1FJGL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
125
structure length
125
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fjgL00
1WI5A 3J81j 4DR1Q 4HJ5A 1AE3A 4A3DH 4A3GH 1RL2A 2WP8J 1HZCA 3BU2A 4HIKA 1VQ4A 4P73A 2BH2A 1I94L 2YTXA 3M85A 1S3OA 4DV0Q 4X64Q 2OQ0A 5C0XJ 3CCVA 4OX9Q 5IYDG 2JE6I 3KFUA 3CMEA 5LMUL 2UU9Q 2FXQA 4A3IG 1EYGA 1UE1A 4L5RC 1E22A 4JI2Q 1HNXQ 4JI4Q 1VQJA 2ZTCA 4LUVA 3F2CA 4A93G 2B29A 5LMNW 1RIPA 3EN2A 2UXCL 4TVAB 4JG2A 2K4KA 4DKAC 4JI0L 2JA7G 3NEMA 4BY7G 1EQQA 2EIFA 3BZKA 4ALPA 3KJPA 1H95A 1P8LA 4LFBQ 3ULJA 3M3YH 4IPHA 3GTGH 1U0LA 1YEZA 2K52A 4A75A 4X6AH 2JA9A 1YJ9A 3J7ZC 4TQUS 5IP7H 2K50A 2L15A 2VQFQ 1J5EQ 2K5HA 1I3QH 3I4MG 3EIVA 3TS2A 4A3LG 2NZHA 4R4IA 1Q8KA 3NBHB 4A3KG 1EUJA 2K14A 1X56A 4H02A 4GNXB 4R1JA 3KDFA 1IYJB 1Y14B 1KIXA 4A3FH 1CUKA 1Y1VG 2A19A 1Y1WH 1N33Q 3KF6A 3S2HH 3L0OA 4A4IA 3UE0A 2NVXH 2WAQE 4DAMA 4X62L 1K8GA 5FJ8H 3UDIA 1VQ9A 4JI8Q 5H1SE 1HR0W 2ZTDA 2B3GA 5IP9G 1N8RC 3PO3G 1B8AA 4DK6C 4DV4Q 2CQOA 4A3JH 5LMNQ 4B3SQ 1E1TA 4JI5L 4IOAA 1XMQQ 1FJGQ 2Y0SE 3ICEA 4GN3B 1BBWA 2PQAA 4QL5A 1SRUA 1TXYA 3HFZB 1QUQA 1SR3A 5DLQE 2KCTA 4DUZQ 1VQHA 4NXNL 2JA8G 3S1MH 1OXXK 3PGZA 5E7NA 4JI3L 1Q1EA 2YTYA 1N9WA 1I5FA 4PZ7A 2PMZE 4BY1H 3I4NH 1SMXA 2GVAA 4LFAQ 1X9NA 4JYAQ 2E5LL 2N49A 1XPUA 4A3GG 2IX0A 3PCOB 4B3TL 1IZ6A 2VS1A 3I2ZA 4YWLA 4LW1A 1PH6A 4IJHA 4JI1L 3W1BA 4GLVB 3ERSX 4HJ8A 4EX5A 1KQSA 1NMFA 5BR8Q 2HT1A 1Z9FA 2OQKA 4A3EG 1BVSA 1R9TH 3STBD 1Q82C 4DV3L 4GN5A 1VQ7A 2QEXA 4A3IH 5M3FG 2F3IA 4UP9A 3M4QA 4QY7A 1NJIC 1GM5A 1HR0Q 4X66L 1VQ6A 4JOIA 5FLXc 2ZJRA 4A93H 4POGA 3HKSA 4DK3C 3S16H 3WWVA 1A8VA 5IWAL 4DV1L 3RZDH 1S40A 3K7UC 1VQOA 3S1QH 4BY7H 3AFQA 2JA7H 5GAHC 1UE5A 3PF5A 5ELOA 4C3HH 1SLJA 1I94Q 1B70B 3OTOL 3I7FA 2MQHA 4KHPL 1L1OC 4IPDA 2RF4A 1YNXA 4JI6L 1HNWQ 3AFPA 5J3BA 4X65Q 4R4TA 4J15A 2AWNA 1SROA 2DGYA 4Y7NH 3J80c 4A3KH 2E2JH 1VQ8A 2PQAB 3E0EA 3E9HA 1Q81C 2PI2E 2R6GA 3UDXA 3KYHC 4APVA 1Y1VH 1NBWA 1K8AC 2R92G 1BBUA 1FGUA 2VW9A 2D0OA 1D8LA 5C0XG 1T9HA 4NXML 1N32Q 2ZJPA 2AMCB 3F8TA 4DR2L 2K5NA 1XPOA 1PA6A 4DV7Q 3UDGA 1PV4A 3CCEA 1M90C 4JI7L 3CD6A 2K5VA 3GDEA 1X3GA 4DV5L 3TRZA 1E3PA 1SFOH 2NVQH 2Z6KA 3HKZE 5IP9H 3PO3H 4YCUA 3PUWA 1OTCA 1W3SA 3AQQA 2RHQB 5GAEC 1X3EA 4KI0A 4GNXA 3W5OA 4LFCL 4K0KQ 2JA8H 2WB1G 1XNRQ 1A0IA 3I4OA 4GOPC 2I5MX 2PI2A 3CCRA 1UE6A 3K81C 4XTCS 1VQNA 2I5LX 3A5UA 1C0AA 4OONA 3U4ZA 3DM3A 3GD7A 1N34Q 1CSQA 3CQZH 5IYCG 4BXXH 3ZJYC 1U5KA 1VQAA 1WOCA 4IPGA 3ULPA 1Q7YC 4B3ML 1ASZA 4JI5Q 4DUYL 4GS3A 4LF8L 4LF5Q 4MTNA 4DR3L 1KAWA 4A3EH 5JJIA 1PH2A 1YJWA 1P16A 2OWOA 3HOYG 3CCQA 2AHOB 4C3IH 1K73C 1M1KC 3M7NA 1TWHH 2N8NA 4JI3Q 1SN8A 5M3FH 3H3VH 4DR7L 4HIOA 1SE8A 2UXBL 1EQRA 3RLFA 3U58A 4LF4L 2HQLA 1DGSA 3U4VA 4DAYB 2ZM6Q 1C9OA 3CF5A 2YTVA 3G71A 3GO5A 3H3VI 4UP7A 1X3FA 1NMGA 5AJ3L 4OXPA 4P75A 3T1YL 4PG3A 3CCJA 1IBML 1JJGA 2CKZB 2NVYH 4IPCA 3I56A 3HOWG 4MZ9A 1IBLL 1QVFA 4WJ4A 1XPRA 1HNZL 3CC7A 4JC0A 4YY3Q 3CW2C 4YHHQ 1FL0A 2HIXA 4B3RQ 1HZ9A 2I5HA 1IBKL 2HIVA 4IFDJ 2KCMA 2E2IH 2JQOA 2R92H 4A3CG 2KHIA 1KRSA 1HJPA 1W2BA 1QVGA 2ZJQA 4JV5L 2KENA 3PUVA 1E7ZA 2EQSA 1I50H 5IYBG 3U50C 3PUZA 1YITA 1N36Q 5JJKA 3UE1A 4C3JH 1EIFA 2CWAA 2YU9H 4L5TA 4UY8C 3PO2G 2JA6G 4DR4L 4KHPQ 4JI6Q 3H0GG 5IY0A 3L7ZC 4DR5Q 2XGTA 1PH9A 3PSIA 5EAYA 5C0XI 1VQLA 3M4OH 2UXDQ 2B63G 2F4VL 2VQEL 2LXJA 3PV0A 4JBMA 1GVPA 2JA5G 1CKNB 3AYHB 4KHZA 3OW2A 3MXNB 1PH5A 2JEBI 4GKJQ 4WJ3M 1JT8A 4NXMQ 1OXUA 4DR1L 4BXXG 3CXCA 4DV6L 4DV5Q 5IYCH 3GTPH 4OO1G 3GTKH 4BA2I 4OX9L 4X64L 5M3MH 3JAMi 2K75A 3F2DA 1K83H 4O0AA 2HHHQ 1LM0A 4JCVE 2UU9L 1D7QA 4AYBG 2F52A 4DR6Q 1KXLA 3HOYH 3HOXG 5ELNA 4LFCQ 3IRBA 4JI2L 2H5XA 3KOJA 3AEVA 1AE2A 3KF8B 3CPFA 1LYLA 4LF7L 1E1OA 3J7A5 2VUMG 5GAGC 3G6EA 2UUCL 1JJ2A 3STBC 4P71A 3NENA 3HOZG 3MEFA 4DUYQ 4LF8Q 2UUAL 2CCZA 2AKWB 3CMAA 2VQFL 4UPAA 5LMUQ 4A76A 2Q2IA 3A0JA 1J5EL 1OXSC 2PNHA 2E8GA 1CKOA 1L1OA 1UWVA 4DV2L 4PMWA 1JB7A 3HOWH 5C4XG 1XMOL 3S14H 2Z0SA 2VZAA 1PH4A 5JEAJ 1VQGA 2CWPA 4BBSG 2UXCQ 1PYSB 2MNAA 1LTLA 2A1AA 1TWFH 3LGJA 2DUDA 5GROA 4IO9A 3TREA 4JI0Q 4LF9L 2R7ZH 1XTDA 4R4OA 2VNUD 3KLWA 5GADC 4QGUA 2KHJA 5HY6A 4DPGA 2BA1A 5IYBH 5AJ3Q 4GKKL 3CC2A 1GO3E 1IBMQ 1XJVA 3PO2H 2ES2A 4B3SL 2VL6A 5LMNL 2JA6H 2WFWA 2JEAI 1VQCA 3TS0A 4HJ9A 4YCWA 1PH1A 3H0GH 4JBWA 1MJCA 1FJGL 1QZHA 2OCEA 2C35B 5M5YH 2EXDA 2B63H 3D0FA 5C3EG 4RMFA 2V1CC 4MNOA 2JA5H 1K0RA 4GLXA 2WAQG 4NPSA 3S24A 4LFAL 2QGQA 4P74A 1OXTA 4JYAL 1TWCH 4X62Q 3EBEA 4GOPA 3K8AA 2ZTEA 4YWMA 4EQ5A 1L0WA 4JV5Q 1YVCA 2R93G 2GN5A 3A74A 3CPWA 2QA4A 3GTQH 3GTOH 1HZAA 4QQBX 2Y0SG 2ALYB 4BA1I 5M3MG 3PIOA 3FP9A 4HIMA 1HZBA 4LWCA 3M9BA 5BR8L 1PVOA 2I0QA 2IHFA 1AH9A 1JE5A 1B7YB 3GTJH 2F4VQ 3RLNA 4UP8A 4IFDG 4YCVA 3CC4A 4XIGS 1CKNA 2BH8A 4NXNQ 4L5QA 1PH8A 3HOXH 3PF4A 1L1OB 1IL2A 3CAMA 4LUZA 1E24A 4OO1I 1L2FA 1XNQL 2YYZA 1CSPA 2E5LQ 2R7FA 3S1NH 3G48A 4BBRG 1WJJA 4B3TQ 2VUMH 4JBJA 1JMCA 1Q86C 1X54A 3PUXA 1MKHA 2CFMA 4P72A 4DNIA 2N78A 4DV6Q 4HIDA 4JI1Q 4KLKA 2AWOA 1MJEA 2YV5A 1A62A 5C44G 3HOZH 2N3SA 3OYYA 2KBNA 1V1QA 1HNWL 4DV3Q 1VQBA 4X65L 1VQEA 4PZ6A 1ASYA 5C4XH 4X66Q 4QJFA 5HGQA 1K3RA 1PHJA 4LF7Q 2R7ZG 1G51A 5IWAQ 1K9MC 4DV1Q 4BBSH 3FHWA 4AQYL 3K80C 4A3CH 3S2DH 3T1HL 4GLAC 5C4JH 2UUCQ 3GTLH 1N32L 2HHHL 3VDYA 3Q8DA 4DV7L 3OTOQ 4GOPB 3HOUH 4RG1A 1YIJA 1PH7A 4OWXB 3UDFA 2NN6G 2UUAQ 3ER0A 3HOVH 1CKMA 1X55A 2D62A 2UUBL 4IOCA 3F2BA 4LF6L 1QZGA 4DV2Q 3FKIG 5IT9c 2Q2HA 1Q12A 2LXKA 4NB3A 4HJAA 1YJNA 1XMOQ 2MFIA 1VQPA 1JJCB 1WCMG 2IX1A 1I6HH 1YHBA 1WFQA 4K0KL 5C3EH 1XNRL 3J81i 3BJUA 3TEHB 4LF9Q 3RZOH 5FLMG 2WB1E 1LUZA 2MO1A 2R7DA 1X6OA 3RR5A 1BKBA 2VY3A 4DR2Q 4GKKQ 4A3MG 1C7YA 1NE3A 3JC66 4JI7Q 3HKZG 3PIPA 4JBKA 1HH2P 1VQDA 1N34L 1Q1BA 3CP0A 4GN4B 3NELA 1EIYB 2R93H 3CCSA 3RNUA 4DV0L 4A3BG 5JEAG 4LF5L 1X65A 1PYBA 2E2HH 2XTIA 3RN2A 1NY4A 1HNXL 4JI4L 1VQFA 1YZ6A 3J80i 3H15A 2OTLA 3K0XA 4LNQA 2NVTH 1TWAH 1G6PA 3A5ZB 3TQYA 4HJ7A 1YI2A 3ULLA 1KHIA 4A3DG 4BBRH 2IT1A 3S15H 4IFDI 2ZM6L 3CCMA 4OWTB 4B3MQ 5JJLA 3RN5A 3CCUA 4LFBL 1O7IA 1VQKA 5C44H 4DR3Q 4IJLA 1EWIA 1VCIA 1VQIA 4QIWE 3F1ZA 4YWKA 3SGIA 5IYDH 4JOIC 4POFA 3B6YA 2IY5B 1KL9A 4R4QA 1IXRA 3S1RH 3J81c 4DR7Q 5M5WH 3S17H 1KRTA 4YY3L 4O2DA 4YHHL 4B3RL 1XNQQ 2UXBQ 3DLLA 4LF4Q 1N33L 1Q46A 3E9IA 1TWGH 3KDFB 3G4SA 2JJQA 3M4PA 3KF6B 4AIMA 1QVCA 2RHSB 1OXVA 3HOUG 1G291 4JI8L 1N36L 3JAMc 2ASBA 1FVIA 3T1YQ 3GTMH 1Z47A 3HOVG 5IP7G 1PH3A 3W1GA 4DV4L 1PFSA 1V9PA 2OTJA 1J6QA 1XMQL 2A8VA 4A3LH 4Y52H 3I4MH 4LUOA 4DR5L 4AH6A 5GQOA 1IBLQ 1YHQA 2ATWA 3FKIH 1A63A 2BA0A 2UXDL 1HNZQ 2Q2TA 3KJOA 4DUZL 4A3FG 1WCMH 1Y1WG 1IBKQ 1S72A 1QUQB 1YHAA 2NN6I 4AQYQ 4OWWB 3I55A 5FLMH 4GKJL 3T1HQ 5FJ8G 1MIUA 1YBYA 1UE7A 2Z6KC 3BZCA 4C2MH 2GVBA 2Q2UA 2MO0A 4FDBA 4ME3A 4A3MH 1KD1C 1VQ5A 1WYDA 1VS0A 4PZ8A 1KC8C 4DR4Q 4A3JG 1VQMA 4GNXC 3CCLA 5IE8A 3PUYA 1V43A 1UEBA 3RLOA 2IHEA 1EFWA 1NTGA 2UUBQ 4R4CA 4LF6Q 3D31A 4A3BH 1GKHA 2JK8A 2LSSA 3K7AH 2RCNA 2VQEQ 2D0PA 4DR6L 1EOVA 3L2PA 5M5XH 1GD7A 4AYBE 3I4NG 4BY1G 1HR0L 2ID0A 4L5SA 2NZOA 5K36G
chains in the Genus database with same CATH superfamily
2F0OA 1BOSA 2CW0C 2BH2A 2C9OA 3M85A 4DV0Q 4OX9Q 4QMGA 1LTBD 3KFUA 5D3IB 1UE1A 4L5RC 4JI4Q 5EQ0A 2XWBB 4B08A 2F0LA 4J1MA 4E6IA 5CV5A 4TVAB 1PRTD 4JG2A 1EQQA 3S17B 3QG1A 1S5FD 1TWFB 3ULJA 3M3YH 4IPHA 3GTGH 1YEZA 2K52A 1YJ9A 5DAUA 1RTOA 5IP7H 3P75A 3I4MG 3TS2A 3EIVA 1DOLA 3OPOA 1EUJA 1Y14B 1KIXA 3D4RA 5COYA 4J6HA 3J81E 3L0OA 2P5ZX 3UE0A 2NVXH 1VQ9A 3KLSX 1MGSA 1HR0W 2JA5B 5CBAE 1CT1D 3R3OA 3P20A 4A3JH 4B9WA 4OGQC 3BYYB 3BDLA 1XMQQ 1JWSD 3ITPA 1SYGA 5D3DA 2ICIA 3NK9A 4QL5A 5J39A 1SRUA 1CA5A 4ZYSA 1HCZA 1IL8A 2K7VA 2ZXPA 1VQHA 2B2TA 4NXNL 1OXXK 3PGZA 5E7NA 4LFAQ 2E74C 2GVAA 2R61A 2TMPA 1XPUA 4AYBB 4A3GG 1CHQD 3PCOB 3T13A 4F7XA 1C8CA 4B3TL 3HOXB 1G6ZA 4YWLA 4LW1A 5DM73 3ND9A 4JW0A 1QCBD 3ERSX 4HJ8A 2VUMB 1Z9FA 2K03A 3H91A 1GJXA 4QB4A 3WOFA 4X66L 4HN7A 5L37A 5FLXc 2OXPA 2ZJRA 4FP5D 2G9HD 3DXJC 5C5MA 4DK3C 3WWVA 4DV1L 3VR2A 4BY7H 2TSSA 1BCPF 5GAHC 1EQTA 5ELOA 3R93A 5IODA 1B9MA 1B70B 1SNQA 3OTOL 1TS5A 3I7FA 2MQHA 2Z9HA 4QUCA 1YNXA 4JI6L 4RAUC 2IL8A 3HOUB 3MHBA 1SROA 1CQVA 4RA8A 4KV6A 1VQ8A 3H6MA 5CMDA 2IWHA 2CHBD 5EBDA 2PI2E 3TP5A 1S4ZA 2VW9A 4R8IA 2L4NA 1T9HA 5A2QL 4GKKL 1I6HB 2K5NA 2K5VA 1I4XA 2NVQH 3HKZE 4B9XA 4FNFA 3NBHA 4YCUA 2B2UC 1OTCA 1D5ZC 4KI0A 1FR3A 1XNRQ 1A0IA 1PLFA 3I4OA 2EYOA 4U68A 3A5UA 3CHBD 1E0BA 1SYEA 4OONA 4BXXH 3CQZH 2KOLA 1U5KA 1B9NA 2F0DA 3ULPA 1E2WA 4DU9A 3EROA 1QG7A 2CW0D 1EYDA 1F2LA 4GS3A 4A3EH 3T53B 1KAWA 1YJWA 2OWOA 2FMCA 4HMIA 3HOYG 1M1KC 4C3IH 4DR7L 3H3VH 5M3FH 4RCOA 1EY5A 1EQRA 3L9AX 2QF7A 2HQLA 4CKEA 4UAIA 5ELBA 1C9OA 1JB3A 3CF5A 3G71A 3ND8A 5EKIA 1TWGB 4H13C 5AJ3L 2KJXA 1IBML 1AZQA 3VYRA 1B4OA 3I56A 3QOJA 3H3VC 1DD2A 4JC0A 4YY3Q 3S9WA 3I4MB 1V8QA 2J0TD 5EPLA 3FKIB 2E2IH 4IFDJ 2E2JB 2JSOA 4N8FA 1LO5D 1WCMB 3AMUA 4JV5L 1N36Q 1I50H 1LT4D 2BDOA 3N6RA 3QO2A 4UY8C 3PO2G 4DR4L 4JI6Q 1HFGA 5I9OA 2AQ3B 2WKCA 2XGTA 4DR5Q 4YIJA 1PH9A 3PSIA 1IYVA 3M4OH 2B63G 5TSSA 4JBMA 1JE4A 2EVBA 4A3BB 1PH5A 3H09A 1JT8A 1YNJC 3K58A 1JOOA 5FO9B 5M5XB 1O7YA 2PZWA 3GTPH 1IYUA 2RDHA 3D6WA 4ULLA 4RGMA 4BA2I 5E1FA 1GUSA 4A3GB 4S3SA 1K83H 2UU9L 1D7QA 4JI2L 1XWEA 3VYTA 4XT1B 2KEDA 3DWAA 5GAGC 1F77A 5C6AA 1PRTB 1QE6A 3STBC 3IKJA 1NCVA 3HOZG 3MEFA 4DNTB 1PZID 2F0FA 1GUTA 2AKWB 1QNKA 5EKKA 2VQFL 4A76A 