4N8FA

Ccml from thermosynechococcus elongatus bp-1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
MKIARVCGTVTSTQKEDTLTGVKFLVLQYLGEDGEFLPDYEVAADTVGAGQDEWVLVSRGSAARHIINGTDKPIDAAVVAIIDTVSRDNYLLYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Interactions and structural variability of beta-carboxysomal shell protein CcmL.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
total genus 14
structure length 95
sequence length 95
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4n8fA00
4JW0A 4JVZA 4N8X1 5L37A 4N8FA 2QW7A 2RCFA 4I7AA 2HD3A 2Z9HA
chains in the Genus database with same CATH superfamily
1PTOH 5IGGA 3HOZH 2B2VC 1VQDA 5CV5A 3H94A 4N8FA 4PNYA 3EA6A 4M1UB 3BG3A 3SR1A 2M2LA 4Y7NB 5I6YA 4R4IA 5C0XJ 1P8LA 4IPCA 2GVAA 3A8IE 3PSIA 2BE5C 4HSPA 5D3DA 4BBSG 4BXXG 4CDEC 3H0GG 1ESFA 1Y8OB 4ULLA 2VW9A 1IYJB 1KD1C 2R3ZA 2DGYA 3HS0C 3FMCA 2F0TA 5CV9A 3GTPB 2WKCA 4ZKBB 1YHQA 4FNFA 5EAYA 3S24A 2ZTDA 4G7ZC 1Q46A 4L5TA 1EUJA 1XTCD 2F0KA 5M5XB 1N36L 1HUMA 1MHWC 2Y0SE 2B29A 4CKEA 2EYOA 2KHSA 1BQQT 2EQSA 3GTQH 1XYIA 1HA6A 4JI1Q 5A2QE 4S3SA 1KL9A 3BU2A 1V1QA 3CCMA 5H1SE 1TWHB 1M8AA 3OTOL 4BBRG 5EKIA 3GTMH 1N9WA 3NWSA 4NMZA 4LFAL 2E2IB 4RG1A 1VQ8A 2KCNA 2A19A 5J3BA 3B6YA 4LF5Q 3S2DB 2BE5D 3W3AA 2NYZD 1FNWA 4G57A 1II3A 4BY7H 3RMHA 1LT6D 2YTXA 1T5EA 3BDCA 2PCFB 1I94Q 4C3JG 1K9MC 3W1BA 2DNEA 2OQKA 4IOCA 4A3GG 2QCPX 1D5MC 5IYDG 4LK1C 1SFOB 2ATWA 4OEMB 1RKNA 5IT9E 2WAQE 3E5SA 2NVYH 4JI2L 2KCMA 1SR3A 1T9HA 1L2FA 3GTLB 1RL2A 2FHTA 4O1NA 1EIYB 3J81L 1DD2A 4PMWA 5CV8A 2VS1A 1Y1WG 2RF4A 4A3JG 1ENFA 4OO1H 1NTGA 1STBA 1TS3A 4FXKC 4JV5Q 1S5DD 4A3DH 3RR5A 2RSNA 5LMNL 1E2VA 1SJED 1WTVA 2Q2TA 4IOAA 3T1YL 1KDAA 3R2IA 5JAVA 5G3LD 4IPDA 2K5WA 2IJ0A 2PI2A 1O7IA 3HGBA 3SXHA 3VR2A 2XRSD 5CBAE 2B2UC 3GTJB 1B9NA 2Y0SG 3DEOA 2HQEA 5FLXL 4K5WA 3D0FA 2JA5B 1NAPA 2N78A 5IWAL 2PQAA 3E6ZX 2F52A 3Q24A 1TY2A 3MA2B 5KGUA 2JYOA 4A3BH 1YHAA 1VMCA 2MGSA 1CZGA 3KF6B 4NB3A 4HIDA 4X62L 4ZKCB 4FXDA 1ONLA 1PXUA 5CYUA 1X3FA 2ALYB 1FJGL 2IX3A 2RCNA 1XTDA 4CDCC 1VQPA 5C5MA 1X54A 1EYAA 1Q8KA 1TWCH 3K5NA 4RHSA 1EWHA 1QVFA 4BBSH 4BXXH 2NVXB 4L5SA 4IUTA 1FGUA 1ZEQX 1HNZQ 1AE2A 1LT3D 1S3OA 1JB3A 2B63B 2F0VA 1UEAB 5D3IB 1BO0A 1S5ED 3RD4A 3PIOA 1KC8C 2WAQG 1D8LA 2LY7A 1GUWA 2R93G 1BUVT 2A69C 1I6VC 2B39A 2OQ0A 5FO9B 3ONAB 1HJPA 4A3KB 1G51A 1A8VA 1F2YA 5AJ3L 3M9BA 1DONA 3A0JA 4BBRH 5IOCA 4HJAA 1XNRL 4UP8A 5IP9G 1PTOB 4JG2A 3HOZB 2FJ2A 2EYLA 4WRDA 5D65A 1HQMC 2NN6H 2E76C 4LWCA 4A3EG 1JWSD 2BDOA 3SEBA 1JOKA 4L5RC 3TS2A 5J39A 4C3IB 4C3JH 5EBCA 4DR7L 4KV6A 2BH8A 3K59A 1IBLL 1U0LA 4DV2L 4A3GH 5HGQA 4FF4A 1Y14B 4DV4L 1FGBD 4RH6A 3H3VI 5IYDH 4OONA 1HNWL 4DN4M 1H95A 1EWCA 3GTOH 2A69D 2LXJA 1NY4A 5C4JH 4C3HG 3W1GA 4JI7L 4BY1H 1MJCA 1RTNA 2MQHA 1F9PA 3HKZB 3HOYB 2PZUA 1PFNA 4A76A 1VQIA 1JORA 4KI0A 4IFDI 4TQUS 5C5LA 3RZDH 1X3QA 4A3JH 3CRKC 4GKKL 2M00A 4ZUJA 1SSOA 4H02A 4OGQC 5DAUA 1DM0B 4R4QA 5J22A 3GTMB 2K04A 3K0YA 4DU9A 3SK8A 1F2ZA 4FF1A 2K05A 1IBKQ 1U4PA 1A63A 4JI4L 1JCKB 4A93H 1BXTA 4A3IH 1X9NA 3L0OA 3M4YA 4BY7B 4J8QA 3AU7A 3CC4A 4JI0L 3Q8DA 3OMGA 1F77A 5ELFA 2WP8J 1R9TH 4U68A 1X6OA 4R8NA 3NXWA 2F0JA 4H44C 3PGZA 4QB4A 1PH1A 4IFDJ 1WVLA 2CH4A 1HFNA 1LTBD 5CORA 2VQEQ 1H9SA 1GD7A 3GV3A 1TXYA 4KD4A 3TP8A 2ZM6L 5KNDA 3KLWA 3U9SA 3TS0A 4PMCA 1QILA 4A3DB 5FK9C 4A3FH 1Z6HA 2UUAQ 3X3MA 4GZYC 2CVRA 2SNMA 2YTVA 4OWXB 1PFBA 3I70A 3W5OA 5JPMC 2N3SA 3K7UC 1K8AC 2I46A 2K5DA 1IL8A 4RCNA 1STNA 3NEMA 4ID6A 2K5QA 1XNQL 1QVCA 1HA5A 4AQYL 1ENCA 3KBGA 1IXRA 1GVPA 5CMDA 3HG9A 5HURA 1VQAA 1LO5D 3MXGA 4DV3L 3MXPA 4CKBA 3S1RB 3KFUA 1OO9B 3G71A 2D5DA 4JI5L 5IGCA 4F87A 1VMPA 5IP9H 4JBWA 3GD7A 3RN2A 1STGA 3FKIB 4HJ9A 5EPKA 3NWTA 1LTRD 5K5PA 3HZXA 3MAQA 4BWGB 4OELB 2KHIA 4KHPL 2YYZA 1A2UA 3CCRA 1ICFB 4DUYL 3DEPA 4JOIA 4KMUC 3AQQA 3A55A 1EY6A 2R7FA 4B3SL 5GAEC 3NE5B 5ELCA 3PUZA 4P74A 1ESRA 5IY0A 5K36H 5C6AA 2TMPA 3W2DA 2O2LD 2UXDL 1XMOQ 2E75C 1GJXA 4KJOA 3H15A 3MXUA 1D2BA 4IN3A 5C0XH 3H3VC 4K0KL 2VUMH 3PO2B 3I4OA 2Q8RE 4DNTB 2JA5G 3PO3H 3UI2A 3PIO3 2PYKA 2E2DC 5CV7A 3CC7A 3ZJYC 4PZ6A 4N8X1 3HKZE 4KY5A 3FP9A 4C56C 5JJIA 2NVQH 3VA7A 3M3YH 3HOVB 5IT9L 4Y7NH 1IBMQ 4CGYB 4IZ8A 4LF8L 3DM1A 1TWGB 1HR0Q 2EXDA 1BCPB 4JI6Q 2YU9H 1GHKA 1FNVA 1HUNA 1NUCA 2C5CA 1BCPF 1VQLA 3KF8A 5C4XB 1F9SA 1W6KA 1QE6A 3OW7A 2B63G 3T13A 1DYQA 1AFPA 3BDOA 1AP0A 4QJFA 4ILWA 4CHTB 2JN4A 3UE1A 3KDFA 1K0RA 4P73A 4KN4C 4BY1B 3CCJA 3IFTA 1VQMA 5EQ0A 1KIXA 1N32Q 1D1IA 5EKLA 1I4RA 2PMZB 3TN2A 4X65Q 2LSSA 3SK6A 5BN5A 1FR3A 2SEBD 2F03A 1I5FA 3RZDB 1NBWA 4A3KG 3MFGA 1FNUA 2V4DA 3OHXC 1TWHH 4DR4Q 5E1FA 3EIVA 2ZT9C 1HCZA 1D6EC 2G9HD 1EFWA 3FPPA 2AUJD 2ID0A 4HSVA 2F0UA 2KOLA 1HQRD 3J80E 2XSCA 4DR1L 3HOZG 3I4NB 1L1OB 4DXGA 4OX9L 3R8BA 1AE3A 1VF5C 3PUYA 4GKJL 1Q7YC 3WWVA 3PQIA 4A93B 1PH3A 3Q23A 3Q0AA 1QUQA 4A3IB 1ILQA 2F0QA 1TIID 2WB1B 1CHPD 2XN9C 2XIWA 5JJLA 1HRJA 1STYA 4C3IG 3JC66 3NBIA 3CMEA 2F0DA 5C4ZA 4UPAA 2R6GA 2IWHA 4PV1C 4GOPC 4F8MA 1SFOH 2QA4A 1EY4A 2PPBC 4IUQA 1V1PA 2LS01 1QWYA 2ICIA 2KUMA 3PIPA 3NTHA 2MNAA 2K7VA 3HKZG 3HOYG 3S15B 5C44H 1LM0A 2Z8LA 2NZHA 4LW1A 2N88A 