1FJGL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
125
structure length
125
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1fjgL00
1E7ZA 4O0AA 4LF6L 1IBKQ 4Y52H 2UUCL 3J80i 1TXYA 2KCMA 3EN2A 3HKZG 4OONA 5C4JH 4OO1G 3FHWA 1K8GA 2JA5G 5M5WH 4R4QA 2Z0SA 1X9NA 4LNQA 2WAQE 1XPRA 1PYBA 1Q12A 1T9HA 5IP7G 4GS3A 3HOXH 1PA6A 3GTKH 2IY5B 1KRTA 3S24A 1I94Q 4JC0A 3M4QA 4R4IA 4YY3L 1HNWL 4TQUS 3KF8B 4WJ4A 4DV0L 5DLQE 3M4OH 4DR2Q 3K0XA 2JEAI 1YJWA 2I0QA 1VQDA 2BH2A 3PO2H 4NXNL 3HFZB 1PV4A 2F4VQ 1D7QA 1HNZL 5C0XJ 3F8TA 2A1AA 4KLKA 1LTLA 4JI0L 4A3KH 1XPOA 1R9TH 4YWMA 4BA2I 1VQHA 1N9WA 4GOPA 4DR3Q 2N3SA 4QGUA 3U4ZA 4X62Q 4DV3L 3G48A 5GROA 5GQOA 2GN5A 1IL2A 1NTGA 1NMFA 3HOWH 5C3EH 1YVCA 2YV5A 4LFCQ 4DR5Q 3WWVA 4GNXC 4UPAA 1EQRA 4JOIC 1YITA 1I94L 4JYAL 4JBWA 3PSIA 2K50A 5FLXc 3RZDH 4POGA 4HJ8A 4GN3B 4DNIA 1AE3A 1TWFH 4HIMA 4OWWB 5E7NA 4A3JH 1FJGL 3S1QH 4JBKA 1FVIA 3OTOQ 2Z6KA 2L15A 1VQPA 1WJJA 3E0EA 1CSPA 3HOYH 4A3GH 1I6HH 1HNXQ 1X55A 1ASZA 1UE1A 2VZAA 3H0GG 3T1HL 1BBWA 2FXQA 4X62L 4EX5A 2R7ZH 4LFCL 3NENA 1KD1C 4GNXB 1VQAA 3CCUA 2HQLA 4OX9L 5C4XH 2VQEL 2F52A 3M7NA 1PH1A 3A5ZB 1U5KA 5IYCH 4DV2Q 1SRUA 4A3IG 1G51A 3OTOL 2ZJRA 3HKZE 1B70B 2AKWB 3CC7A 5ELNA 3Q8DA 4P73A 3A0JA 3PUWA 3TEHB 3JAMi 1HNXL 4LF4Q 1TWAH 4IFDJ 1N36Q 3KLWA 3K81C 4A3LH 1Q1EA 3RR5A 2R7FA 1B7YB 1L1OC 2EXDA 3BZKA 5BR8L 3K7AH 2H5XA 3GTLH 3CCRA 3BZCA 4MTNA 1NY4A 2DGYA 4A3FH 2RCNA 4UP9A 4A93G 4X66Q 1FGUA 2JQOA 4DR4Q 2WB1G 1S40A 3GTGH 3E9HA 4DV2L 3I4OA 3U50C 1YHAA 4DPGA 4YCUA 4YWLA 1E24A 4DKAC 1J6QA 2CQOA 4IPCA 2NN6G 5EAYA 1S72A 1VQ5A 2JA5H 4LF8L 4JV5L 2YTXA 4DV5Q 4IO9A 4A75A 1JT8A 4C2MH 4LF4L 3G71A 3I4MG 3GTMH 3W1BA 1E3PA 4HJ7A 4BXXG 4IJHA 4C3HH 3D0FA 1EIYB 1RL2A 1VQ7A 2C35B 1FL0A 3CCSA 2E2JH 2GVBA 1XNRL 1C0AA 1BVSA 1EUJA 1L1OB 2CCZA 4JI8Q 1KL9A 2B3GA 3CCVA 1W2BA 3A74A 4AH6A 4X66L 1Z9FA 2BA0A 1PH6A 5C0XG 1NMGA 1X65A 4GLXA 1PH4A 1IZ6A 4L5QA 2UXBQ 4NPSA 4QL5A 3CD6A 3RNUA 4A3BG 1KQSA 2ZTCA 1TWHH 4DV5L 1VQ9A 1A8VA 3ULJA 1QUQB 4DV7L 4HIKA 4LW1A 4PMWA 5HGQA 2B63G 2YTYA 4HJ9A 3S2DH 4HJAA 4K0KL 4HIDA 2LXKA 1L1OA 1LYLA 1LUZA 1JB7A 2D0OA 4JI7Q 1YI2A 1K9MC 4LUZA 3RN5A 1M1KC 2HT1A 1WCMG 1GVPA 2CKZB 1I50H 4YCWA 2IX0A 4A3MG 3S17H 1B8AA 4KHZA 5IP9G 1GD7A 1VQMA 1TWCH 2NN6I 3H0GH 4X64Q 4KHPQ 1QVCA 1VQNA 1XPUA 1QZGA 4LF9Q 4DV6Q 4LFBL 4JI2Q 2Y0SG 4JI5L 4LF5L 1GKHA 4YCVA 1WI5A 2NVYH 1Q46A 3GTJH 5LMNQ 2MNAA 1X3FA 3CMEA 1VQ6A 4GLVB 3HOVG 1Y14B 2WB1E 4X65Q 2A8VA 4O2DA 4A3IH 4JI7L 4LF7L 1SMXA 3TRZA 1MJCA 1S3OA 4IPDA 3CAMA 5FLMG 3RN2A 1IBKL 3PGZA 4ME3A 2VUMG 1N32Q 4EQ5A 2JJQA 4UP8A 2LXJA 4J15A 2JA6G 1QVGA 1H95A 5JEAG 1IXRA 2WP8J 1PH7A 5HY6A 4AQYQ 4RG1A 3U4VA 1XMQQ 4XTCS 1SFOH 4KHPL 4IFDG 4DV1Q 1E1TA 1NBWA 1OXUA 2KHIA 1AE2A 4BBRG 3J81c 4DR2L 4LF9L 4BY1G 3OW2A 1CKMA 3JC66 1SLJA 3CP0A 1UE6A 3T1YQ 2Q2UA 1IBLQ 4L5TA 1VQFA 4JI2L 4A93H 2F4VL 2Q2IA 1YIJA 5IYDG 1QZHA 3RZOH 1KHIA 2EQSA 3GTQH 1X56A 1GM5A 3M3YH 3S14H 4DR1Q 1K73C 1N33Q 1CKNB 2I5HA 3ZJYC 2KBNA 4OO1I 3FP9A 4LFAQ 4UY8C 4B3RQ 4WJ3M 4DR3L 2JE6I 2OCEA 3PUXA 2NVQH 1HZAA 3K8AA 2HHHQ 1P8LA 4DR5L 2Q2HA 3I4MH 5GAEC 4P75A 3MEFA 1XMQL 5ELOA 4BXXH 1WYDA 2N78A 1K8AC 4IOAA 1JE5A 2CFMA 3UDXA 3UE0A 2K5HA 1HZ9A 2ID0A 3CXCA 1MIUA 4DV1L 2ASBA 5JJLA 3NELA 2MQHA 4JI3Q 1PHJA 4OWTB 1KRSA 1IBLL 3UDIA 4IPHA 4Y7NH 3J7ZC 2XGTA 4HIOA 3L2PA 4JG2A 1C9OA 2UU9Q 1PH5A 3GD7A 3UE1A 5FJ8H 1CKNA 5IWAQ 1A63A 3AFPA 4A3BH 3KOJA 4JI6Q 4QJFA 5C44G 2HHHL 5M3MG 3IRBA 1E22A 4DUYQ 3CW2C 3I55A 2IX1A 2F3IA 1HZCA 2IHEA 2Y0SE 1EFWA 3E9IA 4GNXA 1OXVA 3L7ZC 4JOIA 5LMNW 4C3JH 2Q2TA 4NXMQ 2B63H 4AIMA 4JI4Q 1XJVA 4JI3L 1QVFA 4ALPA 3I56A 2R92G 2I5MX 1YJ9A 4A76A 1WCMH 4DR6Q 3W1GA 5M3FG 1HR0W 3S2HH 4A3MH 1K3RA 1X6OA 1Y1VG 2RHSB 5IP9H 2ZTEA 5GAGC 2VQFQ 2JA7G 2JEBI 1N36L 1Z47A 3TS0A 5M5YH 3F2BA 3I4NG 2AMCB 2NVXH 3TS2A 5J3BA 1EQQA 3S1MH 1NE3A 1VQOA 1X3EA 1GO3E 2R7DA 3AQQA 3U58A 2NZHA 3TREA 1J5EQ 3GTPH 3I7FA 1JJCB 1Y1WG 2MO1A 1N34Q 1A0IA 1YEZA 3CPFA 2ES2A 4B3SQ 4NXML 3HOVH 4DR4L 1O7IA 1XNQQ 3J81i 3CCMA 3H15A 4POFA 2AWNA 5FLMH 3CC2A 1CSQA 5FJ8G 4IOCA 4FDBA 3BJUA 2VUMH 3PV0A 4DR7L 3ULPA 4A3EG 4JI1Q 2UUAQ 4LUVA 4B3MQ 2JA6H 3KFUA 1N8RC 4P72A 2N8NA 1PH3A 5IYBG 2IHFA 4R4TA 2UUBQ 1TWGH 4GOPC 4JBJA 4BBRH 4C3IH 3KJOA 1M90C 4LF6Q 4BY1H 4JI8L 1WOCA 2VW9A 1KAWA 3G4SA 1G291 5GADC 4GN4B 1YBYA 4PZ7A 3CMAA 1K83H 4IPGA 1J5EL 5IYDH 1N34L 2PI2A 3AYHB 1SR3A 3PCOB 1OXXK 5IE8A 2ATWA 2R93G 4YY3Q 4X6AH 1KC8C 1HNWQ 4DV4Q 1VQKA 3L0OA 4A3DG 4DK3C 1PFSA 2UXBL 3KF6B 1I5FA 2VNUD 1EYGA 4R4CA 2AHOB 2ZTDA 2KENA 3M85A 2ZJQA 2MFIA 1JJGA 2UUAL 4A3CG 1PVOA 4NXNQ 1OTCA 1HNZQ 3MXNB 5IY0A 4JI0Q 2PI2E 3I2ZA 1YHQA 1HJPA 2A19A 2UUBL 3HOUG 3JAMc 3S15H 1QUQA 4BBSG 1VQEA 4PG3A 2WFWA 4GOPB 3KDFB 4R1JA 1SE8A 2VL6A 3S1NH 1BKBA 1D8LA 2LSSA 4DV3Q 2HIVA 5C0XI 2YYZA 4R4OA 1HR0Q 4TVAB 4JYAQ 4DV4L 4DR7Q 4X64L 3STBD 2D0PA 3PUYA 3S1RH 2E5LQ 1X54A 3KF6A 5C44H 4BY7G 5M3MH 2R6GA 1FJGQ 1YNXA 3TQYA 5K36G 1VQLA 1KIXA 4DV6L 2B29A 2N49A 3CCLA 1DGSA 4P74A 3PIOA 4AYBG 3KJPA 3PO3G 1I3QH 1W3SA 3GO5A 2JA8G 2XTIA 3DLLA 2ZJPA 3CF5A 5LMNL 3UDGA 1C7YA 3H3VH 2QGQA 4X65L 3T1HQ 3KDFA 3ULLA 1PH8A 2R92H 3M4PA 3CCEA 3FKIH 1U0LA 1VQ8A 4NB3A 3NEMA 4DAMA 5M3FH 5IT9c 1N32L 1X3GA 1XTDA 2EIFA 1UE7A 4MZ9A 1Y1VH 2D62A 4PZ8A 1PYSB 1HR0L 1EWIA 4JBMA 4GN5A 1Q86C 2JA7H 4PZ6A 3PUZA 2K5VA 3GDEA 3UDFA 4AQYL 2VQEQ 1NJIC 4OX9Q 2MO0A 3ICEA 3I4NH 3S16H 3PF5A 2K75A 2E5LL 2CWPA 4BA1I 1UWVA 4DAYB 1UE5A 2RF4A 3HOZG 5H1SE 4GKJQ 2E2IH 4YHHQ 5JJIA 3T1YL 2NZOA 4LWCA 3OYYA 4L5RC 3GTOH 1WFQA 2YTVA 3PIPA 4OXPA 2ALYB 1Y1WH 1VQ4A 3D31A 4HJ5A 3HOXG 1SN8A 4KI0A 1SROA 4DR1L 2NVTH 1N33L 1G6PA 1V1QA 1KXLA 1YHBA 2DUDA 1VQCA 4H02A 4LFAL 2UXDQ 4B3RL 3CPWA 5BR8Q 3CCQA 2OTJA 4A3EH 1VQJA 1VQIA 3J80c 3F1ZA 4DUZQ 5AJ3Q 3AEVA 3PO2G 5IYBH 4IFDI 1Q81C 2E8GA 2OQKA 3M9BA 1OXSC 4A3KG 3EBEA 2PNHA 3HKSA 4A4IA 1Q1BA 4IJLA 2JK8A 1MJEA 1EIFA 4GKJL 4YHHL 4JV5Q 1CKOA 4P71A 1UEBA 4MNOA 4LF8Q 4QQBX 5JEAJ 