5M3MG

Free monomeric rna polymerase i at 4.0a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
237
structure length
192
Chain Sequence
ARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
total genus 31
structure length 192
sequence length 237
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3mG02
4GOPB 4GLXA 3PF5A 3M7NA 4HJ9A 5IT9c 1MJCA 1YEZA 4AIMA 1XNRL 4L5RC 2JA5G 5FLMG 1X3GA 4DK3C 1N33Q 4BBSG 2R93G 4JOIC 2LXKA 4C3HH 4GS3A 3GD7A 1PH1A 1MJEA 2IX1A 1GVPA 2OWOA 3HOWG 3OTOL 2R7DA 3ULPA 1NBWA 4DR5Q 4JCVE 4HIMA 4A3GG 1K8GA 2OTLA 1IXRA 4DV0Q 4QL5A 2PQAB 3KF6B 3PUXA 4B3RL 1M90C 2CKZB 1QZGA 1ASZA 1CKOA 3GTOH 1YHAA 2AKWB 2B3GA 3D0FA 4OXPA 5J3BA 4JYAL 4HJ5A 3CCMA 3PF4A 3PV0A 3ER0A 4PZ8A 1X55A 4DV6L 2PMZE 4GNXC 4A93G 1EYGA 4JI5L 3IRBA 4C3IH 1K0RA 1KRTA 4X64L 1QVCA 1VQCA 4LUZA 4DV1L 2UUBQ 2UU9Q 3CF5A 1PYSB 2WAQG 4IPDA 4POFA 1B70B 2VQFL 3PSIA 3RN5A 4LUVA 1CSQA 5C0XG 1I94L 3HOXG 2Q2UA 5E7NA 1NTGA 2KHJA 1KIXA 5JJIA 4LFCQ 4KHPL 4UP9A 4HJAA 2ATWA 3S17H 1H95A 5FLXc 1E24A 1L1OA 3UE0A 1VQ8A 4DR2Q 2OTJA 1K73C 1JT8A 4B3SL 3I2ZA 1TWFH 5IWAQ 5LMNW 3PUWA 1QZHA 1HR0Q 3U4ZA 1N33L 1N32Q 4A3BG 2VL6A 3I7FA 4PZ6A 1G6PA 1MIUA 5M3MH 4P74A 1VS0A 1A62A 1E1TA 1L0WA 3AYHB 5HY6A 4A76A 2Q2TA 2JEAI 4A3LH 3CCEA 4JI4L 1Z47A 4JI0L 2CWAA 4R4OA 4IO9A 3I4OA 3CCLA 4C3JH 2ZJQA 1MKHA 1TXYA 4EQ5A 1X56A 3ICEA 4O0AA 2AHOB 4LFBQ 4LUOA 3S1RH 1X3FA 4DUZL 5GROA 4BY1H 3PIOA 4HIDA 1HNXL 2I5LX 1T9HA 2B63G 2Y0SG 2RHSB 2YU9H 3PO3G 1PYBA 4LF6L 5IE8A 1BBUA 2E5LL 3A5ZB 4IFDG 1EQQA 3J81i 1FL0A 1HJPA 3BU2A 1M1KC 1U5KA 3CC2A 2ZM6Q 1UE1A 2MO0A 1N34L 1K9MC 1YBYA 1SR3A 2UU9L 4GKJL 4LF8Q 3HOYH 5M5XH 1N36Q 3G48A 3K7UC 2GN5A 3MEFA 3PGZA 3ZJYC 4A3KH 4LF4L 4A3FH 2K50A 2A8VA 1UE5A 2JEBI 2VW9A 4J15A 1EWIA 4A3IH 4K0KL 2BA1A 3G6EA 3DLLA 4GNXB 3S1NH 2JJQA 3CMAA 4OWXB 4LFCL 1CKNB 2VQEL 1I6HH 2V1CC 1KXLA 1VQEA 3HOZG 2JA8G 2QA4A 4YCWA 3S1QH 1IBML 1WI5A 3B6YA 1EIFA 5IWAL 1K83H 1S40A 2NN6I 1ASYA 1N32L 4OO1I 2IT1A 2A19A 2MNAA 4NXNL 1R9TH 2IY5B 2UXBQ 1OXTA 4B3ML 4JI6Q 4JI1L 1Y1VH 2ES2A 1E7ZA 5AJ3Q 1OXUA 2YYZA 3CCUA 4AQYL 2E2IH 3LGJA 3T1HQ 5FJ8G 4JI8Q 4DKAC 1IYJB 1A8VA 3CC4A 4YHHQ 4A3DG 2RHQB 1UE6A 1XTDA 3F2CA 5M3FH 3CMEA 3K80C 3KJOA 1B7YB 1Y1WH 3WWVA 2L15A 4BBRH 4DNIA 3AQQA 3J81c 2HHHL 4BY7H 1J5EQ 1CSPA 4ALPA 2GVAA 3CAMA 1JB7A 4PG3A 2YV5A 3M4PA 2MFIA 3FKIH 3L2PA 3F2DA 4X65Q 1XMOQ 3K8AA 1JJGA 4HJ7A 3RZDH 4LFAQ 2I0QA 2DUDA 1L2FA 1VQAA 2KCTA 3HOUH 1WFQA 2IHFA 5M5YH 5C44H 1UEBA 3E0EA 2YTXA 2F3IA 2HIVA 1P16A 3RN2A 2E2JH 4NPSA 2JA7H 3STBD 1IBLL 4TVAB 2YTYA 1W3SA 3S2HH 4GN5A 3U4VA 2KENA 2K52A 3RLFA 1IL2A 4PZ7A 4X6AH 1YI2A 2JA6H 3S24A 4DV7Q 4JI7Q 1OTCA 1VQ5A 2UXBL 1UE7A 5LMUQ 2K14A 1EQRA 2BA0A 1VQBA 3W1GA 4L5QA 1VQ6A 1V1QA 3I4MH 1IZ6A 1E3PA 4A3CH 4DUYL 5DLQE 3I56A 4JI8L 2PNHA 2ZTCA 2NZOA 4DV3Q 2UUAQ 2WB1E 4IOCA 1VQ7A 3ERSX 1E22A 2VY3A 4DR4Q 2NVXH 5LMNQ 1FGUA 2DGYA 2JA9A 4O2DA 4MZ9A 4A75A 3TS2A 5IYDH 2RCNA 1Q12A 1I5FA 1KAWA 3KDFB 4NB3A 2F4VQ 2R93H 1SN8A 1VQGA 4YCVA 3J7A5 4DR6Q 2OQKA 2PI2E 1HNZQ 2KHIA 2ALYB 3CP0A 5JEAG 4P71A 2WP8J 1YJ9A 3OYYA 3EIVA 4YWLA 4DV2L 5GAEC 2EIFA 1VQNA 4LWCA 4X65L 1XMOL 3CD6A 1O7IA 1WCMH 2K5VA 3NBHB 2F52A 4KHZA 3KLWA 3G71A 4A3JH 4A3EH 1N9WA 3STBC 3D31A 4GN4B 4YCUA 2JQOA 1V9PA 4DR1Q 5GADC 1Q7YC 1QUQB 4BY1G 1VCIA 2VUMG 2NVYH 1L1OC 4DV4Q 5C0XJ 1XMQQ 4DR5L 5K36G 1X3EA 1HH2P 2K75A 5JEAJ 3I4NG 2AWNA 1Q46A 4GLVB 4DV5Q 4JI7L 1SRUA 4GLAC 4DV0L 4KI0A 2I5MX 3RLNA 3JC66 5LMUL 4DAYB 4POGA 2WFWA 4IPCA 2RF4A 4X62Q 1VQOA 1Q81C 3S15H 4A3KG 2K5HA 3KF8B 3L0OA 1X65A 4A3FG 5IP9G 2WB1G 4IPHA 4QY7A 4DR3Q 4YWKA 4A4IA 4R4QA 4A3IG 4QIWE 4DV3L 2UUAL 4R4TA 4LF7L 1X9NA 3GTLH 3UE1A 1PFSA 2IX0A 1YZ6A 1Q86C 2CQOA 2UUBL 4BXXH 4MNOA 2BH2A 3L7ZC 1JJCB 2D62A 2CWPA 1GKHA 2HQLA 2ZTEA 4UY8C 2NVQH 4DR7Q 1VQIA 1LUZA 3AFPA 4X66Q 4C2MH 2MO1A 4GOPA 3GTJH 4JBMA 2R7ZH 1XPOA 1PA6A 3H0GH 4A3BH 1OXXK 1C0AA 2FXQA 2EXDA 1HNZL 3K7AH 3J7ZC 3BZCA 3NENA 4HIOA 1VQLA 1XJVA 3BJUA 3PO2H 4DR2L 4IFDJ 3TEHB 1JMCA 3KJPA 3E9HA 1BVSA 2R7FA 5IYBH 1Y1VG 5H1SE 1YVCA 1HR0L 4AH6A 2D0PA 5C0XI 2ZTDA 5C4JH 4WJ3M 4ME3A 3ULJA 3BZKA 4B3TQ 4DR1L 3M3YH 1PH7A 1XPRA 1IBKQ 3PO3H 5JJLA 2PQAA 3KF6A 2A1AA 1XMQL 1YITA 1HZBA 5EAYA 2NVTH 5M3FG 2UXCQ 1I3QH 4RG1A 3F8TA 1OXSC 3J80i 4HJ8A 3U58A 2VNUD 3M85A 2VZAA 3RLOA 3I55A 4DV5L 1Y1WG 1SMXA 2AWOA 4BBRG 4LFBL 4BY7G 3KFUA 5C4XH 3A5UA 5IY0A 3CCVA 1PHJA 2QGQA 2R6GA 1QVFA 1QVGA 1L1OB 2K4KA 2VS1A 1NY4A 1VQDA 3FKIG 3VDYA 3CPWA 5C3EH 4DR3L 5IP7H 1NMGA 4FDBA 1KQSA 1Q8KA 1WOCA 1JJ2A 4BA1I 3CCSA 1TWGH 4APVA 2IHEA 2ZM6L 5IYCH 1YJNA 2E2HH 1B8AA 3Q8DA 4LF8L 1E1OA 3H3VI 5C44G 1YIJA 1HZ9A 1N36L 1A0IA 2JA7G 4DR7L 1J6QA 4X66L 3RZOH 1PH5A 4JBJA 1FJGQ 4KHPQ 2D0OA 4IFDI 3J81j 2ASBA 3TRZA 1WYDA 3NELA 2JA6G 3GDEA 4X64Q 1PVOA 4AYBE 1AE2A 4UPAA 1PH9A 1DGSA 2I5HA 1S72A 3S14H 3I4MG 1N8RC 4B3TL 1I94Q 1IBKL 3PIPA 4LNQA 4JI6L 3A74A 1VQJA 3HKZE 2R92G 3M4QA 4GN3B 2JK8A 5AJ3L 1LTLA 1AE3A 1Z9FA 5IYDG 3J80c 4HIKA 4B3SQ 1BKBA 4DPGA 3T1HL 4A3MH 4P73A 4P72A 2LSSA 5BR8Q 1HZAA 3CW2C 3PUZA 4IJHA 3PUYA 4YWMA 4YHHL 1A63A 1VQHA 2C35B 2K5NA 3JAMi 1VQ4A 4JC0A 1PH6A 3HOVH 2UXDQ 1HNWQ 2JE6I 2XGTA 4XIGS 4JI4Q 1WCMG 4JI0Q 1GO3E 2JA5H 5FLMH 2CFMA 3MXNB 3OW2A 1J5EL 4BBSH 3AFQA 3UDFA 4GNXA 4A3JG 4A3EG 1GM5A 4JI2Q 1G51A 2B29A 1EOVA 5M3MG 1EUJA 1CKNA 4DUZQ 2R92H 4QGUA 4OX9Q 3K0XA 1HNXQ 1Q1EA 2GVBA 2Q2IA 5M5WH 1FJGL 4LF6Q 3ULLA 2E5LQ 3HOWH 4A3LG 4P75A 2BH8A 2Y0SE 2CCZA 4QQBX 2Z0SA 3UDIA 4LFAL 4A3GH 3PCOB 4BA2I 4JG2A 4OONA 2ZJRA 4JI3Q 1N34Q 4AYBG 3GTGH 4GKJQ 1EIYB 3GTQH 3UDGA 3T1YQ 1D7QA 4DK6C 4XTCS 3CCJA 3F1ZA 4YY3Q 1KD1C 3W5OA 4LF4Q 2NN6G 1NE3A 3KOJA 1YHQA 4K0KQ 4OO1G 1C7YA 4UP8A 1VQMA 3AEVA 4LF5Q 4DV7L 4A93H 4GKKQ 5ELNA 3HKZG 4PMWA 3E9IA 3NEMA 2ZJPA 2KCMA 2VQEQ 4BXXG 1NJIC 3HOYG 4UP7A 3FHWA 1IBMQ 3S16H 4JBWA 1OXVA 4NXMQ 2AMCB 2R7ZG 3HOXH 5BR8L 1TWCH 3H0GG 4L5TA 3TS0A 1HZCA 4DR4L 1YNXA 3A0JA 4NXNQ 1VQKA 5ELOA 1YHBA 5LMNL 4LF9Q 4JV5Q 2N8NA 2UXDL 3JAMc 1HNWL 1SFOH 3HKSA 3PO2G 2XTIA 4B3MQ 1AH9A 3PUVA 4JI1Q 2HIXA 5GAGC 1PH3A 2F4VL 5IYBG 3W1BA 4R1JA 2EQSA 1LM0A 3SGIA 4DR6L 4AQYQ 3FP9A 4DAMA 5HGQA 1W2BA 4JI2L 2UUCQ 1SROA 1G291 1D8LA 3KYHC 4OWTB 1XNQQ 1EFWA 1HR0W 1VQ9A 4OX9L 2KBNA 1YJWA 3UDXA 4R4IA 2NZHA 4OWWB 1I50H 3I4NH 1PH4A 4GOPC 4WJ4A 1RIPA 2E8GA 4KLKA 2HHHQ 4JI3L 5C4XG 3H3VH 4IPGA 1SE8A 1S3OA 3T1YL 2B63H 5JJKA 3CC7A 2HT1A 1NMFA 3TQYA 4DV4L 2Q2HA 4YY3L 2YTVA 2N49A 5IP9H 1Q82C 3K81C 1KHIA 4LF7Q 5C3EG 1BBWA 3S1MH 5IP7G 3RNUA 4LF5L 1XPUA 1KRSA 1X54A 1UWVA 1XNRQ 4GKKL 3S2DH 4L5SA 1SLJA 4IOAA 1Y14B 1C9OA 2LXJA 5IYCG 4Y7NH 1VQPA 3CPFA 1KL9A 4X62L 1RL2A 2Z6KA 1GD7A 1CUKA 2ID0A 3CQZH 2N78A 4H02A 4QJFA 1IBLQ 4NXML 2H5XA 3OTOQ 3KDFA 1U0LA 3CCRA 1JE5A 4MTNA 3RR5A 1CKMA 3GTMH 2PI2A 3HFZB 3HOUG 4LF9L 3M4OH 4JV5L 2MQHA 3DM3A 1K3RA 4TQUS 2JA8H 1TWAH 3HOZH 4B3RQ 4Y52H 2Z6KC 3GTKH 1WJJA 1X6OA 2OCEA 1TWHH 1FVIA 1LYLA 4JBKA 3GTPH 4IJLA 4JYAQ 4DUYQ 2UUCL 1VQFA 1K8AC 1P8LA 1XNQL 4DV6Q 3EBEA 5GAHC 3F2BA 1KC8C 1QUQA 4JI5Q 3TREA 4DV1Q 1PH8A 3CXCA 3H15A 4EX5A 2VQFQ 2VUMH 3G4SA 1PV4A 2WAQE 5GQOA 5FJ8H 3CCQA 4LW1A 1Q1BA 3EN2A 4JOIA 3U50C 3M9BA 4A3MG 4A3CG 4A3DH 1V43A 4RMFA 2N3SA 2OQ0A 1PH2A 2QEXA 4DV2Q 4R4CA 3HOVG 2UXCL 3GO5A
chains in the Genus database with same CATH superfamily
2E76C 2LMCB 4GLXA 4HJ9A 5IT9c 4AIMA 3BZDB 4ZK9B 5FLMG 1N33Q 2NVQB 4JOIC 5C3XA 5IGFA 2LXKA 5G3LF 4A3BB 1E0BA 3C1FA 1AN8A 3NK9A 1MJEA 2R7DA 2F0KA 4X3TA 4TSSA 4JCVE 1I4QA 2AUJD 2OTLA 4B9XA 1EIHA 2XRQD 1W6JA 1YHAA 2RSNA 3D0FA 4OL7A 3MC0B 4JYAL 4HJ5A 3CCMA 2NBFA 3PV0A 1LO5D 2F0MA 2K5WA 1LTID 3S1MB 4A93G 1PDQA 1EYGA 1SNMA 4C3IH 1K0RA 1KRTA 2UU9Q 1VQCA 1S5BD 3CF5A 3BYTB 4POFA 1B70B 3RN5A 2PQEA 3C1EA 5C0XG 3U9SA 2ZXPA 3CQZB 3WOFA 5E7NA 1NTGA 1KIXA 1PZKD 3A8JE 4LFCQ 4KY7A 1LT6D 1L1OA 3TMEA 2OTJA 3M4OB 2F0JA 1K73C 1AW7A 2FMCA 1TWAB 1TWFH 3L3OC 5LMNW 1QZHA 2JA8B 1S4ZA 3NBIA 4CHTB 1G6PA 1MIUA 1PFBA 3CU7A 4P74A 1RHPA 4HCSA 4RHSA 1WTWA 1A62A 2K7VA 3AYHB 2WKCA 4A76A 4XYOA 1Z47A 1WTOA 2BCOA 2CWAA 4CJ2C 3I4OA 4IO9A 2KECA 2SNSA 4EQ5A 5JAVA 1PTOC 3SK8A 1HTPA 2E5LL 3MVVA 1MI2A 3A5ZB 3BVGA 1LTAD 1EQQA 2K32A 1XWEA 4KKSA 1B9MA 1UE1A 1ML0D 1PMRA 4GKJL 5M5XH 3G48A 1H9RA 2GN5A 2A8VA 1EL0A 1CK1A 4J15A 1EWIA 4B08A 3DLLA 4GNXB 1WTPA 2P5ZX 1X3QA 2VQEL 1TS5A 3MFGA 4ILWA 2L4NA 5CV4A 4KY5A 4KD4A 1WI5A 1F9RA 2KHSA 2E2DC 1R9TH 4ZRZA 5J22A 3VYRA 1OXTA 4EGVA 1Y1VH 1E7ZA 4IALA 4V0BA 5E3FA 1PRTC 4DAVA 2E2IH 1ZYRD 5FJ8G 5IGGA 1U4PA 1UE6A 1XTDA 4J1MA 1PTOF 1Y1WH 2L15A 4BBRH 2HHHL 1J5EQ 2A6HD 3N52A 2KCNA 2YV5A 4C3HG 3L2PA 4FF1A 5CBAE 3Q23A 1XMOQ 1HUNA 3K8AA 2PYKA 1L2FA 1KDBA 2B2YA 4UHVA 1TS4A 2E2JH 1NSNS 4HMIA 2YTYA 4CKEA 1ENAA 1CM9A 1NCVA 2KENA 4JK1C 2KOLA 3JAME 2JA6H 3S24A 1STNA 5FK9C 4DV7Q 4JI7Q 1OTCA 1VQ5A 4FXDA 2UXBL 5C4ZA 4U673 1EQRA 3R2TA 4L5QA 1V1QA 2XIWA 2PNHA 2NZOA 4DV3Q 3SVMA 4DR4Q 3ERSX 1E22A 4QUCA 1PZID 1FGUA 1PRTF 4MZ9A 4NKLA 2OT2A 4A75A 2B2VA 3QWNA 1IW7C 1KAWA 3KDFB 1C8CA 1SN8A 2EYLA 4DR6Q 2LFNA 1U9RA 2F0DA 1FNWA 4P71A 1O78A 3R93A 3OYYA 3VR4A 1GXDC 2EIFA 3NTKA 1A63A 2A6EC 4LWCA 5A35A 1WCMH 2K5VA 3NBHB 4I7ZC 3KLWA 5LL6X 4KJOA 3D31A 4GN4B 4YCUA 1S5DD 1TWHB 2RCFA 4DR1Q 1QUQB 2H1EA 4BY1G 2MPMA 1DOLA 1L1OC 2K75A 2AWNA 3K6OA 2RDFA 5LMUL 3RLNA 4DAYB 1A3VA 3NPPA 2WFWA 4IPCA 1VQOA 5IOCA 4A3KG 2NN6H 1H9SA 1PH8A 4A3IG 2X6GA 4QIWB 4A4IA 2UUAL 4R4TA 5A2QE 3UE1A 2IX0A 3W2DA 1Q86C 