3S1RH

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 24
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1rH00
1XNRQ 2K14A 2WAQG 1GO3E 1YBYA 3AEVA 1VQAA 3CCJA 4BXXG 3S17H 3DM3A 1HNXL 5M3FG 4DV0Q 4A3KH 5IYDH 1UE7A 4IOCA 1VQ5A 1XMOL 5GAGC 4DV4Q 1N34Q 3S14H 3ULPA 4JBWA 4JV5Q 2JA7H 1GVPA 5M5YH 3KJOA 4DUZQ 3I4OA 3ER0A 1K83H 4HJ7A 2UXBQ 3K81C 4XIGS 1TWFH 5IP9G 3DLLA 2VQFL 1HR0W 2EXDA 4JCVE 3U58A 3B6YA 1Q7YC 2JA6H 1J6QA 1EFWA 2H5XA 1X3EA 4FDBA 2UU9Q 1N33L 4JI1Q 4DR3L 4KLKA 2JA8H 2HQLA 4YY3L 4DV1Q 4IJHA 1KC8C 5FJ8G 3Q8DA 1JJCB 5GAHC 2VQEL 2NN6G 1YJNA 2UUBQ 4YWLA 1ASYA 3CC7A 1QUQA 2NVYH 1I5FA 2Q2IA 5GADC 3S24A 2I5HA 1EUJA 3HOZG 2EQSA 3KJPA 1V9PA 1GD7A 1KAWA 2Z0SA 4NB3A 3W1GA 4JI6L 1C0AA 2VNUD 4ME3A 2XTIA 2NZHA 4QY7A 1E3PA 2GVAA 1B70B 3CPFA 4B3SQ 4QL5A 3K7UC 4YCUA 1KRTA 3S2DH 1PH2A 3J81c 4JI7L 4WJ4A 4IPHA 3PO2H 3BU2A 3J7A5 4IFDI 2CQOA 4YCWA 4L5TA 3BZKA 2OQKA 1TWCH 3NBHB 3AYHB 4GLAC 3WWVA 3HOXH 3ULLA 4MZ9A 3CMAA 4GN5A 1IBLL 4BA2I 4GKKQ 2HHHQ 5C0XJ 1PH4A 4OXPA 1OXVA 5GAEC 4BY7H 3K7AH 1Y1WG 1EQQA 3ULJA 1XNQQ 4X62L 3T1YQ 3K0XA 4A3DH 4B3RQ 4AH6A 1B7YB 2UUCQ 3PUZA 1N9WA 3I4NH 1YNXA 1G291 4XTCS 2YV5A 4YWMA 5FLXc 2UXCL 4GOPB 4PG3A 1YHAA 1HNXQ 2PQAA 4LFBL 3FHWA 3I4MH 2N49A 1XMOQ 2K4KA 5DLQE 1P16A 5GROA 1XMQL 4A3IG 2GN5A 2K75A 5JEAJ 4DKAC 4OX9L 1I6HH 1BVSA 4UY8C 2JA9A 3D31A 1JMCA 4J15A 4LF5L 2VQFQ 2ASBA 4ALPA 4A3LG 2JEAI 5IWAL 4AIMA 2UXBL 1BBWA 5LMUL 2AWOA 2GVBA 3KF8B 4JC0A 3G71A 1Q46A 2V1CC 4LF8L 1N33Q 1S40A 3GTOH 4DR3Q 4A93H 1RIPA 4YY3Q 1WCMH 1UE1A 4HJ5A 3CXCA 4MNOA 3F8TA 2NVQH 2VQEQ 1Q1BA 1TWAH 4B3TL 4DR6L 3K80C 1U5KA 2VW9A 1I3QH 1OTCA 1VQKA 1CKNB 2JEBI 2JK8A 1E22A 4RMFA 4A3JG 2N78A 4Y52H 1AE3A 1K0RA 4C3JH 5JJKA 3PGZA 4LFAL 4EQ5A 3UE0A 4A3CG 4BBRG 3RN5A 4JI6Q 4DV3L 2D0PA 3TRZA 3T1HL 1V1QA 5LMNQ 3A0JA 2ZJRA 3HKZG 2ZM6L 1XPOA 1I50H 3RR5A 2OTLA 2NVTH 1Q82C 3HOUG 2E5LL 4LF9L 3E0EA 4HIOA 1CSPA 3HOWH 5ELOA 2BA0A 2CKZB 2K5HA 2DGYA 2E2IH 1PHJA 1UEBA 4GNXA 5M3FH 4JBKA 1JT8A 2MFIA 3PUXA 2KBNA 3EBEA 1Z9FA 2NN6I 4JI4L 3J81j 4DR1L 1HNZL 4JI0L 3F2DA 2R93G 2E8GA 4PZ6A 1G51A 1A62A 3FP9A 4WJ3M 1GM5A 1C7YA 2MO0A 1HR0L 2QGQA 1YZ6A 4LUZA 3TREA 4X62Q 5FLMG 5ELNA 2R7ZH 3VDYA 1LTLA 3CCVA 4HJAA 3G4SA 4IJLA 1LM0A 2I0QA 2HIVA 4DV5L 3E9IA 3I7FA 4LNQA 2F52A 2DUDA 1IXRA 3TQYA 2UXCQ 4JG2A 1E7ZA 2I5LX 4LFBQ 1X54A 3GO5A 3RZOH 1B8AA 3PO3G 1XMQQ 1YHBA 4UPAA 5IYBG 1XJVA 4OX9Q 2IX0A 2N3SA 1JE5A 3D0FA 3FKIH 1EIYB 2UXDL 2LXJA 2VUMH 4LF5Q 3S1RH 5C4XH 3GTPH 5IWAQ 2HIXA 4AQYL 4O2DA 5LMUQ 2RHSB 1SFOH 2JJQA 2F3IA 3H0GH 4LF8Q 1K73C 1PH6A 1BBUA 1TWHH 2AWNA 1YITA 4X65Q 4NXNL 1QVCA 4JOIA 1PH9A 3CP0A 4DR6Q 1SMXA 3M9BA 1SN8A 3PV0A 4BY1G 4B3TQ 1NTGA 2B63G 1E24A 4A3GH 5JJLA 1FL0A 1YVCA 1L0WA 3UE1A 4GOPA 2PMZE 4JYAQ 3PUYA 4LFAQ 5IT9c 3TS0A 3M3YH 3MXNB 1PVOA 1OXSC 3CCUA 4DV3Q 5K36G 3T1HQ 4OONA 3J80i 1CUKA 1L1OA 1S3OA 5C44H 2YTVA 2ZM6Q 4LF4L 1Y1VH 4A3FG 3OTOL 1J5EL 3HOYG 3CAMA 2E5LQ 2IHEA 1PH5A 5LMNL 1LYLA 1HZCA 3KDFB 4LF9Q 3S1MH 4A3BH 1BKBA 3CQZH 3KF6B 1OXTA 1K8AC 2R6GA 1VQLA 4OWXB 2ES2A 3PUVA 4JBJA 2R7DA 1KQSA 1YJWA 4JI4Q 2IHFA 3L7ZC 3STBC 4DR1Q 2C35B 1XPRA 1HNZQ 1SROA 1YJ9A 4JI0Q 2A1AA 2Y0SE 1HR0Q 4GKJL 5IYDG 4A3KG 2F4VL 1JJ2A 2CCZA 4BBSH 1FGUA 4LUVA 4UP7A 1SLJA 3PSIA 3CCLA 4IOAA 1EQRA 1VQFA 1VQGA 3H15A 4A76A 3PF5A 1PFSA 1X3FA 4POGA 2JA7G 5IY0A 4DV5Q 1HZAA 1VQCA 4LW1A 4PZ7A 3PCOB 1VQOA 1KXLA 1Q1EA 5C3EH 1S72A 3H3VH 4L5QA 1D7QA 2ZTEA 2MO1A 2JA6G 4DR4L 1JB7A 2YTYA 3KFUA 3A74A 1CSQA 2R92G 2IY5B 4HJ8A 2Z6KA 1Q81C 4DK3C 5M5XH 3CC2A 2JA8G 3RLNA 3RLOA 1VQ7A 1VQ4A 3TS2A 3CCMA 5C0XG 1KHIA 4L5RC 2UXDQ 2JE6I 2PNHA 1R9TH 3CD6A 1IYJB 4DV7Q 4AQYQ 3CCEA 1PH7A 2Q2TA 5IE8A 5J3BA 1N8RC 1LUZA 1XTDA 2EIFA 4GLVB 4NXNQ 4IPDA 3M85A 3W1BA 3K8AA 4R4IA 4DUYL 2IT1A 4DV6L 3S2HH 4R4TA 5IYCG 3JAMi 4LWCA 4DNIA 5IP7H 4X65L 1GKHA 1VCIA 4DV2L 1Q12A 1EYGA 1KRSA 2E2JH 2LXKA 2ZJQA 4AYBE 3UDXA 1FVIA 1DGSA 3S15H 4IFDJ 2ZTCA 5JEAG 2A8VA 2JA5H 2MNAA 1T9HA 3PIPA 3PO2G 1NE3A 1HNWL 2K5NA 1IBKL 4JYAL 4P73A 3I2ZA 3HOXG 1VQ6A 4TVAB 4LF4Q 1J5EQ 1PYBA 1VS0A 4DAMA 5H1SE 3OTOQ 1A63A 2E2HH 4AYBG 3HOVH 3EN2A 3CC4A 4BY7G 1A8VA 4A3DG 3OYYA 3U4VA 1PH1A 4YCVA 5M3MH 4A3MH 4L5SA 1XPUA 1VQIA 1V43A 4BXXH 3I55A 2YU9H 1QZHA 1NY4A 4X6AH 1M1KC 2YTXA 1PYSB 3I4NG 4JI2L 1I94L 3PUWA 3S16H 1NBWA 4GKJQ 2RF4A 4JI3L 2MQHA 2F4VQ 3I4MG 1NMGA 3JC66 3U50C 1EWIA 4RG1A 5IP9H 3BZCA 1KD1C 2UUAL 4P75A 4GNXC 4HIKA 3KDFA 4QJFA 1PA6A 1IL2A 2NZOA 4GN4B 4DR4Q 1WYDA 1WFQA 5FJ8H 4PMWA 3KF6A 2PQAB 1QVGA 1X65A 3NEMA 2JQOA 4A93G 3AFQA 1X55A 2K5VA 3PIOA 1WCMG 3ZJYC 1VQNA 1AH9A 2VS1A 3U4ZA 4OO1G 4UP8A 2K50A 3HOZH 2CFMA 2WP8J 1VQEA 3KOJA 3NELA 3HFZB 1Q86C 2IX1A 4YHHL 1X3GA 3GTGH 2FXQA 4DV7L 4LF7L 2WAQE 3ERSX 4DK6C 3RZDH 5BR8L 3S1QH 4R4QA 4DUYQ 3AQQA 1OXUA 4APVA 4DV6Q 4GLXA 1SE8A 3G48A 4DR7L 2D62A 4X64Q 4GN3B 4KHZA 4C3HH 4K0KL 3RN2A 4JI8L 1WJJA 4DV2Q 1X9NA 3HOWG 1PH8A 1L2FA 4H02A 4Y7NH 3A5ZB 2I5MX 4KI0A 4A75A 2ZTDA 1HNWQ 4P71A 1IBKQ 5C0XI 1PV4A 2RHQB 1Y1WH 3J80c 1Z47A 2D0OA 2KHJA 4R4CA 4X66Q 3F1ZA 5GQOA 1VQ9A 4JOIC 4LF6L 4EX5A 1JJGA 2BA1A 4A4IA 1VQJA 1MKHA 3SGIA 1VQBA 5JJIA 1SR3A 1VQMA 2LSSA 2R7ZG 2ALYB 4GOPC 4DAYB 2OQ0A 4P74A 3KLWA 4HIDA 1ASZA 4C2MH 4GNXB 3GDEA 4B3ML 4JI2Q 1I94Q 2B3GA 1E1OA 1TXYA 4NXML 1K8GA 1L1OC 4A3IH 4GS3A 4A3EG 4JI3Q 3GTQH 2OCEA 2WB1E 1IZ6A 3UDGA 3UDIA 1NJIC 3GD7A 1A0IA 1CKNA 1EOVA 5EAYA 4KHPL 1WOCA 4A3LH 1OXXK 1N32Q 3FKIG 5AJ3L 2UUAQ 4YWKA 1PH3A 1Q8KA 1KIXA 2VUMG 2WB1G 5C4XG 2Y0SG 3M4OH 5IYCH 2QA4A 4DR2L 2YYZA 3IRBA 3ICEA 3RLFA 2B29A 1W3SA 4POFA 2AMCB 3H0GG 4JI5L 2BH2A 2QEXA 3H3VI 3J81i 3UDFA 2R92H 2R7FA 4LFCL 4A3JH 2ATWA 4TQUS 4BA1I 1QVFA 4A3GG 4DR5L 4A3CH 4BBRH 2PI2A 1W2BA 1HZ9A 4YHHQ 1FJGL 2K52A 4LF7Q 1KL9A 3HOUH 1YEZA 1K3RA 4O0AA 5BR8Q 3G6EA 1VQPA 5C44G 4PZ8A 1N36L 1AE2A 1C9OA 3L0OA 1Y1VG 4DR7Q 2Z6KC 4OWTB 4K0KQ 2HT1A 4JI8Q 3JAMc 3S1NH 1YIJA 1RL2A 5LMNW 4X64L 4QIWE 4DPGA 4A3BG 3GTLH 1NMFA 3BJUA 3NENA 3M4PA 4NPSA 1IBML 4JBMA 2R93H 3F2CA 1XNRL 1QUQB 4OO1I 3A5UA 4DV0L 1O7IA 1L1OB 2PI2E 4LF6Q 3TEHB 5FLMH 4IO9A 4DV4L 1N34L 1TWGH 4X66L 4MTNA 4JV5L 4BBSG 4DUZL 3MEFA 3W5OA 2ID0A 4OWWB 1HJPA 4IPCA 3PF4A 3LGJA 2CWPA 2BH8A 2VY3A 3GTKH 3L2PA 4B3MQ 3CMEA 1CKMA 3I56A 5M5WH 4NXMQ 2ZJPA 1MJCA 3PO3H 5HY6A 4R4OA 5C3EG 5IYBH 2UU9L 4JI1L 4QGUA 3CCSA 2VZAA 4IFDG 4IPGA 3HKZE 5E7NA 1MIUA 4DV1L 1E1TA 3M7NA 1D8LA 2Q2UA 1MJEA 3CF5A 2UUBL 4KHPQ 3AFPA 2OWOA 2CWAA 1CKOA 1K9MC 5AJ3Q 2AHOB 3CPWA 3CCQA 3STBD 4HJ9A 2KHIA 3RNUA 1N32L 3GTMH 4DR2Q 2AKWB 3CCRA 3CW2C 2N8NA 1UWVA 2VL6A 1HZBA 1EIFA 5C4JH 3F2BA 4JI5Q 4BY1H 1H95A 2B63H 3GTJH 4JI7Q 1Y14B 4B3SL 1M90C 1VQ8A 4LFCQ 3HKSA 4P72A 1VQDA 1WI5A 2KCMA 5IP7G 1UE6A 1UE5A 3J7ZC 4DR5Q 4R1JA 1VQHA 1IBLQ 3KYHC 1FJGQ 3E9HA 2RCNA 3M4QA 4A3FH 2JA5G 1X56A 1P8LA 2XGTA 3HOYH 2A19A 4GKKL 3OW2A 2HHHL 1YHQA 1N36Q 3EIVA 2L15A 2KCTA 1HH2P 4UP9A 1XNQL 3T1YL 4B3RL 4QQBX 1X6OA 1G6PA 5HGQA 2NVXH 2OTJA 3HOVG 2KENA 4C3IH 1U0LA 2UUCL 2WFWA 1SRUA 1YI2A 4HIMA 4LUOA 5M3MG 1QZGA 4A3MG 4A3EH 1IBMQ 2Q2HA
chains in the Genus database with same CATH superfamily
2E2DC 2WAQG 2RDFA 1VQAA 1PTOF 3TN2A 3CCJA 1UE7A 1PMRA 1SNOA 5GAGC 2JSOA 1WCMB 1ZXTA 5EQ0A 3KJOA 3TZUA 2WIIB 2EJMA 3K81C 4XIGS 2VQFL 3B6YA 1AN8A 1Q7YC 3DHQA 4U68A 4DNRB 1PZKD 4KLKA 2JA8H 4DV1Q 3MVVA 4PMCA 3HOVB 3Q8DA 5GAHC 4JW0A 1YJNA 1IYUA 3CC7A 1QUQA 4IURA 2RCFA 3HOWB 2J0TD 2E2IB 2EQSA 1E0BA 2VNUD 2Z0SA 1C0AA 2D5DA 5IGGA 1E3PA 3D6WA 4QL5A 3K7UC 4KY6A 2Z1CA 4S3SA 4YCUA 3J81c 3PO2H 3BU2A 3NUCA 4C3HG 4DNTB 4L5TA 2OQKA 1TWCH 3AYHB 1PZJD 5ELFA 3WWVA 4GKKQ 2KCCA 3C46A 3QOJA 2WACA 5C0XJ 1F2ZA 3H94A 1Y1WG 4X62L 4AH6A 3D4WA 1F2MA 3I4NH 2VUMB 4YWMA 2UXCL 1ICWA 4PG3A 4LFBL 2PQAA 5IGFA 3S1QB 2K4KA 1P16A 1Y8PB 4OX9L 2K75A 3I4LA 1SYBA 2AQ1B 5CR3A 4CDCC 3EROA 4A3GB 4B9WA 3EA6A 3M3YB 4A93H 4DR3Q 2O5JC 1WCMH 2RKSA 4B9XA 2IL8A 4MNOA 1TWAH 2VW9A 1VQKA 2R92G 5JVH3 4Y52H 4A3JG 1VMCA 1U4LA 5JJKA 3PGZA 1PRTF 3UE0A 4BBRG 5E1FA 3NWTA 5ISRA 4UHVA 4R8NA 5LMNQ 3HKZG 1JWMD 2ZM6L 4A3IB 4B08A 2OTLA 1U4PA 2GA4B 3MWYW 4HIOA 1CSPA 3HOWH 1LO5D 2BA0A 2F0DA 4DAYA 2DGYA 2E2IH 3I91A 2TSSA 5C3XA 2KBNA 3EBEA 2B2TA 4JI4L 4DAPA 2F4IA 1HTLD 5J39A 1G51A 3RMHA 2IX3A 4ZQ3A 4FF2A 2I07B 2ENBA 2RDHA 3VDYA 2KOLA 4HJAA 1LM0A 2HIVA 2XRQD 5BN3A 4LNQA 2DUDA 3TQYA 1I6VC 2F0OA 2HDMA 3MFYA 1X54A 3D6CA 4IZ8A 2MHVA 1WTRA 2B2UA 2IX0A 1KDBA 4ZLTF 3S9WA 1VF7A 2LXJA 2SNMA 4LF5Q 2VUMH 3GTLB 1H9SA 3KBXA 5LMUQ 2RHSB 2KVMA 3U9OA 3DWAA 3UI2A 2F3IA 3H0GH 2JA5B 1K73C 1D5XC 1DOKA 1QVCA 4NW2A 1F9QA 4DR6Q 1SMXA 2Q8RE 5T1GA 3I73A 1SDFA 2BOSA 1E24A 4WRDA 1BQQT 4A3GH 4IUVA 4J1MA 1FL0A 1L0WA 4M1UB 5FOBB 5IT9c 3M3YH 4YIJA 3HRZC 4DV3Q 2MPMA 5M5WB 3T1HQ 3D3RA 1B50A 3TP5A 3V96A 2E5LQ 3KDFB 3S1MH 1TVXA 3KF6B 1VQLA 2CW0D 2R7DA 1EU4A 3DWPA 4DR1Q 2C35B 1SROA 1YJ9A 4JI0Q 4K5XA 2RA4A 3H91A 1HR0Q 4GKJL 1S5ED 4LUVA 1SLJA 1EQRA 3OOCA 5EPJA 1K3BC 3HP3A 2L11A 2B2YA 1D5ZC 1VQCA 4PZ7A 4KKSA 1Q1EA 2A6HC 4IFDH 3BS1A 5ELBA 2PZTA 1JB7A 3W2DA 3GTGB 3A74A 5EBDA 1Q3LA 1H9JA 2AUKA 1PTOD 3PIO3 2JA8G 3RLNA 2LS01 3GQBA 3CCMA 3CD6A 1SYCA 4AQYQ 1BXTA 5D14A 1JR0D 4MN3A 1PH7A 2Q2TA 5CBEE 5HGTA 1XTCD 2PW7A 1ENCA 4IPDA 1YNJC 3Q23A 4DV6L 3IFDA 5FO8B 3WOFA 3JAMi 3NWSA 1GKHA 3K57A 1KRSA 2LXKA 1MSHA 1FVIA 2E75C 3PO2G 2B2VA 1MSGA 3HGBA 2JA5H 1HNWL 3PIPA 1NE3A 1GUNA 1B44D 3H6MA 1G6ZA 4TVAB 4PV1C 2EZVA 3OTOQ 1F9RA 1A63A 