1J5EL 3A0JA 3K5MA 1EOTA 2PNHA 2E8GA 4OEMB 1CKOA 3DUZA 5K5PA 3HOWH 1XMOL 4XQNA 4V190 3S14H 2LMCB 2Z0SA 5JEAJ 1VQGA 5NUCA 3IL8A 2MNAA 2A1AA 2NVYB 1TWFH 3LGJA 4IO9A 4LF9L 4JI0Q 2MGSA 1XTDA 2KECA 4I7ZC 1BR9A 3KLWA 2KHJA 4PV1C 5HY6A 1Y1WB 3K5OA 5IYBH 5AJ3Q 1BXTA 3GQBA 3E0JA 5FK9C 1IBMQ 1XJVA 2VL6A 5KNBA 3TS0A 4HJ9A 1FJGL 3R2TA 4JBWA 2NYZD 2C35B 5M5YH 2WIIB 2QEJC 5C3EG 3WDNA 4KD3A 2JA5H 2BCOA 2KVMA 2WAQG 3PMFA 3S24A 2QGQA 4P74A 5CORA 4DFAA 4JV5Q 1L0WA 2VB2X 3A74A 3GTQH 3PIOA 5IGCA 1PVOA 5BR8L 3M9BA 1II3A 2I0QA 1EIGA 1JE5A 1O7ZA 1TVXA 3GTJH 2RDFA 4XIGS 1SNOA 1PH8A 3HOXH 3MXNA 3PF4A 2F0QA 3SR1A 1D6EC 4K2KA 1HUNA 2CH4W 4A3IB 3HOYB 2VUMH 4JBJA 1JMCA 2WV6D 3PUXA 4P72A 2LY7A 3U9OA 4DF7A 2AWOA 4DXFA 3RZDB 4TSSA 3S1QB 4EQOA 1HNWL 1I4RA 1YNNC 4ODGA 4X65L 3KF8A 3M7GA 4QIWB 4RFBA 2R7ZG 1BUVT 1G51A 5IWAQ 1K9MC 1PFBA 4Y7NB 3K80C 4GLAC 4CKBA 2R3ZA 4DV7L 1Y1VB 1L0XB 4GOPB 3HOUH 4RG1A 4OWXB 2G5DA 2DJFC 1CKMA 2D62A 4IOCA 3F2BA 2HDLA 2LFNA 4OIJA 5IT9c 4NB3A 1XMOQ 3TMEA 3PO2B 4JPBW 1I6HH 3CRKC 3FVQA 2EYLA 1B2TA 3TEHB 4LF9Q 5FLMG 3DEOA 2RBMA 3GV6A 4DR2Q 2JA8B 4A3MG 4KJOA 1NE3A 3JC66 1GUNA 2R93H 1TWCB 3CCSA 2DJGC 2QDBA 5E3FA 2B2WC 1K0SA 1PYBA 2CVRA 1IKLA 3J80i 2NB0A 4LNQA 3IFTA 1PTOF 5KYLA 2NVTH 3K5LA 1G6PA 4HJ7A 1KHIA 4BBRH 3CCMA 1WTHA 4OWTB 4LJZC 2K28A 3SK8A 1Q8IA 5C44H 1VQIA 4QIWE 4DAPA 1QILA 1KL9A 1IXRA 3HOZB 5M5WH 3RD4A 3U9SA 3DEPA 4B3RL 1Z6HA 1UEAB 2FMMA 1TWGH 1JCKB 3EVQA 2ZT9C 2A5HA 3KF6B 3K57A 1OXVA 4JI8L 2Z4IA 1H9JA 3JAMc 4DXGA 3GTMH 3T1YQ 2R92B 1Z47A 4DV4L 4WFN3 1A2TA 1IW7C 3I4MH 4LUOA 3EFXD 5GQOA 2YU9B 3FKIH 1A63A 2BA0A 4MN3A 2Q2TA 3KJOA 1WCMH 5KIXA 1QUQB 1S5ED 4OWWB 1UE7A 3BZCA 5J22A 2GVBA 2VB3X 4PZ8A 1KC8C 2WAQB 3CCLA 5BN3A 1FD7D 1EFWA 3PUYA 2F1MA 4R4CA 3LWEA 4A3BH 1GKHA 1S5DD 1ESRA 2RCNA 5CV7A 5EPJA 1EOVA 5M5XH 1GD7A 4BY1G 1ZKOA 3IFDA 1Z7TA 5K36G 1LTTD 5FOBB 3J81j 4HJ5A 4A3DH 4A3GH 3BU2A 3TDQA 2KUMA 2YTXA 1S3OA 4X64Q 3CCVA 1F9QA 2MPMA 5KYIA 2FXQA 1SYBA 2B39A 1E22A 4RKLA 1U4RA 1YNND 4A93G 1ET9A 3EN2A 2UXCL 3PQIA 4DKAC 2JA7G 3NEMA 2QW7A 1EWHA 1DOKA 3T16A 2R7ZB 1U0LA 2I46A 4X6AH 2F0KA 3J7ZC 1BCPB 4TQUS 3QIAA 1GXDC 2BOSA 1G8ZD 2NZHA 4R4IA 1Q8KA 2AQ2B 4A3KG 2HDMA 5KNDA 1TS3A 4GNXB 1ENAA 2JA6B 3KDFA 2IW3A 3OMGA 4A3FH 1Y1WH 2EJGC 1EEFD 3KUPA 3R2IA 2WAQE 4X62L 3UDIA 1ZEQX 4JI8Q 3W2DA 4C1NK 2ZTDA 3MWYW 1N8RC 3PO3G 1B8AA 2EOTA 2PCFB 3G7LA 4DV4Q 4B3SQ 5LMNQ 2SNMA 2L55A 4JI5L 4CDDC 4HCSA 4GN3B 4A3MB 2L11A 4FF3A 3S1MH 2KCTA 2B2WA 1NNXA 2B2YC 1Q90A 4H44C 3I4NH 1HQRD 1EU4A 1STEA 4JYAQ 4G4KA 2E5LL 4G7HC 4I65A 1CA6A 2K04A 3AB9A 4IJHA 4JI1L 2LS01 2F0NA 1KQSA 3NP8A 1BVSA 3MFYA 2EXZA 3G6JB 3Q22A 5DM63 1RCVD 4BWGB 4P2CB 5LHY1 1VQ7A 4A3IH 1GM5A 2KA7A 2O5IC 3D8GA 3RZDH 3D3RA 1U4MA 1SNCA 1PTOD 1S40A 1VQOA 3S1QH 3K0YA 1F2ZA 3VR4A 4IUPA 3H94A 4BBSB 2RF4A 2F0PA 3AFPA 2F0SA 3MFGA 4Y7NH 1JWMD 2DGYA 1MHWC 1C48A 2PQAB 3E0EA 3TP7A 2LKVA 1I3QB 2R6GA 2DY8A 4HMJA 5C3XA 1Y1VH 1NBWA 1K8AC 2A6HC 1K28A 4QF4A 4CJ1B 5C0XG 4IURA 4NXML 2JP1A 1N32Q 1ZYRC 4RCNA 1C4QA 2ZJPA 2HHHQ 4JI7L 3RZOB 3CCEA 1QWYA 4DV5L 1X3GA 1SFOH 1BDOA 5IP9H 5C5LA 5JVG3 3AQQA 3HP3A 1KTKA 5ELDA 2KQ3A 2JA8H 3SK4A 2WB1G 1DZ1A 4GOPC 3CCRA 1EZ8A 4KN4C 3D4WA 4NDXA 4XQJA 3FMCA 3GV3A 1VQNA 1RKNA 3TP8A 4K5XA 4ME5A 4B3ML 1WOCA 2BE5D 4JI5Q 2CQAA 2F4IA 2EYHA 4DR3L 1ONLA 1P16A 1EY9A 4UDUC 3CCQA 2AHOB 3M7NA 3P1HA 2ZXOA 4LF4L 4DAYB 1ILPA 2ZM6Q 4FYDA 3SHLA 4A93B 2YTVA 3IAYA 1SE2A 5EJWA 2RVLA 2XNAC 4IALA 2JA7B 1JJGA 2CKZB 2A69D 4IPCA 1CZWA 4MZ9A 1IBLL 3BG3A 4YHHQ 1FL0A 2HIXA 4CBVA 1EY6A 2I5HA 4Z9CB 5KNCA 1H9SB 2R92H 4A3KB 1EU3A 1KRSA 1HJPA 3MAQA 1WTRA 2ZJQA 2EQSA 5JJKA 3PUZA 4C3JH 2YU9H 5T1IA 3FEWX 2H4OA 5FLXL 3H0GG 3E6ZX 2X6LA 1UNSA 2B2VC 2NZ1D 5C0XI 3HKZB 2AUJD 1A6XA 4PQXA 1H9RA 1BF4A 3X3NA 1MD2D 5CV6A 3OW2A 4NXMQ 2B2YA 1X3QA 4DR1L 2RQXA 1SE3A 4DV5Q 5IYCH 3F2DA 4OHJA 4EQPA 1I4PA 1XYIA 4DR6Q 2F52A 1CZGA 2PQEA 3KOJA 2H1EA 4FXGC 3AEVA 4PMCA 1LYLA 2DNCA 3J7A5 1K8MA 1VF7A 3OW7A 2I07B 2QCPX 3L3OC 2EYFA 4MIUA 3CMAA 1WVLA 1JB7A 5FKAC 1STNA 5C4XG 5IGEA 3SE0A 1LTLA 2R7ZH 4A3CG 4H7BA 1HRJA 4R4OA 4PMBA 5GADC 4QGUA 2A6HD 1NSNS 1TY2A 3VA5A 3DHQA 4DPGA 3S2HB 1HHVA 3CC2A 1GO3E 2XIWA 2JA6H 1G91A 2JEAI 2L1BA 1L0YB 2PW5A 4R9WA 4YCWA 1QZHA 3I8ZA 1V1PA 1W6JA 4NP5A 3BVGA 1K0RA 4NPSA 4WRDA 1B3QA 4GOPA 4EQ5A 1STAA 2WB1B 3CPWA 3SK5A 1HZAA 1NAPA 4QQBX 2Y0SG 4OO1H 5M3MG 4HIMA 1HZBA 3D4DA 4LWCA 1O7LA 5I6YA 5CV4A 1PFNA 4UP8A 4CDCC 4NXNQ 1CKNA 4N8X1 3BDCA 3NTKA 4K5VA 1IL2A 1HTLD 4C1NI 3CAMA 2YYZA 1CSPA 2R7FA 3G48A 1WJJA 4B3TQ 1O78A 2BDNA 4QCLA 1BQQT 1X54A 1MKHA 3J7AV 1PTOB 4KLKA 1A62A 4CJ2C 2L0CA 5JVH3 3FRPB 4WORA 1VQBA 2G9DA 3K6OA 4EQNA 4PZ6A 1CM9A 4RGNA 4CJ0B 4X66Q 4IUVA 4DNRB 4DV1Q 4BBSH 3OWFA 3NWSA 3S2DH 3Q8DA 2WACA 3OTOQ 3TSSA 1PH7A 2NN6G 3ER0A 2UUBL 1QZGA 2AQ1B 2Q2HA 5ISRA 2LXKA 4CKCA 4HJAA 1VQPA 1JJCB 2O5JC 1YHBA 4K0KL 3ZYYX 3RZOH 2N55A 3BJUA 2WB1E 1BKBA 4WJWA 4GKKQ 1ICFB 2O4XA 3NSWA 5I2YA 3PIPA 4FVMA 1HH2P 1RD9D 3J80L 1N34L 4JBKA 1EIYB 1G2SA 4LF5L 4KKTA 2E2HH 4IFDH 2DNEA 5I2XA 1I4GA 1VQFA 3H15A 4FXDA 1LLRD 4M1UB 1VDZA 1KDAA 2O2LD 3ULLA 3I3CA 4HSPA 4DK1A 4U673 4LFBL 3CCUA 1O7IA 1EY4A 5EKLA 2RCFA 4IJLA 4YWKA 3SGIA 3F1ZA 3Q0AA 3B6YA 2IY5B 4DR7Q 1MSGA 5JPMC 3S17H 4O2DA 4UHVA 5A35A 4OL7A 5JAVA 3OSOA 5C4ZA 3E9IA 5I9PA 1SE4A 3BZDB 2JJQA 5C4XB 1CI3M 1QVCA 3QB3A 2ZXRA 3O13A 3OIQA 2GA4B 5IP7G 4L6TB 4MHEA 3GTLB 1HA6A 1UUPA 1JC7A 1YHQA 2E2DC 2UXDL 2B2UA 2M00A 5A2QE 2F0MA 2RSNA 1S72A 2FJ2A 1YHAA 2NN6I 3I55A 4GKJL 1LTRD 4ZRZA 2Z6KC 1JR0D 3BVZA 2MO0A 5KEEA 3URYA 1E2ZA 3AU7A 4A3JG 4DR4Q 3MZ5A 4IUNA 1V43A 2IHEA 2UUBQ 1K3BC 1NUCA 1AEXA 5JEAH 2B8FA 2EDGA 1SMYC 3Q6SA 2Y0SB 2Z1CA 5M3MB 2OF1A 1HR0L 2ID0A 3NPPA 2WKDA 3FPPA 1AE3A 5IT9L 1HZCA 4HIKA 3HZXA 3P7JA 2K1BA 1VQ4A 4P73A 4LMQD 2OQ0A 5C0XJ 3OMCA 5I6WA 1NR4A 2HD3A 4TKOB 4K8JA 3CMEA 2EE1A 1SYFA 5LMUL 1LT5D 2UU9Q 4JVZA 1SYCA 4JI2Q 1FNVA 3F2CA 4LUVA 5ELEA 1RIPA 1XXGA 1SSOA 1KDCA 4BY7G 5ELFA 5IGFA 1LTSD 4KD4A 3KJPA 3KBXA 4ZAIA 4LFBQ 4A75A 1KABA 2VQFQ 2K50A 2L15A 4A3LG 1J5EQ 1D1KA 3GP7A 1SJED 2K6AA 3NBHB 4ABNA 3DWPA 2K14A 1SDFA 4H02A 1TT2A 1U4LA 1B3AA 5IGDA 3S2HH 2EYMA 2B63B 2F0IA 3LWUA 4DAMA 5FJ8H 1F9PA 5H1SE 2VXWA 1YNJD 2B3GA 2HQEA 1EQVA 4N9TA 5IIFA 2F0UA 2IX3A 3NE5B 4KY6A 3VR6A 1FJGQ 4IOAA 2Y0SE 2QKIC 1BBWA 2PQAA 4EGVA 3HFZB 5DLQE 4DGZA 1XTCD 4JI3L 3EJIA 3JAML 2EYJA 1SMXA 3CRLC 3KLRA 1A15A 2N49A 2IX0A 1OO9B 1IZ6A 2VS1A 2EZVA 1PH6A 4OIKA 3A7LA 1LT6D 4GLVB 4XT3B 1NMFA 5BR8Q 2HT1A 4A3EG 3STBD 4DV3L 4C3IG 4G7OC 4GN5A 1MI2A 4FF1A 5M3FG 2F3IA 4UP9A 1RHPA 2SOBA 1NJIC 1HR0Q 1VQ6A 1GHKA 3HKSA 1XX8A 1W6KA 4KK7A 1A8VA 3NHHA 3BVMA 3K7UC 4V0BA 3PF5A 1SLJA 4KHPL 5C4JB 1HNWQ 3KK7A 4RKBA 2Q8IB 4X65Q 4R4TA 4J15A 2AWNA 4L8JA 2E2JH 1FYCA 3N52A 1PFMA 3E9HA 4DAYA 1Q81C 3UDXA 3MVVA 3SEBA 1BBUA 1FGUA 2EY1A 2D0OA 1D8LA 2EJFC 1JOKA 3F8TA 4IN3A 4DV7Q 5C3EB 3UDGA 3CD6A 5HGTA 3GDEA 2M9VA 5CBEE 1KAAA 2Z6KA 2NVXB 2CH4A 3PUWA 3HRZC 2AUKA 1W3SA 3MTSA 1X3EA 3NTIA 3X3MA 1B50A 2I5MX 2PI2A 1UE6A 1SMYD 3K81C 4XTCS 1WTXA 1HQMC 2I5LX 1LABA 1LTAD 3HS0C 3VA7A 3GD7A 3WOEA 1SJHD 2C5CA 3ZJYC 1VQAA 4IPGA 1Q7YC 3R8BA 1ASZA 4BS9A 4DUYL 2HUGA 4MTNA 5JJIA 2J4XA 1K73C 3I70A 4JI3Q 1SN8A 4HIOA 4RGOS 1SE8A 2PYKA 4R8NA 2UXBL 3RLFA 3U58A 4FO2A 1S5BD 1DGSA 3U4VA 1Q3LA 1A2UA 4IQZA 3OWEB 4C3HG 1HFNA 3H3VI 4UP7A 1X3FA 4ILWA 4F87A 2K01A 3CCJA 2IPKD 1SBBB 4ZUJA 2K32A 4L63B 2NVYH 3HOWG 1QVFA 5C3WA 1HNZL 1PRTC 3CC7A 3CW2C 4B3RQ 1AP0A 1WTOA 1IBKL 1Y8OB 2HIVA 3NQTA 2JQOA 4J8QA 3TP6A 1W2BA 3PUVA 5IYBG 1YITA 3J81L 4KHPQ 4L5TA 5I4DA 4F88A 3L7ZC 1VQLA 2XVSA 4HR7B 2NVQB 2VQEL 3PV0A 1A3UA 2JA5G 3AYHB 4OELB 3MXNB 5FO8B 1OXUA 1EY0A 4JK1C 1KNEA 3HEJA 5AFWA 4ZUIA 5M3MH 3JAMi 4OX9L 3NWTA 2K05A 4K6LA 1LM0A 4AYBG 5JPNC 3HOYH 1FNUA 5ELNA 3HOXG 1PMRA 1TU2B 1AE2A 3KF8B 3CPFA 1E1OA 2VUMG 5D65A 1D5XC 1CK1A 3A56A 3FPUB 3C3LA 5M3FB 2JYOA 4DN4M 1JJ2A 2F0TA 2HCCA 2KHSA 1LT3D 3NENA 2IJ0A 1I4QA 3Q23A 1F2YA 4DUYQ 2NBFA 2UUAL 3PIO3 2L12A 1IHZA 1GHJA 2Q2IA 4XDXA 1V1OA 4PMWA 1NR2A 1IW7D 2CWPA 2UXCQ 1K8OA 1PYSB 4RWSC 5GROA 1DYQA 2VNUD 2B8GA 1M8AA 4DA2A 1WTWA 1EFID 3PO2H 2ES2A 3A55A 2F0EA 1VQCA 1I50B 1MJCA 2A68C 2OCEA 2B63H 2K5DA 2V1CC 4MNOA 5BN5A 4CDEC 3M4OB 3KBGA 4LFAL 1VMPA 1STGA 1TWCH 4X62Q 1DCZA 1RDPD 2ZTEA 4YWMA 1YVCA 2R93G 4BY1B 2GN5A 2MHVA 2QA4A 4H0LC 2ALYB 4BA1I 2OEOA 3C1EA 1AH9A 1B7YB 2XN9C 5IGGA 1F9SA 3RLNA 4YCVA 3CC4A 2JXMB 2BH8A 5J1ZA 1L1OB 1R9TB 1K83B 5CV9A 2E5LQ 1EY7A 4BBRG 1PZJD 1DM0B 3J7AF 4DNIA 2CFMA 3CKIB 4JI1Q 1MJEA 3KLSA 3HOZH 5C44G 3T51B 2KBNA 2X6GA 4C3HB 3DM1A 2E76C 3OOCA 1VQEA 5DEHA 4ZKCB 1K3RA 5FO7B 1BBXC 1PHJA 4AQYL 3HOWB 3S14B 5C4JH 3I72A 4I7AA 2Z6BA 1PZKD 3VYUA 1T5XD 2UUAQ 5E4XA 5HURA 3EA6A 1X55A 3S16B 3FKIG 1TY0A 1JQYD 3PO3B 3QOLA 1WCMG 4K6DA 2IX1A 3VR3A 2XWJB 5C3EH 1XNRL 3J81i 1GUGA 1LUZA 2R7DA 1X6OA 2PNRC 5M5YB 2VY3A 1EEID 4C56C 1C7YA 4JI7Q 5M9OA 2K33A 1VQDA 1Q1BA 4GN4B 1PXUA 4A3BG 1JWUD 2PPBC 1X65A 2A73B 1ET6A 3GTQB 2XTIA 3RN2A 1NY4A 1HNXL 4RHRA 2M2LA 1YZ6A 2OTLA 5D14A 4Q0FA 3GTJB 2FFKB 3A5ZB 2EPBA 3TQYA 1YI2A 1PYWD 4A3DG 1TWHB 5E4WC 2IT1A 2QILA 4B3MQ 1VQKA 1DONA 4DR3Q 1VCIA 3DMUA 4DK0A 2F0WA 3T4AC 4JOIC 4POFA 1LACA 2PO4A 3C2PA 2F0VA 1KRTA 4FF2A 4YY3L 4K5WA 5KRUA 2L9HA 3DLLA 3CU7A 4LF4Q 2D2CC 1N33L 3KDFB 4G57A 2RSOA 3NTHA 1N36L 1FVIA 1ZYRD 4CHTB 3HOVG 1QOHA 3W1GA 1PFSA 1V9PA 