4A3KH

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Initial RNA Polymerase II Transcription.
pubmed doi rcsb
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3kH00
1A0IA 2ZJQA 4C3IH 3PGZA 2Z0SA 1PH7A 2UXBL 3I4NH 4P74A 4FDBA 4A3KG 2ASBA 1QUQA 1UEBA 4DPGA 1E24A 4K0KQ 3EN2A 3GTGH 4LFAQ 3K7AH 2JA6H 2VQEL 3HOUH 4DR6L 1QVGA 2N3SA 4MTNA 4JI2L 4LF7L 2ATWA 4C3HH 4X6AH 3VDYA 2NN6G 3M9BA 3M4PA 5H1SE 1VCIA 5C3EG 1YIJA 2EIFA 1VQEA 3LGJA 2JE6I 3TQYA 1JE5A 3A5UA 1EUJA 5M3MH 4JI5Q 2BH2A 1O7IA 4LFBQ 1A63A 3PSIA 1FJGQ 1G51A 2QGQA 1PYBA 4HJ5A 4B3SL 1D7QA 4DV0L 3S2DH 1PV4A 1GM5A 4LNQA 3D31A 4LUVA 1OXVA 2UUAQ 4IFDG 2JK8A 1QZGA 3CD6A 3BZCA 4QL5A 4X62L 3JAMc 3FKIG 2VW9A 4XIGS 4DR4Q 1XTDA 2OQKA 3HOZH 2UUBQ 4GN4B 1FGUA 4JBJA 4ALPA 1N9WA 4DV4Q 2K4KA 1XNQQ 5FLMH 2D0PA 2UXCQ 2IHFA 3HOXG 3S15H 3HKSA 1UE7A 2B3GA 4DR2Q 3I2ZA 2B63G 2OCEA 4PZ6A 2B29A 4POGA 1ASYA 3T1HQ 1JT8A 1BBWA 4A93G 4OWXB 1WI5A 1N32Q 2R92G 4H02A 4YWMA 4HJ7A 3K7UC 2YTYA 5M3FG 1KIXA 1VQKA 1NE3A 4GOPA 4NXNL 4Y7NH 4B3ML 1K8GA 2H5XA 3PF5A 4YY3L 3ULLA 3RLFA 5LMNW 1W3SA 4DV6Q 3WWVA 2NN6I 2I5HA 3J80i 3J81i 3KOJA 1J6QA 4YHHQ 4DV5L 1H95A 2HQLA 3GDEA 5JJKA 2WAQE 1L1OB 3U4ZA 4GN5A 2VUMG 1HNXL 5IYDG 1MKHA 4B3TQ 4RG1A 1QZHA 4JI6L 1MJCA 2AMCB 4GKJL 3S1RH 1KL9A 2RHSB 1VS0A 3AEVA 1HNZQ 4BY7G 1SN8A 4IJLA 2QA4A 4JYAL 2IHEA 4DUZQ 4DV3L 4IFDI 3RR5A 4GOPB 1KC8C 5IYCG 2VQFL 5M5WH 2MFIA 5FJ8G 4A3BH 1JJ2A 2K52A 4R1JA 2ZM6Q 3CP0A 3ULPA 1PVOA 3RLNA 1I6HH 3G71A 5IP7G 1Q46A 4TVAB 1VQHA 4HJAA 4PZ7A 4WJ4A 2YU9H 3PO2G 1YJNA 2YTXA 4JI1Q 1VQ5A 1GO3E 2VS1A 1S3OA 4WJ3M 1OXXK 1RL2A 2LSSA 4P71A 5EAYA 5HGQA 4A3EG 1P16A 1VQLA 4UY8C 4BBSH 4L5SA 4A3IG 1X9NA 4R4OA 2UU9L 1K0RA 3HKZE 4R4TA 2R7ZG 4GKKL 5JJLA 4LWCA 3UE0A 4LF8L 1VQAA 4LUOA 2VY3A 4UP9A 5C44H 5M5YH 1JMCA 4A75A 4KHPL 1EYGA 4MZ9A 3TS0A 4JV5Q 4O2DA 4A3MH 4MNOA 3A0JA 3STBC 2UXDQ 1CSQA 2F3IA 1TWFH 3A5ZB 4IPGA 4YCWA 3I4OA 4A3JH 3KFUA 4DV2L 3CCMA 4YWLA 4A3FG 2VNUD 1I5FA 1CUKA 3PO3H 4X65Q 1NMFA 2JEAI 3PUYA 1DGSA 2PNHA 2D62A 4GS3A 1JB7A 1IYJB 2OQ0A 2JA8H 2JA9A 3CW2C 4AYBG 1AH9A 1PYSB 1TWAH 1SROA 2LXKA 4POFA 2IY5B 3CC4A 2JA7H 4Y52H 1Y1WG 3GO5A 1K83H 1XPRA 4DR3Q 2EQSA 2Y0SE 4C2MH 1WJJA 1WOCA 4JBMA 1Q81C 1EIFA 1BVSA 3CPFA 4GNXA 1VQ9A 1I3QH 2CCZA 2RHQB 1OXSC 1N33Q 4TQUS 2JA6G 2KBNA 3KDFA 1X3FA 2ALYB 5J3BA 2XTIA 4QQBX 2UUCQ 1D8LA 4LW1A 3ZJYC 4DR1L 3PUVA 3HOYG 1TWCH 3D0FA 4L5TA 1W2BA 3S2HH 2VZAA 2D0OA 3RNUA 1KQSA 1AE2A 1U5KA 4IPDA 3S1NH 1EIYB 4NB3A 3RN5A 2HHHQ 5M3MG 1YI2A 4UP7A 3G4SA 1IBLQ 4B3RL 3CAMA 1A62A 3CF5A 3MXNB 4LF9L 3KLWA 4YWKA 1R9TH 3HOWH 1X3EA 2GVAA 3NELA 2NZOA 2JA5H 1XNRQ 2R93H 1WFQA 1Y14B 3CXCA 2KHJA 1HZBA 4RMFA 5M5XH 2IX0A 1VQMA 1PHJA 1HR0L 1NMGA 4BXXG 4BBRH 1FVIA 4DV7L 1N36Q 2F4VQ 2ZTEA 1K3RA 5IY0A 1N34Q 3ERSX 1Y1VH 2JJQA 3HFZB 4L5QA 1C7YA 3K0XA 5LMNQ 3T1YL 4LF4Q 2GVBA 3HOZG 1Q12A 1IBKQ 3S14H 2MQHA 3GTQH 1SMXA 1QUQB 1IBMQ 1G291 4YCUA 4X66Q 1XMOL 1VQPA 3E9IA 2R6GA 1I94Q 4LF6L 2NVXH 2A8VA 4JI7L 1HJPA 3RZOH 1E3PA 2N78A 4LFCQ 2E5LL 2MO0A 4A76A 3KYHC 4YCVA 3UDIA 3F2DA 4O0AA 1UE6A 2PQAA 4A3KH 1KHIA 5BR8Q 4J15A 4JBKA 5IP9G 3G6EA 1HNWL 1L1OC 3CQZH 2CWAA 2K14A 4DUYL 4OXPA 1CKNA 4AH6A 5IWAQ 3ICEA 1X6OA 1X54A 3I55A 1TXYA 2KENA 5C3EH 1V1QA 3ER0A 3B6YA 3CMEA 1CKMA 2WAQG 2WFWA 1KD1C 1Q7YC 4GOPC 4BA2I 4IOAA 1UE1A 1YVCA 4JOIA 1XMQQ 2DUDA 4OONA 1OTCA 2MNAA 2Q2TA 2ZTCA 4JI4Q 4UP8A 1Z9FA 4A3LH 2PQAB 4A3DG 1EQRA 4DAMA 4DV1L 2E8GA 4OX9L 3PIPA 1PH5A 1NTGA 1E7ZA 1UWVA 4X64L 1N8RC 4LF5Q 3PCOB 4JCVE 4AQYQ 1NY4A 1CKNB 3FKIH 4JC0A 1B8AA 1PH1A 1OXUA 1TWGH 3BJUA 4QGUA 5HY6A 3TRZA 5IE8A 4DR7L 5AJ3Q 4QIWE 4AIMA 5LMUL 2NVTH 3HOXH 4NXMQ 4HIKA 1X56A 4JI3Q 2PMZE 2B63H 3OTOQ 4JI8L 1YBYA 1HZ9A 1E1OA 4K0KL 1AE3A 3H3VH 1J5EQ 1YHAA 1VQOA 1CKOA 4LFAL 3HOVH 4JI0Q 5C0XJ 3PIOA 3KJPA 1LTLA 5M3FH 4BBSG 4DR5Q 1MJEA 4P73A 3M3YH 1Q1BA 1PH9A 5C44G 5IYBH 3UDGA 2UXBQ 4PMWA 1VQGA 4JBWA 4QJFA 1VQ4A 1CSPA 3GTOH 4JI5L 3PUZA 1WCMG 3E9HA 4HJ8A 4LFBL 1SRUA 2L15A 4GLVB 1IXRA 4NPSA 4A3MG 3S16H 1FJGL 2VQEQ 4DR6Q 2VUMH 2K50A 1G6PA 1K9MC 2IT1A 4JI2Q 1UE5A 3BZKA 3TREA 2A1AA 1K8AC 4LF7Q 4OO1I 4IFDJ 1EOVA 3J81j 1X3GA 1KAWA 5JEAG 2ZJRA 1YZ6A 2UUAL 3CPWA 2CKZB 1QVFA 4DNIA 4DR4L 3TEHB 2QEXA 2UUBL 2JA8G 2I0QA 3RN2A 2Q2HA 1YEZA 2F52A 4DV4L 1RIPA 3S1QH 4B3SQ 3AFPA 1XNQL 4A3GH 1C9OA 3JAMi 3F8TA 4DV0Q 2UXCL 4APVA 1WYDA 2JA7G 3AFQA 4DR2L 4KI0A 2Y0SG 3I7FA 3CCQA 1OXTA 4X62Q 1YHQA 3T1HL 4EQ5A 4JG2A 1SLJA 1N32L 2AHOB 1VQJA 2R7FA 5IP7H 2Z6KC 2BA1A 2WP8J 4BY1H 1PH8A 3I4MG 1VQCA 1VQNA 4A3EH 3W5OA 3L2PA 1HZAA 2PI2E 4A3IH 1PFSA 2R7ZH 3I4NG 1KRSA 2DGYA 4DV6L 4R4QA 4DR7Q 3CC7A 4PZ8A 2I5LX 1T9HA 3DLLA 4YHHL 3M4QA 3HOUG 1S72A 1JJCB 1HR0W 4DKAC 1HH2P 4B3TL 5JJIA 5DLQE 4NXNQ 3W1GA 2JA5G 1GVPA 4R4IA 4B3MQ 4P75A 4A3CH 1XJVA 5C4XH 2Q2IA 4XTCS 2RF4A 4EX5A 4YY3Q 1HNZL 3CC2A 2KCMA 1A8VA 4BBRG 4A3FH 1BBUA 2E2HH 3S17H 3KF6A 4DUZL 3MEFA 1B7YB 4DV5Q 1VQ6A 1VQDA 1HZCA 1Y1VG 4KLKA 4IJHA 1HNXQ 3M7NA 2WB1E 3KF8B 1SR3A 3GTJH 1Z47A 4GNXB 1KRTA 5C0XG 4JI6Q 3JC66 4GKJQ 2BA0A 3EIVA 5IT9c 5C4JH 2ZM6L 3CMAA 3KDFB 4R4CA 3BU2A 4JYAQ 2LXJA 3F1ZA 5LMUQ 4P72A 3U58A 1B70B 4DV3Q 1YITA 3H0GH 3L0OA 4JI1L 4JI8Q 5FLMG 3GTMH 2VQFQ 4HIOA 1I50H 3S1MH 3IRBA 1BKBA 2MO1A 2YYZA 1L0WA 5JEAJ 1EWIA 5GAGC 5GADC 5GAEC 2E2IH 4HIDA 3KF6B 2NVQH 3CCJA 2N8NA 3U4VA 1XPOA 1Q8KA 3HOYH 2K5VA 4LUZA 4IPCA 2RCNA 3SGIA 1LUZA 2E2JH 3NEMA 3GTPH 4GLXA 4JV5L 2FXQA 1E22A 4DK3C 2UXDL 1NBWA 2OTJA 2ID0A 3J7ZC 2UU9Q 3TS2A 4GKKQ 5ELOA 4LF8Q 3UDFA 3W1BA 4A3LG 4KHPQ 4DK6C 2NZHA 1X55A 4X65L 4HIMA 4BXXH 4OO1G 1X65A 3CCEA 2ES2A 3UE1A 3PF4A 1PH2A 1S40A 4JOIC 3PV0A 1M1KC 1XPUA 1L2FA 1M90C 1YJ9A 3I56A 1VQIA 4DV2Q 1K73C 4DR3L 1PH3A 2K5NA 5C0XI 3L7ZC 1L1OA 1LM0A 3CCVA 2HIXA 4L5RC 3S24A 3CCLA 1GD7A 2CWPA 1N33L 3HOVG 4A3BG 1MIUA 1PH4A 4IO9A 2UUCL 2CQOA 5IP9H 3CCSA 1YJWA 3U50C 4A4IA 5IYBG 1P8LA 4A93H 1QVCA 1Q86C 2HHHL 2R92H 3AQQA 5GQOA 1IBLL 3HKZG 3OW2A 2N49A 2OWOA 3ULJA 4IPHA 1XNRL 4DR1Q 1SFOH 3K80C 1FL0A 4IOCA 3KJOA 1C0AA 2Q2UA 2ZJPA 2F4VL 3CCRA 1TWHH 1N36L 3UDXA 4A3DH 2NVYH 3FHWA 1N34L 1PA6A 3RZDH 4LF4L 5K36G 5LMNL 4B3RQ 5IYDH 3NENA 1Q1EA 3F2BA 1IBKL 4LF9Q 4A3GG 4A3JG 1IBML 2KCTA 1JJGA 3GTKH 2OTLA 4UPAA 3H15A 4X66L 4OWTB 2YV5A 1I94L 4BY7H 3E0EA 4OWWB 1HR0Q 1ASZA 2R7DA 2HT1A 3PO3G 2AWOA 1EQQA 4LFCL 4DV7Q 3FP9A 2XGTA 1VQBA 2EXDA 2AWNA 2ZTDA 3K8AA 1YHBA 4DR5L 5IYCH 1VQFA 2VL6A 5FJ8H 5BR8L 3T1YQ 4BY1G 1V43A 2JQOA 3M4OH 3H3VI 3CCUA 1XMOQ 1SE8A 5IWAL 3K81C 3EBEA 4GLAC 3J80c 3J81c 4LF6Q 1YNXA 3Q8DA 2BH8A 4JI7Q 1EFWA 2E5LQ 2AKWB 4GN3B 5GROA 1VQ7A 2HIVA 2IX1A 1IL2A 3J7A5 3PO2H 5E7NA 1WCMH 3STBD 1NJIC 3GD7A 3PUXA 1HNWQ 1XMQL 3OYYA 4DUYQ 3GTLH 4PG3A 4GNXC 4JI4L 1U0LA 1V9PA 4A3CG 1KXLA 5C4XG 5ELNA 1Q82C 2YTVA 1PH6A 3G48A 2JEBI 3AYHB 3M85A 4LF5L 2C35B 2KHIA 4AQYL 4C3JH 3HOWG 5FLXc 2R93G 2WB1G 2GN5A 2K5HA 4BA1I 1E1TA 2PI2A 2Z6KA 5AJ3L 4ME3A 3DM3A 2V1CC 3NBHB 4KHZA 4JI3L 4NXML 1LYLA 3PUWA 4DAYB 4DV1Q 4OX9Q 3A74A 3OTOL 2CFMA 3F2CA 2A19A 4X64Q 1VQ8A 1IZ6A 4HJ9A 3H0GG 1J5EL 4QY7A 4JI0L 4AYBE 5GAHC 3RLOA 1GKHA 2I5MX 2K75A 3I4MH 1Y1WH
chains in the Genus database with same CATH superfamily
1FR3A 2ZJQA 3PGZA 2Z0SA 2JA7B 1PRTB 3C1FA 5LHY1 2BDNA 1UEBA 4DPGA 3EN2A 3GTGH 2M2LA 2VQEL 1I3QB 3NP8A 3TP5A 1QVGA 4LF7L 3I4MB 2QDBA 5C3EG 1YIJA 1RODA 2KECA 3R2IA 3LGJA 2JE6I 3NBIA 4JI5Q 2OT2A 1CHQD 3MXUA 2BH2A 1O7IA 2XIWA 2K28A 1FJGQ 2F0KA 3K7AB 4HJ5A 1D7QA 1KNEA 3S2DH 1PV4A 1GM5A 3HOWB 4IFDG 2UUAQ 4X62L 1PZJD 2B2WA 4DR4Q 1FGUA 3GV3A 3OW7A 1XNQQ 1TT2A 2C5CA 2UXCQ 4B08A 4CKCA 2B63G 5TSSA 3I2ZA 5KNCA 1RHPA 2A68C 4PZ6A 1ICWA 4POGA 3OWFA 4QCLA 1ASYA 3T1HQ 2FHTA 4N8X1 1BBWA 2KCNA 5C3WA 1BDOA 2NVXB 1N32Q 4K2LA 4YWMA 3K7UC 2YTYA 1CFMA 5J22A 3A7AB 5BN4A 4Y7NH 1D2BA 4B3ML 1K8MA 1SJHD 2H5XA 3NPPA 1D6EC 1WTPA 3ULLA 5LMNW 3J80E 1W3SA 3T16A 3WWVA 1XYIA 3J80i 3KOJA 1J6QA 2WKCA 3HG9A 4DV5L 1EYAA 5C3EB 2LFNA 1S5ED 2EY5A 4RG1A 1FNUA 1JORA 3DWPA 1VS0A 1HNZQ 4BY7G 1C4QA 1RF2D 5EPJA 1KC8C 5IYCG 5M5WH 1Q3LA 2C9OA 4CDDC 1QILA 3ULPA 3P1HA 2K5WA 2RSNA 3I91A 5I2YA 3BVGA 2EE1A 3G71A 2NVTB 4PZ7A 2BDOA 2B63B 4L8JA 3K0YA 4A3EG 1RL2A 2LSSA 3FEWX 1P16A 4QB4A 4GKKL 3HKZE 2KHSA 4LWCA 2VY3A 4NMZA 5KGUA 5C44H 2H1EA 1PXUA 4O2DA 3R93A 3A0JA 2UXDQ 1A6XA 3A5ZB 4EGVA 1NR2A 2F0FA 2O2LD 1HHVA 1KNAA 2VNUD 1PYWD 4X65Q 3ND9A 2JEAI 1NAPA 1XTCD 1GUGA 2OQ0A 1PYSB 2L9HA 2LXKA 2NWGA 3J81L 4DR3Q 2EQSA 5IGEA 1WJJA 3HP3A 5DAUA 3KF8A 2SEBD 2B2YC 2JA6G 1TWAB 3VR5A 3PUVA 4L5TA 3I73A 3S2HH 2VZAA 1DONA 4LMQD 1AE2A 3P20A 4IPDA 1PMRA 4CDEC 2HHHQ 5FLXL 4UP7A 4B3RL 4LF9L 1A62A 3MXNB 1R9TH 2JA5H 5D3IB 3CXCA 5FO8B 4R8IA 2KHJA 2PZUA 2DJFC 5M5XH 2IX0A 1VQMA 4BXXG 5JOBA 4H44C 4BBRH 4CGYB 2ZTEA 1N34Q 5C4XB 3ERSX 3HFZB 1AP0A 2K01A 3K0XA 2KOLA 3S17B 3E6ZX 1XXGA 1IBKQ 3S14H 2L0CA 1ILQA 3GTQH 1AN8A 4QUCA 4YCUA 2L1BA 1XMOL 3NE5B 3C3LA 1QCBD 3E9IA 1EIHA 4RHRA 4JI7L 1BCPD 3RZOH 3KYHC 4YCVA 1QG7A 4K6DA 1DOLA 5EGTA 1UAPA 2EY2A 2IX3A 3EQLC 3CQZH 2CWAA 3H0GB 3IKJA 2XVSA 3NTKA 2XSCA 1X6OA 1O7YA 1X54A 3OIPA 1TXYA 4FVMA 2VB2X 1CKMA 2WAQG 1KD1C 4OGQC 4FF1A 4IOAA 1YVCA 1XMQQ 5K5PA 4ZLTF 4JI4Q 2CH4A 4DV1L 4OX9L 1UNSA 3PIPA 5JJZA 4LF5Q 3I3CA 4AQYQ 1NY4A 1NSNS 4J6HA 2F0UA 5FO7B 3BJUA 1II3A 4HIKA 4JI3Q 4M1UB 2Z4HA 4IUVA 1YBYA 3A8JE 3SEBA 4K0KL 1J5EQ 1VQOA 3A55A 5CGKA 2PPBC 4JI0Q 3FKIB 3PIOA 1EY6A 5IODA 1LTLA 2ZT9C 2EJGC 1MSGA 1Q1BA 3L9AX 1F9RA 