1U9RA

Crystal structure of staphylococcal nuclease mutant v66e/p117g/h124l/s128a at room temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Stabilization of internal charges in a protein: water penetration or conformational change?
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u9rA00
1EY7A 1A3UA 2F0KA 2EY5A 5NUCA 1SYEA 5IGEA 1A2TA 3TP7A 2HQEA 4HMIA 2F0FA 5C5LA 1KDCA 3C1FA 1EY8A 4NMZA 1EZ8A 4ZUIA 1STNA 4KY7A 2F0UA 2PQEA 4IUNA 5KIXA 4G57A 4K8JA 2SOBA 5CV6A 4N9TA 1SYBA 4KY6A 4QB4A 3BDCA 4WRDA 3NQTA 1EYDA 5EKKA 4NP5A 3T13A 4QMGA 4KD4A 3T16A 3TP6A 1RKNA 5I9PA 4DGZA 1KDAA 1NSNS 1JOKA 3D4WA 2F0TA 4NDXA 4EVOA 5J22A 3SK6A 1EZ6A 1U9RA 2QDBA 4KTAA 4K5WA 5C4ZA 3SK4A 2PYKA 1ENCA 1SNDA 2EYHA 1SNOA 3NK9A 4HMJA 5CV9A 2F0IA 2RKSA 3QB3A 2F0WA 3D8GA 3DHQA 2EYOA 5EGTA 1EQVA 3EROA 1SYFA 4F7XA 2F0HA 2F0NA 2OXPA 4DU9A 3PMFA 2EXZA 1SNCA 5IOCA 4TRDA 3NP8A 1TR5A 2NUCA 3P75A 4RKBA 5CR3A 3DMUA 5CV7A 5DAUA 4N9PA 2KQ3A 2PZTA 4IALA 3RUZA 1EYCA 4DF7A 2F3VA 3BDLA 2EYLA 3R3OA 2EYJA 2EY1A 4K2KA 5J1ZA 2F3WA 5C6AA 4KJOA 4LAAA 3OMGA 3QOJA 4HTHA 1SNMA 4K8IA 5IGFA 5J39A 1F2YA 2EYFA 1EY4A 4K5XA 2PW5A 4KV6A 2F0VA 1STYA 2RDFA 5IGBA 3OSOA 5K5PA 5M9OA 1STBA 2EYPA 4PNYA 1EY5A 4K6DA 3MXPA 3MZ5A 2PZWA 5C5MA 1SNQA 1TT2A 1TQOA 4E6IA 5IGCA 1SYGA 2WACA 5CGKA 4I65A 4ME5A 1EYAA 4ODGA 5E1FA 4ZUJA 4EQNA 3QOLA 4F8MA 5DEHA 4KJNA 2F0DA 5JOBA 3TMEA 4K5VA 2F0MA 4H7BA 1EY9A 3HEJA 3MHBA 4R8NA 4RKLA 3TP5A 1KABA 4KHVA 3NUCA 5KRUA 2ENBA 1KDBA 2PW7A 5I9OA 3LX0A 1KAAA 1SYDA 5IIFA 1II3A 3ERQA 3U9OA 4WORA 2OF1A 3TP8A 2F0GA 3ITPA 3SHLA 5IGDA 4PMCA 5KGUA 3EJIA 1STHA 4EQOA 4ZQ3A 3NHHA 5C4HA 1SYCA 5CV5A 5KEEA 4ID6A 5E3FA 4J6HA 4B9XA 4K2LA 4J1MA 4OL7A 1JORA 4DFAA 2F0SA 4YIJA 1NUCA 2EY2A 2F0PA 3SXHA 2SNMA 4KY5A 2LKVA 2F0QA 1AEXA 5KYLA 1JOQA 5JAVA 3SK5A 2F0EA 4EQPA 4IZ8A 5C3WA 3OWFA 3OMCA 3EVQA 4B9WA 1F2ZA 2SNSA 5IODA 4NKLA 1STGA 3H6MA 1EY0A 5F2DA 2F0JA 3SK8A 2O4XA 5CV8A 2OEOA 4K14A 5C3XA 5ISRA 3V2TA 2PZUA 2F0OA 5I6YA 3MEHA 5CC4A 5IGGA 5I6WA 5KYIA 1EY6A 3C1EA 3SR1A 2RBMA 5HGTA 1SNPA 2EY6A 3HZXA 1A3TA 3E5SA 3NXWA 4MIUA 3P1HA 4KD3A 1A2UA 2KHSA 4S3SA 3MVVA 3D6CA 2M00A 2F0LA 1F2MA 1JOOA 1STAA 3S9WA 1ENAA 1IHZA 5HURA 3D4DA 1A3VA 2EYMA 3VA5A 5CV4A 4PMBA 4QF4A 5EKLA
chains in the Genus database with same CATH superfamily
1GUWA 2BOSA 2KBNA 2UUAL 2N8NA 4TVAB 3QO2A 3TBIB 2K03A 1E0BA 5KIXA 3SDZA 4FF4A 3D3RA 3WDNA 1FNWA 2ZJRA 5C4XB 4R4CA 2QKIC 1I4PA 1BKBA 1HUNA 4B3SQ 3JAML 3T16A 2X6LA 5JJLA 1KDAA 2E2HH 1WOCA 2UU9Q 1C7YA 4A93G 4Q5VA 3HRZC 2PCFB 3DHQA 4IFDG 1YNNC 3I8ZA 2F0NA 4JG2A 3F2DA 4RHRA 2E8GA 4L8JA 1Q7YC 1UNSA 2MHVA 1Q86C 3BDLA 2ZJQA 2DY8A 2JSOA 3GP7A 2A6ED 4KJOA 4DR6L 2C35B 2R7FA 1I4QA 3M3YH 4K5XA 3P20A 3J81L 3CCVA 4BBRB 2BH8A 3FHWA 4OGQC 2WP8J 1YNJD 1SE2A 4ABNA 1AE2A 1G6ZA 2A8VA 1VQFA 2WAQE 3F2UA 1W6JA 1CSPA 4JOIA 4YCWA 4HJ8A 3G4SA 4DV4L 2Y0SB 4WFN3 1WTVA 5CYUA 1RODA 2R7DA 3H3VI 1DOKA 5EAYA 3FDTA 1Q82C 3ZJYC 3PGZA 2IWHA 1GUSA 3T51B 2VQFL 3GTJH 4K0KQ 4BY7H 1AH9A 1NUCA 1WFQA 2EY2A 2NVYH 3FPUB 2L15A 2K5VA 3A56A 3UI2A 2LKVA 4DV2Q 2L9HA 2YU9H 4R4OA 1UUPA 3S2HB 5ELCA 1IBLL 1MKHA 1F2ZA 2OTJA 5K36G 2F0JA 3OW2A 2OEOA 2JA8G 3U58A 3CCSA 3NBHA 1A2UA 1FNVA 1MHWC 3IFDA 1F9RA 1DD2A 2PQAA 2JN4A 1O7YA 2JA5H 1VQHA 4PMBA 5EKLA 4Y52H 3NQIA 5GAEC 2RSNA 1WI5A 4DV6Q 2OT2A 3F2BA 3BVZA 4ZUIA 2L11A 5GADC 2F4IA 3J7AF 4OXPA 1HA6A 1TS3A 1NAPA 2PI2E 3BDCA 4KKSA 4RHSA 5EKKA 2X69A 1SLJA 1PYWD 3I4NH 2MFIA 1EZ6A 5C3EB 5CORA 1HTPA 3U50C 4A3GB 3M4PA 4UHVA 5CMDA 4CJ1B 3QB3A 1P16A 5ELOA 3BZDB 1XXGA 2ICEC 5LMNL 4RCOA 3HKZE 3GTKB 4B3RQ 3D6WA 2RHSB 1R4PB 2B2YC 3R3OA 5J1ZA 2JEAI 1K73C 3I4MG 4JC0A 3J80L 2OQKA 1I94L 1F2YA 3J7ZC 3FPPA 4GNXC 2VW9A 2RDFA 2E2JB 4YHHL 5FLMG 2K5DA 3Q22A 4LF4L 3UE0A 4KHPQ 1SYGA 5IYCH 3I55A 4NXML 1QUQA 3KFUA 3HKZG 5JJKA 2BE5D 3KLRA 2F0DA 2JA6G 4K5VA 1QB5D 3KYHC 5G3LF 3W2DA 3S1MH 5IYBH 2DNEA 1KHIA 1KAAA 3CC4A 4J8QA 3HOUG 4HSVA 3K80C 4JYAQ 4OWTB 5E4WC 3JAMc 4B9XA 4DV0L 3H91A 2F0PA 3TZDA 2VUMB 2I46A 2BA0A 5EPKA 2BA1A 1TWCH 3RLOA 1JJCB 5GAGC 2CH4A 3MXUA 2Q2HA 2WKDA 1VQDA 2ZTDA 4RAUC 3S2DH 2ZJPA 4MNOA 1STGA 4P73A 2O4XA 1ZEQX 4WJ4A 1K83B 5ISRA 2A5HA 3KUPA 5IGGA 2EJMA 3AFQA 4A3MG 1UEAB 1VDZA 2Q8TA 3R8BA 3MEFA 2XRQD 4C1NI 3A5ZB 5EPJA 1L1OC 4CKCA 3D6CA 1D5XC 1A3VA 1TWAH 3M9BA 2PPBC 3F8TA 3PO2H 4KLKA 5IGEA 2E76C 3S17H 1KNEA 3G6JB 1EWIA 1STNA 1F77A 1H95A 3GQBA 5E4XA 1V43A 5D3IB 2VNUD 2WB1B 4X62L 3L9AX 3NPPA 5ELFA 3J7A5 3J80E 3HOYG 1A63A 3I72A 1JWUD 1SNOA 4RA8A 4HMJA 5CV9A 3T56B 1B7YB 3SE0A 2UXDL 1K28A 1OXTA 4NXNL 1V1QA 4O1NA 1VQ9A 1WD1A 1IKMA 1D8LA 1E1OA 3ER0A 4JI6Q 3EFXD 2FINB 5ELBA 1YHBA 2BE5C 4X3TA 5IWAQ 5M5WB 1B1ZA 1J5EL 1CT1D 2EYJA 2B63G 4C3HB 2XGTA 2R3ZA 1QNKA 1Y1VH 4A3BG 5C44G 1MIUA 1PTOF 2JP1A 3CU7A 4HIKA 1VQ7A 5COYA 2NWGA 2Z6KC 4DA2A 4A93H 1XTCD 1RTOA 1TY0A 1PDQA 4TSSA 4GLVB 4CDFC 1IBKQ 2OWOA 2K50A 2JA9A 3QJYA 3S24A 1G291 5DEHA 3K0YA 2KOLA 3QWNA 3J7AV 1TWHH 4DKAC 1WTPA 3IL8A 4Y7NB 1EQRA 1XPUA 4DR2L 4HIDA 2B2TC 5EKIA 2DUDA 1SYCA 1S5BD 3NWTA 4CKBA 4L6TB 3GTGH 4XYQA 1C9OA 2QCPX 1VQJA 3KJPA 3SXHA 1FR3A 5FJ8G 1IXRA 4KHZA 5KYLA 2PNHA 2WB1E 2XIWA 2VL6A 1IZ6A 2QDLA 4DK1A 3OMCA 1EIYB 3AB9A 1BCPD 2MNAA 3I7FA 1QJOA 2LXJA 1N34Q 2VB3X 1HTLD 5DM63 3K6OA 3TDQA 3K58A 4LF8Q 2R61A 2NVXH 1PLFA 1EY6A 3Q0AA 4OELB 3CRLC 2LSSA 3CHBD 3TSSA 3E3XA 4LF5L 3MVVA 1X9NA 4DN4M 2K33A 2EZVA 1Q46A 3D4DA 3VA5A 4YY3L 3S1NH 1C48A 4YWLA 3BZKA 4DV5L 2ZXPA 1JT8A 1PH7A 2L55A 3LNNA 3URYA 1EY8A 2R92H 3OPOA 4MTKA 1HR0W 1TY2A 1F9SA 3BYTB 4JI0Q 4L5TA 3RZOB 1JOKA 3ERSX 4I7ZC 3M4QA 4LF6L 3FEWX 1S5FD 3PUWA 3VYSA 4IUQA 5GROA 3NBIA 1CSQA 1FYCA 2KHJA 4RKBA 3HOVG 4A3FH 4BY1H 5EQ0A 3E0JA 3CKIB 1K9MC 3N52A 4HTHA 2LS01 2VS1A 2K28A 3CPFA 2F0VA 2D2CC 1STBA 1S72A 3A8KE 1PHJA 2B2UA 1Y69U 2PZWA 1BBXC 1SNQA 3P7JA 1FVIA 4GOPC 1SMYD 2H5XA 1CK1A 4ME5A 1BDOA 3Q6SA 1LUZA 4LJZC 1TWGB 1QZGA 4NW2A 5KRUA 1BCPC 1KDBA 2CHBD 4JBKA 4DR4Q 1EQQA 3I4MH 1B9MA 3HOWH 4WORA 5D14A 3GTPH 1C8CA 3CCLA 1GUTA 1HXYD 1B70B 1NMFA 4BY7G 1S4ZA 3VR3A 1XJVA 1DCZA 1I6HH 1KC8C 2F0QA 2ICIA 4X65Q 2XWBB 2ZM6Q 1JOQA 1PTOD 2Q2UA 2ATWA 1HQMC 1S5CD 2ZTCA 2BCOA 1LLRD 4L63B 3SK8A 1EEFD 5CV8A 4AQYL 4OONA 2C9OA 1A15A 3FRPB 3NXWA 3P1HA 2PI2A 3Q8DA 2VQFQ 1RL2A 1SFOB 2JA5G 4CBVA 4CDEC 5CV4A 2X6GA 4DAMA 1DYQA 2F4VQ 2B29A 1R9TH 2MO0A 4O2DA 2A69D 3PUZA 3J7YW 2CW0D 4JK1C 3SEBA 5M5XH 2E2IB 2Q2TA 2KEEA 5FLXc 1HA5A 3ULJA 3I4NG 4DGZA 3TREA 4P2CB 4LFBQ 3SK6A 1E7ZA 1PXUA 1VQEA 1WTXA 2CQOA 4DUYL 4H0LC 1PMRA 3CP0A 3EROA 2WV6D 1N36L 2F0HA 1SMYC 2RCNA 1TWFB 1I6VC 3HOXG 5CR3A 2HCCA 4A3EH 3RUZA 2K5HA 3L2PA 1O7IA 1ZXTA 4X3KA 5T1IA 4C3IB 5BR8L 3K0XA 3BVGA 2I5LX 1YBYA 1DM0B 1CZGA 2NVTH 1EY4A 2EJGC 2JQOA 3KF8B 2BDOA 5IGBA 2Q8RE 5CBEE 5IP7G 4ALPA 2RSOA 4A76A 4JI3Q 1E2WA 2HD3A 1N32L 1F9QA 5IYCG 4IJHA 3PIO3 1VQBA 1BXTA 2CKZB 2ID0A 5E1FA 3T1YL 1MSHA 1K3BC 4G7ZC 1PTOC 3D4RA 1BF4A 3PUVA 2UXCL 4OO1G 5IYBG 4KN7C 1TS5A 2PW7A 1PA6A 4XYOA 2NZHA 2R7ZG 3EA6A 4A3BH 1I94Q 4PMCA 1STHA 1Q81C 1ET9A 2GVBA 2A1AA 1Z47A 4OL7A 4YHHQ 2I5MX 1Y14B 1CKNB 2O5JC 4KY5A 4DV1L 5LL6X 1VQNA 4A3LG 1I50B 1HZAA 2LXKA 1I4RA 3HGBA 5EBDA 3V96A 1NY4A 2CW0C 4OEMB 2IHEA 1WVLA 3A55A 3KK7A 4AYBB 5I6YA 4QY7A 1EU3A 4CJ2C 3RZDB 4PMWA 5JVG3 3CPWA 2JEBI 4C2MH 4DV0Q 1STAA 1V9PA 4IPHA 1SJHD 1GVPA 5FJ8H 3PO2G 1YNXA 5NUCA 1UEBA 2HQEA 1SE3A 1PH3A 3ND8A 1E1TA 4G7OC 2MO1A 1O7ZA 2IX0A 1Z7TA 2IY5B 5M3MG 1QE6A 1HQRD 2R93B 2G9DA 2EQSA 4WJWA 4JI5L 4N8FA 5FO9B 4DR5L 2MP1A 2JXMB 3K57A 1XMOL 3GTOH 1JJGA 3GTQH 1LTRD 1PZJD 1VQOA 2A74C 3NK9A 2HQLA 2UXBQ 2F0IA 4L5QA 1N33L 3D8GA 1LABA 1EQVA 3PMFA 2K04A 4GN3B 1TS4A 4DAPA 2KUMA 1CUKA 4H13C 2B2YA 4APVA 1VQLA 1Y1VG 5JEAJ 2QA4A 4GNXA 1B3AA 4CGYB 5M3FG 2B2WC 3HFZB 5K5PA 1XWEA 1U0LA 4TQUS 3S15H 4A3KG 1VF7A 4AYBE 2JA8B 1TT2A 5ELNA 2WACA 1CKOA 4HIOA 1DOMA 5ELEA 2XVSA 4NXNQ 4ZUJA 2QEXA 3J81j 1HJPA 3HOVH 4G7HC 3VYUA 3MA2B 3NUCA 1Y1WG 1T5EA 1X65A 3GTLH 3D31A 4YCVA 3TP8A 1PH6A 2NTTA 3KJOA 3TRZA 1X3QA 4J6HA 1AE3A 3I3CA 4LMQD 1B50A 1L0XB 4RGNA 3PQIA 2HIVA 1M4VA 4DAYA 3HOZH 3L0OA 4DXGA 1SMXA 2MUYA 1QVFA 4LF7L 2TSSA 3H3VC 3CF5A 3BZCA 2K01A 3OYYA 1GJXA 1CQFA 5JPNC 2KEDA 3HKSA 3MEHA 3S14B 1U4RA 3E5SA 4DUZL 4DR2Q 2JA7B 1L1OA 2JK8A 1YJWA 4KN4C 4LFAL 1KNAA 1PRTB 2H1EA 2J4XA 4DV7L 1EEID 2NZOA 1EY7A 1KRSA 2F0KA 2WAQG 3L3OC 2NTSA 2VQEQ 1A2TA 1EFID 4DPGA 2F0FA 3CQZB 3BS1A 3C1FA 2R92G 1MJCA 4A3IB 1Q90A 2KCMA 1EWHA 3EBEA 2NVQB 1JWMD 1HH2P 2TMPA 3J80i 3TP6A 1RKNA 3D0FA 1K0SA 1QNUA 1U9RA 1Y8OB 4FXGC 4LW1A 4JI4L 2JA6B 3LWEA 5C4XG 4XQJA 1WTRA 4ZCKA 3ONAB 4L5RC 1H9KA 