y C;  3PUV A;  3T1H Q;  2E5L Q;  4EQ5 A;  1HNX Q;  3M7N A;  5IYD G;  4PMW A;  4BY1 H;  1LYL A;  1SMX A;  1U0L A;  3KDF B;  3J7A 5;  1VQ8 A;  3RZO H;  3CAM A;  1GO3 E;  4NXN L;  4QL5 A;  3TRE A;  4DKA C;  3PCO B;  1E24 A;  4L5S A;  1N36 L;  4X64 Q;  4YHH L;  4WJ4 A;  1N32 Q;  3RN5 A;  4DV0 L;  3AEV A;  1LM0 A;  5M5Y H;  2NVY H;  2ZM6 Q;  1Q82 C;  1A62 A;  5C44 H;  3I2Z A;  2RHQ B;  1SLJ A;  3K8A A;  4A3I G;  3BU2 A;  3CPF A;  1OXT A;  4GN3 B;  1V43 A;  2Q2H A;  3W1B A;  1HR0 L;  1FJG Q;  1XMO Q;  1EYG A;  3PO3 H;  2UUA L;  1XPO A;  1O7I A;  4DV6 L;  2HIX A;  1VS0 A;  3U50 C;  2NVX H;  4A3L G;  2UXB Q;  1TWH H;  2KHJ A;  4AYB E;  3A5Z B;  3KF6 B;  4YWM A;  4UP7 A;  4LFB Q;  2WAQ G;  3RLO A;  1IZ6 A;  2VZA A;  2D0O A;  1XMQ Q;  1XJV A;  3BZK A;  5AJ3 Q;  2JJQ A;  5FLM H;  5C0X G;  4XTC S;  3CCV A;  4AQY Q;  1CUK A;  2XTI A;  1CKO A;  3RR5 A;  4MZ9 A;  2HQL A;  2NVT H;  1A0I A;  5IYC H;  4DV3 L;  2EQS A;  4GNX C;  3S24 A;  4DR2 Q;  1IBM L;  2CWP A;  2V1C C;  3CCE A;  3M4P A;  4OWW B;  1U5K A;  3JC6 6;  3K7A H;  4LFC L;  1ASY A;  1HH2 P;  5HGQ A;  5LMN W;  1VQN A;  2RF4 A;  2A1A A;  3BJU A;  1QZG A;  4LF7 Q;  4DUZ L;  4GKK Q;  1WYD A;  1PH7 A;  4GKJ Q;  3PUW A;  5IP9 H;  3F2D A;  3HOU G;  2VW9 A;  4IPH A;  3NBH B;  2R7F A;  4LWC A;  1VQJ A;  4OX9 Q;  3RZD H;  2UUB L;  2VQF L;  4BBS G;  4JI6 L;  2R7Z H;  2A19 A;  2UXC Q;  1Q12 A;  2IT1 A;  3PUY A;  5C0X J;  1G6P A;  2AKW B;  1IYJ B;  5ELO A;  3U4V A;  1PYS B;  2RCN A;  1J5E Q;  4LF9 L;  4JG2 A;  3OTO L;  1NMF A;  1TXY A;  1PA6 A;  4DR4 Q;  4JC0 A;  4LFA L;  3OW2 A;  2Z0S A;  1VQ6 A;  4BY1 G;  3H3V I;  3PUZ A;  1FJG L;  5C0X I;  3S1Q H;  2VQE L;  3PSI A;  4A3D H;  4GLV B;  1NMG A;  4YWL A;  4BA1 I;  1SR3 A;  3AYH B;  3KLW A;  4JI7 L;  4O2D A;  3GD7 A;  5IYD H;  2D0P A;  5EAY A;  2N49 A;  3UDI A;  5FLX c;  5C44 G;  4GN5 A;  1I94 L;  3I55 A;  2B63 G;  1JE5 A;  2DUD A;  3S1R H;  1KRS A;  1KAW A;  4PZ7 A;  2UXD Q;  2Y0S E;  2JK8 A;  3J80 i;  2KBN A;  1VQA A;  5IP7 G;  4GOP B;  2ZJR A;  4K0K L;  5BR8 Q;  4JI3 L;  3M4O H;  3TEH B;  1JJG A;  1KD1 C;  1H95 A;  4A76 A;  1Q86 C;  1IBK Q;  4A93 H;  3CCM A;  4LF5 L;  4JV5 Q;  3GTL H;  4QIW E;  1Q1B A;  1Y14 B;  1VCI A;  2PI2 E;  4GN4 B;  3GO5 A;  1MJC A;  4DR7 Q;  4IPD A;  1P8L A;  3A5U A;  4KHP L;  4OWX B;  3H15 A;  4IO9 A;  2HHH Q;  1PH5 A;  2RHS B;  1W2B A;  2NVQ H;  2OCE A;  2AWO A;  2Z6K C;  4X66 L;  3HOZ G;  3I4M G;  4LUZ A;  3GDE A;  1CSQ A;  4DV4 Q;  2JA8 H;  2NZO A;  1GVP A;  2MO0 A;  1CKM A;  2K4K A;  4RMF A;  1K73 C;  4R4C A;  3HOY G;  1AE2 A;  1E7Z A;  2VY3 A;  1C0A A;  1TWG H;  4X65 Q;  1RIP A;  1PHJ A;  1YHB A;  3K80 C;  2YYZ A;  4DR1 L;  1C7Y A;  1JMC A;  4DR5 Q;  1PYB A;  1VQB A;  2YTV A;  1XNR L;  2VL6 A;  4KHZ A;  2EXD A;  3L7Z C;  3J81 j;  4IPC A;  3KFU A;  4IOC A;  4JI1 Q;  3HOU H;  1N34 Q;  4LUV A;  4YWK A;  1YI2 A;  1I3Q H;  4LF8 L;  2KEN A;  1S3O A;  1GKH A;  1KQS A;  2ID0 A;  3G48 A;  4HJA A;  1Q46 A;  3VDY A;  2YTY A;  5LMN Q;  4L5T A;  4R4T A;  3FP9 A;  2F4V L;  3HOV H;  4B3R Q;  2R93 G;  2LXJ A;  4P71 A;  1XTD A;  3F2B A;  3S15 H;  5JJL A;  1CKN A;  2ZTC A;  1PH3 A;  2JA5 G;  1J6Q A;  2JA9 A;  3MXN B;  4JI5 Q;  3JAM i;  1VQC A;  1E1O A;  5C4X G;  2MNA A;  3FHW A;  3ULP A;  1GM5 A;  1JJ2 A;  4LF6 L;  4B3S Q;  1N33 L;  2K52 A;  1HZB A;  4A3G G;  2E8G A;  3CCJ A;  3CC4 A;  5JEA G;  2N78 A;  4C2M H;  2B63 H;  3GTQ H;  3UE0 A;  3U58 A;  4TVA B;  2OQ0 A;  4A75 A;  3UDF A;  4A3E H;  4A93 G;  5M3F H;  1X3G A;  4R4Q A;  3CCR A;  1L1O A;  3RNU A;  5IP7 H;  3PIO A;  1Y1W H;  4A3F G;  4LF4 Q;  1VQF A;  4X62 Q;  1FGU A;  1X54 A;  5LMU Q;  3HFZ B;  5GRO A;  2LSS A;  3EBE A;  3J80 c;  2K50 A;  1T9H A;  2UU9 Q;  1HNZ Q;  2PI2 A;  4KLK A;  1JJC B;  1KIX A;  2JA8 G;  1ASZ A;  4JI0 Q;  4DV5 Q;  1SRU A;  4NXM L;  4DV1 Q;  1KC8 C;  4DR3 Q;  2H5X A;  4DNI A;  1BVS A;  3EIV A;  1PH1 A;  4L5R C;  2ZTE A;  4MTN A;  4OXP A;  4RG1 A;  4GOP C;  3GTP H;  3I4M H;  3HOZ H;  2WAQ E;  4JI4 L;  2JE6 I;  3BZC A;  1E3P A;  3UDG A;  3M85 A;  2VUM H;  3RN2 A;  1E1T A;  3RLN A;  5E7N A;  3S17 H;  4DV7 L;  4BBR H;  1D8L A;  1L1O B;  1CSP A;  1HR0 W;  3HOY H;  1AE3 A;  1X3F A;  3D31 A;  3T1H L;  2E5L L;  5GAE C;  1VQM A;  1HNX L;  1B8A A;  1YBY A;  1QVG A;  1XPU A;  2R7D A;  1KXL A;  4HIM A;  3PIP A;  3MEF A;  1FVI A;  4C3J H;  1OXX K;  3NEM A;  1N9W A;  3GTJ H;  4DUY Q;  4X64 L;  3S2H H;  1SRO A;  1N32 L;  1X6O A;  1BKB A;  4APV A;  4JBJ A;  4JCV E;  2ATW A;  2ZM6 L;  3S14 H;  3HOV G;  1Y1V H;  2I0Q A;  4LUO A;  2KHI A;  2EIF A;  4HJ8 A;  3GTO H;  1UE6 A;  3STB C;  2CWA A;  4DAY B;  4POF A;  3G71 A;  2IX0 A;  4HIK A;  5M3M G;  4POG A;  2HIV A;  4BY7 G;  2L15 A;  2XGT A;  1TWA H;  3ERS X;  3H0G H;  1XMO L;  1K8A C;  1I50 H;  4LW1 A;  2E2J H;  3ULL A;  1GD7 A;  1PH9 A;  2JEA I;  1HNW Q;  4KI0 A;  2UXB L;  1I6H H;  1EOV A;  2JA5 H;  1MIU A;  4LFB L;  3NEL A;  5C4X H;  1N8R C;  4GNX A;  4A3E G;  3I56 A;  1VQG A;  2K14 A;  4PZ8 A;  5M3F G;  1VQO A;  1XMQ L;  3NEN A;  5AJ3 L;  1M90 C;  4A3G H;  3PGZ A;  4JOI C;  4AQY L;  1OTC A;  1WI5 A;  2D62 A;  2I5L X;  1Y1W G;  1QVC A;  1MJE A;  2AWN A;  2VS1 A;  4JBW A;  3JAM c;  