3FKIG 2JA9A 2WAQG 3HOWG 1ASYA 5C3EG 1E1OA 2QEXA 3W5OA 2E2HH 2UU9L 2OWOA 3K7UC 4B3TQ 3J7A5 2R93H 1AH9A 1IYJB 1IBMQ 1JMCA 4A3DH 4LUOA 3G6EA 1XNRQ 5IWAL 2UXDL 3EIVA 2PQAB 4QIWE 4JI6L 3CC4A 3B6YA 4A3JG 3RLFA 4A3CH 4DUZL 5AJ3L 2QA4A 4DUYL 1VS0A 2IT1A 1OXTA 3HOUH 4BBSH 1XMOQ 4DK6C 4AYBE 4XIGS 1Q8KA 2ZM6Q 3HOYG 3A5UA 3PF4A 4A3GG 4JI4L 1EOVA 1YZ6A 2AWOA 5LMUQ 1VQBA 1Q82C 3DM3A 3BU2A 2UXCQ 3SGIA 3K80C 2VY3A 1V43A 3CQZH 3ER0A 3RLOA 4DR6L 5IP7H 4GKKQ 2YU9H 4B3TL 2R7ZG 2RHQB 3KYHC 4APVA 4DV7Q 4JCVE 1HH2P 4UP7A 1IBML 2VQFL 3STBC 2CWAA 1P16A 1RIPA 3VDYA 4QY7A 5C4XG 2KHJA 4BY7H 4K0KQ 5IYCG 1PH9A 3F2DA 2PQAA 3CCJA 4RMFA 2K14A 2UUCQ 1L2FA 1LM0A 2K4KA 3PO3H 1HZBA 5JJKA 2HIXA 2BH8A 1CUKA 1XMOL 1Q7YC 2K52A 2OTLA 2JA8H 2BA1A 3H3VI 2ZM6L 4B3SL 1MKHA 1A62A 2GVAA 2OQ0A 4GLAC 2VS1A 5LMUL 1VCIA 2I5LX 3RLNA 1XNQL 1K0RA 1L0WA 1BBUA 2KCTA 4OWXB 4DV0Q 2UXCL 4A3LG 3LGJA 3AFQA 5M5XH 4GKKL 4LFBQ 1V9PA 4JI1L 2Z6KC 1YJNA 4JI5Q 4B3ML 4L5SA 4LF5Q 4A3FG 2PMZE 3ERSX 3F2CA 2V1CC 4YWKA 3J81j 1JJ2A 3NBHB 1VQGA 1PH2A 5GAHC 2K5NA 3PUVA 4LF7Q 3HOZH
chains in the Genus database with same CATH superfamily
1E7ZA 2PO4A 4O0AA 4LF6L 5C4HA 1HXYD 3J80i 2CVRA 3HKZG 4OO1G 4IUPA 1DOKA 3FHWA 1O78A 2Z0SA 4LNQA 3Q23A 1T9HA 2OXPA 4YIJA 2IY5B 1DXMA 1I94Q 4WJ4A 3KF8B 3MWYW 4C3HG 4IN3A 1G91A 5DLQE 1M4VA 2JEAI 3HP3A 1YJWA 3PO2H 2F0HA 1M8AA 2A1AA 4JI0L 4A3KH 1PFMA 4R8IA 4I7AA 1VQHA 2B2TA 4X62Q 3HKZB 5GROA 2GN5A 1IL2A 1NTGA 1YVCA 4C56C 4UPAA 5JJZA 4JYAL 1WD1A 3HZXA 1CI3M 1STAA 4HJ8A 4C3HB 4GN3B 1HUMA 3L9AX 3S1MB 1II3A 1NR2A 4JBKA 1PMRA 1ZKOA 1G8ZD 5CGKA 1VQPA 3W3AA 3E0EA 1CSPA 3GTPB 3DXJC 1YNNC 5C3XA 1KDCA 2JYOA 4EX5A 2R7ZH 3NENA 1GUOA 1VQAA 4OX9L 5C4XH 2F0QA 3M7NA 2EYLA 2KJXA 3HGBA 4A3IG 1EZ6A 1GOZA 2X69A 3OTOL 1JOOA 1B70B 3LX0A 4P73A 3PUWA 5J1ZA 3JAMi 1HNXL 1SJED 3K81C 2M00A 1SYEA 3TP6A 1Q1EA 3RR5A 2PW5A 1B7YB 1L1OC 3Q0AA 2ZT9C 3GTLH 1GUGA 3CKIB 4B9XA 4A3FH 4UP9A 3WOFA 3UI2A 1JOQA 1HTLD 4YCUA 4A3IB 1S72A 2L11A 4A75A 2K32A 2K33A 1JT8A 1MHWC 4F88A 5CV9A 2WV6D 4IJHA 3D0FA 5FO7B 2C35B 2E2JH 4JI8Q 3CCVA 2R3ZA 3VYRA 3T51B 4DFAA 4X66L 1ML0D 2BA0A 4HSVA 5C0XG 1LT5D 1XTCD 3GTQB 5A2QL 4NPSA 3CD6A 3BG3A 4MTKA 2ZTCA 4FF4A 4ME5A 1B3AA 2KQ3A 3A7AB 1VQ9A 1A8VA 1Y69U 4TSSA 4DV7L 4HIKA 4PMWA 3BS1A 3IAYA 5CBEE 4HJ9A 1PTOF 3S2DH 4HJAA 1L1OA 4N9TA 2D0OA 3HEJA 1JB7A 5C5LA 5EKKA 2ENBA 2E2IB 1TKWB 4EQPA 1LABA 1WCMG 1EEFD 1GVPA 2QDLA 2RA4A 1I50H 4Y7NB 2IX0A 4KHZA 2PW7A 1VQMA 1TWCH 3H0GH 4KJOA 1QVCA 1XPUA 1QZGA 4LF9Q 3H94A 5EPJA 1QNKA 3VA5A 4JI2Q 4LFBL 1GKHA 2PPBC 2NVYH 1AEXA 3MEHA 2F0UA 1JC7A 4ZQ3A 5LMNQ 1VQ6A 1X3FA 2D9UA 4JI7L 3E5SA 5IT9L 1S3OA 4F8MA 3RN2A 3CAMA 1TY0A 1N32Q 2JJQA 2E76C 2EOTA 1PH7A 2J7ZA 3J7AF 2R93B 1V1OA 1SFOH 2CQAA 4IFDG 4DV1Q 1CHQD 1OXUA 5ELDA 4DR2L 3OW2A 4LK1C 1SLJA 3CP0A 3T1YQ 2L1BA 2A6HC 1JORA 2EQSA 1GM5A 3M3YH 3S14H 4OO1I 4H0LC 4LFAQ 1SYDA 2EZVA 2NN6H 4WJ3M 2JE6I 2OCEA 1HZAA 3K8AA 1PFBA 4DR5L 1XMQL 1WYDA 2N78A 1K8AC 2CFMA 1HZ9A 3CXCA 1MIUA 2MQHA 3N52A 1NAPA 1KRSA 1MSGA 1WTOA 4AYBB 4NMZA 1X3QA 2RDGA 1PH5A 1S5CD 1LTTD 4ZK9B 4A3BH 2L0CA 4JI6Q 2FMMA 1H9SB 2F0TA 4CDFC 4DA2A 3I55A 4L63B 1HZCA 2LS01 3OMCA 5FOBB 5CC4A 4GNXA 4FF2A 3L7ZC 4JI4Q 1AW7A 1XJVA 4JI3L 1QVFA 1JWUD 3TBIB 1ENCA 2L12A 3W1GA 5M3FG 1WTPA 4A3MH 2NBFA 2RHSB 1X6OA 5IP9H 4CDCC 4CKEA 3OOCA 2JEBI 1N36L 2JA7G 5M5YH 3F2BA 2NVXH 3TS2A 3NWSA 1FNWA 1X3EA 1R4PB 3U58A 1SYCA 2NZHA 1CQFA 2VB2X 4DU9A 3P75A 1JJCB 2D5DA 4IUVA 4A3KB 1A0IA 1Y1WG 3CPFA 4FVMA 2ES2A 4B3SQ 2CW0D 3HOVH 4K2KA 1O7IA 5KRUA 3CCMA 4POFA 2AWNA 5FJ8G 4IOCA 4FDBA 3BJUA 2VUMH 3H09A 2WAQB 4A3EG 1WTVA 1UAPA 2UUAQ 1N8RC 1B2TA 2F0OA 1JWSD 1PTOB 3CRKC 4JBJA 3WDNA 4C3IH 4LF6Q 5C4ZA 3VYUA 2VW9A 3G4SA 5KIXA 5D65A 2K5DA 3CMAA 5IYDH 1D5XC 1X3PA 2F0KA 2SNMA 2ATWA 2OF1A 3FRPB 2V4DA 1VQKA 1JQYD 1QB5D 4A3DG 2VNUD 2NVTB 1A6XA 3LWEA 5EBCA 3RD4A 1OTCA 4A3EB 2R7ZB 1XWEA 5IY0A 4JI0Q 1B53A 3S15H 2A19A 5DEHA 1VDZA 1VQEA 4PG3A 4RHRA 4R1JA 4XQNA 3OMGA 1D8LA 4OL7A 2HIVA 5C0XI 1IW7C 2QEJC 5FLXL 4WORA 5DAUA 4JYAQ 3DEPA 3ERQA 3J81L 4KN4C 4X64L 3STBD 3S1RH 5NUCA 2E5LQ 1KLGD 1SDFA 4DXFA 5IGGA 3NK9A 3TQYA 4DV6L 2N49A 3KJPA 4A3FB 1I3QH 3BDOA 1W3SA 3CF5A 2EVBA 3H3VH 3KDFA 4B08A 3MXPA 3OW7A 3FKIH 1U0LA 2AQ2B 3QJYA 3K6OA 1SE2A 1XTDA 4KN7C 3CQZB 4JBMA 3GDEA 1FGBD 4OX9Q 3V96A 1NJIC 3ICEA 3A8IE 3I4NH 5A2QE 3PF5A 2K75A 2A68D 1UE5A 4EQNA 1BCPD 1ET9A 2H4OA 2WACA 1SROA 4CBVA 4PNYA 1KXLA 1YHBA 4E6IA 4RKBA 2HUGA 3NTIA 1MSHA 2CH4A 3H91A 3F1ZA 1SNCA 5AJ3Q 3J80c 4DNTB 1QNUA 4IFDI 1J8IA 4EGVA 2E8GA 1HQRD 1D1KA 2DJGC 4YHHL 2XIWA 1F2MA 5C4JB 5J22A 5C3EG 2OWOA 1I50B 2UU9L 3J7A5 4Z9CB 4XYQA 1IBMQ 1TWCB 3H0GB 5IT9E 1E2ZA 4IALA 2PQAB 3K5MA 1DCZA 5TSSA 1HHVA 3URYA 2QA4A 2A6HD 2QF7A 2IT1A 4KY7A 4BBSH 1XMOQ 4FNFA 4AYBE 2NVYB 1Q8KA 3I73A 1B4OA 3PF4A 3KBGA 1WTXA 1D5MC 4ZLTF 1SYBA 2VY3A 4DR6L 1S5DD 3ER0A 4DAVA 5C3EB 4DV7Q 2HCIA 2L55A 1SFOB 4HEDA 3VDYA 2KHJA 4BY7H 5IYCG 3F2DA 3BZDB 1CM9A 1L2FA 3PO3H 3S1QB 1HZBA 2K52A 1ENFA 2ICEC 2ZM6L 3GP7A 1MKHA 2GVAA 1I4QA 2NB0A 3S14B 3M3YB 3RLNA 1I6HB 1K0RA 3HRZC 1BBUA 4OWXB 1ZXTA 4DV0Q 4C1NK 1H9JA 2D2CC 4XQQA 4LFBQ 1V9PA 4JI1L 4B3ML 4JPBW 1SNMA 1EWHA 3R93A 1JJ2A 5C3WA 4KV6A 4G57A 4BS9A 5GAHC 2A74C 3PUVA 3HOZH 3MAQA 4DXGA 4Y52H 2KCCA 2UUCL 4OONA 2PZWA 1K8GA 2JA5G 1RDPD 2R61A 1X9NA 2WAQE 1Q12A 3HOXH 1PA6A 4JC0A 4R4IA 4YY3L 1HNWL 3WOEA 4A3BB 4DR2Q 3MC0B 4FXDA 1VQDA 4NXNL 3HFZB 2OT2A 2K1BA 5C0XJ 1FNVA 1HNZL 3VR3A 1R9TH 2NYZD 2MUYA 3NBHA 2DNEA 2PCFB 4BA2I 1N9WA 1SNDA 1EY5A 2FMCA 4EQOA 4RFBA 4P2CB 5GQOA 2BE5D 3U9SA 1NMFA 4DR5Q 1ICFB 4JBWA 1EQTA 1D5ZC 1SJHD 4G7HC 1A2UA 2NVXB 5KNCA 1L0XB 1E2VA 1B9NA 4A3JH 2B2UC 4N8X1 1FVIA 2Y0SB 4IUUA 4HAEA 1WJJA 4A3GH 4FP5D 2VZAA 2QDBA 2RCFA 4O1NA 2FXQA 4RCNA 2WKCA 4GZYC 2VUMB 4LFCL 1ZYRD 4GNXB 1V8QA 2HCCA 2HQLA 3SK8A 2F3VA 1WTWA 2F0EA 5CMDA 3A5ZB 1A2TA 1SRUA 2FFKB 1G51A 2ZJRA 1IW7D 2AKWB 3CC7A 4LF4Q 1X32A 4IFDJ 1N36Q 2BCOA 3NTKA 