4N8FA

Ccml from thermosynechococcus elongatus bp-1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
MKIARVCGTVTSTQKEDTLTGVKFLVLQYLGEDGEFLPDYEVAADTVGAGQDEWVLVSRGSAARHIINGTDKPIDAAVVAIIDTVSRDNYLLYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Interactions and structural variability of beta-carboxysomal shell protein CcmL.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Structural protein
total genus 14
structure length 95
sequence length 95
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4n8fA00
2QW7A 2Z9HA 4JVZA 5L37A 2RCFA 4JW0A 2HD3A 4N8X1 4I7AA 4N8FA
chains in the Genus database with same CATH superfamily
4C3JG 1XPOA 2B2TC 2D0PA 3ERQA 4CDDC 4OXPA 5M3MB 4JW0A 2QEXA 3CCLA 2HDMA 3U9OA 4JOIA 3FP9A 4YWKA 3RZOB 1PLFA 4XYQA 4OEMB 1S40A 1X6OA 1L1OA 1YNNC 1AFPA 4JBWA 1SR3A 3ONAB 3AMUA 1Y8PB 3JC66 1SFOH 1B7YB 3NXWA 5EKIA 3FEWX 3R93A 4AYBB 5IYDG 4X62Q 1CHPD 1V8QA 4DR6Q 3PO3B 1JWMD 2MQHA 1HZ9A 1L0WA 3QR8A 1IBKQ 2H4OA 1J9OA 5I2YA 4HIKA 4CDEC 2D5DA 4X3UA 3H3VI 5IYDH 2Q8RE 5C44G 2AWNA 5LMUQ 4DK0A 1PYWD 5IT9c 4KK7A 1I94Q 2JA5H 5CV6A 2L11A 4B08A 2R7ZG 4IPDA 4A3IB 4NXML 1JOOA 2QW7A 5C44H 5JEAJ 1VQMA 3SK6A 4G7OC 4RMFA 5KEEA 1T5XD 4KD3A 5EAYA 3GTKH 3HOYG 4R4TA 2R3ZA 4POFA 1XX8A 2R7ZH 5IYBG 4IFDI 5IGBA 2B2TA 2C9OA 1I6HB 4WORA 4NDXA 4B3ML 3R3OA 1QVCA 2XIWA 5BN4A 4JI5L 1A2TA 4XQNA 4IOAA 5IYBH 3NWTA 1R9TH 3ND9A 4UDUC 2KHIA 4ZRZA 5F2DA 2VQFL 3QO2A 3GTQH 5KNDA 2F52A 2VB3X 1A15A 3TP6A 1UUPA 1S4ZA 1VQEA 2B8FA 4FDBA 5FK9C 1FR3A 1STNA 4DV6L 3PMFA 4NXMQ 4E6IA 3K0YA 5C0XJ 3M3YB 2EYMA 4KJNA 1IBML 1NAPA 1B44D 3PIPA 4KI0A 4JI8L 1GUWA 3Q8DA 1SJED 1SNCA 2A68D 3I55A 4X3KA 1ENFA 4APVA 1CSPA 2EDGA 1RCVD 4BY1G 2PW7A 3HOZG 1EYGA 3S14B 1ZYRD 1TQOA 4PQXA 3ZYYX 1EU4A 3IFDA 4RKLA 2O4XA 1TS5A 2K28A 1FNUA 4JI3Q 5T1GA 4HSPA 2K7VA 2JA7H 5LMNQ 2J4XA 4BY1H 4ID6A 5FJ8G 2PW5A 1ASYA 1N32L 4L8JA 3SGIA 2JQOA 3ITPA 1VQBA 4FXGC 4JCVE 4ZKCB 4R1JA 3I4NG 5EPLA 2XWJB 3CXCA 1YHQA 5FJ8H 2PCFB 4XXEA 1WCMB 3QOJA 4C1NK 2K5DA 2EE1A 3S1MB 1VQJA 1YITA 1F9RA 3E0JA 5CC4A 1E3PA 3I4NH 4RCOA 1S72A 1HR0L 1JR0D 4KKSA 3PF4A 1K8MA 2WKDA 2UUAQ 1MSGA 5C6AA 4DR3L 2E2HB 5CV8A 3TDQA 3D8GA 2VNUD 2Q8IB 3CRLC 4FF4A 3G6JB 5E4WC 5T1IA 3HOUH 1WTPA 3BDOA 2F0JA 4LAAA 4N8X1 3RLOA 1MJEA 3RLNA 2EY2A 4XDXA 1CZWA 1M1KC 1X3PA 1F9SA 2A19A 1DXMA 2FHTA 1V9PA 5C4JH 2B3GA 3MXNA 3RLFA 5I9PA 4V0BA 1WVLA 1K0SA 4LJZC 1EQVA 3SE0A 2YTVA 1LTAD 1C48A 1H9KA 5IODA 2A68C 3VYSA 4RFBA 1AZQA 3NBHB 5LL6X 1DONA 2K05A 2NN6G 2RSNA 5CV9A 2M00A 1ZYRC 4WFN3 1CA6A 2ZJPA 2EXDA 2SNSA 1LTRD 3TN2A 4DV1L 1N34Q 4AH6A 4KY7A 4K0KQ 1FJGL 4MHEA 4X3SA 1Q1BA 4YWLA 1PRTD 3RN5A 2NN6H 3I90A 3IRBA 4QL5A 1OO9B 4IUNA 1ESRA 3CHBD 4R8NA 3DWPA 5M5WH 1SEBD 1VQGA 3MHBA 4PMCA 1PTOF 1PTOD 4L5RC 3A54A 3ERSX 2Z4IA 4KLKA 3H6MA 4X6AH 1TWCH 3S15H 4UP7A 3GTOH 5J22A 4DU9A 1Q46A 4RH6A 1PYBA 4WJ4A 2PZWA 4N9PA 3AFQA 3MZ5A 3RUZA 2TMPA 3K7AH 2R93B 2F0OA 1HUNA 1MGSA 1PRTB 1XPUA 2HD3A 4RGTA 2L15A 1X56A 2PNRC 4LMQD 4DV1Q 3OSOA 1TWAB 2I5LX 1FJGQ 5COYA 4BS9A 4JYAQ 1HTPA 4RHRA 4A3IG 3TBIB 5IP7G 3A8JE 4H44C 4A3MB 3A5ZB 1II3A 1R4QB 1VMPA 2F0IA 1PTOB 4EQ5A 5IGFA 2IHFA 4KJOA 1NR4A 5C5LA 3Q24A 5ISRA 2ENBA 4M8AA 2O2LD 3KF6B 5C3EG 4G7ZC 1G51A 5IP7H 3FRPB 4LF4L 1SDFA 2RHSB 1GUGA 2KVMA 4HCEA 2JE6I 1SJHD 4DR4L 2NVQH 5FLMH 2QCPX 2AUKA 4DXFA 5IWAL 1I3QB 1EY4A 1IHZA 1SNMA 2NWGA 1HUMA 4C56C 3M7NA 2NTTA 3N52A 1E7ZA 1I4GA 3NE5B 1QG7A 1YJWA 1Y1WG 1KDAA 3I3CA 2NUCA 3NBHA 1PRTC 3PIOA 3OPOA 3MFYA 4TKOB 4IFDG 3VA7A 3J81j 1WTQA 2YU9B 1PFSA 4JI1Q 1Y1WH 1B70B 1OXXK 4LF6L 1S5ED 1YNJD 2JA6B 2E74C 3HKSA 3CC2A 3D4WA 1PTOC 2KCTA 4LF5Q 1SBBB 4LF4Q 4IFDH 3FKIG 1LT3D 2V4DA 4CBVA 1R4PB 2OT2A 5EQ0A 5EBDA 4A93B 1VQAA 4A3FB 2HCIA 2ATWA 4R9WA 2MHVA 4GNXB 1OXUA 1RTOA 2Q2IA 5IWAQ 3FKIH 3TZUA 3X3NA 3BS1A 2KCCA 1Q8IA 2HIVA 3T1HL 4A3EB 1PFNA 2GVAA 3EA6A 3D3RA 3OWFA 2HHHQ 1B4OA 4HN7A 5M5YB 4X65L 5JPMC 3T51B 4P74A 3D4DA 3I4OA 4C3HB 3KLSA 2LMCB 3I91A 1EIHA 1LO5D 1Q81C 2RDGA 2EYJA 1XXGA 1L0XB 2R7FA 3S1RH 3BVGA 1HZAA 4JBMA 1H95A 1SNDA 4YCWA 1BUVT 1E1TA 3J81E 2ZTEA 4CJ2C 1I5FA 1TY0A 3J80E 4ZUIA 2A6ED 1A2UA 2QEJC 3NENA 3GDEA 2K52A 4H7BA 2PYKA 3KF6A 4QMGA 4F8MA 1IYJB 1JQYD 3G7LA 3SK5A 3I72A 2FJ2A 1V1PB 4GNXC 4JI2L 4AYBE 1SFOB 3M4QA 4C3JB 4GN4B 5H1SE 1M90C 1QZGA 2K01A 1ASZA 3SEBA 3HKZG 1WTHA 2K75A 1E2VA 5CGKA 4X65Q 1CHQD 3OYYA 1YZ6A 3GTGH 4XYOA 3KOJA 1YNJC 3T1YL 2BH8A 2DGYA 1TS2A 3BDLA 4IPHA 5FLXE 1SNOA 3S9WA 4LF7L 1C4QA 5C44B 1JB3A 4TRDA 4KKUA 2B2YC 3JAMc 1B2TA 4HMJA 3GTKB 1O78A 2AQ1B 5ELBA 2R7ZB 4J8QA 1XYIA 1MI2A 2HQLA 4KN7C 1DOLA 4KD4A 3Q0AA 4JI0L 1HNWL 1H9JA 5GAHC 4GNXA 2CH4A 1BBWA 4DV7Q 3CRKC 1R9TB 4LF9Q 2EYPA 2NVYB 3K58A 1NSNS 1RKNA 3GTQB 5ELFA 1D5ZC 3D4RA 4IZ8A 4DV3L 3HOWH 5KIXA 3C46A 3UDXA 3DEOA 2E75C 1VS0A 1RF2D 4NXNL 1STBA 4LF7Q 2WIIB 2CVRA 2KJXA 2R93G 3H09A 3AEVA 4RGNA 4XQJA 4GS3A 3J81i 2A6EC 2UU9L 3J80i 2UXDQ 2XRQD 4IUPA 2RVLA 3V96A 1S5BD 1XMOL 1CA5A 1KIXA 5M3FH 2B2YA 3S2DH 2NVXH 5LL6S 1G6PA 1OXTA 4A3KG 3IFTA 1HFGA 1EYDA 4HJ8A 3OIQA 1AW7A 4IJHA 1C7YA 1JICA 3MXPA 1Y69U 3AYHB 2JJQA 4JI6L 1WD1A 1WTOA 2OCEA 1NJIC 2PQEA 3MAQA 4KMUC 