1HNXL 3HOUB 2KECA 4DV5Q 2K6AA 4JI7Q 3R93A 1LT6D 4IALA 5GQOA 4BY1G 4A3FG 1ASYA 1HCZA 4XT3B 1E3PA 1FD7D 2EYLA 1AFPA 4I7AA 3WOFA 2A68D 3TN2A 2Z4IA 1CZWA 3QOJA 2KVMA 1A6XA 1PZKD 4NPSA 4ZLTF 2Q2IA 5C0XG 3K7AB 1PYSB 2EYPA 2R6GA 3VR2A 2Y0SE 4LUZA 2Z6KA 5LMUL 4HIMA 1O78A 1OTCA 3FKIH 5IT9L 5HY6A 1SN8A 5CGKA 5C4JB 3PO3B 1K8GA 1XNRL 5M5YH 4V190 4BBRG 2NB0A 1I3QH 1Z9FA 1RHPA 4B3ML 3HOXH 4KHVA 1MGSA 1E24A 4QJFA 4JV5L 1C4QA 5I9OA 1QCBD 3BYYB 3HOWG 4LFCL 1HZBA 2B2TA 3GTMB 1OO9B 4JI2L 2RHQB 3T1HQ 1BO0A 1WTOA 2UUBL 5IP7H 1PYBA 5FO8B 1BCPF 3M4YA 3RMHA 3AEVA 3AMUA 2WIIB 2HUGA 1O7LA 3W3AA 2SNSA 3HOYB 1A0IA 1WCMH 1HZCA 1GD7A 4JI1L 2K75A 4OO1H 5CC4A 4YCUA 3S16H 3K5NA 3KDFB 3HZXA 2R7ZH 4A3JH 1JE5A 2KCNA 4IFDJ 2SDFA 1F2MA 2WINB 4QIWB 3MXNB 2B63B 1JICA 4P71A 5C44B 2E5LL 4A3LH 2KA7A 4HMIA 4KKTA 1SSOA 2FXQA 2K52A 4B3TL 1JE4A 2XSCA 4K8JA 4N9TA 4QB4A 2GN5A 3T53B 2DJGC 3S1QH 2A68C 4AQYQ 4XXEA 5J22A 1KLUD 4POGA 4U673 1VF5C 4QUFA 1JMCA 3J81c 1NTGA 4PV1C 2IW3A 1FNUA 4OX9L 1X6OA 4LF9L 3TEHB 4DNTB 3K5LA 2OTLA 4X6AH 2CH4W 1IYVA 3DXJC 5C3EG 5AJ3L 1S40A 3M4OH 3KF6B 4QCLA 1GUOA 2I07B 4HCSA 4C1NK 4A3EG 5IT9E 2BH2A 2PZTA 1GUNA 5M3MH 1LTTD 2K05A 4K8IA 1H9SA 5J39A 2GVAA 1E2ZA 3F1ZA 2UUCQ 4GKKQ 2RCFA 1STYA 2WFWA 1AN8A 2Z8LA 4KI0A 2DY7A 4A3DH 4A75A 4BBSH 3DWAA 4GOPA 5IGCA 2QW7A 3F2CA 2CWPA 1SEBD 3PSIA 2NZ1D 4KJNA 3TMEA 1X3EA 2F0MA 4H7BA 1EY9A 3S1RH 3HEJA 4QIWE 4UP7A 2IL8A 1SYDA 4QL5A 3EQLC 1V8QA 1RJTA 5M3FH 3TS0A 4UP8A 4Q0FA 4A3KH 3G48A 5KNDA 2EPBA 1EQTA 2YV5A 3ND9A 2F0EA 4IUTA 4IZ8A 5A35A 1D5MC 2E2HB 3EVQA 3T1YQ 5IODA 1Y8NB 4HAEA 1KRTA 4DAYB 4QUCA 2UXCQ 1G2TA 1STEA 1Y1WH 1VCIA 2L12A 3C1EA 2RBMA 1OXXK 3I90A 1H9MA 1EYGA 3VR6A 1GHJA 2FHTA 2E75C 1MSGA 2M00A 2F0LA 2OCEA 2HCIA 2Z0SA 1JOOA 5JVH3 5GAHC 3CRKC 1JJ2A 1KL9A 4DV1Q 2CQAA 3W1GA 1XNQL 3M3YB 2F1MA 1SYEA 1KDCA 2NYZD 4NMZA 4F88A 1X56A 1EWCA 1JC7A 1GOZA 1D2BA 3KBXA 2ZXRA 1YZ6A 4GKJL 4K0KL 4QMGA 4BWGB 3U4VA 1SBBB 3J80c 5FKAC 4EX5A 2D0PA 1HFGA 4KMUC 1UE1A 5E7NA 3NBHB 2DGYA 1PTOH 2WB1G 2PQAB 2EXZA 3GTJB 1L0YB 4TRDA 3TQYA 1LO5D 4X64Q 4BY7B 2PMZB 1LTBD 4DR3L 2NVYB 1J9OA 2LMCB 1CA5A 3ZYYX 4LWCA 3DLLA 3I73A 3CCRA 1D5ZC 3OSOA 4CJ0B 4JI5Q 3A74A 5DLQE 1VQIA 3CW2C 3A54A 3MXPA 4RGOS 5C4XH 1L2FA 4RGMA 1XPOA 4X3UA 3OHXC 1N9WA 4EQNA 4ZK9B 3QOLA 2MQHA 2UUAQ 4UP9A 3VYRA 4R8NA 1EIGA 1I4XA 1K3RA 2JA5B 1UE6A 4G4KA 4DV3L 4B08A 2L4NA 5IGDA 5C4HA 1K8OA 5E3FA 1ML0D 5C0XH 4GLAC 5A2QE 3GO5A 2IJ0A 1MD2D 3HG9A 2XTIA 1OXSC 3I70A 1HPCA 4EQPA 4IO9A 1T9HA 3HOZG 3I4NB 3R2IA 3E9IA 4BBRH 3CCQA 3PIP3 4DR1L 1CKMA 4NKLA 1W3SA 1QILA 1QUQB 2P5ZX 3WOEA 2NN6H 1NMGA 4FYDA 4XDXA 4IN3A 3MWYW 4YWKA 4DR6Q 4MIUA 1YJNA 5LL6S 1HNWL 4S3SA 2RVLA 2AKWB 1LM0A 5J3BA 1C0AA 1SE4A 2EY5A 4JCVE 3SVMA 1RD9D 5C5LA 4KY7A 2F0UA 2KCCA 4G57A 4DV4Q 4R4IA 1ONLA 4GS3A 1B53A 4JYAL 4C3JB 1YIJA 4KKUA 4NP5A 3T13A 3S2HH 5D3DA 2D9UA 4H02A 1NSNS 1ILQA 5JJZA 4K5WA 1Q12A 1IYUA 3S1MB 3E0EA 2EYHA 4LFAQ 1T5XD 2AUKA 2RKSA 1YVCA 2NVQH 4FF3A 4F7XA 1Q1EA 3CMAA 3DM3A 1ENFA 1O80A 2O2LD 2K4KA 2J7ZA 2EJFC 4OWWB 1IBLQ 1EYCA 1PH1A 1PH5A 4R4TA 4LAAA 4BA2I 1ESFA 1TWCB 4CDDC 1U4MA 3UE1A 2PW5A 4KV6A 2AQ1B 2B2WA 1Q8KA 3I4LA 2F03A 3S2DB 4K6DA 3Q23A 3FKIG 3MZ5A 1VQGA 5D65A 4MHEA 1HNZL 1TVXA 1Q1BA 4E6IA 4I65A 1LTAD 5EBCA 1GO3E 2O5IC 1MJEA 1LTSD 1YITA 3H3VH 1HNXQ 5C3EH 3G71A 1G2SA 4IFDI 4A3GH 1B9NA 2QF7A 1LT5D 5C4JH 1TWAB 3BVMA 4OIKA 1II3A 2Z1CA 3ERQA 3VR5A 4O0AA 3PO2B 3OIQA 3ITPA 3GTKH 4N8X1 3CMEA 1KXLA 4ID6A 4K2LA 1PH2A 5JPMC 2Q8IB 1PH4A 3I4OA 4UAIA 2XN9C 1PH8A 1W6KA 3H0GB 3PUYA 1VQ5A 4JI6L 3G7LA 3GV6A 2E2JH 1BQQT 5IWAL 5LMNQ 4B3MQ 4OIJA 1WCMG 1EY0A 2K32A 3MTSA 5BN4A 1RCVD 4JPBW 1BBWA 2GA4B 4BXXH 2A73B 4JV5Q 4A3JG 2EY6A 1WTHA 1NNXA 1Z6HA 4LFCQ 2HIXA 1SAPA 2KHSA 3CCMA 4JI2Q 3VYTA 1IBKL 1ENAA 1HR0L 3AU7A 1N8RC 2SEBD 4FF1A 1Y1VB 4LF4Q 2ZTEA 1PFNA 5I2XA 1TS2A 3K5MA 1XX8A 4NXMQ 3RLFA 5FK9C 4DK0A 4A93B 3AQQA 4IUVA 1R4QB 2VUMH 4KY6A 4JI1Q 4A3CH 1WTWA 1JQYD 2MJ8A 3PIOA 2VZAA 2QDBA 2XNAC 2YTVA 1QVCA 3DEOA 1TWHB 2PYKA 1K83H 1FJGL 3AFPA 3CCUA 1XMQL 4KK7A 2EYOA 2V1CC 2XWJB 4DR7L 2RQXA 1SNCA 3MAQA 2E5LQ 2D62A 3DUZA 3GTGB 2KQ3A 4RH6A 4LF8L 3OTOL 1QVGA 4K2KA 1Y8PB 3A7AB 2B3GA 4A3DG 1I4HA 4X66L 2VY3A 2DN8A 5DNFA 1MI2A 4BBSG 2K5QA 3KBGA 1GXDC 2HDLA 5IY0A 1BOSA 2NVXB 2A6HD 3QIAA 4ODGA 4OX9Q 2HDMA 1CFMA 5CBAE 1AZQA 3SGIA 1CQVA 4TKOB 4GZYC 3TP5A 5H1SE 2CFMA 4DNRB 1RIPA 4JI0L 1SJED 1X32A 4DNIA 1PRTC 1ICWA 1VQCA 3S1NB 4RG1A 1LT3D 2F0GA 3SHLA 3M85A 2WAQB 3ICEA 5BN3A 2Z4HA 4X62Q 2R92B 2F0SA 1D6EC 5M5WH 2B2VC 4C3HH 1CTMA 1X54A 2F3IA 2UXDQ 4B9WA 1IBML 3OW7A 1YJ9A 5F2DA 1DGSA 4O42A 1FL0A 2KJXA 5KYIA 1J5EQ 1QZHA 4ILWA 1IL8A 1PFMA 1SDFA 1MBYA 1SRUA 4MTNA 1K8MA 3STBD 4A3FB 4BY1B 4EGVA 1Q8IA 3DWQA 4AYBG 4JI8L 4K6LA 3IKJA 4Y7NH 1PFSA 3FP9A 4QF4A 4RWSC 2CCZA 1UE7A 5HGQA 4JBJA 4L5SA 1TKWB 4DR4L 3PF4A 2SOBA 1SYBA 4FVMA 5T1GA 2I5HA 1VQ8A 3M7NA 3SK4A 4X65L 2ZM6L 1G8ZD 4MZ9A 5JJIA 3BG3A 4UDUC 1S5ED 4AH6A 2F0WA 3I4MB 2R93G 3HOWB 3RN5A 3GTPB 2K5NA 3I2ZA 1XNQQ 2WKCA 3LWUA 5IOCA 3NP8A 5DAUA 4HR7B 2A6HC 1TU2B 2B8GA 2IX1A 3KLSX 4N9PA 1I6HB 5LHY1 1ET6A 4FXDA 1A8VA 1K8AC 2N88A 3MFGA 4POFA 4GKJQ 2IPKD 2EVBA 3CD6A 3HKZB 5M9OA 2AMCB 4PNYA 2QGQA 4FDBA 2ALYB 3CXCA 2F4VL 4LF5Q 2EDGA 3HP3A 4HJAA 1M8AA 2B39A 4OWXB 4F87A 2DNCA 4M1UB 3RZOH 4YY3Q 4C56C 3C3LA 3NELA 4P74A 5JOBA 5EPLA 4RKLA 2N49A 4DR3Q 3LX0A 2ZT9C 1XYIA 1M90C 1R9TB 1NJIC 4LFBL 4EQOA 4QQBX 3NHHA 1UE5A 5KEEA 1WYDA 2MGSA 1WJJA 3JAME 3DEPA 4DFAA 5M5XB 2B8FA 4XT1B 4LF6Q 5JEAH 3STBC 1ZYRD 4A3MB 3VA7A 2A19A 1DXMA 1XTDA 2NN6G 1CHPD 3HS0C 3V2TA 4ZKBB 3NE5B 3NWSA 2A6EC 4DV3Q 1SNPA 1TXYA 4IOAA 5IYDG 5L37A 4JI3L 1TWGH 4HSPA 4A3EB 4GN4B 1B44D 2Y0SG 4IURA 2EIFA 4ME3A 3J81E 1DOLA 2RA4A 2H4OA 1IHZA 3NSWA 1LV9A 1YNJC 5HURA 1EOTA 2HT1A 1D1IA 1X3PA 3K7UC 2EE1A 2JA7G 2NVTB 3E9HA 3RD4A 3K59A 1JB3A 1SROA 3KOJA 4HEDA 1EL0A 1EZ8A 2QILA 4HJ9A 4DR1Q 4IUNA 2PQEA 5IE8A 3DWPA 4GN5A 3QG1A 4CHTB 4PZ7A 3H09A 4KD4A 5I9PA 1EFWA 4NDXA 3OWEB 4R9WA 5C4ZA 1HNWQ 3MXGA 4A3IG 2JE6I 1WD0A 3UDGA 4C3JH 2RDGA 4A3BB 1F2LA 3DM1A 2AQ2B 1ASZA 5C6AA 1NR4A 1TR5A 2NUCA 3CCEA 4DF7A 4R1JA 1SFOH 2L0CA 1PVOA 1B4OA 1BR9A 4CDCC 1CI3M 4GLXA 3A0JA 3NENA 1SNMA 3NTKA 4AIMA 4PZ6A 2FJ2A 2FMMA 2ZXOA 2E74C 2E2IH 1E22A 2V4DA 1KD1C 3K5OA 2EXDA 1BUVT 4BA1I 1PFBA 4JOIC 2KENA 1ZYRC 4EQ5A 1VQ4A 4C2MB 4A3GG 5IP9H 3I91A 1VQKA 3PO3G 1LTID 1LTLA 2OF1A 2HHHL 2Z6BA 4PG3A 1TWFH 4ZQ3A 1V1PA 2UXBL 1GHKA 4J1MA 4C3IH 1WTQA 1U5KA 3C2PA 4GNXB 1JCKB 2LY7A 1HNZQ 4DUYQ 3NEMA 5C3WA 3BDOA 1N36Q 2IHFA 3GTOB 3GTQB 1QG7A 3FMCA 4R8IA 4B3SL 1EUJA 3H0GH 5BR8Q 3RN2A 2OQ0A 4BXXG 2IX3A 3SR1A 2G5DA 2UU9L 2Z9HA 3B6YA 2BDNA 1VMPA 3BU2A 3IRBA 4ULLA 3S9WA 2AWNA 2EYMA 5I4DA 1N32Q 4JW0A 3KLWA 1H9JA 1F9PA 3S15B 4X3SA 3I56A 3KF8A 5C0XJ 2VUMG 4FF2A 4WJ3M 4WRDA 3PUXA 4HJ7A 4A3CG 1I50H 1S3OA 3FVQA 2K14A 5A2QL 5I2YA 3HOVB 1V1OA 4PQXA 3GTLB 2VXWA 1HR0Q 1B8AA 4R4QA 4IFDH 1SE8A 3IFTA 1L1OB 3RZDH 4DU9A 3EN2A 5IT9c 1CHQD 3GV3A 5FLXL 5KNCA 2XRSD 3C46A 1FGBD 5CV7A 3QR8A 1VQAA 2EY1A 2J0TD 5FO7B 3OMGA 1CKNA 2EYFA 1SXTA 3HOZB 2N3SA 2DJFC 4DV2L 1LYLA 4IUUA 3OOCA 1TQOA 4UPAA 2ES2A 3A8IE 1LACA 3CC7A 4ZRZA 4DK3C 1XMQQ 4JVZA 2VQEL 1FJGQ 2R93H 1E2VA 4DR7Q 1X3GA 4RMFA 1GUGA 1OXVA 1GM5A 2M9VA 1D1KA 2ENBA 4JBWA 3OTOQ 3V05A 2NBFA 2RF4A 3U9OA 2K5WA 1VQ6A 2YU9B 5G3LD 2LFNA 3EJIA 4YWMA 1VS0A 5CV5A 1UWVA 3UDFA 4DR5Q 1RTNA 2G9HD 1RF2D 4Z9CB 1XMOQ 4YIJA 3E6ZX 2YTXA 4X66Q 2SNMA 4C3HG 3PF5A 1G6PA 1AEXA 5JAVA 3SK5A 4JI7L 1PRTF 4XTCS 2N55A 1N33Q 1G51A 1J8IA 4DV6L 3O13A 4M8AA 3H15A 3X3MA 4IPDA 3H94A 4LK1C 5K36H 4V0BA 4J15A 1JWSD 2JA8H 2PZUA 3CC2A 3U4ZA 2E2DC 3OIPA 5HGTA 1KAWA 4OO1I 2K7VA 3NTIA 3CAMA 4KD3A 2C5CA 1A62A 4FXKC 1EU4A 2QEJC 2CVRA 4P75A 1K0RA 3RLNA 3JC66 4LUOA 4B3RL 3GDEA 3TP7A 1DONA 4XIGS 1VMCA 3FKIB 1IBMQ 4DXFA 5CV6A 1VQPA 2YTYA 2VB2X 4A4IA 2MPMA 5FLXE 3PCOB 1EYDA 4LUVA 5M5YB 3T1HL 1I3QB 2F0TA 4EVOA 4ZKCB 3TS2A 5IYDH 5ELDA 3HOXB 1BNZA 1ZKOA 2PMZE 4P72A 1SNDA 4KHPL 1QOHA 2FFKB 1L0WA 1D7QA 2AQ3B 1PV4A 1KLGD 4JI8Q 2PNRC 1HRJA 1SYFA 3S14H 1AW7A 2JA7H 1UAPA 3MC0B 1CM9A 2FMCA 4ZYSA 4LF7Q 3X3NA 1VQMA 4U68A 3CQZH 5FLMH 1EY5A 4DUZQ 1WCMB 1ESRA 1BVSA 4A3IH 1I5FA 3PIPA 1HFNA 3S16B 1DZ1A 4DV7Q 2R7ZB 1EYAA 1TIID 4A3JB 2M2LA 1YEZA 4DAVA 1YHQA 2IT1A 3L7ZC 2D0OA 3M7GA 2JA6H 2AUJD 4RGTA 3MHBA 4IQZA 1U4LA 1KABA 1IW7D 4ZAIA 5BN5A 4JBMA 3K81C 5KGUA 1QWYA 3HOUH 4FO2A 2I0QA 3TZUA 2KCTA 1JORA 1H9SB 3GD7A 1AP0A 1BBUA 3T4AC 5JEAG 2B2VA 4JI4Q 1V1PB 5FOBB 1PH9A 3S1QB 2N78A 1FGUA 3VDYA 1HZ9A 3K7AH 1Q3LA 4GOPB 1HUMA 2D5DA 3H6MA 1LTGD 1S5DD 2UUCL 4GKKL 1U4PA 2F0OA 3PO3H 4PZ8A 5I6WA 4A3MH 1A3TA 3A5UA 3R2TA 3S17B 2YYZA 3M4OB 2PO4A 1BCPB 1G91A 4RCNA 1EIHA 1CA6A 1EOVA 3UDIA 5LMUQ 1NBWA 1KQSA 4FNFA 5M3MB 2JJQA 1I4GA 1LT4D 1A3UA 3RNUA 3GTMH 1XNRQ 1NCVA 2AHOB 2RDHA 4LNQA 3G6EA 4A3DB 1GKHA 1YI2A 4BBSB 1PRTD 1P8LA 1DJRD 3Q24A 3NQTA 3RR5A 3PV0A 3D4WA 1IYJB 3MFYA 4KTAA 3S1RB 3HOYH 3W5OA 1ENCA 4CKEA 4C3JG 4XQQA 2UUBQ 5EGTA 1J6QA 2OXPA 1M1KC 4BS9A 3BJUA 1X3FA 5AFWA 5KNBA 3P75A 5M3FB 3DMUA 1SR3A 1JR0D 1YHAA 3K8AA 2F3VA 4DK6C 4A3KB 1W2BA 2K1BA 2F3WA 2B63H 4HN7A 1AZPA 1B3QA 5IGFA 2F52A 1IW7C 4XQNA 2CWAA 5C44H 5TSSA 3CCJA 1H9RA 4MN3A 4IPGA 1JB7A 2B2UC 1X55A 5C5MA 3W1BA 1YNND 1Y1WB 2EOTA 2JYOA 3A8JE 3IAYA 5DM73 1RDPD 2KHIA 3KLSA 2L5TA 3ULLA 3U9SA 4F8MA 2A69C 3EIVA 3KDFA 1KTKA 4HCEA 1N34L 4H44C 4IPCA 5IP9G 4B3TQ 3VR4A 5IIFA 3AYHB 1XPRA 3JAMi 3MXNA 4IJLA 1ICFB 5LMNW 3N6RA 1IL2A 4C3IG 1ILPA 3UDXA 4IUPA 3NTHA 4QGUA 1EIFA 5C0XI 3LGJA 4NB3A 1NE3A 1B2TA 5EJWA 3OWFA 4X64L 4LF9Q 4OHJA 1NR2A 5AJ3Q 1HHVA 5C3XA 4K14A 3ULPA 3A7LA 3H0GG 1PTOB 1PZID 4FP5D 1OXUA 4HJ5A 2NN6I 2HHHQ 3J81i 1IKLA 4UY8C 2ASBA 2AWOA 4RFBA 2L1BA 3KF6A 3WWVA 4IOCA 1KIXA
