3I4OA

Crystal structure of translation initiation factor 1 from mycobacterium tuberculosis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
68
structure length
68
Chain Sequence
GAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor IF-1
publication title Structure of translation initiation factor 1 from Mycobacterium tuberculosis and inferred binding to the 30S ribosomal subunit.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Translation
total genus 16
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4oA00
3OW2A 1YNXA 4AQYQ 3RNUA 3ULLA 4GLAC 2CWAA 4LUZA 5FJ8G 1D8LA 3FKIG 1I5FA 4YY3Q 5FLMH 3RZDH 1XPRA 5IT9c 1N33Q 1JJGA 4DK3C 1VQPA 2VQEL 1T9HA 3W1GA 2VUMG 1V43A 1E24A 1GKHA 3KOJA 3K0XA 4GN4B 4ME3A 1XNQQ 3GD7A 4IO9A 2IHFA 1Q8KA 4C3IH 4K0KL 1GVPA 1VQEA 3KF6A 3CC2A 2LSSA 3J81j 1UEBA 5C44G 1VQDA 3SGIA 5GQOA 4IJHA 1VQKA 3D0FA 3M4PA 3F2BA 4LF6Q 4HJAA 3PF5A 1NJIC 2R7ZG 4TQUS 3IRBA 1XPUA 3U4ZA 4IPCA 5FLXc 2E5LL 2ZJPA 3BZKA 2F4VL 3WWVA 3CCMA 2C35B 4QY7A 4DV7L 4GKJL 1JJCB 4DR3Q 4A3GG 4X62Q 4BXXH 3T1YL 1Y1WG 4Y52H 4APVA 4A3FG 2JA5G 3J7ZC 4A76A 3PO2G 1CKMA 4QJFA 4GNXA 1N34L 1YHAA 2PI2A 5LMNW 1P8LA 1SRUA 4AYBG 4A3CH 3HKSA 1QUQB 4KHZA 1VQJA 3PSIA 5LMNL 1X54A 3GO5A 3CXCA 1PH9A 4RG1A 4R4CA 2NZOA 4DUYL 2IY5B 1OTCA 4A75A 1EQRA 2UXCL 3HOXH 3G6EA 1WOCA 5E7NA 2UXBL 1VQAA 4X65L 5LMUQ 4DV6L 4A3DH 4X66Q 1N36L 1UE1A 1L1OA 4LUVA 5M3MH 2L15A 4LF9L 3STBD 4LF4Q 2GVBA 4IPDA 3ULJA 4HIKA 4JI2L 4GN5A 3GTMH 4BXXG 3AYHB 2UU9Q 3HOVH 1HZAA 3A5ZB 1VQNA 2Q2IA 4LF5L 4OO1G 1HNZQ 1JMCA 3CCEA 1EOVA 1EIFA 1SE8A 1N9WA 1Q46A 3CPFA 1Y1VH 4A3KH 3CC4A 3G48A 4HJ7A 4B3SQ 1A63A 3NEMA 4DAMA 2UUAL 4OX9L 3BJUA 3GTQH 1IYJB 3CP0A 3CMAA 3HOWG 2K5VA 4IFDJ 2Z6KC 3HOYG 4C3HH 1YHBA 4FDBA 4DR6L 1I6HH 4A93G 3PIPA 4LF8L 1IXRA 2CWPA 4DPGA 2LXJA 5DLQE 3I4OA 2ALYB 4YHHQ 2BA1A 2ES2A 1A62A 3RLOA 2NVYH 4OWXB 1NBWA 3T1HL 1IBLL 2WFWA 1Q82C 1LM0A 2B3GA 4GNXC 3ERSX 2NN6G 1Q1BA 1HR0W 1Z47A 1BKBA 1E3PA 3K81C 4DV0Q 3E9HA 2ZTDA 4X64L 3CD6A 4HJ9A 2OQKA 2JE6I 4LWCA 4B3MQ 4PMWA 5C4XG 4JI4Q 2MO1A 3L0OA 2OTLA 4BBSG 3PF4A 3K7UC 4L5SA 4BA1I 2I0QA 1X3FA 2JA5H 1NE3A 2I5HA 3F8TA 1WJJA 4P71A 1PH3A 2Q2UA 4LF7Q 3HOZH 1P16A 2VQEQ 1L1OC 1FJGL 1CKNB 1N32L 1XMQL 3H0GH 1K3RA 1HNXL 1VQGA 1EQQA 3RLNA 4K0KQ 4GLVB 2NN6I 1GD7A 1VQCA 1PH5A 3A74A 1UWVA 1K73C 4POFA 4DR4L 5GROA 3S1RH 5M5XH 3M3YH 1M1KC 3PUYA 4IFDI 3EIVA 3S16H 5IYCH 2JJQA 2LXKA 5IYBH 5ELNA 1Y14B 2F3IA 4A3IG 2A1AA 1Z9FA 4R4TA 4NXNL 2I5MX 2KHIA 2YYZA 3ZJYC 2E5LQ 1AH9A 2F4VQ 3L7ZC 4BY7H 3KF6B 4BBRG 2IX1A 4DV7Q 1Q12A 3TRZA 3AEVA 3GTJH 3T1YQ 4AIMA 2N49A 4A3BH 3CW2C 3G71A 1VQ5A 1YEZA 3PUWA 3K80C 3M7NA 2R93G 1LYLA 1N34Q 3RR5A 3W1BA 4GKKQ 2VZAA 3CCJA 4DV2L 3E9IA 3LGJA 3S2HH 4HIOA 1YJ9A 3S1NH 5LMNQ 4A3MG 4JI7Q 4UP8A 1IZ6A 3CCLA 4DUYQ 1GM5A 4IOAA 3I4MG 1K8AC 3HOWH 1GO3E 1BBWA 3EBEA 5AJ3L 2UXCQ 4DV3L 2UXBQ 2QA4A 4X65Q 4DV6Q 1PA6A 2N3SA 1MKHA 5H1SE 1N36Q 1K9MC 4LF9Q 2HQLA 2VY3A 5C3EH 2UUBL 1QVCA 2B63G 3KF8B 4JI2Q 3CMEA 2Z6KA 4YCVA 3I55A 3CCUA 2EIFA 4AH6A 2HHHL 4A3LG 3CCVA 4LF5Q 3I4NH 2PQAA 5JEAG 5IWAL 4PG3A 1XPOA 1SR3A 4LNQA 2JEBI 4B3TL 2AWNA 4GLXA 4JYAL 4DV5L 2XTIA 3F2CA 5IYDG 4JI0L 3H3VI 1PH8A 4DV4L 4JI6L 4DR7L 4IJLA 3CAMA 4POGA 2IX0A 1YZ6A 1BBUA 2IT1A 4LUOA 4BY1G 2UUAQ 4OX9Q 3PO3G 2KCTA 1JT8A 2JA8G 2K75A 3MEFA 2ZJRA 4DR6Q 2YTVA 1EFWA 3KLWA 3PGZA 2JA7H 1I50H 2QEXA 1FGUA 1WCMG 2DGYA 1CSPA 4JG2A 4LF8Q 1C9OA 4BA2I 4UP9A 2BA0A 1LUZA 1B70B 2K14A 2RF4A 4A3EH 1MJEA 3HOUG 2JA6G 2Q2HA 5IP7G 1IL2A 3CCSA 5HGQA 1VQ6A 3T1HQ 2CFMA 1IBLQ 3BU2A 5IP9G 1S3OA 4O0AA 3UDIA 3PIOA 1PFSA 4DR2L 3Q8DA 4X64Q 4GN3B 2R92G 2PMZE 1HR0Q 1O7IA 4A3JH 4R4IA 2CQOA 2XGTA 1M90C 4KHPL 1X6OA 2VL6A 3GTLH 1XMOL 2VNUD 3J7A5 1PV4A 4KI0A 2GVAA 1XNQL 4JBWA 1B8AA 2YU9H 2AKWB 1VQBA 1L0WA 3UE0A 2RCNA 5FJ8H 5GADC 1J5EL 3FKIH 1FJGQ 1N32Q 2VQFL 2E2HH 1HNXQ 1OXTA 3A0JA 4X6AH 2VUMH 3OTOL 3EN2A 4UY8C 1PYBA 2K5HA 1SMXA 3H3VH 4OWTB 1YJWA 4DR4Q 4HJ8A 2RHQB 1PH6A 4OO1I 1K83H 5C0XG 3RN2A 1QUQA 1WYDA 5C44H 5M3FG 5C4JH 2JEAI 3S17H 2UUCL 3VDYA 4JCVE 5BR8L 1PH7A 1KD1C 4NXNQ 1SFOH 2R7ZH 1JJ2A 1HZBA 2MO0A 5FLMG 1QZHA 2PNHA 3STBC 3CC7A 1NTGA 5JJKA 1OXSC 3GTKH 2V1CC 1WFQA 3S14H 3KYHC 5M5YH 1I94L 2HIVA 4UP7A 4DNIA 1TWGH 2D62A 4A3GH 4DV1L 1DGSA 2KENA 4R4QA 1Y1WH 2WP8J 3B6YA 3PV0A 3I2ZA 2PI2E 4DV2Q 1S40A 3AFQA 4A3FH 2RHSB 4DR1L 1C7YA 3PO2H 1MIUA 1VQIA 2A19A 1TXYA 1AE2A 1UE7A 5ELOA 3FHWA 2ID0A 4MTNA 2OTJA 2Q2TA 3A5UA 1VQ9A 2WB1E 2EQSA 4UPAA 3U58A 4JI5L 3GTPH 2KBNA 5AJ3Q 3MXNB 4O2DA 4DV3Q 2AWOA 2Y0SE 1Q86C 1E22A 2OWOA 1V9PA 3RN5A 3GDEA 4LFAL 4GOPA 1ASZA 1EWIA 2UU9L 4DK6C 2ASBA 3PCOB 3HFZB 4IPGA 3U50C 2DUDA 3PUZA 1EUJA 4HIDA 1VQOA 2UUBQ 5J3BA 4QQBX 3CF5A 2HIXA 1YHQA 2NVXH 3K7AH 1KAWA 2UXDL 2HHHQ 1X3GA 2NVQH 2JK8A 4P72A 1X55A 1R9TH 1XNRL 3CCQA 4L5TA 4A3CG 5IWAQ 3HKZE 4GKJQ 1U0LA 4B3TQ 3GTOH 5GAGC 4JYAQ 5K36G 4DV5Q 2WAQE 1K0RA 3UE1A 1HNWL 3U4VA 1YIJA 4JI0Q 3D31A 1E1TA 4IOCA 4DV4Q 4JI6Q 4DR7Q 2K52A 3ULPA 1IBKL 3HOXG 3UDFA 4YWLA 4A3DG 1SROA 1YITA 4EX5A 3FP9A 4HIMA 2R7FA 4PZ6A 4QIWE 2NZHA 1E7ZA 5M3MG 2N78A 1FL0A 3M4QA 4OONA 4HJ5A 3JAMi 1CKOA 4Y7NH 5JEAJ 3NELA 3H15A 3F1ZA 1U5KA 3G4SA 1VQ7A 3HOYH 1AE3A 4LFCL 4GNXB 1TWCH 3UDGA 3PUVA 3HOVG 3KFUA 4A93H 3F2DA 2BH8A 1HJPA 1W3SA 4DR5L 4DUZL 4A4IA 1HZ9A 2E8GA 2JQOA 5IE8A 1Y1VG 4A3KG 1YJNA 4GS3A 4B3ML 5EAYA 1TWFH 4NB3A 4DR2Q 3UDXA 1XTDA 3GTGH 2I5LX 4H02A 3I56A 4NXML 4JV5L 4LF7L 4KHPQ 1L1OB 3KDFA 4DKAC 1PYSB 1XMOQ 1IBML 4LFBL 4B3RL 1Q7YC 3M4OH 1YVCA 2KHJA 2YV5A 4JI3L 2JA9A 5C4XH 1QVGA 4WJ3M 2AMCB 1X3EA 1LTLA 4BBSH 3KJPA 4GOPC 2OQ0A 1J5EQ 2GN5A 3K8AA 2VQFQ 4L5QA 1QZGA 3RZOH 2YTYA 1B7YB 3CPWA 1K8GA 4YCUA 1YBYA 3OTOQ 2ZM6L 1E1OA 1PH1A 3S15H 4XIGS 4KLKA 2E2IH 1G51A 1X56A 1KIXA 1CUKA 4JI1L 3ICEA 2D0PA 1HZCA 4JI8L 4LW1A 1UE5A 4AYBE 4MZ9A 3AFPA 4R4OA 1VQLA 5GAEC 5BR8Q 2UUCQ 2HT1A 3S1QH 2MQHA 1VQ4A 5JJLA 3CQZH 1TWHH 1J6QA 3S24A 2MNAA 4A3IH 3HOZG 4GKKL 4AQYL 1PHJA 4P74A 1I94Q 2H5XA 4BBRH 3BZCA 1SLJA 3H0GG 4YY3L 4OWWB 1N33L 2ATWA 2QGQA 1ASYA 4DV1Q 2K5NA 3RLFA 1VS0A 4JI7L 2N8NA 2E2JH 5C0XJ 3TEHB 4OXPA 4JOIA 4DR1Q 1JB7A 2R93H 3J80c 1G291 5HY6A 4MNOA 4RMFA 1VQ8A 3I7FA 1XMQQ 5IYCG 4C3JH 1UE6A 3J81c 4JI5Q 5GAHC 5IYBG 1KL9A 4A3MH 4LF6L 3I4MH 1WI5A 2MFIA 4BY7G 4LFAQ 1OXUA 1Q1EA 1PH2A 1BVSA 4QL5A 3NBHB 3M85A 4A3BG 2YTXA 1Q81C 4DR3L 2FXQA 5IY0A 1TWAH 4X62L 2UXDQ 1CSQA 3J80i 1XNRQ 2B63H 3TS2A 2D0OA 1L2FA 1X65A 4XTCS 1H95A 4YWKA 1W2BA 1N8RC 4GOPB 1JE5A 3J81i 4A3LH 3JC66 3CCRA 1HNWQ 1NMGA 1I3QH 1IBKQ 1KC8C 2VW9A 2IHEA 3NENA 2ZJQA 1EIYB 1V1QA 1C0AA 5IYDH 3E0EA 2AHOB 3DM3A 1KHIA 1SN8A 5LMUL 5C3EG 4BY1H 5C0XI 4X66L 5M5WH 3PO3H 1RIPA 2JA8H 1QVFA 2R6GA 3W5OA 2K4KA 4LFCQ 3TREA 4LF4L 3AQQA 3I4NG 1WCMH 4J15A 4IPHA 5JJIA 2R7DA 2WB1G 4DR5Q 4DUZQ 4IFDG 1OXVA 2A8VA 4ALPA 2EXDA 1A0IA 3DLLA 1HR0L 2Y0SG 1HNZL 3HOUH 1A8VA 5IP7H 3JAMc 2JA6H 4NPSA 3KJOA 4P75A 1KQSA 1OXXK 4JOIC 1NMFA 4R1JA 5IP9H 3M9BA 1PH4A 2NVTH 4B3SL 4NXMQ 4JV5Q 3PUXA 1FVIA 1KRSA 3TS0A 1IBMQ 4LFBQ 3S2DH 4JBJA 4QGUA 1KRTA 2R92H 4B3RQ 2B29A 4JI3Q 1VQHA 4JC0A 3TQYA 2JA7G 1RL2A 1MJCA 1YI2A 1NY4A 3HKZG 4YCWA 2CKZB 4A3EG 2VS1A 3OYYA 4JBKA 1VQFA 2PQAB 2WAQG 2ZTCA 2F52A 4P73A 1PVOA 4PZ7A 3KDFB 4JBMA 4WJ4A 1KXLA 2ZM6Q 1VQMA 4YWMA 4PZ8A 4TVAB 4YHHL 2OCEA 1EYGA 2Z0SA 3S1MH 3L2PA 1S72A 1D7QA 4JI1Q 1G6PA 1XJVA 4L5RC 1X9NA 4JI8Q 4DAYB 4A3JG 1HH2P 2CCZA 4EQ5A 1VCIA 1CKNA 4DV0L 3ER0A 2KCMA 5M3FH 4JI4L 2BH2A 2K50A 2ZTEA 4C2MH
chains in the Genus database with same CATH superfamily
1SMYC 4WJWA 1CA5A 2CWAA 4YY3Q 1I5FA 2E75C 1BBXC 4RCNA 4QUCA 3CU7A 2MUYA 3W1GA 4EVOA 4DGZA 1GKHA 1WVLA 2F0KA 3K0XA 3AMUA 2J4XA 1Q8KA 1PLFA 1GVPA 1VQEA 3KF6A 2LSSA 3J81j 1UEBA 5C44G 2JYOA 3IL8A 3F2BA 4NP5A 4HJAA 3IRBA 4J8QA 3MXUA 1EU4A 2F4VL 2IL8A 1SNOA 1HUMA 1ICFB 4KMUC 4DV7L 4DR3Q 4GKJL 3ND9A 1HRJA 2L55A 4Y52H 4A3FG 4GNXA 1N34L 4RH6A 5LMNW 2A6ED 2G5DA 4AYBG 3PMFA 3JAML 2OF1A 3I73A 4HR7B 4DUYL 2IY5B 3G6EA 3I4MB 1LTTD 5I9PA 2PW5A 4L6TB 1GUOA 1PTOD 1N36L 3DM1A 4JPBW 4LUVA 1X32A 2L15A 4LF9L 1EIHA 4XDXA 4IPDA 3E0JA 2EY5A 3C1EA 4HIKA 3EA6A 4B9XA 3GTMH 2B63B 5FKAC 1UUPA 3MVVA 1VQNA 2NYZD 1HNZQ 5D14A 1JICA 4EQOA 4IUQA 5EJWA 4FXGC 1SE8A 4A3KH 1C4QA 2A68C 2G9HD 4DAMA 1AW7A 3NTHA 5CYUA 1NCVA 1IYJB 1EQTA 2K6AA 1LTID 5M5WB 4C3HH 4DR6L 5FLXE 1QOHA 4A93G 3KK7A 2CWPA 1EQVA 5T1GA 1F2MA 1IBLL 5FOBB 1MSHA 2EY2A 1C48A 2IPKD 2NN6G 4KV6A 2NVTB 1XWEA 4DV0Q 5KRUA 5DNFA 5J39A 4X64L 4LWCA 4B3MQ 3S2DB 3MC0B 3PF4A 4L5SA 4BA1I 2I5HA 3F8TA 4LF7Q 1MD2D 1PH3A 2Q2UA 3HOZH 1VDZA 1P16A 5LL6X 2VQEQ 1FJGL 1CKNB 1N32L 1STGA 5LHY1 1JWMD 2O5JC 5EQ0A 4I7ZC 3RLNA 2F03A 1XTCD 1SE3A 1A2UA 1EZ6A 1UWVA 1K73C 4POFA 2IX3A 1M1KC 3PUYA 3S16H 4S3SA 2XNAC 2EYJA 5IYBH 4IURA 2EYOA 1Z9FA 3ZJYC 1AH9A 3KF6B 1Q12A 1VMPA 4KY7A 3T1YQ 3RZDB 5BN3A 3C2PA 1W6JA 2R93G 3PUWA 3K80C 3IAYA 4RGNA 1LYLA 2NBFA 3SR1A 4DAVA 5ISRA 4GKKQ 4DV2L 3GP7A 3S2HH 4HIOA 1YJ9A 4C3JG 2F1MA 5LMNQ 4UP8A 1IZ6A 3MZ5A 2B2YC 1E2WA 4M8AA 1B4OA 2LY7A 2UXBQ 4X65Q 1B2TA 2E2IB 2N3SA 3ZYYX 1LABA 2VY3A 3EJIA 2UUBL 4R8NA 2DNCA 4AH6A 1QJOA 2J7ZA 2L5TA 1E2VA 2NN6H 2PQAA 1SR3A 4BBRB 1ET6A 3F2CA 1ILPA 5JAVA 4DV4L 4JI6L 3CAMA 1EY0A 1ZEQX 4BY1G 1WTQA 2C5CA 2JA8G 4A3DB 4FP5D 5I2YA 5KNBA 2D2CC 4LF8Q 4BA2I 4G7OC 1BR9A 1IYVA 5ELEA 1X3QA 2Q2HA 5HGQA 4HSVA 1A3VA 4H0LC 3BU2A 2F0OA 1EY5A 1TKWB 2KHSA 4HMIA 4O0AA 3UDIA 3PIOA 3BS1A 5IIFA 2A6HD 1PFSA 2KCCA 2F0HA 3Q8DA 