3I4OA

Crystal structure of translation initiation factor 1 from mycobacterium tuberculosis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
68
structure length
68
Chain Sequence
GAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of translation initiation factor 1 from Mycobacterium tuberculosis and inferred binding to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
molecule keywords Translation initiation factor IF-1
total genus 16
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4oA00
1SE8A 4A3GH 4EX5A 3M3YH 4IFDI 1VQAA 2UUAL 1D8LA 5ELOA 2OWOA 1AH9A 1IBMQ 2VUMH 3S1QH 1OXTA 1LTLA 1XMQL 3PO2G 3KDFB 3HOXG 1DGSA 1T9HA 3JC66 2D0PA 3TREA 4DUZL 4AQYQ 2AKWB 2JA6H 3STBC 3UDGA 4ME3A 3I4MG 3I4NH 1PYSB 4DUYQ 4GNXB 5M3MG 2BA0A 4R1JA 5BR8L 1XNQL 3CCLA 2B63G 3VDYA 3BU2A 3U4ZA 3L2PA 1HNZQ 3CCEA 4LF8Q 4JI2L 2Z6KA 2IX1A 4C3IH 3PUZA 1N32L 4XTCS 1HNXL 4JBKA 2K75A 2R92G 2JA5G 2DUDA 1EQRA 2CQOA 4OONA 4DAYB 4DR1Q 3UDFA 1PH9A 1HR0W 3TRZA 2UXCL 2VQEQ 2ZJQA 4POGA 3J7A5 2OQ0A 3PV0A 3CMEA 2JA8H 4X64Q 3I4OA 4A3DH 3FHWA 2Z6KC 3AFQA 3A74A 5IT9c 4KHPL 3F2CA 1L1OC 2KCMA 4JI1Q 1I94L 1OXUA 1A62A 2R93G 5IP9H 4YHHL 3I56A 1LUZA 2JE6I 1QUQB 3D31A 3AEVA 2ZTDA 3K0XA 4LF7Q 3S14H 1CKNB 2UUBQ 2CWPA 4DR3L 1AE2A 4GKKL 4PZ8A 3AFPA 3PUWA 2E2IH 1RIPA 1X56A 1HZAA 3OTOL 2JA6G 3I4MH 3NENA 1I6HH 3A0JA 1G291 4YWMA 3CP0A 4A3LH 1TXYA 1UE1A 5EAYA 1FJGQ 2UU9Q 1TWHH 1PH8A 1EUJA 1N33Q 4L5TA 1Y1WG 1YITA 2K52A 2LXJA 3S1RH 2VQFL 1VQIA 3TS0A 1WYDA 3J81c 1L0WA 3M85A 3NELA 2E8GA 1YZ6A 2YV5A 1W3SA 1J6QA 2KCTA 2AWNA 2RHQB 2UXDL 2VW9A 3RR5A 2A8VA 1HNWL 1Q1EA 4QY7A 4C3HH 4QGUA 4UPAA 5M3FG 4DV1L 2JEBI 4A3CG 2NZOA 1JJ2A 4B3MQ 4DNIA 4UP8A 4GNXC 1VS0A 4BY7H 3KF6B 4PG3A 2JA7G 3GTMH 1VQCA 5JEAG 2NN6G 1SRUA 1KQSA 1WJJA 2GVAA 4BBRG 5IP9G 1GO3E 3UDIA 2I5LX 3PCOB 2MNAA 4K0KL 1N36Q 4DV0L 4DV5L 4OX9L 5GADC 5GAGC 5AJ3Q 1YHAA 3CCSA 4GKJL 1CKMA 1SN8A 1XJVA 3PO2H 1FGUA 1G6PA 3J81j 5IYBG 3S16H 2K4KA 3S24A 4LUVA 4YWLA 3RZOH 1V43A 5JEAJ 2ES2A 1GVPA 1X3FA 5M3MH 4DR5L 2UXBQ 3I7FA 2I0QA 3HOXH 4JI6Q 5IP7H 5IYCG 5C0XI 1YHQA 4JI5Q 3PUXA 3FKIG 4GS3A 1L2FA 4DR2Q 2FXQA 3HFZB 4R4OA 3E9HA 1IBML 1HJPA 4LF5L 1CUKA 1XMOQ 3HOUH 1NMGA 1XMQQ 2K5NA 5LMUQ 1IBKQ 3SGIA 4A3JH 1HR0Q 4DUZQ 3D0FA 1X3GA 2YU9H 2HQLA 4BY1G 4BA2I 1X9NA 1N34L 2JA9A 3MXNB 3PUYA 5BR8Q 5C44H 1PH7A 1XNQQ 1TWAH 1CSQA 1VQHA 3KFUA 1Q12A 4HJAA 1Q8KA 1HNZL 3CCQA 1VQ7A 4LF8L 1N32Q 3WWVA 1EQQA 1VCIA 2NZHA 2XTIA 1BBWA 4DV6L 4A3IH 1L1OA 1HNXQ 3DLLA 3PO3H 1PV4A 1WCMH 4DR1L 2UXCQ 4UP9A 2EQSA 3GTPH 1XNRL 1C0AA 2IHFA 1JMCA 1G51A 1EWIA 1PVOA 4P71A 4TQUS 4A3KG 3E9IA 2PQAB 1YNXA 4AYBE 1YJNA 1IBLL 1VQ5A 1L1OB 3JAMc 4KHPQ 5H1SE 1HZ9A 3A5ZB 3AYHB 2GN5A 3UE1A 2OTLA 3CC2A 4YHHQ 4ALPA 1B70B 4A3GG 3G71A 4LF7L 4LFCQ 1X55A 4A75A 2UUBL 4IFDJ 4DR3Q 1PH2A 4GKKQ 1E24A 2UUCL 4QL5A 2Q2UA 1K0RA 1VQEA 4IJHA 3L0OA 5DLQE 5HGQA 4R4TA 3PUVA 3TQYA 3W1BA 3PF4A 3GTGH 1VQLA 2D62A 1KAWA 2UU9L 3I4NG 3M4OH 4A3CH 2A1AA 2HHHL 3AQQA 2KBNA 2B63H 4B3SQ 5IWAL 3EIVA 1KL9A 5C4XH 3GTQH 1Q81C 1XPRA 3KF8B 1CKOA 4A3FH 4UY8C 2OQKA 3K7AH 2V1CC 1S40A 1NBWA 2UXDQ 3CW2C 4DPGA 1FVIA 1HNWQ 4DV1Q 1YJWA 1MJCA 1X54A 3CMAA 4DR6L 4MZ9A 1GM5A 4LFAL 3I2ZA 3RZDH 1KIXA 1HH2P 3B6YA 1KRSA 4DV2Q 4APVA 4IOAA 3J80i 1C7YA 1EIYB 4JI0L 1Q86C 1PH4A 3FKIH 1B8AA 4JI4Q 1VQ4A 2CCZA 3IRBA 2R7FA 4NXNL 3H3VH 1EOVA 2WP8J 4DV5Q 1LYLA 4L5QA 4HJ7A 2Y0SE 5AJ3L 3GTOH 4GKJQ 1ASYA 3J81i 3ULPA 4BBSH 3BJUA 3PIPA 2E2JH 1VQDA 1YVCA 3KJPA 4JYAQ 4HJ9A 1XTDA 2ZTCA 2VS1A 4DV4L 2IY5B 4AIMA 5J3BA 4OWWB 4DR5Q 2UXBL 5C44G 3CCUA 3S1MH 4MNOA 1BVSA 1TWFH 4UP7A 4A4IA 1V1QA 4JV5L 2A19A 3RLOA 4YY3L 2PNHA 4GOPC 4R4CA 1WFQA 1RL2A 1VQFA 4DR2L 2NVTH 2WAQG 2D0OA 3E0EA 3EBEA 3RNUA 4BY1H 3K7UC 2VL6A 4JCVE 1XMOL 1PH6A 4LF5Q 2R92H 5LMUL 1JJGA 1IBKL 3M4PA 5C0XJ 3HOZG 4DKAC 1HR0L 5HY6A 4A3MH 3M7NA 4X6AH 4HIOA 5C0XG 1PFSA 4OWTB 4A76A 4P74A 1N34Q 1R9TH 1TWCH 3H0GG 2Q2IA 3NBHB 1Q46A 5LMNL 2HIVA 4Y52H 1YJ9A 3KDFA 2NN6I 4HJ8A 1Y14B 3ZJYC 5IYDG 3F2BA 4OWXB 4DV6Q 1IL2A 1M90C 2CKZB 3K8AA 4JI8L 5M5WH 1XNRQ 4WJ4A 2I5HA 1NJIC 3W5OA 3J7ZC 1Y1VH 4LUOA 3A5UA 4JC0A 4DR4Q 2BH8A 1O7IA 2HT1A 1KXLA 1A0IA 4OXPA 1IBLQ 3CPWA 1VQPA 1A8VA 1E1OA 2WFWA 1A63A 2ID0A 1X6OA 1C9OA 2GVBA 2MO1A 5ELNA 4Y7NH 2E2HH 1GD7A 4B3TQ 1K83H 4TVAB 2EXDA 2Q2TA 4DK3C 2F4VL 4B3RL 1XPUA 1E22A 1PH3A 4NXMQ 4YCVA 4X62Q 3S17H 2YTXA 2HIXA 4LFCL 4A93G 5M5XH 2K5VA 4POFA 2CWAA 1EYGA 2ZTEA 4EQ5A 2UUCQ 1UE7A 4LWCA 4A3FG 4H02A 1YHBA 4DR7L 2QA4A 2Z0SA 2PI2E 4AH6A 1WI5A 3FP9A 2QEXA 3CCJA 4AYBG 4C3JH 5C4JH 2YTYA 4OO1I 2K5HA 5M5YH 2HHHQ 1I3QH 3T1YL 3K80C 5FLMH 4JOIC 4HIMA 1J5EL 4B3SL 4DAMA 1EIFA 5IWAQ 5GAHC 4A3BH 4BBRH 4X65Q 3GTLH 4PZ7A 4PZ6A 4BBSG 5K36G 1S3OA 1Y1VG 1D7QA 2R6GA 4DR6Q 3W1GA 4KLKA 4LFAQ 4XIGS 2ZM6L 1QVGA 3ERSX 1MJEA 4LF6Q 3S1NH 4DV2L 4DV7Q 3HOWH 3PSIA 1K3RA 3G48A 1OTCA 4DV3L 4JI0Q 1VQGA 3MEFA 4JI4L 1OXXK 4GLXA 4JOIA 4KHZA 2ASBA 3GTKH 4BXXH 5IP7G 1YIJA 1P16A 3S15H 4NXNQ 2QGQA 2DGYA 3M4QA 1KRTA 1X3EA 1P8LA 1QVFA 3KF6A 4JV5Q 4GLAC 4LFBQ 5C3EG 5JJIA 4JI7L 4JYAL 1MKHA 5JJKA 1JT8A 4DV4Q 2ATWA 4IO9A 3OW2A 1MIUA 3J80c 1N8RC 3G6EA 2LXKA 3ULJA 4A3JG 4HJ5A 2R7ZH 4JI3L 2AWOA 1I50H 1U0LA 4HIKA 2R93H 4YY3Q 4FDBA 2E5LQ 2N8NA 3ICEA 4OO1G 1UEBA 2YTVA 3Q8DA 5LMNW 5FLXc 1UE6A 4J15A 2BA1A 4IPHA 3T1HQ 2VUMG 1PH1A 2Q2HA 4A3IG 3PO3G 2JK8A 1PH5A 1B7YB 4LW1A 4GN4B 4X66L 3TS2A 3GO5A 3KYHC 1NY4A 4A3EH 1WOCA 3EN2A 2EIFA 2CFMA 4P75A 2RHSB 3CXCA 1QUQA 1FL0A 1VQOA 3HOYG 3CD6A 4QQBX 4O0AA 4LF9Q 1CKNA 4P73A 2OTJA 3HKZG 1OXSC 5LMNQ 2KENA 3PGZA 3H15A 2VZAA 2YYZA 3F1ZA 2JA5H 5C3EH 2ALYB 1SLJA 2MFIA 5GROA 4JI8Q 5E7NA 3GD7A 4QIWE 3UE0A 3U58A 4IPCA 3RN5A 2PMZE 2F3IA 1BBUA 1CSPA 4R4QA 1VQNA 4P72A 1K9MC 2NVYH 1E3PA 4DR4L 2N3SA 2R7ZG 1SR3A 1PA6A 3RLNA 3ER0A 2KHIA 3CF5A 3DM3A 1Z47A 4GLVB 2RCNA 3ULLA 5FLMG 1K73C 1ASZA 1Q7YC 4GOPA 1QZGA 4PMWA 4LF4Q 4B3TL 2JQOA 2F4VQ 5GAEC 1NE3A 4B3RQ 3HOZH 4NXML 1LM0A 2L15A 4BA1I 5IY0A 4X62L 4IPGA 2UUAQ 2PQAA 4JBWA 4MTNA 1GKHA 3S2HH 1W2BA 3CC7A 1S72A 3UDXA 2KHJA 4O2DA 4DR7Q 1KC8C 4AQYL 3BZKA 4YCWA 4A3MG 1JB7A 3HOWG 4A3BG 1VQJA 1VQ9A 4IPDA 1PHJA 5IYCH 1OXVA 4DUYL 1N9WA 3NEMA 3T1YQ 1HZBA 3M9BA 1J5EQ 1VQ8A 2ZJRA 3HOVH 4KI0A 2AMCB 4JI2Q 4X65L 3CCMA 2JJQA 3OYYA 5IYDH 4HIDA 3HOUG 2XGTA 1VQBA 3CAMA 1Y1WH 4GN5A 2K14A 4BXXG 1SROA 5M3FH 3HKZE 4JBJA 3RLFA 2VQEL 2ZM6Q 5FJ8H 4LNQA 3K81C 3JAMi 4LF6L 4A93H 2VNUD 4DV7L 4X64L 1I5FA 2WB1G 1JE5A 1HZCA 3BZCA 3L7ZC 3F2DA 3CPFA 4DV3Q 2OCEA 1UWVA 2WB1E 3PIOA 1IZ6A 4BY7G 2IT1A 3H3VI 4JI1L 1NTGA 3PF5A 1I94Q 4RG1A 4C2MH 4A3DG 3F8TA 1KD1C 4LFBL 1BKBA 4JI7Q 4L5RC 1X65A 3LGJA 1VQ6A 1YI2A 4IJLA 1IYJB 1TWGH 3KOJA 3OTOQ 1Z9FA 4GN3B 5GQOA 2NVXH 2IX0A 1PYBA 2N78A 4YCUA 2F52A 4JG2A 1VQKA 1K8AC 4JI3Q 3U4VA 1FJGL 2IHEA 1N33L 2MQHA 4A3EG 3HOVG 2N49A 2B3GA 4QJFA 2E5LL 2BH2A 2VQFQ 3H0GH 4LUZA 4NPSA 1NMFA 1YEZA 2RF4A 2Y0SG 3CCRA 3T1HL 3HOYH 2I5MX 2LSSA 2PI2A 3GTJH 1VQMA 1UE5A 3CCVA 3TEHB 5FJ8G 4X66Q 4GOPB 2B29A 3RN2A 2ZJPA 1EFWA 4B3ML 4WJ3M 1E7ZA 3I55A 3GDEA 4JBMA 3CC4A 3CQZH 4A3LG 4IFDG 4R4IA 5C4XG 1QZHA 1H95A 2H5XA 1E1TA 4YWKA 3U50C 1Q1BA 2C35B 3HKSA 3KJOA 2MO0A 1XPOA 1AE3A 5JJLA 4K0KQ 1N36L 1WCMG 4DV0Q 4OX9Q 1IXRA 1V9PA 2WAQE 1JJCB 4GNXA 2NVQH 2R7DA 3S2DH 3KLWA 2JA7H 4RMFA 4A3KH 1YBYA 4L5SA 4IOCA 5IE8A 1Q82C 2JEAI 1K8GA 1KHIA 4DK6C 1M1KC 4NB3A 1SMXA 1SFOH 3G4SA 4LF4L 2VY3A 4JI6L 4LF9L 1U5KA 2JA8G 5IYBH 1QVCA 2K50A 3STBD 4JI5L 2AHOB
chains in the Genus database with same CATH superfamily
1SE8A 1Z7TA 4A3GH 2DJGC 4E6IA 2Z1CA 1VQAA 5ELOA 2OWOA 3QO2A 1ONLA 1OXTA 4HTHA 1XMQL 1TT2A 1EY0A 2NVYB 4CDCC 2VXWA 1O7YA 2JA6H 3STBC 1LV9A 3H91A 4ME3A 5CV9A 3I4MG 1PYSB 1I50B 5M3MG 2BA0A 1Y8NB 1VF5C 4KJOA 3BU2A 5EKIA 3U4ZA 3L2PA 1HNXL 1B9NA 2K75A 2MP1A 4ODGA 2DUDA 2CQOA 3UDFA 5BN5A 1PH9A 4X3KA 4POGA 2XSCA 2E75C 1HUNA 2MGSA 2JA8H 4X64Q 3FHWA 5DM63 1TQOA 1L1OC 5IP9H 4YHHL 4CJ1B 1LUZA 1QUQB 2HD3A 2XN9C 5M3FB 3AEVA 3K0XA 1CFMA 2IPKD 1EWCA 1SJHD 4DR3L 4GKKL 1EYCA 2R92B 3AFPA 3BVZA 1RIPA 3O13A 2EYJA 4CHTB 1GXDC 1G291 1STBA 3SHLA 3CP0A 1TXYA 1FJGQ 1TWHH 1EUJA 3V05A 1QNUA 2K52A 3C1FA 5ELCA 1EY5A 5IT9E 3DMUA 3M85A 1W3SA 4QGUA 4BBSB 4DNIA 2M9VA 2E2JB 4ZCKA 1VS0A 1NR4A 4PG3A 3K58A 2RKSA 1EIGA 1WJJA 5IP9G 1V1PB 5BN3A 4IQZA 4X3TA 3PCOB 3EVQA 1F77A 1N36Q 5GADC 3CCSA 4GKJL 3A7AB 4K2LA 5M5XB 3S24A 1WTQA 2PW5A 4LUVA 1EU3A 1V43A 1H9JA 4YWLA 4KMUC 1DD2A 3OIQA 3KK7A 4C3JB 1ILPA 4DAYA 5CYUA 5IGCA 5C0XI 5KYIA 4TSSA 4DR2Q 4EQNA 2ENBA 5CC4A 5DEHA 3KLSA 5I6YA 4A3KB 1XYIA 2C9OA 1XMQQ 1QILA 4J6HA 1K28A 4A3JH 1HR0Q 1F2ZA 2KHSA 4BY1G 3Q6SA 1IL8A 1X9NA 3A54A 3I3CA 3S1NB 1XNQQ 3KFUA 3CHBD 1VQHA 1Q12A 2MUYA 3M3YB 4B08A 4DXFA 3WWVA 4Y7NB 2NZHA 1HNXQ 3DLLA 5FLXE 3MWYW 3WOEA 1DCZA 1WCMH 1CQVA 2EQSA 1XNRL 1C0AA 1EU4A 1EWIA 1RF2D 1YNXA 2K33A 4KHPQ 5IGFA 2GN5A 4NP5A 3UE1A 3NWSA 2OTLA 1L0YB 3OWFA 4U68A 3DXJC 4H44C 1VDZA 3G71A 4DR3Q 1G8ZD 1E24A 3P7JA 4IJHA 1B53A 3L0OA 5DLQE 3W1BA 1VMCA 5KIXA 1PLFA 4XQNA 4OHJA 4C3HG 1A3VA 2A1AA 2CW0D 2KBNA 3DEPA 4B3SQ 4XXEA 5KNCA 3GTQH 1Q81C 3KF8B 3NHHA 2OQKA 4DK0A 1S40A 1NBWA 2D2CC 4FXGC 1MJCA 3CMAA 4KN7C 4MZ9A 3I2ZA 4OO1H 4MHEA 2Q8TA 2RDHA 1HTLD 4HAEA 2QW7A 3J80i 2JYOA 1EIYB 3FKIH 4XYQA 2CCZA 1A15A 3IRBA 3H3VH 1A2TA 1EOVA 4RAUC 5EBCA 3FMCA 1FNWA 2J0TD 3PIPA 1YVCA 2NZ1D 4JYAQ 4ZYSA 5J3BA 1GUNA 1B50A 2K5WA 4A4IA 1V1QA 2JXMB 1JOKA 1H9KA 1ENCA 1VQFA 2WAQG 4DR2L 3RNUA 5JVH3 4JCVE 