4F8MA

Crystal structure of staphylococcal nuclease variant delta+phs v23i/i92v at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f8mA00
2EYPA 2F0TA 3VA5A 3EVQA 1ENCA 2O4XA 2RKSA 3H6MA 4HMIA 1SNCA 3OWFA 2F0GA 1EY8A 5C4ZA 1STNA 1SYCA 5CV9A 4ODGA 2KHSA 5CV6A 5CV5A 5F2DA 1KDCA 3SXHA 1SNQA 4ID6A 1STAA 2F0FA 5I6WA 4K5XA 4KHVA 1U9RA 2LKVA 3DMUA 1EY7A 3MHBA 3SK4A 3SR1A 4G57A 2F0NA 2SNSA 4DFAA 2RBMA 3MVVA 4H7BA 4N9PA 3MEHA 3D6CA 3MZ5A 5J22A 1KDAA 4HMJA 4PNYA 4ZUJA 5CC4A 1TT2A 4K5WA 2F0JA 1SNMA 5DAUA 4KJNA 5HGTA 1EY9A 4PMBA 3NXWA 5CR3A 4J1MA 5J1ZA 3OMCA 3S9WA 1II3A 3PMFA 4KD4A 4J6HA 3HZXA 4EQPA 2F0SA 2OXPA 5DEHA 4QMGA 2F3WA 5IGDA 5IODA 3EROA 4KY7A 2PZUA 1SYBA 1EY4A 2EYFA 2OF1A 5EKKA 5EKLA 5HURA 5IGEA 5M9OA 2F0EA 4WORA 4WRDA 2PW5A 5KIXA 3SK8A 2F0PA 1STGA 1JOOA 2EY6A 4LAAA 1STHA 3BDLA 4RKBA 3OSOA 1NUCA 2SOBA 3TP7A 4R8NA 3U9OA 2EYOA 3R3OA 2HQEA 2NUCA 5E3FA 1EYAA 5C5LA 3RUZA 4QB4A 1SNPA 4IUNA 2EYMA 1EY5A 1EZ8A 3SK6A 1JORA 1EY6A 5IOCA 5KEEA 4F7XA 1SYDA 1KABA 5K5PA 4EQOA 3P1HA 2F0LA 1EZ6A 1A3TA 4TRDA 2OEOA 3D4WA 3DHQA 4NDXA 2PQEA 3T16A 1A3VA 1F2MA 3LX0A 4K2KA 2EY2A 4KD3A 4YIJA 5NUCA 2F0IA 4NKLA 1A3UA 4NP5A 2WACA 3T13A 4E6IA 3QOJA 4KY6A 5CGKA 2F0MA 1JOKA 3NUCA 2ENBA 4KY5A 4QF4A 5IGFA 5KYIA 1A2UA 2QDBA 5I9OA 1EYCA 4K8JA 2F0DA 2EY1A 1STBA 2PZWA 3BDCA 2EYJA 3SK5A 1EQVA 5E1FA 4DU9A 2RDFA 3NK9A 4B9WA 4K14A 1EYDA 1IHZA 5IIFA 1F2ZA 4DGZA 1EY0A 5C5MA 1TR5A 2EYHA 3OMGA 2EY5A 4EQNA 3C1FA 5C3XA 2F0OA 3E5SA 1SNOA 1AEXA 3TMEA 5JAVA 4OL7A 2F0WA 5IGBA 1A2TA 4DF7A 4ZQ3A 4N9TA 4B9XA 3ITPA 1SYGA 5KYLA 2F0QA 1KDBA 4K6DA 3C1EA 5CV4A 4RKLA 5ISRA 5J39A 1SYEA 1JOQA 5I9PA 5C3WA 2F0KA 3NP8A 4F8MA 5C4HA 5C6AA 4EVOA 4NMZA 3TP6A 3V2TA 3ERQA 4ME5A 3MXPA 3QB3A 4IZ8A 2EXZA 5JOBA 4MIUA 1RKNA 4I65A 3HEJA 5EGTA 2F3VA 3TP5A 2F0UA 2PZTA 1SNDA 5IGCA 1STYA 4KJOA 5KGUA 2PYKA 2PW7A 3QOLA 1F2YA 2F0HA 4KV6A 4S3SA 3NQTA 4K5VA 4IALA 3D8GA 4HTHA 1KAAA 5IGGA 3NHHA 4PMCA 4K2LA 5CV7A 2KQ3A 3SHLA 2EYLA 2F0VA 1SYFA 3P75A 1TQOA 1ENAA 4KTAA 4ZUIA 3TP8A 3EJIA 5CV8A 4K8IA 5KRUA 5I6YA 2SNMA 3D4DA 2M00A 1NSNS
chains in the Genus database with same CATH superfamily
3QWNA 1R9TB 2MQHA 1WFQA 5A35A 3OWFA 1PVOA 1LUZA 4WFN3 5C3EB 2P5ZX 1L0YB 3HOYB 1WJJA 1U9RA 4TVAB 2KJXA 3RNUA 1Y69U 3A7LA 3H91A 4CHTB 3MVVA 1BCPC 1I4RA 4X65L 1CQVA 1NR2A 2WB1E 5CC4A 3W1GA 1A8VA 1F9RA 2AQ2B 4A3LH 2VY3A 3RZOH 1G2SA 3L0OA 1JMCA 3A5ZB 5M9OA 1MJCA 1LT5D 3FHWA 4WRDA 2YYZA 1QZGA 1TWGB 4UAIA 1S5FD 2K5WA 1JB7A 4YY3L 4OX9L 1KHIA 3T1HQ 1OXXK 1SYDA 1HUNA 5K5PA 3GTJB 1EZ6A 2CH4A 1WI5A 3VYRA 5K36H 4F88A 3I70A 3K5NA 2O2LD 4JV5L 2K1BA 4KN4C 3CF5A 3NUCA 5KYIA 4M1UB 1STBA 1LT4D 5E1FA 4JBWA 3UDFA 2E2JB 1RJTA 2EYHA 2UXDQ 2FMMA 1CSPA 2F0OA 1CTMA 2IX3A 1K8AC 1H9SB 3CW2C 3FPPA 4JI1L 4A3IH 2QEJC 3TZUA 4N9TA 3I73A 1Q8IA 3J80i 2D62A 1KLGD 5J39A 1RODA 5C3WA 4A3DB 2F0KA 4K0KQ 3PF5A 3V2TA 4A3GH 2PCFB 3R93A 1SNDA 2MO0A 4HJ5A 4OO1I 4OELB 1GJXA 3N52A 4R8IA 3OHXC 5IE8A 1K83B 5M5XH 1F2YA 2ALYB 1SFOH 3MC0B 1VQ7A 1SE4A 1A6XA 1L0WA 2MO1A 3T51B 4KTAA 4XQQA 4GS3A 4DKAC 2BH8A 1IBKQ 4BBSH 1GXDC 4C3JB 1EOVA 1ZYRC 1IYJB 1SNCA 4P75A 3JAML 3MAQA 2YU9B 4DR1L 2UUBL 1SLJA 3H09A 4AYBE 3K8AA 4KKSA 2B3GA 1STAA 1UEBA 2FFKB 4DK0A 4KHVA 4DV7Q 1YZ6A 1E1TA 3BJUA 3TQYA 2SNSA 3E0EA 4DR5Q 1QOHA 4M8AA 2N8NA 5GAEC 1TT2A 5BN5A 1AFPA 2K5HA 1S4ZA 1VQGA 3NXWA 4ABNA 1I94Q 1GUTA 3KLWA 4XT1B 5CMDA 2L0CA 2UXBL 4IPCA 4C1NI 4QMGA 2JEBI 2HT1A 5IODA 1L1OB 1EY4A 1X6OA 3S17B 1QJOA 2J0TD 1Y1WH 1RL2A 1FJGL 4DV5Q 2K4KA 3S2DH 1SDFA 3BDLA 1S72A 4JYAL 2Q2UA 2R7ZH 2BE5C 3BDOA 3A5UA 1EYGA 1JE5A 3U58A 2EYMA 5D3IB 3PO3B 1S5DD 4A3BH 1TWCB 4LFBL 5IOCA 1VQDA 5DM73 2DGYA 3L2PA 1B8AA 1O7LA 4B08A 1K8GA 4ZRZA 1KXLA 1PH8A 2NN6G 3KF6A 2F0IA 4CDCC 1EL0A 1SE3A 1MSGA 4QF4A 3BZDB 3LWUA 1BBWA 3BDCA 3CCLA 4JI8L 2B63B 1M4VA 1LT3D 4X3UA 2AUJD 1M8AA 3CKIB 3C1FA 3TMEA 1D2BA 2K6AA 3X3NA 4IURA 1QE6A 4JI7L 4A93B 3KJOA 3NTKA 4OWTB 1XNQQ 1YBYA 4FF2A 5FLXE 1H95A 3QJYA 2XNAC 4LFCQ 4I65A 1VCIA 2MGSA 3UDXA 1WTXA 3HOZG 3HOUG 2R61A 4DV0L 4S3SA 1SMYC 3HGBA 1VQAA 2XIWA 3T53B 2F0VA 3PO2G 3OTOQ 5IT9E 2XSCA 1F9PA 3GTKB 3PUYA 3HKZG 5IY0A 5H1SE 1XXGA 1ENCA 4O0AA 1Z9FA 2QILA 3AQQA 4DUZL 2MFIA 2EJGC 4G4KA 5CV9A 2QEXA 3K6OA 1K3BC 1SNQA 3AU7A 4IPGA 2KVMA 1DONA 1RIPA 1GUNA 4KK7A 5IYBH 3H15A 4LMQD 3K59A 1UWVA 4B3SL 1YNXA 1BDOA 4HMJA 1EFWA 1ZEQX 2LFNA 1T5XD 3GTOH 1IZ6A 3I3CA 3HS0C 2NZ1D 2LXJA 2N88A 5DEHA 4LUOA 4R9WA 5CBEE 5JVG3 2K5VA 5C44H 4DV2Q 1V8QA 4OGQC 4CBVA 2EY6A 1NJIC 2VUMG 2VQFL 2NVXB 1PV4A 4R8NA 2EYOA 4UP7A 1CFMA 2B2UA 1OTCA 4ZLTF 4A3KH 4LF6Q 1DZ1A 4PQXA 1IYUA 1T9HA 5EBCA 4EQOA 1WCMG 3VR5A 4TRDA 1I6VC 5ELOA 1E22A 1ZYRD 4ZKBB 1O7ZA 3S14H 4YIJA 5NUCA 2KBNA 1B44D 1XMQL 1ZKOA 4DUYQ 3VA7A 3QOJA 4IQZA 2K04A 1VQHA 2XN9C 2CCZA 5C3EG 4R4TA 4X66Q 4XT3B 1PZJD 2EYJA 3P7JA 1HR0L 2UXCQ 1D5ZC 1IHZA 2E2IH 1UE1A 1N36Q 4IN3A 5FLXc 1N34Q 4DR4L 5M5WH 5GAGC 2NZOA 3CHBD 4PV1C 1EQQA 3SE0A 5IGBA 4A4IA 3GTPB 1YNJD 3GTMH 3ITPA 1H9SA 1HNWL 4KI0A 4FXDA 3F2UA 4HJ9A 4BA2I 1RF2D 4IZ8A 5IT9c 2BE5D 3Q23A 1RHPA 3D0FA 2PZTA 1XWEA 2JEAI 1ASYA 4R4OA 4DV1L 3SHLA 1X3GA 1HNZQ 1SMXA 4A3EH 1FVIA 2OQKA 5KRUA 1KRTA 1NSNS 1PYBA 1B9MA 5M3FG 3MEFA 5COYA 3KOJA 1EY8A 3PF4A 4GKKQ 1VQFA 2CH4W 2DNCA 4GNXC 4AIMA 3GTLH 5EPLA 1EQRA 2IW3A 3W5OA 4FYDA 3PIOA 3IFDA 4PZ8A 5EQ0A 3E6ZX 4CKBA 5HY6A 1CA6A 3MEHA 5I2XA 1LTGD 3ND8A 1CKNB 4ZUJA 1X65A 1PH4A 3BVZA 4JI0L 4APVA 5D65A 3M85A 5C0XG 1EY9A 5C4XH 5GQOA 4EX5A 3GTQH 4J1MA 4UP8A 1Q12A 2OXPA 1J9OA 3T1YQ 2F3WA 1U4LA 1A63A 2R93H 5KNCA 1Q90A 2N49A 5EKLA 4O2DA 4WORA 1HH2P 4A3DG 1L1OA 3GQBA 4UPAA 3MWYW 1C0AA 2SOBA 1QVCA 4G7HC 1MGSA 5A2QL 1IBML 1NAPA 2EQSA 4F7XA 2Z6KC 1VQIA 3WDNA 4X6AH 4NDXA 3EIVA 4C2MB 4ALPA 3KDFA 4JK1C 1DOLA 3H0GG 3J80L 2B8GA 3CCSA 4C3JG 4JI3Q 4LF5Q 1JOKA 4IFDH 5IGFA 4QIWB 2JSOA 3G48A 3HOXB 5BN3A 1F77A 3F2CA 1V9PA 3K7AB 1FL0A 4LNQA 2BDOA 5FOBB 3HFZB 3KJPA 3OPOA 3EFXD 1EUJA 1Q3LA 1DJRD 4JOIC 3J7AV 4FF4A 1Z6HA 1PXUA 2Q2TA 1NY4A 4HN7A 2WB1B 2K50A 2K32A 5IGCA 3PIO3 3H3VI 2RA4A 3OOCA 1UE6A 3DWPA 3I4MH 5IGGA 1DOKA 1UE7A 4LF7Q 4HIDA 4J8QA 1TQOA 1WTPA 3EJIA 5FKAC 3PO3G 2I0QA 3UE0A 2D0PA 2DJFC 4QY7A 3HOVB 3GV6A 5I4DA 3PCOB 1Q1BA 3KF8B 3VA5A 2RKSA 3NQIA 4C3HB 1B9NA 2NYZD 1OO9B 1Q86C 4R1JA 4HR7B 1JWMD 1KDCA 4XIGS 3DMUA 1D1IA 1BNZA 1XPRA 3EBEA 4DAYA 4DFAA 5AJ3Q 2ICEC 3CCRA 1HR0W 1ML0D 5J22A 4B3ML 1VS0A 1ESRA 2N78A 2HHHQ 3FKIB 2B63G 1LTBD 1VQ6A 5HGTA 3TDQA 1B53A 4JBMA 4LWCA 3HRZC 3HOWB 1IYVA 3S9WA 3J81L 3PMFA 3OW2A 1PMRA 4JI5L 2F0SA 3S1RH 1IBLL 2JA8H 4A93G 1N32L 2PZUA 1SYBA 1MKHA 4WJ4A 4B3TL 3CCJA 2Y0SE 1CKOA 4IPDA 4HCSA 5GROA 3LNNA 5EPKA 3R3OA 5E3FA 4CJ0B 1QCBD 3RUZA 2GN5A 4RGNA 3ICEA 5KEEA 4ZAIA 1CZWA 3DHQA 4N8FA 3K5LA 4LFAL 3L9AX 4MZ9A 3I72A 1PFMA 1SBBB 1GM5A 1RTOA 1O80A 1TU2B 1Y8OB 4KY5A 3QG1A 3W3AA 1XPUA 5I9OA 2B2TC 3CCQA 2I07B 1XTDA 4X3TA 2BA1A 4B9WA 1E24A 4DGZA 4GN5A 3MXNA 4RH6A 3VR4A 4BA1I 4OL7A 4A3FB 2EOTA 2E5LL 1G51A 3Q8DA 4LF8L 4A3JB 1CM9A 1SYGA 3HP3A 3MTSA 1JOQA 5M3MB 1D5MC 2RCNA 3S1NH 5G3LF 3PIPA 1OXSC 4ME5A 3MXPA 4RWSC 3TP7A 1AN8A 1IXRA 4A76A 4Y52H 3SEBA 3VR2A 1F9QA 1TWHB 1STYA 4DK3C 1G8ZD 5IYCG 1HA5A 4R4CA 3QOLA 1PRTF 3I91A 1B4OA 2KQ3A 3RZDB 1J5EL 1LTAD 3K58A 4X65Q 3D4DA 3I8ZA 2EYPA 3B6YA 2EJFC 2GVAA 1PFBA 3DWAA 4DR6L 1HPCA 1DOMA 1STNA 2G5DA 1PTOF 3M4OH 2O5JC 5D14A 5BN4A 3ULJA 4BBRB 4FP5D 1M90C 3K0XA 1FGBD 5C0XJ 2L4NA 4GKJL 4G7OC 1KDAA 2WV6D 2QDLA 1BF4A 2D0OA 5DAUA 3G6EA 4OX9Q 4DV6L 4PMBA 1CKNA 1WTWA 4TKOB 3CQZB 2DJGC 3OMCA 3HZXA 3EQLC 1AP0A 2KCMA 2IX1A 1TXYA 4LF9L 4JV5Q 1LACA 4MN3A 3VDYA 1EWHA 2CQOA 4FXKC 3OSOA 4K6LA 4RKBA 3TRZA 4DV4Q 4QGUA 1ET9A 2Z0SA 2L1BA 1SEBD 3CPFA 4WJWA 2L11A 4R4IA 1IKMA 4GLVB 2HCCA 5D3DA 2K03A 2ZTCA 1Y14B 5CORA 4PG3A 3DEOA 4JBJA 2QA4A 4Q0FA 2WINB 1Q46A 1SR3A 1WTQA 4JI6L 2BA0A 5FLMG 3BVMA 1WTHA 4JI1Q 3T13A 2OTLA 2QKIC 3PQIA 2KCTA 3PIP3 2LS01 2UUCL 3SK5A 3FVQA 1EYDA 5JJKA 2Q8TA 1TR5A 1I4GA 1TWAH 3M9BA 2NZHA 1JQYD 3E5SA 1A2TA 3S1MB 5M3FB 1YJ9A 4JVZA 3LWEA 1VQOA 3AB9A 4WJ3M 4BXXG 3QO2A 3CD6A 4Z9CB 1CZGA 5JVH3 1JT8A 4DR1Q 2NVYB 2UUBQ 1EEID 2O5IC 1MI2A 3A8JE 1NMGA 4KV6A 2YTYA 5JJLA 2KUMA 4FO2A 1PTOH 1SYFA 3NWSA 3GTOB 2GA4B 1Y8PB 4DR7Q 1A15A 3JAMc 3NWTA 1I50H 2NN6H 5I6WA 1H9JA 2F1MA 3S15H 3HKSA 5C44B 3KF8A 4YCWA 3M3YH 3C2PA 4RCOA 4A3MB 2CWAA 4QL5A 4ID6A 2D5DA 4HIOA 3GTGH 2KOLA 3MHBA 3HOXG 2Q2IA 1IW7D 1VF7A 2KECA 1D8LA 1FJGQ 4H7BA 1E7ZA 2AQ1B 2D2CC 5ELDA 4I7AA 4JYAQ 1E1OA 1K8OA 3LGJA 1VQ9A 1X3PA 3TS2A 5DNFA 4LFBQ 2AHOB 1LM0A 1T5EA 1X56A 5FO9B 5LMNL 1EEFD 3K81C 3H0GB 4X3KA 