3DWQA 4UDUC 2R7FA 4IZ8A 2EXDA 3BZKA 5BR8L 1NY4A 1RCVD 2DGYA 2RCNA 1D6EC 4A93G 3J81E 1FGUA 2WKDA 2EYJA 3FMCA 4PV1C 4DV2L 4WJWA 1PLFA 1KDAA 1YHAA 3EROA 2B2UA 2NWGA 1E0BA 3TN2A 1S5ED 5EAYA 2K5QA 4HMJA 4C2MH 5C5MA 3I4MG 3GTMH 4BXXG 2B39A 1VQ7A 1XNRL 2GVBA 3S1RB 2CCZA 2RKSA 1JICA 1SYFA 2PZUA 1W2BA 2RDHA 3FEWX 4A93B 1PH6A 1I3QB 5G3LF 1DM0B 4L5QA 1CK1A 4L8JA 4QL5A 5M9OA 1TWHH 3MTSA 4DV5L 3M7GA 4XXEA 4LW1A 3FPPA 2HQEA 2EYPA 3P7JA 4HIDA 1SMYD 1NSNS 4OIJA 1YI2A 1GUSA 2KEEA 4O42A 2CKZB 3NUCA 1B8AA 4KKSA 4ZUJA 2NN6I 4X64Q 1LTAD 4DV6Q 2MJ8A 1RTNA 4CDDC 4HR7B 4K6DA 2BDOA 5COYA 1Y14B 2A8VA 4O2DA 1LLRD 1MJCA 2XSCA 4IPDA 1IBKL 1AZQA 3PGZA 1TR5A 1LTID 4UP8A 1LACA 2WP8J 1GHKA 1FR3A 4RG1A 3U4VA 3T16A 4KHPL 4R8NA 1AN8A 1E1TA 2KHIA 1CZGA 3TSSA 4L5TA 1O7ZA 5EBDA 1YIJA 4BBSB 3QB3A 3RZOH 1NUCA 1JB3A 4Q5VA 1K73C 1CKNB 3ZJYC 4HCEA 5JPMC 2HHHQ 2XN9C 2F0FA 2KUMA 2Q2HA 1OO9B 4P75A 3MEFA 2ZXRA 2IX3A 4JVZA 3EQLC 1SE3A 2ID0A 2K5HA 2WINB 1W6KA 4CGYB 2ASBA 2A6EC 1PHJA 1IBLL 4KJNA 3PO3B 3OSOA 3I4LA 2UU9Q 2E75C 3AMUA 1RKNA 3UE1A 5FJ8H 1A63A 3AFPA 4ZUIA 5C44G 5M3MG 3CW2C 5BN4A 2F4IA 2DJFC 2Y0SE 2A69C 1Q90A 3NWTA 2Z6BA 1D2BA 4NXMQ 5L37A 2B63H 4C3JH 4AIMA 1STYA 4ALPA 5CBAE 2BDNA 4A76A 4DR6Q 3MHBA 1HR0W 3S2HH 3NPPA 2ZTEA 2G5DA 5GAGC 2F03A 4U68A 3W2DA 1T5XD 1EEID 2IJ0A 5J3BA 3X3NA 3A7LA 5C44B 1MBYA 5M3MB 1VQOA 2R7DA 1JWMD 4CDEC 2PMZB 3DMUA 5I2YA 1J5EQ 1RD9D 1N34Q 4RKLA 4DR4L 1EIHA 3G6JB 2TSSA 2N88A 1PRTD 5FLMH 3CC2A 1CSQA 3OWEB 3TZUA 4CJ1B 1I6VC 4JI1Q 2JA6H 4B3MQ 1DJRD 4P72A 2GA4B 1Y8NB 2UUBQ 5DM73 1EY4A 5I9OA 1STBA 1TWGH 1MGSA 4GOPC 4HSPA 4BBRH 1M90C 1RTOA 4BY1H 1U4MA 4A3JB 1JOKA 4B9WA 4IUNA 5GADC 4GN4B 1MD2D 1K83H 2XWJB 1JR0D 2PI2A 1XXGA 3AYHB 4X6AH 4CKBA 2R93G 4YY3Q 1HNWQ 4DV4Q 3L0OA 2UXBL 1K8MA 1I5FA 4R4CA 2AHOB 2KENA 1JE4A 3PIO3 2MFIA 4A3CG 4NXNQ 4RAUC 1HNZQ 3MXNB 1F2YA 3BDLA 2HDMA 2F0WA 2RQXA 2VL6A 3S1NH 2G9DA 2LSSA 1K28A 2AUJD 2YYZA 3RUZA 3MXUA 2VB3X 4JK1C 3H6MA 4FXKC 1WVLA 4DR7Q 4CJ0B 4K2LA 4ZKCB 4R9WA 1VF7A 5FO9B 5D3IB 3KF6A 1BUVT 1HA5A 4ZKBB 3CCLA 1KIXA 1DGSA 3PIOA 4AYBG 3NXWA 3CU7A 3GO5A 2ZJPA 4G7ZC 1C7YA 2E2DC 2QGQA 5IIFA 4RGTA 1EYAA 2R92H 5E4XA 3M4PA 1KABA 3NEMA 3EJIA 5IT9c 2EIFA 4PZ8A 4CHTB 1Y1VH 3S9WA 1HR0L 1EWIA 4C2MB 3A56A 2K5VA 3UDFA 3GTMB 1ONLA 3S16H 2CWPA 4KKUA 3V05A 4DAYB 3E6ZX 3MZ5A 4Q0FA 2Q8RE 1YNJC 4MN3A 3OYYA 1TS3A 1VQ4A 3T56B 5I2XA 1SN8A 1N33L 1V1QA 5DNFA 2IWHA 4B3RL 5BR8Q 1Y8OB 4K14A 1VQJA 3ZYYX 1VQIA 1LTRD 1B50A 3PO2G 5IYBH 1Q81C 3PQIA 5T1GA 4A3KG 1Q1BA 3V2TA 2F0LA 4IJLA 2JK8A 5JOBA 4GKJL 2EYHA 1UEBA 4MNOA 4NP5A 1I4XA 5JEAJ 1S5FD 4X3TA 2WAQG 5ISRA 2QEXA 1E1OA 2E2HH 2A5HA 1CA6A 1PRTB 3G6EA 1XNRQ 2UXDL 4QIWE 1GUNA 3B6YA 3RLFA 4DUZL 4DUYL 3HOUH 3PO2B 4DK6C 1EOVA 1YNND 2AWOA 1VQBA 2EY1A 3G7LA 1QJOA 3K80C 3IKJA 3N6RA 5K5PA 2YU9H 4B3TL 2R7ZG 5CORA 2VQFL 4K6LA 1EOTA 2CWAA 1RIPA 5C4XG 3SK4A 5KGUA 1K3BC 3VR5A 5K36H 3CCJA 2KA7A 2K4KA 1LM0A 5JJKA 3SE0A 1Q7YC 2JA8H 2BA1A 4KK7A 2P5ZX 4DK1A 3BVMA 2VS1A 5LMUL 2I5LX 1XNQL 2KCTA 1IKLA 1QOHA 2UXCL 3LGJA 1IYUA 1B3QA 3AFQA 5M5XH 4GKKL 3CHBD 1YJNA 2SOBA 4A3FG 2PMZE 1LTGD 3F2CA 2V1CC 3E0JA 1TQOA 5C4XB 2K5NA 1RF2D 5JVH3 4DAPA 1IBKQ 3SHLA 2EJFC 2KCMA 2JP1A 4KY6A 5M5WH 2N55A 4R4QA 1XPRA 1PYBA 3SVMA 5IP7G 5BN5A 1MI2A 2RVLA 3DHQA 3SK5A 5FO8B 5CYUA 3M4OH 3K0XA 2BH2A 3GTLB 1D7QA 3F8TA 1QE6A 3D4RA 1LTLA 1XPOA 3DUZA 5EGTA 4YWMA 3OHXC 1RHPA 3T53B 2KCNA 4KKTA 2N3SA 3NSWA 1VMPA 3U4ZA 3OIPA 4DV3L 3HOWH 4RH6A 2YV5A 3S2HB 3WWVA 2K01A 4JOIC 1YITA 1I94L 1BCPF 3RZDH 5FLXc 1LT4D 5IGDA 1TU2B 4POGA 2FHTA 3KF8A 4DNIA 4RGNA 4HIMA 4OWWB 5E7NA 2E2JB 3IL8A 1FJGL 1LT3D 2JXMB 3OTOQ 2LKVA 3HOYH 1HNXQ 1X55A 1UE1A 3H0GG 3VR2A 2XRSD 1H9KA 2KEDA 1BBWA 4X62L 1Q8IA 1A15A 2JA6B 3I70A 2F0JA 3CCUA 1A3VA 2VQEL 4JW0A 1TWGB 1PH1A 5CV5A 2ZXOA 2CHBD 4BBRB 4BY1B 1ET6A 3S2DB 5ELNA 1O7YA 3TEHB 1QCBD 1TWAH 3TMEA 3ITPA 4PQXA 2SNSA 4A3LH 4IUQA 3K7AH 1GJXA 3BVZA 3CCRA 5T1IA 3BZCA 4WFN3 4MTNA 4OGQC 1VMCA 4X66Q 4DR4Q 3GV6A 1I4GA 1S40A 1EFID 3I4OA 4M1UB 3U50C 3J7AV 4YWLA 4OO1H 4V190 3S1NB 2CQOA 2NN6G 1VQ5A 4LF8L 2YTXA 3NBIA 4IO9A 2HD3A 3G71A 3W1BA 1EZ8A 4EVOA 4HJ7A 2QKIC 4C3HH 1EIYB 1RL2A 1IKMA 1BVSA 1EUJA 1L1OB 1KL9A 2B3GA 3D8GA 3KK7A 4KY5A 2EY6A 5C6AA 4AH6A 1PFNA 1Z9FA 1F9PA 3DWPA 1NMGA 1QG7A 2L5TA 2SDFA 4GLXA 2UXBQ 4A3BG 1KQSA 2R92B 1HRJA 2AUKA 3EVQA 2O4XA 4PMBA 2KVMA 2IW3A 3JAML 1Y1VB 4OIKA 1K8OA 4LJZC 2QILA 2PQEA 2WIIB 3S16B 4K0KL 2B2WC 4JI7Q 1LYLA 1F2ZA 5DM63 4LUZA 2HT1A 1F9SA 4H7BA 4A3MG 3S17H 5IP9G 3KLSA 1GD7A 4QUCA 3KBXA 3ND8A 1TS5A 4KHVA 1F2LA 1HQMC 5AFWA 1KLUD 3K59A 4JI5L 2Y0SG 5I6WA 4XQJA 4KTAA 4LF5L 4YCVA 1Q46A 3GTJH 4DF7A 2MNAA 3CMEA 3HOVG 4GLVB 2WB1E 1AP0A 4A3IH 2RSNA 1KAAA 2G9HD 5FKAC 3FPUB 2B2YC 4ME3A 2VUMG 4EQ5A 2Z4HA 2LXJA 4NKLA 4J15A 4WRDA 1BCPB 1QVGA 5JEAG 4A3MB 2E2HB 1XMQQ 3NQIA 4XTCS 1DYQA 3QG1A 1NBWA 2F0IA 5M5YB 1AE2A 4C3IG 4LF9L 3JC66 1LTSD 1UE6A 4MIUA 1B1ZA 4JI2L 1EL0A 1TT2A 3AB9A 2F4VL 2Q2IA 3HOUB 5IYDG 5F2DA 4C1NI 3GTQH 1LO5D 1X56A 2JN4A 3TP5A 1N33Q 2I5HA 3HOVB 2KBNA 2XNAC 3FP9A 2B2WA 4B3RQ 4DR3L 4DN4M 1AZPA 2NVQH 1XX8A 3L3OC 1P8LA 2BOSA 2CH4W 5KEEA 1LT6D 2MP1A 5ELOA 1JE5A 3UDXA 3UE0A 4DV1L 1FNUA 3TZDA 1BO0A 1IL8A 4JI3Q 4C3IB 4OWTB 3UDIA 2LMCB 4Y7NH 4HIOA 5C0XH 2JA8B 3GD7A 2QW7A 2MPMA 5JPNC 2LY7A 1EY7A 5EJWA 1B44D 4QJFA 2B2YA 3LWUA 1BOSA 4DUYQ 5M5XB 2VXWA 5I6YA 2F3IA 1EY6A 1ILQA 1STEA 3OWFA 3S15B 2Q2TA 3C46A 2SEBD 3I56A 2I5MX 1WCMH 2DNCA 1NNXA 2Z8LA 5IGEA 1HFGA 4CJ2C 1DOLA 1K3RA 2TMPA 1J9OA 4RCOA 2VQFQ 2O5IC 1Z47A 1EIGA 1PTOC 4K5XA 3TS0A 3I4NG 2AMCB 4XYOA 1EQQA 3M4OB 3M4YA 1KDBA 3AQQA 1H9SA 2NZ1D 3TREA 3C3LA 3VYTA 5FK9C 1AH9A 3QO2A 2MO1A 2OEOA 1XNQQ 3J81i 3H15A 1CQVA 1HUNA 1EWCA 1CA5A 3FKIB 1NCVA 3HOWB 1BNZA 4LUVA 4M8AA 2Z4IA 3D3RA 4LAAA 4FXGC 5CR3A 2IHFA 5HURA 1PH3A 4IFDH 5KNBA 3J80E 3AU7A 2K03A 1ICWA 1U9RA 3KJOA 3I4NB 2IPKD 1GUWA 1WOCA 1KAWA 5J39A 3E3XA 1GUTA 3C2PA 1C48A 4PZ7A 4IPGA 2F0NA 3MA2B 