2OTJA 1J6QA 4XXEA 4A3LH 4Y52H 4DR5L 4AH6A 1M4VA 1IBLQ 4ZK9B 1LTGD 3LNNA 4CGYB 1HUMA 5G3LD 1MSHA 4DUZL 4TRDA 4A3FG 2A68D 1Y1WG 4AQYQ 5FLMH 1BCPC 1YBYA 2FHTA 1CHPD 2XRQD 4FDBA 2QDLA 4IUQA 4ME3A 4A3MH 1KD1C 1WYDA 1VQ5A 1VS0A 4K14A 1VQMA 4GNXC 2J7ZA 5IE8A 1KNAA 5IOCA 2LSSA 2R93B 2D0PA 4O1NA 3GTKB 1RF2D 3L2PA 1QJOA 4AYBE 3ERQA 3I4NG 1G2TA 1HXYD 5JOBA 1U9RA 3TZDA 1WI5A 4DR1Q 1RL2A 2PMZB 2WP8J 2NVTB 1TR5A 1I94L 1LTID 1EY8A 3A8IE 4K2LA 1RTNA 2K5WA 4BBRB 5IYDG 1DOMA 2JE6I 3A8JE 4A3IG 1GUWA 1EYGA 4HTHA 1HNXQ 1VQJA 2ZTCA 5C44B 1TQOA 3HGBA 2B29A 4ZKBB 5LMNW 1SXTA 1AW7A 1WTPA 2K4KA 4JI0L 5M5WB 2EIFA 3BZKA 2SEBD 1I4HA 4ALPA 1H95A 1P8LA 2F0JA 1SNPA 2JA9A 3TZUA 2K5HA 1B44D 1I3QH 3NXWA 1VMCA 2F3WA 3GTMB 1X56A 4ZQ3A 5T1GA 4R1JA 2B2VA 1IYJB 1CUKA 1S5CD 1Y1VG 2A19A 3H0GB 1N33Q 3KF6A 2PZUA 4A4IA 5F2DA 5FLXE 1K8GA 5IP9G 4DK6C 2CQOA 1E1TA 4EVOA 2KCCA 3ICEA 2K5QA 3GTOB 1TXYA 2PW7A 1QB5D 1QUQA 1SR3A 4MTKA 4DUZQ 2JA8G 1ENFA 1R4QB 1Q1EA 2YTYA 1N9WA 1I5FA 4PZ7A 2PMZE 2MP1A 3MXUA 4BY1H 1X9NA 2F0HA 5K36H 2NTSA 5C4HA 1D2BA 3I2ZA 5JJZA 3W1BA 3S1NB 4EX5A 2OQKA 4A3DB 2ICEC 1R9TH 4KN7C 1Q82C 2Q8RE 4RHSA 1T5EA 1KLUD 2A74C 2QEXA 1GUOA 3M4QA 4QY7A 4JOIA 3I91A 4A93H 3QWNA 4POGA 1IKMA 5IGBA 5CYUA 2EY2A 5IWAL 1WD1A 2EJMA 2SNSA 3AFQA 4KTAA 4O42A 5LL6X 2JA7H 1UE5A 2D9UA 4C3HH 1I94Q 1SYDA 1L1OC 4IPDA 5J3BA 4FXKC 3V2TA 1CTMA 1AZPA 3J80c 3TBIB 4A3KH 2Q8TA 3HOVB 2XSCA 3KYHC 4APVA 2R92G 1DXMA 1BNZA 1B1ZA 2AMCB 4DR2L 1XPOA 1PA6A 1M90C 4A3FB 1PV4A 3S16H 1A3TA 3TRZA 4C3JG 1BCPD 3C1FA 1E3PA 3PO3H 1WD0A 1AN8A 4GNXA 2RHQB 5GAEC 2KEEA 3W5OA 1EZ6A 3T56B 3E3XA 4LFCL 4K0KQ 5DNFA 2F3VA 5EPKA 3S1MB 1C0AA 3VYSA 2EYPA 3U4ZA 3DM3A 1N34Q 1CSQA 4XQQA 5IYCG 3I4NB 1EIHA 1TWAB 3UI2A 5ELCA 1RJTA 4LF8L 5EBCA 4LF5Q 3S15B 1PH2A 2NTTA 2DY7A 2FINB 1TWHH 2N8NA 1STBA 3VR5A 2RDGA 4ID6A 4XYQA 3MEHA 3S1RB 2F03A 1EYAA 4M8AA 3Q24A 3V05A 3GO5A 4KMUC 1STHA 1NMGA 4IUTA 3DWQA 4OXPA 4P75A 3T1YL 4PG3A 4DAVA 3BS1A 1STYA 3FDTA 1E2VA 2V4DA 4WJ4A 4F8MA 1XPRA 1UAPA 4G7ZC 1HZ9A 3I4LA 1ML0D 1V1PB 1KLGD 4CDFC 3RUZA 1TKWB 1JOQA 2KCMA 4KY5A 3A7AB 2KHIA 5C0XH 1QVGA 2KENA 1E7ZA 3MC0B 3U50C 1KDBA 3UE1A 1EIFA 2CWAA 2OT2A 4KKSA 4NW2A 2JA6G 1J9OA 1F9RA 4C2MB 3TN2A 5IY0A 3MXGA 3A54A 5EAYA 2UXDQ 1SFOB 2F4VL 2LXJA 1GVPA 3J7YW 3K7AB 3V96A 1CKNB 4KHZA 3J80E 4GKJQ 2JEBI 4X3SA 4WJ3M 4BXXG 3CXCA 4DV6L 4OO1G 4GZYC 3GTKH 2A6EC 3NQIA 4X64L 2K75A 1Y69U 4O0AA 1GOZA 3QR8A 4JCVE 4HCEA 1EYCA 1KXLA 1QNUA 1FNWA 1Y8NB 4LFCQ 3IRBA 2H5XA 2EY5A 1PTOH 4LF7L 3G6EA 1ESFA 2UUCL 4ZLTF 1AFPA 4P71A 3W3AA 3M4YA 4LF8Q 2CCZA 4ZCKA 4UPAA 5LMUQ 1HA5A 1OXSC 1L1OA 4DV2L 1UWVA 3M3YB 3GTGB 2D5DA 1F2MA 1PH4A 2VZAA 4X3TA 1PTOC 4BBSG 4KHVA 2DUDA 3TREA 2F0GA 1ILQA 1J8IA 4HAEA 2BA1A 3K59A 4B3SL 5LMNL 2WFWA 1JORA 1ICWA 4LAAA 1PH1A 3H0GH 2MJ8A 3MA2B 4C3JB 3NBIA 2EXDA 4A3JB 3D0FA 1H9SA 4RMFA 4GLXA 3A8KE 4JYAL 1OXTA 3EBEA 2KCNA 3K8AA 3SXHA 4X3KA 3GTOH 3QJYA 3FP9A 2IHFA 1PDQA 1VF5C 1JICA 2F4VQ 4IFDG 1SEBD 1CQFA 4L5QA 1RODA 2EY6A 4OO1I 4LUZA 1E24A 1PRTF 1L2FA 5IT9E 1XNQL 5LL6S 4IZ8A 3S1NH 1Q86C 4HIDA 4DV6Q 2BE5C 2N78A 3PIP3 4XYOA 2YV5A 5CGKA 2E75C 2N3SA 3C46A 4BY7B 3OYYA 3D6CA 3E5SA 1V1QA 1D1IA 4DV3Q 4N9PA 1ASYA 1O80A 3BYTB 5C4XH 2JN4A 4QJFA 5HGQA 4LF7Q 5BN4A 3FHWA 1SNDA 4A3CH 3MXPA 3F2UA 3T1HL 2UUCQ 3GTLH 1N32L 2HHHL 3VDYA 5CR3A 3I73A 1YIJA 3SDZA 2A69C 1DJRD 4IUUA 2RA4A 3UDFA 2NWGA 1TS2A 3HG9A 3HOVH 5CV8A 1TIID 4LF6L 4DV2Q 1Q12A 2L5TA 2Z4HA 1YJNA 2MFIA 4NKLA 4HEDA 1B53A 1WFQA 2PZTA 4NMZA 2MO1A 5KGUA 3RR5A 1X32A 4FF4A 1WTVA 2X69A 3HKZG 1Y8PB 3CP0A 3NELA 4KKUA 2NUCA 3RNUA 4DV0L 3SVMA 5JEAG 1EL0A 2ENBA 1CFMA 2XRSD 2B2TC 3CQZB 3JAME 4KJNA 2SDFA 1A3VA 2A6ED 4K8IA 4JI4L 2WINB 4A3EB 3K0XA 1TWAH 4PNYA 2MUYA 4C3IB 2N88A 3EQLC 3S15H 3BDOA 1BO0A 4IFDI 2ZM6L 5EGTA 1WTQA 1I6VC 2RKSA 5JJLA 3RN5A 3NUCA 1MBYA 1EWIA 4Q5VA 5IYDH 5G3LF 3OHXC 4R4QA 2Z8LA 3S1RH 3J81c 3LX0A 2UXBQ 4YHHL 1XNQQ 4HSVA 1Q46A 1TS4A 3G4SA 3OIPA 3M4PA 3ONAB 4AIMA 2RHSB 4LK1C 3HOUG 1G291 3I90A 2ASBA 2E2IB 3S2DB 2DN8A 1PH3A 2NN6H 1D5MC 1HTPA 2A8VA 1XMQL 1H9KA 2ATWA 1EWCA 3K5NA 1HNZQ 1R4PB 1IBKQ 1FGBD 1H9MA 3T1HQ 4RH6A 1MIUA 4QUFA 5FJ8G 4C2MH 2Q2UA 1SNMA 5CC4A 3RLOA 1UEBA 1NTGA 1SAPA 4LF6Q 3D31A 1ZXTA 2JK8A 3K7AH 1LV9A 3GTPB 2HCIA 2VQEQ 4DR6L 1U4PA 4X3UA 1ENCA 3SK6A 3RMHA 4RGTA 4L5SA 4KY7A 1X3PA 2NZOA 2E2HB 1HPCA
chains in the Genus database with same CATH topology
1WI5A 3J81j 4DR1Q 4HJ5A 1AE3A 4A3DH 4A3GH 1RL2A 2WP8J 1HZCA 3BU2A 4HIKA 1VQ4A 4P73A 2BH2A 1I94L 2YTXA 3M85A 1S3OA 4DV0Q 4X64Q 2OQ0A 5C0XJ 3CCVA 4OX9Q 5IYDG 2JE6I 3KFUA 3CMEA 5LMUL 2UU9Q 2FXQA 4A3IG 1EYGA 1UE1A 4L5RC 1E22A 4JI2Q 1HNXQ 4JI4Q 1VQJA 2ZTCA 4LUVA 3F2CA 4A93G 2B29A 5LMNW 1RIPA 3EN2A 2UXCL 4TVAB 4JG2A 2K4KA 4DKAC 4JI0L 2JA7G 3NEMA 4BY7G 1EQQA 2EIFA 3BZKA 4ALPA 3KJPA 1H95A 1P8LA 4LFBQ 3ULJA 3M3YH 4IPHA 3GTGH 1U0LA 1YEZA 2K52A 4A75A 4X6AH 2JA9A 1YJ9A 3J7ZC 4TQUS 5IP7H 2K50A 2L15A 2VQFQ 1J5EQ 2K5HA 1I3QH 3I4MG 3EIVA 3TS2A 4A3LG 2NZHA 4R4IA 1Q8KA 3NBHB 4A3KG 1EUJA 2K14A 1X56A 4H02A 4GNXB 4R1JA 3KDFA 1IYJB 1Y14B 1KIXA 4A3FH 1CUKA 1Y1VG 2A19A 1Y1WH 1N33Q 3KF6A 3S2HH 3L0OA 4A4IA 3UE0A 2NVXH 2WAQE 4DAMA 4X62L 1K8GA 5FJ8H 3UDIA 1VQ9A 4JI8Q 5H1SE 1HR0W 2ZTDA 2B3GA 5IP9G 1N8RC 3PO3G 1B8AA 4DK6C 4DV4Q 2CQOA 4A3JH 5LMNQ 4B3SQ 1E1TA 4JI5L 4IOAA 1XMQQ 1FJGQ 2Y0SE 3ICEA 4GN3B 1BBWA 2PQAA 4QL5A 1SRUA 1TXYA 3HFZB 1QUQA 1SR3A 5DLQE 2KCTA 4DUZQ 1VQHA 4NXNL 2JA8G 3S1MH 1OXXK 3PGZA 5E7NA 4JI3L 1Q1EA 2YTYA 1N9WA 1I5FA 4PZ7A 2PMZE 4BY1H 3I4NH 1SMXA 2GVAA 4LFAQ 1X9NA 4JYAQ 2E5LL 2N49A 1XPUA 4A3GG 2IX0A 3PCOB 4B3TL 1IZ6A 2VS1A 3I2ZA 4YWLA 4LW1A 1PH6A 4IJHA 4JI1L 3W1BA 4GLVB 3ERSX 4HJ8A 4EX5A 1KQSA 1NMFA 5BR8Q 2HT1A 1Z9FA 2OQKA 4A3EG 1BVSA 1R9TH 3STBD 1Q82C 4DV3L 4GN5A 1VQ7A 2QEXA 4A3IH 5M3FG 2F3IA 4UP9A 3M4QA 4QY7A 1NJIC 1GM5A 1HR0Q 4X66L 1VQ6A 4JOIA 5FLXc 2ZJRA 4A93H 4POGA 3HKSA 4DK3C 3S16H 3WWVA 1A8VA 5IWAL 4DV1L 3RZDH 1S40A 3K7UC 1VQOA 3S1QH 4BY7H 3AFQA 2JA7H 5GAHC 1UE5A 3PF5A 5ELOA 4C3HH 1SLJA 1I94Q 1B70B 3OTOL 3I7FA 2MQHA 4KHPL 1L1OC 4IPDA 2RF4A 1YNXA 4JI6L 1HNWQ 3AFPA 5J3BA 4X65Q 4R4TA 4J15A 2AWNA 1SROA 2DGYA 4Y7NH 3J80c 4A3KH 2E2JH 1VQ8A 2PQAB 3E0EA 3E9HA 1Q81C 2PI2E 2R6GA 3UDXA 3KYHC 4APVA 1Y1VH 1NBWA 1K8AC 2R92G 1BBUA 1FGUA 2VW9A 2D0OA 1D8LA 5C0XG 1T9HA 4NXML 1N32Q 2ZJPA 2AMCB 3F8TA 4DR2L 2K5NA 1XPOA 1PA6A 4DV7Q 3UDGA 1PV4A 3CCEA 1M90C 4JI7L 3CD6A 2K5VA 3GDEA 1X3GA 4DV5L 3TRZA 1E3PA 1SFOH 2NVQH 2Z6KA 3HKZE 5IP9H 3PO3H 4YCUA 3PUWA 1OTCA 1W3SA 3AQQA 2RHQB 5GAEC 1X3EA 4KI0A 4GNXA 3W5OA 4LFCL 4K0KQ 2JA8H 2WB1G 1XNRQ 1A0IA 3I4OA 4GOPC 2I5MX 2PI2A 3CCRA 1UE6A 3K81C 4XTCS 1VQNA 2I5LX 3A5UA 1C0AA 4OONA 3U4ZA 3DM3A 3GD7A 1N34Q 1CSQA 3CQZH 5IYCG 4BXXH 3ZJYC 1U5KA 1VQAA 1WOCA 4IPGA 3ULPA 1Q7YC 4B3ML 1ASZA 4JI5Q 4DUYL 4GS3A 4LF8L 4LF5Q 4MTNA 4DR3L 1KAWA 4A3EH 5JJIA 1PH2A 1YJWA 1P16A 2OWOA 3HOYG 3CCQA 2AHOB 4C3IH 1K73C 1M1KC 3M7NA 1TWHH 2N8NA 4JI3Q 1SN8A 5M3FH 3H3VH 4DR7L 4HIOA 1SE8A 2UXBL 1EQRA 3RLFA 3U58A 4LF4L 2HQLA 1DGSA 3U4VA 4DAYB 2ZM6Q 1C9OA 3CF5A 2YTVA 3G71A 3GO5A 3H3VI 4UP7A 1X3FA 1NMGA 5AJ3L 4OXPA 4P75A 3T1YL 4PG3A 3CCJA 1IBML 1JJGA 2CKZB 2NVYH 4IPCA 3I56A 3HOWG 4MZ9A 1IBLL 1QVFA 4WJ4A 1XPRA 1HNZL 3CC7A 4JC0A 4YY3Q 3CW2C 4YHHQ 1FL0A 2HIXA 4B3RQ 1HZ9A 2I5HA 1IBKL 2HIVA 4IFDJ 2KCMA 2E2IH 2JQOA 2R92H 4A3CG 2KHIA 1KRSA 1HJPA 1W2BA 1QVGA 2ZJQA 4JV5L 2KENA 3PUVA 1E7ZA 2EQSA 1I50H 5IYBG 3U50C 3PUZA 1YITA 1N36Q 5JJKA 3UE1A 4C3JH 1EIFA 2CWAA 2YU9H 4L5TA 4UY8C 3PO2G 2JA6G 4DR4L 4KHPQ 4JI6Q 3H0GG 5IY0A 3L7ZC 4DR5Q 2XGTA 1PH9A 3PSIA 5EAYA 5C0XI 1VQLA 3M4OH 2UXDQ 2B63G 2F4VL 2VQEL 2LXJA 3PV0A 4JBMA 1GVPA 2JA5G 1CKNB 3AYHB 4KHZA 3OW2A 3MXNB 1PH5A 2JEBI 4GKJQ 4WJ3M 1JT8A 4NXMQ 1OXUA 4DR1L 4BXXG 3CXCA 4DV6L 4DV5Q 5IYCH 3GTPH 4OO1G 3GTKH 4BA2I 4OX9L 4X64L 5M3MH 3JAMi 2K75A 3F2DA 1K83H 4O0AA 2HHHQ 1LM0A 4JCVE 2UU9L 1D7QA 4AYBG 2F52A 4DR6Q 1KXLA 3HOYH 3HOXG 5ELNA 4LFCQ 3IRBA 4JI2L 2H5XA 3KOJA 3AEVA 1AE2A 3KF8B 3CPFA 1LYLA 4LF7L 1E1OA 3J7A5 2VUMG 5GAGC 3G6EA 2UUCL 1JJ2A 3STBC 4P71A 3NENA 3HOZG 3MEFA 4DUYQ 4LF8Q 2UUAL 2CCZA 2AKWB 3CMAA 2VQFL 4UPAA 5LMUQ 4A76A 2Q2IA 3A0JA 1J5EL 1OXSC 2PNHA 2E8GA 1CKOA 1L1OA 1UWVA 4DV2L 4PMWA 1JB7A 3HOWH 5C4XG 1XMOL 3S14H 2Z0SA 2VZAA 1PH4A 5JEAJ 1VQGA 2CWPA 4BBSG 2UXCQ 1PYSB 2MNAA 1LTLA 2A1AA 1TWFH 3LGJA 2DUDA 5GROA 4IO9A 3TREA 4JI0Q 4LF9L 2R7ZH 1XTDA 4R4OA 2VNUD 3KLWA 5GADC 4QGUA 2KHJA 5HY6A 4DPGA 2BA1A 5IYBH 5AJ3Q 4GKKL 3CC2A 1GO3E 1IBMQ 1XJVA 3PO2H 2ES2A 4B3SL 2VL6A 5LMNL 2JA6H 2WFWA 2JEAI 1VQCA 3TS0A 4HJ9A 4YCWA 1PH1A 3H0GH 4JBWA 1MJCA 1FJGL 1QZHA 2OCEA 2C35B 5M5YH 2EXDA 2B63H 3D0FA 5C3EG 4RMFA 2V1CC 4MNOA 2JA5H 1K0RA 4GLXA 2WAQG 4NPSA 3S24A 4LFAL 2QGQA 4P74A 1OXTA 4JYAL 1TWCH 4X62Q 3EBEA 4GOPA 3K8AA 2ZTEA 4YWMA 4EQ5A 1L0WA 4JV5Q 1YVCA 2R93G 2GN5A 3A74A 3CPWA 2QA4A 3GTQH 3GTOH 1HZAA 4QQBX 2Y0SG 2ALYB 4BA1I 5M3MG 3PIOA 3FP9A 4HIMA 1HZBA 4LWCA 3M9BA 5BR8L 1PVOA 2I0QA 2IHFA 1AH9A 1JE5A 1B7YB 3GTJH 2F4VQ 3RLNA 4UP8A 4IFDG 4YCVA 3CC4A 4XIGS 1CKNA 2BH8A 4NXNQ 4L5QA 1PH8A 3HOXH 3PF4A 1L1OB 1IL2A 3CAMA 4LUZA 1E24A 4OO1I 1L2FA 1XNQL 2YYZA 1CSPA 2E5LQ 2R7FA 3S1NH 3G48A 4BBRG 1WJJA 4B3TQ 2VUMH 4JBJA 1JMCA 1Q86C 1X54A 3PUXA 1MKHA 2CFMA 4P72A 4DNIA 2N78A 4DV6Q 4HIDA 4JI1Q 4KLKA 2AWOA 1MJEA 2YV5A 1A62A 5C44G 3HOZH 2N3SA 3OYYA 2KBNA 1V1QA 1HNWL 4DV3Q 1VQBA 4X65L 1VQEA 