4N8FA

Ccml from thermosynechococcus elongatus bp-1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
b'MKIARVCGTVTSTQKEDTLTGVKFLVLQYLGEDGEFLPDYEVAADTVGAGQDEWVLVSRGSAARHIINGTDKPIDAAVVAIIDTVSRDNYLLYSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Interactions and structural variability of beta-carboxysomal shell protein CcmL.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Structural protein
total genus 14
structure length 95
sequence length 95
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2013-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03319 EutN_CcmL Ethanolamine utilisation protein EutN/carboxysome
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.220 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) EutN/Ccml 4n8fA00
2HD3A 2Z9HA 2QW7A 5L37A 4JW0A 4I7AA 4JVZA 4N8X1 2RCFA 4N8FA
chains in the Genus database with same CATH superfamily
3S24A 4MZ9A 2IX1A 1VQOA 3L0OA 1Q8KA 4RGNA 1I4RA 2RSOA 3CCVA 2LSSA 5ELBA 3D4RA 4LF6L 2AUJD 1PYWD 4BBRB 3D0FA 2NVTH 4FVMA 4U673 3X3MA 2TMPA 3DWPA 3A54A 2HCIA 4LFBQ 3HOYH 3G4SA 1VQBA 2F52A 2R7FA 3IFDA 1TWHB 3E6ZX 4FNFA 3OTOL 1CKNA 4O2DA 4C3HG 2VY3A 2L55A 4C3JG 2F0UA 2JA8G 4QL5A 3CCMA 3NELA 2N55A 4M8AA 3RZDB 1G6ZA 3PO2G 5JOBA 1W6JA 3K7AH 1NMFA 4H13C 1EY0A 1BQQT 5EBDA 2H5XA 1A3TA 4IUNA 2AQ2B 3KLSX 5DLQE 2NVQH 3PO3G 4AYBE 1VQ6A 1B1ZA 4IZ8A 3PUWA 1QJOA 3PUZA 2ASBA 4N8FA 5E1FA 1X65A 3V05A 1EY9A 1TXYA 2AUKA 4FXKC 5FO9B 1E1TA 1N33Q 1SSOA 1KAWA 3UDXA 1MIUA 2JA6H 2YU9B 4IUUA 1B44D 1Q1EA 5C3EG 4P75A 3QJYA 2XWJB 2VB3X 2A68C 4OX9Q 1VS0A 3GTMB 4DR7L 3FPPA 4PG3A 2LFNA 4MHEA 4ZYSA 5C4JB 3BZCA 4R4IA 2BOSA 3HOYG 4A76A 1Q81C 1PXUA 1RJTA 1JC7A 1U5KA 4A3LH 2PZUA 2A1AA 3U58A 1BCPD 3AFQA 5FKAC 1YJWA 1WOCA 3OOCA 2NN6H 2C35B 1N32Q 1SYDA 3K81C 3GV6A 3S2DB 1VQ8A 4M1UB 1F2MA 3G71A 4C3IH 4CKCA 1CQVA 3R8BA 1L0YB 4JW0A 4K8JA 3ER0A 3DXJC 1SFOH 3AMUA 1V1OA 2KEDA 5IYCH 4B9XA 2B63H 3T16A 3W3AA 1RIPA 3UDIA 1JJCB 1M4VA 1K28A 1DYQA 2Z9HA 3H3VI 1A3VA 3SXHA 2R7DA 3IL8A 4QIWE 1HZCA 4LF4L 3HS0C 5T1IA 1M8AA 4RA8A 3I4OA 4UHVA 5FLXc 3VA5A 3C3LA 1P8LA 1UUPA 3ULPA 1XNRQ 1SNDA 3IFTA 4MIUA 1YNND 3BYTB 3BVZA 5FO7B 4KKTA 1AN8A 1DGSA 4UP7A 1JT8A 3S1NB 1O7ZA 3SGIA 3SR1A 2OWOA 2KENA 3BVGA 2OQ0A 4J15A 2BE5C 3T1HL 1HXYD 3HOXH 2XN9C 4GKKL 2NN6G 1BBXC 4BXXH 1LTRD 2LY7A 3R2TA 2DGYA 1SYGA 1Y1VB 2Y0SG 1ET9A 4JI5L 2JA7H 4ALPA 3A56A 3URYA 1Q82C 3VYRA 4C3IG 4QJFA 2N3SA 4JI2Q 1RDPD 1EY8A 3GTJH 4OO1H 4F88A 5IYCG 3S1RB 1EZ6A 2HDMA 5DM63 3CF5A 3BDCA 4JI6L 3SE0A 3QOJA 4OIKA 3HOUH 2LS01 3O13A 4DR2L 4N8X1 1ENAA 2D0OA 4FYDA 3TP5A 5C5MA 1SNQA 2IL8A 3JC66 2A6EC 2MUYA 3MEFA 5KYLA 4HMJA 3AYHB 4DR5L 5CBEE 4K14A 5ELNA 5D65A 5K5PA 4HSVA 3ULJA 2FINB 3SEBA 1IBKQ 1M1KC 1E2WA 4LF7L 1RCVD 4A93B 2IHFA 4KK7A 4XT3B 3N6RA 3DMUA 5DEHA 3OHXC 5M9OA 1ASZA 2BCOA 1XPRA 2MQHA 4WFN3 3OYYA 3Q8DA 3J81j 1LM0A 3KBXA 2EYJA 1LT4D 1S5BD 1AP0A 4BXXG 2B2YA 4JOIC 4UP8A 2F0VA 2IPKD 3DEPA 3L3OC 2K5QA 2PMZB 3VR6A 1BBUA 2VW9A 1JOKA 1L0XB 1PTOB 1S72A 2VQFQ 1QCBD 1C9OA 3PIPA 4FP5D 2AMCB 1K0SA 1H9RA 4DFAA 3TSSA 2HDLA 2NTSA 1HR0Q 2UUCQ 5CV7A 5IT9E 2F0KA 3PIP3 3MTSA 4KN7C 1IW7C 4R4OA 5ISRA 3EBEA 2J4XA 1IL2A 5M3MB 3ND8A 1HNZL 1JWUD 1NCVA 1U4PA 4LFAQ 1HNXQ 3TN2A 5JAVA 1AEXA 2H1EA 4K0KQ 2O4XA 3PIO3 4KI0A 1E22A 1GO3E 4DV7Q 4JC0A 1GVPA 3CXCA 3VA7A 1PH8A 1IKMA 5J22A 1SNCA 2Y0SE 3R3OA 3EIVA 1HFGA 1ILPA 1VQ9A 4GLXA 1STBA 1BCPB 3KLSA 3M4PA 1KL9A 1LTBD 1K83B 1H9SB 2QEXA 1O7LA 5IWAQ 1NMGA 3PF5A 1ESRA 3NUCA 1I5FA 4A3MB 3L2PA 3G7LA 1V43A 2UXBL 2QILA 1VCIA 5EAYA 1PH7A 4GOPC 3I8ZA 2K32A 3EJIA 3H0GH 1WTHA 3GP7A 1QUQA 4JBKA 1U9RA 2N78A 1JWMD 4KKUA 4CDDC 4CKEA 3SVMA 3QG1A 3M9BA 4NPSA 4P74A 4X3SA 2PW7A 3S16B 4CDCC 1EFID 2OEOA 4DUYQ 1CHPD 4OX9L 1PHJA 2NVYB 3S17H 4K5XA 1Q8IA 3A5UA 1PTOF 2Z4IA 4CJ0B 2HIVA 4YWLA 4TSSA 1STNA 3CAMA 4AYBB 3F2DA 1LUZA 4NXMQ 4C2MB 3S1MH 4FF2A 3D4WA 3HZXA 4G4KA 2M00A 1MHWC 1C8CA 5JJIA 2C5CA 2L11A 2YV5A 3U4VA 5G3LD 5I6YA 1KD1C 4P73A 1WTWA 1X56A 3TREA 5FJ8H 5CC4A 1N32L 3T1YQ 2EY2A 3H09A 4C1NK 3OIPA 4A3FB 3OTOQ 1AFPA 5D3IB 2WB1G 5C4HA 5JPNC 1SE2A 3CQZH 1A2UA 3QWNA 2RBMA 2ZXRA 3CW2C 3RNUA 3D4DA 5ELCA 4A3JB 2R93H 4A3EB 3KUPA 5GQOA 4B3RQ 3J80L 4O42A 4XT1B 2K28A 3PUYA 3E9HA 4QY7A 1S3OA 2F0PA 1CUKA 2F0OA 1SYFA 3EQLC 5M5YB 1YJNA 3VR5A 1UE7A 4YWKA 1U4MA 1QWYA 3KF6A 2P5ZX 3I70A 4JPBW 2FHTA 1LT5D 1GD7A 4LJZC 3A8JE 5EPJA 2D2CC 1BBWA 1DXMA 4ZUJA 3TZDA 3TBIB 4IPCA 1QE6A 1VQFA 2N88A 1X3PA 1S5DD 3GTPB 3NE5B 2AQ1B 2MO1A 3K6OA 4HJ8A 3H91A 3V2TA 3HOZH 1HTLD 3I4NH 5CBAE 1PFNA 1TIID 1EIHA 5IE8A 5EPLA 3WOFA 5A2QE 2KEEA 2DN8A 1VQLA 2D0PA 2PPBC 4C3HB 5ELDA 3HOWH 4XIGS 2JA8B 5JVH3 4P2CB 1B9MA 2SOBA 3ND9A 1KIXA 5A2QL 3PO2B 2QDBA 4JI2L 4ZRZA 1DZ1A 4J1MA 1EYCA 5CMDA 2X69A 2Q2HA 2E2DC 1VQ4A 4KY7A 1YNJC 3R2IA 1EIFA 4TQUS 1ZXTA 4LF9Q 2K33A 3G6JB 1CSPA 3S15B 3KF8A 3S14H 4LF8Q 3VYSA 2FJ2A 1Z47A 1UEBA 1PFSA 3IRBA 3TP8A 1TWGH 1AE2A 1TWCH 2EYMA 1IXRA 1FGBD 4KV6A 5C3EB 1R4PB 4OEMB 2WB1E 2JXMB 4XQJA 1MKHA 4UDUC 1IBKL 4LF4Q 2XTIA 1PVOA 3SK8A 3FP9A 4R1JA 3UDFA 1G51A 3ONAB 1VQMA 1JWSD 2NVTB 4B9WA 3CKIB 1IBMQ 3I4NG 1YHAA 4C56C 1TKWB 3HOYB 3MFYA 5E7NA 1QOHA 