2J4XA 1SR3A 3HOYB 2EYOA 5IE8A 1SBBB 3GQBA 1PFSA 3M85A 2ZJQA 2UUAL 1PVOA 4IURA 2PI2E 3I2ZA 1HJPA 4BBSG 1QUQA 3QWNA 2WFWA 2H1EA 3KDFB 4FF1A 4ZYSA 1BKBA 4DV3Q 2B8GA 4OEMB 4R4OA 2J0TD 4X3SA 5EKIA 1TWAB 3R2TA 1G2SA 2B8FA 1X54A 1GHJA 4BY7G 2R6GA 1FJGQ 3K7AB 3MXGA 2B29A 4IQZA 4P74A 3PO3G 1CHPD 1EY9A 2F0GA 1SYGA 2K7VA 2QCPX 2XTIA 3DLLA 2L9HA 3QIAA 5ELCA 3UDGA 4X65L 1HCZA 3CCEA 1EY8A 1VQ8A 4TKOB 5M3FH 1X3GA 1U4PA 3ONAB 4KD3A 1UE7A 3DEOA 4MZ9A 1UEAB 2D62A 1PTOH 3BVGA 2JA7H 4PZ6A 3R3OA 1ESRA 3PUZA 4ZAIA 2VQEQ 4AQYL 2MO0A 2E5LL 1CT1D 1UWVA 4QIWB 3QOJA 4RA8A 3HOZG 5H1SE 4BY7B 4YHHQ 2NZOA 4LWCA 3JAME 4L5RC 3GTOH 1WFQA 5KYIA 4ULLA 1Y1WH 2O2LD 3HOXG 1WTQA 2CW0C 4K5WA 4KI0A 2C5CA 3OPOA 4DR1L 2NVTH 4H02A 1F9QA 4ZRZA 3A8KE 3CPWA 3CCQA 4A3EH 1QILA 1STHA 5ELFA 3AEVA 2F0VA 1F9RA 2MGSA 1SAPA 2OQKA 1Z7TA 1OXSC 5E3FA 2RDFA 2PNHA 3EBEA 2F0DA 1MJEA 3HOZB 4P71A 4LF8Q 3D6WA 2JA9A 1LTBD 4QCLA 2JSOA 3S17B 1IYJB 3HOXB 4TRDA 4A3DH 4LUOA 1SE4A 4NW2A 1RJTA 5IWAL 3EIVA 4UAIA 5JAVA 1U4LA 1PRTF 1BR9A 4A3JG 2AQ3B 5AJ3L 1SNQA 2A73B 3GTJB 2ZM6Q 4A3GG 1WTHA 1R9TB 3R2IA 3I91A 4K5VA 3BU2A 3SGIA 1V43A 3CQZH 3RLOA 5IP7H 3FVQA 5IGFA 3KYHC 4APVA 4JCVE 1IBML 3U9OA 4DNRB 3STBC 3SXHA 1P16A 5CV6A 4QY7A 2EJGC 4K0KQ 1PH9A 2PQAA 4RMFA 2K14A 2UUCQ 4N8FA 2F1MA 1GXDC 1CUKA 2BH8A 4ODGA 1XMOL 1ENAA 2OTLA 1DOMA 3H3VI 1PZID 1A62A 4GLAC 4A3GB 1K0SA 3OIQA 1TVXA 2NVQB 5A35A 2EY5A 4JI5Q 2Z6KC 4LF5Q 5I4DA 4YWKA 3NBHB 4X3KA 1PH2A 2A68C 1TXYA 3EN2A 5C4JH 1IYVA 1BCPC 2RBMA 3GTKH 4GS3A 1PTOD 1KRTA 3S24A 4ID6A 3M4QA 1UUPA 4TQUS 4DV0L 3HS0C 3IFDA 3TP8A 2I0QA 3NP8A 1PV4A 3KLSX 2F4VQ 2HDLA 3QR8A 4KLKA 5D14A 3DM1A 3EA6A 1CZWA 5IODA 4GOPA 4DR3Q 3R8BA 4QGUA 1HPCA 3G48A 4FYDA 1WCMB 5C3EH 4LFCQ 3LNNA 4GNXC 1EQRA 1C4QA 3D6CA 3PSIA 2K50A 1FD7D 2M9VA 1AE3A 1TWFH 1AFPA 2EDGA 3HG9A 3I72A 1F77A 2DN8A 3S1QH 2Z6KA 2L15A 3NHHA 3O13A 1I6HH 1UNSA 3EFXD 3SDZA 1ASZA 3X3MA 3T1HL 1IHZA 1B9MA 1TWHB 4J6HA 1KD1C 3NTHA 1TIID 4XT3B 1BQQT 1W6JA 4RHSA 1D1IA 2F52A 1U5KA 5IYCH 4DV2Q 4J1MA 1TS4A 1ESFA 3HKZE 1VF5C 5KYLA 3Q8DA 3A0JA 3KLWA 5D3DA 2Q8IB 2KHSA 1O7LA 3MFGA 1HA6A 5E1FA 2ZXPA 2PNRC 2H5XA 3VR4A 1S5BD 2JQOA 3C1EA 3SR1A 2WB1G 3ND9A 2Z1CA 3VA7A 3GTGH 3E9HA 3H3VC 4DPGA 4UHVA 1E24A 4DKAC 1J6QA 4IPCA 1H9MA 1JCKB 4JV5L 2JA5H 2EY2A 4DV5Q 4LF4L 4HCSA 1E3PA 1C0AA 1FL0A 3CCSA 1CTMA 3FDTA 2A6ED 3A74A 4HTHA 2KOLA 5CV8A 4DK0A 1X65A 3D4WA 3RZOB 3BYTB 2I46A 1IZ6A 2WB1B 1PH4A 4BWGB 1T5EA 3RNUA 2FJ2A 1PZKD 2BE5C 5M3FB 5JEAH 2NTSA 1I4PA 3ULJA 1QUQB 3KUPA 2A69D 2JA7B 4ABNA 2F3WA 5HGQA 2B63G 4C3JG 2YTYA 5EKLA 2ICIA 2NUCA 2DY7A 2LXKA 1LUZA 1K9MC 3RN5A 1M1KC 5E4WC 3GTOB 1S4ZA 1STNA 2B2VC 4YCWA 1Y1WB 1EYCA 1WTRA 1FYCA 5ELBA 2EJMA 4KHPQ 1VQNA 4F7XA 4U673 1KNEA 1SNOA 1ZYRC 2XVSA 1WI5A 1V1PA 1HTPA 5LHY1 4DGZA 2B63B 4C3JB 4X65Q 4LF7L 1SMXA 2AQ1B 4K8JA 3TRZA 5FLMG 3NE5B 1EYDA 1BDOA 3QOLA 2JA6G 4MHEA 4N9PA 1IXRA 2X6GA 3SK6A 5HY6A 3K58A 4ZCKA 1BBXC 1H95A 4AQYQ 4A3DB 4RGMA 4BBRG 3J81c 2F0SA 4BY1G 1CKMA 2Q2UA 1IBLQ 1VQFA 4J8QA 5CV4A 4A93H 2K28A 3DWAA 4IUTA 1QZHA 1KHIA 4DR1Q 2EPBA 4UY8C 3J80L 1QWYA 3PUXA 4V0BA 3RMHA 2I07B 2B2VA 1STGA 3I4MH 5GAEC 4BXXH 4G4KA 4I7ZC 4XT1B 4IOAA 3F2UA 1PDQA 5JJLA 3NELA 3T4AC 4IPHA 5HGTA 3J7ZC 2XGTA 2K5WA 3L2PA 1K83B 4JG2A 1C9OA 1NR4A 3GV3A 1CKNA 5IWAQ 4OELB 3KOJA 3MVVA 3VR6A 1Z6HA 2EYFA 2HHHL 3IRBA 1E22A 4PMCA 3I90A 2IX1A 2IHEA 1EFWA 3E9IA 1OXVA 4JOIA 5LMNW 1SMYC 1YJ9A 2R92G 1A3UA 1CFMA 2XRQD 1H9RA 3P20A 1Y1VG 1Y8PB 3GTKB 3A55A 3VYSA 2Q8TA 3SEBA 3S1MH 1NE3A 1GO3E 1YNJD 3CRLC 1KNAA 1PZJD 2KECA 3I7FA 3KLRA 1BF4A 4NXML 3GTPH 1YEZA 3A54A 2C9OA 1SNPA 5JVG3 1ZEQX 3PV0A 3ULPA 3KFUA 2X6LA 2N8NA 5IYBG 4R4TA 3PMFA 5KNDA 1TWFB 2EYMA 1SXTA 4JI8L 1G291 1YBYA 2O5JC 1J5EL 1PXUA 3TP7A 1N34L 2XWBB 1L0YB 3PCOB 1OXXK 2PZTA 1KC8C 4DK3C 3KF6B 1EYGA 2ZTDA 3K5NA 1I4HA 4K8IA 3A8JE 1SSOA 1JJGA 5CV7A 1YHQA 3HOUG 2UUBL 4FO2A 2EE1A 3JAMc 4G7OC 4GOPB 4QF4A 1C8CA 1BXTA 4LMQD 1SE8A 3K5OA 4RWSC 4ILWA 5BN3A 1EY0A 3IFTA 3K5LA 2K6AA 3C1FA 4RGOS 4QB4A 4TVAB 1HR0Q 4X3UA 4DV4L 2EXZA 2D0PA 4CKCA 1WD0A 3PUYA 4HN7A 4HMIA 5C44H 5M3MH 5EQ0A 1YNXA 5K36G 3PIP3 3MFYA 1VQLA 2RSOA 3K57A 3MXNA 2JA8G 5LMNL 3GTGB 1DONA 3T1HQ 3ULLA 1PH8A 4S3SA 4NB3A 4DAMA 1XYIA 2JA5B 2L4NA 1N32L 3Q6SA 2K05A 1PYSB 3Q24A 2YU9B 4GN5A 1Q86C 4H13C 4DR7L 5ELEA 2DY8A 1Q3LA 4KD4A 4BA1I 1U4RA 2RF4A 1SEBD 4GKJQ 2E2IH 5JJIA 2FINB 3D4DA 3T1YL 4H44C 2YTVA 3PIPA 4OXPA 2ALYB 3I3CA 3D31A 4F87A 4HJ5A 2F0MA 2E74C 1G6PA 1PRTC 3I8ZA 2DUDA 1VQCA 4LFAL 2UXDQ 1ILPA 4XDXA 2OTJA 3Q22A 1EU4A 4DUZQ 2IL8A 3M9BA 3HKSA 4A4IA 5LL6S 1EIFA 4DAYA 4I65A 4JV5Q 1CKOA 4QQBX 5I9PA 3FKIG 3HOWG 1ASYA 1RODA 5M5WB 3NQTA 4B3TQ 3W5OA 3K7UC 2R93H 3BDCA 3BYYB 1I4RA 1JMCA 1G6ZA 1A3TA 4JI6L 5EPKA 3CC4A 1EU3A 4A3CH 5FLXE 4FF3A 1VS0A 3P1HA 2PYKA 1OXTA 4XIGS 4OHJA 5EPLA 4QUFA 3HOYG 3A5UA 2NTTA 4JI4L 1YZ6A 5LMUQ 1Q82C 3DM3A 2UXCQ 3T13A 1G2TA 1E2WA 1DZ1A 4GKKQ 2F0PA 2RHQB 1PYWD 1HH2P 4UP7A 2MHVA 5IGCA 1O80A 4NDXA 3TDQA 3RZDB 1LV9A 4QMGA 5LL6X 3J7YW 2B2TC 2LFNA 1TY2A 2HIXA 1DD2A 1KTKA 2M2LA 1EQVA 4B3SL 3K0YA 2OQ0A 1VCIA 1L0WA 4A3LG 4KMUC 5IGBA 1R4QB 4L6TB 4L5SA 5G3LD 1V1PB 5IOCA 3I4MB 3ERSX 3J81j 1HFNA 2K04A 2Z9HA 1VQGA 1TS2A 4LF7Q
chains in the Genus database with same CATH topology