1GUSA 3EN2A 4IUUA 1A8VA 1NR4A 3V05A 4QF4A 2LKVA 1VQIA 1V43A 2FINB 3X3MA 2XSCA 5DM73 3I4NG 3GP7A 5C3WA 3S16H 2F0VA 4JI3L 3G7LA 3JC66 1WTWA 1DM0B 2AQ3B 3BZCA 3HEJA 1WD0A 1KD1C 1LABA 1R4PB 2UUAL 1WTXA 4HIKA 1KDCA 4PQXA 2B2TC 2NZOA 5IIFA 4DR4Q 1WYDA 1WFQA 5FJ8H 2PQAB 2NN6H 4EQOA 3NEMA 4A93G 3AFQA 4OELB 2K5VA 1WCMG 3ZJYC 1VQNA 3VA5A 2HD3A 2VS1A 4UP8A 1DYQA 1VQEA 2X69A 2IX1A 2O5IC 1R4QB 2QKIC 1X3GA 3GTGH 5I9PA 2FXQA 4X3SA 1WTPA 2WAQE 4ZUJA 4DUYQ 3AQQA 1OXUA 1SE8A 2B2UC 4RFBA 5KNDA 1WJJA 4DV2Q 3C1FA 1HFNA 3A8JE 3HOWG 2DNCA 3PMFA 2D2CC 2NBFA 4A75A 1JB3A 4HMJA 5K5PA 3SHLA 4CKBA 1QJOA 5M9OA 4R4CA 3VYRA 2K03A 1Q90A 1MKHA 5C6AA 1I3QB 1HCZA 4HMIA 3SK4A 2IPKD 4DAYB 4P74A 5JPNC 2Z4HA 5D65A 4B3ML 1TS5A 1E1OA 2QDLA 1K8GA 1X3PA 4GS3A 2RDGA 4HN7A 4A3EG 2MP1A 1NJIC 3UDIA 3FPUB 1A0IA 1CKNA 1EOVA 4FF4A 4KHPL 3J80L 4A3LH 1LT3D 5CC4A 4YWKA 1BCPF 1Q8KA 2VUMG 1C8CA 2QA4A 1FNVA 1U4MA 3ICEA 3RLFA 2AMCB 3H0GG 1EYCA 4JI5L 3HOYB 2C5CA 4C1NI 3QWNA 2R7FA 1KAAA 4LFCL 1O7ZA 1V1PB 4I7ZC 4TQUS 2KEEA 4BA1I 4A3GG 2B8FA 5IODA 2B2YC 1FJGL 4LF7Q 3FPPA 3MHBA 4O0AA 5BR8Q 4LJZC 1B1ZA 3S17B 3L0OA 4A3KB 2HT1A 4JI8Q 5I4DA 5LMNW 4QIWE 4F88A 2WINB 2Y0SB 3BYTB 3NP8A 1SE4A 4JBMA 1EQVA 1TWFB 3F2CA 3P1HA 4OO1I 3VR2A 3A5UA 5L37A 1TIID 3TEHB 3ZYYX 5FLMH 1U9RA 3VYTA 4RGOS 3W5OA 2EYHA 1YNND 3PF4A 2B2VC 2DN8A 3CMEA 4NXMQ 5IYBH 4QGUA 3O13A 2VZAA 4IFDG 1SAPA 4N9TA 3HKZE 5E7NA 4DV1L 3K5MA 1D8LA 2EY2A 2Q2UA 2BE5D 5FKAC 1ET6A 2F0QA 1K9MC 4EVOA 1ZKOA 5JVG3 3CCRA 2FHTA 1UWVA 4A3DB 3BZDB 3OWEB 3EQLC 4RGTA 1I4HA 2A6HD 4GKKL 3R2IA 2JA5G 4CBVA 3HOYH 2M00A 3A7AB 1PXUA 2KCTA 1G6PA 3I4MB 4CKCA 1LLRD 4K2LA 2KECA 2OTJA 1I6HB 2HDLA 1LACA 4KD4A 1B53A 2K14A 1GO3E 3AEVA 3SK5A 3S17H 5M3FG 4A3KH 1YNJD 5IYDH 4IOCA 2XRSD 3OHXC 4DV4Q 3ER0A 1STAA 1TWFH 1SYEA 1HR0W 1D1KA 4JCVE 2JA6H 2RSOA 1J6QA 4OIJA 4H0LC 4C3JB 3OMGA 1X3EA 4FDBA 2L1BA 3I72A 2FMCA 4DR3L 1KC8C 5FJ8G 1JJCB 2NN6G 2ICEC 2L4NA 5M3MB 2NVYH 1I5FA 2X6GA 1GUGA 2I5HA 3S24A 1GD7A 1KAWA 4NB3A 4TRDA 3W1GA 2XTIA 4KKUA 4HEDA 4B3SQ 4JI7L 2K05A 3J7AV 5JEAH 1Y8NB 1VF5C 4YCWA 3HOXH 3FDTA 4GLAC 3CMAA 4GN5A 1IBLL 4ZKBB 1M8AA 4MTKA 2IWHA 1OXVA 1PFMA 5GAEC 3K7AH 4A3DH 1TKWB 3RZOB 1LT5D 1J8IA 1B7YB 1DZ1A 2E74C 3HOZB 2AQ2B 1N9WA 5JJZA 5BN4A 2WKCA 4HSVA 5IGBA 4ZK9B 5C4XB 1JWUD 2A5HA 3J81L 4GOPB 1GXDC 1HNXQ 1YHAA 1BDOA 1CZWA 5LL6S 1SFOB 5ELCA 3I4MH 2N49A 5GROA 3V2TA 1G91A 3I70A 2WKDA 1I6HH 1BVSA 4N9PA 1JMCA 3E3XA 1K8MA 1O7LA 4LF5L 2ASBA 4ALPA 4A3LG 1RTOA 2JEAI 2UXBL 5LMUL 4JC0A 3DEPA 1HXYD 1Q46A 1S40A 4YY3Q 2XWJB 3E6ZX 3T16A 2EY6A 3F8TA 4DR6L 4H7BA 1WVLA 3K80C 1OTCA 1CKNB 4J6HA 3Q0AA 1IW7C 1K0RA 1W6JA 3CQZB 4C3JH 1O7YA 1SSOA 4DV3L 3T1HL 1V1QA 1I50H 4RKLA 2IW3A 1Q82C 2E5LL 5EJWA 2AUJD 2NUCA 1B9NA 1B3QA 2RQXA 2CKZB 2EJGC 1PHJA 1UEBA 4GNXA 1XYIA 3MXGA 4DR1L 4JI0L 3F2DA 5C3EB 2PPBC 3FP9A 1CA5A 3IFTA 1C7YA 4FP5D 1HR0L 4LUZA 2SNSA 3TREA 3WDNA 5FLMG 1B3AA 4E6IA 4R8IA 1LTLA 3CCVA 1PYWD 3CRKC 3OSOA 4HSPA 4IJLA 3T4AC 1IYVA 2I0QA 3I7FA 1R9TB 2F52A 4LAAA 4JG2A 1E7ZA 2I5LX 3HOUB 3GO5A 3RZOH 1JE4A 1XMQQ 5IYBG 1DJRD 1JE5A 4HCEA 3NBHA 4OGQC 2F03A 4RKBA 5C4XH 2Q8TA 3QOLA 5IWAQ 2EYPA 4O2DA 4AQYL 1SFOH 1WTQA 2JJQA 1STEA 1PH6A 4X65Q 4KN7C 2CH4A 5CBAE 5IGEA 3CP0A 3VYUA 4H44C 4HCSA 1NR2A 1UUPA 1KNAA 3IAYA 2PMZE 2EYOA 5EKIA 3TS0A 3MXNB 1EY7A 2LY7A 3J80i 5NUCA 5A35A 3QJYA 3OTOL 4RA8A 3HOYG 3CAMA 1XXGA 1EY0A 1SE2A 1HZCA 4QB4A 2JP1A 3KF8A 3CQZH 1K8AC 1PTOB 1CQVA 3PUVA 1S5FD 1HNZQ 1KDAA 2A1AA 5CV9A 1EU3A 2M9VA 1SBBB 2XIWA 5IT9L 5IYDG 4A3KG 3GTJB 2OXPA 3HS0C 3MZ5A 1ICFB 1VQGA 1I4QA 2ZXPA 2L12A 4DV5Q 1LV9A 1VQOA 1KXLA 5C3EH 1S72A 3H3VH 2MO1A 3BG3A 2JA6G 4DR4L 1O80A 1T5XD 4IUTA 1LT4D 1SNPA 2Z6KA 1Q81C 4DK3C 3HG9A 1VQ7A 1QNUA 2EYFA 1AZPA 2PNHA 1R9TH 1JICA 4FF1A 2FMMA 4K2KA 1H9RA 1N8RC 1AEXA 1XTDA 2EIFA 4ZRZA 4NXNQ 3EFXD 4DUYL 1RKNA 4LWCA 4DNIA 1A3VA 1VCIA 1PRTC 4DV2L 1Q12A 4NDXA 5FLXL 1SJHD 2ZJQA 4AYBE 5KEEA 4IFDJ 5JEAG 2A8VA 4XT1B 4JYAL 3URYA 3HOXG 3TDQA 4LF4Q 1J5EQ 1PYBA 1QNKA 3SE0A 2F0FA 1STGA 3HOVH 2HCIA 4A3DG 2RVLA 5CV4A 3OYYA 4IUQA 3U4VA 1A15A 1QE6A 4YCVA 1M4VA 1XPUA 4BXXH 1NY4A 1M1KC 5J1ZA 5KYIA 3PUWA 4OHJA 3TMEA 1MI2A 1NBWA 3M7GA 2RF4A 4LMQD 2EYJA 3T13A 1A3UA 3I4MG 1SYDA 3Q24A 2H1EA 3U50C 1PTOH 3PQIA 4X3UA 2F0NA 5IP9H 1FYCA 3I90A 3OWFA 4GNXC 3D4DA 1PA6A 5A2QL 2QILA 1RD9D 4PMWA 4BY7B 4QMGA 4TSSA 3PIOA 2QF7A 1NCVA 4CJ1B 1PRTB 2K50A 1MGSA 2CFMA 1HQMC 2WP8J 1BNZA 3KOJA 1ET9A 4C3JG 4DV7L 4LF7L 3DXJC 3ERSX 1JOKA 1PDQA 5BR8L 3S1QH 1FNWA 2HQEA 4CDDC 4GN3B 4IUPA 4JI8L 2K04A 3ND9A 3A5ZB 1F2YA 2I5MX 2PZUA 4K8JA 4KI0A 5KYLA 1S5DD 1IBKQ 2L9HA 1HA6A 5C0XI 4KTAA 4Q0FA 4QUCA 1YNNC 1B2TA 1Z47A 2D0OA 4X66Q 3PO3B 3A8KE 3F1ZA 1VQ9A 3FMCA 1VQBA 5JJIA 1IW7D 2BE5C 1SYGA 2ALYB 1VQMA 4KD3A 1CFMA 3KLWA 2EE1A 1ASZA 4GNXB 2F0PA 2B3GA 4N8FA 1TXYA 1T5EA 4NXML 4A3IH 4DN4M 1GHKA 2WB1E 1IZ6A 2K1BA 5C4JB 1MBYA 4QUFA 2B63B 1WOCA 1E2ZA 4H13C 2MGSA 3Q6SA 2JN4A 5C4XG 3SK6A 1I4RA 5IYCH 2YYZA 2K32A 4KKTA 2B29A 4C56C 2V4DA 2BH2A 2QEXA 1HTPA 2N55A 3J81i 1PFNA 3J7YW 1S4ZA 3U9SA 4HTHA 4A3CH 4C3IB 5HURA 1HZ9A 2K5WA 1EWHA 2ICIA 1I4GA 3VA7A 1YEZA 1AE2A 3L9AX 1C9OA 5IGDA 3R3OA 4DR7Q 2Z6KC 2ZT9C 4OWTB 5EKKA 3EVQA 3SDZA 4K0KQ 1O78A 5KRUA 1RL2A 1YIJA 3S14B 4X64L 2JA7B 4DPGA 2I46A 2KA7A 3GTLH 1K83B 3KBGA 1LTGD 2O4XA 1QUQB 1TWHB 3HZXA 4LF6Q 4IO9A 4DV4L 1E2WA 4MTNA 2F0SA 2ID0A 3MXUA 4G4KA 4OWWB 1HJPA 4IPCA 2VY3A 2BH8A 1TT2A 3CKIB 3ONAB 5M5WH 5DAUA 5C44B 5CYUA 3PO3H 4R4OA 5C3EG 1TS4A 4G7ZC 1RTNA 2Z9HA 3N6RA 2B2WC 2E76C 1JCKB 5C4HA 3OIPA 4FYDA 2AHOB 3QG1A 2MJ8A 5E4XA 2KHIA 3RNUA 1N32L 1KTKA 2XN9C 4ZUIA 2F0GA 2N8NA 2VL6A 4U673 5C4JH 3F2BA 1H95A 3A54A 2B63H 1Y14B 4B3SL 1M90C 1VQ8A 3HKSA 4P72A 3ERQA 1CA6A 2KEDA 3J7ZC 3T53B 2QEJC 3E9HA 2XGTA 2A19A 3K58A 4L6TB 4HR7B 1N36Q 3EIVA 1XWEA 2HCCA 5CV8A 4UP9A 2PYKA 1X6OA 1EWCA 2VB3X 3HOVG 4C3IH 1U0LA 4K6DA 3X3NA 4LUOA 1YI2A 1RHPA 4KY7A 2K6AA 1IBMQ 2Q2HA 1XNRQ 2BDOA 1YBYA 4BXXG 1NNXA 3DM3A 1HNXL 4DV0Q 1HPCA 4EQNA 1VQ5A 1H9MA 1N34Q 3S14H 3GV3A 1PRTD 2JA7H 1HRJA 1GVPA 3I4OA 2NVQB 1K83H 1DOMA 3NK9A 2F0JA 3KUPA 5IP9G 3DLLA 4TKOB 2EXDA 3U58A 1ILQA 4I7AA 1EFWA 2H5XA 4JI1Q 1B4OA 2HQLA 4YY3L 1AP0A 1BCPC 4YWLA 1ASYA 2F0LA 4A3MB 2M2LA 2WAQB 1EUJA 4C1NK 1ILPA 3KJPA 1AZQA 1V9PA 1CT1D 3BVGA 2NZHA 3P20A 1B70B 3CPFA 2Z6BA 3CHBD 1KRTA 1GOZA 5CORA 1PH2A 4WJ4A 3J7A5 4MIUA 4HAEA 3DM1A 1TY0A 2A69C 4BA2I 2G5DA 4MZ9A 1H9SB 1CHPD 3K0XA 3D4RA 5C5LA 3FKIB 1L0XB 1G291 1KABA 4RCOA 3JAME 2Z8LA 3RZDB 4K6LA 1XMOQ 5DLQE 1XMQL 4A3IG 2GN5A 1L0YB 5JEAJ 4DKAC 4KHVA 5JOBA 3KLSA 1BCPB 1IHZA 4UY8C 2LMCB 2VXWA 3D31A 4J15A 2TMPA 5EPKA 4Y7NB 1EY4A 5IWAL 1BBWA 3BDLA 2AWOA 3G71A 1RDPD 2EXZA 1Y1WB 1N33Q 3EJIA 3K0YA 1RIPA 1UE1A 4HJ5A 2A74C 2L0CA 1Y1VB 2B39A 2NVQH 2VQEQ 4OO1H 1D6EC 4JPBW 1Z7TA 1U5KA 3R2TA 1I3QH 2JK8A 2N78A 4XQNA 4BWGB 1UEAB 3TP7A 1UAPA 2K33A 4EQ5A 1STYA 2EPBA 4K8IA 4JI6Q 3TRZA 2D0PA 4A3CG 2ZJRA 4FF3A 2Q8IB 1H9KA 4CDEC 3NTKA 3LWUA 4CJ0B 4QIWB 2DNEA 3E0EA 2F0KA 4BBSB 1PZID 1CM9A 1SYFA 3I3CA 1JT8A 1KLUD 4RAUC 3PUXA 1IKMA 3OIQA 1HNZL 4PZ6A 1GM5A 1MD2D 1YZ6A 2QGQA 2R92B 4ILWA 5ELNA 3KK7A 1FNUA 1ENAA 1ZEQX 3G4SA 3AB9A 1CQFA 4DV5L 3E9IA 1BUVT 1AW7A 3HKZB 4K5VA 3H09A 1EY6A 1VDZA 3PO3G 4RWSC 1YHBA 4UPAA 5DM63 1XJVA 3LNNA 3FKIH 3S1NB 3T51B 2F0EA 3NSWA 2E2JB 3A7LA 5ELEA 4LF8Q 2ZXRA 5KGUA 1YITA 4NXNL 1PH9A 4B3TQ 4XDXA 1SN8A 2B63G 1AFPA 5JJLA 1YVCA 3UE1A 1MHWC 4KY5A 1CZGA 3PUYA 4LFAQ 4ULLA 1W6KA 1OXSC 3CCUA 4OONA 1CUKA 2YU9B 3A8IE 4LF4L 1Y1VH 1J5EL 1PH5A 5LMNL 4LF9Q 4UDUC 2PW5A 3BDOA 3E5SA 2R6GA 5KNCA 4C3IG 2ES2A 4JBJA 2F0IA 4RGMA 4RCNA 5IOCA 4ZYSA 2KHSA 4KV6A 3VYSA 4DU9A 5CGKA 4BBSH 4UP7A 3PSIA 1VQFA 2K01A 3PF5A 1PFSA 1X3FA 2JA7G 5I2XA 4DK1A 3K59A 1HZAA 3PCOB 4Q5VA 3DUZA 4L5QA 1D7QA 5AFWA 1CSQA 2OF1A 3CC2A 4OIKA 3RLOA 1VQ4A 5FLXE 1KHIA 2UXDQ 2JE6I 2RBMA 3C1EA 2NYZD 1HUNA 4IALA 5IE8A 5J3BA 2XNAC 3W1BA 3K8AA 2IT1A 4NKLA 1K8OA 2F0TA 2E2JH 2F0MA 4L8JA 1T9HA 2C9OA 1S5BD 2K5NA 1IBKL 5CMDA 4P73A 1F9PA 3I2ZA 1VS0A 2JA8B 4CHTB 5I2YA 2K5QA 3SR1A 2R61A 1BCPD 2PNRC 1B9MA 1OO9B 2F3WA 3NTHA 1PH1A 5M3MH 3CRLC 1FR3A 1EEFD 3I55A 2YU9H 3I8ZA 1SMYC 1QZHA 4X6AH 1PYSB 5FO9B 1DD2A 2MQHA 2F4VQ 1NMGA 4ZCKA 4P75A 3F2UA 2A69D 5C5MA 3KDFA 2EOTA 4QJFA 2HUGA 4P2CB 1G2TA 4GN4B 4O1NA 3DEOA 2Z4IA 1LTRD 4KJOA 5FK9C 3KF6A 2JQOA 2IJ0A 1AH9A 3P75A 1XX8A 4K14A 1WTOA 4OO1G 3HOZH 3W3AA 1PFBA 2X6LA 3DWQA 1STHA 2R93B 4DK6C 5JPMC 2A68C 3G48A 4DR7L 1QCBD 1QG7A 3TP6A 4CKEA 4K0KL 1LT6D 4N8X1 3RN2A 2EVBA 1X9NA 3OMCA 1PH8A 2XVSA 2ZTDA 2NWGA 1PV4A 2RHQB 2MUYA 4A93B 3LWEA 1SJED 4Z9CB 2KHJA 5GQOA 4LF6L 4EX5A 1TWAB 4A4IA 1VQJA 1FGBD 5FO7B 4NP5A 1SR3A 2LSSA 4CGYB 3GDEA 2EY1A 1ZYRD 4JI2Q 3NE5B 1I94Q 2NTTA 1RODA 2QCPX 4DXFA 3TSSA 3GTMB 1K0SA 4G7HC 2QW7A 5DNFA 4BY1B 5EAYA 2SDFA 1EY9A 1OXXK 3FKIG 1PH3A 1KIXA 2CVRA 2Y0SG 1I4PA 3FEWX 2FFKB 3ND8A 1W3SA 3AU7A 4POFA 4A3FB 1J9OA 4RHSA 3H3VI 2N88A 2PMZB 3NBIA 3UDFA 4ODGA 3SK8A 2ATWA 1SEBD 2NVXB 1D1IA 1LTBD 1QVFA 3OW7A 4J8QA 5C4ZA 4YHHQ 4NMZA 4A3EB 1KL9A 1SNDA 3HOUH 1K3RA 1VQPA 5TSSA 4PZ8A 1N36L 1PLFA 1Y1VG 4CDFC 5KIXA 1EYDA 3JAMc 4M8AA 1DCZA 3RUZA 5M5YB 1X3QA 4OEMB 3BJUA 3NENA 1IBML 2R93H 3TBIB 1XNRL 2L5TA 3H0GB 2DY8A 1BR9A 4DV0L 1DXMA 1WTHA 2PI2E 5EGTA 3QIAA 1N34L 2B2WA 4BBSG 1G2SA 2EYMA 4ME5A 3KLRA 3SVMA 3LGJA 2CWPA 3SXHA 2ZJPA 2RSNA 4JI1L 1QWYA 1RF2D 