3CHBD 1D1KA 2NWGA 1ENFA 1AE3A 1VQIA 2ID0A 2A6HD 2PCFB 1TY2A 4I65A 4F87A 4DF7A 1PYSB 1Z9FA 3Q22A 1OXTA 2B2WA 3NPPA 5T1GA 1AZQA 1HQRD 2VQFL 4L8JA 2B2VA 2K1BA 3K7AB 4GKJL 3BVMA 3DWAA 1PZJD 2UUCL 4G7OC 5M5XH 2RHQB 5I6WA 2IW3A 2ATWA 5IYBH 5IP9H 1SN8A 4JI8Q 1V1PB 2SNSA 1K8GA 2VQEQ 3U4ZA 4N9PA 1I4GA 3MXNA 1HNXL 1E1OA 1CHQD 1X3EA 3NP8A 4CHTB 4JI6Q 4RMFA 3QIAA 4DK6C 2UU9Q 4BY1H 2PQEA 1KHIA 3SK5A 4KD4A 1DCZA 1BO0A 1PLFA 2B2TA 4DR3Q 4X3KA 4GLVB 1L2FA 4DU9A 4O1NA 4JI1Q 4FXGC 2VS1A 1RTOA 3OWFA 4A3FG 1DM0B 3RLFA 2E74C 2XIWA 4GLAC 5IWAL 2IY5B 5IT9c 3U9SA 3GTQH 4IFDH 2MFIA 1TS3A 3TMEA 1K8OA 1KLGD 2EE1A 2B39A 5CV6A 1N9WA 2ICEC 2V4DA 2G9DA 3Q23A 1I4XA 1OXVA 2R7ZH 1LO5D 1KDAA 3NTKA 1PTOC 1UNSA 3VDYA 3ULLA 1EYDA 1TS5A 2Y0SB 4ID6A 3ZYYX 4C3IB 1MSGA 4PZ6A 4DUYL 1A62A 2IJ0A 1A15A 1ENCA 2Z6KC 1FL0A 3AQQA 5EJWA 1JCKB 1SFOB 1I6HH 3NWTA 4WJWA 5IYBG 4BA2I 3P75A 2RCNA 1IBLQ 2B63B 4BY7H 5E3FA 1NJIC 5CR3A 1JJ2A 4NXML 2L5TA 1HA6A 1Y8NB 2EYOA 2MGSA 3PQIA 1J9OA 1TQOA 1ICFB 1SJED 1K3RA 2K5WA 1BKBA 1PRTD 4RGOS 1HNZQ 1HA5A 1VQJA 3P7JA 1XXGA 4NXNL 4TKOB 5IP7H 1GJXA 3T1YL 3MXUA 1BCPC 1CKMA 2LMCB 4FO2A 3D6CA 3MZ5A 2V1CC 3MFGA 1UE1A 2SEBD 1OXXK 3F1ZA 1EY4A 2E2IH 4A3GH 4B3RL 4KD3A 5C0XI 1KQSA 4JI0Q 1WTOA 3KBGA 1NUCA 2KCNA 3K5NA 2K5HA 4LUZA 3HOXB 4OXPA 2WFWA 4DV6Q 5H1SE 5LL6S 2UXBQ 4HIDA 1PFBA 4EVOA 2D62A 1DOLA 2ZTCA 2JA7B 3BU2A 4DV4L 1KRSA 1I94Q 1EWHA 4KN4C 2OQKA 4QB4A 1VQKA 2BA0A 1SYEA 4YCVA 2MHVA 5KGUA 3M3YH 4BY7G 2Q2IA 2F0GA 1OXUA 4L5SA 1YNNC 1EEFD 2RVLA 4HIKA 4UP9A 3NQIA 4NP5A 1CK1A 2Z8LA 1F2ZA 2EJMA 3ZJYC 1X32A 1HNWL 2KUMA 1YZ6A 2F03A 2XRQD 2ALYB 4H02A 3DM3A 1YHQA 4EQOA 5GADC 1BF4A 3PCOB 1SNPA 2CH4A 1H95A 4KKSA 3E0JA 5CV4A 1O7YA 3EROA 4PNYA 4A3GG 5I2YA 1IZ6A 3UDGA 3CCLA 2Q2UA 1AH9A 2B2UA 4DUZL 1A8VA 4WJ4A 2RKSA 2XRSD 4LF9L 2NVXH 2FMMA 1HHVA 2K7VA 5JJZA 4LFCQ 4DN4M 5FLMH 2XWBB 4LF8L 2ICIA 5HGTA 3Q24A 3FVQA 1T5EA 2KHIA 4IFDJ 1SBBB 2EJFC 4IUQA 2EYHA 3GO5A 2F3VA 1FYCA 2JA6G 5IGGA 1EYAA 2NZ1D 2F0HA 4F7XA 4IPDA 4DV0Q 3U50C 1KDBA 1IYUA 2A5HA 4JBJA 1IBML 2LKVA 3BS1A 2QA4A 4EQPA 4F8MA 3HKZG 3EFXD 4BBRH 1PV4A 1SE4A 4HN7A 1QILA 2X6GA 2KCTA 2KJXA 4IJLA 4A3LG 4KHPQ 1Y14B 1EOVA 4J6HA 1EWCA 2L9HA 3CCQA 3NBHA 4HAEA 2DUDA 2KHSA 1Y1WH 2WB1B 3M7NA 3TZUA 4KLKA 3J80i 4P72A 3CPWA 1TWFH 1ASYA 1D5MC 1WD1A 4B3SQ 3VR3A 2CHBD 2O2LD 4JI8L 2CH4W 1II3A 5CGKA 1X3QA 2VQEL 3A8IE 1QZGA 1F2LA 4GN4B 2QF7A 4DAYA 3H0GB 4X65L 5JVG3 5LMUQ 4CKBA 2B63G 2MNAA 1YJ9A 1LT3D 3K57A 1XMQL 2VL6A 2JYOA 2UU9L 3OMGA 3KJPA 4KY6A 1OXSC 2JEBI 1SAPA 3DEOA 2OTJA 3CMAA 4DR3L 1OO9B 3S9WA 4JI1L 1XTCD 4DR4Q 4RKBA 1SRUA 3ICEA 3S17B 3RLNA 4KHVA 1VF7A 2EXDA 4OL7A 4B08A 2PNHA 1A2TA 2YTXA 4IALA 5C6AA 3BZKA 4PZ8A 3OIQA 4IO9A 3GTLB 2KVMA 2F0SA 4DNIA 2CW0C 2K04A 5IIFA 3S1MB 5AJ3Q 3GTMH 2DJGC 1TS4A 5C4JH 4DV1Q 4NW2A 3VYTA 3H94A 4R8IA 4A3KH 3MHBA 2OF1A 3E3XA 1D1IA 4DXFA 3HOXG 4NDXA 1L1OB 2Z6BA 2WIIB 1FNVA 1KNEA 3SHLA 3M7GA 3T4AC 5BR8Q 3K0XA 4R4QA 3CQZB 1EYGA 2F1MA 3W1BA 5EBCA 2JA7G 3L9AX 4ZK9B 1GM5A 2B8FA 3W2DA 2A69D 1SMYD 1ZKOA 4LNQA 1JICA 1IBLL 3CCSA 1KLUD 4OWXB 4GKJQ 1FNWA 1SE3A 4OO1G 1GUSA 3SK6A 3E5SA 3GDEA 2IX3A 2UUBQ 1UE5A 3HKZE 4JBWA 3SK4A 2G9HD 3HOUG 3ERQA 2PI2A 4R9WA 2JP1A 3PIOA 4J8QA 3K59A 2L15A 1SLJA 5IGFA 1U4RA 4XTCS 4K5WA 2D9UA 4AQYL 3NEMA 1XMOL 3FRPB 1E0BA 1RODA 1HZAA 4GS3A 1J5EL 4RKLA 4DAPA 4QMGA 4X3TA 3H3VH 3RN5A 1LLRD 1ONLA 4AIMA 1D2BA 2F0QA 3I4MH 1JE4A 2XSCA 1D5ZC 3PUVA 2R6GA 3I4NB 4JI0L 2K52A 3KYHC 1H9MA 2HHHQ 4NMZA 1GUWA 2QDLA 3FDTA 3C1EA 4DV6L 5GAGC 4A3KG 3HOWB 4POGA 2B8GA 5J3BA 3I56A 3M85A 4GNXB 2JSOA 2IX0A 1H9KA 2F3IA 4TVAB 1HQMC 5J39A 3UE0A 1WTVA 3DWQA 1QZHA 1I94L 4IUPA 3KJOA 1ZEQX 1LTTD 1S5FD 4HMIA 4RG1A 1CM9A 1B70B 1Q3LA 4DNTB 3K5LA 1NTGA 2B2YC 4A3DH 1O78A 2XNAC 4TRDA 3I4LA 1B3AA 4JV5Q 1WTPA 3FMCA 4QGUA 3HFZB 1XPUA 1I50H 1WCMH 5E4WC 1C48A 4DAVA 4UPAA 4CJ1B 3I91A 3S14B 2EY1A 2WAQG 1SE8A 1JOQA 2HD3A 5CV5A 2F0NA 2PQAA 2AWNA 4L63B 1TWGB 3NXWA 2OXPA 1TWCB 3BJUA 3TRZA 4RGMA 1EFWA 3GTKH 5I2XA 1W2BA 1STEA 2YYZA 3LWEA 1R9TH 2RCFA 4LW1A 2HCCA 3J80E 4NXNQ 2A74C 4UY8C 3I4MG 1FJGQ 1STGA 2JA5H 2KCCA 4ULLA 5C44H 4B3MQ 4LWCA 2MJ8A 5AFWA 1KDCA 2EYFA 5FO8B 1F77A 4N9TA 2EVBA 4IUVA 2Z4HA 4LF5Q 1PMRA 1SEBD 2IT1A 1MD2D 4PMBA 1CKNB 4LFCL 3QB3A 1CTMA 1BCPF 5K36H 1NY4A 4FF4A 2ZJRA 3OSOA 4E6IA 1TS2A 3H0GG 1Z6HA 1K0RA 2HIXA 2WKCA 2F4VQ 1EY7A 1BDOA 2EXZA 1LABA 4A3DG 3KDFA 4CGYB 5M5XB 1HJPA 4DV4Q 1I3QB 1PTOH 3GTOH 5CV9A 4DV0L 4QUFA 3A0JA 1PH1A 1WCMG 2EYPA 1F9SA 1S40A 2ZJQA 4RH6A 2FMCA 2VB2X 2BDNA 5KNCA 4KHPL 1HZBA 5C4XH 1PZID 4PMCA 1HNWQ 3AU7A 2A6HC 1N36Q 2E2JH 1A6XA 1SNMA 5BN3A 2QGQA 3NENA 5EKLA 5FJ8G 2E5LQ 2XGTA 1Y8OB 4HR7B 1K3BC 3L7ZC 4Q5VA 1B4OA 1NR4A 4KHZA 5C44G 2K4KA 4B3SL 1TWAB 3GTQB 3Q0AA 3WDNA 1MGSA 2RDGA 1VMCA 4HJ9A 3TEHB 2R93G 4JI3L 5K36G 5LMUL 3CRKC 1RHPA 4XXEA 2R7ZB 4K6DA 4DUZQ 1GUOA 3STBD 1STAA 2WAQE 3AEVA 2UUAQ 1VQ7A 1DONA 4A3IH 1DOMA 2EJGC 4HCSA 2XVSA 1SMXA 2AHOB 2KCMA 4A4IA 4DR4L 2R92H 1FD7D 2J0TD 1I6HB 2DJFC 3LNNA 3S16H 1C0AA 3KLWA 4LK1C 3MXPA 4BY7B 1RTNA 5IYDH 3J7YW 1X54A 3S2HH 3KLRA 4K8IA 4K2LA 1F2YA 2MP1A 4HSPA 4PZ7A 2HUGA 5AJ3L 4JK1C 4ODGA 3LGJA 3M4YA 3HOZG 1Q90A 