1E7ZA 4O0AA 4LF6L 1IBKQ 4Y52H 2UUCL 3J80i 1TXYA 2KCMA 3EN2A 3HKZG 4OONA 5C4JH 4OO1G 3FHWA 1K8GA 2JA5G 5M5WH 4R4QA 2Z0SA 1X9NA 4LNQA 2WAQE 1XPRA 1PYBA 1Q12A 1T9HA 5IP7G 4GS3A 3HOXH 1PA6A 3GTKH 2IY5B 1KRTA 3S24A 1I94Q 4JC0A 3M4QA 4R4IA 4YY3L 1HNWL 4TQUS 3KF8B 4WJ4A 4DV0L 5DLQE 3M4OH 4DR2Q 3K0XA 2JEAI 1YJWA 2I0QA 1VQDA 2BH2A 3PO2H 4NXNL 3HFZB 1PV4A 2F4VQ 1D7QA 1HNZL 5C0XJ 3F8TA 2A1AA 4KLKA 1LTLA 4JI0L 4A3KH 1XPOA 1R9TH 4YWMA 4BA2I 1VQHA 1N9WA 4GOPA 4DR3Q 2N3SA 4QGUA 3U4ZA 4X62Q 4DV3L 3G48A 5GROA 5GQOA 2GN5A 1IL2A 1NTGA 1NMFA 3HOWH 5C3EH 1YVCA 2YV5A 4LFCQ 4DR5Q 3WWVA 4GNXC 4UPAA 1EQRA 4JOIC 1YITA 1I94L 4JYAL 4JBWA 3PSIA 2K50A 5FLXc 3RZDH 4POGA 4HJ8A 4GN3B 4DNIA 1AE3A 1TWFH 4HIMA 4OWWB 5E7NA 4A3JH 1FJGL 3S1QH 4JBKA 1FVIA 3OTOQ 2Z6KA 2L15A 1VQPA 1WJJA 3E0EA 1CSPA 3HOYH 4A3GH 1I6HH 1HNXQ 1X55A 1ASZA 1UE1A 2VZAA 3H0GG 3T1HL 1BBWA 2FXQA 4X62L 4EX5A 2R7ZH 4LFCL 3NENA 1KD1C 4GNXB 1VQAA 3CCUA 2HQLA 4OX9L 5C4XH 2VQEL 2F52A 3M7NA 1PH1A 3A5ZB 1U5KA 5IYCH 4DV2Q 1SRUA 4A3IG 1G51A 3OTOL 2ZJRA 3HKZE 1B70B 2AKWB 3CC7A 5ELNA 3Q8DA 4P73A 3A0JA 3PUWA 3TEHB 3JAMi 1HNXL 4LF4Q 1TWAH 4IFDJ 1N36Q 3KLWA 3K81C 4A3LH 1Q1EA 3RR5A 2R7FA 1B7YB 1L1OC 2EXDA 3BZKA 5BR8L 3K7AH 2H5XA 3GTLH 3CCRA 3BZCA 4MTNA 1NY4A 2DGYA 4A3FH 2RCNA 4UP9A 4A93G 4X66Q 1FGUA 2JQOA 4DR4Q 2WB1G 1S40A 3GTGH 3E9HA 4DV2L 3I4OA 3U50C 1YHAA 4DPGA 4YCUA 4YWLA 1E24A 4DKAC 1J6QA 2CQOA 4IPCA 2NN6G 5EAYA 1S72A 1VQ5A 2JA5H 4LF8L 4JV5L 2YTXA 4DV5Q 4IO9A 4A75A 1JT8A 4C2MH 4LF4L 3G71A 3I4MG 3GTMH 3W1BA 1E3PA 4HJ7A 4BXXG 4IJHA 4C3HH 3D0FA 1EIYB 1RL2A 1VQ7A 2C35B 1FL0A 3CCSA 2E2JH 2GVBA 1XNRL 1C0AA 1BVSA 1EUJA 1L1OB 2CCZA 4JI8Q 1KL9A 2B3GA 3CCVA 1W2BA 3A74A 4AH6A 4X66L 1Z9FA 2BA0A 1PH6A 5C0XG 1NMGA 1X65A 4GLXA 1PH4A 1IZ6A 4L5QA 2UXBQ 4NPSA 4QL5A 3CD6A 3RNUA 4A3BG 1KQSA 2ZTCA 1TWHH 4DV5L 1VQ9A 1A8VA 3ULJA 1QUQB 4DV7L 4HIKA 4LW1A 4PMWA 5HGQA 2B63G 2YTYA 4HJ9A 3S2DH 4HJAA 4K0KL 4HIDA 2LXKA 1L1OA 1LYLA 1LUZA 1JB7A 2D0OA 4JI7Q 1YI2A 1K9MC 4LUZA 3RN5A 1M1KC 2HT1A 1WCMG 1GVPA 2CKZB 1I50H 4YCWA 2IX0A 4A3MG 3S17H 1B8AA 4KHZA 5IP9G 1GD7A 1VQMA 1TWCH 2NN6I 3H0GH 4X64Q 4KHPQ 1QVCA 1VQNA 1XPUA 1QZGA 4LF9Q 4DV6Q 4LFBL 4JI2Q 2Y0SG 4JI5L 4LF5L 1GKHA 4YCVA 1WI5A 2NVYH 1Q46A 3GTJH 5LMNQ 2MNAA 1X3FA 3CMEA 1VQ6A 4GLVB 3HOVG 1Y14B 2WB1E 4X65Q 2A8VA 4O2DA 4A3IH 4JI7L 4LF7L 1SMXA 3TRZA 1MJCA 1S3OA 4IPDA 3CAMA 5FLMG 3RN2A 1IBKL 3PGZA 4ME3A 2VUMG 1N32Q 4EQ5A 2JJQA 4UP8A 2LXJA 4J15A 2JA6G 1QVGA 1H95A 5JEAG 1IXRA 2WP8J 1PH7A 5HY6A 4AQYQ 4RG1A 3U4VA 1XMQQ 4XTCS 1SFOH 4KHPL 4IFDG 4DV1Q 1E1TA 1NBWA 1OXUA 2KHIA 1AE2A 4BBRG 3J81c 4DR2L 4LF9L 4BY1G 3OW2A 1CKMA 3JC66 1SLJA 3CP0A 1UE6A 3T1YQ 2Q2UA 1IBLQ 4L5TA 1VQFA 4JI2L 4A93H 2F4VL 2Q2IA 1YIJA 5IYDG 1QZHA 3RZOH 1KHIA 2EQSA 3GTQH 1X56A 1GM5A 3M3YH 3S14H 4DR1Q 1K73C 1N33Q 1CKNB 2I5HA 3ZJYC 2KBNA 4OO1I 3FP9A 4LFAQ 4UY8C 4B3RQ 4WJ3M 4DR3L 2JE6I 2OCEA 3PUXA 2NVQH 1HZAA 3K8AA 2HHHQ 1P8LA 4DR5L 2Q2HA 3I4MH 5GAEC 4P75A 3MEFA 1XMQL 5ELOA 4BXXH 1WYDA 2N78A 1K8AC 4IOAA 1JE5A 2CFMA 3UDXA 3UE0A 2K5HA 1HZ9A 2ID0A 3CXCA 1MIUA 4DV1L 2ASBA 5JJLA 3NELA 2MQHA 4JI3Q 1PHJA 4OWTB 1KRSA 1IBLL 3UDIA 4IPHA 4Y7NH 3J7ZC 2XGTA 4HIOA 3L2PA 4JG2A 1C9OA 2UU9Q 1PH5A 3GD7A 3UE1A 5FJ8H 1CKNA 5IWAQ 1A63A 3AFPA 4A3BH 3KOJA 4JI6Q 4QJFA 5C44G 2HHHL 5M3MG 3IRBA 1E22A 4DUYQ 3CW2C 3I55A 2IX1A 2F3IA 1HZCA 2IHEA 2Y0SE 1EFWA 3E9IA 4GNXA 1OXVA 3L7ZC 4JOIA 5LMNW 4C3JH 2Q2TA 4NXMQ 2B63H 4AIMA 4JI4Q 1XJVA 4JI3L 1QVFA 4ALPA 3I56A 2R92G 2I5MX 1YJ9A 4A76A 1WCMH 4DR6Q 3W1GA 5M3FG 1HR0W 3S2HH 4A3MH 1K3RA 1X6OA 1Y1VG 2RHSB 5IP9H 2ZTEA 5GAGC 2VQFQ 2JA7G 2JEBI 1N36L 1Z47A 3TS0A 5M5YH 3F2BA 3I4NG 2AMCB 2NVXH 3TS2A 5J3BA 1EQQA 3S1MH 1NE3A 1VQOA 1X3EA 1GO3E 2R7DA 3AQQA 3U58A 2NZHA 3TREA 1J5EQ 3GTPH 3I7FA 1JJCB 1Y1WG 2MO1A 1N34Q 1A0IA 1YEZA 3CPFA 2ES2A 4B3SQ 4NXML 3HOVH 4DR4L 1O7IA 1XNQQ 3J81i 3CCMA 3H15A 4POFA 2AWNA 5FLMH 3CC2A 1CSQA 5FJ8G 4IOCA 4FDBA 3BJUA 2VUMH 3PV0A 4DR7L 3ULPA 4A3EG 4JI1Q 2UUAQ 4LUVA 4B3MQ 2JA6H 3KFUA 1N8RC 4P72A 2N8NA 1PH3A 5IYBG 2IHFA 4R4TA 2UUBQ 1TWGH 4GOPC 4JBJA 4BBRH 4C3IH 3KJOA 1M90C 4LF6Q 4BY1H 4JI8L 1WOCA 2VW9A 1KAWA 3G4SA 1G291 5GADC 4GN4B 1YBYA 4PZ7A 3CMAA 1K83H 4IPGA 1J5EL 5IYDH 1N34L 2PI2A 3AYHB 1SR3A 3PCOB 1OXXK 5IE8A 2ATWA 2R93G 4YY3Q 4X6AH 1KC8C 1HNWQ 4DV4Q 1VQKA 3L0OA 4A3DG 4DK3C 1PFSA 2UXBL 3KF6B 1I5FA 2VNUD 1EYGA 4R4CA 2AHOB 2ZTDA 2KENA 3M85A 2ZJQA 2MFIA 1JJGA 2UUAL 4A3CG 1PVOA 4NXNQ 1OTCA 1HNZQ 3MXNB 5IY0A 4JI0Q 2PI2E 3I2ZA 1YHQA 1HJPA 2A19A 2UUBL 3HOUG 3JAMc 3S15H 1QUQA 4BBSG 1VQEA 4PG3A 2WFWA 4GOPB 3KDFB 4R1JA 1SE8A 2VL6A 3S1NH 1BKBA 1D8LA 2LSSA 4DV3Q 2HIVA 5C0XI 2YYZA 4R4OA 1HR0Q 4TVAB 4JYAQ 4DV4L 4DR7Q 4X64L 3STBD 2D0PA 3PUYA 3S1RH 2E5LQ 1X54A 3KF6A 5C44H 4BY7G 5M3MH 2R6GA 1FJGQ 1YNXA 3TQYA 5K36G 1VQLA 1KIXA 4DV6L 2B29A 2N49A 3CCLA 1DGSA 4P74A 3PIOA 4AYBG 3KJPA 3PO3G 1I3QH 1W3SA 3GO5A 2JA8G 2XTIA 3DLLA 2ZJPA 3CF5A 5LMNL 3UDGA 1C7YA 3H3VH 2QGQA 4X65L 3T1HQ 3KDFA 3ULLA 1PH8A 2R92H 3M4PA 3CCEA 3FKIH 1U0LA 1VQ8A 4NB3A 3NEMA 4DAMA 5M3FH 5IT9c 1N32L 1X3GA 1XTDA 2EIFA 1UE7A 4MZ9A 1Y1VH 2D62A 4PZ8A 1PYSB 1HR0L 1EWIA 4JBMA 4GN5A 1Q86C 2JA7H 4PZ6A 3PUZA 2K5VA 3GDEA 3UDFA 4AQYL 2VQEQ 1NJIC 4OX9Q 2MO0A 3ICEA 3I4NH 3S16H 3PF5A 2K75A 2E5LL 2CWPA 4BA1I 1UWVA 4DAYB 1UE5A 2RF4A 3HOZG 5H1SE 4GKJQ 2E2IH 4YHHQ 5JJIA 3T1YL 2NZOA 4LWCA 3OYYA 4L5RC 3GTOH 1WFQA 2YTVA 3PIPA 4OXPA 2ALYB 1Y1WH 1VQ4A 3D31A 4HJ5A 3HOXG 1SN8A 4KI0A 1SROA 4DR1L 2NVTH 1N33L 1G6PA 1V1QA 1KXLA 1YHBA 2DUDA 1VQCA 4H02A 4LFAL 2UXDQ 4B3RL 3CPWA 5BR8Q 3CCQA 2OTJA 4A3EH 1VQJA 1VQIA 3J80c 3F1ZA 4DUZQ 5AJ3Q 3AEVA 3PO2G 5IYBH 4IFDI 1Q81C 2E8GA 2OQKA 3M9BA 1OXSC 4A3KG 3EBEA 2PNHA 3HKSA 4A4IA 1Q1BA 4IJLA 2JK8A 1MJEA 1EIFA 4GKJL 4YHHL 4JV5Q 1CKOA 4P71A 1UEBA 4MNOA 4LF8Q 4QQBX 5JEAJ 3FKIG 2JA9A 2WAQG 3HOWG 1ASYA 5C3EG 1E1OA 2QEXA 3W5OA 2E2HH 2UU9L 2OWOA 3K7UC 4B3TQ 3J7A5 2R93H 1AH9A 1IYJB 1IBMQ 1JMCA 4A3DH 4LUOA 3G6EA 1XNRQ 5IWAL 2UXDL 3EIVA 2PQAB 4QIWE 4JI6L 3CC4A 3B6YA 4A3JG 3RLFA 4A3CH 4DUZL 5AJ3L 2QA4A 4DUYL 1VS0A 2IT1A 1OXTA 3HOUH 4BBSH 1XMOQ 4DK6C 4AYBE 4XIGS 1Q8KA 2ZM6Q 3HOYG 3A5UA 3PF4A 4A3GG 4JI4L 1EOVA 1YZ6A 2AWOA 5LMUQ 1VQBA 1Q82C 3DM3A 3BU2A 2UXCQ 3SGIA 3K80C 2VY3A 1V43A 3CQZH 3ER0A 3RLOA 4DR6L 5IP7H 4GKKQ 2YU9H 4B3TL 2R7ZG 2RHQB 3KYHC 4APVA 4DV7Q 4JCVE 1HH2P 4UP7A 1IBML 2VQFL 3STBC 2CWAA 1P16A 1RIPA 3VDYA 4QY7A 5C4XG 2KHJA 4BY7H 4K0KQ 5IYCG 1PH9A 3F2DA 2PQAA 3CCJA 4RMFA 2K14A 2UUCQ 1L2FA 1LM0A 2K4KA 3PO3H 1HZBA 5JJKA 2HIXA 2BH8A 1CUKA 1XMOL 1Q7YC 2K52A 2OTLA 2JA8H 2BA1A 3H3VI 2ZM6L 4B3SL 1MKHA 1A62A 2GVAA 2OQ0A 4GLAC 2VS1A 5LMUL 1VCIA 2I5LX 