2J4XA 2K33A 4QJFA 1A15A 3GTOH 4F88A 3BVZA 3S16H 4A93B 2R92B 2QW7A 3BZKA 2FMMA 5M3FB 1K8AC 2EJMA 3J81j 1X3GA 2X6LA 5JVH3 1X32A 2CKZB 4DNIA 3MXPA 1TWHB 3RN2A 2Q2HA 1YEZA 3S1QH 1GUNA 5CBEE 1C9OA 3F8TA 3RZDB 2DY8A 1D5ZC 3AFQA 3V2TA 4DR2L 2Y0SG 3I7FA 2PQEA 4CJ1B 4KY5A 4EQ5A 1SLJA 1VQJA 5IP7H 1ENAA 2BA1A 4OHJA 3VR4A 3W5OA 1D1KA 1EZ8A 4A3IH 3VYSA 1PFSA 2R7ZH 3M4OB 3MFGA 2NZ1D 4DV6L 3D8GA 2F0LA 4WJWA 1CM9A 3M4QA 3KK7A 1JJCB 4DKAC 1IYUA 1WTWA 2WACA 1GVPA 5IGCA 1MBYA 2JSOA 2RF4A 3MXGA 4XTCS 3CC2A 3AMUA 5AFWA 2KCMA 2E2HH 3KF6A 2RDHA 5CV4A 4DUZL 2JYOA 3FRPB 3PMFA 3JC66 2BA0A 5IT9c 3CMAA 4RWSC 4XYOA 3H09A 4P72A 1B70B 4ODGA 4A3FB 3CU7A 3MTSA 5EJWA 4JI1L 2VQFQ 1I50H 3S1MH 3IRBA 1L0WA 2NVQH 1CQFA 2N8NA 2NTTA 1XPOA 3L3OC 2O5IC 3HOYH 4CDCC 3IFTA 4XQNA 2EYLA 1B53A 4DU9A 1NBWA 1K3BC 2F0QA 4HCSA 3GTGB 2E2IB 1BO0A 3TSSA 4KHPQ 4Q5VA 4HIMA 1HA5A 1PH2A 1M1KC 1XPUA 4X3KA 4DV2Q 1LTAD 3W3AA 3C1EA 1WVLA 4IFDH 1TY0A 1LM0A 3CCVA 2F0JA 3S2DB 1EY9A 3S24A 4KK7A 1FNVA 4KV6A 4IO9A 2SNMA 2CQOA 1CA5A 3E3XA 2K05A 2NYZD 1GUOA 1ZKOA 3TP6A 3GQBA 5DEHA 1AEXA 2B2UA 2B2TC 2X69A 3AQQA 2K7VA 3HKZG 4FYDA 4DR1Q 2A69C 5IIFA 1FL0A 4IOCA 3KJOA 4Y7NB 5IOCA 2QILA 4H0LC 1NNXA 1FYCA 1KTKA 3FHWA 4PV1C 5KNBA 2P5ZX 4PQXA 4LF4L 5C3XA 3NENA 1Q1EA 2KQ3A 4A3GG 2OTLA 3H15A 2YV5A 1I94L 4BY7H 4OWWB 3SK6A 1F2LA 3Q22A 1HR0Q 1ASZA 2XWJB 2DNEA 4LFCL 3FP9A 3QWNA 3QR8A 4MIUA 5IYCH 3KLSA 1I4RA 4BY1G 4DAVA 2JQOA 3H3VI 3I70A 3CCUA 1SMYD 1S5DD 5IWAL 3K81C 4LF6Q 3J81c 1YNXA 2O4XA 1LTSD 1DOKA 1B4OA 2FMCA 2E5LQ 4GN3B 3NBHA 2KA7A 1LV9A 5E7NA 4DA2A 4IUPA 1HXYD 5CMDA 1NJIC 3BDOA 1BBXC 4ZUIA 3GD7A 1IKLA 5CV8A 3OYYA 1TS3A 1U0LA 2DJGC 2SOBA 1PH6A 3HKZB 2HCIA 1H9RA 5C44B 2KHIA 4F87A 5FLXc 2WB1G 1WCMB 1I4GA 1SNCA 3VR2A 2Z6KA 3OMCA 5T1GA 4DAYB 3J80L 1A2UA 1B9MA 3F2CA 2FINB 3Q23A 5GAHC 3RLOA 4DR5L 3DHQA 4DNRB 3K57A 4FDBA 1QUQA 1E24A 2JA6H 3U9SA 4DR6L 2N3SA 4JI2L 2ATWA 1SYDA 1M4VA 2EIFA 1VQEA 1VMCA 4ZQ3A 1HA6A 5EKIA 3A5UA 1EUJA 4P2CB 4LFBQ 4N9PA 4KKTA 1PYBA 3HOUB 2N55A 4PMBA 1J9OA 4OELB 5CV7A 3D31A 2KVMA 1R9TB 2JA5B 2JK8A 1HCZA 1T5EA 3C46A 2UUBQ 4GN4B 3V05A 4JBJA 4BBRB 4ALPA 1HRJA 4DV4Q 2K4KA 2D0PA 1STEA 3S15H 2AUJD 4E6IA 3HKSA 1DD2A 3GTQB 2B29A 3DM1A 3RZOB 4H02A 4HJ7A 4XT3B 1JWMD 3GV6A 2R3ZA 1VQKA 1NE3A 4GOPA 2I5HA 1HFNA 2AQ1B 3JAML 1F77A 2HQLA 2WAQE 2CQAA 3FMCA 4GN5A 3U4ZA 1HNXL 5IYDG 1MKHA 4B3TQ 1B9NA 1LLRD 1RTOA 2AMCB 4GKJL 1F9QA 1T5XD 2L5TA 3S1RH 2N88A 1TY2A 4UDUC 4JYAL 1JOQA 1Y8NB 2IHEA 5JPNC 3MWYW 5FJ8G 4A3BH 1JJ2A 1PTOH 2K52A 4R1JA 2EY1A 3NWSA 3NHHA 5D14A 2B8FA 4OEMB 1W6KA 2CW0D 3R2TA 1U9RA 1I6HH 1S5FD 2LY7A 3BVMA 5IP7G 4HJAA 4WJ4A 3PO2G 1GO3E 1S3OA 4WJ3M 5HGQA 1VQLA 4L5SA 4A3IG 2R7ZG 1M8AA 1K0RA 3UE0A 4LF8L 3O13A 1A3TA 3DWQA 4DXGA 4JV5Q 3TDQA 3OHXC 3STBC 3GTOB 1PFNA 3I4OA 4B9XA 1TVXA 1ZYRC 5NUCA 1RD9D 3PO3H 1X3QA 1DGSA 3R8BA 3KBXA 1IYJB 1LTID 4AYBG 3PQIA 1SROA 4K2KA 4POFA 4FXGC 4Y52H 1Y1WG 1U4MA 2NBFA 2Y0SE 4C3IG 1WOCA 4GNXA 1O78A 3LNNA 1N33Q 4TQUS 2ALYB 5J3BA 2XTIA 1D8LA 3HOYG 4C3HG 4KD4A 1R4PB 1W2BA 2EOTA 3RNUA 4ZKBB 1EIYB 4DN4M 2R7ZB 4NB3A 1JCKB 2ZXRA 4OIKA 5M3MG 4CBVA 1O80A 3QOLA 3CF5A 1ENCA 3TP7A 2A6HC 4FXKC 1XNRQ 4G57A 1WFQA 1CTMA 3V96A 1NMGA 2RVLA 2WKDA 4DV7L 1N36Q 2F4VQ 1PZKD 1SYGA 3S9WA 2JJQA 2XNAC 4L5QA 1C7YA 3T1YL 3HOZG 4IN3A 1SE3A 1IBMQ 3DEOA 1G291 2R93B 4X66Q 1E2VA 2A6ED 2N78A 2MO0A 1V1PA 1UE6A 3X3NA 2PQAA 4A3KH 1GUWA 1FNWA 2EYHA 5KRUA 3G6EA 3J7YW 1HNWL 2K14A 4OXPA 1I50B 3S1MB 2IL8A 3QO2A 3LWEA 2KENA 2NVQB 3B6YA 1MI2A 2RDGA 1E0BA 1Q7YC 3NTIA 4BA2I 1UE1A 4JOIA 2DUDA 1PZID 4OONA 2KEEA 5BN5A 2Q2TA 2ZTCA 1Z9FA 4K5WA 1EQRA 2E8GA 2RQXA 1NTGA 4HMJA 1A3UA 2K5QA 4X64L 4JCVE 4JC0A 1ESRA 1HTPA 1B8AA 1OXUA 1TWGH 3TRZA 4QGUA 2IPKD 5HY6A 4DR7L 2D2CC 5AJ3Q 1G91A 3HOXH 3VR6A 4NXMQ 2PMZE 1GXDC 4JI8L 4CHTB 1E1OA 4X3SA 1AE3A 4DK1A 1YHAA 4V190 5CV9A 4KY7A 2ENBA 4K8IA 3M3YH 2IWHA 3A8KE 2UXBQ 4PMWA 1VQGA 3M7GA 5KIXA 1VQ4A 4JI5L 3E9HA 5ELBA 2PYKA 2G9HD 4GLVB 2F0SA 1QNUA 2KEDA 2JXMB 4O42A 1FJGL 5HURA 2VUMH 4OO1I 1UE5A 2LKVA 1JWUD 1BNZA 1U4RA 2GA4B 5JEAG 2UUAL 3ND8A 4ZCKA 1QVFA 4DR4L 3TEHB 1QOHA 5CV5A 4A3GH 1RIPA 5E3FA 1LTGD 4B3SQ 1XNQL 4DV0Q 2UXCL 1WYDA 1CHPD 4KJNA 5ISRA 1LACA 1Q90A 1PRTC 3T1HL 4BY7B 4JG2A 1N32L 2AHOB 1YNND 2MGSA 1STAA 4BY1H 1PH8A 1VQCA 1STHA 1HZAA 5G3LF 1WD1A 4J8QA 1I4HA 1KRSA 2DGYA 4F8MA 2O5JC 4R4QA 3CC7A 4LJZC 5ELCA 4RH6A 3BYYB 4IZ8A 3OMGA 5DLQE 4NXNQ 3W1GA 4A3EB 3MC0B 2L4NA 5EKLA 4TSSA 1VDZA 4YY3Q 1HNZL 1GJXA 3ONAB 1NUCA 1BBUA 4DGZA 3TP8A 1VF7A 1VQ6A 1CK1A 1HZCA 1Y1VG 5I2XA 1LT4D 3M7NA 2WB1E 3GTJH 2M9VA 2B2YA 4JI6Q 4Q0FA 3UI2A 3EIVA 4N8FA 2VXWA 3KDFB 1SNOA 3SDZA 3SK5A 1DYQA 4K8JA 4DV3Q 2EJFC 1WTRA 2G9DA 3L0OA 3IAYA 1HQMC 3T51B 1BKBA 5GAEC 5T1IA 4FF3A 3NTHA 3KF6B 3U4VA 1Q8KA 1GHKA 1PDQA 2K5VA 4R9WA 2RCNA 3SGIA 2E2JH 3NEMA 3GTPH 4MTKA 2UXDL 3J7ZC 2UU9Q 2JA6B 4TRDA 4KHVA 1ENFA 1J8IA 1Y8OB 5BN3A 1G2SA 4X65L 3MHBA 3CCEA 1WTQA 2Z9HA 4QMGA 2A74C 4ABNA 1QWYA 1U4LA 1M90C 1PRTF 3M4YA 1VQIA 4RKBA 4DXFA 1VF5C 1B44D 3NSWA 5C0XI 4DR3L 3CKIB 3L7ZC 2A68D 3QG1A 4CJ0B 1GD7A 2IW3A 4L6TB 2EYPA 2VB3X 3E0JA 3HOVG 4A3BG 5G3LD 1BR9A 1PH4A 1EWCA 3QJYA 5IP9H 1YJWA 3U50C 1JQYD 4A4IA 1BUVT 2B2VC 3S15B 4WFN3 4IALA 1P8LA 1HFGA 3PIP3 2HHHL 4C56C 1I4QA 2D9UA 4I7ZC 3ULJA 4IPHA 1I4XA 1JOKA 1HPCA 5FOBB 2Q2UA 2ZJPA 3CCRA 4A3DH 1N34L 1PA6A 1B3AA 5IYDH 1IBKL 3F2BA 2EYJA 3ZYYX 5CR3A 1JJGA 1SYFA 2WAQB 3GTKH 3PIO3 2XN9C 1SSOA 3PO3G 3I4LA 1ML0D 3HEJA 5I4DA 2AWOA 1SNPA 1EYDA 3S1RB 1FGBD 1VQBA 2AWNA 2NVYB 3A54A 3K8AA 1K8OA 1VQFA 5FJ8H 5I6YA 1CQVA 1SE8A 3EBEA 5IT9E 1PTOB 2BH8A 2AKWB 4HAEA 2IX1A 2HIVA 3PO2H 1I6HB 4KD3A 1SNDA 2WINB 1XMQL 4DUYQ 4JI4L 1V9PA 5A2QE 3D6CA 3G48A 2JEBI 4LF5L 2A73B 2L55A 4AQYL 1PRTD 5DNFA 4KKSA 4X3TA 1IL8A 2GN5A 1QE6A 2K5HA 2PI2A 1QJOA 3R3OA 1IW7C 3DM3A 4RAUC 3NBHB 3GTLB 4JI3L 1LYLA 1SYEA 1EY7A 4FP5D 1WTOA 1L0YB 3MXNA 3E5SA 3P75A 2Z8LA 4HJ9A 1J5EL 4JI0L 4AYBE 4IUNA 3BDLA 1DXMA 1EL0A 3I4MH 1Y1WH 3SE0A 1IKMA 1K0SA 4C3IH 4NP5A 3I4NH 5J39A 4A3KG 2Y0SB 2PZTA 2V4DA 4IUUA 2ASBA 2HD3A 1SDFA 1V1OA 4LFAQ 3K7AH 4MTNA 4C3HH 3Q0AA 3M4PA 5H1SE 1VCIA 2BOSA 5CBAE 1EZ6A 3TQYA 3KBGA 5M3MH 3PSIA 2QGQA 1EFID 2LMCB 5C0XH 4LNQA 4LUVA 5A35A 4QF4A 4GZYC 3BZCA 4QL5A 3NQTA 4HR7B 2OQKA 3HOZH 1JR0D 1N9WA 4ME5A 5FLMH 1E2ZA 3HOXG 3T56B 3A7LA 3AU7A 3K6OA 1H9SB 4KTAA 2OCEA 3F2UA 2D5DA 2HDMA 1JT8A 1JC7A 1WI5A 1I6VC 4WORA 1KIXA 3OOCA 1TR5A 3RUZA 4A3KB 3WOEA 4EVOA 2Q8TA 1WTXA 1ET9A 2NN6I 3J81E 2RDFA 4QUFA 3J81i 4YHHQ 5EKKA 3GDEA 1L1OB 2EZVA 2VUMG 2NTSA 4HSVA 1QZHA 2F0OA 5CORA 1MJCA 1KL9A 3AEVA 2QA4A 1R4QB 1EU4A 2EYOA 4GOPB 4K5XA 2VQFL 2KCCA 5FLXE 4RCOA 2B2TA 2ZM6Q 1A2TA 1TQOA 3RLNA 1F9PA 1EU3A 5I6WA 4JVZA 1VQHA 2PMZB 5FK9C 2F0DA 2YU9H 1YJNA 2YTXA 4ID6A 4EQOA 5M5WB 3U9OA 4UY8C 4IFDJ 4R4TA 1JMCA 4KHPL 5M5YH 4A75A 3M3YB 4C3JG 2MUYA 4MNOA 1TS5A 3KUPA 2F3IA 4YCWA 4A3JH 4DV2L 3MEHA 4C1NI 5JEAH 4M8AA 1I5FA 1CUKA 4YIJA 4HN7A 2BE5C 3PUYA 2D62A 2RBMA 2JA9A 1AH9A 1MHWC 1TWAH 2Z6BA 4XQJA 2IY5B 3CC4A 3K59A 1K83H 1STNA 4A3GB 4C2MH 2DNCA 1Q81C 3K5MA 1PFMA 2CCZA 2RHQB 1OXSC 2KBNA 2PW7A 4OIJA 3FPUB 1LO5D 2UUCQ 4DR1L 1TWCH 4BY1B 3D0FA 3D4RA 2D0OA 3KLSX 1KQSA 1U5KA 3WOFA 4ZAIA 1UUPA 4IUTA 1OO9B 3S1NH 3RN5A 1YI2A 1CI3M 3CRLC 3RD4A 1IBLQ 3QB3A 3CAMA 5FO9B 3KLWA 4YWKA 4HEDA 1X3EA 2GVAA 2NZOA 3I8ZA 4RMFA 1HZBA 1KABA 1STYA 1HR0L 1PHJA 3S2HB 1FVIA 1K3RA 1Y1VH 4UHVA 5LMNQ 1CA6A 2GVBA 2MQHA 4NKLA 2PO4A 1DJRD 2WB1B 1VQPA 1LTBD 3D6WA 4LF6L 1S5BD 1HJPA 5M5XB 1E3PA 4PNYA 1SNMA 2E5LL 4A76A 3F2DA 4O0AA 5BR8Q 4J15A 4JBKA 2FFKB 5IP9G 1L1OC 3S14B 1EIGA 4AH6A 1CKNA 1O7LA 3ICEA 2NN6H 1C8CA 3ER0A 3CMEA 1A3VA 2X6GA 2HDLA 1EEFD 1SXTA 4GOPC 2E2JB 3GTPB 1X3PA 1LT3D 5CV6A 1BCPB 1V1PB 2MNAA 3CQZB 4UP8A 2IJ0A 4RGTA 3K5OA 2PQAB 4A3DG 4DAMA 1MSHA 1PH5A 1G2TA 1LABA 1E7ZA 1UWVA 1N8RC 4FXDA 1HTLD 3PCOB 3NQIA 3FKIH 1SNQA 5L37A 2XWBB 4QIWE 5LMUL 3EJIA 2EVBA 3OTOQ 3H3VH 3HOVH 2F0IA 3KJPA 3W2DA 2QCPX 3EROA 5M3FH 4BBSG 2A69D 4IURA 1PH9A 2MHVA 2F0MA 4JBWA 2L11A 1CSPA 1F2ZA 3PUZA 4HJ8A 3D4WA 4LFBL 2L15A 1IXRA 4A3MG 1LT5D 2VQEQ 2L12A 1F9SA 2K32A 3TREA 4LF7Q 3MA2B 2K04A 3CPWA 4IUQA 3TZUA 3OIQA 2QEXA 2UUBL 1HQRD 2JA8G 2CHBD 2F52A 5C6AA 4DV4L 3AFPA 3S16B 4XXEA 2PCFB 2JA7G 1AZPA 4KI0A 3CCQA 4ZRZA 2EDGA 1OXTA 4X62Q 1YHQA 1EYCA 2I07B 2WP8J 1TKWB 5E4WC 3I4MG 3HZXA 1VQNA 3S1QB 3KLRA 3L2PA 5JPMC 2HCCA 3I4NG 2J0TD 1MGSA 4RCNA 2MJ8A 2I5LX 1IHZA 1T9HA 5KYIA 1S72A 1HR0W 2Z4IA 4B3TL 4FO2A 5JJIA 3PO2B 4KN7C 1LTTD 4B3MQ 4NDXA 1XJVA 2Q2IA 1QB5D 2E76C 1H9KA 4A3IB 1BOSA 3SHLA 1A8VA 3BG3A 4A3FH 1B7YB 2ZXPA 4DV5Q 1XWEA 4KLKA 1BXTA 2LS01 3KF8B 1SR3A 2PNRC 1KRTA 5C0XG 5DM63 5C4JH 2MP1A 5LL6X 4JW0A 3BU2A 3HGBA 3U58A 2E2HB 4JPBW 2F4IA 2TMPA 4JI8Q 5JVG3 5DM73 3BDCA 5FLMG 4HIOA 3GTMH 1JB3A 2E2IH 2MO1A 5GAGC 2Q8IB 5GADC 4AYBB 4DF7A 2B2WC 4CDFC 1BCPC 5D65A 1Y1WB 5EPKA 3T53B 4NW2A 4CKBA 4GLXA 4C3IB 4JV5L 2FXQA 4X3UA 4EQPA 1E22A 4RA8A 4DK3C 3I4NB 1TS2A 3G6JB 2ID0A 2OTJA 3C2PA 3TS2A 4GKKQ 1SJED 2HQEA 2M00A 5IT9L 3W1BA 4A3LG 3HOYB 1X55A 3MVVA 1LT6D 4C3HB 3DWAA 3NK9A 4WRDA 2OEOA 2I46A 2ES2A 3UE1A 4XYQA 4JOIC 3SXHA 3AB9A 1DM0B 5M3MB 1L2FA 4DFAA 1K73C 5A2QL 2K5NA 2XRQD 3WDNA 1KLUD 2CWPA 1N33L 3J7AF 5ELDA 3TMEA 3BYTB 1MIUA 3HOZB 3G7LA 2QEJC 3OSOA 5IYBG 3T4AC 2EY6A 5EBCA 1QVCA 3GP7A 1Q86C 5GQOA 2N49A 2OWOA 1XNRL 1HUMA 4HTHA 1SFOH 3K80C 1C0AA 3P7JA 