4F8MA

Crystal structure of staphylococcal nuclease variant delta+phs v23i/i92v at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4f8mA00
1SNCA 5CGKA 5J39A 1SYBA 2F0HA 2EY6A 5IGDA 3U9OA 4B9XA 4G57A 1ENAA 4OL7A 5CV7A 2KQ3A 3DMUA 4ID6A 3SHLA 2F0EA 1EY5A 2EYFA 4NMZA 1KAAA 3H6MA 3RUZA 4K2LA 4KY6A 3TP8A 1SYEA 5IGBA 5KYLA 2F0MA 2F3WA 4ME5A 3HZXA 5DEHA 3NQTA 2PW5A 3TMEA 2EYJA 1KDAA 1SYDA 4EQNA 3C1FA 4N9PA 2QDBA 3MXPA 5CV5A 1TT2A 2F0SA 5C6AA 1EY7A 1F2ZA 5CV9A 4J1MA 2F0PA 3OMGA 2HQEA 3QOLA 3C1EA 1STYA 3SXHA 2SOBA 5K5PA 2F0WA 3E5SA 1EYCA 2F3VA 2NUCA 4DU9A 4QF4A 2PZTA 5IGCA 2OXPA 5KYIA 3D8GA 3MVVA 5J1ZA 1STHA 5NUCA 5IGGA 2F0NA 4K5WA 1SNMA 3NP8A 5C4ZA 1A2TA 5I9PA 5KEEA 5IGEA 2F0GA 2O4XA 4HMIA 4K8JA 4NKLA 4PMBA 2PW7A 4DFAA 4EVOA 2EYPA 1EZ6A 1STGA 3PMFA 4KD4A 4H7BA 4QB4A 5C4HA 4ODGA 4WRDA 1EY0A 4J6HA 4ZQ3A 5IIFA 4KHVA 5CR3A 1JOKA 1NUCA 3SK5A 4WORA 4K5XA 1JOOA 4LAAA 4PMCA 4QMGA 2LKVA 2SNSA 1EY9A 2EXZA 2M00A 2PYKA 3D4DA 4EQOA 1KDCA 4NDXA 2EYLA 1KDBA 2F0DA 3EROA 5C3XA 3SK4A 3V2TA 4I65A 1NSNS 2SNMA 4KD3A 5I9OA 1U9RA 1STBA 5E3FA 5ISRA 4KY5A 5C5LA 5EKLA 5KRUA 4KJNA 5EKKA 1A3VA 2F0UA 4E6IA 4F8MA 3QOJA 5I6WA 4PNYA 3NUCA 4YIJA 1A2UA 1STNA 1A3TA 3DHQA 5CV4A 2OEOA 4N9TA 2F0VA 3SR1A 3NK9A 2EY2A 3ITPA 2EYMA 3VA5A 1F2MA 1TQOA 3OMCA 4K6DA 5CC4A 1AEXA 1EY6A 3T13A 4KTAA 2KHSA 4KY7A 2PQEA 1TR5A 2F0JA 2F0QA 5M9OA 4IUNA 3NHHA 1RKNA 1SNOA 4K8IA 3BDLA 2F0OA 1SYFA 2RKSA 3OWFA 1EY4A 1SNQA 2EYOA 3T16A 4K14A 1SYCA 4F7XA 2EY1A 2WACA 2F0TA 2ENBA 2EY5A 2OF1A 3P1HA 4K2KA 5C5MA 1JORA 5KGUA 3EJIA 1KABA 4IZ8A 4KJOA 4IALA 4NP5A 1EQVA 3MEHA 5JOBA 1SYGA 3D6CA 5C3WA 1SNDA 4TRDA 2F0LA 3S9WA 4HTHA 1JOQA 5E1FA 4ZUJA 3EVQA 5CV8A 3LX0A 4KV6A 3TP6A 5IOCA 2PZUA 1STAA 1EY8A 4MIUA 5I6YA 3OSOA 1ENCA 3TP7A 1EYDA 3BDCA 4HMJA 5EGTA 3SK8A 1IHZA 4EQPA 3R3OA 1SNPA 4DGZA 2EYHA 3ERQA 5HGTA 3SK6A 1II3A 3P75A 3MZ5A 3D4WA 4R8NA 5J22A 4ZUIA 3TP5A 2RDFA 4K5VA 5DAUA 4B9WA 4DF7A 2F0IA 2PZWA 5CV6A 5IGFA 4RKLA 5HURA 3NXWA 5F2DA 3HEJA 1EZ8A 3MHBA 3QB3A 2F0FA 2F0KA 4S3SA 4RKBA 5JAVA 2RBMA 1F2YA 5IODA 5KIXA 1EYAA 1A3UA
chains in the Genus database with same CATH superfamily
1WD0A 5IGDA 4X3SA 5EAYA 3S1RB 3VA7A 3PO2B 2K5DA 4TQUS 3GTGH 4B3ML 2B2VC 3KDFA 3D31A 3TP8A 2I46A 1SFOH 1IXRA 1CM9A 1KDAA 5IYDG 1WTQA 5CV5A 3A7AB 4DAVA 1ZEQX 2R93B 1CT1D 3H3VI 1EOTA 3FKIG 1B3AA 1HFNA 3SXHA 4DA2A 1NJIC 4V0BA 4F87A 4OO1G 2NN6H 3MVVA 4WJ4A 3MA2B 4JBMA 2VUMB 2B39A 4B3SQ 2ZM6L 4HIDA 4K6LA 1YJ9A 3L9AX 3ULPA 5IGEA 5EBDA 2AMCB 4DFAA 2K05A 4EVOA 1VQ9A 3PMFA 4HN7A 3HOZB 2DNCA 2L0CA 3NQIA 1G51A 4A3GB 1CKMA 2LS01 1TU2B 4A3MB 4GZYC 4RWSC 2Z6KA 1VF7A 3X3NA 3KUPA 2R93H 1CQFA 1G91A 1VQLA 5CBAE 4E6IA 1PVOA 4UPAA 4DV7L 4QQBX 4JBKA 5J3BA 3U4VA 1D1IA 1VQHA 2EYMA 5EPKA 2Z1CA 1L1OA 1PH8A 1E0BA 3NBIA 4JI5L 4CJ0B 5GADC 2AWOA 4YY3L 2RKSA 4IO9A 2EIFA 3RNUA 1SNQA 3O13A 2L1BA 2NYZD 2ENBA 3I7FA 2EY5A 1GUNA 3UI2A 3CHBD 1DOLA 4P74A 1XMQL 2F3IA 3S2DB 1Q82C 2F0LA 1HR0Q 3K7UC 2F03A 3J80i 1K28A 4CKCA 1LT3D 4DPGA 3IAYA 3SK8A 2L4NA 3QG1A 2HHHQ 3KFUA 2EZVA 2WB1G 3T4AC 5BN4A 5J22A 4K5VA 3I70A 4UP8A 5DAUA 3KK7A 1M1KC 1IBKL 1WTVA 5C44G 1CHPD 1FJGQ 1PV4A 2F52A 1YIJA 4HAEA 2N49A 4C3IG 1C4QA 2B2UA 4RKBA 3S24A 4A3CG 3MFGA 4C3JH 4RGNA 3U9OA 4KHPL 2JN4A 2F0EA 3S2DH 4K2LA 4OELB 1Y14B 4IURA 2Y0SE 1PTOB 4IPHA 4A3KG 4EQNA 1EWIA 4BBSB 1W3SA 1KNEA 2CQOA 2QILA 2MQHA 2CQAA 1MD2D 5ELFA 5IYCG 3E9IA 1E24A 4P72A 3RZDH 2O5JC 1QVGA 1CI3M 2RDGA 4YCUA 3F2DA 1C0AA 4DR2Q 1FNVA 1EQQA 1CFMA 1CZGA 1RL2A 2V4DA 4Q5VA 2ZJRA 4ZQ3A 1TIID 1IW7C 2G9DA 2GA4B 4KHVA 1EYGA 1F9RA 4K5XA 1HTLD 4ZLTF 4A3LG 1PRTD 1PTOH 2LMCB 3AFQA 2WINB 3K5NA 1DJRD 1N34L 1WTPA 2A74C 4X3KA 4HR7B 5EKKA 3HOXB 4F8MA 2K01A 2IHEA 2Z6KC 1K8GA 4JPBW 3HOYB 1XPRA 1AEXA 5D3DA 1OXSC 1KXLA 1WTRA 2KCCA 2I5MX 1L0YB 3OIPA 2VW9A 1L1OC 1EQRA 1MSGA 3IFDA 5M3FB 3RN5A 1EEFD 1O7LA 4P75A 4L5QA 1ESFA 3GQBA 5IP7H 4RG1A 2D0PA 3BDCA 2IJ0A 4FXKC 4EQPA 1I3QB 1K0SA 3STBC 4DV3L 2PQAB 1TWHB 3QWNA 3PGZA 3T1HQ 3PUZA 4LF9Q 2UUCL 1S5ED 3UE0A 1F9SA 1NMGA 1KAWA 3BVMA 4DR5L 5CV6A 1TWFB 4I7AA 4ILWA 3M4OH 4JI1L 1SR3A 4A3IH 4G57A 1ENAA 1CA5A 1P8LA 1IBLQ 1PH6A 1EY5A 5FLMH 2K14A 5M3FH 3H6MA 2IX3A 5IGBA 5FK9C 1HNWQ 5IWAL 3K5LA 3MC0B 4ME5A 1SDFA 1SYDA 2B2YA 1STEA 2F0SA 1EWHA 4LF5L 2HQEA 5BR8L 3I3CA 1VQKA 4CKEA 3KF8A 3GV3A 1B53A 2AQ2B 2F3VA 5BN3A 1JCKB 4FVMA 1GUGA 4DN4M 1YNJC 1I6HB 2QKIC 4DV5L 2KVMA 4KHZA 5M3MB 2J7ZA 3S16B 4DR7L 4BY1G 5ELDA 2X6GA 4QMGA 2H1EA 4HEDA 4HIOA 4NDXA 1LT5D 4H44C 3GTKH 3V2TA 2EJGC 3DUZA 1E1OA 1DYQA 1Q1BA 3NWTA 2A8VA 1LTTD 2MP1A 1WD1A 1V43A 2UUBL 5M5XB 1HZBA 5LL6S 4RMFA 1A2UA 4XQNA 3J7AV 4LK1C 4KY7A 1I6HH 4GNXB 1BKBA 2F0OA 5IYBG 1TWCH 2GVAA 4Z9CB 2OQ0A 4JVZA 5M3MH 1H9RA 2F0TA 3S16H 3EA6A 2KEEA 4LUZA 4LJZC 3A55A 2QDLA 2IY5B 1IBMQ 3OPOA 4A76A 1DM0B 1TXYA 2J0TD 1N33L 2BOSA 4R4QA 2FINB 1D2BA 1C9OA 1X6OA 2RDHA 2JA8B 1IL8A 4F88A 4ZK9B 1ENFA 3CP0A 3J7YW 5FO9B 2XN9C 3H94A 2N88A 1HNXL 1E22A 3KF6B 3E0JA 4DUYQ 3HFZB 2A6HC 4L5TA 4JI4L 2EVBA 3CC2A 4YHHQ 4DNIA 1WJJA 4KN4C 4A3FH 2E2IB 1OXVA 1IW7D 3U9SA 2OT2A 5KYLA 4LMQD 3MXNA 4YCVA 1BF4A 3RR5A 3M85A 5LMUQ 2QF7A 1E7ZA 1FD7D 4U68A 3S1QB 2IW3A 4JOIC 3RD4A 1I4GA 1EYCA 3C3LA 1Y1WB 5J1ZA 1S5BD 1Q12A 5JEAG 5IT9c 3PO3B 3OYYA 3RLNA 2YTYA 2O4XA 1SJED 3NSWA 4CJ2C 4X3UA 2PW7A 1TS2A 1Y8PB 2UXCL 4B3MQ 1PXUA 3NWSA 2O5IC 5T1GA 4KK7A 1OXTA 3HG9A 4WORA 1KRSA 3J7A5 2MUYA 4JI6L 1V1PB 3L2PA 2MHVA 1QUQA 1VQAA 3CQZB 3AU7A 5H1SE 1UE1A 2K33A 2LFNA 4Y52H 2EOTA 3STBD 1QE6A 4IPDA 2ZM6Q 1S5DD 1WFQA 4K6DA 2UXDL 1TY2A 2EJMA 4UHVA 5BN5A 2N8NA 4A75A 3J80E 3PO3H 4A3JH 4OWXB 1K0RA 2MPMA 2LY7A 1X3PA 4H0LC 4IJLA 4C3HB 1ICWA 5D14A 4JI7L 2Z4HA 4GLVB 1BXTA 2EDGA 4LUVA 2XWBB 3EVQA 4LWCA 5C0XH 1WYDA 4CJ1B 1EY8A 4BBRB 4DV7Q 1SE4A 2IX0A 5C3EB 3CCSA 5FJ8H 2R93G 3OOCA 4OO1I 3BJUA 3T1HL 4KKSA 4JI5Q 4YY3Q 1Y8NB 2A69C 3QB3A 4CKBA 1YNJD 4LF4L 5IE8A 3TN2A 4JCVE 3D0FA 4A4IA 1EIFA 1MJEA 1XMQQ 3T1YL 4V190 3BZKA 1B7YB 3E9HA 4DK6C 4GN3B 4C3HH 2ZJPA 1UE6A 1RODA 1IYJB 2SEBD 4A3EH 1FYCA 3L0OA 1D5MC 5FLXc 3TMEA 2PW5A 1G2SA 3S1NB 4RH6A 5C4XG 1KQSA 2QDBA 3PCOB 2L55A 2Q2IA 1H95A 1EY7A 1JB3A 1HTPA 4DK0A 1AZPA 4TSSA 4LFAL 1ICFB 1W6JA 2PZTA 1GHJA 3S1MB 4CDFC 1WTXA 1I94L 3WOEA 4DV4L 1IL2A 2HDMA 1AE2A 1PYWD 1EQTA 4DXGA 4KHPQ 3I91A 4MN3A 2DJGC 2PO4A 3HOUH 5COYA 4C3JG 2K5VA 5AFWA 1SRUA 2PCFB 5IIFA 1GOZA 3HP3A 1J9OA 3P20A 1JOKA 1O78A 1VQJA 4HJ5A 4LAAA 2XSCA 4X3TA 1YEZA 1C48A 1EIYB 3AYHB 4X66L 4DXFA 1PFMA 5ISRA 3A54A 1I4RA 1JQYD 4XXEA 3GTPB 3A8JE 4JK1C 2E8GA 4BY7H 2BE5C 4N9TA 3K5MA 2L9HA 3S1MH 2K03A 5TSSA 3X3MA 2JA7H 3DEPA 4K0KL 4IUNA 1SYFA 3I90A 1PH5A 5CORA 2A6HD 2EY1A 1VQIA 2K75A 4A3DB 4AYBG 3P1HA 5C3WA 4BA1I 4C2MB 1SNDA 5ELEA 2XGTA 1WOCA 1N34Q 4GKJL 5IOCA 1VQDA 5JJLA 4FXDA 1HUMA 1LTLA 2Z4IA 1YJNA 4BXXH 5EGTA 1PTOF 3R3OA 3NTKA 4C1NK 1EEID 2X69A 4RAUC 2HQLA 3H0GB 3J80L 4WJWA 5LMNL 5AJ3L 1RHPA 2NVTB 1NBWA 4DKAC 1YZ6A 3NXWA 2GVBA 3A0JA 2F0FA 4DUYL 2NVYH 1BCPC 1T5XD 3TS2A 3PIOA 2F0HA 4A3DH 3N52A 2N3SA 1N9WA 4DAYA 3C46A 3DMUA 3QO2A 4RCOA 3VR5A 1LTRD 1X9NA 2MO1A 2UU9L 1RJTA 4A93B 2Q2HA 4DV3Q 3CRLC 3C1FA 3T51B 1YBYA 5A35A 5EPJA 5CV9A 2UUCQ 2DNEA 3CXCA 1HXYD 4DR5Q 3HOVH 1QZHA 1JWUD 2PQAA 1VMCA 2SOBA 1ONLA 2WAQG 3VR4A 2NVTH 5LL6X 3TREA 4JI1Q 5C4ZA 1A2TA 1MBYA 4LFCL 1B44D 3FPUB 2JE6I 4IQZA 1EU3A 4AIMA 5IWAQ 2MJ8A 4A3IG 4LF7L 1EIHA 3BG3A 2E74C 2JYOA 2IWHA 4PMCA 4FDBA 5FLMG 4IFDJ 2PYKA 3NENA 3CAMA 2JQOA 3PUVA 4GOPB 4QGUA 2E5LL 4LF5Q 2KUMA 5BR8Q 4KD3A 3PSIA 1R9TB 3CU7A 1XWEA 3OW2A 2PPBC 3EBEA 1G8ZD 4L5SA 1YNXA 1EUJA 1MIUA 5E4XA 2F0VA 2B2WC 5LHY1 3JAME 1G6PA 2L5TA 4DV5Q 1VQ7A 1PTOC 3TQYA 3A8KE 3G48A 3OWEB 2E2HB 3MTSA 4PG3A 4LNQA 1F9PA 3S17B 1MKHA 3S1RH 3OWFA 4DR7Q 4MZ9A 3PO2H 2NZ1D 1VQ5A 1NR2A 2B2TA 1CQVA 4WFN3 3G6JB 2BH2A 1B9MA 4IZ8A 3RLOA 4WJ3M 4DAPA 3S9WA 4TRDA 5JVH3 3NPPA 1CKNA 3LX0A 4UP7A 2RCNA 2BCOA 1XNRQ 3I4MB 2UUBQ 4HMJA 2PNRC 3MWYW 4GLXA 1EIGA 3DM3A 1II3A 4A3BB 2VB3X 2WFWA 3EN2A 2VUMH 3DWPA 2PZWA 3HKZG 4HSVA 5IP9G 4M1UB 1JWMD 3HOZH 2R92B 4DUZL 1S4ZA 3ONAB 4A3GH 1KTKA 5JAVA 1GXDC 3SGIA 4GNXA 4A3MH 1U4RA 1AP0A 3Q22A 1LTAD 1PRTB 3QR8A 1SYBA 4OL7A 4HCEA 4PZ7A 1LTSD 2V1CC 3ZJYC 4KY6A 1X54A 2XNAC 4L6TB 1N33Q 2KCNA 2EYJA 1CZWA 1Q7YC 4O1NA 1HA6A 1RF2D 2JEBI 2C9OA 1VQ4A 3OMGA 1M90C 2B63B 1LV9A 1J5EL 1HNXQ 1STYA 5L37A 2K52A 3F2UA 2F0WA 3R2TA 4JI4Q 3BZCA 2F0NA 2JA6B 1F77A 1SNMA 1KNAA 2K6AA 1HZCA 1X65A 2Q8RE 1Y1VB 2PI2E 3KF6A 1OXUA 4JC0A 3CF5A 2OWOA 1DONA 2R7ZB 3R93A 1YI2A 2CKZB 1KC8C 1D6EC 4DV0Q 2RQXA 1GUOA 3U4ZA 1FR3A 4X62L 4A3FG 2NVQB 