1U9RA

Crystal structure of staphylococcal nuclease mutant v66e/p117g/h124l/s128a at room temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Stabilization of internal charges in a protein: water penetration or conformational change?
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u9rA00
3C1EA 1RKNA 3MZ5A 5KGUA 5JAVA 2SOBA 3SK5A 4KD3A 4ZUIA 2WACA 1SNQA 5F2DA 3SXHA 3TP7A 3SK6A 1KDCA 4HMJA 3SK8A 3QB3A 2F3VA 5I6WA 5CR3A 3NHHA 3T13A 5NUCA 2O4XA 5IGBA 1SNOA 4PNYA 2F0EA 4NKLA 5C6AA 5C4ZA 1AEXA 2F0VA 2F0TA 3EVQA 4EQPA 5I9PA 3TP5A 2RDFA 1JOOA 2EYLA 2SNMA 4OL7A 1EYDA 5M9OA 4ID6A 5E1FA 1EY4A 1JORA 5C3XA 4KHVA 4KY6A 5CV7A 5DAUA 4N9TA 1SYFA 5JOBA 3TP8A 3D4DA 3D6CA 1A3TA 5CV9A 3TMEA 1KAAA 2PZWA 5CV4A 5KRUA 4I65A 1TR5A 2F0JA 2OXPA 3D4WA 4DGZA 1EY5A 2F0SA 2F0WA 3C1FA 2RKSA 2EYPA 2F0FA 3MVVA 2EYHA 2M00A 2EY1A 5KEEA 4PMBA 2EYFA 3DHQA 2PZUA 3EROA 4IUNA 1KDAA 4J1MA 1A2TA 2F0HA 3OSOA 4ZUJA 2NUCA 2F0UA 4B9WA 5IODA 4F7XA 3EJIA 1EY6A 2F0NA 1A3UA 3NK9A 4K5VA 4IZ8A 1KDBA 4WORA 5I6YA 3LX0A 2OEOA 2RBMA 5EGTA 4DF7A 4QMGA 4NP5A 1STYA 5CV6A 1ENCA 1EY0A 4NDXA 5K5PA 1F2MA 2F0OA 4KTAA 1IHZA 4KJOA 4KY5A 4EQOA 3P1HA 5CC4A 3NXWA 4KJNA 5I9OA 1SNCA 1A3VA 2QDBA 1NSNS 1KABA 2EYMA 2PW5A 2F0PA 2SNSA 1EY9A 3QOJA 4KD4A 4KV6A 4K8JA 3SK4A 3T16A 4K2LA 2PZTA 5HGTA 3ERQA 1SYGA 4NMZA 4H7BA 4WRDA 4R8NA 4QF4A 3S9WA 2F0IA 1SYEA 5E3FA 3NP8A 5J1ZA 5C4HA 1STBA 4K8IA 3E5SA 2EY5A 4S3SA 3VA5A 3RUZA 5C3WA 4K5WA 4MIUA 2EY2A 2EYOA 1NUCA 3NUCA 3PMFA 3HEJA 4K14A 4KY7A 3TP6A 2PQEA 3DMUA 3MHBA 4F8MA 3R3OA 5IGCA 5J39A 1EZ8A 3D8GA 3SR1A 3MEHA 4EQNA 3MXPA 5IGFA 1SYDA 1STAA 5KYLA 2PYKA 1JOKA 1F2YA 3BDCA 4G57A 5IGGA 4N9PA 1EY7A 3ITPA 1SNPA 5IGDA 5KYIA 5J22A 4E6IA 1SYCA 3HZXA 4J6HA 1TQOA 1EYCA 4ME5A 4RKBA 1STHA 2F0KA 2F0LA 3OMGA 2KHSA 3V2TA 4B9XA 4DFAA 2F0MA 5C5MA 4DU9A 3BDLA 4K6DA 5KIXA 3H6MA 4IALA 4EVOA 4QB4A 4HTHA 4PMCA 5EKLA 1EYAA 2F0QA 2F0DA 5CGKA 4LAAA 5DEHA 2PW7A 5ISRA 3OMCA 1SNDA 2ENBA 2EYJA 3QOLA 1F2ZA 1TT2A 5EKKA 4RKLA 5HURA 4ZQ3A 1U9RA 2OF1A 2EXZA 5IIFA 4ODGA 1EZ6A 5IGEA 5CV8A 3SHLA 1STNA 4HMIA 5CV5A 1A2UA 1EY8A 1SNMA 1SYBA 2F0GA 2F3WA 4K5XA 4TRDA 5C5LA 3OWFA 2HQEA 2EY6A 5IOCA 1EQVA 1ENAA 1II3A 4YIJA 1STGA 2KQ3A 2LKVA 1JOQA 3P75A 4K2KA 3NQTA 3U9OA
chains in the Genus database with same CATH superfamily
1VQAA 1TY2A 2B2TC 3ZJYC 3K80C 2KCNA 2N78A 4DUYQ 2D0OA 3JAME 4WJ4A 4ZCKA 4OWWB 1D5MC 2IPKD 3AMUA 4OELB 1CM9A 4A4IA 5C6AA 5IYDH 4P74A 1UWVA 3BG3A 3TZUA 2FFKB 3PO3B 3CCRA 3TP8A 1X56A 5FO8B 4X3KA 1AZQA 1XNRQ 4R4CA 4TVAB 1TR5A 2PPBC 2ZTCA 4POFA 4DGZA 4X64L 2EE1A 2RKSA 3S1NH 1HZBA 4QJFA 1U4LA 3PUXA 3E6ZX 4R9WA 1B3QA 1K3RA 1I6VC 3KLSX 4O0AA 3S1RB 3S14H 1UE5A 1QCBD 4PZ8A 3VYTA 3S17H 3K8AA 5JEAJ 2R3ZA 1KDBA 1XYIA 1JJGA 3S2DH 2DN8A 1CUKA 4ULLA 1XPRA 3LWEA 1GXDC 4BWGB 1SE3A 2B2YA 1PTOH 3P1HA 3CCVA 4WJ3M 4M8AA 2J7ZA 2ICIA 1QNUA 4HJ8A 3QR8A 2WFWA 4G7HC 3GTJB 3RUZA 4OO1G 5FO9B 2OQKA 1QJOA 5IYBH 4DAYB 2YTYA 1FD7D 2BA0A 3CC4A 4NXML 5M3FB 2E5LL 4IUUA 4XYOA 4MZ9A 4IALA 2JYOA 2R6GA 4TSSA 4A3DG 2WV6D 1LV9A 1FR3A 1KLGD 2E76C 4A3LG 2Z4HA 1D6EC 1T5EA 4Y7NB 3HOZG 2O5JC 5EKKA 4JI0Q 4A3JH 4K0KL 3SEBA 1EZ6A 2YTVA 3HOVB 4H44C 1CKMA 3WDNA 3AEVA 1PMRA 3ULPA 2A69C 1S72A 3K5LA 1M90C 4ZKCB 1VDZA 1RCVD 4DR7Q 3ERSX 1I4HA 4DV1Q 3HOUH 4OIJA 4DAPA 2DY8A 4PNYA 3R2IA 1ILQA 1WTPA 5A2QE 1HNXQ 4NW2A 1PZID 3KBGA 4KHVA 4DV6Q 2R7FA 4IPDA 5A35A 3M85A 1UE1A 1KAAA 4Q0FA 1E22A 2RCFA 1YEZA 2F0SA 1TWAH 3CC7A 1CA6A 4QUFA 3L9AX 3MVVA 4DV4Q 2HDMA 1YHBA 4GNXC 4DV0L 4JI4Q 3X3MA 1X3FA 1A2TA 5IODA 2F0UA 3VR6A 2A5HA 4BY1B 1YJWA 1LTID 2IHEA 1DXMA 2C35B 2X69A 1Q82C 4IZ8A 2VUMG 1HFGA 4UY8C 5CMDA 1C48A 1MSGA 5LHY1 3M4YA 3NXWA 2KA7A 3PGZA 1J5EL 3H0GH 3NBHB 1I50B 3CHBD 3J7AV 4DR2L 4JI1L 3K81C 4RGTA 3S15H 2JA5G 2R93H 1XTDA 3A7AB 3OW7A 4C3JG 3I2ZA 3GTKH 2EYOA 1MJCA 4DV2Q 3S2HH 5CBEE 5LL6X 2CH4W 3OIPA 1Z47A 3H15A 3CPWA 3MTSA 4JI5Q 2Y0SG 4HJ7A 2AQ2B 3MXPA 3D3RA 1IZ6A 4A3FB 3L0OA 4X3UA 1JMCA 3CW2C 2JSOA 3ULLA 1TWGB 2E75C 5IWAQ 4IUQA 4K6DA 3W1BA 1TVXA 2WB1E 3OIQA 3AQQA 3J81L 1H9SB 3BZCA 1UE6A 4L5QA 5EBCA 3RZDH 3QOLA 4RKLA 2DGYA 1Y69U 3UI2A 1YITA 4DPGA 3G4SA 1SYBA 5C3EH 1FJGQ 4XQQA 4DNRB 1Q3LA 2BA1A 2YV5A 1PZJD 3FVQA 3IFTA 4IUTA 4X3TA 1PH3A 4A3BG 1Y8OB 1KLUD 2SEBD 4JPBW 1A6XA 2L1BA 2KHIA 5JAVA 1O7ZA 1GUGA 1HH2P 1SLJA 1EIYB 1DD2A 1TIID 3GQBA 1YBYA 2AKWB 2F0EA 1GJXA 2Z6KA 5H1SE 5C4ZA 3J81c 2ZXRA 2R92G 2ZXPA 3PO3H 3KF6A 3GTQB 4OL7A 3T1HL 2WKDA 5E1FA 3HKZB 5DNFA 2NVTB 2G5DA 1YZ6A 4JW0A 3T1YL 4K6LA 4H02A 1AZPA 4NPSA 3KLSA 4BXXG 2I46A 2EY1A 3S1RH 2VXWA 4IUNA 4V0BA 4IPCA 4KHPQ 2A6HD 4MTKA 5DM63 1L0YB 2NZ1D 1WYDA 1EY6A 2KENA 3EFXD 3HFZB 3J81i 5ELEA 5FLMH 5EGTA 1STYA 4RCNA 1LM0A 2ZM6L 1XTCD 1A8VA 2MUYA 1YNND 5ELBA 2XVSA 2UXBL 4AQYL 4HJ9A 2LFNA 4JBJA 2QA4A 3W3AA 4IOCA 2Z8LA 3GTJH 4LF6Q 4N8FA 1I4XA 4A3EG 4OX9L 4FP5D 3VA5A 2HD3A 2I07B 3R3OA 4LUVA 1GUTA 1Z6HA 2VW9A 4A3KB 1BUVT 1VQIA 1SDFA 4KKTA 4A75A 5KYIA 2ZJPA 2B39A 2QKIC 5J3BA 2A68D 3OMGA 2KHSA 1WFQA 4JI2Q 4DR5L 4DR6L 1B53A 4IFDH 4Y7NH 1GUOA 3P20A 5D3IB 1DGSA 2ZJQA 2EYJA 1VMCA 5M5WB 1IW7C 2NN6H 2HQLA 2RCNA 1I94Q 1CA5A 1HNZQ 3HOVH 2WAQE 4GNXB 3RZOB 1UUPA 2H1EA 5IT9L 1L1OC 4P2CB 2HT1A 4LF8Q 1UEAB 2MP1A 3K7AB 3NEMA 3UDXA 5I6WA 1IBKL 1S4ZA 1NBWA 1TWFB 4L5TA 3HOXG 2WACA 2N49A 2KEDA 2RQXA 1PYBA 1E3PA 1S5DD 1QZHA 5NUCA 1D1IA 3I8ZA 1R9TB 2TSSA 2WIIB 1EIGA 1FYCA 3TP5A 3QJYA 3EN2A 1SMYC 2H4OA 1BO0A 3NBIA 1PYWD 1A3TA 3Q23A 2PZWA 3L3OC 2F0JA 5IT9c 2WAQB 4IO9A 1KNEA 1RTNA 3CC2A 3CCLA 1KL9A 5EAYA 1KDAA 3FKIG 1HCZA 1A63A 1JJ2A 1F9SA 1HZ9A 1Y14B 3DWQA 3KJPA 4G7ZC 5K36H 4OIKA 4C2MB 1IBLL 2UUAQ 3P7JA 1D5ZC 1CT1D 1K3BC 1I50H 2IL8A 4PZ6A 4DUZL 1YJNA 1NSNS 4O42A 3QO2A 2RDHA 1SEBD 1J6QA 2OCEA 2RA4A 1B70B 2QF7A 1GUNA 1LTTD 3W5OA 3C2PA 4OONA 3GTMB 1CSPA 1ONLA 4A3FH 2FJ2A 2D2CC 4BBSG 1EY7A 1SNPA 1TWGH 4CJ0B 1M1KC 1VS0A 1WVLA 1X54A 2F0LA 3C3LA 1GUWA 1JWMD 2B8FA 4QUCA 2AUJD 2X6LA 1RF2D 4Q5VA 2AHOB 1PH8A 2XNAC 2RHQB 4X62Q 1CSQA 1PH2A 3W2DA 3EIVA 2L9HA 1N34L 3A54A 2A68C 4DNTB 1EY8A 4LUOA 4FYDA 4QQBX 2NBFA 4F87A 4A93B 2E2HB 2QEJC 4XXEA 3ER0A 1HTPA 1F77A 3G71A 3TP7A 1BR9A 5IP9H 4JI3Q 1RDPD 3BZKA 3NHHA 4C3HB 3K0YA 1KRTA 4A3GH 5DLQE 1QNKA 1VQPA 3GTQH 5AJ3L 3OHXC 5D3DA 4J15A 5EPLA 1BVSA 4RA8A 2NVTH 2Q8TA 1LABA 1DCZA 1H9KA 3TSSA 3EBEA 3DM1A 4DV5L 4KI0A 2WINB 4CHTB 1Y1VG 2A6ED 1XPUA 1DOMA 2PZUA 2BCOA 3PUWA 4Z9CB 3R93A 4F7XA 4B08A 3I4NG 3NWTA 3KDFB 1HNWQ 3CCQA 2NZOA 4KY5A 4L8JA 5CC4A 4EQ5A 1PFSA 4GN5A 4BBRB 5HGTA 5GAHC 4RGOS 4QF4A 3S9WA 1HZAA 3NP8A 1I6HH 4C3IG 3NTHA 1G51A 1TKWB 2MO1A 2EY2A 3C46A 3PMFA 5E7NA 5JEAG 4A3KH 1BXTA 1NJIC 1YVCA 4YWLA 4X64Q 1KQSA 2NWGA 2CKZB 1L2FA 1S5CD 1N33Q 1RL2A 2CW0C 4GKJQ 3V2TA 1XJVA 5JJLA 1LUZA 4QB4A 3BJUA 5DEHA 1JJCB 4BY7G 1M4VA 2JA7B 1EQTA 1JE5A 5M5WH 5M5XH 1JICA 3I55A 2D9UA 4FXGC 4OWXB 3RNUA 3RZOH 5LMUL 1XMOQ 1NE3A 5ELCA 4JYAQ 2VZAA 1VQ7A 3GO5A 2Q2IA 4A3IB 3CCSA 2DUDA 1STGA 3I73A 2EOTA 4IOAA 1TWFH 3U9OA 1RKNA 4LFCQ 2F4IA 4DR1Q 3CAMA 1B1ZA 2E2JB 3MAQA 5K36G 1R9TH 1WTXA 4GKKL 2E5LQ 2LY7A 3S1QB 4PG3A 4WFN3 4A3MG 2PCFB 2PNRC 4B3RL 1M8AA 4LF7L 2B63G 5KRUA 3F2CA 3CRLC 2RSOA 3ND9A 1LTLA 3HKSA 1C8CA 3PO2B 2OXPA 1LTBD 4K0KQ 3I4MG 1EOTA 1VQBA 5GQOA 1VQ9A 3EA6A 1VQKA 4LFAL 1Z9FA 4CDCC 1PFMA 1WCMG 1IL2A 2UXCL 2Z1CA 1EYGA 1NTGA 1AH9A 3CCEA 3M3YB 3HOYB 3IFDA 5M3MB 2A6EC 2EPBA 2Z6KC 2JA9A 1PFNA 4IFDJ 3U58A 3H91A 3HG9A 2ALYB 5IGFA 3J80c 2QILA 1MD2D 4PZ7A 1V1PB 2CH4A 4U68A 1PA6A 2UXDQ 1STBA 3FHWA 1NY4A 4JOIA 4MIUA 2LSSA 3GTMH 1RIPA 2IT1A 4GN3B 2B2WA 2PQEA 1ET6A 1LLRD 2HHHL 3VA7A 4JCVE 2K5VA 4QCLA 2I5LX 1AE3A 1E1OA 3K0XA 5IP9G 1AW7A 4FVMA 2HUGA 1MHWC 2WB1G 3J80i 1N8RC 2A73B 2MGSA 4HTHA 3JAML 4A3GG 4LFBL 5D14A 5CGKA 1H9JA 1HR0Q 3CCMA 4KLKA 4FXDA 1H95A 4ZQ3A 1ET9A 2CVRA 1YI2A 3I4OA 1J5EQ 3UDIA 4DR2Q 1OO9B 2F3WA 2K28A 2JA6B 2JA8B 2E2HH 1KXLA 1VF7A 1ENAA 1J8IA 4IFDI 3P75A 3I56A 4K2KA 1V9PA 1PVOA 2K01A 4ZYSA 4GOPA 2UU9L 1VMPA 4APVA 5LL6S 1EWIA 4RHRA 2Q8IB 4C3HH 3EQLC 2NN6I 5IGBA 4A76A 5JPMC 3JAMc 4NKLA 2KECA 2KOLA 3E0EA 2AQ3B 1K28A 4EQPA 3SVMA 1N36L 1Y1WB 2LS01 1K0SA 3F2BA 4RH6A 2EYLA 2SNMA 4UP7A 3MXNA 1SYFA 1CHPD 1N32L 1BCPC 4RHSA 4R4TA 1EY5A 1EU4A 2E74C 5AFWA 1H9MA 1SXTA 5IY0A 1DOLA 4PV1C 1WD1A 4DR3L 2NUCA 4UP9A 2AMCB 3QG1A 3JAMi 2F4VL 2XRSD 3X3NA 3Q6SA 3A55A 2R7ZB 2EJMA 4ZAIA 4EX5A 5K5PA 2N8NA 4AYBG 5I9OA 4X66Q 1SNCA 4BBRH 1HUNA 2O5IC 5IP7H 1EY9A 3HS0C 3KF8B 3T1HQ 4GLXA 2EY5A 1SFOB 3HEJA 2XTIA 2XRQD 1DJRD 2CHBD 1B9MA 3GTGB 1H9RA 4G7OC 1FGUA 4U673 4DXFA 5COYA 3HOWB 4YY3Q 1VQ5A 1SYCA 3GV6A 4GS3A 4RKBA 3Q22A 