4F8MA

Crystal structure of staphylococcal nuclease variant delta+phs v23i/i92v at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f8mA00
2F0FA 1NSNS 1KAAA 4K14A 4K5XA 4ZQ3A 4ME5A 3TP8A 1STGA 3PMFA 4DU9A 1TQOA 2PZTA 5IGBA 5EKKA 2RBMA 4K5VA 3R3OA 5KIXA 4E6IA 1KDAA 2EY1A 3NXWA 1A2UA 4KY5A 5I9OA 1EZ8A 2F0GA 4K6DA 5I6YA 5I9PA 5DEHA 1EY4A 2F0LA 1EY9A 4KY7A 5CV5A 2EXZA 1F2ZA 3D6CA 1ENCA 2F0JA 5C4HA 2F0TA 1TR5A 4J1MA 5DAUA 3D4DA 1EY6A 2PYKA 2F0WA 3P75A 5E3FA 3OSOA 4R8NA 3DHQA 1SYGA 1STBA 5J1ZA 3SR1A 3U9OA 4K2KA 4I65A 1SYDA 2EYLA 5CV7A 3SK8A 3SK4A 3QOJA 3T13A 2EY6A 1A3TA 1EY0A 2F0UA 2F0KA 2F0NA 4HMJA 3MVVA 4PMBA 3S9WA 3NQTA 4KTAA 1F2YA 3C1FA 3MXPA 4ZUIA 5HURA 2EYMA 1IHZA 5IGCA 4IALA 3ITPA 1EY7A 2EYHA 4NMZA 3D4WA 4NDXA 5CGKA 1A2TA 4KV6A 3OWFA 2NUCA 5M9OA 2O4XA 1ENAA 4NP5A 1A3UA 2F0HA 1STYA 2LKVA 2WACA 1A3VA 2SOBA 5CV6A 2KHSA 2OF1A 4K8IA 5JAVA 1NUCA 2EY2A 2F0MA 5I6WA 4DGZA 4YIJA 1RKNA 1U9RA 4EVOA 5CR3A 3TP5A 5C3XA 3DMUA 5KYLA 5KRUA 1EY8A 2EYJA 3NUCA 1JORA 3C1EA 1SNOA 5IGDA 4ODGA 4DF7A 2F0PA 4TRDA 3TP6A 5EKLA 3SHLA 1EYDA 4K5WA 1KABA 2F0IA 3E5SA 3H6MA 1JOQA 4KJOA 5IOCA 5CV8A 5KGUA 2F0SA 5E1FA 5F2DA 3RUZA 2OXPA 4IZ8A 5HGTA 4G57A 2QDBA 3EROA 5CV9A 1F2MA 4F7XA 1EY5A 2EYPA 5C5LA 1SYFA 2F0OA 3MHBA 4KD3A 2OEOA 3OMGA 2EYOA 1SNQA 3MEHA 5JOBA 5CV4A 2F0EA 3NP8A 1II3A 5J22A 3SK6A 3SK5A 1EYAA 1KDBA 5IODA 4PNYA 2SNMA 1SNPA 3D8GA 3V2TA 3QOLA 4NKLA 5C4ZA 4RKLA 1SYBA 5K5PA 4DFAA 2RDFA 4H7BA 1EZ6A 3NHHA 4EQNA 4ZUJA 5ISRA 1SNMA 1SNDA 3EJIA 3MZ5A 2HQEA 4WRDA 4B9XA 4RKBA 5NUCA 4PMCA 4EQPA 2F0VA 1STAA 3VA5A 1JOOA 2EY5A 2F0QA 2RKSA 2SNSA 1KDCA 3P1HA 4ID6A 3EVQA 5IIFA 4K2LA 4MIUA 2PZUA 1AEXA 2M00A 4IUNA 5IGFA 5IGGA 1EQVA 2F0DA 4N9PA 4EQOA 3T16A 5KYIA 4WORA 5J39A 4LAAA 4KY6A 4HTHA 5KEEA 4QMGA 1SNCA 3NK9A 5C5MA 5IGEA 1TT2A 2EYFA 3TP7A 4F8MA 2ENBA 2PQEA 4KD4A 2KQ3A 3ERQA 3HZXA 4HMIA 1EYCA 5CC4A 2F3WA 3BDLA 2PZWA 2F3VA 4KJNA 4J6HA 4B9WA 1STNA 5EGTA 5C6AA 3OMCA 4KHVA 3SXHA 3BDCA 2PW7A 3HEJA 4OL7A 4QB4A 4K8JA 3TMEA 1SYCA 2PW5A 4N9TA 4QF4A 1JOKA 5C3WA 1STHA 3LX0A 4S3SA 3QB3A 1SYEA
chains in the Genus database with same CATH superfamily
3H09A 1SE4A 5D3IB 5BN5A 1K8GA 1S3OA 4QQBX 1KDAA 2FMCA 3OIQA 1JWUD 1SMYD 4XYQA 5M5YH 3T4AC 4L63B 1B4OA 2IT1A 2GA4B 3H15A 3QOJA 2IPKD 4DR4Q 3MVVA 4PZ6A 3VR5A 3NQTA 2C35B 2XRSD 3PO2H 3ULPA 4A3GH 3CU7A 4JBWA 1IYJB 1X3EA 3C3LA 2FJ2A 4KV6A 1WD0A 1Q3LA 1AFPA 1BBXC 3CCSA 3S16B 1LTAD 1NBWA 2ZT9C 5DLQE 1O7IA 4A3FH 4XIGS 4FDBA 1YHAA 5C3XA 1JORA 1X54A 3C1EA 2B2UC 3GO5A 5EBDA 2ICEC 1KQSA 3J81j 3VR2A 3BDOA 4K5WA 1PTOD 4CJ2C 1JOQA 4GKKQ 3RR5A 3I8ZA 5KGUA 2OXPA 3GQBA 1ZYRC 3DUZA 5CV9A 3FPPA 4KD3A 1TS3A 4K6LA 4A3JB 1E1OA 1EEID 2EXDA 2C9OA 2CKZB 2ZXRA 3Q24A 3I70A 1FD7D 4RAUC 5K5PA 2DY8A 3TDQA 2B8FA 4JW0A 4H7BA 2DY7A 3NHHA 1O7ZA 5C0XJ 3WWVA 1XX8A 1KTKA 3FKIB 2N55A 4DR1Q 4JCVE 4LMQD 4DR4L 4MIUA 1ENFA 5COYA 5TSSA 1N34Q 5J39A 4N9PA 4DV2Q 4OWWB 4WORA 4DPGA 2ZM6Q 2KCNA 5KEEA 1TWGB 1Z7TA 3J80i 5C0XI 1TT2A 1U0LA 3OYYA 4L5RC 4R4TA 4U673 4LFCQ 3KDFB 2F52A 4ULLA 3PF4A 3HKSA 2JA6G 1IBLL 4HAEA 5C6AA 1LTBD 3FPUB 3OMCA 2ZJRA 3IL8A 1NR4A 4GKJQ 5EPJA 1X55A 1NMFA 4R4IA 3PMFA 3NEMA 3HOZG 3C2PA 1TWCH 3CCEA 4KY5A 4LW1A 4I7ZC 1YHQA 1PFSA 1F9SA 2GN5A 1PYSB 4YWLA 3TZUA 1C0AA 1T5EA 1MHWC 2MUYA 3S1QB 3RZOB 4KTAA 5M3MG 3P7JA 1Y1VB 5HY6A 4KN7C 2JA5H 2UUCL 3EFXD 4DR1L 1EY7A 2EYHA 1CQFA 4XQJA 2KJXA 2A69D 1N34L 2SOBA 3PUVA 2ZM6L 2EY2A 5KNDA 2AMCB 2EYJA 3S2HB 3E6ZX 1SFOB 4MZ9A 5EKLA 4K0KQ 4OO1I 1MI2A 3CCQA 1XMQQ 3HOYG 3E5SA 1DOKA 3BU2A 3STBC 1EIYB 1X3PA 5LL6S 2E2HH 2JQOA 4F7XA 3VR6A 4A3BG 4GKJL 3PIO3 3PV0A 1VQ7A 1HPCA 4BY7G 2XWBB 2F0EA 4OGQC 3DM3A 4Q5VA 2QA4A 2B63G 1YNXA 3AMUA 3M4YA 5FLMG 4ALPA 1HNXL 2SNMA 4A3EB 5EPLA 3RMHA 1LLRD 5BN3A 2O5IC 3GV6A 1LM0A 2A73B 2R92B 3FMCA 4ZAIA 1QILA 3EJIA 2NTSA 3NTIA 2AWNA 4IPDA 1B3QA 3V05A 5ELNA 3HP3A 2JN4A 4DN4M 1OO9B 2K5HA 1V1PA 5DNFA 1QUQA 1SDFA 1F9RA 3KLSA 4RCNA 2NVXH 3DEPA 1G291 3BVGA 4LF8L 4JV5L 2HHHQ 1YIJA 1TS4A 1JQYD 2KBNA 1LTGD 3GTPH 1WTRA 1LTRD 1GUSA 3W3AA 1SR3A 1HRJA 1GUGA 2PW7A 3HEJA 4OL7A 4K0KL 1ASZA 4N9TA 3H0GB 1BF4A 4S3SA 3PUZA 4K5XA 2GVAA 3CC2A 1QG7A 1V8QA 2ICIA 2LXJA 3NXWA 2B39A 3GTQH 1B50A 3NE5B 1FGUA 4LF6L 1EY4A 1F2ZA 2L9HA 3I7FA 3RZDH 5C4XG 1XTCD 2XTIA 4R8IA 2R7ZB 1Q82C 1CK1A 3S14H 1PFBA 4M8AA 1IL2A 2F0UA 2F0KA 3HOVB 1GHJA 3CD6A 3I4NB 2D5DA 4QIWE 5HURA 5M5XH 2QW7A 4KHZA 3BVMA 3GTOH 3BYTB 2O4XA 1MJEA 1ENAA 1G91A 5C3EG 1EFID 4AQYQ 1HUNA 3E0JA 2I07B 4DGZA 1EU4A 1FGBD 2RDHA 3M9BA 2HHHL 3GTLB 5IGDA 1PRTB 2F0PA 4DV7Q 5HGQA 4JOIC 2BCOA 2UXBL 3BJUA 1SSOA 2VY3A 1V1OA 3ULLA 1X56A 3QWNA 3MWYW 5K36G 3K5NA 3MEHA 2UXCQ 2E8GA 1PHJA 2EJFC 1B70B 1FR3A 2OQKA 3M7GA 4BBRB 2EPBA 1BXTA 4OEMB 1KDBA 1P16A 4PNYA 2QEXA 2K5WA 5G3LD 3RLOA 3JAME 1SAPA 1MJCA 1TIID 3VR3A 3MXUA 2B2VA 1MD2D 2IX0A 2F4VQ 1TWFB 2JP1A 1SE8A 3MTSA 4JI8L 1M1KC 2OTJA 1WTXA 2KCCA 2SDFA 4F87A 1RF2D 2VW9A 2CHBD 3M4OH 1UEBA 4CHTB 1PH1A 1V1PB 1QUQB 5A2QE 2Z4HA 4P73A 1YJWA 3FVQA 1PH9A 1F9PA 4QIWB 1F77A 4QMGA 2M2LA 2V1CC 4AQYL 4A3IH 2KQ3A 2A6HD 1GUNA 2JA6H 2A8VA 2TMPA 4DR5Q 1NR2A 2MP1A 4J6HA 4KKTA 1UE7A 1FJGL 5FLXE 5C4JH 1HCZA 3S1NH 5FK9C 1BR9A 1IBMQ 3QR8A 4CBVA 4DXFA 2PMZE 4IN3A 1YNNC 1EOVA 2L5TA 1NY4A 3KLSX 3BG3A 2UXCL 1D8LA 3K81C 1XNQQ 2ZJQA 2C5CA 1A63A 5M5WH 1CSPA 4J1MA 4IFDG 4LUVA 1T5XD 3HOXB 4GLVB 4OONA 3DHQA 4DA2A 2ID0A 4A3JG 2FHTA 3KJPA 5M3MH 4QY7A 3GV3A 3I4MB 3ZYYX 1CTMA 3E9HA 1K8OA 4JI1Q 1I3QH 2UUAQ 2N8NA 2UUBL 2B3GA 3H3VC 1A6XA 3A5UA 2XSCA 2Y0SE 4R1JA 2VUMH 3DEOA 2JA7H 1EL0A 2WKDA 2QEJC 5FO7B 3UDFA 1YVCA 2HIVA 2RDGA 3CCRA 4A4IA 3HOYH 4DR5L 4XXEA 3ICEA 3NPPA 4LF7L 2X6LA 4C3HG 4JVZA 3WDNA 2UU9L 2K5NA 1MIUA 2VL6A 3UDXA 4OWTB 2OEOA 1IBML 4DV0L 1TWAH 2JA8G 2QF7A 4I7AA 3SK6A 3SK5A 2E75C 3J80E 2AUKA 3J7AF 2NVYB 1B44D 3FHWA 2RDFA 4HSPA 3A8KE 3HOZB 4LF4L 1I4GA 2RHQB 5IYBH 4X3KA 1AP0A 1Q1EA 2F0QA 2JXMB 1B53A 2PZUA 4OX9Q 5JEAG 1N32L 2DGYA 3A8IE 4DR2Q 3UI2A 4X3SA 3K5MA 4JI1L 2UUAL 1R9TB 3V96A 1CHQD 4RHRA 4UAIA 3KLWA 3LWEA 1CA5A 5M3FG 1EWCA 1GOZA 2PQEA 4RH6A 3T1YQ 5ELCA 2F3VA 2PNRC 2Z1CA 3VYTA 3I4LA 4JI4Q 1IW7C 1H9JA 5FJ8H 3BDCA 1C4QA 4DNRB 2KHIA 1L1OA 5JVG3 2D0OA 1H95A 1N8RC 3HOWB 1HFGA 2K50A 3D6WA 3VYUA 4H02A 1WI5A 4FXGC 1LV9A 4DK0A 2NVQB 2XN9C 2CW0D 4KI0A 1ASYA 4X62L 4GN3B 3P75A 3WOEA 4NXMQ 1NCVA 4A3CG 3DM1A 2Q2HA 5L37A 5LMNW 4X66L 1SROA 2HCIA 3NBHA 3G4SA 3X3NA 4A3EG 1TY2A 4LWCA 3I73A 2O5JC 2MO1A 1AZPA 1I6HH 3HRZC 1WTQA 4NDXA 1ILPA 3KOJA 1A2TA 1EQTA 4OX9L 1WD1A 1A3UA 3U9SA 2R61A 3HG9A 4BA1I 1VF5C 5IE8A 2JEAI 2R93B 1J9OA 1TU2B 3CW2C 3S1MB 5KYLA 1XJVA 1E2VA 1I6VC 4Z9CB 4OELB 3A7AB 3CMEA 4UP8A 4JI4L 5ELDA 1Y14B 1OXUA 4ZLTF 3T1HL 2LY7A 2B2TA 1KXLA 5C5LA 2F0OA 4JI6L 2CWAA 2JE6I 2RCFA 1V1QA 4DUZQ 5ELOA 1JE4A 1EQRA 3GTKH 3KF6A 2PCFB 1BCPF 2YYZA 3K7AH 2EIFA 4MNOA 4NKLA 1EIGA 3TSSA 3C46A 1CUKA 1ET9A 4Y7NB 3TS0A 3D4RA 1MSHA 5AFWA 2L55A 5IWAL 1PXUA 5IY0A 1UAPA 3CC7A 3RN2A 1Q86C 2Z6KC 3P1HA 2SNSA 4ID6A 1Y8NB 1JJGA 2FMMA 3H94A 2OTLA 5IGGA 2MNAA 3RN5A 2LMCB 4FXKC 2IY5B 2K5QA 1ML0D 1OXXK 4PZ8A 3HOVG 3EA6A 3UE1A 1SNCA 2WB1E 1C7YA 1JB3A 3I4NG 2G5DA 3ERQA 4G7HC 3GTJH 1XPRA 3SVMA 2BDOA 5D14A 1DD2A 4L5SA 3GTMH 3S16H 1K0SA 4JI7Q 4C3IG 3DWQA 4JBJA 3TRZA 2E2DC 5C3EB 3AFPA 1VS0A 2B2UA 1L1OB 1D6EC 3A8JE 3J81L 1SYCA 3M85A 1EIHA 1KC8C 4ME3A 4A75A 2H5XA 4UDUC 2F0FA 1PZID 4C2MB 4WFN3 2JEBI 3TQYA 1SJED 1PYBA 2NWGA 4E6IA 1DOLA 4V0BA 1VQNA 3MXNA 5I9PA 5I6YA 5ELEA 4IJLA 4IFDH 1B7YB 2HCCA 2BA0A 1VQCA 3U50C 1HXYD 1XXGA 4A3JH 1ZYRD 1B3AA 4C3JB 1IXRA 3NBHB 4NXNL 3OTOQ 4BBRG 4LF5Q 3C1FA 4CJ0B 4ZK9B 3A56A 1PFMA 3G6EA 2YTYA 4IUVA 1NNXA 1MBYA 3OWFA 4NP5A 4BBSH 2WINB 1STYA 3FKIH 3LNNA 2RF4A 2EZVA 1O7LA 3H91A 5JJLA 4XT1B 5D65A 1HZBA 2K6AA 2MGSA 1TWGH 3I2ZA 2I5HA 1FVIA 4WJWA 5LHY1 2X6GA 4DV3L 2FXQA 1K83B 5E1FA 4UHVA 2A6EC 2A5HA 2QDBA 4IFDJ 4MN3A 1Y1WB 4GN5A 4DAMA 2EYOA 3W5OA 5C0XH 3EN2A 3ERSX 3DWAA 1FNUA 3KF6B 5IP9G 1K8MA 4O1NA 4C1NK 1TS5A 4JBMA 3S2DB 5EAYA 1LACA 4IFDI 1WTPA 1SYBA 5CYUA 2K7VA 5BR8L 1DXMA 1N33Q 2L4NA 4LFBL 1SNDA 3MZ5A 1LT3D 4BWGB 3KUPA 1RODA 1WCMG 5IYDH 1I5FA 3VA5A 1C9OA 2NN6G 1KDCA 2LXKA 1A62A 2MHVA 4LF5L 4GNXC 3HOXG 1KAWA 2KOLA 2F0DA 1YJ9A 4DR6L 3S1QH 4OWXB 3CQZB 2NVTB 5JPMC 4BXXG 1Y1VH 3OW2A 4A3MG 4A3KB 3I4MG 3M4QA 1G6PA 1AE2A 4MTKA 2PI2A 1E2ZA 1PTOH 4JI5Q 1O80A 4EGVA 3ONAB 1XPUA 2WKCA 4A3DG 3S2HH 2V4DA 2N3SA 3AFQA 4CKBA 2HIXA 1SFOH 2QCPX 1GM5A 1D1KA 1D2BA 5EKKA 4A93G 1CM9A 3MXNB 2RSNA 1X3GA 1EUJA 1YNJC 1JE5A 5GAGC 3F2CA 1XPOA 1UNSA 3STBD 4RWSC 5DAUA 4C3HB 2F0WA 5JEAJ 