3RLNA 1XNQL 1K0RA 1L0WA 1BBUA 2KCTA 4OWXB 4DV0Q 2UXCL 4A3LG 3LGJA 3AFQA 5M5XH 4GKKL 4LFBQ 1V9PA 4JI1L 2Z6KC 1YJNA 4JI5Q 4B3ML 4L5SA 4LF5Q 4A3FG 2PMZE 3ERSX 3F2CA 2V1CC 4YWKA 3J81j 1JJ2A 3NBHB 1VQGA 1PH2A 5GAHC 2K5NA 3PUVA 4LF7Q 3HOZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7Z A;  4O0A A;  4LF6 L;  1IBK Q;  4Y52 H;  2UUC L;  3J80 i;  1TXY A;  2KCM A;  3EN2 A;  3HKZ G;  4OON A;  5C4J H;  4OO1 G;  3FHW A;  1K8G A;  2JA5 G;  5M5W H;  4R4Q A;  2Z0S A;  1X9N A;  4LNQ A;  2WAQ E;  1XPR A;  1PYB A;  1Q12 A;  1T9H A;  5IP7 G;  4GS3 A;  3HOX H;  1PA6 A;  3GTK H;  2IY5 B;  1KRT A;  3S24 A;  1I94 Q;  4JC0 A;  3M4Q A;  4R4I A;  4YY3 L;  1HNW L;  4TQU S;  3KF8 B;  4WJ4 A;  4DV0 L;  5DLQ E;  3M4O H;  4DR2 Q;  3K0X A;  2JEA I;  1YJW A;  2I0Q A;  1VQD A;  2BH2 A;  3PO2 H;  4NXN L;  3HFZ B;  1PV4 A;  2F4V Q;  1D7Q A;  1HNZ L;  5C0X J;  3F8T A;  2A1A A;  4KLK A;  1LTL A;  4JI0 L;  4A3K H;  1XPO A;  1R9T H;  4YWM A;  4BA2 I;  1VQH A;  1N9W A;  4GOP A;  4DR3 Q;  2N3S A;  4QGU A;  3U4Z A;  4X62 Q;  4DV3 L;  3G48 A;  5GRO A;  5GQO A;  2GN5 A;  1IL2 A;  1NTG A;  1NMF A;  3HOW H;  5C3E H;  1YVC A;  2YV5 A;  4LFC Q;  4DR5 Q;  3WWV A;  4GNX C;  4UPA A;  1EQR A;  4JOI C;  1YIT A;  1I94 L;  4JYA L;  4JBW A;  3PSI A;  2K50 A;  5FLX c;  3RZD H;  4POG A;  4HJ8 A;  4GN3 B;  4DNI A;  1AE3 A;  1TWF H;  4HIM A;  4OWW B;  5E7N A;  4A3J H;  1FJG L;  3S1Q H;  4JBK A;  1FVI A;  3OTO Q;  2Z6K A;  2L15 A;  1VQP A;  1WJJ A;  3E0E A;  1CSP A;  3HOY H;  4A3G H;  1I6H H;  1HNX Q;  1X55 A;  1ASZ A;  1UE1 A;  2VZA A;  3H0G G;  3T1H L;  1BBW A;  2FXQ A;  4X62 L;  4EX5 A;  2R7Z H;  4LFC L;  3NEN A;  1KD1 C;  4GNX B;  1VQA A;  3CCU A;  2HQL A;  4OX9 L;  5C4X H;  2VQE L;  2F52 A;  3M7N A;  1PH1 A;  3A5Z B;  1U5K A;  5IYC H;  4DV2 Q;  1SRU A;  4A3I G;  1G51 A;  3OTO L;  2ZJR A;  3HKZ E;  1B70 B;  2AKW B;  3CC7 A;  5ELN A;  3Q8D A;  4P73 A;  3A0J A;  3PUW A;  3TEH B;  3JAM i;  1HNX L;  4LF4 Q;  1TWA H;  4IFD J;  1N36 Q;  3KLW A;  3K81 C;  4A3L H;  1Q1E A;  3RR5 A;  2R7F A;  1B7Y B;  1L1O C;  2EXD A;  3BZK A;  5BR8 L;  3K7A H;  2H5X A;  3GTL H;  3CCR A;  3BZC A;  4MTN A;  1NY4 A;  2DGY A;  4A3F H;  2RCN A;  4UP9 A;  4A93 G;  4X66 Q;  1FGU A;  2JQO A;  4DR4 Q;  2WB1 G;  1S40 A;  3GTG H;  3E9H A;  4DV2 L;  3I4O A;  3U50 C;  1YHA A;  4DPG A;  4YCU A;  4YWL A;  1E24 A;  4DKA C;  1J6Q A;  2CQO A;  4IPC A;  2NN6 G;  5EAY A;  1S72 A;  1VQ5 A;  2JA5 H;  4LF8 L;  4JV5 L;  2YTX A;  4DV5 Q;  4IO9 A;  4A75 A;  1JT8 A;  4C2M H;  4LF4 L;  3G71 A;  3I4M G;  3GTM H;  3W1B A;  1E3P A;  4HJ7 A;  4BXX G;  4IJH A;  4C3H H;  3D0F A;  1EIY B;  1RL2 A;  1VQ7 A;  2C35 B;  1FL0 A;  3CCS A;  2E2J H;  2GVB A;  1XNR L;  1C0A A;  1BVS A;  1EUJ A;  1L1O B;  2CCZ A;  4JI8 Q;  1KL9 A;  2B3G A;  3CCV A;  1W2B A;  3A74 A;  4AH6 A;  4X66 L;  1Z9F A;  2BA0 A;  1PH6 A;  5C0X G;  1NMG A;  1X65 A;  4GLX A;  1PH4 A;  1IZ6 A;  4L5Q A;  2UXB Q;  4NPS A;  4QL5 A;  3CD6 A;  3RNU A;  4A3B G;  1KQS A;  2ZTC A;  1TWH H;  4DV5 L;  1VQ9 A;  1A8V A;  3ULJ A;  1QUQ B;  4DV7 L;  4HIK A;  4LW1 A;  4PMW A;  5HGQ A;  2B63 G;  2YTY A;  4HJ9 A;  3S2D H;  4HJA A;  4K0K L;  4HID A;  2LXK A;  1L1O A;  1LYL A;  1LUZ A;  1JB7 A;  2D0O A;  4JI7 Q;  1YI2 A;  1K9M C;  4LUZ A;  3RN5 A;  1M1K C;  2HT1 A;  1WCM G;  1GVP A;  2CKZ B;  1I50 H;  4YCW A;  2IX0 A;  4A3M G;  3S17 H;  1B8A A;  4KHZ A;  5IP9 G;  1GD7 A;  1VQM A;  1TWC H;  2NN6 I;  3H0G H;  4X64 Q;  4KHP Q;  1QVC A;  1VQN A;  1XPU A;  1QZG A;  4LF9 Q;  4DV6 Q;  4LFB L;  4JI2 Q;  2Y0S G;  4JI5 L;  4LF5 L;  1GKH A;  4YCV A;  1WI5 A;  2NVY H;  1Q46 A;  3GTJ H;  5LMN Q;  2MNA A;  1X3F A;  3CME A;  1VQ6 A;  4GLV B;  3HOV G;  1Y14 B;  2WB1 E;  4X65 Q;  2A8V A;  4O2D A;  4A3I H;  4JI7 L;  4LF7 L;  1SMX A;  3TRZ A;  1MJC A;  1S3O A;  4IPD A;  3CAM A;  5FLM G;  3RN2 A;  1IBK L;  3PGZ A;  4ME3 A;  2VUM G;  1N32 Q;  4EQ5 A;  2JJQ A;  4UP8 A;  2LXJ A;  4J15 A;  2JA6 G;  1QVG A;  1H95 A;  5JEA G;  1IXR A;  2WP8 J;  1PH7 A;  5HY6 A;  4AQY Q;  4RG1 A;  3U4V A;  1XMQ Q;  4XTC S;  1SFO H;  4KHP L;  4IFD G;  4DV1 Q;  1E1T A;  1NBW A;  1OXU A;  2KHI A;  1AE2 A;  4BBR G;  3J81 c;  4DR2 L;  4LF9 L;  4BY1 G;  3OW2 A;  1CKM A;  3JC6 6;  1SLJ A;  3CP0 A;  1UE6 A;  3T1Y Q;  2Q2U A;  1IBL Q;  4L5T A;  1VQF A;  4JI2 L;  4A93 H;  2F4V L;  2Q2I A;  1YIJ A;  5IYD G;  1QZH A;  3RZO H;  1KHI A;  2EQS A;  3GTQ H;  1X56 A;  1GM5 A;  3M3Y H;  3S14 H;  4DR1 Q;  1K73 C;  1N33 Q;  1CKN B;  2I5H A;  3ZJY C;  2KBN A;  4OO1 I;  3FP9 A;  4LFA Q;  4UY8 C;  4B3R Q;  4WJ3 M;  4DR3 L;  2JE6 I;  2OCE A;  3PUX A;  2NVQ H;  1HZA A;  3K8A A;  2HHH Q;  1P8L A;  4DR5 L;  2Q2H A;  3I4M H;  5GAE C;  4P75 A;  3MEF A;  1XMQ L;  5ELO A;  4BXX H;  1WYD A;  2N78 A;  1K8A C;  4IOA A;  1JE5 A;  2CFM A;  3UDX A;  3UE0 A;  2K5H A;  1HZ9 A;  2ID0 A;  3CXC A;  1MIU A;  4DV1 L;  2ASB A;  5JJL A;  3NEL A;  2MQH A;  4JI3 Q;  1PHJ A;  4OWT B;  1KRS A;  1IBL L;  3UDI A;  4IPH A;  4Y7N H;  3J7Z C;  2XGT A;  4HIO A;  3L2P A;  4JG2 A;  1C9O A;  2UU9 Q;  1PH5 A;  3GD7 A;  3UE1 A;  5FJ8 H;  1CKN A;  5IWA Q;  1A63 A;  3AFP A;  4A3B H;  3KOJ A;  4JI6 Q;  4QJF A;  5C44 G;  2HHH L;  5M3M G;  3IRB A;  1E22 A;  4DUY Q;  3CW2 C;  3I55 A;  2IX1 A;  2F3I A;  1HZC A;  2IHE A;  2Y0S E;  1EFW A;  3E9I A;  4GNX A;  1OXV A;  3L7Z C;  4JOI A;  5LMN W;  4C3J H;  2Q2T A;  4NXM Q;  2B63 H;  4AIM A;  4JI4 Q;  1XJV A;  4JI3 L;  1QVF A;  4ALP A;  3I56 A;  2R92 G;  2I5M X;  1YJ9 A;  4A76 A;  1WCM H;  4DR6 Q;  3W1G A;  5M3F G;  1HR0 W;  3S2H H;  4A3M H;  1K3R A;  1X6O A;  1Y1V G;  2RHS B;  5IP9 H;  2ZTE A;  5GAG C;  2VQF Q;  2JA7 G;  2JEB I;  1N36 L;  1Z47 A;  3TS0 A;  5M5Y H;  3F2B A;  3I4N G;  2AMC B;  2NVX H;  3TS2 A;  5J3B A;  1EQQ A;  3S1M H;  1NE3 A;  1VQO A;  1X3E A;  1GO3 E;  2R7D A;  3AQQ A;  3U58 A;  2NZH A;  3TRE A;  1J5E