3S1RH

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with gtp
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 24
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1rH00
3OTOL 1XJVA 1BBUA 1WJJA 3TEHB 1L1OC 2K50A 1BBWA 4LFAQ 1S72A 4BBRH 3HOUH 1UWVA 3J7A5 4GLVB 3S1QH 4IFDJ 4DK3C 4JYAL 3STBC 4DR4L 1Z9FA 1K0RA 2UXBQ 1C0AA 4YY3Q 2R7ZH 1HZAA 4NPSA 3CMAA 4HJ7A 2IX0A 2VY3A 1CSPA 2K5NA 2Z0SA 4IO9A 1Y1VG 4A3DH 2VW9A 2MO0A 1EYGA 3CPFA 2AWOA 1NJIC 1RL2A 1L0WA 4LF9Q 4IFDG 2HHHQ 2A1AA 1YVCA 2PMZE 1N36L 3PO3H 1M1KC 4PZ6A 5J3BA 4B3TL 1PH6A 2BH8A 3ULLA 3M85A 3CXCA 3KLWA 4DV7Q 1X55A 3AYHB 3W1BA 1KIXA 4PMWA 3RN5A 3RZOH 5IYBH 2WAQE 5M3FH 1XMOQ 4LF9L 4BY1G 4A3LG 4C3JH 4C3HH 2HHHL 3CC2A 4BXXH 3GO5A 1YEZA 1UE1A 1V9PA 3PF5A 2JA8G 2IY5B 3TQYA 3K0XA 2F4VL 1CKNA 3J81c 2UXDQ 1AH9A 4YWLA 4K0KL 1KL9A 1TXYA 4X62Q 2PI2A 4X65Q 1HZBA 1PA6A 2UXCQ 2E5LL 2MNAA 3K7UC 5LMNW 4UP8A 4JG2A 4IFDI 1TWAH 3CCLA 2VUMH 1B70B 5FJ8H 4C3IH 2VQEQ 5K36G 1P16A 1X56A 1S40A 2UXDL 4B3ML 2BA1A 3KOJA 3PUZA 3ULJA 4X62L 4X65L 1SRUA 3G4SA 2PI2E 3NBHB 2I5LX 4DV4L 4IOAA 4UP9A 5E7NA 3U4ZA 1IBLQ 1WI5A 1VQNA 1VQIA 4A93H 4BY7G 1N33Q 1BVSA 3NENA 2WB1G 2PQAA 3D31A 3ER0A 3S1RH 2VQEL 1IBML 1X3GA 4RMFA 1OXUA 1JT8A 2UUAQ 2ATWA 1HR0Q 1CUKA 1A63A 4OXPA 5JJIA 2FXQA 4NXMQ 3UDIA 1N33L 4A3CH 1W3SA 4AQYQ 1PVOA 4LF8L 1I50H 3HKZG 2LXJA 2ZJRA 4A75A 1VQFA 1YI2A 1J5EQ 1NBWA 1J6QA 2CFMA 1CKNB 2RCNA 1YIJA 2ZTEA 3AFPA 1I3QH 3U4VA 4QY7A 4R4IA 3CMEA 4OWXB 5BR8Q 3H0GG 4NXML 1XNQL 1GM5A 2RF4A 4LW1A 4OONA 4DV5L 2RHQB 1E1TA 1D8LA 4AQYL 4DV0L 3Q8DA 4BBSG 2MFIA 2NVTH 1OXVA 3CCSA 3G6EA 4A76A 3G48A 4TVAB 3A74A 4GN5A 5GAGC 4DV6L 3HOWH 1Z47A 5IYCG 3CCMA 1EIFA 1W2BA 3GTQH 1JJCB 2PQAB 3TREA 1VQGA 4GLAC 4GS3A 5FLMH 2HT1A 3ICEA 3NELA 4JV5L 3H3VH 3EN2A 1RIPA 5EAYA 1E1OA 4P72A 4R1JA 4A3MH 3A5ZB 3M4OH 1N8RC 2JA7H 4MTNA 2ES2A 2NVYH 3S1NH 4IPGA 5IP9H 1EQQA 2UU9Q 1ASYA 3B6YA 4RG1A 1Q1EA 1VQ7A 1FJGQ 5C44H 2R92G 1YNXA 3J81i 4A3KH 4YWMA 2HIXA 3M4PA 3S2HH 3S16H 4H02A 3I56A 4L5TA 2CCZA 2CKZB 4HIKA 3E0EA 1HZCA 2UU9L 4JI5Q 2HQLA 3I4MG 1K83H 1SLJA 2Q2IA 4LFBQ 1D7QA 3M4QA 4IJLA 1LUZA 5ELNA 1AE2A 4DUZL 1JE5A 2VNUD 1PH7A 4LF6Q 2I5HA 1Q7YC 4DR7Q 2E2HH 2R7DA 4DR3L 3PUWA 4PZ7A 3PO2G 4UP7A 4JI5L 1JMCA 3KF8B 2YYZA 3OTOQ 3FKIH 1VQOA 2OTLA 2R7FA 3HOVH 2UUBQ 2ALYB 4DV2L 4HIOA 4A3GH 2YTVA 3BZCA 4A3IH 4JYAQ 4BA1I 2OCEA 4Y7NH 1A8VA 2EIFA 2KBNA 1XPRA 1EIYB 1KHIA 3I4NG 2QA4A 3GTPH 3HOZH 1FL0A 3IRBA 4YHHL 2CWAA 1N34L 3CCQA 4KLKA 2JA5G 1QVCA 3K80C 2UUBL 1HNWQ 5C4JH 4JBJA 3HOYG 4DAMA 3U58A 1X9NA 1KAWA 1V43A 4A3FH 4UY8C 3KF6A 1N36Q 4A3BH 2IHFA 1TWGH 4LFCL 5M3MH 1YHAA 4B3TQ 3J80i 1B8AA 5IE8A 2K5VA 4MZ9A 5M5YH 3KJOA 1WCMG 4JBMA 2N8NA 4A3JH 3CD6A 1HNWL 1JJGA 3RNUA 1KRSA 1TWHH 4LNQA 3CW2C 4A3EH 2VZAA 1O7IA 1OTCA 2GVBA 2HIVA 3F8TA 5DLQE 2EXDA 2KCTA 3F1ZA 3E9HA 1E24A 4IOCA 4EQ5A 4Y52H 2VL6A 1KD1C 2F4VQ 2V1CC 4K0KQ 5IYDG 3HOXH 3ERSX 2E5LQ 5C4XG 3GD7A 1GD7A 5C3EG 2MQHA 1T9HA 3J81j 3F2BA 2H5XA 2I5MX 5GAEC 2OTJA 2N3SA 2KHJA 2K52A 4JC0A 1QUQB 2WB1E 4PZ8A 4DV1L 3MEFA 1PHJA 1Q12A 4B3MQ 1EQRA 4B3SL 2YU9H 4DV4Q 4DR5L 3HOZG 3OW2A 1A62A 1MIUA 2RHSB 1PH5A 3HFZB 3HOUG 3TS0A 3KF6B 4BBRG 4GOPB 1HR0W 1VCIA 1IBMQ 4APVA 1CKMA 1TWCH 4JOIC 2JEAI 2LXKA 3HKZE 2PNHA 1CKOA 2Q2HA 4AIMA 4JI3L 1VQJA 2AKWB 1NY4A 2R7ZG 1SFOH 2UUCL 2B3GA 3BZKA 5GQOA 3RLNA 5AJ3Q 1BKBA 4IJHA 4A3DG 5IP7H 4LF8Q 3KFUA 1Q82C 3JC66 3STBD 3PF4A 4FDBA 4JI8L 1IYJB 3JAMi 5HGQA 3PO3G 4XTCS 5M5WH 4DKAC 1XNQQ 1XPUA 4X66Q 5AJ3L 4DV5Q 3J7ZC 5IT9c 3A5UA 4OX9Q 2XGTA 4GN4B 4DV0Q 1SE8A 4R4CA 1XNRL 1G51A 2OQ0A 2YTXA 3PV0A 5IYBG 5M3FG 3GTOH 2XTIA 2A8VA 1PH8A 2VQFL 1VQCA 3FP9A 4DV6Q 4BXXG 1X54A 3K81C 2I0QA 4XIGS 3ULPA 4JBWA 3CF5A 1PH9A 3L7ZC 4X66L 3PSIA 4OX9L 3BU2A 2JK8A 1CSQA 3PIOA 3PIPA 3RLOA 3J80c 4LWCA 5LMNQ 4WJ4A 2R93H 3PUVA 4JV5Q 3L2PA 4DPGA 4ALPA 3F2CA 1EFWA 2VUMG 3ZJYC 5FJ8G 1GO3E 4OWTB 2VS1A 4AYBG 4LF7L 3U50C 5IWAL 1Q81C 1LTLA 1IZ6A 5M5XH 4OWWB 4GOPC 5LMNL 5LMUL 3CC4A 2JJQA 1UEBA 4A93G 2DUDA 2K4KA 1UE7A 2QGQA 4AH6A 1KQSA 1MKHA 4LF5L 1PV4A 4OO1G 2D0OA 1DGSA 4QL5A 4JI6L 1HNXL 1OXTA 5JEAJ 4JOIA 1Y1WH 4A4IA 4JI4Q 2F52A 4DUZQ 3MXNB 4POGA 4A3CG 2IX1A 3PGZA 1N9WA 1MJCA 4JI0L 2B63H 1YHQA 2LSSA 1UE6A 3CPWA 4DR3Q 1Q86C 3I55A 1FVIA 2JA6H 2JE6I 3VDYA 1G291 1YJWA 2BH2A 2D0PA 1VQAA 2NVQH 3H15A 4JI4L 3RZDH 2IT1A 2NN6G 5JEAG 4DV2Q 5IY0A 1PH1A 4DR6Q 3CCVA 1IBKL 1Q1BA 4GKKL 2KENA 2Y0SE 3HOWG 4R4QA 5GROA 2OWOA 4IPCA 3HKSA 2AMCB 1VQPA 4YHHQ 3JAMc 1N34Q 4P75A 4HJ8A 2KCMA 1K8GA 1PH3A 1EOVA 4NXNL 1P8LA 2N49A 2IHEA 3PUYA 5FLMG 4PG3A 1Y1VH 4YCUA 1HNZL 2E2IH 4LF4L 4DR6L 1IL2A 4HIDA 2GVAA 2K5HA 3S24A 3A0JA 4DK6C 4O0AA 2K75A 1QUQA 1X3EA 3OYYA 4A3MG 2Q2UA 4LFCQ 4KHPL 1YBYA 4WJ3M 3LGJA 3FHWA 1K8AC 1YJ9A 2JA7G 1WYDA 4GNXB 5IP9G 4DR1L 2NN6I 1NMGA 2Y0SG 3I2ZA 3W5OA 4DR2L 2ID0A 1X6OA 5C44G 1VQ4A 1PH2A 5H1SE 4GOPA 4A3KG 1VQ6A 4JBKA 4B3RL 2E2JH 3K8AA 4BY1H 4A3LH 4JI2Q 3CAMA 4QJFA 4EX5A 3DLLA 5HY6A 2ZM6Q 4DUYL 4GKJL 2JA8H 1VQKA 1G6PA 1JJ2A 3EBEA 4HIMA 4JI2L 4DV1Q 2KHIA 4R4TA 3W1GA 2A19A 2WFWA 2ZM6L 4DV3Q 3T1YL 4B3SQ 1N32L 2ZJPA 4DR5Q 2YV5A 4QQBX 3FKIG 5FLXc 1R9TH 3GDEA 3KDFB 4JCVE 1E3PA 1XTDA 4LUVA 3HOVG 4KHZA 4ME3A 4JI1L 4BY7H 4JI7L 4TQUS 4A3GG 4A3IG 2NZOA 4LFAL 1SR3A 1VQBA 4P73A 1GKHA 4DV3L 3T1HQ 4JI3Q 2BA0A 2JEBI 3GTLH 4IPDA 2UUCQ 3AEVA 5JJLA 2Z6KA 2UXBL 1VQLA 2MO1A 4L5QA 2GN5A 5ELOA 1Q8KA 4YY3L 2C35B 2ZTCA 1GVPA 3S14H 2K14A 4JI8Q 4A3FG 1QZGA 1VQ9A 4L5RC 3T1HL 3TS2A 3D0FA 4GNXC 4A3BG 1U0LA 2E8GA 5M3MG 1LM0A 1VQEA 3RLFA 1KC8C 3AQQA 4A3JG 1XNRQ 3GTMH 3PUXA 3H0GH 3NEMA 3TRZA 1OXXK 3SGIA 1VQDA 2DGYA 4HJAA 3EIVA 2QEXA 4A3EG 1QZHA 2VQFQ 4DV7L 4BBSH 1IXRA 1XMOL 1QVGA 3G71A 3GTJH 2EQSA 2AHOB 1WFQA 2AWNA 2R6GA 5IYCH 2F3IA 1C9OA 4KI0A 4AYBE 4DAYB 3HOXG 1KRTA 2NVXH 2WAQG 1M90C 1S3OA 1A0IA 1I5FA 2JQOA 3E9IA 1K73C 4BA2I 2UXCL 1LYLA 2NZHA 3CP0A 4LF7Q 3WWVA 3L0OA 5IWAQ 4P74A 3S17H 5LMUQ 4O2DA 2ASBA 1L1OA 4C2MH 3CCEA 1MJEA 5C0XJ 2OQKA 5GAHC 1NMFA 1PYBA 3CCJA 1NTGA 4GLXA 1IBLL 1NE3A 4LF5Q 2R92H 1SROA 4JI6Q 1HNXQ 3UDGA 4L5SA 1PYSB 2ZTDA 1AE3A 1X65A 3GTKH 2UUAL 1VQ5A 3I4MH 2B29A 1HR0L 4JI0Q 1Y14B 3CQZH 5IP7G 3PCOB 4X6AH 1YJNA 5C0XG 3K7AH 3S2DH 1XMQQ 1K9MC 3UDXA 4YWKA 1J5EL 2D62A 1I6HH 1H95A 2CWPA 3PO2H 3S15H 4GNXA 4LUOA 4YCWA 4HJ9A 1K3RA 4NB3A 2WP8J 3BJUA 1EUJA 5BR8L 1PFSA 1IBKQ 1I94Q 3M7NA 3KYHC 1XMQL 4J15A 4GKKQ 3CCRA 1WOCA 1VS0A 3I7FA 1YITA 3I4NH 1HJPA 1L1OB 4QGUA 4NXNQ 1JB7A 3I4OA 4LUZA 3F2DA 1HNZQ 4R4OA 3RN2A 2YTYA 2JA5H 4LF4Q 2R93G 1I94L 2CQOA 4X64Q 2Z6KC 4IPHA 3S1MH 4OO1I 1E7ZA 5C0XI 3HOYH 1QVFA 4DNIA 4KHPQ 1X3FA 4YCVA 1VQMA 4HJ5A 4DR1Q 3UE0A 2ZJQA 3DM3A 1WCMH 3KDFA 4DR2Q 4X64L 3M3YH 2Q2TA 4B3RQ 4UPAA 1VQ8A 1HZ9A 1L2FA 4MNOA 4QIWE 3RR5A 1FJGL 1HH2P 1VQHA 4DUYQ 4GKJQ 1XPOA 1SMXA 2N78A 4P71A 3M9BA 1OXSC 1Y1WG 1YZ6A 3UDFA 3CCUA 1FGUA 5GADC 5IYDH 5C4XH 1KXLA 4LFBL 3AFQA 5C3EH 2B63G 1EWIA 1SN8A 3GTGH 1U5KA 1C7YA 2JA9A 3KJPA 1TWFH 1YHBA 3CC7A 3T1YQ 1PH4A 1ASZA 2JA6G 1N32Q 4LF6L 4DR7L 1B7YB 1E22A 4POFA 4DR4Q 4GN3B 3UE1A 1Q46A 2L15A 1V1QA 5JJKA 4JI1Q 1UE5A 4JI7Q 3H3VI
chains in the Genus database with same CATH superfamily
3T51B 3OTOL 3TEHB 1S72A 4ME5A 1BBWA 3J7A5 2G5DA 3S1QH 2M9VA 2O5IC 4DK3C 2A5HA 2UXBQ 3FMCA 1ENFA 2R7ZH 1AP0A 3OWFA 4HJ7A 2Q2UA 2VY3A 3SXHA 1GXDC 3MFGA 1CM9A 5CBEE 4Y7NB 3MAQA 2F0VA 1IW7C 4ULLA 2L55A 4PZ6A 5J3BA 3N52A 4B3TL 1LACA 1PH6A 3KLWA 5C4JB 1KIXA 1HA6A 1OO9B 3RZOH 2PYKA 1XMOQ 1JWUD 4BY1G 4C3JH 4C3HH 4N9TA 1YEZA 2F0UA 2E2JB 3PF5A 2JA8G 1EFID 2IY5B 3J81c 4YWLA 4NP5A 2PI2A 1HZBA 1PA6A 2E5LL 4QCLA 2FMMA 3P20A 4IFDI 4DFAA 1RHPA 5FJ8H 3TBIB 1QILA 1B2TA 3QIAA 1VMPA 2BA1A 3G4SA 2PI2E 3NBHB 3SEBA 4R8NA 1TVXA 4DV4L 4A93H 1DJRD 3P1HA 4NMZA 1BVSA 2PQAA 2RDHA 4C1NK 1X3GA 3BVZA 4RMFA 1SNCA 2B2TA 1IYVA 5J1ZA 1HR0Q 1A63A 1SNMA 2B2UA 4KK7A 3UDIA 1PMRA 4QMGA 2B2YC 3AU7A 4AQYQ 2XIWA 4KJOA 1I50H 1J5EQ 2LXJA 4IALA 2CFMA 1K0SA 3M7GA 3AFPA 1CQVA 2SOBA 3U4VA 4R4IA 2WIIB 1GM5A 2IW3A 4OONA 4UAIA 5JEAH 2RHQB 4AQYL 1D8LA 3TDQA 3GTMB 2MFIA 2NVTH 1OXVA 1SNOA 3KLRA 1Z47A 1ICWA 3CCMA 4HN7A 3GTQH 3I91A 2PQAB 3TREA 2HT1A 4GS3A 3ICEA 4P72A 4R8IA 2PNRC 1N8RC 3S17B 1ZXTA 2ES2A 4IPGA 3ND9A 1QE6A 1FJGQ 3PIO3 1A3TA 2HIXA 4KY5A 2A68D 2F0HA 3I56A 1SJED 4L5TA 1XX8A 4HIKA 1HZCA 1C48A 2F0IA 5ELNA 1AE2A 1JE5A 2VNUD 3CQZB 3J80L 2D9UA 2E2HH 4U673 4KD4A 4UP7A 2XVSA 3H94A 4DXFA 1PTOF 5J39A 4DV2L 4HIOA 1IL8A 1PZID 5KIXA 1H9SA 2QA4A 1DOLA 1HTLD 2CWAA 5KYIA 1LT3D 4DAMA 1X9NA 1CZGA 3S1MB 1O7YA 2AUKA 2B2UC 2RBMA 3I3CA 1EY5A 1N36Q 2IHFA 1EYDA 4IZ8A 5CV9A 3MXGA 1B9MA 2K5VA 3LWEA 5IE8A 1RKNA 5M5YH 2BE5D 1JJGA 3R2IA 2KCCA 4A3EH 2VZAA 1CTMA 1J8IA 4HSPA 2GVBA 2HIVA 4J1MA 3F1ZA 3LWUA 4IOCA 2VL6A 4J6HA 1GUGA 3HOXH 1GD7A 3JAML 2MQHA 5C4XB 1PFNA 4RCNA 2H5XA 2R3ZA 1GUTA 2C5CA 4JC0A 4DK1A 3GTGB 4OL7A 1QUQB 4DV1L 1TR5A 3CRKC 1IHZA 3MEFA 1PHJA 4B3SL 1CHPD 2YU9H 3OW2A 1A62A 5JAVA 1MIUA 4PMCA 2RHSB 3HOUG 4BBRG 4GOPB 1HR0W 4WJWA 1IBMQ 3HKZE 2PNHA 1CKOA 2Q2HA 1TU2B 1NCVA 2AKWB 5NUCA 2UUCL 3BZKA 3RLNA 3KFUA 3NWSA 2KVMA 4DXGA 4FDBA 3PO3G 2F0QA 3IFTA 2OT2A 2XGTA 1STGA 1EU3A 2QDLA 2TSSA 2A8VA 5M3FB 3K81C 2B39A 5C6AA 4JBWA 1CFMA 3CF5A 3BU2A 5M9OA 3D6CA 3J80c 1LV9A 2R93H 1FR3A 4RGMA 4CDDC 4OHJA 3BDLA 1G8ZD 4X3KA 1EFWA 2EY2A 1GO3E 4ZLTF 2VS1A 5BN4A 4LF7L 3U50C 1ET6A 4OWWB 4GOPC 5KRUA 4K14A 2DUDA 1GUWA 1UE7A 3A55A 2HQEA 2X69A 