4JI2Q 4WJ3M 1N36Q 3SR1A 3MXGA 2G9HD 4OO1H 3Q0AA 1SMYC 4AIMA 3IRBA 1N33L 1GKHA 2DN8A 2JA8B 3DWPA 1W6JA 3OW7A 5IT9E 1E3PA 3TZDA 4GKKL 4NMZA 3D4WA 2R92H 1DONA 1S5CD 4ILWA 2A68C 2PI2E 1CI3M 2OF1A 5JJIA 4HR7B 3PO2B 1S40A 2KHJA 3K59A 2OCEA 3ER0A 4A3GB 1M8AA 1GXDC 3URYA 3A7LA 4JC0A 1EYDA 1HQMC 2N78A 4HN7A 4JI5L 3F1ZA 4GS3A 4KKSA 5M3FB 4IZ8A 1JJ2A 4A3FB 2Y0SG 4KK7A 3J7ZC 2F4IA 1PTOC 1QNKA 3S1RH 1SNQA 2CH4W 2R6GA 4IJHA 2SEBD 1GHKA 4XQNA 4BY1G 3H0GH 4DV2L 5ELFA 5IODA 4OIJA 2ALYB 5IT9c 1PH3A 1VQIA 3TREA 3CCVA 1QZHA 3TN2A 3HOWG 1VQEA 4IOCA 3TEHB 2GVBA 2LSSA 2EOTA 4LFCL 4JI2L 2WAQE 1N36L 4IO9A 5NUCA 1IKLA 2EY5A 1G8ZD 4X64Q 3EVQA 2VQFQ 1GD7A 1TKWB 1EQQA 4IUNA 2R7ZH 5EKIA 3JC66 1PRTD 1HA5A 5FKAC 1K73C 1W6KA 2EJMA 2ZJPA 1Q1BA 2F3WA 1CA6A 4IQZA 4EX5A 1S5ED 1QOHA 1BBUA 1B9NA 2ZTCA 2R93G 2PW5A 1QVFA 4JOIA 1STHA 4B3TQ 4FNFA 4QGUA 3NSWA 1KHIA 1EU3A 1B8AA 5KIXA 4XDXA 4FF1A 1IKMA 3BZKA 4G7ZC 2ZTEA 5CV5A 1MKHA 3Q6SA 1Q46A 4YWMA 2BH8A 4FF3A 1U4RA 4KHPQ 4RG1A 3OSOA 2D62A 2CVRA 4KKUA 4DK3C 2EY6A 4ZUIA 3MAQA 2EYMA 1WTWA 1XMQL 3ITPA 1IZ6A 4X64L 2IL8A 3J7YW 2VQFL 5CGKA 1OXVA 1CZGA 3D3RA 3PQIA 4ZKCB 2EDGA 4APVA 2F0MA 2KVMA 3E9IA 2B2YC 1NAPA 2A69C 3SE0A 1LT4D 4CDCC 4DK6C 2F0IA 1X9NA 5JVH3 2DNEA 4G57A 1DCZA 3I72A 3G71A 4B3TL 4PZ7A 4YWKA 4C3IB 3OOCA 3AEVA 3QG1A 3R93A 1K8AC 1XTDA 3A5ZB 1C48A 4JI0Q 2E2HB 4PG3A 1DJRD 2TSSA 3KBXA 2J4XA 3IAYA 1Z47A 4YHHQ 3KFUA 4EQNA 3K7UC 1YNND 4O42A 1PH8A 1TWHB 3RLFA 5C44G 1KLGD 1SBBB 1VQ4A 4A3LG 4P71A 1G2TA 2OWOA 4GN4B 3M7NA 3U4VA 5KYIA 1D5MC 4C3JG 2QILA 4F88A 3UDIA 2UXDQ 1E22A 1PTOF 1UE1A 4GOPC 1I50H 3VR4A 3Q23A 2RHSB 1UEAB 1I4RA 2ZTDA 4LK1C 2XIWA 1Q90A 3K57A 3PUYA 3LX0A 4XT3B 2VB2X 2IJ0A 1XMOQ 1ILQA 4K14A 1L2FA 2WB1G 4O0AA 2RBMA 2JK8A 3IFTA 3R3OA 4K5VA 3GTPB 4CDEC 5DEHA 1H9SA 1VQ6A 5LMUQ 1PVOA 1TR5A 3PO3G 1Y1WG 1SYGA 3E0EA 1WVLA 1G6ZA 1SYDA 5KNCA 2KECA 1A0IA 1S72A 4HMJA 3NWSA 4IUUA 2YTVA 4DV7L 4LFAQ 1NMGA 3UE0A 2NN6I 1BQQT 2NVYH 3RZDB 4FF4A 4ZCKA 1E7ZA 1U4LA 1E1TA 3HOZH 2AHOB 1Y69U 4N8X1 1ZKOA 3NQIA 1XYIA 1VDZA 1WCMB 3J81c 3B6YA 5CORA 2UXDL 5CBAE 5EJWA 5E4WC 4LF9Q 2FINB 1R9TH 3BZDB 5I2YA 3SHLA 3NENA 2L15A 4DAYA 2D2CC 4A3KG 3HOUG 2CH4A 3CPWA 1PZJD 2WFWA 4A3MB 2F4VL 3CCLA 1PZKD 3CKIB 3CRKC 5HGTA 3S17B 4ZKBB 1D7QA 4DR3Q 3N52A 3EIVA 5JOBA 1XMOL 1BCPC 4QJFA 1I94Q 3GTGB 3K5LA 4HJ5A 4ABNA 1IW7D 2E5LQ 3M3YB 1EFWA 3SGIA 5IP7G 4A3DB 3D31A 4RKLA 4DFAA 3A74A 1G2SA 1I4PA 4IPGA 4WRDA 1U5KA 1SXTA 4A93B 2NVQH 3ND8A 2RKSA 4NB3A 4DV5Q 2BA1A 2M00A 4LFAL 2JA9A 2F1MA 4A3BH 2I0QA 4BY7H 1Q7YC 3G48A 4PQXA 2B63H 1BVSA 4P2CB 2HUGA 4P75A 3NK9A 5FLMH 1K3BC 1VF7A 4R9WA 1R4PB 1I4XA 5LL6X 1Y8OB 1JC7A 2NZ1D 2PMZB 2YV5A 1E0BA 1XNQL 1K3RA 1PRTF 4GZYC 4LF9L 3VDYA 1XWEA 4HCSA 4N8FA 2B2WC 4B3MQ 1KNEA 3NELA 3PO2G 3LGJA 3S1MH 4A3GG 1VQBA 4IPCA 4LUOA 2PZTA 4RGOS 5FO9B 1X3QA 3FDTA 4H44C 3K80C 1H9SB 1I94L 4UY8C 1BKBA 3EBEA 5C4HA 1NTGA 3D4DA 4A3FG 2Y0SB 1PV4A 1STBA 3U9OA 4HJ9A 3I4OA 1EOTA 4BY1B 4UP7A 2Q8IB 2DUDA 4IALA 2K1BA 4X3TA 2Z6KA 4DKAC 4CGYB 3KF8A 4DV5L 1AH9A 1M90C 2WACA 4M1UB 4TKOB 2HQLA 2K5DA 4RMFA 4CKCA 1LABA 3MFYA 1AW7A 5D3DA 5C4XH 2E2JB 4QCLA 2BE5D 4TRDA 1CZWA 4DAYB 4QUCA 2IX1A 2Q8RE 4CJ1B 4DV1Q 3PUXA 2VUMB 3H6MA 1VQJA 4L6TB 1LYLA 2JA7B 4DR7Q 3RUZA 2KEDA 4B3ML 3RLNA 1F2MA 2R3ZA 1WYDA 2AQ2B 5CC4A 1SYFA 4R4OA 1E2WA 5C3EH 1VQ9A 4YCWA 1PYWD 4JYAQ 4DR2L 4CDFC 1KRSA 1O78A 3QOLA 3NWTA 2AKWB 4C2MH 2HT1A 2JSOA 3CAMA 5T1GA 5H1SE 1EZ6A 1BDOA 4ZUJA 1TWAB 3T1YL 1TVXA 2IWHA 2F0VA 2RSOA 1HNZQ 4HJ7A 1HHVA 4G4KA 2E2IB 1CQVA 2YU9H 4HJAA 5K36H 4XQQA 3NTKA 4EQOA 4KN4C 4HJ8A 4HTHA 1JICA 4LUZA 1CKNA 4B08A 1S5BD 4KLKA 4L5TA 4TVAB 1CFMA 1Q8IA 3F2UA 4F8MA 3QO2A 3HKZE 5GQOA 2WAQG 2PZWA 4NXML 2VXWA 3S15B 4JG2A 1L0WA 4DR6Q 1QZGA 1WTHA 2JA5G 1S5DD 2A19A 2B29A 2EJGC 1WTVA 1CHPD 5G3LF 4RFBA 4DU9A 4HEDA 2O2LD 1LTTD 4K6DA 4L5QA 3F2DA 4DV4Q 2EXZA 1PDQA 3D6CA 4JYAL 3FEWX 4V190 1ZXTA 1WFQA 4X3UA 2A6ED 3AB9A 4MHEA 1D5ZC 3GP7A 1HNWQ 3ZJYC 5JJKA 3S9WA 2HD3A 3S2DH 2RCNA 1VQAA 1HNZL 3KF8B 2EQSA 1HZAA 1PH5A 1GUWA 1JMCA 3KBGA 4DNIA 1DGSA 2XVSA 4GNXA 2K52A 1EIFA 2NBFA 4NW2A 1U9RA 1SLJA 1TXYA 1SRUA 3JAML 4DUZL 5C44B 3MFGA 1VQDA 3NUCA 1I6HB 4DF7A 4UPAA 3J81i 1M4VA 3HKZB 2E76C 1X32A 4GLAC 5A2QL 2K32A 1Z9FA 2RA4A 1EY5A 1OXTA 1MGSA 4CDDC 2K01A 3CRLC 1H9MA 4XYOA 1N9WA 2KENA 1J8IA 1SNPA 1QJOA 1HR0W 3AYHB 3PUWA 4LNQA 1F2LA 4J8QA 2WB1B 5E7NA 4ZRZA 2I46A 5JAVA 4R4CA 5FLXL 1HNWL 1STAA 3BS1A 3GTKB 5IIFA 4JI7L 4C3HH 2DJFC 1VQ5A 1YNJD 4K2LA 4XTCS 1AEXA 3PO3B 4DXGA 1KRTA 5IYCG 1CKNB 2JA8H 1IYUA 4B3SQ 1ET6A 3K8AA 1SEBD 2ENBA 4KD4A 1SMXA 1TS2A 4POFA 5EGTA 4GLXA 4JBKA 2Q2IA 3M4PA 3TMEA 2A68D 1Q12A 3HS0C 1JOKA 5C3WA 3BVZA 3OTOL 5JEAH 3GTJB 1G51A 1OTCA 5DM63 4OIKA 3GTMB 4U68A 3RZOH 3TS2A 5I9OA 1I4QA 2L12A 5M3FH 3HOUB 2F0TA 3U58A 5CMDA 1FNVA 1IBLQ 1EY6A 3K0XA 5E3FA 5J1ZA 1VMPA 2AWOA 2Z9HA 1PH7A 1VQKA 2MPMA 3T13A 1QE6A 5GAEC 3L2PA 3CCUA 2H4OA 1QVCA 1QB5D 3IFDA 4FVMA 2K33A 3J7A5 4GNXB 2LKVA 2J7ZA 3CMAA 1GO3E 2KUMA 3SEBA 2D0PA 3J80L 4FYDA 2VNUD 4AYBE 1RKNA 1CKOA 4B3SL 1PLFA 5CR3A 4EQ5A 2JJQA 1ONLA 3TP5A 1VCIA 2F3IA 4A3CH 1SNOA 1MSGA 2N49A 5I4DA 2BH2A 3TP6A 3N6RA 4BBSB 2ATWA 2UUCQ 1DM0B 1O7YA 5KNBA 4A3EH 2WV6D 4QL5A 4IOAA 5M5YB 1JCKB 4G7OC 3MHBA 1F9QA 2RQXA 3T56B 3R2IA 2QKIC 3PGZA 4A3IG 3FP9A 2I5LX 2K28A 2KEEA 1RTNA 1UE6A 1YEZA 2E74C 5ISRA 1LTID 1SNMA 3MC0B 4B9XA 2CQOA 4HIOA 3CXCA 1JOOA 2PPBC 3CC4A 3FRPB 5JJZA 1HZ9A 4DNTB 5IGFA 1HNXQ 1SE3A 5IGEA 2I5MX 4UP9A 3I90A 5E4XA 4DV6Q 3TP7A 4NPSA 2WP8J 3HZXA 1EYCA 2AUJD 1PH4A 3A0JA 2B2YA 1BBWA 4AYBB 3ND9A 3PSIA 1HA6A 4QF4A 1QNUA 1KAAA 4LF8Q 1Q8KA 4JV5Q 2VS1A 1S4ZA 5BN4A 2L0CA 2OT2A 3HOVH 1PTOB 2VUMG 1X3FA 2JA7G 3I4NH 5I2XA 2HDLA 1EWIA 1WOCA 1PH6A 1E24A 1NE3A 1ICWA 3I3CA 1KNAA 1GUOA 4I65A 3SK8A 2EYLA 4C3IH 3KK7A 3SK4A 3WOFA 1EY0A 2IW3A 2WIIB 1IL8A 4IUQA 3GD7A 4FF2A 3GTLH 5EQ0A 1KIXA 3TBIB 1AN8A 3K0YA 4LF6Q 5M9OA 2NUCA 5ELBA 2F0HA 4IURA 1CSQA 3KYHC 1TWHH 5CV6A 1XNRQ 3OIPA 4P72A 1DZ1A 1NUCA 4HIKA 3PIPA 4EVOA 3CCJA 4DV6L 3IKJA 4GOPA 2Z6BA 4DAPA 1TWCB 4BBRH 5IYBG 4TSSA 1VQ8A 2NTTA 1LT6D 1HUMA 3R8BA 1Y8PB 2LFNA 3QJYA 2WAQB 3PF5A 1TWFH 1RL2A 2A74C 2EVBA 1GVPA 5J22A 2A1AA 1AE3A 1AZQA 2K04A 5AJ3Q 2JA5B 1RJTA 2Q2TA 2UXBQ 3S1RB 1VQOA 3GDEA 3CCMA 5EPKA 1K0RA 5FJ8G 2ASBA 2ES2A 4YCVA 5IYCH 3I91A 2K5VA 2MQHA 3T16A 4Y52H 5IP9H 1ESRA 5C5MA 3I56A 4LJZC 2EYFA 2P5ZX 1XNRL 2KA7A 3W1BA 3OHXC 1PRTC 3PCOB 4JI8Q 3U4ZA 4KHPL 4KHVA 1WCMH 4O2DA 4HIMA 2HDMA 1VQLA 2N88A 2NN6H 5J3BA 3RD4A 1UWVA 1C8CA 4IPHA 3HOXH 1JWSD 2VQEQ 1TQOA 2MJ8A 5EBCA 5FOBB 2PQAA 4BXXH 1UE5A 4A3MH 3HKZG 5T1IA 3I4MH 4FP5D 1YZ6A 3S17H 1ENCA 2CWPA 2PO4A 2MFIA 4RGTA 4B3RQ 4R8NA 3K5OA 5AJ3L 1SE2A 4PV1C 1RDPD 3GTGH 1FJGQ 2NVXB 1A3TA 2Z8LA 3CP0A 5GAHC 1BCPD 3M3YH 1VQFA 3X3MA 1UUPA 1IHZA 5IGCA 4JI3Q 3J81E 4A3DH 2IX3A 2G9DA 4A93H 1CT1D 1A3VA 3UDGA 3EQLC 4GOPB 3W2DA 2NB0A 3W1GA 4JI0L 1DYQA 2F03A 3H3VH 2IHEA 2AQ1B 5CBEE 1KABA 4YHHL 3GTQB 1QCBD 1VQPA 1U4MA 2UUBQ 1R4QB 2F0SA 2DJGC 2B2WA 3DXJC 4OHJA 4X6AH 1YI2A 3OMGA 2VQEL 1S5FD 3NP8A 1Z6HA 3S14B 4RHSA 3V2TA 3L9AX 2BOSA 2XWJB 5M5XB 3I55A 1YJNA 4LF7Q 4B3RL 3GTOB 2UU9Q 2FFKB 3K6OA 1JWMD 1LUZA 2BDNA 4RKBA 5LMNQ 1U4PA 1BUVT 2KCMA 1RD9D 3JAMc 4DV0Q 1V9PA 1EWHA 3F2BA 1TY0A 2R7FA 4JI3L 3S24A 1DOMA 1HH2P 2PNHA 4POGA 1VQGA 4KY6A 2IHFA 1HTLD 3L3OC 4BY1H 3F8TA 1LT5D 3HFZB 4J15A 4X65Q 1W2BA 3HOWH 1RHPA 4RGMA 5LMUL 4LF4Q 2LS01 1STNA 1HQRD 3H3VI 5IT9L 3OPOA 1N32Q 4K8JA 2E2JH 4IUTA 2CQAA 1I50B 1SYEA 1HJPA 1NSNS 3TP8A 4ME5A 1PH2A 1STGA 2L11A 5IGBA 1B9MA 4BBSG 2PQAB 3E3XA 1VQHA 3FKIG 3VYRA 3MEFA 5FLXc 1KL9A 1LO5D 2F0LA 1BCPB 1EY9A 2B2VC 1JT8A 2XRQD 2CCZA 2PYKA 3M4OB 1PA6A 3AU7A 4IUPA 4K2KA 5CV7A 4HCEA 2F0NA 4YCUA 3PIP3 2R93H 1X6OA 3VA7A 2A6HC 4DUYQ 3KJOA 5LMNL 4A3IB 1EEFD 1IYVA 1RCVD 1RTOA 4DAVA 2JYOA 2JA6B 2K05A 4C1NI 5C0XG 4X62Q 4DR3L 2KHSA 2CFMA 3ULJA 4BS9A 5I6WA 2ZXOA 3CF5A 4YIJA 2E2IH 5JPNC 2L1BA 5C4JB 1VQMA 3S1NB 2K03A 4L8JA 4X66Q 4RCOA 2E5LL 4X65L 1NJIC 2B8GA 4HSVA 5A35A 2X69A 1HZCA 5IYDG 4HIDA 1W3SA 5CV8A 5F2DA 4JK1C 1ZEQX 4MTNA 4WJ4A 5M5WB 4Y7NH 2QGQA 3EROA 2QDLA 2K14A 4AYBG 3S15H 2YTXA 1II3A 1Y1VG 4QUFA 5M3MB 3D8GA 1J5EQ 1JB7A 2M9VA 1FNWA 1A8VA 2D9UA 2Z4IA 3G7LA 4JPBW 1I3QB 3L0OA 2HQEA 1WJJA 3T1HQ 4PMCA 3A54A 3J80c 4OXPA 2K4KA 4JI6Q 4DUYL 1IBKQ 1EQVA 1BOSA 3Q8DA 1EYGA 1B2TA 1P8LA 4LAAA 1SN8A 2KCTA 1STEA 3HOYB 1HFNA 2Q8TA 3QIAA 1K28A 2MO0A 5FO8B 4R4QA 5IWAQ 1HR0Q 4HMIA 2Z0SA 1RIPA 3CHBD 4A3BB 1FL0A 4KJNA 2VB3X 3O13A 1PMRA 4OO1G 1A15A 4BY7B 2B63B 1QWYA 3SXHA 5GROA 1GJXA 4QB4A 5C44H 1KD1C 1L0YB 2OQ0A 4A3LH 3QB3A 5GADC 1Q81C 1YHBA 3OWEB 4ZQ3A 3D0FA 2R92G 4C3JH 2EY1A 2NYZD 1A2UA 1EZ8A 2F0GA 2ZXPA 1L0XB 4KY7A 4Q0FA 3DLLA 2F0JA 3HGBA 4CKEA 2EE1A 3L7ZC 1GUTA 1T9HA 1H9KA 2VZAA 1J5EL 5DM73 2Q2UA 1YBYA 4PMBA 2XNAC 4PMWA 1F2YA 3MXPA 3K58A 4H0LC 4DV1L 4BA2I 1CKMA 3AQQA 4DR7L 1D5XC 1ICFB 4KMUC 4TQUS 1IBKL 4RGNA 3RNUA 4K8IA 4YY3Q 4H13C 3G6JB 1K83H 3H0GG 3SDZA 2H1EA 3PO3H 3NTHA 1Y1WH 3DMUA 5KRUA 1EY8A 1B1ZA 3Q22A 4NXNQ 1VMCA 1HR0L 1OXSC 4C56C 4ODGA 1L1OC 1LTLA 4FO2A 2R7DA 1FYCA 2CW0C 1X65A 4KJOA 5IOCA 1LTSD 3R2TA 5C4XB 4DK1A 2BE5C 1JR0D 2R7ZG 2EYPA 1HTPA 3KLRA 1JJCB 2DNCA 5CV4A 2AQ3B 4P74A 1V43A 3J7AV 1EYAA 3P20A 4ZYSA 1PFNA 5C4ZA 3MA2B 2J0TD 3LWUA 4RA8A 4DV3Q 3T51B 3PIOA 3CQZH 2NVTH 4A3KH 2XGTA 4EQPA 3HOUH 1BO0A 2NZOA 1H9RA 1K9MC 3BZCA 1WTOA 1BNZA 1YITA 2NZHA 1ESFA 3JAMi 3NBIA 5BR8Q 4FXDA 3VYSA 1D1IA 4YY3L 3A55A 4LFBQ 4AH6A 5IP7H 4DV4L 2YU9B 3CPFA 1SJHD 3KDFA 3T53B 3BDLA 1KLUD 4B9WA 1I4HA 1J6QA 2K75A 2B2TC 2RVLA 3BYYB 4A76A 1QVGA 3K7AB
