4M1UB

The crystal structure of stx2 and a disaccharide ligand
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Shiga toxin 2 A-subunit
publication title The crystal structure of shiga toxin type 2 with bound disaccharide guides the design of a heterobifunctional toxin inhibitor.
pubmed doi rcsb
source organism Escherichia coli o157:h7
total genus 21
structure length 70
sequence length 70
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2013-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4m1uB00
1BOSA 4ULLA 2GA4B 1R4PB 1C48A 2BOSA 1CZGA 1D1IA 2XSCA 3MXGA 1R4QB 1D1KA 1CQFA 1DM0B 4M1UB 1QNUA 1QOHA 1C4QA 1CZWA 4P2CB 2C5CA
chains in the Genus database with same CATH superfamily
5FLXE 2K52A 2HHHQ 1NAPA 1NR4A 3H3VC 1EFID 4F7XA 3A8KE 3X3NA 5C4HA 3T1YQ 4CJ1B 1EIYB 3IRBA 3E6ZX 3OTOL 1YJ9A 1SNPA 4DR5Q 1NUCA 1SSOA 1V43A 2ZXRA 1HQRD 3GDEA 2PCFB 4L8JA 2OTJA 3M9BA 2N78A 1YHAA 4DKAC 3J7AF 4A93H 2K5NA 1VQNA 3FRPB 1Y1VB 5ELCA 4RAUC 5LMNQ 5E7NA 1LT4D 4JI8L 3PO3H 5G3LD 4HEDA 2WB1G 1QE6A 4AYBG 1I94L 2E2IH 1KRSA 3VA7A 4DAVA 1WTRA 2CW0D 4C3IH 1K9MC 3C46A 3U50C 2HHHL 1BCPD 2QGQA 2KQ3A 3D8GA 1D6EC 4L6TB 3GTGB 2CH4W 1G2SA 5C4XG 4ZRZA 3T1YL 1QB5D 5TSSA 5CBEE 2PYKA 4DR5L 1EWIA 3PUXA 4P74A 3L2PA 1HA6A 1GKHA 4IALA 3A5ZB 4RHSA 4LAAA 4QQBX 1A2UA 2XGTA 4HIKA 2B3GA 1IXRA 1YHBA 3PF5A 4V0BA 3NTKA 3MVVA 1VQ8A 2JN4A 1UAPA 2BH2A 1H9SB 5LMNL 2K75A 3CXCA 1LTLA 1PTOB 4DR6Q 2NVTB 4CKEA 3J81i 4NDXA 3E3XA 1VQFA 2UUCL 1TWHH 4IQZA 1KC8C 3I3CA 4BXXG 4O42A 3N6RA 1V1PA 2IL8A 1ESRA 1K0RA 5KEEA 1DZ1A 4A3MG 2BOSA 1P8LA 1YEZA 5M3MH 5IYBH 1LV9A 1B8AA 3BU2A 3NENA 4B3RQ 4M1UB 1PYSB 2PO4A 1KAAA 1NMGA 2X69A 4FXKC 1YNJD 3SK4A 5IP9G 3GTOH 4FYDA 2Q2UA 3K81C 1N8RC 4CHTB 1CTMA 5A2QL 5LMNW 1L1OA 4AIMA 2N3SA 4GKKL 4JK1C 4MTKA 3CAMA 3GV3A 2EYPA 1PTOD 1F2LA 1FNVA 2RHQB 3S1MB 4NMZA 1CA5A 5JEAG 1PLFA 1O80A 3EROA 4LFBQ 3DWPA 1PDQA 3EBEA 5M9OA 2J0TD 1R9TB 3URYA 3CF5A 1SEBD 3H0GB 3QJYA 2CHBD 5JJKA 3CD6A 2K05A 4ZUIA 4TRDA 1Q86C 4B3RL 2QDLA 5K5PA 3DLLA 2F03A 2WB1E 2TMPA 4AYBE 3J7YW 4MN3A 1P16A 3P1HA 3LNNA 2A6EC 2L4NA 1WYDA 2B2TA 4JBWA 2PW5A 3S9WA 4KI0A 1EFWA 3CCRA 2EY2A 3RLOA 2D0PA 2IW3A 1JOOA 3HOWB 2SEBD 3TREA 4B08A 4BXXH 3OWEB 2JA6B 2PZUA 3HOZG 3EA6A 4LFBL 5JJLA 5J1ZA 4BY7G 4JI4Q 1F77A 3LGJA 1ILPA 5M5XB 1RCVD 3HOVG 3NUCA 4NKLA 1PA6A 4LF4Q 3FKIB 3TP8A 2NVQH 3SVMA 2AQ3B 3U58A 1UNSA 1HFNA 5IP9H 2MO1A 1EYGA 3EIVA 3FEWX 1STGA 4UDUC 4A3CG 1G2TA 2NYZD 5EBCA 4QJFA 2YV5A 4ODGA 3GTPB 1RIPA 4KK7A 1JE5A 2E2DC 2FMCA 2IHFA 1WI5A 3C1FA 3J81L 1AE2A 3BVGA 2UUBQ 2QDBA 2ZXOA 3K7AB 5LMUQ 2B63G 2KHJA 3PUVA 3G48A 1W6KA 3K5OA 1XNQQ 4HSVA 4A3JG 1GD7A 5JEAH 1H9JA 1CQFA 1PH3A 1N9WA 1II3A 1EU4A 4JI4L 4L5QA 4GOPB 1QOHA 5I9PA 4QUCA 2RDFA 1EYAA 3KLRA 4LF4L 2VS1A 1KDBA 1KABA 2I5MX 3CMEA 2JEAI 1JJ2A 3DM3A 4JYAQ 4DAYA 4KHPQ 2KHIA 2L1BA 3CRLC 3K57A 3GTLH 5IGCA 2VQEL 1S5ED 5IGBA 5D14A 3EJIA 5IT9c 4LF8L 1EEID 2FFKB 3K5LA 2UUBL 1SE4A 1VMPA 4NPSA 5KNDA 4ZAIA 4BWGB 3TP6A 1SYFA 1SJED 3PIO3 5LMUL 1HUMA 3NBIA 1Q46A 1E2VA 4P2CB 4DAPA 3DUZA 1Y1VG 3P7JA 3STBC 3ND8A 2JYOA 4QUFA 5DLQE 1BDOA 2RCFA 4OELB 3VR2A 2UUAQ 2O5IC 2KCMA 4BY7H 3KF8A 1H95A 4K5XA 2LXKA 3R8BA 1YITA 1WTHA 3HOVH 4EVOA 2F4VQ 4G7HC 4X6AH 5NUCA 4UHVA 4HR7B 4LUZA 4JYAL 4KHPL 3DWAA 1V9PA 3ND9A 3RNUA 2NBFA 4K2LA 1Q81C 4A3GB 3U4VA 2C9OA 2RCNA 2JA5B 3JAMc 4A3CH 1O7YA 1PYWD 2RVLA 4JBMA 4JC0A 3A56A 3C3LA 2XRQD 4H13C 1PRTC 1K3RA 4UY8C 5EGTA 4AH6A 1TY2A 1H9MA 2MQHA 1GUSA 1E7ZA 1SJHD 3L9AX 2B63H 4UP9A 3M4OB 4FF2A 1QCBD 2HCIA 3MA2B 4KY6A 1I6HH 4A3JH 1AZQA 2HDLA 2ZTEA 1D1KA 1VQHA 1G51A 3EVQA 3VA5A 1AH9A 2UUAL 5IGGA 3BYYB 1ILQA 1GXDC 1HZAA 1VQ6A 4LJZC 4K0KL 1WTVA 2XVSA 1E22A 4GNXC 3M4QA 5I4DA 4LW1A 1LTID 2E76C 5LHY1 1RKNA 1TWGB 3V2TA 3K7UC 5I6YA 1A8VA 3AFQA 3SEBA 1YIJA 4DV7Q 1VQDA 5EKLA 1XPRA 1Q90A 1SR3A 2EY6A 1XX8A 4A3EB 3CQZB 1QNUA 3UE0A 3QOJA 1EQVA 1C4QA 5M5WB 5C3EB 2K5QA 1Y1VH 1PH4A 1SYGA 3ITPA 2WINB 4NP5A 4XQQA 3A74A 5JOBA 3VYSA 2L9HA 5AJ3Q 1N33Q 1FNWA 1YNNC 1VQ7A 2OEOA 3GTGH 2F0KA 2OQKA 2DNCA 3OPOA 3NPPA 3R2IA 3GTKH 1JJCB 5C0XI 2K28A 2K04A 2KJXA 4HMJA 4NXMQ 2VQFQ 1EQQA 2NUCA 1C9OA 4UP8A 2L15A 4DV7L 2IX1A 1JORA 4G7ZC 1HHVA 3PUYA 2KBNA 1EZ8A 1K73C 2Z6KA 4CKCA 3NP8A 3CCJA 1WTPA 1XYIA 2BH8A 3UDGA 3KF6A 1PTOH 4RHRA 1LM0A 1UE1A 5KIXA 3TP7A 2NVTH 3I4MB 5DM63 1BUVT 4ZQ3A 4C1NK 3I8ZA 1CSPA 2BA1A 1YNXA 1S5BD 3DMUA 2PZWA 3A7LA 4IUNA 3S1QB 4EQOA 2PI2A 5AJ3L 1N33L 3HOWG 1EIHA 2FMMA 5C3XA 4LF7Q 2J4XA 4LF6Q 1OO9B 3PSIA 4NXML 2VQFL 5GAEC 1EY0A 4EX5A 1SMYC 4DAMA 3FKIG 2EDGA 4X65Q 2B2WC 1Y1WB 3TS2A 1TU2B 1VDZA 1E1OA 3OHXC 3BVZA 1QG7A 4XYOA 1YHQA 3A55A 1LTGD 2LKVA 2Q8RE 3M85A 1XJVA 2OF1A 4OXPA 1I5FA 1QZHA 3U9SA 1D5MC 2L11A 4IPDA 3Q0AA 1PH8A 2UU9L 3W3AA 2ZTDA 1IBLQ 4LF7L 3VR3A 3CC7A 1EUJA 4IOCA 4LF6L 2WIIB 2XNAC 3BZDB 2A69D 2YTYA 1PFNA 1YI2A 1GO3E 1UEBA 3H0GH 4X65L 1VF5C 2F0WA 5KYLA 3W5OA 5LL6X 1SAPA 4ILWA 1XPUA 2LSSA 1V1PB 4IFDJ 1N32Q 1A2TA 4F88A 3K5NA 1PZID 2K14A 4EQ5A 4O0AA 2EXDA 5H1SE 2B2UC 2WV6D 2WACA 4CDCC 1IBLL 1HFGA 2WFWA 3SHLA 3H3VI 3HOWH 1ESFA 2XN9C 2JA6H 1PH5A 1KIXA 2R92B 3DWQA 1L1OB 5IODA 3R3OA 1JQYD 2EYHA 4WRDA 2JA8B 5M5XH 2UXDQ 3LWEA 3FKIH 4DR7Q 4PZ6A 2KEDA 5EQ0A 5IP7G 1JCKB 1ZEQX 3QOLA 5C44B 1L0WA 5FKAC 2Y0SB 2Q8TA 4A76A 4F87A 4A3GG 2ID0A 2JA5G 5C5LA 4JI3L 3GTPH 3J81E 2NVYB 4DR3Q 1VQIA 2LY7A 2VNUD 3K7AH 2QEJC 4HJ5A 3VR6A 1S40A 2NZHA 2FHTA 1M4VA 2DNEA 1K83B 3FMCA 4DV1Q 2Z8LA 2JXMB 1BR9A 3B6YA 2LS01 3NWSA 1Q3LA 4ME3A 3UI2A 3ONAB 4KD3A 4GLVB 3TZUA 4DV0Q 2VB3X 2UXDL 1MI2A 3OMGA 1C7YA 2A6HC 1B1ZA 3RLFA 1STYA 4DR7L 2BDNA 4GLAC 1RL2A 1SRUA 2EVBA 1FJGQ 1WD1A 3VYTA 4POFA 1CKMA 2CWAA 2EE1A 3HRZC 1X6OA 2AQ2B 3W2DA 4DR3L 4C3IG 5CV9A 4A3EG 3O13A 4JBJA 4RA8A 1CT1D 5DNFA 5C3EG 2ZJRA 5JVH3 3W1GA 1A3TA 4DV1L 5JAVA 3MXUA 1VQAA 2K4KA 5FO9B 4L5RC 3T1HQ 1ML0D 1MHWC 1DOKA 4IJHA 4YWMA 4DV0L 4PMCA 2AUJD 4YWLA 5L37A 1SN8A 4JI6Q 1QVCA 4R1JA 2KUMA 3T13A 3J80c 5FO8B 5IP7H 2E2JB 4K8JA 1K8AC 1FJGL 3QG1A 4C1NI 3EN2A 4J15A 4MZ9A 4A3GH 2VXWA 2EPBA 4A75A 1YJWA 3K0XA 4JI8Q 4JV5Q 2QW7A 2MHVA 2SNMA 4NB3A 4G7OC 1LLRD 3E5SA 1XTCD 4BA1I 1SFOB 5M5YB 4DAYB 4K5WA 1JWSD 3H94A 3HG9A 3M4OH 1F2YA 4BBRB 5IOCA 1LT6D 1V8QA 3I4MG 1UE6A 3HFZB 4ABNA 3T1HL 4XDXA 3VR5A 5M3MG 3RN2A 4R4OA 5GAGC 1IL8A 5IYBG 4JI6L 4QY7A 3BZKA 1DGSA 4MHEA 4HCEA 4DNIA 5EAYA 4LFCQ 4DR4Q 1TWGH 2CKZB 3KF8B 5E4XA 4JV5L 1Y1WG 4JI1L 4K2KA 1HZ9A 4S3SA 4A4IA 4GLXA 2RKSA 2Z4HA 1N36Q 2UUCQ 4KHVA 1I4XA 1YJNA 4A3EH 3CQZH 5KYIA 1U4RA 1OXUA 1SYCA 1RODA 5F2DA 1KRTA 5M5WH 5C3EH 4FF3A 1NY4A 3GTKB 2AUKA 5FLXc 4A3KB 4J1MA 1EL0A 4IPGA 3U4ZA 1BNZA 1BCPF 4GN4B 4JI5Q 1X3EA 1BBWA 3KUPA 1EQRA 5ELBA 3RR5A 1FL0A 2R7ZH 1TXYA 1BVSA 1HUNA 3W1BA 1UEAB 2MGSA 5I6WA 1ICFB 4DU9A 3F2BA 4LFCL 4DR4L 3K59A 2DGYA 3HP3A 2OCEA 4HIDA 5CBAE 4BY1B 4CJ2C 3S2HB 4GKKQ 1N36L 2KA7A 3X3MA 1B9MA 1BKBA 3TN2A 1HPCA 4YCVA 3TZDA 2IY5B 1C8CA 3WDNA 1K8GA 3MFYA 5CV7A 1X3FA 3G7LA 3I56A 2SNSA 1JWUD 2I07B 2Q2IA 3I4MH 1HRJA 1QJOA 3CRKC 2D5DA 1D1IA 4JI5L 5JPNC 3ULLA 2B2YC 4OIKA 3S1QH 1D5XC 1HR0Q 3PCOB 4A3FB 1LT3D 3K80C 1A6XA 1TWCB 1KXLA 5FJ8G 2F0GA 3GO5A 1XNRQ 4FO2A 2R92G 2OQ0A 1E3PA 3S14B 3SXHA 4QCLA 1KTKA 1AW7A 4ZYSA 1E0BA 3VYRA 1Y1WH 3G6JB 2A68C 4DF7A 3I4NB 1NBWA 5C44G 1A0IA 3CMAA 3ZJYC 4B3SQ 4PZ7A 1GUNA 4DK6C 2Z4IA 2EJGC 2VUMB 1PTOF 4HAEA 2F0LA 1JOKA 1HR0L 3HKSA 4X3TA 2MNAA 3SK5A 3MZ5A 5BN3A 3P20A 4LUVA 2H5XA 1XNRL 2A6ED 2K6AA 1ICWA 1QWYA 1SLJA 3A7AB 3KF6B 1Y8NB 4LMQD 4Z9CB 1N34Q 2WAQB 1VQ9A 1A3UA 2X6LA 3RLNA 2I5HA 2F0PA 1PHJA 2KHSA 4B3SL 1GHJA 4HJ8A 1Q82C 4H44C 2JP1A 3KOJA 3D4WA 3M4PA 5HY6A 3V05A 3BDOA 4Y52H 1PVOA 3VDYA 1FR3A 2D0OA 4ZK9B 3PGZA 1AEXA 3Q8DA 3Q22A 2JEBI 2KCTA 2EYFA 1HNWQ 2E74C 2RQXA 3OYYA 4C56C 1HR0W 1JR0D 2HQLA 2AQ1B 2AWOA 4YCWA 1STNA 1I50B 3IFDA 5FJ8H 2R92H 4ID6A 1N34L 4DK3C 2OTLA 2VQEQ 1ENCA 1M90C 1WCMB 2B2VC 2JA8H 2RDGA 4LF8Q 1ET6A 1F2MA 1RF2D 4IFDG 5C44H 1VQGA 4FNFA 2R7DA 2JJQA 3PIOA 4R4QA 2KCNA 3R93A 3J81j 3J7ZC 2ICIA 4WJWA 4R4TA 2NVYH 4A3BB 2CH4A 1HNWL 3I90A 5JJZA 