1U9RA

Crystal structure of staphylococcal nuclease mutant v66e/p117g/h124l/s128a at room temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Stabilization of internal charges in a protein: water penetration or conformational change?
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u9rA00
1EZ6A 4NMZA 5CV8A 5HURA 5IODA 1F2YA 1EYAA 3QOLA 2F0LA 2PW5A 1SNCA 2EY5A 4K8IA 4ODGA 3TP7A 1SYDA 3NXWA 3OWFA 4YIJA 3SXHA 4DFAA 1A2TA 5CV5A 4DU9A 5KIXA 1EY9A 5KYLA 1AEXA 4KJNA 3NP8A 2EYPA 2F0SA 2OF1A 3H6MA 3OSOA 1EY5A 4IALA 3SK4A 2EYLA 3T13A 2RBMA 3QB3A 4K8JA 4NKLA 5HGTA 1EYDA 1NSNS 1SNQA 4J1MA 5NUCA 2F0FA 5EGTA 2F0VA 4B9WA 3T16A 2F3VA 4G57A 5K5PA 2EYHA 4K5VA 4KD3A 2F3WA 4J6HA 3S9WA 5EKLA 3SR1A 2KHSA 4KJOA 5M9OA 2RKSA 1F2MA 4N9PA 5CC4A 3HZXA 5C5LA 5J39A 1KDCA 1TT2A 3PMFA 2PW7A 2F0IA 2SOBA 3NHHA 4K2LA 1SNDA 1SNPA 2LKVA 5CV6A 3MXPA 4ZQ3A 4F8MA 5C4ZA 1SYBA 5IOCA 3MZ5A 4HMJA 3SK8A 1STHA 2F0OA 3LX0A 4PMBA 2F0DA 5I6WA 2EY6A 4S3SA 1U9RA 5E1FA 2F0GA 1TR5A 1EY4A 1EYCA 1SNMA 1A3TA 5I6YA 3R3OA 3DMUA 1KDAA 1EQVA 2OEOA 2HQEA 2OXPA 2EY1A 2PQEA 1STAA 2F0EA 4EVOA 5C6AA 2PYKA 1JOKA 3NUCA 2F0NA 4KY6A 5EKKA 2PZTA 5IGBA 2SNSA 5IGCA 4QB4A 4KY5A 3DHQA 4HTHA 4WORA 1F2ZA 1ENCA 4N9TA 3P75A 4EQPA 5DEHA 4IUNA 4ME5A 4RKLA 1EZ8A 3TP5A 2F0TA 1KDBA 3HEJA 3MHBA 3U9OA 4EQOA 5KGUA 3E5SA 1TQOA 4K6DA 4QMGA 4KTAA 2EYOA 5KRUA 3ITPA 2F0HA 3V2TA 5IGDA 2WACA 3QOJA 3P1HA 4K14A 4OL7A 4I65A 3RUZA 1SYGA 2KQ3A 2F0UA 4R8NA 5F2DA 5IGGA 1EY8A 1II3A 2PZUA 3EROA 3ERQA 2M00A 3EJIA 1SYCA 2F0QA 3NQTA 4RKBA 1EY6A 5JAVA 4EQNA 2EYFA 4WRDA 3C1EA 2F0JA 5C3WA 2EYMA 3SK5A 4HMIA 2EXZA 2SNMA 3TP6A 4ID6A 5IGEA 1NUCA 5J22A 5J1ZA 4KHVA 2F0PA 1KABA 1STYA 1A3UA 4K5WA 4ZUIA 3NK9A 4NDXA 5C3XA 5IIFA 3D4DA 5C5MA 5C4HA 1SNOA 5CGKA 3SK6A 1STNA 4E6IA 5CR3A 5CV7A 2RDFA 4TRDA 1A2UA 3D4WA 3SHLA 3OMGA 4B9XA 5E3FA 2EYJA 1STGA 3VA5A 4DGZA 3D6CA 4PMCA 4MIUA 1STBA 5KYIA 3BDLA 5DAUA 2F0MA 2NUCA 1SYEA 2QDBA 3D8GA 4K2KA 4KY7A 1SYFA 1JOOA 3TMEA 5IGFA 2O4XA 4H7BA 2ENBA 4QF4A 4PNYA 5JOBA 1IHZA 5I9OA 2PZWA 5CV9A 4KD4A 5CV4A 1JOQA 5ISRA 1JORA 3EVQA 3OMCA 4ZUJA 1EY0A 1KAAA 3C1FA 3MVVA 4DF7A 5KEEA 1A3VA 3BDCA 2F0WA 1EY7A 4IZ8A 4NP5A 1ENAA 3MEHA 4K5XA 1RKNA 4KV6A 3TP8A 4LAAA 2F0KA 4F7XA 2EY2A 5I9PA
chains in the Genus database with same CATH superfamily
2YU9H 3F8TA 2LS01 2YV5A 2FJ2A 2K32A 1XYIA 2UXCL 1X65A 2B3GA 4DK1A 3HOZB 4A3GH 1XPRA 5C4JH 5C44B 1JB3A 5LHY1 3CCJA 1N33L 2AQ2B 4I7ZC 1HNXL 5K36G 4G4KA 3M3YH 5K5PA 2R6GA 3S9WA 1E1TA 3BVZA 4X3TA 1C4QA 1BBXC 2BH2A 4A3CG 4IQZA 2Z9HA 1TT2A 3GTQH 3F2BA 1K0RA 1G6ZA 1QNKA 4JBWA 4DXFA 4XXEA 3U58A 3MZ5A 4FXGC 4HMJA 2F0OA 1PRTB 2R92B 5LMUL 5ELDA 3TREA 3Q8DA 1GOZA 3BJUA 2QW7A 1HNZQ 3J80E 3M4OB 3EA6A 3CC2A 1B70B 1Y1VH 5J3BA 1ET6A 2PMZB 3SDZA 2OEOA 4OGQC 1JE4A 2A5HA 3NUCA 2K03A 4JI6L 4DV1L 4LF6L 1NNXA 4KY5A 1ZXTA 2MJ8A 1GHKA 1PZKD 1IBKQ 3SVMA 3TP5A 5KGUA 4CJ2C 4HAEA 1XX8A 1GO3E 2PI2E 1CHQD 3K5MA 3S14H 1V1QA 4A3EH 1Q81C 1HNZL 2NZHA 3QOJA 4DV0L 2JYOA 3MTSA 1DGSA 1PH9A 1EIFA 1II3A 3BG3A 3V2TA 2R7ZH 1O80A 3HGBA 2P5ZX 4OHJA 3T4AC 1PH3A 2PQAA 1LTGD 2Z4IA 3F2UA 1PFSA 3K81C 5CBEE 1UUPA 1U4LA 1IKMA 2B2YC 1A3UA 3AQQA 3D4DA 3DM1A 3SK6A 5CR3A 1I4RA 3H0GH 4XIGS 4A4IA 3D4WA 3CCSA 1DOMA 1PYBA 3CKIB 4PZ6A 3D6CA 2Y0SB 3DWAA 1TWGB 4GN5A 1CZWA 1WTHA 2AMCB 3JAMi 1TY2A 4DAYB 2KEEA 1SYFA 1JOOA 3JAMc 3GTKH 4O42A 2CW0D 3S2HH 4LF7Q 1CA6A 4P73A 4DV6L 3NWSA 3PF5A 4TSSA 4HJ9A 4BXXH 4M1UB 2L5TA 3DWPA 4XDXA 3K57A 5ELEA 4DPGA 2I5HA 2E5LQ 2R61A 1SMYC 2Z1CA 1EY9A 1BNZA 1GXDC 1JB7A 2EYPA 1CKNB 2RBMA 1TS3A 4LF7L 2NVYB 2WB1G 2B2WC 3VYTA 2K1BA 3MXNA 3MEFA 4AYBE 3HKZE 3SGIA 5M9OA 3CCVA 1RHPA 1XMOQ 1JWUD 2E2IB 1KRSA 4B3SQ 1QWYA 1Y1WG 3KF8B 3OYYA 4UDUC 2E5LL 2K6AA 5JEAH 1S5ED 4ZYSA 3HOYB 4XT3B 2OQ0A 2J4XA 3K5OA 2HQEA 4JI2Q 3J7A5 1XMOL 2ZTEA 1B8AA 1A62A 1AZQA 4DAMA 4B3SL 4HTHA 1FD7D 2NN6H 4UP7A 2V1CC 4X3KA 1X56A 1TQOA 2N8NA 3J7YW 3FEWX 4PV1C 1K8AC 3NELA 3QG1A 4P71A 1LT6D 4K14A 1TWCB 2B39A 4R8NA 2EVBA 4JI2L 2VB2X 3KF6B 4A3JH 1H9JA 3D6WA 4CGYB 2EXZA 3GV6A 3NTKA 4LFBQ 1SE8A 1A15A 3AFPA 5C3XA 4XYQA 4DR6Q 3HOVH 4KHPQ 4BWGB 1ONLA 2RDFA 5M5WB 1STGA 2NBFA 1PFNA 1JE5A 3ERSX 3VA7A 1S5FD 3F2CA 3GD7A 2ALYB 1T5XD 1Q1EA 1D1KA 5CMDA 5M5YB 5C0XG 2XGTA 1EIHA 4R4TA 4FXKC 2I07B 3J81j 3MVVA 5KEEA 3S1QB 4LFBL 1KC8C 5K36H 2XRQD 4RMFA 2A6HC 4KHPL 1F9PA 3RZOH 1RKNA 3DXJC 4A3CH 1EYAA 3ER0A 1I4HA 1S72A 2E74C 1A0IA 1V1PA 3I4MB 4YIJA 4A3IB 3SXHA 3PUZA 1O78A 2VUMB 3NP8A 1XWEA 1I50B 5M3MG 2O2LD 1XXGA 4LMQD 4J1MA 4ZKCB 2F3VA 1RTNA 1YBYA 3SR1A 4RAUC 3NPPA 4LFAL 1Z6HA 3EQLC 4APVA 2CVRA 1C48A 2F0IA 3HOWG 1ML0D 4A3BH 2BCOA 4DR5Q 3A8KE 3C3LA 1Z7TA 1K28A 5EBCA 3SK8A 1PXUA 1VQCA 4S3SA 3PO2H 4WJWA 1VCIA 1EY4A 2K5VA 3I4NB 5M3FB 4DV2Q 3M7NA 1SMXA 2JA5G 2DN8A 2JN4A 5EKKA 3K7AB 4ME3A 5GADC 2K5QA 4DR5L 4V0BA 2HCCA 1I4QA 2KA7A 4ME5A 4QUFA 1RCVD 1KD1C 3GTPB 5CYUA 1G8ZD 2PNRC 3G48A 5E4XA 1PH8A 4P75A 2A74C 4ZK9B 1KNAA 3KYHC 4C3JB 3P1HA 4U68A 3GTGB 4DV2L 1I94Q 2IX1A 3EJIA 2Z4HA 3T53B 1GVPA 5EJWA 4FVMA 2WB1E 4DR4Q 3UE0A 4Q0FA 2JA7B 4JW0A 5I2YA 2E2JH 1G2TA 3S1MH 3BYTB 1ZEQX 3FP9A 3NK9A 3S16B 1L1OC 1BXTA 3M7GA 1AP0A 2MO1A 1QZHA 1CQFA 3OMGA 2D5DA 4CDFC 2B2TC 4DXGA 3KUPA 1I94L 1V8QA 3FKIG 1LT5D 3BDLA 4GOPA 4G7OC 2UUBQ 4DR4L 1SFOB 3GTLB 5IT9L 1XNRQ 2C5CA 4V190 2CHBD 5C3EB 1E24A 3LWUA 4IFDI 2ZJRA 2CH4A 3B6YA 3LWEA 4OO1H 2A73B 1NR2A 1YIJA 3T1HL 2JEBI 5I9PA 1PFBA 1YNJD 1D2BA 2ASBA 1FJGQ 1EFID 4A3KB 1EIGA 1C0AA 4DKAC 1Y1WH 2Q8IB 2UUBL 1YHAA 1HZ9A 2IY5B 4GLAC 5JPMC 1D1IA 4C3HG 1XNRL 3PO3G 2F0VA 3T16A 4LUZA 4BBRB 2Z6KC 1SROA 4QIWE 4IUUA 4N9PA 4LF8Q 2GA4B 2K04A 4OEMB 2M9VA 2WKDA 2ZXOA 4BBSG 3MXPA 3IKJA 1QCBD 1V9PA 3VYRA 4RGOS 1PH5A 4JI5Q 3J7AF 1Z9FA 1TWAB 3LGJA 1H95A 1EYCA 1PTOB 1MI2A 2VZAA 1STAA 4EVOA 1JOKA 2LY7A 4LF8L 5KNDA 3DWQA 4QB4A 1JQYD 3DHQA 3E0EA 1RJTA 2YTXA 3URYA 1QOHA 5FLXc 1MSGA 1QG7A 2AQ1B 2DNCA 1M4VA 4JI5L 5AJ3L 4KKSA 1PYWD 1X9NA 2WACA 1W6KA 2I0QA 1NTGA 1SRUA 1H9MA 3JAML 2IHEA 1BOSA 3E9IA 1TS2A 3AEVA 1IYJB 1YZ6A 1STYA 3WOEA 4Y52H 1VQHA 2D0OA 5C4HA 1DD2A 3QIAA 1ZYRC 4E6IA 3CW2C 1RF2D 3NBHA 4LW1A 4TRDA 4HN7A 2NVQH 1D8LA 3I55A 2EXDA 1LTAD 2TMPA 1AE2A 2VXWA 4MIUA 4A75A 1V43A 1EEID 2AHOB 2MO0A 1W6JA 3HOZG 2RCFA 2V4DA 3FVQA 1P16A 3CMEA 3KOJA 2BDOA 1K9MC 1OXTA 1BUVT 1T5EA 3R2TA 4CKCA 3WDNA 1TU2B 3VR4A 4HIKA 2MFIA 1JT8A 2EY5A 1YNND 4FXDA 4A3FH 5I2XA 5KYLA 3K5LA 2RDGA 3OSOA 4GOPC 2R92G 1EYDA 1CKMA 4X66Q 2UUCL 4CDCC 3A7AB 4J15A 2R7DA 5LMNQ 4Y7NH 2XTIA 1GUSA 4IPDA 1TVXA 2RHSB 3CCQA 1PH6A 2VB3X 2JA5H 2B2UC 1KRTA 3PCOB 2NVXB 1YJWA 1I6HH 2A6EC 1FR3A 4C1NI 4ZQ3A 4F8MA 1CZGA 2HUGA 4RCNA 3FPPA 4IPHA 4L8JA 5GQOA 1I3QH 4CDEC 4HJ5A 3ND8A 2KBNA 1C9OA 5LMNL 2F0NA 1CT1D 5FLXE 2KEDA 5M5XB 4A93B 2VL6A 3J81c 5DLQE 1B9NA 1KDBA 1J5EL 4I7AA 4IUVA 4HCEA 4LNQA 4XT1B 3MC0B 3H3VI 2CKZB 3Q6SA 1IZ6A 2Y0SG 2F0QA 3J80i 1SSOA 2GN5A 3MXGA 4WRDA 3CF5A 4X6AH 3FKIH 2AWNA 2NWGA 3FHWA 4A76A 2PCFB 3TP6A 2K5WA 2AUKA 5CBAE 2GVBA 1Q7YC 2J0TD 2B2YA 4K5WA 5JJKA 3K7UC 5IP9H 1A63A 2ES2A 1TWHH 1G91A 3I7FA 3PV0A 2Q8RE 3VYUA 3SHLA 3A5ZB 4O2DA 5AFWA 3S24A 3I91A 3M4YA 1QUQA 1WI5A 1E2ZA 3M4QA 1PRTC 3X3MA 1Y8PB 3TBIB 1M1KC 4N8FA 1R9TB 3OOCA 1A6XA 3RZDB 4JK1C 2MP1A 1B7YB 1IHZA 1VQNA 3CQZB 4C3HH 1J6QA 2A68D 4KKUA 4K6LA 4DR3L 2F0WA 3PO3H 1SAPA 3GTJH 1QVGA 1WFQA 1WOCA 1YNXA 1BCPF 4C2MB 4DR7L 1BDOA 1Q46A 1Q82C 2VQFL 4JBJA 4BBSH 4A3JG 1E1OA 2CH4W 3KLWA 4DNRB 4HIOA 1HHVA 5A2QE 3KK7A 3KBGA 2UXCQ 1YVCA 1EWHA 1NSNS 2A69D 4UPAA 1WCMB 5EGTA 5DM63 2B2WA 1N33Q 1X3QA 1OO9B 2QA4A 1FGBD 3KFUA 3T51B 3S1NB 4H02A 5ELBA 2HDMA 4CJ0B 3CCMA 3CRKC 4C3IB 2K75A 3J7ZC 3W1GA 1STHA 2K05A 2D62A 3I3CA 4RHSA 2UXDQ 1HJPA 4G7ZC 1HFNA 2OCEA 2ZTCA 2N49A 1A3TA 5LMUQ 1J8IA 5JVH3 1VQBA 5EBDA 4POGA 1KL9A 3J81E 1RTOA 4JI6Q 5IYBH 4DV1Q 3G7LA 1PZJD 3E5SA 3M85A 3STBC 2UXDL 5IYDG 4GLXA 1BR9A 4DV7Q 2RF4A 5FJ8G 1BKBA 4A3DB 1DOKA 2JXMB 1EQRA 3ZYYX 1LTID 4RKBA 4DV0Q 1QNUA 3A8IE 1FGUA 3GO5A 2PMZE 3KJOA 3HOZH 4A3BG 4P72A 1WJJA 4FNFA 4KHVA 5C44H 2F0PA 2JK8A 2I5LX 2JQOA 3BU2A 2KCTA 1P8LA 2ZXRA 2N3SA 4DV7L 1X54A 1IW7D 2HD3A 1MHWC 4O1NA 3PO2G 2Z8LA 4CHTB 1EQTA 1XTCD 1HR0W 1SJED 4B08A 1AH9A 4DV5Q 3I4OA 4JCVE 4A3IG 2K5HA 3U4ZA 2EZVA 1EYGA 3TMEA 4H7BA 1F2LA 5JEAJ 2EOTA 3IFDA 2L15A 4KD4A 5CV4A 3RMHA 5GAGC 2KJXA 4RGMA 2R92H 1EY0A 2RA4A 4YWLA 3PUVA 1I4GA 4JPBW 4NP5A 4CBVA 3M4OH 4DV6Q 3TDQA 1O7LA 5JJZA 1NAPA 2B63B 1UEAB 1H9RA 3OW7A 4CJ1B 4DV5L 2BA0A 4L5TA 5CV5A 1AEXA 3PIOA 3UI2A 2F0SA 3S15H 4ABNA 1Y8OB 4K8JA 4Z9CB 1TWFH 1X32A 2Y0SE 4XQNA 2F0FA 5JJLA 1RD9D 4QL5A 4IFDH 4FYDA 