2MPMA 3MVVA 1K3BC 4BY1B 2JP1A 1V1PA 4A3KH 4K5WA 3GTJB 1HPCA 3CC4A 2F0QA 2WP8J 3S16H 4POGA 4A75A 3DWQA 1SMXA 4I7ZC 2P5ZX 2CQAA 1PHJA 2IHEA 1EIGA 2A1AA 4OL7A 1X54A 4LF8L 4NXNQ 4DV0Q 1QZHA 2ES2A 3FDTA 4YY3L 4RWSC 1XMOQ 3I4NB 2K32A 1IXRA 1KLGD 1XPRA 4FF2A 1NMGA 1L2FA 2EY5A 1TR5A 1LTID 3ULPA 3RN2A 3HOVG 4A3CG 1KL9A 2KOLA 3RR5A 3TP7A 1PH2A 4DR2L 2R92G 2EPBA 4DUYQ 3STBD 4YCVA 4JI6Q 2UUCQ 1QNUA 3HOVH 1VF7A 3E9IA 2L5TA 3T56B 2G5DA 2F4VQ 3PIP3 2D62A 4A93G 2IT1A 4ZAIA 3A8KE 4A3FG 1ZKOA 2RDHA 2AHOB 2CHBD 3NQTA 1ZXTA 1KD1C 5C5MA 2N49A 4KHZA 2ZJRA 4PZ8A 5C4JB 4L63B 2LSSA 1FVIA 4FO2A 3GTLH 3D31A 4XT3B 3V05A 2AKWB 4YY3Q 1PFMA 2PQAB 5C4XG 1L1OC 4L5QA 3J81L 3J80L 1VQOA 1KNEA 2QILA 5C4HA 2F0PA 4BY7H 3ND8A 4B3SL 2VW9A 1FGUA 4L5TA 1B9NA 2I5MX 3BVMA 1GUSA 4DN4M 1SSOA 5I9OA 1WOCA 3G48A 2F4IA 1QILA 2KHJA 4DAVA 2UXBL 4JK1C 5M5WB 1DM0B 4IFDJ 4JI7Q 4A3DH 1YEZA 1DGSA 4HEDA 3K59A 1PH1A 1IZ6A 3HZXA 1CKMA 3AQQA 1D5XC 4KV6A 4CGYB 1V1OA 2EZVA 1TWCB 4PMBA 3S15B 2E8GA 4KY5A 3GV3A 1K8OA 2K5NA 3GTOB 4U68A 3U9SA 5FLXL 4JI4L 2OQKA 4RKBA 1NTGA 3D0FA 1QB5D 2F0LA 1EZ6A 4BBSG 2HUGA 4DNRB 2KQ3A 2L55A 3J7ZC 1C8CA 1C9OA 3TZDA 3S24A 4G57A 4XTCS 4KY6A 2EIFA 1X55A 1HJPA 3STBC 3KF8B 1AE2A 3IAYA 5FOBB 4BBSH 2JA5G 4IALA 3QG1A 4RA8A 4F7XA 1UEAB 2D0OA 3CCQA 2NZHA 4FNFA 5FO7B 2UXBQ 5DEHA 1XMQL 3K80C 1AP0A 4K5VA 1I4HA 1ONLA 1RODA 3KBGA 3KBXA 1N33Q 1IYUA 1RD9D 2F0NA 2QKIC 5NUCA 5KGUA 2VXWA 3G71A 1LABA 3GD7A 4KHVA 3V2TA 5C3EB 4DAMA 3G6EA 1GUOA 3J7A5 1IW7D 5KYIA 1FNWA 2A69D 3CU7A 2O5JC 4C3IH 4JBJA 4I7AA 1PH9A 3OW7A 1BNZA 3ULJA 4DKAC 4ZCKA 4XQQA 2E2JB 1O7YA 3AFPA 1FGBD 3SK4A 3WWVA 5HURA 4BWGB 2PQAA 1HR0W 3OHXC 1VF5C 1NR2A 5K36H 2KEDA 1X3GA 1DOMA 4N8FA 1BDOA 3URYA 1P8LA 1Y1WB 1RL2A 3QOLA 3NTIA 1X3QA 3Q23A 2Y0SG 5CV5A 5EKKA 5C3WA 3UDIA 2WB1G 4IPGA 2Z9HA 3BZKA 4LWCA 2DJGC 2L12A 3SXHA 1DYQA 4L5SA 1JJ2A 4H13C 4UP9A 3M9BA 3FKIB 2JA7G 3GQBA 3T4AC 4B3MQ 1STGA 3CAMA 1K0RA 4JI5Q 2F0KA 2B63G 1X32A 1Z47A 1J5EL 3F1ZA 4UPAA 1V1QA 3GP7A 2VQFQ 3F2BA 5EPJA 5JVH3 3H3VC 3TS2A 1VQFA 1EWCA 1CFMA 3CP0A 3P75A 2B63H 2HT1A 2MUYA 1U0LA 3KF8A 2VUMH 2AWOA 2ID0A 3E3XA 2K14A 4DV6Q 4BBRG 3NWSA 3WOFA 1U4MA 3EN2A 1IBMQ 4OX9L 1EZ8A 5LHY1 2KCMA 4MTKA 1Q82C 2QGQA 1F2LA 4JI8Q 2VL6A 3DM1A 1T5EA 1U4RA 2AQ2B 5DAUA 1EEFD 1IW7C 4BBRH 3PIO3 2A69C 3T13A 3HOUG 1IYVA 3K0XA 4K5XA 1I4RA 3NTHA 1S5CD 2A73B 3S1NH 1K8GA 1GUNA 5D14A 2X6LA 3W1BA 2I0QA 2UUBL 5EBCA 3OWEB 3H0GH 4R8IA 1SYDA 1VQ9A 1BBUA 1U9RA 3TS0A 2BCOA 2PZUA 4BA1I 2TSSA 3DXJC 3I4LA 3MXUA 4J6HA 3NPPA 3VDYA 4UHVA 1N32Q 2BA1A 4LUZA 3GTGB 4P2CB 1MD2D 4ME5A 1J6QA 4HR7B 2XVSA 2F3WA 4PNYA 4CKBA 3HKZB 1QWYA 1PH7A 1AZPA 3PUZA 3CMAA 4RGOS 1CUKA 4ZKBB 1H9MA 2KUMA 3U50C 1A3VA 1B3AA 5IE8A 4Q0FA 3GTMB 3EQLC 4A3JH 3VR5A 2FFKB 1LTLA 3PQIA 3SHLA 3CCVA 1KLUD 2F0WA 4R4QA 1HR0Q 4DR5L 1HQRD 1Q12A 2PMZB 2XWBB 1NBWA 3I7FA 4GKKL 4DR3Q 2Z1CA 2MJ8A 1B3QA 2DY7A 4YIJA 4J15A 1CKOA 2HIXA 3PV0A 2K6AA 4IPCA 3M4OH 2OXPA 1KRSA 5CV4A 4MZ9A 2QDBA 4HJ5A 1SMYD 4TQUS 2B2VC 2F0VA 1U5KA 3KJPA 3PSIA 4EX5A 1J8IA 4RG1A 1I6VC 3BU2A 3HOWB 5KYLA 5M5XH 4DK1A 2Z6BA 5JPNC 3VR3A 4A3BG 1GOZA 1Q86C 3PUYA 4NPSA 3I73A 1PZID 1PH4A 3P7JA 3K81C 2MO0A 1L0YB 5HGTA 3A8IE 2LKVA 1FD7D 4PMWA 3S2DB 1ESFA 5C4ZA 3N6RA 4A3BH 2NVXB 4GKKQ 3R2TA 2JSOA 1HZCA 4GOPB 3DLLA 1HH2P 4IO9A 2BA0A 2SDFA 2YTXA 2B29A 3UE1A 1YJ9A 1PZKD 2CQOA 5GAEC 2VQEL 3WDNA 3RNUA 4A3KB 2K33A 3RZOH 1QUQB 1Z9FA 4K6LA 4GN5A 2UXCL 5D65A 2B2VA 1CSQA 3S16B 1CQVA 4FP5D 5FLMG 1TWHH 4MIUA 1EY9A 1SE8A 1KXLA 2LXJA 1BQQT 3PO3H 1N8RC 4JV5L 2EYHA 4B9WA 3SR1A 1NE3A 3H15A 3E0EA 2Z6KC 4OO1H 2IY5B 1JJCB 1JMCA 1C0AA 4C1NI 2N88A 3NELA 3KYHC 2IX0A 5IOCA 3FHWA 4R4IA 1NCVA 2IPKD 4ZQ3A 2E2IH 1MJCA 4IOCA 2I07B 2NVTH 4L6TB 4GOPC 4JBKA 3HOVB 4GLXA 3GV6A 3VYRA 1SMYC 4DV4L 3M7GA 2R92B 1I6HH 2UXCQ 1NUCA 1W6JA 1MHWC 1MSHA 3S17B 1I4QA 4AQYL 3RZDH 3GO5A 4YCUA 3TQYA 1X3FA 3LNNA 3NBIA 3CCSA 3AU7A 3NK9A 4DUZL 3DUZA 1ZEQX 1NY4A 3GTPH 4HJ9A 4DR4Q 2XN9C 3S1QH 1A62A 1GM5A 5HY6A 1JE5A 3C1EA 4MN3A 3I2ZA 2Z6KA 4U673 5C4XB 5G3LF 2B2WC 1K28A 3CKIB 5G3LD 4LW1A 1UE1A 4GKJL 3RMHA 1CI3M 3PO2H 4QF4A 4CDCC 1X3EA 1Y8OB 4DV4Q 4GOPA 1A6XA 5JAVA 4LF6Q 2PI2A 1AEXA 4B3TL 1KQSA 1WTWA 3S14H 3DHQA 3KK7A 4A3DB 4O1NA 2EYOA 1Z6HA 1CT1D 1CTMA 1QUQA 2RSOA 2WFWA 4DUZQ 4DV5L 4IUVA 1PH8A 1YJNA 3CC7A 1SYEA 2C5CA 1NNXA 2PPBC 4LK1C 3M4PA 4KHPL 1SAPA 3KDFB 3CD6A 4NB3A 3T1HQ 5J39A 1QVGA 1U4LA 5EGTA 4MNOA 4QJFA 1XTCD 2NZOA 2X6GA 3NTKA 4FXKC 2B2WA 4BBSB 1Q8KA 3I4MG 2PNHA 1LYLA 4HMIA 5JEAH 2N78A 4DR7L 1DCZA 5I6YA 1VQKA 2H1EA 3T16A 1EUJA 1VQIA 1F77A 4X66L 1VQ7A 1VQLA 1XWEA 2ZJQA 3A55A 2JA5B 1HA6A 2ZTDA 2JEAI 1QCBD 2RDFA 3I4MH 1OXVA 3HG9A 3K5MA 5DM63 4DV2L 4S3SA 3CF5A 2LFNA 2JA9A 4BXXG 4GN3B 2ZXRA 2D2CC 2Z8LA 4N9TA 1EEID 4IUTA 4QQBX 1UWVA 4KKTA 2NZ1D 3H91A 2JN4A 2N55A 2RBMA 4JI2Q 1XNRL 3CMEA 3E5SA 4A4IA 4BXXH 3ER0A 1WD0A 5KNBA 5JVG3 3B6YA 3VA5A 3TP8A 3VYTA 3HOWG 1QJOA 1Y1VG 3E9HA 5DM73 5ELNA 4PV1C 2I46A 1WI5A 4WRDA 3P1HA 3T1YQ 5FO9B 3K5OA 3DWAA 1OXSC 1Y1VH 5FO8B 5IP9G 1D7QA 5M3FG 4FYDA 2XSCA 5JJLA 2X69A 5I6WA 1GHKA 4AIMA 2R61A 5E7NA 1ICFB 3EBEA 5GROA 4X64L 1ML0D 