1NAPA 1O7IA 4FVMA 4A3JH 1M90C 1X6OA 1XMOL 1AZQA 2Z4IA 4IZ8A 1XNQL 2YU9H 1VQBA 1L0WA 3UE0A 3KLRA 3FKIH 1IKLA 3E6ZX 2EDGA 2A6EC 3QOLA 4DA2A 3SE0A 4CHTB 1K3BC 1YJWA 4DR4Q 4HJ8A 3J7AV 1EIGA 1K83H 1QUQA 1KDCA 3K6OA 4RGTA 2V4DA 5C4JH 1HA5A 4NXNQ 1KD1C 1PTOC 4X3SA 4HEDA 2MO0A 3FRPB 3OMGA 3VR4A 4M1UB 3CC7A 3GTKH 1WFQA 1H9MA 1SXTA 5M5YH 5J22A 4DNIA 3DMUA 2KENA 1Y1WH 3B6YA 2PI2E 3AFQA 3NP8A 1C7YA 2KECA 1TXYA 3IFDA 2OTJA 3A5UA 4UPAA 2EQSA 3U58A 2EZVA 4JI5L 3M3YB 2KBNA 5AJ3Q 4O2DA 4KKSA 1U4MA 2NZ1D 1F2LA 4LFAL 1ASZA 3R3OA 4BY7B 3U50C 5D65A 2K7VA 4CKCA 4QQBX 2MGSA 3GTJB 5DM73 1X3GA 2JK8A 4P72A 4A3CG 4GKJQ 1U0LA 4HSPA 3WOFA 4JYAQ 4DV5Q 4OO1H 2CQAA 1HNWL 1DONA 5I6YA 3V96A 1EY9A 3HOXG 1GUWA 1BDOA 2VB3X 2QF7A 4QIWE 1E7ZA 4DFAA 3M4QA 4QMGA 4OONA 2RDHA 1NUCA 1BF4A 3H15A 4G7ZC 2K32A 1EWCA 1W3SA 4A4IA 1Y1VG 3EROA 4KD3A 4J6HA 3G6JB 1B50A 3GTGH 2I5LX 3D4RA 3VR3A 2DNEA 1IBML 4B3RL 1Q7YC 3E5SA 2YV5A 4JI3L 1QVGA 1CTMA 3KJPA 2JA7B 3K8AA 3NK9A 1TR5A 1QZGA 1RD9D 2ICEC 1B7YB 1J9OA 1JC7A 4YCUA 1YBYA 1K8GA 2E76C 1PH1A 2WAQB 4BWGB 4HMJA 2EE1A 5JJZA 4QB4A 5IGFA 3DWPA 1HZCA 1BCPB 4LW1A 4UHVA 4K5XA 2K01A 5GAEC 1HQRD 1MGSA 2IW3A 3BYYB 4RA8A 4P74A 4CDDC 2ATWA 4YY3L 1EY4A 1PDQA 2QGQA 4DV1Q 1D5XC 4JI7L 1SE2A 1JB7A 3J80c 4IQZA 1CFMA 4RMFA 5EKIA 3VYUA 2PQEA 3J81c 2RQXA 5GAHC 4K5WA 2G9DA 4EQNA 2N88A 2DJGC 3I4MH 1WI5A 2MFIA 2Q8IB 1NR4A 4Z9CB 4KJNA 1LTGD 1Q81C 1EL0A 4DR3L 1H9SA 3S14B 5E4XA 2UXDQ 1CZGA 1TWAH 2XN9C 3J80i 1RF2D 2B63H 2D0OA 1L2FA 1H95A 4XTCS 1K0SA 4A3FB 3J81i 3JC66 1TS3A 5JEAH 3HOZB 2A6HC 1NMGA 4K14A 4AYBB 1IBKQ 2VW9A 1V1QA 3NTIA 1M4VA 3LNNA 1KHIA 4KN7C 5M5WH 1RIPA 3F2UA 3HP3A 1QVFA 2R6GA 3W5OA 3S16B 1BCPD 1D5MC 1I6VC 3I4NG 3K7AB 4ZK9B 1MBYA 4OIJA 2B2UC 4DUZQ 4IFDG 2A8VA 1SMYD 2EXDA 4C1NI 4K6LA 1QG7A 1EYDA 3LX0A 1STBA 2AUJD 1A8VA 5IP7H 4WORA 3JAMc 1HNZL 3HOUH 1ML0D 1JOOA 4JOIC 1PH4A 2NVTH 1JOQA 2NTSA 3VYRA 4JV5Q 4LFBQ 1QCBD 3S2DH 4N9PA 3HS0C 3TQYA 2BOSA 1YI2A 3HKZG 3K57A 2HUGA 4A3EG 2VS1A 1H9KA 2Z9HA 2ZTCA 4P73A 4X3KA 4A93B 4TVAB 4XQNA 2OCEA 2QCPX 3L2PA 2JP1A 2OT2A 4Q5VA 1JOKA 2RBMA 3OW7A 1G6PA 3TZDA 4L5RC 4O1NA 3WDNA 4DV0L 3ER0A 5C0XH 3QR8A 2F0MA 4ZUJA 2BH2A 2A74C 3Q22A 2ZTEA 1RHPA 4C2MH 4AQYQ 3R93A 1G8ZD 2E74C 5FJ8G 3I91A 3RZDH 1N33Q 3D6CA 1JJGA 1OO9B 4DK3C 3SVMA 1T9HA 2VQEL 3TP7A 1V43A 4K2LA 3NWTA 4ME3A 1XNQQ 3OSOA 2F0PA 1CM9A 3NXWA 4CJ1B 3L3OC 5CV8A 3SGIA 1VQKA 2L9HA 1EY7A 1DCZA 1XPUA 3U4ZA 3SHLA 5FLXc 2QDLA 3FDTA 4QY7A 4HN7A 3T1YL 1LV9A 4PV1C 4RAUC 2B2TC 1QB5D 2PI2A 1B9MA 4OIKA 1SRUA 1NNXA 1STHA 1F2ZA 4KHZA 3PSIA 4XYQA 5C5LA 1H9SB 2TMPA 2JSOA 5LMNL 4C3JB 1PH9A 4RG1A 4R4CA 1OTCA 4DK0A 5E7NA 2F0DA 2UXBL 1F9RA 4X65L 4A3DH 1L1OA 2BCOA 2F0UA 4LF4Q 2GVBA 1X3PA 1ENAA 4GN5A 5IGCA 1SYCA 3AYHB 1Y8OB 1L0XB 3HOVH 2QILA 2Q2IA 3NHHA 2MJ8A 2CH4A 4K8IA 1EIFA 1K8MA 4J1MA 4KTAA 4N9TA 4RGOS 3G48A 2DJFC 1A63A 4DXGA 4LMQD 1L0YB 4RKLA 5C4HA 4IFDJ 2F0LA 3HOYG 4FDBA 1PRTD 4LF8L 4FF1A 2Z1CA 2LXJA 5DLQE 5KIXA 2F0IA 2X6GA 3D4WA 4YHHQ 4OWXB 1NBWA 2WFWA 3LWEA 4X3TA 2B3GA 4FF2A 1LO5D 1SNDA 3ERSX 1Z47A 3SK6A 3K81C 1E3PA 3DWQA 4K5VA 1B3QA 2JE6I 2OQKA 5C4XG 2OTLA 3A54A 3K7UC 2I0QA 1DZ1A 1NE3A 1LTAD 4P71A 3NBHA 1SNMA 2R3ZA 1K3RA 2EPBA 1DOMA 4K0KQ 1FNVA 2NN6I 1CQVA 3PIP3 4ZLTF 1SNCA 4DR4L 5M5XH 4G4KA 3M3YH 5J1ZA 5IYCH 5D3DA 1F9PA 3ONAB 1Y14B 4A3IG 2A1AA 5I2XA 4NXNL 5EGTA 3C46A 2YYZA 2E5LQ 3L7ZC 4ILWA 4BY7H 1SNPA 1DD2A 1BCPC 3J81L 3TRZA 3AEVA 3GTJH 4AIMA 3CW2C 3G71A 2VZAA 4KKTA 3E9IA 5I6WA 4V190 4JI7Q 2JN4A 3H09A 4IOAA 4XXEA 1K8AC 1GO3E 1BBWA 5AJ3L 4DV6Q 2EJMA 3O13A 3V2TA 1IHZA 1TS2A 4N8FA 1K9MC 1PTOF 4NW2A 1F77A 1KDAA 3KF8B 3CMEA 3CHBD 3MA2B 2MPMA 3I55A 3CCUA 4A3LG 4LF5Q 2M00A 2JEBI 4GLXA 4JYAL 3TP5A 4DV5L 2XTIA 5IYDG 4IJLA 1DJRD 4POGA 2IX0A 4PQXA 1BBUA 2IT1A 4LUOA 4MHEA 2UUAQ 3HOXB 4DAYA 4OX9Q 3PO3G 1SNQA 4F7XA 1Y8NB 2K75A 1JT8A 4H44C 1EFWA 1GXDC 3KLWA 1PMRA 2JA7H 4H13C 1EWHA 1GHKA 2LKVA 3EQLC 2K5WA 2RF4A 1SAPA 2K14A 1CI3M 5CV7A 1CQFA 1STAA 1LACA 3HRZC 3CCSA 3T1HQ 5IP9G 1TWAB 5ELBA 1Y1VB 1QILA 2R92G 2PMZE 2DY8A 5COYA 2CQOA 2XGTA 5JOBA 3GTLH 1CK1A 1QNKA 2K28A 4JBWA 5CORA 5GADC 1CA6A 2SOBA 1HNXQ 2B2WC 1D2BA 2NVYB 4FXDA 2RHQB 1PH6A 3KLSA 4RCOA 4OO1I 4QF4A 4RGMA 5C44H 2JEAI 4U673 3W2DA 3KLSX 3HOUB 3LWUA 4RFBA 3BDOA 5FLMG 5D3IB 2ICIA 5JJKA 3I70A 2D9UA 2V1CC 4RKBA 3S14H 1BOSA 4CDCC 4UP7A 1SE4A 1TY0A 4DV1L 3FPUB 4OELB 5FLXL 4C3IG 4A3FH 2QKIC 2O4XA 1MIUA 2A19A 2PCFB 1O80A 3FHWA 2ID0A 4I7AA 2BDOA 1VQ9A 2WB1E 3S1RB 4LJZC 2KEEA 3MXNB 4RHRA 2Y0SE 1Q86C 1EY6A 3GDEA 3J7AF 3Q23A 4GOPA 2EJFC 2UU9L 3PCOB 3HFZB 4IPGA 4BXXG 3PUZA 4HIDA 1EUJA 1PRTC 4IUTA 1VQOA 1EOTA 2RCFA 3QO2A 1YHQA 3K7AH 1KAWA 2UXDL 1AZPA 5CBAE 4C2MB 4B3TQ 2EYHA 3I8ZA 5K36G 1G2TA 3UE1A 2K03A 2WV6D 3D31A 4DR7Q 3ERQA 2K52A 1IBKL 4YWLA 1SROA 3FP9A 4HIMA 5M3MG 1FL0A 5FO9B 4L8JA 5DEHA 1CKOA 2H1EA 3TN2A 2SNMA 4I65A 3G4SA 1VQ7A 1AE3A 1SYBA 4GNXB 3UDGA 4A93H 1V8QA 4HTHA 3F2DA 3TP8A 3I4NB 4CBVA 4UAIA 5IOCA 4DUZL 1HZ9A 2JQOA 5IE8A 3N6RA 4GS3A 5EAYA 1TWFH 4DR2Q 1O78A 3UDXA 1I4HA 4H02A 4JV5L 4KHPQ 3KDFA 4LFBL 4JK1C 4XQJA 1TQOA 5DAUA 3H91A 2SEBD 3FVQA 1ENCA 4KK7A 3VA7A 2OQ0A 1J5EQ 2GN5A 2L4NA 2FFKB 2YTYA 4A3EB 2HD3A 3OTOQ 3OMCA 1E1OA 1S4ZA 4C1NK 2F0GA 3S15H 4XIGS 4ZYSA 1KIXA 1CUKA 1JE4A 3A8JE 1HQMC 5I4DA 1II3A 2F4IA 2Z6BA 5E4WC 3HOVB 1VQLA 4XT1B 3H6MA 1Q3LA 3SK5A 2MQHA 3I90A 1TWHH 3S24A 4AQYL 1PHJA 1SLJA 3H0GG 1N33L 1ASYA 2N8NA 1V1PA 2E2HB 2B2VC 4OXPA 4DR1Q 2R93H 4C56C 3VR5A 5HY6A 1VQ8A 3I7FA 3OIQA 2EXZA 3X3NA 4C3JH 4ZKBB 2NB0A 1QE6A 1F2YA 5CBEE 5EBCA 3SK4A 1PH2A 1BVSA 2X69A 4QL5A 3V05A 3I72A 3DWAA 1PXUA 4A3BG 1ESFA 2YTXA 2F0SA 3A8KE 2P5ZX 4PMBA 1XNRQ 2JXMB 5C4ZA 2AUKA 4GOPB 5AFWA 1STYA 1WTPA 4ABNA 2CHBD 1VF5C 1KC8C 3GTPB 1SSOA 2ZJQA 1EIYB 3E0EA 1H9RA 3I4LA 1HTLD 1SN8A 5C3EG 3OWEB 5C0XI 4BY1H 3K5MA 2JA8H 5M5XB 1GUTA 1H9JA 2O2LD 3TREA 4LF4L 2NVXB 4J15A 1FD7D 3BG3A 4IPHA 1Z7TA 2NVQB 1JR0D 1R9TB 4DR5Q 1OXVA 4MN3A 1HR0L 1EEID 1JORA 1B3AA 2VB2X 1ZKOA 3KJOA 1KQSA 1NMFA 3A56A 5EPKA 4NXMQ 3PUXA 3TS0A 4JBJA 4KN4C 1VQHA 4JC0A 1S5FD 4FYDA 1U4RA 1NY4A 1I4GA 4YCWA 3AU7A 3OYYA 5A2QE 3HOYB 2PQAB 1TWCB 3RMHA 3KDFB 2ZM6Q 1VQMA 5IGGA 4YHHL 2Z0SA 1EU3A 5TSSA 4JI1Q 1RTNA 4JI8Q 3SEBA 2WACA 3GV3A 4EQ5A 1MI2A 5DM63 1TVXA 1E2ZA 1CHPD 3TZUA 3ULLA 3K59A 1XPRA 1PZKD 3URYA 1VQPA 2VUMG 1E24A 1TIID 5EBDA 3T53B 3KOJA 1RKNA 4IO9A 2IHFA 3OPOA 4K0KL 1Z6HA 4F88A 1VQDA 2K05A 3FMCA 5GQOA 4IJHA 2K04A 1V1PB 3M4PA 4LK1C 4LF6Q 3PF5A 1NJIC 2R7ZG 2Z8LA 5IGBA 1UEAB 4IPCA 2E5LL 3BZKA 4A3IB 1Q90A 3WWVA 2C35B 3CCMA 4A3GG 4CJ2C 4X62Q 3M4OB 4APVA 1I4PA 4G7HC 4EGVA 4A76A 1RTOA 3GTLB 3PO2G 1CKMA 5JPNC 4A3CH 1QUQB 1VQJA 3GQBA 4A75A 3VYTA 1EQRA 3NUCA 4XT3B 3HOXH 1S5DD 4DV6L 1B53A 5LMUQ 4H7BA 1UE1A 2A69D 4PMCA 5C44B 1BCPF 1LT6D 1O7LA 1Y8PB 5IT9E 5FK9C 1WTXA 2UU9Q 1GUNA 5I9OA 4LF5L 2RDGA 4ZRZA 1JMCA 3QOJA 1Q46A 4FXKC 1Y1VH 4B3SQ 1I3QB 3CC4A 1A2TA 1PFMA 1UNSA 2UUAL 4OX9L 3HOWG 2K5VA 1EY8A 1A15A 3PO3B 2NUCA 4PNYA 1RJTA 1O7YA 3BVZA 3PIPA 1IXRA 4FF4A 2ALYB 2BA1A 3RLOA 2NVYH 5EKLA 3K5NA 3QIAA 3T1HL 4WRDA 1A3TA 1LM0A 4GNXC 3H94A 1WTOA 1Q1BA 3IFTA 4KY6A 1HR0W 3D4DA 1BKBA 1W6KA 2ZTDA 3CRKC 3MFGA 4PMWA 2MO1A 1VF7A 4BBSG 1DOKA 3NQTA 2FINB 1FR3A 2F0VA 5C3XA 3X3MA 1Q8IA 1GJXA 1XMQL 2WINB 4HCEA 1HNXL 1EQQA 5ELCA 1ICWA 4GLVB 2TSSA 1VQCA 3A74A 4KKUA 3S1RH 5CV6A 3EIVA 2WIIB 3MWYW 3OHXC 4R4TA 2PW7A 4NMZA 4BBRG 1ZXTA 1TWFB 1STNA 3T56B 2N49A 1VQ5A 1JWUD 3RR5A 2EOTA 3MXPA 3CCJA 4KY5A 1IW7D 1I4RA 4A3MG 2ZXOA 3Q24A 4DK1A 1GM5A 4OGQC 3CRLC 3HOWH 3EBEA 2UXCQ 2F0JA 2QA4A 3S15B 1PA6A 4KJOA 2HQLA 1JQYD 4JI2Q 2Z6KA 1SBBB 1TWHB 2XRSD 3CCVA 3I4NH 1XPOA 4PG3A 4LNQA 2L0CA 2FMCA 4B3TL 4IFDH 5C5MA 2F0FA 2B8GA 1HXYD 1K28A 4CJ0B 4OL7A 4Q0FA 4DR7L 2R93B 2CW0D 1IL8A 2KCTA 2QEJC 3MEFA 2ZJRA 3BVMA 5M3MB 1DOLA 3VR6A 2F3WA 1FGUA 1WCMG 4JG2A 3RD4A 1C9OA 4UP9A 1JB3A 1PRTF 1LUZA 1B70B 2BDNA 2I46A 2OEOA 4A3EH 1MJEA 3QG1A 2JA6G 1VQ6A 3TBIB 2CFMA 4B08A 4DR2L 2KOLA 1HR0Q 2VXWA 3P20A 1VMCA 5T1IA 3SXHA 4KHPL 2EYLA 2RSOA 2VL6A 3P1HA 4B9WA 3GTQB 1K8OA 3IKJA 3J7A5 2GVAA 1I6HB 1HFNA 1WTRA 4IUNA 2AKWB 2RCNA 5FJ8H 1J5EL 2QW7A 2E2HH 1PZJD 2XWJB 4BY1B 4FO2A 1XXGA 3OTOL 3TSSA 2JA8B 1PYBA 5C3WA 1SMXA 4KHVA 3H3VH 4OWTB 1EYCA 2EY6A 2Z4HA 5CR3A 1WYDA 5M3FG 4JCVE 4K8JA 1PH7A 1T5EA 5ELDA 1SFOH 1JJ2A 1SJHD 1QZHA 3KBXA 2A69C 1GUGA 1JCKB 1F9SA 2FHTA 3I3CA 1DGSA 3H0GB 3PV0A 1HUNA 1WTVA 3W3AA 4DR1L 4R9WA 2F0EA 1UE7A 1HA6A 3BYTB 3GTPH 4DV3Q 1E22A 1PYWD 2OWOA 1V9PA 3RN5A 2KEDA 1EWIA 2B39A 2SNSA 2PZTA 5JPMC 2IWHA 3CF5A 2HIXA 2NVXH 2RKSA 3EFXD 4A3BB 2HHHQ 2NVQH 1XNRL 1R9TH 1KAAA 5IWAQ 5BN5A 4FNFA 2E2DC 1KABA 2WAQE 3U4VA 1YIJA 4JI0Q 1E1TA 3NSWA 2ENBA 3UDFA 4EX5A 3K5LA 2R7FA 4PZ6A 4HJ5A 2O5IC 2N78A 4IUPA 1AN8A 3L9AX 3D8GA 5C3EB 1U5KA 1PTOB 3HOYH 1TWCH 3MEHA 1B1ZA 5E1FA 4DR5L 2E8GA 4A3KG 4RHSA 1TT2A 3QJYA 1BXTA 2F0QA 3BZDB 4V0BA 4NB3A 2LS01 5G3LD 1XTDA 1TY2A 2HDLA 1ONLA 1DM0B 5CV4A 4CDEC 3I56A 1UAPA 4NXML 1L1OB 4XQQA 4P2CB 1ENFA 4C3HG 1B9NA 2KHJA 3NWSA 5C4XH 3Q0AA 1D1KA 4WJ3M 2AMCB 1X3EA 2KCNA 2PNRC 1E0BA 1I50B 2VQFQ 3K5OA 4L5QA 5IGDA 3JAME 3CPWA 2RSNA 2ZM6L 3M4YA 1IW7C 1G51A 1X56A 2L12A 5KEEA 4JI1L 4L63B 2D0PA 1STEA 5NUCA 4QIWB 4JI8L 1UE5A 4AYBE 4MZ9A 2UUCQ 3AB9A 3FEWX 5BR8Q 1VQ4A 1NR2A 2KA7A 2MNAA 4A3IH 3HOZG 3A55A 3TMEA 4CDFC 1I94Q 4OWWB 3BZCA 3M4OH 2B2UA 2K5NA 3RLFA 3TEHB 4ZQ3A 2LFNA 4JOIA 2VUMB 1G91A 1G291 1YNND 3DUZA 