2EYHA 4KD3A 5M3FG 2B29A 3I4NG 5EKLA 1QJOA 1GHJA 4JI7Q 4YCUA 2H4OA 1SNPA 2AKWB 4AIMA 1ICFB 4IUQA 2L11A 1SNMA 4C3JG 4IOAA 3AYHB 3UE1A 2E2HB 1PH1A 4JI7L 2PYKA 1XNQQ 4OO1G 2NVTB 1CTMA 3PIP3 1TWGH 1H9KA 4FF3A 4PQXA 1WVLA 2F4VQ 1YNJC 1VQ9A 3TSSA 1L2FA 3BYYB 4KHZA 4KTAA 5KRUA 2JA8B 4RFBA 1E0BA 1WD0A 4NPSA 3ONAB 1SE4A 1OXXK 1S5BD 4AYBB 1B53A 3HKZB 5IGGA 1EY8A 1H9SB 1B3AA 1XNQL 1L0XB 4RH6A 1Y69U 2Z6BA 4KI0A 2G9HD 5T1IA 5TSSA 5EPKA 1HZCA 3NWTA 4UP9A 3H3VC 4MZ9A 2F4VL 4MNOA 4UHVA 2NVYH 1L1OA 2CQAA 5HY6A 1LUZA 2OQKA 5CV7A 4OONA 1WYDA 3KJPA 3D4RA 4DGZA 2B2TA 2E2IH 4ULLA 5JJIA 1STBA 1MJCA 4L5RC 2L55A 4YCVA 1SYEA 2QDBA 3OIQA 3RLOA 3AMUA 2KCCA 4QUCA 3TS2A 2B8GA 3H94A 5JPNC 3HOVB 1GUOA 5CV9A 1JOQA 4B3TQ 4JV5Q 4DK3C 4DUZL 3HOYH 3BDCA 4OIJA 1IL8A 2HHHQ 4AH6A 2KECA 1QE6A 3TZDA 4KK7A 4GN4B 1SLJA 4PZ8A 3EFXD 3HS0C 1S40A 2HQLA 1DZ1A 1CHPD 3BZDB 3CRLC 4UAIA 1TS4A 1RODA 1R4QB 3ULJA 3RN2A 4XTCS 1NMFA 5DNFA 2OTJA 1UE1A 2IL8A 4JBMA 4NB3A 4B3TL 1PA6A 4JV5L 1EWCA 1PYSB 4QCLA 1YI2A 2HHHL 2Z6KA 1B3QA 1STEA 1TWCH 3V05A 1I4PA 5J39A 3PMFA 3GTMB 4OELB 1NMGA 3NHHA 4LWCA 4LFAQ 2DUDA 1SDFA 2RDHA 2WAQB 4IJHA 1G6PA 1TKWB 2XRSD 3LX0A 4DR2Q 2F0GA 2JA9A 2I46A 1JWSD 5IYDH 1WTOA 5FJ8H 1KDAA 5M5WH 4U673 4TQUS 2XVSA 4TVAB 4P2CB 2KENA 2DJFC 3J80L 4OWWB 1D5ZC 2WFWA 1QVCA 4N9TA 5M5YH 3S1RB 5LL6S 4A3FG 4K6DA 1YNNC 4PZ7A 2PPBC 4DR2L 3P7JA 5IGDA 3S1QH 3W5OA 4TKOB 4JI8Q 4KMUC 3HOXB 1VQ8A 4OX9Q 1JJ2A 3OWEB 5F2DA 2ZT9C 4IOCA 1HRJA 5EPLA 2M00A 3CCUA 3CPFA 5JAVA 3TEHB 4EQNA 2F4IA 2F0JA 1VQFA 3I4MH 2IX3A 4A3IH 4B3MQ 1DONA 4DK0A 5BN4A 3DLLA 1VQ5A 4WJ4A 2VUMH 4ID6A 2NTSA 4FO2A 1I50H 1O7ZA 4FF4A 3BZKA 4IPCA 4NDXA 1SNOA 3CPWA 3E9HA 5GAEC 3G6EA 3S2DB 1I4XA 4JI8L 3MA2B 5ELFA 4YHHQ 4OX9L 1A8VA 1K3BC 2ZM6Q 3I73A 3NTHA 1VQ6A 1W2BA 2ICEC 1PTOC 4B3ML 5JOBA 1GUWA 3NSWA 3UDIA 1BVSA 3N52A 2BDNA 1WTQA 4X65Q 4DN4M 2C35B 1GKHA 2JA6B 3I4NH 5M3FH 4LAAA 2E75C 1UWVA 4YHHL 2F52A 5HGQA 2FINB 1F2YA 2KUMA 3G4SA 2HCIA 3K7AH 3T1HQ 3AFQA 4HCSA 4RWSC 4IURA 3OWFA 2ZM6L 2O5IC 1HFGA 1CI3M 5G3LF 3IRBA 1CM9A 3GTPH 2Q2UA 4NKLA 4K0KQ 4DUYL 3AU7A 4X65L 4OXPA 4C3JH 5IP9G 1QZGA 1F2MA 3GTGH 3AB9A 3CAMA 3HZXA 1PZID 1JMCA 1CA5A 3W1BA 2B2UA 1D6EC 4L5SA 1NR4A 4JI3Q 4A93G 1EU4A 5C0XJ 4BY1B 3DUZA 1SYBA 3BDOA 1TXYA 5G3LD 2XSCA 1SMYD 1KIXA 3S16H 4K0KL 1I6VC 2JP1A 3S17B 2D9UA 2UU9Q 1EQVA 5KNCA 2PQEA 1S4ZA 1U4RA 4WORA 1SFOH 3GTLH 4JI3L 3FMCA 4RKLA 1LO5D 2FHTA 1RIPA 4EQOA 3PGZA 5C3EH 4IJLA 1LM0A 1G2SA 1L0YB 2CCZA 5C4XB 2UU9L 2F0UA 5AJ3Q 2MGSA 1X3EA 1EY6A 1HZBA 3MXNB 4A3KH 3HRZC 2LFNA 3SK5A 4HMIA 2VQEQ 1FNWA 1NUCA 3CCRA 1E7ZA 1EIYB 2KOLA 1HNWL 1JICA 1I5FA 1KHIA 5CGKA 3PIPA 1UEBA 4BBRH 3CC7A 4R8IA 5E3FA 4FP5D 1ICWA 4R4QA 4QJFA 4KY7A 4A3LH 2K28A 2O4XA 4DA2A 4PG3A 3E6ZX 2PZWA 4BY7B 3KLRA 2VQEL 3EVQA 5IYBG 5ELOA 5E4WC 3I90A 1LTRD 1VQIA 3QJYA 1PTOH 5IP7G 1IBLQ 3MAQA 1B44D 1KABA 4BA1I 5IODA 3Q0AA 1EL0A 1FNUA 4K8IA 2PW5A 5M3MB 3NXWA 4DU9A 3GTOB 1E2WA 1PH7A 3C2PA 2ATWA 3H6MA 1EY5A 5A35A 2F3IA 1KTKA 1PLFA 4K5VA 5C44G 1E2VA 1NY4A 1WD1A 3HOWB 1IBLL 2UUCQ 1VQJA 1EOVA 1KDCA 2A6HD 1IW7C 1PVOA 4IUTA 1CK1A 1HA6A 2LKVA 1C7YA 2B2VC 1E3PA 3TN2A 2A19A 4HR7B 3L9AX 4PMBA 2F0DA 3HP3A 3EBEA 2L9HA 1CKOA 1JC7A 2CWAA 1OXSC 4R4IA 4F88A 4A3DG 4DAYA 1BBWA 3ND9A 5FLMG 3DMUA 4JI0Q 1I6HB 4LF4L 2VW9A 1NJIC 4KY6A 4OIKA 4N8X1 4HJ8A 2R7FA 3D0FA 3P75A 4MTKA 1IL2A 3U9OA 1EZ8A 3VR3A 2IJ0A 3MHBA 1N32Q 3WWVA 3NTIA 4GS3A 1V1PB 3U50C 3VR6A 4A3MB 1J5EQ 2DJGC 3I4LA 3V96A 1B9MA 1DYQA 4I65A 4JI0L 4IFDG 3KLSA 3K0YA 1CKNA 3A8JE 2CW0C 1CSQA 1DXMA 3I72A 2ZJPA 5C3WA 1IYVA 1X3GA 1HPCA 2QILA 3ZJYC 3PQIA 1DJRD 3DM3A 1KLUD 1LTSD 5ELCA 3J81i 1N32L 2R93B 1AN8A 1BQQT 1VQEA 3HOUB 1HUMA 4L5QA 1IBMQ 3K0XA 1D5MC 3KF8A 5EKIA 2RCNA 1Q90A 2B63G 4DV4L 1K83B 1ESFA 4EQ5A 2HIXA 4LUVA 5D14A 1CUKA 2NVXH 5IGFA 1O7IA 2ENBA 1HTLD 2D0PA 2IW3A 1E22A 2JSOA 2K33A 1PH4A 3H91A 3OMCA 1KAAA 2B8FA 3OIPA 1IBML 4DR3Q 3TP8A 4HSPA 4NMZA 5HURA 2FMMA 2AWOA 3IL8A 4MHEA 4ODGA 1N36Q 4JOIC 4DR7Q 4MN3A 5M5XH 4A93H 2OF1A 4YY3Q 4LUOA 3Q24A 2EYLA 2VQFQ 1Y8NB 2OWOA 3KF6A 3D3RA 2KHSA 2RKSA 1EU3A 2BA1A 4KN7C 1UAPA 2RVLA 3J7AV 3G6JB 3IFTA 1SNDA 5EQ0A 3M9BA 3RR5A 1N36L 4JYAQ 4DAVA 1HCZA 3VDYA 4YY3L 2JA8G 3W3AA 4YWMA 1U9RA 1K8OA 1B50A 4KLKA 4FF2A 3HOYG 2A1AA 1SE2A 3BS1A 1Q86C 2QEJC 2YU9B 3P20A 5IGCA 2PZTA 1ENFA 1HXYD 4GKJQ 1R9TH 1LTBD 4A3GB 3RZDH 2EJGC 5D3IB 4JYAL 5C4JB 1SE3A 1BCPD 1Q8IA 2DY7A 1WTRA 3CQZH 3EN2A 2IWHA 2M2LA 2EYOA 3M3YB 3ITPA 2WIIB 1WTPA 1QB5D 1DCZA 3VR5A 3CC4A 4C2MH 3GTQB 1XTDA 1VQLA 4GKJL 2XWBB 4HSVA 2QF7A 2MNAA 3OPOA 1K0SA 4GNXC 2A8VA 2AQ3B 1EOTA 1LT3D 3F2DA 1STNA 1Y1VB 2GVAA 5IP7H 3G71A 2XWJB 4IPGA 1J9OA 2AUJD 1X55A 2JE6I 3K6OA 1GJXA 3S1NH 5KYIA 1HA5A 1YHBA 1V1OA 4K2KA 3D8GA 1EWIA 5IT9c 3RLFA 4R1JA 4H44C 1Z47A 4QF4A 3DEPA 4C3IH 1B4OA 5KNBA 4DF7A 2MPMA 4HIMA 1NCVA 3S14B 1M8AA 4A3EB 4IZ8A 1VQDA 1AFPA 4PMWA 3H09A 2R7ZB 2UUAQ 1ZYRD 3FDTA 1SNCA 4G7HC 1ESRA 1Q1BA 2VNUD 1A2TA 4M8AA 2WAQG 4RCOA 3I4MG 2WKCA 2QGQA 1MBYA 2LMCB 2VUMG 3H0GB 4J6HA 1MJEA 4A3DH 3A55A 5FLMH 1GUTA 2L12A 3K59A 3GP7A 5C0XI 5C5LA 3S15B 4L63B 2UUAL 1PDQA 1TWFB 1LTTD 2FFKB 3NBHB 3Q22A 3ULPA 3L3OC 5CV6A 3GTKB 4POFA 2QEXA 2I5MX 5C4ZA 1XMQQ 2KCNA 3S2HB 4CKBA 1PMRA 2EJMA 1TR5A 2H5XA 1F9QA 3R8BA 1EFWA 1UE7A 3HOXG 1JWMD 1RDPD 4ILWA 3HKSA 1IBKL 2D2CC 3A54A 3CP0A 4AQYQ 4GNXB 3BZCA 1ENCA 3MFGA 4RGNA 4EQPA 1UE5A 5BR8Q 3HEJA 1XMQL 4QMGA 2A6ED 5FLXL 5FO8B 4RA8A 1AZPA 4OL7A 3RUZA 1SYGA 2Z0SA 4HJ7A 4FDBA 3EROA 2B63H 1SYCA 2K5DA 2K52A 1LYLA 4AQYL 1VQ4A 2J7ZA 2BE5D 4ZLTF 4WJ3M 2HIVA 5IGEA 3GV3A 5J1ZA 5BR8L 1VQAA 2NYZD 2JA7G 1S5DD 5C5MA 4GZYC 4CDDC 1FL0A 1VQPA 2JA6G 1A2UA 3FPUB 1D7QA 3UDXA 2G5DA 4LF9Q 1TY0A 3NEMA 5IYCG 5IT9E 1VMCA 2YYZA 1YJ9A 3OTOQ 1C8CA 1PRTF 3T1YQ 4JI1Q 1TS5A 2EIFA 4QQBX 3CXCA 3NQIA 1JORA 3L2PA 1LT4D 5L37A 4GKKQ 1EY7A 2CWPA 3KBXA 5C3EG 1HQRD 2G9DA 4GN3B 4K5XA 3SE0A 5COYA 2E2HH 4YCWA 2WINB 4LF9L 3HFZB 2NVTH 2F0LA 4A3JB 3OTOL 2L4NA 4ZAIA 3TP7A 4BY1G 2YTYA 1PRTD 4A3KG 1VQKA 1ILPA 3T13A 3T1YL 4JI1L 3SK4A 4DV3Q 2JA8H 1Q12A 4GKKL 2F3WA 1EEFD 1GUGA 1Y14B 1VF5C 4DAPA 4KJOA 5A2QL 4L6TB 3RLNA 5IWAQ 5CC4A 4O0AA 4HIDA 4BBRG 2RSOA 4ALPA 1KXLA 3MXUA 1QUQB 1N9WA 5FO7B 4A3LG 1T9HA 4Q5VA 4DV3L 2SEBD 5E1FA 1BBUA 2HDLA 3L7ZC 4X64Q 5C4XG 3RZOB 1BF4A 1FYCA 2NTTA 2F0EA 3BVGA 1VQGA 4X62Q 5IWAL 1AE3A 2SNSA 3TS0A 4XYOA 1EQQA 1NE3A 2Q8TA 2ZXPA 1VDZA 4XQJA 2BOSA 2JEAI 4IUNA 3TRZA 2F0TA 1LLRD 1XJVA 3J81L 3L0OA 4WFN3 1S5CD 2TSSA 3RNUA 1O7YA 5D3DA 4R4CA 3JAME 1RL2A 1HR0Q 4X64L 2WAQE 4ZKBB 5BN5A 2HT1A 4X62L 4A3BB 1X3PA 2EYMA 3R93A 2SNMA 3I56A 4BY7G 2MQHA 4RHRA 4H13C 5J22A 4DR6L 1K8MA 3KDFB 3QR8A 3BVMA 3PO2B 2WV6D 4NW2A 3N6RA 4BA2I 4P74A 1HH2P 3STBD 3A0JA 3SEBA 1HR0L 1YHQA 5FK9C 2EYJA 3VA5A 2PO4A 2LXJA 1M90C 3GDEA 3GTMH 5DAUA 1HQMC 2EDGA 2XNAC 4OWTB 4JC0A 1F77A 2K50A 3H15A 2FMCA 3K80C 3PSIA 4IFDJ 4FF1A 4H0LC 1GM5A 2R3ZA 1EUJA 1SEBD 4KV6A 1ZKOA 3RN5A 1MIUA 5CV8A 3MWYW 5EAYA 1MGSA 1U0LA 2QKIC 3Q23A 3H3VH 4QY7A 3K8AA 5JVG3 3VYSA 3S1RH 1R4PB 2YTVA 3U4VA 2E2JB 3S1MB 3ULLA 4EGVA 1U4PA 3U9SA 4HEDA 4B9WA 2CQOA 1L0WA 2KVMA 3WOFA 4IN3A 4DUYQ 4HJAA 3HOXH 2X6LA 4OWXB 2NB0A 5I4DA 1K73C 4LF5Q 1U5KA 2B2VA 3CD6A 3NE5B 5I6WA 2RQXA 1FVIA 1OXUA 1PFMA 2EY6A 4A3MG 2WB1B 1XPOA 3R3OA 5T1GA 3CMAA 3S2DH 2X6GA 1VS0A 1TIID 2OXPA 3JC66 2PQAB 5C6AA 1VQOA 5LMNW 1WTWA 4LF5L 1Y1WB 1MKHA 1F2ZA 5DEHA 4BS9A 5IOCA 1AW7A 2R93G 1KQSA 2F0HA 5BN3A 2F03A 2JA7H 3HOUG 1JJGA 2ID0A 4DR1Q 2JA6H 2SDFA 1YITA 3T56B 3ERQA 5IYCH 3I2ZA 4C1NK 2O5JC 2K5NA 1U4MA 4IUPA 3GQBA 2A68C 2KCMA 1ASZA 2F1MA 1Q3LA 4LK1C 1SN8A 3PUYA 3X3NA 5GROA 1CSPA 1GUNA 3TZUA 1HNWQ 4DR1L 4X3UA 4ZCKA 2IT1A 1LACA 1W3SA 1WTXA 2VS1A 2NUCA 5FOBB 3QWNA 2A69C 2WP8J 4QIWB 4BY1H 3A74A 1G291 2E76C 2KHIA 4ZUJA 1VQMA 2MHVA 4J8QA 4C56C 2E8GA 3MEHA 3S17H 1FJGL 1BCPC 1ET9A 4YWKA 2Q2IA 2NZOA 1EZ6A 3QOLA 2QDLA 4IO9A 1VQ7A 3W2DA 2OTLA 4JOIA 2EPBA 5KIXA 5H1SE 4KJNA 1KAWA 2N78A 4UY8C 3QB3A 3M4PA 3TQYA 1SNQA 3UDFA 3VR2A 3CHBD 3CU7A 2H1EA 4G57A 3F1ZA 2NVQB 4MTNA 4KKTA 3ICEA 5C4XH 1WCMG 4UP8A 1YEZA 1L1OB 1TWAH 4NXMQ 2PW7A 5E7NA 1N34Q 1QILA 2NN6I 4K2LA 3O13A 4A3GG 2VY3A 4LJZC 2K4KA 2UXBQ 4R4OA 3A7LA 3E3XA 4C3IG 2DY8A 5I6YA 5FO9B 3DEOA 4X3SA 1D5XC 2Q2HA 1LTLA 2X69A 2EE1A 1OXVA 2EJFC 4ZRZA 5C0XH 5LL6X 4RG1A 4LF4Q 4NXML 4A3FB 1N34L 2PI2A 4JG2A 1PV4A 2UXBL 3PIO3 4BY7H 1G51A 1VMPA 3K5NA 1PHJA 1Y1VG 3A5UA 2K14A 4Y7NB 2KHJA 2KQ3A 2RSNA 3NQTA 1SR3A 2PZUA 2JA5B 2EYFA 1BO0A 5ELNA 5M3MH 2FXQA 2IPKD 3GTOH 3D31A 1QVFA 1YJNA 1BCPB 4GNXA 1IKLA 1I3QB 5IIFA 4A3EG 1JJCB 1LABA 1F9RA 4R9WA 1MSHA 1X6OA 1CFMA 1KLGD 5CORA 2ZTDA 4B9XA 3HOWH 2R7ZG 1ILQA 3PUWA 1B1ZA 3PUXA 3I70A 1CQVA 4DV4Q 4PNYA 4JBKA 1PTOF 5EPJA 4F87A 5ISRA 3C1FA 1DOLA 3H0GG 1HUNA 4DNIA 4F7XA 4DNTB 2EY2A 1F9SA 4LFCQ 3UDGA 3CCLA 3IAYA 3NENA 3FKIB 1SYDA 2OT2A 4DFAA 2RHQB 4X66L 4IALA 5HGTA 1ASYA 4BXXG 1PTOD 5NUCA 1H9SA 1MD2D 1TWHB 1VF7A 4A3MH 2BE5C 5GAHC 2BH8A 3PF4A 1Q8KA 1SBBB 4LFCL 4XQQA 3MFYA 3OHXC 2SOBA 3C46A 2IX0A 1PH2A 4C3HB 2CFMA 2ZJQA 2R93H 2K01A 1UE6A 2C9OA 3PO3B 1GD7A 3HOUH 4JI4Q 2LSSA 3FRPB 2ICIA 4GLVB 3GTJB 4QGUA 2EY1A 1UNSA 5IE8A 3OW2A 3J80c 2XIWA 1N8RC 3HG9A 1K83H 5IGBA 1X3FA 3KLSX 3EIVA 1XPUA 1HTPA 4NXNQ 4BBSB 5JEAG 4KN4C 3R2IA 3QO2A 2DNEA 4DK6C 3NBIA 2QCPX 5D65A 1KNEA 3RD4A 4JI4L 4GOPB 2N88A 1OTCA 1SXTA 4CKEA 1IYUA 2DGYA 3E0JA 1K3RA 1NBWA 4EX5A 2NN6G 2NZ1D 4AYBG 3C1EA 3HKZG 1HZAA 4NXNL 2MUYA 3K58A 2N55A 1JR0D 2K7VA 3LNNA 4ZUIA 1K8GA 2XN9C 4RGTA 5FKAC 4OO1I 2LXKA 2EQSA 5IY0A 4DUZQ 4LF6Q 4B3RQ 4PMCA 2F0MA 1DM0B 2IHFA 3I8ZA 5DM73 3A56A 5I9OA 2Q2TA 1SJHD 2L1BA 1HNXQ 4JVZA 1IXRA 1LV9A 2JJQA 3HOVG 1FNVA 1A3VA 1JCKB 2E2DC 1WTVA 1B2TA 1ENAA 2PNHA 2L0CA 3KDFA 3CCEA 1S3OA 2F0KA 4B3RL 1WCMH