1VQ5A 1IYJB 3MXNA 2K1BA 2G9DA 2E5LQ 3M7GA 4BBRG 1PRTB 4EGVA 1IW7C 3WOEA 1J5EQ 1K83H 1TR5A 2EYJA 4HIMA 1CFMA 4DXGA 2K50A 4IZ8A 5CMDA 3AB9A 4DFAA 1SNDA 3I2ZA 3MAQA 3P75A 2IT1A 3STBD 4RWSC 3RZOB 3J80L 5KRUA 4JBKA 1TWAH 1KQSA 4K6DA 5M3FB 3GV6A 3H3VH 2PQAA 1CUKA 1BBXC 1QILA 2BE5C 1ET9A 2ZM6Q 1JB3A 2XTIA 3M3YB 2EQSA 1GUGA 3S17B 5GAHC 2IHEA 1OXVA 4C3JB 1I4QA 4N8X1 3UDIA 4KN7C 2QA4A 1HNXQ 2NB0A 4K0KQ 2E5LL 5C5MA 3BVMA 1WTQA 1Y8OB 3NQTA 1B4OA 1HXYD 5ELFA 4A3KG 1J5EL 3NXWA 4DV2L 2BCOA 1XMOQ 2NN6G 1HNZQ 1PRTD 1LTSD 4PMBA 5COYA 5D3DA 5J22A 5C4ZA 1M8AA 3GTJB 1VS0A 4KY7A 1B44D 4IFDH 2E2JH 2E2HB 3KJOA 1GUTA 1XWEA 4DN4M 4QIWB 2F0DA 2Q2TA 2F1MA 4BY1G 2ZM6L 4GOPC 5EPKA 4CDFC 5C0XJ 1Q1EA 1K3BC 1HNXL 1IYUA 1SFOH 4GN5A 4APVA 5M5YH 1SNOA 1BBUA 2HD3A 3SDZA 5CC4A 4FVMA 4BBRH 1EY6A 4HJ7A 1QVFA 1VQLA 4TQUS 3CHBD 4XYQA 1C48A 4FF1A 2ZXPA 2F4IA 4HMIA 4LUOA 4DGZA 1XMOL 1HNZL 4K6LA 1IYVA 1E2ZA 4A3FG 4V190 3L3OC 4G57A 5GADC 1Q12A 3EFXD 5BN5A 1IZ6A 2ENBA 4DUYQ 1TS4A 1KDCA 3S2DB 4DR2Q 3CP0A 4JW0A 1PH6A 4E6IA 4BA2I 1YNND 4KD4A 1MJCA 3I4NG 4K14A 3IAYA 5GROA 2VB2X 1UWVA 3H09A 5IWAQ 5IYDG 2R7ZB 1FGBD 1VF7A 5EKIA 4N9TA 5C4JB 4LFAQ 1D8LA 2VUMG 4A3KH 4A3DB 3NTHA 3BJUA 4DNRB 1SYBA 4CGYB 3H0GG 4TKOB 3K58A 2GVAA 2NN6H 1MKHA 4DV5Q 1Z9FA 4K8IA 2BA0A 4RGOS 1B50A 2L0CA 3TQYA 2F0IA 2R7FA 3TP5A 4J8QA 1EU3A 2YTVA 5ISRA 3F2CA 4I65A 3AU7A 5I2XA 4YHHQ 4GS3A 2WAQG 3JC66 2K7VA 4JI0Q 3T53B 4PQXA 5CR3A 4DUYL 4WFN3 4DR2L 1STBA 1B2TA 4BY1H 3S2HH 1STAA 5CV4A 2B8FA 1O7LA 1BQQT 1STEA 4OEMB 2P5ZX 3NE5B 2B29A 1S3OA 5IWAL 2UU9Q 2NVXB 1SYEA 2Z6BA 1T9HA 3TBIB 3PUZA 4N9PA 2K5VA 1Z47A 3F1ZA 2JA6G 4FP5D 2DY8A 1Y8PB 4LFAL 4OONA 1T5XD 1Z7TA 1XTDA 1TIID 1SMYD 2YTXA 2Z0SA 3U9OA 1OTCA 2GVBA 3RMHA 2V1CC 2NZOA 2N49A 2K5HA 4DV5L 4A3FH 5J3BA 4RMFA 3I4LA 3H6MA 1TWCH 4C3HB 4YHHL 3JAMi 5ELEA 2N55A 3I4OA 4JI0L 3S14H 1WCMG 5CV5A 1NMFA 1PH2A 4XT3B 2WP8J 1Q7YC 2JE6I 3A5UA 2H1EA 4JI7L 5EKKA 1STHA 4HTHA 3I4NH 4EQNA 2R93B 2EY5A 1EY5A 1SE2A 5IYDH 4DR1L 2I0QA 4IUTA 1X56A 4IO9A 3S24A 3IKJA 1DJRD 1UUPA 2VUMH 2UXBQ 5DM73 4PG3A 2UXCL 4A3BG 3DHQA 3CCUA 1ZYRC 3E0JA 3ERSX 1U4MA 4HCSA 4QGUA 3NK9A 3G71A 1EOVA 2KOLA 3SK8A 4QB4A 1AFPA 1R4PB 2HQEA 3CPWA 3RZDB 3KBXA 4DV4Q 2K5WA 3J7AV 4LK1C 4JI3Q 1KD1C 4ALPA 2R61A 4NW2A 3Q24A 4L63B 1YVCA 3OW7A 2Q8IB 3S16B 1U4PA 1F9QA 4IPCA 4KKUA 3NSWA 3HKZB 1ONLA 5JVG3 2UXBL 2N8NA 2F0UA 1U5KA 2F0VA 4GNXA 2R6GA 4JPBW 3QR8A 3DXJC 3TMEA 3PIP3 2WAQE 3D0FA 4A3MB 3M7NA 4B3MQ 1IBKL 1Q8IA 4IUVA 4N8FA 2PI2E 1I50H 2N88A 3NELA 5HGTA 4POGA 2LFNA 4DV4L 4YCUA 2EY1A 2K03A 1WCMH 2F0NA 3HEJA 2YU9B 4UAIA 2AWNA 3FPUB 5IT9L 1PV4A 4JCVE 1B3QA 4ZLTF 4MTNA 2F0EA 5C3WA 1QVGA 1GVPA 1D2BA 3TEHB 4XQNA 4WJ3M 3ICEA 3BDLA 3K8AA 2AMCB 3T16A 4OWWB 2E75C 2A6HD 2NTSA 4YIJA 4A3BH 3QWNA 1L2FA 5EJWA 4B3ML 4XTCS 2DJGC 4A3IB 1VQCA 1PFBA 4O2DA 4F8MA 1TWAB 1G291 4KTAA 3I73A 3JAML 2PZTA 1FD7D 1KNEA 3NEMA 2ALYB 3J80E 4IURA 2CFMA 3CCMA 3RZOH 1PZKD 3J81c 5GQOA 2TSSA 5M3FH 1A63A 1AN8A 1L1OC 2CQOA 3MTSA 2F0OA 3UDXA 1S72A 4OO1I 3M4YA 3M3YH 3S17H 4BBSB 1SROA 4C3JH 1IBML 3AMUA 3TDQA 3MC0B 3TRZA 3CCSA 2R7ZG 3A54A 2C35B 3NBHA 2XWBB 5JPMC 2ICEC 3KLWA 5IY0A 3S15B 2CQAA 3GD7A 1JB7A 1H9KA 1O7IA 1NTGA 2JK8A 2B2WA 2ZJPA 1X55A 4LWCA 3AYHB 4A3DG 1JJGA 1TS3A 2EYMA 4ZKBB 2H4OA 1CI3M 2F0JA 2M2LA 2D2CC 4KKSA 4JI1Q 3MWYW 4I7AA 3MXNB 1AE3A 4MNOA 3GTJH 2F3WA 2OT2A 2E2HH 3AFPA 1EIGA 5D3IB 2NWGA 3WWVA 2B2TC 1K28A 1PFSA 4I7ZC 5EBDA 3F2DA 3KDFA 4RGTA 1EY7A 1MD2D 1GM5A 3NQIA 4KY5A 3OSOA 3KLSX 5EPJA 1BXTA 4B3TQ 1CK1A 2RA4A 3QO2A 3PO2H 4X64Q 3TS0A 2PQAB 2EIFA 3Q23A 1VQJA 3VYUA 1G6ZA 2G5DA 2I46A 1S5CD 3NTIA 2RDHA 3CW2C 5DAUA 4QIWE 2DJFC 3GTMB 1SNCA 4TVAB 3IFTA 3MEHA 4P71A 2B39A 1R4QB 4IN3A 4C3HG 1S4ZA 4DUZQ 2B2UA 2IX0A 2QF7A 2WKCA 3DEOA 5G3LF 4HIOA 1ASZA 2PNRC 2IJ0A 1GHKA 2C5CA 1KL9A 3HS0C 1S5FD 2YYZA 3KFUA 5C0XG 3S2DH 1EEFD 2MO0A 2JSOA 3MFGA 1PFMA 4UP7A 1ENAA 2R93G 4B3TL 5CV8A 1PH9A 1VQPA 1A15A 3FVQA 4X64L 2EYLA 3ERQA 1X65A 3GTQB 1H9RA 5CV6A 5C4JH 4OGQC 2CW0C 4MIUA 2OXPA 4A3DH 1BCPC 4A3LG 1LUZA 1G6PA 1WVLA 2QCPX 4GN3B 1HJPA 4DA2A 2LXJA 2ASBA 1U0LA 4U68A 5BN4A 3GP7A 3D4RA 1MIUA 1UE5A 2K33A 1PMRA 4DUZL 2PW7A 3S1RB 3D3RA 4AQYQ 5A35A 4RGMA 3G6EA 4ME5A 1HH2P 4OX9Q 4IJLA 1ZXTA 2IPKD 3HOYB 1NSNS 1VQKA 1CHQD 2EYOA 5IYCG 4YY3Q 1EOTA 1PH7A 1LACA 3UE1A 2NVXH 4B9WA 1KHIA 4PNYA 2EJFC 2XWJB 1A3VA 3OMCA 3HKZG 2VZAA 3RN5A 4JOIC 1X54A 4ZUJA 2PQEA 2JA8G 2J7ZA 1X32A 2JA9A 2A68D 4DK1A 3ULPA 2XIWA 3K5MA 1B3AA 1VQBA 3J80i 2L12A 4LNQA 3L0OA 1EIFA 3BG3A 4GKJQ 3KYHC 1F2ZA 3AQQA 1I3QB 2AHOB 2Y0SG 4AQYL 4C3HH 3L7ZC 4L5TA 4KV6A 5AFWA 3PF4A 4OX9L 1CKNA 3S1NB 5C0XH 1YNJC 4YY3L 2D62A 2VY3A 2MJ8A 4DR6L 4CKBA 4JI2Q 5IGFA 5BR8Q 4IOAA 3LWUA 1I4HA 2R93H 2PPBC 3KK7A 1FYCA 1RD9D 1VMCA 4H0LC 4FXDA 2K5DA 1OXSC 4RFBA 2ZT9C 3OOCA 1RHPA 4EQPA 4DV6Q 1PTOC 4TSSA 4WORA 4Y7NB 3CCQA 2B8GA 4CBVA 1SYDA 5C4XH 5J39A 2KEEA 4A3LH 1AP0A 1G91A 4X3UA 5K36G 4L5SA 4GKJL 4A3IG 2RBMA 2Z9HA 3HOXB 1LO5D 5ELNA 2AKWB 3RZDH 1T5EA 3UDFA 3I70A 2EXZA 3PUWA 3K0YA 1MGSA 1J9OA 5KGUA 3HOUB 4R9WA 2RSNA 1SMXA 4KMUC 4OWXB 4CDEC 1KNAA 3E9IA 5HURA 2GN5A 5IYCH 4JI2L 5BR8L 3S16H 5CGKA 2XRSD 4O1NA 2PMZB 2EZVA 5KNCA 4DV6L 1RTOA 4LF5Q 4BBSG 4DXFA 3K6OA 5JJIA 1X3QA 4JVZA 4RCOA 1HTLD 5IGDA 1E24A 4IPHA 1ENFA 3I72A 4A3MH 1TWFB 5IIFA 1EY9A 4K5VA 4RKBA 1DD2A 5E3FA 1QNKA 3E9HA 4U673 4OIJA 1YZ6A 1C0AA 2CWPA 3NHHA 2IX3A 1IKLA 1DM0B 2LMCB 3NWTA 5IT9E 1QUQA 2YU9H 1EZ6A 3HKZE 1B9NA 1CZWA 1WFQA 1FNUA 4C2MB 5CORA 4KJOA 5D65A 3Q6SA 2Z6KC 1IW7D 4FXGC 1QZGA 1HQMC 3D31A 1BF4A 1WTXA 1TKWB 4LF5L 1Y14B 4GZYC 1EY4A 4DV2Q 2NZ1D 2NTTA 3FDTA 4R4IA 2Y0SE 1TVXA 4G4KA 1MSHA 1O7ZA 3SK6A 1Q1BA 1HCZA 5IE8A 5K36H 1KDAA 4A3IH 1JC7A 1XXGA 2BE5D 3JAME 2QKIC 4GNXB 4J6HA 2K32A 1CM9A 1GUOA 4OO1G 1VQEA 1K8MA 2MP1A 1CZGA 3QIAA 1EY8A 1LT5D 3OW2A 1OXXK 4YWKA 2HIVA 1SNQA 2SOBA 2B2YA 2ZJQA 1V1QA 2ATWA 1G8ZD 2RHSB 2BDOA 4XIGS 1XNQL 5IGEA 1WTOA 4JG2A 5T1GA 4BBSH 2F0MA 2F0QA 3TSSA 4JOIA 4P72A 1MJEA 3HOZH 4PMWA 3KJPA 1CHPD 2A74C 2VW9A 3S15H 4DPGA 4X66Q 2KENA 3I7FA 3A8JE 2A1AA 2Q2HA 3SR1A 1PRTF 1DOMA 1UE7A 5ELOA 1GJXA 4FF4A 1CA6A 1TS5A 4RH6A 3CC2A 3F2UA 2JA7B 4HN7A 1VQ4A 2KCCA 3T56B 3I55A 1U4LA 4X62Q 3H91A 1RJTA 4XXEA 2V4DA 5FO7B 4CJ0B 3J7A5 3PO2B 2O5JC 3LX0A 5FLXL 3HOYG 3C2PA 2F52A 3CCVA 2X6GA 1H9SA 1AZPA 3HGBA 3ER0A 3FHWA 1IHZA 1WTWA 1M1KC 4X66L 1JMCA 2KVMA 1ZKOA 2F4VL 1U9RA 3FPPA 2DN8A 4XQJA 1S5DD 4A93B 1DOLA 2A73B 1W3SA 3NBHB 4OO1H 3PO3B 3GTMH 1CQVA 3CU7A 1B70B 4X62L 2E2IB 1LTTD 5T1IA 3IL8A 5FK9C 1HZBA 1NR2A 4DNTB 2F0FA 4C3IB 2SDFA 4KHZA 4P75A 1F9RA 3CCEA 1SDFA 1JOQA 2L5TA 2MPMA 1SBBB 1LTRD 1OXTA 3OIPA 1DCZA 3D4DA 4XT1B 1LYLA 3R2TA 4ULLA 1HTPA 2I5LX 4DK0A 2B2VA 1DONA 1CKOA 4IUQA 1ASYA 2EOTA 3GTQH 1DYQA 2FXQA 3BS1A 5EPLA 2HDMA 3KDFB 5E1FA 2HCCA 2JQOA 1XPOA 1SNMA 1HA5A 3MXPA 4JI7Q 1W2BA 1PZJD 2E8GA 2ZTCA 2KECA 3HOXG 3S1RH 1TWHB 1SE3A 4DR1Q 2O2LD 3OWFA 1FVIA 3ULJA 4RCNA 4OHJA 3HOUG 2F3IA 3HOYH 1NE3A 4UPAA 1I4PA 2UXCQ 2FINB 1RTNA 5JEAJ 1Z6HA 1LTBD 2DUDA 3MXGA 3T4AC 2FJ2A 2O4XA 5M3MB 3G4SA 1MSGA 3C1EA 1JE4A 1VQMA 1KLGD 1WD0A 3GTOB 1K0SA 4OL7A 2L55A 3V96A 1XMQQ 1EQTA 1W6JA 2HUGA 1TY0A 2F0SA 2WB1B 1D5ZC 3KLSA 4AYBB 1I3QH 4H7BA 5HGQA 5CYUA 1B53A 3PQIA 1JICA 5A2QE 4KN4C 5ELDA 3S1NH 3D6CA 1ZYRD 3I91A 3WOFA 5C4XB 4P73A 1JWMD 3BZCA 1E1TA 1X3PA 3BDCA 1BOSA 3MEFA 3PIPA 1IBKQ 2Z1CA 4PV1C 1BO0A 4R8IA 3S1MH 4Y7NH 2QILA 3A8IE 2IWHA 1R9TH 4KLKA 3CKIB 1XMQL 2A69C 2CVRA 2OWOA 4GOPA 5I9OA 4H02A 1NNXA 1J8IA 1EYCA 3HOXH 5M3FG 3BYTB 2WKDA 2F0HA 4RKLA 2M00A 1IL2A 2GA4B 3HOUH 5C6AA 4C3JG 1NCVA 1GOZA 1WOCA 1EYDA 2XSCA 4X3SA 2A8VA 1RDPD 3PV0A 3N52A 4X3KA 1F9SA 2PNHA 2MFIA 3MHBA 2NVQB 3PMFA 1DXMA 4HSPA 3F8TA 2G9HD 5E4WC 1CKNB 4M8AA 1F9PA 3GQBA 1TS2A 1HZCA 4DV3Q 3HZXA 1TWFH 5FLMG 4QF4A 3ZYYX 4B9XA 4LF9Q 4NXNQ 3D6WA 1EWHA 1MBYA 1PH1A 4FDBA 2JA7G 1N32L 5I2YA 5LL6S 2PMZE 3E0EA 1JT8A 1VQOA 4C2MH 1X9NA 3AEVA 1IBMQ 1TT2A 4RG1A 4R8NA 4IFDI 2K01A 3PO2G 2R3ZA 3OIQA 1I4RA 1I6VC 1X3GA 2EJMA 4PZ8A 3H15A 1SE8A 4HJ9A 2D9UA 4KKTA 3GTLB 1NJIC 4DV3L 1V1OA 1SXTA 3DM1A 4QMGA 3RD4A 1PYBA 4R4CA 5DEHA 3DEPA 4NXNL 4LF9L 1O78A 2ES2A 1CSQA 4ZCKA 2QEXA 4A93G 2F3VA 1KAWA 2A5HA 1PXUA 4Q0FA 3A0JA 3PO3G 2RSOA 1Y69U 3HOZB 1L0YB 3T51B 1LABA 3EQLC 3SE0A 4BY7B 4Q5VA 4OWTB 3HOVB 1KLUD 1VCIA 3CCLA 1B7YB 4RGNA 3CPFA 1Q8KA 1QUQB 2A19A 2DY7A 4ZKCB 2HT1A 4KJNA 3OTOQ 1I4GA 4BS9A 1WJJA 1IKMA 3QB3A 1K8OA 2VL6A 3FP9A 1A62A 4CDDC 1E2WA 1TQOA 5FLMH 4IUPA 3VR4A 5KNBA 1FGUA 4HJAA 1EWCA 3RUZA 2HIXA 1J6QA 2B63B 1YBYA 1LTAD 2JA7H 2MUYA 2RF4A 4IUUA 2NN6I 5FOBB 2F0TA 1I6HB 4A3JB 2JA5H 2M9VA 3CC4A 1BCPB 3SGIA 3KBGA 4QL5A 4WJ4A 2CCZA 1I94Q 1D7QA 1GUWA 1L0XB