chains in the Genus database with same CATH topology
1GUWA 2BOSA 3QO2A 3TBIB 2K03A 1E0BA 5KIXA 3SDZA 4FF4A 3D3RA 3WDNA 1FNWA 5C4XB 2QKIC 1I4PA 1HUNA 3JAML 3T16A 2X6LA 1KDAA 4Q5VA 3HRZC 2PCFB 3DHQA 4IFDG 1YNNC 3I8ZA 2F0NA 4RHRA 4L8JA 1UNSA 2MHVA 3BDLA 2DY8A 2JSOA 3GP7A 2A6ED 4KJOA 1I4QA 4K5XA 3P20A 3J81L 4BBRB 4OGQC 2WP8J 1YNJD 1SE2A 4ABNA 1G6ZA 3F2UA 1W6JA 2Y0SB 4WFN3 1WTVA 5CYUA 1RODA 1DOKA 3FDTA 2IWHA 1GUSA 3T51B 1NUCA 2EY2A 3FPUB 3A56A 3UI2A 2LKVA 2L9HA 1UUPA 3S2HB 5ELCA 1F2ZA 5K36G 2F0JA 2OEOA 3NBHA 1A2UA 1FNVA 3IFDA 1DD2A 1F9RA 1O7YA 4PMBA 5EKLA 3NQIA 2RSNA 2OT2A 3BVZA 4ZUIA 2L11A 2F4IA 3J7AF 1HA6A 1TS3A 1NAPA 3BDCA 4KKSA 4RHSA 5EKKA 2X69A 1PYWD 1EZ6A 5C3EB 5CORA 1HTPA 4A3GB 5CMDA 4CJ1B 3QB3A 3BZDB 1XXGA 2ICEC 4RCOA 3GTKB 3D6WA 1R4PB 2B2YC 3R3OA 5J1ZA 2JEAI 3J80L 1F2YA 3FPPA 2RDFA 2E2JB 2K5DA 3Q22A 1SYGA 2BE5D 3KLRA 2F0DA 4K5VA 1QB5D 5G3LF 3W2DA 2DNEA 1KAAA 4J8QA 4HSVA 5E4WC 4B9XA 3H91A 2F0PA 3TZDA 2VUMB 2I46A 2BA0A 5EPKA 2BA1A 3MXUA 2WKDA 4RAUC 1STGA 2O4XA 1ZEQX 1K83B 5ISRA 2A5HA 3KUPA 5IGGA 2EJMA 1UEAB 1VDZA 2Q8TA 3R8BA 2XRQD 4C1NI 5EPJA 4CKCA 3D6CA 1D5XC 1A3VA 2PPBC 5IGEA 2E76C 1KNEA 3G6JB 1STNA 1F77A 3GQBA 5E4XA 1V43A 5D3IB 2VNUD 2WB1B 3L9AX 3NPPA 5ELFA 3J80E 3I72A 1JWUD 1SNOA 4RA8A 4HMJA 5CV9A 3T56B 3SE0A 1OXTA 1IKMA 4O1NA 1WD1A 3EFXD 2FINB 5ELBA 2BE5C 4X3TA 5M5WB 1B1ZA 1CT1D 2EYJA 4C3HB 2R3ZA 1QNKA 1PTOF 2JP1A 3CU7A 5COYA 2NWGA 4DA2A 1XTCD 1RTOA 1TY0A 1PDQA 4TSSA 3QJYA 1G291 5DEHA 3K0YA 2KOLA 3QWNA 3J7AV 1WTPA 3IL8A 4Y7NB 2B2TC 5EKIA 1SYCA 1S5BD 3NWTA 4CKBA 4L6TB 4XYQA 2QCPX 3SXHA 1FR3A 4KHZA 5KYLA 2XIWA 4DK1A 3OMCA 3AB9A 1BCPD 1QJOA 2VB3X 1HTLD 5DM63 3K6OA 3TDQA 3K58A 2R61A 1PLFA 1EY6A 3Q0AA 3CRLC 3CHBD 3TSSA 3MVVA 4DN4M 2K33A 2EZVA 3D4DA 3VA5A 1C48A 2ZXPA 2L55A 3LNNA 3URYA 1EY8A 3OPOA 1TY2A 1F9SA 3BYTB 3RZOB 1JOKA 4I7ZC 3FEWX 1S5FD 3PUWA 3VYSA 4IUQA 3NBIA 1FYCA 4RKBA 5EQ0A 3E0JA 3CKIB 3N52A 4HTHA 2LS01 2K28A 2F0VA 2D2CC 1STBA 3A8KE 2B2UA 1Y69U 2PZWA 1BBXC 1SNQA 3P7JA 1SMYD 1CK1A 4ME5A 1BDOA 3Q6SA 4LJZC 1TWGB 4NW2A 5KRUA 1BCPC 1KDBA 2CHBD 1B9MA 4WORA 5D14A 1C8CA 1GUTA 1HXYD 1S4ZA 3VR3A 1DCZA 2F0QA 2ICIA 2XWBB 1JOQA 1PTOD 1HQMC 1S5CD 2BCOA 1LLRD 4L63B 3SK8A 1EEFD 5CV8A 2C9OA 1A15A 3FRPB 3NXWA 3P1HA 1SFOB 4CBVA 5CV4A 2X6GA 1DYQA 2A69D 3PUZA 3J7YW 2CW0D 4JK1C 3SEBA 2E2IB 2KEEA 1HA5A 4DGZA 4P2CB 3SK6A 1PXUA 1WTXA 4H0LC 1PMRA 3EROA 2WV6D 2F0HA 1SMYC 1TWFB 1I6VC 5CR3A 2HCCA 3RUZA 5T1IA 1ZXTA 4X3KA 4C3IB 3BVGA 1DM0B 1CZGA 1EY4A 2EJGC 2BDOA 5IGBA 2Q8RE 5CBEE 2RSOA 1E2WA 1F9QA 3PIO3 1BXTA 2ID0A 5E1FA 1MSHA 4G7ZC 1PTOC 3D4RA 1BF4A 3PUVA 4OO1G 4KN7C 1TS5A 2PW7A 4XYOA 3EA6A 4PMCA 1STHA 1ET9A 1Z47A 4OL7A 2O5JC 4KY5A 5LL6X 1I50B 1I4RA 3HGBA 5EBDA 3V96A 2CW0C 1WVLA 3A55A 3KK7A 4AYBB 5I6YA 1EU3A 4CJ2C 3RZDB 4PMWA 5JVG3 2JEBI 1STAA 1SJHD 5NUCA 2HQEA 1SE3A 3ND8A 4G7OC 1O7ZA 2IX0A 1Z7TA 1QE6A 1HQRD 2R93B 2G9DA 4WJWA 5FO9B 2MP1A 2JXMB 3K57A 1LTRD 1PZJD 2A74C 3NK9A 2F0IA 3D8GA 1LABA 1EQVA 3PMFA 2K04A 1TS4A 4DAPA 2KUMA 4H13C 2B2YA 5JEAJ 1B3AA 4CGYB 2B2WC 5K5PA 1XWEA 4TQUS 1VF7A 2JA8B 1TT2A 2WACA 1DOMA 5ELEA 2XVSA 4ZUJA 4G7HC 3VYUA 3MA2B 3NUCA 1T5EA 3D31A 3TP8A 2NTTA 1X3QA 4J6HA 3I3CA 4LMQD 1B50A 1L0XB 4RGNA 1M4VA 4DAYA 4DXGA 2MUYA 2TSSA 3H3VC 2K01A 1GJXA 1CQFA 5JPNC 2KEDA 3MEHA 3S14B 1U4RA 3E5SA 2JA7B 4KN4C 1KNAA 1PRTB 2H1EA 2J4XA 1EEID 1EY7A 2F0KA 3L3OC 2NTSA 1A2TA 1EFID 2F0FA 3CQZB 3BS1A 3C1FA 4A3IB 1Q90A 1EWHA 2NVQB 1JWMD 2TMPA 3TP6A 1RKNA 1QNUA 1U9RA 1Y8OB 4FXGC 2JA6B 3LWEA 4XQJA 1WTRA 3ONAB 1H9KA 3HOUB 2KECA 2K6AA 3R93A 1LT6D 4IALA 1HCZA 4XT3B 2EYLA 1FD7D 1AFPA 3WOFA 2A68D 3TN2A 2Z4IA 1CZWA 3QOJA 2KVMA 1A6XA 1PZKD 4ZLTF 5C0XG 3K7AB 2EYPA 2R6GA 3VR2A 1O78A 5IT9L 5CGKA 5C4JB 3PO3B 4V190 2NB0A 1RHPA 4KHVA 1MGSA 1C4QA 5I9OA 1QCBD 3BYYB 2B2TA 3GTMB 1OO9B 1WTOA 1BO0A 5FO8B 1BCPF 3M4YA 3RMHA 3AMUA 2WIIB 2HUGA 1O7LA 3W3AA 2SNSA 3HOYB 4OO1H 5CC4A 3K5NA 3HZXA 2KCNA 4IFDJ 2SDFA 1F2MA 2WINB 4QIWB 2B63B 1JICA 5C44B 2KA7A 4HMIA 4KKTA 1SSOA 1JE4A 2XSCA 4K8JA 4N9TA 4QB4A 3T53B 2A68C 4XXEA 5J22A 1KLUD 4U673 1VF5C 4QUFA 4PV1C 2IW3A 1FNUA 4DNTB 3K5LA 1IYVA 3DXJC 4QCLA 1GUOA 4C1NK 2I07B 4HCSA 5IT9E 2PZTA 1GUNA 4K8IA 1LTTD 2K05A 1H9SA 5J39A 1E2ZA 1STYA 1AN8A 2Z8LA 4KI0A 2DY7A 3DWAA 5IGCA 1SEBD 2NZ1D 4KJNA 3TMEA 2F0MA 4H7BA 1EY9A 3HEJA 2IL8A 1SYDA 3EQLC 1V8QA 1RJTA 4Q0FA 5KNDA 2EPBA 1EQTA 4IUTA 3ND9A 2F0EA 5A35A 4IZ8A 1D5MC 2E2HB 3EVQA 5IODA 1Y8NB 4HAEA 4QUCA 1G2TA 1STEA 1VCIA 2L12A 3C1EA 2RBMA 1OXXK 3I90A 1H9MA 3VR6A 1GHJA 2FHTA 2E75C 1MSGA 2M00A 2F0LA 2HCIA 5JVH3 1JOOA 3CRKC 2CQAA 3M3YB 2F1MA 1SYEA 1KDCA 2NYZD 4NMZA 4F88A 1EWCA 1JC7A 1GOZA 1D2BA 3KBXA 2ZXRA 4QMGA 4BWGB 1SBBB 5FKAC 1HFGA 4KMUC 1PTOH 2EXZA 3GTJB 1L0YB 4TRDA 1LO5D 4BY7B 2PMZB 1LTBD 2NVYB 1J9OA 2LMCB 1CA5A 3ZYYX 3I73A 1D5ZC 3OSOA 4CJ0B 3A54A 3MXPA 4RGOS 4RGMA 4X3UA 3OHXC 4EQNA 4ZK9B 3QOLA 3VYRA 4R8NA 1EIGA 1I4XA 2JA5B 4G4KA 4B08A 2L4NA 5IGDA 5C4HA 1K8OA 5E3FA 1ML0D 5C0XH 5A2QE 3GO5A 2IJ0A 1MD2D 3HG9A 1OXSC 3I70A 1HPCA 4EQPA 3I4NB 3R2IA 3PIP3 4NKLA 1QILA 3WOEA 2NN6H 4FYDA 4XDXA 4IN3A 3MWYW 4MIUA 5LL6S 4S3SA 2RVLA 1SE4A 2EY5A 3SVMA 1RD9D 5C5LA 4KY7A 2F0UA 2KCCA 4G57A 1ONLA 1B53A 4C3JB 4KKUA 4NP5A 3T13A 5D3DA 2D9UA 1NSNS 1ILQA 5JJZA 4K5WA 1Q12A 1IYUA 3S1MB 2EYHA 1T5XD 2AUKA 2RKSA 4FF3A 4F7XA 1Q1EA 1ENFA 1O80A 2O2LD 2J7ZA 2EJFC 1EYCA 4LAAA 4BA2I 1ESFA 1TWCB 1U4MA 2PW5A 4KV6A 2AQ1B 2B2WA 3I4LA 2F03A 3S2DB 4K6DA 3Q23A 3MZ5A 5D65A 4MHEA 1TVXA 1Q1BA 4E6IA 4I65A 1LTAD 5EBCA 2O5IC 1LTSD 1G2SA 4IFDI 1B9NA 2QF7A 1LT5D 1TWAB 3BVMA 4OIKA 1II3A 2Z1CA 3ERQA 3VR5A 3PO2B 3OIQA 3ITPA 4ID6A 4K2LA 5JPMC 2Q8IB 4UAIA 2XN9C 1W6KA 3H0GB 3PUYA 3G7LA 3GV6A 1BQQT 4OIJA 1EY0A 2K32A 3MTSA 5BN4A 1RCVD 2GA4B 2A73B 2EY6A 1Z6HA 1SAPA 2KHSA 3VYTA 1ENAA 3AU7A 2SEBD 4FF1A 1Y1VB 1PFNA 5I2XA 1TS2A 3K5MA 1XX8A 3RLFA 5FK9C 4DK0A 4A93B 4IUVA 1R4QB 4KY6A 1WTWA 1JQYD 2MJ8A 2QDBA 2XNAC 3DEOA 1TWHB 2PYKA 4KK7A 2EYOA 2XWJB 2RQXA 1SNCA 3MAQA 2D62A 3DUZA 3GTGB 2KQ3A 4RH6A 4K2KA 1Y8PB 3A7AB 1I4HA 2DN8A 5DNFA 1MI2A 2K5QA 3KBGA 1GXDC 2HDLA 1BOSA 2NVXB 2A6HD 3QIAA 4ODGA 2HDMA 1CFMA 5CBAE 1AZQA 1CQVA 4TKOB 4GZYC 3TP5A 4DNRB 1SJED 1X32A 1PRTC 1ICWA 3S1NB 1LT3D 2F0GA 3SHLA 3M85A 2WAQB 5BN3A 2Z4HA 2R92B 2F0SA 1D6EC 2B2VC 1CTMA 4B9WA 3OW7A 5F2DA 4O42A 2KJXA 5KYIA 4ILWA 1IL8A 1PFMA 1SDFA 1MBYA 1K8MA 4A3FB 4BY1B 4EGVA 1Q8IA 3DWQA 4K6LA 3IKJA 4QF4A 4RWSC 1TKWB 2SOBA 1SYBA 4FVMA 5T1GA 3M7NA 3SK4A 1G8ZD 3BG3A 4UDUC 1S5ED 3I4MB 2F0WA 3HOWB 3GTPB 2WKCA 3LWUA 5IOCA 3NP8A 5DAUA 4HR7B 2A6HC 1TU2B 2B8GA 2IX1A 3KLSX 4N9PA 1I6HB 5LHY1 1ET6A 4FXDA 2N88A 3MFGA 2IPKD 2EVBA 3HKZB 5M9OA 4PNYA 2EDGA 3HP3A 1M8AA 2B39A 4F87A 2DNCA 4M1UB 4C56C 3C3LA 5JOBA 5EPLA 4RKLA 3LX0A 2ZT9C 1XYIA 1R9TB 4EQOA 3NHHA 5KEEA 2MGSA 3JAME 3DEPA 4DFAA 5M5XB 2B8FA 4XT1B 5JEAH 1ZYRD 4A3MB 3VA7A 1DXMA 2NN6G 1CHPD 3HS0C 3V2TA 4ZKBB 3NE5B 3NWSA 2A6EC 1SNPA 4HSPA 4A3EB 1B44D 4IURA 3J81E 1DOLA 2RA4A 2H4OA 1IHZA 3NSWA 1LV9A 1YNJC 5HURA 1EOTA 1D1IA 1X3PA 2EE1A 2NVTB 3RD4A 3K59A 1JB3A 4HEDA 1EL0A 1EZ8A 2QILA 4IUNA 2PQEA 3DWPA 3QG1A 4CHTB 3H09A 4KD4A 5I9PA 4NDXA 3OWEB 4R9WA 5C4ZA 3MXGA 2JE6I 1WD0A 2RDGA 4A3BB 1F2LA 3DM1A 2AQ2B 5C6AA 1NR4A 1TR5A 2NUCA 4DF7A 2L0CA 1B4OA 1BR9A 1CI3M 1SNMA 3NTKA 2FJ2A 2FMMA 2ZXOA 2E74C 2V4DA 3K5OA 1BUVT 4BA1I 1PFBA 1ZYRC 4C2MB 3I91A 1LTID 2OF1A 4ZQ3A 1V1PA 1GHKA 4J1MA 