4OO1G 1DGSA 3AMUA 3OW7A 5JEAJ 1F9SA 4A4IA 4K6LA 3PIP3 5KNDA 1N9WA 2B63H 1PZJD 4MIUA 1SYEA 1Q86C 2JE6I 1I3QB 2NN6G 5IY0A 4DR6Q 1LTBD 1HUMA 5GROA 4M8AA 3HOWB 1S5CD 3JAMc 1PH3A 1L0YB 4NXNL 2N49A 1KAAA 5FLMG 4DR6L 3I8ZA 1IL2A 4HIDA 3S24A 2K1BA 4O0AA 3M4YA 2H1EA 3OYYA 4A3MG 4LFCQ 1GHJA 4JW0A 5DM73 1K8AC 2BDOA 1WYDA 4GNXB 2Y0SG 1PH2A 3K6OA 2E2JH 3K8AA 5C44B 1WTXA 3CAMA 3S2HB 2NUCA 5HY6A 1BCPB 5I6YA 1E2WA 3Q0AA 1A2UA 1HA5A 1JJ2A 1BOSA 3O13A 2GA4B 5EGTA 1EYAA 3T1YL 1N32L 1WD1A 2ZJPA 2K03A 4QQBX 1S5BD 5FLXc 1E3PA 1XTDA 3NTHA 2NTSA 3A54A 4ME3A 4JI1L 4DAYA 4DK0A 4ZQ3A 4PQXA 2NZOA 3T1HQ 4JI3Q 2BA0A 2A74C 2Z6KA 3VA5A 4X3TA 1B3AA 1CQFA 4L5QA 1Q8KA 4F7XA 2K14A 4K6DA 5E3FA 4L5RC 3T1HL 2OF1A 4GNXC 4A3BG 1EEID 1LM0A 1VQEA 1TWGB 4FNFA 2R7ZB 3AQQA 3D3RA 4A3JG 1XNRQ 3GTMH 1WTWA 3H0GH 2F0SA 2EY1A 4HJAA 2DGYA 5IGFA 3A56A 1QZHA 4DV7L 1BCPC 1RDPD 4BBSH 1TWHB 1YNNC 3LX0A 4P2CB 2ICEC 2PMZB 4PV1C 2F3IA 4K2KA 3BG3A 4DAYB 1KRTA 2NVXH 1KNEA 1Y8OB 4ZUIA 3RZOB 5EKLA 1M90C 3NUCA 4BA2I 3E9IA 1ONLA 4C3HB 4C3JB 1G2TA 4MN3A 4P74A 3S17H 5IGGA 1F2MA 4O2DA 3K57A 1MJEA 3G6JB 3CCJA 2F0PA 1IBLL 1NTGA 4LF5Q 1K8OA 3KK7A 1TWCB 4JI6Q 2ZTDA 2Z1CA 1C4QA 2B29A 3BZDB 4A93B 3CQZH 5IP7G 1EWCA 3VR4A 2WV6D 1XMQQ 1K9MC 4DGZA 4YWKA 3TP7A 3NPPA 2CWPA 2B2WC 3OHXC 3S15H 2LFNA 3KLSA 4CKBA 3BJUA 1DCZA 4KHVA 1XMQL 1I50B 4I65A 1WOCA 1K3BC 1VS0A 4IN3A 4KD3A 1MSHA 1YITA 1HJPA 2LS01 3WOFA 1PFMA 5DAUA 2F0TA 4QGUA 3I4OA 4MTKA 4LF4Q 4X64Q 2Z6KC 1ZKOA 3S1MH 3HOYH 1QVFA 1U4PA 1A6XA 1QB5D 4EQOA 4DR1Q 3DM1A 5CORA 1WCMH 5M5XB 4X64L 2Q2TA 4UPAA 4IUNA 4FXDA 1TQOA 4MNOA 4QIWE 3RR5A 4FXKC 1HH2P 2B2VA 3NHHA 4X3UA 1SMXA 2N78A 2Z8LA 4DUYQ 4GKJQ 4S3SA 3M9BA 1ILQA 3CCUA 1FGUA 5C4XH 1K8MA 3GTGH 3EJIA 1KNAA 2HCIA 1B7YB 1E22A 1KABA 3OIPA 3CKIB 4HTHA 2MP1A 4JI7Q 1XJVA 1BBUA 1WJJA 4QIWB 4LFAQ 2K50A 2EJGC 2FMCA 1UWVA 4JYAL 3STBC 1Q8IA 4YY3Q 2EPBA 4NPSA 4IO9A 2XN9C 2MO0A 1EYGA 2XRQD 3CPFA 1Y1VB 1WTOA 1RL2A 3LNNA 2A1AA 1YVCA 2A6HC 3ULLA 3CXCA 2MPMA 2ZXOA 4PMBA 5KGUA 4NW2A 5IYBH 5M3FH 4A3LG 3MXUA 1V8QA 5M5YB 5I9PA 2X6LA 3K0XA 2F4VL 2UXDQ 2ZT9C 1KL9A 5IT9E 2UXCQ 4A3EB 2MNAA 3K7UC 3SK4A 5LMNW 1PLFA 3Q24A 3CCLA 2F1MA 5K36G 1P16A 2UXDL 1SE4A 4B3ML 3ULJA 4RHSA 2QDBA 3DHQA 5CV8A 2I5LX 4H13C 1ZEQX 4UP9A 3NENA 2RSNA 4BY7B 2NTTA 3ER0A 3OMGA 2PO4A 4IUTA 3E6ZX 2YU9B 2B2VC 1Z6HA 4OXPA 2BOSA 4NXMQ 5JJIA 1HFNA 1G2SA 2ENBA 3BYTB 1PVOA 2XWJB 4LF8L 2I07B 3HKZG 2ZJRA 3GV3A 4A75A 2RCNA 1TS3A 2ZTEA 1I3QH 4QY7A 3J81L 3K5NA 1WD0A 4NXML 4DV5L 4HMIA 2LKVA 4DV0L 2N55A 2BDNA 1QWYA 1EY8A 4IUQA 1ICFB 3G48A 4V0BA 3HOWH 4DV6L 1DONA 3GTJB 1EIFA 3SK5A 4QUCA 5G3LD 2N88A 1EQVA 1BCPD 4KN7C 1YNND 4GLAC 2VXWA 3EA6A 1KDBA 3S9WA 5FK9C 3BVGA 1D1IA 1TY0A 3A5ZB 3T16A 1F9RA 5CMDA 1NUCA 2JA7H 5IP9H 1E2ZA 2R93B 3B6YA 4LMQD 5C44H 1YNXA 3S2HH 3M4PA 2R92B 2EY6A 4UHVA 1S5ED 5FOBB 2B8FA 3I4MG 4JI5Q 1D7QA 2Q2IA 4IJLA 5CV7A 4LF6Q 1Q7YC 4DR7Q 2R7DA 3HEJA 4DR3L 3PO2G 5CV4A 4JI5L 5JVH3 3ND8A 3OTOQ 1VQOA 2OTLA 2B63B 1QJOA 2UUBQ 2YTVA 2F3VA 1XPRA 1A8VA 2EIFA 2KBNA 1KHIA 4CJ0B 1SXTA 3I4NB 3TMEA 1FL0A 1N34L 1DM0B 4KLKA 3CCQA 2UUBL 1I4RA 5JPNC 1EY9A 1BXTA 2JA5B 1V43A 1EY4A 2BCOA 4UY8C 1IKLA 1TWGH 2EXZA 4TSSA 1YHAA 4B3TQ 1B8AA 2X6GA 1WTQA 1NR2A 4JBMA 2N8NA 3NBHA 3RNUA 1KRSA 1TWHH 3QO2A 2TMPA 4KKSA 1JWSD 5CBAE 4N8FA 5COYA 4EQ5A 4Q0FA 2F4IA 1T5EA 2E5LQ 1HTPA 2H4OA 3F2BA 1T9HA 5GAEC 5C3EB 1PFBA 2N3SA 2OTJA 2K52A 3Q22A 1KLUD 2QCPX 4PZ8A 2KJXA 1Q12A 4UDUC 4L8JA 4DV4Q 4DR5L 4XYOA 4KKTA 3NSWA 1HRJA 3TS0A 3PQIA 2XRSD 1TWCH 4JOIC 2KHSA 4ZUJA 2R7ZG 2RKSA 4L63B 1NNXA 1LT6D 1Q82C 4A3DB 3STBD 5C0XH 2KOLA 1AZQA 4H7BA 3KBGA 5M5WH 4XQJA 1XPUA 2CW0C 1B9NA 2PZUA 3A5UA 4GN4B 1SE8A 2A69D 2D5DA 2XTIA 4C3HG 4C3JG 2VQFL 2A6HD 1MD2D 3C2PA 2I0QA 4XIGS 1UUPA 1PH9A 3A7AB 3FVQA 3L7ZC 3HZXA 3PSIA 2G9HD 3H0GB 1HUNA 2L9HA 3PIPA 3BVMA 2O5JC 3DEOA 3PUVA 4BBSB 2QEJC 2KQ3A 3ZJYC 5FJ8G 3OPOA 4C3IB 1STEA 4H44C 1Q81C 2RCFA 5M5XH 1MI2A 2NVXB 5LMUL 3MTSA 4A93G 2K4KA 3MC0B 4N9PA 4KV6A 5T1IA 4AH6A 1ENCA 1MKHA 4XT3B 5EBDA 2D0OA 3S1RB 5IGCA 1AFPA 4TKOB 1PXUA 3FEWX 4QL5A 3NQTA 3SVMA 3OMCA 3ERQA 4JI4Q 4LJZC 4JI0L 4I7AA 1I4GA 1YHQA 1UE6A 4ZKBB 3I55A 5IODA 2SNSA 1F9PA 1RTOA 1G291 2E76C 1YJWA 4JI4L 5LL6X 1VDZA 4RKLA 5JEAG 4QB4A 4DV2Q 2G9DA 1PH1A 3CCVA 5A2QE 4GKKL 3R93A 3J7YW 4IPCA 1STNA 3HKSA 1VQPA 3A8JE 3S15B 4HJ8A 2KCMA 1K8GA 3NQIA 1P8LA 1HNZL 4PG3A 1Y1VH 1BQQT 3A0JA 3W2DA 1QUQA 1X3EA 4IFDH 1I4QA 2F0WA 1XYIA 5C3WA 2NN6I 2NVYB 1BO0A 2KEEA 2ID0A 1VQ4A 4F88A 3HOYB 5H1SE 4GOPA 1KDAA 3DXJC 5K5PA 2EYLA 5CR3A 4A3KB 4QJFA 1JOQA 2ZM6Q 1VF5C 1W6JA 1WCMB 2VB3X 3NTIA 3I73A 2CHBD 1K83B 1SYGA 2OXPA 4DV1Q 3W1GA 2A19A 2ZM6L 4DV3Q 2QF7A 4B3SQ 5I2YA 4Z9CB 3KDFB 3FKIB 4BY7H 4TQUS 2AQ2B 2XWBB 3FRPB 5EQ0A 4A3GB 2Z4IA 1VQBA 3K58A 4DV3L 1VMCA 4A3IB 2JEBI 2UUCQ 3AEVA 3HOZB 1TS4A 3E3XA 2MO1A 2GN5A 5ELOA 3T13A 5A35A 3HP3A 4B9XA 1QZGA 2CH4W 3V05A 5E4XA 1YNJC 1FGBD 1C8CA 3IFDA 4CKEA 5M3MB 1JQYD 1EL0A 3NEMA 1OXXK 3SGIA 1KC8C 4G7HC 4A3EG 3EIVA 2XSCA 2O2LD 3C46A 1IXRA 1QVGA 3G71A 3GTJH 2EQSA 2AWNA 4B08A 5IYCH 4OIJA 1C9OA 3MZ5A 3HOXG 3NXWA 3L9AX 4KY6A 5DM63 1EWHA 5FLXL 1PRTF 3DWPA 1RTNA 5CV6A 5IIFA 4FXGC 1S3OA 1IW7D 2NZHA 5I2XA 2DNEA 3CP0A 1X3QA 4LF7Q 3L0OA 5G3LF 4DN4M 2MHVA 2QW7A 5E1FA 2VB2X 2IX3A 1L1OA 2F0OA 1FD7D 3D4WA 5C0XJ 2JSOA 1PTOB 1NMFA 1PYBA 3U9OA 2R92H 2RA4A 1SROA 1ML0D 2DJFC 4RHRA 4K5XA 4XT1B 1GOZA 2UUAL 1VQ5A 4FF2A 3MXPA 1JOOA 1YJNA 1DOMA 2NZ1D 1EY7A 3VYRA 2D62A 1H95A 2KECA 1EOTA 4GNXA 5FO8B 1K3RA 1GUSA 2WP8J 3QOLA 1EUJA 5BR8L 1PFSA 5FKAC 3KYHC 3CCRA 3K5OA 5KNBA 3GTOB 3I7FA 1V1OA 2CW0D 3KUPA 3I4NH 1L1OB 1II3A 1SYBA 4NXNQ 5IGDA 4RGNA 4YIJA 3C1EA 3QR8A 4LUZA 3RN2A 1NSNS 3TP8A 2YTYA 2D2CC 2JA5H 2R93G 4IPHA 3T4AC 3EQLC 1VQMA 4HJ5A 1ZYRC 3UE0A 1PTOC 3ITPA 5F2DA 1O7ZA 4Q5VA 4ZCKA 1GUOA 5C4ZA 1HZ9A 1PZKD 4RGTA 1QNUA 3C3LA 4IUUA 2PW5A 2JA7B 3UDFA 3GQBA 1UNSA 5IYDH 1MHWC 1HFGA 1D1KA 1HPCA 1ESRA 3AFQA 5C3EH 1Y1WB 2B63G 1NAPA 4N8X1 4LFBL 1LT4D 2EY5A 1U5KA 1C7YA 3KJPA 1ASZA 3T1YQ 2NYZD 1N32Q 1PH4A 4DR4Q 2JA6B 4GN3B 1Q46A 2L15A 4JI1Q 1F2LA 3RZDB 3H3VI 2B2WA 1AH9A 1L1OC 4IFDJ 5ISRA 4DF7A 1JOKA 3N6RA 3V2TA 4PNYA 1TY2A 2K28A 4DR4L 1Z9FA 4HCSA 1HZAA 3CMAA 2IX0A 1SYCA 4A3DH 1Z7TA 2AWOA 5ELCA 3OOCA 4HSVA 1L0WA 2E2IB 3R8BA 5D3DA 2PMZE 3HG9A 1MSGA 1DXMA 1M1KC 1I6VC 2BH8A 4DV7Q 3W1BA 3T53B 3IAYA 2WAQE 2Z6BA 3CC2A 4BXXH 1LLRD 3GO5A 4BY1B 1UE1A 3R2TA 4NDXA 3TQYA 4ILWA 4K0KL 3IKJA 1H9RA 1TXYA 2JA8B 5HURA 2Z4HA 4JG2A 3Q23A 2VUMH 4C3IH 2VQEQ 1X56A 1W6KA 3KOJA 3A7LA 1SRUA 1EIGA 2WAQB 4IOAA 3U4ZA 1CA6A 3J80E 1IBLQ 1WI5A 4H0LC 1VQIA 4ZAIA 4E6IA 1N33Q 2F0LA 3S1RH 1H9MA 2VQEL 1OXUA 4K5VA 1VF7A 1CUKA 3GTLB 4XXEA 5E4WC 1M8AA 1N33L 4A3CH 4C56C 5ELBA 4IURA 3TP6A 1VQFA 1X3PA 1NBWA 1J6QA 1YIJA 4FF3A 1SE2A 1XNQL 3H0GG 5DNFA 2RF4A 2AQ3B 3Q8DA 4BBSG 1CZWA 1YNJD 3CCSA 1DOKA 3MA2B 1D5MC 4TVAB 3A74A 4GN5A 5M5WB 1ENAA 5TSSA 3NELA 4JV5L 3TZDA 3H3VH 5EAYA 3M4OH 3K5LA 4BWGB 3JAME 1KLGD 2NVYH 2QILA 1ASYA 3P75A 1LTSD 3C1FA 1VQ7A 2Q8RE 4A3KH 4YWMA 2IJ0A 1NR4A 5KEEA 2CCZA 2CKZB 3E0EA 2HQLA 1K83H 1SLJA 3M4QA 1LUZA 2NBFA 4DUZL 2E74C 2J4XA 1Y69U 3PUWA 4PZ7A 2K6AA 2Z9HA 1I6HB 2YYZA 1DD2A 3FKIH 4RCOA 3HOVH 2ALYB 2F3WA 4A3GH 4A3IH 4JYAQ 4BA1I 4I7ZC 1JCKB 1A3UA 1RF2D 3GTPH 3HOZH 2NB0A 2L11A 1DZ1A 3IRBA 4YHHL 1HNWQ 2IL8A 3CU7A 4JBJA 3HOYG 4G7ZC 1KAWA 4A3FH 1V1PB 1HHVA 1O80A 5M3MH 5IOCA 3J80i 3KJOA 1HNWL 1WCMG 5CYUA 1DYQA 2KCNA 1CK1A 4LNQA 3NWTA 3M3YB 1D2BA 1O7IA 4DAPA 2F0JA 1PTOD 4Y52H 1E24A 3E0JA 1T5XD 2F4VQ 5ELFA 4CJ1B 2V1CC 2L5TA 2F03A 5C4XG 3GD7A 4RGOS 4DA2A 3J81j 1B1ZA 2I5MX 2WB1E 3KBXA 2LY7A 4B3MQ 4JPBW 3HOZG 5C5MA 1EQTA 1PTOH 1WTRA 3H6MA 3HFZB 2F0FA 4APVA 3HOUB 1CKMA 4BBRB 2JEAI 2LXKA 1TT2A 4AIMA 1CHQD 1VQJA 1NY4A 5GQOA 4IJHA 1BR9A 5EKIA 4LF8Q 2WB1B 3PF4A 1B50A 4JI8L 1IYJB 4HEDA 4OGQC 3JAMi 4KMUC 2FJ2A 1AEXA 1I4PA 4XTCS 1BF4A 4DV5Q 2F0MA 3J7ZC 4DV0Q 3VYUA 4R4CA 2YTXA 5IYBG 5M3FG 3GTOH 1VQCA 3I4LA 4DV6Q 1BNZA 1X54A 1EY0A 1Q3LA 5IGBA 3PIOA 3MHBA 1TS2A 3RLOA 3SDZA 4LWCA 4ZKCB 3L2PA 3W3AA 4DPGA 3G7LA 3F2CA 3K5MA 1L0XB 1TWAB 5IWAL 5HGTA 1IZ6A 1LTGD 1SNQA 3CRLC 3DUZA 3K59A 1TS5A 4KTAA 2JJQA 1CT1D 5CV5A 3D4DA 1EIHA 1WTVA 5CGKA 2QGQA 1KQSA 1LABA 4R9WA 1PV4A 1HNXL 1STBA 4JOIA 1Y1WH 2F52A 1A2TA 4POGA 3BDCA 3VYSA 3RUZA 5D14A 4DR3Q 1FVIA 2JA6H 3HRZC 1BDOA 4OEMB 2D0PA 3VR6A 2BH2A 3H15A 3RZDH 5EPJA 1STAA 2M2LA 1IYUA 1IBKL 2KENA 2Y0SE 3HOWG 2F0DA 4R4QA 4GZYC 3OIQA 3Q6SA 2EYPA 2AMCB 1N34Q 4P75A 3PUYA 4YCUA 1JORA 2E2IH 2MJ8A 2K5HA 4DK6C 2R61A 2SNMA 4KHPL 1YBYA 2WACA 4WJ3M 3FHWA 2JA7G 1QNKA 5C5LA 5IP9G 2SEBD 1LTAD 1NMGA 3W5OA 3E5SA 4DR2L 5C44G 1X6OA 2Y0SB 5JVG3 3I72A 4JK1C 4JBKA 4BY1H 4B3RL 1Y8NB 1D5XC 1BUVT 4X3SA 4EX5A 3DLLA 1H9JA 3S16B 1LT5D 2JA8H 1VQKA 1TKWB 1G6PA 2KHIA 4ABNA 2ZXRA 4DR5Q 3GDEA 4LUVA 1TIID 1EU4A 2PQEA 1R4QB 1UEAB 5CC4A 5JPMC 3GTLH 5JJLA 2K5QA 1IKMA 2UXBL 1VQLA 2MGSA 1WTHA 2AUJD 3DWAA 2EYMA 1GVPA 1R4PB 3TS2A 1QOHA 1O78A 2HCCA 1U0LA 2E8GA 1SJHD 4A3BB 1I4HA 2EYJA 3ONAB 4K5WA 3PUXA 3TSSA 1VQDA 4A3JB 2QEXA 2VQFQ 1XMOL 4CBVA 2RDFA 2WINB 4ZK9B 1FNUA 4KI0A 4AYBE 3D8GA 2PPBC 2WAQG 3DWQA 1I5FA 1LYLA 1CI3M 3BYYB 3WWVA 1STYA 4F8MA 2RSOA 5LMUQ 3CCEA 1HCZA 3T56B 2OQKA 3NBIA 3TZUA 4GLXA 1NE3A 3I90A 2VUMB 4RAUC 4AYBB 1PYSB 3ZYYX 1X65A 1HR0L 4JI0Q 1SFOB 1Y14B 3PCOB 4X6AH 1F77A 2EZVA 5C0XG 1RD9D 5D65A 3NE5B 1SMYC 