chains in the Genus database with same CATH topology
5FLXE 1NAPA 1NR4A 3H3VC 1EFID 4F7XA 3A8KE 3X3NA 5C4HA 4CJ1B 3E6ZX 1SNPA 1NUCA 1SSOA 1V43A 2ZXRA 1HQRD 2PCFB 4L8JA 3J7AF 3FRPB 1Y1VB 5ELCA 4RAUC 1LT4D 5G3LD 4HEDA 1QE6A 3VA7A 4DAVA 1WTRA 2CW0D 3C46A 1BCPD 2KQ3A 3D8GA 1D6EC 4L6TB 3GTGB 1G2SA 4ZRZA 1QB5D 5TSSA 5CBEE 2PYKA 3PUXA 1HA6A 4IALA 4RHSA 4LAAA 1A2UA 4V0BA 3NTKA 3MVVA 1UAPA 1H9SB 1PTOB 2NVTB 4CKEA 4NDXA 4IQZA 3I3CA 4O42A 3N6RA 1V1PA 2IL8A 1ESRA 5KEEA 1DZ1A 2BOSA 1LV9A 4M1UB 2PO4A 1KAAA 2X69A 4FXKC 3SK4A 1YNJD 4FYDA 4CHTB 1CTMA 5A2QL 4JK1C 3GV3A 2EYPA 1PTOD 1F2LA 1FNVA 3S1MB 4NMZA 1CA5A 5JEAG 1PLFA 1O80A 3EROA 3DWPA 1PDQA 5M9OA 2J0TD 1R9TB 3URYA 1SEBD 3H0GB 3QJYA 2CHBD 2K05A 4ZUIA 4TRDA 5K5PA 2F03A 2TMPA 3J7YW 4MN3A 3P1HA 3LNNA 2A6EC 2L4NA 2B2TA 4JBWA 2PW5A 3S9WA 4KI0A 2EY2A 2IW3A 1JOOA 3HOWB 2SEBD 4B08A 3OWEB 2JA6B 2PZUA 3EA6A 5J1ZA 1F77A 1ILPA 5M5XB 1RCVD 3NUCA 4NKLA 3FKIB 3TP8A 3SVMA 2AQ3B 1UNSA 1HFNA 3FEWX 1STGA 4UDUC 1G2TA 2NYZD 5EBCA 4ODGA 3GTPB 4KK7A 2E2DC 2FMCA 3C1FA 3J81L 3BVGA 2QDBA 2ZXOA 3K7AB 3PUVA 1W6KA 3K5OA 4HSVA 5JEAH 1H9JA 1CQFA 1II3A 1EU4A 1QOHA 5I9PA 4QUCA 2RDFA 1EYAA 3KLRA 1KDBA 1KABA 2JEAI 4DAYA 2L1BA 3CRLC 3K57A 5IGCA 1S5ED 5IGBA 5D14A 3EJIA 1EEID 2FFKB 3K5LA 1SE4A 1VMPA 5KNDA 4ZAIA 4BWGB 3TP6A 1SYFA 1SJED 3PIO3 1HUMA 3NBIA 1E2VA 4P2CB 4DAPA 3DUZA 3P7JA 3ND8A 2JYOA 4QUFA 1BDOA 3VR2A 2O5IC 3KF8A 4K5XA 3R8BA 4EVOA 4G7HC 5NUCA 4HR7B 3DWAA 3ND9A 2NBFA 4K2LA 4A3GB 2C9OA 2JA5B 1O7YA 1PYWD 2RVLA 3A56A 3C3LA 2XRQD 4H13C 1PRTC 5EGTA 1TY2A 1H9MA 1GUSA 1SJHD 3L9AX 3M4OB 4FF2A 1QCBD 2HCIA 3MA2B 4KY6A 1AZQA 2HDLA 1D1KA 3EVQA 3VA5A 5IGGA 3BYYB 1ILQA 1GXDC 4LJZC 1WTVA 2XVSA 5I4DA 1LTID 2E76C 5LHY1 1RKNA 1TWGB 3V2TA 5I6YA 3SEBA 5EKLA 1Q90A 2EY6A 1XX8A 4A3EB 3CQZB 1QNUA 3QOJA 1EQVA 1C4QA 5M5WB 5C3EB 2K5QA 1SYGA 3ITPA 2WINB 4NP5A 4XQQA 5JOBA 3VYSA 2L9HA 1FNWA 1YNNC 2OEOA 2F0KA 2DNCA 3OPOA 3NPPA 3R2IA 5C0XI 2K28A 2K04A 2KJXA 4HMJA 2NUCA 2IX1A 1JORA 4G7ZC 1HHVA 3PUYA 1EZ8A 4CKCA 3NP8A 1XYIA 1WTPA 1PTOH 4RHRA 5KIXA 3TP7A 3I4MB 5DM63 1BUVT 4ZQ3A 4C1NK 3I8ZA 2BA1A 3DMUA 1S5BD 4IUNA 2PZWA 3A7LA 3S1QB 4EQOA 1EIHA 2FMMA 5C3XA 2J4XA 1OO9B 1EY0A 1SMYC 2EDGA 2B2WC 1Y1WB 1TU2B 1VDZA 3OHXC 3BVZA 1QG7A 4XYOA 3A55A 1LTGD 2LKVA 2Q8RE 3M85A 2OF1A 3U9SA 1D5MC 2L11A 3Q0AA 3W3AA 3VR3A 2WIIB 2XNAC 3BZDB 2A69D 1PFNA 1VF5C 2F0WA 5KYLA 5LL6X 1SAPA 4ILWA 1V1PB 4IFDJ 1A2TA 4F88A 3K5NA 1PZID 2B2UC 2WV6D 2WACA 1HFGA 3SHLA 1ESFA 2XN9C 2R92B 3DWQA 5IODA 3R3OA 1JQYD 2EYHA 4WRDA 2JA8B 3LWEA 2KEDA 5EQ0A 1JCKB 1ZEQX 3QOLA 5C44B 5FKAC 2Y0SB 2Q8TA 4F87A 2ID0A 5C5LA 3J81E 2NVYB 2LY7A 2VNUD 2QEJC 3VR6A 2FHTA 1M4VA 2DNEA 1K83B 3FMCA 2Z8LA 2JXMB 1BR9A 2LS01 3NWSA 1Q3LA 3UI2A 3ONAB 4KD3A 3TZUA 2VB3X 1MI2A 3OMGA 2A6HC 1B1ZA 3RLFA 1STYA 2BDNA 2EVBA 1WD1A 3VYTA 2EE1A 3HRZC 2AQ2B 3W2DA 4C3IG 5CV9A 3O13A 4RA8A 5DNFA 1CT1D 5JVH3 1A3TA 5JAVA 3MXUA 5FO9B 1ML0D 1DOKA 4PMCA 2AUJD 2KUMA 3T13A 5FO8B 2E2JB 4K8JA 3QG1A 4C1NI 2VXWA 2EPBA 2MHVA 2SNMA 4G7OC 1LLRD 3E5SA 1XTCD 4BA1I 1SFOB 5M5YB 4K5WA 1JWSD 3H94A 3HG9A 1F2YA 4BBRB 5IOCA 1LT6D 1V8QA 4ABNA 4XDXA 3VR5A 1IL8A 4MHEA 4HCEA 5E4XA 4K2KA 4S3SA 2RKSA 2Z4HA 4KHVA 1I4XA 5KYIA 1U4RA 1OXUA 1SYCA 1RODA 5F2DA 4FF3A 3GTKB 2AUKA 4A3KB 4J1MA 1EL0A 1BNZA 1BCPF 3KUPA 5ELBA 1HUNA 1UEAB 2MGSA 5I6WA 4DU9A 3K59A 3HP3A 5CBAE 4BY1B 4CJ2C 3S2HB 2KA7A 3X3MA 1B9MA 3TN2A 1HPCA 3TZDA 1C8CA 3WDNA 3MFYA 5CV7A 3G7LA 2SNSA 1JWUD 2I07B 1HRJA 1QJOA 3CRKC 2D5DA 1D1IA 5JPNC 2B2YC 4OIKA 1D5XC 4A3FB 1LT3D 1A6XA 1TWCB 2F0GA 3GO5A 4FO2A 3S14B 3SXHA 4QCLA 1KTKA 1AW7A 4ZYSA 1E0BA 3VYRA 3G6JB 2A68C 4DF7A 3I4NB 1GUNA 2Z4IA 2EJGC 2VUMB 1PTOF 4HAEA 2F0LA 1JOKA 4X3TA 3SK5A 3MZ5A 5BN3A 3P20A 2A6ED 2K6AA 1ICWA 1QWYA 3A7AB 1Y8NB 4LMQD 4Z9CB 2WAQB 1A3UA 2X6LA 2F0PA 2KHSA 1GHJA 4H44C 2JP1A 3D4WA 3V05A 3BDOA 1FR3A 4ZK9B 1AEXA 3Q22A 2JEBI 2EYFA 2E74C 2RQXA 4C56C 1JR0D 2AQ1B 2AWOA 1STNA 1I50B 3IFDA 4ID6A 1ENCA 1WCMB 2B2VC 2RDGA 1ET6A 1F2MA 1RF2D 4IFDG 4FNFA 2KCNA 3R93A 2ICIA 4WJWA 4A3BB 3I90A 5JJZA 3MXNA 2K1BA 2G9DA 3M7GA 1PRTB 4EGVA 1IW7C 3WOEA 1TR5A 2EYJA 1CFMA 4DXGA 4IZ8A 5CMDA 3AB9A 4DFAA 1SNDA 3MAQA 3P75A 2IT1A 3RZOB 4RWSC 3J80L 5KRUA 4K6DA 5M3FB 3GV6A 1BBXC 1QILA 2BE5C 1ET9A 1JB3A 3M3YB 1GUGA 3S17B 1OXVA 4C3JB 1I4QA 4KN7C 2NB0A 5C5MA 3BVMA 1WTQA 1Y8OB 3NQTA 1B4OA 1HXYD 5ELFA 3NXWA 2BCOA 2NN6G 1PRTD 1LTSD 4PMBA 5COYA 5D3DA 5J22A 5C4ZA 1M8AA 3GTJB 4KY7A 1B44D 4IFDH 2E2HB 1GUTA 1XWEA 4DN4M 4QIWB 2F0DA 2F1MA 5EPKA 5C0XJ 1Q1EA 1IYUA 1SNOA 3SDZA 5CC4A 4FVMA 1EY6A 4TQUS 3CHBD 4XYQA 1C48A 4FF1A 2ZXPA 2F4IA 4HMIA 4DGZA 4K6LA 1IYVA 1E2ZA 4V190 3L3OC 4G57A 1Q12A 3EFXD 5BN5A 2ENBA 1TS4A 1KDCA 3S2DB 4E6IA 4BA2I 1YNND 4KD4A 4K14A 3IAYA 2VB2X 3H09A 2R7ZB 1FGBD 1VF7A 5EKIA 4N9TA 5C4JB 4A3DB 3NTHA 4DNRB 1SYBA 4CGYB 4TKOB 3K58A 2NN6H 4K8IA 2BA0A 4RGOS 1B50A 2L0CA 5ISRA 2F0IA 3TP5A 4J8QA 1EU3A 4I65A 3AU7A 5I2XA 2K7VA 3T53B 4PQXA 5CR3A 4WFN3 1STBA 1B2TA 1STAA 5CV4A 2B8FA 1O7LA 1BQQT 1STEA 3NE5B 2NVXB 1SYEA 3TBIB 3PUZA 4N9PA 1Z47A 4FP5D 2DY8A 1Y8PB 1T5XD 1Z7TA 1TIID 1SMYD 3U9OA 3RMHA 3I4LA 3H6MA 4C3HB 5ELEA 2N55A 5CV5A 4XT3B 2WP8J 2JE6I 2H1EA 5EKKA 1STHA 4HTHA 4EQNA 2R93B 2EY5A 1EY5A 1SE2A 4IUTA 3IKJA 1DJRD 1UUPA 5DM73 3DHQA 1ZYRC 3E0JA 1U4MA 4HCSA 3NK9A 2KOLA 3SK8A 4QB4A 1AFPA 1R4PB 2HQEA 3RZDB 3KBXA 2K5WA 3J7AV 4LK1C 2R61A 4NW2A 3Q24A 4L63B 3OW7A 2Q8IB 3S16B 1U4PA 1F9QA 4KKUA 3NSWA 3HKZB 1ONLA 5JVG3 2F0UA 2F0VA 2R6GA 3DXJC 3TMEA 3PIP3 4A3MB 3M7NA 1Q8IA 4IUVA 2N88A 5HGTA 2LFNA 2EY1A 2K03A 2F0NA 3HEJA 2YU9B 4UAIA 2AWNA 3FPUB 5IT9L 4ZLTF 5C3WA 2F0EA 1D2BA 4XQNA 3BDLA 3T16A 2E75C 2A6HD 2NTSA 4YIJA 3QWNA 5EJWA 4XTCS 4A3IB 1PFBA 4F8MA 1TWAB 1G291 4KTAA 3I73A 3JAML 2PZTA 1FD7D 1KNEA 3J80E 4IURA 1PZKD 2TSSA 1AN8A 3MTSA 2F0OA 4OO1I 3M4YA 4BBSB 3AMUA 3TDQA 3MC0B 3A54A 3NBHA 5JPMC 2XWBB 2ICEC 3S15B 2CQAA 3GD7A 1H9KA 2B2WA 1TS3A 2EYMA 4ZKBB 2H4OA 1CI3M 2F0JA 2M2LA 2D2CC 4KKSA 3MWYW 2F3WA 2OT2A 1EIGA 5D3IB 2NWGA 2B2TC 4I7ZC 5EBDA 4RGTA 1EY7A 1MD2D 3NQIA 4KY5A 3OSOA 3KLSX 5EPJA 1BXTA 1CK1A 2RA4A 3QO2A 3Q23A 3VYUA 1G6ZA 2I46A 1S5CD 3NTIA 2RDHA 5DAUA 3GTMB 1SNCA 3IFTA 3MEHA 2B39A 1R4QB 4IN3A 4C3HG 1S4ZA 2B2UA 2IX0A 2QF7A 2WKCA 3DEOA 5G3LF 2PNRC 2IJ0A 1GHKA 2C5CA 3HS0C 1S5FD 2YYZA 5C0XG 1EEFD 3MFGA 2JSOA 1PFMA 1ENAA 5CV8A 1A15A 3FVQA 2EYLA 3ERQA 3GTQB 1H9RA 5CV6A 4OGQC 2CW0C 4MIUA 2OXPA 1BCPC 1WVLA 2QCPX 4DA2A 4U68A 5BN4A 3GP7A 3D4RA 2K33A 1PMRA 2PW7A 3S1RB 3D3RA 5A35A 4RGMA 4ME5A 1ZXTA 2IPKD 3HOYB 1NSNS 1CHQD 2EYOA 1EOTA 1LACA 4B9WA 4PNYA 2EJFC 2XWJB 1A3VA 3OMCA 4ZUJA 2PQEA 2J7ZA 1X32A 2A68D 4DK1A 2XIWA 3K5MA 1B3AA 2L12A 3BG3A 1F2ZA 1I3QB 3L7ZC 4KV6A 5AFWA 3S1NB 5C0XH 1YNJC 2D62A 2MJ8A 4CKBA 5IGFA 3LWUA 1I4HA 2PPBC 3KK7A 1FYCA 1RD9D 1VMCA 4H0LC 4FXDA 2K5DA 1OXSC 4RFBA 2ZT9C 3OOCA 1RHPA 4EQPA 1PTOC 4TSSA 4WORA 4Y7NB 4CBVA 2B8GA 1SYDA 5J39A 2KEEA 1AP0A 1G91A 4X3UA 5K36G 2RBMA 3HOXB 1LO5D 1T5EA 3I70A 2EXZA 3PUWA 3K0YA 1MGSA 1J9OA 5KGUA 3HOUB 4R9WA 2RSNA 4KMUC 1KNAA 5HURA 5CGKA 2XRSD 4O1NA 2PMZB 2EZVA 5KNCA 1RTOA 4DXFA 3K6OA 1X3QA 4RCOA 1HTLD 5IGDA 1ENFA 3I72A 1TWFB 5IIFA 1EY9A 4K5VA 4RKBA 1DD2A 5E3FA 1QNKA 4U673 4OIJA 3NHHA 2IX3A 1IKLA 1DM0B 2LMCB 3NWTA 5IT9E 1EZ6A 1B9NA 1CZWA 4C2MB 1FNUA 5CORA 4KJOA 5D65A 3Q6SA 1IW7D 4FXGC 1HQMC 3D31A 1BF4A 1WTXA 1TKWB 4GZYC 1EY4A 2NZ1D 