1U9RA

Crystal structure of staphylococcal nuclease mutant v66e/p117g/h124l/s128a at room temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETVEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Stabilization of internal charges in a protein: water penetration or conformational change?
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2004-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u9rA00
4KTAA 5EKKA 2QDBA 4ME5A 4N9PA 4K14A 1F2ZA 5IGDA 1F2YA 2SNMA 2EYJA 5JAVA 2OEOA 5CV6A 5IODA 3EVQA 2RDFA 5DAUA 1RKNA 2F3WA 3D8GA 5IOCA 1SNCA 2SOBA 4IUNA 5C4HA 1SNQA 3NXWA 2EYFA 5IIFA 1STNA 1KABA 2F0GA 5IGFA 1EY0A 3BDLA 2NUCA 3DHQA 5I6WA 5IGBA 2EXZA 4PMBA 2EY2A 4DF7A 2F0DA 3TP6A 3EROA 1EY7A 2F0KA 4KJNA 3SK8A 3OMGA 4DU9A 4N9TA 4RKLA 1TR5A 5C5MA 1EY4A 1U9RA 1SYBA 1SYDA 2M00A 1STBA 5CGKA 1ENCA 5I9OA 4PMCA 5C3WA 2EYPA 4NDXA 4EVOA 4K8IA 3TP8A 4K5VA 4ODGA 1AEXA 5C4ZA 2RKSA 3SR1A 3RUZA 4DGZA 4E6IA 5DEHA 2F0LA 1A3VA 3OSOA 2PZTA 1EYCA 4K2LA 4IZ8A 3MZ5A 4S3SA 5CV4A 2PZWA 3P75A 4KV6A 4KHVA 1SNOA 5KEEA 2EYLA 4KY7A 5KYLA 2F0NA 1EYDA 3MVVA 3OMCA 4MIUA 4WORA 3U9OA 3QOLA 1TQOA 5C5LA 1EZ8A 4ZUIA 1SYFA 5J1ZA 1JOOA 4K2KA 4QMGA 5ISRA 5IGCA 5E1FA 2O4XA 4EQNA 5IGGA 1II3A 2F0JA 4K5WA 1KAAA 1JOKA 1SYGA 3HEJA 3SHLA 3SK5A 3S9WA 3SK4A 1JOQA 4J6HA 2F0HA 4TRDA 3T16A 2F0FA 2EY6A 2KQ3A 2EYMA 4NKLA 4J1MA 5HURA 1NUCA 3P1HA 1STAA 4NP5A 3SXHA 1EY6A 2SNSA 3QB3A 3QOJA 3D4WA 4EQPA 4B9WA 5KRUA 5CV8A 2F0SA 2EYOA 5F2DA 1SYCA 3MEHA 1EY5A 1IHZA 5CV5A 4ZUJA 1F2MA 3DMUA 2PW5A 2F0MA 1A3UA 1KDCA 3NHHA 4WRDA 4K6DA 3R3OA 5EKLA 3OWFA 4QB4A 3H6MA 1JORA 2EYHA 3VA5A 2F0IA 5M9OA 1KDAA 1TT2A 2F0PA 3ERQA 4G57A 5K5PA 1EY9A 4R8NA 2F0TA 3NK9A 2EY5A 5EGTA 2OXPA 5E3FA 2F0VA 1SNPA 1STHA 4IALA 4KD4A 1A2UA 2PZUA 2EY1A 5JOBA 2F0UA 3HZXA 4RKBA 2F0OA 3MXPA 4DFAA 4KY5A 4ID6A 5CC4A 3D6CA 3C1FA 3MHBA 4KY6A 5J22A 3ITPA 3C1EA 1A3TA 3E5SA 5CV9A 1NSNS 1SNDA 2ENBA 2RBMA 2LKVA 1EZ6A 4LAAA 4YIJA 3SK6A 3PMFA 5KGUA 2F0WA 4K8JA 3TMEA 1SNMA 2HQEA 3LX0A 5CV7A 5KIXA 4KD3A 4HMJA 2F3VA 4B9XA 5C6AA 2PYKA 5J39A 4F7XA 5C3XA 3NP8A 1STGA 1EQVA 4QF4A 2OF1A 4K5XA 3T13A 5I9PA 4HTHA 4I65A 1EYAA 5CR3A 5IGEA 5NUCA 2F0EA 4EQOA 1EY8A 1STYA 2WACA 3NUCA 4KJOA 5I6YA 4ZQ3A 3TP7A 1A2TA 2F0QA 4H7BA 3TP5A 3V2TA 2KHSA 3BDCA 4NMZA 1ENAA 2PQEA 1SYEA 3EJIA 4OL7A 3NQTA 4PNYA 5HGTA 3D4DA 5KYIA 4F8MA 2PW7A 4HMIA 1KDBA
chains in the Genus database with same CATH superfamily
2QDBA 2A74C 1Z9FA 5BR8L 5JPMC 1RDPD 1ILPA 5COYA 5DAUA 1RKNA 1V1OA 5IOCA 2VNUD 1H9SB 3RN2A 3VYSA 1LTRD 3MWYW 1PRTF 1UNSA 1RF2D 4LK1C 4OELB 1LT5D 4NPSA 4GLAC 1XYIA 3EA6A 1J8IA 2M2LA 2WB1E 1E1TA 3VYUA 3CC7A 5FLXc 3G48A 3OTOQ 5C4ZA 1P8LA 5BN3A 1I4RA 4RCNA 2R7ZH 3CPWA 1MSHA 2ZM6Q 4BS9A 2MO0A 1Q8KA 4CGYB 3M3YH 4WORA 1KAWA 1E2WA 1B4OA 3KJPA 4OXPA 1A6XA 1TS5A 3F2UA 2H4OA 2IY5B 3ULPA 2Z4IA 3G71A 1N33L 1JE5A 1RODA 3TZUA 1AE3A 1VQAA 4RG1A 4JV5Q 5GQOA 4NKLA 2K6AA 3T1YQ 5C0XJ 2I5HA 1ICWA 1VQGA 2NYZD 2D0PA 5C3EG 2R93H 3NTIA 1PYSB 4DR1L 1WTOA 1G2TA 1SMXA 1JICA 2NN6G 1AE2A 1MHWC 2DJGC 4A4IA 3MXGA 1X3QA 4L6TB 1WD1A 2VS1A 5E7NA 2A6HD 3LWUA 1XMOQ 3ONAB 4R8NA 2IWHA 4B3MQ 2XTIA 4CDFC 4IALA 2BA1A 3FP9A 1MI2A 2Y0SB 5IYDG 5IP9G 1G2SA 4A93B 4APVA 1SNDA 4P75A 4X66Q 3FDTA 3BDOA 2K5VA 3J80i 2F4IA 3PUYA 2HD3A 3VA7A 2PYKA 1YEZA 3K7UC 1D2BA 3T13A 4A3IH 1SR3A 3S1RH 2ZTDA 5NUCA 1V1QA 2AMCB 1ENFA 3Q24A 4DV4Q 1YNJC 4P72A 2RSNA 4ILWA 1O7LA 1SYEA 3D4DA 1DGSA 4GLVB 1SLJA 1J5EQ 2XVSA 4X3KA 3A5ZB 3D0FA 2CCZA 1Y1VH 3HOWG 1G6PA 1KLGD 3Q8DA 1FGBD 4R4IA 1N36Q 2NVXH 2VUMB 1BOSA 3A8IE 4X65L 1JC7A 1VQ5A 2KOLA 1YBYA 1SXTA 5L37A 2EXZA 4H02A 1X6OA 1WTVA 3SK8A 3E3XA 3CF5A 4N9TA 3U9SA 3CQZB 4GOPC 1B70B 2KJXA 5CGKA 1TWCB 1STEA 4JI4L 3KLRA 3S1MB 3GTQB 4TKOB 4O0AA 5BN5A 1EEID 3NENA 3MXNA 4DK1A 1BCPC 1A3VA 4K2LA 2PCFB 4OONA 1PH8A 3PO3H 4L8JA 1TQOA 3AFPA 1ZYRC 4DV1L 1G291 1O78A 3MC0B 1UE1A 3FKIH 5IGCA 4KKTA 1PFMA 1HPCA 2GVBA 4A3EB 1JOKA 3D3RA 4IFDG 3MTSA 1X55A 4A3LH 2JJQA 1IKMA 3T16A 2F4VQ 1N9WA 2K33A 4N8FA 1GHKA 2CFMA 2JA8H 1PYBA 4NP5A 1KLUD 4HIKA 2ICEC 2AKWB 2CW0C 4PQXA 1A62A 3M4QA 2L5TA 4OWXB 5CBEE 5FO8B 1VQKA 5M5YB 5K36H 1CA6A 2BA0A 2JA6H 4WRDA 4DV2L 1EU3A 3MFGA 3VR3A 3JC66 3GTMH 2VZAA 5JEAJ 4XXEA 3OTOL 1JB7A 1F9RA 3DM3A 2QA4A 4IUQA 3S15B 3CCMA 1H9SA 3OW2A 1HFNA 1VQ4A 4BY7H 1AZPA 2B2VC 2RDGA 1QNKA 4RGNA 1YJ9A 4YIJA 2RBMA 1FYCA 2KCTA 1LACA 3H94A 1DONA 2RQXA 1PH1A 4H0LC 2DY8A 3T53B 1QJOA 1EQTA 2UUCQ 1IYVA 1V1PB 2MP1A 4HTHA 4A3FG 1N32Q 1DOMA 1I94Q 2UXCL 5I6YA 3T1HQ 2KHSA 3BDCA 4AYBG 4C3JG 1ET9A 4LUZA 1CM9A 4CHTB 3BZDB 3K5MA 2WB1B 1JWMD 4YY3L 3EBEA 3S17B 5ELNA 2KUMA 3IKJA 4O42A 4AH6A 5ELDA 1SRUA 1WTWA 2A8VA 2EYFA 2KEDA 3ND8A 1XMOL 1PTOB 5IGBA 1WCMG 4B3ML 4BXXG 4DF7A 2F0DA 1LTGD 4AQYL 4DKAC 2A1AA 2XSCA 5IE8A 4FXDA 2V1CC 3J7ZC 1TWFH 1D8LA 1D5MC 4HR7B 4DV0Q 2PPBC 1GOZA 2Q2HA 1QB5D 5M3MB 5FO9B 1KNEA 3I4NH 2EYPA 4K5VA 4NXMQ 1B53A 4E6IA 4C2MB 1SAPA 3RD4A 2R3ZA 3P75A 4DR2L 2GN5A 1S72A 1G91A 1EYDA 3U9OA 5IYCG 3QR8A 1EWIA 1Y8PB 4HIDA 4B08A 3GTLB 2AUKA 3R2IA 1II3A 2KA7A 5LMNQ 2UXDQ 3SK5A 2B2UA 2JE6I 5KNBA 4KKUA 3H0GG 2NZOA 2K28A 4A3CH 1HHVA 2BCOA 4RAUC 1CSQA 1I3QH 4DAYB 1EY6A 3I91A 3HOXG 2JP1A 4EQPA 3GTKB 3CP0A 1H95A 4OEMB 1GUSA 2PW5A 1I6HB 4YHHL 4MTNA 3KFUA 1JORA 2KECA 1VQ8A 5JVG3 2WAQG 4G57A 4TSSA 3PIP3 2OTLA 2JA7B 5E3FA 4DV3Q 2JK8A 3J7A5 5C3EB 4JYAL 1L1OC 5D14A 5J22A 1A3TA 3SK6A 1Y8NB 4A3DG 5KGUA 3TS0A 4DR7L 3NQIA 2EJFC 1WFQA 4QJFA 1G6ZA 1U0LA 1IYUA 4F7XA 1VS0A 3LWEA 5IGEA 1VQPA 2YTXA 2SEBD 4KJOA 2H5XA 4ZQ3A 3TQYA 1XPOA 4LF7L 4LF6Q 1TY2A 4WJWA 5IT9L 4B3SQ 4FVMA 4C3IB 3G6EA 3A8KE 3GD7A 5EPKA 1B9MA 2B63G 1S40A 4FXKC 5D3DA 4DV5Q 4A3GG 1RJTA 2F0KA 2NVQB 1TR5A 2XWBB 4DK3C 1U9RA 1MBYA 3K0XA 3SEBA 2E2HB 5A35A 1VQFA 3RZDH 2K7VA 2A5HA 3AB9A 3L9AX 2YU9B 1PZID 2R92H 2HCIA 1LABA 2PI2E 5CORA 1HNZQ 3S2DB 4U673 2QILA 2QW7A 4L5QA 2IHEA 2K50A 3T1HL 5EKIA 5J1ZA 2MO1A 4QMGA 3MA2B 1KNAA 5E1FA 1FNUA 1E2ZA 4EX5A 2I5LX 1KRTA 4A93H 1LTLA 3FVQA 4LFAQ 1G8ZD 3VR6A 4RGOS 2EYMA 2O2LD 2AQ3B 2XRQD 2CH4A 3UE1A 2JA5H 2N55A 1LT3D 4LF4L 5DM63 2A68C 2XNAC 5FO7B 4J15A 3J7AV 4HSPA 4LF8Q 4P74A 4JCVE 4DV0L 4POGA 4FF2A 3HOVG 4ZKBB 1SJHD 4GN3B 3CHBD 5M5XB 3PUXA 4NXML 3OHXC 3Q6SA 1EIGA 4DAMA 2Z6KC 1KXLA 4RWSC 2IHFA 1Q46A 3D6CA 2VUMH 4XYOA 5FK9C 4JI3Q 2FFKB 1E24A 4OIKA 1I6VC 3HG9A 2LKVA 2CQAA 1EQRA 3OWEB 1YITA 1GUTA 2F0WA 2PQAB 5CV7A 3TMEA 4KD3A 1VQ9A 2R92G 1HZ9A 5LMNL 3CQZH 1YVCA 1SE4A 3GQBA 2OF1A 3H09A 3M4OB 1TWCH 3M9BA 3S1MH 3NUCA 1J6QA 1C48A 2IW3A 1OXXK 3V2TA 1ENAA 4GN5A 4MNOA 1DOLA 3HKZG 4DR5L 1C7YA 1SN8A 1F2ZA 2IX3A 3I56A 2B2TC 3EVQA 3NWTA 4ULLA 3SVMA 3KUPA 1MIUA 1STNA 2BDNA 1CZWA 3TZDA 1VF5C 4A3EH 1MGSA 3K8AA 3L7ZC 4PMBA 1GJXA 2HIXA 3PV0A 2UU9Q 1NAPA 4DAYA 1PRTC 4YCUA 3OIPA 2JEBI 3DUZA 3ULJA 1EYGA 2L4NA 4A75A 1EIYB 2JQOA 5C3WA 2KENA 5M5YH 4YCWA 2UUAL 1PLFA 5C44B 2PZTA 4X64Q 3PO2H 1UWVA 3TN2A 5HGQA 5KEEA 5C4XB 1GM5A 1HH2P 1JWSD 4A3BG 4R8IA 2LSSA 4LF6L 3KBGA 4K2KA 2NVYH 3D4RA 3S15H 5ELFA 2BE5C 4UDUC 4FYDA 2PO4A 3I70A 3CW2C 3L3OC 5C0XH 1O7YA 2WKDA 1K3BC 2D2CC 4O2DA 4QL5A 3MEFA 1NUCA 1STAA 4BBSB 1F2LA 2I07B 2VY3A 4DV5L 2E2JB 3T56B 1IHZA 1BBXC 3ERSX 2D5DA 1HTPA 2K4KA 1S5BD 4XIGS 2D0OA 3H0GB 4A3JG 1TWHB 1EOVA 1M4VA 5M9OA 1S5ED 1EY9A 4P2CB 1TXYA 4GOPB 3J80L 2F0VA 1M90C 3S17H 1PA6A 4JI2L 1Q90A 3H3VC 4HIOA 1WTRA 1BCPB 1JCKB 1X32A 1Y69U 1PTOH 4CKCA 1FJGL 3LX0A 2E76C 3J7AF 2WAQB 3LGJA 2BH8A 3NP8A 3PIOA 3D6WA 3PO2G 5M3MH 3K81C 3HOUG 1STYA 2AQ2B 5EPJA 4A76A 1I4PA 1LYLA 2F0QA 5JJZA 1HNWL 1NCVA 4GKKQ 2PQEA 2FJ2A 1EWCA 3PGZA 3J81i 3U4ZA 4A3DB 4KTAA 1LV9A 5KNDA 2SNMA 1Y1WH 3I4MG 4QCLA 5JPNC 3H91A 3J81j 1ML0D 1NTGA 5HY6A 2K5WA 1LLRD 3VYTA 3GTLH 3DWQA 4X62L 1F77A 2EDGA 1KABA 1XNQL 4PV1C 1GKHA 2NUCA 3DHQA 1SEBD 4OHJA 3HOYB 4Y7NB 3J80c 1EY7A 1K3RA 1W6KA 1EUJA 4LF9L 4RKLA 4PG3A 2O5IC 3GDEA 4CKEA 4JI3L 4J8QA 4C3HG 3BYYB 1ENCA 1F9SA 5I9OA 1QNUA 2N3SA 4K8IA 2AQ1B 3GTKH 4NXNQ 2ATWA 3N52A 4DGZA 3N6RA 2OT2A 1WTPA 1I6HH 1HNXQ 1K28A 2LXJA 4KY7A 1RCVD 2EIFA 1VMPA 2BE5D 2A6EC 5M3FG 2JA7H 1NR2A 3I2ZA 1DYQA 2MNAA 3EIVA 2ICIA 1KAAA 2OQ0A 4WJ4A 3WDNA 4RA8A 2PQAA 4BBRG 4KHPQ 4DR3L 4J1MA 3J80E 1PH7A 1S3OA 1K8MA 2PNRC 4JI8Q 1B3QA 4OO1G 2EOTA 1GUWA 3MAQA 1KRSA 3CPFA 2Q8IB 2EYOA 3DWAA 2UU9L 4UP7A 2HHHL 4A3KG 1AN8A 1LTAD 3OWFA 4NW2A 4UP8A 4CJ0B 1Y1WG 5JEAH 3TBIB 1PFSA 2F3IA 4PMWA 4QUFA 2HCCA 4HSVA 1F9QA 1B3AA 4IPGA 5D65A 1A8VA 2VXWA 5IP7G 3GTPB 4MZ9A 1L0WA 2EY1A 4C3IH 3PUWA 3LNNA 2NBFA 5A2QE 2SDFA 1PFNA 1NY4A 1HZCA 1E1OA 2VB3X 2HQEA 2TSSA 1AZQA 4XQNA 2NVQH 4FXGC 2DGYA 4IPHA 4KLKA 4FO2A 1EQVA 