1WTQA 3C2PA 1JCKB 2LY7A 5C3WA 3BDOA 3GTOB 3GTQB 1QG7A 3FMCA 4R8IA 2IX3A 3SR1A 2BDNA 1VMPA 4ULLA 3S9WA 2AWNA 2EYMA 5I4DA 1H9JA 1F9PA 3S15B 4X3SA 3KF8A 5C0XJ 4FF2A 4WRDA 3PUXA 3FVQA 5A2QL 5I2YA 3HOVB 1V1OA 4PQXA 3GTLB 2VXWA 4IFDH 3IFTA 4DU9A 1CHQD 3GV3A 5FLXL 5KNCA 2XRSD 3C46A 1FGBD 5CV7A 2EY1A 2J0TD 5FO7B 3OMGA 2EYFA 1SXTA 3HOZB 4IUUA 3OOCA 1TQOA 3A8IE 1LACA 4ZRZA 1E2VA 1GUGA 1OXVA 2M9VA 1D1KA 2ENBA 4JBWA 3V05A 2NBFA 3U9OA 2K5WA 2YU9B 5G3LD 2LFNA 3EJIA 5CV5A 1RTNA 2G9HD 1RF2D 4Z9CB 4YIJA 3E6ZX 2SNMA 4C3HG 1AEXA 5JAVA 3SK5A 1PRTF 4XTCS 2N55A 1J8IA 3O13A 4M8AA 3X3MA 3H94A 4LK1C 5K36H 4V0BA 1JWSD 2PZUA 2E2DC 3OIPA 5HGTA 4OO1I 2K7VA 3NTIA 4KD3A 2C5CA 4FXKC 1EU4A 2QEJC 2CVRA 3TP7A 1DONA 4XIGS 1VMCA 3FKIB 4DXFA 5CV6A 2VB2X 5FLXE 2MPMA 1EYDA 5M5YB 1I3QB 2F0TA 4EVOA 4ZKCB 5ELDA 3HOXB 1BNZA 1ZKOA 1SNDA 1QOHA 2FFKB 2AQ3B 1KLGD 2PNRC 1HRJA 1SYFA 1AW7A 1UAPA 3MC0B 1CM9A 2FMCA 4ZYSA 3X3NA 4U68A 1EY5A 1WCMB 1ESRA 1HFNA 3S16B 1DZ1A 2R7ZB 1EYAA 1TIID 4A3JB 2M2LA 4DAVA 2IT1A 3L7ZC 3M7GA 2AUJD 4RGTA 3MHBA 4IQZA 1U4LA 1KABA 1IW7D 4ZAIA 5BN5A 5KGUA 1QWYA 4FO2A 3TZUA 1JORA 1H9SB 3GD7A 1AP0A 3T4AC 5JEAG 2B2VA 1V1PB 5FOBB 3S1QB 1Q3LA 1HUMA 2D5DA 3H6MA 1LTGD 1S5DD 1U4PA 2F0OA 5I6WA 1A3TA 3R2TA 3S17B 2YYZA 3M4OB 2PO4A 1BCPB 1G91A 4RCNA 1EIHA 1CA6A 4FNFA 5M3MB 1I4GA 1LT4D 1A3UA 1NCVA 2RDHA 4A3DB 4BBSB 1PRTD 1DJRD 3Q24A 3NQTA 3PV0A 3D4WA 3MFYA 4KTAA 3S1RB 1ENCA 4CKEA 4C3JG 4XQQA 5EGTA 2OXPA 4BS9A 5AFWA 5KNBA 3P75A 5M3FB 3DMUA 1JR0D 2F3VA 4A3KB 2K1BA 2F3WA 4HN7A 1AZPA 5IGFA 1IW7C 4XQNA 5TSSA 1H9RA 4MN3A 2B2UC 5C5MA 1YNND 1Y1WB 2EOTA 2JYOA 3A8JE 3IAYA 5DM73 1RDPD 3KLSA 2L5TA 3U9SA 4F8MA 2A69C 1KTKA 4HCEA 4H44C 3VR4A 5IIFA 3MXNA 3N6RA 1ILPA 4C3IG 4IUPA 3NTHA 5C0XI 1B2TA 5EJWA 3OWFA 4OHJA 1NR2A 1HHVA 5C3XA 4K14A 3A7LA 1PTOB 1PZID 4FP5D 1OXUA 2NN6I 1IKLA 2AWOA 4RFBA 2L1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY7 A;  1A3U A;  2F0K A;  2EY5 A;  5NUC A;  1SYE A;  5IGE A;  1A2T A;  3TP7 A;  2HQE A;  4HMI A;  2F0F A;  5C5L A;  1KDC A;  3C1F A;  1EY8 A;  4NMZ A;  1EZ8 A;  4ZUI A;  1STN A;  4KY7 A;  2F0U A;  2PQE A;  4IUN A;  5KIX A;  4G57 A;  4K8J A;  2SOB A;  5CV6 A;  4N9T A;  1SYB A;  4KY6 A;  4QB4 A;  3BDC A;  4WRD A;  3NQT A;  1EYD A;  5EKK A;  4NP5 A;  3T13 A;  4QMG A;  4KD4 A;  3T16 A;  3TP6 A;  1RKN A;  5I9P A;  4DGZ A;  1KDA A;  1NSN S;  1JOK A;  3D4W A;  2F0T A;  4NDX A;  4EVO A;  5J22 A;  3SK6 A;  1EZ6 A;  1U9R A;  2QDB A;  4KTA A;  4K5W A;  5C4Z A;  3SK4 A;  2PYK A;  1ENC A;  1SND A;  2EYH A;  1SNO A;  3NK9 A;  4HMJ A;  5CV9 A;  2F0I A;  2RKS A;  3QB3 A;  2F0W A;  3D8G A;  3DHQ A;  2EYO A;  5EGT A;  1EQV A;  3ERO A;  1SYF A;  4F7X A;  2F0H A;  2F0N A;  2OXP A;  4DU9 A;  3PMF A;  2EXZ A;  1SNC A;  5IOC A;  4TRD A;  3NP8 A;  1TR5 A;  2NUC A;  3P75 A;  4RKB A;  5CR3 A;  3DMU A;  5CV7 A;  5DAU A;  4N9P A;  2KQ3 A;  2PZT A;  4IAL A;  3RUZ A;  1EYC A;  4DF7 A;  2F3V A;  3BDL A;  2EYL A;  3R3O A;  2EYJ A;  2EY1 A;  4K2K A;  5J1Z A;  2F3W A;  5C6A A;  4KJO A;  4LAA A;  3OMG A;  3QOJ A;  4HTH A;  1SNM A;  4K8I A;  5IGF A;  5J39 A;  1F2Y A;  2EYF A;  1EY4 A;  4K5X A;  2PW5 A;  4KV6 A;  2F0V A;  1STY A;  2RDF A;  5IGB A;  3OSO A;  5K5P A;  5M9O A;  1STB A;  2EYP A;  4PNY A;  1EY5 A;  4K6D A;  3MXP A;  3MZ5 A;  2PZW A;  5C5M A;  1SNQ A;  1TT2 A;  1TQO A;  4E6I A;  5IGC A;  1SYG A;  2WAC A;  5CGK A;  4I65 A;  4ME5 A;  1EYA A;  4ODG A;  5E1F A;  4ZUJ A;  4EQN A;  3QOL A;  4F8M A;  5DEH A;  4KJN A;  2F0D A;  5JOB A;  3TME A;  4K5V A;  2F0M A;  4H7B A;  1EY9 A;  3HEJ A;  3MHB A;  4R8N A;  4RKL A;  3TP5 A;  1KAB A;  4KHV A;  3NUC A;  5KRU A;  2ENB A;  1KDB A;  2PW7 A;  5I9O A;  3LX0 A;  1KAA A;  1SYD A;  5IIF A;  1II3 A;  3ERQ A;  3U9O A;  4WOR A;  2OF1 A;  3TP8 A;  2F0G A;  3ITP A;  3SHL A;  5IGD A;  4PMC A;  5KGU A;  3EJI A;  1STH A;  4EQO A;  4ZQ3 A;  3NHH A;  5C4H A;  1SYC A;  5CV5 A;  5KEE A;  4ID6 A;  5E3F A;  4J6H A;  4B9X A;  4K2L A;  4J1M A;  4OL7 A;  1JOR A;  4DFA A;  2F0S A;  4YIJ A;  1NUC A;  2EY2 A;  2F0P A;  3SXH A;  2SNM A;  4KY5 A;  2LKV A;  2F0Q A;  1AEX A;  5KYL A;  1JOQ A;  5JAV A;  3SK5 A;  2F0E A;  4EQP A;  4IZ8 A;  5C3W A;  3OWF A;  3OMC A;  3EVQ A;  4B9W A;  1F2Z A;  2SNS A;  5IOD A;  4NKL A;  1STG A;  3H6M A;  1EY0 A;  5F2D A;  2F0J A;  3SK8 A;  2O4X A;  5CV8 A;  2OEO A;  4K14 A;  5C3X A;  5ISR A;  3V2T A;  2PZU A;  2F0O A;  5I6Y A;  3MEH A;  5CC4 A;  5IGG A;  5I6W A;  5KYI A;  1EY6 A;  3C1E A;  3SR1 A;  2RBM A;  5HGT A;  1SNP A;  2EY6 A;  3HZX A;  1A3T A;  3E5S A;  3NXW A;  4MIU A;  3P1H A;  4KD3 A;  1A2U A;  2KHS A;  4S3S A;  3MVV A;  3D6C A;  2M00 A;  2F0L A;  1F2M A;  1JOO A;  1STA A;  3S9W A;  1ENA A;  1IHZ A;  5HUR A;  3D4D A;  1A3V A;  2EYM A;  3VA5 A;  5CV4 A;  4PMB A;  4QF4 A;  5EKL A; 
#chains in the Genus database with same CATH topology
 1GUW A;  2BOS A;  2KBN A;  2UUA L;  2N8N A;  4TVA B;  3QO2 A;  3TBI B;  2K03 A;  1E0B A;  5KIX A;  3SDZ A;  4FF4 A;  3D3R A;  3WDN A;  1FNW A;  2ZJR A;  5C4X B;  4R4C A;  2QKI C;  1I4P A;  1BKB A;  1HUN A;  4B3S Q;  3JAM L;  3T16 A;  2X6L A;  5JJL A;  1KDA A;  2E2H H;  1WOC A;  2UU9 Q;  1C7Y A;  4A93 G;  4Q5V A;  3HRZ C;  2PCF B;  3DHQ A;  4IFD G;  1YNN C;  3I8Z A;  2F0N A;  4JG2 A;  3F2D A;  4RHR A;  2E8G A;  4L8J A;  1Q7Y C;  1UNS A;  2MHV A;  1Q86 C;  3BDL A;  2ZJQ A;  2DY8 A;  2JSO A;  3GP7 A;  2A6E D;  4KJO A;  4DR6 L;  2C35 B;  2R7F A;  1I4Q A;  3M3Y H;  4K5X A;  3P20 A;  3J81 L;  3CCV A;  4BBR B;  2BH8 A;  3FHW A;  4OGQ C;  2WP8 J;  1YNJ D;  1SE2 A;  4ABN A;  1AE2 A;  1G6Z A;  2A8V A;  1VQF A;  2WAQ E;  3F2U A;  1W6J A;  1CSP A;  4JOI A;  4YCW A;  4HJ8 A;  3G4S A;  4DV4 L;  2Y0S B;  4WFN 3;  1WTV A;  5CYU A;  1ROD A;  2R7D A;  3H3V I;  1DOK A;  5EAY A;  3FDT A;  1Q82 C;  3ZJY C;  3PGZ A;  2IWH A;  1GUS A;  3T51 B;  2VQF L;  3GTJ H;  4K0K Q;  4BY7 H;  1AH9 A;  1NUC A;  1WFQ A;  2EY2 A;  2NVY H;  3FPU B;  2L15 A;  2K5V A;  3A56 A;  3UI2 A;  2LKV A;  4DV2 Q;  2L9H A;  2YU9 H;  4R4O A;  1UUP A;  3S2H B;  5ELC A;  1IBL L;  1MKH A;  1F2Z A;  2OTJ A;  5K36 G;  2F0J A;  3OW2 A;  2OEO A;  2JA8 G;  3U58 A;  3CCS A;  3NBH A;  1A2U A;  1FNV A;  1MHW C;  3IFD A;  1F9R A;  1DD2 A;  2PQA A;  2JN4 A;  1O7Y A;  2JA5 H;  1VQH A;  4PMB A;  5EKL A;  4Y52 H;  3NQI A;  5GAE C;  2RSN A;  1WI5 A;  4DV6 Q;  2OT2 A;  3F2B A;  3BVZ A;  4ZUI A;  2L11 A;  5GAD C;  2F4I A;  3J7A F;  4OXP A;  1HA6 A;  1TS3 A;  1NAP A;  2PI2 E;  3BDC A;  4KKS A;  4RHS A;  5EKK A;  2X69 A;  1SLJ A;  1PYW D;  3I4N H;  2MFI A;  1EZ6 A;  5C3E B;  5COR A;  1HTP A;  3U50 C;  4A3G B;  3M4P A;  4UHV A;  5CMD A;  4CJ1 B;  3QB3 A;  1P16 A;  5ELO A;  3BZD B;  1XXG A;  2ICE C;  5LMN L;  4RCO A;  3HKZ E;  3GTK B;  4B3R Q;  3D6W A;  2RHS B;  1R4P B;  2B2Y C;  3R3O A;  5J1Z A;  2JEA I;  1K73 C;  3I4M G;  4JC0 A;  3J80 L;  2OQK A;  1I94 L;  1F2Y A;  3J7Z C;  3FPP A;  4GNX C;  2VW9 A;  2RDF A;  2E2J B;  4YHH L;  5FLM G;  2K5D A;  3Q22 A;  4LF4 L;  3UE0 A;  4KHP Q;  1SYG A;  5IYC H;  3I55 A;  4NXM L;  1QUQ A;  3KFU A;  3HKZ G;  5JJK A;  2BE5 D;  3KLR A;  2F0D A;  2JA6 G;  4K5V A;  1QB5 D;  3KYH C;  5G3L F;  3W2D A;  3S1M H;  5IYB H;  2DNE A;  1KHI A;  1KAA A;  3CC4 A;  4J8Q A;  3HOU G;  4HSV A;  3K80 C;  4JYA Q;  4OWT B;  5E4W C;  3JAM c;  4B9X A;  4DV0 L;  3H91 A;  2F0P A;  3TZD A;  2VUM B;  2I46 A;  2BA0 A;  5EPK A;  2BA1 A;  1TWC H;  3RLO A;  1JJC B;  5GAG C;  2CH4 A;  3MXU A;  2Q2H A;  2WKD A;  1VQD A;  2ZTD A;  4RAU C;  3S2D H;  2ZJP A;  4MNO A;  1STG A;  4P73 A;  2O4X A;  1ZEQ X;  4WJ4 A;  1K83 B;  5ISR A;  2A5H A;  3KUP A;  5IGG A;  2EJM A;  3AFQ A;  4A3M G;  1UEA B;  1VDZ A;  2Q8T A;  3R8B A;  3MEF A;  2XRQ D;  4C1N I;  3A5Z B;  5EPJ A;  1L1O C;  4CKC A;  3D6C A;  1D5X C;  1A3V A;  1TWA H;  3M9B A;  2PPB C;  3F8T A;  3PO2 H;  4KLK A;  5IGE A;  2E76 C;  3S17 H;  1KNE A;  3G6J B;  1EWI A;  1STN A;  1F77 A;  1H95 A;  3GQB A;  5E4X A;  1V43 A;  5D3I B;  2VNU D;  2WB1 B;  4X62 L;  3L9A X;  3NPP A;  5ELF A;  3J7A 5;  3J80 E;  3HOY G;  1A63 A;  3I72 A;  1JWU D;  1SNO A;  4RA8 A;  4HMJ A;  5CV9 A;  3T56 B;  1B7Y B;  3SE0 A;  2UXD L;  1K28 A;  1OXT A;  4NXN L;  1V1Q A;  4O1N A;  1VQ9 A;  1WD1 A;  1IKM A;  1D8L A;  1E1O A;  3ER0 A;  4JI6 Q;  3EFX D;  2FIN B;  5ELB A;  1YHB A;  2BE5 C;  4X3T A;  5IWA Q;  5M5W B;  1B1Z A;  1J5E L;  1CT1 D;  2EYJ A;  2B63 G;  4C3H B;  2XGT A;  2R3Z A;  1QNK A;  1Y1V H;  4A3B G;  5C44 G;  1MIU