3BZDB 1L2FA 4BA2I 2A68D 1YITA 4H13C 3DLLA 5KNCA 1JR0D 1RCVD 1VMPA 1STBA 2EXDA 4LW1A 1GUWA 1F2LA 2K4KA 3VYUA 5I6WA 2B63H 1MSHA 5GQOA 2Z9HA 3LWUA 2YU9B 3GV6A 3ITPA 1F2MA 5CC4A 2UXCQ 3D6WA 2I5LX 1D7QA 2JA6H 2FMCA 2M9VA 3ICEA 1K73C 1YNNC 1B70B 2K7VA 3R8BA 1BCPD 4JI6Q 1SXTA 5EKIA 5KNBA 3HOWB 2OF1A 2QW7A 1JWSD 4BBSH 3MEHA 5HY6A 3I4NB 1I4QA 4Y7NB 4IOAA 1AFPA 1V1PA 1JMCA 2B2TC 2E75C 5DLQE 1E2WA 4DGZA 1Q8IA 1RDPD 3KLWA 1WCMB 1TS4A 1H9SB 2UXDQ 3D4WA 4DF7A 4HIKA 5GROA 4YWKA 4FP5D 2JA5B 3HEJA 2OTLA 1HZ9A 1X3EA 3MHBA 4JI7Q 4PZ6A 4A3JG 1WI5A 1NCVA 4HJAA 3H09A 1YHQA 4JV5L 2I07B 3P7JA 5CV7A 4ID6A 2CVRA 3I4NH 3NQTA 3ER0A 2H4OA 4JBWA 3HOXH 5C0XG 1XX8A 3QJYA 4N9PA 2TMPA 1RIPA 3PIP3 1Q86C 3HOYH 1V8QA 5FJ8G 1ZYRC 1BO0A 4PMWA 3OW7A 4IOCA 4LF4Q 3HS0C 3FKIB 4QF4A 2QCPX 1N8RC 1H9MA 2C35B 4K5WA 2Y0SG 3T1YQ 2D62A 1S72A 2HD3A 4UP9A 1FGBD 1FGUA 4NPSA 1ASZA 4H7BA 2B2UC 2P5ZX 1I6VC 1SLJA 1SN8A 4WRDA 4U673 3DM1A 3BYYB 3AFPA 1JJGA 4A3EG 4IN3A 5E4WC 3A56A 1X3GA 1BBXC 1I3QH 3DXJC 3PUYA 4IFDI 1XJVA 1TWHH 4LFAQ 4RFBA 3ZYYX 1I50B 4KJNA 1A3VA 3DWAA 1I94Q 4DV4Q 1PLFA 3FPPA 2BA0A 3NUCA 1N32L 1TWFH 4OONA 1VDZA 1W6KA 3M7GA 1F9QA 3S15B 3K7AB 5D3IB 2UXBL 4GN4B 4KKUA 4DV2L 3J81c 1PH4A 2F0QA 1PH1A 4OO1H 5ELOA 3BDLA 2K32A 2YYZA 2QA4A 4JI8Q 3T16A 1SYCA 4GLAC 3HOUG 2XRSD 5I2XA 2WACA 1HNZQ 1YVCA 2ICIA 2CH4A 2OQKA 5C5MA 3AEVA 1D5ZC 2EPBA 2KA7A 2K5HA 1EQVA 3U58A 1SYGA 4X66Q 2VNUD 4APVA 4CHTB 5CV8A 4KV6A 1XNRL 5HGTA 4XT3B 3C2PA 1QOHA 2A1AA 4OWTB 1J8IA 4R8NA 4K0KQ 3TP5A 4JW0A 2WB1B 4BY7G 4GN5A 2PNHA 3K7AH 2VZAA 2ZXPA 3L7ZC 5A2QE 2JA7G 5C44B 3IL8A 1O7IA 2F0KA 1CSQA 1F2YA 5IODA 1FVIA 1EYAA 2ATWA 4C3IB 2K1BA 3JAMi 1D1KA 4GKJQ 1A8VA 3WWVA 3HRZC 2K28A 2F3WA 4B08A 1PH3A 4KMUC 4YWLA 5M5XH 2WKCA 4KI0A 4MHEA 4NXNL 4BXXG 4A3KB 5LMNQ 5AJ3Q 3S14B 1I4PA 2RVLA 1PA6A 2AHOB 1I4XA 5NUCA 1T5EA 4DR1L 5C44H 1JC7A 3RZOB 3EFXD 1EZ6A 2UU9Q 2FJ2A 1YNND 2VQFL 1VQMA 4KD4A 1CA6A 3UE1A 4A3CH 4DV0L 4NW2A 5CR3A 1NUCA 3MXUA 1Q1EA 2A5HA 2UUAL 2QEJC 4G4KA 4O42A 1KDBA 1Q81C 4PV1C 5I9OA 2JA8H 5E3FA 4LF6L 1M4VA 4RHSA 5D65A 1KD1C 3G7LA 2F0UA 2B2YC 3KJOA 2M2LA 3HOVG 4LFCQ 1A3TA 3NBHA 4BS9A 1LO5D 1NTGA 1AN8A 3FVQA 1VQNA 2EY2A 4IPGA 3TZDA 3SE0A 1HRJA 1A15A 4LF7Q 1ML0D 2E2IH 1D5XC 3K6OA 5DM63 5C0XJ 1CKOA 2E5LQ 4KJOA 2F4VL 4FF3A 2YV5A 4JYAQ 5IY0A 3I56A 1TY0A 4X6AH 4FXGC 4GOPA 3S1QH 2KENA 1IHZA 2EE1A 2XRQD 3A7LA 1S5CD 1Y1WH 1OXXK 1GKHA 1B50A 4ZCKA 2NN6G 4ZAIA 4G7HC 1J6QA 2IL8A 1XNQL 2TSSA 2DGYA 2RBMA 5KIXA 5CGKA 3PO2G 3MEFA 4I7ZC 3S2HB 3CMAA 3CQZH 1VS0A 2EYFA 2Z8LA 1LM0A 1QVCA 3FDTA 2VY3A 2RHSB 4R4CA 2VB2X 2MFIA 3J81j 2Z6BA 4CGYB 1L0WA 1GM5A 1K83B 5JPNC 3MAQA 2NVXB 5CMDA 4DUZQ 3H3VH 4QIWE 4KN7C 2VUMG 3GTOB 5ELBA 4B3RL 2GN5A 4KKTA 1PYBA 1HH2P 4AYBE 1LTGD 1I5FA 3HOZG 3TEHB 1A0IA 4HMIA 4A3GG 4K8JA 4QUCA 1VQOA 4DNTB 4A3MG 2CH4W 1STGA 4MTNA 1XYIA 3S2HH 5IT9E 3BVZA 1EY9A 4BBRH 1HPCA 1VQBA 3I73A 5C3EH 4BY1B 2RA4A 3G4SA 5GAEC 1J5EQ 2K5WA 5M5YB 1GO3E 1C8CA 1RD9D 3U50C 3M7NA 3K80C 4MNOA 1BOSA 5KNDA 3NEMA 2ZT9C 1DD2A 1TWAB 4R4IA 2KOLA 3J7AF 1STNA 1R4PB 3Q6SA 3GTOH 1PFSA 1W2BA 1GHKA 3KF8B 4POFA 1X3FA 2RSOA 1B3QA 2F0JA 2XWJB 4TKOB 1MJCA 1UNSA 4JI8L 3GTJB 4X62Q 3GTMB 1HNZL 4O0AA 1PRTF 2B3GA 2WIIB 2Q8IB 3VDYA 2I5HA 1QB5D 3EJIA 3S1NH 1VF5C 4RCNA 2HUGA 5ELCA 4HTHA 4P71A 4DR3L 2PMZE 2ZTEA 2ZTCA 1QNUA 2QGQA 4XYQA 1BR9A 3SK6A 1R4QB 2R3ZA 2HIVA 4EGVA 1UE5A 3J7ZC 1TWAH 2F0IA 3I72A 2HCIA 5HURA 1E1TA 2JA6G 5K36H 1ZKOA 1TWGB 4AQYL 1QZGA 1C7YA 2NZHA 2XVSA 2K5QA 2IHFA 1WTHA 3SHLA 5M5WB 3K8AA 4BBSG 3RUZA 4QL5A 2HCCA 1YJWA 5JEAJ 5G3LF 3E0EA 1TT2A 2FFKB 3GTPH 4OGQC 1VQGA 4OX9L 2ZTDA 3MXGA 2ASBA 1UUPA 4L63B 3WOFA 2F4IA 4B3TQ 3PIO3 5FLXE 1X32A 1H9SA 2WV6D 2NUCA 1K3RA 1SMXA 2OXPA 2C5CA 3D8GA 1U4MA 1JT8A 4JV5Q 1SROA 4LFBL 2ICEC 2L12A 1LLRD 4IUUA 2MO0A 2EYPA 1Y69U 4C2MH 3F8TA 5JJIA 4QB4A 1UEBA 3TS0A 3GO5A 3SK5A 2Q2TA 1JOOA 4IPCA 5IP7G 3D4DA 4QCLA 2L11A 5JJZA 2EYLA 3GD7A 4X64Q 2B8GA 4OIKA 1PH2A 3GTGB 3Q23A 3HOXG 1PRTC 3HKZE 5C3XA 3CCEA 1K8AC 4LUOA 4AH6A 3H0GH 1SFOB 1SE2A 5FOBB 3CC7A 3QOJA 3HOYG 3E3XA 2LSSA 2YTVA 3DHQA 2R7DA 3CCVA 3SR1A 1UAPA 4IJHA 4KTAA 4UAIA 3EQLC 4XTCS 1XPUA 2EYOA 5IT9L 1PMRA 4FNFA 4A93H 5M3FG 2WB1E 1ILPA 4K2KA 3KBXA 1JORA 4N8X1 4XT1B 1QJOA 1WVLA 5C0XI 4JYAL 5E1FA 2QEXA 1S3OA 5JJKA 5C4JB 1E3PA 1NMFA 1Q8KA 3EIVA 2KECA 1N32Q 2HDLA 1LABA 1QUQB 2NBFA 4DV1L 2UXBQ 3MFYA 4DV2Q 4B9WA 2A69D 3LNNA 4JI3L 3RLFA 2ALYB 3J81i 3I4OA 4H02A 4L8JA 4FF1A 3GTQB 5FO7B 3M4QA 4CBVA 1HFGA 2A73B 1PDQA 3NTIA 5J39A 1NAPA 3VYRA 3PUWA 2KQ3A 4DR4L 1IYVA 4NMZA 3I8ZA 3IRBA 5LMNW 3R2IA 1RTOA 1R9TH 4EX5A 1VQCA 5C4JH 4ULLA 2NTSA 2N55A 5ELNA 3CPWA 2IT1A 1PH9A 5C4XB 2J4XA 1NY4A 1D8LA 4XQJA 3QOLA 2E2HH 4DR6L 4IFDH 2HIXA 5K5PA 3S17H 3CCUA 1BCPB 5IGGA 1PZKD 1NNXA 4RGOS 3GTQH 5KEEA 1P16A 5M3MG 1RTNA 4PMBA 1BDOA 1Y8OB 1UEAB 1B8AA 4RGTA 3GTLB 2A19A 3NTHA 4C3JB 2VQEL 3I4MH 1ET9A 5HGQA 3F2BA 2AWNA 4NXNQ 4C56C 3W1BA 3PF5A 2DN8A 1O80A 1TS3A 4A3BH 3VR6A 3ERSX 4JI2Q 5FLXL 1V1QA 1X56A 5C4XH 4Q0FA 5EKLA 1KIXA 4DV6L 4FO2A 2BE5D 1B9NA 3D4RA 4ME3A 3CC4A 2R92H 3Q0AA 4DR1Q 1PHJA 5CV4A 3TBIB 3NK9A 3OMCA 2I0QA 1QWYA 1MGSA 3TZUA 3IFTA 4MTKA 1KLGD 2D0OA 2VQFQ 3OTOL 3VR2A 3T53B 2FMMA 3PQIA 4YWMA 4HIMA 1SNOA 1I4HA 1JB7A 3FMCA 3RZDB 4HJ8A 1XMOQ 3W1GA 1H9JA 4CDCC 2UUAQ 1CHQD 2BA1A 1OTCA 2RCFA 4QIWB 2BDNA 3GTLH 3KYHC 4NP5A 3SVMA 3AMUA 1VQ6A 4AYBB 1L0XB 1SJHD 4FYDA 4LF6Q 1SMYC 1V9PA 1U4PA 2PZUA 3A5ZB 3LGJA 1JE5A 1UE7A 3I2ZA 1AH9A 2AKWB 3AQQA 1XTCD 1GUSA 1UWVA 2VL6A 2EYHA 2ZXRA 2JA8G 4R9WA 3MZ5A 1N36L 1CK1A 3G71A 3BS1A 1Y1VH 4HJ9A 3M4YA 1LT4D 4RKLA 1G6ZA 2R7ZH 3FEWX 1EZ8A 1BUVT 3ULLA 2DUDA 1XXGA 2F4VQ 2NVQH 3HGBA 1IYUA 3UDGA 3DEOA 1Q46A 4J8QA 4NXMQ 2R6GA 3CD6A 3HZXA 3JAML 3GP7A 4C1NI 2PI2A 1AE3A 2B8FA 3Q8DA 2YU9H 4J1MA 4B3TL 1A63A 4OXPA 1Y1WG 1DOKA 3CW2C 4O2DA 3SEBA 1XNQQ 4POGA 2AQ3B 4BWGB 2LXKA 3PO3G 1VQEA 5KYIA 4KLKA 2PMZB 3UDIA 2WAQB 4X65L 1BVSA 1GVPA 3HOWH 2F0GA 2XTIA 3I4LA 2KBNA 2EQSA 2NWGA 2R61A 4GNXC 2K50A 1K8MA 4Y7NH 4OWWB 1VQPA 3M4OB 1TKWB 3HKSA 4A3IB 2ES2A 4DAYB 1PFBA 4X64L 1K3BC 1WCMH 1E2VA 3CRKC 2NN6I 4I65A 4JI0L 2SNMA 1DGSA 1MI2A 5KRUA 4B3RQ 1QNKA 1VQ8A 4IUVA 4PNYA 2JA5H 1PTOD 4YIJA 5DM73 1K8OA 5G3LD 1TQOA 1X55A 3FRPB 4CDDC 3K0XA 4J15A 2H5XA 1VCIA 4R4TA 5M9OA 4LF8L 1TR5A 4OEMB 4C3HG 2RSNA 2JA9A 1JJ2A 3F1ZA 1EFWA 3K58A 3URYA 3BVGA 2VS1A 1A6XA 3BDOA 4GKKL 3PIPA 3KDFB 5KGUA 3K5OA 4IALA 5JOBA 1JOQA 4BBRG 1SSOA 5EQ0A 3TP6A 5IYDH 5C3EG 4MIUA 4ZKBB 2BH8A 3KLSA 1SBBB 1ENCA 3OSOA 2Q2UA 4JOIA 2KJXA 1TVXA 3ERQA 3FKIH 3P75A 3GTKB 2RDFA 2R7FA 1AZQA 1DOMA 1Q90A 1HQMC 2NZOA 3BYTB 1IKMA 4N8FA 2ID0A 5EBCA 4FF2A 1BBWA 1Q3LA 4IUPA 3HKZB 3B6YA 4L5RC 4G7ZC 4R1JA 5FKAC 1A3UA 3VYSA 1SNCA 4B3SL 1YHBA 4DR3Q 2EJFC 2N78A 2YTXA 1TWCB 4UY8C 3V05A 3TRZA 3M4PA 5DEHA 1DCZA 1I50H 3H91A 3W2DA 3RN2A 3SDZA 1CKNB 3JC66 2A6EC 2KHJA 2E2JB 3D3RA 3K57A 3S15H 3KJPA 3C1EA 1PH7A 3G6EA 2G5DA 4TVAB 3VYTA 1SE8A 2D5DA 2KCTA 3TDQA 1L1OB 4AQYQ 1OO9B 1MHWC 4JG2A 5I9PA 5IP9H 5K36G 3PUXA 5E7NA 1GJXA 2JK8A 3ND9A 4DK1A 3NE5B 2MNAA 3H3VC 5C4HA 3ULJA 1LACA 1ASYA 2BDOA 1ILQA 1FL0A 1TS5A 1V1OA 4ALPA 2LKVA 1HUNA 1HCZA 2EXZA 1EOVA 5EPLA 4OX9Q 3UDFA 2LXJA 4A3FB 3M3YB 1SMYD 3EROA 1E2ZA 4JI2L 1NSNS 3PF4A 1BNZA 1HR0L 2CW0C 2F1MA 4KY5A 2E2JH 3J80c 4HCSA 4XIGS 2E76C 4LFBQ 1ZXTA 2OEOA 2AUKA 2HHHL 4QUFA 1DXMA 3VA5A 4C3IH 3UDXA 2KHSA 3BU2A 3CCLA 2ZXOA 1WTOA 4A3DG 5FO8B 1U5KA 1XMOL 2Z0SA 1FJGL 1BBUA 4EQ5A 2Q8TA 1K9MC 1A62A 2D9UA 1KABA 4OHJA 1O7ZA 3J81E 4A3KH 2WP8J 3K81C 4PZ8A 5JPMC 3M3YH 5I6YA 3S14H 1M8AA 1LTID 1SNPA 3H0GG 4M8AA 3N6RA 1O7YA 4ZUIA 5IYCH 5CYUA 3CCQA 1AW7A 2MGSA 3RZOH 4G7OC 3AB9A 4IUTA 5T1IA 4S3SA 3H15A 2X6LA 4R8IA 1B1ZA 2HT1A 3A8IE 2EY6A 4B9XA 4A93G 1JICA 1H9KA 4A3JB 1S40A 4DR2L 3WDNA 1KL9A 5JVG3 3E6ZX 1QVFA 2OTJA 4NXML 1KAAA 4A3LH 5I4DA 4DV1Q 4ZKCB 3NELA 3DWQA 2ZJQA 2WKDA 1SAPA 1Z47A 1ZYRD 4JI3Q 1NR4A 3FP9A 3VR3A 2F0PA 1SEBD 3F2CA 1LYLA 1PYSB 1IZ6A 3LWEA 3TSSA 4DU9A 1BQQT 5IGCA 5CBEE 3KBGA 1T9HA 1LUZA 1HZAA 2IPKD 1GUTA 3CCJA 1EFID 4DR4Q 1FNUA 2DJFC 2Y0SB 2CWAA 2VXWA 4RGMA 2JSOA 4ODGA 1EY0A 4J6HA 2G9HD 1HR0W 2SNSA 1CUKA 4DAMA 2M00A 2RHQB 4EQOA 3W5OA 4ZYSA 1KRTA 4IUQA 2F0DA 2FHTA 4A3EB 2KHIA 1X3QA 5GAHC 4DR6Q 5A2QL 3T56B 4JBJA 5C5LA 1PFNA 1Z6HA 4IFDG 3K59A 4HJ7A 2NTTA 3I55A 1HJPA 3T13A 3Q24A 3CKIB 2PQEA 4LF9L 2JXMB 4GS3A 1DZ1A 1RKNA 4RHRA 1EY4A 2VQEQ 4K14A 2XIWA 3KOJA 4ABNA 4QY7A 1ET6A 2O2LD 3HOUB 1B4OA 3L3OC 3I4MG 2NVXH 1K83H 1QCBD 2JEAI 4DV6Q 1IBLL 2KCMA 3ND8A 4A3BG 1HNWL 1HQRD 4P2CB 3TP7A 1EYDA 1JE4A 1U4LA 2SDFA 2A6ED 1CSPA 2CHBD 3OTOQ 2R92G 1IBKQ 3CMEA 5DNFA 5GAGC 2RF4A 1Z9FA 1VQFA 3W3AA 5EJWA 4P73A 4RA8A 4DK3C 2B2VA 4BY7B 1BCPF 2D2CC 2NB0A 2K5NA 4FF4A 2JA7B 3J81L 3GDEA 2CWPA 1CTMA 4CDEC 4BY1H 1KLUD 2DY7A 2AUJD 1EWCA 3PV0A 1HA5A 2WAQE 5M5YH 1SYEA 2F0MA 4PQXA 1EU4A 1SE3A 3MXPA 1JJCB 1N36Q 1WTWA 2JP1A 5C6AA 3OIQA 2B63G 1F2ZA 4GOPC 4OIJA 2B2WA 4DNRB 2CW0D 1NE3A 1HHVA 2KEDA 4XYOA 3E5SA 3M9BA 3OHXC 2AQ1B 1Y1VG 1STHA 3GTMH 3GTJH 1IKLA 3NP8A 1G291 2R7ZG 2E2DC 5IYBH 1QILA 4NKLA 4NB3A 1FNWA 2FXQA 2NVYB 4R4OA 1XPOA 3CCMA 1KDCA 1ESRA 3JAMc 2DY8A 2A68C 3SK4A 1U9RA 3CPFA 1Z7TA 2CFMA 3V96A 3KLSX 1IBML 2K04A 1S5FD 1XTDA 2B29A 3KLRA 2CCZA 1KHIA 4ZRZA 4UDUC 4X65Q 4QJFA 3HOVB 1TWGH 1U0LA 1EY6A 1YHAA 4XDXA 4K8IA 3NHHA 1GD7A 4XQQA 2JJQA 3HOWG 5M5WH 4F7XA 1LTBD 3K0YA 3I4NG 4YCWA 3A5UA 4YHHL 3D6CA 4JI0Q 4ZUJA 5I2YA 3MXNB 1PZID 4HSPA 1PZJD 2L15A 3A74A 1STAA 3RMHA 3FHWA 1LT6D 1WCMG 1QG7A 1B2TA 5LMUL 4LF8Q 2JA5G 3IKJA 3QIAA 2OCEA 1EL0A 5JEAH 5IGFA 5F2DA 3NBHB 3CCRA 1G2TA 2IX1A 4GKKQ