2N8NA 1K9MC 2E2HH 1QVGA 3KLWA 1Q7YC 3GTJB 2YU9H 1FD7D 4G4KA 3NQTA 5KYIA 4F8MA 2EJGC 1KDBA 4KK7A 2B3GA 1U4MA 4DUYL 3S2DH 3EFXD 3R93A 2OEOA 2PNHA 3WOFA 1ASZA 3A0JA 5IWAQ 4HEDA 4RHRA 2Q8TA 4C1NK 1DM0B 1C8CA 1CFMA 3RZOB 1I4XA 3A7LA 2R7ZG 1LTTD 5C5MA 1R9TB 1BNZA 2E75C 1XJVA 3KDFB 1L1OB 4R4TA 4A3MB 3S16B 1PFBA 1KHIA 3T51B 1B44D 3K7AB 5LMUQ 3E9IA 3ZYYX 2KHJA 4GOPA 1PHJA 4IUUA 5M5XH 2HQLA 1WTHA 1Z7TA 1SYFA 3S2HH 3A55A 2R93G 5ISRA 1QG7A 2NB0A 3JAMi 1MSGA 1LTID 3ULLA 1DCZA 1C0AA 2F0JA 2M9VA 4LF5Q 2F0FA 4ZCKA 4QIWE 2E8GA 2K01A 5EBDA 2L15A 4JBMA 3GV6A 3SGIA 1CI3M 2HDLA 3IFTA 4IPDA 1P16A 4DR4L 3S14B 3M4OH 2EVBA 4L5SA 2F0MA 4DR6Q 5AJ3L 5CYUA 5I2YA 4UAIA 3AQQA 4QB4A 3W1GA 1IBLQ 2RCFA 1Q86C 4F87A 1TY0A 4LMQD 2A69C 2VQFL 2EY5A 2FMMA 1K83B 3NBIA 3S1QH 1STHA 4ZAIA 3QWNA 2PI2A 1CHQD 5BN4A 4A3IG 1FGUA 3C1FA 1CQVA 1JMCA 5JJLA 4JI7Q 4YWKA 3QJYA 2PMZB 2Z6BA 2Q8RE 1VCIA 4MTKA 2JYOA 1PXUA 4QF4A 1LTBD 5CR3A 2B2VA 2WACA 1Y1VG 1OXUA 3Q23A 4HJ8A 3UDFA 4IO9A 4B3RQ 5C44H 3OOCA 2ZM6L 4KN4C 4JBWA 4QY7A 5C4XH 1ILQA 1EEFD 3TSSA 1X9NA 1HZAA 2RDFA 3BG3A 3KOJA 1HZBA 2E5LQ 4DV6Q 1SNQA 5GROA 3L2PA 4JI6Q 5G3LD 3CC2A 2F0GA 3FPPA 1RIPA 2ZT9C 4XT1B 3RMHA 1BVSA 2EJMA 1NJIC 1YNJD 1IBMQ 2BOSA 2NVTB 4DU9A 1X3FA 4JV5L 1ASYA 3T1YL 1WTQA 3PO3G 4BY1B 5IY0A 2M00A 4M8AA 1YIJA 3A8JE 4BBSH 3TP8A 3I4LA 1SROA 3OPOA 1AEXA 1N34Q 2E2JH 3FKIG 3SR1A 1RD9D 3UDXA 2E2IB 1UEBA 3MZ5A 4X3UA 1O7ZA 1YZ6A 4A3LG 3E0JA 3MXUA 3R8BA 3OMCA 4UY8C 4JC0A 4HJ5A 1XMQQ 4IJLA 2JA8G 4HJAA 2YTYA 3HOZB 1DOKA 4B3TQ 5K36G 1IW7C 1NNXA 2JA6G 5I2XA 4J6HA 2IT1A 5IWAL 1BCPD 4X66L 2BDOA 1EFID 5HURA 1YNNC 2UXBQ 2SNSA 1PV4A 3UE0A 3K80C 2LY7A 3HP3A 5M3FB 2ALYB 4JG2A 1KC8C 1ZYRD 1GHJA 1HXYD 3IAYA 1A3UA 4BY7G 4AYBE 4IFDJ 1KDCA 4EQ5A 3CCUA 3GV3A 2A69D 4DV4L 1BKBA 1D7QA 2LXKA 1RTNA 3ERQA 1FNWA 1PRTB 2AHOB 3KLSA 4Z9CB 1J5EL 5LL6X 3V05A 4ABNA 4PZ8A 1H9RA 2RA4A 3MXPA 4YWMA 2CW0D 4ID6A 1N36L 4L5TA 5FLMH 1QE6A 4CJ1B 3E0EA 2LS01 1NSNS 4YCVA 3HOYH 4Y7NH 1BBWA 4K8JA 1SNMA 1M1KC 2R61A 2DNEA 5C6AA 2KCCA 2N78A 2Z0SA 3KDFA 3DEOA 2FXQA 3HS0C 1L1OA 1WJJA 2G5DA 3FMCA 2RDHA 1PH5A 2ZXOA 4OWTB 1BQQT 4HMIA 1SFOB 2HUGA 3UDGA 4BA2I 2QGQA 4LFBQ 4CDDC 4M1UB 4CDEC 3U50C 2B2WC 1EIHA 4KHZA 5IIFA 2NWGA 1HJPA 3I4NG 1YHBA 1B50A 2B8FA 3I3CA 5LHY1 3H15A 4XTCS 1IKLA 3A54A 3TP6A 5C0XI 1LM0A 2F4VL 1EY4A 4R4QA 5ELCA 4CKBA 4JI7L 1BF4A 4NDXA 1XWEA 1KIXA 2CHBD 3KF8B 1VQ7A 4QIWB 2PZWA 2WIIB 4X3SA 1SE2A 2EYLA 2WAQE 3BYTB 4ZK9B 2EPBA 4CJ2C 2AWNA 4JI0Q 4JI1Q 1EQQA 4A3CG 1LTSD 3K5OA 4HCEA 1UAPA 5J3BA 1ESFA 1K0RA 3GTPH 1HRJA 2OTJA 2ZTEA 4Q0FA 3K58A 5I4DA 4EQNA 2R7DA 1SYGA 4UHVA 1YNND 2IPKD 3I4OA 3U4VA 3CCQA 2G9HD 2E5LL 1QCBD 3BS1A 2Q2TA 3P1HA 3HOWB 1NBWA 3QB3A 3K6OA 2MFIA 3CCRA 1HR0Q 2F0SA 4P73A 5F2DA 4FDBA 1IBML 2UUCL 2VW9A 2I0QA 4LWCA 3PIO3 1N32L 4K6LA 5LMNW 3GTJH 1I94L 4JBKA 4OO1I 2B2YC 2WV6D 2A19A 2EYHA 1WYDA 3FEWX 2K5DA 2JEAI 2J7ZA 4RGTA 5EAYA 2ID0A 2XRSD 1N34L 2RF4A 5IT9c 4KD4A 3ICEA 2DN8A 2F0UA 1JE4A 2OQKA 1TKWB 1XMQL 1TWGB 1EZ6A 3CRKC 3RZOH 2VQEQ 4AIMA 3J81L 3VR5A 1R9TH 2Z6KA 1TU2B 5FJ8H 1EY8A 4A3MH 3S16H 1KTKA 4NMZA 1JJCB 4PNYA 1NMGA 1L0XB 2K32A 3BU2A 3K7AH 3AEVA 4K14A 1A0IA 1D6EC 5IT9E 1SBBB 3G7LA 4L63B 1DZ1A 1CSPA 3I8ZA 4IOAA 4GS3A 1S5FD 3BZCA 2ZJPA 1XNRQ 2UXDL 4ZKCB 3GTQH 1H9JA 4DV7Q 2B2TA 1PH2A 1U5KA 3NEMA 3I55A 4PMCA 2FMCA 2B8GA 1L2FA 2RHQB 3X3NA 4L5RC 3S14H 3RNUA 2Y0SG 2F0LA 3P20A 1EYCA 1TS2A 3J81c 4A93G 4PZ6A 3K5LA 1S5CD 3E6ZX 2QKIC 2F0NA 3PUZA 5KYLA 4A3FB 5BR8Q 1XXGA 1EZ8A 5ELOA 2R7FA 1K83H 4DV3L 2JA5G 1KL9A 3BVMA 3STBC 4AYBB 5GAGC 2O4XA 4C3JB 1X54A 3RLFA 4K5WA 3S9WA 3SHLA 4GNXC 3SK4A 4NB3A 1JOQA 3RR5A 4TRDA 2FHTA 3F2CA 5JVH3 2J0TD 3IL8A 3A7AB 2G9DA 1FNVA 3QOJA 1E0BA 1SYCA 1WCMB 2JN4A 4GKJQ 2YTVA 3HGBA 1MJCA 3DMUA 1D5XC 4DPGA 4K6DA 2OWOA 4XQJA 1KQSA 3VA5A 4LUVA 2VUMG 3PF4A 1BR9A 3HKZE 1VQJA 3QO2A 3M7NA 3W5OA 3J81E 5K5PA 4B3SL 4DK0A 2PZUA 4ZYSA 1OXTA 1N33Q 3CU7A 2F0OA 2X69A 3W2DA 4DFAA 3HRZC 1PH9A 2A68D 4JI1L 3CMAA 4JI0L 1I4HA 3IRBA 4CDCC 3GTGB 1X65A 1YJNA 1X3EA 2ENBA 4JOIC 2WKCA 2Z4HA 2NTTA 1QZGA 2Q2UA 2E74C 2JSOA 4FP5D 2NVTH 2QEJC 2F3VA 4HMJA 1V8QA 4DR1Q 2LMCB 5C3XA 4BY1H 1DD2A 3TS2A 1WTXA 4LNQA 3KF8A 1RTOA 4I7AA 5EJWA 5M5WB 4A3EG 2E2IH 5HGTA 1HR0L 3CCEA 3HOXB 5DM73 1HNZL 2O5JC 1GUGA 2EYJA 3S24A 1JJ2A 1IXRA 4CBVA 3D8GA 1XTCD 5IYBH 3OIQA 3HOZH 4I7ZC 1PH4A 3RLOA 4LFAL 5E4WC 2A73B 2D9UA 3OYYA 1STBA 4MHEA 4HIMA 4C2MH 1TWFB 4EVOA 4ODGA 2VQEL 4IOCA 1HUNA 5E4XA 3JAML 1TIID 2IL8A 1CHPD 2MQHA 2K05A 4LF8L 4ALPA 2PMZE 5CMDA 5C0XG 2TMPA 3MVVA 4MIUA 2D62A 3GP7A 5C5LA 4N8X1 1YI2A 1PRTD 3F8TA 1D1IA 2B29A 1JWUD 4C56C 1ONLA 1E3PA 4X65Q 3C2PA 1IYJB 3A74A 3HEJA 2Q2IA 4H44C 3NBHB 2F0HA 1PDQA 3CCLA 2EY6A 4G7OC 4F88A 1JR0D 4JI4Q 1PTOF 2X6GA 3BZKA 5FLXL 2B63B 5CBAE 2WB1G 1HTLD 4RHSA 1QOHA 1QWYA 1Y14B 1MJEA 4A3GB 3NHHA 4DV7L 1W2BA 4KN7C 2LFNA 5C3EH 1WI5A 1SFOH 1CKMA 4DV1Q 5JJKA 4IPCA 5EQ0A 2JA9A 4DNRB 2NN6H 1Z6HA 1K8AC 4KY5A 1ESRA 1JJGA 5M3MG 4JW0A 1QUQB 2JXMB 4RCOA 5LL6S 4LAAA 1IBKQ 2WINB 2ZXPA 2ZJRA 3L0OA 2EE1A 1VQHA 3MFYA 1UEAB 2WP8J 1PMRA 1K0SA 4R1JA 5J39A 3M85A 5IYDH 5IP9H 1STGA 4K5XA 5C4JB 2RVLA 1PYWD 3F2BA 4DV2Q 3AFQA 4ZRZA 2HDMA 3T4AC 3TP7A 3GTOB 2VL6A 1QZHA 1VQIA 1CKNB 3H3VH 3PUVA 2RKSA 4X64L 1HA6A 1VQ6A 4YWLA 4GKJL 4K0KQ 1EL0A 4O1NA 1SE8A 1B7YB 1Q81C 3W1BA 1FL0A 4RMFA 1R4PB 3JAME 1H9KA 2L55A 4IUNA 2AUJD 3NXWA 3SDZA 5C4HA 1SDFA 3HOVB 5IGFA 1EY0A 3I90A 1BDOA 3VR2A 4KJNA 3OMGA 1QVCA 1CUKA 2GA4B 1SYBA 1U4LA 1JQYD 1UE6A 3GO5A 3HOWH 3UI2A 3OW7A 3B6YA 1VQLA 2UXCQ 2JA7G 2DUDA 4R4OA 2HT1A 3RZDB 3DM1A 3E9HA 4S3SA 5ELBA 2R92B 5CV4A 5GAEC 4YY3Q 3URYA 3CKIB 5FLXE 3QOLA 4JI5Q 4Y52H 4LFCQ 1G51A 5IGGA 4JBJA 3M7GA 2V4DA 3HKZB 4PZ7A 4AQYQ 1CK1A 3QG1A 2FINB 1TWGH 1K8GA 2BH2A 1PVOA 5JEAG 3UDIA 3SXHA 3BVZA 3X3MA 5CV8A 3NWSA 2OCEA 2A6ED 3MEHA 4IURA 1M8AA 4IFDH 2JA5B 4C3IG 5CV5A 1R4QB 4HJ9A 4DR2Q 1NMFA 2K5QA 4GKKL 3PF5A 1SNPA 1TVXA 3AYHB 2EQSA 3ZJYC 4JPBW 4X3TA 3CD6A 4QGUA 3CCVA 5FKAC 2K14A 4G7ZC 1A15A 3PQIA 4A3BB 1O7IA 5CV9A 1EU4A 1GUOA 1NR4A 2XIWA 3IFDA 1K73C 3TEHB 2QF7A 4B9XA 1YHQA 2Z1CA 1EWHA 3W3AA 1FVIA 1I4GA 4YHHQ 1OXVA 3BJUA 5T1GA 1IL2A 1EIFA 4NXNL 4XQQA 2PW7A 1HNXL 4H13C 1UE5A 4IQZA 5EKKA 1LUZA 4A3FH 4JYAQ 1HA5A 2I46A 3I73A 5T1IA 2NZ1D 2IJ0A 1SNCA 2SOBA 3S1NB 4A3JB 3NBHA 1VQMA 4C3JH 1VQNA 4X6AH 4DR7Q 3O13A 1SE3A 3VR4A 4KHPL 1B1ZA 4DXFA 4JI8L 2MPMA 1X56A 1IBKL 4OWWB 4V190 3KF6B 1WCMH 2B39A 4ZLTF 1I4QA 4LF7Q 4BXXH 1A63A 4POFA 1OTCA 2C35B 2RHSB 4Q5VA 3CMEA 3EQLC 5EBCA 4FNFA 1FR3A 3M4YA 3PO2B 3HOUB 1PH3A 3G6JB 5AFWA 1YHAA 5H1SE 2IX1A 2KCMA 2RSOA 1TWAB 4XT3B 1QUQA 4K0KL 2NVYB 3GTGH 1S5DD 1UE7A 3I4MB 5IYCH 2KVMA 1KD1C 1OXSC 3CRLC 1VF7A 5KNCA 3VYRA 4IN3A 2ASBA 4OGQC 1EY5A 3H0GH 1CKNA 1TWHH 2QCPX 1VQEA 1B9NA 2XWJB 2YYZA 5M5WH 1KDAA 1TT2A 4C3HB 1SJED 2MHVA 2HIVA 2F0TA 2XGTA 3HOXH 2OXPA 3PCOB 1VQCA 3ND9A 1XPUA 1I50B 2J4XA 1ZXTA 3MHBA 4KY6A 1Z47A 3WWVA 3NPPA 4JI5L 3K57A 3CCSA 1PH6A 1ICFB 1HCZA 4OX9Q 3P7JA 1Q1BA 1ZEQX 2IX0A 5G3LF 3PMFA 4LFCL 5KIXA 1LT4D 5C44G 1AH9A 4RH6A 2XN9C 4LF4Q 5C4XG 5I9PA 1WVLA 1T5EA 1N8RC 1EYAA 2QEXA 2F0EA 4BBRB 3DLLA 3TREA 4TVAB 4GNXB 4A3DH 3TRZA 3NSWA 5DLQE 5LMUL 4DAPA 4ME5A 4N9PA 1RL2A 4A3KB 1Y1WB 4BBSG 2GVAA 3K59A 4RGMA 2F52A 3KBXA 1Y8OB 2AWOA 2EY2A 4HJ7A 2E2DC 3EROA 4LF5L 3I7FA 1HQMC 1GXDC 1MD2D 3D31A 3R2TA 3HKSA 2F1MA 4TQUS 1Q3LA 1BCPF 1H9MA 2X6LA 2B2WA 4XDXA 1XPRA 2B63H 1BUVT 3NTHA 2Z8LA 4A3GH 3KYHC 2B2UC 3OSOA 4DR6L 4DR5Q 2CWPA 1IBLL 2K03A 2NTSA 5TSSA 5EPLA 1XTDA 2KCNA 2MGSA 1IZ6A 3ER0A 4IUTA 1JOOA 5FOBB 1ET6A 3TDQA 4ME3A 2CWAA 1VQBA 4KMUC 1D1KA 1BBUA 4DNIA 1S4ZA 2L0CA 3NELA 2L1BA 4BA1I 3KJOA 1GO3E 3NTKA 2ZTCA 3KLSX 1VMCA 2P5ZX 4B9WA 1SMYC 5C4JH 2UUAQ 4ZUJA 3A56A 3FPUB 2R7ZB 1LO5D 4FF3A 3GTOH 1U4RA 5EKLA 4G7HC 1X3GA 4WFN3 5FLMG 3M3YB 1E2VA 1IW7D 4B3RL 3EN2A 3HOYG 1O80A 1NE3A 3NK9A 2K75A 1CA5A 1LT6D 4DNTB 2ZXRA 1A2UA 4DAVA 3V96A 1CT1D 3AU7A 4BWGB 3AMUA 1OO9B 2B2YA 4DV6L 4JI6L 4DUZQ 2F03A 3ITPA 3HOVH 1V43A 1WOCA 5GADC 2R93B 1T9HA 3C3LA 3KF6A 1Q1EA 1CKOA 1A2TA 4H7BA 4DXGA 3EJIA 1T5XD 2R6GA 1JT8A 2K5HA 5IGDA 1HUMA 2L9HA 5JAVA 2RCNA 4JI2Q 2F3WA 1B2TA 1BXTA 3VDYA 1VQOA 4B3TL 3C46A 3BDLA 3DEPA 1J9OA 3DXJC 1QVFA 1FJGQ 3Q0AA 2I5MX 1WD0A 2UUBQ 1B8AA 4XYQA 4A3IB 3S1RB 1YJWA 2UXBL 5ELEA 4OX9L 1HNWQ 4R4CA 4U68A 4QQBX 2H1EA 3RUZA 1V1PA 5DEHA 1SSOA 4IZ8A 1SNOA 1CZGA 1AW7A 1MKHA 4ZUIA 4LUOA 1Y1VB 4X62Q 4MN3A 4HCSA 2NVXB 2KEEA 1XNQQ 4LJZC 1GVPA 2NN6I 1V9PA 3S2HB 4LF9Q 4A3BH 3M4PA 3G4SA 2KQ3A 1GD7A 3CXCA 1SMYD 1ZKOA 4JVZA 4C1NI 1TS3A 3NE5B 1PZJD 4HAEA 1QILA 2N88A 4GNXA 1PTOC 2C9OA 3H6MA 4DN4M 3H3VI 3PO3B 3RN5A 2N49A 3A5UA 3K0YA 1YNXA 1VQDA 1Q12A 3FKIB 5JOBA 1HR0W 4LFBL 2ZJQA 2YV5A 1D5ZC 2QDLA 4RKBA 3S1QB 2CH4W 1E7ZA 5FJ8G 3S1NH 4RFBA 4A3JH 4V0BA 2K04A 2L11A 4DR3Q 4A3MG 1XX8A 2JA8B 1E22A 3U58A 4IUVA 4R9WA 1BO0A 5JJIA 3PSIA 2HHHQ 4GLXA 2JA6B 4EQOA 4GN4B 2DJFC 3TP5A 2Y0SE 4JOIA 2CVRA 4OL7A 3GTMB 3WOEA 2CQOA 3PIPA 1IL8A 1F2YA 4LW1A 1EOTA 2C5CA 5CV6A 5D3IB 1W6JA 5IODA 3HOUH 4BY7B 1DXMA 1AFPA 2Z9HA 2EZVA 1TWAH 5I6WA 1CTMA 1X3PA 3CAMA 3SE0A 2KHIA 2L12A 1RHPA 3I4MH 1VDZA 3F2DA 5DNFA 4DUZL 1SYDA 3CCJA 1DJRD 4UP9A 1Q8IA 2MUYA 4IFDI 2MJ8A 1HFGA 3Q22A 4WJ3M 3RLNA 3CC4A 1EFWA 4KV6A 1UUPA 1I5FA 4KHVA 4HN7A 4DUYQ 4EGVA 4C3HH 1F9PA 1TS4A 1Q82C 4FF1A 3J7YW 1PZKD 1HQRD 2DY7A 3FRPB 1I50H 2KBNA 3F1ZA 4DA2A 4QUCA 2EXDA 4JK1C 5M3FH 2K52A 4FF4A 2K5NA 3I4NB 3D4WA 1PTOD 5KRUA 1C9OA 1L0YB 2VB2X 4IJHA 2NZHA 4OIJA 1F2MA 4GZYC 4UPAA 3I72A 3STBD 4BBRH 2UUBL 3R3OA 2K1BA 3MXNB 2F0IA 1C4QA 3HFZB 1CQFA 4OO1H 2F0PA 2DNCA 5EGTA 3QIAA 4P71A 5A2QL 2WFWA 2A6HC 3HZXA 4A3KH 2CKZB 4BY1G 5CC4A 3C1EA 2ES2A 1K8OA 3E5SA 3KK7A 3K5NA 1XNRL 1JB3A 1W3SA 4DK6C 5IP7H 1I3QB 4KI0A 3BVGA 3FHWA 4KKSA 4DR4Q 4I65A 1AP0A 5AJ3Q 5IYBG 5GAHC 4IUPA 3HOZG 1U4PA 3DWPA 3JAMc 1GUNA 2VQFQ