4DFAA 1IBMQ 3LGJA 3TBIB 1JT8A 1FNVA 4DK1A 2JA7H 1EFWA 1SMXA 2F0DA 1ESRA 3KUPA 3MWYW 2ZM6Q 2CFMA 2UXBQ 1NR4A 2J0TD 3ZYYX 5A2QL 1G6ZA 5IGEA 1CK1A 2IX0A 3NTIA 1TS2A 2L0CA 4A3IH 3BYTB 5C4XB 4YIJA 3FMCA 3OWEB 4OWTB 2AQ1B 1IW7D 1S40A 1X3EA 3CMAA 2N3SA 4JG2A 1E0BA 2E8GA 3FDTA 5LMNQ 3M4OB 1G2TA 2E2JH 5IYDG 1HHVA 2B63B 3SXHA 1QZGA 2K5DA 2K4KA 5FO7B 5C44B 2X6GA 1BQQT 3U9SA 3S1QH 1V1OA 3HKZE 1AEXA 3TZDA 1D8LA 1C0AA 1NAPA 1EOVA 1GO3E 2K52A 3URYA 4YHHL 1GUSA 3I7FA 4LJZC 2M2LA 4ZK9B 4PQXA 3IAYA 3MEFA 1EY4A 1GKHA 5CV7A 3PO2H 4JI0L 3D6CA 1HFNA 5CV9A 2UUCL 2XIWA 3TQYA 1SMYD 2EYHA 2DJFC 1Q81C 2N88A 3V05A 2BH8A 1IKLA 3ND8A 1YHQA 1LTRD 1GD7A 2NVXB 1OXUA 1A3UA 1NR2A 4DR7L 2YTXA 3M3YH 2JE6I 2RBMA 3PUYA 3HOYH 2MPMA 1CHQD 5M3MH 1EY0A 4NDXA 1XX8A 5TSSA 3A8JE 3D0FA 1IYUA 3ONAB 4QY7A 1ZXTA 1B7YB 4O2DA 2PMZB 3FP9A 3M4PA 1HNXL 2Z9HA 1AE2A 1E7ZA 1ZYRD 1I4GA 1H9SA 2IJ0A 5E3FA 1JC7A 3K6OA 5IYBG 2EDGA 5C3WA 3TREA 4JBWA 4OO1I 2K05A 2MHVA 2RF4A 4R1JA 1P16A 3MXGA 1ESFA 4DV4L 4IQZA 3S1MB 2N55A 4JI4L 2JEAI 4LF9Q 3OTOL 4R8IA 2K33A 3O13A 2KVMA 3PUVA 2VQFQ 4GLVB 1RD9D 3MA2B 1BF4A 5DM73 1HJPA 1XWEA 3Q0AA 3H3VC 3TEHB 3IL8A 4MN3A 4A3JG 3GTPB 3ICEA 3CU7A 4H0LC 1WD0A 1A0IA 2P5ZX 2UUBQ 2A1AA 3DM3A 4DUZQ 1O80A 4A3DB 1OXTA 5ELOA 5IIFA 4FF4A 4KKUA 3QWNA 1I4QA 5BN3A 2JA6H 2JA8H 2VB2X 1ZKOA 5FJ8H 3NSWA 5JVH3 3HOZB 3KLWA 3Q24A 5IOCA 4JI7Q 3GTLB 1DYQA 1II3A 1F2LA 2VY3A 5M3FH 4DV2L 3HOUG 1EQRA 4JI5L 4AIMA 1NCVA 2PQAB 3SK5A 1QVCA 4ZUIA 4CGYB 1O7IA 3B6YA 4JI8Q 4HAEA 1UNSA 2JEBI 1GHKA 4YCVA 3SGIA 5C0XH 1Y1WH 5IWAL 3A5ZB 4IPHA 3PV0A 3PF4A 2PI2E 3FPPA 3KLRA 1FVIA 3DEPA 2CWPA 4R4OA 1EYDA 4HSVA 1FL0A 5M9OA 3HRZC 1D7QA 1S3OA 4N9TA 2K32A 3D4DA 4UP8A 1WTOA 5CV4A 3FPUB 5D65A 4DV3Q 3TN2A 4JBKA 3D4WA 1XNQL 1HRJA 3GD7A 4JC0A 2NVYB 1N34Q 2EYPA 4IUVA 4I7ZC 4DK3C 5IYCH 4UHVA 4X65Q 4C56C 3PIPA 3NTKA 1DOKA 4G4KA 5L37A 3NENA 2EYFA 4DV7Q 3DHQA 4CJ2C 4FNFA 1ZEQX 3CQZB 2A19A 3OSOA 1WTVA 3PF5A 1PDQA 2R7ZH 3NK9A 2BDOA 2BDNA 4DF7A 4NP5A 2LMCB 1PRTD 3H0GG 1W2BA 2BE5D 2EQSA 2R93G 1XMQQ 4LUZA 4BA2I 3K57A 4A3CH 2OT2A 2SNSA 3L7ZC 2VUMB 3VR5A 5AJ3Q 2OQ0A 3PQIA 4JI6L 4DR4L 4H7BA 1TY0A 4XT3B 1CKOA 4MHEA 1UEBA 1CQVA 2BOSA 1SFOH 4BY1H 3E5SA 3I91A 1CKNB 3GTGH 1W6JA 2JJQA 1HR0W 3D8GA 2JA5B 2JXMB 1QE6A 4C3JB 3HOWH 1B8AA 4LF5Q 4KHPL 1W3SA 3QIAA 2DNEA 1ZYRC 1V1QA 2EIFA 2QGQA 1CFMA 1EYCA 2RSNA 2Y0SB 2EVBA 2VQEL 2RVLA 3I90A 4B3SQ 1LT4D 2XGTA 5EKIA 1ICWA 2CQOA 1SSOA 1Q8IA 3DWPA 1Z7TA 3AU7A 1PH6A 2CW0D 3OMCA 4P75A 3M7GA 2M9VA 4RFBA 4HIDA 2K6AA 5C3EG 2KJXA 1LT6D 5M5YB 1OXSC 2A74C 3SHLA 5C4XH 1A2UA 4RWSC 2I5MX 2OTJA 4JOIC 3K59A 1IL8A 1LT5D 3G48A 2B2WC 1TU2B 3SE0A 2PI2A 3VYUA 4XQJA 4P73A 5JJKA 3F2DA 5C44H 5GROA 3SK6A 1KDCA 3IRBA 3PO3G 4A3BB 4IURA 3T13A 2B2YC 1HXYD 2O4XA 3S14B 4IUPA 1JE4A 2WKCA 2FINB 1MSHA 1JOOA 3H94A 4FO2A 3LNNA 2H5XA 3RMHA 2IX3A 2R92B 2OWOA 1WI5A 1WTRA 1HNZL 1I94L 5LMUQ 1U5KA 4DA2A 3U50C 1T5XD 5FLXE 2NVXH 1G91A 5FLMG 1AFPA 4LF8L 1EU3A 5KNDA 4NXNL 2FMCA 1SJED 2B29A 1E2VA 4GOPC 4B3TQ 2YYZA 3A8KE 5I6YA 4QMGA 2L12A 4P71A 3K5OA 4LF4L 3PIP3 4DAMA 4M1UB 2ZXOA 4ILWA 1PH4A 5BR8Q 1C7YA 3I70A 3KJOA 4LK1C 1JWSD 5IGCA 4K8IA 2LXJA 1PRTC 5T1IA 3NUCA 3DMUA 4XQNA 2FMMA 1E2WA 3S1MH 2BE5C 5M3FG 4A3EB 2ASBA 1TWCB 1SYDA 2Z6BA 4OO1H 4BS9A 1DM0B 4HN7A 2K7VA 2DJGC 2D62A 4IFDG 4LFAQ 3HZXA 1CZWA 5EQ0A 1ASYA 3AFPA 2CCZA 3GTPH 3E9HA 1EYAA 1SJHD 5HY6A 2UUAL 2HIVA 3M4QA 3N6RA 4LAAA 2NN6G 5ISRA 2K5WA 2DY7A 1I4RA 1L1OB 3HOVG 3GP7A 2C5CA 4A3DH 5LMNW 4NB3A 3GV3A 2G9DA 4A3LH 5CV8A 1YHAA 3HOZH 5CV5A 1SNMA 1YNJD 1QUQB 1NMFA 1VQEA 1G6PA 4OEMB 1VQHA 3VYSA 5KGUA 2SOBA 4DK6C 1K8OA 4KD3A 1WJJA 1HA6A 4GN4B 1SNQA 4HMJA 3SK8A 4DNIA 3M7NA 5CR3A 1VQ8A 1SNOA 1ICFB 1X32A 4YCUA 1EQQA 4JV5L 3HOXB 3CP0A 3CRKC 5I9PA 3STBD 2JN4A 1XPOA 4ZKBB 1JCKB 1VQ4A 3J7A5 5FOBB 4X62L 2K03A 4B3ML 3K7AH 1K83B 2NVYH 2NZHA 4BY1G 1W6KA 3Q8DA 2F0WA 4QIWE 1HUMA 3CQZH 3RR5A 1BCPD 1G291 3TS2A 4C1NK 4NXMQ 2OEOA 4CBVA 2UU9Q 1NNXA 3FKIB 1F2MA 1KAWA 4JI3L 1BKBA 4KTAA 2QCPX 1PRTF 1QG7A 3J80L 3DLLA 3NE5B 2VUMH 1VQFA 2YU9B 1A3VA 2XWJB 1N36Q 4K8JA 1S5FD 2C9OA 5CORA 3T51B 5E4WC 4R8NA 2KCMA 3OW2A 1SYEA 3UE0A 4A3FG 2V1CC 3NWSA 4OGQC 4QIWB 2JA5H 1STEA 3TS0A 4C3JH 3OYYA 4C2MH 1PV4A 4WJWA 1EIHA 5HGQA 4HJAA 1BBXC 1QOHA 1ENFA 1BOSA 4E6IA 2ZTDA 1PYSB 2Q2HA 4ME5A 1NMGA 3J7YW 2K5HA 4B9XA 3KBXA 4DU9A 3BDLA 1VQJA 2K1BA 4RGMA 4EVOA 4BBSB 1TS3A 2Z0SA 1HNWL 5JJIA 2B3GA 5C0XJ 1PH9A 4LW1A 2ENBA 5M5YH 4CJ1B 3A7LA 2I0QA 1B3AA 1DZ1A 4KK7A 1U9RA 1Q7YC 5C4JB 2GA4B 4OHJA 4ME3A 2O2LD 2RHSB 4FXKC 4H13C 4DV0Q 2HQEA 1IYJB 1PH1A 1JB3A 4YWKA 4GOPB 3C1EA 5GAGC 1IKMA 4A3BH 3BU2A 1JR0D 1LTAD 2QDLA 1EWCA 2Q8RE 2XN9C 5T1GA 4CKCA 2MQHA 3I3CA 4DN4M 1N33L 1YNJC 1BNZA 1LTSD 3HKZG 5BN5A 4GKJL 1K9MC 1EEFD 3EVQA 1ML0D 2K14A 3MXNB 4JI1Q 1PFBA 2NTTA 1WOCA 2R92H 4A93H 1PXUA 1Q1EA 1PRTB 1VQNA 3U4ZA 3FEWX 1XMOL 2PO4A 1PLFA 4JYAL 2E2IB 1V1PA 5JJZA 2J4XA 1A62A 5C0XI 1SROA 1SBBB 4B9WA 3STBC 4ZUJA 4BXXH 1C9OA 3D6WA 4L63B 3H3VH 4K5VA 4HR7B 4LFCL 4HCSA 3VDYA 1Y1VB 4DR1L 1S5ED 2CWAA 1D5XC 4J8QA 1JWUD 3F8TA 2L55A 4FF1A 1LYLA 1VQMA 2IY5B 4KJNA 1U4MA 3I4NB 4Y52H 2PW5A 4KD4A 4YHHQ 4A3KG 1SYGA 4CDEC 3NELA 3HP3A 2RDGA 4K5WA 1KC8C 1VQDA 2UUCQ 3NPPA 1YIJA 5J39A 5GAEC 4A3EH 1J9OA 1UE7A 1TWCH 2NVQB 4JVZA 1KRSA 1X3QA 4DUYL 4C3IB 3RLFA 4DAYA 2VNUD 4LMQD 4N9PA 3UE1A 4HEDA 1PTOD 4J6HA 1E1TA 3CPFA 3GDEA 2NTSA 5EKLA 2B2UA 3D31A 1X65A 3D4RA 1XNRL 3KFUA 3T1YQ 1U4PA 4HCEA 1TWHB 1STNA 2PNHA 4BY7B 2SDFA 4TRDA 1HQRD 3R2TA 2UXDL 1KHIA 3OWFA 2EY6A 1EQVA 4CDFC 5EJWA 3T53B 3IKJA 1JOQA 1QB5D 1B2TA 2B2VA 2QEXA 2F1MA 3I4LA 4L5RC 5CYUA 3MXUA 1IYVA 3ULJA 3OTOQ 3TDQA 2L5TA 2HCIA 3J81E 1Q12A 3HOXH 3TRZA 2MNAA 4AQYQ 2WAQG 1SE2A 3RLNA 1K8MA 2V4DA 2Q2UA 1HR0L 4ID6A 1Y8PB 1K83H 5C3XA 4OX9Q 5EBDA 4PMWA 1K8AC 4A3MB 3MFGA 1SE4A 4RG1A 2NYZD 1QVFA 1SRUA 4F88A 4DKAC 5G3LD 3KK7A 2DNCA 3KF8A 3BVZA 1BCPF 1G2SA 3OPOA 3WWVA 3I4MB 1Y8NB 2VB3X 3KF6B 3FKIH 3LX0A 4DR5Q 5CV6A 4DR6Q 1ENCA 3F2UA 2PMZE 4RCOA 1KNAA 1B4OA 4KMUC 2YU9H 1WCMB 4EQOA 1SN8A 1VQ6A 3S16B 1BBWA 1P8LA 1U0LA 2EYMA 2F0PA 3QOJA 4YCWA 3SK4A 1WTQA 2EXDA 3DWAA 3NBHA 1GOZA 3E3XA 2KBNA 5C4HA 3V96A 1F9RA 1MBYA 1CTMA 3AFQA 4HIKA 2KCTA 3BVGA 4F8MA 1XNQQ 1EZ8A 2XSCA 1IBKQ 2B2TA 4EQNA 5CBAE 1STAA 2GVBA 4DV1L 1VQLA 1QVGA 5J22A 1JB7A 1I3QB 3A74A 1X55A 4MNOA 3PIOA 1STHA 1MJEA 1LACA 4BBSH 4XT1B 2R61A 1G8ZD 1JQYD 1PH5A 3H6MA 2AWNA 5EPJA 2F0QA 1SE8A 2K50A 4JK1C 2VS1A 2PW7A 4DV6L 4X66L 5C4JH 2WB1B 4X6AH 5HURA 3M9BA 4A93G 4V190 4A3GB 1MGSA 1PTOC 4JI6Q 2HIXA 4DR4Q 4HMIA 2ICEC 2F0GA 2KHJA 3KOJA 5C5LA 2EJGC 3RLOA 2BH2A 2KQ3A 1X9NA 4C3HG 3NQTA 2HCCA 2CQAA 5JVG3 1CI3M 3PSIA 4POGA 1FNWA 1QILA 2F52A 2R7DA 4DXGA 1IBLQ 2XWBB 2NB0A 4YY3L 2F3VA 1PH7A 1K73C 1N9WA 3J7ZC 1IBML 1BCPB 4OXPA 4KKSA 2VQEQ 1KIXA 1LTGD 1RJTA 1QWYA 5JPNC 2ZJRA 1OXVA 1JORA 1GVPA 5IT9E 4AYBE 1RODA 2E2IH 3W1GA 1E24A 1XXGA 1WTWA 4R4QA 2M00A 1CQFA 5KEEA 5GADC 1V8QA 3OOCA 1F9QA 1CZGA 2Z4IA 4C1NI 1B9NA 3A56A 2L15A 1I6HB 3EJIA 3T56B 1Y1VH 3E0JA 3UDFA 4UPAA 2Q2TA 3F1ZA 4WORA 5LMNL 1L0WA 4I7AA 2IWHA 4UAIA 4BBRG 4X3SA 2F0OA 5IP7G 2G9HD 4KJOA 3I4NH 3CXCA 1O7YA 4FF3A 4ZLTF 3JC66 5ELNA 3T16A 1ASZA 3N52A 4AYBB 1FJGL 4WRDA 3G6JB 2F0IA 5J1ZA 5KIXA 2MO0A 4ALPA 4S3SA 4QL5A 2EJFC 4P72A 1EL0A 1K8GA 5M5XB 1NUCA 2NVQH 3WOFA 1YJ9A 3TP6A 1B50A 4C3IH 4YWMA 3SR1A 3DXJC 5JEAH 2Y0SE 4HIMA 1EIFA 2PYKA 5IGGA 2JA7G 3GTOB 4XIGS 4RGNA 1PTOF 4NXNQ 1U4RA 2ATWA 4HIOA 2ZT9C 2PQAA 3R8BA 3G7LA 4LF4Q 4CKBA 1SAPA 1TT2A 3E9IA 4A3IG 1EUJA 1TWHH 3T4AC 1Q90A 3CF5A 4DV5Q 2EXZA 4BY7H 3PIO3 2JP1A 3BYYB 4GLAC 4GNXA 1X6OA 2F3IA 3MC0B 1MIUA 1B44D 5KNBA 3H09A 1VF5C 3CCUA 5ELDA 1AP0A 5BN4A 1EEID 2ZTEA 4LF9L 2VQFL 1IXRA 3KYHC 3AB9A 3PCOB 3CKIB 2WP8J 4FF2A 3BDOA 2VL6A 3PO2G 4LF6L 1C4QA 3J7AF 1FNUA 4A3MH 2UUBL 5JOBA 2A6HC 1S5BD 2IX1A 3M4OH 1O78A 4ABNA 1X3GA 2GVAA 2B63H 1TXYA 4UDUC 5G3LF 4PMBA 3S1NB 1BDOA 5FKAC 3BVMA 4JI7L 3K7UC 4J1MA 2F0HA 3RN5A 3I4MH 3HOYG 3RN2A 1E2ZA 1CKNA 5M3MG 3UDGA 1YNNC 4JI2L 4DAVA 2ES2A 3S17B 1HQMC 1T9HA 4TKOB 2D0PA 1TS5A 1WCMH 4JI8L 1I4PA 3S2DB 3S16H 1VQOA 4DK0A 2QDBA 1KABA 1PTOB 4JV5Q 2F03A 4K2LA 2PZTA 4NMZA 1HPCA 2GN5A 2K04A 3H3VI 2KUMA 3LWUA 2TMPA 3K58A 2EZVA 2HDLA 1FGBD 4B3MQ 4DV3L 4KY7A 2MJ8A 1VQGA 2L11A 4KHZA 1D1KA 4X65L 3MEHA 4DV7L 4LNQA 1I3QH 3NQIA 5KYLA 1EWHA 1F2YA 4G57A 3ITPA 4CDDC 3DUZA 5EPKA 2F0KA 1ILPA 5KNCA 4GKKQ 4LWCA 4L5SA 3CD6A 1Q8KA 2FXQA 1RHPA 4B3RQ 2JA6G 1SNDA 4JBMA 4IPGA 4LF7Q 2JA8G 1XMQL 5FJ8G 2AUKA 4BA1I 2OTLA 1I5FA 2OF1A 4L6TB 1KD1C 4ODGA 3PUZA 4A3JB 2E2DC 4O1NA 2IHFA 4EGVA 1OTCA 1DONA 2K75A 4K5XA 3I72A 4ZRZA 1LT3D 1R4QB 3A8IE 3VYRA 2UXCQ 5IE8A 3MZ5A 3AYHB 5FLXL 4LF5L 5C0XG 1Y1WG 5F2DA 4HSPA 3CCJA 2B8GA 4RAUC 3QB3A 2KCCA 1X3PA 2I5HA 3A5UA 3U4VA 1Q1BA 1SR3A 2QW7A 1AN8A 3K5MA 3HOUB 3A0JA 2F0VA 1GHJA 4B3SL 1RTOA 2F0TA 2RDFA 4KN7C 5FK9C 4XTCS 3WOEA 2B2UC 2D5DA 3SDZA 3GTLH 4CKEA 4KY6A 4XYQA 5DAUA 5IYCG 3TMEA 4I65A 3VR2A 1A15A 3VR4A 3C1FA 4N8X1 2F0FA 2HHHQ 4AH6A 1PHJA 1TWAB 1MKHA 2R7ZG 3DEOA 3MFYA 3EROA 1Q46A 4TQUS 5I4DA 4GZYC 2K5NA 3FRPB 5FLXc 3S24A 2B2VC 1L0XB 2F0NA 4XDXA 1V43A 2MFIA 4IJLA 1OXXK 3RD4A 4MTNA 4A3CG 1VCIA 4LFBQ 4KN4C 4IJHA 1IHZA 4FDBA 3J80E 2IW3A 3KDFA 3CMEA 4R4IA 1HZCA 3J81j 3BS1A 5I2XA 4KV6A 3G6EA 3BZDB 3H0GB 3L2PA 3ERQA 4HJ5A 2ID0A 1YNXA 3S15B 2R93B 1L1OA 3HOWG 4K14A 3HGBA 3GTKB 3MHBA 1UAPA 2LXKA 4QGUA 3S2HB 1HA5A 1O7LA 5E4XA 3GTOH 1QUQA 1EFID 1JOKA 3BDCA 5IGDA 4RMFA 5ELFA 1TQOA 4B3TL 2KEEA 2F0MA 5C5MA 1GM5A 1PZKD 2JQOA 4PMCA 2A8VA 1MI2A 2AWOA 2A69D 1R4PB 5C4XG 1F2ZA 3K5NA 3RZDB 1TS4A 1N32Q 1KTKA 2L4NA 5BR8L 1LO5D 1VQCA 3VR3A 2K5QA 2JK8A 4IN3A 1D2BA 2FHTA 1F9PA 1Q86C 1WTHA 1HTLD 5C3EB 4DR3Q 5C44G 5I2YA 2LKVA 1BBUA 1K0RA 2F4VQ