chains in the Genus database with same CATH topology
1WD0A 5IGDA 4X3SA 3S1RB 3VA7A 3PO2B 2K5DA 4TQUS 2B2VC 3D31A 3TP8A 2I46A 1CM9A 1KDAA 1WTQA 5CV5A 3A7AB 4DAVA 1ZEQX 2R93B 1CT1D 1EOTA 1B3AA 1HFNA 3SXHA 4DA2A 4OO1G 4V0BA 4F87A 2NN6H 3MVVA 3MA2B 2VUMB 2B39A 4K6LA 3L9AX 5IGEA 5EBDA 4DFAA 2K05A 4EVOA 3PMFA 4HN7A 3HOZB 2DNCA 2L0CA 3NQIA 4A3GB 2LS01 1TU2B 4A3MB 4GZYC 4RWSC 1VF7A 3X3NA 3KUPA 1CQFA 1G91A 5CBAE 4E6IA 1D1IA 2EYMA 5EPKA 2Z1CA 1E0BA 3NBIA 4CJ0B 2AWOA 2RKSA 1SNQA 3O13A 2L1BA 2NYZD 2ENBA 2EY5A 1GUNA 3UI2A 3CHBD 1DOLA 3S2DB 2F0LA 2F03A 4CKCA 1LT3D 3IAYA 3SK8A 2L4NA 3QG1A 2EZVA 3T4AC 5BN4A 5J22A 4K5VA 3I70A 5DAUA 3KK7A 1WTVA 1CHPD 4HAEA 4C3IG 1C4QA 2B2UA 4RKBA 3MFGA 4RGNA 3U9OA 2F0EA 4K2LA 4IURA 1PTOB 4EQNA 4BBSB 1KNEA 2QILA 2CQAA 1MD2D 5ELFA 2O5JC 1CI3M 2RDGA 1FNVA 1CFMA 1CZGA 2V4DA 4Q5VA 4ZQ3A 1TIID 1IW7C 4KHVA 2G9DA 2GA4B 1F9RA 4K5XA 1HTLD 4ZLTF 1PRTD 1PTOH 2LMCB 2WINB 3K5NA 1DJRD 1WTPA 2A74C 4X3KA 4HR7B 5EKKA 3HOXB 4F8MA 2K01A 3HOYB 1AEXA 5D3DA 1OXSC 1WTRA 2KCCA 1L0YB 3OIPA 1MSGA 3IFDA 5M3FB 1EEFD 1O7LA 1ESFA 3GQBA 3BDCA 2IJ0A 4FXKC 4EQPA 1I3QB 1TWHB 3QWNA 3PUZA 1S5ED 1F9SA 3BVMA 5CV6A 1TWFB 4ILWA 4G57A 1ENAA 1CA5A 1EY5A 3H6MA 2IX3A 5IGBA 5FK9C 3K5LA 3MC0B 4ME5A 1SDFA 1SYDA 2B2YA 1STEA 2F0SA 1EWHA 2HQEA 3I3CA 4CKEA 3KF8A 3GV3A 1B53A 2AQ2B 2F3VA 5BN3A 1JCKB 4FVMA 1GUGA 4DN4M 1YNJC 1I6HB 2QKIC 2KVMA 4KHZA 5M3MB 2J7ZA 3S16B 5ELDA 2X6GA 4QMGA 2H1EA 4HEDA 4NDXA 1LT5D 4H44C 3V2TA 2EJGC 3DUZA 1Q1BA 1DYQA 3NWTA 1LTTD 2MP1A 1WD1A 1V43A 5M5XB 5LL6S 1A2UA 4XQNA 3J7AV 4LK1C 4KY7A 2F0OA 4Z9CB 1H9RA 2F0TA 3EA6A 2KEEA 4LJZC 3A55A 3OPOA 1DM0B 2J0TD 2BOSA 2FINB 1D2BA 2RDHA 2JA8B 1IL8A 4F88A 4ZK9B 1ENFA 3J7YW 5FO9B 2XN9C 3H94A 2N88A 3E0JA 2A6HC 2EVBA 4KN4C 2E2IB 1OXVA 1IW7D 3U9SA 2OT2A 5KYLA 4LMQD 3MXNA 1BF4A 3M85A 2QF7A 1FD7D 4U68A 3S1QB 2IW3A 3RD4A 1I4GA 1EYCA 3C3LA 1Y1WB 5J1ZA 1S5BD 1Q12A 5JEAG 3PO3B 2O4XA 1SJED 3NSWA 4CJ2C 4X3UA 2PW7A 1TS2A 1Y8PB 1PXUA 3NWSA 2O5IC 5T1GA 4KK7A 1OXTA 3HG9A 4WORA 2MUYA 1V1PB 2MHVA 3CQZB 3AU7A 2K33A 2LFNA 2EOTA 1QE6A 1S5DD 4K6DA 1TY2A 2EJMA 5BN5A 3J80E 2MPMA 2LY7A 1X3PA 4H0LC 4C3HB 1ICWA 5D14A 2Z4HA 1BXTA 2EDGA 2XWBB 3EVQA 5C0XH 4CJ1B 1EY8A 4BBRB 1SE4A 2IX0A 5C3EB 3OOCA 4OO1I 4KKSA 1Y8NB 2A69C 3QB3A 4CKBA 1YNJD 3TN2A 4V190 1RODA 2SEBD 1FYCA 1D5MC 3TMEA 2PW5A 1G2SA 3S1NB 4RH6A 2QDBA 2L55A 1EY7A 1JB3A 1HTPA 4DK0A 1AZPA 4TSSA 1W6JA 2PZTA 1GHJA 3S1MB 1WTXA 3WOEA 2HDMA 1PYWD 4DXGA 1EQTA 3I91A 4MN3A 2PO4A 5COYA 4C3JG 5AFWA 5IIFA 2PCFB 1GOZA 3HP3A 1J9OA 3P20A 1JOKA 1O78A 4LAAA 2XSCA 4X3TA 1C48A 4DXFA 1PFMA 5ISRA 3A54A 1I4RA 1JQYD 4XXEA 3GTPB 3A8JE 4JK1C 2BE5C 4N9TA 3K5MA 2L9HA 2K03A 5TSSA 3X3MA 3DEPA 4IUNA 1SYFA 3I90A 5CORA 2A6HD 2EY1A 4A3DB 3P1HA 5C3WA 4BA1I 4C2MB 1SNDA 5ELEA 5IOCA 4FXDA 1HUMA 2Z4IA 5EGTA 1PTOF 3R3OA 3NTKA 4C1NK 1EEID 2X69A 4RAUC 3H0GB 3J80L 4WJWA 2NVTB 1RHPA 3NXWA 2F0FA 1T5XD 1BCPC 2F0HA 3N52A 4DAYA 3C46A 3DMUA 3QO2A 4RCOA 3VR5A 1LTRD 1RJTA 4A93B 3CRLC 3C1FA 3T51B 5A35A 5EPJA 5CV9A 2DNEA 1HXYD 1JWUD 1VMCA 2SOBA 1ONLA 3VR4A 5LL6X 5C4ZA 1A2TA 1MBYA 1B44D 3FPUB 2JE6I 4IQZA 1EU3A 2MJ8A 1EIHA 3BG3A 2E74C 2JYOA 2IWHA 4PMCA 4IFDJ 2PYKA 3PUVA 2KUMA 4KD3A 1R9TB 3CU7A 1XWEA 2PPBC 1G8ZD 5E4XA 2F0VA 2B2WC 5LHY1 3JAME 2L5TA 1PTOC 3A8KE 3OWEB 2E2HB 3MTSA 1F9PA 3S17B 3OWFA 2NZ1D 1NR2A 2B2TA 1CQVA 4WFN3 3G6JB 1B9MA 4IZ8A 4DAPA 3S9WA 4TRDA 5JVH3 3NPPA 3LX0A 2BCOA 3I4MB 4HMJA 2PNRC 3MWYW 1EIGA 1II3A 4A3BB 2VB3X 3DWPA 2PZWA 4HSVA 4M1UB 1JWMD 2R92B 1S4ZA 3ONAB 1KTKA 5JAVA 1GXDC 1U4RA 1AP0A 3Q22A 1LTAD 1PRTB 1SYBA 4OL7A 4HCEA 1LTSD 4KY6A 2XNAC 4L6TB 2KCNA 2EYJA 1CZWA 4O1NA 1HA6A 1RF2D 2JEBI 2C9OA 3OMGA 2B63B 1LV9A 1STYA 3F2UA 2F0WA 3R2TA 2F0NA 2JA6B 1F77A 1SNMA 1KNAA 2K6AA 2Q8RE 1Y1VB 1OXUA 1DONA 2R7ZB 3R93A 1D6EC 2RQXA 1GUOA 1FR3A 2NVQB 3BZDB 4BA2I 2A68D 4H13C 5KNCA 1JR0D 1RCVD 1VMPA 1STBA 1GUWA 1F2LA 3VYUA 5I6WA 1MSHA 3LWUA 2YU9B 3GV6A 3ITPA 1F2MA 5CC4A 3D6WA 2FMCA 2M9VA 1YNNC 2K7VA 3R8BA 1BCPD 1SXTA 5EKIA 5KNBA 3HOWB 2OF1A 1JWSD 3MEHA 3I4NB 1I4QA 4Y7NB 1AFPA 1V1PA 2B2TC 2E75C 1E2WA 4DGZA 1Q8IA 1RDPD 1WCMB 1TS4A 1H9SB 3D4WA 4DF7A 4FP5D 2JA5B 3HEJA 3MHBA 1NCVA 3H09A 2I07B 3P7JA 5CV7A 4ID6A 2CVRA 3NQTA 2H4OA 4JBWA 5C0XG 1XX8A 3QJYA 4N9PA 2TMPA 3PIP3 1V8QA 1ZYRC 1BO0A 4PMWA 3OW7A 3HS0C 3FKIB 4QF4A 2QCPX 1H9MA 4K5WA 2D62A 1FGBD 4H7BA 2B2UC 4U673 1I6VC 4WRDA 3DM1A 3BYYB 4IN3A 5E4WC 3A56A 1BBXC 3DXJC 3PUYA 4IFDI 4RFBA 3ZYYX 1I50B 4KJNA 1A3VA 3DWAA 1PLFA 3FPPA 2BA0A 3NUCA 1VDZA 1W6KA 3M7GA 1F9QA 3S15B 3K7AB 5D3IB 4KKUA 2F0QA 4OO1H 3BDLA 2K32A 2YYZA 3T16A 1SYCA 5I2XA 2XRSD 2WACA 2ICIA 5C5MA 1D5ZC 2EPBA 2KA7A 1EQVA 1SYGA 2VNUD 4CHTB 5CV8A 4KV6A 5HGTA 4XT3B 3C2PA 1QOHA 1J8IA 4R8NA 3TP5A 2WB1B 2ZXPA 3L7ZC 5A2QE 5C44B 3IL8A 2F0KA 1F2YA 5IODA 1EYAA 4C3IB 2K1BA 1D1KA 3HRZC 2K28A 2F3WA 4B08A 4KMUC 2WKCA 4KI0A 4MHEA 4A3KB 3S14B 1I4PA 2RVLA 1I4XA 5NUCA 1T5EA 1JC7A 3RZOB 3EFXD 1EZ6A 2FJ2A 1YNND 4KD4A 1CA6A 4NW2A 5CR3A 1NUCA 3MXUA 1Q1EA 2A5HA 2QEJC 4G4KA 4O42A 1KDBA 4PV1C 5I9OA 5E3FA 1M4VA 4RHSA 5D65A 3G7LA 2F0UA 2B2YC 2M2LA 1A3TA 3NBHA 4BS9A 1LO5D 1AN8A 3FVQA 2EY2A 3TZDA 3SE0A 1HRJA 1A15A 1ML0D 1D5XC 3K6OA 5DM63 5C0XJ 4KJOA 4FF3A 1TY0A 4FXGC 1IHZA 2EE1A 2XRQD 3A7LA 1S5CD 1OXXK 1B50A 2NN6G 4ZAIA 4G7HC 2IL8A 2TSSA 2RBMA 5KIXA 5CGKA 4I7ZC 3S2HB 2EYFA 2Z8LA 3FDTA 2VB2X 4CGYB 2NVXB 1K83B 5JPNC 3MAQA 5CMDA 4KN7C 3GTOB 5ELBA 4KKTA 1LTGD 4HMIA 4K8JA 4QUCA 4DNTB 1STGA 1XYIA 5IT9E 3BVZA 1EY9A 1HPCA 3I73A 4BY1B 2RA4A 2K5WA 5M5YB 1C8CA 1RD9D 3M7NA 1BOSA 5KNDA 2ZT9C 1DD2A 1TWAB 3J7AF 2KOLA 1STNA 1R4PB 3Q6SA 1GHKA 2RSOA 2F0JA 2XWJB 4TKOB 1UNSA 3GTMB 3GTJB 1PRTF 2WIIB 2Q8IB 1QB5D 3EJIA 1VF5C 4RCNA 2HUGA 5ELCA 4HTHA 1QNUA 4XYQA 1BR9A 3SK6A 1R4QB 2R3ZA 4EGVA 2F0IA 3I72A 2HCIA 5HURA 5K36H 1ZKOA 1TWGB 2XVSA 2K5QA 3SHLA 5M5WB 3RUZA 2HCCA 5JEAJ 5G3LF 1TT2A 2FFKB 4OGQC 3MXGA 1UUPA 4L63B 3WOFA 2F4IA 3PIO3 5FLXE 1X32A 1H9SA 2WV6D 2NUCA 2OXPA 2C5CA 3D8GA 1U4MA 2ICEC 2L12A 1LLRD 4IUUA 2EYPA 1Y69U 4QB4A 3GO5A 3SK5A 1JOOA 3D4DA 4QCLA 2L11A 5JJZA 2EYLA 3GD7A 2B8GA 4OIKA 3GTGB 3Q23A 1PRTC 5C3XA 1SFOB 1SE2A 5FOBB 3QOJA 3DHQA 3SR1A 1UAPA 4KTAA 4UAIA 3EQLC 4XTCS 2EYOA 5IT9L 1PMRA 4FNFA 1ILPA 4K2KA 3KBXA 1JORA 4XT1B 1QJOA 1WVLA 5C0XI 5E1FA 5C4JB 2KECA 2HDLA 1LABA 2NBFA 3MFYA 4B9WA 2A69D 3LNNA 3RLFA 4L8JA 4FF1A 3GTQB 5FO7B 4CBVA 1HFGA 2A73B 1PDQA 3NTIA 5J39A 1NAPA 3VYRA 3PUWA 2KQ3A 1IYVA 4NMZA 3I8ZA 3R2IA 1RTOA 4ULLA 2NTSA 2N55A 2IT1A 5C4XB 2J4XA 4XQJA 3QOLA 4IFDH 5K5PA 1BCPB 5IGGA 1PZKD 4RGOS 5KEEA 1RTNA 4PMBA 1BDOA 1Y8OB 1UEAB 4RGTA 3GTLB 3NTHA 4C3JB 1ET9A 2AWNA 4C56C 2DN8A 1O80A 1TS3A 3VR6A 5FLXL 4Q0FA 5EKLA 4FO2A 2BE5D 1B9NA 3D4RA 3Q0AA 5CV4A 3TBIB 3NK9A 3OMCA 1QWYA 1MGSA 3TZUA 3IFTA 1KLGD 3VR2A 3T53B 2FMMA 1SNOA 1I4HA 3FMCA 3RZDB 1H9JA 1CHQD 2BA1A 4QIWB 2BDNA 4NP5A 3SVMA 3AMUA 4AYBB 1L0XB 1SJHD 4FYDA 1SMYC 1U4PA 2PZUA 1XTCD 1GUSA 2EYHA 2ZXRA 4R9WA 3MZ5A 1CK1A 3BS1A 3M4YA 1LT4D 4RKLA 1G6ZA 3FEWX 1EZ8A 1BUVT 1XXGA 3HGBA 1IYUA 3DEOA 4J8QA 2R6GA 3HZXA 3JAML 3GP7A 4C1NI 2B8FA 4J1MA 1DOKA 3SEBA 2AQ3B 4BWGB 5KYIA 2PMZB 2WAQB 2F0GA 3I4LA 2NWGA 2R61A 1K8MA 3M4OB 1TKWB 4A3IB 1PFBA 1E2VA 3CRKC 2NN6I 4I65A 2SNMA 1MI2A 5KRUA 1QNKA 4IUVA 4PNYA 1PTOD 4YIJA 5DM73 1K8OA 5G3LD 1TQOA 3FRPB 1VCIA 5M9OA 1TR5A 4C3HG 2RSNA 3K58A 3URYA 3BVGA 1A6XA 3BDOA 5KGUA 3K5OA 4IALA 5JOBA 1JOQA 1SSOA 5EQ0A 3TP6A 4MIUA 4ZKBB 3KLSA 1SBBB 1ENCA 3OSOA 2KJXA 1TVXA 3ERQA 3P75A 3GTKB 2RDFA 1AZQA 