1FJGL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 13
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fjgL00
4DUYQ 1YIJA 3WWVA 5GAHC 5LMNQ 1PH7A 4DR5L 1X3EA 3U4ZA 2ZJRA 1C7YA 4JI3Q 2VZAA 3S1QH 2R7DA 3OYYA 1WJJA 1I5FA 2R7FA 3K8AA 4RMFA 2VQEL 2LSSA 3CCEA 1GM5A 1EIFA 2YU9H 1VQLA 3PF5A 1WI5A 5LMUL 1HNZL 2ZJQA 1FGUA 5M5WH 2ATWA 3H3VH 1K0RA 4DR7Q 2I5HA 3U50C 1N34L 3D31A 1PH4A 3BZKA 3TEHB 4IO9A 1XPRA 1OXUA 2RF4A 1L1OB 2I5MX 2K75A 3L2PA 4JI1Q 2UXBL 4RG1A 4BY7H 2RCNA 4R4TA 5FJ8H 3B6YA 5E7NA 4DV0L 1E24A 4AYBG 3H15A 4DV5Q 1NBWA 2KCMA 3FKIH 2NZOA 3NEMA 3J81c 4DR5Q 1PH2A 4LFAQ 3KLWA 2VS1A 4JI3L 2PI2E 2VNUD 4HIDA 2A19A 4JI7Q 3EN2A 4PG3A 2E2HH 1VQKA 5C4JH 4A3MG 2VL6A 1E1OA 3A0JA 3A5ZB 3UE0A 5AJ3Q 1KAWA 3M9BA 5J3BA 4DUZQ 2HT1A 4DR7L 2PMZE 2H5XA 4R4CA 2OCEA 4UPAA 4OO1I 3M85A 2B29A 4JG2A 1LM0A 4A3KG 1YBYA 2D0OA 1VQDA 1I94L 4GKKQ 1EYGA 1VQJA 3U4VA 3CCJA 3HOWG 2D0PA 4UY8C 4YWLA 2ALYB 4OONA 1YNXA 4QY7A 1MJEA 1FJGQ 1NJIC 4KHPQ 1FVIA 4DR6L 1Q1EA 4L5SA 4GKJQ 1OXTA 4NB3A 4JYAQ 3KF6A 5GAEC 2QGQA 1OTCA 4X62Q 1HJPA 1VQPA 4B3TL 4JI7L 3RN5A 3T1YQ 2JA8G 3HOVG 4QQBX 3GO5A 5FJ8G 4DUZL 1HZCA 2IHFA 1QVCA 3CCLA 3S15H 2LXKA 4A3GG 2RHQB 4XTCS 4P75A 5C44H 1LUZA 1WCMH 4GN4B 1J6QA 2JA7H 1CKMA 1W2BA 5IWAL 4YCVA 3ICEA 4A3GH 1GKHA 4HJ5A 3CCSA 3STBD 1WCMG 4PZ6A 4C3JH 1Q82C 3KDFB 1TXYA 5LMNW 3VDYA 1JMCA 3PF4A 1HNXQ 1I6HH 2BH2A 3NBHB 3CCQA 1K8AC 4JI6Q 3F2DA 4FDBA 1Q81C 3DM3A 4YHHL 4DV6L 4B3RQ 1KRSA 2AWOA 1Q7YC 4WJ3M 2UUBQ 4MZ9A 3ERSX 3I55A 1B70B 4GNXA 4A93G 4YWKA 4B3TQ 1PHJA 3CCUA 4A75A 3HOZH 3HOWH 4YCUA 2JA5H 1CKNB 2N8NA 1EOVA 4IPDA 4MTNA 5M5XH 4BA1I 2I5LX 3GTLH 1NY4A 3HKZG 2XTIA 4A3FH 5C3EG 4A3LG 1SMXA 1A8VA 4LUVA 1JB7A 2JA6G 1AE3A 4HJ9A 1WYDA 3W5OA 1EWIA 1KL9A 2B3GA 4HJ7A 2A8VA 2ZTDA 4DR4Q 3PCOB 4GN3B 2QEXA 4B3SQ 4IFDI 1K73C 5GQOA 3I4NH 1HNXL 4B3MQ 4DK6C 3K0XA 1PVOA 2BH8A 3EIVA 4TQUS 1XPOA 2OQKA 3CC2A 4LF4Q 1A62A 1NE3A 1SE8A 2KENA 4NXML 1Q8KA 2IT1A 2WB1G 1DGSA 3CMEA 4GOPA 1PH8A 1NMGA 4UP9A 2E5LL 1N33L 1U5KA 3PO2H 2ZTCA 4JI0L 2R93H 1D7QA 5BR8Q 2D62A 3J81i 2OTJA 4TVAB 1O7IA 4P72A 1C0AA 3RN2A 1SR3A 5IT9c 2HIVA 4GNXB 1IBKQ 2C35B 4OWTB 3TS2A 4JCVE 4UP7A 2E2IH 2AHOB 4B3SL 1YVCA 4L5TA 3PO3H 3J80c 1B7YB 3I4MH 4B3ML 3I7FA 1MIUA 1X3GA 2JE6I 1VQMA 1X55A 3HKZE 3F1ZA 4LFCQ 3CPWA 1L1OC 4O0AA 1XNRL 2WAQE 1OXVA 1KRTA 2OQ0A 4POFA 3CMAA 4DAMA 4NXMQ 4A3JG 1Z9FA 4A4IA 1UE5A 3W1GA 2KHIA 4APVA 1Q1BA 2E5LQ 4LF5Q 1N33Q 2UU9L 3J7A5 2R7ZG 2A1AA 3KF8B 4XIGS 3CXCA 2MNAA 4LNQA 4JI2Q 5IP9G 3TS0A 4DV1L 2JEBI 1HNWQ 3A5UA 4JOIC 2R7ZH 4X65Q 1BBUA 3TQYA 1N9WA 4BXXH 1IYJB 1X56A 2V1CC 3K7AH 4IPHA 4R1JA 5ELOA 5IP9H 3I4OA 4A76A 4JI8Q 1L0WA 1B8AA 4DR2Q 1XJVA 4GOPC 2CFMA 4X64L 4L5QA 1QVFA 3UDFA 1E1TA 4X6AH 1V43A 1PH6A 3S1RH 3RLFA 2ZTEA 2FXQA 1IBMQ 2Q2TA 1UE7A 1S3OA 3M3YH 1CSQA 3FHWA 4AQYL 3M4OH 2UXDQ 3G48A 4A3BG 3MXNB 4JI5L 1YITA 4LF7Q 2NN6I 4AIMA 5C3EH 4A3LH 5JEAJ 1UE1A 5HGQA 5ELNA 3I4MG 4A93H 2UXCQ 1HZAA 3RR5A 4X66L 4YY3Q 1E7ZA 3NELA 3I56A 3G6EA 3CCVA 1K9MC 4DV1Q 4A3BH 5C0XG 2YTVA 2WP8J 1VQAA 2K4KA 4X65L 1BBWA 4DV7L 1YHQA 3LGJA 4A3DG 1NMFA 2GVAA 3E9IA 3F2BA 4A3JH 1QVGA 1YEZA 4JC0A 2Y0SE 4JI8L 5M3FH 4DUYL 4HJAA 1SRUA 2QA4A 3RZDH 1J5EQ 3PSIA 4LF8Q 3RZOH 5LMNL 1C9OA 2IHEA 1EQQA 2F4VQ 3S1MH 2ZJPA 4DR3Q 3PV0A 4C2MH 4ALPA 2JA7G 3M7NA 5M5YH 3GTKH 1SLJA 4P73A 1PH1A 2UXDL 4A3CH 3M4PA 5IYBG 2RHSB 3ULPA 1JE5A 4LF9L 2AWNA 4HJ8A 4BY1G 1HR0Q 1ASZA 3GTOH 4H02A 1PH3A 5IYDH 4JI1L 4JOIA 2PQAB 4IPGA 2NVXH 2UUAQ 1N36Q 2JK8A 4LW1A 2HHHQ 4DV7Q 3PO3G 3AFQA 5IYDG 4A3IG 4DV5L 2Q2HA 1VQ9A 2VUMG 3PUWA 2JA5G 4LF8L 1UEBA 2JQOA 3H3VI 2YTYA 2VQFL 2BA1A 4GLAC 1IL2A 3PUXA 1XMQQ 1M90C 1XPUA 1YJ9A 4NXNQ 3H0GG 4BBRH 4GLXA 1PH9A 5FLMH 5AJ3L 2K50A 5IY0A 4DV4Q 1P8LA 1SROA 3SGIA 3J80i 4DNIA 3FP9A 1U0LA 1HR0L 2MFIA 4DKAC 2E2JH 1CKOA 3GTMH 1K3RA 1I94Q 1VQBA 2NZHA 2B63H 1RL2A 1GO3E 4GNXC 3OTOL 2PNHA 2JA8H 1YJNA 1N8RC 3HKSA 3HOXH 4DV2Q 3A74A 5HY6A 1KQSA 1W3SA 1ASYA 1FJGL 5M3MG 2OTLA 2CQOA 4KHPL 4DR6Q 2PQAA 3K81C 3W1BA 3RLOA 1XMQL 3GTJH 4X62L 4A3EG 4NXNL 1VCIA 3T1YL 4IFDJ 3FKIG 3S24A 2ES2A 2OWOA 1PH5A 2L15A 5GADC 3UDXA 4A3IH 1Y1VH 5IE8A 1VS0A 3KF6B 3KYHC 4BA2I 5JJIA 3CC4A 5IWAQ 2CWPA 3E9HA 2UXBQ 3UDGA 2EXDA 3M4QA 3OTOQ 1LYLA 3ULJA 1E22A 4DV2L 1S40A 1OXXK 4DV0Q 4YWMA 5FLMG 3J81j 1WFQA 3GTGH 3HOVH 1YI2A 3CCRA 4JI6L 3KFUA 2XGTA 4DV6Q 4LFAL 1PA6A 2AKWB 4HIKA 3TRZA 5C4XH 2UUBL 3OW2A 4LUZA 4A3CG 4Y7NH 3ZJYC 1PFSA 1WOCA 4JI4Q 4K0KQ 5C4XG 5JEAG 2Z0SA 3I2ZA 1Y1WG 2IY5B 2KBNA 4R4OA 1SN8A 1EQRA 5C0XJ 4GKKL 1JJGA 3F2CA 2UUCL 3AEVA 1H95A 2N49A 1IXRA 2VUMH 3KJPA 1X3FA 4IOCA 3AFPA 4P71A 4NPSA 1EIYB 4LFBL 1EUJA 1VQ6A 4BXXG 5GAGC 1K83H 1VQEA 4GKJL 1E3PA 4DAYB 3CC7A 4JYAL 5FLXc 4WJ4A 3PUZA 2K52A 3S1NH 4LF4L 4PMWA 2DUDA 2ID0A 1HZ9A 1BKBA 2HIXA 4JI4L 1KHIA 4KHZA 4K0KL 5JJLA 3KDFA 4A3DH 2LXJA 2CKZB 4OWWB 5GROA 4JI0Q 1CUKA 3GTPH 2K14A 1LTLA 2MO0A 3PIOA 1X6OA 4OXPA 2Q2IA 3GDEA 4BBRG 2UUCQ 1JT8A 2VW9A 1X65A 4LWCA 1P16A 1V1QA 2MQHA 2NVYH 4OO1G 3T1HQ 4UP8A 4IPCA 4C3HH 4DK3C 4GS3A 3DLLA 4LFBQ 4IOAA 3GD7A 2JA9A 1L2FA 1TWFH 4QJFA 4OWXB 2CCZA 4B3RL 4QIWE 4A3EH 4YHHQ 3S16H 5M3FG 1NTGA 1XTDA 2BA0A 3PUVA 1TWGH 1L1OA 4LFCL 1G291 1Y14B 3TREA 3CF5A 1XNRQ 4BBSG 1VQCA 5M3MH 1Y1VG 1PV4A 1G51A 1RIPA 4JBJA 5IYCH 4OX9L 1V9PA 2R92G 1I3QH 3HOUH 2YTXA 3HFZB 3AYHB 1Z47A 3L0OA 5IP7H 4PZ8A 3S2HH 2YV5A 1KXLA 1JJCB 2K5HA 4R4QA 2CWAA 4JBMA 4IFDG 1QUQA 2R92H 1N32Q 1IBLL 1OXSC 2N3SA 2F52A 3J7ZC 3Q8DA 1YJWA 1HR0W 1UE6A 3ULLA 4JV5Q 2YYZA 1GD7A 3NENA 3HOZG 2R93G 4JBKA 2DGYA 4QL5A 3G71A 1PYSB 4HIMA 3T1HL 4DR4L 2KCTA 2ZM6L 1PYBA 4HIOA 1G6PA 2Z6KA 4DR2L 3KOJA 1VQGA 3STBC 1Q46A 1KD1C 3S2DH 5EAYA 2WAQG 1AE2A 1T9HA 1VQOA 2K5VA 4KI0A 4A3FG 3L7ZC 1R9TH 3PIPA 1HZBA 1A63A 3JC66 4GLVB 2IX1A 3CD6A 4AQYQ 4BY7G 4OX9Q 3PGZA 3BZCA 1M1KC 3RNUA 4LF7L 3K80C 1TWAH 4DR1Q 3CW2C 2JEAI 3H0GH 1Q86C 5BR8L 5JJKA 1KIXA 1EFWA 4JV5L 2HQLA 3JAMc 3GTQH 1N32L 5K36G 1IBLQ 4Y52H 1XMOQ 1XNQL 4EX5A 2KHJA 1Q12A 3KJOA 1VQ4A 2N78A 3PUYA 3F8TA 5C44G 1IBKL 2B63G 2NVTH 4BBSH 1AH9A 1VQNA 1D8LA 4AYBE 2ZM6Q 1CKNA 2F3IA 3K7UC 1MKHA 3HOXG 2F4VL 4BY1H 1X9NA 1J5EL 3HOYG 1A0IA 3PO2G 5C0XI 1SFOH 3CCMA 4DR3L 1YHBA 4IJHA 1QZHA 2Y0SG 3IRBA 2MO1A 4O2DA 3BJUA 1VQHA 3EBEA 4DPGA 2NVQH 4A3KH 1QUQB 3S17H 5DLQE 1S72A 4MNOA 3HOYH 3UE1A 3G4SA 1YHAA 1BVSA 2NN6G 1IZ6A 3CQZH 4JBWA 2ASBA 4LF6L 4DR1L 4LF5L 4A3MH 4LF9Q 2UU9Q 1CSPA 2WFWA 3RLNA 1K8GA 4GN5A 2GVBA 4R4IA 4JI2L 4DV3Q 1GVPA 2WB1E 1KC8C 3AQQA 4EQ5A 1HNWL 2UUAL 3S14H 1XMOL 1N36L 1XNQQ 2EQSA 1VQIA 2VY3A 2HHHL 3I4NG 2K5NA 2PI2A 2AMCB 3BU2A 2JJQA 2Z6KC 5H1SE 4QGUA 3CAMA 1TWCH 3E0EA 4X64Q 3CPFA 2JA6H 2VQFQ 5IYCG 2VQEQ 4J15A 1QZGA 2EIFA 1Y1WH 1IBML 1YZ6A 1TWHH 1VQ7A 5IP7G 5LMUQ 2IX0A 4C3IH 1HNZQ 4PZ7A 4L5RC 1HH2P 4JI5Q 4LF6Q 1N34Q 4DV4L 3MEFA 3CP0A 3U58A 1VQ5A 1MJCA 3D0FA 4KLKA 2UXCL 4P74A 1VQFA 4YY3L 4X66Q 4DV3L 1VQ8A 2Q2UA 3UDIA 5IYBH 4YCWA 1X54A 3JAMi 1UWVA 3ER0A 2GN5A 4IJLA 4AH6A 4GOPB 4LUOA 2I0QA 3HOUG 2R6GA 2E8GA 1FL0A 1JJ2A 4ME3A 4POGA 1I50H
chains in the Genus database with same CATH superfamily
2HQEA 2EVBA 1TWAB 4DR5L 1X3EA 5FKAC 1C7YA 3QIAA 3T13A 2LSSA 4DAVA 3OIPA 2YU9H 5JOBA 1FGUA 3WOFA 4QUCA 4DR7Q 4QB4A 3D31A 4IO9A 3GTKB 5CR3A 4JI1Q 4A3BB 3GV3A 3SE0A 3GTMB 1L0YB 3ONAB 1LT3D 3CRKC 3NHHA 2MPMA 2RKSA 3H15A 3AB9A 5M5WB 1TS4A 2MUYA 2VS1A 2PO4A 3L9AX 1VQKA 1HQRD 2HT1A 5J3BA 4OO1I 2B29A 1EY5A 4JG2A 3HOYB 1WTRA 4A3KG 2Z6BA 1VQDA 4GKKQ 3D6WA 1HHVA 1HUMA 4OONA 2F0MA 4QY7A 1FJGQ 1G91A 1VF7A 3X3MA 4DR6L 4L5SA 4PNYA 3A54A 5GAEC 1Q8IA 1H9RA 1OTCA 4B3TL 3T1YQ 1S5BD 2SNMA 4CDFC 2H1EA 1IKMA 2TSSA 2NWGA 2VXWA 1GUWA 1V8QA 1WCMH 2PCFB 4GN4B 2JA7H 1CKMA 1W2BA 2RVLA 1WTOA 1F9QA 4R8NA 4M8AA 4C3JH 3SK4A 1EWHA 1JMCA 2F0KA 1I6HH 1K8AC 4WJ3M 1KRSA 3ERSX 4A93G 5KRUA 1IW7C 3HOUB 1SJED 1H9SA 1EOVA 1V1PA 5M5XH 4BA1I 2SEBD 4RKLA 4XXEA 1TT2A 4DXGA 3W5OA 3GQBA 4GN3B 2SNSA 4B3SQ 1K73C 2K01A 1HNXL 4ZLTF 1EY4A 4KK7A 4NP5A 5EKKA 1PVOA 3BYYB 1XPOA 1C48A 2JA5B 2AQ1B 4ZQ3A 3I4LA 3MC0B 2RDGA 1NE3A 2IL8A 3NPPA 2KENA 2IT1A 2Q8TA 3CMEA 3MAQA 2WACA 3QG1A 2DNEA 1O7ZA 3QR8A 4EGVA 2HUGA 1DOLA 2R93H 1D7QA 1K28A 5BR8Q 2E2HB 1MSHA 1O7IA 4F7XA 1F2LA 1C0AA 4FF3A 5JJZA 4DN4M 1F9PA 3IFDA 2B2VA 2C35B 1I3QB 3S1MB 4ODGA 4B3SL 4B3ML 1U9RA 5KYIA 1MIUA 1X55A 3HKZE 3CPWA 1L1OC 1STYA 1D2BA 2WAQE 4POFA 5DNFA 3S9WA 2KHIA 1Q1BA 3W3AA 1U4PA 2A1AA 3J7A5 1QE6A 1CZWA 2JEBI 1EYDA 4OGQC 1TS3A 2R7ZH 1BBUA 4BXXH 1N9WA 2XIWA 4R1JA 2QEJC 3QO2A 4IPHA 5ELOA 3S1QB 5IP9H 4A76A 2CFMA 1LO5D 2D9UA 3RMHA 1PH6A 3D6CA 2ZTEA 2FXQA 1IBMQ 3M4OH 2OXPA 3MXNB 4LF7Q 2DJFC 3FKIB 2F0PA 4A93H 3I56A 4YY3Q 1BOSA 2WV6D 3NELA 4A3BH 4OO1H 1C4QA 4DV7L 1HTPA 3LGJA 3TP6A 1NMFA 4P2CB 2B63B 4KY7A 4EVOA 2F4VQ 1UEAB 3H91A 3PSIA 5C3EB 1Y69U 2Z4HA 3I91A 1PXUA 4YIJA 5M5YH 1SLJA 4P73A 5EBDA 2UXDL 1IL8A 4K2KA 3NBHA 5CGKA 1QB5D 1BQQT 1I4XA 4KHVA 2EYOA 4H02A 4CDCC 5CV4A 4A3KB 4JI1L 4JOIA 2EPBA 1FD7D 1QCBD 4IPGA 3GP7A 5M3MB 2NVXH 1K8OA 1PRTF 5IYDG 3EJIA 2JSOA 4KN4C 2JA5G 4LF8L 3BDCA 2JQOA 2HCCA 4K2LA 2YTYA 2A6ED 1IL2A 3PUXA 1M90C 1LT5D 2F0DA 3K6OA 2AQ3B 1SROA 3FP9A 4I7AA 2MFIA 1G8ZD 4DA2A 3GTMH 1RL2A 3PIP3 3OW7A 3OTOL 4G7HC 1TWCB 4DV2Q 4G7OC 3RZDB 5HY6A 2F0LA 4ME5A 4A3JB 1FJGL 3J80L 4DR6Q 1I6HB 4RGMA 4K6LA 4CDEC 3KLSA 2PQAA 2RA4A 1PFBA 2KA7A 1VCIA 1HPCA 1QILA 3S24A 2OWOA 5GADC 5HURA 1LTAD 4DU9A 5EPLA 1VS0A 