chains in the Genus database with same CATH topology
2LS01 2FJ2A 2K32A 1XYIA 4DK1A 3HOZB 5C44B 1JB3A 5LHY1 2AQ2B 4I7ZC 5K36G 4G4KA 5K5PA 2R6GA 3S9WA 3BVZA 4X3TA 1C4QA 1BBXC 4IQZA 1TT2A 1G6ZA 1QNKA 4JBWA 4DXFA 4XXEA 3MZ5A 4FXGC 4HMJA 2F0OA 1PRTB 2R92B 5ELDA 1GOZA 3J80E 3M4OB 3EA6A 1ET6A 2PMZB 3SDZA 2OEOA 4OGQC 1JE4A 2A5HA 3NUCA 2K03A 4KY5A 1ZXTA 2MJ8A 1GHKA 1PZKD 3SVMA 3TP5A 5KGUA 4CJ2C 4HAEA 1XX8A 3K5MA 1CHQD 3QOJA 2JYOA 3MTSA 1II3A 3BG3A 3V2TA 1O80A 3HGBA 4OHJA 3T4AC 1LTGD 2Z4IA 3F2UA 5CBEE 1UUPA 1U4LA 1IKMA 2B2YC 1A3UA 3D4DA 3DM1A 3SK6A 5CR3A 1I4RA 4XIGS 3D4WA 1DOMA 3CKIB 3D6CA 2Y0SB 3DWAA 1TWGB 1CZWA 1TY2A 2KEEA 1SYFA 1JOOA 4O42A 2CW0D 1CA6A 3NWSA 4TSSA 4M1UB 2L5TA 3DWPA 4XDXA 3K57A 5ELEA 2R61A 1SMYC 2Z1CA 1EY9A 1BNZA 1GXDC 2EYPA 2RBMA 1TS3A 2NVYB 2B2WC 3VYTA 2K1BA 3MXNA 5M9OA 1RHPA 2E2IB 1JWUD 1QWYA 4UDUC 2K6AA 5JEAH 1S5ED 4ZYSA 3HOYB 4XT3B 2J4XA 3K5OA 2HQEA 1AZQA 4HTHA 1FD7D 2NN6H 4X3KA 1TQOA 3J7YW 3FEWX 4PV1C 3QG1A 1LT6D 4K14A 1TWCB 2B39A 4R8NA 2EVBA 2VB2X 1H9JA 3D6WA 4CGYB 2EXZA 3GV6A 3NTKA 1A15A 5C3XA 4XYQA 4BWGB 1ONLA 2RDFA 5M5WB 1STGA 2NBFA 1PFNA 3VA7A 1S5FD 3GD7A 1T5XD 1Q1EA 1D1KA 5CMDA 5M5YB 5C0XG 1EIHA 4FXKC 2I07B 3MVVA 5KEEA 3S1QB 5K36H 2XRQD 2A6HC 1F9PA 1RKNA 3DXJC 1EYAA 1I4HA 2E74C 1V1PA 3I4MB 4YIJA 4A3IB 3SXHA 3PUZA 1O78A 2VUMB 3NP8A 1XWEA 1I50B 2O2LD 1XXGA 4LMQD 4J1MA 4ZKCB 2F3VA 1RTNA 3SR1A 4RAUC 3NPPA 1Z6HA 3EQLC 2CVRA 1C48A 2F0IA 1ML0D 2BCOA 3A8KE 3C3LA 1Z7TA 5EBCA 3SK8A 1PXUA 4S3SA 4WJWA 1VCIA 1EY4A 3I4NB 5M3FB 3M7NA 2DN8A 5EKKA 3K7AB 2K5QA 4V0BA 2HCCA 1I4QA 2KA7A 4ME5A 4QUFA 1RCVD 3GTPB 5CYUA 1G8ZD 2PNRC 5E4XA 2A74C 4ZK9B 1KNAA 4C3JB 3P1HA 4U68A 3GTGB 2IX1A 3EJIA 2Z4HA 3T53B 5EJWA 4FVMA 4Q0FA 2JA7B 5I2YA 1G2TA 3BYTB 1ZEQX 3NK9A 3S16B 1BXTA 3M7GA 1AP0A 1CQFA 3OMGA 2D5DA 2B2TC 4DXGA 3KUPA 1V8QA 1LT5D 3BDLA 4G7OC 1SFOB 3GTLB 5IT9L 2C5CA 4V190 2CHBD 5C3EB 3LWUA 4IFDI 3LWEA 4OO1H 2A73B 1NR2A 2JEBI 5I9PA 1PFBA 1YNJD 1D2BA 1EFID 4A3KB 1EIGA 2Q8IB 5JPMC 1D1IA 4C3HG 2F0VA 3T16A 4BBRB 4IUUA 4N9PA 2GA4B 2K04A 2M9VA 2WKDA 2ZXOA 3MXPA 3IKJA 1QCBD 3VYRA 4RGOS 3J7AF 1TWAB 1EYCA 1PTOB 1MI2A 1STAA 4EVOA 1JOKA 2LY7A 5KNDA 3DWQA 4QB4A 1JQYD 3DHQA 1RJTA 3URYA 1QOHA 1MSGA 1QG7A 2AQ1B 2DNCA 1M4VA 4KKSA 1PYWD 2WACA 1W6KA 1H9MA 3JAML 1BOSA 1TS2A 1STYA 3WOEA 5C4HA 1DD2A 3QIAA 1ZYRC 4E6IA 1RF2D 3NBHA 4TRDA 4HN7A 1LTAD 2TMPA 2VXWA 4MIUA 1V43A 1EEID 1W6JA 2V4DA 3FVQA 2BDOA 1OXTA 1BUVT 1T5EA 3R2TA 4CKCA 3WDNA 1TU2B 3VR4A 2EY5A 1YNND 4FXDA 5I2XA 5KYLA 3K5LA 2RDGA 3OSOA 1EYDA 3A7AB 1GUSA 1TVXA 2VB3X 2B2UC 2NVXB 2A6EC 1FR3A 4C1NI 4ZQ3A 4F8MA 1CZGA 2HUGA 4RCNA 3FPPA 4L8JA 3ND8A 2F0NA 1CT1D 5FLXE 2KEDA 5M5XB 4A93B 1B9NA 1KDBA 4IUVA 4HCEA 4XT1B 3MC0B 3Q6SA 2F0QA 1SSOA 4WRDA 3MXGA 2AWNA 2NWGA 2PCFB 3TP6A 2K5WA 2AUKA 5CBAE 2J0TD 2B2YA 4K5WA 1G91A 3PV0A 2Q8RE 3VYUA 3SHLA 5AFWA 3I91A 3M4YA 1E2ZA 3X3MA 1PRTC 1Y8PB 3TBIB 1R9TB 3OOCA 1A6XA 3RZDB 4JK1C 2MP1A 1IHZA 3CQZB 2A68D 4KKUA 4K6LA 2F0WA 1SAPA 1BCPF 4C2MB 1BDOA 4DNRB 1HHVA 5A2QE 3KK7A 3KBGA 1EWHA 1NSNS 2A69D 1WCMB 5EGTA 5DM63 2B2WA 1X3QA 1OO9B 1FGBD 3T51B 3S1NB 5ELBA 2HDMA 4CJ0B 3CRKC 4C3IB 1STHA 2K05A 2D62A 3I3CA 4RHSA 4G7ZC 1HFNA 1A3TA 1J8IA 5JVH3 5EBDA 3J81E 1RTOA 3G7LA 1PZJD 3E5SA 3M85A 1BR9A 4A3DB 1DOKA 2JXMB 3ZYYX 1LTID 4RKBA 1QNUA 3A8IE 3GO5A 4FNFA 4KHVA 2F0PA 2ZXRA 1IW7D 4O1NA 2Z8LA 4CHTB 1EQTA 1XTCD 1SJED 4B08A 2EZVA 3TMEA 4H7BA 1F2LA 5JEAJ 2EOTA 3IFDA 4KD4A 5CV4A 3RMHA 2KJXA 4RGMA 1EY0A 2RA4A 3PUVA 1I4GA 4CBVA 4NP5A 3TDQA 1O7LA 5JJZA 1NAPA 2B63B 1UEAB 1H9RA 3OW7A 4CJ1B 2BA0A 5CV5A 1AEXA 3UI2A 2F0SA 4ABNA 1Y8OB 4K8JA 4Z9CB 1X32A 4XQNA 2F0FA 1RD9D 4IFDH 4FYDA 2EYHA 4KD3A 5EKLA 1QJOA 1GHJA 2H4OA 1SNPA 4IUQA 2L11A 1SNMA 4C3JG 2E2HB 2PYKA 2NVTB 4OO1G 1CTMA 3PIP3 1H9KA 4FF3A 4PQXA 1WVLA 1YNJC 3TSSA 3BYYB 4KHZA 4KTAA 5KRUA 2JA8B 4RFBA 1E0BA 1WD0A 3ONAB 1SE4A 1OXXK 1S5BD 4AYBB 1B53A 3HKZB 5IGGA 1EY8A 1H9SB 1B3AA 1L0XB 4RH6A 1Y69U 4KI0A 2G9HD 5T1IA 5TSSA 5EPKA 3NWTA 3H3VC 2CQAA 5CV7A 3D4RA 4DGZA 2B2TA 4ULLA 1STBA 2L55A 1SYEA 2QDBA 3OIQA 3AMUA 2KCCA 4QUCA 2B8GA 3H94A 5JPNC 3HOVB 1GUOA 5CV9A 1JOQA 3BDCA 4OIJA 1IL8A 2KECA 1QE6A 3TZDA 4KK7A 3EFXD 3HS0C 1DZ1A 1CHPD 3BZDB 3CRLC 4UAIA 1TS4A 1RODA 1R4QB 4XTCS 5DNFA 2IL8A 1EWCA 4QCLA 1STEA 3V05A 1I4PA 5J39A 3PMFA 3GTMB 3NHHA 1SDFA 2RDHA 2WAQB 1TKWB 2XRSD 3LX0A 2F0GA 2I46A 1JWSD 1WTOA 1KDAA 4U673 4TQUS 2XVSA 4P2CB 3J80L 1D5ZC 4N9TA 3S1RB 5LL6S 4K6DA 1YNNC 2PPBC 3P7JA 5IGDA 4TKOB 4KMUC 3HOXB 3OWEB 5F2DA 2ZT9C 1HRJA 5EPLA 2M00A 5JAVA 4EQNA 2F4IA 2F0JA 2IX3A 1DONA 4DK0A 5BN4A 4ID6A 2NTSA 4FO2A 1O7ZA 4FF4A 4NDXA 1SNOA 3S2DB 1I4XA 3MA2B 5ELFA 3I73A 3NTHA 2ICEC 1PTOC 5JOBA 1GUWA 3NSWA 3N52A 2BDNA 1WTQA 4DN4M 2JA6B 4LAAA 2E75C 2FINB 1F2YA 2KUMA 2HCIA 4HCSA 4RWSC 4IURA 3OWFA 2O5IC 1HFGA 1CI3M 5G3LF 1CM9A 4NKLA 3AU7A 1F2MA 3AB9A 3HZXA 1PZID 1CA5A 2B2UA 1D6EC 1NR4A 1EU4A 5C0XJ 4BY1B 3DUZA 1SYBA 3BDOA 5G3LD 2XSCA 1SMYD 1I6VC 2JP1A 3S17B 2D9UA 1EQVA 5KNCA 2PQEA 1S4ZA 1U4RA 4WORA 3FMCA 4RKLA 1LO5D 2FHTA 4EQOA 1G2SA 1L0YB 5C4XB 2F0UA 2MGSA 1EY6A 3HRZC 2LFNA 3SK5A 4HMIA 1FNWA 1NUCA 2KOLA 1JICA 5CGKA 4R8IA 5E3FA 4FP5D 1ICWA 4KY7A 2K28A 2O4XA 4DA2A 3E6ZX 2PZWA 4BY7B 3KLRA 3EVQA 5E4WC 3I90A 1LTRD 3QJYA 1PTOH 3MAQA 1B44D 1KABA 4BA1I 5IODA 3Q0AA 1EL0A 1FNUA 4K8IA 2PW5A 5M3MB 3NXWA 4DU9A 3GTOB 1E2WA 3C2PA 3H6MA 1EY5A 5A35A 1KTKA 1PLFA 4K5VA 1E2VA 1WD1A 3HOWB 1KDCA 2A6HD 1IW7C 4IUTA 1CK1A 1HA6A 2LKVA 2B2VC 3TN2A 4HR7B 3L9AX 4PMBA 2F0DA 3HP3A 2L9HA 1JC7A 1OXSC 4F88A 4DAYA 3ND9A 3DMUA 1I6HB 4KY6A 4OIKA 3P75A 3U9OA 1EZ8A 3VR3A 2IJ0A 3MHBA 3NTIA 1V1PB 3VR6A 4A3MB 3I4LA 3V96A 1B9MA 1DYQA 4I65A 4IFDG 3KLSA 3K0YA 3A8JE 2CW0C 1DXMA 3I72A 5C3WA 1IYVA 1HPCA 2QILA 1DJRD 2R93B 1KLUD 1LTSD 5ELCA 1AN8A 1BQQT 3HOUB 1HUMA 1D5MC 3KF8A 5EKIA 1Q90A 1K83B 1ESFA 5D14A 5IGFA 2ENBA 1HTLD 2IW3A 2JSOA 2K33A 3H91A 3OMCA 1KAAA 2B8FA 3OIPA 3TP8A 4HSPA 4NMZA 5HURA 2FMMA 2AWOA 3IL8A 4MHEA 4ODGA 4MN3A 2OF1A 3Q24A 2EYLA 1Y8NB 3D3RA 2KHSA 2RKSA 1EU3A 2BA1A 4KN7C 1UAPA 2RVLA 3J7AV 3G6JB 3IFTA 1SNDA 5EQ0A 4DAVA 1HCZA 3W3AA 1U9RA 1K8OA 1B50A 4FF2A 1SE2A 3BS1A 2QEJC 2YU9B 3P20A 5IGCA 2PZTA 1ENFA 1HXYD 1LTBD 4A3GB 2EJGC 5D3IB 5C4JB 1SE3A 1BCPD 1Q8IA 2DY7A 1WTRA 2IWHA 2M2LA 2EYOA 3M3YB 3ITPA 2WIIB 1WTPA 1QB5D 1DCZA 3VR5A 3GTQB 2XWBB 4HSVA 2QF7A 3OPOA 2AQ3B 1EOTA 1LT3D 1STNA 1Y1VB 2XWJB 1J9OA 2AUJD 2JE6I 3K6OA 1GJXA 5KYIA 1HA5A 1V1OA 4K2KA 3D8GA 3RLFA 4H44C 1Z47A 4QF4A 3DEPA 1B4OA 5KNBA 4DF7A 2MPMA 1NCVA 3S14B 1M8AA 4A3EB 4IZ8A 1AFPA 4PMWA 3H09A 2R7ZB 1ZYRD 3FDTA 1SNCA 4G7HC 1ESRA 1Q1BA 2VNUD 1A2TA 4M8AA 4RCOA 2WKCA 1MBYA 2LMCB 3H0GB 4J6HA 3A55A 1GUTA 2L12A 3K59A 3GP7A 5C0XI 5C5LA 3S15B 4L63B 1PDQA 1TWFB 1LTTD 2FFKB 3Q22A 3L3OC 5CV6A 3GTKB 5C4ZA 2KCNA 3S2HB 4CKBA 1PMRA 2EJMA 1TR5A 1F9QA 3R8BA 1JWMD 1RDPD 4ILWA 2D2CC 3A54A 3MFGA 1ENCA 4RGNA 4EQPA 3HEJA 4QMGA 2A6ED 5FLXL 5FO8B 4RA8A 1AZPA 4OL7A 3RUZA 1SYGA 3EROA 1SYCA 2K5DA 2J7ZA 2BE5D 4ZLTF 5IGEA 3GV3A 5J1ZA 2NYZD 1S5DD 5C5MA 4GZYC 1A2UA 3FPUB 1TY0A 5IT9E 1VMCA 2YYZA 1C8CA 1PRTF 1TS5A 3NQIA 1JORA 1LT4D 1EY7A 3KBXA 1HQRD 2G9DA 4K5XA 3SE0A 5COYA 2WINB 2F0LA 4A3JB 2L4NA 4ZAIA 3TP7A 1PRTD 1ILPA 3T13A 3SK4A 1Q12A 2F3WA 1EEFD 1GUGA 1VF5C 4DAPA 4KJOA 5A2QL 4L6TB 5CC4A 2RSOA 3MXUA 5FO7B 4Q5VA 2SEBD 5E1FA 2HDLA 3L7ZC 3RZOB 1BF4A 1FYCA 2NTTA 2F0EA 3BVGA 2SNSA 4XYOA 2Q8TA 