3ICE A;  1EUJ A;  2CKZ B;  1IL2 A;  2JQO A;  1KHI A;  4DR2 L;  1QZH A;  5K36 G;  2YV5 A;  1XNQ Q;  5FJ8 G;  3KF8 B;  4P75 A;  1UE7 A;  1VQK A;  4A3F H;  2IHF A;  5IWA Q;  1K83 H;  4LF7 L;  4GKK L;  3M4Q A;  4YCW A;  3T1Y Q;  1PVO A;  4GKJ L;  1IBL Q;  4DV2 Q;  3STB D;  2DGY A;  4JYA Q;  2PQA A;  4AIM A;  5GAH C;  1K0R A;  1SN8 A;  2R6G A;  4YY3 Q;  1B7Y B;  1S40 A;  2ZJQ A;  4OX9 L;  2UXC L;  1X9N A;  4HJ7 A;  2VUM G;  2ZJP A;  1VQ9 A;  3GTG H;  2N3S A;  4PZ6 A;  4BBR G;  3CCS A;  2PMZ E;  2BA0 A;  1J5E L;  4FDB A;  4B3M Q;  3CD6 A;  4DR6 Q;  3OYY A;  4H02 A;  1NJI C;  4B3T Q;  1QUQ A;  3I4N G;  4DR4 L;  1WOC A;  4MNO A;  3HKS A;  2Q2T A;  4WJ3 M;  4Y7N H;  2E2H H;  2A8V A;  4BA2 I;  1C9O A;  4NXN Q;  3WWV A;  2OWO A;  4O0A A;  1PH2 A;  1EIY B;  1W3S A;  1Q81 C;  1N36 Q;  1VQI A;  3U4Z A;  4YHH Q;  1L0W A;  3RLF A;  4DV0 Q;  2IHE A;  1S72 A;  4JI2 Q;  1L2F A;  2VNU D;  3UDX A;  3HOX G;  1Y1V G;  1VQ5 A;  1YHA A;  2UXD L;  2ASB A;  3TRZ A;  3TQY A;  1YJW A;  1XPR A;  4QQB X;  1UEB A;  3K81 C;  3ZJY C;  5BR8 L;  4A3J G;  3H0G G;  1HR0 Q;  1WFQ A;  5IYB G;  4OO1 G;  5IT9 c;  4P74 A;  1VQD A;  1EFW A;  2UUA Q;  4BXX H;  4DV6 Q;  2OTJ A;  2ES2 A;  1YIJ A;  1IBK L;  1MKH A;  3HOW G;  3CP0 A;  1I5F A;  4PG3 A;  3CF5 A;  4JV5 L;  4EX5 A;  5M3M H;  2NN6 G;  1QVF A;  2B3G A;  2K5N A;  2Z6K A;  4BY7 H;  2K5V A;  4DR7 L;  1SFO H;  3M9B A;  1KRT A;  1M1K C;  1G51 A;  4DAM A;  1IXR A;  3EN2 A;  1X56 A;  1NTG A;  2GVA A;  2K5H A;  2HHH L;  1VQH A;  3L2P A;  1OXU A;  1SE8 A;  4JBM A;  4DV3 Q;  4A3M G;  4OWT B;  5C3E G;  4DV4 L;  1NBW A;  1IBM Q;  5ELN A;  2F52 A;  1OXV A;  2CQO A;  5H1S E;  2LXK A;  3GTM H;  2PNH A;  1UE1 A;  4QGU A;  4B3M L;  4LFC Q;  4DK3 C;  1E22 A;  3FKI G;  3KF6 A;  4A3K G;  2IX1 A;  4OON A;  4X65 L;  3E0E A;  4A4I A;  2QA4 A;  3DLL A;  3F1Z A;  1K9M C;  5FJ8 H;  5C4J H;  4ME3 A;  2YTX A;  3LGJ A;  1CKN B;  4DR5 L;  3I4O A;  1JB7 A;  1VQ7 A;  2UUB Q;  1LTL A;  3D0F A;  2VQF Q;  4JI6 Q;  3Q8D A;  1RL2 A;  4JI8 Q;  4JI2 L;  1HZC A;  4OO1 I;  4JI1 L;  2UUC Q;  1N34 L;  4A3C G;  5GAG C;  3S1N H;  4LF9 Q;  5DLQ E;  5JEA J;  3OTO Q;  2R92 H;  3F2C A;  1YVC A;  4AYB G;  4HIO A;  2NN6 I;  4LFA Q;  3E9H A;  1TWF H;  4IJH A;  3AFP A;  4UY8 C;  1X55 A;  3CW2 C;  5LMN L;  3G4S A;  1Q8K A;  2QEX A;  4HID A;  4B3R L;  3KYH C;  4UP9 A;  2VQE Q;  4AH6 A;  1EWI A;  3I4N H;  1Z47 A;  4J15 A;  3CME A;  1X65 A;  3CCQ A;  4JI7 Q;  4JI5 L;  2JA7 G;  5JJK A;  1I94 Q;  1BBU A;  4YCU A;  5GQO A;  4GLA C;  4Y52 H;  4B3S L;  4IFD G; 
#chains in the Genus database with same CATH topology
 4DAV A;  4A3B G;  5JJI A;  3FPP A;  3DMU A;  3NXW A;  3T51 B;  1EQQ A;  2MHV A;  4UPA A;  3PUX A;  3V96 A;  1TWH B;  2F0J A;  4WRD A;  4XIG S;  4LF4 L;  1JT8 A;  4X62 L;  1K8M A;  5DAU A;  4GLX A;  4GS3 A;  5FO7 B;  3GTP B;  2NN6 H;  2FXQ A;  3I4M B;  2NZH A;  1EY0 A;  1STN A;  2MQH A;  2PYK A;  1TU2 B;  4R4O A;  1LUZ A;  2UUC L;  3F8T A;  4BBR B;  3Q24 A;  1R9T H;  4QF4 A;  1Q1E A;  1CA6 A;  4A3M H;  2WAC A;  2KCM A;  3I73 A;  1S5B D;  3I8Z A;  5IT9 L;  2XIW A;  5KYL A;  3HZX A;  3CPW A;  1JC7 A;  4IUV A;  3J7Z C;  4A3K H;  3S14 B;  4IUN A;  1H9R A;  1Y1V B;  4LF8 Q;  3DWQ A;  2M2L A;  3GTO B;  4DUY L;  1SEB D;  2JP1 A;  4CKE A;  1O7L A;  4ZLT F;  1DYQ A;  1FL0 A;  4C3I H;  1SNP A;  2BA1 A;  1QNK A;  1A2T A;  4A3I H;  2WII B;  1OXS C;  3TS0 A;  1A15 A;  4LF6 Q;  1Y8P B;  5COY A;  1HNW L;  4RAU C;  4RHS A;  4DXF A;  4IQZ A;  3K6O A;  1A6X A;  4ID6 A;  4NKL A;  1JWM D;  4JK1 C;  4R4I A;  1STY A;  1I4X A;  5IGB A;  3H3V H;  4A3B H;  3LNN A;  4DPG A;  1Y8N B;  1B2T A;  1T5E A;  4UP8 A;  4A3F B;  3W5O A;  2A74 C;  1CZG A;  4HJ5 A;  1JIC A;  1HJP A;  2NYZ D;  3I70 A;  4IUP A;  3J7A F;  1JB3 A;  3CU7 A;  1Z6H A;  5IWA L;  3TS2 A;  2M00 A;  1IBL L;  4H13 C;  5IE8 A;  3UE1 A;  1PH8 A;  4Y7N B;  1LO5 D;  4PV1 C;  4HTH A;  4DV7 Q;  2RBM A;  3J81 c;  2F0V A;  3PUV A;  2E5L Q;  1BF4 A;  5LL6 S;  4KK7 A;  1LYL A;  1SMX A;  3A8K E;  1BR9 A;  3KDF B;  1UUP A;  1VQ8 A;  1GO3 E;  1SE3 A;  4E6I A;  1VF7 A;  1N36 L;  5CBA E;  4DV0 L;  1UEA B;  3AEV A;  5DM7 3;  5M5Y H;  5C44 H;  1SLJ A;  3BG3 A;  3BU2 A;  5CR3 A;  4G4K A;  1IYV A;  4HMJ A;  1OXT A;  1LT4 D;  3U9O A;  4GN3 B;  5EJW A;  3W1B A;  2E2D C;  1EYG A;  1O7I A;  4DV6 L;  2HIX A;  3U50 C;  4A3L G;  2O2L D;  5A35 A;  2KHJ A;  3A5Z B;  2KJX A;  1KDB A;  4UP7 A;  4C2M B;  1KTK A;  2QDB A;  1ROD A;  5C0X G;  4AQY Q;  1CUK A;  5NUC A;  3RR5 A;  3GTM B;  2NVT H;  1A0I A;  4DAY A;  4DV3 L;  4RCO A;  5AFW A;  4V19 0;  4DR2 Q;  4RKL A;  2EXZ A;  1ASY A;  3K7A H;  4XQN A;  1PZJ D;  2RF4 A;  2A1A A;  1RJT A;  4GKK Q;  2HUG A;  4OGQ C;  3F2D A;  2EY6 A;  4G57 A;  3NBH B;  3S1N B;  4KD4 A;  4OIK A;  1HXY D;  4OX9 Q;  3E5S A;  3ERO A;  2UXC Q;  1TWF B;  4UDU C;  2IT1 A;  2VB2 X;  1J5E Q;  4RGN A;  2E75 C;  1NMF A;  3I72 A;  3I4N B;  4JC0 A;  4LFA L;  5G3L F;  2EY5 A;  3FEW X;  3PSI A;  3SR1 A;  1SYC A;  1NMG A;  4YWL A;  3S2H B;  1SR3 A;  4CJ2 C;  2L9H A;  3UDI A;  5FLX c;  2K5D A;  2LY7 A;  4I7A A;  2UXD Q;  3KBG A;  1SE2 A;  1ML0 D;  2JK8 A;  5E4X A;  5CV8 A;  1CHQ D;  1S5E D;  5ELB A;  1ZXT A;  