A;  1PTO F;  2JP1 A;  3CU7 A;  4HIK A;  1VQ7 A;  5COY A;  2NWG A;  2Z6K C;  4DA2 A;  4A93 H;  1XTC D;  1RTO A;  1TY0 A;  1PDQ A;  4TSS A;  4GLV B;  4CDF C;  1IBK Q;  2OWO A;  2K50 A;  2JA9 A;  3QJY A;  3S24 A;  1G29 1;  5DEH A;  3K0Y A;  2KOL A;  3QWN A;  3J7A V;  1TWH H;  4DKA C;  1WTP A;  3IL8 A;  4Y7N B;  1EQR A;  1XPU A;  4DR2 L;  4HID A;  2B2T C;  5EKI A;  2DUD A;  1SYC A;  1S5B D;  3NWT A;  4CKB A;  4L6T B;  3GTG H;  4XYQ A;  1C9O A;  2QCP X;  1VQJ A;  3KJP A;  3SXH A;  1FR3 A;  5FJ8 G;  1IXR A;  4KHZ A;  5KYL A;  2PNH A;  2WB1 E;  2XIW A;  2VL6 A;  1IZ6 A;  2QDL A;  4DK1 A;  3OMC A;  1EIY B;  3AB9 A;  1BCP D;  2MNA A;  3I7F A;  1QJO A;  2LXJ A;  1N34 Q;  2VB3 X;  1HTL D;  5DM6 3;  3K6O A;  3TDQ A;  3K58 A;  4LF8 Q;  2R61 A;  2NVX H;  1PLF A;  1EY6 A;  3Q0A A;  4OEL B;  3CRL C;  2LSS A;  3CHB D;  3TSS A;  3E3X A;  4LF5 L;  3MVV A;  1X9N A;  4DN4 M;  2K33 A;  2EZV A;  1Q46 A;  3D4D A;  3VA5 A;  4YY3 L;  3S1N H;  1C48 A;  4YWL A;  3BZK A;  4DV5 L;  2ZXP A;  1JT8 A;  1PH7 A;  2L55 A;  3LNN A;  3URY A;  1EY8 A;  2R92 H;  3OPO A;  4MTK A;  1HR0 W;  1TY2 A;  1F9S A;  3BYT B;  4JI0 Q;  4L5T A;  3RZO B;  1JOK A;  3ERS X;  4I7Z C;  3M4Q A;  4LF6 L;  3FEW X;  1S5F D;  3PUW A;  3VYS A;  4IUQ A;  5GRO A;  3NBI A;  1CSQ A;  1FYC A;  2KHJ A;  4RKB A;  3HOV G;  4A3F H;  4BY1 H;  5EQ0 A;  3E0J A;  3CKI B;  1K9M C;  3N52 A;  4HTH A;  2LS0 1;  2VS1 A;  2K28 A;  3CPF A;  2F0V A;  2D2C C;  1STB A;  1S72 A;  3A8K E;  1PHJ A;  2B2U A;  1Y69 U;  2PZW A;  1BBX C;  1SNQ A;  3P7J A;  1FVI A;  4GOP C;  1SMY D;  2H5X A;  1CK1 A;  4ME5 A;  1BDO A;  3Q6S A;  1LUZ A;  4LJZ C;  1TWG B;  1QZG A;  4NW2 A;  5KRU A;  1BCP C;  1KDB A;  2CHB D;  4JBK A;  4DR4 Q;  1EQQ A;  3I4M H;  1B9M A;  3HOW H;  4WOR A;  5D14 A;  3GTP H;  1C8C A;  3CCL A;  1GUT A;  1HXY D;  1B70 B;  1NMF A;  4BY7 G;  1S4Z A;  3VR3 A;  1XJV A;  1DCZ A;  1I6H H;  1KC8 C;  2F0Q A;  2ICI A;  4X65 Q;  2XWB B;  2ZM6 Q;  1JOQ A;  1PTO D;  2Q2U A;  2ATW A;  1HQM C;  1S5C D;  2ZTC A;  2BCO A;  1LLR D;  4L63 B;  3SK8 A;  1EEF D;  5CV8 A;  4AQY L;  4OON A;  2C9O A;  1A15 A;  3FRP B;  3NXW A;  3P1H A;  2PI2 A;  3Q8D A;  2VQF Q;  1RL2 A;  1SFO B;  2JA5 G;  4CBV A;  4CDE C;  5CV4 A;  2X6G A;  4DAM A;  1DYQ A;  2F4V Q;  2B29 A;  1R9T H;  2MO0 A;  4O2D A;  2A69 D;  3PUZ A;  3J7Y W;  2CW0 D;  4JK1 C;  3SEB A;  5M5X H;  2E2I B;  2Q2T A;  2KEE A;  5FLX c;  1HA5 A;  3ULJ A;  3I4N G;  4DGZ A;  3TRE A;  4P2C B;  4LFB Q;  3SK6 A;  1E7Z A;  1PXU A;  1VQE A;  1WTX A;  2CQO A;  4DUY L;  4H0L C;  1PMR A;  3CP0 A;  3ERO A;  2WV6 D;  1N36 L;  2F0H A;  1SMY C;  2RCN A;  1TWF B;  1I6V C;  3HOX G;  5CR3 A;  2HCC A;  4A3E H;  3RUZ A;  2K5H A;  3L2P A;  1O7I A;  1ZXT A;  4X3K A;  5T1I A;  4C3I B;  5BR8 L;  3K0X A;  3BVG A;  2I5L X;  1YBY A;  1DM0 B;  1CZG A;  2NVT H;  1EY4 A;  2EJG C;  2JQO A;  3KF8 B;  2BDO A;  5IGB A;  2Q8R E;  5CBE E;  5IP7 G;  4ALP A;  2RSO A;  4A76 A;  4JI3 Q;  1E2W A;  2HD3 A;  1N32 L;  1F9Q A;  5IYC G;  4IJH A;  3PIO 3;  1VQB A;  1BXT A;  2CKZ B;  2ID0 A;  5E1F A;  3T1Y L;  1MSH A;  1K3B C;  4G7Z C;  1PTO C;  3D4R A;  1BF4 A;  3PUV A;  2UXC L;  4OO1 G;  5IYB G;  4KN7 C;  1TS5 A;  2PW7 A;  1PA6 A;  4XYO A;  2NZH A;  2R7Z G;  3EA6 A;  4A3B H;  1I94 Q;  4PMC A;  1STH A;  1Q81 C;  1ET9 A;  2GVB A;  2A1A A;  1Z47 A;  4OL7 A;  4YHH Q;  2I5M X;  1Y14 B;  1CKN B;  2O5J C;  4KY5 A;  4DV1 L;  5LL6 X;  1VQN A;  4A3L G;  1I50 B;  1HZA A;  2LXK A;  1I4R A;  3HGB A;  5EBD A;  3V96 A;  1NY4 A;  2CW0 C;  4OEM B;  2IHE A;  1WVL A;  3A55 A;  3KK7 A;  4AYB B;  5I6Y A;  4QY7 A;  1EU3 A;  4CJ2 C;  3RZD B;  4PMW A;  5JVG 3;  3CPW A;  2JEB I;  4C2M H;  4DV0 Q;  1STA A;  1V9P A;  4IPH A;  1SJH D;  1GVP A;  5FJ8 H;  3PO2 G;  1YNX A;  5NUC A;  1UEB A;  2HQE A;  1SE3 A;  1PH3 A;  3ND8 A;  1E1T A;  4G7O C;  2MO1 A;  1O7Z A;  2IX0 A;  1Z7T A;  2IY5 B;  5M3M G;  1QE6 A;  1HQR D;  2R93 B;  2G9D A;  2EQS A;  4WJW A;  4JI5 L;  4N8F A;  5FO9 B;  4DR5 L;  2MP1 A;  2JXM B;  3K57 A;  1XMO L;  3GTO H;  1JJG A;  3GTQ H;  1LTR D;  1PZJ D;  1VQO A;  2A74 C;  3NK9 A;  2HQL A;  2UXB Q;  2F0I A;  4L5Q A;  1N33 L;  3D8G A;  1LAB A;  1EQV A;  3PMF A;  2K04 A;  4GN3 B;  1TS4 A;  4DAP A;  2KUM A;  1CUK A;  4H13 C;  2B2Y A;  4APV A;  1VQL A;  1Y1V G;  5JEA J;  2QA4 A;  4GNX A;  1B3A A;  4CGY B;  5M3F G;  2B2W C;  3HFZ B;  5K5P A;  1XWE A;  1U0L A;  4TQU S;  3S15 H;  4A3K G;  1VF7 A;  4AYB E;  2JA8 B;  1TT2 A;  5ELN A;  2WAC A;  1CKO A;  4HIO A;  1DOM A;  5ELE A;  2XVS A;  4NXN Q;  4ZUJ A;  2QEX A;  3J81 j;  1HJP A;  3HOV H;  4G7H C;  3VYU A;  3MA2 B;  3NUC A;  1Y1W G;  1T5E A;  1X65 A;  3GTL H;  3D31 A;  4YCV A;  3TP8 A;  1PH6 A;  2NTT A;  3KJO A;  3TRZ A;  1X3Q A;  4J6H A;  1AE3 A;  3I3C A;  4LMQ D;  1B50 A;  1L0X B;  4RGN A;  3PQI A;  2HIV A;  1M4V A;  4DAY A;  3HOZ H;  3L0O A;  4DXG A;  1SMX A;  2MUY A;  1QVF A;  4LF7 L;  2TSS A;  3H3V C;  3CF5 A;  3BZC A;  2K01 A;  3OYY A;  1GJX A;  1CQF A;  5JPN C;  2KED A;  3HKS A;  3MEH A;  3S14 B;  1U4R A;  3E5S A;  4DUZ L;  4DR2 Q;  2JA7 B;  1L1O A;  2JK8 A;  1YJW A;  4KN4 C;  4LFA L;  1KNA A;  1PRT B;  2H1E A;  2J4X A;  4DV7 L;  1EEI D;  2NZO A;  1EY7 A;  1KRS A;  2F0K A;  2WAQ G;  3L3O C;  2NTS A;  2VQE Q;  1A2T A;  1EFI D;  4DPG A;  2F0F A;  3CQZ B;  3BS1 A;  3C1F A;  2R92 G;  1MJC A;  4A3I B;  1Q90 A;  2KCM A;  1EWH A;  3EBE A;  2NVQ B;  1JWM D;  1HH2 P;  2TMP A;  3J80 i;  3TP6 A;  1RKN A;  3D0F A;  1K0S A;  1QNU A;  1U9R A;  1Y8O B;  4FXG C;  4LW1 A;  4JI4 L;  2JA6 B;  3LWE A;  5C4X G;  4XQJ A;  1WTR A;  4ZCK A;  3ONA B;  4L5R C;  1H9K A;  1HNX L;  3HOU B;  2KEC A;  4DV5 Q;  2K6A A;  4JI7 Q;  3R93 A;  1LT6 D;  4IAL A;  5GQO A;  4BY1 G;  4A3F G;  1ASY A;  1HCZ A;  4XT3 B;  1E3P A;  1FD7 D;  2EYL A;  1AFP A;  4I7A A;  3WOF A;  2A68 D;  3TN2 A;  2Z4I A;  1CZW A;  3QOJ A;  2KVM A;  1A6X A;  1PZK D;  4NPS A;  4ZLT F;  2Q2I A;  5C0X G;  3K7A B;  1PYS B;  2EYP A;  2R6G A;  3VR2 A;  2Y0S E;  4LUZ A;  2Z6K A;  5LMU L;  4HIM A;  1O78 A;  1OTC A;  3FKI H;  5IT9 L;  5HY6 A;  1SN8 A;  5CGK A;  5C4J B;  3PO3 B;  1K8G A;  1XNR L;  5M5Y H;  4V19 0;  4BBR G;  2NB0 A;  1I3Q H;  1Z9F A;  1RHP A;  4B3M L;  3HOX H;  4KHV A;  1MGS A;  1E24 A;  4QJF A;  4JV5 L;  1C4Q A;  5I9O A;  1QCB D;  3BYY B;  3HOW G;  4LFC L;  1HZB A;  2B2T A;  3GTM B;  1OO9 B;  4JI2 L;  2RHQ B;  3T1H Q;  1BO0 A;  1WTO A;  2UUB L;  5IP7 H;  1PYB A;  5FO8 B;  1BCP F;  3M4Y A;  3RMH A;  3AEV A;  3AMU A;  2WII B;  2HUG A;  1O7L A;  3W3A A;  2SNS A;  3HOY B;  1A0I A;  1WCM H;  1HZC A;  1GD7 A;  4JI1 L;  2K75 A;  4OO1 H;  5CC4 A;  4YCU A;  3S16 H;  3K5N A;  3KDF B;  3HZX A;  2R7Z H;  4A3J H;  1JE5 A;  2KCN A;  4IFD J;  2SDF A;  1F2M A;  2WIN B;  4QIW B;  3MXN B;  2B63 B;  1JIC A;  4P71 A;  5C44 B;  2E5L L;  4A3L H;  2KA7 A;  4HMI A;  4KKT A;  1SSO A;  2FXQ A;  2K52 A;  4B3T L;  1JE4 A;  2XSC A;  4K8J A;  4N9T A;  4QB4 A;  2GN5 A;  3T53 B;  2DJG C;  3S1Q H;  2A68 C;  4AQY Q;  4XXE A;  5J22 A;  1KLU D;  4POG A;  4U67 3;  1VF5 C;  4QUF A;  1JMC A;  3J81 c;  1NTG A;  4PV1 C;  2IW3 A;  1FNU A;  4OX9 L;  1X6O A;  4LF9 L;  3TEH B;  4DNT B;  3K5L A;  2OTL A;  4X6A H;  2CH4 W;  1IYV A;  3DXJ C;  5C3E G;  5AJ3 L;  1S40 A;  3M4O H;  3KF6 B;  4QCL A;  1GUO A;  2I07 B;  4HCS A;  4C1N K;  4A3E G;  5IT9 E;  2BH2 A;  2PZT A;  1GUN A;  5M3M H;  1LTT D;  2K05 A;  4K8I A;  1H9S A;  5J39 A;  2GVA A;  1E2Z A;  3F1Z A;  2UUC Q;  4GKK Q;  2RCF A;  1STY A;  2WFW A;  1AN8 A;  2Z8L A;  4KI0 A;  2DY7 A;  4A3D H;  4A75 A;  4BBS H;  3DWA A;  4GOP A;  5IGC A;  2QW7 A;  3F2C A;  2CWP A;  1SEB D;  3PSI A;  2NZ1 D;  4KJN A;  3TME A;  1X3E A;  2F0M A;  4H7B A;  1EY9 A;  3S1R H;  3HEJ A;  4QIW E;  4UP7 A;  2IL8 A;  1SYD A;  4QL5 A;  3EQL C;  1V8Q A;  1RJT A;  5M3F H;  3TS0 A;  4UP8 A;  4Q0F A;  4A3K H;  3G48 A;  5KND A;  2EPB A;  1EQT A;  2YV5 A;  3ND9 A;  2F0E A;  4IUT A;  4IZ8 A;  5A35 A;  1D5M C;  2E2H B;  3EVQ A;  3T1Y Q;  5IOD A;  1Y8N B;  4HAE A;  1KRT A;  4DAY B;  4QUC A;  2UXC Q;  1G2T A;  1STE A;  1Y1W H;  1VCI A;  2L12 A;  3C1E A;  2RBM A;  1OXX K;  3I90 A;  1H9M A;  1EYG A;  3VR6 A;  1GHJ A;  2FHT A;  2E75 C;  1MSG A;  2M00 A;  2F0L A;  2OCE A;  2HCI A;  2Z0S A;  1JOO A;  5JVH 3;  5GAH C;  3CRK C;  1JJ2 A;  1KL9 A;  4DV1 Q;  2CQA A;  3W1G A;  1XNQ L;  3M3Y B;  2F1M A;  1SYE A;  1KDC A;  2NYZ D;  4NMZ A;  4F88 A;  1X56 A;  1EWC A;  1JC7 A;  1GOZ A;  