3KF6B 1SMYC 1ZKOA 1X32A 4CKEA 3M4QA 1HCZA 3OTOQ 1W6JA 1S40A 1TWFB 4MHEA 3MZ5A 4YWMA 2X6GA 1LTID 3MXPA 3T53B 3NTHA 1PFNA 2K7VA 3O13A 2AUKA 4LUZA 1EEID 1SYEA 1X3QA 4R8IA 1LLRD 3JAML 1ET6A 2SDFA 4X3KA 4K0KQ 1ENAA 1AW7A 4XYQA 2LMCB 1H95A 2N49A 1K8MA 1X3FA 5ELBA 3PMFA 4NPSA 4LFBL 4RFBA 3DM1A 4ZYSA 1VQ6A 5GAGC 5FLXc 4WJ4A 2K52A 4Y7NB 5E1FA 5C4ZA 2WIIB 1BKBA 2F0TA 4KHZA 4K0KL 3T16A 4MTKA 4OWWB 1CUKA 1EY7A 2MO0A 4MN3A 4OXPA 2JXMB 2QF7A 1DZ1A 1SDFA 4CHTB 1P16A 2MQHA 1GOZA 3T1HQ 4DK3C 3K5MA 3DLLA 4LFBQ 2JA9A 2B2UC 2CCZA 4A3EH 3S16H 5M3FG 1NTGA 2BA0A 1AEXA 3PUVA 5IT9L 1L1OA 3CF5A 4BBSG 4WORA 1VQCA 1GUTA 1Y1VG 4OX9L 3HOUH 1MI2A 3HOWB 1NUCA 2K5HA 2CWAA 4CDDC 1CHPD 1DONA 2RSNA 3Q8DA 1UE6A 3ULLA 4ZKBB 4QL5A 5C44B 4L8JA 3T1HL 3NK9A 5IOCA 1G6PA 3ND8A 3KOJA 4B08A 1KD1C 1Q46A 2WAQG 1T9HA 4J6HA 4A3FG 4CKBA 3PIPA 3U9SA 1AZQA 1B1ZA 1MHWC 2IX1A 3CD6A 2L4NA 3K0YA 4BY7G 4OX9Q 1M1KC 3Q0AA 3K80C 4DAYA 4L63B 3OOCA 4JV5L 3JAMc 2E75C 2F0IA 1J9OA 1XMOQ 2KHJA 1VQ4A 1II3A 3EVQA 3K7UC 3HOYG 5COYA 5C0XI 3KF8A 1YHBA 2B2WA 2P5ZX 1VQHA 4J8QA 3DEOA 2WINB 2KEEA 5DLQE 1CM9A 3NWTA 1YHAA 3BS1A 4JBWA 4LF6L 4LF5L 4LF9Q 1FNVA 5I6YA 3RLNA 1K8GA 4GN5A 3QB3A 4DV3Q 2WB1E 1B9MA 1WTWA 1E2VA 2ZXOA 2K5NA 2PI2A 1EYCA 5BN5A 2B2UA 2Z6KC 2E2JB 2A68C 4RWSC 3E3XA 1LTRD 1PRTD 4Q5VA 4RKBA 2EIFA 3VA5A 1TWHH 1VQ7A 3SK5A 2IX0A 4L5RC 2KUMA 1N34Q 3U58A 2I46A 2PMZB 1HFNA 5ISRA 5DAUA 4X66Q 2XWBB 5IYBH 2NVTB 1X54A 1GHJA 4KV6A 4C56C 2I0QA 3HOUG 3URYA 4AYBB 4ME3A 5LHY1 4DUYQ 5EGTA 5LMNQ 1PH7A 2ZJRA 2VZAA 3S1QH 1WJJA 1I5FA 2VQEL 2DY8A 4B9XA 1VQLA 3PF5A 2O5IC 5I9OA 1WI5A 2ZJQA 1Y8OB 3RZOB 5M5WH 3H3VH 2K5QA 2I5HA 1N34L 4E6IA 3BZKA 4CBVA 5M5YB 1L1OB 4EQOA 4BY7H 4TSSA 2F03A 4JVZA 5E7NA 3HEJA 1E24A 1XXGA 1EWCA 1H9SB 3FKIH 1B2TA 3J81c 3K58A 4DR5Q 3KLWA 3S14B 2PI2E 4HIDA 4FO2A 5J22A 3M3YB 4PG3A 2VB3X 3D4WA 5AJ3Q 4DUZQ 4F87A 4DR7L 4UPAA 4UAIA 3VA7A 1BO0A 3D3RA 2D0OA 2XVSA 3BG3A 3U4VA 1TR5A 4XQNA 4UY8C 5CV8A 2DJGC 2ALYB 3ERQA 2BE5C 4IUTA 1NJIC 1FVIA 1Q1EA 3MHBA 2AQ2B 4NB3A 1DCZA 4CJ1B 2QGQA 2TMPA 4N8X1 4X62Q 5KGUA 3HOVG 4QQBX 2JA8G 5FJ8G 3ND9A 4DUZL 4A3GG 3S15H 2LXKA 2RHQB 4XTCS 5E4WC 1G6ZA 1GKHA 3NXWA 4HJ5A 1WTVA 1WCMG 2PW5A 3PO3B 4QIWB 2HCIA 5LMNW 2E2IB 3PF4A 1JC7A 3NBHB 5C4HA 3CCQA 3JAME 3DM3A 4YHHL 3A8JE 2UUBQ 1VDZA 3I55A 4B3TQ 1PHJA 3HOWH 4BY7B 1CKNB 3FPUB 5C0XH 2G9DA 4ZAIA 1M4VA 1ML0D 1NY4A 4A3FH 1JB7A 2JA6G 2E76C 1I4PA 2LFNA 2A8VA 4XQJA 2BE5D 3NTIA 4DR4Q 4A3FB 3PCOB 2QEXA 5GQOA 1EU3A 2BH8A 1I6VC 4TQUS 3CC2A 5IT9E 1A62A 3HS0C 5KEEA 1SE8A 4ABNA 4NXML 1Q8KA 1NMGA 4UP9A 1N33L 4JI0L 2D62A 4UDUC 3AU7A 2OTJA 4TVAB 3CU7A 3D4DA 2MP1A 5EKIA 3Q23A 1WTHA 2KQ3A 4O1NA 2A6HD 4JCVE 1YVCA 1S5ED 4KY5A 2C9OA 1XX8A 1VQMA 2SOBA 1B44D 4ZUIA 4LFCQ 2M2LA 4O0AA 1FGBD 2OF1A 1KRTA 4DAMA 4NXMQ 4A3JG 3R3OA 5ELEA 1LTTD 4A4IA 1ZYRD 4APVA 1EIHA 4WFN3 4IUUA 1DYQA 3TS0A 4DV1L 3M4OB 5EPJA 4JOIC 2RDFA 4X65Q 2A68D 3TQYA 1AZPA 1SYCA 1X56A 1S5FD 5EPKA 3C1FA 1L0WA 1MD2D 5DM73 4G57A 4X64L 4GOPC 4FNFA 4X6AH 1SYBA 1S4ZA 3S1RH 3RLFA 2Q2TA 2LKVA 3TMEA 1UE7A 1AN8A 4U68A 1CSQA 4AQYL 1EFID 5T1IA 1H9MA 2EYLA 4JI5L 5C3EH 4A3LH 5HGQA 3I4MG 2BOSA 1HZAA 3RR5A 1A3UA 1STGA 5C0XG 2YTVA 3WDNA 2K4KA 3VR6A 5IGDA 4A3DG 1L0XB 2GVAA 4ILWA 4JC0A 5M3FH 4HJAA 4LNQA 3C46A 4DUYL 4K14A 2QA4A 1J5EQ 3RZOH 5LMNL 1C9OA 2QKIC 5CBAE 3S1MH 3CQZB 2CH4A 3PV0A 4U673 2JA7G 1KABA 4MIUA 1IHZA 3M4PA 2EDGA 2RHSB 1I50B 1JE5A 2K1BA 4BBRB 4HJ8A 1FNUA 3NBIA 1STEA 4BY1G 1CA5A 1HR0Q 4K5XA 3SK6A 2G5DA 3GTOH 5LL6S 1ONLA 2F0VA 2UUAQ 1HRJA 1M8AA 1A2UA 1U4RA 3BVGA 1N36Q 1HQMC 2WB1B 2HHHQ 4DV7Q 3PO3G 3AFQA 5JPMC 4A3IG 5IGGA 1VQ9A 2NB0A 2Z8LA 1TY0A 4EQNA 2VQFL 5KIXA 2DN8A 1TIID 1PH9A 2RBMA 1P8LA 4DNIA 4DFAA 5M3FB 1HR0L 2JP1A 1JOKA 1TKWB 1GO3E 2JA8H 1RKNA 2F4IA 1YJNA 1GUNA 2MGSA 2CQOA 1F2MA 3A8KE 4LAAA 2JN4A 3RLOA 3W1BA 1O7YA 3GTJH 4X62L 4A3EG 2A5HA 4NMZA 3FVQA 3T1YL 2PYKA 1PH5A 1IKLA 1Y1VH 5JJIA 2OEOA 5TSSA 5IGEA 2UXBQ 4XQQA 2ICEC 2EXDA 2E74C 2IX3A 3UDGA 2D2CC 5ELCA 1LYLA 4DV2L 1CQVA 4DV0Q 4FF4A 3P20A 5FLMG 1YI2A 3CCRA 3KFUA 2XGTA 4LFAL 1KDAA 3MFGA 4R9WA 2PW7A 1B4OA 4C2MB 3OW2A 4A3CG 2A6HC 3RUZA 1CTMA 1PTOH 4JI4Q 1PYWD 2Z0SA 3I2ZA 3V2TA 1Y1WG 1D5ZC 2HD3A 2A73B 5C0XJ 1EQRA 2A69D 1JJGA 2UUCL 1H9JA 3J7YW 2VUMH 3TN2A 4TRDA 3N6RA 3VYRA 1EIYB 4OIKA 1SNDA 3S1NH 3TP5A 1LACA 4PMWA 4RGNA 1Q90A 1DXMA 5DEHA 3KDFA 5KYLA 3GTPH 5CBEE 3PIOA 4KJOA 3V96A 2Q2IA 3DWAA 1HTLD 1PFMA 4ZRZA 1QNUA 2KJXA 2UUCQ 1Z7TA 2L12A 1BCPB 3GTPB 3QJYA 5CV7A 1EZ8A 2KHSA 4IUQA 3R2TA 4IOAA 4C3IG 1L2FA 1TWFH 4B3RL 4QIWE 3VYTA 1CQFA 2CW0D 1G291 1Y14B 3IFTA 3TREA 4LMQD 1PV4A 1RIPA 4JBJA 4PV1C 1V9PA 3GTOB 3L0OA 4PZ8A 1KXLA 4FP5D 3EROA 2H4OA 2NUCA 3S1NB 2C5CA 5E3FA 1IBLL 1OXSC 2N3SA 2F52A 2ICIA 1BF4A 1EY6A 3HOZG 4JBKA 1K83B 2PPBC 2EYFA 1EL0A 3F2UA 5FO7B 1A6XA 2KCTA 2ZM6L 1BUVT 3A56A 1GUGA 5CMDA 2Z6KA 3S2DH 1DD2A 1QG7A 4RA8A 1AE2A 4FF2A 2K5VA 2YU9B 1D1IA 4AQYQ 1ILQA 3RNUA 4LF7L 3CW2C 1STAA 3H0GH 5J39A 1Q86C 5FOBB 4XT3B 1UAPA 1KIXA 1EZ6A 5K36G 1IBLQ 1GXDC 3NQTA 1XNQL 5ELFA 1Q12A 1AH9A 1PRTB 3V05A 3F8TA 5C44G 1IBKL 2B63G 1H9KA 4A3IB 4AYBE 4B9WA 1TS2A 1HFGA 2F4VL 3HOXG 4BY1H 2EOTA 1A0IA 3PO2G 4N8FA 3G7LA 4IJHA 1QZHA 3MWYW 2KCCA 1O7LA 3S17H 4DPGA 3U9OA 1S72A 4MNOA 3HOYH 3G4SA 1Y1VB 2UU9Q 2XRQD 3MEHA 1HA5A 4ID6A 4H0LC 4R4IA 4JI2L 5I9PA 1GVPA 3AQQA 2UUAL 3S14H 1SEBD 2F0UA 1XMOL 1N36L 1XNQQ 2EQSA 1VQIA 5KNCA 4IUVA 1WD1A 2JJQA 4KD4A 2FJ2A 1TWCH 5CORA 2Z1CA 4CKCA 3C1EA 5LMUQ 1U4LA 4IALA 2PZTA 4C3IH 1HH2P 1SNMA 4LF6Q 1RCVD 1YNNC 2RCFA 1MJCA 4DAPA 2UXCL 4P74A 1VQ8A 2V4DA 4N9PA 4ZCKA 4DV3L 2Q2UA 2WKDA 3S17B 3ER0A 4LUOA 3LNNA 2R6GA 3QOJA 3DHQA 4A3EB 1W6KA 4HSVA 4JI3Q 4V0BA 2Y0SB 2R7DA 3OYYA 1A15A 2R7FA 3K8AA 4RMFA 4CGYB 3T4AC 4Q0FA 4PQXA 3N52A 2KVMA 1KLUD 5LMUL 2FHTA 3H3VC 2A69C 1PH4A 4KKSA 3TEHB 4UHVA 1XPRA 1OXUA 2RF4A 3NE5B 1T5EA 2I5MX 2K75A 3B6YA 1PZID 4AYBG 3FMCA 4A3MB 1SYFA 4DV5Q 2NZOA 1PH2A 4LFAQ 4JI3L 5CC4A 2A19A 5M9OA 4NDXA 4JI7Q 2E2HH 3NSWA 5C4JH 4A3MG 2EY2A 1MBYA 3A0JA 3A5ZB 3UE0A 1KAWA 3M9BA 4JW0A 2Q8IB 2PMZE 4R4CA 2OCEA 4G4KA 1LM0A 1YBYA 2EY1A 1CZGA 1I94L 1MGSA 2EJMA 1VQJA 3CCJA 2D0PA 4YWLA 1WTXA 1TWGB 1JICA 5AFWA 4KHPQ 1DM0B 4CJ2C 4QCLA 1OXTA 2FMMA 1R4QB 4L6TB 1VQPA 5E4XA 1KLGD 3RN5A 3GO5A 4HCSA 1XWEA 3H0GB 1HUNA 4A3DB 2EZVA 1RDPD 3CCLA 4P75A 1J6QA 4H7BA 4YCVA 4A3GH 3WOEA 2K03A 3MFYA 2VUMB 3CCSA 4KD3A 3ZYYX 4PZ6A 1NSNS 1Q82C 1F9SA 2R3ZA 4WJWA 3KUPA 4HN7A 1CT1D 1NCVA 2HDLA 2I07B 4JI6Q 3PO2B 4FDBA 1Q81C 4DV6L 4B3RQ 2AWOA 2B8GA 2LY7A 5EJWA 5BN4A 2IW3A 2L1BA 3HOZH 1YNJC 4KMUC 2JA8B 3D8GA 4YCUA 4HTHA 3S15B 4MTNA 4OEMB 2I5LX 1KDBA 1I4QA 4O42A 2XTIA 3DXJC 5C3EG 4A3LG 1IYVA 1JQYD 1SMXA 1A8VA 4LUVA 1YNND 1XYIA 1AE3A 4HEDA 2EJFC 1WYDA 4HMJA 1EWIA 1KL9A 2B3GA 1BR9A 1PTOF 3PIO3 2ZTDA 1GUSA 1FNWA 4RHSA 3I4NH 1NR4A 3GTLB 3K0XA 3EIVA 4C3HG 1LTBD 4C3JG 2EYMA 1DGSA 1Y8NB 4GOPA 1PH8A 2E5LL 1U5KA 1PTOD 2ENBA 3PO2H 3J81i 4P72A 5C3XA 1JR0D 3KBGA 3RN2A 1SR3A 1A3VA 2K28A 1IBKQ 4K8IA 3TS2A 3TBIB 2E2IH 3DMUA 3PO3H 3J80c 1B7YB 1C8CA 5I2YA 2JE6I 1VF5C 3F1ZA 2F0SA 1XNRL 3LX0A 3L3OC 1Z9FA 4ZKCB 1BXTA 1UE5A 3W1GA 2E5LQ 4LF5Q 1N33Q 2UU9L 3KF8B 4XIGS 2MNAA 4JI2Q 1QWYA 4RCNA 3K7AH 2V1CC 3HG9A 2F0EA 3J80E 3I4OA 3I72A 1SXTA 4JI8Q 3NUCA 4NKLA 4DF7A 4DR2Q 4L5QA 1V43A 3AMUA 1EQTA 4RAUC 1S3OA 2XNAC 1UNSA 3M3YH 3FHWA 2K5WA 2R61A 3LWEA 4AIMA 3NP8A 5JEAJ 1UE1A 3M7GA 2EYPA 1TWHB 2UXCQ 4X66L 1K9MC 1E7ZA 2K05A 4DV1Q 4H44C 2WP8J 4X65L 1BBWA 3E9IA 1STBA 1QVGA 5NUCA 2NYZD 4JI8L 3W2DA 2Y0SE 3RZDH 2F0QA 3HKZB 2ZJPA 4DR3Q 4IQZA 4FXDA 4ALPA 1EYAA 3M7NA 1ZYRC 3DWQA 3GTGB 4A3CH 5IYBG 3J7AV 3CRLC 3ULPA 2XRSD 2AWNA 2R93B 2RQXA 2PZWA 1DOMA 1SYGA 4QMGA 2NBFA 1F77A 4RGTA 4DV5L 1KTKA 2Q2HA 3X3NA 2VUMG 1D1KA 5A2QL 4ZUJA 5C4JB 1VMCA 3H3VI 2BA1A 4GLAC 1XMQQ 1PRTC 4NXNQ 3TP8A 1BDOA 3H0GG 4BBRH 1R9TB 5AJ3L 5ELDA 2K50A 1X3PA 4DV4Q 3NTKA 1U0LA 2E2JH 4DKAC 4OELB 1K3RA 1I94Q 1VQBA 2NZHA 2B63H 1CI3M 3BVMA 2PNHA 1N8RC 3HKSA 3HOXH 3DWPA 1KQSA 1B53A 5M3MG 2OTLA 2L11A 1GHKA 3K81C 1B9NA 1JB3A 4HSPA 1XMQL 4IFDJ 2KCNA 3TP7A 3SDZA 2L15A 3UDXA 1TVXA 3I90A 5IE8A 4BA2I 1E2WA 1ICWA 2F0OA 3CC4A 5IGFA 3A7LA 1LV9A 3G6JB 1KNAA 4FF1A 1E22A 1SNOA 2B2WC 3BDOA 4QUFA 5A2QE 5C4XB 2PZUA 1EY9A 3J81j 4V190 3GTGH 3HOVH 2EYHA 1RTOA 2A6EC 2F0NA 1PA6A 2AKWB 4HIKA 1WTQA 3VYSA 5C4XH 1KNEA 2UUBL 1PTOC 3VYUA 1WOCA 3HGBA 1J8IA 3QOLA 5KNDA 2KBNA 4R4OA 1SN8A 2R92B 5EKLA 1ZXTA 3EA6A 3P7JA 4F88A 1AP0A 4DGZA 2K5DA 2XSCA 1EUJA 2CQAA 1WD0A 1LT4D 1E2ZA 4GKJL 4DAYB 3CC7A 4JYAL 3C2PA 4ZK9B 1SE2A 1PTOB 1IYUA 1PZJD 1HZ9A 4RHRA 1SNQA 2D5DA 1LT6D 2HIXA 4JI4L 1KHIA 5JJLA 4A3DH 5GROA 1BCPC 1SYDA 4JI0Q 2K14A 1LTLA 1X6OA 3I3CA 4BBRG 4LWCA 1X65A 1EQVA 1V1QA 5FO9B 2B2YC 4UP8A 4IPCA 4GS3A 2KOLA 3GD7A 3T56B 2F0WA 5L37A 4LFCL 5M3MH 1G51A 2R92G 1I3QH 2MJ8A 5EQ0A 2YTXA 3MA2B 2F0JA 4RCOA 3S2HH 1CFMA 2YV5A 3OIQA 4R4QA 4DK1A 5HGTA 1I4RA 1QUQA 2FINB 1N32Q 1HR0W 1YJWA 2R93G 2YYZA 3NENA 3S2HB 5D65A 1STNA 1TS5A 2JA6B 2E2DC 1D6EC 4HIOA 4DR2L 3STBC 4DXFA 5CV5A 2F3WA 3VR2A 3L7ZC 1R9TH 4A3GB 1HZBA 1A63A 2ZT9C 3JC66 4GLVB 1G2SA 3BZCA 1BBXC 1DOKA 2O5JC 1EIGA 2JEAI 4M1UB 5BR8L 1EFWA 3GTQH 1A2TA 4Y52H 5JPNC 4EX5A 3KJOA 1S5CD 4BBSH 2N78A 3PUYA 2NVTH 2ZM6Q 1MKHA 1X9NA 1J5EL 3CCMA 3IRBA 4O2DA 3BJUA 1JCKB 3EBEA 2NVQH 1QUQB 1I4HA 2X6LA 3CKIB 2Z9HA 3UE1A 2NTSA 3GTJB 3FRPB 3I8ZA 