1HZAA 3WOFA 1KNEA 4YHHQ 3L2PA 1EYDA 3R93A 3X3NA 3CC2A 1K8GA 2I5HA 1SYCA 1QNUA 2UUCL 3PUWA 1K83H 4A3FB 2UXBL 4KLKA 1EU3A 2HQLA 4QIWB 1LV9A 2BOSA 4KHZA 2SOBA 4DV6L 1TWAB 5JEAJ 5T1IA 2F1MA 4DR5Q 2NWGA 1YJWA 3OYYA 1V8QA 4BY7G 4JYAQ 4PZ7A 1X3EA 4APVA 3S16B 1SRUA 2I5MX 3JAMc 4IUNA 3TQYA 4DKAC 3GTJH 1HNXQ 1YJNA 1O80A 1B9MA 1CTMA 3DWQA 1GUNA 4MN3A 1S40A 3BVZA 1EYCA 1B50A 3M7NA 4JBMA 3FPUB 2H1EA 1KXLA 4BA2I 4FP5D 2P5ZX 3EFXD 3DHQA 4LNQA 1S5FD 2KENA 4X64Q 4UAIA 2MO1A 5IP7G 2QDBA 2RBMA 1CHQD 4OO1G 1WD0A 4JOIC 3J80i 4XXEA 3GQBA 4JI3Q 1Q90A 1V9PA 4A3DG 4DV0L 1PRTC 3V05A 1YITA 3TP5A 4EQPA 1C0AA 3NHHA 3WDNA 4V190 4GN5A 3F2CA 1BDOA 1C9OA 2BA0A 5M5YB 3D3RA 3ERQA 4XTCS 2BH2A 4DAYB 1VQOA 4RGTA 1WTWA 1V1OA 3U58A 4DV5Q 1R4QB 2VB2X 2G9DA 2PQEA 1WCMH 4X6AH 1E22A 3S9WA 3CD6A 2VUMB 3I3CA 1PZID 1EY5A 1JOQA 3PO3B 2K33A 3VYSA 1VDZA 4LF7L 3OIPA 1KQSA 1S5BD 4R9WA 1SAPA 4YY3L 2PMZE 2KQ3A 2KA7A 1OXTA 3FKIG 2NVQB 3M3YB 1KRTA 4OHJA 1PFMA 4DUZQ 1EOTA 1TWFB 4IALA 1J8IA 1PRTD 2J0TD 2H4OA 3LWUA 3T51B 1AH9A 3IFDA 1SLJA 1SNMA 3EBEA 2YU9B 1LTGD 4TVAB 4C3IH 5EBDA 5EPLA 3VYUA 2F3VA 4HCEA 1ML0D 5KNBA 3D4WA 1JWMD 3H6MA 4GN3B 2Q8TA 4HIMA 3IKJA 2RDHA 2WKDA 3ZYYX 1J5EL 1WD1A 2Z1CA 5BR8Q 3K5LA 2WB1E 4O0AA 2ZTCA 5M3MH 5ELNA 2FXQA 2V1CC 1PYWD 1LTTD 3NUCA 1D5ZC 3OSOA 2Z6BA 2A68C 5M5WH 3HOYH 2Z0SA 3AYHB 3SGIA 3NQTA 2AMCB 1GHJA 3PO2G 2PO4A 4FVMA 2HIVA 2FMMA 1QZGA 4CJ1B 4IPGA 2NVTB 2IW3A 3K5OA 2KEEA 2F4VL 1RF2D 2VQFL 3CCVA 1BVSA 2Z9HA 2QEJC 2IHEA 3HOVG 3UDFA 4N9TA 4IFDH 4CDDC 2NN6G 1ZYRC 1IYUA 4IO9A 1JE5A 1X56A 4G4KA 1EIFA 1EQTA 2Q2UA 4YCUA 2L9HA 1LYLA 4RHRA 4P2CB 2OF1A 3CP0A 4QIWE 5C4XG 4OIKA 3AEVA 2EE1A 2JSOA 2E5LQ 1JWUD 1N33Q 4P72A 2A68D 4TRDA 5ELBA 2Z4IA 4BY1G 1M4VA 5DM73 4IJLA 5KYLA 3TMEA 4NXNQ 1KDCA 4DV1Q 5C44B 3GTKB 3K8AA 3I4MB 4RKBA 2BA1A 5IP7H 1I50B 2EY5A 5CC4A 1X55A 1Y69U 3P20A 1D7QA 1MKHA 2MUYA 2M9VA 4H7BA 2AWOA 3PIP3 2UUBL 1WTXA 5FO7B 3PF4A 3A5UA 1K83B 1EY9A 1ZYRD 3DLLA 4X3UA 2EYPA 1TQOA 4QUFA 4KKSA 4A93G 1Q3LA 4A3IG 2WB1G 5IIFA 2VQEL 4R8IA 2PNHA 4DR6Q 4G7OC 4P75A 2KCTA 2KCCA 2F0NA 1ASYA 2MJ8A 1IW7C 5GQOA 1UNSA 4LF9Q 1ZKOA 3KOJA 3HOWH 3ND8A 3M4OB 3OMCA 4EQOA 5IGDA 3S1RH 2X6LA 4X66Q 5I4DA 5LMUL 1NMGA 4GLXA 3HP3A 2Z6KA 2PZWA 3FKIH 1X32A 1HR0W 2PW7A 4J1MA 4GN4B 2HCCA 1IHZA 5JJKA 2DN8A 4YCVA 3VR4A 1EYGA 1GM5A 1QG7A 3F2UA 2OXPA 4A3FG 3K81C 2EJGC 1O78A 4B3TL 1RD9D 3HFZB 4DAMA 1WJJA 2K6AA 4DK0A 1G2TA 4LFBQ 4J15A 4DV7L 3OWFA 2B2YA 1OXUA 2LMCB 1K3BC 2AKWB 2RA4A 1K0SA 1LT5D 3BYYB 4OWWB 3J80L 1IW7D 3CCEA 4A4IA 2A6EC 4Q0FA 2EYMA 3U4ZA 1EWIA 1STHA 1WCMB 3PO2H 4UDUC 3QOLA 5E7NA 2RHSB 1J6QA 4JBJA 5C3WA 4DR3L 3V2TA 4UY8C 2K01A 1JICA 2F0OA 1Y8NB 4LUOA 3HOVH 1MBYA 1HH2P 2SDFA 3NK9A 1Q81C 3A8JE 1WOCA 3GO5A 1FVIA 1TWGH 2EXZA 2XGTA 4PMBA 2NB0A 4MIUA 2KVMA 5C4XH 1PYSB 4KD3A 1BBXC 4MNOA 2A6ED 5GADC 1N34L 3D8GA 1SYGA 4IUVA 2A6HC 1CKOA 1VQ7A 5K36G 1B2TA 1Y1VB 2HIXA 3TDQA 5M3MB 5J1ZA 4ZCKA 4NXMQ 1UE5A 1CI3M 2FINB 1H9MA 3I4LA 5M5WB 5C0XG 2EJMA 3C1EA 4IPHA 2NTSA 4L5QA 1UE6A 2VUMG 3PO3G 3OTOQ 4QF4A 1EY0A 2I0QA 4LUVA 1MI2A 4LFAQ 3HOUB 3RZOB 4B3RL 1I6HH 3EVQA 1F9QA 4L63B 1SE4A 3FEWX 3MXNB 2K50A 3G4SA 1O7YA 3NBHA 4J6HA 3I4NH 4LAAA 5JJZA 1RDPD 3SE0A 1ICWA 2R7ZH 2ZXPA 2B2TA 1UE7A 3U50C 1SXTA 4R1JA 4RAUC 2Q8IB 2KJXA 4KKTA 3M85A 3N52A 2QILA 4KKUA 4LJZC 3BS1A 2N8NA 2RDGA 4A3MB 3QO2A 2R92B 2KEDA 5JVH3 3VDYA 1HTLD 2A6HD 2L0CA 4K2KA 4DR4L 4JI2Q 4AYBB 1K73C 1NR4A 2KBNA 4G7HC 2EVBA 1ET9A 3OPOA 1XPOA 4B3ML 5JEAH 1XPRA 4K5XA 2L5TA 3D6CA 5FKAC 3PUVA 3S15H 2DY7A 2JP1A 2K4KA 4RGNA 2VNUD 4PQXA 3CAMA 5GROA 3M4PA 4K6LA 3ITPA 5LMNQ 2A74C 1KTKA 4I65A 1VQKA 3CF5A 3T1YQ 1CFMA 2Q2HA 2AUKA 4QL5A 2JA7B 5I9OA 1WTHA 1NSNS 1SE3A 4NPSA 1IL2A 4DR2Q 3ULPA 1TWAH 3E3XA 2UXCL 1TR5A 1ILPA 1PZKD 4RWSC 3S16H 1HPCA 1PA6A 4CDFC 1OXSC 3ULLA 5IWAQ 2PI2E 3EJIA 2Z6KC 2ENBA 3ERSX 3HOWB 1EIGA 1NMFA 1EL0A 4CKCA 4GOPB 1H9SB 1CKNA 1DXMA 1EY8A 1V43A 4ZAIA 1FJGQ 3AFPA 4ME5A 3M7GA 3M4QA 5C44G 5JPNC 2DJFC 2XTIA 1NE3A 4JCVE 1Z7TA 1YNXA 5JVG3 1XMQL 2HDLA 3VYTA 4DNRB 2E2JB 1NJIC 3PV0A 1E2WA 2K03A 4XYQA 1PTOC 2IT1A 3EQLC 3E0EA 2C35B 5M5YH 4DA2A 4LF6L 2CWAA 3C1FA 1WTRA 3NENA 1TS2A 1XXGA 5IYCH 4CBVA 1PH8A 1D5XC 5AJ3Q 1X65A 1PH2A 1WI5A 1STEA 2HHHL 2HT1A 5A35A 2ZJQA 3TBIB 4OIJA 3L9AX 3JAME 1EU4A 4DK3C 1ET6A 2QKIC 3CCSA 2R7DA 1VQ5A 1TWFH 4A3CH 1I4HA 5HGTA 4OL7A 1VQ9A 5CV4A 4KJNA 3TP6A 3SDZA 3K57A 4DV5L 3QWNA 2I07B 1Q1BA 4POGA 1PTOD 2N49A 1N8RC 5C4HA 4DR7Q 4HJ8A 1IBLQ 5CR3A 3BVMA 4DV2Q 5D14A 3UDIA 4DV4Q 2B2WA 2CWPA 3FHWA 1HNWQ 4FF3A 1PRTB 4RGMA 1Q8IA 3LNNA 4H13C 1TU2B 4QGUA 1ZXTA 2JXMB 3T1HL 4JI7Q 1PRTF 2NTTA 1NNXA 2E2HB 3ULJA 4FO2A 1WFQA 3TREA 2LFNA 2F0GA 4XQQA 2JEBI 5LL6X 3AB9A 1G6PA 4DUZL 1B3AA 3S2HB 1WCMG 1BF4A 4GKKQ 2QGQA 2Q2IA 4XT1B 4BA1I 4AYBE 3BZDB 1E7ZA 3R2TA 3HRZC 4GNXB 2SNSA 2B2TC 2JA6B 2NVTH 1I6HB 3S1MB 4HTHA 1VQNA 2VB3X 1LABA 1CA5A 5LHY1 2K32A 4JI4Q 1K8OA 3CCQA 4P71A 5BR8L 2R7ZB 2I5LX 4JI0Q 5E3FA 3I91A 1A3TA 3KF8B 2AWNA 3K0XA 4JI1L 4KHVA 2XWBB 1TS5A 2PW5A 1OXVA 3KLSA 1C48A 3TP7A 1XWEA 3RLFA 2KHJA 2CQAA 3TRZA 5M3MG 2L11A 3P75A 1AN8A 3D4DA 4I7AA 1GOZA 2ZM6Q 3C3LA 