2R92H 3S16B 2K01A 3M4PA 4ZLTF 3IKJA 1NR2A 2FINB 4RA8A 4L8JA 2EJGC 4HIOA 4OWTB 1R9TH 1TWCH 2F0GA 5E1FA 2Q2IA 1Q46A 4H0LC 5IGEA 4Q0FA 1SNMA 3F2BA 5E4WC 1IL2A 4C2MB 1M90C 2CKZB 5CV4A 1D5XC 1XNRQ 1WTVA 1O7LA 4KTAA 3J7ZC 3MC0B 4LUOA 1FNVA 4OIJA 1O7IA 1YNNC 1A3TA 1VQPA 2WFWA 3QJYA 4IN3A 1C9OA 1GOZA 5ELNA 4DK3C 4CDDC 2F0PA 4YCVA 2QEJC 4KHVA 1B9MA 2NTTA 2CWAA 2KOLA 2ZT9C 2ZTEA 2PQEA 3ZYYX 5EJWA 4JK1C 4DR7L 1DYQA 3D3RA 4UAIA 2YTYA 2M2LA 4OO1I 3TBIB 4KY6A 1EIHA 3CQZB 1I3QH 3K80C 2WKDA 4A3BH 3K5OA 5ELDA 3S9WA 1O78A 5K36G 3IFDA 1D7QA 3I91A 1ESFA 2R6GA 4LMQD 2ZM6L 3S1NH 3HOWH 5J1ZA 4DV3L 4ZQ3A 3MEFA 2ASBA 4JOIA 2I46A 1P8LA 2MHVA 3KF6A 3R2TA 3MXGA 4GLAC 5C3EG 1ICFB 1H9MA 2EJMA 3OW2A 3LWUA 4C3JG 3G6EA 1K8MA 1STHA 1BCPB 3ULJA 4HJ5A 5FO8B 5LHY1 1U0LA 4HIKA 2A6HC 4YY3Q 2R93H 4F7XA 4OO1G 1UEBA 1PRTC 1UE6A 4F87A 4J15A 2BA1A 3T1HQ 2VUMG 3TP7A 4A3IG 3D6WA 2F0HA 4LW1A 4GN4B 1D1KA 3TMEA 4X66L 4G7HC 4A3EH 3GTGB 5I4DA 3EN2A 4P75A 1QUQA 1FL0A 1VQOA 4QQBX 2PYKA 2OTJA 3ND9A 4KK7A 1WVLA 3H15A 5ELBA 2YYZA 3F1ZA 2KCCA 2ALYB 4TKOB 5KRUA 2F1MA 3T16A 4DN4M 4QIWE 4ABNA 4A3MB 2PMZE 2F3IA 2E2IB 1K9MC 2NVYH 1ENAA 2F0WA 3RLNA 1PA6A 5JOBA 3X3MA 1Y69U 3CF5A 1Z47A 4LF9Q 1K73C 1Q7YC 1GUSA 2ICEC 4KV6A 4B3RQ 3FVQA 3HKZB 4NXML 1H9RA 3A55A 1BOSA 5IY0A 1EFID 5M5WB 2UUAQ 2PQAA 2RA4A 4MTNA 1BQQT 4RHSA 1SNOA 2JSOA 3MEHA 1S72A 2KHJA 1CTMA 2F0SA 1BBXC 3HOWG 2BDNA 1B3QA 1VQJA 1GUOA 1VQ9A 5KEEA 1RODA 4DUYL 5IOCA 2MJ8A 4A3DB 1VQ8A 3OOCA 3GQBA 2NVTB 3HOVH 4KI0A 1XX8A 1M8AA 4BXXG 1CM9A 1SROA 1IKMA 3QOLA 1CHQD 3CU7A 2VQEL 1EL0A 1JICA 4LNQA 1WTRA 2VNUD 2Z8LA 2AQ1B 3BZCA 1EEFD 2X69A 1UWVA 4PMBA 4ME5A 1WD1A 3H3VI 1NTGA 3PF5A 3CKIB 4C2MH 5DM73 2NN6H 4XT3B 1HCZA 1BKBA 1CA5A 1TWGH 4GN3B 2N78A 2XWBB 4JG2A 1JOOA 4DK1A 3U4VA 2IW3A 1F9RA 4A3EG 2E74C 3ITPA 2F03A 5D3IB 3GTMB 1YEZA 3CCRA 1EQTA 1TS2A 3T1HL 3HOYH 2PI2A 1E2ZA 3GTJH 1VQMA 3HEJA 1UE5A 1ZKOA 3SDZA 3GDEA 2CHBD 4JBMA 4QB4A 1B4OA 1I6VC 3CC4A 3CQZH 1V8QA 5D14A 2H5XA 3BG3A 1E1TA 2PMZB 2K5QA 3DEOA 3E3XA 3RUZA 1HUMA 3SVMA 1S5BD 4OX9Q 1IXRA 2WAQE 3C3LA 3KLWA 1FNUA 4S3SA 1LT3D 3P20A 4RFBA 1VF7A 3G7LA 2RDGA 3I70A 5IE8A 4HR7B 1Q82C 2A74C 1KHIA 1K8GA 2K5DA 3GV6A 4F8MA 3TSSA 4LF9L 2JA8G 1U5KA 5IYBH 5JVG3 1BO0A 1LT5D 1TWAB 3K5NA 3D6CA 2EJFC 4EX5A 5C4XB 2UUAL 4FVMA 3K5MA 2VUMH 1HQMC 3C2PA 3TREA 4DUZL 2F0QA 4AQYQ 4EQPA 3K6OA 4IUVA 3UDGA 5COYA 4GNXB 2K1BA 2R93B 5BR8L 2B63G 3FEWX 3CCEA 4JI2L 2Z6KA 1N32L 4C3IH 3PUZA 3SR1A 4FF1A 2EOTA 4OONA 4DR1Q 2B8FA 1IW7D 4CDEC 4L63B 5EPKA 2ZJQA 3J7A5 1STGA 4FXDA 5ELEA 1KAAA 1CQFA 1SYDA 2CW0C 3J81E 3AFQA 2B2WC 4DNRB 3F2CA 1TWFB 2NYZD 2KCMA 3I8ZA 2WINB 3D31A 3HRZC 3S14H 5KNBA 2B2TA 2CWPA 3PUWA 2E2IH 1X56A 1I6HH 2JA6G 3I4MH 4KKSA 3EROA 3A0JA 2EZVA 2UU9Q 2LMCB 3S1RH 4K2KA 5I2XA 1R4PB 2A73B 1VQIA 1L0WA 3NELA 2XVSA 3DWPA 2KCTA 1J6QA 4C1NI 2VW9A 2A8VA 1HNWL 1Q1EA 1S5ED 5M3FG 4DV1L 4UP8A 1Y1VB 4BY7H 4HCEA 4GZYC 3VR2A 1KQSA 1F9PA 5I9PA 4BBRG 1AN8A 3N52A 2I5LX 3A7LA 4ZRZA 1XXGA 4DV0L 5IT9L 4OX9L 5AJ3Q 1YHAA 1G6PA 3VYUA 5JEAJ 3HOXH 4IUNA 2NB0A 4TRDA 1TWCB 3PUXA 5FLXL 3C1EA 1JWUD 4R4OA 2FFKB 4IZ8A 1XMOQ 2CQAA 4C3IG 5LMUQ 4PV1C 3MZ5A 2HQLA 3PUYA 5BR8Q 1VMPA 3T53B 4IFDH 4A3GB 5ISRA 4HJAA 1HNZL 1Q8KA 5IGGA 4LF8L 1N32Q 3KBGA 1EQQA 4DV6L 3PO3H 2Z9HA 1L1OA 5DAUA 2UXCQ 4UP9A 3VYSA 2IHFA 4OIKA 1G51A 3I4NB 1SXTA 4TQUS 4A3KG 1SYCA 4QCLA 3E9IA 3OMCA 5JAVA 1NUCA 1IBLL 1L1OB 1BCPF 3A5ZB 3AYHB 4ALPA 4LF7L 3EJIA 4LFCQ 3J7AV 2UUCL 4QL5A 2Q2UA 1K0RA 2F0UA 4R4TA 3RMHA 5E3FA 1VQLA 2UU9L 3Q23A 1KTKA 5C4XH 1QWYA 3S15B 1A2UA 3CW2C 4CKBA 1V1PA 3IFTA 1HNWQ 3MXPA 4LFAL 3AMUA 1NNXA 3PQIA 4JI0L 1PH4A 2EE1A 3EFXD 1FGBD 1U4MA 1KNAA 4KJNA 2E2DC 2WP8J 4DV5Q 1LYLA 4H13C 3U9SA 4HJ7A 5AJ3L 3GTOH 3J81i 3S2HB 2E2JH 3KJPA 2EDGA 2ZTCA 3H94A 5C5MA 2IY5B 4DR5Q 3CCUA 2Z6BA 1Q8IA 2A19A 3RLOA 3MVVA 3I72A 4J1MA 3MAQA 1WFQA 3E0EA 2D0OA 3EBEA 5C4ZA 2RQXA 4CGYB 3K7UC 5LMUL 3I4MB 1JJGA 5M3MB 3OSOA 3NXWA 1ET6A 3K0YA 4X6AH 1PFSA 4A76A 1N34Q 1SYFA 3GV3A 4QIWB 3NBHB 4Y52H 4XYOA 3KDFA 3ZJYC 1RKNA 5TSSA 1PRTF 2HDMA 1NJIC 2YU9B 3W5OA 1SEBD 1Y1VH 2BOSA 4DR4Q 3OPOA 2HT1A 2PZUA 1A0IA 1U4LA 3WDNA 1E1OA 2PCFB 4ULLA 1B44D 2MO1A 3H6MA 2O5IC 1K83H 2Q2TA 2PZWA 3H0GB 1C48A 4X62Q 2YTXA 3NWTA 5JPNC 2JN4A 1R4QB 1EYGA 2UUCQ 4LWCA 2G5DA 1QNKA 1PXUA 1X3QA 2Z0SA 1TR5A 2PI2E 3WOFA 4AH6A 2QEXA 4XQJA 3HOXB 5C4JH 3BYYB 2K5HA 3M7GA 2RCFA 1ICWA 3C46A 3KBXA 1STYA 2NUCA 2TSSA 4BBRH 3OW7A 4X65Q 4PZ6A 5HGTA 4BBSG 2A6EC 1IYVA 2A68D 3T51B 4DR6Q 4LFAQ 4N9TA 1EY4A 3ERSX 3QOJA 4DV7Q 2BE5D 1OTCA 2F0MA 2OXPA 1OXXK 4KHZA 4OGQC 5IP7G 3K7AB 2QGQA 2NWGA 1QVFA 3D4RA 1BCPD 5JJIA 4JI7L 1KLUD 3TN2A 1V1OA 3HOYB 1MKHA 1SNQA 5JJKA 5JPMC 2DY7A 1JT8A 1PFBA 4IO9A 1N8RC 4CJ0B 3J80c 4XQQA 1Y8PB 2R7ZH 4JI3L 3I90A 2O4XA 1O80A 4FDBA 2E5LQ 3HG9A 3E6ZX 1EQVA 3VA7A 2EYMA 3PO3G 2JK8A 1S5DD 1PH5A 1B7YB 4NMZA 1NY4A 2F0FA 1WOCA 2L11A 2RHSB 2EVBA 3QR8A 2Z4HA 2KENA 3PGZA 4XT1B 4KD4A 5C6AA 4K8IA 4RGMA 1SLJA 1WTPA 2MFIA 4N9PA 5GROA 4JI8Q 3GD7A 3UE0A 4DAVA 4IPCA 2K32A 4R4QA 2VUMB 5LL6X 2G9DA 1E3PA 2N3SA 1R9TB 1IKLA 2VB3X 1KDCA 2G9HD 3ER0A 3DM3A 2VB2X 4PMWA 1Z6HA 1DJRD 2JQOA 1NE3A 4DU9A 2SNMA 3MHBA 1LM0A 5E4XA 3HGBA 4RCNA 2LFNA 3UDXA 4C3HB 4O2DA 3BZKA 3SK5A 4A3MG 5D3DA 3S1MB 1UUPA 2A69D 3Q22A 1N9WA 3T1YQ 3M9BA 3CCMA 4B9XA 4HIDA 1VQBA 3IAYA 4GN5A 1QJOA 1GJXA 1MBYA 1HXYD 2V4DA 2KEDA 3K5LA 4IURA 3JAMi 5M5YB 1B3AA 4N8FA 4X64L 4DV7L 1I5FA 1HZCA 3L7ZC 3CPFA 3T13A 4A3BB 2WB1E 3PIOA 1IZ6A 2IT1A 4WJWA 4JI1L 2P5ZX 4RG1A 5CV5A 1IHZA 1AZPA 1KD1C 1DOLA 3BVGA 4L5RC 1U4RA 1X65A 3DUZA 3LGJA 3A8IE 1IYJB 5ELFA 3OTOQ 3KOJA 2ZXOA 5GQOA 1VQKA 4YCUA 4RCOA 4R9WA 4JI3Q 5C0XH 1QCBD 2E5LL 5CR3A 1I4PA 1GUGA 3M4YA 2Y0SG 1TS3A 4ZUJA 4BWGB 4QUFA 2I5MX 1E2WA 4G4KA 1CK1A 3LX0A 3TEHB 4DXGA 4GOPB 2ZJPA 2OEOA 3KLRA 5C4JB 3I55A 1MSGA 1PRTD 4K5VA 1QZHA 1H95A 3U50C 3HKSA 1XPOA 1AE3A 2J7ZA 5JJLA 1MSHA 1WCMG 1IW7C 2QKIC 3HP3A 1JJCB 4GNXA 2R7DA 3FPUB 4K6DA 2JA7H 4DA2A 1JOQA 4L5SA 2JEAI 1XTCD 4JPBW 1M1KC 1BF4A 1SMXA 5EPJA 4HEDA 5FKAC 1SFOH 2VY3A 1WTHA 1QVCA 2K50A 2AHOB 2SEBD 1WD0A 1D8LA 1EY8A 1HA5A 1IBMQ 3J7YW 2SNSA 1JC7A 3HOXG 1DGSA 2SOBA 1T9HA 1AP0A 3I4NH 5CORA 1XNQL 1PZKD 3CCLA 4I7AA 2F0OA 4R8NA 3VDYA 1LABA 4RGTA 4XTCS 4JBKA 3H3VC 1HTPA 4MN3A 3PIP3 2JA5G 4DAYB 1TY0A 4WFN3 1SE4A 4PNYA 2B2VA 2OQ0A 4K14A 3I4OA 4A3DH 3A74A 2RBMA 1PZJD 4KHPL 2F4IA 3ERQA 1LLRD 2CH4A 4JI1Q 5C3EB 1OXUA 1A62A 2R93G 2JE6I 1CKNB 2UUBQ 4RH6A 3AB9A 1AE2A 1ILQA 2IL8A 1HZAA 3OTOL 4LAAA 2A68C 3NENA 4B9WA 1F9SA 4A3LH 1UE1A 5EAYA 1PH8A 1Y1WG 2IJ0A 1YITA 4G7ZC 2VQFL 3NQTA 3J81L 1ENFA 3HZXA 2KECA 4RWSC 1YZ6A 5EQ0A 3AU7A 2AWNA 2UXDL 3EQLC 4QY7A 4C3HH 4UPAA 4B3MQ 4ZK9B 3KF6B 3NTIA 3QG1A 1G6ZA 1XWEA 5FK9C 5I9OA 4P2CB 1VQCA 5JEAG 2NN6G 3BYTB 3MFYA 1QOHA 3URYA 1QG7A 1HPCA 2LS01 3UDIA 1PTOB 2B2UC 1YNJC 2F0EA 1LTBD 4Q5VA 5T1IA 3PO2H 3UI2A 1FGUA 4BY1B 1KDBA 1RTOA 2K4KA 1EZ8A 1RCVD 1U9RA 3SXHA 5M3MH 2UXBQ 2I0QA 1UNSA 4JI6Q 5IYCG 1F2YA 1AEXA 1YHQA 1I3QB 2XRSD 2WKCA 4GS3A 2NVQB 2PZTA 2FXQA 3HFZB 2ICIA 3E9HA 4HMJA 4MIUA 3TP5A 1IBML 4LF5L 1CUKA 2EYFA 3HOUH 2K5NA 1IBKQ 1T5EA 3SGIA 3D0FA 2Q8IB 2YU9H 4BA2I 4ZKCB 1G91A 1CA6A 3MXNB 5C44H 4DAPA 4KD3A 1TWAH 1G2TA 3NPPA 2HCCA 3CCQA 1D2BA 1PZID 2XTIA 4A3IH 1BBWA 1ML0D 2BDOA 2EYPA 1WTXA 1I4GA 2ZXRA 3NE5B 1JMCA 1BCPC 1PVOA 2J4XA 4P71A 5J22A 3QB3A 3EA6A 2PQAB 4O1NA 1YJNA 3R3OA 2DNEA 4PQXA 2ZXPA 1HZ9A 3TZDA 2QF7A 3GP7A 4YHHQ 2L5TA 1B70B 1JORA 2LY7A 1X55A 4IFDJ 2UUBL 4GKKQ 1JCKB 2KCNA 3GTKH 5HGQA 2XWJB 2E76C 4QUCA 1ZEQX 4A3EB 1BNZA 3GTGH 2D62A 3I4NG 1PDQA 3M4OH 2HHHL 3AQQA 1K3BC 2B2YA 2B63H 1H9SB 3K57A 3EIVA 1XPRA 1CKOA 4R8IA 4UY8C 3K7AH 2V1CC 1EZ6A 2UXDQ 1FVIA 5JEAH 1X54A 2F0VA 2WV6D 1GM5A 5C4HA 3RZDH 1KIXA 1HH2P 1STAA 3B6YA 1KRSA 4APVA 2WAQB 1B8AA 4FP5D 1VQ4A 2R7FA 2KUMA 3HOZB 2F0NA 2Y0SE 3HS0C 4GKJQ 1ASYA 3ULPA 2EY6A 1VQDA 5FO9B 1Y8OB 5F2DA 2OF1A 2VS1A 2JA8B 2K05A 4AIMA 2UXBL 4I65A 4MNOA 1BVSA 4UP7A 4YY3L 1SDFA 1JR0D 2NVTH 3HOVB 5JJZA 3A56A 5KYLA 2L12A 4LF5Q 2VL6A 3LWEA 1B2TA 4J8QA 1IBKL 1HR0L 5T1GA 1EWHA 3M7NA 4H7BA 5C0XG 1TWHB 4LJZC 4P74A 2DY8A 3NP8A 1BXTA 5LMNL 2B2TC 1SNDA 2NN6I 4HJ8A 1Y14B 4OELB 4OWXB 4RGOS 4RKLA 5C3XA 1HFGA 4WRDA 4NKLA 2AUJD 2BH8A 3NBIA 1KXLA 4OXPA 3CPWA 1A63A 3OWEB 2ID0A 1X6OA 3NSWA 4QMGA 4B3TQ 2H1EA 4TVAB 4B3RL 1XPUA 1PH3A 4NXMQ 3J80E 5M5XH 4FNFA 2F0TA 2RDFA 3GTJB 4HCSA 4A3FG 4H02A 5EBDA 1K0SA 1AZQA 4L6TB 3CCJA 4AYBG 4C3JH 4ZUIA 1DXMA 5M5YH 1SJED 2HHHQ 1JWSD 5FLMH 1YNND 3NQIA 4RHRA 1CHPD 4B3SL 5GAHC 4HSVA 2EY5A 4UDUC 1G2SA 4PZ7A 3R8BA 2JP1A 1EEID 4WORA 1S3OA 1CZGA 1Y1VG 2KQ3A 1HRJA 4A3JB 3W1GA 4KLKA 4XIGS 4V190 3E5SA 1QVGA 3IL8A 1MJEA 2F3WA 3LNNA 3FDTA 3Q24A 2CH4W 3G48A 1VQGA 2B39A 4QF4A 3X3NA 1M4VA 1YIJA 3G6JB 4A3IB 1P16A 3S15H 3QWNA 3M4QA 1KRTA 1PTOF 1X3EA 2B8GA 4OL7A 1LTRD 4JYAL 2L9HA 1H9SA 2ATWA 1AW7A 1EY9A 1MIUA 1D5MC 4IUUA 1TIID 1BDOA 2L0CA 3ICEA 1CI3M 2YTVA 5LMNW 1HHVA 4C3IB 4X3SA 2WACA 1PH1A 2Q2HA 1LTGD 4EGVA 3GO5A 3KYHC 3S2DB 2EIFA 2CFMA 3SK4A 3CXCA 5G3LF 3HOYG 3M4OB 3NTHA 2IWHA 1AFPA 4O0AA 4EQOA 1CKNA 4P73A 3HKZG 5LMNQ 5IGBA 1SFOB 1KDAA 4HN7A 2JA5H 3F2UA 5CBEE 2PNRC 1RDPD 4FO2A 2K7VA 5E7NA 3VR6A 3U58A 3RN5A 4NW2A 1BBUA 1CSPA 3NBHA 1VQNA 4P72A 5FOBB 1EYAA 2RSOA 2KHIA 2N55A 1DZ1A 4DFAA 1ASZA 2RCNA 5FLMG 2L55A 4LF4Q 1QZGA 4B3TL 5LL6S 3BDLA 3MXUA 3HOZH 4FF2A 4IPGA 4JBWA 1W2BA 2BCOA 3CC7A 4HSPA 4DR7Q 4AQYL 2MPMA 