chains in the Genus database with same CATH topology
3H09A 1SE4A 5D3IB 5BN5A 1KDAA 2FMCA 3OIQA 1JWUD 1SMYD 4XYQA 3T4AC 4L63B 1B4OA 2IT1A 2GA4B 3QOJA 2IPKD 3MVVA 3VR5A 3NQTA 2XRSD 3CU7A 4JBWA 3C3LA 2FJ2A 4KV6A 1WD0A 1Q3LA 1AFPA 1BBXC 3S16B 1LTAD 2ZT9C 4XIGS 5C3XA 1JORA 3GO5A 3C1EA 2B2UC 5EBDA 2ICEC 3VR2A 3BDOA 4K5WA 1PTOD 4CJ2C 1JOQA 3I8ZA 5KGUA 2OXPA 3GQBA 1ZYRC 3DUZA 5CV9A 3FPPA 4KD3A 1TS3A 4K6LA 4A3JB 1EEID 2C9OA 2ZXRA 3Q24A 3I70A 1FD7D 4RAUC 5K5PA 2DY8A 3TDQA 2B8FA 4H7BA 2DY7A 3NHHA 1O7ZA 5C0XJ 1XX8A 1KTKA 3FKIB 2N55A 4LMQD 4MIUA 1ENFA 5COYA 5TSSA 5J39A 4N9PA 4WORA 2KCNA 5KEEA 1TWGB 1Z7TA 5C0XI 1TT2A 4U673 4ULLA 4HAEA 5C6AA 1LTBD 3FPUB 3OMCA 3IL8A 1NR4A 5EPJA 3PMFA 3C2PA 4KY5A 4I7ZC 1F9SA 3TZUA 1T5EA 2MUYA 3S1QB 3RZOB 4KTAA 3P7JA 1Y1VB 4KN7C 3EFXD 1EY7A 2EYHA 1CQFA 4XQJA 2KJXA 2A69D 2SOBA 3PUVA 2EY2A 5KNDA 2EYJA 3S2HB 3E6ZX 1SFOB 5EKLA 4OO1I 1MI2A 3E5SA 1DOKA 1X3PA 5LL6S 4F7XA 3VR6A 3PIO3 3PV0A 1HPCA 2XWBB 2F0EA 4OGQC 4Q5VA 3AMUA 3M4YA 2SNMA 4A3EB 5EPLA 3RMHA 1LLRD 5BN3A 2O5IC 3GV6A 2A73B 2R92B 3FMCA 4ZAIA 1QILA 3EJIA 2NTSA 3NTIA 2AWNA 3V05A 3HP3A 4DN4M 1OO9B 1V1PA 5DNFA 1SDFA 1F9RA 3KLSA 4RCNA 3DEPA 1G291 3BVGA 1TS4A 1JQYD 1LTGD 1WTRA 1LTRD 1GUSA 3W3AA 1HRJA 1GUGA 2PW7A 3HEJA 4OL7A 4N9TA 3H0GB 1BF4A 4S3SA 3PUZA 4K5XA 1QG7A 1V8QA 2ICIA 3NXWA 2B39A 1B50A 3NE5B 1EY4A 1F2ZA 2L9HA 1XTCD 4R8IA 2R7ZB 1CK1A 1PFBA 4M8AA 2F0UA 2F0KA 3HOVB 1GHJA 3I4NB 2D5DA 5HURA 4KHZA 3BVMA 3BYTB 2O4XA 1ENAA 1G91A 1EFID 1HUNA 3E0JA 2I07B 4DGZA 1EU4A 1FGBD 2RDHA 3GTLB 5IGDA 1PRTB 2F0PA 2BCOA 1SSOA 1V1OA 3QWNA 3MWYW 5K36G 3K5NA 3MEHA 2EJFC 1FR3A 3M7GA 4BBRB 2EPBA 1BXTA 1KDBA 4PNYA 2K5WA 5G3LD 3JAME 1SAPA 1TIID 3VR3A 3MXUA 2B2VA 1MD2D 2IX0A 1TWFB 2JP1A 3MTSA 1WTXA 2KCCA 2SDFA 4F87A 1RF2D 2CHBD 4CHTB 1V1PB 5A2QE 2Z4HA 3FVQA 1F9PA 4QIWB 1F77A 4QMGA 2M2LA 2KQ3A 2A6HD 1GUNA 2TMPA 1NR2A 2MP1A 4J6HA 4KKTA 5FLXE 1HCZA 5FK9C 1BR9A 4CBVA 4DXFA 4IN3A 1YNNC 2L5TA 3KLSX 3BG3A 2C5CA 4J1MA 4IFDG 1T5XD 3HOXB 3DHQA 4DA2A 2ID0A 2FHTA 3GV3A 3I4MB 3ZYYX 1CTMA 1K8OA 3H3VC 1A6XA 2XSCA 3DEOA 1EL0A 2WKDA 2QEJC 5FO7B 2RDGA 4XXEA 3NPPA 2X6LA 4C3HG 3WDNA 2OEOA 2QF7A 3SK6A 3SK5A 2E75C 3J80E 2AUKA 3J7AF 2NVYB 1B44D 2RDFA 4HSPA 3A8KE 3HOZB 1I4GA 4X3KA 1AP0A 1Q1EA 2F0QA 2JXMB 1B53A 2PZUA 5JEAG 3A8IE 3UI2A 4X3SA 3K5MA 1R9TB 3V96A 1CHQD 4RHRA 4UAIA 3LWEA 1CA5A 1EWCA 1GOZA 2PQEA 4RH6A 5ELCA 2F3VA 2PNRC 2Z1CA 3VYTA 3I4LA 1IW7C 1H9JA 3BDCA 1C4QA 4DNRB 5JVG3 3HOWB 1HFGA 3D6WA 3VYUA 4FXGC 1LV9A 4DK0A 2NVQB 2XN9C 2CW0D 4KI0A 3P75A 3WOEA 1NCVA 3DM1A 2HCIA 3NBHA 3X3NA 1TY2A 2O5JC 3I73A 1AZPA 3HRZC 1WTQA 4NDXA 1ILPA 1A2TA 1EQTA 1WD1A 1A3UA 3U9SA 2R61A 3HG9A 4BA1I 1VF5C 2JEAI 2R93B 1J9OA 1TU2B 3S1MB 5KYLA 1E2VA 1I6VC 4Z9CB 3A7AB 5ELDA 1OXUA 4ZLTF 2LY7A 2B2TA 5C5LA 2F0OA 2JE6I 1JE4A 2PCFB 1BCPF 2YYZA 3TSSA 4NKLA 3C46A 1EIGA 1ET9A 4Y7NB 3D4RA 1MSHA 5AFWA 2L55A 1PXUA 1UAPA 3P1HA 2SNSA 4ID6A 1Y8NB 2FMMA 3H94A 5IGGA 2LMCB 4FXKC 2K5QA 1ML0D 1OXXK 3EA6A 1SNCA 1JB3A 3ERQA 4G7HC 3SVMA 2BDOA 5D14A 1DD2A 4C3IG 3DWQA 2E2DC 5C3EB 2B2UA 3A8JE 1D6EC 3J81L 1SYCA 3M85A 1EIHA 4UDUC 2F0FA 1PZID 4C2MB 4WFN3 2JEBI 1SJED 2NWGA 4E6IA 1DOLA 4V0BA 3MXNA 5I9PA 5I6YA 5ELEA 4IFDH 2HCCA 2BA0A 1HXYD 1XXGA 1ZYRD 1B3AA 4C3JB 3C1FA 4CJ0B 4ZK9B 3A56A 1PFMA 4IUVA 1MBYA 3OWFA 4NP5A 2WINB 1STYA 3LNNA 2EZVA 1O7LA 3H91A 4XT1B 5D65A 2K6AA 2MGSA 4WJWA 5LHY1 2X6GA 1K83B 5E1FA 2A6EC 2A5HA 2QDBA 4IFDJ 4MN3A 1Y1WB 2EYOA 5C0XH 3DWAA 1FNUA 1K8MA 4O1NA 4C1NK 1TS5A 3S2DB 1LACA 4IFDI 1WTPA 1SYBA 5CYUA 2K7VA 1DXMA 2L4NA 1SNDA 3MZ5A 1LT3D 4BWGB 3KUPA 1RODA 3VA5A 2NN6G 1KDCA 2MHVA 2KOLA 2F0DA 3CQZB 2NVTB 5JPMC 4A3KB 1E2ZA 1PTOH 1O80A 4EGVA 3ONAB 2WKCA 2V4DA 4CKBA 2QCPX 1D1KA 1D2BA 5EKKA 1CM9A 2RSNA 1YNJC 1UNSA 4RWSC 5DAUA 4C3HB 2F0WA 5JEAJ 3SR1A 3MXGA 2G9HD 4OO1H 3Q0AA 1SMYC 2DN8A 2JA8B 3DWPA 1W6JA 3OW7A 5IT9E 3TZDA 4NMZA 3D4WA 1DONA 1S5CD 4ILWA 2A68C 1CI3M 2OF1A 4HR7B 3PO2B 3K59A 4A3GB 1M8AA 1GXDC 3URYA 3A7LA 1EYDA 1HQMC 4HN7A 4KKSA 5M3FB 4IZ8A 4A3FB 4KK7A 2F4IA 1PTOC 1QNKA 1SNQA 2R6GA 2SEBD 1GHKA 4XQNA 5ELFA 5IODA 4OIJA 3TN2A 2EOTA 5NUCA 1IKLA 2EY5A 1G8ZD 3EVQA 1TKWB 4IUNA 5EKIA 1PRTD 1HA5A 5FKAC 1W6KA 2EJMA 1Q1BA 2F3WA 1CA6A 4IQZA 1S5ED 1QOHA 1B9NA 2PW5A 1STHA 4FNFA 3NSWA 1EU3A 5KIXA 4XDXA 4FF1A 1IKMA 4G7ZC 5CV5A 3Q6SA 4FF3A 1U4RA 3OSOA 2D62A 2CVRA 4KKUA 2EY6A 4ZUIA 3MAQA 2EYMA 1WTWA 3ITPA 2IL8A 3J7YW 5CGKA 1OXVA 1CZGA 3D3RA 4ZKCB 2EDGA 2F0MA 2KVMA 2B2YC 1NAPA 2A69C 3SE0A 1LT4D 2F0IA 5JVH3 2DNEA 4G57A 1DCZA 3I72A 4C3IB 3OOCA 3QG1A 3R93A 1C48A 2E2HB 1DJRD 2TSSA 3KBXA 2J4XA 3IAYA 1Z47A 4EQNA 1YNND 4O42A 1TWHB 3RLFA 1KLGD 1SBBB 1G2TA 3M7NA 5KYIA 1D5MC 4C3JG 2QILA 4F88A 1PTOF 3VR4A 3Q23A 1UEAB 1I4RA 4LK1C 2XIWA 1Q90A 3K57A 3PUYA 4XT3B 3LX0A 2VB2X 2IJ0A 1ILQA 4K14A 2RBMA 4K5VA 3IFTA 3R3OA 3GTPB 5DEHA 1H9SA 1TR5A 1SYGA 1WVLA 1G6ZA 1SYDA 5KNCA 2KECA 4HMJA 3NWSA 4IUUA 2NN6I 1BQQT 3RZDB 4FF4A 1U4LA 1Y69U 1ZKOA 3NQIA 1XYIA 1VDZA 1WCMB 5CORA 5CBAE 5EJWA 5E4WC 2FINB 3BZDB 5I2YA 3SHLA 4DAYA 2D2CC 1PZJD 4A3MB 1PZKD 3CKIB 3CRKC 5HGTA 3S17B 4ZKBB 3N52A 5JOBA 1BCPC 3GTGB 3K5LA 4ABNA 1IW7D 3M3YB 4A3DB 3D31A 4RKLA 4DFAA 1G2SA 1I4PA 4WRDA 1SXTA 4A93B 3ND8A 2RKSA 2BA1A 2M00A 2F1MA 4PQXA 4P2CB 2HUGA 3NK9A 1VF7A 4R9WA 1R4PB 1I4XA 5LL6X 1Y8OB 1JC7A 2NZ1D 2PMZB 1E0BA 1PRTF 4GZYC 1XWEA 4HCSA 2B2WC 1KNEA 2PZTA 4RGOS 5FO9B 1X3QA 3FDTA 4H44C 1H9SB 5C4HA 3D4DA 2Y0SB 1STBA 3U9OA 1EOTA 4BY1B 2Q8IB 4IALA 2K1BA 4X3TA 4CGYB 3KF8A 2WACA 4M1UB 4TKOB 2K5DA 4CKCA 1LABA 3MFYA 1AW7A 5D3DA 2E2JB 4QCLA 2BE5D 4TRDA 1CZWA 2IX1A 4QUCA 2Q8RE 4CJ1B 3PUXA 2VUMB 3H6MA 4L6TB 2JA7B 3RUZA 2KEDA 1F2MA 2R3ZA 5CC4A 2AQ2B 1SYFA 1E2WA 1PYWD 1O78A 3QOLA 3NWTA 2JSOA 5T1GA 1EZ6A 4ZUJA 1BDOA 1TWAB 1TVXA 2IWHA 2F0VA 2RSOA 1HHVA 4G4KA 2E2IB 1CQVA 5K36H 4XQQA 3NTKA 4EQOA 4KN4C 4HTHA 1JICA 4B08A 1S5BD 1CFMA 1Q8IA 3F2UA 4F8MA 3QO2A 2PZWA 2VXWA 3S15B 1S5DD 2EJGC 1WTVA 1CHPD 5G3LF 4RFBA 4DU9A 4HEDA 2O2LD 1LTTD 4K6DA 2EXZA 1PDQA 3D6CA 3FEWX 4V190 1ZXTA 4X3UA 2A6ED 3AB9A 4MHEA 1D5ZC 3GP7A 3S9WA 1GUWA 3KBGA 2XVSA 2NBFA 4NW2A 1U9RA 3JAML 5C44B 3MFGA 3NUCA 1I6HB 4DF7A 1M4VA 3HKZB 2E76C 1X32A 5A2QL 2K32A 2RA4A 1EY5A 1OXTA 1MGSA 2K01A 3CRLC 1H9MA 4XYOA 1J8IA 1SNPA 1QJOA 3PUWA 1F2LA 4J8QA 2WB1B 4ZRZA 2I46A 5JAVA 5FLXL 1STAA 3BS1A 3GTKB 5IIFA 1YNJD 4K2LA 4XTCS 1AEXA 3PO3B 4DXGA 1IYUA 1ET6A 1SEBD 2ENBA 4KD4A 1TS2A 5EGTA 3TMEA 2A68D 1Q12A 3HS0C 1JOKA 5C3WA 3BVZA 5JEAH 3GTJB 5DM63 4OIKA 3GTMB 4U68A 5I9OA 1I4QA 2L12A 3HOUB 2F0TA 5CMDA 1FNVA 1EY6A 5E3FA 5J1ZA 1VMPA 2AWOA 2MPMA 3T13A 1QE6A 2H4OA 1QB5D 3IFDA 4FVMA 2K33A 2LKVA 2J7ZA 2KUMA 3SEBA 3J80L 4FYDA 2VNUD 1RKNA 1PLFA 5CR3A 1ONLA 3TP5A 1VCIA 1SNOA 1MSGA 5I4DA 3TP6A 3N6RA 4BBSB 1DM0B 1O7YA 5KNBA 2WV6D 5M5YB 1JCKB 4G7OC 3MHBA 1F9QA 2RQXA 3T56B 3R2IA 2QKIC 2K28A 2KEEA 1RTNA 2E74C 5ISRA 1LTID 1SNMA 3MC0B 4B9XA 1JOOA 2PPBC 3FRPB 5JJZA 4DNTB 5IGFA 1SE3A 5IGEA 3I90A 5E4XA 3TP7A 2WP8J 3HZXA 1EYCA 2AUJD 2B2YA 4AYBB 3ND9A 1HA6A 4QF4A 1QNUA 1KAAA 1S4ZA 5BN4A 2L0CA 2OT2A 1PTOB 5I2XA 2HDLA 1ICWA 3I3CA 1KNAA 1GUOA 4I65A 3SK8A 2EYLA 3KK7A 3SK4A 3WOFA 1EY0A 2IW3A 2WIIB 1IL8A 4IUQA 3GD7A 4FF2A 5EQ0A 3TBIB 1AN8A 3K0YA 5M9OA 2NUCA 5ELBA 2F0HA 4IURA 5CV6A 1DZ1A 3OIPA 1NUCA 4EVOA 3IKJA 4DAPA 1TWCB 4TSSA 2NTTA 1LT6D 1HUMA 3R8BA 1Y8PB 2LFNA 3QJYA 2WAQB 2A74C 2EVBA 5J22A 1AZQA 2K04A 2JA5B 1RJTA 3S1RB 5EPKA 3I91A 3T16A 1ESRA 5C5MA 4LJZC 2EYFA 2KA7A 3OHXC 1PRTC 4KHVA 2HDMA 2N88A 2NN6H 3RD4A 