3J7AF 4LF5L 4JI8Q 4MTNA 5KNCA 3GTKH 1P16A 3I4MH 1YEZA 1I50H 1JC7A 1L0XB 1U4LA 4ZLTF 3HOUG 1F2MA 3JAMi 1I94L 3HOXB 4QCLA 2O4XA 2B3GA 5EGTA 1Q1EA 1YBYA 2QW7A 2OT2A 4A3LG 2MP1A 1QUQB 1YNNC 5ISRA 4IFDG 1ASZA 3S14B 1XNQQ 1HHVA 3J81c 4OWTB 1EZ8A 1RCVD 3MVVA 4AQYQ 1A0IA 4DV1L 4ZRZA 4ALPA 1UE1A 2R92G 3F2DA 4EGVA 3F1ZA 2K5NA 1LUZA 2F0MA 2WACA 4AYBG 3K6OA 1U4MA 3U9OA 4JI5Q 3M4OH 4JV5L 1IYVA 3LGJA 1DOKA 1MSGA 4DNIA 2D62A 5ELOA 3EN2A 2EPBA 1LT4D 2WAQB 2VZAA 1HXYD 1X3PA 3PF5A 2R93B 3DXJC 4AIMA 4DAYA 4KHPQ 1I4GA 1A3UA 3KLSX 1PDQA 2RDFA 4FXGC 4DUYQ 1YIJA 1YNND 4JC0A 3MEFA 5FLXc 2HUGA 1C8CA 1E1TA 2J7ZA 4B3SQ 2JA7G 4O2DA 2IL8A 1WTPA 4AH6A 2XNAC 4LF4Q 4Q5VA 1JJCB 1G6ZA 3E9IA 4R4TA 2UXDQ 2JQOA 4HR7B 3CKIB 4IUPA 3C46A 1SROA 4K0KQ 3TSSA 2F0PA 1UUPA 1H9RA 4GLVB 1UEBA 1QVGA 3T53B 3HOWG 1G2SA 5GAGC 3P7JA 1VQHA 3CPWA 1NR2A 1MJEA 1CA6A 1HNZL 4QY7A 1E0BA 3TZUA 2HDMA 1TT2A 4LF8Q 1E2ZA 3ER0A 1KAWA 4WJWA 2D9UA 2B2WC 1SMXA 1QOHA 4XQNA 4C2MH 1XPUA 5KYIA 2GVBA 4K2LA 1B44D 3I2ZA 2AHOB 3C2PA 1VQEA 2OTJA 3VA5A 1WTOA 1OTCA 2UU9Q 1SJHD 1Y1VH 1UWVA 2JE6I 2LXKA 3D6WA 1A62A 1GUOA 5E4XA 5LMNW 1YNJD 1QZHA 3G6JB 4U673 1O7LA 4M8AA 4KTAA 2L15A 3H3VH 1VQGA 3QG1A 3HOUH 1R4PB 3RZOH 4DR1Q 2D2CC 2J4XA 1GXDC 4I7ZC 1K28A 4OX9Q 1LTID 1JJ2A 4XT3B 4Y52H 4GKJQ 2L12A 3VR6A 1CSPA 4YWMA 1KLUD 4A3LH 4K8IA 2B8FA 4NKLA 3GTGH 1HZBA 4RFBA 4PZ8A 4DFAA 4DGZA 5DLQE 1SYDA 1S4ZA 4NXML 3S17B 2JA8B 3PMFA 1JB7A 3NPPA 1SDFA 4A3MH 2R92H 2X69A 2ES2A 1LTSD 1KRSA 4FF2A 4HJ7A 2MHVA 3V96A 3HEJA 1U5KA 3RN5A 4LMQD 1Z47A 3KBXA 4XQJA 5FLMH 1G8ZD 2EIFA 3J7AV 4Z9CB 4CJ2C 1IBKL 5BN3A 5C3EH 4X3KA 2F3WA 5I9PA 1AEXA 1ENAA 2JK8A 2DNCA 4HJ5A 1PH7A 1VQ6A 2PNRC 2CKZB 1VS0A 4K5VA 2UUCQ 2F3IA 2JA6G 2UXBQ 3MEHA 2MFIA 1DGSA 2IHFA 5KRUA 4DV6Q 4ZK9B 3I4NG 3RLOA 4LFCQ 2JA7H 2R7ZG 5IGFA 4ABNA 2OEOA 1EY7A 2RSOA 3PUXA 3JAML 3KF6A 3UDGA 1PV4A 1CZWA 3FRPB 1PFSA 1STAA 3G48A 1CM9A 4WORA 2CH4W 2E74C 4A75A 3I73A 4XIGS 4ODGA 2EY6A 5IE8A 5M3FH 2K28A 5JOBA 2QF7A 2UUAL 1C4QA 1Q82C 1FL0A 1DCZA 4QQBX 2D0PA 3NQIA 3A74A 2F0SA 5JEAG 1QB5D 1U4RA 4DR2L 2R61A 1CSQA 2IY5B 1CQFA 3G7LA 4UP9A 2G5DA 4YWLA 1VQCA 3L3OC 5I2XA 1EQQA 4OXPA 1MD2D 1W6JA 3K7AB 4DV0Q 1SNQA 3HOXG 2AQ2B 4DF7A 2E2JH 2VY3A 3J81j 3K5MA 3CU7A 4KK7A 4RMFA 3I90A 1AW7A 1B53A 1CQVA 3CQZH 5TSSA 4HN7A 2OTLA 3FVQA 3I8ZA 3GDEA 1EQRA 4DAVA 1BBUA 1RTOA 1EFID 3QIAA 4JW0A 3A54A 1XX8A 3OW2A 2A1AA 3QR8A 3QB3A 3N6RA 1OXXK 4EQ5A 1KHIA 5ELEA 5ELDA 4HMJA 3RLNA 2CW0C 1BKBA 2BDNA 1AZPA 2PQAB 4HIKA 4LF7Q 2PZTA 3LWEA 4DK1A 2RHQB 3GV6A 3H0GH 1PMRA 3T4AC 2QDLA 4YY3Q 2NUCA 4E6IA 2F0WA 1GUSA 1KNAA 3UE0A 1B7YB 3DMUA 2CHBD 3CW2C 4LUZA 3MWYW 3D4RA 2C9OA 1BBWA 2WFWA 3E9HA 2CFMA 5IGEA 1CKMA 1L0YB 2FFKB 5EJWA 1D1KA 1TKWB 1A6XA 2RCFA 1YVCA 1VQ4A 1XMOL 4C2MB 1T5XD 2JEAI 2IPKD 2RVLA 3BYTB 4ZUIA 1NCVA 2WINB 1MIUA 1J5EQ 1JMCA 3TZDA 1SYFA 5DM63 3IRBA 2E2HH 3MXNA 2CW0D 3U4VA 1PTOF 1EZ6A 5CBEE 1N36Q 5IYCG 1B3QA 5IT9c 1GO3E 4DAPA 3MTSA 3S2HH 3G6EA 1SYEA 1IBML 3GP7A 3S1QH 3CCLA 2K75A 2ZXRA 1RHPA 3SVMA 2GA4B 1HR0L 2B8GA 4JI6L 1HZCA 2F4VQ 4RGOS 4JBKA 3KK7A 2VQFQ 4QUCA 4XDXA 1M1KC 2MO0A 2NZOA 5M9OA 1YI2A 2JA6H 3S1MH 4HIOA 1F2LA 2VL6A 3GTGB 4A3CG 1EIHA 1SYBA 3KLRA 4YWKA 3GTQB 1N32L 2EYHA 4RCOA 5DNFA 3DWAA 1S72A 2ZTEA 4EQNA 1Y1WH 3AFQA 2K14A 4X65L 2TSSA 1LTLA 4K6DA 1K3RA 1JE4A 4PG3A 3K80C 4V0BA 2ICEC 4NDXA 2WIIB 4JPBW 4MHEA 3MC0B 3T16A 4IQZA 1S5CD 3CCUA 1BNZA 4HCSA 1IZ6A 1B70B 5I2YA 3KJOA 2K5VA 5C3EB 1VQFA 1HTPA 1G291 1SE8A 4TKOB 1SNPA 5CGKA 3Q6SA 3CHBD 2UUBQ 1CK1A 3DUZA 3LX0A 1JOOA 3ND9A 5KEEA 3HOXH 2EYFA 1GUGA 3NBHB 2O5JC 1CT1D 1H9KA 1PHJA 4OO1I 4HEDA 1TS4A 5F2DA 1GUTA 5IYBG 2NVYB 1I4XA 3BDLA 3S1NH 2CCZA 4F7XA 2IX1A 4GOPA 3S14H 2FMCA 3NTIA 2NZ1D 1I3QH 2JA8G 4O42A 4JI8L 2HD3A 2F0FA 2D0OA 1EQVA 1W3SA 3AMUA 4YHHL 4DPGA 5LL6S 3STBC 1I4QA 2DUDA 2WV6D 5LMUQ 5M3FB 4C1NI 4X62Q 1PLFA 4X3TA 5IODA 1IKMA 3FDTA 3RNUA 2AQ3B 5COYA 2K52A 4JK1C 4B08A 1E3PA 2JA9A 3D31A 2X6GA 2CQOA 1A3VA 2R93H 4DR5L 3I4MG 3KYHC 4JYAL 1YZ6A 1PH5A 4R4OA 2XRQD 4NW2A 4DK6C 4B3TQ 3DWPA 1KABA 2B2YC 3BZKA 1HNXL 3CQZB 1DJRD 3H91A 4YCWA 4DV7Q 1SMYC 2JJQA 1VCIA 4C1NK 3O13A 4A3BB 1JR0D 1RIPA 4RA8A 1Y8PB 1EOVA 4X3SA 1VQJA 1KAAA 3RUZA 3OIQA 3I72A 3STBD 1TY0A 3NELA 4YIJA 2LKVA 4POFA 1JJGA 1VQBA 4X64L 1HZ9A 4A3EH 1X3GA 1TWCB 5FJ8G 1W2BA 4ZQ3A 4BBSB 1CKNB 4JI3L 5A2QL 2K1BA 3P1HA 4DR3Q 1XJVA 1JT8A 3H0GB 1XNRQ 3NSWA 5I6WA 1RJTA 3J81E 2A73B 4IJHA 3TEHB 1MSHA 3E0JA 4C3HH 1PH6A 4LF4L 2XVSA 3J7A5 3A7LA 2BCOA 2A8VA 1O7ZA 2XWJB 1KDBA 5NUCA 4H0LC 1DOLA 3NTKA 3QOJA 4BS9A 2YTYA 1SMYD 3R3OA 3EROA 2NN6I 3IAYA 1SNOA 3A8KE 1SNDA 1N34Q 3OOCA 4CJ0B 4BBRB 4F88A 2EYJA 2RKSA 2EY1A 1SE2A 4GNXA 1Z9FA 3SK4A 3H09A 3K58A 1DZ1A 2L55A 1L1OA 1FYCA 3QJYA 1B8AA 3HKSA 5FLXE 2O5IC 3MZ5A 1PYBA 2EDGA 2B2VA 3S1QB 3I56A 4UHVA 4K14A 1SEBD 2ZJPA 4C3JB 4B3RQ 2Z4HA 1Q12A 4FYDA 5E4WC 4A3GB 5FOBB 2L1BA 3GTPH 1CUKA 3MFYA 4EVOA 2MPMA 1WTQA 3SHLA 3GTOB 1SNCA 2K5HA 5IYBH 5C4JB 2E8GA 1SBBB 1LTAD 2UU9L 5M5XH 1BR9A 5GAHC 3I55A 4ZYSA 2F0LA 4FDBA 3S17H 2JA8H 1Y1WB 2F4IA 1AZQA 4A3JB 4B9XA 3Q22A 1E24A 4DXFA 2F0EA 1DOMA 5KIXA 4KY7A 2NBFA 4ME3A 