chains in the Genus database with same CATH topology
2QDBA 2A74C 5JPMC 1RDPD 1ILPA 5COYA 5DAUA 1RKNA 1V1OA 5IOCA 2VNUD 1H9SB 3VYSA 1LTRD 3MWYW 1PRTF 1UNSA 1RF2D 4LK1C 1LT5D 1XYIA 3EA6A 1J8IA 2M2LA 3VYUA 5C4ZA 5BN3A 1I4RA 4RCNA 1MSHA 4BS9A 4CGYB 4WORA 1E2WA 1B4OA 1A6XA 1TS5A 3F2UA 2H4OA 2Z4IA 1RODA 3TZUA 4NKLA 2K6AA 5C0XJ 1ICWA 2NYZD 3NTIA 1WTOA 1G2TA 1JICA 2NN6G 3MXGA 1X3QA 4L6TB 1WD1A 2A6HD 3LWUA 3ONAB 4R8NA 2IWHA 4IALA 2BA1A 1MI2A 2Y0SB 1G2SA 4A93B 1SNDA 3FDTA 3BDOA 2F4IA 3PUYA 3VA7A 2PYKA 1D2BA 3T13A 5NUCA 1ENFA 3Q24A 1YNJC 2RSNA 4ILWA 1O7LA 1SYEA 3D4DA 2XVSA 4X3KA 1KLGD 2VUMB 1FGBD 1BOSA 3A8IE 1JC7A 2KOLA 1SXTA 2EXZA 1WTVA 3SK8A 4N9TA 3U9SA 3CQZB 2KJXA 5CGKA 1TWCB 1STEA 3S1MB 3KLRA 3GTQB 4TKOB 5BN5A 1EEID 3MXNA 4DK1A 1BCPC 1A3VA 4K2LA 2PCFB 4L8JA 1TQOA 1ZYRC 1G291 1O78A 3MC0B 5IGCA 4KKTA 1PFMA 1HPCA 4A3EB 1JOKA 3D3RA 4IFDG 3MTSA 1IKMA 3T16A 2K33A 1GHKA 4NP5A 1KLUD 2ICEC 2CW0C 4PQXA 5CBEE 2L5TA 5FO8B 5M5YB 5K36H 1CA6A 2BA0A 4WRDA 1EU3A 3MFGA 3VR3A 5JEAJ 4XXEA 1F9RA 4IUQA 3S15B 1H9SA 1HFNA 1AZPA 2B2VC 2RDGA 1QNKA 4RGNA 4YIJA 2RBMA 1FYCA 3H94A 1LACA 1DONA 2RQXA 4H0LC 2DY8A 3T53B 1QJOA 1EQTA 1IYVA 1V1PB 2MP1A 4HTHA 1DOMA 5I6YA 2KHSA 3BDCA 4C3JG 1ET9A 1CM9A 4CHTB 3BZDB 3K5MA 2WB1B 1JWMD 3S17B 2KUMA 3IKJA 4O42A 5ELDA 1WTWA 2EYFA 2KEDA 3ND8A 1PTOB 5IGBA 4DF7A 2F0DA 1LTGD 2XSCA 4FXDA 1D5MC 4HR7B 2PPBC 1GOZA 1QB5D 5M3MB 5FO9B 1KNEA 2EYPA 4K5VA 1B53A 4E6IA 4C2MB 1SAPA 3RD4A 2R3ZA 3P75A 1G91A 1EYDA 3U9OA 1Y8PB 4B08A 3GTLB 2AUKA 3R2IA 1II3A 2KA7A 3SK5A 2B2UA 2JE6I 5KNBA 4KKUA 2K28A 1HHVA 2BCOA 4RAUC 1EY6A 3I91A 2JP1A 4EQPA 3GTKB 1GUSA 2PW5A 1I6HB 1JORA 2KECA 5JVG3 4G57A 4TSSA 3PIP3 2JA7B 5E3FA 5C3EB 5D14A 5J22A 1A3TA 3SK6A 1Y8NB 5KGUA 3NQIA 2EJFC 1G6ZA 1IYUA 4F7XA 3LWEA 5IGEA 2SEBD 4KJOA 4ZQ3A 1TY2A 4WJWA 5IT9L 4FVMA 4C3IB 3A8KE 3GD7A 5EPKA 1B9MA 4FXKC 5D3DA 1RJTA 2F0KA 2NVQB 1TR5A 2XWBB 1U9RA 1MBYA 3SEBA 2E2HB 5A35A 2K7VA 2A5HA 3AB9A 3L9AX 2YU9B 1PZID 2HCIA 1LABA 5CORA 3S2DB 4U673 2QILA 5EKIA 5J1ZA 4QMGA 3MA2B 1KNAA 5E1FA 1FNUA 1E2ZA 3FVQA 1G8ZD 3VR6A 4RGOS 2EYMA 2O2LD 2AQ3B 2XRQD 2N55A 1LT3D 5DM63 2A68C 2XNAC 5FO7B 3J7AV 4HSPA 4FF2A 4ZKBB 1SJHD 3CHBD 5M5XB 3PUXA 3OHXC 3Q6SA 1EIGA 4RWSC 3D6CA 4XYOA 5FK9C 2FFKB 4OIKA 1I6VC 2LKVA 2CQAA 3HG9A 3OWEB 1GUTA 2F0WA 3TMEA 5CV7A 4KD3A 1SE4A 3GQBA 2OF1A 3H09A 3M4OB 3NUCA 2IW3A 1C48A 1OXXK 3V2TA 1ENAA 1DOLA 1F2ZA 2IX3A 2B2TC 3EVQA 3NWTA 4ULLA 3SVMA 3KUPA 1STNA 2BDNA 1CZWA 3TZDA 1VF5C 1MGSA 3L7ZC 4PMBA 1GJXA 3PV0A 1NAPA 4DAYA 1PRTC 3OIPA 2JEBI 3DUZA 2L4NA 5C3WA 1PLFA 5C44B 2PZTA 3TN2A 5KEEA 5C4XB 1JWSD 4R8IA 3KBGA 4K2KA 3D4RA 5ELFA 2BE5C 4UDUC 4FYDA 2PO4A 3I70A 3L3OC 5C0XH 1O7YA 2WKDA 2D2CC 1NUCA 1STAA 4BBSB 1F2LA 2I07B 2E2JB 3T56B 1IHZA 1BBXC 2D5DA 1HTPA 1S5BD 4XIGS 3H0GB 1TWHB 1M4VA 5M9OA 1S5ED 1EY9A 4P2CB 3J80L 2F0VA 1Q90A 3H3VC 1WTRA 1BCPB 1JCKB 1X32A 1Y69U 4CKCA 1PTOH 3LX0A 2E76C 3J7AF 2WAQB 3NP8A 3D6WA 1STYA 2AQ2B 5EPJA 1I4PA 2F0QA 5JJZA 1NCVA 2PQEA 2FJ2A 1EWCA 4A3DB 4KTAA 1LV9A 5KNDA 2SNMA 4QCLA 5JPNC 3H91A 1ML0D 2K5WA 1LLRD 3VYTA 3DWQA 1F77A 2EDGA 1KABA 4PV1C 2NUCA 3DHQA 1SEBD 4OHJA 3HOYB 4Y7NB 1EY7A 1W6KA 4RKLA 2O5IC 4CKEA 4J8QA 4C3HG 3BYYB 1ENCA 5I9OA 1F9SA 1QNUA 4K8IA 2AQ1B 3N52A 4DGZA 3N6RA 2OT2A 1WTPA 4KY7A 1RCVD 1VMPA 2BE5D 2A6EC 1NR2A 1DYQA 2ICIA 1KAAA 3WDNA 4RA8A 4J1MA 3J80E 1K8MA 2PNRC 4OO1G 1GUWA 2EOTA 3MAQA 2Q8IB 2EYOA 3DWAA 1AN8A 1LTAD 3OWFA 4NW2A 4CJ0B 5JEAH 3TBIB 4PMWA 4QUFA 2HCCA 4HSVA 1F9QA 1B3AA 5D65A 3GTPB 2VXWA 2EY1A 3PUWA 3LNNA 2NBFA 5A2QE 2SDFA 1PFNA 2VB3X 2HQEA 2TSSA 1AZQA 4XQNA 4FXGC 4FO2A 1EQVA 3GTJB 1FD7D 4G4KA 3NQTA 5KYIA 4F8MA 2EJGC 1KDBA 4KK7A 1U4MA 3EFXD 3R93A 2OEOA 3WOFA 4HEDA 4RHRA 2Q8TA 4C1NK 1DM0B 1C8CA 1CFMA 3RZOB 1I4XA 3A7LA 1LTTD 5C5MA 1R9TB 1BNZA 2E75C 4A3MB 3S16B 1PFBA 3T51B 1B44D 3K7AB 3ZYYX 4IUUA 1Z7TA 1SYFA 3A55A 5ISRA 1QG7A 2NB0A 1LTID 1MSGA 1DCZA 2F0JA 2M9VA 2F0FA 2K01A 5EBDA 3GV6A 1CI3M 2HDLA 3IFTA 3S14B 2EVBA 2F0MA 5CYUA 5I2YA 4UAIA 4QB4A 4F87A 1TY0A 4LMQD 2A69C 2EY5A 2FMMA 1K83B 3NBIA 1STHA 4ZAIA 3QWNA 1CHQD 5BN4A 3C1FA 1CQVA 3QJYA 2PMZB 2Q8RE 1VCIA 2JYOA 1PXUA 4QF4A 1LTBD 5CR3A 2B2VA 2WACA 1OXUA 3Q23A 3OOCA 4KN4C 4JBWA 1ILQA 1EEFD 3TSSA 2RDFA 3BG3A 1SNQA 5G3LD 2F0GA 3FPPA 2ZT9C 4XT1B 3RMHA 2EJMA 1YNJD 2BOSA 2NVTB 4DU9A 1WTQA 4BY1B 2M00A 4M8AA 3A8JE 3TP8A 3I4LA 3OPOA 1AEXA 3SR1A 1RD9D 2E2IB 3MZ5A 4X3UA 1O7ZA 3E0JA 3MXUA 3R8BA 3OMCA 3HOZB 1DOKA 5K36G 1IW7C 5I2XA 4J6HA 2IT1A 1BCPD 2BDOA 1EFID 5HURA 1YNNC 2SNSA 2LY7A 3HP3A 5M3FB 1ZYRD 1GHJA 1HXYD 3IAYA 1A3UA 4IFDJ 1KDCA 3GV3A 2A69D 1RTNA 3ERQA 1FNWA 1PRTB 3KLSA 4Z9CB 5LL6X 3V05A 4ABNA 1H9RA 2RA4A 3MXPA 2CW0D 4ID6A 1QE6A 4CJ1B 2LS01 1NSNS 4K8JA 1SNMA 2R61A 2DNEA 5C6AA 2KCCA 3DEOA 3HS0C 3FMCA 2RDHA 2ZXOA 1BQQT 4HMIA 1SFOB 2HUGA 4BA2I 4M1UB 2B2WC 1EIHA 4KHZA 5IIFA 2NWGA 1B50A 2B8FA 3I3CA 5LHY1 4XTCS 1IKLA 3A54A 3TP6A 5C0XI 1EY4A 5ELCA 4CKBA 1BF4A 4NDXA 1XWEA 2CHBD 4QIWB 2PZWA 2WIIB 4X3SA 1SE2A 2EYLA 3BYTB 4ZK9B 2EPBA 4CJ2C 2AWNA 1LTSD 3K5OA 4HCEA 1UAPA 1ESFA 1HRJA 4Q0FA 3K58A 5I4DA 4EQNA 1SYGA 1YNND 2IPKD 2G9HD 1QCBD 3BS1A 3P1HA 3HOWB 3QB3A 3K6OA 2F0SA 5F2DA 3PIO3 4K6LA 4OO1I 2B2YC 2WV6D 2EYHA 3FEWX 2K5DA 2JEAI 2J7ZA 4RGTA 2ID0A 2XRSD 4KD4A 2DN8A 2F0UA 1JE4A 1TKWB 1TWGB 1EZ6A 3CRKC 3J81L 3VR5A 1TU2B 1EY8A 1KTKA 4NMZA 4PNYA 1L0XB 2K32A 4K14A 1D6EC 5IT9E 1SBBB 3G7LA 4L63B 1DZ1A 3I8ZA 1S5FD 4ZKCB 1H9JA 2B2TA 4PMCA 2FMCA 2B8GA 3X3NA 2F0LA 3P20A 1EYCA 1TS2A 3K5LA 1S5CD 3E6ZX 2QKIC 2F0NA 3PUZA 5KYLA 4A3FB 1XXGA 1EZ8A 4AYBB 3BVMA 2O4XA 4C3JB 3RLFA 4K5WA 3S9WA 3SHLA 3SK4A 1JOQA 4TRDA 2FHTA 5JVH3 2J0TD 3A7AB 3IL8A 2G9DA 1FNVA 3QOJA 1E0BA 1SYCA 1WCMB 3HGBA 3DMUA 1D5XC 4K6DA 4XQJA 3VA5A 1BR9A 3M7NA 3QO2A 3J81E 5K5PA 4DK0A 2PZUA 4ZYSA 1OXTA 3CU7A 2F0OA 2X69A 3W2DA 4DFAA 3HRZC 2A68D 3GTGB 1I4HA 2ENBA 2WKCA 2Z4HA 2NTTA 2E74C 2JSOA 4FP5D 2QEJC 2F3VA 4HMJA 1V8QA 2LMCB 5C3XA 1DD2A 1WTXA 3KF8A 1RTOA 5EJWA 5M5WB 5HGTA 3HOXB 5DM73 2O5JC 1GUGA 2EYJA 4CBVA 3D8GA 1XTCD 3OIQA 4I7ZC 5E4WC 2A73B 2D9UA 1STBA 4MHEA 1TWFB 4EVOA 4ODGA 1HUNA 5E4XA 3JAML 1TIID 2IL8A 1CHPD 2K05A 5CMDA 5C0XG 2TMPA 3MVVA 4MIUA 2D62A 3GP7A 5C5LA 1PRTD 1D1IA 1JWUD 4C56C 1ONLA 3C2PA 3HEJA 4H44C 2F0HA 1PDQA 2EY6A 4G7OC 4F88A 1JR0D 1PTOF 2X6GA 5FLXL 2B63B 5CBAE 1HTLD 4RHSA 1QOHA 1QWYA 4A3GB 3NHHA 4KN7C 2LFNA 5EQ0A 4DNRB 2NN6H 1Z6HA 4KY5A 1ESRA 2JXMB 4RCOA 5LL6S 4LAAA 2WINB 2ZXPA 2EE1A 3MFYA 1UEAB 2WP8J 1PMRA 5J39A 3M85A 1STGA 4K5XA 5C4JB 2RVLA 1PYWD 4ZRZA 3T4AC 2HDMA 3TP7A 3GTOB 3PUVA 2RKSA 1HA6A 1EL0A 4O1NA 1R4PB 3JAME 1H9KA 2L55A 4IUNA 2AUJD 3NXWA 3SDZA 5C4HA 1SDFA 3HOVB 5IGFA 1EY0A 3I90A 1BDOA 3VR2A 4KJNA 3OMGA 2GA4B 1SYBA 1U4LA 1JQYD 3GO5A 3UI2A 3OW7A 3RZDB 3DM1A 4S3SA 5ELBA 2R92B 5CV4A 3URYA 3CKIB 5FLXE 3QOLA 5IGGA 3M7GA 2V4DA 3HKZB 1CK1A 3QG1A 2FINB 5JEAG 3SXHA 3BVZA 3X3MA 5CV8A 3NWSA 2A6ED 3MEHA 4IURA 1M8AA 4IFDH 2JA5B 4C3IG 5CV5A 1R4QB 2K5QA 1SNPA 1TVXA 4X3TA 5FKAC 4G7ZC 1A15A 4A3BB 5CV9A 1EU4A 1GUOA 1NR4A 2XIWA 3IFDA 2QF7A 4B9XA 2Z1CA 1EWHA 3W3AA 1I4GA 1OXVA 5T1GA 4XQQA 2PW7A 4H13C 5EKKA 4IQZA 1HA5A 2I46A 3I73A 5T1IA 2NZ1D 2IJ0A 1SNCA 2SOBA 3S1NB 4A3JB 3NBHA 3O13A 1SE3A 3VR4A 1B1ZA 4DXFA 2MPMA 4V190 2B39A 4ZLTF 1I4QA 4Q5VA 3EQLC 5EBCA 4FNFA 1FR3A 3M4YA 3PO2B 3HOUB 3G6JB 5AFWA 