4PZ6A 1ASYA 5C4XH 4X66Q 4QJFA 5HGQA 1K3RA 1PHJA 4LF7Q 2R7ZG 1G51A 5IWAQ 1K9MC 4DV1Q 4BBSH 3FHWA 4AQYL 3K80C 4A3CH 3S2DH 3T1HL 4GLAC 5C4JH 2UUCQ 3GTLH 1N32L 2HHHL 3VDYA 3Q8DA 4DV7L 3OTOQ 4GOPB 3HOUH 4RG1A 1YIJA 1PH7A 4OWXB 3UDFA 2NN6G 2UUAQ 3ER0A 3HOVH 1CKMA 1X55A 2D62A 2UUBL 4IOCA 3F2BA 4LF6L 1QZGA 4DV2Q 3FKIG 5IT9c 2Q2HA 1Q12A 2LXKA 4NB3A 4HJAA 1YJNA 1XMOQ 2MFIA 1VQPA 1JJCB 1WCMG 2IX1A 1I6HH 1YHBA 1WFQA 4K0KL 5C3EH 1XNRL 3J81i 3BJUA 3TEHB 4LF9Q 3RZOH 5FLMG 2WB1E 1LUZA 2MO1A 2R7DA 1X6OA 3RR5A 1BKBA 2VY3A 4DR2Q 4GKKQ 4A3MG 1C7YA 1NE3A 3JC66 4JI7Q 3HKZG 3PIPA 4JBKA 1HH2P 1VQDA 1N34L 1Q1BA 3CP0A 4GN4B 3NELA 1EIYB 2R93H 3CCSA 3RNUA 4DV0L 4A3BG 5JEAG 4LF5L 1X65A 1PYBA 2E2HH 2XTIA 3RN2A 1NY4A 1HNXL 4JI4L 1VQFA 1YZ6A 3J80i 3H15A 2OTLA 3K0XA 4LNQA 2NVTH 1TWAH 1G6PA 3A5ZB 3TQYA 4HJ7A 1YI2A 3ULLA 1KHIA 4A3DG 4BBRH 2IT1A 3S15H 4IFDI 2ZM6L 3CCMA 4OWTB 4B3MQ 5JJLA 3RN5A 3CCUA 4LFBL 1O7IA 1VQKA 5C44H 4DR3Q 4IJLA 1EWIA 1VCIA 1VQIA 4QIWE 3F1ZA 4YWKA 3SGIA 5IYDH 4JOIC 4POFA 3B6YA 2IY5B 1KL9A 4R4QA 1IXRA 3S1RH 3J81c 4DR7Q 5M5WH 3S17H 1KRTA 4YY3L 4O2DA 4YHHL 4B3RL 1XNQQ 2UXBQ 3DLLA 4LF4Q 1N33L 1Q46A 3E9IA 1TWGH 3KDFB 3G4SA 2JJQA 3M4PA 3KF6B 4AIMA 1QVCA 2RHSB 1OXVA 3HOUG 1G291 4JI8L 1N36L 3JAMc 2ASBA 1FVIA 3T1YQ 3GTMH 1Z47A 3HOVG 5IP7G 1PH3A 3W1GA 4DV4L 1PFSA 1V9PA 2OTJA 1J6QA 1XMQL 2A8VA 4A3LH 4Y52H 3I4MH 4LUOA 4DR5L 4AH6A 5GQOA 1IBLQ 1YHQA 2ATWA 3FKIH 1A63A 2BA0A 2UXDL 1HNZQ 2Q2TA 3KJOA 4DUZL 4A3FG 1WCMH 1Y1WG 1IBKQ 1S72A 1QUQB 1YHAA 2NN6I 4AQYQ 4OWWB 3I55A 5FLMH 4GKJL 3T1HQ 5FJ8G 1MIUA 1YBYA 1UE7A 2Z6KC 3BZCA 4C2MH 2GVBA 2Q2UA 2MO0A 4FDBA 4ME3A 4A3MH 1KD1C 1VQ5A 1WYDA 1VS0A 4PZ8A 1KC8C 4DR4Q 4A3JG 1VQMA 4GNXC 3CCLA 5IE8A 3PUYA 1V43A 1UEBA 3RLOA 2IHEA 1EFWA 1NTGA 2UUBQ 4R4CA 4LF6Q 3D31A 4A3BH 1GKHA 2JK8A 2LSSA 3K7AH 2RCNA 2VQEQ 2D0PA 4DR6L 1EOVA 3L2PA 5M5XH 1GD7A 4AYBE 3I4NG 4BY1G 1HR0L 2ID0A 4L5SA 2NZOA 5K36G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI5 A;  3J81 j;  4DR1 Q;  4HJ5 A;  1AE3 A;  4A3D H;  4A3G H;  1RL2 A;  2WP8 J;  1HZC A;  3BU2 A;  4HIK A;  1VQ4 A;  4P73 A;  2BH2 A;  1I94 L;  2YTX A;  3M85 A;  1S3O A;  4DV0 Q;  4X64 Q;  2OQ0 A;  5C0X J;  3CCV A;  4OX9 Q;  5IYD G;  2JE6 I;  3KFU A;  3CME A;  5LMU L;  2UU9 Q;  2FXQ A;  4A3I G;  1EYG A;  1UE1 A;  4L5R C;  1E22 A;  4JI2 Q;  1HNX Q;  4JI4 Q;  1VQJ A;  2ZTC A;  4LUV A;  3F2C A;  4A93 G;  2B29 A;  5LMN W;  1RIP A;  3EN2 A;  2UXC L;  4TVA B;  4JG2 A;  2K4K A;  4DKA C;  4JI0 L;  2JA7 G;  3NEM A;  4BY7 G;  1EQQ A;  2EIF A;  3BZK A;  4ALP A;  3KJP A;  1H95 A;  1P8L A;  4LFB Q;  3ULJ A;  3M3Y H;  4IPH A;  3GTG H;  1U0L A;  1YEZ A;  2K52 A;  4A75 A;  4X6A H;  2JA9 A;  1YJ9 A;  3J7Z C;  4TQU S;  5IP7 H;  2K50 A;  2L15 A;  2VQF Q;  1J5E Q;  2K5H A;  1I3Q H;  3I4M G;  3EIV A;  3TS2 A;  4A3L G;  2NZH A;  4R4I A;  1Q8K A;  3NBH B;  4A3K G;  1EUJ A;  2K14 A;  1X56 A;  4H02 A;  4GNX B;  4R1J A;  3KDF A;  1IYJ B;  1Y14 B;  1KIX A;  4A3F H;  1CUK A;  1Y1V G;  2A19 A;  1Y1W H;  1N33 Q;  3KF6 A;  3S2H H;  3L0O A;  4A4I A;  3UE0 A;  2NVX H;  2WAQ E;  4DAM A;  4X62 L;  1K8G A;  5FJ8 H;  3UDI A;  1VQ9 A;  4JI8 Q;  5H1S E;  1HR0 W;  2ZTD A;  2B3G A;  5IP9 G;  1N8R C;  3PO3 G;  1B8A A;  4DK6 C;  4DV4 Q;  2CQO A;  4A3J H;  5LMN Q;  4B3S Q;  1E1T A;  4JI5 L;  4IOA A;  1XMQ Q;  1FJG Q;  2Y0S E;  3ICE A;  4GN3 B;  1BBW A;  2PQA A;  4QL5 A;  1SRU A;  1TXY A;  3HFZ B;  1QUQ A;  1SR3 A;  5DLQ E;  2KCT A;  4DUZ Q;  1VQH A;  4NXN L;  2JA8 G;  3S1M H;  1OXX K;  3PGZ A;  5E7N A;  4JI3 L;  1Q1E A;  2YTY A;  1N9W A;  1I5F A;  4PZ7 A;  2PMZ E;  4BY1 H;  3I4N H;  1SMX A;  2GVA A;  4LFA Q;  1X9N A;  4JYA Q;  2E5L L;  2N49 A;  1XPU A;  4A3G G;  2IX0 A;  3PCO B;  4B3T L;  1IZ6 A;  2VS1 A;  3I2Z A;  4YWL A;  4LW1 A;  1PH6 A;  4IJH A;  4JI1 L;  3W1B A;  4GLV B;  3ERS X;  4HJ8 A;  4EX5 A;  1KQS A;  1NMF A;  5BR8 Q;  2HT1 A;  1Z9F A;  2OQK A;  4A3E G;  1BVS A;  1R9T H;  3STB D;  1Q82 C;  4DV3 L;  4GN5 A;  1VQ7 A;  2QEX A;  4A3I H;  5M3F G;  2F3I A;  4UP9 A;  3M4Q A;  4QY7 A;  1NJI C;  1GM5 A;  1HR0 Q;  4X66 L;  1VQ6 A;  4JOI A;  5FLX c;  2ZJR A;  4A93 H;  4POG A;  3HKS A;  4DK3 C;  3S16 H;  3WWV A;  1A8V A;  5IWA L;  4DV1 L;  3RZD H;  1S40 A;  3K7U C;  1VQO A;  3S1Q H;  4BY7 H;  3AFQ A;  2JA7 H;  5GAH C;  1UE5 A;  3PF5 A;  5ELO A;  4C3H H;  1SLJ A;  1I94 Q;  1B70 B;  3OTO L;  3I7F A;  2MQH A;  4KHP L;  1L1O C;  4IPD A;  2RF4 A;  1YNX A;  4JI6 L;  1HNW Q;  3AFP A;  5J3B A;  4X65 Q;  4R4T A;  4J15 A;  2AWN A;  1SRO A;  2DGY A;  4Y7N H;  3J80 c;  4A3K H;  2E2J H;  1VQ8 A;  2PQA B;  3E0E A;  3E9H A;  1Q81 C;  2PI2 E;  2R6G A;  3UDX A;  3KYH C;  4APV A;  1Y1V H;  1NBW A;  1K8A C;  2R92 G;  1BBU A;  1FGU A;  2VW9 A;  2D0O A;  1D8L A;  5C0X G;  1T9H A;  4NXM L;  1N32 Q;  2ZJP A;  2AMC B;  3F8T A;  4DR2 L;  2K5N A;  1XPO A;  1PA6 A;  4DV7 Q;  3UDG A;  1PV4 A;  3CCE A;  1M90 C;  4JI7 L;  3CD6 A;  2K5V A;  3GDE A;  1X3G A;  4DV5 L;  3TRZ A;  1E3P A;  1SFO H;  2NVQ H;  2Z6K A;  3HKZ E;  5IP9 H;  3PO3 H;  4YCU A;  3PUW A;  1OTC A;  1W3S A;  3AQQ A;  2RHQ B;  5GAE C;  1X3E A;  4KI0 A;  4GNX A;  3W5O A;  4LFC L;  4K0K Q;  2JA8 H;  2WB1 G;  1XNR Q;  1A0I A;  3I4O A;  4GOP C;  2I5M X;  2PI2 A;  3CCR A;  1UE6 A;  3K81 C;  4XTC S;  1VQN A;  2I5L X;  3A5U A;  1C0A A;  4OON A;  3U4Z A;  3DM3 A;  3GD7 A;  1N34 Q;  1CSQ A;  3CQZ H;  5IYC G;  4BXX H;  3ZJY C;  1U5K A;  1VQA A;  1WOC A;  4IPG A;  3ULP A;  1Q7Y C;  4B3M L;  1ASZ A;  4JI5 Q;  4DUY L;  4GS3 A;  4LF8 L;  4LF5 Q;  4MTN A;  4DR3 L;  1KAW A;  4A3E H;  5JJI A;  1PH2 A;  1YJW A;  1P16 A;  2OWO A;  3HOY G;  3CCQ A;  2AHO B;  4C3I H;  1K73 C;  1M1K C;  3M7N A;  1TWH H;  2N8N A;  4JI3 Q;  1SN8 A;  5M3F H;  3H3V H;  4DR7 L;  4HIO A;  1SE8 A;  2UXB L;  1EQR A;  3RLF A;  3U58 A;  4LF4 L;  2HQL A;  1DGS A;  3U4V A;  4DAY B;  2ZM6 Q;  1C9O A;  3CF5 A;  2YTV A;  3G71 A;  3GO5 A;  3H3V I;  4UP7 A;  1X3F A;  1NMG A;  5AJ3 L;  4OXP A;  4P75 A;  3T1Y L;  4PG3 A;  3CCJ A;  1IBM L;  1JJG A;  2CKZ B;  2NVY H;  4IPC A;  3I56 A;  3HOW G;  4MZ9 A;  1IBL L;  1QVF A;  4WJ4 A;  1XPR A;  1HNZ L;  3CC7 A;  4JC0 A;  4YY3 Q;  3CW2 C;  4YHH Q;  1FL0 A;  2HIX A;  4B3R Q;  1HZ9 A;  2I5H A;  1IBK L;  2HIV A;  4IFD J;  2KCM A;  2E2I H;  2JQO A;  2R92 H;  4A3C G;  2KHI A;  1KRS A;  1HJP A;  1W2B A;  1QVG A;  2ZJQ A;  4JV5 L;  2KEN A;  3PUV A;  1E7Z A;  2EQS A;  1I50 H;  5IYB G;  3U50 C;  3PUZ A;  1YIT A;  1N36 Q;  5JJK A;  3UE1 A;  4C3J H;  1EIF A;  2CWA A;  2YU9 H;  4L5T A;  4UY8 C;  3PO2 G;  2JA6 G;  4DR4 L;  4KHP Q;  4JI6 Q;  3H0G G;  5IY0 A;  3L7Z C;  4DR5 Q;  2XGT A;  1PH9 A;  3PSI A;  5EAY A;  5C0X I;  1VQL A;  3M4O H;  2UXD Q;  2B63 G;  2F4V L;  2VQE L;  2LXJ A;  3PV0 A;  4JBM A;  1GVP A;  2JA5 G;  1CKN B;  3AYH B;  4KHZ A;  3OW2 A;  3MXN B;  1PH5 A;  2JEB I;  4GKJ Q;  4WJ3 M;  1JT8 A;  4NXM Q;  1OXU A;  4DR1 L;  4BXX G;  3CXC A;  4DV6 L;  4DV5 Q;  5IYC H;  3GTP H;  4OO1 G;  3GTK H;  4BA2 I;  4OX9 L;  4X64 L;  5M3M H;  3JAM i;  2K75 A;  3F2D A;  1K83 H;  4O0A A;  2HHH Q;  1LM0 A;  4JCV E;  2UU9 L;  1D7Q A;  4AYB G;  2F52 A;  4DR6 Q;  1KXL A;  3HOY H;  3HOX G;  5ELN A;  4LFC Q;  3IRB A;  4JI2 L;  2H5X A;  3KOJ A;  3AEV A;  1AE2 A;  3KF8 B;  3CPF A;  1LYL A;  4LF7 L;  1E1O A;  3J7A 5;  2VUM G;  5GAG C;  3G6E A;  2UUC L;  1JJ2 A;  3STB C;  4P71 A;  3NEN A;  3HOZ G;  3MEF A;  4DUY Q;  4LF8 Q;  2UUA L;  2CCZ A;  2AKW B;  3CMA A;  2VQF L;  4UPA A;  5LMU Q;  4A76 A;  2Q2I A;  3A0J A;  1J5E L;  1OXS C;  2PNH A;  2E8G A;  1CKO A;  1L1O A;  1UWV A;  4DV2 L;  4PMW A;  1JB7 A;  3HOW H;  5C4X G;  1XMO L;  3S14 H;  2Z0S A;  2VZA A;  1PH4 A;  5JEA J;  1VQG A;  2CWP A;  4BBS G;  2UXC Q;  1PYS B;  2MNA A;  1LTL A;  2A1A A;  1TWF H;  3LGJ A;  2DUD A;  5GRO A;  4IO9 A;  3TRE A;  4JI0 Q;  4LF9 L;  2R7Z H;  1XTD A;  4R4O A;  2VNU D;  3KLW A;  5GAD C;  4QGU A;  2KHJ A;  5HY6 A;  4DPG A;  2BA1 A;  5IYB H;  5AJ3 Q;  4GKK L;  3CC2 A;  1GO3 E;  1IBM Q;  1XJV A;  3PO2 H;  2ES2 A;  4B3S L;  2VL6 A;  5LMN L;  2JA6 H;  2WFW A;  2JEA I;  1VQC A;  3TS0 A;  4HJ9 A;  4YCW A;  1PH1 A;  3H0G H;  4JBW A;  1MJC A;  1FJG L;  1QZH A;  2OCE A;  2C35 B;  5M5Y H;  2EXD A;  2B63 H;  3D0F A;  5C3E G;  4RMF A;  2V1C C;  4MNO A;  2JA5 H;  1K0R A;  4GLX A;  2WAQ G;  4NPS A;  3S24 A;  4LFA L;  2QGQ A;  4P74 A;  1OXT A;  4JYA L;  1TWC H;  4X62 Q;  3EBE A;  4GOP A;  3K8A A;  2ZTE A;  4YWM A;  4EQ5 A;  1L0W A;  4JV5 Q;  1YVC A;  2R93 G;  2GN5 A;  3A74 A;  3CPW A;  2QA4 A;  3GTQ H;  3GTO H;  1HZA A;  4QQB X;  2Y0S G;  2ALY B;  4BA1 I;  5M3M G;  3PIO A;  3FP9 A;  4HIM A;  1HZB A;  4LWC A;  3M9B A;  5BR8 L;  1PVO A;  2I0Q A;  2IHF A;  1AH9 A;  1JE5 A;  1B7Y B;  3GTJ H;  2F4V Q;  3RLN A;  4UP8 A;  4IFD G;  4YCV A;  3CC4 A;  4XIG S;  1CKN A;  2BH8 A;  4NXN Q;  4L5Q A;  1PH8 A;  3HOX H;  3PF4 A;  1L1O B;  1IL2 A;  3CAM A;  4LUZ A;  1E24 A;  4OO1 I;  1L2F A;  1XNQ L;  2YYZ A;  1CSP A;  2E5L Q;  2R7F A;  3S1N H;  3G48 A;  4BBR G;  1WJJ A;  4B3T Q;  2VUM H;  4JBJ A;  1JMC A;  1Q86 C;  1X54 A;  3PUX A;  1MKH A;  2CFM A;  4P72 A;  4DNI A;  2N78 A;  4DV6 Q;  4HID A;  4JI1 Q;  4KLK A;  2AWO A;  1MJE A;  2YV5 A;  1A62 A;  5C44 G;  3HOZ H;  2N3S A;  3OYY A;  2KBN A;  1V1Q