1J5EL 1B4OA 1I6HH 1SE3A 4RKBA 1PDQA 4LUOA 4GKKQ 2DNCA 2J7ZA 1E2VA 1HNZQ 2EYHA 2CQAA 1F2YA 4OO1I 4V190 5IGEA 1X3FA 1QG7A 5EPKA 2EYOA 2EOTA 5I4DA 2ZJQA 3DM3A 2EDGA 1B44D 3KDFA 4CDEC 3NK9A 3D4RA 3M3YH 2KEDA 3OSOA 1FJGL 1L2FA 3GP7A 1VQHA 3M4OB 3VR2A 1XPOA 2CVRA 4HCEA 5EKKA 2FHTA 1EWIA 4HMJA 4ZRZA 3VA7A 2JA9A 3DMUA 1TWFH 1YHBA 1HQMC 3CC7A 3PMFA 4POFA 4O1NA 3RMHA 3UE1A 3A8IE 2Q8IB 1O7LA 3V96A 4EGVA 2NVQB 1UE5A 2I46A 3HOUH 2B2TC 4BBRH 2K5WA 2LMCB 4GLVB 4CHTB 1JE4A 2ICIA 3J81E 1K0RA 1C0AA 1GUNA 1X32A 1M4VA 1JB3A 1CSPA 2K5NA 2Z0SA 5EJWA 3HOVB 1Y1VG 1SNPA 5C4HA 2VW9A 1I4XA 3NTKA 2RVLA 1NJIC 1SEBD 4LF9Q 4IFDG 2ZXPA 2L1BA 2HHHQ 3GTPB 1AZPA 1N36L 3PO3H 5KYLA 3H3VC 3OWEB 3M85A 3U9SA 3DEPA 2RDGA 4IQZA 1X55A 3AYHB 2DN8A 4PMWA 3RN5A 4A3FB 4ODGA 4LF9L 2KA7A 2K05A 2HHHL 4DU9A 1F2ZA 1JC7A 2V4DA 1H9SB 1V9PA 2F0EA 1J9OA 2NWGA 1CKNA 4X62Q 4X65Q 4UP8A 3BS1A 1TWAH 1B70B 1S40A 3WDNA 3QB3A 3QWNA 3PUZA 4X62L 4X65L 5E7NA 5T1GA 2J0TD 1R9TB 1VQNA 4BY7G 1CA5A 2WB1G 3D31A 1BCPF 1IBML 4OO1H 1JT8A 2UUAQ 2ATWA 5LHY1 5DEHA 1U4LA 2FXQA 2DY7A 3R3OA 1SYDA 1W3SA 4XQNA 3FDTA 3S14B 2L4NA 1YI2A 1CKNB 3HKZB 1JICA 5D3IB 2EJFC 3CMEA 4OWXB 5BR8Q 1ILPA 2NN6H 4LW1A 1E1TA 4TRDA 2F0NA 1G6ZA 3G6EA 4A76A 5GAGC 3EROA 4KJNA 5IYCG 1W2BA 1H9KA 1JJCB 3KF8A 1VQGA 5FLMH 1HXYD 1ESFA 1S4ZA 5JJZA 4NKLA 3EN2A 3QOJA 4B9WA 1RIPA 1RJTA 1E1OA 4R1JA 4A3MH 1SNDA 3AB9A 1MBYA 4MTNA 3S1NH 1EQQA 2UU9Q 5AFWA 4RG1A 1Q1EA 4C2MB 2HUGA 5IT9L 2R92G 3J81i 3S16H 4H02A 3VR3A 3VYTA 2FFKB 3D6WA 4M1UB 2A6EC 2UU9L 5I9OA 4LFBQ 3GTKB 3I4MB 1PH7A 3SK6A 4DNRB 2I5HA 1WVLA 3K7AB 3S2DB 1JMCA 4RWSC 4FF4A 2SDFA 3KF8B 3KLSX 3PO2B 2R7FA 2WKCA 4RFBA 4ID6A 1SMYD 3BZCA 2OCEA 4Y7NH 1EIYB 2CH4A 1A3VA 2HD3A 4CKCA 3I4NG 4L6TB 4K8IA 1S5FD 1FYCA 4O42A 2JA5G 1QVCA 3K80C 4XDXA 3I70A 5C4JH 1PRTB 3U58A 3H09A 1LTID 3TP5A 5BN5A 3KF6A 4A3BH 1RCVD 4LFCL 3FPUB 1XWEA 4MZ9A 4KY7A 3CD6A 4IUPA 4A3JH 3H91A 1LTRD 3CW2C 2XNAC 1OTCA 1LO5D 4CGYB 5DLQE 3F8TA 2EXDA 2K04A 2KCTA 3E9HA 1KD1C 4K0KQ 4KN4C 4HR7B 5IYDG 3ERSX 5C3EG 3K0YA 3CHBD 2KHJA 1KTKA 3F2UA 1EQRA 4FYDA 5C3XA 2EYFA 2DY8A 1PH5A 3BDOA 4G57A 3KF6B 1VCIA 4XYQA 1D6EC 3QJYA 5KNCA 3S1QB 4JI3L 4FF1A 1PRTC 2IPKD 1SBBB 1SFOH 2B3GA 5AJ3Q 1BKBA 4A3DG 1JWMD 5IP7H 4ZYSA 2L12A 3JC66 2PZWA 4G7OC 5HGQA 2HDMA 4DKAC 1XNQQ 4X66Q 5AJ3L 1SYFA 5IT9c 4OX9Q 1XNRL 1G51A 2OQ0A 3PV0A 2O4XA 2EVBA 1XTCD 3MXNA 1PH8A 3FP9A 4BXXG 3ULPA 2JXMB 4X66L 4K2LA 2F0KA 4OX9L 1CSQA 2JK8A 5LMNQ 4WJ4A 4QUFA 4JV5Q 4ALPA 4OIKA 3NP8A 2VUMG 4C3IG 4OWTB 4AYBG 2QKIC 3EFXD 5FO7B 2P5ZX 1LTLA 2WKDA 1EZ8A 3VR5A 5LMNL 1BBXC 3L3OC 3CC4A 2EE1A 1UEBA 3WOEA 1FNVA 2K7VA 5BN3A 3SE0A 4LF5L 2PZTA 5FO9B 1Q90A 4JI6L 1OXTA 2RQXA 1STHA 1F9QA 1Y8PB 4DUZQ 3MXNB 4A3CG 2IX1A 3PGZA 1MJCA 3A8KE 2LSSA 4KKUA 3CPWA 3FPPA 1V1PA 3VDYA 4G4KA 1VQAA 2NVQH 2IT1A 4RH6A 1Q1BA 2NVTB 2OWOA 2IWHA 1S5DD 4YHHQ 1RODA 2AQ1B 1EOVA 3GTQB 2IHEA 4LF4L 2C9OA 4CDFC 2GVAA 2K75A 1U4MA 3EVQA 3X3MA 3LGJA 5FLXE 1YJ9A 2M00A 4DR1L 2Q8TA 1EZ6A 3I2ZA 5LL6S 1VQ6A 4A3KG 5J22A 4WRDA 4A3LH 1AW7A 4JI2Q 1U4RA 1HQRD 4FVMA 4DUYL 4GKJL 1SAPA 4EQNA 3EBEA 1ZYRD 1EY6A 1FNWA 2JP1A 4HIMA 4JI2L 1WTPA 2KUMA 3P7JA 4R4TA 2A6ED 2WFWA 5K36H 2E2HB 2YV5A 2MUYA 4HAEA 3FKIG 3X3NA 1R9TH 4JCVE 4DAVA 2A73B 4IUVA 3HOVG 4KHZA 4CJ2C 4JI7L 1QCBD 4A3GG 4A3IG 1TWFB 2K33A 4LFAL 1SR3A 3MVVA 4P73A 1GKHA 2A69C 4QF4A 4IPDA 5EBCA 4YY3L 2C35B 2ZTCA 4BS9A 3S14H 4FP5D 2HDLA 2K01A 4JI8Q 4A3FG 1VQ9A 3D0FA 3MEHA 5A2QL 1B53A 5M3MG 3IL8A 3RLFA 1EEFD 4CDCC 3TRZA 4U68A 2E75C 2AHOB 3PO3B 1WFQA 2R6GA 1GJXA 2PW7A 2F0GA 3HOXB 1A0IA 2JQOA 1K73C 2UXCL 3TN2A 3HS0C 2OEOA 5IWAQ 3RD4A 4WORA 3HGBA 4JVZA 2A68C 3SK8A 2ASBA 4C2MH 4EVOA 3SHLA 4OELB 5GAHC 2EJMA 3MFYA 1EYCA 3QG1A 1HNXQ 3UDGA 4XQQA 4L5SA 1AE3A 4J8QA 3GTKH 3I4MH 4LK1C 1E0BA 1ET9A 4MHEA 3K7AH 4LAAA 3S2DH 1A15A 3UDXA 1PRTD 1MGSA 3GV6A 3PO2H 5EPLA 4YCWA 1SSOA 4HJ9A 4NB3A 2JN4A 1JR0D 1IBKQ 1I94Q 1AN8A 3M7NA 2E2DC 4J15A 4FO2A 4EQPA 3MWYW 1XXGA 5ELEA 4DNTB 1UAPA 1JB7A 3F2DA 3J7AV 1K28A 4R4OA 1LTTD 5JOBA 1I94L 2CQOA 2BE5C 1E7ZA 5C0XI 4DNIA 2PCFB 4KHPQ 4YCVA 5ELDA 3SR1A 4K8JA 4DR2Q 2JYOA 2DJGC 4B3RQ 2B8GA 1VQ8A 3URYA 4A3MB 1KDCA 4P71A 4F87A 1U9RA 2K5DA 1OXSC 3UI2A 1Y1WG 1YZ6A 2B2YA 3J7AF 3S1NB 5GADC 1G91A 1GHKA 1KXLA 5I6WA 1SN8A 5L37A 4WFN3 1B3QA 4RA8A 2K32A 2JA6G 4LF6L 4DR7L 1D5ZC 4C1NI 1SDFA 2FINB 1V1QA 5JJKA 1PYWD 2L0CA
chains in the Genus database with same CATH topology
3OTOL 1XJVA 1BBUA 1WJJA 3TEHB 1L1OC 2K50A 1BBWA 4LFAQ 1S72A 4BBRH 3HOUH 1UWVA 3J7A5 4GLVB 3S1QH 4IFDJ 4DK3C 4JYAL 3STBC 4DR4L 1Z9FA 1K0RA 2UXBQ 1C0AA 4YY3Q 2R7ZH 1HZAA 4NPSA 3CMAA 4HJ7A 2IX0A 2VY3A 1CSPA 2K5NA 2Z0SA 4IO9A 1Y1VG 4A3DH 2VW9A 2MO0A 1EYGA 3CPFA 2AWOA 1NJIC 1RL2A 1L0WA 4LF9Q 4IFDG 2HHHQ 2A1AA 1YVCA 2PMZE 1N36L 3PO3H 1M1KC 4PZ6A 5J3BA 4B3TL 1PH6A 2BH8A 3ULLA 3M85A 3CXCA 3KLWA 4DV7Q 1X55A 3AYHB 3W1BA 1KIXA 4PMWA 3RN5A 3RZOH 5IYBH 2WAQE 5M3FH 1XMOQ 4LF9L 4BY1G 4A3LG 4C3JH 4C3HH 2HHHL 3CC2A 4BXXH 3GO5A 1YEZA 1UE1A 1V9PA 3PF5A 2JA8G 2IY5B 3TQYA 3K0XA 2F4VL 1CKNA 3J81c 2UXDQ 1AH9A 4YWLA 4K0KL 1KL9A 1TXYA 4X62Q 2PI2A 4X65Q 1HZBA 1PA6A 2UXCQ 2E5LL 2MNAA 3K7UC 5LMNW 4UP8A 4JG2A 4IFDI 1TWAH 3CCLA 2VUMH 1B70B 5FJ8H 4C3IH 2VQEQ 5K36G 1P16A 1X56A 1S40A 2UXDL 4B3ML 2BA1A 3KOJA 3PUZA 3ULJA 4X62L 4X65L 1SRUA 3G4SA 2PI2E 3NBHB 2I5LX 4DV4L 4IOAA 4UP9A 5E7NA 3U4ZA 1IBLQ 1WI5A 1VQNA 1VQIA 4A93H 4BY7G 1N33Q 1BVSA 3NENA 2WB1G 2PQAA 3D31A 3ER0A 3S1RH 2VQEL 1IBML 1X3GA 4RMFA 1OXUA 1JT8A 2UUAQ 2ATWA 1HR0Q 1CUKA 1A63A 4OXPA 5JJIA 2FXQA 4NXMQ 3UDIA 1N33L 4A3CH 1W3SA 4AQYQ 1PVOA 4LF8L 1I50H 3HKZG 2LXJA 2ZJRA 4A75A 1VQFA 1YI2A 1J5EQ 1NBWA 1J6QA 2CFMA 1CKNB 2RCNA 1YIJA 2ZTEA 3AFPA 1I3QH 3U4VA 4QY7A 4R4IA 3CMEA 4OWXB 5BR8Q 3H0GG 4NXML 1XNQL 1GM5A 2RF4A 4LW1A 4OONA 4DV5L 2RHQB 1E1TA 1D8LA 4AQYL 4DV0L 3Q8DA 4BBSG 2MFIA 2NVTH 1OXVA 3CCSA 3G6EA 4A76A 3G48A 4TVAB 3A74A 4GN5A 5GAGC 4DV6L 3HOWH 1Z47A 5IYCG 3CCMA 1EIFA 1W2BA 3GTQH 1JJCB 2PQAB 3TREA 1VQGA 4GLAC 4GS3A 5FLMH 2HT1A 3ICEA 3NELA 4JV5L 3H3VH 3EN2A 1RIPA 5EAYA 1E1OA 4P72A 4R1JA 4A3MH 3A5ZB 3M4OH 1N8RC 2JA7H 4MTNA 2ES2A 2NVYH 3S1NH 4IPGA 5IP9H 1EQQA 2UU9Q 1ASYA 3B6YA 4RG1A 1Q1EA 1VQ7A 1FJGQ 5C44H 2R92G 1YNXA 3J81i 4A3KH 4YWMA 2HIXA 3M4PA 3S2HH 3S16H 4H02A 3I56A 4L5TA 2CCZA 2CKZB 4HIKA 3E0EA 1HZCA 2UU9L 4JI5Q 2HQLA 3I4MG 1K83H 1SLJA 2Q2IA 4LFBQ 1D7QA 3M4QA 4IJLA 1LUZA 5ELNA 1AE2A 4DUZL 1JE5A 2VNUD 1PH7A 4LF6Q 2I5HA 1Q7YC 4DR7Q 2E2HH 2R7DA 4DR3L 3PUWA 4PZ7A 3PO2G 4UP7A 4JI5L 1JMCA 3KF8B 2YYZA 3OTOQ 3FKIH 1VQOA 2OTLA 2R7FA 3HOVH 2UUBQ 2ALYB 4DV2L 4HIOA 4A3GH 2YTVA 3BZCA 4A3IH 4JYAQ 4BA1I 2OCEA 4Y7NH 1A8VA 2EIFA 2KBNA 1XPRA 1EIYB 1KHIA 3I4NG 2QA4A 3GTPH 3HOZH 1FL0A 3IRBA 4YHHL 2CWAA 1N34L 3CCQA 4KLKA 2JA5G 1QVCA 3K80C 2UUBL 1HNWQ 5C4JH 4JBJA 3HOYG 4DAMA 3U58A 1X9NA 1KAWA 1V43A 4A3FH 4UY8C 3KF6A 1N36Q 4A3BH 2IHFA 1TWGH 4LFCL 5M3MH 1YHAA 4B3TQ 3J80i 1B8AA 5IE8A 2K5VA 4MZ9A 5M5YH 3KJOA 1WCMG 4JBMA 2N8NA 4A3JH 3CD6A 1HNWL 1JJGA 3RNUA 1KRSA 1TWHH 4LNQA 3CW2C 4A3EH 2VZAA 1O7IA 1OTCA 2GVBA 2HIVA 3F8TA 5DLQE 2EXDA 2KCTA 3F1ZA 3E9HA 1E24A 4IOCA 4EQ5A 4Y52H 2VL6A 1KD1C 2F4VQ 2V1CC 4K0KQ 5IYDG 3HOXH 3ERSX 2E5LQ 5C4XG 3GD7A 1GD7A 5C3EG 2MQHA 1T9HA 3J81j 3F2BA 2H5XA 2I5MX 5GAEC 2OTJA 2N3SA 2KHJA 2K52A 4JC0A 1QUQB 2WB1E 4PZ8A 4DV1L 3MEFA 1PHJA 1Q12A 4B3MQ 1EQRA 4B3SL 2YU9H 4DV4Q 4DR5L 3HOZG 3OW2A 1A62A 1MIUA 2RHSB 1PH5A 3HFZB 3HOUG 3TS0A 3KF6B 4BBRG 4GOPB 1HR0W 1VCIA 1IBMQ 4APVA 1CKMA 1TWCH 4JOIC 2JEAI 2LXKA 3HKZE 2PNHA 1CKOA 2Q2HA 4AIMA 4JI3L 1VQJA 2AKWB 1NY4A 2R7ZG 1SFOH 2UUCL 2B3GA 3BZKA 5GQOA 3RLNA 5AJ3Q 1BKBA 4IJHA 4A3DG 5IP7H 4LF8Q 3KFUA 1Q82C 3JC66 3STBD 3PF4A 4FDBA 4JI8L 1IYJB 3JAMi 5HGQA 3PO3G 4XTCS 5M5WH 4DKAC 1XNQQ 1XPUA 4X66Q 5AJ3L 4DV5Q 3J7ZC 5IT9c 3A5UA 4OX9Q 2XGTA 4GN4B 4DV0Q 1SE8A 4R4CA 1XNRL 1G51A 2OQ0A 2YTXA 3PV0A 5IYBG 5M3FG 3GTOH 2XTIA 2A8VA 1PH8A 2VQFL 1VQCA 3FP9A 4DV6Q 4BXXG 1X54A 3K81C 2I0QA 4XIGS 3ULPA 4JBWA 3CF5A 1PH9A 3L7ZC 4X66L 3PSIA 4OX9L 3BU2A 2JK8A 1CSQA 3PIOA 3PIPA 3RLOA 3J80c 4LWCA 5LMNQ 4WJ4A 2R93H 3PUVA 4JV5Q 3L2PA 4DPGA 4ALPA 3F2CA 1EFWA 2VUMG 3ZJYC 5FJ8G 1GO3E 4OWTB 2VS1A 4AYBG 4LF7L 3U50C 5IWAL 1Q81C 1LTLA 1IZ6A 5M5XH 4OWWB 4GOPC 5LMNL 5LMUL 3CC4A 2JJQA 1UEBA 4A93G 2DUDA 2K4KA 1UE7A 2QGQA 4AH6A 1KQSA 1MKHA 4LF5L 1PV4A 4OO1G 2D0OA 1DGSA 4QL5A 4JI6L 1HNXL 1OXTA 5JEAJ 4JOIA 1Y1WH 4A4IA 4JI4Q 2F52A 4DUZQ 3MXNB 4POGA 4A3CG 2IX1A 3PGZA 1N9WA 1MJCA 4JI0L 2B63H 1YHQA 2LSSA 1UE6A 3CPWA 4DR3Q 1Q86C 3I55A 1FVIA 2JA6H 2JE6I 3VDYA 1G291 1YJWA 2BH2A 2D0PA 1VQAA 2NVQH 3H15A 4JI4L 3RZDH 2IT1A 2NN6G 5JEAG 4DV2Q 5IY0A 1PH1A 4DR6Q 3CCVA 1IBKL 1Q1BA 4GKKL 2KENA 2Y0SE 3HOWG 4R4QA 5GROA 2OWOA 4IPCA 3HKSA 2AMCB 1VQPA 4YHHQ 3JAMc 1N34Q 4P75A 4HJ8A 2KCMA 1K8GA 1PH3A 1EOVA 4NXNL 1P8LA 2N49A 2IHEA 3PUYA 5FLMG 4PG3A 1Y1VH 4YCUA 1HNZL 2E2IH 4LF4L 4DR6L 1IL2A 4HIDA 2GVAA 2K5HA 3S24A 3A0JA 4DK6C 4O0AA 2K75A 1QUQA 1X3EA 3OYYA 4A3MG 2Q2UA 4LFCQ 4KHPL 1YBYA 4WJ3M 3LGJA 3FHWA 1K8AC 1YJ9A 2JA7G 1WYDA 4GNXB 5IP9G 4DR1L 2NN6I 1NMGA 2Y0SG 3I2ZA 3W5OA 4DR2L 2ID0A 1X6OA 5C44G 1VQ4A 1PH2A 5H1SE 4GOPA 4A3KG 1VQ6A 4JBKA 4B3RL 2E2JH 3K8AA 4BY1H 4A3LH 4JI2Q 3CAMA 4QJFA 4EX5A 3DLLA 5HY6A 2ZM6Q 4DUYL 4GKJL 2JA8H 1VQKA 1G6PA 1JJ2A 3EBEA 4HIMA 4JI2L 4DV1Q 2KHIA 4R4TA 3W1GA 2A19A 2WFWA 2ZM6L 4DV3Q 3T1YL 4B3SQ 1N32L 2ZJPA 4DR5Q 2YV5A 