1IZ6A 2CHBD 3CQZH 2ASBA 4A3MH 1CSPA 2WFWA 2GVBA 4FXKC 4KKUA 1CA6A 1KC8C 4EQ5A 1HNWL 5F2DA 2VY3A 2HHHL 3I4NG 3FPPA 5CYUA 5I6WA 2AMCB 4HR7B 5H1SE 3I4MB 3CAMA 2CH4W 3E0EA 3CPFA 2VQFQ 3K59A 3LWUA 5IYCG 4J15A 1Y1WH 1YZ6A 2IJ0A 1RTNA 5IP7G 3RD4A 2K32A 1HNZQ 1F2YA 4DV4L 3BZDB 3CP0A 4DK0A 4YY3L 4RH6A 2NVQB 4YCWA 1JOQA 2GN5A 1LTGD 4IJLA 4GOPB 3SXHA 2E8GA 1FL0A 2K33A 1JJ2A 3OWFA 1I50H 4POGA 4FXGC 1YIJA 3WWVA 5GAHC 3U4ZA 1GM5A 4C3IB 3CCEA 5C5LA 1EIFA 1Z6HA 1HNZL 2ATWA 1ILPA 1K0RA 1SNPA 2CW0C 1GUOA 3U50C 2F1MA 3L2PA 1R4PB 4I7ZC 1ET9A 2UXBL 4RG1A 4BS9A 1NNXA 3Q6SA 2RCNA 4R4TA 5FJ8H 2B2TC 4DV0L 2M00A 4WRDA 1NBWA 2KCMA 3NEMA 2VNUD 1LTSD 3BVZA 2K04A 1JOOA 2EYJA 2NN6H 4K5WA 4BWGB 3EN2A 2QILA 2VL6A 1E1OA 1B3QA 2H5XA 3M85A 1WCMB 3BDLA 4QF4A 1SE4A 1QJOA 1EYGA 3S16B 3HOWG 4IZ8A 2XWJB 5IGCA 1BNZA 2DY7A 2HDMA 1YNXA 1MJEA 5JVG3 2JYOA 4H13C 1K3BC 3H6MA 3DUZA 4GKJQ 3SHLA 4JYAQ 3KF6A 1HJPA 4JI7L 2OT2A 4EQPA 3SEBA 1HZCA 2IHFA 1QVCA 3R2IA 5C44H 1LUZA 1ICFB 2RDHA 5M5XB 5IWAL 3ICEA 1HXYD 3HRZC 2O4XA 2L0CA 1RODA 4OIJA 3STBD 3MTSA 1PZKD 1XTCD 2NTTA 1PLFA 3KDFB 1DJRD 1TXYA 2L9HA 1RJTA 3VDYA 1HNXQ 2BH2A 3AEVA 3F2DA 1Q7YC 4MZ9A 3S1RB 5D14A 1B70B 4GNXA 4J1MA 4YWKA 3CCUA 4A75A 4KY6A 2JA5H 3I4NB 2N8NA 4IPDA 3GTLH 2KECA 2EJGC 3OMGA 5KNBA 3HKZG 5CV9A 3GTQB 1QNKA 4HJ9A 1EOTA 4HMIA 4HJ7A 1GJXA 4KTAA 2B8FA 2Z4IA 3NWSA 4IFDI 4IN3A 1NR2A 2QCPX 4B3MQ 2B2YA 5C5MA 4DK6C 2QDBA 1RF2D 2OQKA 4LF4Q 1JE4A 3HOZB 2WB1G 1D5XC 1CK1A 2ZTCA 1PDQA 4ULLA 5JAVA 1BCPD 1D5MC 1U4MA 5IT9c 2HIVA 3K57A 4GNXB 4OWTB 2G9HD 3BYTB 2AHOB 4UP7A 2JA7B 1TY2A 2EY5A 4L5TA 3MXNA 3I4MH 4RGOS 4C1NI 3I7FA 4I65A 1X3GA 3KLRA 1T5XD 1OXVA 2OQ0A 3CMAA 1KAAA 2R7ZG 2F0HA 3CXCA 2J7ZA 3OPOA 5IP9G 1SSOA 1HNWQ 5I2XA 3A5UA 3I73A 3TSSA 1IYJB 2F0FA 1B8AA 2IWHA 3TZDA 3NQIA 1XJVA 1JORA 4FYDA 1QVFA 3UDFA 2BCOA 1E1TA 2X69A 3OMCA 1TU2B 5IIFA 1UUPA 2UXDQ 3G48A 4A3BG 1YITA 1MSGA 2NN6I 3R93A 5FLXL 5D3IB 5ELNA 4JV5Q 3G6EA 3MXUA 3CCVA 5C6AA 2IPKD 3DEPA 1VMPA 1VQAA 2FMCA 3OSOA 1YHQA 3R8BA 3F2BA 2AUJD 5BN3A 4A3JH 1YEZA 2NZ1D 4NW2A 5CV6A 1SRUA 3HZXA 3VR4A 4LF8Q 1E0BA 1EQQA 2IHEA 3A55A 3IL8A 1EU4A 3I70A 4C2MH 3FDTA 3GTKH 4OL7A 1PH1A 1RD9D 3C3LA 1F2ZA 4XYOA 4LF9L 1QOHA 3UI2A 3HP3A 1JWMD 1Y8PB 2GA4B 4N9TA 1ASZA 1PH3A 5IYDH 1G2TA 2PQAB 3K5OA 3QWNA 2JK8A 4LW1A 1IW7D 4KKTA 5T1GA 3J81E 1JWSD 3KK7A 1SNCA 3PUWA 3K7AB 1V1PB 1UEBA 3D4RA 1F9RA 1K0SA 3IAYA 1ENFA 1XPUA 1AFPA 1FYCA 4OHJA 1YJ9A 4JK1C 1BCPF 4CJ0B 4GLXA 2BDNA 5FLMH 2MHVA 5IY0A 2KEDA 3P1HA 1I4GA 3SGIA 5C3WA 2EY6A 2VB2X 5J1ZA 3J80i 3S2DB 2DNCA 1Y1WB 1CKOA 2B2TA 2J0TD 4GNXC 1S5DD 3K5LA 2FFKB 2N55A 3A74A 3VR3A 1WVLA 1W3SA 1ASYA 4A93B 4DNRB 4KHPL 4PMBA 3T51B 4LK1C 4IFDH 4NXNL 1SFOB 3FKIG 2ES2A 3E0JA 5JVH3 3Q22A 4A3IH 1RHPA 4BBSB 3KYHC 4BY1B 2M9VA 5IWAQ 2CWPA 3E9HA 5FK9C 3Q24A 3ULJA 1OXXK 4K8JA 3J81L 1WFQA 1SBBB 4JI6L 2R7ZB 5IODA 4DV6Q 1Q3LA 4C1NK 3TRZA 3E6ZX 3IKJA 4Y7NH 4G7ZC 4PMCA 1JWUD 3ZJYC 1PFSA 5C4XG 5JEAG 4X3TA 2LS01 3K5NA 5FLXE 3FEWX 2PQEA 2IY5B 4GKKL 1PMRA 1NAPA 2ZXPA 3F2CA 5EBCA 1IXRA 2WKCA 3KJPA 1STHA 4IOCA 3AFPA 4P71A 4Z9CB 4GZYC 4BXXG 1K83H 3A8IE 2F0GA 1VQEA 1E3PA 1WTPA 3VR5A 3PUZA 3GV6A 2QW7A 3SVMA 4LF4L 3H09A 1EY0A 2DUDA 2ID0A 5D3DA 4IUNA 1SE3A 2LXJA 4XT1B 2CKZB 4KJNA 1EY8A 4C3HB 1FR3A 3GDEA 2J4XA 1JT8A 2VW9A 1LABA 2ZXRA 3MVVA 2NVYH 4IUPA 4OO1G 4C3HH 4X3SA 4XDXA 4QJFA 4OWXB 3HOVB 4YHHQ 2WAQB 2A74C 5K36H 1XTDA 1TWGH 4HAEA 1XNRQ 2RSOA 1B50A 3KLSX 5G3LF 5IYCH 3M4YA 1SAPA 2EE1A 3HFZB 3AYHB 1Z47A 5IP7H 1ESRA 1JJCB 4IFDG 3E5SA 4JBMA 1O78A 2R92H 3CHBD 3J7ZC 3HOXB 4C3JB 1GD7A 2DGYA 4HIMA 3G71A 1PYSB 2F3VA 4DR4L 4K6DA 1PYBA 3H94A 1VQGA 5EAYA 1VQOA 4KI0A 4FVMA 1HA6A 1ENCA 1V1OA 4HCEA 3PGZA 4X3UA 1TWAH 4DR1Q 2NVYB 3J7AF 2K6AA 4DNTB 1SJHD 5JJKA 2HQLA 1N32L 3SK8A 4JPBW 4S3SA 5JEAH 1VQNA 1D8LA 1CKNA 1YNJD 2CVRA 2F3IA 2L55A 1TQOA 2B2VC 1SFOH 3OHXC 4DR3L 1SMYD 4K5VA 2QDLA 2Y0SG 3P75A 2MO1A 4F8MA 2L5TA 2PNRC 2B39A 4A3KH 1A3TA 5I4DA 1BVSA 2NN6G 1ESFA 4DR1L 5G3LD 5LL6X 3TZUA 4TKOB 5FO8B 5A35A 1CHQD 3A7AB 2XN9C 1B3AA 3EQLC 3BU2A 1KDCA 1O80A 2N88A 2BDOA 4QGUA 4X64Q 2JA6H 2VQEQ 1IBML 3MXGA 1QZGA 3TDQA 4IURA 3KBXA 4PZ7A 3EFXD 4KN7C 4JI5Q 1VQ5A 3MEFA 5DM63 3SR1A 3D0FA 4KLKA 1VQFA 5K5PA 3ITPA 3UDIA 3PQIA 5IGBA 3JAMi 1UWVA 1ZEQX 4AH6A 1EEFD 2Q8RE 2NVXB 4LJZC 3OWEB 1OO9B 2O2LD 2EXZA
chains in the Genus database with same CATH topology
4DUYQ 1YIJA 3WWVA 5GAHC 5LMNQ 1PH7A 4DR5L 1X3EA 3U4ZA 2ZJRA 1C7YA 4JI3Q 2VZAA 3S1QH 2R7DA 3OYYA 1WJJA 1I5FA 2R7FA 3K8AA 4RMFA 2VQEL 2LSSA 3CCEA 1GM5A 1EIFA 2YU9H 1VQLA 3PF5A 1WI5A 5LMUL 1HNZL 2ZJQA 1FGUA 5M5WH 2ATWA 3H3VH 1K0RA 4DR7Q 2I5HA 3U50C 1N34L 3D31A 1PH4A 3BZKA 3TEHB 4IO9A 1XPRA 1OXUA 2RF4A 1L1OB 2I5MX 2K75A 3L2PA 4JI1Q 2UXBL 4RG1A 4BY7H 2RCNA 4R4TA 5FJ8H 3B6YA 5E7NA 4DV0L 1E24A 4AYBG 3H15A 4DV5Q 1NBWA 2KCMA 3FKIH 2NZOA 3NEMA 3J81c 4DR5Q 1PH2A 4LFAQ 3KLWA 2VS1A 4JI3L 2PI2E 2VNUD 4HIDA 2A19A 4JI7Q 3EN2A 4PG3A 2E2HH 1VQKA 5C4JH 4A3MG 2VL6A 1E1OA 3A0JA 3A5ZB 3UE0A 5AJ3Q 1KAWA 3M9BA 5J3BA 4DUZQ 2HT1A 4DR7L 2PMZE 2H5XA 4R4CA 2OCEA 4UPAA 4OO1I 3M85A 2B29A 4JG2A 1LM0A 4A3KG 1YBYA 2D0OA 1VQDA 1I94L 4GKKQ 1EYGA 1VQJA 3U4VA 3CCJA 3HOWG 2D0PA 4UY8C 4YWLA 2ALYB 4OONA 1YNXA 4QY7A 1MJEA 1FJGQ 1NJIC 4KHPQ 1FVIA 4DR6L 1Q1EA 4L5SA 4GKJQ 1OXTA 4NB3A 4JYAQ 3KF6A 5GAEC 2QGQA 1OTCA 4X62Q 1HJPA 1VQPA 4B3TL 4JI7L 3RN5A 3T1YQ 2JA8G 3HOVG 4QQBX 3GO5A 5FJ8G 4DUZL 1HZCA 2IHFA 1QVCA 3CCLA 3S15H 2LXKA 4A3GG 2RHQB 4XTCS 4P75A 5C44H 1LUZA 1WCMH 4GN4B 1J6QA 2JA7H 1CKMA 1W2BA 5IWAL 4YCVA 3ICEA 4A3GH 1GKHA 4HJ5A 3CCSA 3STBD 1WCMG 4PZ6A 4C3JH 1Q82C 3KDFB 1TXYA 5LMNW 3VDYA 1JMCA 3PF4A 1HNXQ 1I6HH 2BH2A 3NBHB 3CCQA 1K8AC 4JI6Q 3F2DA 4FDBA 1Q81C 3DM3A 4YHHL 4DV6L 4B3RQ 1KRSA 2AWOA 1Q7YC 4WJ3M 2UUBQ 4MZ9A 3ERSX 3I55A 1B70B 4GNXA 4A93G 4YWKA 4B3TQ 1PHJA 3CCUA 4A75A 3HOZH 3HOWH 4YCUA 2JA5H 1CKNB 2N8NA 1EOVA 4IPDA 4MTNA 5M5XH 4BA1I 2I5LX 3GTLH 1NY4A 3HKZG 2XTIA 4A3FH 5C3EG 4A3LG 1SMXA 1A8VA 4LUVA 1JB7A 2JA6G 1AE3A 4HJ9A 1WYDA 3W5OA 1EWIA 1KL9A 2B3GA 4HJ7A 2A8VA 2ZTDA 4DR4Q 3PCOB 4GN3B 2QEXA 4B3SQ 4IFDI 1K73C 5GQOA 3I4NH 1HNXL 4B3MQ 4DK6C 3K0XA 1PVOA 2BH8A 3EIVA 4TQUS 1XPOA 2OQKA 3CC2A 4LF4Q 1A62A 1NE3A 1SE8A 2KENA 4NXML 1Q8KA 2IT1A 2WB1G 1DGSA 3CMEA 4GOPA 1PH8A 1NMGA 4UP9A 2E5LL 1N33L 1U5KA 3PO2H 2ZTCA 4JI0L 2R93H 1D7QA 5BR8Q 2D62A 3J81i 2OTJA 4TVAB 1O7IA 4P72A 1C0AA 3RN2A 1SR3A 5IT9c 2HIVA 4GNXB 1IBKQ 2C35B 4OWTB 3TS2A 4JCVE 4UP7A 2E2IH 2AHOB 4B3SL 1YVCA 4L5TA 3PO3H 3J80c 1B7YB 3I4MH 4B3ML 3I7FA 1MIUA 1X3GA 2JE6I 1VQMA 1X55A 3HKZE 3F1ZA 4LFCQ 3CPWA 1L1OC 4O0AA 1XNRL 2WAQE 1OXVA 1KRTA 2OQ0A 4POFA 3CMAA 4DAMA 4NXMQ 4A3JG 1Z9FA 4A4IA 1UE5A 3W1GA 2KHIA 4APVA 1Q1BA 2E5LQ 4LF5Q 1N33Q 2UU9L 3J7A5 2R7ZG 2A1AA 3KF8B 4XIGS 3CXCA 2MNAA 4LNQA 4JI2Q 5IP9G 3TS0A 4DV1L 2JEBI 1HNWQ 3A5UA 4JOIC 2R7ZH 4X65Q 1BBUA 3TQYA 1N9WA 4BXXH 1IYJB 1X56A 2V1CC 3K7AH 4IPHA 4R1JA 5ELOA 5IP9H 3I4OA 4A76A 4JI8Q 1L0WA 1B8AA 4DR2Q 1XJVA 4GOPC 2CFMA 4X64L 4L5QA 1QVFA 3UDFA 1E1TA 4X6AH 1V43A 1PH6A 3S1RH 3RLFA 2ZTEA 2FXQA 1IBMQ 2Q2TA 1UE7A 1S3OA 3M3YH 1CSQA 3FHWA 4AQYL 3M4OH 2UXDQ 3G48A 4A3BG 3MXNB 4JI5L 1YITA 4LF7Q 2NN6I 4AIMA 5C3EH 4A3LH 5JEAJ 1UE1A 5HGQA 5ELNA 3I4MG 4A93H 2UXCQ 1HZAA 3RR5A 4X66L 4YY3Q 1E7ZA 3NELA 3I56A 3G6EA 3CCVA 1K9MC 4DV1Q 4A3BH 5C0XG 2YTVA 2WP8J 1VQAA 2K4KA 4X65L 1BBWA 4DV7L 1YHQA 3LGJA 4A3DG 1NMFA 2GVAA 3E9IA 3F2BA 4A3JH 1QVGA 1YEZA 4JC0A 2Y0SE 4JI8L 5M3FH 4DUYL 4HJAA 1SRUA 2QA4A 3RZDH 1J5EQ 3PSIA 4LF8Q 3RZOH 5LMNL 1C9OA 2IHEA 1EQQA 2F4VQ 3S1MH 2ZJPA 4DR3Q 3PV0A 4C2MH 4ALPA 2JA7G 3M7NA 5M5YH 3GTKH 1SLJA 4P73A 1PH1A 2UXDL 4A3CH 3M4PA 5IYBG 2RHSB 3ULPA 1JE5A 4LF9L 2AWNA 4HJ8A 4BY1G 1HR0Q 1ASZA 3GTOH 4H02A 1PH3A 5IYDH 4JI1L 4JOIA 2PQAB 4IPGA 2NVXH 2UUAQ 1N36Q 2JK8A 4LW1A 2HHHQ 4DV7Q 3PO3G 3AFQA 5IYDG 4A3IG 4DV5L 2Q2HA 1VQ9A 2VUMG 3PUWA 2JA5G 4LF8L 1UEBA 2JQOA 3H3VI 2YTYA 2VQFL 2BA1A 4GLAC 1IL2A 3PUXA 1XMQQ 1M90C 1XPUA 1YJ9A 4NXNQ 3H0GG 4BBRH 4GLXA 1PH9A 5FLMH 5AJ3L 2K50A 5IY0A 4DV4Q 1P8LA 1SROA 3SGIA 3J80i 4DNIA 3FP9A 1U0LA 1HR0L 2MFIA 4DKAC 2E2JH 1CKOA 3GTMH 1K3RA 1I94Q 1VQBA 2NZHA 2B63H 1RL2A 1GO3E 4GNXC 3OTOL 2PNHA 2JA8H 1YJNA 1N8RC 3HKSA 3HOXH 4DV2Q 3A74A 5HY6A 1KQSA 1W3SA 1ASYA 1FJGL 5M3MG 2OTLA 2CQOA 4KHPL 4DR6Q 2PQAA 3K81C 3W1BA 3RLOA 1XMQL 3GTJH 4X62L 4A3EG 4NXNL 1VCIA 3T1YL 4IFDJ 3FKIG 3S24A 2ES2A 2OWOA 1PH5A 2L15A 5GADC 3UDXA 4A3IH 1Y1VH 5IE8A 1VS0A 3KF6B 3KYHC 4BA2I 5JJIA 3CC4A 5IWAQ 2CWPA 3E9HA 2UXBQ 3UDGA 2EXDA 3M4QA 3OTOQ 1LYLA 3ULJA 1E22A 4DV2L 1S40A 1OXXK 4DV0Q 4YWMA 5FLMG 3J81j 1WFQA 3GTGH 3HOVH 1YI2A 3CCRA 4JI6L 3KFUA 2XGTA 4DV6Q 4LFAL 1PA6A 2AKWB 4HIKA 3TRZA 5C4XH 2UUBL 3OW2A 4LUZA 4A3CG 4Y7NH 3ZJYC 1PFSA 1WOCA 4JI4Q 4K0KQ 5C4XG 5JEAG 2Z0SA 3I2ZA 1Y1WG 2IY5B 2KBNA 4R4OA 1SN8A 1EQRA 5C0XJ 4GKKL 1JJGA 3F2CA 2UUCL 3AEVA 1H95A 2N49A 1IXRA 2VUMH 3KJPA 1X3FA 4IOCA 3AFPA 4P71A 4NPSA 1EIYB 4LFBL 1EUJA 1VQ6A 4BXXG 5GAGC 1K83H 1VQEA 4GKJL 1E3PA 4DAYB 3CC7A 4JYAL 5FLXc 4WJ4A 3PUZA 2K52A 3S1NH 4LF4L 4PMWA 2DUDA 2ID0A 1HZ9A 1BKBA 2HIXA 4JI4L 1KHIA 4KHZA 4K0KL 5JJLA 3KDFA 4A3DH 2LXJA 2CKZB 4OWWB 5GROA 4JI0Q 1CUKA 3GTPH 2K14A 1LTLA 2MO0A 3PIOA 1X6OA 4OXPA 2Q2IA 3GDEA 4BBRG 2UUCQ 1JT8A 2VW9A 1X65A 4LWCA 1P16A 1V1QA 2MQHA 2NVYH 4OO1G 3T1HQ 4UP8A 4IPCA 4C3HH 4DK3C 4GS3A 3DLLA 4LFBQ 4IOAA 3GD7A 2JA9A 1L2FA 1TWFH 4QJFA 