4A3CG 3D31A 2RSOA 3RLOA 2VNUD 2BDNA 3S1QH 2YTVA 1JJ2A 5HURA 4KHZA 4IFDJ 2F0EA 4DA2A 5EKIA 3HOZH 2WB1G 3SK8A 3I4NB 3HOUH 1JOOA 3VYSA 2ZTDA 4GOPC 2NUCA 2E2IB 2DNEA 4C1NK 3PO2H 1JORA 2L15A 1GUOA 4NXMQ 4JI8Q 3DM1A 3P1HA 5C0XI 3TREA 5GAHC 3D6WA 1A3TA 1AZQA 1X9NA 4DXFA 1VMCA 1TVXA 4PMWA 3HOVG 1HZAA 2OCEA 2EZVA 1JR0D 1O7YA 1GUWA 4JI7Q 2A68C 2A6HC 2XWJB 3RLFA 4C3HG 3F2BA 2VZAA 5LL6X 1GKHA 4K8JA 1DCZA 4IUVA 2RVLA 3NK9A 5IYDG 4NXNL 3IRBA 3I90A 4YCUA 1E2WA 4Y7NB 1MSHA 1K3RA 1Q81C 4DV0Q 3M4YA 2KEEA 1Q7YC 3FKIG 5EJWA 3MXUA 1PDQA 3KDFB 3URYA 3A0JA 3HOWG 3VYTA 2JA7B 4K6DA 2R92B 3S16B 4OWXB 5I9PA 5C6AA 3AMUA 4MNOA 1I4XA 2E2DC 1SSOA 4AH6A 4EVOA 2E2HB 2VUMH 3H3VC 4DUZQ 3BYTB 2F3VA 3AYHB 1B1ZA 1L0XB 1HJPA 1BCPD 1HXYD 3QIAA 2ZXOA 5M5YH 1ONLA 4K5VA 4FNFA 3UE1A 3CCMA 3G7LA 1SJED 1WCMH 4K2LA 5LMUL 2R3ZA 3ND9A 2A69C 1HZCA 2BCOA 1R9TH 2NVQB 4P2CB 2VW9A 3VR6A 4UDUC 2ID0A 3N6RA 1G6PA 2F0GA 4LK1C 5C3EH 3RN2A 3OIQA 4JG2A 4LUZA 4KHPL 4QCLA 3HOYH 1LLRD 2PMZE 4CGYB 5C4JB 2A19A 1QVFA 1HCZA 3TBIB 1D7QA 2UU9L 3H94A 2VQFQ 1I94L 4PNYA 5AFWA 3CP0A 1I6HH 2B2WC 2FHTA 1WOCA 1X3EA 1IL2A 3PUVA 4BBSG 2A74C 5CR3A 5J1ZA 4DNIA 2A6EC 2IHFA 4A3FG 2ICIA 1NBWA 1BXTA 1N8RC 4A3JG 2JA6B 1K8MA 4FF3A 1SRUA 2KHIA 5M3MG 1XMQQ 3U9SA 4DAYB 4LAAA 2WKDA 4JW0A 4NB3A 1NUCA 4DR3L 1TWGH 1BCPB 3K0YA 1QB5D 1EYAA 1TY2A 4U68A 1HHVA 1BQQT 5E4XA 2MJ8A 1HR0Q 3NELA 2Q2HA 3TN2A 5FO8B 3GTJH 2Z6KA 1BUVT 3OYYA 2JA9A 2A73B 2JE6I 1ICFB 4DR4Q 4KD3A 2M9VA 2EE1A 2K5DA 1PRTC 4ILWA 2MP1A 3DXJC 1LTSD 2D9UA 4JC0A 2X6LA 1OXTA 1Y1WG 4IFDI 4OIJA 2UUAL 2K05A 3KFUA 1VQ4A 2JXMB 1B2TA 5DLQE 4BBRG 2E2JH 5T1GA 5C0XH 3DEPA 2LXKA 1JICA 1B50A 2KENA 1EWCA 1SNOA 4JOIA 4DV1Q 3DWQA 5TSSA 4FF1A 3T4AC 4B9XA 3KLSX 5GADC 4RA8A 1U4MA 2K7VA 4MTKA 5LMNW 3TS0A 5ISRA 4RKLA 4A3DH 1CQFA 1KNAA 2I5LX 1QUQA 2EDGA 4MIUA 3W2DA 2NWGA 1N33L 2PI2E 1W6KA 1E2ZA 4POFA 1R4PB 1K83H 2QGQA 3MXNB 5KNBA 2ZJQA 4P71A 3D8GA 4HIKA 1HNXQ 2EYLA 1PA6A 3OIPA 4ULLA 2AMCB 2EXDA 1BBUA 2Y0SB 4ZYSA 3KLSA 2ZXRA 1QZHA 3MA2B 1PZKD 3KLRA 4JI0Q 2NVTB 3GDEA 4C3JH 1FYCA 4XYOA 3CU7A 2A68D 2A6HD 2YU9H 1SYCA 1TY0A 2CHBD 3SXHA 2WAQE 2ZXPA 4UY8C 4BY1B 1EY7A 1MD2D 3MFGA 1TWFB 3MZ5A 1EWIA 2R7DA 1ILQA 2Z1CA 5LHY1 4ME3A 1S40A 4KD4A 1B7YB 2VXWA 3GO5A 4H13C 2IT1A 2JA5B 2SEBD 4BS9A 5IGEA 1PH6A 2EVBA 3S17H 1XPOA 4GOPB 4OO1G 3BG3A 4LF6L 3CAMA 4DNTB 2DY7A 2VQEL 4HCEA 3CCVA 3ER0A 3PO3H 1X55A 1TWCH 5IP7H 1G291 4C3IB 3J80c 4DN4M 3NPPA 2PQEA 5BR8L 1SE2A 1Y1VB 2K28A 1XJVA 2Q8RE 4KY6A 4DV3L 2ENBA 1UAPA 1A2UA 2OQ0A 1X32A 5C44G 3U4VA 1AH9A 4A3MG 2KCNA 1ENFA 2WP8J 1H9MA 3A54A 3VYUA 1FD7D 1SMYD 2E75C 3Q24A 1G2TA 1VQ5A 1XX8A 4CKCA 4CDEC 2B63H 4DK1A 2ZM6L 3A8KE 4GN4B 4CJ1B 4IUQA 3WOEA 4TSSA 2B8FA 2K5QA 4A93H 3ULPA 4LJZC 1PH2A 3C1EA 2HDLA 4PZ7A 4RGOS 1XNRL 3V05A 2RQXA 4KMUC 1NTGA 1CK1A 4RCNA 2ZTEA 1Q8KA 4IPHA 3I4NG 1H9KA 2PW7A 4OWWB 1NE3A 2XRQD 5G3LD 4UHVA 3UDIA 4B3RL 2IY5B 1EIHA 4P74A 3A7AB 4AQYL 3GTKH 5I6YA 2RCFA 4B3MQ 3JAMi 1DXMA 2E76C 3H6MA 2LY7A 3L7ZC 4HMIA 3GV3A 1QVGA 1LV9A 1C4QA 3AEVA 4JI5Q 1IBLQ 1XTCD 2JK8A 2F0FA 1TS3A 2JJQA 1OXUA 2TSSA 1N32Q 3HG9A 2CVRA 2RDGA 1TS2A 3NTIA 1JJCB 3J81c 1HFNA 2F0JA 1SNMA 3M4PA 4KJNA 1RTNA 3C46A 1YHBA 3RZOB 1I4HA 1XMOQ 4BY7H 1QWYA 1II3A 4EQPA 2HIVA 4Q5VA 3J7A5 1VQ8A 1HUMA 4KY7A 4LFAQ 2JA7G 2R92G 3PUZA 5IYCH 2F0PA 5FO7B 1WVLA 1FNVA 1KNEA 2NVXH 2G9DA 2IHEA 1EFID 1C7YA 1HZ9A 1EY5A 3NBIA 4JCVE 3Q22A 3DUZA 4PZ6A 1PHJA 2F03A 3A55A 3UDGA 2G9HD 4P72A 2E5LQ 1NR4A 4LF8Q 3QR8A 5CGKA 1JE4A 1BKBA 2I46A 2F0DA 2A8VA 2EY1A 1Q82C 4MHEA 3KUPA 2NTSA 1U0LA 1QILA 4X64L 5E4WC 1YNNC 1BOSA 1EY0A 1KQSA 5C5MA 3M7NA 2RHQB 1GVPA 1CI3M 2IPKD 3A8IE 4A3IB 1J5EQ 3GTPH 3Q6SA 5ELNA 3SVMA 2F0QA 1UUPA 4IOCA 3P20A 1W6JA 3I7FA 5FJ8G 1PZID 2Z6BA 5C4HA 2JA6G 4NMZA 4DR6Q 4A3GB 2B2VC 1S5CD 2AWNA 5EGTA 2F0UA 2F4VL 3CMEA 1AZPA 1LTLA 2E8GA 2OT2A 5M5XB 1SFOB 3UI2A 4HSVA 1RCVD 1JC7A 1ENAA 4AYBB 4CDDC 5CV8A 4X62L 4BBSB 4JBKA 3J81j 4GKJQ 4RAUC 5FLMH 1KLUD 2NN6I 4CKEA 1CKMA 4DV6Q 3RD4A 5JEAG 2JN4A 4OHJA 1I3QH 1CSQA 1L1OC 2XRSD 5F2DA 2AUKA 2HD3A 2K01A 1PYWD 1SAPA 2M2LA 4LF9Q 2F3IA 4LF4L 1EU3A 3DLLA 2KHJA 1MHWC 2WFWA 4BXXH 2KCCA 1M1KC 4V190 2K33A 1ICWA 4GNXB 3NBHA 3JC66 5EKKA 4JI6Q 5E7NA 3JAME 1Y1WB 1D6EC 3S2DB 3FRPB 1R4QB 4L5RC 2R7ZB 3CCEA 5C5LA 4GOPA 4J15A 1SNPA 1B3QA 2UUCQ 3A74A 4DR2L 4A3BB 2J4XA 1VQCA 3O13A 2C35B 1KABA 3GD7A 1W3SA 4HIMA 4YY3Q 2C9OA 3ERSX 3PGZA 4GLAC 1DM0B 2Y0SG 2F4IA 3T16A 4C2MH 1ESFA 1F2MA 2Q8IB 5ELBA 2K75A 5IWAL 2BH2A 2WACA 1A62A 4E6IA 4U673 3HOXH 4L5QA 2OWOA 5J3BA 3SGIA 1WTVA 2PZWA 4LW1A 3K7AH 3IAYA 4KN7C 4BY1G 4K14A 1S5ED 1A0IA 3OMGA 1V1PB 2PMZB 4EQNA 3CMAA 2IL8A 4A3CH 2LSSA 4JI4L 1VF5C 2A5HA 1QNUA 4L6TB 1X3QA 2JA5G 1VQEA 2EXZA 2VB3X 1GUGA 3TP5A 4JI2L 5CV7A 4PMCA 1I6HB 2MUYA 2OTJA 1K28A 3X3MA 3RLNA 3CCUA 4YHHL 4C3IG 3HOVH 2YTXA 4QJFA 4ZK9B 4GN3B 4C3HH 1Y1VG 5LMNQ 4GLXA 1QUQB 1FR3A 5JJZA 3SR1A 5IYDH 1YNND 4DK6C 2Z8LA 1K9MC 2Z9HA 3E0JA 3SDZA 3FKIH 4K5WA 2IJ0A 2MPMA 4H0LC 2B2WA 2X69A 2K14A 3HOWH 2EJMA 4R4QA 1V1QA 2Z4IA 1VQKA 4FDBA 4DV4L 5IP9G 2UXBQ 2RSNA 1KRSA 2KEDA 5I2YA 1AE3A 2L9HA 1B3AA 3BZCA 4QB4A 1CHPD 1PLFA 1EIGA 4A3KB 1HTLD 4NXNQ 3J7AF 2OEOA 1VQLA 3S14B 3NENA 1K73C 3LX0A 4HEDA 3F2DA 4G7ZC 4N8X1 4P73A 4EGVA 1BR9A 3S2HH 4QUCA 1EYCA 4O42A 1EIFA 3U4ZA 2B2YC 5HGQA 3T1HL 2L5TA 1C9OA 1NNXA 3W1BA 1TS5A 2BOSA 2B29A 3R2TA 3M7GA 2NB0A 2WAQB 2K5NA 5C3XA 5M5WB 1EQTA 1OXVA 1VQNA 3TSSA 3CXCA 4A3FH 2I5MX 2EPBA 5LMUQ 4C56C 4A3JH 3GTMB 4A3LG 4IUTA 5KYLA 4HJ8A 2FINB 3IL8A 5CV4A 5M3MH 4JPBW 1CHQD 3K7UC 2MNAA 3BU2A 1YJNA 3HKZE 4RGTA 1LTTD 1YIJA 3CC4A 1TWHH 4KHPQ 2UXDL 4DR7L 1O78A 3NEMA 4L5TA 1LT6D 3IFTA 1LO5D 3RZDH 4RFBA 1HTPA 4A3EB 1QNKA 4K8IA 2R7FA 2UU9Q 1I4QA 3I55A 2PNHA 5JEAJ 4K0KL 1YNJC 5K36G 1XYIA 4ODGA 3GTLB 1P16A 5CV5A 4OXPA 1B70B 3SK4A 4BBRH 1CUKA 3PV0A 2RBMA 3J7YW 3CC7A 3D6CA 1IBKL 4DR3Q 1ILPA 2QW7A 1ASZA 3J81i 1PH7A 2CW0C 5C4XB 3GTQB 1GUSA 2ZT9C 3CQZH 4B3SQ 2V1CC 2PO4A 4J6HA 4XQJA 3D4RA 1VQPA 4A3IG 1HZBA 1TKWB 4DV7L 2R93B 1EOTA 4GNXA 1GO3E 4DR5L 1PH5A 3K5MA 1STHA 3STBC 3CRLC 4A3GG 4NXML 2HQEA 3CC2A 4RMFA 1Z7TA 2E74C 2UUAQ 4OEMB 1CA5A 3R2IA 1SJHD 1HA6A 4YCVA 2RHSB 4AYBG 2VL6A 2HQLA 2H1EA 1X3FA 1C48A 2K52A 2ATWA 1WTOA 1A3UA 4NP5A 4DV5L 2V4DA 1J8IA 1HQMC 2XTIA 4DAMA 1G91A 1SN8A 2N55A 4OIKA 1PH3A 1L2FA 2FJ2A 1WD0A 2PQAB 5IIFA 1N33Q 4QQBX 2MHVA 5A2QE 2EY5A 4RHSA 5JAVA 1V1PA 2F0WA 3BZKA 3S1MH 5M3FH 3G6JB 1V1OA 3NTHA 1X54A 4F8MA 2AKWB 3TP6A 4OO1H 2Z4HA 3J80E 3K5OA 1HNWQ 4IJHA 3HEJA 2NVYH 1LTID 1JWSD 5KGUA 3FMCA 3I4LA 1KIXA 1LTRD 2CQAA 5EPJA 2R7ZG 3I4MB 3PUXA 2VS1A 1EIYB 1TIID 1U4RA 4ZUIA 1SXTA 4A3BG 1PTOC 2PPBC 4BY7B 2SNMA 1XNQL 4RHRA 3IKJA 4IO9A 2NBFA 3EN2A 1NCVA 4LFCL 5ELCA 2XVSA 3L3OC 5C4ZA 4HSPA 1ET6A 3U50C 5CBAE 4A3MH 3TEHB 4K5XA 3D3RA 1STEA 4G57A 3RR5A 3BYYB 3OTOL 4EQ5A 3K57A 2VQEQ 2GVBA 1P8LA 2L55A 4XDXA 4XYQA 4F87A 1DGSA 4HJAA 1QG7A 1KC8C 2EIFA 3H0GH 3S1RB 2JA8B 5IGDA 1E2VA 1NMFA 4L63B 1KD1C 2SDFA 2EYFA 5BR8Q 2HIXA 3HOYG 5KIXA 3I4NH 2C5CA 3WOFA 4DV3Q 3OW7A 3U9OA 1CT1D 1JB3A 1GOZA 4IUNA 1JCKB 3ONAB 1EZ8A 2HUGA 1EY6A 2LMCB 3FEWX 2AWOA 2ZM6Q 1IBMQ 2IX0A 4RG1A 4KKUA 1BCPF 4K2KA 4DV2L 2PI2A 3NBHB 4DXGA 2KA7A 4NKLA 2FMCA 3J81E 1HQRD 5DM63 1Z47A 2QDBA 1J6QA 4DAVA 2HDMA 1XNRQ 1EQVA 1D5XC 4X3SA 3I4OA 2QCPX 1PFSA 1F2ZA 4YWMA 3S24A 5IYBG 4Y7NH 3G4SA 5L37A 2CW0D 4FVMA 2A69D 4ZCKA 2JYOA 2JQOA 4DUYL 4B3RQ 2J7ZA 2NTTA 4ZQ3A 4IUPA 4AQYQ 5FLXL 2JA7H 4X66L 2R92H 3S16H 1SYEA 1I3QB 3NP8A 3S1NB 3STBD 2E2HH 3ERQA 2UXCL 1KAWA 4POGA 3V96A 3ZJYC 1HNXL 2B2VA 3MXGA 1N36L 4KJOA 2B2TA 3KYHC 3R8BA 2H4OA 1N34L 5JJIA 2L12A 4HTHA 3KBGA 5IT9L 1KAAA 4DPGA 1Q1EA 1JJGA 3P75A 1YVCA 5ELEA 4A3KG 3CPWA 1Y8NB 2A6ED 2HCIA 1FGUA 2F0TA 2NVQH 2O4XA 1N9WA 1PH9A 4H44C 1MBYA 5CV6A 2KHSA 1VQJA 1C8CA 3NSWA 5C4JH 1UE5A 2LKVA 3M4OB 2F0NA 2ASBA 1HNZL 1BO0A 3I56A 2DY8A 1KL9A 5LL6S 3G71A 3ZYYX 3BS1A 3RN5A 2ES2A 2WAQG 4GKKL 1D1KA 5ELFA 2QF7A 3ULLA 4YWKA 3KBXA 1PRTD 4DAPA 5FJ8H 3GP7A 2JA6H 1MIUA 2OF1A 1SROA 3DM3A 1STGA 1UNSA 1YEZA 2WKCA 4B3TQ 2DUDA 2B2UC 4NW2A 4QUFA 2AQ3B 1YHQA 1FNWA 1PTOD 1KTKA 2VB2X 4NPSA 4X64Q 2DN8A 1K0RA 3F1ZA 3T1YL 3A56A 4A3EG 5JEAH 1A3VA 2EY2A 1PH1A 1WTRA 3EA6A 3MFYA 4BWGB 2RDHA 3FPUB 1BBXC 1VDZA 1YITA 3WWVA 3FP9A 4DU9A 2RDFA 3BVGA 2N3SA 4I7ZC 2F4VQ 1TWAB 2PQAA 5IP7G 4FXGC 1VMPA 1WD1A 1H9RA 4JI3L 1AW7A 4LF5L 5C4XG 4X62Q 1F2LA 4HAEA 3Q0AA 4L8JA 1KDBA 1PRTB 1S5BD 1YJWA 4MTNA 1LABA 2R93G 1V43A 5JOBA 1RKNA 3RMHA 1EU4A 5T1IA 2PYKA 2CFMA 2X6GA 2F0HA 3NHHA 4LF4Q 1PTOB 1HFGA 1I50B 4UP9A 2M00A 4CDFC 2NVTH 3EVQA 3AFPA 3M4QA 3S15B 1YHAA 1FNUA 4IUUA 3KK7A 4OONA 4ZKCB 3M3YB 2ZJRA 4IJLA 5FK9C 3GTGB 4IFDG 4BY1H 1PFNA 3E3XA 4A75A 4LF7L 3E9HA 4N9PA 1TWFH 2RF4A 1XMOL 3VR3A 1K0SA 1WYDA 3NE5B 1VQBA 4IOAA 1JWUD 1IKLA 2F52A 1LYLA 3F8TA 4YWLA 3PUWA 4DR2Q 4H02A 4LUVA 1PYSB 3PSIA 1S3OA 1U4PA 4CJ2C 2JA5H 2XGTA 3EROA 3S1QB 2JP1A 1DYQA 3S2HB 5KNDA 4GZYC 5IWAQ 1ZXTA 2B39A 2PW5A 2CKZB 2R6GA 2PNRC 3E9IA 5AJ3L 3HOUB 3HOZB 1YI2A 4TQUS 2HHHL 1IW7C 1IL8A 2IWHA 1BVSA 3PO2B 1VQMA 2CWPA 5JPMC 3SK6A 1HRJA 3J7ZC 3I4MG 3T56B 3OWEB 5EBDA 3HKZB 4C3IH 2F0LA 2I5HA 1GHJA 3KF6B 3D4WA 4BY7G 4RGMA 1U5KA 4KKTA 1Y1VH 4XTCS 4HJ7A 1RDPD 1O7IA 2F0MA 2TMPA 4O1NA 4JI4Q 3FDTA 2ZJPA 1W2BA 1DD2A 1E0BA 1RD9D 1MJEA 2B2YA 3TZDA 5CYUA 2WIIB 4XXEA 4JI2Q 3C3LA 1AEXA 1I4PA 3K80C 1GHKA 2XWBB 4DF7A 3AFQA 4XQNA 3I2ZA 4YHHQ 5EAYA 1AE2A 5IP9H 1F9SA 3H3VH 2JA8G 2VUMB 1I5FA 4V0BA 3QB3A 5JPNC 1TS4A 1G6ZA 1SE8A 1UEAB 2FXQA 4KLKA 1GD7A 5M5YB 2H5XA 1E3PA 3NQTA 4IALA 4DNRB 4L5SA 1WCMB 3TP8A 3CRKC 4QIWE 2A1AA 2YV5A