5IP9H 2Y0SB 2WB1B 4JI0Q 3CPFA 1HNWQ 3DM3A 3VR4A 1E2ZA 4KTAA 1A3TA 2OF1A 3KUPA 1G2TA 2Q2HA 2JA7B 3O13A 4QY7A 1VCIA 2DY8A 1MKHA 1YHAA 3KDFA 3BYYB 2KHSA 2I5HA 5CYUA 2K5QA 1EQTA 1RHPA 1G8ZD 2B63B 1E2WA 4DV3Q 3MC0B 5IT9E 1BO0A 1O7IA 2VUMB 2ICIA 1OTCA 1ENAA 4RGMA 1TWAH 5E4XA 3HFZB 5HGQA 2RCFA 3BVZA 3W1GA 2VY3A 1LTSD 4HIOA 2B39A 4B3RL 2EOTA 3J7YW 1BF4A 2UU9Q 1A0IA 4A3MH 1Q90A 1N9WA 4LNQA 4ALPA 3LX0A 2FMMA 4O0AA 4BBRB 1HNZL 1XJVA 3S1NB 3TMEA 1TKWB 4H02A 4X3TA 1N36L 1XNQL 2R7DA 3J81c 3J80c 1CKNB 1V43A 2K03A 3HOUB 1D8LA 2KEEA 1LT4D 3NEMA 3CCJA 3EJIA 5IIFA 1TWFH 1H9SB 1F2ZA 1SXTA 4H0LC 1ILQA 1PYSB 2WKCA 3HKZE 4TSSA 1UE5A 5ELEA 1Q7YC 4LFBL 1UAPA 4LF8Q 3EVQA 4EGVA 1IL2A 4BY7G 1GD7A 4LUVA 1CQFA 3R8BA 1BR9A 5CMDA 1F9PA 2NBFA 2YU9H 4NW2A 3CCRA 1D5MC 2PMZE 3KJOA 1HNZQ 1ET6A 1BKBA 3BYTB 4NKLA 1KDBA 2IWHA 2A6HD 5TSSA 4DR2Q 3CCEA 4A3GG 2BE5D 1A63A 3VYUA 1KAAA 5CBEE 3QIAA 3EROA 1JWSD 4A3DG 2EJGC 3HGBA 3Q22A 3M4OB 1X65A 1LT5D 5I2XA 4A3GH 1E22A 2G9DA 4DAYB 1EY6A 5E1FA 1M4VA 3PF5A 4OWXB 4QCLA 3PUWA 3K5LA 2YYZA 4HIDA 2FMCA 4EQOA 4LFBQ 3BZCA 5ELDA 4DF7A 2F0GA 4DR6L 4DR1L 2MP1A 2C35B 5D3IB 5M5YH 1IBKL 5I4DA 3OMGA 5DLQE 1JCKB 4PZ7A 1E1OA 2WAQB 1STEA 5LMUL 4DXGA 5IYCH 3L2PA 1EIYB 1I94L 4B3SQ 4A3BB 1EY7A 1VMCA 3K7AB 4CJ1B 1MIUA 2PI2E 2F0UA 3IL8A 2EYFA 3E6ZX 1EYCA 2LS01 3F2CA 4V190 4OO1I 5CBAE 4DPGA 3UE0A 2OTLA 1PH3A 1Z7TA 4HTHA 2A8VA 1CKNA 1DOKA 4OWWB 1TWHB 4C3JH 1F2MA 1AH9A 2ICEC 4K8IA 5KRUA 4C3IG 1TU2B 2F0DA 4DR1Q 3C1FA 1G91A 1W6KA 1H9SA 4PG3A 2FXQA 5IGEA 2KBNA 3D6CA 2K1BA 2AQ3B 2Q2TA 4ILWA 2NVQB 4JI4Q 1I50H 1D6EC 5K36G 1JORA 1HFNA 2KCNA 1K83H 5L37A 3FPUB 3HEJA 1STAA 3CPWA 2A6HC 2F3IA 4IQZA 3WOEA 2ZT9C 1AN8A 1RJTA 2BE5C 2FINB 4C2MH 5JJKA 2E2IB 3OOCA 2NVTB 1KNAA 1WJJA 1TXYA 1XMQQ 4IUUA 1LLRD 1HA5A 1XTDA 2RKSA 3RZDB 1HQMC 1YI2A 1TY2A 3L7ZC 3HOYH 4JI3L 1JOKA 4DAYA 4Y7NH 5IT9L 4DK3C 2MNAA 4EVOA 5LMNL 5IY0A 2F03A 3GTPB 2NVYH 2F0SA 3MXNB 4J1MA 2ZXPA 3S1QB 3BDCA 1SN8A 2GVBA 4FVMA 2L1BA 2EXZA 3BZDB 3P20A 1HXYD 3NP8A 3W3AA 4PZ6A 1VQPA 5D3DA 2SEBD 1D1IA 3CQZH 1S5DD 1KTKA 3OIPA 2VUMG 1SROA 4QUFA 3DMUA 3PO2B 1EY5A 4K2LA 1TWGH 2V1CC 1EL0A 4NP5A 2IW3A 4GLAC 1Q3LA 5EPKA 1S5FD 1RTNA 2UUAL 4HJ7A 1TT2A 3S1RB 1YVCA 3UDFA 2DJFC 1VDZA 4A3LG 3KFUA 1SRUA 4A76A 1STYA 3MXGA 1B53A 3S2HH 2L0CA 4KN4C 3H0GG 3HOZH 3QWNA 4P75A 2IX3A 3GTJH 1TS4A 1JJGA 1KC8C 4A3LH 1HTLD 4GZYC 4IUQA 1IKMA 4G7HC 3UDGA 5K5PA 2EJFC 1J5EQ 1CM9A 1SNPA 1FL0A 1VQCA 2Z4HA 5FKAC 2YTYA 3A7AB 4QB4A 4RHSA 4OGQC 5GQOA 1KDCA 2SOBA 2OQ0A 2N3SA 2XGTA 4QIWB 4A3JG 1WTXA 5AJ3L 2EQSA 1LV9A 2LY7A 3U4VA 5C0XI 1Q1EA 2CW0D 3I4MB 4TVAB 1N34L 1F9QA 4K0KL 4P73A 3Q6SA 3MWYW 4OX9Q 3H94A 1A8VA 3NHHA 3I70A 5EKLA 3DEPA 4RAUC 2B8GA 1TIID 2H5XA 4DFAA 2KENA 3BG3A 3X3MA 2Q8TA 4IN3A 1I4XA 3NUCA 2UUBQ 1LT6D 4ODGA 5A2QL 1GJXA 4EQPA 2OEOA 3L3OC 4EQNA 1PV4A 2CH4W 4ABNA 1O7LA 3HOXG 1KRTA 3L0OA 4OHJA 1M8AA 1O7ZA 5AJ3Q 2WAQG 2JA8G 1GO3E 2CFMA 3J7AV 3HOXH 1BVSA 2CWPA 1Y1VB 4JG2A 1QVFA 2DNEA 1ENCA 1STHA 1PRTF 1VQHA 2ASBA 4JYAL 1VQ5A 4GLVB 3U4ZA 5BN3A 5DNFA 2JA8H 4OWTB 1Y8NB 2Y0SE 4DR5Q 2WB1E 3M85A 5M3FB 1EQQA 2K04A 1IKLA 4OELB 5M3MG 5JOBA 3RD4A 1SYCA 2F0MA 3NQIA 5E3FA 2ZM6L 1PFBA 1BBXC 1JWUD 4HAEA 5EJWA 4K6DA 3K6OA 4AYBG 5M3MH 2WACA 3I8ZA 1IBLL 1S3OA 3ZJYC 3PO3G 2E76C 4O2DA 3K5NA 4Y52H 4O42A 1VQ6A 2E5LL 2QDLA 2MGSA 4OIKA 2CW0C 1EOTA 2K5WA 1EOVA 3CW2C 4OO1G 2RHQB 2EVBA 2RA4A 3D6WA 3R2IA 1QNKA 3L9AX 3ICEA 3LGJA 5J3BA 4Z9CB 3JAME 4JI1L 2AMCB 1D1KA 1UE6A 4YWMA 2NTSA 4DA2A 4A3IH 2ZM6Q 4LF5L 2EY1A 3M4YA 2ZTCA 1DJRD 4QUCA 1GVPA 4HSVA 1PA6A 1G2SA 5CORA 3F2UA 2VQEQ 5C3EH 1TWFB 2K50A 4FXDA 1H9RA 1IBLQ 1G6ZA 3TEHB 4CHTB 1P16A 1SE2A 2BOSA 4YHHL 2E5LQ 2G9HD 1LACA 1T9HA 4ZYSA 2E2JH 3OW2A 1PH5A 2XTIA 3H3VH 4DNIA 1HZBA 3GTLB 4JV5Q 2HHHL 2EYLA 3EFXD 3LWEA 2Q2UA 4P72A 1GKHA 2CCZA 1SLJA 3PO2G 2K5HA 2A5HA 4BY7B 5M9OA 2CWAA 1W2BA 1PMRA 3OMCA 2BDOA 2HDLA 4F88A 1NMFA 4M1UB 3M3YH 1U4PA 2DUDA 2K4KA 5A35A 4DGZA 2F0EA 2JXMB 1EIFA 1RIPA 1WYDA 1UE7A 5JJZA 4HJAA 1JC7A 2VB2X 4WJ3M 3MFGA 1B8AA 4A3GB 3AB9A 1PDQA 2KA7A 1SE3A 3IKJA 4YHHQ 1X9NA 3C2PA 4AQYQ 1SE4A 3SK8A 1HHVA 2KECA 3A0JA 1A3UA 2M2LA 2WAQE 1IL8A 4OIJA 1TVXA 2Z0SA 3HRZC 4Q5VA 1HRJA 1WCMG 2JEBI 1CK1A 1YHBA 3JAMi 2HCCA 3C3LA 2OTJA 3K57A 3CCUA 5JEAG 2QA4A 1HNXL 2NYZD 1BCPF 3TSSA 2JYOA 1BCPD 1HCZA 3OTOL 1WCMH 3W2DA 2D9UA 4GKJQ 3S1MH 3HP3A 2PO4A 1QE6A 4P71A 1K73C 4B3TQ 1ILPA 5CR3A 1VQNA 2E2HH 4K14A 1LTGD 4JC0A 4IJLA 3CCMA 1YNXA 4DV7L 1LUZA 3HS0C 1E0BA 2N8NA 3A7LA 2R6GA 4F87A 4DV5Q 1K3RA 4LF9L 1ET9A 5GAGC 3VR2A 5ELOA 2F1MA 4ULLA 2L4NA 3F2DA 2CKZB 1I50B 1VQ4A 2M9VA 2PZTA 4KHPQ 1BCPB 4C3IB 3TREA 1K83B 1B50A 5C0XG 4FF1A 1HNXQ 3PCOB 4ME3A 1EY0A 4B9XA 3OTOQ 4K8JA 1G291 1SYGA 1JOQA 2F0TA 3T53B 3LWUA 4C2MB 3GTMH 1SYBA 3J7AF 1UNSA 1B1ZA 1E24A 1VQDA 5C0XH 3I56A 2UXDL 2L9HA 1LTTD 3KLSX 4DR7Q 4CDFC 2SNMA 1EWIA 1BOSA 1KHIA 5AFWA 3W5OA 1Y14B 1WTRA 4X66Q 3G4SA 4UY8C 1I4PA 2VZAA 2BDNA 1LTBD 2RCNA 2WV6D 3VR6A 4DV2Q 3HOYB 3MEHA 2MFIA 1VQ8A 4ZLTF 4Y7NB 5JJIA 3U58A 1GXDC 4G4KA 4OONA 1LM0A 1EU3A 4BA2I 2F0HA 4UP8A 5CV7A 1XNRQ 3JAML 3F8TA 5IGCA 3A74A 1BCPC 4CJ0B 