4OWXB 2CCZA 4B3RL 4QIWE 4A3EH 4YHHQ 3S16H 5M3FG 1NTGA 1XTDA 2BA0A 3PUVA 1TWGH 1L1OA 4LFCL 1G291 1Y14B 3TREA 3CF5A 1XNRQ 4BBSG 1VQCA 5M3MH 1Y1VG 1PV4A 1G51A 1RIPA 4JBJA 5IYCH 4OX9L 1V9PA 2R92G 1I3QH 3HOUH 2YTXA 3HFZB 3AYHB 1Z47A 3L0OA 5IP7H 4PZ8A 3S2HH 2YV5A 1KXLA 1JJCB 2K5HA 4R4QA 2CWAA 4JBMA 4IFDG 1QUQA 2R92H 1N32Q 1IBLL 1OXSC 2N3SA 2F52A 3J7ZC 3Q8DA 1YJWA 1HR0W 1UE6A 3ULLA 4JV5Q 2YYZA 1GD7A 3NENA 3HOZG 2R93G 4JBKA 2DGYA 4QL5A 3G71A 1PYSB 4HIMA 3T1HL 4DR4L 2KCTA 2ZM6L 1PYBA 4HIOA 1G6PA 2Z6KA 4DR2L 3KOJA 1VQGA 3STBC 1Q46A 1KD1C 3S2DH 5EAYA 2WAQG 1AE2A 1T9HA 1VQOA 2K5VA 4KI0A 4A3FG 3L7ZC 1R9TH 3PIPA 1HZBA 1A63A 3JC66 4GLVB 2IX1A 3CD6A 4AQYQ 4BY7G 4OX9Q 3PGZA 3BZCA 1M1KC 3RNUA 4LF7L 3K80C 1TWAH 4DR1Q 3CW2C 2JEAI 3H0GH 1Q86C 5BR8L 5JJKA 1KIXA 1EFWA 4JV5L 2HQLA 3JAMc 3GTQH 1N32L 5K36G 1IBLQ 4Y52H 1XMOQ 1XNQL 4EX5A 2KHJA 1Q12A 3KJOA 1VQ4A 2N78A 3PUYA 3F8TA 5C44G 1IBKL 2B63G 2NVTH 4BBSH 1AH9A 1VQNA 1D8LA 4AYBE 2ZM6Q 1CKNA 2F3IA 3K7UC 1MKHA 3HOXG 2F4VL 4BY1H 1X9NA 1J5EL 3HOYG 1A0IA 3PO2G 5C0XI 1SFOH 3CCMA 4DR3L 1YHBA 4IJHA 1QZHA 2Y0SG 3IRBA 2MO1A 4O2DA 3BJUA 1VQHA 3EBEA 4DPGA 2NVQH 4A3KH 1QUQB 3S17H 5DLQE 1S72A 4MNOA 3HOYH 3UE1A 3G4SA 1YHAA 1BVSA 2NN6G 1IZ6A 3CQZH 4JBWA 2ASBA 4LF6L 4DR1L 4LF5L 4A3MH 4LF9Q 2UU9Q 1CSPA 2WFWA 3RLNA 1K8GA 4GN5A 2GVBA 4R4IA 4JI2L 4DV3Q 1GVPA 2WB1E 1KC8C 3AQQA 4EQ5A 1HNWL 2UUAL 3S14H 1XMOL 1N36L 1XNQQ 2EQSA 1VQIA 2VY3A 2HHHL 3I4NG 2K5NA 2PI2A 2AMCB 3BU2A 2JJQA 2Z6KC 5H1SE 4QGUA 3CAMA 1TWCH 3E0EA 4X64Q 3CPFA 2JA6H 2VQFQ 5IYCG 2VQEQ 4J15A 1QZGA 2EIFA 1Y1WH 1IBML 1YZ6A 1TWHH 1VQ7A 5IP7G 5LMUQ 2IX0A 4C3IH 1HNZQ 4PZ7A 4L5RC 1HH2P 4JI5Q 4LF6Q 1N34Q 4DV4L 3MEFA 3CP0A 3U58A 1VQ5A 1MJCA 3D0FA 4KLKA 2UXCL 4P74A 1VQFA 4YY3L 4X66Q 4DV3L 1VQ8A 2Q2UA 3UDIA 5IYBH 4YCWA 1X54A 3JAMi 1UWVA 3ER0A 2GN5A 4IJLA 4AH6A 4GOPB 4LUOA 2I0QA 3HOUG 2R6GA 2E8GA 1FL0A 1JJ2A 4ME3A 4POGA 1I50H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY Q;  1YIJ A;  3WWV A;  5GAH C;  5LMN Q;  1PH7 A;  4DR5 L;  1X3E A;  3U4Z A;  2ZJR A;  1C7Y A;  4JI3 Q;  2VZA A;  3S1Q H;  2R7D A;  3OYY A;  1WJJ A;  1I5F A;  2R7F A;  3K8A A;  4RMF A;  2VQE L;  2LSS A;  3CCE A;  1GM5 A;  1EIF A;  2YU9 H;  1VQL A;  3PF5 A;  1WI5 A;  5LMU L;  1HNZ L;  2ZJQ A;  1FGU A;  5M5W H;  2ATW A;  3H3V H;  1K0R A;  4DR7 Q;  2I5H A;  3U50 C;  1N34 L;  3D31 A;  1PH4 A;  3BZK A;  3TEH B;  4IO9 A;  1XPR A;  1OXU A;  2RF4 A;  1L1O B;  2I5M X;  2K75 A;  3L2P A;  4JI1 Q;  2UXB L;  4RG1 A;  4BY7 H;  2RCN A;  4R4T A;  5FJ8 H;  3B6Y A;  5E7N A;  4DV0 L;  1E24 A;  4AYB G;  3H15 A;  4DV5 Q;  1NBW A;  2KCM A;  3FKI H;  2NZO A;  3NEM A;  3J81 c;  4DR5 Q;  1PH2 A;  4LFA Q;  3KLW A;  2VS1 A;  4JI3 L;  2PI2 E;  2VNU D;  4HID A;  2A19 A;  4JI7 Q;  3EN2 A;  4PG3 A;  2E2H H;  1VQK A;  5C4J H;  4A3M G;  2VL6 A;  1E1O A;  3A0J A;  3A5Z B;  3UE0 A;  5AJ3 Q;  1KAW A;  3M9B A;  5J3B A;  4DUZ Q;  2HT1 A;  4DR7 L;  2PMZ E;  2H5X A;  4R4C A;  2OCE A;  4UPA A;  4OO1 I;  3M85 A;  2B29 A;  4JG2 A;  1LM0 A;  4A3K G;  1YBY A;  2D0O A;  1VQD A;  1I94 L;  4GKK Q;  1EYG A;  1VQJ A;  3U4V A;  3CCJ A;  3HOW G;  2D0P A;  4UY8 C;  4YWL A;  2ALY B;  4OON A;  1YNX A;  4QY7 A;  1MJE A;  1FJG Q;  1NJI C;  4KHP Q;  1FVI A;  4DR6 L;  1Q1E A;  4L5S A;  4GKJ Q;  1OXT A;  4NB3 A;  4JYA Q;  3KF6 A;  5GAE C;  2QGQ A;  1OTC A;  4X62 Q;  1HJP A;  1VQP A;  4B3T L;  4JI7 L;  3RN5 A;  3T1Y Q;  2JA8 G;  3HOV G;  4QQB X;  3GO5 A;  5FJ8 G;  4DUZ L;  1HZC A;  2IHF A;  1QVC A;  3CCL A;  3S15 H;  2LXK A;  4A3G G;  2RHQ B;  4XTC S;  4P75 A;  5C44 H;  1LUZ A;  1WCM H;  4GN4 B;  1J6Q A;  2JA7 H;  1CKM A;  1W2B A;  5IWA L;  4YCV A;  3ICE A;  4A3G H;  1GKH A;  4HJ5 A;  3CCS A;  3STB D;  1WCM G;  4PZ6 A;  4C3J H;  1Q82 C;  3KDF B;  1TXY A;  5LMN W;  3VDY A;  1JMC A;  3PF4 A;  1HNX Q;  1I6H H;  2BH2 A;  3NBH B;  3CCQ A;  1K8A C;  4JI6 Q;  3F2D A;  4FDB A;  1Q81 C;  3DM3 A;  4YHH L;  4DV6 L;  4B3R Q;  1KRS A;  2AWO A;  1Q7Y C;  4WJ3 M;  2UUB Q;  4MZ9 A;  3ERS X;  3I55 A;  1B70 B;  4GNX A;  4A93 G;  4YWK A;  4B3T Q;  1PHJ A;  3CCU A;  4A75 A;  3HOZ H;  3HOW H;  4YCU A;  2JA5 H;  1CKN B;  2N8N A;  1EOV A;  4IPD A;  4MTN A;  5M5X H;  4BA1 I;  2I5L X;  3GTL H;  1NY4 A;  3HKZ G;  2XTI A;  4A3F H;  5C3E G;  4A3L G;  1SMX A;  1A8V A;  4LUV A;  1JB7 A;  2JA6 G;  1AE3 A;  4HJ9 A;  1WYD A;  3W5O A;  1EWI A;  1KL9 A;  2B3G A;  4HJ7 A;  2A8V A;  2ZTD A;  4DR4 Q;  3PCO B;  4GN3 B;  2QEX A;  4B3S Q;  4IFD I;  1K73 C;  5GQO A;  3I4N H;  1HNX L;  4B3M Q;  4DK6 C;  3K0X A;  1PVO A;  2BH8 A;  3EIV A;  4TQU S;  1XPO A;  2OQK A;  3CC2 A;  4LF4 Q;  1A62 A;  1NE3 A;  1SE8 A;  2KEN A;  4NXM L;  1Q8K A;  2IT1 A;  2WB1 G;  1DGS A;  3CME A;  4GOP A;  1PH8 A;  1NMG A;  4UP9 A;  2E5L L;  1N33 L;  1U5K A;  3PO2 H;  2ZTC A;  4JI0 L;  2R93 H;  1D7Q A;  5BR8 Q;  2D62 A;  3J81 i;  2OTJ A;  4TVA B;  1O7I A;  4P72 A;  1C0A A;  3RN2 A;  1SR3 A;  5IT9 c;  2HIV A;  4GNX B;  1IBK Q;  2C35 B;  4OWT B;  3TS2 A;  4JCV E;  4UP7 A;  2E2I H;  2AHO B;  4B3S L;  1YVC A;  4L5T A;  3PO3 H;  3J80 c;  1B7Y B;  3I4M H;  4B3M L;  3I7F A;  1MIU A;  1X3G A;  2JE6 I;  1VQM A;  1X55 A;  3HKZ E;  3F1Z A;  4LFC Q;  3CPW A;  1L1O C;  4O0A A;  1XNR L;  2WAQ E;  1OXV A;  1KRT A;  2OQ0 A;  4POF A;  3CMA A;  4DAM A;  4NXM Q;  4A3J G;  1Z9F A;  4A4I A;  1UE5 A;  3W1G A;  2KHI A;  4APV A;  1Q1B A;  2E5L Q;  4LF5 Q;  1N33 Q;  2UU9 L;  3J7A 5;  2R7Z G;  2A1A A;  3KF8 B;  4XIG S;  3CXC A;  2MNA A;  4LNQ A;  4JI2 Q;  5IP9 G;  3TS0 A;  4DV1 L;  2JEB I;  1HNW Q;  3A5U A;  4JOI C;  2R7Z H;  4X65 Q;  1BBU A;  3TQY A;  1N9W A;  4BXX H;  1IYJ B;  1X56 A;  2V1C C;  3K7A H;  4IPH A;  4R1J A;  5ELO A;  5IP9 H;  3I4O A;  4A76 A;  4JI8 Q;  1L0W A;  1B8A A;  4DR2 Q;  1XJV A;  4GOP C;  2CFM A;  4X64 L;  4L5Q A;  1QVF A;  3UDF A;  1E1T A;  4X6A H;  1V43 A;  1PH6 A;  3S1R H;  3RLF A;  2ZTE A;  2FXQ A;  1IBM Q;  2Q2T A;  1UE7 A;  1S3O A;  3M3Y H;  1CSQ A;  3FHW A;  4AQY L;  3M4O H;  2UXD Q;  3G48 A;  4A3B G;  3MXN B;  4JI5 L;  1YIT A;  4LF7 Q;  2NN6 I;  4AIM A;  5C3E H;  4A3L H;  5JEA J;  1UE1 A;  5HGQ A;  5ELN A;  3I4M G;  4A93 H;  2UXC Q;  1HZA A;  3RR5 A;  4X66 L;  4YY3 Q;  1E7Z A;  3NEL A;  3I56 A;  3G6E A;  3CCV A;  1K9M C;  4DV1 Q;  4A3B H;  5C0X G;  2YTV A;  2WP8 J;  1VQA A;  2K4K A;  4X65 L;  1BBW A;  4DV7 L;  1YHQ A;  3LGJ A;  4A3D G;  1NMF A;  2GVA A;  3E9I A;  3F2B A;  4A3J H;  1QVG A;  1YEZ A;  4JC0 A;  2Y0S E;  4JI8 L;  5M3F H;  4DUY L;  4HJA A;  1SRU A;  2QA4 A;  3RZD H;  1J5E Q;  3PSI A;  4LF8 Q;  3RZO H;  5LMN L;  1C9O A;  2IHE A;  1EQQ A;  2F4V Q;  3S1M H;  2ZJP A;  4DR3 Q;  3PV0 A;  4C2M H;  4ALP A;  2JA7 G;  3M7N A;  5M5Y H;  3GTK H;  1SLJ A;  4P73 A;  1PH1 A;  2UXD L;  4A3C H;  3M4P A;  5IYB G;  2RHS B;  3ULP A;  1JE5 A;  4LF9 L;  2AWN A;  4HJ8 A;  4BY1 G;  1HR0 Q;  1ASZ A;  3GTO H;  4H02 A;  1PH3 A;  5IYD H;  4JI1 L;  4JOI A;  2PQA B;  4IPG A;  2NVX H;  2UUA Q;  1N36 Q;  2JK8 A;  4LW1 A;  2HHH Q;  4DV7 Q;  3PO3 G;  3AFQ A;  5IYD G;  4A3I G;  4DV5 L;  2Q2H A;  1VQ9 A;  2VUM G;  3PUW A;  2JA5 G;  4LF8 L;  1UEB A;  2JQO A;  3H3V I;  2YTY A;  2VQF L;  2BA1 A;  4GLA C;  1IL2 A;  3PUX A;  1XMQ Q;  1M90 C;  1XPU A;  1YJ9 A;  4NXN Q;  3H0G G;  4BBR H;  4GLX A;  1PH9 A;  5FLM H;  5AJ3 L;  2K50 A;  5IY0 A;  4DV4 Q;  1P8L A;  1SRO A;  3SGI A;  3J80 i;  4DNI A;  3FP9 A;  1U0L A;  1HR0 L;  2MFI A;  4DKA C;  2E2J H;  1CKO A;  3GTM H;  1K3R A;  1I94 Q;  1VQB A;  2NZH A;  2B63 H;  1RL2 A;  1GO3 E;  4GNX C;  3OTO L;  2PNH A;  2JA8 H;  1YJN A;  1N8R C;  3HKS A;  3HOX H;  4DV2 Q;  3A74 A;  5HY6 A;  1KQS A;  1W3S A;  1ASY A;  1FJG L;  5M3M G;  2OTL A;  2CQO A;  4KHP L;  4DR6 Q;  2PQA A;  3K81 C;  3W1B A;  3RLO A;  1XMQ L;  3GTJ H;  4X62 L;  4A3E G;  4NXN L;  1VCI A;  3T1Y L;  4IFD J;  3FKI G;  3S24 A;  2ES2 A;  2OWO A;  1PH5 A;  2L15 A;  5GAD C;  3UDX A;  4A3I H;  1Y1V H;  5IE8 A;  1VS0 A;  3KF6 B;  3KYH C;  4BA2 I;  5JJI A;  3CC4 A;  5IWA Q;  2CWP A;  3E9H A;  2UXB Q;  3UDG A;  2EXD A;  3M4Q A;  3OTO Q;  1LYL A;  3ULJ A;  1E22 A;  4DV2 L;  1S40 A;  1OXX K;  4DV0 Q;  4YWM A;  5FLM G;  3J81 j;  1WFQ A;  3GTG H;  3HOV H;  1YI2 A;  3CCR A;  4JI6 L;  3KFU A;  2XGT A;  4DV6 Q;  4LFA L;  1PA6 A;  2AKW B;  4HIK A;  3TRZ A;  5C4X H;  2UUB L;  3OW2 A;  4LUZ A;  4A3C G;  4Y7N H;  3ZJY C;  1PFS A;  1WOC A;  4JI4 Q;  4K0K Q;  5C4X G;  5JEA G;  2Z0S A;  3I2Z A;  1Y1W G;  2IY5 B;  2KBN A;  4R4O A;  1SN8 A;  1EQR A;  5C0X J;  4GKK L;  1JJG A;  3F2C A;  2UUC L;  3AEV A;  1H95 A;  2N49 A;  1IXR A;  2VUM H;  3KJP A;  1X3F A;  4IOC A;  3AFP A;  4P71 A;  4NPS A;  1EIY B;  4LFB L;  1EUJ A;  1VQ6 A;  4BXX G;  5GAG C;  1K83 H;  1VQE A;  4GKJ L;  1E3P A;  4DAY B;  3CC7 A;  4JYA L;  5FLX c;  4WJ4 A;  3PUZ A;  2K52 A;  3S1N H;  4LF4 L;  4PMW A;  2DUD A;  2ID0 A;  1HZ9 A;  1BKB A;  2HIX A;  4JI4 L;  1KHI A;  4KHZ A;  4K0K L;  5JJL A;  3KDF A;  4A3D H;  2LXJ A;  2CKZ B;  4OWW B;  5GRO A;  4JI0 Q;  1CUK A;  3GTP H;  2K14 A;  1LTL A;  2MO0 A;  3PIO A;  1X6O A;  4OXP A;  2Q2I A;  3GDE A;  4BBR G;  2UUC Q;  1JT8 A;  2VW9 A;  1X65 A;  4LWC A;  1P16 A;  1V1Q A;  2MQH A;  2NVY H;  4OO1 G;  3T1H Q;  4UP8 A;  4IPC A;  4C3H H;  4DK3 C;  4GS3 A;  3DLL A;  4LFB