1HCZA 3RZDB 4BXXH 1DD2A 3NQTA 1JJCB 2D62A 3HRZC 2FINB 4UY8C 5M5YB 2NVQH 3AFPA 4CGYB 4A3BH 1XPOA 1PA6A 1OXXK 4I65A 3L9AX 1XTCD 2QCPX 1HNZL 4CJ0B 5IT9E 3QOJA 1SNOA 4UAIA 5COYA 2IL8A 4J8QA 1YVCA 5H1SE 5I9OA 3UI2A 4AH6A 4ME3A 4KJNA 3M3YH 2A69D 5I2YA 2EY5A 3CRKC 1K8MA 1LLRD 2BE5D 1I3QH 4RG1A 3U58A 3FDTA 2NWGA 4PMBA 2L0CA 3BDCA 3J80i 4DV5L 2AWOA 3A5UA 2Z6BA 5IY0A 3CCVA 4R8IA 4K5XA 4CJ1B 1NY4A 3DXJC 3FKIG 3VDYA 4DR3L 1BQQT 3BVZA 1WD0A 1KQSA 2WV6D 3T53B 1WTHA 2DJFC 3TZDA 4BA1I 1TWGH 4ZQ3A 1YJNA 1SYGA 2E74C 1CA5A 1SJED 4A3JB 4A3EB 5C44G 1HZ9A 3SE0A 1A0IA 2JA7G 2L55A 1PH5A 4JPBW 1TS2A 5FLXL 4IFDI 3TBIB 3J81j 2AQ3B 2ASBA 1KDAA 3D4DA 2F0FA 3NSWA 4HEDA 4C3JB 3GDEA 1AE2A 3EA6A 3I4MG 1EY9A 3S15B 3MA2B 4CDCC 2B2YC 1O7ZA 3HKZE 3W3AA 1A15A 1AE3A 1O80A 5IYDG 3J80c 1BKBA 3H6MA 5EPKA 4DPGA 4A3MH 3NP8A 3PUYA 4FO2A 1GUOA 1WTQA 1LT4D 2C35B 3NUCA 1PH6A 2UXDQ 4JC0A 3HOVH 2VB2X 2ICIA 4PNYA 4RA8A 1O7YA 2XGTA 5CYUA 4RGMA 1F2ZA 2JA5H 1J5EL 4XQNA 1K83B 4K2KA 4G7HC 2BDOA 2B29A 4DXGA 4RGNA 5M3MG 4KD3A 4QGUA 4OX9Q 3K0XA 3HOWH 4KHPL 4LF6Q 2B2VC 2Z0SA 2VB3X 2NVTB 3PCOB 1JQYD 4JG2A 4MTKA 1N34Q 2KVMA 4XDXA 4AYBG 1EIYB 2TMPA 1D7QA 4YY3Q 3W5OA 4TKOB 4OO1G 4PQXA 4UP8A 2KEDA 4DV7L 4KMUC 1MHWC 3MEHA 1NJIC 1H9KA 3C2PA 3HOYG 2Q8RE 4KTAA 1LTGD 1SMYC 2A74C 2LS01 1KNEA 3TS0A 4FF3A 1HZCA 4DR4L 1EWHA 1YNXA 4NXNQ 2N8NA 1HNWL 3HKSA 2XTIA 4B3MQ 1EY0A 1G2TA 2HIXA 5GAGC 5IYBG 4R1JA 3SGIA 4DR6L 3IKJA 4DAMA 5HGQA 2PZTA 5CV8A 1UEAB 1VQ9A 1YJWA 1TY0A 4R4IA 4DGZA 1QJOA 3TP6A 2A68C 2L1BA 3K0YA 5DNFA 4JI3L 2LKVA 4G57A 3FMCA 3J7AF 1MGSA 3H3VH 1LACA 3KK7A 1Q3LA 5JJKA 2HT1A 5J1ZA 2EYOA 4RGTA 3VR3A 2RDHA 4LF7Q 1JCKB 2Q8IB 1X54A 1UWVA 4GKKL 1SLJA 3G7LA 1Y14B 2LXJA 4WJWA 1VQPA 1EQVA 1RL2A 3M4YA 4QJFA 2N78A 1QWYA 2CW0C 1H9JA 1F9QA 1SDFA 4MTNA 1V8QA 2AUKA 2KEEA 3LNNA 3HOUG 4H44C 4JV5L 1BO0A 2MQHA 1K3RA 1EYCA 3HOZH 4L8JA 1S5FD 1EY7A 2EYHA 2Z4HA 3BVMA 1WJJA 4FF4A 3GTGB 3E0JA 1TWHH 1LYLA 4JYAQ 2NVYB 2J7ZA 1ESRA 1RCVD 1GUSA 2B2UA 1I4RA 1E2ZA 5NUCA 4A93B 3CXCA 3EVQA 3H15A 1EFID 5KIXA 3G4SA 3CCQA 1Q1BA 1DCZA 4JOIA 1MBYA 4A3DH 2N3SA 1VDZA 4DV2Q 3GTLB 5K5PA 2G5DA 4WRDA 3KF8A 3MXGA 5KYLA 5JVG3 1XNRL 1W6KA 3T4AC 4DK3C 1EY4A 2F4IA 5ISRA 1GVPA 2OWOA 3OTOL 3PO2B 4MIUA 2MJ8A 1HFNA 5CV6A 1STGA 4G7OC 3KF6B 3PUXA 3OMGA 1RKNA 5C4JB 2HCIA 5C4HA 1ASZA 2B3GA 5J3BA 2SDFA 4QB4A 1BXTA 1QNKA 3EROA 3C3LA 3ER0A 1X55A 2QKIC 1TVXA 2UUBQ 4DV1L 4EQOA 4LUZA 3S2DB 1PYSB 2WAQG 4IPDA 4Y7NB 1BCPC 2O2LD 3HOXG 2Z4IA 5C3EB 1MD2D 2KHJA 4Q5VA 5JJIA 4HJAA 2ATWA 5ELBA 3UE0A 1VQ8A 4DR2Q 4QMGA 4F7XA 1HR0Q 3U4ZA 2F3WA 3I7FA 3RZOB 4YIJA 4HSVA 1DZ1A 2L11A 2ICEC 4F8MA 1E1TA 1DONA 1L0WA 5HY6A 4A3LH 3CCLA 4C3JH 1TXYA 2DNEA 2PW5A 3FEWX 3ICEA 5EKKA 2XWJB 1X3FA 2VUMH 3PIOA 3E3XA 1T9HA 2B63G 2RHSB 1PYBA 4LF6L 1BBUA 1SNCA 3J81i 1HJPA 1M1KC 1U5KA 4RCOA 1N34L 3VR2A 4JW0A 1IYUA 5DAUA 3K7UC 2G9HD 4JVZA 4C3HB 4A3FH 1B50A 2JEBI 2VW9A 3VA5A 1E2VA 2BA1A 2HD3A 3CMAA 1A3TA 1I6HH 2V1CC 3J80E 1VQEA 4FF2A 1BCPF 2QA4A 4YCWA 2FFKB 4OGQC 3B6YA 5IWAL 1EIFA 1K83H 1BF4A 1ASYA 1N32L 3GTOB 2F0PA 2IT1A 1G8ZD 2MNAA 4NXNL 3TSSA 4A3GB 2UXBQ 4B3ML 4C56C 4ME5A 5AJ3Q 1OXUA 4EQPA 3CCUA 1JC7A 1QCBD 3I72A 4LAAA 4DKAC 1A8VA 3GV3A 3MFYA 3DM1A 3F2CA 5EKLA 4MHEA 5M3FH 3BDLA 3K80C 2HDMA 3S17B 1ZXTA 2KCCA 3WWVA 4DNIA 3J81c 3D8GA 4BY7H 1HXYD 1PTOB 1CSPA 1I4HA 2B2UC 3PIO3 5BN5A 3M4PA 3P1HA 1EQTA 3F2DA 4ULLA 4H13C 2SNMA 3SHLA 2I0QA 2KCTA 3MAQA 3WDNA 3DUZA 3BG3A 2EDGA 3E0EA 5BN3A 1FR3A 1P16A 1TU2B 3STBD 1B9NA 4TVAB 2CHBD 4BY1B 3SDZA 3S2HH 2RQXA 4ZUJA 2O4XA 2K52A 3RLFA 2Z9HA 4PZ7A 1YI2A 1BBXC 5C3WA 2HCCA 5LMUQ 2BA0A 1VQBA 3W1GA 4C3IG 3KBGA 5JJZA 2XNAC 1E3PA 4EVOA 4A3KB 3I56A 4F87A 4KV6A 2ZTCA 2UUAQ 2WB1E 4IUQA 5BN4A 1VQ7A 5LMNQ 1PRTB 1BUVT 2RCNA 1I5FA 3S1QB 2OQKA 2PI2E 1HNZQ 5JEAG 1Y8PB 2WP8J 1YJ9A 3OIPA 3EIVA 4DV2L 2M2LA 2EJFC 3CD6A 1KDCA 3DWAA 5HGTA 5GADC 1Q7YC 1O7LA 2NVYH 1TQOA 1SNQA 5K36G 4DV5Q 4GLAC 2NYZD 3JC66 3BS1A 2K03A 4X62Q 3WOEA 4FXGC 3FKIB 1STEA 4QY7A 4DR3Q 4YWKA 4QIWE 3GTLH 1PFSA 5EBDA 3QJYA 1A3UA 2UUBL 2A73B 4ZCKA 2ZTEA 5C44B 2HQEA 3R3OA 4GOPA 4C2MH 2R7ZH 4JBMA 3GTJH 4I7AA 2JA7B 3H0GH 3K7AH 4KN4C 1VQLA 1NR4A 4Z9CB 4HAEA 3BJUA 1XJVA 3PO2H 2M00A 4DR2L 4IFDJ 1ILQA 3TEHB 1UUPA 1BVSA 4NW2A 1Y1VG 1BNZA 1HR0L 5C0XI 2ZTDA 5C4JH 4WJ3M 5C6AA 3I4MB 1JWSD 1D5MC 2PQAA 2A1AA 1XMQL 1C4QA 1HZBA 3HP3A 2NVXB 3OWEB 4O1NA 4ABNA 3I3CA 3OW7A 1Y1WG 4BBRG 3KFUA 5C4XH 1QVGA 1L1OB 2IJ0A 3K5OA 5C3EH 1H9MA 2XN9C 1Q8KA 2M9VA 1CI3M 4APVA 2IHEA 3VR6A 1G91A 1YIJA 5KNDA 3Q6SA 5M3MB 4DR7L 3RZOH 1EIGA 1VF7A 4KHPQ 3TZUA 1AFPA 2PNRC 1RD9D 3NELA 2JA6G 5EPLA 1DJRD 1B4OA 1BDOA 2C9OA 3RUZA 4E6IA 3S1RB 1XXGA 4UPAA 4DK0A 1DGSA 1PH9A 2KA7A 2YU9B 2GA4B 2X6LA 1F2MA 1I94Q 4ID6A 1M8AA 4BS9A 1EOTA 3A74A 1M4VA 5IGCA 4O42A 2R92G 4GN3B 5AJ3L 2JK8A 1PZJD 4HIKA 1AZPA 4B3SQ 3HOYB 1GOZA 3ONAB 5KNCA 5IGEA 2LSSA 2WB1B 3CW2C 2SOBA 2HDLA 4IJHA 4YWMA 1B44D 3DWQA 1T5EA 2K04A 1T5XD 3S1NB 1HNWQ 4XIGS 3HS0C 1DYQA 4JI4Q 1WCMG 5LHY1 2I46A 4BWGB 4BBSH 1JOQA 2EYPA 1GM5A 1G51A 3VR5A 1EUJA 1CKNA 1SYFA 2GVBA 1FJGL 4QQBX 3HG9A 1HPCA 3ERQA 3TN2A 2CH4W 4A3GH 4H7BA 4BA2I 2J0TD 3HEJA 1EZ6A 2EY1A 3T13A 4JI3Q 2MP1A 4NMZA 1ICWA 3UDGA 4XTCS 5FO7B 1I6VC 3F1ZA 1KD1C 1YNNC 2NN6G 4ZLTF 2PZWA 1D2BA 4S3SA 5G3LD 4GKKQ 4PMWA 1YNJC 3E9IA 3NEMA 2KCMA 4BXXG 2EOTA 2E2HB 2EY6A 4FVMA 1IBMQ 3R8BA 1WTRA 3O13A 4IQZA 4GZYC 2EYJA 5BR8L 1TWCH 4L5TA 3KLSA 2F0WA 3A0JA 5LMNL 1YHBA 2PO4A 4JV5Q 3HOUB 3J81E 3I4LA 3OPOA 3W1BA 2EQSA 2A5HA 4JI2L 1SROA 1G291 4OWTB 4RKLA 5CV5A 4ZKCB 2N88A 4CDFC 2KBNA 2SEBD 3UDXA 4M8AA 2EPBA 4OWWB 1HUMA 4C1NI 1RTNA 2NB0A 4GOPC 2K5QA 5D3DA 1RIPA 3R2IA 2XWBB 5I9PA 2IWHA 2L9HA 4K14A 4IPGA 1HRJA 3CC7A 4N9PA 3SK6A 3K81C 3LWUA 4K8JA 4X3UA 4IFDH 3S1MH 4LF5L 2RDGA 1ICFB 1KRSA 1XNRQ 4L5SA 4RH6A 4X62L 1CZGA 1CUKA 3CQZH 2D2CC 4H02A 2H5XA 3OTOQ 1JORA 3RD4A 5T1GA 4LF9L 3M4OH 3DM3A 1SYDA 2JA8H 1TWAH 4Y52H 2WACA 2Z6KC 1EU3A 2K05A 4X3KA 3Q0AA 2OCEA 2F0VA 4IJLA 1P8LA 1XNQL 3EBEA 5IODA 3TREA 4DV1Q 1B3QA 4DNRB 1H9SB 3NWTA 3K57A 4A3CG 3S16B 3EN2A 2TSSA 3M9BA 4A3MG 4RMFA 3HOXB 2QEXA 1FD7D 3K59A 3HOVG 5JOBA 3M7NA 3PF5A 1MJCA 1YEZA 3T56B 4L5RC 2JA5G 2R93G 1GUNA 1PH1A 3HOWG 3ULPA 1NBWA 3SK5A 1I50B 1IXRA 4QL5A 2OXPA 2CKZB 1QZGA 3OHXC 1WVLA 4HCEA 1PTOD 3FRPB 2B63B 4DV6L 4PZ8A 2PMZB 1VMPA 2LY7A 3RMHA 2B2TA 4JI5L 3IRBA 1QVCA 1TKWB 4LUVA 3D3RA 1I94L 2Q2UA 1OO9B 4UP9A 5FLXc 3GTMB 1E24A 1JT8A 4B3SL 4M1UB 3I2ZA 5IWAQ 3PUWA 2JP1A 3GTKB 1N32Q 4PZ6A 5M3MH 3GTPB 1VS0A 3TP7A 3E5SA 2F03A 1SBBB 4JI4L 4R4OA 1MKHA 1X56A 4LFBQ 1L0YB 4O0AA 3MXPA 4LUOA 3S1RH 1PRTD 4ZYSA 5GROA 2JYOA 4HIDA 2I5LX 3PO3G 2Y0SG 2MHVA 2YU9H 1LV9A 5I6YA 1I4XA 1RF2D 1SYCA 2ENBA 3CC2A 1LT3D 2MO0A 3OOCA 1K9MC 1K0SA 1YBYA 1SR3A 2B2WA 2N55A 4LF8Q 3HOYH 4L63B 1N36Q 3BYYB 3PGZA 3ZJYC 5CV7A 1Q8IA 2K50A 1UE5A 3GV6A 2QDBA 3G6EA 3S1NH 4OWXB 1V1PA 1KXLA 4DF7A 3HOZG 3MTSA 3FPUB 1IBML 2K1BA 1BCPB 4OO1I 1TY2A 2A19A 3MXNA 3I73A 3V2TA 5M5WB 2IY5B 3LX0A 3N6RA 3D6CA 2ES2A 1X32A 2RA4A 3LGJA 1D6EC 3X3NA 1K8OA 1IYJB 3ND9A 1LTSD 1ZKOA 3G6JB 4YHHQ 4A3DG 3VYTA 2RHQB 3CMEA 3KJOA 4QCLA 4XYQA 3AQQA 2NTTA 3A7AB 1TWFB 2RKSA 2GVAA 1JB7A 1F9SA 1IW7D 2MFIA 1JJGA 1SFOB 3RZDH 3HOUH 1VQAA 2EJGC 2A6ED 1WFQA 1I4PA 2IHFA 5M5YH 1NUCA 4CKCA 1UEBA 4ZKBB 2YTXA 2HIVA 2F0HA 3JAML 3PQIA 1ENCA 1ZEQX 1IL2A 1SAPA 1QG7A 4HMJA 2K14A 3AB9A 2O5JC 4K5VA 1ZYRC 3D4RA 1Z7TA 4U68A 1PXUA 4QF4A 5KRUA 1XYIA 3IAYA 1VQ6A 5M5XB 5DLQE 4IUNA 4JI8L 2CVRA 4EQNA 2JA9A 2A6HC 1ENFA 1STAA 4NB3A 2VXWA 4YCVA 1GHJA 2KHIA 2ALYB 4K6DA 2B2TC 1R9TB 4X65L 2EXZA 1SYEA 4HR7B 2F52A 4KHZA 4R8NA 3IFDA 1LTBD 3X3MA 3Q24A 4A3JH 4A3EH 3FPPA 4C3JG 4N8FA 1B3AA 5EBCA 2E2IB 2VUMG 1VCIA 2PZUA 2F0EA 5HURA 5FO9B 4DV4Q 1IHZA 5C0XJ 1XMQQ 1EY6A 1HH2P 3I4NG 5JEAJ 3H94A 1KTKA 1SRUA 1Y1WB 4KI0A 2I5MX 4BBRB 4LJZC 2F0NA 5FO8B 3S15H 2B39A 2K5DA 3L0OA 1PFNA 3KF8B 1X65A 1Y8NB 4A3FG 5IP9G 5A2QL 2F0LA 3T16A 4R4QA 5F2DA 4WORA 1X9NA 4HTHA 2CQOA 4FYDA 4MNOA 4DR7Q 1VQIA 5I2XA 1LUZA 2MO1A 2E2JB 1HQRD 3NE5B 1RJTA 2EXDA 2X69A 3BZCA 5I4DA 4HIOA 1SNPA 1CT1D 2B2WC 2CQAA 2JA6B 4FNFA 1JMCA 3E9HA 3QR8A 2R3ZA 5FKAC 2PCFB 3BZKA 2F0SA 1PH7A 1XPRA 5JJLA 1WD1A 4N9TA 5EAYA 2NVTH 3KUPA 2C5CA 1CFMA 5M3FG 2UXCQ 2VNUD 1OXSC 2QF7A 2R92B 2QEJC 2HUGA 1Y8OB 2VZAA 3RLOA 3I55A 1SMXA 4LFBL 4BY7G 1PFMA 2K4KA 1VQDA 4OIKA 1CQFA 5IP7H 1JICA 4FDBA 1L0XB 1NMGA 3K5LA 1JJ2A 1RTOA 5D14A 1WCMB 3CCSA 2EVBA 5IYCH 4DN4M 4LF8L 1E1OA 1N36L 5DEHA 1II3A 4X66L 4JBJA 1FJGQ 2D0OA 4XQQA 5FLXE 4J6HA 1VMCA 4X64Q 1PVOA 1HQMC 3I91A 4AYBE 1I4GA 2I5HA 2A69C 1S72A 1ONLA 1N8RC 2WKDA 4B3TL 2BE5C 1IBKL 4LNQA 1VQJA 3M4QA 1AP0A 1IYVA 2IPKD 5BR8Q 1HZAA 3PUZA 2EJMA 1HTLD 4A3IB 4YHHL 1SMYD 1KAAA 2RBMA 3EQLC 1DOMA 1HFGA 3NHHA 2JE6I 4JI0Q 1GO3E 1TS3A 5FLMH 4L6TB 3AFQA 3UDFA 4GNXA 4JI2Q 1EY5A 4DUZQ 2ZT9C 1HNXQ 1Q1EA 3M3YB 5M5WH 4P75A 2BH8A 2Y0SE 3I8ZA 1R4PB 3UDIA 1B2TA 1I3QB 2F0IA 3T51B 2PPBC 5CC4A 1JR0D 3GTGH 5DM73 1FGBD 2A68D 4DK6C 1ET9A 2K28A 3SEBA 4LF4Q 4K0KQ 5CR3A 1C7YA 5EKIA 1VQMA 3AEVA 4LF5Q 4C1NK 3ZYYX 4A93H 1MSGA 3HKZG 1Y69U 1TWGB 1E2WA 1LTTD 4UP7A 3FHWA 1OXVA 1EU4A 5C0XH 2AMCB 2R7ZG 3H0GG 5JEAH 2K33A 1VQKA 1SXTA 2CW0D 4LF9Q 2ZXOA 1SFOH 3PO2G 5KYIA 5FOBB 4JI1Q 1PH3A 1LM0A 1J8IA 4AQYQ 4KKUA 4H0LC 1D8LA 2H4OA 1XNQQ 1EFWA 4RAUC 4P2CB 5K36H 1JE4A 5ELFA 4WJ4A 3P7JA 2E8GA 4FXKC 2QDLA 2XVSA 5C4XG 1SE8A 1S3OA 1ET6A 