3K0Y A;  1H95 A;  1Q86 C;  4A93 H;  1XYI A;  3HOW B;  1VMP A;  3CCM A;  4H44 C;  4LF5 L;  1Y14 B;  4DR7 Q;  2EDG A;  3TME A;  4IPD A;  4OWX B;  1SNQ A;  5CMD A;  2HHH Q;  1PH5 A;  3QOJ A;  3I4M G;  4X66 L;  1CSQ A;  4DV4 Q;  2JA8 H;  4MN3 A;  1SJE D;  3C1F A;  3VR2 A;  1K73 C;  3NQT A;  2IJ0 A;  2YYZ A;  4DR1 L;  1G2T A;  1VQB A;  4B08 A;  4KHZ A;  1QNU A;  3C46 A;  1N34 Q;  1I3Q H;  3KK7 A;  3MVV A;  2KEN A;  1Y69 U;  4AYB B;  1GKH A;  5M5W B;  4L5T A;  1YNJ C;  3ND8 A;  3F2B A;  1L0X B;  5BN3 A;  1CKN A;  2JA7 B;  3MXN B;  1E1O A;  1X3P A;  3FHW A;  1N33 L;  3GP7 A;  3MXG A;  1YNN C;  3CCJ A;  1RTN A;  2N78 A;  2IPK D;  3GTQ H;  3UE0 A;  4TVA B;  4A3E H;  4A75 A;  3UDF A;  1PMR A;  2IW3 A;  3N6R A;  4A3F G;  4LF4 Q;  4X62 Q;  1ONL A;  1FGU A;  5COR A;  5G3L D;  1X54 A;  3VYT A;  4RKB A;  5GRO A;  1R4Q B;  1SE4 A;  5JVH 3;  3J80 c;  2K50 A;  2NWG A;  2FFK B;  1KDA A;  2K1B A;  1JWS D;  1JOR A;  1C8C A;  1KLU D;  1SRU A;  4O42 A;  5IGF A;  4NXM L;  3PO2 B;  4DNI A;  5T1G A;  3GTP H;  2ZTE A;  3I4M H;  2CW0 C;  1EY6 A;  4R8N A;  2JE6 I;  3GV6 A;  3H6M A;  4OIJ A;  2QDL A;  3M4Y A;  3RN2 A;  4BBR H;  1L1O B;  2Y0S B;  2A68 C;  3D31 A;  3T1H L;  1VQM A;  1HNX L;  1B8A A;  1KNE A;  3NEM A;  3V05 A;  4DUY Q;  1MI2 A;  4QIW B;  4ZUJ A;  1O7Z A;  5C6A A;  2EJG C;  4APV A;  3S14 H;  1Y1V H;  4DGZ A;  3PO3 B;  2EVB A;  2IL8 A;  4LUO A;  3C2P A;  2NVX B;  3U9S A;  3GTO H;  2X6G A;  3STB C;  4HIK A;  2XGT A;  3ERS X;  4LW1 A;  3ULL A;  1PH9 A;  2B2Y C;  1HNW Q;  3O13 A;  2UXB L;  1EOV A;  2JYO A;  5IOC A;  1MIU A;  3NEL A;  5BN5 A;  2ZXO A;  1FD7 D;  1N8R C;  4FVM A;  1ZYR C;  3I56 A;  4GNX A;  2K14 A;  3PGZ A;  1WI5 A;  1X32 A;  2I5L X;  1QVC A;  2Z4H A;  4K14 A;  4FNF A;  1TT2 A;  1IL2 A;  2B2U A;  4X3U A;  3D6C A;  1LAB A;  1EEI D;  1LT6 D;  4A3F H;  4GZY C;  5IWA Q;  4X3K A;  1BOS A;  4ZK9 B;  1SYG A;  1SNO A;  3M4Q A;  4YCW A;  2R7Z B;  4RGT A;  1IBL Q;  4GKJ L;  1MD2 D;  2F0I A;  1XXG A;  1ENA A;  2ZJP A;  4XXE A;  2N3S A;  3IAY A;  3P7J A;  3OYY A;  1NJI C;  1QUQ A;  3I4N G;  4DR4 L;  1ZKO A;  4MNO A;  3HKS A;  4WJ3 M;  4XYO A;  4Y7N H;  1GUS A;  1C9O A;  3WWV A;  1PH2 A;  1EIY B;  1W3S A;  3L9A X;  1N36 Q;  1SAP A;  4DV0 Q;  2CHB D;  3X3M A;  3DHQ A;  1KLG D;  1PXU A;  2E76 C;  2ASB A;  4FF1 A;  3ZJY C;  3P75 A;  2OTJ A;  4BXX H;  4DV6 Q;  1IBK L;  3HOW G;  2HDM A;  3CP0 A;  4F7X A;  3OHX C;  2NVQ B;  2WAQ B;  2Z6K A;  1B9M A;  1KRT A;  2G9D A;  2JXM B;  5EBD A;  1R4P B;  2DNE A;  2GVA A;  1IL8 A;  5FO8 B;  3L2P A;  4JBM A;  4DV3 Q;  2SNS A;  4OWT B;  5ELN A;  1H9K A;  1ICF B;  1OXV A;  1EYC A;  3GTM H;  5ELD A;  4B3M L;  4DK0 A;  1MBY A;  3KF6 A;  1MSH A;  4X65 L;  5I4D A;  1I4P A;  2QA4 A;  4CDC C;  3SE0 A;  2JSO A;  1AW7 A;  1BQQ T;  3ZYY X;  1LTL A;  1PLF A;  3VA5 A;  4OO1 I;  4JI8 Q;  4FF2 A;  3OPO A;  3T56 B;  1D5X C;  3S1N H;  5JEA J;  4AYB G;  5TSS A;  5E3F A;  4LFA Q;  3E9H A;  1TWF H;  5I2X A;  3AFP A;  1NR4 A;  1X55 A;  5LMN L;  1EWC A;  2QEX A;  4HID A;  1AP0 A;  3KYH C;  5CV9 A;  3Q6S A;  4XT3 B;  1EWI A;  3I4N H;  1HFG A;  4J15 A;  1X65 A;  3ND9 A;  2JA7 G;  2F0U A;  3HS0 C;  2O5I C;  1BBU A;  4YCU A;  2A73 B;  5C44 B;  2B63 B;  3K57 A;  2PO4 A;  5M3F B;  4IFD G;  3HG9 A;  3H91 A;  5FLX E;  5KRU A;  4I7Z C;  3DEO A;  3H94 A;  3TP6 A;  2CCZ A;  4IJL A;  2A6H D;  1YHQ A;  4X3T A;  1EQV A;  3KLS A;  4G7H C;  1ET9 A;  4LF5 Q;  4CJ1 B;  2B2W A;  5D65 A;  1PH4 A;  3LWU A;  1CTM A;  5LMU L;  2JEB I;  1BBW A;  2RDG A;  3HOW H;  3T16 A;  3CKI B;  3J81 i;  3TN2 A;  4X66 Q;  3HOZ B;  1HNZ L;  1B44 D;  3N52 A;  2ENB A;  4R1J A;  2ALY B;  1QOH A;  2PNR C;  2VUM B;  2PCF B;  1Z9F A;  3K0X A;  5IGD A;  3PO2 G;  3S17 B;  4RWS C;  1B3A A;  1VQL A;  3HOY B;  1V1Q A;  3E9I A;  1ESR A;  4DR1 Q;  4MHE A;  1TQO A;  2Y0S G;  2A5H A;  2RVL A;  2L55 A;  1V1P B;  4CHT B;  3ULJ A;  3H3V C;  1H9J A;  3DWP A;  4QCL A;  2AHO B;  2AQ1 B;  3HEJ A;  3NTH A;  5FO9 B;  2RDH A;  2WB1 E;  1A63 A;  4NB3 A;  1GHK A;  1CQV A;  2N8N A;  2QKI C;  3PO3 G;  3T13 A;  1TS2 A;  1YIT A;  4TQU S;  3A0J A;  3W3A A;  4V0B A;  5M5W H;  5C4X B;  4H7B A;  4HJ9 A;  1N33 Q;  4XQQ A;  4JOI A;  5ELE A;  3RD4 A;  2BH2 A;  2JA7 H;  4KKT A;  4ZKC B;  2QGQ A;  2I07 B;  2FMM A;  1H9M A;  4A93 B;  2K33 A;  1DCZ A;  2PQA B;  3NPP A;  4P73 A;  1VQP A;  2B8F A;  1P16 A;  1E2W A;  1HHV A;  3KOJ A;  5KIX A;  3H09 A;  4P72 A;  3W1G A;  1JR0 D;  2WFW A;  3BDL A;  3J80 E;  2R7Z G;  2JA8 B;  4DV2 L;  1PV4 A;  3G7L A;  4NXM Q;  1KAA A;  1YNX A;  4JYA L;  3ER0 A;  2K03 A;  1CT1 D;  2WKC A;  3HGB A;  1STH A;  1AH9 A;  1VQE A;  4FXG C;  4YCV A;  5BN4 A;  3PO2 H;  4K5W A;  1Q7Y C;  4DUZ Q;  3T1H Q;  1J9O A;  2KHS A;  2RSO A;  4EQ5 A;  4CDF C;  1HNX Q;  1U0L A;  1I3Q B;  2EYJ A;  3J7A 5;  3CAM A;  1SND A;  3TRE A;  4WJ4 A;  3PCO B;  1E24 A;  4KJO A;  4YHH L;  1Q82 C;  1RF2 D;  4C3I G;  3I2Z A;  4A3I G;  2KCC A;  1RCV D;  2Q2H A;  1FJG Q;  3PO3 H;  2UUA L;  2NVX H;  2DJF C;  2UXB Q;  4AYB E;  4JVZ A;  2WAQ G;  2B2V A;  2VZA A;  1HA6 A;  4A3E B;  1XJV A;  2XRQ D;  3BZK A;  5EGT A;  2K5W A;  1CKO A;  3TSS A;  2P5Z X;  2VB3 X;  2WV6 D;  3DM1 A;  1IBM