Q;  4IOA A;  3GD7 A;  2JA9 A;  1L2F A;  1TWF H;  4QJF A;  4OWX B;  2CCZ A;  4B3R L;  4QIW E;  4A3E H;  4YHH Q;  3S16 H;  5M3F G;  1NTG A;  1XTD A;  2BA0 A;  3PUV A;  1TWG H;  1L1O A;  4LFC L;  1G29 1;  1Y14 B;  3TRE A;  3CF5 A;  1XNR Q;  4BBS G;  1VQC A;  5M3M H;  1Y1V G;  1PV4 A;  1G51 A;  1RIP A;  4JBJ A;  5IYC H;  4OX9 L;  1V9P A;  2R92 G;  1I3Q H;  3HOU H;  2YTX A;  3HFZ B;  3AYH B;  1Z47 A;  3L0O A;  5IP7 H;  4PZ8 A;  3S2H H;  2YV5 A;  1KXL A;  1JJC B;  2K5H A;  4R4Q A;  2CWA A;  4JBM A;  4IFD G;  1QUQ A;  2R92 H;  1N32 Q;  1IBL L;  1OXS C;  2N3S A;  2F52 A;  3J7Z C;  3Q8D A;  1YJW A;  1HR0 W;  1UE6 A;  3ULL A;  4JV5 Q;  2YYZ A;  1GD7 A;  3NEN A;  3HOZ G;  2R93 G;  4JBK A;  2DGY A;  4QL5 A;  3G71 A;  1PYS B;  4HIM A;  3T1H L;  4DR4 L;  2KCT A;  2ZM6 L;  1PYB A;  4HIO A;  1G6P A;  2Z6K A;  4DR2 L;  3KOJ A;  1VQG A;  3STB C;  1Q46 A;  1KD1 C;  3S2D H;  5EAY A;  2WAQ G;  1AE2 A;  1T9H A;  1VQO A;  2K5V A;  4KI0 A;  4A3F G;  3L7Z C;  1R9T H;  3PIP A;  1HZB A;  1A63 A;  3JC6 6;  4GLV B;  2IX1 A;  3CD6 A;  4AQY Q;  4BY7 G;  4OX9 Q;  3PGZ A;  3BZC A;  1M1K C;  3RNU A;  4LF7 L;  3K80 C;  1TWA H;  4DR1 Q;  3CW2 C;  2JEA I;  3H0G H;  1Q86 C;  5BR8 L;  5JJK A;  1KIX A;  1EFW A;  4JV5 L;  2HQL A;  3JAM c;  3GTQ H;  1N32 L;  5K36 G;  1IBL Q;  4Y52 H;  1XMO Q;  1XNQ L;  4EX5 A;  2KHJ A;  1Q12 A;  3KJO A;  1VQ4 A;  2N78 A;  3PUY A;  3F8T A;  5C44 G;  1IBK L;  2B63 G;  2NVT H;  4BBS H;  1AH9 A;  1VQN A;  1D8L A;  4AYB E;  2ZM6 Q;  1CKN A;  2F3I A;  3K7U C;  1MKH A;  3HOX G;  2F4V L;  4BY1 H;  1X9N A;  1J5E L;  3HOY G;  1A0I A;  3PO2 G;  5C0X I;  1SFO H;  3CCM A;  4DR3 L;  1YHB A;  4IJH A;  1QZH A;  2Y0S G;  3IRB A;  2MO1 A;  4O2D A;  3BJU A;  1VQH A;  3EBE A;  4DPG A;  2NVQ H;  4A3K H;  1QUQ B;  3S17 H;  5DLQ E;  1S72 A;  4MNO A;  3HOY H;  3UE1 A;  3G4S A;  1YHA A;  1BVS A;  2NN6 G;  1IZ6 A;  3CQZ H;  4JBW A;  2ASB A;  4LF6 L;  4DR1 L;  4LF5 L;  4A3M H;  4LF9 Q;  2UU9 Q;  1CSP A;  2WFW A;  3RLN A;  1K8G A;  4GN5 A;  2GVB A;  4R4I A;  4JI2 L;  4DV3 Q;  1GVP A;  2WB1 E;  1KC8 C;  3AQQ A;  4EQ5 A;  1HNW L;  2UUA L;  3S14 H;  1XMO L;  1N36 L;  1XNQ Q;  2EQS A;  1VQI A;  2VY3 A;  2HHH L;  3I4N G;  2K5N A;  2PI2 A;  2AMC B;  3BU2 A;  2JJQ A;  2Z6K C;  5H1S E;  4QGU A;  3CAM A;  1TWC H;  3E0E A;  4X64 Q;  3CPF A;  2JA6 H;  2VQF Q;  5IYC G;  2VQE Q;  4J15 A;  1QZG A;  2EIF A;  1Y1W H;  1IBM L;  1YZ6 A;  1TWH H;  1VQ7 A;  5IP7 G;  5LMU Q;  2IX0 A;  4C3I H;  1HNZ Q;  4PZ7 A;  4L5R C;  1HH2 P;  4JI5 Q;  4LF6 Q;  1N34 Q;  4DV4 L;  3MEF A;  3CP0 A;  3U58 A;  1VQ5 A;  1MJC A;  3D0F A;  4KLK A;  2UXC L;  4P74 A;  1VQF A;  4YY3 L;  4X66 Q;  4DV3 L;  1VQ8 A;  2Q2U A;  3UDI A;  5IYB H;  4YCW A;  1X54 A;  3JAM i;  1UWV A;  3ER0 A;  2GN5 A;  4IJL A;  4AH6 A;  4GOP B;  4LUO A;  2I0Q A;  3HOU G;  2R6G A;  2E8G A;  1FL0 A;  1JJ2 A;  4ME3 A;  4POG A;  1I50 H; 
#chains in the Genus database with same CATH topology
 2HQE A;  2EVB A;  1TWA B;  4DR5 L;  1X3E A;  5FKA C;  1C7Y A;  3QIA A;  3T13 A;  2LSS A;  4DAV A;  3OIP A;  2YU9 H;  5JOB A;  1FGU A;  3WOF A;  4QUC A;  4DR7 Q;  4QB4 A;  3D31 A;  4IO9 A;  3GTK B;  5CR3 A;  4JI1 Q;  4A3B B;  3GV3 A;  3SE0 A;  3GTM B;  1L0Y B;  3ONA B;  1LT3 D;  3CRK C;  3NHH A;  2MPM A;  2RKS A;  3H15 A;  3AB9 A;  5M5W B;  1TS4 A;  2MUY A;  2VS1 A;  2PO4 A;  3L9A X;  1VQK A;  1HQR D;  2HT1 A;  5J3B A;  4OO1 I;  2B29 A;  1EY5 A;  4JG2 A;  3HOY B;  1WTR A;  4A3K G;  2Z6B A;  1VQD A;  4GKK Q;  3D6W A;  1HHV A;  1HUM A;  4OON A;  2F0M A;  4QY7 A;  1FJG Q;  1G91 A;  1VF7 A;  3X3M A;  4DR6 L;  4L5S A;  4PNY A;  3A54 A;  5GAE C;  1Q8I A;  1H9R A;  1OTC A;  4B3T L;  3T1Y Q;  1S5B D;  2SNM A;  4CDF C;  2H1E A;  1IKM A;  2TSS A;  2NWG A;  2VXW A;  1GUW A;  1V8Q A;  1WCM H;  2PCF B;  4GN4 B;  2JA7 H;  1CKM A;  1W2B A;  2RVL A;  1WTO A;  1F9Q A;  4R8N A;  4M8A A;  4C3J H;  3SK4 A;  1EWH A;  1JMC A;  2F0K A;  1I6H H;  1K8A C;  4WJ3 M;  1KRS A;  3ERS X;  4A93 G;  5KRU A;  1IW7 C;  3HOU B;  1SJE D;  1H9S A;  1EOV A;  1V1P A;  5M5X H;  4BA1 I;  2SEB D;  4RKL A;  4XXE A;  1TT2 A;  4DXG A;  3W5O A;  3GQB A;  4GN3 B;  2SNS A;  4B3S Q;  1K73 C;  2K01 A;  1HNX L;  4ZLT F;  1EY4 A;  4KK7 A;  4NP5 A;  5EKK A;  1PVO A;  3BYY B;  1XPO A;  1C48 A;  2JA5 B;  2AQ1 B;  4ZQ3 A;  3I4L A;  3MC0 B;  2RDG A;  1NE3 A;  2IL8 A;  3NPP A;  2KEN A;  2IT1 A;  2Q8T A;  3CME A;  3MAQ A;  2WAC A;  3QG1 A;  2DNE A;  1O7Z A;  3QR8 A;  4EGV A;  2HUG A;  1DOL A;  2R93 H;  1D7Q A;  1K28 A;  5BR8 Q;  2E2H B;  1MSH A;  1O7I A;  4F7X A;  1F2L A;  1C0A A;  4FF3 A;  5JJZ A;  4DN4 M;  1F9P A;  3IFD A;  2B2V A;  2C35 B;  1I3Q B;  3S1M B;  4ODG A;  4B3S L;  4B3M L;  1U9R A;  5KYI A;  1MIU A;  1X55 A;  3HKZ E;  3CPW A;  1L1O C;  1STY A;  1D2B A;  2WAQ E;  4POF A;  5DNF A;  3S9W A;  2KHI A;  1Q1B A;  3W3A A;  1U4P A;  2A1A A;  3J7A 5;  1QE6 A;  1CZW A;  2JEB I;  1EYD A;  4OGQ C;  1TS3 A;  2R7Z H;  1BBU A;  4BXX H;  1N9W A;  2XIW A;  4R1J A;  2QEJ C;  3QO2 A;  4IPH A;  5ELO A;  3S1Q B;  5IP9 H;  4A76 A;  2CFM A;  1LO5 D;  2D9U A;  3RMH A;  1PH6 A;  3D6C A;  2ZTE A;  2FXQ A;  1IBM Q;  3M4O H;  2OXP A;  3MXN B;  4LF7 Q;  2DJF C;  3FKI B;  2F0P A;  4A93 H;  3I56 A;  4YY3 Q;  1BOS A;  2WV6 D;  3NEL A;  4A3B H;  4OO1 H;  1C4Q A;  4DV7 L;  1HTP A;  3LGJ A;  3TP6 A;  1NMF A;  4P2C B;  2B63 B;  4KY7 A;  4EVO A;  2F4V Q;  1UEA B;  3H91 A;  3PSI A;  5C3E B;  1Y69 U;  2Z4H A;  3I91 A;  1PXU A;  4YIJ A;  5M5Y H;  1SLJ A;  4P73 A;  5EBD A;  2UXD L;  1IL8 A;  4K2K A;  3NBH A;  5CGK A;  1QB5 D;  1BQQ T;  1I4X A;  4KHV A;  2EYO A;  4H02 A;  4CDC C;  5CV4 A;  4A3K B;  4JI1 L;  4JOI A;  2EPB A;  1FD7 D;  1QCB D;  4IPG A;  3GP7 A;  5M3M B;  2NVX H;  1K8O A;  1PRT F;  5IYD G;  3EJI A;  2JSO A;  4KN4 C;  2JA5 G;  4LF8 L;  3BDC A;  2JQO A;  2HCC A;  4K2L A;  2YTY A;  2A6E D;  1IL2 A;  3PUX A;  1M90 C;  1LT5 D;  2F0D A;  3K6O A;  2AQ3 B;  1SRO A;  3FP9 A;  4I7A A;  2MFI A;  1G8Z D;  4DA2 A;  3GTM H;  1RL2 A;  3PIP 3;  3OW7 A;  3OTO L;  4G7H C;  1TWC B;  4DV2 Q;  4G7O C;  3RZD B;  5HY6 A;  2F0L A;  4ME5 A;  4A3J B;  1FJG L;  3J80 L;  4DR6 Q;  1I6H B;  4RGM A;  4K6L A;  4CDE C;  3KLS A;  2PQA A;  2RA4 A;  1PFB A;  2KA7 A;  1VCI A;  1HPC A;  1QIL A;  3S24 A;  2OWO A;  5GAD C;  5HUR A;  1LTA D;  4DU9 A;  5EPL A;  1VS0 A;  3KF6 B;  1SMY C;  1ZKO A;  1X32 A;  4CKE A;  3M4Q A;  1HCZ A;  3OTO Q;  1W6J A;  1S40 A;  1TWF B;  4MHE A;  3MZ5 A;  4YWM A;  2X6G A;  1LTI D;  3MXP A;  3T53 B;  3NTH A;  1PFN A;  2K7V A;  3O13 A;  2AUK A;  4LUZ A;  1EEI D;  1SYE A;  1X3Q A;  4R8I A;  1LLR D;  3JAM L;  1ET6 A;  2SDF A;  4X3K A;  4K0K Q;  1ENA A;  1AW7 A;  4XYQ A;  2LMC B;  1H95 A;  2N49 A;  1K8M A;  1X3F A;  5ELB A;  3PMF A;  4NPS A;  4LFB L;  4RFB A;  3DM1 A;  4ZYS A;  1VQ6 A;  5GAG C;  5FLX c;  4WJ4 A;  2K52 A;  4Y7N B;  5E1F A;  5C4Z A;  2WII B;  1BKB A;  2F0T A;  4KHZ A;  4K0K L;  3T16 A;  4MTK A;  4OWW B;  1CUK A;  1EY7 A;  2MO0 A;  4MN3 A;  4OXP A;  2JXM B;  2QF7 A;  1DZ1 A;  1SDF A;  4CHT B;  1P16 A;  2MQH A;  1GOZ A;  3T1H Q;  4DK3 C;  3K5M A;  3DLL A;  4LFB Q;  2JA9 A;  2B2U C;  2CCZ A;  4A3E H;  3S16 H;  5M3F G;  1NTG A;  2BA0 A;  1AEX A;  3PUV A;  5IT9 L;  1L1O A;  3CF5 A;  4BBS G;  4WOR A;  1VQC A;  1GUT A;  1Y1V G;  4OX9 L;  3HOU H;  1MI2 A;  3HOW B;  1NUC A;  2K5H A;  2CWA A;  4CDD C;  1CHP D;  1DON A;  2RSN A;  3Q8D A;  1UE6 A;  3ULL A;  4ZKB B;  4QL5 A;  5C44 B;  4L8J A;  3T1H L;  3NK9 A;  5IOC A;  1G6P A;  3ND8 A;  3KOJ A;  4B08 A;  1KD1 C;  1Q46 A;  2WAQ G;  1T9H A;  4J6H A;  4A3F G;  4CKB A;  3PIP A;  3U9S A;  1AZQ A;  1B1Z A;  1MHW C;  2IX1 A;  3CD6 A;  2L4N A;  3K0Y A;  4BY7 G;  4OX9 Q;  1M1K C;  3Q0A A;  3K80 C;  4DAY A;  4L63 B;  3OOC A;  4JV5 L;  3JAM c;  2E75 C;  2F0I A;  1J9O A;  1XMO Q;  2KHJ A;  1VQ4 A;  1II3 A;  3EVQ A;  3K7U C;  3HOY G;  5COY A;  5C0X I;  3KF8 A;  1YHB A;  2B2W A;  2P5Z X;  1VQH A;  4J8Q A;  3DEO A;  2WIN B;  2KEE A;  5DLQ E;  1CM9 A;  3NWT A;  1YHA A;  3BS1 A;  4JBW A;  4LF6 L;  4LF5 L;  4LF9 Q;  1FNV A;  5I6Y A;  3RLN A;  1K8G A;  4GN5 A;  3QB3 A;  4DV3 Q;  2WB1 E;  1B9M A;  1WTW A;  1E2V A;  2ZXO A;  2K5N A;  2PI2 A;  1EYC A;  5BN5 A;  2B2U A;  2Z6K C;  2E2J B;  2A68 C;  4RWS C;  3E3X A;  1LTR D;  1PRT D;  4Q5V A;  4RKB A;  2EIF A;  3VA5 A;  1TWH H;  1VQ7 A;  3SK5 A;  2IX0 A;  4L5R C;  2KUM A;  1N34 Q;  3U58 A;  2I46 A;  2PMZ B;  1HFN A;  5ISR A;  5DAU A;  4X66 Q;  2XWB B;  5IYB H;  2NVT B;  1X54 A;  1GHJ A;  4KV6 A;  4C56 C;  2I0Q A;  3HOU G;  3URY A;  4AYB B;  4ME3 A;  5LHY 1;  4DUY Q;  5EGT A;  5LMN Q;  1PH7 A;  2ZJR A;  2VZA A;  3S1Q H;  1WJJ A;  1I5F A;  2VQE L;  2DY8 A;  4B9X A;  1VQL A;  3PF5 A;  2O5I C;  5I9O A;  1WI5 A;  2ZJQ A;  1Y8O B;  3RZO B;  5M5W H;  3H3V H;  2K5Q A;  2I5H A;  1N34 L;  4E6I A;  3BZK A;  4CBV A;  5M5Y B;  1L1O B;  4EQO A;  4BY7 H;  4TSS A;  2F03 A;  4JVZ A;  5E7N A;  3HEJ A;  1E24 A;  1XXG A;  1EWC A;  1H9S B;  3FKI H;  1B2T A;  3J81 c;  3K58 A;  4DR5 Q;  3KLW A;  3S14 B;  2PI2 E;  4HID A;  4FO2 A;  5J22 A;  3M3Y B;  4PG3 A;  2VB3 X;  3D4W A;  5AJ3 Q;  4DUZ Q;  4F87 A;  4DR7 L;  4UPA A;  4UAI A;  3VA7 A;  1BO0 A;  3D3R A;  2D0O A;  2XVS A;  3BG3 A;  