4DV1L 4XQNA 5C4XG 2E8GA 4ZLTF 2K5VA 4C2MH 1IHZA 1CA5A 5ELOA 1UEAB 4HIMA 5M5WH 1XPOA 3HOWG 1E2VA 2L12A 1YEZA 2LXKA 5BR8L 1VDZA 1T9HA 3JAML 2EZVA 4L5QA 2RHSB 4PQXA 1Q7YC 2E2IB 4A3GB 2JK8A 1GOZA 1GKHA 4OHJA 4OWTB 4EQ5A 3CCRA 1MJCA 4Y52H 3OMCA 2KECA 3I2ZA 3E9IA 1IYVA 5EPKA 1PYBA 5NUCA 2UUBL 4A3EH 3NBHB 3CP0A 5JEAH 4DR1Q 4A3CH 5L37A 2NVQB 4KJOA 1EQQA 1Q46A 2HQEA 2I5HA 2OT2A 4A3IG 1RL2A 4L5TA 5F2DA 2FXQA 3F8TA 4ME5A 2Z6KA 4X62L 4X65Q 2CCZA 1I4HA 1YIJA 4HEDA 2ZT9C 1XMQQ 1WJJA 4ZAIA 3OPOA 4PV1C 4CJ2C 1S5ED 4YHHQ 1EOTA 2JA6B 1DD2A 1DJRD 1SR3A 1M90C 2ZXPA 1QVCA 4DAYB 3I73A 1YNJD 1VQ5A 3FKIH 1V8QA 1YVCA 4MNOA 4DK3C 4EGVA 3MVVA 4MTNA 2HHHL 3HKZB 3KOJA 3J81L 5D3DA 1B9NA 1KRTA 5JJKA 2NN6I 1Q12A 1JQYD 5IY0A 1STYA 2KA7A 3S1QH 2ZM6Q 2VNUD 1B3QA 4WORA 5EKKA 1L1OC 1PFMA 4DPGA 1SDFA 2GVBA 4HTHA 2K50A 1A0IA 2PW5A 4C3JH 4JYAQ 4X64Q 5M3FH 1X9NA 1G291 3HP3A 1JB7A 1PH4A 3T13A 3CC7A 3TP6A 1AW7A 3K0YA 3I55A 4JV5L 5KRUA 2B2WC 4I7AA 2NVXB 3CMEA 4Y7NH 3FPUB 3R93A 2Q8TA 3F2BA 2JQOA 5IP9G 4A3CG 3A7LA 2NZHA 1SXTA 1FGUA 3QOLA 2JE6I 1Q1BA 2F0WA 1N8RC 3PO3H 1VQCA 3TDQA 3DLLA 4DKAC 2ZXOA 4BY1G 4DK1A 2Q8IB 2N8NA 3KFUA 3CC4A 1EQRA 5LHY1 5I9PA 1FJGL 3FKIG 4AQYQ 1CFMA 2RF4A 4B3ML 1STHA 1XMOQ 4A75A 2B2TC 1J5EQ 3F2CA 1E24A 1IL8A 3CD6A 3C1FA 1HFNA 4LF5L 3CPFA 4IFDG 2YTVA 1ZYRD 1I4QA 1U4LA 3PV0A 1EIGA 1LACA 4XDXA 5E4XA 2NUCA 5G3LF 4GNXC 3TP7A 1K8MA 5COYA 1TY0A 1SROA 1D6EC 2QKIC 4C1NI 2R7ZG 4XYOA 3B6YA 1Y1WB 2AWOA 4V0BA 5KNDA 2F4VL 1XNQQ 3UE1A 1FR3A 4OELB 4ME3A 5M3FG 4XQQA 1TWFB 4P71A 2KBNA 4OO1I 2SNMA 4ILWA 2C9OA 4OWWB 3J80c 4HJ7A 4RCNA 2I46A 3LX0A 1HCZA 1GHJA 1EU4A 3J7ZC 3G48A 3GTJB 2F0EA 1PH6A 5GAHC 1JB3A 5LMNQ 3GTGH 1QUQB 1EWIA 3ERSX 4Q0FA 3HOUB 4YCWA 1BVSA 1VQDA 2E2HH 3VYUA 4BBSH 4X6AH 1LT6D 2OTLA 1PTOD 4NKLA 4POFA 1OTCA 1N36L 5HY6A 3M4OH 1GHKA 2GA4B 2VZAA 3GD7A 4U68A 1X3FA 5IP7G 2E5LL 5JEAJ 1PA6A 2KOLA 3NTIA 5CYUA 4IPGA 1MI2A 4KY5A 2PNRC 2JJQA 3NQTA 3AFPA 4QUCA 5IGBA 3I7FA 4EQNA 4GZYC 2PQAB 1LTAD 1BR9A 3RZOH 1SNOA 3RR5A 2MPMA 2CQOA 4KJNA 4A3KB 1LTID 4RGTA 2YTYA 1DOKA 4KTAA 2B3GA 4IOCA 2M2LA 2UUAL 1L0WA 4ZQ3A 4DV5L 2ES2A 3IKJA 1KTKA 4DV2Q 1G91A 4A3BH 4AH6A 1SJHD 5ELEA 4QQBX 3CCJA 5C4ZA 1VQEA 2WINB 1TVXA 2E76C 2VUMH 1EY6A 1G2TA 3TQYA 1YI2A 3HOVH 4RAUC 3KF6B 2TSSA 4JI7Q 4BBSG 2NYZD 2WAQB 4R8NA 5FK9C 1Z7TA 3KDFB 2EIFA 5KNBA 3PF4A 3KK7A 1B8AA 1WI5A 1UAPA 1HH2P 5KIXA 2HT1A 2BDOA 4R4TA 4YCUA 2Q8RE 3E0EA 2ZJPA 2PZWA 3HGBA 4CBVA 1TWHH 4ZUIA 1CZWA 2DY8A 3I4MB 4DR6L 4HJ5A 4DA2A 2N49A 4DAMA 1PH9A 2A68D 3EVQA 3T51B 1F9RA 2A69C 2RA4A 1SMYC 1C7YA 4FF3A 2IHEA 3RUZA 3RZDH 3NWSA 4DR1L 1E3PA 1PDQA 2A8VA 4JOIA 3EN2A 1AZPA 1LTGD 4JI3Q 1ILQA 3JAMc 4G7ZC 4JBMA 5IGEA 4G57A 4A3BG 2B2UC 4MTKA 1W3SA 5TSSA 5FLMG 1IYJB 2EQSA 5A35A 1V1PA 1H9JA 3A55A 3ITPA 5C0XH 5IOCA 4YHHL 1LTLA 1XTDA 2UXDL 4A3DB 1GUGA 4FF1A 2WKDA 3C2PA 3H15A 1PRTB 4I7ZC 2VUMG 1KNAA 4XYQA 1I50B 1EUJA 1VQNA 1WCMB 4B3TQ 3MAQA 2YU9H 2BH8A 3HOVG 3KF8B 1X3GA 4YY3Q 1W6KA 2EY5A 3NK9A 4BBRG 4QF4A 1XWEA 3A7AB 2ZM6L 1WFQA 1D5XC 4DNRB 4ZCKA 3GTKB 5J1ZA 3X3NA 4K5VA 1R9TB 5IGCA 2Q2TA 4JI4Q 1EQTA 1Y8PB 3OWEB 1P16A 4YIJA 1WTQA 5LL6X 4JYAL 4X64L 2JA5B 4DXGA 3CCEA 5C44B 1YHBA 1QG7A 3J81c 1Y1WG 1IKLA 3BZDB 1QNKA 2A73B 1F9PA 1EL0A 1XX8A 2PYKA 4NB3A 1CSQA 1CKOA 2R93B 3S2DH 1FVIA 1O80A 4GOPA 1UE6A 3Q6SA 1NAPA 2PZTA 3M4QA 1VQHA 1B2TA 3RLOA 4IPHA 2CWPA 2M9VA 2J7ZA 3K5OA 1WTXA 3AB9A 2BE5D 5C0XG 1UWVA 2EDGA 2EPBA 2CFMA 2BH2A 1N34Q 4X62Q 3MC0B 2SDFA 3GTOB 1MBYA 4HIOA 4Z9CB 1PH3A 5DNFA 3MXNB 3I3CA 2K03A 4IJHA 3BYYB 3OW2A 2B29A 1KAAA 3HOZB 1PRTF 2I5LX 4LFBL 3GV3A 2JA9A 1VQPA 5C4XB 3MWYW 2R61A 2E2JB 1YNXA 5C5LA 5IT9L 3FEWX 1JORA 3JAMi 1SYBA 1YBYA 2A6ED 3S1NH 1KXLA 3D6WA 1QVGA 1XNQL 5HGQA 1E2ZA 4RFBA 4PMWA 2UXCQ 2WACA 4H44C 3CCUA 3TS0A 1EY5A 1EQVA 1B53A 4OONA 1HUNA 2CW0D 1NSNS 3MXGA 1Y1VH 2Z1CA 4LMQD 1T5XD 2PI2E 5LMNL 1K9MC 2NBFA 4APVA 1BNZA 4X66Q 3DM1A 1HPCA 3HEJA 4IOAA 1K73C 1G6PA 5LMNW 4A3IB 1RF2D 5CORA 4QCLA 1HUMA 3S1RH 3FHWA 3SDZA 1WVLA 4BS9A 1N33L 3LWUA 1Y69U 1BOSA 2R92B 2PO4A 3J7AV 1S5CD 1CZGA 4DV3Q 3BDOA 1ML0D 1LTSD 4LUOA 4X3UA 1LV9A 2QW7A 1VQGA 4OIJA 4RWSC 2EOTA 1ET6A 4HJAA 1WYDA 1QB5D 3NSWA 1K8AC 3S2HB 3MA2B 3D8GA 1JOOA 3J81i 3PGZA 2EYLA 5KEEA 2CWAA 5C0XJ 1IW7D 2AKWB 3P1HA 3T53B 3WWVA 3G6EA 2Z0SA 5ELFA 5I9OA 2F0MA 3GTLH 4A93H 4H0LC 4L6TB 4DK0A 4LF6Q 1G2SA 3W5OA 5M5WB 2F0DA 1I4PA 1VQAA 3IAYA 3STBC 1A3UA 1JE5A 4DV2L 1D8LA 1G8ZD 1GXDC 4WRDA 5EKIA 3HKSA 5D14A 2L4NA 4V190 4YWMA 1YITA 1JMCA 2F0JA 5IODA 3J7AF 1KABA 2BA1A 1Y1VG 3N52A 2LXJA 3GQBA 2ENBA 2K5NA 4WJ3M 3PMFA 3I72A 4RCOA 4HCEA 2DNEA 4JI7L 1C4QA 1HZ9A 3BDLA 3T56B 4S3SA 2K6AA 3TS2A 2DNCA 1MSHA 5KYIA 3K7UC 1NE3A 2FFKB 2I5MX 4BY1B 1R4QB 1VF5C 2NTTA 2KQ3A 5M3MH 1X6OA 2RSNA 4UAIA 3PUXA 3CC2A 1B7YB 2ZTEA 4H7BA 5JJLA 3FKIB 4MN3A 2K05A 4IFDI 3CRLC 1XNRL 2WP8J 2RDHA 4JG2A 2JA5G 2A19A 1LYLA 4G7HC 4IURA 1ICWA 4K6LA 1CQFA 2EY6A 3K80C 4A93G 2L0CA 4ZKBB 4K2KA 4RHRA 3S1QB 1K83H 2CQAA 1SYCA 4DR7Q 4DGZA 3QR8A 2D5DA 5DM73 3WOEA 4GN3B 1NNXA 1MJEA 1BUVT 1WTRA 4QIWB 4LAAA 4IUTA 2AQ3B 2IWHA 3CU7A 4A3MH 4C3JB 5M3FB 1WD0A 4DV5Q 3MEHA 2F0LA 4CDEC 1V9PA 4BWGB 2OCEA 