2XRQD 4YCWA 1JB7A 5K36H 5CV7A 3ND8A 4BY7B 3TP8A 3P1HA 1OXVA 2E2HB 2B2VC 3BVMA 3NEMA 2NBFA 2F0DA 2ZJRA 5I2YA 4JI2Q 2EY2A 2FMMA 4LK1C 3HOUG 1RD9D 1Y1WH 3CAMA 2K14A 1II3A 1PFNA 5M3FH 1YNJD 3RLFA 1STNA 3MTSA 3VR5A 2ZM6Q 5FJ8H 1EYDA 3K81C 1B1ZA 2WB1G 1JE5A 3PIO3 3F2DA 4DV3Q 4CJ2C 2OCEA 3DWQA 4JVZA 3GTLB 4U673 5CBAE 1I94Q 1JQYD 2PW7A 3D4WA 4A3DG 2QDBA 1LTID 3MXNA 2C5CA 1VQ6A 1DOMA 4IJLA 2XIWA 3MA2B 1Z9FA 4O42A 2IX0A 4K8JA 3FRPB 2Q8RE 2EYLA 1K8AC 5FO7B 2IHEA 1N33L 2MQHA 3HOVG 2N49A 4KKTA 4QJFA 1RJTA 1A3UA 1LTAD 4HMIA 1PTOH 2K28A 4KY5A 1GUTA 2LSSA 4X66Q 3GTPB 1L0XB 2R61A 2EY1A 1TKWB 2A6HD 3ONAB 4A3LG 2HDLA 5C4XG 2F0KA 4EVOA 2C35B 2N88A 5EKKA 2MO0A 4K0KQ 4DV0Q 1QB5D 2NVQH 1S5FD 2R3ZA 1EY7A 4IUPA 4A3KH 3DM1A 3VYTA 3E0JA 5CGKA 1S4ZA 1KABA 4M8AA 4DK6C 2FJ2A 3G4SA 4LF4L 1PMRA 2DN8A 5DNFA 4JI5L 2RSNA 5C44B 3K59A 3PMFA 3M3YH 4IFDI 3TDQA 2AQ3B 4FXKC 4A3FB 2EYOA 1AH9A 3S1QH 1LTLA 3PO2G 1MD2D 1WCMB 3KDFB 2QCPX 4AYBB 3JC66 2D0PA 5KGUA 2AKWB 1RHPA 4XDXA 4DUYQ 4N8X1 4G7OC 4R1JA 1UAPA 1HNZQ 4LF8Q 2IX1A 2R92G 1EQRA 1HR0W 2UXCL 3TRZA 1LT4D 3L3OC 2VQEQ 5EGTA 3PV0A 3CMEA 5D65A 3U9OA 2Z6KC 5IT9c 1LTSD 4RGNA 2RVLA 1I94L 3I56A 1F2MA 2B63B 2DJFC 2ZTDA 4LF7Q 3GTQB 4PZ8A 1FYCA 4A93B 1IYUA 4Z9CB 3T56B 3OHXC 4F88A 4YWMA 3RZDB 2AUKA 2B2WA 2HUGA 5EPLA 4L5TA 1MHWC 1N33Q 2LXJA 4YIJA 3VR3A 5CMDA 3TS0A 1SMYC 1WYDA 3J81c 2E8GA 3W3AA 2YV5A 5A2QL 2RHQB 1D5ZC 1SAPA 3RR5A 3BDOA 4A3CG 2JEBI 2NZOA 3J80L 1JJ2A 4GNXC 2EXZA 1DOKA 1SMYD 2JA7G 1SRUA 2F3VA 2GVAA 1W6KA 3J7AF 1GO3E 2B2UA 4I7ZC 2MNAA 1Y1WB 4K0KL 1ZXTA 1ZYRC 4DV5L 5GAGC 3S17B 1CKMA 1SNCA 1SN8A 5HURA 1XJVA 2KJXA 3J81j 5IYBG 3S16H 2DNCA 3RZOH 1PTOC 2ES2A 3VR4A 1GVPA 1X3FA 4DR5L 3I7FA 2HCIA 3L9AX 5IP7H 1NSNS 1I4QA 4JI5Q 3FKIG 5L37A 1L2FA 5IGDA 1TU2B 4BBRB 1EY6A 1HJPA 1MGSA 1NMGA 1JB3A 3TP6A 4FF4A 4BS9A 4PMCA 4DUZQ 1X3GA 1F9QA 5CV6A 3H09A 1QE6A 1N34L 1TY2A 4RKBA 2JA9A 3SEBA 1PH7A 1CSQA 1LO5D 3SK8A 1VQ7A 2BE5C 1VCIA 2KEEA 1PV4A 2M00A 4DR1L 3GTPH 2WB1B 2QILA 4AYBE 1VQ5A 3JAMc 2R7ZB 5H1SE 3I73A 1PTOD 3CC2A 4A3GG 4A75A 1EOTA 1PH2A 2A6ED 4ZKBB 1VQEA 1I4XA 2EPBA 1MI2A 3PF4A 3PUVA 3TQYA 1W6JA 3R93A 4A3CH 1KAWA 2SDFA 1SYBA 4C56C 1UEAB 5AFWA 5A35A 1JWMD 3HOWB 3OMGA 2LKVA 5M9OA 2A5HA 5IWAL 3TZUA 1KL9A 4A3FH 1Q3LA 4FF3A 3S1QB 4DPGA 4DV1Q 1YJWA 5C5LA 4DR6L 4IUQA 4JW0A 2F0JA 1STEA 4UHVA 2KA7A 3BS1A 5K5PA 4DV2Q 1Q90A 4IOAA 1C7YA 2D5DA 1Q86C 4JI4Q 1BR9A 2L1BA 4NXNL 2TMPA 2NTSA 1SE2A 4L5QA 4JV5L 4BBSH 3BJUA 1LT6D 4IALA 1XTDA 4HJ9A 2PO4A 4DV4L 2L4NA 2I07B 4OWWB 4OEMB 3P75A 5C44G 3S1MH 1TWFH 5A2QE 2PNHA 4GOPC 4R4CA 1RL2A 3S14B 3T4AC 3PO2B 1U4PA 4BY1H 1XMOL 1PH6A 1SSOA 3HOZG 5C0XJ 1GHKA 4DKAC 5HY6A 4A3MH 2X6GA 3CRKC 4KKUA 3V2TA 2GA4B 3S1RB 3H0GG 4C1NK 2HIVA 1YJ9A 1C8CA 1WTOA 2K04A 3A8JE 5IYDG 4DV6Q 2O5JC 3CRLC 1O7ZA 2K6AA 3VA5A 1GHJA 3K8AA 4JI8L 5M5WH 1F2LA 4WJ4A 2I5HA 1SBBB 4KY7A 3A5UA 2PPBC 4JC0A 3SE0A 1TS5A 4FYDA 2NVXB 1IBLQ 1A8VA 1SNPA 1S5CD 2GVBA 4Y7NH 2E2HH 1GD7A 4ILWA 2EXDA 4DF7A 2F4VL 2IX3A 1CZWA 1E22A 3DHQA 3NUCA 3S17H 2HIXA 4LFCL 4A93G 2K5VA 4POFA 4EQ5A 2F0LA 3MFGA 1UE7A 1YHBA 2QA4A 3SK6A 1WI5A 3FP9A 1D6EC 1I4HA 4CKEA 1TVXA 2AQ2B 3T1YL 1J5EL 4JOIC 4HIMA 4DAMA 1EIFA 1DM0B 5IWAQ 3GTLH 5NUCA 3D4DA 3GTKB 3JAML 1A6XA 2JA7B 4K5WA 1TWGB 1PYWD 4LF6Q 4DV2L 3PSIA 1K3RA 1J9OA 4JI0Q 3A8KE 4JI4L 4BXXH 4V0BA 4GLXA 3PO3B 1ET9A 4NXNQ 2DGYA 4JV5Q 1FR3A 4LFBQ 4DV4Q 2LXKA 4A3JG 5J39A 4KN4C 2JA6B 3FKIB 2AWOA 1I50H 4IUTA 1E2VA 1E0BA 2N8NA 1NCVA 3Q8DA 5FLXc 1HA6A 4IPHA 4K6LA 2X6LA 4K5XA 1HQRD 4G57A 1OO9B 4M1UB 3KLSX 3TS2A 1D1IA 3NTKA 1BUVT 1PRTB 5IODA 3CD6A 5I6WA 1NAPA 1OXSC 1RTNA 1X32A 1SE3A 2VZAA 1J8IA 5C3EH 2K03A 4DR4L 1LACA 2R7ZG 2B2YC 1SR3A 3BDCA 3KF8A 2FHTA 1DONA 4GLVB 3ULLA 3RD4A 2OT2A 4GOPA 4X3UA 2F4VQ 5GAEC 1HFNA 1LTTD 3V96A 2L15A 4BA1I 3R2IA 3GTOB 4X62L 2Z4IA 5C3WA 3S2HH 1GKHA 3N6RA 5G3LD 1I4RA 1KC8C 3GTMH 2D9UA 4A3BG 1SYEA 4CBVA 4CKCA 4IPDA 1PHJA 5IYCH 3QIAA 1FD7D 1TS4A 1HZBA 1J5EQ 4MTKA 2AMCB 4X65L 2JJQA 3OYYA 5IYDH 2XGTA 5IIFA 2H4OA 3HKZE 3D8GA 1ZYRD 4JBJA 2CVRA 1I6HB 4LF6L 3OIPA 4A93H 5EKLA 1ESRA 2Y0SB 4DNTB 4BY7G 3FPPA 2WIIB 1C4QA 4NDXA 3F8TA 4LFBL 4JI7Q 3VYRA 1YI2A 1CT1D 1GUWA 5KNDA 3HOUB 4ID6A 2XNAC 2NVXH 1PYBA 2F0IA 2F52A 1FJGL 3NK9A 1K83B 2B3GA 2QDLA 3I4LA 2BH2A 2VQFQ 3H0GH 4LUZA 4NPSA 1NMFA 3JAME 4DGZA 2FMCA 2RF4A 5CV8A 2EYHA 1SYGA 3RN2A 3CCVA 5FJ8G 2B29A 1EFWA 3BZDB 3DWAA 4B3ML 4CDFC 4WJ3M 2A69C 1E7ZA 3KUPA 2KVMA 1T5XD 1KLGD 3RZOB 3Q0AA 4IFDG 4R4IA 5BN4A 4YWKA 1Q1BA 3KJOA 1N36L 1WTWA 2HQEA 1V9PA 4ZAIA 3S2DH 1PFMA 1K8OA 4RMFA 1JE4A 1KNEA 1YBYA 4IOCA 3W2DA 4NB3A 1X3PA 4JI6L 2JA5B 3STBD 2O2LD
chains in the Genus database with same CATH topology
1SE8A 4A3GH 4EX5A 3M3YH 4IFDI 1VQAA 2UUAL 1D8LA 5ELOA 2OWOA 1AH9A 1IBMQ 2VUMH 3S1QH 1OXTA 1LTLA 1XMQL 3PO2G 3KDFB 3HOXG 1DGSA 1T9HA 3JC66 2D0PA 3TREA 4DUZL 4AQYQ 2AKWB 2JA6H 3STBC 3UDGA 4ME3A 3I4MG 3I4NH 1PYSB 4DUYQ 4GNXB 5M3MG 2BA0A 4R1JA 5BR8L 1XNQL 3CCLA 2B63G 3VDYA 3BU2A 3U4ZA 3L2PA 1HNZQ 3CCEA 4LF8Q 4JI2L 2Z6KA 2IX1A 4C3IH 3PUZA 1N32L 4XTCS 1HNXL 4JBKA 2K75A 2R92G 2JA5G 2DUDA 1EQRA 2CQOA 4OONA 4DAYB 4DR1Q 3UDFA 1PH9A 1HR0W 3TRZA 2UXCL 2VQEQ 2ZJQA 4POGA 3J7A5 2OQ0A 3PV0A 3CMEA 2JA8H 4X64Q 3I4OA 4A3DH 3FHWA 2Z6KC 3AFQA 3A74A 5IT9c 4KHPL 3F2CA 1L1OC 2KCMA 4JI1Q 1I94L 1OXUA 1A62A 2R93G 5IP9H 4YHHL 3I56A 1LUZA 2JE6I 1QUQB 3D31A 3AEVA 2ZTDA 3K0XA 4LF7Q 3S14H 1CKNB 2UUBQ 2CWPA 4DR3L 1AE2A 4GKKL 4PZ8A 3AFPA 3PUWA 2E2IH 1RIPA 1X56A 1HZAA 3OTOL 2JA6G 3I4MH 3NENA 1I6HH 3A0JA 1G291 4YWMA 3CP0A 4A3LH 1TXYA 1UE1A 5EAYA 1FJGQ 2UU9Q 1TWHH 1PH8A 1EUJA 1N33Q 4L5TA 1Y1WG 1YITA 2K52A 2LXJA 3S1RH 2VQFL 1VQIA 3TS0A 1WYDA 3J81c 1L0WA 3M85A 3NELA 2E8GA 1YZ6A 2YV5A 1W3SA 1J6QA 2KCTA 2AWNA 2RHQB 2UXDL 2VW9A 3RR5A 2A8VA 1HNWL 1Q1EA 4QY7A 4C3HH 4QGUA 4UPAA 5M3FG 4DV1L 2JEBI 4A3CG 2NZOA 1JJ2A 4B3MQ 4DNIA 4UP8A 4GNXC 1VS0A 4BY7H 3KF6B 4PG3A 2JA7G 3GTMH 1VQCA 5JEAG 2NN6G 1SRUA 1KQSA 1WJJA 2GVAA 4BBRG 5IP9G 1GO3E 3UDIA 2I5LX 3PCOB 2MNAA 4K0KL 1N36Q 4DV0L 4DV5L 4OX9L 5GADC 5GAGC 5AJ3Q 1YHAA 3CCSA 4GKJL 1CKMA 1SN8A 1XJVA 3PO2H 1FGUA 1G6PA 3J81j 5IYBG 3S16H 2K4KA 3S24A 4LUVA 4YWLA 3RZOH 1V43A 5JEAJ 2ES2A 1GVPA 1X3FA 5M3MH 4DR5L 2UXBQ 3I7FA 2I0QA 3HOXH 4JI6Q 5IP7H 5IYCG 5C0XI 1YHQA 4JI5Q 3PUXA 3FKIG 4GS3A 1L2FA 4DR2Q 2FXQA 3HFZB 4R4OA 3E9HA 1IBML 1HJPA 4LF5L 1CUKA 1XMOQ 3HOUH 1NMGA 1XMQQ 2K5NA 5LMUQ 1IBKQ 3SGIA 4A3JH 1HR0Q 4DUZQ 3D0FA 1X3GA 2YU9H 2HQLA 4BY1G 4BA2I 1X9NA 1N34L 2JA9A 3MXNB 3PUYA 5BR8Q 5C44H 1PH7A 1XNQQ 1TWAH 1CSQA 1VQHA 3KFUA 1Q12A 4HJAA 1Q8KA 1HNZL 3CCQA 1VQ7A 4LF8L 1N32Q 3WWVA 1EQQA 1VCIA 2NZHA 2XTIA 1BBWA 4DV6L 4A3IH 1L1OA 1HNXQ 3DLLA 3PO3H 1PV4A 1WCMH 4DR1L 2UXCQ 4UP9A 2EQSA 3GTPH 1XNRL 1C0AA 2IHFA 1JMCA 1G51A 1EWIA 1PVOA 4P71A 4TQUS 4A3KG 3E9IA 2PQAB 1YNXA 4AYBE 1YJNA 1IBLL 1VQ5A 1L1OB 3JAMc 4KHPQ 5H1SE 1HZ9A 3A5ZB 3AYHB 2GN5A 3UE1A 2OTLA 3CC2A 4YHHQ 4ALPA 1B70B 4A3GG 3G71A 4LF7L 4LFCQ 1X55A 4A75A 2UUBL 4IFDJ 4DR3Q 1PH2A 4GKKQ 1E24A 2UUCL 4QL5A 2Q2UA 1K0RA 1VQEA 4IJHA 3L0OA 5DLQE 5HGQA 4R4TA 3PUVA 3TQYA 3W1BA 3PF4A 3GTGH 1VQLA 2D62A 1KAWA 2UU9L 3I4NG 3M4OH 4A3CH 2A1AA 2HHHL 3AQQA 2KBNA 2B63H 4B3SQ 5IWAL 3EIVA 1KL9A 5C4XH 3GTQH 1Q81C 1XPRA 3KF8B 1CKOA 4A3FH 4UY8C 2OQKA 3K7AH 2V1CC 1S40A 1NBWA 2UXDQ 3CW2C 4DPGA 1FVIA 1HNWQ 4DV1Q 1YJWA 1MJCA 1X54A 3CMAA 4DR6L 4MZ9A 1GM5A 4LFAL 3I2ZA 3RZDH 1KIXA 1HH2P 3B6YA 1KRSA 4DV2Q 4APVA 4IOAA 3J80i 1C7YA 1EIYB 4JI0L 1Q86C 1PH4A 3FKIH 1B8AA 4JI4Q 1VQ4A 2CCZA 3IRBA 2R7FA 4NXNL 3H3VH 1EOVA 2WP8J 4DV5Q 1LYLA 4L5QA 4HJ7A 2Y0SE 5AJ3L 3GTOH 4GKJQ 1ASYA 3J81i 3ULPA 4BBSH 3BJUA 3PIPA 2E2JH 1VQDA 1YVCA 3KJPA 4JYAQ 4HJ9A 1XTDA 2ZTCA 2VS1A 4DV4L 2IY5B 4AIMA 5J3BA 4OWWB 4DR5Q 2UXBL 5C44G 3CCUA 3S1MH 4MNOA 1BVSA 1TWFH 4UP7A 4A4IA 1V1QA 4JV5L 2A19A 3RLOA 4YY3L 2PNHA 4GOPC 4R4CA 1WFQA 1RL2A 1VQFA 4DR2L 2NVTH 2WAQG 2D0OA 3E0EA 3EBEA 3RNUA 4BY1H 3K7UC 2VL6A 4JCVE 1XMOL 1PH6A 4LF5Q 2R92H 5LMUL 1JJGA 1IBKL 3M4PA 5C0XJ 3HOZG 4DKAC 1HR0L 5HY6A 4A3MH 3M7NA 4X6AH 4HIOA 5C0XG 1PFSA 4OWTB 4A76A 4P74A 1N34Q 1R9TH 1TWCH 3H0GG 2Q2IA 3NBHB 1Q46A 5LMNL 2HIVA 4Y52H 1YJ9A 3KDFA 2NN6I 4HJ8A 1Y14B 3ZJYC 5IYDG 3F2BA 4OWXB 4DV6Q 1IL2A 1M90C 2CKZB 3K8AA 4JI8L 5M5WH 1XNRQ 4WJ4A 2I5HA 1NJIC 3W5OA 3J7ZC 1Y1VH 4LUOA 3A5UA 4JC0A 4DR4Q 2BH8A 1O7IA 2HT1A 1KXLA 1A0IA 4OXPA 1IBLQ 3CPWA 1VQPA 1A8VA 1E1OA 2WFWA 1A63A 2ID0A 1X6OA 1C9OA 2GVBA 2MO1A 5ELNA 4Y7NH 2E2HH 1GD7A 4B3TQ 1K83H 4TVAB 2EXDA 2Q2TA 4DK3C 2F4VL 4B3RL 1XPUA 1E22A 1PH3A 4NXMQ 4YCVA 4X62Q 3S17H 2YTXA 2HIXA 4LFCL 4A93G 5M5XH 2K5VA 4POFA 2CWAA 1EYGA 2ZTEA 4EQ5A 2UUCQ 1UE7A 4LWCA 4A3FG 4H02A 1YHBA 4DR7L 2QA4A 2Z0SA 2PI2E 4AH6A 1WI5A 3FP9A 2QEXA 3CCJA 4AYBG 4C3JH 5C4JH 2YTYA 4OO1I 2K5HA 5M5YH 2HHHQ 1I3QH 3T1YL 3K80C 5FLMH 4JOIC 4HIMA 1J5EL 4B3SL 4DAMA 1EIFA 5IWAQ 5GAHC 4A3BH 4BBRH 4X65Q 3GTLH 4PZ7A 4PZ6A 4BBSG 5K36G 1S3OA 1Y1VG 1D7QA 2R6GA 4DR6Q 3W1GA 4KLKA 4LFAQ 4XIGS 2ZM6L 1QVGA 3ERSX 1MJEA 4LF6Q 3S1NH 4DV2L 4DV7Q 3HOWH 3PSIA 1K3RA 3G48A 1OTCA 4DV3L 4JI0Q 1VQGA 3MEFA 4JI4L 1OXXK 4GLXA 4JOIA 4KHZA 2ASBA 3GTKH 4BXXH 5IP7G 1YIJA 1P16A 3S15H 4NXNQ 2QGQA 2DGYA 3M4QA 1KRTA 1X3EA 1P8LA 1QVFA 3KF6A 4JV5Q 4GLAC 4LFBQ 5C3EG 5JJIA 4JI7L 4JYAL 1MKHA 5JJKA 1JT8A 4DV4Q 2ATWA 4IO9A 3OW2A 1MIUA 3J80c 1N8RC 3G6EA 2LXKA 3ULJA 4A3JG 4HJ5A 2R7ZH 4JI3L 2AWOA 1I50H 1U0LA 4HIKA 2R93H 4YY3Q 4FDBA 2E5LQ 2N8NA 3ICEA 4OO1G 