5BN5A 3CQZB 3NSWA 4UAIA 4ZUJA 1SNQA 3MTSA 4DV0L 4WJWA 3QB3A 3PUVA 1FYCA 2XRSD 1PVOA 4NMZA 1TWGB 4DAPA 4LFAL 3SDZA 1MBYA 2HQEA 2R93H 1B9MA 5GADC 4A3MG 3KLWA 1PH6A 3K8AA 4DUYL 2J0TD 1EQRA 1KABA 2ALYB 3A5UA 2UUCL 2DN8A 1K9MC 4DK6C 2NB0A 3S2HB 4K2KA 1QOHA 2EY6A 2IJ0A 2F3VA 3QJYA 3HOZB 1EYAA 1PTOH 4X64Q 2GA4B 2F4VL 1EY8A 1D2BA 1JT8A 4FF3A 3A56A 2O5IC 4XIGS 5J1ZA 4JVZA 1JB7A 3H0GB 4HCSA 1L1OB 2DNCA 4IURA 2A74C 2E2DC 3FVQA 4LFCL 1W3SA 2B2UC 4R4CA 1DZ1A 1O80A 3ULLA 1GHJA 1I3QH 1SYFA 4QIWE 4LUOA 1BXTA 1YNND 4DNTB 4LFAQ 1CZGA 2YV5A 2K5VA 1WTVA 1PZJD 3TRZA 1K8AC 1PXUA 2AUJD 4XT1B 2JA6G 3K7UC 3MA2B 2VS1A 4I65A 3MEFA 5BR8L 2XNAC 4B3RQ 4A3JB 1ICWA 4A3CH 2MO1A 1JE4A 3PGZA 1F2YA 2R92H 2RQXA 3FMCA 4HIMA 1KAWA 2JA6H 2QF7A 2J7ZA 3S17H 2JK8A 4JI7L 1EWHA 2NN6I 5FLXc 3TP5A 1N36Q 5C3XA 1XNQQ 1GUTA 1YBYA 2WINB 5IGGA 5KNCA 4A93H 1RDPD 4A3FH 4JOIC 4A3EG 4LFCQ 3EIVA 3UI2A 3KLRA 1EFWA 1UEBA 2ZXOA 2EJMA 2B2UA 4JPBW 1AE3A 4CKCA 4MTNA 2GN5A 4A3EH 2F0FA 3BJUA 4C3HG 3FPPA 4X62L 5C4XH 5M5XB 4R4OA 5IGDA 3SVMA 3HOXB 2IX1A 4CKEA 5IYCG 1TS3A 1EFID 5BR8Q 4RCNA 2OWOA 2BH2A 2LXKA 2IL8A 2JA8B 4C3HH 3PUXA 5A2QE 4ZK9B 1YIJA 5LMNW 5ELCA 1DD2A 2RF4A 1WFQA 1N33L 4QGUA 1FNVA
chains in the Genus database with same CATH topology
2QW7A 2Z9HA 4JVZA 5L37A 2RCFA 4JW0A 2HD3A 4N8X1 4I7AA 4N8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QW7 A;  2Z9H A;  4JVZ A;  5L37 A;  2RCF A;  4JW0 A;  2HD3 A;  4N8X 1;  4I7A A;  4N8F A; 
#chains in the Genus database with same CATH topology
 4C3J G;  1XPO A;  2B2T C;  2D0P A;  3ERQ A;  4CDD C;  4OXP A;  5M3M B;  4JW0 A;  2QEX A;  3CCL A;  2HDM A;  3U9O A;  4JOI A;  3FP9 A;  4YWK A;  3RZO B;  1PLF A;  4XYQ A;  4OEM B;  1S40 A;  1X6O A;  1L1O A;  1YNN C;  1AFP A;  4JBW A;  1SR3 A;  3ONA B;  3AMU A;  1Y8P B;  3JC6 6;  1SFO H;  1B7Y B;  3NXW A;  5EKI A;  3FEW X;  3R93 A;  4AYB B;  5IYD G;  4X62 Q;  1CHP D;  1V8Q A;  4DR6 Q;  3PO3 B;  1JWM D;  2MQH A;  1HZ9 A;  1L0W A;  3QR8 A;  1IBK Q;  2H4O A;  1J9O A;  5I2Y A;  4HIK A;  4CDE C;  2D5D A;  4X3U A;  3H3V I;  5IYD H;  2Q8R E;  5C44 G;  2AWN A;  5LMU Q;  4DK0 A;  1PYW D;  5IT9 c;  4KK7 A;  1I94 Q;  2JA5 H;  5CV6 A;  2L11 A;  4B08 A;  2R7Z G;  4IPD A;  4A3I B;  4NXM L;  1JOO A;  2QW7 A;  5C44 H;  5JEA J;  1VQM A;  3SK6 A;  4G7O C;  4RMF A;  5KEE A;  1T5X D;  4KD3 A;  5EAY A;  3GTK H;  3HOY G;  4R4T A;  2R3Z A;  4POF A;  1XX8 A;  2R7Z H;  5IYB G;  4IFD I;  5IGB A;  2B2T A;  2C9O A;  1I6H B;  4WOR A;  4NDX A;  4B3M L;  3R3O A;  1QVC A;  2XIW A;  5BN4 A;  4JI5 L;  1A2T A;  4XQN A;  4IOA A;  5IYB H;  3NWT A;  1R9T H;  3ND9 A;  4UDU C;  2KHI A;  4ZRZ A;  5F2D A;  2VQF L;  3QO2 A;  3GTQ H;  5KND A;  2F52 A;  2VB3 X;  1A15 A;  3TP6 A;  1UUP A;  1S4Z A;  1VQE A;  2B8F A;  4FDB A;  5FK9 C;  1FR3 A;  1STN A;  4DV6 L;  3PMF A;  4NXM Q;  4E6I A;  3K0Y A;  5C0X J;  3M3Y B;  2EYM A;  4KJN A;  1IBM L;  1NAP A;  1B44 D;  3PIP A;  4KI0 A;  4JI8 L;  1GUW A;  3Q8D A;  1SJE D;  1SNC A;  2A68 D;  3I55 A;  4X3K A;  1ENF A;  4APV A;  1CSP A;  2EDG A;  1RCV D;  4BY1 G;  2PW7 A;  3HOZ G;  1EYG A;  3S14 B;  1ZYR D;  1TQO A;  4PQX A;  3ZYY X;  1EU4 A;  3IFD A;  4RKL A;  2O4X A;  1TS5 A;  2K28 A;  1FNU A;  4JI3 Q;  5T1G A;  4HSP A;  2K7V A;  2JA7 H;  5LMN Q;  2J4X A;  4BY1 H;  4ID6 A;  5FJ8 G;  2PW5 A;  1ASY A;  1N32 L;  4L8J A;  3SGI A;  2JQO A;  3ITP A;  1VQB A;  4FXG C;  4JCV E;  4ZKC B;  4R1J A;  3I4N G;  5EPL A;  2XWJ B;  3CXC A;  1YHQ A;  5FJ8 H;  2PCF B;  4XXE A;  1WCM B;  3QOJ A;  4C1N K;  2K5D A;  2EE1 A;  3S1M B;  1VQJ A;  1YIT A;  1F9R A;  3E0J A;  5CC4 A;  1E3P A;  3I4N H;  4RCO A;  1S72 A;  1HR0 L;  1JR0 D;  4KKS A;  3PF4 A;  1K8M A;  2WKD A;  2UUA Q;  1MSG A;  5C6A A;  4DR3 L;  2E2H B;  5CV8 A;  3TDQ A;  3D8G A;  2VNU D;  2Q8I B;  3CRL C;  4FF4 A;  3G6J B;  5E4W C;  5T1I A;  3HOU H;  1WTP A;  3BDO A;  2F0J A;  4LAA A;  4N8X 1;  3RLO A;  1MJE A;  3RLN A;  2EY2 A;  4XDX A;  1CZW A;  1M1K C;  1X3P A;  1F9S A;  2A19 A;  1DXM A;  2FHT A;  1V9P A;  5C4J H;  2B3G A;  3MXN A;  3RLF A;  5I9P A;  4V0B A;  1WVL A;  1K0S A;  4LJZ C;  1EQV A;  3SE0 A;  2YTV A;  1LTA D;  1C48 A;  1H9K A;  5IOD A;  2A68 C;  3VYS A;  4RFB A;  1AZQ A;  3NBH B;  5LL6 X;  1DON A;  2K05 A;  2NN6 G;  2RSN A;  5CV9 A;  2M00 A;  1ZYR C;  4WFN 3;  1CA6 A;  2ZJP A;  2EXD A;  2SNS A;  1LTR D;  3TN2 A;  4DV1 L;  1N34 Q;  4AH6 A;  4KY7 A;  4K0K Q;  1FJG L;  4MHE A;  4X3S A;  1Q1B A;  4YWL A;  1PRT D;  3RN5 A;  2NN6 H;  3I90 A;  3IRB A;  4QL5 A;  1OO9 B;  4IUN A;  1ESR A;  3CHB D;  4R8N A;  3DWP A;  5M5W H;  1SEB D;  1VQG A;  3MHB A;  4PMC A;  1PTO F;  1PTO D;  4L5R C;  3A54 A;  3ERS X;  2Z4I A;  4KLK A;  3H6M A;  4X6A H;  1TWC H;  3S15 H;  4UP7 A;  3GTO H;  5J22 A;  4DU9 A;  1Q46 A;  4RH6 A;  1PYB A;  4WJ4 A;  2PZW A;  4N9P A;  3AFQ A;  3MZ5 A;  3RUZ A;  2TMP A;  3K7A H;  2R93 B;  2F0O A;  1HUN A;  1MGS A;  1PRT B;  1XPU A;  2HD3 A;  4RGT A;  2L15 A;  1X56 A;  2PNR C;  4LMQ D;  4DV1 Q;  3OSO A;  1TWA B;  2I5L X;  1FJG Q;  5COY A;  4BS9 A;  4JYA Q;  1HTP A;  4RHR A;  4A3I