3S1RH

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 24
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1rH00
4GNXC 4IPCA 2VY3A 5JEAJ 3ULLA 5AJ3L 3A5UA 4QJFA 4DV2L 4DR3Q 3GO5A 1PA6A 2KHIA 3K8AA 1VQHA 5IP7G 2K5VA 2F3IA 2MQHA 3PO3H 4QL5A 3CC7A 3BZCA 3I56A 2I5HA 2UUBL 3CW2C 2VUMH 4KHPQ 4PZ7A 4LF7L 1I5FA 2HQLA 3CCRA 3CCVA 1PH5A 5C44H 4A3KH 4L5RC 1KL9A 5M3MH 1YHBA 3HOWG 4TVAB 3HOXH 2VQFL 4X64Q 4A3EG 1KC8C 1NJIC 2C35B 3CC4A 2JA8H 1NTGA 3AFQA 4R4IA 1EFWA 1Q8KA 1XPRA 2Q2TA 4AIMA 4A76A 2IHFA 4BA2I 1I6HH 1YJWA 4A3IG 2JA5H 1VQ7A 1MJCA 1JJ2A 4LFAL 1KXLA 2IX0A 1PYSB 1VQAA 3BZKA 4BY1G 3J81j 3PGZA 2I5LX 3AYHB 3JAMi 1YIJA 2UU9Q 2NVQH 5E7NA 2KCTA 2JEBI 1RIPA 1E1TA 2ZTDA 3JC66 3ULPA 2BA0A 5FLMG 2ZJPA 3M4QA 2JA7H 1HR0Q 4X66L 3I4NG 4AQYL 4A3GH 2UXBL 1PVOA 4A3BG 1GD7A 1YNXA 1XNRQ 2A1AA 1QZHA 1VQPA 1L1OB 3EBEA 2Q2HA 4X65Q 1K0RA 4DV3L 1Y1WG 2QA4A 2JA6H 3GTJH 2WB1E 2UUCQ 1JJCB 5BR8L 3NELA 1YHAA 4KI0A 1VQ4A 1PHJA 1CSPA 3M9BA 4NXNL 1GM5A 1WCMG 2PI2A 2JE6I 3U58A 5DLQE 2OWOA 2NVXH 4C3IH 3CC2A 4JI2L 1JJGA 4K0KL 4NXML 4UPAA 4DUZQ 2WAQG 1N34Q 3W1BA 1PH4A 1YI2A 4MNOA 1AE2A 1Q12A 4YWLA 4JBJA 5GADC 4LF6Q 3HOUG 2CWAA 4JI1Q 1YEZA 1E24A 3IRBA 4POGA 2N49A 3D31A 1Z9FA 2UUAL 2L15A 4JI3L 2EXDA 4DV7L 1VQ6A 1WFQA 1K3RA 3EN2A 4JI6L 3PF4A 1K8GA 3KJPA 2DUDA 1N32L 1TWHH 4OXPA 4HJAA 1KD1C 2ASBA 1HZBA 1LUZA 5BR8Q 2Q2IA 1HNWQ 2A19A 1IBKQ 3J7ZC 2GN5A 3OW2A 4BBSG 1VQNA 1SR3A 4LFBQ 3AQQA 3MEFA 4K0KQ 1VQIA 1V43A 1D8LA 1XTDA 4O2DA 4GOPC 3S2HH 1VQLA 3CAMA 5GQOA 1VQ8A 3M7NA 4JC0A 2CKZB 2YYZA 1QVCA 3J81c 4A3JG 2ZTCA 2E5LL 4BY7G 3KOJA 2IT1A 2FXQA 1MJEA 1WI5A 2UXDQ 4OX9L 3GD7A 3PCOB 2ZJQA 4DV0L 4MTNA 4GLVB 1RL2A 2BA1A 1J6QA 4JOIC 4P75A 2YU9H 4JI6Q 2GVBA 4YWKA 3CCJA 4DR3L 1KHIA 2AKWB 3BU2A 1G51A 3TREA 4IJHA 3CCQA 1P16A 1I94Q 4JV5Q 2CFMA 1C7YA 2RHQB 3WWVA 3VDYA 3OTOL 5C4JH 2PI2E 3S24A 2K5HA 2R7DA 4LUVA 5IYCG 1PH2A 4A75A 1KIXA 4KHPL 5JJKA 3KYHC 5C4XG 1EQQA 4A3FG 4DR7Q 4X62Q 1NY4A 1OXVA 2NZOA 2K4KA 2R6GA 4JBWA 4A3IH 2ES2A 1E22A 5H1SE 1I3QH 4BY1H 2MO1A 2QEXA 1WJJA 3HOZG 2E5LQ 2N8NA 3CCEA 4JYAQ 4X64L 3ZJYC 1HNXQ 4DV6L 2Z6KA 2PQAA 3CPFA 5FLMH 1PH8A 2D62A 2YTYA 3G4SA 1JMCA 1PFSA 4HJ7A 2VQEL 3K7AH 1HZAA 2PQAB 3K7UC 3U4ZA 2R7ZG 2WAQE 4OO1I 4GNXA 2F4VQ 1BKBA 3STBD 2IX1A 4DV0Q 4C3HH 4GNXB 3GDEA 2JEAI 2LXJA 3T1YQ 2UU9L 2UXCQ 2RHSB 1N33L 4BXXG 4QY7A 1EQRA 4OWXB 1UE6A 3OTOQ 3Q8DA 1YJ9A 3GTOH 2AHOB 4YHHL 1HR0L 1FJGL 4HIOA 3I4MG 3A74A 5JEAG 1VQJA 4L5TA 3F2CA 4GN3B 1XNRL 2OTLA 3ERSX 1K73C 2VL6A 2D0OA 4X65L 3EIVA 2Y0SG 1VQEA 5ELNA 3FKIG 5C0XJ 1EIFA 1XJVA 3J81i 4DV6Q 4QQBX 3LGJA 1XPUA 1X3EA 1IZ6A 4YCUA 2UUCL 3HOUH 4IOAA 2VQEQ 5IP9G 3AFPA 4UP8A 3CPWA 1YJNA 1YBYA 4LFCL 3PIPA 4DR4Q 1IYJB 1SMXA 3OYYA 1AH9A 1S3OA 1P8LA 2AWOA 4R4QA 4DUZL 1N34L 5GAGC 3PIOA 1Y1VH 1N33Q 3S1QH 4OWTB 3UDFA 3UDIA 4A93G 4WJ4A 4LF6L 4X6AH 1X55A 4Y52H 4YHHQ 3PSIA 4JI1L 5LMUL 1FJGQ 1SLJA 1L1OA 4XTCS 1MKHA 4A3DG 3K80C 1VQBA 4ALPA 2E2IH 4JBMA 4GKJL 2MNAA 2RF4A 4BBRH 4HJ5A 1IL2A 4IO9A 2EQSA 2KENA 3PUXA 4JI8Q 5IY0A 1CUKA 1XPOA 3F1ZA 5FJ8G 4R4TA 4DK3C 4YCVA 5HGQA 3AEVA 4BY7H 3HOYG 1O7IA 1GVPA 1TWCH 1IBKL 3HOVH 1K83H 1UWVA 4DAMA 4LFCQ 4R4OA 1V9PA 3ER0A 4DUYQ 2E2HH 2E2JH 4LFBL 3KLWA 1PH6A 1B7YB 4R4CA 3L7ZC 2LSSA 2XTIA 2B63G 1K8AC 3S2DH 4JI5L 4J15A 4KLKA 4JI4Q 1G6PA 2OCEA 5M3FG 5LMUQ 3F2DA 2UXDL 4L5SA 3PO3G 3KDFA 4DV4L 4IPGA 4GKJQ 4A3FH 3CCMA 4AH6A 2JA9A 1W3SA 3KDFB 3KF6A 4IFDI 4AYBG 1SRUA 4EQ5A 1XMOQ 4P71A 5IYDG 4O0AA 1TWGH 3S1MH 1I94L 3L2PA 4A3KG 4JV5L 1H95A 3KF6B 1UE1A 1IBLQ 2B63H 5M3MG 1A8VA 1SROA 2NN6G 1BVSA 4LUOA 2K5NA 4EX5A 1IBML 4LNQA 1C9OA 3D0FA 4DK6C 5LMNW 2JA8G 2Y0SE 4P72A 4X62L 4GOPA 2OQ0A 4DR7L 4APVA 4BA1I 1C0AA 2AWNA 4GOPB 2XGTA 3RLFA 4JI5Q 2JA5G 5IP7H 2EIFA 1KAWA 1X54A 4JYAL 3TQYA 5ELOA 4YY3Q 1YITA 1HNXL 2KBNA 5J3BA 4C2MH 1QUQA 1BBUA 1XMQQ 3UDXA 3HFZB 4GS3A 1A0IA 3M85A 3H0GG 4DV4Q 2I5MX 1QUQB 1V1QA 4FDBA 4HIMA 1EWIA 1X56A 4QIWE 2F4VL 1Q81C 2CQOA 2JQOA 3G6EA 4A3GG 3F8TA 3BJUA 3NBHB 4P74A 4POFA 2HHHQ 3T1YL 2R93G 2UXCL 4JI0Q 3HOWH 2NVYH 4A3EH 1K9MC 1LM0A 2R92G 1VQCA 1T9HA 1HNWL 1IXRA 2Z0SA 3I7FA 4R1JA 3RNUA 4DV1Q 2BH8A 1IBMQ 4GLAC 1LYLA 1N36Q 1X3FA 1HJPA 1PH7A 1S40A 4A3MG 3S14H 2ZJRA 3TS0A 3S15H 4IOCA 4A3LG 1TXYA 3RLNA 4PMWA 2MO0A 2KHJA 1TWFH 1PYBA 1FL0A 1OXSC 3G48A 4RMFA 2VW9A 2BH2A 4A93H 3E9IA 4DR6Q 1CKOA 1UE7A 5GAEC 4IFDJ 1X65A 4QGUA 3I4NH 4A3BH 5IWAQ 3RN2A 4DNIA 3B6YA 2F52A 3GTMH 4A3DH 1SN8A 1TWAH 2AMCB 4P73A 4DR4L 3RN5A 1ASZA 4A3CG 1VCIA 1Q1BA 2JJQA 4C3JH 2HT1A 4LF4Q 5IT9c 4JBKA 2YTXA 4DR1Q 3E9HA 2PMZE 3I55A 1Y1WH 1OXUA 5K36G 3T1HQ 5FJ8H 2ZM6Q 3UDGA 1W2BA 4LF5Q 1WYDA 4IPHA 4B3SL 3HOYH 3CMEA 1VQGA 4JCVE 3MXNB 1WCMH 1QZGA 1L0WA 2K14A 2HIXA 1X6OA 3DM3A 4AYBE 4LF8Q 4JI7Q 4PG3A 4DPGA 2ID0A 5M5WH 3CF5A 4JI8L 1EIYB 4B3MQ 1Q82C 1FGUA 1UE5A 2B29A 1YHQA 3GTGH 3TS2A 2OTJA 3CP0A 3A0JA 4GKKQ 1B70B 5M3FH 4JG2A 2HIVA 4ME3A 1HR0W 5IYBG 4DUYL 3CCLA 1PH9A 3M3YH 1A62A 1PV4A 3CXCA 1VQ5A 4UP9A 3PV0A 5C0XG 1X9NA 1E3PA 2ALYB 4LF9Q 2WP8J 2NVTH 3H3VH 4WJ3M 5IYDH 4JI4L 3H3VI 3J80c 3RZOH 1VS0A 1Q86C 4B3SQ 2JK8A 1LTLA 5JJIA 2NN6I 2KCMA 1EUJA 3KJOA 2K52A 3PO2G 1G291 1OXTA 4BBSH 2VS1A 4B3RL 4IJLA 1R9TH 2YV5A 2K50A 2IHEA 3H15A 4IPDA 3GTQH 1XMOL 2H5XA 3GTLH 2V1CC 3SGIA 4KHZA 5AJ3Q 4DV2Q 4A3JH 1PH1A 1IBLL 2PNHA 4A4IA 3U50C 5FLXc 3RZDH 1GO3E 1DGSA 2N78A 3HKZG 1A63A 1D7QA 2DGYA 3H0GH 4DV5L 4UY8C 3CQZH 1HNZL 2UUBQ 3CD6A 1QVFA 4OO1G 1HZCA 4LF7Q 3DLLA 5C3EG 3S16H 3UE1A 4DKAC 1Q1EA 1CKMA 3E0EA 1L1OC 4MZ9A 2R93H 3CCUA 4YY3L 3GTKH 3J7A5 1NE3A 2R92H 3PUWA 2IY5B 1E7ZA 1XMQL 5IYCH 2GVAA 2VQFQ 4HJ9A 4DR2L 5C4XH 4B3RQ 1N8RC 1JB7A 4DR5L 2VUMG 3HKSA 4LWCA 1CKNA 2NZHA 1M1KC 4GN5A 3W5OA 2VNUD 3PUYA 1Z47A 4A3MH 2A8VA 4HJ8A 2HHHL 2ATWA 5C44G 1OTCA 4A3LH 4JI0L 5M5YH 2VZAA 1CKNB 4NB3A 4OWWB 4LFAQ 3S1NH 3HOZH 2OQKA 4Y7NH 1NBWA 3K81C 1VQFA 1VQMA 1QVGA 3HOXG 4DV1L 1B8AA 4DV5Q 1HH2P 2I0QA 1N36L 1HNZQ 2R7ZH 4LUZA 4X66Q 4AQYQ 2UXBQ 1VQDA 3CCSA 1MIUA 5LMNL 4OONA 3PF5A 1J5EL 1XNQL 4A3CH 1Q46A 5JJLA 3UE0A 4BXXH 2QGQA 2E8GA 1OXXK 3J80i 4DR6L 1YZ6A 3KF8B 4DV3Q 1Y1VG 1S72A 4PZ6A 4DR2Q 3I4MH 3CMAA 5IWAL 4JOIA 5IE8A 4DR5Q 2JA7G 3PUVA 4NXNQ 4GLXA 2R7FA 4LF4L 3S1RH 3FKIH 5EAYA 4DR1L 1VQOA 1U5KA 4JI2Q 4B3TL 2B3GA 4BBRG 4NXMQ 3T1HL 3ULJA 2Q2UA 2ZM6L 1AE3A 4LF5L 3FHWA 1CSQA 2RCNA 3TRZA 2JA6G 1VQKA 1N9WA 4DAYB 5IP9H 1X3GA 3RLOA 1VQ9A 5IYBH 4LF8L 1GKHA 4JI7L 3HOVG 5LMNQ 1J5EQ 3I2ZA 1XNQQ 2UUAQ 5M5XH 4JI3Q 5C0XI 3RR5A 4DV7Q 3NENA 4B3ML 1SE8A 4TQUS 3A5ZB 3M4PA 3HKZE 1N32Q 1JT8A 4GKKL 3JAMc 2K75A 3F2BA 1ASYA 1Y14B 4NPSA 1U0LA 3M4OH 1E1OA 3I4OA 4H02A 3TEHB 4UP7A 3PO2H 4GN4B 4HIKA 2D0PA 1NMFA 4XIGS 1FVIA 4HIDA 2N3SA 4YCWA 2MFIA 3W1GA 2LXKA 2YTVA 3FP9A 1KRTA 2WB1G 1NMGA 1YVCA 2CWPA 1UEBA 3STBC 1M90C 3G71A 1HZ9A 4B3TQ 4LF9L 4IFDG 4L5QA 3ICEA 3GTPH 1I50H 1L2FA 4RG1A 3NEMA 2WFWA 1KQSA 1Q7YC 1JE5A 4PZ8A 1BBWA 3U4VA 3PUZA 3L0OA 1KRSA 2CCZA 1EOVA 2Z6KC 3K0XA 1PH3A 3S17H 5GROA 1EYGA 4OX9Q 3KFUA 4LW1A 5GAHC 4YWMA 1WOCA 2ZTEA 5C3EH 5HY6A 1SFOH
chains in the Genus database with same CATH superfamily
2NVXH 5E4XA 1CM9A 4A3FB 1KAAA 5FO7B 2MQHA 1KDBA 2E75C 3BZCA 3CW2C 4PZ7A 3TZUA 2EXZA 2K6AA 1SNPA 1PH5A 4L5RC 1IL8A 1GOZA 4A3EG 4X64Q 3J7AF 1NTGA 2K5DA 1Q8KA 3E0JA 2Q2TA 4A76A 3DXJC 1NUCA 2TMPA 4A3IG 2IX0A 4BY1G 1E2WA 3Q23A 1RIPA 2F0MA 2NVYB 1II3A 1JOKA 1I4GA 1XNRQ 2K33A 1LTTD 1B2TA 1VF5C 1STGA 4C3JG 1STHA 2JA6H 2LY7A 3SK8A 1HQMC 4FF3A 2PNRC 3GTJH 4A93B 4KI0A 1GM5A 4NXNL 2PI2A 5DLQE 1EIHA 1BNZA 1LACA 4JI2L 4DUZQ 3R2IA 4A3DB 4NMZA 1KTKA 1Q12A 2EJMA 2WIIB 1Y1WB 4JBJA 3HOUG 4JI1Q 3VA7A 3HOYB 5DM73 4N8FA 1WFQA 1LT3D 2VXWA 5J39A 4JI6L 3J81E 1K8GA 1TWHH 2B2UA 1ZYRD 1KD1C 1HZBA 1TIID 1LUZA 3GTGB 2A19A 1MBYA 2GN5A 3OW2A 2EZVA 3MEFA 3VYUA 1VQIA 1V43A 4GOPC 3S2HH 3CAMA 1VQ8A 3M7NA 4JC0A 1QVCA 2ZTCA 4BY7G 3KOJA 1EWHA 1SJED 1WVLA 1MJEA 2PPBC 2UXDQ 3RZOB 3GD7A 3PCOB 3C1FA 1W6KA 3H09A 4FF1A 4JOIC 4LMQD 2K03A 3BU2A 1G51A 3TREA 4JV5Q 1I94Q 1DM0B 5C4JH 4DFAA 1EY5A 4A3JB 5IYCG 2R7DA 3UI2A 4IUPA 1RDPD 4DR7Q 4X62Q 4JBWA 3H0GB 1E22A 1PTOH 2MJ8A 2E5LQ 2KCNA 3EVQA 4JYAQ 4X64L 1YNJD 4MIUA 2PQAA 2C9OA 2L55A 2LFNA 5FLMH 1PH8A 1JMCA 2AQ2B 2R92B 1HZAA 2WAQE 4GNXA 1SDFA 1TS5A 1GUTA 3C46A 1QG7A 5C4XB 2QEJC 5A2QE 3T1YQ 2UXCQ 2RHSB 5DAUA 1EQRA 4OWXB 1UE6A 4CHTB 3Q8DA 3S1NB 4YHHL 2XWBB 3A74A 1XNRL 1DOKA 2OTLA 1K73C 2VL6A 5I6YA 1VQEA 4N9TA 1M4VA 3FKIG 1EIFA 4DV6Q 4QQBX 1XPUA 1A2UA 4IQZA 5IP9G 3AFPA 5CC4A 1YBYA 3BDCA 5C6AA 1IYJB 2AWOA 4DUZL 3S1QH 5FLXL 3G6JB 3EROA 4ID6A 1L0YB 2A69C 4JI1L 1ILPA 5JVH3 1MKHA 1ICFB 2E2IH 3NQIA 4GKJL 2MNAA 2RF4A 4IO9A 2BOSA 4RA8A 3PUXA 1PTOF 2B2WC 4F8MA 1TWCH 2PZWA 1K83H 4R4OA 1WD0A 4XQNA 3M4OB 3KLWA 3AMUA 2SNSA 4JI5L 3R8BA 1F77A 1G6PA 2OCEA 5LMUQ 2UXDL 4M8AA 3WOEA 4DV4L 4A3FH 5COYA 3HKZB 1I4QA 2NTSA 2A6ED 4O0AA 4JV5L 1H95A 1I94L 4A3KG 2B63B 5M3MG 3NSWA 1A8VA 1SFOB 4UDUC 1BVSA 3FRPB 1IBML 1PTOD 1B9NA 2Y0SE 4L8JA 4X62L 2JA8G 4DR7L 1ICWA 4APVA 1WTRA 1C0AA 5CGKA 2VUMB 3RLFA 2JA5G 1KAWA 2BDNA 4JYAL 5ELOA 1YITA 5J3BA 3V96A 4DXFA 3UDXA 1U9RA 2F0JA 1QUQB 3NBHA 4HIMA 1GUOA 1Q81C 3F8TA 4H44C 3BJUA 3FPPA 2HHHQ 3T1YL 2R93G 2UXCL 3T51B 4JI0Q 2NVYH 4X3TA 1LM0A 2BCOA 1S5ED 1U4RA 2L0CA 4QUCA 3SHLA 2EOTA 2Z6BA 4WORA 4EVOA 1AW7A 1HJPA 1JC7A 1CQVA 4A3LG 1TXYA 2WKDA 3A56A 3W3AA 4RMFA 1OXSC 4A93H 4DR6Q 3R93A 1E2ZA 1V1OA 4CDCC 2QDBA 