2A73B 1XMQQ 1UE6A 5IYBG 1KL9A 2AQ2B 4LF6L 2CW0C 1V1OA 3S17B 2R7ZB 3NBHB 3M85A 2R61A 1LT3D 5IY0A 4X62L 3T4AC 1TWGB 4A3GB 5IODA 1X65A 2WKDA 4YWKA 1W2BA 2PZUA 1JE5A 3R2IA 4CGYB 4A3LH 2A5HA 3PO2B 3CCRA 1WTHA 4CKBA 1I3QH 1S5ED 2IHEA 4DNTB 5IYDH 5LMUL 2BE5D 3QB3A 1XX8A 3NQIA 3PO3H 2K4KA 2PO4A 4LFCQ 3A8IE 4F87A 3T16A 2L1BA 2R7DA 2WB1G 3DLLA 2Y0SG 3GTOB 1D1IA 3KUPA 3S9WA 4P75A 1ESRA 1OXXK 5IP9H 1WD1A 3M9BA 1DYQA 4B3SL 5KGUA 1FVIA 4IN3A 4NKLA 4DAPA 2R92H 1KRTA 3J7YW 1RL2A 2KQ3A 4Y7NB 2PPBC 3HOWB 2B2TA 1KLGD 1VQFA 3BDLA 5KNDA 4WJ4A 1KXLA 4YWMA 3EVQA 4PZ8A 5KYIA 2X6LA 2F0WA 2RDFA 3S1MH 1S72A 4LAAA 4DAYB 4A3JG 2CCZA 1VCIA 3TDQA 3KBGA 2KCMA 4ZKCB 2K50A 1LTLA 2KVMA 3OW2A 1KNAA 1YNXA 3RNUA 4GLAC 2RVLA 4LUZA 1D8LA 3FKIG 5FLMH 4BBSB 1SYGA 5IT9c 3VR2A 1SJED 2K33A 3RZOB 4GN4B 4FF3A 2ZXRA 3GD7A 1PZID 4C3IH 3CC2A 3RUZA 1SEBD 3HKZB 1LTSD 2KJXA 3D0FA 4TQUS 4DF7A 5FO7B 1TS5A 1G2SA 3S1QB 3K0YA 4KD4A 5E3FA 3CQZB 4ZCKA 2ZJPA 5LL6S 1LT4D 1JJCB 1T5XD 1BNZA 5EPLA 1Y1WG 4BXXH 2EVBA 2JA5G 3J7ZC 2E2JB 4QJFA 1YHAA 1P8LA 3HKSA 5K36H 2OXPA 1X54A 2QDBA 3GO5A 4U68A 3P7JA 4EQPA 3CXCA 2NZOA 4A3MB 1AP0A 4K2KA 2UXCL 1WOCA 1VQAA 4X66Q 3G7LA 3QWNA 4DN4M 5M3MH 1EYAA 3STBD 1RDPD 3T51B 3ULJA 4JI2L 1SFOB 1HZAA 3A5ZB 4OO1G 4HCSA 3CCEA 3OOCA 1LT5D 2HDMA 2EYPA 1XYIA 1EOVA 3UI2A 1N9WA 3CPFA 4HJ7A 1A6XA 5M9OA 3U9OA 3NEMA 3BJUA 3GTQH 3A7AB 2RA4A 3CP0A 3CMAA 2Z6KC 1FNWA 1ILQA 1YHBA 1I6HH 1RODA 1WCMB 1R4PB 4IALA 4DPGA 3I4OA 2XWBB 1SYEA 2ES2A 1A62A 1YNNC 1Q82C 2JA6B 5KYLA 1M8AA 4UDUC 2J0TD 3E9HA 1S5CD 3CD6A 2ZT9C 4HJ9A 4JI4Q 3L0OA 1IKMA 3NPPA 1WTWA 1X3FA 1MHWC 2JA5H 4X3UA 1WJJA 1HFGA 4YIJA 1L1OC 1FYCA 2Q8RE 3H0GH 1VQGA 4DXFA 1IYUA 2B8FA 3NBIA 5C6AA 1GD7A 1PH5A 1G6ZA 5BN4A 3R2TA 5GROA 4IFDI 2EJGC 1D6EC 2JJQA 2LXKA 2HQEA 5ELNA 5EPJA 2F3IA 2BE5C 2I5MX 2KHIA 5M3FB 2F4VQ 1AFPA 1GOZA 2IX1A 4DV7Q 2CVRA 1SYDA 4QCLA 1O7ZA 4A3BH 1YEZA 3M7NA 1N34Q 1FNUA 3W1BA 5C4XB 1DXMA 5A2QL 3LGJA 3NE5B 2XVSA 1HPCA 1I4QA 3M7GA 3S1NH 1FGBD 1B44D 3CCLA 4DUYQ 1PFNA 3I4MG 3HGBA 4DV3L 3DXJC 4GZYC 5H1SE 1MKHA 1N36Q 2EYFA 5HURA 4LF9Q 2XRQD 5K5PA 4ZAIA 5C3EH 1PTOH 1QVCA 2B63G 2B2WA 4YCVA 3D6WA 1KLUD 2MP1A 3WOEA 2HHHL 1A3UA 2EIFA 5JEAG 5IWAL 2AWNA 4JW0A 4TSSA 2EYMA 3MHBA 4JI0L 3H3VI 1EZ8A 3Q6SA 1PH8A 4XYOA 1YZ6A 3VYSA 4MIUA 3OWFA 4DR6Q 2YTVA 1KNEA 3PGZA 1KTKA 1I50H 3GV6A 3TP6A 2DGYA 3ND8A 2QEXA 1CSPA 4CKEA 5CGKA 4DU9A 3DHQA 2BA0A 3E3XA 3GTMB 3VA5A 4RWSC 3HOUG 5IP7G 1IL2A 1IBLQ 3CKIB 1S3OA 4G57A 4A3KB 1TS4A 1U4PA 2K1BA 4X64Q 4GN3B 2FMMA 5JVG3 4R4IA 1GHJA 2C9OA 2VNUD 1EEFD 2Q8TA 3ITPA 1PV4A 1KDBA 4KI0A 4C3HB 1B8AA 4HAEA 2PYKA 1FJGQ 1N32Q 3OIPA 2VQFL 1OXTA 3D3RA 3A0JA 4X6AH 1RCVD 2VUMH 3EN2A 4K6DA 4UY8C 2K5HA 3PQIA 5IT9L 5C0XG 2HCCA 3RN2A 3S17H 2UUCL 2B2YA 3VDYA 2K5DA 5BR8L 2R7ZH 1HZBA 5JVH3 3PIO3 1BUVT 2PNHA 1Y69U 3STBC 1NTGA 1OXSC 4NDXA 1ZYRD 3KYHC 1I94L 2HIVA 1TWGH 2D62A 4A3GH 2R92B 1GUSA 4R4QA 2WP8J 1S40A 4DV2Q 3I2ZA 1MSGA 2RHSB 2DN8A 3PO2H 1VQIA 3MTSA 1AE2A 5ELOA 4MTNA 2Q2TA 4O42A 2PMZB 1YNJD 2ZXPA 2AWOA 3MXGA 3S1MB 3A7LA 2K5QA 4DK6C 2ASBA 2UUBQ 2DUDA 5J3BA 2NTTA 1NSNS 2I07B 1X55A 4TRDA 3CCQA 4L5TA 3HKZE 3GTOH 5GAGC 4BS9A 3S2HB 1K0RA 4IOCA 4DV4Q 4JI6Q 2XSCA 3HG9A 2F0NA 3ULPA 4A3DG 1HTPA 1YITA 3T13A 4IUUA 2NZHA 2KUMA 4C3IB 4ULLA 3JAMi 1I4XA 4Y7NH 1AEXA 5JEAJ 5IGEA 3NELA 4E6IA 4QUFA 3F1ZA 5KNCA 2B2VA 1HHVA 4LFCL 2CH4W 3HOVG 3PUVA 3KFUA 2M2LA 2BH8A 3H3VC 1HJPA 3K58A 1LTRD 1YJNA 2WB1B 2NWGA 4B3ML 1CZWA 2PZWA 1BQQT 2Y0SB 2LMCB 1SYFA 5CV9A 4LF7L 3P75A 4DKAC 1PYSB 1XMOQ 2MHVA 4WFN3 1C8CA 1YVCA 2JA9A 2FJ2A 2XIWA 3FPPA 4BBSH 4MTKA 4GOPC 3RZOH 4ID6A 5L37A 1QWYA 1PRTB 4TKOB 4KLKA 2E2IH 1CT1D 3SK8A 2HCIA 2M9VA 3ICEA 3MAQA 2A68D 1TU2B 4R4OA 3AFPA 2L11A 2HT1A 3S1QH 4A3JB 5JJLA 3CQZH 1J6QA 1R4QB 2D5DA 3MFYA 4GKKL 1SDFA 2H5XA 4BBRH 3C1FA 2YU9B 1J8IA 1VS0A 1U4LA 3FKIB 2E2JH 5C0XJ 3KF8A 1D5ZC 4MNOA 3BDCA 5IYCG 4JI5Q 4JVZA 1K83B 2WKCA 4ZUIA 4A3MH 5C4JB 1S5BD 4BY7G 4LFAQ 1OXUA 1Q1EA 5EKKA 3DEOA 5ELFA 3GTKB 1LTBD 5CC4A 2FXQA 5M5YB 3BVGA 1CSQA 5FO8B 3TS2A 1WD0A 1Y1WB 1N8RC 5A35A 5CV5A 2JA5B 1HNWQ 3HZXA 4N8X1 3NENA 2SDFA 1C0AA 3DEPA 4ODGA 2AHOB 3DM3A 1LLRD 1PFBA 4X66L 3N52A 3U9SA 4ME5A 1U9RA 4F8MA 3AQQA 1WCMH 4OEMB 1ET9A 5JJIA 2GA4B 1QNUA 5CMDA 4ALPA 1A0IA 1EFID 1HCZA 4OHJA 2JA6H 3SDZA 4NPSA 2F0TA 3J80E 4R1JA 4DNRB 1KRSA 3J81E 2AQ3B 5G3LF 1IBMQ 4QGUA 4B3RQ 5HGTA 2B29A 3HEJA 4JI3Q 3S1NB 2JA7G 1BO0A 1MJCA 3C3LA 1ZYRC 2F3VA 2DY7A 2CKZB 3R8BA 4JBKA 2WAQG 2F52A 1PVOA 3NTKA 4PZ7A 1F9QA 4JBMA 4IUVA 1CHQD 4R8IA 2H4OA 1EYGA 2N55A 3J80L 2EY1A 1D7QA 1XJVA 1YNJC 1JWSD 1X9NA 1HH2P 2IJ0A 5F2DA 3GTGB 1CKNA 5M3FH 4JI4L 3MXNA 2AQ1B
chains in the Genus database with same CATH topology
3OW2A 1YNXA 4AQYQ 3RNUA 3ULLA 4GLAC 2CWAA 4LUZA 5FJ8G 1D8LA 3FKIG 1I5FA 4YY3Q 5FLMH 3RZDH 1XPRA 5IT9c 1N33Q 1JJGA 4DK3C 1VQPA 2VQEL 1T9HA 3W1GA 2VUMG 1V43A 1E24A 1GKHA 3KOJA 3K0XA 4GN4B 4ME3A 1XNQQ 3GD7A 4IO9A 2IHFA 1Q8KA 4C3IH 4K0KL 1GVPA 1VQEA 3KF6A 3CC2A 2LSSA 3J81j 1UEBA 5C44G 1VQDA 3SGIA 5GQOA 4IJHA 1VQKA 3D0FA 3M4PA 3F2BA 4LF6Q 4HJAA 3PF5A 1NJIC 2R7ZG 4TQUS 3IRBA 1XPUA 3U4ZA 4IPCA 5FLXc 2E5LL 2ZJPA 3BZKA 2F4VL 3WWVA 3CCMA 2C35B 4QY7A 4DV7L 4GKJL 1JJCB 4DR3Q 4A3GG 4X62Q 4BXXH 3T1YL 1Y1WG 4Y52H 4APVA 4A3FG 2JA5G 3J7ZC 4A76A 3PO2G 1CKMA 4QJFA 4GNXA 1N34L 1YHAA 2PI2A 5LMNW 1P8LA 1SRUA 4AYBG 4A3CH 3HKSA 1QUQB 4KHZA 1VQJA 3PSIA 5LMNL 1X54A 3GO5A 3CXCA 1PH9A 4RG1A 4R4CA 2NZOA 4DUYL 2IY5B 1OTCA 4A75A 1EQRA 2UXCL 3HOXH 3G6EA 1WOCA 5E7NA 2UXBL 1VQAA 4X65L 5LMUQ 4DV6L 4A3DH 4X66Q 1N36L 1UE1A 1L1OA 4LUVA 5M3MH 2L15A 4LF9L 3STBD 4LF4Q 2GVBA 4IPDA 3ULJA 4HIKA 4JI2L 4GN5A 3GTMH 4BXXG 3AYHB 2UU9Q 3HOVH 1HZAA 3A5ZB 1VQNA 2Q2IA 4LF5L 4OO1G 1HNZQ 1JMCA 3CCEA 1EOVA 1EIFA 1SE8A 1N9WA 1Q46A 3CPFA 1Y1VH 4A3KH 3CC4A 3G48A 4HJ7A 4B3SQ 1A63A 3NEMA 4DAMA 2UUAL 4OX9L 3BJUA 3GTQH 1IYJB 3CP0A 3CMAA 3HOWG 2K5VA 4IFDJ 2Z6KC 3HOYG 4C3HH 1YHBA 4FDBA 4DR6L 1I6HH 4A93G 3PIPA 4LF8L 1IXRA 2CWPA 4DPGA 2LXJA 5DLQE 3I4OA 2ALYB 4YHHQ 2BA1A 2ES2A 1A62A 3RLOA 2NVYH 4OWXB 1NBWA 3T1HL 1IBLL 2WFWA 1Q82C 1LM0A 2B3GA 4GNXC 3ERSX 2NN6G 1Q1BA 1HR0W 1Z47A 1BKBA 1E3PA 3K81C 4DV0Q 3E9HA 2ZTDA 4X64L 3CD6A 4HJ9A 2OQKA 2JE6I 4LWCA 4B3MQ 4PMWA 5C4XG 4JI4Q 2MO1A 3L0OA 2OTLA 4BBSG 3PF4A 3K7UC 4L5SA 4BA1I 2I0QA 1X3FA 2JA5H 1NE3A 2I5HA 3F8TA 1WJJA 4P71A 1PH3A 2Q2UA 4LF7Q 3HOZH 1P16A 2VQEQ 1L1OC 1FJGL 1CKNB 1N32L 1XMQL 3H0GH 1K3RA 1HNXL 1VQGA 1EQQA 3RLNA 4K0KQ 4GLVB 2NN6I 1GD7A 1VQCA 1PH5A 3A74A 1UWVA 1K73C 4POFA 4DR4L 5GROA 3S1RH 5M5XH 3M3YH 1M1KC 3PUYA 4IFDI 3EIVA 3S16H 5IYCH 2JJQA 2LXKA 5IYBH 5ELNA 1Y14B 2F3IA 4A3IG 2A1AA 1Z9FA 4R4TA 4NXNL 2I5MX 2KHIA 2YYZA 3ZJYC 2E5LQ 1AH9A 2F4VQ 3L7ZC 4BY7H 3KF6B 4BBRG 2IX1A 4DV7Q 1Q12A 3TRZA 3AEVA 3GTJH 3T1YQ 4AIMA 2N49A 4A3BH 3CW2C 3G71A 1VQ5A 1YEZA 3PUWA 3K80C 3M7NA 2R93G 1LYLA 1N34Q 3RR5A 3W1BA 4GKKQ 2VZAA 3CCJA 4DV2L 3E9IA 3LGJA 3S2HH 4HIOA 1YJ9A 3S1NH 5LMNQ 4A3MG 4JI7Q 4UP8A 1IZ6A 3CCLA 4DUYQ 1GM5A 4IOAA 3I4MG 1K8AC 3HOWH 1GO3E 1BBWA 3EBEA 5AJ3L 2UXCQ 4DV3L 2UXBQ 2QA4A 4X65Q 4DV6Q 1PA6A 2N3SA 1MKHA 5H1SE 1N36Q 1K9MC 4LF9Q 2HQLA 2VY3A 5C3EH 2UUBL 1QVCA 2B63G 3KF8B 4JI2Q 3CMEA 2Z6KA 4YCVA 3I55A 3CCUA 2EIFA 4AH6A 2HHHL 4A3LG 3CCVA 4LF5Q 3I4NH 2PQAA 5JEAG 5IWAL 4PG3A 1XPOA 1SR3A 4LNQA 2JEBI 4B3TL 2AWNA 4GLXA 4JYAL 4DV5L 2XTIA 3F2CA 5IYDG 4JI0L 3H3VI 1PH8A 4DV4L 4JI6L 4DR7L 4IJLA 3CAMA 4POGA 2IX0A 1YZ6A 1BBUA 2IT1A 4LUOA 4BY1G 2UUAQ 4OX9Q 3PO3G 2KCTA 1JT8A 2JA8G 2K75A 3MEFA 2ZJRA 4DR6Q 2YTVA 1EFWA 3KLWA 3PGZA 2JA7H 1I50H 2QEXA 1FGUA 1WCMG 2DGYA 1CSPA 4JG2A 4LF8Q 1C9OA 4BA2I 4UP9A 2BA0A 1LUZA 1B70B 2K14A 2RF4A 4A3EH 1MJEA 3HOUG 2JA6G 2Q2HA 5IP7G 1IL2A 3CCSA 5HGQA 1VQ6A 3T1HQ 2CFMA 1IBLQ 3BU2A 5IP9G 1S3OA 4O0AA 3UDIA 3PIOA 1PFSA 4DR2L 3Q8DA 4X64Q 4GN3B 2R92G 2PMZE 1HR0Q 1O7IA 4A3JH 4R4IA 2CQOA 2XGTA 1M90C 4KHPL 1X6OA 2VL6A 3GTLH 1XMOL 2VNUD 3J7A5 1PV4A 4KI0A 2GVAA 1XNQL 4JBWA 1B8AA 2YU9H 2AKWB 1VQBA 1L0WA 3UE0A 2RCNA 5FJ8H 5GADC 1J5EL 3FKIH 1FJGQ 1N32Q 2VQFL 2E2HH 1HNXQ 1OXTA 3A0JA 4X6AH 2VUMH 3OTOL 3EN2A 4UY8C 1PYBA 2K5HA 1SMXA 3H3VH 4OWTB 1YJWA 4DR4Q 4HJ8A 2RHQB 1PH6A 4OO1I 1K83H 5C0XG 3RN2A 1QUQA 1WYDA 5C44H 5M3FG 5C4JH 2JEAI 3S17H 2UUCL 3VDYA 4JCVE 5BR8L 1PH7A 1KD1C 4NXNQ 1SFOH 2R7ZH 1JJ2A 1HZBA 2MO0A 5FLMG 1QZHA 2PNHA 3STBC 3CC7A 1NTGA 5JJKA 1OXSC 3GTKH 2V1CC 1WFQA 3S14H 3KYHC 5M5YH 1I94L 2HIVA 4UP7A 4DNIA 1TWGH 2D62A 4A3GH 4DV1L 1DGSA 2KENA 4R4QA 1Y1WH 2WP8J 3B6YA 3PV0A 3I2ZA 2PI2E 4DV2Q 1S40A 3AFQA 4A3FH 2RHSB 4DR1L 1C7YA 3PO2H 1MIUA 1VQIA 2A19A 1TXYA 1AE2A 1UE7A 5ELOA 3FHWA 2ID0A 4MTNA 2OTJA 2Q2TA 3A5UA 1VQ9A 2WB1E 2EQSA 4UPAA 3U58A 4JI5L 3GTPH 2KBNA 5AJ3Q 3MXNB 4O2DA 4DV3Q 2AWOA 2Y0SE 1Q86C 1E22A 2OWOA 1V9PA 3RN5A 3GDEA 4LFAL 4GOPA 1ASZA 1EWIA 2UU9L 4DK6C 2ASBA 3PCOB 3HFZB 4IPGA 3U50C 2DUDA 3PUZA 1EUJA 4HIDA 1VQOA 2UUBQ 5J3BA 4QQBX 3CF5A 2HIXA 1YHQA 2NVXH 3K7AH 1KAWA 2UXDL 2HHHQ 1X3GA 2NVQH 2JK8A 4P72A 1X55A 1R9TH 1XNRL 3CCQA 4L5TA 4A3CG 5IWAQ 3HKZE 4GKJQ 1U0LA 4B3TQ 3GTOH 5GAGC 4JYAQ 5K36G 4DV5Q 2WAQE 1K0RA 3UE1A 1HNWL 3U4VA 1YIJA 4JI0Q 3D31A 1E1TA 4IOCA 4DV4Q 4JI6Q 4DR7Q 2K52A 3ULPA 1IBKL 3HOXG 3UDFA 4YWLA 4A3DG 1SROA 1YITA 4EX5A 3FP9A 4HIMA 2R7FA 4PZ6A 4QIWE 2NZHA 1E7ZA 5M3MG 2N78A 1FL0A 3M4QA 4OONA 4HJ5A 3JAMi 1CKOA 4Y7NH 5JEAJ 3NELA 3H15A 3F1ZA 1U5KA 3G4SA 1VQ7A 3HOYH 1AE3A 4LFCL 4GNXB 1TWCH 3UDGA 3PUVA 3HOVG 3KFUA 4A93H 