2F4VL 2QDLA 1N36L 1RJTA 5K36G 4H7BA 4B3RQ 2F1MA 4G7ZC 4LF9Q 4A3JG 1IBML 4UPAA 4X66L 2JP1A 4OWTB 4I7AA 3E0EA 2HT1A 4K5VA 1RKNA 2EPBA 2SNSA 2XGTA 2A5HA 3K5LA 4DAPA 2ZTDA 3FDTA 2AQ2B 3DMUA 1BCPF 3EVQA 1L0XB 5IGBA 2ICEC 1XMOQ 4RFBA 3J80c 4JI7Q 1VQ7A 1B50A 3J7A5 3MZ5A 1Q8IA 1WCMH 3STBD 2F0VA 2F0TA 3PUXA 1HUNA 2YU9B 1ESFA 4PG3A 4A3CG 2SDFA 1EWHA 1KXLA 5C4XG 1ZYRD 5ELNA 1EY0A 1AW7A 1SAPA 4KN4C 2RCFA 3AYHB 1DZ1A 4L63B 2C35B 1EOTA 5M5YB 4C3JH 1GUSA 4BA1I 1E1TA 5AJ3L 2V1CC 4NXML 4DV1Q 4OX9Q 3A74A 4A3JB 2A19A 3FVQA 1IZ6A 2PW5A 1FD7D 3H0GG 2F03A 4QY7A 1RDPD 1B3QA 4XQQA 1GKHA 3JAME 4FF4A 2I5MX 2K75A 4LK1C 3EFXD 3JAMi 1A0IA 4G7OC 1PH7A 1F2MA 2UXBL 4P74A 1K83B 2NUCA 4C2MB 2QF7A 4K0KQ 3LWUA 3HOUH 4RGNA 1XX8A 2R61A 2A6HD 4KJOA 2G5DA 4X6AH 3VDYA 2NN6G 3M9BA 1KAAA 4H13C 3BZDB 1TWCB 1JE5A 1A63A 3S1NB 1G51A 1EQTA 4B3SL 4HCEA 4DV0L 5C4HA 3SK4A 1OXVA 1QZGA 3CD6A 1JOOA 3JAMc 3FKIG 2VW9A 4XIGS 1XTDA 1UEAB 1EQVA 5IGFA 1H9JA 3T13A 1Y1VB 3I72A 2IHFA 3X3MA 1UE7A 2B3GA 4DR2Q 2FJ2A 4A93G 4OWXB 1KLGD 2R92G 5LL6S 2RSOA 5M3FG 4BWGB 3LX0A 4G7HC 1CT1D 3DUZA 4NXNL 1WTHA 4IQZA 1K8GA 1U4PA 1D5MC 2F0NA 3PF5A 4YY3L 4DV6Q 3RLFA 3Q6SA 1H95A 1JE4A 4FF2A 5JJKA 4OO1H 4JI6L 4KKUA 2RHSB 3VR3A 4FNFA 1SN8A 4IJLA 2AUKA 4DUZQ 4ULLA 3SK8A 1SE2A 3RR5A 4DV3L 4IFDI 2Q8RE 2B2VA 2MFIA 3NXWA 1S5CD 1G6ZA 3CP0A 4ZYSA 5I9PA 1PVOA 5JAVA 3HS0C 2QKIC 4QIWB 5I9OA 1Q46A 4TVAB 2JN4A 3N6RA 4JI1Q 1VQ5A 2VS1A 1OXXK 5EAYA 1BF4A 4P71A 2CH4W 4BBSH 1X9NA 1SMYC 4R4OA 2UU9L 3HOVB 4A3BB 1KDBA 5JJLA 4U673 1VQAA 4LUOA 4UP9A 4N9TA 2E75C 1EYGA 4MZ9A 3TS0A 2F3VA 3A8IE 4A3MH 1CSQA 1TWFH 4IPGA 5KEEA 2PZWA 3KFUA 1JICA 3CCMA 1ZXTA 4YWLA 4ILWA 4A3FG 2H4OA 1NMFA 4F7XA 2K03A 4GS3A 2PNHA 1JB7A 3QOJA 2JA8H 3CW2C 5IGGA 2JA7H 3GO5A 1XPRA 4RHSA 5EQ0A 3D3RA 4HMIA 4JBMA 1EIFA 1BVSA 3CPFA 5D3DA 3NWTA 1VQ9A 3PO3B 1I3QH 4S3SA 3KDFA 1X3FA 3QIAA 4QQBX 1KDCA 4RKLA 4LW1A 3ZJYC 5E4XA 4KMUC 1CZWA 4KY6A 1CZGA 1GUTA 3G4SA 4ZUJA 3OWEB 3HOWH 2R93H 2HUGA 2WV6D 3NELA 1Y14B 1AFPA 4UAIA 5CC4A 3VYRA 2RA4A 1V8QA 2F0HA 2KUMA 1JWSD 5IY0A 3A56A 1STGA 2ICIA 1D1IA 4LF4Q 1Q12A 1SMXA 1QUQB 3DEPA 3FPPA 2K6AA 1I94Q 2R6GA 2A8VA 2NVXH 4LFCQ 1PLFA 5EPLA 5C4JB 3UDIA 1DOMA 1B2TA 1KHIA 4MN3A 4DNTB 3BS1A 4DUYL 3GTMB 5IWAQ 2EYFA 3TZDA 5M9OA 3I55A 1IYVA 5C3EH 1V1QA 2WFWA 2XRSD 1SYCA 4XT1B 3H6MA 3IL8A 1OTCA 4A3LH 1Y69U 2Z1CA 2B2UC 1W6JA 3J7AV 1I4PA 2EYMA 1CKNB 1YNJC 1PH1A 5IE8A 4U68A 1VMPA 4AIMA 2NVTH 3K5NA 3H3VC 1X56A 1EY4A 1PTOC 3Q24A 2B63H 1EY8A 1AZQA 4I65A 1KDAA 1HZ9A 4ZK9B 5FKAC 4LFAL 1CKOA 5C0XJ 1ICFB 4O1NA 1WD0A 4DR5Q 1SE4A 1TWGB 1MJEA 4P73A 2CW0C 2MPMA 5C44G 5IYBH 1STBA 3UDGA 3HOXB 3H91A 3ITPA 1BQQT 1WCMG 1SRUA 4NPSA 4R8NA 4DR6Q 2K50A 1G6PA 1K9MC 2IT1A 4JI2Q 1G8ZD 2OF1A 2A1AA 2DY7A 1EOVA 4BS9A 1KAWA 2ZJRA 1YZ6A 2E74C 4G4KA 1SFOB 2CVRA 2ZXOA 3URYA 5HGTA 5EBDA 5K36H 5KNDA 2I0QA 3RMHA 3N52A 3TBIB 4APVA 2VUMB 3VA5A 5C5MA 1F2YA 3SR1A 2K5DA 2R7FA 2Z6KC 4A3EH 2PI2E 2E2DC 5C5LA 4PZ8A 1S4ZA 3VYUA 3DLLA 4YHHL 3H94A 3HOUG 1ILPA 4EQNA 1HH2P 3HRZC 2JA5G 4R4IA 4A3CH 4P75A 1IW7D 5C4XH 4EX5A 2WIIB 4BBRG 5E1FA 3S17H 3MEFA 1VQDA 1O7ZA 4RGMA 2EXZA 4IJHA 1HNXQ 4DK0A 3VYTA 4GNXB 1Z47A 1PTOF 4C3JB 4GKJQ 4OL7A 2ZM6L 2OXPA 4R4CA 1QNKA 3ERQA 4JYAQ 4RGOS 2LXJA 3F1ZA 5LMUQ 1YITA 3H0GH 3OPOA 1C48A 2YYZA 5JEAJ 1EWIA 3GTJB 4J1MA 4HIDA 2F0GA 3CCJA 3K58A 1EY5A 2A6EC 4LUZA 4IPCA 1NCVA 1LUZA 2KJXA 4PMCA 1ONLA 3VA7A 1DCZA 1H9SA 5KYLA 1SEBD 3IFDA 4JK1C 5COYA 5ELOA 4LF8Q 3UDFA 2F0WA 4DK6C 2NZHA 1SBBB 4C1NK 4BXXH 4OO1G 1X65A 3PF4A 3EA6A 1S40A 1PFBA 3PV0A 1YJ9A 3I56A 5CYUA 1PH3A 3SVMA 1L1OA 2HIXA 4V0BA 1EEID 4L5RC 3CCLA 1RCVD 1GHJA 1TU2B 1Z7TA 2TSSA 2UUCL 2F0PA 2J7ZA 3CCSA 2B39A 3MFYA 1ET6A 4LAAA 1GOZA 3I90A 1K28A 4A93H 2NB0A 2R92H 4B9WA 3NUCA 1IBLL 3OW2A 1YNJD 1SYBA 5C4ZA 1Y8PB 5F2DA 1TWHH 3UDXA 2NVYH 1PTOD 1NR4A 3RZDH 1RTNA 3D4DA 5ELEA 5ELFA 3MAQA 4XDXA 5LMNL 3CHBD 2BCOA 2KCTA 2R7DA 1EQQA 4DV7Q 4HSPA 1E2WA 1LTRD 2EXDA 4A3DB 1YHBA 2AQ3B 2VL6A 5BR8L 3T1YQ 2F0EA 1V43A 2F3WA 3M4OH 1B1ZA 3GTKB 4GLAC 3Q8DA 4MHEA 1EFWA 4TKOB 4ZKCB 3TN2A 5GROA 4CKEA 1IL2A 1YNNC 4DAYA 2B8GA 1HNWQ 3GTLH 5J1ZA 4GNXC 1Q82C 2YTVA 4BBSB 2RKSA 1H9MA 2DN8A 3M85A 1D5XC 1TS4A 2K1BA 2BE5D 3HOWG 2R93G 4K6LA 4A3MB 4K14A 1ZEQX 5IGDA 4ME3A 4KHZA 1TWFB 3PUWA 4Z9CB 1TIID 3OTOL 2CFMA 1Z6HA 4X64Q 3CRKC 1VQ8A 3DXJC 1MD2D 4CJ2C 1WTVA 2JA8B 4DR7Q
chains in the Genus database with same CATH topology
1A0IA 2ZJQA 4C3IH 3PGZA 2Z0SA 1PH7A 2UXBL 3I4NH 4P74A 4FDBA 4A3KG 2ASBA 1QUQA 1UEBA 4DPGA 1E24A 4K0KQ 3EN2A 3GTGH 4LFAQ 3K7AH 2JA6H 2VQEL 3HOUH 4DR6L 1QVGA 2N3SA 4MTNA 4JI2L 4LF7L 2ATWA 4C3HH 4X6AH 3VDYA 2NN6G 3M9BA 3M4PA 5H1SE 1VCIA 5C3EG 1YIJA 2EIFA 1VQEA 3LGJA 2JE6I 3TQYA 1JE5A 3A5UA 1EUJA 5M3MH 4JI5Q 2BH2A 1O7IA 4LFBQ 1A63A 3PSIA 1FJGQ 1G51A 2QGQA 1PYBA 4HJ5A 4B3SL 1D7QA 4DV0L 3S2DH 1PV4A 1GM5A 4LNQA 3D31A 4LUVA 1OXVA 2UUAQ 4IFDG 2JK8A 1QZGA 3CD6A 3BZCA 4QL5A 4X62L 3JAMc 3FKIG 2VW9A 4XIGS 4DR4Q 1XTDA 2OQKA 3HOZH 2UUBQ 4GN4B 1FGUA 4JBJA 4ALPA 1N9WA 4DV4Q 2K4KA 1XNQQ 5FLMH 2D0PA 2UXCQ 2IHFA 3HOXG 3S15H 3HKSA 1UE7A 2B3GA 4DR2Q 3I2ZA 2B63G 2OCEA 4PZ6A 2B29A 4POGA 1ASYA 3T1HQ 1JT8A 1BBWA 4A93G 4OWXB 1WI5A 1N32Q 2R92G 4H02A 4YWMA 4HJ7A 3K7UC 2YTYA 5M3FG 1KIXA 1VQKA 1NE3A 4GOPA 4NXNL 4Y7NH 4B3ML 1K8GA 2H5XA 3PF5A 4YY3L 3ULLA 3RLFA 5LMNW 1W3SA 4DV6Q 3WWVA 2NN6I 2I5HA 3J80i 3J81i 3KOJA 1J6QA 4YHHQ 4DV5L 1H95A 2HQLA 3GDEA 5JJKA 2WAQE 1L1OB 3U4ZA 4GN5A 2VUMG 1HNXL 5IYDG 1MKHA 4B3TQ 4RG1A 1QZHA 4JI6L 1MJCA 2AMCB 4GKJL 3S1RH 1KL9A 2RHSB 1VS0A 3AEVA 1HNZQ 4BY7G 1SN8A 4IJLA 2QA4A 4JYAL 2IHEA 4DUZQ 4DV3L 4IFDI 3RR5A 4GOPB 1KC8C 5IYCG 2VQFL 5M5WH 2MFIA 5FJ8G 4A3BH 1JJ2A 2K52A 4R1JA 2ZM6Q 3CP0A 3ULPA 1PVOA 3RLNA 1I6HH 3G71A 5IP7G 1Q46A 4TVAB 1VQHA 4HJAA 4PZ7A 4WJ4A 2YU9H 3PO2G 1YJNA 2YTXA 4JI1Q 1VQ5A 1GO3E 2VS1A 1S3OA 4WJ3M 1OXXK 1RL2A 2LSSA 4P71A 5EAYA 5HGQA 4A3EG 1P16A 1VQLA 4UY8C 4BBSH 4L5SA 4A3IG 1X9NA 4R4OA 2UU9L 1K0RA 3HKZE 4R4TA 2R7ZG 4GKKL 5JJLA 4LWCA 3UE0A 4LF8L 1VQAA 4LUOA 2VY3A 4UP9A 5C44H 5M5YH 1JMCA 4A75A 4KHPL 1EYGA 4MZ9A 3TS0A 4JV5Q 4O2DA 4A3MH 4MNOA 3A0JA 3STBC 2UXDQ 1CSQA 2F3IA 1TWFH 3A5ZB 4IPGA 4YCWA 3I4OA 4A3JH 3KFUA 4DV2L 3CCMA 4YWLA 4A3FG 2VNUD 1I5FA 1CUKA 3PO3H 4X65Q 1NMFA 2JEAI 3PUYA 1DGSA 2PNHA 2D62A 4GS3A 1JB7A 1IYJB 2OQ0A 2JA8H 2JA9A 3CW2C 4AYBG 1AH9A 1PYSB 1TWAH 1SROA 2LXKA 4POFA 2IY5B 3CC4A 2JA7H 4Y52H 1Y1WG 3GO5A 1K83H 1XPRA 4DR3Q 2EQSA 2Y0SE 4C2MH 1WJJA 1WOCA 4JBMA 1Q81C 1EIFA 1BVSA 3CPFA 4GNXA 1VQ9A 1I3QH 2CCZA 2RHQB 1OXSC 1N33Q 4TQUS 2JA6G 2KBNA 3KDFA 1X3FA 2ALYB 5J3BA 2XTIA 4QQBX 2UUCQ 1D8LA 4LW1A 3ZJYC 4DR1L 3PUVA 3HOYG 1TWCH 3D0FA 4L5TA 1W2BA 3S2HH 2VZAA 2D0OA 3RNUA 1KQSA 1AE2A 1U5KA 4IPDA 3S1NH 1EIYB 4NB3A 3RN5A 2HHHQ 5M3MG 1YI2A 4UP7A 3G4SA 1IBLQ 4B3RL 3CAMA 1A62A 3CF5A 3MXNB 4LF9L 3KLWA 4YWKA 1R9TH 3HOWH 1X3EA 2GVAA 3NELA 2NZOA 2JA5H 1XNRQ 2R93H 1WFQA 1Y14B 3CXCA 2KHJA 1HZBA 4RMFA 5M5XH 2IX0A 1VQMA 1PHJA 1HR0L 1NMGA 4BXXG 4BBRH 1FVIA 4DV7L 1N36Q 2F4VQ 2ZTEA 1K3RA 5IY0A 1N34Q 3ERSX 1Y1VH 2JJQA 3HFZB 4L5QA 1C7YA 3K0XA 5LMNQ 3T1YL 4LF4Q 2GVBA 3HOZG 1Q12A 1IBKQ 3S14H 2MQHA 3GTQH 1SMXA 1QUQB 1IBMQ 1G291 4YCUA 4X66Q 1XMOL 1VQPA 3E9IA 2R6GA 1I94Q 4LF6L 2NVXH 2A8VA 4JI7L 1HJPA 3RZOH 1E3PA 2N78A 4LFCQ 2E5LL 2MO0A 4A76A 3KYHC 4YCVA 3UDIA 3F2DA 4O0AA 1UE6A 2PQAA 4A3KH 1KHIA 5BR8Q 4J15A 4JBKA 5IP9G 3G6EA 1HNWL 1L1OC 3CQZH 2CWAA 2K14A 4DUYL 4OXPA 1CKNA 4AH6A 5IWAQ 3ICEA 1X6OA 1X54A 3I55A 1TXYA 2KENA 5C3EH 1V1QA 3ER0A 3B6YA 3CMEA 1CKMA 2WAQG 2WFWA 1KD1C 1Q7YC 4GOPC 4BA2I 4IOAA 1UE1A 1YVCA 4JOIA 1XMQQ 2DUDA 4OONA 1OTCA 2MNAA 2Q2TA 2ZTCA 4JI4Q 4UP8A 1Z9FA 4A3LH 2PQAB 4A3DG 1EQRA 4DAMA 4DV1L 2E8GA 4OX9L 3PIPA 1PH5A 1NTGA 1E7ZA 1UWVA 4X64L 1N8RC 4LF5Q 3PCOB 4JCVE 4AQYQ 1NY4A 1CKNB 3FKIH 4JC0A 1B8AA 1PH1A 1OXUA 1TWGH 3BJUA 4QGUA 5HY6A 3TRZA 5IE8A 4DR7L 5AJ3Q 4QIWE 4AIMA 5LMUL 2NVTH 3HOXH 4NXMQ 4HIKA 1X56A 4JI3Q 2PMZE 2B63H 3OTOQ 4JI8L 1YBYA 1HZ9A 1E1OA 4K0KL 1AE3A 3H3VH 1J5EQ 1YHAA 1VQOA 1CKOA 4LFAL 3HOVH 4JI0Q 5C0XJ 3PIOA 3KJPA 1LTLA 5M3FH 4BBSG 4DR5Q 1MJEA 4P73A 3M3YH 1Q1BA 1PH9A 5C44G 5IYBH 3UDGA 2UXBQ 4PMWA 1VQGA 4JBWA 4QJFA 1VQ4A 1CSPA 3GTOH 4JI5L 3PUZA 1WCMG 3E9HA 4HJ8A 4LFBL 1SRUA 2L15A 4GLVB 1IXRA 4NPSA 4A3MG 3S16H 1FJGL 2VQEQ 4DR6Q 2VUMH 2K50A 1G6PA 1K9MC 2IT1A 4JI2Q 1UE5A 3BZKA 3TREA 2A1AA 1K8AC 4LF7Q 4OO1I 4IFDJ 1EOVA 3J81j 1X3GA 1KAWA 5JEAG 2ZJRA 1YZ6A 2UUAL 3CPWA 2CKZB 1QVFA 4DNIA 4DR4L 3TEHB 2QEXA 2UUBL 2JA8G 2I0QA 3RN2A 2Q2HA 1YEZA 2F52A 4DV4L 1RIPA 3S1QH 4B3SQ 3AFPA 1XNQL 4A3GH 1C9OA 3JAMi 3F8TA 4DV0Q 2UXCL 4APVA 1WYDA 2JA7G 3AFQA 4DR2L 4KI0A 2Y0SG 3I7FA 3CCQA 1OXTA 4X62Q 1YHQA 3T1HL 4EQ5A 4JG2A 1SLJA 1N32L 2AHOB 1VQJA 2R7FA 5IP7H 2Z6KC 2BA1A 2WP8J 4BY1H 1PH8A 3I4MG 1VQCA 1VQNA 4A3EH 3W5OA 3L2PA 1HZAA 2PI2E 4A3IH 1PFSA 2R7ZH 3I4NG 1KRSA 2DGYA 4DV6L 4R4QA 4DR7Q 3CC7A 4PZ8A 2I5LX 1T9HA 3DLLA 4YHHL 3M4QA 3HOUG 1S72A 1JJCB 1HR0W 4DKAC 1HH2P 4B3TL 5JJIA 5DLQE 4NXNQ 3W1GA 2JA5G 1GVPA 4R4IA 4B3MQ 4P75A 4A3CH 1XJVA 5C4XH 2Q2IA 4XTCS 2RF4A 4EX5A 4YY3Q 1HNZL 3CC2A 2KCMA 1A8VA 4BBRG 4A3FH 1BBUA 2E2HH 3S17H 3KF6A 4DUZL 3MEFA 1B7YB 4DV5Q 1VQ6A 1VQDA 1HZCA 1Y1VG 4KLKA 4IJHA 1HNXQ 3M7NA 2WB1E 3KF8B 1SR3A 3GTJH 1Z47A 4GNXB 1KRTA 5C0XG 4JI6Q 3JC66 4GKJQ 2BA0A 3EIVA 5IT9c 5C4JH 2ZM6L 3CMAA 3KDFB 4R4CA 3BU2A 4JYAQ 2LXJA 3F1ZA 5LMUQ 4P72A 