1UEBA 2YTVA 3Q8DA 5LMNW 5FLXc 1UE6A 4J15A 2BA1A 4IPHA 3T1HQ 2VUMG 1PH1A 2Q2HA 4A3IG 3PO3G 2JK8A 1PH5A 1B7YB 4LW1A 4GN4B 4X66L 3TS2A 3GO5A 3KYHC 1NY4A 4A3EH 1WOCA 3EN2A 2EIFA 2CFMA 4P75A 2RHSB 3CXCA 1QUQA 1FL0A 1VQOA 3HOYG 3CD6A 4QQBX 4O0AA 4LF9Q 1CKNA 4P73A 2OTJA 3HKZG 1OXSC 5LMNQ 2KENA 3PGZA 3H15A 2VZAA 2YYZA 3F1ZA 2JA5H 5C3EH 2ALYB 1SLJA 2MFIA 5GROA 4JI8Q 5E7NA 3GD7A 4QIWE 3UE0A 3U58A 4IPCA 3RN5A 2PMZE 2F3IA 1BBUA 1CSPA 4R4QA 1VQNA 4P72A 1K9MC 2NVYH 1E3PA 4DR4L 2N3SA 2R7ZG 1SR3A 1PA6A 3RLNA 3ER0A 2KHIA 3CF5A 3DM3A 1Z47A 4GLVB 2RCNA 3ULLA 5FLMG 1K73C 1ASZA 1Q7YC 4GOPA 1QZGA 4PMWA 4LF4Q 4B3TL 2JQOA 2F4VQ 5GAEC 1NE3A 4B3RQ 3HOZH 4NXML 1LM0A 2L15A 4BA1I 5IY0A 4X62L 4IPGA 2UUAQ 2PQAA 4JBWA 4MTNA 1GKHA 3S2HH 1W2BA 3CC7A 1S72A 3UDXA 2KHJA 4O2DA 4DR7Q 1KC8C 4AQYL 3BZKA 4YCWA 4A3MG 1JB7A 3HOWG 4A3BG 1VQJA 1VQ9A 4IPDA 1PHJA 5IYCH 1OXVA 4DUYL 1N9WA 3NEMA 3T1YQ 1HZBA 3M9BA 1J5EQ 1VQ8A 2ZJRA 3HOVH 4KI0A 2AMCB 4JI2Q 4X65L 3CCMA 2JJQA 3OYYA 5IYDH 4HIDA 3HOUG 2XGTA 1VQBA 3CAMA 1Y1WH 4GN5A 2K14A 4BXXG 1SROA 5M3FH 3HKZE 4JBJA 3RLFA 2VQEL 2ZM6Q 5FJ8H 4LNQA 3K81C 3JAMi 4LF6L 4A93H 2VNUD 4DV7L 4X64L 1I5FA 2WB1G 1JE5A 1HZCA 3BZCA 3L7ZC 3F2DA 3CPFA 4DV3Q 2OCEA 1UWVA 2WB1E 3PIOA 1IZ6A 4BY7G 2IT1A 3H3VI 4JI1L 1NTGA 3PF5A 1I94Q 4RG1A 4C2MH 4A3DG 3F8TA 1KD1C 4LFBL 1BKBA 4JI7Q 4L5RC 1X65A 3LGJA 1VQ6A 1YI2A 4IJLA 1IYJB 1TWGH 3KOJA 3OTOQ 1Z9FA 4GN3B 5GQOA 2NVXH 2IX0A 1PYBA 2N78A 4YCUA 2F52A 4JG2A 1VQKA 1K8AC 4JI3Q 3U4VA 1FJGL 2IHEA 1N33L 2MQHA 4A3EG 3HOVG 2N49A 2B3GA 4QJFA 2E5LL 2BH2A 2VQFQ 3H0GH 4LUZA 4NPSA 1NMFA 1YEZA 2RF4A 2Y0SG 3CCRA 3T1HL 3HOYH 2I5MX 2LSSA 2PI2A 3GTJH 1VQMA 1UE5A 3CCVA 3TEHB 5FJ8G 4X66Q 4GOPB 2B29A 3RN2A 2ZJPA 1EFWA 4B3ML 4WJ3M 1E7ZA 3I55A 3GDEA 4JBMA 3CC4A 3CQZH 4A3LG 4IFDG 4R4IA 5C4XG 1QZHA 1H95A 2H5XA 1E1TA 4YWKA 3U50C 1Q1BA 2C35B 3HKSA 3KJOA 2MO0A 1XPOA 1AE3A 5JJLA 4K0KQ 1N36L 1WCMG 4DV0Q 4OX9Q 1IXRA 1V9PA 2WAQE 1JJCB 4GNXA 2NVQH 2R7DA 3S2DH 3KLWA 2JA7H 4RMFA 4A3KH 1YBYA 4L5SA 4IOCA 5IE8A 1Q82C 2JEAI 1K8GA 1KHIA 4DK6C 1M1KC 4NB3A 1SMXA 1SFOH 3G4SA 4LF4L 2VY3A 4JI6L 4LF9L 1U5KA 2JA8G 5IYBH 1QVCA 2K50A 3STBD 4JI5L 2AHOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE8 A;  4A3G H;  4EX5 A;  3M3Y H;  4IFD I;  1VQA A;  2UUA L;  1D8L A;  5ELO A;  2OWO A;  1AH9 A;  1IBM Q;  2VUM H;  3S1Q H;  1OXT A;  1LTL A;  1XMQ L;  3PO2 G;  3KDF B;  3HOX G;  1DGS A;  1T9H A;  3JC6 6;  2D0P A;  3TRE A;  4DUZ L;  4AQY Q;  2AKW B;  2JA6 H;  3STB C;  3UDG A;  4ME3 A;  3I4M G;  3I4N H;  1PYS B;  4DUY Q;  4GNX B;  5M3M G;  2BA0 A;  4R1J A;  5BR8 L;  1XNQ L;  3CCL A;  2B63 G;  3VDY A;  3BU2 A;  3U4Z A;  3L2P A;  1HNZ Q;  3CCE A;  4LF8 Q;  4JI2 L;  2Z6K A;  2IX1 A;  4C3I H;  3PUZ A;  1N32 L;  4XTC S;  1HNX L;  4JBK A;  2K75 A;  2R92 G;  2JA5 G;  2DUD A;  1EQR A;  2CQO A;  4OON A;  4DAY B;  4DR1 Q;  3UDF A;  1PH9 A;  1HR0 W;  3TRZ A;  2UXC L;  2VQE Q;  2ZJQ A;  4POG A;  3J7A 5;  2OQ0 A;  3PV0 A;  3CME A;  2JA8 H;  4X64 Q;  3I4O A;  4A3D H;  3FHW A;  2Z6K C;  3AFQ A;  3A74 A;  5IT9 c;  4KHP L;  3F2C A;  1L1O C;  2KCM A;  4JI1 Q;  1I94 L;  1OXU A;  1A62 A;  2R93 G;  5IP9 H;  4YHH L;  3I56 A;  1LUZ A;  2JE6 I;  1QUQ B;  3D31 A;  3AEV A;  2ZTD A;  3K0X A;  4LF7 Q;  3S14 H;  1CKN B;  2UUB Q;  2CWP A;  4DR3 L;  1AE2 A;  4GKK L;  4PZ8 A;  3AFP A;  3PUW A;  2E2I H;  1RIP A;  1X56 A;  1HZA A;  3OTO L;  2JA6 G;  3I4M H;  3NEN A;  1I6H H;  3A0J A;  1G29 1;  4YWM A;  3CP0 A;  4A3L H;  1TXY A;  1UE1 A;  5EAY A;  1FJG Q;  2UU9 Q;  1TWH H;  1PH8 A;  1EUJ A;  1N33 Q;  4L5T A;  1Y1W G;  1YIT A;  2K52 A;  2LXJ A;  3S1R H;  2VQF L;  1VQI A;  3TS0 A;  1WYD A;  3J81 c;  1L0W A;  3M85 A;  3NEL A;  2E8G A;  1YZ6 A;  2YV5 A;  1W3S A;  1J6Q A;  2KCT A;  2AWN A;  2RHQ B;  2UXD L;  2VW9 A;  3RR5 A;  2A8V A;  1HNW L;  1Q1E A;  4QY7 A;  4C3H H;  4QGU A;  4UPA A;  5M3F G;  4DV1 L;  2JEB I;  4A3C G;  2NZO A;  1JJ2 A;  4B3M Q;  4DNI A;  4UP8 A;  4GNX C;  1VS0 A;  4BY7 H;  3KF6 B;  4PG3 A;  2JA7 G;  3GTM H;  1VQC A;  5JEA G;  2NN6 G;  1SRU A;  1KQS A;  1WJJ A;  2GVA A;  4BBR G;  5IP9 G;  1GO3 E;  3UDI A;  2I5L X;  3PCO B;  2MNA A;  4K0K L;  1N36 Q;  4DV0 L;  4DV5 L;  4OX9 L;  5GAD C;  5GAG C;  5AJ3 Q;  1YHA A;  3CCS A;  4GKJ L;  1CKM A;  1SN8 A;  1XJV A;  3PO2 H;  1FGU A;  1G6P A;  3J81 j;  5IYB G;  3S16 H;  2K4K A;  3S24 A;  4LUV A;  4YWL A;  3RZO H;  1V43 A;  5JEA J;  2ES2 A;  1GVP A;  1X3F A;  5M3M H;  4DR5 L;  2UXB Q;  3I7F A;  2I0Q A;  3HOX H;  4JI6 Q;  5IP7 H;  5IYC G;  5C0X I;  1YHQ A;  4JI5 Q;  3PUX A;  3FKI G;  4GS3 A;  1L2F A;  4DR2 Q;  2FXQ A;  3HFZ B;  4R4O A;  3E9H A;  1IBM L;  1HJP A;  4LF5 L;  1CUK A;  1XMO Q;  3HOU H;  1NMG A;  1XMQ Q;  2K5N A;  5LMU Q;  1IBK Q;  3SGI A;  4A3J H;  1HR0 Q;  4DUZ Q;  3D0F A;  1X3G A;  2YU9 H;  2HQL A;  4BY1 G;  4BA2 I;  1X9N A;  1N34 L;  2JA9 A;  3MXN B;  3PUY A;  5BR8 Q;  5C44 H;  1PH7 A;  1XNQ Q;  1TWA H;  1CSQ A;  1VQH A;  3KFU A;  1Q12 A;  4HJA A;  1Q8K A;  1HNZ L;  3CCQ A;  1VQ7 A;  4LF8 L;  1N32 Q;  3WWV A;  1EQQ A;  1VCI A;  2NZH A;  2XTI A;  1BBW A;  4DV6 L;  4A3I H;  1L1O A;  1HNX Q;  3DLL A;  3PO3 H;  1PV4 A;  1WCM H;  4DR1 L;  2UXC Q;  4UP9 A;  2EQS A;  3GTP H;  1XNR L;  1C0A A;  2IHF A;  1JMC A;  1G51 A;  1EWI A;  1PVO A;  4P71 A;  4TQU S;  4A3K G;  3E9I A;  2PQA B;  1YNX A;  4AYB E;  1YJN A;  1IBL L;  1VQ5 A;  1L1O B;  3JAM c;  4KHP Q;  5H1S E;  1HZ9 A;  3A5Z B;  3AYH B;  2GN5 A;  3UE1 A;  2OTL A;  3CC2 A;  4YHH Q;  4ALP A;  1B70 B;  4A3G G;  3G71 A;  4LF7 L;  4LFC Q;  1X55 A;  4A75 A;  2UUB L;  4IFD J;  4DR3 Q;  1PH2 A;  4GKK Q;  1E24 A;  2UUC L;  4QL5 A;  2Q2U A;  1K0R A;  1VQE A;  4IJH A;  3L0O A;  5DLQ E;  5HGQ A;  4R4T A;  3PUV A;  3TQY A;  3W1B A;  3PF4 A;  3GTG H;  1VQL A;  2D62 A;  1KAW A;  2UU9 L;  3I4N G;  3M4O H;  4A3C H;  2A1A A;  2HHH L;  3AQQ A;  2KBN A;  2B63 H;  4B3S Q;  5IWA L;  3EIV A;  1KL9 A;  5C4X H;  3GTQ H;  1Q81 C;  1XPR A;  3KF8 B;  1CKO A;  4A3F H;  4UY8 C;  2OQK A;  3K7A H;  2V1C C;  1S40 A;  1NBW A;  2UXD Q;  3CW2 C;  4DPG A;  1FVI A;  1HNW Q;  4DV1 Q;  1YJW A;  1MJC A;  1X54 A;  3CMA A;  4DR6 L;  4MZ9 A;  1GM5 A;  4LFA L;  3I2Z A;  3RZD H;  1KIX A;  1HH2 P;  3B6Y A;  1KRS A;  4DV2 Q;  4APV A;  4IOA A;  3J80 i;  1C7Y A;  1EIY B;  4JI0 L;  1Q86 C;  1PH4 A;  3FKI H;  1B8A A;  4JI4 Q;  1VQ4 A;  2CCZ A;  3IRB A;  2R7F A;  4NXN L;  3H3V H;  1EOV A;  2WP8 J;  4DV5 Q;  1LYL A;  4L5Q A;  4HJ7 A;  2Y0S E;  5AJ3 L;  3GTO H;  4GKJ Q;  1ASY A;  3J81 i;  3ULP A;  4BBS H;  3BJU A;  3PIP A;  2E2J H;  1VQD A;  1YVC A;  3KJP A;  4JYA Q;  4HJ9 A;  1XTD A;  2ZTC A;  2VS1 A;  4DV4 L;  2IY5 B;  4AIM A;  5J3B A;  4OWW B;  4DR5 Q;  2UXB L;  5C44 G;  3CCU A;  3S1M H;  4MNO A;  1BVS A;  1TWF H;  4UP7 A;  4A4I A;  1V1Q A;  4JV5 L;  2A19 A;  3RLO A;  4YY3 L;  2PNH A;  4GOP C;  4R4C A;  1WFQ A;  1RL2 A;  1VQF A;  4DR2 L;  2NVT H;  2WAQ G;  2D0O A;  3E0E A;  3EBE A;  3RNU A;  4BY1 H;  3K7U C;  2VL6 A;  4JCV E;  1XMO L;  1PH6 A;  4LF5 Q;  2R92 H;  5LMU L;  1JJG A;  1IBK L;  3M4P A;  5C0X J;  3HOZ G;  4DKA C;  1HR0 L;  5HY6 A;  4A3M H;  3M7N A;  4X6A H;  4HIO A;  5C0X G;  1PFS A;  4OWT B;  4A76 A;  4P74 A;  1N34 Q;  1R9T H;  1TWC H;  3H0G G;  2Q2I A;  3NBH B;  1Q46 A;  5LMN L;  2HIV A;  4Y52 H;  1YJ9 A;  3KDF A;  2NN6 I;  4HJ8 A;  1Y14 B;  3ZJY C;  5IYD G;  3F2B A;  4OWX B;  4DV6 Q;  1IL2 A;  1M90 C;  2CKZ B;  3K8A A;  4JI8 L;  5M5W H;  1XNR Q;  4WJ4 A;  2I5H A;  1NJI C;  3W5O A;  3J7Z C;  1Y1V H;  4LUO A;  3A5U A;  4JC0 A;  4DR4 Q;  2BH8 A;  1O7I A;  2HT1 A;  1KXL A;  1A0I A;  4OXP A;  1IBL Q;  3CPW A;  1VQP A;  1A8V A;  1E1O A;  2WFW A;  1A63 A;  2ID0 A;  1X6O A;  1C9O A;  2GVB A;  2MO1 A;  5ELN A;  4Y7N H;  2E2H H;  1GD7 A;  4B3T Q;  1K83 H;  4TVA B;  2EXD A;  2Q2T A;  4DK3 C;  2F4V L;  4B3R L;  1XPU A;  1E22 A;  1PH3 A;  4NXM Q;  4YCV A;  4X62 Q;  3S17 H;  2YTX A;  2HIX A;  4LFC L;  4A93 G;  5M5X H;  2K5V A;  4POF A;  2CWA A;  1EYG A;  2ZTE A;  4EQ5 A;  2UUC Q;  1UE7 A;  4LWC A;  4A3F G;  4H02 A;  1YHB A;  4DR7 L;  2QA4 A;  2Z0S A;  2PI2 E;  4AH6 A;  1WI5 A;  3FP9 A;  2QEX A;  3CCJ A;  4AYB G;  4C3J H;  5C4J H;  2YTY A;  4OO1 I;  2K5H A;  5M5Y H;  2HHH Q;  1I3Q H;  3T1Y L;  3K80 C;  5FLM H;  4JOI C;  4HIM A;  1J5E L;  4B3S L;  4DAM A;  1EIF A;  5IWA Q;  5GAH C;  4A3B H;  4BBR H;  4X65 Q;  3GTL H;  4PZ7 A;  4PZ6 A;  4BBS G;  5K36 G;  1S3O A;  1Y1V G;  1D7Q A;  2R6G A;  4DR6 Q;  3W1G A;  4KLK A;  4LFA Q;  4XIG S;  2ZM6 L;  1QVG A;  3ERS X;  1MJE A;  4LF6 Q;  3S1N H;  4DV2 L;  4DV7 Q;  3HOW H;  3PSI A;  1K3R A;  3G48 A;  1OTC A;  4DV3 L;  4JI0 Q;  1VQG A;  3MEF A;  4JI4 L;  1OXX K;  4GLX A;  4JOI A;  4KHZ A;  2ASB A;  3GTK H;  4BXX H;  5IP7 G;  1YIJ A;  1P16 A;  3S15 H;  4NXN Q;  2QGQ A;  2DGY A;  3M4Q A;  1KRT A;  1X3E A;  1P8L A;  1QVF A;  3KF6 A;  4JV5 Q;  4GLA C;  4LFB Q;  5C3E G;  5JJI A;  4JI7 L;  4JYA L;  1MKH A;  5JJK A;  1JT8 A;  4DV4 Q;  2ATW A;  4IO9 A;  3OW2 A;  1MIU A;  3J80 c;  1N8R C;  3G6E A;  2LXK A;  3ULJ A;  4A3J G;  4HJ5 A;  2R7Z H;  4JI3 L;  2AWO A;  1I50 H;  1U0L A;  4HIK A;  2R93 H;  4YY3 Q;  4FDB A;  2E5L Q;  2N8N A;  3ICE A;  4OO1 G;  1UEB A;  2YTV A;  3Q8D A;  5LMN W;  5FLX c;  1UE6 A;  4J15 A;  2BA1 A;  4IPH A;  3T1H Q;  2VUM G;  1PH1 A;  