chains in the Genus database with same CATH topology
3QWNA 1R9TB 5A35A 3OWFA 4WFN3 5C3EB 1L0YB 3HOYB 1U9RA 2KJXA 1Y69U 3A7LA 3H91A 4CHTB 3MVVA 1BCPC 1I4RA 1CQVA 1NR2A 5CC4A 1F9RA 2AQ2B 1G2SA 5M9OA 1LT5D 4WRDA 2YYZA 1TWGB 4UAIA 1S5FD 2K5WA 1OXXK 1SYDA 1HUNA 5K5PA 3GTJB 1EZ6A 3VYRA 5K36H 4F88A 3I70A 3K5NA 2O2LD 2K1BA 4KN4C 3NUCA 5KYIA 4M1UB 1STBA 1LT4D 5E1FA 4JBWA 2E2JB 1RJTA 2EYHA 2FMMA 2F0OA 1CTMA 2IX3A 1H9SB 3FPPA 2QEJC 3TZUA 4N9TA 3I73A 1Q8IA 2D62A 1KLGD 5J39A 1RODA 5C3WA 4A3DB 2F0KA 3V2TA 2PCFB 3R93A 1SNDA 4OO1I 1GJXA 3N52A 4R8IA 3OHXC 1K83B 1F2YA 1A6XA 3MC0B 1SE4A 3T51B 4KTAA 4XQQA 1GXDC 4C3JB 1ZYRC 1SNCA 3JAML 3MAQA 2YU9B 3H09A 4KKSA 1STAA 2FFKB 4DK0A 4KHVA 2SNSA 1QOHA 4M8AA 1TT2A 5BN5A 1AFPA 1S4ZA 3NXWA 4ABNA 1GUTA 4XT1B 5CMDA 2L0CA 4C1NI 4QMGA 2JEBI 5IODA 1EY4A 3S17B 1QJOA 2J0TD 1SDFA 3BDLA 2BE5C 3BDOA 2EYMA 5D3IB 3PO3B 1S5DD 1TWCB 5IOCA 5DM73 1O7LA 4B08A 4ZRZA 2NN6G 2F0IA 1EL0A 1SE3A 1MSGA 4QF4A 3BZDB 3LWUA 3BDCA 2B63B 1M4VA 1LT3D 4X3UA 2AUJD 1M8AA 3CKIB 3C1FA 3TMEA 1D2BA 2K6AA 3X3NA 4IURA 1QE6A 4A93B 3NTKA 4FF2A 5FLXE 3QJYA 2XNAC 4I65A 1VCIA 2MGSA 1WTXA 2R61A 4S3SA 1SMYC 3HGBA 2XIWA 3T53B 2F0VA 5IT9E 2XSCA 1F9PA 3GTKB 3PUYA 1XXGA 1ENCA 2QILA 4G4KA 2EJGC 5CV9A 3K6OA 1SNQA 3AU7A 2KVMA 1DONA 1GUNA 4KK7A 4LMQD 3K59A 1BDOA 4HMJA 1ZEQX 2LFNA 1T5XD 3I3CA 3HS0C 2NZ1D 5DEHA 2N88A 4R9WA 5CBEE 5JVG3 1V8QA 4OGQC 4CBVA 2EY6A 2NVXB 4R8NA 2EYOA 1CFMA 2B2UA 4ZLTF 1DZ1A 4PQXA 1IYUA 5EBCA 4EQOA 3VR5A 4TRDA 1I6VC 1ZYRD 4ZKBB 1O7ZA 4YIJA 5NUCA 1B44D 1ZKOA 3VA7A 3QOJA 4IQZA 2K04A 2XN9C 4XT3B 1PZJD 2EYJA 3P7JA 1D5ZC 1IHZA 4IN3A 3CHBD 4PV1C 3SE0A 5IGBA 3GTPB 1YNJD 3ITPA 1H9SA 4KI0A 4FXDA 3F2UA 4BA2I 1RF2D 4IZ8A 3Q23A 2BE5D 1RHPA 2PZTA 1XWEA 2JEAI 3SHLA 5KRUA 1NSNS 1B9MA 5COYA 1EY8A 2DNCA 5EPLA 2IW3A 4FYDA 3IFDA 5EQ0A 3E6ZX 4CKBA 1CA6A 3MEHA 5I2XA 1LTGD 3ND8A 4ZUJA 3BVZA 3M85A 5D65A 5C0XG 1EY9A 4J1MA 1Q12A 2OXPA 1J9OA 2F3WA 1U4LA 5KNCA 1Q90A 5EKLA 4WORA 3GQBA 3MWYW 2SOBA 4G7HC 1MGSA 5A2QL 1NAPA 4F7XA 3WDNA 4NDXA 4C2MB 4JK1C 1DOLA 3J80L 2B8GA 4C3JG 1JOKA 4IFDH 5IGFA 4QIWB 2JSOA 3HOXB 5BN3A 1F77A 3K7AB 2BDOA 5FOBB 3OPOA 3EFXD 1Q3LA 1DJRD 3J7AV 4FF4A 1Z6HA 1PXUA 4HN7A 2WB1B 2K32A 5IGCA 3PIO3 2RA4A 3OOCA 3DWPA 5IGGA 1DOKA 4J8QA 1TQOA 1WTPA 3EJIA 5FKAC 3HOVB 3GV6A 5I4DA 1Q1BA 3VA5A 2RKSA 3NQIA 4C3HB 1B9NA 2NYZD 1OO9B 4HR7B 1JWMD 1KDCA 4XIGS 3DMUA 1D1IA 1BNZA 4DAYA 4DFAA 2ICEC 1ML0D 5J22A 1ESRA 3FKIB 1LTBD 5HGTA 3TDQA 1B53A 3HRZC 3HOWB 1IYVA 3S9WA 3J81L 3PMFA 1PMRA 2F0SA 2PZUA 1SYBA 4HCSA 3LNNA 5EPKA 3R3OA 5E3FA 4CJ0B 1QCBD 3RUZA 4RGNA 5KEEA 4ZAIA 1CZWA 3DHQA 3K5LA 3L9AX 3I72A 1PFMA 1SBBB 1RTOA 1O80A 1TU2B 1Y8OB 4KY5A 3QG1A 3W3AA 5I9OA 2B2TC 2I07B 4X3TA 2BA1A 4B9WA 4DGZA 3MXNA 4RH6A 3VR4A 4BA1I 4OL7A 4A3FB 2EOTA 4A3JB 1CM9A 1SYGA 3HP3A 3MTSA 1JOQA 5M3MB 1D5MC 5G3LF 1OXSC 4ME5A 3MXPA 4RWSC 3TP7A 1AN8A 3SEBA 3VR2A 1F9QA 1TWHB 1STYA 1G8ZD 1HA5A 3QOLA 1PRTF 3I91A 1B4OA 2KQ3A 3RZDB 1LTAD 3K58A 3D4DA 3I8ZA 2EYPA 2EJFC 1PFBA 3DWAA 1HPCA 1DOMA 1STNA 1PTOF 2O5JC 5D14A 5BN4A 4BBRB 4FP5D 1FGBD 5C0XJ 2L4NA 4G7OC 1KDAA 2WV6D 1BF4A 5DAUA 4PMBA 1WTWA 4TKOB 3CQZB 3OMCA 3HZXA 3EQLC 1AP0A 2IX1A 1LACA 4MN3A 1EWHA 4FXKC 4RKBA 3OSOA 4K6LA 1ET9A 2L1BA 1SEBD 4WJWA 2L11A 1IKMA 5D3DA 2HCCA 2K03A 5CORA 3DEOA 4Q0FA 2WINB 1WTQA 2BA0A 3BVMA 3T13A 2QKIC 3PIP3 2LS01 3SK5A 3FVQA 1EYDA 2Q8TA 1TR5A 1I4GA 3E5SA 1JQYD 1A2TA 3S1MB 5M3FB 3LWEA 3AB9A 3QO2A 4Z9CB 1CZGA 5JVH3 2NVYB 1EEID 2O5IC 1MI2A 3A8JE 4KV6A 2KUMA 4FO2A 1PTOH 1SYFA 3NWSA 3GTOB 2GA4B 1Y8PB 1A15A 3NWTA 2NN6H 5I6WA 1H9JA 2F1MA 5C44B 3KF8A 3C2PA 4RCOA 4A3MB 4ID6A 2D5DA 2KOLA 3MHBA 1IW7D 1VF7A 2KECA 4H7BA 2AQ1B 2D2CC 5ELDA 1K8OA 1X3PA 5DNFA 1T5EA 5FO9B 1EEFD 3H0GB 4X3KA 2VNUD 3D31A 2RSOA 2BDNA 5HURA 4KHZA 4IFDJ 2F0EA 4DA2A 5EKIA 3SK8A 3I4NB 1JOOA 3VYSA 2NUCA 2E2IB 2DNEA 4C1NK 1JORA 1GUOA 5C0XI 3DM1A 3P1HA 3D6WA 1A3TA 1AZQA 4DXFA 1VMCA 1TVXA 4PMWA 2EZVA 1JR0D 1O7YA 1GUWA 2A68C 2A6HC 2XWJB 3RLFA 4C3HG 5LL6X 4K8JA 1DCZA 4IUVA 2RVLA 3NK9A 3I90A 1E2WA 4Y7NB 1MSHA 3M4YA 2KEEA 5EJWA 3MXUA 1PDQA 3URYA 3VYTA 2JA7B 4K6DA 2R92B 3S16B 5I9PA 5C6AA 3AMUA 1I4XA 2E2DC 1SSOA 4EVOA 2E2HB 3H3VC 3BYTB 2F3VA 1B1ZA 1L0XB 1BCPD 1HXYD 3QIAA 2ZXOA 1ONLA 4K5VA 4FNFA 3G7LA 1SJED 4K2LA 2R3ZA 3ND9A 2A69C 2BCOA 2NVQB 4P2CB 3VR6A 4UDUC 2ID0A 3N6RA 2F0GA 4LK1C 3OIQA 4QCLA 1LLRD 4CGYB 5C4JB 1HCZA 3TBIB 3H94A 4PNYA 5AFWA 2B2WC 2FHTA 3PUVA 2A74C 5CR3A 5J1ZA 2A6EC 2ICIA 1BXTA 2JA6B 1K8MA 4FF3A 3U9SA 4LAAA 2WKDA 1NUCA 1BCPB 3K0YA 1QB5D 1EYAA 1TY2A 4U68A 1HHVA 1BQQT 5E4XA 2MJ8A 3TN2A 5FO8B 1BUVT 2A73B 2JE6I 4KD3A 2M9VA 2EE1A 2K5DA 1PRTC 4ILWA 2MP1A 3DXJC 1LTSD 2D9UA 2X6LA 1OXTA 4IFDI 4OIJA 2K05A 2JXMB 1B2TA 5T1GA 5C0XH 3DEPA 1JICA 1B50A 1EWCA 1SNOA 3DWQA 5TSSA 4FF1A 3T4AC 4B9XA 3KLSX 4RA8A 1U4MA 2K7VA 5ISRA 4RKLA 1CQFA 1KNAA 2EDGA 4MIUA 3W2DA 2NWGA 1W6KA 1E2ZA 1R4PB 5KNBA 3D8GA 2EYLA 3OIPA 4ULLA 2Y0SB 4ZYSA 3KLSA 2ZXRA 3MA2B 1PZKD 3KLRA 2NVTB 1FYCA 4XYOA 3CU7A 2A68D 2A6HD 1SYCA 1TY0A 2CHBD 3SXHA 2ZXPA 4BY1B 1EY7A 1MD2D 3MFGA 1TWFB 3MZ5A 1ILQA 2Z1CA 5LHY1 4KD4A 2VXWA 3GO5A 4H13C 2IT1A 2JA5B 2SEBD 4BS9A 5IGEA 2EVBA 4OO1G 3BG3A 4DNTB 2DY7A 4HCEA 1G291 4C3IB 4DN4M 3NPPA 2PQEA 1SE2A 1Y1VB 2K28A 2Q8RE 4KY6A 2ENBA 1UAPA 1A2UA 1X32A 2KCNA 1ENFA 2WP8J 1H9MA 3A54A 3VYUA 1FD7D 1SMYD 2E75C 3Q24A 1G2TA 1XX8A 4CKCA 4DK1A 3A8KE 4CJ1B 4IUQA 3WOEA 4TSSA 2B8FA 2K5QA 4LJZC 3C1EA 2HDLA 4RGOS 3V05A 2RQXA 4KMUC 4RCNA 1CK1A 1H9KA 2PW7A 2XRQD 5G3LD 1EIHA 3A7AB 5I6YA 1DXMA 2E76C 3H6MA 2LY7A 3L7ZC 4HMIA 3GV3A 1LV9A 1C4QA 1XTCD 2F0FA 1TS3A 1OXUA 2TSSA 3HG9A 2CVRA 2RDGA 1TS2A 3NTIA 1HFNA 2F0JA 1SNMA 4KJNA 1RTNA 3C46A 3RZOB 1I4HA 1QWYA 1II3A 4EQPA 4Q5VA 1HUMA 4KY7A 3PUZA 2F0PA 5FO7B 1WVLA 1FNVA 1KNEA 2G9DA 1EFID 1EY5A 3NBIA 3Q22A 3DUZA 2F03A 3A55A 2G9HD 1NR4A 5CGKA 1JE4A 2I46A 2F0DA 2EY1A 4MHEA 3KUPA 2NTSA 1QILA 5E4WC 1YNNC 1BOSA 1EY0A 3M7NA 5C5MA 1CI3M 2IPKD 3A8IE 4A3IB 3Q6SA 3SVMA 2F0QA 1UUPA 3P20A 1W6JA 1PZID 5C4HA 4NMZA 4A3GB 2B2VC 1S5CD 2AWNA 5EGTA 2F0UA 1AZPA 2OT2A 5M5XB 1SFOB 3UI2A 4HSVA 1RCVD 1JC7A 1ENAA 4AYBB 5CV8A 4BBSB 4RAUC 1KLUD 2NN6I 4CKEA 3RD4A 5JEAG 4OHJA 2XRSD 5F2DA 2AUKA 2K01A 1PYWD 1SAPA 2M2LA 1EU3A 2KCCA 4V190 2K33A 1ICWA 3NBHA 5EKKA 3JAME 1Y1WB 1D6EC 3S2DB 3FRPB 1R4QB 2R7ZB 5C5LA 1SNPA 4A3BB 2J4XA 3O13A 1KABA 3GD7A 2C9OA 1DM0B 2F4IA 3T16A 1ESFA 1F2MA 2Q8IB 5ELBA 2WACA 4E6IA 4U673 1WTVA 2PZWA 3IAYA 4KN7C 4K14A 1S5ED 3OMGA 1V1PB 2PMZB 4EQNA 2IL8A 1VF5C 2A5HA 1QNUA 4L6TB 1X3QA 2EXZA 2VB3X 1GUGA 3TP5A 5CV7A 4PMCA 1I6HB 2MUYA 3X3MA 4C3IG 4ZK9B 1FR3A 5JJZA 3SR1A 1YNND 2Z8LA 3E0JA 3SDZA 4K5WA 2IJ0A 2MPMA 4H0LC 2B2WA 2X69A 2EJMA 2Z4IA 2RSNA 2KEDA 5I2YA 2L9HA 1B3AA 4QB4A 1CHPD 1PLFA 1EIGA 4A3KB 1HTLD 3J7AF 2OEOA 3S14B 3LX0A 4HEDA 4G7ZC 4EGVA 1BR9A 4QUCA 1EYCA 4O42A 2B2YC 2L5TA 1TS5A 2BOSA 3R2TA 3M7GA 2NB0A 2WAQB 5C3XA 5M5WB 1EQTA 1OXVA 3TSSA 2EPBA 4C56C 3GTMB 4IUTA 5KYLA 2FINB 3IL8A 5CV4A 1CHQD 4RGTA 1LTTD 1O78A 1LT6D 3IFTA 1LO5D 4RFBA 1HTPA 4A3EB 1QNKA 4K8IA 1I4QA 5JEAJ 1YNJC 5K36G 1XYIA 4ODGA 3GTLB 5CV5A 3SK4A 3PV0A 2RBMA 3J7YW 3D6CA 1ILPA 2CW0C 5C4XB 3GTQB 1GUSA 2ZT9C 2PO4A 4J6HA 4XQJA 3D4RA 1TKWB 2R93B 1EOTA 3K5MA 1STHA 3CRLC 2HQEA 1Z7TA 2E74C 1CA5A 3R2IA 1SJHD 1HA6A 2H1EA 1C48A 1WTOA 1A3UA 4NP5A 2V4DA 1J8IA 1HQMC 1G91A 2N55A 4OIKA 2FJ2A 1WD0A 5IIFA 2MHVA 5A2QE 2EY5A 4RHSA 5JAVA 1V1PA 2F0WA 3G6JB 1V1OA 3NTHA 4F8MA 3TP6A 4OO1H 2Z4HA 3J80E 3K5OA 3HEJA 1JWSD 1LTID 5KGUA 