2F52A 4OGQC 4A3DH 4DGZA 5EBDA 5IGBA 1G91A 1VCIA 3LWEA 1D1IA 2HT1A 4LF4Q 1H9KA 5IT9c 1SMYC 2EJFC 4FNFA 1Y1WH 1J8IA 1OXUA 5K36G 3UDGA 4C3IB 3MXNA 3A8KE 3HOYH 5D65A 1UNSA 1L0WA 2HIXA 4LF8Q 3DM3A 5J22A 3V2TA 3J80E 3MXUA 3GTGH 3TS2A 3GV3A 2OTJA 5EPLA 3CP0A 2HIVA 1B53A 5G3LF 1DCZA 1UAPA 5CMDA 5IYBG 1VMCA 3CCLA 1Z6HA 3SE0A 1PH9A 1STAA 2EJGC 4UP9A 3PV0A 3RZOH 2TSSA 1Q86C 3D4DA 2NWGA 3PO2G 1OXTA 4FF4A 2VS1A 1K3BC 2K50A 1LTAD 1DYQA 4KTAA 3EQLC 5AJ3Q 4DV2Q 1BCPB 4A3JH 5FLXc 2PO4A 1DGSA 4KK7A 4G7OC 1WTXA 5JAVA 3H0GH 4UY8C 4TRDA 2UUBQ 2OEOA 1RKNA 1QVFA 3MAQA 4XXEA 4QUFA 5G3LD 4DKAC 1G2TA 4C1NK 1CKMA 4MZ9A 2XNAC 3J7A5 2K04A 2R92H 4A3IB 2EYJA 1K28A 4HJ9A 4BY1B 5C4XH 1CK1A 4WJWA 2EY1A 2XVSA 2DN8A 1M1KC 4GN5A 4X3SA 3ZYYX 2ATWA 2HHHL 5C44G 1UEAB 4JI0L 1E0BA 3T56B 4LFAQ 3S1NH 1WTHA 1LT4D 1QVGA 2FFKB 4L6TB 1NR2A 3HOXG 4DV5Q 2I0QA 4NDXA 3R3OA 1F9QA 5CBAE 4KN7C 4AQYQ 5HURA 2UXBQ 5LMNL 4OONA 3PF5A 1XNQL 3GTOB 1Q46A 3UE0A 2HUGA 3J81L 4DR6L 1M8AA 4DV3Q 4WFN3 3I4LA 1GJXA 4JOIA 1B4OA 3P75A 1VMPA 3QOJA 1CZWA 4HMJA 3HOUB 2DJGC 4LF4L 4RCOA 2B3GA 1SE4A 3MXGA 1AE3A 1H9SA 3HG9A 3FHWA 2RCNA 4IN3A 1BDOA 2EYOA 4LF8L 1B1ZA 3DEPA 5IGCA 3I2ZA 5CORA 3VYRA 5EGTA 4OIKA 1Q8IA 3RR5A 2F0PA 5BN4A 5C0XI 5DNFA 4TQUS 4ZYSA 3IFTA 1ASYA 2ICEC 3NUCA 3M4OH 3I4OA 4UP7A 4EGVA 1S5BD 3V05A 3QJYA 4HIDA 4BY7B 3W1GA 2LXKA 2WB1G 2CWPA 3TP5A 1DXMA 3ICEA 4ZQ3A 4RG1A 1MD2D 4FXKC 2F0UA 1KQSA 3NTHA 3FDTA 3PUZA 2P5ZX 3L0OA 1JWUD 1PH3A 5GROA 4OX9Q 4YWMA 1WOCA 2B63H 1SFOH 3N52A 4GNXC 2RBMA 4IPCA 5AJ3L 4DV2L 4DR3Q 3OMGA 5A2QL 3GO5A 1VQHA 1PYWD 2F3IA 2L12A 5CV9A 4F87A 2UUBL 2VUMH 1B44D 1AP0A 4KHPQ 2XIWA 2HQLA 3CCRA 3CCVA 1OO9B 5C3XA 1YHBA 1KC8C 1ML0D 3AFQA 4R4IA 4X3UA 2K5QA 2DJFC 4BA2I 1A2TA 3A8IE 4HN7A 2I46A 1VQ7A 4QCLA 4LFAL 1TY0A 2K5WA 3PGZA 2I5LX 3JAMi 1YIJA 2UU9Q 1D5XC 1I4PA 2ZTDA 3E6ZX 1TKWB 3ULPA 1HCZA 3HOWB 2KEDA 4IUTA 4AQYL 2UXBL 1JE4A 1YNXA 5I4DA 2A1AA 1FYCA 1L1OB 2F0OA 4DV3L 4B9XA 3S14B 2QA4A 2RSNA 4U68A 5M9OA 1JOQA 1JJCB 5BR8L 3NELA 1VQ4A 2F3WA 2PCFB 1JCKB 3U58A 3I4NB 3OIPA 4C3IH 4A3BB 1JJGA 4K0KL 1EY8A 3GTMB 1ZYRC 4Q0FA 1YI2A 1AE2A 1JB3A 4CDDC 1NR4A 1EYCA 5ELDA 3NBIA 2SDFA 3ONAB 1YEZA 3IRBA 1EZ6A 2N49A 3D31A 4EQNA 1RTOA 2L15A 4G4KA 2EXDA 1VQ6A 3EN2A 2EE1A 1WCMB 3I91A 3KJPA 3C2PA 5JJZA 1RF2D 4OXPA 1KDAA 1IBKQ 4PMCA 4BBSG 4J6HA 3AQQA 5HGTA 1XTDA 4DAYA 2QKIC 2D5DA 1VQLA 5GQOA 3M3YB 2YYZA 4XQQA 1DD2A 3P20A 4K5XA 3J81c 3TN2A 2NVTB 2BE5D 2FXQA 1LTID 4OX9L 1EY4A 1C48A 1RL2A 4GLVB 4JI6Q 4P75A 1PMRA 3VR2A 2GVBA 4DR3L 4JVZA 1GXDC 1YNJC 4HAEA 3GTQB 1D1KA 3D3RA 2RHQB 3WWVA 3WDNA 5EPKA 3X3MA 3RUZA 2QCPX 2K5HA 4KHPL 4A75A 3KYHC 3RZDB 5KNCA 1NY4A 1OXVA 4A3IH 1SNDA 2K4KA 2SEBD 3RMHA 2ES2A 4FF2A 1IYVA 4K2LA 1EYDA 3CQZB 4L63B 2L4NA 1IHZA 4BY1H 3HOZG 4MTKA 3CCEA 3S16B 2DNEA 1HNXQ 2K1BA 2R93B 2YTYA 1SE3A 3A7LA 4OO1H 2VQEL 3E3XA 2F4VQ 3NWTA 1XWEA 2IX1A 1CQFA 2UU9L 2JXMB 4H7BA 3PMFA 1PRTF 2CW0D 3MFGA 3GTOH 2M00A 2AHOB 1FJGL 3HRZC 2QW7A 1VQJA 4L5TA 4DAPA 5JEAG 4GN3B 5F2DA 5I9PA 2F0QA 2R7ZB 3J80L 5D14A 1D6EC 1D5MC 4RGMA 1K8OA 3IKJA 1X3EA 3MTSA 3HOUH 2BDOA 4FP5D 1YJNA 4FXDA 2FJ2A 3PIPA 3I4MB 4N8X1 3OYYA 1BCPF 1DJRD 1P8LA 2Q8RE 1RJTA 2FHTA 3PIOA 4OELB 3VYSA 2KECA 3S1RB 4WJ4A 4Y52H 1NNXA 4YHHQ 2RCFA 4RGOS 3TP6A 5FO8B 4ALPA 1VQBA 4HJ5A 2KENA 5FJ8G 4R4TA 4DK3C 2HD3A 4ZCKA 4BY7H 1D2BA 1IBKL 1UWVA 4GZYC 1V9PA 4K5VA 1PFNA 3ER0A 2DY7A 2A6EC 2C5CA 3QG1A 1PH6A 1B7YB 3PO2B 2EYLA 1LTBD 3Q6SA 4PNYA 4J15A 3URYA 2OXPA 4JI4Q 1B3AA 1BCPD 4KHVA 2KUMA 1PTOC 2L9HA 1I50B 4L5SA 1FNUA 2PZTA 5ELBA 4GKJQ 2JA9A 4IFDH 3KDFB 2CQAA 1XMOQ 5IYDG 4XDXA 3KF6B 1O7LA 1UE1A 4Q5VA 1SROA 2NN6G 1HFNA 1CA6A 1QE6A 1LTGD 2A68D 2J0TD 1F2YA 1WTQA 2OQ0A 3SK5A 3PO3B 4BA1I 4CJ0B 1ENAA 3T4AC 4JI5Q 2A73B 5IP7H 1SNCA 2CVRA 1X54A 2M9VA 4AYBB 3TQYA 1HNXL 5C44B 1G8ZD 1QUQA 1XMQQ 3M85A 2EY6A 4DV4Q 2NYZD 3EFXD 2F4VL 1X56A 3HOXB 2CQOA 2O2LD 4POFA 3I90A 3HOWH 1VQCA 3CRLC 4RFBA 3A54A 3RNUA 1SYEA 4DV1Q 1IBMQ 2K01A 1LYLA 2NVQB 1X3FA 1PH7A 1B3QA 3S14H 1AN8A 2ZJRA 3TS0A 3RLNA 4A3GB 3OWFA 4PMWA 2XN9C 2MO0A 4KKTA 1H9RA 1FL0A 2VW9A 4RWSC 5GAEC 1X65A 1ONLA 1S5CD 3I4NH 4A3BH 3B6YA 3GTMH 4V190 4P73A 5EKIA 1B50A 2YTXA 4DR1Q 3I55A 2A6HD 4DK0A 1STBA 2ZM6Q 3R2TA 4LF5Q 2FMMA 4JCVE 1WCMH 4AYBE 4JI7Q 1SYDA 2ID0A 3KLSX 1JWMD 1EIYB 2NTTA 1Q82C 1SYGA 2B29A 2WB1B 1LO5D 1ZKOA 1TQOA 1B70B 4ME3A 4OIJA 2KEEA 1SNMA 3M3YH 1HXYD 3LWUA 3QIAA 2R61A 2ALYB 2NVTH 3HEJA 4JI4L 3J80c 3MEHA 1B9MA 1VS0A 2F4IA 1LTLA 2KCMA 4ZLTF 1EUJA 3KJOA 3TP7A 2HCIA 2QDLA 3KLSA 4IUQA 1XXGA 4IJLA 2YV5A 3Q24A 3GTQH 1XMOL 1QJOA 5CYUA 2JYOA 3SGIA 1DZ1A 5KNDA 2PNHA 4UHVA 3U50C 3RZDH 1GO3E 3A55A 2DGYA 3CQZH 4LF7Q 1EFID 4LK1C 5KYLA 3S16H 1Q1EA 2R93H 3D4WA 3CCUA 1ENFA 3PUWA 1E7ZA 2K32A 3BDOA 1I3QB 1XMQL 2GVAA 5EJWA 2VQFQ 2X6GA 1N8RC 4DR5L 3HKSA 2RQXA 2Z4HA 1DOLA 3PUYA 1EEFD 1FD7D 1F9RA 4A3LH 4NB3A 3C3LA 5CV6A 1I4HA 3LNNA 4DV1L 3EJIA 1HH2P 2R7ZH 1X3QA 2N55A 4LUZA 1MSHA 1DONA 1VQDA 1J5EL 2RDGA 4KJOA 5JJLA 4BXXH 4CKEA 1LV9A 1MSGA 2E8GA 3PIP3 1SEBD 5K36H 1BUVT 2IL8A 3PIO3 3I4MH 2J4XA 2JA7G 4CKCA 3BS1A 3PUVA 4PMBA 4OEMB 4GLXA 3S1RH 1SSOA 4DR1L 2JSOA 5BN3A 4B3TL 2O5IC 4NXMQ 4FYDA 3ULJA 2Q2UA 4HCEA 2ZM6L 4LF5L 3VR5A 2FINB 2MUYA 1VQKA 1N9WA 1JOOA 3K5OA 5DEHA 1Y1VB 1VQ9A 5LL6X 5IYBH 1GKHA 4JI7L 2F0KA 4K6DA 1I4XA 5LMNQ 1XNQQ 4JI3Q 3NENA 1SE8A 1PZKD 1GHKA 3M4PA 3HKZE 2D2CC 4XYOA 2SOBA 4BBRB 4NP5A 4NPSA 4HSVA 2Z9HA 2WINB 3PO2H 4HIKA 1NMFA 3OMCA 4KY7A 3AU7A 1FVIA 1BOSA 5EKLA 3DHQA 2N3SA 2YTVA 1M90C 2DY8A 3HOVB 3G71A 2L11A 1I50H 1L2FA 2E2JB 3NEMA 3NHHA 2XWJB 5EQ0A 2VB3X 1JE5A 3DMUA 2HQEA 3S2DB 4H13C 3SK4A 3U4VA 1KRSA 1S5DD 1FGBD 3K0XA 3NE5B 5E4WC 4LW1A 1LTSD 1LTRD 4KY5A 2EIFA 3RD4A 5JEAJ 3A5UA 1PA6A 4K8JA 2CH4A 2KHIA 3K8AA 2RVLA 2NB0A 3VR3A 2H4OA 5EKKA 3PO3H 4QL5A 1PRTB 1TWGB 3CC7A 1G6ZA 3I56A 4LF7L 1TS2A 1ILQA 1R4QB 5C44H 5I9OA 1HUNA 2KA7A 3I8ZA 2B8GA 3HOXH 4I7AA 2VQFL 5LHY1 2C35B 1NSNS 5KRUA 4ZRZA 1PZID 5JPNC 4C2MB 1MGSA 2VB2X 2O5JC 1U4MA 1MJCA 2B2TC 1PYSB 1U4LA 2ENBA 3BZKA 3J81j 3AYHB 2NVQH 5E7NA 2KCTA 2ZXOA 3I3CA 1EIGA 3M4QA 4A3EB 4A3GH 1MI2A 1GD7A 1TS3A 1V1PB 2XRSD 3BDLA 4C3HG 5C4HA 1VQPA 1K0RA 3S9WA 3MHBA 1Y1WG 4QIWB 2UUCQ 1HNWL 1YHAA 1PHJA 1SBBB 5C3WA 1CSPA 3M9BA 3OHXC 2OWOA 3NPPA 4NXML 1IW7D 4UPAA 1PFMA 2WAQG 1TWAB 3OPOA 2EDGA 3W1BA 1NAPA 1KLUD 2IJ0A 4C3JB 4J8QA 4YWLA 5GADC 4DF7A 1WTPA 1EU3A 2CWAA 4XT3B 3QB3A 4NW2A 1GUGA 1Z9FA 3KF8A 4JI3L 4R8NA 1STNA 2XSCA 5NUCA 1GHJA 1FNVA 3K6OA 2BE5C 3MXPA 3CU7A 4HJAA 5ELEA 5BR8Q 2Q2IA 3J7ZC 5JVG3 2ZXPA 1W6JA 3KBGA 3KLRA 1VQNA 4LFBQ 1DOMA 4K6LA 4OHJA 4O2DA 4K0KQ 1Q90A 2CKZB 4A3JG 1QB5D 2EYMA 3ND8A 5IIFA 1WI5A 1FNWA 1BQQT 2RSOA 3K5LA 2B2YA 4YWKA 3CCJA 1KHIA 2Z8LA 3HZXA 2H1EA 3W2DA 3CCQA 1P16A 5ELFA 1C7YA 3VDYA 1CHQD 3OTOL 3FPUB 2B8FA 4XT1B 2DNCA 5EPJA 5C4XG 2F0DA 1EQQA 3BVGA 4TSSA 4IUUA 5H1SE 1I3QH 1CHPD 1HFGA 4F7XA 2MO1A 2CW0C 1WJJA 2QEXA 4KJNA 5IGGA 4ULLA 3CPFA 4WRDA 2F0FA 3K7UC 3U4ZA 4OO1I 2F1MA 3K59A 3TSSA 1O7ZA 1QWYA 4B08A 2OF1A 1AFPA 4XYQA 3GDEA 4ODGA 1N33L 1QNKA 4FVMA 5M5YB 3PQIA 3GV6A 1SE2A 1X32A 3ERSX 2D0OA 3EIVA 2G9HD 2PYKA 2Y0SG 1T5EA 3J81i 3D4RA 3IFDA 3DM1A 3TBIB 4IOAA 4YCUA 2UUCL 4KD4A 2MP1A 2VQEQ 4UP8A 3CPWA 4LFCL 4DR4Q 3I72A 1S3OA 4HSPA 1Y1VH 4NKLA 1CTMA 1Y8PB 4OWTB 3UDFA 1ET9A 3FKIB 3L3OC 1X55A 2HDMA 1FJGQ 5BN5A 4ME5A 3K57A 1I6VC 1A3UA 1EQVA 1CFMA 2F0IA 4BBRH 1IL2A 3KK7A 2EQSA 2F0SA 4JI8Q 4DN4M 5IY0A 1BCPC 3F1ZA 1RCVD 5HGQA 1F2ZA 3AEVA 2LKVA 3HOVH 1JQYD 1BF4A 2E2JH 4LFBL 5J1ZA 2XTIA 2B63G 4I65A 1GUNA 1K8AC 3S2DH 4KLKA 1EY6A 5M3FG 2A68C 3F2DA 5KGUA 4HTHA 3KDFA 5T1IA 4AH6A 1W3SA 1STYA 3KF6A 4IFDI 1SRUA 4EQ5A 2F0WA 1VF7A 1TWGH 3L2PA 3DWPA 4LJZC 1IBLQ 3I73A 4LUOA 2PMZB 5LMNW 4P72A 5A35A 1PLFA 4RGNA 2AWNA 4GOPB 4YY3Q 2EY5A 2KBNA 4A3KB 4C2MH 1S4ZA 3HFZB 5M3MB 3SEBA 2RKSA 3FVQA 5JEAH 1Y69U 3G6EA 1IKLA 2JA8B 2Q8IB 1TT2A 5I2YA 1SYCA 1TY2A 4A3EH 1K9MC 1F9SA 1I6HB 1T9HA 2JA5B 4DA2A 1IXRA 2Z0SA 1TS4A 2BH8A 2F3VA 1N36Q 3SK6A 3D8GA 4K2KA 2A6HC 4A3MG 1HPCA 1VDZA 3DUZA 2JA7B 4IOCA 2EYHA 4X6AH 2BH2A 3E9IA 2F0NA 4QGUA 3FMCA 1HTPA 1TVXA 2PZUA 5L37A 2E74C 4DNIA 1TWAH 2AMCB 4DR4L 1ASZA 4A3CG 1Q1BA 4C3JH 5LL6S 4JBKA 1O78A 2PMZE 3KUPA 3T1HQ 2G5DA 5FJ8H 1W2BA 4IPHA 1CT1D 4B3SL 1X6OA 4RCNA 3NTIA 4DPGA 4RHSA 4JI8L 4B3MQ 4JW0A 4GKKQ 1R4PB 1EZ8A 2KQ3A 2EY2A 1LABA 2B2TA 1PV4A 1WTWA 3P7JA 5C0XG 1E3PA 2O4XA 4RAUC 5IYDH 3H3VH 4WJ3M 3FEWX 1KNAA 4QMGA 2NN6H 2JK8A 1BO0A 3P1HA 1G291 4B3RL 1PRTD 2RA4A 3C1EA 2H5XA 4MN3A 1CA5A 1JICA 1H9MA 5T1GA 1PH1A 1IBLL 3ERQA 1JWSD 4F88A 4ZUJA 2YU9B 4A4IA 1A63A 1D7QA 1HNZL 3CD6A 4OO1G 4BWGB 1IYUA 5C3EG 1HHVA 3UE1A 1L1OC 3OW7A 4C56C 4YY3L 4ZUIA 1NE3A 1GUSA 5FK9C 4HR7B 5IYCH 5CV8A 4DR2L 5IGDA 3ND9A 3K5NA 4LWCA 2M2LA 2A8VA 4HJ8A 1OTCA 4E6IA 4R9WA 3K7AB 1CKNB 5M5YH 1SYFA 2X69A 1YNND 1EU4A 4CGYB 3K81C 1SJHD 1UUPA 4C3HB 1B8AA 1O80A 5D3IB 1N36L 2IX3A 4X66Q 4DAVA 3CCSA 1MIUA 3DWAA 4RKLA 1Y8NB 4IALA 2B39A 3QWNA 1SXTA 3M7GA 3J80i 1YZ6A 4H0LC 2G9DA 4PZ6A 2WAQB 1IKMA 3H6MA 5IE8A 4DR5Q 2SNMA 4B9WA 3I70A 3NTKA 4KKSA 2KVMA 2R7FA 2MPMA 3JAME 3CKIB 3FKIH 3T1HL 4N9PA 1CSQA 3TRZA 2JA6G 4DAYB 5IP9H 2AQ3B 1X3GA 3MWYW 3X3NA 2ZXRA 3QR8A 1QCBD 2QF7A 1J5EQ 2UUAQ 2NUCA 4DV7Q 4B3ML 1RHPA 5FOBB 3A5ZB 1N32Q 1JT8A 4GKKL 2B2YC 2K75A 4O1NA 5KEEA 3WOFA 4GN4B 5I2XA 2D0PA 2XRQD 4YCWA 2MFIA 4HMIA 4DNRB 1NMGA 