3F2DA 2BH8A 1HJPA 1W3SA 4DR5L 4DUZL 4A4IA 1HZ9A 2E8GA 2JQOA 5IE8A 1Y1VG 4A3KG 1YJNA 4GS3A 4B3ML 5EAYA 1TWFH 4NB3A 4DR2Q 3UDXA 1XTDA 3GTGH 2I5LX 4H02A 3I56A 4NXML 4JV5L 4LF7L 4KHPQ 1L1OB 3KDFA 4DKAC 1PYSB 1XMOQ 1IBML 4LFBL 4B3RL 1Q7YC 3M4OH 1YVCA 2KHJA 2YV5A 4JI3L 2JA9A 5C4XH 1QVGA 4WJ3M 2AMCB 1X3EA 1LTLA 4BBSH 3KJPA 4GOPC 2OQ0A 1J5EQ 2GN5A 3K8AA 2VQFQ 4L5QA 1QZGA 3RZOH 2YTYA 1B7YB 3CPWA 1K8GA 4YCUA 1YBYA 3OTOQ 2ZM6L 1E1OA 1PH1A 3S15H 4XIGS 4KLKA 2E2IH 1G51A 1X56A 1KIXA 1CUKA 4JI1L 3ICEA 2D0PA 1HZCA 4JI8L 4LW1A 1UE5A 4AYBE 4MZ9A 3AFPA 4R4OA 1VQLA 5GAEC 5BR8Q 2UUCQ 2HT1A 3S1QH 2MQHA 1VQ4A 5JJLA 3CQZH 1TWHH 1J6QA 3S24A 2MNAA 4A3IH 3HOZG 4GKKL 4AQYL 1PHJA 4P74A 1I94Q 2H5XA 4BBRH 3BZCA 1SLJA 3H0GG 4YY3L 4OWWB 1N33L 2ATWA 2QGQA 1ASYA 4DV1Q 2K5NA 3RLFA 1VS0A 4JI7L 2N8NA 2E2JH 5C0XJ 3TEHB 4OXPA 4JOIA 4DR1Q 1JB7A 2R93H 3J80c 1G291 5HY6A 4MNOA 4RMFA 1VQ8A 3I7FA 1XMQQ 5IYCG 4C3JH 1UE6A 3J81c 4JI5Q 5GAHC 5IYBG 1KL9A 4A3MH 4LF6L 3I4MH 1WI5A 2MFIA 4BY7G 4LFAQ 1OXUA 1Q1EA 1PH2A 1BVSA 4QL5A 3NBHB 3M85A 4A3BG 2YTXA 1Q81C 4DR3L 2FXQA 5IY0A 1TWAH 4X62L 2UXDQ 1CSQA 3J80i 1XNRQ 2B63H 3TS2A 2D0OA 1L2FA 1X65A 4XTCS 1H95A 4YWKA 1W2BA 1N8RC 4GOPB 1JE5A 3J81i 4A3LH 3JC66 3CCRA 1HNWQ 1NMGA 1I3QH 1IBKQ 1KC8C 2VW9A 2IHEA 3NENA 2ZJQA 1EIYB 1V1QA 1C0AA 5IYDH 3E0EA 2AHOB 3DM3A 1KHIA 1SN8A 5LMUL 5C3EG 4BY1H 5C0XI 4X66L 5M5WH 3PO3H 1RIPA 2JA8H 1QVFA 2R6GA 3W5OA 2K4KA 4LFCQ 3TREA 4LF4L 3AQQA 3I4NG 1WCMH 4J15A 4IPHA 5JJIA 2R7DA 2WB1G 4DR5Q 4DUZQ 4IFDG 1OXVA 2A8VA 4ALPA 2EXDA 1A0IA 3DLLA 1HR0L 2Y0SG 1HNZL 3HOUH 1A8VA 5IP7H 3JAMc 2JA6H 4NPSA 3KJOA 4P75A 1KQSA 1OXXK 4JOIC 1NMFA 4R1JA 5IP9H 3M9BA 1PH4A 2NVTH 4B3SL 4NXMQ 4JV5Q 3PUXA 1FVIA 1KRSA 3TS0A 1IBMQ 4LFBQ 3S2DH 4JBJA 4QGUA 1KRTA 2R92H 4B3RQ 2B29A 4JI3Q 1VQHA 4JC0A 3TQYA 2JA7G 1RL2A 1MJCA 1YI2A 1NY4A 3HKZG 4YCWA 2CKZB 4A3EG 2VS1A 3OYYA 4JBKA 1VQFA 2PQAB 2WAQG 2ZTCA 2F52A 4P73A 1PVOA 4PZ7A 3KDFB 4JBMA 4WJ4A 1KXLA 2ZM6Q 1VQMA 4YWMA 4PZ8A 4TVAB 4YHHL 2OCEA 1EYGA 2Z0SA 3S1MH 3L2PA 1S72A 1D7QA 4JI1Q 1G6PA 1XJVA 4L5RC 1X9NA 4JI8Q 4DAYB 4A3JG 1HH2P 2CCZA 4EQ5A 1VCIA 1CKNA 4DV0L 3ER0A 2KCMA 5M3FH 4JI4L 2BH2A 2K50A 2ZTEA 4C2MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 A;  1YNX A;  4AQY Q;  3RNU A;  3ULL A;  4GLA C;  2CWA A;  4LUZ A;  5FJ8 G;  1D8L A;  3FKI G;  1I5F A;  4YY3 Q;  5FLM H;  3RZD H;  1XPR A;  5IT9 c;  1N33 Q;  1JJG A;  4DK3 C;  1VQP A;  2VQE L;  1T9H A;  3W1G A;  2VUM G;  1V43 A;  1E24 A;  1GKH A;  3KOJ A;  3K0X A;  4GN4 B;  4ME3 A;  1XNQ Q;  3GD7 A;  4IO9 A;  2IHF A;  1Q8K A;  4C3I H;  4K0K L;  1GVP A;  1VQE A;  3KF6 A;  3CC2 A;  2LSS A;  3J81 j;  1UEB A;  5C44 G;  1VQD A;  3SGI A;  5GQO A;  4IJH A;  1VQK A;  3D0F A;  3M4P A;  3F2B A;  4LF6 Q;  4HJA A;  3PF5 A;  1NJI C;  2R7Z G;  4TQU S;  3IRB A;  1XPU A;  3U4Z A;  4IPC A;  5FLX c;  2E5L L;  2ZJP A;  3BZK A;  2F4V L;  3WWV A;  3CCM A;  2C35 B;  4QY7 A;  4DV7 L;  4GKJ L;  1JJC B;  4DR3 Q;  4A3G G;  4X62 Q;  4BXX H;  3T1Y L;  1Y1W G;  4Y52 H;  4APV A;  4A3F G;  2JA5 G;  3J7Z C;  4A76 A;  3PO2 G;  1CKM A;  4QJF A;  4GNX A;  1N34 L;  1YHA A;  2PI2 A;  5LMN W;  1P8L A;  1SRU A;  4AYB G;  4A3C H;  3HKS A;  1QUQ B;  4KHZ A;  1VQJ A;  3PSI A;  5LMN L;  1X54 A;  3GO5 A;  3CXC A;  1PH9 A;  4RG1 A;  4R4C A;  2NZO A;  4DUY L;  2IY5 B;  1OTC A;  4A75 A;  1EQR A;  2UXC L;  3HOX H;  3G6E A;  1WOC A;  5E7N A;  2UXB L;  1VQA A;  4X65 L;  5LMU Q;  4DV6 L;  4A3D H;  4X66 Q;  1N36 L;  1UE1 A;  1L1O A;  4LUV A;  5M3M H;  2L15 A;  4LF9 L;  3STB D;  4LF4 Q;  2GVB A;  4IPD A;  3ULJ A;  4HIK A;  4JI2 L;  4GN5 A;  3GTM H;  4BXX G;  3AYH B;  2UU9 Q;  3HOV H;  1HZA A;  3A5Z B;  1VQN A;  2Q2I A;  4LF5 L;  4OO1 G;  1HNZ Q;  1JMC A;  3CCE A;  1EOV A;  1EIF A;  1SE8 A;  1N9W A;  1Q46 A;  3CPF A;  1Y1V H;  4A3K H;  3CC4 A;  3G48 A;  4HJ7 A;  4B3S Q;  1A63 A;  3NEM A;  4DAM A;  2UUA L;  4OX9 L;  3BJU A;  3GTQ H;  1IYJ B;  3CP0 A;  3CMA A;  3HOW G;  2K5V A;  4IFD J;  2Z6K C;  3HOY G;  4C3H H;  1YHB A;  4FDB A;  4DR6 L;  1I6H H;  4A93 G;  3PIP A;  4LF8 L;  1IXR A;  2CWP A;  4DPG A;  2LXJ A;  5DLQ E;  3I4O A;  2ALY B;  4YHH Q;  2BA1 A;  2ES2 A;  1A62 A;  3RLO A;  2NVY H;  4OWX B;  1NBW A;  3T1H L;  1IBL L;  2WFW A;  1Q82 C;  1LM0 A;  2B3G A;  4GNX C;  3ERS X;  2NN6 G;  1Q1B A;  1HR0 W;  1Z47 A;  1BKB A;  1E3P A;  3K81 C;  4DV0 Q;  3E9H A;  2ZTD A;  4X64 L;  3CD6 A;  4HJ9 A;  2OQK A;  2JE6 I;  4LWC A;  4B3M Q;  4PMW A;  5C4X G;  4JI4 Q;  2MO1 A;  3L0O A;  2OTL A;  4BBS G;  3PF4 A;  3K7U C;  4L5S A;  4BA1 I;  2I0Q A;  1X3F A;  2JA5 H;  1NE3 A;  2I5H A;  3F8T A;  1WJJ A;  4P71 A;  1PH3 A;  2Q2U A;  4LF7 Q;  3HOZ H;  1P16 A;  2VQE Q;  1L1O C;  1FJG L;  1CKN B;  1N32 L;  1XMQ L;  3H0G H;  1K3R A;  1HNX L;  1VQG A;  1EQQ A;  3RLN A;  4K0K Q;  4GLV B;  2NN6 I;  1GD7 A;  1VQC A;  1PH5 A;  3A74 A;  1UWV A;  1K73 C;  4POF A;  4DR4 L;  5GRO A;  3S1R H;  5M5X H;  3M3Y H;  1M1K C;  3PUY A;  4IFD I;  3EIV A;  3S16 H;  5IYC H;  2JJQ A;  2LXK A;  5IYB H;  5ELN A;  1Y14 B;  2F3I A;  4A3I G;  2A1A A;  1Z9F A;  4R4T A;  4NXN L;  2I5M X;  2KHI A;  2YYZ A;  3ZJY C;  2E5L Q;  1AH9 A;  2F4V Q;  3L7Z C;  4BY7 H;  3KF6 B;  4BBR G;  2IX1 A;  4DV7 Q;  1Q12 A;  3TRZ A;  3AEV A;  3GTJ H;  3T1Y Q;  4AIM A;  2N49 A;  4A3B H;  3CW2 C;  3G71 A;  1VQ5 A;  1YEZ A;  3PUW A;  3K80 C;  3M7N A;  2R93 G;  1LYL A;  1N34 Q;  3RR5 A;  3W1B A;  4GKK Q;  2VZA A;  3CCJ A;  4DV2 L;  3E9I A;  3LGJ A;  3S2H H;  4HIO A;  1YJ9 A;  3S1N H;  5LMN Q;  4A3M G;  4JI7 Q;  4UP8 A;  1IZ6 A;  3CCL A;  4DUY Q;  1GM5 A;  4IOA A;  3I4M G;  1K8A C;  3HOW H;  1GO3 E;  1BBW A;  3EBE A;  5AJ3 L;  2UXC Q;  4DV3 L;  2UXB Q;  2QA4 A;  4X65 Q;  4DV6 Q;  1PA6 A;  2N3S A;  1MKH A;  5H1S E;  1N36 Q;  1K9M C;  4LF9 Q;  2HQL A;  2VY3 A;  5C3E H;  2UUB L;  1QVC A;  2B63 G;  3KF8 B;  4JI2 Q;  3CME A;  2Z6K A;  4YCV A;  3I55 A;  3CCU A;  2EIF A;  4AH6 A;  2HHH L;  4A3L G;  3CCV A;  4LF5 Q;  3I4N H;  2PQA A;  5JEA G;  5IWA L;  4PG3 A;  1XPO A;  1SR3 A;  4LNQ A;  2JEB I;  4B3T L;  2AWN A;  4GLX A;  4JYA L;  4DV5 L;  2XTI A;  3F2C A;  5IYD G;  4JI0 L;  3H3V I;  1PH8 A;  4DV4 L;  4JI6 L;  4DR7 L;  4IJL A;  3CAM A;  4POG A;  2IX0 A;  1YZ6 A;  1BBU A;  2IT1 A;  4LUO A;  4BY1 G;  2UUA Q;  4OX9 Q;  3PO3 G;  2KCT A;  1JT8 A;  2JA8 G;  2K75 A;  3MEF A;  2ZJR A;  4DR6 Q;  2YTV A;  1EFW A;  3KLW A;  3PGZ A;  2JA7 H;  1I50 H;  2QEX A;  1FGU A;  1WCM G;  2DGY A;  1CSP A;  4JG2 A;  4LF8 Q;  1C9O A;  4BA2 I;  4UP9 A;  2BA0 A;  1LUZ A;  1B70 B;  2K14 A;  2RF4 A;  4A3E H;  1MJE A;  3HOU G;  2JA6 G;  2Q2H A;  5IP7 G;  1IL2 A;  3CCS A;  5HGQ A;  1VQ6 A;  3T1H Q;  2CFM A;  1IBL Q;  3BU2 A;  5IP9 G;  1S3O A;  4O0A A;  3UDI A;  3PIO A;  1PFS A;  4DR2 L;  3Q8D A;  4X64 Q;  4GN3 B;  2R92 G;  2PMZ E;  1HR0 Q;  1O7I A;  4A3J H;  4R4I A;  2CQO A;  2XGT A;  1M90 C;  4KHP L;  1X6O A;  2VL6 A;  3GTL H;  1XMO L;  2VNU D;  3J7A 5;  1PV4 A;  4KI0 A;  2GVA A;  1XNQ L;  4JBW A;  1B8A A;  2YU9 H;  2AKW B;  1VQB A;  1L0W A;  3UE0 A;  2RCN A;  5FJ8 H;  5GAD C;  1J5E L;  3FKI H;  1FJG Q;  1N32 Q;  2VQF L;  2E2H H;  1HNX Q;  1OXT A;  3A0J A;  4X6A H;  2VUM H;  3OTO L;  3EN2 A;  4UY8 C;  1PYB A;  2K5H A;  1SMX A;  3H3V H;  4OWT B;  1YJW A;  4DR4 Q;  4HJ8 A;  2RHQ B;  1PH6 A;  4OO1 I;  1K83 H;  5C0X G;  3RN2 A;  1QUQ A;  1WYD A;  5C44 H;  5M3F G;  5C4J H;  2JEA I;  3S17 H;  2UUC L;  3VDY A;  4JCV E;  5BR8 L;  1PH7 A;  1KD1 C;  4NXN Q;  1SFO H;  2R7Z H;  1JJ2 A;  1HZB A;  2MO0 A;  5FLM G;  1QZH A;  2PNH A;  3STB C;  3CC7 A;  1NTG A;  5JJK A;  1OXS C;  3GTK H;  2V1C C;  1WFQ A;  3S14 H;  3KYH C;  5M5Y H;  1I94 L;  2HIV A;  4UP7 A;  4DNI A;  1TWG H;  2D62 A;  4A3G H;  4DV1 L;  1DGS A;  2KEN A;  4R4Q A;  1Y1W H;  2WP8 J;  3B6Y A;  3PV0 A;  3I2Z A;  2PI2 E;  4DV2 Q;  1S40 A;  3AFQ A;  4A3F H;  2RHS B;  4DR1 L;  1C7Y A;  3PO2 H;  1MIU A;  1VQI A;  2A19 A;  1TXY A;  1AE2 A;  1UE7 A;  5ELO A;  3FHW A;  2ID0 A;  4MTN A;  2OTJ A;  2Q2T A;  3A5U A;  1VQ9 A;  2WB1 E;  2EQS A;  4UPA A;  3U58 A;  4JI5 L;  3GTP H;  2KBN A;  5AJ3 Q;  3MXN B;  4O2D A;  4DV3 Q;  2AWO A;  2Y0S E;  1Q86 C;  1E22 A;  2OWO A;  1V9P A;  3RN5 A;  3GDE A;  4LFA L;  4GOP A;  1ASZ A;  1EWI A;  2UU9 L;  4DK6 C;  2ASB A;  3PCO B;  3HFZ B;  4IPG A;  3U50 C;  2DUD A;  3PUZ A;  1EUJ A;  4HID A;  1VQO A;  2UUB Q;  5J3B A;  4QQB X;  3CF5 A;  2HIX A;  1YHQ A;  2NVX H;  3K7A H;  1KAW A;  2UXD L;  2HHH Q;  1X3G A;  2NVQ H;  2JK8 A;  4P72 A;  1X55 A;  1R9T H;  1XNR L;  3CCQ A;  4L5T A;  4A3C G;  5IWA Q;  3HKZ E;  4GKJ Q;  1U0L A;  4B3T Q;  3GTO H;  5GAG C;  4JYA Q;  5K36 G;  4DV5 Q;  2WAQ E;  1K0R A;  3UE1 A;  1HNW L;  3U4V A;  1YIJ A;  4JI0 Q;  3D31 A;  1E1T A;  4IOC A;  4DV4 Q;  4JI6 Q;  4DR7 Q;  2K52 A;  3ULP A;  1IBK L;  3HOX G;  3UDF A;  4YWL A;  4A3D G;  1SRO A;  1YIT A;  4EX5 A;  3FP9 A;  4HIM A;  2R7F A;  4PZ6 A;  4QIW E;  2NZH A;  1E7Z A;  5M3M G;  2N78 A;  1FL0 A;  3M4Q A;  4OON A;  4HJ5 A;  3JAM i;  1CKO A;  4Y7N H;  5JEA J;  3NEL A;  3H15 A;  3F1Z A;  1U5K A;  3G4S A;  1VQ7 A;  3HOY H;  1AE3 A;  4LFC L;  4GNX B;  1TWC H;  3UDG A;  3PUV A;  3HOV G;  3KFU A;  4A93 H;  3F2D A;  2BH8 A;  1HJP A;  1W3S A;  4DR5 L;  4DUZ L;  4A4I A;  1HZ9 A;  2E8G A;  2JQO A;  5IE8 A;  1Y1V G;  4A3K G;  1YJN A;  