1D7QA 5FLXE 2RDFA 1E7ZA 4Y7NB 2F4IA 4B3TL 5BN5A 2O5JC 5C3XA 1BXTA 1U0LA 2GN5A 4YY3L 1JJGA 2CVRA 1CI3M 2K75A 3PO3B 3DHQA 1GUTA 1J8IA 2K5DA 2NVYH 5FLXL 4IN3A 3A8KE 1A63A 3JAME 5GROA 5M3MG 1EU3A 4JI4L 2F0FA 3H3VC 2I07B 4BA1I 3A74A 1CT1D 4R4CA 3HOVB 1TR5A 5FOBB 3K5MA 3U9OA 4ZKCB 3NTHA 5HURA 1ESFA 4A3FH 4DR6Q 1EZ8A 4O0AA 1L1OA 2R3ZA 2RQXA 3QO2A 3D31A 1PH2A 2NB0A 2O5IC 4ABNA 2F0TA 3VR2A 1PH5A 4A3JH 4A3MG 3PSIA 3V96A 5EQ0A 4FDBA 2K14A 5M5YH 1N34L 1F9QA 3T1HQ 1Q86C 1XYIA 4GKKQ 3I90A 4GN5A 1PRTC 1HRJA 1FNUA 1J6QA 4JCVE 3VR4A 2R92G 3P20A 3J81E 2UXDQ 5EGTA 1HR0L 4JI5Q 3C46A 2I0QA 4IQZA 3GTGB 4JVZA 1I3QH 5DAUA 3M3YB 2X6LA 5IYDG 1TU2B 3OW7A 3D3RA 1HR0W 2E2HB 2CKZB 2HQLA 2GVAA 3HRZC 4BBSB 1RKNA 1O7IA 4LFAL 4KMUC 1QVFA 1RD9D 2QCPX 3GTPH 1X55A 1EEID 3W1GA 1ZYRC 4LUVA 3M4OB 4K0KL 3RD4A 4EX5A 4AYBG 4DV7L 3NHHA 4DR2Q 1PZKD 3F2UA 1H9SA 3K58A 1NBWA 3DUZA 2DY7A 4FXDA 5BN4A 2UXCL 1I6VC 1EIYB 3UI2A 1CA6A 3EA6A 1NR2A 1TT2A 3RMHA 4DR5Q 2PMZE 4C3HH 2K01A 1B50A 3K8AA 3NBIA 5JPMC 2JA8H 3A5ZB 5I4DA 4GNXA 3RZOB 4RHSA 4L5RC 3J7A5 5IGDA 4LF7Q 1TWAH 1HTPA 4X66L 1GUNA 2G5DA 2MO0A 3PO2H 2F3WA 2NZOA 1JR0D 5GAEC 5C3WA 2H4OA 2QEJC 4A3JG 1XJVA 4A3EG 5JEAG 1S4ZA 2B2VC 3RN2A 4A3BB 2KHJA 2VXWA 1QNUA 3HG9A 2ZTDA 4CDFC 2JN4A 4DV3L 1KC8C 3BG3A 2E75C 4GOPB 3S15H 2L1BA 1V1QA 2JEAI 2WV6D 2VUMB 5CV8A 2F0IA 1VMPA 5C3EH 4OGQC 3H6MA
chains in the Genus database with same CATH topology
2HD3A 2Z9HA 2QW7A 5L37A 4JW0A 4I7AA 4JVZA 4N8X1 2RCFA 4N8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HD3 A;  2Z9H A;  2QW7 A;  5L37 A;  4JW0 A;  4I7A A;  4JVZ A;  4N8X 1;  2RCF A;  4N8F A; 
#chains in the Genus database with same CATH topology
 3S24 A;  4MZ9 A;  2IX1 A;  1VQO A;  3L0O A;  1Q8K A;  4RGN A;  1I4R A;  2RSO A;  3CCV A;  2LSS A;  5ELB A;  3D4R A;  4LF6 L;  2AUJ D;  1PYW D;  4BBR B;  3D0F A;  2NVT H;  4FVM A;  4U67 3;  3X3M A;  2TMP A;  3DWP A;  3A54 A;  2HCI A;  4LFB Q;  3HOY H;  3G4S A;  1VQB A;  2F52 A;  2R7F A;  3IFD A;  1TWH B;  3E6Z X;  4FNF A;  3OTO L;  1CKN A;  4O2D A;  4C3H G;  2VY3 A;  2L55 A;  4C3J G;  2F0U A;  2JA8 G;  4QL5 A;  3CCM A;  3NEL A;  2N55 A;  4M8A A;  3RZD B;  1G6Z A;  3PO2 G;  5JOB A;  1W6J A;  3K7A H;  1NMF A;  4H13 C;  1EY0 A;  1BQQ T;  5EBD A;  2H5X A;  1A3T A;  4IUN A;  2AQ2 B;  3KLS X;  5DLQ E;  2NVQ H;  3PO3 G;  4AYB E;  1VQ6 A;  1B1Z A;  4IZ8 A;  3PUW A;  1QJO A;  3PUZ A;  2ASB A;  4N8F A;  5E1F A;  1X65 A;  3V05 A;  1EY9 A;  1TXY A;  2AUK A;  4FXK C;  5FO9 B;  1E1T A;  1N33 Q;  1SSO A;  1KAW A;  3UDX A;  1MIU A;  2JA6 H;  2YU9 B;  4IUU A;  1B44 D;  1Q1E A;  5C3E G;  4P75 A;  3QJY A;  2XWJ B;  2VB3 X;  2A68 C;  4OX9 Q;  1VS0 A;  3GTM B;  4DR7 L;  3FPP A;  4PG3 A;  2LFN A;  4MHE A;  4ZYS A;  5C4J B;  3BZC A;  4R4I A;  2BOS A;  3HOY G;  4A76 A;  1Q81 C;  1PXU A;  1RJT A;  1JC7 A;  1U5K A;  4A3L H;  2PZU A;  2A1A A;  3U58 A;  1BCP D;  3AFQ A;  5FKA C;  1YJW A;  1WOC A;  3OOC A;  2NN6 H;  2C35 B;  1N32 Q;  1SYD A;  3K81 C;  3GV6 A;  3S2D B;  1VQ8 A;  4M1U B;  1F2M A;  3G71 A;  4C3I H;  4CKC A;  1CQV A;  3R8B A;  1L0Y B;  4JW0 A;  4K8J A;  3ER0 A;  3DXJ C;  1SFO H;  3AMU A;  1V1O A;  2KED A;  5IYC H;  4B9X A;  2B63 H;  3T16 A;  3W3A A;  1RIP A;  3UDI A;  1JJC B;  1M4V A;  1K28 A;  1DYQ A;  2Z9H A;  3H3V I;  1A3V A;  3SXH A;  2R7D A;  3IL8 A;  4QIW E;  1HZC A;  4LF4 L;  3HS0 C;  5T1I A;  1M8A A;  4RA8 A;  3I4O A;  4UHV A;  5FLX c;  3VA5 A;  3C3L A;  1P8L A;  1UUP A;  3ULP A;  1XNR Q;  1SND A;  3IFT A;  4MIU A;  1YNN D;  3BYT B;  3BVZ A;  5FO7 B;  4KKT A;  1AN8 A;  1DGS A;  4UP7 A;  1JT8 A;  3S1N B;  1O7Z A;  3SGI A;  3SR1 A;  2OWO A;  2KEN A;  3BVG A;  2OQ0 A;  4J15 A;  2BE5 C;  3T1H L;  1HXY D;  3HOX H;  2XN9 C;  4GKK L;  2NN6 G;  1BBX C;  4BXX H;  1LTR D;  2LY7 A;  3R2T A;  2DGY A;  1SYG A;  1Y1V B;  2Y0S G;  1ET9 A;  4JI5 L;  2JA7 H;  4ALP A;  3A56 A;  3URY A;  1Q82 C;  3VYR A;  4C3I G;  4QJF A;  2N3S A;  4JI2 Q;  1RDP D;  1EY8 A;  3GTJ H;  4OO1 H;  4F88 A;  5IYC G;  3S1R B;  1EZ6 A;  2HDM A;  5DM6 3;  3CF5 A;  3BDC A;  4JI6 L;  3SE0 A;  3QOJ A;  4OIK A;  3HOU H;  2LS0 1;  3O13 A;  4DR2 L;  4N8X 1;  1ENA A;  2D0O A;  4FYD A;  3TP5 A;  5C5M A;  1SNQ A;  2IL8 A;  3JC6 6;  2A6E C;  2MUY A;  3MEF A;  5KYL A;  4HMJ A;  3AYH B;  4DR5 L;  5CBE E;  4K14 A;  5ELN A;  5D65 A;  5K5P A;  4HSV A;  3ULJ A;  2FIN B;  3SEB A;  1IBK Q;  1M1K C;  1E2W A;  4LF7 L;  1RCV D;  4A93 B;  2IHF A;  4KK7 A;  4XT3 B;  3N6R A;  3DMU A;  5DEH A;  3OHX C;  5M9O A;  1ASZ A;  2BCO A;  1XPR A;  2MQH A;  4WFN 3;  3OYY A;  3Q8D A;  3J81 j;  1LM0 A;  3KBX A;  2EYJ A;  1LT4 D;  1S5B D;  1AP0 A;  4BXX G;  2B2Y A;  4JOI C;  4UP8 A;  2F0V A;  2IPK D;  3DEP A;  3L3O C;  2K5Q A;  2PMZ B;  3VR6 A;  1BBU A;  2VW9 A;  1JOK A;  1L0X B;  1PTO B;  1S72 A;  2VQF Q;  1QCB D;  1C9O A;  3PIP A;  4FP5 D;  2AMC B;  1K0S A;  1H9R A;  4DFA A;  3TSS A;  2HDL A;  2NTS A;  1HR0 Q;  2UUC Q;  5CV7 A;  5IT9 E;  2F0K A;  3PIP 3;  3MTS A;  4KN7 C;  1IW7 C;  4R4O A;  5ISR A;  3EBE A;  2J4X A;  1IL2 A;  5M3M B;  3ND8 A;  1HNZ L;  1JWU D;  1NCV A;  1U4P A;  4LFA