4IPGA 1MIUA 2OT2A 5J22A 3E0JA 1MJEA 3CF5A 1BBXC 3S1MB 1S5CD 2OWOA 1CKOA 5AJ3Q 3S2DB 4IQZA 3GTMH 5IGCA 4DR2Q 3CW2C 1EIFA 1HZBA 4JK1C 4BY1H 3GTJH 4JI7Q 4AYBB 2EY5A 3J7AF 1VQDA 1WI5A 3L3OC 4ABNA 1UE6A 1UE5A 2DY7A 4KJNA 4DR5Q 4R1JA 1IBLQ 3C2PA 5K36H 2L55A 4A3FH 1X56A 3OW2A 1YHQA 4V0BA 1BO0A 2L15A 1HH2P 4QQBX 5HGQA 2NVXH 1VMPA 1JC7A 2KENA 2BCOA 2WFWA 1SRUA 4HIMA 1BOSA 1D5MC 5M3MG 1QZGA 4A3EH 4QCLA 1F9SA 4DXGA 1V1PA 1XMOL 3GTOB 3ULPA 4JBWA 3QB3A 4JV5Q 3MEHA 5M5YH 4DUZQ 5G3LF 5I6YA 4HJ7A 2UXBQ 3J80E 1EEID 3MXPA 2O2LD 1WD1A 2UU9Q 1N33L 4FXDA 2NTSA 4IJHA 1LTID 5C0XH 2NVTB 5LHY1 2VQEL 2UUBQ 3C3LA 2Q2IA 4X3KA 5GADC 1EY8A 1SMYD 3HOZG 5M3FB 4JI6L 1U4RA 4EGVA 2D9UA 4ME3A 3S16B 1CHQD 4QY7A 1X32A 2GVAA 1NAPA 2A6EC 1EOTA 3S2DH 4V190 5COYA 4IPHA 4IFDI 2CQOA 2R7ZB 4IUNA 4DA2A 1HFGA 3BZKA 3NBHB 3ULLA 1D2BA 2VB2X 2HHHQ 1PH4A 4OXPA 4RH6A 4BY7H 1EQQA 3ULJA 1XNQQ 3T1YQ 4B3RQ 1JQYD 2UUCQ 3NQIA 3PUZA 2NB0A 4MHEA 1ONLA 4CJ2C 1YNXA 1EIGA 4XTCS 2YV5A 3VR6A 1DONA 4F8MA 2G9HD 2J7ZA 2WB1B 5FLXc 3S1RB 3GTPB 1RCVD 3K5LA 2A68D 3FHWA 2F0UA 5T1IA 3FVQA 1QOHA 2PO4A 2JA9A 1JWSD 5LL6X 2VQFQ 2NZ1D 2CQAA 4AIMA 3KF8B 2GVBA 3NTIA 4FXKC 1CI3M 1CK1A 2V1CC 3TP8A 4LF8L 1SNCA 3GTOH 4KK7A 3CXCA 3VR3A 5E4WC 5I9OA 1FD7D 1Q1BA 2CH4W 3CU7A 4B3TL 1KNEA 3BVMA 3BDCA 2JEBI 3K6OA 1F77A 1E22A 4RMFA 1AE3A 4A3BB 4LFAL 3RN5A 2G9DA 3A0JA 1XPOA 3RR5A 2NVTH 3HOUG 4DGZA 5BN5A 4LF9L 3A56A 3LX0A 5ELOA 4ZAIA 2K5HA 4I65A 4KMUC 5M3FH 4JBKA 2MFIA 1Z9FA 2NN6I 2F0HA 3J81j 3IL8A 1E2VA 2R93G 2E8GA 4FNFA 1A62A 4WJ3M 4UAIA 2MO0A 1STBA 2P5ZX 4X62Q 1EZ8A 4RHRA 4XYQA 2R7ZH 4JVZA 5M5XB 1I4XA 1V1OA 2PZWA 1GUTA 1IXRA 1ENFA 2UXCQ 1KLGD 4LFBQ 1LTTD 2PQEA 1B8AA 1IL8A 4OX9Q 1LTSD 2N3SA 1A2UA 4BS9A 3D0FA 3S2HB 1EIYB 2UXDL 3BVZA 3S1RH 3GTPH 4RGNA 1LTAD 2HIXA 2JXMB 3S15B 2WV6D 1BBUA 1TWHH 2AWNA 1A6XA 4JOIA 4OL7A 3M9BA 3PV0A 4BY1G 2E2HB 4IN3A 1NTGA 3M4YA 4DAVA 3VR5A 2OEOA 4GOPA 2FJ2A 4JYAQ 1Y8OB 3PIP3 1PVOA 5K36G 5CV6A 2J4XA 2DJFC 1EQTA 1L1OA 1S3OA 5C44H 2YTVA 2ZM6Q 4A3FG 1G8ZD 2IHEA 1LYLA 1DOLA 1Y69U 3FRPB 2LFNA 2A73B 4A3BH 1BKBA 1OXTA 3VR4A 2BDNA 4OWXB 1KQSA 1C4QA 1YJWA 4JI4Q 2IHFA 3L7ZC 3STBC 1XPRA 4F7XA 5E3FA 2R3ZA 3MFGA 2Y0SE 3J81E 3KLSX 5EKLA 2F4VL 4ID6A 1SNMA 1JJ2A 2CCZA 1FGUA 1GUOA 3CCLA 4IOAA 4A76A 3H15A 1CTMA 4POGA 4FXGC 5IY0A 4LW1A 1UNSA 4G7OC 1A2TA 4DF7A 2ZTEA 3OPOA 3KFUA 2YTYA 2IY5B 4HJ8A 2DJGC 2KUMA 5M5XH 3K5OA 3TS2A 2SEBD 1QILA 2SOBA 5C0XG 4L5RC 3N52A 1STNA 1HUMA 4C3HB 2F1MA 1IYJB 2F0WA 4DV7Q 3CCEA 5G3LD 1QB5D 1LUZA 4GLVB 3M85A 4R4IA 3S2HH 4R4TA 5IYCG 3T56B 5IP7H 4X65L 4ZKCB 2K28A 3MTSA 1EYGA 3IKJA 4X3TA 3UDXA 1DGSA 3S15H 2ZTCA 2MNAA 1Q8IA 2JA6B 4C2MB 1VQ6A 1HHVA 4DAMA 1NSNS 5H1SE 4DFAA 1ZYRC 2B8GA 2E2HH 4AYBG 3AMUA 3CC4A 4BY7G 3GTQB 4FO2A 2NVYB 4A3MH 4L5SA 2QDBA 5EBCA 5F2DA 2YTXA 1ML0D 4JI2L 4KN4C 1I94L 3M4OB 4GKJQ 3D8GA 3TZDA 2A6ED 1ESRA 3MXNA 1EWIA 4RG1A 4A3JB 3QO2A 2H4OA 3HOXB 2F3VA 4BBRB 1IL2A 1GUWA 1QVGA 3K7AB 3K5NA 1X65A 1X55A 1EIHA 3RD4A 1Z6HA 3U4ZA 3NELA 1GHJA 3HFZB 1Q86C 4YHHL 1JOOA 1EFID 3RZDH 5D3DA 4R4QA 4DV6Q 4APVA 4GLXA 1C48A 5D3IB 2D62A 4X64Q 3GV6A 4KHZA 4C3HH 3NXWA 1TWGB 1L2FA 4H02A 4R9WA 4G57A 4Y7NH 1SNQA 2KQ3A 1HNWQ 4P71A 1ESFA 3GTKB 1Y1WH 1TS3A 3MC0B 1HQRD 4XYOA 3J80c 1IKLA 4JOIC 1JJGA 5IT9E 2BA1A 3SGIA 1JORA 1V8QA 2R7ZG 4GOPC 2OQ0A 4LK1C 4HIDA 4C2MH 3ITPA 1GJXA 5CV5A 5JAVA 2KJXA 1L1OC 1I50B 4JI3Q 3GTQH 2OCEA 3UDGA 4FVMA 4K5WA 3GD7A 3WOEA 3NHHA 3Q22A 1N32Q 5AJ3L 2UUAQ 3A55A 2WB1G 3M4OH 4DR2L 3IRBA 4DK0A 4XXEA 4F87A 4PNYA 4XT3B 2R92H 3SEBA 4A3JH 4DR5L 4BBRH 2PI2A 3MA2B 1W2BA 3P7JA 2K52A 3BYYB 4O42A 4WFN3 1TR5A 3G6EA 4GZYC 5C44G 1EYAA 4WORA 2EDGA 3S1NH 1NUCA 4A3BG 1SE3A 1TS2A 2ZXOA 3NQTA 1NMFA 3M4PA 4NPSA 5KNBA 3H3VC 1II3A 2XWBB 1O7IA 1L1OB 2K7VA 1TWGH 4X66L 4JV5L 5I6WA 4DUZL 3DMUA 1TU2B 3MEFA 5CV7A 3GTKH 3L2PA 4B3MQ 5DEHA 3JAML 1CKMA 2PCFB 4EQPA 3I56A 1MJCA 5HY6A 2UU9L 5A2QE 3CCSA 1E1TA 3M7NA 1TQOA 2UUBL 4KHPQ 3AFPA 2CHBD 4XQQA 2CWAA 1EZ6A 3MAQA 2K5DA 2KCNA 2CW0C 4L63B 1TY2A 3CPWA 3STBD 3CCQA 4HJ9A 1A3TA 1BF4A 3PO2B 3R93A 2AKWB 1TWCB 3NPPA 2EYLA 5EPLA 4JI5Q 1K28A 3QR8A 4LFCQ 1SXTA 2KCMA 5IP7G 4WJWA 1VQHA 4XQJA 3KYHC 1EL0A 1FJGQ 3I4NB 2RCNA 3M4QA 3G6JB 3R8BA 1P8LA 2JYOA 2HHHL 5ELDA 1F2LA 4PMBA 1XNQL 2EJFC 3T1YL 4B3RL 1JOQA 1PTOC 1RJTA 2UUCL 1WTVA 1HA5A 4A3MG 1EY5A
chains in the Genus database with same CATH topology
1XNRQ 2K14A 2WAQG 1GO3E 1YBYA 3AEVA 1VQAA 3CCJA 4BXXG 3S17H 3DM3A 1HNXL 5M3FG 4DV0Q 4A3KH 5IYDH 1UE7A 4IOCA 1VQ5A 1XMOL 5GAGC 4DV4Q 1N34Q 3S14H 3ULPA 4JBWA 4JV5Q 2JA7H 1GVPA 5M5YH 3KJOA 4DUZQ 3I4OA 3ER0A 1K83H 4HJ7A 2UXBQ 3K81C 4XIGS 1TWFH 5IP9G 3DLLA 2VQFL 1HR0W 2EXDA 4JCVE 3U58A 3B6YA 1Q7YC 2JA6H 1J6QA 1EFWA 2H5XA 1X3EA 4FDBA 2UU9Q 1N33L 4JI1Q 4DR3L 4KLKA 2JA8H 2HQLA 4YY3L 4DV1Q 4IJHA 1KC8C 5FJ8G 3Q8DA 1JJCB 5GAHC 2VQEL 2NN6G 1YJNA 2UUBQ 4YWLA 1ASYA 3CC7A 1QUQA 2NVYH 1I5FA 2Q2IA 5GADC 3S24A 2I5HA 1EUJA 3HOZG 2EQSA 3KJPA 1V9PA 1GD7A 1KAWA 2Z0SA 4NB3A 3W1GA 4JI6L 1C0AA 2VNUD 4ME3A 2XTIA 2NZHA 4QY7A 1E3PA 2GVAA 1B70B 3CPFA 4B3SQ 4QL5A 3K7UC 4YCUA 1KRTA 3S2DH 1PH2A 3J81c 4JI7L 4WJ4A 4IPHA 3PO2H 3BU2A 3J7A5 4IFDI 2CQOA 4YCWA 4L5TA 3BZKA 2OQKA 1TWCH 3NBHB 3AYHB 4GLAC 3WWVA 3HOXH 3ULLA 4MZ9A 3CMAA 4GN5A 1IBLL 4BA2I 4GKKQ 2HHHQ 5C0XJ 1PH4A 4OXPA 1OXVA 5GAEC 4BY7H 3K7AH 1Y1WG 1EQQA 3ULJA 1XNQQ 4X62L 3T1YQ 3K0XA 4A3DH 4B3RQ 4AH6A 1B7YB 2UUCQ 3PUZA 1N9WA 3I4NH 1YNXA 1G291 4XTCS 2YV5A 4YWMA 5FLXc 2UXCL 4GOPB 4PG3A 1YHAA 1HNXQ 2PQAA 4LFBL 3FHWA 3I4MH 2N49A 1XMOQ 2K4KA 5DLQE 1P16A 5GROA 1XMQL 4A3IG 2GN5A 2K75A 5JEAJ 4DKAC 4OX9L 1I6HH 1BVSA 4UY8C 2JA9A 3D31A 1JMCA 4J15A 4LF5L 2VQFQ 2ASBA 4ALPA 4A3LG 2JEAI 5IWAL 4AIMA 2UXBL 1BBWA 5LMUL 2AWOA 2GVBA 3KF8B 4JC0A 3G71A 1Q46A 2V1CC 4LF8L 1N33Q 1S40A 3GTOH 4DR3Q 4A93H 1RIPA 4YY3Q 1WCMH 1UE1A 4HJ5A 3CXCA 4MNOA 3F8TA 2NVQH 2VQEQ 1Q1BA 1TWAH 4B3TL 4DR6L 3K80C 1U5KA 2VW9A 1I3QH 1OTCA 1VQKA 1CKNB 2JEBI 2JK8A 1E22A 4RMFA 4A3JG 2N78A 4Y52H 1AE3A 1K0RA 4C3JH 5JJKA 3PGZA 4LFAL 4EQ5A 3UE0A 4A3CG 4BBRG 3RN5A 4JI6Q 4DV3L 2D0PA 3TRZA 3T1HL 1V1QA 5LMNQ 3A0JA 2ZJRA 3HKZG 2ZM6L 1XPOA 1I50H 3RR5A 2OTLA 2NVTH 1Q82C 3HOUG 2E5LL 4LF9L 3E0EA 4HIOA 1CSPA 3HOWH 5ELOA 2BA0A 2CKZB 2K5HA 2DGYA 2E2IH 1PHJA 1UEBA 4GNXA 5M3FH 4JBKA 1JT8A 2MFIA 3PUXA 2KBNA 3EBEA 1Z9FA 2NN6I 4JI4L 3J81j 4DR1L 1HNZL 4JI0L 3F2DA 2R93G 2E8GA 4PZ6A 1G51A 1A62A 3FP9A 4WJ3M 1GM5A 1C7YA 2MO0A 1HR0L 2QGQA 1YZ6A 4LUZA 3TREA 4X62Q 5FLMG 5ELNA 2R7ZH 3VDYA 1LTLA 3CCVA 4HJAA 3G4SA 4IJLA 1LM0A 2I0QA 2HIVA 4DV5L 3E9IA 3I7FA 4LNQA 2F52A 2DUDA 1IXRA 3TQYA 2UXCQ 4JG2A 1E7ZA 2I5LX 4LFBQ 1X54A 3GO5A 3RZOH 1B8AA 3PO3G 1XMQQ 1YHBA 4UPAA 5IYBG 1XJVA 4OX9Q 2IX0A 2N3SA 1JE5A 3D0FA 3FKIH 1EIYB 2UXDL 2LXJA 2VUMH 4LF5Q 3S1RH 5C4XH 3GTPH 5IWAQ 2HIXA 4AQYL 4O2DA 5LMUQ 2RHSB 1SFOH 2JJQA 2F3IA 3H0GH 4LF8Q 1K73C 1PH6A 1BBUA 1TWHH 2AWNA 1YITA 4X65Q 4NXNL 1QVCA 4JOIA 1PH9A 3CP0A 4DR6Q 1SMXA 3M9BA 1SN8A 3PV0A 4BY1G 4B3TQ 1NTGA 2B63G 1E24A 4A3GH 5JJLA 1FL0A 1YVCA 1L0WA 3UE1A 4GOPA 2PMZE 4JYAQ 3PUYA 4LFAQ 5IT9c 3TS0A 3M3YH 3MXNB 1PVOA 1OXSC 3CCUA 4DV3Q 5K36G 3T1HQ 4OONA 3J80i 1CUKA 1L1OA 1S3OA 5C44H 2YTVA 2ZM6Q 4LF4L 1Y1VH 4A3FG 3OTOL 1J5EL 3HOYG 3CAMA 2E5LQ 2IHEA 1PH5A 5LMNL 1LYLA 1HZCA 3KDFB 4LF9Q 3S1MH 4A3BH 1BKBA 3CQZH 3KF6B 1OXTA 1K8AC 2R6GA 1VQLA 4OWXB 2ES2A 3PUVA 4JBJA 2R7DA 1KQSA 1YJWA 4JI4Q 2IHFA 3L7ZC 3STBC 4DR1Q 2C35B 1XPRA 1HNZQ 1SROA 1YJ9A 4JI0Q 2A1AA 2Y0SE 1HR0Q 4GKJL 5IYDG 4A3KG 2F4VL 1JJ2A 2CCZA 4BBSH 1FGUA 4LUVA 4UP7A 1SLJA 3PSIA 3CCLA 4IOAA 1EQRA 1VQFA 1VQGA 3H15A 4A76A 3PF5A 1PFSA 1X3FA 4POGA 2JA7G 5IY0A 4DV5Q 1HZAA 1VQCA 4LW1A 4PZ7A 3PCOB 1VQOA 1KXLA 1Q1EA 5C3EH 1S72A 3H3VH 4L5QA 1D7QA 2ZTEA 2MO1A 2JA6G 4DR4L 1JB7A 2YTYA 3KFUA 3A74A 1CSQA 2R92G 2IY5B 4HJ8A 2Z6KA 1Q81C 4DK3C 5M5XH 3CC2A 2JA8G 3RLNA 3RLOA 1VQ7A 1VQ4A 3TS2A 3CCMA 5C0XG 1KHIA 4L5RC 2UXDQ 2JE6I 2PNHA 1R9TH 3CD6A 1IYJB 4DV7Q 4AQYQ 3CCEA 1PH7A 2Q2TA 5IE8A 5J3BA 1N8RC 1LUZA 1XTDA 2EIFA 4GLVB 4NXNQ 4IPDA 3M85A 3W1BA 3K8AA 4R4IA 4DUYL 2IT1A 4DV6L 3S2HH 4R4TA 5IYCG 3JAMi 4LWCA 4DNIA 5IP7H 4X65L 1GKHA 1VCIA 4DV2L 1Q12A 1EYGA 1KRSA 2E2JH 2LXKA 2ZJQA 4AYBE 3UDXA 1FVIA 1DGSA 3S15H 4IFDJ 2ZTCA 5JEAG 2A8VA 2JA5H 2MNAA 1T9HA 3PIPA 3PO2G 1NE3A 1HNWL 2K5NA 1IBKL 4JYAL 4P73A 3I2ZA 3HOXG 1VQ6A 4TVAB 4LF4Q 1J5EQ 1PYBA 1VS0A 4DAMA 5H1SE 3OTOQ 1A63A 2E2HH 4AYBG 3HOVH 3EN2A 3CC4A 4BY7G 1A8VA 4A3DG 3OYYA 3U4VA 1PH1A 4YCVA 5M3MH 4A3MH 4L5SA 1XPUA 1VQIA 1V43A 4BXXH 3I55A 2YU9H 1QZHA 1NY4A 4X6AH 1M1KC 2YTXA 1PYSB 3I4NG 4JI2L 1I94L 3PUWA 3S16H 1NBWA 4GKJQ 2RF4A 4JI3L 2MQHA 2F4VQ 3I4MG 1NMGA 3JC66 3U50C 1EWIA 4RG1A 5IP9H 3BZCA 1KD1C 2UUAL 4P75A 4GNXC 4HIKA 3KDFA 4QJFA 1PA6A 1IL2A 2NZOA 4GN4B 4DR4Q 1WYDA 1WFQA 5FJ8H 4PMWA 3KF6A 2PQAB 1QVGA 1X65A 3NEMA 2JQOA 4A93G 3AFQA 1X55A 2K5VA 3PIOA 1WCMG 3ZJYC 1VQNA 1AH9A 2VS1A 3U4ZA 4OO1G 4UP8A 2K50A 3HOZH 2CFMA 2WP8J 1VQEA 3KOJA 3NELA 3HFZB 1Q86C 2IX1A 4YHHL 1X3GA 3GTGH 2FXQA 4DV7L 4LF7L 2WAQE 3ERSX 4DK6C 3RZDH 5BR8L 3S1QH 4R4QA 4DUYQ 3AQQA 1OXUA 4APVA 4DV6Q 4GLXA 1SE8A 3G48A 4DR7L 2D62A 4X64Q 4GN3B 4KHZA 4C3HH 4K0KL 3RN2A 4JI8L 1WJJA 4DV2Q 1X9NA 3HOWG 1PH8A 1L2FA 4H02A 4Y7NH 3A5ZB 2I5MX 4KI0A 4A75A 2ZTDA 1HNWQ 4P71A 1IBKQ 5C0XI 1PV4A 2RHQB 1Y1WH 3J80c 1Z47A 2D0OA 2KHJA 4R4CA 4X66Q 3F1ZA 5GQOA 1VQ9A 4JOIC 4LF6L 4EX5A 1JJGA 2BA1A 