A;  1HNW L;  4DV3 Q;  1VQB A;  4X65 L;  1VQE A;  4PZ6 A;  1ASY A;  5C4X H;  4X66 Q;  4QJF A;  5HGQ A;  1K3R A;  1PHJ A;  4LF7 Q;  2R7Z G;  1G51 A;  5IWA Q;  1K9M C;  4DV1 Q;  4BBS H;  3FHW A;  4AQY L;  3K80 C;  4A3C H;  3S2D H;  3T1H L;  4GLA C;  5C4J H;  2UUC Q;  3GTL H;  1N32 L;  2HHH L;  3VDY A;  3Q8D A;  4DV7 L;  3OTO Q;  4GOP B;  3HOU H;  4RG1 A;  1YIJ A;  1PH7 A;  4OWX B;  3UDF A;  2NN6 G;  2UUA Q;  3ER0 A;  3HOV H;  1CKM A;  1X55 A;  2D62 A;  2UUB L;  4IOC A;  3F2B A;  4LF6 L;  1QZG A;  4DV2 Q;  3FKI G;  5IT9 c;  2Q2H A;  1Q12 A;  2LXK A;  4NB3 A;  4HJA A;  1YJN A;  1XMO Q;  2MFI A;  1VQP A;  1JJC B;  1WCM G;  2IX1 A;  1I6H H;  1YHB A;  1WFQ A;  4K0K L;  5C3E H;  1XNR L;  3J81 i;  3BJU A;  3TEH B;  4LF9 Q;  3RZO H;  5FLM G;  2WB1 E;  1LUZ A;  2MO1 A;  2R7D A;  1X6O A;  3RR5 A;  1BKB A;  2VY3 A;  4DR2 Q;  4GKK Q;  4A3M G;  1C7Y A;  1NE3 A;  3JC6 6;  4JI7 Q;  3HKZ G;  3PIP A;  4JBK A;  1HH2 P;  1VQD A;  1N34 L;  1Q1B A;  3CP0 A;  4GN4 B;  3NEL A;  1EIY B;  2R93 H;  3CCS A;  3RNU A;  4DV0 L;  4A3B G;  5JEA G;  4LF5 L;  1X65 A;  1PYB A;  2E2H H;  2XTI A;  3RN2 A;  1NY4 A;  1HNX L;  4JI4 L;  1VQF A;  1YZ6 A;  3J80 i;  3H15 A;  2OTL A;  3K0X A;  4LNQ A;  2NVT H;  1TWA H;  1G6P A;  3A5Z B;  3TQY A;  4HJ7 A;  1YI2 A;  3ULL A;  1KHI A;  4A3D G;  4BBR H;  2IT1 A;  3S15 H;  4IFD I;  2ZM6 L;  3CCM A;  4OWT B;  4B3M Q;  5JJL A;  3RN5 A;  3CCU A;  4LFB L;  1O7I A;  1VQK A;  5C44 H;  4DR3 Q;  4IJL A;  1EWI A;  1VCI A;  1VQI A;  4QIW E;  3F1Z A;  4YWK A;  3SGI A;  5IYD H;  4JOI C;  4POF A;  3B6Y A;  2IY5 B;  1KL9 A;  4R4Q A;  1IXR A;  3S1R H;  3J81 c;  4DR7 Q;  5M5W H;  3S17 H;  1KRT A;  4YY3 L;  4O2D A;  4YHH L;  4B3R L;  1XNQ Q;  2UXB Q;  3DLL A;  4LF4 Q;  1N33 L;  1Q46 A;  3E9I A;  1TWG H;  3KDF B;  3G4S A;  2JJQ A;  3M4P A;  3KF6 B;  4AIM A;  1QVC A;  2RHS B;  1OXV A;  3HOU G;  1G29 1;  4JI8 L;  1N36 L;  3JAM c;  2ASB A;  1FVI A;  3T1Y Q;  3GTM H;  1Z47 A;  3HOV G;  5IP7 G;  1PH3 A;  3W1G A;  4DV4 L;  1PFS A;  1V9P A;  2OTJ A;  1J6Q A;  1XMQ L;  2A8V A;  4A3L H;  4Y52 H;  3I4M H;  4LUO A;  4DR5 L;  4AH6 A;  5GQO A;  1IBL Q;  1YHQ A;  2ATW A;  3FKI H;  1A63 A;  2BA0 A;  2UXD L;  1HNZ Q;  2Q2T A;  3KJO A;  4DUZ L;  4A3F G;  1WCM H;  1Y1W G;  1IBK Q;  1S72 A;  1QUQ B;  1YHA A;  2NN6 I;  4AQY Q;  4OWW B;  3I55 A;  5FLM H;  4GKJ L;  3T1H Q;  5FJ8 G;  1MIU A;  1YBY A;  1UE7 A;  2Z6K C;  3BZC A;  4C2M H;  2GVB A;  2Q2U A;  2MO0 A;  4FDB A;  4ME3 A;  4A3M H;  1KD1 C;  1VQ5 A;  1WYD A;  1VS0 A;  4PZ8 A;  1KC8 C;  4DR4 Q;  4A3J G;  1VQM A;  4GNX C;  3CCL A;  5IE8 A;  3PUY A;  1V43 A;  1UEB A;  3RLO A;  2IHE A;  1EFW A;  1NTG A;  2UUB Q;  4R4C A;  4LF6 Q;  3D31 A;  4A3B H;  1GKH A;  2JK8 A;  2LSS A;  3K7A H;  2RCN A;  2VQE Q;  2D0P A;  4DR6 L;  1EOV A;  3L2P A;  5M5X H;  1GD7 A;  4AYB E;  3I4N G;  4BY1 G;  1HR0 L;  2ID0 A;  4L5S A;  2NZO A;  5K36 G; 
#chains in the Genus database with same CATH topology
 2F0O A;  1BOS A;  2CW0 C;  2BH2 A;  2C9O A;  3M85 A;  4DV0 Q;  4OX9 Q;  4QMG A;  1LTB D;  3KFU A;  5D3I B;  1UE1 A;  4L5R C;  4JI4 Q;  5EQ0 A;  2XWB B;  4B08 A;  2F0L A;  4J1M A;  4E6I A;  5CV5 A;  4TVA B;  1PRT D;  4JG2 A;  1EQQ A;  3S17 B;  3QG1 A;  1S5F D;  1TWF B;  3ULJ A;  3M3Y H;  4IPH A;  3GTG H;  1YEZ A;  2K52 A;  1YJ9 A;  5DAU A;  1RTO A;  5IP7 H;  3P75 A;  3I4M G;  3TS2 A;  3EIV A;  1DOL A;  3OPO A;  1EUJ A;  1Y14 B;  1KIX A;  3D4R A;  5COY A;  4J6H A;  3J81 E;  3L0O A;  2P5Z X;  3UE0 A;  2NVX H;  1VQ9 A;  3KLS X;  1MGS A;  1HR0 W;  2JA5 B;  5CBA E;  1CT1 D;  3R3O A;  3P20 A;  4A3J H;  4B9W A;  4OGQ C;  3BYY B;  3BDL A;  1XMQ Q;  1JWS D;  3ITP A;  1SYG A;  5D3D A;  2ICI A;  3NK9 A;  4QL5 A;  5J39 A;  1SRU A;  1CA5 A;  4ZYS A;  1HCZ A;  1IL8 A;  2K7V A;  2ZXP A;  1VQH A;  2B2T A;  4NXN L;  1OXX K;  3PGZ A;  5E7N A;  4LFA Q;  2E74 C;  2GVA A;  2R61 A;  2TMP A;  1XPU A;  4AYB B;  4A3G G;  1CHQ D;  3PCO B;  3T13 A;  4F7X A;  1C8C A;  4B3T L;  3HOX B;  1G6Z A;  4YWL A;  4LW1 A;  5DM7 3;  3ND9 A;  4JW0 A;  1QCB D;  3ERS X;  4HJ8 A;  2VUM B;  1Z9F A;  2K03 A;  3H91 A;  1GJX A;  4QB4 A;  3WOF A;  4X66 L;  4HN7 A;  5L37 A;  5FLX c;  2OXP A;  2ZJR A;  4FP5 D;  2G9H D;  3DXJ C;  5C5M A;  4DK3 C;  3WWV A;  4DV1 L;  3VR2 A;  4BY7 H;  2TSS A;  1BCP F;  5GAH C;  1EQT A;  5ELO A;  3R93 A;  5IOD A;  1B9M A;  1B70 B;  1SNQ A;  3OTO L;  1TS5 A;  3I7F A;  2MQH A;  2Z9H A;  4QUC A;  1YNX A;  4JI6 L;  4RAU C;  2IL8 A;  3HOU B;  3MHB A;  1SRO A;  1CQV A;  4RA8 A;  4KV6 A;  1VQ8 A;  3H6M A;  5CMD A;  2IWH A;  2CHB D;  5EBD A;  2PI2 E;  3TP5 A;  1S4Z A;  2VW9 A;  4R8I A;  2L4N A;  1T9H A;  5A2Q L;  4GKK L;  1I6H B;  2K5N A;  2K5V A;  1I4X A;  2NVQ H;  3HKZ E;  4B9X A;  4FNF A;  3NBH A;  4YCU A;  2B2U C;  1OTC A;  1D5Z C;  4KI0 A;  1FR3 A;  1XNR Q;  1A0I A;  1PLF A;  3I4O A;  2EYO A;  4U68 A;  3A5U A;  3CHB D;  1E0B A;  1SYE A;  4OON A;  4BXX H;  3CQZ H;  2KOL A;  1U5K A;  1B9N A;  2F0D A;  3ULP A;  1E2W A;  4DU9 A;  3ERO A;  1QG7 A;  2CW0 D;  1EYD A;  1F2L A;  4GS3 A;  4A3E H;  3T53 B;  1KAW A;  1YJW A;  2OWO A;  2FMC A;  4HMI A;  3HOY G;  1M1K C;  4C3I H;  4DR7 L;  3H3V H;  5M3F H;  4RCO A;  1EY5 A;  1EQR A;  3L9A X;  2QF7 A;  2HQL A;  4CKE A;  4UAI A;  5ELB A;  1C9O A;  1JB3 A;  3CF5 A;  3G71 A;  3ND8 A;  5EKI A;  1TWG B;  4H13 C;  5AJ3 L;  2KJX A;  1IBM L;  1AZQ A;  3VYR A;  1B4O A;  3I56 A;  3QOJ A;  3H3V C;  1DD2 A;  4JC0 A;  4YY3 Q;  3S9W A;  3I4M B;  1V8Q A;  2J0T D;  5EPL A;  3FKI B;  2E2I H;  4IFD J;  2E2J B;  2JSO A;  4N8F A;  1LO5 D;  1WCM B;  3AMU A;  4JV5 L;  1N36 Q;  1I50 H;  1LT4 D;  2BDO A;  3N6R A;  3QO2 A;  4UY8 C;  3PO2 G;  4DR4 L;  4JI6 Q;  1HFG A;  5I9O A;  2AQ3 B;  2WKC A;  2XGT A;  4DR5 Q;  4YIJ A;  1PH9 A;  3PSI A;  1IYV A;  3M4O H;  2B63 G;  5TSS A;  4JBM A;  1JE4 A;  2EVB A;  4A3B B;  1PH5 A;  3H09 A;  1JT8 A;  1YNJ C;  3K58 A;  1JOO A;  5FO9 B;  5M5X B;  1O7Y A;  2PZW A;  3GTP H;  1IYU A;  2RDH A;  3D6W A;  4ULL A;  4RGM A;  4BA2 I;  5E1F A;  1GUS A;  4A3G B;  4S3S A;  1K83 H;  2UU9 L;  1D7Q A;  4JI2 L;  1XWE A;  3VYT A;  4XT1 B;  2KED A;  3DWA A;  5GAG C;  1F77 A;  5C6A A;  1PRT B;  1QE6 A;  3STB C;  3IKJ A;  1NCV A;  3HOZ G;  3MEF A;  4DNT B;  1PZI D;  2F0F A;  1GUT A;  2AKW B;  1QNK A;  5EKK A;  2VQF L;  4A76 A;  1J5E L;  3A0J A;  3K5M A;  1EOT A;  2PNH A;  2E8G A;  4OEM B;  1CKO A;  3DUZ A;  5K5P A;  3HOW H;  1XMO L;  4XQN A;  4V19 0;  3S14 H;  2LMC B;  2Z0S A;  5JEA J;  1VQG A;  5NUC A;  3IL8 A;  2MNA A;  2A1A A;  2NVY B;  1TWF H;  3LGJ A;  4IO9 A;  4LF9 L;  4JI0 Q;  2MGS A;  1XTD A;  2KEC A;  4I7Z C;  1BR9 A;  3KLW A;  2KHJ A;  4PV1 C;  5HY6 A;  1Y1W B;  3K5O A;  5IYB H;  5AJ3 Q;  1BXT A;  3GQB A;  3E0J A;  5FK9 C;  1IBM Q;  1XJV A;  2VL6 A;  5KNB A;  3TS0 A;  4HJ9 A;  1FJG L;  3R2T A;  4JBW A;  2NYZ D;  2C35 B;  5M5Y H;  2WII B;  2QEJ C;  5C3E G;  3WDN A;  4KD3 A;  2JA5 H;  2BCO A;  2KVM A;  2WAQ G;  3PMF A;  3S24 A;  2QGQ A;  4P74 A;  5COR A;  4DFA A;  4JV5 Q;  1L0W A;  2VB2 X;  3A74 A;  3GTQ H;  3PIO A;  5IGC A;  1PVO A;  5BR8 L;  3M9B A;  1II3 A;  2I0Q A;  1EIG A;  1JE5 A;  1O7Z A;  1TVX A;  3GTJ H;  2RDF A;  4XIG S;  1SNO A;  1PH8 A;  3HOX H;  3MXN A;  3PF4 A;  2F0Q A;  3SR1 A;  1D6E C;  4K2K A;  1HUN A;  2CH4 W;  4A3I B;  3HOY B;  2VUM H;  4JBJ A;  1JMC A;  2WV6 D;  3PUX A;  4P72 A;  2LY7 A;  3U9O A;  4DF7 A;  2AWO A;  4DXF A;  3RZD B;  4TSS A;  3S1Q B;  4EQO A;  1HNW L;  1I4R A;  1YNN C;  4ODG A;  4X65 L;  3KF8 A;  3M7G A;  4QIW B;  4RFB A;  2R7Z G;  1BUV T;  1G51 A;  5IWA Q;  1K9M C;  1PFB A;  4Y7N B;  3K80 C;  4GLA C;  4CKB A;  2R3Z A;  4DV7 L;  1Y1V B;  1L0X B;  4GOP B;  3HOU H;  4RG1 A;  4OWX B;  2G5D A;  2DJF C;  1CKM A;  2D62 A;  4IOC A;  3F2B A;  2HDL A;  2LFN A;  4OIJ A;  5IT9 c;  4NB3 A;  1XMO Q;  3TME A;  3PO2 B;  4JPB W;  1I6H H;  3CRK C;  3FVQ A;  2EYL A;  1B2T A;  3TEH B;  4LF9 Q;  5FLM G;  3DEO A;  2RBM A;  3GV6 A;  4DR2 Q;  2JA8 B;  4A3M G;  4KJO A;  1NE3 A;  3JC6 6;  1GUN A;  2R93 H;  1TWC B;  3CCS A;  2DJG C;  2QDB A;  5E3F A;  2B2W C;  1K0S A;  1PYB A;  2CVR A;  1IKL A;  3J80 i;  2NB0 A;  4LNQ A;  3IFT A;  1PTO F;  5KYL A;  2NVT H;  3K5L A;  1G6P A;  4HJ7 A;  1KHI A;  4BBR H;  3CCM A;  1WTH A;  4OWT B;  4LJZ C;  2K28 A;  3SK8 A;  1Q8I A;  5C44 H;  1VQI A;  4QIW E;  4DAP A;  1QIL A;  1KL9 A;  1IXR A;  3HOZ B;  5M5W H;  3RD4 A;  3U9S A;  3DEP A;  4B3R L;  1Z6H A;  1UEA B;  2FMM A;  1TWG H;  1JCK B;  3EVQ A;  2ZT9 C;  2A5H A;  3KF6 B;  3K57 A;  1OXV A;  4JI8 L;  2Z4I A;  1H9J A;  3JAM c;  4DXG A;  3GTM H;  3T1Y Q;  2R92 B;  1Z47 A;  4DV4 L;  4WFN 3;  1A2T A;  1IW7 C;  3I4M H;  4LUO A;  3EFX D;  5GQO A;  2YU9 B;  3FKI H;  1A63 A;  2BA0 A;  4MN3 A;  2Q2T A;  3KJO A;  1WCM H;  5KIX A;  1QUQ B;  1S5E D;  4OWW B;  1UE7 A;  3BZC A;  5J22 A;  2GVB A;  2VB3 X;  4PZ8 A;  1KC8 C;  2WAQ B;  3CCL A;  5BN3 A;  1FD7 D;  1EFW A;  3PUY A;  2F1M A;  4R4C A;  3LWE A;  4A3B H;  1GKH A;  1S5D D;  1ESR A;  2RCN A;  5CV7 A;  5EPJ A;  1EOV A;  5M5X H;  1GD7 A;  4BY1 G;  1ZKO A;  3IFD A;  1Z7T A;  5K36 G;  1LTT D;  5FOB B;  3J81 j;  4HJ5 A;  4A3D H;  4A3G H;  3BU2 A;  3TDQ A;  2KUM A;  2YTX A;  1S3O A;  4X64 Q;  3CCV A;  