4QQBX 3FKIG 5FLXc 1R9TH 3GDEA 3KDFB 4JCVE 1E3PA 1XTDA 4LUVA 3HOVG 4KHZA 4ME3A 4JI1L 4BY7H 4JI7L 4TQUS 4A3GG 4A3IG 2NZOA 4LFAL 1SR3A 1VQBA 4P73A 1GKHA 4DV3L 3T1HQ 4JI3Q 2BA0A 2JEBI 3GTLH 4IPDA 2UUCQ 3AEVA 5JJLA 2Z6KA 2UXBL 1VQLA 2MO1A 4L5QA 2GN5A 5ELOA 1Q8KA 4YY3L 2C35B 2ZTCA 1GVPA 3S14H 2K14A 4JI8Q 4A3FG 1QZGA 1VQ9A 4L5RC 3T1HL 3TS2A 3D0FA 4GNXC 4A3BG 1U0LA 2E8GA 5M3MG 1LM0A 1VQEA 3RLFA 1KC8C 3AQQA 4A3JG 1XNRQ 3GTMH 3PUXA 3H0GH 3NEMA 3TRZA 1OXXK 3SGIA 1VQDA 2DGYA 4HJAA 3EIVA 2QEXA 4A3EG 1QZHA 2VQFQ 4DV7L 4BBSH 1IXRA 1XMOL 1QVGA 3G71A 3GTJH 2EQSA 2AHOB 1WFQA 2AWNA 2R6GA 5IYCH 2F3IA 1C9OA 4KI0A 4AYBE 4DAYB 3HOXG 1KRTA 2NVXH 2WAQG 1M90C 1S3OA 1A0IA 1I5FA 2JQOA 3E9IA 1K73C 4BA2I 2UXCL 1LYLA 2NZHA 3CP0A 4LF7Q 3WWVA 3L0OA 5IWAQ 4P74A 3S17H 5LMUQ 4O2DA 2ASBA 1L1OA 4C2MH 3CCEA 1MJEA 5C0XJ 2OQKA 5GAHC 1NMFA 1PYBA 3CCJA 1NTGA 4GLXA 1IBLL 1NE3A 4LF5Q 2R92H 1SROA 4JI6Q 1HNXQ 3UDGA 4L5SA 1PYSB 2ZTDA 1AE3A 1X65A 3GTKH 2UUAL 1VQ5A 3I4MH 2B29A 1HR0L 4JI0Q 1Y14B 3CQZH 5IP7G 3PCOB 4X6AH 1YJNA 5C0XG 3K7AH 3S2DH 1XMQQ 1K9MC 3UDXA 4YWKA 1J5EL 2D62A 1I6HH 1H95A 2CWPA 3PO2H 3S15H 4GNXA 4LUOA 4YCWA 4HJ9A 1K3RA 4NB3A 2WP8J 3BJUA 1EUJA 5BR8L 1PFSA 1IBKQ 1I94Q 3M7NA 3KYHC 1XMQL 4J15A 4GKKQ 3CCRA 1WOCA 1VS0A 3I7FA 1YITA 3I4NH 1HJPA 1L1OB 4QGUA 4NXNQ 1JB7A 3I4OA 4LUZA 3F2DA 1HNZQ 4R4OA 3RN2A 2YTYA 2JA5H 4LF4Q 2R93G 1I94L 2CQOA 4X64Q 2Z6KC 4IPHA 3S1MH 4OO1I 1E7ZA 5C0XI 3HOYH 1QVFA 4DNIA 4KHPQ 1X3FA 4YCVA 1VQMA 4HJ5A 4DR1Q 3UE0A 2ZJQA 3DM3A 1WCMH 3KDFA 4DR2Q 4X64L 3M3YH 2Q2TA 4B3RQ 4UPAA 1VQ8A 1HZ9A 1L2FA 4MNOA 4QIWE 3RR5A 1FJGL 1HH2P 1VQHA 4DUYQ 4GKJQ 1XPOA 1SMXA 2N78A 4P71A 3M9BA 1OXSC 1Y1WG 1YZ6A 3UDFA 3CCUA 1FGUA 5GADC 5IYDH 5C4XH 1KXLA 4LFBL 3AFQA 5C3EH 2B63G 1EWIA 1SN8A 3GTGH 1U5KA 1C7YA 2JA9A 3KJPA 1TWFH 1YHBA 3CC7A 3T1YQ 1PH4A 1ASZA 2JA6G 1N32Q 4LF6L 4DR7L 1B7YB 1E22A 4POFA 4DR4Q 4GN3B 3UE1A 1Q46A 2L15A 1V1QA 5JJKA 4JI1Q 1UE5A 4JI7Q 3H3VI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO L;  1XJV A;  1BBU A;  1WJJ A;  3TEH B;  1L1O C;  2K50 A;  1BBW A;  4LFA Q;  1S72 A;  4BBR H;  3HOU H;  1UWV A;  3J7A 5;  4GLV B;  3S1Q H;  4IFD J;  4DK3 C;  4JYA L;  3STB C;  4DR4 L;  1Z9F A;  1K0R A;  2UXB Q;  1C0A A;  4YY3 Q;  2R7Z H;  1HZA A;  4NPS A;  3CMA A;  4HJ7 A;  2IX0 A;  2VY3 A;  1CSP A;  2K5N A;  2Z0S A;  4IO9 A;  1Y1V G;  4A3D H;  2VW9 A;  2MO0 A;  1EYG A;  3CPF A;  2AWO A;  1NJI C;  1RL2 A;  1L0W A;  4LF9 Q;  4IFD G;  2HHH Q;  2A1A A;  1YVC A;  2PMZ E;  1N36 L;  3PO3 H;  1M1K C;  4PZ6 A;  5J3B A;  4B3T L;  1PH6 A;  2BH8 A;  3ULL A;  3M85 A;  3CXC A;  3KLW A;  4DV7 Q;  1X55 A;  3AYH B;  3W1B A;  1KIX A;  4PMW A;  3RN5 A;  3RZO H;  5IYB H;  2WAQ E;  5M3F H;  1XMO Q;  4LF9 L;  4BY1 G;  4A3L G;  4C3J H;  4C3H H;  2HHH L;  3CC2 A;  4BXX H;  3GO5 A;  1YEZ A;  1UE1 A;  1V9P A;  3PF5 A;  2JA8 G;  2IY5 B;  3TQY A;  3K0X A;  2F4V L;  1CKN A;  3J81 c;  2UXD Q;  1AH9 A;  4YWL A;  4K0K L;  1KL9 A;  1TXY A;  4X62 Q;  2PI2 A;  4X65 Q;  1HZB A;  1PA6 A;  2UXC Q;  2E5L L;  2MNA A;  3K7U C;  5LMN W;  4UP8 A;  4JG2 A;  4IFD I;  1TWA H;  3CCL A;  2VUM H;  1B70 B;  5FJ8 H;  4C3I H;  2VQE Q;  5K36 G;  1P16 A;  1X56 A;  1S40 A;  2UXD L;  4B3M L;  2BA1 A;  3KOJ A;  3PUZ A;  3ULJ A;  4X62 L;  4X65 L;  1SRU A;  3G4S A;  2PI2 E;  3NBH B;  2I5L X;  4DV4 L;  4IOA A;  4UP9 A;  5E7N A;  3U4Z A;  1IBL Q;  1WI5 A;  1VQN A;  1VQI A;  4A93 H;  4BY7 G;  1N33 Q;  1BVS A;  3NEN A;  2WB1 G;  2PQA A;  3D31 A;  3ER0 A;  3S1R H;  2VQE L;  1IBM L;  1X3G A;  4RMF A;  1OXU A;  1JT8 A;  2UUA Q;  2ATW A;  1HR0 Q;  1CUK A;  1A63 A;  4OXP A;  5JJI A;  2FXQ A;  4NXM Q;  3UDI A;  1N33 L;  4A3C H;  1W3S A;  4AQY Q;  1PVO A;  4LF8 L;  1I50 H;  3HKZ G;  2LXJ A;  2ZJR A;  4A75 A;  1VQF A;  1YI2 A;  1J5E Q;  1NBW A;  1J6Q A;  2CFM A;  1CKN B;  2RCN A;  1YIJ A;  2ZTE A;  3AFP A;  1I3Q H;  3U4V A;  4QY7 A;  4R4I A;  3CME A;  4OWX B;  5BR8 Q;  3H0G G;  4NXM L;  1XNQ L;  1GM5 A;  2RF4 A;  4LW1 A;  4OON A;  4DV5 L;  2RHQ B;  1E1T A;  1D8L A;  4AQY L;  4DV0 L;  3Q8D A;  4BBS G;  2MFI A;  2NVT H;  1OXV A;  3CCS A;  3G6E A;  4A76 A;  3G48 A;  4TVA B;  3A74 A;  4GN5 A;  5GAG C;  4DV6 L;  3HOW H;  1Z47 A;  5IYC G;  3CCM A;  1EIF A;  1W2B A;  3GTQ H;  1JJC B;  2PQA B;  3TRE A;  1VQG A;  4GLA C;  4GS3 A;  5FLM H;  2HT1 A;  3ICE A;  3NEL A;  4JV5 L;  3H3V H;  3EN2 A;  1RIP A;  5EAY A;  1E1O A;  4P72 A;  4R1J A;  4A3M H;  3A5Z B;  3M4O H;  1N8R C;  2JA7 H;  4MTN A;  2ES2 A;  2NVY H;  3S1N H;  4IPG A;  5IP9 H;  1EQQ A;  2UU9 Q;  1ASY A;  3B6Y A;  4RG1 A;  1Q1E A;  1VQ7 A;  1FJG Q;  5C44 H;  2R92 G;  1YNX A;  3J81 i;  4A3K H;  4YWM A;  2HIX A;  3M4P A;  3S2H H;  3S16 H;  4H02 A;  3I56 A;  4L5T A;  2CCZ A;  2CKZ B;  4HIK A;  3E0E A;  1HZC A;  2UU9 L;  4JI5 Q;  2HQL A;  3I4M G;  1K83 H;  1SLJ A;  2Q2I A;  4LFB Q;  1D7Q A;  3M4Q A;  4IJL A;  1LUZ A;  5ELN A;  1AE2 A;  4DUZ L;  1JE5 A;  2VNU D;  1PH7 A;  4LF6 Q;  2I5H A;  1Q7Y C;  4DR7 Q;  2E2H H;  2R7D A;  4DR3 L;  3PUW A;  4PZ7 A;  3PO2 G;  4UP7 A;  4JI5 L;  1JMC A;  3KF8 B;  2YYZ A;  3OTO Q;  3FKI H;  1VQO A;  2OTL A;  2R7F A;  3HOV H;  2UUB Q;  2ALY B;  4DV2 L;  4HIO A;  4A3G H;  2YTV A;  3BZC A;  4A3I H;  4JYA Q;  4BA1 I;  2OCE A;  4Y7N H;  1A8V A;  2EIF A;  2KBN A;  1XPR A;  1EIY B;  1KHI A;  3I4N G;  2QA4 A;  3GTP H;  3HOZ H;  1FL0 A;  3IRB A;  4YHH L;  2CWA A;  1N34 L;  3CCQ A;  4KLK A;  2JA5 G;  1QVC A;  3K80 C;  2UUB L;  1HNW Q;  5C4J H;  4JBJ A;  3HOY G;  4DAM A;  3U58 A;  1X9N A;  1KAW A;  1V43 A;  4A3F H;  4UY8 C;  3KF6 A;  1N36 Q;  4A3B H;  2IHF A;  1TWG H;  4LFC L;  5M3M H;  1YHA A;  4B3T Q;  3J80 i;  1B8A A;  5IE8 A;  2K5V A;  4MZ9 A;  5M5Y H;  3KJO A;  1WCM G;  4JBM A;  2N8N A;  4A3J H;  3CD6 A;  1HNW L;  1JJG A;  3RNU A;  1KRS A;  1TWH H;  4LNQ A;  3CW2 C;  4A3E H;  2VZA A;  1O7I A;  1OTC A;  2GVB A;  2HIV A;  3F8T A;  5DLQ E;  2EXD A;  2KCT A;  3F1Z A;  3E9H A;  1E24 A;  4IOC A;  4EQ5 A;  4Y52 H;  2VL6 A;  1KD1 C;  2F4V Q;  2V1C C;  4K0K Q;  5IYD G;  3HOX H;  3ERS X;  2E5L Q;  5C4X G;  3GD7 A;  1GD7 A;  5C3E G;  2MQH A;  1T9H A;  3J81 j;  3F2B A;  2H5X A;  2I5M X;  5GAE C;  2OTJ A;  2N3S A;  2KHJ A;  2K52 A;  4JC0 A;  1QUQ B;  2WB1 E;  4PZ8 A;  4DV1 L;  3MEF A;  1PHJ A;  1Q12 A;  4B3M Q;  1EQR A;  4B3S L;  2YU9 H;  4DV4 Q;  4DR5 L;  3HOZ G;  3OW2 A;  1A62 A;  1MIU A;  2RHS B;  1PH5 A;  3HFZ B;  3HOU G;  3TS0 A;  3KF6 B;  4BBR G;  4GOP B;  1HR0 W;  1VCI A;  1IBM Q;  4APV A;  1CKM A;  1TWC H;  4JOI C;  2JEA I;  2LXK A;  3HKZ E;  2PNH A;  1CKO A;  2Q2H A;  4AIM A;  4JI3 L;  1VQJ A;  2AKW B;  1NY4 A;  2R7Z G;  1SFO H;  2UUC L;  2B3G A;  3BZK A;  5GQO A;  3RLN A;  5AJ3 Q;  1BKB A;  4IJH A;  4A3D G;  5IP7 H;  4LF8 Q;  3KFU A;  1Q82 C;  3JC6 6;  3STB D;  3PF4 A;  4FDB A;  4JI8 L;  1IYJ B;  3JAM i;  5HGQ A;  3PO3 G;  4XTC S;  5M5W H;  4DKA C;  1XNQ Q;  1XPU A;  4X66 Q;  5AJ3 L;  4DV5 Q;  3J7Z C;  5IT9 c;  3A5U A;  4OX9 Q;  2XGT A;  4GN4 B;  4DV0 Q;  1SE8 A;  4R4C A;  1XNR L;  1G51 A;  2OQ0 A;  2YTX A;  3PV0 A;  5IYB G;  5M3F G;  3GTO H;  2XTI A;  2A8V A;  1PH8 A;  2VQF L;  1VQC A;  3FP9 A;  4DV6 Q;  4BXX G;  1X54 A;  3K81 C;  2I0Q A;  4XIG S;  3ULP A;  4JBW A;  3CF5 A;  1PH9 A;  3L7Z C;  4X66 L;  3PSI A;  4OX9 L;  3BU2 A;  2JK8 A;  1CSQ A;  3PIO A;  3PIP A;  3RLO A;  3J80 c;  4LWC A;  5LMN Q;  4WJ4 A;  2R93 H;  3PUV A;  4JV5 Q;  3L2P A;  4DPG A;  4ALP A;  3F2C A;  1EFW A;  2VUM G;  3ZJY C;  5FJ8 G;  1GO3 E;  4OWT B;  2VS1 A;  4AYB G;  4LF7 L;  3U50 C;  5IWA L;  1Q81 C;  1LTL A;  1IZ6 A;  5M5X H;  4OWW B;  4GOP C;  5LMN L;  5LMU L;  3CC4 A;  2JJQ A;  1UEB A;  4A93 G;  2DUD A;  2K4K A;  1UE7 A;  2QGQ A;  4AH6 A;  1KQS A;  1MKH A;  4LF5 L;  1PV4 A;  4OO1 G;  2D0O A;  1DGS A;  4QL5 A;  4JI6 L;  1HNX L;  1OXT A;  5JEA J;  4JOI A;  1Y1W H;  4A4I A;  4JI4 Q;  2F52 A;  4DUZ Q;  3MXN B;  4POG A;  4A3C G;  2IX1 A;  3PGZ A;  1N9W A;  1MJC A;  4JI0 L;  2B63 H;  1YHQ A;  2LSS A;  1UE6 A;  3CPW A;  4DR3 Q;  1Q86 C;  3I55 A;  1FVI A;  2JA6 H;  2JE6 I;  3VDY A;  1G29 1;  1YJW A;  2BH2 A;  2D0P A;  1VQA A;  2NVQ H;  3H15 A;  4JI4 L;  3RZD H;  2IT1 A;  2NN6 G;  5JEA G;  4DV2 Q;  5IY0 A;  1PH1 A;  4DR6 Q;  3CCV A;  1IBK L;  1Q1B A;  4GKK L;  2KEN A;  2Y0S E;  3HOW G;  4R4Q A;  5GRO A;  2OWO A;  4IPC A;  3HKS A;  2AMC B;  1VQP A;  4YHH Q;  3JAM c;  1N34 Q;  4P75 A;  4HJ8 A;  2KCM A;  1K8G A;  1PH3 A;  1EOV A;  4NXN L;  1P8L A;  2N49 A;  2IHE A;  3PUY A;  5FLM G;  4PG3 A;  1Y1V H;  4YCU A;  1HNZ L;  2E2I H;  4LF4 L;  4DR6 L;  1IL2 A;  4HID A;  2GVA A;  2K5H A;  3S24 A;  3A0J A;  4DK6 C;  4O0A A;  2K75 A;  1QUQ A;  1X3E A;  3OYY A;  4A3M G;  2Q2U A;  4LFC Q;  4KHP L;  1YBY A;  4WJ3 M;  3LGJ A;  3FHW A;  1K8A C;  1YJ9 A;  2JA7 G;  1WYD A;  4GNX B;  5IP9 G;  4DR1 L;  2NN6 I;  1NMG A;  2Y0S G;  3I2Z A;  3W5O A;  4DR2 L;  2ID0 A;  1X6O A;  5C44 G;  1VQ4 A;  1PH2 A;  5H1S E;  4GOP A;  4A3K G;  1VQ6 A;  4JBK A;  4B3R L;  2E2J H;  3K8A A;  4BY1 H;  4A3L H;  4JI2 Q;  3CAM A;  4QJF A;  4EX5 A;  3DLL A;  5HY6 A;  2ZM6 Q;  4DUY L;  4GKJ L;  2JA8 H;  1VQK A;  1G6P A;  1JJ2 A;  3EBE A;  4HIM A;  4JI2 L;  4DV1 Q;  2KHI A;  4R4T A;  3W1G A;  2A19 A;  2WFW A;  2ZM6 L;  4DV3 Q;  3T1Y L;  4B3S Q;  