1YVCA 2L5TA 1UEBA 2EVBA 3STBC 5IT9L 4B3TQ 1HZ9A 4IFDG 1EY7A 2E2HB 3NXWA 5CV7A 4CBVA 2B2VA 1EYAA 1Q7YC 2IWHA 3MVVA 1EOVA 2KCCA 1EYGA 4M1UB 3GP7A 2AUKA 4DV0Q 5KNBA 4XQJA 3ULLA 2VY3A 4QJFA 2KOLA 5IP7G 3TZDA 2K5VA 2NBFA 4MHEA 5E1FA 2RDHA 1QNUA 4JK1C 3S1MB 2F0EA 2I5HA 1EL0A 4P2CB 1PZJD 1HRJA 1LT6D 5CV5A 1I5FA 4KV6A 1ZXTA 4IUVA 4A3KH 1KL9A 5M3MH 3HOWG 4TVAB 1NJIC 3CC4A 2MGSA 2JA8H 1O7YA 1EFWA 5AFWA 1XPRA 4AIMA 2MHVA 1A3TA 2IHFA 4RGTA 1I6HH 3G7LA 1YJWA 2JA5H 3MFYA 5CBEE 3VR6A 1JJ2A 1KXLA 1ESRA 1VQAA 4JPBW 2JEBI 4RH6A 2PW7A 2Y0SB 1E1TA 2IPKD 3JC66 3K58A 2BA0A 2F0GA 4CJ1B 2X6LA 5FLMG 2ZJPA 2JA7H 3OOCA 4X66L 1HR0Q 1V1PA 5IOCA 3I4NG 1PVOA 4A3BG 1IW7C 4O42A 4R8IA 1V8QA 2FMCA 1QZHA 4RHRA 4X65Q 3EBEA 2Q2HA 4UAIA 2EYFA 1EQTA 3S15B 1K8MA 1TWFB 2WB1E 1NCVA 3HGBA 2LS01 2EPBA 1WCMG 2JE6I 1U4PA 4KKUA 3CC2A 4CJ2C 2Z1CA 3EA6A 1N34Q 3GQBA 2OT2A 5CR3A 1PH4A 4MNOA 3DWQA 4K5WA 3CRKC 4LF6Q 3OIQA 3BVZA 1E24A 4IUNA 5K5PA 3H94A 4POGA 1A3VA 2UUAL 4IURA 4DV7L 1H9JA 1K3RA 3PF4A 4DK1A 5IODA 2DUDA 1N32L 2F0VA 5M5WB 3K0YA 4FXGC 1PFBA 2ASBA 1KDCA 4G7ZC 2WACA 1AZPA 1HNWQ 1RD9D 5M3FB 1A6XA 4U673 1SR3A 3NP8A 1D8LA 2CHBD 2F0TA 3SDZA 3J7YW 2E5LL 2IT1A 3SR1A 2ZJQA 1CI3M 4MTNA 3L9AX 4DV0L 2YU9H 2AQ1B 1J6QA 2BA1A 4IZ8A 4BBSB 2KJXA 3U9SA 1R9TB 2AKWB 4KMUC 1LLRD 4IJHA 3GTLB 2CFMA 2E2DC 2PI2E 3S24A 1PH2A 1KIXA 4LUVA 5JJKA 1HQRD 3VYTA 1SYBA 1TU2B 2RDFA 4A3FG 2NZOA 2R6GA 1S5FD 2HDLA 2KHSA 2K7VA 2N8NA 5D3DA 3ZJYC 4DV6L 2Z6KA 2F03A 1C8CA 2D62A 3GTKB 3G4SA 1PFSA 4HJ7A 3K7AH 2ZT9C 2PQAB 3CHBD 2R7ZG 3KBXA 4PQXA 3SVMA 1BKBA 4ZKBB 1AZQA 4OL7A 3T53B 2R3ZA 3STBD 4Z9CB 4C3HH 2LMCB 4GNXB 2JEAI 2LXJA 1TR5A 4BXXG 2ICIA 4QY7A 4A3MB 4ZK9B 3OTOQ 3HOZB 2I07B 1YJ9A 2A74C 1HR0L 4J1MA 3T13A 4Y7NB 1WTVA 4BS9A 4HIOA 3I4MG 3F2CA 4ZKCB 4DU9A 1K0SA 4X65L 3QOLA 5ELNA 1F2MA 5C0XJ 1XJVA 3LGJA 1IZ6A 3TP8A 3TMEA 1LT5D 1AH9A 1SMXA 4R4QA 4YIJA 1N34L 5GAGC 1N33Q 3QO2A 3UDIA 3J7AV 3IL8A 3NWSA 3SXHA 4A93G 1Y8OB 4LF6L 1XX8A 3PSIA 5LMUL 1SLJA 2K28A 1L1OA 4XTCS 4A3DG 4K14A 3K80C 4JBMA 3D6WA 4RKBA 1XPOA 1CUKA 1SNOA 5M5XB 3LX0A 4YCVA 3HOYG 1O7IA 1GVPA 4DAMA 1T5XD 4LFCQ 2A69D 4V0BA 4DUYQ 2E2HH 2HCCA 1HA6A 4R4CA 3L7ZC 1SNQA 4K8IA 2LSSA 5KIXA 5IGFA 1QILA 4G7HC 5JOBA 3GTPB 5FKAC 1E2VA 1X3PA 3PO3G 4IPGA 3CCMA 2CH4W 4AYBG 3S17B 2F0HA 4LAAA 4P71A 3S1MH 3Q22A 2PW5A 5C3EB 1C4QA 3T16A 1F2LA 3M4YA 2NVXB 2K5NA 4EX5A 2QILA 4LNQA 1C9OA 3D0FA 4DK6C 1HUMA 4GOPA 2N88A 1BBXC 2XGTA 4S3SA 1Z7TA 5C4ZA 1QOHA 2PQEA 1BBUA 4GS3A 1A0IA 3N6RA 1WTOA 3H0GG 2AUJD 2I5MX 4ZAIA 1V1QA 2B2UC 4FDBA 1EWIA 3BYTB 4QIWE 2JQOA 5DM63 4A3GG 3NBHB 1KABA 4P74A 2F0LA 3JAML 4HEDA 3BG3A 2R92G 1XYIA 1EY0A 3I7FA 4R1JA 4GLAC 2D9UA 4TKOB 2IW3A 5IT9E 1S40A 1RODA 5C5MA 3H91A 1JR0D 4FO2A 4I7ZC 3S15H 2KHJA 1TWFH 1PYBA 3G48A 1CKOA 1UE7A 4IFDJ 3NQTA 1AEXA 5IWAQ 3RN2A 1ESFA 2JA6B 1SN8A 5IGEA 3RN5A 3GTJB 2JJQA 3E9HA 3IAYA 3NK9A 1J9OA 2Z4IA 1WYDA 3MZ5A 3CMEA 1VQGA 2B2VC 3MXNB 1QZGA 1D5ZC 2K14A 4PG3A 4CDEC 3CF5A 5M5WH 4KN4C 3HP3A 5TSSA 3D6CA 2GA4B 1HTLD 1FGUA 1UE5A 1YHQA 1SMYD 3A0JA 5M3FH 1ENCA 4JG2A 4PV1C 1PRTC 1CZGA 2WV6D 1TWHB 1HR0W 4DUYL 3O13A 1A62A 1VQ5A 1HA5A 3CXCA 1BXTA 3HS0C 1X9NA 2J7ZA 4LF9Q 2WP8J 1EEID 5FLXE 5FO9B 3H3VI 4B3SQ 5E3FA 3S2HB 2NN6I 1PXUA 2K52A 4BBSH 1R9TH 2L1BA 5EBCA 2IHEA 3H15A 2JP1A 4IPDA 3GTLH 2V1CC 1JORA 4EQPA 4KHZA 2B2WA 4CDFC 2N78A 1G2SA 3HKZG 1ET6A 3U9OA 4DXGA 5JPMC 4DV5L 4G57A 1HZCA 2E76C 3OWEB 5C4JB 3DLLA 1YNNC 3E0EA 4KD3A 3GTKH 2A5HA 2IY5B 2JN4A 1PTOB 1KLGD 4B3RQ 4ILWA 1JB7A 2VUMG 1RTNA 1CKNA 2NZHA 3W5OA 2VNUD 4A3MH 1Z47A 5JJIA 4QB4A 2VZAA 3BYYB 4OWWB 1L0XB 3HOZH 4DNTB 2OQKA 3K5MA 4Y7NH 1NBWA 1VQFA 1VQMA 3F2UA 1HNZQ 4QF4A 4A3CH 4X3KA 1EOTA 2Q8TA 1BR9A 3MA2B 2QGQA 1OXXK 3KF8B 1Y1VG 1S72A 4C1NI 4CKBA 3Q0AA 4DR2Q 3VR4A 3CMAA 3ITPA 5IWAL 3A7AB 3VA5A 3E5SA 1I4RA 4NXNQ 4KY6A 1VQOA 3MC0B 1EWCA 5EAYA 1U5KA 4JI2Q 5ISRA 1GUWA 4BBRG 3BZDB 3H3VC 1SAPA 3OSOA 3RLOA 3S1QB 1H9SB 1KNEA 1STEA 5KYIA 3BVMA 3HOVG 5C0XH 5I6WA 4C3IG 1Q3LA 5M5XH 5CV4A 1XTCD 5C5LA 2E2IB 3JAMc 3F2BA 1Y14B 1U0LA 2EYPA 1E1OA 4H02A 3TEHB 1MHWC 4XIGS 3AB9A 1A15A 1EY9A 1ZEQX 4EQOA 1KRTA 3FP9A 1TWCB 4HCSA 1WD1A 3A8JE 4LF9L 1K83B 2K05A 4L5QA 1PDQA 3GTPH 2WFWA 4ABNA 3TDQA 5ELCA 1F9PA 4PZ8A 1BBWA 1FR3A 2CCZA 3DEOA 2Z6KC 3S17H 2NZ1D 2WKCA 3KFUA 5GAHC 2V4DA 2ZTEA 5C3EH 5HY6A
chains in the Genus database with same CATH topology
4GNXC 4IPCA 2VY3A 5JEAJ 3ULLA 5AJ3L 3A5UA 4QJFA 4DV2L 4DR3Q 3GO5A 1PA6A 2KHIA 3K8AA 1VQHA 5IP7G 2K5VA 2F3IA 2MQHA 3PO3H 4QL5A 3CC7A 3BZCA 3I56A 2I5HA 2UUBL 3CW2C 2VUMH 4KHPQ 4PZ7A 4LF7L 1I5FA 2HQLA 3CCRA 3CCVA 1PH5A 5C44H 4A3KH 4L5RC 1KL9A 5M3MH 1YHBA 3HOWG 4TVAB 3HOXH 2VQFL 4X64Q 4A3EG 1KC8C 1NJIC 2C35B 3CC4A 2JA8H 1NTGA 3AFQA 4R4IA 1EFWA 1Q8KA 1XPRA 2Q2TA 4AIMA 4A76A 2IHFA 4BA2I 1I6HH 1YJWA 4A3IG 2JA5H 1VQ7A 1MJCA 1JJ2A 4LFAL 1KXLA 2IX0A 1PYSB 1VQAA 3BZKA 4BY1G 3J81j 3PGZA 2I5LX 3AYHB 3JAMi 1YIJA 2UU9Q 2NVQH 5E7NA 2KCTA 2JEBI 1RIPA 1E1TA 2ZTDA 3JC66 3ULPA 2BA0A 5FLMG 2ZJPA 3M4QA 2JA7H 1HR0Q 4X66L 3I4NG 4AQYL 4A3GH 2UXBL 1PVOA 4A3BG 1GD7A 1YNXA 1XNRQ 2A1AA 1QZHA 1VQPA 1L1OB 3EBEA 2Q2HA 4X65Q 1K0RA 4DV3L 1Y1WG 2QA4A 2JA6H 3GTJH 2WB1E 2UUCQ 1JJCB 5BR8L 3NELA 1YHAA 4KI0A 1VQ4A 1PHJA 1CSPA 3M9BA 4NXNL 1GM5A 1WCMG 2PI2A 2JE6I 3U58A 5DLQE 2OWOA 2NVXH 4C3IH 3CC2A 4JI2L 1JJGA 4K0KL 4NXML 4UPAA 4DUZQ 2WAQG 1N34Q 3W1BA 1PH4A 1YI2A 4MNOA 1AE2A 1Q12A 4YWLA 4JBJA 5GADC 4LF6Q 3HOUG 2CWAA 4JI1Q 1YEZA 1E24A 3IRBA 4POGA 2N49A 3D31A 1Z9FA 2UUAL 2L15A 4JI3L 2EXDA 4DV7L 1VQ6A 1WFQA 1K3RA 3EN2A 4JI6L 3PF4A 1K8GA 3KJPA 2DUDA 1N32L 1TWHH 4OXPA 4HJAA 1KD1C 2ASBA 1HZBA 1LUZA 5BR8Q 2Q2IA 1HNWQ 2A19A 1IBKQ 3J7ZC 2GN5A 3OW2A 4BBSG 1VQNA 1SR3A 4LFBQ 3AQQA 3MEFA 4K0KQ 1VQIA 1V43A 1D8LA 1XTDA 4O2DA 4GOPC 3S2HH 1VQLA 3CAMA 5GQOA 1VQ8A 3M7NA 4JC0A 2CKZB 2YYZA 1QVCA 3J81c 4A3JG 2ZTCA 2E5LL 4BY7G 3KOJA 2IT1A 2FXQA 1MJEA 1WI5A 2UXDQ 4OX9L 3GD7A 3PCOB 2ZJQA 4DV0L 4MTNA 4GLVB 1RL2A 2BA1A 1J6QA 4JOIC 4P75A 2YU9H 4JI6Q 2GVBA 4YWKA 3CCJA 4DR3L 1KHIA 2AKWB 3BU2A 1G51A 3TREA 4IJHA 3CCQA 1P16A 1I94Q 4JV5Q 2CFMA 1C7YA 2RHQB 3WWVA 3VDYA 3OTOL 5C4JH 2PI2E 3S24A 2K5HA 2R7DA 4LUVA 5IYCG 1PH2A 4A75A 1KIXA 4KHPL 5JJKA 3KYHC 5C4XG 1EQQA 4A3FG 4DR7Q 4X62Q 1NY4A 1OXVA 2NZOA 2K4KA 2R6GA 4JBWA 4A3IH 2ES2A 1E22A 5H1SE 1I3QH 4BY1H 2MO1A 2QEXA 1WJJA 3HOZG 2E5LQ 2N8NA 3CCEA 4JYAQ 4X64L 3ZJYC 1HNXQ 4DV6L 2Z6KA 2PQAA 3CPFA 5FLMH 1PH8A 2D62A 2YTYA 3G4SA 1JMCA 1PFSA 4HJ7A 2VQEL 3K7AH 1HZAA 2PQAB 3K7UC 3U4ZA 2R7ZG 2WAQE 4OO1I 4GNXA 2F4VQ 1BKBA 3STBD 2IX1A 4DV0Q 4C3HH 4GNXB 3GDEA 2JEAI 2LXJA 3T1YQ 2UU9L 2UXCQ 2RHSB 1N33L 4BXXG 4QY7A 1EQRA 4OWXB 1UE6A 3OTOQ 3Q8DA 1YJ9A 3GTOH 2AHOB 4YHHL 1HR0L 1FJGL 4HIOA 3I4MG 3A74A 5JEAG 1VQJA 4L5TA 3F2CA 4GN3B 1XNRL 2OTLA 3ERSX 1K73C 2VL6A 2D0OA 4X65L 3EIVA 2Y0SG 1VQEA 5ELNA 3FKIG 5C0XJ 1EIFA 1XJVA 3J81i 4DV6Q 4QQBX 3LGJA 1XPUA 1X3EA 1IZ6A 4YCUA 2UUCL 3HOUH 4IOAA 2VQEQ 5IP9G 3AFPA 4UP8A 3CPWA 1YJNA 1YBYA 4LFCL 3PIPA 4DR4Q 1IYJB 1SMXA 3OYYA 1AH9A 1S3OA 1P8LA 2AWOA 4R4QA 4DUZL 1N34L 5GAGC 3PIOA 1Y1VH 1N33Q 3S1QH 4OWTB 3UDFA 3UDIA 4A93G 4WJ4A 4LF6L 4X6AH 1X55A 4Y52H 4YHHQ 3PSIA 4JI1L 5LMUL 1FJGQ 1SLJA 1L1OA 4XTCS 1MKHA 4A3DG 3K80C 1VQBA 4ALPA 2E2IH 4JBMA 4GKJL 2MNAA 2RF4A 4BBRH 4HJ5A 1IL2A 4IO9A 2EQSA 2KENA 3PUXA 4JI8Q 5IY0A 1CUKA 1XPOA 3F1ZA 5FJ8G 4R4TA 4DK3C 4YCVA 5HGQA 3AEVA 4BY7H 3HOYG 1O7IA 1GVPA 1TWCH 1IBKL 3HOVH 1K83H 1UWVA 4DAMA 4LFCQ 4R4OA 1V9PA 3ER0A 4DUYQ 2E2HH 2E2JH 4LFBL 3KLWA 1PH6A 1B7YB 4R4CA 3L7ZC 2LSSA 2XTIA 2B63G 1K8AC 3S2DH 4JI5L 4J15A 4KLKA 4JI4Q 1G6PA 2OCEA 5M3FG 5LMUQ 3F2DA 2UXDL 4L5SA 3PO3G 3KDFA 4DV4L 4IPGA 4GKJQ 4A3FH 3CCMA 4AH6A 2JA9A 1W3SA 3KDFB 3KF6A 4IFDI 4AYBG 1SRUA 4EQ5A 1XMOQ 4P71A 5IYDG 4O0AA 1TWGH 3S1MH 1I94L 3L2PA 4A3KG 4JV5L 1H95A 3KF6B 1UE1A 1IBLQ 2B63H 5M3MG 1A8VA 1SROA 2NN6G 1BVSA 4LUOA 2K5NA 4EX5A 1IBML 4LNQA 1C9OA 3D0FA 4DK6C 5LMNW 2JA8G 2Y0SE 4P72A 4X62L 4GOPA 2OQ0A 4DR7L 4APVA 4BA1I 1C0AA 2AWNA 4GOPB 2XGTA 3RLFA 4JI5Q 2JA5G 5IP7H 2EIFA 1KAWA 1X54A 4JYAL 3TQYA 5ELOA 4YY3Q 1YITA 1HNXL 2KBNA 5J3BA 4C2MH 1QUQA 1BBUA 1XMQQ 3UDXA 3HFZB 4GS3A 1A0IA 3M85A 3H0GG 4DV4Q 2I5MX 1QUQB 1V1QA 4FDBA 4HIMA 1EWIA 1X56A 4QIWE 2F4VL 1Q81C 2CQOA 2JQOA 3G6EA 4A3GG 3F8TA 3BJUA 3NBHB 4P74A 4POFA 2HHHQ 3T1YL 2R93G 2UXCL 4JI0Q 3HOWH 2NVYH 4A3EH 1K9MC 1LM0A 2R92G 1VQCA 1T9HA 1HNWL 1IXRA 2Z0SA 3I7FA 4R1JA 3RNUA 4DV1Q 2BH8A 1IBMQ 4GLAC 1LYLA 1N36Q 1X3FA 1HJPA 1PH7A 1S40A 4A3MG 3S14H 2ZJRA 3TS0A 3S15H 4IOCA 4A3LG 1TXYA 3RLNA 4PMWA 2MO0A 2KHJA 1TWFH 1PYBA 1FL0A 1OXSC 3G48A 4RMFA 2VW9A 2BH2A 4A93H 3E9IA 4DR6Q 1CKOA 1UE7A 5GAEC 4IFDJ 1X65A 4QGUA 3I4NH 4A3BH 5IWAQ 3RN2A 4DNIA 3B6YA 2F52A 3GTMH 4A3DH 1SN8A 1TWAH 2AMCB 4P73A 4DR4L 3RN5A 1ASZA 4A3CG 1VCIA 1Q1BA 2JJQA 4C3JH 2HT1A 4LF4Q 5IT9c 4JBKA 2YTXA 4DR1Q 3E9HA 2PMZE 3I55A 1Y1WH 1OXUA 5K36G 3T1HQ 5FJ8H 2ZM6Q 3UDGA 1W2BA 4LF5Q 1WYDA 4IPHA 4B3SL 3HOYH 3CMEA 1VQGA 4JCVE 3MXNB 1WCMH 1QZGA 1L0WA 2K14A 2HIXA 1X6OA 3DM3A 4AYBE 4LF8Q 4JI7Q 4PG3A 4DPGA 2ID0A 5M5WH 3CF5A 4JI8L 1EIYB 4B3MQ 1Q82C 1FGUA 1UE5A 2B29A 1YHQA 3GTGH 3TS2A 2OTJA 3CP0A 3A0JA 4GKKQ 1B70B 5M3FH 4JG2A 2HIVA 4ME3A 1HR0W 5IYBG 4DUYL 3CCLA 1PH9A 3M3YH 1A62A 1PV4A 3CXCA 1VQ5A 4UP9A 3PV0A 5C0XG 1X9NA 1E3PA 2ALYB 4LF9Q 2WP8J 2NVTH 3H3VH 4WJ3M 5IYDH 4JI4L 3H3VI 3J80c 3RZOH 1VS0A 1Q86C 4B3SQ 