4IUUA 3VYRA 1Q86C 2E2IH 3BJUA 3KDFB 3BVGA 2EZVA 1PH4A 4B3MQ 3L7ZC 3S2DH 5IGBA 3PCOB 4WJ3M 1Y1VG 1WYDA 1PZJD 1C7YA 3KJPA 2AQ1B 4EX5A 3A56A 4KY6A 3KUPA 1E1OA 2F0IA 3OWEB 1JQYD 1M90C 3J81i 1J9OA 2Y0SB 3UDXA 3NP8A 5EPJA 4HAEA 1QCBD 4TSSA 2DY8A 1R9TB 1MGSA 3CRLC 1K8MA 4MTKA 1LACA 5DEHA 2E5LL 1N33L 1LLRD 1UAPA 2QEXA 2UXCQ 1U9RA 1BOSA 3GTLH 4KN7C 4GS3A 3F8TA 3S1NB 1B4OA 3I7FA 1I3QB 4NXNL 2GN5A 4GLAC 4A3MG 2VXWA 3BZCA 4NP5A 2OCEA 2ZJRA 5FJ8H 2KECA 1V1PB 4UP7A 4K8JA 1QNKA 4DV3Q 4JVZA 1G91A 4IURA 2DJGC 5FLMG 4LFCL 5T1GA 5HY6A 3A7AB 5C3EG 1RODA 2YV5A 1XMQQ 1GKHA 3J7ZC 2A5HA 3K7AH 4DR6L 2ZXOA 3CXCA 1L0WA 2JA5H 1YJ9A 3T56B 1HFGA 5G3LF 3MHBA 2B2UA 2RQXA 4LF6Q 4LF9L 2EOTA 5CV6A 3CMAA 1EEFD 1QJOA 5L37A 2L4NA 4X66L 1VF7A 1BCPC 4R4CA 1H9JA 1KLGD 4B9WA 3VR3A 1F9RA 4A3EB 2HHHQ 2NVXH 1TVXA 2IX0A 1PH9A 3SK5A 5M3FG 2HCIA 5C0XI 1I4PA 1B1ZA 2B63H 1YNJC 4L6TB 4N9PA 3J7YW 1FD7D 3A5ZB 1YHBA 2N55A 1PVOA 4WJ4A 3IL8A 4LFBL 4C3HB 3ICEA 3VR5A 4WFN3 1A2TA 3WOEA 3J80c 1EEID 4RKLA 5EKKA 1A15A 3F2BA 2F0HA 2ASBA 5BN4A 3URYA 4GNXC 3CPFA 5C3XA 4MZ9A 4A3KH 1IKLA 1SN8A 4XYOA 5FO8B 2H5XA 2OWOA 2EY2A 3T1HQ 2EJFC 4HMIA 1L1OC 4QMGA 4A3BG 3DM3A 5AFWA 1BCPD 4L8JA
chains in the Genus database with same CATH topology
4JW0A 4JVZA 4N8X1 5L37A 4N8FA 2QW7A 2RCFA 4I7AA 2HD3A 2Z9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW0 A;  4JVZ A;  4N8X 1;  5L37 A;  4N8F A;  2QW7 A;  2RCF A;  4I7A A;  2HD3 A;  2Z9H A; 
#chains in the Genus database with same CATH topology
 1PTO H;  5IGG A;  3HOZ H;  2B2V C;  1VQD A;  5CV5 A;  3H94 A;  4N8F A;  4PNY A;  3EA6 A;  4M1U B;  3BG3 A;  3SR1 A;  2M2L A;  4Y7N B;  5I6Y A;  4R4I A;  5C0X J;  1P8L A;  4IPC A;  2GVA A;  3A8I E;  3PSI A;  2BE5 C;  4HSP A;  5D3D A;  4BBS G;  4BXX G;  4CDE C;  3H0G G;  1ESF A;  1Y8O B;  4ULL A;  2VW9 A;  1IYJ B;  1KD1 C;  2R3Z A;  2DGY A;  3HS0 C;  3FMC A;  2F0T A;  5CV9 A;  3GTP B;  2WKC A;  4ZKB B;  1YHQ A;  4FNF A;  5EAY A;  3S24 A;  2ZTD A;  4G7Z C;  1Q46 A;  4L5T A;  1EUJ A;  1XTC D;  2F0K A;  5M5X B;  1N36 L;  1HUM A;  1MHW C;  2Y0S E;  2B29 A;  4CKE A;  2EYO A;  2KHS A;  1BQQ T;  2EQS A;  3GTQ H;  1XYI A;  1HA6 A;  4JI1 Q;  5A2Q E;  4S3S A;  1KL9 A;  3BU2 A;  1V1Q A;  3CCM A;  5H1S E;  1TWH B;  1M8A A;  3OTO L;  4BBR G;  5EKI A;  3GTM H;  1N9W A;  3NWS A;  4NMZ A;  4LFA L;  2E2I B;  4RG1 A;  1VQ8 A;  2KCN A;  2A19 A;  5J3B A;  3B6Y A;  4LF5 Q;  3S2D B;  2BE5 D;  3W3A A;  2NYZ D;  1FNW A;  4G57 A;  1II3 A;  4BY7 H;  3RMH A;  1LT6 D;  2YTX A;  1T5E A;  3BDC A;  2PCF B;  1I94 Q;  4C3J G;  1K9M C;  3W1B A;  2DNE A;  2OQK A;  4IOC A;  4A3G G;  2QCP X;  1D5M C;  5IYD G;  4LK1 C;  1SFO B;  2ATW A;  4OEM B;  1RKN A;  5IT9 E;  2WAQ E;  3E5S A;  2NVY H;  4JI2 L;  2KCM A;  1SR3 A;  1T9H A;  1L2F A;  3GTL B;  1RL2 A;  2FHT A;  4O1N A;  1EIY B;  3J81 L;  1DD2 A;  4PMW A;  5CV8 A;  2VS1 A;  1Y1W G;  2RF4 A;  4A3J G;  1ENF A;  4OO1 H;  1NTG A;  1STB A;  1TS3 A;  4FXK C;  4JV5 Q;  1S5D D;  4A3D H;  3RR5 A;  2RSN A;  5LMN L;  1E2V A;  1SJE D;  1WTV A;  2Q2T A;  4IOA A;  3T1Y L;  1KDA A;  3R2I A;  5JAV A;  5G3L D;  4IPD A;  2K5W A;  2IJ0 A;  2PI2 A;  1O7I A;  3HGB A;  3SXH A;  3VR2 A;  2XRS D;  5CBA E;  2B2U C;  3GTJ B;  1B9N A;  2Y0S G;  3DEO A;  2HQE A;  5FLX L;  4K5W A;  3D0F A;  2JA5 B;  1NAP A;  2N78 A;  5IWA L;  2PQA A;  3E6Z X;  2F52 A;  3Q24 A;  1TY2 A;  3MA2 B;  5KGU A;  2JYO A;  4A3B H;  1YHA A;  1VMC A;  2MGS A;  1CZG A;  3KF6 B;  4NB3 A;  4HID A;  4X62 L;  4ZKC B;  4FXD A;  1ONL A;  1PXU A;  5CYU A;  1X3F A;  2ALY B;  1FJG L;  2IX3 A;  2RCN A;  1XTD A;  4CDC C;  1VQP A;  5C5M A;  1X54 A;  1EYA A;  1Q8K A;  1TWC H;  3K5N A;  4RHS A;  1EWH A;  1QVF A;  4BBS H;  4BXX H;  2NVX B;  4L5S A;  4IUT A;  1FGU A;  1ZEQ X;  1HNZ Q;  1AE2 A;  1LT3 D;  1S3O A;  1JB3 A;  2B63 B;  2F0V A;  1UEA B;  5D3I B;  1BO0 A;  1S5E D;  3RD4 A;  3PIO A;  1KC8 C;  2WAQ G;  1D8L A;  2LY7 A;  1GUW A;  2R93 G;  1BUV T;  2A69 C;  1I6V C;  2B39 A;  2OQ0 A;  5FO9 B;  3ONA B;  1HJP A;  4A3K B;  1G51 A;  1A8V A;  1F2Y A;  5AJ3 L;  3M9B A;  1DON A;  3A0J A;  4BBR H;  5IOC A;  4HJA A;  1XNR L;  4UP8 A;  5IP9 G;  1PTO B;  4JG2 A;  3HOZ B;  2FJ2 A;  2EYL A;  4WRD A;  5D65 A;  1HQM C;  2NN6 H;  2E76 C;  4LWC A;  4A3E G;  1JWS D;  2BDO A;  3SEB A;  1JOK A;  4L5R C;  3TS2 A;  5J39 A;  4C3I B;  4C3J H;  5EBC A;  4DR7 L;  4KV6 A;  2BH8 A;  3K59 A;  1IBL L;  1U0L A;  4DV2 L;  4A3G H;  5HGQ A;  4FF4 A;  1Y14 B;  4DV4 L;  1FGB D;  4RH6 A;  3H3V I;  5IYD H;  4OON A;  1HNW L;  4DN4 M;  1H95 A;  1EWC A;  3GTO H;  2A69 D;  2LXJ A;  1NY4 A;  5C4J H;  4C3H G;  3W1G A;  4JI7 L;  4BY1 H;  1MJC A;  1RTN A;  2MQH A;  1F9P A;  3HKZ B;  3HOY B;  2PZU A;  1PFN A;  4A76 A;  1VQI A;  1JOR A;  4KI0 A;  4IFD I;  4TQU S;  5C5L A;  3RZD H;  1X3Q A;  4A3J H;  3CRK C;  4GKK L;  2M00 A;  4ZUJ A;  1SSO A;  4H02 A;  4OGQ C;  5DAU A;  1DM0 B;  4R4Q A;  5J22 A;  3GTM B;  2K04 A;  3K0Y A;  4DU9 A;  3SK8 A;  1F2Z A;  4FF1 A;  2K05 A;  1IBK Q;  1U4P A;  1A63 A;  4JI4 L;  1JCK B;  4A93 H;  1BXT A;  4A3I