1N32 L;  2ZJP A;  4DR5 Q;  2YV5 A;  4QQB X;  3FKI G;  5FLX c;  1R9T H;  3GDE A;  3KDF B;  4JCV E;  1E3P A;  1XTD A;  4LUV A;  3HOV G;  4KHZ A;  4ME3 A;  4JI1 L;  4BY7 H;  4JI7 L;  4TQU S;  4A3G G;  4A3I G;  2NZO A;  4LFA L;  1SR3 A;  1VQB A;  4P73 A;  1GKH A;  4DV3 L;  3T1H Q;  4JI3 Q;  2BA0 A;  2JEB I;  3GTL H;  4IPD A;  2UUC Q;  3AEV A;  5JJL A;  2Z6K A;  2UXB L;  1VQL A;  2MO1 A;  4L5Q A;  2GN5 A;  5ELO A;  1Q8K A;  4YY3 L;  2C35 B;  2ZTC A;  1GVP A;  3S14 H;  2K14 A;  4JI8 Q;  4A3F G;  1QZG A;  1VQ9 A;  4L5R C;  3T1H L;  3TS2 A;  3D0F A;  4GNX C;  4A3B G;  1U0L A;  2E8G A;  5M3M G;  1LM0 A;  1VQE A;  3RLF A;  1KC8 C;  3AQQ A;  4A3J G;  1XNR Q;  3GTM H;  3PUX A;  3H0G H;  3NEM A;  3TRZ A;  1OXX K;  3SGI A;  1VQD A;  2DGY A;  4HJA A;  3EIV A;  2QEX A;  4A3E G;  1QZH A;  2VQF Q;  4DV7 L;  4BBS H;  1IXR A;  1XMO L;  1QVG A;  3G71 A;  3GTJ H;  2EQS A;  2AHO B;  1WFQ A;  2AWN A;  2R6G A;  5IYC H;  2F3I A;  1C9O A;  4KI0 A;  4AYB E;  4DAY B;  3HOX G;  1KRT A;  2NVX H;  2WAQ G;  1M90 C;  1S3O A;  1A0I A;  1I5F A;  2JQO A;  3E9I A;  1K73 C;  4BA2 I;  2UXC L;  1LYL A;  2NZH A;  3CP0 A;  4LF7 Q;  3WWV A;  3L0O A;  5IWA Q;  4P74 A;  3S17 H;  5LMU Q;  4O2D A;  2ASB A;  1L1O A;  4C2M H;  3CCE A;  1MJE A;  5C0X J;  2OQK A;  5GAH C;  1NMF A;  1PYB A;  3CCJ A;  1NTG A;  4GLX A;  1IBL L;  1NE3 A;  4LF5 Q;  2R92 H;  1SRO A;  4JI6 Q;  1HNX Q;  3UDG A;  4L5S A;  1PYS B;  2ZTD A;  1AE3 A;  1X65 A;  3GTK H;  2UUA L;  1VQ5 A;  3I4M H;  2B29 A;  1HR0 L;  4JI0 Q;  1Y14 B;  3CQZ H;  5IP7 G;  3PCO B;  4X6A H;  1YJN A;  5C0X G;  3K7A H;  3S2D H;  1XMQ Q;  1K9M C;  3UDX A;  4YWK A;  1J5E L;  2D62 A;  1I6H H;  1H95 A;  2CWP A;  3PO2 H;  3S15 H;  4GNX A;  4LUO A;  4YCW A;  4HJ9 A;  1K3R A;  4NB3 A;  2WP8 J;  3BJU A;  1EUJ A;  5BR8 L;  1PFS A;  1IBK Q;  1I94 Q;  3M7N A;  3KYH C;  1XMQ L;  4J15 A;  4GKK Q;  3CCR A;  1WOC A;  1VS0 A;  3I7F A;  1YIT A;  3I4N H;  1HJP A;  1L1O B;  4QGU A;  4NXN Q;  1JB7 A;  3I4O A;  4LUZ A;  3F2D A;  1HNZ Q;  4R4O A;  3RN2 A;  2YTY A;  2JA5 H;  4LF4 Q;  2R93 G;  1I94 L;  2CQO A;  4X64 Q;  2Z6K C;  4IPH A;  3S1M H;  4OO1 I;  1E7Z A;  5C0X I;  3HOY H;  1QVF A;  4DNI A;  4KHP Q;  1X3F A;  4YCV A;  1VQM A;  4HJ5 A;  4DR1 Q;  3UE0 A;  2ZJQ A;  3DM3 A;  1WCM H;  3KDF A;  4DR2 Q;  4X64 L;  3M3Y H;  2Q2T A;  4B3R Q;  4UPA A;  1VQ8 A;  1HZ9 A;  1L2F A;  4MNO A;  4QIW E;  3RR5 A;  1FJG L;  1HH2 P;  1VQH A;  4DUY Q;  4GKJ Q;  1XPO A;  1SMX A;  2N78 A;  4P71 A;  3M9B A;  1OXS C;  1Y1W G;  1YZ6 A;  3UDF A;  3CCU A;  1FGU A;  5GAD C;  5IYD H;  5C4X H;  1KXL A;  4LFB L;  3AFQ A;  5C3E H;  2B63 G;  1EWI A;  1SN8 A;  3GTG H;  1U5K A;  1C7Y A;  2JA9 A;  3KJP A;  1TWF H;  1YHB A;  3CC7 A;  3T1Y Q;  1PH4 A;  1ASZ A;  2JA6 G;  1N32 Q;  4LF6 L;  4DR7 L;  1B7Y B;  1E22 A;  4POF A;  4DR4 Q;  4GN3 B;  3UE1 A;  1Q46 A;  2L15 A;  1V1Q A;  5JJK A;  4JI1 Q;  1UE5 A;  4JI7 Q;  3H3V I; 
#chains in the Genus database with same CATH topology
 3T51 B;  3OTO L;  3TEH B;  1S72 A;  4ME5 A;  1BBW A;  3J7A 5;  2G5D A;  3S1Q H;  2M9V A;  2O5I C;  4DK3 C;  2A5H A;  2UXB Q;  3FMC A;  1ENF A;  2R7Z H;  1AP0 A;  3OWF A;  4HJ7 A;  2Q2U A;  2VY3 A;  3SXH A;  1GXD C;  3MFG A;  1CM9 A;  5CBE E;  4Y7N B;  3MAQ A;  2F0V A;  1IW7 C;  4ULL A;  2L55 A;  4PZ6 A;  5J3B A;  3N52 A;  4B3T L;  1LAC A;  1PH6 A;  3KLW A;  5C4J B;  1KIX A;  1HA6 A;  1OO9 B;  3RZO H;  2PYK A;  1XMO Q;  1JWU D;  4BY1 G;  4C3J H;  4C3H H;  4N9T A;  1YEZ A;  2F0U A;  2E2J B;  3PF5 A;  2JA8 G;  1EFI D;  2IY5 B;  3J81 c;  4YWL A;  4NP5 A;  2PI2 A;  1HZB A;  1PA6 A;  2E5L L;  4QCL A;  2FMM A;  3P20 A;  4IFD I;  4DFA A;  1RHP A;  5FJ8 H;  3TBI B;  1QIL A;  1B2T A;  3QIA A;  1VMP A;  2BA1 A;  3G4S A;  2PI2 E;  3NBH B;  3SEB A;  4R8N A;  1TVX A;  4DV4 L;  4A93 H;  1DJR D;  3P1H A;  4NMZ A;  1BVS A;  2PQA A;  2RDH A;  4C1N K;  1X3G A;  3BVZ A;  4RMF A;  1SNC A;  2B2T A;  1IYV A;  5J1Z A;  1HR0 Q;  1A63 A;  1SNM A;  2B2U A;  4KK7 A;  3UDI A;  1PMR A;  4QMG A;  2B2Y C;  3AU7 A;  4AQY Q;  2XIW A;  4KJO A;  1I50 H;  1J5E Q;  2LXJ A;  4IAL A;  2CFM A;  1K0S A;  3M7G A;  3AFP A;  1CQV A;  2SOB A;  3U4V A;  4R4I A;  2WII B;  1GM5 A;  2IW3 A;  4OON A;  4UAI A;  5JEA H;  2RHQ B;  4AQY L;  1D8L A;  3TDQ A;  3GTM B;  2MFI A;  2NVT H;  1OXV A;  1SNO A;  3KLR A;  1Z47 A;  1ICW A;  3CCM A;  4HN7 A;  3GTQ H;  3I91 A;  2PQA B;  3TRE A;  2HT1 A;  4GS3 A;  3ICE A;  4P72 A;  4R8I A;  2PNR C;  1N8R C;  3S17 B;  1ZXT A;  2ES2 A;  4IPG A;  3ND9 A;  1QE6 A;  1FJG Q;  3PIO 3;  1A3T A;  2HIX A;  4KY5 A;  2A68 D;  2F0H A;  3I56 A;  1SJE D;  4L5T A;  1XX8 A;  4HIK A;  1HZC A;  1C48 A;  2F0I A;  5ELN A;  1AE2 A;  1JE5 A;  2VNU D;  3CQZ B;  3J80 L;  2D9U A;  2E2H H;  4U67 3;  4KD4 A;  4UP7 A;  2XVS A;  3H94 A;  4DXF A;  1PTO F;  5J39 A;  4DV2 L;  4HIO A;  1IL8 A;  1PZI D;  5KIX A;  1H9S A;  2QA4 A;  1DOL A;  1HTL D;  2CWA A;  5KYI A;  1LT3 D;  4DAM A;  1X9N A;  1CZG A;  3S1M B;  1O7Y A;  2AUK A;  2B2U C;  2RBM A;  3I3C A;  1EY5 A;  1N36 Q;  2IHF A;  1EYD A;  4IZ8 A;  5CV9 A;  3MXG A;  1B9M A;  2K5V A;  3LWE A;  5IE8 A;  1RKN A;  5M5Y H;  2BE5 D;  1JJG A;  3R2I A;  2KCC A;  4A3E H;  2VZA A;  1CTM A;  1J8I A;  4HSP A;  2GVB A;  2HIV A;  4J1M A;  3F1Z A;  3LWU A;  4IOC A;  2VL6 A;  4J6H A;  1GUG A;  3HOX H;  1GD7 A;  3JAM L;  2MQH A;  5C4X B;  1PFN A;  4RCN A;  2H5X A;  2R3Z A;  1GUT A;  2C5C A;  4JC0 A;  4DK1 A;  3GTG B;  4OL7 A;  1QUQ B;  4DV1 L;  1TR5 A;  3CRK C;  1IHZ A;  3MEF A;  1PHJ A;  4B3S L;  1CHP D;  2YU9 H;  3OW2 A;  1A62 A;  5JAV A;  1MIU A;  4PMC A;  2RHS B;  3HOU G;  4BBR G;  4GOP B;  1HR0 W;  4WJW A;  1IBM Q;  3HKZ E;  2PNH A;  1CKO A;  2Q2H A;  1TU2 B;  1NCV A;  2AKW B;  5NUC A;  2UUC L;  3BZK A;  3RLN A;  3KFU A;  3NWS A;  2KVM A;  4DXG A;  4FDB A;  3PO3 G;  2F0Q A;  3IFT A;  2OT2 A;  2XGT A;  1STG A;  1EU3 A;  2QDL A;  2TSS A;  2A8V A;  5M3F B;  3K81 C;  2B39 A;  5C6A A;  4JBW A;  1CFM A;  3CF5 A;  3BU2 A;  5M9O A;  3D6C A;  3J80 c;  1LV9 A;  2R93 H;  1FR3 A;  4RGM A;  4CDD C;  4OHJ A;  3BDL A;  1G8Z D;  4X3K A;  1EFW A;  2EY2 A;  1GO3 E;  4ZLT F;  2VS1 A;  5BN4 A;  4LF7 L;  3U50 C;  1ET6 A;  4OWW B;  4GOP C;  5KRU A;  4K14 A;  2DUD A;  1GUW A;  1UE7 A;  3A55 A;  2HQE A;  2X69 A;  4OO1 G;  1DGS A;  3AMU A;  3OW7 A;  5JEA J;  1F9S A;  4A4I A;  4K6L A;  3PIP 3;  5KND A;  1N9W A;  2B63 H;  1PZJ D;  4MIU A;  1SYE A;  1Q86 C;  2JE6 I;  1I3Q B;  2NN6 G;  5IY0 A;  4DR6 Q;  1LTB D;  1HUM A;  5GRO A;  4M8A A;  3HOW B;  1S5C D;  3JAM c;  1PH3 A;  1L0Y B;  4NXN L;  2N49 A;  1KAA A;  5FLM G;  4DR6 L;  3I8Z A;  1IL2 A;  4HID A;  3S24 A;  2K1B A;  4O0A A;  3M4Y A;  2H1E A;  3OYY A;  4A3M G;  4LFC Q;  1GHJ A;  4JW0 A;  5DM7 3;  1K8A C;  2BDO A;  1WYD A;  4GNX B;  2Y0S G;  1PH2 A;  3K6O A;  2E2J H;  3K8A A;  5C44 B;  1WTX A;  3CAM A;  3S2H B;  2NUC A;  5HY6 A;  1BCP B;  5I6Y A;  1E2W A;  3Q0A A;  1A2U A;  1HA5 A;  1JJ2 A;  1BOS A;  3O13 A;  2GA4 B;  5EGT A;  1EYA A;  3T1Y L;  1N32 L;  1WD1 A;  2ZJP A;  2K03 A;  4QQB X;  1S5B D;  5FLX c;  1E3P A;  1XTD A;  3NTH A;  2NTS A;  3A54 A;  4ME3 A;  4JI1 L;  4DAY A;  4DK0 A;  4ZQ3 A;  4PQX A;  2NZO A;  3T1H Q;  4JI3 Q;  2BA0 A;  2A74 C;  2Z6K A;  3VA5 A;  4X3T A;  1B3A A;  1CQF A;  4L5Q A;  1Q8K A;  4F7X A;  2K14 A;  4K6D A;  5E3F A;  4L5R C;  3T1H L;  2OF1 A;  4GNX C;  4A3B G;  1EEI D;  1LM0 A;  1VQE A;  1TWG B;  4FNF A;  2R7Z B;  3AQQ A;  3D3R A;  4A3J G;  1XNR Q;  3GTM H;  1WTW A;  3H0G H;  2F0S A;  2EY1 A;  4HJA A;  2DGY A;  5IGF A;  3A56 A;  1QZH A;  4DV7 L;  1BCP C;  1RDP D;  4BBS H;  1TWH B;  1YNN C;  3LX0 A;  4P2C B;  2ICE C;  2PMZ B;  4PV1 C;  2F3I A;  4K2K A;  3BG3 A;  4DAY B;  1KRT A;  2NVX H;  1KNE A;  1Y8O B;  4ZUI A;  3RZO B;  5EKL A;  1M90 C;  3NUC A;  4BA2 I;  3E9I A;  1ONL A;  4C3H B;  4C3J B;  1G2T A;  4MN3 A;  4P74 A;  3S17 H;  5IGG A;  1F2M A;  4O2D A;  3K57 A;  1MJE A;  3G6J B;  3CCJ A;  2F0P A;  1IBL L;  1NTG A;  4LF5 Q;  1K8O A;  3KK7 A;  1TWC B;  4JI6 Q;  2ZTD A;  2Z1C A;  1C4Q A;  2B29 A;  3BZD B;  4A93 B;  3CQZ H;  5IP7 G;  1EWC A;  3VR4 A;  2WV6 D;  1XMQ Q;  1K9M C;  4DGZ A;  4YWK A;  3TP7 A;  3NPP A;  2CWP A;  2B2W C;  3OHX C;  3S15 H;  2LFN A;  3KLS A;  4CKB A;  3BJU A;  1DCZ A;  4KHV A;  1XMQ L;  1I50 B;  4I65 A;  1WOC A;  1K3B C;  1VS0 A;  4IN3 A;  4KD3 A;  1MSH A;  1YIT A;  1HJP A;  2LS0 1;  3WOF A;  1PFM A;  5DAU A;  2F0T A;  4QGU A;  3I4O A;  4MTK A;  4LF4 Q;  4X64 Q;  2Z6K C;  1ZKO A;  3S1M H;  3HOY H;  1QVF A;  1U4P A;  1A6X A;  1QB5 D;  4EQO A;  4DR1 Q;  3DM1 A;  5COR A;  1WCM H;  5M5X B;  4X64 L;  2Q2T A;  4UPA A;  4IUN A;  4FXD A;  1TQO A;  4MNO A;  4QIW E;  3RR5 A;  4FXK C;  1HH2 P;  2B2V A;  3NHH A;  4X3U A;  1SMX A;  2N78 A;  2Z8L A;  4DUY Q;  4GKJ Q;  4S3S A;  3M9B A;  1ILQ A;  3CCU A;  1FGU A;  5C4X H;  1K8M A;  3GTG H;  3EJI A;  1KNA A;  2HCI A;  1B7Y B;  1E22 A;  1KAB A;  3OIP A;  3CKI B;  4HTH A;  2MP1 A;  4JI7 Q;  1XJV A;  1BBU A;  1WJJ A;  4QIW B;  4LFA Q;  2K50 A;  2EJG C;  2FMC A;  1UWV A;  4JYA L;  3STB C;  1Q8I A;  4YY3 Q;  2EPB A;  4NPS A;  4IO9 A;  2XN9 C;  2MO0 A;  1EYG A;  2XRQ D;  3CPF A;  1Y1V B;  1WTO A;  1RL2 A;  3LNN A;  2A1A A;  1YVC A;  2A6H