L;  2V1C C;  5CV4 A;  5HGQ A;  5LMN W;  3BJU A;  1QZG A;  3MZ5 A;  1HUM A;  2K6A A;  3HKZ B;  4GKJ Q;  3SDZ A;  1F2Y A;  3PUW A;  5ELC A;  4DA2 A;  2R7F A;  2A6E C;  2VQF L;  2R7Z H;  4IN3 A;  5C0X J;  1U9R A;  1IYJ B;  2RCN A;  1GUO A;  2EE1 A;  2ICI A;  2B2T C;  1U4L A;  4DR4 Q;  2F0H A;  1VQ6 A;  3LWE A;  5C4H A;  2VQE L;  3KLW A;  1A2U A;  1TKW B;  1EYA A;  4O2D A;  5C44 G;  2B63 G;  2DUD A;  4PZ7 A;  1KAW A;  4IUR A;  1K28 A;  2Y0S E;  3J80 i;  4GOP B;  2ZJR A;  1SYD A;  4A3J B;  4JI3 L;  3TEH B;  2LFN A;  1RTO A;  1IBK Q;  2ZT9 C;  4QIW E;  2PI2 E;  3GO5 A;  5DNF A;  1TWC B;  1SYE A;  1DOL A;  3A5U A;  3MA2 B;  4KHP L;  1H9S A;  3MXP A;  3H15 A;  4IO9 A;  5M5X B;  2RHS B;  2NVQ H;  2AWO A;  3HOZ G;  5C3E B;  1GVP A;  2DNC A;  2XWB B;  1S5F D;  4J1M A;  1SMY D;  2K4K A;  4RMF A;  5M9O A;  3HOY G;  3FKI B;  1L0Y B;  1C0A A;  4OEM B;  5JPM C;  4KD3 A;  4X65 Q;  1DOK A;  1YHB A;  3K80 C;  3EVQ A;  1PYB A;  1EIH A;  1SSO A;  2VL6 A;  2EXD A;  2C5C A;  4QUC A;  2AQ2 B;  3RUZ A;  2KEC A;  4IOC A;  1OO9 B;  4YWK A;  3CHB D;  1S3O A;  1KQS A;  3G48 A;  5KNC A;  5LMN Q;  2F4V L;  1HCZ A;  3D3R A;  5CYU A;  4P71 A;  1EYD A;  3S15 H;  2HQE A;  1J6Q A;  2JA9 A;  1VQC A;  5C4X G;  2J7Z A;  2K52 A;  4HSV A;  4QB4 A;  3Q23 A;  1A3T A;  2OXP A;  4DF7 A;  1F2M A;  1O7Y A;  1ILP A;  1DJR D;  3K5M A;  1TY0 A;  3MEH A;  3BYY B;  4J6H A;  4KMU C;  3SK4 A;  2B63 H;  3VA7 A;  3EFX D;  4WFN 3;  4A93 G;  5M3F H;  4R4Q A;  3CCR A;  4IUQ A;  4NW2 A;  3CQZ B;  2BE5 D;  3PIO A;  4ZQ3 A;  1Y1W H;  1VQF A;  3S2D B;  5LMU Q;  4DFA A;  3EBE A;  1Q3L A;  1NUC A;  1T9H A;  1HNZ Q;  4FO2 A;  4K5X A;  4BBS B;  2JA8 G;  3A7A B;  1TVX A;  1CI3 M;  3BDO A;  1KDC A;  1KC8 C;  3EIV A;  2LS0 1;  4GOP C;  4G7O C;  3HOZ H;  2WAQ E;  2K04 A;  3UDG A;  2VUM H;  2DY8 A;  3S17 H;  1D8L A;  1B50 A;  2WB1 B;  1CSP A;  3HOY H;  3T53 B;  1AE3 A;  2BDN A;  1XPU A;  1YBY A;  2NVY B;  3VYU A;  4HIM A;  1OXX K;  2H4O A;  4X64 L;  5HUR A;  1X6O A;  1BKB A;  4F88 A;  4JBJ A;  2ATW A;  1Q8I A;  3E6Z X;  2I0Q A;  2EIF A;  3KF8 A;  4HJ8 A;  1UE6 A;  1O78 A;  2CWA A;  5EKK A;  2IX0 A;  2HIV A;  4FXD A;  2L15 A;  2NUC A;  1GD7 A;  1AN8 A;  2J0T D;  5JOB A;  1TS3 A;  4LFB L;  1EL0 A;  5C4X H;  4A3E G;  1VQG A;  1M90 C;  5AJ3 L;  2D62 A;  1MGS A;  1MJE A;  2AWN A;  2VS1 A;  4JBW A;  4B9X A;  1FNV A;  2AQ3 B;  2EYF A;  1B9N A;  3R2I A;  2KUM A;  2IHF A;  3FVQ A;  1AFP A;  1PFB A;  4DV2 Q;  3NUC A;  5EPJ A;  5KNB A;  4JYA Q;  1B3Q A;  4AIM A;  2EYH A;  1PRT F;  1BBX C;  1X9N A;  4HJ7 A;  4NDX A;  3S1Q B;  4BBR G;  2BA0 A;  4U67 3;  4H02 A;  4KTA A;  3AU7 A;  4HMI A;  1VF5 C;  4BA2 I;  4O0A A;  1G2S A;  2KCN A;  1VQI A;  4YHH Q;  2RCF A;  2QF7 A;  1L2F A;  2VNU D;  1LTI D;  1Y1V G;  2L12 A;  5LHY 1;  1VQ5 A;  2D5D A;  4HCS A;  3TQY A;  1XPR A;  2NB0 A;  4K8J A;  4EQO A;  3J7Y W;  3K81 C;  2RDF A;  2K7V A;  1C48 A;  5BR8 L;  4A3J G;  1WD1 A;  2B39 A;  2PZT A;  5IT9 c;  1VQD A;  2UUA Q;  1KAB A;  2ES2 A;  1QE6 A;  4XYQ A;  1QVF A;  5IGC A;  2K5N A;  4ZUI A;  3MWY W;  4DAM A;  1IXR A;  3DWA A;  1NTG A;  2K5H A;  2IWH A;  5K5P A;  1OXU A;  1IKM A;  2F3W A;  1U4M A;  1TWG B;  4EGV A;  5JAV A;  5C3E G;  1IBM Q;  2CQO A;  4KY7 A;  2LXK A;  4ZRZ A;  5H1S E;  2PNH A;  4QGU A;  5J1Z A;  3FKI G;  2X6L A;  4K6L A;  4ME5 A;  1XTC D;  3OWE B;  3OSO A;  3WOE A;  4A4I A;  3F1Z A;  2A6H C;  1UNS A;  2K01 A;  2YTX A;  3LGJ A;  1BXT A;  1STB A;  1VQ7 A;  1BCP F;  2VQF Q;  2PQE A;  4Q0F A;  1ZEQ X;  3Q8D A;  1PFM A;  1RL2 A;  1PDQ A;  4JI2 L;  4JI1 L;  2UUC Q;  1LTG D;  4A3C G;  2K05 A;  3HOV B;  1WTW A;  2R92 H;  4HSP A;  2NN6 I;  2RSN A;  2O5J C;  2WKD A;  1G6Z A;  4UY8 C;  4NP5 A;  4K8I A;  3G4S A;  5FOB B;  4B3R L;  4FYD A;  2VQE Q;  5KGU A;  3NBH A;  4AH6 A;  1BUV T;  4JI5 L;  2EZV A;  5GQO A;  4B3S L;  2FIN B;  2F3V A;  1PRT D;  2F3I A;  3NP8 A;  3IRB A;  3IL8 A;  4RGM A;  2RKS A;  4QY7 A;  4JI3 Q;  3A74 A;  1D7Q A;  3TDQ A;  4BXX G;  2K28 A;  1G29 1;  1F2L A;  1A8V A;  3JAM E;  4PNY A;  2E2I H;  3PF4 A;  3RMH A;  1F9Q A;  2I5H A;  1B4O A;  1O80 A;  2OTL A;  4A3J H;  4LMQ D;  3CC2 A;  2ZXR A;  1V9P A;  4RHR A;  4KHP Q;  2PMZ B;  2MFI A;  2UU9 L;  3GV3 A;  1TWC H;  1YJ9 A;  3SK6 A;  3CXC A;  4IFD J;  4JI0 L;  3DEP A;  4DV5 L;  2FHT A;  4DR3 L;  5M5X H;  4NPS A;  3QOL A;  5C3E H;  4X6A H;  1HZ9 A;  3DM3 A;  5I9O A;  1JE4 A;  4C3J B;  1K8G A;  1JOK A;  5GAD C;  1NSN S;  1EIF A;  2WB1 G;  3OIQ A;  2SNM A;  3FKI H;  4CDE C;  1SYB A;  5E1F A;  1NE3 A;  1HQR D;  1EQR A;  3SVM A;  3CC7 A;  3PV0 A;  3IFD A;  1PZI D;  1JWU D;  2WP8 J;  2AMC B;  3AFQ A;  3HKZ E;  2OQK A;  5HY6 A;  2F4V Q;  4A3C H;  1DGS A;  1TWA B;  2IY5 B;  2R93 B;  1I50 B;  1I4R A;  2AUK A;  1QWY A;  2GVB A;  4L5Q A;  4DK6 C;  3KBX A;  3CMA A;  5ELF A;  1ESF A;  2GN5 A;  1ENC A;  2F0G A;  5FLM G;  3NTK A;  4A3G B;  5DEH A;  1BCP D;  1UE5 A;  4K2K A;  5A2Q E;  4HN7 A;  3KJO A;  2HT1 A;  5JJZ A;  3HP3 A;  3MXN A;  5E4W C;  2Q2U A;  1L1O C;  3SEB A;  3CQZ H;  2B29 A;  2H1E A;  2Z9H A;  2C35 B;  2VXW A;  1DON A;  3VR5 A;  4CDD C;  3S2D H;  3BVZ A;  3T1Y L;  2F0L A;  3L3O C;  1X3E A;  3I7F A;  4CJ0 B;  1QJO