3T1YL 4A3MB 1GJXA 1K3BC 1NMFA 4DV4L 2Q2HA 3DWPA 2YTVA 2N49A 1Q82C 1KLGD 1JOKA 5CMDA 1KHIA 5C3EG 3HOVB 1BBWA 4K2LA 3RNUA 2O5IC 3S2DH 3I70A 2R93B 4Y7NH 2JA5B 3CPFA 2Z6KA 4KY6A 4MN3A 5E1FA 3QO2A 1S5CD 3D4WA 1IBLQ 2R61A 4NXML 5CGKA 1TR5A 1IKLA 3KDFA 1U0LA 3HOWB 3CCRA 1JE5A 2PI2A 3HFZB 3P75A 4TQUS 1HA6A 1CTMA 1UNSA 1X6OA 4K5WA 4KN7C 3NBHA 4JBKA 4DUYQ 2UUCL 4DV6Q 5GAHC 3F2BA 5JPNC 1KC8C 1QUQA 4JI5Q 2CH4A 4AYBB 4EX5A 1SE2A 2WAQE 5FJ8H 4LW1A 4PV1C 3U50C 1V43A 1PLFA 2MUYA 1BCPD 4DAYA 1FNUA 4R4CA 5C5MA 2UXCL 3GO5A 3HGBA 4RGOS 4GOPB 2BOSA 4Q0FA 5CBEE 4HN7A 1BR9A 1X3GA 3K5NA 4BBSG 1ILPA 5IGBA 4C3HH 3C46A 4GS3A 1LABA 3GD7A 2IX1A 1U4RA 4DR5Q 3GP7A 5C5LA 4HIMA 2NZ1D 4A3GG 1K8GA 4DXFA 1GUWA 4DV0Q 2PQAB 4B3RL 1M90C 1PYWD 4OEMB 1CKOA 3GTOH 2F0GA 1GUGA 2AKWB 4RCNA 3PO3B 2Y0SB 4OXPA 4DK1A 3PF4A 1B53A 5EGTA 2PMZE 4GNXC 1CQVA 5ELCA 3DMUA 4LMQD 2R92H 4X64L 1EYDA 4XXEA 4DFAA 2VQFL 3PSIA 4HSPA 3CKIB 1CSQA 2F0QA 3NXWA 1H95A 3S17H 5KGUA 3E6ZX 1NAPA 2XRSD 4KHVA 1U4MA 1A2TA 1PTOH 3HOZB 4IURA 1N33L 4A3BG 2B8FA 2VL6A 1A2UA 4IZ8A 1STHA 2Q2TA 2JEAI 3OIQA 3CCEA 1SEBD 4N8X1 4JI0L 3IFTA 1LT5D 3OSOA 2ZJQA 1NR2A 2K6AA 2AHOB 3S14B 5TSSA 4DUZL 5EQ0A 4BY1H 1HNXL 4A3DB 2F3VA 5IE8A 2Q8TA 4XQJA 4IFDG 1FL0A 2RSOA 3BU2A 3VYUA 3TP8A 2ZM6Q 1FNVA 2UU9L 1EEID 4PMCA 3MEFA 4A3KH 4KK7A 4LF4L 3BDOA 4K0KL 4A3IH 2JJQA 3J80L 4LFCL 1CKNB 3ND8A 2JA8G 3LWEA 3S1QH 4IUTA 1S40A 2NN6I 3H3VC 3EFXD 3J7YW 4V190 2F0OA 2AQ2B 1AZQA 4JI6Q 4CBVA 3MXUA 4JI1L 1NNXA 2YYZA 2KQ3A 3GTQB 4AQYL 1JWMD 5LL6S 5JVH3 3D6WA 3T1HQ 4JI8Q 4XT1B 4LK1C 3CC4A 1CA6A 3K5MA 4NDXA 1B7YB 2JSOA 2WAQB 2L12A 2Z1CA 1C48A 4ALPA 1G2SA 3CAMA 5D65A 4PG3A 1SNDA 3J7AV 3FKIH 2QILA 4X65Q 2NTSA 2OF1A 4HJ7A 4LFAQ 1U4LA 2DUDA 4DNTB 1QILA 3VA7A 5C44H 2EY2A 4ODGA 1ESFA 2F3IA 2JA7H 3RN2A 4NPSA 3KBXA 1D1IA 1IBLL 2VUMB 1W3SA 3IL8A 4GN5A 3U4VA 1D5XC 4X6AH 3I4NB 1IL8A 3NWSA 4NP5A 1FYCA 1UE7A 1EEFD 1Q90A 3I4MH 3MWYW 1IZ6A 4A3CH 4DUYL 2MGSA 4OHJA 4A3FB 4IOCA 2VY3A 2NVXH 2DGYA 3A56A 4O2DA 3TS2A 5IYDH 1I6HB 1Q12A 4X3SA 2F4VQ 4XT3B 2R93H 3J7A5 1VQGA 2G9DA 4DU9A 2FJ2A 3CP0A 4CDDC 5IGDA 4YWLA 5E4XA 2K01A 5GAEC 1VQNA 1XMOL 4R9WA 1O7IA 2L5TA 2D5DA 4OIJA 3G71A 1WTVA 1N9WA 3STBC 2JQOA 1V9PA 3QB3A 2J4XA 2WINB 2XSCA 1BOSA 1D1KA 4DR5L 1X3EA 1VF5C 2EZVA 5T1IA 5M3FB 1HA5A 1Q46A 1DM0B 4GLVB 3URYA 4JI7L 2PW7A 3TP5A 4DV0L 4BY7B 4CDEC 4POGA 1Q81C 2RF4A 2K5HA 3P20A 4OO1H 2WB1G 4IPHA 4DV3L 1JB3A 1YZ6A 2KUMA 1J9OA 2BH2A 3L7ZC 2CWPA 1GKHA 2HQLA 1STYA 4X66Q 2BDNA 5EPJA 3K58A 1C0AA 1F2LA 2FXQA 3A54A 3S2HB 3J7ZC 3NENA 3H09A 5J39A 5AFWA 3KJPA 3A8KE 5ELDA 2R7FA 5IYBH 4RWSC 1G6ZA 2D0PA 4KKTA 3ULJA 4DA2A 5CV9A 4B3TQ 4DR1L 1A6XA 3PO3H 1IBKQ 2FMMA 3KF6A 1TT2A 1QOHA 1YITA 4IUVA 1CZWA 4HJ8A 3F8TA 4C3IB 3M85A 3Q22A 1AEXA 1PHJA 2QGQA 2R6GA 1QVFA 2AQ1B 2VS1A 5M9OA 3CPWA 3AMUA 2F1MA 1WOCA 4ZUIA 3U9OA 2ZM6L 2E2HH 1B8AA 3Q8DA 1Z6HA 4CKBA 1EY8A 3H3VI 1J6QA 1K28A 4G7ZC 1EZ8A 2F0UA 3A7LA 3TRZA 1WYDA 3A55A 3KLRA 2FHTA 3S14H 1TIID 1EYAA 1D5ZC 2DY8A 5L37A 2OEOA 1SSOA 1YNND 2DNCA 3PIPA 1DOKA 1S5ED 2D9UA 4JI6L 1DXMA 3HKZB 3V96A 2I07B 2DJGC 1LTLA 1Z9FA 1YNJD 1F2YA 1XX8A 3T1HL 3KLSX 3EJIA 4P72A 4P73A 4UDUC 3HZXA 4C2MB 2IX3A 3GTJB 2R7ZB 1KLUD 3H0GB 1V1PB 1VQHA 2K5NA 1F9PA 3JAMi 3K7AB 1VQ4A 1STBA 1R4QB 3GQBA 1EWCA 2DN8A 2CFMA 3MXNB 3OW2A 5IIFA 4A3JG 1QB5D 4A3EG 1X3PA 1MSHA 1HHVA 1EOVA 5D3IB 3AU7A 2Z8LA 4WFN3 2Q2IA 3ULLA 2E5LQ 4A3LG 1GUTA 2CCZA 4OELB 3QOLA 1UAPA 3PMFA 2NUCA 2JN4A 4IN3A 1KABA 4LFAL 1SE4A 1Y1VB 4OONA 2ZJRA 2E75C 4GKJQ 4G4KA 3GTQH 3T1YQ 5C4XB 3M7GA 3CCJA 2B8GA 1NE3A 3KOJA 1YHQA 4FP5D 1V1OA 3DEPA 5ELNA 2ZJPA 1F77A 2VQEQ 3S16H 4JBWA 2V4DA 2DY7A 4NXMQ 1SYBA 3HOXH 4F88A 5JPMC 5CORA 3OMCA 4B9WA 3PIP3 5ELOA 3J81L 2UXDL 3JAMc 2QW7A 2JXMB 4DAPA 1AH9A 5ELEA 3PUVA 1B1ZA 4IUUA 2F4VL 3ITPA 1JOOA 3FP9A 3QIAA 4IUPA 1W2BA 3OWFA 2UUCQ 3KYHC 5IT9L 1QNUA 1HR0W 4OX9L 4TRDA 2NZHA 1I50H 4K6LA 5KEEA 3I4NH 1PH4A 4QUFA 5EJWA 4KLKA 2HHHQ 1JWUD 1RDPD 3SXHA 3VYSA 2B63H 3TQYA 4YY3L 5IP9H 3SR1A 1QE6A 3NQIA 3CRLC 5IP7G 5KNBA 1XPUA 4IOAA 1C9OA 5IYCG 4BBSB 1KL9A 2F0TA 3MHBA 1GD7A 1KNAA 2ID0A 2WIIB 3FVQA 2ZXRA 4RKBA 3MZ5A 3RR5A 1CKMA 3SK4A 3GTMH 3DEOA 4ZAIA 4K8IA 3S9WA 4B3RQ 4RHRA 3GTKH 3A8IE 3I90A 1SJHD 2EYMA 3DHQA 1RODA 1FVIA 3GTPH 1VQFA 1K8AC 1CHQD 3NTHA 3H91A 4RFBA 2EYFA 3CHBD 5I6WA 3F2UA 1IKMA 2KJXA 1GHKA 3TDQA 1SE3A 2VQFQ 1WTXA 5DM63 5E4WC 1PV4A 5GQOA 1CHPD 3QG1A 2RVLA 3V05A 2OQ0A 2EE1A 1PH2A 1TWCB 2IW3A 3NTIA 1LTRD 4LF7L
chains in the Genus database with same CATH topology
4GOPB 4GLXA 3PF5A 3M7NA 4HJ9A 5IT9c 1MJCA 1YEZA 4AIMA 1XNRL 4L5RC 2JA5G 5FLMG 1X3GA 4DK3C 1N33Q 4BBSG 2R93G 4JOIC 2LXKA 4C3HH 4GS3A 3GD7A 1PH1A 1MJEA 2IX1A 1GVPA 2OWOA 3HOWG 3OTOL 2R7DA 3ULPA 1NBWA 4DR5Q 4JCVE 4HIMA 4A3GG 1K8GA 2OTLA 1IXRA 4DV0Q 4QL5A 2PQAB 3KF6B 3PUXA 4B3RL 1M90C 2CKZB 1QZGA 1ASZA 1CKOA 3GTOH 1YHAA 2AKWB 2B3GA 3D0FA 4OXPA 5J3BA 4JYAL 4HJ5A 3CCMA 3PF4A 3PV0A 3ER0A 4PZ8A 1X55A 4DV6L 2PMZE 4GNXC 4A93G 1EYGA 4JI5L 3IRBA 4C3IH 1K0RA 1KRTA 4X64L 1QVCA 1VQCA 4LUZA 4DV1L 2UUBQ 2UU9Q 3CF5A 1PYSB 2WAQG 4IPDA 4POFA 1B70B 2VQFL 3PSIA 3RN5A 4LUVA 1CSQA 5C0XG 1I94L 3HOXG 2Q2UA 5E7NA 1NTGA 2KHJA 1KIXA 5JJIA 4LFCQ 4KHPL 4UP9A 4HJAA 2ATWA 3S17H 1H95A 5FLXc 1E24A 1L1OA 3UE0A 1VQ8A 4DR2Q 2OTJA 1K73C 1JT8A 4B3SL 3I2ZA 1TWFH 5IWAQ 5LMNW 3PUWA 1QZHA 1HR0Q 3U4ZA 1N33L 1N32Q 4A3BG 2VL6A 3I7FA 4PZ6A 1G6PA 1MIUA 5M3MH 4P74A 1VS0A 1A62A 1E1TA 1L0WA 3AYHB 5HY6A 4A76A 2Q2TA 2JEAI 4A3LH 3CCEA 4JI4L 1Z47A 4JI0L 2CWAA 4R4OA 4IO9A 3I4OA 3CCLA 4C3JH 2ZJQA 1MKHA 1TXYA 4EQ5A 1X56A 3ICEA 4O0AA 2AHOB 4LFBQ 4LUOA 3S1RH 1X3FA 4DUZL 5GROA 4BY1H 3PIOA 4HIDA 1HNXL 2I5LX 1T9HA 2B63G 2Y0SG 2RHSB 2YU9H 3PO3G 1PYBA 4LF6L 5IE8A 1BBUA 2E5LL 3A5ZB 4IFDG 1EQQA 3J81i 1FL0A 1HJPA 3BU2A 1M1KC 1U5KA 3CC2A 2ZM6Q 1UE1A 2MO0A 1N34L 1K9MC 1YBYA 1SR3A 2UU9L 4GKJL 4LF8Q 3HOYH 5M5XH 1N36Q 3G48A 3K7UC 2GN5A 3MEFA 3PGZA 3ZJYC 4A3KH 4LF4L 4A3FH 2K50A 2A8VA 1UE5A 2JEBI 2VW9A 4J15A 1EWIA 4A3IH 4K0KL 2BA1A 3G6EA 3DLLA 4GNXB 3S1NH 2JJQA 3CMAA 4OWXB 4LFCL 1CKNB 2VQEL 1I6HH 2V1CC 1KXLA 1VQEA 3HOZG 2JA8G 2QA4A 4YCWA 3S1QH 1IBML 1WI5A 3B6YA 1EIFA 5IWAL 1K83H 1S40A 2NN6I 1ASYA 1N32L 4OO1I 2IT1A 2A19A 2MNAA 4NXNL 1R9TH 2IY5B 2UXBQ 1OXTA 4B3ML 4JI6Q 4JI1L 1Y1VH 2ES2A 1E7ZA 5AJ3Q 1OXUA 2YYZA 3CCUA 4AQYL 2E2IH 3LGJA 3T1HQ 5FJ8G 4JI8Q 4DKAC 1IYJB 1A8VA 3CC4A 4YHHQ 4A3DG 2RHQB 1UE6A 1XTDA 3F2CA 5M3FH 3CMEA 3K80C 3KJOA 1B7YB 1Y1WH 3WWVA 2L15A 4BBRH 4DNIA 3AQQA 3J81c 2HHHL 4BY7H 1J5EQ 1CSPA 4ALPA 2GVAA 3CAMA 1JB7A 4PG3A 2YV5A 3M4PA 2MFIA 3FKIH 3L2PA 3F2DA 4X65Q 1XMOQ 3K8AA 1JJGA 4HJ7A 3RZDH 4LFAQ 2I0QA 2DUDA 1L2FA 1VQAA 2KCTA 3HOUH 1WFQA 2IHFA 5M5YH 5C44H 1UEBA 3E0EA 2YTXA 2F3IA 2HIVA 1P16A 3RN2A 2E2JH 4NPSA 2JA7H 3STBD 1IBLL 4TVAB 2YTYA 1W3SA 3S2HH 4GN5A 3U4VA 2KENA 2K52A 3RLFA 1IL2A 4PZ7A 4X6AH 1YI2A 2JA6H 3S24A 4DV7Q 4JI7Q 1OTCA 1VQ5A 2UXBL 1UE7A 5LMUQ 2K14A 1EQRA 2BA0A 1VQBA 3W1GA 4L5QA 1VQ6A 1V1QA 3I4MH 1IZ6A 1E3PA 4A3CH 4DUYL 5DLQE 3I56A 4JI8L 2PNHA 2ZTCA 2NZOA 4DV3Q 2UUAQ 2WB1E 4IOCA 1VQ7A 3ERSX 1E22A 2VY3A 4DR4Q 2NVXH 5LMNQ 1FGUA 2DGYA 2JA9A 4O2DA 4MZ9A 4A75A 3TS2A 5IYDH 2RCNA 1Q12A 1I5FA 1KAWA 3KDFB 4NB3A 2F4VQ 2R93H 1SN8A 1VQGA 4YCVA 3J7A5 4DR6Q 2OQKA 2PI2E 1HNZQ 2KHIA 2ALYB 3CP0A 5JEAG 4P71A 2WP8J 1YJ9A 3OYYA 3EIVA 4YWLA 4DV2L 5GAEC 2EIFA 1VQNA 4LWCA 4X65L 1XMOL 3CD6A 1O7IA 1WCMH 2K5VA 3NBHB 2F52A 4KHZA 3KLWA 3G71A 4A3JH 4A3EH 1N9WA 3STBC 3D31A 4GN4B 4YCUA 2JQOA 1V9PA 4DR1Q 5GADC 1Q7YC 1QUQB 4BY1G 1VCIA 2VUMG 2NVYH 1L1OC 4DV4Q 5C0XJ 1XMQQ 4DR5L 5K36G 1X3EA 1HH2P 2K75A 5JEAJ 3I4NG 2AWNA 1Q46A 4GLVB 4DV5Q 4JI7L 1SRUA 4GLAC 4DV0L 4KI0A 2I5MX 3RLNA 3JC66 5LMUL 4DAYB 4POGA 2WFWA 4IPCA 2RF4A 4X62Q 1VQOA 1Q81C 3S15H 4A3KG 2K5HA 3KF8B 3L0OA 1X65A 4A3FG 5IP9G 2WB1G 4IPHA 4QY7A 4DR3Q 4YWKA 4A4IA 4R4QA 4A3IG 4QIWE 4DV3L 2UUAL 4R4TA 4LF7L 1X9NA 3GTLH 3UE1A 1PFSA 2IX0A 1YZ6A 1Q86C 2CQOA 2UUBL 4BXXH 4MNOA 2BH2A 3L7ZC 1JJCB 2D62A 2CWPA 1GKHA 2HQLA 2ZTEA 4UY8C 2NVQH 4DR7Q 1VQIA 1LUZA 3AFPA 4X66Q 4C2MH 2MO1A 4GOPA 3GTJH 4JBMA 2R7ZH 1XPOA 1PA6A 3H0GH 4A3BH 1OXXK 1C0AA 2FXQA 2EXDA 1HNZL 3K7AH 3J7ZC 3BZCA 3NENA 4HIOA 1VQLA 1XJVA 3BJUA 3PO2H 4DR2L 4IFDJ 3TEHB 1JMCA 3KJPA 3E9HA 1BVSA 2R7FA 5IYBH 1Y1VG 5H1SE 1YVCA 1HR0L 4AH6A 2D0PA 5C0XI 2ZTDA 5C4JH 4WJ3M 4ME3A 3ULJA 3BZKA 4B3TQ 4DR1L 3M3YH 1PH7A 1XPRA 1IBKQ 3PO3H 5JJLA 2PQAA 3KF6A 2A1AA 1XMQL 1YITA 1HZBA 5EAYA 2NVTH 5M3FG 2UXCQ 1I3QH 4RG1A 3F8TA 1OXSC 3J80i 4HJ8A 3U58A 2VNUD 3M85A 2VZAA 3RLOA 3I55A 4DV5L 1Y1WG 1SMXA 2AWOA 4BBRG 4LFBL 4BY7G 3KFUA 5C4XH 3A5UA 5IY0A 3CCVA 1PHJA 2QGQA 2R6GA 1QVFA 1QVGA 1L1OB 2K4KA 2VS1A 1NY4A 1VQDA 3FKIG 3VDYA 3CPWA 5C3EH 4DR3L 5IP7H 1NMGA 4FDBA 1KQSA 1Q8KA 1WOCA 1JJ2A 4BA1I 3CCSA 1TWGH 4APVA 2IHEA 2ZM6L 5IYCH 1YJNA 2E2HH 1B8AA 3Q8DA 4LF8L 1E1OA 3H3VI 5C44G 1YIJA 1HZ9A 1N36L 1A0IA 2JA7G 4DR7L 1J6QA 4X66L 3RZOH 1PH5A 4JBJA 1FJGQ 4KHPQ 2D0OA 4IFDI 3J81j 2ASBA 3TRZA 1WYDA 3NELA 2JA6G 3GDEA 4X64Q 1PVOA 4AYBE 1AE2A 4UPAA 1PH9A 1DGSA 2I5HA 1S72A 3S14H 3I4MG 1N8RC 4B3TL 1I94Q 1IBKL 3PIPA 4LNQA 4JI6L 3A74A 1VQJA 3HKZE 2R92G 3M4QA 4GN3B 2JK8A 5AJ3L 1LTLA 1AE3A 1Z9FA 5IYDG 3J80c 4HIKA 4B3SQ 1BKBA 4DPGA 3T1HL 4A3MH 4P73A 4P72A 2LSSA 5BR8Q 1HZAA 3CW2C 3PUZA 4IJHA 3PUYA 4YWMA 4YHHL 1A63A 1VQHA 2C35B 2K5NA 3JAMi 1VQ4A 4JC0A 1PH6A 3HOVH 2UXDQ 1HNWQ 2JE6I 2XGTA 