5M3MG

Free monomeric rna polymerase i at 4.0a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
237
structure length
192
Chain Sequence
ARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Structure of RNA polymerase I transcribing ribosomal DNA genes.
pubmed doi rcsb
molecule tags Transcription
total genus 31
structure length 192
sequence length 237
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
G PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m3mG02
3OYYA 1N32L 4JG2A 4JOIA 1XNQL 3E9IA 1HNZQ 1CSPA 1XNRQ 4A3FH 4A3BH 4DR3Q 3PIPA 3FP9A 4HJ8A 1J6QA 2K52A 1Q86C 2RHSB 1Q12A 1VQFA 3AEVA 5JJLA 4JI2L 2A1AA 3HOUH 2A19A 1KAWA 2ATWA 1YHQA 2D0OA 4A3JH 5C4JH 1PV4A 1E1TA 3STBC 1LUZA 5IYBH 3F2DA 1KL9A 2OQ0A 4BBSG 2NZHA 1UE6A 3S1QH 2R92H 2RF4A 3I4NH 4JI1Q 2PI2E 1YNXA 2IT1A 4NPSA 4JI8L 1IBLL 1HZCA 2B63G 4LFBQ 2IY5B 3K81C 1T9HA 3RLFA 1O7IA 4XTCS 2KHJA 3SGIA 4DV6L 4LF9L 4A3DG 5ELOA 1MJCA 4GOPB 3HOXH 4POFA 1HJPA 2K5VA 2PQAA 3I4OA 3GO5A 4GNXA 1WCMH 2F4VQ 2ZTCA 4DV1L 1WFQA 2OTLA 2JA6H 4KI0A 2E5LL 2KCTA 1IBKQ 4WJ3M 3BU2A 4C3JH 3W1GA 4X64L 4OX9L 1W2BA 4P75A 2DUDA 2Q2TA 3Q8DA 1X9NA 4A3KG 1N36Q 3M85A 2VQFQ 4BY7H 3NBHB 4R4CA 2NN6I 4GLXA 3KF6A 1B8AA 3S17H 2VS1A 1XJVA 1YZ6A 2WB1E 1C9OA 1TXYA 2GN5A 2MO1A 4UP9A 4ALPA 3J7A5 4IPDA 1JB7A 1GKHA 5IWAQ 3S16H 1YJ9A 4BBSH 2MQHA 2UXCL 3CW2C 3GTMH 1NTGA 5IE8A 1PH9A 5FLMG 4A3EG 4YCWA 2AWNA 4DR5L 4JBWA 5IYDG 1IXRA 1L1OC 3S2HH 1HNWQ 5IT9c 1VQEA 1HR0W 3HKZE 1X6OA 4B3TQ 1OXTA 4OONA 3B6YA 4L5TA 1HNZL 1X65A 3RZOH 4GKKQ 1N8RC 1R9TH 5LMUL 3CCMA 2GVAA 4L5RC 4UP8A 3UE1A 1M1KC 1UE1A 2UUCQ 2K14A 3CMAA 1VQ5A 1EOVA 1A63A 2LXJA 3PF5A 4KLKA 4LW1A 4IPGA 4DR6Q 1N34Q 4YHHL 3D0FA 4JI4Q 4B3RQ 4JI5L 3T1HL 5IP7G 3CMEA 3PSIA 3HOYH 2UUAL 2ZJRA 1VQDA 4QIWE 1JE5A 1Q8KA 1NY4A 3U4VA 4JCVE 4APVA 1KRSA 1VCIA 4LF6L 1SFOH 1VQIA 1Y14B 1XMQL 1CUKA 3L7ZC 3CCQA 4DNIA 3RN2A 5K36G 1I94Q 2WP8J 4MZ9A 3G6EA 3CCUA 3AYHB 2ZM6Q 1PHJA 2UUBL 4L5SA 2NVQH 4B3MQ 5C44G 1Q1EA 4FDBA 4JOIC 4HIOA 2ASBA 3H3VI 3CC2A 3U50C 1Y1VG 4R4QA 4B3SQ 3GTJH 4LF7Q 2JEAI 1IBKL 3BZKA 1XPOA 2VY3A 1NMGA 5M5YH 4MTNA 4DV4Q 1K3RA 4DUYQ 2UXBL 3J81i 1EQRA 2ALYB 2E2IH 2DGYA 1X56A 4DV7L 1VS0A 1J5EQ 4JV5Q 1VQKA 1V9PA 3M4QA 4OO1G 3IRBA 3JAMc 3LGJA 2Z0SA 1PH8A 1JJ2A 4LFCQ 2VUMH 2N49A 4R4TA 4HJ5A 1W3SA 3HOUG 2N3SA 4GOPA 1HZAA 5IWAL 2YTXA 2K5NA 4DV2Q 5IYBG 2OQKA 1VQ6A 1TWHH 2PI2A 1VQAA 2R6GA 2KENA 2CCZA 4GN5A 1HNWL 4O0AA 4NXML 4AH6A 3CD6A 4NB3A 1NMFA 3CPWA 1G6PA 4GNXC 3FKIH 3A74A 2HQLA 2K4KA 4KHPQ 1DGSA 2K75A 4YCVA 2KHIA 4GKKL 2K50A 2XGTA 2R7FA 5C44H 3HOXG 3CC7A 1GD7A 1I5FA 2Z6KA 4YWMA 2IX0A 2YTVA 1WCMG 4R1JA 3S15H 2HHHQ 4H02A 2QA4A 1K9MC 1YIJA 1EFWA 1KIXA 2JA6G 2Q2IA 2NN6G 5M3MH 1TWAH 3PUXA 3M4PA 1Q82C 1MIUA 3U58A 4JBJA 1QVFA 2E8GA 1UEBA 1WYDA 2D62A 3H15A 5J3BA 4DV3Q 4BY7G 1U0LA 1CKNA 4A76A 4LF4Q 1L2FA 4PG3A 2VQEQ 1HNXL 2BA0A 4IJHA 1UE7A 3K7UC 4HJAA 2R93G 5BR8Q 2NZOA 2CKZB 3BZCA 1S40A 1VQGA 5GROA 2ZM6L 3ER0A 4X65Q 5C4XH 3CCLA 3T1YL 4DV5Q 4HIMA 3S14H 2ZJQA 4QY7A 4JI0Q 2ES2A 3AFQA 1NJIC 4AYBE 5HGQA 4AQYL 2V1CC 1LYLA 3I7FA 3A5UA 1OXVA 1K8GA 1VQLA 1UE5A 3K80C 2I0QA 4PZ6A 2AHOB 3PIOA 4JBMA 4JYAQ 1TWCH 1HZ9A 1P16A 1PH7A 5GQOA 1EWIA 3CCJA 4LF5Q 1N33Q 2I5LX 4LF8L 3GTKH 1CKOA 1HR0L 1I50H 1MKHA 1X3GA 4R4OA 1IBMQ 1VQ4A 5C0XI 4A3IH 1NE3A 2Q2UA 3TREA 2B29A 1XPUA 1PYBA 3HOYG 1XTDA 1KRTA 1VQJA 2BH8A 2JQOA 4YWLA 3OTOQ 1KD1C 3ULJA 4JI7Q 3W5OA 1ASZA 3J81j 2UXDQ 1PYSB 1YHAA 2R93H 1SROA 1U5KA 4GKJQ 4BBRH 3GD7A 4GS3A 1VQNA 2CQOA 2GVBA 3RR5A 4C2MH 3FHWA 3HOZH 3S1MH 2UU9Q 4DR1L 4AIMA 1CKNB 2JA7H 3KDFB 4J15A 4BXXG 2BH2A 4JC0A 4UY8C 4OXPA 3GDEA 1XNRL 1N9WA 3CCRA 1PH6A 4LUOA 4TVAB 4X62Q 4DAMA 5IYCH 4K0KQ 2JEBI 1FL0A 5ELNA 3JC66 4AYBG 4DR3L 1V43A 2NVYH 2YTYA 5EAYA 4JI6Q 3GTQH 4OWXB 3M4OH 3MXNB 4GOPC 4IOAA 1P8LA 3TRZA 4P74A 4PMWA 5C0XJ 4A3MH 2VUMG 3KLWA 4LFAQ 3PO3G 1Y1WH 5AJ3Q 4NXNQ 3EN2A 1PH3A 1BBUA 3G48A 4IO9A 1OTCA 4DUZQ 2WAQE 4IJLA 4DR4Q 2N8NA 4BA1I 4DPGA 2C35B 4JI1L 2H5XA 2LXKA 4BA2I 4DV5L 3H3VH 1Q81C 4LFBL 1KHIA 1PFSA 4YCUA 3UE0A 4DR2Q 3E9HA 4A3LH 1WI5A 3FKIG 1D8LA 3AQQA 4JI3Q 4LNQA 1YEZA 2KCMA 1B7YB 3CC4A 1N32Q 2F4VL 4DR7Q 4BXXH 1XNQQ 3K7AH 3MEFA 3PCOB 5M5XH 3ICEA 2HIXA 3PGZA 4DV0Q 3L0OA 1RIPA 5M3MG 3OW2A 1CKMA 3J80c 2ID0A 4JI2Q 1N36L 2EXDA 4PZ7A 1SE8A 2VQFL 5LMNQ 1FVIA 4DAYB 3RZDH 3ERSX 1PH1A 1YBYA 2CWAA 4PZ8A 3HOWG 3OTOL 1WOCA 5DLQE 3PO3H 5M3FG 2Q2HA 2UXDL 4HIDA 1YJNA 2EIFA 1A0IA 2IHFA 4P73A 5JJIA 1X3EA 2RHQB 3JAMi 4P71A 3AFPA 2R7ZG 1I6HH 1Z9FA 2IHEA 4OWTB 3M9BA 1HZBA 4JI8Q 4BY1G 4YY3Q 1IBLQ 4IPCA 3GTPH 4DV6Q 4LF9Q 4IFDI 3L2PA 1GVPA 1YVCA 1VQ8A 5C4XG 1Q7YC 5JJKA 1QVCA 2WAQG 3ZJYC 4B3TL 2YV5A 3KFUA 2YU9H 1LM0A 1LTLA 3F2CA 4RMFA 3A0JA 4DV1Q 1FJGQ 2E5LQ 4LWCA 5C3EH 1XMOQ 4OX9Q 2UUCL 3UDGA 5C0XG 4MNOA 1KXLA 1YJWA 3ULLA 3F1ZA 4O2DA 1KQSA 1EIFA 4LUVA 4DR6L 4KHZA 1N34L 1X55A 5AJ3L 4JI4L 4B3RL 2EQSA 2VZAA 2KBNA 1AE3A 1K83H 4A3IG 1SR3A 3HOWH 3PO2G 3CPFA 3KDFA 3KOJA 5JEAJ 3ULPA 4X6AH 5M3FH 1H95A 1EUJA 2UXCQ 3PUWA 1YHBA 3CCSA 2HT1A 4WJ4A 2K5HA 2R7ZH 4DR5Q 1JMCA 4BBRG 4BY1H 4IFDJ 1I94L 4XIGS 1SRUA 3RLNA 4QQBX 4B3ML 1E7ZA 1PH2A 1OXUA 3HOZG 4DR7L 3UDXA 2LSSA 2CFMA 4GLVB 3PF4A 2PNHA 1QUQB 1WJJA 5GAGC 4B3SL 4LF7L 3I55A 2JA7G 3TS2A 1EQQA 2JA5H 3A5ZB 4DV0L 3K8AA 5LMUQ 3K0XA 1MJEA 2I5MX 2XTIA 4X66Q 4DV4L 4DUYL 3W1BA 5IYCG 3F2BA 2ZTDA 4C3IH 2FXQA 2Y0SG 1BVSA 5LMNL 4DKAC 2A8VA 4JV5L 1J5EL 1I3QH 1M90C 3DM3A 1L1OB 1E22A 4QGUA 5HY6A 4YHHQ 3CCVA 4LFCL 2QGQA 4JI5Q 1Q46A 4DK6C 3T1HQ 2UUAQ 4OO1I 4YWKA 4A3MG 1BBWA 1GM5A 1X3FA 4GN3B 5H1SE 4HJ9A 1Y1WG 1PVOA 4DV2L 1L0WA 3PO2H 3DLLA 4LF6Q 1GO3E 4YY3L 2IX1A 1XMQQ 5M5WH 3CXCA 3EIVA 3STBD 3HOVH 4A93H 1G291 4POGA 3H0GH 2UUBQ 3VDYA 3RN5A 4KHPL 5LMNW 1Q1BA 4A3LG 1C7YA 1FJGL 4A3GG 2HIVA 4A75A 2NVTH 1QZGA 4R4IA 3S1NH 1XMOL 3U4ZA 2MNAA 3E0EA 3TQYA 2HHHL 1YITA 5IY0A 2WFWA 2PMZE 4UPAA 2UXBQ 2MFIA 2MO0A 2AWOA 1K73C 2OCEA 3KJOA 3KF8B 2JJQA 4DV7Q 2F52A 2YYZA 1VQMA 3CP0A 1CSQA 4GLAC 1XPRA 5JEAG 3NENA 1G51A 3UDFA 4DV3L 3NEMA 2E2HH 3GTLH 1OXXK 3RLOA 1AH9A 4LF4L 4C3HH 1SLJA 4A3CG 2VQEL 4EX5A 4IFDG 1VQ7A 1BKBA 2F3IA 5BR8L 4LUZA 4QJFA 3CF5A 2B63H 1YI2A 2VL6A 4A3DH 4NXMQ 4X65L 2NVXH 1ASYA 3KJPA 1VQBA 1PA6A 4Y7NH 2AKWB 3HFZB 3KYHC 4JI0L 2I5HA 3BJUA 4HJ7A 3I4MG 3CQZH 2Z6KC 3UDIA 2RCNA 1NBWA 4A3GH 4IOCA 1E3PA 4X66L 1A62A 3S2DH 2JE6I 2R7DA 2QEXA 3CCEA 4JYAL 1AE2A 1C0AA 2OWOA 1JT8A 3M3YH 1JJCB 3EBEA 4QL5A 3PUYA 5C3EG 4LF5L 1N33L 4ME3A 4A3KH 2CWPA 1Z47A 3G71A 3TS0A 1IL2A 3PUVA 2PQAB 1X54A 1FGUA 1UWVA 4GNXB 1IBML 2JA8G 3GTOH 5IP9G 4RG1A 2B3GA 1TWGH 1RL2A 1SN8A 3J80i 3G4SA 1HNXQ 1QUQA 4EQ5A 5GAHC 1VQCA 4A3CH 1IZ6A 4JI7L 2VNUD 2WB1G 5FJ8G 5FLMH 2VW9A 4A3EH 2ZJPA 4GKJL 5IYDH 1E1OA 3D31A 4P72A 3PUZA 2L15A 3TEHB 2BA1A 4DK3C 1EIYB 2AMCB 3HKSA 3KF6B 3T1YQ 3S1RH 1KC8C 1VQ9A 2UU9L 4A4IA 1L1OA 3J81c 1E24A 4OWWB 3I2ZA 2JK8A 4AQYQ 1B70B 3I56A 3HKZG 3I4MH 4HIKA 4UP7A 1OXSC 3F8TA 2Y0SE 5GADC 4A3FG 1PH4A 2JA5G 1IYJB 3M7NA 4A3BG 4K0KL 2ZTEA 1K0RA 4X62L 5GAEC 1VQOA 4Y52H 1D7QA 3WWVA 5FLXc 1A8VA 4L5QA 3CAMA 4JI6L 4X64Q 1V1QA 1VQPA 1S72A 1K8AC 4LF8Q 1TWFH 1HR0Q 1PH5A 3PV0A 2OTJA 5IP7H 4A3JG 1HH2P 2N78A 4JBKA 3NELA 3J7ZC 3S24A 4LFAL 2JA8H 1SMXA 4NXNL 5IP9H 1JJGA 2R92G 1VQHA 1QVGA 1EYGA 4GN4B 4IPHA 4DUZL 3I4NG 1QZHA 4DR4L 5FJ8H 2E2JH 3GTGH 2JA9A 4TQUS 3HOVG 5E7NA 1S3OA 2D0PA 4DR2L 4A93G 3H0GG 4DR1Q 1Y1VH 3RNUA 4JI3L
chains in the Genus database with same CATH superfamily
3E9IA 1HNZQ 1CSPA 1DOMA 4EQOA 3PIPA 2SEBD 4HJ8A 1J6QA 1V8QA 1Q12A 1D6EC 1Z6HA 1SAPA 4A3KB 2K05A 1YHQA 1Z7TA 5I6WA 1DD2A 4LMQD 2F0DA 3STBC 2OQ0A 2NZHA 1UE6A 3SEBA 3S1QH 2R92H 3I3CA 4JI1Q 2KVMA 3ERQA 4LFBQ 4A3EB 4XQNA 4DV6L 1D7QA 1O7IA 1J9OA 4XQQA 1F2YA 3HOXH 1HJPA 2DNEA 2PQAA 3S1RB 4GNXA 1A3TA 5KIXA 2F4VQ 2KJXA 1WFQA 1JICA 3K5OA 3PIP3 3P20A 4KI0A 2OTLA 4WJ3M 3BU2A 4C3JH 3NWSA 3W1GA 1NNXA 5ELDA 4P75A 1ZXTA 3DMUA 1EZ8A 4CJ1B 5A35A 3KF6A 3S17H 2WB1E 1GUOA 4UP9A 4ALPA 1SNOA 1GUTA 1JB7A 3S16H 2JA8B 2UXCL 4YCWA 1ENFA 2AUJD 2E2JB 3GTGB 3HKZE 4Q5VA 1HNZL 4GKKQ 3P75A 3MXUA 3A7AB 4HSPA 1Y1VB 1JC7A 3CCMA 4L5RC 1U9RA 1UE1A 4A3FB 1WTXA 3CMAA 5C3XA 4A3BB 4KLKA 4DR6Q 4YHHL 1CI3M 4DNRB 3T1HL 3PSIA 2C5CA 4C3IB 4IUNA 1SYGA 3HOUB 1JE5A 5I9PA 1SFOH 1BOSA 3NTIA 3K57A 4ZYSA 4XT3B 3RN2A 4OHJA 4QIWB 2ZM6Q 1BDOA 4L5SA 2NVQH 4ZUIA 4B3MQ 4FDBA 4JOIC 3H3VI 5FO9B 1FYCA 4B3SQ 3C1EA 4LF7Q 3BZKA 5CV9A 2EPBA 1XPOA 3TZUA 3J81i 2ALYB 1IKMA 1X56A 4DN4M 4JV5Q 4IUUA 1VQKA 1V9PA 3M4QA 3JAMc 3S15H 1JJ2A 4HJ5A 4JW0A 1R4PB 2R61A 4N9PA 5IGGA 4GN5A 3KUPA 4O0AA 2K5WA 4C1NK 3GTMB 3CPWA 3D6CA 1UEAB 2MGSA 4KHPQ 1DGSA 1CZWA 1PFMA 2K75A 4YCVA 4GKKL 4J8QA 2WACA 5C44H 3HOXG 1X32A 1LTBD 2LMCB 2HHHQ 1EFWA 1K9MC 1H9RA 1WTRA 5M3MH 4C3JG 4HSVA 1PFBA 3VYTA 3M4PA 4N9TA 1MIUA 4B9WA 4ZLTF 5CYUA 1QVFA 2E8GA 1WYDA 2DY8A 4KV6A 4HN7A 1U0LA 2XWJB 5DM63 1L2FA 3DWQA 4R8IA 3HOYB 4XYQA 4BWGB 4HJAA 4RHSA 3T4AC 1MSGA 4G7HC 1SYDA 4L63B 1S40A 2ZM6L 4CKBA 3CCLA 3S14H 4QY7A 3AFQA 4AYBE 4AQYL 3KBGA 2I0QA 5CC4A 4PZ6A 3PIOA 3QOJA 2AQ3B 2QEJC 1N33Q 4DAPA 1GHJA 5EQ0A 2XN9C 1CKOA 1AEXA 2Z8LA 1IHZA 1KDCA 1X3QA 3LX0A 1HR0L 5ELEA 5C0XI 2Q2UA 2B29A 1XTDA 4KKUA 1KRTA 2JQOA 4YWLA 1KD1C 2VXWA 3ULJA 2F03A 1PYSB 2N88A 1U5KA 3K5NA 1TWHB 4GKJQ 3CU7A 3GD7A 3NE5B 4GS3A 2BCOA 4C2MH 3IAYA 1DOKA 2F0NA 4DR1L 3QR8A 4U68A 4DA2A 4J15A 3HS0C 5HGTA 2QDBA 3CCRA 4X62Q 4DAMA 3EA6A 4IUPA 2SDFA 1CHPD 3C1FA 