C;  3ULL A;  3CXC A;  2MPM A;  2ZXO A;  4PMB A;  5KGU A;  4NW2 A;  5IYB H;  5M3F H;  4A3L G;  3MXU A;  1V8Q A;  5M5Y B;  5I9P A;  2X6L A;  3K0X A;  2F4V L;  2UXD Q;  2ZT9 C;  1KL9 A;  5IT9 E;  2UXC Q;  4A3E B;  2MNA A;  3K7U C;  3SK4 A;  5LMN W;  1PLF A;  3Q24 A;  3CCL A;  2F1M A;  5K36 G;  1P16 A;  2UXD L;  1SE4 A;  4B3M L;  3ULJ A;  4RHS A;  2QDB A;  3DHQ A;  5CV8 A;  2I5L X;  4H13 C;  1ZEQ X;  4UP9 A;  3NEN A;  2RSN A;  4BY7 B;  2NTT A;  3ER0 A;  3OMG A;  2PO4 A;  4IUT A;  3E6Z X;  2YU9 B;  2B2V C;  1Z6H A;  4OXP A;  2BOS A;  4NXM Q;  5JJI A;  1HFN A;  1G2S A;  2ENB A;  3BYT B;  1PVO A;  2XWJ B;  4LF8 L;  2I07 B;  3HKZ G;  2ZJR A;  3GV3 A;  4A75 A;  2RCN A;  1TS3 A;  2ZTE A;  1I3Q H;  4QY7 A;  3J81 L;  3K5N A;  1WD0 A;  4NXM L;  4DV5 L;  4HMI A;  2LKV A;  4DV0 L;  2N55 A;  2BDN A;  1QWY A;  1EY8 A;  4IUQ A;  1ICF B;  3G48 A;  4V0B A;  3HOW H;  4DV6 L;  1DON A;  3GTJ B;  1EIF A;  3SK5 A;  4QUC A;  5G3L D;  2N88 A;  1EQV A;  1BCP D;  4KN7 C;  1YNN D;  4GLA C;  2VXW A;  3EA6 A;  1KDB A;  3S9W A;  5FK9 C;  3BVG A;  1D1I A;  1TY0 A;  3A5Z B;  3T16 A;  1F9R A;  5CMD A;  1NUC A;  2JA7 H;  5IP9 H;  1E2Z A;  2R93 B;  3B6Y A;  4LMQ D;  5C44 H;  1YNX A;  3S2H H;  3M4P A;  2R92 B;  2EY6 A;  4UHV A;  1S5E D;  5FOB B;  2B8F A;  3I4M G;  4JI5 Q;  1D7Q A;  2Q2I A;  4IJL A;  5CV7 A;  4LF6 Q;  1Q7Y C;  4DR7 Q;  2R7D A;  3HEJ A;  4DR3 L;  3PO2 G;  5CV4 A;  4JI5 L;  5JVH 3;  3ND8 A;  3OTO Q;  1VQO A;  2OTL A;  2B63 B;  1QJO A;  2UUB Q;  2YTV A;  2F3V A;  1XPR A;  1A8V A;  2EIF A;  2KBN A;  1KHI A;  4CJ0 B;  1SXT A;  3I4N B;  3TME A;  1FL0 A;  1N34 L;  1DM0 B;  4KLK A;  3CCQ A;  2UUB L;  1I4R A;  5JPN C;  1EY9 A;  1BXT A;  2JA5 B;  1V43 A;  1EY4 A;  2BCO A;  4UY8 C;  1IKL A;  1TWG H;  2EXZ A;  4TSS A;  1YHA A;  4B3T Q;  1B8A A;  2X6G A;  1WTQ A;  1NR2 A;  4JBM A;  2N8N A;  3NBH A;  3RNU A;  1KRS A;  1TWH H;  3QO2 A;  2TMP A;  4KKS A;  1JWS D;  5CBA E;  4N8F A;  5COY A;  4EQ5 A;  4Q0F A;  2F4I A;  1T5E A;  2E5L Q;  1HTP A;  2H4O A;  3F2B A;  1T9H A;  5GAE C;  5C3E B;  1PFB A;  2N3S A;  2OTJ A;  2K52 A;  3Q22 A;  1KLU D;  2QCP X;  4PZ8 A;  2KJX A;  1Q12 A;  4UDU C;  4L8J A;  4DV4 Q;  4DR5 L;  4XYO A;  4KKT A;  3NSW A;  1HRJ A;  3TS0 A;  3PQI A;  2XRS D;  1TWC H;  4JOI C;  2KHS A;  4ZUJ A;  2R7Z G;  2RKS A;  4L63 B;  1NNX A;  1LT6 D;  1Q82 C;  4A3D B;  3STB D;  5C0X H;  2KOL A;  1AZQ A;  4H7B A;  3KBG A;  5M5W H;  4XQJ A;  1XPU A;  2CW0 C;  1B9N A;  2PZU A;  3A5U A;  4GN4 B;  1SE8 A;  2A69 D;  2D5D A;  2XTI A;  4C3H G;  4C3J G;  2VQF L;  2A6H D;  1MD2 D;  3C2P A;  2I0Q A;  4XIG S;  1UUP A;  1PH9 A;  3A7A B;  3FVQ A;  3L7Z C;  3HZX A;  3PSI A;  2G9H D;  3H0G B;  1HUN A;  2L9H A;  3PIP A;  3BVM A;  2O5J C;  3DEO A;  3PUV A;  4BBS B;  2QEJ C;  2KQ3 A;  3ZJY C;  5FJ8 G;  3OPO A;  4C3I B;  1STE A;  4H44 C;  1Q81 C;  2RCF A;  5M5X H;  1MI2 A;  2NVX B;  5LMU L;  3MTS A;  4A93 G;  2K4K A;  3MC0 B;  4N9P A;  4KV6 A;  5T1I A;  4AH6 A;  1ENC A;  1MKH A;  4XT3 B;  5EBD A;  2D0O A;  3S1R B;  5IGC A;  1AFP A;  4TKO B;  1PXU A;  3FEW X;  4QL5 A;  3NQT A;  3SVM A;  3OMC A;  3ERQ A;  4JI4 Q;  4LJZ C;  4JI0 L;  4I7A A;  1I4G A;  1YHQ A;  1UE6 A;  4ZKB B;  3I55 A;  5IOD A;  2SNS A;  1F9P A;  1RTO A;  1G29 1;  2E76 C;  1YJW A;  4JI4 L;  5LL6 X;  1VDZ A;  4RKL A;  5JEA G;  4QB4 A;  4DV2 Q;  2G9D A;  1PH1 A;  3CCV A;  5A2Q E;  4GKK L;  3R93 A;  3J7Y W;  4IPC A;  1STN A;  3HKS A;  1VQP A;  3A8J E;  3S15 B;  4HJ8 A;  2KCM A;  1K8G A;  3NQI A;  1P8L A;  1HNZ L;  4PG3 A;  1Y1V H;  1BQQ T;  3A0J A;  3W2D A;  1QUQ A;  1X3E A;  4IFD H;  1I4Q A;  2F0W A;  1XYI A;  5C3W A;  2NN6 I;  2NVY B;  1BO0 A;  2KEE A;  2ID0 A;  1VQ4 A;  4F88 A;  3HOY B;  5H1S E;  4GOP A;  1KDA A;  3DXJ C;  5K5P A;  2EYL A;  5CR3 A;  4A3K B;  4QJF A;  1JOQ A;  2ZM6 Q;  1VF5 C;  1W6J A;  1WCM B;  2VB3 X;  3NTI A;  3I73 A;  2CHB D;  1K83 B;  1SYG A;  2OXP A;  4DV1 Q;  3W1G A;  2A19 A;  2ZM6 L;  4DV3 Q;  2QF7 A;  4B3S Q;  5I2Y A;  4Z9C B;  3KDF B;  3FKI B;  4BY7 H;  4TQU S;  2AQ2 B;  2XWB B;  3FRP B;  5EQ0 A;  4A3G B;  2Z4I A;  1VQB A;  3K58 A;  4DV3 L;  1VMC A;  4A3I B;  2JEB I;  2UUC Q;  3AEV A;  3HOZ B;  1TS4 A;  3E3X A;  2MO1 A;  2GN5 A;  5ELO A;  3T13 A;  5A35 A;  3HP3 A;  4B9X A;  1QZG A;  2CH4 W;  3V05 A;  5E4X A;  1YNJ C;  1FGB D;  1C8C A;  3IFD A;  4CKE A;  5M3M B;  1JQY D;  1EL0 A;  3NEM A;  1OXX K;  3SGI A;  1KC8 C;  4G7H C;  4A3E G;  3EIV A;  2XSC A;  2O2L D;  3C46 A;  1IXR A;  1QVG A;  3G71 A;  3GTJ H;  2EQS A;  2AWN A;  4B08 A;  5IYC H;  4OIJ A;  1C9O A;  3MZ5 A;  3HOX G;  3NXW A;  3L9A X;  4KY6 A;  5DM6 3;  1EWH A;  5FLX L;  1PRT F;  3DWP A;  1RTN A;  5CV6 A;  5IIF A;  4FXG C;  1S3O A;  1IW7 D;  2NZH A;  5I2X A;  2DNE A;  3CP0 A;  1X3Q A;  4LF7 Q;  3L0O A;  5G3L F;  4DN4 M;  2MHV A;  2QW7 A;  5E1F A;  2VB2 X;  2IX3 A;  1L1O A;  2F0O A;  1FD7 D;  3D4W A;  5C0X J;  2JSO A;  1PTO B;  1NMF A;  1PYB A;  3U9O A;  2R92 H;  2RA4 A;  1SRO A;  1ML0 D;  2DJF C;  4RHR A;  4K5X A;  4XT1 B;  1GOZ A;  2UUA L;  1VQ5 A;  4FF2 A;  3MXP A;  1JOO A;  1YJN A;  1DOM A;  2NZ1 D;  1EY7 A;  3VYR A;  2D62 A;  1H95 A;  2KEC A;  1EOT A;  4GNX A;  5FO8 B;  1K3R A;  1GUS A;  2WP8 J;  3QOL A;  1EUJ A;  5BR8 L;  1PFS A;  5FKA C;  3KYH C;  3CCR A;  3K5O A;  5KNB A;  3GTO B;  3I7F A;  1V1O A;  2CW0 D;  3KUP A;  3I4N H;  1L1O B;  1II3 A;  1SYB A;  4NXN Q;  5IGD A;  4RGN A;  4YIJ A;  3C1E A;  3QR8 A;  4LUZ A;  3RN2 A;  1NSN S;  3TP8 A;  2YTY A;  2D2C C;  2JA5 H;  2R93 G;  4IPH A;  3T4A C;  3EQL C;  1VQM A;  4HJ5 A;  1ZYR C;  3UE0 A;  1PTO C;  3ITP A;  5F2D A;  1O7Z A;  4Q5V A;  4ZCK A;  1GUO A;  5C4Z A;  1HZ9 A;  1PZK D;  4RGT A;  1QNU A;  3C3L A;  4IUU A;  2PW5 A;  2JA7 B;  3UDF A;  3GQB A;  1UNS A;  5IYD H;  1MHW C;  1HFG A;  1D1K A;  1HPC A;  1ESR A;  3AFQ A;  5C3E H;  1Y1W B;  2B63 G;  1NAP A;  4N8X 1;  4LFB L;  1LT4 D;  2EY5 A;  1U5K A;  1C7Y A;  3KJP A;  1ASZ A;  3T1Y Q;  2NYZ D;  1N32 Q;  1PH4 A;  4DR4 Q;  2JA6 B;  4GN3 B;  1Q46 A;  2L15 A;  4JI1 Q;  1F2L A;  3RZD B;  3H3V I;  2B2W A;  1AH9 A;  1L1O C;  4IFD J;  5ISR A;  4DF7 A;  1JOK A;  3N6R A;  3V2T A;  4PNY A;  1TY2 A;  2K28 A;  4DR4 L;  1Z9F A;  4HCS A;  1HZA A;  3CMA A;  2IX0 A;  1SYC A;  4A3D H;  1Z7T A;  2AWO A;  5ELC A;  3OOC A;  4HSV A;  1L0W A;  2E2I B;  3R8B A;  5D3D A;  2PMZ E;  3HG9 A;  1MSG A;  1DXM A;  1M1K C;  1I6V C;  2BH8 A;  4DV7 Q;  3W1B A;  3T53 B;  3IAY A;  2WAQ E;  2Z6B A;  3CC2 A;  4BXX H;  1LLR D;  3GO5 A;  4BY1 B;  1UE1 A;  3R2T A;  4NDX A;  3TQY A;  4ILW A;  4K0K L;  3IKJ A;  1H9R A;  1TXY A;  2JA8 B;  5HUR A;  2Z4H A;  4JG2 A;  3Q23 A;  2VUM H;  4C3I H;  2VQE Q;  1X56 A;  1W6K A;  3KOJ A;  3A7L A;  1SRU A;  1EIG A;  2WAQ B;  4IOA A;  3U4Z A;  1CA6 A;  3J80 E;  1IBL Q;  1WI5 A;  4H0L C;  1VQI A;  4ZAI A;  4E6I A;  1N33 Q;  2F0L A;  3S1R H;  1H9M A;  2VQE L;  1OXU A;  4K5V A;  1VF7 A;  1CUK A;  3GTL B;  4XXE A;  5E4W C;  1M8A A;  1N33 L;  4A3C H;  4C56 C;  5ELB A;  4IUR A;  3TP6 A;  1VQF A;  1X3P A;  1NBW A;  1J6Q A;  1YIJ A;  4FF3 A;  1SE2 A;  1XNQ L;  3H0G G;  5DNF A;  2RF4 A;  2AQ3 B;  3Q8D A;  4BBS G;  1CZW A;  1YNJ D;  3CCS A;  1DOK A;  3MA2 B;  1D5M C;  4TVA B;  3A74 A;  4GN5 A;  5M5W B;  1ENA A;  5TSS A;  3NEL A;  4JV5 L;  3TZD A;  3H3V H;  5EAY A;  3M4O H;  3K5L A;  4BWG B;  3JAM E;  1KLG D;  2NVY H;  2QIL A;  1ASY A;  3P75 A;  1LTS D;  3C1F A;  1VQ7 A;  2Q8R E;  4A3K H;  4YWM A;  2IJ0 A;  1NR4 A;  5KEE A;  2CCZ A;  2CKZ B;  3E0E A;  2HQL A;  1K83 H;  1SLJ A;  3M4Q A;  1LUZ A;  2NBF A;  4DUZ L;  2E74 C;  2J4X A;  1Y69 U;  3PUW A;  4PZ7 A;  2K6A A;  2Z9H A;  1I6H B;  2YYZ A;  1DD2 A;  3FKI H;  4RCO A;  3HOV H;  2ALY B;  2F3W A;  4A3G H;  4A3I H;  4JYA Q;  4BA1 I;  4I7Z C;  1JCK B;  1A3U A;  1RF2 D;  3GTP H;  3HOZ H;  2NB0 A;  2L11 A;  1DZ1 A;  3IRB A;  4YHH L;  1HNW Q;  2IL8 A;  3CU7 A;  4JBJ A;  3HOY G;  4G7Z C;  1KAW A;  4A3F H;  1V1P B;  1HHV A;  1O80 A;  5M3M H;  5IOC A;  3J80 i;  3KJO A;  1HNW L;  1WCM G;  5CYU A;  1DYQ A;  2KCN A;  1CK1 A;  4LNQ A;  3NWT A;  3M3Y B;  1D2B A;  1O7I A;  4DAP A;  2F0J A;  1PTO D;  4Y52 H;  1E24 A;  3E0J A;  1T5X D;  2F4V Q;  5ELF A;  4CJ1 B;  2V1C C;  2L5T A;  2F03 A;  5C4X G;  3GD7 A;  4RGO S;  4DA2 A;  3J81 j;  1B1Z A;  2I5M X;  2WB1 E;  3KBX A;  2LY7 A;  4B3M Q;  4JPB W;  3HOZ G;  5C5M A;  1EQT A;  1PTO H;  1WTR A;  3H6M A;  3HFZ B;  2F0F A;  4APV A;  3HOU B;  1CKM A;  4BBR B;  2JEA I;  2LXK A;  1TT2 A;  4AIM A;  1CHQ D;  1VQJ A;  1NY4 A;  5GQO A;  4IJH A;  1BR9 A;  5EKI A;  4LF8 Q;  2WB1 B;  3PF4 A;  1B50 A;  4JI8 L;  1IYJ B;  4HED A;  4OGQ C;  3JAM i;  4KMU C;  2FJ2 A;  1AEX A;  1I4P A;  4XTC S;  1BF4 A;  4DV5 Q;  2F0M A;  3J7Z C;  4DV0 Q;  3VYU A;  4R4C A;  2YTX A;  5IYB G;  5M3F G;  3GTO H;  1VQC A;  3I4L A;  4DV6 Q;  1BNZ A;  1X54 A;  1EY0 A;  1Q3L A;  5IGB A;  3PIO A;  3MHB A;  1TS2 A;  3RLO A;  3SDZ A;  4LWC A;  4ZKC B;  3L2P A;  3W3A A;  4DPG A;  3G7L A;  3F2C A;  3K5M A;  1L0X B;  1TWA B;  5IWA L;  5HGT A;  1IZ6 A;  1LTG D;  1SNQ A;  3CRL C;  3DUZ A;  3K59 A;  1TS5 A;  4KTA A;  2JJQ A;  1CT1 D;  5CV5 A;  3D4D A;  1EIH A;  1WTV A;  5CGK A;  2QGQ A;  1KQS A;  1LAB A;  4R9W A;  1PV4 A;  1HNX