4XIGS 4JI4Q 1WCMG 4JI0Q 1GO3E 2JA5H 5FLMH 2CFMA 3MXNB 3OW2A 1J5EL 4BBSH 3AFQA 3UDFA 4GNXA 4A3JG 4A3EG 1GM5A 4JI2Q 1G51A 2B29A 1EOVA 5M3MG 1EUJA 1CKNA 4DUZQ 2R92H 4QGUA 4OX9Q 3K0XA 1HNXQ 1Q1EA 2GVBA 2Q2IA 5M5WH 1FJGL 4LF6Q 3ULLA 2E5LQ 3HOWH 4A3LG 4P75A 2BH8A 2Y0SE 2CCZA 4QQBX 2Z0SA 3UDIA 4LFAL 4A3GH 3PCOB 4BA2I 4JG2A 4OONA 2ZJRA 4JI3Q 1N34Q 4AYBG 3GTGH 4GKJQ 1EIYB 3GTQH 3UDGA 3T1YQ 1D7QA 4DK6C 4XTCS 3CCJA 3F1ZA 4YY3Q 1KD1C 3W5OA 4LF4Q 2NN6G 1NE3A 3KOJA 1YHQA 4K0KQ 4OO1G 1C7YA 4UP8A 1VQMA 3AEVA 4LF5Q 4DV7L 4A93H 4GKKQ 5ELNA 3HKZG 4PMWA 3E9IA 3NEMA 2ZJPA 2KCMA 2VQEQ 4BXXG 1NJIC 3HOYG 4UP7A 3FHWA 1IBMQ 3S16H 4JBWA 1OXVA 4NXMQ 2AMCB 2R7ZG 3HOXH 5BR8L 1TWCH 3H0GG 4L5TA 3TS0A 1HZCA 4DR4L 1YNXA 3A0JA 4NXNQ 1VQKA 5ELOA 1YHBA 5LMNL 4LF9Q 4JV5Q 2N8NA 2UXDL 3JAMc 1HNWL 1SFOH 3HKSA 3PO2G 2XTIA 4B3MQ 1AH9A 3PUVA 4JI1Q 2HIXA 5GAGC 1PH3A 2F4VL 5IYBG 3W1BA 4R1JA 2EQSA 1LM0A 3SGIA 4DR6L 4AQYQ 3FP9A 4DAMA 5HGQA 1W2BA 4JI2L 2UUCQ 1SROA 1G291 1D8LA 3KYHC 4OWTB 1XNQQ 1EFWA 1HR0W 1VQ9A 4OX9L 2KBNA 1YJWA 3UDXA 4R4IA 2NZHA 4OWWB 1I50H 3I4NH 1PH4A 4GOPC 4WJ4A 1RIPA 2E8GA 4KLKA 2HHHQ 4JI3L 5C4XG 3H3VH 4IPGA 1SE8A 1S3OA 3T1YL 2B63H 5JJKA 3CC7A 2HT1A 1NMFA 3TQYA 4DV4L 2Q2HA 4YY3L 2YTVA 2N49A 5IP9H 1Q82C 3K81C 1KHIA 4LF7Q 5C3EG 1BBWA 3S1MH 5IP7G 3RNUA 4LF5L 1XPUA 1KRSA 1X54A 1UWVA 1XNRQ 4GKKL 3S2DH 4L5SA 1SLJA 4IOAA 1Y14B 1C9OA 2LXJA 5IYCG 4Y7NH 1VQPA 3CPFA 1KL9A 4X62L 1RL2A 2Z6KA 1GD7A 1CUKA 2ID0A 3CQZH 2N78A 4H02A 4QJFA 1IBLQ 4NXML 2H5XA 3OTOQ 3KDFA 1U0LA 3CCRA 1JE5A 4MTNA 3RR5A 1CKMA 3GTMH 2PI2A 3HFZB 3HOUG 4LF9L 3M4OH 4JV5L 2MQHA 3DM3A 1K3RA 4TQUS 2JA8H 1TWAH 3HOZH 4B3RQ 4Y52H 2Z6KC 3GTKH 1WJJA 1X6OA 2OCEA 1TWHH 1FVIA 1LYLA 4JBKA 3GTPH 4IJLA 4JYAQ 4DUYQ 2UUCL 1VQFA 1K8AC 1P8LA 1XNQL 4DV6Q 3EBEA 5GAHC 3F2BA 1KC8C 1QUQA 4JI5Q 3TREA 4DV1Q 1PH8A 3CXCA 3H15A 4EX5A 2VQFQ 2VUMH 3G4SA 1PV4A 2WAQE 5GQOA 5FJ8H 3CCQA 4LW1A 1Q1BA 3EN2A 4JOIA 3U50C 3M9BA 4A3MG 4A3CG 4A3DH 1V43A 4RMFA 2N3SA 2OQ0A 1PH2A 2QEXA 4DV2Q 4R4CA 3HOVG 2UXCL 3GO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOP B;  4GLX A;  3PF5 A;  3M7N A;  4HJ9 A;  5IT9 c;  1MJC A;  1YEZ A;  4AIM A;  1XNR L;  4L5R C;  2JA5 G;  5FLM G;  1X3G A;  4DK3 C;  1N33 Q;  4BBS G;  2R93 G;  4JOI C;  2LXK A;  4C3H H;  4GS3 A;  3GD7 A;  1PH1 A;  1MJE A;  2IX1 A;  1GVP A;  2OWO A;  3HOW G;  3OTO L;  2R7D A;  3ULP A;  1NBW A;  4DR5 Q;  4JCV E;  4HIM A;  4A3G G;  1K8G A;  2OTL A;  1IXR A;  4DV0 Q;  4QL5 A;  2PQA B;  3KF6 B;  3PUX A;  4B3R L;  1M90 C;  2CKZ B;  1QZG A;  1ASZ A;  1CKO A;  3GTO H;  1YHA A;  2AKW B;  2B3G A;  3D0F A;  4OXP A;  5J3B A;  4JYA L;  4HJ5 A;  3CCM A;  3PF4 A;  3PV0 A;  3ER0 A;  4PZ8 A;  1X55 A;  4DV6 L;  2PMZ E;  4GNX C;  4A93 G;  1EYG A;  4JI5 L;  3IRB A;  4C3I H;  1K0R A;  1KRT A;  4X64 L;  1QVC A;  1VQC A;  4LUZ A;  4DV1 L;  2UUB Q;  2UU9 Q;  3CF5 A;  1PYS B;  2WAQ G;  4IPD A;  4POF A;  1B70 B;  2VQF L;  3PSI A;  3RN5 A;  4LUV A;  1CSQ A;  5C0X G;  1I94 L;  3HOX G;  2Q2U A;  5E7N A;  1NTG A;  2KHJ A;  1KIX A;  5JJI A;  4LFC Q;  4KHP L;  4UP9 A;  4HJA A;  2ATW A;  3S17 H;  1H95 A;  5FLX c;  1E24 A;  1L1O A;  3UE0 A;  1VQ8 A;  4DR2 Q;  2OTJ A;  1K73 C;  1JT8 A;  4B3S L;  3I2Z A;  1TWF H;  5IWA Q;  5LMN W;  3PUW A;  1QZH A;  1HR0 Q;  3U4Z A;  1N33 L;  1N32 Q;  4A3B G;  2VL6 A;  3I7F A;  4PZ6 A;  1G6P A;  1MIU A;  5M3M H;  4P74 A;  1VS0 A;  1A62 A;  1E1T A;  1L0W A;  3AYH B;  5HY6 A;  4A76 A;  2Q2T A;  2JEA I;  4A3L H;  3CCE A;  4JI4 L;  1Z47 A;  4JI0 L;  2CWA A;  4R4O A;  4IO9 A;  3I4O A;  3CCL A;  4C3J H;  2ZJQ A;  1MKH A;  1TXY A;  4EQ5 A;  1X56 A;  3ICE A;  4O0A A;  2AHO B;  4LFB Q;  4LUO A;  3S1R H;  1X3F A;  4DUZ L;  5GRO A;  4BY1 H;  3PIO A;  4HID A;  1HNX L;  2I5L X;  1T9H A;  2B63 G;  2Y0S G;  2RHS B;  2YU9 H;  3PO3 G;  1PYB A;  4LF6 L;  5IE8 A;  1BBU A;  2E5L L;  3A5Z B;  4IFD G;  1EQQ A;  3J81 i;  1FL0 A;  1HJP A;  3BU2 A;  1M1K C;  1U5K A;  3CC2 A;  2ZM6 Q;  1UE1 A;  2MO0 A;  1N34 L;  1K9M C;  1YBY A;  1SR3 A;  2UU9 L;  4GKJ L;  4LF8 Q;  3HOY H;  5M5X H;  1N36 Q;  3G48 A;  3K7U C;  2GN5 A;  3MEF A;  3PGZ A;  3ZJY C;  4A3K H;  4LF4 L;  4A3F H;  2K50 A;  2A8V A;  1UE5 A;  2JEB I;  2VW9 A;  4J15 A;  1EWI A;  4A3I H;  4K0K L;  2BA1 A;  3G6E A;  3DLL A;  4GNX B;  3S1N H;  2JJQ A;  3CMA A;  4OWX B;  4LFC L;  1CKN B;  2VQE L;  1I6H H;  2V1C C;  1KXL A;  1VQE A;  3HOZ G;  2JA8 G;  2QA4 A;  4YCW A;  3S1Q H;  1IBM L;  1WI5 A;  3B6Y A;  1EIF A;  5IWA L;  1K83 H;  1S40 A;  2NN6 I;  1ASY A;  1N32 L;  4OO1 I;  2IT1 A;  2A19 A;  2MNA A;  4NXN L;  1R9T H;  2IY5 B;  2UXB Q;  1OXT A;  4B3M L;  4JI6 Q;  4JI1 L;  1Y1V H;  2ES2 A;  1E7Z A;  5AJ3 Q;  1OXU A;  2YYZ A;  3CCU A;  4AQY L;  2E2I H;  3LGJ A;  3T1H Q;  5FJ8 G;  4JI8 Q;  4DKA C;  1IYJ B;  1A8V A;  3CC4 A;  4YHH Q;  4A3D G;  2RHQ B;  1UE6 A;  1XTD A;  3F2C A;  5M3F H;  3CME A;  3K80 C;  3KJO A;  1B7Y B;  1Y1W H;  3WWV A;  2L15 A;  4BBR H;  4DNI A;  3AQQ A;  3J81 c;  2HHH L;  4BY7 H;  1J5E Q;  1CSP A;  4ALP A;  2GVA A;  3CAM A;  1JB7 A;  4PG3 A;  2YV5 A;  3M4P A;  2MFI A;  3FKI H;  3L2P A;  3F2D A;  4X65 Q;  1XMO Q;  3K8A A;  1JJG A;  4HJ7 A;  3RZD H;  4LFA Q;  2I0Q A;  2DUD A;  1L2F A;  1VQA A;  2KCT A;  3HOU H;  1WFQ A;  2IHF A;  5M5Y H;  5C44 H;  1UEB A;  3E0E A;  2YTX A;  2F3I A;  2HIV A;  1P16 A;  3RN2 A;  2E2J H;  4NPS A;  2JA7 H;  3STB D;  1IBL L;  4TVA B;  2YTY A;  1W3S A;  3S2H H;  4GN5 A;  3U4V A;  2KEN A;  2K52 A;  3RLF A;  1IL2 A;  4PZ7 A;  4X6A H;  1YI2 A;  2JA6 H;  3S24 A;  4DV7 Q;  4JI7 Q;  1OTC A;  1VQ5 A;  2UXB L;  1UE7 A;  5LMU Q;  2K14 A;  1EQR A;  2BA0 A;  1VQB A;  3W1G A;  4L5Q A;  1VQ6 A;  1V1Q A;  3I4M H;  1IZ6 A;  1E3P A;  4A3C H;  4DUY L;  5DLQ E;  3I56 A;  4JI8 L;  2PNH A;  2ZTC A;  2NZO A;  4DV3 Q;  2UUA Q;  2WB1 E;  4IOC A;  1VQ7 A;  3ERS X;  1E22 A;  2VY3 A;  4DR4 Q;  2NVX H;  5LMN Q;  1FGU A;  2DGY A;  2JA9 A;  4O2D A;  4MZ9 A;  4A75 A;  3TS2 A;  5IYD H;  2RCN A;  1Q12 A;  1I5F A;  1KAW A;  3KDF B;  4NB3 A;  2F4V Q;  2R93 H;  1SN8 A;  1VQG A;  4YCV A;  3J7A 5;  4DR6 Q;  2OQK A;  2PI2 E;  1HNZ Q;  2KHI A;  2ALY B;  3CP0 A;  5JEA G;  4P71 A;  2WP8 J;  1YJ9 A;  3OYY A;  3EIV A;  4YWL A;  4DV2 L;  5GAE C;  2EIF A;  1VQN A;  4LWC A;  4X65 L;  1XMO L;  3CD6 A;  1O7I A;  1WCM H;  2K5V A;  3NBH B;  2F52 A;  4KHZ A;  3KLW A;  3G71 A;  4A3J H;  4A3E H;  1N9W A;  3STB C;  3D31 A;  4GN4 B;  4YCU A;  2JQO A;  1V9P A;  4DR1 Q;  5GAD C;  1Q7Y C;  1QUQ B;  4BY1 G;  1VCI A;  2VUM G;  2NVY H;  1L1O C;  4DV4 Q;  5C0X J;  1XMQ Q;  4DR5 L;  5K36 G;  1X3E A;  1HH2 P;  2K75 A;  5JEA J;  3I4N G;  2AWN A;  1Q46 A;  4GLV B;  4DV5 Q;  4JI7 L;  1SRU A;  4GLA C;  4DV0 L;  4KI0 A;  2I5M X;  3RLN A;  3JC6 6;  5LMU L;  4DAY B;  4POG A;  2WFW A;  4IPC A;  2RF4 A;  4X62 Q;  1VQO A;  1Q81 C;  3S15 H;  4A3K G;  2K5H A;  3KF8 B;  3L0O A;  1X65 A;  4A3F G;  5IP9 G;  2WB1 G;  4IPH A;  4QY7 A;  4DR3 Q;  4YWK A;  4A4I A;  4R4Q A;  4A3I G;  4QIW E;  4DV3 L;  2UUA L;  4R4T A;  4LF7 L;  1X9N A;  3GTL H;  3UE1 A;  1PFS A;  2IX0 A;  1YZ6 A;  1Q86 C;  2CQO A;  2UUB L;  4BXX H;  4MNO A;  2BH2 A;  3L7Z C;  1JJC B;  2D62 A;  2CWP A;  1GKH A;  2HQL A;  2ZTE A;  4UY8 C;  2NVQ H;  4DR7 Q;  1VQI A;  1LUZ A;  3AFP A;  4X66 Q;  4C2M H;  2MO1 A;  4GOP A;  3GTJ H;  4JBM A;  2R7Z H;  1XPO A;  1PA6 A;  3H0G H;  4A3B H;  1OXX K;  1C0A A;  2FXQ A;  2EXD A;  1HNZ L;  3K7A H;  3J7Z C;  3BZC A;  3NEN A;  4HIO A;  1VQL A;  1XJV A;  3BJU A;  3PO2 H;  4DR2 L;  4IFD J;  3TEH B;  1JMC A;  3KJP A;  3E9H A;  1BVS A;  2R7F A;  5IYB H;  1Y1V G;  5H1S E;  1YVC A;  1HR0 L;  4AH6 A;  2D0P A;  5C0X I;  2ZTD A;  5C4J H;  4WJ3 M;  4ME3 A;  3ULJ A;  3BZK A;  4B3T Q;  4DR1 L;  3M3Y H;  1PH7 A;  1XPR A;  1IBK Q;  3PO3 H;  5JJL A;  2PQA A;  3KF6 A;  2A1A A;  1XMQ L;  1YIT A;  1HZB A;  5EAY A;  2NVT H;  5M3F G;  2UXC Q;  1I3Q H;  4RG1 A;  3F8T A;  1OXS C;  3J80 i;  4HJ8 A;  3U58 A;  2VNU D;  3M85 A;  2VZA A;  3RLO A;  3I55 A;  4DV5 L;  1Y1W G;  1SMX A;  2AWO A;  4BBR G;  4LFB L;  4BY7 G;  3KFU A;  5C4X H;  3A5U A;  5IY0 A;  3CCV A;  1PHJ A;  2QGQ A;  2R6G A;  1QVF A;  1QVG A;  1L1O B;  2K4K A;  2VS1 A;  1NY4 A;  1VQD A;  3FKI G;  3VDY A;  3CPW A;  5C3E H;  4DR3 L;  5IP7 H;  1NMG A;  4FDB A;  1KQS A;  1Q8K A;  1WOC A;  1JJ2 A;  4BA1 I;  3CCS A;  1TWG H;  4APV A;  2IHE A;  2ZM6 L;  5IYC H;  1YJN A;  2E2H H;  1B8A A;  3Q8D A;  4LF8 L;  1E1O A;  3H3V I;  5C44 G;  1YIJ A;  1HZ9 A;  1N36 L;  1A0I A;  2JA7 G;  4DR7 L;  1J6Q A;  4X66 L;  3RZO H;  1PH5 A;  4JBJ A;  1FJG Q;  4KHP Q;  2D0O A;  4IFD I;  3J81 j;  2ASB A;  3TRZ A;  1WYD A;  3NEL A;  2JA6 G;  3GDE A;  4X64 Q;  1PVO A;  4AYB E;  1AE2 A;  4UPA A;  1PH9 A;  1DGS A;  2I5H A;  1S72 A;  3S14 H;  3I4M G;  1N8R C;  4B3T L;  1I94 Q;  1IBK L;  3PIP A;  4LNQ A;  4JI6 L;  3A74 A;  1VQJ A;  3HKZ E;  2R92 G;  3M4Q A;  4GN3 B;  2JK8 A;  5AJ3 L;  1LTL A;  1AE3 A;  1Z9F A;  5IYD G;  3J80 c;  4HIK A;  4B3S Q;  1BKB A;  4DPG A;  3T1H L;  4A3M H;  4P73 A;  4P72 A;  2LSS A;  5BR8 Q;  1HZA A;  3CW2 C;  3PUZ A;  4IJH A;  3PUY A;  4YWM A;  4YHH L;  1A63 A;  1VQH A;  2C35 B;  2K5N A;  3JAM i;  1VQ4 A;  4JC0 A;  1PH6 A;  3HOV H;  2UXD Q;  1HNW Q;  2JE6 I;  2XGT A;  4XIG S;  4JI4 Q;  1WCM G;  