1F9Q A;  2MPM A;  5KYI A;  2FXQ A;  1SYB A;  2B39 A;  1E22 A;  4RKL A;  1U4R A;  1YNN D;  4A93 G;  1ET9 A;  3EN2 A;  2UXC L;  3PQI A;  4DKA C;  2JA7 G;  3NEM A;  2QW7 A;  1EWH A;  1DOK A;  3T16 A;  2R7Z B;  1U0L A;  2I46 A;  4X6A H;  2F0K A;  3J7Z C;  1BCP B;  4TQU S;  3QIA A;  1GXD C;  2BOS A;  1G8Z D;  2NZH A;  4R4I A;  1Q8K A;  2AQ2 B;  4A3K G;  2HDM A;  5KND A;  1TS3 A;  4GNX B;  1ENA A;  2JA6 B;  3KDF A;  2IW3 A;  3OMG A;  4A3F H;  1Y1W H;  2EJG C;  1EEF D;  3KUP A;  3R2I A;  2WAQ E;  4X62 L;  3UDI A;  1ZEQ X;  4JI8 Q;  3W2D A;  4C1N K;  2ZTD A;  3MWY W;  1N8R C;  3PO3 G;  1B8A A;  2EOT A;  2PCF B;  3G7L A;  4DV4 Q;  4B3S Q;  5LMN Q;  2SNM A;  2L55 A;  4JI5 L;  4CDD C;  4HCS A;  4GN3 B;  4A3M B;  2L11 A;  4FF3 A;  3S1M H;  2KCT A;  2B2W A;  1NNX A;  2B2Y C;  1Q90 A;  4H44 C;  3I4N H;  1HQR D;  1EU4 A;  1STE A;  4JYA Q;  4G4K A;  2E5L L;  4G7H C;  4I65 A;  1CA6 A;  2K04 A;  3AB9 A;  4IJH A;  4JI1 L;  2LS0 1;  2F0N A;  1KQS A;  3NP8 A;  1BVS A;  3MFY A;  2EXZ A;  3G6J B;  3Q22 A;  5DM6 3;  1RCV D;  4BWG B;  4P2C B;  5LHY 1;  1VQ7 A;  4A3I H;  1GM5 A;  2KA7 A;  2O5I C;  3D8G A;  3RZD H;  3D3R A;  1U4M A;  1SNC A;  1PTO D;  1S40 A;  1VQO A;  3S1Q H;  3K0Y A;  1F2Z A;  3VR4 A;  4IUP A;  3H94 A;  4BBS B;  2RF4 A;  2F0P A;  3AFP A;  2F0S A;  3MFG A;  4Y7N H;  1JWM D;  2DGY A;  1MHW C;  1C48 A;  2PQA B;  3E0E A;  3TP7 A;  2LKV A;  1I3Q B;  2R6G A;  2DY8 A;  4HMJ A;  5C3X A;  1Y1V H;  1NBW A;  1K8A C;  2A6H C;  1K28 A;  4QF4 A;  4CJ1 B;  5C0X G;  4IUR A;  4NXM L;  2JP1 A;  1N32 Q;  1ZYR C;  4RCN A;  1C4Q A;  2ZJP A;  2HHH Q;  4JI7 L;  3RZO B;  3CCE A;  1QWY A;  4DV5 L;  1X3G A;  1SFO H;  1BDO A;  5IP9 H;  5C5L A;  5JVG 3;  3AQQ A;  3HP3 A;  1KTK A;  5ELD A;  2KQ3 A;  2JA8 H;  3SK4 A;  2WB1 G;  1DZ1 A;  4GOP C;  3CCR A;  1EZ8 A;  4KN4 C;  3D4W A;  4NDX A;  4XQJ A;  3FMC A;  3GV3 A;  1VQN A;  1RKN A;  3TP8 A;  4K5X A;  4ME5 A;  4B3M L;  1WOC A;  2BE5 D;  4JI5 Q;  2CQA A;  2F4I A;  2EYH A;  4DR3 L;  1ONL A;  1P16 A;  1EY9 A;  4UDU C;  3CCQ A;  2AHO B;  3M7N A;  3P1H A;  2ZXO A;  4LF4 L;  4DAY B;  1ILP A;  2ZM6 Q;  4FYD A;  3SHL A;  4A93 B;  2YTV A;  3IAY A;  1SE2 A;  5EJW A;  2RVL A;  2XNA C;  4IAL A;  2JA7 B;  1JJG A;  2CKZ B;  2A69 D;  4IPC A;  1CZW A;  4MZ9 A;  1IBL L;  3BG3 A;  4YHH Q;  1FL0 A;  2HIX A;  4CBV A;  1EY6 A;  2I5H A;  4Z9C B;  5KNC A;  1H9S B;  2R92 H;  4A3K B;  1EU3 A;  1KRS A;  1HJP A;  3MAQ A;  1WTR A;  2ZJQ A;  2EQS A;  5JJK A;  3PUZ A;  4C3J H;  2YU9 H;  5T1I A;  3FEW X;  2H4O A;  5FLX L;  3H0G G;  3E6Z X;  2X6L A;  1UNS A;  2B2V C;  2NZ1 D;  5C0X I;  3HKZ B;  2AUJ D;  1A6X A;  4PQX A;  1H9R A;  1BF4 A;  3X3N A;  1MD2 D;  5CV6 A;  3OW2 A;  4NXM Q;  2B2Y A;  1X3Q A;  4DR1 L;  2RQX A;  1SE3 A;  4DV5 Q;  5IYC H;  3F2D A;  4OHJ A;  4EQP A;  1I4P A;  1XYI A;  4DR6 Q;  2F52 A;  1CZG A;  2PQE A;  3KOJ A;  2H1E A;  4FXG C;  3AEV A;  4PMC A;  1LYL A;  2DNC A;  3J7A 5;  1K8M A;  1VF7 A;  3OW7 A;  2I07 B;  2QCP X;  3L3O C;  2EYF A;  4MIU A;  3CMA A;  1WVL A;  1JB7 A;  5FKA C;  1STN A;  5C4X G;  5IGE A;  3SE0 A;  1LTL A;  2R7Z H;  4A3C G;  4H7B A;  1HRJ A;  4R4O A;  4PMB A;  5GAD C;  4QGU A;  2A6H D;  1NSN S;  1TY2 A;  3VA5 A;  3DHQ A;  4DPG A;  3S2H B;  1HHV A;  3CC2 A;  1GO3 E;  2XIW A;  2JA6 H;  1G91 A;  2JEA I;  2L1B A;  1L0Y B;  2PW5 A;  4R9W A;  4YCW A;  1QZH A;  3I8Z A;  1V1P A;  1W6J A;  4NP5 A;  3BVG A;  1K0R A;  4NPS A;  4WRD A;  1B3Q A;  4GOP A;  4EQ5 A;  1STA A;  2WB1 B;  3CPW A;  3SK5 A;  1HZA A;  1NAP A;  4QQB X;  2Y0S G;  4OO1 H;  5M3M G;  4HIM A;  1HZB A;  3D4D A;  4LWC A;  1O7L A;  5I6Y A;  5CV4 A;  1PFN A;  4UP8 A;  4CDC C;  4NXN Q;  1CKN A;  4N8X 1;  3BDC A;  3NTK A;  4K5V A;  1IL2 A;  1HTL D;  4C1N I;  3CAM A;  2YYZ A;  1CSP A;  2R7F A;  3G48 A;  1WJJ A;  4B3T Q;  1O78 A;  2BDN A;  4QCL A;  1BQQ T;  1X54 A;  1MKH A;  3J7A V;  1PTO B;  4KLK A;  1A62 A;  4CJ2 C;  2L0C A;  5JVH 3;  3FRP B;  4WOR A;  1VQB A;  2G9D A;  3K6O A;  4EQN A;  4PZ6 A;  1CM9 A;  4RGN A;  4CJ0 B;  4X66 Q;  4IUV A;  4DNR B;  4DV1 Q;  4BBS H;  3OWF A;  3NWS A;  3S2D H;  3Q8D A;  2WAC A;  3OTO Q;  3TSS A;  1PH7 A;  2NN6 G;  3ER0 A;  2UUB L;  1QZG A;  2AQ1 B;  2Q2H A;  5ISR A;  2LXK A;  4CKC A;  4HJA A;  1VQP A;  1JJC B;  2O5J C;  1YHB A;  4K0K L;  3ZYY X;  3RZO H;  2N55 A;  3BJU A;  2WB1 E;  1BKB A;  4WJW A;  4GKK Q;  1ICF B;  2O4X A;  3NSW A;  5I2Y A;  3PIP A;  4FVM A;  1HH2 P;  1RD9 D;  3J80 L;  1N34 L;  4JBK A;  1EIY B;  1G2S A;  4LF5 L;  4KKT A;  2E2H H;  4IFD H;  2DNE A;  5I2X A;  1I4G A;  1VQF A;  3H15 A;  4FXD A;  1LLR D;  4M1U B;  1VDZ A;  1KDA A;  2O2L D;  3ULL A;  3I3C A;  4HSP A;  4DK1 A;  4U67 3;  4LFB L;  3CCU A;  1O7I A;  1EY4 A;  5EKL A;  2RCF A;  4IJL A;  4YWK A;  3SGI A;  3F1Z A;  3Q0A A;  3B6Y A;  2IY5 B;  4DR7 Q;  1MSG A;  5JPM C;  3S17 H;  4O2D A;  4UHV A;  5A35 A;  4OL7 A;  5JAV A;  3OSO A;  5C4Z A;  3E9I A;  5I9P A;  1SE4 A;  3BZD B;  2JJQ A;  5C4X B;  1CI3 M;  1QVC A;  3QB3 A;  2ZXR A;  3O13 A;  3OIQ A;  2GA4 B;  5IP7 G;  4L6T B;  4MHE A;  3GTL B;  1HA6 A;  1UUP A;  1JC7 A;  1YHQ A;  2E2D C;  2UXD L;  2B2U A;  2M00 A;  5A2Q E;  2F0M A;  2RSN A;  1S72 A;  2FJ2 A;  1YHA A;  2NN6 I;  3I55 A;  4GKJ L;  1LTR D;  4ZRZ A;  2Z6K C;  1JR0 D;  3BVZ A;  2MO0 A;  5KEE A;  3URY A;  1E2Z A;  3AU7 A;  4A3J G;  4DR4 Q;  3MZ5 A;  4IUN A;  1V43 A;  2IHE A;  2UUB Q;  1K3B C;  1NUC A;  1AEX A;  5JEA H;  2B8F A;  2EDG A;  1SMY C;  3Q6S A;  2Y0S B;  2Z1C A;  5M3M B;  2OF1 A;  1HR0 L;  2ID0 A;  3NPP A;  2WKD A;  3FPP A;  1AE3 A;  5IT9 L;  1HZC A;  4HIK A;  3HZX A;  3P7J A;  2K1B A;  1VQ4 A;  4P73 A;  4LMQ D;  2OQ0 A;  5C0X J;  3OMC A;  5I6W A;  1NR4 A;  2HD3 A;  4TKO B;  4K8J A;  3CME A;  2EE1 A;  1SYF A;  5LMU L;  1LT5 D;  2UU9 Q;  4JVZ A;  1SYC A;  4JI2 Q;  1FNV A;  3F2C A;  4LUV A;  5ELE A;  1RIP A;  1XXG A;  1SSO A;  1KDC A;  4BY7 G;  5ELF A;  5IGF A;  1LTS D;  4KD4 A;  3KJP A;  3KBX A;  4ZAI A;  4LFB Q;  4A75 A;  1KAB A;  2VQF Q;  2K50 A;  2L15 A;  4A3L G;  1J5E Q;  1D1K A;  3GP7 A;  1SJE D;  2K6A A;  3NBH B;  4ABN A;  3DWP A;  2K14 A;  1SDF A;  4H02 A;  1TT2 A;  1U4L A;  1B3A A;  5IGD A;  3S2H H;  2EYM A;  2B63 B;  2F0I A;  3LWU A;  4DAM A;  5FJ8 H;  1F9P A;  5H1S E;  2VXW A;  1YNJ D;  2B3G A;  2HQE A;  1EQV A;  4N9T A;  5IIF A;  2F0U A;  2IX3 A;  3NE5 B;  4KY6 A;  3VR6 A;  1FJG Q;  4IOA A;  2Y0S E;  2QKI C;  1BBW A;  2PQA A;  4EGV A;  3HFZ B;  5DLQ E;  4DGZ A;  1XTC D;  4JI3 L;  3EJI A;  3JAM L;  2EYJ A;  1SMX A;  3CRL C;  3KLR A;  1A15 A;  2N49 A;  2IX0 A;  1OO9 B;  1IZ6 A;  2VS1 A;  2EZV A;  1PH6 A;  4OIK A;  3A7L A;  1LT6 D;  4GLV B;  4XT3 B;  1NMF A;  5BR8 Q;  2HT1 A;  4A3E G;  3STB D;  4DV3 L;  4C3I G;  4G7O C;  4GN5 A;  1MI2 A;  4FF1 A;  5M3F G;  2F3I A;  4UP9 A;  1RHP A;  2SOB A;  1NJI C;  1HR0 Q;  1VQ6 A;  1GHK A;  3HKS A;  1XX8 A;  1W6K A;  4KK7 A;  1A8V A;  3NHH A;  3BVM A;  3K7U C;  4V0B A;  3PF5 A;  1SLJ A;  4KHP L;  5C4J B;  1HNW Q;  3KK7 A;  4RKB A;  2Q8I B;  4X65 Q;  4R4T A;  4J15 A;  2AWN A;  4L8J A;  2E2J H;  1FYC A;  3N52 A;  1PFM A;  3E9H A;  4DAY A;  1Q81 C;  3UDX A;  3MVV A;  3SEB A;  1BBU A;  1FGU A;  2EY1 A;  2D0O A;  1D8L A;  2EJF C;  1JOK A;  3F8T A;  4IN3 A;  4DV7 Q;  5C3E B;  3UDG A;  3CD6 A;  5HGT A;  3GDE A;  2M9V A;  5CBE E;  1KAA A;  2Z6K A;  2NVX B;  2CH4 A;  3PUW A;  3HRZ C;  2AUK A;  1W3S A;  3MTS A;  1X3E A;  3NTI A;  3X3M A;  1B50 A;  2I5M X;  2PI2 A;  1UE6 A;  1SMY D;  3K81 C;  4XTC S;  1WTX A;  1HQM C;  2I5L X;  1LAB A;  1LTA D;  3HS0 C;  3VA7 A;  3GD7 A;  3WOE A;  1SJH D;  2C5C A;  3ZJY C;  1VQA A;  4IPG A;  1Q7Y C;  3R8B A;  1ASZ A;  4BS9 A;  4DUY L;  2HUG A;  4MTN A;  5JJI A;  2J4X A;  1K73 C;  3I70 A;  4JI3 Q;  1SN8 A;  4HIO A;  4RGO S;  1SE8 A;  2PYK A;  4R8N A;  2UXB L;  3RLF A;  3U58 A;  4FO2 A;  1S5B D;  1DGS A;  3U4V A;  1Q3L A;  1A2U A;  4IQZ A;  3OWE B;  4C3H G;  1HFN A;  3H3V I;  4UP7 A;  1X3F A;  4ILW A;  4F87 A;  2K01 A;  3CCJ A;  2IPK D;  1SBB B;  4ZUJ A;  2K32 A;  4L63 B;  2NVY H;  3HOW G;  1QVF A;  5C3W A;  1HNZ L;  1PRT C;  3CC7 A;  3CW2 C;  4B3R Q;  1AP0 A;  1WTO A;  1IBK L;  1Y8O B;  2HIV A;  3NQT A;  2JQO A;  4J8Q A;  3TP6 A;  1W2B A;  3PUV A;  5IYB G;  1YIT A;  3J81 L;  4KHP Q;  4L5T A;  5I4D A;  4F88 A;  3L7Z C;  1VQL A;  2XVS A;  4HR7 B;  2NVQ B;  2VQE L;  3PV0 A;  1A3U A;  2JA5 G;  3AYH B;  4OEL B;  3MXN B;  5FO8 B;  1OXU A;  1EY0 A;  4JK1 C;  1KNE A;  3HEJ A;  5AFW A;  4ZUI A;  5M3M H;  3JAM i;  4OX9 L;  3NWT A;  2K05 A;  4K6L A;  1LM0 A;  4AYB G;  5JPN C;  3HOY H;  1FNU A;  5ELN A;  3HOX G;  1PMR A;  1TU2 B;  1AE2 A;  3KF8 B;  3CPF A;  1E1O A;  2VUM G;  5D65 A;  1D5X C;  1CK1 A;  3A56 A;  3FPU B;  3C3L A;  5M3F B;  2JYO A;  4DN4 M;  1JJ2 A;  2F0T A;  2HCC A;  2KHS A;  1LT3 D;  3NEN A;  2IJ0 A;  1I4Q A;  3Q23 A;  1F2Y A;  4DUY Q;  2NBF A;  2UUA L;  3PIO 3;  2L12 A;  1IHZ A;  1GHJ A;  2Q2I A;  4XDX A;  1V1O A;  4PMW A;  1NR2 A;  1IW7 D;  2CWP A;  2UXC Q;  1K8O A;  1PYS B;  4RWS C;  5GRO A;  1DYQ A;  2VNU D;  2B8G A;  1M8A A;  4DA2 A;  1WTW A;  1EFI D;  3PO2 H;  2ES2 A;  3A55 A;  2F0E A;  1VQC A;  1I50 B;  1MJC A;  2A68 C;  2OCE A;  2B63 H;  2K5D A;  2V1C C;  4MNO