chains in the Genus database with same CATH topology
1TY2A 2B2TC 2KCNA 3JAME 1D5MC 2IPKD 3AMUA 1CM9A 5C6AA 3BG3A 3TZUA 2FFKB 3PO3B 3TP8A 5FO8B 4X3KA 1AZQA 1TR5A 2PPBC 4DGZA 2EE1A 2RKSA 1U4LA 3PUXA 3E6ZX 4R9WA 1I6VC 3KLSX 3S1RB 1QCBD 3VYTA 5JEAJ 2R3ZA 1KDBA 1XYIA 2DN8A 4ULLA 3LWEA 1GXDC 4BWGB 1SE3A 2B2YA 1PTOH 3P1HA 4M8AA 2J7ZA 2ICIA 1QNUA 4G7HC 3GTJB 3RUZA 4OO1G 5FO9B 1QJOA 1FD7D 2BA0A 5M3FB 4IUUA 4XYOA 4IALA 2JYOA 2R6GA 4TSSA 2WV6D 1LV9A 1FR3A 1KLGD 2E76C 2Z4HA 1D6EC 1T5EA 4Y7NB 2O5JC 5EKKA 3SEBA 1EZ6A 3HOVB 4H44C 3WDNA 1PMRA 2A69C 3K5LA 4ZKCB 1VDZA 1RCVD 1I4HA 4OIJA 4DAPA 2DY8A 4PNYA 3R2IA 1ILQA 1WTPA 5A2QE 4NW2A 1PZID 3KBGA 4KHVA 3M85A 5A35A 1KAAA 4Q0FA 2F0SA 1CA6A 4QUFA 3L9AX 3MVVA 2HDMA 3X3MA 1A2TA 5IODA 2F0UA 3VR6A 2A5HA 4BY1B 1LTID 1DXMA 2X69A 4IZ8A 1HFGA 5CMDA 1C48A 1MSGA 5LHY1 3M4YA 3NXWA 2KA7A 1I50B 3CHBD 3J7AV 4RGTA 3A7AB 3OW7A 4C3JG 2EYOA 5CBEE 5LL6X 3OIPA 1Z47A 3MTSA 2AQ2B 3MXPA 3D3RA 4A3FB 4X3UA 2JSOA 1TWGB 2E75C 4IUQA 4K6DA 1TVXA 3OIQA 3J81L 1H9SB 5EBCA 3QOLA 4RKLA 1Y69U 3UI2A 1SYBA 4XQQA 4DNRB 1Q3LA 2BA1A 1PZJD 3FVQA 3IFTA 4IUTA 4X3TA 1Y8OB 1KLUD 2SEBD 1A6XA 2L1BA 5JAVA 1O7ZA 1GUGA 1DD2A 1TIID 3GQBA 2F0EA 1GJXA 5C4ZA 2ZXRA 2ZXPA 3GTQB 4OL7A 2WKDA 5E1FA 3HKZB 5DNFA 2NVTB 4K6LA 1AZPA 3KLSA 2I46A 2EY1A 2VXWA 4IUNA 4V0BA 2A6HD 5DM63 1L0YB 2NZ1D 1EY6A 3EFXD 5ELEA 5EGTA 1STYA 4RCNA 1XTCD 2MUYA 1YNND 5ELBA 2XVSA 2LFNA 3W3AA 2Z8LA 1I4XA 4FP5D 3VA5A 2I07B 3R3OA 1GUTA 1Z6HA 4A3KB 1BUVT 1SDFA 4KKTA 5KYIA 2B39A 2QKIC 2A68D 3OMGA 2KHSA 1B53A 4IFDH 1GUOA 3P20A 5D3IB 2EYJA 1VMCA 5M5WB 1IW7C 2NN6H 1CA5A 3RZOB 1UUPA 2H1EA 5IT9L 4P2CB 1UEAB 2MP1A 3K7AB 5I6WA 1S4ZA 1TWFB 2WACA 2KEDA 2RQXA 1S5DD 5NUCA 1D1IA 3I8ZA 1R9TB 2TSSA 2WIIB 1EIGA 1FYCA 3TP5A 3QJYA 1SMYC 2H4OA 1BO0A 3NBIA 1PYWD 1A3TA 3Q23A 2PZWA 3L3OC 2F0JA 2WAQB 1KNEA 1RTNA 1KDAA 1HCZA 1F9SA 3DWQA 4G7ZC 5K36H 4OIKA 4C2MB 3P7JA 1D5ZC 1CT1D 2IL8A 1NSNS 4O42A 3QO2A 2RDHA 1SEBD 2RA4A 2QF7A 1GUNA 1LTTD 3C2PA 3GTMB 1ONLA 2FJ2A 2D2CC 1EY7A 1SNPA 4CJ0B 1WVLA 2F0LA 3C3LA 1GUWA 1JWMD 2B8FA 4QUCA 2AUJD 2X6LA 1RF2D 4Q5VA 2XNAC 3W2DA 2L9HA 3A54A 2A68C 4DNTB 1EY8A 4FYDA 2NBFA 4F87A 4A93B 2E2HB 2QEJC 4XXEA 1HTPA 1F77A 3TP7A 1BR9A 1RDPD 3NHHA 4C3HB 3K0YA 1QNKA 3OHXC 5D3DA 5EPLA 4RA8A 2Q8TA 1LABA 1DCZA 1H9KA 3TSSA 3DM1A 4KI0A 2WINB 4CHTB 2A6ED 1DOMA 2PZUA 2BCOA 3PUWA 4Z9CB 3R93A 4F7XA 4B08A 3NWTA 4KY5A 4L8JA 5CC4A 4BBRB 5HGTA 4RGOS 4QF4A 3S9WA 3NP8A 4C3IG 3NTHA 1TKWB 2EY2A 3C46A 3PMFA 5JEAG 1BXTA 2NWGA 1S5CD 2CW0C 3V2TA 4QB4A 5DEHA 2JA7B 1M4VA 1EQTA 1JICA 2D9UA 4FXGC 5ELCA 3GO5A 4A3IB 1STGA 3I73A 2EOTA 3U9OA 1RKNA 2F4IA 1B1ZA 2E2JB 3MAQA 5K36G 1WTXA 2LY7A 3S1QB 4WFN3 2PCFB 2PNRC 1M8AA 5KRUA 3CRLC 2RSOA 3ND9A 1C8CA 3PO2B 2OXPA 1LTBD 1EOTA 3EA6A 1PFMA 2Z1CA 3M3YB 3HOYB 3IFDA 5M3MB 2A6EC 2EPBA 1PFNA 4IFDJ 3H91A 3HG9A 5IGFA 2QILA 1MD2D 1V1PB 4U68A 1STBA 4MIUA 2IT1A 2B2WA 2PQEA 1ET6A 1LLRD 3VA7A 4QCLA 1AW7A 4FVMA 2HUGA 2A73B 2MGSA 4HTHA 3JAML 5D14A 5CGKA 1H9JA 4FXDA 4ZQ3A 1ET9A 2CVRA 1OO9B 2F3WA 2K28A 2JA6B 2JA8B 1VF7A 1ENAA 1J8IA 4IFDI 3P75A 4K2KA 2K01A 4ZYSA 1VMPA 5LL6S 4RHRA 2Q8IB 3EQLC 2NN6I 5IGBA 5JPMC 4NKLA 2KECA 2KOLA 2AQ3B 4EQPA 3SVMA 1Y1WB 2LS01 4RH6A 2EYLA 2SNMA 3MXNA 1SYFA 1CHPD 1BCPC 4RHSA 1EY5A 1EU4A 2E74C 5AFWA 1H9MA 1SXTA 1DOLA 4PV1C 1WD1A 2NUCA 3QG1A 2XRSD 3X3NA 3Q6SA 3A55A 2R7ZB 2EJMA 4ZAIA 5K5PA 5I9OA 1SNCA 1HUNA 2O5IC 1EY9A 3HS0C 2EY5A 1SFOB 3HEJA 2XRQD 1DJRD 2CHBD 1B9MA 3GTGB 1H9RA 4G7OC 4U673 4DXFA 5COYA 3HOWB 1SYCA 3GV6A 4RKBA 3Q22A 4DFAA 3TBIB 1FNVA 4DK1A 2F0DA 1ESRA 3KUPA 3MWYW 1NR4A 2J0TD 3ZYYX 5A2QL 1G6ZA 5IGEA 1CK1A 2IX0A 3NTIA 1TS2A 2L0CA 3BYTB 5C4XB 4YIJA 3FMCA 3OWEB 2AQ1B 1IW7D 1E0BA 3M4OB 3FDTA 1HHVA 1G2TA 2B63B 3SXHA 2K5DA 5FO7B 5C44B 2X6GA 1BQQT 3U9SA 1V1OA 1AEXA 3TZDA 1NAPA 3URYA 1GUSA 4LJZC 2M2LA 4ZK9B 4PQXA 3IAYA 1EY4A 5CV7A 3D6CA 1HFNA 5CV9A 2XIWA 1SMYD 2EYHA 2N88A 3V05A 1IKLA 3ND8A 1LTRD 2NVXB 1OXUA 1A3UA 1NR2A 2JE6I 2RBMA 3PUYA 2MPMA 1CHQD 1EY0A 4NDXA 1XX8A 5TSSA 3A8JE 1IYUA 3ONAB 1ZXTA 2PMZB 1ZYRD 1I4GA 1H9SA 2IJ0A 5E3FA 1JC7A 3K6OA 2EDGA 5C3WA 4JBWA 4OO1I 2K05A 2MHVA 3MXGA 1ESFA 4IQZA 3S1MB 2N55A 2JEAI 4R8IA 2K33A 3O13A 2KVMA 3PUVA 1RD9D 3MA2B 1BF4A 5DM73 1XWEA 3Q0AA 3H3VC 3IL8A 4MN3A 3GTPB 3CU7A 4H0LC 1WD0A 1O80A 4A3DB 1OXTA 5IIFA 4FF4A 4KKUA 3QWNA 1I4QA 5BN3A 2VB2X 1ZKOA 3NSWA 5JVH3 3HOZB 3Q24A 5IOCA 3GTLB 1DYQA 1II3A 1F2LA 1NCVA 3SK5A 4ZUIA 4CGYB 4HAEA 1UNSA 2JEBI 1GHKA 5C0XH 3PV0A 3FPPA 3KLRA 3DEPA 1EYDA 4HSVA 5M9OA 3HRZC 4N9TA 2K32A 3D4DA 1WTOA 5CV4A 3FPUB 5D65A 1HRJA 3TN2A 3D4WA 3GD7A 2NVYB 2EYPA 4IUVA 4I7ZC 4C56C 3NTKA 1DOKA 4G4KA 2EYFA 3DHQA 4CJ2C 4FNFA 1ZEQX 3CQZB 3OSOA 1WTVA 1PDQA 3NK9A 2BDOA 2BDNA 4DF7A 4NP5A 2LMCB 1PRTD 2BE5D 4BA2I 3K57A 2VUMB 2OT2A 2SNSA 3L7ZC 3VR5A 4H7BA 1TY0A 4XT3B 4MHEA 1CQVA 2BOSA 3E5SA 3I91A 1W6JA 3D8GA 2JA5B 2JXMB 1QE6A 4C3JB 3QIAA 2DNEA 1ZYRC 1CFMA 1EYCA 2RSNA 2Y0SB 2EVBA 2RVLA 3I90A 1LT4D 5EKIA 1ICWA 1SSOA 1Q8IA 3DWPA 1Z7TA 3AU7A 2CW0D 3OMCA 3M7GA 2M9VA 4RFBA 2K6AA 2KJXA 1LT6D 5M5YB 1OXSC 2A74C 3SHLA 1A2UA 4RWSC 3K59A 1IL8A 1LT5D 2B2WC 1TU2B 3SE0A 3VYUA 4XQJA 3SK6A 1KDCA 4A3BB 4IURA 3T13A 2B2YC 1HXYD 2O4XA 3S14B 4IUPA 1JE4A 2WKCA 2FINB 1MSHA 1JOOA 3H94A 4FO2A 3LNNA 3RMHA 2IX3A 2R92B 1WTRA 4DA2A 1T5XD 5FLXE 1G91A 1AFPA 1EU3A 5KNDA 2FMCA 1SJED 1E2VA 2YYZA 3A8KE 5I6YA 4QMGA 2L12A 3K5OA 3PIP3 4M1UB 2ZXOA 4ILWA 3I70A 4LK1C 1JWSD 5IGCA 4K8IA 1PRTC 5T1IA 3NUCA 3DMUA 4XQNA 2FMMA 1E2WA 2BE5C 4A3EB 1TWCB 1SYDA 4OO1H 4BS9A 1DM0B 4HN7A 2K7VA 2D62A 4IFDG 3HZXA 1CZWA 5EQ0A 1EYAA 1SJHD 3N6RA 4LAAA 2NN6G 5ISRA 2K5WA 2DY7A 1I4RA 3GP7A 2C5CA 3GV3A 2G9DA 5CV8A 5CV5A 1SNMA 1YNJD 3VYSA 5KGUA 2SOBA 1K8OA 4KD3A 1HA6A 1SNQA 4HMJA 3SK8A 3M7NA 5CR3A 1SNOA 1X32A 3HOXB 3CRKC 5I9PA 4ZKBB 1JCKB 5FOBB 2K03A 1K83B 1W6KA 2F0WA 1HUMA 1BCPD 1G291 4C1NK 2OEOA 4CBVA 3FKIB 1F2MA 4KTAA 2QCPX 1PRTF 1QG7A 3J80L 3NE5B 2YU9B 1A3VA 2XWJB 4K8JA 1S5FD 2C9OA 5CORA 3T51B 5E4WC 4R8NA 1SYEA 3NWSA 4OGQC 4QIWB 1STEA 4WJWA 1EIHA 1BBXC 1QOHA 1ENFA 1BOSA 4E6IA 4ME5A 3J7YW 4B9XA 3KBXA 4DU9A 3BDLA 2K1BA 4RGMA 4EVOA 4BBSB 1TS3A 5C0XJ 2ENBA 4CJ1B 3A7LA 1B3AA 1DZ1A 4KK7A 1U9RA 5C4JB 2GA4B 4OHJA 2O2LD 4FXKC 4H13C 2HQEA 1JB3A 3C1EA 1IKMA 1JR0D 1LTAD 5T1GA 1EWCA 2Q8RE 4CKCA 4DN4M 2XN9C 3I3CA 1YNJC 1BNZA 1LTSD 5BN5A 1EEFD 3EVQA 1ML0D 1PFBA 2NTTA 1PXUA 1Q1EA 1PRTB 3FEWX 2PO4A 1PLFA 2E2IB 1V1PA 5JJZA 2J4XA 5C0XI 1SBBB 4B9WA 4ZUJA 3D6WA 4L63B 4K5VA 4HR7B 4HCSA 1Y1VB 1S5ED 1D5XC 4J8QA 1JWUD 2L55A 4FF1A 4KJNA 1U4MA 3I4NB 2PW5A 4KD4A 1SYGA 3HP3A 2RDGA 4K5WA 3NPPA 5J39A 1J9OA 2NVQB 1X3QA 4C3IB 3RLFA 4DAYA 2VNUD 4LMQD 4N9PA 4HEDA 1PTOD 4J6HA 2NTSA 5EKLA 2B2UA 3D31A 3D4RA 1U4PA 4HCEA 1TWHB 1STNA 4BY7B 2SDFA 4TRDA 1HQRD 3R2TA 3OWFA 2EY6A 1EQVA 5EJWA 3T53B 3IKJA 1JOQA 1QB5D 1B2TA 2B2VA 2F1MA 3I4LA 5CYUA 3MXUA 1IYVA 3TDQA 2L5TA 2HCIA 3J81E 1Q12A 1SE2A 1K8MA 2V4DA 4ID6A 1Y8PB 5C3XA 5EBDA 4PMWA 4A3MB 3MFGA 1SE4A 2NYZD 4F88A 5G3LD 3KK7A 2DNCA 3KF8A 3BVZA 1BCPF 1G2SA 3OPOA 3I4MB 1Y8NB 2VB3X 3LX0A 5CV6A 1ENCA 3F2UA 4RCOA 1KNAA 1B4OA 4KMUC 1WCMB 4EQOA 3S16B 1WTQA 3QOJA 2EYMA 2F0PA 3SK4A 3NBHA 3DWAA 1GOZA 5C4HA 3V96A 1F9RA 1MBYA 1CTMA 3BVGA 4F8MA 1EZ8A 2XSCA 2B2TA 4EQNA 5CBAE 1STAA 5J22A 1I3QB 1STHA 1LACA 4XT1B 2R61A 1G8ZD 1JQYD 3H6MA 2AWNA 5EPJA 2F0QA 4JK1C 2PW7A 2WB1B 5HURA 4V190 4A3GB 1MGSA 1PTOC 