1D2B A;  3KBX A;  2ZXR A;  1YZ6 A;  4GKJ L;  4K0K L;  4QMG A;  4BWG B;  3U4V A;  1SBB B;  3J80 c;  5FKA C;  4EX5 A;  2D0P A;  1HFG A;  4KMU C;  1UE1 A;  5E7N A;  3NBH B;  2DGY A;  1PTO H;  2WB1 G;  2PQA B;  2EXZ A;  3GTJ B;  1L0Y B;  4TRD A;  3TQY A;  1LO5 D;  4X64 Q;  4BY7 B;  2PMZ B;  1LTB D;  4DR3 L;  2NVY B;  1J9O A;  2LMC B;  1CA5 A;  3ZYY X;  4LWC A;  3DLL A;  3I73 A;  3CCR A;  1D5Z C;  3OSO A;  4CJ0 B;  4JI5 Q;  3A74 A;  5DLQ E;  1VQI A;  3CW2 C;  3A54 A;  3MXP A;  4RGO S;  5C4X H;  1L2F A;  4RGM A;  1XPO A;  4X3U A;  3OHX C;  1N9W A;  4EQN A;  4ZK9 B;  3QOL A;  2MQH A;  2UUA Q;  4UP9 A;  3VYR A;  4R8N A;  1EIG A;  1I4X A;  1K3R A;  2JA5 B;  1UE6 A;  4G4K A;  4DV3 L;  4B08 A;  2L4N A;  5IGD A;  5C4H A;  1K8O A;  5E3F A;  1ML0 D;  5C0X H;  4GLA C;  5A2Q E;  3GO5 A;  2IJ0 A;  1MD2 D;  3HG9 A;  2XTI A;  1OXS C;  3I70 A;  1HPC A;  4EQP A;  4IO9 A;  1T9H A;  3HOZ G;  3I4N B;  3R2I A;  3E9I A;  4BBR H;  3CCQ A;  3PIP 3;  4DR1 L;  1CKM A;  4NKL A;  1W3S A;  1QIL A;  1QUQ B;  2P5Z X;  3WOE A;  2NN6 H;  1NMG A;  4FYD A;  4XDX A;  4IN3 A;  3MWY W;  4YWK A;  4DR6 Q;  4MIU A;  1YJN A;  5LL6 S;  1HNW L;  4S3S A;  2RVL A;  2AKW B;  1LM0 A;  5J3B A;  1C0A A;  1SE4 A;  2EY5 A;  4JCV E;  3SVM A;  1RD9 D;  5C5L A;  4KY7 A;  2F0U A;  2KCC A;  4G57 A;  4DV4 Q;  4R4I A;  1ONL A;  4GS3 A;  1B53 A;  4JYA L;  4C3J B;  1YIJ A;  4KKU A;  4NP5 A;  3T13 A;  3S2H H;  5D3D A;  2D9U A;  4H02 A;  1NSN S;  1ILQ A;  5JJZ A;  4K5W A;  1Q12 A;  1IYU A;  3S1M B;  3E0E A;  2EYH A;  4LFA Q;  1T5X D;  2AUK A;  2RKS A;  1YVC A;  2NVQ H;  4FF3 A;  4F7X A;  1Q1E A;  3CMA A;  3DM3 A;  1ENF A;  1O80 A;  2O2L D;  2K4K A;  2J7Z A;  2EJF C;  4OWW B;  1IBL Q;  1EYC A;  1PH1 A;  1PH5 A;  4R4T A;  4LAA A;  4BA2 I;  1ESF A;  1TWC B;  4CDD C;  1U4M A;  3UE1 A;  2PW5 A;  4KV6 A;  2AQ1 B;  2B2W A;  1Q8K A;  3I4L A;  2F03 A;  3S2D B;  4K6D A;  3Q23 A;  3FKI G;  3MZ5 A;  1VQG A;  5D65 A;  4MHE A;  1HNZ L;  1TVX A;  1Q1B A;  4E6I A;  4I65 A;  1LTA D;  5EBC A;  1GO3 E;  2O5I C;  1MJE A;  1LTS D;  1YIT A;  3H3V H;  1HNX Q;  5C3E H;  3G71 A;  1G2S A;  4IFD I;  4A3G H;  1B9N A;  2QF7 A;  1LT5 D;  5C4J H;  1TWA B;  3BVM A;  4OIK A;  1II3 A;  2Z1C A;  3ERQ A;  3VR5 A;  4O0A A;  3PO2 B;  3OIQ A;  3ITP A;  3GTK H;  4N8X 1;  3CME A;  1KXL A;  4ID6 A;  4K2L A;  1PH2 A;  5JPM C;  2Q8I B;  1PH4 A;  3I4O A;  4UAI A;  2XN9 C;  1PH8 A;  1W6K A;  3H0G B;  3PUY A;  1VQ5 A;  4JI6 L;  3G7L A;  3GV6 A;  2E2J H;  1BQQ T;  5IWA L;  5LMN Q;  4B3M Q;  4OIJ A;  1WCM G;  1EY0 A;  2K32 A;  3MTS A;  5BN4 A;  1RCV D;  4JPB W;  1BBW A;  2GA4 B;  4BXX H;  2A73 B;  4JV5 Q;  4A3J G;  2EY6 A;  1WTH A;  1NNX A;  1Z6H A;  4LFC Q;  2HIX A;  1SAP A;  2KHS A;  3CCM A;  4JI2 Q;  3VYT A;  1IBK L;  1ENA A;  1HR0 L;  3AU7 A;  1N8R C;  2SEB D;  4FF1 A;  1Y1V B;  4LF4 Q;  2ZTE A;  1PFN A;  5I2X A;  1TS2 A;  3K5M A;  1XX8 A;  4NXM Q;  3RLF A;  5FK9 C;  4DK0 A;  4A93 B;  3AQQ A;  4IUV A;  1R4Q B;  2VUM H;  4KY6 A;  4JI1 Q;  4A3C H;  1WTW A;  1JQY D;  2MJ8 A;  3PIO A;  2VZA A;  2QDB A;  2XNA C;  2YTV A;  1QVC A;  3DEO A;  1TWH B;  2PYK A;  1K83 H;  1FJG L;  3AFP A;  3CCU A;  1XMQ L;  4KK7 A;  2EYO A;  2V1C C;  2XWJ B;  4DR7 L;  2RQX A;  1SNC A;  3MAQ A;  2E5L Q;  2D62 A;  3DUZ A;  3GTG B;  2KQ3 A;  4RH6 A;  4LF8 L;  3OTO L;  1QVG A;  4K2K A;  1Y8P B;  3A7A B;  2B3G A;  4A3D G;  1I4H A;  4X66 L;  2VY3 A;  2DN8 A;  5DNF A;  1MI2 A;  4BBS G;  2K5Q A;  3KBG A;  1GXD C;  2HDL A;  5IY0 A;  1BOS A;  2NVX B;  2A6H D;  3QIA A;  4ODG A;  4OX9 Q;  2HDM A;  1CFM A;  5CBA E;  1AZQ A;  3SGI A;  1CQV A;  4TKO B;  4GZY C;  3TP5 A;  5H1S E;  2CFM A;  4DNR B;  1RIP A;  4JI0 L;  1SJE D;  1X32 A;  4DNI A;  1PRT C;  1ICW A;  1VQC A;  3S1N B;  4RG1 A;  1LT3 D;  2F0G A;  3SHL A;  3M85 A;  2WAQ B;  3ICE A;  5BN3 A;  2Z4H A;  4X62 Q;  2R92 B;  2F0S A;  1D6E C;  5M5W H;  2B2V C;  4C3H H;  1CTM A;  1X54 A;  2F3I A;  2UXD Q;  4B9W A;  1IBM L;  3OW7 A;  1YJ9 A;  5F2D A;  1DGS A;  4O42 A;  1FL0 A;  2KJX A;  5KYI A;  1J5E Q;  1QZH A;  4ILW A;  1IL8 A;  1PFM A;  1SDF A;  1MBY A;  1SRU A;  4MTN A;  1K8M A;  3STB D;  4A3F B;  4BY1 B;  4EGV A;  1Q8I A;  3DWQ A;  4AYB G;  4JI8 L;  4K6L A;  3IKJ A;  4Y7N H;  1PFS A;  3FP9 A;  4QF4 A;  4RWS C;  2CCZ A;  1UE7 A;  5HGQ A;  4JBJ A;  4L5S A;  1TKW B;  4DR4 L;  3PF4 A;  2SOB A;  1SYB A;  4FVM A;  5T1G A;  2I5H A;  1VQ8 A;  3M7N A;  3SK4 A;  4X65 L;  2ZM6 L;  1G8Z D;  4MZ9 A;  5JJI A;  3BG3 A;  4UDU C;  1S5E D;  4AH6 A;  2F0W A;  3I4M B;  2R93 G;  3HOW B;  3RN5 A;  3GTP B;  2K5N A;  3I2Z A;  1XNQ Q;  2WKC A;  3LWU A;  5IOC A;  3NP8 A;  5DAU A;  4HR7 B;  2A6H C;  1TU2 B;  2B8G A;  2IX1 A;  3KLS X;  4N9P A;  1I6H B;  5LHY 1;  1ET6 A;  4FXD A;  1A8V A;  1K8A C;  2N88 A;  3MFG A;  4POF A;  4GKJ Q;  2IPK D;  2EVB A;  3CD6 A;  3HKZ B;  5M9O A;  2AMC B;  4PNY A;  2QGQ A;  4FDB A;  2ALY B;  3CXC A;  2F4V L;  4LF5 Q;  2EDG A;  3HP3 A;  4HJA A;  1M8A A;  2B39 A;  4OWX B;  4F87 A;  2DNC A;  4M1U B;  3RZO H;  4YY3 Q;  4C56 C;  3C3L A;  3NEL A;  4P74 A;  5JOB A;  5EPL A;  4RKL A;  2N49 A;  4DR3 Q;  3LX0 A;  2ZT9 C;  1XYI A;  1M90 C;  1R9T B;  1NJI C;  4LFB L;  4EQO A;  4QQB X;  3NHH A;  1UE5 A;  5KEE A;  1WYD A;  2MGS A;  1WJJ A;  3JAM E;  3DEP A;  4DFA A;  5M5X B;  2B8F A;  4XT1 B;  4LF6 Q;  5JEA H;  3STB C;  1ZYR D;  4A3M B;  3VA7 A;  2A19 A;  1DXM A;  1XTD A;  2NN6 G;  1CHP D;  3HS0 C;  3V2T A;  4ZKB B;  3NE5 B;  3NWS A;  2A6E C;  4DV3 Q;  1SNP A;  1TXY A;  4IOA A;  5IYD G;  5L37 A;  4JI3 L;  1TWG H;  4HSP A;  4A3E B;  4GN4 B;  1B44 D;  2Y0S G;  4IUR A;  2EIF A;  4ME3 A;  3J81 E;  1DOL A;  2RA4 A;  2H4O A;  1IHZ A;  3NSW A;  1LV9 A;  1YNJ C;  5HUR A;  1EOT A;  2HT1 A;  1D1I A;  1X3P A;  3K7U C;  2EE1 A;  2JA7 G;  2NVT B;  3E9H A;  3RD4 A;  3K59 A;  1JB3 A;  1SRO A;  3KOJ A;  4HED A;  1EL0 A;  1EZ8 A;  2QIL A;  4HJ9 A;  4DR1 Q;  4IUN A;  2PQE A;  5IE8 A;  3DWP A;  4GN5 A;  3QG1 A;  4CHT B;  4PZ7 A;  3H09 A;  4KD4 A;  5I9P A;  1EFW A;  4NDX A;  3OWE B;  4R9W A;  5C4Z A;  1HNW Q;  3MXG A;  4A3I G;  2JE6 I;  1WD0 A;  3UDG A;  4C3J H;  2RDG A;  4A3B B;  1F2L A;  3DM1 A;  2AQ2 B;  1ASZ A;  5C6A A;  1NR4 A;  1TR5 A;  2NUC A;  3CCE A;  4DF7 A;  4R1J A;  1SFO H;  2L0C A;  1PVO A;  1B4O A;  1BR9 A;  4CDC C;  1CI3 M;  4GLX A;  3A0J A;  3NEN A;  1SNM A;  3NTK A;  4AIM A;  4PZ6 A;  2FJ2 A;  2FMM A;  2ZXO A;  2E74 C;  2E2I H;  1E22 A;  2V4D A;  1KD1 C;  3K5O A;  2EXD A;  1BUV T;  4BA1 I;  1PFB A;  4JOI C;  2KEN A;  1ZYR C;  4EQ5 A;  1VQ4 A;  4C2M B;  4A3G G;  5IP9 H;  3I91 A;  1VQK A;  3PO3 G;  1LTI D;  1LTL A;  2OF1 A;  2HHH L;  2Z6B A;  4PG3 A;  1TWF H;  4ZQ3 A;  1V1P A;  2UXB L;  1GHK A;  4J1M A;  4C3I H;  1WTQ A;  1U5K A;  3C2P A;  4GNX B;  1JCK B;  2LY7 A;  1HNZ Q;  4DUY Q;  3NEM A;  5C3W A;  3BDO A;  1N36 Q;  2IHF A;  3GTO B;  3GTQ B;  1QG7 A;  3FMC A;  4R8I A;  4B3S L;  1EUJ A;  3H0G H;  5BR8 Q;  3RN2 A;  2OQ0 A;  4BXX G;  2IX3 A;  3SR1 A;  2G5D A;  2UU9 L;  2Z9H A;  3B6Y A;  2BDN A;  1VMP A;  3BU2 A;  3IRB A;  4ULL A;  3S9W A;  2AWN A;  2EYM A;  5I4D A;  1N32 Q;  4JW0 A;  3KLW A;  1H9J A;  1F9P A;  3S15 B;  4X3S A;  3I56 A;  3KF8 A;  5C0X J;  2VUM G;  4FF2 A;  4WJ3 M;  4WRD A;  3PUX A;  4HJ7 A;  4A3C G;  1I50 H;  1S3O A;  3FVQ A;  2K14 A;  5A2Q L;  5I2Y A;  3HOV B;  1V1O A;  4PQX A;  3GTL B;  2VXW A;  1HR0 Q;  1B8A A;  4R4Q A;  4IFD H;  1SE8 A;  3IFT A;  1L1O B;  3RZD H;  4DU9 A;  3EN2 A;  5IT9 c;  1CHQ D;  3GV3 A;  5FLX L;  5KNC A;  2XRS D;  3C46 A;  1FGB D;  5CV7 A;  3QR8 A;  1VQA A;  2EY1 A;  2J0T D;  5FO7 B;  3OMG A;  1CKN A;  2EYF A;  1SXT A;  3HOZ B;  2N3S A;  2DJF C;  4DV2 L;  1LYL A;  4IUU A;  3OOC A;  1TQO A;  4UPA A;  2ES2 A;  3A8I E;  1LAC A;  3CC7 A;  4ZRZ A;  4DK3 C;  1XMQ Q;  4JVZ A;  2VQE L;  1FJG Q;  2R93 H;  1E2V A;  4DR7 Q;  1X3G A;  4RMF A;  1GUG A;  1OXV A;  1GM5 A;  2M9V A;  1D1K A;  2ENB A;  4JBW A;  3OTO Q;  3V05 A;  2NBF A;  2RF4 A;  3U9O A;  2K5W A;  1VQ6 A;  2YU9 B;  5G3L D;  2LFN A;  3EJI A;  4YWM A;  1VS0 A;  5CV5 A;  1UWV A;  3UDF A;  4DR5 Q;  1RTN A;  2G9H D;  1RF2 D;  4Z9C B;  1XMO Q;  4YIJ A;  3E6Z X;  2YTX A;  4X66 Q;  2SNM A;  4C3H G;  3PF5 A;  1G6P A;  1AEX A;  5JAV A;  3SK5 A;  4JI7 L;  1PRT F;  4XTC S;  2N55 A;  1N33 Q;  1G51 A;  1J8I A;  4DV6 L;  3O13 A;  4M8A A;  3H15 A;  3X3M A;  4IPD A;  3H94 A;  4LK1 C;  5K36 H;  4V0B A;  4J15 A;  1JWS D;  2JA8 H;  2PZU A;  3CC2 