A;  5BN5 A;  4CDE C;  3M4O B;  3KBG A;  4LFA L;  1VMP A;  1STG A;  1TWC H;  4X62 Q;  1DCZ A;  1RDP D;  2ZTE A;  4YWM A;  1YVC A;  2R93 G;  4BY1 B;  2GN5 A;  2MHV A;  2QA4 A;  4H0L C;  2ALY B;  4BA1 I;  2OEO A;  3C1E A;  1AH9 A;  1B7Y B;  2XN9 C;  5IGG A;  1F9S A;  3RLN A;  4YCV A;  3CC4 A;  2JXM B;  2BH8 A;  5J1Z A;  1L1O B;  1R9T B;  1K83 B;  5CV9 A;  2E5L Q;  1EY7 A;  4BBR G;  1PZJ D;  1DM0 B;  3J7A F;  4DNI A;  2CFM A;  3CKI B;  4JI1 Q;  1MJE A;  3KLS A;  3HOZ H;  5C44 G;  3T51 B;  2KBN A;  2X6G A;  4C3H B;  3DM1 A;  2E76 C;  3OOC A;  1VQE A;  5DEH A;  4ZKC B;  1K3R A;  5FO7 B;  1BBX C;  1PHJ A;  4AQY L;  3HOW B;  3S14 B;  5C4J H;  3I72 A;  4I7A A;  2Z6B A;  1PZK D;  3VYU A;  1T5X D;  2UUA Q;  5E4X A;  5HUR A;  3EA6 A;  1X55 A;  3S16 B;  3FKI G;  1TY0 A;  1JQY D;  3PO3 B;  3QOL A;  1WCM G;  4K6D A;  2IX1 A;  3VR3 A;  2XWJ B;  5C3E H;  1XNR L;  3J81 i;  1GUG A;  1LUZ A;  2R7D A;  1X6O A;  2PNR C;  5M5Y B;  2VY3 A;  1EEI D;  4C56 C;  1C7Y A;  4JI7 Q;  5M9O A;  2K33 A;  1VQD A;  1Q1B A;  4GN4 B;  1PXU A;  4A3B G;  1JWU D;  2PPB C;  1X65 A;  2A73 B;  1ET6 A;  3GTQ B;  2XTI A;  3RN2 A;  1NY4 A;  1HNX L;  4RHR A;  2M2L A;  1YZ6 A;  2OTL A;  5D14 A;  4Q0F A;  3GTJ B;  2FFK B;  3A5Z B;  2EPB A;  3TQY A;  1YI2 A;  1PYW D;  4A3D G;  1TWH B;  5E4W C;  2IT1 A;  2QIL A;  4B3M Q;  1VQK A;  1DON A;  4DR3 Q;  1VCI A;  3DMU A;  4DK0 A;  2F0W A;  3T4A C;  4JOI C;  4POF A;  1LAC A;  2PO4 A;  3C2P A;  2F0V A;  1KRT A;  4FF2 A;  4YY3 L;  4K5W A;  5KRU A;  2L9H A;  3DLL A;  3CU7 A;  4LF4 Q;  2D2C C;  1N33 L;  3KDF B;  4G57 A;  2RSO A;  3NTH A;  1N36 L;  1FVI A;  1ZYR D;  4CHT B;  3HOV G;  1QOH A;  3W1G A;  1PFS A;  1V9P A;  2OTJ A;  1J6Q A;  4XXE A;  4A3L H;  4Y52 H;  4DR5 L;  4AH6 A;  1M4V A;  1IBL Q;  4ZK9 B;  1LTG D;  3LNN A;  4CGY B;  1HUM A;  5G3L D;  1MSH A;  4DUZ L;  4TRD A;  4A3F G;  2A68 D;  1Y1W G;  4AQY Q;  5FLM H;  1BCP C;  1YBY A;  2FHT A;  1CHP D;  2XRQ D;  4FDB A;  2QDL A;  4IUQ A;  4ME3 A;  4A3M H;  1KD1 C;  1WYD A;  1VQ5 A;  1VS0 A;  4K14 A;  1VQM A;  4GNX C;  2J7Z A;  5IE8 A;  1KNA A;  5IOC A;  2LSS A;  2R93 B;  2D0P A;  4O1N A;  3GTK B;  1RF2 D;  3L2P A;  1QJO A;  4AYB E;  3ERQ A;  3I4N G;  1G2T A;  1HXY D;  5JOB A;  1U9R A;  3TZD A;  1WI5 A;  4DR1 Q;  1RL2 A;  2PMZ B;  2WP8 J;  2NVT B;  1TR5 A;  1I94 L;  1LTI D;  1EY8 A;  3A8I E;  4K2L A;  1RTN A;  2K5W A;  4BBR B;  5IYD G;  1DOM A;  2JE6 I;  3A8J E;  4A3I G;  1GUW A;  1EYG A;  4HTH A;  1HNX Q;  1VQJ A;  2ZTC A;  5C44 B;  1TQO A;  3HGB A;  2B29 A;  4ZKB B;  5LMN W;  1SXT A;  1AW7 A;  1WTP A;  2K4K A;  4JI0 L;  5M5W B;  2EIF A;  3BZK A;  2SEB D;  1I4H A;  4ALP A;  1H95 A;  1P8L A;  2F0J A;  1SNP A;  2JA9 A;  3TZU A;  2K5H A;  1B44 D;  1I3Q H;  3NXW A;  1VMC A;  2F3W A;  3GTM B;  1X56 A;  4ZQ3 A;  5T1G A;  4R1J A;  2B2V A;  1IYJ B;  1CUK A;  1S5C D;  1Y1V G;  2A19 A;  3H0G B;  1N33 Q;  3KF6 A;  2PZU A;  4A4I A;  5F2D A;  5FLX E;  1K8G A;  5IP9 G;  4DK6 C;  2CQO A;  1E1T A;  4EVO A;  2KCC A;  3ICE A;  2K5Q A;  3GTO B;  1TXY A;  2PW7 A;  1QB5 D;  1QUQ A;  1SR3 A;  4MTK A;  4DUZ Q;  2JA8 G;  1ENF A;  1R4Q B;  1Q1E A;  2YTY A;  1N9W A;  1I5F A;  4PZ7 A;  2PMZ E;  2MP1 A;  3MXU A;  4BY1 H;  1X9N A;  2F0H A;  5K36 H;  2NTS A;  5C4H A;  1D2B A;  3I2Z A;  5JJZ A;  3W1B A;  3S1N B;  4EX5 A;  2OQK A;  4A3D B;  2ICE C;  1R9T H;  4KN7 C;  1Q82 C;  2Q8R E;  4RHS A;  1T5E A;  1KLU D;  2A74 C;  2QEX A;  1GUO A;  3M4Q A;  4QY7 A;  4JOI A;  3I91 A;  4A93 H;  3QWN A;  4POG A;  1IKM A;  5IGB A;  5CYU A;  2EY2 A;  5IWA L;  1WD1 A;  2EJM A;  2SNS A;  3AFQ A;  4KTA A;  4O42 A;  5LL6 X;  2JA7 H;  1UE5 A;  2D9U A;  4C3H H;  1I94 Q;  1SYD A;  1L1O C;  4IPD A;  5J3B A;  4FXK C;  3V2T A;  1CTM A;  1AZP A;  3J80 c;  3TBI B;  4A3K H;  2Q8T A;  3HOV B;  2XSC A;  3KYH C;  4APV A;  2R92 G;  1DXM A;  1BNZ A;  1B1Z A;  2AMC B;  4DR2 L;  1XPO A;  1PA6 A;  1M90 C;  4A3F B;  1PV4 A;  3S16 H;  1A3T A;  3TRZ A;  4C3J G;  1BCP D;  3C1F A;  1E3P A;  3PO3 H;  1WD0 A;  1AN8 A;  4GNX A;  2RHQ B;  5GAE C;  2KEE A;  3W5O A;  1EZ6 A;  3T56 B;  3E3X A;  4LFC L;  4K0K Q;  5DNF A;  2F3V A;  5EPK A;  3S1M B;  1C0A A;  3VYS A;  2EYP A;  3U4Z A;  3DM3 A;  1N34 Q;  1CSQ A;  4XQQ A;  5IYC G;  3I4N B;  1EIH A;  1TWA B;  3UI2 A;  5ELC A;  1RJT A;  4LF8 L;  5EBC A;  4LF5 Q;  3S15 B;  1PH2 A;  2NTT A;  2DY7 A;  2FIN B;  1TWH H;  2N8N A;  1STB A;  3VR5 A;  2RDG A;  4ID6 A;  4XYQ A;  3MEH A;  3S1R B;  2F03 A;  1EYA A;  4M8A A;  3Q24 A;  3V05 A;  3GO5 A;  4KMU C;  1STH A;  1NMG A;  4IUT A;  3DWQ A;  4OXP A;  4P75 A;  3T1Y L;  4PG3 A;  4DAV A;  3BS1 A;  1STY A;  3FDT A;  1E2V A;  2V4D A;  4WJ4 A;  4F8M A;  1XPR A;  1UAP A;  4G7Z C;  1HZ9 A;  3I4L A;  1ML0 D;  1V1P B;  1KLG D;  4CDF C;  3RUZ A;  1TKW B;  1JOQ A;  2KCM A;  4KY5 A;  3A7A B;  2KHI A;  5C0X H;  1QVG A;  2KEN A;  1E7Z A;  3MC0 B;  3U50 C;  1KDB A;  3UE1 A;  1EIF A;  2CWA A;  2OT2 A;  4KKS A;  4NW2 A;  2JA6 G;  1J9O A;  1F9R A;  4C2M B;  3TN2 A;  5IY0 A;  3MXG A;  3A54 A;  5EAY A;  2UXD Q;  1SFO B;  2F4V L;  2LXJ A;  1GVP A;  3J7Y W;  3K7A B;  3V96 A;  1CKN B;  4KHZ A;  3J80 E;  4GKJ Q;  2JEB I;  4X3S A;  4WJ3 M;  4BXX G;  3CXC A;  4DV6 L;  4OO1 G;  4GZY C;  3GTK H;  2A6E C;  3NQI A;  4X64 L;  2K75 A;  1Y69 U;  4O0A A;  1GOZ A;  3QR8 A;  4JCV E;  4HCE A;  1EYC A;  1KXL A;  1QNU A;  1FNW A;  1Y8N B;  4LFC Q;  3IRB A;  2H5X A;  2EY5 A;  1PTO H;  4LF7 L;  3G6E A;  1ESF A;  2UUC L;  4ZLT F;  1AFP A;  4P71 A;  3W3A A;  3M4Y A;  4LF8 Q;  2CCZ A;  4ZCK A;  4UPA A;  5LMU Q;  1HA5 A;  1OXS C;  1L1O A;  4DV2 L;  1UWV A;  3M3Y B;  3GTG B;  2D5D A;  1F2M A;  1PH4 A;  2VZA A;  4X3T A;  1PTO C;  4BBS G;  4KHV A;  2DUD A;  3TRE A;  2F0G A;  1ILQ A;  1J8I A;  4HAE A;  2BA1 A;  3K59 A;  4B3S L;  5LMN L;  2WFW A;  1JOR A;  1ICW A;  4LAA A;  1PH1 A;  3H0G H;  2MJ8 A;  3MA2 B;  4C3J B;  3NBI A;  2EXD A;  4A3J B;  3D0F A;  1H9S A;  4RMF A;  4GLX A;  3A8K E;  4JYA L;  1OXT A;  3EBE A;  2KCN A;  3K8A A;  3SXH A;  4X3K A;  3GTO H;  3QJY A;  3FP9 A;  2IHF A;  1PDQ A;  1VF5 C;  1JIC A;  2F4V Q;  4IFD G;  1SEB D;  1CQF A;  4L5Q A;  1ROD A;  2EY6 A;  4OO1 I;  4LUZ A;  1E24 A;  1PRT F;  1L2F A;  5IT9 E;  1XNQ L;  5LL6 S;  4IZ8 A;  3S1N H;  1Q86 C;  4HID A;  4DV6 Q;  2BE5 C;  2N78 A;  3PIP 3;  4XYO A;  2YV5 A;  5CGK A;  2E75 C;  2N3S A;  3C46 A;  4BY7 B;  3OYY A;  3D6C A;  3E5S A;  1V1Q A;  1D1I A;  4DV3 Q;  4N9P A;  1ASY A;  1O80 A;  3BYT B;  5C4X H;  2JN4 A;  4QJF A;  5HGQ A;  4LF7 Q;  5BN4 A;  3FHW A;  1SND A;  4A3C H;  3MXP A;  3F2U A;  3T1H L;  2UUC Q;  3GTL H;  1N32 L;  2HHH L;  3VDY A;  5CR3 A;  3I73 A;  1YIJ A;  3SDZ A;  2A69 C;  1DJR D;  4IUU A;  2RA4 A;  3UDF A;  2NWG A;  1TS2 A;  3HG9 A;  3HOV H;  5CV8 A;  1TII D;  4LF6 L;  4DV2 Q;  1Q12 A;  2L5T A;  2Z4H A;  1YJN A;  2MFI A;  4NKL A;  4HED A;  1B53 A;  1WFQ A;  2PZT A;  4NMZ A;  2MO1 A;  5KGU A;  3RR5 A;  1X32 A;  4FF4 A;  1WTV A;  2X69 A;  3HKZ G;  1Y8P B;  3CP0 A;  3NEL A;  4KKU A;  2NUC A;  3RNU A;  4DV0 L;  3SVM A;  5JEA G;  1EL0 A;  2ENB A;  1CFM A;  2XRS D;  2B2T C;  3CQZ B;  3JAM E;  4KJN A;  2SDF A;  1A3V A;  2A6E D;  4K8I A;  4JI4 L;  2WIN B;  4A3E B;  3K0X A;  1TWA H;  4PNY A;  2MUY A;  4C3I B;  2N88 A;  3EQL C;  3S15 H;  3BDO A;  1BO0 A;  4IFD I;  2ZM6 L;  5EGT A;  1WTQ A;  1I6V C;  2RKS A;  5JJL A;  3RN5 A;  3NUC A;  1MBY A;  1EWI A;  4Q5V A;  5IYD H;  5G3L F;  3OHX C;  4R4Q A;  2Z8L A;  3S1R H;  3J81 c;  3LX0 A;  2UXB Q;  4YHH L;  1XNQ Q;  4HSV A;  1Q46 A;  1TS4 A;  3G4S A;  3OIP A;  3M4P A;  3ONA B;  4AIM A;  2RHS B;  4LK1 C;  3HOU G;  1G29 1;  3I90 A;  2ASB A;  2E2I B;  3S2D B;  2DN8 A;  1PH3 A;  2NN6 H;  1D5M C;  1HTP A;  2A8V A;  1XMQ L;  1H9K A;  2ATW A;  1EWC A;  3K5N A;  1HNZ Q;  1R4P B;  1IBK Q;  1FGB D;  1H9M A;  3T1H Q;  4RH6 A;  1MIU A;  4QUF A;  5FJ8 G;  4C2M H;  2Q2U A;  1SNM A;  5CC4 A;  3RLO A;  1UEB A;  1NTG A;  1SAP A;  4LF6 Q;  3D31 A;  1ZXT A;  2JK8 A;  3K7A H;  1LV9 A;  3GTP B;  2HCI A;  2VQE Q;  4DR6 L;  1U4P A;  4X3U A;  1ENC A;  3SK6 A;  3RMH A;  4RGT A;  4L5S A;  4KY7 A;  1X3P A;  2NZO A;  2E2H B;  1HPC A; 
#chains in the Genus database with same CATH homology