Q;  3GTP H;  3I7F A;  1JJC B;  1Y1W G;  2MO1 A;  1N34 Q;  1A0I A;  1YEZ A;  3CPF A;  2ES2 A;  4B3S Q;  4NXM L;  3HOV H;  4DR4 L;  1O7I A;  1XNQ Q;  3J81 i;  3CCM A;  3H15 A;  4POF A;  2AWN A;  5FLM H;  3CC2 A;  1CSQ A;  5FJ8 G;  4IOC A;  4FDB A;  3BJU A;  2VUM H;  3PV0 A;  4DR7 L;  3ULP A;  4A3E G;  4JI1 Q;  2UUA Q;  4LUV A;  4B3M Q;  2JA6 H;  3KFU A;  1N8R C;  4P72 A;  2N8N A;  1PH3 A;  5IYB G;  2IHF A;  4R4T A;  2UUB Q;  1TWG H;  4GOP C;  4JBJ A;  4BBR H;  4C3I H;  3KJO A;  1M90 C;  4LF6 Q;  4BY1 H;  4JI8 L;  1WOC A;  2VW9 A;  1KAW A;  3G4S A;  1G29 1;  5GAD C;  4GN4 B;  1YBY A;  4PZ7 A;  3CMA A;  1K83 H;  4IPG A;  1J5E L;  5IYD H;  1N34 L;  2PI2 A;  3AYH B;  1SR3 A;  3PCO B;  1OXX K;  5IE8 A;  2ATW A;  2R93 G;  4YY3 Q;  4X6A H;  1KC8 C;  1HNW Q;  4DV4 Q;  1VQK A;  3L0O A;  4A3D G;  4DK3 C;  1PFS A;  2UXB L;  3KF6 B;  1I5F A;  2VNU D;  1EYG A;  4R4C A;  2AHO B;  2ZTD A;  2KEN A;  3M85 A;  2ZJQ A;  2MFI A;  1JJG A;  2UUA L;  4A3C G;  1PVO A;  4NXN Q;  1OTC A;  1HNZ Q;  3MXN B;  5IY0 A;  4JI0 Q;  2PI2 E;  3I2Z A;  1YHQ A;  1HJP A;  2A19 A;  2UUB L;  3HOU G;  3JAM c;  3S15 H;  1QUQ A;  4BBS G;  1VQE A;  4PG3 A;  2WFW A;  4GOP B;  3KDF B;  4R1J A;  1SE8 A;  2VL6 A;  3S1N H;  1BKB A;  1D8L A;  2LSS A;  4DV3 Q;  2HIV A;  5C0X I;  2YYZ A;  4R4O A;  1HR0 Q;  4TVA B;  4JYA Q;  4DV4 L;  4DR7 Q;  4X64 L;  3STB D;  2D0P A;  3PUY A;  3S1R H;  2E5L Q;  1X54 A;  3KF6 A;  5C44 H;  4BY7 G;  5M3M H;  2R6G A;  1FJG Q;  1YNX A;  3TQY A;  5K36 G;  1VQL A;  1KIX A;  4DV6 L;  2B29 A;  2N49 A;  3CCL A;  1DGS A;  4P74 A;  3PIO A;  4AYB G;  3KJP A;  3PO3 G;  1I3Q H;  1W3S A;  3GO5 A;  2JA8 G;  2XTI A;  3DLL A;  2ZJP A;  3CF5 A;  5LMN L;  3UDG A;  1C7Y A;  3H3V H;  2QGQ A;  4X65 L;  3T1H Q;  3KDF A;  3ULL A;  1PH8 A;  2R92 H;  3M4P A;  3CCE A;  3FKI H;  1U0L A;  1VQ8 A;  4NB3 A;  3NEM A;  4DAM A;  5M3F H;  5IT9 c;  1N32 L;  1X3G A;  1XTD A;  2EIF A;  1UE7 A;  4MZ9 A;  1Y1V H;  2D62 A;  4PZ8 A;  1PYS B;  1HR0 L;  1EWI A;  4JBM A;  4GN5 A;  1Q86 C;  2JA7 H;  4PZ6 A;  3PUZ A;  2K5V A;  3GDE A;  3UDF A;  4AQY L;  2VQE Q;  1NJI C;  4OX9 Q;  2MO0 A;  3ICE A;  3I4N H;  3S16 H;  3PF5 A;  2K75 A;  2E5L L;  2CWP A;  4BA1 I;  1UWV A;  4DAY B;  1UE5 A;  2RF4 A;  3HOZ G;  5H1S E;  4GKJ Q;  2E2I H;  4YHH Q;  5JJI A;  3T1Y L;  2NZO A;  4LWC A;  3OYY A;  4L5R C;  3GTO H;  1WFQ A;  2YTV A;  3PIP A;  4OXP A;  2ALY B;  1Y1W H;  1VQ4 A;  3D31 A;  4HJ5 A;  3HOX G;  1SN8 A;  4KI0 A;  1SRO A;  4DR1 L;  2NVT H;  1N33 L;  1G6P A;  1V1Q A;  1KXL A;  1YHB A;  2DUD A;  1VQC A;  4H02 A;  4LFA L;  2UXD Q;  4B3R L;  3CPW A;  5BR8 Q;  3CCQ A;  2OTJ A;  4A3E H;  1VQJ A;  1VQI A;  3J80 c;  3F1Z A;  4DUZ Q;  5AJ3 Q;  3AEV A;  3PO2 G;  5IYB H;  4IFD I;  1Q81 C;  2E8G A;  2OQK A;  3M9B A;  1OXS C;  4A3K G;  3EBE A;  2PNH A;  3HKS A;  4A4I A;  1Q1B A;  4IJL A;  2JK8 A;  1MJE A;  1EIF A;  4GKJ L;  4YHH L;  4JV5 Q;  1CKO A;  4P71 A;  1UEB A;  4MNO A;  4LF8 Q;  4QQB X;  5JEA J;  3FKI G;  2JA9 A;  2WAQ G;  3HOW G;  1ASY A;  5C3E G;  1E1O A;  2QEX A;  3W5O A;  2E2H H;  2UU9 L;  2OWO A;  3K7U C;  4B3T Q;  3J7A 5;  2R93 H;  1AH9 A;  1IYJ B;  1IBM Q;  1JMC A;  4A3D H;  4LUO A;  3G6E A;  1XNR Q;  5IWA L;  2UXD L;  3EIV A;  2PQA B;  4QIW E;  4JI6 L;  3CC4 A;  3B6Y A;  4A3J G;  3RLF A;  4A3C H;  4DUZ L;  5AJ3 L;  2QA4 A;  4DUY L;  1VS0 A;  2IT1 A;  1OXT A;  3HOU H;  4BBS H;  1XMO Q;  4DK6 C;  4AYB E;  4XIG S;  1Q8K A;  2ZM6 Q;  3HOY G;  3A5U A;  3PF4 A;  4A3G G;  4JI4 L;  1EOV A;  1YZ6 A;  2AWO A;  5LMU Q;  1VQB A;  1Q82 C;  3DM3 A;  3BU2 A;  2UXC Q;  3SGI A;  3K80 C;  2VY3 A;  1V43 A;  3CQZ H;  3ER0 A;  3RLO A;  4DR6 L;  5IP7 H;  4GKK Q;  2YU9 H;  4B3T L;  2R7Z G;  2RHQ B;  3KYH C;  4APV A;  4DV7 Q;  4JCV E;  1HH2 P;  4UP7 A;  1IBM L;  2VQF L;  3STB C;  2CWA A;  1P16 A;  1RIP A;  3VDY A;  4QY7 A;  5C4X G;  2KHJ A;  4BY7 H;  4K0K Q;  5IYC G;  1PH9 A;  3F2D A;  2PQA A;  3CCJ A;  4RMF A;  2K14 A;  2UUC Q;  1L2F A;  1LM0 A;  2K4K A;  3PO3 H;  1HZB A;  5JJK A;  2HIX A;  2BH8 A;  1CUK A;  1XMO L;  1Q7Y C;  2K52 A;  2OTL A;  2JA8 H;  2BA1 A;  3H3V I;  2ZM6 L;  4B3S L;  1MKH A;  1A62 A;  2GVA A;  2OQ0 A;  4GLA C;  2VS1 A;  5LMU L;  1VCI A;  2I5L X;  3RLN A;  1XNQ L;  1K0R A;  1L0W A;  1BBU A;  2KCT A;  4OWX B;  4DV0 Q;  2UXC L;  4A3L G;  3LGJ A;  3AFQ A;  5M5X H;  4GKK L;  4LFB Q;  1V9P A;  4JI1 L;  2Z6K C;  1YJN A;  4JI5 Q;  4B3M L;  4L5S A;  4LF5 Q;  4A3F G;  2PMZ E;  3ERS X;  3F2C A;  2V1C C;  4YWK A;  3J81 j;  1JJ2 A;  3NBH B;  1VQG A;  1PH2 A;  5GAH C;  2K5N A;  3PUV A;  4LF7 Q;  3HOZ H; 
#chains in the Genus database with same CATH topology
 1E7Z A;  2PO4 A;  4O0A A;  4LF6 L;  5C4H A;  1HXY D;  3J80 i;  2CVR A;  3HKZ G;  4OO1 G;  4IUP A;  1DOK A;  3FHW A;  1O78 A;  2Z0S A;  4LNQ A;  3Q23 A;  1T9H A;  2OXP A;  4YIJ A;  2IY5 B;  1DXM A;  1I94 Q;  4WJ4 A;  3KF8 B;  3MWY W;  4C3H G;  4IN3 A;  1G91 A;  5DLQ E;  1M4V A;  2JEA I;  3HP3 A;  1YJW A;  3PO2 H;  2F0H A;  1M8A A;  2A1A A;  4JI0 L;  4A3K H;  1PFM A;  4R8I A;  4I7A A;  1VQH A;  2B2T A;  4X62 Q;  3HKZ B;  5GRO A;  2GN5 A;  1IL2 A;  1NTG A;  1YVC A;  4C56 C;  4UPA A;  5JJZ A;  4JYA L;  1WD1 A;  3HZX A;  1CI3 M;  1STA A;  4HJ8 A;  4C3H B;  4GN3 B;  1HUM A;  3L9A X;  3S1M B;  1II3 A;  1NR2 A;  4JBK A;  1PMR A;  1ZKO A;  1G8Z D;  5CGK A;  1VQP A;  3W3A A;  3E0E A;  1CSP A;  3GTP B;  3DXJ C;  1YNN C;  5C3X A;  1KDC A;  2JYO A;  4EX5 A;  2R7Z H;  3NEN A;  1GUO A;  1VQA A;  4OX9 L;  5C4X H;  2F0Q A;  3M7N A;  2EYL A;  2KJX A;  3HGB A;  4A3I G;  1EZ6 A;  1GOZ A;  2X69 A;  3OTO L;  1JOO A;  1B70 B;  3LX0 A;  4P73 A;  3PUW A;  5J1Z A;  3JAM i;  1HNX L;  1SJE D;  3K81 C;  2M00 A;  1SYE A;  3TP6 A;  1Q1E A;  3RR5 A;  2PW5 A;  1B7Y B;  1L1O C;  3Q0A A;  2ZT9 C;  3GTL H;  1GUG A;  3CKI B;  4B9X A;  4A3F H;  4UP9 A;  3WOF A;  