2ZXPA 1VDZA 4XQJA 2BOSA 2JEAI 4IUNA 2F0TA 1LLRD 3J81L 4WFN3 1S5CD 2TSSA 1O7YA 5D3DA 3JAME 4ZKBB 5BN5A 4A3BB 1X3PA 2EYMA 3R93A 2SNMA 4RHRA 4H13C 5J22A 1K8MA 3BVMA 3PO2B 2WV6D 4NW2A 3N6RA 4BA2I 3SEBA 5FK9C 2EYJA 3VA5A 2PO4A 5DAUA 1HQMC 2EDGA 2XNAC 1F77A 2FMCA 4FF1A 4H0LC 2R3ZA 1SEBD 4KV6A 1ZKOA 5CV8A 3MWYW 1MGSA 2QKIC 3Q23A 5JVG3 3VYSA 1R4PB 2E2JB 3S1MB 4EGVA 1U4PA 3U9SA 4HEDA 4B9WA 2KVMA 3WOFA 4IN3A 2X6LA 2NB0A 5I4DA 2B2VA 3NE5B 5I6WA 2RQXA 1OXUA 1PFMA 2EY6A 2WB1B 3R3OA 5T1GA 2X6GA 1TIID 2OXPA 5C6AA 1WTWA 1Y1WB 1F2ZA 5DEHA 4BS9A 5IOCA 1AW7A 2F0HA 5BN3A 2F03A 2ID0A 2SDFA 3T56B 3ERQA 4C1NK 2O5JC 1U4MA 4IUPA 3GQBA 2A68C 2F1MA 1Q3LA 4LK1C 3PUYA 3X3NA 1GUNA 3TZUA 4X3UA 2IT1A 1LACA 1WTXA 2NUCA 5FOBB 3QWNA 2A69C 2WP8J 4QIWB 1G291 2E76C 4ZUJA 2MHVA 4J8QA 4C56C 3MEHA 1BCPC 1ET9A 1EZ6A 3QOLA 3W2DA 2EPBA 5KIXA 4KJNA 3QB3A 1SNQA 3VR2A 3CHBD 3CU7A 2H1EA 4G57A 2NVQB 4KKTA 2PW7A 1QILA 2NN6I 4K2LA 3O13A 4LJZC 3A7LA 4C3IG 2DY8A 5I6YA 5FO9B 3DEOA 4X3SA 1D5XC 2X69A 2EE1A 1OXVA 2EJFC 4ZRZA 5C0XH 5LL6X 4A3FB 3PIO3 1VMPA 3K5NA 4Y7NB 2KQ3A 2RSNA 3NQTA 2PZUA 2JA5B 2EYFA 1BO0A 2IPKD 3D31A 1BCPB 1IKLA 1I3QB 5IIFA 1LABA 1F9RA 4R9WA 1MSHA 1CFMA 1KLGD 5CORA 4B9XA 1ILQA 3PUWA 1B1ZA 3PUXA 3I70A 1CQVA 4PNYA 1PTOF 5EPJA 4F87A 5ISRA 3C1FA 1DOLA 1HUNA 4F7XA 4DNTB 2EY2A 1F9SA 3IAYA 3FKIB 1SYDA 2OT2A 4DFAA 4IALA 5HGTA 1PTOD 5NUCA 1H9SA 1MD2D 1TWHB 1VF7A 2BE5C 1SBBB 4XQQA 3MFYA 3OHXC 2SOBA 3C46A 2IX0A 4C3HB 2K01A 2C9OA 3PO3B 3FRPB 2ICIA 3GTJB 2EY1A 1UNSA 2XIWA 3HG9A 5IGBA 3KLSX 1HTPA 4BBSB 5JEAG 4KN4C 3R2IA 3QO2A 2DNEA 3NBIA 2QCPX 5D65A 1KNEA 3RD4A 2N88A 1SXTA 4CKEA 1IYUA 3E0JA 2NN6G 2NZ1D 3C1EA 2MUYA 3K58A 2N55A 1JR0D 2K7VA 3LNNA 4ZUIA 2XN9C 4RGTA 5FKAC 4OO1I 4PMCA 2F0MA 1DM0B 3I8ZA 5DM73 3A56A 5I9OA 1SJHD 2L1BA 1LV9A 1FNVA 1A3VA 1JCKB 2E2DC 1WTVA 1B2TA 1ENAA 2L0CA 4IFDJ 2F0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZ6 A;  4NMZ A;  5CV8 A;  5HUR A;  5IOD A;  1F2Y A;  1EYA A;  3QOL A;  2F0L A;  2PW5 A;  1SNC A;  2EY5 A;  4K8I A;  4ODG A;  3TP7 A;  1SYD A;  3NXW A;  3OWF A;  4YIJ A;  3SXH A;  4DFA A;  1A2T A;  5CV5 A;  4DU9 A;  5KIX A;  1EY9 A;  5KYL A;  1AEX A;  4KJN A;  3NP8 A;  2EYP A;  2F0S A;  2OF1 A;  3H6M A;  3OSO A;  1EY5 A;  4IAL A;  3SK4 A;  2EYL A;  3T13 A;  2RBM A;  3QB3 A;  4K8J A;  4NKL A;  5HGT A;  1EYD A;  1NSN S;  1SNQ A;  4J1M A;  5NUC A;  2F0F A;  5EGT A;  2F0V A;  4B9W A;  3T16 A;  2F3V A;  4G57 A;  5K5P A;  2EYH A;  4K5V A;  4KD3 A;  2F3W A;  4J6H A;  3S9W A;  5EKL A;  3SR1 A;  2KHS A;  4KJO A;  5M9O A;  2RKS A;  1F2M A;  4N9P A;  5CC4 A;  3HZX A;  5C5L A;  5J39 A;  1KDC A;  1TT2 A;  3PMF A;  2PW7 A;  2F0I A;  2SOB A;  3NHH A;  4K2L A;  1SND A;  1SNP A;  2LKV A;  5CV6 A;  3MXP A;  4ZQ3 A;  4F8M A;  5C4Z A;  1SYB A;  5IOC A;  3MZ5 A;  4HMJ A;  3SK8 A;  1STH A;  2F0O A;  3LX0 A;  4PMB A;  2F0D A;  5I6W A;  2EY6 A;  4S3S A;  1U9R A;  5E1F A;  2F0G A;  1TR5 A;  1EY4 A;  1EYC A;  1SNM A;  1A3T A;  5I6Y A;  3R3O A;  3DMU A;  1KDA A;  1EQV A;  2OEO A;  2HQE A;  2OXP A;  2EY1 A;  2PQE A;  1STA A;  2F0E A;  4EVO A;  5C6A A;  2PYK A;  1JOK A;  3NUC A;  2F0N A;  4KY6 A;  5EKK A;  2PZT A;  5IGB A;  2SNS A;  5IGC A;  4QB4 A;  4KY5 A;  3DHQ A;  4HTH A;  4WOR A;  1F2Z A;  1ENC A;  4N9T A;  3P75 A;  4EQP A;  5DEH A;  4IUN A;  4ME5 A;  4RKL A;  1EZ8 A;  3TP5 A;  2F0T A;  1KDB A;  3HEJ A;  3MHB A;  3U9O A;  4EQO A;  5KGU A;  3E5S A;  1TQO A;  4K6D A;  4QMG A;  4KTA A;  2EYO A;  5KRU A;  3ITP A;  2F0H A;  3V2T A;  5IGD A;  2WAC A;  3QOJ A;  3P1H A;  4K14 A;  4OL7 A;  4I65 A;  3RUZ A;  1SYG A;  2KQ3 A;  2F0U A;  4R8N A;  5F2D A;  5IGG A;  1EY8 A;  1II3 A;  2PZU A;  3ERO A;  3ERQ A;  2M00 A;  3EJI A;  1SYC A;  2F0Q A;  3NQT A;  4RKB A;  1EY6 A;  5JAV A;  4EQN A;  2EYF A;  4WRD A;  3C1E A;  2F0J A;  5C3W A;  2EYM A;  3SK5 A;  4HMI A;  2EXZ A;  2SNM A;  3TP6 A;  4ID6 A;  5IGE A;  1NUC A;  5J22 A;  5J1Z A;  4KHV A;  2F0P A;  1KAB A;  1STY A;  1A3U A;  4K5W A;  4ZUI A;  3NK9 A;  4NDX A;  5C3X A;  5IIF A;  3D4D A;  5C5M A;  5C4H A;  1SNO A;  5CGK A;  3SK6 A;  1STN A;  4E6I A;  5CR3 A;  5CV7 A;  2RDF A;  4TRD A;  1A2U A;  3D4W A;  3SHL A;  3OMG A;  4B9X A;  5E3F A;  2EYJ A;  1STG A;  3VA5 A;  4DGZ A;  3D6C A;  4PMC A;  4MIU A;  1STB A;  5KYI A;  3BDL A;  5DAU A;  2F0M A;  2NUC A;  1SYE A;  2QDB A;  3D8G A;  4K2K A;  4KY7 A;  1SYF A;  1JOO A;  3TME A;  5IGF A;  2O4X A;  4H7B A;  2ENB A;  4QF4 A;  4PNY A;  5JOB A;  1IHZ A;  5I9O A;  2PZW A;  5CV9 A;  4KD4 A;  5CV4 A;  1JOQ A;  5ISR A;  1JOR A;  3EVQ A;  3OMC A;  4ZUJ A;  1EY0 A;  1KAA A;  3C1F A;  3MVV A;  4DF7 A;  5KEE A;  1A3V A;  3BDC A;  2F0W A;  1EY7 A;  4IZ8 A;  4NP5 A;  1ENA A;  3MEH A;  4K5X A;  1RKN A;  4KV6 A;  3TP8 A;  4LAA A;  2F0K A;  4F7X A;  2EY2 A;  5I9P A; 
#chains in the Genus database with same CATH topology
 2YU9 H;  3F8T A;  2LS0 1;  2YV5 A;  2FJ2 A;  2K32 A;  1XYI A;  2UXC L;  1X65 A;  2B3G A;  4DK1 A;  3HOZ B;  4A3G H;  1XPR A;  5C4J H;  5C44 B;  1JB3 A;  5LHY 1;  3CCJ A;  1N33 L;  2AQ2 B;  4I7Z C;  1HNX L;  5K36 G;  4G4K A;  3M3Y H;  5K5P A;  2R6G A;  3S9W A;  1E1T A;  3BVZ A;  4X3T A;  1C4Q A;  1BBX C;  2BH2 A;  4A3C G;  4IQZ A;  2Z9H A;  1TT2 A;  3GTQ H;  3F2B A;  1K0R A;  1G6Z A;  1QNK A;  4JBW A;  4DXF A;  4XXE A;  3U58 A;  3MZ5 A;  4FXG C;  4HMJ A;  2F0O A;  1PRT B;  2R92 B;  5LMU L;  5ELD A;  3TRE A;  3Q8D A;  1GOZ A;  3BJU A;  2QW7 A;  1HNZ Q;  3J80 E;  3M4O B;  3EA6 A;  3CC2 A;  1B70 B;  1Y1V H;  5J3B A;  1ET6 A;  2PMZ B;  3SDZ A;  2OEO A;  4OGQ C;  1JE4 A;  2A5H A;  3NUC A;  2K03 A;  4JI6 L;  4DV1 L;  4LF6 L;  1NNX A;  4KY5 A;  1ZXT A;  2MJ8 A;  1GHK A;  1PZK D;  1IBK Q;  3SVM A;  3TP5 A;  5KGU A;  4CJ2 C;  4HAE A;  1XX8 A;  1GO3 E;  2PI2 E;  1CHQ D;  3K5M A;  3S14 H;  1V1Q A;  4A3E H;  1Q81 C;  1HNZ L;  2NZH A;  3QOJ A;  4DV0 L;  2JYO A;  3MTS A;  1DGS A;  1PH9 A;  1EIF A;  1II3 A;  3BG3 A;  3V2T A;  2R7Z H;  1O80 A;  3HGB A;  2P5Z X;  4OHJ A;  3T4A C;  1PH3 A;  2PQA A;  1LTG D;  2Z4I A;  3F2U A;  1PFS A;  3K81 C;  5CBE E;  1UUP A;  1U4L A;  1IKM A;  2B2Y C;  1A3U A;  3AQQ A;  3D4D A;  3DM1 A;  3SK6 A;  5CR3 A;  1I4R A;  3H0G H;  4XIG S;  4A4I A;  3D4W A;  3CCS A;  1DOM A;  1PYB A;  3CKI B;  4PZ6 A;  3D6C A;  2Y0S B;  3DWA A;  1TWG B;  4GN5 A;  1CZW A;  1WTH A;  2AMC B;  3JAM i;  1TY2 A;  4DAY B;  2KEE A;  1SYF A;  1JOO A;  3JAM c;  3GTK H;  4O42 A;  2CW0 D;  3S2H H;  4LF7 Q;  1CA6 A;  4P73 A;  4DV6 L;  3NWS A;  3PF5 A;  4TSS A;  4HJ9 A;  4BXX H;  4M1U B;  2L5T A;  3DWP A;  4XDX A;  3K57 A;  5ELE A;  4DPG A;  2I5H A;  2E5L Q;  2R61 A;  1SMY C;  2Z1C A;  1EY9 A;  1BNZ A;  1GXD C;  1JB7 A;  2EYP A;  1CKN B;  2RBM A;  1TS3 A;  4LF7 L;  2NVY B;  2WB1 G;  2B2W C;  3VYT A;  2K1B A;  3MXN A;  3MEF A;  4AYB E;  3HKZ E;  3SGI A;  5M9O A;  3CCV A;  1RHP A;  1XMO Q;  1JWU D;  2E2I B;  1KRS A;  4B3S Q;  1QWY A;  1Y1W G;  3KF8 B;  3OYY A;  4UDU C;  2E5L L;  2K6A A;  5JEA H;  1S5E D;  4ZYS A;  3HOY B;  4XT3 B;  2OQ0 A;  2J4X A;  3K5O A;  2HQE A;  4JI2 Q;  3J7A 5;  1XMO L;  2ZTE A;  1B8A A;  1A62 A;  1AZQ A;  4DAM A;  4B3S L;  4HTH A;  1FD7 D;  2NN6 H;  4UP7 A;  2V1C C;  4X3K A;  1X56 A;  1TQO A;  2N8N A;  3J7Y W;  3FEW X;  4PV1 C;  1K8A C;  3NEL A;  3QG1 A;  4P71 A;  1LT6 D;  4K14 A;  1TWC B;  2B39 A;  4R8N A;  2EVB A;  4JI2 L;  2VB2 X;  3KF6 B;  4A3J H;  1H9J A;  3D6W A;  4CGY B;  2EXZ A;  3GV6 A;  3NTK A;  4LFB Q;  1SE8 A;  1A15 A;  3AFP A;  5C3X A;  4XYQ A;  4DR6 Q;  3HOV H;  4KHP Q;  4BWG B;  1ONL A;  2RDF A;  5M5W B;  1STG A;  2NBF A;  1PFN A;  1JE5 A;  3ERS X;  3VA7 A;  1S5F D;  3F2C A;  3GD7 A;  2ALY B;  1T5X D;  1Q1E A;  1D1K A;  5CMD A;  5M5Y B;  5C0X G;  2XGT A;  1EIH A;  4R4T A;  4FXK C;  2I07 B;  3J81 j;  3MVV A;  5KEE A;  3S1Q B;  4LFB L;  1KC8 C;  5K36 H;  2XRQ D;  4RMF A;  2A6H C;  4KHP L;  1F9P A;  3RZO H;  1RKN A;  3DXJ C;  4A3C H;  1EYA A;  3ER0 A;  1I4H A;  1S72 A;  2E74 C;  1A0I A;  1V1P A;  3I4M B;  4YIJ A;  4A3I B;  3SXH A;  3PUZ A;  1O78 A;  2VUM B;  3NP8 A;  1XWE A;  1I50 B;  5M3M G;  2O2L D;  1XXG A;  4LMQ D;  4J1M A;  4ZKC B;  2F3V A;  1RTN A;  1YBY A;  3SR1 A;  4RAU C;  3NPP A;  4LFA L;  1Z6H A;  3EQL C;  4APV A;  2CVR A;  1C48 A;  2F0I A;  3HOW G;  1ML0 D;  4A3B H;  2BCO A;  4DR5 Q;  3A8K E;  3C3L A;  1Z7T A;  1K28 A;  5EBC A;  3SK8 A;  1PXU A;  1VQC A;  4S3S A;  3PO2 H;  4WJW A;  1VCI A;  1EY4 A;  2K5V A;  3I4N B;  5M3F B;  4DV2 Q;  3M7N