2Q2H A;  4A3I G;  3PO3 G;  2JK8 A;  1PH5 A;  1B7Y B;  4LW1 A;  4GN4 B;  4X66 L;  3TS2 A;  3GO5 A;  3KYH C;  1NY4 A;  4A3E H;  1WOC A;  3EN2 A;  2EIF A;  2CFM A;  4P75 A;  2RHS B;  3CXC A;  1QUQ A;  1FL0 A;  1VQO A;  3HOY G;  3CD6 A;  4QQB X;  4O0A A;  4LF9 Q;  1CKN A;  4P73 A;  2OTJ A;  3HKZ G;  1OXS C;  5LMN Q;  2KEN A;  3PGZ A;  3H15 A;  2VZA A;  2YYZ A;  3F1Z A;  2JA5 H;  5C3E H;  2ALY B;  1SLJ A;  2MFI A;  5GRO A;  4JI8 Q;  5E7N A;  3GD7 A;  4QIW E;  3UE0 A;  3U58 A;  4IPC A;  3RN5 A;  2PMZ E;  2F3I A;  1BBU A;  1CSP A;  4R4Q A;  1VQN A;  4P72 A;  1K9M C;  2NVY H;  1E3P A;  4DR4 L;  2N3S A;  2R7Z G;  1SR3 A;  1PA6 A;  3RLN A;  3ER0 A;  2KHI A;  3CF5 A;  3DM3 A;  1Z47 A;  4GLV B;  2RCN A;  3ULL A;  5FLM G;  1K73 C;  1ASZ A;  1Q7Y C;  4GOP A;  1QZG A;  4PMW A;  4LF4 Q;  4B3T L;  2JQO A;  2F4V Q;  5GAE C;  1NE3 A;  4B3R Q;  3HOZ H;  4NXM L;  1LM0 A;  2L15 A;  4BA1 I;  5IY0 A;  4X62 L;  4IPG A;  2UUA Q;  2PQA A;  4JBW A;  4MTN A;  1GKH A;  3S2H H;  1W2B A;  3CC7 A;  1S72 A;  3UDX A;  2KHJ A;  4O2D A;  4DR7 Q;  1KC8 C;  4AQY L;  3BZK A;  4YCW A;  4A3M G;  1JB7 A;  3HOW G;  4A3B G;  1VQJ A;  1VQ9 A;  4IPD A;  1PHJ A;  5IYC H;  1OXV A;  4DUY L;  1N9W A;  3NEM A;  3T1Y Q;  1HZB A;  3M9B A;  1J5E Q;  1VQ8 A;  2ZJR A;  3HOV H;  4KI0 A;  2AMC B;  4JI2 Q;  4X65 L;  3CCM A;  2JJQ A;  3OYY A;  5IYD H;  4HID A;  3HOU G;  2XGT A;  1VQB A;  3CAM A;  1Y1W H;  4GN5 A;  2K14 A;  4BXX G;  1SRO A;  5M3F H;  3HKZ E;  4JBJ A;  3RLF A;  2VQE L;  2ZM6 Q;  5FJ8 H;  4LNQ A;  3K81 C;  3JAM i;  4LF6 L;  4A93 H;  2VNU D;  4DV7 L;  4X64 L;  1I5F A;  2WB1 G;  1JE5 A;  1HZC A;  3BZC A;  3L7Z C;  3F2D A;  3CPF A;  4DV3 Q;  2OCE A;  1UWV A;  2WB1 E;  3PIO A;  1IZ6 A;  4BY7 G;  2IT1 A;  3H3V I;  4JI1 L;  1NTG A;  3PF5 A;  1I94 Q;  4RG1 A;  4C2M H;  4A3D G;  3F8T A;  1KD1 C;  4LFB L;  1BKB A;  4JI7 Q;  4L5R C;  1X65 A;  3LGJ A;  1VQ6 A;  1YI2 A;  4IJL A;  1IYJ B;  1TWG H;  3KOJ A;  3OTO Q;  1Z9F A;  4GN3 B;  5GQO A;  2NVX H;  2IX0 A;  1PYB A;  2N78 A;  4YCU A;  2F52 A;  4JG2 A;  1VQK A;  1K8A C;  4JI3 Q;  3U4V A;  1FJG L;  2IHE A;  1N33 L;  2MQH A;  4A3E G;  3HOV G;  2N49 A;  2B3G A;  4QJF A;  2E5L L;  2BH2 A;  2VQF Q;  3H0G H;  4LUZ A;  4NPS A;  1NMF A;  1YEZ A;  2RF4 A;  2Y0S G;  3CCR A;  3T1H L;  3HOY H;  2I5M X;  2LSS A;  2PI2 A;  3GTJ H;  1VQM A;  1UE5 A;  3CCV A;  3TEH B;  5FJ8 G;  4X66 Q;  4GOP B;  2B29 A;  3RN2 A;  2ZJP A;  1EFW A;  4B3M L;  4WJ3 M;  1E7Z A;  3I55 A;  3GDE A;  4JBM A;  3CC4 A;  3CQZ H;  4A3L G;  4IFD G;  4R4I A;  5C4X G;  1QZH A;  1H95 A;  2H5X A;  1E1T A;  4YWK A;  3U50 C;  1Q1B A;  2C35 B;  3HKS A;  3KJO A;  2MO0 A;  1XPO A;  1AE3 A;  5JJL A;  4K0K Q;  1N36 L;  1WCM G;  4DV0 Q;  4OX9 Q;  1IXR A;  1V9P A;  2WAQ E;  1JJC B;  4GNX A;  2NVQ H;  2R7D A;  3S2D H;  3KLW A;  2JA7 H;  4RMF A;  4A3K H;  1YBY A;  4L5S A;  4IOC A;  5IE8 A;  1Q82 C;  2JEA I;  1K8G A;  1KHI A;  4DK6 C;  1M1K C;  4NB3 A;  1SMX A;  1SFO H;  3G4S A;  4LF4 L;  2VY3 A;  4JI6 L;  4LF9 L;  1U5K A;  2JA8 G;  5IYB H;  1QVC A;  2K50 A;  3STB D;  4JI5 L;  2AHO B; 
#chains in the Genus database with same CATH topology
 1SE8 A;  1Z7T A;  4A3G H;  2DJG C;  4E6I A;  2Z1C A;  1VQA A;  5ELO A;  2OWO A;  3QO2 A;  1ONL A;  1OXT A;  4HTH A;  1XMQ L;  1TT2 A;  1EY0 A;  2NVY B;  4CDC C;  2VXW A;  1O7Y A;  2JA6 H;  3STB C;  1LV9 A;  3H91 A;  4ME3 A;  5CV9 A;  3I4M G;  1PYS B;  1I50 B;  5M3M G;  2BA0 A;  1Y8N B;  1VF5 C;  4KJO A;  3BU2 A;  5EKI A;  3U4Z A;  3L2P A;  1HNX L;  1B9N A;  2K75 A;  2MP1 A;  4ODG A;  2DUD A;  2CQO A;  3UDF A;  5BN5 A;  1PH9 A;  4X3K A;  4POG A;  2XSC A;  2E75 C;  1HUN A;  2MGS A;  2JA8 H;  4X64 Q;  3FHW A;  5DM6 3;  1TQO A;  1L1O C;  5IP9 H;  4YHH L;  4CJ1 B;  1LUZ A;  1QUQ B;  2HD3 A;  2XN9 C;  5M3F B;  3AEV A;  3K0X A;  1CFM A;  2IPK D;  1EWC A;  1SJH D;  4DR3 L;  4GKK L;  1EYC A;  2R92 B;  3AFP A;  3BVZ A;  1RIP A;  3O13 A;  2EYJ A;  4CHT B;  1GXD C;  1G29 1;  1STB A;  3SHL A;  3CP0 A;  1TXY A;  1FJG Q;  1TWH H;  1EUJ A;  3V05 A;  1QNU A;  2K52 A;  3C1F A;  5ELC A;  1EY5 A;  5IT9 E;  3DMU A;  3M85 A;  1W3S A;  4QGU A;  4BBS B;  4DNI A;  2M9V A;  2E2J B;  4ZCK A;  1VS0 A;  1NR4 A;  4PG3 A;  3K58 A;  2RKS A;  1EIG A;  1WJJ A;  5IP9 G;  1V1P B;  5BN3 A;  4IQZ A;  4X3T A;  3PCO B;  3EVQ A;  1F77 A;  1N36 Q;  5GAD C;  3CCS A;  4GKJ L;  3A7A B;  4K2L A;  5M5X B;  3S24 A;  1WTQ A;  2PW5 A;  4LUV A;  1EU3 A;  1V43 A;  1H9J A;  4YWL A;  4KMU C;  1DD2 A;  3OIQ A;  3KK7 A;  4C3J B;  1ILP A;  4DAY A;  5CYU A;  5IGC A;  5C0X I;  5KYI A;  4TSS A;  4DR2 Q;  4EQN A;  2ENB A;  5CC4 A;  5DEH A;  3KLS A;  5I6Y A;  4A3K B;  1XYI A;  2C9O A;  1XMQ Q;  1QIL A;  4J6H A;  1K28 A;  4A3J H;  1HR0 Q;  1F2Z A;  2KHS A;  4BY1 G;  3Q6S A;  1IL8 A;  1X9N A;  3A54 A;  3I3C A;  3S1N B;  1XNQ Q;  3KFU A;  3CHB D;  1VQH A;  1Q12 A;  2MUY A;  3M3Y B;  4B08 A;  4DXF A;  3WWV A;  4Y7N B;  2NZH A;  1HNX Q;  3DLL A;  5FLX E;  3MWY W;  3WOE A;  1DCZ A;  1WCM H;  1CQV A;  2EQS A;  1XNR L;  1C0A A;  1EU4 A;  1EWI A;  1RF2 D;  1YNX A;  2K33 A;  4KHP Q;  5IGF A;  2GN5 A;  4NP5 A;  3UE1 A;  3NWS A;  2OTL A;  1L0Y B;  3OWF A;  4U68 A;  3DXJ C;  4H44 C;  1VDZ A;  3G71 A;  4DR3 Q;  1G8Z D;  1E24 A;  3P7J A;  4IJH A;  1B53 A;  3L0O A;  5DLQ E;  3W1B A;  1VMC A;  5KIX A;  1PLF A;  4XQN A;  4OHJ A;  4C3H G;  1A3V A;  2A1A A;  2CW0 D;  2KBN A;  3DEP A;  4B3S Q;  4XXE A;  5KNC A;  3GTQ H;  1Q81 C;  3KF8 B;  3NHH A;  2OQK A;  4DK0 A;  1S40 A;  1NBW A;  2D2C C;  4FXG C;  1MJC A;  3CMA A;  4KN7 C;  4MZ9 A;  3I2Z A;  4OO1 H;  4MHE A;  2Q8T A;  2RDH A;  1HTL D;  4HAE A;  2QW7 A;  3J80 i;  2JYO A;  1EIY B;  3FKI H;  4XYQ A;  2CCZ A;  1A15 A;  3IRB A;  3H3V H;  1A2T A;  1EOV A;  4RAU C;  5EBC A;  3FMC A;  1FNW A;  2J0T D;  3PIP A;  1YVC A;  2NZ1 D;  4JYA Q;  4ZYS A;  5J3B A;  1GUN A;  1B50 A;  2K5W A;  4A4I A;  1V1Q A;  2JXM B;  1JOK A;  1H9K A;  1ENC A;  1VQF A;  2WAQ G;  4DR2 L;  3RNU A;  5JVH 3;  4JCV E;  2R92 H;  3S16 B;  2K01 A;  3M4P A;  4ZLT F;  3IKJ A;  1NR2 A;  2FIN B;  4RA8 A;  4L8J A;  2EJG C;  4HIO A;  4OWT B;  1R9T H;  1TWC H;  2F0G A;  5E1F A;  2Q2I A;  1Q46 A;  4H0L C;  5IGE A;  4Q0F A;  1SNM A;  3F2B A;  5E4W C;  1IL2 A;  4C2M B;  1M90 C;  2CKZ B;  5CV4 A;  1D5X C;  1XNR Q;  1WTV A;  1O7L A;  4KTA A;  3J7Z C;  3MC0 B;  4LUO A;  1FNV A;  4OIJ A;  1O7I A;  1YNN C;  1A3T A;  1VQP A;  2WFW A;  3QJY A;  4IN3 A;  1C9O A;  1GOZ A;  5ELN A;  4DK3 C;  4CDD C;  2F0P A;  4YCV A;  2QEJ C;  4KHV A;  1B9M A;  2NTT A;  2CWA A;  2KOL A;  2ZT9 C;  2ZTE A;  2PQE A;  3ZYY X;  5EJW A;  4JK1 C;  4DR7 L;  1DYQ A;  3D3R A;  4UAI A;  2YTY A;  2M2L A;  4OO1 I;  3TBI B;  4KY6 A;  1EIH A;  3CQZ B;  1I3Q H;  3K80 C;  2WKD A;  4A3B H;  3K5O A;  5ELD A;  3S9W A;  1O78 A;  5K36 G;  3IFD A;  1D7Q A;  3I91 A;  1ESF A;  2R6G A;  4LMQ D;  2ZM6 L;  3S1N H;  3HOW H;  5J1Z A;  4DV3 L;  4ZQ3 A;  3MEF A;  2ASB A;  4JOI A;  2I46 A;  1P8L A;  2MHV A;  3KF6 A;  3R2T A;  3MXG A;  4GLA C;  5C3E G;  1ICF B;  1H9M A;  2EJM A;  3OW2 A;  3LWU A;  4C3J G;  3G6E A;  1K8M A;  1STH A;  1BCP B;  3ULJ A;  4HJ5 A;  5FO8 B;  5LHY 1;  1U0L A;  4HIK A;  2A6H C;  4YY3 Q;  2R93 H;  4F7X A;  4OO1 G;  1UEB A;  1PRT C;  1UE6 A;  4F87 A;  4J15 A;  2BA1 A;  3T1H Q;  2VUM G;  3TP7 A;  4A3I G;  3D6W A;  2F0H A;  4LW1 A;  4GN4 B;  1D1K A;  3TME A;  4X66 L;  4G7H C;  4A3E H;  3GTG B;  5I4D A;  3EN2 A;  4P75 A;  1QUQ A;  1FL0 A;  1VQO A;  4QQB X;  2PYK A;  2OTJ A;  3ND9 A;  4KK7 A;  1WVL A;  3H15 A;  5ELB A;  2YYZ A;  3F1Z A;  2KCC A;  2ALY B;  4TKO B;  5KRU A;  2F1M A;  3T16 A;  4DN4 M;  4QIW E;  4ABN A;  4A3M B;  2PMZ E;  2F3I A;  2E2I B;  1K9M C;  2NVY H;  1ENA A;  2F0W A;  3RLN A;  1PA6 A;  5JOB A;  3X3M A;  1Y69 U;  3CF5 A;  1Z47 A;  4LF9 Q;  1K73 C;  1Q7Y C;  1GUS A;  2ICE C;  4KV6 A;  4B3R Q;  3FVQ A;  3HKZ B;  4NXM L;  1H9R A;  3A55 A;  1BOS A;  5IY0 A;  1EFI D;  5M5W B;  2UUA Q;  2PQA A;  2RA4 A;  4MTN A;  1BQQ T;  4RHS A;  1SNO A;  2JSO A;  3MEH A;  1S72 A;  2KHJ A;  1CTM A;  2F0S A;  1BBX C;  3HOW G;  2BDN A;  1B3Q A;  1VQJ A;  1GUO A;  1VQ9 A;  5KEE A;  1ROD A;  4DUY L;  5IOC A;  2MJ8 A;  4A3D B;  1VQ8 A;  3OOC A;  3GQB A;  2NVT B;  3HOV H;  4KI0 A;  1XX8 A;  1M8A A;  4BXX G;  1CM9 A;  1SRO A;  1IKM A;  3QOL A;  1CHQ D;  3CU7 A;  2VQE L;  1EL0 A;  1JIC A;  4LNQ A;  1WTR A;  2VNU D;  2Z8L A;  2AQ1 B;  3BZC A;  1EEF D;  2X69 A;  1UWV A;  4PMB A;  4ME5 A;  1WD1 A;  3H3V I;  1NTG A;  3PF5 A;  3CKI B;  4C2M H;  5DM7 3;  2NN6 H;  4XT3 B;  1HCZ A;  1BKB A;  1CA5 A;  1TWG H;  4GN3 B;  2N78 A;  2XWB B;  4JG2 A;  1JOO A;  4DK1 A;  3U4V A;  2IW3 A;  1F9R A;  4A3E G;  2E74 C;  3ITP A;  2F03 A;  5D3I B;  3GTM B;  1YEZ A;  3CCR A;  1EQT A;  1TS2 A;  3T1H L;  3HOY H;  2PI2 A;  1E2Z A;  3GTJ H;  1VQM A;  3HEJ A;  1UE5 A;  1ZKO A;  3SDZ A;  3GDE A;  2CHB D;  4JBM A;  4QB4 A;  1B4O A;  1I6V C;  3CC4 A;  3CQZ H;  1V8Q A;  5D14 A;  2H5X A;  3BG3 A;  1E1T A;  2PMZ B;  2K5Q A;  3DEO A;  3E3X A;  3RUZ A;  1HUM A;  3SVM A;  1S5B D;  4OX9 Q;  1IXR A;  2WAQ E;  3C3L A;  3KLW A;  1FNU A;  4S3S A;  1LT3 D;  3P20 A;  4RFB A;  1VF7 A;  3G7L A;  2RDG A;  3I70 A;  5IE8 A;  4HR7 B;  1Q82 C;  2A74 C;  1KHI A;  1K8G A;  2K5D A;  3GV6 