4JI0 Q;  1GO3 E;  2JA5 H;  5FLM H;  2CFM A;  3MXN B;  3OW2 A;  1J5E L;  4BBS H;  3AFQ A;  3UDF A;  4GNX A;  4A3J G;  4A3E G;  1GM5 A;  4JI2 Q;  1G51 A;  2B29 A;  1EOV A;  5M3M G;  1EUJ A;  1CKN A;  4DUZ Q;  2R92 H;  4QGU A;  4OX9 Q;  3K0X A;  1HNX Q;  1Q1E A;  2GVB A;  2Q2I A;  5M5W H;  1FJG L;  4LF6 Q;  3ULL A;  2E5L Q;  3HOW H;  4A3L G;  4P75 A;  2BH8 A;  2Y0S E;  2CCZ A;  4QQB X;  2Z0S A;  3UDI A;  4LFA L;  4A3G H;  3PCO B;  4BA2 I;  4JG2 A;  4OON A;  2ZJR A;  4JI3 Q;  1N34 Q;  4AYB G;  3GTG H;  4GKJ Q;  1EIY B;  3GTQ H;  3UDG A;  3T1Y Q;  1D7Q A;  4DK6 C;  4XTC S;  3CCJ A;  3F1Z A;  4YY3 Q;  1KD1 C;  3W5O A;  4LF4 Q;  2NN6 G;  1NE3 A;  3KOJ A;  1YHQ A;  4K0K Q;  4OO1 G;  1C7Y A;  4UP8 A;  1VQM A;  3AEV A;  4LF5 Q;  4DV7 L;  4A93 H;  4GKK Q;  5ELN A;  3HKZ G;  4PMW A;  3E9I A;  3NEM A;  2ZJP A;  2KCM A;  2VQE Q;  4BXX G;  1NJI C;  3HOY G;  4UP7 A;  3FHW A;  1IBM Q;  3S16 H;  4JBW A;  1OXV A;  4NXM Q;  2AMC B;  2R7Z G;  3HOX H;  5BR8 L;  1TWC H;  3H0G G;  4L5T A;  3TS0 A;  1HZC A;  4DR4 L;  1YNX A;  3A0J A;  4NXN Q;  1VQK A;  5ELO A;  1YHB A;  5LMN L;  4LF9 Q;  4JV5 Q;  2N8N A;  2UXD L;  3JAM c;  1HNW L;  1SFO H;  3HKS A;  3PO2 G;  2XTI A;  4B3M Q;  1AH9 A;  3PUV A;  4JI1 Q;  2HIX A;  5GAG C;  1PH3 A;  2F4V L;  5IYB G;  3W1B A;  4R1J A;  2EQS A;  1LM0 A;  3SGI A;  4DR6 L;  4AQY Q;  3FP9 A;  4DAM A;  5HGQ A;  1W2B A;  4JI2 L;  2UUC Q;  1SRO A;  1G29 1;  1D8L A;  3KYH C;  4OWT B;  1XNQ Q;  1EFW A;  1HR0 W;  1VQ9 A;  4OX9 L;  2KBN A;  1YJW A;  3UDX A;  4R4I A;  2NZH A;  4OWW B;  1I50 H;  3I4N H;  1PH4 A;  4GOP C;  4WJ4 A;  1RIP A;  2E8G A;  4KLK A;  2HHH Q;  4JI3 L;  5C4X G;  3H3V H;  4IPG A;  1SE8 A;  1S3O A;  3T1Y L;  2B63 H;  5JJK A;  3CC7 A;  2HT1 A;  1NMF A;  3TQY A;  4DV4 L;  2Q2H A;  4YY3 L;  2YTV A;  2N49 A;  5IP9 H;  1Q82 C;  3K81 C;  1KHI A;  4LF7 Q;  5C3E G;  1BBW A;  3S1M H;  5IP7 G;  3RNU A;  4LF5 L;  1XPU A;  1KRS A;  1X54 A;  1UWV A;  1XNR Q;  4GKK L;  3S2D H;  4L5S A;  1SLJ A;  4IOA A;  1Y14 B;  1C9O A;  2LXJ A;  5IYC G;  4Y7N H;  1VQP A;  3CPF A;  1KL9 A;  4X62 L;  1RL2 A;  2Z6K A;  1GD7 A;  1CUK A;  2ID0 A;  3CQZ H;  2N78 A;  4H02 A;  4QJF A;  1IBL Q;  4NXM L;  2H5X A;  3OTO Q;  3KDF A;  1U0L A;  3CCR A;  1JE5 A;  4MTN A;  3RR5 A;  1CKM A;  3GTM H;  2PI2 A;  3HFZ B;  3HOU G;  4LF9 L;  3M4O H;  4JV5 L;  2MQH A;  3DM3 A;  1K3R A;  4TQU S;  2JA8 H;  1TWA H;  3HOZ H;  4B3R Q;  4Y52 H;  2Z6K C;  3GTK H;  1WJJ A;  1X6O A;  2OCE A;  1TWH H;  1FVI A;  1LYL A;  4JBK A;  3GTP H;  4IJL A;  4JYA Q;  4DUY Q;  2UUC L;  1VQF A;  1K8A C;  1P8L A;  1XNQ L;  4DV6 Q;  3EBE A;  5GAH C;  3F2B A;  1KC8 C;  1QUQ A;  4JI5 Q;  3TRE A;  4DV1 Q;  1PH8 A;  3CXC A;  3H15 A;  4EX5 A;  2VQF Q;  2VUM H;  3G4S A;  1PV4 A;  2WAQ E;  5GQO A;  5FJ8 H;  3CCQ A;  4LW1 A;  1Q1B A;  3EN2 A;  4JOI A;  3U50 C;  3M9B A;  4A3M G;  4A3C G;  4A3D H;  1V43 A;  4RMF A;  2N3S A;  2OQ0 A;  1PH2 A;  2QEX A;  4DV2 Q;  4R4C A;  3HOV G;  2UXC L;  3GO5 A; 
#chains in the Genus database with same CATH topology
 2E76 C;  2LMC B;  4GLX A;  4HJ9 A;  5IT9 c;  4AIM A;  3BZD B;  4ZK9 B;  5FLM G;  1N33 Q;  2NVQ B;  4JOI C;  5C3X A;  5IGF A;  2LXK A;  5G3L F;  4A3B B;  1E0B A;  3C1F A;  1AN8 A;  3NK9 A;  1MJE A;  2R7D A;  2F0K A;  4X3T A;  4TSS A;  4JCV E;  1I4Q A;  2AUJ D;  2OTL A;  4B9X A;  1EIH A;  2XRQ D;  1W6J A;  1YHA A;  2RSN A;  3D0F A;  4OL7 A;  3MC0 B;  4JYA L;  4HJ5 A;  3CCM A;  2NBF A;  3PV0 A;  1LO5 D;  2F0M A;  2K5W A;  1LTI D;  3S1M B;  4A93 G;  1PDQ A;  1EYG A;  1SNM A;  4C3I H;  1K0R A;  1KRT A;  2UU9 Q;  1VQC A;  1S5B D;  3CF5 A;  3BYT B;  4POF A;  1B70 B;  3RN5 A;  2PQE A;  3C1E A;  5C0X G;  3U9S A;  2ZXP A;  3CQZ B;  3WOF A;  5E7N A;  1NTG A;  1KIX A;  1PZK D;  3A8J E;  4LFC Q;  4KY7 A;  1LT6 D;  1L1O A;  3TME A;  2OTJ A;  3M4O B;  2F0J A;  1K73 C;  1AW7 A;  2FMC A;  1TWA B;  1TWF H;  3L3O C;  5LMN W;  1QZH A;  2JA8 B;  1S4Z A;  3NBI A;  4CHT B;  1G6P A;  1MIU A;  1PFB A;  3CU7 A;  4P74 A;  1RHP A;  4HCS A;  4RHS A;  1WTW A;  1A62 A;  2K7V A;  3AYH B;  2WKC A;  4A76 A;  4XYO A;  1Z47 A;  1WTO A;  2BCO A;  2CWA A;  4CJ2 C;  3I4O A;  4IO9 A;  2KEC A;  2SNS A;  4EQ5 A;  5JAV A;  1PTO C;  3SK8 A;  1HTP A;  2E5L L;  3MVV A;  1MI2 A;  3A5Z B;  3BVG A;  1LTA D;  1EQQ A;  2K32 A;  1XWE A;  4KKS A;  1B9M A;  1UE1 A;  1ML0 D;  1PMR A;  4GKJ L;  5M5X H;  3G48 A;  1H9R A;  2GN5 A;  2A8V A;  1EL0 A;  1CK1 A;  4J15 A;  1EWI A;  4B08 A;  3DLL A;  4GNX B;  1WTP A;  2P5Z X;  1X3Q A;  2VQE L;  1TS5 A;  3MFG A;  4ILW A;  2L4N A;  5CV4 A;  4KY5 A;  4KD4 A;  1WI5 A;  1F9R A;  2KHS A;  2E2D C;  1R9T H;  4ZRZ A;  5J22 A;  3VYR A;  1OXT A;  4EGV A;  1Y1V H;  1E7Z A;  4IAL A;  4V0B A;  5E3F A;  1PRT C;  4DAV A;  2E2I H;  1ZYR D;  5FJ8 G;  5IGG A;  1U4P A;  1UE6 A;  1XTD A;  4J1M A;  1PTO F;  1Y1W H;  2L15 A;  4BBR H;  2HHH L;  1J5E Q;  2A6H D;  3N52 A;  2KCN A;  2YV5 A;  4C3H G;  3L2P A;  4FF1 A;  5CBA E;  3Q23 A;  1XMO Q;  1HUN A;  3K8A A;  2PYK A;  1L2F A;  1KDB A;  2B2Y A;  4UHV A;  1TS4 A;  2E2J H;  1NSN S;  4HMI A;  2YTY A;  4CKE A;  1ENA A;  1CM9 A;  1NCV A;  2KEN A;  4JK1 C;  2KOL A;  3JAM E;  2JA6 H;  3S24 A;  1STN A;  5FK9 C;  4DV7 Q;  4JI7 Q;  1OTC A;  1VQ5 A;  4FXD A;  2UXB L;  5C4Z A;  4U67 3;  1EQR A;  3R2T A;  4L5Q A;  1V1Q A;  2XIW A;  2PNH A;  2NZO A;  4DV3 Q;  3SVM A;  4DR4 Q;  3ERS X;  1E22 A;  4QUC A;  1PZI D;  1FGU A;  1PRT F;  4MZ9 A;  4NKL A;  2OT2 A;  4A75 A;  2B2V A;  3QWN A;  1IW7 C;  1KAW A;  3KDF B;  1C8C A;  1SN8 A;  2EYL A;  4DR6 Q;  2LFN A;  1U9R A;  2F0D A;  1FNW A;  4P71 A;  1O78 A;  3R93 A;  3OYY A;  3VR4 A;  1GXD C;  2EIF A;  3NTK A;  1A63 A;  2A6E C;  4LWC A;  5A35 A;  1WCM H;  2K5V A;  3NBH B;  4I7Z C;  3KLW A;  5LL6 X;  4KJO A;  3D31 A;  4GN4 B;  4YCU A;  1S5D D;  1TWH B;  2RCF A;  4DR1 Q;  1QUQ B;  2H1E A;  4BY1 G;  2MPM A;  1DOL A;  1L1O C;  2K75 A;  2AWN A;  3K6O A;  2RDF A;  5LMU L;  3RLN A;  4DAY B;  1A3V A;  3NPP A;  2WFW A;  4IPC A;  1VQO A;  5IOC A;  4A3K G;  2NN6 H;  1H9S A;  1PH8 A;  4A3I G;  2X6G A;  4QIW B;  4A4I A;  2UUA L;  4R4T A;  5A2Q E;  3UE1 A;  2IX0 A;  3W2D A;  1Q86 C;  1HCZ A;  3RZD B;  4BXX H;  1DD2 A;  3NQT A;  1JJC B;  2D62 A;  3HRZ C;  2FIN B;  4UY8 C;  5M5Y B;  2NVQ H;  3AFP A;  4CGY B;  4A3B H;  1XPO A;  1PA6 A;  1OXX K;  4I65 A;  3L9A X;  1XTC D;  2QCP X;  1HNZ L;  4CJ0 B;  5IT9 E;  3QOJ A;  1SNO A;  4UAI A;  5COY A;  2IL8 A;  4J8Q A;  1YVC A;  5H1S E;  5I9O A;  3UI2 A;  4AH6 A;  4ME3 A;  4KJN A;  3M3Y H;  2A69 D;  5I2Y A;  2EY5 A;  3CRK C;  1K8M A;  1LLR D;  2BE5 D;  1I3Q H;  4RG1 A;  3U58 A;  3FDT A;  2NWG A;  4PMB A;  2L0C A;  3BDC A;  3J80 i;  4DV5 L;  2AWO A;  3A5U A;  2Z6B A;  5IY0 A;  3CCV A;  4R8I A;  4K5X A;  4CJ1 B;  1NY4 A;  3DXJ C;  3FKI G;  3VDY A;  4DR3 L;  1BQQ T;  3BVZ A;  1WD0 A;  1KQS A;  2WV6 D;  3T53 B;  1WTH A;  2DJF C;  3TZD A;  4BA1 I;  1TWG H;  4ZQ3 A;  1YJN A;  1SYG A;  2E74 C;  1CA5 A;  1SJE D;  4A3J B;  4A3E B;  5C44 G;  1HZ9 A;  3SE0 A;  1A0I A;  2JA7 G;  2L55 A;  1PH5 A;  4JPB W;  1TS2 A;  5FLX L;  4IFD I;  3TBI B;  3J81 j;  2AQ3 B;  2ASB A;  1KDA A;  3D4D A;  2F0F A;  3NSW A;  4HED A;  4C3J B;  3GDE A;  1AE2 A;  3EA6 A;  3I4M G;  1EY9 A;  3S15 B;  3MA2 B;  4CDC C;  2B2Y C;  1O7Z A;  3HKZ E;  3W3A A;  1A15 A;  1AE3 A;  1O80 A;  5IYD G;  3J80 c;  1BKB A;  3H6M A;  5EPK A;  4DPG A;  4A3M H;  3NP8 A;  3PUY A;  4FO2 A;  1GUO A;  1WTQ A;  1LT4 D;  2C35 B;  3NUC A;  1PH6 A;  2UXD Q;  4JC0 A;  3HOV H;  2VB2 X;  2ICI A;  4PNY A;  4RA8 A;  1O7Y A;  2XGT A;  5CYU A;  4RGM A;  1F2Z A;  2JA5 H;  1J5E L;  4XQN A;  1K83 B;  4K2K A;  4G7H C;  2BDO A;  2B29 A;  4DXG A;  4RGN A;  5M3M G;  4KD3 A;  4QGU A;  4OX9 Q;  3K0X A;  3HOW H;  4KHP L;  4LF6 Q;  2B2V C;  2Z0S A;  2VB3 X;  2NVT B;  3PCO B;  1JQY D;  4JG2 A;  4MTK A;  1N34 Q;  2KVM A;  4XDX A;  4AYB G;  1EIY B;  2TMP A;  1D7Q A;  4YY3 Q;  3W5O A;  4TKO B;  4OO1 G;  4PQX A;  4UP8 A;  2KED A;  4DV7 L;  4KMU C;  1MHW C;  3MEH A;  1NJI C;  1H9K A;  3C2P A;  3HOY G;  2Q8R E;  4KTA A;  1LTG D;  1SMY C;  2A74 C;  2LS0 1;  1KNE A;  3TS0 A;  4FF3 A;  1HZC A;  4DR4 L;  1EWH A;  1YNX A;  4NXN Q;  2N8N A;  1HNW L;  3HKS A;  2XTI A;  4B3M Q;  1EY0 A;  1G2T A;  2HIX A;  5GAG C;  5IYB G;  4R1J A;  3SGI A;  4DR6 L;  3IKJ A;  4DAM A;  5HGQ A;  2PZT A;  5CV8 A;  1UEA B;  1VQ9 A;  1YJW A;  1TY0 A;  4R4I A;  4DGZ A;  1QJO A;  3TP6 A;  2A68 C;  2L1B A;  3K0Y A;  5DNF A;  4JI3 L;  2LKV A;  4G57 A;  3FMC A;  3J7A F;  1MGS A;  3H3V H;  1LAC A;  3KK7 A;  1Q3L A;  5JJK A;  2HT1 A;  5J1Z A;  2EYO A;  4RGT A;  3VR3 A;  2RDH A;  4LF7 Q;  1JCK B;  2Q8I B;  1X54 A;  1UWV A;  4GKK L;  1SLJ A;  3G7L A;  1Y14 B;  2LXJ A;  4WJW A;  1VQP A;  1EQV A;  1RL2 A;  3M4Y A;  4QJF A;  2N78 A;  1QWY A;  2CW0 C;  1H9J A;  1F9Q A;  1SDF A;  4MTN A;  1V8Q A;  2AUK A;  2KEE A;  3LNN A;  3HOU G;  4H44 C;  4JV5 L;  1BO0 A;  2MQH A;  1K3R A;  1EYC A;  3HOZ H;  4L8J A;  1S5F D;  1EY7 A;  2EYH A;  2Z4H A;  3BVM A;  1WJJ A;  4FF4 A;  3GTG B;  3E0J A;  1TWH H;  1LYL A;  4JYA Q;  2NVY B;  2J7Z A;  1ESR A;  1RCV D;  1GUS A;  2B2U A;  1I4R A;  1E2Z A;  5NUC A;  4A93 B;  3CXC A;  3EVQ A;  3H15 A;  1EFI D;  5KIX A;  3G4S A;  