3FMCA 3I4LA 1LTRD 2CQAA 5EPJA 3I4MB 3PUXA 1TIID 1U4RA 4ZUIA 1SXTA 1PTOC 2PPBC 4BY7B 2SNMA 4RHRA 3IKJA 2NBFA 1NCVA 5ELCA 2XVSA 3L3OC 5C4ZA 4HSPA 1ET6A 5CBAE 4K5XA 3D3RA 1STEA 4G57A 3BYYB 3K57A 2L55A 4XDXA 4XYQA 4F87A 1QG7A 3S1RB 2JA8B 5IGDA 1E2VA 4L63B 2SDFA 2EYFA 5KIXA 2C5CA 3WOFA 3OW7A 3U9OA 1CT1D 1JB3A 1GOZA 4IUNA 1JCKB 3ONAB 1EZ8A 2HUGA 1EY6A 2LMCB 3FEWX 2AWOA 2IX0A 4KKUA 1BCPF 4K2KA 4DXGA 2KA7A 4NKLA 2FMCA 3J81E 1HQRD 5DM63 1Z47A 2QDBA 4DAVA 2HDMA 1EQVA 1D5XC 4X3SA 2QCPX 1F2ZA 2CW0D 4FVMA 2A69D 2JYOA 2J7ZA 2NTTA 4ZQ3A 4IUPA 5FLXL 1SYEA 1I3QB 3NP8A 3S1NB 3ERQA 3V96A 2B2VA 3MXGA 4KJOA 2B2TA 3R8BA 2H4OA 2L12A 4HTHA 3KBGA 5IT9L 1KAAA 1Q1EA 3P75A 5ELEA 1Y8NB 2A6ED 2HCIA 2F0TA 2O4XA 4H44C 1MBYA 5CV6A 2KHSA 1C8CA 3NSWA 2LKVA 3M4OB 2F0NA 1BO0A 2DY8A 5LL6S 3ZYYX 3BS1A 1D1KA 5ELFA 2QF7A 3KBXA 4DAPA 1PRTD 3GP7A 2OF1A 1STGA 1UNSA 2WKCA 2B2UC 4NW2A 4QUFA 2AQ3B 1FNWA 1PTOD 1KTKA 2VB2X 2DN8A 3A56A 5JEAH 1A3VA 2EY2A 1WTRA 3EA6A 3MFYA 4BWGB 2RDHA 3FPUB 1BBXC 1VDZA 4DU9A 2RDFA 3BVGA 4I7ZC 1TWAB 4FXGC 1VMPA 1WD1A 1H9RA 1AW7A 3Q0AA 1F2LA 4HAEA 4L8JA 1KDBA 1PRTB 1S5BD 1LABA 1V43A 5JOBA 1RKNA 3RMHA 1EU4A 5T1IA 2PYKA 2X6GA 2F0HA 3NHHA 1PTOB 1HFGA 1I50B 2M00A 3EVQA 3S15B 1FNUA 4IUUA 3KK7A 4ZKCB 3M3YB 5FK9C 3GTGB 4IFDG 1PFNA 4N9PA 3VR3A 3NE5B 1JWUD 1IKLA 3PUWA 1U4PA 4CJ2C 3EROA 3S1QB 2JP1A 1DYQA 3S2HB 5KNDA 4GZYC 1ZXTA 2B39A 2PW5A 2R6GA 3HOUB 2PNRC 3HOZB 4TQUS 1IW7C 1IL8A 2IWHA 3PO2B 5JPMC 3SK6A 1HRJA 3T56B 3OWEB 5EBDA 3HKZB 2F0LA 1GHJA 3D4WA 4RGMA 4KKTA 4XTCS 1RDPD 2F0MA 2TMPA 4O1NA 3FDTA 1DD2A 1E0BA 1RD9D 2B2YA 3TZDA 5CYUA 2WIIB 4XXEA 3C3LA 1AEXA 1I4PA 1GHKA 2XWBB 4DF7A 4XQNA 1F9SA 2VUMB 4V0BA 3QB3A 5JPNC 1TS4A 1G6ZA 1UEAB 5M5YB 3NQTA 4IALA 4DNRB 1WCMB 3TP8A 3CRKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYP A;  2F0T A;  3VA5 A;  3EVQ A;  1ENC A;  2O4X A;  2RKS A;  3H6M A;  4HMI A;  1SNC A;  3OWF A;  2F0G A;  1EY8 A;  5C4Z A;  1STN A;  1SYC A;  5CV9 A;  4ODG A;  2KHS A;  5CV6 A;  5CV5 A;  5F2D A;  1KDC A;  3SXH A;  1SNQ A;  4ID6 A;  1STA A;  2F0F A;  5I6W A;  4K5X A;  4KHV A;  1U9R A;  2LKV A;  3DMU A;  1EY7 A;  3MHB A;  3SK4 A;  3SR1 A;  4G57 A;  2F0N A;  2SNS A;  4DFA A;  2RBM A;  3MVV A;  4H7B A;  4N9P A;  3MEH A;  3D6C A;  3MZ5 A;  5J22 A;  1KDA A;  4HMJ A;  4PNY A;  4ZUJ A;  5CC4 A;  1TT2 A;  4K5W A;  2F0J A;  1SNM A;  5DAU A;  4KJN A;  5HGT A;  1EY9 A;  4PMB A;  3NXW A;  5CR3 A;  4J1M A;  5J1Z A;  3OMC A;  3S9W A;  1II3 A;  3PMF A;  4KD4 A;  4J6H A;  3HZX A;  4EQP A;  2F0S A;  2OXP A;  5DEH A;  4QMG A;  2F3W A;  5IGD A;  5IOD A;  3ERO A;  4KY7 A;  2PZU A;  1SYB A;  1EY4 A;  2EYF A;  2OF1 A;  5EKK A;  5EKL A;  5HUR A;  5IGE A;  5M9O A;  2F0E A;  4WOR A;  4WRD A;  2PW5 A;  5KIX A;  3SK8 A;  2F0P A;  1STG A;  1JOO A;  2EY6 A;  4LAA A;  1STH A;  3BDL A;  4RKB A;  3OSO A;  1NUC A;  2SOB A;  3TP7 A;  4R8N A;  3U9O A;  2EYO A;  3R3O A;  2HQE A;  2NUC A;  5E3F A;  1EYA A;  5C5L A;  3RUZ A;  4QB4 A;  1SNP A;  4IUN A;  2EYM A;  1EY5 A;  1EZ8 A;  3SK6 A;  1JOR A;  1EY6 A;  5IOC A;  5KEE A;  4F7X A;  1SYD A;  1KAB A;  5K5P A;  4EQO A;  3P1H A;  2F0L A;  1EZ6 A;  1A3T A;  4TRD A;  2OEO A;  3D4W A;  3DHQ A;  4NDX A;  2PQE A;  3T16 A;  1A3V A;  1F2M A;  3LX0 A;  4K2K A;  2EY2 A;  4KD3 A;  4YIJ A;  5NUC A;  2F0I A;  4NKL A;  1A3U A;  4NP5 A;  2WAC A;  3T13 A;  4E6I A;  3QOJ A;  4KY6 A;  5CGK A;  2F0M A;  1JOK A;  3NUC A;  2ENB A;  4KY5 A;  4QF4 A;  5IGF A;  5KYI A;  1A2U A;  2QDB A;  5I9O A;  1EYC A;  4K8J A;  2F0D A;  2EY1 A;  1STB A;  2PZW A;  3BDC A;  2EYJ A;  3SK5 A;  1EQV A;  5E1F A;  4DU9 A;  2RDF A;  3NK9 A;  4B9W A;  4K14 A;  1EYD A;  1IHZ A;  5IIF A;  1F2Z A;  4DGZ A;  1EY0 A;  5C5M A;  1TR5 A;  2EYH A;  3OMG A;  2EY5 A;  4EQN A;  3C1F A;  5C3X A;  2F0O A;  3E5S A;  1SNO A;  1AEX A;  3TME A;  5JAV A;  4OL7 A;  2F0W A;  5IGB A;  1A2T A;  4DF7 A;  4ZQ3 A;  4N9T A;  4B9X A;  3ITP A;  1SYG A;  5KYL A;  2F0Q A;  1KDB A;  4K6D A;  3C1E A;  5CV4 A;  4RKL A;  5ISR A;  5J39 A;  1SYE A;  1JOQ A;  5I9P A;  5C3W A;  2F0K A;  3NP8 A;  4F8M A;  5C4H A;  5C6A A;  4EVO A;  4NMZ A;  3TP6 A;  3V2T A;  3ERQ A;  4ME5 A;  3MXP A;  3QB3 A;  4IZ8 A;  2EXZ A;  5JOB A;  4MIU A;  1RKN A;  4I65 A;  3HEJ A;  5EGT A;  2F3V A;  3TP5 A;  2F0U A;  2PZT A;  1SND A;  5IGC A;  1STY A;  4KJO A;  5KGU A;  2PYK A;  2PW7 A;  3QOL A;  1F2Y A;  2F0H A;  4KV6 A;  4S3S A;  3NQT A;  4K5V A;  4IAL A;  3D8G A;  4HTH A;  1KAA A;  5IGG A;  3NHH A;  4PMC A;  4K2L A;  5CV7 A;  2KQ3 A;  3SHL A;  2EYL A;  2F0V A;  1SYF A;  3P75 A;  1TQO A;  1ENA A;  4KTA A;  4ZUI A;  3TP8 A;  3EJI A;  5CV8 A;  4K8I A;  5KRU A;  5I6Y A;  2SNM A;  3D4D A;  2M00 A;  1NSN S; 
#chains in the Genus database with same CATH topology
 3QWN A;  1R9T B;  2MQH A;  1WFQ A;  5A35 A;  3OWF A;  1PVO A;  1LUZ A;  4WFN 3;  5C3E B;  2P5Z X;  1L0Y B;  3HOY B;  1WJJ A;  1U9R A;  4TVA B;  2KJX A;  3RNU A;  1Y69 U;  3A7L A;  3H91 A;  4CHT B;  3MVV A;  1BCP C;  1I4R A;  4X65 L;  1CQV A;  1NR2 A;  2WB1 E;  5CC4 A;  3W1G A;  1A8V A;  1F9R A;  2AQ2 B;  4A3L H;  2VY3 A;  3RZO H;  1G2S A;  3L0O A;  1JMC A;  3A5Z B;  5M9O A;  1MJC A;  1LT5 D;  3FHW A;  4WRD A;  2YYZ A;  1QZG A;  1TWG B;  4UAI A;  1S5F D;  2K5W A;  1JB7 A;  4YY3 L;  4OX9 L;  1KHI A;  3T1H Q;  1OXX K;  1SYD A;  1HUN A;  5K5P A;  3GTJ B;  1EZ6 A;  2CH4 A;  1WI5 A;  3VYR A;  5K36 H;  4F88 A;  3I70 A;  3K5N A;  2O2L D;  4JV5 L;  2K1B A;  4KN4 C;  3CF5 A;  3NUC A;  5KYI A;  4M1U B;  1STB A;  1LT4 D;  5E1F A;  4JBW A;  3UDF A;  2E2J B;  1RJT A;  2EYH A;  2UXD Q;  2FMM A;  1CSP A;  2F0O A;  1CTM A;  2IX3 A;  1K8A C;  1H9S B;  3CW2 C;  3FPP A;  4JI1 L;  4A3I H;  2QEJ C;  3TZU A;  4N9T A;  3I73 A;  1Q8I A;  3J80 i;  2D62 A;  1KLG D;  5J39 A;  1ROD A;  5C3W A;  4A3D B;  2F0K A;  4K0K Q;  3PF5 A;  3V2T A;  4A3G H;  2PCF B;  3R93 A;  1SND A;  2MO0 A;  4HJ5 A;  4OO1 I;  4OEL B;  1GJX A;  3N52 A;  4R8I A;  3OHX C;  5IE8 A;  1K83 B;  5M5X H;  1F2Y A;  2ALY B;  1SFO H;  3MC0 B;  1VQ7 A;  1SE4 A;  1A6X A;  1L0W A;  2MO1 A;  3T51 B;  4KTA A;  4XQQ A;  4GS3 A;  4DKA C;  2BH8 A;  1IBK Q;  4BBS H;  1GXD C;  4C3J B;  1EOV A;  1ZYR C;  1IYJ B;  1SNC A;  4P75 A;  3JAM L;  3MAQ A;  2YU9 B;  4DR1 L;  2UUB L;  1SLJ A;  3H09 A;  4AYB E;  3K8A A;  4KKS A;  2B3G A;  1STA A;  1UEB A;  2FFK B;  4DK0 A;  4KHV A;  4DV7 Q;  1YZ6 A;  1E1T A;  3BJU A;  3TQY A;  2SNS A;  3E0E A;  4DR5 Q;  1QOH A;  4M8A A;  2N8N A;  5GAE C;  1TT2 A;  5BN5 A;  1AFP A;  2K5H A;  1S4Z A;  1VQG A;  3NXW A;  4ABN A;  1I94 Q;  1GUT A;  3KLW A;  4XT1 B;  5CMD A;  2L0C A;  2UXB L;  4IPC A;  4C1N I;  4QMG A;  2JEB I;  2HT1 A;  5IOD A;  1L1O B;  1EY4 A;  1X6O A;  3S17 B;  1QJO A;  2J0T D;  1Y1W H;  1RL2 A;  1FJG L;  4DV5 Q;  2K4K A;  3S2D H;  1SDF A;  3BDL A;  1S72 A;  4JYA L;  2Q2U A;  2R7Z H;  2BE5 C;  3BDO A;  3A5U A;  1EYG A;  1JE5 A;  3U58 A;  2EYM A;  5D3I B;  3PO3 B;  1S5D D;  4A3B H;  1TWC B;  4LFB L;  5IOC A;  1VQD A;  5DM7 3;  2DGY A;  3L2P A;  1B8A A;  1O7L A;  4B08 A;  1K8G A;  4ZRZ A;  1KXL A;  1PH8 A;  2NN6 G;  3KF6 A;  2F0I A;  4CDC C;  1EL0 A;  1SE3 A;  1MSG A;  4QF4 A;  3BZD B;  3LWU A;  1BBW A;  3BDC A;  3CCL A;  4JI8 L;  2B63 B;  1M4V A;  1LT3 D;  4X3U A;  2AUJ D;  1M8A A;  3CKI B;  3C1F A;  3TME A;  1D2B A;  2K6A A;  3X3N A;  4IUR A;  1QE6 A;  4JI7 L;  4A93 B;  3KJO A;  3NTK A;  4OWT B;  1XNQ Q;  1YBY A;  4FF2 A;  5FLX E;  1H95 A;  3QJY A;  2XNA C;  4LFC Q;  4I65 A;  1VCI A;  2MGS A;  3UDX A;  1WTX A;  3HOZ G;  3HOU G;  2R61 A;  4DV0 L;  4S3S A;  1SMY C;  3HGB A;  1VQA A;  2XIW A;  3T53 B;  2F0V A;  3PO2 G;  3OTO Q;  5IT9 E;  2XSC A;  1F9P A;  3GTK B;  3PUY A;  3HKZ G;  5IY0 A;  5H1S E;  1XXG A;  1ENC A;  4O0A A;  1Z9F A;  2QIL A;  3AQQ A;  4DUZ L;  2MFI A;  2EJG C;  4G4K A;  5CV9 A;  2QEX A;  3K6O A;  1K3B C;  1SNQ A;  3AU7 A;  4IPG A;  2KVM A;  1DON A;  1RIP A;  1GUN A;  4KK7 A;  5IYB H;  3H15 A;  4LMQ D;  3K59 A;  1UWV A;  4B3S L;  1YNX A;  1BDO A;  4HMJ A;  1EFW A;  1ZEQ X;  2LFN A;  1T5X D;  3GTO H;  1IZ6 A;  3I3C A;  3HS0 C;  2NZ1 D;  2LXJ A;  2N88 A;  5DEH A;  4LUO A;  4R9W A;  5CBE E;  5JVG 3;  2K5V A;  5C44 H;  4DV2 Q;  1V8Q A;  4OGQ C;  4CBV A;  2EY6 A;  1NJI C;  2VUM G;  2VQF L;  2NVX B;  1PV4 A;  4R8N A;  2EYO A;  4UP7 A;  1CFM A;  2B2U A;  1OTC A;  4ZLT F;  4A3K H;  4LF6 Q;  1DZ1 A;  4PQX A;  1IYU A;  1T9H A;  5EBC A;  4EQO A;  1WCM G;  3VR5 A;  4TRD A;  