2JK8A 1LTLA 5JJIA 2NN6I 2KCMA 1EUJA 3KJOA 2K52A 3PO2G 1G291 1OXTA 4BBSH 2VS1A 4B3RL 4IJLA 1R9TH 2YV5A 2K50A 2IHEA 3H15A 4IPDA 3GTQH 1XMOL 2H5XA 3GTLH 2V1CC 3SGIA 4KHZA 5AJ3Q 4DV2Q 4A3JH 1PH1A 1IBLL 2PNHA 4A4IA 3U50C 5FLXc 3RZDH 1GO3E 1DGSA 2N78A 3HKZG 1A63A 1D7QA 2DGYA 3H0GH 4DV5L 4UY8C 3CQZH 1HNZL 2UUBQ 3CD6A 1QVFA 4OO1G 1HZCA 4LF7Q 3DLLA 5C3EG 3S16H 3UE1A 4DKAC 1Q1EA 1CKMA 3E0EA 1L1OC 4MZ9A 2R93H 3CCUA 4YY3L 3GTKH 3J7A5 1NE3A 2R92H 3PUWA 2IY5B 1E7ZA 1XMQL 5IYCH 2GVAA 2VQFQ 4HJ9A 4DR2L 5C4XH 4B3RQ 1N8RC 1JB7A 4DR5L 2VUMG 3HKSA 4LWCA 1CKNA 2NZHA 1M1KC 4GN5A 3W5OA 2VNUD 3PUYA 1Z47A 4A3MH 2A8VA 4HJ8A 2HHHL 2ATWA 5C44G 1OTCA 4A3LH 4JI0L 5M5YH 2VZAA 1CKNB 4NB3A 4OWWB 4LFAQ 3S1NH 3HOZH 2OQKA 4Y7NH 1NBWA 3K81C 1VQFA 1VQMA 1QVGA 3HOXG 4DV1L 1B8AA 4DV5Q 1HH2P 2I0QA 1N36L 1HNZQ 2R7ZH 4LUZA 4X66Q 4AQYQ 2UXBQ 1VQDA 3CCSA 1MIUA 5LMNL 4OONA 3PF5A 1J5EL 1XNQL 4A3CH 1Q46A 5JJLA 3UE0A 4BXXH 2QGQA 2E8GA 1OXXK 3J80i 4DR6L 1YZ6A 3KF8B 4DV3Q 1Y1VG 1S72A 4PZ6A 4DR2Q 3I4MH 3CMAA 5IWAL 4JOIA 5IE8A 4DR5Q 2JA7G 3PUVA 4NXNQ 4GLXA 2R7FA 4LF4L 3S1RH 3FKIH 5EAYA 4DR1L 1VQOA 1U5KA 4JI2Q 4B3TL 2B3GA 4BBRG 4NXMQ 3T1HL 3ULJA 2Q2UA 2ZM6L 1AE3A 4LF5L 3FHWA 1CSQA 2RCNA 3TRZA 2JA6G 1VQKA 1N9WA 4DAYB 5IP9H 1X3GA 3RLOA 1VQ9A 5IYBH 4LF8L 1GKHA 4JI7L 3HOVG 5LMNQ 1J5EQ 3I2ZA 1XNQQ 2UUAQ 5M5XH 4JI3Q 5C0XI 3RR5A 4DV7Q 3NENA 4B3ML 1SE8A 4TQUS 3A5ZB 3M4PA 3HKZE 1N32Q 1JT8A 4GKKL 3JAMc 2K75A 3F2BA 1ASYA 1Y14B 4NPSA 1U0LA 3M4OH 1E1OA 3I4OA 4H02A 3TEHB 4UP7A 3PO2H 4GN4B 4HIKA 2D0PA 1NMFA 4XIGS 1FVIA 4HIDA 2N3SA 4YCWA 2MFIA 3W1GA 2LXKA 2YTVA 3FP9A 1KRTA 2WB1G 1NMGA 1YVCA 2CWPA 1UEBA 3STBC 1M90C 3G71A 1HZ9A 4B3TQ 4LF9L 4IFDG 4L5QA 3ICEA 3GTPH 1I50H 1L2FA 4RG1A 3NEMA 2WFWA 1KQSA 1Q7YC 1JE5A 4PZ8A 1BBWA 3U4VA 3PUZA 3L0OA 1KRSA 2CCZA 1EOVA 2Z6KC 3K0XA 1PH3A 3S17H 5GROA 1EYGA 4OX9Q 3KFUA 4LW1A 5GAHC 4YWMA 1WOCA 2ZTEA 5C3EH 5HY6A 1SFOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNX C;  4IPC A;  2VY3 A;  5JEA J;  3ULL A;  5AJ3 L;  3A5U A;  4QJF A;  4DV2 L;  4DR3 Q;  3GO5 A;  1PA6 A;  2KHI A;  3K8A A;  1VQH A;  5IP7 G;  2K5V A;  2F3I A;  2MQH A;  3PO3 H;  4QL5 A;  3CC7 A;  3BZC A;  3I56 A;  2I5H A;  2UUB L;  3CW2 C;  2VUM H;  4KHP Q;  4PZ7 A;  4LF7 L;  1I5F A;  2HQL A;  3CCR A;  3CCV A;  1PH5 A;  5C44 H;  4A3K H;  4L5R C;  1KL9 A;  5M3M H;  1YHB A;  3HOW G;  4TVA B;  3HOX H;  2VQF L;  4X64 Q;  4A3E G;  1KC8 C;  1NJI C;  2C35 B;  3CC4 A;  2JA8 H;  1NTG A;  3AFQ A;  4R4I A;  1EFW A;  1Q8K A;  1XPR A;  2Q2T A;  4AIM A;  4A76 A;  2IHF A;  4BA2 I;  1I6H H;  1YJW A;  4A3I G;  2JA5 H;  1VQ7 A;  1MJC A;  1JJ2 A;  4LFA L;  1KXL A;  2IX0 A;  1PYS B;  1VQA A;  3BZK A;  4BY1 G;  3J81 j;  3PGZ A;  2I5L X;  3AYH B;  3JAM i;  1YIJ A;  2UU9 Q;  2NVQ H;  5E7N A;  2KCT A;  2JEB I;  1RIP A;  1E1T A;  2ZTD A;  3JC6 6;  3ULP A;  2BA0 A;  5FLM G;  2ZJP A;  3M4Q A;  2JA7 H;  1HR0 Q;  4X66 L;  3I4N G;  4AQY L;  4A3G H;  2UXB L;  1PVO A;  4A3B G;  1GD7 A;  1YNX A;  1XNR Q;  2A1A A;  1QZH A;  1VQP A;  1L1O B;  3EBE A;  2Q2H A;  4X65 Q;  1K0R A;  4DV3 L;  1Y1W G;  2QA4 A;  2JA6 H;  3GTJ H;  2WB1 E;  2UUC Q;  1JJC B;  5BR8 L;  3NEL A;  1YHA A;  4KI0 A;  1VQ4 A;  1PHJ A;  1CSP A;  3M9B A;  4NXN L;  1GM5 A;  1WCM G;  2PI2 A;  2JE6 I;  3U58 A;  5DLQ E;  2OWO A;  2NVX H;  4C3I H;  3CC2 A;  4JI2 L;  1JJG A;  4K0K L;  4NXM L;  4UPA A;  4DUZ Q;  2WAQ G;  1N34 Q;  3W1B A;  1PH4 A;  1YI2 A;  4MNO A;  1AE2 A;  1Q12 A;  4YWL A;  4JBJ A;  5GAD C;  4LF6 Q;  3HOU G;  2CWA A;  4JI1 Q;  1YEZ A;  1E24 A;  3IRB A;  4POG A;  2N49 A;  3D31 A;  1Z9F A;  2UUA L;  2L15 A;  4JI3 L;  2EXD A;  4DV7 L;  1VQ6 A;  1WFQ A;  1K3R A;  3EN2 A;  4JI6 L;  3PF4 A;  1K8G A;  3KJP A;  2DUD A;  1N32 L;  1TWH H;  4OXP A;  4HJA A;  1KD1 C;  2ASB A;  1HZB A;  1LUZ A;  5BR8 Q;  2Q2I A;  1HNW Q;  2A19 A;  1IBK Q;  3J7Z C;  2GN5 A;  3OW2 A;  4BBS G;  1VQN A;  1SR3 A;  4LFB Q;  3AQQ A;  3MEF A;  4K0K Q;  1VQI A;  1V43 A;  1D8L A;  1XTD A;  4O2D A;  4GOP C;  3S2H H;  1VQL A;  3CAM A;  5GQO A;  1VQ8 A;  3M7N A;  4JC0 A;  2CKZ B;  2YYZ A;  1QVC A;  3J81 c;  4A3J G;  2ZTC A;  2E5L L;  4BY7 G;  3KOJ A;  2IT1 A;  2FXQ A;  1MJE A;  1WI5 A;  2UXD Q;  4OX9 L;  3GD7 A;  3PCO B;  2ZJQ A;  4DV0 L;  4MTN A;  4GLV B;  1RL2 A;  2BA1 A;  1J6Q A;  4JOI C;  4P75 A;  2YU9 H;  4JI6 Q;  2GVB A;  4YWK A;  3CCJ A;  4DR3 L;  1KHI A;  2AKW B;  3BU2 A;  1G51 A;  3TRE A;  4IJH A;  3CCQ A;  1P16 A;  1I94 Q;  4JV5 Q;  2CFM A;  1C7Y A;  2RHQ B;  3WWV A;  3VDY A;  3OTO L;  5C4J H;  2PI2 E;  3S24 A;  2K5H A;  2R7D A;  4LUV A;  5IYC G;  1PH2 A;  4A75 A;  1KIX A;  4KHP L;  5JJK A;  3KYH C;  5C4X G;  1EQQ A;  4A3F G;  4DR7 Q;  4X62 Q;  1NY4 A;  1OXV A;  2NZO A;  2K4K A;  2R6G A;  4JBW A;  4A3I H;  2ES2 A;  1E22 A;  5H1S E;  1I3Q H;  4BY1 H;  2MO1 A;  2QEX A;  1WJJ A;  3HOZ G;  2E5L Q;  2N8N A;  3CCE A;  4JYA Q;  4X64 L;  3ZJY C;  1HNX Q;  4DV6 L;  2Z6K A;  2PQA A;  3CPF A;  5FLM H;  1PH8 A;  2D62 A;  2YTY A;  3G4S A;  1JMC A;  1PFS A;  4HJ7 A;  2VQE L;  3K7A H;  1HZA A;  2PQA B;  3K7U C;  3U4Z A;  2R7Z G;  2WAQ E;  4OO1 I;  4GNX A;  2F4V Q;  1BKB A;  3STB D;  2IX1 A;  4DV0 Q;  4C3H H;  4GNX B;  3GDE A;  2JEA I;  2LXJ A;  3T1Y Q;  2UU9 L;  2UXC Q;  2RHS B;  1N33 L;  4BXX G;  4QY7 A;  1EQR A;  4OWX B;  1UE6 A;  3OTO Q;  3Q8D A;  1YJ9 A;  3GTO H;  2AHO B;  4YHH L;  1HR0 L;  1FJG L;  4HIO A;  3I4M G;  3A74 A;  5JEA G;  1VQJ A;  4L5T A;  3F2C A;  4GN3 B;  1XNR L;  2OTL A;  3ERS X;  1K73 C;  2VL6 A;  2D0O A;  4X65 L;  3EIV A;  2Y0S G;  1VQE A;  5ELN A;  3FKI G;  5C0X J;  1EIF A;  1XJV A;  3J81 i;  4DV6 Q;  4QQB X;  3LGJ A;  1XPU A;  1X3E A;  1IZ6 A;  4YCU A;  2UUC L;  3HOU H;  4IOA A;  2VQE Q;  5IP9 G;  3AFP A;  4UP8 A;  3CPW A;  1YJN A;  1YBY A;  4LFC L;  3PIP A;  4DR4 Q;  1IYJ B;  1SMX A;  3OYY A;  1AH9 A;  1S3O A;  1P8L A;  2AWO A;  4R4Q A;  4DUZ L;  1N34 L;  5GAG C;  3PIO A;  1Y1V H;  1N33 Q;  3S1Q H;  4OWT B;  3UDF A;  3UDI A;  4A93 G;  4WJ4 A;  4LF6 L;  4X6A H;  1X55 A;  4Y52 H;  4YHH Q;  3PSI A;  4JI1 L;  5LMU L;  1FJG Q;  1SLJ A;  1L1O A;  4XTC S;  1MKH A;  4A3D G;  3K80 C;  1VQB A;  4ALP A;  2E2I H;  4JBM A;  4GKJ L;  2MNA A;  2RF4 A;  4BBR H;  4HJ5 A;  1IL2 A;  4IO9 A;  2EQS A;  2KEN A;  3PUX A;  4JI8 Q;  5IY0 A;  1CUK A;  1XPO A;  3F1Z A;  5FJ8 G;  4R4T A;  4DK3 C;  4YCV A;  5HGQ A;  3AEV A;  4BY7 H;  3HOY G;  1O7I A;  1GVP A;  1TWC H;  1IBK L;  3HOV H;  1K83 H;  1UWV A;  4DAM A;  4LFC Q;  4R4O A;  1V9P A;  3ER0 A;  4DUY Q;  2E2H H;  2E2J H;  4LFB L;  3KLW A;  1PH6 A;  1B7Y B;  4R4C A;  3L7Z C;  2LSS A;  2XTI A;  2B63 G;  1K8A C;  3S2D H;  4JI5 L;  4J15 A;  4KLK A;  4JI4 Q;  1G6P A;  2OCE A;  5M3F G;  5LMU Q;  3F2D A;  2UXD L;  4L5S A;  3PO3 G;  3KDF A;  4DV4 L;  4IPG A;  4GKJ Q;  4A3F H;  3CCM A;  4AH6 A;  2JA9 A;  1W3S A;  3KDF B;  3KF6 A;  4IFD I;  4AYB G;  1SRU A;  4EQ5 A;  1XMO Q;  4P71 A;  5IYD G;  4O0A A;  1TWG H;  3S1M H;  1I94 L;  3L2P A;  4A3K G;  4JV5 L;  1H95 A;  3KF6 B;  1UE1 A;  1IBL Q;  2B63 H;  5M3M G;  1A8V A;  1SRO A;  2NN6 G;  1BVS A;  4LUO A;  2K5N A;  4EX5 A;  1IBM L;  4LNQ A;  1C9O A;  3D0F A;  4DK6 C;  5LMN W;  2JA8 G;  2Y0S E;  4P72 A;  4X62 L;  4GOP A;  2OQ0 A;  4DR7 L;  4APV A;  4BA1 I;  1C0A A;  2AWN A;  4GOP B;  2XGT A;  3RLF A;  4JI5 Q;  2JA5 G;  5IP7 H;  2EIF A;  1KAW A;  1X54 A;  4JYA L;  3TQY A;  5ELO A;  4YY3 Q;  1YIT A;  1HNX L;  2KBN A;  5J3B A;  4C2M H;  1QUQ A;  1BBU A;  1XMQ Q;  3UDX A;  3HFZ B;  4GS3 A;  1A0I A;  3M85 A;  3H0G G;  4DV4 Q;  2I5M X;  1QUQ B;  1V1Q A;  4FDB A;  4HIM A;  1EWI A;  1X56 A;  4QIW E;  2F4V L;  1Q81 C;  2CQO A;  2JQO A;  3G6E A;  4A3G G;  3F8T A;  3BJU A;  3NBH B;  4P74 A;  4POF A;  2HHH Q;  3T1Y L;  2R93 G;  2UXC L;  4JI0 Q;  3HOW H;  2NVY H;  4A3E H;  1K9M C;  1LM0 A;  2R92 G;  1VQC A;  1T9H A;  1HNW L;  1IXR A;  2Z0S A;  3I7F A;  4R1J A;  3RNU A;  4DV1 Q;  2BH8 A;  1IBM Q;  4GLA C;  1LYL A;  1N36 Q;  1X3F A;  1HJP A;  1PH7 A;  1S40 A;  4A3M G;  3S14 H;  2ZJR A;  3TS0 A;  3S15 H;  4IOC A;  4A3L G;  1TXY A;  3RLN A;  4PMW A;  2MO0 A;  2KHJ A;  1TWF H;  1PYB A;  1FL0 A;  1OXS C;  3G48 A;  4RMF A;  2VW9 A;  2BH2 A;  4A93 H;  3E9I A;  4DR6 Q;  1CKO A;  1UE7 A;  5GAE C;  4IFD J;  1X65 A;  4QGU A;  3I4N H;  4A3B H;  5IWA Q;  3RN2 A;  4DNI A;  3B6Y A;  2F52 A;  3GTM H;  4A3D H;  1SN8 A;  1TWA H;  2AMC B;  4P73 A;  4DR4 L;  3RN5 A;  1ASZ A;  4A3C G;  1VCI A;  1Q1B A;  2JJQ A;  4C3J H;  2HT1 A;  4LF4 Q;  5IT9 c;  4JBK A;  2YTX A;  4DR1 Q;  3E9H A;  2PMZ E;  3I55 A;  1Y1W H;  1OXU A;  5K36 G;  3T1H Q;  5FJ8 H;  2ZM6 Q;  3UDG A;  1W2B A;  4LF5 Q;  1WYD A;  4IPH A;  4B3S L;  3HOY H;  3CME A;  1VQG A;  4JCV E;  3MXN B;  1WCM H;  1QZG A;  1L0W A;  2K14 A;  2HIX A;  1X6O A;  3DM3 A;  4AYB E;  4LF8 Q;  4JI7 Q;  4PG3 A;  4DPG A;  2ID0 A;  5M5W H;  3CF5 A;  4JI8 L;  1EIY B;  4B3M Q;  1Q82 C;  1FGU A;  1UE5 A;  2B29 A;  1YHQ A;  3GTG H;  3TS2 A;  2OTJ A;  3CP0 A;  3A0J A;  4GKK Q;  1B70 B;  5M3F H;  4JG2 A;  2HIV A;  4ME3 A;  1HR0 W;  5IYB G;  4DUY L;  3CCL A;  1PH9 A;  3M3Y H;  1A62 A;  1PV4 A;  3CXC A;  1VQ5 A;  4UP9 A;  3PV0 A;  5C0X G;  1X9N A;  1E3P A;  2ALY B;  4LF9 Q;  2WP8 J;  2NVT H;  3H3V H;  4WJ3 M;  5IYD H;  4JI4 