1DOMA 1Q90A 1HQMC 3BYTB 1IKMA 2ID0A 5EBCA 4FF2A 1Q3LA 4IUPA 3HKZB 4G7ZC 5FKAC 1A3UA 3VYSA 1SNCA 2EJFC 1TWCB 3V05A 5DEHA 1DCZA 3W2DA 3H91A 3SDZA 2A6EC 2E2JB 3D3RA 3K57A 3C1EA 3VYTA 2D5DA 3TDQA 1OO9B 5I9PA 5K36G 3PUXA 1GJXA 4DK1A 3ND9A 3NE5B 3H3VC 5C4HA 1LACA 2BDOA 1ILQA 1TS5A 1V1OA 2LKVA 1HUNA 1HCZA 2EXZA 5EPLA 4A3FB 3M3YB 1SMYD 3EROA 1E2ZA 1NSNS 1BNZA 2CW0C 2F1MA 4KY5A 4HCSA 4XIGS 2E76C 1ZXTA 2OEOA 2AUKA 4QUFA 1DXMA 3VA5A 2KHSA 2ZXOA 1WTOA 5FO8B 2Q8TA 2D9UA 1KABA 4OHJA 1O7ZA 3J81E 2WP8J 5JPMC 5I6YA 1M8AA 1LTID 1SNPA 4M8AA 3N6RA 1O7YA 4ZUIA 5CYUA 1AW7A 2MGSA 4G7OC 3AB9A 4IUTA 5T1IA 4S3SA 2X6LA 4R8IA 1B1ZA 3A8IE 2EY6A 4B9XA 1JICA 1H9KA 4A3JB 3WDNA 5JVG3 3E6ZX 1KAAA 5I4DA 4ZKCB 3DWQA 2WKDA 1SAPA 1Z47A 1ZYRD 1NR4A 3VR3A 2F0PA 1SEBD 3LWEA 3TSSA 4DU9A 1BQQT 5IGCA 5CBEE 3KBGA 2IPKD 1GUTA 1EFID 1FNUA 2Y0SB 2VXWA 4RGMA 2JSOA 4ODGA 1EY0A 4J6HA 2G9HD 2SNSA 2M00A 4EQOA 4ZYSA 4IUQA 2F0DA 2FHTA 4A3EB 1X3QA 5A2QL 3T56B 5C5LA 1PFNA 1Z6HA 4IFDG 3K59A 2NTTA 3Q24A 3T13A 3CKIB 2PQEA 2JXMB 1DZ1A 1RKNA 4RHRA 1EY4A 4K14A 2XIWA 4ABNA 1ET6A 2O2LD 3HOUB 1B4OA 3L3OC 1QCBD 2JEAI 3ND8A 1HQRD 4P2CB 3TP7A 1EYDA 1JE4A 1U4LA 2SDFA 2A6ED 2CHBD 5DNFA 3W3AA 5EJWA 4RA8A 2B2VA 4BY7B 1BCPF 2D2CC 2NB0A 4FF4A 2JA7B 3J81L 1CTMA 1KLUD 2DY7A 2AUJD 1EWCA 3PV0A 1HA5A 1SYEA 2F0MA 4PQXA 1EU4A 1SE3A 3MXPA 1WTWA 2JP1A 5C6AA 3OIQA 1F2ZA 4OIJA 2B2WA 4DNRB 2CW0D 1HHVA 2KEDA 4XYOA 3E5SA 3OHXC 2AQ1B 1STHA 1IKLA 3NP8A 1G291 2E2DC 1QILA 4NKLA 1FNWA 2NVYB 1KDCA 1ESRA 2DY8A 2A68C 3SK4A 1U9RA 1Z7TA 3V96A 3KLSX 2K04A 1S5FD 3KLRA 4ZRZA 4UDUC 3HOVB 1EY6A 4XDXA 4K8IA 3NHHA 4XQQA 4F7XA 1LTBD 3K0YA 3D6CA 4ZUJA 5I2YA 1PZID 4HSPA 1PZJD 1STAA 3RMHA 1LT6D 1QG7A 1B2TA 3IKJA 3QIAA 1EL0A 5JEAH 5IGFA 5F2DA 1G2TA 2IX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNC A;  5CGK A;  5J39 A;  1SYB A;  2F0H A;  2EY6 A;  5IGD A;  3U9O A;  4B9X A;  4G57 A;  1ENA A;  4OL7 A;  5CV7 A;  2KQ3 A;  3DMU A;  4ID6 A;  3SHL A;  2F0E A;  1EY5 A;  2EYF A;  4NMZ A;  1KAA A;  3H6M A;  3RUZ A;  4K2L A;  4KY6 A;  3TP8 A;  1SYE A;  5IGB A;  5KYL A;  2F0M A;  2F3W A;  4ME5 A;  3HZX A;  5DEH A;  3NQT A;  2PW5 A;  3TME A;  2EYJ A;  1KDA A;  1SYD A;  4EQN A;  3C1F A;  4N9P A;  2QDB A;  3MXP A;  5CV5 A;  1TT2 A;  2F0S A;  5C6A A;  1EY7 A;  1F2Z A;  5CV9 A;  4J1M A;  2F0P A;  3OMG A;  2HQE A;  3QOL A;  3C1E A;  1STY A;  3SXH A;  2SOB A;  5K5P A;  2F0W A;  3E5S A;  1EYC A;  2F3V A;  2NUC A;  4DU9 A;  4QF4 A;  2PZT A;  5IGC A;  2OXP A;  5KYI A;  3D8G A;  3MVV A;  5J1Z A;  1STH A;  5NUC A;  5IGG A;  2F0N A;  4K5W A;  1SNM A;  3NP8 A;  5C4Z A;  1A2T A;  5I9P A;  5KEE A;  5IGE A;  2F0G A;  2O4X A;  4HMI A;  4K8J A;  4NKL A;  4PMB A;  2PW7 A;  4DFA A;  4EVO A;  2EYP A;  1EZ6 A;  1STG A;  3PMF A;  4KD4 A;  4H7B A;  4QB4 A;  5C4H A;  4ODG A;  4WRD A;  1EY0 A;  4J6H A;  4ZQ3 A;  5IIF A;  4KHV A;  5CR3 A;  1JOK A;  1NUC A;  3SK5 A;  4WOR A;  4K5X A;  1JOO A;  4LAA A;  4PMC A;  4QMG A;  2LKV A;  2SNS A;  1EY9 A;  2EXZ A;  2M00 A;  2PYK A;  3D4D A;  4EQO A;  1KDC A;  4NDX A;  2EYL A;  1KDB A;  2F0D A;  3ERO A;  5C3X A;  3SK4 A;  3V2T A;  4I65 A;  1NSN S;  2SNM A;  4KD3 A;  5I9O A;  1U9R A;  1STB A;  5E3F A;  5ISR A;  4KY5 A;  5C5L A;  5EKL A;  5KRU A;  4KJN A;  5EKK A;  1A3V A;  2F0U A;  4E6I A;  4F8M A;  3QOJ A;  5I6W A;  4PNY A;  3NUC A;  4YIJ A;  1A2U A;  1STN A;  1A3T A;  3DHQ A;  5CV4 A;  2OEO A;  4N9T A;  2F0V A;  3SR1 A;  3NK9 A;  2EY2 A;  3ITP A;  2EYM A;  3VA5 A;  1F2M A;  1TQO A;  3OMC A;  4K6D A;  5CC4 A;  1AEX A;  1EY6 A;  3T13 A;  4KTA A;  2KHS A;  4KY7 A;  2PQE A;  1TR5 A;  2F0J A;  2F0Q A;  5M9O A;  4IUN A;  3NHH A;  1RKN A;  1SNO A;  4K8I A;  3BDL A;  2F0O A;  1SYF A;  2RKS A;  3OWF A;  1EY4 A;  1SNQ A;  2EYO A;  3T16 A;  4K14 A;  1SYC A;  4F7X A;  2EY1 A;  2WAC A;  2F0T A;  2ENB A;  2EY5 A;  2OF1 A;  3P1H A;  4K2K A;  5C5M A;  1JOR A;  5KGU A;  3EJI A;  1KAB A;  4IZ8 A;  4KJO A;  4IAL A;  4NP5 A;  1EQV A;  3MEH A;  5JOB A;  1SYG A;  3D6C A;  5C3W A;  1SND A;  4TRD A;  2F0L A;  3S9W A;  4HTH A;  1JOQ A;  5E1F A;  4ZUJ A;  3EVQ A;  5CV8 A;  3LX0 A;  4KV6 A;  3TP6 A;  5IOC A;  2PZU A;  1STA A;  1EY8 A;  4MIU A;  5I6Y A;  3OSO A;  1ENC A;  3TP7 A;  1EYD A;  3BDC A;  4HMJ A;  5EGT A;  3SK8 A;  1IHZ A;  4EQP A;  3R3O A;  1SNP A;  4DGZ A;  2EYH A;  3ERQ A;  5HGT A;  3SK6 A;  1II3 A;  3P75 A;  3MZ5 A;  3D4W A;  4R8N A;  5J22 A;  4ZUI A;  3TP5 A;  2RDF A;  4K5V A;  5DAU A;  4B9W A;  4DF7 A;  2F0I A;  2PZW A;  5CV6 A;  5IGF A;  4RKL A;  5HUR A;  3NXW A;  5F2D A;  3HEJ A;  1EZ8 A;  3MHB A;  3QB3 A;  2F0F A;  2F0K A;  4S3S A;  4RKB A;  5JAV A;  2RBM A;  1F2Y A;  5IOD A;  5KIX A;  1EYA A;  1A3U A; 
#chains in the Genus database with same CATH topology
 1WD0 A;  5IGD A;  4X3S A;  5EAY A;  3S1R B;  3VA7 A;  3PO2 B;  2K5D A;  4TQU S;  3GTG H;  4B3M L;  2B2V C;  3KDF A;  3D31 A;  3TP8 A;  2I46 A;  1SFO H;  1IXR A;  1CM9 A;  1KDA A;  5IYD G;  1WTQ A;  5CV5 A;  3A7A B;  4DAV A;  1ZEQ X;  2R93 B;  1CT1 D;  3H3V I;  1EOT A;  3FKI G;  1B3A A;  1HFN A;  3SXH A;  4DA2 A;  1NJI C;  4V0B A;  4F87 A;  4OO1 G;  2NN6 H;  3MVV A;  4WJ4 A;  3MA2 B;  4JBM A;  2VUM B;  2B39 A;  4B3S Q;  2ZM6 L;  4HID A;  4K6L A;  1YJ9 A;  3L9A X;  3ULP A;  5IGE A;  5EBD A;  2AMC B;  4DFA A;  2K05 A;  4EVO A;  1VQ9 A;  3PMF A;  4HN7 A;  3HOZ B;  2DNC A;  2L0C A;  3NQI A;  1G51 A;  4A3G B;  1CKM A;  2LS0 1;  1TU2 B;  4A3M B;  4GZY C;  4RWS C;  2Z6K A;  1VF7 A;  3X3N A;  3KUP A;  2R93 H;  1CQF A;  1G91 A;  1VQL A;  5CBA E;  4E6I A;  1PVO A;  4UPA A;  4DV7 L;  4QQB X;  4JBK A;  5J3B A;  3U4V A;  1D1I A;  1VQH A;  2EYM A;  5EPK A;  2Z1C A;  1L1O A;  1PH8 A;  1E0B A;  3NBI A;  4JI5 L;  4CJ0 B;  5GAD C;  2AWO A;  4YY3 L;  2RKS A;  4IO9 A;  2EIF A;  3RNU A;  1SNQ A;  3O13 A;  2L1B A;  2NYZ D;  2ENB A;  3I7F A;  2EY5 A;  1GUN A;  3UI2 A;  3CHB D;  1DOL A;  4P74 A;  1XMQ L;  2F3I A;  3S2D B;  1Q82 C;  2F0L A;  1HR0 Q;  3K7U C;  2F03 A;  3J80 i;  1K28 A;  4CKC A;  1LT3 D;  4DPG A;  3IAY A;  3SK8 A;  2L4N A;  3QG1 A;  2HHH Q;  3KFU A;  2EZV A;  2WB1 G;  3T4A C;  5BN4 A;  5J22 A;  4K5V A;  3I70 A;  4UP8 A;  5DAU A;  3KK7 A;  1M1K C;  1IBK L;  1WTV A;  5C44 G;  1CHP D;  1FJG Q;  1PV4 A;  2F52 A;  1YIJ A;  4HAE A;  2N49 A;  4C3I G;  1C4Q A;  2B2U A;  4RKB A;  3S24 A;  4A3C G;  3MFG A;  4C3J H;  4RGN A;  3U9O A;  4KHP L;  2JN4 A;  2F0E A;  3S2D H;  4K2L A;  4OEL B;  1Y14 B;  4IUR A;  2Y0S E;  1PTO B;  4IPH A;  4A3K G;  4EQN A;  1EWI A;  4BBS B;  1W3S A;  1KNE A;  2CQO A;  2QIL A;  2MQH A;  2CQA A;  1MD2 D;  5ELF A;  5IYC G;  3E9I A;  1E24 A;  4P72 A;  3RZD H;  2O5J C;  1QVG A;  1CI3 M;  2RDG A;  4YCU A;  3F2D A;  1C0A A;  4DR2 Q;  1FNV A;  1EQQ A;  1CFM A;  1CZG A;  1RL2 A;  2V4D A;  4Q5V A;  2ZJR A;  4ZQ3 A;  1TII D;  1IW7 C;  2G9D A;  2GA4 B;  4KHV A;  1EYG A;  1F9R A;  4K5X A;  1HTL D;  4ZLT F;  4A3L G;  1PRT D;  1PTO H;  2LMC B;  3AFQ A;  2WIN B;  3K5N A;  1DJR D;  1N34 L;  1WTP A;  2A74 C;  4X3K A;  4HR7 B;  5EKK A;  3HOX B;  4F8M A;  2K01 A;  2IHE A;  2Z6K C;  1K8G A;  4JPB W;  3HOY B;  1XPR A;  1AEX A;  5D3D A;  1OXS C;  1KXL A;  1WTR A;  2KCC A;  2I5M X;  1L0Y B;  3OIP A;  2VW9 A;  1L1O C;  1EQR A;  1MSG A;  3IFD A;  5M3F B;  3RN5 A;  1EEF D;  1O7L A;  4P75 A;  4L5Q A;  1ESF A;  3GQB A;  5IP7 H;  4RG1 A;  2D0P A;  3BDC A;  2IJ0 A;  4FXK C;  4EQP A;  1I3Q B;  1K0S A;  3STB C;  4DV3 L;  2PQA B;  1TWH B;  3QWN A;  3PGZ A;  3T1H Q;  3PUZ A;  4LF9 Q;  2UUC L;  1S5E D;  3UE0 A;  1F9S A;  1NMG A;  1KAW A;  3BVM A;  4DR5 L;  5CV6 A;  1TWF B;  4I7A A;  4ILW A;  3M4O H;  4JI1 L;  1SR3 A;  4A3I H;  4G57 A;  1ENA A;  1CA5 A;  1P8L A;  1IBL Q;  1PH6 A;  1EY5 A;  5FLM H;  2K14 A;  5M3F H;  3H6M A;  2IX3 A;  5IGB A;  5FK9 C;  1HNW Q;  5IWA L;  3K5L A;  3MC0 B;  4ME5 A;  1SDF A;  1SYD A;  2B2Y A;  1STE A;  2F0S A;  1EWH A;  4LF5 L;  2HQE A;  5BR8 L;  3I3C A;  1VQK A;  4CKE A;  3KF8 A;  3GV3 A;  1B53 A;  2AQ2 B;  2F3V A;  5BN3 A;  1JCK B;  4FVM A;  1GUG A;  4DN4 M;  1YNJ C;  1I6H B;  2QKI C;  4DV5 L;  2KVM A;  4KHZ A;  5M3M B;  2J7Z A;  3S16 B;  4DR7 L;  4BY1 G;  5ELD A;  2X6G A;  4QMG A;  2H1E A;  4HED A;  4HIO A;  4NDX A;  1LT5 D;  4H44 C;  3GTK H;  3V2T A;  2EJG C;  3DUZ A;  1E1O A;  1DYQ A;  1Q1B A;  3NWT A;  2A8V A;  1LTT D;  2MP1 A;  1WD1 A;  1V43 A;  2UUB L;  5M5X B;  1HZB A;  5LL6 S;  4RMF A;  1A2U A;  4XQN A;  3J7A V;  4LK1 C;  4KY7 A;  