4HMIA 2ICEC 2F0GA 5C5LA 2EJGC 2KQ3A 4C3HG 3NQTA 2HCCA 2CQAA 5JVG3 1CI3M 1FNWA 1QILA 4DXGA 2XWBB 2NB0A 2F3VA 1BCPB 4KKSA 1LTGD 1RJTA 1QWYA 5JPNC 1OXVA 1JORA 5IT9E 1RODA 1XXGA 1WTWA 2M00A 1CQFA 5KEEA 1V8QA 3OOCA 1F9QA 1CZGA 2Z4IA 4C1NI 1B9NA 3A56A 1I6HB 3EJIA 3T56B 3E0JA 4WORA 2IWHA 4UAIA 4X3SA 2F0OA 2G9HD 4KJOA 1O7YA 4FF3A 4ZLTF 3T16A 3N52A 4AYBB 4WRDA 3G6JB 2F0IA 5J1ZA 5KIXA 4S3SA 2EJFC 1EL0A 5M5XB 1NUCA 3WOFA 3TP6A 1B50A 3SR1A 3DXJC 5JEAH 2PYKA 5IGGA 3GTOB 4XIGS 4RGNA 1PTOF 1U4RA 2ZT9C 3R8BA 3G7LA 4CKBA 1SAPA 1TT2A 3T4AC 1Q90A 2EXZA 3PIO3 2JP1A 3BYYB 3MC0B 1B44D 5KNBA 3H09A 1VF5C 5ELDA 1AP0A 5BN4A 1EEID 3AB9A 3CKIB 2WP8J 4FF2A 3BDOA 1C4QA 3J7AF 1FNUA 5JOBA 2A6HC 1S5BD 2IX1A 1O78A 4ABNA 4UDUC 5G3LF 4PMBA 3S1NB 1BDOA 5FKAC 3BVMA 4J1MA 2F0HA 1E2ZA 1YNNC 4DAVA 3S17B 1HQMC 4TKOB 1TS5A 1I4PA 3S2DB 4DK0A 2QDBA 1KABA 1PTOB 2F03A 4K2LA 2PZTA 4NMZA 1HPCA 2K04A 2KUMA 3LWUA 2TMPA 3K58A 2EZVA 2HDLA 1FGBD 4KY7A 2MJ8A 2L11A 4KHZA 1D1KA 3MEHA 3NQIA 5KYLA 1EWHA 1F2YA 4G57A 3ITPA 3DUZA 5EPKA 2F0KA 1ILPA 5KNCA 1RHPA 1SNDA 2AUKA 4BA1I 2OF1A 4L6TB 4ODGA 3PUZA 4A3JB 2E2DC 4O1NA 4EGVA 1DONA 4K5XA 3I72A 4ZRZA 1LT3D 1R4QB 3A8IE 3VYRA 3MZ5A 5FLXL 5C0XG 5F2DA 4HSPA 2B8GA 4RAUC 3QB3A 1X3PA 2KCCA 1Q1BA 3HOUB 3K5MA 1AN8A 2F0VA 1GHJA 1RTOA 2F0TA 2RDFA 4KN7C 5FK9C 4XTCS 3WOEA 2B2UC 2D5DA 3SDZA 4CKEA 4KY6A 4XYQA 5DAUA 3TMEA 4I65A 3VR2A 1A15A 3VR4A 3C1FA 2F0FA 1TWAB 3DEOA 3MFYA 3EROA 4TQUS 5I4DA 4GZYC 3FRPB 2B2VC 1L0XB 2F0NA 4XDXA 1V43A 1OXXK 3RD4A 1VCIA 4KN4C 1IHZA 3J80E 2IW3A 3BS1A 5I2XA 4KV6A 3BZDB 3H0GB 3ERQA 2ID0A 3S15B 2R93B 4K14A 3HGBA 3GTKB 3MHBA 1UAPA 3S2HB 1HA5A 1O7LA 5E4XA 1EFID 1JOKA 3BDCA 5IGDA 5ELFA 1TQOA 2KEEA 2F0MA 5C5MA 1PZKD 4PMCA 1MI2A 2AWOA 2A69D 1R4PB 1F2ZA 3K5NA 3RZDB 1TS4A 1KTKA 2L4NA 1LO5D 3VR3A 2K5QA 4IN3A 1D2BA 2FHTA 1F9PA 1HTLD 5C3EB 5I2YA 2LKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1E A;  1RKN A;  3MZ5 A;  5KGU A;  5JAV A;  2SOB A;  3SK5 A;  4KD3 A;  4ZUI A;  2WAC A;  1SNQ A;  5F2D A;  3SXH A;  3TP7 A;  3SK6 A;  1KDC A;  4HMJ A;  3SK8 A;  3QB3 A;  2F3V A;  5I6W A;  5CR3 A;  3NHH A;  3T13 A;  5NUC A;  2O4X A;  5IGB A;  1SNO A;  4PNY A;  2F0E A;  4NKL A;  5C6A A;  5C4Z A;  1AEX A;  2F0V A;  2F0T A;  3EVQ A;  4EQP A;  5I9P A;  3TP5 A;  2RDF A;  1JOO A;  2EYL A;  2SNM A;  4OL7 A;  1EYD A;  5M9O A;  4ID6 A;  5E1F A;  1EY4 A;  1JOR A;  5C3X A;  4KHV A;  4KY6 A;  5CV7 A;  5DAU A;  4N9T A;  1SYF A;  5JOB A;  3TP8 A;  3D4D A;  3D6C A;  1A3T A;  5CV9 A;  3TME A;  1KAA A;  2PZW A;  5CV4 A;  5KRU A;  4I65 A;  1TR5 A;  2F0J A;  2OXP A;  3D4W A;  4DGZ A;  1EY5 A;  2F0S A;  2F0W A;  3C1F A;  2RKS A;  2EYP A;  2F0F A;  3MVV A;  2EYH A;  2M00 A;  2EY1 A;  5KEE A;  4PMB A;  2EYF A;  3DHQ A;  2PZU A;  3ERO A;  4IUN A;  1KDA A;  4J1M A;  1A2T A;  2F0H A;  3OSO A;  4ZUJ A;  2NUC A;  2F0U A;  4B9W A;  5IOD A;  4F7X A;  3EJI A;  1EY6 A;  2F0N A;  1A3U A;  3NK9 A;  4K5V A;  4IZ8 A;  1KDB A;  4WOR A;  5I6Y A;  3LX0 A;  2OEO A;  2RBM A;  5EGT A;  4DF7 A;  4QMG A;  4NP5 A;  1STY A;  5CV6 A;  1ENC A;  1EY0 A;  4NDX A;  5K5P A;  1F2M A;  2F0O A;  4KTA A;  1IHZ A;  4KJO A;  4KY5 A;  4EQO A;  3P1H A;  5CC4 A;  3NXW A;  4KJN A;  5I9O A;  1SNC A;  1A3V A;  2QDB A;  1NSN S;  1KAB A;  2EYM A;  2PW5 A;  2F0P A;  2SNS A;  1EY9 A;  3QOJ A;  4KD4 A;  4KV6 A;  4K8J A;  3SK4 A;  3T16 A;  4K2L A;  2PZT A;  5HGT A;  3ERQ A;  1SYG A;  4NMZ A;  4H7B A;  4WRD A;  4R8N A;  4QF4 A;  3S9W A;  2F0I A;  1SYE A;  5E3F A;  3NP8 A;  5J1Z A;  5C4H A;  1STB A;  4K8I A;  3E5S A;  2EY5 A;  4S3S A;  3VA5 A;  3RUZ A;  5C3W A;  4K5W A;  4MIU A;  2EY2 A;  2EYO A;  1NUC A;  3NUC A;  3PMF A;  3HEJ A;  4K14 A;  4KY7 A;  3TP6 A;  2PQE A;  3DMU A;  3MHB A;  4F8M A;  3R3O A;  5IGC A;  5J39 A;  1EZ8 A;  3D8G A;  3SR1 A;  3MEH A;  4EQN A;  3MXP A;  5IGF A;  1SYD A;  1STA A;  5KYL A;  2PYK A;  1JOK A;  1F2Y A;  3BDC A;  4G57 A;  5IGG A;  4N9P A;  1EY7 A;  3ITP A;  1SNP A;  5IGD A;  5KYI A;  5J22 A;  4E6I A;  1SYC A;  3HZX A;  4J6H A;  1TQO A;  1EYC A;  4ME5 A;  4RKB A;  1STH A;  2F0K A;  2F0L A;  3OMG A;  2KHS A;  3V2T A;  4B9X A;  4DFA A;  2F0M A;  5C5M A;  4DU9 A;  3BDL A;  4K6D A;  5KIX A;  3H6M A;  4IAL A;  4EVO A;  4QB4 A;  4HTH A;  4PMC A;  5EKL A;  1EYA A;  2F0Q A;  2F0D A;  5CGK A;  4LAA A;  5DEH A;  2PW7 A;  5ISR A;  3OMC A;  1SND A;  2ENB A;  2EYJ A;  3QOL A;  1F2Z A;  1TT2 A;  5EKK A;  4RKL A;  5HUR A;  4ZQ3 A;  1U9R A;  2OF1 A;  2EXZ A;  5IIF A;  4ODG A;  1EZ6 A;  5IGE A;  5CV8 A;  3SHL A;  1STN A;  4HMI A;  5CV5 A;  1A2U A;  1EY8 A;  1SNM A;  1SYB A;  2F0G A;  2F3W A;  4K5X A;  4TRD A;  5C5L A;  3OWF A;  2HQE A;  2EY6 A;  5IOC A;  1EQV A;  1ENA A;  1II3 A;  4YIJ A;  1STG A;  2KQ3 A;  2LKV A;  1JOQ A;  3P75 A;  4K2K A;  3NQT A;  3U9O A; 
#chains in the Genus database with same CATH topology
 1VQA A;  1TY2 A;  2B2T C;  3ZJY C;  3K80 C;  2KCN A;  2N78 A;  4DUY Q;  2D0O A;  3JAM E;  4WJ4 A;  4ZCK A;  4OWW B;  1D5M C;  2IPK D;  3AMU A;  4OEL B;  1CM9 A;  4A4I A;  5C6A A;  5IYD H;  4P74 A;  1UWV A;  3BG3 A;  3TZU A;  2FFK B;  3PO3 B;  3CCR A;  3TP8 A;  1X56 A;  5FO8 B;  4X3K A;  1AZQ A;  1XNR Q;  4R4C A;  4TVA B;  1TR5 A;  2PPB C;  2ZTC A;  4POF A;  4DGZ A;  4X64 L;  2EE1 A;  2RKS A;  3S1N H;  1HZB A;  4QJF A;  1U4L A;  3PUX A;  3E6Z X;  4R9W A;  1B3Q A;  1K3R A;  1I6V C;  3KLS X;  4O0A A;  3S1R B;  3S14 H;  1UE5 A;  1QCB D;  4PZ8 A;  3VYT A;  3S17 H;  3K8A A;  5JEA J;  2R3Z A;  1KDB A;  1XYI A;  1JJG A;  3S2D H;  2DN8 A;  1CUK A;  4ULL A;  1XPR A;  3LWE A;  1GXD C;  4BWG B;  1SE3 A;  2B2Y A;  1PTO H;  3P1H A;  3CCV A;  4WJ3 M;  4M8A A;  2J7Z A;  2ICI A;  1QNU A;  4HJ8 A;  3QR8 A;  2WFW A;  4G7H C;  3GTJ B;  3RUZ A;  4OO1 G;  5FO9 B;  2OQK A;  1QJO A;  5IYB H;  4DAY B;  2YTY A;  1FD7 D;  2BA0 A;  3CC4 A;  4NXM L;  5M3F B;  2E5L L;  4IUU A;  4XYO A;  4MZ9 A;  4IAL A;  2JYO A;  2R6G A;  4TSS A;  4A3D G;  2WV6 D;  1LV9 A;  1FR3 A;  1KLG D;  2E76 C;  4A3L G;  2Z4H A;  1D6E C;  1T5E A;  4Y7N B;  3HOZ G;  2O5J C;  5EKK A;  4JI0 Q;  4A3J H;  4K0K L;  3SEB A;  1EZ6 A;  2YTV A;  3HOV B;  4H44 C;  1CKM A;  3WDN A;  3AEV A;  1PMR A;  3ULP A;  2A69 C;  1S72 A;  3K5L A;  1M90 C;  4ZKC B;  1VDZ A;  1RCV D;  4DR7 Q;  3ERS X;  1I4H A;  4DV1 Q;  3HOU H;  4OIJ A;  4DAP A;  2DY8 A;  4PNY A;  3R2I A;  1ILQ A;  1WTP A;  5A2Q E;  1HNX Q;  4NW2 A;  1PZI D;  3KBG A;  4KHV A;  4DV6 Q;  2R7F A;  4IPD A;  5A35 A;  3M85 A;  1UE1 A;  1KAA A;  4Q0F A;  1E22 A;  2RCF A;  1YEZ A;  2F0S A;  1TWA H;  3CC7 A;  1CA6 A;  4QUF A;  3L9A X;  3MVV A;  4DV4 Q;  2HDM A;  1YHB A;  4GNX C;  4DV0 L;  4JI4 Q;  3X3M A;  1X3F A;  1A2T A;  5IOD A;  2F0U A;  3VR6 A;  2A5H A;  4BY1 B;  1YJW A;  1LTI D;  2IHE A;  1DXM A;  2C35 B;  2X69 A;  1Q82 C;  4IZ8 A;  2VUM G;  1HFG A;  4UY8 C;  5CMD A;  1C48 A;  1MSG A;  5LHY 1;  3M4Y A;  3NXW A;  2KA7 A;  3PGZ A;  1J5E L;  3H0G H;  3NBH B;  1I50 B;  3CHB D;  3J7A V;  4DR2 L;  4JI1 L;  3K81 C;  4RGT A;  3S15 H;  2JA5 G;  2R93 H;  1XTD A;  3A7A B;  3OW7 A;  4C3J G;  3I2Z A;  3GTK H;  2EYO A;  1MJC A;  4DV2 Q;  3S2H H;  5CBE E;  5LL6 X;  2CH4 W;  3OIP A;  1Z47 A;  3H15 A;  3CPW A;  3MTS A;  4JI5 Q;  2Y0S G;  4HJ7 A;  2AQ2 B;  3MXP A;  3D3R A;  1IZ6 A;  4A3F B;  3L0O A;  4X3U A;  1JMC A;  3CW2 C;  2JSO A;  3ULL A;  1TWG B;  2E75 C;  5IWA Q;  4IUQ A;  4K6D A;  3W1B A;  1TVX A;  2WB1 E;  3OIQ A;  3AQQ A;  3J81 L;  1H9S B;  3BZC A;  1UE6 A;  4L5Q A;  5EBC A;  3RZD H;  3QOL A;  4RKL A;  2DGY A;  1Y69 U;  3UI2 A;  1YIT A;  4DPG A;  3G4S A;  1SYB A;  5C3E H;  1FJG Q;  4XQQ A;  4DNR B;  1Q3L A;  2BA1 A;  2YV5 A;  1PZJ D;  3FVQ A;  3IFT A;  4IUT A;  4X3T A;  1PH3 A;  4A3B G;  1Y8O B;  1KLU D;  2SEB D;  4JPB W;  1A6X A;  2L1B A;  2KHI A;  5JAV A;  1O7Z A;  1GUG A;  1HH2 P;  1SLJ A;  1EIY B;  1DD2 A;  1TII D;  3GQB A;  1YBY A;  2AKW B;  2F0E A;  1GJX A;  2Z6K A;  5H1S E;  5C4Z A;  3J81 c;  2ZXR A;  2R92 G;  2ZXP A;  3PO3 H;  3KF6 A;  3GTQ B;  4OL7 A;  3T1H L;  2WKD A;  5E1F A;  3HKZ B;  5DNF A;  2NVT B;  2G5D A;  1YZ6 A;  4JW0 A;  3T1Y L;  4K6L A;  4H02 A;  1AZP A;  4NPS A;  3KLS A;  4BXX G;  2I46 A;  2EY1 A;  3S1R H;  2VXW A;  4IUN A;  4V0B A;  4IPC A;  4KHP Q;  2A6H D;  4MTK A;  5DM6 3;  1L0Y B;  2NZ1 D;  1WYD A;  1EY6 A;  2KEN A;  3EFX D;  3HFZ B;  3J81 i;  5ELE A;  5FLM H;  5EGT A;  1STY A;  4RCN A;  1LM0 A;  2ZM6 L;  1XTC D;  1A8V A;  2MUY A;  1YNN D;  5ELB A;  2XVS A;  2UXB