4A4IA 1VQJA 1MKHA 3SGIA 1VQBA 5JJIA 1SR3A 1VQMA 2LSSA 2R7ZG 2ALYB 4GOPC 4DAYB 2OQ0A 4P74A 3KLWA 4HIDA 1ASZA 4C2MH 4GNXB 3GDEA 4B3ML 4JI2Q 1I94Q 2B3GA 1E1OA 1TXYA 4NXML 1K8GA 1L1OC 4A3IH 4GS3A 4A3EG 4JI3Q 3GTQH 2OCEA 2WB1E 1IZ6A 3UDGA 3UDIA 1NJIC 3GD7A 1A0IA 1CKNA 1EOVA 5EAYA 4KHPL 1WOCA 4A3LH 1OXXK 1N32Q 3FKIG 5AJ3L 2UUAQ 4YWKA 1PH3A 1Q8KA 1KIXA 2VUMG 2WB1G 5C4XG 2Y0SG 3M4OH 5IYCH 2QA4A 4DR2L 2YYZA 3IRBA 3ICEA 3RLFA 2B29A 1W3SA 4POFA 2AMCB 3H0GG 4JI5L 2BH2A 2QEXA 3H3VI 3J81i 3UDFA 2R92H 2R7FA 4LFCL 4A3JH 2ATWA 4TQUS 4BA1I 1QVFA 4A3GG 4DR5L 4A3CH 4BBRH 2PI2A 1W2BA 1HZ9A 4YHHQ 1FJGL 2K52A 4LF7Q 1KL9A 3HOUH 1YEZA 1K3RA 4O0AA 5BR8Q 3G6EA 1VQPA 5C44G 4PZ8A 1N36L 1AE2A 1C9OA 3L0OA 1Y1VG 4DR7Q 2Z6KC 4OWTB 4K0KQ 2HT1A 4JI8Q 3JAMc 3S1NH 1YIJA 1RL2A 5LMNW 4X64L 4QIWE 4DPGA 4A3BG 3GTLH 1NMFA 3BJUA 3NENA 3M4PA 4NPSA 1IBML 4JBMA 2R93H 3F2CA 1XNRL 1QUQB 4OO1I 3A5UA 4DV0L 1O7IA 1L1OB 2PI2E 4LF6Q 3TEHB 5FLMH 4IO9A 4DV4L 1N34L 1TWGH 4X66L 4MTNA 4JV5L 4BBSG 4DUZL 3MEFA 3W5OA 2ID0A 4OWWB 1HJPA 4IPCA 3PF4A 3LGJA 2CWPA 2BH8A 2VY3A 3GTKH 3L2PA 4B3MQ 3CMEA 1CKMA 3I56A 5M5WH 4NXMQ 2ZJPA 1MJCA 3PO3H 5HY6A 4R4OA 5C3EG 5IYBH 2UU9L 4JI1L 4QGUA 3CCSA 2VZAA 4IFDG 4IPGA 3HKZE 5E7NA 1MIUA 4DV1L 1E1TA 3M7NA 1D8LA 2Q2UA 1MJEA 3CF5A 2UUBL 4KHPQ 3AFPA 2OWOA 2CWAA 1CKOA 1K9MC 5AJ3Q 2AHOB 3CPWA 3CCQA 3STBD 4HJ9A 2KHIA 3RNUA 1N32L 3GTMH 4DR2Q 2AKWB 3CCRA 3CW2C 2N8NA 1UWVA 2VL6A 1HZBA 1EIFA 5C4JH 3F2BA 4JI5Q 4BY1H 1H95A 2B63H 3GTJH 4JI7Q 1Y14B 4B3SL 1M90C 1VQ8A 4LFCQ 3HKSA 4P72A 1VQDA 1WI5A 2KCMA 5IP7G 1UE6A 1UE5A 3J7ZC 4DR5Q 4R1JA 1VQHA 1IBLQ 3KYHC 1FJGQ 3E9HA 2RCNA 3M4QA 4A3FH 2JA5G 1X56A 1P8LA 2XGTA 3HOYH 2A19A 4GKKL 3OW2A 2HHHL 1YHQA 1N36Q 3EIVA 2L15A 2KCTA 1HH2P 4UP9A 1XNQL 3T1YL 4B3RL 4QQBX 1X6OA 1G6PA 5HGQA 2NVXH 2OTJA 3HOVG 2KENA 4C3IH 1U0LA 2UUCL 2WFWA 1SRUA 1YI2A 4HIMA 4LUOA 5M3MG 1QZGA 4A3MG 4A3EH 1IBMQ 2Q2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR Q;  2K14 A;  2WAQ G;  1GO3 E;  1YBY A;  3AEV A;  1VQA A;  3CCJ A;  4BXX G;  3S17 H;  3DM3 A;  1HNX L;  5M3F G;  4DV0 Q;  4A3K H;  5IYD H;  1UE7 A;  4IOC A;  1VQ5 A;  1XMO L;  5GAG C;  4DV4 Q;  1N34 Q;  3S14 H;  3ULP A;  4JBW A;  4JV5 Q;  2JA7 H;  1GVP A;  5M5Y H;  3KJO A;  4DUZ Q;  3I4O A;  3ER0 A;  1K83 H;  4HJ7 A;  2UXB Q;  3K81 C;  4XIG S;  1TWF H;  5IP9 G;  3DLL A;  2VQF L;  1HR0 W;  2EXD A;  4JCV E;  3U58 A;  3B6Y A;  1Q7Y C;  2JA6 H;  1J6Q A;  1EFW A;  2H5X A;  1X3E A;  4FDB A;  2UU9 Q;  1N33 L;  4JI1 Q;  4DR3 L;  4KLK A;  2JA8 H;  2HQL A;  4YY3 L;  4DV1 Q;  4IJH A;  1KC8 C;  5FJ8 G;  3Q8D A;  1JJC B;  5GAH C;  2VQE L;  2NN6 G;  1YJN A;  2UUB Q;  4YWL A;  1ASY A;  3CC7 A;  1QUQ A;  2NVY H;  1I5F A;  2Q2I A;  5GAD C;  3S24 A;  2I5H A;  1EUJ A;  3HOZ G;  2EQS A;  3KJP A;  1V9P A;  1GD7 A;  1KAW A;  2Z0S A;  4NB3 A;  3W1G A;  4JI6 L;  1C0A A;  2VNU D;  4ME3 A;  2XTI A;  2NZH A;  4QY7 A;  1E3P A;  2GVA A;  1B70 B;  3CPF A;  4B3S Q;  4QL5 A;  3K7U C;  4YCU A;  1KRT A;  3S2D H;  1PH2 A;  3J81 c;  4JI7 L;  4WJ4 A;  4IPH A;  3PO2 H;  3BU2 A;  3J7A 5;  4IFD I;  2CQO A;  4YCW A;  4L5T A;  3BZK A;  2OQK A;  1TWC H;  3NBH B;  3AYH B;  4GLA C;  3WWV A;  3HOX H;  3ULL A;  4MZ9 A;  3CMA A;  4GN5 A;  1IBL L;  4BA2 I;  4GKK Q;  2HHH Q;  5C0X J;  1PH4 A;  4OXP A;  1OXV A;  5GAE C;  4BY7 H;  3K7A H;  1Y1W G;  1EQQ A;  3ULJ A;  1XNQ Q;  4X62 L;  3T1Y Q;  3K0X A;  4A3D H;  4B3R Q;  4AH6 A;  1B7Y B;  2UUC Q;  3PUZ A;  1N9W A;  3I4N H;  1YNX A;  1G29 1;  4XTC S;  2YV5 A;  4YWM A;  5FLX c;  2UXC L;  4GOP B;  4PG3 A;  1YHA A;  1HNX Q;  2PQA A;  4LFB L;  3FHW A;  3I4M H;  2N49 A;  1XMO Q;  2K4K A;  5DLQ E;  1P16 A;  5GRO A;  1XMQ L;  4A3I G;  2GN5 A;  2K75 A;  5JEA J;  4DKA C;  4OX9 L;  1I6H H;  1BVS A;  4UY8 C;  2JA9 A;  3D31 A;  1JMC A;  4J15 A;  4LF5 L;  2VQF Q;  2ASB A;  4ALP A;  4A3L G;  2JEA I;  5IWA L;  4AIM A;  2UXB L;  1BBW A;  5LMU L;  2AWO A;  2GVB A;  3KF8 B;  4JC0 A;  3G71 A;  1Q46 A;  2V1C C;  4LF8 L;  1N33 Q;  1S40 A;  3GTO H;  4DR3 Q;  4A93 H;  1RIP A;  4YY3 Q;  1WCM H;  1UE1 A;  4HJ5 A;  3CXC A;  4MNO A;  3F8T A;  2NVQ H;  2VQE Q;  1Q1B A;  1TWA H;  4B3T L;  4DR6 L;  3K80 C;  1U5K A;  2VW9 A;  1I3Q H;  1OTC A;  1VQK A;  1CKN B;  2JEB I;  2JK8 A;  1E22 A;  4RMF A;  4A3J G;  2N78 A;  4Y52 H;  1AE3 A;  1K0R A;  4C3J H;  5JJK A;  3PGZ A;  4LFA L;  4EQ5 A;  3UE0 A;  4A3C G;  4BBR G;  3RN5 A;  4JI6 Q;  4DV3 L;  2D0P A;  3TRZ A;  3T1H L;  1V1Q A;  5LMN Q;  3A0J A;  2ZJR A;  3HKZ G;  2ZM6 L;  1XPO A;  1I50 H;  3RR5 A;  2OTL A;  2NVT H;  1Q82 C;  3HOU G;  2E5L L;  4LF9 L;  3E0E A;  4HIO A;  1CSP A;  3HOW H;  5ELO A;  2BA0 A;  2CKZ B;  2K5H A;  2DGY A;  2E2I H;  1PHJ A;  1UEB A;  4GNX A;  5M3F H;  4JBK A;  1JT8 A;  2MFI A;  3PUX A;  2KBN A;  3EBE A;  1Z9F A;  2NN6 I;  4JI4 L;  3J81 j;  4DR1 L;  1HNZ L;  4JI0 L;  3F2D A;  2R93 G;  2E8G A;  4PZ6 A;  1G51 A;  1A62 A;  3FP9 A;  4WJ3 M;  1GM5 A;  1C7Y A;  2MO0 A;  1HR0 L;  2QGQ A;  1YZ6 A;  4LUZ A;  3TRE A;  4X62 Q;  5FLM G;  5ELN A;  2R7Z H;  3VDY A;  1LTL A;  3CCV A;  4HJA A;  3G4S A;  4IJL A;  1LM0 A;  2I0Q A;  2HIV A;  4DV5 L;  3E9I A;  3I7F A;  4LNQ A;  2F52 A;  2DUD A;  1IXR A;  3TQY A;  2UXC Q;  4JG2 A;  1E7Z A;  2I5L X;  4LFB Q;  1X54 A;  3GO5 A;  3RZO H;  1B8A A;  3PO3 G;  1XMQ Q;  1YHB A;  4UPA A;  5IYB G;  1XJV A;  4OX9 Q;  2IX0 A;  2N3S A;  1JE5 A;  3D0F A;  3FKI H;  1EIY B;  2UXD L;  2LXJ A;  2VUM H;  4LF5 Q;  3S1R H;  5C4X H;  3GTP H;  5IWA Q;  2HIX A;  4AQY L;  4O2D A;  5LMU Q;  2RHS B;  1SFO H;  2JJQ A;  2F3I A;  3H0G H;  4LF8 Q;  1K73 C;  1PH6 A;  1BBU A;  1TWH H;  2AWN A;  1YIT A;  4X65 Q;  4NXN L;  1QVC A;  4JOI A;  1PH9 A;  3CP0 A;  4DR6 Q;  1SMX A;  3M9B A;  1SN8 A;  3PV0 A;  4BY1 G;  4B3T Q;  1NTG A;  2B63 G;  1E24 A;  4A3G H;  5JJL A;  1FL0 A;  1YVC A;  1L0W A;  3UE1 A;  4GOP A;  2PMZ E;  4JYA Q;  3PUY A;  4LFA Q;  5IT9 c;  3TS0 A;  3M3Y H;  3MXN B;  1PVO A;  1OXS C;  3CCU A;  4DV3 Q;  5K36 G;  3T1H Q;  4OON A;  3J80 i;  1CUK A;  1L1O A;  1S3O A;  5C44 H;  2YTV A;  2ZM6 Q;  4LF4 L;  1Y1V H;  4A3F G;  3OTO L;  1J5E L;  3HOY G;  3CAM A;  2E5L Q;  2IHE A;  1PH5 A;  5LMN L;  1LYL A;  1HZC A;  3KDF B;  4LF9 Q;  3S1M H;  4A3B H;  1BKB A;  3CQZ H;  3KF6 B;  1OXT A;  1K8A C;  2R6G A;  1VQL A;  4OWX B;  2ES2 A;  3PUV A;  4JBJ A;  2R7D A;  1KQS A;  1YJW A;  4JI4 Q;  2IHF A;  3L7Z C;  3STB C;  4DR1 Q;  2C35 B;  1XPR A;  1HNZ Q;  1SRO A;  1YJ9 A;  4JI0 Q;  2A1A A;  2Y0S E;  1HR0 Q;  4GKJ L;  5IYD G;  4A3K G;  2F4V L;  1JJ2 A;  2CCZ A;  4BBS H;  1FGU A;  4LUV A;  4UP7 A;  1SLJ A;  3PSI A;  3CCL A;  4IOA A;  1EQR A;  1VQF A;  1VQG A;  3H15 A;  4A76 A;  3PF5 A;  1PFS A;  1X3F A;  4POG A;  2JA7 G;  5IY0 A;  4DV5 Q;  1HZA A;  1VQC A;  4LW1 A;  4PZ7 A;  3PCO B;  1VQO A;  1KXL A;  1Q1E A;  5C3E H;  1S72 A;  3H3V H;  4L5Q A;  1D7Q A;  2ZTE A;  2MO1 A;  2JA6 G;  4DR4 L;  1JB7 A;  2YTY A;  3KFU A;  3A74 A;  1CSQ A;  2R92 G;  2IY5 B;  4HJ8 A;  2Z6K A;  1Q81 C;  4DK3 C;  5M5X H;  3CC2 A;  2JA8 G;  3RLN A;  3RLO A;  1VQ7 A;  1VQ4 A;  3TS2 A;  3CCM A;  5C0X G;  1KHI A;  4L5R C;  2UXD Q;  2JE6 I;  2PNH A;  1R9T H;  3CD6 A;  1IYJ B;  4DV7 Q;  4AQY Q;  3CCE A;  1PH7 A;  2Q2T A;  5IE8 A;  5J3B A;  1N8R C;  1LUZ A;  1XTD A;  2EIF A;  4GLV B;  4NXN Q;  4IPD A;  3M85 A;  3W1B A;  3K8A A;  4R4I A;  4DUY L;  2IT1 A;  4DV6 L;  3S2H H;  4R4T A;  5IYC G;  3JAM i;  4LWC A;  4DNI A;  5IP7 H;  4X65 L;  1GKH A;  1VCI A;  4DV2 L;  1Q12 A;  1EYG A;  1KRS A;  2E2J H;  2LXK A;  2ZJQ A;  4AYB E;  3UDX A;  1FVI A;  1DGS A;  3S15 H;  4IFD J;  2ZTC A;  5JEA G;  2A8V A;  2JA5 H;  2MNA A;  1T9H A;  3PIP A;  3PO2 G;  1NE3 A;  1HNW L;  2K5N A;  1IBK L;  4JYA L;  4P73 A;  3I2Z A;  3HOX G;  1VQ6 A;  4TVA B;  4LF4 Q;  1J5E Q;  1PYB A;  1VS0 A;  4DAM A;  5H1S E;  3OTO Q;  1A63 A;  2E2H H;  4AYB G;  3HOV H;  3EN2 A;  3CC4 A;  4BY7 G;  1A8V A;  4A3D G;  3OYY A;  3U4V A;  1PH1 A;  4YCV A;  5M3M H;  4A3M H;  4L5S A;  1XPU A;  1VQI A;  1V43 A;  4BXX H;  3I55 A;  2YU9 H;  1QZH A;  1NY4 A;  4X6A H;  1M1K C;  2YTX A;  1PYS B;  3I4N G;  4JI2 L;  1I94 L;  3PUW A;  3S16 H;  1NBW A;  4GKJ Q;  2RF4 A;  4JI3 L;  2MQH A;  2F4V Q;  3I4M G;  1NMG A;  3JC6 6;  3U50 C;  1EWI A;  4RG1 A;  5IP9 H;  3BZC A;  1KD1 C;  2UUA L;  4P75 A;  4GNX C;  4HIK A;  3KDF A;  4QJF A;  1PA6 A;  1IL2 A;  2NZO A;  4GN4 B;  4DR4 Q;  1WYD A;  1WFQ A;  5FJ8 H;  4PMW A;  3KF6 A;  2PQA B;  1QVG A;  1X65 A;  3NEM A;  2JQO A;  4A93 G;  3AFQ A;  1X55 A;  2K5V A;  3PIO A;  1WCM G;  3ZJY C;  1VQN A;  1AH9 A;  2VS1 A;  3U4Z A;  4OO1 G;  4UP8 A;  2K50 A;  3HOZ H;  2CFM A;  2WP8 J;  1VQE A;  3KOJ A;  3NEL A;  3HFZ B;  1Q86 C;  2IX1 A;  4YHH L;  1X3G A;  3GTG H;  2FXQ A;  4DV7 L;  4LF7 L;  2WAQ E;  3ERS X;  4DK6 C;  3RZD H;  5BR8 L;  3S1Q H;  4R4Q A;  4DUY Q;  3AQQ A;  1OXU A;  4APV A;  4DV6 Q;  4GLX A;  1SE8 A;  3G48 A;  4DR7 L;  2D62 A;  4X64 Q;  4GN3 B;  4KHZ A;  4C3H H;  4K0K L;  3RN2 A;  4JI8 L;  1WJJ A;  4DV2 Q;  1X9N A;  3HOW G;  1PH8 A;  1L2F A;  4H02 A;  4Y7N H;  3A5Z B;  2I5M X;  4KI0 A;  4A75 A;  2ZTD A;  1HNW Q;  4P71 A;  1IBK Q;  5C0X I;  1PV4 A;  2RHQ B;  1Y1W H;  3J80 c;  1Z47 A;  2D0O A;  2KHJ A;  4R4C A;  4X66 Q;  3F1Z A;  5GQO