A;  1SMX A;  2JA5 G;  2DN8 A;  2JN4 A;  5EKK A;  3K7A B;  4ME3 A;  5GAD C;  2K5Q A;  4DR5 L;  4V0B A;  2HCC A;  1I4Q A;  2KA7 A;  4ME5 A;  4QUF A;  1RCV D;  1KD1 C;  3GTP B;  5CYU A;  1G8Z D;  2PNR C;  3G48 A;  5E4X A;  1PH8 A;  4P75 A;  2A74 C;  4ZK9 B;  1KNA A;  3KYH C;  4C3J B;  3P1H A;  4U68 A;  3GTG B;  4DV2 L;  1I94 Q;  2IX1 A;  3EJI A;  2Z4H A;  3T53 B;  1GVP A;  5EJW A;  4FVM A;  2WB1 E;  4DR4 Q;  3UE0 A;  4Q0F A;  2JA7 B;  4JW0 A;  5I2Y A;  2E2J H;  1G2T A;  3S1M H;  3BYT B;  1ZEQ X;  3FP9 A;  3NK9 A;  3S16 B;  1L1O C;  1BXT A;  3M7G A;  1AP0 A;  2MO1 A;  1QZH A;  1CQF A;  3OMG A;  2D5D A;  4CDF C;  2B2T C;  4DXG A;  3KUP A;  1I94 L;  1V8Q A;  3FKI G;  1LT5 D;  3BDL A;  4GOP A;  4G7O C;  2UUB Q;  4DR4 L;  1SFO B;  3GTL B;  5IT9 L;  1XNR Q;  2C5C A;  4V19 0;  2CHB D;  5C3E B;  1E24 A;  3LWU A;  4IFD I;  2ZJR A;  2CH4 A;  3B6Y A;  3LWE A;  4OO1 H;  2A73 B;  1NR2 A;  1YIJ A;  3T1H L;  2JEB I;  5I9P A;  1PFB A;  1YNJ D;  1D2B A;  2ASB A;  1FJG Q;  1EFI D;  4A3K B;  1EIG A;  1C0A A;  4DKA C;  1Y1W H;  2Q8I B;  2UUB L;  1YHA A;  1HZ9 A;  2IY5 B;  4GLA C;  5JPM C;  1D1I A;  4C3H G;  1XNR L;  3PO3 G;  2F0V A;  3T16 A;  4LUZ A;  4BBR B;  2Z6K C;  1SRO A;  4QIW E;  4IUU A;  4N9P A;  4LF8 Q;  2GA4 B;  2K04 A;  4OEM B;  2M9V A;  2WKD A;  2ZXO A;  4BBS G;  3MXP A;  3IKJ A;  1QCB D;  1V9P A;  3VYR A;  4RGO S;  1PH5 A;  4JI5 Q;  3J7A F;  1Z9F A;  1TWA B;  3LGJ A;  1H95 A;  1EYC A;  1PTO B;  1MI2 A;  2VZA A;  1STA A;  4EVO A;  1JOK A;  2LY7 A;  4LF8 L;  5KND A;  3DWQ A;  4QB4 A;  1JQY D;  3DHQ A;  3E0E A;  1RJT A;  2YTX A;  3URY A;  1QOH A;  5FLX c;  1MSG A;  1QG7 A;  2AQ1 B;  2DNC A;  1M4V A;  4JI5 L;  5AJ3 L;  4KKS A;  1PYW D;  1X9N A;  2WAC A;  1W6K A;  2I0Q A;  1NTG A;  1SRU A;  1H9M A;  3JAM L;  2IHE A;  1BOS A;  3E9I A;  1TS2 A;  3AEV A;  1IYJ B;  1YZ6 A;  1STY A;  3WOE A;  4Y52 H;  1VQH A;  2D0O A;  5C4H A;  1DD2 A;  3QIA A;  1ZYR C;  4E6I A;  3CW2 C;  1RF2 D;  3NBH A;  4LW1 A;  4TRD A;  4HN7 A;  2NVQ H;  1D8L A;  3I55 A;  2EXD A;  1LTA D;  2TMP A;  1AE2 A;  2VXW A;  4MIU A;  4A75 A;  1V43 A;  1EEI D;  2AHO B;  2MO0 A;  1W6J A;  3HOZ G;  2RCF A;  2V4D A;  3FVQ A;  1P16 A;  3CME A;  3KOJ A;  2BDO A;  1K9M C;  1OXT A;  1BUV T;  1T5E A;  3R2T A;  4CKC A;  3WDN A;  1TU2 B;  3VR4 A;  4HIK A;  2MFI A;  1JT8 A;  2EY5 A;  1YNN D;  4FXD A;  4A3F H;  5I2X A;  5KYL A;  3K5L A;  2RDG A;  3OSO A;  4GOP C;  2R92 G;  1EYD A;  1CKM A;  4X66 Q;  2UUC L;  4CDC C;  3A7A B;  4J15 A;  2R7D A;  5LMN Q;  4Y7N H;  2XTI A;  1GUS A;  4IPD A;  1TVX A;  2RHS B;  3CCQ A;  1PH6 A;  2VB3 X;  2JA5 H;  2B2U C;  1KRT A;  3PCO B;  2NVX B;  1YJW A;  1I6H H;  2A6E C;  1FR3 A;  4C1N I;  4ZQ3 A;  4F8M A;  1CZG A;  2HUG A;  4RCN A;  3FPP A;  4IPH A;  4L8J A;  5GQO A;  1I3Q H;  4CDE C;  4HJ5 A;  3ND8 A;  2KBN A;  1C9O A;  5LMN L;  2F0N A;  1CT1 D;  5FLX E;  2KED A;  5M5X B;  4A93 B;  2VL6 A;  3J81 c;  5DLQ E;  1B9N A;  1KDB A;  1J5E L;  4I7A A;  4IUV A;  4HCE A;  4LNQ A;  4XT1 B;  3MC0 B;  3H3V I;  2CKZ B;  3Q6S A;  1IZ6 A;  2Y0S G;  2F0Q A;  3J80 i;  1SSO A;  2GN5 A;  3MXG A;  4WRD A;  3CF5 A;  4X6A H;  3FKI H;  2AWN A;  2NWG A;  3FHW A;  4A76 A;  2PCF B;  3TP6 A;  2K5W A;  2AUK A;  5CBA E;  2GVB A;  1Q7Y C;  2J0T D;  2B2Y A;  4K5W A;  5JJK A;  3K7U C;  5IP9 H;  1A63 A;  2ES2 A;  1TWH H;  1G91 A;  3I7F A;  3PV0 A;  2Q8R E;  3VYU A;  3SHL A;  3A5Z B;  4O2D A;  5AFW A;  3S24 A;  3I91 A;  3M4Y A;  1QUQ A;  1WI5 A;  1E2Z A;  3M4Q A;  1PRT C;  3X3M A;  1Y8P B;  3TBI B;  1M1K C;  4N8F A;  1R9T B;  3OOC A;  1A6X A;  3RZD B;  4JK1 C;  2MP1 A;  1B7Y B;  1IHZ A;  1VQN A;  3CQZ B;  4C3H H;  1J6Q A;  2A68 D;  4KKU A;  4K6L A;  4DR3 L;  2F0W A;  3PO3 H;  1SAP A;  3GTJ H;  1QVG A;  1WFQ A;  1WOC A;  1YNX A;  1BCP F;  4C2M B;  4DR7 L;  1BDO A;  1Q46 A;  1Q82 C;  2VQF L;  4JBJ A;  4BBS H;  4A3J G;  1E1O A;  2CH4 W;  3KLW A;  4DNR B;  4HIO A;  1HHV A;  5A2Q E;  3KK7 A;  3KBG A;  2UXC Q;  1YVC A;  1EWH A;  1NSN S;  2A69 D;  4UPA A;  1WCM B;  5EGT A;  5DM6 3;  2B2W A;  1N33 Q;  1X3Q A;  1OO9 B;  2QA4 A;  1FGB D;  3KFU A;  3T51 B;  3S1N B;  4H02 A;  5ELB A;  2HDM A;  4CJ0 B;  3CCM A;  3CRK C;  4C3I B;  2K75 A;  3J7Z C;  3W1G A;  1STH A;  2K05 A;  2D62 A;  3I3C A;  4RHS A;  2UXD Q;  1HJP A;  4G7Z C;  1HFN A;  2OCE A;  2ZTC A;  2N49 A;  1A3T A;  5LMU Q;  1J8I A;  5JVH 3;  1VQB A;  5EBD A;  4POG A;  1KL9 A;  3J81 E;  1RTO A;  4JI6 Q;  5IYB H;  4DV1 Q;  3G7L A;  1PZJ D;  3E5S A;  3M85 A;  3STB C;  2UXD L;  5IYD G;  4GLX A;  1BR9 A;  4DV7 Q;  2RF4 A;  5FJ8 G;  1BKB A;  4A3D B;  1DOK A;  2JXM B;  1EQR A;  3ZYY X;  1LTI D;  4RKB A;  4DV0 Q;  1QNU A;  3A8I E;  1FGU A;  3GO5 A;  2PMZ E;  3KJO A;  3HOZ H;  4A3B G;  4P72 A;  1WJJ A;  4FNF A;  4KHV A;  5C44 H;  2F0P A;  2JK8 A;  2I5L X;  2JQO A;  3BU2 A;  2KCT A;  1P8L A;  2ZXR A;  2N3S A;  4DV7 L;  1X54 A;  1IW7 D;  2HD3 A;  1MHW C;  4O1N A;  3PO2 G;  2Z8L A;  4CHT B;  1EQT A;  1XTC D;  1HR0 W;  1SJE D;  4B08 A;  1AH9 A;  4DV5 Q;  3I4O A;  4JCV E;  4A3I G;  2K5H A;  3U4Z A;  2EZV A;  1EYG A;  3TME A;  4H7B A;  1F2L A;  5JEA J;  2EOT A;  3IFD A;  2L15 A;  4KD4 A;  5CV4 A;  3RMH A;  5GAG C;  2KJX A;  4RGM A;  2R92 H;  1EY0 A;  2RA4 A;  4YWL A;  3PUV A;  1I4G A;  4JPB W;  4NP5 A;  4CBV A;  3M4O H;  4DV6 Q;  3TDQ A;  1O7L A;  5JJZ A;  1NAP A;  2B63 B;  1UEA B;  1H9R A;  3OW7 A;  4CJ1 B;  4DV5 L;  2BA0 A;  4L5T A;  5CV5 A;  1AEX A;  3PIO A;  3UI2 A;  2F0S A;  3S15 H;  4ABN A;  1Y8O B;  4K8J A;  4Z9C B;  1TWF H;  1X32 A;  2Y0S E;  4XQN A;  2F0F A;  5JJL A;  1RD9 D;  4QL5 A;  4IFD H;  4FYD A;  2EYH A;  4KD3 A;  5M3F G;  2B29 A;  3I4N G;  5EKL A;  1QJO A;  1GHJ A;  4JI7 Q;  4YCU A;  2H4O A;  1SNP A;  2AKW B;  4AIM A;  1ICF B;  4IUQ A;  2L11 A;  1SNM A;  4C3J G;  4IOA A;  3AYH B;  3UE1 A;  2E2H B;  1PH1 A;  4JI7 L;  2PYK A;  1XNQ Q;  4OO1 G;  2NVT B;  1CTM A;  3PIP 3;  1TWG H;  1H9K A;  4FF3 A;  4PQX A;  1WVL A;  2F4V Q;  1YNJ C;  1VQ9 A;  3TSS A;  1L2F A;  3BYY B;  4KHZ A;  4KTA A;  5KRU A;  2JA8 B;  4RFB A;  1E0B A;  1WD0 A;  4NPS A;  3ONA B;  1SE4 A;  1OXX K;  1S5B D;  4AYB B;  1B53 A;  3HKZ B;  5IGG A;  1EY8 A;  1H9S B;  1B3A A;  1XNQ L;  1L0X B;  4RH6 A;  1Y69 U;  2Z6B A;  4KI0 A;  2G9H D;  5T1I A;  5TSS A;  5EPK A;  1HZC A;  3NWT A;  4UP9 A;  3H3V C;  4MZ9 A;  2F4V L;  4MNO A;  4UHV A;  2NVY H;  1L1O A;  2CQA A;  5HY6 A;  1LUZ A;  2OQK A;  5CV7 A;  4OON A;  1WYD A;  3KJP A;  3D4R A;  4DGZ A;  2B2T A;  2E2I H;  4ULL A;  5JJI A;  1STB A;  1MJC A;  4L5R C;  2L55 A;  4YCV A;  1SYE A;  2QDB A;  3OIQ A;  3RLO A;  3AMU A;  2KCC A;  4QUC A;  3TS2 A;  2B8G A;  3H94 A;  5JPN C;  3HOV B;  1GUO A;  5CV9 A;  1JOQ A;  4B3T Q;  4JV5 Q;  4DK3 C;  4DUZ L;  3HOY H;  3BDC A;  4OIJ A;  1IL8 A;  2HHH Q;  4AH6 A;  2KEC A;  1QE6 A;  3TZD A;  4KK7 A;  4GN4 B;  1SLJ A;  4PZ8 A;  3EFX D;  3HS0 C;  1S40 A;  2HQL A;  1DZ1 A;  1CHP D;  3BZD B;  3CRL C;  4UAI A;  1TS4 A;  1ROD A;  1R4Q B;  3ULJ A;  3RN2 A;  4XTC S;  1NMF A;  5DNF A;  2OTJ A;  1UE1 A;  2IL8 A;  4JBM A;  4NB3 A;  4B3T L;  1PA6 A;  4JV5 L;  1EWC A;  1PYS B;  4QCL A;  1YI2 A;  2HHH L;  2Z6K A;  1B3Q A;  1STE A;  1TWC H;  3V05 A;  1I4P A;  5J39 A;  3PMF A;  3GTM B;  4OEL B;  1NMG A;  3NHH A;  4LWC A;  4LFA Q;  2DUD A;  1SDF A;  2RDH A;  2WAQ B;  4IJH A;  1G6P A;  1TKW B;  2XRS D;  3LX0 A;  4DR2 Q;  2F0G A;  2JA9 A;  2I46 A;  1JWS D;  5IYD H;  1WTO A;  5FJ8 H;  1KDA A;  5M5W H;  4U67 3;  4TQU S;  2XVS A;  4TVA B;  4P2C B;  2KEN A;  2DJF C;  3J80 L;  4OWW B;  1D5Z C;  2WFW A;  1QVC A;  4N9T A;  5M5Y H;  3S1R B;  5LL6 S;  4A3F G;  4K6D A;  1YNN C;  4PZ7 A;  2PPB C;  4DR2 L;  3P7J A;  5IGD A;  3S1Q H;  3W5O A;  4TKO B;  4JI8 Q;  4KMU C;  3HOX B;  1VQ8 A;  4OX9 Q;  1JJ2 A;  3OWE B;  5F2D A;  2ZT9 C;  4IOC A;  1HRJ A;  5EPL A;  2M00 A;  3CCU A;  3CPF A;  5JAV A;  3TEH B;  4EQN A;  2F4I A;  2F0J A;  1VQF A;  3I4M H;  2IX3 A;  4A3I H;  4B3M Q;  1DON A;  4DK0 A;  5BN4 A;  3DLL A;  1VQ5 A;  4WJ4 A;  2VUM H;  4ID6 A;  2NTS A;  4FO2 A;  1I50 H;  1O7Z A;  4FF4 A;  3BZK A;  4IPC A;  4NDX A;  1SNO A;  3CPW A;  3E9H A;  5GAE C;  3G6E A;  3S2D B;  1I4X A;  4JI8 L;  3MA2 B;  5ELF A;  4YHH Q;  4OX9 L;  1A8V A;  1K3B C;  2ZM6 Q;  3I73 A;  3NTH A;  1VQ6 A;  1W2B A;  2ICE C;  1PTO C;  4B3M L;  5JOB A;  1GUW A;  3NSW A;  3UDI A;  1BVS A;  3N52 A;  2BDN A;  1WTQ A;  4X65 Q;  4DN4 M;  2C35 B;  1GKH A;  2JA6 B;  