A;  3KUP A;  3BS1 A;  1HRJ A;  1ILQ A;  4YY3 L;  3A56 A;  1EIG A;  2L0C A;  2LKV A;  2KEE A;  5CV7 A;  4BBS H;  2QIL A;  1XWE A;  2E2H B;  3SGI A;  1PFS A;  1I4H A;  4IOA A;  4M8A A;  3MFY A;  4DR6 L;  2MO1 A;  1EWH A;  4IUU A;  4TKO B;  3M7N A;  5IYD G;  4BY1 H;  2Z8L A;  4NXN L;  4DKA C;  1MHW C;  1F9S A;  2RA4 A;  3WOF A;  4X64 Q;  1G91 A;  3RN5 A;  1LM0 A;  3P20 A;  2NVY H;  3OIP A;  1NR2 A;  3S15 B;  4U68 A;  3P1H A;  3CPF A;  2J4X A;  3BVG A;  5M3M B;  1V43 A;  4H0L C;  2KOL A;  3C3L A;  1FNU A;  2R3Z A;  1XPO A;  1VS0 A;  4LFB Q;  3RLO A;  4KKU A;  2D0O A;  2G9H D;  2C9O A;  2JJQ A;  5FLM H;  5AJ3 Q;  4XTC S;  3CCV A;  1Y1W B;  4MZ9 A;  1V1O A;  2HQL A;  5T1I A;  3OMG A;  1ET6 A;  4RFB A;  3TBI B;  3S24 A;  1YNN D;  3BVM A;  3CCE A;  3M4P A;  4OWW B;  4DU9 A;  1U5K A;  2X69 A;  5C4J B;  1HUN A;  5CV6 A;  1HH2 P;  1VQN A;  1CFM A;  1EU4 A;  1LT3 D;  5CBE E;  5J39 A;  1B1Z A;  3QO2 A;  1LLR D;  4QMG A;  2VW9 A;  2L4N A;  2XVS A;  4LWC A;  1VQJ A;  2SEB D;  2A19 A;  3PUY A;  1G6P A;  2AKW B;  3U4V A;  3AB9 A;  1PYS B;  1NNX A;  4LF9 L;  4JG2 A;  3OTO L;  1PA6 A;  4ZYS A;  4BS9 A;  2Z0S A;  1BNZ A;  3PUZ A;  4ZKB B;  5C0X I;  3S1Q H;  1EZ6 A;  4GLV B;  1PTO F;  1WVL A;  4BA1 I;  1NCV A;  3AYH B;  4O1N A;  4JI7 L;  5IYD H;  1SMY C;  3GD7 A;  2D0P A;  1I94 L;  1LT5 D;  2F0M A;  2N49 A;  3HOX B;  4OL7 A;  3I55 A;  1E0B A;  3ITP A;  1VQA A;  5IP7 G;  3A7L A;  4K0K L;  5BR8 Q;  4EQP A;  1IW7 D;  3I4L A;  2NBF A;  4RGO S;  4DXG A;  3A54 A;  5IT9 E;  4ZCK A;  3J81 L;  1JCK B;  1JQY D;  1MJC A;  5D3I B;  1EY8 A;  2CQA A;  2Z4I A;  4EQN A;  4KN4 C;  5KND A;  2A69 D;  4TRD A;  1Z7T A;  1W2B A;  4LUZ A;  3GDE A;  2NZO A;  2FMC A;  1CKM A;  2YU9 B;  1AE2 A;  3J7A V;  1E7Z A;  3NHH A;  1EFI D;  2FJ2 A;  2BDO A;  3I90 A;  3E3X A;  1TWG H;  4F8M A;  2XRS D;  1RIP A;  1PHJ A;  4ABN A;  4B9W A;  4C3J G;  3PIO 3;  1JMC A;  3I91 A;  2YTV A;  1XNR L;  3L7Z C;  3MXU A;  3J81 j;  2BE5 C;  1CQF A;  4JI1 Q;  4LUV A;  1YI2 A;  1H9S B;  3K5O A;  2BCO A;  3VDY A;  1Q46 A;  2YTY A;  2K5Q A;  2KVM A;  4B3R Q;  5FKA C;  3HOV H;  2R93 G;  2LXJ A;  2EJM A;  4XT1 B;  2PW5 A;  3A55 A;  3A8J E;  4I65 A;  1E2Z A;  4JI5 Q;  2KED A;  1GM5 A;  4B3S Q;  4C3H B;  4A3G G;  1HZB A;  2E8G A;  3CC4 A;  5JEA G;  2EYM A;  3DXJ C;  3BDC A;  3M3Y B;  2B2V C;  5EQ0 A;  1CK1 A;  5EKI A;  3VR4 A;  2JA6 B;  5I9P A;  1WCM B;  1SJH D;  1X3G A;  1LAC A;  3S16 B;  3D4W A;  2MUY A;  5IP7 H;  3QR8 A;  3K5N A;  3WDN A;  3NK9 A;  5K36 H;  1PTO D;  2PZU A;  2UU9 Q;  5EKL A;  4KLK A;  3VYR A;  1JJC B;  1KIX A;  3A8I E;  5FLX L;  1ASZ A;  4JI0 Q;  4DV5 Q;  3VR3 A;  1KNA A;  1LTT D;  4DR3 Q;  4L5R C;  4RG1 A;  2MJ8 A;  1SBB B;  4JI4 L;  1Q90 A;  3M85 A;  3TP8 A;  3RZO B;  1D6E C;  1D2B A;  4OHJ A;  3D8G A;  1QVG A;  5KEE A;  1KXL A;  1FVI A;  3ONA B;  4C3J H;  2R92 B;  1N9W A;  1SRO A;  1N32 L;  1GUT A;  3VR6 A;  1PFN A;  2MPM A;  3TZU A;  2ZM6 L;  2NTS A;  2KHI A;  4XDX A;  1ICW A;  1D5M C;  1S5C D;  2N55 A;  2NZ1 D;  4PMC A;  3SK8 A;  4DAY B;  5M3M G;  1SDF A;  1V1P A;  1PRT B;  3H0G H;  4KV6 A;  1TWA H;  2R93 H;  1NAP A;  1XMO L;  1I50 H;  2CVR A;  3TZD A;  1I6H H;  2F0P A;  5DM6 3;  2N88 A;  4ZAI A;  1XMQ L;  1VQO A;  4PZ8 A;  5M3F G;  4FF3 A;  4A3G H;  2E2I B;  1OTC A;  4HED A;  5JEA H;  1Y1W G;  1GHJ A;  3JAM c;  4EVO A;  1KHI A;  1QZH A;  2TMP A;  5FJ8 G;  3KF8 B;  4P75 A;  3RZD B;  4LF7 L;  3CRL C;  4LAA A;  3T1Y Q;  1PVO A;  4DNR B;  2PQA A;  1FNW A;  5EBC A;  2R6G A;  2B2T A;  3TP5 A;  4YY3 Q;  2ZJQ A;  3UI2 A;  2VUM G;  3CRK C;  4RA8 A;  3CCS A;  4PZ6 A;  4B3M Q;  2PMZ E;  4DR6 Q;  1IYU A;  1STA A;  4A3D B;  1WOC A;  3PQI A;  5CV5 A;  2E2H H;  2A8V A;  1TS4 A;  4NXN Q;  3S1R B;  2OWO A;  1I4Q A;  1Q81 C;  1EY9 A;  2F0Q A;  3J80 L;  4CGY B;  1L0W A;  2DY7 A;  3HOX G;  3M4O B;  1YHA A;  4K6D A;  4WOR A;  1YJW A;  4QQB X;  1CM9 A;  1UEB A;  3SK5 A;  4XQJ A;  3GTL B;  1EQT A;  3MC0 B;  2XN9 C;  1BCP B;  5IYB G;  4OO1 G;  4P74 A;  1EFW A;  4ODG A;  1LV9 A;  4CBV A;  1MKH A;  1YIJ A;  4JV5 L;  3QB3 A;  5M3M H;  5I6Y A;  2OF1 A;  1CA5 A;  1G51 A;  3EN2 A;  1X56 A;  2D2C C;  2F52 A;  1SNC A;  5I6W A;  1UE1 A;  2Q8R E;  1XX8 A;  4DK3 C;  1E22 A;  1PRT C;  2IX1 A;  4OON A;  3E0E A;  1V8Q A;  3DLL A;  2BOS A;  3HOU B;  4RCN A;  5FJ8 H;  5C4J H;  1PYW D;  4ME3 A;  1CKN B;  4DR5 L;  4K5V A;  2L11 A;  4L6T B;  3D0F A;  3QG1 A;  4C1N I;  3E0J A;  1K3B C;  5J22 A;  5GAG C;  4LF9 Q;  5DLQ E;  2DJG C;  3OTO Q;  4CKB A;  1YVC A;  3F2C A;  4IJH A;  2M9V A;  4BY1 B;  2MP1 A;  3CW2 C;  2F0N A;  3Q22 A;  3CCQ A;  2GA4 B;  4JI7 Q;  1I94 Q;  4C3H G;  2I5M X;  3M7G A;  1KL9 A;  3Q0A A;  2R61 A;  3HRZ C;  5CGK A;  4K0K Q;  1B53 A;  3EQL C;  3HOX H;  4R8I A;  2JA6 G;  1EY4 A;  1WCM G;  4UAI A;  1YJN A;  5D14 A;  2OEO A;  5IYB H;  4OO1 H;  1YEZ A;  1HZA A;  4JPB W;  3R3O A;  1FYC A;  4Z9C B;  4GOP A;  4IPG A;  2CFM A;  1S4Z A;  5L37 A;  3AMU A;  4JI8 L;  1NY4 A;  3FPU B;  4DV1 L;  4QJF A;  2EY2 A;  3R93 A;  1G8Z D;  3EJI A;  1JOO A;  1BCP C;  1EU3 A;  4C56 C;  1HTL D;  4JW0 A;  1B70 B;  1YZ6 A;  4DAP A;  4IFD I;  1TR5 A;  2F0S A;  5J3B A;  3PF5 A;  4L8J A;  1A3U