2IX1A 2RSOA 1TWAB 4XT3B 2NVYB 1S5DD 3I4MB 2KVMA 5KNCA 1OXSC 3CRLC 1VF7A 3VYRA 4IN3A 4OGQC 1EY5A 2QCPX 1B9NA 2XWJB 2YYZA 1KDAA 1TT2A 4C3HB 1SJED 2MHVA 2F0TA 2OXPA 3ND9A 1I50B 2J4XA 1ZXTA 3MHBA 4KY6A 1Z47A 3NPPA 3K57A 1HCZA 3P7JA 1Q1BA 1ZEQX 2IX0A 5G3LF 3PMFA 5KIXA 1LT4D 4RH6A 2XN9C 5I9PA 1WVLA 1T5EA 1EYAA 2F0EA 4BBRB 3NSWA 4DAPA 4ME5A 4N9PA 4A3KB 1Y1WB 3K59A 4RGMA 3KBXA 1Y8OB 2AWOA 2EY2A 2E2DC 3EROA 1HQMC 1GXDC 1MD2D 3D31A 3R2TA 2F1MA 4TQUS 1Q3LA 1BCPF 1H9MA 2X6LA 2B2WA 4XDXA 1BUVT 3NTHA 2Z8LA 3OSOA 2B2UC 2K03A 2NTSA 5TSSA 5EPLA 2KCNA 2MGSA 4IUTA 1JOOA 5FOBB 1ET6A 3TDQA 4KMUC 1D1KA 1S4ZA 2L0CA 2L1BA 4BA1I 3NTKA 3KLSX 1VMCA 4B9WA 1SMYC 4ZUJA 3A56A 3FPUB 2R7ZB 1LO5D 4FF3A 1U4RA 5EKLA 4G7HC 4WFN3 3M3YB 1E2VA 1IW7D 1O80A 3NK9A 1CA5A 1LT6D 4DNTB 2ZXRA 1A2UA 4DAVA 3V96A 1CT1D 3AU7A 4BWGB 3AMUA 1OO9B 2B2YA 2F03A 3ITPA 1V43A 2R93B 3C3LA 1Q1EA 1A2TA 4H7BA 4DXGA 3EJIA 1T5XD 2R6GA 5IGDA 1HUMA 2L9HA 5JAVA 2F3WA 1B2TA 1BXTA 3C46A 3BDLA 3DEPA 1J9OA 3DXJC 3Q0AA 1WD0A 4XYQA 4A3IB 3S1RB 5ELEA 4U68A 2H1EA 3RUZA 1V1PA 5DEHA 1SSOA 4IZ8A 1SNOA 1CZGA 1AW7A 4ZUIA 1Y1VB 4MN3A 4HCSA 2NVXB 2KEEA 4LJZC 2NN6I 3S2HB 2KQ3A 1SMYD 1ZKOA 4C1NI 1TS3A 3NE5B 1PZJD 4HAEA 1QILA 2N88A 1PTOC 2C9OA 3H6MA 4DN4M 3PO3B 3K0YA 1Q12A 3FKIB 5JOBA 1D5ZC 4RKBA 3S1QB 4RFBA 4V0BA 2K04A 2L11A 1XX8A 2JA8B 4IUVA 4R9WA 1BO0A 2JA6B 4EQOA 3TP5A 2CVRA 4OL7A 3GTMB 3WOEA 1IL8A 1F2YA 1EOTA 2C5CA 5CV6A 5D3IB 1W6JA 5IODA 4BY7B 1DXMA 1AFPA 2EZVA 5I6WA 1CTMA 1X3PA 3SE0A 2L12A 1RHPA 1VDZA 5DNFA 1SYDA 1DJRD 1Q8IA 2MUYA 4IFDI 2MJ8A 1HFGA 3Q22A 4KV6A 1UUPA 4KHVA 4HN7A 4EGVA 1F9PA 1TS4A 4FF1A 3J7YW 1PZKD 1HQRD 2DY7A 3FRPB 4DA2A 4QUCA 4JK1C 4FF4A 3I4NB 3D4WA 1PTOD 5KRUA 1L0YB 2VB2X 4OIJA 1F2MA 4GZYC 3I72A 3R3OA 2K1BA 2F0IA 1C4QA 1CQFA 4OO1H 2F0PA 2DNCA 5EGTA 3QIAA 5A2QL 2A6HC 3HZXA 5CC4A 3C1EA 1K8OA 3E5SA 3KK7A 3K5NA 1JB3A 1I3QB 4KI0A 3BVGA 4KKSA 4I65A 1AP0A 4IUPA 1U4PA 3DWPA 1GUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTA A;  5EKK A;  2QDB A;  4ME5 A;  4N9P A;  4K14 A;  1F2Z A;  5IGD A;  1F2Y A;  2SNM A;  2EYJ A;  5JAV A;  2OEO A;  5CV6 A;  5IOD A;  3EVQ A;  2RDF A;  5DAU A;  1RKN A;  2F3W A;  3D8G A;  5IOC A;  1SNC A;  2SOB A;  4IUN A;  5C4H A;  1SNQ A;  3NXW A;  2EYF A;  5IIF A;  1STN A;  1KAB A;  2F0G A;  5IGF A;  1EY0 A;  3BDL A;  2NUC A;  3DHQ A;  5I6W A;  5IGB A;  2EXZ A;  4PMB A;  2EY2 A;  4DF7 A;  2F0D A;  3TP6 A;  3ERO A;  1EY7 A;  2F0K A;  4KJN A;  3SK8 A;  3OMG A;  4DU9 A;  4N9T A;  4RKL A;  1TR5 A;  5C5M A;  1EY4 A;  1U9R A;  1SYB A;  1SYD A;  2M00 A;  1STB A;  5CGK A;  1ENC A;  5I9O A;  4PMC A;  5C3W A;  2EYP A;  4NDX A;  4EVO A;  4K8I A;  3TP8 A;  4K5V A;  4ODG A;  1AEX A;  5C4Z A;  2RKS A;  3SR1 A;  3RUZ A;  4DGZ A;  4E6I A;  5DEH A;  2F0L A;  1A3V A;  3OSO A;  2PZT A;  1EYC A;  4K2L A;  4IZ8 A;  3MZ5 A;  4S3S A;  5CV4 A;  2PZW A;  3P75 A;  4KV6 A;  4KHV A;  1SNO A;  5KEE A;  2EYL A;  4KY7 A;  5KYL A;  2F0N A;  1EYD A;  3MVV A;  3OMC A;  4MIU A;  4WOR A;  3U9O A;  3QOL A;  1TQO A;  5C5L A;  1EZ8 A;  4ZUI A;  1SYF A;  5J1Z A;  1JOO A;  4K2K A;  4QMG A;  5ISR A;  5IGC A;  5E1F A;  2O4X A;  4EQN A;  5IGG A;  1II3 A;  2F0J A;  4K5W A;  1KAA A;  1JOK A;  1SYG A;  3HEJ A;  3SHL A;  3SK5 A;  3S9W A;  3SK4 A;  1JOQ A;  4J6H A;  2F0H A;  4TRD A;  3T16 A;  2F0F A;  2EY6 A;  2KQ3 A;  2EYM A;  4NKL A;  4J1M A;  5HUR A;  1NUC A;  3P1H A;  1STA A;  4NP5 A;  3SXH A;  1EY6 A;  2SNS A;  3QB3 A;  3QOJ A;  3D4W A;  4EQP A;  4B9W A;  5KRU A;  5CV8 A;  2F0S A;  2EYO A;  5F2D A;  1SYC A;  3MEH A;  1EY5 A;  1IHZ A;  5CV5 A;  4ZUJ A;  1F2M A;  3DMU A;  2PW5 A;  2F0M A;  1A3U A;  1KDC A;  3NHH A;  4WRD A;  4K6D A;  3R3O A;  5EKL A;  3OWF A;  4QB4 A;  3H6M A;  1JOR A;  2EYH A;  3VA5 A;  2F0I A;  5M9O A;  1KDA A;  1TT2 A;  2F0P A;  3ERQ A;  4G57 A;  5K5P A;  1EY9 A;  4R8N A;  2F0T A;  3NK9 A;  2EY5 A;  5EGT A;  2OXP A;  5E3F A;  2F0V A;  1SNP A;  1STH A;  4IAL A;  4KD4 A;  1A2U A;  2PZU A;  2EY1 A;  5JOB A;  2F0U A;  3HZX A;  4RKB A;  2F0O A;  3MXP A;  4DFA A;  4KY5 A;  4ID6 A;  5CC4 A;  3D6C A;  3C1F A;  3MHB A;  4KY6 A;  5J22 A;  3ITP A;  3C1E A;  1A3T A;  3E5S A;  5CV9 A;  1NSN S;  1SND A;  2ENB A;  2RBM A;  2LKV A;  1EZ6 A;  4LAA A;  4YIJ A;  3SK6 A;  3PMF A;  5KGU A;  2F0W A;  4K8J A;  3TME A;  1SNM A;  2HQE A;  3LX0 A;  5CV7 A;  5KIX A;  4KD3 A;  4HMJ A;  2F3V A;  4B9X A;  5C6A A;  2PYK A;  5J39 A;  4F7X A;  5C3X A;  3NP8 A;  1STG A;  1EQV A;  4QF4 A;  2OF1 A;  4K5X A;  3T13 A;  5I9P A;  4HTH A;  4I65 A;  1EYA A;  5CR3 A;  5IGE A;  5NUC A;  2F0E A;  4EQO A;  1EY8 A;  1STY A;  2WAC A;  3NUC A;  4KJO A;  5I6Y A;  4ZQ3 A;  3TP7 A;  1A2T A;  2F0Q A;  4H7B A;  3TP5 A;  3V2T A;  2KHS A;  3BDC A;  4NMZ A;  1ENA A;  2PQE A;  1SYE A;  3EJI A;  4OL7 A;  3NQT A;  4PNY A;  5HGT A;  3D4D A;  5KYI A;  4F8M A;  2PW7 A;  4HMI A;  1KDB A; 
#chains in the Genus database with same CATH topology
 2QDB A;  2A74 C;  1Z9F A;  5BR8 L;  5JPM C;  1RDP D;  1ILP A;  5COY A;  5DAU A;  1RKN A;  1V1O A;  5IOC A;  2VNU D;  1H9S B;  3RN2 A;  3VYS A;  1LTR D;  3MWY W;  1PRT F;  1UNS A;  1RF2 D;  4LK1 C;  4OEL B;  1LT5 D;  4NPS A;  4GLA C;  1XYI A;  3EA6 A;  1J8I A;  2M2L A;  2WB1 E;  1E1T A;  3VYU A;  3CC7 A;  5FLX c;  3G48 A;  3OTO Q;  5C4Z A;  1P8L A;  5BN3 A;  1I4R A;  4RCN A;  2R7Z H;  3CPW A;  1MSH A;  2ZM6 Q;  4BS9 A;  2MO0 A;  1Q8K A;  4CGY B;  3M3Y H;  4WOR A;  1KAW A;  1E2W A;  1B4O A;  3KJP A;  4OXP A;  1A6X A;  1TS5 A;  3F2U A;  2H4O A;  2IY5 B;  3ULP A;  2Z4I A;  3G71 A;  1N33 L;  1JE5 A;  1ROD A;  3TZU A;  1AE3 A;  1VQA A;  4RG1 A;  4JV5 Q;  5GQO A;  4NKL A;  2K6A A;  3T1Y Q;  5C0X J;  2I5H A;  1ICW A;  1VQG A;  2NYZ D;  2D0P A;  5C3E G;  2R93 H;  3NTI A;  1PYS B;  4DR1 L;  1WTO A;  1G2T A;  1SMX A;  1JIC A;  2NN6 G;  1AE2 A;  1MHW C;  2DJG C;  4A4I A;  3MXG A;  1X3Q A;  4L6T B;  1WD1 A;  2VS1 A;  5E7N A;  2A6H D;  3LWU A;  1XMO Q;  3ONA B;  4R8N A;  2IWH A;  4B3M Q;  2XTI A;  4CDF C;  4IAL A;  2BA1 A;  3FP9 A;  1MI2 A;  2Y0S B;  5IYD G;  5IP9 G;  1G2S A;  4A93 B;  4APV A;  1SND A;  4P75 A;  4X66 Q;  3FDT A;  3BDO A;  2K5V A;  3J80 i;  2F4I A;  3PUY A;  2HD3 A;  3VA7 A;  2PYK A;  1YEZ A;  3K7U C;  1D2B A;  3T13 A;  4A3I H;  1SR3 A;  3S1R H;  2ZTD A;  5NUC A;  1V1Q A;  2AMC B;  1ENF A;  3Q24 A;  4DV4 Q;  1YNJ C;  4P72 A;  2RSN A;  4ILW A;  1O7L A;  1SYE A;  3D4D A;  1DGS A;  4GLV B;  1SLJ A;  1J5E Q;  2XVS A;  4X3K A;  3A5Z B;  3D0F A;  2CCZ A;  1Y1V H;  3HOW G;  1G6P A;  1KLG D;  3Q8D A;  1FGB D;  4R4I A;  1N36 Q;  2NVX H;  2VUM B;  1BOS A;  3A8I E;  4X65 L;  1JC7 A;  1VQ5 A;  2KOL A;  1YBY A;  1SXT A;  5L37 A;  2EXZ A;  4H02 A;  1X6O A;  1WTV A;  3SK8 A;  3E3X A;  3CF5 A;  4N9T A;  3U9S A;  3CQZ B;  4GOP C;  1B70 B;  2KJX A;  5CGK A;  1TWC B;  1STE A;  4JI4 L;  3KLR A;  3S1M B;  3GTQ B;  4TKO B;  4O0A A;  5BN5 A;  1EEI D;  3NEN A;  3MXN A;  4DK1 A;  1BCP C;  1A3V A;  4K2L A;  2PCF B;  4OON A;  1PH8 A;  3PO3 H;  4L8J A;  1TQO A;  3AFP A;  1ZYR C;  4DV1 L;  1G29 1;  1O78 A;  3MC0 B;  1UE1 A;  3FKI H;  5IGC A;  4KKT A;  1PFM A;  1HPC A;  2GVB A;  4A3E B;  1JOK A;  3D3R A;  4IFD G;  3MTS A;  1X55 A;  4A3L H;  2JJQ A;  1IKM A;  3T16 A;  2F4V Q;  1N9W A;  2K33 A;  4N8F A;  1GHK A;  2CFM A;  2JA8 H;  1PYB A;  4NP5 A;  1KLU D;  4HIK A;  2ICE C;  2AKW B;  2CW0 C;  4PQX A;  1A62 A;  3M4Q A;  2L5T A;  4OWX B;  5CBE E;  5FO8 B;  1VQK A;  5M5Y B;  5K36 H;  1CA6 A;  2BA0 A;  2JA6 H;  4WRD A;  4DV2 L;  1EU3 A;  3MFG A;  3VR3 A;  3JC6 6;  3GTM H;  2VZA A;  5JEA J;  4XXE A;  3OTO L;  1JB7 A;  1F9R A;  3DM3 A;  2QA4 A;  4IUQ A;  3S15 B;  3CCM A;  1H9S A;  3OW2 A;  1HFN A;  1VQ4 A;  4BY7 H;  1AZP A;  2B2V C;  2RDG A;  1QNK A;  4RGN A;  1YJ9 A;  4YIJ A;  2RBM A;  1FYC A;  2KCT A;  1LAC A;  3H94 A;  1DON A;  2RQX A;  1PH1 A;  4H0L C;  2DY8 A;  3T53 B;  1QJO A;  1EQT A;  2UUC Q;  1IYV A;  1V1P B;  2MP1 A;  4HTH A;  4A3F G;  1N32 Q;  1DOM A;  1I94 Q;  2UXC L;  5I6Y A;  3T1H Q;  2KHS A;  3BDC A;  4AYB G;  4C3J G;  1ET9 A;  4LUZ A;  1CM9 A;  4CHT B;  3BZD B;  3K5M A;  2WB1 B;  1JWM D;  4YY3 L;  3EBE A;  3S17 B;  5ELN A;  2KUM A;  3IKJ A;  4O42 A;  4AH6 A;  5ELD A;  1SRU A;  1WTW A;  2A8V A;  2EYF A;  2KED A;  3ND8 A;  1XMO L;  1PTO B;  5IGB A;  1WCM G;  4B3M L;  4BXX G;  4DF7 A;  2F0D A;  1LTG D;  4AQY L;  4DKA C;  2A1A A;  2XSC A;  5IE8 A;  4FXD A;  2V1C C;  3J7Z C;  1TWF H;  1D8L A;  1D5M C;  4HR7 B;  4DV0 Q;  2PPB C;  