L;  1STB A;  4JOI A;  1Y1W H;  2F52 A;  1A2T A;  4POG A;  3BDC A;  3VYS A;  3RUZ A;  5D14 A;  4DR3 Q;  1FVI A;  2JA6 H;  3HRZ C;  1BDO A;  4OEM B;  2D0P A;  3VR6 A;  2BH2 A;  3H15 A;  3RZD H;  5EPJ A;  1STA A;  2M2L A;  1IYU A;  1IBK L;  2KEN A;  2Y0S E;  3HOW G;  2F0D A;  4R4Q A;  4GZY C;  3OIQ A;  3Q6S A;  2EYP A;  2AMC B;  1N34 Q;  4P75 A;  3PUY A;  4YCU A;  1JOR A;  2E2I H;  2MJ8 A;  2K5H A;  4DK6 C;  2R61 A;  2SNM A;  4KHP L;  1YBY A;  2WAC A;  4WJ3 M;  3FHW A;  2JA7 G;  1QNK A;  5C5L A;  5IP9 G;  2SEB D;  1LTA D;  1NMG A;  3W5O A;  3E5S A;  4DR2 L;  5C44 G;  1X6O A;  2Y0S B;  5JVG 3;  3I72 A;  4JK1 C;  4JBK A;  4BY1 H;  4B3R L;  1Y8N B;  1D5X C;  1BUV T;  4X3S A;  4EX5 A;  3DLL A;  1H9J A;  3S16 B;  1LT5 D;  2JA8 H;  1VQK A;  1TKW B;  1G6P A;  2KHI A;  4ABN A;  2ZXR A;  4DR5 Q;  3GDE A;  4LUV A;  1TII D;  1EU4 A;  2PQE A;  1R4Q B;  1UEA B;  5CC4 A;  5JPM C;  3GTL H;  5JJL A;  2K5Q A;  1IKM A;  2UXB L;  1VQL A;  2MGS A;  1WTH A;  2AUJ D;  3DWA A;  2EYM A;  1GVP A;  1R4P B;  3TS2 A;  1QOH A;  1O78 A;  2HCC A;  1U0L A;  2E8G A;  1SJH D;  4A3B B;  1I4H A;  2EYJ A;  3ONA B;  4K5W A;  3PUX A;  3TSS A;  1VQD A;  4A3J B;  2QEX A;  2VQF Q;  1XMO L;  4CBV A;  2RDF A;  2WIN B;  4ZK9 B;  1FNU A;  4KI0 A;  4AYB E;  3D8G A;  2PPB C;  2WAQ G;  3DWQ A;  1I5F A;  1LYL A;  1CI3 M;  3BYY B;  3WWV A;  1STY A;  4F8M A;  2RSO A;  5LMU Q;  3CCE A;  1HCZ A;  3T56 B;  2OQK A;  3NBI A;  3TZU A;  4GLX A;  1NE3 A;  3I90 A;  2VUM B;  4RAU C;  4AYB B;  1PYS B;  3ZYY X;  1X65 A;  1HR0 L;  4JI0 Q;  1SFO B;  1Y14 B;  3PCO B;  4X6A H;  1F77 A;  2EZV A;  5C0X G;  1RD9 D;  5D65 A;  3NE5 B;  1SMY C;  1J5E L;  1B4O A;  1I6H H;  1SE3 A;  4RKB A;  1PDQ A;  4LUO A;  4GKK Q;  2DNC A;  2J7Z A;  1E2V A;  1HNZ Q;  2EYH A;  2CQA A;  1F2Y A;  4OO1 I;  4V19 0;  5IGE A;  1X3F A;  1QG7 A;  5EPK A;  2EYO A;  2EOT A;  5I4D A;  2ZJQ A;  3DM3 A;  2EDG A;  1B44 D;  3KDF A;  4CDE C;  3NK9 A;  3D4R A;  3M3Y H;  2KED A;  3OSO A;  1FJG L;  1L2F A;  3GP7 A;  1VQH A;  3M4O B;  3VR2 A;  1XPO A;  2CVR A;  4HCE A;  5EKK A;  2FHT A;  1EWI A;  4HMJ A;  4ZRZ A;  3VA7 A;  2JA9 A;  3DMU A;  1TWF H;  1YHB A;  1HQM C;  3CC7 A;  3PMF A;  4POF A;  4O1N A;  3RMH A;  3UE1 A;  3A8I E;  2Q8I B;  1O7L A;  3V96 A;  4EGV A;  2NVQ B;  1UE5 A;  2I46 A;  3HOU H;  2B2T C;  4BBR H;  2K5W A;  2LMC B;  4GLV B;  4CHT B;  1JE4 A;  2ICI A;  3J81 E;  1K0R A;  1C0A A;  1GUN A;  1X32 A;  1M4V A;  1JB3 A;  1CSP A;  2K5N A;  2Z0S A;  5EJW A;  3HOV B;  1Y1V G;  1SNP A;  5C4H A;  2VW9 A;  1I4X A;  3NTK A;  2RVL A;  1NJI C;  1SEB D;  4LF9 Q;  4IFD G;  2ZXP A;  2L1B A;  2HHH Q;  3GTP B;  1AZP A;  1N36 L;  3PO3 H;  5KYL A;  3H3V C;  3OWE B;  3M85 A;  3U9S A;  3DEP A;  2RDG A;  4IQZ A;  1X55 A;  3AYH B;  2DN8 A;  4PMW A;  3RN5 A;  4A3F B;  4ODG A;  4LF9 L;  2KA7 A;  2K05 A;  2HHH L;  4DU9 A;  1F2Z A;  1JC7 A;  2V4D A;  1H9S B;  1V9P A;  2F0E A;  1J9O A;  2NWG A;  1CKN A;  4X62 Q;  4X65 Q;  4UP8 A;  3BS1 A;  1TWA H;  1B70 B;  1S40 A;  3WDN A;  3QB3 A;  3QWN A;  3PUZ A;  4X62 L;  4X65 L;  5E7N A;  5T1G A;  2J0T D;  1R9T B;  1VQN A;  4BY7 G;  1CA5 A;  2WB1 G;  3D31 A;  1BCP F;  1IBM L;  4OO1 H;  1JT8 A;  2UUA Q;  2ATW A;  5LHY 1;  5DEH A;  1U4L A;  2FXQ A;  2DY7 A;  3R3O A;  1SYD A;  1W3S A;  4XQN A;  3FDT A;  3S14 B;  2L4N A;  1YI2 A;  1CKN B;  3HKZ B;  1JIC A;  5D3I B;  2EJF C;  3CME A;  4OWX B;  5BR8 Q;  1ILP A;  2NN6 H;  4LW1 A;  1E1T A;  4TRD A;  2F0N A;  1G6Z A;  3G6E A;  4A76 A;  5GAG C;  3ERO A;  4KJN A;  5IYC G;  1W2B A;  1H9K A;  1JJC B;  3KF8 A;  1VQG A;  5FLM H;  1HXY D;  1ESF A;  1S4Z A;  5JJZ A;  4NKL A;  3EN2 A;  3QOJ A;  4B9W A;  1RIP A;  1RJT A;  1E1O A;  4R1J A;  4A3M H;  1SND A;  3AB9 A;  1MBY A;  4MTN A;  3S1N H;  1EQQ A;  2UU9 Q;  5AFW A;  4RG1 A;  1Q1E A;  4C2M B;  2HUG A;  5IT9 L;  2R92 G;  3J81 i;  3S16 H;  4H02 A;  3VR3 A;  3VYT A;  2FFK B;  3D6W A;  4M1U B;  2A6E C;  2UU9 L;  5I9O A;  4LFB Q;  3GTK B;  3I4M B;  1PH7 A;  3SK6 A;  4DNR B;  2I5H A;  1WVL A;  3K7A B;  3S2D B;  1JMC A;  4RWS C;  4FF4 A;  2SDF A;  3KF8 B;  3KLS X;  3PO2 B;  2R7F A;  2WKC A;  4RFB A;  4ID6 A;  1SMY D;  3BZC A;  2OCE A;  4Y7N H;  1EIY B;  2CH4 A;  1A3V A;  2HD3 A;  4CKC A;  3I4N G;  4L6T B;  4K8I A;  1S5F D;  1FYC A;  4O42 A;  2JA5 G;  1QVC A;  3K80 C;  4XDX A;  3I70 A;  5C4J H;  1PRT B;  3U58 A;  3H09 A;  1LTI D;  3TP5 A;  5BN5 A;  3KF6 A;  4A3B H;  1RCV D;  4LFC L;  3FPU B;  1XWE A;  4MZ9 A;  4KY7 A;  3CD6 A;  4IUP A;  4A3J H;  3H91 A;  1LTR D;  3CW2 C;  2XNA C;  1OTC A;  1LO5 D;  4CGY B;  5DLQ E;  3F8T A;  2EXD A;  2K04 A;  2KCT A;  3E9H A;  1KD1 C;  4K0K Q;  4KN4 C;  4HR7 B;  5IYD G;  3ERS X;  5C3E G;  3K0Y A;  3CHB D;  2KHJ A;  1KTK A;  3F2U A;  1EQR A;  4FYD A;  5C3X A;  2EYF A;  2DY8 A;  1PH5 A;  3BDO A;  4G57 A;  3KF6 B;  1VCI A;  4XYQ A;  1D6E C;  3QJY A;  5KNC A;  3S1Q B;  4JI3 L;  4FF1 A;  1PRT C;  2IPK D;  1SBB B;  1SFO H;  2B3G A;  5AJ3 Q;  1BKB A;  4A3D G;  1JWM D;  5IP7 H;  4ZYS A;  2L12 A;  3JC6 6;  2PZW A;  4G7O C;  5HGQ A;  2HDM A;  4DKA C;  1XNQ Q;  4X66 Q;  5AJ3 L;  1SYF A;  5IT9 c;  4OX9 Q;  1XNR L;  1G51 A;  2OQ0 A;  3PV0 A;  2O4X A;  2EVB A;  1XTC D;  3MXN A;  1PH8 A;  3FP9 A;  4BXX G;  3ULP A;  2JXM B;  4X66 L;  4K2L A;  2F0K A;  4OX9 L;  1CSQ A;  2JK8 A;  5LMN Q;  4WJ4 A;  4QUF A;  4JV5 Q;  4ALP A;  4OIK A;  3NP8 A;  2VUM G;  4C3I G;  4OWT B;  4AYB G;  2QKI C;  3EFX D;  5FO7 B;  2P5Z X;  1LTL A;  2WKD A;  1EZ8 A;  3VR5 A;  5LMN L;  1BBX C;  3L3O C;  3CC4 A;  2EE1 A;  1UEB A;  3WOE A;  1FNV A;  2K7V A;  5BN3 A;  3SE0 A;  4LF5 L;  2PZT A;  5FO9 B;  1Q90 A;  4JI6 L;  1OXT A;  2RQX A;  1STH A;  1F9Q A;  1Y8P B;  4DUZ Q;  3MXN B;  4A3C G;  2IX1 A;  3PGZ A;  1MJC A;  3A8K E;  2LSS A;  4KKU A;  3CPW A;  3FPP A;  1V1P A;  3VDY A;  4G4K A;  1VQA A;  2NVQ H;  2IT1 A;  4RH6 A;  1Q1B A;  2NVT B;  2OWO A;  2IWH A;  1S5D D;  4YHH Q;  1ROD A;  2AQ1 B;  1EOV A;  3GTQ B;  2IHE A;  4LF4 L;  2C9O A;  4CDF C;  2GVA A;  2K75 A;  1U4M A;  3EVQ A;  3X3M A;  3LGJ A;  5FLX E;  1YJ9 A;  2M00 A;  4DR1 L;  2Q8T A;  1EZ6 A;  3I2Z A;  5LL6 S;  1VQ6 A;  4A3K G;  5J22 A;  4WRD A;  4A3L H;  1AW7 A;  4JI2 Q;  1U4R A;  1HQR D;  4FVM A;  4DUY L;  4GKJ L;  1SAP A;  4EQN A;  3EBE A;  1ZYR D;  1EY6 A;  1FNW A;  2JP1 A;  4HIM A;  4JI2 L;  1WTP A;  2KUM A;  3P7J A;  4R4T A;  2A6E D;  2WFW A;  5K36 H;  2E2H B;  2YV5 A;  2MUY A;  4HAE A;  3FKI G;  3X3N A;  1R9T H;  4JCV E;  4DAV A;  2A73 B;  4IUV A;  3HOV G;  4KHZ A;  4CJ2 C;  4JI7 L;  1QCB D;  4A3G G;  4A3I G;  1TWF B;  2K33 A;  4LFA L;  1SR3 A;  3MVV A;  4P73 A;  1GKH A;  2A69 C;  4QF4 A;  4IPD A;  5EBC A;  4YY3 L;  2C35 B;  2ZTC A;  4BS9 A;  3S14 H;  4FP5 D;  2HDL A;  2K01 A;  4JI8 Q;  4A3F G;  1VQ9 A;  3D0F A;  3MEH A;  5A2Q L;  1B53 A;  5M3M G;  3IL8 A;  3RLF A;  1EEF D;  4CDC C;  3TRZ A;  4U68 A;  2E75 C;  2AHO B;  3PO3 B;  1WFQ A;  2R6G A;  1GJX A;  2PW7 A;  2F0G A;  3HOX B;  1A0I A;  2JQO A;  1K73 C;  2UXC L;  3TN2 A;  3HS0 C;  2OEO A;  5IWA Q;  3RD4 A;  4WOR A;  3HGB A;  4JVZ A;  2A68 C;  3SK8 A;  2ASB A;  4C2M H;  4EVO A;  3SHL A;  4OEL B;  5GAH C;  2EJM A;  3MFY A;  1EYC A;  3QG1 A;  1HNX Q;  3UDG A;  4XQQ A;  4L5S A;  1AE3 A;  4J8Q A;  3GTK H;  3I4M H;  4LK1 C;  1E0B A;  1ET9 A;  4MHE A;  3K7A H;  4LAA A;  3S2D H;  1A15 A;  3UDX A;  1PRT D;  1MGS A;  3GV6 A;  3PO2 H;  5EPL A;  4YCW A;  1SSO A;  4HJ9 A;  4NB3 A;  2JN4 A;  1JR0 D;  1IBK Q;  1I94 Q;  1AN8 A;  3M7N A;  2E2D C;  4J15 A;  4FO2 A;  4EQP A;  3MWY W;  1XXG A;  5ELE A;  4DNT B;  1UAP A;  1JB7 A;  3F2D A;  3J7A V;  1K28 A;  4R4O A;  1LTT D;  5JOB A;  1I94 L;  2CQO A;  2BE5 C;  1E7Z A;  5C0X I;  4DNI A;  2PCF B;  4KHP Q;  4YCV A;  5ELD A;  3SR1 A;  4K8J A;  4DR2 Q;  2JYO A;  2DJG C;  4B3R Q;  2B8G A;  1VQ8 A;  3URY A;  4A3M B;  1KDC A;  4P71 A;  4F87 A;  1U9R A;  2K5D A;  1OXS C;  3UI2 A;  1Y1W G;  1YZ6 A;  2B2Y A;  3J7A F;  3S1N B;  5GAD C;  1G91 A;  1GHK A;  1KXL A;  5I6W A;  1SN8 A;  5L37 A;  4WFN 3;  1B3Q A;  4RA8 A;  2K32 A;  2JA6 G;  4LF6 L;  4DR7 L;  1D5Z C;  4C1N I;  1SDF A;  2FIN B;  1V1Q A;  5JJK A;  1PYW D;  2L0C A; 
#chains in the Genus database with same CATH homology