A;  2YU9 H;  4ALP A;  3GTJ B;  1XNR Q;  3HKZ G;  2K75 A;  1UWV A;  2KCT A;  2BH8 A;  2R92 G;  2SOB A;  4DNT B;  1LTR D;  4GNX B;  1GUN A;  2E2J B;  3GTK B;  3S1M H;  2A6E D;  2AUJ D;  5LL6 X;  2JA5 B;  4CKC A;  2F0D A;  2I46 A;  3FMC A;  2Q2I A;  4N8F A;  3G6J B;  4LK1 C;  1STG A;  4A3L H;  5C5L A;  1WJJ A;  5IYC G;  1WTR A;  1DM0 B;  2L1B A;  1STE A;  4C3H H;  1EOT A;  5C0X H;  4HAE A;  5IY0 A;  1CHP D;  3B6Y A;  3M3Y H;  1K83 B;  2JA6 H;  4PQX A;  3D4R A;  1WCM H;  1DOM A;  3KDF A;  5IP9 G;  3L0O A;  1XNQ L;  3S16 H;  4KJN A;  2EJF C;  1QUQ B;  2ZTD A;  2CH4 W;  3KJP A;  1PH6 A;  1VQ4 A;  4RH6 A;  1U4R A;  4KHV A;  4KY6 A;  5FK9 C;  5HGT A;  1Y8O B;  3GTG B;  3CCL A;  4JBK A;  4JI4 Q;  1K3R A;  4PMB A;  1W6J A;  3GQB A;  3CCU A;  1HPC A;  3G6E A;  3K7U C;  3AQQ A;  4A3D G;  1DZ1 A;  4LNQ A;  1GUG A;  4B3T L;  2EYO A;  4X3S A;  4PMW A;  1K8O A;  1RDP D;  3RZO H;  4QL5 A;  3LX0 A;  3SHL A;  4L5S A;  1BDO A;  1N32 Q;  2ZM6 Q;  1A62 A;  3PIP 3;  2RHQ B;  4WJW A;  3K8A A;  4TSS A;  1AEX A;  4BY7 B;  4HCE A;  1HR0 L;  1XMO Q;  1SFO B;  1QG7 A;  2OT2 A;  1HA5 A;  3BZD B;  1TWH H;  3KF6 B;  4YWM A;  2EYL A;  3NE5 B;  5F2D A;  3S9W A;  1IZ6 A;  2XWJ B;  1D1I A;  3T4A C;  1XMQ Q;  2F0E A;  2TSS A;  2XTI A;  1PTO B;  5IYC H;  2EQS A;  4C1N K;  2Z6B A;  4GNX C;  1DD2 A;  2RQX A;  1U4P A;  2CWP A;  4N9P A;  3JC6 6;  4LFC L;  3SXH A;  4LF7 Q;  4DUZ L;  1WYD A;  2B2U C;  1PH7 A;  1II3 A;  4G7Z C;  3VYS A;  3K58 A;  3HOU G;  5IP9 H;  1IW7 C;  4IPH A;  5D3D A;  2CH4 A;  2XSC A;  3RZD H;  2UUB L;  3MFG A;  4BBS G;  4JI6 L;  1Q12 A;  2L5T A;  5JPN C;  3NWT A;  5ELO A;  1GUW A;  1TXY A;  3OW2 A;  2A69 C;  1SYF A;  4BY1 G;  2Q8T A;  3H3V I;  2Z1C A;  5C5M A;  1FJG L;  4A3D H;  3EA6 A;  1IKL A;  3DUZ A;  3NWS A;  4KKS A;  5EAY A;  4GN5 A;  1JE5 A;  1F9R A;  1RKN A;  1KRS A;  3S1R H;  2KBN A;  3H0G B;  2PPB C;  3M4O H;  1SXT A;  1VMC A;  4IUT A;  1JJG A;  1KD1 C;  4A76 A;  2B2Y A;  1I6H B;  4JV5 Q;  3GTL H;  1Q1B A;  2NTT A;  3D6W A;  3NSW A;  3C1E A;  1VCI A;  4GN4 B;  1EY7 A;  1FR3 A;  5C3X A;  2EY1 A;  4S3S A;  5EPK A;  1P8L A;  3FRP B;  3K59 A;  4HR7 B;  4ILW A;  2K32 A;  1R9T B;  4FF4 A;  2OCE A;  2Z6K C;  4A3M B;  1D1K A;  2WIN B;  4J8Q A;  2MO0 A;  4ULL A;  1J8I A;  5CC4 A;  4R4C A;  4P2C B;  4A3K B;  2VY3 A;  1I4G A;  5IGG A;  3F2U A;  3J81 E;  3BYT B;  1C7Y A;  4DR5 Q;  1HFN A;  1TY2 A;  4IPC A;  3KFU A;  3HOU H;  2F0O A;  4C3I B;  4LF8 L;  4BWG B;  4A3I B;  1PTO C;  2ID0 A;  4HJA A;  1X3Q A;  4R4T A;  3FP9 A;  1K0S A;  1XTD A;  5JJL A;  1PH3 A;  2ZTC A;  2JA5 G;  1TS5 A;  3JAM i;  2HD3 A;  2MNA A;  3ULP A;  1JJ2 A;  1PZK D;  4LF6 L;  1DXM A;  2E74 C;  4IZ8 A;  4A3B B;  1S5D D;  5JVG 3;  4N9T A;  1E2V A;  3X3N A;  4C2M H;  2HCC A;  3PMF A;  2KA7 A;  3U58 A;  2OQ0 A;  4N8X 1;  1T5X D;  1L1O A;  3RNU A;  1RD9 D;  1MSG A;  3HFZ B;  5IIF A;  3D4D A;  3W2D A;  2LSS A;  4YIJ A;  1EEF D;  3KLR A;  2B2W C;  2PI2 A;  1YNJ D;  5I2Y A;  2KQ3 A;  1LTS D;  3R8B A;  3KLS X;  4KY5 A;  4R9W A;  4DV1 Q;  1WD0 A;  1PH1 A;  2H5X A;  1BVS A;  4MTN A;  4OXP A;  4LJZ C;  4F87 A;  1WTX A;  2QCP X;  3BZC A;  1E3P A;  1EY5 A;  3JAM L;  1E1T A;  3RLN A;  5E7N A;  4M1U B;  4DV7 L;  2F0W A;  1HR0 W;  1UAP A;  1X3F A;  2E5L L;  2G5D A;  5GAE C;  5M5Y B;  1FGB D;  2HCI A;  2R7D A;  3PIP A;  3MEF A;  1CZW A;  3GTJ H;  3IFT A;  3S2H H;  1QIL A;  1GXD C;  1HTP A;  1F9P A;  3I3C A;  4JCV E;  2EPB A;  1ENF A;  1GJX A;  3QWN A;  3HOV G;  2PW7 A;  1W6K A;  4POF A;  2ZXP A;  4POG A;  3G71 A;  2EYP A;  1BO0 A;  4BY7 G;  1A3V A;  1K8A C;  2E2J H;  3GTK H;  2HDL A;  2CW0 D;  2JEA I;  1WTV A;  4KI0 A;  2JA5 H;  4MTK A;  1HQM C;  3K5L A;  2NVT B;  1EZ8 A;  2SDF A;  2A68 D;  3NEN A;  3TP7 A;  4JOI C;  4AQY L;  5C3W A;  3K7A B;  1WTP A;  2JN4 A;  4K2L A;  3ICE A;  1EUJ A;  2CKZ B;  2JQO A;  5IOD A;  4DR2 L;  2F0K A;  5K36 G;  2YV5 A;  1XNQ Q;  1UE7 A;  2D9U A;  1VQK A;  3URY A;  4QUF A;  1K83 H;  3OWF A;  4GKK L;  4FP5 D;  3STB D;  1AZP A;  2DGY A;  1F2Z A;  3V2T A;  5GAH C;  1K0R A;  1SN8 A;  1S40 A;  1B7Y B;  4OX9 L;  1SNM A;  4Q5V A;  2UXC L;  5A2Q L;  1VQ9 A;  3GTG H;  3CD6 A;  1J5E L;  4FDB A;  2F4I A;  3ERQ A;  4B3T Q;  2QW7 A;  1ZYR D;  2Q2T A;  1WTQ A;  2ICE C;  3FDT A;  2QEJ C;  2PZW A;  2F0T A;  1WTH A;  4IAL A;  1GOZ A;  3U4Z A;  3RLF A;  1RHP A;  2IHE A;  1S72 A;  4JI2 Q;  1TII D;  4FXK C;  3NTI A;  3UDX A;  1LTB D;  1JOQ A;  4MIU A;  4UHV A;  4OEL B;  3S1M B;  2DN8 A;  2Q8I B;  2UXD L;  3TRZ A;  4IFD H;  5ISR A;  3NBI A;  3R2T A;  2F0F A;  3H0G G;  1HR0 Q;  1WFQ A;  3OMC A;  3MAQ A;  1QCB D;  1I5F A;  2O4X A;  3OW7 A;  4PG3 A;  3CF5 A;  4EX5 A;  3MHB A;  2NN6 G;  5C4Z A;  1WTO A;  2B3G A;  1IHZ A;  4BY7 H;  2K5V A;  1QB5 D;  4DR7 L;  2F03 A;  1SFO H;  3M9B A;  1M1K C;  3NQI A;  2V4D A;  4DK1 A;  4L63 B;  4KN7 C;  1M4V A;  1VDZ A;  5IGE A;  2HHH L;  1VQH A;  2F1M A;  5EPL A;  1SE8 A;  4A3M G;  2MGS A;  4DV4 L;  1NBW A;  5KYI A;  2XNA C;  4LFC Q;  1PTO H;  2EOT A;  4A3K G;  2LMC B;  1LTA D;  1K9M C;  3QIA A;  1I6V C;  3I4O A;  1JB7 A;  2UUB Q;  4JI6 Q;  3IKJ A;  1HZC A;  1N34 L;  3OOC A;  4NMZ A;  4HIO A;  2B8G A;  1C4Q A;  1F77 A;  1Q8K A;  4UP9 A;  1M8A A;  1D5Z C;  1AZQ A;  1Z47 A;  3MTS A;  4DN4 M;  3CME A;  3QJY A;  5JJK A;  4GLA C;  3GTQ B;  4Y52 H;  2IX3 A; 