5G3LD 3MXNB 1ENCA 1IYVA 4EQPA 5TSSA 4P74A 1BBUA 1KABA 3G48A 3I73A 3TBIB 3OIQA 2A69D 1PTOD 1PZJD 1K28A 2EE1A 3H3VH 1W6KA 4DR2Q 4H7BA 4A3LH 3K6OA 2MJ8A 3D3RA 1B7YB 2KCCA 2G9DA 1CK1A 2CW0D 5G3LF 4M1UB 3K7AH 1I4RA 3HOXB 1O80A 3L0OA 5M3MG 3J80c 1JR0D 1STYA 4JI2Q 1N36L 1PTOF 2EXDA 2VB2X 2ZT9C 2ZXOA 1K8MA 4C3JB 3MXPA 3ERSX 1I50B 1ICWA 4PZ8A 1G2TA 3K5MA 5DLQE 1F9SA 4HIDA 1A0IA 1QG7A 1RHPA 1X3EA 2R3ZA 4P71A 1Z9FA 2IHEA 1HZBA 2EZVA 3FRPB 4LF9Q 3FPUB 1JOKA 2HCCA 4K8IA 1KAAA 3KFUA 4N8FA 1HTPA 1JORA 1V1OA 2X69A 3R2TA 4RMFA 2E5LQ 4LWCA 5C3EH 1B4OA 1XMOQ 4RHRA 3UDGA 4MNOA 1KXLA 4RCNA 3F1ZA 4O2DA 4LUVA 1Y8OB 4KHZA 4QUCA 1N34L 4JI4L 1QB5D 2EQSA 2VZAA 1AE3A 1SR3A 1GUSA 3KOJA 3D4RA 2NTTA 5IGDA 1LV9A 2KEDA 4IFDJ 5CMDA 1I94L 1SNPA 3IFTA 3MXNA 2X6GA 1OXUA 3EVQA 4GLVB 3PF4A 3Q23A 1EWHA 5GAGC 1WJJA 3NQTA 2H4OA 3BVMA 3K8AA 5LMUQ 2KECA 5KYIA 2D5DA 4X66Q 1LO5D 3W1BA 1ZYRD 1BVSA 5ELFA 2EYJA 5C0XH 1I3QH 1E22A 4QGUA 5HY6A 4DK6C 1PMRA 2UUAQ 4OO1I 1GM5A 4RGMA 1X3FA 5H1SE 4HJ9A 1PVOA 4DV2L 3DLLA 4LF6Q 2RQXA 3CXCA 2PZWA 2F0OA 2K04A 4H0LC 4IN3A 1F2LA 3GTPB 3T51B 3D4WA 4A3LG 1C7YA 4A3GG 3VYSA 2HIVA 1RODA 1XMOL 2EY6A 2MNAA 3BDCA 3TQYA 1YITA 5IY0A 2WFWA 2UXBQ 2A74C 1DZ1A 5IODA 2OCEA 3KF8B 2JJQA 1VQMA 2A68C 1S5CD 4RA8A 4OIKA 1G51A 2F0JA 3NEMA 5M3MB 1OXXK 1ILQA 4LF4L 1AH9A 2LY7A 3VA7A 4C3HH 1K83B 1BKBA 1JCKB 1VF5C 2F3IA 3TP7A 2B63H 4KKTA 1D1KA 2VL6A 4A3DH 2CW0C 4IALA 2FJ2A 2JSOA 3HFZB 4JI0L 3I4MG 1BQQT 4X66L 1A62A 1HTLD 2JE6I 5KYLA 4FNFA 4JYAL 1AE2A 1K8OA 1GUGA 2JA5B 5C3EG 4ME3A 4A3KH 1IL2A 3PUVA 5EBCA 1X54A 1UWVA 1IBML 2Q8RE 3EFXD 1RL2A 5HURA 3G4SA 1HNXQ 4JI7L 2VNUD 2WB1G 4A3EH 1F9PA 4HMIA 2BA1A 2AMCB 1EU3A 3S1RH 1KC8C 4A93B 3VYUA 2RSNA 3I56A 3HKZG 4HIKA 1OXSC 4PMBA 2PZUA 3M7NA 1ONLA 2NVTB 3S1NB 5FLXc 1A8VA 4QMGA 4LF8Q 2F0FA 1FNUA 3PV0A 4A3JG 1S5DD 4KY7A 2HDMA 2JA8H 2WV6D 2E2JH 1STGA 3GTGH 5C4HA 2JA9A 1S3OA 1SXTA 3KF8A 1CT1D 2I07B 4KJNA 4K5VA 2NYZD 1Y1VH 3D8GA 1G8ZD 1N32L 2CH4A 2RSOA 1NR4A 1XNQL 2IJ0A 1U4LA 2QCPX 1QCBD 4I7AA 4A3GB 4A3FH 4A3BH 1I4GA 4DFAA 4DR3Q 4TRDA 2F0IA 3OWEB 3FP9A 5IT9E 1Q86C 3AEVA 4OL7A 3M3YB 5JJLA 4OO1H 1SSOA 1TT2A 2A1AA 2XNAC 3HOUH 1KAWA 1PV4A 5CGKA 5IYBH 3GTOB 1KL9A 4C3HG 1KDBA 4BBSG 2RF4A 2PI2E 1D5ZC 1YNXA 2IT1A 5E3FA 2B63G 5E4WC 2K03A 1T9HA 1PTOB 3K81C 4A3DG 3SGIA 5ELOA 4GOPB 2IL8A 5E4XA 2K5VA 3GO5A 4B9XA 2Z4IA 4ID6A 4DV1L 1SNQA 1EIGA 2NZ1D 1IBKQ 3I4MB 4OX9L 1SDFA 1E2VA 2EVBA 1MD2D 3ND9A 4ODGA 3Q8DA 1X9NA 4A3KG 2VQFQ 3EJIA 3NBHB 2XIWA 4R4CA 2HDLA 1SYEA 1C9OA 1TXYA 2MO1A 4XDXA 4IPDA 1GKHA 2MQHA 5JVH3 1FGBD 3GTMH 1NTGA 5EKIA 1PH9A 4A3EG 4DR5L 4QB4A 3A8IE 3C2PA 1X6OA 1XYIA 4B3TQ 1RTOA 3LWUA 4OONA 3B6YA 4L5TA 5KNCA 3L3OC 4XT1B 1EEID 1B53A 3UE1A 2UUCQ 2V4DA 1S5FD 3TZDA 1VQ5A 4JPBW 2Z9HA 1F2MA 4B3RQ 4KN4C 3CMEA 3CKIB 3HOYH 4K5XA 3MFYA 2BE5D 3OOCA 1VQDA 1Q8KA 4A3JB 1NY4A 2FMCA 1II3A 1KRSA 1VCIA 1CUKA 3CCQA 5K36G 4MZ9A 1PHJA 2UUBL 2B2WA 4HIOA 3CC2A 1Y1VG 4R4QA 1IBKL 2L0CA 5JJZA 2IPKD 1A3UA 1NMGA 1WCMB 2VY3A 4MTNA 4OELB 2A6ED 1H9JA 2TMPA 1I4XA 3A54A 2ICIA 2Z1CA 1J5EQ 1V1PB 4OO1G 4N8X1 3HOUG 2N49A 2JP1A 1JWMD 2N3SA 4GOPA 5EBDA 2YTXA 1R4QB 5IYBG 1VQ6A 1TWHH 2B2TA 1VQAA 4QUFA 2KENA 4C3HB 4BBSB 2NB0A 4NXML 4AH6A 4KTAA 4NB3A 1NMFA 3CD6A 1G6PA 3FKIH 3E6ZX 2R7FA 3NBHA 4R8NA 1GD7A 4YWMA 5JPNC 3L9AX 3LWEA 4CJ2C 2QA4A 1KTKA 1KIXA 2Q2IA 1MHWC 1Q82C 1EYCA 1TS4A 3U58A 4TSSA 5J3BA 2D2CC 3QOLA 1PRTC 5CV5A 4A76A 3DHQA 2EY1A 2KHSA 3URYA 3C46A 3K7UC 1LTGD 2NZOA 3NTKA 3FPPA 3BZCA 3FMCA 5GROA 2HD3A 4HIMA 1PXUA 1QJOA 1NJIC 2V1CC 1LYLA 3I7FA 2RA4A 3K80C 2AHOB 4ZKCB 2B8FA 2LS01 1P16A 2F0LA 3CCJA 5C6AA 5M5YB 3IKJA 2RDHA 4AYBB 1I50H 4FO2A 1X3GA 1T5EA 2E2IB 1GUWA 1SE3A 4A3IH 2EY2A 1NE3A 3M4YA 3NPPA 4FF2A 4KKSA 1PYBA 3HOYG 1VQJA 2BH8A 4JVZA 4LJZC 2LKVA 4IUTA 3OTOQ 3W5OA 1STHA 5L37A 1SROA 1SMYD 4DXFA 1QE6A 1VQNA 2CQOA 4K6DA 3RR5A 4ABNA 3HOZH 2UU9Q 1V1PA 5T1GA 4CBVA 2JA7H 4BXXG 1L0XB 4UY8C 4CHTB 3GDEA 5EKKA 5COYA 1N9WA 1SE4A 1AN8A 4TVAB 5IYCH 2GA4B 1EQTA 1FL0A 5ELNA 2SNSA 4MN3A 2BE5C 2N55A 5EAYA 3MAQA 4FXGC 1G91A 4XQJA 3TRZA 5C0XJ 1YNJD 3MA2B 4NXNQ 2O5IC 5KNDA 1S4ZA 2WAQE 4DR4Q 4BA1I 4JI1L 4OGQC 3NP8A 2EJMA 2M00A 4LFBL 1PFSA 3VR2A 3HP3A 1WI5A 4CDEC 3FKIG 1D8LA 1CM9A 1WTHA 2A6EC 3AQQA 4FYDA 2F4VL 4DR7Q 5M5XH 1D5MC 3PGZA 1ZEQX 1RIPA 1BF4A 1RCVD 1TWCB 3OW2A 1CKMA 5JEAH 2TSSA 3GV6A 2ID0A 2CWAA 2EXZA 2B2VC 3U9SA 3OTOL 1WOCA 1GHKA 2EIFA 1EY8A 3Q22A 2RHQB 2A5HA 4OWTB 4JI8Q 1IBLQ 4BY1G 4YY3Q 3Q24A 4IPCA 4IQZA 3GTPH 1VQ8A 1GVPA 1RTNA 1YVCA 5JJKA 4FP5D 1HUMA 1O7ZA 3WDNA 1LTLA 3V05A 4BS9A 1WTQA 2J0TD 3A0JA 1Y8PB 1FR3A 1DXMA 2MPMA 3OW7A 3FDTA 4DR6L 1U4RA 2NVYB 5KNBA 3M4OB 1X55A 1K83H 4A3IG 1PZKD 1IW7D 4J6HA 4X6AH 1EUJA 1RKNA 3PUWA 4ZQ3A 1IKLA 1TR5A 4WJ4A 2HT1A 2G5DA 2K5HA 2L12A 3R93A 4Q0FA 3RD4A 4XIGS 5FKAC 4QQBX 4QF4A 4B3ML 1E7ZA 3HOZG 4DR7L 2E75C 2EYOA 2LSSA 3UDXA 5CBEE 2RDFA 4B3SL 4CDCC 4FXKC 5K5PA 4LF7L 2JA7G 4CKEA 2JA5H 1CTMA 2EYPA 3A5ZB 5IYCG 1XTCD 3KLRA 4JV5L 2KOLA 1M90C 3CCVA 1I4QA 2QGQA 4JI5Q 1RD9D 3RZDB 1BBWA 4HR7B 4ZCKA 1SMYC 2FHTA 4GN3B 5FK9C 1E0BA 1UAPA 1L0WA 2B2YC 4YY3L 1XMQQ 4A93H 2D9UA 4PMCA 1I6HB 4HTHA 2WKCA 3RN5A 4KHPL 1EU4A 3BVGA 2K6AA 2EOTA 2NVTH 1GUNA 3S1NH 1NSNS 1JOOA 3KLSA 1HA6A 3FKIB 4G7OC 3E0EA 2HHHL 3H6MA 1YNJC 4DV7Q 4DGZA 1K0SA 3MWYW 3T16A 2KUMA 4GLAC 1XPRA 1SYBA 5JEAG 3WOEA 3GTLH 2A73B 4ULLA 3GV3A 1MI2A 4A3CG 4EX5A 5M9OA 2A68D 4LUZA 4QJFA 1IL8A 1YI2A 3HGBA 4K6LA 2NVXH 1UUPA 4NP5A 1VQBA 3KYHC 3TP8A 4BY1B 2OT2A 3BJUA 3H94A 2Z6KC 3UDIA 1RJTA 4A3GH 4IOCA 3S2DH 2QEXA 3CCEA 1STNA 1JT8A 3M3YH 1JJCB 2AUKA 4UHVA 2F3WA 1N33L 3DEPA 3G71A 2NWGA 4F7XA 3GTOH 5IP9G 1LACA 4RG1A 4DNTB 1F9RA 2O4XA 4RGOS 5BN4A 4L6TB 4EQ5A 1I6VC 1VQCA 2E76C 5FLMH 4A3IB 1PTOH 3Q6SA 5T1IA 4GKJL 5IYDH 3D31A 1K3BC 3PUZA 2L15A 1EIYB 3SE0A 5M5WB 3T1YQ 3A8KE 2XVSA 2IWHA 1U4PA 1VQ9A 3J81c 1E24A 2JK8A 3MTSA 3I4MH 4UP7A 5GADC 3HOZB 2JA5G 1IYJB 2F1MA 2ZTEA 4X62L 5GAEC 4Y52H 3WWVA 2JA7B 2M9VA 1LTSD 1S72A 4FF4A 1IW7C 2Z6BA 2JXMB 3HG9A 1PH5A 2OTJA 3SK8A 4JBKA 3ONAB 1LTTD 1F9QA 1FNWA 2E2HB 4HEDA 1E2WA 4V0BA 4OEMB 3I4NG 4GN4B 1HQMC 4TQUS 1DJRD 4EVOA 4A93G 4DR2L 4OWWB 3J7AF 1LT3D 3SHLA 4WORA 5A2QE 4JOIA 1XNRQ 1JWSD 1L0YB 2KA7A 1ML0D 5AFWA 1F2ZA 1VQFA 5M5XB 4JI2L 2A19A 2F0KA 3JAML 2D0OA 4A3JH 4WFN3 2B2VA 2FFKB 1LUZA 2K7VA 4DXGA 2EJFC 3T56B 1LT4D 2IY5B 1DCZA 2PZTA 3RLFA 4LF9L 2VB3X 3EQLC 4RKLA 1MJCA 2F0QA 1B3QA 2BDNA 2NBFA 1WCMH 1EZ6A 4M8AA 2E5LL 2KCTA 2NN6H 1Q3LA 3X3MA 4ZKBB 3A56A 3UI2A 1VF7A 1W2BA 2DNCA 3OPOA 1MGSA 1CFMA 3H3VC 1EYAA 2J7ZA 2VS1A 1XJVA 5CV8A 2GN5A 3F2UA 5EGTA 1BCPD 4BBSH 1AZPA 3CW2C 1PDQA 5FLMG 1PYWD 2AWNA 4JBWA 1HQRD 3QG1A 5IYDG 1L1OC 1A6XA 5IT9c 1VQEA 2ENBA 4IZ8A 1OXTA 1CA5A 1DM0B 4MTKA 5IGFA 1N8RC 2PW7A 3PQIA 5LMUL 2GVAA 1H9MA 4UP8A 1M1KC 3GP7A 1BCPF 3TSSA 1A63A 4HCEA 3PF5A 2XRQD 5D14A 3D0FA 1STEA 1LTRD 3DUZA 2UUAL 2ZJRA 4MHEA 1FD7D 3U4VA 2SNMA 5C4JB 4JCVE 3BZDB 4APVA 4LF6L 2B2YA 1QNKA 1A15A 1VQIA 1Y14B 5A2QL 2MP1A 4RGTA 3I4NB 1KNEA 2I46A 1X3PA 3CCUA 3PMFA 1Q1EA 2RVLA 1ZKOA 3U50C 2JEAI 3SXHA 5M5YH 4DV4Q 1K3RA 4DUYQ 2UXBL 2M2LA 2P5ZX 2E2IH 4K14A 1BBXC 4K8JA 5DNFA 1GJXA 4LFCQ 3LGJA 2VUMH 2HCIA 4R4TA 1NUCA 1W3SA 2LFNA 4S3SA 4BY7B 1HZAA 1BR9A 1ESFA 2K5NA 3R3OA 2PI2A 3GTLB 2R6GA 5EPJA 4F8MA 1DOLA 4GNXC 5K36H 1ENAA 1LABA 3KLSX 3S2HB 1I5FA 2Z6KA 2IX0A 1WCMG 2NVXB 4R1JA 3QWNA 4H02A 1H9SB 5CORA 2DJGC 4PQXA 2NN6G 1TWAH 1R9TB 3PUXA 2XRSD 3J80L 4JBJA 3S2DB 4QCLA 3TP5A 4NW2A 1UEBA 3H15A 4DV3Q 1CKNA 1D2BA 2VQEQ 1T5XD 1BUVT 1QWYA 4IJHA 1HNXL 1UE7A 1LT6D 1HCZA 4ZUJA 2R93G 1EWCA 1A2TA 5BR8Q 3ND8A 2MUYA 5D3IB 4OIJA 4X65Q 4EQNA 1PRTD 3D6WA 1M4VA 4DV5Q 4O42A 2ZJQA 1HA5A 2ES2A 5HGQA 3A5UA 1K8GA 1TWCH 1HZ9A 1PH7A 1I4HA 2FMMA 3FEWX 4LF5Q 2I5LX 1STBA 2L4NA 4RCOA 3K59A 4LF8L 1BCPC 1MKHA 4R4OA 4KHVA 4LK1C 3MEHA 3TREA 1PRTF 3J81j 2UXDQ 1YHAA 3DXJC 2PYKA 1WD1A 4FVMA 4ZAIA 2GVBA 2PW5A 3IFDA 1XWEA 1EY7A 5CV7A 3N52A 5EPLA 4AIMA 3KDFB 2ZXPA 3R2IA 4JC0A 2BOSA 3QO2A 1BXTA 3P1HA 5FOBB 4LAAA 4K0KQ 4LUOA 3I4LA 4DU9A 1M8AA 3NHHA 1EL0A 4AYBG 2DY7A 1TS2A 1V43A 2NVYH 4DR3L 4JI6Q 3M4OH 4OWXB 5LL6S 5I6YA 1P8LA 2PMZB 2J4XA 4PMWA 1YNNC 2VUMG 2B8GA 3A8JE 3KLWA 2Z4HA 4LFAQ 3PO3G 1Y1WH 1CA6A 3EN2A 2C9OA 3ZYYX 4C56C 4DUZQ 4IJLA 2WINB 1W6JA 4DPGA 2C35B 1B50A 1H9SA 2LXKA 3MHBA 4BA2I 4DV5L 2JN4A 2F0WA 1KHIA 3H91A 3UE0A 4H13C 1EY4A 1O7LA 2X6LA 3I72A 4JI3Q 2WAQB 2DN8A 3WOFA 4BXXH 3NUCA 3PCOB 2HIXA 3DWAA 3NQIA 1VDZA 4KMUC 3E3XA 1C4QA 2VQFL 5LMNQ 3RZDH 1FVIA 3NK9A 4DAYB 1QOHA 1PH1A 3GTKB 1YBYA 2F3VA 3SK4A 3HOWG 5M3FG 2KQ3A 2Q2HA 5IGCA 2UXDL 1TY2A 1YJNA 1Y8NB 2O2LD 4P73A 3AMUA 4TKOB 3JAMi 3AFPA 2R7ZG 1I6HH 3M9BA 4DV6Q 2R93B 1A2UA 4B3TL 2YV5A 4YIJA 4K5WA 2IX3A 5IGEA 1E2ZA 2UUCL 1YJWA 1NCVA 3ULLA 2Y0SB 3BS1A 3GTQB 4B3RL 1STAA 2RKSA 1EY9A 3PO2G 4A3MB 3KDFA 3ULPA 2UXCQ 2L5TA 1YHBA 3QIAA 2K28A 3CCSA 2H1EA 1BCPB 1JMCA 4BY1H 4WJWA 1WVLA 3RLNA 1PH2A 2CFMA 2PNHA 1QUQB 3ITPA 4K2LA 4DK1A 1EQQA 2HUGA 1TIID 2XTIA 1O7YA 5FLXL 3IL8A 3F2BA 2ZTDA 5LMNL 4DKAC 5C3WA 2A8VA 2CH4W 1J5EL 1F77A 3DM3A 5I4DA 4YHHQ 3T1HQ 1Y1WG 3SDZA 3OHXC 4G57A 2PNRC 2VUMB 1EY5A 1GO3E 3PO3B 3CRKC 5M5WH 5KGUA 3EIVA 1O78A 3OMGA 5NUCA 3N6RA 3VDYA 5LMNW 2DJFC 4DAYA 4A75A 3BG3A 1QZGA 4R4IA 1EYDA 2YU9B 4HMJA 3U4ZA 5CR3A 3A7LA 5EKLA 1MSHA 2PMZE 4UPAA 2MO0A 2AWOA 1K73C 1UNSA 2F52A 2YYZA 3I91A 3CP0A 2QDLA 3NENA 2WKDA 2E2HH 3I90A 1TWAB 1B9MA 