 1WI5 A;  3J81 j;  4DR1 Q;  4HJ5 A;  1AE3 A;  4A3D H;  4A3G H;  1RL2 A;  2WP8 J;  1HZC A;  3BU2 A;  4HIK A;  1VQ4 A;  4P73 A;  2BH2 A;  1I94 L;  2YTX A;  3M85 A;  1S3O A;  4DV0 Q;  4X64 Q;  2OQ0 A;  5C0X J;  3CCV A;  4OX9 Q;  5IYD G;  2JE6 I;  3KFU A;  3CME A;  5LMU L;  2UU9 Q;  2FXQ A;  4A3I G;  1EYG A;  1UE1 A;  4L5R C;  1E22 A;  4JI2 Q;  1HNX Q;  4JI4 Q;  1VQJ A;  2ZTC A;  4LUV A;  3F2C A;  4A93 G;  2B29 A;  5LMN W;  1RIP A;  3EN2 A;  2UXC L;  4TVA B;  4JG2 A;  2K4K A;  4DKA C;  4JI0 L;  2JA7 G;  3NEM A;  4BY7 G;  1EQQ A;  2EIF A;  3BZK A;  4ALP A;  3KJP A;  1H95 A;  1P8L A;  4LFB Q;  3ULJ A;  3M3Y H;  4IPH A;  3GTG H;  1U0L A;  1YEZ A;  2K52 A;  4A75 A;  4X6A H;  2JA9 A;  1YJ9 A;  3J7Z C;  4TQU S;  5IP7 H;  2K50 A;  2L15 A;  2VQF Q;  1J5E Q;  2K5H A;  1I3Q H;  3I4M G;  3EIV A;  3TS2 A;  4A3L G;  2NZH A;  4R4I A;  1Q8K A;  3NBH B;  4A3K G;  1EUJ A;  2K14 A;  1X56 A;  4H02 A;  4GNX B;  4R1J A;  3KDF A;  1IYJ B;  1Y14 B;  1KIX A;  4A3F H;  1CUK A;  1Y1V G;  2A19 A;  1Y1W H;  1N33 Q;  3KF6 A;  3S2H H;  3L0O A;  4A4I A;  3UE0 A;  2NVX H;  2WAQ E;  4DAM A;  4X62 L;  1K8G A;  5FJ8 H;  3UDI A;  1VQ9 A;  4JI8 Q;  5H1S E;  1HR0 W;  2ZTD A;  2B3G A;  5IP9 G;  1N8R C;  3PO3 G;  1B8A A;  4DK6 C;  4DV4 Q;  2CQO A;  4A3J H;  5LMN Q;  4B3S Q;  1E1T A;  4JI5 L;  4IOA A;  1XMQ Q;  1FJG Q;  2Y0S E;  3ICE A;  4GN3 B;  1BBW A;  2PQA A;  4QL5 A;  1SRU A;  1TXY A;  3HFZ B;  1QUQ A;  1SR3 A;  5DLQ E;  2KCT A;  4DUZ Q;  1VQH A;  4NXN L;  2JA8 G;  3S1M H;  1OXX K;  3PGZ A;  5E7N A;  4JI3 L;  1Q1E A;  2YTY A;  1N9W A;  1I5F A;  4PZ7 A;  2PMZ E;  4BY1 H;  3I4N H;  1SMX A;  2GVA A;  4LFA Q;  1X9N A;  4JYA Q;  2E5L L;  2N49 A;  1XPU A;  4A3G G;  2IX0 A;  3PCO B;  4B3T L;  1IZ6 A;  2VS1 A;  3I2Z A;  4YWL A;  4LW1 A;  1PH6 A;  4IJH A;  4JI1 L;  3W1B A;  4GLV B;  3ERS X;  4HJ8 A;  4EX5 A;  1KQS A;  1NMF A;  5BR8 Q;  2HT1 A;  1Z9F A;  2OQK A;  4A3E G;  1BVS A;  1R9T H;  3STB D;  1Q82 C;  4DV3 L;  4GN5 A;  1VQ7 A;  2QEX A;  4A3I H;  5M3F G;  2F3I A;  4UP9 A;  3M4Q A;  4QY7 A;  1NJI C;  1GM5 A;  1HR0 Q;  4X66 L;  1VQ6 A;  4JOI A;  5FLX c;  2ZJR A;  4A93 H;  4POG A;  3HKS A;  4DK3 C;  3S16 H;  3WWV A;  1A8V A;  5IWA L;  4DV1 L;  3RZD H;  1S40 A;  3K7U C;  1VQO A;  3S1Q H;  4BY7 H;  3AFQ A;  2JA7 H;  5GAH C;  1UE5 A;  3PF5 A;  5ELO A;  4C3H H;  1SLJ A;  1I94 Q;  1B70 B;  3OTO L;  3I7F A;  2MQH A;  4KHP L;  1L1O C;  4IPD A;  2RF4 A;  1YNX A;  4JI6 L;  1HNW Q;  3AFP A;  5J3B A;  4X65 Q;  4R4T A;  4J15 A;  2AWN A;  1SRO A;  2DGY A;  4Y7N H;  3J80 c;  4A3K H;  2E2J H;  1VQ8 A;  2PQA B;  3E0E A;  3E9H A;  1Q81 C;  2PI2 E;  2R6G A;  3UDX A;  3KYH C;  4APV A;  1Y1V H;  1NBW A;  1K8A C;  2R92 G;  1BBU A;  1FGU A;  2VW9 A;  2D0O A;  1D8L A;  5C0X G;  1T9H A;  4NXM L;  1N32 Q;  2ZJP A;  2AMC B;  3F8T A;  4DR2 L;  2K5N A;  1XPO A;  1PA6 A;  4DV7 Q;  3UDG A;  1PV4 A;  3CCE A;  1M90 C;  4JI7 L;  3CD6 A;  2K5V A;  3GDE A;  1X3G A;  4DV5 L;  3TRZ A;  1E3P A;  1SFO H;  2NVQ H;  2Z6K A;  3HKZ E;  5IP9 H;  3PO3 H;  4YCU A;  3PUW A;  1OTC A;  1W3S A;  3AQQ A;  2RHQ B;  5GAE C;  1X3E A;  4KI0 A;  4GNX A;  3W5O A;  4LFC L;  4K0K Q;  2JA8 H;  2WB1 G;  1XNR Q;  1A0I A;  3I4O A;  4GOP C;  2I5M X;  2PI2 A;  3CCR A;  1UE6 A;  3K81 C;  4XTC S;  1VQN A;  2I5L X;  3A5U A;  1C0A A;  4OON A;  3U4Z A;  3DM3 A;  3GD7 A;  1N34 Q;  1CSQ A;  3CQZ H;  5IYC G;  4BXX H;  3ZJY C;  1U5K A;  1VQA A;  1WOC A;  4IPG A;  3ULP A;  1Q7Y C;  4B3M L;  1ASZ A;  4JI5 Q;  4DUY L;  4GS3 A;  4LF8 L;  4LF5 Q;  4MTN A;  4DR3 L;  1KAW A;  4A3E H;  5JJI A;  1PH2 A;  1YJW A;  1P16 A;  2OWO A;  3HOY G;  3CCQ A;  2AHO B;  4C3I H;  1K73 C;  1M1K C;  3M7N A;  1TWH H;  2N8N A;  4JI3 Q;  1SN8 A;  5M3F H;  3H3V H;  4DR7 L;  4HIO A;  1SE8 A;  2UXB L;  1EQR A;  3RLF A;  3U58 A;  4LF4 L;  2HQL A;  1DGS A;  3U4V A;  4DAY B;  2ZM6 Q;  1C9O A;  3CF5 A;  2YTV A;  3G71 A;  3GO5 A;  3H3V I;  4UP7 A;  1X3F A;  1NMG A;  5AJ3 L;  4OXP A;  4P75 A;  3T1Y L;  4PG3 A;  3CCJ A;  1IBM L;  1JJG A;  2CKZ B;  2NVY H;  4IPC A;  3I56 A;  3HOW G;  4MZ9 A;  1IBL L;  1QVF A;  4WJ4 A;  1XPR A;  1HNZ L;  3CC7 A;  4JC0 A;  4YY3 Q;  3CW2 C;  4YHH Q;  1FL0 A;  2HIX A;  4B3R Q;  1HZ9 A;  2I5H A;  1IBK L;  2HIV A;  4IFD J;  2KCM A;  2E2I H;  2JQO A;  2R92 H;  4A3C G;  2KHI A;  1KRS A;  1HJP A;  1W2B A;  1QVG A;  2ZJQ A;  4JV5 L;  2KEN A;  3PUV A;  1E7Z A;  2EQS A;  1I50 H;  5IYB G;  3U50 C;  3PUZ A;  1YIT A;  1N36 Q;  5JJK A;  3UE1 A;  4C3J H;  1EIF A;  2CWA A;  2YU9 H;  4L5T A;  4UY8 C;  3PO2 G;  2JA6 G;  4DR4 L;  4KHP Q;  4JI6 Q;  3H0G G;  5IY0 A;  3L7Z C;  4DR5 Q;  2XGT A;  1PH9 A;  3PSI A;  5EAY A;  5C0X I;  1VQL A;  3M4O H;  2UXD Q;  2B63 G;  2F4V L;  2VQE L;  2LXJ A;  3PV0 A;  4JBM A;  1GVP A;  2JA5 G;  1CKN B;  3AYH B;  4KHZ A;  3OW2 A;  3MXN B;  1PH5 A;  2JEB I;  4GKJ Q;  4WJ3 M;  1JT8 A;  4NXM Q;  1OXU A;  4DR1 L;  4BXX G;  3CXC A;  4DV6 L;  4DV5 Q;  5IYC H;  3GTP H;  4OO1 G;  3GTK H;  4BA2 I;  4OX9 L;  4X64 L;  5M3M H;  3JAM i;  2K75 A;  3F2D A;  1K83 H;  4O0A A;  2HHH Q;  1LM0 A;  4JCV E;  2UU9 L;  1D7Q A;  4AYB G;  2F52 A;  4DR6 Q;  1KXL A;  3HOY H;  3HOX G;  5ELN A;  4LFC Q;  3IRB A;  4JI2 L;  2H5X A;  3KOJ A;  3AEV A;  1AE2 A;  3KF8 B;  3CPF A;  1LYL A;  4LF7 L;  1E1O A;  3J7A 5;  2VUM G;  5GAG C;  3G6E A;  2UUC L;  1JJ2 A;  3STB C;  4P71 A;  3NEN A;  3HOZ G;  3MEF A;  4DUY Q;  4LF8 Q;  2UUA L;  2CCZ A;  2AKW B;  3CMA A;  2VQF L;  4UPA A;  5LMU Q;  4A76 A;  2Q2I A;  3A0J A;  1J5E L;  1OXS C;  2PNH A;  2E8G A;  1CKO A;  1L1O A;  1UWV A;  4DV2 L;  4PMW A;  1JB7 A;  3HOW H;  5C4X G;  1XMO L;  3S14 H;  2Z0S A;  2VZA A;  1PH4 A;  5JEA J;  1VQG A;  2CWP A;  4BBS G;  2UXC Q;  1PYS B;  2MNA A;  1LTL A;  2A1A A;  1TWF H;  3LGJ A;  2DUD A;  5GRO A;  4IO9 A;  3TRE A;  4JI0 Q;  4LF9 L;  2R7Z H;  1XTD A;  4R4O A;  2VNU D;  3KLW A;  5GAD C;  4QGU A;  2KHJ A;  5HY6 A;  4DPG A;  2BA1 A;  5IYB H;  5AJ3 Q;  4GKK L;  3CC2 A;  1GO3 E;  1IBM Q;  1XJV A;  3PO2 H;  2ES2 A;  4B3S L;  2VL6 A;  5LMN L;  2JA6 H;  2WFW A;  2JEA I;  1VQC A;  3TS0 A;  4HJ9 A;  4YCW A;  1PH1 A;  3H0G H;  4JBW A;  1MJC A;  1FJG L;  1QZH A;  2OCE A;  2C35 B;  5M5Y H;  2EXD A;  2B63 H;  3D0F A;  5C3E G;  4RMF A;  2V1C C;  4MNO A;  2JA5 H;  1K0R A;  4GLX A;  2WAQ G;  4NPS A;  3S24 A;  4LFA L;  2QGQ A;  4P74 A;  1OXT A;  4JYA L;  1TWC H;  4X62 Q;  3EBE A;  4GOP A;  3K8A A;  2ZTE A;  4YWM A;  4EQ5 A;  1L0W A;  4JV5 Q;  1YVC A;  2R93 G;  2GN5 A;  3A74 A;  3CPW A;  2QA4 A;  3GTQ H;  3GTO H;  1HZA A;  4QQB X;  2Y0S G;  2ALY B;  4BA1 I;  5M3M G;  3PIO A;  3FP9 A;  4HIM A;  1HZB A;  4LWC A;  3M9B A;  5BR8 L;  1PVO A;  2I0Q A;  2IHF A;  1AH9 A;  1JE5 A;  1B7Y B;  3GTJ H;  2F4V Q;  3RLN A;  4UP8 A;  4IFD G;  4YCV A;  3CC4 A;  4XIG S;  1CKN A;  2BH8 A;  4NXN Q;  4L5Q A;  1PH8 A;  3HOX H;  3PF4 A;  1L1O B;  1IL2 A;  3CAM A;  4LUZ A;  1E24 A;  4OO1 I;  1L2F A;  1XNQ L;  2YYZ A;  1CSP A;  2E5L Q;  2R7F A;  3S1N H;  3G48 A;  4BBR G;  1WJJ A;  4B3T Q;  2VUM H;  4JBJ A;  1JMC A;  1Q86 C;  1X54 A;  3PUX A;  1MKH A;  2CFM A;  4P72 A;  4DNI A;  2N78 A;  4DV6 Q;  4HID A;  4JI1 Q;  4KLK A;  2AWO A;  1MJE A;  2YV5 A;  1A62 A;  5C44 G;  3HOZ H;  2N3S A;  3OYY A;  2KBN A;  1V1Q A;  1HNW L;  4DV3 Q;  1VQB A;  4X65 L;  1VQE A;  4PZ6 A;  1ASY A;  5C4X H;  4X66 Q;  4QJF A;  5HGQ A;  1K3R A;  1PHJ A;  4LF7 Q;  2R7Z G;  1G51 A;  5IWA Q;  1K9M C;  4DV1 Q;  4BBS H;  3FHW A;  4AQY L;  3K80 C;  4A3C H;  3S2D H;  3T1H L;  4GLA C;  5C4J H;  2UUC Q;  3GTL H;  1N32 L;  2HHH L;  3VDY A;  3Q8D A;  4DV7 L;  3OTO Q;  4GOP B;  3HOU H;  4RG1 A;  1YIJ A;  1PH7 A;  4OWX B;  3UDF A;  2NN6 G;  2UUA Q;  3ER0 A;  3HOV H;  1CKM A;  1X55 A;  2D62 A;  2UUB L;  4IOC A;  3F2B A;  4LF6 L;  1QZG A;  4DV2 Q;  3FKI G;  5IT9 c;  2Q2H A;  1Q12 A;  2LXK A;  4NB3 A;  4HJA A;  1YJN A;  1XMO Q;  2MFI A;  1VQP A;  1JJC B;  1WCM G;  2IX1 A;  1I6H H;  1YHB A;  1WFQ A;  4K0K L;  5C3E H;  1XNR L;  3J81 i;  3BJU A;  3TEH B;  4LF9 Q;  3RZO H;  5FLM G;  2WB1 E;  1LUZ A;  2MO1 A;  2R7D A;  1X6O A;  3RR5 A;  1BKB A;  2VY3 A;  4DR2 Q;  4GKK Q;  4A3M G;  1C7Y A;  1NE3 A;  3JC6 6;  4JI7 Q;  3HKZ G;  3PIP A;  4JBK A;  1HH2 P;  1VQD A;  1N34 L;  1Q1B A;  3CP0 A;  4GN4 B;  3NEL A;  1EIY B;  2R93 H;  3CCS A;  3RNU A;  4DV0 L;  4A3B G;  5JEA G;  4LF5 L;  1X65 A;  1PYB A;  2E2H H;  2XTI A;  3RN2 A;  1NY4 A;  1HNX L;  4JI4 L;  1VQF A;  1YZ6 A;  3J80 i;  3H15 A;  2OTL A;  3K0X A;  4LNQ A;  2NVT H;  1TWA H;  1G6P A;  3A5Z B;  3TQY A;  4HJ7 A;  1YI2 A;  3ULL A;  1KHI A;  4A3D G;  4BBR H;  2IT1 A;  3S15 H;  4IFD I;  2ZM6 L;  3CCM A;  4OWT B;  4B3M Q;  5JJL A;  3RN5 A;  3CCU A;  4LFB L;  1O7I A;  1VQK A;  5C44 H;  4DR3 Q;  4IJL A;  1EWI A;  1VCI A;  1VQI A;  4QIW E;  3F1Z A;  4YWK A;  3SGI A;  5IYD H;  4JOI C;  4POF A;  3B6Y A;  2IY5 B;  1KL9 A;  4R4Q A;  1IXR A;  3S1R H;  3J81 c;  4DR7 Q;  5M5W H;  3S17 H;  1KRT A;  4YY3 L;  4O2D A;  4YHH L;  4B3R L;  1XNQ Q;  2UXB Q;  3DLL A;  4LF4 Q;  1N33 L;  1Q46 A;  3E9I A;  1TWG H;  3KDF B;  3G4S A;  2JJQ A;  3M4P A;  3KF6 B;  4AIM A;  1QVC A;  2RHS B;  1OXV A;  3HOU G;  1G29 1;  4JI8 L;  1N36 L;  3JAM c;  2ASB A;  1FVI A;  3T1Y Q;  3GTM H;  1Z47 A;  3HOV G;  5IP7 G;  1PH3 A;  3W1G A;  4DV4 L;  1PFS A;  1V9P A;  2OTJ A;  1J6Q A;  1XMQ L;  2A8V A;  4A3L H;  4Y52 H;  3I4M H;  4LUO A;  4DR5 L;  4AH6 A;  5GQO A;  1IBL Q;  1YHQ A;  2ATW A;  3FKI H;  1A63 A;  2BA0 A;  2UXD L;  1HNZ Q;  2Q2T A;  3KJO A;  4DUZ L;  4A3F G;  1WCM H;  1Y1W G;  1IBK Q;  1S72 A;  1QUQ B;  1YHA A;  2NN6 I;  4AQY Q;  4OWW B;  3I55 A;  5FLM H;  4GKJ L;  3T1H Q;  5FJ8 G;  1MIU A;  1YBY A;  1UE7 A;  2Z6K C;  3BZC A;  4C2M H;  2GVB A;  2Q2U A;  2MO0 A;  4FDB A;  4ME3 A;  4A3M H;  1KD1 C;  1VQ5 A;  1WYD A;  1VS0 A;  4PZ8 A;  1KC8 C;  4DR4 Q;  4A3J G;  1VQM A;  4GNX C;  3CCL A;  5IE8 A;  3PUY A;  1V43 A;  1UEB A;  3RLO A;  2IHE A;  1EFW A;  1NTG A;  2UUB Q;  4R4C A;  4LF6 Q;  3D31 A;  4A3B H;  1GKH A;  2JK8 A;  2LSS A;  3K7A H;  2RCN A;  2VQE Q;  2D0P A;  4DR6 L;  1EOV A;  3L2P A;  5M5X H;  1GD7 A;  4AYB E;  3I4N G;  4BY1 G;  1HR0 L;  2ID0 A;  4L5S A;  2NZO A;  5K36 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...