2NTTA 3FDTA 1TVXA 4G4KA 1MSHA 1O7ZA 3SK6A 1Q1BA 1HCZA 5K36H 1KDAA 1JC7A 1XXGA 2BE5D 3JAME 2QKIC 4J6HA 2K32A 1CM9A 1GUOA 4OO1G 1K8MA 2MP1A 1CZGA 3QIAA 1EY8A 1LT5D 1OXXK 1SNQA 2SOBA 2B2YA 1G8ZD 2BDOA 4XIGS 5IGEA 1WTOA 5T1GA 2F0MA 2F0QA 3TSSA 4PMWA 1CHPD 2A74C 3A8JE 3SR1A 1PRTF 1DOMA 1GJXA 4FF4A 1CA6A 1TS5A 4RH6A 3F2UA 2JA7B 4HN7A 2KCCA 3T56B 1U4LA 3H91A 1RJTA 4XXEA 2V4DA 5FO7B 4CJ0B 3PO2B 2O5JC 3LX0A 5FLXL 3C2PA 2X6GA 1H9SA 1AZPA 3HGBA 1IHZA 1WTWA 2KVMA 1ZKOA 1U9RA 3FPPA 2DN8A 4XQJA 1S5DD 4A93B 1DOLA 2A73B 4OO1H 3PO3B 1CQVA 3CU7A 2E2IB 1LTTD 5T1IA 3IL8A 5FK9C 1NR2A 4DNTB 2F0FA 4C3IB 2SDFA 4KHZA 1F9RA 1SDFA 1JOQA 2L5TA 2MPMA 1SBBB 1LTRD 1OXTA 3OIPA 1DCZA 3D4DA 4XT1B 3R2TA 4ULLA 1HTPA 4DK0A 2B2VA 1DONA 4IUQA 2EOTA 1DYQA 3BS1A 5EPLA 2HDMA 5E1FA 2HCCA 1SNMA 1HA5A 3MXPA 1PZJD 2KECA 1TWHB 1SE3A 2O2LD 3OWFA 4RCNA 4OHJA 1I4PA 2FINB 1RTNA 5JEAJ 1Z6HA 1LTBD 3MXGA 3T4AC 2FJ2A 2O4XA 5M3MB 1MSGA 3C1EA 1JE4A 1KLGD 1WD0A 3GTOB 4OL7A 2L55A 3V96A 1EQTA 1W6JA 2HUGA 1TY0A 2F0SA 2WB1B 1D5ZC 3KLSA 4AYBB 4H7BA 5CYUA 1B53A 1JICA 5A2QE 4KN4C 5ELDA 3D6CA 1ZYRD 3I91A 3WOFA 5C4XB 1JWMD 1X3PA 3BDCA 1BOSA 2Z1CA 4PV1C 1BO0A 4R8IA 2QILA 3A8IE 2IWHA 3CKIB 2A69C 2CVRA 5I9OA 1J8IA 1EYCA 3BYTB 2WKDA 2F0HA 4RKLA 2M00A 2GA4B 5C6AA 4C3JG 1NCVA 1GOZA 1EYDA 2XSCA 4X3SA 1RDPD 3PV0A 3N52A 4X3KA 1F9SA 3MHBA 2NVQB 4HSPA 1DXMA 3PMFA 2G9HD 5E4WC 4M8AA 1F9PA 3GQBA 1TS2A 3HZXA 4QF4A 3ZYYX 4B9XA 3D6WA 1EWHA 1MBYA 5I2YA 5LL6S 1TT2A 4R8NA 4IFDI 2K01A 2R3ZA 3OIQA 1I4RA 1I6VC 2EJMA 2D9UA 4KKTA 3GTLB 1V1OA 1SXTA 3DM1A 4QMGA 3RD4A 5DEHA 3DEPA 1O78A 2F3VA 2A5HA 1PXUA 4Q0FA 2RSOA 1Y69U 3HOZB 1L0YB 3T51B 1LABA 3EQLC 3SE0A 4BY7B 4Q5VA 3HOVB 1KLUD 1VCIA 4RGNA 2DY7A 4ZKCB 4KJNA 1I4GA 4BS9A 1IKMA 3QB3A 1K8OA 1E2WA 1TQOA 4IUPA 3VR4A 5KNBA 1EWCA 3RUZA 2B63B 1LTAD 2MUYA 4IUUA 5FOBB 2NN6I 1I6HB 2F0TA 4A3JB 2M9VA 1BCPB 3KBGA 1GUWA 1L0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOS A;  4ULL A;  2GA4 B;  1R4P B;  1C48 A;  2BOS A;  1CZG A;  1D1I A;  2XSC A;  3MXG A;  1R4Q B;  1D1K A;  1CQF A;  1DM0 B;  4M1U B;  1QNU A;  1QOH A;  1C4Q A;  1CZW A;  4P2C B;  2C5C A; 
#chains in the Genus database with same CATH topology
 5FLX E;  2K52 A;  2HHH Q;  1NAP A;  1NR4 A;  3H3V C;  1EFI D;  4F7X A;  3A8K E;  3X3N A;  5C4H A;  3T1Y Q;  4CJ1 B;  1EIY B;  3IRB A;  3E6Z X;  3OTO L;  1YJ9 A;  1SNP A;  4DR5 Q;  1NUC A;  1SSO A;  1V43 A;  2ZXR A;  1HQR D;  3GDE A;  2PCF B;  4L8J A;  2OTJ A;  3M9B A;  2N78 A;  1YHA A;  4DKA C;  3J7A F;  4A93 H;  2K5N A;  1VQN A;  3FRP B;  1Y1V B;  5ELC A;  4RAU C;  5LMN Q;  5E7N A;  1LT4 D;  4JI8 L;  3PO3 H;  5G3L D;  4HED A;  2WB1 G;  1QE6 A;  4AYB G;  1I94 L;  2E2I H;  1KRS A;  3VA7 A;  4DAV A;  1WTR A;  2CW0 D;  4C3I H;  1K9M C;  3C46 A;  3U50 C;  2HHH L;  1BCP D;  2QGQ A;  2KQ3 A;  3D8G A;  1D6E C;  4L6T B;  3GTG B;  2CH4 W;  1G2S A;  5C4X G;  4ZRZ A;  3T1Y L;  1QB5 D;  5TSS A;  5CBE E;  2PYK A;  4DR5 L;  1EWI A;  3PUX A;  4P74 A;  3L2P A;  1HA6 A;  1GKH A;  4IAL A;  3A5Z B;  4RHS A;  4LAA A;  4QQB X;  1A2U A;  2XGT A;  4HIK A;  2B3G A;  1IXR A;  1YHB A;  3PF5 A;  4V0B A;  3NTK A;  3MVV A;  1VQ8 A;  2JN4 A;  1UAP A;  2BH2 A;  1H9S B;  5LMN L;  2K75 A;  3CXC A;  1LTL A;  1PTO B;  4DR6 Q;  2NVT B;  4CKE A;  3J81 i;  4NDX A;  3E3X A;  1VQF A;  2UUC L;  1TWH H;  4IQZ A;  1KC8 C;  3I3C A;  4BXX G;  4O42 A;  3N6R A;  1V1P A;  2IL8 A;  1ESR A;  1K0R A;  5KEE A;  1DZ1 A;  4A3M G;  2BOS A;  1P8L A;  1YEZ A;  5M3M H;  5IYB H;  1LV9 A;  1B8A A;  3BU2 A;  3NEN A;  4B3R Q;  4M1U B;  1PYS B;  2PO4 A;  1KAA A;  1NMG A;  2X69 A;  4FXK C;  1YNJ D;  3SK4 A;  5IP9 G;  3GTO H;  4FYD A;  2Q2U A;  3K81 C;  1N8R C;  4CHT B;  1CTM A;  5A2Q L;  5LMN W;  1L1O A;  4AIM A;  2N3S A;  4GKK L;  4JK1 C;  4MTK A;  3CAM A;  3GV3 A;  2EYP A;  1PTO D;  1F2L A;  1FNV A;  2RHQ B;  3S1M B;  4NMZ A;  1CA5 A;  5JEA G;  1PLF A;  1O80 A;  3ERO A;  4LFB Q;  3DWP A;  1PDQ A;  3EBE A;  5M9O A;  2J0T D;  1R9T B;  3URY A;  3CF5 A;  1SEB D;  3H0G B;  3QJY A;  2CHB D;  5JJK A;  3CD6 A;  2K05 A;  4ZUI A;  4TRD A;  1Q86 C;  4B3R L;  2QDL A;  5K5P A;  3DLL A;  2F03 A;  2WB1 E;  2TMP A;  4AYB E;  3J7Y W;  4MN3 A;  1P16 A;  3P1H A;  3LNN A;  2A6E C;  2L4N A;  1WYD A;  2B2T A;  4JBW A;  2PW5 A;  3S9W A;  4KI0 A;  1EFW A;  3CCR A;  2EY2 A;  3RLO A;  2D0P A;  2IW3 A;  1JOO A;  3HOW B;  2SEB D;  3TRE A;  4B08 A;  4BXX H;  3OWE B;  2JA6 B;  2PZU A;  3HOZ G;  3EA6 A;  4LFB L;  5JJL A;  5J1Z A;  4BY7 G;  4JI4 Q;  1F77 A;  3LGJ A;  1ILP A;  5M5X B;  1RCV D;  3HOV G;  3NUC A;  4NKL A;  1PA6 A;  4LF4 Q;  3FKI B;  3TP8 A;  2NVQ H;  3SVM A;  2AQ3 B;  3U58 A;  1UNS A;  1HFN A;  5IP9 H;  2MO1 A;  1EYG A;  3EIV A;  3FEW X;  1STG A;  4UDU C;  4A3C G;  1G2T A;  2NYZ D;  5EBC A;  4QJF A;  2YV5 A;  4ODG A;  3GTP B;  1RIP A;  4KK7 A;  1JE5 A;  2E2D C;  2FMC A;  2IHF A;  1WI5 A;  3C1F A;  3J81 L;  1AE2 A;  3BVG A;  2UUB Q;  2QDB A;  2ZXO A;  3K7A B;  5LMU Q;  2B63 G;  2KHJ A;  3PUV A;  3G48 A;  1W6K A;  3K5O A;  1XNQ Q;  4HSV A;  4A3J G;  1GD7 A;  5JEA H;  1H9J A;  1CQF A;  1PH3 A;  1N9W A;  1II3 A;  1EU4 A;  4JI4 L;  4L5Q A;  4GOP B;  1QOH A;  5I9P A;  4QUC A;  2RDF A;  1EYA A;  3KLR A;  4LF4 L;  2VS1 A;  1KDB A;  1KAB A;  2I5M X;  3CME A;  2JEA I;  1JJ2 A;  3DM3 A;  4JYA Q;  4DAY A;  4KHP Q;  2KHI A;  2L1B A;  3CRL C;  3K57 A;  3GTL H;  5IGC A;  2VQE L;  1S5E D;  5IGB A;  5D14 A;  3EJI A;  5IT9 c;  4LF8 L;  1EEI D;  2FFK B;  3K5L A;  2UUB L;  1SE4 A;  1VMP A;  4NPS A;  5KND A;  4ZAI A;  4BWG B;  3TP6 A;  1SYF A;  1SJE D;  3PIO 3;  5LMU L;  1HUM A;  3NBI A;  1Q46 A;  1E2V A;  4P2C B;  4DAP A;  3DUZ A;  1Y1V G;  3P7J A;  3STB C;  3ND8 A;  2JYO A;  4QUF A;  5DLQ E;  1BDO A;  2RCF A;  4OEL B;  3VR2 A;  2UUA Q;  2O5I C;  2KCM A;  4BY7 H;  3KF8 A;  1H95 A;  4K5X A;  2LXK A;  3R8B A;  1YIT A;  1WTH A;  3HOV H;  4EVO A;  2F4V Q;  4G7H C;  4X6A H;  5NUC A;  4UHV A;  4HR7 B;  4LUZ A;  4JYA L;  4KHP L;  3DWA A;  1V9P A;  3ND9 A;  3RNU A;  2NBF A;  4K2L A;  1Q81 C;  4A3G B;  3U4V A;  2C9O A;  2RCN A;  2JA5 B;  3JAM c;  4A3C H;  1O7Y A;  1PYW D;  2RVL A;  4JBM A;  4JC0 A;  3A56 A;  3C3L A;  2XRQ D;  4H13 C;  1PRT C;  1K3R A;  4UY8 C;  5EGT A;  4AH6 A;  1TY2 A;  1H9M A;  2MQH A;  1GUS A;  1E7Z A;  1SJH D;  3L9A X;  2B63 H;  4UP9 A;  3M4O B;  4FF2 A;  1QCB D;  2HCI A;  3MA2 B;  4KY6 A;  1I6H H;  4A3J H;  1AZQ A;  2HDL A;  2ZTE A;  1D1K A;  1VQH A;  1G51 A;  3EVQ A;  3VA5 A;  1AH9 A;  2UUA L;  5IGG A;  3BYY B;  1ILQ A;  1GXD C;  1HZA A;  1VQ6 A;  4LJZ C;  4K0K L;  1WTV A;  2XVS A;  1E22 A;  4GNX C;  3M4Q A;  5I4D A;  4LW1 A;  1LTI D;  2E76 C;  5LHY 1;  1RKN A;  1TWG B;  3V2T A;  3K7U C;  5I6Y A;  1A8V A;  3AFQ A;  3SEB A;  1YIJ A;  4DV7 Q;  1VQD A;  5EKL A;  1XPR A;  1Q90 A;  1SR3 A;  2EY6 A;  1XX8 A;  4A3E B;  3CQZ B;  1QNU A;  3UE0 A;  3QOJ A;  1EQV A;  1C4Q A;  5M5W B;  5C3E B;  2K5Q A;  1Y1V H;  1PH4 A;  1SYG A;  3ITP A;  2WIN B;  4NP5 A;  4XQQ A;  3A74 A;  5JOB A;  3VYS A;  2L9H A;  5AJ3 Q;  1N33 Q;  1FNW A;  1YNN C;  1VQ7 A;  2OEO A;  3GTG H;  2F0K A;  2OQK A;  2DNC A;  3OPO A;  3NPP A;  3R2I A;  3GTK H;  1JJC B;  5C0X I;  2K28 A;  2K04 A;  2KJX A;  4HMJ A;  4NXM Q;  2VQF Q;  1EQQ A;  2NUC A;  1C9O A;  4UP8 A;  2L15 A;  4DV7 L;  2IX1 A;  1JOR A;  4G7Z C;  1HHV A;  3PUY A;  2KBN A;  1EZ8 A;  1K73 C;  2Z6K A;  4CKC A;  3NP8 A;  3CCJ A;  1WTP A;  1XYI A;  2BH8 A;  3UDG A;  3KF6 A;  1PTO H;  4RHR A;  1LM0 A;  1UE1 A;  5KIX A;  3TP7 A;  2NVT H;  3I4M B;  5DM6 3;  1BUV T;  4ZQ3 A;  4C1N K;  3I8Z A;  1CSP A;  2BA1 A;  1YNX A;  1S5B D;  3DMU A;  2PZW A;  3A7L A;  4IUN A;  3S1Q B;  4EQO A;  2PI2 A;  5AJ3 L;  1N33 L;  3HOW G;  1EIH A;  2FMM A;  5C3X A;  4LF7 Q;  2J4X A;  4LF6 Q;  1OO9 B;  3PSI A;  4NXM L;  2VQF L;  5GAE C;  1EY0 A;  4EX5 A;  1SMY C;  4DAM A;  3FKI G;  2EDG A;  4X65 Q;  2B2W C;  1Y1W B;  3TS2 A;  1TU2 B;  1VDZ A;  1E1O