1C8CA 1JWSD 1TQOA 2MJ8A 5EBCA 5FOBB 5T1IA 4FP5D 1ENCA 2PO4A 4RGTA 4R8NA 3K5OA 1SE2A 4PV1C 1RDPD 2NVXB 1A3TA 2Z8LA 1BCPD 3X3MA 1UUPA 1IHZA 5IGCA 3J81E 2IX3A 2G9DA 1CT1D 1A3VA 3EQLC 3W2DA 2NB0A 1DYQA 2F03A 2AQ1B 5CBEE 1KABA 3GTQB 1QCBD 1U4MA 1R4QB 2F0SA 2B2WA 3DXJC 4OHJA 3OMGA 1S5FD 3NP8A 1Z6HA 3S14B 4RHSA 3V2TA 3L9AX 2BOSA 2XWJB 5M5XB 3GTOB 2FFKB 1JWMD 2BDNA 3K6OA 4RKBA 1U4PA 1BUVT 1RD9D 1EWHA 1TY0A 1DOMA 4KY6A 1HTLD 3L3OC 1LT5D 1RHPA 4RGMA 2LS01 1STNA 1HQRD 5IT9L 3OPOA 4K8JA 4IUTA 2CQAA 1I50B 1SYEA 1NSNS 3TP8A 4ME5A 1STGA 2L11A 5IGBA 1B9MA 3VYRA 1LO5D 2F0LA 1BCPB 1EY9A 2B2VC 2XRQD 2PYKA 3M4OB 3AU7A 4IUPA 4K2KA 5CV7A 4HCEA 2F0NA 3PIP3 3VA7A 2A6HC 4A3IB 1EEFD 1IYVA 1RCVD 1RTOA 4DAVA 2JYOA 2JA6B 2K05A 4C1NI 5C0XG 2KHSA 4BS9A 5I6WA 2ZXOA 4YIJA 5JPNC 2L1BA 5C4JB 3S1NB 2K03A 4L8JA 4RCOA 2B8GA 4HSVA 5A35A 2X69A 5CV8A 5F2DA 4JK1C 1ZEQX 5M5WB 3EROA 1II3A 4QUFA 5M3MB 3D8GA 2M9VA 1FNWA 2D9UA 2Z4IA 3G7LA 1I3QB 2HQEA 4PMCA 3A54A 1EQVA 1BOSA 1B2TA 4LAAA 1STEA 3HOYB 1HFNA 2Q8TA 3QIAA 5FO8B 4HMIA 3CHBD 4A3BB 4KJNA 2VB3X 3O13A 1PMRA 4OO1G 1A15A 4BY7B 2B63B 1QWYA 3SXHA 1GJXA 4QB4A 1L0YB 3QB3A 3OWEB 4ZQ3A 2EY1A 2NYZD 1A2UA 1EZ8A 2F0GA 2ZXPA 1L0XB 4KY7A 4Q0FA 2F0JA 3HGBA 4CKEA 2EE1A 3L7ZC 1GUTA 1H9KA 5DM73 4PMBA 2XNAC 4PMWA 1F2YA 3MXPA 3K58A 4H0LC 4BA2I 1D5XC 4KMUC 4TQUS 4RGNA 4K8IA 4H13C 3G6JB 3SDZA 2H1EA 3NTHA 3DMUA 5KRUA 1EY8A 1B1ZA 3Q22A 1VMCA 1OXSC 4C56C 4ODGA 4FO2A 1FYCA 2CW0C 4KJOA 5IOCA 1LTSD 3R2TA 5C4XB 4DK1A 2BE5C 1JR0D 2EYPA 1HTPA 3KLRA 2DNCA 5CV4A 2AQ3B 1V43A 3J7AV 1EYAA 3P20A 4ZYSA 1PFNA 5C4ZA 3MA2B 2J0TD 3LWUA 4RA8A 3T51B 4EQPA 1BO0A 1H9RA 1WTOA 1BNZA 1ESFA 4FXDA 3NBIA 3VYSA 1D1IA 3A55A 2YU9B 1SJHD 3T53B 3BDLA 1KLUD 4B9WA 1I4HA 2B2TC 2RVLA 3BYYB 3K7AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0F A;  1NSN S;  1KAA A;  4K14 A;  4K5X A;  4ZQ3 A;  4ME5 A;  3TP8 A;  1STG A;  3PMF A;  4DU9 A;  1TQO A;  2PZT A;  5IGB A;  5EKK A;  2RBM A;  4K5V A;  3R3O A;  5KIX A;  4E6I A;  1KDA A;  2EY1 A;  3NXW A;  1A2U A;  4KY5 A;  5I9O A;  1EZ8 A;  2F0G A;  4K6D A;  5I6Y A;  5I9P A;  5DEH A;  1EY4 A;  2F0L A;  1EY9 A;  4KY7 A;  5CV5 A;  2EXZ A;  1F2Z A;  3D6C A;  1ENC A;  2F0J A;  5C4H A;  2F0T A;  1TR5 A;  4J1M A;  5DAU A;  3D4D A;  1EY6 A;  2PYK A;  2F0W A;  3P75 A;  5E3F A;  3OSO A;  4R8N A;  3DHQ A;  1SYG A;  1STB A;  5J1Z A;  3SR1 A;  3U9O A;  4K2K A;  4I65 A;  1SYD A;  2EYL A;  5CV7 A;  3SK8 A;  3SK4 A;  3QOJ A;  3T13 A;  2EY6 A;  1A3T A;  1EY0 A;  2F0U A;  2F0K A;  2F0N A;  4HMJ A;  3MVV A;  4PMB A;  3S9W A;  3NQT A;  4KTA A;  1F2Y A;  3C1F A;  3MXP A;  4ZUI A;  5HUR A;  2EYM A;  1IHZ A;  5IGC A;  4IAL A;  3ITP A;  1EY7 A;  2EYH A;  4NMZ A;  3D4W A;  4NDX A;  5CGK A;  1A2T A;  4KV6 A;  3OWF A;  2NUC A;  5M9O A;  2O4X A;  1ENA A;  4NP5 A;  1A3U A;  2F0H A;  1STY A;  2LKV A;  2WAC A;  1A3V A;  2SOB A;  5CV6 A;  2KHS A;  2OF1 A;  4K8I A;  5JAV A;  1NUC A;  2EY2 A;  2F0M A;  5I6W A;  4DGZ A;  4YIJ A;  1RKN A;  1U9R A;  4EVO A;  5CR3 A;  3TP5 A;  5C3X A;  3DMU A;  5KYL A;  5KRU A;  1EY8 A;  2EYJ A;  3NUC A;  1JOR A;  3C1E A;  1SNO A;  5IGD A;  4ODG A;  4DF7 A;  2F0P A;  4TRD A;  3TP6 A;  5EKL A;  3SHL A;  1EYD A;  4K5W A;  1KAB A;  2F0I A;  3E5S A;  3H6M A;  1JOQ A;  4KJO A;  5IOC A;  5CV8 A;  5KGU A;  2F0S A;  5E1F A;  5F2D A;  3RUZ A;  2OXP A;  4IZ8 A;  5HGT A;  4G57 A;  2QDB A;  3ERO A;  5CV9 A;  1F2M A;  4F7X A;  1EY5 A;  2EYP A;  5C5L A;  1SYF A;  2F0O A;  3MHB A;  4KD3 A;  2OEO A;  3OMG A;  2EYO A;  1SNQ A;  3MEH A;  5JOB A;  5CV4 A;  2F0E A;  3NP8 A;  1II3 A;  5J22 A;  3SK6 A;  3SK5 A;  1EYA A;  1KDB A;  5IOD A;  4PNY A;  2SNM A;  1SNP A;  3D8G A;  3V2T A;  3QOL A;  4NKL A;  5C4Z A;  4RKL A;  1SYB A;  5K5P A;  4DFA A;  2RDF A;  4H7B A;  1EZ6 A;  3NHH A;  4EQN A;  4ZUJ A;  5ISR A;  1SNM A;  1SND A;  3EJI A;  3MZ5 A;  2HQE A;  4WRD A;  4B9X A;  4RKB A;  5NUC A;  4PMC A;  4EQP A;  2F0V A;  1STA A;  3VA5 A;  1JOO A;  2EY5 A;  2F0Q A;  2RKS A;  2SNS A;  1KDC A;  3P1H A;  4ID6 A;  3EVQ A;  5IIF A;  4K2L A;  4MIU A;  2PZU A;  1AEX A;  2M00 A;  4IUN A;  5IGF A;  5IGG A;  1EQV A;  2F0D A;  4N9P A;  4EQO A;  3T16 A;  5KYI A;  4WOR A;  5J39 A;  4LAA A;  4KY6 A;  4HTH A;  5KEE A;  4QMG A;  1SNC A;  3NK9 A;  5C5M A;  5IGE A;  1TT2 A;  2EYF A;  3TP7 A;  4F8M A;  2ENB A;  2PQE A;  4KD4 A;  2KQ3 A;  3ERQ A;  3HZX A;  4HMI A;  1EYC A;  5CC4 A;  2F3W A;  3BDL A;  2PZW A;  2F3V A;  4KJN A;  4J6H A;  4B9W A;  1STN A;  5EGT A;  5C6A A;  3OMC A;  4KHV A;  3SXH A;  3BDC A;  2PW7 A;  3HEJ A;  4OL7 A;  4QB4 A;  4K8J A;  3TME A;  1SYC A;  2PW5 A;  4N9T A;  4QF4 A;  1JOK A;  5C3W A;  1STH A;  3LX0 A;  4S3S A;  3QB3 A;  1SYE A; 
#chains in the Genus database with same CATH topology
 3H09 A;  1SE4 A;  5D3I B;  5BN5 A;  1K8G A;  1S3O A;  4QQB X;  1KDA A;  2FMC A;  3OIQ A;  1JWU D;  1SMY D;  4XYQ A;  5M5Y H;  3T4A C;  4L63 B;  1B4O A;  2IT1 A;  2GA4 B;  3H15 A;  3QOJ A;  2IPK D;  4DR4 Q;  3MVV A;  4PZ6 A;  3VR5 A;  3NQT A;  2C35 B;  2XRS D;  3PO2 H;  3ULP A;  4A3G H;  3CU7 A;  4JBW A;  1IYJ B;  1X3E A;  3C3L A;  2FJ2 A;  4KV6 A;  1WD0 A;  1Q3L A;  1AFP A;  1BBX C;  3CCS A;  3S16 B;  1LTA D;  1NBW A;  2ZT9 C;  5DLQ E;  1O7I A;  4A3F H;  4XIG S;  4FDB A;  1YHA A;  5C3X A;  1JOR A;  1X54 A;  3C1E A;  2B2U C;  3GO5 A;  5EBD A;  2ICE C;  1KQS A;  3J81 j;  3VR2 A;  3BDO A;  4K5W A;  1PTO D;  4CJ2 C;  1JOQ A;  4GKK Q;  3RR5 A;  3I8Z A;  5KGU A;  2OXP A;  3GQB A;  1ZYR C;  3DUZ A;  5CV9 A;  3FPP A;  4KD3 A;  1TS3 A;  4K6L A;  4A3J B;  1E1O A;  1EEI D;  2EXD A;  2C9O A;  2CKZ B;  2ZXR A;  3Q24 A;  3I70 A;  1FD7 D;  4RAU C;  5K5P A;  2DY8 A;  3TDQ A;  2B8F A;  4JW0 A;  4H7B A;  2DY7 A;  3NHH A;  1O7Z A;  5C0X J;  3WWV A;  1XX8 A;  1KTK A;  3FKI B;  2N55 A;  4DR1 Q;  4JCV E;  4LMQ D;  4DR4 L;  4MIU A;  1ENF A;  5COY A;  5TSS A;  1N34 Q;  5J39 A;  4N9P A;  4DV2 Q;  4OWW B;  4WOR A;  4DPG A;  2ZM6 Q;  2KCN A;  5KEE A;  1TWG B;  1Z7T A;  3J80 i;  5C0X I;  1TT2 A;  1U0L A;  3OYY A;  4L5R C;  4R4T A;  4U67 3;  4LFC Q;  3KDF B;  2F52 A;  4ULL A;  3PF4 A;  3HKS A;  2JA6 G;  1IBL L;  4HAE A;  5C6A A;  1LTB D;  3FPU B;  3OMC A;  2ZJR A;  3IL8 A;  1NR4 A;  4GKJ Q;  5EPJ A;  1X55 A;  1NMF A;  4R4I A;  3PMF A;  3NEM A;  3HOZ G;  3C2P A;  1TWC H;  3CCE A;  4KY5 A;  4LW1 A;  4I7Z C;  1YHQ A;  1PFS A;  1F9S A;  2GN5 A;  1PYS B;  4YWL A;  3TZU A;  1C0A A;  1T5E A;  1MHW C;  2MUY A;  3S1Q B;  3RZO B;  4KTA A;  5M3M G;  3P7J A;  1Y1V B;  5HY6 A;  4KN7 C;  2JA5 H;  2UUC L;  3EFX D;  4DR1 L;  1EY7 A;  2EYH A;  1CQF A;  4XQJ A;  2KJX A;  2A69 D;  1N34 L;  2SOB A;  3PUV A;  2ZM6 L;  2EY2 A;  5KND A;  2AMC B;  2EYJ A;  3S2H B;  3E6Z X;  1SFO B;  4MZ9 A;  5EKL A;  4K0K Q;  4OO1 I;  1MI2 A;  3CCQ A;  1XMQ Q;  3HOY G;  3E5S A;  1DOK A;  3BU2 A;  3STB C;  1EIY B;  1X3P A;  5LL6 S;  2E2H H;  2JQO A;  4F7X A;  3VR6 A;  4A3B G;  4GKJ L;  3PIO 3;  3PV0 A;  1VQ7 A;  1HPC A;  4BY7 G;  2XWB B;  2F0E A;  4OGQ C;  3DM3 A;  4Q5V A;  2QA4 A;  2B63 G;  1YNX A;  3AMU A;  3M4Y A;  5FLM G;  4ALP A;  1HNX L;  2SNM A;  4A3E B;  5EPL A;  3RMH A;  1LLR D;  5BN3 A;  2O5I C;  3GV6 A;  1LM0 A;  2A73 B;  2R92 B;  3FMC A;  4ZAI A;  1QIL A;  3EJI A;  2NTS A;  3NTI A;  2AWN A;  4IPD A;  1B3Q A;  3V05 A;  5ELN A;  3HP3 A;  2JN4 A;  4DN4 M;  1OO9 B;  2K5H A;  1V1P A;  5DNF A;  1QUQ A;  1SDF A;  1F9R A;  3KLS A;  4RCN A;  2NVX H;  3DEP A;  1G29 1;  3BVG A;  4LF8 L;  4JV5 L;  2HHH Q;  1YIJ A;  1TS4 A;  1JQY D;  2KBN A;  1LTG D;  3GTP H;  1WTR A;  1LTR D;  1GUS A;  3W3A A;  1SR3 A;  1HRJ A;  1GUG A;  2PW7 A;  3HEJ A;  4OL7 A;  4K0K L;  1ASZ A;  4N9T A;  3H0G B;  1BF4 A;  4S3S A;  3PUZ A;  4K5X A;  2GVA A;  3CC2 A;  1QG7 A;  1V8Q A;  2ICI A;  2LXJ A;  3NXW A;  2B39 A;  3GTQ H;  1B50 A;  3NE5 B;  1FGU A;  4LF6 L;  1EY4 A;  1F2Z A;  2L9H A;  3I7F A;  3RZD H;  5C4X G;  1XTC D;  2XTI A;  4R8I A;  2R7Z B;  1Q82 C;  1CK1 A;  3S14 H;  1PFB A;  4M8A A;  1IL2 A;  2F0U A;  2F0K A;  3HOV B;  1GHJ A;  3CD6 A;  3I4N B;  2D5D A;  4QIW E;  5HUR A;  5M5X H;  2QW7 A;  4KHZ A;  3BVM A;  3GTO H;  3BYT B;  2O4X A;  1MJE A;  1ENA A;  1G91 A;  5C3E G;  1EFI D;  4AQY Q;  1HUN A;  3E0J A;  2I07 B;  4DGZ A;  1EU4 A;  1FGB D;  2RDH A;  3M9B A;  2HHH L;  3GTL B;  5IGD A;  1PRT B;  2F0P A;  4DV7 Q;  5HGQ A;  4JOI C;  2BCO A;  2UXB L;  3BJU A;  1SSO A;  2VY3 A;  1V1O A;  3ULL A;  1X56 A;  3QWN A;  3MWY W;  5K36 G;  