1I6V C;  5ELO A;  1E22 A;  1ZYR D;  4ZKB B;  1O7Z A;  3S14 H;  4YIJ A;  5NUC A;  2KBN A;  1B44 D;  1XMQ L;  1ZKO A;  4DUY Q;  3VA7 A;  3QOJ A;  4IQZ A;  2K04 A;  1VQH A;  2XN9 C;  2CCZ A;  5C3E G;  4R4T A;  4X66 Q;  4XT3 B;  1PZJ D;  2EYJ A;  3P7J A;  1HR0 L;  2UXC Q;  1D5Z C;  1IHZ A;  2E2I H;  1UE1 A;  1N36 Q;  4IN3 A;  5FLX c;  1N34 Q;  4DR4 L;  5M5W H;  5GAG C;  2NZO A;  3CHB D;  4PV1 C;  1EQQ A;  3SE0 A;  5IGB A;  4A4I A;  3GTP B;  1YNJ D;  3GTM H;  3ITP A;  1H9S A;  1HNW L;  4KI0 A;  4FXD A;  3F2U A;  4HJ9 A;  4BA2 I;  1RF2 D;  4IZ8 A;  5IT9 c;  2BE5 D;  3Q23 A;  1RHP A;  3D0F A;  2PZT A;  1XWE A;  2JEA I;  1ASY A;  4R4O A;  4DV1 L;  3SHL A;  1X3G A;  1HNZ Q;  1SMX A;  4A3E H;  1FVI A;  2OQK A;  5KRU A;  1KRT A;  1NSN S;  1PYB A;  1B9M A;  5M3F G;  3MEF A;  5COY A;  3KOJ A;  1EY8 A;  3PF4 A;  4GKK Q;  1VQF A;  2CH4 W;  2DNC A;  4GNX C;  4AIM A;  3GTL H;  5EPL A;  1EQR A;  2IW3 A;  3W5O A;  4FYD A;  3PIO A;  3IFD A;  4PZ8 A;  5EQ0 A;  3E6Z X;  4CKB A;  5HY6 A;  1CA6 A;  3MEH A;  5I2X A;  1LTG D;  3ND8 A;  1CKN B;  4ZUJ A;  1X65 A;  1PH4 A;  3BVZ A;  4JI0 L;  4APV A;  5D65 A;  3M85 A;  5C0X G;  1EY9 A;  5C4X H;  5GQO A;  4EX5 A;  3GTQ H;  4J1M A;  4UP8 A;  1Q12 A;  2OXP A;  1J9O A;  3T1Y Q;  2F3W A;  1U4L A;  1A63 A;  2R93 H;  5KNC A;  1Q90 A;  2N49 A;  5EKL A;  4O2D A;  4WOR A;  1HH2 P;  4A3D G;  1L1O A;  3GQB A;  4UPA A;  3MWY W;  1C0A A;  2SOB A;  1QVC A;  4G7H C;  1MGS A;  5A2Q L;  1IBM L;  1NAP A;  2EQS A;  4F7X A;  2Z6K C;  1VQI A;  3WDN A;  4X6A H;  4NDX A;  3EIV A;  4C2M B;  4ALP A;  3KDF A;  4JK1 C;  1DOL A;  3H0G G;  3J80 L;  2B8G A;  3CCS A;  4C3J G;  4JI3 Q;  4LF5 Q;  1JOK A;  4IFD H;  5IGF A;  4QIW B;  2JSO A;  3G48 A;  3HOX B;  5BN3 A;  1F77 A;  3F2C A;  1V9P A;  3K7A B;  1FL0 A;  4LNQ A;  2BDO A;  5FOB B;  3HFZ B;  3KJP A;  3OPO A;  3EFX D;  1EUJ A;  1Q3L A;  1DJR D;  4JOI C;  3J7A V;  4FF4 A;  1Z6H A;  1PXU A;  2Q2T A;  1NY4 A;  4HN7 A;  2WB1 B;  2K50 A;  2K32 A;  5IGC A;  3PIO 3;  3H3V I;  2RA4 A;  3OOC A;  1UE6 A;  3DWP A;  3I4M H;  5IGG A;  1DOK A;  1UE7 A;  4LF7 Q;  4HID A;  4J8Q A;  1TQO A;  1WTP A;  3EJI A;  5FKA C;  3PO3 G;  2I0Q A;  3UE0 A;  2D0P A;  2DJF C;  4QY7 A;  3HOV B;  3GV6 A;  5I4D A;  3PCO B;  1Q1B A;  3KF8 B;  3VA5 A;  2RKS A;  3NQI A;  4C3H B;  1B9N A;  2NYZ D;  1OO9 B;  1Q86 C;  4R1J A;  4HR7 B;  1JWM D;  1KDC A;  4XIG S;  3DMU A;  1D1I A;  1BNZ A;  1XPR A;  3EBE A;  4DAY A;  4DFA A;  5AJ3 Q;  2ICE C;  3CCR A;  1HR0 W;  1ML0 D;  5J22 A;  4B3M L;  1VS0 A;  1ESR A;  2N78 A;  2HHH Q;  3FKI B;  2B63 G;  1LTB D;  1VQ6 A;  5HGT A;  3TDQ A;  1B53 A;  4JBM A;  4LWC A;  3HRZ C;  3HOW B;  1IYV A;  3S9W A;  3J81 L;  3PMF A;  3OW2 A;  1PMR A;  4JI5 L;  2F0S A;  3S1R H;  1IBL L;  2JA8 H;  4A93 G;  1N32 L;  2PZU A;  1SYB A;  1MKH A;  4WJ4 A;  4B3T L;  3CCJ A;  2Y0S E;  1CKO A;  4IPD A;  4HCS A;  5GRO A;  3LNN A;  5EPK A;  3R3O A;  5E3F A;  4CJ0 B;  1QCB D;  3RUZ A;  2GN5 A;  4RGN A;  3ICE A;  5KEE A;  4ZAI A;  1CZW A;  3DHQ A;  4N8F A;  3K5L A;  4LFA L;  3L9A X;  4MZ9 A;  3I72 A;  1PFM A;  1SBB B;  1GM5 A;  1RTO A;  1O80 A;  1TU2 B;  1Y8O B;  4KY5 A;  3QG1 A;  3W3A A;  1XPU A;  5I9O A;  2B2T C;  3CCQ A;  2I07 B;  1XTD A;  4X3T A;  2BA1 A;  4B9W A;  1E24 A;  4DGZ A;  4GN5 A;  3MXN A;  4RH6 A;  3VR4 A;  4BA1 I;  4OL7 A;  4A3F B;  2EOT A;  2E5L L;  1G51 A;  3Q8D A;  4LF8 L;  4A3J B;  1CM9 A;  1SYG A;  3HP3 A;  3MTS A;  1JOQ A;  5M3M B;  1D5M C;  2RCN A;  3S1N H;  5G3L F;  3PIP A;  1OXS C;  4ME5 A;  3MXP A;  4RWS C;  3TP7 A;  1AN8 A;  1IXR A;  4A76 A;  4Y52 H;  3SEB A;  3VR2 A;  1F9Q A;  1TWH B;  1STY A;  4DK3 C;  1G8Z D;  5IYC G;  1HA5 A;  4R4C A;  3QOL A;  1PRT F;  3I91 A;  1B4O A;  2KQ3 A;  3RZD B;  1J5E L;  1LTA D;  3K58 A;  4X65 Q;  3D4D A;  3I8Z A;  2EYP A;  3B6Y A;  2EJF C;  2GVA A;  1PFB A;  3DWA A;  4DR6 L;  1HPC A;  1DOM A;  1STN A;  2G5D A;  1PTO F;  3M4O H;  2O5J C;  5D14 A;  5BN4 A;  3ULJ A;  4BBR B;  4FP5 D;  1M90 C;  3K0X A;  1FGB D;  5C0X J;  2L4N A;  4GKJ L;  4G7O C;  1KDA A;  2WV6 D;  2QDL A;  1BF4 A;  2D0O A;  5DAU A;  3G6E A;  4OX9 Q;  4DV6 L;  4PMB A;  1CKN A;  1WTW A;  4TKO B;  3CQZ B;  2DJG C;  3OMC A;  3HZX A;  3EQL C;  1AP0 A;  2KCM A;  2IX1 A;  1TXY A;  4LF9 L;  4JV5 Q;  1LAC A;  4MN3 A;  3VDY A;  1EWH A;  2CQO A;  4FXK C;  3OSO A;  4K6L A;  4RKB A;  3TRZ A;  4DV4 Q;  4QGU A;  1ET9 A;  2Z0S A;  2L1B A;  1SEB D;  3CPF A;  4WJW A;  2L11 A;  4R4I A;  1IKM A;  4GLV B;  2HCC A;  5D3D A;  2K03 A;  2ZTC A;  1Y14 B;  5COR A;  4PG3 A;  3DEO A;  4JBJ A;  2QA4 A;  4Q0F A;  2WIN B;  1Q46 A;  1SR3 A;  1WTQ A;  4JI6 L;  2BA0 A;  5FLM G;  3BVM A;  1WTH A;  4JI1 Q;  3T13 A;  2OTL A;  2QKI C;  3PQI A;  2KCT A;  3PIP 3;  2LS0 1;  2UUC L;  3SK5 A;  3FVQ A;  1EYD A;  5JJK A;  2Q8T A;  1TR5 A;  1I4G A;  1TWA H;  3M9B A;  2NZH A;  1JQY D;  3E5S A;  1A2T A;  3S1M B;  5M3F B;  1YJ9 A;  4JVZ A;  3LWE A;  1VQO A;  3AB9 A;  4WJ3 M;  4BXX G;  3QO2 A;  3CD6 A;  4Z9C B;  1CZG A;  5JVH 3;  1JT8 A;  4DR1 Q;  2NVY B;  2UUB Q;  1EEI D;  2O5I C;  1MI2 A;  3A8J E;  1NMG A;  4KV6 A;  2YTY A;  5JJL A;  2KUM A;  4FO2 A;  1PTO H;  1SYF A;  3NWS A;  3GTO B;  2GA4 B;  1Y8P B;  4DR7 Q;  1A15 A;  3JAM c;  3NWT A;  1I50 H;  2NN6 H;  5I6W A;  1H9J A;  2F1M A;  3S15 H;  3HKS A;  5C44 B;  3KF8 A;  4YCW A;  3M3Y H;  3C2P A;  4RCO A;  4A3M B;  2CWA A;  4QL5 A;  4ID6 A;  2D5D A;  4HIO A;  3GTG H;  2KOL A;  3MHB A;  3HOX G;  2Q2I A;  1IW7 D;  1VF7 A;  2KEC A;  1D8L A;  1FJG Q;  4H7B A;  1E7Z A;  2AQ1 B;  2D2C C;  5ELD A;  4I7A A;  4JYA Q;  1E1O A;  1K8O A;  3LGJ A;  1VQ9 A;  1X3P A;  3TS2 A;  5DNF A;  4LFB Q;  2AHO B;  1LM0 A;  1T5E A;  1X56 A;  5FO9 B;  5LMN L;  1EEF D;  3K81 C;  3H0G B;  4X3K A;  4A3C G;  3D31 A;  2RSO A;  3RLO A;  2VNU D;  2BDN A;  3S1Q H;  2YTV A;  1JJ2 A;  5HUR A;  4KHZ A;  4IFD J;  2F0E A;  4DA2 A;  5EKI A;  3HOZ H;  2WB1 G;  3SK8 A;  3I4N B;  3HOU H;  1JOO A;  3VYS A;  2ZTD A;  4GOP C;  2NUC A;  2E2I B;  2DNE A;  4C1N K;  3PO2 H;  1JOR A;  2L15 A;  1GUO A;  4NXM Q;  4JI8 Q;  3DM1 A;  3P1H A;  5C0X I;  3TRE A;  5GAH C;  3D6W A;  1A3T A;  1AZQ A;  1X9N A;  4DXF A;  1VMC A;  1TVX A;  4PMW A;  3HOV G;  1HZA A;  2OCE A;  2EZV A;  1JR0 D;  1O7Y A;  1GUW A;  4JI7 Q;  2A68 C;  2A6H C;  2XWJ B;  3RLF A;  4C3H G;  3F2B A;  2VZA A;  5LL6 X;  1GKH A;  4K8J A;  1DCZ A;  4IUV A;  2RVL A;  3NK9 A;  5IYD G;  4NXN L;  3IRB A;  3I90 A;  4YCU A;  1E2W A;  4Y7N B;  1MSH A;  1K3R A;  1Q81 C;  4DV0 Q;  3M4Y A;  2KEE A;  1Q7Y C;  3FKI G;  5EJW A;  3MXU A;  1PDQ A;  3KDF B;  3URY A;  3A0J A;  3HOW G;  3VYT A;  2JA7 B;  4K6D A;  2R92 B;  3S16 B;  4OWX B;  5I9P A;  5C6A A;  3AMU A;  4MNO A;  1I4X A;  2E2D C;  1SSO A;  4AH6 A;  4EVO A;  2E2H B;  2VUM H;  3H3V C;  4DUZ Q;  3BYT B;  2F3V A;  3AYH B;  1B1Z A;  1L0X B;  1HJP A;  1BCP D;  1HXY D;  3QIA A;  2ZXO A;  5M5Y H;  1ONL A;  4K5V A;  4FNF A;  3UE1 A;  3CCM A;  3G7L A;  1SJE D;  1WCM H;  4K2L A;  5LMU L;  2R3Z A;  3ND9 A;  2A69 C;  1HZC A;  2BCO A;  1R9T H;  2NVQ B;  4P2C B;  2VW9 A;  3VR6 A;  4UDU C;  2ID0 A;  3N6R A;  1G6P A;  2F0G A;  4LK1 C;  5C3E H;  3RN2 A;  3OIQ A;  4JG2 A;  4LUZ A;  4KHP L;  4QCL A;  3HOY H;  1LLR D;  2PMZ E;  4CGY B;  5C4J B;  2A19 A;  1QVF A;  1HCZ A;  3TBI B;  1D7Q A;  2UU9 L;  3H94 A;  2VQF Q;  1I94 L;  4PNY A;  5AFW A;  3CP0 A;  1I6H H;  2B2W C;  2FHT A;  1WOC A;  1X3E A;  1IL2 A;  3PUV A;  4BBS G;  2A74 C;  5CR3 A;  5J1Z A;  4DNI A;  2A6E C;  2IHF A;  4A3F G;  2ICI A;  1NBW A;  1BXT A;  1N8R C;  4A3J G;  2JA6 B;  1K8M A;  4FF3 A;  1SRU A;  2KHI A;  5M3M G;  1XMQ Q;  3U9S A;  4DAY B;  4LAA A;  2WKD A;  4JW0 A;  4NB3 A;  1NUC A;  4DR3 L;  1TWG H;  1BCP B;  3K0Y A;  1QB5 D;  1EYA A;  1TY2 A;  4U68 A;  1HHV A;  1BQQ T;  5E4X A;  2MJ8 A;  1HR0 Q;  3NEL A;  2Q2H A;  3TN2 A;  5FO8 B;  3GTJ H;  2Z6K A;  1BUV T;  3OYY A;  2JA9 A;  2A73 B;  2JE6 I;  1ICF B;  4DR4 Q;  4KD3 A;  2M9V A;  2EE1 A;  2K5D A;  1PRT C;  4ILW A;  2MP1 A;  3DXJ C;  1LTS D;  2D9U A;  4JC0 A;  2X6L A;  1OXT A;  1Y1W G;  4IFD I;  4OIJ A;  2UUA L;  2K05 A;  3KFU A;  1VQ4 A;  2JXM B;  1B2T A;  5DLQ E;  4BBR G;  2E2J H;  5T1G A;  5C0X H;  3DEP A;  2LXK A;  1JIC A;  1B50 A;  2KEN A;  1EWC A;  1SNO A;  4JOI A;  4DV1 Q;  3DWQ A;  5TSS A;  4FF1 A;  3T4A C;  4B9X A;  3KLS X;  5GAD C;  4RA8 A;  1U4M A;  2K7V A;  4MTK A;  5LMN W;  3TS0 A;  5ISR A;  4RKL