A;  4F8M A;  3TSS A;  4LF9 L;  2JA8 G;  1U5K A;  5IYB H;  5JVG 3;  1BO0 A;  1LT5 D;  1TWA B;  3K5N A;  3D6C A;  2EJF C;  4EX5 A;  5C4X B;  2UUA L;  4FVM A;  3K5M A;  2VUM H;  1HQM C;  3C2P A;  3TRE A;  4DUZ L;  2F0Q A;  4AQY Q;  4EQP A;  3K6O A;  4IUV A;  3UDG A;  5COY A;  4GNX B;  2K1B A;  2R93 B;  5BR8 L;  2B63 G;  3FEW X;  3CCE A;  4JI2 L;  2Z6K A;  1N32 L;  4C3I H;  3PUZ A;  3SR1 A;  4FF1 A;  2EOT A;  4OON A;  4DR1 Q;  2B8F A;  1IW7 D;  4CDE C;  4L63 B;  5EPK A;  2ZJQ A;  3J7A 5;  1STG A;  4FXD A;  5ELE A;  1KAA A;  1CQF A;  1SYD A;  2CW0 C;  3J81 E;  3AFQ A;  2B2W C;  4DNR B;  3F2C A;  1TWF B;  2NYZ D;  2KCM A;  3I8Z A;  2WIN B;  3D31 A;  3HRZ C;  3S14 H;  5KNB A;  2B2T A;  2CWP A;  3PUW A;  2E2I H;  1X56 A;  1I6H H;  2JA6 G;  3I4M H;  4KKS A;  3ERO A;  3A0J A;  2EZV A;  2UU9 Q;  2LMC B;  3S1R H;  4K2K A;  5I2X A;  1R4P B;  2A73 B;  1VQI A;  1L0W A;  3NEL A;  2XVS A;  3DWP A;  2KCT A;  1J6Q A;  4C1N I;  2VW9 A;  2A8V A;  1HNW L;  1Q1E A;  1S5E D;  5M3F G;  4DV1 L;  4UP8 A;  1Y1V B;  4BY7 H;  4HCE A;  4GZY C;  3VR2 A;  1KQS A;  1F9P A;  5I9P A;  4BBR G;  1AN8 A;  3N52 A;  2I5L X;  3A7L A;  4ZRZ A;  1XXG A;  4DV0 L;  5IT9 L;  4OX9 L;  5AJ3 Q;  1YHA A;  1G6P A;  3VYU A;  5JEA J;  3HOX H;  4IUN A;  2NB0 A;  4TRD A;  1TWC B;  3PUX A;  5FLX L;  3C1E A;  1JWU D;  4R4O A;  2FFK B;  4IZ8 A;  1XMO Q;  2CQA A;  4C3I G;  5LMU Q;  4PV1 C;  3MZ5 A;  2HQL A;  3PUY A;  5BR8 Q;  1VMP A;  3T53 B;  4IFD H;  4A3G B;  5ISR A;  4HJA A;  1HNZ L;  1Q8K A;  5IGG A;  4LF8 L;  1N32 Q;  3KBG A;  1EQQ A;  4DV6 L;  3PO3 H;  2Z9H A;  1L1O A;  5DAU A;  2UXC Q;  4UP9 A;  3VYS A;  2IHF A;  4OIK A;  1G51 A;  3I4N B;  1SXT A;  4TQU S;  4A3K G;  1SYC A;  4QCL A;  3E9I A;  3OMC A;  5JAV A;  1NUC A;  1IBL L;  1L1O B;  1BCP F;  3A5Z B;  3AYH B;  4ALP A;  4LF7 L;  3EJI A;  4LFC Q;  3J7A V;  2UUC L;  4QL5 A;  2Q2U A;  1K0R A;  2F0U A;  4R4T A;  3RMH A;  5E3F A;  1VQL A;  2UU9 L;  3Q23 A;  1KTK A;  5C4X H;  1QWY A;  3S15 B;  1A2U A;  3CW2 C;  4CKB A;  1V1P A;  3IFT A;  1HNW Q;  3MXP A;  4LFA L;  3AMU A;  1NNX A;  3PQI A;  4JI0 L;  1PH4 A;  2EE1 A;  3EFX D;  1FGB D;  1U4M A;  1KNA A;  4KJN A;  2E2D C;  2WP8 J;  4DV5 Q;  1LYL A;  4H13 C;  3U9S A;  4HJ7 A;  5AJ3 L;  3GTO H;  3J81 i;  3S2H B;  2E2J H;  3KJP A;  2EDG A;  2ZTC A;  3H94 A;  5C5M A;  2IY5 B;  4DR5 Q;  3CCU A;  2Z6B A;  1Q8I A;  2A19 A;  3RLO A;  3MVV A;  3I72 A;  4J1M A;  3MAQ A;  1WFQ A;  3E0E A;  2D0O A;  3EBE A;  5C4Z A;  2RQX A;  4CGY B;  3K7U C;  5LMU L;  3I4M B;  1JJG A;  5M3M B;  3OSO A;  3NXW A;  1ET6 A;  3K0Y A;  4X6A H;  1PFS A;  4A76 A;  1N34 Q;  1SYF A;  3GV3 A;  4QIW B;  3NBH B;  4Y52 H;  4XYO A;  3KDF A;  3ZJY C;  1RKN A;  5TSS A;  1PRT F;  2HDM A;  1NJI C;  2YU9 B;  3W5O A;  1SEB D;  1Y1V H;  2BOS A;  4DR4 Q;  3OPO A;  2HT1 A;  2PZU A;  1A0I A;  1U4L A;  3WDN A;  1E1O A;  2PCF B;  4ULL A;  1B44 D;  2MO1 A;  3H6M A;  2O5I C;  1K83 H;  2Q2T A;  2PZW A;  3H0G B;  1C48 A;  4X62 Q;  2YTX A;  3NWT A;  5JPN C;  2JN4 A;  1R4Q B;  1EYG A;  2UUC Q;  4LWC A;  2G5D A;  1QNK A;  1PXU A;  1X3Q A;  2Z0S A;  1TR5 A;  2PI2 E;  3WOF A;  4AH6 A;  2QEX A;  4XQJ A;  3HOX B;  5C4J H;  3BYY B;  2K5H A;  3M7G A;  2RCF A;  1ICW A;  3C46 A;  3KBX A;  1STY A;  2NUC A;  2TSS A;  4BBR H;  3OW7 A;  4X65 Q;  4PZ6 A;  5HGT A;  4BBS G;  2A6E C;  1IYV A;  2A68 D;  3T51 B;  4DR6 Q;  4LFA Q;  4N9T A;  1EY4 A;  3ERS X;  3QOJ A;  4DV7 Q;  2BE5 D;  1OTC A;  2F0M A;  2OXP A;  1OXX K;  4KHZ A;  4OGQ C;  5IP7 G;  3K7A B;  2QGQ A;  2NWG A;  1QVF A;  3D4R A;  1BCP D;  5JJI A;  4JI7 L;  1KLU D;  3TN2 A;  1V1O A;  3HOY B;  1MKH A;  1SNQ A;  5JJK A;  5JPM C;  2DY7 A;  1JT8 A;  1PFB A;  4IO9 A;  1N8R C;  4CJ0 B;  3J80 c;  4XQQ A;  1Y8P B;  2R7Z H;  4JI3 L;  3I90 A;  2O4X A;  1O80 A;  4FDB A;  2E5L Q;  3HG9 A;  3E6Z X;  1EQV A;  3VA7 A;  2EYM A;  3PO3 G;  2JK8 A;  1S5D D;  1PH5 A;  1B7Y B;  4NMZ A;  1NY4 A;  2F0F A;  1WOC A;  2L11 A;  2RHS B;  2EVB A;  3QR8 A;  2Z4H A;  2KEN A;  3PGZ A;  4XT1 B;  4KD4 A;  5C6A A;  4K8I A;  4RGM A;  1SLJ A;  1WTP A;  2MFI A;  4N9P A;  5GRO A;  4JI8 Q;  3GD7 A;  3UE0 A;  4DAV A;  4IPC A;  2K32 A;  4R4Q A;  2VUM B;  5LL6 X;  2G9D A;  1E3P A;  2N3S A;  1R9T B;  1IKL A;  2VB3 X;  1KDC A;  2G9H D;  3ER0 A;  3DM3 A;  2VB2 X;  4PMW A;  1Z6H A;  1DJR D;  2JQO A;  1NE3 A;  4DU9 A;  2SNM A;  3MHB A;  1LM0 A;  5E4X A;  3HGB A;  4RCN A;  2LFN A;  3UDX A;  4C3H B;  4O2D A;  3BZK A;  3SK5 A;  4A3M G;  5D3D A;  3S1M B;  1UUP A;  2A69 D;  3Q22 A;  1N9W A;  3T1Y Q;  3M9B A;  3CCM A;  4B9X A;  4HID A;  1VQB A;  3IAY A;  4GN5 A;  1QJO A;  1GJX A;  1MBY A;  1HXY D;  2V4D A;  2KED A;  3K5L A;  4IUR A;  3JAM i;  5M5Y B;  1B3A A;  4N8F A;  4X64 L;  4DV7 L;  1I5F A;  1HZC A;  3L7Z C;  3CPF A;  3T13 A;  4A3B B;  2WB1 E;  3PIO A;  1IZ6 A;  2IT1 A;  4WJW A;  4JI1 L;  2P5Z X;  4RG1 A;  5CV5 A;  1IHZ A;  1AZP A;  1KD1 C;  1DOL A;  3BVG A;  4L5R C;  1U4R A;  1X65 A;  3DUZ A;  3LGJ A;  3A8I E;  1IYJ B;  5ELF A;  3OTO Q;  3KOJ A;  2ZXO A;  5GQO A;  1VQK A;  4YCU A;  4RCO A;  4R9W A;  4JI3 Q;  5C0X H;  1QCB D;  2E5L L;  5CR3 A;  1I4P A;  1GUG A;  3M4Y A;  2Y0S G;  1TS3 A;  4ZUJ A;  4BWG B;  4QUF A;  2I5M X;  1E2W A;  4G4K A;  1CK1 A;  3LX0 A;  3TEH B;  4DXG A;  4GOP B;  2ZJP A;  2OEO A;  3KLR A;  5C4J B;  3I55 A;  1MSG A;  1PRT D;  4K5V A;  1QZH A;  1H95 A;  3U50 C;  3HKS A;  1XPO A;  1AE3 A;  2J7Z A;  5JJL A;  1MSH A;  1WCM G;  1IW7 C;  2QKI C;  3HP3 A;  1JJC B;  4GNX A;  2R7D A;  3FPU B;  4K6D A;  2JA7 H;  4DA2 A;  1JOQ A;  4L5S A;  2JEA I;  1XTC D;  4JPB W;  1M1K C;  1BF4 A;  1SMX A;  5EPJ A;  4HED A;  5FKA C;  1SFO H;  2VY3 A;  1WTH A;  1QVC A;  2K50 A;  2AHO B;  2SEB D;  1WD0 A;  1D8L A;  1EY8 A;  1HA5 A;  1IBM Q;  3J7Y W;  2SNS A;  1JC7 A;  3HOX G;  1DGS A;  2SOB A;  1T9H A;  1AP0 A;  3I4N H;  5COR A;  1XNQ L;  1PZK D;  3CCL A;  4I7A A;  2F0O A;  4R8N A;  3VDY A;  1LAB A;  4RGT A;  4XTC S;  4JBK A;  3H3V C;  1HTP A;  4MN3 A;  3PIP 3;  2JA5 G;  4DAY B;  1TY0 A;  4WFN 3;  1SE4 A;  4PNY A;  2B2V A;  2OQ0 A;  4K14 A;  3I4O A;  4A3D H;  3A74 A;  2RBM A;  1PZJ D;  4KHP L;  2F4I A;  3ERQ A;  1LLR D;  2CH4 A;  4JI1 Q;  5C3E B;  1OXU A;  1A62 A;  2R93 G;  2JE6 I;  1CKN B;  2UUB Q;  4RH6 A;  3AB9 A;  1AE2 A;  1ILQ A;  2IL8 A;  1HZA A;  3OTO L;  4LAA A;  2A68 C;  3NEN A;  4B9W A;  1F9S A;  4A3L H;  1UE1 A;  5EAY A;  1PH8 A;  1Y1W G;  2IJ0 A;  1YIT A;  4G7Z C;  2VQF L;  3NQT A;  3J81 L;  1ENF A;  3HZX A;  2KEC A;  4RWS C;  1YZ6 A;  5EQ0 A;  3AU7 A;  2AWN A;  2UXD L;  3EQL C;  4QY7 A;  4C3H H;  4UPA A;  4B3M Q;  4ZK9 B;  3KF6 B;  3NTI A;  3QG1 A;  1G6Z A;  1XWE A;  5FK9 C;  5I9O A;  4P2C B;  1VQC A;  5JEA G;  2NN6 G;  3BYT B;  3MFY A;  1QOH A;  3URY A;  1QG7 A;  1HPC A;  2LS0 1;  3UDI A;  1PTO B;  2B2U C;  1YNJ C;  2F0E A;  1LTB D;  4Q5V A;  5T1I A;  3PO2 H;  3UI2 A;  1FGU A;  4BY1 B;  1KDB A;  1RTO A;  2K4K A;  1EZ8 A;  1RCV D;  1U9R A;  3SXH A;  5M3M H;  2UXB Q;  2I0Q A;  1UNS A;  4JI6 Q;  5IYC G;  1F2Y A;  1AEX A;  1YHQ A;  1I3Q B;  2XRS D;  2WKC A;  4GS3 A;  2NVQ B;  2PZT A;  2FXQ A;  3HFZ B;  2ICI A;  3E9H A;  4HMJ A;  4MIU A;  3TP5 A;  1IBM L;  4LF5 L;  1CUK A;  2EYF A;  3HOU H;  2K5N A;  1IBK Q;  1T5E A;  3SGI A;  3D0F A;  2Q8I B;  2YU9 H;  4BA2 I;  4ZKC B;  1G91 A;  1CA6 A;  3MXN B;  5C44 H;  4DAP A;  4KD3 A;  1TWA H;  1G2T A;  3NPP A;  2HCC A;  3CCQ A;  1D2B A;  1PZI D;  2XTI A;  4A3I H;  1BBW A;  1ML0 D;  2BDO A;  2EYP A;  1WTX A;  1I4G A;  2ZXR A;  3NE5 B;  1JMC A;  1BCP C;  1PVO A;  2J4X A;  4P71 A;  5J22 A;  3QB3 A;  3EA6 A;  2PQA B;  4O1N A;  1YJN A;  3R3O A;  2DNE A;  4PQX A;  2ZXP A;  1HZ9 A;  3TZD A;  2QF7 A;  3GP7 A;  4YHH Q;  2L5T A;  1B70 B;  1JOR A;  2LY7 A;  1X55 A;  4IFD J;  2UUB L;  4GKK Q;  1JCK B;  2KCN A;  3GTK H;  5HGQ A;  2XWJ B;  2E76 C;  4QUC A;  1ZEQ X;  4A3E B;  1BNZ A;  3GTG H;  2D62 A;  3I4N G;  1PDQ A;  3M4O H;  2HHH L;  3AQQ A;  1K3B C;  2B2Y A;  2B63 H;  1H9S B;  3K57 A;  3EIV A;  1XPR A;  1CKO A;  4R8I A;  4UY8 C;  3K7A H;  2V1C C;  1EZ6 A;  2UXD Q;  1FVI A;  5JEA H;  1X54 A;  2F0V A;  2WV6 D;  1GM5 A;  5C4H A;  3RZD H;  1KIX A;  1HH2 P;  1STA A;  3B6Y A;  1KRS A;  4APV A;  2WAQ B;  1B8A A;  4FP5 D;  1VQ4 A;  2R7F A;  2KUM A;  3HOZ B;  2F0N A;  2Y0S E;  3HS0 C;  4GKJ Q;  1ASY A;  3ULP A;  2EY6 A;  1VQD A;  5FO9 B;  1Y8O B;  5F2D A;  2OF1 A;  2VS1 A;  2JA8 B;  2K05 A;  4AIM A;  2UXB L;  4I65 A;  4MNO A;  1BVS A;  4UP7 A;  4YY3 L;  1SDF A;  1JR0 D;  2NVT H;  3HOV B;  5JJZ A;  3A56 A;  5KYL A;  2L12 A;  4LF5 Q;  2VL6 A;  3LWE A;  1B2T A;  4J8Q A;  1IBK L;  1HR0 L;  5T1G A;  1EWH A;  3M7N A;  4H7B A;  5C0X G;  1TWH B;  4LJZ C;  4P74 A;  2DY8 A;  3NP8 A;  1BXT A;  5LMN L;  2B2T C;  1SND A;  2NN6 I;  4HJ8 A;  1Y14 B;  4OEL B;  4OWX B;  4RGO S;  4RKL A;  5C3X A;  1HFG A;  4WRD A;  4NKL A;  2AUJ D;  2BH8 A;  3NBI A;  1KXL A;  4OXP A;  3CPW A;  1A63 A;  3OWE B;  2ID0 A;  1X6O A;  3NSW A;  4QMG A;  4B3T Q;  2H1E A;  4TVA B;  4B3R L;  1XPU A;  1PH3 A;  4NXM Q;  3J80 E;  5M5X H;  4FNF A;  2F0T A;  2RDF A;  3GTJ B;  4HCS A;  4A3F G;  4H02 A;  5EBD A;  1K0S A;  1AZQ A;  4L6T B;  3CCJ A;  4AYB G;  4C3J H;  4ZUI A;  1DXM A;  5M5Y H;  1SJE D;  2HHH Q;  1JWS D;  5FLM