L;  3H3V I;  3J80 c;  3RZO H;  1VS0 A;  1Q86 C;  4B3S Q;  2JK8 A;  1LTL A;  5JJI A;  2NN6 I;  2KCM A;  1EUJ A;  3KJO A;  2K52 A;  3PO2 G;  1G29 1;  1OXT A;  4BBS H;  2VS1 A;  4B3R L;  4IJL A;  1R9T H;  2YV5 A;  2K50 A;  2IHE A;  3H15 A;  4IPD A;  3GTQ H;  1XMO L;  2H5X A;  3GTL H;  2V1C C;  3SGI A;  4KHZ A;  5AJ3 Q;  4DV2 Q;  4A3J H;  1PH1 A;  1IBL L;  2PNH A;  4A4I A;  3U50 C;  5FLX c;  3RZD H;  1GO3 E;  1DGS A;  2N78 A;  3HKZ G;  1A63 A;  1D7Q A;  2DGY A;  3H0G H;  4DV5 L;  4UY8 C;  3CQZ H;  1HNZ L;  2UUB Q;  3CD6 A;  1QVF A;  4OO1 G;  1HZC A;  4LF7 Q;  3DLL A;  5C3E G;  3S16 H;  3UE1 A;  4DKA C;  1Q1E A;  1CKM A;  3E0E A;  1L1O C;  4MZ9 A;  2R93 H;  3CCU A;  4YY3 L;  3GTK H;  3J7A 5;  1NE3 A;  2R92 H;  3PUW A;  2IY5 B;  1E7Z A;  1XMQ L;  5IYC H;  2GVA A;  2VQF Q;  4HJ9 A;  4DR2 L;  5C4X H;  4B3R Q;  1N8R C;  1JB7 A;  4DR5 L;  2VUM G;  3HKS A;  4LWC A;  1CKN A;  2NZH A;  1M1K C;  4GN5 A;  3W5O A;  2VNU D;  3PUY A;  1Z47 A;  4A3M H;  2A8V A;  4HJ8 A;  2HHH L;  2ATW A;  5C44 G;  1OTC A;  4A3L H;  4JI0 L;  5M5Y H;  2VZA A;  1CKN B;  4NB3 A;  4OWW B;  4LFA Q;  3S1N H;  3HOZ H;  2OQK A;  4Y7N H;  1NBW A;  3K81 C;  1VQF A;  1VQM A;  1QVG A;  3HOX G;  4DV1 L;  1B8A A;  4DV5 Q;  1HH2 P;  2I0Q A;  1N36 L;  1HNZ Q;  2R7Z H;  4LUZ A;  4X66 Q;  4AQY Q;  2UXB Q;  1VQD A;  3CCS A;  1MIU A;  5LMN L;  4OON A;  3PF5 A;  1J5E L;  1XNQ L;  4A3C H;  1Q46 A;  5JJL A;  3UE0 A;  4BXX H;  2QGQ A;  2E8G A;  1OXX K;  3J80 i;  4DR6 L;  1YZ6 A;  3KF8 B;  4DV3 Q;  1Y1V G;  1S72 A;  4PZ6 A;  4DR2 Q;  3I4M H;  3CMA A;  5IWA L;  4JOI A;  5IE8 A;  4DR5 Q;  2JA7 G;  3PUV A;  4NXN Q;  4GLX A;  2R7F A;  4LF4 L;  3S1R H;  3FKI H;  5EAY A;  4DR1 L;  1VQO A;  1U5K A;  4JI2 Q;  4B3T L;  2B3G A;  4BBR G;  4NXM Q;  3T1H L;  3ULJ A;  2Q2U A;  2ZM6 L;  1AE3 A;  4LF5 L;  3FHW A;  1CSQ A;  2RCN A;  3TRZ A;  2JA6 G;  1VQK A;  1N9W A;  4DAY B;  5IP9 H;  1X3G A;  3RLO A;  1VQ9 A;  5IYB H;  4LF8 L;  1GKH A;  4JI7 L;  3HOV G;  5LMN Q;  1J5E Q;  3I2Z A;  1XNQ Q;  2UUA Q;  5M5X H;  4JI3 Q;  5C0X I;  3RR5 A;  4DV7 Q;  3NEN A;  4B3M L;  1SE8 A;  4TQU S;  3A5Z B;  3M4P A;  3HKZ E;  1N32 Q;  1JT8 A;  4GKK L;  3JAM c;  2K75 A;  3F2B A;  1ASY A;  1Y14 B;  4NPS A;  1U0L A;  3M4O H;  1E1O A;  3I4O A;  4H02 A;  3TEH B;  4UP7 A;  3PO2 H;  4GN4 B;  4HIK A;  2D0P A;  1NMF A;  4XIG S;  1FVI A;  4HID A;  2N3S A;  4YCW A;  2MFI A;  3W1G A;  2LXK A;  2YTV A;  3FP9 A;  1KRT A;  2WB1 G;  1NMG A;  1YVC A;  2CWP A;  1UEB A;  3STB C;  1M90 C;  3G71 A;  1HZ9 A;  4B3T Q;  4LF9 L;  4IFD G;  4L5Q A;  3ICE A;  3GTP H;  1I50 H;  1L2F A;  4RG1 A;  3NEM A;  2WFW A;  1KQS A;  1Q7Y C;  1JE5 A;  4PZ8 A;  1BBW A;  3U4V A;  3PUZ A;  3L0O A;  1KRS A;  2CCZ A;  1EOV A;  2Z6K C;  3K0X A;  1PH3 A;  3S17 H;  5GRO A;  1EYG A;  4OX9 Q;  3KFU A;  4LW1 A;  5GAH C;  4YWM A;  1WOC A;  2ZTE A;  5C3E H;  5HY6 A;  1SFO H; 
#chains in the Genus database with same CATH topology
 2NVX H;  5E4X A;  1CM9 A;  4A3F B;  1KAA A;  5FO7 B;  2MQH A;  1KDB A;  2E75 C;  3BZC A;  3CW2 C;  4PZ7 A;  3TZU A;  2EXZ A;  2K6A A;  1SNP A;  1PH5 A;  4L5R C;  1IL8 A;  1GOZ A;  4A3E G;  4X64 Q;  3J7A F;  1NTG A;  2K5D A;  1Q8K A;  3E0J A;  2Q2T A;  4A76 A;  3DXJ C;  1NUC A;  2TMP A;  4A3I G;  2IX0 A;  4BY1 G;  1E2W A;  3Q23 A;  1RIP A;  2F0M A;  2NVY B;  1II3 A;  1JOK A;  1I4G A;  1XNR Q;  2K33 A;  1LTT D;  1B2T A;  1VF5 C;  1STG A;  4C3J G;  1STH A;  2JA6 H;  2LY7 A;  3SK8 A;  1HQM C;  4FF3 A;  2PNR C;  3GTJ H;  4A93 B;  4KI0 A;  1GM5 A;  4NXN L;  2PI2 A;  5DLQ E;  1EIH A;  1BNZ A;  1LAC A;  4JI2 L;  4DUZ Q;  3R2I A;  4A3D B;  4NMZ A;  1KTK A;  1Q12 A;  2EJM A;  2WII B;  1Y1W B;  4JBJ A;  3HOU G;  4JI1 Q;  3VA7 A;  3HOY B;  5DM7 3;  4N8F A;  1WFQ A;  1LT3 D;  2VXW A;  5J39 A;  4JI6 L;  3J81 E;  1K8G A;  1TWH H;  2B2U A;  1ZYR D;  1KD1 C;  1HZB A;  1TII D;  1LUZ A;  3GTG B;  2A19 A;  1MBY A;  2GN5 A;  3OW2 A;  2EZV A;  3MEF A;  3VYU A;  1VQI A;  1V43 A;  4GOP C;  3S2H H;  3CAM A;  1VQ8 A;  3M7N A;  4JC0 A;  1QVC A;  2ZTC A;  4BY7 G;  3KOJ A;  1EWH A;  1SJE D;  1WVL A;  1MJE A;  2PPB C;  2UXD Q;  3RZO B;  3GD7 A;  3PCO B;  3C1F A;  1W6K A;  3H09 A;  4FF1 A;  4JOI C;  4LMQ D;  2K03 A;  3BU2 A;  1G51 A;  3TRE A;  4JV5 Q;  1I94 Q;  1DM0 B;  5C4J H;  4DFA A;  1EY5 A;  4A3J B;  5IYC G;  2R7D A;  3UI2 A;  4IUP A;  1RDP D;  4DR7 Q;  4X62 Q;  4JBW A;  3H0G B;  1E22 A;  1PTO H;  2MJ8 A;  2E5L Q;  2KCN A;  3EVQ A;  4JYA Q;  4X64 L;  1YNJ D;  4MIU A;  2PQA A;  2C9O A;  2L55 A;  2LFN A;  5FLM H;  1PH8 A;  1JMC A;  2AQ2 B;  2R92 B;  1HZA A;  2WAQ E;  4GNX A;  1SDF A;  1TS5 A;  1GUT A;  3C46 A;  1QG7 A;  5C4X B;  2QEJ C;  5A2Q E;  3T1Y Q;  2UXC Q;  2RHS B;  5DAU A;  1EQR A;  4OWX B;  1UE6 A;  4CHT B;  3Q8D A;  3S1N B;  4YHH L;  2XWB B;  3A74 A;  1XNR L;  1DOK A;  2OTL A;  1K73 C;  2VL6 A;  5I6Y A;  1VQE A;  4N9T A;  1M4V A;  3FKI G;  1EIF A;  4DV6 Q;  4QQB X;  1XPU A;  1A2U A;  4IQZ A;  5IP9 G;  3AFP A;  5CC4 A;  1YBY A;  3BDC A;  5C6A A;  1IYJ B;  2AWO A;  4DUZ L;  3S1Q H;  5FLX L;  3G6J B;  3ERO A;  4ID6 A;  1L0Y B;  2A69 C;  4JI1 L;  1ILP A;  5JVH 3;  1MKH A;  1ICF B;  2E2I H;  3NQI A;  4GKJ L;  2MNA A;  2RF4 A;  4IO9 A;  2BOS A;  4RA8 A;  3PUX A;  1PTO F;  2B2W C;  4F8M A;  1TWC H;  2PZW A;  1K83 H;  4R4O A;  1WD0 A;  4XQN A;  3M4O B;  3KLW A;  3AMU A;  2SNS A;  4JI5 L;  3R8B A;  1F77 A;  1G6P A;  2OCE A;  5LMU Q;  2UXD L;  4M8A A;  3WOE A;  4DV4 L;  4A3F H;  5COY A;  3HKZ B;  1I4Q A;  2NTS A;  2A6E D;  4O0A A;  4JV5 L;  1H95 A;  1I94 L;  4A3K G;  2B63 B;  5M3M G;  3NSW A;  1A8V A;  1SFO B;  4UDU C;  1BVS A;  3FRP B;  1IBM L;  1PTO D;  1B9N A;  2Y0S E;  4L8J A;  4X62 L;  2JA8 G;  4DR7 L;  1ICW A;  4APV A;  1WTR A;  1C0A A;  5CGK A;  2VUM B;  3RLF A;  2JA5 G;  1KAW A;  2BDN A;  4JYA L;  5ELO A;  1YIT A;  5J3B A;  3V96 A;  4DXF A;  3UDX A;  1U9R A;  2F0J A;  1QUQ B;  3NBH A;  4HIM A;  1GUO A;  1Q81 C;  3F8T A;  4H44 C;  3BJU A;  3FPP A;  2HHH Q;  3T1Y L;  2R93 G;  2UXC L;  3T51 B;  4JI0 Q;  2NVY H;  4X3T A;  1LM0 A;  2BCO A;  1S5E D;  1U4R A;  2L0C A;  4QUC A;  3SHL A;  2EOT A;  2Z6B A;  4WOR A;  4EVO A;  1AW7 A;  1HJP A;  1JC7 A;  1CQV A;  4A3L G;  1TXY A;  2WKD A;  3A56 A;  3W3A A;  4RMF A;  1OXS C;  4A93 H;  4DR6 Q;  3R93 A;  1E2Z A;  1V1O A;  4CDC C;  2QDB A;  2F52 A;  4OGQ C;  4A3D H;  4DGZ A;  5EBD A;  5IGB A;  1G91 A;  1VCI A;  3LWE A;  1D1I A;  2HT1 A;  4LF4 Q;  1H9K A;  5IT9 c;  1SMY C;  2EJF C;  4FNF A;  1Y1W H;  1J8I A;  1OXU A;  5K36 G;  3UDG A;  4C3I B;  3MXN A;  3A8K E;  3HOY H;  5D65 A;  1UNS A;  1L0W A;  2HIX A;  4LF8 Q;  3DM3 A;  5J22 A;  3V2T A;  3J80 E;  3MXU A;  3GTG H;  3TS2 A;  3GV3 A;  2OTJ A;  5EPL A;  3CP0 A;  2HIV A;  1B53 A;  5G3L F;  1DCZ A;  1UAP A;  5CMD A;  5IYB G;  1VMC A;  3CCL A;  1Z6H A;  3SE0 A;  1PH9 A;  1STA A;  2EJG C;  4UP9 A;  3PV0 A;  3RZO H;  2TSS A;  1Q86 C;  3D4D A;  2NWG A;  3PO2 G;  1OXT A;  4FF4 A;  2VS1 A;  1K3B C;  2K50 A;  1LTA D;  1DYQ A;  4KTA A;  3EQL C;  5AJ3 Q;  4DV2 Q;  1BCP B;  4A3J H;  5FLX c;  2PO4 A;  1DGS A;  4KK7 A;  4G7O C;  1WTX A;  5JAV A;  3H0G H;  4UY8 C;  4TRD A;  2UUB Q;  2OEO A;  1RKN A;  1QVF A;  3MAQ A;  4XXE A;  4QUF A;  5G3L D;  4DKA C;  1G2T A;  4C1N K;  1CKM A;  4MZ9 A;  2XNA C;  3J7A 5;  2K04 A;  2R92 H;  4A3I B;  2EYJ A;  1K28 A;  4HJ9 A;  4BY1 B;  5C4X H;  1CK1 A;  4WJW A;  2EY1 A;  2XVS A;  2DN8 A;  1M1K C;  4GN5 A;  4X3S A;  3ZYY X;  2ATW A;  2HHH L;  5C44 G;  1UEA B;  4JI0 L;  1E0B A;  3T56 B;  4LFA Q;  3S1N H;  1WTH A;  1LT4 D;  1QVG A;  2FFK B;  4L6T B;  1NR2 A;  3HOX G;  4DV5 Q;  2I0Q A;  4NDX A;  3R3O A;  1F9Q A;  5CBA E;  4KN7 C;  4AQY Q;  5HUR A;  2UXB Q;  5LMN L;  4OON A;  3PF5 A;  1XNQ L;  3GTO B;  1Q46 A;  3UE0 A;  2HUG A;  3J81 L;  4DR6 L;  1M8A A;  4DV3 Q;  4WFN 3;  3I4L A;  1GJX A;  4JOI A;  1B4O A;  3P75 A;  1VMP A;  3QOJ A;  1CZW A;  4HMJ A;  3HOU B;  2DJG C;  4LF4 L;  4RCO A;  2B3G A;  1SE4 A;  3MXG A;  1AE3 A;  1H9S A;  3HG9 A;  3FHW A;  2RCN A;  4IN3 A;  1BDO A;  2EYO A;  4LF8 L;  1B1Z A;  3DEP A;  5IGC A;  3I2Z A;  5COR A;  3VYR A;  5EGT A;  4OIK A;  1Q8I A;  3RR5 A;  2F0P A;  5BN4 A;  5C0X I;  5DNF A;  4TQU S;  4ZYS A;  3IFT A;  1ASY A;  2ICE C;  3NUC A;  3M4O H;  3I4O A;  4UP7 A;  4EGV A;  1S5B D;  3V05 A;  3QJY A;  4HID A;  4BY7 B;  3W1G A;  2LXK A;  2WB1 G;  2CWP A;  3TP5 A;  1DXM A;  3ICE A;  4ZQ3 A;  4RG1 A;  1MD2 D;  4FXK C;  2F0U A;  1KQS A;  3NTH A;  3FDT A;  3PUZ A;  2P5Z X;  3L0O A;  1JWU D;  1PH3 A;  5GRO A;  4OX9 Q;  4YWM A;  1WOC A;  2B63 H;  1SFO H;  3N52 A;  4GNX C;  2RBM A;  4IPC A;  5AJ3 L;  4DV2 L;  4DR3 Q;  3OMG A;  5A2Q L;  3GO5 A;  1VQH A;  1PYW D;  2F3I A;  2L12 A;  5CV9 A;  4F87 A;  2UUB L;  2VUM H;  1B44 D;  1AP0 A;  4KHP Q;  2XIW A;  2HQL A;  3CCR A;  3CCV A;  1OO9 B;  5C3X A;  1YHB A;  1KC8 C;  1ML0 D;  3AFQ A;  4R4I A;  4X3U A;  2K5Q A;  2DJF C;  4BA2 I;  1A2T A;  3A8I E;  4HN7 A;  2I46 A;  1VQ7 A;  4QCL A;  4LFA L;  1TY0 A;  2K5W A;  3PGZ A;  2I5L X;  3JAM i;  1YIJ A;  2UU9 Q;  1D5X C;  1I4P A;  2ZTD A;  3E6Z X;  1TKW B;  3ULP A;  1HCZ A;  3HOW B;  2KED A;  4IUT A;  4AQY L;  2UXB L;  1JE4 A;  1YNX A;  5I4D A;  2A1A A;  1FYC