2A6HC 5ELBA 4IFDG 1VQ7A 3HOWB 5M3FB 2F0EA 2WIIB 2R7ZB 3BDLA 2I5HA 2RCNA 1NBWA 1E3PA 3SR1A 2R7DA 1ILPA 4X3SA 2RDGA 5LHY1 3DWPA 4QL5A 3PUYA 1DONA 1NR2A 3MC0B 3GQBA 1VMCA 4I65A 3BYYB 2ZXRA 2EDGA 1TWGH 1SN8A 3J80i 1QUQA 4A3CH 3TP6A 2F0TA 3S9WA 1LTAD 5FJ8G 1XX8A 2VW9A 2PPBC 3VR4A 2ZJPA 3PO2B 1E1OA 1HRJA 3TEHB 2F0SA 5DAUA 1EY0A 3HOVB 3SK5A 4NKLA 2UU9L 4A4IA 3I8ZA 3H0GB 4AQYQ 1HXYD 1PRTB 1LLRD 3F8TA 2Y0SE 1G2SA 1K0RA 4L5QA 4X64Q 1K8AC 5EJWA 1HR0Q 2NUCA 5IP7H 2CVRA 2N78A 3E5SA 3NELA 4RGNA 4NXNL 5IP9H 4FF3A 2R92G 1VQHA 1QVGA 2OXPA 3TDQA 1QZHA 4DR4L 2B2UC 1Y1WB 5I2YA 1C8CA 3D4DA 5C5MA 1WD0A 5E7NA 1H9KA 4IUQA 4DR1Q 5I9OA 3OYYA 4Y7NB 4JG2A 4F88A 2K5DA 1KLUD 3CQZB 1QILA 1HPCA 2L1BA 3W3AA 4Z9CB 2K52A 1TQOA 2L55A 2RHSB 3VR3A 2ATWA 1SYFA 4CGYB 1SNMA 5C4JH 1E1TA 5CBAE 5BN3A 3F2DA 3I4NH 4RWSC 4NPSA 4JI8L 1IBLL 1FNVA 1HZCA 2F0PA 4XTCS 2KHJA 2HQEA 3TMEA 3VR5A 3VYRA 4CDFC 4G7ZC 2E2DC 2EJGC 4POFA 1DYQA 2B39A 3I4OA 2ZTCA 2JA6H 3MVVA 5I2XA 4X64L 3NTHA 2DUDA 2Q2TA 4ZK9B 1N36Q 3M85A 4BY7H 2NN6I 4GLXA 1B8AA 1TWFB 4I7ZC 4CKCA 1D5XC 1YZ6A 3DM1A 1JB3A 3J7A5 5IWAQ 1YJ9A 3A55A 4ME5A 3H09A 3HRZC 4RH6A 5IE8A 1IXRA 3JAME 3PIO3 3S2HH 1HNWQ 1HR0W 4L8JA 4UAIA 5DM73 3CRLC 1SNCA 1X65A 1CZGA 1R9TH 3RUZA 1CHQD 3M7GA 2K14A 1EOVA 2LXJA 4LW1A 4IPGA 4B08A 1N34Q 1B1ZA 4JI4Q 3R8BA 4F87A 4JI5L 5IP7G 2L11A 3K58A 1ICFB 4QIWE 4CJ0B 1XMQL 3L7ZC 4FXDA 3J7AV 3S1QB 5D65A 4X3KA 2R92B 4DNIA 1I94Q 2WP8J 3G6EA 3AYHB 5C44G 2ASBA 3K0YA 1SJHD 3GTJH 4ZRZA 5J39A 1JWUD 1AFPA 3NBIA 1EQRA 2DGYA 4DV7L 1VS0A 5BN5A 1NAPA 2SOBA 4P2CB 3IRBA 5J1ZA 1WTVA 1TVXA 2Z0SA 1PH8A 3RZOH 2F0HA 1ESRA 5IWAL 5EPKA 2MHVA 2XWBB 3S17B 4DV2Q 2OQKA 1SYCA 5J22A 3HEJA 2CCZA 3S16B 1HNWL 4FF1A 3BVZA 1MBYA 4E6IA 3X3NA 3OSOA 5ISRA 3A74A 2HQLA 2K4KA 2KHIA 2AQ1B 2K50A 2XGTA 3CC7A 2YTVA 2JA6G 1YIJA 2EY5A 3NSWA 3VR6A 5CV4A 2PCFB 4WRDA 1AP0A 3MFGA 2D62A 4BY7G 4LF4Q 2F0GA 1KDAA 4PG3A 2BA0A 4RAUC 1B9NA 5JVG3 1G6ZA 2CKZB 1TWGB 1VQGA 3ER0A 4C1NI 5C4XH 1SFOB 3I70A 1GOZA 2ICEC 3T1YL 4JI0Q 3DEOA 1VQLA 2NVQB 1OXVA 2OF1A 1UE5A 1C48A 3T13A 2IW3A 4JBMA 4KD4A 2L9HA 4JYAQ 1JE4A 5GQOA 1ET9A 1EWIA 2QILA 1J8IA 1VMPA 3GTKH 1IBMQ 1Y69U 3O13A 1VQ4A 2AQ2B 2K1BA 1XPUA 3S15B 1EQVA 4JI7Q 1ASZA 2B2UA 2R93H 3J80E 4J1MA 4RFBA 4BBRH 3W2DA 2B2WC 2RCFA 3FHWA 3S1MH 1CKNB 2BH2A 3J7YW 2KCNA 4OXPA 4XYOA 5C44B 2RBMA 5FO8B 1D1IA 3P7JA 5C4ZA 1PH6A 3AU7A 1PZID 3E0JA 4O1NA 1XNRL 4MIUA 2JEBI 5LL6X 3JC66 3SK6A 2A69C 2YTYA 5IOCA 1PTOC 3J81E 3GTQH 2PQEA 4GOPC 4IOAA 2CQAA 4A3MH 3G7LA 2B2TC 5AJ3Q 1PH3A 4IO9A 1XXGA 1OTCA 4GZYC 3G6JB 5FO7B 1KLGD 1Q90A 1SE2A 2N8NA 3TN2A 2H5XA 1Q81C 1YNND 2EYFA 1WTOA 4YCUA 3T53B 3E9HA 4LNQA 5JOBA 1YEZA 2KCMA 3CC4A 3S14B 1N32Q 3LNNA 1EFID 1SEBD 1XNQQ 3MEFA 4KY5A 3RMHA 3ICEA 4DV0Q 1PFNA 1PLFA 2JA6B 4PZ7A 1SE8A 2K33A 3CHBD 2G9HD 4HCSA 4PNYA 3PO3H 1A3VA 3MZ5A 2QKIC 3OIPA 2IHFA 1WTWA 5KEEA 5JJIA 1GXDC 3VA5A 4IFDI 3L2PA 5C4XG 1SNDA 1Q7YC 4EGVA 1QVCA 2WAQG 3ZJYC 3BYTB 3BDOA 2YU9H 1LM0A 4C2MB 3K5LA 5F2DA 3F2CA 4DV1Q 1FJGQ 3NWTA 2EYMA 2XSCA 5D3DA 4OX9Q 4X3TA 4XXEA 1AZQA 4KJOA 5C0XG 1EEFD 5DEHA 4H44C 2O5JC 3EROA 2E74C 1EIFA 1KQSA 2CHBD 1S5BD 5AJ3L 3V2TA 5E1FA 2JYOA 2KBNA 1HFNA 3C3LA 3HOWH 3Q0AA 3CPFA 5JEAJ 1H95A 5M3FH 4DF7A 2R7ZH 4DR5Q 4BBRG 4NDXA 1ZYRC 2F0VA 4CDDC 1SRUA 5JPMC 3J81L 1BO0A 3TS2A 5KRUA 3I55A 4DV0L 4DAVA 4R9WA 3K0XA 1MJEA 2I5MX 1S5ED 2BDOA 4DV4L 4DUYL 3K7AB 1TKWB 4C3IH 2FXQA 2Y0SG 3V96A 3GTJB 5ELCA 1L1OB 1SBBB 4LFCL 1Q46A 2F4IA 4PV1C 4YWKA 4A3MG 3KK7A 3PO2H 3RZOB 2KEEA 2IX1A 1LT5D 3U9OA 2K32A 3STBD 3HOVH 1G291 4POGA 3H0GH 2UUBQ 2EYHA 1Q1BA 1FJGL 1I4PA 1TU2B 3HZXA 1JQYD 1EY6A 1Q8IA 2PO4A 4G4KA 5JAVA 2MFIA 4X3UA 3KJOA 5C3EB 1BNZA 1B44D 1CSQA 3UDFA 4DV3L 1HUNA 3RLOA 1SLJA 1TS5A 3QB3A 3AB9A 2VQEL 2F0MA 1EOTA 2F0UA 4JK1C 5FLXE 1U4MA 5BR8L 4NMZA 3CF5A 2WB1B 4NXMQ 2A6HD 4X65L 1ASYA 1ET6A 3KJPA 1PA6A 1KNAA 2AKWB 4Y7NH 5IGBA 4U673 3SVMA 4HJ7A 1CQFA 3CQZH 4RKBA 5C4XB 3HKZB 4KK7A 4KN7C 4DK0A 1C0AA 2OWOA 3EBEA 1HFGA 4LF5L 5CV6A 2CWPA 1Z47A 2K01A 3TS0A 1EIHA 1JOQA 2PQAB 1FGUA 4GNXB 3NXWA 3QJYA 1OO9B 1I3QB 2JA8G 1TY0A 2K5QA 2B3GA 4KY6A 2QW7A 2Q8IB 5GAHC 1IZ6A 1AW7A 2EYLA 4IFDH 4HAEA 4P72A 4DK3C 5IT9L 3HKSA 1CQVA 3KF6B 4UDUC 1L1OA 3I2ZA 4BBRB 1RDPD 1B70B 3KBXA 4A3FG 2QF7A 1PH4A 1TS3A 4A3BG 3S1MB 3FVQA 1QNUA 4K0KL 3MXGA 1VQOA 3CAMA 4IURA 1VQPA 1V1QA 4C3IG 3OWFA 4JI6L 2OEOA 1TWFH 1LTID 1HH2P 4IUVA 3OMCA 4K2KA 1RF2D 3S24A 3J7ZC 1SMXA 4LFAL 1SJED 1HHVA 1JJGA 1B2TA 1EYGA 4IPHA 4KD3A 4DUZL 2NTSA 1WTPA 1IYUA 5FJ8H 5IIFA 2B63B 3HOVG 2D0PA 2FINB 4ILWA 5C5LA 4A3DB 3H0GG 2Q8TA 3RNUA 4JI3L 1B3AA 4V190
chains in the Genus database with same CATH topology
3OYYA 1N32L 4JG2A 4JOIA 1XNQL 3E9IA 1HNZQ 1CSPA 1XNRQ 4A3FH 4A3BH 4DR3Q 3PIPA 3FP9A 4HJ8A 1J6QA 2K52A 1Q86C 2RHSB 1Q12A 1VQFA 3AEVA 5JJLA 4JI2L 2A1AA 3HOUH 2A19A 1KAWA 2ATWA 1YHQA 2D0OA 4A3JH 5C4JH 1PV4A 1E1TA 3STBC 1LUZA 5IYBH 3F2DA 1KL9A 2OQ0A 4BBSG 2NZHA 1UE6A 3S1QH 2R92H 2RF4A 3I4NH 4JI1Q 2PI2E 1YNXA 2IT1A 4NPSA 4JI8L 1IBLL 1HZCA 2B63G 4LFBQ 2IY5B 3K81C 1T9HA 3RLFA 1O7IA 4XTCS 2KHJA 3SGIA 4DV6L 4LF9L 4A3DG 5ELOA 1MJCA 4GOPB 3HOXH 4POFA 1HJPA 2K5VA 2PQAA 3I4OA 3GO5A 4GNXA 1WCMH 2F4VQ 2ZTCA 4DV1L 1WFQA 2OTLA 2JA6H 4KI0A 2E5LL 2KCTA 1IBKQ 4WJ3M 3BU2A 4C3JH 3W1GA 4X64L 4OX9L 1W2BA 4P75A 2DUDA 2Q2TA 3Q8DA 1X9NA 4A3KG 1N36Q 3M85A 2VQFQ 4BY7H 3NBHB 4R4CA 2NN6I 4GLXA 3KF6A 1B8AA 3S17H 2VS1A 1XJVA 1YZ6A 2WB1E 1C9OA 1TXYA 2GN5A 2MO1A 4UP9A 4ALPA 3J7A5 4IPDA 1JB7A 1GKHA 5IWAQ 3S16H 1YJ9A 4BBSH 2MQHA 2UXCL 3CW2C 3GTMH 1NTGA 5IE8A 1PH9A 5FLMG 4A3EG 4YCWA 2AWNA 4DR5L 4JBWA 5IYDG 1IXRA 1L1OC 3S2HH 1HNWQ 5IT9c 1VQEA 1HR0W 3HKZE 1X6OA 4B3TQ 1OXTA 4OONA 3B6YA 4L5TA 1HNZL 1X65A 3RZOH 4GKKQ 1N8RC 1R9TH 5LMUL 3CCMA 2GVAA 4L5RC 4UP8A 3UE1A 1M1KC 1UE1A 2UUCQ 2K14A 3CMAA 1VQ5A 1EOVA 1A63A 2LXJA 3PF5A 4KLKA 4LW1A 4IPGA 4DR6Q 1N34Q 4YHHL 3D0FA 4JI4Q 4B3RQ 4JI5L 3T1HL 5IP7G 3CMEA 3PSIA 3HOYH 2UUAL 2ZJRA 1VQDA 4QIWE 1JE5A 1Q8KA 1NY4A 3U4VA 4JCVE 4APVA 1KRSA 1VCIA 4LF6L 1SFOH 1VQIA 1Y14B 1XMQL 1CUKA 3L7ZC 3CCQA 4DNIA 3RN2A 5K36G 1I94Q 2WP8J 4MZ9A 3G6EA 3CCUA 3AYHB 2ZM6Q 1PHJA 2UUBL 4L5SA 2NVQH 4B3MQ 5C44G 1Q1EA 4FDBA 4JOIC 4HIOA 2ASBA 3H3VI 3CC2A 3U50C 1Y1VG 4R4QA 4B3SQ 3GTJH 4LF7Q 2JEAI 1IBKL 3BZKA 1XPOA 2VY3A 1NMGA 5M5YH 4MTNA 4DV4Q 1K3RA 4DUYQ 2UXBL 3J81i 1EQRA 2ALYB 2E2IH 2DGYA 1X56A 4DV7L 1VS0A 1J5EQ 4JV5Q 1VQKA 1V9PA 3M4QA 4OO1G 3IRBA 3JAMc 3LGJA 2Z0SA 1PH8A 1JJ2A 4LFCQ 2VUMH 2N49A 4R4TA 4HJ5A 1W3SA 3HOUG 2N3SA 4GOPA 1HZAA 5IWAL 2YTXA 2K5NA 4DV2Q 5IYBG 2OQKA 1VQ6A 1TWHH 2PI2A 1VQAA 2R6GA 2KENA 2CCZA 4GN5A 1HNWL 4O0AA 4NXML 4AH6A 3CD6A 4NB3A 1NMFA 3CPWA 1G6PA 4GNXC 3FKIH 3A74A 2HQLA 2K4KA 4KHPQ 1DGSA 2K75A 4YCVA 2KHIA 4GKKL 2K50A 2XGTA 2R7FA 5C44H 3HOXG 3CC7A 1GD7A 1I5FA 2Z6KA 4YWMA 2IX0A 2YTVA 1WCMG 4R1JA 3S15H 2HHHQ 4H02A 2QA4A 1K9MC 1YIJA 1EFWA 1KIXA 2JA6G 2Q2IA 2NN6G 5M3MH 1TWAH 3PUXA 3M4PA 1Q82C 1MIUA 3U58A 4JBJA 1QVFA 2E8GA 1UEBA 1WYDA 2D62A 3H15A 5J3BA 4DV3Q 4BY7G 1U0LA 1CKNA 4A76A 4LF4Q 1L2FA 4PG3A 2VQEQ 1HNXL 2BA0A 4IJHA 1UE7A 3K7UC 4HJAA 2R93G 5BR8Q 2NZOA 2CKZB 3BZCA 1S40A 1VQGA 5GROA 2ZM6L 3ER0A 4X65Q 5C4XH 3CCLA 3T1YL 4DV5Q 4HIMA 3S14H 2ZJQA 4QY7A 4JI0Q 2ES2A 3AFQA 1NJIC 4AYBE 5HGQA 4AQYL 2V1CC 1LYLA 3I7FA 3A5UA 1OXVA 1K8GA 1VQLA 1UE5A 3K80C 2I0QA 4PZ6A 2AHOB 3PIOA 4JBMA 4JYAQ 1TWCH 1HZ9A 1P16A 1PH7A 5GQOA 1EWIA 3CCJA 4LF5Q 1N33Q 2I5LX 4LF8L 3GTKH 1CKOA 1HR0L 1I50H 1MKHA 1X3GA 4R4OA 1IBMQ 1VQ4A 5C0XI 4A3IH 1NE3A 2Q2UA 3TREA 2B29A 1XPUA 1PYBA 3HOYG 1XTDA 1KRTA 1VQJA 2BH8A 2JQOA 4YWLA 3OTOQ 1KD1C 3ULJA 4JI7Q 3W5OA 1ASZA 3J81j 2UXDQ 1PYSB 1YHAA 2R93H 1SROA 1U5KA 4GKJQ 4BBRH 3GD7A 4GS3A 1VQNA 2CQOA 2GVBA 3RR5A 4C2MH 3FHWA 3HOZH 3S1MH 2UU9Q 4DR1L 4AIMA 1CKNB 2JA7H 3KDFB 4J15A 4BXXG 2BH2A 4JC0A 4UY8C 4OXPA 3GDEA 1XNRL 1N9WA 3CCRA 1PH6A 4LUOA 4TVAB 4X62Q 4DAMA 5IYCH 4K0KQ 2JEBI 1FL0A 5ELNA 3JC66 4AYBG 4DR3L 1V43A 2NVYH 2YTYA 5EAYA 4JI6Q 3GTQH 4OWXB 3M4OH 3MXNB 4GOPC 4IOAA 1P8LA 3TRZA 4P74A 4PMWA 5C0XJ 4A3MH 2VUMG 3KLWA 4LFAQ 3PO3G 1Y1WH 5AJ3Q 4NXNQ 3EN2A 1PH3A 1BBUA 3G48A 4IO9A 1OTCA 4DUZQ 2WAQE 4IJLA 4DR4Q 2N8NA 4BA1I 4DPGA 2C35B 4JI1L 2H5XA 2LXKA 4BA2I 4DV5L 3H3VH 1Q81C 4LFBL 1KHIA 1PFSA 4YCUA 3UE0A 4DR2Q 3E9HA 4A3LH 1WI5A 3FKIG 1D8LA 3AQQA 4JI3Q 4LNQA 1YEZA 2KCMA 1B7YB 3CC4A 1N32Q 2F4VL 4DR7Q 4BXXH 1XNQQ 3K7AH 3MEFA 3PCOB 5M5XH 3ICEA 2HIXA 3PGZA 4DV0Q 3L0OA 1RIPA 5M3MG 3OW2A 1CKMA 3J80c 2ID0A 4JI2Q 1N36L 2EXDA 4PZ7A 1SE8A 2VQFL 5LMNQ 1FVIA 4DAYB 3RZDH 3ERSX 1PH1A 1YBYA 2CWAA 4PZ8A 3HOWG 3OTOL 1WOCA 5DLQE 3PO3H 5M3FG 2Q2HA 2UXDL 4HIDA 1YJNA 2EIFA 1A0IA 2IHFA 4P73A 5JJIA 1X3EA 2RHQB 3JAMi 4P71A 3AFPA 2R7ZG 1I6HH 1Z9FA 2IHEA 4OWTB 3M9BA 1HZBA 4JI8Q 4BY1G 4YY3Q 1IBLQ 4IPCA 3GTPH 4DV6Q 4LF9Q 4IFDI 3L2PA 1GVPA 1YVCA 1VQ8A 5C4XG 1Q7YC 5JJKA 1QVCA 2WAQG 3ZJYC 4B3TL 2YV5A 3KFUA 2YU9H 1LM0A 1LTLA 3F2CA 4RMFA 3A0JA 4DV1Q 1FJGQ 2E5LQ 4LWCA 5C3EH 1XMOQ 4OX9Q 2UUCL 3UDGA 5C0XG 4MNOA 1KXLA 1YJWA 3ULLA 3F1ZA 4O2DA 1KQSA 1EIFA 4LUVA 4DR6L 4KHZA 1N34L 1X55A 5AJ3L 4JI4L 4B3RL 2EQSA 2VZAA 2KBNA 1AE3A 1K83H 4A3IG 1SR3A 3HOWH 3PO2G 3CPFA 3KDFA 3KOJA 5JEAJ 3ULPA 4X6AH 5M3FH 1H95A 1EUJA 2UXCQ 3PUWA 1YHBA 3CCSA 2HT1A 4WJ4A 2K5HA 2R7ZH 4DR5Q 1JMCA 4BBRG 4BY1H 4IFDJ 1I94L 4XIGS 1SRUA 3RLNA 4QQBX 4B3ML 1E7ZA 1PH2A 1OXUA 3HOZG 4DR7L 3UDXA 2LSSA 2CFMA 4GLVB 3PF4A 2PNHA 1QUQB 1WJJA 5GAGC 4B3SL 