3K5N A;  3MEH A;  2UXC Q;  2E8G A;  1PHJ A;  2EJF C;  1B70 B;  1FR3 A;  2OQK A;  3M7G A;  4BBR B;  2EPB A;  1BXT A;  4OEM B;  1KDB A;  1P16 A;  4PNY A;  2QEX A;  2K5W A;  5G3L D;  3RLO A;  3JAM E;  1SAP A;  1MJC A;  1TII D;  3VR3 A;  3MXU A;  2B2V A;  1MD2 D;  2IX0 A;  2F4V Q;  1TWF B;  2JP1 A;  1SE8 A;  3MTS A;  4JI8 L;  1M1K C;  2OTJ A;  1WTX A;  2KCC A;  2SDF A;  4F87 A;  1RF2 D;  2VW9 A;  2CHB D;  3M4O H;  1UEB A;  4CHT B;  1PH1 A;  1V1P B;  1QUQ B;  5A2Q E;  2Z4H A;  4P73 A;  1YJW A;  3FVQ A;  1PH9 A;  1F9P A;  4QIW B;  1F77 A;  4QMG A;  2M2L A;  2V1C C;  4AQY L;  4A3I H;  2KQ3 A;  2A6H D;  1GUN A;  2JA6 H;  2A8V A;  2TMP A;  4DR5 Q;  1NR2 A;  2MP1 A;  4J6H A;  4KKT A;  1UE7 A;  1FJG L;  5FLX E;  5C4J H;  1HCZ A;  3S1N H;  5FK9 C;  1BR9 A;  1IBM Q;  3QR8 A;  4CBV A;  4DXF A;  2PMZ E;  4IN3 A;  1YNN C;  1EOV A;  2L5T A;  1NY4 A;  3KLS X;  3BG3 A;  2UXC L;  1D8L A;  3K81 C;  1XNQ Q;  2ZJQ A;  2C5C A;  1A63 A;  5M5W H;  1CSP A;  4J1M A;  4IFD G;  4LUV A;  1T5X D;  3HOX B;  4GLV B;  4OON A;  3DHQ A;  4DA2 A;  2ID0 A;  4A3J G;  2FHT A;  3KJP A;  5M3M H;  4QY7 A;  3GV3 A;  3I4M B;  3ZYY X;  1CTM A;  3E9H A;  1K8O A;  4JI1 Q;  1I3Q H;  2UUA Q;  2N8N A;  2UUB L;  2B3G A;  3H3V C;  1A6X A;  3A5U A;  2XSC A;  2Y0S E;  4R1J A;  2VUM H;  3DEO A;  2JA7 H;  1EL0 A;  2WKD A;  2QEJ C;  5FO7 B;  3UDF A;  1YVC A;  2HIV A;  2RDG A;  3CCR A;  4A4I A;  3HOY H;  4DR5 L;  4XXE A;  3ICE A;  3NPP A;  4LF7 L;  2X6L A;  4C3H G;  4JVZ A;  3WDN A;  2UU9 L;  2K5N A;  1MIU A;  2VL6 A;  3UDX A;  4OWT B;  2OEO A;  1IBM L;  4DV0 L;  1TWA H;  2JA8 G;  2QF7 A;  4I7A A;  3SK6 A;  3SK5 A;  2E75 C;  3J80 E;  2AUK A;  3J7A F;  2NVY B;  1B44 D;  3FHW A;  2RDF A;  4HSP A;  3A8K E;  3HOZ B;  4LF4 L;  1I4G A;  2RHQ B;  5IYB H;  4X3K A;  1AP0 A;  1Q1E A;  2F0Q A;  2JXM B;  1B53 A;  2PZU A;  4OX9 Q;  5JEA G;  1N32 L;  2DGY A;  3A8I E;  4DR2 Q;  3UI2 A;  4X3S A;  3K5M A;  4JI1 L;  2UUA L;  1R9T B;  3V96 A;  1CHQ D;  4RHR A;  4UAI A;  3KLW A;  3LWE A;  1CA5 A;  5M3F G;  1EWC A;  1GOZ A;  2PQE A;  4RH6 A;  3T1Y Q;  5ELC A;  2F3V A;  2PNR C;  2Z1C A;  3VYT A;  3I4L A;  4JI4 Q;  1IW7 C;  1H9J A;  5FJ8 H;  3BDC A;  1C4Q A;  4DNR B;  2KHI A;  1L1O A;  5JVG 3;  2D0O A;  1H95 A;  1N8R C;  3HOW B;  1HFG A;  2K50 A;  3D6W A;  3VYU A;  4H02 A;  1WI5 A;  4FXG C;  1LV9 A;  4DK0 A;  2NVQ B;  2XN9 C;  2CW0 D;  4KI0 A;  1ASY A;  4X62 L;  4GN3 B;  3P75 A;  3WOE A;  4NXM Q;  1NCV A;  4A3C G;  3DM1 A;  2Q2H A;  5L37 A;  5LMN W;  4X66 L;  1SRO A;  2HCI A;  3NBH A;  3G4S A;  3X3N A;  4A3E G;  1TY2 A;  4LWC A;  3I73 A;  2O5J C;  2MO1 A;  1AZP A;  1I6H H;  3HRZ C;  1WTQ A;  4NDX A;  1ILP A;  3KOJ A;  1A2T A;  1EQT A;  4OX9 L;  1WD1 A;  1A3U A;  3U9S A;  2R61 A;  3HG9 A;  4BA1 I;  1VF5 C;  5IE8 A;  2JEA I;  2R93 B;  1J9O A;  1TU2 B;  3CW2 C;  3S1M B;  5KYL A;  1XJV A;  1E2V A;  1I6V C;  4Z9C B;  4OEL B;  3A7A B;  3CME A;  4UP8 A;  4JI4 L;  5ELD A;  1Y14 B;  1OXU A;  4ZLT F;  3T1H L;  2LY7 A;  2B2T A;  1KXL A;  5C5L A;  2F0O A;  4JI6 L;  2CWA A;  2JE6 I;  2RCF A;  1V1Q A;  4DUZ Q;  5ELO A;  1JE4 A;  1EQR A;  3GTK H;  3KF6 A;  2PCF B;  1BCP F;  2YYZ A;  3K7A H;  2EIF A;  4MNO A;  4NKL A;  1EIG A;  3TSS A;  3C46 A;  1CUK A;  1ET9 A;  4Y7N B;  3TS0 A;  3D4R A;  1MSH A;  5AFW A;  2L55 A;  5IWA L;  1PXU A;  5IY0 A;  1UAP A;  3CC7 A;  3RN2 A;  1Q86 C;  2Z6K C;  3P1H A;  2SNS A;  4ID6 A;  1Y8N B;  1JJG A;  2FMM A;  3H94 A;  2OTL A;  5IGG A;  2MNA A;  3RN5 A;  2LMC B;  4FXK C;  2IY5 B;  2K5Q A;  1ML0 D;  1OXX K;  4PZ8 A;  3HOV G;  3EA6 A;  3UE1 A;  1SNC A;  2WB1 E;  1C7Y A;  1JB3 A;  3I4N G;  2G5D A;  3ERQ A;  4G7H C;  3GTJ H;  1XPR A;  3SVM A;  2BDO A;  5D14 A;  1DD2 A;  4L5S A;  3GTM H;  3S16 H;  1K0S A;  4JI7 Q;  4C3I G;  3DWQ A;  4JBJ A;  3TRZ A;  2E2D C;  5C3E B;  3AFP A;  1VS0 A;  2B2U A;  1L1O B;  1D6E C;  3A8J E;  3J81 L;  1SYC A;  3M85 A;  1EIH A;  1KC8 C;  4ME3 A;  4A75 A;  2H5X A;  4UDU C;  2F0F A;  1PZI D;  4C2M B;  4WFN 3;  2JEB I;  3TQY A;  1SJE D;  1PYB A;  2NWG A;  4E6I A;  1DOL A;  4V0B A;  1VQN A;  3MXN A;  5I9P A;  5I6Y A;  5ELE A;  4IJL A;  4IFD H;  1B7Y B;  2HCC A;  2BA0 A;  1VQC A;  3U50 C;  1HXY D;  1XXG A;  4A3J H;  1ZYR D;  1B3A A;  4C3J B;  1IXR A;  3NBH B;  4NXN L;  3OTO Q;  4BBR G;  4LF5 Q;  3C1F A;  4CJ0 B;  4ZK9 B;  3A56 A;  1PFM A;  3G6E A;  2YTY A;  4IUV A;  1NNX A;  1MBY A;  3OWF A;  4NP5 A;  4BBS H;  2WIN B;  1STY A;  3FKI H;  3LNN A;  2RF4 A;  2EZV A;  1O7L A;  3H91 A;  5JJL A;  4XT1 B;  5D65 A;  1HZB A;  2K6A A;  2MGS A;  1TWG H;  3I2Z A;  2I5H A;  1FVI A;  4WJW A;  5LHY 1;  2X6G A;  4DV3 L;  2FXQ A;  1K83 B;  5E1F A;  4UHV A;  2A6E C;  2A5H A;  2QDB A;  4IFD J;  4MN3 A;  1Y1W B;  4GN5 A;  4DAM A;  2EYO A;  3W5O A;  5C0X H;  3EN2 A;  3ERS X;  3DWA A;  1FNU A;  3KF6 B;  5IP9 G;  1K8M A;  4O1N A;  4C1N K;  1TS5 A;  4JBM A;  3S2D B;  5EAY A;  1LAC A;  4IFD I;  1WTP A;  1SYB A;  5CYU A;  2K7V A;  5BR8 L;  1DXM A;  1N33 Q;  2L4N A;  4LFB L;  1SND A;  3MZ5 A;  1LT3 D;  4BWG B;  3KUP A;  1ROD A;  1WCM G;  5IYD H;  1I5F A;  3VA5 A;  1C9O A;  2NN6 G;  1KDC A;  2LXK A;  1A62 A;  2MHV A;  4LF5 L;  4GNX C;  3HOX G;  1KAW A;  2KOL A;  2F0D A;  1YJ9 A;  4DR6 L;  3S1Q H;  4OWX B;  3CQZ B;  2NVT B;  5JPM C;  4BXX G;  1Y1V H;  3OW2 A;  4A3M G;  4A3K B;  3I4M G;  3M4Q A;  1G6P A;  1AE2 A;  4MTK A;  2PI2 A;  1E2Z A;  1PTO H;  4JI5 Q;  1O80 A;  4EGV A;  3ONA B;  1XPU A;  2WKC A;  4A3D G;  3S2H H;  2V4D A;  2N3S A;  3AFQ A;  4CKB A;  2HIX A;  1SFO H;  2QCP X;  1GM5 A;  1D1K A;  1D2B A;  5EKK A;  4A93 G;  1CM9 A;  3MXN B;  2RSN A;  1X3G A;  1EUJ A;  1YNJ C;  1JE5 A;  5GAG C;  3F2C A;  1XPO A;  1UNS A;  3STB D;  4RWS C;  5DAU A;  4C3H B;  2F0W A;  5JEA J;  4JI2 Q;  4WJ3 M;  1N36 Q;  3SR1 A;  3MXG A;  2G9H D;  4OO1 H;  3Q0A A;  1SMY C;  4AIM A;  3IRB A;  1N33 L;  1GKH A;  2DN8 A;  2JA8 B;  3DWP A;  1W6J A;  3OW7 A;  5IT9 E;  1E3P A;  3TZD A;  4GKK L;  4NMZ A;  3D4W A;  2R92 H;  1DON A;  1S5C D;  4ILW A;  2A68 C;  2PI2 E;  1CI3 M;  2OF1 A;  5JJI A;  4HR7 B;  3PO2 B;  1S40 A;  2KHJ A;  3K59 A;  2OCE A;  3ER0 A;  4A3G B;  1M8A A;  1GXD C;  3URY A;  3A7L A;  4JC0 A;  1EYD A;  1HQM C;  2N78 A;  4HN7 A;  4JI5 L;  3F1Z A;  4GS3 A;  4KKS A;  5M3F B;  4IZ8 A;  1JJ2 A;  4A3F B;  2Y0S G;  4KK7 A;  3J7Z C;  2F4I A;  1PTO C;  1QNK A;  3S1R H;  1SNQ A;  2CH4 W;  2R6G A;  4IJH A;  2SEB D;  1GHK A;  4XQN A;  4BY1 G;  3H0G H;  4DV2 L;  5ELF A;  5IOD A;  4OIJ A;  2ALY B;  5IT9 c;  1PH3 A;  1VQI A;  3TRE A;  3CCV A;  1QZH A;  3TN2 A;  3HOW G;  1VQE A;  4IOC A;  3TEH B;  2GVB A;  2LSS A;  2EOT A;  4LFC L;  4JI2 L;  2WAQ E;  1N36 L;  4IO9 A;  5NUC A;  1IKL A;  2EY5 A;  1G8Z D;  4X64 Q;  3EVQ A;  2VQF Q;  1GD7 A;  1TKW B;  1EQQ A;  4IUN A;  2R7Z H;  5EKI A;  3JC6 6;  1PRT D;  1HA5 A;  5FKA C;  1K73 C;  1W6K A;  2EJM A;  2ZJP A;  1Q1B A;  2F3W A;  1CA6 A;  4IQZ A;  4EX5 A;  1S5E D;  1QOH A;  1BBU A;  1B9N A;  2ZTC A;  2R93 G;  2PW5 A;  1QVF A;  4JOI A;  1STH A;  4B3T Q;  4FNF A;  4QGU A;  3NSW A;  1KHI A;  1EU3 A;  1B8A A;  5KIX A;  4XDX A;  4FF1 A;  1IKM A;  3BZK A;  4G7Z C;  2ZTE A;  5CV5 A;  1MKH A;  3Q6S A;  1Q46 A;  4YWM A;  2BH8 A;  4FF3 A;  1U4R A;  4KHP Q;  4RG1 A;  3OSO A;  2D62 A;  2CVR A;  4KKU A;  4DK3 C;  2EY6 A;  4ZUI A;  3MAQ A;  2EYM A;  1WTW A;  1XMQ L;  3ITP A;  1IZ6 A;  4X64 L;  2IL8 A;  3J7Y W;  2VQF L;  5CGK A;  1OXV A;  1CZG A;  3D3R A;  3PQI A;  4ZKC B;  2EDG A;  4APV A;  2F0M A;  2KVM A;  3E9I A;  2B2Y C;  1NAP A;  2A69 C;  3SE0 A;  1LT4 D;  4CDC C;  4DK6 C;  2F0I A;  1X9N A;  5JVH 3;  2DNE A;  4G57 A;  1DCZ A;  3I72 A;  3G71 A;  4B3T L;  4PZ7 A;  4YWK A;  4C3I B;  3OOC A;  3AEV A;  3QG1 A;  3R93 A;  1K8A C;  1XTD A;  3A5Z B;  1C48 A;  4JI0 Q;  2E2H B;  4PG3 A;  1DJR D;  2TSS A;  3KBX A;  2J4X A;  3IAY A;  1Z47 A;  4YHH Q;  3KFU A;  4EQN A;  3K7U C;  1YNN D;  4O42 A;  1PH8 A;  1TWH B;  3RLF A;  5C44 G;  1KLG D;  1SBB B;  1VQ4 A;  4A3L G;  4P71 A;  1G2T A;  2OWO A;  4GN4 B;  3M7N A;  3U4V A;  5KYI A;  1D5M C;  4C3J G;  2QIL A;  4F88 A;  3UDI A;  2UXD Q;  1E22 A;  1PTO F;  1UE1 A;  4GOP C;  1I50 H;  3VR4 A;  3Q23 A;  2RHS B;  1UEA B;  1I4R A;  2ZTD A;  4LK1 C;  2XIW A;  1Q90 A;  3K57 A;  3PUY A;  3LX0 A;  4XT3 B;  2VB2 X;  2IJ0 A;  1XMO Q;  1ILQ A;  4K14 A;  1L2F A;  2WB1 G;  4O0A A;  2RBM A;  2JK8 A;  3IFT A;  3R3O A;  4K5V A;  3GTP B;  4CDE