3U58A 1B70B 4DV3Q 1YITA 3H0GH 3L0OA 4JI1L 4JI8Q 5FLMG 3GTMH 2VQFQ 4HIOA 1I50H 3S1MH 3IRBA 1BKBA 2MO1A 2YYZA 1L0WA 5JEAJ 1EWIA 5GAGC 5GADC 5GAEC 2E2IH 4HIDA 3KF6B 2NVQH 3CCJA 2N8NA 3U4VA 1XPOA 1Q8KA 3HOYH 2K5VA 4LUZA 4IPCA 2RCNA 3SGIA 1LUZA 2E2JH 3NEMA 3GTPH 4GLXA 4JV5L 2FXQA 1E22A 4DK3C 2UXDL 1NBWA 2OTJA 2ID0A 3J7ZC 2UU9Q 3TS2A 4GKKQ 5ELOA 4LF8Q 3UDFA 3W1BA 4A3LG 4KHPQ 4DK6C 2NZHA 1X55A 4X65L 4HIMA 4BXXH 4OO1G 1X65A 3CCEA 2ES2A 3UE1A 3PF4A 1PH2A 1S40A 4JOIC 3PV0A 1M1KC 1XPUA 1L2FA 1M90C 1YJ9A 3I56A 1VQIA 4DV2Q 1K73C 4DR3L 1PH3A 2K5NA 5C0XI 3L7ZC 1L1OA 1LM0A 3CCVA 2HIXA 4L5RC 3S24A 3CCLA 1GD7A 2CWPA 1N33L 3HOVG 4A3BG 1MIUA 1PH4A 4IO9A 2UUCL 2CQOA 5IP9H 3CCSA 1YJWA 3U50C 4A4IA 5IYBG 1P8LA 4A93H 1QVCA 1Q86C 2HHHL 2R92H 3AQQA 5GQOA 1IBLL 3HKZG 3OW2A 2N49A 2OWOA 3ULJA 4IPHA 1XNRL 4DR1Q 1SFOH 3K80C 1FL0A 4IOCA 3KJOA 1C0AA 2Q2UA 2ZJPA 2F4VL 3CCRA 1TWHH 1N36L 3UDXA 4A3DH 2NVYH 3FHWA 1N34L 1PA6A 3RZDH 4LF4L 5K36G 5LMNL 4B3RQ 5IYDH 3NENA 1Q1EA 3F2BA 1IBKL 4LF9Q 4A3GG 4A3JG 1IBML 2KCTA 1JJGA 3GTKH 2OTLA 4UPAA 3H15A 4X66L 4OWTB 2YV5A 1I94L 4BY7H 3E0EA 4OWWB 1HR0Q 1ASZA 2R7DA 2HT1A 3PO3G 2AWOA 1EQQA 4LFCL 4DV7Q 3FP9A 2XGTA 1VQBA 2EXDA 2AWNA 2ZTDA 3K8AA 1YHBA 4DR5L 5IYCH 1VQFA 2VL6A 5FJ8H 5BR8L 3T1YQ 4BY1G 1V43A 2JQOA 3M4OH 3H3VI 3CCUA 1XMOQ 1SE8A 5IWAL 3K81C 3EBEA 4GLAC 3J80c 3J81c 4LF6Q 1YNXA 3Q8DA 2BH8A 4JI7Q 1EFWA 2E5LQ 2AKWB 4GN3B 5GROA 1VQ7A 2HIVA 2IX1A 1IL2A 3J7A5 3PO2H 5E7NA 1WCMH 3STBD 1NJIC 3GD7A 3PUXA 1HNWQ 1XMQL 3OYYA 4DUYQ 3GTLH 4PG3A 4GNXC 4JI4L 1U0LA 1V9PA 4A3CG 1KXLA 5C4XG 5ELNA 1Q82C 2YTVA 1PH6A 3G48A 2JEBI 3AYHB 3M85A 4LF5L 2C35B 2KHIA 4AQYL 4C3JH 3HOWG 5FLXc 2R93G 2WB1G 2GN5A 2K5HA 4BA1I 1E1TA 2PI2A 2Z6KA 5AJ3L 4ME3A 3DM3A 2V1CC 3NBHB 4KHZA 4JI3L 4NXML 1LYLA 3PUWA 4DAYB 4DV1Q 4OX9Q 3A74A 3OTOL 2CFMA 3F2CA 2A19A 4X64Q 1VQ8A 1IZ6A 4HJ9A 3H0GG 1J5EL 4QY7A 4JI0L 4AYBE 5GAHC 3RLOA 1GKHA 2I5MX 2K75A 3I4MH 1Y1WH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0I A;  2ZJQ A;  4C3I H;  3PGZ A;  2Z0S A;  1PH7 A;  2UXB L;  3I4N H;  4P74 A;  4FDB A;  4A3K G;  2ASB A;  1QUQ A;  1UEB A;  4DPG A;  1E24 A;  4K0K Q;  3EN2 A;  3GTG H;  4LFA Q;  3K7A H;  2JA6 H;  2VQE L;  3HOU H;  4DR6 L;  1QVG A;  2N3S A;  4MTN A;  4JI2 L;  4LF7 L;  2ATW A;  4C3H H;  4X6A H;  3VDY A;  2NN6 G;  3M9B A;  3M4P A;  5H1S E;  1VCI A;  5C3E G;  1YIJ A;  2EIF A;  1VQE A;  3LGJ A;  2JE6 I;  3TQY A;  1JE5 A;  3A5U A;  1EUJ A;  5M3M H;  4JI5 Q;  2BH2 A;  1O7I A;  4LFB Q;  1A63 A;  3PSI A;  1FJG Q;  1G51 A;  2QGQ A;  1PYB A;  4HJ5 A;  4B3S L;  1D7Q A;  4DV0 L;  3S2D H;  1PV4 A;  1GM5 A;  4LNQ A;  3D31 A;  4LUV A;  1OXV A;  2UUA Q;  4IFD G;  2JK8 A;  1QZG A;  3CD6 A;  3BZC A;  4QL5 A;  4X62 L;  3JAM c;  3FKI G;  2VW9 A;  4XIG S;  4DR4 Q;  1XTD A;  2OQK A;  3HOZ H;  2UUB Q;  4GN4 B;  1FGU A;  4JBJ A;  4ALP A;  1N9W A;  4DV4 Q;  2K4K A;  1XNQ Q;  5FLM H;  2D0P A;  2UXC Q;  2IHF A;  3HOX G;  3S15 H;  3HKS A;  1UE7 A;  2B3G A;  4DR2 Q;  3I2Z A;  2B63 G;  2OCE A;  4PZ6 A;  2B29 A;  4POG A;  1ASY A;  3T1H Q;  1JT8 A;  1BBW A;  4A93 G;  4OWX B;  1WI5 A;  1N32 Q;  2R92 G;  4H02 A;  4YWM A;  4HJ7 A;  3K7U C;  2YTY A;  5M3F G;  1KIX A;  1VQK A;  1NE3 A;  4GOP A;  4NXN L;  4Y7N H;  4B3M L;  1K8G A;  2H5X A;  3PF5 A;  4YY3 L;  3ULL A;  3RLF A;  5LMN W;  1W3S A;  4DV6 Q;  3WWV A;  2NN6 I;  2I5H A;  3J80 i;  3J81 i;  3KOJ A;  1J6Q A;  4YHH Q;  4DV5 L;  1H95 A;  2HQL A;  3GDE A;  5JJK A;  2WAQ E;  1L1O B;  3U4Z A;  4GN5 A;  2VUM G;  1HNX L;  5IYD G;  1MKH A;  4B3T Q;  4RG1 A;  1QZH A;  4JI6 L;  1MJC A;  2AMC B;  4GKJ L;  3S1R H;  1KL9 A;  2RHS B;  1VS0 A;  3AEV A;  1HNZ Q;  4BY7 G;  1SN8 A;  4IJL A;  2QA4 A;  4JYA L;  2IHE A;  4DUZ Q;  4DV3 L;  4IFD I;  3RR5 A;  4GOP B;  1KC8 C;  5IYC G;  2VQF L;  5M5W H;  2MFI A;  5FJ8 G;  4A3B H;  1JJ2 A;  2K52 A;  4R1J A;  2ZM6 Q;  3CP0 A;  3ULP A;  1PVO A;  3RLN A;  1I6H H;  3G71 A;  5IP7 G;  1Q46 A;  4TVA B;  1VQH A;  4HJA A;  4PZ7 A;  4WJ4 A;  2YU9 H;  3PO2 G;  1YJN A;  2YTX A;  4JI1 Q;  1VQ5 A;  1GO3 E;  2VS1 A;  1S3O A;  4WJ3 M;  1OXX K;  1RL2 A;  2LSS A;  4P71 A;  5EAY A;  5HGQ A;  4A3E G;  1P16 A;  1VQL A;  4UY8 C;  4BBS H;  4L5S A;  4A3I G;  1X9N A;  4R4O A;  2UU9 L;  1K0R A;  3HKZ E;  4R4T A;  2R7Z G;  4GKK L;  5JJL A;  4LWC A;  3UE0 A;  4LF8 L;  1VQA A;  4LUO A;  2VY3 A;  4UP9 A;  5C44 H;  5M5Y H;  1JMC A;  4A75 A;  4KHP L;  1EYG A;  4MZ9 A;  3TS0 A;  4JV5 Q;  4O2D A;  4A3M H;  4MNO A;  3A0J A;  3STB C;  2UXD Q;  1CSQ A;  2F3I A;  1TWF H;  3A5Z B;  4IPG A;  4YCW A;  3I4O A;  4A3J H;  3KFU A;  4DV2 L;  3CCM A;  4YWL A;  4A3F G;  2VNU D;  1I5F A;  1CUK A;  3PO3 H;  4X65 Q;  1NMF A;  2JEA I;  3PUY A;  1DGS A;  2PNH A;  2D62 A;  4GS3 A;  1JB7 A;  1IYJ B;  2OQ0 A;  2JA8 H;  2JA9 A;  3CW2 C;  4AYB G;  1AH9 A;  1PYS B;  1TWA H;  1SRO A;  2LXK A;  4POF A;  2IY5 B;  3CC4 A;  2JA7 H;  4Y52 H;  1Y1W G;  3GO5 A;  1K83 H;  1XPR A;  4DR3 Q;  2EQS A;  2Y0S E;  4C2M H;  1WJJ A;  1WOC A;  4JBM A;  1Q81 C;  1EIF A;  1BVS A;  3CPF A;  4GNX A;  1VQ9 A;  1I3Q H;  2CCZ A;  2RHQ B;  1OXS C;  1N33 Q;  4TQU S;  2JA6 G;  2KBN A;  3KDF A;  1X3F A;  2ALY B;  5J3B A;  2XTI A;  4QQB X;  2UUC Q;  1D8L A;  4LW1 A;  3ZJY C;  4DR1 L;  3PUV A;  3HOY G;  1TWC H;  3D0F A;  4L5T A;  1W2B A;  3S2H H;  2VZA A;  2D0O A;  3RNU A;  1KQS A;  1AE2 A;  1U5K A;  4IPD A;  3S1N H;  1EIY B;  4NB3 A;  3RN5 A;  2HHH Q;  5M3M G;  1YI2 A;  4UP7 A;  3G4S A;  1IBL Q;  4B3R L;  3CAM A;  1A62 A;  3CF5 A;  3MXN B;  4LF9 L;  3KLW A;  4YWK A;  1R9T H;  3HOW H;  1X3E A;  2GVA A;  3NEL A;  2NZO A;  2JA5 H;  1XNR Q;  2R93 H;  1WFQ A;  1Y14 B;  3CXC A;  2KHJ A;  1HZB A;  4RMF A;  5M5X H;  2IX0 A;  1VQM A;  1PHJ A;  1HR0 L;  1NMG A;  4BXX G;  4BBR H;  1FVI A;  4DV7 L;  1N36 Q;  2F4V Q;  2ZTE A;  1K3R A;  5IY0 A;  1N34 Q;  3ERS X;  1Y1V H;  2JJQ A;  3HFZ B;  4L5Q A;  1C7Y A;  3K0X A;  5LMN Q;  3T1Y L;  4LF4 Q;  2GVB A;  3HOZ G;  1Q12 A;  1IBK Q;  3S14 H;  2MQH A;  3GTQ H;  1SMX A;  1QUQ B;  1IBM Q;  1G29 1;  4YCU A;  4X66 Q;  1XMO L;  1VQP A;  3E9I A;  2R6G A;  1I94 Q;  4LF6 L;  2NVX H;  2A8V A;  4JI7 L;  1HJP A;  3RZO H;  1E3P A;  2N78 A;  4LFC Q;  2E5L L;  2MO0 A;  4A76 A;  3KYH C;  4YCV A;  3UDI A;  3F2D A;  4O0A A;  1UE6 A;  2PQA A;  4A3K H;  1KHI A;  5BR8 Q;  4J15 A;  4JBK A;  5IP9 G;  3G6E A;  1HNW L;  1L1O C;  3CQZ H;  2CWA A;  2K14 A;  4DUY L;  4OXP A;  1CKN A;  4AH6 A;  5IWA Q;  3ICE A;  1X6O A;  1X54 A;  3I55 A;  1TXY A;  2KEN A;  5C3E H;  1V1Q A;  3ER0 A;  3B6Y A;  3CME A;  1CKM A;  2WAQ G;  2WFW A;  1KD1 C;  1Q7Y C;  4GOP C;  4BA2 I;  4IOA A;  1UE1 A;  1YVC A;  4JOI A;  1XMQ Q;  2DUD A;  4OON A;  1OTC A;  2MNA A;  2Q2T A;  2ZTC A;  4JI4 Q;  4UP8 A;  1Z9F A;  4A3L H;  2PQA B;  4A3D G;  1EQR A;  4DAM A;  4DV1 L;  2E8G A;  4OX9 L;  3PIP A;  1PH5 A;  1NTG A;  1E7Z A;  1UWV A;  4X64 L;  1N8R C;  4LF5 Q;  3PCO B;  4JCV E;  4AQY Q;  1NY4 A;  1CKN B;  3FKI H;  4JC0 A;  1B8A A;  1PH1 A;  1OXU A;  1TWG H;  3BJU A;  4QGU A;  5HY6 A;  3TRZ A;  5IE8 A;  4DR7 L;  5AJ3 Q;  4QIW E;  4AIM A;  5LMU L;  2NVT H;  3HOX H;  4NXM Q;  4HIK A;  1X56 A;  4JI3 Q;  2PMZ E;  2B63 H;  3OTO Q;  4JI8 L;  1YBY A;  1HZ9 A;  1E1O A;  4K0K L;  1AE3 A;  3H3V H;  1J5E Q;  1YHA A;  1VQO A;  1CKO A;  4LFA L;  3HOV H;  4JI0 Q;  5C0X J;  3PIO A;  3KJP A;  1LTL A;  5M3F H;  4BBS G;  4DR5 Q;  1MJE A;  4P73 A;  3M3Y H;  1Q1B A;  1PH9 A;  5C44 G;  5IYB H;  3UDG A;  2UXB Q;  4PMW A;  1VQG A;  4JBW A;  4QJF A;  1VQ4 A;  1CSP A;  3GTO H;  4JI5 L;  3PUZ A;  1WCM G;  3E9H A;  4HJ8 A;  4LFB L;  1SRU A;  2L15 A;  4GLV B;  1IXR A;  4NPS A;  4A3M G;  3S16 H;  1FJG L;  2VQE Q;  4DR6 Q;  2VUM H;  2K50 A;  1G6P A;  1K9M C;  2IT1 A;  4JI2 Q;  1UE5 A;  3BZK A;  3TRE A;  2A1A A;  1K8A C;  4LF7 Q;  4OO1 I;  4IFD J;  1EOV A;  3J81 j;  1X3G A;  1KAW A;  5JEA G;  2ZJR A;  1YZ6 A;  2UUA L;  3CPW A;  2CKZ B;  1QVF A;  4DNI A;  4DR4 L;  3TEH B;  2QEX A;  2UUB L;  2JA8 G;  2I0Q A;  3RN2 A;  2Q2H A;  1YEZ A;  2F52 A;  4DV4 L;  1RIP A;  3S1Q H;  4B3S Q;  3AFP A;  1XNQ L;  4A3G H;  1C9O A;  3JAM i;  3F8T A;  4DV0 Q;  2UXC L;  4APV A;  1WYD A;  2JA7 G;  3AFQ A;  4DR2 L;  4KI0 A;  2Y0S G;  3I7F A;  3CCQ A;  1OXT A;  4X62 Q;  1YHQ A;  3T1H L;  4EQ5 A;  4JG2 A;  1SLJ A;  1N32 L;  2AHO B;  1VQJ A;  2R7F A;  5IP7 H;  2Z6K C;  2BA1 A;  2WP8 J;  4BY1 H;  1PH8 A;  3I4M G;  1VQC A;  1VQN A;  4A3E H;  3W5O A;  3L2P A;  1HZA A;  2PI2 E;  4A3I H;  1PFS A;  2R7Z H;  3I4N G;  1KRS A;  2DGY A;  4DV6 L;  4R4Q A;  4DR7 Q;  3CC7 A;  4PZ8 A;  2I5L X;  1T9H A;  3DLL A;  4YHH L;  3M4Q A;  3HOU G;  1S72 A;  1JJC B;  1HR0 W;  4DKA C;  1HH2 P;  4B3T L;  5JJI A;  5DLQ E;  4NXN Q;  3W1G A;  2JA5 G;  1GVP A;  4R4I A;  4B3M Q;  4P75 A;  4A3C H;  1XJV A;  5C4X H;  2Q2I A;  4XTC S;  2RF4 A;  4EX5 A;  4YY3 Q;  1HNZ L;  3CC2 A;  2KCM A;  1A8V A;  4BBR G;  4A3F H;  1BBU A;  2E2H H;  3S17 H;  3KF6 A;  4DUZ L;  3MEF A;  1B7Y B;  4DV5 Q;  1VQ6 A;  1VQD A;  1HZC A;  1Y1V G;  4KLK A;  4IJH A;  1HNX Q;  3M7N A;  2WB1 E;  3KF8 B;  1SR3 A;  3GTJ H;  1Z47 A;  4GNX B;  1KRT A;  5C0X G;  4JI6 Q;  3JC6 6;  4GKJ Q;  2BA0 A;  3EIV A;  5IT9 c;  5C4J H;  2ZM6 L;  3CMA A;  3KDF B;  4R4C A;  3BU2 A;  4JYA