4LF7L 3I55A 2JA7G 3TS2A 1EQQA 2JA5H 3A5ZB 4DV0L 3K8AA 5LMUQ 3K0XA 1MJEA 2I5MX 2XTIA 4X66Q 4DV4L 4DUYL 3W1BA 5IYCG 3F2BA 2ZTDA 4C3IH 2FXQA 2Y0SG 1BVSA 5LMNL 4DKAC 2A8VA 4JV5L 1J5EL 1I3QH 1M90C 3DM3A 1L1OB 1E22A 4QGUA 5HY6A 4YHHQ 3CCVA 4LFCL 2QGQA 4JI5Q 1Q46A 4DK6C 3T1HQ 2UUAQ 4OO1I 4YWKA 4A3MG 1BBWA 1GM5A 1X3FA 4GN3B 5H1SE 4HJ9A 1Y1WG 1PVOA 4DV2L 1L0WA 3PO2H 3DLLA 4LF6Q 1GO3E 4YY3L 2IX1A 1XMQQ 5M5WH 3CXCA 3EIVA 3STBD 3HOVH 4A93H 1G291 4POGA 3H0GH 2UUBQ 3VDYA 3RN5A 4KHPL 5LMNW 1Q1BA 4A3LG 1C7YA 1FJGL 4A3GG 2HIVA 4A75A 2NVTH 1QZGA 4R4IA 3S1NH 1XMOL 3U4ZA 2MNAA 3E0EA 3TQYA 2HHHL 1YITA 5IY0A 2WFWA 2PMZE 4UPAA 2UXBQ 2MFIA 2MO0A 2AWOA 1K73C 2OCEA 3KJOA 3KF8B 2JJQA 4DV7Q 2F52A 2YYZA 1VQMA 3CP0A 1CSQA 4GLAC 1XPRA 5JEAG 3NENA 1G51A 3UDFA 4DV3L 3NEMA 2E2HH 3GTLH 1OXXK 3RLOA 1AH9A 4LF4L 4C3HH 1SLJA 4A3CG 2VQEL 4EX5A 4IFDG 1VQ7A 1BKBA 2F3IA 5BR8L 4LUZA 4QJFA 3CF5A 2B63H 1YI2A 2VL6A 4A3DH 4NXMQ 4X65L 2NVXH 1ASYA 3KJPA 1VQBA 1PA6A 4Y7NH 2AKWB 3HFZB 3KYHC 4JI0L 2I5HA 3BJUA 4HJ7A 3I4MG 3CQZH 2Z6KC 3UDIA 2RCNA 1NBWA 4A3GH 4IOCA 1E3PA 4X66L 1A62A 3S2DH 2JE6I 2R7DA 2QEXA 3CCEA 4JYAL 1AE2A 1C0AA 2OWOA 1JT8A 3M3YH 1JJCB 3EBEA 4QL5A 3PUYA 5C3EG 4LF5L 1N33L 4ME3A 4A3KH 2CWPA 1Z47A 3G71A 3TS0A 1IL2A 3PUVA 2PQAB 1X54A 1FGUA 1UWVA 4GNXB 1IBML 2JA8G 3GTOH 5IP9G 4RG1A 2B3GA 1TWGH 1RL2A 1SN8A 3J80i 3G4SA 1HNXQ 1QUQA 4EQ5A 5GAHC 1VQCA 4A3CH 1IZ6A 4JI7L 2VNUD 2WB1G 5FJ8G 5FLMH 2VW9A 4A3EH 2ZJPA 4GKJL 5IYDH 1E1OA 3D31A 4P72A 3PUZA 2L15A 3TEHB 2BA1A 4DK3C 1EIYB 2AMCB 3HKSA 3KF6B 3T1YQ 3S1RH 1KC8C 1VQ9A 2UU9L 4A4IA 1L1OA 3J81c 1E24A 4OWWB 3I2ZA 2JK8A 4AQYQ 1B70B 3I56A 3HKZG 3I4MH 4HIKA 4UP7A 1OXSC 3F8TA 2Y0SE 5GADC 4A3FG 1PH4A 2JA5G 1IYJB 3M7NA 4A3BG 4K0KL 2ZTEA 1K0RA 4X62L 5GAEC 1VQOA 4Y52H 1D7QA 3WWVA 5FLXc 1A8VA 4L5QA 3CAMA 4JI6L 4X64Q 1V1QA 1VQPA 1S72A 1K8AC 4LF8Q 1TWFH 1HR0Q 1PH5A 3PV0A 2OTJA 5IP7H 4A3JG 1HH2P 2N78A 4JBKA 3NELA 3J7ZC 3S24A 4LFAL 2JA8H 1SMXA 4NXNL 5IP9H 1JJGA 2R92G 1VQHA 1QVGA 1EYGA 4GN4B 4IPHA 4DUZL 3I4NG 1QZHA 4DR4L 5FJ8H 2E2JH 3GTGH 2JA9A 4TQUS 3HOVG 5E7NA 1S3OA 2D0PA 4DR2L 4A93G 3H0GG 4DR1Q 1Y1VH 3RNUA 4JI3L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYY A;  1N32 L;  4JG2 A;  4JOI A;  1XNQ L;  3E9I A;  1HNZ Q;  1CSP A;  1XNR Q;  4A3F H;  4A3B H;  4DR3 Q;  3PIP A;  3FP9 A;  4HJ8 A;  1J6Q A;  2K52 A;  1Q86 C;  2RHS B;  1Q12 A;  1VQF A;  3AEV A;  5JJL A;  4JI2 L;  2A1A A;  3HOU H;  2A19 A;  1KAW A;  2ATW A;  1YHQ A;  2D0O A;  4A3J H;  5C4J H;  1PV4 A;  1E1T A;  3STB C;  1LUZ A;  5IYB H;  3F2D A;  1KL9 A;  2OQ0 A;  4BBS G;  2NZH A;  1UE6 A;  3S1Q H;  2R92 H;  2RF4 A;  3I4N H;  4JI1 Q;  2PI2 E;  1YNX A;  2IT1 A;  4NPS A;  4JI8 L;  1IBL L;  1HZC A;  2B63 G;  4LFB Q;  2IY5 B;  3K81 C;  1T9H A;  3RLF A;  1O7I A;  4XTC S;  2KHJ A;  3SGI A;  4DV6 L;  4LF9 L;  4A3D G;  5ELO A;  1MJC A;  4GOP B;  3HOX H;  4POF A;  1HJP A;  2K5V A;  2PQA A;  3I4O A;  3GO5 A;  4GNX A;  1WCM H;  2F4V Q;  2ZTC A;  4DV1 L;  1WFQ A;  2OTL A;  2JA6 H;  4KI0 A;  2E5L L;  2KCT A;  1IBK Q;  4WJ3 M;  3BU2 A;  4C3J H;  3W1G A;  4X64 L;  4OX9 L;  1W2B A;  4P75 A;  2DUD A;  2Q2T A;  3Q8D A;  1X9N A;  4A3K G;  1N36 Q;  3M85 A;  2VQF Q;  4BY7 H;  3NBH B;  4R4C A;  2NN6 I;  4GLX A;  3KF6 A;  1B8A A;  3S17 H;  2VS1 A;  1XJV A;  1YZ6 A;  2WB1 E;  1C9O A;  1TXY A;  2GN5 A;  2MO1 A;  4UP9 A;  4ALP A;  3J7A 5;  4IPD A;  1JB7 A;  1GKH A;  5IWA Q;  3S16 H;  1YJ9 A;  4BBS H;  2MQH A;  2UXC L;  3CW2 C;  3GTM H;  1NTG A;  5IE8 A;  1PH9 A;  5FLM G;  4A3E G;  4YCW A;  2AWN A;  4DR5 L;  4JBW A;  5IYD G;  1IXR A;  1L1O C;  3S2H H;  1HNW Q;  5IT9 c;  1VQE A;  1HR0 W;  3HKZ E;  1X6O A;  4B3T Q;  1OXT A;  4OON A;  3B6Y A;  4L5T A;  1HNZ L;  1X65 A;  3RZO H;  4GKK Q;  1N8R C;  1R9T H;  5LMU L;  3CCM A;  2GVA A;  4L5R C;  4UP8 A;  3UE1 A;  1M1K C;  1UE1 A;  2UUC Q;  2K14 A;  3CMA A;  1VQ5 A;  1EOV A;  1A63 A;  2LXJ A;  3PF5 A;  4KLK A;  4LW1 A;  4IPG A;  4DR6 Q;  1N34 Q;  4YHH L;  3D0F A;  4JI4 Q;  4B3R Q;  4JI5 L;  3T1H L;  5IP7 G;  3CME A;  3PSI A;  3HOY H;  2UUA L;  2ZJR A;  1VQD A;  4QIW E;  1JE5 A;  1Q8K A;  1NY4 A;  3U4V A;  4JCV E;  4APV A;  1KRS A;  1VCI A;  4LF6 L;  1SFO H;  1VQI A;  1Y14 B;  1XMQ L;  1CUK A;  3L7Z C;  3CCQ A;  4DNI A;  3RN2 A;  5K36 G;  1I94 Q;  2WP8 J;  4MZ9 A;  3G6E A;  3CCU A;  3AYH B;  2ZM6 Q;  1PHJ A;  2UUB L;  4L5S A;  2NVQ H;  4B3M Q;  5C44 G;  1Q1E A;  4FDB A;  4JOI C;  4HIO A;  2ASB A;  3H3V I;  3CC2 A;  3U50 C;  1Y1V G;  4R4Q A;  4B3S Q;  3GTJ H;  4LF7 Q;  2JEA I;  1IBK L;  3BZK A;  1XPO A;  2VY3 A;  1NMG A;  5M5Y H;  4MTN A;  4DV4 Q;  1K3R A;  4DUY Q;  2UXB L;  3J81 i;  1EQR A;  2ALY B;  2E2I H;  2DGY A;  1X56 A;  4DV7 L;  1VS0 A;  1J5E Q;  4JV5 Q;  1VQK A;  1V9P A;  3M4Q A;  4OO1 G;  3IRB A;  3JAM c;  3LGJ A;  2Z0S A;  1PH8 A;  1JJ2 A;  4LFC Q;  2VUM H;  2N49 A;  4R4T A;  4HJ5 A;  1W3S A;  3HOU G;  2N3S A;  4GOP A;  1HZA A;  5IWA L;  2YTX A;  2K5N A;  4DV2 Q;  5IYB G;  2OQK A;  1VQ6 A;  1TWH H;  2PI2 A;  1VQA A;  2R6G A;  2KEN A;  2CCZ A;  4GN5 A;  1HNW L;  4O0A A;  4NXM L;  4AH6 A;  3CD6 A;  4NB3 A;  1NMF A;  3CPW A;  1G6P A;  4GNX C;  3FKI H;  3A74 A;  2HQL A;  2K4K A;  4KHP Q;  1DGS A;  2K75 A;  4YCV A;  2KHI A;  4GKK L;  2K50 A;  2XGT A;  2R7F A;  5C44 H;  3HOX G;  3CC7 A;  1GD7 A;  1I5F A;  2Z6K A;  4YWM A;  2IX0 A;  2YTV A;  1WCM G;  4R1J A;  3S15 H;  2HHH Q;  4H02 A;  2QA4 A;  1K9M C;  1YIJ A;  1EFW A;  1KIX A;  2JA6 G;  2Q2I A;  2NN6 G;  5M3M H;  1TWA H;  3PUX A;  3M4P A;  1Q82 C;  1MIU A;  3U58 A;  4JBJ A;  1QVF A;  2E8G A;  1UEB A;  1WYD A;  2D62 A;  3H15 A;  5J3B A;  4DV3 Q;  4BY7 G;  1U0L A;  1CKN A;  4A76 A;  4LF4 Q;  1L2F A;  4PG3 A;  2VQE Q;  1HNX L;  2BA0 A;  4IJH A;  1UE7 A;  3K7U C;  4HJA A;  2R93 G;  5BR8 Q;  2NZO A;  2CKZ B;  3BZC A;  1S40 A;  1VQG A;  5GRO A;  2ZM6 L;  3ER0 A;  4X65 Q;  5C4X H;  3CCL A;  3T1Y L;  4DV5 Q;  4HIM A;  3S14 H;  2ZJQ A;  4QY7 A;  4JI0 Q;  2ES2 A;  3AFQ A;  1NJI C;  4AYB E;  5HGQ A;  4AQY L;  2V1C C;  1LYL A;  3I7F A;  3A5U A;  1OXV A;  1K8G A;  1VQL A;  1UE5 A;  3K80 C;  2I0Q A;  4PZ6 A;  2AHO B;  3PIO A;  4JBM A;  4JYA Q;  1TWC H;  1HZ9 A;  1P16 A;  1PH7 A;  5GQO A;  1EWI A;  3CCJ A;  4LF5 Q;  1N33 Q;  2I5L X;  4LF8 L;  3GTK H;  1CKO A;  1HR0 L;  1I50 H;  1MKH A;  1X3G A;  4R4O A;  1IBM Q;  1VQ4 A;  5C0X I;  4A3I H;  1NE3 A;  2Q2U A;  3TRE A;  2B29 A;  1XPU A;  1PYB A;  3HOY G;  1XTD A;  1KRT A;  1VQJ A;  2BH8 A;  2JQO A;  4YWL A;  3OTO Q;  1KD1 C;  3ULJ A;  4JI7 Q;  3W5O A;  1ASZ A;  3J81 j;  2UXD Q;  1PYS B;  1YHA A;  2R93 H;  1SRO A;  1U5K A;  4GKJ Q;  4BBR H;  3GD7 A;  4GS3 A;  1VQN A;  2CQO A;  2GVB A;  3RR5 A;  4C2M H;  3FHW A;  3HOZ H;  3S1M H;  2UU9 Q;  4DR1 L;  4AIM A;  1CKN B;  2JA7 H;  3KDF B;  4J15 A;  4BXX G;  2BH2 A;  4JC0 A;  4UY8 C;  4OXP A;  3GDE A;  1XNR L;  1N9W A;  3CCR A;  1PH6 A;  4LUO A;  4TVA B;  4X62 Q;  4DAM A;  5IYC H;  4K0K Q;  2JEB I;  1FL0 A;  5ELN A;  3JC6 6;  4AYB G;  4DR3 L;  1V43 A;  2NVY H;  2YTY A;  5EAY A;  4JI6 Q;  3GTQ H;  4OWX B;  3M4O H;  3MXN B;  4GOP C;  4IOA A;  1P8L A;  3TRZ A;  4P74 A;  4PMW A;  5C0X J;  4A3M H;  2VUM G;  3KLW A;  4LFA Q;  3PO3 G;  1Y1W H;  5AJ3 Q;  4NXN Q;  3EN2 A;  1PH3 A;  1BBU A;  3G48 A;  4IO9 A;  1OTC A;  4DUZ Q;  2WAQ E;  4IJL A;  4DR4 Q;  2N8N A;  4BA1 I;  4DPG A;  2C35 B;  4JI1 L;  2H5X A;  2LXK A;  4BA2 I;  4DV5 L;  3H3V H;  1Q81 C;  4LFB L;  1KHI A;  1PFS A;  4YCU A;  3UE0 A;  4DR2 Q;  3E9H A;  4A3L H;  1WI5 A;  3FKI G;  1D8L A;  3AQQ A;  4JI3 Q;  4LNQ A;  1YEZ A;  2KCM A;  1B7Y B;  3CC4 A;  1N32 Q;  2F4V L;  4DR7 Q;  4BXX H;  1XNQ Q;  3K7A H;  3MEF A;  3PCO B;  5M5X H;  3ICE A;  2HIX A;  3PGZ A;  4DV0 Q;  3L0O A;  1RIP A;  5M3M G;  3OW2 A;  1CKM A;  3J80 c;  2ID0 A;  4JI2 Q;  1N36 L;  2EXD A;  4PZ7 A;  1SE8 A;  2VQF L;  5LMN Q;  1FVI A;  4DAY B;  3RZD H;  3ERS X;  1PH1 A;  1YBY A;  2CWA A;  4PZ8 A;  3HOW G;  3OTO L;  1WOC A;  5DLQ E;  3PO3 H;  5M3F G;  2Q2H A;  2UXD L;  4HID A;  1YJN A;  2EIF A;  1A0I A;  2IHF A;  4P73 A;  5JJI A;  1X3E A;  2RHQ B;  3JAM i;  4P71 A;  3AFP A;  2R7Z G;  1I6H H;  1Z9F A;  2IHE A;  4OWT B;  3M9B A;  1HZB A;  4JI8 Q;  4BY1 G;  4YY3 Q;  1IBL Q;  4IPC A;  3GTP H;  4DV6 Q;  4LF9 Q;  4IFD I;  3L2P A;  1GVP A;  1YVC A;  1VQ8 A;  5C4X G;  1Q7Y C;  5JJK A;  1QVC A;  2WAQ G;  3ZJY C;  4B3T L;  2YV5 A;  3KFU A;  2YU9 H;  1LM0 A;  1LTL A;  3F2C A;  4RMF A;  3A0J A;  4DV1 Q;  1FJG Q;  2E5L Q;  4LWC A;  5C3E H;  1XMO Q;  4OX9 Q;  2UUC L;  3UDG A;  5C0X G;  4MNO A;  1KXL A;  1YJW A;  3ULL A;  3F1Z A;  4O2D A;  1KQS A;  1EIF A;  4LUV A;  4DR6 L;  4KHZ A;  1N34 L;  1X55 A;  5AJ3 L;  4JI4 L;  4B3R L;  2EQS A;  2VZA A;  2KBN A;  1AE3 A;  1K83 H;  4A3I G;  1SR3 A;  3HOW H;  3PO2 G;  3CPF A;  3KDF A;  3KOJ A;  5JEA J;  3ULP A;  4X6A H;  5M3F H;  1H95 A;  1EUJ A;  2UXC Q;  3PUW A;  1YHB A;  3CCS A;  2HT1 A;  4WJ4 A;  2K5H A;  2R7Z H;  4DR5 Q;  1JMC A;  4BBR G;  4BY1 H;  4IFD J;  1I94 L;  4XIG S;  1SRU A;  3RLN A;  4QQB X;  4B3M L;  1E7Z A;  1PH2 A;  1OXU A;  3HOZ G;  4DR7 L;  3UDX A;  2LSS A;  2CFM A;  4GLV B;  3PF4 A;  2PNH A;  1QUQ B;  1WJJ A;  5GAG C;  4B3S L;  4LF7 L;  3I55 A;  2JA7 G;  3TS2 A;  1EQQ A;  2JA5 H;  3A5Z B;  4DV0 L;  3K8A A;  5LMU Q;  3K0X A;  