A;  3OHX C;  3BVZ A;  1QG7 A;  4XYO A;  1YHQ A;  3A55 A;  1LTG D;  2LKV A;  2Q8R E;  3M85 A;  1XJV A;  2OF1 A;  4OXP A;  1I5F A;  1QZH A;  3U9S A;  1D5M C;  2L11 A;  4IPD A;  3Q0A A;  1PH8 A;  2UU9 L;  3W3A A;  2ZTD A;  1IBL Q;  4LF7 L;  3VR3 A;  3CC7 A;  1EUJ A;  4IOC A;  4LF6 L;  2WII B;  2XNA C;  3BZD B;  2A69 D;  2YTY A;  1PFN A;  1YI2 A;  1GO3 E;  1UEB A;  3H0G H;  4X65 L;  1VF5 C;  2F0W A;  5KYL A;  3W5O A;  5LL6 X;  1SAP A;  4ILW A;  1XPU A;  2LSS A;  1V1P B;  4IFD J;  1N32 Q;  1A2T A;  4F88 A;  3K5N A;  1PZI D;  2K14 A;  4EQ5 A;  4O0A A;  2EXD A;  5H1S E;  2B2U C;  2WV6 D;  2WAC A;  4CDC C;  1IBL L;  1HFG A;  2WFW A;  3SHL A;  3H3V I;  3HOW H;  1ESF A;  2XN9 C;  2JA6 H;  1PH5 A;  1KIX A;  2R92 B;  3DWQ A;  1L1O B;  5IOD A;  3R3O A;  1JQY D;  2EYH A;  4WRD A;  2JA8 B;  5M5X H;  2UXD Q;  3LWE A;  3FKI H;  4DR7 Q;  4PZ6 A;  2KED A;  5EQ0 A;  5IP7 G;  1JCK B;  1ZEQ X;  3QOL A;  5C44 B;  1L0W A;  5FKA C;  2Y0S B;  2Q8T A;  4A76 A;  4F87 A;  4A3G G;  2ID0 A;  2JA5 G;  5C5L A;  4JI3 L;  3GTP H;  3J81 E;  2NVY B;  4DR3 Q;  1VQI A;  2LY7 A;  2VNU D;  3K7A H;  2QEJ C;  4HJ5 A;  3VR6 A;  1S40 A;  2NZH A;  2FHT A;  1M4V A;  2DNE A;  1K83 B;  3FMC A;  4DV1 Q;  2Z8L A;  2JXM B;  1BR9 A;  3B6Y A;  2LS0 1;  3NWS A;  1Q3L A;  4ME3 A;  3UI2 A;  3ONA B;  4KD3 A;  4GLV B;  3TZU A;  4DV0 Q;  2VB3 X;  2UXD L;  1MI2 A;  3OMG A;  1C7Y A;  2A6H C;  1B1Z A;  3RLF A;  1STY A;  4DR7 L;  2BDN A;  4GLA C;  1RL2 A;  1SRU A;  2EVB A;  1FJG Q;  1WD1 A;  3VYT A;  4POF A;  1CKM A;  2CWA A;  2EE1 A;  3HRZ C;  1X6O A;  2AQ2 B;  3W2D A;  4DR3 L;  4C3I G;  5CV9 A;  4A3E G;  3O13 A;  4JBJ A;  4RA8 A;  1CT1 D;  5DNF A;  5C3E G;  2ZJR A;  5JVH 3;  3W1G A;  1A3T A;  4DV1 L;  5JAV A;  3MXU A;  1VQA A;  2K4K A;  5FO9 B;  4L5R C;  3T1H Q;  1ML0 D;  1MHW C;  1DOK A;  4IJH A;  4YWM A;  4DV0 L;  4PMC A;  2AUJ D;  4YWL A;  5L37 A;  1SN8 A;  4JI6 Q;  1QVC A;  4R1J A;  2KUM A;  3T13 A;  3J80 c;  5FO8 B;  5IP7 H;  2E2J B;  4K8J A;  1K8A C;  1FJG L;  3QG1 A;  4C1N I;  3EN2 A;  4J15 A;  4MZ9 A;  4A3G H;  2VXW A;  2EPB A;  4A75 A;  1YJW A;  3K0X A;  4JI8 Q;  4JV5 Q;  2QW7 A;  2MHV A;  2SNM A;  4NB3 A;  4G7O C;  1LLR D;  3E5S A;  1XTC D;  4BA1 I;  1SFO B;  5M5Y B;  4DAY B;  4K5W A;  1JWS D;  3H94 A;  3HG9 A;  3M4O H;  1F2Y A;  4BBR B;  5IOC A;  1LT6 D;  1V8Q A;  3I4M G;  1UE6 A;  3HFZ B;  4ABN A;  3T1H L;  4XDX A;  3VR5 A;  5M3M G;  3RN2 A;  4R4O A;  5GAG C;  1IL8 A;  5IYB G;  4JI6 L;  4QY7 A;  3BZK A;  1DGS A;  4MHE A;  4HCE A;  4DNI A;  5EAY A;  4LFC Q;  4DR4 Q;  1TWG H;  2CKZ B;  3KF8 B;  5E4X A;  4JV5 L;  1Y1W G;  4JI1 L;  4K2K A;  1HZ9 A;  4S3S A;  4A4I A;  4GLX A;  2RKS A;  2Z4H A;  1N36 Q;  2UUC Q;  4KHV A;  1I4X A;  1YJN A;  4A3E H;  3CQZ H;  5KYI A;  1U4R A;  1OXU A;  1SYC A;  1ROD A;  5F2D A;  1KRT A;  5M5W H;  5C3E H;  4FF3 A;  1NY4 A;  3GTK B;  2AUK A;  5FLX c;  4A3K B;  4J1M A;  1EL0 A;  4IPG A;  3U4Z A;  1BNZ A;  1BCP F;  4GN4 B;  4JI5 Q;  1X3E A;  1BBW A;  3KUP A;  1EQR A;  5ELB A;  3RR5 A;  1FL0 A;  2R7Z H;  1TXY A;  1BVS A;  1HUN A;  3W1B A;  1UEA B;  2MGS A;  5I6W A;  1ICF B;  4DU9 A;  3F2B A;  4LFC L;  4DR4 L;  3K59 A;  2DGY A;  3HP3 A;  2OCE A;  4HID A;  5CBA E;  4BY1 B;  4CJ2 C;  3S2H B;  4GKK Q;  1N36 L;  2KA7 A;  3X3M A;  1B9M A;  1BKB A;  3TN2 A;  1HPC A;  4YCV A;  3TZD A;  2IY5 B;  1C8C A;  3WDN A;  1K8G A;  3MFY A;  5CV7 A;  1X3F A;  3G7L A;  3I56 A;  2SNS A;  1JWU D;  2I07 B;  2Q2I A;  3I4M H;  1HRJ A;  1QJO A;  3CRK C;  2D5D A;  1D1I A;  4JI5 L;  5JPN C;  3ULL A;  2B2Y C;  4OIK A;  3S1Q H;  1D5X C;  1HR0 Q;  3PCO B;  4A3F B;  1LT3 D;  3K80 C;  1A6X A;  1TWC B;  1KXL A;  5FJ8 G;  2F0G A;  3GO5 A;  1XNR Q;  4FO2 A;  2R92 G;  2OQ0 A;  1E3P A;  3S14 B;  3SXH A;  4QCL A;  1KTK A;  1AW7 A;  4ZYS A;  1E0B A;  3VYR A;  1Y1W H;  3G6J B;  2A68 C;  4DF7 A;  3I4N B;  1NBW A;  5C44 G;  1A0I A;  3CMA A;  3ZJY C;  4B3S Q;  4PZ7 A;  1GUN A;  4DK6 C;  2Z4I A;  2EJG C;  2VUM B;  1PTO F;  4HAE A;  2F0L A;  1JOK A;  1HR0 L;  3HKS A;  4X3T A;  2MNA A;  3SK5 A;  3MZ5 A;  5BN3 A;  3P20 A;  4LUV A;  2H5X A;  1XNR L;  2A6E D;  2K6A A;  1ICW A;  1QWY A;  1SLJ A;  3A7A B;  3KF6 B;  1Y8N B;  4LMQ D;  4Z9C B;  1N34 Q;  2WAQ B;  1VQ9 A;  1A3U A;  2X6L A;  3RLN A;  2I5H A;  2F0P A;  1PHJ A;  2KHS A;  4B3S L;  1GHJ A;  4HJ8 A;  1Q82 C;  4H44 C;  2JP1 A;  3KOJ A;  3D4W A;  3M4P A;  5HY6 A;  3V05 A;  3BDO A;  4Y52 H;  1PVO A;  3VDY A;  1FR3 A;  2D0O A;  4ZK9 B;  3PGZ A;  1AEX A;  3Q8D A;  3Q22 A;  2JEB I;  2KCT A;  2EYF A;  1HNW Q;  2E74 C;  2RQX A;  3OYY A;  4C56 C;  1HR0 W;  1JR0 D;  2HQL A;  2AQ1 B;  2AWO A;  4YCW A;  1STN A;  1I50 B;  3IFD A;  5FJ8 H;  2R92 H;  4ID6 A;  1N34 L;  4DK3 C;  2OTL A;  2VQE Q;  1ENC A;  1M90 C;  1WCM B;  2B2V C;  2JA8 H;  2RDG A;  4LF8 Q;  1ET6 A;  1F2M A;  1RF2 D;  4IFD G;  5C44 H;  1VQG A;  4FNF A;  2R7D A;  2JJQ A;  3PIO A;  4R4Q A;  2KCN A;  3R93 A;  3J81 j;  3J7Z C;  2ICI A;  4WJW A;  4R4T A;  2NVY H;  4A3B B;  2CH4 A;  1HNW L;  3I90 A;  5JJZ A;  1VQ5 A;  1IYJ B;  3MXN A;  2K1B A;  2G9D A;  2E5L Q;  3M7G A;  4BBR G;  1PRT B;  4EGV A;  1IW7 C;  3WOE A;  1J5E Q;  1K83 H;  1TR5 A;  2EYJ A;  4HIM A;  1CFM A;  4DXG A;  2K50 A;  4IZ8 A;  5CMD A;  3AB9 A;  4DFA A;  1SND A;  3I2Z A;  3MAQ A;  3P75 A;  2IT1 A;  3STB D;  4RWS C;  3RZO B;  3J80 L;  5KRU A;  4JBK A;  1TWA H;  1KQS A;  4K6D A;  5M3F B;  3GV6 A;  3H3V H;  2PQA A;  1CUK A;  1BBX C;  1QIL A;  2BE5 C;  1ET9 A;  2ZM6 Q;  1JB3 A;  2XTI A;  3M3Y B;  2EQS A;  1GUG A;  3S17 B;  5GAH C;  2IHE A;  1OXV A;  4C3J B;  1I4Q A;  4N8X 1;  3UDI A;  4KN7 C;  2QA4 A;  1HNX Q;  2NB0 A;  4K0K Q;  2E5L L;  5C5M A;  3BVM A;  1WTQ A;  1Y8O B;  3NQT A;  1B4O A;  1HXY D;  5ELF A;  4A3K G;  1J5E L;  3NXW A;  4DV2 L;  2BCO A;  1XMO Q;  2NN6 G;  1HNZ Q;  1PRT D;  1LTS D;  4PMB A;  5COY A;  5D3D A;  5J22 A;  5C4Z A;  1M8A A;  3GTJ B;  1VS0 A;  4KY7 A;  1B44 D;  4IFD H;  2E2J H;  2E2H B;  3KJO A;  1GUT A;  1XWE A;  4DN4 M;  4QIW B;  2F0D A;  2Q2T A;  2F1M A;  4BY1 G;  2ZM6 L;  4GOP C;  5EPK A;  4CDF C;  5C0X J;  1Q1E A;  1K3B C;  1HNX L;  1IYU A;  1SFO H;  4GN5 A;  4APV A;  5M5Y H;  1SNO A;  1BBU A;  2HD3 A;  3SDZ A;  5CC4 A;  4FVM A;  4BBR H;  1EY6 A;  4HJ7 A;  1QVF A;  1VQL A;  4TQU S;  3CHB D;  4XYQ A;  1C48 A;  4FF1 A;  2ZXP A;  2F4I A;  4HMI A;  4LUO A;  4DGZ A;  1XMO L;  1HNZ L;  4K6L A;  1IYV A;  1E2Z A;  4A3F G;  4V19 0;  3L3O C;  4G57 A;  5GAD C;  1Q12 A;  3EFX D;  5BN5 A;  1IZ6 A;  2ENB A;  4DUY Q;  1TS4 A;  1KDC A;  3S2D B;  4DR2 Q;  3CP0 A;  4JW0 A;  1PH6 A;  4E6I A;  4BA2 I;  1YNN D;  4KD4 A;  1MJC A;  3I4N G;  4K14 A;  3IAY A;  5GRO A;  2VB2 X;  1UWV A;  3H09 A;  5IWA Q;  5IYD G;  2R7Z B;  1FGB D;  1VF7 A;  5EKI A;  4N9T A;  5C4J B;  4LFA Q;  1D8L A;  2VUM G;  4A3K H;  4A3D B;  3NTH A;  3BJU A;  4DNR B;  1SYB A;  4CGY B;  3H0G G;  4TKO B;  3K58 A;  2GVA A;  2NN6 H;  1MKH A;  4DV5 Q;  1Z9F A;  4K8I A;  2BA0 A;  4RGO S;  1B50 A;  2L0C A;  3TQY A;  2F0I A;  2R7F A;  3TP5 A;  4J8Q A;  1EU3 A;  2YTV A;  5ISR A;  3F2C A;  4I65 A;  3AU7 A;  5I2X A;  4YHH Q;  4GS3 A;  2WAQ G;  3JC6 6;  2K7V A;  4JI0 Q;  3T53 B;  4PQX A;  5CR3 A;  4DUY L;  4WFN 3;  4DR2 L;  1STB A;  1B2T A;  4BY1 H;  3S2H H;  1STA A;  5CV4 A;  2B8F A;  1O7L A;  1BQQ T;  1STE A;  4OEM B;  2P5Z X;  3NE5 B;  2B29 A;  1S3O A;  5IWA L;  2UU9 Q;  2NVX B;  1SYE A;  2Z6B A;  1T9H A;  3TBI B;  3PUZ A;  4N9P A;  2K5V A;  1Z47 A;  3F1Z A;  2JA6 G;  4FP5 D;  2DY8 A;  1Y8P B;  4LFA L;  4OON A;  1T5X D;  1Z7T A;  1XTD A;  1TII D;  1SMY D;  2YTX A;  2Z0S A;  3U9O A;  1OTC A;  2GVB A;  3RMH A;  2V1C C;  2NZO A;  2N49 A;  2K5H A;  4DV5 L;  4A3F H;  5J3B A;  4RMF A;  3I4L A;  3H6M A;  1TWC H;  4C3H B;  4YHH L;  3JAM i;  5ELE A;  2N55 A;  3I4O A;  4JI0 L;  3S14 H;  1WCM G;  5CV5 A;  1NMF A;  1PH2 A;  4XT3 B;  2WP8 J;  1Q7Y C;  2JE6 I;  3A5U A;  