3I4N H;  5M3F H;  4LAA A;  2E75 C;  1UWV A;  4YHH L;  2F52 A;  5HGQ A;  2FIN B;  1F2Y A;  2KUM A;  3G4S A;  2HCI A;  3K7A H;  3T1H Q;  3AFQ A;  4HCS A;  4RWS C;  4IUR A;  3OWF A;  2ZM6 L;  2O5I C;  1HFG A;  1CI3 M;  5G3L F;  3IRB A;  1CM9 A;  3GTP H;  2Q2U A;  4NKL A;  4K0K Q;  4DUY L;  3AU7 A;  4X65 L;  4OXP A;  4C3J H;  5IP9 G;  1QZG A;  1F2M A;  3GTG H;  3AB9 A;  3CAM A;  3HZX A;  1PZI D;  1JMC A;  1CA5 A;  3W1B A;  2B2U A;  1D6E C;  4L5S A;  1NR4 A;  4JI3 Q;  4A93 G;  1EU4 A;  5C0X J;  4BY1 B;  3DUZ A;  1SYB A;  3BDO A;  1TXY A;  5G3L D;  2XSC A;  1SMY D;  1KIX A;  3S16 H;  4K0K L;  1I6V C;  2JP1 A;  3S17 B;  2D9U A;  2UU9 Q;  1EQV A;  5KNC A;  2PQE A;  1S4Z A;  1U4R A;  4WOR A;  1SFO H;  3GTL H;  4JI3 L;  3FMC A;  4RKL A;  1LO5 D;  2FHT A;  1RIP A;  4EQO A;  3PGZ A;  5C3E H;  4IJL A;  1LM0 A;  1G2S A;  1L0Y B;  2CCZ A;  5C4X B;  2UU9 L;  2F0U A;  5AJ3 Q;  2MGS A;  1X3E A;  1EY6 A;  1HZB A;  3MXN B;  4A3K H;  3HRZ C;  2LFN A;  3SK5 A;  4HMI A;  2VQE Q;  1FNW A;  1NUC A;  3CCR A;  1E7Z A;  1EIY B;  2KOL A;  1HNW L;  1JIC A;  1I5F A;  1KHI A;  5CGK A;  3PIP A;  1UEB A;  4BBR H;  3CC7 A;  4R8I A;  5E3F A;  4FP5 D;  1ICW A;  4R4Q A;  4QJF A;  4KY7 A;  4A3L H;  2K28 A;  2O4X A;  4DA2 A;  4PG3 A;  3E6Z X;  2PZW A;  4BY7 B;  3KLR A;  2VQE L;  3EVQ A;  5IYB G;  5ELO A;  5E4W C;  3I90 A;  1LTR D;  1VQI A;  3QJY A;  1PTO H;  5IP7 G;  1IBL Q;  3MAQ A;  1B44 D;  1KAB A;  4BA1 I;  5IOD A;  3Q0A A;  1EL0 A;  1FNU A;  4K8I A;  2PW5 A;  5M3M B;  3NXW A;  4DU9 A;  3GTO B;  1E2W A;  1PH7 A;  3C2P A;  2ATW A;  3H6M A;  1EY5 A;  5A35 A;  2F3I A;  1KTK A;  1PLF A;  4K5V A;  5C44 G;  1E2V A;  1NY4 A;  1WD1 A;  3HOW B;  1IBL L;  2UUC Q;  1VQJ A;  1EOV A;  1KDC A;  2A6H D;  1IW7 C;  1PVO A;  4IUT A;  1CK1 A;  1HA6 A;  2LKV A;  1C7Y A;  2B2V C;  1E3P A;  3TN2 A;  2A19 A;  4HR7 B;  3L9A X;  4PMB A;  2F0D A;  3HP3 A;  3EBE A;  2L9H A;  1CKO A;  1JC7 A;  2CWA A;  1OXS C;  4R4I A;  4F88 A;  4A3D G;  4DAY A;  1BBW A;  3ND9 A;  5FLM G;  3DMU A;  4JI0 Q;  1I6H B;  4LF4 L;  2VW9 A;  1NJI C;  4KY6 A;  4OIK A;  4N8X 1;  4HJ8 A;  2R7F A;  3D0F A;  3P75 A;  4MTK A;  1IL2 A;  3U9O A;  1EZ8 A;  3VR3 A;  2IJ0 A;  3MHB A;  1N32 Q;  3WWV A;  3NTI A;  4GS3 A;  1V1P B;  3U50 C;  3VR6 A;  4A3M B;  1J5E Q;  2DJG C;  3I4L A;  3V96 A;  1B9M A;  1DYQ A;  4I65 A;  4JI0 L;  4IFD G;  3KLS A;  3K0Y A;  1CKN A;  3A8J E;  2CW0 C;  1CSQ A;  1DXM A;  3I72 A;  2ZJP A;  5C3W A;  1IYV A;  1X3G A;  1HPC A;  2QIL A;  3ZJY C;  3PQI A;  1DJR D;  3DM3 A;  1KLU D;  1LTS D;  5ELC A;  3J81 i;  1N32 L;  2R93 B;  1AN8 A;  1BQQ T;  1VQE A;  3HOU B;  1HUM A;  4L5Q A;  1IBM Q;  3K0X A;  1D5M C;  3KF8 A;  5EKI A;  2RCN A;  1Q90 A;  2B63 G;  4DV4 L;  1K83 B;  1ESF A;  4EQ5 A;  2HIX A;  4LUV A;  5D14 A;  1CUK A;  2NVX H;  5IGF A;  1O7I A;  2ENB A;  1HTL D;  2D0P A;  2IW3 A;  1E22 A;  2JSO A;  2K33 A;  1PH4 A;  3H91 A;  3OMC A;  1KAA A;  2B8F A;  3OIP A;  1IBM L;  4DR3 Q;  3TP8 A;  4HSP A;  4NMZ A;  5HUR A;  2FMM A;  2AWO A;  3IL8 A;  4MHE A;  4ODG A;  1N36 Q;  4JOI C;  4DR7 Q;  4MN3 A;  5M5X H;  4A93 H;  2OF1 A;  4YY3 Q;  4LUO A;  3Q24 A;  2EYL A;  2VQF Q;  1Y8N B;  2OWO A;  3KF6 A;  3D3R A;  2KHS A;  2RKS A;  1EU3 A;  2BA1 A;  4KN7 C;  1UAP A;  2RVL A;  3J7A V;  3G6J B;  3IFT A;  1SND A;  5EQ0 A;  3M9B A;  3RR5 A;  1N36 L;  4JYA Q;  4DAV A;  1HCZ A;  3VDY A;  4YY3 L;  2JA8 G;  3W3A A;  4YWM A;  1U9R A;  1K8O A;  1B50 A;  4KLK A;  4FF2 A;  3HOY G;  2A1A A;  1SE2 A;  3BS1 A;  1Q86 C;  2QEJ C;  2YU9 B;  3P20 A;  5IGC A;  2PZT A;  1ENF A;  1HXY D;  4GKJ Q;  1R9T H;  1LTB D;  4A3G B;  3RZD H;  2EJG C;  5D3I B;  4JYA L;  5C4J B;  1SE3 A;  1BCP D;  1Q8I A;  2DY7 A;  1WTR A;  3CQZ H;  3EN2 A;  2IWH A;  2M2L A;  2EYO A;  3M3Y B;  3ITP A;  2WII B;  1WTP A;  1QB5 D;  1DCZ A;  3VR5 A;  3CC4 A;  4C2M H;  3GTQ B;  1XTD A;  1VQL A;  4GKJ L;  2XWB B;  4HSV A;  2QF7 A;  2MNA A;  3OPO A;  1K0S A;  4GNX C;  2A8V A;  2AQ3 B;  1EOT A;  1LT3 D;  3F2D A;  1STN A;  1Y1V B;  2GVA A;  5IP7 H;  3G71 A;  2XWJ B;  4IPG A;  1J9O A;  2AUJ D;  1X55 A;  2JE6 I;  3K6O A;  1GJX A;  3S1N H;  5KYI A;  1HA5 A;  1YHB A;  1V1O A;  4K2K A;  3D8G A;  1EWI A;  5IT9 c;  3RLF A;  4R1J A;  4H44 C;  1Z47 A;  4QF4 A;  3DEP A;  4C3I H;  1B4O A;  5KNB A;  4DF7 A;  2MPM A;  4HIM A;  1NCV A;  3S14 B;  1M8A A;  4A3E B;  4IZ8 A;  1VQD A;  1AFP A;  4PMW A;  3H09 A;  2R7Z B;  2UUA Q;  1ZYR D;  3FDT A;  1SNC A;  4G7H C;  1ESR A;  1Q1B A;  2VNU D;  1A2T A;  4M8A A;  2WAQ G;  4RCO A;  3I4M G;  2WKC A;  2QGQ A;  1MBY A;  2LMC B;  2VUM G;  3H0G B;  4J6H A;  1MJE A;  4A3D H;  3A55 A;  5FLM H;  1GUT A;  2L12 A;  3K59 A;  3GP7 A;  5C0X I;  5C5L A;  3S15 B;  4L63 B;  2UUA L;  1PDQ A;  1TWF B;  1LTT D;  2FFK B;  3NBH B;  3Q22 A;  3ULP A;  3L3O C;  5CV6 A;  3GTK B;  4POF A;  2QEX A;  2I5M X;  5C4Z A;  1XMQ Q;  2KCN A;  3S2H B;  4CKB A;  1PMR A;  2EJM A;  1TR5 A;  2H5X A;  1F9Q A;  3R8B A;  1EFW A;  1UE7 A;  3HOX G;  1JWM D;  1RDP D;  4ILW A;  3HKS A;  1IBK L;  2D2C C;  3A54 A;  3CP0 A;  4AQY Q;  4GNX B;  3BZC A;  1ENC A;  3MFG A;  4RGN A;  4EQP A;  1UE5 A;  5BR8 Q;  3HEJ A;  1XMQ L;  4QMG A;  2A6E D;  5FLX L;  5FO8 B;  4RA8 A;  1AZP A;  4OL7 A;  3RUZ A;  1SYG A;  2Z0S A;  4HJ7 A;  4FDB A;  3ERO A;  2B63 H;  1SYC A;  2K5D A;  2K52 A;  1LYL A;  4AQY L;  1VQ4 A;  2J7Z A;  2BE5 D;  4ZLT F;  4WJ3 M;  2HIV A;  5IGE A;  3GV3 A;  5J1Z A;  5BR8 L;  1VQA A;  2NYZ D;  2JA7 G;  1S5D D;  5C5M A;  4GZY C;  4CDD C;  1FL0 A;  1VQP A;  2JA6 G;  1A2U A;  3FPU B;  1D7Q A;  3UDX A;  2G5D A;  4LF9 Q;  1TY0 A;  3NEM A;  5IYC G;  5IT9 E;  1VMC A;  2YYZ A;  1YJ9 A;  3OTO Q;  1C8C A;  1PRT F;  3T1Y Q;  4JI1 Q;  1TS5 A;  2EIF A;  4QQB X;  3CXC A;  3NQI A;  1JOR A;  3L2P A;  1LT4 D;  5L37 A;  4GKK Q;  1EY7 A;  2CWP A;  3KBX A;  5C3E G;  1HQR D;  2G9D A;  4GN3 B;  4K5X A;  3SE0 A;  5COY A;  2E2H H;  4YCW A;  2WIN B;  4LF9 L;  3HFZ B;  2NVT H;  2F0L A;  4A3J B;  3OTO L;  2L4N A;  4ZAI A;  3TP7 A;  4BY1 G;  2YTY A;  1PRT D;  4A3K G;  1VQK A;  1ILP A;  3T13 A;  3T1Y L;  4JI1 L;  3SK4 A;  4DV3 Q;  2JA8 H;  1Q12 A;  4GKK L;  2F3W A;  1EEF D;  1GUG A;  1Y14 B;  1VF5 C;  4DAP A;  4KJO A;  5A2Q L;  4L6T B;  3RLN A;  5IWA Q;  5CC4 A;  4O0A A;  4HID A;  4BBR G;  2RSO A;  4ALP A;  1KXL A;  3MXU A;  1QUQ B;  1N9W A;  5FO7 B;  4A3L G;  1T9H A;  4Q5V A;  4DV3 L;  2SEB D;  5E1F A;  1BBU A;  2HDL A;  3L7Z C;  4X64 Q;  5C4X G;  3RZO B;  1BF4 A;  1FYC A;  2NTT A;  2F0E A;  3BVG A;  1VQG A;  4X62 Q;  5IWA L;  1AE3 A;  2SNS A;  3TS0 A;  4XYO A;  1EQQ A;  1NE3 A;  2Q8T A;  2ZXP A;  1VDZ A;  4XQJ A;  2BOS A;  2JEA I;  4IUN A;  3TRZ A;  2F0T A;  1LLR D;  1XJV A;  3J81 L;  3L0O A;  4WFN 3;  1S5C D;  2TSS A;  3RNU A;  1O7Y A;  5D3D A;  4R4C A;  3JAM E;  1RL2 A;  1HR0 Q;  4X64 L;  2WAQ E;  4ZKB B;  5BN5 A;  2HT1 A;  4X62 L;  4A3B B;  1X3P A;  2EYM A;  3R93 A;  2SNM A;  3I56 A;  4BY7 G;  2MQH A;  4RHR A;  4H13 C;  5J22 A;  4DR6 L;  1K8M A;  3KDF B;  3QR8 A;  3BVM A;  3PO2 B;  2WV6 D;  4NW2 A;  3N6R A;  4BA2 I;  4P74 A;  1HH2 P;  3STB D;  3A0J A;  3SEB A;  1HR0 L;  1YHQ A;  5FK9 C;  2EYJ A;  3VA5 A;  2PO4 A;  2LXJ A;  1M90 C;  3GDE A;  3GTM H;  5DAU A;  1HQM C;  2EDG A;  2XNA C;  4OWT B;  4JC0 A;  1F77 A;  2K50 A;  3H15 A;  2FMC A;  3K80 C;  3PSI A;  4IFD J;  4FF1 A;  4H0L C;  1GM5 A;  2R3Z A;  1EUJ A;  1SEB D;  4KV6 A;  1ZKO A;  3RN5 A;  1MIU A;  5CV8 A;  3MWY W;  5EAY A;  1MGS A;  1U0L A;  2QKI C;  3Q23 A;  3H3V H;  4QY7 A;  3K8A A;  5JVG 3;  3VYS A;  3S1R H;  1R4P B;  2YTV A;  3U4V A;  2E2J B;  3S1M B;  3ULL A;  4EGV A;  1U4P A;  3U9S A;  4HED A;  4B9W A;  2CQO A;  1L0W A;  2KVM A;  3WOF A;  4IN3 A;  4DUY Q;  4HJA A;  3HOX H;  2X6L A;  4OWX B;  2NB0 A;  5I4D A;  1K73 C;  4LF5 Q;  1U5K A;  2B2V A;  3CD6 A;  3NE5 B;  5I6W A;  2RQX A;  1FVI A;  1OXU A;  1PFM A;  2EY6 A;  4A3M G;  2WB1 B;  1XPO A;  3R3O A;  5T1G A;  3CMA A;  3S2D H;  2X6G A;  1VS0 A;  1TII D;  2OXP A;  3JC6 6;  2PQA B;  5C6A A;  1VQO A;  5LMN W;  1WTW A;  4LF5 L;  1Y1W B;  1MKH A;  1F2Z A;  5DEH A;  4BS9 A;  5IOC A;  1AW7 A;  2R93 G;  1KQS A;  2F0H A;  5BN3 A;  2F03 A;  2JA7 H;  3HOU G;  1JJG A;  2ID0 A;  4DR1 Q;  2JA6 H;  2SDF A;  1YIT A;  3T56 B;  3ERQ A;  5IYC H;  3I2Z A;  4C1N K;  2O5J C;  2K5N A;  1U4M A;  4IUP A;  3GQB A;  2A68 C;  2KCM A;  1ASZ A;  2F1M A;  1Q3L A;  4LK1 C;  1SN8 A;  3PUY A;  3X3N A;  5GRO A;  1CSP