A;  1L1O B;  2F0O A;  4DV3 L;  4B9X A;  3S14 B;  2QA4 A;  2RSN A;  4U68 A;  5M9O A;  1JOQ A;  1JJC B;  5BR8 L;  3NEL A;  1VQ4 A;  2F3W A;  2PCF B;  1JCK B;  3U58 A;  3I4N B;  3OIP A;  4C3I H;  4A3B B;  1JJG A;  4K0K L;  1EY8 A;  3GTM B;  1ZYR C;  4Q0F A;  1YI2 A;  1AE2 A;  1JB3 A;  4CDD C;  1NR4 A;  1EYC A;  5ELD A;  3NBI A;  2SDF A;  3ONA B;  1YEZ A;  3IRB A;  1EZ6 A;  2N49 A;  3D31 A;  4EQN A;  1RTO A;  2L15 A;  4G4K A;  2EXD A;  1VQ6 A;  3EN2 A;  2EE1 A;  1WCM B;  3I91 A;  3KJP A;  3C2P A;  5JJZ A;  1RF2 D;  4OXP A;  1KDA A;  1IBK Q;  4PMC A;  4BBS G;  4J6H A;  3AQQ A;  5HGT A;  1XTD A;  4DAY A;  2QKI C;  2D5D A;  1VQL A;  5GQO A;  3M3Y B;  2YYZ A;  4XQQ A;  1DD2 A;  3P20 A;  4K5X A;  3J81 c;  3TN2 A;  2NVT B;  2BE5 D;  2FXQ A;  1LTI D;  4OX9 L;  1EY4 A;  1C48 A;  1RL2 A;  4GLV B;  4JI6 Q;  4P75 A;  1PMR A;  3VR2 A;  2GVB A;  4DR3 L;  4JVZ A;  1GXD C;  1YNJ C;  4HAE A;  3GTQ B;  1D1K A;  3D3R A;  2RHQ B;  3WWV A;  3WDN A;  5EPK A;  3X3M A;  3RUZ A;  2QCP X;  2K5H A;  4KHP L;  4A75 A;  3KYH C;  3RZD B;  5KNC A;  1NY4 A;  1OXV A;  4A3I H;  1SND A;  2K4K A;  2SEB D;  3RMH A;  2ES2 A;  4FF2 A;  1IYV A;  4K2L A;  1EYD A;  3CQZ B;  4L63 B;  2L4N A;  1IHZ A;  4BY1 H;  3HOZ G;  4MTK A;  3CCE A;  3S16 B;  2DNE A;  1HNX Q;  2K1B A;  2R93 B;  2YTY A;  1SE3 A;  3A7L A;  4OO1 H;  2VQE L;  3E3X A;  2F4V Q;  3NWT A;  1XWE A;  2IX1 A;  1CQF A;  2UU9 L;  2JXM B;  4H7B A;  3PMF A;  1PRT F;  2CW0 D;  3MFG A;  3GTO H;  2M00 A;  2AHO B;  1FJG L;  3HRZ C;  2QW7 A;  1VQJ A;  4L5T A;  4DAP A;  5JEA G;  4GN3 B;  5F2D A;  5I9P A;  2F0Q A;  2R7Z B;  3J80 L;  5D14 A;  1D6E C;  1D5M C;  4RGM A;  1K8O A;  3IKJ A;  1X3E A;  3MTS A;  3HOU H;  2BDO A;  4FP5 D;  1YJN A;  4FXD A;  2FJ2 A;  3PIP A;  3I4M B;  4N8X 1;  3OYY A;  1BCP F;  1DJR D;  1P8L A;  2Q8R E;  1RJT A;  2FHT A;  3PIO A;  4OEL B;  3VYS A;  2KEC A;  3S1R B;  4WJ4 A;  4Y52 H;  1NNX A;  4YHH Q;  2RCF A;  4RGO S;  3TP6 A;  5FO8 B;  4ALP A;  1VQB A;  4HJ5 A;  2KEN A;  5FJ8 G;  4R4T A;  4DK3 C;  2HD3 A;  4ZCK A;  4BY7 H;  1D2B A;  1IBK L;  1UWV A;  4GZY C;  1V9P A;  4K5V A;  1PFN A;  3ER0 A;  2DY7 A;  2A6E C;  2C5C A;  3QG1 A;  1PH6 A;  1B7Y B;  3PO2 B;  2EYL A;  1LTB D;  3Q6S A;  4PNY A;  4J15 A;  3URY A;  2OXP A;  4JI4 Q;  1B3A A;  1BCP D;  4KHV A;  2KUM A;  1PTO C;  2L9H A;  1I50 B;  4L5S A;  1FNU A;  2PZT A;  5ELB A;  4GKJ Q;  2JA9 A;  4IFD H;  3KDF B;  2CQA A;  1XMO Q;  5IYD G;  4XDX A;  3KF6 B;  1O7L A;  1UE1 A;  4Q5V A;  1SRO A;  2NN6 G;  1HFN A;  1CA6 A;  1QE6 A;  1LTG D;  2A68 D;  2J0T D;  1F2Y A;  1WTQ A;  2OQ0 A;  3SK5 A;  3PO3 B;  4BA1 I;  4CJ0 B;  1ENA A;  3T4A C;  4JI5 Q;  2A73 B;  5IP7 H;  1SNC A;  2CVR A;  1X54 A;  2M9V A;  4AYB B;  3TQY A;  1HNX L;  5C44 B;  1G8Z D;  1QUQ A;  1XMQ Q;  3M85 A;  2EY6 A;  4DV4 Q;  2NYZ D;  3EFX D;  2F4V L;  1X56 A;  3HOX B;  2CQO A;  2O2L D;  4POF A;  3I90 A;  3HOW H;  1VQC A;  3CRL C;  4RFB A;  3A54 A;  3RNU A;  1SYE A;  4DV1 Q;  1IBM Q;  2K01 A;  1LYL A;  2NVQ B;  1X3F A;  1PH7 A;  1B3Q A;  3S14 H;  1AN8 A;  2ZJR A;  3TS0 A;  3RLN A;  4A3G B;  3OWF A;  4PMW A;  2XN9 C;  2MO0 A;  4KKT A;  1H9R A;  1FL0 A;  2VW9 A;  4RWS C;  5GAE C;  1X65 A;  1ONL A;  1S5C D;  3I4N H;  4A3B H;  3B6Y A;  3GTM H;  4V19 0;  4P73 A;  5EKI A;  1B50 A;  2YTX A;  4DR1 Q;  3I55 A;  2A6H D;  4DK0 A;  1STB A;  2ZM6 Q;  3R2T A;  4LF5 Q;  2FMM A;  4JCV E;  1WCM H;  4AYB E;  4JI7 Q;  1SYD A;  2ID0 A;  3KLS X;  1JWM D;  1EIY B;  2NTT A;  1Q82 C;  1SYG A;  2B29 A;  2WB1 B;  1LO5 D;  1ZKO A;  1TQO A;  1B70 B;  4ME3 A;  4OIJ A;  2KEE A;  1SNM A;  3M3Y H;  1HXY D;  3LWU A;  3QIA A;  2R61 A;  2ALY B;  2NVT H;  3HEJ A;  4JI4 L;  3J80 c;  3MEH A;  1B9M A;  1VS0 A;  2F4I A;  1LTL A;  2KCM A;  4ZLT F;  1EUJ A;  3KJO A;  3TP7 A;  2HCI A;  2QDL A;  3KLS A;  4IUQ A;  1XXG A;  4IJL A;  2YV5 A;  3Q24 A;  3GTQ H;  1XMO L;  1QJO A;  5CYU A;  2JYO A;  3SGI A;  1DZ1 A;  5KND A;  2PNH A;  4UHV A;  3U50 C;  3RZD H;  1GO3 E;  3A55 A;  2DGY A;  3CQZ H;  4LF7 Q;  1EFI D;  4LK1 C;  5KYL A;  3S16 H;  1Q1E A;  2R93 H;  3D4W A;  3CCU A;  1ENF A;  3PUW A;  1E7Z A;  2K32 A;  3BDO A;  1I3Q B;  1XMQ L;  2GVA A;  5EJW A;  2VQF Q;  2X6G A;  1N8R C;  4DR5 L;  3HKS A;  2RQX A;  2Z4H A;  1DOL A;  3PUY A;  1EEF D;  1FD7 D;  1F9R A;  4A3L H;  4NB3 A;  3C3L A;  5CV6 A;  1I4H A;  3LNN A;  4DV1 L;  3EJI A;  1HH2 P;  2R7Z H;  1X3Q A;  2N55 A;  4LUZ A;  1MSH A;  1DON A;  1VQD A;  1J5E L;  2RDG A;  4KJO A;  5JJL A;  4BXX H;  4CKE A;  1LV9 A;  1MSG A;  2E8G A;  3PIP 3;  1SEB D;  5K36 H;  1BUV T;  2IL8 A;  3PIO 3;  3I4M H;  2J4X A;  2JA7 G;  4CKC A;  3BS1 A;  3PUV A;  4PMB A;  4OEM B;  4GLX A;  3S1R H;  1SSO A;  4DR1 L;  2JSO A;  5BN3 A;  4B3T L;  2O5I C;  4NXM Q;  4FYD A;  3ULJ A;  2Q2U A;  4HCE A;  2ZM6 L;  4LF5 L;  3VR5 A;  2FIN B;  2MUY A;  1VQK A;  1N9W A;  1JOO A;  3K5O A;  5DEH A;  1Y1V B;  1VQ9 A;  5LL6 X;  5IYB H;  1GKH A;  4JI7 L;  2F0K A;  4K6D A;  1I4X A;  5LMN Q;  1XNQ Q;  4JI3 Q;  3NEN A;  1SE8 A;  1PZK D;  1GHK A;  3M4P A;  3HKZ E;  2D2C C;  4XYO A;  2SOB A;  4BBR B;  4NP5 A;  4NPS A;  4HSV A;  2Z9H A;  2WIN B;  3PO2 H;  4HIK A;  1NMF A;  3OMC A;  4KY7 A;  3AU7 A;  1FVI A;  1BOS A;  5EKL A;  3DHQ A;  2N3S A;  2YTV A;  1M90 C;  2DY8 A;  3HOV B;  3G71 A;  2L11 A;  1I50 H;  1L2F A;  2E2J B;  3NEM A;  3NHH A;  2XWJ B;  5EQ0 A;  2VB3 X;  1JE5 A;  3DMU A;  2HQE A;  3S2D B;  4H13 C;  3SK4 A;  3U4V A;  1KRS A;  1S5D D;  1FGB D;  3K0X A;  3NE5 B;  5E4W C;  4LW1 A;  1LTS D;  1LTR D;  4KY5 A;  2EIF A;  3RD4 A;  5JEA J;  3A5U A;  1PA6 A;  4K8J A;  2CH4 A;  2KHI A;  3K8A A;  2RVL A;  2NB0 A;  3VR3 A;  2H4O A;  5EKK A;  3PO3 H;  4QL5 A;  1PRT B;  1TWG B;  3CC7 A;  1G6Z A;  3I56 A;  4LF7 L;  1TS2 A;  1ILQ A;  1R4Q B;  5C44 H;  5I9O A;  1HUN A;  2KA7 A;  3I8Z A;  2B8G A;  3HOX H;  4I7A A;  2VQF L;  5LHY 1;  2C35 B;  1NSN S;  5KRU A;  4ZRZ A;  1PZI D;  5JPN C;  4C2M B;  1MGS A;  2VB2 X;  2O5J C;  1U4M A;  1MJC A;  2B2T C;  1PYS B;  1U4L A;  2ENB A;  3BZK A;  3J81 j;  3AYH B;  2NVQ H;  5E7N A;  2KCT A;  2ZXO A;  3I3C A;  1EIG A;  3M4Q A;  4A3E B;  4A3G H;  1MI2 A;  1GD7 A;  1TS3 A;  1V1P B;  2XRS D;  3BDL A;  4C3H G;  5C4H A;  1VQP A;  1K0R A;  3S9W A;  3MHB A;  1Y1W G;  4QIW B;  2UUC Q;  1HNW L;  1YHA A;  1PHJ A;  1SBB B;  5C3W A;  1CSP A;  3M9B A;  3OHX C;  2OWO A;  3NPP A;  4NXM L;  1IW7 D;  4UPA A;  1PFM A;  2WAQ G;  1TWA B;  3OPO A;  2EDG A;  3W1B A;  1NAP A;  1KLU D;  2IJ0 A;  4C3J B;  4J8Q A;  4YWL A;  5GAD C;  4DF7 A;  1WTP A;  1EU3 A;  2CWA A;  4XT3 B;  3QB3 A;  4NW2 A;  1GUG A;  1Z9F A;  3KF8 A;  4JI3 L;  4R8N A;  1STN A;  2XSC A;  5NUC A;  1GHJ A;  1FNV A;  3K6O A;  2BE5 C;  3MXP A;  3CU7 A;  4HJA A;  5ELE A;  5BR8 Q;  2Q2I A;  3J7Z C;  5JVG 3;  2ZXP A;  1W6J A;  3KBG A;  3KLR A;  1VQN A;  4LFB Q;  1DOM A;  4K6L A;  4OHJ A;  4O2D A;  4K0K Q;  1Q90 A;  2CKZ B;  4A3J G;  1QB5 D;  2EYM A;  3ND8 A;  5IIF A;  1WI5 A;  1FNW A;  1BQQ T;  2RSO A;  3K5L A;  2B2Y A;  4YWK A;  3CCJ A;  1KHI A;  2Z8L A;  3HZX A;  2H1E A;  3W2D A;  3CCQ A;  1P16 A;  5ELF A;  1C7Y A;  3VDY A;  1CHQ D;  3OTO L;  3FPU B;  2B8F A;  4XT1 B;  2DNC A;  5EPJ A;  5C4X G;  2F0D A;  1EQQ A;  3BVG A;  4TSS A;  4IUU A;  5H1S E;  1I3Q H;  1CHP D;  1HFG A;  4F7X A;  2MO1 A;  2CW0 C;  1WJJ A;  2QEX A;  4KJN A;  5IGG A;  4ULL A;  3CPF A;  4WRD A;  2F0F A;  3K7U C;  3U4Z A;  4OO1 I;  2F1M A;  3K59 A;  3TSS A;  1O7Z A;  1QWY A;  4B08 A;  2OF1 A;  1AFP A;  4XYQ A;  3GDE A;  4ODG A;  1N33 L;  1QNK A;  4FVM A;  5M5Y B;  3PQI A;  3GV6 A;  1SE2 A;  1X32 A;  3ERS X;  2D0O A;  3EIV A;  2G9H D;  2PYK A;  2Y0S G;  1T5E A;  3J81 i;  3D4R A;  3IFD A;  3DM1 A;  3TBI B;  4IOA A;  4YCU A;  2UUC L;  4KD4 A;  2MP1 A;  2VQE Q;  4UP8 A;  3CPW A;  4LFC L;  4DR4 Q;  3I72 A;  1S3O A;  4HSP A;  1Y1V H;  4NKL A;  1CTM A;  1Y8P B;  4OWT B;  3UDF A;  1ET9 A;  3FKI B;  3L3O C;  1X55 A;  2HDM A;  1FJG Q;  5BN5 A;  4ME5 A;  3K57 A;  1I6V C;  1A3U A;  1EQV A;  1CFM A;  2F0I A;  4BBR H;  1IL2 A;  3KK7 A;  2EQS A;  2F0S A;  4JI8 Q;  4DN4 M;  5IY0 A;  1BCP C;  3F1Z A;  1RCV D;  5HGQ A;  1F2Z A;  3AEV A;  2LKV A;  3HOV H;  1JQY D;  1BF4 A;  2E2J H;  4LFB L;  5J1Z A;  2XTI A;  2B63 G;  4I65 A;  1GUN A;  1K8A C;  3S2D H;  4KLK A;  1EY6 A;  5M3F G;  2A68 C;  3F2D A;  5KGU A;  4HTH A;  3KDF A;  5T1I A;  4AH6 A;  1W3S A;  1STY A;  3KF6 A;  4IFD I;  1SRU A;  4EQ5 A;  2F0W A;  1VF7 A;  1TWG H;  3L2P A;  3DWP A;  4LJZ C;  1IBL Q;  3I73 A;  4LUO A;  2PMZ B;  5LMN W;  4P72 A;  5A35 A;  1PLF A;  4RGN A;  2AWN A;  4GOP B;  4YY3 Q;  2EY5 A;  2KBN A;  4A3K B;  4C2M H;  1S4Z A;  3HFZ B;  5M3M B;  3SEB A;  2RKS A;  3FVQ A;  5JEA H;  1Y69 U;  3G6E A;  1IKL A;  2JA8 B;  2Q8I B;  1TT2 A;  5I2Y A;  1SYC A;  1TY2 A;  4A3E H;  1K9M C;  1F9S A;  1I6H B;  1T9H A;  2JA5 B;  4DA2 A;  1IXR A;  2Z0S A;  1TS4 A;  2BH8 A;  2F3V A;  1N36 Q;  3SK6 A;  3D8G A;  4K2K A;  2A6H C;  4A3M G;  1HPC A;  1VDZ A;  3DUZ A;  2JA7 B;  4IOC A;  2EYH A;  4X6A H;  2BH2 A;  3E9I A;  2F0N A;  4QGU A;  3FMC A;  1HTP A;  1TVX A;  2PZU A;  5L37 A;  2E74 C;  4DNI A;  1TWA H;  2AMC B;  4DR4 L;  1ASZ A;  4A3C G;  1Q1B A;  4C3J H;  5LL6 S;  4JBK A;  