#chains in the Genus database with same CATH homology
 2I5M X;  4A3B G;  1KL9 A;  5JJI A;  2F3I A;  3IRB A;  4K0K Q;  2CCZ A;  4IJL A;  1EQQ A;  4QY7 A;  4UPA A;  4JI3 Q;  3PUX A;  3HOX H;  3A74 A;  2JA6 G;  1D7Q A;  1YHQ A;  4BXX G;  1WCM G;  1G29 1;  1A8V A;  2E2I H;  3PF4 A;  4LF5 Q;  1YJN A;  4XIG S;  2I5H A;  4LF4 L;  1JT8 A;  2OTL A;  4X62 L;  4A3J H;  1PH4 A;  3CC2 A;  5IYB H;  5LMU L;  1YEZ A;  4GLX A;  2JEB I;  4GS3 A;  1BBW A;  1V9P A;  3HOW H;  4KHP Q;  1HZA A;  2MFI A;  3J81 i;  2FXQ A;  4X66 Q;  2UU9 L;  4GOP A;  1HNZ L;  4IPG A;  2CFM A;  2NZH A;  4R1J A;  1TWC H;  2R93 H;  1YJ9 A;  2MQH A;  3CXC A;  2ALY B;  4R4O A;  4JI0 L;  4JI8 L;  4DV5 L;  1LUZ A;  1NY4 A;  4IFD J;  1Z9F A;  3K0X A;  2UUC L;  3PO2 G;  3F8T A;  4DV1 L;  4DR3 L;  5M5X H;  4QJF A;  1R9T H;  1VQL A;  1Q1E A;  4A3M H;  2KCM A;  1V1Q A;  4NPS A;  5C3E H;  4X6A H;  1HZ9 A;  3DM3 A;  3E9I A;  1B70 B;  1YZ6 A;  4DR1 Q;  4IFD I;  1K8G A;  5GAD C;  5J3B A;  3PF5 A;  1EIF A;  2WB1 G;  2YU9 H;  4ALP A;  2Y0S G;  1XNR Q;  3FKI H;  3CPW A;  4A3K H;  3HKZ G;  2K75 A;  3J7Z C;  1UWV A;  3ULJ A;  1NE3 A;  2AHO B;  1EQR A;  2KCT A;  2BH8 A;  3CC7 A;  4LF8 Q;  2R92 G;  3PV0 A;  2WB1 E;  2WP8 J;  4DUY L;  2AMC B;  1A63 A;  3AFQ A;  4NB3 A;  4GNX B;  3HKZ E;  2OQK A;  5HY6 A;  2F4V Q;  4A3C H;  1DGS A;  1FL0 A;  2IY5 B;  2N8N A;  4C3I H;  3PO3 G;  3S1M H;  2BA1 A;  4A3I H;  1YIT A;  4TQU S;  3A0J A;  5M5W H;  1OXS C;  2GVB A;  4L5Q A;  2Q2I A;  4DK6 C;  3CMA A;  3TS0 A;  4LF6 Q;  4HJ9 A;  2GN5 A;  1N33 Q;  5FLM G;  1HNW L;  4A3L H;  4JOI A;  2BH2 A;  2JA7 H;  1WJJ A;  1UE5 A;  4R4I A;  2QGQ A;  5IYC G;  3H3V H;  4C3H H;  2PQA B;  4A3B H;  4DPG A;  4P73 A;  5IY0 A;  4UP8 A;  3KJO A;  3W5O A;  1VQP A;  1P16 A;  3B6Y A;  3M3Y H;  2HT1 A;  2JA6 H;  3KOJ A;  4HJ5 A;  2Q2U A;  1HJP A;  1WCM H;  3KDF A;  5IP9 G;  1L1O C;  3L0O A;  1XNQ L;  3S16 H;  3CQZ H;  2B29 A;  1QUQ B;  2ZTD A;  4P72 A;  3W1G A;  3KJP A;  5IWA L;  2C35 B;  1PH6 A;  1VQ4 A;  3S2D H;  3TS2 A;  2WFW A;  2R7Z G;  3T1Y L;  1IBL L;  1X3E A;  4DV2 L;  3I7F A;  1PV4 A;  3GTK H;  4NXM Q;  3CCL A;  1YNX A;  4JYA L;  5IE8 A;  3ER0 A;  3UE1 A;  4YY3 L;  1PH8 A;  4JBK A;  4JI4 Q;  1AH9 A;  1K3R A;  1VQE A;  4BBS H;  4YCV A;  3SGI A;  3CCU A;  1PFS A;  4IOA A;  3PO2 H;  3G6E A;  3K7U C;  4DV7 Q;  3AQQ A;  4DR6 L;  4A3D G;  2MO1 A;  4LNQ A;  4B3T L;  3J81 c;  4DUZ Q;  1Q7Y C;  3PUV A;  3T1H Q;  2E5L Q;  4EQ5 A;  1HNX Q;  3M7N A;  5IYD G;  4PMW A;  4BY1 H;  1LYL A;  1SMX A;  1U0L A;  3KDF B;  3J7A 5;  1VQ8 A;  3RZO H;  3CAM A;  1GO3 E;  4NXN L;  4QL5 A;  3TRE A;  4DKA C;  3PCO B;  1E24 A;  4L5S A;  1N36 L;  4X64 Q;  4YHH L;  4WJ4 A;  1N32 Q;  3RN5 A;  4DV0 L;  3AEV A;  1LM0 A;  5M5Y H;  2NVY H;  2ZM6 Q;  1Q82 C;  1A62 A;  5C44 H;  3I2Z A;  2RHQ B;  1SLJ A;  3K8A A;  4A3I G;  3BU2 A;  3CPF A;  1OXT A;  4GN3 B;  1V43 A;  2Q2H A;  3W1B A;  1HR0 L;  1FJG Q;  1XMO Q;  1EYG A;  3PO3 H;  2UUA L;  1XPO A;  1O7I A;  4DV6 L;  2HIX A;  1VS0 A;  3U50 C;  2NVX H;  4A3L G;  2UXB Q;  1TWH H;  2KHJ A;  4AYB E;  3A5Z B;  3KF6 B;  4YWM A;  4UP7 A;  4LFB Q;  2WAQ G;  3RLO A;  1IZ6 A;  2VZA A;  2D0O A;  1XMQ Q;  1XJV A;  3BZK A;  5AJ3 Q;  2JJQ A;  5FLM H;  5C0X G;  4XTC S;  3CCV A;  4AQY Q;  1CUK A;  2XTI A;  1CKO A;  3RR5 A;  4MZ9 A;  2HQL A;  2NVT H;  1A0I A;  5IYC H;  4DV3 L;  2EQS A;  4GNX C;  3S24 A;  4DR2 Q;  1IBM L;  2CWP A;  2V1C C;  3CCE A;  3M4P A;  4OWW B;  1U5K A;  3JC6 6;  3K7A H;  4LFC L;  1ASY A;  1HH2 P;  5HGQ A;  5LMN W;  1VQN A;  2RF4 A;  2A1A A;  3BJU A;  1QZG A;  4LF7 Q;  4DUZ L;  4GKK Q;  1WYD A;  1PH7 A;  4GKJ Q;  3PUW A;  5IP9 H;  3F2D A;  3HOU G;  2VW9 A;  4IPH A;  3NBH B;  2R7F A;  4LWC A;  1VQJ A;  4OX9 Q;  3RZD H;  2UUB L;  2VQF L;  4BBS G;  4JI6 L;  2R7Z H;  2A19 A;  2UXC Q;  1Q12 A;  2IT1 A;  3PUY A;  5C0X J;  1G6P A;  2AKW B;  1IYJ B;  5ELO A;  3U4V A;  1PYS B;  2RCN A;  1J5E Q;  4LF9 L;  4JG2 A;  3OTO L;  1NMF A;  1TXY A;  1PA6 A;  4DR4 Q;  4JC0 A;  4LFA L;  3OW2 A;  2Z0S A;  1VQ6 A;  4BY1 G;  3H3V I;  3PUZ A;  1FJG L;  5C0X I;  3S1Q H;  2VQE L;  3PSI A;  4A3D H;  4GLV B;  1NMG A;  4YWL A;  4BA1 I;  1SR3 A;  3AYH B;  3KLW A;  4JI7 L;  4O2D A;  3GD7 A;  5IYD H;  2D0P A;  5EAY A;  2N49 A;  3UDI A;  5FLX c;  5C44 G;  4GN5 A;  1I94 L;  3I55 A;  2B63 G;  1JE5 A;  2DUD A;  3S1R H;  1KRS A;  1KAW A;  4PZ7 A;  2UXD Q;  2Y0S E;  2JK8 A;  3J80 i;  2KBN A;  1VQA A;  5IP7 G;  4GOP B;  2ZJR A;  4K0K L;  5BR8 Q;  4JI3 L;  3M4O H;  3TEH B;  1JJG A;  1KD1 C;  1H95 A;  4A76 A;  1Q86 C;  1IBK Q;  4A93 H;  3CCM A;  4LF5 L;  4JV5 Q;  3GTL H;  4QIW E;  1Q1B A;  1Y14 B;  1VCI A;  2PI2 E;  4GN4 B;  3GO5 A;  1MJC A;  4DR7 Q;  4IPD A;  1P8L A;  3A5U A;  4KHP L;  4OWX B;  3H15 A;  4IO9 A;  2HHH Q;  1PH5 A;  2RHS B;  1W2B A;  2NVQ H;  2OCE A;  2AWO A;  2Z6K C;  4X66 L;  3HOZ G;  3I4M G;  4LUZ A;  3GDE A;  1CSQ A;  4DV4 Q;  2JA8 H;  2NZO A;  1GVP A;  2MO0 A;  1CKM A;  2K4K A;  4RMF A;  1K73 C;  4R4C A;  3HOY G;  1AE2 A;  1E7Z A;  2VY3 A;  1C0A A;  