1GOZ A;  2Q2H A;  1QB5 D;  5M3M B;  5FO9 B;  1KNE A;  3I4N H;  2EYP A;  4K5V A;  4NXM Q;  1B53 A;  4E6I A;  4C2M B;  1SAP A;  3RD4 A;  2R3Z A;  3P75 A;  4DR2 L;  2GN5 A;  1S72 A;  1G91 A;  1EYD A;  3U9O A;  5IYC G;  3QR8 A;  1EWI A;  1Y8P B;  4HID A;  4B08 A;  3GTL B;  2AUK A;  3R2I A;  1II3 A;  2KA7 A;  5LMN Q;  2UXD Q;  3SK5 A;  2B2U A;  2JE6 I;  5KNB A;  4KKU A;  3H0G G;  2NZO A;  2K28 A;  4A3C H;  1HHV A;  2BCO A;  4RAU C;  1CSQ A;  1I3Q H;  4DAY B;  1EY6 A;  3I91 A;  3HOX G;  2JP1 A;  4EQP A;  3GTK B;  3CP0 A;  1H95 A;  4OEM B;  1GUS A;  2PW5 A;  1I6H B;  4YHH L;  4MTN A;  3KFU A;  1JOR A;  2KEC A;  1VQ8 A;  5JVG 3;  2WAQ G;  4G57 A;  4TSS A;  3PIP 3;  2OTL A;  2JA7 B;  5E3F A;  4DV3 Q;  2JK8 A;  3J7A 5;  5C3E B;  4JYA L;  1L1O C;  5D14 A;  5J22 A;  1A3T A;  3SK6 A;  1Y8N B;  4A3D G;  5KGU A;  3TS0 A;  4DR7 L;  3NQI A;  2EJF C;  1WFQ A;  4QJF A;  1G6Z A;  1U0L A;  1IYU A;  4F7X A;  1VS0 A;  3LWE A;  5IGE A;  1VQP A;  2YTX A;  2SEB D;  4KJO A;  2H5X A;  4ZQ3 A;  3TQY A;  1XPO A;  4LF7 L;  4LF6 Q;  1TY2 A;  4WJW A;  5IT9 L;  4B3S Q;  4FVM A;  4C3I B;  3G6E A;  3A8K E;  3GD7 A;  5EPK A;  1B9M A;  2B63 G;  1S40 A;  4FXK C;  5D3D A;  4DV5 Q;  4A3G G;  1RJT A;  2F0K A;  2NVQ B;  1TR5 A;  2XWB B;  4DK3 C;  1U9R A;  1MBY A;  3K0X A;  3SEB A;  2E2H B;  5A35 A;  1VQF A;  3RZD H;  2K7V A;  2A5H A;  3AB9 A;  3L9A X;  2YU9 B;  1PZI D;  2R92 H;  2HCI A;  1LAB A;  2PI2 E;  5COR A;  1HNZ Q;  3S2D B;  4U67 3;  2QIL A;  2QW7 A;  4L5Q A;  2IHE A;  2K50 A;  3T1H L;  5EKI A;  5J1Z A;  2MO1 A;  4QMG A;  3MA2 B;  1KNA A;  5E1F A;  1FNU A;  1E2Z A;  4EX5 A;  2I5L X;  1KRT A;  4A93 H;  1LTL A;  3FVQ A;  4LFA Q;  1G8Z D;  3VR6 A;  4RGO S;  2EYM A;  2O2L D;  2AQ3 B;  2XRQ D;  2CH4 A;  3UE1 A;  2JA5 H;  2N55 A;  1LT3 D;  4LF4 L;  5DM6 3;  2A68 C;  2XNA C;  5FO7 B;  4J15 A;  3J7A V;  4HSP A;  4LF8 Q;  4P74 A;  4JCV E;  4DV0 L;  4POG A;  4FF2 A;  3HOV G;  4ZKB B;  1SJH D;  4GN3 B;  3CHB D;  5M5X B;  3PUX A;  4NXM L;  3OHX C;  3Q6S A;  1EIG A;  4DAM A;  2Z6K C;  1KXL A;  4RWS C;  2IHF A;  1Q46 A;  3D6C A;  2VUM H;  4XYO A;  5FK9 C;  4JI3 Q;  2FFK B;  1E24 A;  4OIK A;  1I6V C;  3HG9 A;  2LKV A;  2CQA A;  1EQR A;  3OWE B;  1YIT A;  1GUT A;  2F0W A;  2PQA B;  5CV7 A;  3TME A;  4KD3 A;  1VQ9 A;  2R92 G;  1HZ9 A;  5LMN L;  3CQZ H;  1YVC A;  1SE4 A;  3GQB A;  2OF1 A;  3H09 A;  3M4O B;  1TWC H;  3M9B A;  3S1M H;  3NUC A;  1J6Q A;  1C48 A;  2IW3 A;  1OXX K;  3V2T A;  1ENA A;  4GN5 A;  4MNO A;  1DOL A;  3HKZ G;  4DR5 L;  1C7Y A;  1SN8 A;  1F2Z A;  2IX3 A;  3I56 A;  2B2T C;  3EVQ A;  3NWT A;  4ULL A;  3SVM A;  3KUP A;  1MIU A;  1STN A;  2BDN A;  1CZW A;  3TZD A;  1VF5 C;  4A3E H;  1MGS A;  3K8A A;  3L7Z C;  4PMB A;  1GJX A;  2HIX A;  3PV0 A;  2UU9 Q;  1NAP A;  4DAY A;  1PRT C;  4YCU A;  3OIP A;  2JEB I;  3DUZ A;  3ULJ A;  1EYG A;  2L4N A;  4A75 A;  1EIY B;  2JQO A;  5C3W A;  2KEN A;  5M5Y H;  4YCW A;  2UUA L;  1PLF A;  5C44 B;  2PZT A;  4X64 Q;  3PO2 H;  1UWV A;  3TN2 A;  5HGQ A;  5KEE A;  5C4X B;  1GM5 A;  1HH2 P;  1JWS D;  4A3B G;  4R8I A;  2LSS A;  4LF6 L;  3KBG A;  4K2K A;  2NVY H;  3D4R A;  3S15 H;  5ELF A;  2BE5 C;  4UDU C;  4FYD A;  2PO4 A;  3I70 A;  3CW2 C;  3L3O C;  5C0X H;  1O7Y A;  2WKD A;  1K3B C;  2D2C C;  4O2D A;  4QL5 A;  3MEF A;  1NUC A;  1STA A;  4BBS B;  1F2L A;  2I07 B;  2VY3 A;  4DV5 L;  2E2J B;  3T56 B;  1IHZ A;  1BBX C;  3ERS X;  2D5D A;  1HTP A;  2K4K A;  1S5B D;  4XIG S;  2D0O A;  3H0G B;  4A3J G;  1TWH B;  1EOV A;  1M4V A;  5M9O A;  1S5E D;  1EY9 A;  4P2C B;  1TXY A;  4GOP B;  3J80 L;  2F0V A;  1M90 C;  3S17 H;  1PA6 A;  4JI2 L;  1Q90 A;  3H3V C;  4HIO A;  1WTR A;  1BCP B;  1JCK B;  1X32 A;  1Y69 U;  1PTO H;  4CKC A;  1FJG L;  3LX0 A;  2E76 C;  3J7A F;  2WAQ B;  3LGJ A;  2BH8 A;  3NP8 A;  3PIO A;  3D6W A;  3PO2 G;  5M3M H;  3K81 C;  3HOU G;  1STY A;  2AQ2 B;  5EPJ A;  4A76 A;  1I4P A;  1LYL A;  2F0Q A;  5JJZ A;  1HNW L;  1NCV A;  4GKK Q;  2PQE A;  2FJ2 A;  1EWC A;  3PGZ A;  3J81 i;  3U4Z A;  4A3D B;  4KTA A;  1LV9 A;  5KND A;  2SNM A;  1Y1W H;  3I4M G;  4QCL A;  5JPN C;  3H91 A;  3J81 j;  1ML0 D;  1NTG A;  5HY6 A;  2K5W A;  1LLR D;  3VYT A;  3GTL H;  3DWQ A;  4X62 L;  1F77 A;  2EDG A;  1KAB A;  1XNQ L;  4PV1 C;  1GKH A;  2NUC A;  3DHQ A;  1SEB D;  4OHJ A;  3HOY B;  4Y7N B;  3J80 c;  1EY7 A;  1K3R A;  1W6K A;  1EUJ A;  4LF9 L;  4RKL A;  4PG3 A;  2O5I C;  3GDE A;  4CKE A;  4JI3 L;  4J8Q A;  4C3H G;  3BYY B;  1ENC A;  1F9S A;  5I9O A;  1QNU A;  2N3S A;  4K8I A;  2AQ1 B;  3GTK H;  4NXN Q;  2ATW A;  3N52 A;  4DGZ A;  3N6R A;  2OT2 A;  1WTP A;  1I6H H;  1HNX Q;  1K28 A;  2LXJ A;  4KY7 A;  1RCV D;  2EIF A;  1VMP A;  2BE5 D;  2A6E C;  5M3F G;  2JA7 H;  1NR2 A;  3I2Z A;  1DYQ A;  2MNA A;  3EIV A;  2ICI A;  1KAA A;  2OQ0 A;  4WJ4 A;  3WDN A;  4RA8 A;  2PQA A;  4BBR G;  4KHP Q;  4DR3 L;  4J1M A;  3J80 E;  1PH7 A;  1S3O A;  1K8M A;  2PNR C;  4JI8 Q;  1B3Q A;  4OO1 G;  2EOT A;  1GUW A;  3MAQ A;  1KRS A;  3CPF A;  2Q8I B;  2EYO A;  3DWA A;  2UU9 L;  4UP7 A;  2HHH L;  4A3K G;  1AN8 A;  1LTA D;  3OWF A;  4NW2 A;  4UP8 A;  4CJ0 B;  1Y1W G;  5JEA H;  3TBI B;  1PFS A;  2F3I A;  4PMW A;  4QUF A;  2HCC A;  4HSV A;  1F9Q A;  1B3A A;  4IPG A;  5D65 A;  1A8V A;  2VXW A;  5IP7 G;  3GTP B;  4MZ9 A;  1L0W A;  2EY1 A;  4C3I H;  3PUW A;  3LNN A;  2NBF A;  5A2Q E;  2SDF A;  1PFN A;  1NY4 A;  1HZC A;  1E1O A;  2VB3 X;  2HQE A;  2TSS A;  1AZQ A;  4XQN A;  2NVQ H;  4FXG C;  2DGY A;  4IPH A;  4KLK A;  4FO2 A;  1EQV A;  2N8N A;  1K9M C;  2E2H H;  1QVG A;  3KLW A;  1Q7Y C;  3GTJ B;  2YU9 H;  1FD7 D;  4G4K A;  3NQT A;  5KYI A;  4F8M A;  2EJG C;  1KDB A;  4KK7 A;  2B3G A;  1U4M A;  4DUY L;  3S2D H;  3EFX D;  3R93 A;  2OEO A;  2PNH A;  3WOF A;  1ASZ A;  3A0J A;  5IWA Q;  4HED A;  4RHR A;  2Q8T A;  4C1N K;  1DM0 B;  1C8C A;  1CFM A;  3RZO B;  1I4X A;  3A7L A;  2R7Z G;  1LTT D;  5C5M A;  1R9T B;  1BNZ A;  2E75 C;  1XJV A;  3KDF B;  1L1O B;  4R4T A;  4A3M B;  3S16 B;  1PFB A;  1KHI A;  3T51 B;  1B44 D;  3K7A B;  5LMU Q;  3E9I A;  3ZYY X;  2KHJ A;  4GOP A;  1PHJ A;  4IUU A;  5M5X H;  2HQL A;  1WTH A;  1Z7T A;  1SYF A;  3S2H H;  3A55 A;  2R93 G;  5ISR A;  1QG7 A;  2NB0 A;  3JAM i;  1MSG A;  1LTI D;  3ULL A;  1DCZ A;  1C0A A;  2F0J A;  2M9V A;  4LF5 Q;  2F0F A;  4ZCK A;  4QIW E;  2E8G A;  2K01 A;  5EBD A;  2L15 A;  4JBM A;  3GV6 A;  3SGI A;  1CI3 M;  2HDL A;  3IFT A;  4IPD A;  1P16 A;  4DR4 L;  3S14 B;  3M4O H;  2EVB A;  4L5S A;  2F0M A;  4DR6 Q;  5AJ3 L;  5CYU A;  5I2Y A;  4UAI A;  3AQQ A;  4QB4 A;  3W1G A;  1IBL Q;  2RCF A;  1Q86 C;  4F87 A;  1TY0 A;  4LMQ D;  2A69 C;  2VQF L;  2EY5 A;  2FMM A;  1K83 B;  3NBI A;  3S1Q H;  1STH A;  4ZAI A;  3QWN A;  2PI2 A;  1CHQ D;  5BN4 A;  4A3I G;  1FGU A;  3C1F A;  1CQV A;  1JMC A;  5JJL A;  4JI7 Q;  4YWK A;  3QJY A;  2PMZ B;  2Z6B A;  2Q8R E;  1VCI A;  4MTK A;  2JYO A;  1PXU A;  4QF4 A;  1LTB D;  5CR3 A;  2B2V A;  2WAC A;  1Y1V G;  1OXU A;  3Q23 A;  4HJ8 A;  3UDF A;  4IO9 A;  4B3R Q;  5C44 H;  3OOC A;  2ZM6 L;  4KN4 C;  4JBW A;  4QY7 A;  5C4X H;  1ILQ A;  1EEF D;  3TSS A;  1X9N A;  1HZA A;  2RDF A;  3BG3 A;  3KOJ A;  1HZB A;  2E5L Q;  4DV6 Q;  1SNQ A;  5GRO A;  3L2P A;  4JI6 Q;  5G3L D;  3CC2 A;  2F0G A;  3FPP A;  1RIP A;  2ZT9 C;  4XT1 B;  3RMH A;  1BVS A;  2EJM A;  1NJI C;  1YNJ D;  1IBM Q;  2BOS A;  2NVT B;  4DU9 A;  1X3F A;  4JV5 L;  1ASY A;  3T1Y L;  1WTQ A;  3PO3 G;  4BY1 B;  5IY0 A;  2M00 A;  4M8A A;  1YIJ A;  3A8J E;  4BBS H;  3TP8 A;  3I4L A;  1SRO A;  3OPO A;  1AEX A;  1N34 Q;  2E2J H;  3FKI G;  3SR1 A;  1RD9 D;  3UDX A;  2E2I B;  1UEB A;  3MZ5 A;  4X3U A;  1O7Z A;  1YZ6 A;  4A3L G;  3E0J A;  3MXU A;  3R8B A;  3OMC A;  4UY8 C;  4JC0 A;  4HJ5 A;  1XMQ Q;  4IJL A;  2JA8 G;  4HJA A;  2YTY A;  3HOZ B;  1DOK A;  4B3T Q;  5K36 G;  1IW7 C;  1NNX A;  2JA6 G;  5I2X A;  4J6H A;  2IT1 A;  5IWA L;  1BCP D;  4X66 L;  2BDO A;  1EFI D;  5HUR A;  1YNN C;  2UXB Q;  2SNS A;  1PV4 A;  3UE0 A;  3K80 C;  2LY7 A;  3HP3 A;  5M3F B;  2ALY B;  4JG2 A;  1KC8 C;  1ZYR D;  1GHJ A;  1HXY D;  3IAY A;  1A3U A;  4BY7 G;  4AYB E;  4IFD J;  1KDC A;  4EQ5 A;  3CCU A;  3GV3 A;  2A69 D;  4DV4 L;  1BKB A;  1D7Q A;  2LXK A;  1RTN A;  3ERQ A;  1FNW A;  1PRT B;  2AHO B;  3KLS A;  4Z9C B;  1J5E L;  5LL6 X;  3V05 A;  4ABN A;  4PZ8 A;  1H9R A;  2RA4 A;  3MXP A;  4YWM A;  2CW0 D;  4ID6 A;  1N36 L;  4L5T A;  5FLM H;  1QE6 A;  4CJ1 B;  3E0E A;  2LS0 1;  1NSN S;  