A;  1GUN A;  3TZU A;  1HNW Q;  4DR1 L;  4X3U A;  4ZCK A;  2IT1 A;  1LAC A;  1W3S A;  1WTX A;  2VS1 A;  2NUC A;  5FOB B;  3QWN A;  2A69 C;  2WP8 J;  4QIW B;  4BY1 H;  3A74 A;  1G29 1;  2E76 C;  2KHI A;  4ZUJ A;  1VQM A;  2MHV A;  4J8Q A;  4C56 C;  2E8G A;  3MEH A;  3S17 H;  1FJG L;  1BCP C;  1ET9 A;  4YWK A;  2Q2I A;  2NZO A;  1EZ6 A;  3QOL A;  2QDL A;  4IO9 A;  1VQ7 A;  3W2D A;  2OTL A;  4JOI A;  2EPB A;  5KIX A;  5H1S E;  4KJN A;  1KAW A;  2N78 A;  4UY8 C;  3QB3 A;  3M4P A;  3TQY A;  1SNQ A;  3UDF A;  3VR2 A;  3CHB D;  3CU7 A;  2H1E A;  4G57 A;  3F1Z A;  2NVQ B;  4MTN A;  4KKT A;  3ICE A;  5C4X H;  1WCM G;  4UP8 A;  1YEZ A;  1L1O B;  1TWA H;  4NXM Q;  2PW7 A;  5E7N A;  1N34 Q;  1QIL A;  2NN6 I;  4K2L A;  3O13 A;  4A3G G;  2VY3 A;  4LJZ C;  2K4K A;  2UXB Q;  4R4O A;  3A7L A;  3E3X A;  4C3I G;  2DY8 A;  5I6Y A;  5FO9 B;  3DEO A;  4X3S A;  1D5X C;  2Q2H A;  1LTL A;  2X69 A;  2EE1 A;  1OXV A;  2EJF C;  4ZRZ A;  5C0X H;  5LL6 X;  4RG1 A;  4LF4 Q;  4NXM L;  4A3F B;  1N34 L;  2PI2 A;  4JG2 A;  1PV4 A;  2UXB L;  3PIO 3;  4BY7 H;  1G51 A;  1VMP A;  3K5N A;  1PHJ A;  1Y1V G;  3A5U A;  2K14 A;  4Y7N B;  2KHJ A;  2KQ3 A;  2RSN A;  3NQT A;  1SR3 A;  2PZU A;  2JA5 B;  2EYF A;  1BO0 A;  5ELN A;  5M3M H;  2FXQ A;  2IPK D;  3GTO H;  3D31 A;  1QVF A;  1YJN A;  1BCP B;  4GNX A;  1IKL A;  1I3Q B;  5IIF A;  4A3E G;  1JJC B;  1LAB A;  1F9R A;  4R9W A;  1MSH A;  1X6O A;  1CFM A;  1KLG D;  5COR A;  2ZTD A;  4B9X A;  3HOW H;  2R7Z G;  1ILQ A;  3PUW A;  1B1Z A;  3PUX A;  3I70 A;  1CQV A;  4DV4 Q;  4PNY A;  4JBK A;  1PTO F;  5EPJ A;  4F87 A;  5ISR A;  3C1F A;  1DOL A;  3H0G G;  1HUN A;  4DNI A;  4F7X A;  4DNT B;  2EY2 A;  1F9S A;  4LFC Q;  3UDG A;  3CCL A;  3IAY A;  3NEN A;  3FKI B;  1SYD A;  2OT2 A;  4DFA A;  2RHQ B;  4X66 L;  4IAL A;  5HGT A;  1ASY A;  4BXX G;  1PTO D;  5NUC A;  1H9S A;  1MD2 D;  1TWH B;  1VF7 A;  4A3M H;  2BE5 C;  5GAH C;  2BH8 A;  3PF4 A;  1Q8K A;  1SBB B;  4LFC L;  4XQQ A;  3MFY A;  3OHX C;  2SOB A;  3C46 A;  2IX0 A;  1PH2 A;  4C3H B;  2CFM A;  2ZJQ A;  2R93 H;  2K01 A;  1UE6 A;  2C9O A;  3PO3 B;  1GD7 A;  3HOU H;  4JI4 Q;  2LSS A;  3FRP B;  2ICI A;  4GLV B;  3GTJ B;  4QGU A;  2EY1 A;  1UNS A;  5IE8 A;  3OW2 A;  3J80 c;  2XIW A;  1N8R C;  3HG9 A;  1K83 H;  5IGB A;  1X3F A;  3KLS X;  3EIV A;  1XPU A;  1HTP A;  4NXN Q;  4BBS B;  5JEA G;  4KN4 C;  3R2I A;  3QO2 A;  2DNE A;  4DK6 C;  3NBI A;  2QCP X;  5D65 A;  1KNE A;  3RD4 A;  4JI4 L;  4GOP B;  2N88 A;  1OTC A;  1SXT A;  4CKE A;  1IYU A;  2DGY A;  3E0J A;  1K3R A;  1NBW A;  4EX5 A;  2NN6 G;  2NZ1 D;  4AYB G;  3C1E A;  3HKZ G;  1HZA A;  4NXN L;  2MUY A;  3K58 A;  2N55 A;  1JR0 D;  2K7V A;  3LNN A;  4ZUI A;  1K8G A;  2XN9 C;  4RGT A;  5FKA C;  4OO1 I;  2LXK A;  2EQS A;  5IY0 A;  4DUZ Q;  4LF6 Q;  4B3R Q;  4PMC A;  2F0M A;  1DM0 B;  2IHF A;  3I8Z A;  5DM7 3;  3A56 A;  5I9O A;  2Q2T A;  1SJH D;  2L1B A;  1HNX Q;  4JVZ A;  1IXR A;  1LV9 A;  2JJQ A;  3HOV G;  1FNV A;  1A3V A;  1JCK B;  2E2D C;  1WTV A;  1B2T A;  1ENA A;  2PNH A;  2L0C A;  3KDF A;  3CCE A;  1S3O A;  2F0K A;  4B3R L;  1WCM H; 
#chains in the Genus database with same CATH homology
 2LS0 1;  2FJ2 A;  2K32 A;  1XYI A;  4DK1 A;  3HOZ B;  5C44 B;  1JB3 A;  5LHY 1;  2AQ2 B;  4I7Z C;  5K36 G;  4G4K A;  5K5P A;  2R6G A;  3S9W A;  3BVZ A;  4X3T A;  1C4Q A;  1BBX C;  4IQZ A;  1TT2 A;  1G6Z A;  1QNK A;  4JBW A;  4DXF A;  4XXE A;  3MZ5 A;  4FXG C;  4HMJ A;  2F0O A;  1PRT B;  2R92 B;  5ELD A;  1GOZ A;  3J80 E;  3M4O B;  3EA6 A;  1ET6 A;  2PMZ B;  3SDZ A;  2OEO A;  4OGQ C;  1JE4 A;  2A5H A;  3NUC A;  2K03 A;  4KY5 A;  1ZXT A;  2MJ8 A;  1GHK A;  1PZK D;  3SVM A;  3TP5 A;  5KGU A;  4CJ2 C;  4HAE A;  1XX8 A;  3K5M A;  1CHQ D;  3QOJ A;  2JYO A;  3MTS A;  1II3 A;  3BG3 A;  3V2T A;  1O80 A;  3HGB A;  4OHJ A;  3T4A C;  1LTG D;  2Z4I A;  3F2U A;  5CBE E;  1UUP A;  1U4L A;  1IKM A;  2B2Y C;  1A3U A;  3D4D A;  3DM1 A;  3SK6 A;  5CR3 A;  1I4R A;  4XIG S;  3D4W A;  1DOM A;  3CKI B;  3D6C A;  2Y0S B;  3DWA A;  1TWG B;  1CZW A;  1TY2 A;  2KEE A;  1SYF A;  1JOO A;  4O42 A;  2CW0 D;  1CA6 A;  3NWS A;  4TSS A;  4M1U B;  2L5T A;  3DWP A;  4XDX A;  3K57 A;  5ELE A;  2R61 A;  1SMY C;  2Z1C A;  1EY9 A;  1BNZ A;  1GXD C;  2EYP A;  2RBM A;  1TS3 A;  2NVY B;  2B2W C;  3VYT A;  2K1B A;  3MXN A;  5M9O A;  1RHP A;  2E2I B;  1JWU D;  1QWY A;  4UDU C;  2K6A A;  5JEA H;  1S5E D;  4ZYS A;  3HOY B;  4XT3 B;  2J4X A;  3K5O A;  2HQE A;  1AZQ A;  4HTH A;  1FD7 D;  2NN6 H;  4X3K A;  1TQO A;  3J7Y W;  3FEW X;  4PV1 C;  3QG1 A;  1LT6 D;  4K14 A;  1TWC B;  2B39 A;  4R8N A;  2EVB A;  2VB2 X;  1H9J A;  3D6W A;  4CGY B;  2EXZ A;  3GV6 A;  3NTK A;  1A15 A;  5C3X A;  4XYQ A;  4BWG B;  1ONL A;  2RDF A;  5M5W B;  1STG A;  2NBF A;  1PFN A;  3VA7 A;  1S5F D;  3GD7 A;  1T5X D;  1Q1E A;  1D1K A;  5CMD A;  5M5Y B;  5C0X G;  1EIH A;  4FXK C;  2I07 B;  3MVV A;  5KEE A;  3S1Q B;  5K36 H;  2XRQ D;  2A6H C;  1F9P A;  1RKN A;  3DXJ C;  1EYA A;  1I4H A;  2E74 C;  1V1P A;  3I4M B;  4YIJ A;  4A3I B;  3SXH A;  3PUZ A;  1O78 A;  2VUM B;  3NP8 A;  1XWE A;  1I50 B;  2O2L D;  1XXG A;  4LMQ D;  4J1M A;  4ZKC B;  2F3V A;  1RTN A;  3SR1 A;  4RAU C;  3NPP A;  1Z6H A;  3EQL C;  2CVR A;  1C48 A;  2F0I A;  1ML0 D;  2BCO A;  3A8K E;  3C3L A;  1Z7T A;  5EBC A;  3SK8 A;  1PXU A;  4S3S A;  4WJW A;  1VCI A;  1EY4 A;  3I4N B;  5M3F B;  3M7N A;  2DN8 A;  5EKK A;  3K7A B;  2K5Q A;  4V0B A;  2HCC A;  1I4Q A;  2KA7 A;  4ME5 A;  4QUF A;  1RCV D;  3GTP B;  5CYU A;  1G8Z D;  2PNR C;  5E4X A;  2A74 C;  4ZK9 B;  1KNA A;  4C3J B;  3P1H A;  4U68 A;  3GTG B;  2IX1 A;  3EJI A;  2Z4H A;  3T53 B;  5EJW A;  4FVM A;  4Q0F A;  2JA7 B;  5I2Y A;  1G2T A;  3BYT B;  1ZEQ X;  3NK9 A;  3S16 B;  1BXT A;  3M7G A;  1AP0 A;  1CQF A;  3OMG A;  2D5D A;  2B2T C;  4DXG A;  3KUP A;  1V8Q A;  1LT5 D;  3BDL A;  4G7O C;  1SFO B;  3GTL B;  5IT9 L;  2C5C A;  4V19 0;  2CHB D;  5C3E B;  3LWU A;  4IFD I;  3LWE A;  4OO1 H;  2A73 B;  1NR2 A;  2JEB I;  5I9P A;  1PFB A;  1YNJ D;  1D2B A;  1EFI D;  4A3K B;  1EIG A;  2Q8I B;  5JPM C;  1D1I A;  4C3H G;  2F0V A;  3T16 A;  4BBR B;  4IUU A;  4N9P A;  2GA4 B;  2K04 A;  2M9V A;  2WKD A;  2ZXO A;  3MXP A;  3IKJ A;  1QCB D;  3VYR A;  4RGO S;  3J7A F;  1TWA B;  1EYC A;  1PTO B;  1MI2 A;  1STA A;  4EVO A;  1JOK A;  2LY7 A;  5KND A;  3DWQ A;  4QB4 A;  1JQY D;  3DHQ A;  1RJT A;  3URY A;  1QOH A;  1MSG A;  1QG7 A;  2AQ1 B;  2DNC A;  1M4V A;  4KKS A;  1PYW D;  2WAC A;  1W6K A;  1H9M A;  3JAM L;  1BOS A;  1TS2 A;  1STY A;  3WOE A;  5C4H A;  1DD2 A;  3QIA A;  1ZYR C;  4E6I A;  1RF2 D;  3NBH A;  4TRD A;  4HN7 A;  1LTA D;  2TMP A;  2VXW A;  4MIU A;  1V43 A;  1EEI D;  1W6J A;  2V4D A;  3FVQ A;  2BDO A;  1OXT A;  1BUV T;  1T5E A;  3R2T A;  4CKC A;  3WDN A;  1TU2 B;  3VR4 A;  2EY5 A;  1YNN D;  4FXD A;  5I2X A;  5KYL A;  3K5L A;  2RDG A;  3OSO A;  1EYD A;  3A7A B;  1GUS A;  1TVX A;  2VB3 X;  2B2U C;  2NVX B;  2A6E C;  1FR3 A;  4C1N I;  4ZQ3 A;  4F8M A;  1CZG A;  2HUG A;  4RCN A;  3FPP A;  4L8J A;  3ND8 A;  2F0N A;  1CT1 D;  5FLX E;  2KED A;  5M5X B;  4A93 B;  1B9N A;  1KDB A;  4IUV A;  4HCE A;  4XT1 B;  3MC0 B;  3Q6S A;  2F0Q A;  1SSO A;  4WRD A;  3MXG A;  2AWN A;  2NWG A;  2PCF B;  3TP6 A;  2K5W A;  2AUK A;  5CBA E;  2J0T D;  2B2Y A;  4K5W A;  1G91 A;  3PV0 A;  2Q8R E;  3VYU A;  3SHL A;  5AFW A;  3I91 A;  3M4Y A;  1E2Z A;  3X3M A;  1PRT C;  1Y8P B;  3TBI B;  1R9T B;  3OOC A;  1A6X A;  3RZD B;  4JK1 C;  2MP1 A;  1IHZ A;  3CQZ B;  2A68 D;  4KKU A;  4K6L A;  2F0W A;  1SAP A;  1BCP F;  4C2M B;  1BDO A;  4DNR B;  1HHV A;  5A2Q E;  3KK7 A;  3KBG A;  1EWH A;  1NSN S;  2A69 D;  1WCM B;  5EGT A;  5DM6 3;  2B2W A;  1X3Q A;  1OO9 B;  1FGB D;  3T51 B;  3S1N B;  5ELB A;  2HDM A;  4CJ0 B;  3CRK C;  4C3I B;  1STH A;  2K05 A;  2D62 A;  3I3C A;  4RHS A;  4G7Z C;  1HFN A;  1A3T A;  1J8I A;  5JVH 3;  5EBD A;  3J81 E;  1RTO A;  3G7L A;  1PZJ D;  3E5S A;  3M85 A;  1BR9 A;  4A3D B;  1DOK A;  2JXM B;  3ZYY X;  1LTI D;  4RKB A;  1QNU A;  3A8I E;  3GO5 A;  4FNF A;  4KHV A;  2F0P A;  2ZXR A;  1IW7 D;  4O1N A;  2Z8L A;  4CHT B;  1EQT A;  1XTC D;  1SJE D;  4B08 A;  2EZV A;  3TME A;  4H7B A;  1F2L A;  5JEA J;  2EOT A;  3IFD A;  4KD4 A;  5CV4 A;  3RMH A;  2KJX A;  4RGM A;  1EY0 A;  2RA4 A;  3PUV A;  1I4G A;  4CBV A;  4NP5 A;  3TDQ A;  1O7L A;  5JJZ A;  1NAP A;  2B63 B;  1UEA B;  1H9R A;  3OW7 A;  4CJ1 B;  2BA0 A;  5CV5 A;  1AEX A;  