G;  3TBI B;  5IP7 G;  3A8J E;  4H44 C;  4A3M B;  3A5Z B;  1II3 A;  1R4Q B;  1VMP A;  2F0I A;  1PTO B;  4EQ5 A;  5IGF A;  2IHF A;  4KJO A;  1NR4 A;  5C5L A;  3Q24 A;  5ISR A;  2ENB A;  4M8A A;  2O2L D;  3KF6 B;  5C3E G;  4G7Z C;  1G51 A;  5IP7 H;  3FRP B;  4LF4 L;  1SDF A;  2RHS B;  1GUG A;  2KVM A;  4HCE A;  2JE6 I;  1SJH D;  4DR4 L;  2NVQ H;  5FLM H;  2QCP X;  2AUK A;  4DXF A;  5IWA L;  1I3Q B;  1EY4 A;  1IHZ A;  1SNM A;  2NWG A;  1HUM A;  4C56 C;  3M7N A;  2NTT A;  3N52 A;  1E7Z A;  1I4G A;  3NE5 B;  1QG7 A;  1YJW A;  1Y1W G;  1KDA A;  3I3C A;  2NUC A;  3NBH A;  1PRT C;  3PIO A;  3OPO A;  3MFY A;  4TKO B;  4IFD G;  3VA7 A;  3J81 j;  1WTQ A;  2YU9 B;  1PFS A;  4JI1 Q;  1Y1W H;  1B70 B;  1OXX K;  4LF6 L;  1S5E D;  1YNJ D;  2JA6 B;  2E74 C;  3HKS A;  3CC2 A;  3D4W A;  1PTO C;  2KCT A;  4LF5 Q;  1SBB B;  4LF4 Q;  4IFD H;  3FKI G;  1LT3 D;  2V4D A;  4CBV A;  1R4P B;  2OT2 A;  5EQ0 A;  5EBD A;  4A93 B;  1VQA A;  4A3F B;  2HCI A;  2ATW A;  4R9W A;  2MHV A;  4GNX B;  1OXU A;  1RTO A;  2Q2I A;  5IWA Q;  3FKI H;  3TZU A;  3X3N A;  3BS1 A;  2KCC A;  1Q8I A;  2HIV A;  3T1H L;  4A3E B;  1PFN A;  2GVA A;  3EA6 A;  3D3R A;  3OWF A;  2HHH Q;  1B4O A;  4HN7 A;  5M5Y B;  4X65 L;  5JPM C;  3T51 B;  4P74 A;  3D4D A;  3I4O A;  4C3H B;  3KLS A;  2LMC B;  3I91 A;  1EIH A;  1LO5 D;  1Q81 C;  2RDG A;  2EYJ A;  1XXG A;  1L0X B;  2R7F A;  3S1R H;  3BVG A;  1HZA A;  4JBM A;  1H95 A;  1SND A;  4YCW A;  1BUV T;  1E1T A;  3J81 E;  2ZTE A;  4CJ2 C;  1I5F A;  1TY0 A;  3J80 E;  4ZUI A;  2A6E D;  1A2U A;  2QEJ C;  3NEN A;  3GDE A;  2K52 A;  4H7B A;  2PYK A;  3KF6 A;  4QMG A;  4F8M A;  1IYJ B;  1JQY D;  3G7L A;  3SK5 A;  3I72 A;  2FJ2 A;  1V1P B;  4GNX C;  4JI2 L;  4AYB E;  1SFO B;  3M4Q A;  4C3J B;  4GN4 B;  5H1S E;  1M90 C;  1QZG A;  2K01 A;  1ASZ A;  3SEB A;  3HKZ G;  1WTH A;  2K75 A;  1E2V A;  5CGK A;  4X65 Q;  1CHQ D;  3OYY A;  1YZ6 A;  3GTG H;  4XYO A;  3KOJ A;  1YNJ C;  3T1Y L;  2BH8 A;  2DGY A;  1TS2 A;  3BDL A;  4IPH A;  5FLX E;  1SNO A;  3S9W A;  4LF7 L;  1C4Q A;  5C44 B;  1JB3 A;  4TRD A;  4KKU A;  2B2Y C;  3JAM c;  1B2T A;  4HMJ A;  3GTK B;  1O78 A;  2AQ1 B;  5ELB A;  2R7Z B;  4J8Q A;  1XYI A;  1MI2 A;  2HQL A;  4KN7 C;  1DOL A;  4KD4 A;  3Q0A A;  4JI0 L;  1HNW L;  1H9J A;  5GAH C;  4GNX A;  2CH4 A;  1BBW A;  4DV7 Q;  3CRK C;  1R9T B;  4LF9 Q;  2EYP A;  2NVY B;  3K58 A;  1NSN S;  1RKN A;  3GTQ B;  5ELF A;  1D5Z C;  3D4R A;  4IZ8 A;  4DV3 L;  3HOW H;  5KIX A;  3C46 A;  3UDX A;  3DEO A;  2E75 C;  1VS0 A;  1RF2 D;  4NXN L;  1STB A;  4LF7 Q;  2WII B;  2CVR A;  2KJX A;  2R93 G;  3H09 A;  3AEV A;  4RGN A;  4XQJ A;  4GS3 A;  3J81 i;  2A6E C;  2UU9 L;  3J80 i;  2UXD Q;  2XRQ D;  4IUP A;  2RVL A;  3V96 A;  1S5B D;  1XMO L;  1CA5 A;  1KIX A;  5M3F H;  2B2Y A;  3S2D H;  2NVX H;  5LL6 S;  1G6P A;  1OXT A;  4A3K G;  3IFT A;  1HFG A;  1EYD A;  4HJ8 A;  3OIQ A;  1AW7 A;  4IJH A;  1C7Y A;  1JIC A;  3MXP A;  1Y69 U;  3AYH B;  2JJQ A;  4JI6 L;  1WD1 A;  1WTO A;  2OCE A;  1NJI C;  2PQE A;  3MAQ A;  4KMU C;  2MPM A;  3MVV A;  1K3B C;  4BY1 B;  2JP1 A;  1V1P A;  4A3K H;  4K5W A;  3GTJ B;  1HPC A;  3CC4 A;  2F0Q A;  2WP8 J;  3S16 H;  4POG A;  4A75 A;  3DWQ A;  1SMX A;  4I7Z C;  2P5Z X;  2CQA A;  1PHJ A;  2IHE A;  1EIG A;  2A1A A;  4OL7 A;  1X54 A;  4LF8 L;  4NXN Q;  4DV0 Q;  1QZH A;  2ES2 A;  3FDT A;  4YY3 L;  4RWS C;  1XMO Q;  3I4N B;  2K32 A;  1IXR A;  1KLG D;  1XPR A;  4FF2 A;  1NMG A;  1L2F A;  2EY5 A;  1TR5 A;  1LTI D;  3ULP A;  3RN2 A;  3HOV G;  4A3C G;  1KL9 A;  2KOL A;  3RR5 A;  3TP7 A;  1PH2 A;  4DR2 L;  2R92 G;  2EPB A;  4DUY Q;  3STB D;  4YCV A;  4JI6 Q;  2UUC Q;  1QNU A;  3HOV H;  1VF7 A;  3E9I A;  2L5T A;  3T56 B;  2G5D A;  2F4V Q;  3PIP 3;  2D62 A;  4A93 G;  2IT1 A;  4ZAI A;  3A8K E;  4A3F G;  1ZKO A;  2RDH A;  2AHO B;  2CHB D;  3NQT A;  1ZXT A;  1KD1 C;  5C5M A;  2N49 A;  4KHZ A;  2ZJR A;  4PZ8 A;  5C4J B;  4L63 B;  2LSS A;  1FVI A;  4FO2 A;  3GTL H;  3D31 A;  4XT3 B;  3V05 A;  2AKW B;  4YY3 Q;  1PFM A;  2PQA B;  5C4X G;  1L1O C;  4L5Q A;  3J81 L;  3J80 L;  1VQO A;  1KNE A;  2QIL A;  5C4H A;  2F0P A;  4BY7 H;  3ND8 A;  4B3S L;  2VW9 A;  1FGU A;  4L5T A;  1B9N A;  2I5M X;  3BVM A;  1GUS A;  4DN4 M;  1SSO A;  5I9O A;  1WOC A;  3G48 A;  2F4I A;  1QIL A;  2KHJ A;  4DAV A;  2UXB L;  4JK1 C;  5M5W B;  1DM0 B;  4IFD J;  4JI7 Q;  4A3D H;  1YEZ A;  1DGS A;  4HED A;  3K59 A;  1PH1 A;  1IZ6 A;  3HZX A;  1CKM A;  3AQQ A;  1D5X C;  4KV6 A;  4CGY B;  1V1O A;  2EZV A;  1TWC B;  4PMB A;  3S15 B;  2E8G A;  4KY5 A;  3GV3 A;  1K8O A;  2K5N A;  3GTO B;  4U68 A;  3U9S A;  5FLX L;  4JI4 L;  2OQK A;  4RKB A;  1NTG A;  3D0F A;  1QB5 D;  2F0L A;  1EZ6 A;  4BBS G;  2HUG A;  4DNR B;  2KQ3 A;  2L55 A;  3J7Z C;  1C8C A;  1C9O A;  3TZD A;  3S24 A;  4G57 A;  4XTC S;  4KY6 A;  2EIF A;  1X55 A;  1HJP A;  3STB C;  3KF8 B;  1AE2 A;  3IAY A;  5FOB B;  4BBS H;  2JA5 G;  4IAL A;  3QG1 A;  4RA8 A;  4F7X A;  1UEA B;  2D0O A;  3CCQ A;  2NZH A;  4FNF A;  5FO7 B;  2UXB Q;  5DEH A;  1XMQ L;  3K80 C;  1AP0 A;  