4YCV A;  3HOY H;  4Y7N H;  1BBW A;  4K8J A;  1SNM A;  1M1K C;  2R61 A;  2DNE A;  5C6A A;  2KCC A;  2N78 A;  2Z0S A;  3KDF A;  3DEO A;  2FXQ A;  3HS0 C;  1L1O A;  1WJJ A;  2G5D A;  3FMC A;  2RDH A;  1PH5 A;  2ZXO A;  4OWT B;  1BQQ T;  4HMI A;  1SFO B;  2HUG A;  3UDG A;  4BA2 I;  2QGQ A;  4LFB Q;  4CDD C;  4M1U B;  4CDE C;  3U50 C;  2B2W C;  1EIH A;  4KHZ A;  5IIF A;  2NWG A;  1HJP A;  3I4N G;  1YHB A;  1B50 A;  2B8F A;  3I3C A;  5LHY 1;  3H15 A;  4XTC S;  1IKL A;  3A54 A;  3TP6 A;  5C0X I;  1LM0 A;  2F4V L;  1EY4 A;  4R4Q A;  5ELC A;  4CKB A;  4JI7 L;  1BF4 A;  4NDX A;  1XWE A;  1KIX A;  2CHB D;  3KF8 B;  1VQ7 A;  4QIW B;  2PZW A;  2WII B;  4X3S A;  1SE2 A;  2EYL A;  2WAQ E;  3BYT B;  4ZK9 B;  2EPB A;  4CJ2 C;  2AWN A;  4JI0 Q;  4JI1 Q;  1EQQ A;  4A3C G;  1LTS D;  3K5O A;  4HCE A;  1UAP A;  5J3B A;  1ESF A;  1K0R A;  3GTP H;  1HRJ A;  2OTJ A;  2ZTE A;  4Q0F A;  3K58 A;  5I4D A;  4EQN A;  2R7D A;  1SYG A;  4UHV A;  1YNN D;  2IPK D;  3I4O A;  3U4V A;  3CCQ A;  2G9H D;  2E5L L;  1QCB D;  3BS1 A;  2Q2T A;  3P1H A;  3HOW B;  1NBW A;  3QB3 A;  3K6O A;  2MFI A;  3CCR A;  1HR0 Q;  2F0S A;  4P73 A;  5F2D A;  4FDB A;  1IBM L;  2UUC L;  2VW9 A;  2I0Q A;  4LWC A;  3PIO 3;  1N32 L;  4K6L A;  5LMN W;  3GTJ H;  1I94 L;  4JBK A;  4OO1 I;  2B2Y C;  2WV6 D;  2A19 A;  2EYH A;  1WYD A;  3FEW X;  2K5D A;  2JEA I;  2J7Z A;  4RGT A;  5EAY A;  2ID0 A;  2XRS D;  1N34 L;  2RF4 A;  5IT9 c;  4KD4 A;  3ICE A;  2DN8 A;  2F0U A;  1JE4 A;  2OQK A;  1TKW B;  1XMQ L;  1TWG B;  1EZ6 A;  3CRK C;  3RZO H;  2VQE Q;  4AIM A;  3J81 L;  3VR5 A;  1R9T H;  2Z6K A;  1TU2 B;  5FJ8 H;  1EY8 A;  4A3M H;  3S16 H;  1KTK A;  4NMZ A;  1JJC B;  4PNY A;  1NMG A;  1L0X B;  2K32 A;  3BU2 A;  3K7A H;  3AEV A;  4K14 A;  1A0I A;  1D6E C;  5IT9 E;  1SBB B;  3G7L A;  4L63 B;  1DZ1 A;  1CSP A;  3I8Z A;  4IOA A;  4GS3 A;  1S5F D;  3BZC A;  2ZJP A;  1XNR Q;  2UXD L;  4ZKC B;  3GTQ H;  1H9J A;  4DV7 Q;  2B2T A;  1PH2 A;  1U5K A;  3NEM A;  3I55 A;  4PMC A;  2FMC A;  2B8G A;  1L2F A;  2RHQ B;  3X3N A;  4L5R C;  3S14 H;  3RNU A;  2Y0S G;  2F0L A;  3P20 A;  1EYC A;  1TS2 A;  3J81 c;  4A93 G;  4PZ6 A;  3K5L A;  1S5C D;  3E6Z X;  2QKI C;  2F0N A;  3PUZ A;  5KYL A;  4A3F B;  5BR8 Q;  1XXG A;  1EZ8 A;  5ELO A;  2R7F A;  1K83 H;  4DV3 L;  2JA5 G;  1KL9 A;  3BVM A;  3STB C;  4AYB B;  5GAG C;  2O4X A;  4C3J B;  1X54 A;  3RLF A;  4K5W A;  3S9W A;  3SHL A;  4GNX C;  3SK4 A;  4NB3 A;  1JOQ A;  3RR5 A;  4TRD A;  2FHT A;  3F2C A;  5JVH 3;  2J0T D;  3IL8 A;  3A7A B;  2G9D A;  1FNV A;  3QOJ A;  1E0B A;  1SYC A;  1WCM B;  2JN4 A;  4GKJ Q;  2YTV A;  3HGB A;  1MJC A;  3DMU A;  1D5X C;  4DPG A;  4K6D A;  2OWO A;  4XQJ A;  1KQS A;  3VA5 A;  4LUV A;  2VUM G;  3PF4 A;  1BR9 A;  3HKZ E;  1VQJ A;  3QO2 A;  3M7N A;  3W5O A;  3J81 E;  5K5P A;  4B3S L;  4DK0 A;  2PZU A;  4ZYS A;  1OXT A;  1N33 Q;  3CU7 A;  2F0O A;  2X69 A;  3W2D A;  4DFA A;  3HRZ C;  1PH9 A;  2A68 D;  4JI1 L;  3CMA A;  4JI0 L;  1I4H A;  3IRB A;  4CDC C;  3GTG B;  1X65 A;  1YJN A;  1X3E A;  2ENB A;  4JOI C;  2WKC A;  2Z4H A;  2NTT A;  1QZG A;  2Q2U A;  2E74 C;  2JSO A;  4FP5 D;  2NVT H;  2QEJ C;  2F3V A;  4HMJ A;  1V8Q A;  4DR1 Q;  2LMC B;  5C3X A;  4BY1 H;  1DD2 A;  3TS2 A;  1WTX A;  4LNQ A;  3KF8 A;  1RTO A;  4I7A A;  5EJW A;  5M5W B;  4A3E G;  2E2I H;  5HGT A;  1HR0 L;  3CCE A;  3HOX B;  5DM7 3;  1HNZ L;  2O5J C;  1GUG A;  2EYJ A;  3S24 A;  1JJ2 A;  1IXR A;  4CBV A;  3D8G A;  1XTC D;  5IYB H;  3OIQ A;  3HOZ H;  4I7Z C;  1PH4 A;  3RLO A;  4LFA L;  5E4W C;  2A73 B;  2D9U A;  3OYY A;  1STB A;  4MHE A;  4HIM A;  4C2M H;  1TWF B;  4EVO A;  4ODG A;  2VQE L;  4IOC A;  1HUN A;  5E4X A;  3JAM L;  1TII D;  2IL8 A;  1CHP D;  2MQH A;  2K05 A;  4LF8 L;  4ALP A;  2PMZ E;  5CMD A;  5C0X G;  2TMP A;  3MVV A;  4MIU A;  2D62 A;  3GP7 A;  5C5L A;  4N8X 1;  1YI2 A;  1PRT D;  3F8T A;  1D1I A;  2B29 A;  1JWU D;  4C56 C;  1ONL A;  1E3P A;  4X65 Q;  3C2P A;  1IYJ B;  3A74 A;  3HEJ A;  2Q2I A;  4H44 C;  3NBH B;  2F0H A;  1PDQ A;  3CCL A;  2EY6 A;  4G7O C;  4F88 A;  1JR0 D;  4JI4 Q;  1PTO F;  2X6G A;  3BZK A;  5FLX L;  2B63 B;  5CBA E;  2WB1 G;  1HTL D;  4RHS A;  1QOH A;  1QWY A;  1Y14 B;  1MJE A;  4A3G B;  3NHH A;  4DV7 L;  1W2B A;  4KN7 C;  2LFN A;  5C3E H;  1WI5 A;  1SFO H;  1CKM A;  4DV1 Q;  5JJK A;  4IPC A;  5EQ0 A;  2JA9 A;  4DNR B;  2NN6 H;  1Z6H A;  1K8A C;  4KY5 A;  1ESR A;  1JJG A;  5M3M G;  4JW0 A;  1QUQ B;  2JXM B;  4RCO A;  5LL6 S;  4LAA A;  1IBK Q;  2WIN B;  2ZXP A;  2ZJR A;  3L0O A;  2EE1 A;  1VQH A;  3MFY A;  1UEA B;  2WP8 J;  1PMR A;  1K0S A;  4R1J A;  5J39 A;  3M85 A;  5IYD H;  5IP9 H;  1STG A;  4K5X A;  5C4J B;  2RVL A;  1PYW D;  3F2B A;  4DV2 Q;  3AFQ A;  4ZRZ A;  2HDM A;  3T4A C;  3TP7 A;  3GTO B;  2VL6 A;  1QZH A;  1VQI A;  1CKN B;  3H3V H;  3PUV A;  2RKS A;  4X64 L;  1HA6 A;  1VQ6 A;  4YWL A;  4GKJ L;  4K0K Q;  1EL0 A;  4O1N A;  1SE8 A;  1B7Y B;  1Q81 C;  3W1B A;  1FL0 A;  4RMF A;  1R4P B;  3JAM E;  1H9K A;  2L55 A;  4IUN A;  2AUJ D;  3NXW A;  3SDZ A;  5C4H A;  1SDF A;  3HOV B;  5IGF A;  1EY0 A;  3I90 A;  1BDO A;  3VR2 A;  4KJN A;  3OMG A;  1QVC A;  1CUK A;  2GA4 B;  1SYB A;  1U4L A;  1JQY D;  1UE6 A;  3GO5 A;  3HOW H;  3UI2 A;  3OW7 A;  3B6Y A;  1VQL A;  2UXC Q;  2JA7 G;  2DUD A;  4R4O A;  2HT1 A;  3RZD B;  3DM1 A;  3E9H A;  4S3S A;  5ELB A;  2R92 B;  5CV4 A;  5GAE C;  4YY3 Q;  3URY A;  3CKI B;  5FLX E;  3QOL A;  4JI5 Q;  4Y52 H;  4LFC Q;  1G51 A;  5IGG A;  4JBJ A;  3M7G A;  2V4D A;  3HKZ B;  4PZ7 A;  4AQY Q;  1CK1 A;  3QG1 A;  2FIN B;  1TWG H;  1K8G A;  2BH2 A;  1PVO A;  5JEA G;  3UDI A;  3SXH A;  3BVZ A;  3X3M A;  5CV8 A;  3NWS A;  2OCE A;  2A6E D;  3MEH A;  4IUR A;  1M8A A;  4IFD H;  2JA5 B;  4C3I G;  5CV5 A;  1R4Q B;  4HJ9 A;  4DR2 Q;  1NMF A;  2K5Q A;  4GKK L;  3PF5 A;  1SNP A;  1TVX A;  3AYH B;  2EQS A;  3ZJY C;  4JPB W;  4X3T A;  3CD6 A;  4QGU A;  3CCV A;  5FKA C;  2K14 A;  4G7Z C;  1A15 A;  3PQI A;  4A3B B;  1O7I A;  5CV9 A;  1EU4 A;  1GUO A;  1NR4 A;  2XIW A;  3IFD A;  1K73 C;  3TEH B;  2QF7 A;  4B9X A;  1YHQ A;  2Z1C A;  1EWH A;  3W3A A;  1FVI A;  1I4G A;  4YHH Q;  1OXV A;  3BJU A;  5T1G A;  1IL2 A;  1EIF A;  4NXN L;  4XQQ A;  2PW7 A;  1HNX L;  4H13 C;  1UE5 A;  4IQZ A;  5EKK A;  1LUZ A;  4A3F H;  4JYA Q;  1HA5 A;  2I46 A;  3I73 A;  5T1I A;  2NZ1 D;  2IJ0 A;  1SNC A;  2SOB A;  3S1N B;  4A3J B;  3NBH A;  1VQM A;  4C3J H;  1VQN A;  4X6A H;  4DR7 Q;  3O13 A;  1SE3 A;  3VR4 A;  4KHP L;  1B1Z A;  4DXF A;  4JI8 L;  2MPM A;  1X56 A;  1IBK L;  4OWW B;  4V19 0;  3KF6 B;  1WCM H;  2B39 A;  4ZLT F;  1I4Q A;  4LF7 Q;  4BXX H;  1A63 A;  4POF A;  1OTC A;  2C35 B;  2RHS B;  4Q5V A;  3CME A;  3EQL C;  5EBC A;  4FNF A;  1FR3 A;  3M4Y A;  3PO2 B;  3HOU B;  1PH3 A;  3G6J B;  5AFW A;  1YHA A;  5H1S E;  2IX1 A;  2KCM A;  2RSO A;  1TWA B;  4XT3 B;  1QUQ A;  4K0K L;  2NVY B;  3GTG H;  1S5D D;  1UE7 A;  3I4M B;  5IYC H;  2KVM A;  1KD1 C;  1OXS C;  3CRL C;  1VF7 A;  5KNC A;  3VYR A;  4IN3 A;  2ASB A;  4OGQ C;  1EY5 A;  3H0G H;  1CKN A;  1TWH H;  2QCP X;  1VQE A;  1B9N A;  2XWJ B;  2YYZ A;  5M5W H;  1KDA A;  1TT2 A;  4C3H B;  1SJE D;  2MHV A;  2HIV A;  2F0T A;  2XGT A;  3HOX H;  2OXP A;  3PCO B;  1VQC A;  3ND9 A;  1XPU A;  1I50 B;  2J4X A;  1ZXT A;  3MHB A;  4KY6 A;  1Z47 A;  3WWV A;  3NPP A;  4JI5 L;  3K57 A;  3CCS A;  1PH6 A;  1ICF B;  1HCZ A;  4OX9 Q;  3P7J A;  1Q1B A;  1ZEQ X;  2IX0 A;  5G3L F;  3PMF A;  4LFC L;  5KIX A;  1LT4 D;  5C44 G;  1AH9 A;  4RH6 A;  2XN9 C;  4LF4 Q;  5C4X G;  5I9P A;  1WVL A;  1T5E A;  1N8R C;  1EYA A;  2QEX A;  2F0E A;  4BBR B;  3DLL A;  3TRE A;  4TVA B;  4GNX B;  4A3D H;  3TRZ A;  3NSW A;  5DLQ E;  5LMU L;  4DAP A;  4ME5 A;  4N9P A;  1RL2 A;  4A3K B;  1Y1W B;  4BBS G;  2GVA A;  3K59 A;  4RGM A;  2F52 A;  3KBX A;  1Y8O B;  2AWO A;  2EY2 A;  4HJ7 A;  2E2D C;  3ERO A;  4LF5 L;  3I7F A;  1HQM C;  1GXD C;  1MD2 D;  3D31 A;  3R2T A;  3HKS A;  2F1M A;  4TQU S;  1Q3L A;  1BCP F;  1H9M A;  2X6L A;  2B2W A;  4XDX A;  1XPR A;  2B63 H;  1BUV T;  3NTH A;  2Z8L A;  4A3G H;  3KYH C;  2B2U C;  3OSO A;  4DR6 L;  4DR5 Q;  2CWP A;  1IBL L;  2K03 A;  2NTS A;  5TSS A;  5EPL A;  1XTD A;  2KCN A;  2MGS A;  1IZ6 A;  3ER0 A;  4IUT A;  1JOO A;  5FOB B;  1ET6 A;  3TDQ A;  4ME3 A;  2CWA A;  1VQB A;  4KMU C;  1D1K A;  1BBU A;  4DNI A;  1S4Z A;  2L0C A;  3NEL A;  2L1B A;  4BA1 I;  3KJO A;  1GO3 E;  3NTK A;  2ZTC A;  3KLS X;  1VMC A;  2P5Z X;  4B9W A;  1SMY