Q;  2LXJ A;  3F1Z A;  5LMU Q;  4P72 A;  3U58 A;  1B70 B;  4DV3 Q;  1YIT A;  3H0G H;  3L0O A;  4JI1 L;  4JI8 Q;  5FLM G;  3GTM H;  2VQF Q;  4HIO A;  1I50 H;  3S1M H;  3IRB A;  1BKB A;  2MO1 A;  2YYZ A;  1L0W A;  5JEA J;  1EWI A;  5GAG C;  5GAD C;  5GAE C;  2E2I H;  4HID A;  3KF6 B;  2NVQ H;  3CCJ A;  2N8N A;  3U4V A;  1XPO A;  1Q8K A;  3HOY H;  2K5V A;  4LUZ A;  4IPC A;  2RCN A;  3SGI A;  1LUZ A;  2E2J H;  3NEM A;  3GTP H;  4GLX A;  4JV5 L;  2FXQ A;  1E22 A;  4DK3 C;  2UXD L;  1NBW A;  2OTJ A;  2ID0 A;  3J7Z C;  2UU9 Q;  3TS2 A;  4GKK Q;  5ELO A;  4LF8 Q;  3UDF A;  3W1B A;  4A3L G;  4KHP Q;  4DK6 C;  2NZH A;  1X55 A;  4X65 L;  4HIM A;  4BXX H;  4OO1 G;  1X65 A;  3CCE A;  2ES2 A;  3UE1 A;  3PF4 A;  1PH2 A;  1S40 A;  4JOI C;  3PV0 A;  1M1K C;  1XPU A;  1L2F A;  1M90 C;  1YJ9 A;  3I56 A;  1VQI A;  4DV2 Q;  1K73 C;  4DR3 L;  1PH3 A;  2K5N A;  5C0X I;  3L7Z C;  1L1O A;  1LM0 A;  3CCV A;  2HIX A;  4L5R C;  3S24 A;  3CCL A;  1GD7 A;  2CWP A;  1N33 L;  3HOV G;  4A3B G;  1MIU A;  1PH4 A;  4IO9 A;  2UUC L;  2CQO A;  5IP9 H;  3CCS A;  1YJW A;  3U50 C;  4A4I A;  5IYB G;  1P8L A;  4A93 H;  1QVC A;  1Q86 C;  2HHH L;  2R92 H;  3AQQ A;  5GQO A;  1IBL L;  3HKZ G;  3OW2 A;  2N49 A;  2OWO A;  3ULJ A;  4IPH A;  1XNR L;  4DR1 Q;  1SFO H;  3K80 C;  1FL0 A;  4IOC A;  3KJO A;  1C0A A;  2Q2U A;  2ZJP A;  2F4V L;  3CCR A;  1TWH H;  1N36 L;  3UDX A;  4A3D H;  2NVY H;  3FHW A;  1N34 L;  1PA6 A;  3RZD H;  4LF4 L;  5K36 G;  5LMN L;  4B3R Q;  5IYD H;  3NEN A;  1Q1E A;  3F2B A;  1IBK L;  4LF9 Q;  4A3G G;  4A3J G;  1IBM L;  2KCT A;  1JJG A;  3GTK H;  2OTL A;  4UPA A;  3H15 A;  4X66 L;  4OWT B;  2YV5 A;  1I94 L;  4BY7 H;  3E0E A;  4OWW B;  1HR0 Q;  1ASZ A;  2R7D A;  2HT1 A;  3PO3 G;  2AWO A;  1EQQ A;  4LFC L;  4DV7 Q;  3FP9 A;  2XGT A;  1VQB A;  2EXD A;  2AWN A;  2ZTD A;  3K8A A;  1YHB A;  4DR5 L;  5IYC H;  1VQF A;  2VL6 A;  5FJ8 H;  5BR8 L;  3T1Y Q;  4BY1 G;  1V43 A;  2JQO A;  3M4O H;  3H3V I;  3CCU A;  1XMO Q;  1SE8 A;  5IWA L;  3K81 C;  3EBE A;  4GLA C;  3J80 c;  3J81 c;  4LF6 Q;  1YNX A;  3Q8D A;  2BH8 A;  4JI7 Q;  1EFW A;  2E5L Q;  2AKW B;  4GN3 B;  5GRO A;  1VQ7 A;  2HIV A;  2IX1 A;  1IL2 A;  3J7A 5;  3PO2 H;  5E7N A;  1WCM H;  3STB D;  1NJI C;  3GD7 A;  3PUX A;  1HNW Q;  1XMQ L;  3OYY A;  4DUY Q;  3GTL H;  4PG3 A;  4GNX C;  4JI4 L;  1U0L A;  1V9P A;  4A3C G;  1KXL A;  5C4X G;  5ELN A;  1Q82 C;  2YTV A;  1PH6 A;  3G48 A;  2JEB I;  3AYH B;  3M85 A;  4LF5 L;  2C35 B;  2KHI A;  4AQY L;  4C3J H;  3HOW G;  5FLX c;  2R93 G;  2WB1 G;  2GN5 A;  2K5H A;  4BA1 I;  1E1T A;  2PI2 A;  2Z6K A;  5AJ3 L;  4ME3 A;  3DM3 A;  2V1C C;  3NBH B;  4KHZ A;  4JI3 L;  4NXM L;  1LYL A;  3PUW A;  4DAY B;  4DV1 Q;  4OX9 Q;  3A74 A;  3OTO L;  2CFM A;  3F2C A;  2A19 A;  4X64 Q;  1VQ8 A;  1IZ6 A;  4HJ9 A;  3H0G G;  1J5E L;  4QY7 A;  4JI0 L;  4AYB E;  5GAH C;  3RLO A;  1GKH A;  2I5M X;  2K75 A;  3I4M H;  1Y1W H; 
#chains in the Genus database with same CATH topology
 1FR3 A;  2ZJQ A;  3PGZ A;  2Z0S A;  2JA7 B;  1PRT B;  3C1F A;  5LHY 1;  2BDN A;  1UEB A;  4DPG A;  3EN2 A;  3GTG H;  2M2L A;  2VQE L;  1I3Q B;  3NP8 A;  3TP5 A;  1QVG A;  4LF7 L;  3I4M B;  2QDB A;  5C3E G;  1YIJ A;  1ROD A;  2KEC A;  3R2I A;  3LGJ A;  2JE6 I;  3NBI A;  4JI5 Q;  2OT2 A;  1CHQ D;  3MXU A;  2BH2 A;  1O7I A;  2XIW A;  2K28 A;  1FJG Q;  2F0K A;  3K7A B;  4HJ5 A;  1D7Q A;  1KNE A;  3S2D H;  1PV4 A;  1GM5 A;  3HOW B;  4IFD G;  2UUA Q;  4X62 L;  1PZJ D;  2B2W A;  4DR4 Q;  1FGU A;  3GV3 A;  3OW7 A;  1XNQ Q;  1TT2 A;  2C5C A;  2UXC Q;  4B08 A;  4CKC A;  2B63 G;  5TSS A;  3I2Z A;  5KNC A;  1RHP A;  2A68 C;  4PZ6 A;  1ICW A;  4POG A;  3OWF A;  4QCL A;  1ASY A;  3T1H Q;  2FHT A;  4N8X 1;  1BBW A;  2KCN A;  5C3W A;  1BDO A;  2NVX B;  1N32 Q;  4K2L A;  4YWM A;  3K7U C;  2YTY A;  1CFM A;  5J22 A;  3A7A B;  5BN4 A;  4Y7N H;  1D2B A;  4B3M L;  1K8M A;  1SJH D;  2H5X A;  3NPP A;  1D6E C;  1WTP A;  3ULL A;  5LMN W;  3J80 E;  1W3S A;  3T16 A;  3WWV A;  1XYI A;  3J80 i;  3KOJ A;  1J6Q A;  2WKC A;  3HG9 A;  4DV5 L;  1EYA A;  5C3E B;  2LFN A;  1S5E D;  2EY5 A;  4RG1 A;  1FNU A;  1JOR A;  3DWP A;  1VS0 A;  1HNZ Q;  4BY7 G;  1C4Q A;  1RF2 D;  5EPJ A;  1KC8 C;  5IYC G;  5M5W H;  1Q3L A;  2C9O A;  4CDD C;  1QIL A;  3ULP A;  3P1H A;  2K5W A;  2RSN A;  3I91 A;  5I2Y A;  3BVG A;  2EE1 A;  3G71 A;  2NVT B;  4PZ7 A;  2BDO A;  2B63 B;  4L8J A;  3K0Y A;  4A3E G;  1RL2 A;  2LSS A;  3FEW X;  1P16 A;  4QB4 A;  4GKK L;  3HKZ E;  2KHS A;  4LWC A;  2VY3 A;  4NMZ A;  5KGU A;  5C44 H;  2H1E A;  1PXU A;  4O2D A;  3R93 A;  3A0J A;  2UXD Q;  1A6X A;  3A5Z B;  4EGV A;  1NR2 A;  2F0F A;  2O2L D;  1HHV A;  1KNA A;  2VNU D;  1PYW D;  4X65 Q;  3ND9 A;  2JEA I;  1NAP A;  1XTC D;  1GUG A;  2OQ0 A;  1PYS B;  2L9H A;  2LXK A;  2NWG A;  3J81 L;  4DR3 Q;  2EQS A;  5IGE A;  1WJJ A;  3HP3 A;  5DAU A;  3KF8 A;  2SEB D;  2B2Y C;  2JA6 G;  1TWA B;  3VR5 A;  3PUV A;  4L5T A;  3I73 A;  3S2H H;  2VZA A;  1DON A;  4LMQ D;  1AE2 A;  3P20 A;  4IPD A;  1PMR A;  4CDE C;  2HHH Q;  5FLX L;  4UP7 A;  4B3R L;  4LF9 L;  1A62 A;  3MXN B;  1R9T H;  2JA5 H;  5D3I B;  3CXC A;  5FO8 B;  4R8I A;  2KHJ A;  2PZU A;  2DJF C;  5M5X H;  2IX0 A;  1VQM A;  4BXX G;  5JOB A;  4H44 C;  4BBR H;  4CGY B;  2ZTE A;  1N34 Q;  5C4X B;  3ERS X;  3HFZ B;  1AP0 A;  2K01 A;  3K0X A;  2KOL A;  3S17 B;  3E6Z X;  1XXG A;  1IBK Q;  3S14 H;  2L0C A;  1ILQ A;  3GTQ H;  1AN8 A;  4QUC A;  4YCU A;  2L1B A;  1XMO L;  3NE5 B;  3C3L A;  1QCB D;  3E9I A;  1EIH A;  4RHR A;  4JI7 L;  1BCP D;  3RZO H;  3KYH C;  4YCV A;  1QG7 A;  4K6D A;  1DOL A;  5EGT A;  1UAP A;  2EY2 A;  2IX3 A;  3EQL C;  3CQZ H;  2CWA A;  3H0G B;  3IKJ A;  2XVS A;  3NTK A;  2XSC A;  1X6O A;  1O7Y A;  1X54 A;  3OIP A;  1TXY A;  4FVM A;  2VB2 X;  1CKM A;  2WAQ G;  1KD1 C;  4OGQ C;  4FF1 A;  4IOA A;  1YVC A;  1XMQ Q;  5K5P A;  4ZLT F;  4JI4 Q;  2CH4 A;  4DV1 L;  4OX9 L;  1UNS A;  3PIP A;  5JJZ A;  4LF5 Q;  3I3C A;  4AQY Q;  1NY4 A;  1NSN S;  4J6H A;  2F0U A;  5FO7 B;  3BJU A;  1II3 A;  4HIK A;  4JI3 Q;  4M1U B;  2Z4H A;  4IUV A;  1YBY A;  3A8J E;  3SEB A;  4K0K L;  1J5E Q;  1VQO A;  3A55 A;  5CGK A;  2PPB C;  4JI0 Q;  3FKI B;  3PIO A;  1EY6 A;  5IOD A;  1LTL A;  2ZT9 C;  2EJG C;  1MSG A;  1Q1B A;  3L9A X;  1F9R A;  2J4X A;  2K33 A;  4QJF A;  1A15 A;  3GTO H;  4F88 A;  3BVZ A;  3S16 H;  4A93 B;  2R92 B;  2QW7 A;  3BZK A;  2FMM A;  5M3F B;  1K8A C;  2EJM A;  3J81 j;  1X3G A;  2X6L A;  5JVH 3;  1X32 A;  2CKZ B;  4DNI A;  3MXP A;  1TWH B;  3RN2 A;  2Q2H A;  1YEZ A;  3S1Q H;  1GUN A;  5CBE E;  1C9O A;  3F8T A;  3RZD B;  2DY8 A;  1D5Z C;  3AFQ A;  3V2T A;  4DR2 L;  2Y0S G;  3I7F A;  2PQE A;  4CJ1 B;  4KY5 A;  4EQ5 A;  1SLJ A;  1VQJ A;  5IP7 H;  1ENA A;  2BA1 A;  4OHJ A;  3VR4 A;  3W5O A;  1D1K A;  1EZ8 A;  4A3I H;  3VYS A;  1PFS A;  2R7Z H;  3M4O B;  3MFG A;  2NZ1 D;  4DV6 L;  3D8G A;  2F0L A;  4WJW A;  1CM9 A;  3M4Q A;  3KK7 A;  1JJC B;  4DKA C;  1IYU A;  1WTW A;  2WAC A;  1GVP A;  5IGC A;  1MBY A;  2JSO A;  2RF4 A;  3MXG A;  4XTC S;  3CC2 A;  3AMU A;  5AFW A;  2KCM A;  2E2H H;  3KF6 A;  2RDH A;  5CV4 A;  4DUZ L;  2JYO A;  3FRP B;  3PMF A;  3JC6 6;  2BA0 A;  5IT9 c;  3CMA A;  4RWS C;  4XYO A;  3H09 A;  4P72 A;  1B70 B;  4ODG A;  4A3F B;  3CU7 A;  3MTS A;  5EJW A;  4JI1 L;  2VQF Q;  1I50 H;  3S1M H;  3IRB A;  1L0W A;  2NVQ H;  1CQF A;  2N8N A;  2NTT A;  1XPO A;  3L3O C;  2O5I C;  3HOY H;  4CDC C;  3IFT A;  4XQN A;  2EYL A;  1B53 A;  4DU9 A;  1NBW A;  1K3B C;  2F0Q A;  4HCS A;  3GTG B;  2E2I B;  1BO0 A;  3TSS A;  4KHP Q;  4Q5V A;  4HIM A;  1HA5 A;  1PH2 A;  1M1K C;  1XPU A;  4X3K A;  4DV2 Q;  1LTA D;  3W3A A;  3C1E A;  1WVL A;  4IFD H;  1TY0 A;  1LM0 A;  3CCV A;  2F0J A;  3S2D B;  1EY9 A;  3S24 A;  4KK7 A;  1FNV A;  4KV6 A;  4IO9 A;  2SNM A;  2CQO A;  1CA5 A;  3E3X A;  2K05 A;  2NYZ D;  1GUO A;  1ZKO A;  3TP6 A;  3GQB A;  5DEH A;  1AEX A;  2B2U A;  2B2T C;  2X69 A;  3AQQ A;  2K7V A;  3HKZ G;  4FYD A;  4DR1 Q;  2A69 C;  5IIF A;  1FL0 A;  4IOC A;  3KJO A;  4Y7N B;  5IOC A;  2QIL A;  4H0L C;  1NNX A;  1FYC A;  1KTK A;  3FHW A;  4PV1 C;  5KNB A;  2P5Z X;  4PQX A;  4LF4 L;  5C3X A;  3NEN A;  1Q1E A;  2KQ3 A;  4A3G G;  2OTL A;  3H15 A;  2YV5 A;  1I94 L;  4BY7 H;  4OWW B;  3SK6 A;  1F2L A;  3Q22 A;  1HR0 Q;  1ASZ A;  2XWJ B;  2DNE A;  4LFC L;  3FP9 A;  3QWN A;  3QR8 A;  4MIU A;  5IYC H;  3KLS A;  1I4R A;  4BY1 G;  4DAV A;  2JQO A;  3H3V I;  3I70 A;  3CCU A;  1SMY D;  1S5D D;  5IWA L;  3K81 C;  4LF6 Q;  3J81 c;  1YNX A;  2O4X A;  1LTS D;  1DOK A;  1B4O A;  2FMC A;  2E5L Q;  4GN3 B;  3NBH A;  2KA7 A;  1LV9 A;  5E7N A;  4DA2 A;  4IUP A;  1HXY D;  5CMD A;  1NJI C;  3BDO A;  1BBX C;  4ZUI A;  3GD7 A;  1IKL A;  5CV8 A;  3OYY A;  1TS3 A;  1U0L A;  2DJG C;  2SOB A;  1PH6 A;  3HKZ B;  2HCI A;  1H9R A;  5C44 B;  2KHI A;  4F87 A;  5FLX c;  2WB1 G;  1WCM B;  1I4G A;  1SNC A;  3VR2 A;  2Z6K A;  3OMC A;  5T1G A;  4DAY B;  3J80 L;  1A2U A;  1B9M A;  3F2C A;  2FIN B;  3Q23 A;  5GAH C;  3RLO A;  4DR5 L;  3DHQ A;  4DNR B;  3K57 A;  4FDB A;  1QUQ A;  1E24 A;  2JA6 H;  3U9S A;  4DR6 L;  2N3S A;  4JI2 L;  2ATW A;  1SYD A;  1M4V A;  2EIF A;  1VQE A;  1VMC A;  4ZQ3 A;  1HA6 A;  5EKI A;  3A5U