1MJE A;  2I5M X;  2XTI A;  4X66 Q;  4DV4 L;  4DUY L;  3W1B A;  5IYC G;  3F2B A;  2ZTD A;  4C3I H;  2FXQ A;  2Y0S G;  1BVS A;  5LMN L;  4DKA C;  2A8V A;  4JV5 L;  1J5E L;  1I3Q H;  1M90 C;  3DM3 A;  1L1O B;  1E22 A;  4QGU A;  5HY6 A;  4YHH Q;  3CCV A;  4LFC L;  2QGQ A;  4JI5 Q;  1Q46 A;  4DK6 C;  3T1H Q;  2UUA Q;  4OO1 I;  4YWK A;  4A3M G;  1BBW A;  1GM5 A;  1X3F A;  4GN3 B;  5H1S E;  4HJ9 A;  1Y1W G;  1PVO A;  4DV2 L;  1L0W A;  3PO2 H;  3DLL A;  4LF6 Q;  1GO3 E;  4YY3 L;  2IX1 A;  1XMQ Q;  5M5W H;  3CXC A;  3EIV A;  3STB D;  3HOV H;  4A93 H;  1G29 1;  4POG A;  3H0G H;  2UUB Q;  3VDY A;  3RN5 A;  4KHP L;  5LMN W;  1Q1B A;  4A3L G;  1C7Y A;  1FJG L;  4A3G G;  2HIV A;  4A75 A;  2NVT H;  1QZG A;  4R4I A;  3S1N H;  1XMO L;  3U4Z A;  2MNA A;  3E0E A;  3TQY A;  2HHH L;  1YIT A;  5IY0 A;  2WFW A;  2PMZ E;  4UPA A;  2UXB Q;  2MFI A;  2MO0 A;  2AWO A;  1K73 C;  2OCE A;  3KJO A;  3KF8 B;  2JJQ A;  4DV7 Q;  2F52 A;  2YYZ A;  1VQM A;  3CP0 A;  1CSQ A;  4GLA C;  1XPR A;  5JEA G;  3NEN A;  1G51 A;  3UDF A;  4DV3 L;  3NEM A;  2E2H H;  3GTL H;  1OXX K;  3RLO A;  1AH9 A;  4LF4 L;  4C3H H;  1SLJ A;  4A3C G;  2VQE L;  4EX5 A;  4IFD G;  1VQ7 A;  1BKB A;  2F3I A;  5BR8 L;  4LUZ A;  4QJF A;  3CF5 A;  2B63 H;  1YI2 A;  2VL6 A;  4A3D H;  4NXM Q;  4X65 L;  2NVX H;  1ASY A;  3KJP A;  1VQB A;  1PA6 A;  4Y7N H;  2AKW B;  3HFZ B;  3KYH C;  4JI0 L;  2I5H A;  3BJU A;  4HJ7 A;  3I4M G;  3CQZ H;  2Z6K C;  3UDI A;  2RCN A;  1NBW A;  4A3G H;  4IOC A;  1E3P A;  4X66 L;  1A62 A;  3S2D H;  2JE6 I;  2R7D A;  2QEX A;  3CCE A;  4JYA L;  1AE2 A;  1C0A A;  2OWO A;  1JT8 A;  3M3Y H;  1JJC B;  3EBE A;  4QL5 A;  3PUY A;  5C3E G;  4LF5 L;  1N33 L;  4ME3 A;  4A3K H;  2CWP A;  1Z47 A;  3G71 A;  3TS0 A;  1IL2 A;  3PUV A;  2PQA B;  1X54 A;  1FGU A;  1UWV A;  4GNX B;  1IBM L;  2JA8 G;  3GTO H;  5IP9 G;  4RG1 A;  2B3G A;  1TWG H;  1RL2 A;  1SN8 A;  3J80 i;  3G4S A;  1HNX Q;  1QUQ A;  4EQ5 A;  5GAH C;  1VQC A;  4A3C H;  1IZ6 A;  4JI7 L;  2VNU D;  2WB1 G;  5FJ8 G;  5FLM H;  2VW9 A;  4A3E H;  2ZJP A;  4GKJ L;  5IYD H;  1E1O A;  3D31 A;  4P72 A;  3PUZ A;  2L15 A;  3TEH B;  2BA1 A;  4DK3 C;  1EIY B;  2AMC B;  3HKS A;  3KF6 B;  3T1Y Q;  3S1R H;  1KC8 C;  1VQ9 A;  2UU9 L;  4A4I A;  1L1O A;  3J81 c;  1E24 A;  4OWW B;  3I2Z A;  2JK8 A;  4AQY Q;  1B70 B;  3I56 A;  3HKZ G;  3I4M H;  4HIK A;  4UP7 A;  1OXS C;  3F8T A;  2Y0S E;  5GAD C;  4A3F G;  1PH4 A;  2JA5 G;  1IYJ B;  3M7N A;  4A3B G;  4K0K L;  2ZTE A;  1K0R A;  4X62 L;  5GAE C;  1VQO A;  4Y52 H;  1D7Q A;  3WWV A;  5FLX c;  1A8V A;  4L5Q A;  3CAM A;  4JI6 L;  4X64 Q;  1V1Q A;  1VQP A;  1S72 A;  1K8A C;  4LF8 Q;  1TWF H;  1HR0 Q;  1PH5 A;  3PV0 A;  2OTJ A;  5IP7 H;  4A3J G;  1HH2 P;  2N78 A;  4JBK A;  3NEL A;  3J7Z C;  3S24 A;  4LFA L;  2JA8 H;  1SMX A;  4NXN L;  5IP9 H;  1JJG A;  2R92 G;  1VQH A;  1QVG A;  1EYG A;  4GN4 B;  4IPH A;  4DUZ L;  3I4N G;  1QZH A;  4DR4 L;  5FJ8 H;  2E2J H;  3GTG H;  2JA9 A;  4TQU S;  3HOV G;  5E7N A;  1S3O A;  2D0P A;  4DR2 L;  4A93 G;  3H0G G;  4DR1 Q;  1Y1V H;  3RNU A;  4JI3 L; 
#chains in the Genus database with same CATH topology
 3E9I A;  1HNZ Q;  1CSP A;  1DOM A;  4EQO A;  3PIP A;  2SEB D;  4HJ8 A;  1J6Q A;  1V8Q A;  1Q12 A;  1D6E C;  1Z6H A;  1SAP A;  4A3K B;  2K05 A;  1YHQ A;  1Z7T A;  5I6W A;  1DD2 A;  4LMQ D;  2F0D A;  3STB C;  2OQ0 A;  2NZH A;  1UE6 A;  3SEB A;  3S1Q H;  2R92 H;  3I3C A;  4JI1 Q;  2KVM A;  3ERQ A;  4LFB Q;  4A3E B;  4XQN A;  4DV6 L;  1D7Q A;  1O7I A;  1J9O A;  4XQQ A;  1F2Y A;  3HOX H;  1HJP A;  2DNE A;  2PQA A;  3S1R B;  4GNX A;  1A3T A;  5KIX A;  2F4V Q;  2KJX A;  1WFQ A;  1JIC A;  3K5O A;  3PIP 3;  3P20 A;  4KI0 A;  2OTL A;  4WJ3 M;  3BU2 A;  4C3J H;  3NWS A;  3W1G A;  1NNX A;  5ELD A;  4P75 A;  1ZXT A;  3DMU A;  1EZ8 A;  4CJ1 B;  5A35 A;  3KF6 A;  3S17 H;  2WB1 E;  1GUO A;  4UP9 A;  4ALP A;  1SNO A;  1GUT A;  1JB7 A;  3S16 H;  2JA8 B;  2UXC L;  4YCW A;  1ENF A;  2AUJ D;  2E2J B;  3GTG B;  3HKZ E;  4Q5V A;  1HNZ L;  4GKK Q;  3P75 A;  3MXU A;  3A7A B;  4HSP A;  1Y1V B;  1JC7 A;  3CCM A;  4L5R C;  1U9R A;  1UE1 A;  4A3F B;  1WTX A;  3CMA A;  5C3X A;  4A3B B;  4KLK A;  4DR6 Q;  4YHH L;  1CI3 M;  4DNR B;  3T1H L;  3PSI A;  2C5C A;  4C3I B;  4IUN A;  1SYG A;  3HOU B;  1JE5 A;  5I9P A;  1SFO H;  1BOS A;  3NTI A;  3K57 A;  4ZYS A;  4XT3 B;  3RN2 A;  4OHJ A;  4QIW B;  2ZM6 Q;  1BDO A;  4L5S A;  2NVQ H;  4ZUI A;  4B3M Q;  4FDB A;  4JOI C;  3H3V I;  5FO9 B;  1FYC A;  4B3S Q;  3C1E A;  4LF7 Q;  3BZK A;  5CV9 A;  2EPB A;  1XPO A;  3TZU A;  3J81 i;  2ALY B;  1IKM A;  1X56 A;  4DN4 M;  4JV5 Q;  4IUU A;  1VQK A;  1V9P A;  3M4Q A;  3JAM c;  3S15 H;  1JJ2 A;  4HJ5 A;  4JW0 A;  1R4P B;  2R61 A;  4N9P A;  5IGG A;  4GN5 A;  3KUP A;  4O0A A;  2K5W A;  4C1N K;  3GTM B;  3CPW A;  3D6C A;  1UEA B;  2MGS A;  4KHP Q;  1DGS A;  1CZW A;  1PFM A;  2K75 A;  4YCV A;  4GKK L;  4J8Q A;  2WAC A;  5C44 H;  3HOX G;  1X32 A;  1LTB D;  2LMC B;  2HHH Q;  1EFW A;  1K9M C;  1H9R A;  1WTR A;  5M3M H;  4C3J G;  4HSV A;  1PFB A;  3VYT A;  3M4P A;  4N9T A;  1MIU A;  4B9W A;  4ZLT F;  5CYU A;  1QVF A;  2E8G A;  1WYD A;  2DY8 A;  4KV6 A;  4HN7 A;  1U0L A;  2XWJ B;  5DM6 3;  1L2F A;  3DWQ A;  4R8I A;  3HOY B;  4XYQ A;  4BWG B;  4HJA A;  4RHS A;  3T4A C;  1MSG A;  4G7H C;  1SYD A;  4L63 B;  1S40 A;  2ZM6 L;  4CKB A;  3CCL A;  3S14 H;  4QY7 A;  3AFQ A;  4AYB E;  4AQY L;  3KBG A;  2I0Q A;  5CC4 A;  4PZ6 A;  3PIO A;  3QOJ A;  2AQ3 B;  2QEJ C;  1N33 Q;  4DAP A;  1GHJ A;  5EQ0 A;  2XN9 C;  1CKO A;  1AEX A;  2Z8L A;  1IHZ A;  1KDC A;  1X3Q A;  3LX0 A;  1HR0 L;  5ELE A;  5C0X I;  2Q2U A;  2B29 A;  1XTD A;  4KKU A;  1KRT A;  2JQO A;  4YWL A;  1KD1 C;  2VXW A;  3ULJ A;  2F03 A;  1PYS B;  2N88 A;  1U5K A;  3K5N A;  1TWH B;  4GKJ Q;  3CU7 A;  3GD7 A;  3NE5 B;  4GS3 A;  2BCO A;  4C2M H;  3IAY A;  1DOK A;  2F0N A;  4DR1 L;  3QR8 A;  4U68 A;  4DA2 A;  4J15 A;  3HS0 C;  5HGT A;  2QDB A;  3CCR A;  4X62 Q;  4DAM A;  3EA6 A;  4IUP A;  2SDF A;  1CHP D;  3C1F A;  5G3L D;  3MXN B;  1ENC A;  1IYV A;  4EQP A;  5TSS A;  4P74 A;  1BBU A;  1KAB A;  3G48 A;  3I73 A;  3TBI B;  3OIQ A;  2A69 D;  1PTO D;  1PZJ D;  1K28 A;  2EE1 A;  3H3V H;  1W6K A;  4DR2 Q;  4H7B A;  4A3L H;  3K6O A;  2MJ8 A;  3D3R A;  1B7Y B;  2KCC A;  2G9D A;  1CK1 A;  2CW0 D;  5G3L F;  4M1U B;  3K7A H;  1I4R A;  3HOX B;  1O80 A;  3L0O A;  5M3M G;  3J80 c;  1JR0 D;  1STY A;  4JI2 Q;  1N36 L;  1PTO F;  2EXD A;  2VB2 X;  2ZT9 C;  2ZXO A;  1K8M A;  4C3J B;  3MXP A;  3ERS X;  1I50 B;  1ICW A;  4PZ8 A;  1G2T A;  3K5M A;  5DLQ E;  1F9S A;  4HID A;  1A0I A;  1QG7 A;  1RHP A;  1X3E A;  2R3Z A;  4P71 A;  1Z9F A;  2IHE A;  1HZB A;  2EZV A;  3FRP B;  4LF9 Q;  3FPU B;  1JOK A;  2HCC A;  4K8I A;  1KAA A;  3KFU A;  4N8F A;  1HTP A;  1JOR A;  1V1O A;  2X69 A;  3R2T A;  4RMF A;  2E5L Q;  4LWC A;  5C3E H;  1B4O A;  1XMO Q;  4RHR A;  3UDG A;  4MNO A;  1KXL A;  4RCN A;  3F1Z A;  4O2D A;  4LUV A;  1Y8O B;  4KHZ A;  4QUC A;  1N34 L;  4JI4 L;  1QB5 D;  2EQS A;  2VZA A;  1AE3 A;  1SR3 A;  1GUS A;  3KOJ A;  3D4R A;  2NTT A;  5IGD A;  1LV9 A;  2KED A;  4IFD J;  5CMD A;  1I94 L;  1SNP A;  3IFT A;  3MXN A;  2X6G A;  1OXU A;  3EVQ A;  4GLV B;  3PF4 A;  3Q23 A;  1EWH A;  5GAG C;  1WJJ A;  3NQT A;  2H4O A;  3BVM A;  3K8A A;  5LMU Q;  2KEC A;  5KYI A;  2D5D A;  4X66 Q;  1LO5 D;  3W1B A;  1ZYR D;  1BVS A;  5ELF A;  2EYJ A;  5C0X H;  1I3Q H;  1E22 A;  4QGU A;  5HY6 A;  4DK6 C;  1PMR A;  2UUA Q;  4OO1 I;  1GM5 A;  4RGM A;  1X3F A;  5H1S E;  4HJ9 A;  1PVO A;  4DV2 L;  3DLL A;  4LF6 Q;  2RQX A;  3CXC A;  2PZW A;  2F0O A;  2K04 A;  4H0L C;  4IN3 A;  1F2L A;  3GTP B;  3T51 B;  3D4W A;  4A3L G;  1C7Y A;  4A3G G;  3VYS A;  2HIV A;  1ROD A;  1XMO L;  2EY6 A;  2MNA A;  3BDC A;  3TQY A;  1YIT A;  5IY0 A;  2WFW A;  2UXB Q;  2A74 C;  1DZ1 A;  5IOD A;  2OCE A;  3KF8 B;  2JJQ A;  1VQM A;  2A68 C;  1S5C D;  4RA8 A;  4OIK A;  1G51 A;  2F0J A;  3NEM A;  5M3M B;  1OXX K;  1ILQ A;  4LF4 L;  1AH9 A;  2LY7 A;  3VA7 A;  4C3H H;  1K83 B;  1BKB A;  1JCK B;  1VF5 C;  2F3I A;  3TP7 A;  2B63 H;  4KKT A;  1D1K A;  2VL6 A;  4A3D H;  2CW0 C;  4IAL A;  2FJ2 A;  2JSO A;  3HFZ B;  4JI0 L;  3I4M G;  1BQQ T;  4X66 L;  1A62 A;  1HTL D;  2JE6 I;  5KYL A;  4FNF A;  4JYA L;  1AE2 A;  1K8O A;  1GUG A;  2JA5 B;  5C3E G;  4ME3 A;  4A3K H;  1IL2 A;  3PUV A;  5EBC A;  1X54 A;  1UWV A;  1IBM L;  2Q8R E;  3EFX D;  1RL2 A;  5HUR A;  3G4S A;  1HNX Q;  4JI7 L;  2VNU D;  2WB1 G;  4A3E H;  1F9P A;  4HMI A;  2BA1 A;  2AMC B;  1EU3 A;  3S1R H;  1KC8 C;  4A93 B;  3VYU A;  2RSN A;  3I56 A;  3HKZ G;  4HIK A;  1OXS C;  4PMB A;  2PZU A;  3M7N A;  1ONL A;  2NVT B;  3S1N B;  5FLX c;  1A8V A;  4QMG A;  4LF8 Q;  2F0F A;  1FNU A;  3PV0 A;  4A3J G;  1S5D D;  4KY7 A;  2HDM A;  2JA8 H;  2WV6 D;  2E2J H;  1STG A;  3GTG H;  5C4H A;  2JA9 A;  1S3O A;  1SXT A;  3KF8 A;  1CT1 D;  2I07 B;  4KJN A;  4K5V A;  2NYZ D;  1Y1V H;  3D8G A;  1G8Z D;  1N32 L;  2CH4 A;  2RSO A;  1NR4 A;  1XNQ L;  2IJ0 A;  1U4L A;  2QCP X;  1QCB D;  4I7A A;  4A3G B;  4A3F H;  4A3B H;  1I4G A;  4DFA A;  4DR3 Q;  4TRD A;  2F0I A;  3OWE B;  3FP9 A;  5IT9 E;  1Q86 C;  3AEV A;  4OL7 A;  3M3Y B;  5JJL A;  4OO1 H;  1SSO A;  1TT2 A;  2A1A A;  2XNA C;  3HOU H;  