C;  5DEH A;  1H9S A;  1VQ6 A;  5LMU Q;  1PVO A;  1TR5 A;  3PO3 G;  1Y1W G;  1SYG A;  3E0E A;  1WVL A;  1G6Z A;  1SYD A;  5KNC A;  2KEC A;  1A0I A;  1S72 A;  4HMJ A;  3NWS A;  4IUU A;  2YTV A;  4DV7 L;  4LFA Q;  1NMG A;  3UE0 A;  2NN6 I;  1BQQ T;  2NVY H;  3RZD B;  4FF4 A;  4ZCK A;  1E7Z A;  1U4L A;  1E1T A;  3HOZ H;  2AHO B;  1Y69 U;  4N8X 1;  1ZKO A;  3NQI A;  1XYI A;  1VDZ A;  1WCM B;  3J81 c;  3B6Y A;  5COR A;  2UXD L;  5CBA E;  5EJW A;  5E4W C;  4LF9 Q;  2FIN B;  1R9T H;  3BZD B;  5I2Y A;  3SHL A;  3NEN A;  2L15 A;  4DAY A;  2D2C C;  4A3K G;  3HOU G;  2CH4 A;  3CPW A;  1PZJ D;  2WFW A;  4A3M B;  2F4V L;  3CCL A;  1PZK D;  3CKI B;  3CRK C;  5HGT A;  3S17 B;  4ZKB B;  1D7Q A;  4DR3 Q;  3N52 A;  3EIV A;  5JOB A;  1XMO L;  1BCP C;  4QJF A;  1I94 Q;  3GTG B;  3K5L A;  4HJ5 A;  4ABN A;  1IW7 D;  2E5L Q;  3M3Y B;  1EFW A;  3SGI A;  5IP7 G;  4A3D B;  3D31 A;  4RKL A;  4DFA A;  3A74 A;  1G2S A;  1I4P A;  4IPG A;  4WRD A;  1U5K A;  1SXT A;  4A93 B;  2NVQ H;  3ND8 A;  2RKS A;  4NB3 A;  4DV5 Q;  2BA1 A;  2M00 A;  4LFA L;  2JA9 A;  2F1M A;  4A3B H;  2I0Q A;  4BY7 H;  1Q7Y C;  3G48 A;  4PQX A;  2B63 H;  1BVS A;  4P2C B;  2HUG A;  4P75 A;  3NK9 A;  5FLM H;  1K3B C;  1VF7 A;  4R9W A;  1R4P B;  1I4X A;  5LL6 X;  1Y8O B;  1JC7 A;  2NZ1 D;  2PMZ B;  2YV5 A;  1E0B A;  1XNQ L;  1K3R A;  1PRT F;  4GZY C;  4LF9 L;  3VDY A;  1XWE A;  4HCS A;  4N8F A;  2B2W C;  4B3M Q;  1KNE A;  3NEL A;  3PO2 G;  3LGJ A;  3S1M H;  4A3G G;  1VQB A;  4IPC A;  4LUO A;  2PZT A;  4RGO S;  5FO9 B;  1X3Q A;  3FDT A;  4H44 C;  3K80 C;  1H9S B;  1I94 L;  4UY8 C;  1BKB A;  3EBE A;  5C4H A;  1NTG A;  3D4D A;  4A3F G;  2Y0S B;  1PV4 A;  1STB A;  3U9O A;  4HJ9 A;  3I4O A;  1EOT A;  4BY1 B;  4UP7 A;  2Q8I B;  2DUD A;  4IAL A;  2K1B A;  4X3T A;  2Z6K A;  4DKA C;  4CGY B;  3KF8 A;  4DV5 L;  1AH9 A;  1M90 C;  2WAC A;  4M1U B;  4TKO B;  2HQL A;  2K5D A;  4RMF A;  4CKC A;  1LAB A;  3MFY A;  1AW7 A;  5D3D A;  5C4X H;  2E2J B;  4QCL A;  2BE5 D;  4TRD A;  1CZW A;  4DAY B;  4QUC A;  2IX1 A;  2Q8R E;  4CJ1 B;  4DV1 Q;  3PUX A;  2VUM B;  3H6M A;  1VQJ A;  4L6T B;  1LYL A;  2JA7 B;  4DR7 Q;  3RUZ A;  2KED A;  4B3M L;  3RLN A;  1F2M A;  2R3Z A;  1WYD A;  2AQ2 B;  5CC4 A;  1SYF A;  4R4O A;  1E2W A;  5C3E H;  1VQ9 A;  4YCW A;  1PYW D;  4JYA Q;  4DR2 L;  4CDF C;  1KRS A;  1O78 A;  3QOL A;  3NWT A;  2AKW B;  4C2M H;  2HT1 A;  2JSO A;  3CAM A;  5T1G A;  5H1S E;  1EZ6 A;  1BDO A;  4ZUJ A;  1TWA B;  3T1Y L;  1TVX A;  2IWH A;  2F0V A;  2RSO A;  1HNZ Q;  4HJ7 A;  1HHV A;  4G4K A;  2E2I B;  1CQV A;  2YU9 H;  4HJA A;  5K36 H;  4XQQ A;  3NTK A;  4EQO A;  4KN4 C;  4HJ8 A;  4HTH A;  1JIC A;  4LUZ A;  1CKN A;  4B08 A;  1S5B D;  4KLK A;  4L5T A;  4TVA B;  1CFM A;  1Q8I A;  3F2U A;  4F8M A;  3QO2 A;  3HKZ E;  5GQO A;  2WAQ G;  2PZW A;  4NXM L;  2VXW A;  3S15 B;  4JG2 A;  1L0W A;  4DR6 Q;  1QZG A;  1WTH A;  2JA5 G;  1S5D D;  2A19 A;  2B29 A;  2EJG C;  1WTV A;  1CHP D;  5G3L F;  4RFB A;  4DU9 A;  4HED A;  2O2L D;  1LTT D;  4K6D A;  4L5Q A;  3F2D A;  4DV4 Q;  2EXZ A;  1PDQ A;  3D6C A;  4JYA L;  3FEW X;  4V19 0;  1ZXT A;  1WFQ A;  4X3U A;  2A6E D;  3AB9 A;  4MHE A;  1D5Z C;  3GP7 A;  1HNW Q;  3ZJY C;  5JJK A;  3S9W A;  2HD3 A;  3S2D H;  2RCN A;  1VQA A;  1HNZ L;  3KF8 B;  2EQS A;  1HZA A;  1PH5 A;  1GUW A;  1JMC A;  3KBG A;  4DNI A;  1DGS A;  2XVS A;  4GNX A;  2K52 A;  1EIF A;  2NBF A;  4NW2 A;  1U9R A;  1SLJ A;  1TXY A;  1SRU A;  3JAM L;  4DUZ L;  5C44 B;  3MFG A;  1VQD A;  3NUC A;  1I6H B;  4DF7 A;  4UPA A;  3J81 i;  1M4V A;  3HKZ B;  2E76 C;  1X32 A;  4GLA C;  5A2Q L;  2K32 A;  1Z9F A;  2RA4 A;  1EY5 A;  1OXT A;  1MGS A;  4CDD C;  2K01 A;  3CRL C;  1H9M A;  4XYO A;  1N9W A;  2KEN A;  1J8I A;  1SNP A;  1QJO A;  1HR0 W;  3AYH B;  3PUW A;  4LNQ A;  1F2L A;  4J8Q A;  2WB1 B;  5E7N A;  4ZRZ A;  2I46 A;  5JAV A;  4R4C A;  5FLX L;  1HNW L;  1STA A;  3BS1 A;  3GTK B;  5IIF A;  4JI7 L;  4C3H H;  2DJF C;  1VQ5 A;  1YNJ D;  4K2L A;  4XTC S;  1AEX A;  3PO3 B;  4DXG A;  1KRT A;  5IYC G;  1CKN B;  2JA8 H;  1IYU A;  4B3S Q;  1ET6 A;  3K8A A;  1SEB D;  2ENB A;  4KD4 A;  1SMX A;  1TS2 A;  4POF A;  5EGT A;  4GLX A;  4JBK A;  2Q2I A;  3M4P A;  3TME A;  2A68 D;  1Q12 A;  3HS0 C;  1JOK A;  5C3W A;  3BVZ A;  3OTO L;  5JEA H;  3GTJ B;  1G51 A;  1OTC A;  5DM6 3;  4OIK A;  3GTM B;  4U68 A;  3RZO H;  3TS2 A;  5I9O A;  1I4Q A;  2L12 A;  5M3F H;  3HOU B;  2F0T A;  3U58 A;  5CMD A;  1FNV A;  1IBL Q;  1EY6 A;  3K0X A;  5E3F A;  5J1Z A;  1VMP A;  2AWO A;  2Z9H A;  1PH7 A;  1VQK A;  2MPM A;  3T13 A;  1QE6 A;  5GAE C;  3L2P A;  3CCU A;  2H4O A;  1QVC A;  1QB5 D;  3IFD A;  4FVM A;  2K33 A;  3J7A 5;  4GNX B;  2LKV A;  2J7Z A;  3CMA A;  1GO3 E;  2KUM A;  3SEB A;  2D0P A;  3J80 L;  4FYD A;  2VNU D;  4AYB E;  1RKN A;  1CKO A;  4B3S L;  1PLF A;  5CR3 A;  4EQ5 A;  2JJQ A;  1ONL A;  3TP5 A;  1VCI A;  2F3I A;  4A3C H;  1SNO A;  1MSG A;  2N49 A;  5I4D A;  2BH2 A;  3TP6 A;  3N6R A;  4BBS B;  2ATW A;  2UUC Q;  1DM0 B;  1O7Y A;  5KNB A;  4A3E H;  2WV6 D;  4QL5 A;  4IOA A;  5M5Y B;  1JCK B;  4G7O C;  3MHB A;  1F9Q A;  2RQX A;  3T56 B;  3R2I A;  2QKI C;  3PGZ A;  4A3I G;  3FP9 A;  2I5L X;  2K28 A;  2KEE A;  1RTN A;  1UE6 A;  1YEZ A;  2E74 C;  5ISR A;  1LTI D;  1SNM A;  3MC0 B;  4B9X A;  2CQO A;  4HIO A;  3CXC A;  1JOO A;  2PPB C;  3CC4 A;  3FRP B;  5JJZ A;  1HZ9 A;  4DNT B;  5IGF A;  1HNX Q;  1SE3 A;  5IGE A;  2I5M X;  4UP9 A;  3I90 A;  5E4X A;  4DV6 Q;  3TP7 A;  4NPS A;  2WP8 J;  3HZX A;  1EYC A;  2AUJ D;  1PH4 A;  3A0J A;  2B2Y A;  1BBW A;  4AYB B;  3ND9 A;  3PSI A;  1HA6 A;  4QF4 A;  1QNU A;  1KAA A;  4LF8 Q;  1Q8K A;  4JV5 Q;  2VS1 A;  1S4Z A;  5BN4 A;  2L0C A;  2OT2 A;  3HOV H;  1PTO B;  2VUM G;  1X3F A;  2JA7 G;  3I4N H;  5I2X A;  2HDL A;  1EWI A;  1WOC A;  1PH6 A;  1E24 A;  1NE3 A;  1ICW A;  3I3C A;  1KNA A;  1GUO A;  4I65 A;  3SK8 A;  2EYL A;  4C3I H;  3KK7 A;  3SK4 A;  3WOF A;  1EY0 A;  2IW3 A;  2WII B;  1IL8 A;  4IUQ A;  3GD7 A;  4FF2 A;  3GTL H;  5EQ0 A;  1KIX A;  3TBI B;  1AN8 A;  3K0Y A;  4LF6 Q;  5M9O A;  2NUC A;  5ELB A;  2F0H A;  4IUR A;  1CSQ A;  3KYH C;  1TWH H;  5CV6 A;  1XNR Q;  3OIP A;  4P72 A;  1DZ1 A;  1NUC A;  4HIK A;  3PIP A;  4EVO A;  3CCJ A;  4DV6 L;  3IKJ A;  4GOP A;  2Z6B A;  4DAP A;  1TWC B;  4BBR H;  5IYB G;  4TSS A;  1VQ8 A;  2NTT A;  1LT6 D;  1HUM A;  3R8B A;  1Y8P B;  2LFN A;  3QJY A;  2WAQ B;  3PF5 A;  1TWF H;  1RL2 A;  2A74 C;  2EVB A;  1GVP A;  5J22 A;  2A1A A;  1AE3 A;  1AZQ A;  2K04 A;  5AJ3 Q;  2JA5 B;  1RJT A;  2Q2T A;  2UXB Q;  3S1R B;  1VQO A;  3GDE A;  3CCM A;  5EPK A;  1K0R A;  5FJ8 G;  2ASB A;  2ES2 A;  4YCV A;  5IYC H;  3I91 A;  2K5V A;  2MQH A;  3T16 A;  4Y52 H;  5IP9 H;  1ESR A;  5C5M A;  3I56 A;  4LJZ C;  2EYF A;  2P5Z X;  1XNR L;  2KA7 A;  3W1B A;  3OHX C;  1PRT C;  3PCO B;  4JI8 Q;  3U4Z A;  4KHP L;  4KHV A;  1WCM H;  4O2D A;  4HIM A;  2HDM A;  1VQL A;  2N88 A;  2NN6 H;  5J3B A;  3RD4 A;  1UWV A;  1C8C A;  4IPH A;  3HOX H;  1JWS D;  2VQE Q;  1TQO A;  2MJ8 A;  5EBC A;  5FOB B;  2PQA A;  4BXX H;  1UE5 A;  4A3M H;  3HKZ G;  5T1I A;  3I4M H;  4FP5 D;  1YZ6 A;  3S17 H;  1ENC A;  2CWP A;  2PO4 A;  2MFI A;  4RGT A;  4B3R Q;  4R8N A;  3K5O A;  5AJ3 L;  1SE2 A;  4PV1 C;  1RDP D;  3GTG H;  1FJG Q;  2NVX B;  1A3T A;  2Z8L A;  3CP0 A;  5GAH C;  1BCP D;  3M3Y H;  1VQF A;  3X3M A;  1UUP A;  1IHZ A;  5IGC A;  4JI3 Q;  3J81 E;  4A3D H;  2IX3 A;  2G9D A;  4A93 H;  1CT1 D;  1A3V A;  3UDG A;  3EQL C;  4GOP B;  3W2D A;  2NB0 A;  3W1G A;  4JI0 L;  1DYQ A;  2F03 A;  3H3V H;  2IHE A;  2AQ1 B;  5CBE E;  1KAB A;  4YHH L;  3GTQ B;  1QCB D;  1VQP A;  1U4M A;  2UUB Q;  1R4Q B;  2F0S A;  2DJG C;  2B2W A;  3DXJ C;  4OHJ A;  4X6A H;  1YI2 A;  3OMG A;  2VQE L;  1S5F D;  3NP8 A;  1Z6H A;  3S14 B;  4RHS A;  3V2T A;  3L9A X;  2BOS A;  2XWJ B;  5M5X B;  3I55 A;  1YJN A;  4LF7 Q;  4B3R L;  3GTO B;  2UU9 Q;  2FFK B;  3K6O A;  1JWM D;  1LUZ A;  2BDN A;  4RKB A;  5LMN Q;  1U4P A;  1BUV T;  2KCM A;  1RD9 D;  3JAM c;  4DV0 Q;  1V9P A;  1EWH A;  3F2B A;  1TY0 A;  2R7F A;  4JI3 L;  3S24 A;  1DOM A;  1HH2 P;  2PNH A;  4POG A;  1VQG A;  4KY6 A;  2IHF A;  1HTL D;  3L3O C;  4BY1 H;  3F8T A;  1LT5 D;  3HFZ B;  4J15 A;  4X65 Q;  1W2B A;  3HOW H;  1RHP A;  4RGM A;  5LMU L;  4LF4 Q;  2LS0 1;  1STN A;  1HQR D;  3H3V I;  5IT9 L;  3OPO A;  1N32 Q;  4K8J A;  2E2J H;  4IUT A;  2CQA A;  1I50 B;  1SYE A;  1HJP A;  1NSN S;  3TP8 A;  4ME5 A;  1PH2 A;  1STG A;  2L11 A;  5IGB A;  1B9M A;  4BBS G;  2PQA B;  3E3X A;  1VQH A;  3FKI G;  3VYR A;  3MEF A;  5FLX c;  1KL9 A;  1LO5 D;  2F0L A;  1BCP B;  1EY9 A;  2B2V C;  1JT8 A;  2XRQ D;  2CCZ A;  2PYK A;  3M4O B;  1PA6 A;  3AU7 A;  4IUP A;  4K2K A;  5CV7 A;  4HCE A;  2F0N A;  4YCU A;  3PIP 3;  2R93 H;  1X6O A;  3VA7 A;  2A6H C;  4DUY Q;  3KJO A;  5LMN L;  4A3I B;  1EEF D;  1IYV A;  1RCV D;  1RTO A;  4DAV A;  2JYO A;  2JA6 B;  2K05 A;  4C1N I;  5C0X G;  4X62 Q;  4DR3 L;  2KHS A;  2CFM A;  3ULJ A;  4BS9 A;  5I6W A;  2ZXO A;  3CF5 A;  4YIJ A;  2E2I H;  5JPN C;  2L1B A;  5C4J B;  1VQM A;  3S1N B;  2K03 A;  4L8J A;  4X66 Q;  4RCO A;  2E5L L;  4X65 L;  1NJI C;  2B8G A;  4HSV A;  5A35 A;  2X69 A;  1HZC A;  5IYD G;  4HID A;  1W3S A;  5CV8 A;  5F2D A;  4JK1 C;  1ZEQ X;  4MTN A;  4WJ4 A;  5M5W B;  4Y7N H;  2QGQ A;  3ERO A;  2QDL A;  2K14 A;  4AYB G;  3S15 H;  2YTX A;  1II3 A;  1Y1V G;  4QUF A;  5M3M B;  3D8G A;  1J5E Q;  1JB7 A;  2M9V A;  1FNW A;  1A8V A;  2D9U A;  2Z4I A;  3G7L A;  4JPB W;  1I3Q B;  3L0O A;  2HQE A;  1WJJ A;  3T1H Q;  4PMC A;  3A54 A;  3J80 c;  4OXP A;  2K4K A;  4JI6 Q;  4DUY L;  1IBK Q;  1EQV A;  1BOS A;  3Q8D A;  1EYG A;  1B2T A;  1P8L A;  4LAA A;  1SN8 A;  2KCT A;  1STE A;  3HOY B;  1HFN A;  2Q8T A;  3QIA A;  1K28 A;  2MO0 A;  5FO8 B;  4R4Q A;  5IWA Q;  1HR0 Q;  4HMI A;  2Z0S A;  1RIP A;  3CHB D;  4A3B B;  1FL0 A;  4KJN A;  2VB3 X;  3O13 A;  1PMR A;  4OO1 G;  1A15 A;  4BY7 B;  2B63 B;  1QWY A;  3SXH A;  5GRO A;  1GJX A;  4QB4 A;  5C44 H;  1KD1 C;  1L0Y B;  2OQ0 A;  4A3L H;  3QB3 A;  5GAD C;  1Q81 C;  1YHB A;  3OWE B;  4ZQ3 A;  3D0F A;  2R92 G;  4C3J H;  2EY1 A;  2NYZ D;  1A2U A;  1EZ8 A;  2F0G A;  2ZXP A;  1L0X B;  4KY7 A;  4Q0F A;  3DLL A;  2F0J A;  3HGB A;  4CKE A;  2EE1 A;  3L7Z C;  1GUT A;  1T9H A;  1H9K A;  2VZA A;  1J5E L;  5DM7 3;  2Q2U A;  1YBY A;  4PMB A;  2XNA C;  4PMW A;  1F2Y A;  3MXP A;  3K58 A;  4H0L C;  4DV1 L;  4BA2 I;  1CKM A;  3AQQ A;  4DR7 L;  1D5X C;  1ICF B;  4KMU C;  4TQU S;  1IBK L;  4RGN A;  3RNU A;  4K8I A;  4YY3 Q;  4H13 C;  3G6J B;  1K83 H;  3H0G G;  3SDZ A;  2H1E A;  3PO3 H;  3NTH A;  1Y1W H;  3DMU A;  5KRU A;  1EY8 A;  1B1Z A;  3Q22 A;  4NXN Q;  1VMC A;  1HR0 L;  1OXS C;  4C56 C;  4ODG A;  1L1O C;  1LTL A;  4FO2 A;  2R7D A;  1FYC A;  2CW0 C;  1X65 A;  4KJO A;  5IOC A;  1LTS D;  3R2T A;  5C4X B;  4DK1 A;  2BE5 C;  1JR0 D;  2R7Z G;  2EYP A;  1HTP A;  3KLR A;  1JJC B;  2DNC A;  5CV4 A;  2AQ3 B;  4P74 A;  1V43 A;  3J7A V;  1EYA A;  3P20 A;  4ZYS A;  1PFN A;  5C4Z A;  3MA2 B;  2J0T D;  3LWU A;  4RA8 A;  4DV3 Q;  3T51 B;  3PIO A;  3CQZ H;  2NVT H;  4A3K H;  2XGT A;  4EQP A;  3HOU H;  1BO0 A;  2NZO A;  1H9R A;  1K9M C;  3BZC A;  1WTO A;  1BNZ A;  1YIT A;  2NZH A;  1ESF A;  3JAM i;  3NBI A;  5BR8 Q;  4FXD A;  3VYS A;  1D1I A;  4YY3 L;  3A55 A;  4LFB Q;  4AH6 A;  5IP7 H;  4DV4 L;  2YU9 B;  3CPF A;  1SJH D;  3KDF A;  3T53 B;  3BDL A;  1KLU D;  4B9W A;  1I4H A;  1J6Q A;  2K75 A;  2B2T C;  2RVL A;  3BYY B;  4A76 A;  1QVG A;  3K7A B; 
#chains in the Genus database with same CATH homology
 3H09 A;  1SE4 A;  5D3I B;  5BN5 A;  1KDA A;  2FMC A;  3OIQ A;  1JWU D;  1SMY D;  4XYQ A;  3T4A C;  4L63 B;  1B4O A;  2IT1 A;  2GA4 B;  3QOJ A;  2IPK D;  3MVV A;  3VR5 A;  3NQT A;  2XRS D;  3CU7 A;  4JBW A;  3C3L A;  2FJ2 A;  4KV6 A;  1WD0 A;  1Q3L A;  1AFP A;  1BBX C;  3S16 B;  1LTA D;  2ZT9 C;  4XIG S;  5C3X A;  1JOR A;  3GO5 A;  3C1E A;  2B2U C;  5EBD A;  2ICE C;  3VR2 A;  3BDO A;  4K5W A;  1PTO D;  4CJ2 C;  1JOQ A;  3I8Z A;  5KGU A;  2OXP A;  3GQB A;  1ZYR C;  3DUZ A;  5CV9 A;  3FPP A;  4KD3 A;  1TS3 A;  4K6L A;  4A3J B;  1EEI D;  2C9O A;  2ZXR A;  3Q24 A;  3I70 A;  1FD7 D;  4RAU C;  5K5P A;  2DY8 A;  3TDQ A;  2B8F A;  4H7B A;  2DY7 A;  3NHH A;  1O7Z A;  5C0X J;  1XX8 A;  1KTK A;  3FKI B;  2N55 A;  4LMQ D;  4MIU A;  1ENF A;  5COY A;  5TSS A;  5J39 A;  4N9P A;  4WOR A;  2KCN A;  5KEE A;  1TWG B;  1Z7T A;  5C0X I;  1TT2 A;  4U67 3;  4ULL A;  4HAE A;  5C6A A;  1LTB D;  3FPU B;  3OMC A;  3IL8 A;  1NR4 A;  5EPJ A;  3PMF A;  3C2P A;  4KY5 A;  4I7Z C;  1F9S A;  3TZU A;  1T5E A;  2MUY A;  3S1Q B;  3RZO B;  4KTA A;  3P7J A;  1Y1V B;  4KN7 C;  3EFX D;  1EY7 A;  2EYH A;  1CQF A;  4XQJ A;  2KJX A;  2A69 D;  2SOB A;  3PUV A;  2EY2 A;  5KND A;  2EYJ A;  3S2H B;  3E6Z X;  1SFO B;  5EKL A;  4OO1 I;  1MI2 A;  3E5S A;  1DOK A;  1X3P A;  5LL6 S;  4F7X A;  3VR6 A;  3PIO 3;  3PV0 A;  1HPC A;  2XWB B;  2F0E A;  4OGQ C;  4Q5V A;  3AMU A;  3M4Y A;  2SNM A;  4A3E B;  5EPL A;  3RMH A;  1LLR D;  5BN3 A;  2O5I C;  3GV6 A;  2A73 B;  2R92 B;  3FMC A;  4ZAI A;  1QIL A;  3EJI A;  2NTS A;  3NTI A;  2AWN A;  3V05 A;  3HP3 A;  4DN4 M;  1OO9 B;  1V1P A;  5DNF A;  1SDF A;  1F9R A;  3KLS A;  4RCN A;  3DEP A;  1G29 1;  3BVG A;  1TS4 A;  1JQY D;  1LTG D;  1WTR A;  1LTR D;  1GUS A;  3W3A A;  1HRJ A;  1GUG A;  2PW7 A;  3HEJ A;  4OL7 A;  4N9T A;  3H0G B;  1BF4 A;  4S3S A;  3PUZ A;  4K5X A;  1QG7 A;  1V8Q A;  2ICI A;  3NXW A;  2B39 A;  1B50 A;  3NE5 B;  1EY4 A;  1F2Z A;  2L9H A;  1XTC D;  4R8I A;  2R7Z B;  1CK1 A;  1PFB A;  4M8A A;  2F0U A;  2F0K A;  3HOV B;  1GHJ A;  3I4N B;  2D5D A;  5HUR A;  4KHZ A;  3BVM A;  3BYT B;  2O4X A;  1ENA A;  1G91 A;  1EFI D;  1HUN A;  3E0J A;  2I07 B;  4DGZ A;  1EU4 A;  1FGB D;  2RDH A;  3GTL B;  5IGD A;  1PRT B;  2F0P A;  2BCO A;  1SSO A;  1V1O A;  3QWN A;  3MWY W;  5K36 G;  3K5N A;  3MEH A;  2EJF C;  1FR3 A;  3M7G A;  4BBR B;  2EPB A;  1BXT A;  1KDB A;  4PNY A;  2K5W A;  5G3L D;  3JAM E;  1SAP A;  1TII D;  3VR3 A;  3MXU A;  2B2V A;  1MD2 D;  2IX0 A;  1TWF B;  2JP1 A;  3MTS A;  1WTX A;  2KCC A;  2SDF A;  4F87 A;  1RF2 D;  2CHB D;  4CHT B;  1V1P B;  5A2Q E;  2Z4H A;  3FVQ A;  1F9P A;  4QIW B;  1F77 A;  4QMG A;  2M2L A;  2KQ3 A;  2A6H D;  1GUN A;  2TMP A;  1NR2 A;  2MP1 A;  4J6H A;  4KKT A;  5FLX E;  1HCZ A;  5FK9 C;  1BR9 A;  4CBV A;  4DXF A;  4IN3 A;  1YNN C;  2L5T A;  3KLS X;  3BG3 A;  2C5C A;  4J1M A;  4IFD G;  1T5X D;  3HOX B;  3DHQ A;  4DA2 A;  2ID0 A;  2FHT A;  3GV3 A;  3I4M B;  3ZYY X;  1CTM A;  1K8O A;  3H3V C;  1A6X A;  2XSC A;  3DEO A;  1EL0 A;  2WKD A;  2QEJ C;  5FO7 B;  2RDG A;  4XXE A;  3NPP A;  2X6L A;  4C3H G;  3WDN A;  2OEO A;  2QF7 A;  3SK6 A;  3SK5 A;  2E75 C;  3J80 E;  2AUK A;  3J7A F;  2NVY B;  1B44 D;  2RDF A;  4HSP A;  3A8K E;  3HOZ B;  1I4G A;  4X3K A;  1AP0 A;  1Q1E A;  2F0Q A;  2JXM B;  1B53 A;  2PZU A;  5JEA G;  3A8I E;  3UI2 A;  4X3S A;  3K5M A;  1R9T B;  3V96 A;  1CHQ D;  4RHR A;  4UAI A;  3LWE A;  1CA5 A;  1EWC A;  1GOZ A;  2PQE A;  4RH6 A;  5ELC A;  2F3V A;  2PNR C;  2Z1C A;  3VYT A;  3I4L A;  1IW7 C;  1H9J A;  3BDC A;  1C4Q A;  4DNR B;  5JVG 3;  3HOW B;  1HFG A;  3D6W A;  3VYU A;  4FXG C;  1LV9 A;  4DK0 A;  2NVQ B;  2XN9 C;  2CW0 D;  4KI0 A;  3P75 A;  3WOE A;  1NCV A;  3DM1 A;  2HCI A;  3NBH A;  3X3N A;  1TY2 A;  2O5J C;  3I73 A;  1AZP A;  3HRZ C;  1WTQ A;  4NDX A;  1ILP A;  1A2T A;  1EQT A;  1WD1 A;  1A3U A;  3U9S A;  2R61 A;  3HG9 A;  4BA1 I;  1VF5 C;  2JEA I;  2R93 B;  1J9O A;  1TU2 B;  3S1M B;  5KYL A;  1E2V A;  1I6V C;  4Z9C B;  3A7A B;  5ELD A;  1OXU A;  4ZLT F;  2LY7 A;  2B2T A;  5C5L A;  2F0O A;  2JE6 I;  1JE4 A;  2PCF B;  1BCP F;  2YYZ A;  3TSS A;  4NKL A;  3C46 A;  1EIG A;  1ET9 A;  4Y7N B;  3D4R A;  1MSH A;  5AFW A;  2L55 A;  1PXU A;  1UAP A;  3P1H A;  2SNS A;  4ID6 A;  1Y8N B;  2FMM A;  3H94 A;  5IGG A;  2LMC B;  4FXK C;  2K5Q A;  1ML0 D;  1OXX K;  3EA6 A;  1SNC A;  1JB3 A;  3ERQ A;  4G7H C;  3SVM A;  2BDO A;  5D14 A;  1DD2 A;  4C3I G;  3DWQ A;  2E2D C;  5C3E B;  2B2U A;  3A8J E;  1D6E C;  3J81 L;  1SYC A;  3M85 A;  1EIH A;  4UDU C;  2F0F A;  1PZI D;  4C2M B;  4WFN 3;  2JEB I;  1SJE D;  2NWG A;  4E6I A;  1DOL A;  4V0B A;  3MXN A;  5I9P A;  5I6Y A;  5ELE A;  4IFD H;  2HCC A;  2BA0 A;  1HXY D;  1XXG A;  1ZYR D;  1B3A A;  4C3J B;  3C1F A;  4CJ0 B;  4ZK9 B;  3A56 A;  1PFM A;  4IUV A;  1MBY A;  3OWF A;  4NP5 A;  2WIN B;  1STY A;  3LNN A;  2EZV A;  1O7L A;  3H91 A;  4XT1 B;  5D65 A;  2K6A A;  2MGS A;  4WJW A;  5LHY 1;  2X6G A;  1K83 B;  5E1F A;  2A6E C;  2A5H A;  2QDB A;  4IFD J;  4MN3 A;  1Y1W B;  2EYO A;  5C0X H;  3DWA A;  1FNU A;  1K8M A;  4O1N A;  4C1N K;  1TS5 A;  3S2D B;  1LAC A;  4IFD I;  1WTP A;  1SYB A;  5CYU A;  2K7V A;  1DXM A;  2L4N A;  1SND A;  3MZ5 A;  1LT3 D;  4BWG B;  3KUP A;  1ROD A;  3VA5 A;  