4K5V A;  1I4H A;  1ONL A;  1ROD A;  3KBG A;  3KBX A;  1N33 Q;  1IYU A;  1RD9 D;  2F0N A;  2QKI C;  5NUC A;  5KGU A;  2VXW A;  3G71 A;  1LAB A;  3GD7 A;  4KHV A;  3V2T A;  5C3E B;  4DAM A;  3G6E A;  1GUO A;  3J7A 5;  1IW7 D;  5KYI A;  1FNW A;  2A69 D;  3CU7 A;  2O5J C;  4C3I H;  4JBJ A;  4I7A A;  1PH9 A;  3OW7 A;  1BNZ A;  3ULJ A;  4DKA C;  4ZCK A;  4XQQ A;  2E2J B;  1O7Y A;  3AFP A;  1FGB D;  3SK4 A;  3WWV A;  5HUR A;  4BWG B;  2PQA A;  1HR0 W;  3OHX C;  1VF5 C;  1NR2 A;  5K36 H;  2KED A;  1X3G A;  1DOM A;  4N8F A;  1BDO A;  3URY A;  1P8L A;  1Y1W B;  1RL2 A;  3QOL A;  3NTI A;  1X3Q A;  3Q23 A;  2Y0S G;  5CV5 A;  5EKK A;  5C3W A;  3UDI A;  2WB1 G;  4IPG A;  2Z9H A;  3BZK A;  4LWC A;  2DJG C;  2L12 A;  3SXH A;  1DYQ A;  4L5S A;  1JJ2 A;  4H13 C;  4UP9 A;  3M9B A;  3FKI B;  2JA7 G;  3GQB A;  3T4A C;  4B3M Q;  1STG A;  3CAM A;  1K0R A;  4JI5 Q;  2F0K A;  2B63 G;  1X32 A;  1Z47 A;  1J5E L;  3F1Z A;  4UPA A;  1V1Q A;  3GP7 A;  2VQF Q;  3F2B A;  5EPJ A;  5JVH 3;  3H3V C;  3TS2 A;  1VQF A;  1EWC A;  1CFM A;  3CP0 A;  3P75 A;  2B63 H;  2HT1 A;  2MUY A;  1U0L A;  3KF8 A;  2VUM H;  2AWO A;  2ID0 A;  3E3X A;  2K14 A;  4DV6 Q;  4BBR G;  3NWS A;  3WOF A;  1U4M A;  3EN2 A;  1IBM Q;  4OX9 L;  1EZ8 A;  5LHY 1;  2KCM A;  4MTK A;  1Q82 C;  2QGQ A;  1F2L A;  4JI8 Q;  2VL6 A;  3DM1 A;  1T5E A;  1U4R A;  2AQ2 B;  5DAU A;  1EEF D;  1IW7 C;  4BBR H;  3PIO 3;  2A69 C;  3T13 A;  3HOU G;  1IYV A;  3K0X A;  4K5X A;  1I4R A;  3NTH A;  1S5C D;  2A73 B;  3S1N H;  1K8G A;  1GUN A;  5D14 A;  2X6L A;  3W1B A;  2I0Q A;  2UUB L;  5EBC A;  3OWE B;  3H0G H;  4R8I A;  1SYD A;  1VQ9 A;  1BBU A;  1U9R A;  3TS0 A;  2BCO A;  2PZU A;  4BA1 I;  2TSS A;  3DXJ C;  3I4L A;  3MXU A;  4J6H A;  3NPP A;  3VDY A;  4UHV A;  1N32 Q;  2BA1 A;  4LUZ A;  3GTG B;  4P2C B;  1MD2 D;  4ME5 A;  1J6Q A;  4HR7 B;  2XVS A;  2F3W A;  4PNY A;  4CKB A;  3HKZ B;  1QWY A;  1PH7 A;  1AZP A;  3PUZ A;  3CMA A;  4RGO S;  1CUK A;  4ZKB B;  1H9M A;  2KUM A;  3U50 C;  1A3V A;  1B3A A;  5IE8 A;  4Q0F A;  3GTM B;  3EQL C;  4A3J H;  3VR5 A;  2FFK B;  1LTL A;  3PQI A;  3SHL A;  3CCV A;  1KLU D;  2F0W A;  4R4Q A;  1HR0 Q;  4DR5 L;  1HQR D;  1Q12 A;  2PMZ B;  2XWB B;  1NBW A;  3I7F A;  4GKK L;  4DR3 Q;  2Z1C A;  2MJ8 A;  1B3Q A;  2DY7 A;  4YIJ A;  4J15 A;  1CKO A;  2HIX A;  3PV0 A;  2K6A A;  4IPC A;  3M4O H;  2OXP A;  1KRS A;  5CV4 A;  4MZ9 A;  2QDB A;  4HJ5 A;  1SMY D;  4TQU S;  2B2V C;  2F0V A;  1U5K A;  3KJP A;  3PSI A;  4EX5 A;  1J8I A;  4RG1 A;  1I6V C;  3BU2 A;  3HOW B;  5KYL A;  5M5X H;  4DK1 A;  2Z6B A;  5JPN C;  3VR3 A;  4A3B G;  1GOZ A;  1Q86 C;  3PUY A;  4NPS A;  3I73 A;  1PZI D;  1PH4 A;  3P7J A;  3K81 C;  2MO0 A;  1L0Y B;  5HGT A;  3A8I E;  2LKV A;  1FD7 D;  4PMW A;  3S2D B;  1ESF A;  5C4Z A;  3N6R A;  4A3B H;  2NVX B;  4GKK Q;  3R2T A;  2JSO A;  1HZC A;  4GOP B;  3DLL A;  1HH2 P;  4IO9 A;  2BA0 A;  2SDF A;  2YTX A;  2B29 A;  3UE1 A;  1YJ9 A;  1PZK D;  2CQO A;  5GAE C;  2VQE L;  3WDN A;  3RNU A;  4A3K B;  2K33 A;  3RZO H;  1QUQ B;  1Z9F A;  4K6L A;  4GN5 A;  2UXC L;  5D65 A;  2B2V A;  1CSQ A;  3S16 B;  1CQV A;  4FP5 D;  5FLM G;  1TWH H;  4MIU A;  1EY9 A;  1SE8 A;  1KXL A;  2LXJ A;  1BQQ T;  3PO3 H;  1N8R C;  4JV5 L;  2EYH A;  4B9W A;  3SR1 A;  1NE3 A;  3H15 A;  3E0E A;  2Z6K C;  4OO1 H;  2IY5 B;  1JJC B;  1JMC A;  1C0A A;  4C1N I;  2N88 A;  3NEL A;  3KYH C;  2IX0 A;  5IOC A;  3FHW A;  4R4I A;  1NCV A;  2IPK D;  4ZQ3 A;  2E2I H;  1MJC A;  4IOC A;  2I07 B;  2NVT H;  4L6T B;  4GOP C;  4JBK A;  3HOV B;  4GLX A;  3GV6 A;  3VYR A;  1SMY C;  4DV4 L;  3M7G A;  2R92 B;  1I6H H;  2UXC Q;  1NUC A;  1W6J A;  1MHW C;  1MSH A;  3S17 B;  1I4Q A;  4AQY L;  3RZD H;  3GO5 A;  4YCU A;  3TQY A;  1X3F A;  3LNN A;  3NBI A;  3CCS A;  3AU7 A;  3NK9 A;  4DUZ L;  3DUZ A;  1ZEQ X;  1NY4 A;  3GTP H;  4HJ9 A;  4DR4 Q;  2XN9 C;  3S1Q H;  1A62 A;  1GM5 A;  5HY6 A;  1JE5 A;  3C1E A;  4MN3 A;  3I2Z A;  2Z6K A;  4U67 3;  5C4X B;  5G3L F;  2B2W C;  1K28 A;  3CKI B;  5G3L D;  4LW1 A;  1UE1 A;  4GKJ L;  3RMH A;  1CI3 M;  3PO2 H;  4QF4 A;  4CDC C;  1X3E A;  1Y8O B;  4DV4 Q;  4GOP A;  1A6X A;  5JAV A;  4LF6 Q;  2PI2 A;  1AEX A;  4B3T L;  1KQS A;  1WTW A;  3S14 H;  3DHQ A;  3KK7 A;  4A3D B;  4O1N A;  2EYO A;  1Z6H A;  1CT1 D;  1CTM A;  1QUQ A;  2RSO A;  2WFW A;  4DUZ Q;  4DV5 L;  4IUV A;  1PH8 A;  1YJN A;  3CC7 A;  1SYE A;  2C5C A;  1NNX A;  2PPB C;  4LK1 C;  3M4P A;  4KHP L;  1SAP A;  3KDF B;  3CD6 A;  4NB3 A;  3T1H Q;  5J39 A;  1QVG A;  1U4L A;  5EGT A;  4MNO A;  4QJF A;  1XTC D;  2NZO A;  2X6G A;  3NTK A;  4FXK C;  2B2W A;  4BBS B;  1Q8K A;  3I4M G;  2PNH A;  1LYL A;  4HMI A;  5JEA H;  2N78 A;  4DR7 L;  1DCZ A;  5I6Y A;  1VQK A;  2H1E A;  3T16 A;  1EUJ A;  1VQI A;  1F77 A;  4X66 L;  1VQ7 A;  1VQL A;  1XWE A;  2ZJQ A;  3A55 A;  2JA5 B;  1HA6 A;  2ZTD A;  2JEA I;  1QCB D;  2RDF A;  3I4M H;  1OXV A;  3HG9 A;  3K5M A;  5DM6 3;  4DV2 L;  4S3S A;  3CF5 A;  2LFN A;  2JA9 A;  4BXX G;  4GN3 B;  2ZXR A;  2D2C C;  2Z8L A;  4N9T A;  1EEI D;  4IUT A;  4QQB X;  