A;  4A3D H;  1CQF A;  1KNA A;  2I5L X;  1QUQ A;  2EDG A;  4MIU A;  3W2D A;  2NWG A;  1N33 L;  2PI2 E;  1W6K A;  1E2Z A;  4POF A;  1R4P B;  1K83 H;  2QGQ A;  3MXN B;  5KNB A;  2ZJQ A;  4P71 A;  3D8G A;  4HIK A;  1HNX Q;  2EYL A;  1PA6 A;  3OIP A;  4ULL A;  2AMC B;  2EXD A;  1BBU A;  2Y0S B;  4ZYS A;  3KLS A;  2ZXR A;  1QZH A;  3MA2 B;  1PZK D;  3KLR A;  4JI0 Q;  2NVT B;  3GDE A;  4C3J H;  1FYC A;  4XYO A;  3CU7 A;  2A68 D;  2A6H D;  2YU9 H;  1SYC A;  1TY0 A;  2CHB D;  3SXH A;  2WAQ E;  2ZXP A;  4UY8 C;  4BY1 B;  1EY7 A;  1MD2 D;  3MFG A;  1TWF B;  3MZ5 A;  1EWI A;  2R7D A;  1ILQ A;  2Z1C A;  5LHY 1;  4ME3 A;  1S40 A;  4KD4 A;  1B7Y B;  2VXW A;  3GO5 A;  4H13 C;  2IT1 A;  2JA5 B;  2SEB D;  4BS9 A;  5IGE A;  1PH6 A;  2EVB A;  3S17 H;  1XPO A;  4GOP B;  4OO1 G;  3BG3 A;  4LF6 L;  3CAM A;  4DNT B;  2DY7 A;  2VQE L;  4HCE A;  3CCV A;  3ER0 A;  3PO3 H;  1X55 A;  1TWC H;  5IP7 H;  1G29 1;  4C3I B;  3J80 c;  4DN4 M;  3NPP A;  2PQE A;  5BR8 L;  1SE2 A;  1Y1V B;  2K28 A;  1XJV A;  2Q8R E;  4KY6 A;  4DV3 L;  2ENB A;  1UAP A;  1A2U A;  2OQ0 A;  1X32 A;  5C44 G;  3U4V A;  1AH9 A;  4A3M G;  2KCN A;  1ENF A;  2WP8 J;  1H9M A;  3A54 A;  3VYU A;  1FD7 D;  1SMY D;  2E75 C;  3Q24 A;  1G2T A;  1VQ5 A;  1XX8 A;  4CKC A;  4CDE C;  2B63 H;  4DK1 A;  2ZM6 L;  3A8K E;  4GN4 B;  4CJ1 B;  4IUQ A;  3WOE A;  4TSS A;  2B8F A;  2K5Q A;  4A93 H;  3ULP A;  4LJZ C;  1PH2 A;  3C1E A;  2HDL A;  4PZ7 A;  4RGO S;  1XNR L;  3V05 A;  2RQX A;  4KMU C;  1NTG A;  1CK1 A;  4RCN A;  2ZTE A;  1Q8K A;  4IPH A;  3I4N G;  1H9K A;  2PW7 A;  4OWW B;  1NE3 A;  2XRQ D;  5G3L D;  4UHV A;  3UDI A;  4B3R L;  2IY5 B;  1EIH A;  4P74 A;  3A7A B;  4AQY L;  3GTK H;  5I6Y A;  2RCF A;  4B3M Q;  3JAM i;  1DXM A;  2E76 C;  3H6M A;  2LY7 A;  3L7Z C;  4HMI A;  3GV3 A;  1QVG A;  1LV9 A;  1C4Q A;  3AEV A;  4JI5 Q;  1IBL Q;  1XTC D;  2JK8 A;  2F0F A;  1TS3 A;  2JJQ A;  1OXU A;  2TSS A;  1N32 Q;  3HG9 A;  2CVR A;  2RDG A;  1TS2 A;  3NTI A;  1JJC B;  3J81 c;  1HFN A;  2F0J A;  1SNM A;  3M4P A;  4KJN A;  1RTN A;  3C46 A;  1YHB A;  3RZO B;  1I4H A;  1XMO Q;  4BY7 H;  1QWY A;  1II3 A;  4EQP A;  2HIV A;  4Q5V A;  3J7A 5;  1VQ8 A;  1HUM A;  4KY7 A;  4LFA Q;  2JA7 G;  2R92 G;  3PUZ A;  5IYC H;  2F0P A;  5FO7 B;  1WVL A;  1FNV A;  1KNE A;  2NVX H;  2G9D A;  2IHE A;  1EFI D;  1C7Y A;  1HZ9 A;  1EY5 A;  3NBI A;  4JCV E;  3Q22 A;  3DUZ A;  4PZ6 A;  1PHJ A;  2F03 A;  3A55 A;  3UDG A;  2G9H D;  4P72 A;  2E5L Q;  1NR4 A;  4LF8 Q;  3QR8 A;  5CGK A;  1JE4 A;  1BKB A;  2I46 A;  2F0D A;  2A8V A;  2EY1 A;  1Q82 C;  4MHE A;  3KUP A;  2NTS A;  1U0L A;  1QIL A;  4X64 L;  5E4W C;  1YNN C;  1BOS A;  1EY0 A;  1KQS A;  5C5M A;  3M7N A;  2RHQ B;  1GVP A;  1CI3 M;  2IPK D;  3A8I E;  4A3I B;  1J5E Q;  3GTP H;  3Q6S A;  5ELN A;  3SVM A;  2F0Q A;  1UUP A;  4IOC A;  3P20 A;  1W6J A;  3I7F A;  5FJ8 G;  1PZI D;  2Z6B A;  5C4H A;  2JA6 G;  4NMZ A;  4DR6 Q;  4A3G B;  2B2V C;  1S5C D;  2AWN A;  5EGT A;  2F0U A;  2F4V L;  3CME A;  1AZP A;  1LTL A;  2E8G A;  2OT2 A;  5M5X B;  1SFO B;  3UI2 A;  4HSV A;  1RCV D;  1JC7 A;  1ENA A;  4AYB B;  4CDD C;  5CV8 A;  4X62 L;  4BBS B;  4JBK A;  3J81 j;  4GKJ Q;  4RAU C;  5FLM H;  1KLU D;  2NN6 I;  4CKE A;  1CKM A;  4DV6 Q;  3RD4 A;  5JEA G;  2JN4 A;  4OHJ A;  1I3Q H;  1CSQ A;  1L1O C;  2XRS D;  5F2D A;  2AUK A;  2HD3 A;  2K01 A;  1PYW D;  1SAP A;  2M2L A;  4LF9 Q;  2F3I A;  4LF4 L;  1EU3 A;  3DLL A;  2KHJ A;  1MHW C;  2WFW A;  4BXX H;  2KCC A;  1M1K C;  4V19 0;  2K33 A;  1ICW A;  4GNX B;  3NBH A;  3JC6 6;  5EKK A;  4JI6 Q;  5E7N A;  3JAM E;  1Y1W B;  1D6E C;  3S2D B;  3FRP B;  1R4Q B;  4L5R C;  2R7Z B;  3CCE A;  5C5L A;  4GOP A;  4J15 A;  1SNP A;  1B3Q A;  2UUC Q;  3A74 A;  4DR2 L;  4A3B B;  2J4X A;  1VQC A;  3O13 A;  2C35 B;  1KAB A;  3GD7 A;  1W3S A;  4HIM A;  4YY3 Q;  2C9O A;  3ERS X;  3PGZ A;  4GLA C;  1DM0 B;  2Y0S G;  2F4I A;  3T16 A;  4C2M H;  1ESF A;  1F2M A;  2Q8I B;  5ELB A;  2K75 A;  5IWA L;  2BH2 A;  2WAC A;  1A62 A;  4E6I A;  4U67 3;  3HOX H;  4L5Q A;  2OWO A;  5J3B A;  3SGI A;  1WTV A;  2PZW A;  4LW1 A;  3K7A H;  3IAY A;  4KN7 C;  4BY1 G;  4K14 A;  1S5E D;  1A0I A;  3OMG A;  1V1P B;  2PMZ B;  4EQN A;  3CMA A;  2IL8 A;  4A3C H;  2LSS A;  4JI4 L;  1VF5 C;  2A5H A;  1QNU A;  4L6T B;  1X3Q A;  2JA5 G;  1VQE A;  2EXZ A;  2VB3 X;  1GUG A;  3TP5 A;  4JI2 L;  5CV7 A;  4PMC A;  1I6H B;  2MUY A;  2OTJ A;  1K28 A;  3X3M A;  3RLN A;  3CCU A;  4YHH L;  4C3I G;  3HOV H;  2YTX A;  4QJF A;  4ZK9 B;  4GN3 B;  4C3H H;  1Y1V G;  5LMN Q;  4GLX A;  1QUQ B;  1FR3 A;  5JJZ A;  3SR1 A;  5IYD H;  1YNN D;  4DK6 C;  2Z8L A;  1K9M C;  2Z9H A;  3E0J A;  3SDZ A;  3FKI H;  4K5W A;  2IJ0 A;  2MPM A;  4H0L C;  2B2W A;  2X69 A;  2K14 A;  3HOW H;  2EJM A;  4R4Q A;  1V1Q A;  2Z4I A;  1VQK A;  4FDB A;  4DV4 L;  5IP9 G;  2UXB Q;  2RSN A;  1KRS A;  2KED A;  5I2Y A;  1AE3 A;  2L9H A;  1B3A A;  3BZC A;  4QB4 A;  1CHP D;  1PLF A;  1EIG A;  4A3K B;  1HTL D;  4NXN Q;  3J7A F;  2OEO A;  1VQL A;  3S14 B;  3NEN A;  1K73 C;  3LX0 A;  4HED A;  3F2D A;  4G7Z C;  4N8X 1;  4P73 A;  4EGV A;  1BR9 A;  3S2H H;  4QUC A;  1EYC A;  4O42 A;  1EIF A;  3U4Z A;  2B2Y C;  5HGQ A;  3T1H L;  2L5T A;  1C9O A;  1NNX A;  3W1B A;  1TS5 A;  2BOS A;  2B29 A;  3R2T A;  3M7G A;  2NB0 A;  2WAQ B;  2K5N A;  5C3X A;  5M5W B;  1EQT A;  1OXV A;  1VQN A;  3TSS A;  3CXC A;  4A3F H;  2I5M X;  2EPB A;  5LMU Q;  4C56 C;  4A3J H;  3GTM B;  4A3L G;  4IUT A;  5KYL A;  4HJ8 A;  2FIN B;  3IL8 A;  5CV4 A;  5M3M H;  4JPB W;  1CHQ D;  3K7U C;  2MNA A;  3BU2 A;  1YJN A;  3HKZ E;  4RGT A;  1LTT D;  1YIJ A;  3CC4 A;  1TWH H;  4KHP Q;  2UXD L;  4DR7 L;  1O78 A;  3NEM A;  4L5T A;  1LT6 D;  3IFT A;  1LO5 D;  3RZD H;  4RFB A;  1HTP A;  4A3E B;  1QNK A;  4K8I A;  2R7F A;  2UU9 Q;  1I4Q A;  3I55 A;  2PNH A;  5JEA J;  4K0K L;  1YNJ C;  5K36 G;  1XYI A;  4ODG A;  3GTL B;  1P16 A;  5CV5 A;  4OXP A;  1B70 B;  3SK4 A;  4BBR H;  1CUK A;  3PV0 A;  2RBM A;  3J7Y W;  3CC7 A;  3D6C A;  1IBK L;  4DR3 Q;  1ILP A;  2QW7 A;  1ASZ A;  3J81 i;  1PH7 A;  2CW0 C;  5C4X B;  3GTQ B;  1GUS A;  2ZT9 C;  3CQZ H;  4B3S Q;  2V1C C;  2PO4 A;  4J6H A;  4XQJ A;  3D4R A;  1VQP A;  4A3I G;  1HZB A;  1TKW B;  4DV7 L;  2R93 B;  1EOT A;  4GNX A;  1GO3 E;  4DR5 L;  1PH5 A;  3K5M A;  1STH A;  3STB C;  3CRL C;  4A3G G;  4NXM L;  2HQE A;  3CC2 A;  4RMF A;  1Z7T A;  2E74 C;  2UUA Q;  4OEM B;  1CA5 A;  3R2I A;  1SJH D;  1HA6 A;  4YCV A;  2RHS B;  4AYB G;  2VL6 A;  2HQL A;  2H1E A;  1X3F A;  1C48 A;  2K52 A;  2ATW A;  1WTO A;  1A3U A;  4NP5 A;  4DV5 L;  2V4D A;  1J8I A;  1HQM C;  2XTI A;  4DAM A;  1G91 A;  1SN8 A;  2N55 A;  4OIK A;  1PH3 A;  1L2F A;  2FJ2 A;  1WD0 A;  2PQA B;  5IIF A;  1N33 Q;  4QQB X;  2MHV A;  5A2Q E;  2EY5 A;  4RHS A;  5JAV A;  1V1P A;  2F0W A;  3BZK A;  3S1M H;  5M3F H;  3G6J B;  1V1O A;  3NTH A;  1X54 A;  4F8M A;  2AKW B;  3TP6 A;  4OO1 H;  2Z4H A;  3J80 E;  3K5O A;  1HNW Q;  4IJH A;  3HEJ A;  2NVY H;  1LTI D;  1JWS D;  5KGU A;  3FMC A;  3I4L A;  1KIX A;  1LTR D;  2CQA A;  5EPJ A;  2R7Z G;  3I4M B;  3PUX A;  2VS1 A;  1EIY B;  1TII D;  1U4R A;  4ZUI A;  1SXT A;  4A3B G;  1PTO C;  2PPB C;  4BY7 B;  2SNM A;  1XNQ L;  4RHR A;  3IKJ A;  4IO9 A;  2NBF A;  3EN2 A;  1NCV A;  4LFC L;  5ELC A;  2XVS A;  3L3O C;  5C4Z A;  4HSP A;  1ET6 A;  3U50 C;  5CBA E;  4A3M H;  3TEH B;  4K5X A;  3D3R A;  1STE A;  4G57 A;  3RR5 A;  3BYY B;  3OTO L;  4EQ5 A;  3K57 A;  2VQE Q;  2GVB A;  1P8L A;  2L55 A;  4XDX A;  4XYQ A;  4F87 A;  1DGS A;  4HJA A;  1QG7 A;  1KC8 C;  2EIF A;  3H0G H;  3S1R B;  2JA8 B;  5IGD A;  1E2V A;  1NMF A;  4L63 B;  1KD1 C;  2SDF A;  2EYF A;  5BR8 Q;  2HIX A;  3HOY G;  5KIX A;  3I4N H;  2C5C A;  3WOF A;  4DV3 Q;  3OW7 A;  3U9O A;  1CT1 D;  1JB3 A;  1GOZ A;  4IUN A;  1JCK B;  3ONA B;  1EZ8 A;  2HUG A;  1EY6 A;  2LMC B;  3FEW X;  2AWO A;  2ZM6 Q;  1IBM Q;  2IX0 A;  4RG1 A;  4KKU A;  1BCP F;  4K2K A;  4DV2 L;  2PI2 A;  3NBH B;  4DXG A;  2KA7 A;  4NKL A;  2FMC A;  3J81 E;  1HQR D;  5DM6 3;  1Z47 A;  2QDB A;  1J6Q A;  4DAV A;  2HDM A;  1XNR Q;  1EQV A;  1D5X C;  4X3S A;  3I4O A;  2QCP X;  1PFS A;  1F2Z A;  4YWM A;  3S24 A;  5IYB G;  4Y7N H;  3G4S A;  5L37 A;  2CW0 D;  4FVM A;  2A69 D;  4ZCK A;  2JYO A;  2JQO A;  4DUY L;  4B3R Q;  2J7Z A;  2NTT A;  4ZQ3 A;  4IUP A;  4AQY Q;  5FLX L;  2JA7 H;  4X66 L;  2R92 H;  3S16 H;  1SYE A;  1I3Q B;  3NP8 A;  3S1N B;  3STB D;  