A;  1VQ9 A;  4JOI C;  4LF6 L;  4EX5 A;  1JJG A;  2BA1 A;  4A4I A;  1VQJ A;  1MKH A;  3SGI A;  1VQB A;  5JJI A;  1SR3 A;  1VQM A;  2LSS A;  2R7Z G;  2ALY B;  4GOP C;  4DAY B;  2OQ0 A;  4P74 A;  3KLW A;  4HID A;  1ASZ A;  4C2M H;  4GNX B;  3GDE A;  4B3M L;  4JI2 Q;  1I94 Q;  2B3G A;  1E1O A;  1TXY A;  4NXM L;  1K8G A;  1L1O C;  4A3I H;  4GS3 A;  4A3E G;  4JI3 Q;  3GTQ H;  2OCE A;  2WB1 E;  1IZ6 A;  3UDG A;  3UDI A;  1NJI C;  3GD7 A;  1A0I A;  1CKN A;  1EOV A;  5EAY A;  4KHP L;  1WOC A;  4A3L H;  1OXX K;  1N32 Q;  3FKI G;  5AJ3 L;  2UUA Q;  4YWK A;  1PH3 A;  1Q8K A;  1KIX A;  2VUM G;  2WB1 G;  5C4X G;  2Y0S G;  3M4O H;  5IYC H;  2QA4 A;  4DR2 L;  2YYZ A;  3IRB A;  3ICE A;  3RLF A;  2B29 A;  1W3S A;  4POF A;  2AMC B;  3H0G G;  4JI5 L;  2BH2 A;  2QEX A;  3H3V I;  3J81 i;  3UDF A;  2R92 H;  2R7F A;  4LFC L;  4A3J H;  2ATW A;  4TQU S;  4BA1 I;  1QVF A;  4A3G G;  4DR5 L;  4A3C H;  4BBR H;  2PI2 A;  1W2B A;  1HZ9 A;  4YHH Q;  1FJG L;  2K52 A;  4LF7 Q;  1KL9 A;  3HOU H;  1YEZ A;  1K3R A;  4O0A A;  5BR8 Q;  3G6E A;  1VQP A;  5C44 G;  4PZ8 A;  1N36 L;  1AE2 A;  1C9O A;  3L0O A;  1Y1V G;  4DR7 Q;  2Z6K C;  4OWT B;  4K0K Q;  2HT1 A;  4JI8 Q;  3JAM c;  3S1N H;  1YIJ A;  1RL2 A;  5LMN W;  4X64 L;  4QIW E;  4DPG A;  4A3B G;  3GTL H;  1NMF A;  3BJU A;  3NEN A;  3M4P A;  4NPS A;  1IBM L;  4JBM A;  2R93 H;  3F2C A;  1XNR L;  1QUQ B;  4OO1 I;  3A5U A;  4DV0 L;  1O7I A;  1L1O B;  2PI2 E;  4LF6 Q;  3TEH B;  5FLM H;  4IO9 A;  4DV4 L;  1N34 L;  1TWG H;  4X66 L;  4MTN A;  4JV5 L;  4BBS G;  4DUZ L;  3MEF A;  3W5O A;  2ID0 A;  4OWW B;  1HJP A;  4IPC A;  3PF4 A;  3LGJ A;  2CWP A;  2BH8 A;  2VY3 A;  3GTK H;  3L2P A;  4B3M Q;  3CME A;  1CKM A;  3I56 A;  5M5W H;  4NXM Q;  2ZJP A;  1MJC A;  3PO3 H;  5HY6 A;  4R4O A;  5C3E G;  5IYB H;  2UU9 L;  4JI1 L;  4QGU A;  3CCS A;  2VZA A;  4IFD G;  4IPG A;  3HKZ E;  5E7N A;  1MIU A;  4DV1 L;  1E1T A;  3M7N A;  1D8L A;  2Q2U A;  1MJE A;  3CF5 A;  2UUB L;  4KHP Q;  3AFP A;  2OWO A;  2CWA A;  1CKO A;  1K9M C;  5AJ3 Q;  2AHO B;  3CPW A;  3CCQ A;  3STB D;  4HJ9 A;  2KHI A;  3RNU A;  1N32 L;  3GTM H;  4DR2 Q;  2AKW B;  3CCR A;  3CW2 C;  2N8N A;  1UWV A;  2VL6 A;  1HZB A;  1EIF A;  5C4J H;  3F2B A;  4JI5 Q;  4BY1 H;  1H95 A;  2B63 H;  3GTJ H;  4JI7 Q;  1Y14 B;  4B3S L;  1M90 C;  1VQ8 A;  4LFC Q;  3HKS A;  4P72 A;  1VQD A;  1WI5 A;  2KCM A;  5IP7 G;  1UE6 A;  1UE5 A;  3J7Z C;  4DR5 Q;  4R1J A;  1VQH A;  1IBL Q;  3KYH C;  1FJG Q;  3E9H A;  2RCN A;  3M4Q A;  4A3F H;  2JA5 G;  1X56 A;  1P8L A;  2XGT A;  3HOY H;  2A19 A;  4GKK L;  3OW2 A;  2HHH L;  1YHQ A;  1N36 Q;  3EIV A;  2L15 A;  2KCT A;  1HH2 P;  4UP9 A;  1XNQ L;  3T1Y L;  4B3R L;  4QQB X;  1X6O A;  1G6P A;  5HGQ A;  2NVX H;  2OTJ A;  3HOV G;  2KEN A;  4C3I H;  1U0L A;  2UUC L;  2WFW A;  1SRU A;  1YI2 A;  4HIM A;  4LUO A;  5M3M G;  1QZG A;  4A3M G;  4A3E H;  1IBM Q;  2Q2H A; 
#chains in the Genus database with same CATH topology
 2E2D C;  2WAQ G;  2RDF A;  1VQA A;  1PTO F;  3TN2 A;  3CCJ A;  1UE7 A;  1PMR A;  1SNO A;  5GAG C;  2JSO A;  1WCM B;  1ZXT A;  5EQ0 A;  3KJO A;  3TZU A;  2WII B;  2EJM A;  3K81 C;  4XIG S;  2VQF L;  3B6Y A;  1AN8 A;  1Q7Y C;  3DHQ A;  4U68 A;  4DNR B;  1PZK D;  4KLK A;  2JA8 H;  4DV1 Q;  3MVV A;  4PMC A;  3HOV B;  3Q8D A;  5GAH C;  4JW0 A;  1YJN A;  1IYU A;  3CC7 A;  1QUQ A;  4IUR A;  2RCF A;  3HOW B;  2J0T D;  2E2I B;  2EQS A;  1E0B A;  2VNU D;  2Z0S A;  1C0A A;  2D5D A;  5IGG A;  1E3P A;  3D6W A;  4QL5 A;  3K7U C;  4KY6 A;  2Z1C A;  4S3S A;  4YCU A;  3J81 c;  3PO2 H;  3BU2 A;  3NUC A;  4C3H G;  4DNT B;  4L5T A;  2OQK A;  1TWC H;  3AYH B;  1PZJ D;  5ELF A;  3WWV A;  4GKK Q;  2KCC A;  3C46 A;  3QOJ A;  2WAC A;  5C0X J;  1F2Z A;  3H94 A;  1Y1W G;  4X62 L;  4AH6 A;  3D4W A;  1F2M A;  3I4N H;  2VUM B;  4YWM A;  2UXC L;  1ICW A;  4PG3 A;  4LFB L;  2PQA A;  5IGF A;  3S1Q B;  2K4K A;  1P16 A;  1Y8P B;  4OX9 L;  2K75 A;  3I4L A;  1SYB A;  2AQ1 B;  5CR3 A;  4CDC C;  3ERO A;  4A3G B;  4B9W A;  3EA6 A;  3M3Y B;  4A93 H;  4DR3 Q;  2O5J C;  1WCM H;  2RKS A;  4B9X A;  2IL8 A;  4MNO A;  1TWA H;  2VW9 A;  1VQK A;  2R92 G;  5JVH 3;  4Y52 H;  4A3J G;  1VMC A;  1U4L A;  5JJK A;  3PGZ A;  1PRT F;  3UE0 A;  4BBR G;  5E1F A;  3NWT A;  5ISR A;  4UHV A;  4R8N A;  5LMN Q;  3HKZ G;  1JWM D;  2ZM6 L;  4A3I B;  4B08 A;  2OTL A;  1U4P A;  2GA4 B;  3MWY W;  4HIO A;  1CSP A;  3HOW H;  1LO5 D;  2BA0 A;  2F0D A;  4DAY A;  2DGY A;  2E2I H;  3I91 A;  2TSS A;  5C3X A;  2KBN A;  3EBE A;  2B2T A;  4JI4 L;  4DAP A;  2F4I A;  1HTL D;  5J39 A;  1G51 A;  3RMH A;  2IX3 A;  4ZQ3 A;  4FF2 A;  2I07 B;  2ENB A;  2RDH A;  3VDY A;  2KOL A;  4HJA A;  1LM0 A;  2HIV A;  2XRQ D;  5BN3 A;  4LNQ A;  2DUD A;  3TQY A;  1I6V C;  2F0O A;  2HDM A;  3MFY A;  1X54 A;  3D6C A;  4IZ8 A;  2MHV A;  1WTR A;  2B2U A;  2IX0 A;  1KDB A;  4ZLT F;  3S9W A;  1VF7 A;  2LXJ A;  2SNM A;  4LF5 Q;  2VUM H;  3GTL B;  1H9S A;  3KBX A;  5LMU Q;  2RHS B;  2KVM A;  3U9O A;  3DWA A;  3UI2 A;  2F3I A;  3H0G H;  2JA5 B;  1K73 C;  1D5X C;  1DOK A;  1QVC A;  4NW2 A;  1F9Q A;  4DR6 Q;  1SMX A;  2Q8R E;  5T1G A;  3I73 A;  1SDF A;  2BOS A;  1E24 A;  4WRD A;  1BQQ T;  4A3G H;  4IUV A;  4J1M A;  1FL0 A;  1L0W A;  4M1U B;  5FOB B;  5IT9 c;  3M3Y H;  4YIJ A;  3HRZ C;  4DV3 Q;  2MPM A;  5M5W B;  3T1H Q;  3D3R A;  1B50 A;  3TP5 A;  3V96 A;  2E5L Q;  3KDF B;  3S1M H;  1TVX A;  3KF6 B;  1VQL A;  2CW0 D;  2R7D A;  1EU4 A;  3DWP A;  4DR1 Q;  2C35 B;  1SRO A;  1YJ9 A;  4JI0 Q;  4K5X A;  2RA4 A;  3H91 A;  1HR0 Q;  4GKJ L;  1S5E D;  4LUV A;  1SLJ A;  1EQR A;  3OOC A;  5EPJ A;  1K3B C;  3HP3 A;  2L11 A;  2B2Y A;  1D5Z C;  1VQC A;  4PZ7 A;  4KKS A;  1Q1E A;  2A6H C;  4IFD H;  3BS1 A;  5ELB A;  2PZT A;  1JB7 A;  3W2D A;  3GTG B;  3A74 A;  5EBD A;  1Q3L A;  1H9J A;  2AUK A;  1PTO D;  3PIO 3;  2JA8 G;  3RLN A;  2LS0 1;  3GQB A;  3CCM A;  3CD6 A;  1SYC A;  4AQY Q;  1BXT A;  5D14 A;  1JR0 D;  4MN3 A;  1PH7 A;  2Q2T A;  5CBE E;  5HGT A;  1XTC D;  2PW7 A;  1ENC A;  4IPD A;  1YNJ C;  3Q23 A;  4DV6 L;  3IFD A;  5FO8 B;  3WOF A;  3JAM i;  3NWS A;  1GKH A;  3K57 A;  1KRS A;  2LXK A;  1MSH A;  1FVI A;  2E75 C;  3PO2 G;  2B2V A;  1MSG A;  3HGB A;  2JA5 H;  1HNW L;  3PIP A;  1NE3 A;  1GUN A;  1B44 D;  3H6M A;  1G6Z A;  4TVA B;  4PV1 C;  2EZV A;  3OTO Q;  1F9R A;  1A63 A;  1GUS A;  3EN2 A;  4IUU A;  1A8V A;  1NR4 A;  3V05 A;  4QF4 A;  2LKV A;  1VQI A;  1V43 A;  2FIN B;  3X3M A;  2XSC A;  5DM7 3;  3I4N G;  3GP7 A;  5C3W A;  3S16 H;  2F0V A;  4JI3 L;  3G7L A;  3JC6 6;  1WTW A;  1DM0 B;  2AQ3 B;  3BZC A;  3HEJ A;  1WD0 A;  1KD1 C;  1LAB A;  1R4P B;  2UUA L;  1WTX A;  4HIK A;  1KDC A;  4PQX A;  2B2T C;  2NZO A;  5IIF A;  4DR4 Q;  1WYD A;  1WFQ A;  5FJ8 H;  2PQA B;  2NN6 H;  4EQO A;  3NEM A;  4A93 G;  3AFQ A;  4OEL B;  2K5V A;  1WCM G;  3ZJY C;  1VQN A;  3VA5 A;  2HD3 A;  2VS1 A;  4UP8 A;  1DYQ A;  1VQE A;  2X69 A;  2IX1 A;  2O5I C;  1R4Q B;  2QKI C;  1X3G A;  3GTG H;  5I9P A;  2FXQ A;  4X3S A;  1WTP A;  2WAQ E;  4ZUJ A;  4DUY Q;  3AQQ A;  1OXU A;  1SE8 A;  2B2U C;  4RFB A;  5KND A;  1WJJ A;  4DV2 Q;  3C1F A;  1HFN A;  3A8J E;  3HOW G;  2DNC A;  3PMF A;  2D2C C;  2NBF A;  4A75 A;  1JB3 A;  4HMJ A;  5K5P A;  3SHL A;  4CKB A;  1QJO A;  5M9O A;  4R4C A;  3VYR A;  2K03 A;  1Q90 A;  1MKH A;  5C6A A;  1I3Q B;  1HCZ A;  4HMI A;  3SK4 A;  2IPK D;  4DAY B;  4P74 A;  5JPN C;  2Z4H A;  5D65 A;  4B3M L;  1TS5 A;  1E1O A;  2QDL A;  1K8G A;  1X3P A;  4GS3 A;  2RDG A;  4HN7 A;  4A3E G;  2MP1 A;  1NJI C;  3UDI A;  3FPU B;  1A0I A;  1CKN A;  1EOV A;  4FF4 A;  4KHP L;  3J80 L;  4A3L H;  1LT3 D;  5CC4 A;  4YWK A;  1BCP F;  1Q8K A;  2VUM G;  1C8C A;  2QA4 A;  1FNV A;  1U4M A;  3ICE A;  3RLF A;  2AMC B;  3H0G G;  1EYC A;  4JI5 L;  3HOY B;  2C5C A;  4C1N I;  3QWN A;  2R7F A;  1KAA A;  4LFC L;  1O7Z A;  1V1P B;  4I7Z C;  4TQU S;  2KEE A;  4BA1 I;  4A3G G;  2B8F A;  5IOD A;  2B2Y C;  1FJG L;  4LF7 Q;  3FPP A;  3MHB A;  4O0A A;  5BR8 Q;  4LJZ C;  1B1Z A;  3S17 B;  3L0O A;  4A3K B;  2HT1 A;  4JI8 Q;  5I4D A;  5LMN W;  4QIW E;  4F88 A;  2WIN B;  2Y0S B;  3BYT B;  3NP8 A;  1SE4 A;  4JBM A;  1EQV A;  1TWF B;  3F2C A;  3P1H A;  4OO1 I;  3VR2 A;  3A5U A;  5L37 A;  1TII D;  3TEH B;  3ZYY X;  5FLM H;  1U9R A;  3VYT A;  4RGO S;  3W5O A;  2EYH A;  1YNN D;  3PF4 A;  2B2V C;  2DN8 A;  3CME A;  4NXM Q;  5IYB H;  4QGU A;  3O13 A;  2VZA A;  4IFD G;  1SAP A;  4N9T A;  3HKZ E;  5E7N A;  4DV1 L;  3K5M A;  1D8L A;  2EY2 A;  2Q2U A;  2BE5 D;  5FKA C;  1ET6 A;  2F0Q A;  1K9M C;  4EVO A;  1ZKO A;  5JVG 3;  3CCR A;  2FHT A;  1UWV A;  4A3D B;  3BZD B;  3OWE B;  3EQL C;  4RGT A;  1I4H A;  2A6H D;  4GKK L;  3R2I A;  2JA5 G;  4CBV A;  3HOY H;  2M00 A;  3A7A B;  1PXU A;  2KCT A;  1G6P A;  3I4M B;  4CKC A;  1LLR D;  4K2L A;  2KEC A;  2OTJ A;  1I6H B;  2HDL A;  1LAC A;  4KD4 A;  1B53 A;  2K14 A;  1GO3 E;  3AEV A;  3SK5 A;  3S17 H;  5M3F G;  4A3K H;  1YNJ D;  5IYD H;  4IOC A;  2XRS D;  3OHX C;  4DV4 Q;  3ER0 A;  1STA A;  1TWF H;  1SYE A;  1HR0 W;  1D1K A;  4JCV E;  2JA6 H;  2RSO A;  1J6Q A;  4OIJ A;  4H0L C;  4C3J B;  3OMG A;  1X3E A;  4FDB A;  2L1B A;  3I72 A;  2FMC A;  4DR3 L;  1KC8 C;  5FJ8 G;  1JJC B;  2NN6 G;  2ICE