A;  1EUJ A;  4P2C B;  4LFB Q;  4N9P A;  4KKT A;  1PYB A;  3HOU B;  2N55 A;  4PMB A;  1J9O A;  4OEL B;  5CV7 A;  3D31 A;  2KVM A;  1R9T B;  2JA5 B;  2JK8 A;  1HCZ A;  1T5E A;  3C46 A;  2UUB Q;  4GN4 B;  3V05 A;  4JBJ A;  4BBR B;  4ALP A;  1HRJ A;  4DV4 Q;  2K4K A;  2D0P A;  1STE A;  3S15 H;  2AUJ D;  4E6I A;  3HKS A;  1DD2 A;  3GTQ B;  2B29 A;  3DM1 A;  3RZO B;  4H02 A;  4HJ7 A;  4XT3 B;  1JWM D;  3GV6 A;  2R3Z A;  1VQK A;  1NE3 A;  4GOP A;  2I5H A;  1HFN A;  2AQ1 B;  3JAM L;  1F77 A;  2HQL A;  2WAQ E;  2CQA A;  3FMC A;  4GN5 A;  3U4Z A;  1HNX L;  5IYD G;  1MKH A;  4B3T Q;  1B9N A;  1LLR D;  1RTO A;  2AMC B;  4GKJ L;  1F9Q A;  1T5X D;  2L5T A;  3S1R H;  2N88 A;  1TY2 A;  4UDU C;  4JYA L;  1JOQ A;  1Y8N B;  2IHE A;  5JPN C;  3MWY W;  5FJ8 G;  4A3B H;  1JJ2 A;  1PTO H;  2K52 A;  4R1J A;  2EY1 A;  3NWS A;  3NHH A;  5D14 A;  2B8F A;  4OEM B;  1W6K A;  2CW0 D;  3R2T A;  1U9R A;  1I6H H;  1S5F D;  2LY7 A;  3BVM A;  5IP7 G;  4HJA A;  4WJ4 A;  3PO2 G;  1GO3 E;  1S3O A;  4WJ3 M;  5HGQ A;  1VQL A;  4L5S A;  4A3I G;  2R7Z G;  1M8A A;  1K0R A;  3UE0 A;  4LF8 L;  3O13 A;  1A3T A;  3DWQ A;  4DXG A;  4JV5 Q;  3TDQ A;  3OHX C;  3STB C;  3GTO B;  1PFN A;  3I4O A;  4B9X A;  1TVX A;  1ZYR C;  5NUC A;  1RD9 D;  3PO3 H;  1X3Q A;  1DGS A;  3R8B A;  3KBX A;  1IYJ B;  1LTI D;  4AYB G;  3PQI A;  1SRO A;  4K2K A;  4POF A;  4FXG C;  4Y52 H;  1Y1W G;  1U4M A;  2NBF A;  2Y0S E;  4C3I G;  1WOC A;  4GNX A;  1O78 A;  3LNN A;  1N33 Q;  4TQU S;  2ALY B;  5J3B A;  2XTI A;  1D8L A;  3HOY G;  4C3H G;  4KD4 A;  1R4P B;  1W2B A;  2EOT A;  3RNU A;  4ZKB B;  1EIY B;  4DN4 M;  2R7Z B;  4NB3 A;  1JCK B;  2ZXR A;  4OIK A;  5M3M G;  4CBV A;  1O80 A;  3QOL A;  3CF5 A;  1ENC A;  3TP7 A;  2A6H C;  4FXK C;  1XNR Q;  4G57 A;  1WFQ A;  1CTM A;  3V96 A;  1NMG A;  2RVL A;  2WKD A;  4DV7 L;  1N36 Q;  2F4V Q;  1PZK D;  1SYG A;  3S9W A;  2JJQ A;  2XNA C;  4L5Q A;  1C7Y A;  3T1Y L;  3HOZ G;  4IN3 A;  1SE3 A;  1IBM Q;  3DEO A;  1G29 1;  2R93 B;  4X66 Q;  1E2V A;  2A6E D;  2N78 A;  2MO0 A;  1V1P A;  1UE6 A;  3X3N A;  2PQA A;  4A3K H;  1GUW A;  1FNW A;  2EYH A;  5KRU A;  3G6E A;  3J7Y W;  1HNW L;  2K14 A;  4OXP A;  1I50 B;  3S1M B;  2IL8 A;  3QO2 A;  3LWE A;  2KEN A;  2NVQ B;  3B6Y A;  1MI2 A;  2RDG A;  1E0B A;  1Q7Y C;  3NTI A;  4BA2 I;  1UE1 A;  4JOI A;  2DUD A;  1PZI D;  4OON A;  2KEE A;  5BN5 A;  2Q2T A;  2ZTC A;  1Z9F A;  4K5W A;  1EQR A;  2E8G A;  2RQX A;  1NTG A;  4HMJ A;  1A3U A;  2K5Q A;  4X64 L;  4JCV E;  4JC0 A;  1ESR A;  1HTP A;  1B8A A;  1OXU A;  1TWG H;  3TRZ A;  4QGU A;  2IPK D;  5HY6 A;  4DR7 L;  2D2C C;  5AJ3 Q;  1G91 A;  3HOX H;  3VR6 A;  4NXM Q;  2PMZ E;  1GXD C;  4JI8 L;  4CHT B;  1E1O A;  4X3S A;  1AE3 A;  4DK1 A;  1YHA A;  4V19 0;  5CV9 A;  4KY7 A;  2ENB A;  4K8I A;  3M3Y H;  2IWH A;  3A8K E;  2UXB Q;  4PMW A;  1VQG A;  3M7G A;  5KIX A;  1VQ4 A;  4JI5 L;  3E9H A;  5ELB A;  2PYK A;  2G9H D;  4GLV B;  2F0S A;  1QNU A;  2KED A;  2JXM B;  4O42 A;  1FJG L;  5HUR A;  2VUM H;  4OO1 I;  1UE5 A;  2LKV A;  1JWU D;  1BNZ A;  1U4R A;  2GA4 B;  5JEA G;  2UUA L;  3ND8 A;  4ZCK A;  1QVF A;  4DR4 L;  3TEH B;  1QOH A;  5CV5 A;  4A3G H;  1RIP A;  5E3F A;  1LTG D;  4B3S Q;  1XNQ L;  4DV0 Q;  2UXC L;  1WYD A;  1CHP D;  4KJN A;  5ISR A;  1LAC A;  1Q90 A;  1PRT C;  3T1H L;  4BY7 B;  4JG2 A;  1N32 L;  2AHO B;  1YNN D;  2MGS A;  1STA A;  4BY1 H;  1PH8 A;  1VQC A;  1STH A;  1HZA A;  5G3L F;  1WD1 A;  4J8Q A;  1I4H A;  1KRS A;  2DGY A;  4F8M A;  2O5J C;  4R4Q A;  3CC7 A;  4LJZ C;  5ELC A;  4RH6 A;  3BYY B;  4IZ8 A;  3OMG A;  5DLQ E;  4NXN Q;  3W1G A;  4A3E B;  3MC0 B;  2L4N A;  5EKL A;  4TSS A;  1VDZ A;  4YY3 Q;  1HNZ L;  1GJX A;  3ONA B;  1NUC A;  1BBU A;  4DGZ A;  3TP8 A;  1VF7 A;  1VQ6 A;  1CK1 A;  1HZC A;  1Y1V G;  5I2X A;  1LT4 D;  3M7N A;  2WB1 E;  3GTJ H;  2M9V A;  2B2Y A;  4JI6 Q;  4Q0F A;  3UI2 A;  3EIV A;  4N8F A;  2VXW A;  3KDF B;  1SNO A;  3SDZ A;  3SK5 A;  1DYQ A;  4K8J A;  4DV3 Q;  2EJF C;  1WTR A;  2G9D A;  3L0O A;  3IAY A;  1HQM C;  3T51 B;  1BKB A;  5GAE C;  5T1I A;  4FF3 A;  3NTH A;  3KF6 B;  3U4V A;  1Q8K A;  1GHK A;  1PDQ A;  2K5V A;  4R9W A;  2RCN A;  3SGI A;  2E2J H;  3NEM A;  3GTP H;  4MTK A;  2UXD L;  3J7Z C;  2UU9 Q;  2JA6 B;  4TRD A;  4KHV A;  1ENF A;  1J8I A;  1Y8O B;  5BN3 A;  1G2S A;  4X65 L;  3MHB A;  3CCE A;  1WTQ A;  2Z9H A;  4QMG A;  2A74 C;  4ABN A;  1QWY A;  1U4L A;  1M90 C;  1PRT F;  3M4Y A;  1VQI A;  4RKB A;  4DXF A;  1VF5 C;  1B44 D;  3NSW A;  5C0X I;  4DR3 L;  3CKI B;  3L7Z C;  2A68 D;  3QG1 A;  4CJ0 B;  1GD7 A;  2IW3 A;  4L6T B;  2EYP A;  2VB3 X;  3E0J A;  3HOV G;  4A3B G;  5G3L D;  1BR9 A;  1PH4 A;  1EWC A;  3QJY A;  5IP9 H;  1YJW A;  3U50 C;  1JQY D;  4A4I A;  1BUV T;  2B2V C;  3S15 B;  4WFN 3;  4IAL A;  1P8L A;  1HFG A;  3PIP 3;  2HHH L;  4C56 C;  1I4Q A;  2D9U A;  4I7Z C;  3ULJ A;  4IPH A;  1I4X A;  1JOK A;  1HPC A;  5FOB B;  2Q2U A;  2ZJP A;  3CCR A;  4A3D H;  1N34 L;  1PA6 A;  1B3A A;  5IYD H;  1IBK L;  3F2B A;  2EYJ A;  3ZYY X;  5CR3 A;  1JJG A;  1SYF A;  2WAQ B;  3GTK H;  3PIO 3;  2XN9 C;  1SSO A;  3PO3 G;  3I4L A;  1ML0 D;  3HEJ A;  5I4D A;  2AWO A;  1SNP A;  1EYD A;  3S1R B;  1FGB D;  1VQB A;  2AWN A;  2NVY B;  3A54 A;  3K8A A;  1K8O A;  1VQF A;  5FJ8 H;  5I6Y A;  1CQV A;  1SE8 A;  3EBE A;  5IT9 E;  1PTO B;  2BH8 A;  2AKW B;  4HAE A;  2IX1 A;  2HIV A;  3PO2 H;  1I6H B;  4KD3 A;  1SND A;  2WIN B;  1XMQ L;  4DUY Q;  4JI4 L;  1V9P A;  5A2Q E;  3D6C A;  3G48 A;  2JEB I;  4LF5 L;  2A73 B;  2L55 A;  4AQY L;  1PRT D;  5DNF A;  4KKS A;  4X3T A;  1IL8 A;  2GN5 A;  1QE6 A;  2K5H A;  2PI2 A;  1QJO A;  3R3O A;  1IW7 C;  3DM3 A;  4RAU C;  3NBH B;  3GTL B;  4JI3 L;  1LYL A;  1SYE A;  1EY7 A;  4FP5 D;  1WTO A;  1L0Y B;  3MXN A;  3E5S A;  3P75 A;  2Z8L A;  4HJ9 A;  1J5E L;  4JI0 L;  4AYB E;  4IUN A;  3BDL A;  1DXM A;  1EL0 A;  3I4M H;  1Y1W H;  3SE0 A;  1IKM A;  1K0S A;  4C3I H;  4NP5 A;  3I4N H;  5J39 A;  4A3K G;  2Y0S B;  2PZT A;  2V4D A;  4IUU A;  2ASB A;  2HD3 A;  1SDF A;  1V1O A;  4LFA Q;  3K7A H;  4MTN A;  4C3H H;  3Q0A A;  3M4P A;  5H1S E;  1VCI A;  2BOS A;  5CBA E;  1EZ6 A;  3TQY A;  3KBG A;  5M3M H;  3PSI A;  2QGQ A;  1EFI D;  2LMC B;  5C0X H;  4LNQ A;  4LUV A;  5A35 A;  4QF4 A;  4GZY C;  3BZC A;  4QL5 A;  3NQT A;  4HR7 B;  2OQK A;  3HOZ H;  1JR0 D;  1N9W A;  4ME5 A;  5FLM H;  1E2Z A;  3HOX G;  3T56 B;  3A7L A;  3AU7 A;  3K6O A;  1H9S B;  4KTA A;  2OCE A;  3F2U A;  2D5D A;  2HDM A;  1JT8 A;  1JC7 A;  1WI5 A;  1I6V C;  4WOR A;  1KIX A;  3OOC A;  1TR5 A;  3RUZ A;  4A3K B;  3WOE A;  4EVO A;  2Q8T A;  1WTX A;  1ET9 A;  2NN6 I;  3J81 E;  2RDF A;  4QUF A;  3J81 i;  4YHH Q;  5EKK A;  3GDE A;  1L1O B;  2EZV A;  2VUM G;  2NTS A;  4HSV A;  1QZH A;  2F0O A;  5COR A;  1MJC A;  1KL9 A;  3AEV A;  2QA4 A;  1R4Q B;  1EU4 A;  2EYO A;  4GOP B;  4K5X A;  2VQF L;  2KCC A;  5FLX E;  4RCO A;  2B2T A;  2ZM6 Q;  1A2T A;  1TQO A;  3RLN A;  1F9P A;  1EU3 A;  5I6W A;  4JVZ A;  1VQH A;  2PMZ B;  5FK9 C;  2F0D A;  2YU9 H;  1YJN A;  2YTX A;  4ID6 A;  4EQO A;  5M5W B;  3U9O A;  4UY8 C;  4IFD J;  4R4T A;  1JMC A;  4KHP L;  5M5Y H;  4A75 A;  3M3Y B;  4C3J G;  2MUY A;  4MNO A;  1TS5 A;  3KUP A;  2F3I A;  4YCW A;  4A3J H;  4DV2 L;  3MEH A;  4C1N I;  5JEA H;  4M8A A;  1I5F A;  1CUK A;  4YIJ A;  4HN7 A;  2BE5 C;  3PUY A;  2D62 A;  2RBM A;  2JA9 A;  1AH9 A;  1MHW C;  1TWA H;  2Z6B A;  4XQJ A;  2IY5 B;  3CC4 A;  3K59 A;  1K83 H;  1STN A;  4A3G B;  4C2M H;  2DNC A;  1Q81 C;  3K5M A;  1PFM A;  2CCZ A;  2RHQ B;  1OXS C;  2KBN A;  2PW7 A;  4OIJ A;  3FPU B;  1LO5 D;  2UUC Q;  4DR1 L;  1TWC H;  4BY1 B;  3D0F A;  3D4R A;  2D0O A;  3KLS X;  1KQS A;  1U5K A;  3WOF A;  4ZAI A;  1UUP A;  4IUT A;  1OO9 B;  3S1N H;  3RN5 A;  1YI2 A;  1CI3 M;  3CRL C;  3RD4 A;  1IBL Q;  3QB3 A;  3CAM A;  5FO9 B;  3KLW A;  4YWK A;  4HED A;  1X3E A;  2GVA A;  2NZO A;  3I8Z A;  4RMF A;  1HZB A;  1KAB A;  1STY A;  1HR0 L;  1PHJ A;  3S2H B;  1FVI A;  1K3R A;  1Y1V H;  4UHV A;  5LMN Q;  1CA6 A;  2GVB A;  2MQH A;  4NKL A;  2PO4 A;  1DJR D;  2WB1 B;  1VQP A;  1LTB D;  3D6W A;  4LF6 L;  1S5B D;  1HJP A;  5M5X B;  1E3P A;  4PNY A;  1SNM A;  2E5L L;  4A76 A;  3F2D A;  4O0A A;  5BR8 Q;  4J15 A;  4JBK A;  2FFK B;  5IP9 G;  1L1O C;  3S14 B;  1EIG A;  4AH6 A;  1CKN A;  1O7L A;  3ICE A;  2NN6 H;  1C8C A;  3ER0 A;  3CME A;  1A3V A;  2X6G A;  2HDL A;  1EEF D;  1SXT A;  4GOP C;  2E2J B;  3GTP B;  1X3P A;  1LT3 D;  5CV6 A;  1BCP B;  1V1P B;  2MNA A;  3CQZ B;  4UP8 A;  2IJ0 A;  4RGT A;  3K5O A;  2PQA B;  4A3D G;  4DAM A;  1MSH A;  1PH5 A;  1G2T A;  1LAB A;  1E7Z A;  1UWV A;  1N8R C;  4FXD A;  1HTL D;  3PCO B;  3NQI A;  3FKI H;  1SNQ A;  5L37 A;  2XWB B;  4QIW E;  5LMU L;  3EJI A;  2EVB A;  3OTO Q;  3H3V H;  3HOV H;  2F0I A;  3KJP A;  3W2D A;  2QCP X;  3ERO A;  5M3F H;  4BBS G;  2A69 D;  4IUR A;  1PH9 A;  2MHV A;  2F0M A;  4JBW A;  2L11 A;  1CSP A;  1F2Z A;  3PUZ A;  4HJ8 A;  3D4W A;  4LFB L;  2L15 A;  1IXR A;  4A3M G;  1LT5 D;  2VQE Q;  2L12 A;  1F9S A;  2K32 A;  3TRE A;  4LF7 Q;  3MA2 B;  2K04 A;  3CPW A;  4IUQ A;  3TZU A;  3OIQ A;  2QEX A;  2UUB L;  1HQR D;  2JA8 G;  2CHB D;  2F52 A;  5C6A A;  4DV4 L;  3AFP A;  3S16 B;  4XXE A;  2PCF