Q;  1HNX Q;  3TN2 A;  5JAV A;  1AEX A;  2H1E A;  4K0K Q;  2O4X A;  3PIO 3;  4KI0 A;  1E22 A;  1GO3 E;  4DV7 Q;  4JC0 A;  1GVP A;  3CXC A;  3VA7 A;  1PH8 A;  1IKM A;  5J22 A;  1SNC A;  2Y0S E;  3R3O A;  3EIV A;  1HFG A;  1ILP A;  1VQ9 A;  4GLX A;  1STB A;  1BCP B;  3KLS A;  3M4P A;  1KL9 A;  1LTB D;  1K83 B;  1H9S B;  2QEX A;  1O7L A;  5IWA Q;  1NMG A;  3PF5 A;  1ESR A;  3NUC A;  1I5F A;  4A3M B;  3L2P A;  3G7L A;  1V43 A;  2UXB L;  2QIL A;  1VCI A;  5EAY A;  1PH7 A;  4GOP C;  3I8Z A;  2K32 A;  3EJI A;  3H0G H;  1WTH A;  3GP7 A;  1QUQ A;  4JBK A;  1U9R A;  2N78 A;  1JWM D;  4KKU A;  4CDD C;  4CKE A;  3SVM A;  3QG1 A;  3M9B A;  4NPS A;  4P74 A;  4X3S A;  2PW7 A;  3S16 B;  4CDC C;  1EFI D;  2OEO A;  4DUY Q;  1CHP D;  4OX9 L;  1PHJ A;  2NVY B;  3S17 H;  4K5X A;  1Q8I A;  3A5U A;  1PTO F;  2Z4I A;  4CJ0 B;  2HIV A;  4YWL A;  4TSS A;  1STN A;  3CAM A;  4AYB B;  3F2D A;  1LUZ A;  4NXM Q;  4C2M B;  3S1M H;  4FF2 A;  3D4W A;  3HZX A;  4G4K A;  2M00 A;  1MHW C;  1C8C A;  5JJI A;  2C5C A;  2L11 A;  2YV5 A;  3U4V A;  5G3L D;  5I6Y A;  1KD1 C;  4P73 A;  1WTW A;  1X56 A;  3TRE A;  5FJ8 H;  5CC4 A;  1N32 L;  3T1Y Q;  2EY2 A;  3H09 A;  4C1N K;  3OIP A;  4A3F B;  3OTO Q;  1AFP A;  5D3I B;  2WB1 G;  5C4H A;  5JPN C;  1SE2 A;  3CQZ H;  1A2U A;  3QWN A;  2RBM A;  2ZXR A;  3CW2 C;  3RNU A;  3D4D A;  5ELC A;  4A3J B;  2R93 H;  4A3E B;  3KUP A;  5GQO A;  4B3R Q;  3J80 L;  4O42 A;  4XT1 B;  2K28 A;  3PUY A;  3E9H A;  4QY7 A;  1S3O A;  2F0P A;  1CUK A;  2F0O A;  1SYF A;  3EQL C;  5M5Y B;  1YJN A;  3VR5 A;  1UE7 A;  4YWK A;  1U4M A;  1QWY A;  3KF6 A;  2P5Z X;  3I70 A;  4JPB W;  2FHT A;  1LT5 D;  1GD7 A;  4LJZ C;  3A8J E;  5EPJ A;  2D2C C;  1BBW A;  1DXM A;  4ZUJ A;  3TZD A;  3TBI B;  4IPC A;  1QE6 A;  1VQF A;  2N88 A;  1X3P A;  1S5D D;  3GTP B;  3NE5 B;  2AQ1 B;  2MO1 A;  3K6O A;  4HJ8 A;  3H91 A;  3V2T A;  3HOZ H;  1HTL D;  3I4N H;  5CBA E;  1PFN A;  1TII D;  1EIH A;  5IE8 A;  5EPL A;  3WOF A;  5A2Q E;  2KEE A;  2DN8 A;  1VQL A;  2D0P A;  2PPB C;  4C3H B;  5ELD A;  3HOW H;  4XIG S;  2JA8 B;  5JVH 3;  4P2C B;  1B9M A;  2SOB A;  3ND9 A;  1KIX A;  5A2Q L;  3PO2 B;  2QDB A;  4JI2 L;  4ZRZ A;  1DZ1 A;  4J1M A;  1EYC A;  5CMD A;  2X69 A;  2Q2H A;  2E2D C;  1VQ4 A;  4KY7 A;  1YNJ C;  3R2I A;  1EIF A;  4TQU S;  1ZXT A;  4LF9 Q;  2K33 A;  3G6J B;  1CSP A;  3S15 B;  3KF8 A;  3S14 H;  4LF8 Q;  3VYS A;  2FJ2 A;  1Z47 A;  1UEB A;  1PFS A;  3IRB A;  3TP8 A;  1TWG H;  1AE2 A;  1TWC H;  2EYM A;  1IXR A;  1FGB D;  4KV6 A;  5C3E B;  1R4P B;  4OEM B;  2WB1 E;  2JXM B;  4XQJ A;  1MKH A;  4UDU C;  1IBK L;  4LF4 Q;  2XTI A;  1PVO A;  3SK8 A;  3FP9 A;  4R1J A;  3UDF A;  1G51 A;  3ONA B;  1VQM A;  1JWS D;  2NVT B;  4B9W A;  3CKI B;  1IBM Q;  3I4N G;  1YHA A;  4C56 C;  1TKW B;  3HOY B;  3MFY A;  5E7N A;  1QOH A;  3CHB D;  1D1K A;  2NWG A;  1ENF A;  1AE3 A;  1VQI A;  2ID0 A;  2A6H D;  2PCF B;  1TY2 A;  4I65 A;  4F87 A;  4DF7 A;  1PYS B;  1Z9F A;  3Q22 A;  1OXT A;  2B2W A;  3NPP A;  5T1G A;  1AZQ A;  1HQR D;  2VQF L;  4L8J A;  2B2V A;  2K1B A;  3K7A B;  4GKJ L;  3BVM A;  3DWA A;  1PZJ D;  2UUC L;  4G7O C;  5M5X H;  2RHQ B;  5I6W A;  2IW3 A;  2ATW A;  5IYB H;  5IP9 H;  1SN8 A;  4JI8 Q;  1V1P B;  2SNS A;  1K8G A;  2VQE Q;  3U4Z A;  4N9P A;  1I4G A;  3MXN A;  1HNX L;  1E1O A;  1CHQ D;  1X3E A;  3NP8 A;  4CHT B;  4JI6 Q;  4RMF A;  3QIA A;  4DK6 C;  2UU9 Q;  4BY1 H;  2PQE A;  1KHI A;  3SK5 A;  4KD4 A;  1DCZ A;  1BO0 A;  1PLF A;  2B2T A;  4DR3 Q;  4X3K A;  4GLV B;  1L2F A;  4DU9 A;  4O1N A;  4JI1 Q;  4FXG C;  2VS1 A;  1RTO A;  3OWF A;  4A3F G;  1DM0 B;  3RLF A;  2E74 C;  2XIW A;  4GLA C;  5IWA L;  2IY5 B;  5IT9 c;  3U9S A;  3GTQ H;  4IFD H;  2MFI A;  1TS3 A;  3TME A;  1K8O A;  1KLG D;  2EE1 A;  2B39 A;  5CV6 A;  1N9W A;  2ICE C;  2V4D A;  2G9D A;  3Q23 A;  1I4X A;  1OXV A;  2R7Z H;  1LO5 D;  1KDA A;  3NTK A;  1PTO C;  1UNS A;  3VDY A;  3ULL A;  1EYD A;  1TS5 A;  2Y0S B;  4ID6 A;  3ZYY X;  4C3I B;  1MSG A;  4PZ6 A;  4DUY L;  1A62 A;  2IJ0 A;  1A15 A;  1ENC A;  2Z6K C;  1FL0 A;  3AQQ A;  5EJW A;  1JCK B;  1SFO B;  1I6H H;  3NWT A;  4WJW A;  5IYB G;  4BA2 I;  3P75 A;  2RCN A;  1IBL Q;  2B63 B;  4BY7 H;  5E3F A;  1NJI C;  5CR3 A;  1JJ2 A;  4NXM L;  2L5T A;  1HA6 A;  1Y8N B;  2EYO A;  2MGS A;  3PQI A;  1J9O A;  1TQO A;  1ICF B;  1SJE D;  1K3R A;  2K5W A;  1BKB A;  1PRT D;  4RGO S;  1HNZ Q;  1HA5 A;  1VQJ A;  3P7J A;  1XXG A;  4NXN L;  4TKO B;  5IP7 H;  1GJX A;  3T1Y L;  3MXU A;  1BCP C;  1CKM A;  2LMC B;  4FO2 A;  3D6C A;  3MZ5 A;  2V1C C;  3MFG A;  1UE1 A;  2SEB D;  1OXX K;  3F1Z A;  1EY4 A;  2E2I H;  4A3G H;  4B3R L;  4KD3 A;  5C0X I;  1KQS A;  4JI0 Q;  1WTO A;  3KBG A;  1NUC A;  2KCN A;  3K5N A;  2K5H A;  4LUZ A;  3HOX B;  4OXP A;  2WFW A;  4DV6 Q;  5H1S E;  5LL6 S;  2UXB Q;  4HID A;  1PFB A;  4EVO A;  2D62 A;  1DOL A;  2ZTC A;  2JA7 B;  3BU2 A;  4DV4 L;  1KRS A;  1I94 Q;  1EWH A;  4KN4 C;  2OQK A;  4QB4 A;  1VQK A;  2BA0 A;  1SYE A;  4YCV A;  2MHV A;  5KGU A;  3M3Y H;  4BY7 G;  2Q2I A;  2F0G A;  1OXU A;  4L5S A;  1YNN C;  1EEF D;  