L;  4AQY L;  4HJ9 A;  2LFN A;  4JBJ A;  2QA4 A;  3W3A A;  4IOC A;  2Z8L A;  3GTJ H;  4LF6 Q;  4N8F A;  1I4X A;  4A3E G;  4OX9 L;  4FP5 D;  3VA5 A;  2HD3 A;  2I07 B;  3R3O A;  4LUV A;  1GUT A;  1Z6H A;  2VW9 A;  4A3K B;  1BUV T;  1VQI A;  1SDF A;  4KKT A;  4A75 A;  5KYI A;  2ZJP A;  2B39 A;  2QKI C;  5J3B A;  2A68 D;  3OMG A;  2KHS A;  1WFQ A;  4JI2 Q;  4DR5 L;  4DR6 L;  1B53 A;  4IFD H;  4Y7N H;  1GUO A;  3P20 A;  5D3I B;  1DGS A;  2ZJQ A;  2EYJ A;  1VMC A;  5M5W B;  1IW7 C;  2NN6 H;  2HQL A;  2RCN A;  1I94 Q;  1CA5 A;  1HNZ Q;  3HOV H;  2WAQ E;  4GNX B;  3RZO B;  1UUP A;  2H1E A;  5IT9 L;  1L1O C;  4P2C B;  2HT1 A;  4LF8 Q;  1UEA B;  2MP1 A;  3K7A B;  3NEM A;  3UDX A;  5I6W A;  1IBK L;  1S4Z A;  1NBW A;  1TWF B;  4L5T A;  3HOX G;  2WAC A;  2N49 A;  2KED A;  2RQX A;  1PYB A;  1E3P A;  1S5D D;  1QZH A;  5NUC A;  1D1I A;  3I8Z A;  1R9T B;  2TSS A;  2WII B;  1EIG A;  1FYC A;  3TP5 A;  3QJY A;  3EN2 A;  1SMY C;  2H4O A;  1BO0 A;  3NBI A;  1PYW D;  1A3T A;  3Q23 A;  2PZW A;  3L3O C;  2F0J A;  5IT9 c;  2WAQ B;  4IO9 A;  1KNE A;  1RTN A;  3CC2 A;  3CCL A;  1KL9 A;  5EAY A;  1KDA A;  3FKI G;  1HCZ A;  1A63 A;  1JJ2 A;  1F9S A;  1HZ9 A;  1Y14 B;  3DWQ A;  3KJP A;  4G7Z C;  5K36 H;  4OIK A;  4C2M B;  1IBL L;  2UUA Q;  3P7J A;  1D5Z C;  1CT1 D;  1K3B C;  1I50 H;  2IL8 A;  4PZ6 A;  4DUZ L;  1YJN A;  1NSN S;  4O42 A;  3QO2 A;  2RDH A;  1SEB D;  1J6Q A;  2OCE A;  2RA4 A;  1B70 B;  2QF7 A;  1GUN A;  1LTT D;  3W5O A;  3C2P A;  4OON A;  3GTM B;  1CSP A;  1ONL A;  4A3F H;  2FJ2 A;  2D2C C;  4BBS G;  1EY7 A;  1SNP A;  1TWG H;  4CJ0 B;  1M1K C;  1VS0 A;  1WVL A;  1X54 A;  2F0L A;  3C3L A;  1GUW A;  1JWM D;  2B8F A;  4QUC A;  2AUJ D;  2X6L A;  1RF2 D;  4Q5V A;  2AHO B;  1PH8 A;  2XNA C;  2RHQ B;  4X62 Q;  1CSQ A;  1PH2 A;  3W2D A;  3EIV A;  2L9H A;  1N34 L;  3A54 A;  2A68 C;  4DNT B;  1EY8 A;  4LUO A;  4FYD A;  4QQB X;  2NBF A;  4F87 A;  4A93 B;  2E2H B;  2QEJ C;  4XXE A;  3ER0 A;  1HTP A;  1F77 A;  3G71 A;  3TP7 A;  1BR9 A;  5IP9 H;  4JI3 Q;  1RDP D;  3BZK A;  3NHH A;  4C3H B;  3K0Y A;  1KRT A;  4A3G H;  5DLQ E;  1QNK A;  1VQP A;  3GTQ H;  5AJ3 L;  3OHX C;  5D3D A;  4J15 A;  5EPL A;  1BVS A;  4RA8 A;  2NVT H;  2Q8T A;  1LAB A;  1DCZ A;  1H9K A;  3TSS A;  3EBE A;  3DM1 A;  4DV5 L;  4KI0 A;  2WIN B;  4CHT B;  1Y1V G;  2A6E D;  1XPU A;  1DOM A;  2PZU A;  2BCO A;  3PUW A;  4Z9C B;  3R93 A;  4F7X A;  4B08 A;  3I4N G;  3NWT A;  3KDF B;  1HNW Q;  3CCQ A;  2NZO A;  4KY5 A;  4L8J A;  5CC4 A;  4EQ5 A;  1PFS A;  4GN5 A;  4BBR B;  5HGT A;  5GAH C;  4RGO S;  4QF4 A;  3S9W A;  1HZA A;  3NP8 A;  1I6H H;  4C3I G;  3NTH A;  1G51 A;  1TKW B;  2MO1 A;  2EY2 A;  3C46 A;  3PMF A;  5E7N A;  5JEA G;  4A3K H;  1BXT A;  1NJI C;  1YVC A;  4YWL A;  4X64 Q;  1KQS A;  2NWG A;  2CKZ B;  1L2F A;  1S5C D;  1N33 Q;  1RL2 A;  2CW0 C;  4GKJ Q;  3V2T A;  1XJV A;  5JJL A;  1LUZ A;  4QB4 A;  3BJU A;  5DEH A;  1JJC B;  4BY7 G;  1M4V A;  2JA7 B;  1EQT A;  1JE5 A;  5M5W H;  5M5X H;  1JIC A;  3I55 A;  2D9U A;  4FXG C;  4OWX B;  3RNU A;  3RZO H;  5LMU L;  1XMO Q;  1NE3 A;  5ELC A;  4JYA Q;  2VZA A;  1VQ7 A;  3GO5 A;  2Q2I A;  4A3I B;  3CCS A;  2DUD A;  1STG A;  3I73 A;  2EOT A;  4IOA A;  1TWF H;  3U9O A;  1RKN A;  4LFC Q;  2F4I A;  4DR1 Q;  3CAM A;  1B1Z A;  2E2J B;  3MAQ A;  5K36 G;  1R9T H;  1WTX A;  4GKK L;  2E5L Q;  2LY7 A;  3S1Q B;  4PG3 A;  4WFN 3;  4A3M G;  2PCF B;  2PNR C;  4B3R L;  1M8A A;  4LF7 L;  2B63 G;  5KRU A;  3F2C A;  3CRL C;  2RSO A;  3ND9 A;  1LTL A;  3HKS A;  1C8C A;  3PO2 B;  2OXP A;  1LTB D;  4K0K Q;  3I4M G;  1EOT A;  1VQB A;  5GQO A;  1VQ9 A;  3EA6 A;  1VQK A;  4LFA L;  1Z9F A;  4CDC C;  1PFM A;  1WCM G;  1IL2 A;  2UXC L;  2Z1C A;  1EYG A;  1NTG A;  1AH9 A;  3CCE A;  3M3Y B;  3HOY B;  3IFD A;  5M3M B;  2A6E C;  2EPB A;  2Z6K C;  2JA9 A;  1PFN A;  4IFD J;  3U58 A;  3H91 A;  3HG9 A;  2ALY B;  5IGF A;  3J80 c;  2QIL A;  1MD2 D;  4PZ7 A;  1V1P B;  2CH4 A;  4U68 A;  1PA6 A;  2UXD Q;  1STB A;  3FHW A;  1NY4 A;  4JOI A;  4MIU A;  2LSS A;  3GTM H;  1RIP A;  2IT1 A;  4GN3 B;  2B2W A;  2PQE A;  1ET6 A;  1LLR D;  2HHH L;  3VA7 A;  4JCV E;  2K5V A;  4QCL A;  2I5L X;  1AE3 A;  1E1O A;  3K0X A;  5IP9 G;  1AW7 A;  4FVM A;  2HUG A;  1MHW C;  2WB1 G;  3J80 i;  1N8R C;  2A73 B;  2MGS A;  4HTH A;  3JAM L;  4A3G G;  4LFB L;  5D14 A;  5CGK A;  1H9J A;  1HR0 Q;  3CCM A;  4KLK A;  4FXD A;  1H95 A;  4ZQ3 A;  1ET9 A;  2CVR A;  1YI2 A;  3I4O A;  1J5E Q;  3UDI A;  4DR2 Q;  1OO9 B;  2F3W A;  2K28 A;  2JA6 B;  2JA8 B;  2E2H H;  1KXL A;  1VF7 A;  1ENA A;  1J8I A;  4IFD I;  3P75 A;  3I56 A;  4K2K A;  1V9P A;  1PVO A;  2K01 A;  4ZYS A;  4GOP A;  2UU9 L;  1VMP A;  4APV A;  5LL6 S;  1EWI A;  4RHR A;  2Q8I B;  4C3H H;  3EQL C;  2NN6 I;  5IGB A;  4A76 A;  5JPM C;  3JAM c;  4NKL A;  2KEC A;  2KOL A;  3E0E A;  2AQ3 B;  1K28 A;  4EQP A;  3SVM A;  1N36 L;  1Y1W B;  2LS0 1;  1K0S A;  3F2B A;  4RH6 A;  2EYL A;  2SNM A;  4UP7 A;  3MXN A;  1SYF A;  1CHP D;  1N32 L;  1BCP C;  4RHS A;  4R4T A;  1EY5 A;  1EU4 A;  2E74 C;  5AFW A;  1H9M A;  1SXT A;  5IY0 A;  1DOL A;  4PV1 C;  1WD1 A;  4DR3 L;  2NUC A;  4UP9 A;  2AMC B;  3QG1 A;  3JAM i;  2F4V L;  2XRS D;  3X3N A;  3Q6S A;  3A55 A;  2R7Z B;  2EJM A;  4ZAI A;  4EX5 A;  5K5P A;  2N8N A;  4AYB G;  5I9O A;  4X66 Q;  1SNC A;  4BBR H;  1HUN A;  2O5I C;  5IP7 H;  1EY9 A;  3HS0 C;  3KF8 B;  3T1H Q;  4GLX A;  2EY5 A;  1SFO B;  3HEJ A;  2XTI A;  2XRQ D;  1DJR D;  2CHB D;  1B9M A;  3GTG B;  1H9R A;  4G7O C;  1FGU A;  4U67 3;  4DXF A;  5COY A;  3HOW B;  4YY3 Q;  1VQ5 A;  1SYC A;  3GV6 A;  4GS3 A;  4RKB A;  3Q22 A;  4DFA A;  1IBM Q;  3LGJ A;  3TBI B;  1JT8 A;  1FNV A;  4DK1 A;  2JA7 H;  1EFW A;  1SMX A;  2F0D A;  1ESR A;  3KUP A;  3MWY W;  2ZM6 Q;  2CFM A;  2UXB Q;  1NR4 A;  2J0T D;  3ZYY X;  5A2Q L;  1G6Z A;  5IGE A;  1CK1 A;  2IX0 A;  3NTI A;  1TS2 A;  2L0C A;  4A3I H;  3BYT B;  5C4X B;  4YIJ A;  3FMC A;  3OWE B;  4OWT B;  2AQ1 B;  1IW7 D;  1S40 A;  1X3E A;  3CMA A;  2N3S A;  4JG2 A;  1E0B A;  2E8G A;  3FDT A;  5LMN Q;  3M4O B;  1G2T A;  2E2J H;  5IYD G;  1HHV A;  2B63 B;  3SXH A;  1QZG A;  2K5D A;  2K4K A;  5FO7 B;  5C44 B;  2X6G A;  1BQQ T;  3U9S A;  3S1Q H;  1V1O A;  3HKZ E;  1AEX A;  3TZD A;  1D8L A;  1C0A A;  1NAP A;  1EOV A;  1GO3 E;  2K52 A;  3URY A;  4YHH L;  1GUS A;  3I7F A;  4LJZ C;  2M2L A;  4ZK9 B;  4PQX A;  3IAY A;  3MEF A;  1EY4 A;  1GKH A;  5CV7 A;  3PO2 H;  4JI0 L;  3D6C A;  1HFN A;  5CV9 A;  2UUC L;  2XIW A;  3TQY A;  1SMY D;  2EYH A;  2DJF C;  1Q81 C;  2N88 A;  3V05 A;  2BH8 A;  1IKL A;  3ND8 A;  1YHQ A;  1LTR D;  1GD7 A;  2NVX B;  1OXU A;  1A3U A;  1NR2 A;  4DR7 L;  2YTX A;  3M3Y H;  2JE6 I;  2RBM A;  3PUY A;  3HOY H;  2MPM A;  1CHQ D;  5M3M H;  1EY0 A;  4NDX A;  1XX8 A;  5TSS A;  3A8J E;  3D0F A;  1IYU A;  3ONA B;  4QY7 A;  1ZXT A;  1B7Y B;  4O2D A;  2PMZ B;  3FP9 A;  3M4P A;  1HNX L;  2Z9H A;  1AE2 A;  1E7Z A;  1ZYR D;  1I4G A;  1H9S A;  2IJ0 A;  5E3F A;  1JC7 A;  3K6O A;  5IYB G;  2EDG A;  5C3W A;  3TRE A;  4JBW A;  4OO1 I;  2K05 A;  2MHV A;  2RF4 A;  4R1J A;  1P16 A;  3MXG A;  1ESF A;  4DV4 L;  4IQZ A;  3S1M B;  2N55 A;  4JI4 L;  2JEA I;  4LF9 Q;  3OTO L;  4R8I A;  2K33 A;  3O13 A;  2KVM A;  3PUV A;  2VQF Q;  4GLV B;  1RD9 D;  3MA2 B;  1BF4 A;  5DM7 3;  1HJP A;  1XWE A;  3Q0A A;  3H3V C;  3TEH B;  3IL8 A;  4MN3 A;  4A3J G;  3GTP B;  3ICE A;  3CU7 A;  4H0L C;  1WD0 A;  1A0I A;  2P5Z X;  2UUB Q;  2A1A A;  3DM3 A;  4DUZ Q;  1O80 A;  4A3D B;  1OXT A;  5ELO A;  5IIF A;  4FF4 A;  4KKU A;  3QWN A;  1I4Q A;  5BN3 A;  2JA6 H;  2JA8 H;  2VB2 X;  1ZKO A;  5FJ8 H;  3NSW A;  5JVH 3;  3HOZ B;  3KLW A;  3Q24 A;  5IOC A;  4JI7 Q;  3GTL B;  1DYQ A;  1II3 A;  1F2L A;  2VY3 A;  5M3F H;  4DV2 L;  3HOU G;  1EQR A;  4JI5 L;  4AIM A;  1NCV A;  2PQA B;  3SK5 A;  1QVC A;  4ZUI A;  4CGY B;  1O7I A;  3B6Y A;  4JI8 Q;  4HAE A;  1UNS A;  2JEB I;  1GHK A;  4YCV A;  3SGI A;  5C0X H;  1Y1W H;  5IWA L;  3A5Z B;  4IPH A;  3PV0 A;  3PF4 A;  2PI2 E;  3FPP A;  3KLR A;  1FVI A;  3DEP A;  2CWP A;  4R4O A;  1EYD A;  4HSV A;  1FL0 A;  5M9O A;  3HRZ C;  1D7Q A;  1S3O A;  4N9T A;  2K32 A;  3D4D A;  4UP8 A;  1WTO A;  5CV4 A;  3FPU B;  5D65 A;  4DV3 Q;  3TN2 A;  4JBK A;  3D4W A;  1XNQ L;  1HRJ A;  3GD7 A;  4JC0 A;  2NVY B;  1N34 Q;  2EYP A;  4IUV A;  4I7Z C;  4DK3 C;  5IYC H;  4UHV A;  4X65 Q;  4C56 C;  3PIP A;  3NTK A;  1DOK A;  4G4K A;  5L37 A;  3NEN A;  2EYF A;  