A;  3U4Z A;  2E2D C;  3OIP A;  5HGT A;  1KAW A;  4OO1 I;  2K7V A;  3NTI A;  3CAM A;  4KD3 A;  2C5C A;  1A62 A;  4FXK C;  1EU4 A;  2QEJ C;  2CVR A;  4P75 A;  1K0R A;  3RLN A;  3JC6 6;  4LUO A;  4B3R L;  3GDE A;  3TP7 A;  1DON A;  4XIG S;  1VMC A;  3FKI B;  1IBM Q;  4DXF A;  5CV6 A;  1VQP A;  2YTY A;  2VB2 X;  4A4I A;  2MPM A;  5FLX E;  3PCO B;  1EYD A;  4LUV A;  5M5Y B;  3T1H L;  1I3Q B;  2F0T A;  4EVO A;  4ZKC B;  3TS2 A;  5IYD H;  5ELD A;  3HOX B;  1BNZ A;  1ZKO A;  2PMZ E;  4P72 A;  1SND A;  4KHP L;  1QOH A;  2FFK B;  1L0W A;  1D7Q A;  2AQ3 B;  1PV4 A;  1KLG D;  4JI8 Q;  2PNR C;  1HRJ A;  1SYF A;  3S14 H;  1AW7 A;  2JA7 H;  1UAP A;  3MC0 B;  1CM9 A;  2FMC A;  4ZYS A;  4LF7 Q;  3X3N A;  1VQM A;  4U68 A;  3CQZ H;  5FLM H;  1EY5 A;  4DUZ Q;  1WCM B;  1ESR A;  1BVS A;  4A3I H;  1I5F A;  3PIP A;  1HFN A;  3S16 B;  1DZ1 A;  4DV7 Q;  2R7Z B;  1EYA A;  1TII D;  4A3J B;  2M2L A;  1YEZ A;  4DAV A;  1YHQ A;  2IT1 A;  3L7Z C;  2D0O A;  3M7G A;  2JA6 H;  2AUJ D;  4RGT A;  3MHB A;  4IQZ A;  1U4L A;  1KAB A;  1IW7 D;  4ZAI A;  5BN5 A;  4JBM A;  3K81 C;  5KGU A;  1QWY A;  3HOU H;  4FO2 A;  2I0Q A;  3TZU A;  2KCT A;  1JOR A;  1H9S B;  3GD7 A;  1AP0 A;  1BBU A;  3T4A C;  5JEA G;  2B2V A;  4JI4 Q;  1V1P B;  5FOB B;  1PH9 A;  3S1Q B;  2N78 A;  1FGU A;  3VDY A;  1HZ9 A;  3K7A H;  1Q3L A;  4GOP B;  1HUM A;  2D5D A;  3H6M A;  1LTG D;  1S5D D;  2UUC L;  4GKK L;  1U4P A;  2F0O A;  3PO3 H;  4PZ8 A;  5I6W A;  4A3M H;  1A3T A;  3A5U A;  3R2T A;  3S17 B;  2YYZ A;  3M4O B;  2PO4 A;  1BCP B;  1G91 A;  4RCN A;  1EIH A;  1CA6 A;  1EOV A;  3UDI A;  5LMU Q;  1NBW A;  1KQS A;  4FNF A;  5M3M B;  2JJQ A;  1I4G A;  1LT4 D;  1A3U A;  3RNU A;  3GTM H;  1XNR Q;  1NCV A;  2AHO B;  2RDH A;  4LNQ A;  3G6E A;  4A3D B;  1GKH A;  1YI2 A;  4BBS B;  1PRT D;  1P8L A;  1DJR D;  3Q24 A;  3NQT A;  3RR5 A;  3PV0 A;  3D4W A;  1IYJ B;  3MFY A;  4KTA A;  3S1R B;  3HOY H;  3W5O A;  1ENC A;  4CKE A;  4C3J G;  4XQQ A;  2UUB Q;  5EGT A;  1J6Q A;  2OXP A;  1M1K C;  4BS9 A;  3BJU A;  1X3F A;  5AFW A;  5KNB A;  3P75 A;  5M3F B;  3DMU A;  1SR3 A;  1JR0 D;  1YHA A;  3K8A A;  2F3V A;  4DK6 C;  4A3K B;  1W2B A;  2K1B A;  2F3W A;  2B63 H;  4HN7 A;  1AZP A;  1B3Q A;  5IGF A;  2F52 A;  1IW7 C;  4XQN A;  2CWA A;  5C44 H;  5TSS A;  3CCJ A;  1H9R A;  4MN3 A;  4IPG A;  1JB7 A;  2B2U C;  1X55 A;  5C5M A;  3W1B A;  1YNN D;  1Y1W B;  2EOT A;  2JYO A;  3A8J E;  3IAY A;  5DM7 3;  1RDP D;  2KHI A;  3KLS A;  2L5T A;  3ULL A;  3U9S A;  4F8M A;  2A69 C;  3EIV A;  3KDF A;  1KTK A;  4HCE A;  1N34 L;  4H44 C;  4IPC A;  5IP9 G;  4B3T Q;  3VR4 A;  5IIF A;  3AYH B;  1XPR A;  3JAM i;  3MXN A;  4IJL A;  1ICF B;  5LMN W;  3N6R A;  1IL2 A;  4C3I G;  1ILP A;  3UDX A;  4IUP A;  3NTH A;  4QGU A;  1EIF A;  5C0X I;  3LGJ A;  4NB3 A;  1NE3 A;  1B2T A;  5EJW A;  3OWF A;  4X64 L;  4LF9 Q;  4OHJ A;  1NR2 A;  5AJ3 Q;  1HHV A;  5C3X A;  4K14 A;  3ULP A;  3A7L A;  3H0G G;  1PTO B;  1PZI D;  4FP5 D;  1OXU A;  4HJ5 A;  2NN6 I;  2HHH Q;  3J81 i;  1IKL A;  4UY8 C;  2ASB A;  2AWO A;  4RFB A;  2L1B A;  3KF6 A;  3WWV A;  4IOC A;  1KIX A; 
#chains in the Genus database with same CATH homology
 1GUW A;  2BOS A;  3QO2 A;  3TBI B;  2K03 A;  1E0B A;  5KIX A;  3SDZ A;  4FF4 A;  3D3R A;  3WDN A;  1FNW A;  5C4X B;  2QKI C;  1I4P A;  1HUN A;  3JAM L;  3T16 A;  2X6L A;  1KDA A;  4Q5V A;  3HRZ C;  2PCF B;  3DHQ A;  4IFD G;  1YNN C;  3I8Z A;  2F0N A;  4RHR A;  4L8J A;  1UNS A;  2MHV A;  3BDL A;  2DY8 A;  2JSO A;  3GP7 A;  2A6E D;  4KJO A;  1I4Q A;  4K5X A;  3P20 A;  3J81 L;  4BBR B;  4OGQ C;  2WP8 J;  1YNJ D;  1SE2 A;  4ABN A;  1G6Z A;  3F2U A;  1W6J A;  2Y0S B;  4WFN 3;  1WTV A;  5CYU A;  1ROD A;  1DOK A;  3FDT A;  2IWH A;  1GUS A;  3T51 B;  1NUC A;  2EY2 A;  3FPU B;  3A56 A;  3UI2 A;  2LKV A;  2L9H A;  1UUP A;  3S2H B;  5ELC A;  1F2Z A;  5K36 G;  2F0J A;  2OEO A;  3NBH A;  1A2U A;  1FNV A;  3IFD A;  1DD2 A;  1F9R A;  1O7Y A;  4PMB A;  5EKL A;  3NQI A;  2RSN A;  2OT2 A;  3BVZ A;  4ZUI A;  2L11 A;  2F4I A;  3J7A F;  1HA6 A;  1TS3 A;  1NAP A;  3BDC A;  4KKS A;  4RHS A;  5EKK A;  2X69 A;  1PYW D;  1EZ6 A;  5C3E B;  5COR A;  1HTP A;  4A3G B;  5CMD A;  4CJ1 B;  3QB3 A;  3BZD B;  1XXG A;  2ICE C;  4RCO A;  3GTK B;  3D6W A;  1R4P B;  2B2Y C;  3R3O A;  5J1Z A;  2JEA I;  3J80 L;  1F2Y A;  3FPP A;  2RDF A;  2E2J B;  2K5D A;  3Q22 A;  1SYG A;  2BE5 D;  3KLR A;  2F0D A;  4K5V A;  1QB5 D;  5G3L F;  3W2D A;  2DNE A;  1KAA A;  4J8Q A;  4HSV A;  5E4W C;  4B9X A;  3H91 A;  2F0P A;  3TZD A;  2VUM B;  2I46 A;  2BA0 A;  5EPK A;  2BA1 A;  3MXU A;  2WKD A;  4RAU C;  1STG A;  2O4X A;  1ZEQ X;  1K83 B;  5ISR A;  2A5H A;  3KUP A;  5IGG A;  2EJM A;  1UEA B;  1VDZ A;  2Q8T A;  3R8B A;  2XRQ D;  4C1N I;  5EPJ A;  4CKC A;  3D6C A;  1D5X C;  1A3V A;  2PPB C;  5IGE A;  2E76 C;  1KNE A;  3G6J B;  1STN A;  1F77 A;  3GQB A;  5E4X A;  1V43 A;  5D3I B;  2VNU D;  2WB1 B;  3L9A X;  3NPP A;  5ELF A;  3J80 E;  3I72 A;  1JWU D;  1SNO A;  4RA8 A;  4HMJ A;  5CV9 A;  3T56 B;  3SE0 A;  1OXT A;  1IKM A;  4O1N A;  1WD1 A;  3EFX D;  2FIN B;  5ELB A;  2BE5 C;  4X3T A;  5M5W B;  1B1Z A;  1CT1 D;  2EYJ A;  4C3H B;  2R3Z A;  1QNK A;  1PTO F;  2JP1 A;  3CU7 A;  5COY A;  2NWG A;  4DA2 A;  1XTC D;  1RTO A;  1TY0 A;  1PDQ A;  4TSS A;  3QJY A;  1G29 1;  5DEH A;  3K0Y A;  2KOL A;  3QWN A;  3J7A V;  1WTP A;  3IL8 A;  4Y7N B;  2B2T C;  5EKI A;  1SYC A;  1S5B D;  3NWT A;  4CKB A;  4L6T B;  4XYQ A;  2QCP X;  3SXH A;  1FR3 A;  4KHZ A;  5KYL A;  2XIW A;  4DK1 A;  3OMC A;  3AB9 A;  1BCP D;  1QJO A;  2VB3 X;  1HTL D;  5DM6 3;  3K6O A;  3TDQ A;  3K58 A;  2R61 A;  1PLF A;  1EY6 A;  3Q0A A;  3CRL C;  3CHB D;  3TSS A;  3MVV A;  4DN4 M;  2K33 A;  2EZV A;  3D4D A;  3VA5 A;  1C48 A;  2ZXP A;  2L55 A;  3LNN A;  3URY A;  1EY8 A;  3OPO A;  1TY2 A;  1F9S A;  3BYT B;  3RZO B;  1JOK A;  4I7Z C;  3FEW X;  1S5F D;  3PUW A;  3VYS A;  4IUQ A;  3NBI A;  1FYC A;  4RKB A;  5EQ0 A;  3E0J A;  3CKI B;  3N52 A;  4HTH A;  2LS0 1;  2K28 A;  2F0V A;  2D2C C;  1STB A;  3A8K E;  2B2U A;  1Y69 U;  2PZW A;  1BBX C;  1SNQ A;  3P7J A;  1SMY D;  1CK1 A;  4ME5 A;  1BDO A;  3Q6S A;  4LJZ C;  1TWG B;  4NW2 A;  5KRU A;  1BCP C;  1KDB A;  2CHB D;  1B9M A;  4WOR A;  5D14 A;  1C8C A;  1GUT A;  1HXY D;  1S4Z A;  3VR3 A;  1DCZ A;  2F0Q A;  2ICI A;  2XWB B;  1JOQ A;  1PTO D;  1HQM C;  1S5C D;  2BCO A;  1LLR D;  4L63 B;  3SK8 A;  1EEF D;  5CV8 A;  2C9O A;  1A15 A;  3FRP B;  3NXW A;  3P1H A;  1SFO B;  4CBV A;  5CV4 A;  2X6G A;  1DYQ A;  2A69 D;  3PUZ A;  3J7Y W;  2CW0 D;  4JK1 C;  3SEB A;  2E2I B;  2KEE A;  1HA5 A;  4DGZ A;  4P2C B;  3SK6 A;  1PXU A;  1WTX A;  4H0L C;  1PMR A;  3ERO A;  2WV6 D;  2F0H A;  1SMY C;  1TWF B;  1I6V C;  5CR3 A;  2HCC A;  3RUZ A;  5T1I A;  1ZXT A;  4X3K A;  4C3I B;  3BVG A;  1DM0 B;  1CZG A;  1EY4 A;  2EJG C;  2BDO A;  5IGB A;  2Q8R E;  5CBE E;  2RSO A;  1E2W A;  1F9Q A;  3PIO 3;  1BXT A;  2ID0 A;  5E1F A;  1MSH A;  4G7Z C;  1PTO C;  3D4R A;  1BF4 A;  3PUV A;  4OO1 G;  4KN7 C;  1TS5 A;  2PW7 A;  4XYO A;  3EA6 A;  4PMC A;  1STH A;  1ET9 A;  1Z47 A;  4OL7 A;  2O5J C;  4KY5 A;  5LL6 X;  1I50 B;  1I4R A;  3HGB A;  5EBD A;  3V96 A;  2CW0 C;  1WVL A;  3A55 A;  3KK7 A;  4AYB B;  5I6Y A;  1EU3 A;  4CJ2 C;  3RZD B;  4PMW A;  5JVG 3;  2JEB I;  1STA A;  1SJH D;  5NUC A;  2HQE A;  1SE3 A;  3ND8 A;  4G7O C;  1O7Z A;  2IX0 A;  1Z7T A;  1QE6 A;  1HQR D;  2R93 B;  2G9D A;  4WJW A;  5FO9 B;  2MP1 A;  2JXM B;  3K57 A;  1LTR D;  1PZJ D;  2A74 C;  3NK9 A;  2F0I A;  3D8G A;  1LAB A;  1EQV A;  3PMF A;  2K04 A;  1TS4 A;  4DAP A;  2KUM A;  4H13 C;  2B2Y A;  5JEA J;  1B3A A;  4CGY B;  2B2W C;  5K5P A;  1XWE A;  4TQU S;  1VF7 A;  2JA8 B;  1TT2 A;  2WAC A;  1DOM A;  5ELE A;  2XVS A;  4ZUJ A;  4G7H C;  3VYU A;  3MA2 B;  3NUC A;  1T5E A;  3D31 A;  3TP8 A;  2NTT A;  1X3Q A;  4J6H A;  3I3C A;  4LMQ D;  1B50 A;  1L0X B;  4RGN A;  1M4V A;  4DAY A;  4DXG A;  2MUY A;  2TSS A;  3H3V C;  2K01 A;  1GJX A;  1CQF A;  5JPN C;  2KED A;  3MEH A;  3S14 B;  1U4R A;  3E5S A;  2JA7 B;  4KN4 C;  1KNA A;  1PRT B;  2H1E A;  2J4X A;  1EEI D;  1EY7 A;  2F0K A;  3L3O C;  2NTS A;  1A2T A;  1EFI D;  2F0F A;  3CQZ B;  3BS1 A;  3C1F A;  4A3I B;  1Q90 A;  1EWH A;  2NVQ B;  1JWM D;  2TMP A;  3TP6 A;  1RKN A;  1QNU A;  1U9R A;  1Y8O B;  4FXG C;  2JA6 B;  3LWE A;  4XQJ A;  1WTR A;  3ONA B;  1H9K A;  3HOU B;  2KEC A;  2K6A A;  3R93 A;  1LT6 D;  4IAL A;  1HCZ A;  