2RVL A;  4HIK A;  4UP9 A;  3NQI A;  4NP5 A;  1CK1 A;  2Z8L A;  1F2Z A;  2EJM A;  3ZJY C;  1X32 A;  1HNW L;  2KUM A;  1YZ6 A;  2F03 A;  2XRQ D;  2ALY B;  4H02 A;  3DM3 A;  1YHQ A;  4EQO A;  5GAD C;  1BF4 A;  3PCO B;  1SNP A;  2CH4 A;  1H95 A;  4KKS A;  3E0J A;  5CV4 A;  1O7Y A;  3ERO A;  4PNY A;  4A3G G;  5I2Y A;  1IZ6 A;  3UDG A;  3CCL A;  2Q2U A;  1AH9 A;  2B2U A;  4DUZ L;  1A8V A;  4WJ4 A;  2RKS A;  2XRS D;  4LF9 L;  2NVX H;  2FMM A;  1HHV A;  2K7V A;  5JJZ A;  4LFC Q;  4DN4 M;  5FLM H;  2XWB B;  4LF8 L;  2ICI A;  5HGT A;  3Q24 A;  3FVQ A;  1T5E A;  2KHI A;  4IFD J;  1SBB B;  2EJF C;  4IUQ A;  2EYH A;  3GO5 A;  2F3V A;  1FYC A;  2JA6 G;  5IGG A;  1EYA A;  2NZ1 D;  2F0H A;  4F7X A;  4IPD A;  4DV0 Q;  3U50 C;  1KDB A;  1IYU A;  2A5H A;  4JBJ A;  1IBM L;  2LKV A;  3BS1 A;  2QA4 A;  4EQP A;  4F8M A;  3HKZ G;  3EFX D;  4BBR H;  1PV4 A;  1SE4 A;  4HN7 A;  1QIL A;  2X6G A;  2KCT A;  2KJX A;  4IJL A;  4A3L G;  4KHP Q;  1Y14 B;  1EOV A;  4J6H A;  1EWC A;  2L9H A;  3CCQ A;  3NBH A;  4HAE A;  2DUD A;  2KHS A;  1Y1W H;  2WB1 B;  3M7N A;  3TZU A;  4KLK A;  3J80 i;  4P72 A;  3CPW A;  1TWF H;  1ASY A;  1D5M C;  1WD1 A;  4B3S Q;  3VR3 A;  2CHB D;  2O2L D;  4JI8 L;  2CH4 W;  1II3 A;  5CGK A;  1X3Q A;  2VQE L;  3A8I E;  1QZG A;  1F2L A;  4GN4 B;  2QF7 A;  4DAY A;  3H0G B;  4X65 L;  5JVG 3;  5LMU Q;  4CKB A;  2B63 G;  2MNA A;  1YJ9 A;  1LT3 D;  3K57 A;  1XMQ L;  2VL6 A;  2JYO A;  2UU9 L;  3OMG A;  3KJP A;  4KY6 A;  1OXS C;  2JEB I;  1SAP A;  3DEO A;  2OTJ A;  3CMA A;  4DR3 L;  1OO9 B;  3S9W A;  4JI1 L;  1XTC D;  4DR4 Q;  4RKB A;  1SRU A;  3ICE A;  3S17 B;  3RLN A;  4KHV A;  1VF7 A;  2EXD A;  4OL7 A;  4B08 A;  2PNH A;  1A2T A;  2YTX A;  4IAL A;  5C6A A;  3BZK A;  4PZ8 A;  3OIQ A;  4IO9 A;  3GTL B;  2KVM A;  2F0S A;  4DNI A;  2CW0 C;  2K04 A;  5IIF A;  3S1M B;  5AJ3 Q;  3GTM H;  2DJG C;  1TS4 A;  5C4J H;  4DV1 Q;  4NW2 A;  3VYT A;  3H94 A;  4R8I A;  4A3K H;  3MHB A;  2OF1 A;  3E3X A;  1D1I A;  4DXF A;  3HOX G;  4NDX A;  1L1O B;  2Z6B A;  2WII B;  1FNV A;  1KNE A;  3SHL A;  3M7G A;  3T4A C;  5BR8 Q;  3K0X A;  4R4Q A;  3CQZ B;  1EYG A;  2F1M A;  3W1B A;  5EBC A;  2JA7 G;  3L9A X;  4ZK9 B;  1GM5 A;  2B8F A;  3W2D A;  2A69 D;  1SMY D;  1ZKO A;  4LNQ A;  1JIC A;  1IBL L;  3CCS A;  1KLU D;  4OWX B;  4GKJ Q;  1FNW A;  1SE3 A;  4OO1 G;  1GUS A;  3SK6 A;  3E5S A;  3GDE A;  2IX3 A;  2UUB Q;  1UE5 A;  3HKZ E;  4JBW A;  3SK4 A;  2G9H D;  3HOU G;  3ERQ A;  2PI2 A;  4R9W A;  2JP1 A;  3PIO A;  4J8Q A;  3K59 A;  2L15 A;  1SLJ A;  5IGF A;  1U4R A;  4XTC S;  4K5W A;  2D9U A;  4AQY L;  3NEM A;  1XMO L;  3FRP B;  1E0B A;  1ROD A;  1HZA A;  4GS3 A;  1J5E L;  4RKL A;  4DAP A;  4QMG A;  4X3T A;  3H3V H;  3RN5 A;  1LLR D;  1ONL A;  4AIM A;  1D2B A;  2F0Q A;  3I4M H;  1JE4 A;  2XSC A;  1D5Z C;  3PUV A;  2R6G A;  3I4N B;  4JI0 L;  2K52 A;  3KYH C;  1H9M A;  2HHH Q;  4NMZ A;  1GUW A;  2QDL A;  3FDT A;  3C1E A;  4DV6 L;  5GAG C;  4A3K G;  3HOW B;  4POG A;  2B8G A;  5J3B A;  3I56 A;  3M85 A;  4GNX B;  2JSO A;  2IX0 A;  1H9K A;  2F3I A;  4TVA B;  1HQM C;  5J39 A;  3UE0 A;  1WTV A;  3DWQ A;  1QZH A;  1I94 L;  4IUP A;  3KJO A;  1ZEQ X;  1LTT D;  1S5F D;  4HMI A;  4RG1 A;  1CM9 A;  1B70 B;  1Q3L A;  4DNT B;  3K5L A;  1NTG A;  2B2Y C;  4A3D H;  1O78 A;  2XNA C;  4TRD A;  3I4L A;  1B3A A;  4JV5 Q;  1WTP A;  3FMC A;  4QGU A;  3HFZ B;  1XPU A;  1I50 H;  1WCM H;  5E4W C;  1C48 A;  4DAV A;  4UPA A;  4CJ1 B;  3I91 A;  3S14 B;  2EY1 A;  2WAQ G;  1SE8 A;  1JOQ A;  2HD3 A;  5CV5 A;  2F0N A;  2PQA A;  2AWN A;  4L63 B;  1TWG B;  3NXW A;  2OXP A;  1TWC B;  3BJU A;  3TRZ A;  4RGM A;  1EFW A;  3GTK H;  5I2X A;  1W2B A;  1STE A;  2YYZ A;  3LWE A;  1R9T H;  2RCF A;  4LW1 A;  2HCC A;  3J80 E;  4NXN Q;  2A74 C;  4UY8 C;  3I4M G;  1FJG Q;  1STG A;  2JA5 H;  2KCC A;  4ULL A;  5C44 H;  4B3M Q;  4LWC A;  2MJ8 A;  5AFW A;  1KDC A;  2EYF A;  5FO8 B;  1F77 A;  4N9T A;  2EVB A;  4IUV A;  2Z4H A;  4LF5 Q;  1PMR A;  1SEB D;  2IT1 A;  1MD2 D;  4PMB A;  1CKN B;  4LFC L;  3QB3 A;  1CTM A;  1BCP F;  5K36 H;  1NY4 A;  4FF4 A;  2ZJR A;  3OSO A;  4E6I A;  1TS2 A;  3H0G G;  1Z6H A;  1K0R A;  2HIX A;  2WKC A;  2F4V Q;  1EY7 A;  1BDO A;  2EXZ A;  1LAB A;  4A3D G;  3KDF A;  4CGY B;  5M5X B;  1HJP A;  4DV4 Q;  1I3Q B;  1PTO H;  3GTO H;  5CV9 A;  4DV0 L;  4QUF A;  3A0J A;  1PH1 A;  1WCM G;  2EYP A;  1F9S A;  1S40 A;  2ZJQ A;  4RH6 A;  2FMC A;  2VB2 X;  2BDN A;  5KNC A;  4KHP L;  1HZB A;  5C4X H;  1PZI D;  4PMC A;  1HNW Q;  3AU7 A;  2A6H C;  1N36 Q;  2E2J H;  1A6X A;  1SNM A;  5BN3 A;  2QGQ A;  3NEN A;  5EKL A;  5FJ8 G;  2E5L Q;  2XGT A;  1Y8O B;  4HR7 B;  1K3B C;  3L7Z C;  4Q5V A;  1B4O A;  1NR4 A;  4KHZ A;  5C44 G;  2K4K A;  4B3S L;  1TWA B;  3GTQ B;  3Q0A A;  3WDN A;  1MGS A;  2RDG A;  1VMC A;  4HJ9 A;  3TEH B;  2R93 G;  4JI3 L;  5K36 G;  5LMU L;  3CRK C;  1RHP A;  4XXE A;  2R7Z B;  4K6D A;  4DUZ Q;  1GUO A;  3STB D;  1STA A;  2WAQ E;  3AEV A;  2UUA Q;  1VQ7 A;  1DON A;  4A3I H;  1DOM A;  2EJG C;  4HCS A;  2XVS A;  1SMX A;  2AHO B;  2KCM A;  4A4I A;  4DR4 L;  