1KAW A;  1PV4 A;  5CGK A;  5IYB H;  3GTO B;  1KL9 A;  4C3H G;  1KDB A;  4BBS G;  2RF4 A;  2PI2 E;  1D5Z C;  1YNX A;  2IT1 A;  5E3F A;  2B63 G;  5E4W C;  2K03 A;  1T9H A;  1PTO B;  3K81 C;  4A3D G;  3SGI A;  5ELO A;  4GOP B;  2IL8 A;  5E4X A;  2K5V A;  3GO5 A;  4B9X A;  2Z4I A;  4ID6 A;  4DV1 L;  1SNQ A;  1EIG A;  2NZ1 D;  1IBK Q;  3I4M B;  4OX9 L;  1SDF A;  1E2V A;  2EVB A;  1MD2 D;  3ND9 A;  4ODG A;  3Q8D A;  1X9N A;  4A3K G;  2VQF Q;  3EJI A;  3NBH B;  2XIW A;  4R4C A;  2HDL A;  1SYE A;  1C9O A;  1TXY A;  2MO1 A;  4XDX A;  4IPD A;  1GKH A;  2MQH A;  5JVH 3;  1FGB D;  3GTM H;  1NTG A;  5EKI A;  1PH9 A;  4A3E G;  4DR5 L;  4QB4 A;  3A8I E;  3C2P A;  1X6O A;  1XYI A;  4B3T Q;  1RTO A;  3LWU A;  4OON A;  3B6Y A;  4L5T A;  5KNC A;  3L3O C;  4XT1 B;  1EEI D;  1B53 A;  3UE1 A;  2UUC Q;  2V4D A;  1S5F D;  3TZD A;  1VQ5 A;  4JPB W;  2Z9H A;  1F2M A;  4B3R Q;  4KN4 C;  3CME A;  3CKI B;  3HOY H;  4K5X A;  3MFY A;  2BE5 D;  3OOC A;  1VQD A;  1Q8K A;  4A3J B;  1NY4 A;  2FMC A;  1II3 A;  1KRS A;  1VCI A;  1CUK A;  3CCQ A;  5K36 G;  4MZ9 A;  1PHJ A;  2UUB L;  2B2W A;  4HIO A;  3CC2 A;  1Y1V G;  4R4Q A;  1IBK L;  2L0C A;  5JJZ A;  2IPK D;  1A3U A;  1NMG A;  1WCM B;  2VY3 A;  4MTN A;  4OEL B;  2A6E D;  1H9J A;  2TMP A;  1I4X A;  3A54 A;  2ICI A;  2Z1C A;  1J5E Q;  1V1P B;  4OO1 G;  4N8X 1;  3HOU G;  2N49 A;  2JP1 A;  1JWM D;  2N3S A;  4GOP A;  5EBD A;  2YTX A;  1R4Q B;  5IYB G;  1VQ6 A;  1TWH H;  2B2T A;  1VQA A;  4QUF A;  2KEN A;  4C3H B;  4BBS B;  2NB0 A;  4NXM L;  4AH6 A;  4KTA A;  4NB3 A;  1NMF A;  3CD6 A;  1G6P A;  3FKI H;  3E6Z X;  2R7F A;  3NBH A;  4R8N A;  1GD7 A;  4YWM A;  5JPN C;  3L9A X;  3LWE A;  4CJ2 C;  2QA4 A;  1KTK A;  1KIX A;  2Q2I A;  1MHW C;  1Q82 C;  1EYC A;  1TS4 A;  3U58 A;  4TSS A;  5J3B A;  2D2C C;  3QOL A;  1PRT C;  5CV5 A;  4A76 A;  3DHQ A;  2EY1 A;  2KHS A;  3URY A;  3C46 A;  3K7U C;  1LTG D;  2NZO A;  3NTK A;  3FPP A;  3BZC A;  3FMC A;  5GRO A;  2HD3 A;  4HIM A;  1PXU A;  1QJO A;  1NJI C;  2V1C C;  1LYL A;  3I7F A;  2RA4 A;  3K80 C;  2AHO B;  4ZKC B;  2B8F A;  2LS0 1;  1P16 A;  2F0L A;  3CCJ A;  5C6A A;  5M5Y B;  3IKJ A;  2RDH A;  4AYB B;  1I50 H;  4FO2 A;  1X3G A;  1T5E A;  2E2I B;  1GUW A;  1SE3 A;  4A3I H;  2EY2 A;  1NE3 A;  3M4Y A;  3NPP A;  4FF2 A;  4KKS A;  1PYB A;  3HOY G;  1VQJ A;  2BH8 A;  4JVZ A;  4LJZ C;  2LKV A;  4IUT A;  3OTO Q;  3W5O A;  1STH A;  5L37 A;  1SRO A;  1SMY D;  4DXF A;  1QE6 A;  1VQN A;  2CQO A;  4K6D A;  3RR5 A;  4ABN A;  3HOZ H;  2UU9 Q;  1V1P A;  5T1G A;  4CBV A;  2JA7 H;  4BXX G;  1L0X B;  4UY8 C;  4CHT B;  3GDE A;  5EKK A;  5COY A;  1N9W A;  1SE4 A;  1AN8 A;  4TVA B;  5IYC H;  2GA4 B;  1EQT A;  1FL0 A;  5ELN A;  2SNS A;  4MN3 A;  2BE5 C;  2N55 A;  5EAY A;  3MAQ A;  4FXG C;  1G91 A;  4XQJ A;  3TRZ A;  5C0X J;  1YNJ D;  3MA2 B;  4NXN Q;  2O5I C;  5KND A;  1S4Z A;  2WAQ E;  4DR4 Q;  4BA1 I;  4JI1 L;  4OGQ C;  3NP8 A;  2EJM A;  2M00 A;  4LFB L;  1PFS A;  3VR2 A;  3HP3 A;  1WI5 A;  4CDE C;  3FKI G;  1D8L A;  1CM9 A;  1WTH A;  2A6E C;  3AQQ A;  4FYD A;  2F4V L;  4DR7 Q;  5M5X H;  1D5M C;  3PGZ A;  1ZEQ X;  1RIP A;  1BF4 A;  1RCV D;  1TWC B;  3OW2 A;  1CKM A;  5JEA H;  2TSS A;  3GV6 A;  2ID0 A;  2CWA A;  2EXZ A;  2B2V C;  3U9S A;  3OTO L;  1WOC A;  1GHK A;  2EIF A;  1EY8 A;  3Q22 A;  2RHQ B;  2A5H A;  4OWT B;  4JI8 Q;  1IBL Q;  4BY1 G;  4YY3 Q;  3Q24 A;  4IPC A;  4IQZ A;  3GTP H;  1VQ8 A;  1GVP A;  1RTN A;  1YVC A;  5JJK A;  4FP5 D;  1HUM A;  1O7Z A;  3WDN A;  1LTL A;  3V05 A;  4BS9 A;  1WTQ A;  2J0T D;  3A0J A;  1Y8P B;  1FR3 A;  1DXM A;  2MPM A;  3OW7 A;  3FDT A;  4DR6 L;  1U4R A;  2NVY B;  5KNB A;  3M4O B;  1X55 A;  1K83 H;  4A3I G;  1PZK D;  1IW7 D;  4J6H A;  4X6A H;  1EUJ A;  1RKN A;  3PUW A;  4ZQ3 A;  1IKL A;  1TR5 A;  4WJ4 A;  2HT1 A;  2G5D A;  2K5H A;  2L12 A;  3R93 A;  4Q0F A;  3RD4 A;  4XIG S;  5FKA C;  4QQB X;  4QF4 A;  4B3M L;  1E7Z A;  3HOZ G;  4DR7 L;  2E75 C;  2EYO A;  2LSS A;  3UDX A;  5CBE E;  2RDF A;  4B3S L;  4CDC C;  4FXK C;  5K5P A;  4LF7 L;  2JA7 G;  4CKE A;  2JA5 H;  1CTM A;  2EYP A;  3A5Z B;  5IYC G;  1XTC D;  3KLR A;  4JV5 L;  2KOL A;  1M90 C;  3CCV A;  1I4Q A;  2QGQ A;  4JI5 Q;  1RD9 D;  3RZD B;  1BBW A;  4HR7 B;  4ZCK A;  1SMY C;  2FHT A;  4GN3 B;  5FK9 C;  1E0B A;  1UAP A;  1L0W A;  2B2Y C;  4YY3 L;  1XMQ Q;  4A93 H;  2D9U A;  4PMC A;  1I6H B;  4HTH A;  2WKC A;  3RN5 A;  4KHP L;  1EU4 A;  3BVG A;  2K6A A;  2EOT A;  2NVT H;  1GUN A;  3S1N H;  1NSN S;  1JOO A;  3KLS A;  1HA6 A;  3FKI B;  4G7O C;  3E0E A;  2HHH L;  3H6M A;  1YNJ C;  4DV7 Q;  4DGZ A;  1K0S A;  3MWY W;  3T16 A;  2KUM A;  4GLA C;  1XPR A;  1SYB A;  5JEA G;  3WOE A;  3GTL H;  2A73 B;  4ULL A;  3GV3 A;  1MI2 A;  4A3C G;  4EX5 A;  5M9O A;  2A68 D;  4LUZ A;  4QJF A;  1IL8 A;  1YI2 A;  3HGB A;  4K6L A;  2NVX H;  1UUP A;  4NP5 A;  1VQB A;  3KYH C;  3TP8 A;  4BY1 B;  2OT2 A;  3BJU A;  3H94 A;  2Z6K C;  3UDI A;  1RJT A;  4A3G H;  4IOC A;  3S2D H;  2QEX A;  3CCE A;  1STN A;  1JT8 A;  3M3Y H;  1JJC B;  2AUK A;  4UHV A;  2F3W A;  1N33 L;  3DEP A;  3G71 A;  2NWG A;  4F7X A;  3GTO H;  5IP9 G;  1LAC A;  4RG1 A;  4DNT B;  1F9R A;  2O4X A;  4RGO S;  5BN4 A;  4L6T B;  4EQ5 A;  1I6V C;  1VQC A;  2E76 C;  5FLM H;  4A3I B;  1PTO H;  3Q6S A;  5T1I A;  4GKJ L;  5IYD H;  3D31 A;  1K3B C;  3PUZ A;  2L15 A;  1EIY B;  3SE0 A;  5M5W B;  3T1Y Q;  3A8K E;  2XVS A;  2IWH A;  1U4P A;  1VQ9 A;  3J81 c;  1E24 A;  2JK8 A;  3MTS A;  3I4M H;  4UP7 A;  5GAD C;  3HOZ B;  2JA5 G;  1IYJ B;  2F1M A;  2ZTE A;  4X62 L;  5GAE C;  4Y52 H;  3WWV A;  2JA7 B;  2M9V A;  1LTS D;  1S72 A;  4FF4 A;  1IW7 C;  2Z6B A;  2JXM B;  3HG9 A;  1PH5 A;  2OTJ A;  3SK8 A;  4JBK A;  3ONA B;  1LTT D;  1F9Q A;  1FNW A;  2E2H B;  4HED A;  1E2W A;  4V0B A;  4OEM B;  3I4N G;  4GN4 B;  1HQM C;  4TQU S;  1DJR D;  4EVO A;  4A93 G;  4DR2 L;  4OWW B;  3J7A F;  1LT3 D;  3SHL A;  4WOR A;  5A2Q E;  4JOI A;  1XNR Q;  1JWS D;  1L0Y B;  2KA7 A;  1ML0 D;  5AFW A;  1F2Z A;  1VQF A;  5M5X B;  4JI2 L;  2A19 A;  2F0K A;  3JAM L;  2D0O A;  4A3J H;  4WFN 3;  2B2V A;  2FFK B;  1LUZ A;  2K7V A;  4DXG A;  2EJF C;  3T56 B;  1LT4 D;  2IY5 B;  1DCZ A;  2PZT A;  3RLF A;  4LF9 L;  2VB3 X;  3EQL C;  4RKL A;  1MJC A;  2F0Q A;  1B3Q A;  2BDN A;  2NBF A;  1WCM H;  1EZ6 A;  4M8A A;  2E5L L;  2KCT A;  2NN6 H;  1Q3L A;  3X3M A;  4ZKB B;  3A56 A;  3UI2 A;  1VF7 A;  1W2B A;  2DNC A;  3OPO A;  1MGS A;  1CFM A;  3H3V C;  1EYA A;  2J7Z A;  2VS1 A;  1XJV A;  5CV8 A;  2GN5 A;  3F2U A;  5EGT A;  1BCP D;  4BBS H;  1AZP A;  3CW2 C;  1PDQ A;  5FLM G;  1PYW D;  2AWN A;  4JBW A;  1HQR D;  3QG1 A;  5IYD G;  1L1O C;  1A6X A;  5IT9 c;  1VQE A;  2ENB A;  4IZ8 A;  1OXT A;  1CA5 A;  1DM0 B;  4MTK A;  5IGF A;  1N8R C;  2PW7 A;  3PQI A;  5LMU L;  2GVA A;  1H9M A;  4UP8 A;  1M1K C;  3GP7 A;  1BCP F;  3TSS A;  1A63 A;  4HCE A;  3PF5 A;  2XRQ D;  5D14 A;  3D0F A;  1STE A;  1LTR D;  3DUZ A;  2UUA L;  2ZJR A;  4MHE A;  1FD7 D;  3U4V A;  2SNM A;  5C4J B;  4JCV E;  3BZD B;  4APV A;  4LF6 L;  2B2Y A;  1QNK A;  1A15 A;  1VQI A;  1Y14 B;  5A2Q L;  2MP1 A;  4RGT A;  3I4N B;  1KNE A;  2I46 A;  1X3P A;  3CCU A;  3PMF A;  1Q1E A;  2RVL A;  1ZKO A;  3U50 C;  2JEA I;  3SXH A;  5M5Y H;  4DV4 Q;  1K3R A;  4DUY Q;  2UXB L;  2M2L A;  2P5Z X;  2E2I H;  4K14 A;  1BBX C;  4K8J A;  5DNF A;  1GJX A;  4LFC Q;  3LGJ A;  2VUM H;  2HCI A;  4R4T A;  1NUC A;  1W3S A;  2LFN A;  4S3S A;  4BY7 B;  1HZA A;  1BR9 A;  1ESF A;  2K5N A;  3R3O A;  2PI2 A;  3GTL B;  2R6G A;  5EPJ A;  4F8M A;  1DOL A;  4GNX C;  5K36 H;  1ENA A;  1LAB A;  3KLS X;  3S2H B;  1I5F A;  2Z6K A;  2IX0 A;  1WCM G;  2NVX B;  4R1J A;  3QWN A;  4H02 A;  1H9S B;  5COR A;  2DJG C;  4PQX A;  2NN6 G;  1TWA H;  1R9T B;  3PUX A;  2XRS D;  3J80 L;  4JBJ A;  3S2D B;  4QCL A;  3TP5 A;  4NW2 A;  1UEB A;  3H15 A;  4DV3 Q;  1CKN A;  1D2B A;  2VQE Q;  1T5X D;  1BUV T;  1QWY A;  4IJH A;  1HNX L;  1UE7 A;  1LT6 D;  1HCZ A;  4ZUJ A;  2R93 G;  1EWC A;  1A2T A;  5BR8 Q;  3ND8 A;  2MUY A;  5D3I B;  4OIJ A;  4X65 Q;  4EQN A;  1PRT D;  3D6W A;  1M4V A;  4DV5 Q;  4O42 A;  2ZJQ A;  1HA5 A;  2ES2 A;  5HGQ A;  3A5U A;  1K8G A;  1TWC H;  1HZ9 A;  1PH7 A;  1I4H A;  2FMM A;  3FEW X;  4LF5 Q;  2I5L X;  1STB A;  2L4N A;  4RCO A;  3K59 A;  4LF8 L;  1BCP C;  1MKH A;  4R4O A;  4KHV A;  4LK1 C;  3MEH A;  3TRE A;  1PRT F;  3J81 j;  2UXD Q;  1YHA A;  3DXJ C;  2PYK A;  1WD1 A;  4FVM A;  4ZAI A;  2GVB A;  2PW5 A;  3IFD A;  1XWE A;  1EY7 A;  5CV7 A;  3N52 A;  5EPL A;  4AIM A;  3KDF B;  2ZXP A;  3R2I A;  4JC0 A;  2BOS A;  3QO2 A;  1BXT A;  3P1H A;  5FOB B;  4LAA A;  4K0K Q;  4LUO A;  3I4L A;  4DU9 A;  1M8A A;  3NHH A;  1EL0 A;  4AYB G;  2DY7 A;  1TS2 A;  1V43 A;  2NVY H;  4DR3 L;  4JI6 Q;  3M4O H;  4OWX B;  5LL6 S;  5I6Y A;  1P8L A;  2PMZ B;  2J4X A;  4PMW A;  1YNN C;  2VUM G;  2B8G A;  3A8J E;  3KLW A;  2Z4H A;  4LFA Q;  3PO3 G;  1Y1W H;  1CA6 A;  3EN2 A;  2C9O A;  3ZYY X;  4C56 C;  4DUZ Q;  4IJL A;  2WIN B;  1W6J A;  4DPG A;  2C35 B;  1B50 A;  1H9S A;  2LXK A;  3MHB A;  4BA2 I;  4DV5 L;  2JN4 A;  2F0W A;  1KHI A;  3H91 A;  3UE0 A;  4H13 C;  1EY4 A;  1O7L A;  2X6L A;  3I72 A;  4JI3 Q;  2WAQ B;  2DN8 A;  3WOF A;  4BXX H;  3NUC A;  3PCO B;  2HIX A;  3DWA A;  3NQI A;  1VDZ A;  4KMU C;  3E3X A;  1C4Q A;  2VQF L;  5LMN Q;  3RZD H;  1FVI A;  3NK9 A;  4DAY B;  1QOH A;  1PH1 A;  3GTK B;  1YBY A;  2F3V A;  3SK4 A;  3HOW G;  5M3F G;  2KQ3 A;  2Q2H A;  5IGC A;  2UXD L;  1TY2 A;  1YJN A;  1Y8N B;  2O2L D;  4P73 A;  3AMU A;  4TKO B;  3JAM i;  3AFP A;  2R7Z G;  1I6H H;  3M9B A;  4DV6 Q;  2R93 B;  1A2U A;  4B3T L;  2YV5 A;  4YIJ A;  4K5W A;  2IX3 A;  5IGE A;  1E2Z A;  2UUC L;  1YJW A;  1NCV A;  3ULL A;  2Y0S B;  3BS1 A;  3GTQ B;  4B3R L;  1STA A;  2RKS A;  1EY9 A;  3PO2 G;  4A3M B;  3KDF A;  3ULP A;  2UXC Q;  2L5T A;  1YHB A;  3QIA A;  2K28 A;  3CCS A;  2H1E A;  1BCP B;  1JMC A;  4BY1 H;  4WJW A;  1WVL A;  3RLN A;  1PH2 A;  2CFM A;  2PNH A;  1QUQ B;  3ITP A;  4K2L A;  4DK1 A;  1EQQ A;  2HUG A;  1TII D;  2XTI A;  1O7Y A;  5FLX L;  3IL8 A;  3F2B A;  2ZTD A;  5LMN L;  4DKA C;  5C3W A;  2A8V A;  2CH4 W;  1J5E L;  1F77 A;  3DM3 A;  5I4D A;  4YHH Q;  3T1H Q;  1Y1W G;  3SDZ A;  3OHX C;  4G57 A;  2PNR C;  2VUM B;  1EY5 A;  1GO3 E;  3PO3 B;  3CRK C;  5M5W H;  5KGU A;  3EIV A;  1O78 A;  3OMG A;  5NUC A;  3N6R A;  3VDY A;  5LMN W;  2DJF C;  4DAY A;  4A75 A;  3BG3 A;  1QZG A;  4R4I A;  1EYD A;  2YU9 B;  4HMJ A;  3U4Z A;  5CR3 A;  3A7L A;  5EKL A;  1MSH A;  2PMZ E;  4UPA A;  2MO0 A;  2AWO A;  1K73 C;  1UNS A;  2F52 A;  2YYZ A;  3I91 A;  3CP0 A;  2QDL A;  3NEN A;  2WKD A;  2E2H H;  3I90 A;  1TWA B;  1B9M A;  2A6H C;  5ELB A;  4IFD G;  1VQ7 A;  3HOW B;  5M3F B;  2F0E A;  2WII B;  2R7Z B;  3BDL A;  2I5H A;  2RCN A;  1NBW A;  1E3P A;  3SR1 A;  2R7D A;  1ILP A;  4X3S A;  2RDG A;  5LHY 1;  3DWP A;  4QL5 A;  3PUY A;  1DON A;  1NR2 A;  3MC0 B;  3GQB A;  1VMC A;  4I65 A;  3BYY B;  2ZXR A;  2EDG A;  1TWG H;  1SN8 A;  3J80 i;  1QUQ A;  4A3C H;  3TP6 A;  2F0T A;  3S9W A;  1LTA D;  5FJ8 G;  1XX8 A;  2VW9 A;  2PPB C;  3VR4 A;  2ZJP A;  3PO2 B;  1E1O A;  1HRJ A;  3TEH B;  2F0S A;  5DAU A;  1EY0 A;  3HOV B;  3SK5 A;  4NKL A;  2UU9 L;  4A4I A;  3I8Z A;  3H0G B;  4AQY Q;  1HXY D;  1PRT B;  1LLR D;  3F8T A;  2Y0S E;  1G2S A;  1K0R A;  4L5Q A;  4X64 Q;  1K8A C;  5EJW A;  1HR0 Q;  2NUC A;  5IP7 H;  2CVR A;  2N78 A;  3E5S A;  3NEL A;  4RGN A;  4NXN L;  5IP9 H;  4FF3 A;  2R92 G;  1VQH A;  1QVG A;  2OXP A;  3TDQ A;  1QZH A;  4DR4 L;  2B2U C;  1Y1W B;  5I2Y A;  1C8C A;  3D4D A;  5C5M A;  1WD0 A;  5E7N A;  1H9K A;  4IUQ A;  4DR1 Q;  5I9O A;  3OYY A;  4Y7N B;  4JG2 A;  4F88 A;  2K5D A;  1KLU D;  3CQZ B;  1QIL A;  1HPC A;  2L1B A;  3W3A A;  4Z9C B;  2K52 A;  1TQO A;  2L55 A;  2RHS B;  3VR3 A;  2ATW A;  1SYF A;  4CGY B;  1SNM A;  5C4J H;  1E1T A;  5CBA E;  5BN3 A;  3F2D A;  3I4N H;  4RWS C;  4NPS A;  4JI8 L;  1IBL L;  1FNV A;  1HZC A;  2F0P A;  4XTC S;  2KHJ A;  2HQE A;  3TME A;  3VR5 A;  3VYR A;  4CDF C;  4G7Z C;  2E2D C;  2EJG C;  4POF A;  1DYQ A;  2B39 A;  3I4O A;  2ZTC A;  2JA6 H;  3MVV A;  5I2X A;  4X64 L;  3NTH A;  2DUD A;  2Q2T A;  4ZK9 B;  1N36 Q;  3M85 A;  4BY7 H;  2NN6 I;  4GLX A;  1B8A A;  1TWF B;  4I7Z C;  4CKC A;  1D5X C;  1YZ6 A;  3DM1 A;  1JB3 A;  3J7A 5;  5IWA Q;  1YJ9 A;  3A55 A;  4ME5 A;  3H09 A;  3HRZ C;  4RH6 A;  5IE8 A;  1IXR A;  3JAM E;  3PIO 3;  3S2H H;  1HNW Q;  1HR0 W;  4L8J A;  4UAI A;  5DM7 3;  3CRL C;  1SNC A;  1X65 A;  1CZG A;  1R9T H;  3RUZ A;  1CHQ D;  3M7G A;  2K14 A;  1EOV A;  2LXJ A;  4LW1 A;  4IPG A;  4B08 A;  1N34 Q;  1B1Z A;  4JI4 Q;  3R8B A;  4F87 A;  4JI5 L;  5IP7 G;  2L11 A;  3K58 A;  1ICF B;  4QIW E;  4CJ0 B;  1XMQ L;  3L7Z C;  4FXD A;  3J7A V;  3S1Q B;  5D65 A;  4X3K A;  2R92 B;  4DNI A;  1I94 Q;  2WP8 J;  3G6E A;  3AYH B;  5C44 G;  2ASB A;  3K0Y A;  1SJH D;  3GTJ H;  4ZRZ A;  5J39 A;  1JWU D;  1AFP A;  3NBI A;  1EQR A;  2DGY A;  4DV7 L;  1VS0 A;  5BN5 A;  1NAP A;  2SOB A;  4P2C B;  3IRB A;  5J1Z A;  1WTV A;  1TVX A;  2Z0S A;  1PH8 A;  3RZO H;  2F0H A;  1ESR A;  5IWA L;  5EPK A;  2MHV A;  2XWB B;  3S17 B;  4DV2 Q;  2OQK A;  1SYC A;  5J22 A;  3HEJ A;  2CCZ A;  3S16 B;  1HNW L;  4FF1 A;  3BVZ A;  1MBY A;  4E6I A;  3X3N A;  3OSO A;  5ISR A;  3A74 A;  2HQL A;  2K4K A;  2KHI A;  2AQ1 B;  2K50 A;  2XGT A;  3CC7 A;  2YTV A;  2JA6 G;  1YIJ A;  2EY5 A;  3NSW A;  3VR6 A;  5CV4 A;  2PCF B;  4WRD A;  1AP0 A;  3MFG A;  2D62 A;  4BY7 G;  4LF4 Q;  2F0G A;  1KDA A;  4PG3 A;  2BA0 A;  4RAU C;  1B9N A;  5JVG 3;  1G6Z A;  2CKZ B;  1TWG B;  1VQG A;  3ER0 A;  4C1N I;  5C4X H;  1SFO B;  3I70 A;  1GOZ A;  2ICE C;  3T1Y L;  4JI0 Q;  3DEO A;  1VQL A;  2NVQ B;  1OXV A;  2OF1 A;  1UE5 A;  1C48 A;  3T13 A;  2IW3 A;  4JBM A;  4KD4 A;  2L9H A;  4JYA Q;  1JE4 A;  5GQO A;  1ET9 A;  1EWI A;  2QIL A;  1J8I A;  1VMP A;  3GTK H;  1IBM Q;  1Y69 U;  3O13 A;  1VQ4 A;  2AQ2 B;  2K1B A;  1XPU A;  3S15 B;  1EQV A;  4JI7 Q;  1ASZ A;  2B2U A;  2R93 H;  3J80 E;  4J1M A;  4RFB A;  4BBR H;  3W2D A;  2B2W C;  2RCF A;  3FHW A;  3S1M H;  1CKN B;  2BH2 A;  3J7Y W;  2KCN A;  4OXP A;  4XYO A;  5C44 B;  2RBM A;  5FO8 B;  1D1I A;  3P7J A;  5C4Z A;  1PH6 A;  3AU7 A;  1PZI D;  3E0J A;  4O1N A;  1XNR L;  4MIU A;  2JEB I;  5LL6 X;  3JC6 6;  3SK6 A;  2A69 C;  2YTY A;  5IOC A;  1PTO C;  3J81 E;  3GTQ H;  2PQE A;  4GOP C;  4IOA A;  2CQA A;  4A3M H;  3G7L A;  2B2T C;  5AJ3 Q;  1PH3 A;  4IO9 A;  1XXG A;  1OTC A;  4GZY C;  3G6J B;  5FO7 B;  1KLG D;  1Q90 A;  1SE2 A;  2N8N A;  3TN2 A;  2H5X A;  1Q81 C;  1YNN D;  2EYF A;  1WTO A;  4YCU A;  3T53 B;  3E9H A;  4LNQ A;  5JOB A;  1YEZ A;  2KCM A;  3CC4 A;  3S14 B;  1N32 Q;  3LNN A;  1EFI D;  1SEB D;  1XNQ Q;  3MEF A;  4KY5 A;  3RMH A;  3ICE A;  4DV0 Q;  1PFN A;  1PLF A;  2JA6 B;  4PZ7 A;  1SE8 A;  2K33 A;  3CHB D;  2G9H D;  4HCS A;  4PNY A;  3PO3 H;  1A3V A;  3MZ5 A;  2QKI C;  3OIP A;  2IHF A;  1WTW A;  5KEE A;  5JJI A;  1GXD C;  3VA5 A;  4IFD I;  3L2P A;  5C4X G;  1SND A;  1Q7Y C;  4EGV A;  1QVC A;  2WAQ G;  3ZJY C;  3BYT B;  3BDO A;  2YU9 H;  1LM0 A;  4C2M B;  3K5L A;  5F2D A;  3F2C A;  4DV1 Q;  1FJG Q;  3NWT A;  2EYM A;  2XSC A;  5D3D A;  4OX9 Q;  4X3T A;  4XXE A;  1AZQ A;  4KJO A;  5C0X G;  1EEF D;  5DEH A;  4H44 C;  2O5J C;  3ERO A;  2E74 C;  1EIF A;  1KQS A;  2CHB D;  1S5B D;  5AJ3 L;  3V2T A;  5E1F A;  2JYO A;  2KBN A;  1HFN A;  3C3L A;  3HOW H;  3Q0A A;  3CPF A;  5JEA J;  1H95 A;  5M3F H;  4DF7 A;  2R7Z H;  4DR5 Q;  4BBR G;  4NDX A;  1ZYR C;  2F0V A;  4CDD C;  1SRU A;  5JPM C;  3J81 L;  1BO0 A;  3TS2 A;  5KRU A;  3I55 A;  4DV0 L;  4DAV A;  4R9W A;  3K0X A;  1MJE A;  2I5M X;  1S5E D;  2BDO A;  4DV4 L;  4DUY L;  3K7A B;  1TKW B;  4C3I H;  2FXQ A;  2Y0S G;  3V96 A;  3GTJ B;  5ELC A;  1L1O B;  1SBB B;  4LFC L;  1Q46 A;  2F4I A;  4PV1 C;  4YWK A;  4A3M G;  3KK7 A;  3PO2 H;  3RZO B;  2KEE A;  2IX1 A;  1LT5 D;  3U9O A;  2K32 A;  3STB D;  3HOV H;  1G29 1;  4POG A;  3H0G H;  2UUB Q;  2EYH A;  1Q1B A;  1FJG L;  1I4P A;  1TU2 B;  3HZX A;  1JQY D;  1EY6 A;  1Q8I A;  2PO4 A;  4G4K A;  5JAV A;  2MFI A;  4X3U A;  3KJO A;  5C3E B;  1BNZ A;  1B44 D;  1CSQ A;  3UDF A;  4DV3 L;  1HUN A;  3RLO A;  1SLJ A;  1TS5 A;  3QB3 A;  3AB9 A;  2VQE L;  2F0M A;  1EOT A;  2F0U A;  4JK1 C;  5FLX E;  1U4M A;  5BR8 L;  4NMZ A;  3CF5 A;  2WB1 B;  4NXM Q;  2A6H D;  4X65 L;  1ASY A;  1ET6 A;  3KJP A;  1PA6 A;  1KNA A;  2AKW B;  4Y7N H;  5IGB A;  4U67 3;  3SVM A;  4HJ7 A;  1CQF A;  3CQZ H;  4RKB A;  5C4X B;  3HKZ B;  4KK7 A;  4KN7 C;  4DK0 A;  1C0A A;  2OWO A;  3EBE A;  1HFG A;  4LF5 L;  5CV6 A;  2CWP A;  1Z47 A;  2K01 A;  3TS0 A;  1EIH A;  1JOQ A;  2PQA B;  1FGU A;  4GNX B;  3NXW A;  3QJY A;  1OO9 B;  1I3Q B;  2JA8 G;  1TY0 A;  2K5Q A;  2B3G A;  4KY6 A;  2QW7 A;  2Q8I B;  5GAH C;  1IZ6 A;  1AW7 A;  2EYL A;  4IFD H;  4HAE A;  4P72 A;  4DK3 C;  5IT9 L;  3HKS A;  1CQV A;  3KF6 B;  4UDU C;  1L1O A;  3I2Z A;  4BBR B;  1RDP D;  1B70 B;  3KBX A;  4A3F G;  2QF7 A;  1PH4 A;  1TS3 A;  4A3B G;  3S1M B;  3FVQ A;  1QNU A;  4K0K L;  3MXG A;  1VQO A;  3CAM A;  4IUR A;  1VQP A;  1V1Q A;  4C3I G;  3OWF A;  4JI6 L;  2OEO A;  1TWF H;  1LTI D;  1HH2 P;  4IUV A;  3OMC A;  4K2K A;  1RF2 D;  3S24 A;  3J7Z C;  1SMX A;  4LFA L;  1SJE D;  1HHV A;  1JJG A;  1B2T A;  1EYG A;  4IPH A;  4KD3 A;  4DUZ L;  2NTS A;  1WTP A;  1IYU A;  5FJ8 H;  5IIF A;  2B63 B;  3HOV G;  2D0P A;  2FIN B;  4ILW A;  5C5L A;  4A3D B;  3H0G G;  2Q8T A;  3RNU A;  4JI3 L;  1B3A A;  4V19 0; 
#chains in the Genus database with same CATH homology