 3OTO L;  1XJV A;  1BBU A;  1WJJ A;  3TEH B;  1L1O C;  2K50 A;  1BBW A;  4LFA Q;  1S72 A;  4BBR H;  3HOU H;  1UWV A;  3J7A 5;  4GLV B;  3S1Q H;  4IFD J;  4DK3 C;  4JYA L;  3STB C;  4DR4 L;  1Z9F A;  1K0R A;  2UXB Q;  1C0A A;  4YY3 Q;  2R7Z H;  1HZA A;  4NPS A;  3CMA A;  4HJ7 A;  2IX0 A;  2VY3 A;  1CSP A;  2K5N A;  2Z0S A;  4IO9 A;  1Y1V G;  4A3D H;  2VW9 A;  2MO0 A;  1EYG A;  3CPF A;  2AWO A;  1NJI C;  1RL2 A;  1L0W A;  4LF9 Q;  4IFD G;  2HHH Q;  2A1A A;  1YVC A;  2PMZ E;  1N36 L;  3PO3 H;  1M1K C;  4PZ6 A;  5J3B A;  4B3T L;  1PH6 A;  2BH8 A;  3ULL A;  3M85 A;  3CXC A;  3KLW A;  4DV7 Q;  1X55 A;  3AYH B;  3W1B A;  1KIX A;  4PMW A;  3RN5 A;  3RZO H;  5IYB H;  2WAQ E;  5M3F H;  1XMO Q;  4LF9 L;  4BY1 G;  4A3L G;  4C3J H;  4C3H H;  2HHH L;  3CC2 A;  4BXX H;  3GO5 A;  1YEZ A;  1UE1 A;  1V9P A;  3PF5 A;  2JA8 G;  2IY5 B;  3TQY A;  3K0X A;  2F4V L;  1CKN A;  3J81 c;  2UXD Q;  1AH9 A;  4YWL A;  4K0K L;  1KL9 A;  1TXY A;  4X62 Q;  2PI2 A;  4X65 Q;  1HZB A;  1PA6 A;  2UXC Q;  2E5L L;  2MNA A;  3K7U C;  5LMN W;  4UP8 A;  4JG2 A;  4IFD I;  1TWA H;  3CCL A;  2VUM H;  1B70 B;  5FJ8 H;  4C3I H;  2VQE Q;  5K36 G;  1P16 A;  1X56 A;  1S40 A;  2UXD L;  4B3M L;  2BA1 A;  3KOJ A;  3PUZ A;  3ULJ A;  4X62 L;  4X65 L;  1SRU A;  3G4S A;  2PI2 E;  3NBH B;  2I5L X;  4DV4 L;  4IOA A;  4UP9 A;  5E7N A;  3U4Z A;  1IBL Q;  1WI5 A;  1VQN A;  1VQI A;  4A93 H;  4BY7 G;  1N33 Q;  1BVS A;  3NEN A;  2WB1 G;  2PQA A;  3D31 A;  3ER0 A;  3S1R H;  2VQE L;  1IBM L;  1X3G A;  4RMF A;  1OXU A;  1JT8 A;  2UUA Q;  2ATW A;  1HR0 Q;  1CUK A;  1A63 A;  4OXP A;  5JJI A;  2FXQ A;  4NXM Q;  3UDI A;  1N33 L;  4A3C H;  1W3S A;  4AQY Q;  1PVO A;  4LF8 L;  1I50 H;  3HKZ G;  2LXJ A;  2ZJR A;  4A75 A;  1VQF A;  1YI2 A;  1J5E Q;  1NBW A;  1J6Q A;  2CFM A;  1CKN B;  2RCN A;  1YIJ A;  2ZTE A;  3AFP A;  1I3Q H;  3U4V A;  4QY7 A;  4R4I A;  3CME A;  4OWX B;  5BR8 Q;  3H0G G;  4NXM L;  1XNQ L;  1GM5 A;  2RF4 A;  4LW1 A;  4OON A;  4DV5 L;  2RHQ B;  1E1T A;  1D8L A;  4AQY L;  4DV0 L;  3Q8D A;  4BBS G;  2MFI A;  2NVT H;  1OXV A;  3CCS A;  3G6E A;  4A76 A;  3G48 A;  4TVA B;  3A74 A;  4GN5 A;  5GAG C;  4DV6 L;  3HOW H;  1Z47 A;  5IYC G;  3CCM A;  1EIF A;  1W2B A;  3GTQ H;  1JJC B;  2PQA B;  3TRE A;  1VQG A;  4GLA C;  4GS3 A;  5FLM H;  2HT1 A;  3ICE A;  3NEL A;  4JV5 L;  3H3V H;  3EN2 A;  1RIP A;  5EAY A;  1E1O A;  4P72 A;  4R1J A;  4A3M H;  3A5Z B;  3M4O H;  1N8R C;  2JA7 H;  4MTN A;  2ES2 A;  2NVY H;  3S1N H;  4IPG A;  5IP9 H;  1EQQ A;  2UU9 Q;  1ASY A;  3B6Y A;  4RG1 A;  1Q1E A;  1VQ7 A;  1FJG Q;  5C44 H;  2R92 G;  1YNX A;  3J81 i;  4A3K H;  4YWM A;  2HIX A;  3M4P A;  3S2H H;  3S16 H;  4H02 A;  3I56 A;  4L5T A;  2CCZ A;  2CKZ B;  4HIK A;  3E0E A;  1HZC A;  2UU9 L;  4JI5 Q;  2HQL A;  3I4M G;  1K83 H;  1SLJ A;  2Q2I A;  4LFB Q;  1D7Q A;  3M4Q A;  4IJL A;  1LUZ A;  5ELN A;  1AE2 A;  4DUZ L;  1JE5 A;  2VNU D;  1PH7 A;  4LF6 Q;  2I5H A;  1Q7Y C;  4DR7 Q;  2E2H H;  2R7D A;  4DR3 L;  3PUW A;  4PZ7 A;  3PO2 G;  4UP7 A;  4JI5 L;  1JMC A;  3KF8 B;  2YYZ A;  3OTO Q;  3FKI H;  1VQO A;  2OTL A;  2R7F A;  3HOV H;  2UUB Q;  2ALY B;  4DV2 L;  4HIO A;  4A3G H;  2YTV A;  3BZC A;  4A3I H;  4JYA Q;  4BA1 I;  2OCE A;  4Y7N H;  1A8V A;  2EIF A;  2KBN A;  1XPR A;  1EIY B;  1KHI A;  3I4N G;  2QA4 A;  3GTP H;  3HOZ H;  1FL0 A;  3IRB A;  4YHH L;  2CWA A;  1N34 L;  3CCQ A;  4KLK A;  2JA5 G;  1QVC A;  3K80 C;  2UUB L;  1HNW Q;  5C4J H;  4JBJ A;  3HOY G;  4DAM A;  3U58 A;  1X9N A;  1KAW A;  1V43 A;  4A3F H;  4UY8 C;  3KF6 A;  1N36 Q;  4A3B H;  2IHF A;  1TWG H;  4LFC L;  5M3M H;  1YHA A;  4B3T Q;  3J80 i;  1B8A A;  5IE8 A;  2K5V A;  4MZ9 A;  5M5Y H;  3KJO A;  1WCM G;  4JBM A;  2N8N A;  4A3J H;  3CD6 A;  1HNW L;  1JJG A;  3RNU A;  1KRS A;  1TWH H;  4LNQ A;  3CW2 C;  4A3E H;  2VZA A;  1O7I A;  1OTC A;  2GVB A;  2HIV A;  3F8T A;  5DLQ E;  2EXD A;  2KCT A;  3F1Z A;  3E9H A;  1E24 A;  4IOC A;  4EQ5 A;  4Y52 H;  2VL6 A;  1KD1 C;  2F4V Q;  2V1C C;  4K0K Q;  5IYD G;  3HOX H;  3ERS X;  2E5L Q;  5C4X G;  3GD7 A;  1GD7 A;  5C3E G;  2MQH A;  1T9H A;  3J81 j;  3F2B A;  2H5X A;  2I5M X;  5GAE C;  2OTJ A;  2N3S A;  2KHJ A;  2K52 A;  4JC0 A;  1QUQ B;  2WB1 E;  4PZ8 A;  4DV1 L;  3MEF A;  1PHJ A;  1Q12 A;  4B3M Q;  1EQR A;  4B3S L;  2YU9 H;  4DV4 Q;  4DR5 L;  3HOZ G;  3OW2 A;  1A62 A;  1MIU A;  2RHS B;  1PH5 A;  3HFZ B;  3HOU G;  3TS0 A;  3KF6 B;  4BBR G;  4GOP B;  1HR0 W;  1VCI A;  1IBM Q;  4APV A;  1CKM A;  1TWC H;  4JOI C;  2JEA I;  2LXK A;  3HKZ E;  2PNH A;  1CKO A;  2Q2H A;  4AIM A;  4JI3 L;  1VQJ A;  2AKW B;  1NY4 A;  2R7Z G;  1SFO H;  2UUC L;  2B3G A;  3BZK A;  5GQO A;  3RLN A;  5AJ3 Q;  1BKB A;  4IJH A;  4A3D G;  5IP7 H;  4LF8 Q;  3KFU A;  1Q82 C;  3JC6 6;  3STB D;  3PF4 A;  4FDB A;  4JI8 L;  1IYJ B;  3JAM i;  5HGQ A;  3PO3 G;  4XTC S;  5M5W H;  4DKA C;  1XNQ Q;  1XPU A;  4X66 Q;  5AJ3 L;  4DV5 Q;  3J7Z C;  5IT9 c;  3A5U A;  4OX9 Q;  2XGT A;  4GN4 B;  4DV0 Q;  1SE8 A;  4R4C A;  1XNR L;  1G51 A;  2OQ0 A;  2YTX A;  3PV0 A;  5IYB G;  5M3F G;  3GTO H;  2XTI A;  2A8V A;  1PH8 A;  2VQF L;  1VQC A;  3FP9 A;  4DV6 Q;  4BXX G;  1X54 A;  3K81 C;  2I0Q A;  4XIG S;  3ULP A;  4JBW A;  3CF5 A;  1PH9 A;  3L7Z C;  4X66 L;  3PSI A;  4OX9 L;  3BU2 A;  2JK8 A;  1CSQ A;  3PIO A;  3PIP A;  3RLO A;  3J80 c;  4LWC A;  5LMN Q;  4WJ4 A;  2R93 H;  3PUV A;  4JV5 Q;  3L2P A;  4DPG A;  4ALP A;  3F2C A;  1EFW A;  2VUM G;  3ZJY C;  5FJ8 G;  1GO3 E;  4OWT B;  2VS1 A;  4AYB G;  4LF7 L;  3U50 C;  5IWA L;  1Q81 C;  1LTL A;  1IZ6 A;  5M5X H;  4OWW B;  4GOP C;  5LMN L;  5LMU L;  3CC4 A;  2JJQ A;  1UEB A;  4A93 G;  2DUD A;  2K4K A;  1UE7 A;  2QGQ A;  4AH6 A;  1KQS A;  1MKH A;  4LF5 L;  1PV4 A;  4OO1 G;  2D0O A;  1DGS A;  4QL5 A;  4JI6 L;  1HNX L;  1OXT A;  5JEA J;  4JOI A;  1Y1W H;  4A4I A;  4JI4 Q;  2F52 A;  4DUZ Q;  3MXN B;  4POG A;  4A3C G;  2IX1 A;  3PGZ A;  1N9W A;  1MJC A;  4JI0 L;  2B63 H;  1YHQ A;  2LSS A;  1UE6 A;  3CPW A;  4DR3 Q;  1Q86 C;  3I55 A;  1FVI A;  2JA6 H;  2JE6 I;  3VDY A;  1G29 1;  1YJW A;  2BH2 A;  2D0P A;  1VQA A;  2NVQ H;  3H15 A;  4JI4 L;  3RZD H;  2IT1 A;  2NN6 G;  5JEA G;  4DV2 Q;  5IY0 A;  1PH1 A;  4DR6 Q;  3CCV A;  1IBK L;  1Q1B A;  4GKK L;  2KEN A;  2Y0S E;  3HOW G;  4R4Q A;  5GRO A;  2OWO A;  4IPC A;  3HKS A;  2AMC B;  1VQP A;  4YHH Q;  3JAM c;  1N34 Q;  4P75 A;  4HJ8 A;  2KCM A;  1K8G A;  1PH3 A;  1EOV A;  4NXN L;  1P8L A;  2N49 A;  2IHE A;  3PUY A;  5FLM G;  4PG3 A;  1Y1V H;  4YCU A;  1HNZ L;  2E2I H;  4LF4 L;  4DR6 L;  1IL2 A;  4HID A;  2GVA A;  2K5H A;  3S24 A;  3A0J A;  4DK6 C;  4O0A A;  2K75 A;  1QUQ A;  1X3E A;  3OYY A;  4A3M G;  2Q2U A;  4LFC Q;  4KHP L;  1YBY A;  4WJ3 M;  3LGJ A;  3FHW A;  1K8A C;  1YJ9 A;  2JA7 G;  1WYD A;  4GNX B;  5IP9 G;  4DR1 L;  2NN6 I;  1NMG A;  2Y0S G;  3I2Z A;  3W5O A;  4DR2 L;  2ID0 A;  1X6O A;  5C44 G;  1VQ4 A;  1PH2 A;  5H1S E;  4GOP A;  4A3K G;  1VQ6 A;  4JBK A;  4B3R L;  2E2J H;  3K8A A;  4BY1 H;  4A3L H;  4JI2 Q;  3CAM A;  4QJF A;  4EX5 A;  3DLL A;  5HY6 A;  2ZM6 Q;  4DUY L;  4GKJ L;  2JA8 H;  1VQK A;  1G6P A;  1JJ2 A;  3EBE A;  4HIM A;  4JI2 L;  4DV1 Q;  2KHI A;  4R4T A;  3W1G A;  2A19 A;  2WFW A;  2ZM6 L;  4DV3 Q;  3T1Y L;  4B3S Q;  1N32 L;  2ZJP A;  4DR5 Q;  2YV5 A;  4QQB X;  3FKI G;  5FLX c;  1R9T H;  3GDE A;  3KDF B;  4JCV E;  1E3P A;  1XTD A;  4LUV A;  3HOV G;  4KHZ A;  4ME3 A;  4JI1 L;  4BY7 H;  4JI7 L;  4TQU S;  4A3G G;  4A3I G;  2NZO A;  4LFA L;  1SR3 A;  1VQB A;  4P73 A;  1GKH A;  4DV3 L;  3T1H Q;  4JI3 Q;  2BA0 A;  2JEB I;  3GTL H;  4IPD A;  2UUC Q;  3AEV A;  5JJL A;  2Z6K A;  2UXB L;  1VQL A;  2MO1 A;  4L5Q A;  2GN5 A;  5ELO A;  1Q8K A;  4YY3 L;  2C35 B;  2ZTC A;  1GVP A;  3S14 H;  2K14 A;  4JI8 Q;  4A3F G;  1QZG A;  1VQ9 A;  4L5R C;  3T1H L;  3TS2 A;  3D0F A;  4GNX C;  4A3B G;  1U0L A;  2E8G A;  5M3M G;  1LM0 A;  1VQE A;  3RLF A;  1KC8 C;  3AQQ A;  4A3J G;  1XNR Q;  3GTM H;  3PUX A;  3H0G H;  3NEM A;  3TRZ A;  1OXX K;  3SGI A;  1VQD A;  2DGY A;  4HJA A;  3EIV A;  2QEX A;  4A3E G;  1QZH A;  2VQF Q;  4DV7 L;  4BBS H;  1IXR A;  1XMO L;  1QVG A;  3G71 A;  3GTJ H;  2EQS A;  2AHO B;  1WFQ A;  2AWN A;  2R6G A;  5IYC H;  2F3I A;  1C9O A;  4KI0 A;  4AYB E;  4DAY B;  3HOX G;  1KRT A;  2NVX H;  2WAQ G;  1M90 C;  1S3O A;  1A0I A;  1I5F A;  2JQO A;  3E9I A;  1K73 C;  4BA2 I;  2UXC L;  1LYL A;  2NZH A;  3CP0 A;  4LF7 Q;  3WWV A;  3L0O A;  5IWA Q;  4P74 A;  3S17 H;  5LMU Q;  4O2D A;  2ASB A;  1L1O A;  4C2M H;  3CCE A;  1MJE A;  5C0X J;  2OQK A;  5GAH C;  1NMF A;  1PYB A;  3CCJ A;  1NTG A;  4GLX A;  1IBL L;  1NE3 A;  4LF5 Q;  2R92 H;  1SRO A;  4JI6 Q;  1HNX Q;  3UDG A;  4L5S A;  1PYS B;  2ZTD A;  1AE3 A;  1X65 A;  3GTK H;  2UUA L;  1VQ5 A;  3I4M H;  2B29 A;  1HR0 L;  4JI0 Q;  1Y14 B;  3CQZ H;  5IP7 G;  3PCO B;  4X6A H;  1YJN A;  5C0X G;  3K7A H;  3S2D H;  1XMQ Q;  1K9M C;  3UDX A;  4YWK A;  1J5E L;  2D62 A;  1I6H H;  1H95 A;  2CWP A;  3PO2 H;  3S15 H;  4GNX A;  4LUO A;  4YCW A;  4HJ9 A;  1K3R A;  4NB3 A;  2WP8 J;  3BJU A;  1EUJ A;  5BR8 L;  1PFS A;  1IBK Q;  1I94 Q;  3M7N A;  3KYH C;  1XMQ L;  4J15 A;  4GKK Q;  3CCR A;  1WOC A;  1VS0 A;  3I7F A;  1YIT A;  3I4N H;  1HJP A;  1L1O B;  4QGU A;  4NXN Q;  1JB7 A;  3I4O A;  4LUZ A;  3F2D A;  1HNZ Q;  4R4O A;  3RN2 A;  2YTY A;  2JA5 H;  4LF4 Q;  2R93 G;  1I94 L;  2CQO A;  4X64 Q;  2Z6K C;  4IPH A;  3S1M H;  4OO1 I;  1E7Z A;  5C0X I;  3HOY H;  1QVF A;  4DNI A;  4KHP Q;  1X3F A;  4YCV A;  1VQM A;  4HJ5 A;  4DR1 Q;  3UE0 A;  2ZJQ A;  3DM3 A;  1WCM H;  3KDF A;  4DR2 Q;  4X64 L;  3M3Y H;  2Q2T A;  4B3R Q;  4UPA A;  1VQ8 A;  1HZ9 A;  1L2F A;  4MNO A;  4QIW E;  3RR5 A;  1FJG L;  1HH2 P;  1VQH A;  4DUY Q;  4GKJ Q;  1XPO A;  1SMX A;  2N78 A;  4P71 A;  3M9B A;  1OXS C;  1Y1W G;  1YZ6 A;  3UDF A;  3CCU A;  1FGU A;  5GAD C;  5IYD H;  5C4X H;  1KXL A;  4LFB L;  3AFQ A;  5C3E H;  2B63 G;  1EWI A;  1SN8 A;  3GTG H;  1U5K A;  1C7Y A;  2JA9 A;  3KJP A;  1TWF H;  1YHB A;  3CC7 A;  3T1Y Q;  1PH4 A;  1ASZ A;  2JA6 G;  1N32 Q;  4LF6 L;  4DR7 L;  1B7Y B;  1E22 A;  4POF A;  4DR4 Q;  4GN3 B;  3UE1 A;  1Q46 A;  2L15 A;  1V1Q A;  5JJK A;  4JI1 Q;  1UE5 A;  4JI7 Q;  3H3V I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...