C;  2L4N A;  5M3M B;  2NVY H;  1I5F A;  2X6G A;  1GUG A;  2I5H A;  3S24 A;  1GD7 A;  1KAW A;  4NB3 A;  4TRD A;  3W1G A;  2XTI A;  4KKU A;  4HED A;  4B3S Q;  4JI7 L;  2K05 A;  3J7A V;  5JEA H;  1Y8N B;  1VF5 C;  4YCW A;  3HOX H;  3FDT A;  4GLA C;  3CMA A;  4GN5 A;  1IBL L;  4ZKB B;  1M8A A;  4MTK A;  2IWH A;  1OXV A;  1PFM A;  5GAE C;  3K7A H;  4A3D H;  1TKW B;  3RZO B;  1LT5 D;  1J8I A;  1B7Y B;  1DZ1 A;  2E74 C;  3HOZ B;  2AQ2 B;  1N9W A;  5JJZ A;  5BN4 A;  2WKC A;  4HSV A;  5IGB A;  4ZK9 B;  5C4X B;  1JWU D;  2A5H A;  3J81 L;  4GOP B;  1GXD C;  1HNX Q;  1YHA A;  1BDO A;  1CZW A;  5LL6 S;  1SFO B;  5ELC A;  3I4M H;  2N49 A;  5GRO A;  3V2T A;  1G91 A;  3I70 A;  2WKD A;  1I6H H;  1BVS A;  4N9P A;  1JMC A;  3E3X A;  1K8M A;  1O7L A;  4LF5 L;  2ASB A;  4ALP A;  4A3L G;  1RTO A;  2JEA I;  2UXB L;  5LMU L;  4JC0 A;  3DEP A;  1HXY D;  1Q46 A;  1S40 A;  4YY3 Q;  2XWJ B;  3E6Z X;  3T16 A;  2EY6 A;  3F8T A;  4DR6 L;  4H7B A;  1WVL A;  3K80 C;  1OTC A;  1CKN B;  4J6H A;  3Q0A A;  1IW7 C;  1K0R A;  1W6J A;  3CQZ B;  4C3J H;  1O7Y A;  1SSO A;  4DV3 L;  3T1H L;  1V1Q A;  1I50 H;  4RKL A;  2IW3 A;  1Q82 C;  2E5L L;  5EJW A;  2AUJ D;  2NUC A;  1B9N A;  1B3Q A;  2RQX A;  2CKZ B;  2EJG C;  1PHJ A;  1UEB A;  4GNX A;  1XYI A;  3MXG A;  4DR1 L;  4JI0 L;  3F2D A;  5C3E B;  2PPB C;  3FP9 A;  1CA5 A;  3IFT A;  1C7Y A;  4FP5 D;  1HR0 L;  4LUZ A;  2SNS A;  3TRE A;  3WDN A;  5FLM G;  1B3A A;  4E6I A;  4R8I A;  1LTL A;  3CCV A;  1PYW D;  3CRK C;  3OSO A;  4HSP A;  4IJL A;  3T4A C;  1IYV A;  2I0Q A;  3I7F A;  1R9T B;  2F52 A;  4LAA A;  4JG2 A;  1E7Z A;  2I5L X;  3HOU B;  3GO5 A;  3RZO H;  1JE4 A;  1XMQ Q;  5IYB G;  1DJR D;  1JE5 A;  4HCE A;  3NBH A;  4OGQ C;  2F03 A;  4RKB A;  5C4X H;  2Q8T A;  3QOL A;  5IWA Q;  2EYP A;  4O2D A;  4AQY L;  1SFO H;  1WTQ A;  2JJQ A;  1STE A;  1PH6 A;  4X65 Q;  4KN7 C;  2CH4 A;  5CBA E;  5IGE A;  3CP0 A;  3VYU A;  4H44 C;  4HCS A;  1NR2 A;  1UUP A;  1KNA A;  3IAY A;  2PMZ E;  2EYO A;  5EKI A;  3TS0 A;  3MXN B;  1EY7 A;  2LY7 A;  3J80 i;  5NUC A;  5A35 A;  3QJY A;  3OTO L;  4RA8 A;  3HOY G;  3CAM A;  1XXG A;  1EY0 A;  1SE2 A;  1HZC A;  4QB4 A;  2JP1 A;  3KF8 A;  3CQZ H;  1K8A C;  1PTO B;  1CQV A;  3PUV A;  1S5F D;  1HNZ Q;  1KDA A;  2A1A A;  5CV9 A;  1EU3 A;  2M9V A;  1SBB B;  2XIW A;  5IT9 L;  5IYD G;  4A3K G;  3GTJ B;  2OXP A;  3HS0 C;  3MZ5 A;  1ICF B;  1VQG A;  1I4Q A;  2ZXP A;  2L12 A;  4DV5 Q;  1LV9 A;  1VQO A;  1KXL A;  5C3E H;  1S72 A;  3H3V H;  2MO1 A;  3BG3 A;  2JA6 G;  4DR4 L;  1O80 A;  1T5X D;  4IUT A;  1LT4 D;  1SNP A;  2Z6K A;  1Q81 C;  4DK3 C;  3HG9 A;  1VQ7 A;  1QNU A;  2EYF A;  1AZP A;  2PNH A;  1R9T H;  1JIC A;  4FF1 A;  2FMM A;  4K2K A;  1H9R A;  1N8R C;  1AEX A;  1XTD A;  2EIF A;  4ZRZ A;  4NXN Q;  3EFX D;  4DUY L;  1RKN A;  4LWC A;  4DNI A;  1A3V A;  1VCI A;  1PRT C;  4DV2 L;  1Q12 A;  4NDX A;  5FLX L;  1SJH D;  2ZJQ A;  4AYB E;  5KEE A;  4IFD J;  5JEA G;  2A8V A;  4XT1 B;  4JYA L;  3URY A;  3HOX G;  3TDQ A;  4LF4 Q;  1J5E Q;  1PYB A;  1QNK A;  3SE0 A;  2F0F A;  1STG A;  3HOV H;  2HCI A;  4A3D G;  2RVL A;  5CV4 A;  3OYY A;  4IUQ A;  3U4V A;  1A15 A;  1QE6 A;  4YCV A;  1M4V A;  1XPU A;  4BXX H;  1NY4 A;  1M1K C;  5J1Z A;  5KYI A;  3PUW A;  4OHJ A;  3TME A;  1MI2 A;  1NBW A;  3M7G A;  2RF4 A;  4LMQ D;  2EYJ A;  3T13 A;  1A3U A;  3I4M G;  1SYD A;  3Q24 A;  2H1E A;  3U50 C;  1PTO H;  3PQI A;  4X3U A;  2F0N A;  5IP9 H;  1FYC A;  3I90 A;  3OWF A;  4GNX C;  3D4D A;  1PA6 A;  5A2Q L;  2QIL A;  1RD9 D;  4PMW A;  4BY7 B;  4QMG A;  4TSS A;  3PIO A;  2QF7 A;  1NCV A;  4CJ1 B;  1PRT B;  2K50 A;  1MGS A;  2CFM A;  1HQM C;  2WP8 J;  1BNZ A;  3KOJ A;  1ET9 A;  4C3J G;  4DV7 L;  4LF7 L;  3DXJ C;  3ERS X;  1JOK A;  1PDQ A;  5BR8 L;  3S1Q H;  1FNW A;  2HQE A;  4CDD C;  4GN3 B;  4IUP A;  4JI8 L;  2K04 A;  3ND9 A;  3A5Z B;  1F2Y A;  2I5M X;  2PZU A;  4K8J A;  4KI0 A;  5KYL A;  1S5D D;  1IBK Q;  2L9H A;  1HA6 A;  5C0X I;  4KTA A;  4Q0F A;  4QUC A;  1YNN C;  1B2T A;  1Z47 A;  2D0O A;  4X66 Q;  3PO3 B;  3A8K E;  3F1Z A;  1VQ9 A;  3FMC A;  1VQB A;  5JJI A;  1IW7 D;  2BE5 C;  1SYG A;  2ALY B;  1VQM A;  4KD3 A;  1CFM A;  3KLW A;  2EE1 A;  1ASZ A;  4GNX B;  2F0P A;  2B3G A;  4N8F A;  1TXY A;  1T5E A;  4NXM L;  4A3I H;  4DN4 M;  1GHK A;  2WB1 E;  1IZ6 A;  2K1B A;  5C4J B;  1MBY A;  4QUF A;  2B63 B;  1WOC A;  1E2Z A;  4H13 C;  2MGS A;  3Q6S A;  2JN4 A;  5C4X G;  3SK6 A;  1I4R A;  5IYC H;  2YYZ A;  2K32 A;  4KKT A;  2B29 A;  4C56 C;  2V4D A;  2BH2 A;  2QEX A;  1HTP A;  2N55 A;  3J81 i;  1PFN A;  3J7Y W;  1S4Z A;  3U9S A;  4HTH A;  4A3C H;  4C3I B;  5HUR A;  1HZ9 A;  2K5W A;  1EWH A;  2ICI A;  1I4G A;  3VA7 A;  1YEZ A;  1AE2 A;  3L9A X;  1C9O A;  5IGD A;  3R3O A;  4DR7 Q;  2Z6K C;  2ZT9 C;  4OWT B;  5EKK A;  3EVQ A;  3SDZ A;  4K0K Q;  1O78 A;  5KRU A;  1RL2 A;  1YIJ A;  3S14 B;  4X64 L;  2JA7 B;  4DPG A;  2I46 A;  2KA7 A;  3GTL H;  1K83 B;  3KBG A;  1LTG D;  2O4X A;  1QUQ B;  1TWH B;  3HZX A;  4LF6 Q;  4IO9 A;  4DV4 L;  1E2W A;  4MTN A;  2F0S A;  2ID0 A;  3MXU A;  4G4K A;  4OWW B;  1HJP A;  4IPC A;  2VY3 A;  2BH8 A;  1TT2 A;  3CKI B;  3ONA B;  5M5W H;  5DAU A;  5C44 B;  5CYU A;  3PO3 H;  4R4O A;  5C3E G;  1TS4 A;  4G7Z C;  1RTN A;  2Z9H A;  3N6R A;  2B2W C;  2E76 C;  1JCK B;  5C4H A;  3OIP A;  4FYD A;  2AHO B;  3QG1 A;  2MJ8 A;  5E4X A;  2KHI A;  3RNU A;  1N32 L;  1KTK A;  2XN9 C;  4ZUI A;  2F0G A;  2N8N A;  2VL6 A;  4U67 3;  5C4J H;  3F2B A;  1H95 A;  3A54 A;  2B63 H;  1Y14 B;  4B3S L;  1M90 C;  1VQ8 A;  3HKS A;  4P72 A;  3ERQ A;  1CA6 A;  2KED A;  3J7Z C;  3T53 B;  2QEJ C;  3E9H A;  2XGT A;  2A19 A;  3K58 A;  4L6T B;  4HR7 B;  1N36 Q;  3EIV A;  1XWE A;  2HCC A;  5CV8 A;  4UP9 A;  2PYK A;  1X6O A;  1EWC A;  2VB3 X;  3HOV G;  4C3I H;  1U0L A;  4K6D A;  3X3N A;  4LUO A;  1YI2 A;  1RHP A;  4KY7 A;  2K6A A;  1IBM Q;  2Q2H A;  1XNR Q;  2BDO A;  1YBY A;  4BXX G;  1NNX A;  3DM3 A;  1HNX L;  4DV0 Q;  1HPC A;  4EQN A;  1VQ5 A;  1H9M A;  1N34 Q;  3S14 H;  3GV3 A;  1PRT D;  2JA7 H;  1HRJ A;  1GVP A;  3I4O A;  2NVQ B;  1K83 H;  1DOM A;  3NK9 A;  2F0J A;  3KUP A;  5IP9 G;  3DLL A;  4TKO B;  2EXD A;  3U58 A;  1ILQ A;  4I7A A;  1EFW A;  2H5X A;  4JI1 Q;  1B4O A;  2HQL A;  4YY3 L;  1AP0 A;  1BCP C;  4YWL A;  1ASY A;  2F0L A;  4A3M B;  2M2L A;  2WAQ B;  1EUJ A;  4C1N K;  1ILP A;  3KJP A;  1AZQ A;  1V9P A;  1CT1 D;  3BVG A;  2NZH A;  3P20 A;  1B70 B;  3CPF A;  2Z6B A;  3CHB D;  1KRT A;  1GOZ A;  5COR A;  1PH2 A;  4WJ4 A;  3J7A 5;  4MIU A;  4HAE A;  3DM1 A;  1TY0 A;  2A69 C;  4BA2 I;  2G5D A;  4MZ9 A;  1H9S B;  1CHP D;  3K0X A;  3D4R A;  5C5L A;  3FKI B;  1L0X B;  1G29 1;  1KAB A;  4RCO A;  3JAM E;  2Z8L A;  3RZD B;  4K6L A;  1XMO Q;  5DLQ E;  1XMQ L;  4A3I G;  2GN5 A;  1L0Y B;  5JEA J;  4DKA C;  4KHV A;  5JOB A;  3KLS A;  1BCP B;  1IHZ A;  4UY8 C;  2LMC B;  2VXW A;  3D31 A;  4J15 A;  2TMP A;  5EPK A;  4Y7N B;  1EY4 A;  5IWA L;  1BBW A;  3BDL A;  2AWO A;  3G71 A;  1RDP D;  2EXZ A;  1Y1W B;  1N33 Q;  3EJI A;  3K0Y A;  1RIP A;  1UE1 A;  4HJ5 A;  2A74 C;  2L0C A;  1Y1V B;  2B39 A;  2NVQ H;  2VQE Q;  4OO1 H;  1D6E C;  4JPB W;  1Z7T A;  1U5K A;  3R2T A;  1I3Q H;  2JK8 A;  2N78 A;  4XQN A;  4BWG B;  1UEA B;  3TP7 A;  1UAP A;  2K33 A;  4EQ5 A;  1STY A;  2EPB A;  4K8I A;  4JI6 Q;  3TRZ A;  2D0P A;  4A3C G;  2ZJR A;  4FF3 A;  2Q8I B;  1H9K A;  4CDE C;  3NTK A;  3LWU A;  4CJ0 B;  4QIW B;  2DNE A;  3E0E A;  2F0K A;  4BBS B;  1PZI D;  1CM9 A;  1SYF A;  3I3C A;  1JT8 A;  1KLU D;  4RAU C;  3PUX A;  1IKM A;  3OIQ A;  1HNZ L;  4PZ6 A;  1GM5 A;  1MD2 D;  1YZ6 A;  2QGQ A;  2R92 B;  4ILW A;  5ELN A;  3KK7 A;  1FNU A;  1ENA A;  1ZEQ X;  3G4S A;  3AB9 A;  1CQF A;  4DV5 L;  3E9I A;  1BUV T;  1AW7 A;  3HKZ B;  4K5V A;  3H09 A;  1EY6 A;  1VDZ A;  3PO3 G;  4RWS C;  1YHB A;  4UPA A;  5DM6 3;  1XJV A;  3LNN A;  3FKI H;  3S1N B;  3T51 B;  2F0E A;  3NSW A;  2E2J B;  3A7L A;  5ELE A;  4LF8 Q;  2ZXR A;  5KGU A;  1YIT A;  4NXN L;  1PH9 A;  4B3T Q;  4XDX A;  1SN8 A;  2B63 G;  1AFP A;  5JJL A;  1YVC A;  3UE1 A;  1MHW C;  4KY5 A;  1CZG A;  3PUY A;  4LFA Q;  4ULL A;  1W6K A;  1OXS C;  3CCU A;  4OON A;  1CUK A;  2YU9 B;  3A8I E;  4LF4 L;  1Y1V H;  1J5E L;  1PH5 A;  5LMN L;  4LF9 Q;  4UDU C;  2PW5 A;  3BDO A;  3E5S A;  2R6G A;  5KNC A;  4C3I G;  2ES2 A;  4JBJ A;  2F0I A;  4RGM A;  4RCN A;  5IOC A;  4ZYS A;  2KHS A;  4KV6 A;  3VYS A;  4DU9 A;  5CGK A;  4BBS H;  4UP7 A;  3PSI A;  1VQF A;  2K01 A;  3PF5 A;  1PFS A;  1X3F A;  2JA7 G;  5I2X A;  4DK1 A;  3K59 A;  1HZA A;  3PCO B;  4Q5V A;  3DUZ A;  4L5Q A;  1D7Q A;  5AFW A;  1CSQ A;  2OF1 A;  3CC2 A;  4OIK A;  3RLO A;  1VQ4 A;  5FLX E;  1KHI A;  2UXD Q;  2JE6 I;  2RBM A;  3C1E A;  2NYZ D;  1HUN A;  4IAL A;  5IE8 A;  5J3B A;  2XNA C;  3W1B A;  3K8A A;  2IT1 A;  4NKL A;  1K8O A;  2F0T A;  2E2J H;  2F0M A;  4L8J A;  1T9H A;  2C9O A;  1S5B D;  2K5N A;  1IBK L;  5CMD A;  4P73 A;  1F9P A;  3I2Z A;  1VS0 A;  2JA8 B;  4CHT B;  5I2Y A;  2K5Q A;  3SR1 A;  2R61 A;  1BCP D;  2PNR C;  1B9M A;  1OO9 B;  2F3W A;  3NTH A;  1PH1 A;  5M3M H;  3CRL C;  1FR3 A;  1EEF D;  3I55 A;  2YU9 H;  3I8Z A;  1SMY C;  1QZH A;  4X6A H;  1PYS B;  5FO9 B;  1DD2 A;  2MQH A;  