1I6H H;  4GNX B;  1BKB A;  2F0O A;  5IYB G;  1TWC H;  2GVA A;  4Z9C B;  2OQ0 A;  4JVZ A;  5M3M H;  1H9R A;  2F0T A;  3S16 H;  3EA6 A;  2KEE A;  4LUZ A;  4LJZ C;  3A55 A;  2QDL A;  2IY5 B;  1IBM Q;  3OPO A;  4A76 A;  1DM0 B;  1TXY A;  2J0T D;  1N33 L;  2BOS A;  4R4Q A;  2FIN B;  1D2B A;  1C9O A;  1X6O A;  2RDH A;  2JA8 B;  1IL8 A;  4F88 A;  4ZK9 B;  1ENF A;  3CP0 A;  3J7Y W;  5FO9 B;  2XN9 C;  3H94 A;  2N88 A;  1HNX L;  1E22 A;  3KF6 B;  3E0J A;  4DUY Q;  3HFZ B;  2A6H C;  4L5T A;  4JI4 L;  2EVB A;  3CC2 A;  4YHH Q;  4DNI A;  1WJJ A;  4KN4 C;  4A3F H;  2E2I B;  1OXV A;  1IW7 D;  3U9S A;  2OT2 A;  5KYL A;  4LMQ D;  3MXN A;  4YCV A;  1BF4 A;  3RR5 A;  3M85 A;  5LMU Q;  2QF7 A;  1E7Z A;  1FD7 D;  4U68 A;  3S1Q B;  2IW3 A;  4JOI C;  3RD4 A;  1I4G A;  1EYC A;  3C3L A;  1Y1W B;  5J1Z A;  1S5B D;  1Q12 A;  5JEA G;  5IT9 c;  3PO3 B;  3OYY A;  3RLN A;  2YTY A;  2O4X A;  1SJE D;  3NSW A;  4CJ2 C;  4X3U A;  2PW7 A;  1TS2 A;  1Y8P B;  2UXC L;  4B3M Q;  1PXU A;  3NWS A;  2O5I C;  5T1G A;  4KK7 A;  1OXT A;  3HG9 A;  4WOR A;  1KRS A;  3J7A 5;  2MUY A;  4JI6 L;  1V1P B;  3L2P A;  2MHV A;  1QUQ A;  1VQA A;  3CQZ B;  3AU7 A;  5H1S E;  1UE1 A;  2K33 A;  2LFN A;  4Y52 H;  2EOT A;  3STB D;  1QE6 A;  4IPD A;  2ZM6 Q;  1S5D D;  1WFQ A;  4K6D A;  2UXD L;  1TY2 A;  2EJM A;  4UHV A;  5BN5 A;  2N8N A;  4A75 A;  3J80 E;  3PO3 H;  4A3J H;  4OWX B;  1K0R A;  2MPM A;  2LY7 A;  1X3P A;  4H0L C;  4IJL A;  4C3H B;  1ICW A;  5D14 A;  4JI7 L;  2Z4H A;  4GLV B;  1BXT A;  2EDG A;  4LUV A;  2XWB B;  3EVQ A;  4LWC A;  5C0X H;  1WYD A;  4CJ1 B;  1EY8 A;  4BBR B;  4DV7 Q;  1SE4 A;  2IX0 A;  5C3E B;  3CCS A;  5FJ8 H;  2R93 G;  3OOC A;  4OO1 I;  3BJU A;  3T1H L;  4KKS A;  4JI5 Q;  4YY3 Q;  1Y8N B;  2A69 C;  3QB3 A;  4CKB A;  1YNJ D;  4LF4 L;  5IE8 A;  3TN2 A;  4JCV E;  3D0F A;  4A4I A;  1EIF A;  1MJE A;  1XMQ Q;  3T1Y L;  4V19 0;  3BZK A;  1B7Y B;  3E9H A;  4DK6 C;  4GN3 B;  4C3H H;  2ZJP A;  1UE6 A;  1ROD A;  1IYJ B;  2SEB D;  4A3E H;  1FYC A;  3L0O A;  1D5M C;  5FLX c;  3TME A;  2PW5 A;  1G2S A;  3S1N B;  4RH6 A;  5C4X G;  1KQS A;  2QDB A;  3PCO B;  2L55 A;  2Q2I A;  1H95 A;  1EY7 A;  1JB3 A;  1HTP A;  4DK0 A;  1AZP A;  4TSS A;  4LFA L;  1ICF B;  1W6J A;  2PZT A;  1GHJ A;  3S1M B;  4CDF C;  1WTX A;  1I94 L;  3WOE A;  4DV4 L;  1IL2 A;  2HDM A;  1AE2 A;  1PYW D;  1EQT A;  4DXG A;  4KHP Q;  3I91 A;  4MN3 A;  2DJG C;  2PO4 A;  3HOU H;  5COY A;  4C3J G;  2K5V A;  5AFW A;  1SRU A;  2PCF B;  5IIF A;  1GOZ A;  3HP3 A;  1J9O A;  3P20 A;  1JOK A;  1O78 A;  1VQJ A;  4HJ5 A;  4LAA A;  2XSC A;  4X3T A;  1YEZ A;  1C48 A;  1EIY B;  3AYH B;  4X66 L;  4DXF A;  1PFM A;  5ISR A;  3A54 A;  1I4R A;  1JQY D;  4XXE A;  3GTP B;  3A8J E;  4JK1 C;  2E8G A;  4BY7 H;  2BE5 C;  4N9T A;  3K5M A;  2L9H A;  3S1M H;  2K03 A;  5TSS A;  3X3M A;  2JA7 H;  3DEP A;  4K0K L;  4IUN A;  1SYF A;  3I90 A;  1PH5 A;  5COR A;  2A6H D;  2EY1 A;  1VQI A;  2K75 A;  4A3D B;  4AYB G;  3P1H A;  5C3W A;  4BA1 I;  4C2M B;  1SND A;  5ELE A;  2XGT A;  1WOC A;  1N34 Q;  4GKJ L;  5IOC A;  1VQD A;  5JJL A;  4FXD A;  1HUM A;  1LTL A;  2Z4I A;  1YJN A;  4BXX H;  5EGT A;  1PTO F;  3R3O A;  3NTK A;  4C1N K;  1EEI D;  2X69 A;  4RAU C;  2HQL A;  3H0G B;  3J80 L;  4WJW A;  5LMN L;  5AJ3 L;  1RHP A;  2NVT B;  1NBW A;  4DKA C;  1YZ6 A;  3NXW A;  2GVB A;  3A0J A;  2F0F A;  4DUY L;  2NVY H;  1BCP C;  1T5X D;  3TS2 A;  3PIO A;  2F0H A;  4A3D H;  3N52 A;  2N3S A;  1N9W A;  4DAY A;  3C46 A;  3DMU A;  3QO2 A;  4RCO A;  3VR5 A;  1LTR D;  1X9N A;  2MO1 A;  2UU9 L;  1RJT A;  4A93 B;  2Q2H A;  4DV3 Q;  3CRL C;  3C1F A;  3T51 B;  1YBY A;  5A35 A;  5EPJ A;  5CV9 A;  2UUC Q;  2DNE A;  3CXC A;  1HXY D;  4DR5 Q;  3HOV H;  1QZH A;  1JWU D;  2PQA A;  1VMC A;  2SOB A;  1ONL A;  2WAQ G;  3VR4 A;  2NVT H;  5LL6 X;  3TRE A;  4JI1 Q;  5C4Z A;  1A2T A;  1MBY A;  4LFC L;  1B44 D;  3FPU B;  2JE6 I;  4IQZ A;  1EU3 A;  4AIM A;  5IWA Q;  2MJ8 A;  4A3I G;  4LF7 L;  1EIH A;  3BG3 A;  2E74 C;  2JYO A;  2IWH A;  4PMC A;  4FDB A;  5FLM G;  4IFD J;  2PYK A;  3NEN A;  3CAM A;  2JQO A;  3PUV A;  4GOP B;  4QGU A;  2E5L L;  4LF5 Q;  2KUM A;  5BR8 Q;  4KD3 A;  3PSI A;  1R9T B;  3CU7 A;  1XWE A;  3OW2 A;  2PPB C;  3EBE A;  1G8Z D;  4L5S A;  1YNX A;  1EUJ A;  1MIU A;  5E4X A;  2F0V A;  2B2W C;  5LHY 1;  3JAM E;  1G6P A;  2L5T A;  4DV5 Q;  1VQ7 A;  1PTO C;  3TQY A;  3A8K E;  3G48 A;  3OWE B;  2E2H B;  3MTS A;  4PG3 A;  4LNQ A;  1F9P A;  3S17 B;  1MKH A;  3S1R H;  3OWF A;  4DR7 Q;  4MZ9 A;  3PO2 H;  2NZ1 D;  1VQ5 A;  1NR2 A;  2B2T A;  1CQV A;  4WFN 3;  3G6J B;  2BH2 A;  1B9M A;  4IZ8 A;  3RLO A;  4WJ3 M;  4DAP A;  3S9W A;  4TRD A;  5JVH 3;  3NPP A;  1CKN A;  3LX0 A;  4UP7 A;  2RCN A;  2BCO A;  1XNR Q;  3I4M B;  2UUB Q;  4HMJ A;  2PNR C;  3MWY W;  4GLX A;  1EIG A;  3DM3 A;  1II3 A;  4A3B B;  2VB3 X;  2WFW A;  3EN2 A;  2VUM H;  3DWP A;  2PZW A;  3HKZ G;  4HSV A;  5IP9 G;  4M1U B;  1JWM D;  3HOZ H;  2R92 B;  4DUZ L;  1S4Z A;  3ONA B;  4A3G H;  1KTK A;  5JAV A;  1GXD C;  3SGI A;  4GNX A;  4A3M H;  1U4R A;  1AP0 A;  3Q22 A;  1LTA D;  1PRT B;  3QR8 A;  1SYB A;  4OL7 A;  4HCE A;  4PZ7 A;  1LTS D;  2V1C C;  3ZJY C;  4KY6 A;  1X54 A;  2XNA C;  4L6T B;  1N33 Q;  2KCN A;  2EYJ A;  1CZW A;  1Q7Y C;  4O1N A;  1HA6 A;  1RF2 D;  2JEB I;  2C9O A;  1VQ4 A;  3OMG A;  1M90 C;  2B63 B;  1LV9 A;  1J5E L;  1HNX Q;  1STY A;  5L37 A;  2K52 A;  3F2U A;  2F0W A;  3R2T A;  4JI4 Q;  3BZC A;  2F0N A;  2JA6 B;  1F77 A;  1SNM A;  1KNA A;  2K6A A;  1HZC A;  1X65 A;  2Q8R E;  1Y1V B;  2PI2 E;  3KF6 A;  1OXU A;  4JC0 A;  3CF5 A;  2OWO A;  1DON A;  2R7Z B;  3R93 A;  1YI2 A;  2CKZ B;  1KC8 C;  1D6E C;  4DV0 Q;  2RQX A;  1GUO A;  3U4Z A;  1FR3 A;  4X62 L;  4A3F G;  2NVQ B;  3BZD B;  1L2F A;  4BA2 I;  2A68 D;  1YIT A;  4H13 C;  3DLL A;  5KNC A;  1JR0 D;  1RCV D;  1VMP A;  1STB A;  2EXD A;  4LW1 A;  1GUW A;  1F2L A;  2K4K A;  3VYU A;  5I6W A;  2B63 H;  1MSH A;  5GQO A;  2Z9H A;  3LWU A;  2YU9 B;  3GV6 A;  3ITP A;  1F2M A;  5CC4 A;  2UXC Q;  3D6W A;  2I5L X;  1D7Q A;  2JA6 H;  2FMC A;  2M9V A;  3ICE A;  1K73 C;  1YNN C;  1B70 B;  2K7V A;  3R8B A;  1BCP D;  4JI6 Q;  1SXT A;  5EKI A;  5KNB A;  3HOW B;  2OF1 A;  2QW7 A;  1JWS D;  4BBS H;  3MEH A;  5HY6 A;  3I4N B;  1I4Q A;  4Y7N B;  4IOA A;  1AFP A;  1V1P A;  1JMC A;  2B2T C;  2E75 C;  5DLQ E;  1E2W A;  4DGZ A;  1Q8I A;  1RDP D;  3KLW A;  1WCM B;  1TS4 A;  1H9S B;  2UXD Q;  3D4W A;  4DF7 A;  4HIK A;  5GRO A;  4YWK A;  4FP5 D;  2JA5 B;  3HEJ A;  2OTL A;  1HZ9 A;  1X3E A;  3MHB A;  4JI7 Q;  4PZ6 A;  4A3J G;  1WI5 A;  1NCV A;  4HJA A;  3H09 A;  1YHQ A;  4JV5 L;  2I07 B;  3P7J A;  5CV7 A;  4ID6 A;  2CVR A;  3I4N H;  3NQT A;  3ER0 A;  2H4O A;  4JBW A;  3HOX H;  5C0X G;  1XX8 A;  3QJY A;  4N9P A;  2TMP A;  1RIP A;  3PIP 3;  1Q86 C;  3HOY H;  1V8Q A;  5FJ8 G;  1ZYR C;  1BO0 A;  4PMW A;  3OW7 A;  4IOC A;  4LF4 Q;  3HS0 C;  3FKI B;  4QF4 A;  2QCP X;  1N8R C;  1H9M A;  2C35 B;  4K5W A;  2Y0S G;  3T1Y Q;  2D62 A;  1S72 A;  2HD3 A;  4UP9 A;  1FGB D;  1FGU A;  4NPS A;  1ASZ A;  4H7B A;  2B2U C;  2P5Z X;  1I6V C;  1SLJ A;  1SN8 A;  4WRD A;  4U67 3;  3DM1 A;  3BYY B;  3AFP A;  1JJG A;  4A3E G;  4IN3 A;  5E4W C;  3A56 A;  1X3G A;  1BBX C;  1I3Q H;  3DXJ C;  3PUY A;  4IFD I;  1XJV A;  1TWH H;  4LFA Q;  4RFB A;  3ZYY X;  1I50 B;  4KJN A;  1A3V A;  3DWA A;  1I94 Q;  4DV4 Q;  1PLF A;  3FPP A;  2BA0 A;  3NUC A;  1N32 L;  1TWF H;  4OON A;  1VDZ A;  1W6K A;  3M7G A;  1F9Q A;  3S15 B;  3K7A B;  5D3I B;  2UXB L;  4GN4 B;  4KKU A;  4DV2 L;  3J81 c;  1PH4 A;  2F0Q A;  1PH1 A;  4OO1 H;  5ELO A;  3BDL A;  2K32 A;  2YYZ A;  2QA4 A;  4JI8 Q;  3T16 A;  1SYC A;  4GLA C;  3HOU G;  2XRS D;  5I2X A;  2WAC A;  1HNZ Q;  1YVC A;  2ICI A;  2CH4 A;  2OQK A;  5C5M A;  3AEV A;  1D5Z C;  2EPB A;  2KA7 A;  2K5H A;  1EQV A;  3U58 A;  1SYG A;  4X66 Q;  2VNU D;  4APV A;  4CHT B;  5CV8 A;  4KV6 A;  1XNR L;  5HGT A;  4XT3 B;  3C2P A;  1QOH A;  2A1A A;  4OWT B;  1J8I A;  4R8N A;  4K0K Q;  3TP5 A;  4JW0 A;  2WB1 B;  4BY7 G;  4GN5 A;  2PNH A;  3K7A H;  2VZA A;  2ZXP A;  3L7Z C;  5A2Q E;  2JA7 G;  5C44 B;  3IL8 A;  1O7I A;  2F0K A;  1CSQ A;  1F2Y A;  5IOD A;  1FVI A;  1EYA A;  2ATW A;  4C3I B;  2K1B A;  3JAM i;  1D1K A;  4GKJ Q;  1A8V A;  3WWV A;  3HRZ C;  2K28 A;  2F3W A;  4B08 A;  1PH3 A;  4KMU C;  4YWL A;  5M5X H;  2WKC A;  4KI0 A;  4MHE A;  4NXN L;  4BXX G;  4A3K B;  5LMN