H;  1YNN D;  3NQI A;  4RHR A;  1CHP D;  4B3S L;  5GAH C;  4HSV A;  2EY5 A;  4UDU C;  1G2S A;  4PZ7 A;  3R8B A;  2JP1 A;  1EEI D;  4WOR A;  1S3O A;  1CZG A;  1Y1V G;  2KQ3 A;  1HRJ A;  4A3J B;  3W1G A;  4KLK A;  4XIG S;  4V19 0;  3E5S A;  1QVG A;  3IL8 A;  1MJE A;  2F3W A;  3LNN A;  3FDT A;  3Q24 A;  2CH4 W;  3G48 A;  1VQG A;  2B39 A;  4QF4 A;  3X3N A;  1M4V A;  1YIJ A;  3G6J B;  4A3I B;  1P16 A;  3S15 H;  3QWN A;  3M4Q A;  1KRT A;  1PTO F;  1X3E A;  2B8G A;  4OL7 A;  1LTR D;  4JYA L;  2L9H A;  1H9S A;  2ATW A;  1AW7 A;  1EY9 A;  1MIU A;  1D5M C;  4IUU A;  1TII D;  1BDO A;  2L0C A;  3ICE A;  1CI3 M;  2YTV A;  5LMN W;  1HHV A;  4C3I B;  4X3S A;  2WAC A;  1PH1 A;  2Q2H A;  1LTG D;  4EGV A;  3GO5 A;  3KYH C;  3S2D B;  2EIF A;  2CFM A;  3SK4 A;  3CXC A;  5G3L F;  3HOY G;  3M4O B;  3NTH A;  2IWH A;  1AFP A;  4O0A A;  4EQO A;  1CKN A;  4P73 A;  3HKZ G;  5LMN Q;  5IGB A;  1SFO B;  1KDA A;  4HN7 A;  2JA5 H;  3F2U A;  5CBE E;  2PNR C;  1RDP D;  4FO2 A;  2K7V A;  5E7N A;  3VR6 A;  3U58 A;  3RN5 A;  4NW2 A;  1BBU A;  1CSP A;  3NBH A;  1VQN A;  4P72 A;  5FOB B;  1EYA A;  2RSO A;  2KHI A;  2N55 A;  1DZ1 A;  4DFA A;  1ASZ A;  2RCN A;  5FLM G;  2L55 A;  4LF4 Q;  1QZG A;  4B3T L;  5LL6 S;  3BDL A;  3MXU A;  3HOZ H;  4FF2 A;  4IPG A;  4JBW A;  1W2B A;  2BCO A;  3CC7 A;  4HSP A;  4DR7 Q;  4AQY L;  2MPM A;  2XRQ D;  4YCW A;  1JB7 A;  5K36 H;  5CV7 A;  3ND8 A;  4BY7 B;  3TP8 A;  3P1H A;  1OXV A;  2E2H B;  2B2V C;  3BVM A;  3NEM A;  2NBF A;  2F0D A;  2ZJR A;  5I2Y A;  4JI2 Q;  2EY2 A;  2FMM A;  4LK1 C;  3HOU G;  1RD9 D;  1Y1W H;  3CAM A;  2K14 A;  1II3 A;  1PFN A;  5M3F H;  1YNJ D;  3RLF A;  1STN A;  3MTS A;  3VR5 A;  2ZM6 Q;  5FJ8 H;  1EYD A;  3K81 C;  1B1Z A;  2WB1 G;  1JE5 A;  3PIO 3;  3F2D A;  4DV3 Q;  4CJ2 C;  2OCE A;  3DWQ A;  4JVZ A;  3GTL B;  4U67 3;  5CBA E;  1I94 Q;  1JQY D;  2PW7 A;  3D4W A;  4A3D G;  2QDB A;  1LTI D;  3MXN A;  2C5C A;  1VQ6 A;  1DOM A;  4IJL A;  2XIW A;  3MA2 B;  1Z9F A;  4O42 A;  2IX0 A;  4K8J A;  3FRP B;  2Q8R E;  2EYL A;  1K8A C;  5FO7 B;  2IHE A;  1N33 L;  2MQH A;  3HOV G;  2N49 A;  4KKT A;  4QJF A;  1RJT A;  1A3U A;  1LTA D;  4HMI A;  1PTO H;  2K28 A;  4KY5 A;  1GUT A;  2LSS A;  4X66 Q;  3GTP B;  1L0X B;  2R61 A;  2EY1 A;  1TKW B;  2A6H D;  3ONA B;  4A3L G;  2HDL A;  5C4X G;  2F0K A;  4EVO A;  2C35 B;  2N88 A;  5EKK A;  2MO0 A;  4K0K Q;  4DV0 Q;  1QB5 D;  2NVQ H;  1S5F D;  2R3Z A;  1EY7 A;  4IUP A;  4A3K H;  3DM1 A;  3VYT A;  3E0J A;  5CGK A;  1S4Z A;  1KAB A;  4M8A A;  4DK6 C;  2FJ2 A;  3G4S A;  4LF4 L;  1PMR A;  2DN8 A;  5DNF A;  4JI5 L;  2RSN A;  5C44 B;  3K59 A;  3PMF A;  3M3Y H;  4IFD I;  3TDQ A;  2AQ3 B;  4FXK C;  4A3F B;  2EYO A;  1AH9 A;  3S1Q H;  1LTL A;  3PO2 G;  1MD2 D;  1WCM B;  3KDF B;  2QCP X;  4AYB B;  3JC6 6;  2D0P A;  5KGU A;  2AKW B;  1RHP A;  4XDX A;  4DUY Q;  4N8X 1;  4G7O C;  4R1J A;  1UAP A;  1HNZ Q;  4LF8 Q;  2IX1 A;  2R92 G;  1EQR A;  1HR0 W;  2UXC L;  3TRZ A;  1LT4 D;  3L3O C;  2VQE Q;  5EGT A;  3PV0 A;  3CME A;  5D65 A;  3U9O A;  2Z6K C;  5IT9 c;  1LTS D;  4RGN A;  2RVL A;  1I94 L;  3I56 A;  1F2M A;  2B63 B;  2DJF C;  2ZTD A;  4LF7 Q;  3GTQ B;  4PZ8 A;  1FYC A;  4A93 B;  1IYU A;  4Z9C B;  3T56 B;  3OHX C;  4F88 A;  4YWM A;  3RZD B;  2AUK A;  2B2W A;  2HUG A;  5EPL A;  4L5T A;  1MHW C;  1N33 Q;  2LXJ A;  4YIJ A;  3VR3 A;  5CMD A;  3TS0 A;  1SMY C;  1WYD A;  3J81 c;  2E8G A;  3W3A A;  2YV5 A;  5A2Q L;  2RHQ B;  1D5Z C;  1SAP A;  3RR5 A;  3BDO A;  4A3C G;  2JEB I;  2NZO A;  3J80 L;  1JJ2 A;  4GNX C;  2EXZ A;  1DOK A;  1SMY D;  2JA7 G;  1SRU A;  2F3V A;  2GVA A;  1W6K A;  3J7A F;  1GO3 E;  2B2U A;  4I7Z C;  2MNA A;  1Y1W B;  4K0K L;  1ZXT A;  1ZYR C;  4DV5 L;  5GAG C;  3S17 B;  1CKM A;  1SNC A;  1SN8 A;  5HUR A;  1XJV A;  2KJX A;  3J81 j;  5IYB G;  3S16 H;  2DNC A;  3RZO H;  1PTO C;  2ES2 A;  3VR4 A;  1GVP A;  1X3F A;  4DR5 L;  3I7F A;  2HCI A;  3L9A X;  5IP7 H;  1NSN S;  1I4Q A;  4JI5 Q;  3FKI G;  5L37 A;  1L2F A;  5IGD A;  1TU2 B;  4BBR B;  1EY6 A;  1HJP A;  1MGS A;  1NMG A;  1JB3 A;  3TP6 A;  4FF4 A;  4BS9 A;  4PMC A;  4DUZ Q;  1X3G A;  1F9Q A;  5CV6 A;  3H09 A;  1QE6 A;  1N34 L;  1TY2 A;  4RKB A;  2JA9 A;  3SEB A;  1PH7 A;  1CSQ A;  1LO5 D;  3SK8 A;  1VQ7 A;  2BE5 C;  1VCI A;  2KEE A;  1PV4 A;  2M00 A;  4DR1 L;  3GTP H;  2WB1 B;  2QIL A;  4AYB E;  1VQ5 A;  3JAM c;  2R7Z B;  5H1S E;  3I73 A;  1PTO D;  3CC2 A;  4A3G G;  4A75 A;  1EOT A;  1PH2 A;  2A6E D;  4ZKB B;  1VQE A;  1I4X A;  2EPB A;  1MI2 A;  3PF4 A;  3PUV A;  3TQY A;  1W6J A;  3R93 A;  4A3C H;  1KAW A;  2SDF A;  1SYB A;  4C56 C;  1UEA B;  5AFW A;  5A35 A;  1JWM D;  3HOW B;  3OMG A;  2LKV A;  5M9O A;  2A5H A;  5IWA L;  3TZU A;  1KL9 A;  4A3F H;  1Q3L A;  4FF3 A;  3S1Q B;  4DPG A;  4DV1 Q;  1YJW A;  5C5L A;  4DR6 L;  4IUQ A;  4JW0 A;  2F0J A;  1STE A;  4UHV A;  2KA7 A;  3BS1 A;  5K5P A;  4DV2 Q;  1Q90 A;  4IOA A;  1C7Y A;  2D5D A;  1Q86 C;  4JI4 Q;  1BR9 A;  2L1B A;  4NXN L;  2TMP A;  2NTS A;  1SE2 A;  4L5Q A;  4JV5 L;  4BBS H;  3BJU A;  1LT6 D;  4IAL A;  1XTD A;  4HJ9 A;  2PO4 A;  4DV4 L;  2L4N A;  2I07 B;  4OWW B;  4OEM B;  3P75 A;  5C44 G;  3S1M H;  1TWF H;  5A2Q E;  2PNH A;  4GOP C;  4R4C A;  1RL2 A;  3S14 B;  3T4A C;  3PO2 B;  1U4P A;  4BY1 H;  1XMO L;  1PH6 A;  1SSO A;  3HOZ G;  5C0X J;  1GHK A;  4DKA C;  5HY6 A;  4A3M H;  2X6G A;  3CRK C;  4KKU A;  3V2T A;  2GA4 B;  3S1R B;  3H0G G;  4C1N K;  2HIV A;  1YJ9 A;  1C8C A;  1WTO A;  2K04 A;  3A8J E;  5IYD G;  4DV6 Q;  2O5J C;  3CRL C;  1O7Z A;  2K6A A;  3VA5 A;  1GHJ A;  3K8A A;  4JI8 L;  5M5W H;  1F2L A;  4WJ4 A;  2I5H A;  1SBB B;  4KY7 A;  3A5U A;  2PPB C;  4JC0 A;  3SE0 A;  1TS5 A;  4FYD A;  2NVX B;  1IBL Q;  1A8V A;  1SNP A;  1S5C D;  2GVB A;  4Y7N H;  2E2H H;  1GD7 A;  4ILW A;  2EXD A;  4DF7 A;  2F4V L;  2IX3 A;  1CZW A;  1E22 A;  3DHQ A;  3NUC A;  3S17 H;  2HIX A;  4LFC L;  4A93 G;  2K5V A;  4POF A;  4EQ5 A;  2F0L A;  3MFG A;  1UE7 A;  1YHB A;  2QA4 A;  3SK6 A;  1WI5 A;  3FP9 A;  1D6E C;  1I4H A;  4CKE A;  1TVX A;  2AQ2 B;  3T1Y L;  1J5E L;  4JOI C;  4HIM A;  4DAM A;  1EIF A;  1DM0 B;  5IWA Q;  3GTL H;  5NUC A;  3D4D A;  3GTK B;  3JAM L;  1A6X A;  2JA7 B;  4K5W A;  1TWG B;  1PYW D;  4LF6 Q;  4DV2 L;  3PSI A;  1K3R A;  1J9O A;  4JI0 Q;  3A8K E;  4JI4 L;  4BXX H;  4V0B A;  4GLX A;  3PO3 B;  1ET9 A;  4NXN Q;  2DGY A;  4JV5 Q;  1FR3 A;  4LFB Q;  4DV4 Q;  2LXK A;  4A3J G;  5J39 A;  4KN4 C;  2JA6 B;  3FKI B;  2AWO A;  1I50 H;  4IUT A;  1E2V A;  1E0B A;  2N8N A;  1NCV A;  3Q8D A;  5FLX c;  1HA6 A;  4IPH A;  4K6L A;  2X6L A;  4K5X A;  1HQR D;  4G57 A;  1OO9 B;  4M1U B;  3KLS X;  3TS2 A;  1D1I A;  3NTK A;  1BUV T;  1PRT B;  5IOD A;  3CD6 A;  5I6W A;  1NAP A;  1OXS C;  1RTN A;  1X32 A;  1SE3 A;  2VZA A;  1J8I A;  5C3E H;  2K03 A;  4DR4 L;  1LAC A;  2R7Z G;  2B2Y C;  1SR3 A;  3BDC A;  3KF8 A;  2FHT A;  1DON A;  4GLV B;  3ULL A;  3RD4 A;  2OT2 A;  4GOP A;  4X3U A;  2F4V Q;  5GAE C;  1HFN A;  1LTT D;  3V96 A;  2L15 A;  4BA1 I;  3R2I A;  3GTO B;  4X62 L;  2Z4I A;  5C3W A;  3S2H H;  1GKH A;  3N6R A;  5G3L D;  1I4R A;  1KC8 C;  3GTM H;  2D9U A;  4A3B G;  1SYE A;  4CBV A;  4CKC A;  4IPD A;  1PHJ A;  5IYC H;  3QIA A;  1FD7 D;  1TS4 A;  1HZB A;  1J5E Q;  4MTK A;  2AMC B;  4X65 L;  2JJQ A;  3OYY A;  5IYD H;  2XGT A;  5IIF A;  2H4O A;  3HKZ E;  3D8G A;  1ZYR D;  4JBJ A;  2CVR A;  1I6H B;  4LF6 L;  3OIP A;  4A93 H;  5EKL A;  1ESR A;  2Y0S B;  4DNT B;  4BY7 G;  3FPP A;  2WII B;  1C4Q A;  4NDX A;  3F8T A;  4LFB L;  4JI7 Q;  3VYR A;  1YI2 A;  1CT1 D;  1GUW A;  5KND A;  3HOU B;  4ID6 A;  2XNA C;  2NVX H;  1PYB A;  2F0I A;  2F52 A;  1FJG L;  3NK9 A;  1K83 B;  2B3G A;  2QDL A;  3I4L A;  2BH2 A;  2VQF Q;  3H0G H;  4LUZ A;  4NPS A;  1NMF A;  3JAM E;  4DGZ A;  2FMC A;  2RF4 A;  5CV8 A;  2EYH A;  1SYG A;  3RN2 A;  3CCV A;  5FJ8 G;  2B29 A;  1EFW A;  3BZD B;  3DWA A;  4B3M L;  4CDF C;  4WJ3 M;  2A69 C;  1E7Z A;  3KUP A;  2KVM A;  1T5X D;  1KLG D;  3RZO B;  3Q0A A;  4IFD G;  4R4I A;  5BN4 A;  4YWK A;  1Q1B A;  3KJO A;  1N36 L;  1WTW A;  2HQE A;  1V9P A;  4ZAI A;  3S2D H;  1PFM A;  1K8O A;  4RMF A;  1JE4 A;  1KNE A;  1YBY A;  4IOC A;  3W2D A;  4NB3 A;  1X3P A;  4JI6 L;  2JA5 B;  3STB D;  2O2L D; 
#chains in the Genus database with same CATH homology