4XT3 B;  2EYL A;  1FD7 D;  1AFP A;  3WOF A;  2A68 D;  3TN2 A;  2Z4I A;  1CZW A;  3QOJ A;  2KVM A;  1A6X A;  1PZK D;  4ZLT F;  5C0X G;  3K7A B;  2EYP A;  2R6G A;  3VR2 A;  1O78 A;  5IT9 L;  5CGK A;  5C4J B;  3PO3 B;  4V19 0;  2NB0 A;  1RHP A;  4KHV A;  1MGS A;  1C4Q A;  5I9O A;  1QCB D;  3BYY B;  2B2T A;  3GTM B;  1OO9 B;  1WTO A;  1BO0 A;  5FO8 B;  1BCP F;  3M4Y A;  3RMH A;  3AMU A;  2WII B;  2HUG A;  1O7L A;  3W3A A;  2SNS A;  3HOY B;  4OO1 H;  5CC4 A;  3K5N A;  3HZX A;  2KCN A;  4IFD J;  2SDF A;  1F2M A;  2WIN B;  4QIW B;  2B63 B;  1JIC A;  5C44 B;  2KA7 A;  4HMI A;  4KKT A;  1SSO A;  1JE4 A;  2XSC A;  4K8J A;  4N9T A;  4QB4 A;  3T53 B;  2A68 C;  4XXE A;  5J22 A;  1KLU D;  4U67 3;  1VF5 C;  4QUF A;  4PV1 C;  2IW3 A;  1FNU A;  4DNT B;  3K5L A;  1IYV A;  3DXJ C;  4QCL A;  1GUO A;  4C1N K;  2I07 B;  4HCS A;  5IT9 E;  2PZT A;  1GUN A;  4K8I A;  1LTT D;  2K05 A;  1H9S A;  5J39 A;  1E2Z A;  1STY A;  1AN8 A;  2Z8L A;  4KI0 A;  2DY7 A;  3DWA A;  5IGC A;  1SEB D;  2NZ1 D;  4KJN A;  3TME A;  2F0M A;  4H7B A;  1EY9 A;  3HEJ A;  2IL8 A;  1SYD A;  3EQL C;  1V8Q A;  1RJT A;  4Q0F A;  5KND A;  2EPB A;  1EQT A;  4IUT A;  3ND9 A;  2F0E A;  5A35 A;  4IZ8 A;  1D5M C;  2E2H B;  3EVQ A;  5IOD A;  1Y8N B;  4HAE A;  4QUC A;  1G2T A;  1STE A;  1VCI A;  2L12 A;  3C1E A;  2RBM A;  1OXX K;  3I90 A;  1H9M A;  3VR6 A;  1GHJ A;  2FHT A;  2E75 C;  1MSG A;  2M00 A;  2F0L A;  2HCI A;  5JVH 3;  1JOO A;  3CRK C;  2CQA A;  3M3Y B;  2F1M A;  1SYE A;  1KDC A;  2NYZ D;  4NMZ A;  4F88 A;  1EWC A;  1JC7 A;  1GOZ A;  1D2B A;  3KBX A;  2ZXR A;  4QMG A;  4BWG B;  1SBB B;  5FKA C;  1HFG A;  4KMU C;  1PTO H;  2EXZ A;  3GTJ B;  1L0Y B;  4TRD A;  1LO5 D;  4BY7 B;  2PMZ B;  1LTB D;  2NVY B;  1J9O A;  2LMC B;  1CA5 A;  3ZYY X;  3I73 A;  1D5Z C;  3OSO A;  4CJ0 B;  3A54 A;  3MXP A;  4RGO S;  4RGM A;  4X3U A;  3OHX C;  4EQN A;  4ZK9 B;  3QOL A;  3VYR A;  4R8N A;  1EIG A;  1I4X A;  2JA5 B;  4G4K A;  4B08 A;  2L4N A;  5IGD A;  5C4H A;  1K8O A;  5E3F A;  1ML0 D;  5C0X H;  5A2Q E;  3GO5 A;  2IJ0 A;  1MD2 D;  3HG9 A;  1OXS C;  3I70 A;  1HPC A;  4EQP A;  3I4N B;  3R2I A;  3PIP 3;  4NKL A;  1QIL A;  3WOE A;  2NN6 H;  4FYD A;  4XDX A;  4IN3 A;  3MWY W;  4MIU A;  5LL6 S;  4S3S A;  2RVL A;  1SE4 A;  2EY5 A;  3SVM A;  1RD9 D;  5C5L A;  4KY7 A;  2F0U A;  2KCC A;  4G57 A;  1ONL A;  1B53 A;  4C3J B;  4KKU A;  4NP5 A;  3T13 A;  5D3D A;  2D9U A;  1NSN S;  1ILQ A;  5JJZ A;  4K5W A;  1Q12 A;  1IYU A;  3S1M B;  2EYH A;  1T5X D;  2AUK A;  2RKS A;  4FF3 A;  4F7X A;  1Q1E A;  1ENF A;  1O80 A;  2O2L D;  2J7Z A;  2EJF C;  1EYC A;  4LAA A;  4BA2 I;  1ESF A;  1TWC B;  1U4M A;  2PW5 A;  4KV6 A;  2AQ1 B;  2B2W A;  3I4L A;  2F03 A;  3S2D B;  4K6D A;  3Q23 A;  3MZ5 A;  5D65 A;  4MHE A;  1TVX A;  1Q1B A;  4E6I A;  4I65 A;  1LTA D;  5EBC A;  2O5I C;  1LTS D;  1G2S A;  4IFD I;  1B9N A;  2QF7 A;  1LT5 D;  1TWA B;  3BVM A;  4OIK A;  1II3 A;  2Z1C A;  3ERQ A;  3VR5 A;  3PO2 B;  3OIQ A;  3ITP A;  4ID6 A;  4K2L A;  5JPM C;  2Q8I B;  4UAI A;  2XN9 C;  1W6K A;  3H0G B;  3PUY A;  3G7L A;  3GV6 A;  1BQQ T;  4OIJ A;  1EY0 A;  2K32 A;  3MTS A;  5BN4 A;  1RCV D;  2GA4 B;  2A73 B;  2EY6 A;  1Z6H A;  1SAP A;  2KHS A;  3VYT A;  1ENA A;  3AU7 A;  2SEB D;  4FF1 A;  1Y1V B;  1PFN A;  5I2X A;  1TS2 A;  3K5M A;  1XX8 A;  3RLF A;  5FK9 C;  4DK0 A;  4A93 B;  4IUV A;  1R4Q B;  4KY6 A;  1WTW A;  1JQY D;  2MJ8 A;  2QDB A;  2XNA C;  3DEO A;  1TWH B;  2PYK A;  4KK7 A;  2EYO A;  2XWJ B;  2RQX A;  1SNC A;  3MAQ A;  2D62 A;  3DUZ A;  3GTG B;  2KQ3 A;  4RH6 A;  4K2K A;  1Y8P B;  3A7A B;  1I4H A;  2DN8 A;  5DNF A;  1MI2 A;  2K5Q A;  3KBG A;  1GXD C;  2HDL A;  1BOS A;  2NVX B;  2A6H D;  3QIA A;  4ODG A;  2HDM A;  1CFM A;  5CBA E;  1AZQ A;  1CQV A;  4TKO B;  4GZY C;  3TP5 A;  4DNR B;  1SJE D;  1X32 A;  1PRT C;  1ICW A;  3S1N B;  1LT3 D;  2F0G A;  3SHL A;  3M85 A;  2WAQ B;  5BN3 A;  2Z4H A;  2R92 B;  2F0S A;  1D6E C;  2B2V C;  1CTM A;  4B9W A;  3OW7 A;  5F2D A;  4O42 A;  2KJX A;  5KYI A;  4ILW A;  1IL8 A;  1PFM A;  1SDF A;  1MBY A;  1K8M A;  4A3F B;  4BY1 B;  4EGV A;  1Q8I A;  3DWQ A;  4K6L A;  3IKJ A;  4QF4 A;  4RWS C;  1TKW B;  2SOB A;  1SYB A;  4FVM A;  5T1G A;  3M7N A;  3SK4 A;  1G8Z D;  3BG3 A;  4UDU C;  1S5E D;  3I4M B;  2F0W A;  3HOW B;  3GTP B;  2WKC A;  3LWU A;  5IOC A;  3NP8 A;  5DAU A;  4HR7 B;  2A6H C;  1TU2 B;  2B8G A;  2IX1 A;  3KLS X;  4N9P A;  1I6H B;  5LHY 1;  1ET6 A;  4FXD A;  2N88 A;  3MFG A;  2IPK D;  2EVB A;  3HKZ B;  5M9O A;  4PNY A;  2EDG A;  3HP3 A;  1M8A A;  2B39 A;  4F87 A;  2DNC A;  4M1U B;  4C56 C;  3C3L A;  5JOB A;  5EPL A;  4RKL A;  3LX0 A;  2ZT9 C;  1XYI A;  1R9T B;  4EQO A;  3NHH A;  5KEE A;  2MGS A;  3JAM E;  3DEP A;  4DFA A;  5M5X B;  2B8F A;  4XT1 B;  5JEA H;  1ZYR D;  4A3M B;  3VA7 A;  1DXM A;  2NN6 G;  1CHP D;  3HS0 C;  3V2T A;  4ZKB B;  3NE5 B;  3NWS A;  2A6E C;  1SNP A;  4HSP A;  4A3E B;  1B44 D;  4IUR A;  3J81 E;  1DOL A;  2RA4 A;  2H4O A;  1IHZ A;  3NSW A;  1LV9 A;  1YNJ C;  5HUR A;  1EOT A;  1D1I A;  1X3P A;  2EE1 A;  2NVT B;  3RD4 A;  3K59 A;  1JB3 A;  4HED A;  1EL0 A;  1EZ8 A;  2QIL A;  4IUN A;  2PQE A;  3DWP A;  3QG1 A;  4CHT B;  3H09 A;  4KD4 A;  5I9P A;  4NDX A;  3OWE B;  4R9W A;  5C4Z A;  3MXG A;  2JE6 I;  1WD0 A;  2RDG A;  4A3B B;  1F2L A;  3DM1 A;  2AQ2 B;  5C6A A;  1NR4 A;  1TR5 A;  2NUC A;  4DF7 A;  2L0C A;  1B4O A;  1BR9 A;  1CI3 M;  1SNM A;  3NTK A;  2FJ2 A;  2FMM A;  2ZXO A;  2E74 C;  2V4D A;  3K5O A;  1BUV T;  4BA1 I;  1PFB A;  1ZYR C;  4C2M B;  3I91 A;  1LTI D;  2OF1 A;  4ZQ3 A;  1V1P A;  1GHK A;  4J1M A;  1WTQ A;  3C2P A;  1JCK B;  2LY7 A;  5C3W A;  3BDO A;  3GTO B;  3GTQ B;  1QG7 A;  3FMC A;  4R8I A;  2IX3 A;  3SR1 A;  2BDN A;  1VMP A;  4ULL A;  3S9W A;  2AWN A;  2EYM A;  5I4D A;  1H9J A;  1F9P A;  3S15 B;  4X3S A;  3KF8 A;  5C0X J;  4FF2 A;  4WRD A;  3PUX A;  3FVQ A;  5A2Q L;  5I2Y A;  3HOV B;  1V1O A;  4PQX A;  3GTL B;  2VXW A;  4IFD H;  3IFT A;  4DU9 A;  1CHQ D;  3GV3 A;  5FLX L;  5KNC A;  2XRS D;  3C46 A;  1FGB D;  5CV7 A;  2EY1 A;  2J0T D;  5FO7 B;  3OMG A;  2EYF A;  1SXT A;  3HOZ B;  4IUU A;  3OOC A;  1TQO A;  3A8I E;  1LAC A;  4ZRZ A;  1E2V A;  1GUG A;  1OXV A;  2M9V A;  1D1K A;  2ENB A;  4JBW A;  3V05 A;  2NBF A;  3U9O A;  2K5W A;  2YU9 B;  5G3L D;  2LFN A;  3EJI A;  5CV5 A;  1RTN A;  2G9H D;  1RF2 D;  4Z9C B;  4YIJ A;  3E6Z X;  2SNM A;  4C3H G;  1AEX A;  5JAV A;  3SK5 A;  1PRT F;  4XTC S;  2N55 A;  1J8I A;  3O13 A;  4M8A A;  3X3M A;  3H94 A;  4LK1 C;  5K36 H;  4V0B A;  1JWS D;  2PZU A;  2E2D C;  3OIP A;  5HGT A;  4OO1 I;  2K7V A;  3NTI A;  4KD3 A;  2C5C A;  4FXK C;  1EU4 A;  2QEJ C;  2CVR A;  3TP7 A;  1DON A;  4XIG S;  1VMC A;  3FKI B;  4DXF A;  5CV6 A;  2VB2 X;  5FLX E;  2MPM A;  1EYD A;  5M5Y B;  1I3Q B;  2F0T A;  4EVO A;  4ZKC B;  5ELD A;  3HOX B;  1BNZ A;  1ZKO A;  1SND A;  1QOH A;  2FFK B;  2AQ3 B;  1KLG D;  2PNR C;  1HRJ A;  1SYF A;  1AW7 A;  1UAP A;  3MC0 B;  1CM9 A;  2FMC A;  4ZYS A;  3X3N A;  4U68 A;  1EY5 A;  1WCM B;  1ESR A;  1HFN A;  3S16 B;  1DZ1 A;  2R7Z B;  1EYA A;  1TII D;  4A3J B;  2M2L A;  4DAV A;  2IT1 A;  3L7Z C;  3M7G A;  2AUJ D;  4RGT A;  3MHB A;  4IQZ A;  1U4L A;  1KAB A;  1IW7 D;  4ZAI A;  5BN5 A;  5KGU A;  1QWY A;  4FO2 A;  3TZU A;  1JOR A;  1H9S B;  3GD7 A;  1AP0 A;  3T4A C;  5JEA G;  2B2V A;  1V1P B;  5FOB B;  3S1Q B;  1Q3L A;  1HUM A;  2D5D A;  3H6M A;  1LTG D;  1S5D D;  1U4P A;  2F0O A;  5I6W A;  1A3T A;  3R2T A;  3S17 B;  2YYZ A;  3M4O B;  2PO4 A;  1BCP B;  1G91 A;  4RCN A;  1EIH A;  1CA6 A;  4FNF A;  5M3M B;  1I4G A;  1LT4 D;  1A3U A;  1NCV A;  2RDH A;  4A3D B;  4BBS B;  1PRT D;  1DJR D;  3Q24 A;  3NQT A;  3PV0 A;  3D4W A;  3MFY A;  4KTA A;  3S1R B;  1ENC A;  4CKE A;  4C3J G;  4XQQ A;  5EGT A;  2OXP A;  4BS9 A;  5AFW A;  5KNB A;  3P75 A;  5M3F B;  3DMU A;  1JR0 D;  2F3V A;  4A3K B;  2K1B A;  2F3W A;  4HN7 A;  1AZP A;  5IGF A;  1IW7 C;  4XQN A;  5TSS A;  1H9R A;  4MN3 A;  2B2U C;  5C5M A;  1YNN D;  1Y1W B;  2EOT A;  2JYO A;  3A8J E;  3IAY A;  5DM7 3;  1RDP D;  3KLS A;  2L5T A;  3U9S A;  4F8M A;  2A69 C;  1KTK A;  4HCE A;  4H44 C;  3VR4 A;  5IIF A;  3MXN A;  3N6R A;  1ILP A;  4C3I G;  4IUP A;  3NTH A;  5C0X I;  1B2T A;  5EJW A;  3OWF A;  4OHJ A;  1NR2 A;  1HHV A;  5C3X A;  4K14 A;  3A7L A;  1PTO B;  1PZI D;  4FP5 D;  1OXU A;  2NN6 I;  1IKL A;  2AWO A;  4RFB A;  2L1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...