3U4V A;  1TR5 A;  4XQN A;  4UY8 C;  5CV8 A;  2DJG C;  2ALY B;  3ERQ A;  2BE5 C;  4IUT A;  1NJI C;  1FVI A;  1Q1E A;  3MHB A;  2AQ2 B;  4NB3 A;  1DCZ A;  4CJ1 B;  2QGQ A;  2TMP A;  4N8X 1;  4X62 Q;  5KGU A;  3HOV G;  4QQB X;  2JA8 G;  5FJ8 G;  3ND9 A;  4DUZ L;  4A3G G;  3S15 H;  2LXK A;  2RHQ B;  4XTC S;  5E4W C;  1G6Z A;  1GKH A;  3NXW A;  4HJ5 A;  1WTV A;  1WCM G;  2PW5 A;  3PO3 B;  4QIW B;  2HCI A;  5LMN W;  2E2I B;  3PF4 A;  1JC7 A;  3NBH B;  5C4H A;  3CCQ A;  3JAM E;  3DM3 A;  4YHH L;  3A8J E;  2UUB Q;  1VDZ A;  3I55 A;  4B3T Q;  1PHJ A;  3HOW H;  4BY7 B;  1CKN B;  3FPU B;  5C0X H;  2G9D A;  4ZAI A;  1M4V A;  1ML0 D;  1NY4 A;  4A3F H;  1JB7 A;  2JA6 G;  2E76 C;  1I4P A;  2LFN A;  2A8V A;  4XQJ A;  2BE5 D;  3NTI A;  4DR4 Q;  4A3F B;  3PCO B;  2QEX A;  5GQO A;  1EU3 A;  2BH8 A;  1I6V C;  4TQU S;  3CC2 A;  5IT9 E;  1A62 A;  3HS0 C;  5KEE A;  1SE8 A;  4ABN A;  4NXM L;  1Q8K A;  1NMG A;  4UP9 A;  1N33 L;  4JI0 L;  2D62 A;  4UDU C;  3AU7 A;  2OTJ A;  4TVA B;  3CU7 A;  3D4D A;  2MP1 A;  5EKI A;  3Q23 A;  1WTH A;  2KQ3 A;  4O1N A;  2A6H D;  4JCV E;  1YVC A;  1S5E D;  4KY5 A;  2C9O A;  1XX8 A;  1VQM A;  2SOB A;  1B44 D;  4ZUI A;  4LFC Q;  2M2L A;  4O0A A;  1FGB D;  2OF1 A;  1KRT A;  4DAM A;  4NXM Q;  4A3J G;  3R3O A;  5ELE A;  1LTT D;  4A4I A;  1ZYR D;  4APV A;  1EIH A;  4WFN 3;  4IUU A;  1DYQ A;  3TS0 A;  4DV1 L;  3M4O B;  5EPJ A;  4JOI C;  2RDF A;  4X65 Q;  2A68 D;  3TQY A;  1AZP A;  1SYC A;  1X56 A;  1S5F D;  5EPK A;  3C1F A;  1L0W A;  1MD2 D;  5DM7 3;  4G57 A;  4X64 L;  4GOP C;  4FNF A;  4X6A H;  1SYB A;  1S4Z A;  3S1R H;  3RLF A;  2Q2T A;  2LKV A;  3TME A;  1UE7 A;  1AN8 A;  4U68 A;  1CSQ A;  4AQY L;  1EFI D;  5T1I A;  1H9M A;  2EYL A;  4JI5 L;  5C3E H;  4A3L H;  5HGQ A;  3I4M G;  2BOS A;  1HZA A;  3RR5 A;  1A3U A;  1STG A;  5C0X G;  2YTV A;  3WDN A;  2K4K A;  3VR6 A;  5IGD A;  4A3D G;  1L0X B;  2GVA A;  4ILW A;  4JC0 A;  5M3F H;  4HJA A;  4LNQ A;  3C46 A;  4DUY L;  4K14 A;  2QA4 A;  1J5E Q;  3RZO H;  5LMN L;  1C9O A;  2QKI C;  5CBA E;  3S1M H;  3CQZ B;  2CH4 A;  3PV0 A;  4U67 3;  2JA7 G;  1KAB A;  4MIU A;  1IHZ A;  3M4P A;  2EDG A;  2RHS B;  1I50 B;  1JE5 A;  2K1B A;  4BBR B;  4HJ8 A;  1FNU A;  3NBI A;  1STE A;  4BY1 G;  1CA5 A;  1HR0 Q;  4K5X A;  3SK6 A;  2G5D A;  3GTO H;  5LL6 S;  1ONL A;  2F0V A;  2UUA Q;  1HRJ A;  1M8A A;  1A2U A;  1U4R A;  3BVG A;  1N36 Q;  1HQM C;  2WB1 B;  2HHH Q;  4DV7 Q;  3PO3 G;  3AFQ A;  5JPM C;  4A3I G;  5IGG A;  1VQ9 A;  2NB0 A;  2Z8L A;  1TY0 A;  4EQN A;  2VQF L;  5KIX A;  2DN8 A;  1TII D;  1PH9 A;  2RBM A;  1P8L A;  4DNI A;  4DFA A;  5M3F B;  1HR0 L;  2JP1 A;  1JOK A;  1TKW B;  1GO3 E;  2JA8 H;  1RKN A;  2F4I A;  1YJN A;  1GUN A;  2MGS A;  2CQO A;  1F2M A;  3A8K E;  4LAA A;  2JN4 A;  3RLO A;  3W1B A;  1O7Y A;  3GTJ H;  4X62 L;  4A3E G;  2A5H A;  4NMZ A;  3FVQ A;  3T1Y L;  2PYK A;  1PH5 A;  1IKL A;  1Y1V H;  5JJI A;  2OEO A;  5TSS A;  5IGE A;  2UXB Q;  4XQQ A;  2ICE C;  2EXD A;  2E74 C;  2IX3 A;  3UDG A;  2D2C C;  5ELC A;  1LYL A;  4DV2 L;  1CQV A;  4DV0 Q;  4FF4 A;  3P20 A;  5FLM G;  1YI2 A;  3CCR A;  3KFU A;  2XGT A;  4LFA L;  1KDA A;  3MFG A;  4R9W A;  2PW7 A;  1B4O A;  4C2M B;  3OW2 A;  4A3C G;  2A6H C;  3RUZ A;  1CTM A;  1PTO H;  4JI4 Q;  1PYW D;  2Z0S A;  3I2Z A;  3V2T A;  1Y1W G;  1D5Z C;  2HD3 A;  2A73 B;  5C0X J;  1EQR A;  2A69 D;  1JJG A;  2UUC L;  1H9J A;  3J7Y W;  2VUM H;  3TN2 A;  4TRD A;  3N6R A;  3VYR A;  1EIY B;  4OIK A;  1SND A;  3S1N H;  3TP5 A;  1LAC A;  4PMW A;  4RGN A;  1Q90 A;  1DXM A;  5DEH A;  3KDF A;  5KYL A;  3GTP H;  5CBE E;  3PIO A;  4KJO A;  3V96 A;  2Q2I A;  3DWA A;  1HTL D;  1PFM A;  4ZRZ A;  1QNU A;  2KJX A;  2UUC Q;  1Z7T A;  2L12 A;  1BCP B;  3GTP B;  3QJY A;  5CV7 A;  1EZ8 A;  2KHS A;  4IUQ A;  3R2T A;  4IOA A;  4C3I G;  1L2F A;  1TWF H;  4B3R L;  4QIW E;  3VYT A;  1CQF A;  2CW0 D;  1G29 1;  1Y14 B;  3IFT A;  3TRE A;  4LMQ D;  1PV4 A;  1RIP A;  4JBJ A;  4PV1 C;  1V9P A;  3GTO B;  3L0O A;  4PZ8 A;  1KXL A;  4FP5 D;  3ERO A;  2H4O A;  2NUC A;  3S1N B;  2C5C A;  5E3F A;  1IBL L;  1OXS C;  2N3S A;  2F52 A;  2ICI A;  1BF4 A;  1EY6 A;  3HOZ G;  4JBK A;  1K83 B;  2PPB C;  2EYF A;  1EL0 A;  3F2U A;  5FO7 B;  1A6X A;  2KCT A;  2ZM6 L;  1BUV T;  3A56 A;  1GUG A;  5CMD A;  2Z6K A;  3S2D H;  1DD2 A;  1QG7 A;  4RA8 A;  1AE2 A;  4FF2 A;  2K5V A;  2YU9 B;  1D1I A;  4AQY Q;  1ILQ A;  3RNU A;  4LF7 L;  3CW2 C;  1STA A;  3H0G H;  5J39 A;  1Q86 C;  5FOB B;  4XT3 B;  1UAP A;  1KIX A;  1EZ6 A;  5K36 G;  1IBL Q;  1GXD C;  3NQT A;  1XNQ L;  5ELF A;  1Q12 A;  1AH9 A;  1PRT B;  3V05 A;  3F8T A;  5C44 G;  1IBK L;  2B63 G;  1H9K A;  4A3I B;  4AYB E;  4B9W A;  1TS2 A;  1HFG A;  2F4V L;  3HOX G;  4BY1 H;  2EOT A;  1A0I A;  3PO2 G;  4N8F A;  3G7L A;  4IJH A;  1QZH A;  3MWY W;  2KCC A;  1O7L A;  3S17 H;  4DPG A;  3U9O A;  1S72 A;  4MNO A;  3HOY H;  3G4S A;  1Y1V B;  2UU9 Q;  2XRQ D;  3MEH A;  1HA5 A;  4ID6 A;  4H0L C;  4R4I A;  4JI2 L;  5I9P A;  1GVP A;  3AQQ A;  2UUA L;  3S14 H;  1SEB D;  2F0U A;  1XMO L;  1N36 L;  1XNQ Q;  2EQS A;  1VQI A;  5KNC A;  4IUV A;  1WD1 A;  2JJQ A;  4KD4 A;  2FJ2 A;  1TWC H;  5COR A;  2Z1C A;  4CKC A;  3C1E A;  5LMU Q;  1U4L A;  4IAL A;  2PZT A;  4C3I H;  1HH2 P;  1SNM A;  4LF6 Q;  1RCV D;  1YNN C;  2RCF A;  1MJC A;  4DAP A;  2UXC L;  4P74 A;  1VQ8 A;  2V4D A;  4N9P A;  4ZCK A;  4DV3 L;  2Q2U A;  2WKD A;  3S17 B;  3ER0 A;  4LUO A;  3LNN A;  2R6G A;  3QOJ A;  3DHQ A;  4A3E B;  1W6K A;  4HSV A;  4JI3 Q;  4V0B A;  2Y0S B;  2R7D A;  3OYY A;  1A15 A;  2R7F A;  3K8A A;  4RMF A;  4CGY B;  3T4A C;  4Q0F A;  4PQX A;  3N52 A;  2KVM A;  1KLU D;  5LMU L;  2FHT A;  3H3V C;  2A69 C;  1PH4 A;  4KKS A;  3TEH B;  4UHV A;  1XPR A;  1OXU A;  2RF4 A;  3NE5 B;  1T5E A;  2I5M X;  2K75 A;  3B6Y A;  1PZI D;  4AYB G;  3FMC A;  4A3M B;  1SYF A;  4DV5 Q;  2NZO A;  1PH2 A;  4LFA Q;  4JI3 L;  5CC4 A;  2A19 A;  5M9O A;  4NDX A;  4JI7 Q;  2E2H H;  3NSW A;  5C4J H;  4A3M G;  2EY2 A;  1MBY A;  3A0J A;  3A5Z B;  3UE0 A;  1KAW A;  3M9B A;  4JW0 A;  2Q8I B;  2PMZ E;  4R4C A;  2OCE A;  4G4K A;  1LM0 A;  1YBY A;  2EY1 A;  1CZG A;  1I94 L;  1MGS A;  2EJM A;  1VQJ A;  3CCJ A;  2D0P A;  4YWL A;  1WTX A;  1TWG B;  1JIC A;  5AFW A;  4KHP Q;  1DM0 B;  4CJ2 C;  4QCL A;  1OXT A;  2FMM A;  1R4Q B;  4L6T B;  1VQP A;  5E4X A;  1KLG D;  3RN5 A;  3GO5 A;  4HCS A;  1XWE A;  3H0G B;  1HUN A;  4A3D B;  2EZV A;  1RDP D;  3CCL A;  4P75 A;  1J6Q A;  4H7B A;  4YCV A;  4A3G H;  3WOE A;  2K03 A;  3MFY A;  2VUM B;  3CCS A;  4KD3 A;  3ZYY X;  4PZ6 A;  1NSN S;  1Q82 C;  1F9S A;  2R3Z A;  4WJW A;  3KUP A;  4HN7 A;  1CT1 D;  1NCV A;  2HDL A;  2I07 B;  4JI6 Q;  3PO2 B;  4FDB A;  1Q81 C;  4DV6 L;  4B3R Q;  2AWO A;  2B8G A;  2LY7 A;  5EJW A;  5BN4 A;  2IW3 A;  2L1B A;  3HOZ H;  1YNJ C;  4KMU C;  2JA8 B;  3D8G A;  4YCU A;  4HTH A;  3S15 B;  4MTN A;  4OEM B;  2I5L X;  1KDB A;  1I4Q A;  4O42 A;  2XTI A;  3DXJ C;  5C3E G;  4A3L G;  1IYV A;  1JQY D;  1SMX A;  1A8V A;  4LUV A;  1YNN D;  1XYI A;  1AE3 A;  4HED A;  2EJF C;  1WYD A;  4HMJ A;  1EWI A;  1KL9 A;  2B3G A;  1BR9 A;  1PTO F;  3PIO 3;  2ZTD A;  1GUS A;  1FNW A;  4RHS A;  3I4N H;  1NR4 A;  3GTL B;  3K0X A;  3EIV A;  4C3H G;  1LTB D;  4C3J G;  2EYM A;  1DGS A;  1Y8N B;  4GOP A;  1PH8 A;  2E5L L;  1U5K A;  1PTO D;  2ENB A;  3PO2 H;  3J81 i;  4P72 A;  5C3X A;  1JR0 D;  3KBG A;  3RN2 A;  1SR3 A;  1A3V A;  2K28 A;  1IBK Q;  4K8I A;  3TS2 A;  3TBI B;  2E2I H;  3DMU A;  3PO3 H;  3J80 c;  1B7Y B;  1C8C A;  5I2Y A;  2JE6 I;  1VF5 C;  3F1Z A;  2F0S A;  1XNR L;  3LX0 A;  3L3O C;  1Z9F A;  4ZKC B;  1BXT A;  1UE5 A;  3W1G A;  2E5L Q;  4LF5 Q;  1N33 Q;  2UU9 L;  3KF8 B;  4XIG S;  2MNA A;  4JI2 Q;  1QWY A;  4RCN A;  3K7A H;  2V1C C;  3HG9 A;  2F0E A;  3J80 E;  3I4O A;  3I72 A;  1SXT A;  4JI8 Q;  3NUC A;  4NKL A;  4DF7 A;  4DR2 Q;  4L5Q A;  1V43 A;  3AMU A;  1EQT A;  4RAU C;  1S3O A;  2XNA C;  1UNS A;  3M3Y H;  3FHW A;  2K5W A;  2R61 A;  3LWE A;  4AIM A;  3NP8 A;  5JEA J;  1UE1 A;  3M7G A;  2EYP A;  1TWH B;  2UXC Q;  4X66 L;  1K9M C;  1E7Z A;  2K05 A;  4DV1 Q;  4H44 C;  2WP8 J;  4X65 L;  1BBW A;  3E9I A;  1STB A;  1QVG A;  5NUC A;  2NYZ D;  4JI8 L;  3W2D A;  2Y0S E;  3RZD H;  2F0Q A;  3HKZ B;  2ZJP A;  4DR3 Q;  4IQZ A;  4FXD A;  4ALP A;  1EYA A;  3M7N A;  1ZYR C;  3DWQ A;  3GTG B;  4A3C H;  5IYB G;  3J7A V;  3CRL C;  3ULP A;  2XRS D;  2AWN A;  2R93 B;  2RQX A;  2PZW A;  1DOM A;  1SYG A;  4QMG A;  2NBF A;  1F77 A;  4RGT A;  4DV5 L;  1KTK A;  2Q2H A;  3X3N A;  2VUM G;  1D1K A;  5A2Q L;  4ZUJ A;  5C4J B;  1VMC A;  3H3V I;  2BA1 A;  4GLA C;  1XMQ Q;  1PRT C;  4NXN Q;  3TP8 A;  1BDO A;  3H0G G;  4BBR H;  1R9T B;  5AJ3 L;  5ELD A;  2K50 A;  1X3P A;  4DV4 Q;  3NTK A;  1U0L A;  2E2J H;  4DKA C;  4OEL B;  1K3R A;  1I94 Q;  1VQB A;  2NZH A;  2B63 H;  1CI3 M;  3BVM A;  2PNH A;  1N8R C;  3HKS A;  3HOX H;  3DWP A;  1KQS A;  1B53 A;  5M3M G;  2OTL A;  2L11 A;  1GHK A;  3K81 C;  1B9N A;  1JB3 A;  4HSP A;  1XMQ L;  4IFD J;  2KCN A;  3TP7 A;  3SDZ A;  2L15 A;  3UDX A;  1TVX A;  3I90 A;  5IE8 A;  4BA2 I;  1E2W A;  1ICW A;  2F0O A;  3CC4 A;  5IGF A;  3A7L A;  1LV9 A;  3G6J B;  1KNA A;  4FF1 A;  1E22 A;  