4GS3 A;  4B3M L;  5EAY A;  1TWF H;  4NB3 A;  4DR2 Q;  3UDX A;  1XTD A;  3GTG H;  2I5L X;  4H02 A;  3I56 A;  4NXM L;  4JV5 L;  4LF7 L;  4KHP Q;  1L1O B;  3KDF A;  4DKA C;  1PYS B;  1XMO Q;  1IBM L;  4LFB L;  4B3R L;  1Q7Y C;  3M4O H;  1YVC A;  2KHJ A;  2YV5 A;  4JI3 L;  2JA9 A;  5C4X H;  1QVG A;  4WJ3 M;  2AMC B;  1X3E A;  1LTL A;  4BBS H;  3KJP A;  4GOP C;  2OQ0 A;  1J5E Q;  2GN5 A;  3K8A A;  2VQF Q;  4L5Q A;  1QZG A;  3RZO H;  2YTY A;  1B7Y B;  3CPW A;  1K8G A;  4YCU A;  1YBY A;  3OTO Q;  2ZM6 L;  1E1O A;  1PH1 A;  3S15 H;  4XIG S;  4KLK A;  2E2I H;  1G51 A;  1X56 A;  1KIX A;  1CUK A;  4JI1 L;  3ICE A;  2D0P A;  1HZC A;  4JI8 L;  4LW1 A;  1UE5 A;  4AYB E;  4MZ9 A;  3AFP A;  4R4O A;  1VQL A;  5GAE C;  5BR8 Q;  2UUC Q;  2HT1 A;  3S1Q H;  2MQH A;  1VQ4 A;  5JJL A;  3CQZ H;  1TWH H;  1J6Q A;  3S24 A;  2MNA A;  4A3I H;  3HOZ G;  4GKK L;  4AQY L;  1PHJ A;  4P74 A;  1I94 Q;  2H5X A;  4BBR H;  3BZC A;  1SLJ A;  3H0G G;  4YY3 L;  4OWW B;  1N33 L;  2ATW A;  2QGQ A;  1ASY A;  4DV1 Q;  2K5N A;  3RLF A;  1VS0 A;  4JI7 L;  2N8N A;  2E2J H;  5C0X J;  3TEH B;  4OXP A;  4JOI A;  4DR1 Q;  1JB7 A;  2R93 H;  3J80 c;  1G29 1;  5HY6 A;  4MNO A;  4RMF A;  1VQ8 A;  3I7F A;  1XMQ Q;  5IYC G;  4C3J H;  1UE6 A;  3J81 c;  4JI5 Q;  5GAH C;  5IYB G;  1KL9 A;  4A3M H;  4LF6 L;  3I4M H;  1WI5 A;  2MFI A;  4BY7 G;  4LFA Q;  1OXU A;  1Q1E A;  1PH2 A;  1BVS A;  4QL5 A;  3NBH B;  3M85 A;  4A3B G;  2YTX A;  1Q81 C;  4DR3 L;  2FXQ A;  5IY0 A;  1TWA H;  4X62 L;  2UXD Q;  1CSQ A;  3J80 i;  1XNR Q;  2B63 H;  3TS2 A;  2D0O A;  1L2F A;  1X65 A;  4XTC S;  1H95 A;  4YWK A;  1W2B A;  1N8R C;  4GOP B;  1JE5 A;  3J81 i;  4A3L H;  3JC6 6;  3CCR A;  1HNW Q;  1NMG A;  1I3Q H;  1IBK Q;  1KC8 C;  2VW9 A;  2IHE A;  3NEN A;  2ZJQ A;  1EIY B;  1V1Q A;  1C0A A;  5IYD H;  3E0E A;  2AHO B;  3DM3 A;  1KHI A;  1SN8 A;  5LMU L;  5C3E G;  4BY1 H;  5C0X I;  4X66 L;  5M5W H;  3PO3 H;  1RIP A;  2JA8 H;  1QVF A;  2R6G A;  3W5O A;  2K4K A;  4LFC Q;  3TRE A;  4LF4 L;  3AQQ A;  3I4N G;  1WCM H;  4J15 A;  4IPH A;  5JJI A;  2R7D A;  2WB1 G;  4DR5 Q;  4DUZ Q;  4IFD G;  1OXV A;  2A8V A;  4ALP A;  2EXD A;  1A0I A;  3DLL A;  1HR0 L;  2Y0S G;  1HNZ L;  3HOU H;  1A8V A;  5IP7 H;  3JAM c;  2JA6 H;  4NPS A;  3KJO A;  4P75 A;  1KQS A;  1OXX K;  4JOI C;  1NMF A;  4R1J A;  5IP9 H;  3M9B A;  1PH4 A;  2NVT H;  4B3S L;  4NXM Q;  4JV5 Q;  3PUX A;  1FVI A;  1KRS A;  3TS0 A;  1IBM Q;  4LFB Q;  3S2D H;  4JBJ A;  4QGU A;  1KRT A;  2R92 H;  4B3R Q;  2B29 A;  4JI3 Q;  1VQH A;  4JC0 A;  3TQY A;  2JA7 G;  1RL2 A;  1MJC A;  1YI2 A;  1NY4 A;  3HKZ G;  4YCW A;  2CKZ B;  4A3E G;  2VS1 A;  3OYY A;  4JBK A;  1VQF A;  2PQA B;  2WAQ G;  2ZTC A;  2F52 A;  4P73 A;  1PVO A;  4PZ7 A;  3KDF B;  4JBM A;  4WJ4 A;  1KXL A;  2ZM6 Q;  1VQM A;  4YWM A;  4PZ8 A;  4TVA B;  4YHH L;  2OCE A;  1EYG A;  2Z0S A;  3S1M H;  3L2P A;  1S72 A;  1D7Q A;  4JI1 Q;  1G6P A;  1XJV A;  4L5R C;  1X9N A;  4JI8 Q;  4DAY B;  4A3J G;  1HH2 P;  2CCZ A;  4EQ5 A;  1VCI A;  1CKN A;  4DV0 L;  3ER0 A;  2KCM A;  5M3F H;  4JI4 L;  2BH2 A;  2K50 A;  2ZTE A;  4C2M H; 
#chains in the Genus database with same CATH topology
 1SMY C;  4WJW A;  1CA5 A;  2CWA A;  4YY3 Q;  1I5F A;  2E75 C;  1BBX C;  4RCN A;  4QUC A;  3CU7 A;  2MUY A;  3W1G A;  4EVO A;  4DGZ A;  1GKH A;  1WVL A;  2F0K A;  3K0X A;  3AMU A;  2J4X A;  1Q8K A;  1PLF A;  1GVP A;  1VQE A;  3KF6 A;  2LSS A;  3J81 j;  1UEB A;  5C44 G;  2JYO A;  3IL8 A;  3F2B A;  4NP5 A;  4HJA A;  3IRB A;  4J8Q A;  3MXU A;  1EU4 A;  2F4V L;  2IL8 A;  1SNO A;  1HUM A;  1ICF B;  4KMU C;  4DV7 L;  4DR3 Q;  4GKJ L;  3ND9 A;  1HRJ A;  2L55 A;  4Y52 H;  4A3F G;  4GNX A;  1N34 L;  4RH6 A;  5LMN W;  2A6E D;  2G5D A;  4AYB G;  3PMF A;  3JAM L;  2OF1 A;  3I73 A;  4HR7 B;  4DUY L;  2IY5 B;  3G6E A;  3I4M B;  1LTT D;  5I9P A;  2PW5 A;  4L6T B;  1GUO A;  1PTO D;  1N36 L;  3DM1 A;  4JPB W;  4LUV A;  1X32 A;  2L15 A;  4LF9 L;  1EIH A;  4XDX A;  4IPD A;  3E0J A;  2EY5 A;  3C1E A;  4HIK A;  3EA6 A;  4B9X A;  3GTM H;  2B63 B;  5FKA C;  1UUP A;  3MVV A;  1VQN A;  2NYZ D;  1HNZ Q;  5D14 A;  1JIC A;  4EQO A;  4IUQ A;  5EJW A;  4FXG C;  1SE8 A;  4A3K H;  1C4Q A;  2A68 C;  2G9H D;  4DAM A;  1AW7 A;  3NTH A;  5CYU A;  1NCV A;  1IYJ B;  1EQT A;  2K6A A;  1LTI D;  5M5W B;  4C3H H;  4DR6 L;  5FLX E;  1QOH A;  4A93 G;  3KK7 A;  2CWP A;  1EQV A;  5T1G A;  1F2M A;  1IBL L;  5FOB B;  1MSH A;  2EY2 A;  1C48 A;  2IPK D;  2NN6 G;  4KV6 A;  2NVT B;  1XWE A;  4DV0 Q;  5KRU A;  5DNF A;  5J39 A;  4X64 L;  4LWC A;  4B3M Q;  3S2D B;  3MC0 B;  3PF4 A;  4L5S A;  4BA1 I;  2I5H A;  3F8T A;  4LF7 Q;  1MD2 D;  1PH3 A;  2Q2U A;  3HOZ H;  1VDZ A;  1P16 A;  5LL6 X;  2VQE Q;  1FJG L;  1CKN B;  1N32 L;  1STG A;  5LHY 1;  1JWM D;  2O5J C;  5EQ0 A;  4I7Z C;  3RLN A;  2F03 A;  1XTC D;  1SE3 A;  1A2U A;  1EZ6 A;  1UWV A;  1K73 C;  4POF A;  2IX3 A;  1M1K C;  3PUY A;  3S16 H;  4S3S A;  2XNA C;  2EYJ A;  5IYB H;  4IUR A;  2EYO A;  1Z9F A;  3ZJY C;  1AH9 A;  3KF6 B;  1Q12 A;  1VMP A;  4KY7 A;  3T1Y Q;  3RZD B;  5BN3 A;  3C2P A;  1W6J A;  2R93 G;  3PUW A;  3K80 C;  3IAY A;  4RGN A;  1LYL A;  2NBF A;  3SR1 A;  4DAV A;  5ISR A;  4GKK Q;  4DV2 L;  3GP7 A;  3S2H H;  4HIO A;  1YJ9 A;  4C3J G;  2F1M A;  5LMN Q;  4UP8 A;  1IZ6 A;  3MZ5 A;  2B2Y C;  1E2W A;  4M8A A;  1B4O A;  2LY7 A;  2UXB Q;  4X65 Q;  1B2T A;  2E2I B;  2N3S A;  3ZYY X;  1LAB A;  2VY3 A;  3EJI A;  2UUB L;  4R8N A;  2DNC A;  4AH6 A;  1QJO A;  2J7Z A;  2L5T A;  1E2V A;  2NN6 H;  2PQA A;  1SR3 A;  4BBR B;  1ET6 A;  3F2C A;  1ILP A;  5JAV A;  4DV4 L;  4JI6 L;  3CAM A;  1EY0 A;  1ZEQ X;  4BY1 G;  1WTQ A;  2C5C A;  2JA8 G;  4A3D B;  4FP5 D;  5I2Y A;  5KNB A;  2D2C C;  4LF8 Q;  4BA2 I;  4G7O C;  1BR9 A;  1IYV A;  5ELE A;  1X3Q A;  2Q2H A;  5HGQ A;  4HSV A;  1A3V A;  4H0L C;  3BU2 A;  2F0O A;  1EY5 A;  1TKW B;  2KHS A;  4HMI A;  4O0A A;  3UDI A;  3PIO A;  3BS1 A;  5IIF A;  2A6H D;  1PFS A;  2KCC A;  2F0H A;  3Q8D A;  1NAP A;  1O7I A;  4FVM A;  4A3J H;  1M90 C;  1X6O A;  1XMO L;  1AZQ A;  2Z4I A;  4IZ8 A;  1XNQ L;  2YU9 H;  1VQB A;  1L0W A;  3UE0 A;  3KLR A;  3FKI H;  1IKL A;  3E6Z X;  2EDG A;  2A6E C;  3QOL A;  4DA2 A;  3SE0 A;  4CHT B;  1K3B C;  1YJW A;  4DR4 Q;  4HJ8 A;  3J7A V;  1EIG A;  1K83 H;  1QUQ A;  1KDC A;  3K6O A;  4RGT A;  2V4D A;  5C4J H;  1HA5 A;  4NXN Q;  1KD1 C;  1PTO C;  4X3S A;  4HED A;  2MO0 A;  3FRP B;  3OMG A;  3VR4 A;  4M1U B;  3CC7 A;  3GTK H;  1WFQ A;  1H9M A;  1SXT A;  5M5Y H;  5J22 A;  4DNI A;  3DMU A;  2KEN A;  1Y1W H;  3B6Y A;  2PI2 E;  3AFQ A;  3NP8 A;  1C7Y A;  2KEC A;  1TXY A;  3IFD A;  2OTJ A;  3A5U A;  4UPA A;  2EQS A;  3U58 A;  2EZV A;  4JI5 L;  3M3Y B;  2KBN A;  5AJ3 Q;  4O2D A;  4KKS A;  1U4M A;  2NZ1 D;  1F2L A;  4LFA L;  1ASZ A;  3R3O A;  4BY7 B;  3U50 C;  5D65 A;  2K7V A;  4CKC A;  4QQB X;  2MGS A;  3GTJ B;  5DM7 3;  1X3G A;  2JK8 A;  4P72 A;  4A3C G;  4GKJ Q;  1U0L A;  4HSP A;  3WOF A;  4JYA Q;  4DV5 Q;  4OO1 H;  2CQA A;  1HNW L;  1DON A;  5I6Y A;  3V96 A;  1EY9 A;  3HOX G;  1GUW A;  1BDO A;  2VB3 X;  2QF7 A;  4QIW E;  1E7Z A;  4DFA A;  3M4Q A;  4QMG A;  4OON A;  2RDH A;  1NUC A;  1BF4 A;  3H15 A;  4G7Z C;  2K32 A;  1EWC A;  1W3S A;  4A4I A;  1Y1V G;  3ERO A;  4KD3 A;  4J6H A;  3G6J B;  1B50 A;  3GTG H;  2I5L X;  3D4R A;  3VR3 A;  2DNE A;  1IBM L;  4B3R L;  1Q7Y C;  3E5S A;  2YV5 A;  4JI3 L;  1QVG A;  1CTM A;  3KJP A;  2JA7 B;  3K8A A;  3NK9 A;  1TR5 A;  1QZG A;  1RD9 D;  2ICE C;  1B7Y B;  1J9O A;  1JC7 A;  4YCU A;  1YBY A;  1K8G A;  2E76 C;  1PH1 A;  2WAQ B;  4BWG B;  4HMJ A;  2EE1 A;  5JJZ A;  4QB4 A;  5IGF A;  3DWP A;  1HZC A;  1BCP B;  4LW1 A;  4UHV A;  4K5X A;  2K01 A;  5GAE C;  1HQR D;  1MGS A;  2IW3 A;  3BYY B;  4RA8 A;  4P74 A;  4CDD C;  2ATW A;  4YY3 L;  1EY4 A;  1PDQ A;  2QGQ A;  4DV1 Q;  1D5X C;  4JI7 L;  1SE2 A;  1JB7 A;  3J80 c;  4IQZ A;  1CFM A;  4RMF A;  5EKI A;  3VYU A;  2PQE A;  3J81 c;  2RQX A;  5GAH C;  4K5W A;  2G9D A;  4EQN A;  2N88 A;  2DJG C;  3I4M H;  1WI5 A;  2MFI A;  2Q8I B;  1NR4 A;  4Z9C B;  4KJN A;  1LTG D;  1Q81 C;  1EL0 A;  4DR3 L;  1H9S A;  3S14 B;  5E4X A;  2UXD Q;  1CZG A;  1TWA H;  2XN9 C;  3J80 i;  1RF2 D;  2B63 H;  2D0O A;  1L2F A;  1H95 A;  4XTC S;  1K0S A;  4A3F B;  3J81 i;  3JC6 6;  1TS3 A;  5JEA H;  3HOZ B;  2A6H C;  1NMG A;  4K14 A;  4AYB B;  1IBK Q;  2VW9 A;  1V1Q A;  3NTI A;  1M4V A;  3LNN A;  1KHI A;  4KN7 C;  5M5W H;  1RIP A;  3F2U A;  3HP3 A;  1QVF A;  2R6G A;  3W5O A;  3S16 B;  1BCP D;  1D5M C;  1I6V C;  3I4N G;  3K7A B;  4ZK9 B;  1MBY A;  4OIJ A;  2B2U C;  4DUZ Q;  4IFD G;  2A8V A;  1SMY D;  2EXD A;  4C1N I;  4K6L A;  1QG7 A;  1EYD A;  3LX0 A;  1STB A;  2AUJ D;  1A8V A;  5IP7 H;  4WOR A;  3JAM c;  1HNZ L;  3HOU H;  1ML0 D;  1JOO A;  4JOI C;  1PH4 A;  2NVT H;  1JOQ A;  2NTS A;  3VYR A;  4JV5 Q;  4LFB Q;  1QCB D;  3S2D H;  4N9P A;  3HS0 C;  3TQY A;  2BOS A;  1YI2 A;  3HKZ G;  3K57 A;  2HUG A;  4A3E G;  2VS1 A;  1H9K A;  2Z9H A;  2ZTC A;  4P73 A;  4X3K A;  4A93 B;  4TVA B;  4XQN A;  2OCE A;  2QCP X;  3L2P A;  2JP1 A;  2OT2 A;  4Q5V A;  1JOK A;  2RBM A;  3OW7 A;  1G6P A;  3TZD A;  4L5R C;  4O1N A;  3WDN A;  4DV0 L;  3ER0 A;  5C0X H;  3QR8 A;  2F0M A;  4ZUJ A;  2BH2 A;  2A74 C;  3Q22 A;  2ZTE A;  1RHP A;  