1TWG H;  4X65 Q;  1RIP A;  1PHJ A;  1YHB A;  3K80 C;  2YYZ A;  4DR1 L;  1C7Y A;  1JMC A;  4DR5 Q;  1PYB A;  1VQB A;  2YTV A;  1XNR L;  2VL6 A;  4KHZ A;  2EXD A;  3L7Z C;  3J81 j;  4IPC A;  3KFU A;  4IOC A;  4JI1 Q;  3HOU H;  1N34 Q;  4LUV A;  4YWK A;  1YI2 A;  1I3Q H;  4LF8 L;  2KEN A;  1S3O A;  1GKH A;  1KQS A;  2ID0 A;  3G48 A;  4HJA A;  1Q46 A;  3VDY A;  2YTY A;  5LMN Q;  4L5T A;  4R4T A;  3FP9 A;  2F4V L;  3HOV H;  4B3R Q;  2R93 G;  2LXJ A;  4P71 A;  1XTD A;  3F2B A;  3S15 H;  5JJL A;  1CKN A;  2ZTC A;  1PH3 A;  2JA5 G;  1J6Q A;  2JA9 A;  3MXN B;  4JI5 Q;  3JAM i;  1VQC A;  1E1O A;  5C4X G;  2MNA A;  3FHW A;  3ULP A;  1GM5 A;  1JJ2 A;  4LF6 L;  4B3S Q;  1N33 L;  2K52 A;  1HZB A;  4A3G G;  2E8G A;  3CCJ A;  3CC4 A;  5JEA G;  2N78 A;  4C2M H;  2B63 H;  3GTQ H;  3UE0 A;  3U58 A;  4TVA B;  2OQ0 A;  4A75 A;  3UDF A;  4A3E H;  4A93 G;  5M3F H;  1X3G A;  4R4Q A;  3CCR A;  1L1O A;  3RNU A;  5IP7 H;  3PIO A;  1Y1W H;  4A3F G;  4LF4 Q;  1VQF A;  4X62 Q;  1FGU A;  1X54 A;  5LMU Q;  3HFZ B;  5GRO A;  2LSS A;  3EBE A;  3J80 c;  2K50 A;  1T9H A;  2UU9 Q;  1HNZ Q;  2PI2 A;  4KLK A;  1JJC B;  1KIX A;  2JA8 G;  1ASZ A;  4JI0 Q;  4DV5 Q;  1SRU A;  4NXM L;  4DV1 Q;  1KC8 C;  4DR3 Q;  2H5X A;  4DNI A;  1BVS A;  3EIV A;  1PH1 A;  4L5R C;  2ZTE A;  4MTN A;  4OXP A;  4RG1 A;  4GOP C;  3GTP H;  3I4M H;  3HOZ H;  2WAQ E;  4JI4 L;  2JE6 I;  3BZC A;  1E3P A;  3UDG A;  3M85 A;  2VUM H;  3RN2 A;  1E1T A;  3RLN A;  5E7N A;  3S17 H;  4DV7 L;  4BBR H;  1D8L A;  1L1O B;  1CSP A;  1HR0 W;  3HOY H;  1AE3 A;  1X3F A;  3D31 A;  3T1H L;  2E5L L;  5GAE C;  1VQM A;  1HNX L;  1B8A A;  1YBY A;  1QVG A;  1XPU A;  2R7D A;  1KXL A;  4HIM A;  3PIP A;  3MEF A;  1FVI A;  4C3J H;  1OXX K;  3NEM A;  1N9W A;  3GTJ H;  4DUY Q;  4X64 L;  3S2H H;  1SRO A;  1N32 L;  1X6O A;  1BKB A;  4APV A;  4JBJ A;  4JCV E;  2ATW A;  2ZM6 L;  3S14 H;  3HOV G;  1Y1V H;  2I0Q A;  4LUO A;  2KHI A;  2EIF A;  4HJ8 A;  3GTO H;  1UE6 A;  3STB C;  2CWA A;  4DAY B;  4POF A;  3G71 A;  2IX0 A;  4HIK A;  5M3M G;  4POG A;  2HIV A;  4BY7 G;  2L15 A;  2XGT A;  1TWA H;  3ERS X;  3H0G H;  1XMO L;  1K8A C;  1I50 H;  4LW1 A;  2E2J H;  3ULL A;  1GD7 A;  1PH9 A;  2JEA I;  1HNW Q;  4KI0 A;  2UXB L;  1I6H H;  1EOV A;  2JA5 H;  1MIU A;  4LFB L;  3NEL A;  5C4X H;  1N8R C;  4GNX A;  4A3E G;  3I56 A;  1VQG A;  2K14 A;  4PZ8 A;  5M3F G;  1VQO A;  1XMQ L;  3NEN A;  5AJ3 L;  1M90 C;  4A3G H;  3PGZ A;  4JOI C;  4AQY L;  1OTC A;  1WI5 A;  2D62 A;  2I5L X;  1Y1W G;  1QVC A;  1MJE A;  2AWN A;  2VS1 A;  4JBW A;  3JAM c;  3ICE A;  1EUJ A;  2CKZ B;  1IL2 A;  2JQO A;  1KHI A;  4DR2 L;  1QZH A;  5K36 G;  2YV5 A;  1XNQ Q;  5FJ8 G;  3KF8 B;  4P75 A;  1UE7 A;  1VQK A;  4A3F H;  2IHF A;  5IWA Q;  1K83 H;  4LF7 L;  4GKK L;  3M4Q A;  4YCW A;  3T1Y Q;  1PVO A;  4GKJ L;  1IBL Q;  4DV2 Q;  3STB D;  2DGY A;  4JYA Q;  2PQA A;  4AIM A;  5GAH C;  1K0R A;  1SN8 A;  2R6G A;  4YY3 Q;  1B7Y B;  1S40 A;  2ZJQ A;  4OX9 L;  2UXC L;  1X9N A;  4HJ7 A;  2VUM G;  2ZJP A;  1VQ9 A;  3GTG H;  2N3S A;  4PZ6 A;  4BBR G;  3CCS A;  2PMZ E;  2BA0 A;  1J5E L;  4FDB A;  4B3M Q;  3CD6 A;  4DR6 Q;  3OYY A;  4H02 A;  1NJI C;  4B3T Q;  1QUQ A;  3I4N G;  4DR4 L;  1WOC A;  4MNO A;  3HKS A;  2Q2T A;  4WJ3 M;  4Y7N H;  2E2H H;  2A8V A;  4BA2 I;  1C9O A;  4NXN Q;  3WWV A;  2OWO A;  4O0A A;  1PH2 A;  1EIY B;  1W3S A;  1Q81 C;  1N36 Q;  1VQI A;  3U4Z A;  4YHH Q;  1L0W A;  3RLF A;  4DV0 Q;  2IHE A;  1S72 A;  4JI2 Q;  1L2F A;  2VNU D;  3UDX A;  3HOX G;  1Y1V G;  1VQ5 A;  1YHA A;  2UXD L;  2ASB A;  3TRZ A;  3TQY A;  1YJW A;  1XPR A;  4QQB X;  1UEB A;  3K81 C;  3ZJY C;  5BR8 L;  4A3J G;  3H0G G;  1HR0 Q;  1WFQ A;  5IYB G;  4OO1 G;  5IT9 c;  4P74 A;  1VQD A;  1EFW A;  2UUA Q;  4BXX H;  4DV6 Q;  2OTJ A;  2ES2 A;  1YIJ A;  1IBK L;  1MKH A;  3HOW G;  3CP0 A;  1I5F A;  4PG3 A;  3CF5 A;  4JV5 L;  4EX5 A;  5M3M H;  2NN6 G;  1QVF A;  2B3G A;  2K5N A;  2Z6K A;  4BY7 H;  2K5V A;  4DR7 L;  1SFO H;  3M9B A;  1KRT A;  1M1K C;  1G51 A;  4DAM A;  1IXR A;  3EN2 A;  1X56 A;  1NTG A;  2GVA A;  2K5H A;  2HHH L;  1VQH A;  3L2P A;  1OXU A;  1SE8 A;  4JBM A;  4DV3 Q;  4A3M G;  4OWT B;  5C3E G;  4DV4 L;  1NBW A;  1IBM Q;  5ELN A;  2F52 A;  1OXV A;  2CQO A;  5H1S E;  2LXK A;  3GTM H;  2PNH A;  1UE1 A;  4QGU A;  4B3M L;  4LFC Q;  4DK3 C;  1E22 A;  3FKI G;  3KF6 A;  4A3K G;  2IX1 A;  4OON A;  4X65 L;  3E0E A;  4A4I A;  2QA4 A;  3DLL A;  3F1Z A;  1K9M C;  5FJ8 H;  5C4J H;  4ME3 A;  2YTX A;  3LGJ A;  1CKN B;  4DR5 L;  3I4O A;  1JB7 A;  1VQ7 A;  2UUB Q;  1LTL A;  3D0F A;  2VQF Q;  4JI6 Q;  3Q8D A;  1RL2 A;  4JI8 Q;  4JI2 L;  1HZC A;  4OO1 I;  4JI1 L;  2UUC Q;  1N34 L;  4A3C G;  5GAG C;  3S1N H;  4LF9 Q;  5DLQ E;  5JEA J;  3OTO Q;  2R92 H;  3F2C A;  1YVC A;  4AYB G;  4HIO A;  2NN6 I;  4LFA Q;  3E9H A;  1TWF H;  4IJH A;  3AFP A;  4UY8 C;  1X55 A;  3CW2 C;  5LMN L;  3G4S A;  1Q8K A;  2QEX A;  4HID A;  4B3R L;  3KYH C;  4UP9 A;  2VQE Q;  4AH6 A;  1EWI A;  3I4N H;  1Z47 A;  4J15 A;  3CME A;  1X65 A;  3CCQ A;  4JI7 Q;  4JI5 L;  2JA7 G;  5JJK A;  1I94 Q;  1BBU A;  4YCU A;  5GQO A;  4GLA C;  4Y52 H;  4B3S L;  4IFD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...