2E2H H;  3ERQ A;  2UXC L;  1KAW A;  4POG A;  3V96 A;  3ZJY C;  1HNX L;  2B2V A;  3MXG A;  1N36 L;  4KJO A;  2B2T A;  3KYH C;  3R8B A;  2H4O A;  1N34 L;  5JJI A;  2L12 A;  4HTH A;  3KBG A;  5IT9 L;  1KAA A;  4DPG A;  1Q1E A;  1JJG A;  3P75 A;  1YVC A;  5ELE A;  4A3K G;  3CPW A;  1Y8N B;  2A6E D;  2HCI A;  1FGU A;  2F0T A;  2NVQ H;  2O4X A;  1N9W A;  1PH9 A;  4H44 C;  1MBY A;  5CV6 A;  2KHS A;  1VQJ A;  1C8C A;  3NSW A;  5C4J H;  1UE5 A;  2LKV A;  3M4O B;  2F0N A;  2ASB A;  1HNZ L;  1BO0 A;  3I56 A;  2DY8 A;  1KL9 A;  5LL6 S;  3G71 A;  3ZYY X;  3BS1 A;  3RN5 A;  2ES2 A;  2WAQ G;  4GKK L;  1D1K A;  5ELF A;  2QF7 A;  3ULL A;  4YWK A;  3KBX A;  1PRT D;  4DAP A;  5FJ8 H;  3GP7 A;  2JA6 H;  1MIU A;  2OF1 A;  1SRO A;  3DM3 A;  1STG A;  1UNS A;  1YEZ A;  2WKC A;  4B3T Q;  2DUD A;  2B2U C;  4NW2 A;  4QUF A;  2AQ3 B;  1YHQ A;  1FNW A;  1PTO D;  1KTK A;  2VB2 X;  4NPS A;  4X64 Q;  2DN8 A;  1K0R A;  3F1Z A;  3T1Y L;  3A56 A;  4A3E G;  5JEA H;  1A3V A;  2EY2 A;  1PH1 A;  1WTR A;  3EA6 A;  3MFY A;  4BWG B;  2RDH A;  3FPU B;  1BBX C;  1VDZ A;  1YIT A;  3WWV A;  3FP9 A;  4DU9 A;  2RDF A;  3BVG A;  2N3S A;  4I7Z C;  2F4V Q;  1TWA B;  2PQA A;  5IP7 G;  4FXG C;  1VMP A;  1WD1 A;  1H9R A;  4JI3 L;  1AW7 A;  4LF5 L;  5C4X G;  4X62 Q;  1F2L A;  4HAE A;  3Q0A A;  4L8J A;  1KDB A;  1PRT B;  1S5B D;  1YJW A;  4MTN A;  1LAB A;  2R93 G;  1V43 A;  5JOB A;  1RKN A;  3RMH A;  1EU4 A;  5T1I A;  2PYK A;  2CFM A;  2X6G A;  2F0H A;  3NHH A;  4LF4 Q;  1PTO B;  1HFG A;  1I50 B;  4UP9 A;  2M00 A;  4CDF C;  2NVT H;  3EVQ A;  3AFP A;  3M4Q A;  3S15 B;  1YHA A;  1FNU A;  4IUU A;  3KK7 A;  4OON A;  4ZKC B;  3M3Y B;  2ZJR A;  4IJL A;  5FK9 C;  3GTG B;  4IFD G;  4BY1 H;  1PFN A;  3E3X A;  4A75 A;  4LF7 L;  3E9H A;  4N9P A;  1TWF H;  2RF4 A;  1XMO L;  3VR3 A;  1K0S A;  1WYD A;  3NE5 B;  1VQB A;  4IOA A;  1JWU D;  1IKL A;  2F52 A;  1LYL A;  3F8T A;  4YWL A;  3PUW A;  4DR2 Q;  4H02 A;  4LUV A;  1PYS B;  3PSI A;  1S3O A;  1U4P A;  4CJ2 C;  2JA5 H;  2XGT A;  3ERO A;  3S1Q B;  2JP1 A;  1DYQ A;  3S2H B;  5KND A;  4GZY C;  5IWA Q;  1ZXT A;  2B39 A;  2PW5 A;  2CKZ B;  2R6G A;  2PNR C;  3E9I A;  5AJ3 L;  3HOU B;  3HOZ B;  1YI2 A;  4TQU S;  2HHH L;  1IW7 C;  1IL8 A;  2IWH A;  1BVS A;  3PO2 B;  1VQM A;  2CWP A;  5JPM C;  3SK6 A;  1HRJ A;  3J7Z C;  3I4M G;  3T56 B;  3OWE B;  5EBD A;  3HKZ B;  4C3I H;  2F0L A;  2I5H A;  1GHJ A;  3KF6 B;  3D4W A;  4BY7 G;  4RGM A;  1U5K A;  4KKT A;  1Y1V H;  4XTC S;  4HJ7 A;  1RDP D;  1O7I A;  2F0M A;  2TMP A;  4O1N A;  4JI4 Q;  3FDT A;  2ZJP A;  1W2B A;  1DD2 A;  1E0B A;  1RD9 D;  1MJE A;  2B2Y A;  3TZD A;  5CYU A;  2WII B;  4XXE A;  4JI2 Q;  3C3L A;  1AEX A;  1I4P A;  3K80 C;  1GHK A;  2XWB B;  4DF7 A;  3AFQ A;  4XQN A;  3I2Z A;  4YHH Q;  5EAY A;  1AE2 A;  5IP9 H;  1F9S A;  3H3V H;  2JA8 G;  2VUM B;  1I5F A;  4V0B A;  3QB3 A;  5JPN C;  1TS4 A;  1G6Z A;  1SE8 A;  1UEA B;  2FXQ A;  4KLK A;  1GD7 A;  5M5Y B;  2H5X A;  1E3P A;  3NQT A;  4IAL A;  4DNR B;  4L5S A;  1WCM B;  3TP8 A;  3CRK C;  4QIW E;  2A1A A;  2YV5 A; 
#chains in the Genus database with same CATH homology
 3QWN A;  1R9T B;  5A35 A;  3OWF A;  4WFN 3;  5C3E B;  1L0Y B;  3HOY B;  1U9R A;  2KJX A;  1Y69 U;  3A7L A;  3H91 A;  4CHT B;  3MVV A;  1BCP C;  1I4R A;  1CQV A;  1NR2 A;  5CC4 A;  1F9R A;  2AQ2 B;  1G2S A;  5M9O A;  1LT5 D;  4WRD A;  2YYZ A;  1TWG B;  4UAI A;  1S5F D;  2K5W A;  1OXX K;  1SYD A;  1HUN A;  5K5P A;  3GTJ B;  1EZ6 A;  3VYR A;  5K36 H;  4F88 A;  3I70 A;  3K5N A;  2O2L D;  2K1B A;  4KN4 C;  3NUC A;  5KYI A;  4M1U B;  1STB A;  1LT4 D;  5E1F A;  4JBW A;  2E2J B;  1RJT A;  2EYH A;  2FMM A;  2F0O A;  1CTM A;  2IX3 A;  1H9S B;  3FPP A;  2QEJ C;  3TZU A;  4N9T A;  3I73 A;  1Q8I A;  2D62 A;  1KLG D;  5J39 A;  1ROD A;  5C3W A;  4A3D B;  2F0K A;  3V2T A;  2PCF B;  3R93 A;  1SND A;  4OO1 I;  1GJX A;  3N52 A;  4R8I A;  3OHX C;  1K83 B;  1F2Y A;  1A6X A;  3MC0 B;  1SE4 A;  3T51 B;  4KTA A;  4XQQ A;  1GXD C;  4C3J B;  1ZYR C;  1SNC A;  3JAM L;  3MAQ A;  2YU9 B;  3H09 A;  4KKS A;  1STA A;  2FFK B;  4DK0 A;  4KHV A;  2SNS A;  1QOH A;  4M8A A;  1TT2 A;  5BN5 A;  1AFP A;  1S4Z A;  3NXW A;  4ABN A;  1GUT A;  4XT1 B;  5CMD A;  2L0C A;  4C1N I;  4QMG A;  2JEB I;  5IOD A;  1EY4 A;  3S17 B;  1QJO A;  2J0T D;  1SDF A;  3BDL A;  2BE5 C;  3BDO A;  2EYM A;  5D3I B;  3PO3 B;  1S5D D;  1TWC B;  5IOC A;  5DM7 3;  1O7L A;  4B08 A;  4ZRZ A;  2NN6 G;  2F0I A;  1EL0 A;  1SE3 A;  1MSG A;  4QF4 A;  3BZD B;  3LWU A;  3BDC A;  2B63 B;  1M4V A;  1LT3 D;  4X3U A;  2AUJ D;  1M8A A;  3CKI B;  3C1F A;  3TME A;  1D2B A;  2K6A A;  3X3N A;  4IUR A;  1QE6 A;  4A93 B;  3NTK A;  4FF2 A;  5FLX E;  3QJY A;  2XNA C;  4I65 A;  1VCI A;  2MGS A;  1WTX A;  2R61 A;  4S3S A;  1SMY C;  3HGB A;  2XIW A;  3T53 B;  2F0V A;  5IT9 E;  2XSC A;  1F9P A;  3GTK B;  3PUY A;  1XXG A;  1ENC A;  2QIL A;  4G4K A;  2EJG C;  5CV9 A;  3K6O A;  1SNQ A;  3AU7 A;  2KVM A;  1DON A;  1GUN A;  4KK7 A;  4LMQ D;  3K59 A;  1BDO A;  4HMJ A;  1ZEQ X;  2LFN A;  1T5X D;  3I3C A;  3HS0 C;  2NZ1 D;  5DEH A;  2N88 A;  4R9W A;  5CBE E;  5JVG 3;  1V8Q A;  4OGQ C;  4CBV A;  2EY6 A;  2NVX B;  4R8N A;  2EYO A;  1CFM A;  2B2U A;  4ZLT F;  1DZ1 A;  4PQX A;  1IYU A;  5EBC A;  4EQO A;  3VR5 A;  4TRD A;  1I6V C;  1ZYR D;  4ZKB B;  1O7Z A;  4YIJ A;  5NUC A;  1B44 D;  1ZKO A;  3VA7 A;  3QOJ A;  4IQZ A;  2K04 A;  2XN9 C;  4XT3 B;  1PZJ D;  2EYJ A;  3P7J A;  1D5Z C;  1IHZ A;  4IN3 A;  3CHB D;  4PV1 C;  3SE0 A;  5IGB A;  3GTP B;  1YNJ D;  3ITP A;  1H9S A;  4KI0 A;  4FXD A;  3F2U A;  4BA2 I;  1RF2 D;  4IZ8 A;  3Q23 A;  2BE5 D;  1RHP A;  2PZT A;  1XWE A;  2JEA I;  3SHL A;  5KRU A;  1NSN S;  1B9M A;  5COY A;  1EY8 A;  2DNC A;  5EPL A;  2IW3 A;  4FYD A;  3IFD A;  5EQ0 A;  3E6Z X;  4CKB A;  1CA6 A;  3MEH A;  5I2X A;  1LTG D;  3ND8 A;  4ZUJ A;  3BVZ A;  3M85 A;  5D65 A;  5C0X G;  1EY9 A;  4J1M A;  1Q12 A;  2OXP A;  1J9O A;  2F3W A;  1U4L A;  5KNC A;  1Q90 A;  5EKL A;  4WOR A;  3GQB A;  3MWY W;  2SOB A;  4G7H C;  1MGS A;  5A2Q L;  1NAP A;  4F7X A;  3WDN A;  4NDX A;  4C2M B;  4JK1 C;  1DOL A;  3J80 L;  2B8G A;  4C3J G;  1JOK A;  4IFD H;  5IGF A;  4QIW B;  2JSO A;  3HOX B;  5BN3 A;  1F77 A;  3K7A B;  2BDO A;  5FOB B;  3OPO A;  3EFX D;  1Q3L A;  1DJR D;  3J7A V;  4FF4 A;  1Z6H A;  1PXU A;  4HN7 A;  2WB1 B;  2K32 A;  5IGC A;  3PIO 3;  2RA4 A;  3OOC A;  3DWP A;  5IGG A;  1DOK A;  4J8Q A;  1TQO A;  1WTP A;  3EJI A;  5FKA C;  3HOV B;  3GV6 A;  5I4D A;  1Q1B A;  3VA5 A;  2RKS A;  3NQI A;  4C3H B;  1B9N A;  2NYZ D;  1OO9 B;  4HR7 B;  1JWM D;  1KDC A;  4XIG S;  3DMU A;  1D1I A;  1BNZ A;  4DAY A;  4DFA A;  2ICE C;  1ML0 D;  5J22 A;  1ESR A;  3FKI B;  1LTB D;  5HGT A;  3TDQ A;  1B53 A;  3HRZ C;  3HOW B;  1IYV A;  3S9W A;  3J81 L;  3PMF A;  1PMR A;  2F0S A;  2PZU A;  1SYB A;  4HCS A;  3LNN A;  5EPK A;  3R3O A;  5E3F A;  4CJ0 B;  1QCB D;  3RUZ A;  4RGN A;  5KEE A;  4ZAI A;  1CZW A;  3DHQ A;  3K5L A;  3L9A X;  3I72 A;  1PFM A;  1SBB B;  1RTO A;  1O80 A;  1TU2 B;  1Y8O B;  4KY5 A;  3QG1 A;  3W3A A;  5I9O A;  2B2T C;  2I07 B;  4X3T A;  2BA1 A;  4B9W A;  4DGZ A;  3MXN A;  4RH6 A;  3VR4 A;  4BA1 I;  4OL7 A;  4A3F B;  2EOT A;  4A3J B;  1CM9 A;  1SYG A;  3HP3 A;  3MTS A;  1JOQ A;  5M3M B;  1D5M C;  5G3L F;  1OXS C;  4ME5 A;  3MXP A;  4RWS C;  3TP7 A;  1AN8 A;  3SEB A;  3VR2 A;  1F9Q A;  1TWH B;  1STY A;  1G8Z D;  1HA5 A;  3QOL A;  1PRT F;  3I91 A;  1B4O A;  2KQ3 A;  3RZD B;  1LTA D;  3K58 A;  3D4D A;  3I8Z A;  2EYP A;  2EJF C;  1PFB A;  3DWA A;  1HPC A;  1DOM A;  1STN A;  1PTO F;  2O5J C;  5D14 A;  5BN4 A;  4BBR B;  4FP5 D;  1FGB D;  5C0X J;  2L4N A;  4G7O C;  1KDA A;  2WV6 D;  1BF4 A;  5DAU A;  4PMB A;  1WTW A;  4TKO B;  3CQZ B;  3OMC A;  3HZX A;  3EQL C;  1AP0 A;  2IX1 A;  1LAC A;  4MN3 A;  1EWH A;  4FXK C;  4RKB A;  3OSO A;  4K6L A;  1ET9 A;  2L1B A;  1SEB D;  4WJW A;  2L11 A;  1IKM A;  5D3D A;  2HCC A;  2K03 A;  5COR A;  3DEO A;  4Q0F A;  2WIN B;  1WTQ A;  2BA0 A;  3BVM A;  3T13 A;  2QKI C;  3PIP 3;  2LS0 1;  3SK5 A;  3FVQ A;  1EYD A;  2Q8T A;  1TR5 A;  1I4G A;  3E5S A;  1JQY D;  1A2T A;  3S1M B;  5M3F B;  3LWE A;  3AB9 A;  3QO2 A;  4Z9C B;  1CZG A;  5JVH 3;  2NVY B;  1EEI D;  2O5I C;  1MI2 A;  3A8J E;  4KV6 A;  2KUM A;  4FO2 A;  1PTO H;  1SYF A;  3NWS A;  3GTO B;  2GA4 B;  1Y8P B;  1A15 A;  3NWT A;  2NN6 H;  5I6W A;  1H9J A;  2F1M A;  5C44 B;  3KF8 A;  