Q;  5AJ3 Q;  3S14 B;  1I4P A;  2RVL A;  1PA6 A;  2AHO B;  1I4X A;  5NUC A;  1T5E A;  4DR1 L;  5C44 H;  1JC7 A;  3RZO B;  3EFX D;  1EZ6 A;  2UU9 Q;  2FJ2 A;  1YNN D;  2VQF L;  1VQM A;  4KD4 A;  1CA6 A;  3UE1 A;  4A3C H;  4DV0 L;  4NW2 A;  5CR3 A;  1NUC A;  3MXU A;  1Q1E A;  2A5H A;  2UUA L;  2QEJ C;  4G4K A;  4O42 A;  1KDB A;  1Q81 C;  4PV1 C;  5I9O A;  2JA8 H;  5E3F A;  4LF6 L;  1M4V A;  4RHS A;  5D65 A;  1KD1 C;  3G7L A;  2F0U A;  2B2Y C;  3KJO A;  2M2L A;  3HOV G;  4LFC Q;  1A3T A;  3NBH A;  4BS9 A;  1LO5 D;  1NTG A;  1AN8 A;  3FVQ A;  1VQN A;  2EY2 A;  4IPG A;  3TZD A;  3SE0 A;  1HRJ A;  1A15 A;  4LF7 Q;  1ML0 D;  2E2I H;  1D5X C;  3K6O A;  5DM6 3;  5C0X J;  1CKO A;  2E5L Q;  4KJO A;  2F4V L;  4FF3 A;  2YV5 A;  4JYA Q;  5IY0 A;  3I56 A;  1TY0 A;  4X6A H;  4FXG C;  4GOP A;  3S1Q H;  2KEN A;  1IHZ A;  2EE1 A;  2XRQ D;  3A7L A;  1S5C D;  1Y1W H;  1OXX K;  1GKH A;  1B50 A;  4ZCK A;  2NN6 G;  4ZAI A;  4G7H C;  1J6Q A;  2IL8 A;  1XNQ L;  2TSS A;  2DGY A;  2RBM A;  5KIX A;  5CGK A;  3PO2 G;  3MEF A;  4I7Z C;  3S2H B;  3CMA A;  3CQZ H;  1VS0 A;  2EYF A;  2Z8L A;  1LM0 A;  1QVC A;  3FDT A;  2VY3 A;  2RHS B;  4R4C A;  2VB2 X;  2MFI A;  3J81 j;  2Z6B A;  4CGY B;  1L0W A;  1GM5 A;  1K83 B;  5JPN C;  3MAQ A;  2NVX B;  5CMD A;  4DUZ Q;  3H3V H;  4QIW E;  4KN7 C;  2VUM G;  3GTO B;  5ELB A;  4B3R L;  2GN5 A;  4KKT A;  1PYB A;  1HH2 P;  4AYB E;  1LTG D;  1I5F A;  3HOZ G;  3TEH B;  1A0I A;  4HMI A;  4A3G G;  4K8J A;  4QUC A;  1VQO A;  4DNT B;  4A3M G;  2CH4 W;  1STG A;  4MTN A;  1XYI A;  3S2H H;  5IT9 E;  3BVZ A;  1EY9 A;  4BBR H;  1HPC A;  1VQB A;  3I73 A;  5C3E H;  4BY1 B;  2RA4 A;  3G4S A;  5GAE C;  1J5E Q;  2K5W A;  5M5Y B;  1GO3 E;  1C8C A;  1RD9 D;  3U50 C;  3M7N A;  3K80 C;  4MNO A;  1BOS A;  5KND A;  3NEM A;  2ZT9 C;  1DD2 A;  1TWA B;  4R4I A;  2KOL A;  3J7A F;  1STN A;  1R4P B;  3Q6S A;  3GTO H;  1PFS A;  1W2B A;  1GHK A;  3KF8 B;  4POF A;  1X3F A;  2RSO A;  1B3Q A;  2F0J A;  2XWJ B;  4TKO B;  1MJC A;  1UNS A;  4JI8 L;  3GTJ B;  4X62 Q;  3GTM B;  1HNZ L;  4O0A A;  1PRT F;  2B3G A;  2WII B;  2Q8I B;  3VDY A;  2I5H A;  1QB5 D;  3EJI A;  3S1N H;  1VF5 C;  4RCN A;  2HUG A;  5ELC A;  4HTH A;  4P71 A;  4DR3 L;  2PMZ E;  2ZTE A;  2ZTC A;  1QNU A;  2QGQ A;  4XYQ A;  1BR9 A;  3SK6 A;  1R4Q B;  2R3Z A;  2HIV A;  4EGV A;  1UE5 A;  3J7Z C;  1TWA H;  2F0I A;  3I72 A;  2HCI A;  5HUR A;  1E1T A;  2JA6 G;  5K36 H;  1ZKO A;  1TWG B;  4AQY L;  1QZG A;  1C7Y A;  2NZH A;  2XVS A;  2K5Q A;  2IHF A;  1WTH A;  3SHL A;  5M5W B;  3K8A A;  4BBS G;  3RUZ A;  4QL5 A;  2HCC A;  1YJW A;  5JEA J;  5G3L F;  3E0E A;  1TT2 A;  2FFK B;  3GTP H;  4OGQ C;  1VQG A;  4OX9 L;  2ZTD A;  3MXG A;  2ASB A;  1UUP A;  4L63 B;  3WOF A;  2F4I A;  4B3T Q;  3PIO 3;  5FLX E;  1X32 A;  1H9S A;  2WV6 D;  2NUC A;  1K3R A;  1SMX A;  2OXP A;  2C5C A;  3D8G A;  1U4M A;  1JT8 A;  4JV5 Q;  1SRO A;  4LFB L;  2ICE C;  2L12 A;  1LLR D;  4IUU A;  2MO0 A;  2EYP A;  1Y69 U;  4C2M H;  3F8T A;  5JJI A;  4QB4 A;  1UEB A;  3TS0 A;  3GO5 A;  3SK5 A;  2Q2T A;  1JOO A;  4IPC A;  5IP7 G;  3D4D A;  4QCL A;  2L11 A;  5JJZ A;  2EYL A;  3GD7 A;  4X64 Q;  2B8G A;  4OIK A;  1PH2 A;  3GTG B;  3Q23 A;  3HOX G;  1PRT C;  3HKZ E;  5C3X A;  3CCE A;  1K8A C;  4LUO A;  4AH6 A;  3H0G H;  1SFO B;  1SE2 A;  5FOB B;  3CC7 A;  3QOJ A;  3HOY G;  3E3X A;  2LSS A;  2YTV A;  3DHQ A;  2R7D A;  3CCV A;  3SR1 A;  1UAP A;  4IJH A;  4KTA A;  4UAI A;  3EQL C;  4XTC S;  1XPU A;  2EYO A;  5IT9 L;  1PMR A;  4FNF A;  4A93 H;  5M3F G;  2WB1 E;  1ILP A;  4K2K A;  3KBX A;  1JOR A;  4N8X 1;  4XT1 B;  1QJO A;  1WVL A;  5C0X I;  4JYA L;  5E1F A;  2QEX A;  1S3O A;  5JJK A;  5C4J B;  1E3P A;  1NMF A;  1Q8K A;  3EIV A;  2KEC A;  1N32 Q;  2HDL A;  1LAB A;  1QUQ B;  2NBF A;  4DV1 L;  2UXB Q;  3MFY A;  4DV2 Q;  4B9W A;  2A69 D;  3LNN A;  4JI3 L;  3RLF A;  2ALY B;  3J81 i;  3I4O A;  4H02 A;  4L8J A;  4FF1 A;  3GTQ B;  5FO7 B;  3M4Q A;  4CBV A;  1HFG A;  2A73 B;  1PDQ A;  3NTI A;  5J39 A;  1NAP A;  3VYR A;  3PUW A;  2KQ3 A;  4DR4 L;  1IYV A;  4NMZ A;  3I8Z A;  3IRB A;  5LMN W;  3R2I A;  1RTO A;  1R9T H;  4EX5 A;  1VQC A;  5C4J H;  4ULL A;  2NTS A;  2N55 A;  5ELN A;  3CPW A;  2IT1 A;  1PH9 A;  5C4X B;  2J4X A;  1NY4 A;  1D8L A;  4XQJ A;  3QOL A;  2E2H H;  4DR6 L;  4IFD H;  2HIX A;  5K5P A;  3S17 H;  3CCU A;  1BCP B;  5IGG A;  1PZK D;  1NNX A;  4RGO S;  3GTQ H;  5KEE A;  1P16 A;  5M3M G;  1RTN A;  4PMB A;  1BDO A;  1Y8O B;  1UEA B;  1B8A A;  4RGT A;  3GTL B;  2A19 A;  3NTH A;  4C3J B;  2VQE L;  3I4M H;  1ET9 A;  5HGQ A;  3F2B A;  2AWN A;  4NXN Q;  4C56 C;  3W1B A;  3PF5 A;  2DN8 A;  1O80 A;  1TS3 A;  4A3B H;  3VR6 A;  3ERS X;  4JI2 Q;  5FLX L;  1V1Q A;  1X56 A;  5C4X H;  4Q0F A;  5EKL A;  1KIX A;  4DV6 L;  4FO2 A;  2BE5 D;  1B9N A;  3D4R A;  4ME3 A;  3CC4 A;  2R92 H;  3Q0A A;  4DR1 Q;  1PHJ A;  5CV4 A;  3TBI B;  3NK9 A;  3OMC A;  2I0Q A;  1QWY A;  1MGS A;  3TZU A;  3IFT A;  4MTK A;  1KLG D;  2D0O A;  2VQF Q;  3OTO L;  3VR2 A;  3T53 B;  2FMM A;  3PQI A;  4YWM A;  4HIM A;  1SNO A;  1I4H A;  1JB7 A;  3FMC A;  3RZD B;  4HJ8 A;  1XMO Q;  3W1G A;  1H9J A;  4CDC C;  2UUA Q;  1CHQ D;  2BA1 A;  1OTC A;  2RCF A;  4QIW B;  2BDN A;  3GTL H;  3KYH C;  4NP5 A;  3SVM A;  3AMU A;  1VQ6 A;  4AYB B;  1L0X B;  1SJH D;  4FYD A;  4LF6 Q;  1SMY C;  1V9P A;  1U4P A;  2PZU A;  3A5Z B;  3LGJ A;  1JE5 A;  1UE7 A;  3I2Z A;  1AH9 A;  2AKW B;  3AQQ A;  1XTC D;  1GUS A;  1UWV A;  2VL6 A;  2EYH A;  2ZXR A;  2JA8 G;  4R9W A;  3MZ5 A;  1N36 L;  1CK1 A;  3G71 A;  3BS1 A;  1Y1V H;  4HJ9 A;  3M4Y A;  1LT4 D;  4RKL A;  1G6Z A;  2R7Z H;  3FEW X;  1EZ8 A;  1BUV T;  3ULL A;  2DUD A;  1XXG A;  2F4V Q;  2NVQ H;  3HGB A;  1IYU A;  3UDG A;  3DEO A;  1Q46 A;  4J8Q A;  4NXM Q;  2R6G A;  3CD6 A;  3HZX A;  3JAM L;  3GP7 A;  4C1N I;  2PI2 A;  1AE3 A;  2B8F A;  3Q8D A;  2YU9 H;  4J1M A;  4B3T L;  1A63 A;  4OXP A;  1Y1W G;  1DOK A;  3CW2 C;  4O2D A;  3SEB A;  1XNQ Q;  4POG A;  2AQ3 B;  4BWG B;  2LXK A;  3PO3 G;  1VQE A;  5KYI A;  4KLK A;  2PMZ B;  3UDI A;  2WAQ B;  4X65 L;  1BVS A;  1GVP A;  3HOW H;  2F0G A;  2XTI A;  3I4L A;  2KBN A;  2EQS A;  2NWG A;  2R61 A;  4GNX C;  2K50 A;  1K8M A;  4Y7N H;  4OWW B;  1VQP A;  3M4O B;  1TKW B;  3HKS A;  4A3I B;  2ES2 A;  4DAY B;  1PFB A;  4X64 L;  1K3B C;  1WCM H;  1E2V A;  3CRK C;  2NN6 I;  4I65 A;  4JI0 L;  2SNM A;  1DGS A;  1MI2 A;  5KRU A;  4B3R Q;  1QNK A;  1VQ8 A;  4IUV A;  4PNY A;  2JA5 H;  1PTO D;  4YIJ A;  5DM7 3;  1K8O A;  5G3L D;  1TQO A;  1X55 A;  3FRP B;  4CDD C;  3K0X A;  4J15 A;  2H5X A;  1VCI A;  4R4T A;  5M9O A;  4LF8 L;  1TR5 A;  4OEM B;  4C3H G;  2RSN A;  2JA9 A;  1JJ2 A;  3F1Z A;  1EFW A;  3K58 A;  3URY A;  3BVG A;  2VS1 A;  1A6X A;  3BDO A;  4GKK L;  3PIP A;  3KDF B;  5KGU A;  3K5O A;  4IAL A;  5JOB A;  1JOQ A;  4BBR G;  1SSO A;  5EQ0 A;  3TP6 A;  5IYD H;  5C3E G;  4MIU A;  4ZKB B;  2BH8 A;  3KLS A;  1SBB B;  1ENC A;  3OSO A;  2Q2U A;  4JOI A;  2KJX A;  1TVX A;  3ERQ A;  3FKI H;  3P75 A;  3GTK B;  2RDF A;  2R7F A;  1AZQ A;  1DOM A;  1Q90 A;  1HQM C;  2NZO A;  3BYT B;  1IKM A;  4N8F A;  2ID0 A;  5EBC A;  4FF2 A;  1BBW A;  1Q3L A;  4IUP A;  3HKZ B;  3B6Y A;  4L5R C;  4G7Z C;  4R1J A;  5FKA C;  1A3U A;  3VYS A;  1SNC A;  4B3S L;  1YHB A;  4DR3 Q;  2EJF C;  2N78 A;  2YTX A;  1TWC B;  4UY8 C;  3V05 A;  3TRZ A;  3M4P A;  5DEH A;  1DCZ A;  1I50 H;  3H91 A;  3W2D A;  3RN2 A;  3SDZ A;  1CKN B;  3JC6 6;  2A6E C;  2KHJ A;  2E2J B;  3D3R A;  3K57 A;  3S15 H;  3KJP A;  3C1E A;  1PH7 A;  3G6E A;  2G5D A;  4TVA B;  3VYT A;  1SE8 A;  2D5D A;  2KCT A;  3TDQ A;  1L1O B;  4AQY Q;  1OO9 B;  1MHW C;  4JG2 A;  5I9P A;  5IP9 H;  5K36 G;  3PUX A;  5E7N A;  1GJX A;  2JK8 A;  3ND9 A;  4DK1 A;  3NE5 B;  2MNA A;  3H3V C;  5C4H A;  3ULJ A;  1LAC A;  1ASY A;  2BDO A;  1ILQ A;  1FL0 A;  1TS5 A;  1V1O A;  4ALP A;  2LKV A;  1HUN A;  1HCZ A;  2EXZ A;  1EOV A;  5EPL A;  4OX9 Q;  3UDF A;  2LXJ A;  4A3F B;  3M3Y B;  1SMY D;  3ERO A;  1E2Z A;  4JI2 L;  1NSN S;  3PF4 A;  1BNZ A;  1HR0 L;  2CW0 C;  2F1M A;  4KY5 A;  2E2J H;  3J80 c;  4HCS A;  4XIG S;  2E76 C;  4LFB Q;  1ZXT A;  2OEO A;  2AUK A;  2HHH L;  4QUF A;  1DXM A;  3VA5 A;  4C3I H;  3UDX A;  2KHS A;  3BU2 A;  3CCL A;  2ZXO A;  1WTO A;  4A3D G;  5FO8 B;  1U5K A;  1XMO L;  2Z0S A;  1FJG L;  1BBU A;  4EQ5 A;  2Q8T A;  1K9M C;  1A62 A;  2D9U A;  1KAB A;  4OHJ A;  1O7Z A;  3J81 E;  