 1SE8 A;  4A3G H;  4EX5 A;  3M3Y H;  4IFD I;  1VQA A;  2UUA L;  1D8L A;  5ELO A;  2OWO A;  1AH9 A;  1IBM Q;  2VUM H;  3S1Q H;  1OXT A;  1LTL A;  1XMQ L;  3PO2 G;  3KDF B;  3HOX G;  1DGS A;  1T9H A;  3JC6 6;  2D0P A;  3TRE A;  4DUZ L;  4AQY Q;  2AKW B;  2JA6 H;  3STB C;  3UDG A;  4ME3 A;  3I4M G;  3I4N H;  1PYS B;  4DUY Q;  4GNX B;  5M3M G;  2BA0 A;  4R1J A;  5BR8 L;  1XNQ L;  3CCL A;  2B63 G;  3VDY A;  3BU2 A;  3U4Z A;  3L2P A;  1HNZ Q;  3CCE A;  4LF8 Q;  4JI2 L;  2Z6K A;  2IX1 A;  4C3I H;  3PUZ A;  1N32 L;  4XTC S;  1HNX L;  4JBK A;  2K75 A;  2R92 G;  2JA5 G;  2DUD A;  1EQR A;  2CQO A;  4OON A;  4DAY B;  4DR1 Q;  3UDF A;  1PH9 A;  1HR0 W;  3TRZ A;  2UXC L;  2VQE Q;  2ZJQ A;  4POG A;  3J7A 5;  2OQ0 A;  3PV0 A;  3CME A;  2JA8 H;  4X64 Q;  3I4O A;  4A3D H;  3FHW A;  2Z6K C;  3AFQ A;  3A74 A;  5IT9 c;  4KHP L;  3F2C A;  1L1O C;  2KCM A;  4JI1 Q;  1I94 L;  1OXU A;  1A62 A;  2R93 G;  5IP9 H;  4YHH L;  3I56 A;  1LUZ A;  2JE6 I;  1QUQ B;  3D31 A;  3AEV A;  2ZTD A;  3K0X A;  4LF7 Q;  3S14 H;  1CKN B;  2UUB Q;  2CWP A;  4DR3 L;  1AE2 A;  4GKK L;  4PZ8 A;  3AFP A;  3PUW A;  2E2I H;  1RIP A;  1X56 A;  1HZA A;  3OTO L;  2JA6 G;  3I4M H;  3NEN A;  1I6H H;  3A0J A;  1G29 1;  4YWM A;  3CP0 A;  4A3L H;  1TXY A;  1UE1 A;  5EAY A;  1FJG Q;  2UU9 Q;  1TWH H;  1PH8 A;  1EUJ A;  1N33 Q;  4L5T A;  1Y1W G;  1YIT A;  2K52 A;  2LXJ A;  3S1R H;  2VQF L;  1VQI A;  3TS0 A;  1WYD A;  3J81 c;  1L0W A;  3M85 A;  3NEL A;  2E8G A;  1YZ6 A;  2YV5 A;  1W3S A;  1J6Q A;  2KCT A;  2AWN A;  2RHQ B;  2UXD L;  2VW9 A;  3RR5 A;  2A8V A;  1HNW L;  1Q1E A;  4QY7 A;  4C3H H;  4QGU A;  4UPA A;  5M3F G;  4DV1 L;  2JEB I;  4A3C G;  2NZO A;  1JJ2 A;  4B3M Q;  4DNI A;  4UP8 A;  4GNX C;  1VS0 A;  4BY7 H;  3KF6 B;  4PG3 A;  2JA7 G;  3GTM H;  1VQC A;  5JEA G;  2NN6 G;  1SRU A;  1KQS A;  1WJJ A;  2GVA A;  4BBR G;  5IP9 G;  1GO3 E;  3UDI A;  2I5L X;  3PCO B;  2MNA A;  4K0K L;  1N36 Q;  4DV0 L;  4DV5 L;  4OX9 L;  5GAD C;  5GAG C;  5AJ3 Q;  1YHA A;  3CCS A;  4GKJ L;  1CKM A;  1SN8 A;  1XJV A;  3PO2 H;  1FGU A;  1G6P A;  3J81 j;  5IYB G;  3S16 H;  2K4K A;  3S24 A;  4LUV A;  4YWL A;  3RZO H;  1V43 A;  5JEA J;  2ES2 A;  1GVP A;  1X3F A;  5M3M H;  4DR5 L;  2UXB Q;  3I7F A;  2I0Q A;  3HOX H;  4JI6 Q;  5IP7 H;  5IYC G;  5C0X I;  1YHQ A;  4JI5 Q;  3PUX A;  3FKI G;  4GS3 A;  1L2F A;  4DR2 Q;  2FXQ A;  3HFZ B;  4R4O A;  3E9H A;  1IBM L;  1HJP A;  4LF5 L;  1CUK A;  1XMO Q;  3HOU H;  1NMG A;  1XMQ Q;  2K5N A;  5LMU Q;  1IBK Q;  3SGI A;  4A3J H;  1HR0 Q;  4DUZ Q;  3D0F A;  1X3G A;  2YU9 H;  2HQL A;  4BY1 G;  4BA2 I;  1X9N A;  1N34 L;  2JA9 A;  3MXN B;  3PUY A;  5BR8 Q;  5C44 H;  1PH7 A;  1XNQ Q;  1TWA H;  1CSQ A;  1VQH A;  3KFU A;  1Q12 A;  4HJA A;  1Q8K A;  1HNZ L;  3CCQ A;  1VQ7 A;  4LF8 L;  1N32 Q;  3WWV A;  1EQQ A;  1VCI A;  2NZH A;  2XTI A;  1BBW A;  4DV6 L;  4A3I H;  1L1O A;  1HNX Q;  3DLL A;  3PO3 H;  1PV4 A;  1WCM H;  4DR1 L;  2UXC Q;  4UP9 A;  2EQS A;  3GTP H;  1XNR L;  1C0A A;  2IHF A;  1JMC A;  1G51 A;  1EWI A;  1PVO A;  4P71 A;  4TQU S;  4A3K G;  3E9I A;  2PQA B;  1YNX A;  4AYB E;  1YJN A;  1IBL L;  1VQ5 A;  1L1O B;  3JAM c;  4KHP Q;  5H1S E;  1HZ9 A;  3A5Z B;  3AYH B;  2GN5 A;  3UE1 A;  2OTL A;  3CC2 A;  4YHH Q;  4ALP A;  1B70 B;  4A3G G;  3G71 A;  4LF7 L;  4LFC Q;  1X55 A;  4A75 A;  2UUB L;  4IFD J;  4DR3 Q;  1PH2 A;  4GKK Q;  1E24 A;  2UUC L;  4QL5 A;  2Q2U A;  1K0R A;  1VQE A;  4IJH A;  3L0O A;  5DLQ E;  5HGQ A;  4R4T A;  3PUV A;  3TQY A;  3W1B A;  3PF4 A;  3GTG H;  1VQL A;  2D62 A;  1KAW A;  2UU9 L;  3I4N G;  3M4O H;  4A3C H;  2A1A A;  2HHH L;  3AQQ A;  2KBN A;  2B63 H;  4B3S Q;  5IWA L;  3EIV A;  1KL9 A;  5C4X H;  3GTQ H;  1Q81 C;  1XPR A;  3KF8 B;  1CKO A;  4A3F H;  4UY8 C;  2OQK A;  3K7A H;  2V1C C;  1S40 A;  1NBW A;  2UXD Q;  3CW2 C;  4DPG A;  1FVI A;  1HNW Q;  4DV1 Q;  1YJW A;  1MJC A;  1X54 A;  3CMA A;  4DR6 L;  4MZ9 A;  1GM5 A;  4LFA L;  3I2Z A;  3RZD H;  1KIX A;  1HH2 P;  3B6Y A;  1KRS A;  4DV2 Q;  4APV A;  4IOA A;  3J80 i;  1C7Y A;  1EIY B;  4JI0 L;  1Q86 C;  1PH4 A;  3FKI H;  1B8A A;  4JI4 Q;  1VQ4 A;  2CCZ A;  3IRB A;  2R7F A;  4NXN L;  3H3V H;  1EOV A;  2WP8 J;  4DV5 Q;  1LYL A;  4L5Q A;  4HJ7 A;  2Y0S E;  5AJ3 L;  3GTO H;  4GKJ Q;  1ASY A;  3J81 i;  3ULP A;  4BBS H;  3BJU A;  3PIP A;  2E2J H;  1VQD A;  1YVC A;  3KJP A;  4JYA Q;  4HJ9 A;  1XTD A;  2ZTC A;  2VS1 A;  4DV4 L;  2IY5 B;  4AIM A;  5J3B A;  4OWW B;  4DR5 Q;  2UXB L;  5C44 G;  3CCU A;  3S1M H;  4MNO A;  1BVS A;  1TWF H;  4UP7 A;  4A4I A;  1V1Q A;  4JV5 L;  2A19 A;  3RLO A;  4YY3 L;  2PNH A;  4GOP C;  4R4C A;  1WFQ A;  1RL2 A;  1VQF A;  4DR2 L;  2NVT H;  2WAQ G;  2D0O A;  3E0E A;  3EBE A;  3RNU A;  4BY1 H;  3K7U C;  2VL6 A;  4JCV E;  1XMO L;  1PH6 A;  4LF5 Q;  2R92 H;  5LMU L;  1JJG A;  1IBK L;  3M4P A;  5C0X J;  3HOZ G;  4DKA C;  1HR0 L;  5HY6 A;  4A3M H;  3M7N A;  4X6A H;  4HIO A;  5C0X G;  1PFS A;  4OWT B;  4A76 A;  4P74 A;  1N34 Q;  1R9T H;  1TWC H;  3H0G G;  2Q2I A;  3NBH B;  1Q46 A;  5LMN L;  2HIV A;  4Y52 H;  1YJ9 A;  3KDF A;  2NN6 I;  4HJ8 A;  1Y14 B;  3ZJY C;  5IYD G;  3F2B A;  4OWX B;  4DV6 Q;  1IL2 A;  1M90 C;  2CKZ B;  3K8A A;  4JI8 L;  5M5W H;  1XNR Q;  4WJ4 A;  2I5H A;  1NJI C;  3W5O A;  3J7Z C;  1Y1V H;  4LUO A;  3A5U A;  4JC0 A;  4DR4 Q;  2BH8 A;  1O7I A;  2HT1 A;  1KXL A;  1A0I A;  4OXP A;  1IBL Q;  3CPW A;  1VQP A;  1A8V A;  1E1O A;  2WFW A;  1A63 A;  2ID0 A;  1X6O A;  1C9O A;  2GVB A;  2MO1 A;  5ELN A;  4Y7N H;  2E2H H;  1GD7 A;  4B3T Q;  1K83 H;  4TVA B;  2EXD A;  2Q2T A;  4DK3 C;  2F4V L;  4B3R L;  1XPU A;  1E22 A;  1PH3 A;  4NXM Q;  4YCV A;  4X62 Q;  3S17 H;  2YTX A;  2HIX A;  4LFC L;  4A93 G;  5M5X H;  2K5V A;  4POF A;  2CWA A;  1EYG A;  2ZTE A;  4EQ5 A;  2UUC Q;  1UE7 A;  4LWC A;  4A3F G;  4H02 A;  1YHB A;  4DR7 L;  2QA4 A;  2Z0S A;  2PI2 E;  4AH6 A;  1WI5 A;  3FP9 A;  2QEX A;  3CCJ A;  4AYB G;  4C3J H;  5C4J H;  2YTY A;  4OO1 I;  2K5H A;  5M5Y H;  2HHH Q;  1I3Q H;  3T1Y L;  3K80 C;  5FLM H;  4JOI C;  4HIM A;  1J5E L;  4B3S L;  4DAM A;  1EIF A;  5IWA Q;  5GAH C;  4A3B H;  4BBR H;  4X65 Q;  3GTL H;  4PZ7 A;  4PZ6 A;  4BBS G;  5K36 G;  1S3O A;  1Y1V G;  1D7Q A;  2R6G A;  4DR6 Q;  3W1G A;  4KLK A;  4LFA Q;  4XIG S;  2ZM6 L;  1QVG A;  3ERS X;  1MJE A;  4LF6 Q;  3S1N H;  4DV2 L;  4DV7 Q;  3HOW H;  3PSI A;  1K3R A;  3G48 A;  1OTC A;  4DV3 L;  4JI0 Q;  1VQG A;  3MEF A;  4JI4 L;  1OXX K;  4GLX A;  4JOI A;  4KHZ A;  2ASB A;  3GTK H;  4BXX H;  5IP7 G;  1YIJ A;  1P16 A;  3S15 H;  4NXN Q;  2QGQ A;  2DGY A;  3M4Q A;  1KRT A;  1X3E A;  1P8L A;  1QVF A;  3KF6 A;  4JV5 Q;  4GLA C;  4LFB Q;  5C3E G;  5JJI A;  4JI7 L;  4JYA L;  1MKH A;  5JJK A;  1JT8 A;  4DV4 Q;  2ATW A;  4IO9 A;  3OW2 A;  1MIU A;  3J80 c;  1N8R C;  3G6E A;  2LXK A;  3ULJ A;  4A3J G;  4HJ5 A;  2R7Z H;  4JI3 L;  2AWO A;  1I50 H;  1U0L A;  4HIK A;  2R93 H;  4YY3 Q;  4FDB A;  2E5L Q;  2N8N A;  3ICE A;  4OO1 G;  1UEB A;  2YTV A;  3Q8D A;  5LMN W;  5FLX c;  1UE6 A;  4J15 A;  2BA1 A;  4IPH A;  3T1H Q;  2VUM G;  1PH1 A;  2Q2H A;  4A3I G;  3PO3 G;  2JK8 A;  1PH5 A;  1B7Y B;  4LW1 A;  4GN4 B;  4X66 L;  3TS2 A;  3GO5 A;  3KYH C;  1NY4 A;  4A3E H;  1WOC A;  3EN2 A;  2EIF A;  2CFM A;  4P75 A;  2RHS B;  3CXC A;  1QUQ A;  1FL0 A;  1VQO A;  3HOY G;  3CD6 A;  4QQB X;  4O0A A;  4LF9 Q;  1CKN A;  4P73 A;  2OTJ A;  3HKZ G;  1OXS C;  5LMN Q;  2KEN A;  3PGZ A;  3H15 A;  2VZA A;  2YYZ A;  3F1Z A;  2JA5 H;  5C3E H;  2ALY B;  1SLJ A;  2MFI A;  5GRO A;  4JI8 Q;  5E7N A;  3GD7 A;  4QIW E;  3UE0 A;  3U58 A;  4IPC A;  3RN5 A;  2PMZ E;  2F3I A;  1BBU A;  1CSP A;  4R4Q A;  1VQN A;  4P72 A;  1K9M C;  2NVY H;  1E3P A;  4DR4 L;  2N3S A;  2R7Z G;  1SR3 A;  1PA6 A;  3RLN A;  3ER0 A;  2KHI A;  3CF5 A;  3DM3 A;  1Z47 A;  4GLV B;  2RCN A;  3ULL A;  5FLM G;  1K73 C;  1ASZ A;  1Q7Y C;  4GOP A;  1QZG A;  4PMW A;  4LF4 Q;  4B3T L;  2JQO A;  2F4V Q;  5GAE C;  1NE3 A;  4B3R Q;  3HOZ H;  4NXM L;  1LM0 A;  2L15 A;  4BA1 I;  5IY0 A;  4X62 L;  4IPG A;  2UUA Q;  2PQA A;  4JBW A;  4MTN A;  1GKH A;  3S2H H;  1W2B A;  3CC7 A;  1S72 A;  3UDX A;  2KHJ A;  4O2D A;  4DR7 Q;  1KC8 C;  4AQY L;  3BZK A;  4YCW A;  4A3M G;  1JB7 A;  3HOW G;  4A3B G;  1VQJ A;  1VQ9 A;  4IPD A;  1PHJ A;  5IYC H;  1OXV A;  4DUY L;  1N9W A;  3NEM A;  3T1Y Q;  1HZB A;  3M9B A;  1J5E Q;  1VQ8 A;  2ZJR A;  3HOV H;  4KI0 A;  2AMC B;  4JI2 Q;  4X65 L;  3CCM A;  2JJQ A;  3OYY A;  5IYD H;  4HID A;  3HOU G;  2XGT A;  1VQB A;  3CAM A;  1Y1W H;  4GN5 A;  2K14 A;  4BXX G;  1SRO A;  5M3F H;  3HKZ E;  4JBJ A;  3RLF A;  2VQE L;  2ZM6 Q;  5FJ8 H;  4LNQ A;  3K81 C;  3JAM i;  4LF6 L;  4A93 H;  2VNU D;  4DV7 L;  4X64 L;  1I5F A;  2WB1 G;  1JE5 A;  1HZC A;  3BZC A;  3L7Z C;  3F2D A;  3CPF A;  4DV3 Q;  2OCE A;  1UWV A;  2WB1 E;  3PIO A;  1IZ6 A;  4BY7 G;  2IT1 A;  3H3V I;  4JI1 L;  1NTG A;  3PF5 A;  1I94 Q;  4RG1 A;  4C2M H;  4A3D G;  3F8T A;  1KD1 C;  4LFB L;  1BKB A;  4JI7 Q;  4L5R C;  1X65 A;  3LGJ A;  1VQ6 A;  1YI2 A;  4IJL A;  1IYJ B;  1TWG H;  3KOJ A;  3OTO Q;  1Z9F A;  4GN3 B;  5GQO A;  2NVX H;  2IX0 A;  1PYB A;  2N78 A;  4YCU A;  2F52 A;  4JG2 A;  1VQK A;  1K8A C;  4JI3 Q;  3U4V A;  1FJG L;  2IHE A;  1N33 L;  2MQH A;  4A3E G;  3HOV G;  2N49 A;  2B3G A;  4QJF A;  2E5L L;  2BH2 A;  2VQF Q;  3H0G H;  4LUZ A;  4NPS A;  1NMF A;  1YEZ A;  2RF4 A;  2Y0S G;  3CCR A;  3T1H L;  3HOY H;  2I5M X;  2LSS A;  2PI2 A;  3GTJ H;  1VQM A;  1UE5 A;  3CCV A;  3TEH B;  5FJ8 G;  4X66 Q;  4GOP B;  2B29 A;  3RN2 A;  2ZJP A;  1EFW A;  4B3M L;  4WJ3 M;  1E7Z A;  3I55 A;  3GDE A;  4JBM A;  3CC4 A;  3CQZ H;  4A3L G;  4IFD G;  4R4I A;  5C4X G;  1QZH A;  1H95 A;  2H5X A;  1E1T A;  4YWK A;  3U50 C;  1Q1B A;  2C35 B;  3HKS A;  3KJO A;  2MO0 A;  1XPO A;  1AE3 A;  5JJL A;  4K0K Q;  1N36 L;  1WCM G;  4DV0 Q;  4OX9 Q;  1IXR A;  1V9P A;  2WAQ E;  1JJC B;  4GNX A;  2NVQ H;  2R7D A;  3S2D H;  3KLW A;  2JA7 H;  4RMF A;  4A3K H;  1YBY A;  4L5S A;  4IOC A;  5IE8 A;  1Q82 C;  2JEA I;  1K8G A;  1KHI A;  4DK6 C;  1M1K C;  4NB3 A;  1SMX A;  1SFO H;  3G4S A;  4LF4 L;  2VY3 A;  4JI6 L;  4LF9 L;  1U5K A;  2JA8 G;  5IYB H;  1QVC A;  2K50 A;  3STB D;  4JI5 L;  2AHO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...