2F4V Q;  1NMG A;  4ZCK A;  4P75 A;  3F2U A;  2A69 D;  5C5M A;  3KDF A;  2EOT A;  4QJF A;  2HUG A;  4P2C B;  1G2T A;  4GN4 B;  4O1N A;  3DEO A;  2Z4I A;  1LTR D;  4KJO A;  5FK9 C;  3KF6 A;  2JQO A;  2IJ0 A;  1AH9 A;  3P75 A;  1XX8 A;  4K14 A;  1WTO A;  4OO1 G;  3HOZ H;  3W3A A;  1PFB A;  2X6L A;  3DWQ A;  1STH A;  2R93 B;  4DK6 C;  5JPM C;  2A68 C;  3G48 A;  4DR7 L;  1QCB D;  1QG7 A;  3TP6 A;  4CKE A;  4K0K L;  1LT6 D;  4N8X 1;  3RN2 A;  2EVB A;  1X9N A;  3OMC A;  1PH8 A;  2XVS A;  2ZTD A;  2NWG A;  1PV4 A;  2RHQ B;  2MUY A;  4A93 B;  3LWE A;  1SJE D;  4Z9C B;  2KHJ A;  5GQO A;  4LF6 L;  4EX5 A;  1TWA B;  4A4I A;  1VQJ A;  1FGB D;  5FO7 B;  4NP5 A;  1SR3 A;  2LSS A;  4CGY B;  3GDE A;  2EY1 A;  1ZYR D;  4JI2 Q;  3NE5 B;  1I94 Q;  2NTT A;  1ROD A;  2QCP X;  4DXF A;  3TSS A;  3GTM B;  1K0S A;  4G7H C;  2QW7 A;  5DNF A;  4BY1 B;  5EAY A;  2SDF A;  1EY9 A;  1OXX K;  3FKI G;  1PH3 A;  1KIX A;  2CVR A;  2Y0S G;  1I4P A;  3FEW X;  2FFK B;  3ND8 A;  1W3S A;  3AU7 A;  4POF A;  4A3F B;  1J9O A;  4RHS A;  3H3V I;  2N88 A;  2PMZ B;  3NBI A;  3UDF A;  4ODG A;  3SK8 A;  2ATW A;  1SEB D;  2NVX B;  1D1I A;  1LTB D;  1QVF A;  3OW7 A;  4J8Q A;  5C4Z A;  4YHH Q;  4NMZ A;  4A3E B;  1KL9 A;  1SND A;  3HOU H;  1K3R A;  1VQP A;  5TSS A;  4PZ8 A;  1N36 L;  1PLF A;  1Y1V G;  4CDF C;  5KIX A;  1EYD A;  3JAM c;  4M8A A;  1DCZ A;  3RUZ A;  5M5Y B;  1X3Q A;  4OEM B;  3BJU A;  3NEN A;  1IBM L;  2R93 H;  3TBI B;  1XNR L;  2L5T A;  3H0G B;  2DY8 A;  1BR9 A;  4DV0 L;  1DXM A;  1WTH A;  2PI2 E;  5EGT A;  3QIA A;  1N34 L;  2B2W A;  4BBS G;  1G2S A;  2EYM A;  4ME5 A;  3KLR A;  3SVM A;  3LGJ A;  2CWP A;  3SXH A;  2ZJP A;  2RSN A;  4JI1 L;  1QWY A;  1RF2 D;  4IPG A;  1MIU A;  2OT2 A;  5J22 A;  3E0J A;  1MJE A;  3CF5 A;  1BBX C;  3S1M B;  1S5C D;  2OWO A;  1CKO A;  5AJ3 Q;  3S2D B;  4IQZ A;  3GTM H;  5IGC A;  4DR2 Q;  3CW2 C;  1EIF A;  1HZB A;  4JK1 C;  4BY1 H;  3GTJ H;  4JI7 Q;  4AYB B;  2EY5 A;  3J7A F;  1VQD A;  1WI5 A;  3L3O C;  4ABN A;  1UE6 A;  1UE5 A;  2DY7 A;  4KJN A;  4DR5 Q;  4R1J A;  1IBL Q;  3C2P A;  5K36 H;  2L55 A;  4A3F H;  1X56 A;  3OW2 A;  1YHQ A;  4V0B A;  1BO0 A;  2L15 A;  1HH2 P;  4QQB X;  5HGQ A;  2NVX H;  1VMP A;  1JC7 A;  2KEN A;  2BCO A;  2WFW A;  1SRU A;  4HIM A;  1BOS A;  1D5M C;  5M3M G;  1QZG A;  4A3E H;  4QCL A;  1F9S A;  4DXG A;  1V1P A;  1XMO L;  3GTO B;  3ULP A;  4JBW A;  3QB3 A;  4JV5 Q;  3MEH A;  5M5Y H;  4DUZ Q;  5G3L F;  5I6Y A;  4HJ7 A;  2UXB Q;  3J80 E;  1EEI D;  3MXP A;  2O2L D;  1WD1 A;  2UU9 Q;  1N33 L;  4FXD A;  2NTS A;  4IJH A;  1LTI D;  5C0X H;  2NVT B;  5LHY 1;  2VQE L;  2UUB Q;  3C3L A;  2Q2I A;  4X3K A;  5GAD C;  1EY8 A;  1SMY D;  3HOZ G;  5M3F B;  4JI6 L;  1U4R A;  4EGV A;  2D9U A;  4ME3 A;  3S16 B;  1CHQ D;  4QY7 A;  1X32 A;  2GVA A;  1NAP A;  2A6E C;  1EOT A;  3S2D H;  4V19 0;  5COY A;  4IPH A;  4IFD I;  2CQO A;  2R7Z B;  4IUN A;  4DA2 A;  1HFG A;  3BZK A;  3NBH B;  3ULL A;  1D2B A;  2VB2 X;  2HHH Q;  1PH4 A;  4OXP A;  4RH6 A;  4BY7 H;  1EQQ A;  3ULJ A;  1XNQ Q;  3T1Y Q;  4B3R Q;  1JQY D;  2UUC Q;  3NQI A;  3PUZ A;  2NB0 A;  4MHE A;  1ONL A;  4CJ2 C;  1YNX A;  1EIG A;  4XTC S;  2YV5 A;  3VR6 A;  1DON A;  4F8M A;  2G9H D;  2J7Z A;  2WB1 B;  5FLX c;  3S1R B;  3GTP B;  1RCV D;  3K5L A;  2A68 D;  3FHW A;  2F0U A;  5T1I A;  3FVQ A;  1QOH A;  2PO4 A;  2JA9 A;  1JWS D;  5LL6 X;  2VQF Q;  2NZ1 D;  2CQA A;  4AIM A;  3KF8 B;  2GVB A;  3NTI A;  4FXK C;  1CI3 M;  1CK1 A;  2V1C C;  3TP8 A;  4LF8 L;  1SNC A;  3GTO H;  4KK7 A;  3CXC A;  3VR3 A;  5E4W C;  5I9O A;  1FD7 D;  1Q1B A;  2CH4 W;  3CU7 A;  4B3T L;  1KNE A;  3BVM A;  3BDC A;  2JEB I;  3K6O A;  1F77 A;  1E22 A;  4RMF A;  1AE3 A;  4A3B B;  4LFA L;  3RN5 A;  2G9D A;  3A0J A;  1XPO A;  3RR5 A;  2NVT H;  3HOU G;  4DGZ A;  5BN5 A;  4LF9 L;  3A56 A;  3LX0 A;  5ELO A;  4ZAI A;  2K5H A;  4I65 A;  4KMU C;  5M3F H;  4JBK A;  2MFI A;  1Z9F A;  2NN6 I;  2F0H A;  3J81 j;  3IL8 A;  1E2V A;  2R93 G;  2E8G A;  4FNF A;  1A62 A;  4WJ3 M;  4UAI A;  2MO0 A;  1STB A;  2P5Z X;  4X62 Q;  1EZ8 A;  4RHR A;  4XYQ A;  2R7Z H;  4JVZ A;  5M5X B;  1I4X A;  1V1O A;  2PZW A;  1GUT A;  1IXR A;  1ENF A;  2UXC Q;  1KLG D;  4LFB Q;  1LTT D;  2PQE A;  1B8A A;  1IL8 A;  4OX9 Q;  1LTS D;  2N3S A;  1A2U A;  4BS9 A;  3D0F A;  3S2H B;  1EIY B;  2UXD L;  3BVZ A;  3S1R H;  3GTP H;  4RGN A;  1LTA D;  2HIX A;  2JXM B;  3S15 B;  2WV6 D;  1BBU A;  1TWH H;  2AWN A;  1A6X A;  4JOI A;  4OL7 A;  3M9B A;  3PV0 A;  4BY1 G;  2E2H B;  4IN3 A;  1NTG A;  3M4Y A;  4DAV A;  3VR5 A;  2OEO A;  4GOP A;  2FJ2 A;  4JYA Q;  1Y8O B;  3PIP 3;  1PVO A;  5K36 G;  5CV6 A;  2J4X A;  2DJF C;  1EQT A;  1L1O A;  1S3O A;  5C44 H;  2YTV A;  2ZM6 Q;  4A3F G;  1G8Z D;  2IHE A;  1LYL A;  1DOL A;  1Y69 U;  3FRP B;  2LFN A;  2A73 B;  4A3B H;  1BKB A;  1OXT A;  3VR4 A;  2BDN A;  4OWX B;  1KQS A;  1C4Q A;  1YJW A;  4JI4 Q;  2IHF A;  3L7Z C;  3STB C;  1XPR A;  4F7X A;  5E3F A;  2R3Z A;  3MFG A;  2Y0S E;  3J81 E;  3KLS X;  5EKL A;  2F4V L;  4ID6 A;  1SNM A;  1JJ2 A;  2CCZ A;  1FGU A;  1GUO A;  3CCL A;  4IOA A;  4A76 A;  3H15 A;  1CTM A;  4POG A;  4FXG C;  5IY0 A;  4LW1 A;  1UNS A;  4G7O C;  1A2T A;  4DF7 A;  2ZTE A;  3OPO A;  3KFU A;  2YTY A;  2IY5 B;  4HJ8 A;  2DJG C;  2KUM A;  5M5X H;  3K5O A;  3TS2 A;  2SEB D;  1QIL A;  2SOB A;  5C0X G;  4L5R C;  3N52 A;  1STN A;  1HUM A;  4C3H B;  2F1M A;  1IYJ B;  2F0W A;  4DV7 Q;  3CCE A;  5G3L D;  1QB5 D;  1LUZ A;  4GLV B;  3M85 A;  4R4I A;  3S2H H;  4R4T A;  5IYC G;  3T56 B;  5IP7 H;  4X65 L;  4ZKC B;  2K28 A;  3MTS A;  1EYG A;  3IKJ A;  4X3T A;  3UDX A;  1DGS A;  3S15 H;  2ZTC A;  2MNA A;  1Q8I A;  2JA6 B;  4C2M B;  1VQ6 A;  1HHV A;  4DAM A;  1NSN S;  5H1S E;  4DFA A;  1ZYR C;  2B8G A;  2E2H H;  4AYB G;  3AMU A;  3CC4 A;  4BY7 G;  3GTQ B;  4FO2 A;  2NVY B;  4A3M H;  4L5S A;  2QDB A;  5EBC A;  5F2D A;  2YTX A;  1ML0 D;  4JI2 L;  4KN4 C;  1I94 L;  3M4O B;  4GKJ Q;  3D8G A;  3TZD A;  2A6E D;  1ESR A;  3MXN A;  1EWI A;  4RG1 A;  4A3J B;  3QO2 A;  2H4O A;  3HOX B;  2F3V A;  4BBR B;  1IL2 A;  1GUW A;  1QVG A;  3K7A B;  3K5N A;  1X65 A;  1X55 A;  1EIH A;  3RD4 A;  1Z6H A;  3U4Z A;  3NEL A;  1GHJ A;  3HFZ B;  1Q86 C;  4YHH L;  1JOO A;  1EFI D;  3RZD H;  5D3D A;  4R4Q A;  4DV6 Q;  4APV A;  4GLX A;  1C48 A;  5D3I B;  2D62 A;  4X64 Q;  3GV6 A;  4KHZ A;  4C3H H;  3NXW A;  1TWG B;  1L2F A;  4H02 A;  4R9W A;  4G57 A;  4Y7N H;  1SNQ A;  2KQ3 A;  1HNW Q;  4P71 A;  1ESF A;  3GTK B;  1Y1W H;  1TS3 A;  3MC0 B;  1HQR D;  4XYO A;  3J80 c;  1IKL A;  4JOI C;  1JJG A;  5IT9 E;  2BA1 A;  3SGI A;  1JOR A;  1V8Q A;  2R7Z G;  4GOP C;  2OQ0 A;  4LK1 C;  4HID A;  4C2M H;  3ITP A;  1GJX A;  5CV5 A;  5JAV A;  2KJX A;  1L1O C;  1I50 B;  4JI3 Q;  3GTQ H;  2OCE A;  3UDG A;  4FVM A;  4K5W A;  3GD7 A;  3WOE A;  3NHH A;  3Q22 A;  1N32 Q;  5AJ3 L;  2UUA Q;  3A55 A;  2WB1 G;  3M4O H;  4DR2 L;  3IRB A;  4DK0 A;  4XXE A;  4F87 A;  4PNY A;  4XT3 B;  2R92 H;  3SEB A;  4A3J H;  4DR5 L;  4BBR H;  2PI2 A;  3MA2 B;  1W2B A;  3P7J A;  2K52 A;  3BYY B;  4O42 A;  4WFN 3;  1TR5 A;  3G6E A;  4GZY C;  5C44 G;  1EYA A;  4WOR A;  2EDG A;  3S1N H;  1NUC A;  4A3B G;  1SE3 A;  1TS2 A;  2ZXO A;  3NQT A;  1NMF A;  3M4P A;  4NPS A;  5KNB A;  3H3V C;  1II3 A;  2XWB B;  1O7I A;  1L1O B;  2K7V A;  1TWG H;  4X66 L;  4JV5 L;  5I6W A;  4DUZ L;  3DMU A;  1TU2 B;  3MEF A;  5CV7 A;  3GTK H;  3L2P A;  4B3M Q;  5DEH A;  3JAM L;  1CKM A;  2PCF B;  4EQP A;  3I56 A;  1MJC A;  5HY6 A;  2UU9 L;  5A2Q E;  3CCS A;  1E1T A;  3M7N A;  1TQO A;  2UUB L;  4KHP Q;  3AFP A;  2CHB D;  4XQQ A;  2CWA A;  1EZ6 A;  3MAQ A;  2K5D A;  2KCN A;  2CW0 C;  4L63 B;  1TY2 A;  3CPW A;  3STB D;  3CCQ A;  4HJ9 A;  1A3T A;  1BF4 A;  3PO2 B;  3R93 A;  2AKW B;  1TWC B;  3NPP A;  2EYL A;  5EPL A;  4JI5 Q;  1K28 A;  3QR8 A;  4LFC Q;  1SXT A;  2KCM A;  5IP7 G;  4WJW A;  1VQH A;  4XQJ A;  3KYH C;  1EL0 A;  1FJG Q;  3I4N B;  2RCN A;  3M4Q A;  3G6J B;  3R8B A;  1P8L A;  2JYO A;  2HHH L;  5ELD A;  1F2L A;  4PMB A;  1XNQ L;  2EJF C;  3T1Y L;  4B3R L;  1JOQ A;  1PTO C;  1RJT A;  2UUC L;  1WTV A;  1HA5 A;  4A3M G;  1EY5 A; 
#chains in the Genus database with same CATH homology