B;  2JA7 G;  1AZP A;  4KI0 A;  3CCQ A;  4ZRZ A;  2EDG A;  1OXT A;  4X62 Q;  1YHQ A;  1EYC A;  2I07 B;  2WP8 J;  1TKW B;  5E4W C;  3I4M G;  3HZX A;  1VQN A;  3S1Q B;  3KLR A;  3L2P A;  5JPM C;  2HCC A;  3I4N G;  2J0T D;  1MGS A;  4RCN A;  2MJ8 A;  2I5L X;  1IHZ A;  1T9H A;  5KYI A;  1S72 A;  1HR0 W;  2Z4I A;  4B3T L;  4FO2 A;  5JJI A;  3PO2 B;  4KN7 C;  1LTT D;  4B3M Q;  4NDX A;  1XJV A;  2Q2I A;  1QB5 D;  2E76 C;  1H9K A;  4A3I B;  1BOS A;  3SHL A;  1A8V A;  3BG3 A;  4A3F H;  1B7Y B;  2ZXP A;  4DV5 Q;  1XWE A;  4KLK A;  1BXT A;  2LS0 1;  3KF8 B;  1SR3 A;  2PNR C;  1KRT A;  5C0X G;  5DM6 3;  5C4J H;  2MP1 A;  5LL6 X;  4JW0 A;  3BU2 A;  3HGB A;  3U58 A;  2E2H B;  4JPB W;  2F4I A;  2TMP A;  4JI8 Q;  5JVG 3;  5DM7 3;  3BDC A;  5FLM G;  4HIO A;  3GTM H;  1JB3 A;  2E2I H;  2MO1 A;  5GAG C;  2Q8I B;  5GAD C;  4AYB B;  4DF7 A;  2B2W C;  4CDF C;  1BCP C;  5D65 A;  1Y1W B;  5EPK A;  3T53 B;  4NW2 A;  4CKB A;  4GLX A;  4C3I B;  4JV5 L;  2FXQ A;  4X3U A;  4EQP A;  1E22 A;  4RA8 A;  4DK3 C;  3I4N B;  1TS2 A;  3G6J B;  2ID0 A;  2OTJ A;  3C2P A;  3TS2 A;  4GKK Q;  1SJE D;  2HQE A;  2M00 A;  5IT9 L;  3W1B A;  4A3L G;  3HOY B;  1X55 A;  3MVV A;  1LT6 D;  4C3H B;  3DWA A;  3NK9 A;  4WRD A;  2OEO A;  2I46 A;  2ES2 A;  3UE1 A;  4XYQ A;  4JOI C;  3SXH A;  3AB9 A;  1DM0 B;  5M3M B;  1L2F A;  4DFA A;  1K73 C;  5A2Q L;  2K5N A;  2XRQ D;  3WDN A;  1KLU D;  2CWP A;  1N33 L;  3J7A F;  5ELD A;  3TME A;  3BYT B;  1MIU A;  3HOZ B;  3G7L A;  2QEJ C;  3OSO A;  5IYB G;  3T4A C;  2EY6 A;  5EBC A;  1QVC A;  3GP7 A;  1Q86 C;  5GQO A;  2N49 A;  2OWO A;  1XNR L;  1HUM A;  4HTH A;  1SFO H;  3K80 C;  1C0A A;  3P7J A;  2F4V L;  2QDL A;  1N36 L;  1RJT A;  5K36 G;  4H7B A;  4B3R Q;  2F1M A;  4G7Z C;  4LF9 Q;  4A3J G;  1IBM L;  4UPA A;  4X66 L;  2JP1 A;  4OWT B;  4I7A A;  3E0E A;  2HT1 A;  4K5V A;  1RKN A;  2EPB A;  2SNS A;  2XGT A;  2A5H A;  3K5L A;  4DAP A;  2ZTD A;  3FDT A;  2AQ2 B;  3DMU A;  1BCP F;  3EVQ A;  1L0X B;  5IGB A;  2ICE C;  1XMO Q;  4RFB A;  3J80 c;  4JI7 Q;  1VQ7 A;  1B50 A;  3J7A 5;  3MZ5 A;  1Q8I A;  1WCM H;  3STB D;  2F0V A;  2F0T A;  3PUX A;  1HUN A;  2YU9 B;  1ESF A;  4PG3 A;  4A3C G;  2SDF A;  1EWH A;  1KXL A;  5C4X G;  1ZYR D;  5ELN A;  1EY0 A;  1AW7 A;  1SAP A;  4KN4 C;  2RCF A;  3AYH B;  1DZ1 A;  4L63 B;  2C35 B;  1EOT A;  5M5Y B;  4C3J H;  1GUS A;  4BA1 I;  1E1T A;  5AJ3 L;  2V1C C;  4NXM L;  4DV1 Q;  4OX9 Q;  3A74 A;  4A3J B;  2A19 A;  3FVQ A;  1IZ6 A;  2PW5 A;  1FD7 D;  3H0G G;  2F03 A;  4QY7 A;  1RDP D;  1B3Q A;  4XQQ A;  1GKH A;  3JAM E;  4FF4 A;  2I5M X;  2K75 A;  4LK1 C;  3EFX D;  3JAM i;  1A0I A;  4G7O C;  1PH7 A;  1F2M A;  2UXB L;  4P74 A;  1K83 B;  2NUC A;  4C2M B;  2QF7 A;  4K0K Q;  3LWU A;  3HOU H;  4RGN A;  1XX8 A;  2R61 A;  2A6H D;  4KJO A;  2G5D A;  4X6A H;  3VDY A;  2NN6 G;  3M9B A;  1KAA A;  4H13 C;  3BZD B;  1TWC B;  1JE5 A;  1A63 A;  3S1N B;  1G51 A;  1EQT A;  4B3S L;  4HCE A;  4DV0 L;  5C4H A;  3SK4 A;  1OXV A;  1QZG A;  3CD6 A;  1JOO A;  3JAM c;  3FKI G;  2VW9 A;  4XIG S;  1XTD A;  1UEA B;  1EQV A;  5IGF A;  1H9J A;  3T13 A;  1Y1V B;  3I72 A;  2IHF A;  3X3M A;  1UE7 A;  2B3G A;  4DR2 Q;  2FJ2 A;  4A93 G;  4OWX B;  1KLG D;  2R92 G;  5LL6 S;  2RSO A;  5M3F G;  4BWG B;  3LX0 A;  4G7H C;  1CT1 D;  3DUZ A;  4NXN L;  1WTH A;  4IQZ A;  1K8G A;  1U4P A;  1D5M C;  2F0N A;  3PF5 A;  4YY3 L;  4DV6 Q;  3RLF A;  3Q6S A;  1H95 A;  1JE4 A;  4FF2 A;  5JJK A;  4OO1 H;  4JI6 L;  4KKU A;  2RHS B;  3VR3 A;  4FNF A;  1SN8 A;  4IJL A;  2AUK A;  4DUZ Q;  4ULL A;  3SK8 A;  1SE2 A;  3RR5 A;  4DV3 L;  4IFD I;  2Q8R E;  2B2V A;  2MFI A;  3NXW A;  1S5C D;  1G6Z A;  3CP0 A;  4ZYS A;  5I9P A;  1PVO A;  5JAV A;  3HS0 C;  2QKI C;  4QIW B;  5I9O A;  1Q46 A;  4TVA B;  2JN4 A;  3N6R A;  4JI1 Q;  1VQ5 A;  2VS1 A;  1OXX K;  5EAY A;  1BF4 A;  4P71 A;  2CH4 W;  4BBS H;  1X9N A;  1SMY C;  4R4O A;  2UU9 L;  3HOV B;  4A3B B;  1KDB A;  5JJL A;  4U67 3;  1VQA A;  4LUO A;  4UP9 A;  4N9T A;  2E75 C;  1EYG A;  4MZ9 A;  3TS0 A;  2F3V A;  3A8I E;  4A3M H;  1CSQ A;  1TWF H;  4IPG A;  5KEE A;  2PZW A;  3KFU A;  1JIC A;  3CCM A;  1ZXT A;  4YWL A;  4ILW A;  4A3F G;  2H4O A;  1NMF A;  4F7X A;  2K03 A;  4GS3 A;  2PNH A;  1JB7 A;  3QOJ A;  2JA8 H;  3CW2 C;  5IGG A;  2JA7 H;  3GO5 A;  1XPR A;  4RHS A;  5EQ0 A;  3D3R A;  4HMI A;  4JBM A;  1EIF A;  1BVS A;  3CPF A;  5D3D A;  3NWT A;  1VQ9 A;  3PO3 B;  1I3Q H;  4S3S A;  3KDF A;  1X3F A;  3QIA A;  4QQB X;  1KDC A;  4RKL A;  4LW1 A;  3ZJY C;  5E4X A;  4KMU C;  1CZW A;  4KY6 A;  1CZG A;  1GUT A;  3G4S A;  4ZUJ A;  3OWE B;  3HOW H;  2R93 H;  2HUG A;  2WV6 D;  3NEL A;  1Y14 B;  1AFP A;  4UAI A;  5CC4 A;  3VYR A;  2RA4 A;  1V8Q A;  2F0H A;  2KUM A;  1JWS D;  5IY0 A;  3A56 A;  1STG A;  2ICI A;  1D1I A;  4LF4 Q;  1Q12 A;  1SMX A;  1QUQ B;  3DEP A;  3FPP A;  2K6A A;  1I94 Q;  2R6G A;  2A8V A;  2NVX H;  4LFC Q;  1PLF A;  5EPL A;  5C4J B;  3UDI A;  1DOM A;  1B2T A;  1KHI A;  4MN3 A;  4DNT B;  3BS1 A;  4DUY L;  3GTM B;  5IWA Q;  2EYF A;  3TZD A;  5M9O A;  3I55 A;  1IYV A;  5C3E H;  1V1Q A;  2WFW A;  2XRS D;  1SYC A;  4XT1 B;  3H6M A;  3IL8 A;  1OTC A;  4A3L H;  1Y69 U;  2Z1C A;  2B2U C;  1W6J A;  3J7A V;  1I4P A;  2EYM A;  1CKN B;  1YNJ C;  1PH1 A;  5IE8 A;  4U68 A;  1VMP A;  4AIM A;  2NVT H;  3K5N A;  3H3V C;  1X56 A;  1EY4 A;  1PTO C;  3Q24 A;  2B63 H;  1EY8 A;  1AZQ A;  4I65 A;  1KDA A;  1HZ9 A;  4ZK9 B;  5FKA C;  4LFA L;  1CKO A;  5C0X J;  1ICF B;  4O1N A;  1WD0 A;  4DR5 Q;  1SE4 A;  1TWG B;  1MJE A;  4P73 A;  2CW0 C;  2MPM A;  5C44 G;  5IYB H;  1STB A;  3UDG A;  3HOX B;  3H91 A;  3ITP A;  1BQQ T;  1WCM G;  1SRU A;  4NPS A;  4R8N A;  4DR6 Q;  2K50 A;  1G6P A;  1K9M C;  2IT1 A;  4JI2 Q;  1G8Z D;  2OF1 A;  2A1A A;  2DY7 A;  1EOV A;  4BS9 A;  1KAW A;  2ZJR A;  1YZ6 A;  2E74 C;  4G4K A;  1SFO B;  2CVR A;  2ZXO A;  3URY A;  5HGT A;  5EBD A;  5K36 H;  5KND A;  2I0Q A;  3RMH A;  3N52 A;  3TBI B;  4APV A;  2VUM B;  3VA5 A;  5C5M A;  1F2Y A;  3SR1 A;  2K5D A;  2R7F A;  2Z6K C;  4A3E H;  2PI2 E;  2E2D C;  5C5L A;  4PZ8 A;  1S4Z A;  3VYU A;  3DLL A;  4YHH L;  3H94 A;  3HOU G;  1ILP A;  4EQN A;  1HH2 P;  3HRZ C;  2JA5 G;  4R4I A;  4A3C H;  4P75 A;  1IW7 D;  5C4X H;  4EX5 A;  2WII B;  4BBR G;  5E1F A;  3S17 H;  3MEF A;  1VQD A;  1O7Z A;  4RGM A;  2EXZ A;  4IJH A;  1HNX Q;  4DK0 A;  3VYT A;  4GNX B;  1Z47 A;  1PTO F;  4C3J B;  4GKJ Q;  4OL7 A;  2ZM6 L;  2OXP A;  4R4C A;  1QNK A;  3ERQ A;  4JYA Q;  4RGO S;  2LXJ A;  3F1Z A;  5LMU Q;  1YIT A;  3H0G H;  3OPO A;  1C48 A;  2YYZ A;  5JEA J;  1EWI A;  3GTJ B;  4J1M A;  4HID A;  2F0G A;  3CCJ A;  3K58 A;  1EY5 A;  2A6E C;  4LUZ A;  4IPC A;  1NCV A;  1LUZ A;  2KJX A;  4PMC A;  1ONL A;  3VA7 A;  1DCZ A;  1H9S A;  5KYL A;  1SEB D;  3IFD A;  4JK1 C;  5COY A;  5ELO A;  4LF8 Q;  3UDF A;  2F0W A;  4DK6 C;  2NZH A;  1SBB B;  4C1N K;  4BXX H;  4OO1 G;  1X65 A;  3PF4 A;  3EA6 A;  1S40 A;  1PFB A;  3PV0 A;  1YJ9 A;  3I56 A;  5CYU A;  1PH3 A;  3SVM A;  1L1O A;  2HIX A;  4V0B A;  1EEI D;  4L5R C;  3CCL A;  1RCV D;  1GHJ A;  1TU2 B;  1Z7T A;  2TSS A;  2UUC L;  2F0P A;  2J7Z A;  3CCS A;  2B39 A;  3MFY A;  1ET6 A;  4LAA A;  1GOZ A;  3I90 A;  1K28 A;  4A93 H;  2NB0 A;  2R92 H;  4B9W A;  3NUC A;  1IBL L;  3OW2 A;  1YNJ D;  1SYB A;  5C4Z A;  1Y8P B;  5F2D A;  1TWH H;  3UDX A;  2NVY H;  1PTO D;  1NR4 A;  3RZD H;  1RTN A;  3D4D A;  5ELE A;  5ELF A;  3MAQ A;  4XDX A;  5LMN L;  3CHB D;  2BCO A;  2KCT A;  2R7D A;  1EQQ A;  4DV7 Q;  4HSP A;  1E2W A;  1LTR D;  2EXD A;  4A3D B;  1YHB A;  2AQ3 B;  2VL6 A;  5BR8 L;  3T1Y Q;  2F0E A;  1V43 A;  2F3W A;  3M4O H;  1B1Z A;  3GTK B;  4GLA C;  3Q8D A;  4MHE A;  1EFW A;  4TKO B;  4ZKC B;  3TN2 A;  5GRO A;  4CKE A;  1IL2 A;  1YNN C;  4DAY A;  2B8G A;  1HNW Q;  3GTL H;  5J1Z A;  4GNX C;  1Q82 C;  2YTV A;  4BBS B;  2RKS A;  1H9M A;  2DN8 A;  3M85 A;  1D5X C;  1TS4 A;  2K1B A;  2BE5 D;  3HOW G;  2R93 G;  4K6L A;  4A3M B;  4K14 A;  1ZEQ X;  5IGD A;  4ME3 A;  4KHZ A;  1TWF B;  3PUW A;  4Z9C B;  1TII D;  3OTO L;  2CFM A;  1Z6H A;  4X64 Q;  3CRK C;  1VQ8 A;  3DXJ C;  1MD2 D;  4CJ2 C;  1WTV A;  2JA8 B;  4DR7 Q; 
#chains in the Genus database with same CATH homology