4A3K H;  2WP8 J;  3K81 C;  4PZ8 A;  5JPM C;  3M3Y H;  5I6Y A;  3S14 H;  1M8A A;  1LTI D;  1SNP A;  3H0G G;  4M8A A;  3N6R A;  1O7Y A;  4ZUI A;  5IYC H;  5CYU A;  3CCQ A;  1AW7 A;  2MGS A;  3RZO H;  4G7O C;  3AB9 A;  4IUT A;  5T1I A;  4S3S A;  3H15 A;  2X6L A;  4R8I A;  1B1Z A;  2HT1 A;  3A8I E;  2EY6 A;  4B9X A;  4A93 G;  1JIC A;  1H9K A;  4A3J B;  1S40 A;  4DR2 L;  3WDN A;  1KL9 A;  5JVG 3;  3E6Z X;  1QVF A;  2OTJ A;  4NXM L;  1KAA A;  4A3L H;  5I4D A;  4DV1 Q;  4ZKC B;  3NEL A;  3DWQ A;  2ZJQ A;  2WKD A;  1SAP A;  1Z47 A;  1ZYR D;  4JI3 Q;  1NR4 A;  3FP9 A;  3VR3 A;  2F0P A;  1SEB D;  3F2C A;  1LYL A;  1PYS B;  1IZ6 A;  3LWE A;  3TSS A;  4DU9 A;  1BQQ T;  5IGC A;  5CBE E;  3KBG A;  1T9H A;  1LUZ A;  1HZA A;  2IPK D;  1GUT A;  3CCJ A;  1EFI D;  4DR4 Q;  1FNU A;  2DJF C;  2Y0S B;  2CWA A;  2VXW A;  4RGM A;  2JSO A;  4ODG A;  1EY0 A;  4J6H A;  2G9H D;  1HR0 W;  2SNS A;  1CUK A;  4DAM A;  2M00 A;  2RHQ B;  4EQO A;  3W5O A;  4ZYS A;  1KRT A;  4IUQ A;  2F0D A;  2FHT A;  4A3E B;  2KHI A;  1X3Q A;  5GAH C;  4DR6 Q;  5A2Q L;  3T56 B;  4JBJ A;  5C5L A;  1PFN A;  1Z6H A;  4IFD G;  3K59 A;  4HJ7 A;  2NTT A;  3I55 A;  1HJP A;  3T13 A;  3Q24 A;  3CKI B;  2PQE A;  4LF9 L;  2JXM B;  4GS3 A;  1DZ1 A;  1RKN A;  4RHR A;  1EY4 A;  2VQE Q;  4K14 A;  2XIW A;  3KOJ A;  4ABN A;  4QY7 A;  1ET6 A;  2O2L D;  3HOU B;  1B4O A;  3L3O C;  3I4M G;  2NVX H;  1K83 H;  1QCB D;  2JEA I;  4DV6 Q;  1IBL L;  2KCM A;  3ND8 A;  4A3B G;  1HNW L;  1HQR D;  4P2C B;  3TP7 A;  1EYD A;  1JE4 A;  1U4L A;  2SDF A;  2A6E D;  1CSP A;  2CHB D;  3OTO Q;  2R92 G;  1IBK Q;  3CME A;  5DNF A;  5GAG C;  2RF4 A;  1Z9F A;  1VQF A;  3W3A A;  5EJW A;  4P73 A;  4RA8 A;  4DK3 C;  2B2V A;  4BY7 B;  1BCP F;  2D2C C;  2NB0 A;  2K5N A;  4FF4 A;  2JA7 B;  3J81 L;  3GDE A;  2CWP A;  1CTM A;  4CDE C;  4BY1 H;  1KLU D;  2DY7 A;  2AUJ D;  1EWC A;  3PV0 A;  1HA5 A;  2WAQ E;  5M5Y H;  1SYE A;  2F0M A;  4PQX A;  1EU4 A;  1SE3 A;  3MXP A;  1JJC B;  1N36 Q;  1WTW A;  2JP1 A;  5C6A A;  3OIQ A;  2B63 G;  1F2Z A;  4GOP C;  4OIJ A;  2B2W A;  4DNR B;  2CW0 D;  1NE3 A;  1HHV A;  2KED A;  4XYO A;  3E5S A;  3M9B A;  3OHX C;  2AQ1 B;  1Y1V G;  1STH A;  3GTM H;  3GTJ H;  1IKL A;  3NP8 A;  1G29 1;  2R7Z G;  2E2D C;  5IYB H;  1QIL A;  4NKL A;  4NB3 A;  1FNW A;  2FXQ A;  2NVY B;  4R4O A;  1XPO A;  3CCM A;  1KDC A;  1ESR A;  3JAM c;  2DY8 A;  2A68 C;  3SK4 A;  1U9R A;  3CPF A;  1Z7T A;  2CFM A;  3V96 A;  3KLS X;  1IBM L;  2K04 A;  1S5F D;  1XTD A;  2B29 A;  3KLR A;  2CCZ A;  1KHI A;  4ZRZ A;  4UDU C;  4X65 Q;  4QJF A;  3HOV B;  1TWG H;  1U0L A;  1EY6 A;  1YHA A;  4XDX A;  4K8I A;  3NHH A;  1GD7 A;  4XQQ A;  2JJQ A;  3HOW G;  5M5W H;  4F7X A;  1LTB D;  3K0Y A;  3I4N G;  4YCW A;  3A5U A;  4YHH L;  3D6C A;  4JI0 Q;  4ZUJ A;  5I2Y A;  3MXN B;  1PZI D;  4HSP A;  1PZJ D;  2L15 A;  3A74 A;  1STA A;  3RMH A;  3FHW A;  1LT6 D;  1WCM G;  1QG7 A;  1B2T A;  5LMU L;  4LF8 Q;  2JA5 G;  3IKJ A;  3QIA A;  2OCE A;  1EL0 A;  5JEA H;  5IGF A;  5F2D A;  3NBH B;  3CCR A;  1G2T A;  2IX1 A;  4GKK Q; 
#chains in the Genus database with same CATH homology
 1WD0 A;  5IGD A;  4X3S A;  3S1R B;  3VA7 A;  3PO2 B;  2K5D A;  4TQU S;  2B2V C;  3D31 A;  3TP8 A;  2I46 A;  1CM9 A;  1KDA A;  1WTQ A;  5CV5 A;  3A7A B;  4DAV A;  1ZEQ X;  2R93 B;  1CT1 D;  1EOT A;  1B3A A;  1HFN A;  3SXH A;  4DA2 A;  4OO1 G;  4V0B A;  4F87 A;  2NN6 H;  3MVV A;  3MA2 B;  2VUM B;  2B39 A;  4K6L A;  3L9A X;  5IGE A;  5EBD A;  4DFA A;  2K05 A;  4EVO A;  3PMF A;  4HN7 A;  3HOZ B;  2DNC A;  2L0C A;  3NQI A;  4A3G B;  2LS0 1;  1TU2 B;  4A3M B;  4GZY C;  4RWS C;  1VF7 A;  3X3N A;  3KUP A;  1CQF A;  1G91 A;  5CBA E;  4E6I A;  1D1I A;  2EYM A;  5EPK A;  2Z1C A;  1E0B A;  3NBI A;  4CJ0 B;  2AWO A;  2RKS A;  1SNQ A;  3O13 A;  2L1B A;  2NYZ D;  2ENB A;  2EY5 A;  1GUN A;  3UI2 A;  3CHB D;  1DOL A;  3S2D B;  2F0L A;  2F03 A;  4CKC A;  1LT3 D;  3IAY A;  3SK8 A;  2L4N A;  3QG1 A;  2EZV A;  3T4A C;  5BN4 A;  5J22 A;  4K5V A;  3I70 A;  5DAU A;  3KK7 A;  1WTV A;  1CHP D;  4HAE A;  4C3I G;  1C4Q A;  2B2U A;  4RKB A;  3MFG A;  4RGN A;  3U9O A;  2F0E A;  4K2L A;  4IUR A;  1PTO B;  4EQN A;  4BBS B;  1KNE A;  2QIL A;  2CQA A;  1MD2 D;  5ELF A;  2O5J C;  1CI3 M;  2RDG A;  1FNV A;  1CFM A;  1CZG A;  2V4D A;  4Q5V A;  4ZQ3 A;  1TII D;  1IW7 C;  4KHV A;  2G9D A;  2GA4 B;  1F9R A;  4K5X A;  1HTL D;  4ZLT F;  1PRT D;  1PTO H;  2LMC B;  2WIN B;  3K5N A;  1DJR D;  1WTP A;  2A74 C;  4X3K A;  4HR7 B;  5EKK A;  3HOX B;  4F8M A;  2K01 A;  3HOY B;  1AEX A;  5D3D A;  1OXS C;  1WTR A;  2KCC A;  1L0Y B;  3OIP A;  1MSG A;  3IFD A;  5M3F B;  1EEF D;  1O7L A;  1ESF A;  3GQB A;  3BDC A;  2IJ0 A;  4FXK C;  4EQP A;  1I3Q B;  1TWH B;  3QWN A;  3PUZ A;  1S5E D;  1F9S A;  3BVM A;  5CV6 A;  1TWF B;  4ILW A;  4G57 A;  1ENA A;  1CA5 A;  1EY5 A;  3H6M A;  2IX3 A;  5IGB A;  5FK9 C;  3K5L A;  3MC0 B;  4ME5 A;  1SDF A;  1SYD A;  2B2Y A;  1STE A;  2F0S A;  1EWH A;  2HQE A;  3I3C A;  4CKE A;  3KF8 A;  3GV3 A;  1B53 A;  2AQ2 B;  2F3V A;  5BN3 A;  1JCK B;  4FVM A;  1GUG A;  4DN4 M;  1YNJ C;  1I6H B;  2QKI C;  2KVM A;  4KHZ A;  5M3M B;  2J7Z A;  3S16 B;  5ELD A;  2X6G A;  4QMG A;  2H1E A;  4HED A;  4NDX A;  1LT5 D;  4H44 C;  3V2T A;  2EJG C;  3DUZ A;  1Q1B A;  1DYQ A;  3NWT A;  1LTT D;  2MP1 A;  1WD1 A;  1V43 A;  5M5X B;  5LL6 S;  1A2U A;  4XQN A;  3J7A V;  4LK1 C;  4KY7 A;  2F0O A;  4Z9C B;  1H9R A;  2F0T A;  3EA6 A;  2KEE A;  4LJZ C;  3A55 A;  3OPO A;  1DM0 B;  2J0T D;  2BOS A;  2FIN B;  1D2B A;  2RDH A;  2JA8 B;  1IL8 A;  4F88 A;  4ZK9 B;  1ENF A;  3J7Y W;  5FO9 B;  2XN9 C;  3H94 A;  2N88 A;  3E0J A;  2A6H C;  2EVB A;  4KN4 C;  2E2I B;  1OXV A;  1IW7 D;  3U9S A;  2OT2 A;  5KYL A;  4LMQ D;  3MXN A;  1BF4 A;  3M85 A;  2QF7 A;  1FD7 D;  4U68 A;  3S1Q B;  2IW3 A;  3RD4 A;  1I4G A;  1EYC A;  3C3L A;  1Y1W B;  5J1Z A;  1S5B D;  1Q12 A;  5JEA G;  3PO3 B;  2O4X A;  1SJE D;  3NSW A;  4CJ2 C;  4X3U A;  2PW7 A;  1TS2 A;  1Y8P B;  1PXU A;  3NWS A;  2O5I C;  5T1G A;  4KK7 A;  1OXT A;  3HG9 A;  4WOR A;  2MUY A;  1V1P B;  2MHV A;  3CQZ B;  3AU7 A;  2K33 A;  2LFN A;  2EOT A;  1QE6 A;  1S5D D;  4K6D A;  1TY2 A;  2EJM A;  5BN5 A;  3J80 E;  2MPM A;  2LY7 A;  1X3P A;  4H0L C;  4C3H B;  1ICW A;  5D14 A;  2Z4H A;  1BXT A;  2EDG A;  2XWB B;  3EVQ A;  5C0X H;  4CJ1 B;  1EY8 A;  4BBR B;  1SE4 A;  2IX0 A;  5C3E B;  3OOC A;  4OO1 I;  4KKS A;  1Y8N B;  2A69 C;  3QB3 A;  4CKB A;  1YNJ D;  3TN2 A;  4V19 0;  1ROD A;  2SEB D;  1FYC A;  1D5M C;  3TME A;  2PW5 A;  1G2S A;  3S1N B;  4RH6 A;  2QDB A;  2L55 A;  1EY7 A;  1JB3 A;  1HTP A;  4DK0 A;  1AZP A;  4TSS A;  1W6J A;  2PZT A;  1GHJ A;  3S1M B;  1WTX A;  3WOE A;  2HDM A;  1PYW D;  4DXG A;  1EQT A;  3I91 A;  4MN3 A;  2PO4 A;  5COY A;  4C3J G;  5AFW A;  5IIF A;  2PCF B;  1GOZ A;  3HP3 A;  1J9O A;  3P20 A;  1JOK A;  1O78 A;  4LAA A;  2XSC A;  4X3T A;  1C48 A;  4DXF A;  1PFM A;  5ISR A;  3A54 A;  1I4R A;  1JQY D;  4XXE A;  3GTP B;  3A8J E;  4JK1 C;  2BE5 C;  4N9T A;  3K5M A;  2L9H A;  2K03 A;  5TSS A;  3X3M A;  3DEP A;  4IUN A;  1SYF A;  3I90 A;  5COR A;  2A6H D;  2EY1 A;  4A3D B;  3P1H A;  5C3W A;  4BA1 I;  4C2M B;  1SND A;  5ELE A;  5IOC A;  4FXD A;  1HUM A;  2Z4I A;  5EGT A;  1PTO F;  3R3O A;  3NTK A;  4C1N K;  1EEI D;  2X69 A;  4RAU C;  3H0G B;  3J80 L;  4WJW A;  2NVT B;  1RHP A;  3NXW A;  2F0F A;  1T5X D;  1BCP C;  2F0H A;  3N52 A;  4DAY A;  3C46 A;  3DMU A;  3QO2 A;  4RCO A;  3VR5 A;  1LTR D;  1RJT A;  4A93 B;  3CRL C;  3C1F A;  3T51 B;  5A35 A;  5EPJ A;  5CV9 A;  2DNE A;  1HXY D;  1JWU D;  1VMC A;  2SOB A;  1ONL A;  3VR4 A;  5LL6 X;  5C4Z A;  1A2T A;  1MBY A;  1B44 D;  3FPU B;  2JE6 I;  4IQZ A;  1EU3 A;  2MJ8 A;  1EIH A;  3BG3 A;  2E74 C;  2JYO A;  2IWH A;  4PMC A;  4IFD J;  2PYK A;  3PUV A;  2KUM A;  4KD3 A;  1R9T B;  3CU7 A;  1XWE A;  2PPB C;  1G8Z D;  5E4X A;  2F0V A;  2B2W C;  5LHY 1;  3JAM E;  2L5T A;  1PTO C;  3A8K E;  3OWE B;  2E2H B;  3MTS A;  1F9P A;  3S17 B;  3OWF A;  2NZ1 D;  1NR2 A;  2B2T A;  1CQV A;  4WFN 3;  3G6J B;  1B9M A;  4IZ8 A;  4DAP A;  3S9W A;  4TRD A;  5JVH 3;  3NPP A;  3LX0 A;  2BCO A;  3I4M B;  4HMJ A;  2PNR C;  3MWY W;  1EIG A;  1II3 A;  4A3B B;  2VB3 X;  3DWP A;  2PZW A;  4HSV A;  4M1U B;  1JWM D;  2R92 B;  1S4Z A;  3ONA B;  1KTK A;  5JAV A;  1GXD C;  1U4R A;  1AP0 A;  3Q22 A;  1LTA D;  1PRT B;  1SYB A;  4OL7 A;  4HCE A;  1LTS D;  