H;  1X9N A;  3L0O A;  3M4Y A;  4BY7 B;  4J8Q A;  3AU7 A;  3CC4 A;  4JI0 L;  3Q8D A;  3OMG A;  1F77 A;  5ELF A;  2WP8 J;  1R9T H;  4U68 A;  1X6O A;  4R8N A;  3NXW A;  2F0J A;  4H44 C;  3PGZ A;  4QB4 A;  1PH1 A;  4IFD J;  1WVL A;  2CH4 A;  1HFN A;  1LTB D;  5COR A;  2VQE Q;  1H9S A;  1GD7 A;  3GV3 A;  1TXY A;  4KD4 A;  3TP8 A;  2ZM6 L;  5KND A;  3KLW A;  3U9S A;  3TS0 A;  4PMC A;  1QIL A;  4A3D B;  5FK9 C;  4A3F H;  1Z6H A;  2UUA Q;  3X3M A;  4GZY C;  2CVR A;  2SNM A;  2YTV A;  4OWX B;  1PFB A;  3I70 A;  3W5O A;  5JPM C;  2N3S A;  3K7U C;  1K8A C;  2I46 A;  2K5D A;  1IL8 A;  4RCN A;  1STN A;  3NEM A;  4ID6 A;  2K5Q A;  1XNQ L;  1QVC A;  1HA5 A;  4AQY L;  1ENC A;  3KBG A;  1IXR A;  1GVP A;  5CMD A;  3HG9 A;  5HUR A;  1VQA A;  1LO5 D;  3MXG A;  4DV3 L;  3MXP A;  4CKB A;  3S1R B;  3KFU A;  1OO9 B;  3G71 A;  2D5D A;  4JI5 L;  5IGC A;  4F87 A;  1VMP A;  5IP9 H;  4JBW A;  3GD7 A;  3RN2 A;  1STG A;  3FKI B;  4HJ9 A;  5EPK A;  3NWT A;  1LTR D;  5K5P A;  3HZX A;  3MAQ A;  4BWG B;  4OEL B;  2KHI A;  4KHP L;  2YYZ A;  1A2U A;  3CCR A;  1ICF B;  4DUY L;  3DEP A;  4JOI A;  4KMU C;  3AQQ A;  3A55 A;  1EY6 A;  2R7F A;  4B3S L;  5GAE C;  3NE5 B;  5ELC A;  3PUZ A;  4P74 A;  1ESR A;  5IY0 A;  5K36 H;  5C6A A;  2TMP A;  3W2D A;  2O2L D;  2UXD L;  1XMO Q;  2E75 C;  1GJX A;  4KJO A;  3H15 A;  3MXU A;  1D2B A;  4IN3 A;  5C0X H;  3H3V C;  4K0K L;  2VUM H;  3PO2 B;  3I4O A;  2Q8R E;  4DNT B;  2JA5 G;  3PO3 H;  3UI2 A;  3PIO 3;  2PYK A;  2E2D C;  5CV7 A;  3CC7 A;  3ZJY C;  4PZ6 A;  4N8X 1;  3HKZ E;  4KY5 A;  3FP9 A;  4C56 C;  5JJI A;  2NVQ H;  3VA7 A;  3M3Y H;  3HOV B;  5IT9 L;  4Y7N H;  1IBM Q;  4CGY B;  4IZ8 A;  4LF8 L;  3DM1 A;  1TWG B;  1HR0 Q;  2EXD A;  1BCP B;  4JI6 Q;  2YU9 H;  1GHK A;  1FNV A;  1HUN A;  1NUC A;  2C5C A;  1BCP F;  1VQL A;  3KF8 A;  5C4X B;  1F9S A;  1W6K A;  1QE6 A;  3OW7 A;  2B63 G;  3T13 A;  1DYQ A;  1AFP A;  3BDO A;  1AP0 A;  4QJF A;  4ILW A;  4CHT B;  2JN4 A;  3UE1 A;  3KDF A;  1K0R A;  4P73 A;  4KN4 C;  4BY1 B;  3CCJ A;  3IFT A;  1VQM A;  5EQ0 A;  1KIX A;  1N32 Q;  1D1I A;  5EKL A;  1I4R A;  2PMZ B;  3TN2 A;  4X65 Q;  2LSS A;  3SK6 A;  5BN5 A;  1FR3 A;  2SEB D;  2F03 A;  1I5F A;  3RZD B;  1NBW A;  4A3K G;  3MFG A;  1FNU A;  2V4D A;  3OHX C;  1TWH H;  4DR4 Q;  5E1F A;  3EIV A;  2ZT9 C;  1HCZ A;  1D6E C;  2G9H D;  1EFW A;  3FPP A;  2AUJ D;  2ID0 A;  4HSV A;  2F0U A;  2KOL A;  1HQR D;  3J80 E;  2XSC A;  4DR1 L;  3HOZ G;  3I4N B;  1L1O B;  4DXG A;  4OX9 L;  3R8B A;  1AE3 A;  1VF5 C;  3PUY A;  4GKJ L;  1Q7Y C;  3WWV A;  3PQI A;  4A93 B;  1PH3 A;  3Q23 A;  3Q0A A;  1QUQ A;  4A3I B;  1ILQ A;  2F0Q A;  1TII D;  2WB1 B;  1CHP D;  2XN9 C;  2XIW A;  5JJL A;  1HRJ A;  1STY A;  4C3I G;  3JC6 6;  3NBI A;  3CME A;  2F0D A;  5C4Z A;  4UPA A;  2R6G A;  2IWH A;  4PV1 C;  4GOP C;  4F8M A;  1SFO H;  2QA4 A;  1EY4 A;  2PPB C;  4IUQ A;  1V1P A;  2LS0 1;  1QWY A;  2ICI A;  2KUM A;  3PIP A;  3NTH A;  2MNA A;  2K7V A;  3HKZ G;  3HOY G;  3S15 B;  5C44 H;  1LM0 A;  2Z8L A;  2NZH A;  4LW1 A;  2N88 A;  1HZA A;  3WOF A;  1KNE A;  4YHH Q;  3L2P A;  1EYD A;  3R93 A;  3X3N A;  3CC2 A;  1K8G A;  2I5H A;  1SYC A;  1QNU A;  2UUC L;  3PUW A;  1K83 H;  4A3F B;  2UXB L;  4KLK A;  1EU3 A;  2HQL A;  4QIW B;  1LV9 A;  2BOS A;  4KHZ A;  2SOB A;  4DV6 L;  1TWA B;  5JEA J;  5T1I A;  2F1M A;  4DR5 Q;  2NWG A;  1YJW A;  3OYY A;  1V8Q A;  4BY7 G;  4JYA Q;  4PZ7 A;  1X3E A;  4APV A;  3S16 B;  1SRU A;  2I5M X;  3JAM c;  4IUN A;  3TQY A;  4DKA C;  3GTJ H;  1HNX Q;  1YJN A;  1O80 A;  1B9M A;  1CTM A;  3DWQ A;  1GUN A;  4MN3 A;  1S40 A;  3BVZ A;  1EYC A;  1B50 A;  3M7N A;  4JBM A;  3FPU B;  2H1E A;  1KXL A;  4BA2 I;  4FP5 D;  2P5Z X;  3EFX D;  3DHQ A;  4LNQ A;  1S5F D;  2KEN A;  4X64 Q;  4UAI A;  2MO1 A;  5IP7 G;  2QDB A;  2RBM A;  1CHQ D;  4OO1 G;  1WD0 A;  4JOI C;  3J80 i;  4XXE A;  3GQB A;  4JI3 Q;  1Q90 A;  1V9P A;  4A3D G;  4DV0 L;  1PRT C;  3V05 A;  1YIT A;  3TP5 A;  4EQP A;  1C0A A;  3NHH A;  3WDN A;  4V19 0;  4GN5 A;  3F2C A;  1BDO A;  1C9O A;  2BA0 A;  5M5Y B;  3D3R A;  3ERQ A;  4XTC S;  2BH2 A;  4DAY B;  1VQO A;  4RGT A;  1WTW A;  1V1O A;  3U58 A;  4DV5 Q;  1R4Q B;  2VB2 X;  2G9D A;  2PQE A;  1WCM H;  4X6A H;  1E22 A;  3S9W A;  3CD6 A;  2VUM B;  3I3C A;  1PZI D;  1EY5 A;  1JOQ A;  3PO3 B;  2K33 A;  3VYS A;  1VDZ A;  4LF7 L;  3OIP A;  1KQS A;  1S5B D;  4R9W A;  1SAP A;  4YY3 L;  2PMZ E;  2KQ3 A;  2KA7 A;  1OXT A;  3FKI G;  2NVQ B;  3M3Y B;  1KRT A;  4OHJ A;  1PFM A;  4DUZ Q;  1EOT A;  1TWF B;  4IAL A;  1J8I A;  1PRT D;  2J0T D;  2H4O A;  3LWU A;  3T51 B;  1AH9 A;  3IFD A;  1SLJ A;  1SNM A;  3EBE A;  2YU9 B;  1LTG D;  4TVA B;  4C3I H;  5EBD A;  5EPL A;  3VYU A;  2F3V A;  4HCE A;  1ML0 D;  5KNB A;  3D4W A;  1JWM D;  3H6M A;  4GN3 B;  2Q8T A;  4HIM A;  3IKJ A;  2RDH A;  2WKD A;  3ZYY X;  1J5E L;  1WD1 A;  2Z1C A;  5BR8 Q;  3K5L A;  2WB1 E;  4O0A A;  2ZTC A;  5M3M H;  5ELN A;  2FXQ A;  2V1C C;  1PYW D;  1LTT D;  3NUC A;  1D5Z C;  3OSO A;  2Z6B A;  2A68 C;  5M5W H;  3HOY H;  2Z0S A;  