1UWV A;  4KKT A;  2NZ1 D;  3H91 A;  2JN4 A;  2N55 A;  2RBM A;  4JI2 Q;  1XNR L;  3CME A;  3E5S A;  4A4I A;  4BXX H;  3ER0 A;  1WD0 A;  5KNB A;  5JVG 3;  3B6Y A;  3VA5 A;  3TP8 A;  3VYT A;  3HOW G;  1QJO A;  1Y1V G;  3E9H A;  5DM7 3;  5ELN A;  4PV1 C;  2I46 A;  1WI5 A;  4WRD A;  3P1H A;  3T1Y Q;  5FO9 B;  3K5O A;  3DWA A;  1OXS C;  1Y1V H;  5FO8 B;  5IP9 G;  1D7Q A;  5M3F G;  4FYD A;  2XSC A;  5JJL A;  2X69 A;  5I6W A;  1GHK A;  4AIM A;  2R61 A;  5E7N A;  1ICF B;  3EBE A;  5GRO A;  4X64 L;  1ML0 D;  5IP9 H;  2Y0S B;  2WB1 B;  4JI0 Q;  3CPF A;  1HNW Q;  3DM3 A;  3VR4 A;  1E2Z A;  4KTA A;  1A3T A;  2OF1 A;  3KUP A;  1G2T A;  2Q2H A;  2JA7 B;  3O13 A;  4QY7 A;  1VCI A;  2DY8 A;  1MKH A;  1YHA A;  3KDF A;  3BYY B;  2KHS A;  2I5H A;  5CYU A;  2K5Q A;  1EQT A;  1RHP A;  1G8Z D;  2B63 B;  1E2W A;  4DV3 Q;  3MC0 B;  5IT9 E;  1BO0 A;  1O7I A;  2VUM B;  2ICI A;  1OTC A;  1ENA A;  4RGM A;  1TWA H;  5E4X A;  3HFZ B;  5HGQ A;  2RCF A;  3BVZ A;  3W1G A;  2VY3 A;  1LTS D;  4HIO A;  2B39 A;  4B3R L;  2EOT A;  3J7Y W;  1BF4 A;  2UU9 Q;  1A0I A;  4A3M H;  1Q90 A;  1N9W A;  4LNQ A;  4ALP A;  3LX0 A;  2FMM A;  4O0A A;  4BBR B;  1HNZ L;  1XJV A;  3S1N B;  3TME A;  1TKW B;  4H02 A;  4X3T A;  1N36 L;  1XNQ L;  2R7D A;  3J81 c;  3J80 c;  1CKN B;  1V43 A;  2K03 A;  3HOU B;  1D8L A;  2KEE A;  1LT4 D;  3NEM A;  3CCJ A;  3EJI A;  5IIF A;  1TWF H;  1H9S B;  1F2Z A;  1SXT A;  4H0L C;  1ILQ A;  1PYS B;  2WKC A;  3HKZ E;  4TSS A;  1UE5 A;  5ELE A;  1Q7Y C;  4LFB L;  1UAP A;  4LF8 Q;  3EVQ A;  4EGV A;  1IL2 A;  4BY7 G;  1GD7 A;  4LUV A;  1CQF A;  3R8B A;  1BR9 A;  5CMD A;  1F9P A;  2NBF A;  2YU9 H;  4NW2 A;  3CCR A;  1D5M C;  2PMZ E;  3KJO A;  1HNZ Q;  1ET6 A;  1BKB A;  3BYT B;  4NKL A;  1KDB A;  2IWH A;  2A6H D;  5TSS A;  4DR2 Q;  3CCE A;  4A3G G;  2BE5 D;  1A63 A;  3VYU A;  1KAA A;  5CBE E;  3QIA A;  3ERO A;  1JWS D;  4A3D G;  2EJG C;  3HGB A;  3Q22 A;  3M4O B;  1X65 A;  1LT5 D;  5I2X A;  4A3G H;  1E22 A;  2G9D A;  4DAY B;  1EY6 A;  5E1F A;  1M4V A;  3PF5 A;  4OWX B;  4QCL A;  3PUW A;  3K5L A;  2YYZ A;  4HID A;  2FMC A;  4EQO A;  4LFB Q;  3BZC A;  5ELD A;  4DF7 A;  2F0G A;  4DR6 L;  4DR1 L;  2MP1 A;  2C35 B;  5D3I B;  5M5Y H;  1IBK L;  5I4D A;  3OMG A;  5DLQ E;  1JCK B;  4PZ7 A;  1E1O A;  2WAQ B;  1STE A;  5LMU L;  4DXG A;  5IYC H;  3L2P A;  1EIY B;  1I94 L;  4B3S Q;  4A3B B;  1EY7 A;  1VMC A;  3K7A B;  4CJ1 B;  1MIU A;  2PI2 E;  2F0U A;  3IL8 A;  2EYF A;  3E6Z X;  1EYC A;  2LS0 1;  3F2C A;  4V19 0;  4OO1 I;  5CBA E;  4DPG A;  3UE0 A;  2OTL A;  1PH3 A;  1Z7T A;  4HTH A;  2A8V A;  1CKN A;  1DOK A;  4OWW B;  1TWH B;  4C3J H;  1F2M A;  1AH9 A;  2ICE C;  4K8I A;  5KRU A;  4C3I G;  1TU2 B;  2F0D A;  4DR1 Q;  3C1F A;  1G91 A;  1W6K A;  1H9S A;  4PG3 A;  2FXQ A;  5IGE A;  2KBN A;  3D6C A;  2K1B A;  2AQ3 B;  2Q2T A;  4ILW A;  2NVQ B;  4JI4 Q;  1I50 H;  1D6E C;  5K36 G;  1JOR A;  1HFN A;  2KCN A;  1K83 H;  5L37 A;  3FPU B;  3HEJ A;  1STA A;  3CPW A;  2A6H C;  2F3I A;  4IQZ A;  3WOE A;  2ZT9 C;  1AN8 A;  1RJT A;  2BE5 C;  2FIN B;  4C2M H;  5JJK A;  2E2I B;  3OOC A;  2NVT B;  1KNA A;  1WJJ A;  1TXY A;  1XMQ Q;  4IUU A;  1LLR D;  1HA5 A;  1XTD A;  2RKS A;  3RZD B;  1HQM C;  1YI2 A;  1TY2 A;  3L7Z C;  3HOY H;  4JI3 L;  1JOK A;  4DAY A;  4Y7N H;  5IT9 L;  4DK3 C;  2MNA A;  4EVO A;  5LMN L;  5IY0 A;  2F03 A;  3GTP B;  2NVY H;  2F0S A;  3MXN B;  4J1M A;  2ZXP A;  3S1Q B;  3BDC A;  1SN8 A;  2GVB A;  4FVM A;  2L1B A;  2EXZ A;  3BZD B;  3P20 A;  1HXY D;  3NP8 A;  3W3A A;  4PZ6 A;  1VQP A;  5D3D A;  2SEB D;  1D1I A;  3CQZ H;  1S5D D;  1KTK A;  3OIP A;  2VUM G;  1SRO A;  4QUF A;  3DMU A;  3PO2 B;  1EY5 A;  4K2L A;  1TWG H;  2V1C C;  1EL0 A;  4NP5 A;  2IW3 A;  4GLA C;  1Q3L A;  5EPK A;  1S5F D;  1RTN A;  2UUA L;  4HJ7 A;  1TT2 A;  3S1R B;  1YVC A;  3UDF A;  2DJF C;  1VDZ A;  4A3L G;  3KFU A;  1SRU A;  4A76 A;  1STY A;  3MXG A;  1B53 A;  3S2H H;  2L0C A;  4KN4 C;  3H0G G;  3HOZ H;  3QWN A;  4P75 A;  2IX3 A;  3GTJ H;  1TS4 A;  1JJG A;  1KC8 C;  4A3L H;  1HTL D;  4GZY C;  4IUQ A;  1IKM A;  4G7H C;  3UDG A;  5K5P A;  2EJF C;  1J5E Q;  1CM9 A;  1SNP A;  1FL0 A;  1VQC A;  2Z4H A;  5FKA C;  2YTY A;  3A7A B;  4QB4 A;  4RHS A;  4OGQ C;  5GQO A;  1KDC A;  2SOB A;  2OQ0 A;  2N3S A;  2XGT A;  4QIW B;  4A3J G;  1WTX A;  5AJ3 L;  2EQS A;  1LV9 A;  2LY7 A;  3U4V A;  5C0X I;  1Q1E A;  2CW0 D;  3I4M B;  4TVA B;  1N34 L;  1F9Q A;  4K0K L;  4P73 A;  3Q6S A;  3MWY W;  4OX9 Q;  3H94 A;  1A8V A;  3NHH A;  3I70 A;  5EKL A;  3DEP A;  4RAU C;  2B8G A;  1TII D;  2H5X A;  4DFA A;  2KEN A;  3BG3 A;  3X3M A;  2Q8T A;  4IN3 A;  1I4X A;  3NUC A;  2UUB Q;  1LT6 D;  4ODG A;  5A2Q L;  1GJX A;  4EQP A;  2OEO A;  3L3O C;  4EQN A;  1PV4 A;  2CH4 W;  4ABN A;  1O7L A;  3HOX G;  1KRT A;  3L0O A;  4OHJ A;  1M8A A;  1O7Z A;  5AJ3 Q;  2WAQ G;  2JA8 G;  1GO3 E;  2CFM A;  3J7A V;  3HOX H;  1BVS A;  2CWP A;  1Y1V B;  4JG2 A;  1QVF A;  2DNE A;  1ENC A;  1STH A;  1PRT F;  1VQH A;  2ASB A;  4JYA L;  1VQ5 A;  4GLV B;  3U4Z A;  5BN3 A;  5DNF A;  