2R92 H;  1FD7 D;  2J0T D;  1I6H B;  2DJF C;  3LNN A;  3S16 H;  1C0A A;  3KLW A;  4LK1 C;  3MXP A;  4BY7 B;  1RTN A;  5IYD H;  3J7Y W;  1X54 A;  3S2H H;  3KLR A;  4K8I A;  4K2L A;  1F2Y A;  2MP1 A;  4HSP A;  4PZ7 A;  2HUG A;  5AJ3 L;  4JK1 C;  4ODG A;  3LGJ A;  3M4Y A;  3HOZ G;  1Q90 A;  4DV1 L;  4XQN A;  5C4X G;  2E8G A;  4ZLT F;  2K5V A;  4C2M H;  1IHZ A;  1CA5 A;  5ELO A;  1UEA B;  4HIM A;  5M5W H;  1XPO A;  3HOW G;  1E2V A;  2L12 A;  1YEZ A;  2LXK A;  5BR8 L;  1VDZ A;  1T9H A;  3JAM L;  2EZV A;  4L5Q A;  2RHS B;  4PQX A;  1Q7Y C;  2E2I B;  4A3G B;  2JK8 A;  1GOZ A;  1GKH A;  4OHJ A;  4OWT B;  4EQ5 A;  3CCR A;  1MJC A;  4Y52 H;  3OMC A;  2KEC A;  3I2Z A;  3E9I A;  1IYV A;  5EPK A;  1PYB A;  5NUC A;  2UUB L;  4A3E H;  3NBH B;  3CP0 A;  5JEA H;  4DR1 Q;  4A3C H;  5L37 A;  2NVQ B;  4KJO A;  1EQQ A;  1Q46 A;  2HQE A;  2I5H A;  2OT2 A;  4A3I G;  1RL2 A;  4L5T A;  5F2D A;  2FXQ A;  3F8T A;  4ME5 A;  2Z6K A;  4X62 L;  4X65 Q;  2CCZ A;  1I4H A;  1YIJ A;  4HED A;  2ZT9 C;  1XMQ Q;  1WJJ A;  4ZAI A;  3OPO A;  4PV1 C;  4CJ2 C;  1S5E D;  4YHH Q;  1EOT A;  2JA6 B;  1DD2 A;  1DJR D;  1SR3 A;  1M90 C;  2ZXP A;  1QVC A;  4DAY B;  3I73 A;  1YNJ D;  1VQ5 A;  3FKI H;  1V8Q A;  1YVC A;  4MNO A;  4DK3 C;  4EGV A;  3MVV A;  4MTN A;  2HHH L;  3HKZ B;  3KOJ A;  3J81 L;  5D3D A;  1B9N A;  1KRT A;  5JJK A;  2NN6 I;  1Q12 A;  1JQY D;  5IY0 A;  1STY A;  2KA7 A;  3S1Q H;  2ZM6 Q;  2VNU D;  1B3Q A;  4WOR A;  5EKK A;  1L1O C;  1PFM A;  4DPG A;  1SDF A;  2GVB A;  4HTH A;  2K50 A;  1A0I A;  2PW5 A;  4C3J H;  4JYA Q;  4X64 Q;  5M3F H;  1X9N A;  1G29 1;  3HP3 A;  1JB7 A;  1PH4 A;  3T13 A;  3CC7 A;  3TP6 A;  1AW7 A;  3K0Y A;  3I55 A;  4JV5 L;  5KRU A;  2B2W C;  4I7A A;  2NVX B;  3CME A;  4Y7N H;  3FPU B;  3R93 A;  2Q8T A;  3F2B A;  2JQO A;  5IP9 G;  4A3C G;  3A7L A;  2NZH A;  1SXT A;  1FGU A;  3QOL A;  2JE6 I;  1Q1B A;  2F0W A;  1N8R C;  3PO3 H;  1VQC A;  3TDQ A;  3DLL A;  4DKA C;  2ZXO A;  4BY1 G;  4DK1 A;  2Q8I B;  2N8N A;  3KFU A;  3CC4 A;  1EQR A;  5LHY 1;  5I9P A;  1FJG L;  3FKI G;  4AQY Q;  1CFM A;  2RF4 A;  4B3M L;  1STH A;  1XMO Q;  4A75 A;  2B2T C;  1J5E Q;  3F2C A;  1E24 A;  1IL8 A;  3CD6 A;  3C1F A;  1HFN A;  4LF5 L;  3CPF A;  4IFD G;  2YTV A;  1ZYR D;  1I4Q A;  1U4L A;  3PV0 A;  1EIG A;  1LAC A;  4XDX A;  5E4X A;  2NUC A;  5G3L F;  4GNX C;  3TP7 A;  1K8M A;  5COY A;  1TY0 A;  1SRO A;  1D6E C;  2QKI C;  4C1N I;  2R7Z G;  4XYO A;  3B6Y A;  1Y1W B;  2AWO A;  4V0B A;  5KND A;  2F4V L;  1XNQ Q;  3UE1 A;  1FR3 A;  4OEL B;  4ME3 A;  5M3F G;  4XQQ A;  1TWF B;  4P71 A;  2KBN A;  4OO1 I;  2SNM A;  4ILW A;  2C9O A;  4OWW B;  3J80 c;  4HJ7 A;  4RCN A;  2I46 A;  3LX0 A;  1HCZ A;  1GHJ A;  1EU4 A;  3J7Z C;  3G48 A;  3GTJ B;  2F0E A;  1PH6 A;  5GAH C;  1JB3 A;  5LMN Q;  3GTG H;  1QUQ B;  1EWI A;  3ERS X;  4Q0F A;  3HOU B;  4YCW A;  1BVS A;  1VQD A;  2E2H H;  3VYU A;  4BBS H;  4X6A H;  1LT6 D;  2OTL A;  1PTO D;  4NKL A;  4POF A;  1OTC A;  1N36 L;  5HY6 A;  3M4O H;  1GHK A;  2GA4 B;  2VZA A;  3GD7 A;  4U68 A;  1X3F A;  5IP7 G;  2E5L L;  5JEA J;  1PA6 A;  2KOL A;  3NTI A;  5CYU A;  4IPG A;  1MI2 A;  4KY5 A;  2PNR C;  2JJQ A;  3NQT A;  3AFP A;  4QUC A;  5IGB A;  3I7F A;  4EQN A;  4GZY C;  2PQA B;  1LTA D;  1BR9 A;  3RZO H;  1SNO A;  3RR5 A;  2MPM A;  2CQO A;  4KJN A;  4A3K B;  1LTI D;  4RGT A;  2YTY A;  1DOK A;  4KTA A;  2B3G A;  4IOC A;  2M2L A;  2UUA L;  1L0W A;  4ZQ3 A;  4DV5 L;  2ES2 A;  3IKJ A;  1KTK A;  4DV2 Q;  1G91 A;  4A3B H;  4AH6 A;  1SJH D;  5ELE A;  4QQB X;  3CCJ A;  5C4Z A;  1VQE A;  2WIN B;  1TVX A;  2E76 C;  2VUM H;  1EY6 A;  1G2T A;  3TQY A;  1YI2 A;  3HOV H;  4RAU C;  3KF6 B;  2TSS A;  4JI7 Q;  4BBS G;  2NYZ D;  2WAQ B;  4R8N A;  5FK9 C;  1Z7T A;  3KDF B;  2EIF A;  5KNB A;  3PF4 A;  3KK7 A;  1B8A A;  1WI5 A;  1UAP A;  1HH2 P;  5KIX A;  2HT1 A;  2BDO A;  4R4T A;  4YCU A;  2Q8R E;  3E0E A;  2ZJP A;  2PZW A;  3HGB A;  4CBV A;  1TWH H;  4ZUI A;  1CZW A;  2DY8 A;  3I4M B;  4DR6 L;  4HJ5 A;  4DA2 A;  2N49 A;  4DAM A;  1PH9 A;  2A68 D;  3EVQ A;  3T51 B;  1F9R A;  2A69 C;  2RA4 A;  1SMY C;  1C7Y A;  4FF3 A;  2IHE A;  3RUZ A;  3RZD H;  3NWS A;  4DR1 L;  1E3P A;  1PDQ A;  2A8V A;  4JOI A;  3EN2 A;  1AZP A;  1LTG D;  4JI3 Q;  1ILQ A;  3JAM c;  4G7Z C;  4JBM A;  5IGE A;  4G57 A;  4A3B G;  2B2U C;  4MTK A;  1W3S A;  5TSS A;  5FLM G;  1IYJ B;  2EQS A;  5A35 A;  1V1P A;  1H9J A;  3A55 A;  3ITP A;  5C0X H;  5IOC A;  4YHH L;  1LTL A;  1XTD A;  2UXD L;  4A3D B;  1GUG A;  4FF1 A;  2WKD A;  3C2P A;  3H15 A;  1PRT B;  4I7Z C;  2VUM G;  1KNA A;  4XYQ A;  1I50 B;  1EUJ A;  1VQN A;  1WCM B;  4B3T Q;  3MAQ A;  2YU9 H;  2BH8 A;  3HOV G;  3KF8 B;  1X3G A;  4YY3 Q;  1W6K A;  2EY5 A;  3NK9 A;  4BBR G;  4QF4 A;  1XWE A;  3A7A B;  2ZM6 L;  1WFQ A;  1D5X C;  4DNR B;  4ZCK A;  3GTK B;  5J1Z A;  3X3N A;  4K5V A;  1R9T B;  5IGC A;  2Q2T A;  4JI4 Q;  1EQT A;  1Y8P B;  3OWE B;  1P16 A;  4YIJ A;  1WTQ A;  5LL6 X;  4JYA L;  4X64 L;  2JA5 B;  4DXG A;  3CCE A;  5C44 B;  1YHB A;  1QG7 A;  3J81 c;  1Y1W G;  1IKL A;  3BZD B;  1QNK A;  2A73 