 1A0I A;  2ZJQ A;  4C3I H;  3PGZ A;  2Z0S A;  1PH7 A;  2UXB L;  3I4N H;  4P74 A;  4FDB A;  4A3K G;  2ASB A;  1QUQ A;  1UEB A;  4DPG A;  1E24 A;  4K0K Q;  3EN2 A;  3GTG H;  4LFA Q;  3K7A H;  2JA6 H;  2VQE L;  3HOU H;  4DR6 L;  1QVG A;  2N3S A;  4MTN A;  4JI2 L;  4LF7 L;  2ATW A;  4C3H H;  4X6A H;  3VDY A;  2NN6 G;  3M9B A;  3M4P A;  5H1S E;  1VCI A;  5C3E G;  1YIJ A;  2EIF A;  1VQE A;  3LGJ A;  2JE6 I;  3TQY A;  1JE5 A;  3A5U A;  1EUJ A;  5M3M H;  4JI5 Q;  2BH2 A;  1O7I A;  4LFB Q;  1A63 A;  3PSI A;  1FJG Q;  1G51 A;  2QGQ A;  1PYB A;  4HJ5 A;  4B3S L;  1D7Q A;  4DV0 L;  3S2D H;  1PV4 A;  1GM5 A;  4LNQ A;  3D31 A;  4LUV A;  1OXV A;  2UUA Q;  4IFD G;  2JK8 A;  1QZG A;  3CD6 A;  3BZC A;  4QL5 A;  4X62 L;  3JAM c;  3FKI G;  2VW9 A;  4XIG S;  4DR4 Q;  1XTD A;  2OQK A;  3HOZ H;  2UUB Q;  4GN4 B;  1FGU A;  4JBJ A;  4ALP A;  1N9W A;  4DV4 Q;  2K4K A;  1XNQ Q;  5FLM H;  2D0P A;  2UXC Q;  2IHF A;  3HOX G;  3S15 H;  3HKS A;  1UE7 A;  2B3G A;  4DR2 Q;  3I2Z A;  2B63 G;  2OCE A;  4PZ6 A;  2B29 A;  4POG A;  1ASY A;  3T1H Q;  1JT8 A;  1BBW A;  4A93 G;  4OWX B;  1WI5 A;  1N32 Q;  2R92 G;  4H02 A;  4YWM A;  4HJ7 A;  3K7U C;  2YTY A;  5M3F G;  1KIX A;  1VQK A;  1NE3 A;  4GOP A;  4NXN L;  4Y7N H;  4B3M L;  1K8G A;  2H5X A;  3PF5 A;  4YY3 L;  3ULL A;  3RLF A;  5LMN W;  1W3S A;  4DV6 Q;  3WWV A;  2NN6 I;  2I5H A;  3J80 i;  3J81 i;  3KOJ A;  1J6Q A;  4YHH Q;  4DV5 L;  1H95 A;  2HQL A;  3GDE A;  5JJK A;  2WAQ E;  1L1O B;  3U4Z A;  4GN5 A;  2VUM G;  1HNX L;  5IYD G;  1MKH A;  4B3T Q;  4RG1 A;  1QZH A;  4JI6 L;  1MJC A;  2AMC B;  4GKJ L;  3S1R H;  1KL9 A;  2RHS B;  1VS0 A;  3AEV A;  1HNZ Q;  4BY7 G;  1SN8 A;  4IJL A;  2QA4 A;  4JYA L;  2IHE A;  4DUZ Q;  4DV3 L;  4IFD I;  3RR5 A;  4GOP B;  1KC8 C;  5IYC G;  2VQF L;  5M5W H;  2MFI A;  5FJ8 G;  4A3B H;  1JJ2 A;  2K52 A;  4R1J A;  2ZM6 Q;  3CP0 A;  3ULP A;  1PVO A;  3RLN A;  1I6H H;  3G71 A;  5IP7 G;  1Q46 A;  4TVA B;  1VQH A;  4HJA A;  4PZ7 A;  4WJ4 A;  2YU9 H;  3PO2 G;  1YJN A;  2YTX A;  4JI1 Q;  1VQ5 A;  1GO3 E;  2VS1 A;  1S3O A;  4WJ3 M;  1OXX K;  1RL2 A;  2LSS A;  4P71 A;  5EAY A;  5HGQ A;  4A3E G;  1P16 A;  1VQL A;  4UY8 C;  4BBS H;  4L5S A;  4A3I G;  1X9N A;  4R4O A;  2UU9 L;  1K0R A;  3HKZ E;  4R4T A;  2R7Z G;  4GKK L;  5JJL A;  4LWC A;  3UE0 A;  4LF8 L;  1VQA A;  4LUO A;  2VY3 A;  4UP9 A;  5C44 H;  5M5Y H;  1JMC A;  4A75 A;  4KHP L;  1EYG A;  4MZ9 A;  3TS0 A;  4JV5 Q;  4O2D A;  4A3M H;  4MNO A;  3A0J A;  3STB C;  2UXD Q;  1CSQ A;  2F3I A;  1TWF H;  3A5Z B;  4IPG A;  4YCW A;  3I4O A;  4A3J H;  3KFU A;  4DV2 L;  3CCM A;  4YWL A;  4A3F G;  2VNU D;  1I5F A;  1CUK A;  3PO3 H;  4X65 Q;  1NMF A;  2JEA I;  3PUY A;  1DGS A;  2PNH A;  2D62 A;  4GS3 A;  1JB7 A;  1IYJ B;  2OQ0 A;  2JA8 H;  2JA9 A;  3CW2 C;  4AYB G;  1AH9 A;  1PYS B;  1TWA H;  1SRO A;  2LXK A;  4POF A;  2IY5 B;  3CC4 A;  2JA7 H;  4Y52 H;  1Y1W G;  3GO5 A;  1K83 H;  1XPR A;  4DR3 Q;  2EQS A;  2Y0S E;  4C2M H;  1WJJ A;  1WOC A;  4JBM A;  1Q81 C;  1EIF A;  1BVS A;  3CPF A;  4GNX A;  1VQ9 A;  1I3Q H;  2CCZ A;  2RHQ B;  1OXS C;  1N33 Q;  4TQU S;  2JA6 G;  2KBN A;  3KDF A;  1X3F A;  2ALY B;  5J3B A;  2XTI A;  4QQB X;  2UUC Q;  1D8L A;  4LW1 A;  3ZJY C;  4DR1 L;  3PUV A;  3HOY G;  1TWC H;  3D0F A;  4L5T A;  1W2B A;  3S2H H;  2VZA A;  2D0O A;  3RNU A;  1KQS A;  1AE2 A;  1U5K A;  4IPD A;  3S1N H;  1EIY B;  4NB3 A;  3RN5 A;  2HHH Q;  5M3M G;  1YI2 A;  4UP7 A;  3G4S A;  1IBL Q;  4B3R L;  3CAM A;  1A62 A;  3CF5 A;  3MXN B;  4LF9 L;  3KLW A;  4YWK A;  1R9T H;  3HOW H;  1X3E A;  2GVA A;  3NEL A;  2NZO A;  2JA5 H;  1XNR Q;  2R93 H;  1WFQ A;  1Y14 B;  3CXC A;  2KHJ A;  1HZB A;  4RMF A;  5M5X H;  2IX0 A;  1VQM A;  1PHJ A;  1HR0 L;  1NMG A;  4BXX G;  4BBR H;  1FVI A;  4DV7 L;  1N36 Q;  2F4V Q;  2ZTE A;  1K3R A;  5IY0 A;  1N34 Q;  3ERS X;  1Y1V H;  2JJQ A;  3HFZ B;  4L5Q A;  1C7Y A;  3K0X A;  5LMN Q;  3T1Y L;  4LF4 Q;  2GVB A;  3HOZ G;  1Q12 A;  1IBK Q;  3S14 H;  2MQH A;  3GTQ H;  1SMX A;  1QUQ B;  1IBM Q;  1G29 1;  4YCU A;  4X66 Q;  1XMO L;  1VQP A;  3E9I A;  2R6G A;  1I94 Q;  4LF6 L;  2NVX H;  2A8V A;  4JI7 L;  1HJP A;  3RZO H;  1E3P A;  2N78 A;  4LFC Q;  2E5L L;  2MO0 A;  4A76 A;  3KYH C;  4YCV A;  3UDI A;  3F2D A;  4O0A A;  1UE6 A;  2PQA A;  4A3K H;  1KHI A;  5BR8 Q;  4J15 A;  4JBK A;  5IP9 G;  3G6E A;  1HNW L;  1L1O C;  3CQZ H;  2CWA A;  2K14 A;  4DUY L;  4OXP A;  1CKN A;  4AH6 A;  5IWA Q;  3ICE A;  1X6O A;  1X54 A;  3I55 A;  1TXY A;  2KEN A;  5C3E H;  1V1Q A;  3ER0 A;  3B6Y A;  3CME A;  1CKM A;  2WAQ G;  2WFW A;  1KD1 C;  1Q7Y C;  4GOP C;  4BA2 I;  4IOA A;  1UE1 A;  1YVC A;  4JOI A;  1XMQ Q;  2DUD A;  4OON A;  1OTC A;  2MNA A;  2Q2T A;  2ZTC A;  4JI4 Q;  4UP8 A;  1Z9F A;  4A3L H;  2PQA B;  4A3D G;  1EQR A;  4DAM A;  4DV1 L;  2E8G A;  4OX9 L;  3PIP A;  1PH5 A;  1NTG A;  1E7Z A;  1UWV A;  4X64 L;  1N8R C;  4LF5 Q;  3PCO B;  4JCV E;  4AQY Q;  1NY4 A;  1CKN B;  3FKI H;  4JC0 A;  1B8A A;  1PH1 A;  1OXU A;  1TWG H;  3BJU A;  4QGU A;  5HY6 A;  3TRZ A;  5IE8 A;  4DR7 L;  5AJ3 Q;  4QIW E;  4AIM A;  5LMU L;  2NVT H;  3HOX H;  4NXM Q;  4HIK A;  1X56 A;  4JI3 Q;  2PMZ E;  2B63 H;  3OTO Q;  4JI8 L;  1YBY A;  1HZ9 A;  1E1O A;  4K0K L;  1AE3 A;  3H3V H;  1J5E Q;  1YHA A;  1VQO A;  1CKO A;  4LFA L;  3HOV H;  4JI0 Q;  5C0X J;  3PIO A;  3KJP A;  1LTL A;  5M3F H;  4BBS G;  4DR5 Q;  1MJE A;  4P73 A;  3M3Y H;  1Q1B A;  1PH9 A;  5C44 G;  5IYB H;  3UDG A;  2UXB Q;  4PMW A;  1VQG A;  4JBW A;  4QJF A;  1VQ4 A;  1CSP A;  3GTO H;  4JI5 L;  3PUZ A;  1WCM G;  3E9H A;  4HJ8 A;  4LFB L;  1SRU A;  2L15 A;  4GLV B;  1IXR A;  4NPS A;  4A3M G;  3S16 H;  1FJG L;  2VQE Q;  4DR6 Q;  2VUM H;  2K50 A;  1G6P A;  1K9M C;  2IT1 A;  4JI2 Q;  1UE5 A;  3BZK A;  3TRE A;  2A1A A;  1K8A C;  4LF7 Q;  4OO1 I;  4IFD J;  1EOV A;  3J81 j;  1X3G A;  1KAW A;  5JEA G;  2ZJR A;  1YZ6 A;  2UUA L;  3CPW A;  2CKZ B;  1QVF A;  4DNI A;  4DR4 L;  3TEH B;  2QEX A;  2UUB L;  2JA8 G;  2I0Q A;  3RN2 A;  2Q2H A;  1YEZ A;  2F52 A;  4DV4 L;  1RIP A;  3S1Q H;  4B3S Q;  3AFP A;  1XNQ L;  4A3G H;  1C9O A;  3JAM i;  3F8T A;  4DV0 Q;  2UXC L;  4APV A;  1WYD A;  2JA7 G;  3AFQ A;  4DR2 L;  4KI0 A;  2Y0S G;  3I7F A;  3CCQ A;  1OXT A;  4X62 Q;  1YHQ A;  3T1H L;  4EQ5 A;  4JG2 A;  1SLJ A;  1N32 L;  2AHO B;  1VQJ A;  2R7F A;  5IP7 H;  2Z6K C;  2BA1 A;  2WP8 J;  4BY1 H;  1PH8 A;  3I4M G;  1VQC A;  1VQN A;  4A3E H;  3W5O A;  3L2P A;  1HZA A;  2PI2 E;  4A3I H;  1PFS A;  2R7Z H;  3I4N G;  1KRS A;  2DGY A;  4DV6 L;  4R4Q A;  4DR7 Q;  3CC7 A;  4PZ8 A;  2I5L X;  1T9H A;  3DLL A;  4YHH L;  3M4Q A;  3HOU G;  1S72 A;  1JJC B;  1HR0 W;  4DKA C;  1HH2 P;  4B3T L;  5JJI A;  5DLQ E;  4NXN Q;  3W1G A;  2JA5 G;  1GVP A;  4R4I A;  4B3M Q;  4P75 A;  4A3C H;  1XJV A;  5C4X H;  2Q2I A;  4XTC S;  2RF4 A;  4EX5 A;  4YY3 Q;  1HNZ L;  3CC2 A;  2KCM A;  1A8V A;  4BBR G;  4A3F H;  1BBU A;  2E2H H;  3S17 H;  3KF6 A;  4DUZ L;  3MEF A;  1B7Y B;  4DV5 Q;  1VQ6 A;  1VQD A;  1HZC A;  1Y1V G;  4KLK A;  4IJH A;  1HNX Q;  3M7N A;  2WB1 E;  3KF8 B;  1SR3 A;  3GTJ H;  1Z47 A;  4GNX B;  1KRT A;  5C0X G;  4JI6 Q;  3JC6 6;  4GKJ Q;  2BA0 A;  3EIV A;  5IT9 c;  5C4J H;  2ZM6 L;  3CMA A;  3KDF B;  4R4C A;  3BU2 A;  4JYA Q;  2LXJ A;  3F1Z A;  5LMU Q;  4P72 A;  3U58 A;  1B70 B;  4DV3 Q;  1YIT A;  3H0G H;  3L0O A;  4JI1 L;  4JI8 Q;  5FLM G;  3GTM H;  2VQF Q;  4HIO A;  1I50 H;  3S1M H;  3IRB A;  1BKB A;  2MO1 A;  2YYZ A;  1L0W A;  5JEA J;  1EWI A;  5GAG C;  5GAD C;  5GAE C;  2E2I H;  4HID A;  3KF6 B;  2NVQ H;  3CCJ A;  2N8N A;  3U4V A;  1XPO A;  1Q8K A;  3HOY H;  2K5V A;  4LUZ A;  4IPC A;  2RCN A;  3SGI A;  1LUZ A;  2E2J H;  3NEM A;  3GTP H;  4GLX A;  4JV5 L;  2FXQ A;  1E22 A;  4DK3 C;  2UXD L;  1NBW A;  2OTJ A;  2ID0 A;  3J7Z C;  2UU9 Q;  3TS2 A;  4GKK Q;  5ELO A;  4LF8 Q;  3UDF A;  3W1B A;  4A3L G;  4KHP Q;  4DK6 C;  2NZH A;  1X55 A;  4X65 L;  4HIM A;  4BXX H;  4OO1 G;  1X65 A;  3CCE A;  2ES2 A;  3UE1 A;  3PF4 A;  1PH2 A;  1S40 A;  4JOI C;  3PV0 A;  1M1K C;  1XPU A;  1L2F A;  1M90 C;  1YJ9 A;  3I56 A;  1VQI A;  4DV2 Q;  1K73 C;  4DR3 L;  1PH3 A;  2K5N A;  5C0X I;  3L7Z C;  1L1O A;  1LM0 A;  3CCV A;  2HIX A;  4L5R C;  3S24 A;  3CCL A;  1GD7 A;  2CWP A;  1N33 L;  3HOV G;  4A3B G;  1MIU A;  1PH4 A;  4IO9 A;  2UUC L;  2CQO A;  5IP9 H;  3CCS A;  1YJW A;  3U50 C;  4A4I A;  5IYB G;  1P8L A;  4A93 H;  1QVC A;  1Q86 C;  2HHH L;  2R92 H;  3AQQ A;  5GQO A;  1IBL L;  3HKZ G;  3OW2 A;  2N49 A;  2OWO A;  3ULJ A;  4IPH A;  1XNR L;  4DR1 Q;  1SFO H;  3K80 C;  1FL0 A;  4IOC A;  3KJO A;  1C0A A;  2Q2U A;  2ZJP A;  2F4V L;  3CCR A;  1TWH H;  1N36 L;  3UDX A;  4A3D H;  2NVY H;  3FHW A;  1N34 L;  1PA6 A;  3RZD H;  4LF4 L;  5K36 G;  5LMN L;  4B3R Q;  5IYD H;  3NEN A;  1Q1E A;  3F2B A;  1IBK L;  4LF9 Q;  4A3G G;  4A3J G;  1IBM L;  2KCT A;  1JJG A;  3GTK H;  2OTL A;  4UPA A;  3H15 A;  4X66 L;  4OWT B;  2YV5 A;  1I94 L;  4BY7 H;  3E0E A;  4OWW B;  1HR0 Q;  1ASZ A;  2R7D A;  2HT1 A;  3PO3 G;  2AWO A;  1EQQ A;  4LFC L;  4DV7 Q;  3FP9 A;  2XGT A;  1VQB A;  2EXD A;  2AWN A;  2ZTD A;  3K8A A;  1YHB A;  4DR5 L;  5IYC H;  1VQF A;  2VL6 A;  5FJ8 H;  5BR8 L;  3T1Y Q;  4BY1 G;  1V43 A;  2JQO A;  3M4O H;  3H3V I;  3CCU A;  1XMO Q;  1SE8 A;  5IWA L;  3K81 C;  3EBE A;  4GLA C;  3J80 c;  3J81 c;  4LF6 Q;  1YNX A;  3Q8D A;  2BH8 A;  4JI7 Q;  1EFW A;  2E5L Q;  2AKW B;  4GN3 B;  5GRO A;  1VQ7 A;  2HIV A;  2IX1 A;  1IL2 A;  3J7A 5;  3PO2 H;  5E7N A;  1WCM H;  3STB D;  1NJI C;  3GD7 A;  3PUX A;  1HNW Q;  1XMQ L;  3OYY A;  4DUY Q;  3GTL H;  4PG3 A;  4GNX C;  4JI4 L;  1U0L A;  1V9P A;  4A3C G;  1KXL A;  5C4X G;  5ELN A;  1Q82 C;  2YTV A;  1PH6 A;  3G48 A;  2JEB I;  3AYH B;  3M85 A;  4LF5 L;  2C35 B;  2KHI A;  4AQY L;  4C3J H;  3HOW G;  5FLX c;  2R93 G;  2WB1 G;  2GN5 A;  2K5H A;  4BA1 I;  1E1T A;  2PI2 A;  2Z6K A;  5AJ3 L;  4ME3 A;  3DM3 A;  2V1C C;  3NBH B;  4KHZ A;  4JI3 L;  4NXM L;  1LYL A;  3PUW A;  4DAY B;  4DV1 Q;  4OX9 Q;  3A74 A;  3OTO L;  2CFM A;  3F2C A;  2A19 A;  4X64 Q;  1VQ8 A;  1IZ6 A;  4HJ9 A;  3H0G G;  1J5E L;  4QY7 A;  4JI0 L;  4AYB E;  5GAH C;  3RLO A;  1GKH A;  2I5M X;  2K75 A;  3I4M H;  1Y1W H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...