4C2M H;  4AQY Q;  3R93 A;  1G8Z D;  2E74 C;  5FJ8 G;  3I91 A;  3RZD H;  1N33 Q;  3D6C A;  1JJG A;  1OO9 B;  4DK3 C;  3SVM A;  1T9H A;  2VQE L;  3TP7 A;  1V43 A;  4K2L A;  3NWT A;  4ME3 A;  1XNQ Q;  3OSO A;  2F0P A;  1CM9 A;  3NXW A;  4CJ1 B;  3L3O C;  5CV8 A;  3SGI A;  1VQK A;  2L9H A;  1EY7 A;  1DCZ A;  1XPU A;  3U4Z A;  3SHL A;  5FLX c;  2QDL A;  3FDT A;  4QY7 A;  4HN7 A;  3T1Y L;  1LV9 A;  4PV1 C;  4RAU C;  2B2T C;  1QB5 D;  2PI2 A;  1B9M A;  4OIK A;  1SRU A;  1NNX A;  1STH A;  1F2Z A;  4KHZ A;  3PSI A;  4XYQ A;  5C5L A;  1H9S B;  2TMP A;  2JSO A;  5LMN L;  4C3J B;  1PH9 A;  4RG1 A;  4R4C A;  1OTC A;  4DK0 A;  5E7N A;  2F0D A;  2UXB L;  1F9R A;  4X65 L;  4A3D H;  1L1O A;  2BCO A;  2F0U A;  4LF4 Q;  2GVB A;  1X3P A;  1ENA A;  4GN5 A;  5IGC A;  1SYC A;  3AYH B;  1Y8O B;  1L0X B;  3HOV H;  2QIL A;  2Q2I A;  3NHH A;  2MJ8 A;  2CH4 A;  4K8I A;  1EIF A;  1K8M A;  4J1M A;  4KTA A;  4N9T A;  4RGO S;  3G48 A;  2DJF C;  1A63 A;  4DXG A;  4LMQ D;  1L0Y B;  4RKL A;  5C4H A;  4IFD J;  2F0L A;  3HOY G;  4FDB A;  1PRT D;  4LF8 L;  4FF1 A;  2Z1C A;  2LXJ A;  5DLQ E;  5KIX A;  2F0I A;  2X6G A;  3D4W A;  4YHH Q;  4OWX B;  1NBW A;  2WFW A;  3LWE A;  4X3T A;  2B3G A;  4FF2 A;  1LO5 D;  1SND A;  3ERS X;  1Z47 A;  3SK6 A;  3K81 C;  1E3P A;  3DWQ A;  4K5V A;  1B3Q A;  2JE6 I;  2OQK A;  5C4X G;  2OTL A;  3A54 A;  3K7U C;  2I0Q A;  1DZ1 A;  1NE3 A;  1LTA D;  4P71 A;  3NBH A;  1SNM A;  2R3Z A;  1K3R A;  2EPB A;  1DOM A;  4K0K Q;  1FNV A;  2NN6 I;  1CQV A;  3PIP 3;  4ZLT F;  1SNC A;  4DR4 L;  5M5X H;  4G4K A;  3M3Y H;  5J1Z A;  5IYC H;  5D3D A;  1F9P A;  3ONA B;  1Y14 B;  4A3I G;  2A1A A;  5I2X A;  4NXN L;  5EGT A;  3C46 A;  2YYZ A;  2E5L Q;  3L7Z C;  4ILW A;  4BY7 H;  1SNP A;  1DD2 A;  1BCP C;  3J81 L;  3TRZ A;  3AEV A;  3GTJ H;  4AIM A;  3CW2 C;  3G71 A;  2VZA A;  4KKT A;  3E9I A;  5I6W A;  4V19 0;  4JI7 Q;  2JN4 A;  3H09 A;  4IOA A;  4XXE A;  1K8A C;  1GO3 E;  1BBW A;  5AJ3 L;  4DV6 Q;  2EJM A;  3O13 A;  3V2T A;  1IHZ A;  1TS2 A;  4N8F A;  1K9M C;  1PTO F;  4NW2 A;  1F77 A;  1KDA A;  3KF8 B;  3CME A;  3CHB D;  3MA2 B;  2MPM A;  3I55 A;  3CCU A;  4A3L G;  4LF5 Q;  2M00 A;  2JEB I;  4GLX A;  4JYA L;  3TP5 A;  4DV5 L;  2XTI A;  5IYD G;  4IJL A;  1DJR D;  4POG A;  2IX0 A;  4PQX A;  1BBU A;  2IT1 A;  4LUO A;  4MHE A;  2UUA Q;  3HOX B;  4DAY A;  4OX9 Q;  3PO3 G;  1SNQ A;  4F7X A;  1Y8N B;  2K75 A;  1JT8 A;  4H44 C;  1EFW A;  1GXD C;  3KLW A;  1PMR A;  2JA7 H;  4H13 C;  1EWH A;  1GHK A;  2LKV A;  3EQL C;  2K5W A;  2RF4 A;  1SAP A;  2K14 A;  1CI3 M;  5CV7 A;  1CQF A;  1STA A;  1LAC A;  3HRZ C;  3CCS A;  3T1H Q;  5IP9 G;  1TWA B;  5ELB A;  1Y1V B;  1QIL A;  2R92 G;  2PMZ E;  2DY8 A;  5COY A;  2CQO A;  2XGT A;  5JOB A;  3GTL H;  1CK1 A;  1QNK A;  2K28 A;  4JBW A;  5COR A;  5GAD C;  1CA6 A;  2SOB A;  1HNX Q;  2B2W C;  1D2B A;  2NVY B;  4FXD A;  2RHQ B;  1PH6 A;  3KLS A;  4RCO A;  4OO1 I;  4QF4 A;  4RGM A;  5C44 H;  2JEA I;  4U67 3;  3W2D A;  3KLS X;  3HOU B;  3LWU A;  4RFB A;  3BDO A;  5FLM G;  5D3I B;  2ICI A;  5JJK A;  3I70 A;  2D9U A;  2V1C C;  4RKB A;  3S14 H;  1BOS A;  4CDC C;  4UP7 A;  1SE4 A;  1TY0 A;  4DV1 L;  3FPU B;  4OEL B;  5FLX L;  4C3I G;  4A3F H;  2QKI C;  2O4X A;  1MIU A;  2A19 A;  2PCF B;  1O80 A;  3FHW A;  2ID0 A;  4I7A A;  2BDO A;  1VQ9 A;  2WB1 E;  3S1R B;  4LJZ C;  2KEE A;  3MXN B;  4RHR A;  2Y0S E;  1Q86 C;  1EY6 A;  3GDE A;  3J7A F;  3Q23 A;  4GOP A;  2EJF C;  2UU9 L;  3PCO B;  3HFZ B;  4IPG A;  4BXX G;  3PUZ A;  4HID A;  1EUJ A;  1PRT C;  4IUT A;  1VQO A;  1EOT A;  2RCF A;  3QO2 A;  1YHQ A;  3K7A H;  1KAW A;  2UXD L;  1AZP A;  5CBA E;  4C2M B;  4B3T Q;  2EYH A;  3I8Z A;  5K36 G;  1G2T A;  3UE1 A;  2K03 A;  2WV6 D;  3D31 A;  4DR7 Q;  3ERQ A;  2K52 A;  1IBK L;  4YWL A;  1SRO A;  3FP9 A;  4HIM A;  5M3M G;  1FL0 A;  5FO9 B;  4L8J A;  5DEH A;  1CKO A;  2H1E A;  3TN2 A;  2SNM A;  4I65 A;  3G4S A;  1VQ7 A;  1AE3 A;  1SYB A;  4GNX B;  3UDG A;  4A93 H;  1V8Q A;  4HTH A;  3F2D A;  3TP8 A;  3I4N B;  4CBV A;  4UAI A;  5IOC A;  4DUZ L;  1HZ9 A;  2JQO A;  5IE8 A;  3N6R A;  4GS3 A;  5EAY A;  1TWF H;  4DR2 Q;  1O78 A;  3UDX A;  1I4H A;  4H02 A;  4JV5 L;  4KHP Q;  3KDF A;  4LFB L;  4JK1 C;  4XQJ A;  1TQO A;  5DAU A;  3H91 A;  2SEB D;  3FVQ A;  1ENC A;  4KK7 A;  3VA7 A;  2OQ0 A;  1J5E Q;  2GN5 A;  2L4N A;  2FFK B;  2YTY A;  4A3E B;  2HD3 A;  3OTO Q;  3OMC A;  1E1O A;  1S4Z A;  4C1N K;  2F0G A;  3S15 H;  4XIG S;  4ZYS A;  1KIX A;  1CUK A;  1JE4 A;  3A8J E;  1HQM C;  5I4D A;  1II3 A;  2F4I A;  2Z6B A;  5E4W C;  3HOV B;  1VQL A;  4XT1 B;  3H6M A;  1Q3L A;  3SK5 A;  2MQH A;  3I90 A;  1TWH H;  3S24 A;  4AQY L;  1PHJ A;  1SLJ A;  3H0G G;  1N33 L;  1ASY A;  2N8N A;  1V1P A;  2E2H B;  2B2V C;  4OXP A;  4DR1 Q;  2R93 H;  4C56 C;  3VR5 A;  5HY6 A;  1VQ8 A;  3I7F A;  3OIQ A;  2EXZ A;  3X3N A;  4C3J H;  4ZKB B;  2NB0 A;  1QE6 A;  1F2Y A;  5CBE E;  5EBC A;  3SK4 A;  1PH2 A;  1BVS A;  2X69 A;  4QL5 A;  3V05 A;  3I72 A;  3DWA A;  1PXU A;  4A3B G;  1ESF A;  2YTX A;  2F0S A;  3A8K E;  2P5Z X;  4PMB A;  1XNR Q;  2JXM B;  5C4Z A;  2AUK A;  4GOP B;  5AFW A;  1STY A;  1WTP A;  4ABN A;  2CHB D;  1VF5 C;  1KC8 C;  3GTP B;  1SSO A;  2ZJQ A;  1EIY B;  3E0E A;  1H9R A;  3I4L A;  1HTL D;  1SN8 A;  5C3E G;  3OWE B;  5C0X I;  4BY1 H;  3K5M A;  2JA8 H;  5M5X B;  1GUT A;  1H9J A;  2O2L D;  3TRE A;  4LF4 L;  2NVX B;  4J15 A;  1FD7 D;  3BG3 A;  4IPH A;  1Z7T A;  2NVQ B;  1JR0 D;  1R9T B;  4DR5 Q;  1OXV A;  4MN3 A;  1HR0 L;  1EEI D;  1JOR A;  1B3A A;  2VB2 X;  1ZKO A;  3KJO A;  1KQS A;  1NMF A;  3A56 A;  5EPK A;  4NXM Q;  3PUX A;  3TS0 A;  4JBJ A;  4KN4 C;  1VQH A;  4JC0 A;  1S5F D;  4FYD A;  1U4R A;  1NY4 A;  1I4G A;  4YCW A;  3AU7 A;  3OYY A;  5A2Q E;  3HOY B;  2PQA B;  1TWC B;  3RMH A;  3KDF B;  2ZM6 Q;  1VQM A;  5IGG A;  4YHH L;  2Z0S A;  1EU3 A;  5TSS A;  4JI1 Q;  1RTN A;  4JI8 Q;  3SEB A;  2WAC A;  3GV3 A;  4EQ5 A;  1MI2 A;  5DM6 3;  1TVX A;  1E2Z A;  1CHP D;  3TZU A;  3ULL A;  3K59 A;  1XPR A;  1PZK D;  3URY A;  1VQP A;  2VUM G;  1E24 A;  1TII D;  5EBD A;  3T53 B;  3KOJ A;  1RKN A;  4IO9 A;  2IHF A;  3OPO A;  4K0K L;  1Z6H A;  4F88 A;  1VQD A;  2K05 A;  3FMC A;  5GQO A;  4IJH A;  2K04 A;  1V1P B;  3M4P A;  4LK1 C;  4LF6 Q;  3PF5 A;  1NJI C;  2R7Z G;  2Z8L A;  5IGB A;  1UEA B;  4IPC A;  2E5L L;  3BZK A;  4A3I B;  1Q90 A;  3WWV A;  2C35 B;  3CCM A;  4A3G G;  4CJ2 C;  4X62 Q;  3M4O B;  4APV A;  1I4P A;  4G7H C;  4EGV A;  4A76 A;  1RTO A;  3GTL B;  3PO2 G;  1CKM A;  5JPN C;  4A3C H;  1QUQ B;  1VQJ A;  3GQB A;  4A75 A;  3VYT A;  1EQR A;  3NUC A;  4XT3 B;  3HOX H;  1S5D D;  4DV6 L;  1B53 A;  5LMU Q;  4H7B A;  1UE1 A;  2A69 D;  4PMC A;  5C44 B;  1BCP F;  1LT6 D;  1O7L A;  1Y8P B;  5IT9 E;  5FK9 C;  1WTX A;  2UU9 Q;  1GUN A;  5I9O A;  4LF5 L;  2RDG A;  4ZRZ A;  1JMC A;  3QOJ A;  1Q46 A;  4FXK C;  1Y1V H;  4B3S Q;  1I3Q B;  3CC4 A;  1A2T A;  1PFM A;  1UNS A;  2UUA L;  4OX9 L;  3HOW G;  2K5V A;  1EY8 A;  1A15 A;  3PO3 B;  2NUC A;  4PNY A;  1RJT A;  1O7Y A;  3BVZ A;  3PIP A;  1IXR A;  4FF4 A;  2ALY B;  2BA1 A;  3RLO A;  2NVY H;  5EKL A;  3K5N A;  3QIA A;  3T1H L;  4WRD A;  1A3T A;  1LM0 A;  4GNX C;  3H94 A;  1WTO A;  1Q1B A;  3IFT A;  4KY6 A;  1HR0 W;  3D4D A;  1BKB A;  1W6K A;  2ZTD A;  3CRK C;  3MFG A;  4PMW A;  2MO1 A;  1VF7 A;  4BBS G;  1DOK A;  3NQT A;  2FIN B;  1FR3 A;  2F0V A;  5C3X A;  3X3M A;  1Q8I A;  1GJX A;  1XMQ L;  2WIN B;  4HCE A;  1HNX L;  1EQQ A;  5ELC A;  1ICW A;  4GLV B;  2TSS A;  1VQC A;  3A74 A;  4KKU A;  3S1R H;  5CV6 A;  3EIV A;  2WII B;  3MWY W;  3OHX C;  4R4T A;  2PW7 A;  4NMZ A;  4BBR G;  1ZXT A;  1TWF B;  1STN A;  3T56 B;  2N49 A;  1VQ5 A;  1JWU D;  3RR5 A;  2EOT A;  3MXP A;  3CCJ A;  4KY5 A;  1IW7 D;  1I4R A;  4A3M G;  2ZXO A;  3Q24 A;  4DK1 A;  1GM5 A;  4OGQ C;  3CRL C;  3HOW H;  3EBE A;  2UXC Q;  2F0J A;  2QA4 A;  3S15 B;  1PA6 A;  4KJO A;  2HQL A;  1JQY D;  4JI2 Q;  2Z6K A;  1SBB B;  1TWH B;  2XRS D;  3CCV A;  3I4N H;  1XPO A;  4PG3 A;  4LNQ A;  2L0C A;  2FMC A;  4B3T L;  4IFD H;  5C5M A;  2F0F A;  2B8G A;  1HXY D;  1K28 A;  4CJ0 B;  4OL7 A;  4Q0F A;  4DR7 L;  2R93 B;  2CW0 D;  1IL8 A;  2KCT A;  2QEJ C;  3MEF A;  2ZJR A;  3BVM A;  5M3M B;  1DOL A;  3VR6 A;  2F3W A;  1FGU A;  1WCM G;  4JG2 A;  3RD4 A;  1C9O A;  4UP9 A;  1JB3 A;  1PRT F;  1LUZ A;  1B70 B;  2BDN A;  2I46 A;  2OEO A;  4A3E H;  1MJE A;  3QG1 A;  2JA6 G;  1VQ6 A;  3TBI B;  2CFM A;  4B08 A;  4DR2 L;  2KOL A;  1HR0 Q;  2VXW A;  3P20 A;  1VMC A;  5T1I A;  3SXH A;  4KHP L;  2EYL A;  2RSO A;  2VL6 A;  3P1H A;  4B9W A;  3GTQ B;  1K8O A;  3IKJ A;  3J7A 5;  2GVA A;  1I6H B;  1HFN A;  1WTR A;  4IUN A;  2AKW B;  2RCN A;  5FJ8 H;  1J5E L;  2QW7 A;  2E2H H;  1PZJ D;  2XWJ B;  4BY1 B;  4FO2 A;  1XXG A;  3OTO L;  3TSS A;  2JA8 B;  1PYB A;  5C3W A;  1SMX A;  4KHV A;  3H3V H;  4OWT B;  1EYC A;  2EY6 A;  2Z4H A;  5CR3 A;  1WYD A;  5M3F G;  4JCV E;  4K8J A;  1PH7 A;  1T5E A;  5ELD A;  1SFO H;  1JJ2 A;  1SJH D;  1QZH A;  3KBX A;  2A69 C;  1GUG A;  1JCK B;  1F9S A;  2FHT A;  3I3C A;  1DGS A;  3H0G B;  3PV0 A;  1HUN A;  1WTV A;  3W3A A;  4DR1 L;  4R9W A;  2F0E A;  1UE7 A;  1HA6 A;  3BYT B;  3GTP H;  4DV3 Q;  1E22 A;  1PYW D;  2OWO A;  1V9P A;  3RN5 A;  2KED A;  