C;  5C4J H;  2UUA Q;  4ZUJ A;  3A56 A;  3FPU B;  2R7Z B;  1LO5 D;  4FF3 A;  3GTO H;  1U4R A;  5EKL A;  4G7H C;  1X3G A;  4WFN 3;  5FLM G;  3M3Y B;  1E2V A;  1IW7 D;  4B3R L;  3EN2 A;  3HOY G;  1O80 A;  1NE3 A;  3NK9 A;  2K75 A;  1CA5 A;  1LT6 D;  4DNT B;  2ZXR A;  1A2U A;  4DAV A;  3V96 A;  1CT1 D;  3AU7 A;  4BWG B;  3AMU A;  1OO9 B;  2B2Y A;  4DV6 L;  4JI6 L;  4DUZ Q;  2F03 A;  3ITP A;  3HOV H;  1V43 A;  1WOC A;  5GAD C;  2R93 B;  1T9H A;  3C3L A;  3KF6 A;  1Q1E A;  1CKO A;  1A2T A;  4H7B A;  4DXG A;  3EJI A;  1T5X D;  2R6G A;  1JT8 A;  2K5H A;  5IGD A;  1HUM A;  2L9H A;  5JAV A;  2RCN A;  4JI2 Q;  2F3W A;  1B2T A;  1BXT A;  3VDY A;  1VQO A;  4B3T L;  3C46 A;  3BDL A;  3DEP A;  1J9O A;  3DXJ C;  1QVF A;  1FJG Q;  3Q0A A;  2I5M X;  1WD0 A;  2UUB Q;  1B8A A;  4XYQ A;  4A3I B;  3S1R B;  1YJW A;  2UXB L;  5ELE A;  4OX9 L;  1HNW Q;  4R4C A;  4U68 A;  4QQB X;  2H1E A;  3RUZ A;  1V1P A;  5DEH A;  1SSO A;  4IZ8 A;  1SNO A;  1CZG A;  1AW7 A;  1MKH A;  4ZUI A;  4LUO A;  1Y1V B;  4X62 Q;  4MN3 A;  4HCS A;  2NVX B;  2KEE A;  1XNQ Q;  4LJZ C;  1GVP A;  2NN6 I;  1V9P A;  3S2H B;  4LF9 Q;  4A3B H;  3M4P A;  3G4S A;  2KQ3 A;  1GD7 A;  3CXC A;  1SMY D;  1ZKO A;  4JVZ A;  4C1N I;  1TS3 A;  3NE5 B;  1PZJ D;  4HAE A;  1QIL A;  2N88 A;  4GNX A;  1PTO C;  2C9O A;  3H6M A;  4DN4 M;  3H3V I;  3PO3 B;  3RN5 A;  2N49 A;  3A5U A;  3K0Y A;  1YNX A;  1VQD A;  1Q12 A;  3FKI B;  5JOB A;  1HR0 W;  4LFB L;  2ZJQ A;  2YV5 A;  1D5Z C;  2QDL A;  4RKB A;  3S1Q B;  2CH4 W;  1E7Z A;  5FJ8 G;  3S1N H;  4RFB A;  4A3J H;  4V0B A;  2K04 A;  2L11 A;  4DR3 Q;  4A3M G;  1XX8 A;  2JA8 B;  1E22 A;  3U58 A;  4IUV A;  4R9W A;  1BO0 A;  5JJI A;  3PSI A;  2HHH Q;  4GLX A;  2JA6 B;  4EQO A;  4GN4 B;  2DJF C;  3TP5 A;  2Y0S E;  4JOI A;  2CVR A;  4OL7 A;  3GTM B;  3WOE A;  2CQO A;  3PIP A;  1IL8 A;  1F2Y A;  4LW1 A;  1EOT A;  2C5C A;  5CV6 A;  5D3I B;  1W6J A;  5IOD A;  3HOU H;  4BY7 B;  1DXM A;  1AFP A;  2Z9H A;  2EZV A;  1TWA H;  5I6W A;  1CTM A;  1X3P A;  3CAM A;  3SE0 A;  2KHI A;  2L12 A;  1RHP A;  3I4M H;  1VDZ A;  3F2D A;  5DNF A;  4DUZ L;  1SYD A;  3CCJ A;  1DJR D;  4UP9 A;  1Q8I A;  2MUY A;  4IFD I;  2MJ8 A;  1HFG A;  3Q22 A;  4WJ3 M;  3RLN A;  3CC4 A;  1EFW A;  4KV6 A;  1UUP A;  1I5F A;  4KHV A;  4HN7 A;  4DUY Q;  4EGV A;  4C3H H;  1F9P A;  1TS4 A;  1Q82 C;  4FF1 A;  3J7Y W;  1PZK D;  1HQR D;  2DY7 A;  3FRP B;  1I50 H;  2KBN A;  3F1Z A;  4DA2 A;  4QUC A;  2EXD A;  4JK1 C;  5M3F H;  2K52 A;  4FF4 A;  2K5N A;  3I4N B;  3D4W A;  1PTO D;  5KRU A;  1C9O A;  1L0Y B;  2VB2 X;  4IJH A;  2NZH A;  4OIJ A;  1F2M A;  4GZY C;  4UPA A;  3I72 A;  3STB D;  4BBR H;  2UUB L;  3R3O A;  2K1B A;  3MXN B;  2F0I A;  1C4Q A;  3HFZ B;  1CQF A;  4OO1 H;  2F0P A;  2DNC A;  5EGT A;  3QIA A;  4P71 A;  5A2Q L;  2WFW A;  2A6H C;  3HZX A;  4A3K H;  2CKZ B;  4BY1 G;  5CC4 A;  3C1E A;  2ES2 A;  1K8O A;  3E5S A;  3KK7 A;  3K5N A;  1XNR L;  1JB3 A;  1W3S A;  4DK6 C;  5IP7 H;  1I3Q B;  4KI0 A;  3BVG A;  3FHW A;  4KKS A;  4DR4 Q;  4I65 A;  1AP0 A;  5AJ3 Q;  5IYB G;  5GAH C;  4IUP A;  3HOZ G;  1U4P A;  3DWP A;  3JAM c;  1GUN A;  2VQF Q; 
#chains in the Genus database with same CATH homology
 2QDB A;  2A74 C;  5JPM C;  1RDP D;  1ILP A;  5COY A;  5DAU A;  1RKN A;  1V1O A;  5IOC A;  2VNU D;  1H9S B;  3VYS A;  1LTR D;  3MWY W;  1PRT F;  1UNS A;  1RF2 D;  4LK1 C;  1LT5 D;  1XYI A;  3EA6 A;  1J8I A;  2M2L A;  3VYU A;  5C4Z A;  5BN3 A;  1I4R A;  4RCN A;  1MSH A;  4BS9 A;  4CGY B;  4WOR A;  1E2W A;  1B4O A;  1A6X A;  1TS5 A;  3F2U A;  2H4O A;  2Z4I A;  1ROD A;  3TZU A;  4NKL A;  2K6A A;  5C0X J;  1ICW A;  2NYZ D;  3NTI A;  1WTO A;  1G2T A;  1JIC A;  2NN6 G;  3MXG A;  1X3Q A;  4L6T B;  1WD1 A;  2A6H D;  3LWU A;  3ONA B;  4R8N A;  2IWH A;  4IAL A;  2BA1 A;  1MI2 A;  2Y0S B;  1G2S A;  4A93 B;  1SND A;  3FDT A;  3BDO A;  2F4I A;  3PUY A;  3VA7 A;  2PYK A;  1D2B A;  3T13 A;  5NUC A;  1ENF A;  3Q24 A;  1YNJ C;  2RSN A;  4ILW A;  1O7L A;  1SYE A;  3D4D A;  2XVS A;  4X3K A;  1KLG D;  2VUM B;  1FGB D;  1BOS A;  3A8I E;  1JC7 A;  2KOL A;  1SXT A;  2EXZ A;  1WTV A;  3SK8 A;  4N9T A;  3U9S A;  3CQZ B;  2KJX A;  5CGK A;  1TWC B;  1STE A;  3S1M B;  3KLR A;  3GTQ B;  4TKO B;  5BN5 A;  1EEI D;  3MXN A;  4DK1 A;  1BCP C;  1A3V A;  4K2L A;  2PCF B;  4L8J A;  1TQO A;  1ZYR C;  1G29 1;  1O78 A;  3MC0 B;  5IGC A;  4KKT A;  1PFM A;  1HPC A;  4A3E B;  1JOK A;  3D3R A;  4IFD G;  3MTS A;  1IKM A;  3T16 A;  2K33 A;  1GHK A;  4NP5 A;  1KLU D;  2ICE C;  2CW0 C;  4PQX A;  5CBE E;  2L5T A;  5FO8 B;  5M5Y B;  5K36 H;  1CA6 A;  2BA0 A;  4WRD A;  1EU3 A;  3MFG A;  3VR3 A;  5JEA J;  4XXE A;  1F9R A;  4IUQ A;  3S15 B;  1H9S A;  1HFN A;  1AZP A;  2B2V C;  2RDG A;  1QNK A;  4RGN A;  4YIJ A;  2RBM A;  1FYC A;  3H94 A;  1LAC A;  1DON A;  2RQX A;  4H0L C;  2DY8 A;  3T53 B;  1QJO A;  1EQT A;  1IYV A;  1V1P B;  2MP1 A;  4HTH A;  1DOM A;  5I6Y A;  2KHS A;  3BDC A;  4C3J G;  1ET9 A;  1CM9 A;  4CHT B;  3BZD B;  3K5M A;  2WB1 B;  1JWM D;  3S17 B;  2KUM A;  3IKJ A;  4O42 A;  5ELD A;  1WTW A;  2EYF A;  2KED A;  3ND8 A;  1PTO B;  5IGB A;  4DF7 A;  2F0D A;  1LTG D;  2XSC A;  4FXD A;  1D5M C;  4HR7 B;  2PPB C;  1GOZ A;  1QB5 D;  5M3M B;  5FO9 B;  1KNE A;  2EYP A;  4K5V A;  1B53 A;  4E6I A;  4C2M B;  1SAP A;  3RD4 A;  2R3Z A;  3P75 A;  1G91 A;  1EYD A;  3U9O A;  1Y8P B;  4B08 A;  3GTL B;  2AUK A;  3R2I A;  1II3 A;  2KA7 A;  3SK5 A;  2B2U A;  2JE6 I;  5KNB A;  4KKU A;  2K28 A;  1HHV A;  2BCO A;  4RAU C;  1EY6 A;  3I91 A;  2JP1 A;  4EQP A;  3GTK B;  1GUS A;  2PW5 A;  1I6H B;  1JOR A;  2KEC A;  5JVG 3;  4G57 A;  4TSS A;  3PIP 3;  2JA7 B;  5E3F A;  5C3E B;  5D14 A;  5J22 A;  1A3T A;  3SK6 A;  1Y8N B;  5KGU A;  3NQI A;  2EJF C;  1G6Z A;  1IYU A;  4F7X A;  3LWE A;  5IGE A;  2SEB D;  4KJO A;  4ZQ3 A;  1TY2 A;  4WJW A;  5IT9 L;  4FVM A;  4C3I B;  3A8K E;  3GD7 A;  5EPK A;  1B9M A;  4FXK C;  5D3D A;  1RJT A;  2F0K A;  2NVQ B;  1TR5 A;  2XWB B;  1U9R A;  1MBY A;  3SEB A;  2E2H B;  5A35 A;  2K7V A;  2A5H A;  3AB9 A;  3L9A X;  2YU9 B;  1PZI D;  2HCI A;  1LAB A;  5COR A;  3S2D B;  4U67 3;  2QIL A;  5EKI A;  5J1Z A;  4QMG A;  3MA2 B;  1KNA A;  5E1F A;  1FNU A;  1E2Z A;  3FVQ A;  1G8Z D;  3VR6 A;  4RGO S;  2EYM A;  2O2L D;  2AQ3 B;  2XRQ D;  2N55 A;  1LT3 D;  5DM6 3;  2A68 C;  2XNA C;  5FO7 B;  3J7A V;  4HSP A;  4FF2 A;  4ZKB B;  1SJH D;  3CHB D;  5M5X B;  3PUX A;  3OHX C;  3Q6S A;  1EIG A;  4RWS C;  3D6C A;  4XYO A;  5FK9 C;  2FFK B;  4OIK A;  1I6V C;  2LKV A;  2CQA A;  3HG9 A;  3OWE B;  1GUT A;  2F0W A;  3TME A;  5CV7 A;  4KD3 A;  1SE4 A;  3GQB A;  2OF1 A;  3H09 A;  3M4O B;  3NUC A;  2IW3 A;  1C48 A;  1OXX K;  3V2T A;  1ENA A;  1DOL A;  1F2Z A;  2IX3 A;  2B2T C;  3EVQ A;  3NWT A;  4ULL A;  3SVM A;  3KUP A;  1STN A;  2BDN A;  1CZW A;  3TZD A;  1VF5 C;  1MGS A;  3L7Z C;  4PMB A;  1GJX A;  3PV0 A;  1NAP A;  4DAY A;  1PRT C;  3OIP A;  2JEB I;  3DUZ A;  2L4N A;  5C3W A;  1PLF A;  5C44 B;  2PZT A;  3TN2 A;  5KEE A;  5C4X B;  1JWS D;  4R8I A;  3KBG A;  4K2K A;  3D4R A;  5ELF A;  2BE5 C;  4UDU C;  4FYD A;  2PO4 A;  3I70 A;  3L3O C;  5C0X H;  1O7Y A;  2WKD A;  2D2C C;  1NUC A;  1STA A;  4BBS B;  1F2L A;  2I07 B;  2E2J B;  3T56 B;  1IHZ A;  1BBX C;  2D5D A;  1HTP A;  1S5B D;  4XIG S;  3H0G B;  1TWH B;  1M4V A;  5M9O A;  1S5E D;  1EY9 A;  4P2C B;  3J80 L;  2F0V A;  1Q90 A;  3H3V C;  1WTR A;  1BCP B;  1JCK B;  1X32 A;  1Y69 U;  4CKC A;  1PTO H;  3LX0 A;  2E76 C;  3J7A F;  2WAQ B;  3NP8 A;  3D6W A;  1STY A;  2AQ2 B;  5EPJ A;  1I4P A;  2F0Q A;  5JJZ A;  1NCV A;  2PQE A;  2FJ2 A;  1EWC A;  4A3D B;  4KTA A;  1LV9 A;  5KND A;  2SNM A;  4QCL A;  5JPN C;  3H91 A;  1ML0 D;  2K5W A;  1LLR D;  3VYT A;  3DWQ A;  1F77 A;  2EDG A;  1KAB A;  4PV1 C;  2NUC A;  3DHQ A;  1SEB D;  4OHJ A;  3HOY B;  4Y7N B;  1EY7 A;  1W6K A;  4RKL A;  2O5I C;  4CKE A;  4J8Q A;  4C3H G;  3BYY B;  1ENC A;  5I9O A;  1F9S A;  1QNU A;  4K8I A;  2AQ1 B;  3N52 A;  4DGZ A;  3N6R A;  2OT2 A;  1WTP A;  4KY7 A;  1RCV D;  1VMP A;  2BE5 D;  2A6E C;  1NR2 A;  1DYQ A;  2ICI A;  1KAA A;  3WDN A;  4RA8 A;  4J1M A;  3J80 E;  1K8M A;  2PNR C;  4OO1 G;  1GUW A;  2EOT A;  3MAQ A;  2Q8I B;  2EYO A;  3DWA A;  1AN8 A;  1LTA D;  3OWF A;  4NW2 A;  4CJ0 B;  5JEA H;  3TBI B;  4PMW A;  4QUF A;  2HCC A;  4HSV A;  1F9Q A;  1B3A A;  5D65 A;  3GTP B;  2VXW A;  2EY1 A;  3PUW A;  3LNN A;  2NBF A;  5A2Q E;  2SDF A;  1PFN A;  2VB3 X;  2HQE A;  2TSS