3UI2 A;  2F0S A;  4ABN A;  1Y8O B;  4K8J A;  4Z9C B;  1X32 A;  4XQN A;  2F0F A;  1RD9 D;  4IFD H;  4FYD A;  2EYH A;  4KD3 A;  5EKL A;  1QJO A;  1GHJ A;  2H4O A;  1SNP A;  4IUQ A;  2L11 A;  1SNM A;  4C3J G;  2E2H B;  2PYK A;  2NVT B;  4OO1 G;  1CTM A;  3PIP 3;  1H9K A;  4FF3 A;  4PQX A;  1WVL A;  1YNJ C;  3TSS A;  3BYY B;  4KHZ A;  4KTA A;  5KRU A;  2JA8 B;  4RFB A;  1E0B A;  1WD0 A;  3ONA B;  1SE4 A;  1OXX K;  1S5B D;  4AYB B;  1B53 A;  3HKZ B;  5IGG A;  1EY8 A;  1H9S B;  1B3A A;  1L0X B;  4RH6 A;  1Y69 U;  4KI0 A;  2G9H D;  5T1I A;  5TSS A;  5EPK A;  3NWT A;  3H3V C;  2CQA A;  5CV7 A;  3D4R A;  4DGZ A;  2B2T A;  4ULL A;  1STB A;  2L55 A;  1SYE A;  2QDB A;  3OIQ A;  3AMU A;  2KCC A;  4QUC A;  2B8G A;  3H94 A;  5JPN C;  3HOV B;  1GUO A;  5CV9 A;  1JOQ A;  3BDC A;  4OIJ A;  1IL8 A;  2KEC A;  1QE6 A;  3TZD A;  4KK7 A;  3EFX D;  3HS0 C;  1DZ1 A;  1CHP D;  3BZD B;  3CRL C;  4UAI A;  1TS4 A;  1ROD A;  1R4Q B;  4XTC S;  5DNF A;  2IL8 A;  1EWC A;  4QCL A;  1STE A;  3V05 A;  1I4P A;  5J39 A;  3PMF A;  3GTM B;  3NHH A;  1SDF A;  2RDH A;  2WAQ B;  1TKW B;  2XRS D;  3LX0 A;  2F0G A;  2I46 A;  1JWS D;  1WTO A;  1KDA A;  4U67 3;  4TQU S;  2XVS A;  4P2C B;  3J80 L;  1D5Z C;  4N9T A;  3S1R B;  5LL6 S;  4K6D A;  1YNN C;  2PPB C;  3P7J A;  5IGD A;  4TKO B;  4KMU C;  3HOX B;  3OWE B;  5F2D A;  2ZT9 C;  1HRJ A;  5EPL A;  2M00 A;  5JAV A;  4EQN A;  2F4I A;  2F0J A;  2IX3 A;  1DON A;  4DK0 A;  5BN4 A;  4ID6 A;  2NTS A;  4FO2 A;  1O7Z A;  4FF4 A;  4NDX A;  1SNO A;  3S2D B;  1I4X A;  3MA2 B;  5ELF A;  3I73 A;  3NTH A;  2ICE C;  1PTO C;  5JOB A;  1GUW A;  3NSW A;  3N52 A;  2BDN A;  1WTQ A;  4DN4 M;  2JA6 B;  4LAA A;  2E75 C;  2FIN B;  1F2Y A;  2KUM A;  2HCI A;  4HCS A;  4RWS C;  4IUR A;  3OWF A;  2O5I C;  1HFG A;  1CI3 M;  5G3L F;  1CM9 A;  4NKL A;  3AU7 A;  1F2M A;  3AB9 A;  3HZX A;  1PZI D;  1CA5 A;  2B2U A;  1D6E C;  1NR4 A;  1EU4 A;  5C0X J;  4BY1 B;  3DUZ A;  1SYB A;  3BDO A;  5G3L D;  2XSC A;  1SMY D;  1I6V C;  2JP1 A;  3S17 B;  2D9U A;  1EQV A;  5KNC A;  2PQE A;  1S4Z A;  1U4R A;  4WOR A;  3FMC A;  4RKL A;  1LO5 D;  2FHT A;  4EQO A;  1G2S A;  1L0Y B;  5C4X B;  2F0U A;  2MGS A;  1EY6 A;  3HRZ C;  2LFN A;  3SK5 A;  4HMI A;  1FNW A;  1NUC A;  2KOL A;  1JIC A;  5CGK A;  4R8I A;  5E3F A;  4FP5 D;  1ICW A;  4KY7 A;  2K28 A;  2O4X A;  4DA2 A;  3E6Z X;  2PZW A;  4BY7 B;  3KLR A;  3EVQ A;  5E4W C;  3I90 A;  1LTR D;  3QJY A;  1PTO H;  3MAQ A;  1B44 D;  1KAB A;  4BA1 I;  5IOD A;  3Q0A A;  1EL0 A;  1FNU A;  4K8I A;  2PW5 A;  5M3M B;  3NXW A;  4DU9 A;  3GTO B;  1E2W A;  3C2P A;  3H6M A;  1EY5 A;  5A35 A;  1KTK A;  1PLF A;  4K5V A;  1E2V A;  1WD1 A;  3HOW B;  1KDC A;  2A6H D;  1IW7 C;  4IUT A;  1CK1 A;  1HA6 A;  2LKV A;  2B2V C;  3TN2 A;  4HR7 B;  3L9A X;  4PMB A;  2F0D A;  3HP3 A;  2L9H A;  1JC7 A;  1OXS C;  4F88 A;  4DAY A;  3ND9 A;  3DMU A;  1I6H B;  4KY6 A;  4OIK A;  3P75 A;  3U9O A;  1EZ8 A;  3VR3 A;  2IJ0 A;  3MHB A;  3NTI A;  1V1P B;  3VR6 A;  4A3M B;  3I4L A;  3V96 A;  1B9M A;  1DYQ A;  4I65 A;  4IFD G;  3KLS A;  3K0Y A;  3A8J E;  2CW0 C;  1DXM A;  3I72 A;  5C3W A;  1IYV A;  1HPC A;  2QIL A;  1DJR D;  2R93 B;  1KLU D;  1LTS D;  5ELC A;  1AN8 A;  1BQQ T;  3HOU B;  1HUM A;  1D5M C;  3KF8 A;  5EKI A;  1Q90 A;  1K83 B;  1ESF A;  5D14 A;  5IGF A;  2ENB A;  1HTL D;  2IW3 A;  2JSO A;  2K33 A;  3H91 A;  3OMC A;  1KAA A;  2B8F A;  3OIP A;  3TP8 A;  4HSP A;  4NMZ A;  5HUR A;  2FMM A;  2AWO A;  3IL8 A;  4MHE A;  4ODG A;  4MN3 A;  2OF1 A;  3Q24 A;  2EYL A;  1Y8N B;  3D3R A;  2KHS A;  2RKS A;  1EU3 A;  2BA1 A;  4KN7 C;  1UAP A;  2RVL A;  3J7A V;  3G6J B;  3IFT A;  1SND A;  5EQ0 A;  4DAV A;  1HCZ A;  3W3A A;  1U9R A;  1K8O A;  1B50 A;  4FF2 A;  1SE2 A;  3BS1 A;  2QEJ C;  2YU9 B;  3P20 A;  5IGC A;  2PZT A;  1ENF A;  1HXY D;  1LTB D;  4A3G B;  2EJG C;  5D3I B;  5C4J B;  1SE3 A;  1BCP D;  1Q8I A;  2DY7 A;  1WTR A;  2IWH A;  2M2L A;  2EYO A;  3M3Y B;  3ITP A;  2WII B;  1WTP A;  1QB5 D;  1DCZ A;  3VR5 A;  3GTQ B;  2XWB B;  4HSV A;  2QF7 A;  3OPO A;  2AQ3 B;  1EOT A;  1LT3 D;  1STN A;  1Y1V B;  2XWJ B;  1J9O A;  2AUJ D;  2JE6 I;  3K6O A;  1GJX A;  5KYI A;  1HA5 A;  1V1O A;  4K2K A;  3D8G A;  3RLF A;  4H44 C;  1Z47 A;  4QF4 A;  3DEP A;  1B4O A;  5KNB A;  4DF7 A;  2MPM A;  1NCV A;  3S14 B;  1M8A A;  4A3E B;  4IZ8 A;  1AFP A;  4PMW A;  3H09 A;  2R7Z B;  1ZYR D;  3FDT A;  1SNC A;  4G7H C;  1ESR A;  1Q1B A;  2VNU D;  1A2T A;  4M8A A;  4RCO A;  2WKC A;  1MBY A;  2LMC B;  3H0G B;  4J6H A;  3A55 A;  1GUT A;  2L12 A;  3K59 A;  3GP7 A;  5C0X I;  5C5L A;  3S15 B;  4L63 B;  1PDQ A;  1TWF B;  1LTT D;  2FFK B;  3Q22 A;  3L3O C;  5CV6 A;  3GTK B;  5C4Z A;  2KCN A;  3S2H B;  4CKB A;  1PMR A;  2EJM A;  1TR5 A;  1F9Q A;  3R8B A;  1JWM D;  1RDP D;  4ILW A;  2D2C C;  3A54 A;  3MFG A;  1ENC A;  4RGN A;  4EQP A;  3HEJ A;  4QMG A;  2A6E D;  5FLX L;  5FO8 B;  4RA8 A;  1AZP A;  4OL7 A;  3RUZ A;  1SYG A;  3ERO A;  1SYC A;  2K5D A;  2J7Z A;  2BE5 D;  4ZLT F;  5IGE A;  3GV3 A;  5J1Z A;  2NYZ D;  1S5D D;  5C5M A;  4GZY C;  1A2U A;  3FPU B;  1TY0 A;  5IT9 E;  1VMC A;  2YYZ A;  1C8C A;  1PRT F;  1TS5 A;  3NQI A;  1JOR A;  1LT4 D;  1EY7 A;  3KBX A;  1HQR D;  2G9D A;  4K5X A;  3SE0 A;  5COY A;  2WIN B;  2F0L A;  4A3J B;  2L4N A;  4ZAI A;  3TP7 A;  1PRT D;  1ILP A;  3T13 A;  3SK4 A;  1Q12 A;  2F3W A;  1EEF D;  1GUG A;  1VF5 C;  4DAP A;  4KJO A;  5A2Q L;  4L6T B;  5CC4 A;  2RSO A;  3MXU A;  5FO7 B;  4Q5V A;  2SEB D;  5E1F A;  2HDL A;  3L7Z C;  3RZO B;  1BF4 A;  1FYC A;  2NTT A;  2F0E A;  3BVG A;  2SNS A;  4XYO A;  2Q8T A;  2ZXP A;  1VDZ A;  4XQJ A;  2BOS A;  2JEA I;  4IUN A;  2F0T A;  1LLR D;  3J81 L;  4WFN 3;  1S5C D;  2TSS A;  1O7Y A;  5D3D A;  3JAM E;  4ZKB B;  5BN5 A;  4A3B B;  1X3P A;  2EYM A;  3R93 A;  2SNM A;  4RHR A;  4H13 C;  5J22 A;  1K8M A;  3BVM A;  3PO2 B;  2WV6 D;  4NW2 A;  3N6R A;  4BA2 I;  3SEB A;  5FK9 C;  2EYJ A;  3VA5 A;  2PO4 A;  5DAU A;  1HQM C;  2EDG A;  2XNA C;  1F77 A;  2FMC A;  4FF1 A;  4H0L C;  2R3Z A;  1SEB D;  4KV6 A;  1ZKO A;  5CV8 A;  3MWY W;  1MGS A;  2QKI C;  3Q23 A;  5JVG 3;  3VYS A;  1R4P B;  2E2J B;  3S1M B;  4EGV A;  1U4P A;  3U9S A;  4HED A;  4B9W A;  2KVM A;  3WOF A;  4IN3 A;  2X6L A;  2NB0 A;  5I4D A;  2B2V A;  3NE5 B;  5I6W A;  2RQX A;  1OXU A;  1PFM A;  2EY6 A;  2WB1 B;  3R3O A;  5T1G A;  2X6G A;  1TII D;  2OXP A;  5C6A A;  1WTW A;  1Y1W B;  1F2Z A;  5DEH A;  4BS9 A;  5IOC A;  1AW7 A;  2F0H A;  5BN3 A;  2F03 A;  2ID0 A;  2SDF A;  3T56 B;  3ERQ A;  4C1N K;  2O5J C;  1U4M A;  4IUP A;  3GQB A;  2A68 C;  2F1M A;  1Q3L A;  4LK1 C;  3PUY A;  3X3N A;  1GUN A;  3TZU A;  4X3U A;  2IT1 A;  1LAC A;  1WTX A;  2NUC A;  5FOB B;  3QWN A;  2A69 C;  2WP8 J;  4QIW B;  1G29 1;  2E76 C;  4ZUJ A;  2MHV A;  4J8Q A;  4C56 C;  3MEH A;  1BCP C;  1ET9 A;  1EZ6 A;  3QOL A;  3W2D A;  2EPB A;  5KIX A;  4KJN A;  3QB3 A;  1SNQ A;  3VR2 A;  3CHB D;  3CU7 A;  2H1E A;  4G57 A;  2NVQ B;  4KKT A;  2PW7 A;  1QIL A;  2NN6 I;  4K2L A;  3O13 A;  4LJZ C;  3A7L A;  4C3I G;  2DY8 A;  5I6Y A;  5FO9 B;  3DEO A;  4X3S A;  1D5X C;  2X69 A;  2EE1 A;  1OXV A;  2EJF C;  4ZRZ A;  5C0X H;  5LL6 X;  4A3F B;  3PIO 3;  1VMP A;  3K5N A;  4Y7N B;  2KQ3 A;  2RSN A;  3NQT A;  2PZU A;  2JA5 B;  2EYF A;  1BO0 A;  2IPK D;  3D31 A;  1BCP B;  1IKL A;  1I3Q B;  5IIF A;  1LAB A;  1F9R A;  4R9W A;  1MSH A;  1CFM A;  1KLG D;  5COR A;  4B9X A;  1ILQ A;  3PUW A;  1B1Z A;  3PUX A;  3I70 A;  1CQV A;  4PNY A;  1PTO F;  5EPJ A;  4F87 A;  5ISR A;  3C1F A;  1DOL A;  1HUN A;  4F7X A;  4DNT B;  2EY2 A;  1F9S A;  3IAY A;  3FKI B;  1SYD A;  2OT2 A;  4DFA A;  4IAL A;  5HGT A;  1PTO D;  5NUC A;  1H9S A;  1MD2 D;  1TWH B;  1VF7 A;  2BE5 C;  1SBB B;  4XQQ A;  3MFY A;  3OHX C;  2SOB A;  3C46 A;  2IX0 A;  4C3H B;  2K01 A;  2C9O A;  3PO3 B;  3FRP B;  2ICI A;  3GTJ B;  2EY1 A;  1UNS A;  2XIW A;  3HG9 A;  5IGB A;  3KLS X;  1HTP A;  4BBS B;  5JEA G;  4KN4 C;  3R2I A;  3QO2 A;  2DNE A;  3NBI A;  2QCP X;  5D65 A;  1KNE A;  3RD4 A;  2N88 A;  1SXT A;  4CKE A;  1IYU A;  3E0J A;  2NN6 G;  2NZ1 D;  3C1E A;  2MUY A;  3K58 A;  2N55 A;  1JR0 D;  2K7V A;  3LNN A;  4ZUI A;  2XN9 C;  4RGT A;  5FKA C;  4OO1 I;  4PMC A;  2F0M A;  1DM0 B;  3I8Z A;  5DM7 3;  3A56 A;  5I9O A;  1SJH D;  2L1B A;  1LV9 A;  1FNV A;  1A3V A;  1JCK B;  2E2D C;  1WTV A;  1B2T A;  1ENA A;  2L0C A;  4IFD J;  2F0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...