2H1E A;  4JI7 L;  5EKK A;  1STH A;  4HTH A;  3I4N H;  4EQN A;  2R93 B;  2EY5 A;  1EY5 A;  1SE2 A;  5IYD H;  4DR1 L;  2I0Q A;  4IUT A;  1X56 A;  4IO9 A;  3S24 A;  3IKJ A;  1DJR D;  1UUP A;  2VUM H;  2UXB Q;  5DM7 3;  4PG3 A;  2UXC L;  4A3B G;  3DHQ A;  3CCU A;  1ZYR C;  3E0J A;  3ERS X;  1U4M A;  4HCS A;  4QGU A;  3NK9 A;  3G71 A;  1EOV A;  2KOL A;  3SK8 A;  4QB4 A;  1AFP A;  1R4P B;  2HQE A;  3CPW A;  3RZD B;  3KBX A;  4DV4 Q;  2K5W A;  3J7A V;  4LK1 C;  4JI3 Q;  1KD1 C;  4ALP A;  2R61 A;  4NW2 A;  3Q24 A;  4L63 B;  1YVC A;  3OW7 A;  2Q8I B;  3S16 B;  1U4P A;  1F9Q A;  4IPC A;  4KKU A;  3NSW A;  3HKZ B;  1ONL A;  5JVG 3;  2UXB L;  2N8N A;  2F0U A;  1U5K A;  2F0V A;  4GNX A;  2R6G A;  4JPB W;  3QR8 A;  3DXJ C;  3TME A;  3PIP 3;  2WAQ E;  3D0F A;  4A3M B;  3M7N A;  4B3M Q;  1IBK L;  1Q8I A;  4IUV A;  4N8F A;  2PI2 E;  1I50 H;  2N88 A;  3NEL A;  5HGT A;  4POG A;  2LFN A;  4DV4 L;  4YCU A;  2EY1 A;  2K03 A;  1WCM H;  2F0N A;  3HEJ A;  2YU9 B;  4UAI A;  2AWN A;  3FPU B;  5IT9 L;  1PV4 A;  4JCV E;  1B3Q A;  4ZLT F;  4MTN A;  2F0E A;  5C3W A;  1QVG A;  1GVP A;  1D2B A;  3TEH B;  4XQN A;  4WJ3 M;  3ICE A;  3BDL A;  3K8A A;  2AMC B;  3T16 A;  4OWW B;  2E75 C;  2A6H D;  2NTS A;  4YIJ A;  4A3B H;  3QWN A;  1L2F A;  5EJW A;  4B3M L;  4XTC S;  2DJG C;  4A3I B;  1VQC A;  1PFB A;  4O2D A;  4F8M A;  1TWA B;  1G29 1;  4KTA A;  3I73 A;  3JAM L;  2PZT A;  1FD7 D;  1KNE A;  3NEM A;  2ALY B;  3J80 E;  4IUR A;  2CFM A;  3CCM A;  3RZO H;  1PZK D;  3J81 c;  5GQO A;  2TSS A;  5M3F H;  1A63 A;  1AN8 A;  1L1O C;  2CQO A;  3MTS A;  2F0O A;  3UDX A;  1S72 A;  4OO1 I;  3M4Y A;  3M3Y H;  3S17 H;  4BBS B;  1SRO A;  4C3J H;  1IBM L;  3AMU A;  3TDQ A;  3MC0 B;  3TRZ A;  3CCS A;  2R7Z G;  3A54 A;  2C35 B;  3NBH A;  2XWB B;  5JPM C;  2ICE C;  3KLW A;  5IY0 A;  3S15 B;  2CQA A;  3GD7 A;  1JB7 A;  1H9K A;  1O7I A;  1NTG A;  2JK8 A;  2B2W A;  2ZJP A;  1X55 A;  4LWC A;  3AYH B;  4A3D G;  1JJG A;  1TS3 A;  2EYM A;  4ZKB B;  2H4O A;  1CI3 M;  2F0J A;  2M2L A;  2D2C C;  4KKS A;  4JI1 Q;  3MWY W;  4I7A A;  3MXN B;  1AE3 A;  4MNO A;  3GTJ H;  2F3W A;  2OT2 A;  2E2H H;  3AFP A;  1EIG A;  5D3I B;  2NWG A;  3WWV A;  2B2T C;  1K28 A;  1PFS A;  4I7Z C;  5EBD A;  3F2D A;  3KDF A;  4RGT A;  1EY7 A;  1MD2 D;  1GM5 A;  3NQI A;  4KY5 A;  3OSO A;  3KLS X;  5EPJ A;  1BXT A;  4B3T Q;  1CK1 A;  2RA4 A;  3QO2 A;  3PO2 H;  4X64 Q;  3TS0 A;  2PQA B;  2EIF A;  3Q23 A;  1VQJ A;  3VYU A;  1G6Z A;  2G5D A;  2I46 A;  1S5C D;  3NTI A;  2RDH A;  3CW2 C;  5DAU A;  4QIW E;  2DJF C;  3GTM B;  1SNC A;  4TVA B;  3IFT A;  3MEH A;  4P71 A;  2B39 A;  1R4Q B;  4IN3 A;  4C3H G;  1S4Z A;  4DUZ Q;  2B2U A;  2IX0 A;  2QF7 A;  2WKC A;  3DEO A;  5G3L F;  4HIO A;  1ASZ A;  2PNR C;  2IJ0 A;  1GHK A;  2C5C A;  1KL9 A;  3HS0 C;  1S5F D;  2YYZ A;  3KFU A;  5C0X G;  3S2D H;  1EEF D;  2MO0 A;  2JSO A;  3MFG A;  1PFM A;  4UP7 A;  1ENA A;  2R93 G;  4B3T L;  5CV8 A;  1PH9 A;  1VQP A;  1A15 A;  3FVQ A;  4X64 L;  2EYL A;  3ERQ A;  1X65 A;  3GTQ B;  1H9R A;  5CV6 A;  5C4J H;  4OGQ C;  2CW0 C;  4MIU A;  2OXP A;  4A3D H;  1BCP C;  4A3L G;  1LUZ A;  1G6P A;  1WVL A;  2QCP X;  4GN3 B;  1HJP A;  4DA2 A;  2LXJ A;  2ASB A;  1U0L A;  4U68 A;  5BN4 A;  3GP7 A;  3D4R A;  1MIU A;  1UE5 A;  2K33 A;  1PMR A;  4DUZ L;  2PW7 A;  3S1R B;  3D3R A;  4AQY Q;  5A35 A;  4RGM A;  3G6E A;  4ME5 A;  1HH2 P;  4OX9 Q;  4IJL A;  1ZXT A;  2IPK D;  3HOY B;  1NSN S;  1VQK A;  1CHQ D;  2EYO A;  5IYC G;  4YY3 Q;  1EOT A;  1PH7 A;  1LAC A;  3UE1 A;  2NVX H;  4B9W A;  1KHI A;  4PNY A;  2EJF C;  2XWJ B;  1A3V A;  3OMC A;  3HKZ G;  2VZA A;  3RN5 A;  4JOI C;  1X54 A;  4ZUJ A;  2PQE A;  2JA8 G;  2J7Z A;  1X32 A;  2JA9 A;  2A68 D;  4DK1 A;  3ULP A;  2XIW A;  3K5M A;  1B3A A;  1VQB A;  3J80 i;  2L12 A;  4LNQ A;  3L0O A;  1EIF A;  3BG3 A;  4GKJ Q;  3KYH C;  1F2Z A;  3AQQ A;  1I3Q B;  2AHO B;  2Y0S G;  4AQY L;  4C3H H;  3L7Z C;  4L5T A;  4KV6 A;  5AFW A;  3PF4 A;  4OX9 L;  1CKN A;  3S1N B;  5C0X H;  1YNJ C;  4YY3 L;  2D62 A;  2VY3 A;  2MJ8 A;  4DR6 L;  4CKB A;  4JI2 Q;  5IGF A;  5BR8 Q;  4IOA A;  3LWU A;  1I4H A;  2R93 H;  2PPB C;  3KK7 A;  1FYC A;  1RD9 D;  1VMC A;  4H0L C;  4FXD A;  2K5D A;  1OXS C;  4RFB A;  2ZT9 C;  3OOC A;  1RHP A;  4EQP A;  4DV6 Q;  1PTO C;  4TSS A;  4WOR A;  4Y7N B;  3CCQ A;  2B8G A;  4CBV A;  1SYD A;  5C4X H;  5J39 A;  2KEE A;  4A3L H;  1AP0 A;  1G91 A;  4X3U A;  5K36 G;  4L5S A;  4GKJ L;  4A3I G;  2RBM A;  2Z9H A;  3HOX B;  1LO5 D;  5ELN A;  2AKW B;  3RZD H;  1T5E A;  3UDF A;  3I70 A;  2EXZ A;  3PUW A;  3K0Y A;  1MGS A;  1J9O A;  5KGU A;  3HOU B;  4R9W A;  2RSN A;  1SMX A;  4KMU C;  4OWX B;  4CDE C;  1KNA A;  3E9I A;  5HUR A;  2GN5 A;  5IYC H;  4JI2 L;  5BR8 L;  3S16 H;  5CGK A;  2XRS D;  4O1N A;  2PMZ B;  2EZV A;  5KNC A;  4DV6 L;  1RTO A;  4LF5 Q;  4BBS G;  4DXF A;  3K6O A;  5JJI A;  1X3Q A;  4JVZ A;  4RCO A;  1HTL D;  5IGD A;  1E24 A;  4IPH A;  1ENF A;  3I72 A;  4A3M H;  1TWF B;  5IIF A;  1EY9 A;  4K5V A;  4RKB A;  1DD2 A;  5E3F A;  1QNK A;  3E9H A;  4U67 3;  4OIJ A;  1YZ6 A;  1C0A A;  2CWP A;  3NHH A;  2IX3 A;  1IKL A;  1DM0 B;  2LMC B;  3NWT A;  5IT9 E;  1QUQ A;  2YU9 H;  1EZ6 A;  3HKZ E;  1B9N A;  1CZW A;  1WFQ A;  1FNU A;  4C2M B;  5COR A;  4KJO A;  5D65 A;  3Q6S A;  2Z6K C;  1IW7 D;  4FXG C;  1QZG A;  1HQM C;  3D31 A;  1BF4 A;  1WTX A;  1TKW B;  4LF5 L;  1Y14 B;  4GZY C;  1EY4 A;  4DV2 Q;  2NZ1 D;  2NTT A;  3FDT A;  4R4I A;  2Y0S E;  1TVX A;  4G4K A;  1MSH A;  1O7Z A;  3SK6 A;  1Q1B A;  1HCZ A;  5IE8 A;  5K36 H;  1KDA A;  4A3I H;  1JC7 A;  1XXG A;  2BE5 D;  3JAM E;  2QKI C;  4GNX B;  4J6H A;  2K32 A;  1CM9 A;  1GUO A;  4OO1 G;  1VQE A;  1K8M A;  2MP1 A;  1CZG A;  3QIA A;  1EY8 A;  1LT5 D;  3OW2 A;  1OXX K;  4YWK A;  2HIV A;  1SNQ A;  2SOB A;  2B2Y A;  2ZJQ A;  1V1Q A;  2ATW A;  1G8Z D;  2RHS B;  2BDO A;  4XIG S;  1XNQ L;  5IGE A;  1WTO A;  4JG2 A;  5T1G A;  4BBS H;  2F0M A;  2F0Q A;  3TSS A;  4JOI A;  4P72 A;  1MJE A;  3HOZ H;  4PMW A;  3KJP A;  1CHP D;  2A74 C;  2VW9 A;  3S15 H;  4DPG A;  4X66 Q;  2KEN A;  3I7F A;  3A8J E;  2A1A A;  2Q2H A;  3SR1 A;  1PRT F;  1DOM A;  1UE7 A;  5ELO A;  1GJX A;  4FF4 A;  1CA6 A;  1TS5 A;  4RH6 A;  3CC2 A;  3F2U A;  2JA7 B;  4HN7 A;  1VQ4 A;  2KCC A;  3T56 B;  3I55 A;  1U4L A;  4X62 Q;  3H91 A;  1RJT A;  4XXE A;  2V4D A;  5FO7 B;  4CJ0 B;  3J7A 5;  3PO2 B;  2O5J C;  3LX0 A;  5FLX L;  3HOY G;  3C2P A;  2F52 A;  3CCV A;  2X6G A;  1H9S A;  1AZP A;  3HGB A;  3ER0 A;  3FHW A;  1IHZ A;  1WTW A;  1M1K C;  4X66 L;  1JMC A;  2KVM A;  1ZKO A;  2F4V L;  1U9R A;  3FPP A;  2DN8 A;  4XQJ A;  1S5D D;  4A93 B;  1DOL A;  2A73 B;  1W3S A;  3NBH B;  4OO1 H;  3PO3 B;  3GTM H;  1CQV A;  3CU7 A;  1B70 B;  4X62 L;  2E2I B;  1LTT D;  5T1I A;  3IL8 A;  5FK9 C;  1HZB A;  1NR2 A;  4DNT B;  2F0F A;  4C3I B;  2SDF A;  4KHZ A;  4P75 A;  1F9R A;  3CCE A;  1SDF A;  1JOQ A;  2L5T A;  2MPM A;  1SBB B;  1LTR D;  1OXT A;  3OIP A;  1DCZ A;  3D4D A;  4XT1 B;  1LYL A;  3R2T A;  4ULL A;  1HTP A;  2I5L X;  4DK0 A;  2B2V A;  1DON A;  1CKO A;  4IUQ A;  1ASY A;  2EOT A;  3GTQ H;  1DYQ A;  2FXQ A;  3BS1 A;  5EPL A;  2HDM A;  3KDF B;  5E1F A;  2HCC A;  2JQO A;  1XPO A;  1SNM A;  1HA5 A;  3MXP A;  4JI7 Q;  1W2B A;  1PZJ D;  2E8G A;  2ZTC A;  2KEC A;  3HOX G;  3S1R H;  1TWH B;  1SE3 A;  4DR1 Q;  2O2L D;  3OWF A;  1FVI A;  3ULJ A;  4RCN A;  4OHJ A;  3HOU G;  2F3I A;  3HOY H;  1NE3 A;  4UPA A;  1I4P A;  2UXC Q;  2FIN B;  1RTN A;  5JEA J;  1Z6H A;  1LTB D;  2DUD A;  3MXG A;  3T4A C;  2FJ2 A;  2O4X A;  5M3M B;  3G4S A;  1MSG A;  3C1E A;  1JE4 A;  1VQM A;  1KLG D;  1WD0 A;  3GTO B;  1K0S A;  4OL7 A;  2L55 A;  3V96 A;  1XMQ Q;  1EQT A;  1W6J A;  2HUG A;  1TY0 A;  2F0S A;  2WB1 B;  1D5Z C;  3KLS A;  4AYB B;  1I3Q H;  4H7B A;  5HGQ A;  5CYU A;  1B53 A;  3PQI A;  1JIC A;  5A2Q E;  4KN4 C;  5ELD A;  3S1N H;  3D6C A;  1ZYR D;  