1SNO A;  2B2W C;  3BDO A;  4QUF A;  5A2Q E;  5C4X B;  2PZU A;  1EY9 A;  3J81 j;  4V19 0;  3GTG H;  3HOV H;  2EYH A;  1RTO A;  2A6E C;  2F0N A;  1PA6 A;  2AKW B;  4HIK A;  1WTQ A;  3VYS A;  5C4X H;  1KNE A;  2UUB L;  1PTO C;  3VYU A;  1WOC A;  3HGB A;  1J8I A;  3QOL A;  5KND A;  2KBN A;  4R4O A;  1SN8 A;  2R92 B;  5EKL A;  1ZXT A;  3EA6 A;  3P7J A;  4F88 A;  1AP0 A;  4DGZ A;  2K5D A;  2XSC A;  1EUJ A;  2CQA A;  1WD0 A;  1LT4 D;  1E2Z A;  4GKJ L;  4DAY B;  3CC7 A;  4JYA L;  3C2P A;  4ZK9 B;  1SE2 A;  1PTO B;  1IYU A;  1PZJ D;  1HZ9 A;  4RHR A;  1SNQ A;  2D5D A;  1LT6 D;  2HIX A;  4JI4 L;  1KHI A;  5JJL A;  4A3D H;  5GRO A;  1BCP C;  1SYD A;  4JI0 Q;  2K14 A;  1LTL A;  1X6O A;  3I3C A;  4BBR G;  4LWC A;  1X65 A;  1EQV A;  1V1Q A;  5FO9 B;  2B2Y C;  4UP8 A;  4IPC A;  4GS3 A;  2KOL A;  3GD7 A;  3T56 B;  2F0W A;  5L37 A;  4LFC L;  5M3M H;  1G51 A;  2R92 G;  1I3Q H;  2MJ8 A;  5EQ0 A;  2YTX A;  3MA2 B;  2F0J A;  4RCO A;  3S2H H;  1CFM A;  2YV5 A;  3OIQ A;  4R4Q A;  4DK1 A;  5HGT A;  1I4R A;  1QUQ A;  2FIN B;  1N32 Q;  1HR0 W;  1YJW A;  2R93 G;  2YYZ A;  3NEN A;  3S2H B;  5D65 A;  1STN A;  1TS5 A;  2JA6 B;  2E2D C;  1D6E C;  4HIO A;  4DR2 L;  3STB C;  4DXF A;  5CV5 A;  2F3W A;  3VR2 A;  3L7Z C;  1R9T H;  4A3G B;  1HZB A;  1A63 A;  2ZT9 C;  3JC6 6;  4GLV B;  1G2S A;  3BZC A;  1BBX C;  1DOK A;  2O5J C;  1EIG A;  2JEA I;  4M1U B;  5BR8 L;  1EFW A;  3GTQ H;  1A2T A;  4Y52 H;  5JPN C;  4EX5 A;  3KJO A;  1S5C D;  4BBS H;  2N78 A;  3PUY A;  2NVT H;  2ZM6 Q;  1MKH A;  1X9N A;  1J5E L;  3CCM A;  3IRB A;  4O2D A;  3BJU A;  1JCK B;  3EBE A;  2NVQ H;  1QUQ B;  1I4H A;  2X6L A;  3CKI B;  2Z9H A;  3UE1 A;  2NTS A;  3GTJ B;  3FRP B;  3I8Z A;  1IZ6 A;  2CHB D;  3CQZ H;  2ASB A;  4A3M H;  1CSP A;  2WFW A;  2GVB A;  4FXK C;  4KKU A;  1CA6 A;  1KC8 C;  4EQ5 A;  1HNW L;  5F2D A;  2VY3 A;  2HHH L;  3I4N G;  3FPP A;  5CYU A;  5I6W A;  2AMC B;  4HR7 B;  5H1S E;  3I4M B;  3CAM A;  2CH4 W;  3E0E A;  3CPF A;  2VQF Q;  3K59 A;  3LWU A;  5IYC G;  4J15 A;  1Y1W H;  1YZ6 A;  2IJ0 A;  1RTN A;  5IP7 G;  3RD4 A;  2K32 A;  1HNZ Q;  1F2Y A;  4DV4 L;  3BZD B;  3CP0 A;  4DK0 A;  4YY3 L;  4RH6 A;  2NVQ B;  4YCW A;  1JOQ A;  2GN5 A;  1LTG D;  4IJL A;  4GOP B;  3SXH A;  2E8G A;  1FL0 A;  2K33 A;  1JJ2 A;  3OWF A;  1I50 H;  4POG A;  4FXG C;  1YIJ A;  3WWV A;  5GAH C;  3U4Z A;  1GM5 A;  4C3I B;  3CCE A;  5C5L A;  1EIF A;  1Z6H A;  1HNZ L;  2ATW A;  1ILP A;  1K0R A;  1SNP A;  2CW0 C;  1GUO A;  3U50 C;  2F1M A;  3L2P A;  1R4P B;  4I7Z C;  1ET9 A;  2UXB L;  4RG1 A;  4BS9 A;  1NNX A;  3Q6S A;  2RCN A;  4R4T A;  5FJ8 H;  2B2T C;  4DV0 L;  2M00 A;  4WRD A;  1NBW A;  2KCM A;  3NEM A;  2VNU D;  1LTS D;  3BVZ A;  2K04 A;  1JOO A;  2EYJ A;  2NN6 H;  4K5W A;  4BWG B;  3EN2 A;  2QIL A;  2VL6 A;  1E1O A;  1B3Q A;  2H5X A;  3M85 A;  1WCM B;  3BDL A;  4QF4 A;  1SE4 A;  1QJO A;  1EYG A;  3S16 B;  3HOW G;  4IZ8 A;  2XWJ B;  5IGC A;  1BNZ A;  2DY7 A;  2HDM A;  1YNX A;  1MJE A;  5JVG 3;  2JYO A;  4H13 C;  1K3B C;  3H6M A;  3DUZ A;  4GKJ Q;  3SHL A;  4JYA Q;  3KF6 A;  1HJP A;  4JI7 L;  2OT2 A;  4EQP A;  3SEB A;  1HZC A;  2IHF A;  1QVC A;  3R2I A;  5C44 H;  1LUZ A;  1ICF B;  2RDH A;  5M5X B;  5IWA L;  3ICE A;  1HXY D;  3HRZ C;  2O4X A;  2L0C A;  1ROD A;  4OIJ A;  3STB D;  3MTS A;  1PZK D;  1XTC D;  2NTT A;  1PLF A;  3KDF B;  1DJR D;  1TXY A;  2L9H A;  1RJT A;  3VDY A;  1HNX Q;  2BH2 A;  3AEV A;  3F2D A;  1Q7Y C;  4MZ9 A;  3S1R B;  5D14 A;  1B70 B;  4GNX A;  4J1M A;  4YWK A;  3CCU A;  4A75 A;  4KY6 A;  2JA5 H;  3I4N B;  2N8N A;  4IPD A;  3GTL H;  2KEC A;  2EJG C;  3OMG A;  5KNB A;  3HKZ G;  5CV9 A;  3GTQ B;  1QNK A;  4HJ9 A;  1EOT A;  4HMI A;  4HJ7 A;  1GJX A;  4KTA A;  2B8F A;  2Z4I A;  3NWS A;  4IFD I;  4IN3 A;  1NR2 A;  2QCP X;  4B3M Q;  2B2Y A;  5C5M A;  4DK6 C;  2QDB A;  1RF2 D;  2OQK A;  4LF4 Q;  1JE4 A;  3HOZ B;  2WB1 G;  1D5X C;  1CK1 A;  2ZTC A;  1PDQ A;  4ULL A;  5JAV A;  1BCP D;  1D5M C;  1U4M A;  5IT9 c;  2HIV A;  3K57 A;  4GNX B;  4OWT B;  2G9H D;  3BYT B;  2AHO B;  4UP7 A;  2JA7 B;  1TY2 A;  2EY5 A;  4L5T A;  3MXN A;  3I4M H;  4RGO S;  4C1N I;  3I7F A;  4I65 A;  1X3G A;  3KLR A;  1T5X D;  1OXV A;  2OQ0 A;  3CMA A;  1KAA A;  2R7Z G;  2F0H A;  3CXC A;  2J7Z A;  3OPO A;  5IP9 G;  1SSO A;  1HNW Q;  5I2X A;  3A5U A;  3I73 A;  3TSS A;  1IYJ B;  2F0F A;  1B8A A;  2IWH A;  3TZD A;  3NQI A;  1XJV A;  1JOR A;  4FYD A;  1QVF A;  3UDF A;  2BCO A;  1E1T A;  2X69 A;  3OMC A;  1TU2 B;  5IIF A;  1UUP A;  2UXD Q;  3G48 A;  4A3B G;  1YIT A;  1MSG A;  2NN6 I;  3R93 A;  5FLX L;  5D3I B;  5ELN A;  4JV5 Q;  3G6E A;  3MXU A;  3CCV A;  5C6A A;  2IPK D;  3DEP A;  1VMP A;  1VQA A;  2FMC A;  3OSO A;  1YHQ A;  3R8B A;  3F2B A;  2AUJ D;  5BN3 A;  4A3J H;  1YEZ A;  2NZ1 D;  4NW2 A;  5CV6 A;  1SRU A;  3HZX A;  3VR4 A;  4LF8 Q;  1E0B A;  1EQQ A;  2IHE A;  3A55 A;  3IL8 A;  1EU4 A;  3I70 A;  4C2M H;  3FDT A;  3GTK H;  4OL7 A;  1PH1 A;  1RD9 D;  3C3L A;  1F2Z A;  4XYO A;  4LF9 L;  1QOH A;  3UI2 A;  3HP3 A;  1JWM D;  1Y8P B;  2GA4 B;  4N9T A;  1ASZ A;  1PH3 A;  5IYD H;  1G2T A;  2PQA B;  3K5O A;  3QWN A;  2JK8 A;  4LW1 A;  1IW7 D;  4KKT A;  5T1G A;  3J81 E;  1JWS D;  3KK7 A;  1SNC A;  3PUW A;  3K7A B;  1V1P B;  1UEB A;  3D4R A;  1F9R A;  1K0S A;  3IAY A;  1ENF A;  1XPU A;  1AFP A;  1FYC A;  4OHJ A;  1YJ9 A;  4JK1 C;  1BCP F;  4CJ0 B;  4GLX A;  2BDN A;  5FLM H;  2MHV A;  5IY0 A;  2KED A;  3P1H A;  1I4G A;  3SGI A;  5C3W A;  2EY6 A;  2VB2 X;  5J1Z A;  3J80 i;  3S2D B;  2DNC A;  1Y1W B;  1CKO A;  2B2T A;  2J0T D;  4GNX C;  1S5D D;  3K5L A;  2FFK B;  2N55 A;  3A74 A;  3VR3 A;  1WVL A;  1W3S A;  1ASY A;  4A93 B;  4DNR B;  4KHP L;  4PMB A;  3T51 B;  4LK1 C;  4IFD H;  4NXN L;  1SFO B;  3FKI G;  2ES2 A;  3E0J A;  5JVH 3;  3Q22 A;  4A3I H;  1RHP A;  4BBS B;  3KYH C;  4BY1 B;  2M9V A;  5IWA Q;  2CWP A;  3E9H A;  5FK9 C;  3Q24 A;  3ULJ A;  1OXX K;  4K8J A;  3J81 L;  1WFQ A;  1SBB B;  4JI6 L;  2R7Z B;  5IOD A;  4DV6 Q;  1Q3L A;  4C1N K;  3TRZ A;  3E6Z X;  3IKJ A;  4Y7N H;  4G7Z C;  4PMC A;  1JWU D;  3ZJY C;  1PFS A;  5C4X G;  5JEA G;  4X3T A;  2LS0 1;  3K5N A;  5FLX E;  3FEW X;  2PQE A;  2IY5 B;  4GKK L;  1PMR A;  1NAP A;  2ZXP A;  3F2C A;  5EBC A;  1IXR A;  2WKC A;  3KJP A;  1STH A;  4IOC A;  3AFP A;  4P71 A;  4Z9C B;  4GZY C;  4BXX G;  1K83 H;  3A8I E;  2F0G A;  1VQE A;  1E3P A;  1WTP A;  3VR5 A;  3PUZ A;  3GV6 A;  2QW7 A;  3SVM A;  4LF4 L;  3H09 A;  1EY0 A;  2DUD A;  2ID0 A;  5D3D A;  4IUN A;  1SE3 A;  2LXJ A;  4XT1 B;  2CKZ B;  4KJN A;  1EY8 A;  4C3H B;  1FR3 A;  3GDE A;  2J4X A;  1JT8 A;  2VW9 A;  1LAB A;  2ZXR A;  3MVV A;  2NVY H;  4IUP A;  4OO1 G;  4C3H H;  4X3S A;  4XDX A;  4QJF A;  4OWX B;  3HOV B;  4YHH Q;  2WAQ B;  2A74 C;  5K36 H;  1XTD A;  1TWG H;  4HAE A;  1XNR Q;  2RSO A;  1B50 A;  3KLS X;  5G3L F;  5IYC H;  3M4Y A;  1SAP A;  2EE1 A;  3HFZ B;  3AYH B;  1Z47 A;  5IP7 H;  1ESR A;  1JJC B;  4IFD G;  3E5S A;  4JBM A;  1O78 A;  2R92 H;  3CHB D;  3J7Z C;  3HOX B;  4C3J B;  1GD7 A;  2DGY A;  4HIM A;  3G71 A;  1PYS B;  2F3V A;  4DR4 L;  4K6D A;  1PYB A;  3H94 A;  1VQG A;  5EAY A;  1VQO A;  4KI0 A;  4FVM A;  1HA6 A;  1ENC A;  1V1O A;  4HCE A;  3PGZ A;  4X3U A;  1TWA H;  4DR1 Q;  2NVY B;  3J7A F;  2K6A A;  4DNT B;  1SJH D;  5JJK A;  2HQL A;  1N32 L;  3SK8 A;  4JPB W;  4S3S A;  5JEA H;  1VQN A;  1D8L A;  1CKN A;  1YNJ D;  2CVR A;  2F3I A;  2L55 A;  1TQO A;  2B2V C;  1SFO H;  3OHX C;  4DR3 L;  1SMY D;  4K5V A;  2QDL A;  2Y0S G;  3P75 A;  2MO1 A;  4F8M A;  2L5T A;  2PNR C;  2B39 A;  4A3K H;  1A3T A;  5I4D A;  1BVS A;  2NN6 G;  1ESF A;  4DR1 L;  5G3L D;  5LL6 X;  3TZU A;  4TKO B;  5FO8 B;  5A35 A;  1CHQ D;  3A7A B;  2XN9 C;  1B3A A;  3EQL C;  3BU2 A;  1KDC A;  1O80 A;  2N88 A;  2BDO A;  4QGU A;  4X64 Q;  2JA6 H;  2VQE Q;  1IBM L;  3MXG A;  1QZG A;  3TDQ A;  4IUR A;  3KBX A;  4PZ7 A;  3EFX D;  4KN7 C;  4JI5 Q;  1VQ5 A;  3MEF A;  5DM6 3;  3SR1 A;  3D0F A;  4KLK A;  1VQF A;  5K5P A;  3ITP A;  3UDI A;  3PQI A;  5IGB A;  3JAM i;  1UWV A;  1ZEQ X;  4AH6 A;  1EEF D;  2Q8R E;  2NVX B;  4LJZ C;  3OWE B;  1OO9 B;  2O2L D;  2EXZ A; 
#chains in the Genus database with same CATH homology