2JA8 H;  4OWT B;  1Y8N B;  2Y0S E;  4DR5 Q;  2WB1 E;  3M85 A;  5M3F B;  1EQQ A;  2K04 A;  1IKL A;  4OEL B;  5M3M G;  5JOB A;  3RD4 A;  1SYC A;  2F0M A;  3NQI A;  5E3F A;  2ZM6 L;  1PFB A;  1BBX C;  1JWU D;  4HAE A;  5EJW A;  4K6D A;  3K6O A;  4AYB G;  5M3M H;  2WAC A;  3I8Z A;  1IBL L;  1S3O A;  3ZJY C;  3PO3 G;  2E76 C;  4O2D A;  3K5N A;  4Y52 H;  4O42 A;  1VQ6 A;  2E5L L;  2QDL A;  2MGS A;  4OIK A;  2CW0 C;  1EOT A;  2K5W A;  1EOV A;  3CW2 C;  4OO1 G;  2RHQ B;  2EVB A;  2RA4 A;  3D6W A;  3R2I A;  1QNK A;  3L9A X;  3ICE A;  3LGJ A;  5J3B A;  4Z9C B;  3JAM E;  4JI1 L;  2AMC B;  1D1K A;  1UE6 A;  4YWM A;  2NTS A;  4DA2 A;  4A3I H;  2ZM6 Q;  4LF5 L;  2EY1 A;  3M4Y A;  2ZTC A;  1DJR D;  4QUC A;  1GVP A;  4HSV A;  1PA6 A;  1G2S A;  5COR A;  3F2U A;  2VQE Q;  5C3E H;  1TWF B;  2K50 A;  4FXD A;  1H9R A;  1IBL Q;  1G6Z A;  3TEH B;  4CHT B;  1P16 A;  1SE2 A;  2BOS A;  4YHH L;  2E5L Q;  2G9H D;  1LAC A;  1T9H A;  4ZYS A;  2E2J H;  3OW2 A;  1PH5 A;  2XTI A;  3H3V H;  4DNI A;  1HZB A;  3GTL B;  4JV5 Q;  2HHH L;  2EYL A;  3EFX D;  3LWE A;  2Q2U A;  4P72 A;  1GKH A;  2CCZ A;  1SLJ A;  3PO2 G;  2K5H A;  2A5H A;  4BY7 B;  5M9O A;  2CWA A;  1W2B A;  1PMR A;  3OMC A;  2BDO A;  2HDL A;  4F88 A;  1NMF A;  4M1U B;  3M3Y H;  1U4P A;  2DUD A;  2K4K A;  5A35 A;  4DGZ A;  2F0E A;  2JXM B;  1EIF A;  1RIP A;  1WYD A;  1UE7 A;  5JJZ A;  4HJA A;  1JC7 A;  2VB2 X;  4WJ3 M;  3MFG A;  1B8A A;  4A3G B;  3AB9 A;  1PDQ A;  2KA7 A;  1SE3 A;  3IKJ A;  4YHH Q;  1X9N A;  3C2P A;  4AQY Q;  1SE4 A;  3SK8 A;  1HHV A;  2KEC A;  3A0J A;  1A3U A;  2M2L A;  2WAQ E;  1IL8 A;  4OIJ A;  1TVX A;  2Z0S A;  3HRZ C;  4Q5V A;  1HRJ A;  1WCM G;  2JEB I;  1CK1 A;  1YHB A;  3JAM i;  2HCC A;  3C3L A;  2OTJ A;  3K57 A;  3CCU A;  5JEA G;  2QA4 A;  1HNX L;  2NYZ D;  1BCP F;  3TSS A;  2JYO A;  1BCP D;  1HCZ A;  3OTO L;  1WCM H;  3W2D A;  2D9U A;  4GKJ Q;  3S1M H;  3HP3 A;  2PO4 A;  1QE6 A;  4P71 A;  1K73 C;  4B3T Q;  1ILP A;  5CR3 A;  1VQN A;  2E2H H;  4K14 A;  1LTG D;  4JC0 A;  4IJL A;  3CCM A;  1YNX A;  4DV7 L;  1LUZ A;  3HS0 C;  1E0B A;  2N8N A;  3A7L A;  2R6G A;  4F87 A;  4DV5 Q;  1K3R A;  4LF9 L;  1ET9 A;  5GAG C;  3VR2 A;  5ELO A;  2F1M A;  4ULL A;  2L4N A;  3F2D A;  2CKZ B;  1I50 B;  1VQ4 A;  2M9V A;  2PZT A;  4KHP Q;  1BCP B;  4C3I B;  3TRE A;  1K83 B;  1B50 A;  5C0X G;  4FF1 A;  1HNX Q;  3PCO B;  4ME3 A;  1EY0 A;  4B9X A;  3OTO Q;  4K8J A;  1G29 1;  1SYG A;  1JOQ A;  2F0T A;  3T53 B;  3LWU A;  4C2M B;  3GTM H;  1SYB A;  3J7A F;  1UNS A;  1B1Z A;  1E24 A;  1VQD A;  5C0X H;  3I56 A;  2UXD L;  2L9H A;  1LTT D;  3KLS X;  4DR7 Q;  4CDF C;  2SNM A;  1EWI A;  1BOS A;  1KHI A;  5AFW A;  3W5O A;  1Y14 B;  1WTR A;  4X66 Q;  3G4S A;  4UY8 C;  1I4P A;  2VZA A;  2BDN A;  1LTB D;  2RCN A;  2WV6 D;  3VR6 A;  4DV2 Q;  3HOY B;  3MEH A;  2MFI A;  1VQ8 A;  4ZLT F;  4Y7N B;  5JJI A;  3U58 A;  1GXD C;  4G4K A;  4OON A;  1LM0 A;  1EU3 A;  4BA2 I;  2F0H A;  4UP8 A;  5CV7 A;  1XNR Q;  3JAM L;  3F8T A;  5IGC A;  3A74 A;  1BCP C;  4CJ0 B;  5BN5 A;  3CQZ B;  3NSW A;  4UAI A;  4ZUJ A;  1SNQ A;  3MTS A;  4DV0 L;  4WJW A;  3QB3 A;  3PUV A;  1FYC A;  2XRS D;  1PVO A;  4NMZ A;  1TWG B;  4DAP A;  4LFA L;  3SDZ A;  1MBY A;  2HQE A;  2R93 H;  1B9M A;  5GAD C;  4A3M G;  3KLW A;  1PH6 A;  3K8A A;  4DUY L;  2J0T D;  1EQR A;  1KAB A;  2ALY B;  3A5U A;  2UUC L;  2DN8 A;  1K9M C;  4DK6 C;  2NB0 A;  3S2H B;  4K2K A;  1QOH A;  2EY6 A;  2IJ0 A;  2F3V A;  3QJY A;  3HOZ B;  1EYA A;  1PTO H;  4X64 Q;  2GA4 B;  2F4V L;  1EY8 A;  1D2B A;  1JT8 A;  4FF3 A;  3A56 A;  2O5I C;  4XIG S;  5J1Z A;  4JVZ A;  1JB7 A;  3H0G B;  4HCS A;  1L1O B;  2DNC A;  4IUR A;  2A74 C;  2E2D C;  3FVQ A;  4LFC L;  1W3S A;  2B2U C;  4R4C A;  1DZ1 A;  1O80 A;  3ULL A;  1GHJ A;  1I3Q H;  1SYF A;  4QIW E;  4LUO A;  1BXT A;  1YNN D;  4DNT B;  4LFA Q;  1CZG A;  2YV5 A;  2K5V A;  1WTV A;  1PZJ D;  3TRZ A;  1K8A C;  1PXU A;  2AUJ D;  4XT1 B;  2JA6 G;  3K7U C;  3MA2 B;  2VS1 A;  4I65 A;  3MEF A;  5BR8 L;  2XNA C;  4B3R Q;  4A3J B;  1ICW A;  4A3C H;  2MO1 A;  1JE4 A;  3PGZ A;  1F2Y A;  2R92 H;  2RQX A;  3FMC A;  4HIM A;  1KAW A;  2JA6 H;  2QF7 A;  2J7Z A;  3S17 H;  2JK8 A;  4JI7 L;  1EWH A;  2NN6 I;  5FLX c;  3TP5 A;  1N36 Q;  5C3X A;  1XNQ Q;  1GUT A;  1YBY A;  2WIN B;  5IGG A;  5KNC A;  4A93 H;  1RDP D;  4A3F H;  4JOI C;  4A3E G;  4LFC Q;  3EIV A;  3UI2 A;  3KLR A;  1EFW A;  1UEB A;  2ZXO A;  2EJM A;  2B2U A;  4JPB W;  1AE3 A;  4CKC A;  4MTN A;  2GN5 A;  4A3E H;  2F0F A;  3BJU A;  4C3H G;  3FPP A;  4X62 L;  5C4X H;  5M5X B;  4R4O A;  5IGD A;  3SVM A;  3HOX B;  2IX1 A;  4CKE A;  5IYC G;  1TS3 A;  1EFI D;  5BR8 Q;  4RCN A;  2OWO A;  2BH2 A;  2LXK A;  2IL8 A;  2JA8 B;  4C3H H;  3PUX A;  5A2Q E;  4ZK9 B;  1YIJ A;  5LMN W;  5ELC A;  1DD2 A;  2RF4 A;  1WFQ A;  1N33 L;  4QGU A;  1FNV A; 
#chains in the Genus database with same CATH homology
 2QW7 A;  2Z9H A;  4JVZ A;  5L37 A;  2RCF A;  4JW0 A;  2HD3 A;  4N8X 1;  4I7A A;  4N8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...