3I91 A;  3WOF A;  5C4X B;  4P73 A;  1JWM D;  3BZC A;  1E1T A;  1X3P A;  3BDC A;  1BOS A;  3MEF A;  3PIP A;  1IBK Q;  2Z1C A;  4PV1 C;  1BO0 A;  4R8I A;  3S1M H;  4Y7N H;  2QIL A;  3A8I E;  2IWH A;  1R9T H;  4KLK A;  3CKI B;  1XMQ L;  2A69 C;  2CVR A;  2OWO A;  4GOP A;  5I9O A;  4H02 A;  1NNX A;  1J8I A;  1EYC A;  3HOX H;  5M3F G;  3BYT B;  2WKD A;  2F0H A;  4RKL A;  2M00 A;  1IL2 A;  2GA4 B;  3HOU H;  5C6A A;  4C3J G;  1NCV A;  1GOZ A;  1WOC A;  1EYD A;  2XSC A;  4X3S A;  2A8V A;  1RDP D;  3PV0 A;  3N52 A;  4X3K A;  1F9S A;  2PNH A;  2MFI A;  3MHB A;  2NVQ B;  3PMF A;  1DXM A;  4HSP A;  3F8T A;  2G9H D;  5E4W C;  1CKN B;  4M8A A;  1F9P A;  3GQB A;  1TS2 A;  1HZC A;  4DV3 Q;  3HZX A;  1TWF H;  5FLM G;  4QF4 A;  3ZYY X;  4B9X A;  4LF9 Q;  4NXN Q;  3D6W A;  1EWH A;  1MBY A;  1PH1 A;  4FDB A;  2JA7 G;  1N32 L;  5I2Y A;  5LL6 S;  2PMZ E;  3E0E A;  1JT8 A;  1VQO A;  4C2M H;  1X9N A;  3AEV A;  1IBM Q;  1TT2 A;  4RG1 A;  4R8N A;  4IFD I;  2K01 A;  3PO2 G;  2R3Z A;  3OIQ A;  1I4R A;  1I6V C;  1X3G A;  2EJM A;  4PZ8 A;  3H15 A;  1SE8 A;  4HJ9 A;  2D9U A;  4KKT A;  3GTL B;  1NJI C;  4DV3 L;  1V1O A;  1SXT A;  3DM1 A;  4QMG A;  3RD4 A;  1PYB A;  4R4C A;  5DEH A;  3DEP A;  4NXN L;  4LF9 L;  1O78 A;  2ES2 A;  1CSQ A;  4ZCK A;  2QEX A;  4A93 G;  2F3V A;  1KAW A;  2A5H A;  1PXU A;  4Q0F A;  3A0J A;  3PO3 G;  2RSO A;  1Y69 U;  3HOZ B;  1L0Y B;  3T51 B;  1LAB A;  3EQL C;  3SE0 A;  4BY7 B;  4Q5V A;  4OWT B;  3HOV B;  1KLU D;  1VCI A;  3CCL A;  1B7Y B;  4RGN A;  3CPF A;  1Q8K A;  1QUQ B;  2A19 A;  2DY7 A;  4ZKC B;  2HT1 A;  4KJN A;  3OTO Q;  1I4G A;  4BS9 A;  1WJJ A;  1IKM A;  3QB3 A;  1K8O A;  2VL6 A;  3FP9 A;  1A62 A;  4CDD C;  1E2W A;  1TQO A;  5FLM H;  4IUP A;  3VR4 A;  5KNB A;  1FGU A;  4HJA A;  1EWC A;  3RUZ A;  2HIX A;  1J6Q A;  2B63 B;  1YBY A;  1LTA D;  2JA7 H;  2MUY A;  2RF4 A;  4IUU A;  2NN6 I;  5FOB B;  2F0T A;  1I6H B;  4A3J B;  2JA5 H;  2M9V A;  3CC4 A;  1BCP B;  3SGI A;  3KBG A;  4QL5 A;  4WJ4 A;  2CCZ A;  1I94 Q;  1D7Q A;  1GUW A;  1L0X B; 
#chains in the Genus database with same CATH homology
 5FLX E;  1NAP A;  1NR4 A;  3H3V C;  1EFI D;  4F7X A;  3A8K E;  3X3N A;  5C4H A;  4CJ1 B;  3E6Z X;  1SNP A;  1NUC A;  1SSO A;  1V43 A;  2ZXR A;  1HQR D;  2PCF B;  4L8J A;  3J7A F;  3FRP B;  1Y1V B;  5ELC A;  4RAU C;  1LT4 D;  5G3L D;  4HED A;  1QE6 A;  3VA7 A;  4DAV A;  1WTR A;  2CW0 D;  3C46 A;  1BCP D;  2KQ3 A;  3D8G A;  1D6E C;  4L6T B;  3GTG B;  1G2S A;  4ZRZ A;  1QB5 D;  5TSS A;  5CBE E;  2PYK A;  3PUX A;  1HA6 A;  4IAL A;  4RHS A;  4LAA A;  1A2U A;  4V0B A;  3NTK A;  3MVV A;  1UAP A;  1H9S B;  1PTO B;  2NVT B;  4CKE A;  4NDX A;  4IQZ A;  3I3C A;  4O42 A;  3N6R A;  1V1P A;  2IL8 A;  1ESR A;  5KEE A;  1DZ1 A;  2BOS A;  1LV9 A;  4M1U B;  2PO4 A;  1KAA A;  2X69 A;  4FXK C;  3SK4 A;  1YNJ D;  4FYD A;  4CHT B;  1CTM A;  5A2Q L;  4JK1 C;  3GV3 A;  2EYP A;  1PTO D;  1F2L A;  1FNV A;  3S1M B;  4NMZ A;  1CA5 A;  5JEA G;  1PLF A;  1O80 A;  3ERO A;  3DWP A;  1PDQ A;  5M9O A;  2J0T D;  1R9T B;  3URY A;  1SEB D;  3H0G B;  3QJY A;  2CHB D;  2K05 A;  4ZUI A;  4TRD A;  5K5P A;  2F03 A;  2TMP A;  3J7Y W;  4MN3 A;  3P1H A;  3LNN A;  2A6E C;  2L4N A;  2B2T A;  4JBW A;  2PW5 A;  3S9W A;  4KI0 A;  2EY2 A;  2IW3 A;  1JOO A;  3HOW B;  2SEB D;  4B08 A;  3OWE B;  2JA6 B;  2PZU A;  3EA6 A;  5J1Z A;  1F77 A;  1ILP A;  5M5X B;  1RCV D;  3NUC A;  4NKL A;  3FKI B;  3TP8 A;  3SVM A;  2AQ3 B;  1UNS A;  1HFN A;  3FEW X;  1STG A;  4UDU C;  1G2T A;  2NYZ D;  5EBC A;  4ODG A;  3GTP B;  4KK7 A;  2E2D C;  2FMC A;  3C1F A;  3J81 L;  3BVG A;  2QDB A;  2ZXO A;  3K7A B;  3PUV A;  1W6K A;  3K5O A;  4HSV A;  5JEA H;  1H9J A;  1CQF A;  1II3 A;  1EU4 A;  1QOH A;  5I9P A;  4QUC A;  2RDF A;  1EYA A;  3KLR A;  1KDB A;  1KAB A;  2JEA I;  4DAY A;  2L1B A;  3CRL C;  3K57 A;  5IGC A;  1S5E D;  5IGB A;  5D14 A;  3EJI A;  1EEI D;  2FFK B;  3K5L A;  1SE4 A;  1VMP A;  5KND A;  4ZAI A;  4BWG B;  3TP6 A;  1SYF A;  1SJE D;  3PIO 3;  1HUM A;  3NBI A;  1E2V A;  4P2C B;  4DAP A;  3DUZ A;  3P7J A;  3ND8 A;  2JYO A;  4QUF A;  1BDO A;  3VR2 A;  2O5I C;  3KF8 A;  4K5X A;  3R8B A;  4EVO A;  4G7H C;  5NUC A;  4HR7 B;  3DWA A;  3ND9 A;  2NBF A;  4K2L A;  4A3G B;  2C9O A;  2JA5 B;  1O7Y A;  1PYW D;  2RVL A;  3A56 A;  3C3L A;  2XRQ D;  4H13 C;  1PRT C;  5EGT A;  1TY2 A;  1H9M A;  1GUS A;  1SJH D;  3L9A X;  3M4O B;  4FF2 A;  1QCB D;  2HCI A;  3MA2 B;  4KY6 A;  1AZQ A;  2HDL A;  1D1K A;  3EVQ A;  3VA5 A;  5IGG A;  3BYY B;  1ILQ A;  1GXD C;  4LJZ C;  1WTV A;  2XVS A;  5I4D A;  1LTI D;  2E76 C;  5LHY 1;  1RKN A;  1TWG B;  3V2T A;  5I6Y A;  3SEB A;  5EKL A;  1Q90 A;  2EY6 A;  1XX8 A;  4A3E B;  3CQZ B;  1QNU A;  3QOJ A;  1EQV A;  1C4Q A;  5M5W B;  5C3E B;  2K5Q A;  1SYG A;  3ITP A;  2WIN B;  4NP5 A;  4XQQ A;  5JOB A;  3VYS A;  2L9H A;  1FNW A;  1YNN C;  2OEO A;  2F0K A;  2DNC A;  3OPO A;  3NPP A;  3R2I A;  5C0X I;  2K28 A;  2K04 A;  2KJX A;  4HMJ A;  2NUC A;  2IX1 A;  1JOR A;  4G7Z C;  1HHV A;  3PUY A;  1EZ8 A;  4CKC A;  3NP8 A;  1XYI A;  1WTP A;  1PTO H;  4RHR A;  5KIX A;  3TP7 A;  3I4M B;  5DM6 3;  1BUV T;  4ZQ3 A;  4C1N K;  3I8Z A;  2BA1 A;  3DMU A;  1S5B D;  4IUN A;  2PZW A;  3A7L A;  3S1Q B;  4EQO A;  1EIH A;  2FMM A;  5C3X A;  2J4X A;  1OO9 B;  1EY0 A;  1SMY C;  2EDG A;  2B2W C;  1Y1W B;  1TU2 B;  1VDZ A;  3OHX C;  3BVZ A;  1QG7 A;  4XYO A;  3A55 A;  1LTG D;  2LKV A;  2Q8R E;  3M85 A;  2OF1 A;  3U9S A;  1D5M C;  2L11 A;  3Q0A A;  3W3A A;  3VR3 A;  2WII B;  2XNA C;  3BZD B;  2A69 D;  1PFN A;  1VF5 C;  2F0W A;  5KYL A;  5LL6 X;  1SAP A;  4ILW A;  1V1P B;  4IFD J;  1A2T A;  4F88 A;  3K5N A;  1PZI D;  2B2U C;  2WV6 D;  2WAC A;  1HFG A;  3SHL A;  1ESF A;  2XN9 C;  2R92 B;  3DWQ A;  5IOD A;  3R3O A;  1JQY D;  2EYH A;  4WRD A;  2JA8 B;  3LWE A;  2KED A;  5EQ0 A;  1JCK B;  1ZEQ X;  3QOL A;  5C44 B;  5FKA C;  2Y0S B;  2Q8T A;  4F87 A;  2ID0 A;  5C5L A;  3J81 E;  2NVY B;  2LY7 A;  2VNU D;  2QEJ C;  3VR6 A;  2FHT A;  1M4V A;  2DNE A;  1K83 B;  3FMC A;  2Z8L A;  2JXM B;  1BR9 A;  2LS0 1;  3NWS A;  1Q3L A;  3UI2 A;  3ONA B;  4KD3 A;  3TZU A;  2VB3 X;  1MI2 A;  3OMG A;  2A6H C;  1B1Z A;  3RLF A;  1STY A;  2BDN A;  2EVB A;  1WD1 A;  3VYT A;  2EE1 A;  3HRZ C;  2AQ2 B;  3W2D A;  4C3I G;  5CV9 A;  3O13 A;  4RA8 A;  5DNF A;  1CT1 D;  5JVH 3;  1A3T A;  5JAV A;  3MXU A;  5FO9 B;  1ML0 D;  1DOK A;  4PMC A;  2AUJ D;  2KUM A;  3T13 A;  5FO8 B;  2E2J B;  4K8J A;  3QG1 A;  4C1N I;  2VXW A;  2EPB A;  2MHV A;  2SNM A;  4G7O C;  1LLR D;  3E5S A;  1XTC D;  4BA1 I;  1SFO B;  5M5Y B;  4K5W A;  1JWS D;  3H94 A;  3HG9 A;  1F2Y A;  4BBR B;  5IOC A;  1LT6 D;  1V8Q A;  4ABN A;  4XDX A;  3VR5 A;  1IL8 A;  4MHE A;  4HCE A;  5E4X A;  4K2K A;  4S3S A;  2RKS A;  2Z4H A;  4KHV A;  1I4X A;  5KYI A;  1U4R A;  1OXU A;  1SYC A;  1ROD A;  5F2D A;  4FF3 A;  3GTK B;  2AUK A;  4A3K B;  4J1M A;  1EL0 A;  1BNZ A;  1BCP F;  3KUP A;  5ELB A;  1HUN A;  1UEA B;  2MGS A;  5I6W A;  4DU9 A;  3K59 A;  3HP3 A;  5CBA E;  4BY1 B;  4CJ2 C;  3S2H B;  2KA7 A;  3X3M A;  1B9M A;  3TN2 A;  1HPC A;  3TZD A;  1C8C A;  3WDN A;  3MFY A;  5CV7 A;  3G7L A;  2SNS A;  1JWU D;  2I07 B;  1HRJ A;  1QJO A;  3CRK C;  2D5D A;  1D1I A;  5JPN C;  2B2Y C;  4OIK A;  1D5X C;  4A3F B;  1LT3 D;  1A6X A;  1TWC B;  2F0G A;  3GO5 A;  4FO2 A;  3S14 B;  3SXH A;  4QCL A;  1KTK A;  1AW7 A;  4ZYS A;  1E0B A;  3VYR A;  3G6J B;  2A68 C;  4DF7 A;  3I4N B;  1GUN A;  2Z4I A;  2EJG C;  2VUM B;  1PTO F;  4HAE A;  2F0L A;  1JOK A;  4X3T A;  3SK5 A;  3MZ5 A;  5BN3 A;  3P20 A;  2A6E D;  2K6A A;  1ICW A;  1QWY A;  3A7A B;  1Y8N B;  4LMQ D;  4Z9C B;  2WAQ B;  1A3U A;  2X6L A;  2F0P A;  2KHS A;  1GHJ A;  4H44 C;  2JP1 A;  3D4W A;  3V05 A;  3BDO A;  1FR3 A;  4ZK9 B;  1AEX A;  3Q22 A;  2JEB I;  2EYF A;  2E74 C;  2RQX A;  4C56 C;  1JR0 D;  2AQ1 B;  2AWO A;  1STN A;  1I50 B;  3IFD A;  4ID6 A;  1ENC