4DV7 Q;  3DHQ A;  4CJ2 C;  4FNF A;  1ZEQ X;  3CQZ B;  2A19 A;  3OSO A;  1WTV A;  3PF5 A;  1PDQ A;  2R7Z H;  3NK9 A;  2BDO A;  2BDN A;  4DF7 A;  4NP5 A;  2LMC B;  1PRT D;  3H0G G;  1W2B A;  2BE5 D;  2EQS A;  2R93 G;  1XMQ Q;  4LUZ A;  4BA2 I;  3K57 A;  4A3C H;  2OT2 A;  2SNS A;  3L7Z C;  2VUM B;  3VR5 A;  5AJ3 Q;  2OQ0 A;  3PQI A;  4JI6 L;  4DR4 L;  4H7B A;  1TY0 A;  4XT3 B;  1CKO A;  4MHE A;  1UEB A;  1CQV A;  2BOS A;  1SFO H;  4BY1 H;  3E5S A;  3I91 A;  1CKN B;  3GTG H;  1W6J A;  2JJQ A;  1HR0 W;  3D8G A;  2JA5 B;  2JXM B;  1QE6 A;  4C3J B;  3HOW H;  1B8A A;  4LF5 Q;  4KHP L;  1W3S A;  3QIA A;  2DNE A;  1ZYR C;  1V1Q A;  2EIF A;  2QGQ A;  1CFM A;  1EYC A;  2RSN A;  2Y0S B;  2EVB A;  2VQE L;  2RVL A;  3I90 A;  4B3S Q;  1LT4 D;  2XGT A;  5EKI A;  1ICW A;  2CQO A;  1SSO A;  1Q8I A;  3DWP A;  1Z7T A;  3AU7 A;  1PH6 A;  2CW0 D;  3OMC A;  4P75 A;  3M7G A;  2M9V A;  4RFB A;  4HID A;  2K6A A;  5C3E G;  2KJX A;  1LT6 D;  5M5Y B;  1OXS C;  2A74 C;  3SHL A;  5C4X H;  1A2U A;  4RWS C;  2I5M X;  2OTJ A;  4JOI C;  3K59 A;  1IL8 A;  1LT5 D;  3G48 A;  2B2W C;  1TU2 B;  3SE0 A;  2PI2 A;  3VYU A;  4XQJ A;  4P73 A;  5JJK A;  3F2D A;  5C44 H;  5GRO A;  3SK6 A;  1KDC A;  3IRB A;  3PO3 G;  4A3B B;  4IUR A;  3T13 A;  2B2Y C;  1HXY D;  2O4X A;  3S14 B;  4IUP A;  1JE4 A;  2WKC A;  2FIN B;  1MSH A;  1JOO A;  3H94 A;  4FO2 A;  3LNN A;  2H5X A;  3RMH A;  2IX3 A;  2R92 B;  2OWO A;  1WI5 A;  1WTR A;  1HNZ L;  1I94 L;  5LMU Q;  1U5K A;  4DA2 A;  3U50 C;  1T5X D;  5FLX E;  2NVX H;  1G91 A;  5FLM G;  1AFP A;  4LF8 L;  1EU3 A;  5KND A;  4NXN L;  2FMC A;  1SJE D;  2B29 A;  1E2V A;  4GOP C;  4B3T Q;  2YYZ A;  3A8K E;  5I6Y A;  4QMG A;  2L12 A;  4P71 A;  3K5O A;  4LF4 L;  3PIP 3;  4DAM A;  4M1U B;  2ZXO A;  4ILW A;  1PH4 A;  5BR8 Q;  1C7Y A;  3I70 A;  3KJO A;  4LK1 C;  1JWS D;  5IGC A;  4K8I A;  2LXJ A;  1PRT C;  5T1I A;  3NUC A;  3DMU A;  4XQN A;  2FMM A;  1E2W A;  3S1M H;  2BE5 C;  5M3F G;  4A3E B;  2ASB A;  1TWC B;  1SYD A;  2Z6B A;  4OO1 H;  4BS9 A;  1DM0 B;  4HN7 A;  2K7V A;  2DJG C;  2D62 A;  4IFD G;  4LFA Q;  3HZX A;  1CZW A;  5EQ0 A;  1ASY A;  3AFP A;  2CCZ A;  3GTP H;  3E9H A;  1EYA A;  1SJH D;  5HY6 A;  2UUA L;  2HIV A;  3M4Q A;  3N6R A;  4LAA A;  2NN6 G;  5ISR A;  2K5W A;  2DY7 A;  1I4R A;  1L1O B;  3HOV G;  3GP7 A;  2C5C A;  4A3D H;  5LMN W;  4NB3 A;  3GV3 A;  2G9D A;  4A3L H;  5CV8 A;  1YHA A;  3HOZ H;  5CV5 A;  1SNM A;  1YNJ D;  1QUQ B;  1NMF A;  1VQE A;  1G6P A;  4OEM B;  1VQH A;  3VYS A;  5KGU A;  2SOB A;  4DK6 C;  1K8O A;  4KD3 A;  1WJJ A;  1HA6 A;  4GN4 B;  1SNQ A;  4HMJ A;  3SK8 A;  4DNI A;  3M7N A;  5CR3 A;  1VQ8 A;  1SNO A;  1ICF B;  1X32 A;  4YCU A;  1EQQ A;  4JV5 L;  3HOX B;  3CP0 A;  3CRK C;  5I9P A;  3STB D;  2JN4 A;  1XPO A;  4ZKB B;  1JCK B;  1VQ4 A;  3J7A 5;  5FOB B;  4X62 L;  2K03 A;  4B3M L;  3K7A H;  1K83 B;  2NVY H;  2NZH A;  4BY1 G;  1W6K A;  3Q8D A;  2F0W A;  4QIW E;  1HUM A;  3CQZ H;  3RR5 A;  1BCP D;  1G29 1;  3TS2 A;  4C1N K;  4NXM Q;  2OEO A;  4CBV A;  2UU9 Q;  1NNX A;  3FKI B;  1F2M A;  1KAW A;  4JI3 L;  1BKB A;  4KTA A;  2QCP X;  1PRT F;  1QG7 A;  3J80 L;  3DLL A;  3NE5 B;  2VUM H;  1VQF A;  2YU9 B;  1A3V A;  2XWJ B;  1N36 Q;  4K8J A;  1S5F D;  2C9O A;  5COR A;  3T51 B;  5E4W C;  4R8N A;  2KCM A;  3OW2 A;  1SYE A;  3UE0 A;  4A3F G;  2V1C C;  3NWS A;  4OGQ C;  4QIW B;  2JA5 H;  1STE A;  3TS0 A;  4C3J H;  3OYY A;  4C2M H;  1PV4 A;  4WJW A;  1EIH A;  5HGQ A;  4HJA A;  1BBX C;  1QOH A;  1ENF A;  1BOS A;  4E6I A;  2ZTD A;  1PYS B;  2Q2H A;  4ME5 A;  1NMG A;  3J7Y W;  2K5H A;  4B9X A;  3KBX A;  4DU9 A;  3BDL A;  1VQJ A;  2K1B A;  4RGM A;  4EVO A;  4BBS B;  1TS3 A;  2Z0S A;  1HNW L;  5JJI A;  2B3G A;  5C0X J;  1PH9 A;  4LW1 A;  2ENB A;  5M5Y H;  4CJ1 B;  3A7L A;  2I0Q A;  1B3A A;  1DZ1 A;  4KK7 A;  1U9R A;  1Q7Y C;  5C4J B;  2GA4 B;  4OHJ A;  4ME3 A;  2O2L D;  2RHS B;  4FXK C;  4H13 C;  4DV0 Q;  2HQE A;  1IYJ B;  1PH1 A;  1JB3 A;  4YWK A;  4GOP B;  3C1E A;  5GAG C;  1IKM A;  4A3B H;  3BU2 A;  1JR0 D;  1LTA D;  2QDL A;  1EWC A;  2Q8R E;  2XN9 C;  5T1G A;  4CKC A;  2MQH A;  3I3C A;  4DN4 M;  1N33 L;  1YNJ C;  1BNZ A;  1LTS D;  3HKZ G;  5BN5 A;  4GKJ L;  1K9M C;  1EEF D;  3EVQ A;  1ML0 D;  2K14 A;  3MXN B;  4JI1 Q;  1PFB A;  2NTT A;  1WOC A;  2R92 H;  4A93 H;  1PXU A;  1Q1E A;  1PRT B;  1VQN A;  3U4Z A;  3FEW X;  1XMO L;  2PO4 A;  1PLF A;  4JYA L;  2E2I B;  1V1P A;  5JJZ A;  2J4X A;  1A62 A;  5C0X I;  1SRO A;  1SBB B;  4B9W A;  3STB C;  4ZUJ A;  4BXX H;  1C9O A;  3D6W A;  4L63 B;  3H3V H;  4K5V A;  4HR7 B;  4LFC L;  4HCS A;  3VDY A;  1Y1V B;  4DR1 L;  1S5E D;  2CWA A;  1D5X C;  4J8Q A;  1JWU D;  3F8T A;  2L55 A;  4FF1 A;  1LYL A;  1VQM A;  2IY5 B;  4KJN A;  1U4M A;  3I4N B;  4Y52 H;  2PW5 A;  4KD4 A;  4YHH Q;  4A3K G;  1SYG A;  4CDE C;  3NEL A;  3HP3 A;  2RDG A;  4K5W A;  1KC8 C;  1VQD A;  2UUC Q;  3NPP A;  1YIJ A;  5J39 A;  5GAE C;  4A3E H;  1J9O A;  1UE7 A;  1TWC H;  2NVQ B;  4JVZ A;  1KRS A;  1X3Q A;  4DUY L;  4C3I B;  3RLF A;  4DAY A;  2VNU D;  4LMQ D;  4N9P A;  3UE1 A;  4HED A;  1PTO D;  4J6H A;  1E1T A;  3CPF A;  3GDE A;  2NTS A;  5EKL A;  2B2U A;  3D31 A;  1X65 A;  3D4R A;  1XNR L;  3KFU A;  3T1Y Q;  1U4P A;  4HCE A;  1TWH B;  1STN A;  2PNH A;  4BY7 B;  2SDF A;  4TRD A;  1HQR D;  3R2T A;  2UXD L;  1KHI A;  3OWF A;  2EY6 A;  1EQV A;  4CDF C;  5EJW A;  3T53 B;  3IKJ A;  1JOQ A;  1QB5 D;  1B2T A;  2B2V A;  2QEX A;  2F1M A;  3I4L A;  4L5R C;  5CYU A;  3MXU A;  1IYV A;  3ULJ A;  3OTO Q;  3TDQ A;  2L5T A;  2HCI A;  3J81 E;  1Q12 A;  3HOX H;  3TRZ A;  2MNA A;  4AQY Q;  2WAQ G;  1SE2 A;  3RLN A;  1K8M A;  2V4D A;  2Q2U A;  1HR0 L;  4ID6 A;  1Y8P B;  1K83 H;  5C3X A;  4OX9 Q;  5EBD A;  4PMW A;  1K8A C;  4A3M B;  3MFG A;  1SE4 A;  4RG1 A;  2NYZ D;  1QVF A;  1SRU A;  4F88 A;  4DKA C;  5G3L D;  3KK7 A;  2DNC A;  3KF8 A;  3BVZ A;  1BCP F;  1G2S A;  3OPO A;  3WWV A;  3I4M B;  1Y8N B;  2VB3 X;  3KF6 B;  3FKI H;  3LX0 A;  4DR5 Q;  5CV6 A;  4DR6 Q;  1ENC A;  3F2U A;  2PMZ E;  4RCO A;  1KNA A;  1B4O A;  4KMU C;  2YU9 H;  1WCM B;  4EQO A;  1SN8 A;  1VQ6 A;  3S16 B;  1BBW A;  1P8L A;  1U0L A;  2EYM A;  2F0P A;  3QOJ A;  4YCW A;  3SK4 A;  1WTQ A;  2EXD A;  3DWA A;  3NBH A;  1GOZ A;  3E3X A;  2KBN A;  5C4H A;  3V96 A;  1F9R A;  1MBY A;  1CTM A;  3AFQ A;  4HIK A;  2KCT A;  3BVG A;  4F8M A;  1XNQ Q;  1EZ8 A;  2XSC A;  1IBK Q;  2B2T A;  4EQN A;  5CBA E;  1STA A;  2GVB A;  4DV1 L;  1VQL A;  1QVG A;  5J22 A;  1JB7 A;  1I3Q B;  3A74 A;  1X55 A;  4MNO A;  3PIO A;  1STH A;  1MJE A;  1LAC A;  4BBS H;  4XT1 B;  2R61 A;  1G8Z D;  1JQY D;  1PH5 A;  3H6M A;  2AWN A;  5EPJ A;  2F0Q A;  1SE8 A;  2K50 A;  4JK1 C;  2VS1 A;  2PW7 A;  4DV6 L;  4X66 L;  5C4J H;  2WB1 B;  4X6A H;  5HUR A;  3M9B A;  4A93 G;  4V19 0;  4A3G B;  1MGS A;  1PTO C;  4JI6 Q;  2HIX A;  4DR4 Q;  4HMI A;  2ICE C;  2F0G A;  2KHJ A;  3KOJ A;  5C5L A;  2EJG C;  3RLO A;  2BH2 A;  2KQ3 A;  1X9N A;  4C3H G;  3NQT A;  2HCC A;  2CQA A;  5JVG 3;  1CI3 M;  3PSI A;  4POG A;  1FNW A;  1QIL A;  2F52 A;  2R7D A;  4DXG A;  1IBL Q;  2XWB B;  2NB0 A;  4YY3 L;  2F3V A;  1PH7 A;  1K73 C;  1N9W A;  3J7Z C;  1IBM L;  1BCP B;  4OXP A;  4KKS A;  2VQE Q;  1KIX A;  1LTG D;  1RJT A;  1QWY A;  5JPN C;  2ZJR A;  1OXV A;  1JOR A;  1GVP A;  5IT9 E;  4AYB E;  1ROD A;  2E2I H;  3W1G A;  1E24 A;  1XXG A;  1WTW A;  4R4Q A;  2M00 A;  1CQF A;  5KEE A;  5GAD C;  1V8Q A;  3OOC A;  1F9Q A;  1CZG A;  2Z4I A;  4C1N I;  1B9N A;  3A56 A;  2L15 A;  1I6H B;  3EJI A;  3T56 B;  1Y1V H;  3E0J A;  3UDF A;  4UPA A;  2Q2T A;  3F1Z A;  4WOR A;  5LMN L;  1L0W A;  4I7A A;  2IWH A;  4UAI A;  4BBR G;  4X3S A;  2F0O A;  5IP7 G;  2G9H D;  4KJO A;  3I4N H;  3CXC A;  1O7Y A;  4FF3 A;  4ZLT F;  3JC6 6;  5ELN A;  3T16 A;  1ASZ A;  3N52 A;  4AYB B;  1FJG L;  4WRD A;  3G6J B;  2F0I A;  5J1Z A;  5KIX A;  2MO0 A;  4ALP A;  4S3S A;  4QL5 A;  2EJF C;  4P72 A;  1EL0 A;  1K8G A;  5M5X B;  1NUC A;  2NVQ H;  3WOF A;  1YJ9 A;  3TP6 A;  1B50 A;  4C3I H;  4YWM A;  3SR1 A;  3DXJ C;  5JEA H;  2Y0S E;  4HIM A;  1EIF A;  2PYK A;  5IGG A;  2JA7 G;  3GTO B;  4XIG S;  4RGN A;  1PTO F;  4NXN Q;  1U4R A;  2ATW A;  4HIO A;  2ZT9 C;  2PQA A;  3R8B A;  3G7L A;  4LF4 Q;  4CKB A;  1SAP A;  1TT2 A;  3E9I A;  4A3I G;  1EUJ A;  1TWH H;  3T4A C;  1Q90 A;  3CF5 A;  4DV5 Q;  2EXZ A;  4BY7 H;  3PIO 3;  2JP1 A;  3BYY B;  4GLA C;  4GNX A;  1X6O A;  2F3I A;  3MC0 