3CCQ A;  1Q1B A;  1DCZ A;  4JOI A;  1MBY A;  4A3D H;  2N3S A;  1VDZ A;  4DV2 Q;  3GTL B;  5K5P A;  2G5D A;  4WRD A;  3KF8 A;  3MXG A;  5KYL A;  5JVG 3;  1XNR L;  1W6K A;  3T4A C;  4DK3 C;  1EY4 A;  2F4I A;  5ISR A;  1GVP A;  2OWO A;  3OTO L;  3PO2 B;  4MIU A;  2MJ8 A;  1HFN A;  5CV6 A;  1STG A;  4G7O C;  3KF6 B;  3PUX A;  3OMG A;  1RKN A;  5C4J B;  2HCI A;  5C4H A;  1ASZ A;  2B3G A;  5J3B A;  2SDF A;  4QB4 A;  1BXT A;  1QNK A;  3ERO A;  3C3L A;  3ER0 A;  1X55 A;  2QKI C;  1TVX A;  2UUB Q;  4DV1 L;  4EQO A;  4LUZ A;  3S2D B;  1PYS B;  2WAQ G;  4IPD A;  4Y7N B;  1BCP C;  2O2L D;  3HOX G;  2Z4I A;  5C3E B;  1MD2 D;  2KHJ A;  4Q5V A;  5JJI A;  4HJA A;  2ATW A;  5ELB A;  3UE0 A;  1VQ8 A;  4DR2 Q;  4QMG A;  4F7X A;  1HR0 Q;  3U4Z A;  2F3W A;  3I7F A;  3RZO B;  4YIJ A;  4HSV A;  1DZ1 A;  2L11 A;  2ICE C;  4F8M A;  1E1T A;  1DON A;  1L0W A;  5HY6 A;  4A3L H;  3CCL A;  4C3J H;  1TXY A;  2DNE A;  2PW5 A;  3FEW X;  3ICE A;  5EKK A;  2XWJ B;  1X3F A;  2VUM H;  3PIO A;  3E3X A;  1T9H A;  2B63 G;  2RHS B;  1PYB A;  4LF6 L;  1BBU A;  1SNC A;  3J81 i;  1HJP A;  1M1K C;  1U5K A;  4RCO A;  1N34 L;  3VR2 A;  4JW0 A;  1IYU A;  5DAU A;  3K7U C;  2G9H D;  4JVZ A;  4C3H B;  4A3F H;  1B50 A;  2JEB I;  2VW9 A;  3VA5 A;  1E2V A;  2BA1 A;  2HD3 A;  3CMA A;  1A3T A;  1I6H H;  2V1C C;  3J80 E;  1VQE A;  4FF2 A;  1BCP F;  2QA4 A;  4YCW A;  2FFK B;  4OGQ C;  3B6Y A;  5IWA L;  1EIF A;  1K83 H;  1BF4 A;  1ASY A;  1N32 L;  3GTO B;  2F0P A;  2IT1 A;  1G8Z D;  2MNA A;  4NXN L;  3TSS A;  4A3G B;  2UXB Q;  4B3M L;  4C56 C;  4ME5 A;  5AJ3 Q;  1OXU A;  4EQP A;  3CCU A;  1JC7 A;  1QCB D;  3I72 A;  4LAA A;  4DKA C;  1A8V A;  3GV3 A;  3MFY A;  3DM1 A;  3F2C A;  5EKL A;  4MHE A;  5M3F H;  3BDL A;  3K80 C;  2HDM A;  3S17 B;  1ZXT A;  2KCC A;  3WWV A;  4DNI A;  3J81 c;  3D8G A;  4BY7 H;  1HXY D;  1PTO B;  1CSP A;  1I4H A;  2B2U C;  3PIO 3;  5BN5 A;  3M4P A;  3P1H A;  1EQT A;  3F2D A;  4ULL A;  4H13 C;  2SNM A;  3SHL A;  2I0Q A;  2KCT A;  3MAQ A;  3WDN A;  3DUZ A;  3BG3 A;  2EDG A;  3E0E A;  5BN3 A;  1FR3 A;  1P16 A;  1TU2 B;  3STB D;  1B9N A;  4TVA B;  2CHB D;  4BY1 B;  3SDZ A;  3S2H H;  2RQX A;  4ZUJ A;  2O4X A;  2K52 A;  3RLF A;  2Z9H A;  4PZ7 A;  1YI2 A;  1BBX C;  5C3W A;  2HCC A;  5LMU Q;  2BA0 A;  1VQB A;  3W1G A;  4C3I G;  3KBG A;  5JJZ A;  2XNA C;  1E3P A;  4EVO A;  4A3K B;  3I56 A;  4F87 A;  4KV6 A;  2ZTC A;  2UUA Q;  2WB1 E;  4IUQ A;  5BN4 A;  1VQ7 A;  5LMN Q;  1PRT B;  1BUV T;  2RCN A;  1I5F A;  3S1Q B;  2OQK A;  2PI2 E;  1HNZ Q;  5JEA G;  1Y8P B;  2WP8 J;  1YJ9 A;  3OIP A;  3EIV A;  4DV2 L;  2M2L A;  2EJF C;  3CD6 A;  1KDC A;  3DWA A;  5HGT A;  5GAD C;  1Q7Y C;  1O7L A;  2NVY H;  1TQO A;  1SNQ A;  5K36 G;  4DV5 Q;  4GLA C;  2NYZ D;  3JC6 6;  3BS1 A;  2K03 A;  4X62 Q;  3WOE A;  4FXG C;  3FKI B;  1STE A;  4QY7 A;  4DR3 Q;  4YWK A;  4QIW E;  3GTL H;  1PFS A;  5EBD A;  3QJY A;  1A3U A;  2UUB L;  2A73 B;  4ZCK A;  2ZTE A;  5C44 B;  2HQE A;  3R3O A;  4GOP A;  4C2M H;  2R7Z H;  4JBM A;  3GTJ H;  4I7A A;  2JA7 B;  3H0G H;  3K7A H;  4KN4 C;  1VQL A;  1NR4 A;  4Z9C B;  4HAE A;  3BJU A;  1XJV A;  3PO2 H;  2M00 A;  4DR2 L;  4IFD J;  1ILQ A;  3TEH B;  1UUP A;  1BVS A;  4NW2 A;  1Y1V G;  1BNZ A;  1HR0 L;  5C0X I;  2ZTD A;  5C4J H;  4WJ3 M;  5C6A A;  3I4M B;  1JWS D;  1D5M C;  2PQA A;  2A1A A;  1XMQ L;  1C4Q A;  1HZB A;  3HP3 A;  2NVX B;  3OWE B;  4O1N A;  4ABN A;  3I3C A;  3OW7 A;  1Y1W G;  4BBR G;  3KFU A;  5C4X H;  1QVG A;  1L1O B;  2IJ0 A;  3K5O A;  5C3E H;  1H9M A;  2XN9 C;  1Q8K A;  2M9V A;  1CI3 M;  4APV A;  2IHE A;  3VR6 A;  1G91 A;  1YIJ A;  5KND A;  3Q6S A;  5M3M B;  4DR7 L;  3RZO H;  1EIG A;  1VF7 A;  4KHP Q;  3TZU A;  1AFP A;  2PNR C;  1RD9 D;  3NEL A;  2JA6 G;  5EPL A;  1DJR D;  1B4O A;  1BDO A;  2C9O A;  3RUZ A;  4E6I A;  3S1R B;  1XXG A;  4UPA A;  4DK0 A;  1DGS A;  1PH9 A;  2KA7 A;  2YU9 B;  2GA4 B;  2X6L A;  1F2M A;  1I94 Q;  4ID6 A;  1M8A A;  4BS9 A;  1EOT A;  3A74 A;  1M4V A;  5IGC A;  4O42 A;  2R92 G;  4GN3 B;  5AJ3 L;  2JK8 A;  1PZJ D;  4HIK A;  1AZP A;  4B3S Q;  3HOY B;  1GOZ A;  3ONA B;  5KNC A;  5IGE A;  2LSS A;  2WB1 B;  3CW2 C;  2SOB A;  2HDL A;  4IJH A;  4YWM A;  1B44 D;  3DWQ A;  1T5E A;  2K04 A;  1T5X D;  3S1N B;  1HNW Q;  4XIG S;  3HS0 C;  1DYQ A;  4JI4 Q;  1WCM G;  5LHY 1;  2I46 A;  4BWG B;  4BBS H;  1JOQ A;  2EYP A;  1GM5 A;  1G51 A;  3VR5 A;  1EUJ A;  1CKN A;  1SYF A;  2GVB A;  1FJG L;  4QQB X;  3HG9 A;  1HPC A;  3ERQ A;  3TN2 A;  2CH4 W;  4A3G H;  4H7B A;  4BA2 I;  2J0T D;  3HEJ A;  1EZ6 A;  2EY1 A;  3T13 A;  4JI3 Q;  2MP1 A;  4NMZ A;  1ICW A;  3UDG A;  4XTC S;  5FO7 B;  1I6V C;  3F1Z A;  1KD1 C;  1YNN C;  2NN6 G;  4ZLT F;  2PZW A;  1D2B A;  4S3S A;  5G3L D;  4GKK Q;  4PMW A;  1YNJ C;  3E9I A;  3NEM A;  2KCM A;  4BXX G;  2EOT A;  2E2H B;  2EY6 A;  4FVM A;  1IBM Q;  3R8B A;  1WTR A;  3O13 A;  4IQZ A;  4GZY C;  2EYJ A;  5BR8 L;  1TWC H;  4L5T A;  3KLS A;  2F0W A;  3A0J A;  5LMN L;  1YHB A;  2PO4 A;  4JV5 Q;  3HOU B;  3J81 E;  3I4L A;  3OPO A;  3W1B A;  2EQS A;  2A5H A;  4JI2 L;  1SRO A;  1G29 1;  4OWT B;  4RKL A;  5CV5 A;  4ZKC B;  2N88 A;  4CDF C;  2KBN A;  2SEB D;  3UDX A;  4M8A A;  2EPB A;  4OWW B;  1HUM A;  4C1N I;  1RTN A;  2NB0 A;  4GOP C;  2K5Q A;  5D3D A;  1RIP A;  3R2I A;  2XWB B;  5I9P A;  2IWH A;  2L9H A;  4K14 A;  4IPG A;  1HRJ A;  3CC7 A;  4N9P A;  3SK6 A;  3K81 C;  3LWU A;  4K8J A;  4X3U A;  4IFD H;  3S1M H;  4LF5 L;  2RDG A;  1ICF B;  1KRS A;  1XNR Q;  4L5S A;  4RH6 A;  4X62 L;  1CZG A;  1CUK A;  3CQZ H;  2D2C C;  4H02 A;  2H5X A;  3OTO Q;  1JOR A;  3RD4 A;  5T1G A;  4LF9 L;  3M4O H;  3DM3 A;  1SYD A;  2JA8 H;  1TWA H;  4Y52 H;  2WAC A;  2Z6K C;  1EU3 A;  2K05 A;  4X3K A;  3Q0A A;  2OCE A;  2F0V A;  4IJL A;  1P8L A;  1XNQ L;  3EBE A;  5IOD A;  3TRE A;  4DV1 Q;  1B3Q A;  4DNR B;  1H9S B;  3NWT A;  3K57 A;  4A3C G;  3S16 B;  3EN2 A;  2TSS A;  3M9B A;  4A3M G;  4RMF A;  3HOX B;  2QEX A;  1FD7 D;  3K59 A;  3HOV G;  5JOB A;  3M7N A;  3PF5 A;  1MJC A;  1YEZ A;  3T56 B;  4L5R C;  2JA5 G;  2R93 G;  1GUN A;  1PH1 A;  3HOW G;  3ULP A;  1NBW A;  3SK5 A;  1I50 B;  1IXR A;  4QL5 A;  2OXP A;  2CKZ B;  1QZG A;  3OHX C;  1WVL A;  4HCE A;  1PTO D;  3FRP B;  2B63 B;  4DV6 L;  4PZ8 A;  2PMZ B;  1VMP A;  2LY7 A;  3RMH A;  2B2T A;  4JI5 L;  3IRB A;  1QVC A;  1TKW B;  4LUV A;  3D3R A;  1I94 L;  2Q2U A;  1OO9 B;  4UP9 A;  5FLX c;  3GTM B;  1E24 A;  1JT8 A;  4B3S L;  4M1U B;  3I2Z A;  5IWA Q;  3PUW A;  2JP1 A;  3GTK B;  1N32 Q;  4PZ6 A;  5M3M H;  3GTP B;  1VS0 A;  3TP7 A;  3E5S A;  2F03 A;  1SBB B;  4JI4 L;  4R4O A;  1MKH A;  1X56 A;  4LFB Q;  1L0Y B;  4O0A A;  3MXP A;  4LUO A;  3S1R H;  1PRT D;  4ZYS A;  5GRO A;  2JYO A;  4HID A;  2I5L X;  3PO3 G;  2Y0S G;  2MHV A;  2YU9 H;  1LV9 A;  5I6Y A;  1I4X A;  1RF2 D;  1SYC A;  2ENB A;  3CC2 A;  1LT3 D;  2MO0 A;  3OOC A;  1K9M C;  1K0S A;  1YBY A;  1SR3 A;  2B2W A;  2N55 A;  4LF8 Q;  3HOY H;  4L63 B;  1N36 Q;  3BYY B;  3PGZ A;  3ZJY C;  5CV7 A;  1Q8I A;  2K50 A;  1UE5 A;  3GV6 A;  2QDB A;  3G6E A;  3S1N H;  4OWX B;  1V1P A;  1KXL A;  4DF7 A;  3HOZ G;  3MTS A;  3FPU B;  1IBM L;  2K1B A;  1BCP B;  4OO1 I;  1TY2 A;  2A19 A;  3MXN A;  3I73 A;  3V2T A;  5M5W B;  2IY5 B;  3LX0 A;  3N6R A;  3D6C A;  2ES2 A;  1X32 A;  2RA4 A;  3LGJ A;  1D6E C;  3X3N A;  1K8O A;  1IYJ B;  3ND9 A;  1LTS D;  1ZKO A;  3G6J B;  4YHH Q;  4A3D G;  3VYT A;  2RHQ B;  3CME A;  3KJO A;  4QCL A;  4XYQ A;  3AQQ A;  2NTT A;  3A7A B;  1TWF B;  2RKS A;  2GVA A;  1JB7 A;  1F9S A;  1IW7 D;  2MFI A;  1JJG A;  1SFO B;  3RZD H;  3HOU H;  1VQA A;  2EJG C;  2A6E D;  1WFQ A;  1I4P A;  2IHF A;  5M5Y H;  1NUC A;  4CKC A;  1UEB A;  4ZKB B;  2YTX A;  2HIV A;  2F0H A;  3JAM L;  3PQI A;  1ENC A;  1ZEQ X;  1IL2 A;  1SAP A;  1QG7 A;  4HMJ A;  2K14 A;  3AB9 A;  2O5J C;  4K5V A;  1ZYR C;  3D4R A;  1Z7T A;  4U68 A;  1PXU A;  4QF4 A;  5KRU A;  1XYI A;  3IAY A;  1VQ6 A;  5M5X B;  5DLQ E;  4IUN A;  4JI8 L;  2CVR A;  4EQN A;  2JA9 A;  2A6H C;  1ENF A;  1STA A;  4NB3 A;  2VXW A;  4YCV A;  1GHJ A;  2KHI A;  2ALY B;  4K6D A;  2B2T C;  1R9T B;  4X65 L;  2EXZ A;  1SYE A;  4HR7 B;  2F52 A;  4KHZ A;  4R8N A;  3IFD A;  1LTB D;  3X3M A;  3Q24 A;  4A3J H;  4A3E H;  3FPP A;  4C3J G;  4N8F A;  1B3A A;  5EBC A;  2E2I B;  2VUM G;  1VCI A;  2PZU A;  2F0E A;  5HUR A;  5FO9 B;  4DV4 Q;  1IHZ A;  5C0X J;  1XMQ Q;  1EY6 A;  1HH2 P;  3I4N G;  5JEA J;  3H94 A;  1KTK A;  1SRU A;  1Y1W B;  4KI0 A;  2I5M X;  4BBR B;  4LJZ C;  2F0N A;  5FO8 B;  3S15 H;  2B39 A;  2K5D A;  3L0O A;  1PFN A;  3KF8 B;  1X65 A;  1Y8N B;  4A3F G;  5IP9 G;  5A2Q L;  2F0L A;  3T16 A;  4R4Q A;  5F2D A;  4WOR A;  1X9N A;  4HTH A;  2CQO A;  4FYD A;  4MNO A;  4DR7 Q;  1VQI A;  5I2X A;  1LUZ A;  2MO1 A;  2E2J B;  1HQR D;  3NE5 B;  1RJT A;  2EXD A;  2X69 A;  3BZC A;  5I4D A;  4HIO A;  1SNP A;  1CT1 D;  2B2W C;  2CQA A;  2JA6 B;  4FNF A;  1JMC A;  3E9H A;  3QR8 A;  2R3Z A;  5FKA C;  2PCF B;  3BZK A;  2F0S A;  1PH7 A;  1XPR A;  5JJL A;  1WD1 A;  4N9T A;  5EAY A;  2NVT H;  3KUP A;  2C5C A;  1CFM A;  5M3F G;  2UXC Q;  2VNU D;  1OXS C;  2QF7 A;  2R92 B;  2QEJ C;  2HUG A;  1Y8O B;  2VZA A;  3RLO A;  3I55 A;  1SMX A;  4LFB L;  4BY7 G;  1PFM A;  2K4K A;  