3C2P A;  4RCO A;  4A3M B;  4ID6 A;  2D5D A;  2KOL A;  3MHB A;  1IW7 D;  1VF7 A;  2KEC A;  4H7B A;  2AQ1 B;  2D2C C;  5ELD A;  1K8O A;  1X3P A;  5DNF A;  1T5E A;  5FO9 B;  1EEF D;  3H0G B;  4X3K A;  2VNU D;  3D31 A;  2RSO A;  2BDN A;  5HUR A;  4KHZ A;  4IFD J;  2F0E A;  4DA2 A;  5EKI A;  3SK8 A;  3I4N B;  1JOO A;  3VYS A;  2NUC A;  2E2I B;  2DNE A;  4C1N K;  1JOR A;  1GUO A;  5C0X I;  3DM1 A;  3P1H A;  3D6W A;  1A3T A;  1AZQ A;  4DXF A;  1VMC A;  1TVX A;  4PMW A;  2EZV A;  1JR0 D;  1O7Y A;  1GUW A;  2A68 C;  2A6H C;  2XWJ B;  3RLF A;  4C3H G;  5LL6 X;  4K8J A;  1DCZ A;  4IUV A;  2RVL A;  3NK9 A;  3I90 A;  1E2W A;  4Y7N B;  1MSH A;  3M4Y A;  2KEE A;  5EJW A;  3MXU A;  1PDQ A;  3URY A;  3VYT A;  2JA7 B;  4K6D A;  2R92 B;  3S16 B;  5I9P A;  5C6A A;  3AMU A;  1I4X A;  2E2D C;  1SSO A;  4EVO A;  2E2H B;  3H3V C;  3BYT B;  2F3V A;  1B1Z A;  1L0X B;  1BCP D;  1HXY D;  3QIA A;  2ZXO A;  1ONL A;  4K5V A;  4FNF A;  3G7L A;  1SJE D;  4K2L A;  2R3Z A;  3ND9 A;  2A69 C;  2BCO A;  2NVQ B;  4P2C B;  3VR6 A;  4UDU C;  2ID0 A;  3N6R A;  2F0G A;  4LK1 C;  3OIQ A;  4QCL A;  1LLR D;  4CGY B;  5C4J B;  1HCZ A;  3TBI B;  3H94 A;  4PNY A;  5AFW A;  2B2W C;  2FHT A;  3PUV A;  2A74 C;  5CR3 A;  5J1Z A;  2A6E C;  2ICI A;  1BXT A;  2JA6 B;  1K8M A;  4FF3 A;  3U9S A;  4LAA A;  2WKD A;  1NUC A;  1BCP B;  3K0Y A;  1QB5 D;  1EYA A;  1TY2 A;  4U68 A;  1HHV A;  1BQQ T;  5E4X A;  2MJ8 A;  3TN2 A;  5FO8 B;  1BUV T;  2A73 B;  2JE6 I;  4KD3 A;  2M9V A;  2EE1 A;  2K5D A;  1PRT C;  4ILW A;  2MP1 A;  3DXJ C;  1LTS D;  2D9U A;  2X6L A;  1OXT A;  4IFD I;  4OIJ A;  2K05 A;  2JXM B;  1B2T A;  5T1G A;  5C0X H;  3DEP A;  1JIC A;  1B50 A;  1EWC A;  1SNO A;  3DWQ A;  5TSS A;  4FF1 A;  3T4A C;  4B9X A;  3KLS X;  4RA8 A;  1U4M A;  2K7V A;  5ISR A;  4RKL A;  1CQF A;  1KNA A;  2EDG A;  4MIU A;  3W2D A;  2NWG A;  1W6K A;  1E2Z A;  1R4P B;  5KNB A;  3D8G A;  2EYL A;  3OIP A;  4ULL A;  2Y0S B;  4ZYS A;  3KLS A;  2ZXR A;  3MA2 B;  1PZK D;  3KLR A;  2NVT B;  1FYC A;  4XYO A;  3CU7 A;  2A68 D;  2A6H D;  1SYC A;  1TY0 A;  2CHB D;  3SXH A;  2ZXP A;  4BY1 B;  1EY7 A;  1MD2 D;  3MFG A;  1TWF B;  3MZ5 A;  1ILQ A;  2Z1C A;  5LHY 1;  4KD4 A;  2VXW A;  3GO5 A;  4H13 C;  2IT1 A;  2JA5 B;  2SEB D;  4BS9 A;  5IGE A;  2EVB A;  4OO1 G;  3BG3 A;  4DNT B;  2DY7 A;  4HCE A;  1G29 1;  4C3I B;  4DN4 M;  3NPP A;  2PQE A;  1SE2 A;  1Y1V B;  2K28 A;  2Q8R E;  4KY6 A;  2ENB A;  1UAP A;  1A2U A;  1X32 A;  2KCN A;  1ENF A;  2WP8 J;  1H9M A;  3A54 A;  3VYU A;  1FD7 D;  1SMY D;  2E75 C;  3Q24 A;  1G2T A;  1XX8 A;  4CKC A;  4DK1 A;  3A8K E;  4CJ1 B;  4IUQ A;  3WOE A;  4TSS A;  2B8F A;  2K5Q A;  4LJZ C;  3C1E A;  2HDL A;  4RGO S;  3V05 A;  2RQX A;  4KMU C;  4RCN A;  1CK1 A;  1H9K A;  2PW7 A;  2XRQ D;  5G3L D;  1EIH A;  3A7A B;  5I6Y A;  1DXM A;  2E76 C;  3H6M A;  2LY7 A;  3L7Z C;  4HMI A;  3GV3 A;  1LV9 A;  1C4Q A;  1XTC D;  2F0F A;  1TS3 A;  1OXU A;  2TSS A;  3HG9 A;  2CVR A;  2RDG A;  1TS2 A;  3NTI A;  1HFN A;  2F0J A;  1SNM A;  4KJN A;  1RTN A;  3C46 A;  3RZO B;  1I4H A;  1QWY A;  1II3 A;  4EQP A;  4Q5V A;  1HUM A;  4KY7 A;  3PUZ A;  2F0P A;  5FO7 B;  1WVL A;  1FNV A;  1KNE A;  2G9D A;  1EFI D;  1EY5 A;  3NBI A;  3Q22 A;  3DUZ A;  2F03 A;  3A55 A;  2G9H D;  1NR4 A;  5CGK A;  1JE4 A;  2I46 A;  2F0D A;  2EY1 A;  4MHE A;  3KUP A;  2NTS A;  1QIL A;  5E4W C;  1YNN C;  1BOS A;  1EY0 A;  3M7N A;  5C5M A;  1CI3 M;  2IPK D;  3A8I E;  4A3I B;  3Q6S A;  3SVM A;  2F0Q A;  1UUP A;  3P20 A;  1W6J A;  1PZI D;  5C4H A;  4NMZ A;  4A3G B;  2B2V C;  1S5C D;  2AWN A;  5EGT A;  2F0U A;  1AZP A;  2OT2 A;  5M5X B;  1SFO B;  3UI2 A;  4HSV A;  1RCV D;  1JC7 A;  1ENA A;  4AYB B;  5CV8 A;  4BBS B;  4RAU C;  1KLU D;  2NN6 I;  4CKE A;  3RD4 A;  5JEA G;  4OHJ A;  2XRS D;  5F2D A;  2AUK A;  2K01 A;  1PYW D;  1SAP A;  2M2L A;  1EU3 A;  2KCC A;  4V19 0;  2K33 A;  1ICW A;  3NBH A;  5EKK A;  3JAM E;  1Y1W B;  1D6E C;  3S2D B;  3FRP B;  1R4Q B;  2R7Z B;  5C5L A;  1SNP A;  4A3B B;  2J4X A;  3O13 A;  1KAB A;  3GD7 A;  2C9O A;  1DM0 B;  2F4I A;  3T16 A;  1ESF A;  1F2M A;  2Q8I B;  5ELB A;  2WAC A;  4E6I A;  4U67 3;  1WTV A;  2PZW A;  3IAY A;  4KN7 C;  4K14 A;  1S5E D;  3OMG A;  1V1P B;  2PMZ B;  4EQN A;  2IL8 A;  1VF5 C;  2A5H A;  1QNU A;  4L6T B;  1X3Q A;  2EXZ A;  2VB3 X;  1GUG A;  3TP5 A;  5CV7 A;  4PMC A;  1I6H B;  2MUY A;  3X3M A;  4C3I G;  4ZK9 B;  1FR3 A;  5JJZ A;  3SR1 A;  1YNN D;  2Z8L A;  3E0J A;  3SDZ A;  4K5W A;  2IJ0 A;  2MPM A;  4H0L C;  2B2W A;  2X69 A;  2EJM A;  2Z4I A;  2RSN A;  2KED A;  5I2Y A;  2L9H A;  1B3A A;  4QB4 A;  1CHP D;  1PLF A;  1EIG A;  4A3K B;  1HTL D;  3J7A F;  2OEO A;  3S14 B;  3LX0 A;  4HED A;  4G7Z C;  4EGV A;  1BR9 A;  4QUC A;  1EYC A;  4O42 A;  2B2Y C;  2L5T A;  1TS5 A;  2BOS A;  3R2T A;  3M7G A;  2NB0 A;  2WAQ B;  5C3X A;  5M5W B;  1EQT A;  1OXV A;  3TSS A;  2EPB A;  4C56 C;  3GTM B;  4IUT A;  5KYL A;  2FIN B;  3IL8 A;  5CV4 A;  1CHQ D;  4RGT A;  1LTT D;  1O78 A;  1LT6 D;  3IFT A;  1LO5 D;  4RFB A;  1HTP A;  4A3E B;  1QNK A;  4K8I A;  1I4Q A;  5JEA J;  1YNJ C;  5K36 G;  1XYI A;  4ODG A;  3GTL B;  5CV5 A;  3SK4 A;  3PV0 A;  2RBM A;  3J7Y W;  3D6C A;  1ILP A;  2CW0 C;  5C4X B;  3GTQ B;  1GUS A;  2ZT9 C;  2PO4 A;  4J6H A;  4XQJ A;  3D4R A;  1TKW B;  2R93 B;  1EOT A;  3K5M A;  1STH A;  3CRL C;  2HQE A;  1Z7T A;  2E74 C;  1CA5 A;  3R2I A;  1SJH D;  1HA6 A;  2H1E A;  1C48 A;  1WTO A;  1A3U A;  4NP5 A;  2V4D A;  1J8I A;  1HQM C;  1G91 A;  2N55 A;  4OIK A;  2FJ2 A;  1WD0 A;  5IIF A;  2MHV A;  5A2Q E;  2EY5 A;  4RHS A;  5JAV A;  1V1P A;  2F0W A;  3G6J B;  1V1O A;  3NTH A;  4F8M A;  3TP6 A;  4OO1 H;  2Z4H A;  3J80 E;  3K5O A;  3HEJ A;  1JWS D;  1LTI D;  5KGU A;  3FMC A;  3I4L A;  1LTR D;  2CQA A;  5EPJ A;  3I4M B;  3PUX A;  1TII D;  1U4R A;  4ZUI A;  1SXT A;  1PTO C;  2PPB C;  4BY7 B;  2SNM A;  4RHR A;  3IKJ A;  2NBF A;  1NCV A;  5ELC A;  2XVS A;  3L3O C;  5C4Z A;  4HSP A;  1ET6 A;  5CBA E;  4K5X A;  3D3R A;  1STE A;  4G57 A;  3BYY B;  3K57 A;  2L55 A;  4XDX A;  4XYQ A;  4F87 A;  1QG7 A;  3S1R B;  2JA8 B;  5IGD A;  1E2V A;  4L63 B;  2SDF A;  2EYF A;  5KIX A;  2C5C A;  3WOF A;  3OW7 A;  3U9O A;  1CT1 D;  1JB3 A;  1GOZ A;  4IUN A;  1JCK B;  3ONA B;  1EZ8 A;  2HUG A;  1EY6 A;  2LMC B;  3FEW X;  2AWO A;  2IX0 A;  4KKU A;  1BCP F;  4K2K A;  4DXG A;  2KA7 A;  4NKL A;  2FMC A;  3J81 E;  1HQR D;  5DM6 3;  1Z47 A;  2QDB A;  4DAV A;  2HDM A;  1EQV A;  1D5X C;  4X3S A;  2QCP X;  1F2Z A;  2CW0 D;  4FVM A;  2A69 D;  2JYO A;  2J7Z A;  2NTT A;  4ZQ3 A;  4IUP A;  5FLX L;  1SYE A;  1I3Q B;  3NP8 A;  3S1N B;  3ERQ A;  3V96 A;  2B2V A;  3MXG A;  4KJO A;  2B2T A;  3R8B A;  2H4O A;  2L12 A;  4HTH A;  3KBG A;  5IT9 L;  1KAA A;  1Q1E A;  3P75 A;  5ELE A;  1Y8N B;  2A6E D;  2HCI A;  2F0T A;  2O4X A;  4H44 C;  1MBY A;  5CV6 A;  2KHS A;  1C8C A;  3NSW A;  2LKV A;  3M4O B;  2F0N A;  1BO0 A;  2DY8 A;  5LL6 S;  3ZYY X;  3BS1 A;  1D1K A;  5ELF A;  2QF7 A;  3KBX A;  4DAP A;  1PRT D;  3GP7 A;  2OF1 A;  1STG A;  1UNS A;  2WKC A;  2B2U C;  4NW2 A;  4QUF A;  2AQ3 B;  1FNW A;  1PTO D;  1KTK A;  2VB2 X;  2DN8 A;  3A56 A;  5JEA H;  1A3V A;  2EY2 A;  1WTR A;  3EA6 A;  3MFY A;  4BWG B;  2RDH A;  3FPU B;  1BBX C;  1VDZ A;  4DU9 A;  2RDF A;  3BVG A;  4I7Z C;  1TWA B;  4FXG C;  1VMP A;  1WD1 A;  1H9R A;  1AW7 A;  3Q0A A;  1F2L A;  4HAE A;  4L8J A;  1KDB A;  1PRT B;  1S5B D;  1LAB A;  1V43 A;  5JOB A;  1RKN A;  3RMH A;  1EU4 A;  5T1I A;  2PYK A;  2X6G A;  2F0H A;  3NHH A;  1PTO B;  1HFG A;  1I50 B;  2M00 A;  3EVQ A;  3S15 B;  1FNU A;  4IUU A;  3KK7 A;  4ZKC B;  3M3Y B;  5FK9 C;  3GTG B;  4IFD G;  1PFN A;  4N9P A;  3VR3 A;  3NE5 B;  1JWU D;  1IKL A;  3PUW A;  1U4P A;  4CJ2 C;  3ERO A;  3S1Q B;  2JP1 A;  1DYQ A;  3S2H B;  5KND A;  4GZY C;  1ZXT A;  2B39 A;  2PW5 A;  2R6G A;  3HOU B;  2PNR C;  3HOZ B;  4TQU S;  1IW7 C;  1IL8 A;  2IWH A;  3PO2 B;  5JPM C;  3SK6 A;  1HRJ A;  3T56 B;  3OWE B;  5EBD A;  3HKZ B;  2F0L A;  1GHJ A;  3D4W A;  4RGM A;  4KKT A;  4XTC S;  1RDP D;  2F0M A;  2TMP A;  4O1N A;  3FDT A;  1DD2 A;  1E0B A;  1RD9 D;  2B2Y A;  3TZD A;  5CYU A;  2WII B;  4XXE A;  3C3L A;  1AEX A;  1I4P A;  1GHK A;  2XWB B;  4DF7 A;  4XQN A;  1F9S A;  2VUM B;  4V0B A;  3QB3 A;  5JPN C;  1TS4 A;  1G6Z A;  1UEA B;  5M5Y B;  3NQT A;  4IAL A;  4DNR B;  1WCM B;  3TP8 A;  3CRK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...