2NN6 G;  1KDC A;  2MHV A;  2KOL A;  2F0D A;  3CQZ B;  2NVT B;  5JPM C;  4A3K B;  1E2Z A;  1PTO H;  1O80 A;  4EGV A;  3ONA B;  2WKC A;  2V4D A;  4CKB A;  2QCP X;  1D1K A;  1D2B A;  5EKK A;  1CM9 A;  2RSN A;  1YNJ C;  1UNS A;  4RWS C;  5DAU A;  4C3H B;  2F0W A;  5JEA J;  3SR1 A;  3MXG A;  2G9H D;  4OO1 H;  3Q0A A;  1SMY C;  2DN8 A;  2JA8 B;  3DWP A;  1W6J A;  3OW7 A;  5IT9 E;  3TZD A;  4NMZ A;  3D4W A;  1DON A;  1S5C D;  4ILW A;  2A68 C;  1CI3 M;  2OF1 A;  4HR7 B;  3PO2 B;  3K59 A;  4A3G B;  1M8A A;  1GXD C;  3URY A;  3A7L A;  1EYD A;  1HQM C;  4HN7 A;  4KKS A;  5M3F B;  4IZ8 A;  4A3F B;  4KK7 A;  2F4I A;  1PTO C;  1QNK A;  1SNQ A;  2R6G A;  2SEB D;  1GHK A;  4XQN A;  5ELF A;  5IOD A;  4OIJ A;  3TN2 A;  2EOT A;  5NUC A;  1IKL A;  2EY5 A;  1G8Z D;  3EVQ A;  1TKW B;  4IUN A;  5EKI A;  1PRT D;  1HA5 A;  5FKA C;  1W6K A;  2EJM A;  1Q1B A;  2F3W A;  1CA6 A;  4IQZ A;  1S5E D;  1QOH A;  1B9N A;  2PW5 A;  1STH A;  4FNF A;  3NSW A;  1EU3 A;  5KIX A;  4XDX A;  4FF1 A;  1IKM A;  4G7Z C;  5CV5 A;  3Q6S A;  4FF3 A;  1U4R A;  3OSO A;  2D62 A;  2CVR A;  4KKU A;  2EY6 A;  4ZUI A;  3MAQ A;  2EYM A;  1WTW A;  3ITP A;  2IL8 A;  3J7Y W;  5CGK A;  1OXV A;  1CZG A;  3D3R A;  4ZKC B;  2EDG A;  2F0M A;  2KVM A;  2B2Y C;  1NAP A;  2A69 C;  3SE0 A;  1LT4 D;  2F0I A;  5JVH 3;  2DNE A;  4G57 A;  1DCZ A;  3I72 A;  4C3I B;  3OOC A;  3QG1 A;  3R93 A;  1C48 A;  2E2H B;  1DJR D;  2TSS A;  3KBX A;  2J4X A;  3IAY A;  1Z47 A;  4EQN A;  1YNN D;  4O42 A;  1TWH B;  3RLF A;  1KLG D;  1SBB B;  1G2T A;  3M7N A;  5KYI A;  1D5M C;  4C3J G;  2QIL A;  4F88 A;  1PTO F;  3VR4 A;  3Q23 A;  1UEA B;  1I4R A;  4LK1 C;  2XIW A;  1Q90 A;  3K57 A;  3PUY A;  4XT3 B;  3LX0 A;  2VB2 X;  2IJ0 A;  1ILQ A;  4K14 A;  2RBM A;  4K5V A;  3IFT A;  3R3O A;  3GTP B;  5DEH A;  1H9S A;  1TR5 A;  1SYG A;  1WVL A;  1G6Z A;  1SYD A;  5KNC A;  2KEC A;  4HMJ A;  3NWS A;  4IUU A;  2NN6 I;  1BQQ T;  3RZD B;  4FF4 A;  1U4L A;  1Y69 U;  1ZKO A;  3NQI A;  1XYI A;  1VDZ A;  1WCM B;  5COR A;  5CBA E;  5EJW A;  5E4W C;  2FIN B;  3BZD B;  5I2Y A;  3SHL A;  4DAY A;  2D2C C;  1PZJ D;  4A3M B;  1PZK D;  3CKI B;  3CRK C;  5HGT A;  3S17 B;  4ZKB B;  3N52 A;  5JOB A;  1BCP C;  3GTG B;  3K5L A;  4ABN A;  1IW7 D;  3M3Y B;  4A3D B;  3D31 A;  4RKL A;  4DFA A;  1G2S A;  1I4P A;  4WRD A;  1SXT A;  4A93 B;  3ND8 A;  2RKS A;  2BA1 A;  2M00 A;  2F1M A;  4PQX A;  4P2C B;  2HUG A;  3NK9 A;  1VF7 A;  4R9W A;  1R4P B;  1I4X A;  5LL6 X;  1Y8O B;  1JC7 A;  2NZ1 D;  2PMZ B;  1E0B A;  1PRT F;  4GZY C;  1XWE A;  4HCS A;  2B2W C;  1KNE A;  2PZT A;  4RGO S;  5FO9 B;  1X3Q A;  3FDT A;  4H44 C;  1H9S B;  5C4H A;  3D4D A;  2Y0S B;  1STB A;  3U9O A;  1EOT A;  4BY1 B;  2Q8I B;  4IAL A;  2K1B A;  4X3T A;  4CGY B;  3KF8 A;  2WAC A;  4M1U B;  4TKO B;  2K5D A;  4CKC A;  1LAB A;  3MFY A;  1AW7 A;  5D3D A;  2E2J B;  4QCL A;  2BE5 D;  4TRD A;  1CZW A;  2IX1 A;  4QUC A;  2Q8R E;  4CJ1 B;  3PUX A;  2VUM B;  3H6M A;  4L6T B;  2JA7 B;  3RUZ A;  2KED A;  1F2M A;  2R3Z A;  5CC4 A;  2AQ2 B;  1SYF A;  1E2W A;  1PYW D;  1O78 A;  3QOL A;  3NWT A;  2JSO A;  5T1G A;  1EZ6 A;  4ZUJ A;  1BDO A;  1TWA B;  1TVX A;  2IWH A;  2F0V A;  2RSO A;  1HHV A;  4G4K A;  2E2I B;  1CQV A;  5K36 H;  4XQQ A;  3NTK A;  4EQO A;  4KN4 C;  4HTH A;  1JIC A;  4B08 A;  1S5B D;  1CFM A;  1Q8I A;  3F2U A;  4F8M A;  3QO2 A;  2PZW A;  2VXW A;  3S15 B;  1S5D D;  2EJG C;  1WTV A;  1CHP D;  5G3L F;  4RFB A;  4DU9 A;  4HED A;  2O2L D;  1LTT D;  4K6D A;  2EXZ A;  1PDQ A;  3D6C A;  3FEW X;  4V19 0;  1ZXT A;  4X3U A;  2A6E D;  3AB9 A;  4MHE A;  1D5Z C;  3GP7 A;  3S9W A;  1GUW A;  3KBG A;  2XVS A;  2NBF A;  4NW2 A;  1U9R A;  3JAM L;  5C44 B;  3MFG A;  3NUC A;  1I6H B;  4DF7 A;  1M4V A;  3HKZ B;  2E76 C;  1X32 A;  5A2Q L;  2K32 A;  2RA4 A;  1EY5 A;  1OXT A;  1MGS A;  2K01 A;  3CRL C;  1H9M A;  4XYO A;  1J8I A;  1SNP A;  1QJO A;  3PUW A;  1F2L A;  4J8Q A;  2WB1 B;  4ZRZ A;  2I46 A;  5JAV A;  5FLX L;  1STA A;  3BS1 A;  3GTK B;  5IIF A;  1YNJ D;  4K2L A;  4XTC S;  1AEX A;  3PO3 B;  4DXG A;  1IYU A;  1ET6 A;  1SEB D;  2ENB A;  4KD4 A;  1TS2 A;  5EGT A;  3TME A;  2A68 D;  1Q12 A;  3HS0 C;  1JOK A;  5C3W A;  3BVZ A;  5JEA H;  3GTJ B;  5DM6 3;  4OIK A;  3GTM B;  4U68 A;  5I9O A;  1I4Q A;  2L12 A;  3HOU B;  2F0T A;  5CMD A;  1FNV A;  1EY6 A;  5E3F A;  5J1Z A;  1VMP A;  2AWO A;  2MPM A;  3T13 A;  1QE6 A;  2H4O A;  1QB5 D;  3IFD A;  4FVM A;  2K33 A;  2LKV A;  2J7Z A;  2KUM A;  3SEB A;  3J80 L;  4FYD A;  2VNU D;  1RKN A;  1PLF A;  5CR3 A;  1ONL A;  3TP5 A;  1VCI A;  1SNO A;  1MSG A;  5I4D A;  3TP6 A;  3N6R A;  4BBS B;  1DM0 B;  1O7Y A;  5KNB A;  2WV6 D;  5M5Y B;  1JCK B;  4G7O C;  3MHB A;  1F9Q A;  2RQX A;  3T56 B;  3R2I A;  2QKI C;  2K28 A;  2KEE A;  1RTN A;  2E74 C;  5ISR A;  1LTI D;  1SNM A;  3MC0 B;  4B9X A;  1JOO A;  2PPB C;  3FRP B;  5JJZ A;  4DNT B;  5IGF A;  1SE3 A;  5IGE A;  3I90 A;  5E4X A;  3TP7 A;  2WP8 J;  3HZX A;  1EYC A;  2AUJ D;  2B2Y A;  4AYB B;  3ND9 A;  1HA6 A;  4QF4 A;  1QNU A;  1KAA A;  1S4Z A;  5BN4 A;  2L0C A;  2OT2 A;  1PTO B;  5I2X A;  2HDL A;  1ICW A;  3I3C A;  1KNA A;  1GUO A;  4I65 A;  3SK8 A;  2EYL A;  3KK7 A;  3SK4 A;  3WOF A;  1EY0 A;  2IW3 A;  2WII B;  1IL8 A;  4IUQ A;  3GD7 A;  4FF2 A;  5EQ0 A;  3TBI B;  1AN8 A;  3K0Y A;  5M9O A;  2NUC A;  5ELB A;  2F0H A;  4IUR A;  5CV6 A;  1DZ1 A;  3OIP A;  1NUC A;  4EVO A;  3IKJ A;  4DAP A;  1TWC B;  4TSS A;  2NTT A;  1LT6 D;  1HUM A;  3R8B A;  1Y8P B;  2LFN A;  3QJY A;  2WAQ B;  2A74 C;  2EVB A;  5J22 A;  1AZQ A;  2K04 A;  2JA5 B;  1RJT A;  3S1R B;  5EPK A;  3I91 A;  3T16 A;  1ESR A;  5C5M A;  4LJZ C;  2EYF A;  2KA7 A;  3OHX C;  1PRT C;  4KHV A;  2HDM A;  2N88 A;  2NN6 H;  3RD4 A;  1C8C A;  1JWS D;  1TQO A;  2MJ8 A;  5EBC A;  5FOB B;  5T1I A;  4FP5 D;  1ENC A;  2PO4 A;  4RGT A;  4R8N A;  3K5O A;  1SE2 A;  4PV1 C;  1RDP D;  2NVX B;  1A3T A;  2Z8L A;  1BCP D;  3X3M A;  1UUP A;  1IHZ A;  5IGC A;  3J81 E;  2IX3 A;  2G9D A;  1CT1 D;  1A3V A;  3EQL C;  3W2D A;  2NB0 A;  1DYQ A;  2F03 A;  2AQ1 B;  5CBE E;  1KAB A;  3GTQ B;  1QCB D;  1U4M A;  1R4Q B;  2F0S A;  2B2W A;  3DXJ C;  4OHJ A;  3OMG A;  1S5F D;  3NP8 A;  1Z6H A;  3S14 B;  4RHS A;  3V2T A;  3L9A X;  2BOS A;  2XWJ B;  5M5X B;  3GTO B;  2FFK B;  1JWM D;  2BDN A;  3K6O A;  4RKB A;  1U4P A;  1BUV T;  1RD9 D;  1EWH A;  1TY0 A;  1DOM A;  4KY6 A;  1HTL D;  3L3O C;  1LT5 D;  1RHP A;  4RGM A;  2LS0 1;  1STN A;  1HQR D;  5IT9 L;  3OPO A;  4K8J A;  4IUT A;  2CQA A;  1I50 B;  1SYE A;  1NSN S;  3TP8 A;  4ME5 A;  1STG A;  2L11 A;  5IGB A;  1B9M A;  3VYR A;  1LO5 D;  2F0L A;  1BCP B;  1EY9 A;  2B2V C;  2XRQ D;  2PYK A;  3M4O B;  3AU7 A;  4IUP A;  4K2K A;  5CV7 A;  4HCE A;  2F0N A;  3PIP 3;  3VA7 A;  2A6H C;  4A3I B;  1EEF D;  1IYV A;  1RCV D;  1RTO A;  4DAV A;  2JYO A;  2JA6 B;  2K05 A;  4C1N I;  5C0X G;  2KHS A;  4BS9 A;  5I6W A;  2ZXO A;  4YIJ A;  5JPN C;  2L1B A;  5C4J B;  3S1N B;  2K03 A;  4L8J A;  4RCO A;  2B8G A;  4HSV A;  5A35 A;  2X69 A;  5CV8 A;  5F2D A;  4JK1 C;  1ZEQ X;  5M5W B;  3ERO A;  1II3 A;  4QUF A;  5M3M B;  3D8G A;  2M9V A;  1FNW A;  2D9U A;  2Z4I A;  3G7L A;  1I3Q B;  2HQE A;  4PMC A;  3A54 A;  1EQV A;  1BOS A;  1B2T A;  4LAA A;  1STE A;  3HOY B;  1HFN A;  2Q8T A;  3QIA A;  5FO8 B;  4HMI A;  3CHB D;  4A3B B;  4KJN A;  2VB3 X;  3O13 A;  1PMR A;  4OO1 G;  1A15 A;  4BY7 B;  2B63 B;  1QWY A;  3SXH A;  1GJX A;  4QB4 A;  1L0Y B;  3QB3 A;  3OWE B;  4ZQ3 A;  2EY1 A;  2NYZ D;  1A2U A;  1EZ8 A;  2F0G A;  2ZXP A;  1L0X B;  4KY7 A;  4Q0F A;  2F0J A;  3HGB A;  4CKE A;  2EE1 A;  3L7Z C;  1GUT A;  1H9K A;  5DM7 3;  4PMB A;  2XNA C;  4PMW A;  1F2Y A;  3MXP A;  3K58 A;  4H0L C;  4BA2 I;  1D5X C;  4KMU C;  4TQU S;  4RGN A;  4K8I A;  4H13 C;  3G6J B;  3SDZ A;  2H1E A;  3NTH A;  3DMU A;  5KRU A;  1EY8 A;  1B1Z A;  3Q22 A;  1VMC A;  1OXS C;  4C56 C;  4ODG A;  4FO2 A;  1FYC A;  2CW0 C;  4KJO A;  5IOC A;  1LTS D;  3R2T A;  5C4X B;  4DK1 A;  2BE5 C;  1JR0 D;  2EYP A;  1HTP A;  3KLR A;  2DNC A;  5CV4 A;  2AQ3 B;  1V43 A;  3J7A V;  1EYA A;  3P20 A;  4ZYS A;  1PFN A;  5C4Z A;  3MA2 B;  2J0T D;  3LWU A;  4RA8 A;  3T51 B;  4EQP A;  1BO0 A;  1H9R A;  1WTO A;  1BNZ A;  1ESF A;  4FXD A;  3NBI A;  3VYS A;  1D1I A;  3A55 A;  2YU9 B;  1SJH D;  3T53 B;  3BDL A;  1KLU D;  4B9W A;  1I4H A;  2B2T C;  2RVL A;  3BYY B;  3K7A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...