3AYH B;  3SGI A;  3NQT A;  2AMC B;  1GHJ A;  3PO2 G;  2PO4 A;  4FVM A;  2HIV A;  2FMM A;  1QZG A;  4CJ1 B;  4IPG A;  2NVT B;  2IW3 A;  3K5O A;  2KEE A;  2F4V L;  1RF2 D;  2VQF L;  3CCV A;  1BVS A;  2Z9H A;  2QEJ C;  2IHE A;  3HOV G;  3UDF A;  4N9T A;  4IFD H;  4CDD C;  2NN6 G;  1ZYR C;  1IYU A;  4IO9 A;  1JE5 A;  1X56 A;  4G4K A;  1EIF A;  1EQT A;  2Q2U A;  4YCU A;  2L9H A;  1LYL A;  4RHR A;  4P2C B;  2OF1 A;  3CP0 A;  4QIW E;  5C4X G;  4OIK A;  3AEV A;  2EE1 A;  2JSO A;  2E5L Q;  1JWU D;  1N33 Q;  4P72 A;  2A68 D;  4TRD A;  5ELB A;  2Z4I A;  4BY1 G;  1M4V A;  5DM7 3;  4IJL A;  5KYL A;  3TME A;  4NXN Q;  1KDC A;  4DV1 Q;  5C44 B;  3GTK B;  3K8A A;  3I4M B;  4RKB A;  2BA1 A;  5IP7 H;  1I50 B;  2EY5 A;  5CC4 A;  1X55 A;  1Y69 U;  3P20 A;  1D7Q A;  1MKH A;  2MUY A;  2M9V A;  4H7B A;  2AWO A;  3PIP 3;  2UUB L;  1WTX A;  5FO7 B;  3PF4 A;  3A5U A;  1K83 B;  1EY9 A;  1ZYR D;  3DLL A;  4X3U A;  2EYP A;  1TQO A;  4QUF A;  4KKS A;  4A93 G;  1Q3L A;  4A3I G;  2WB1 G;  5IIF A;  2VQE L;  4R8I A;  2PNH A;  4DR6 Q;  4G7O C;  4P75 A;  2KCT A;  2KCC A;  2F0N A;  1ASY A;  2MJ8 A;  1IW7 C;  5GQO A;  1UNS A;  4LF9 Q;  1ZKO A;  3KOJ A;  3HOW H;  3ND8 A;  3M4O B;  3OMC A;  4EQO A;  5IGD A;  3S1R H;  2X6L A;  4X66 Q;  5I4D A;  5LMU L;  1NMG A;  4GLX A;  3HP3 A;  2Z6K A;  2PZW A;  3FKI H;  1X32 A;  1HR0 W;  2PW7 A;  4J1M A;  4GN4 B;  2HCC A;  1IHZ A;  5JJK A;  2DN8 A;  4YCV A;  3VR4 A;  1EYG A;  1GM5 A;  1QG7 A;  3F2U A;  2OXP A;  4A3F G;  3K81 C;  2EJG C;  1O78 A;  4B3T L;  1RD9 D;  3HFZ B;  4DAM A;  1WJJ A;  2K6A A;  4DK0 A;  1G2T A;  4LFB Q;  4J15 A;  4DV7 L;  3OWF A;  2B2Y A;  1OXU A;  2LMC B;  1K3B C;  2AKW B;  2RA4 A;  1K0S A;  1LT5 D;  3BYY B;  4OWW B;  3J80 L;  1IW7 D;  3CCE A;  4A4I A;  2A6E C;  4Q0F A;  2EYM A;  3U4Z A;  1EWI A;  1STH A;  1WCM B;  3PO2 H;  4UDU C;  3QOL A;  5E7N A;  2RHS B;  1J6Q A;  4JBJ A;  5C3W A;  4DR3 L;  3V2T A;  4UY8 C;  2K01 A;  1JIC A;  2F0O A;  1Y8N B;  4LUO A;  3HOV H;  1MBY A;  1HH2 P;  2SDF A;  3NK9 A;  1Q81 C;  3A8J E;  1WOC A;  3GO5 A;  1FVI A;  1TWG H;  2EXZ A;  2XGT A;  4PMB A;  2NB0 A;  4MIU A;  2KVM A;  5C4X H;  1PYS B;  4KD3 A;  1BBX C;  4MNO A;  2A6E D;  5GAD C;  1N34 L;  3D8G A;  1SYG A;  4IUV A;  2A6H C;  1CKO A;  1VQ7 A;  5K36 G;  1B2T A;  1Y1V B;  2HIX A;  3TDQ A;  5M3M B;  5J1Z A;  4ZCK A;  4NXM Q;  1UE5 A;  1CI3 M;  2FIN B;  1H9M A;  3I4L A;  5M5W B;  5C0X G;  2EJM A;  3C1E A;  4IPH A;  2NTS A;  4L5Q A;  1UE6 A;  2VUM G;  3PO3 G;  3OTO Q;  4QF4 A;  1EY0 A;  2I0Q A;  4LUV A;  1MI2 A;  4LFA Q;  3HOU B;  3RZO B;  4B3R L;  1I6H H;  3EVQ A;  1F9Q A;  4L63 B;  1SE4 A;  3FEW X;  3MXN B;  2K50 A;  3G4S A;  1O7Y A;  3NBH A;  4J6H A;  3I4N H;  4LAA A;  5JJZ A;  1RDP D;  3SE0 A;  1ICW A;  2R7Z H;  2ZXP A;  2B2T A;  1UE7 A;  3U50 C;  1SXT A;  4R1J A;  4RAU C;  2Q8I B;  2KJX A;  4KKT A;  3M85 A;  3N52 A;  2QIL A;  4KKU A;  4LJZ C;  3BS1 A;  2N8N A;  2RDG A;  4A3M B;  3QO2 A;  2R92 B;  2KED A;  5JVH 3;  3VDY A;  1HTL D;  2A6H D;  2L0C A;  4K2K A;  4DR4 L;  4JI2 Q;  4AYB B;  1K73 C;  1NR4 A;  2KBN A;  4G7H C;  2EVB A;  1ET9 A;  3OPO A;  1XPO A;  4B3M L;  5JEA H;  1XPR A;  4K5X A;  2L5T A;  3D6C A;  5FKA C;  3PUV A;  3S15 H;  2DY7 A;  2JP1 A;  2K4K A;  4RGN A;  2VNU D;  4PQX A;  3CAM A;  5GRO A;  3M4P A;  4K6L A;  3ITP A;  5LMN Q;  2A74 C;  1KTK A;  4I65 A;  1VQK A;  3CF5 A;  3T1Y Q;  1CFM A;  2Q2H A;  2AUK A;  4QL5 A;  2JA7 B;  5I9O A;  1WTH A;  1NSN S;  1SE3 A;  4NPS A;  1IL2 A;  4DR2 Q;  3ULP A;  1TWA H;  3E3X A;  2UXC L;  1TR5 A;  1ILP A;  1PZK D;  4RWS C;  3S16 H;  1HPC A;  1PA6 A;  4CDF C;  1OXS C;  3ULL A;  5IWA Q;  2PI2 E;  3EJI A;  2Z6K C;  2ENB A;  3ERS X;  3HOW B;  1EIG A;  1NMF A;  1EL0 A;  4CKC A;  4GOP B;  1H9S B;  1CKN A;  1DXM A;  1EY8 A;  1V43 A;  4ZAI A;  1FJG Q;  3AFP A;  4ME5 A;  3M7G A;  3M4Q A;  5C44 G;  5JPN C;  2DJF C;  2XTI A;  1NE3 A;  4JCV E;  1Z7T A;  1YNX A;  5JVG 3;  1XMQ L;  2HDL A;  3VYT A;  4DNR B;  2E2J B;  1NJI C;  3PV0 A;  1E2W A;  2K03 A;  4XYQ A;  1PTO C;  2IT1 A;  3EQL C;  3E0E A;  2C35 B;  5M5Y H;  4DA2 A;  4LF6 L;  2CWA A;  3C1F A;  1WTR A;  3NEN A;  1TS2 A;  1XXG A;  5IYC H;  4CBV A;  1PH8 A;  1D5X C;  5AJ3 Q;  1X65 A;  1PH2 A;  1WI5 A;  1STE A;  2HHH L;  2HT1 A;  5A35 A;  2ZJQ A;  3TBI B;  4OIJ A;  3L9A X;  3JAM E;  1EU4 A;  4DK3 C;  1ET6 A;  2QKI C;  3CCS A;  2R7D A;  1VQ5 A;  1TWF H;  4A3C H;  1I4H A;  5HGT A;  4OL7 A;  1VQ9 A;  5CV4 A;  4KJN A;  3TP6 A;  3SDZ A;  3K57 A;  4DV5 L;  3QWN A;  2I07 B;  1Q1B A;  4POG A;  1PTO D;  2N49 A;  1N8R C;  5C4H A;  4DR7 Q;  4HJ8 A;  1IBL Q;  5CR3 A;  3BVM A;  4DV2 Q;  5D14 A;  3UDI A;  4DV4 Q;  2B2W A;  2CWP A;  3FHW A;  1HNW Q;  4FF3 A;  1PRT B;  4RGM A;  1Q8I A;  3LNN A;  4H13 C;  1TU2 B;  4QGU A;  1ZXT A;  2JXM B;  3T1H L;  4JI7 Q;  1PRT F;  2NTT A;  1NNX A;  2E2H B;  3ULJ A;  4FO2 A;  1WFQ A;  3TRE A;  2LFN A;  2F0G A;  4XQQ A;  2JEB I;  5LL6 X;  3AB9 A;  1G6P A;  4DUZ L;  1B3A A;  3S2H B;  1WCM G;  1BF4 A;  4GKK Q;  2QGQ A;  2Q2I A;  4XT1 