1VQD A;  4OIK A;  1CQF A;  5IP7 H;  1JIC A;  4FDB A;  1L0X B;  1NMG A;  3K5L A;  1JJ2 A;  1RTO A;  5D14 A;  1WCM B;  3CCS A;  2EVB A;  5IYC H;  4DN4 M;  4LF8 L;  1E1O A;  1N36 L;  5DEH A;  1II3 A;  4X66 L;  4JBJ A;  1FJG Q;  2D0O A;  4XQQ A;  5FLX E;  4J6H A;  1VMC A;  4X64 Q;  1PVO A;  1HQM C;  3I91 A;  4AYB E;  1I4G A;  2I5H A;  2A69 C;  1S72 A;  1ONL A;  1N8R C;  2WKD A;  4B3T L;  2BE5 C;  1IBK L;  4LNQ A;  1VQJ A;  3M4Q A;  1AP0 A;  1IYV A;  2IPK D;  5BR8 Q;  1HZA A;  3PUZ A;  2EJM A;  1HTL D;  4A3I B;  4YHH L;  1SMY D;  1KAA A;  2RBM A;  3EQL C;  1DOM A;  1HFG A;  3NHH A;  2JE6 I;  4JI0 Q;  1GO3 E;  1TS3 A;  5FLM H;  4L6T B;  3AFQ A;  3UDF A;  4GNX A;  4JI2 Q;  1EY5 A;  4DUZ Q;  2ZT9 C;  1HNX Q;  1Q1E A;  3M3Y B;  5M5W H;  4P75 A;  2BH8 A;  2Y0S E;  3I8Z A;  1R4P B;  3UDI A;  1B2T A;  1I3Q B;  2F0I A;  3T51 B;  2PPB C;  5CC4 A;  1JR0 D;  3GTG H;  5DM7 3;  1FGB D;  2A68 D;  4DK6 C;  1ET9 A;  2K28 A;  3SEB A;  4LF4 Q;  4K0K Q;  5CR3 A;  1C7Y A;  5EKI A;  1VQM A;  3AEV A;  4LF5 Q;  4C1N K;  3ZYY X;  4A93 H;  1MSG A;  3HKZ G;  1Y69 U;  1TWG B;  1E2W A;  1LTT D;  4UP7 A;  3FHW A;  1OXV A;  1EU4 A;  5C0X H;  2AMC B;  2R7Z G;  3H0G G;  5JEA H;  2K33 A;  1VQK A;  1SXT A;  2CW0 D;  4LF9 Q;  2ZXO A;  1SFO H;  3PO2 G;  5KYI A;  5FOB B;  4JI1 Q;  1PH3 A;  1LM0 A;  1J8I A;  4AQY Q;  4KKU A;  4H0L C;  1D8L A;  2H4O A;  1XNQ Q;  1EFW A;  4RAU C;  4P2C B;  5K36 H;  1JE4 A;  5ELF A;  4WJ4 A;  3P7J A;  2E8G A;  4FXK C;  2QDL A;  2XVS A;  5C4X G;  1SE8 A;  1S3O A;  1ET6 A;  3T1Y L;  4A3M B;  1GJX A;  1K3B C;  1NMF A;  4DV4 L;  2Q2H A;  3DWP A;  2YTV A;  2N49 A;  1Q82 C;  1KLG D;  1JOK A;  5CMD A;  1KHI A;  5C3E G;  3HOV B;  1BBW A;  4K2L A;  3RNU A;  2O5I C;  3S2D H;  3I70 A;  2R93 B;  4Y7N H;  2JA5 B;  3CPF A;  2Z6K A;  4KY6 A;  4MN3 A;  5E1F A;  3QO2 A;  1S5C D;  3D4W A;  1IBL Q;  2R61 A;  4NXM L;  5CGK A;  1TR5 A;  1IKL A;  3KDF A;  1U0L A;  3HOW B;  3CCR A;  1JE5 A;  2PI2 A;  3HFZ B;  3P75 A;  4TQU S;  1HA6 A;  1CTM A;  1UNS A;  1X6O A;  4K5W A;  4KN7 C;  3NBH A;  4JBK A;  4DUY Q;  2UUC L;  4DV6 Q;  5GAH C;  3F2B A;  5JPN C;  1KC8 C;  1QUQ A;  4JI5 Q;  2CH4 A;  4AYB B;  4EX5 A;  1SE2 A;  2WAQ E;  5FJ8 H;  4LW1 A;  4PV1 C;  3U50 C;  1V43 A;  1PLF A;  2MUY A;  1BCP D;  4DAY A;  1FNU A;  4R4C A;  5C5M A;  2UXC L;  3GO5 A;  3HGB A;  4RGO S;  4GOP B;  2BOS A;  4Q0F A;  5CBE E;  4HN7 A;  1BR9 A;  1X3G A;  3K5N A;  4BBS G;  1ILP A;  5IGB A;  4C3H H;  3C46 A;  4GS3 A;  1LAB A;  3GD7 A;  2IX1 A;  1U4R A;  4DR5 Q;  3GP7 A;  5C5L A;  4HIM A;  2NZ1 D;  4A3G G;  1K8G A;  4DXF A;  1GUW A;  4DV0 Q;  2PQA B;  4B3R L;  1M90 C;  1PYW D;  4OEM B;  1CKO A;  3GTO H;  2F0G A;  1GUG A;  2AKW B;  4RCN A;  3PO3 B;  2Y0S B;  4OXP A;  4DK1 A;  3PF4 A;  1B53 A;  5EGT A;  2PMZ E;  4GNX C;  1CQV A;  5ELC A;  3DMU A;  4LMQ D;  2R92 H;  4X64 L;  1EYD A;  4XXE A;  4DFA A;  2VQF L;  3PSI A;  4HSP A;  3CKI B;  1CSQ A;  2F0Q A;  3NXW A;  1H95 A;  3S17 H;  5KGU A;  3E6Z X;  1NAP A;  2XRS D;  4KHV A;  1U4M A;  1A2T A;  1PTO H;  3HOZ B;  4IUR A;  1N33 L;  4A3B G;  2B8F A;  2VL6 A;  1A2U A;  4IZ8 A;  1STH A;  2Q2T A;  2JEA I;  3OIQ A;  3CCE A;  1SEB D;  4N8X 1;  4JI0 L;  3IFT A;  1LT5 D;  3OSO A;  2ZJQ A;  1NR2 A;  2K6A A;  2AHO B;  3S14 B;  5TSS A;  4DUZ L;  5EQ0 A;  4BY1 H;  1HNX L;  4A3D B;  2F3V A;  5IE8 A;  2Q8T A;  4XQJ A;  4IFD G;  1FL0 A;  2RSO A;  3BU2 A;  3VYU A;  3TP8 A;  2ZM6 Q;  1FNV A;  2UU9 L;  1EEI D;  4PMC A;  3MEF A;  4A3K H;  4KK7 A;  4LF4 L;  3BDO A;  4K0K L;  4A3I H;  2JJQ A;  3J80 L;  4LFC L;  1CKN B;  3ND8 A;  2JA8 G;  3LWE A;  3S1Q H;  4IUT A;  1S40 A;  2NN6 I;  3H3V C;  3EFX D;  3J7Y W;  4V19 0;  2F0O A;  2AQ2 B;  1AZQ A;  4JI6 Q;  4CBV A;  3MXU A;  4JI1 L;  1NNX A;  2YYZ A;  2KQ3 A;  3GTQ B;  4AQY L;  1JWM D;  5LL6 S;  5JVH 3;  3D6W A;  3T1H Q;  4JI8 Q;  4XT1 B;  4LK1 C;  3CC4 A;  1CA6 A;  3K5M A;  4NDX A;  1B7Y B;  2JSO A;  2WAQ B;  2L12 A;  2Z1C A;  1C48 A;  4ALP A;  1G2S A;  3CAM A;  5D65 A;  4PG3 A;  1SND A;  3J7A V;  3FKI H;  2QIL A;  4X65 Q;  2NTS A;  2OF1 A;  4HJ7 A;  4LFA Q;  1U4L A;  2DUD A;  4DNT B;  1QIL A;  3VA7 A;  5C44 H;  2EY2 A;  4ODG A;  1ESF A;  2F3I A;  2JA7 H;  3RN2 A;  4NPS A;  3KBX A;  1D1I A;  1IBL L;  2VUM B;  1W3S A;  3IL8 A;  4GN5 A;  3U4V A;  1D5X C;  4X6A H;  3I4N B;  1IL8 A;  3NWS A;  4NP5 A;  1FYC A;  1UE7 A;  1EEF D;  1Q90 A;  3I4M H;  3MWY W;  1IZ6 A;  4A3C H;  4DUY L;  2MGS A;  4OHJ A;  4A3F B;  4IOC A;  2VY3 A;  2NVX H;  2DGY A;  3A56 A;  4O2D A;  3TS2 A;  5IYD H;  1I6H B;  1Q12 A;  4X3S A;  2F4V Q;  4XT3 B;  2R93 H;  3J7A 5;  1VQG A;  2G9D A;  4DU9 A;  2FJ2 A;  3CP0 A;  4CDD C;  5IGD A;  4YWL A;  5E4X A;  2K01 A;  5GAE C;  1VQN A;  1XMO L;  4R9W A;  1O7I A;  2L5T A;  2D5D A;  4OIJ A;  3G71 A;  1WTV A;  1N9W A;  3STB C;  2JQO A;  1V9P A;  3QB3 A;  2J4X A;  2WIN B;  2XSC A;  1BOS A;  1D1K A;  4DR5 L;  1X3E A;  1VF5 C;  2EZV A;  5T1I A;  5M3F B;  1HA5 A;  1Q46 A;  1DM0 B;  4GLV B;  3URY A;  4JI7 L;  2PW7 A;  3TP5 A;  4DV0 L;  4BY7 B;  4CDE C;  4POG A;  1Q81 C;  2RF4 A;  2K5H A;  3P20 A;  4OO1 H;  2WB1 G;  4IPH A;  4DV3 L;  1JB3 A;  1YZ6 A;  2KUM A;  1J9O A;  2BH2 A;  3L7Z C;  2CWP A;  1GKH A;  2HQL A;  1STY A;  4X66 Q;  2BDN A;  5EPJ A;  3K58 A;  1C0A A;  1F2L A;  2FXQ A;  3A54 A;  3S2H B;  3J7Z C;  3NEN A;  3H09 A;  5J39 A;  5AFW A;  3KJP A;  3A8K E;  5ELD A;  2R7F A;  5IYB H;  4RWS C;  1G6Z A;  2D0P A;  4KKT A;  3ULJ A;  4DA2 A;  5CV9 A;  4B3T Q;  4DR1 L;  1A6X A;  3PO3 H;  1IBK Q;  2FMM A;  3KF6 A;  1TT2 A;  1QOH A;  1YIT A;  4IUV A;  1CZW A;  4HJ8 A;  3F8T A;  4C3I B;  3M85 A;  3Q22 A;  1AEX A;  1PHJ A;  2QGQ A;  2R6G A;  1QVF A;  2AQ1 B;  2VS1 A;  5M9O A;  3CPW A;  3AMU A;  2F1M A;  1WOC A;  4ZUI A;  3U9O A;  2ZM6 L;  2E2H H;  1B8A A;  3Q8D A;  1Z6H A;  4CKB A;  1EY8 A;  3H3V I;  1J6Q A;  1K28 A;  4G7Z C;  1EZ8 A;  2F0U A;  3A7L A;  3TRZ A;  1WYD A;  3A55 A;  3KLR A;  2FHT A;  3S14 H;  1TII D;  1EYA A;  1D5Z C;  2DY8 A;  5L37 A;  2OEO A;  1SSO A;  1YNN D;  2DNC A;  3PIP A;  1DOK A;  1S5E D;  2D9U A;  4JI6 L;  1DXM A;  3HKZ B;  3V96 A;  2I07 B;  2DJG C;  1LTL A;  1Z9F A;  1YNJ D;  1F2Y A;  1XX8 A;  3T1H L;  3KLS X;  3EJI A;  4P72 A;  4P73 A;  4UDU C;  3HZX A;  4C2M B;  2IX3 A;  3GTJ B;  2R7Z B;  1KLU D;  3H0G B;  1V1P B;  1VQH A;  2K5N A;  1F9P A;  3JAM i;  3K7A B;  1VQ4 A;  1STB A;  1R4Q B;  3GQB A;  1EWC A;  2DN8 A;  2CFM A;  3MXN B;  3OW2 A;  5IIF A;  4A3J G;  1QB5 D;  4A3E G;  1X3P A;  1MSH A;  1HHV A;  1EOV A;  5D3I B;  3AU7 A;  2Z8L A;  4WFN 3;  2Q2I A;  3ULL A;  2E5L Q;  4A3L G;  1GUT A;  2CCZ A;  4OEL B;  3QOL A;  1UAP A;  3PMF A;  2NUC A;  2JN4 A;  4IN3 A;  1KAB A;  4LFA L;  1SE4 A;  1Y1V B;  4OON A;  2ZJR A;  2E75 C;  4GKJ Q;  4G4K A;  3GTQ H;  3T1Y Q;  5C4X B;  3M7G A;  3CCJ A;  2B8G A;  1NE3 A;  3KOJ A;  1YHQ A;  4FP5 D;  1V1O A;  3DEP A;  5ELN A;  2ZJP A;  1F77 A;  2VQE Q;  3S16 H;  4JBW A;  2V4D A;  2DY7 A;  4NXM Q;  1SYB A;  3HOX H;  4F88 A;  5JPM C;  5COR A;  3OMC A;  4B9W A;  3PIP 3;  5ELO A;  3J81 L;  2UXD L;  3JAM c;  2QW7 A;  2JXM B;  4DAP A;  1AH9 A;  5ELE A;  3PUV A;  1B1Z A;  4IUU A;  2F4V L;  3ITP A;  1JOO A;  3FP9 A;  3QIA A;  4IUP A;  1W2B A;  3OWF A;  2UUC Q;  3KYH C;  5IT9 L;  1QNU A;  1HR0 W;  4OX9 L;  4TRD A;  2NZH A;  1I50 H;  4K6L A;  5KEE A;  3I4N H;  1PH4 A;  4QUF A;  5EJW A;  4KLK A;  2HHH Q;  1JWU D;  1RDP D;  3SXH A;  3VYS A;  2B63 H;  3TQY A;  4YY3 L;  5IP9 H;  3SR1 A;  1QE6 A;  3NQI A;  3CRL C;  5IP7 G;  5KNB A;  1XPU A;  4IOA A;  1C9O A;  5IYC G;  4BBS B;  1KL9 A;  2F0T A;  3MHB A;  1GD7 A;  1KNA A;  2ID0 A;  2WII B;  3FVQ A;  2ZXR A;  4RKB A;  3MZ5 A;  3RR5 A;  1CKM A;  3SK4 A;  3GTM H;  3DEO A;  4ZAI A;  4K8I A;  3S9W A;  4B3R Q;  4RHR A;  3GTK H;  3A8I E;  3I90 A;  1SJH D;  2EYM A;  3DHQ A;  1ROD A;  1FVI A;  3GTP H;  1VQF A;  1K8A C;  1CHQ D;  3NTH A;  3H91 A;  4RFB A;  2EYF A;  3CHB D;  5I6W A;  3F2U A;  1IKM A;  2KJX A;  1GHK A;  3TDQ A;  1SE3 A;  2VQF Q;  1WTX A;  5DM6 3;  5E4W C;  1PV4 A;  5GQO A;  1CHP D;  3QG1 A;  2RVL A;  3V05 A;  2OQ0 A;  2EE1 A;  1PH2 A;  1TWC B;  2IW3 A;  3NTI A;  1LTR D;  4LF7 L; 
#chains in the Genus database with same CATH homology