 1XNR Q;  2K14 A;  2WAQ G;  1GO3 E;  1YBY A;  3AEV A;  1VQA A;  3CCJ A;  4BXX G;  3S17 H;  3DM3 A;  1HNX L;  5M3F G;  4DV0 Q;  4A3K H;  5IYD H;  1UE7 A;  4IOC A;  1VQ5 A;  1XMO L;  5GAG C;  4DV4 Q;  1N34 Q;  3S14 H;  3ULP A;  4JBW A;  4JV5 Q;  2JA7 H;  1GVP A;  5M5Y H;  3KJO A;  4DUZ Q;  3I4O A;  3ER0 A;  1K83 H;  4HJ7 A;  2UXB Q;  3K81 C;  4XIG S;  1TWF H;  5IP9 G;  3DLL A;  2VQF L;  1HR0 W;  2EXD A;  4JCV E;  3U58 A;  3B6Y A;  1Q7Y C;  2JA6 H;  1J6Q A;  1EFW A;  2H5X A;  1X3E A;  4FDB A;  2UU9 Q;  1N33 L;  4JI1 Q;  4DR3 L;  4KLK A;  2JA8 H;  2HQL A;  4YY3 L;  4DV1 Q;  4IJH A;  1KC8 C;  5FJ8 G;  3Q8D A;  1JJC B;  5GAH C;  2VQE L;  2NN6 G;  1YJN A;  2UUB Q;  4YWL A;  1ASY A;  3CC7 A;  1QUQ A;  2NVY H;  1I5F A;  2Q2I A;  5GAD C;  3S24 A;  2I5H A;  1EUJ A;  3HOZ G;  2EQS A;  3KJP A;  1V9P A;  1GD7 A;  1KAW A;  2Z0S A;  4NB3 A;  3W1G A;  4JI6 L;  1C0A A;  2VNU D;  4ME3 A;  2XTI A;  2NZH A;  4QY7 A;  1E3P A;  2GVA A;  1B70 B;  3CPF A;  4B3S Q;  4QL5 A;  3K7U C;  4YCU A;  1KRT A;  3S2D H;  1PH2 A;  3J81 c;  4JI7 L;  4WJ4 A;  4IPH A;  3PO2 H;  3BU2 A;  3J7A 5;  4IFD I;  2CQO A;  4YCW A;  4L5T A;  3BZK A;  2OQK A;  1TWC H;  3NBH B;  3AYH B;  4GLA C;  3WWV A;  3HOX H;  3ULL A;  4MZ9 A;  3CMA A;  4GN5 A;  1IBL L;  4BA2 I;  4GKK Q;  2HHH Q;  5C0X J;  1PH4 A;  4OXP A;  1OXV A;  5GAE C;  4BY7 H;  3K7A H;  1Y1W G;  1EQQ A;  3ULJ A;  1XNQ Q;  4X62 L;  3T1Y Q;  3K0X A;  4A3D H;  4B3R Q;  4AH6 A;  1B7Y B;  2UUC Q;  3PUZ A;  1N9W A;  3I4N H;  1YNX A;  1G29 1;  4XTC S;  2YV5 A;  4YWM A;  5FLX c;  2UXC L;  4GOP B;  4PG3 A;  1YHA A;  1HNX Q;  2PQA A;  4LFB L;  3FHW A;  3I4M H;  2N49 A;  1XMO Q;  2K4K A;  5DLQ E;  1P16 A;  5GRO A;  1XMQ L;  4A3I G;  2GN5 A;  2K75 A;  5JEA J;  4DKA C;  4OX9 L;  1I6H H;  1BVS A;  4UY8 C;  2JA9 A;  3D31 A;  1JMC A;  4J15 A;  4LF5 L;  2VQF Q;  2ASB A;  4ALP A;  4A3L G;  2JEA I;  5IWA L;  4AIM A;  2UXB L;  1BBW A;  5LMU L;  2AWO A;  2GVB A;  3KF8 B;  4JC0 A;  3G71 A;  1Q46 A;  2V1C C;  4LF8 L;  1N33 Q;  1S40 A;  3GTO H;  4DR3 Q;  4A93 H;  1RIP A;  4YY3 Q;  1WCM H;  1UE1 A;  4HJ5 A;  3CXC A;  4MNO A;  3F8T A;  2NVQ H;  2VQE Q;  1Q1B A;  1TWA H;  4B3T L;  4DR6 L;  3K80 C;  1U5K A;  2VW9 A;  1I3Q H;  1OTC A;  1VQK A;  1CKN B;  2JEB I;  2JK8 A;  1E22 A;  4RMF A;  4A3J G;  2N78 A;  4Y52 H;  1AE3 A;  1K0R A;  4C3J H;  5JJK A;  3PGZ A;  4LFA L;  4EQ5 A;  3UE0 A;  4A3C G;  4BBR G;  3RN5 A;  4JI6 Q;  4DV3 L;  2D0P A;  3TRZ A;  3T1H L;  1V1Q A;  5LMN Q;  3A0J A;  2ZJR A;  3HKZ G;  2ZM6 L;  1XPO A;  1I50 H;  3RR5 A;  2OTL A;  2NVT H;  1Q82 C;  3HOU G;  2E5L L;  4LF9 L;  3E0E A;  4HIO A;  1CSP A;  3HOW H;  5ELO A;  2BA0 A;  2CKZ B;  2K5H A;  2DGY A;  2E2I H;  1PHJ A;  1UEB A;  4GNX A;  5M3F H;  4JBK A;  1JT8 A;  2MFI A;  3PUX A;  2KBN A;  3EBE A;  1Z9F A;  2NN6 I;  4JI4 L;  3J81 j;  4DR1 L;  1HNZ L;  4JI0 L;  3F2D A;  2R93 G;  2E8G A;  4PZ6 A;  1G51 A;  1A62 A;  3FP9 A;  4WJ3 M;  1GM5 A;  1C7Y A;  2MO0 A;  1HR0 L;  2QGQ A;  1YZ6 A;  4LUZ A;  3TRE A;  4X62 Q;  5FLM G;  5ELN A;  2R7Z H;  3VDY A;  1LTL A;  3CCV A;  4HJA A;  3G4S A;  4IJL A;  1LM0 A;  2I0Q A;  2HIV A;  4DV5 L;  3E9I A;  3I7F A;  4LNQ A;  2F52 A;  2DUD A;  1IXR A;  3TQY A;  2UXC Q;  4JG2 A;  1E7Z A;  2I5L X;  4LFB Q;  1X54 A;  3GO5 A;  3RZO H;  1B8A A;  3PO3 G;  1XMQ Q;  1YHB A;  4UPA A;  5IYB G;  1XJV A;  4OX9 Q;  2IX0 A;  2N3S A;  1JE5 A;  3D0F A;  3FKI H;  1EIY B;  2UXD L;  2LXJ A;  2VUM H;  4LF5 Q;  3S1R H;  5C4X H;  3GTP H;  5IWA Q;  2HIX A;  4AQY L;  4O2D A;  5LMU Q;  2RHS B;  1SFO H;  2JJQ A;  2F3I A;  3H0G H;  4LF8 Q;  1K73 C;  1PH6 A;  1BBU A;  1TWH H;  2AWN A;  1YIT A;  4X65 Q;  4NXN L;  1QVC A;  4JOI A;  1PH9 A;  3CP0 A;  4DR6 Q;  1SMX A;  3M9B A;  1SN8 A;  3PV0 A;  4BY1 G;  4B3T Q;  1NTG A;  2B63 G;  1E24 A;  4A3G H;  5JJL A;  1FL0 A;  1YVC A;  1L0W A;  3UE1 A;  4GOP A;  2PMZ E;  4JYA Q;  3PUY A;  4LFA Q;  5IT9 c;  3TS0 A;  3M3Y H;  3MXN B;  1PVO A;  1OXS C;  3CCU A;  4DV3 Q;  5K36 G;  3T1H Q;  4OON A;  3J80 i;  1CUK A;  1L1O A;  1S3O A;  5C44 H;  2YTV A;  2ZM6 Q;  4LF4 L;  1Y1V H;  4A3F G;  3OTO L;  1J5E L;  3HOY G;  3CAM A;  2E5L Q;  2IHE A;  1PH5 A;  5LMN L;  1LYL A;  1HZC A;  3KDF B;  4LF9 Q;  3S1M H;  4A3B H;  1BKB A;  3CQZ H;  3KF6 B;  1OXT A;  1K8A C;  2R6G A;  1VQL A;  4OWX B;  2ES2 A;  3PUV A;  4JBJ A;  2R7D A;  1KQS A;  1YJW A;  4JI4 Q;  2IHF A;  3L7Z C;  3STB C;  4DR1 Q;  2C35 B;  1XPR A;  1HNZ Q;  1SRO A;  1YJ9 A;  4JI0 Q;  2A1A A;  2Y0S E;  1HR0 Q;  4GKJ L;  5IYD G;  4A3K G;  2F4V L;  1JJ2 A;  2CCZ A;  4BBS H;  1FGU A;  4LUV A;  4UP7 A;  1SLJ A;  3PSI A;  3CCL A;  4IOA A;  1EQR A;  1VQF A;  1VQG A;  3H15 A;  4A76 A;  3PF5 A;  1PFS A;  1X3F A;  4POG A;  2JA7 G;  5IY0 A;  4DV5 Q;  1HZA A;  1VQC A;  4LW1 A;  4PZ7 A;  3PCO B;  1VQO A;  1KXL A;  1Q1E A;  5C3E H;  1S72 A;  3H3V H;  4L5Q A;  1D7Q A;  2ZTE A;  2MO1 A;  2JA6 G;  4DR4 L;  1JB7 A;  2YTY A;  3KFU A;  3A74 A;  1CSQ A;  2R92 G;  2IY5 B;  4HJ8 A;  2Z6K A;  1Q81 C;  4DK3 C;  5M5X H;  3CC2 A;  2JA8 G;  3RLN A;  3RLO A;  1VQ7 A;  1VQ4 A;  3TS2 A;  3CCM A;  5C0X G;  1KHI A;  4L5R C;  2UXD Q;  2JE6 I;  2PNH A;  1R9T H;  3CD6 A;  1IYJ B;  4DV7 Q;  4AQY Q;  3CCE A;  1PH7 A;  2Q2T A;  5IE8 A;  5J3B A;  1N8R C;  1LUZ A;  1XTD A;  2EIF A;  4GLV B;  4NXN Q;  4IPD A;  3M85 A;  3W1B A;  3K8A A;  4R4I A;  4DUY L;  2IT1 A;  4DV6 L;  3S2H H;  4R4T A;  5IYC G;  3JAM i;  4LWC A;  4DNI A;  5IP7 H;  4X65 L;  1GKH A;  1VCI A;  4DV2 L;  1Q12 A;  1EYG A;  1KRS A;  2E2J H;  2LXK A;  2ZJQ A;  4AYB E;  3UDX A;  1FVI A;  1DGS A;  3S15 H;  4IFD J;  2ZTC A;  5JEA G;  2A8V A;  2JA5 H;  2MNA A;  1T9H A;  3PIP A;  3PO2 G;  1NE3 A;  1HNW L;  2K5N A;  1IBK L;  4JYA L;  4P73 A;  3I2Z A;  3HOX G;  1VQ6 A;  4TVA B;  4LF4 Q;  1J5E Q;  1PYB A;  1VS0 A;  4DAM A;  5H1S E;  3OTO Q;  1A63 A;  2E2H H;  4AYB G;  3HOV H;  3EN2 A;  3CC4 A;  4BY7 G;  1A8V A;  4A3D G;  3OYY A;  3U4V A;  1PH1 A;  4YCV A;  5M3M H;  4A3M H;  4L5S A;  1XPU A;  1VQI A;  1V43 A;  4BXX H;  3I55 A;  2YU9 H;  1QZH A;  1NY4 A;  4X6A H;  1M1K C;  2YTX A;  1PYS B;  3I4N G;  4JI2 L;  1I94 L;  3PUW A;  3S16 H;  1NBW A;  4GKJ Q;  2RF4 A;  4JI3 L;  2MQH A;  2F4V Q;  3I4M G;  1NMG A;  3JC6 6;  3U50 C;  1EWI A;  4RG1 A;  5IP9 H;  3BZC A;  1KD1 C;  2UUA L;  4P75 A;  4GNX C;  4HIK A;  3KDF A;  4QJF A;  1PA6 A;  1IL2 A;  2NZO A;  4GN4 B;  4DR4 Q;  1WYD A;  1WFQ A;  5FJ8 H;  4PMW A;  3KF6 A;  2PQA B;  1QVG A;  1X65 A;  3NEM A;  2JQO A;  4A93 G;  3AFQ A;  1X55 A;  2K5V A;  3PIO A;  1WCM G;  3ZJY C;  1VQN A;  1AH9 A;  2VS1 A;  3U4Z A;  4OO1 G;  4UP8 A;  2K50 A;  3HOZ H;  2CFM A;  2WP8 J;  1VQE A;  3KOJ A;  3NEL A;  3HFZ B;  1Q86 C;  2IX1 A;  4YHH L;  1X3G A;  3GTG H;  2FXQ A;  4DV7 L;  4LF7 L;  2WAQ E;  3ERS X;  4DK6 C;  3RZD H;  5BR8 L;  3S1Q H;  4R4Q A;  4DUY Q;  3AQQ A;  1OXU A;  4APV A;  4DV6 Q;  4GLX A;  1SE8 A;  3G48 A;  4DR7 L;  2D62 A;  4X64 Q;  4GN3 B;  4KHZ A;  4C3H H;  4K0K L;  3RN2 A;  4JI8 L;  1WJJ A;  4DV2 Q;  1X9N A;  3HOW G;  1PH8 A;  1L2F A;  4H02 A;  4Y7N H;  3A5Z B;  2I5M X;  4KI0 A;  4A75 A;  2ZTD A;  1HNW Q;  4P71 A;  1IBK Q;  5C0X I;  1PV4 A;  2RHQ B;  1Y1W H;  3J80 c;  1Z47 A;  2D0O A;  2KHJ A;  4R4C A;  4X66 Q;  3F1Z A;  5GQO A;  1VQ9 A;  4JOI C;  4LF6 L;  4EX5 A;  1JJG A;  2BA1 A;  4A4I A;  1VQJ A;  1MKH A;  3SGI A;  1VQB A;  5JJI A;  1SR3 A;  1VQM A;  2LSS A;  2R7Z G;  2ALY B;  4GOP C;  4DAY B;  2OQ0 A;  4P74 A;  3KLW A;  4HID A;  1ASZ A;  4C2M H;  4GNX B;  3GDE A;  4B3M L;  4JI2 Q;  1I94 Q;  2B3G A;  1E1O A;  1TXY A;  4NXM L;  1K8G A;  1L1O C;  4A3I H;  4GS3 A;  4A3E G;  4JI3 Q;  3GTQ H;  2OCE A;  2WB1 E;  1IZ6 A;  3UDG A;  3UDI A;  1NJI C;  3GD7 A;  1A0I A;  1CKN A;  1EOV A;  5EAY A;  4KHP L;  1WOC A;  4A3L H;  1OXX K;  1N32 Q;  3FKI G;  5AJ3 L;  2UUA Q;  4YWK A;  1PH3 A;  1Q8K A;  1KIX A;  2VUM G;  2WB1 G;  5C4X G;  2Y0S G;  3M4O H;  5IYC H;  2QA4 A;  4DR2 L;  2YYZ A;  3IRB A;  3ICE A;  3RLF A;  2B29 A;  1W3S A;  4POF A;  2AMC B;  3H0G G;  4JI5 L;  2BH2 A;  2QEX A;  3H3V I;  3J81 i;  3UDF A;  2R92 H;  2R7F A;  4LFC L;  4A3J H;  2ATW A;  4TQU S;  4BA1 I;  1QVF A;  4A3G G;  4DR5 L;  4A3C H;  4BBR H;  2PI2 A;  1W2B A;  1HZ9 A;  4YHH Q;  1FJG L;  2K52 A;  4LF7 Q;  1KL9 A;  3HOU H;  1YEZ A;  1K3R A;  4O0A A;  5BR8 Q;  3G6E A;  1VQP A;  5C44 G;  4PZ8 A;  1N36 L;  1AE2 A;  1C9O A;  3L0O A;  1Y1V G;  4DR7 Q;  2Z6K C;  4OWT B;  4K0K Q;  2HT1 A;  4JI8 Q;  3JAM c;  3S1N H;  1YIJ A;  1RL2 A;  5LMN W;  4X64 L;  4QIW E;  4DPG A;  4A3B G;  3GTL H;  1NMF A;  3BJU A;  3NEN A;  3M4P A;  4NPS A;  1IBM L;  4JBM A;  2R93 H;  3F2C A;  1XNR L;  1QUQ B;  4OO1 I;  3A5U A;  4DV0 L;  1O7I A;  1L1O B;  2PI2 E;  4LF6 Q;  3TEH B;  5FLM H;  4IO9 A;  4DV4 L;  1N34 L;  1TWG H;  4X66 L;  4MTN A;  4JV5 L;  4BBS G;  4DUZ L;  3MEF A;  3W5O A;  2ID0 A;  4OWW B;  1HJP A;  4IPC A;  3PF4 A;  3LGJ A;  2CWP A;  2BH8 A;  2VY3 A;  3GTK H;  3L2P A;  4B3M Q;  3CME A;  1CKM A;  3I56 A;  5M5W H;  4NXM Q;  2ZJP A;  1MJC A;  3PO3 H;  5HY6 A;  4R4O A;  5C3E G;  5IYB H;  2UU9 L;  4JI1 L;  4QGU A;  3CCS A;  2VZA A;  4IFD G;  4IPG A;  3HKZ E;  5E7N A;  1MIU A;  4DV1 L;  1E1T A;  3M7N A;  1D8L A;  2Q2U A;  1MJE A;  3CF5 A;  2UUB L;  4KHP Q;  3AFP A;  2OWO A;  2CWA A;  1CKO A;  1K9M C;  5AJ3 Q;  2AHO B;  3CPW A;  3CCQ A;  3STB D;  4HJ9 A;  2KHI A;  3RNU A;  1N32 L;  3GTM H;  4DR2 Q;  2AKW B;  3CCR A;  3CW2 C;  2N8N A;  1UWV A;  2VL6 A;  1HZB A;  1EIF A;  5C4J H;  3F2B A;  4JI5 Q;  4BY1 H;  1H95 A;  2B63 H;  3GTJ H;  4JI7 Q;  1Y14 B;  4B3S L;  1M90 C;  1VQ8 A;  4LFC Q;  3HKS A;  4P72 A;  1VQD A;  1WI5 A;  2KCM A;  5IP7 G;  1UE6 A;  1UE5 A;  3J7Z C;  4DR5 Q;  4R1J A;  1VQH A;  1IBL Q;  3KYH C;  1FJG Q;  3E9H A;  2RCN A;  3M4Q A;  4A3F H;  2JA5 G;  1X56 A;  1P8L A;  2XGT A;  3HOY H;  2A19 A;  4GKK L;  3OW2 A;  2HHH L;  1YHQ A;  1N36 Q;  3EIV A;  2L15 A;  2KCT A;  1HH2 P;  4UP9 A;  1XNQ L;  3T1Y L;  4B3R L;  4QQB X;  1X6O A;  1G6P A;  5HGQ A;  2NVX H;  2OTJ A;  3HOV G;  2KEN A;  4C3I H;  1U0L A;  2UUC L;  2WFW A;  1SRU A;  1YI2 A;  4HIM A;  4LUO A;  5M3M G;  1QZG A;  4A3M G;  4A3E H;  1IBM Q;  2Q2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...