4KY6 A;  2XNA C;  4L6T B;  2KCN A;  2EYJ A;  1CZW A;  4O1N A;  1HA6 A;  1RF2 D;  2JEB I;  2C9O A;  3OMG A;  2B63 B;  1LV9 A;  1STY A;  3F2U A;  2F0W A;  3R2T A;  2F0N A;  2JA6 B;  1F77 A;  1SNM A;  1KNA A;  2K6A A;  2Q8R E;  1Y1V B;  1OXU A;  1DON A;  2R7Z B;  3R93 A;  1D6E C;  2RQX A;  1GUO A;  1FR3 A;  2NVQ B;  3BZD B;  4BA2 I;  2A68 D;  4H13 C;  5KNC A;  1JR0 D;  1RCV D;  1VMP A;  1STB A;  1GUW A;  1F2L A;  3VYU A;  5I6W A;  1MSH A;  3LWU A;  2YU9 B;  3GV6 A;  3ITP A;  1F2M A;  5CC4 A;  3D6W A;  2FMC A;  2M9V A;  1YNN C;  2K7V A;  3R8B A;  1BCP D;  1SXT A;  5EKI A;  5KNB A;  3HOW B;  2OF1 A;  1JWS D;  3MEH A;  3I4N B;  1I4Q A;  4Y7N B;  1AFP A;  1V1P A;  2B2T C;  2E75 C;  1E2W A;  4DGZ A;  1Q8I A;  1RDP D;  1WCM B;  1TS4 A;  1H9S B;  3D4W A;  4DF7 A;  4FP5 D;  2JA5 B;  3HEJ A;  3MHB A;  1NCV A;  3H09 A;  2I07 B;  3P7J A;  5CV7 A;  4ID6 A;  2CVR A;  3NQT A;  2H4O A;  4JBW A;  5C0X G;  1XX8 A;  3QJY A;  4N9P A;  2TMP A;  3PIP 3;  1V8Q A;  1ZYR C;  1BO0 A;  4PMW A;  3OW7 A;  3HS0 C;  3FKI B;  4QF4 A;  2QCP X;  1H9M A;  4K5W A;  2D62 A;  1FGB D;  4H7B A;  2B2U C;  4U67 3;  1I6V C;  4WRD A;  3DM1 A;  3BYY B;  4IN3 A;  5E4W C;  3A56 A;  1BBX C;  3DXJ C;  3PUY A;  4IFD I;  4RFB A;  3ZYY X;  1I50 B;  4KJN A;  1A3V A;  3DWA A;  1PLF A;  3FPP A;  2BA0 A;  3NUC A;  1VDZ A;  1W6K A;  3M7G A;  1F9Q A;  3S15 B;  3K7A B;  5D3I B;  4KKU A;  2F0Q A;  4OO1 H;  3BDL A;  2K32 A;  2YYZ A;  3T16 A;  1SYC A;  5I2X A;  2XRS D;  2WAC A;  2ICI A;  5C5M A;  1D5Z C;  2EPB A;  2KA7 A;  1EQV A;  1SYG A;  2VNU D;  4CHT B;  5CV8 A;  4KV6 A;  5HGT A;  4XT3 B;  3C2P A;  1QOH A;  1J8I A;  4R8N A;  3TP5 A;  2WB1 B;  2ZXP A;  3L7Z C;  5A2Q E;  5C44 B;  3IL8 A;  2F0K A;  1F2Y A;  5IOD A;  1EYA A;  4C3I B;  2K1B A;  1D1K A;  3HRZ C;  2K28 A;  2F3W A;  4B08 A;  4KMU C;  2WKC A;  4KI0 A;  4MHE A;  4A3K B;  3S14 B;  1I4P A;  2RVL A;  1I4X A;  5NUC A;  1T5E A;  1JC7 A;  3RZO B;  3EFX D;  1EZ6 A;  2FJ2 A;  1YNN D;  4KD4 A;  1CA6 A;  4NW2 A;  5CR3 A;  1NUC A;  3MXU A;  1Q1E A;  2A5H A;  2QEJ C;  4G4K A;  4O42 A;  1KDB A;  4PV1 C;  5I9O A;  5E3F A;  1M4V A;  4RHS A;  5D65 A;  3G7L A;  2F0U A;  2B2Y C;  2M2L A;  1A3T A;  3NBH A;  4BS9 A;  1LO5 D;  1AN8 A;  3FVQ A;  2EY2 A;  3TZD A;  3SE0 A;  1HRJ A;  1A15 A;  1ML0 D;  1D5X C;  3K6O A;  5DM6 3;  5C0X J;  4KJO A;  4FF3 A;  1TY0 A;  4FXG C;  1IHZ A;  2EE1 A;  2XRQ D;  3A7L A;  1S5C D;  1OXX K;  1B50 A;  2NN6 G;  4ZAI A;  4G7H C;  2IL8 A;  2TSS A;  2RBM A;  5KIX A;  5CGK A;  4I7Z C;  3S2H B;  2EYF A;  2Z8L A;  3FDT A;  2VB2 X;  4CGY B;  2NVX B;  1K83 B;  5JPN C;  3MAQ A;  5CMD A;  4KN7 C;  3GTO B;  5ELB A;  4KKT A;  1LTG D;  4HMI A;  4K8J A;  4QUC A;  4DNT B;  1STG A;  1XYI A;  5IT9 E;  3BVZ A;  1EY9 A;  1HPC A;  3I73 A;  4BY1 B;  2RA4 A;  2K5W A;  5M5Y B;  1C8C A;  1RD9 D;  3M7N A;  1BOS A;  5KND A;  2ZT9 C;  1DD2 A;  1TWA B;  3J7A F;  2KOL A;  1STN A;  1R4P B;  3Q6S A;  1GHK A;  2RSO A;  2F0J A;  2XWJ B;  4TKO B;  1UNS A;  3GTM B;  3GTJ B;  1PRT F;  2WII B;  2Q8I B;  1QB5 D;  3EJI A;  1VF5 C;  4RCN A;  2HUG A;  5ELC A;  4HTH A;  1QNU A;  4XYQ A;  1BR9 A;  3SK6 A;  1R4Q B;  2R3Z A;  4EGV A;  2F0I A;  3I72 A;  2HCI A;  5HUR A;  5K36 H;  1ZKO A;  1TWG B;  2XVS A;  2K5Q A;  3SHL A;  5M5W B;  3RUZ A;  2HCC A;  5JEA J;  5G3L F;  1TT2 A;  2FFK B;  4OGQ C;  3MXG A;  1UUP A;  4L63 B;  3WOF A;  2F4I A;  3PIO 3;  5FLX E;  1X32 A;  1H9S A;  2WV6 D;  2NUC A;  2OXP A;  2C5C A;  3D8G A;  1U4M A;  2ICE C;  2L12 A;  1LLR D;  4IUU A;  2EYP A;  1Y69 U;  4QB4 A;  3GO5 A;  3SK5 A;  1JOO A;  3D4D A;  4QCL A;  2L11 A;  5JJZ A;  2EYL A;  3GD7 A;  2B8G A;  4OIK A;  3GTG B;  3Q23 A;  1PRT C;  5C3X A;  1SFO B;  1SE2 A;  5FOB B;  3QOJ A;  3DHQ A;  3SR1 A;  1UAP A;  4KTA A;  4UAI A;  3EQL C;  4XTC S;  2EYO A;  5IT9 L;  1PMR A;  4FNF A;  1ILP A;  4K2K A;  3KBX A;  1JOR A;  4XT1 B;  1QJO A;  1WVL A;  5C0X I;  5E1F A;  5C4J B;  2KEC A;  2HDL A;  1LAB A;  2NBF A;  3MFY A;  4B9W A;  2A69 D;  3LNN A;  3RLF A;  4L8J A;  4FF1 A;  3GTQ B;  5FO7 B;  4CBV A;  1HFG A;  2A73 B;  1PDQ A;  3NTI A;  5J39 A;  1NAP A;  3VYR A;  3PUW A;  2KQ3 A;  1IYV A;  4NMZ A;  3I8Z A;  3R2I A;  1RTO A;  4ULL A;  2NTS A;  2N55 A;  2IT1 A;  5C4X B;  2J4X A;  4XQJ A;  3QOL A;  4IFD H;  5K5P A;  1BCP B;  5IGG A;  1PZK D;  4RGO S;  5KEE A;  1RTN A;  4PMB A;  1BDO A;  1Y8O B;  1UEA B;  4RGT A;  3GTL B;  3NTH A;  4C3J B;  1ET9 A;  2AWN A;  4C56 C;  2DN8 A;  1O80 A;  1TS3 A;  3VR6 A;  5FLX L;  4Q0F A;  5EKL A;  4FO2 A;  2BE5 D;  1B9N A;  3D4R A;  3Q0A A;  5CV4 A;  3TBI B;  3NK9 A;  3OMC A;  1QWY A;  1MGS A;  3TZU A;  3IFT A;  1KLG D;  3VR2 A;  3T53 B;  2FMM A;  1SNO A;  1I4H A;  3FMC A;  3RZD B;  1H9J A;  1CHQ D;  2BA1 A;  4QIW B;  2BDN A;  4NP5 A;  3SVM A;  3AMU A;  4AYB B;  1L0X B;  1SJH D;  4FYD A;  1SMY C;  1U4P A;  2PZU A;  1XTC D;  1GUS A;  2EYH A;  2ZXR A;  4R9W A;  3MZ5 A;  1CK1 A;  3BS1 A;  3M4Y A;  1LT4 D;  4RKL A;  1G6Z A;  3FEW X;  1EZ8 A;  1BUV T;  1XXG A;  3HGB A;  1IYU A;  3DEO A;  4J8Q A;  2R6G A;  3HZX A;  3JAM L;  3GP7 A;  4C1N I;  2B8F A;  4J1M A;  1DOK A;  3SEB A;  2AQ3 B;  4BWG B;  5KYI A;  2PMZ B;  2WAQ B;  2F0G A;  3I4L A;  2NWG A;  2R61 A;  1K8M A;  3M4O B;  1TKW B;  4A3I B;  1PFB A;  1E2V A;  3CRK C;  2NN6 I;  4I65 A;  2SNM A;  1MI2 A;  5KRU A;  1QNK A;  4IUV A;  4PNY A;  1PTO D;  4YIJ A;  5DM7 3;  1K8O A;  5G3L D;  1TQO A;  3FRP B;  1VCI A;  5M9O A;  1TR5 A;  4C3H G;  2RSN A;  3K58 A;  3URY A;  3BVG A;  1A6X A;  3BDO A;  5KGU A;  3K5O A;  4IAL A;  5JOB A;  1JOQ A;  1SSO A;  5EQ0 A;  3TP6 A;  4MIU A;  4ZKB B;  3KLS A;  1SBB B;  1ENC A;  3OSO A;  2KJX A;  1TVX A;  3ERQ A;  3P75 A;  3GTK B;  2RDF A;  1AZQ A;  1DOM A;  1Q90 A;  1HQM C;  3BYT B;  1IKM A;  2ID0 A;  5EBC A;  4FF2 A;  1Q3L A;  4IUP A;  3HKZ B;  4G7Z C;  5FKA C;  1A3U A;  3VYS A;  1SNC A;  2EJF C;  1TWC B;  3V05 A;  5DEH A;  1DCZ A;  3W2D A;  3H91 A;  3SDZ A;  2A6E C;  2E2J B;  3D3R A;  3K57 A;  3C1E A;  3VYT A;  2D5D A;  3TDQ A;  1OO9 B;  5I9P A;  5K36 G;  3PUX A;  1GJX A;  4DK1 A;  3ND9 A;  3NE5 B;  3H3V C;  5C4H A;  1LAC A;  2BDO A;  1ILQ A;  1TS5 A;  1V1O A;  2LKV A;  1HUN A;  1HCZ A;  2EXZ A;  5EPL A;  4A3F B;  3M3Y B;  1SMY D;  3ERO A;  1E2Z A;  1NSN S;  1BNZ A;  2CW0 C;  2F1M A;  4KY5 A;  4HCS A;  4XIG S;  2E76 C;  1ZXT A;  2OEO A;  2AUK A;  4QUF A;  1DXM A;  3VA5 A;  2KHS A;  2ZXO A;  1WTO A;  5FO8 B;  2Q8T A;  2D9U A;  1KAB A;  4OHJ A;  1O7Z A;  3J81 E;  2WP8 J;  5JPM C;  5I6Y A;  1M8A A;  1LTI D;  1SNP A;  4M8A A;  3N6R A;  1O7Y A;  4ZUI A;  5CYU A;  1AW7 A;  2MGS A;  4G7O C;  3AB9 A;  4IUT A;  5T1I A;  4S3S A;  2X6L A;  4R8I A;  1B1Z A;  3A8I E;  2EY6 A;  4B9X A;  1JIC A;  1H9K A;  4A3J B;  3WDN A;  5JVG 3;  3E6Z X;  1KAA A;  5I4D A;  4ZKC B;  3DWQ A;  2WKD A;  1SAP A;  1Z47 A;  1ZYR D;  1NR4 A;  3VR3 A;  2F0P A;  1SEB D;  3LWE A;  3TSS A;  4DU9 A;  1BQQ T;  5IGC A;  5CBE E;  3KBG A;  2IPK D;  1GUT A;  1EFI D;  1FNU A;  2Y0S B;  2VXW A;  4RGM A;  2JSO A;  4ODG A;  1EY0 A;  4J6H A;  2G9H D;  2SNS A;  2M00 A;  4EQO A;  4ZYS A;  4IUQ A;  2F0D A;  2FHT A;  4A3E B;  1X3Q A;  5A2Q L;  3T56 B;  5C5L A;  1PFN A;  1Z6H A;  4IFD G;  3K59 A;  2NTT A;  3Q24 A;  3T13 A;  3CKI B;  2PQE A;  2JXM B;  1DZ1 A;  1RKN A;  4RHR A;  1EY4 A;  4K14 A;  2XIW A;  4ABN A;  1ET6 A;  2O2L D;  3HOU B;  1B4O A;  3L3O C;  1QCB D;  2JEA I;  3ND8 A;  1HQR D;  4P2C B;  3TP7 A;  1EYD A;  1JE4 A;  1U4L A;  2SDF A;  2A6E D;  2CHB D;  5DNF A;  3W3A A;  5EJW A;  4RA8 A;  2B2V A;  4BY7 B;  1BCP F;  2D2C C;  2NB0 A;  4FF4 A;  2JA7 B;  3J81 L;  1CTM A;  1KLU D;  2DY7 A;  2AUJ D;  1EWC A;  3PV0 A;  1HA5 A;  1SYE A;  2F0M A;  4PQX A;  1EU4 A;  1SE3 A;  3MXP A;  1WTW A;  2JP1 A;  5C6A A;  3OIQ A;  1F2Z A;  4OIJ A;  2B2W A;  4DNR B;  2CW0 D;  1HHV A;  2KED A;  4XYO A;  3E5S A;  3OHX C;  2AQ1 B;  1STH A;  1IKL A;  3NP8 A;  1G29 1;  2E2D C;  1QIL A;  4NKL A;  1FNW A;  2NVY B;  1KDC A;  1ESR A;  2DY8 A;  2A68 C;  3SK4 A;  1U9R A;  1Z7T A;  3V96 A;  3KLS X;  2K04 A;  1S5F D;  3KLR A;  4ZRZ A;  4UDU C;  3HOV B;  1EY6 A;  4XDX A;  4K8I A;  3NHH A;  4XQQ A;  4F7X A;  1LTB D;  3K0Y A;  3D6C A;  4ZUJ A;  5I2Y A;  1PZI D;  4HSP A;  1PZJ D;  1STA A;  3RMH A;  1LT6 D;  1QG7 A;  1B2T A;  3IKJ A;  3QIA A;  1EL0 A;  5JEA H;  5IGF A;  5F2D A;  1G2T A;  2IX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...