1O78 A;  2PMZ E;  3KUP A;  3T1H Q;  2G5D A;  5FJ8 H;  1W2B A;  4IPH A;  1CT1 D;  4B3S L;  1X6O A;  4RCN A;  3NTI A;  4DPG A;  4RHS A;  4JI8 L;  4B3M Q;  4JW0 A;  4GKK Q;  1R4P B;  1EZ8 A;  2KQ3 A;  2EY2 A;  1LAB A;  2B2T A;  1PV4 A;  1WTW A;  3P7J A;  5C0X G;  1E3P A;  2O4X A;  4RAU C;  5IYD H;  3H3V H;  4WJ3 M;  3FEW X;  1KNA A;  4QMG A;  2NN6 H;  2JK8 A;  1BO0 A;  3P1H A;  1G29 1;  4B3R L;  1PRT D;  2RA4 A;  3C1E A;  2H5X A;  4MN3 A;  1CA5 A;  1JIC A;  1H9M A;  5T1G A;  1PH1 A;  1IBL L;  3ERQ A;  1JWS D;  4F88 A;  4ZUJ A;  2YU9 B;  4A4I A;  1A63 A;  1D7Q A;  1HNZ L;  3CD6 A;  4OO1 G;  4BWG B;  1IYU A;  5C3E G;  1HHV A;  3UE1 A;  1L1O C;  3OW7 A;  4C56 C;  4YY3 L;  4ZUI A;  1NE3 A;  1GUS A;  5FK9 C;  4HR7 B;  5IYC H;  5CV8 A;  4DR2 L;  5IGD A;  3ND9 A;  3K5N A;  4LWC A;  2M2L A;  2A8V A;  4HJ8 A;  1OTC A;  4E6I A;  4R9W A;  3K7A B;  1CKN B;  5M5Y H;  1SYF A;  2X69 A;  1YNN D;  1EU4 A;  4CGY B;  3K81 C;  1SJH D;  1UUP A;  4C3H B;  1B8A A;  1O80 A;  5D3I B;  1N36 L;  2IX3 A;  4X66 Q;  4DAV A;  3CCS A;  1MIU A;  3DWA A;  4RKL A;  1Y8N B;  4IAL A;  2B39 A;  3QWN A;  1SXT A;  3M7G A;  3J80 i;  1YZ6 A;  4H0L C;  2G9D A;  4PZ6 A;  2WAQ B;  1IKM A;  3H6M A;  5IE8 A;  4DR5 Q;  2SNM A;  4B9W A;  3I70 A;  3NTK A;  4KKS A;  2KVM A;  2R7F A;  2MPM A;  3JAM E;  3CKI B;  3FKI H;  3T1H L;  4N9P A;  1CSQ A;  3TRZ A;  2JA6 G;  4DAY B;  5IP9 H;  2AQ3 B;  1X3G A;  3MWY W;  3X3N A;  2ZXR A;  3QR8 A;  1QCB D;  2QF7 A;  1J5E Q;  2UUA Q;  2NUC A;  4DV7 Q;  4B3M L;  1RHP A;  5FOB B;  3A5Z B;  1N32 Q;  1JT8 A;  4GKK L;  2B2Y C;  2K75 A;  4O1N A;  5KEE A;  3WOF A;  4GN4 B;  5I2X A;  2D0P A;  2XRQ D;  4YCW A;  2MFI A;  4HMI A;  4DNR B;  1NMG A;  1YVC A;  2L5T A;  1UEB A;  2EVB A;  3STB C;  5IT9 L;  4B3T Q;  1HZ9 A;  4IFD G;  1EY7 A;  2E2H B;  3NXW A;  5CV7 A;  4CBV A;  2B2V A;  1EYA A;  1Q7Y C;  2IWH A;  3MVV A;  1EOV A;  2KCC A;  1EYG A;  4M1U B;  3GP7 A;  2AUK A;  4DV0 Q;  5KNB A;  4XQJ A;  3ULL A;  2VY3 A;  4QJF A;  2KOL A;  5IP7 G;  3TZD A;  2K5V A;  2NBF A;  4MHE A;  5E1F A;  2RDH A;  1QNU A;  4JK1 C;  3S1M B;  2F0E A;  2I5H A;  1EL0 A;  4P2C B;  1PZJ D;  1HRJ A;  1LT6 D;  5CV5 A;  1I5F A;  4KV6 A;  1ZXT A;  4IUV A;  4A3K H;  1KL9 A;  5M3M H;  3HOW G;  4TVA B;  1NJI C;  3CC4 A;  2MGS A;  2JA8 H;  1O7Y A;  1EFW A;  5AFW A;  1XPR A;  4AIM A;  2MHV A;  1A3T A;  2IHF A;  4RGT A;  1I6H H;  3G7L A;  1YJW A;  2JA5 H;  3MFY A;  5CBE E;  3VR6 A;  1JJ2 A;  1KXL A;  1ESR A;  1VQA A;  4JPB W;  2JEB I;  4RH6 A;  2PW7 A;  2Y0S B;  1E1T A;  2IPK D;  3JC6 6;  3K58 A;  2BA0 A;  2F0G A;  4CJ1 B;  2X6L A;  5FLM G;  2ZJP A;  2JA7 H;  3OOC A;  4X66 L;  1HR0 Q;  1V1P A;  5IOC A;  3I4N G;  1PVO A;  4A3B G;  1IW7 C;  4O42 A;  4R8I A;  1V8Q A;  2FMC A;  1QZH A;  4RHR A;  4X65 Q;  3EBE A;  2Q2H A;  4UAI A;  2EYF A;  1EQT A;  3S15 B;  1K8M A;  1TWF B;  2WB1 E;  1NCV A;  3HGB A;  2LS0 1;  2EPB A;  1WCM G;  2JE6 I;  1U4P A;  4KKU A;  3CC2 A;  4CJ2 C;  2Z1C A;  3EA6 A;  1N34 Q;  3GQB A;  2OT2 A;  5CR3 A;  1PH4 A;  4MNO A;  3DWQ A;  4K5W A;  3CRK C;  4LF6 Q;  3OIQ A;  3BVZ A;  1E24 A;  4IUN A;  5K5P A;  3H94 A;  4POG A;  1A3V A;  2UUA L;  4IUR A;  4DV7 L;  1H9J A;  1K3R A;  3PF4 A;  4DK1 A;  5IOD A;  2DUD A;  1N32 L;  2F0V A;  5M5W B;  3K0Y A;  4FXG C;  1PFB A;  2ASB A;  1KDC A;  4G7Z C;  2WAC A;  1AZP A;  1HNW Q;  1RD9 D;  5M3F B;  1A6X A;  4U67 3;  1SR3 A;  3NP8 A;  1D8L A;  2CHB D;  2F0T A;  3SDZ A;  3J7Y W;  2E5L L;  2IT1 A;  3SR1 A;  2ZJQ A;  1CI3 M;  4MTN A;  3L9A X;  4DV0 L;  2YU9 H;  2AQ1 B;  1J6Q A;  2BA1 A;  4IZ8 A;  4BBS B;  2KJX A;  3U9S A;  1R9T B;  2AKW B;  4KMU C;  1LLR D;  4IJH A;  3GTL B;  2CFM A;  2E2D C;  2PI2 E;  3S24 A;  1PH2 A;  1KIX A;  4LUV A;  5JJK A;  1HQR D;  3VYT A;  1SYB A;  1TU2 B;  2RDF A;  4A3F G;  2NZO A;  2R6G A;  1S5F D;  2HDL A;  2KHS A;  2K7V A;  2N8N A;  5D3D A;  3ZJY C;  4DV6 L;  2Z6K A;  2F03 A;  1C8C A;  2D62 A;  3GTK B;  3G4S A;  1PFS A;  4HJ7 A;  3K7A H;  2ZT9 C;  2PQA B;  3CHB D;  2R7Z G;  3KBX A;  4PQX A;  3SVM A;  1BKB A;  4ZKB B;  1AZQ A;  4OL7 A;  3T53 B;  2R3Z A;  3STB D;  4Z9C B;  4C3H H;  2LMC B;  4GNX B;  2JEA I;  2LXJ A;  1TR5 A;  4BXX G;  2ICI A;  4QY7 A;  4A3M B;  4ZK9 B;  3OTO Q;  3HOZ B;  2I07 B;  1YJ9 A;  2A74 C;  1HR0 L;  4J1M A;  3T13 A;  4Y7N B;  1WTV A;  4BS9 A;  4HIO A;  3I4M G;  3F2C A;  4ZKC B;  4DU9 A;  1K0S A;  4X65 L;  3QOL A;  5ELN A;  1F2M A;  5C0X J;  1XJV A;  3LGJ A;  1IZ6 A;  3TP8 A;  3TME A;  1LT5 D;  1AH9 A;  1SMX A;  4R4Q A;  4YIJ A;  1N34 L;  5GAG C;  1N33 Q;  3QO2 A;  3UDI A;  3J7A V;  3IL8 A;  3NWS A;  3SXH A;  4A93 G;  1Y8O B;  4LF6 L;  1XX8 A;  3PSI A;  5LMU L;  1SLJ A;  2K28 A;  1L1O A;  4XTC S;  4A3D G;  4K14 A;  3K80 C;  4JBM A;  3D6W A;  4RKB A;  1XPO A;  1CUK A;  1SNO A;  5M5X B;  3LX0 A;  4YCV A;  3HOY G;  1O7I A;  1GVP A;  4DAM A;  1T5X D;  4LFC Q;  2A69 D;  4V0B A;  4DUY Q;  2E2H H;  2HCC A;  1HA6 A;  4R4C A;  3L7Z C;  1SNQ A;  4K8I A;  2LSS A;  5KIX A;  5IGF A;  1QIL A;  4G7H C;  5JOB A;  3GTP B;  5FKA C;  1E2V A;  1X3P A;  3PO3 G;  4IPG A;  3CCM A;  2CH4 W;  4AYB G;  3S17 B;  2F0H A;  4LAA A;  4P71 A;  3S1M H;  3Q22 A;  2PW5 A;  5C3E B;  1C4Q A;  3T16 A;  1F2L A;  3M4Y A;  2NVX B;  2K5N A;  4EX5 A;  2QIL A;  4LNQ A;  1C9O A;  3D0F A;  4DK6 C;  1HUM A;  4GOP A;  2N88 A;  1BBX C;  2XGT A;  4S3S A;  1Z7T A;  5C4Z A;  1QOH A;  2PQE A;  1BBU A;  4GS3 A;  1A0I A;  3N6R A;  1WTO A;  3H0G G;  2AUJ D;  2I5M X;  4ZAI A;  1V1Q A;  2B2U C;  4FDB A;  1EWI A;  3BYT B;  4QIW E;  2JQO A;  5DM6 3;  4A3G G;  3NBH B;  1KAB A;  4P74 A;  2F0L A;  3JAM L;  4HED A;  3BG3 A;  2R92 G;  1XYI A;  1EY0 A;  3I7F A;  4R1J A;  4GLA C;  2D9U A;  4TKO B;  2IW3 A;  5IT9 E;  1S40 A;  1ROD A;  5C5M A;  3H91 A;  1JR0 D;  4FO2 A;  4I7Z C;  3S15 H;  2KHJ A;  1TWF H;  1PYB A;  3G48 A;  1CKO A;  1UE7 A;  4IFD J;  3NQT A;  1AEX A;  5IWA Q;  3RN2 A;  1ESF A;  2JA6 B;  1SN8 A;  5IGE A;  3RN5 A;  3GTJ B;  2JJQ A;  3E9H A;  3IAY A;  3NK9 A;  1J9O A;  2Z4I A;  1WYD A;  3MZ5 A;  3CME A;  1VQG A;  2B2V C;  3MXN B;  1QZG A;  1D5Z C;  2K14 A;  4PG3 A;  4CDE C;  3CF5 A;  5M5W H;  4KN4 C;  3HP3 A;  5TSS A;  3D6C A;  2GA4 B;  1HTL D;  1FGU A;  1UE5 A;  1YHQ A;  1SMY D;  3A0J A;  5M3F H;  1ENC A;  4JG2 A;  4PV1 C;  1PRT C;  1CZG A;  2WV6 D;  1TWH B;  1HR0 W;  4DUY L;  3O13 A;  1A62 A;  1VQ5 A;  1HA5 A;  3CXC A;  1BXT A;  3HS0 C;  1X9N A;  2J7Z A;  4LF9 Q;  2WP8 J;  1EEI D;  5FLX E;  5FO9 B;  3H3V I;  4B3S Q;  5E3F A;  3S2H B;  2NN6 I;  1PXU A;  2K52 A;  4BBS H;  1R9T H;  2L1B A;  5EBC A;  2IHE A;  3H15 A;  2JP1 A;  4IPD A;  3GTL H;  2V1C C;  1JOR A;  4EQP A;  4KHZ A;  2B2W A;  4CDF C;  2N78 A;  1G2S A;  3HKZ G;  1ET6 A;  3U9O A;  4DXG A;  5JPM C;  4DV5 L;  4G57 A;  1HZC A;  2E76 C;  3OWE B;  5C4J B;  3DLL A;  1YNN C;  3E0E A;  4KD3 A;  3GTK H;  2A5H A;  2IY5 B;  2JN4 A;  1PTO B;  1KLG D;  4B3R Q;  4ILW A;  1JB7 A;  2VUM G;  1RTN A;  1CKN A;  2NZH A;  3W5O A;  2VNU D;  4A3M H;  1Z47 A;  5JJI A;  4QB4 A;  2VZA A;  3BYY B;  4OWW B;  1L0X B;  3HOZ H;  4DNT B;  2OQK A;  3K5M A;  4Y7N H;  1NBW A;  1VQF A;  1VQM A;  3F2U A;  1HNZ Q;  4QF4 A;  4A3C H;  4X3K A;  1EOT A;  2Q8T A;  1BR9 A;  3MA2 B;  2QGQ A;  1OXX K;  3KF8 B;  1Y1V G;  1S72 A;  4C1N I;  4CKB A;  3Q0A A;  4DR2 Q;  3VR4 A;  3CMA A;  3ITP A;  5IWA L;  3A7A B;  3VA5 A;  3E5S A;  1I4R A;  4NXN Q;  4KY6 A;  1VQO A;  3MC0 B;  1EWC A;  5EAY A;  1U5K A;  4JI2 Q;  5ISR A;  1GUW A;  4BBR G;  3BZD B;  3H3V C;  1SAP A;  3OSO A;  3RLO A;  3S1Q B;  1H9S B;  1KNE A;  1STE A;  5KYI A;  3BVM A;  3HOV G;  5C0X H;  5I6W A;  4C3I G;  1Q3L A;  5M5X H;  5CV4 A;  1XTC D;  5C5L A;  2E2I B;  3JAM c;  3F2B A;  1Y14 B;  1U0L A;  2EYP A;  1E1O A;  4H02 A;  3TEH B;  1MHW C;  4XIG S;  3AB9 A;  1A15 A;  1EY9 A;  1ZEQ X;  4EQO A;  1KRT A;  3FP9 A;  1TWC B;  4HCS A;  1WD1 A;  3A8J E;  4LF9 L;  1K83 B;  2K05 A;  4L5Q A;  1PDQ A;  3GTP H;  2WFW A;  4ABN A;  3TDQ A;  5ELC A;  1F9P A;  4PZ8 A;  1BBW A;  1FR3 A;  2CCZ A;  3DEO A;  2Z6K C;  3S17 H;  2NZ1 D;  2WKC A;  3KFU A;  5GAH C;  2V4D A;  2ZTE A;  5C3E H;  5HY6 A; 
#chains in the Genus database with same CATH homology