 4DUY Q;  1YIJ A;  3WWV A;  5GAH C;  5LMN Q;  1PH7 A;  4DR5 L;  1X3E A;  3U4Z A;  2ZJR A;  1C7Y A;  4JI3 Q;  2VZA A;  3S1Q H;  2R7D A;  3OYY A;  1WJJ A;  1I5F A;  2R7F A;  3K8A A;  4RMF A;  2VQE L;  2LSS A;  3CCE A;  1GM5 A;  1EIF A;  2YU9 H;  1VQL A;  3PF5 A;  1WI5 A;  5LMU L;  1HNZ L;  2ZJQ A;  1FGU A;  5M5W H;  2ATW A;  3H3V H;  1K0R A;  4DR7 Q;  2I5H A;  3U50 C;  1N34 L;  3D31 A;  1PH4 A;  3BZK A;  3TEH B;  4IO9 A;  1XPR A;  1OXU A;  2RF4 A;  1L1O B;  2I5M X;  2K75 A;  3L2P A;  4JI1 Q;  2UXB L;  4RG1 A;  4BY7 H;  2RCN A;  4R4T A;  5FJ8 H;  3B6Y A;  5E7N A;  4DV0 L;  1E24 A;  4AYB G;  3H15 A;  4DV5 Q;  1NBW A;  2KCM A;  3FKI H;  2NZO A;  3NEM A;  3J81 c;  4DR5 Q;  1PH2 A;  4LFA Q;  3KLW A;  2VS1 A;  4JI3 L;  2PI2 E;  2VNU D;  4HID A;  2A19 A;  4JI7 Q;  3EN2 A;  4PG3 A;  2E2H H;  1VQK A;  5C4J H;  4A3M G;  2VL6 A;  1E1O A;  3A0J A;  3A5Z B;  3UE0 A;  5AJ3 Q;  1KAW A;  3M9B A;  5J3B A;  4DUZ Q;  2HT1 A;  4DR7 L;  2PMZ E;  2H5X A;  4R4C A;  2OCE A;  4UPA A;  4OO1 I;  3M85 A;  2B29 A;  4JG2 A;  1LM0 A;  4A3K G;  1YBY A;  2D0O A;  1VQD A;  1I94 L;  4GKK Q;  1EYG A;  1VQJ A;  3U4V A;  3CCJ A;  3HOW G;  2D0P A;  4UY8 C;  4YWL A;  2ALY B;  4OON A;  1YNX A;  4QY7 A;  1MJE A;  1FJG Q;  1NJI C;  4KHP Q;  1FVI A;  4DR6 L;  1Q1E A;  4L5S A;  4GKJ Q;  1OXT A;  4NB3 A;  4JYA Q;  3KF6 A;  5GAE C;  2QGQ A;  1OTC A;  4X62 Q;  1HJP A;  1VQP A;  4B3T L;  4JI7 L;  3RN5 A;  3T1Y Q;  2JA8 G;  3HOV G;  4QQB X;  3GO5 A;  5FJ8 G;  4DUZ L;  1HZC A;  2IHF A;  1QVC A;  3CCL A;  3S15 H;  2LXK A;  4A3G G;  2RHQ B;  4XTC S;  4P75 A;  5C44 H;  1LUZ A;  1WCM H;  4GN4 B;  1J6Q A;  2JA7 H;  1CKM A;  1W2B A;  5IWA L;  4YCV A;  3ICE A;  4A3G H;  1GKH A;  4HJ5 A;  3CCS A;  3STB D;  1WCM G;  4PZ6 A;  4C3J H;  1Q82 C;  3KDF B;  1TXY A;  5LMN W;  3VDY A;  1JMC A;  3PF4 A;  1HNX Q;  1I6H H;  2BH2 A;  3NBH B;  3CCQ A;  1K8A C;  4JI6 Q;  3F2D A;  4FDB A;  1Q81 C;  3DM3 A;  4YHH L;  4DV6 L;  4B3R Q;  1KRS A;  2AWO A;  1Q7Y C;  4WJ3 M;  2UUB Q;  4MZ9 A;  3ERS X;  3I55 A;  1B70 B;  4GNX A;  4A93 G;  4YWK A;  4B3T Q;  1PHJ A;  3CCU A;  4A75 A;  3HOZ H;  3HOW H;  4YCU A;  2JA5 H;  1CKN B;  2N8N A;  1EOV A;  4IPD A;  4MTN A;  5M5X H;  4BA1 I;  2I5L X;  3GTL H;  1NY4 A;  3HKZ G;  2XTI A;  4A3F H;  5C3E G;  4A3L G;  1SMX A;  1A8V A;  4LUV A;  1JB7 A;  2JA6 G;  1AE3 A;  4HJ9 A;  1WYD A;  3W5O A;  1EWI A;  1KL9 A;  2B3G A;  4HJ7 A;  2A8V A;  2ZTD A;  4DR4 Q;  3PCO B;  4GN3 B;  2QEX A;  4B3S Q;  4IFD I;  1K73 C;  5GQO A;  3I4N H;  1HNX L;  4B3M Q;  4DK6 C;  3K0X A;  1PVO A;  2BH8 A;  3EIV A;  4TQU S;  1XPO A;  2OQK A;  3CC2 A;  4LF4 Q;  1A62 A;  1NE3 A;  1SE8 A;  2KEN A;  4NXM L;  1Q8K A;  2IT1 A;  2WB1 G;  1DGS A;  3CME A;  4GOP A;  1PH8 A;  1NMG A;  4UP9 A;  2E5L L;  1N33 L;  1U5K A;  3PO2 H;  2ZTC A;  4JI0 L;  2R93 H;  1D7Q A;  5BR8 Q;  2D62 A;  3J81 i;  2OTJ A;  4TVA B;  1O7I A;  4P72 A;  1C0A A;  3RN2 A;  1SR3 A;  5IT9 c;  2HIV A;  4GNX B;  1IBK Q;  2C35 B;  4OWT B;  3TS2 A;  4JCV E;  4UP7 A;  2E2I H;  2AHO B;  4B3S L;  1YVC A;  4L5T A;  3PO3 H;  3J80 c;  1B7Y B;  3I4M H;  4B3M L;  3I7F A;  1MIU A;  1X3G A;  2JE6 I;  1VQM A;  1X55 A;  3HKZ E;  3F1Z A;  4LFC Q;  3CPW A;  1L1O C;  4O0A A;  1XNR L;  2WAQ E;  1OXV A;  1KRT A;  2OQ0 A;  4POF A;  3CMA A;  4DAM A;  4NXM Q;  4A3J G;  1Z9F A;  4A4I A;  1UE5 A;  3W1G A;  2KHI A;  4APV A;  1Q1B A;  2E5L Q;  4LF5 Q;  1N33 Q;  2UU9 L;  3J7A 5;  2R7Z G;  2A1A A;  3KF8 B;  4XIG S;  3CXC A;  2MNA A;  4LNQ A;  4JI2 Q;  5IP9 G;  3TS0 A;  4DV1 L;  2JEB I;  1HNW Q;  3A5U A;  4JOI C;  2R7Z H;  4X65 Q;  1BBU A;  3TQY A;  1N9W A;  4BXX H;  1IYJ B;  1X56 A;  2V1C C;  3K7A H;  4IPH A;  4R1J A;  5ELO A;  5IP9 H;  3I4O A;  4A76 A;  4JI8 Q;  1L0W A;  1B8A A;  4DR2 Q;  1XJV A;  4GOP C;  2CFM A;  4X64 L;  4L5Q A;  1QVF A;  3UDF A;  1E1T A;  4X6A H;  1V43 A;  1PH6 A;  3S1R H;  3RLF A;  2ZTE A;  2FXQ A;  1IBM Q;  2Q2T A;  1UE7 A;  1S3O A;  3M3Y H;  1CSQ A;  3FHW A;  4AQY L;  3M4O H;  2UXD Q;  3G48 A;  4A3B G;  3MXN B;  4JI5 L;  1YIT A;  4LF7 Q;  2NN6 I;  4AIM A;  5C3E H;  4A3L H;  5JEA J;  1UE1 A;  5HGQ A;  5ELN A;  3I4M G;  4A93 H;  2UXC Q;  1HZA A;  3RR5 A;  4X66 L;  4YY3 Q;  1E7Z A;  3NEL A;  3I56 A;  3G6E A;  3CCV A;  1K9M C;  4DV1 Q;  4A3B H;  5C0X G;  2YTV A;  2WP8 J;  1VQA A;  2K4K A;  4X65 L;  1BBW A;  4DV7 L;  1YHQ A;  3LGJ A;  4A3D G;  1NMF A;  2GVA A;  3E9I A;  3F2B A;  4A3J H;  1QVG A;  1YEZ A;  4JC0 A;  2Y0S E;  4JI8 L;  5M3F H;  4DUY L;  4HJA A;  1SRU A;  2QA4 A;  3RZD H;  1J5E Q;  3PSI A;  4LF8 Q;  3RZO H;  5LMN L;  1C9O A;  2IHE A;  1EQQ A;  2F4V Q;  3S1M H;  2ZJP A;  4DR3 Q;  3PV0 A;  4C2M H;  4ALP A;  2JA7 G;  3M7N A;  5M5Y H;  3GTK H;  1SLJ A;  4P73 A;  1PH1 A;  2UXD L;  4A3C H;  3M4P A;  5IYB G;  2RHS B;  3ULP A;  1JE5 A;  4LF9 L;  2AWN A;  4HJ8 A;  4BY1 G;  1HR0 Q;  1ASZ A;  3GTO H;  4H02 A;  1PH3 A;  5IYD H;  4JI1 L;  4JOI A;  2PQA B;  4IPG A;  2NVX H;  2UUA Q;  1N36 Q;  2JK8 A;  4LW1 A;  2HHH Q;  4DV7 Q;  3PO3 G;  3AFQ A;  5IYD G;  4A3I G;  4DV5 L;  2Q2H A;  1VQ9 A;  2VUM G;  3PUW A;  2JA5 G;  4LF8 L;  1UEB A;  2JQO A;  3H3V I;  2YTY A;  2VQF L;  2BA1 A;  4GLA C;  1IL2 A;  3PUX A;  1XMQ Q;  1M90 C;  1XPU A;  1YJ9 A;  4NXN Q;  3H0G G;  4BBR H;  4GLX A;  1PH9 A;  5FLM H;  5AJ3 L;  2K50 A;  5IY0 A;  4DV4 Q;  1P8L A;  1SRO A;  3SGI A;  3J80 i;  4DNI A;  3FP9 A;  1U0L A;  1HR0 L;  2MFI A;  4DKA C;  2E2J H;  1CKO A;  3GTM H;  1K3R A;  1I94 Q;  1VQB A;  2NZH A;  2B63 H;  1RL2 A;  1GO3 E;  4GNX C;  3OTO L;  2PNH A;  2JA8 H;  1YJN A;  1N8R C;  3HKS A;  3HOX H;  4DV2 Q;  3A74 A;  5HY6 A;  1KQS A;  1W3S A;  1ASY A;  1FJG L;  5M3M G;  2OTL A;  2CQO A;  4KHP L;  4DR6 Q;  2PQA A;  3K81 C;  3W1B A;  3RLO A;  1XMQ L;  3GTJ H;  4X62 L;  4A3E G;  4NXN L;  1VCI A;  3T1Y L;  4IFD J;  3FKI G;  3S24 A;  2ES2 A;  2OWO A;  1PH5 A;  2L15 A;  5GAD C;  3UDX A;  4A3I H;  1Y1V H;  5IE8 A;  1VS0 A;  3KF6 B;  3KYH C;  4BA2 I;  5JJI A;  3CC4 A;  5IWA Q;  2CWP A;  3E9H A;  2UXB Q;  3UDG A;  2EXD A;  3M4Q A;  3OTO Q;  1LYL A;  3ULJ A;  1E22 A;  4DV2 L;  1S40 A;  1OXX K;  4DV0 Q;  4YWM A;  5FLM G;  3J81 j;  1WFQ A;  3GTG H;  3HOV H;  1YI2 A;  3CCR A;  4JI6 L;  3KFU A;  2XGT A;  4DV6 Q;  4LFA L;  1PA6 A;  2AKW B;  4HIK A;  3TRZ A;  5C4X H;  2UUB L;  3OW2 A;  4LUZ A;  4A3C G;  4Y7N H;  3ZJY C;  1PFS A;  1WOC A;  4JI4 Q;  4K0K Q;  5C4X G;  5JEA G;  2Z0S A;  3I2Z A;  1Y1W G;  2IY5 B;  2KBN A;  4R4O A;  1SN8 A;  1EQR A;  5C0X J;  4GKK L;  1JJG A;  3F2C A;  2UUC L;  3AEV A;  1H95 A;  2N49 A;  1IXR A;  2VUM H;  3KJP A;  1X3F A;  4IOC A;  3AFP A;  4P71 A;  4NPS A;  1EIY B;  4LFB L;  1EUJ A;  1VQ6 A;  4BXX G;  5GAG C;  1K83 H;  1VQE A;  4GKJ L;  1E3P A;  4DAY B;  3CC7 A;  4JYA L;  5FLX c;  4WJ4 A;  3PUZ A;  2K52 A;  3S1N H;  4LF4 L;  4PMW A;  2DUD A;  2ID0 A;  1HZ9 A;  1BKB A;  2HIX A;  4JI4 L;  1KHI A;  4KHZ A;  4K0K L;  5JJL A;  3KDF A;  4A3D H;  2LXJ A;  2CKZ B;  4OWW B;  5GRO A;  4JI0 Q;  1CUK A;  3GTP H;  2K14 A;  1LTL A;  2MO0 A;  3PIO A;  1X6O A;  4OXP A;  2Q2I A;  3GDE A;  4BBR G;  2UUC Q;  1JT8 A;  2VW9 A;  1X65 A;  4LWC A;  1P16 A;  1V1Q A;  2MQH A;  2NVY H;  4OO1 G;  3T1H Q;  4UP8 A;  4IPC A;  4C3H H;  4DK3 C;  4GS3 A;  3DLL A;  4LFB Q;  4IOA A;  3GD7 A;  2JA9 A;  1L2F A;  1TWF H;  4QJF A;  4OWX B;  2CCZ A;  4B3R L;  4QIW E;  4A3E H;  4YHH Q;  3S16 H;  5M3F G;  1NTG A;  1XTD A;  2BA0 A;  3PUV A;  1TWG H;  1L1O A;  4LFC L;  1G29 1;  1Y14 B;  3TRE A;  3CF5 A;  1XNR Q;  4BBS G;  1VQC A;  5M3M H;  1Y1V G;  1PV4 A;  1G51 A;  1RIP A;  4JBJ A;  5IYC H;  4OX9 L;  1V9P A;  2R92 G;  1I3Q H;  3HOU H;  2YTX A;  3HFZ B;  3AYH B;  1Z47 A;  3L0O A;  5IP7 H;  4PZ8 A;  3S2H H;  2YV5 A;  1KXL A;  1JJC B;  2K5H A;  4R4Q A;  2CWA A;  4JBM A;  4IFD G;  1QUQ A;  2R92 H;  1N32 Q;  1IBL L;  1OXS C;  2N3S A;  2F52 A;  3J7Z C;  3Q8D A;  1YJW A;  1HR0 W;  1UE6 A;  3ULL A;  4JV5 Q;  2YYZ A;  1GD7 A;  3NEN A;  3HOZ G;  2R93 G;  4JBK A;  2DGY A;  4QL5 A;  3G71 A;  1PYS B;  4HIM A;  3T1H L;  4DR4 L;  2KCT A;  2ZM6 L;  1PYB A;  4HIO A;  1G6P A;  2Z6K A;  4DR2 L;  3KOJ A;  1VQG A;  3STB C;  1Q46 A;  1KD1 C;  3S2D H;  5EAY A;  2WAQ G;  1AE2 A;  1T9H A;  1VQO A;  2K5V A;  4KI0 A;  4A3F G;  3L7Z C;  1R9T H;  3PIP A;  1HZB A;  1A63 A;  3JC6 6;  4GLV B;  2IX1 A;  3CD6 A;  4AQY Q;  4BY7 G;  4OX9 Q;  3PGZ A;  3BZC A;  1M1K C;  3RNU A;  4LF7 L;  3K80 C;  1TWA H;  4DR1 Q;  3CW2 C;  2JEA I;  3H0G H;  1Q86 C;  5BR8 L;  5JJK A;  1KIX A;  1EFW A;  4JV5 L;  2HQL A;  3JAM c;  3GTQ H;  1N32 L;  5K36 G;  1IBL Q;  4Y52 H;  1XMO Q;  1XNQ L;  4EX5 A;  2KHJ A;  1Q12 A;  3KJO A;  1VQ4 A;  2N78 A;  3PUY A;  3F8T A;  5C44 G;  1IBK L;  2B63 G;  2NVT H;  4BBS H;  1AH9 A;  1VQN A;  1D8L A;  4AYB E;  2ZM6 Q;  1CKN A;  2F3I A;  3K7U C;  1MKH A;  3HOX G;  2F4V L;  4BY1 H;  1X9N A;  1J5E L;  3HOY G;  1A0I A;  3PO2 G;  5C0X I;  1SFO H;  3CCM A;  4DR3 L;  1YHB A;  4IJH A;  1QZH A;  2Y0S G;  3IRB A;  2MO1 A;  4O2D A;  3BJU A;  1VQH A;  3EBE A;  4DPG A;  2NVQ H;  4A3K H;  1QUQ B;  3S17 H;  5DLQ E;  1S72 A;  4MNO A;  3HOY H;  3UE1 A;  3G4S A;  1YHA A;  1BVS A;  2NN6 G;  1IZ6 A;  3CQZ H;  4JBW A;  2ASB A;  4LF6 L;  4DR1 L;  4LF5 L;  4A3M H;  4LF9 Q;  2UU9 Q;  1CSP A;  2WFW A;  3RLN A;  1K8G A;  4GN5 A;  2GVB A;  4R4I A;  4JI2 L;  4DV3 Q;  1GVP A;  2WB1 E;  1KC8 C;  3AQQ A;  4EQ5 A;  1HNW L;  2UUA L;  3S14 H;  1XMO L;  1N36 L;  1XNQ Q;  2EQS A;  1VQI A;  2VY3 A;  2HHH L;  3I4N G;  2K5N A;  2PI2 A;  2AMC B;  3BU2 A;  2JJQ A;  2Z6K C;  5H1S E;  4QGU A;  3CAM A;  1TWC H;  3E0E A;  4X64 Q;  3CPF A;  2JA6 H;  2VQF Q;  5IYC G;  2VQE Q;  4J15 A;  1QZG A;  2EIF A;  1Y1W H;  1IBM L;  1YZ6 A;  1TWH H;  1VQ7 A;  5IP7 G;  5LMU Q;  2IX0 A;  4C3I H;  1HNZ Q;  4PZ7 A;  4L5R C;  1HH2 P;  4JI5 Q;  4LF6 Q;  1N34 Q;  4DV4 L;  3MEF A;  3CP0 A;  3U58 A;  1VQ5 A;  1MJC A;  3D0F A;  4KLK A;  2UXC L;  4P74 A;  1VQF A;  4YY3 L;  4X66 Q;  4DV3 L;  1VQ8 A;  2Q2U A;  3UDI A;  5IYB H;  4YCW A;  1X54 A;  3JAM i;  1UWV A;  3ER0 A;  2GN5 A;  4IJL A;  4AH6 A;  4GOP B;  4LUO A;  2I0Q A;  3HOU G;  2R6G A;  2E8G A;  1FL0 A;  1JJ2 A;  4ME3 A;  4POG A;  1I50 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...