A;  1WCM B;  2B2V C;  2RDG A;  1ET6 A;  1F2M A;  1RF2 D;  4IFD G;  4FNF A;  2KCN A;  3R93 A;  2ICI A;  4WJW A;  4A3B B;  3I90 A;  5JJZ A;  3MXN A;  2K1B A;  2G9D A;  3M7G A;  1PRT B;  4EGV A;  1IW7 C;  3WOE A;  1TR5 A;  2EYJ A;  1CFM A;  4DXG A;  4IZ8 A;  5CMD A;  3AB9 A;  4DFA A;  1SND A;  3MAQ A;  3P75 A;  2IT1 A;  3RZO B;  4RWS C;  3J80 L;  5KRU A;  4K6D A;  5M3F B;  3GV6 A;  1BBX C;  1QIL A;  2BE5 C;  1ET9 A;  1JB3 A;  3M3Y B;  1GUG A;  3S17 B;  1OXV A;  4C3J B;  1I4Q A;  4KN7 C;  2NB0 A;  5C5M A;  3BVM A;  1WTQ A;  1Y8O B;  3NQT A;  1B4O A;  1HXY D;  5ELF A;  3NXW A;  2BCO A;  2NN6 G;  1PRT D;  1LTS D;  4PMB A;  5COY A;  5D3D A;  5J22 A;  5C4Z A;  1M8A A;  3GTJ B;  4KY7 A;  1B44 D;  4IFD H;  2E2H B;  1GUT A;  1XWE A;  4DN4 M;  4QIW B;  2F0D A;  2F1M A;  5EPK A;  5C0X J;  1Q1E A;  1IYU A;  1SNO A;  3SDZ A;  5CC4 A;  4FVM A;  1EY6 A;  4TQU S;  3CHB D;  4XYQ A;  1C48 A;  4FF1 A;  2ZXP A;  2F4I A;  4HMI A;  4DGZ A;  4K6L A;  1IYV A;  1E2Z A;  4V19 0;  3L3O C;  4G57 A;  1Q12 A;  3EFX D;  5BN5 A;  2ENB A;  1TS4 A;  1KDC A;  3S2D B;  4E6I A;  4BA2 I;  1YNN D;  4KD4 A;  4K14 A;  3IAY A;  2VB2 X;  3H09 A;  2R7Z B;  1FGB D;  1VF7 A;  5EKI A;  4N9T A;  5C4J B;  4A3D B;  3NTH A;  4DNR B;  1SYB A;  4CGY B;  4TKO B;  3K58 A;  2NN6 H;  4K8I A;  2BA0 A;  4RGO S;  1B50 A;  2L0C A;  5ISR A;  2F0I A;  3TP5 A;  4J8Q A;  1EU3 A;  4I65 A;  3AU7 A;  5I2X A;  2K7V A;  3T53 B;  4PQX A;  5CR3 A;  4WFN 3;  1STB A;  1B2T A;  1STA A;  5CV4 A;  2B8F A;  1O7L A;  1BQQ T;  1STE A;  3NE5 B;  2NVX B;  1SYE A;  3TBI B;  3PUZ A;  4N9P A;  1Z47 A;  4FP5 D;  2DY8 A;  1Y8P B;  1T5X D;  1Z7T A;  1TII D;  1SMY D;  3U9O A;  3RMH A;  3I4L A;  3H6M A;  4C3H B;  5ELE A;  2N55 A;  5CV5 A;  4XT3 B;  2WP8 J;  2JE6 I;  2H1E A;  5EKK A;  1STH A;  4HTH A;  4EQN A;  2R93 B;  2EY5 A;  1EY5 A;  1SE2 A;  4IUT A;  3IKJ A;  1DJR D;  1UUP A;  5DM7 3;  3DHQ A;  1ZYR C;  3E0J A;  1U4M A;  4HCS A;  3NK9 A;  2KOL A;  3SK8 A;  4QB4 A;  1AFP A;  1R4P B;  2HQE A;  3RZD B;  3KBX A;  2K5W A;  3J7A V;  4LK1 C;  2R61 A;  4NW2 A;  3Q24 A;  4L63 B;  3OW7 A;  2Q8I B;  3S16 B;  1U4P A;  1F9Q A;  4KKU A;  3NSW A;  3HKZ B;  1ONL A;  5JVG 3;  2F0U A;  2F0V A;  2R6G A;  3DXJ C;  3TME A;  3PIP 3;  4A3M B;  3M7N A;  1Q8I A;  4IUV A;  2N88 A;  5HGT A;  2LFN A;  2EY1 A;  2K03 A;  2F0N A;  3HEJ A;  2YU9 B;  4UAI A;  2AWN A;  3FPU B;  5IT9 L;  4ZLT F;  5C3W A;  2F0E A;  1D2B A;  4XQN A;  3BDL A;  3T16 A;  2E75 C;  2A6H D;  2NTS A;  4YIJ A;  3QWN A;  5EJW A;  4XTC S;  4A3I B;  1PFB A;  4F8M A;  1TWA B;  1G29 1;  4KTA A;  3I73 A;  3JAM L;  2PZT A;  1FD7 D;  1KNE A;  3J80 E;  4IUR A;  1PZK D;  2TSS A;  1AN8 A;  3MTS A;  2F0O A;  4OO1 I;  3M4Y A;  4BBS B;  3AMU A;  3TDQ A;  3MC0 B;  3A54 A;  3NBH A;  5JPM C;  2XWB B;  2ICE C;  3S15 B;  2CQA A;  3GD7 A;  1H9K A;  2B2W A;  1TS3 A;  2EYM A;  4ZKB B;  2H4O A;  1CI3 M;  2F0J A;  2M2L A;  2D2C C;  4KKS A;  3MWY W;  2F3W A;  2OT2 A;  1EIG A;  5D3I B;  2NWG A;  2B2T C;  4I7Z C;  5EBD A;  4RGT A;  1EY7 A;  1MD2 D;  3NQI A;  4KY5 A;  3OSO A;  3KLS X;  5EPJ A;  1BXT A;  1CK1 A;  2RA4 A;  3QO2 A;  3Q23 A;  3VYU A;  1G6Z A;  2I46 A;  1S5C D;  3NTI A;  2RDH A;  5DAU A;  3GTM B;  1SNC A;  3IFT A;  3MEH A;  2B39 A;  1R4Q B;  4IN3 A;  4C3H G;  1S4Z A;  2B2U A;  2IX0 A;  2QF7 A;  2WKC A;  3DEO A;  5G3L F;  2PNR C;  2IJ0 A;  1GHK A;  2C5C A;  3HS0 C;  1S5F D;  2YYZ A;  5C0X G;  1EEF D;  3MFG A;  2JSO A;  1PFM A;  1ENA A;  5CV8 A;  1A15 A;  3FVQ A;  2EYL A;  3ERQ A;  3GTQ B;  1H9R A;  5CV6 A;  4OGQ C;  2CW0 C;  4MIU A;  2OXP A;  1BCP C;  1WVL A;  2QCP X;  4DA2 A;  4U68 A;  5BN4 A;  3GP7 A;  3D4R A;  2K33 A;  1PMR A;  2PW7 A;  3S1R B;  3D3R A;  5A35 A;  4RGM A;  4ME5 A;  1ZXT A;  2IPK D;  3HOY B;  1NSN S;  1CHQ D;  2EYO A;  1EOT A;  1LAC A;  4B9W A;  4PNY A;  2EJF C;  2XWJ B;  1A3V A;  3OMC A;  4ZUJ A;  2PQE A;  2J7Z A;  1X32 A;  2A68 D;  4DK1 A;  2XIW A;  3K5M A;  1B3A A;  2L12 A;  3BG3 A;  1F2Z A;  1I3Q B;  3L7Z C;  4KV6 A;  5AFW A;  3S1N B;  5C0X H;  1YNJ C;  2D62 A;  2MJ8 A;  4CKB A;  5IGF A;  3LWU A;  1I4H A;  2PPB C;  3KK7 A;  1FYC A;  1RD9 D;  1VMC A;  4H0L C;  4FXD A;  2K5D A;  1OXS C;  4RFB A;  2ZT9 C;  3OOC A;  1RHP A;  4EQP A;  1PTO C;  4TSS A;  4WOR A;  4Y7N B;  4CBV A;  2B8G A;  1SYD A;  5J39 A;  2KEE A;  1AP0 A;  1G91 A;  4X3U A;  5K36 G;  2RBM A;  3HOX B;  1LO5 D;  1T5E A;  3I70 A;  2EXZ A;  3PUW A;  3K0Y A;  1MGS A;  1J9O A;  5KGU A;  3HOU B;  4R9W A;  2RSN A;  4KMU C;  1KNA A;  5HUR A;  5CGK A;  2XRS D;  4O1N A;  2PMZ B;  2EZV A;  5KNC A;  1RTO A;  4DXF A;  3K6O A;  1X3Q A;  4RCO A;  1HTL D;  5IGD A;  1ENF A;  3I72 A;  1TWF B;  5IIF A;  1EY9 A;  4K5V A;  4RKB A;  1DD2 A;  5E3F A;  1QNK A;  4U67 3;  4OIJ A;  3NHH A;  2IX3 A;  1IKL A;  1DM0 B;  2LMC B;  3NWT A;  5IT9 E;  1EZ6 A;  1B9N A;  1CZW A;  4C2M B;  1FNU A;  5COR A;  4KJO A;  5D65 A;  3Q6S A;  1IW7 D;  4FXG C;  1HQM C;  3D31 A;  1BF4 A;  1WTX A;  1TKW B;  4GZY C;  1EY4 A;  2NZ1 D;  2NTT A;  3FDT A;  1TVX A;  4G4K A;  1MSH A;  1O7Z A;  3SK6 A;  1Q1B A;  1HCZ A;  5K36 H;  1KDA A;  1JC7 A;  1XXG A;  2BE5 D;  3JAM E;  2QKI C;  4J6H A;  2K32 A;  1CM9 A;  1GUO A;  4OO1 G;  1K8M A;  2MP1 A;  1CZG A;  3QIA A;  1EY8 A;  1LT5 D;  1OXX K;  1SNQ A;  2SOB A;  2B2Y A;  1G8Z D;  2BDO A;  4XIG S;  5IGE A;  1WTO A;  5T1G A;  2F0M A;  2F0Q A;  3TSS A;  4PMW A;  1CHP D;  2A74 C;  3A8J E;  3SR1 A;  1PRT F;  1DOM A;  1GJX A;  4FF4 A;  1CA6 A;  1TS5 A;  4RH6 A;  3F2U A;  2JA7 B;  4HN7 A;  2KCC A;  3T56 B;  1U4L A;  3H91 A;  1RJT A;  4XXE A;  2V4D A;  5FO7 B;  4CJ0 B;  3PO2 B;  2O5J C;  3LX0 A;  5FLX L;  3C2P A;  2X6G A;  1H9S A;  1AZP A;  3HGB A;  1IHZ A;  1WTW A;  2KVM A;  1ZKO A;  1U9R A;  3FPP A;  2DN8 A;  4XQJ A;  1S5D D;  4A93 B;  1DOL A;  2A73 B;  4OO1 H;  3PO3 B;  1CQV A;  3CU7 A;  2E2I B;  1LTT D;  5T1I A;  3IL8 A;  5FK9 C;  1NR2 A;  4DNT B;  2F0F A;  4C3I B;  2SDF A;  4KHZ A;  1F9R A;  1SDF A;  1JOQ A;  2L5T A;  2MPM A;  1SBB B;  1LTR D;  1OXT A;  3OIP A;  1DCZ A;  3D4D A;  4XT1 B;  3R2T A;  4ULL A;  1HTP A;  4DK0 A;  2B2V A;  1DON A;  4IUQ A;  2EOT A;  1DYQ A;  3BS1 A;  5EPL A;  2HDM A;  5E1F A;  2HCC A;  1SNM A;  1HA5 A;  3MXP A;  1PZJ D;  2KEC A;  1TWH B;  1SE3 A;  2O2L D;  3OWF A;  4RCN A;  4OHJ A;  1I4P A;  2FIN B;  1RTN A;  5JEA J;  1Z6H A;  1LTB D;  3MXG A;  3T4A C;  2FJ2 A;  2O4X A;  5M3M B;  1MSG A;  3C1E A;  1JE4 A;  1KLG D;  1WD0 A;  3GTO B;  4OL7 A;  2L55 A;  3V96 A;  1EQT A;  1W6J A;  2HUG A;  1TY0 A;  2F0S A;  2WB1 B;  1D5Z C;  3KLS A;  4AYB B;  4H7B A;  5CYU A;  1B53 A;  1JIC A;  5A2Q E;  4KN4 C;  5ELD A;  3D6C A;  1ZYR D;  3I91 A;  3WOF A;  5C4X B;  1JWM D;  1X3P A;  3BDC A;  1BOS A;  2Z1C A;  4PV1 C;  1BO0 A;  4R8I A;  2QIL A;  3A8I E;  2IWH A;  3CKI B;  2A69 C;  2CVR A;  5I9O A;  1J8I A;  1EYC A;  3BYT B;  2WKD A;  2F0H A;  4RKL A;  2M00 A;  2GA4 B;  5C6A A;  4C3J G;  1NCV A;  1GOZ A;  1EYD A;  2XSC A;  4X3S A;  1RDP D;  3PV0 A;  3N52 A;  4X3K A;  1F9S A;  3MHB A;  2NVQ B;  4HSP A;  1DXM A;  3PMF A;  2G9H D;  5E4W C;  4M8A A;  1F9P A;  3GQB A;  1TS2 A;  3HZX A;  4QF4 A;  3ZYY X;  4B9X A;  3D6W A;  1EWH A;  1MBY A;  5I2Y A;  5LL6 S;  1TT2 A;  4R8N A;  4IFD I;  2K01 A;  2R3Z A;  3OIQ A;  1I4R A;  1I6V C;  2EJM A;  2D9U A;  4KKT A;  3GTL B;  1V1O A;  1SXT A;  3DM1 A;  4QMG A;  3RD4 A;  5DEH A;  3DEP A;  1O78 A;  2F3V A;  2A5H A;  1PXU A;  4Q0F A;  2RSO A;  1Y69 U;  3HOZ B;  1L0Y B;  3T51 B;  1LAB A;  3EQL C;  3SE0 A;  4BY7 B;  4Q5V A;  3HOV B;  1KLU D;  1VCI A;  4RGN A;  2DY7 A;  4ZKC B;  4KJN A;  1I4G A;  4BS9 A;  1IKM A;  3QB3 A;  1K8O A;  1E2W A;  1TQO A;  4IUP A;  3VR4 A;  5KNB A;  1EWC A;  3RUZ A;  2B63 B;  1LTA D;  2MUY A;  4IUU A;  5FOB B;  2NN6 I;  1I6H B;  2F0T A;  4A3J B;  2M9V A;  1BCP B;  3KBG A;  1GUW A;  1L0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...