 4GNX C;  4IPC A;  2VY3 A;  5JEA J;  3ULL A;  5AJ3 L;  3A5U A;  4QJF A;  4DV2 L;  4DR3 Q;  3GO5 A;  1PA6 A;  2KHI A;  3K8A A;  1VQH A;  5IP7 G;  2K5V A;  2F3I A;  2MQH A;  3PO3 H;  4QL5 A;  3CC7 A;  3BZC A;  3I56 A;  2I5H A;  2UUB L;  3CW2 C;  2VUM H;  4KHP Q;  4PZ7 A;  4LF7 L;  1I5F A;  2HQL A;  3CCR A;  3CCV A;  1PH5 A;  5C44 H;  4A3K H;  4L5R C;  1KL9 A;  5M3M H;  1YHB A;  3HOW G;  4TVA B;  3HOX H;  2VQF L;  4X64 Q;  4A3E G;  1KC8 C;  1NJI C;  2C35 B;  3CC4 A;  2JA8 H;  1NTG A;  3AFQ A;  4R4I A;  1EFW A;  1Q8K A;  1XPR A;  2Q2T A;  4AIM A;  4A76 A;  2IHF A;  4BA2 I;  1I6H H;  1YJW A;  4A3I G;  2JA5 H;  1VQ7 A;  1MJC A;  1JJ2 A;  4LFA L;  1KXL A;  2IX0 A;  1PYS B;  1VQA A;  3BZK A;  4BY1 G;  3J81 j;  3PGZ A;  2I5L X;  3AYH B;  3JAM i;  1YIJ A;  2UU9 Q;  2NVQ H;  5E7N A;  2KCT A;  2JEB I;  1RIP A;  1E1T A;  2ZTD A;  3JC6 6;  3ULP A;  2BA0 A;  5FLM G;  2ZJP A;  3M4Q A;  2JA7 H;  1HR0 Q;  4X66 L;  3I4N G;  4AQY L;  4A3G H;  2UXB L;  1PVO A;  4A3B G;  1GD7 A;  1YNX A;  1XNR Q;  2A1A A;  1QZH A;  1VQP A;  1L1O B;  3EBE A;  2Q2H A;  4X65 Q;  1K0R A;  4DV3 L;  1Y1W G;  2QA4 A;  2JA6 H;  3GTJ H;  2WB1 E;  2UUC Q;  1JJC B;  5BR8 L;  3NEL A;  1YHA A;  4KI0 A;  1VQ4 A;  1PHJ A;  1CSP A;  3M9B A;  4NXN L;  1GM5 A;  1WCM G;  2PI2 A;  2JE6 I;  3U58 A;  5DLQ E;  2OWO A;  2NVX H;  4C3I H;  3CC2 A;  4JI2 L;  1JJG A;  4K0K L;  4NXM L;  4UPA A;  4DUZ Q;  2WAQ G;  1N34 Q;  3W1B A;  1PH4 A;  1YI2 A;  4MNO A;  1AE2 A;  1Q12 A;  4YWL A;  4JBJ A;  5GAD C;  4LF6 Q;  3HOU G;  2CWA A;  4JI1 Q;  1YEZ A;  1E24 A;  3IRB A;  4POG A;  2N49 A;  3D31 A;  1Z9F A;  2UUA L;  2L15 A;  4JI3 L;  2EXD A;  4DV7 L;  1VQ6 A;  1WFQ A;  1K3R A;  3EN2 A;  4JI6 L;  3PF4 A;  1K8G A;  3KJP A;  2DUD A;  1N32 L;  1TWH H;  4OXP A;  4HJA A;  1KD1 C;  2ASB A;  1HZB A;  1LUZ A;  5BR8 Q;  2Q2I A;  1HNW Q;  2A19 A;  1IBK Q;  3J7Z C;  2GN5 A;  3OW2 A;  4BBS G;  1VQN A;  1SR3 A;  4LFB Q;  3AQQ A;  3MEF A;  4K0K Q;  1VQI A;  1V43 A;  1D8L A;  1XTD A;  4O2D A;  4GOP C;  3S2H H;  1VQL A;  3CAM A;  5GQO A;  1VQ8 A;  3M7N A;  4JC0 A;  2CKZ B;  2YYZ A;  1QVC A;  3J81 c;  4A3J G;  2ZTC A;  2E5L L;  4BY7 G;  3KOJ A;  2IT1 A;  2FXQ A;  1MJE A;  1WI5 A;  2UXD Q;  4OX9 L;  3GD7 A;  3PCO B;  2ZJQ A;  4DV0 L;  4MTN A;  4GLV B;  1RL2 A;  2BA1 A;  1J6Q A;  4JOI C;  4P75 A;  2YU9 H;  4JI6 Q;  2GVB A;  4YWK A;  3CCJ A;  4DR3 L;  1KHI A;  2AKW B;  3BU2 A;  1G51 A;  3TRE A;  4IJH A;  3CCQ A;  1P16 A;  1I94 Q;  4JV5 Q;  2CFM A;  1C7Y A;  2RHQ B;  3WWV A;  3VDY A;  3OTO L;  5C4J H;  2PI2 E;  3S24 A;  2K5H A;  2R7D A;  4LUV A;  5IYC G;  1PH2 A;  4A75 A;  1KIX A;  4KHP L;  5JJK A;  3KYH C;  5C4X G;  1EQQ A;  4A3F G;  4DR7 Q;  4X62 Q;  1NY4 A;  1OXV A;  2NZO A;  2K4K A;  2R6G A;  4JBW A;  4A3I H;  2ES2 A;  1E22 A;  5H1S E;  1I3Q H;  4BY1 H;  2MO1 A;  2QEX A;  1WJJ A;  3HOZ G;  2E5L Q;  2N8N A;  3CCE A;  4JYA Q;  4X64 L;  3ZJY C;  1HNX Q;  4DV6 L;  2Z6K A;  2PQA A;  3CPF A;  5FLM H;  1PH8 A;  2D62 A;  2YTY A;  3G4S A;  1JMC A;  1PFS A;  4HJ7 A;  2VQE L;  3K7A H;  1HZA A;  2PQA B;  3K7U C;  3U4Z A;  2R7Z G;  2WAQ E;  4OO1 I;  4GNX A;  2F4V Q;  1BKB A;  3STB D;  2IX1 A;  4DV0 Q;  4C3H H;  4GNX B;  3GDE A;  2JEA I;  2LXJ A;  3T1Y Q;  2UU9 L;  2UXC Q;  2RHS B;  1N33 L;  4BXX G;  4QY7 A;  1EQR A;  4OWX B;  1UE6 A;  3OTO Q;  3Q8D A;  1YJ9 A;  3GTO H;  2AHO B;  4YHH L;  1HR0 L;  1FJG L;  4HIO A;  3I4M G;  3A74 A;  5JEA G;  1VQJ A;  4L5T A;  3F2C A;  4GN3 B;  1XNR L;  2OTL A;  3ERS X;  1K73 C;  2VL6 A;  2D0O A;  4X65 L;  3EIV A;  2Y0S G;  1VQE A;  5ELN A;  3FKI G;  5C0X J;  1EIF A;  1XJV A;  3J81 i;  4DV6 Q;  4QQB X;  3LGJ A;  1XPU A;  1X3E A;  1IZ6 A;  4YCU A;  2UUC L;  3HOU H;  4IOA A;  2VQE Q;  5IP9 G;  3AFP A;  4UP8 A;  3CPW A;  1YJN A;  1YBY A;  4LFC L;  3PIP A;  4DR4 Q;  1IYJ B;  1SMX A;  3OYY A;  1AH9 A;  1S3O A;  1P8L A;  2AWO A;  4R4Q A;  4DUZ L;  1N34 L;  5GAG C;  3PIO A;  1Y1V H;  1N33 Q;  3S1Q H;  4OWT B;  3UDF A;  3UDI A;  4A93 G;  4WJ4 A;  4LF6 L;  4X6A H;  1X55 A;  4Y52 H;  4YHH Q;  3PSI A;  4JI1 L;  5LMU L;  1FJG Q;  1SLJ A;  1L1O A;  4XTC S;  1MKH A;  4A3D G;  3K80 C;  1VQB A;  4ALP A;  2E2I H;  4JBM A;  4GKJ L;  2MNA A;  2RF4 A;  4BBR H;  4HJ5 A;  1IL2 A;  4IO9 A;  2EQS A;  2KEN A;  3PUX A;  4JI8 Q;  5IY0 A;  1CUK A;  1XPO A;  3F1Z A;  5FJ8 G;  4R4T A;  4DK3 C;  4YCV A;  5HGQ A;  3AEV A;  4BY7 H;  3HOY G;  1O7I A;  1GVP A;  1TWC H;  1IBK L;  3HOV H;  1K83 H;  1UWV A;  4DAM A;  4LFC Q;  4R4O A;  1V9P A;  3ER0 A;  4DUY Q;  2E2H H;  2E2J H;  4LFB L;  3KLW A;  1PH6 A;  1B7Y B;  4R4C A;  3L7Z C;  2LSS A;  2XTI A;  2B63 G;  1K8A C;  3S2D H;  4JI5 L;  4J15 A;  4KLK A;  4JI4 Q;  1G6P A;  2OCE A;  5M3F G;  5LMU Q;  3F2D A;  2UXD L;  4L5S A;  3PO3 G;  3KDF A;  4DV4 L;  4IPG A;  4GKJ Q;  4A3F H;  3CCM A;  4AH6 A;  2JA9 A;  1W3S A;  3KDF B;  3KF6 A;  4IFD I;  4AYB G;  1SRU A;  4EQ5 A;  1XMO Q;  4P71 A;  5IYD G;  4O0A A;  1TWG H;  3S1M H;  1I94 L;  3L2P A;  4A3K G;  4JV5 L;  1H95 A;  3KF6 B;  1UE1 A;  1IBL Q;  2B63 H;  5M3M G;  1A8V A;  1SRO A;  2NN6 G;  1BVS A;  4LUO A;  2K5N A;  4EX5 A;  1IBM L;  4LNQ A;  1C9O A;  3D0F A;  4DK6 C;  5LMN W;  2JA8 G;  2Y0S E;  4P72 A;  4X62 L;  4GOP A;  2OQ0 A;  4DR7 L;  4APV A;  4BA1 I;  1C0A A;  2AWN A;  4GOP B;  2XGT A;  3RLF A;  4JI5 Q;  2JA5 G;  5IP7 H;  2EIF A;  1KAW A;  1X54 A;  4JYA L;  3TQY A;  5ELO A;  4YY3 Q;  1YIT A;  1HNX L;  2KBN A;  5J3B A;  4C2M H;  1QUQ A;  1BBU A;  1XMQ Q;  3UDX A;  3HFZ B;  4GS3 A;  1A0I A;  3M85 A;  3H0G G;  4DV4 Q;  2I5M X;  1QUQ B;  1V1Q A;  4FDB A;  4HIM A;  1EWI A;  1X56 A;  4QIW E;  2F4V L;  1Q81 C;  2CQO A;  2JQO A;  3G6E A;  4A3G G;  3F8T A;  3BJU A;  3NBH B;  4P74 A;  4POF A;  2HHH Q;  3T1Y L;  2R93 G;  2UXC L;  4JI0 Q;  3HOW H;  2NVY H;  4A3E H;  1K9M C;  1LM0 A;  2R92 G;  1VQC A;  1T9H A;  1HNW L;  1IXR A;  2Z0S A;  3I7F A;  4R1J A;  3RNU A;  4DV1 Q;  2BH8 A;  1IBM Q;  4GLA C;  1LYL A;  1N36 Q;  1X3F A;  1HJP A;  1PH7 A;  1S40 A;  4A3M G;  3S14 H;  2ZJR A;  3TS0 A;  3S15 H;  4IOC A;  4A3L G;  1TXY A;  3RLN A;  4PMW A;  2MO0 A;  2KHJ A;  1TWF H;  1PYB A;  1FL0 A;  1OXS C;  3G48 A;  4RMF A;  2VW9 A;  2BH2 A;  4A93 H;  3E9I A;  4DR6 Q;  1CKO A;  1UE7 A;  5GAE C;  4IFD J;  1X65 A;  4QGU A;  3I4N H;  4A3B H;  5IWA Q;  3RN2 A;  4DNI A;  3B6Y A;  2F52 A;  3GTM H;  4A3D H;  1SN8 A;  1TWA H;  2AMC B;  4P73 A;  4DR4 L;  3RN5 A;  1ASZ A;  4A3C G;  1VCI A;  1Q1B A;  2JJQ A;  4C3J H;  2HT1 A;  4LF4 Q;  5IT9 c;  4JBK A;  2YTX A;  4DR1 Q;  3E9H A;  2PMZ E;  3I55 A;  1Y1W H;  1OXU A;  5K36 G;  3T1H Q;  5FJ8 H;  2ZM6 Q;  3UDG A;  1W2B A;  4LF5 Q;  1WYD A;  4IPH A;  4B3S L;  3HOY H;  3CME A;  1VQG A;  4JCV E;  3MXN B;  1WCM H;  1QZG A;  1L0W A;  2K14 A;  2HIX A;  1X6O A;  3DM3 A;  4AYB E;  4LF8 Q;  4JI7 Q;  4PG3 A;  4DPG A;  2ID0 A;  5M5W H;  3CF5 A;  4JI8 L;  1EIY B;  4B3M Q;  1Q82 C;  1FGU A;  1UE5 A;  2B29 A;  1YHQ A;  3GTG H;  3TS2 A;  2OTJ A;  3CP0 A;  3A0J A;  4GKK Q;  1B70 B;  5M3F H;  4JG2 A;  2HIV A;  4ME3 A;  1HR0 W;  5IYB G;  4DUY L;  3CCL A;  1PH9 A;  3M3Y H;  1A62 A;  1PV4 A;  3CXC A;  1VQ5 A;  4UP9 A;  3PV0 A;  5C0X G;  1X9N A;  1E3P A;  2ALY B;  4LF9 Q;  2WP8 J;  2NVT H;  3H3V H;  4WJ3 M;  5IYD H;  4JI4 L;  3H3V I;  3J80 c;  3RZO H;  1VS0 A;  1Q86 C;  4B3S Q;  2JK8 A;  1LTL A;  5JJI A;  2NN6 I;  2KCM A;  1EUJ A;  3KJO A;  2K52 A;  3PO2 G;  1G29 1;  1OXT A;  4BBS H;  2VS1 A;  4B3R L;  4IJL A;  1R9T H;  2YV5 A;  2K50 A;  2IHE A;  3H15 A;  4IPD A;  3GTQ H;  1XMO L;  2H5X A;  3GTL H;  2V1C C;  3SGI A;  4KHZ A;  5AJ3 Q;  4DV2 Q;  4A3J H;  1PH1 A;  1IBL L;  2PNH A;  4A4I A;  3U50 C;  5FLX c;  3RZD H;  1GO3 E;  1DGS A;  2N78 A;  3HKZ G;  1A63 A;  1D7Q A;  2DGY A;  3H0G H;  4DV5 L;  4UY8 C;  3CQZ H;  1HNZ L;  2UUB Q;  3CD6 A;  1QVF A;  4OO1 G;  1HZC A;  4LF7 Q;  3DLL A;  5C3E G;  3S16 H;  3UE1 A;  4DKA C;  1Q1E A;  1CKM A;  3E0E A;  1L1O C;  4MZ9 A;  2R93 H;  3CCU A;  4YY3 L;  3GTK H;  3J7A 5;  1NE3 A;  2R92 H;  3PUW A;  2IY5 B;  1E7Z A;  1XMQ L;  5IYC H;  2GVA A;  2VQF Q;  4HJ9 A;  4DR2 L;  5C4X H;  4B3R Q;  1N8R C;  1JB7 A;  4DR5 L;  2VUM G;  3HKS A;  4LWC A;  1CKN A;  2NZH A;  1M1K C;  4GN5 A;  3W5O A;  2VNU D;  3PUY A;  1Z47 A;  4A3M H;  2A8V A;  4HJ8 A;  2HHH L;  2ATW A;  5C44 G;  1OTC A;  4A3L H;  4JI0 L;  5M5Y H;  2VZA A;  1CKN B;  4NB3 A;  4OWW B;  4LFA Q;  3S1N H;  3HOZ H;  2OQK A;  4Y7N H;  1NBW A;  3K81 C;  1VQF A;  1VQM A;  1QVG A;  3HOX G;  4DV1 L;  1B8A A;  4DV5 Q;  1HH2 P;  2I0Q A;  1N36 L;  1HNZ Q;  2R7Z H;  4LUZ A;  4X66 Q;  4AQY Q;  2UXB Q;  1VQD A;  3CCS A;  1MIU A;  5LMN L;  4OON A;  3PF5 A;  1J5E L;  1XNQ L;  4A3C H;  1Q46 A;  5JJL A;  3UE0 A;  4BXX H;  2QGQ A;  2E8G A;  1OXX K;  3J80 i;  4DR6 L;  1YZ6 A;  3KF8 B;  4DV3 Q;  1Y1V G;  1S72 A;  4PZ6 A;  4DR2 Q;  3I4M H;  3CMA A;  5IWA L;  4JOI A;  5IE8 A;  4DR5 Q;  2JA7 G;  3PUV A;  4NXN Q;  4GLX A;  2R7F A;  4LF4 L;  3S1R H;  3FKI H;  5EAY A;  4DR1 L;  1VQO A;  1U5K A;  4JI2 Q;  4B3T L;  2B3G A;  4BBR G;  4NXM Q;  3T1H L;  3ULJ A;  2Q2U A;  2ZM6 L;  1AE3 A;  4LF5 L;  3FHW A;  1CSQ A;  2RCN A;  3TRZ A;  2JA6 G;  1VQK A;  1N9W A;  4DAY B;  5IP9 H;  1X3G A;  3RLO A;  1VQ9 A;  5IYB H;  4LF8 L;  1GKH A;  4JI7 L;  3HOV G;  5LMN Q;  1J5E Q;  3I2Z A;  1XNQ Q;  2UUA Q;  5M5X H;  4JI3 Q;  5C0X I;  3RR5 A;  4DV7 Q;  3NEN A;  4B3M L;  1SE8 A;  4TQU S;  3A5Z B;  3M4P A;  3HKZ E;  1N32 Q;  1JT8 A;  4GKK L;  3JAM c;  2K75 A;  3F2B A;  1ASY A;  1Y14 B;  4NPS A;  1U0L A;  3M4O H;  1E1O A;  3I4O A;  4H02 A;  3TEH B;  4UP7 A;  3PO2 H;  4GN4 B;  4HIK A;  2D0P A;  1NMF A;  4XIG S;  1FVI A;  4HID A;  2N3S A;  4YCW A;  2MFI A;  3W1G A;  2LXK A;  2YTV A;  3FP9 A;  1KRT A;  2WB1 G;  1NMG A;  1YVC A;  2CWP A;  1UEB A;  3STB C;  1M90 C;  3G71 A;  1HZ9 A;  4B3T Q;  4LF9 L;  4IFD G;  4L5Q A;  3ICE A;  3GTP H;  1I50 H;  1L2F A;  4RG1 A;  3NEM A;  2WFW A;  1KQS A;  1Q7Y C;  1JE5 A;  4PZ8 A;  1BBW A;  3U4V A;  3PUZ A;  3L0O A;  1KRS A;  2CCZ A;  1EOV A;  2Z6K C;  3K0X A;  1PH3 A;  3S17 H;  5GRO A;  1EYG A;  4OX9 Q;  3KFU A;  4LW1 A;  5GAH C;  4YWM A;  1WOC A;  2ZTE A;  5C3E H;  5HY6 A;  1SFO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...