 4GOP B;  4GLX A;  3PF5 A;  3M7N A;  4HJ9 A;  5IT9 c;  1MJC A;  1YEZ A;  4AIM A;  1XNR L;  4L5R C;  2JA5 G;  5FLM G;  1X3G A;  4DK3 C;  1N33 Q;  4BBS G;  2R93 G;  4JOI C;  2LXK A;  4C3H H;  4GS3 A;  3GD7 A;  1PH1 A;  1MJE A;  2IX1 A;  1GVP A;  2OWO A;  3HOW G;  3OTO L;  2R7D A;  3ULP A;  1NBW A;  4DR5 Q;  4JCV E;  4HIM A;  4A3G G;  1K8G A;  2OTL A;  1IXR A;  4DV0 Q;  4QL5 A;  2PQA B;  3KF6 B;  3PUX A;  4B3R L;  1M90 C;  2CKZ B;  1QZG A;  1ASZ A;  1CKO A;  3GTO H;  1YHA A;  2AKW B;  2B3G A;  3D0F A;  4OXP A;  5J3B A;  4JYA L;  4HJ5 A;  3CCM A;  3PF4 A;  3PV0 A;  3ER0 A;  4PZ8 A;  1X55 A;  4DV6 L;  2PMZ E;  4GNX C;  4A93 G;  1EYG A;  4JI5 L;  3IRB A;  4C3I H;  1K0R A;  1KRT A;  4X64 L;  1QVC A;  1VQC A;  4LUZ A;  4DV1 L;  2UUB Q;  2UU9 Q;  3CF5 A;  1PYS B;  2WAQ G;  4IPD A;  4POF A;  1B70 B;  2VQF L;  3PSI A;  3RN5 A;  4LUV A;  1CSQ A;  5C0X G;  1I94 L;  3HOX G;  2Q2U A;  5E7N A;  1NTG A;  2KHJ A;  1KIX A;  5JJI A;  4LFC Q;  4KHP L;  4UP9 A;  4HJA A;  2ATW A;  3S17 H;  1H95 A;  5FLX c;  1E24 A;  1L1O A;  3UE0 A;  1VQ8 A;  4DR2 Q;  2OTJ A;  1K73 C;  1JT8 A;  4B3S L;  3I2Z A;  1TWF H;  5IWA Q;  5LMN W;  3PUW A;  1QZH A;  1HR0 Q;  3U4Z A;  1N33 L;  1N32 Q;  4A3B G;  2VL6 A;  3I7F A;  4PZ6 A;  1G6P A;  1MIU A;  5M3M H;  4P74 A;  1VS0 A;  1A62 A;  1E1T A;  1L0W A;  3AYH B;  5HY6 A;  4A76 A;  2Q2T A;  2JEA I;  4A3L H;  3CCE A;  4JI4 L;  1Z47 A;  4JI0 L;  2CWA A;  4R4O A;  4IO9 A;  3I4O A;  3CCL A;  4C3J H;  2ZJQ A;  1MKH A;  1TXY A;  4EQ5 A;  1X56 A;  3ICE A;  4O0A A;  2AHO B;  4LFB Q;  4LUO A;  3S1R H;  1X3F A;  4DUZ L;  5GRO A;  4BY1 H;  3PIO A;  4HID A;  1HNX L;  2I5L X;  1T9H A;  2B63 G;  2Y0S G;  2RHS B;  2YU9 H;  3PO3 G;  1PYB A;  4LF6 L;  5IE8 A;  1BBU A;  2E5L L;  3A5Z B;  4IFD G;  1EQQ A;  3J81 i;  1FL0 A;  1HJP A;  3BU2 A;  1M1K C;  1U5K A;  3CC2 A;  2ZM6 Q;  1UE1 A;  2MO0 A;  1N34 L;  1K9M C;  1YBY A;  1SR3 A;  2UU9 L;  4GKJ L;  4LF8 Q;  3HOY H;  5M5X H;  1N36 Q;  3G48 A;  3K7U C;  2GN5 A;  3MEF A;  3PGZ A;  3ZJY C;  4A3K H;  4LF4 L;  4A3F H;  2K50 A;  2A8V A;  1UE5 A;  2JEB I;  2VW9 A;  4J15 A;  1EWI A;  4A3I H;  4K0K L;  2BA1 A;  3G6E A;  3DLL A;  4GNX B;  3S1N H;  2JJQ A;  3CMA A;  4OWX B;  4LFC L;  1CKN B;  2VQE L;  1I6H H;  2V1C C;  1KXL A;  1VQE A;  3HOZ G;  2JA8 G;  2QA4 A;  4YCW A;  3S1Q H;  1IBM L;  1WI5 A;  3B6Y A;  1EIF A;  5IWA L;  1K83 H;  1S40 A;  2NN6 I;  1ASY A;  1N32 L;  4OO1 I;  2IT1 A;  2A19 A;  2MNA A;  4NXN L;  1R9T H;  2IY5 B;  2UXB Q;  1OXT A;  4B3M L;  4JI6 Q;  4JI1 L;  1Y1V H;  2ES2 A;  1E7Z A;  5AJ3 Q;  1OXU A;  2YYZ A;  3CCU A;  4AQY L;  2E2I H;  3LGJ A;  3T1H Q;  5FJ8 G;  4JI8 Q;  4DKA C;  1IYJ B;  1A8V A;  3CC4 A;  4YHH Q;  4A3D G;  2RHQ B;  1UE6 A;  1XTD A;  3F2C A;  5M3F H;  3CME A;  3K80 C;  3KJO A;  1B7Y B;  1Y1W H;  3WWV A;  2L15 A;  4BBR H;  4DNI A;  3AQQ A;  3J81 c;  2HHH L;  4BY7 H;  1J5E Q;  1CSP A;  4ALP A;  2GVA A;  3CAM A;  1JB7 A;  4PG3 A;  2YV5 A;  3M4P A;  2MFI A;  3FKI H;  3L2P A;  3F2D A;  4X65 Q;  1XMO Q;  3K8A A;  1JJG A;  4HJ7 A;  3RZD H;  4LFA Q;  2I0Q A;  2DUD A;  1L2F A;  1VQA A;  2KCT A;  3HOU H;  1WFQ A;  2IHF A;  5M5Y H;  5C44 H;  1UEB A;  3E0E A;  2YTX A;  2F3I A;  2HIV A;  1P16 A;  3RN2 A;  2E2J H;  4NPS A;  2JA7 H;  3STB D;  1IBL L;  4TVA B;  2YTY A;  1W3S A;  3S2H H;  4GN5 A;  3U4V A;  2KEN A;  2K52 A;  3RLF A;  1IL2 A;  4PZ7 A;  4X6A H;  1YI2 A;  2JA6 H;  3S24 A;  4DV7 Q;  4JI7 Q;  1OTC A;  1VQ5 A;  2UXB L;  1UE7 A;  5LMU Q;  2K14 A;  1EQR A;  2BA0 A;  1VQB A;  3W1G A;  4L5Q A;  1VQ6 A;  1V1Q A;  3I4M H;  1IZ6 A;  1E3P A;  4A3C H;  4DUY L;  5DLQ E;  3I56 A;  4JI8 L;  2PNH A;  2ZTC A;  2NZO A;  4DV3 Q;  2UUA Q;  2WB1 E;  4IOC A;  1VQ7 A;  3ERS X;  1E22 A;  2VY3 A;  4DR4 Q;  2NVX H;  5LMN Q;  1FGU A;  2DGY A;  2JA9 A;  4O2D A;  4MZ9 A;  4A75 A;  3TS2 A;  5IYD H;  2RCN A;  1Q12 A;  1I5F A;  1KAW A;  3KDF B;  4NB3 A;  2F4V Q;  2R93 H;  1SN8 A;  1VQG A;  4YCV A;  3J7A 5;  4DR6 Q;  2OQK A;  2PI2 E;  1HNZ Q;  2KHI A;  2ALY B;  3CP0 A;  5JEA G;  4P71 A;  2WP8 J;  1YJ9 A;  3OYY A;  3EIV A;  4YWL A;  4DV2 L;  5GAE C;  2EIF A;  1VQN A;  4LWC A;  4X65 L;  1XMO L;  3CD6 A;  1O7I A;  1WCM H;  2K5V A;  3NBH B;  2F52 A;  4KHZ A;  3KLW A;  3G71 A;  4A3J H;  4A3E H;  1N9W A;  3STB C;  3D31 A;  4GN4 B;  4YCU A;  2JQO A;  1V9P A;  4DR1 Q;  5GAD C;  1Q7Y C;  1QUQ B;  4BY1 G;  1VCI A;  2VUM G;  2NVY H;  1L1O C;  4DV4 Q;  5C0X J;  1XMQ Q;  4DR5 L;  5K36 G;  1X3E A;  1HH2 P;  2K75 A;  5JEA J;  3I4N G;  2AWN A;  1Q46 A;  4GLV B;  4DV5 Q;  4JI7 L;  1SRU A;  4GLA C;  4DV0 L;  4KI0 A;  2I5M X;  3RLN A;  3JC6 6;  5LMU L;  4DAY B;  4POG A;  2WFW A;  4IPC A;  2RF4 A;  4X62 Q;  1VQO A;  1Q81 C;  3S15 H;  4A3K G;  2K5H A;  3KF8 B;  3L0O A;  1X65 A;  4A3F G;  5IP9 G;  2WB1 G;  4IPH A;  4QY7 A;  4DR3 Q;  4YWK A;  4A4I A;  4R4Q A;  4A3I G;  4QIW E;  4DV3 L;  2UUA L;  4R4T A;  4LF7 L;  1X9N A;  3GTL H;  3UE1 A;  1PFS A;  2IX0 A;  1YZ6 A;  1Q86 C;  2CQO A;  2UUB L;  4BXX H;  4MNO A;  2BH2 A;  3L7Z C;  1JJC B;  2D62 A;  2CWP A;  1GKH A;  2HQL A;  2ZTE A;  4UY8 C;  2NVQ H;  4DR7 Q;  1VQI A;  1LUZ A;  3AFP A;  4X66 Q;  4C2M H;  2MO1 A;  4GOP A;  3GTJ H;  4JBM A;  2R7Z H;  1XPO A;  1PA6 A;  3H0G H;  4A3B H;  1OXX K;  1C0A A;  2FXQ A;  2EXD A;  1HNZ L;  3K7A H;  3J7Z C;  3BZC A;  3NEN A;  4HIO A;  1VQL A;  1XJV A;  3BJU A;  3PO2 H;  4DR2 L;  4IFD J;  3TEH B;  1JMC A;  3KJP A;  3E9H A;  1BVS A;  2R7F A;  5IYB H;  1Y1V G;  5H1S E;  1YVC A;  1HR0 L;  4AH6 A;  2D0P A;  5C0X I;  2ZTD A;  5C4J H;  4WJ3 M;  4ME3 A;  3ULJ A;  3BZK A;  4B3T Q;  4DR1 L;  3M3Y H;  1PH7 A;  1XPR A;  1IBK Q;  3PO3 H;  5JJL A;  2PQA A;  3KF6 A;  2A1A A;  1XMQ L;  1YIT A;  1HZB A;  5EAY A;  2NVT H;  5M3F G;  2UXC Q;  1I3Q H;  4RG1 A;  3F8T A;  1OXS C;  3J80 i;  4HJ8 A;  3U58 A;  2VNU D;  3M85 A;  2VZA A;  3RLO A;  3I55 A;  4DV5 L;  1Y1W G;  1SMX A;  2AWO A;  4BBR G;  4LFB L;  4BY7 G;  3KFU A;  5C4X H;  3A5U A;  5IY0 A;  3CCV A;  1PHJ A;  2QGQ A;  2R6G A;  1QVF A;  1QVG A;  1L1O B;  2K4K A;  2VS1 A;  1NY4 A;  1VQD A;  3FKI G;  3VDY A;  3CPW A;  5C3E H;  4DR3 L;  5IP7 H;  1NMG A;  4FDB A;  1KQS A;  1Q8K A;  1WOC A;  1JJ2 A;  4BA1 I;  3CCS A;  1TWG H;  4APV A;  2IHE A;  2ZM6 L;  5IYC H;  1YJN A;  2E2H H;  1B8A A;  3Q8D A;  4LF8 L;  1E1O A;  3H3V I;  5C44 G;  1YIJ A;  1HZ9 A;  1N36 L;  1A0I A;  2JA7 G;  4DR7 L;  1J6Q A;  4X66 L;  3RZO H;  1PH5 A;  4JBJ A;  1FJG Q;  4KHP Q;  2D0O A;  4IFD I;  3J81 j;  2ASB A;  3TRZ A;  1WYD A;  3NEL A;  2JA6 G;  3GDE A;  4X64 Q;  1PVO A;  4AYB E;  1AE2 A;  4UPA A;  1PH9 A;  1DGS A;  2I5H A;  1S72 A;  3S14 H;  3I4M G;  1N8R C;  4B3T L;  1I94 Q;  1IBK L;  3PIP A;  4LNQ A;  4JI6 L;  3A74 A;  1VQJ A;  3HKZ E;  2R92 G;  3M4Q A;  4GN3 B;  2JK8 A;  5AJ3 L;  1LTL A;  1AE3 A;  1Z9F A;  5IYD G;  3J80 c;  4HIK A;  4B3S Q;  1BKB A;  4DPG A;  3T1H L;  4A3M H;  4P73 A;  4P72 A;  2LSS A;  5BR8 Q;  1HZA A;  3CW2 C;  3PUZ A;  4IJH A;  3PUY A;  4YWM A;  4YHH L;  1A63 A;  1VQH A;  2C35 B;  2K5N A;  3JAM i;  1VQ4 A;  4JC0 A;  1PH6 A;  3HOV H;  2UXD Q;  1HNW Q;  2JE6 I;  2XGT A;  4XIG S;  4JI4 Q;  1WCM G;  4JI0 Q;  1GO3 E;  2JA5 H;  5FLM H;  2CFM A;  3MXN B;  3OW2 A;  1J5E L;  4BBS H;  3AFQ A;  3UDF A;  4GNX A;  4A3J G;  4A3E G;  1GM5 A;  4JI2 Q;  1G51 A;  2B29 A;  1EOV A;  5M3M G;  1EUJ A;  1CKN A;  4DUZ Q;  2R92 H;  4QGU A;  4OX9 Q;  3K0X A;  1HNX Q;  1Q1E A;  2GVB A;  2Q2I A;  5M5W H;  1FJG L;  4LF6 Q;  3ULL A;  2E5L Q;  3HOW H;  4A3L G;  4P75 A;  2BH8 A;  2Y0S E;  2CCZ A;  4QQB X;  2Z0S A;  3UDI A;  4LFA L;  4A3G H;  3PCO B;  4BA2 I;  4JG2 A;  4OON A;  2ZJR A;  4JI3 Q;  1N34 Q;  4AYB G;  3GTG H;  4GKJ Q;  1EIY B;  3GTQ H;  3UDG A;  3T1Y Q;  1D7Q A;  4DK6 C;  4XTC S;  3CCJ A;  3F1Z A;  4YY3 Q;  1KD1 C;  3W5O A;  4LF4 Q;  2NN6 G;  1NE3 A;  3KOJ A;  1YHQ A;  4K0K Q;  4OO1 G;  1C7Y A;  4UP8 A;  1VQM A;  3AEV A;  4LF5 Q;  4DV7 L;  4A93 H;  4GKK Q;  5ELN A;  3HKZ G;  4PMW A;  3E9I A;  3NEM A;  2ZJP A;  2KCM A;  2VQE Q;  4BXX G;  1NJI C;  3HOY G;  4UP7 A;  3FHW A;  1IBM Q;  3S16 H;  4JBW A;  1OXV A;  4NXM Q;  2AMC B;  2R7Z G;  3HOX H;  5BR8 L;  1TWC H;  3H0G G;  4L5T A;  3TS0 A;  1HZC A;  4DR4 L;  1YNX A;  3A0J A;  4NXN Q;  1VQK A;  5ELO A;  1YHB A;  5LMN L;  4LF9 Q;  4JV5 Q;  2N8N A;  2UXD L;  3JAM c;  1HNW L;  1SFO H;  3HKS A;  3PO2 G;  2XTI A;  4B3M Q;  1AH9 A;  3PUV A;  4JI1 Q;  2HIX A;  5GAG C;  1PH3 A;  2F4V L;  5IYB G;  3W1B A;  4R1J A;  2EQS A;  1LM0 A;  3SGI A;  4DR6 L;  4AQY Q;  3FP9 A;  4DAM A;  5HGQ A;  1W2B A;  4JI2 L;  2UUC Q;  1SRO A;  1G29 1;  1D8L A;  3KYH C;  4OWT B;  1XNQ Q;  1EFW A;  1HR0 W;  1VQ9 A;  4OX9 L;  2KBN A;  1YJW A;  3UDX A;  4R4I A;  2NZH A;  4OWW B;  1I50 H;  3I4N H;  1PH4 A;  4GOP C;  4WJ4 A;  1RIP A;  2E8G A;  4KLK A;  2HHH Q;  4JI3 L;  5C4X G;  3H3V H;  4IPG A;  1SE8 A;  1S3O A;  3T1Y L;  2B63 H;  5JJK A;  3CC7 A;  2HT1 A;  1NMF A;  3TQY A;  4DV4 L;  2Q2H A;  4YY3 L;  2YTV A;  2N49 A;  5IP9 H;  1Q82 C;  3K81 C;  1KHI A;  4LF7 Q;  5C3E G;  1BBW A;  3S1M H;  5IP7 G;  3RNU A;  4LF5 L;  1XPU A;  1KRS A;  1X54 A;  1UWV A;  1XNR Q;  4GKK L;  3S2D H;  4L5S A;  1SLJ A;  4IOA A;  1Y14 B;  1C9O A;  2LXJ A;  5IYC G;  4Y7N H;  1VQP A;  3CPF A;  1KL9 A;  4X62 L;  1RL2 A;  2Z6K A;  1GD7 A;  1CUK A;  2ID0 A;  3CQZ H;  2N78 A;  4H02 A;  4QJF A;  1IBL Q;  4NXM L;  2H5X A;  3OTO Q;  3KDF A;  1U0L A;  3CCR A;  1JE5 A;  4MTN A;  3RR5 A;  1CKM A;  3GTM H;  2PI2 A;  3HFZ B;  3HOU G;  4LF9 L;  3M4O H;  4JV5 L;  2MQH A;  3DM3 A;  1K3R A;  4TQU S;  2JA8 H;  1TWA H;  3HOZ H;  4B3R Q;  4Y52 H;  2Z6K C;  3GTK H;  1WJJ A;  1X6O A;  2OCE A;  1TWH H;  1FVI A;  1LYL A;  4JBK A;  3GTP H;  4IJL A;  4JYA Q;  4DUY Q;  2UUC L;  1VQF A;  1K8A C;  1P8L A;  1XNQ L;  4DV6 Q;  3EBE A;  5GAH C;  3F2B A;  1KC8 C;  1QUQ A;  4JI5 Q;  3TRE A;  4DV1 Q;  1PH8 A;  3CXC A;  3H15 A;  4EX5 A;  2VQF Q;  2VUM H;  3G4S A;  1PV4 A;  2WAQ E;  5GQO A;  5FJ8 H;  3CCQ A;  4LW1 A;  1Q1B A;  3EN2 A;  4JOI A;  3U50 C;  3M9B A;  4A3M G;  4A3C G;  4A3D H;  1V43 A;  4RMF A;  2N3S A;  2OQ0 A;  1PH2 A;  2QEX A;  4DV2 Q;  4R4C A;  3HOV G;  2UXC L;  3GO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...