 3OYY A;  1N32 L;  4JG2 A;  4JOI A;  1XNQ L;  3E9I A;  1HNZ Q;  1CSP A;  1XNR Q;  4A3F H;  4A3B H;  4DR3 Q;  3PIP A;  3FP9 A;  4HJ8 A;  1J6Q A;  2K52 A;  1Q86 C;  2RHS B;  1Q12 A;  1VQF A;  3AEV A;  5JJL A;  4JI2 L;  2A1A A;  3HOU H;  2A19 A;  1KAW A;  2ATW A;  1YHQ A;  2D0O A;  4A3J H;  5C4J H;  1PV4 A;  1E1T A;  3STB C;  1LUZ A;  5IYB H;  3F2D A;  1KL9 A;  2OQ0 A;  4BBS G;  2NZH A;  1UE6 A;  3S1Q H;  2R92 H;  2RF4 A;  3I4N H;  4JI1 Q;  2PI2 E;  1YNX A;  2IT1 A;  4NPS A;  4JI8 L;  1IBL L;  1HZC A;  2B63 G;  4LFB Q;  2IY5 B;  3K81 C;  1T9H A;  3RLF A;  1O7I A;  4XTC S;  2KHJ A;  3SGI A;  4DV6 L;  4LF9 L;  4A3D G;  5ELO A;  1MJC A;  4GOP B;  3HOX H;  4POF A;  1HJP A;  2K5V A;  2PQA A;  3I4O A;  3GO5 A;  4GNX A;  1WCM H;  2F4V Q;  2ZTC A;  4DV1 L;  1WFQ A;  2OTL A;  2JA6 H;  4KI0 A;  2E5L L;  2KCT A;  1IBK Q;  4WJ3 M;  3BU2 A;  4C3J H;  3W1G A;  4X64 L;  4OX9 L;  1W2B A;  4P75 A;  2DUD A;  2Q2T A;  3Q8D A;  1X9N A;  4A3K G;  1N36 Q;  3M85 A;  2VQF Q;  4BY7 H;  3NBH B;  4R4C A;  2NN6 I;  4GLX A;  3KF6 A;  1B8A A;  3S17 H;  2VS1 A;  1XJV A;  1YZ6 A;  2WB1 E;  1C9O A;  1TXY A;  2GN5 A;  2MO1 A;  4UP9 A;  4ALP A;  3J7A 5;  4IPD A;  1JB7 A;  1GKH A;  5IWA Q;  3S16 H;  1YJ9 A;  4BBS H;  2MQH A;  2UXC L;  3CW2 C;  3GTM H;  1NTG A;  5IE8 A;  1PH9 A;  5FLM G;  4A3E G;  4YCW A;  2AWN A;  4DR5 L;  4JBW A;  5IYD G;  1IXR A;  1L1O C;  3S2H H;  1HNW Q;  5IT9 c;  1VQE A;  1HR0 W;  3HKZ E;  1X6O A;  4B3T Q;  1OXT A;  4OON A;  3B6Y A;  4L5T A;  1HNZ L;  1X65 A;  3RZO H;  4GKK Q;  1N8R C;  1R9T H;  5LMU L;  3CCM A;  2GVA A;  4L5R C;  4UP8 A;  3UE1 A;  1M1K C;  1UE1 A;  2UUC Q;  2K14 A;  3CMA A;  1VQ5 A;  1EOV A;  1A63 A;  2LXJ A;  3PF5 A;  4KLK A;  4LW1 A;  4IPG A;  4DR6 Q;  1N34 Q;  4YHH L;  3D0F A;  4JI4 Q;  4B3R Q;  4JI5 L;  3T1H L;  5IP7 G;  3CME A;  3PSI A;  3HOY H;  2UUA L;  2ZJR A;  1VQD A;  4QIW E;  1JE5 A;  1Q8K A;  1NY4 A;  3U4V A;  4JCV E;  4APV A;  1KRS A;  1VCI A;  4LF6 L;  1SFO H;  1VQI A;  1Y14 B;  1XMQ L;  1CUK A;  3L7Z C;  3CCQ A;  4DNI A;  3RN2 A;  5K36 G;  1I94 Q;  2WP8 J;  4MZ9 A;  3G6E A;  3CCU A;  3AYH B;  2ZM6 Q;  1PHJ A;  2UUB L;  4L5S A;  2NVQ H;  4B3M Q;  5C44 G;  1Q1E A;  4FDB A;  4JOI C;  4HIO A;  2ASB A;  3H3V I;  3CC2 A;  3U50 C;  1Y1V G;  4R4Q A;  4B3S Q;  3GTJ H;  4LF7 Q;  2JEA I;  1IBK L;  3BZK A;  1XPO A;  2VY3 A;  1NMG A;  5M5Y H;  4MTN A;  4DV4 Q;  1K3R A;  4DUY Q;  2UXB L;  3J81 i;  1EQR A;  2ALY B;  2E2I H;  2DGY A;  1X56 A;  4DV7 L;  1VS0 A;  1J5E Q;  4JV5 Q;  1VQK A;  1V9P A;  3M4Q A;  4OO1 G;  3IRB A;  3JAM c;  3LGJ A;  2Z0S A;  1PH8 A;  1JJ2 A;  4LFC Q;  2VUM H;  2N49 A;  4R4T A;  4HJ5 A;  1W3S A;  3HOU G;  2N3S A;  4GOP A;  1HZA A;  5IWA L;  2YTX A;  2K5N A;  4DV2 Q;  5IYB G;  2OQK A;  1VQ6 A;  1TWH H;  2PI2 A;  1VQA A;  2R6G A;  2KEN A;  2CCZ A;  4GN5 A;  1HNW L;  4O0A A;  4NXM L;  4AH6 A;  3CD6 A;  4NB3 A;  1NMF A;  3CPW A;  1G6P A;  4GNX C;  3FKI H;  3A74 A;  2HQL A;  2K4K A;  4KHP Q;  1DGS A;  2K75 A;  4YCV A;  2KHI A;  4GKK L;  2K50 A;  2XGT A;  2R7F A;  5C44 H;  3HOX G;  3CC7 A;  1GD7 A;  1I5F A;  2Z6K A;  4YWM A;  2IX0 A;  2YTV A;  1WCM G;  4R1J A;  3S15 H;  2HHH Q;  4H02 A;  2QA4 A;  1K9M C;  1YIJ A;  1EFW A;  1KIX A;  2JA6 G;  2Q2I A;  2NN6 G;  5M3M H;  1TWA H;  3PUX A;  3M4P A;  1Q82 C;  1MIU A;  3U58 A;  4JBJ A;  1QVF A;  2E8G A;  1UEB A;  1WYD A;  2D62 A;  3H15 A;  5J3B A;  4DV3 Q;  4BY7 G;  1U0L A;  1CKN A;  4A76 A;  4LF4 Q;  1L2F A;  4PG3 A;  2VQE Q;  1HNX L;  2BA0 A;  4IJH A;  1UE7 A;  3K7U C;  4HJA A;  2R93 G;  5BR8 Q;  2NZO A;  2CKZ B;  3BZC A;  1S40 A;  1VQG A;  5GRO A;  2ZM6 L;  3ER0 A;  4X65 Q;  5C4X H;  3CCL A;  3T1Y L;  4DV5 Q;  4HIM A;  3S14 H;  2ZJQ A;  4QY7 A;  4JI0 Q;  2ES2 A;  3AFQ A;  1NJI C;  4AYB E;  5HGQ A;  4AQY L;  2V1C C;  1LYL A;  3I7F A;  3A5U A;  1OXV A;  1K8G A;  1VQL A;  1UE5 A;  3K80 C;  2I0Q A;  4PZ6 A;  2AHO B;  3PIO A;  4JBM A;  4JYA Q;  1TWC H;  1HZ9 A;  1P16 A;  1PH7 A;  5GQO A;  1EWI A;  3CCJ A;  4LF5 Q;  1N33 Q;  2I5L X;  4LF8 L;  3GTK H;  1CKO A;  1HR0 L;  1I50 H;  1MKH A;  1X3G A;  4R4O A;  1IBM Q;  1VQ4 A;  5C0X I;  4A3I H;  1NE3 A;  2Q2U A;  3TRE A;  2B29 A;  1XPU A;  1PYB A;  3HOY G;  1XTD A;  1KRT A;  1VQJ A;  2BH8 A;  2JQO A;  4YWL A;  3OTO Q;  1KD1 C;  3ULJ A;  4JI7 Q;  3W5O A;  1ASZ A;  3J81 j;  2UXD Q;  1PYS B;  1YHA A;  2R93 H;  1SRO A;  1U5K A;  4GKJ Q;  4BBR H;  3GD7 A;  4GS3 A;  1VQN A;  2CQO A;  2GVB A;  3RR5 A;  4C2M H;  3FHW A;  3HOZ H;  3S1M H;  2UU9 Q;  4DR1 L;  4AIM A;  1CKN B;  2JA7 H;  3KDF B;  4J15 A;  4BXX G;  2BH2 A;  4JC0 A;  4UY8 C;  4OXP A;  3GDE A;  1XNR L;  1N9W A;  3CCR A;  1PH6 A;  4LUO A;  4TVA B;  4X62 Q;  4DAM A;  5IYC H;  4K0K Q;  2JEB I;  1FL0 A;  5ELN A;  3JC6 6;  4AYB G;  4DR3 L;  1V43 A;  2NVY H;  2YTY A;  5EAY A;  4JI6 Q;  3GTQ H;  4OWX B;  3M4O H;  3MXN B;  4GOP C;  4IOA A;  1P8L A;  3TRZ A;  4P74 A;  4PMW A;  5C0X J;  4A3M H;  2VUM G;  3KLW A;  4LFA Q;  3PO3 G;  1Y1W H;  5AJ3 Q;  4NXN Q;  3EN2 A;  1PH3 A;  1BBU A;  3G48 A;  4IO9 A;  1OTC A;  4DUZ Q;  2WAQ E;  4IJL A;  4DR4 Q;  2N8N A;  4BA1 I;  4DPG A;  2C35 B;  4JI1 L;  2H5X A;  2LXK A;  4BA2 I;  4DV5 L;  3H3V H;  1Q81 C;  4LFB L;  1KHI A;  1PFS A;  4YCU A;  3UE0 A;  4DR2 Q;  3E9H A;  4A3L H;  1WI5 A;  3FKI G;  1D8L A;  3AQQ A;  4JI3 Q;  4LNQ A;  1YEZ A;  2KCM A;  1B7Y B;  3CC4 A;  1N32 Q;  2F4V L;  4DR7 Q;  4BXX H;  1XNQ Q;  3K7A H;  3MEF A;  3PCO B;  5M5X H;  3ICE A;  2HIX A;  3PGZ A;  4DV0 Q;  3L0O A;  1RIP A;  5M3M G;  3OW2 A;  1CKM A;  3J80 c;  2ID0 A;  4JI2 Q;  1N36 L;  2EXD A;  4PZ7 A;  1SE8 A;  2VQF L;  5LMN Q;  1FVI A;  4DAY B;  3RZD H;  3ERS X;  1PH1 A;  1YBY A;  2CWA A;  4PZ8 A;  3HOW G;  3OTO L;  1WOC A;  5DLQ E;  3PO3 H;  5M3F G;  2Q2H A;  2UXD L;  4HID A;  1YJN A;  2EIF A;  1A0I A;  2IHF A;  4P73 A;  5JJI A;  1X3E A;  2RHQ B;  3JAM i;  4P71 A;  3AFP A;  2R7Z G;  1I6H H;  1Z9F A;  2IHE A;  4OWT B;  3M9B A;  1HZB A;  4JI8 Q;  4BY1 G;  4YY3 Q;  1IBL Q;  4IPC A;  3GTP H;  4DV6 Q;  4LF9 Q;  4IFD I;  3L2P A;  1GVP A;  1YVC A;  1VQ8 A;  5C4X G;  1Q7Y C;  5JJK A;  1QVC A;  2WAQ G;  3ZJY C;  4B3T L;  2YV5 A;  3KFU A;  2YU9 H;  1LM0 A;  1LTL A;  3F2C A;  4RMF A;  3A0J A;  4DV1 Q;  1FJG Q;  2E5L Q;  4LWC A;  5C3E H;  1XMO Q;  4OX9 Q;  2UUC L;  3UDG A;  5C0X G;  4MNO A;  1KXL A;  1YJW A;  3ULL A;  3F1Z A;  4O2D A;  1KQS A;  1EIF A;  4LUV A;  4DR6 L;  4KHZ A;  1N34 L;  1X55 A;  5AJ3 L;  4JI4 L;  4B3R L;  2EQS A;  2VZA A;  2KBN A;  1AE3 A;  1K83 H;  4A3I G;  1SR3 A;  3HOW H;  3PO2 G;  3CPF A;  3KDF A;  3KOJ A;  5JEA J;  3ULP A;  4X6A H;  5M3F H;  1H95 A;  1EUJ A;  2UXC Q;  3PUW A;  1YHB A;  3CCS A;  2HT1 A;  4WJ4 A;  2K5H A;  2R7Z H;  4DR5 Q;  1JMC A;  4BBR G;  4BY1 H;  4IFD J;  1I94 L;  4XIG S;  1SRU A;  3RLN A;  4QQB X;  4B3M L;  1E7Z A;  1PH2 A;  1OXU A;  3HOZ G;  4DR7 L;  3UDX A;  2LSS A;  2CFM A;  4GLV B;  3PF4 A;  2PNH A;  1QUQ B;  1WJJ A;  5GAG C;  4B3S L;  4LF7 L;  3I55 A;  2JA7 G;  3TS2 A;  1EQQ A;  2JA5 H;  3A5Z B;  4DV0 L;  3K8A A;  5LMU Q;  3K0X A;  1MJE A;  2I5M X;  2XTI A;  4X66 Q;  4DV4 L;  4DUY L;  3W1B A;  5IYC G;  3F2B A;  2ZTD A;  4C3I H;  2FXQ A;  2Y0S G;  1BVS A;  5LMN L;  4DKA C;  2A8V A;  4JV5 L;  1J5E L;  1I3Q H;  1M90 C;  3DM3 A;  1L1O B;  1E22 A;  4QGU A;  5HY6 A;  4YHH Q;  3CCV A;  4LFC L;  2QGQ A;  4JI5 Q;  1Q46 A;  4DK6 C;  3T1H Q;  2UUA Q;  4OO1 I;  4YWK A;  4A3M G;  1BBW A;  1GM5 A;  1X3F A;  4GN3 B;  5H1S E;  4HJ9 A;  1Y1W G;  1PVO A;  4DV2 L;  1L0W A;  3PO2 H;  3DLL A;  4LF6 Q;  1GO3 E;  4YY3 L;  2IX1 A;  1XMQ Q;  5M5W H;  3CXC A;  3EIV A;  3STB D;  3HOV H;  4A93 H;  1G29 1;  4POG A;  3H0G H;  2UUB Q;  3VDY A;  3RN5 A;  4KHP L;  5LMN W;  1Q1B A;  4A3L G;  1C7Y A;  1FJG L;  4A3G G;  2HIV A;  4A75 A;  2NVT H;  1QZG A;  4R4I A;  3S1N H;  1XMO L;  3U4Z A;  2MNA A;  3E0E A;  3TQY A;  2HHH L;  1YIT A;  5IY0 A;  2WFW A;  2PMZ E;  4UPA A;  2UXB Q;  2MFI A;  2MO0 A;  2AWO A;  1K73 C;  2OCE A;  3KJO A;  3KF8 B;  2JJQ A;  4DV7 Q;  2F52 A;  2YYZ A;  1VQM A;  3CP0 A;  1CSQ A;  4GLA C;  1XPR A;  5JEA G;  3NEN A;  1G51 A;  3UDF A;  4DV3 L;  3NEM A;  2E2H H;  3GTL H;  1OXX K;  3RLO A;  1AH9 A;  4LF4 L;  4C3H H;  1SLJ A;  4A3C G;  2VQE L;  4EX5 A;  4IFD G;  1VQ7 A;  1BKB A;  2F3I A;  5BR8 L;  4LUZ A;  4QJF A;  3CF5 A;  2B63 H;  1YI2 A;  2VL6 A;  4A3D H;  4NXM Q;  4X65 L;  2NVX H;  1ASY A;  3KJP A;  1VQB A;  1PA6 A;  4Y7N H;  2AKW B;  3HFZ B;  3KYH C;  4JI0 L;  2I5H A;  3BJU A;  4HJ7 A;  3I4M G;  3CQZ H;  2Z6K C;  3UDI A;  2RCN A;  1NBW A;  4A3G H;  4IOC A;  1E3P A;  4X66 L;  1A62 A;  3S2D H;  2JE6 I;  2R7D A;  2QEX A;  3CCE A;  4JYA L;  1AE2 A;  1C0A A;  2OWO A;  1JT8 A;  3M3Y H;  1JJC B;  3EBE A;  4QL5 A;  3PUY A;  5C3E G;  4LF5 L;  1N33 L;  4ME3 A;  4A3K H;  2CWP A;  1Z47 A;  3G71 A;  3TS0 A;  1IL2 A;  3PUV A;  2PQA B;  1X54 A;  1FGU A;  1UWV A;  4GNX B;  1IBM L;  2JA8 G;  3GTO H;  5IP9 G;  4RG1 A;  2B3G A;  1TWG H;  1RL2 A;  1SN8 A;  3J80 i;  3G4S A;  1HNX Q;  1QUQ A;  4EQ5 A;  5GAH C;  1VQC A;  4A3C H;  1IZ6 A;  4JI7 L;  2VNU D;  2WB1 G;  5FJ8 G;  5FLM H;  2VW9 A;  4A3E H;  2ZJP A;  4GKJ L;  5IYD H;  1E1O A;  3D31 A;  4P72 A;  3PUZ A;  2L15 A;  3TEH B;  2BA1 A;  4DK3 C;  1EIY B;  2AMC B;  3HKS A;  3KF6 B;  3T1Y Q;  3S1R H;  1KC8 C;  1VQ9 A;  2UU9 L;  4A4I A;  1L1O A;  3J81 c;  1E24 A;  4OWW B;  3I2Z A;  2JK8 A;  4AQY Q;  1B70 B;  3I56 A;  3HKZ G;  3I4M H;  4HIK A;  4UP7 A;  1OXS C;  3F8T A;  2Y0S E;  5GAD C;  4A3F G;  1PH4 A;  2JA5 G;  1IYJ B;  3M7N A;  4A3B G;  4K0K L;  2ZTE A;  1K0R A;  4X62 L;  5GAE C;  1VQO A;  4Y52 H;  1D7Q A;  3WWV A;  5FLX c;  1A8V A;  4L5Q A;  3CAM A;  4JI6 L;  4X64 Q;  1V1Q A;  1VQP A;  1S72 A;  1K8A C;  4LF8 Q;  1TWF H;  1HR0 Q;  1PH5 A;  3PV0 A;  2OTJ A;  5IP7 H;  4A3J G;  1HH2 P;  2N78 A;  4JBK A;  3NEL A;  3J7Z C;  3S24 A;  4LFA L;  2JA8 H;  1SMX A;  4NXN L;  5IP9 H;  1JJG A;  2R92 G;  1VQH A;  1QVG A;  1EYG A;  4GN4 B;  4IPH A;  4DUZ L;  3I4N G;  1QZH A;  4DR4 L;  5FJ8 H;  2E2J H;  3GTG H;  2JA9 A;  4TQU S;  3HOV G;  5E7N A;  1S3O A;  2D0P A;  4DR2 L;  4A93 G;  3H0G G;  4DR1 Q;  1Y1V H;  3RNU A;  4JI3 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...