B;  4BA1 I;  4AYB E;  3BZD B;  1E7Z A;  3R2T A;  3HRZ C;  4GNX B;  2SNS A;  2B2T C;  2JA6 B;  2NVT H;  1I6H B;  3S1M B;  4HTH A;  1VQN A;  2VB3 X;  1LAB A;  1CA5 A;  5LHY 1;  2K32 A;  4JI4 Q;  1K8O A;  3CCQ A;  4P71 A;  5BR8 L;  2R7Z B;  2I5L X;  4JI0 Q;  5E3F A;  3I91 A;  1A3T A;  3KF8 B;  2AWN A;  3K0X A;  4JI1 L;  4KHV A;  2XWB B;  1TS5 A;  2PW5 A;  1OXV A;  3KLS A;  1C48 A;  3TP7 A;  1XWE A;  3RLF A;  2KHJ A;  2CQA A;  3TRZ A;  5M3M G;  2L11 A;  3P75 A;  1AN8 A;  3D4D A;  4I7A A;  1GOZ A;  2ZM6 Q;  3C3L A;  3J7A F;  4LF5 L;  4JI8 Q;  4MTN A;  5KNC A;  3GTK H;  1P16 A;  3I4M H;  1YEZ A;  1I50 H;  1JC7 A;  1L0X B;  1U4L A;  4ZLT F;  3HOU G;  1F2M A;  3JAM i;  1I94 L;  3HOX B;  4QCL A;  2O4X A;  2B3G A;  5EGT A;  1Q1E A;  1YBY A;  2QW7 A;  2OT2 A;  4A3L G;  2MP1 A;  1QUQ B;  1YNN C;  5ISR A;  4IFD G;  1ASZ A;  3S14 B;  1XNQ Q;  1HHV A;  3J81 c;  4OWT B;  1EZ8 A;  1RCV D;  3MVV A;  4AQY Q;  1A0I A;  4DV1 L;  4ZRZ A;  4ALP A;  1UE1 A;  2R92 G;  3F2D A;  4EGV A;  3F1Z A;  2K5N A;  1LUZ A;  2F0M A;  2WAC A;  4AYB G;  3K6O A;  1U4M A;  3U9O A;  4JI5 Q;  3M4O H;  4JV5 L;  1IYV A;  3LGJ A;  1DOK A;  1MSG A;  4DNI A;  2D62 A;  5ELO A;  3EN2 A;  2EPB A;  1LT4 D;  2WAQ B;  2VZA A;  1HXY D;  1X3P A;  3PF5 A;  2R93 B;  3DXJ C;  4AIM A;  4DAY A;  4KHP Q;  1I4G A;  1A3U A;  3KLS X;  1PDQ A;  2RDF A;  4FXG C;  4DUY Q;  1YIJ A;  1YNN D;  4JC0 A;  3MEF A;  5FLX c;  2HUG A;  1C8C A;  1E1T A;  2J7Z A;  4B3S Q;  2JA7 G;  4O2D A;  2IL8 A;  1WTP A;  4AH6 A;  2XNA C;  4LF4 Q;  4Q5V A;  1JJC B;  1G6Z A;  3E9I A;  4R4T A;  2UXD Q;  2JQO A;  4HR7 B;  3CKI B;  4IUP A;  3C46 A;  1SRO A;  4K0K Q;  3TSS A;  2F0P A;  1UUP A;  1H9R A;  4GLV B;  1UEB A;  1QVG A;  3T53 B;  3HOW G;  1G2S A;  5GAG C;  3P7J A;  1VQH A;  3CPW A;  1NR2 A;  1MJE A;  1CA6 A;  1HNZ L;  4QY7 A;  1E0B A;  3TZU A;  2HDM A;  1TT2 A;  4LF8 Q;  1E2Z A;  3ER0 A;  1KAW A;  4WJW A;  2D9U A;  2B2W C;  1SMX A;  1QOH A;  4XQN A;  4C2M H;  1XPU A;  5KYI A;  2GVB A;  4K2L A;  1B44 D;  3I2Z A;  2AHO B;  3C2P A;  1VQE A;  2OTJ A;  3VA5 A;  1WTO A;  1OTC A;  2UU9 Q;  1SJH D;  1Y1V H;  1UWV A;  2JE6 I;  2LXK A;  3D6W A;  1A62 A;  1GUO A;  5E4X A;  5LMN W;  1YNJ D;  1QZH A;  3G6J B;  4U67 3;  1O7L A;  4M8A A;  4KTA A;  2L15 A;  3H3V H;  1VQG A;  3QG1 A;  3HOU H;  1R4P B;  3RZO H;  4DR1 Q;  2D2C C;  2J4X A;  1GXD C;  4I7Z C;  1K28 A;  4OX9 Q;  1LTI D;  1JJ2 A;  4XT3 B;  4Y52 H;  4GKJ Q;  2L12 A;  3VR6 A;  1CSP A;  4YWM A;  1KLU D;  4A3L H;  4K8I A;  2B8F A;  4NKL A;  3GTG H;  1HZB A;  4RFB A;  4PZ8 A;  4DFA A;  4DGZ A;  5DLQ E;  1SYD A;  1S4Z A;  4NXM L;  3S17 B;  2JA8 B;  3PMF A;  1JB7 A;  3NPP A;  1SDF A;  4A3M H;  2R92 H;  2X69 A;  2ES2 A;  1LTS D;  1KRS A;  4FF2 A;  4HJ7 A;  2MHV A;  3V96 A;  3HEJ A;  1U5K A;  3RN5 A;  4LMQ D;  1Z47 A;  3KBX A;  4XQJ A;  5FLM H;  1G8Z D;  2EIF A;  3J7A V;  4Z9C B;  4CJ2 C;  1IBK L;  5BN3 A;  5C3E H;  4X3K A;  2F3W A;  5I9P A;  1AEX A;  1ENA A;  2JK8 A;  2DNC A;  4HJ5 A;  1PH7 A;  1VQ6 A;  2PNR C;  2CKZ B;  1VS0 A;  4K5V A;  2UUC Q;  2F3I A;  2JA6 G;  2UXB Q;  3MEH A;  2MFI A;  1DGS A;  2IHF A;  5KRU A;  4DV6 Q;  4ZK9 B;  3I4N G;  3RLO A;  4LFC Q;  2JA7 H;  2R7Z G;  5IGF A;  4ABN A;  2OEO A;  1EY7 A;  2RSO A;  3PUX A;  3JAM L;  3KF6 A;  3UDG A;  1PV4 A;  1CZW A;  3FRP B;  1PFS A;  1STA A;  3G48 A;  1CM9 A;  4WOR A;  2CH4 W;  2E74 C;  4A75 A;  3I73 A;  4XIG S;  4ODG A;  2EY6 A;  5IE8 A;  5M3F H;  2K28 A;  5JOB A;  2QF7 A;  2UUA L;  1C4Q A;  1Q82 C;  1FL0 A;  1DCZ A;  4QQB X;  2D0P A;  3NQI A;  3A74 A;  2F0S A;  5JEA G;  1QB5 D;  1U4R A;  4DR2 L;  2R61 A;  1CSQ A;  2IY5 B;  1CQF A;  3G7L A;  4UP9 A;  2G5D A;  4YWL A;  1VQC A;  3L3O C;  5I2X A;  1EQQ A;  4OXP A;  1MD2 D;  1W6J A;  3K7A B;  4DV0 Q;  1SNQ A;  3HOX G;  2AQ2 B;  4DF7 A;  2E2J H;  2VY3 A;  3J81 j;  3K5M A;  3CU7 A;  4KK7 A;  4RMF A;  3I90 A;  1AW7 A;  1B53 A;  1CQV A;  3CQZ H;  5TSS A;  4HN7 A;  2OTL A;  3FVQ A;  3I8Z A;  3GDE A;  1EQR A;  4DAV A;  1BBU A;  1RTO A;  1EFI D;  3QIA A;  4JW0 A;  3A54 A;  1XX8 A;  3OW2 A;  2A1A A;  3QR8 A;  3QB3 A;  3N6R A;  1OXX K;  4EQ5 A;  1KHI A;  5ELE A;  5ELD A;  4HMJ A;  3RLN A;  2CW0 C;  1BKB A;  2BDN A;  1AZP A;  2PQA B;  4HIK A;  4LF7 Q;  2PZT A;  3LWE A;  4DK1 A;  2RHQ B;  3GV6 A;  3H0G H;  1PMR A;  3T4A C;  2QDL A;  4YY3 Q;  2NUC A;  4E6I A;  2F0W A;  1GUS A;  1KNA A;  3UE0 A;  1B7Y B;  3DMU A;  2CHB D;  3CW2 C;  4LUZ A;  3MWY W;  3D4R A;  2C9O A;  1BBW A;  2WFW A;  3E9H A;  2CFM A;  5IGE A;  1CKM A;  1L0Y B;  2FFK B;  5EJW A;  1D1K A;  1TKW B;  1A6X A;  2RCF A;  1YVC A;  1VQ4 A;  1XMO L;  4C2M B;  1T5X D;  2JEA I;  2IPK D;  2RVL A;  3BYT B;  4ZUI A;  1NCV A;  2WIN B;  1MIU A;  1J5E Q;  1JMC A;  3TZD A;  1SYF A;  5DM6 3;  3IRB A;  2E2H H;  3MXN A;  2CW0 D;  3U4V A;  1PTO F;  1EZ6 A;  5CBE E;  1N36 Q;  5IYC G;  1B3Q A;  5IT9 c;  1GO3 E;  4DAP A;  3MTS A;  3S2H H;  3G6E A;  1SYE A;  1IBM L;  3GP7 A;  3S1Q H;  3CCL A;  2K75 A;  2ZXR A;  1RHP A;  3SVM A;  2GA4 B;  1HR0 L;  2B8G A;  