B;  1MIU A;  1B44 D;  5KNB A;  3H09 A;  1VF5 C;  3CCU A;  5ELD A;  1AP0 A;  5BN4 A;  1EEI D;  2ZTE A;  4LF9 L;  2VQF L;  1IXR A;  3KYH C;  3AB9 A;  3PCO B;  3CKI B;  2WP8 J;  4FF2 A;  3BDO A;  2VL6 A;  3PO2 G;  4LF6 L;  1C4Q A;  3J7A F;  1FNU A;  4A3M H;  2UUB L;  5JOB A;  2A6H C;  1S5B D;  2IX1 A;  3M4O H;  1O78 A;  4ABN A;  1X3G A;  2GVA A;  2B63 H;  1TXY A;  4UDU C;  5G3L F;  4PMB A;  3S1N B;  1BDO A;  5FKA C;  3BVM A;  4JI7 L;  3K7U C;  4J1M A;  2F0H A;  3RN5 A;  3I4M H;  3HOY G;  3RN2 A;  1E2Z A;  1CKN A;  5M3M G;  3UDG A;  1YNN C;  4JI2 L;  4DAV A;  2ES2 A;  3S17 B;  1HQM C;  1T9H A;  4TKO B;  2D0P A;  1TS5 A;  1WCM H;  4JI8 L;  1I4P A;  3S2D B;  3S16 H;  1VQO A;  4DK0 A;  2QDB A;  1KAB A;  1PTO B;  4JV5 Q;  2F03 A;  4K2L A;  2PZT A;  4NMZ A;  1HPC A;  2GN5 A;  2K04 A;  3H3V I;  2KUM A;  3LWU A;  2TMP A;  3K58 A;  2EZV A;  2HDL A;  1FGB D;  4B3M Q;  4DV3 L;  4KY7 A;  2MJ8 A;  1VQG A;  2L11 A;  4KHZ A;  1D1K A;  4X65 L;  3MEH A;  4DV7 L;  4LNQ A;  1I3Q H;  3NQI A;  5KYL A;  1EWH A;  1F2Y A;  4G57 A;  3ITP A;  4CDD C;  3DUZ A;  5EPK A;  2F0K A;  1ILP A;  5KNC A;  4GKK Q;  4LWC A;  4L5S A;  3CD6 A;  1Q8K A;  2FXQ A;  1RHP A;  4B3R Q;  2JA6 G;  1SND A;  4JBM A;  4IPG A;  4LF7 Q;  2JA8 G;  1XMQ L;  5FJ8 G;  2AUK A;  4BA1 I;  2OTL A;  1I5F A;  2OF1 A;  4L6T B;  1KD1 C;  4ODG A;  3PUZ A;  4A3J B;  2E2D C;  4O1N A;  2IHF A;  4EGV A;  1OTC A;  1DON A;  2K75 A;  4K5X A;  3I72 A;  4ZRZ A;  1LT3 D;  1R4Q B;  3A8I E;  3VYR A;  2UXC Q;  5IE8 A;  3MZ5 A;  3AYH B;  5FLX L;  4LF5 L;  5C0X G;  1Y1W G;  5F2D A;  4HSP A;  3CCJ A;  2B8G A;  4RAU C;  3QB3 A;  2KCC A;  1X3P A;  2I5H A;  3A5U A;  3U4V A;  1Q1B A;  1SR3 A;  2QW7 A;  1AN8 A;  3K5M A;  3HOU B;  3A0J A;  2F0V A;  1GHJ A;  4B3S L;  1RTO A;  2F0T A;  2RDF A;  4KN7 C;  5FK9 C;  4XTC S;  3WOE A;  2B2U C;  2D5D A;  3SDZ A;  3GTL H;  4CKE A;  4KY6 A;  4XYQ A;  5DAU A;  5IYC G;  3TME A;  4I65 A;  3VR2 A;  1A15 A;  3VR4 A;  3C1F A;  4N8X 1;  2F0F A;  2HHH Q;  4AH6 A;  1PHJ A;  1TWA B;  1MKH A;  2R7Z G;  3DEO A;  3MFY A;  3ERO A;  1Q46 A;  4TQU S;  5I4D A;  4GZY C;  2K5N A;  3FRP B;  5FLX c;  3S24 A;  2B2V C;  1L0X B;  2F0N A;  4XDX A;  1V43 A;  2MFI A;  4IJL A;  1OXX K;  3RD4 A;  4MTN A;  4A3C G;  1VCI A;  4LFB Q;  4KN4 C;  4IJH A;  1IHZ A;  4FDB A;  3J80 E;  2IW3 A;  3KDF A;  3CME A;  4R4I A;  1HZC A;  3J81 j;  3BS1 A;  5I2X A;  4KV6 A;  3G6E A;  3BZD B;  3H0G B;  3L2P A;  3ERQ A;  4HJ5 A;  2ID0 A;  1YNX A;  3S15 B;  2R93 B;  1L1O A;  3HOW G;  4K14 A;  3HGB A;  3GTK B;  3MHB A;  1UAP A;  2LXK A;  4QGU A;  3S2H B;  1HA5 A;  1O7L A;  5E4X A;  3GTO H;  1QUQ A;  1EFI D;  1JOK A;  3BDC A;  5IGD A;  4RMF A;  5ELF A;  1TQO A;  4B3T L;  2KEE A;  2F0M A;  5C5M A;  1GM5 A;  1PZK D;  2JQO A;  4PMC A;  2A8V A;  1MI2 A;  2AWO A;  2A69 D;  1R4P B;  5C4X G;  1F2Z A;  3K5N A;  3RZD B;  1TS4 A;  1N32 Q;  1KTK A;  2L4N A;  5BR8 L;  1LO5 D;  1VQC A;  3VR3 A;  2K5Q A;  2JK8 A;  4IN3 A;  1D2B A;  2FHT A;  1F9P A;  1Q86 C;  1WTH A;  1HTL D;  5C3E B;  4DR3 Q;  5C44 G;  5I2Y A;  2LKV A;  1BBU A;  1K0R A;  2F4V Q; 
#chains in the Genus database with same CATH homology
 1TY2 A;  2B2T C;  2KCN A;  3JAM E;  1D5M C;  2IPK D;  3AMU A;  1CM9 A;  5C6A A;  3BG3 A;  3TZU A;  2FFK B;  3PO3 B;  3TP8 A;  5FO8 B;  4X3K A;  1AZQ A;  1TR5 A;  2PPB C;  4DGZ A;  2EE1 A;  2RKS A;  1U4L A;  3PUX A;  3E6Z X;  4R9W A;  1I6V C;  3KLS X;  3S1R B;  1QCB D;  3VYT A;  5JEA J;  2R3Z A;  1KDB A;  1XYI A;  2DN8 A;  4ULL A;  3LWE A;  1GXD C;  4BWG B;  1SE3 A;  2B2Y A;  1PTO H;  3P1H A;  4M8A A;  2J7Z A;  2ICI A;  1QNU A;  4G7H C;  3GTJ B;  3RUZ A;  4OO1 G;  5FO9 B;  1QJO A;  1FD7 D;  2BA0 A;  5M3F B;  4IUU A;  4XYO A;  4IAL A;  2JYO A;  2R6G A;  4TSS A;  2WV6 D;  1LV9 A;  1FR3 A;  1KLG D;  2E76 C;  2Z4H A;  1D6E C;  1T5E A;  4Y7N B;  2O5J C;  5EKK A;  3SEB A;  1EZ6 A;  3HOV B;  4H44 C;  3WDN A;  1PMR A;  2A69 C;  3K5L A;  4ZKC B;  1VDZ A;  1RCV D;  1I4H A;  4OIJ A;  4DAP A;  2DY8 A;  4PNY A;  3R2I A;  1ILQ A;  1WTP A;  5A2Q E;  4NW2 A;  1PZI D;  3KBG A;  4KHV A;  3M85 A;  5A35 A;  1KAA A;  4Q0F A;  2F0S A;  1CA6 A;  4QUF A;  3L9A X;  3MVV A;  2HDM A;  3X3M A;  1A2T A;  5IOD A;  2F0U A;  3VR6 A;  2A5H A;  4BY1 B;  1LTI D;  1DXM A;  2X69 A;  4IZ8 A;  1HFG A;  5CMD A;  1C48 A;  1MSG A;  5LHY 1;  3M4Y A;  3NXW A;  2KA7 A;  1I50 B;  3CHB D;  3J7A V;  4RGT A;  3A7A B;  3OW7 A;  4C3J G;  2EYO A;  5CBE E;  5LL6 X;  3OIP A;  1Z47 A;  3MTS A;  2AQ2 B;  3MXP A;  3D3R A;  4A3F B;  4X3U A;  2JSO A;  1TWG B;  2E75 C;  4IUQ A;  4K6D A;  1TVX A;  3OIQ A;  3J81 L;  1H9S B;  5EBC A;  3QOL A;  4RKL A;  1Y69 U;  3UI2 A;  1SYB A;  4XQQ A;  4DNR B;  1Q3L A;  2BA1 A;  1PZJ D;  3FVQ A;  3IFT A;  4IUT A;  4X3T A;  1Y8O B;  1KLU D;  2SEB D;  1A6X A;  2L1B A;  5JAV A;  1O7Z A;  1GUG A;  1DD2 A;  1TII D;  3GQB A;  2F0E A;  1GJX A;  5C4Z A;  2ZXR A;  2ZXP A;  3GTQ B;  4OL7 A;  2WKD A;  5E1F A;  3HKZ B;  5DNF A;  2NVT B;  4K6L A;  1AZP A;  3KLS A;  2I46 A;  2EY1 A;  2VXW A;  4IUN A;  4V0B A;  2A6H D;  5DM6 3;  1L0Y B;  2NZ1 D;  1EY6 A;  3EFX D;  5ELE A;  5EGT A;  1STY A;  4RCN A;  1XTC D;  2MUY A;  1YNN D;  5ELB A;  2XVS A;  2LFN A;  3W3A A;  2Z8L A;  1I4X A;  4FP5 D;  3VA5 A;  2I07 B;  3R3O A;  1GUT A;  1Z6H A;  4A3K B;  1BUV T;  1SDF A;  4KKT A;  5KYI A;  2B39 A;  2QKI C;  2A68 D;  3OMG A;  2KHS A;  1B53 A;  4IFD H;  1GUO A;  3P20 A;  5D3I B;  2EYJ A;  1VMC A;  5M5W B;  1IW7 C;  2NN6 H;  1CA5 A;  3RZO B;  1UUP A;  2H1E A;  5IT9 L;  4P2C B;  1UEA B;  2MP1 A;  3K7A B;  5I6W A;  1S4Z A;  1TWF B;  2WAC A;  2KED A;  2RQX A;  1S5D D;  5NUC A;  1D1I A;  3I8Z A;  1R9T B;  2TSS A;  2WII B;  1EIG A;  1FYC A;  3TP5 A;  3QJY A;  1SMY C;  2H4O A;  1BO0 A;  3NBI A;  1PYW D;  1A3T A;  3Q23 A;  2PZW A;  3L3O C;  2F0J A;  2WAQ B;  1KNE A;  1RTN A;  1KDA A;  1HCZ A;  1F9S A;  3DWQ A;  4G7Z C;  5K36 H;  4OIK A;  4C2M B;  3P7J A;  1D5Z C;  1CT1 D;  2IL8 A;  1NSN S;  4O42 A;  3QO2 A;  2RDH A;  1SEB D;  2RA4 A;  2QF7 A;  1GUN A;  1LTT D;  3C2P A;  3GTM B;  1ONL A;  2FJ2 A;  2D2C C;  1EY7 A;  1SNP A;  4CJ0 B;  1WVL A;  2F0L A;  3C3L A;  1GUW A;  1JWM D;  2B8F A;  4QUC A;  2AUJ D;  2X6L A;  1RF2 D;  4Q5V A;  2XNA C;  3W2D A;  2L9H A;  3A54 A;  2A68 C;  4DNT B;  1EY8 A;  4FYD A;  2NBF A;  4F87 A;  4A93 B;  2E2H B;  2QEJ C;  4XXE A;  1HTP A;  1F77 A;  3TP7 A;  1BR9 A;  1RDP D;  3NHH A;  4C3H B;  3K0Y A;  1QNK A;  3OHX C;  5D3D A;  5EPL A;  4RA8 A;  2Q8T A;  1LAB A;  1DCZ A;  1H9K A;  3TSS A;  3DM1 A;  4KI0 A;  2WIN B;  4CHT B;  2A6E D;  1DOM A;  2PZU A;  2BCO A;  3PUW A;  4Z9C B;  3R93 A;  4F7X A;  4B08 A;  3NWT A;  4KY5 A;  4L8J A;  5CC4 A;  4BBR B;  5HGT A;  4RGO S;  4QF4 A;  3S9W A;  3NP8 A;  4C3I G;  3NTH A;  1TKW B;  2EY2 A;  3C46 A;  3PMF A;  5JEA G;  1BXT A;  2NWG A;  1S5C D;  2CW0 C;  3V2T A;  4QB4 A;  5DEH A;  2JA7 B;  1M4V A;  1EQT A;  1JIC A;  2D9U A;  4FXG C;  5ELC A;  3GO5 A;  4A3I B;  1STG A;  3I73 A;  2EOT A;  3U9O A;  1RKN A;  2F4I A;  1B1Z A;  2E2J B;  3MAQ A;  5K36 G;  1WTX A;  2LY7 A;  3S1Q B;  4WFN 3;  2PCF B;  2PNR C;  1M8A A;  5KRU A;  3CRL C;  2RSO A;  3ND9 A;  1C8C A;  3PO2 B;  2OXP A;  1LTB D;  1EOT A;  3EA6 A;  1PFM A;  2Z1C A;  3M3Y B;  3HOY B;  3IFD A;  5M3M B;  2A6E C;  2EPB A;  1PFN A;  4IFD J;  3H91 A;  3HG9 A;  5IGF A;  2QIL A;  1MD2 D;  1V1P B;  4U68 A;  1STB A;  4MIU A;  2IT1 A;  2B2W A;  2PQE A;  1ET6 A;  1LLR D;  3VA7 A;  4QCL A;  1AW7 A;  4FVM A;  2HUG A;  2A73 B;  2MGS A;  4HTH A;  3JAM L;  5D14 A;  5CGK A;  1H9J A;  4FXD A;  4ZQ3 A;  1ET9 A;  2CVR A;  1OO9 B;  2F3W A;  2K28 A;  2JA6 B;  2JA8 B;  1VF7 A;  1ENA A;  1J8I A;  4IFD I;  3P75 A;  4K2K A;  2K01 A;  4ZYS A;  1VMP A;  5LL6 S;  4RHR A;  2Q8I B;  3EQL C;  2NN6 I;  5IGB A;  5JPM C;  4NKL A;  2KEC A;  2KOL A;  2AQ3 B;  4EQP A;  3SVM A;  1Y1W B;  2LS0 1;  4RH6 A;  2EYL A;  2SNM A;  3MXN A;  1SYF A;  1CHP D;  1BCP C;  4RHS A;  1EY5 A;  1EU4 A;  2E74 C;  5AFW A;  1H9M A;  1SXT A;  1DOL A;  4PV1 C;  1WD1 A;  2NUC A;  3QG1 A;  2XRS D;  3X3N A;  3Q6S A;  3A55 A;  2R7Z B;  2EJM A;  4ZAI A;  5K5P A;  5I9O A;  1SNC A;  1HUN A;  2O5I C;  1EY9 A;  3HS0 C;  2EY5 A;  1SFO B;  3HEJ A;  2XRQ D;  1DJR D;  2CHB D;  1B9M A;  3GTG B;  1H9R A;  4G7O C;  4U67 3;  4DXF A;  5COY A;  3HOW B;  1SYC A;  3GV6 A;  4RKB A;  3Q22 A;  4DFA A;  3TBI B;  1FNV A;  4DK1 A;  2F0D A;  1ESR A;  3KUP A;  3MWY W;  