B;  1F9P A;  1EL0 A;  1XX8 A;  2PYK A;  4NB3 A;  1CSQ A;  1CKO A;  2R93 B;  3S2D H;  1FVI A;  1O80 A;  4GOP A;  1UE6 A;  3Q6S A;  1NAP A;  2PZT A;  3M4Q A;  1VQH A;  1B2T A;  3RLO A;  4IPH A;  2CWP A;  2M9V A;  2J7Z A;  3K5O A;  1WTX A;  3AB9 A;  2BE5 D;  5C0X G;  1UWV A;  2EDG A;  2EPB A;  2CFM A;  2BH2 A;  1N34 Q;  4X62 Q;  3MC0 B;  2SDF A;  3GTO B;  1MBY A;  4HIO A;  4Z9C B;  1PH3 A;  5DNF A;  3MXN B;  3I3C A;  2K03 A;  4IJH A;  3BYY B;  3OW2 A;  2B29 A;  1KAA A;  3HOZ B;  1PRT F;  2I5L X;  4LFB L;  3GV3 A;  2JA9 A;  1VQP A;  5C4X B;  3MWY W;  2R61 A;  2E2J B;  1YNX A;  5C5L A;  5IT9 L;  3FEW X;  1JOR A;  3JAM i;  1SYB A;  1YBY A;  2A6E D;  3S1N H;  1KXL A;  3D6W A;  1QVG A;  1XNQ L;  5HGQ A;  1E2Z A;  4RFB A;  4PMW A;  2UXC Q;  2WAC A;  4H44 C;  3CCU A;  3TS0 A;  1EY5 A;  1EQV A;  1B53 A;  4OON A;  1HUN A;  2CW0 D;  1NSN S;  3MXG A;  1Y1V H;  2Z1C A;  4LMQ D;  1T5X D;  2PI2 E;  5LMN L;  1K9M C;  2NBF A;  4APV A;  1BNZ A;  4X66 Q;  3DM1 A;  1HPC A;  3HEJ A;  4IOA A;  1K73 C;  1G6P A;  5LMN W;  4A3I B;  1RF2 D;  5COR A;  4QCL A;  1HUM A;  3S1R H;  3FHW A;  3SDZ A;  1WVL A;  4BS9 A;  1N33 L;  3LWU A;  1Y69 U;  1BOS A;  2R92 B;  2PO4 A;  3J7A V;  1S5C D;  1CZG A;  4DV3 Q;  3BDO A;  1ML0 D;  1LTS D;  4LUO A;  4X3U A;  1LV9 A;  2QW7 A;  1VQG A;  4OIJ A;  4RWS C;  2EOT A;  1ET6 A;  4HJA A;  1WYD A;  1QB5 D;  3NSW A;  1K8A C;  3S2H B;  3MA2 B;  3D8G A;  1JOO A;  3J81 i;  3PGZ A;  2EYL A;  5KEE A;  2CWA A;  5C0X J;  1IW7 D;  2AKW B;  3P1H A;  3T53 B;  3WWV A;  3G6E A;  2Z0S A;  5ELF A;  5I9O A;  2F0M A;  3GTL H;  4A93 H;  4H0L C;  4L6T B;  4DK0 A;  4LF6 Q;  1G2S A;  3W5O A;  5M5W B;  2F0D A;  1I4P A;  1VQA A;  3IAY A;  3STB C;  1A3U A;  1JE5 A;  4DV2 L;  1D8L A;  1G8Z D;  1GXD C;  4WRD A;  5EKI A;  3HKS A;  5D14 A;  2L4N A;  4V19 0;  4YWM A;  1YIT A;  1JMC A;  2F0J A;  5IOD A;  3J7A F;  1KAB A;  2BA1 A;  1Y1V G;  3N52 A;  2LXJ A;  3GQB A;  2ENB A;  2K5N A;  4WJ3 M;  3PMF A;  3I72 A;  4RCO A;  4HCE A;  2DNE A;  4JI7 L;  1C4Q A;  1HZ9 A;  3BDL A;  3T56 B;  4S3S A;  2K6A A;  3TS2 A;  2DNC A;  1MSH A;  5KYI A;  3K7U C;  1NE3 A;  2FFK B;  2I5M X;  4BY1 B;  1R4Q B;  1VF5 C;  2NTT A;  2KQ3 A;  5M3M H;  1X6O A;  2RSN A;  4UAI A;  3PUX A;  3CC2 A;  1B7Y B;  2ZTE A;  4H7B A;  5JJL A;  3FKI B;  4MN3 A;  2K05 A;  4IFD I;  3CRL C;  1XNR L;  2WP8 J;  2RDH A;  4JG2 A;  2JA5 G;  2A19 A;  1LYL A;  4G7H C;  4IUR A;  1ICW A;  4K6L A;  1CQF A;  2EY6 A;  3K80 C;  4A93 G;  2L0C A;  4ZKB B;  4K2K A;  4RHR A;  3S1Q B;  1K83 H;  2CQA A;  1SYC A;  4DR7 Q;  4DGZ A;  3QR8 A;  2D5D A;  5DM7 3;  3WOE A;  4GN3 B;  1NNX A;  1MJE A;  1BUV T;  1WTR A;  4QIW B;  4LAA A;  4IUT A;  2AQ3 B;  2IWH A;  3CU7 A;  4A3M H;  4C3J B;  5M3F B;  1WD0 A;  4DV5 Q;  3MEH A;  2F0L A;  4CDE C;  1V9P A;  4BWG B;  2OCE A;  1D7Q A;  5FLX E;  2RDF A;  1E7Z A;  4Y7N B;  2F4I A;  4B3T L;  5BN5 A;  2O5J C;  5C3X A;  1BXT A;  1U0L A;  2GN5 A;  4YY3 L;  1JJG A;  2CVR A;  1CI3 M;  2K75 A;  3PO3 B;  3DHQ A;  1GUT A;  1J8I A;  2K5D A;  2NVY H;  5FLX L;  4IN3 A;  3A8K E;  1A63 A;  3JAM E;  5GRO A;  5M3M G;  1EU3 A;  4JI4 L;  2F0F A;  3H3V C;  2I07 B;  4BA1 I;  3A74 A;  1CT1 D;  4R4C A;  3HOV B;  1TR5 A;  5FOB B;  3K5M A;  3U9O A;  4ZKC B;  3NTH A;  5HUR A;  1ESF A;  4A3F H;  4DR6 Q;  1EZ8 A;  4O0A A;  1L1O A;  2R3Z A;  2RQX A;  3QO2 A;  3D31 A;  1PH2 A;  2NB0 A;  2O5I C;  4ABN A;  2F0T A;  3VR2 A;  1PH5 A;  4A3J H;  4A3M G;  3PSI A;  3V96 A;  5EQ0 A;  4FDB A;  2K14 A;  5M5Y H;  1N34 L;  1F9Q A;  3T1H Q;  1Q86 C;  1XYI A;  4GKK Q;  3I90 A;  4GN5 A;  1PRT C;  1HRJ A;  1FNU A;  1J6Q A;  4JCV E;  3VR4 A;  2R92 G;  3P20 A;  3J81 E;  2UXD Q;  5EGT A;  1HR0 L;  4JI5 Q;  3C46 A;  2I0Q A;  4IQZ A;  3GTG B;  4JVZ A;  1I3Q H;  5DAU A;  3M3Y B;  2X6L A;  5IYD G;  1TU2 B;  3OW7 A;  3D3R A;  1HR0 W;  2E2H B;  2CKZ B;  2HQL A;  2GVA A;  3HRZ C;  4BBS B;  1RKN A;  1O7I A;  4LFA L;  4KMU C;  1QVF A;  1RD9 D;  2QCP X;  3GTP H;  1X55 A;  1EEI D;  3W1G A;  1ZYR C;  4LUV A;  3M4O B;  4K0K L;  3RD4 A;  4EX5 A;  4AYB G;  4DV7 L;  3NHH A;  4DR2 Q;  1PZK D;  3F2U A;  1H9S A;  3K58 A;  1NBW A;  3DUZ A;  2DY7 A;  4FXD A;  5BN4 A;  2UXC L;  1I6V C;  1EIY B;  3UI2 A;  1CA6 A;  3EA6 A;  1NR2 A;  1TT2 A;  3RMH A;  4DR5 Q;  2PMZ E;  4C3H H;  2K01 A;  1B50 A;  3K8A A;  3NBI A;  5JPM C;  2JA8 H;  3A5Z B;  5I4D A;  4GNX A;  3RZO B;  4RHS A;  4L5R C;  3J7A 5;  5IGD A;  4LF7 Q;  1TWA H;  1HTP A;  4X66 L;  1GUN A;  2G5D A;  2MO0 A;  3PO2 H;  2F3W A;  2NZO A;  1JR0 D;  5GAE C;  5C3W A;  2H4O A;  2QEJ C;  4A3J G;  1XJV A;  4A3E G;  5JEA G;  1S4Z A;  2B2V C;  3RN2 A;  4A3B B;  2KHJ A;  2VXW A;  1QNU A;  3HG9 A;  2ZTD A;  4CDF C;  2JN4 A;  4DV3 L;  1KC8 C;  3BG3 A;  2E75 C;  4GOP B;  3S15 H;  2L1B A;  1V1Q A;  2JEA I;  2WV6 D;  2VUM B;  5CV8 A;  2F0I A;  1VMP A;  5C3E H;  4OGQ C;  3H6M A; 
#chains in the Genus database with same CATH homology
 2HD3 A;  2Z9H A;  2QW7 A;  5L37 A;  4JW0 A;  4I7A A;  4JVZ A;  4N8X 1;  2RCF A;  4N8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...