4JI6 L;  1HZC A;  2F4V Q;  4RGO S;  4JBK A;  3KK7 A;  2VQF Q;  4QUC A;  4XDX A;  1M1K C;  2MO0 A;  2NZO A;  5M9O A;  1YI2 A;  2JA6 H;  3S1M H;  4HIO A;  1F2L A;  2VL6 A;  3GTG B;  4A3C G;  1EIH A;  1SYB A;  3KLR A;  4YWK A;  3GTQ B;  1N32 L;  2EYH A;  4RCO A;  5DNF A;  3DWA A;  1S72 A;  2ZTE A;  4EQN A;  1Y1W H;  3AFQ A;  2K14 A;  4X65 L;  2TSS A;  1LTL A;  4K6D A;  1K3R A;  1JE4 A;  4PG3 A;  3K80 C;  4V0B A;  2ICE C;  4NDX A;  2WII B;  4JPB W;  4MHE A;  3MC0 B;  3T16 A;  4IQZ A;  1S5C D;  3CCU A;  1BNZ A;  4HCS A;  1IZ6 A;  1B70 B;  5I2Y A;  3KJO A;  2K5V A;  5C3E B;  1VQF A;  1HTP A;  1G29 1;  1SE8 A;  4TKO B;  1SNP A;  5CGK A;  3Q6S A;  3CHB D;  2UUB Q;  1CK1 A;  3DUZ A;  3LX0 A;  1JOO A;  3ND9 A;  5KEE A;  3HOX H;  2EYF A;  1GUG A;  3NBH B;  2O5J C;  1CT1 D;  1H9K A;  1PHJ A;  4OO1 I;  4HED A;  1TS4 A;  5F2D A;  1GUT A;  5IYB G;  2NVY B;  1I4X A;  3BDL A;  3S1N H;  2CCZ A;  4F7X A;  2IX1 A;  4GOP A;  3S14 H;  2FMC A;  3NTI A;  2NZ1 D;  1I3Q H;  2JA8 G;  4O42 A;  4JI8 L;  2HD3 A;  2F0F A;  2D0O A;  1EQV A;  1W3S A;  3AMU A;  4YHH L;  4DPG A;  5LL6 S;  3STB C;  1I4Q A;  2DUD A;  2WV6 D;  5LMU Q;  5M3F B;  4C1N I;  4X62 Q;  1PLF A;  4X3T A;  5IOD A;  1IKM A;  3FDT A;  3RNU A;  2AQ3 B;  5COY A;  2K52 A;  4JK1 C;  4B08 A;  1E3P A;  2JA9 A;  3D31 A;  2X6G A;  2CQO A;  1A3V A;  2R93 H;  4DR5 L;  3I4M G;  3KYH C;  4JYA L;  1YZ6 A;  1PH5 A;  4R4O A;  2XRQ D;  4NW2 A;  4DK6 C;  4B3T Q;  3DWP A;  1KAB A;  2B2Y C;  3BZK A;  1HNX L;  3CQZ B;  1DJR D;  3H91 A;  4YCW A;  4DV7 Q;  1SMY C;  2JJQ A;  1VCI A;  4C1N K;  3O13 A;  4A3B B;  1JR0 D;  1RIP A;  4RA8 A;  1Y8P B;  1EOV A;  4X3S A;  1VQJ A;  1KAA A;  3RUZ A;  3OIQ A;  3I72 A;  3STB D;  1TY0 A;  3NEL A;  4YIJ A;  2LKV A;  4POF A;  1JJG A;  1VQB A;  4X64 L;  1HZ9 A;  4A3E H;  1X3G A;  1TWC B;  5FJ8 G;  1W2B A;  4ZQ3 A;  4BBS B;  1CKN B;  4JI3 L;  5A2Q L;  2K1B A;  3P1H A;  4DR3 Q;  1XJV A;  1JT8 A;  3H0G B;  1XNR Q;  3NSW A;  5I6W A;  1RJT A;  3J81 E;  2A73 B;  4IJH A;  3TEH B;  1MSH A;  3E0J A;  4C3H H;  1PH6 A;  4LF4 L;  2XVS A;  3J7A 5;  3A7L A;  2BCO A;  2A8V A;  1O7Z A;  2XWJ B;  1KDB A;  5NUC A;  4H0L C;  1DOL A;  3NTK A;  3QOJ A;  4BS9 A;  2YTY A;  1SMY D;  3R3O A;  3ERO A;  2NN6 I;  3IAY A;  1SNO A;  3A8K E;  1SND A;  1N34 Q;  3OOC A;  4CJ0 B;  4BBR B;  4F88 A;  2EYJ A;  2RKS A;  2EY1 A;  1SE2 A;  4GNX A;  1Z9F A;  3SK4 A;  3H09 A;  3K58 A;  1DZ1 A;  2L55 A;  1L1O A;  1FYC A;  3QJY A;  1B8A A;  3HKS A;  5FLX E;  2O5I C;  3MZ5 A;  1PYB A;  2EDG A;  2B2V A;  3S1Q B;  3I56 A;  4UHV A;  4K14 A;  1SEB D;  2ZJP A;  4C3J B;  4B3R Q;  2Z4H A;  1Q12 A;  4FYD A;  5E4W C;  4A3G B;  5FOB B;  2L1B A;  3GTP H;  1CUK A;  3MFY A;  4EVO A;  2MPM A;  1WTQ A;  3SHL A;  3GTO B;  1SNC A;  2K5H A;  5IYB H;  5C4J B;  2E8G A;  1SBB B;  1LTA D;  2UU9 L;  5M5X H;  1BR9 A;  5GAH C;  3I55 A;  4ZYS A;  2F0L A;  4FDB A;  3S17 H;  2JA8 H;  1Y1W B;  2F4I A;  1AZQ A;  4A3J B;  4B9X A;  3Q22 A;  1E24 A;  4DXF A;  2F0E A;  1DOM A;  5KIX A;  4KY7 A;  2NBF A;  4ME3 A;  4IUU A;  3VYR A;  1Q86 C;  2E2I H;  3BJU A;  3KDF B;  3BVG A;  2EZV A;  1PH4 A;  4B3M Q;  3L7Z C;  3S2D H;  5IGB A;  3PCO B;  4WJ3 M;  1Y1V G;  1WYD A;  1PZJ D;  1C7Y A;  3KJP A;  2AQ1 B;  4EX5 A;  3A56 A;  4KY6 A;  3KUP A;  1E1O A;  2F0I A;  3OWE B;  1JQY D;  1M90 C;  3J81 i;  1J9O A;  2Y0S B;  3UDX A;  3NP8 A;  5EPJ A;  4HAE A;  1QCB D;  4TSS A;  2DY8 A;  1R9T B;  1MGS A;  3CRL C;  1K8M A;  4MTK A;  1LAC A;  5DEH A;  2E5L L;  1N33 L;  1LLR D;  1UAP A;  2QEX A;  2UXC Q;  1U9R A;  1BOS A;  3GTL H;  4KN7 C;  4GS3 A;  3F8T A;  3S1N B;  1B4O A;  3I7F A;  1I3Q B;  4NXN L;  2GN5 A;  4GLA C;  4A3M G;  2VXW A;  3BZC A;  4NP5 A;  2OCE A;  2ZJR A;  5FJ8 H;  2KEC A;  1V1P B;  4UP7 A;  4K8J A;  1QNK A;  4DV3 Q;  4JVZ A;  1G91 A;  4IUR A;  2DJG C;  5FLM G;  4LFC L;  5T1G A;  5HY6 A;  3A7A B;  5C3E G;  1ROD A;  2YV5 A;  1XMQ Q;  1GKH A;  3J7Z C;  2A5H A;  3K7A H;  4DR6 L;  2ZXO A;  3CXC A;  1L0W A;  2JA5 H;  1YJ9 A;  3T56 B;  1HFG A;  5G3L F;  3MHB A;  2B2U A;  2RQX A;  4LF6 Q;  4LF9 L;  2EOT A;  5CV6 A;  3CMA A;  1EEF D;  1QJO A;  5L37 A;  2L4N A;  4X66 L;  1VF7 A;  1BCP C;  4R4C A;  1H9J A;  1KLG D;  4B9W A;  3VR3 A;  1F9R A;  4A3E B;  2HHH Q;  2NVX H;  1TVX A;  2IX0 A;  1PH9 A;  3SK5 A;  5M3F G;  2HCI A;  5C0X I;  1I4P A;  1B1Z A;  2B63 H;  1YNJ C;  4L6T B;  4N9P A;  3J7Y W;  1FD7 D;  3A5Z B;  1YHB A;  2N55 A;  1PVO A;  4WJ4 A;  3IL8 A;  4LFB L;  4C3H B;  3ICE A;  3VR5 A;  4WFN 3;  1A2T A;  3WOE A;  3J80 c;  1EEI D;  4RKL A;  5EKK A;  1A15 A;  3F2B A;  2F0H A;  2ASB A;  5BN4 A;  3URY A;  4GNX C;  3CPF A;  5C3X A;  4MZ9 A;  4A3K H;  1IKL A;  1SN8 A;  4XYO A;  5FO8 B;  2H5X A;  2OWO A;  2EY2 A;  3T1H Q;  2EJF C;  4HMI A;  1L1O C;  4QMG A;  4A3B G;  3DM3 A;  5AFW A;  1BCP D;  4L8J A; 
#chains in the Genus database with same CATH homology
 4JW0 A;  4JVZ A;  4N8X 1;  5L37 A;  4N8F A;  2QW7 A;  2RCF A;  4I7A A;  2HD3 A;  2Z9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...