1NR4 A;  2J0T D;  3ZYY X;  5A2Q L;  1G6Z A;  5IGE A;  1CK1 A;  2IX0 A;  3NTI A;  1TS2 A;  2L0C A;  3BYT B;  5C4X B;  4YIJ A;  3FMC A;  3OWE B;  2AQ1 B;  1IW7 D;  1E0B A;  3M4O B;  3FDT A;  1HHV A;  1G2T A;  2B63 B;  3SXH A;  2K5D A;  5FO7 B;  5C44 B;  2X6G A;  1BQQ T;  3U9S A;  1V1O A;  1AEX A;  3TZD A;  1NAP A;  3URY A;  1GUS A;  4LJZ C;  2M2L A;  4ZK9 B;  4PQX A;  3IAY A;  1EY4 A;  5CV7 A;  3D6C A;  1HFN A;  5CV9 A;  2XIW A;  1SMY D;  2EYH A;  2N88 A;  3V05 A;  1IKL A;  3ND8 A;  1LTR D;  2NVX B;  1OXU A;  1A3U A;  1NR2 A;  2JE6 I;  2RBM A;  3PUY A;  2MPM A;  1CHQ D;  1EY0 A;  4NDX A;  1XX8 A;  5TSS A;  3A8J E;  1IYU A;  3ONA B;  1ZXT A;  2PMZ B;  1ZYR D;  1I4G A;  1H9S A;  2IJ0 A;  5E3F A;  1JC7 A;  3K6O A;  2EDG A;  5C3W A;  4JBW A;  4OO1 I;  2K05 A;  2MHV A;  3MXG A;  1ESF A;  4IQZ A;  3S1M B;  2N55 A;  2JEA I;  4R8I A;  2K33 A;  3O13 A;  2KVM A;  3PUV A;  1RD9 D;  3MA2 B;  1BF4 A;  5DM7 3;  1XWE A;  3Q0A A;  3H3V C;  3IL8 A;  4MN3 A;  3GTP B;  3CU7 A;  4H0L C;  1WD0 A;  1O80 A;  4A3D B;  1OXT A;  5IIF A;  4FF4 A;  4KKU A;  3QWN A;  1I4Q A;  5BN3 A;  2VB2 X;  1ZKO A;  3NSW A;  5JVH 3;  3HOZ B;  3Q24 A;  5IOC A;  3GTL B;  1DYQ A;  1II3 A;  1F2L A;  1NCV A;  3SK5 A;  4ZUI A;  4CGY B;  4HAE A;  1UNS A;  2JEB I;  1GHK A;  5C0X H;  3PV0 A;  3FPP A;  3KLR A;  3DEP A;  1EYD A;  4HSV A;  5M9O A;  3HRZ C;  4N9T A;  2K32 A;  3D4D A;  1WTO A;  5CV4 A;  3FPU B;  5D65 A;  1HRJ A;  3TN2 A;  3D4W A;  3GD7 A;  2NVY B;  2EYP A;  4IUV A;  4I7Z C;  4C56 C;  3NTK A;  1DOK A;  4G4K A;  2EYF A;  3DHQ A;  4CJ2 C;  4FNF A;  1ZEQ X;  3CQZ B;  3OSO A;  1WTV A;  1PDQ A;  3NK9 A;  2BDO A;  2BDN A;  4DF7 A;  4NP5 A;  2LMC B;  1PRT D;  2BE5 D;  4BA2 I;  3K57 A;  2VUM B;  2OT2 A;  2SNS A;  3L7Z C;  3VR5 A;  4H7B A;  1TY0 A;  4XT3 B;  4MHE A;  1CQV A;  2BOS A;  3E5S A;  3I91 A;  1W6J A;  3D8G A;  2JA5 B;  2JXM B;  1QE6 A;  4C3J B;  3QIA A;  2DNE A;  1ZYR C;  1CFM A;  1EYC A;  2RSN A;  2Y0S B;  2EVB A;  2RVL A;  3I90 A;  1LT4 D;  5EKI A;  1ICW A;  1SSO A;  1Q8I A;  3DWP A;  1Z7T A;  3AU7 A;  2CW0 D;  3OMC A;  3M7G A;  2M9V A;  4RFB A;  2K6A A;  2KJX A;  1LT6 D;  5M5Y B;  1OXS C;  2A74 C;  3SHL A;  1A2U A;  4RWS C;  3K59 A;  1IL8 A;  1LT5 D;  2B2W C;  1TU2 B;  3SE0 A;  3VYU A;  4XQJ A;  3SK6 A;  1KDC A;  4A3B B;  4IUR A;  3T13 A;  2B2Y C;  1HXY D;  2O4X A;  3S14 B;  4IUP A;  1JE4 A;  2WKC A;  2FIN B;  1MSH A;  1JOO A;  3H94 A;  4FO2 A;  3LNN A;  3RMH A;  2IX3 A;  2R92 B;  1WTR A;  4DA2 A;  1T5X D;  5FLX E;  1G91 A;  1AFP A;  1EU3 A;  5KND A;  2FMC A;  1SJE D;  1E2V A;  2YYZ A;  3A8K E;  5I6Y A;  4QMG A;  2L12 A;  3K5O A;  3PIP 3;  4M1U B;  2ZXO A;  4ILW A;  3I70 A;  4LK1 C;  1JWS D;  5IGC A;  4K8I A;  1PRT C;  5T1I A;  3NUC A;  3DMU A;  4XQN A;  2FMM A;  1E2W A;  2BE5 C;  4A3E B;  1TWC B;  1SYD A;  4OO1 H;  4BS9 A;  1DM0 B;  4HN7 A;  2K7V A;  2D62 A;  4IFD G;  3HZX A;  1CZW A;  5EQ0 A;  1EYA A;  1SJH D;  3N6R A;  4LAA A;  2NN6 G;  5ISR A;  2K5W A;  2DY7 A;  1I4R A;  3GP7 A;  2C5C A;  3GV3 A;  2G9D A;  5CV8 A;  5CV5 A;  1SNM A;  1YNJ D;  3VYS A;  5KGU A;  2SOB A;  1K8O A;  4KD3 A;  1HA6 A;  1SNQ A;  4HMJ A;  3SK8 A;  3M7N A;  5CR3 A;  1SNO A;  1X32 A;  3HOX B;  3CRK C;  5I9P A;  4ZKB B;  1JCK B;  5FOB B;  2K03 A;  1K83 B;  1W6K A;  2F0W A;  1HUM A;  1BCP D;  1G29 1;  4C1N K;  2OEO A;  4CBV A;  3FKI B;  1F2M A;  4KTA A;  2QCP X;  1PRT F;  1QG7 A;  3J80 L;  3NE5 B;  2YU9 B;  1A3V A;  2XWJ B;  4K8J A;  1S5F D;  2C9O A;  5COR A;  3T51 B;  5E4W C;  4R8N A;  1SYE A;  3NWS A;  4OGQ C;  4QIW B;  1STE A;  4WJW A;  1EIH A;  1BBX C;  1QOH A;  1ENF A;  1BOS A;  4E6I A;  4ME5 A;  3J7Y W;  4B9X A;  3KBX A;  4DU9 A;  3BDL A;  2K1B A;  4RGM A;  4EVO A;  4BBS B;  1TS3 A;  5C0X J;  2ENB A;  4CJ1 B;  3A7L A;  1B3A A;  1DZ1 A;  4KK7 A;  1U9R A;  5C4J B;  2GA4 B;  4OHJ A;  2O2L D;  4FXK C;  4H13 C;  2HQE A;  1JB3 A;  3C1E A;  1IKM A;  1JR0 D;  1LTA D;  5T1G A;  1EWC A;  2Q8R E;  4CKC A;  4DN4 M;  2XN9 C;  3I3C A;  1YNJ C;  1BNZ A;  1LTS D;  5BN5 A;  1EEF D;  3EVQ A;  1ML0 D;  1PFB A;  2NTT A;  1PXU A;  1Q1E A;  1PRT B;  3FEW X;  2PO4 A;  1PLF A;  2E2I B;  1V1P A;  5JJZ A;  2J4X A;  5C0X I;  1SBB B;  4B9W A;  4ZUJ A;  3D6W A;  4L63 B;  4K5V A;  4HR7 B;  4HCS A;  1Y1V B;  1S5E D;  1D5X C;  4J8Q A;  1JWU D;  2L55 A;  4FF1 A;  4KJN A;  1U4M A;  3I4N B;  2PW5 A;  4KD4 A;  1SYG A;  3HP3 A;  2RDG A;  4K5W A;  3NPP A;  5J39 A;  1J9O A;  2NVQ B;  1X3Q A;  4C3I B;  3RLF A;  4DAY A;  2VNU D;  4LMQ D;  4N9P A;  4HED A;  1PTO D;  4J6H A;  2NTS A;  5EKL A;  2B2U A;  3D31 A;  3D4R A;  1U4P A;  4HCE A;  1TWH B;  1STN A;  4BY7 B;  2SDF A;  4TRD A;  1HQR D;  3R2T A;  3OWF A;  2EY6 A;  1EQV A;  5EJW A;  3T53 B;  3IKJ A;  1JOQ A;  1QB5 D;  1B2T A;  2B2V A;  2F1M A;  3I4L A;  5CYU A;  3MXU A;  1IYV A;  3TDQ A;  2L5T A;  2HCI A;  3J81 E;  1Q12 A;  1SE2 A;  1K8M A;  2V4D A;  4ID6 A;  1Y8P B;  5C3X A;  5EBD A;  4PMW A;  4A3M B;  3MFG A;  1SE4 A;  2NYZ D;  4F88 A;  5G3L D;  3KK7 A;  2DNC A;  3KF8 A;  3BVZ A;  1BCP F;  1G2S A;  3OPO A;  3I4M B;  1Y8N B;  2VB3 X;  3LX0 A;  5CV6 A;  1ENC A;  3F2U A;  4RCO A;  1KNA A;  1B4O A;  4KMU C;  1WCM B;  4EQO A;  3S16 B;  1WTQ A;  3QOJ A;  2EYM A;  2F0P A;  3SK4 A;  3NBH A;  3DWA A;  1GOZ A;  5C4H A;  3V96 A;  1F9R A;  1MBY A;  1CTM A;  3BVG A;  4F8M A;  1EZ8 A;  2XSC A;  2B2T A;  4EQN A;  5CBA E;  1STA A;  5J22 A;  1I3Q B;  1STH A;  1LAC A;  4XT1 B;  2R61 A;  1G8Z D;  1JQY D;  3H6M A;  2AWN A;  5EPJ A;  2F0Q A;  4JK1 C;  2PW7 A;  2WB1 B;  5HUR A;  4V19 0;  4A3G B;  1MGS A;  1PTO C;  4HMI A;  2ICE C;  2F0G A;  5C5L A;  2EJG C;  2KQ3 A;  4C3H G;  3NQT A;  2HCC A;  2CQA A;  5JVG 3;  1CI3 M;  1FNW A;  1QIL A;  4DXG A;  2XWB B;  2NB0 A;  2F3V A;  1BCP B;  4KKS A;  1LTG D;  1RJT A;  1QWY A;  5JPN C;  1OXV A;  1JOR A;  5IT9 E;  1ROD A;  1XXG A;  1WTW A;  2M00 A;  1CQF A;  5KEE A;  1V8Q A;  3OOC A;  1F9Q A;  1CZG A;  2Z4I A;  4C1N I;  1B9N A;  3A56 A;  1I6H B;  3EJI A;  3T56 B;  3E0J A;  4WOR A;  2IWH A;  4UAI A;  4X3S A;  2F0O A;  2G9H D;  4KJO A;  1O7Y A;  4FF3 A;  4ZLT F;  3T16 A;  3N52 A;  4AYB B;  4WRD A;  3G6J B;  2F0I A;  5J1Z A;  5KIX A;  4S3S A;  2EJF C;  1EL0 A;  5M5X B;  1NUC A;  3WOF A;  3TP6 A;  1B50 A;  3SR1 A;  3DXJ C;  5JEA H;  2PYK A;  5IGG A;  3GTO B;  4XIG S;  4RGN A;  1PTO F;  1U4R A;  2ZT9 C;  3R8B A;  3G7L A;  4CKB A;  1SAP A;  1TT2 A;  3T4A C;  1Q90 A;  2EXZ A;  3PIO 3;  2JP1 A;  3BYY B;  3MC0 B;  1B44 D;  5KNB A;  3H09 A;  1VF5 C;  5ELD A;  1AP0 A;  5BN4 A;  1EEI D;  3AB9 A;  3CKI B;  2WP8 J;  4FF2 A;  3BDO A;  1C4Q A;  3J7A F;  1FNU A;  5JOB A;  2A6H C;  1S5B D;  2IX1 A;  1O78 A;  4ABN A;  4UDU C;  5G3L F;  4PMB A;  3S1N B;  1BDO A;  5FKA C;  3BVM A;  4J1M A;  2F0H A;  1E2Z A;  1YNN C;  4DAV A;  3S17 B;  1HQM C;  4TKO B;  1TS5 A;  1I4P A;  3S2D B;  4DK0 A;  2QDB A;  1KAB A;  1PTO B;  2F03 A;  4K2L A;  2PZT A;  4NMZ A;  1HPC A;  2K04 A;  2KUM A;  3LWU A;  2TMP A;  3K58 A;  2EZV A;  2HDL A;  1FGB D;  4KY7 A;  2MJ8 A;  2L11 A;  4KHZ A;  1D1K A;  3MEH A;  3NQI A;  5KYL A;  1EWH A;  1F2Y A;  4G57 A;  3ITP A;  3DUZ A;  5EPK A;  2F0K A;  1ILP A;  5KNC A;  1RHP A;  1SND A;  2AUK A;  4BA1 I;  2OF1 A;  4L6T B;  4ODG A;  3PUZ A;  4A3J B;  2E2D C;  4O1N A;  4EGV A;  1DON A;  4K5X A;  3I72 A;  4ZRZ A;  1LT3 D;  1R4Q B;  3A8I E;  3VYR A;  3MZ5 A;  5FLX L;  5C0X G;  5F2D A;  4HSP A;  2B8G A;  4RAU C;  3QB3 A;  1X3P A;  2KCC A;  1Q1B A;  3HOU B;  3K5M A;  1AN8 A;  2F0V A;  1GHJ A;  1RTO A;  2F0T A;  2RDF A;  4KN7 C;  5FK9 C;  4XTC S;  3WOE A;  2B2U C;  2D5D A;  3SDZ A;  4CKE A;  4KY6 A;  4XYQ A;  5DAU A;  3TME A;  4I65 A;  3VR2 A;  1A15 A;  3VR4 A;  3C1F A;  2F0F A;  1TWA B;  3DEO A;  3MFY A;  3ERO A;  4TQU S;  5I4D A;  4GZY C;  3FRP B;  2B2V C;  1L0X B;  2F0N A;  4XDX A;  1V43 A;  1OXX K;  3RD4 A;  1VCI A;  4KN4 C;  1IHZ A;  3J80 E;  2IW3 A;  3BS1 A;  5I2X A;  4KV6 A;  3BZD B;  3H0G B;  3ERQ A;  2ID0 A;  3S15 B;  2R93 B;  4K14 A;  3HGB A;  3GTK B;  3MHB A;  1UAP A;  3S2H B;  1HA5 A;  1O7L A;  5E4X A;  1EFI D;  1JOK A;  3BDC A;  5IGD A;  5ELF A;  1TQO A;  2KEE A;  2F0M A;  5C5M A;  1PZK D;  4PMC A;  1MI2 A;  2AWO A;  2A69 D;  1R4P B;  1F2Z A;  3K5N A;  3RZD B;  1TS4 A;  1KTK A;  2L4N A;  1LO5 D;  3VR3 A;  2K5Q A;  4IN3 A;  1D2B A;  2FHT A;  1F9P A;  1HTL D;  5C3E B;  5I2Y A;  2LKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...