1EWI A;  2B39 A;  2SNS A;  2PZT A;  5JPM C;  2IWH A;  3CF5 A;  2HIX A;  2NVX H;  2RKS A;  3EFX D;  4A3B B;  2HHH Q;  2NVQ H;  1XNR L;  1R9T H;  1KAA A;  5IWA Q;  5BN5 A;  4FNF A;  2E2D C;  1KAB A;  2WAQ E;  3U4V A;  1YIJ A;  4JI0 Q;  1E1T A;  3NSW A;  2ENB A;  3UDF A;  4EX5 A;  3K5L A;  2R7F A;  4PZ6 A;  4HJ5 A;  2O5I C;  2N78 A;  4IUP A;  1AN8 A;  3L9A X;  3D8G A;  5C3E B;  1U5K A;  1PTO B;  3HOY H;  1TWC H;  3MEH A;  1B1Z A;  5E1F A;  4DR5 L;  2E8G A;  4A3K G;  4RHS A;  1TT2 A;  3QJY A;  1BXT A;  2F0Q A;  3BZD B;  4V0B A;  4NB3 A;  2LS0 1;  5G3L D;  1XTD A;  1TY2 A;  2HDL A;  1ONL A;  1DM0 B;  5CV4 A;  4CDE C;  3I56 A;  1UAP A;  4NXM L;  1L1O B;  4XQQ A;  4P2C B;  1ENF A;  4C3H G;  1B9N A;  2KHJ A;  3NWS A;  5C4X H;  3Q0A A;  1D1K A;  4WJ3 M;  2AMC B;  1X3E A;  2KCN A;  2PNR C;  1E0B A;  1I50 B;  2VQF Q;  3K5O A;  4L5Q A;  5IGD A;  3JAM E;  3CPW A;  2RSN A;  2ZM6 L;  3M4Y A;  1IW7 C;  1G51 A;  1X56 A;  2L12 A;  5KEE A;  4JI1 L;  4L63 B;  2D0P A;  1STE A;  5NUC A;  4QIW B;  4JI8 L;  1UE5 A;  4AYB E;  4MZ9 A;  2UUC Q;  3AB9 A;  3FEW X;  5BR8 Q;  1VQ4 A;  1NR2 A;  2KA7 A;  2MNA A;  4A3I H;  3HOZ G;  3A55 A;  3TME A;  4CDF C;  1I94 Q;  4OWW B;  3BZC A;  3M4O H;  2B2U A;  2K5N A;  3RLF A;  3TEH B;  4ZQ3 A;  2LFN A;  4JOI A;  2VUM B;  1G91 A;  1G29 1;  1YNN D;  3DUZ A;  2A73 B;  1XMQ Q;  1UE6 A;  5IYB G;  1KL9 A;  2AQ2 B;  4LF6 L;  2CW0 C;  1V1O A;  3S17 B;  2R7Z B;  3NBH B;  3M85 A;  2R61 A;  1LT3 D;  5IY0 A;  4X62 L;  3T4A C;  1TWG B;  4A3G B;  5IOD A;  1X65 A;  2WKD A;  4YWK A;  1W2B A;  2PZU A;  1JE5 A;  3R2I A;  4CGY B;  4A3L H;  2A5H A;  3PO2 B;  3CCR A;  1WTH A;  4CKB A;  1I3Q H;  1S5E D;  2IHE A;  4DNT B;  5IYD H;  5LMU L;  2BE5 D;  3QB3 A;  1XX8 A;  3NQI A;  3PO3 H;  2K4K A;  2PO4 A;  4LFC Q;  3A8I E;  4F87 A;  3T16 A;  2L1B A;  2R7D A;  2WB1 G;  3DLL A;  2Y0S G;  3GTO B;  1D1I A;  3KUP A;  3S9W A;  4P75 A;  1ESR A;  1OXX K;  5IP9 H;  1WD1 A;  3M9B A;  1DYQ A;  4B3S L;  5KGU A;  1FVI A;  4IN3 A;  4NKL A;  4DAP A;  2R92 H;  1KRT A;  3J7Y W;  1RL2 A;  2KQ3 A;  4Y7N B;  2PPB C;  3HOW B;  2B2T A;  1KLG D;  1VQF A;  3BDL A;  5KND A;  4WJ4 A;  1KXL A;  4YWM A;  3EVQ A;  4PZ8 A;  5KYI A;  2X6L A;  2F0W A;  2RDF A;  3S1M H;  1S72 A;  4LAA A;  4DAY B;  4A3J G;  2CCZ A;  1VCI A;  3TDQ A;  3KBG A;  2KCM A;  4ZKC B;  2K50 A;  1LTL A;  2KVM A;  3OW2 A;  1KNA A;  1YNX A;  3RNU A;  4GLA C;  2RVL A;  4LUZ A;  1D8L A;  3FKI G;  5FLM H;  4BBS B;  1SYG A;  5IT9 c;  3VR2 A;  1SJE D;  2K33 A;  3RZO B;  4GN4 B;  4FF3 A;  2ZXR A;  3GD7 A;  1PZI D;  4C3I H;  3CC2 A;  3RUZ A;  1SEB D;  3HKZ B;  1LTS D;  2KJX A;  3D0F A;  4TQU S;  4DF7 A;  5FO7 B;  1TS5 A;  1G2S A;  3S1Q B;  3K0Y A;  4KD4 A;  5E3F A;  3CQZ B;  4ZCK A;  2ZJP A;  5LL6 S;  1LT4 D;  1JJC B;  1T5X D;  1BNZ A;  5EPL A;  1Y1W G;  4BXX H;  2EVB A;  2JA5 G;  3J7Z C;  2E2J B;  4QJF A;  1YHA A;  1P8L A;  3HKS A;  5K36 H;  2OXP A;  1X54 A;  2QDB A;  3GO5 A;  4U68 A;  3P7J A;  4EQP A;  3CXC A;  2NZO A;  4A3M B;  1AP0 A;  4K2K A;  2UXC L;  1WOC A;  1VQA A;  4X66 Q;  3G7L A;  3QWN A;  4DN4 M;  5M3M H;  1EYA A;  3STB D;  1RDP D;  3T51 B;  3ULJ A;  4JI2 L;  1SFO B;  1HZA A;  3A5Z B;  4OO1 G;  4HCS A;  3CCE A;  3OOC A;  1LT5 D;  2HDM A;  2EYP A;  1XYI A;  1EOV A;  3UI2 A;  1N9W A;  3CPF A;  4HJ7 A;  1A6X A;  5M9O A;  3U9O A;  3NEM A;  3BJU A;  3GTQ H;  3A7A B;  2RA4 A;  3CP0 A;  3CMA A;  2Z6K C;  1FNW A;  1ILQ A;  1YHB A;  1I6H H;  1ROD A;  1WCM B;  1R4P B;  4IAL A;  4DPG A;  3I4O A;  2XWB B;  1SYE A;  2ES2 A;  1A62 A;  1YNN C;  1Q82 C;  2JA6 B;  5KYL A;  1M8A A;  4UDU C;  2J0T D;  3E9H A;  1S5C D;  3CD6 A;  2ZT9 C;  4HJ9 A;  4JI4 Q;  3L0O A;  1IKM A;  3NPP A;  1WTW A;  1X3F A;  1MHW C;  2JA5 H;  4X3U A;  1WJJ A;  1HFG A;  4YIJ A;  1L1O C;  1FYC A;  2Q8R E;  3H0G H;  1VQG A;  4DXF A;  1IYU A;  2B8F A;  3NBI A;  5C6A A;  1GD7 A;  1PH5 A;  1G6Z A;  5BN4 A;  3R2T A;  5GRO A;  4IFD I;  2EJG C;  1D6E C;  2JJQ A;  2LXK A;  2HQE A;  5ELN A;  5EPJ A;  2F3I A;  2BE5 C;  2I5M X;  2KHI A;  5M3F B;  2F4V Q;  1AFP A;  1GOZ A;  2IX1 A;  4DV7 Q;  2CVR A;  1SYD A;  4QCL A;  1O7Z A;  4A3B H;  1YEZ A;  3M7N A;  1N34 Q;  1FNU A;  3W1B A;  5C4X B;  1DXM A;  5A2Q L;  3LGJ A;  3NE5 B;  2XVS A;  1HPC A;  1I4Q A;  3M7G A;  3S1N H;  1FGB D;  1B44 D;  3CCL A;  4DUY Q;  1PFN A;  3I4M G;  3HGB A;  4DV3 L;  3DXJ C;  4GZY C;  5H1S E;  1MKH A;  1N36 Q;  2EYF A;  5HUR A;  4LF9 Q;  2XRQ D;  5K5P A;  4ZAI A;  5C3E H;  1PTO H;  1QVC A;  2B63 G;  2B2W A;  4YCV A;  3D6W A;  1KLU D;  2MP1 A;  3WOE A;  2HHH L;  1A3U A;  2EIF A;  5JEA G;  5IWA L;  2AWN A;  4JW0 A;  4TSS A;  2EYM A;  3MHB A;  4JI0 L;  3H3V I;  1EZ8 A;  3Q6S A;  1PH8 A;  4XYO A;  1YZ6 A;  3VYS A;  4MIU A;  3OWF A;  4DR6 Q;  2YTV A;  1KNE A;  3PGZ A;  1KTK A;  1I50 H;  3GV6 A;  3TP6 A;  2DGY A;  3ND8 A;  2QEX A;  1CSP A;  4CKE A;  5CGK A;  4DU9 A;  3DHQ A;  2BA0 A;  3E3X A;  3GTM B;  3VA5 A;  4RWS C;  3HOU G;  5IP7 G;  1IL2 A;  1IBL Q;  3CKI B;  1S3O A;  4G57 A;  4A3K B;  1TS4 A;  1U4P A;  2K1B A;  4X64 Q;  4GN3 B;  2FMM A;  5JVG 3;  4R4I A;  1GHJ A;  2C9O A;  2VNU D;  1EEF D;  2Q8T A;  3ITP A;  1PV4 A;  1KDB A;  4KI0 A;  4C3H B;  1B8A A;  4HAE A;  2PYK A;  1FJG Q;  1N32 Q;  3OIP A;  2VQF L;  1OXT A;  3D3R A;  3A0J A;  4X6A H;  1RCV D;  2VUM H;  3EN2 A;  4K6D A;  4UY8 C;  2K5H A;  3PQI A;  5IT9 L;  5C0X G;  2HCC A;  3RN2 A;  3S17 H;  2UUC L;  2B2Y A;  3VDY A;  2K5D A;  5BR8 L;  2R7Z H;  1HZB A;  5JVH 3;  3PIO 3;  1BUV T;  2PNH A;  1Y69 U;  3STB C;  1NTG A;  1OXS C;  4NDX A;  1ZYR D;  3KYH C;  1I94 L;  2HIV A;  1TWG H;  2D62 A;  4A3G H;  2R92 B;  1GUS A;  4R4Q A;  2WP8 J;  1S40 A;  4DV2 Q;  3I2Z A;  1MSG A;  2RHS B;  2DN8 A;  3PO2 H;  1VQI A;  3MTS A;  1AE2 A;  5ELO A;  4MTN A;  2Q2T A;  4O42 A;  2PMZ B;  1YNJ D;  2ZXP A;  2AWO A;  3MXG A;  3S1M B;  3A7L A;  2K5Q A;  4DK6 C;  2ASB A;  2UUB Q;  2DUD A;  5J3B A;  2NTT A;  1NSN S;  2I07 B;  1X55 A;  4TRD A;  3CCQ A;  4L5T A;  3HKZ E;  3GTO H;  5GAG C;  4BS9 A;  3S2H B;  1K0R A;  4IOC A;  4DV4 Q;  4JI6 Q;  2XSC A;  3HG9 A;  2F0N A;  3ULP A;  4A3D G;  1HTP A;  1YIT A;  3T13 A;  4IUU A;  2NZH A;  2KUM A;  4C3I B;  4ULL A;  3JAM i;  1I4X A;  4Y7N H;  1AEX A;  5JEA J;  5IGE A;  3NEL A;  4E6I A;  4QUF A;  3F1Z A;  5KNC A;  2B2V A;  1HHV A;  4LFC L;  2CH4 W;  3HOV G;  3PUV A;  3KFU A;  2M2L A;  2BH8 A;  3H3V C;  1HJP A;  3K58 A;  1LTR D;  1YJN A;  2WB1 B;  2NWG A;  4B3M L;  1CZW A;  2PZW A;  1BQQ T;  2Y0S B;  2LMC B;  1SYF A;  5CV9 A;  4LF7 L;  3P75 A;  4DKA C;  1PYS B;  1XMO Q;  2MHV A;  4WFN 3;  1C8C A;  1YVC A;  2JA9 A;  2FJ2 A;  2XIW A;  3FPP A;  4BBS H;  4MTK A;  4GOP C;  3RZO H;  4ID6 A;  5L37 A;  1QWY A;  1PRT B;  4TKO B;  4KLK A;  2E2I H;  1CT1 D;  3SK8 A;  2HCI A;  2M9V A;  3ICE A;  3MAQ A;  2A68 D;  1TU2 B;  4R4O A;  3AFP A;  2L11 A;  2HT1 A;  3S1Q H;  4A3J B;  5JJL A;  3CQZ H;  1J6Q A;  1R4Q B;  2D5D A;  3MFY A;  4GKK L;  1SDF A;  2H5X A;  4BBR H;  3C1F A;  2YU9 B;  1J8I A;  1VS0 A;  1U4L A;  3FKI B;  2E2J H;  5C0X J;  3KF8 A;  1D5Z C;  4MNO A;  3BDC A;  5IYC G;  4JI5 Q;  4JVZ A;  1K83 B;  2WKC A;  4ZUI A;  4A3M H;  5C4J B;  1S5B D;  4BY7 G;  4LFA Q;  1OXU A;  1Q1E A;  5EKK A;  3DEO A;  5ELF A;  3GTK B;  1LTB D;  5CC4 A;  2FXQ A;  5M5Y B;  3BVG A;  1CSQ A;  5FO8 B;  3TS2 A;  1WD0 A;  1Y1W B;  1N8R C;  5A35 A;  5CV5 A;  2JA5 B;  1HNW Q;  3HZX A;  4N8X 1;  3NEN A;  2SDF A;  1C0A A;  3DEP A;  4ODG A;  2AHO B;  3DM3 A;  1LLR D;  1PFB A;  4X66 L;  3N52 A;  3U9S A;  4ME5 A;  1U9R A;  4F8M A;  3AQQ A;  1WCM H;  4OEM B;  1ET9 A;  5JJI A;  2GA4 B;  1QNU A;  5CMD A;  4ALP A;  1A0I A;  1EFI D;  1HCZ A;  4OHJ A;  2JA6 H;  3SDZ A;  4NPS A;  2F0T A;  3J80 E;  4R1J A;  4DNR B;  1KRS A;  3J81 E;  2AQ3 B;  5G3L F;  1IBM Q;  4QGU A;  4B3R Q;  5HGT A;  2B29 A;  3HEJ A;  4JI3 Q;  3S1N B;  2JA7 G;  1BO0 A;  1MJC A;  3C3L A;  1ZYR C;  2F3V A;  2DY7 A;  2CKZ B;  3R8B A;  4JBK A;  2WAQ G;  2F52 A;  1PVO A;  3NTK A;  4PZ7 A;  1F9Q A;  4JBM A;  4IUV A;  1CHQ D;  4R8I A;  2H4O A;  1EYG A;  2N55 A;  3J80 L;  2EY1 A;  1D7Q A;  1XJV A;  1YNJ C;  1JWS D;  1X9N A;  1HH2 P;  2IJ0 A;  5F2D A;  3GTG B;  1CKN A;  5M3F H;  4JI4 L;  3MXN A;  2AQ1 B; 
#chains in the Genus database with same CATH homology