A;  1AZQ A;  4XQN A;  4FXG C;  4FO2 A;  1EQV A;  3GTJ B;  1FD7 D;  4G4K A;  3NQT A;  5KYI A;  4F8M A;  2EJG C;  1KDB A;  4KK7 A;  1U4M A;  3EFX D;  3R93 A;  2OEO A;  3WOF A;  4HED A;  4RHR A;  2Q8T A;  4C1N K;  1DM0 B;  1C8C A;  1CFM A;  3RZO B;  1I4X A;  3A7L A;  1LTT D;  5C5M A;  1R9T B;  1BNZ A;  2E75 C;  4A3M B;  3S16 B;  1PFB A;  3T51 B;  1B44 D;  3K7A B;  3ZYY X;  4IUU A;  1Z7T A;  1SYF A;  3A55 A;  5ISR A;  1QG7 A;  2NB0 A;  1LTI D;  1MSG A;  1DCZ A;  2F0J A;  2M9V A;  2F0F A;  2K01 A;  5EBD A;  3GV6 A;  1CI3 M;  2HDL A;  3IFT A;  3S14 B;  2EVB A;  2F0M A;  5CYU A;  5I2Y A;  4UAI A;  4QB4 A;  4F87 A;  1TY0 A;  4LMQ D;  2A69 C;  2EY5 A;  2FMM A;  1K83 B;  3NBI A;  1STH A;  4ZAI A;  3QWN A;  1CHQ D;  5BN4 A;  3C1F A;  1CQV A;  3QJY A;  2PMZ B;  2Q8R E;  1VCI A;  2JYO A;  1PXU A;  4QF4 A;  1LTB D;  5CR3 A;  2B2V A;  2WAC A;  1OXU A;  3Q23 A;  3OOC A;  4KN4 C;  4JBW A;  1ILQ A;  1EEF D;  3TSS A;  2RDF A;  3BG3 A;  1SNQ A;  5G3L D;  2F0G A;  3FPP A;  2ZT9 C;  4XT1 B;  3RMH A;  2EJM A;  1YNJ D;  2BOS A;  2NVT B;  4DU9 A;  1WTQ A;  4BY1 B;  2M00 A;  4M8A A;  3A8J E;  3TP8 A;  3I4L A;  3OPO A;  1AEX A;  3SR1 A;  1RD9 D;  2E2I B;  3MZ5 A;  4X3U A;  1O7Z A;  3E0J A;  3MXU A;  3R8B A;  3OMC A;  3HOZ B;  1DOK A;  5K36 G;  1IW7 C;  5I2X A;  4J6H A;  2IT1 A;  1BCP D;  2BDO A;  1EFI D;  5HUR A;  1YNN C;  2SNS A;  2LY7 A;  3HP3 A;  5M3F B;  1ZYR D;  1GHJ A;  1HXY D;  3IAY A;  1A3U A;  4IFD J;  1KDC A;  3GV3 A;  2A69 D;  1RTN A;  3ERQ A;  1FNW A;  1PRT B;  3KLS A;  4Z9C B;  5LL6 X;  3V05 A;  4ABN A;  1H9R A;  2RA4 A;  3MXP A;  2CW0 D;  4ID6 A;  1QE6 A;  4CJ1 B;  2LS0 1;  1NSN S;  4K8J A;  1SNM A;  2R61 A;  2DNE A;  5C6A A;  2KCC A;  3DEO A;  3HS0 C;  3FMC A;  2RDH A;  2ZXO A;  1BQQ T;  4HMI A;  1SFO B;  2HUG A;  4BA2 I;  4M1U B;  2B2W C;  1EIH A;  4KHZ A;  5IIF A;  2NWG A;  1B50 A;  2B8F A;  3I3C A;  5LHY 1;  4XTC S;  1IKL A;  3A54 A;  3TP6 A;  5C0X I;  1EY4 A;  5ELC A;  4CKB A;  1BF4 A;  4NDX A;  1XWE A;  2CHB D;  4QIW B;  2PZW A;  2WII B;  4X3S A;  1SE2 A;  2EYL A;  3BYT B;  4ZK9 B;  2EPB A;  4CJ2 C;  2AWN A;  1LTS D;  3K5O A;  4HCE A;  1UAP A;  1ESF A;  1HRJ A;  4Q0F A;  3K58 A;  5I4D A;  4EQN A;  1SYG A;  1YNN D;  2IPK D;  2G9H D;  1QCB D;  3BS1 A;  3P1H A;  3HOW B;  3QB3 A;  3K6O A;  2F0S A;  5F2D A;  3PIO 3;  4K6L A;  4OO1 I;  2B2Y C;  2WV6 D;  2EYH A;  3FEW X;  2K5D A;  2JEA I;  2J7Z A;  4RGT A;  2ID0 A;  2XRS D;  4KD4 A;  2DN8 A;  2F0U A;  1JE4 A;  1TKW B;  1TWG B;  1EZ6 A;  3CRK C;  3J81 L;  3VR5 A;  1TU2 B;  1EY8 A;  1KTK A;  4NMZ A;  4PNY A;  1L0X B;  2K32 A;  4K14 A;  1D6E C;  5IT9 E;  1SBB B;  3G7L A;  4L63 B;  1DZ1 A;  3I8Z A;  1S5F D;  4ZKC B;  1H9J A;  2B2T A;  4PMC A;  2FMC A;  2B8G A;  3X3N A;  2F0L A;  3P20 A;  1EYC A;  1TS2 A;  3K5L A;  1S5C D;  3E6Z X;  2QKI C;  2F0N A;  3PUZ A;  5KYL A;  4A3F B;  1XXG A;  1EZ8 A;  4AYB B;  3BVM A;  2O4X A;  4C3J B;  3RLF A;  4K5W A;  3S9W A;  3SHL A;  3SK4 A;  1JOQ A;  4TRD A;  2FHT A;  5JVH 3;  2J0T D;  3A7A B;  3IL8 A;  2G9D A;  1FNV A;  3QOJ A;  1E0B A;  1SYC A;  1WCM B;  3HGB A;  3DMU A;  1D5X C;  4K6D A;  4XQJ A;  3VA5 A;  1BR9 A;  3M7N A;  3QO2 A;  3J81 E;  5K5P A;  4DK0 A;  2PZU A;  4ZYS A;  1OXT A;  3CU7 A;  2F0O A;  2X69 A;  3W2D A;  4DFA A;  3HRZ C;  2A68 D;  3GTG B;  1I4H A;  2ENB A;  2WKC A;  2Z4H A;  2NTT A;  2E74 C;  2JSO A;  4FP5 D;  2QEJ C;  2F3V A;  4HMJ A;  1V8Q A;  2LMC B;  5C3X A;  1DD2 A;  1WTX A;  3KF8 A;  1RTO A;  5EJW A;  5M5W B;  5HGT A;  3HOX B;  5DM7 3;  2O5J C;  1GUG A;  2EYJ A;  4CBV A;  3D8G A;  1XTC D;  3OIQ A;  4I7Z C;  5E4W C;  2A73 B;  2D9U A;  1STB A;  4MHE A;  1TWF B;  4EVO A;  4ODG A;  1HUN A;  5E4X A;  3JAM L;  1TII D;  2IL8 A;  1CHP D;  2K05 A;  5CMD A;  5C0X G;  2TMP A;  3MVV A;  4MIU A;  2D62 A;  3GP7 A;  5C5L A;  1PRT D;  1D1I A;  1JWU D;  4C56 C;  1ONL A;  3C2P A;  3HEJ A;  4H44 C;  2F0H A;  1PDQ A;  2EY6 A;  4G7O C;  4F88 A;  1JR0 D;  1PTO F;  2X6G A;  5FLX L;  2B63 B;  5CBA E;  1HTL D;  4RHS A;  1QOH A;  1QWY A;  4A3G B;  3NHH A;  4KN7 C;  2LFN A;  5EQ0 A;  4DNR B;  2NN6 H;  1Z6H A;  4KY5 A;  1ESR A;  2JXM B;  4RCO A;  5LL6 S;  4LAA A;  2WIN B;  2ZXP A;  2EE1 A;  3MFY A;  1UEA B;  2WP8 J;  1PMR A;  5J39 A;  3M85 A;  1STG A;  4K5X A;  5C4J B;  2RVL A;  1PYW D;  4ZRZ A;  3T4A C;  2HDM A;  3TP7 A;  3GTO B;  3PUV A;  2RKS A;  1HA6 A;  1EL0 A;  4O1N A;  1R4P B;  3JAM E;  1H9K A;  2L55 A;  4IUN A;  2AUJ D;  3NXW A;  3SDZ A;  5C4H A;  1SDF A;  3HOV B;  5IGF A;  1EY0 A;  3I90 A;  1BDO A;  3VR2 A;  4KJN A;  3OMG A;  2GA4 B;  1SYB A;  1U4L A;  1JQY D;  3GO5 A;  3UI2 A;  3OW7 A;  3RZD B;  3DM1 A;  4S3S A;  5ELB A;  2R92 B;  5CV4 A;  3URY A;  3CKI B;  5FLX E;  3QOL A;  5IGG A;  3M7G A;  2V4D A;  3HKZ B;  1CK1 A;  3QG1 A;  2FIN B;  5JEA G;  3SXH A;  3BVZ A;  3X3M A;  5CV8 A;  3NWS A;  2A6E D;  3MEH A;  4IUR A;  1M8A A;  4IFD H;  2JA5 B;  4C3I G;  5CV5 A;  1R4Q B;  2K5Q A;  1SNP A;  1TVX A;  4X3T A;  5FKA C;  4G7Z C;  1A15 A;  4A3B B;  5CV9 A;  1EU4 A;  1GUO A;  1NR4 A;  2XIW A;  3IFD A;  2QF7 A;  4B9X A;  2Z1C A;  1EWH A;  3W3A A;  1I4G A;  1OXV A;  5T1G A;  4XQQ A;  2PW7 A;  4H13 C;  5EKK A;  4IQZ A;  1HA5 A;  2I46 A;  3I73 A;  5T1I A;  2NZ1 D;  2IJ0 A;  1SNC A;  2SOB A;  3S1N B;  4A3J B;  3NBH A;  3O13 A;  1SE3 A;  3VR4 A;  1B1Z A;  4DXF A;  2MPM A;  4V19 0;  2B39 A;  4ZLT F;  1I4Q A;  4Q5V A;  3EQL C;  5EBC A;  4FNF A;  1FR3 A;  3M4Y A;  3PO2 B;  3HOU B;  3G6J B;  5AFW A;  2IX1 A;  2RSO A;  1TWA B;  4XT3 B;  2NVY B;  1S5D D;  3I4M B;  2KVM A;  5KNC A;  1OXS C;  3CRL C;  1VF7 A;  3VYR A;  4IN3 A;  4OGQ C;  1EY5 A;  2QCP X;  1B9N A;  2XWJ B;  2YYZ A;  1KDA A;  1TT2 A;  4C3H B;  1SJE D;  2MHV A;  2F0T A;  2OXP A;  3ND9 A;  1I50 B;  2J4X A;  1ZXT A;  3MHB A;  4KY6 A;  1Z47 A;  3NPP A;  3K57 A;  1HCZ A;  3P7J A;  1Q1B A;  1ZEQ X;  2IX0 A;  5G3L F;  3PMF A;  5KIX A;  1LT4 D;  4RH6 A;  2XN9 C;  5I9P A;  1WVL A;  1T5E A;  1EYA A;  2F0E A;  4BBR B;  3NSW A;  4DAP A;  4ME5 A;  4N9P A;  4A3K B;  1Y1W B;  3K59 A;  4RGM A;  3KBX A;  1Y8O B;  2AWO A;  2EY2 A;  2E2D C;  3ERO A;  1HQM C;  1GXD C;  1MD2 D;  3D31 A;  3R2T A;  2F1M A;  4TQU S;  1Q3L A;  1BCP F;  1H9M A;  2X6L A;  2B2W A;  4XDX A;  1BUV T;  3NTH A;  2Z8L A;  3OSO A;  2B2U C;  2K03 A;  2NTS A;  5TSS A;  5EPL A;  2KCN A;  2MGS A;  4IUT A;  1JOO A;  5FOB B;  1ET6 A;  3TDQ A;  4KMU C;  1D1K A;  1S4Z A;  2L0C A;  2L1B A;  4BA1 I;  3NTK A;  3KLS X;  1VMC A;  4B9W A;  1SMY C;  4ZUJ A;  3A56 A;  3FPU B;  2R7Z B;  1LO5 D;  4FF3 A;  1U4R A;  5EKL A;  4G7H C;  4WFN 3;  3M3Y B;  1E2V A;  1IW7 D;  1O80 A;  3NK9 A;  1CA5 A;  1LT6 D;  4DNT B;  2ZXR A;  1A2U A;  4DAV A;  3V96 A;  1CT1 D;  3AU7 A;  4BWG B;  3AMU A;  1OO9 B;  2B2Y A;  2F03 A;  3ITP A;  1V43 A;  2R93 B;  3C3L A;  1Q1E A;  1A2T A;  4H7B A;  4DXG A;  3EJI A;  1T5X D;  2R6G A;  5IGD A;  1HUM A;  2L9H A;  5JAV A;  2F3W A;  1B2T A;  1BXT A;  3C46 A;  3BDL A;  3DEP A;  1J9O A;  3DXJ C;  3Q0A A;  1WD0 A;  4XYQ A;  4A3I B;  3S1R B;  5ELE A;  4U68 A;  2H1E A;  3RUZ A;  1V1P A;  5DEH A;  1SSO A;  4IZ8 A;  1SNO A;  1CZG A;  1AW7 A;  4ZUI A;  1Y1V B;  4MN3 A;  4HCS A;  2NVX B;  2KEE A;  4LJZ C;  2NN6 I;  3S2H B;  2KQ3 A;  1SMY D;  1ZKO A;  4C1N I;  1TS3 A;  3NE5 B;  1PZJ D;  4HAE A;  1QIL A;  2N88 A;  1PTO C;  2C9O A;  3H6M A;  4DN4 M;  3PO3 B;  3K0Y A;  1Q12 A;  3FKI B;  5JOB A;  1D5Z C;  4RKB A;  3S1Q B;  4RFB A;  4V0B A;  2K04 A;  2L11 A;  1XX8 A;  2JA8 B;  4IUV A;  4R9W A;  1BO0 A;  2JA6 B;  4EQO A;  3TP5 A;  2CVR A;  4OL7 A;  3GTM B;  3WOE A;  1IL8 A;  1F2Y A;  1EOT A;  2C5C A;  5CV6 A;  5D3I B;  1W6J A;  5IOD A;  4BY7 B;  1DXM A;  1AFP A;  2EZV A;  5I6W A;  1CTM A;  1X3P A;  3SE0 A;  2L12 A;  1RHP A;  1VDZ A;  5DNF A;  1SYD A;  1DJR D;  1Q8I A;  2MUY A;  4IFD I;  2MJ8 A;  1HFG A;  3Q22 A;  4KV6 A;  1UUP A;  4KHV A;  4HN7 A;  4EGV A;  1F9P A;  1TS4 A;  4FF1 A;  3J7Y W;  1PZK D;  1HQR D;  2DY7 A;  3FRP B;  4DA2 A;  4QUC A;  4JK1 C;  4FF4 A;  3I4N B;  3D4W A;  1PTO D;  5KRU A;  1L0Y B;  2VB2 X;  4OIJ A;  1F2M A;  4GZY C;  3I72 A;  3R3O A;  2K1B A;  2F0I A;  1C4Q A;  1CQF A;  4OO1 H;  2F0P A;  2DNC A;  5EGT A;  3QIA A;  5A2Q L;  2A6H C;  3HZX A;  5CC4 A;  3C1E A;  1K8O A;  3E5S A;  3KK7 A;  3K5N A;  1JB3 A;  1I3Q B;  4KI0 A;  3BVG A;  4KKS A;  4I65 A;  1AP0 A;  4IUP A;  1U4P A;  3DWP A;  1GUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...