 3OW2 A;  1YNX A;  4AQY Q;  3RNU A;  3ULL A;  4GLA C;  2CWA A;  4LUZ A;  5FJ8 G;  1D8L A;  3FKI G;  1I5F A;  4YY3 Q;  5FLM H;  3RZD H;  1XPR A;  5IT9 c;  1N33 Q;  1JJG A;  4DK3 C;  1VQP A;  2VQE L;  1T9H A;  3W1G A;  2VUM G;  1V43 A;  1E24 A;  1GKH A;  3KOJ A;  3K0X A;  4GN4 B;  4ME3 A;  1XNQ Q;  3GD7 A;  4IO9 A;  2IHF A;  1Q8K A;  4C3I H;  4K0K L;  1GVP A;  1VQE A;  3KF6 A;  3CC2 A;  2LSS A;  3J81 j;  1UEB A;  5C44 G;  1VQD A;  3SGI A;  5GQO A;  4IJH A;  1VQK A;  3D0F A;  3M4P A;  3F2B A;  4LF6 Q;  4HJA A;  3PF5 A;  1NJI C;  2R7Z G;  4TQU S;  3IRB A;  1XPU A;  3U4Z A;  4IPC A;  5FLX c;  2E5L L;  2ZJP A;  3BZK A;  2F4V L;  3WWV A;  3CCM A;  2C35 B;  4QY7 A;  4DV7 L;  4GKJ L;  1JJC B;  4DR3 Q;  4A3G G;  4X62 Q;  4BXX H;  3T1Y L;  1Y1W G;  4Y52 H;  4APV A;  4A3F G;  2JA5 G;  3J7Z C;  4A76 A;  3PO2 G;  1CKM A;  4QJF A;  4GNX A;  1N34 L;  1YHA A;  2PI2 A;  5LMN W;  1P8L A;  1SRU A;  4AYB G;  4A3C H;  3HKS A;  1QUQ B;  4KHZ A;  1VQJ A;  3PSI A;  5LMN L;  1X54 A;  3GO5 A;  3CXC A;  1PH9 A;  4RG1 A;  4R4C A;  2NZO A;  4DUY L;  2IY5 B;  1OTC A;  4A75 A;  1EQR A;  2UXC L;  3HOX H;  3G6E A;  1WOC A;  5E7N A;  2UXB L;  1VQA A;  4X65 L;  5LMU Q;  4DV6 L;  4A3D H;  4X66 Q;  1N36 L;  1UE1 A;  1L1O A;  4LUV A;  5M3M H;  2L15 A;  4LF9 L;  3STB D;  4LF4 Q;  2GVB A;  4IPD A;  3ULJ A;  4HIK A;  4JI2 L;  4GN5 A;  3GTM H;  4BXX G;  3AYH B;  2UU9 Q;  3HOV H;  1HZA A;  3A5Z B;  1VQN A;  2Q2I A;  4LF5 L;  4OO1 G;  1HNZ Q;  1JMC A;  3CCE A;  1EOV A;  1EIF A;  1SE8 A;  1N9W A;  1Q46 A;  3CPF A;  1Y1V H;  4A3K H;  3CC4 A;  3G48 A;  4HJ7 A;  4B3S Q;  1A63 A;  3NEM A;  4DAM A;  2UUA L;  4OX9 L;  3BJU A;  3GTQ H;  1IYJ B;  3CP0 A;  3CMA A;  3HOW G;  2K5V A;  4IFD J;  2Z6K C;  3HOY G;  4C3H H;  1YHB A;  4FDB A;  4DR6 L;  1I6H H;  4A93 G;  3PIP A;  4LF8 L;  1IXR A;  2CWP A;  4DPG A;  2LXJ A;  5DLQ E;  3I4O A;  2ALY B;  4YHH Q;  2BA1 A;  2ES2 A;  1A62 A;  3RLO A;  2NVY H;  4OWX B;  1NBW A;  3T1H L;  1IBL L;  2WFW A;  1Q82 C;  1LM0 A;  2B3G A;  4GNX C;  3ERS X;  2NN6 G;  1Q1B A;  1HR0 W;  1Z47 A;  1BKB A;  1E3P A;  3K81 C;  4DV0 Q;  3E9H A;  2ZTD A;  4X64 L;  3CD6 A;  4HJ9 A;  2OQK A;  2JE6 I;  4LWC A;  4B3M Q;  4PMW A;  5C4X G;  4JI4 Q;  2MO1 A;  3L0O A;  2OTL A;  4BBS G;  3PF4 A;  3K7U C;  4L5S A;  4BA1 I;  2I0Q A;  1X3F A;  2JA5 H;  1NE3 A;  2I5H A;  3F8T A;  1WJJ A;  4P71 A;  1PH3 A;  2Q2U A;  4LF7 Q;  3HOZ H;  1P16 A;  2VQE Q;  1L1O C;  1FJG L;  1CKN B;  1N32 L;  1XMQ L;  3H0G H;  1K3R A;  1HNX L;  1VQG A;  1EQQ A;  3RLN A;  4K0K Q;  4GLV B;  2NN6 I;  1GD7 A;  1VQC A;  1PH5 A;  3A74 A;  1UWV A;  1K73 C;  4POF A;  4DR4 L;  5GRO A;  3S1R H;  5M5X H;  3M3Y H;  1M1K C;  3PUY A;  4IFD I;  3EIV A;  3S16 H;  5IYC H;  2JJQ A;  2LXK A;  5IYB H;  5ELN A;  1Y14 B;  2F3I A;  4A3I G;  2A1A A;  1Z9F A;  4R4T A;  4NXN L;  2I5M X;  2KHI A;  2YYZ A;  3ZJY C;  2E5L Q;  1AH9 A;  2F4V Q;  3L7Z C;  4BY7 H;  3KF6 B;  4BBR G;  2IX1 A;  4DV7 Q;  1Q12 A;  3TRZ A;  3AEV A;  3GTJ H;  3T1Y Q;  4AIM A;  2N49 A;  4A3B H;  3CW2 C;  3G71 A;  1VQ5 A;  1YEZ A;  3PUW A;  3K80 C;  3M7N A;  2R93 G;  1LYL A;  1N34 Q;  3RR5 A;  3W1B A;  4GKK Q;  2VZA A;  3CCJ A;  4DV2 L;  3E9I A;  3LGJ A;  3S2H H;  4HIO A;  1YJ9 A;  3S1N H;  5LMN Q;  4A3M G;  4JI7 Q;  4UP8 A;  1IZ6 A;  3CCL A;  4DUY Q;  1GM5 A;  4IOA A;  3I4M G;  1K8A C;  3HOW H;  1GO3 E;  1BBW A;  3EBE A;  5AJ3 L;  2UXC Q;  4DV3 L;  2UXB Q;  2QA4 A;  4X65 Q;  4DV6 Q;  1PA6 A;  2N3S A;  1MKH A;  5H1S E;  1N36 Q;  1K9M C;  4LF9 Q;  2HQL A;  2VY3 A;  5C3E H;  2UUB L;  1QVC A;  2B63 G;  3KF8 B;  4JI2 Q;  3CME A;  2Z6K A;  4YCV A;  3I55 A;  3CCU A;  2EIF A;  4AH6 A;  2HHH L;  4A3L G;  3CCV A;  4LF5 Q;  3I4N H;  2PQA A;  5JEA G;  5IWA L;  4PG3 A;  1XPO A;  1SR3 A;  4LNQ A;  2JEB I;  4B3T L;  2AWN A;  4GLX A;  4JYA L;  4DV5 L;  2XTI A;  3F2C A;  5IYD G;  4JI0 L;  3H3V I;  1PH8 A;  4DV4 L;  4JI6 L;  4DR7 L;  4IJL A;  3CAM A;  4POG A;  2IX0 A;  1YZ6 A;  1BBU A;  2IT1 A;  4LUO A;  4BY1 G;  2UUA Q;  4OX9 Q;  3PO3 G;  2KCT A;  1JT8 A;  2JA8 G;  2K75 A;  3MEF A;  2ZJR A;  4DR6 Q;  2YTV A;  1EFW A;  3KLW A;  3PGZ A;  2JA7 H;  1I50 H;  2QEX A;  1FGU A;  1WCM G;  2DGY A;  1CSP A;  4JG2 A;  4LF8 Q;  1C9O A;  4BA2 I;  4UP9 A;  2BA0 A;  1LUZ A;  1B70 B;  2K14 A;  2RF4 A;  4A3E H;  1MJE A;  3HOU G;  2JA6 G;  2Q2H A;  5IP7 G;  1IL2 A;  3CCS A;  5HGQ A;  1VQ6 A;  3T1H Q;  2CFM A;  1IBL Q;  3BU2 A;  5IP9 G;  1S3O A;  4O0A A;  3UDI A;  3PIO A;  1PFS A;  4DR2 L;  3Q8D A;  4X64 Q;  4GN3 B;  2R92 G;  2PMZ E;  1HR0 Q;  1O7I A;  4A3J H;  4R4I A;  2CQO A;  2XGT A;  1M90 C;  4KHP L;  1X6O A;  2VL6 A;  3GTL H;  1XMO L;  2VNU D;  3J7A 5;  1PV4 A;  4KI0 A;  2GVA A;  1XNQ L;  4JBW A;  1B8A A;  2YU9 H;  2AKW B;  1VQB A;  1L0W A;  3UE0 A;  2RCN A;  5FJ8 H;  5GAD C;  1J5E L;  3FKI H;  1FJG Q;  1N32 Q;  2VQF L;  2E2H H;  1HNX Q;  1OXT A;  3A0J A;  4X6A H;  2VUM H;  3OTO L;  3EN2 A;  4UY8 C;  1PYB A;  2K5H A;  1SMX A;  3H3V H;  4OWT B;  1YJW A;  4DR4 Q;  4HJ8 A;  2RHQ B;  1PH6 A;  4OO1 I;  1K83 H;  5C0X G;  3RN2 A;  1QUQ A;  1WYD A;  5C44 H;  5M3F G;  5C4J H;  2JEA I;  3S17 H;  2UUC L;  3VDY A;  4JCV E;  5BR8 L;  1PH7 A;  1KD1 C;  4NXN Q;  1SFO H;  2R7Z H;  1JJ2 A;  1HZB A;  2MO0 A;  5FLM G;  1QZH A;  2PNH A;  3STB C;  3CC7 A;  1NTG A;  5JJK A;  1OXS C;  3GTK H;  2V1C C;  1WFQ A;  3S14 H;  3KYH C;  5M5Y H;  1I94 L;  2HIV A;  4UP7 A;  4DNI A;  1TWG H;  2D62 A;  4A3G H;  4DV1 L;  1DGS A;  2KEN A;  4R4Q A;  1Y1W H;  2WP8 J;  3B6Y A;  3PV0 A;  3I2Z A;  2PI2 E;  4DV2 Q;  1S40 A;  3AFQ A;  4A3F H;  2RHS B;  4DR1 L;  1C7Y A;  3PO2 H;  1MIU A;  1VQI A;  2A19 A;  1TXY A;  1AE2 A;  1UE7 A;  5ELO A;  3FHW A;  2ID0 A;  4MTN A;  2OTJ A;  2Q2T A;  3A5U A;  1VQ9 A;  2WB1 E;  2EQS A;  4UPA A;  3U58 A;  4JI5 L;  3GTP H;  2KBN A;  5AJ3 Q;  3MXN B;  4O2D A;  4DV3 Q;  2AWO A;  2Y0S E;  1Q86 C;  1E22 A;  2OWO A;  1V9P A;  3RN5 A;  3GDE A;  4LFA L;  4GOP A;  1ASZ A;  1EWI A;  2UU9 L;  4DK6 C;  2ASB A;  3PCO B;  3HFZ B;  4IPG A;  3U50 C;  2DUD A;  3PUZ A;  1EUJ A;  4HID A;  1VQO A;  2UUB Q;  5J3B A;  4QQB X;  3CF5 A;  2HIX A;  1YHQ A;  2NVX H;  3K7A H;  1KAW A;  2UXD L;  2HHH Q;  1X3G A;  2NVQ H;  2JK8 A;  4P72 A;  1X55 A;  1R9T H;  1XNR L;  3CCQ A;  4L5T A;  4A3C G;  5IWA Q;  3HKZ E;  4GKJ Q;  1U0L A;  4B3T Q;  3GTO H;  5GAG C;  4JYA Q;  5K36 G;  4DV5 Q;  2WAQ E;  1K0R A;  3UE1 A;  1HNW L;  3U4V A;  1YIJ A;  4JI0 Q;  3D31 A;  1E1T A;  4IOC A;  4DV4 Q;  4JI6 Q;  4DR7 Q;  2K52 A;  3ULP A;  1IBK L;  3HOX G;  3UDF A;  4YWL A;  4A3D G;  1SRO A;  1YIT A;  4EX5 A;  3FP9 A;  4HIM A;  2R7F A;  4PZ6 A;  4QIW E;  2NZH A;  1E7Z A;  5M3M G;  2N78 A;  1FL0 A;  3M4Q A;  4OON A;  4HJ5 A;  3JAM i;  1CKO A;  4Y7N H;  5JEA J;  3NEL A;  3H15 A;  3F1Z A;  1U5K A;  3G4S A;  1VQ7 A;  3HOY H;  1AE3 A;  4LFC L;  4GNX B;  1TWC H;  3UDG A;  3PUV A;  3HOV G;  3KFU A;  4A93 H;  3F2D A;  2BH8 A;  1HJP A;  1W3S A;  4DR5 L;  4DUZ L;  4A4I A;  1HZ9 A;  2E8G A;  2JQO A;  5IE8 A;  1Y1V G;  4A3K G;  1YJN A;  4GS3 A;  4B3M L;  5EAY A;  1TWF H;  4NB3 A;  4DR2 Q;  3UDX A;  1XTD A;  3GTG H;  2I5L X;  4H02 A;  3I56 A;  4NXM L;  4JV5 L;  4LF7 L;  4KHP Q;  1L1O B;  3KDF A;  4DKA C;  1PYS B;  1XMO Q;  1IBM L;  4LFB L;  4B3R L;  1Q7Y C;  3M4O H;  1YVC A;  2KHJ A;  2YV5 A;  4JI3 L;  2JA9 A;  5C4X H;  1QVG A;  4WJ3 M;  2AMC B;  1X3E A;  1LTL A;  4BBS H;  3KJP A;  4GOP C;  2OQ0 A;  1J5E Q;  2GN5 A;  3K8A A;  2VQF Q;  4L5Q A;  1QZG A;  3RZO H;  2YTY A;  1B7Y B;  3CPW A;  1K8G A;  4YCU A;  1YBY A;  3OTO Q;  2ZM6 L;  1E1O A;  1PH1 A;  3S15 H;  4XIG S;  4KLK A;  2E2I H;  1G51 A;  1X56 A;  1KIX A;  1CUK A;  4JI1 L;  3ICE A;  2D0P A;  1HZC A;  4JI8 L;  4LW1 A;  1UE5 A;  4AYB E;  4MZ9 A;  3AFP A;  4R4O A;  1VQL A;  5GAE C;  5BR8 Q;  2UUC Q;  2HT1 A;  3S1Q H;  2MQH A;  1VQ4 A;  5JJL A;  3CQZ H;  1TWH H;  1J6Q A;  3S24 A;  2MNA A;  4A3I H;  3HOZ G;  4GKK L;  4AQY L;  1PHJ A;  4P74 A;  1I94 Q;  2H5X A;  4BBR H;  3BZC A;  1SLJ A;  3H0G G;  4YY3 L;  4OWW B;  1N33 L;  2ATW A;  2QGQ A;  1ASY A;  4DV1 Q;  2K5N A;  3RLF A;  1VS0 A;  4JI7 L;  2N8N A;  2E2J H;  5C0X J;  3TEH B;  4OXP A;  4JOI A;  4DR1 Q;  1JB7 A;  2R93 H;  3J80 c;  1G29 1;  5HY6 A;  4MNO A;  4RMF A;  1VQ8 A;  3I7F A;  1XMQ Q;  5IYC G;  4C3J H;  1UE6 A;  3J81 c;  4JI5 Q;  5GAH C;  5IYB G;  1KL9 A;  4A3M H;  4LF6 L;  3I4M H;  1WI5 A;  2MFI A;  4BY7 G;  4LFA Q;  1OXU A;  1Q1E A;  1PH2 A;  1BVS A;  4QL5 A;  3NBH B;  3M85 A;  4A3B G;  2YTX A;  1Q81 C;  4DR3 L;  2FXQ A;  5IY0 A;  1TWA H;  4X62 L;  2UXD Q;  1CSQ A;  3J80 i;  1XNR Q;  2B63 H;  3TS2 A;  2D0O A;  1L2F A;  1X65 A;  4XTC S;  1H95 A;  4YWK A;  1W2B A;  1N8R C;  4GOP B;  1JE5 A;  3J81 i;  4A3L H;  3JC6 6;  3CCR A;  1HNW Q;  1NMG A;  1I3Q H;  1IBK Q;  1KC8 C;  2VW9 A;  2IHE A;  3NEN A;  2ZJQ A;  1EIY B;  1V1Q A;  1C0A A;  5IYD H;  3E0E A;  2AHO B;  3DM3 A;  1KHI A;  1SN8 A;  5LMU L;  5C3E G;  4BY1 H;  5C0X I;  4X66 L;  5M5W H;  3PO3 H;  1RIP A;  2JA8 H;  1QVF A;  2R6G A;  3W5O A;  2K4K A;  4LFC Q;  3TRE A;  4LF4 L;  3AQQ A;  3I4N G;  1WCM H;  4J15 A;  4IPH A;  5JJI A;  2R7D A;  2WB1 G;  4DR5 Q;  4DUZ Q;  4IFD G;  1OXV A;  2A8V A;  4ALP A;  2EXD A;  1A0I A;  3DLL A;  1HR0 L;  2Y0S G;  1HNZ L;  3HOU H;  1A8V A;  5IP7 H;  3JAM c;  2JA6 H;  4NPS A;  3KJO A;  4P75 A;  1KQS A;  1OXX K;  4JOI C;  1NMF A;  4R1J A;  5IP9 H;  3M9B A;  1PH4 A;  2NVT H;  4B3S L;  4NXM Q;  4JV5 Q;  3PUX A;  1FVI A;  1KRS A;  3TS0 A;  1IBM Q;  4LFB Q;  3S2D H;  4JBJ A;  4QGU A;  1KRT A;  2R92 H;  4B3R Q;  2B29 A;  4JI3 Q;  1VQH A;  4JC0 A;  3TQY A;  2JA7 G;  1RL2 A;  1MJC A;  1YI2 A;  1NY4 A;  3HKZ G;  4YCW A;  2CKZ B;  4A3E G;  2VS1 A;  3OYY A;  4JBK A;  1VQF A;  2PQA B;  2WAQ G;  2ZTC A;  2F52 A;  4P73 A;  1PVO A;  4PZ7 A;  3KDF B;  4JBM A;  4WJ4 A;  1KXL A;  2ZM6 Q;  1VQM A;  4YWM A;  4PZ8 A;  4TVA B;  4YHH L;  2OCE A;  1EYG A;  2Z0S A;  3S1M H;  3L2P A;  1S72 A;  1D7Q A;  4JI1 Q;  1G6P A;  1XJV A;  4L5R C;  1X9N A;  4JI8 Q;  4DAY B;  4A3J G;  1HH2 P;  2CCZ A;  4EQ5 A;  1VCI A;  1CKN A;  4DV0 L;  3ER0 A;  2KCM A;  5M3F H;  4JI4 L;  2BH2 A;  2K50 A;  2ZTE A;  4C2M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...