3UI2 A;  1JOQ A;  1HTL D;  4YCU A;  4A3I B;  1S72 A;  2L11 A;  4A75 A;  2K32 A;  2K33 A;  1JT8 A;  1MHW C;  4F88 A;  5CV9 A;  2WV6 D;  4IJH A;  3D0F A;  5FO7 B;  2C35 B;  2E2J H;  4JI8 Q;  3CCV A;  2R3Z A;  3VYR A;  3T51 B;  4DFA A;  4X66 L;  1ML0 D;  2BA0 A;  4HSV A;  5C0X G;  1LT5 D;  1XTC D;  3GTQ B;  5A2Q L;  4NPS A;  3CD6 A;  3BG3 A;  4MTK A;  2ZTC A;  4FF4 A;  4ME5 A;  1B3A A;  2KQ3 A;  3A7A B;  1VQ9 A;  1A8V A;  1Y69 U;  4TSS A;  4DV7 L;  4HIK A;  4PMW A;  3BS1 A;  3IAY A;  5CBE E;  4HJ9 A;  1PTO F;  3S2D H;  4HJA A;  1L1O A;  4N9T A;  2D0O A;  3HEJ A;  1JB7 A;  5C5L A;  5EKK A;  2ENB A;  2E2I B;  1TKW B;  4EQP A;  1LAB A;  1WCM G;  1EEF D;  1GVP A;  2QDL A;  2RA4 A;  1I50 H;  4Y7N B;  2IX0 A;  4KHZ A;  2PW7 A;  1VQM A;  1TWC H;  3H0G H;  4KJO A;  1QVC A;  1XPU A;  1QZG A;  4LF9 Q;  3H94 A;  5EPJ A;  1QNK A;  3VA5 A;  4JI2 Q;  4LFB L;  1GKH A;  2PPB C;  2NVY H;  1AEX A;  3MEH A;  2F0U A;  1JC7 A;  4ZQ3 A;  5LMN Q;  1VQ6 A;  1X3F A;  2D9U A;  4JI7 L;  3E5S A;  5IT9 L;  1S3O A;  4F8M A;  3RN2 A;  3CAM A;  1TY0 A;  1N32 Q;  2JJQ A;  2E76 C;  2EOT A;  1PH7 A;  2J7Z A;  3J7A F;  2R93 B;  1V1O A;  1SFO H;  2CQA A;  4IFD G;  4DV1 Q;  1CHQ D;  1OXU A;  5ELD A;  4DR2 L;  3OW2 A;  4LK1 C;  1SLJ A;  3CP0 A;  3T1Y Q;  2L1B A;  2A6H C;  1JOR A;  2EQS A;  1GM5 A;  3M3Y H;  3S14 H;  4OO1 I;  4H0L C;  4LFA Q;  1SYD A;  2EZV A;  2NN6 H;  4WJ3 M;  2JE6 I;  2OCE A;  1HZA A;  3K8A A;  1PFB A;  4DR5 L;  1XMQ L;  1WYD A;  2N78 A;  1K8A C;  2CFM A;  1HZ9 A;  3CXC A;  1MIU A;  2MQH A;  3N52 A;  1NAP A;  1KRS A;  1MSG A;  1WTO A;  4AYB B;  4NMZ A;  1X3Q A;  2RDG A;  1PH5 A;  1S5C D;  1LTT D;  4ZK9 B;  4A3B H;  2L0C A;  4JI6 Q;  2FMM A;  1H9S B;  2F0T A;  4CDF C;  4DA2 A;  3I55 A;  4L63 B;  1HZC A;  2LS0 1;  3OMC A;  5FOB B;  5CC4 A;  4GNX A;  4FF2 A;  3L7Z C;  4JI4 Q;  1AW7 A;  1XJV A;  4JI3 L;  1QVF A;  1JWU D;  3TBI B;  1ENC A;  2L12 A;  3W1G A;  5M3F G;  1WTP A;  4A3M H;  2NBF A;  2RHS B;  1X6O A;  5IP9 H;  4CDC C;  4CKE A;  3OOC A;  2JEB I;  1N36 L;  2JA7 G;  5M5Y H;  3F2B A;  2NVX H;  3TS2 A;  3NWS A;  1FNW A;  1X3E A;  1R4P B;  3U58 A;  1SYC A;  2NZH A;  1CQF A;  2VB2 X;  4DU9 A;  3P75 A;  1JJC B;  2D5D A;  4IUV A;  4A3K B;  1A0I A;  1Y1W G;  3CPF A;  4FVM A;  2ES2 A;  4B3S Q;  2CW0 D;  3HOV H;  4K2K A;  1O7I A;  5KRU A;  3CCM A;  4POF A;  2AWN A;  5FJ8 G;  4IOC A;  4FDB A;  3BJU A;  2VUM H;  3H09 A;  2WAQ B;  4A3E G;  1WTV A;  1UAP A;  2UUA Q;  1N8R C;  1B2T A;  2F0O A;  1JWS D;  1PTO B;  3CRK C;  4JBJ A;  3WDN A;  4C3I H;  4LF6 Q;  5C4Z A;  3VYU A;  2VW9 A;  3G4S A;  5KIX A;  5D65 A;  2K5D A;  3CMA A;  5IYD H;  1D5X C;  1X3P A;  2F0K A;  2SNM A;  2ATW A;  2OF1 A;  3FRP B;  2V4D A;  1VQK A;  1JQY D;  1QB5 D;  4A3D G;  2VNU D;  2NVT B;  1A6X A;  3LWE A;  5EBC A;  3RD4 A;  1OTC A;  4A3E B;  2R7Z B;  1XWE A;  5IY0 A;  4JI0 Q;  1B53 A;  3S15 H;  2A19 A;  5DEH A;  1VDZ A;  1VQE A;  4PG3 A;  4RHR A;  4R1J A;  4XQN A;  3OMG A;  1D8L A;  4OL7 A;  2HIV A;  5C0X I;  1IW7 C;  2QEJ C;  5FLX L;  4WOR A;  5DAU A;  4JYA Q;  3DEP A;  3ERQ A;  3J81 L;  4KN4 C;  4X64 L;  3STB D;  3S1R H;  5NUC A;  2E5L Q;  1KLG D;  1SDF A;  4DXF A;  5IGG A;  3NK9 A;  3TQY A;  4DV6 L;  2N49 A;  3KJP A;  4A3F B;  1I3Q H;  3BDO A;  1W3S A;  3CF5 A;  2EVB A;  3H3V H;  3KDF A;  4B08 A;  3MXP A;  3OW7 A;  3FKI H;  1U0L A;  2AQ2 B;  3QJY A;  3K6O A;  1SE2 A;  1XTD A;  4KN7 C;  3CQZ B;  4JBM A;  3GDE A;  1FGB D;  4OX9 Q;  3V96 A;  1NJI C;  3ICE A;  3A8I E;  3I4N H;  5A2Q E;  3PF5 A;  2K75 A;  2A68 D;  1UE5 A;  4EQN A;  1BCP D;  1ET9 A;  2H4O A;  2WAC A;  1SRO A;  4CBV A;  4PNY A;  1KXL A;  1YHB A;  4E6I A;  4RKB A;  2HUG A;  3NTI A;  1MSH A;  2CH4 A;  3H91 A;  3F1Z A;  1SNC A;  5AJ3 Q;  3J80 c;  4DNT B;  1QNU A;  4IFD I;  1J8I A;  4EGV A;  2E8G A;  1HQR D;  1D1K A;  2DJG C;  4YHH L;  2XIW A;  1F2M A;  5C4J B;  5J22 A;  5C3E G;  2OWO A;  1I50 B;  2UU9 L;  3J7A 5;  4Z9C B;  4XYQ A;  1IBM Q;  1TWC B;  3H0G B;  5IT9 E;  1E2Z A;  4IAL A;  2PQA B;  3K5M A;  1DCZ A;  5TSS A;  1HHV A;  3URY A;  2QA4 A;  2A6H D;  2QF7 A;  2IT1 A;  4KY7 A;  4BBS H;  1XMO Q;  4FNF A;  4AYB E;  2NVY B;  1Q8K A;  3I73 A;  1B4O A;  3PF4 A;  3KBG A;  1WTX A;  1D5M C;  4ZLT F;  1SYB A;  2VY3 A;  4DR6 L;  1S5D D;  3ER0 A;  4DAV A;  5C3E B;  4DV7 Q;  2HCI A;  2L55 A;  1SFO B;  4HED A;  3VDY A;  2KHJ A;  4BY7 H;  5IYC G;  3F2D A;  3BZD B;  1CM9 A;  1L2F A;  3PO3 H;  3S1Q B;  1HZB A;  2K52 A;  1ENF A;  2ICE C;  2ZM6 L;  3GP7 A;  1MKH A;  2GVA A;  1I4Q A;  2NB0 A;  3S14 B;  3M3Y B;  3RLN A;  1I6H B;  1K0R A;  3HRZ C;  1BBU A;  4OWX B;  1ZXT A;  4DV0 Q;  4C1N K;  1H9J A;  2D2C C;  4XQQ A;  4LFB Q;  1V9P A;  4JI1 L;  4B3M L;  4JPB W;  1SNM A;  1EWH A;  3R93 A;  1JJ2 A;  5C3W A;  4KV6 A;  4G57 A;  4BS9 A;  5GAH C;  2A74 C;  3PUV A;  3HOZ H;  3MAQ A;  4DXG A;  4Y52 H;  2KCC A;  2UUC L;  4OON A;  2PZW A;  1K8G A;  2JA5 G;  1RDP D;  2R61 A;  1X9N A;  2WAQ E;  1Q12 A;  3HOX H;  1PA6 A;  4JC0 A;  4R4I A;  4YY3 L;  1HNW L;  3WOE A;  4A3B B;  4DR2 Q;  3MC0 B;  4FXD A;  1VQD A;  4NXN L;  3HFZ B;  2OT2 A;  2K1B A;  5C0X J;  1FNV A;  1HNZ L;  3VR3 A;  1R9T H;  2NYZ D;  2MUY A;  3NBH A;  2DNE A;  2PCF B;  4BA2 I;  1N9W A;  1SND A;  1EY5 A;  2FMC A;  4EQO A;  4RFB A;  4P2C B;  5GQO A;  2BE5 D;  3U9S A;  1NMF A;  4DR5 Q;  1ICF B;  4JBW A;  1EQT A;  1D5Z C;  1SJH D;  4G7H C;  1A2U A;  2NVX B;  5KNC A;  1L0X B;  1E2V A;  1B9N A;  4A3J H;  2B2U C;  4N8X 1;  1FVI A;  2Y0S B;  4IUU A;  4HAE A;  1WJJ A;  4A3G H;  4FP5 D;  2VZA A;  2QDB A;  2RCF A;  4O1N A;  2FXQ A;  4RCN A;  2WKC A;  4GZY C;  2VUM B;  4LFC L;  1ZYR D;  4GNX B;  1V8Q A;  2HCC A;  2HQL A;  3SK8 A;  2F3V A;  1WTW A;  2F0E A;  5CMD A;  3A5Z B;  1A2T A;  1SRU A;  2FFK B;  1G51 A;  2ZJR A;  1IW7 D;  2AKW B;  3CC7 A;  4LF4 Q;  1X32 A;  4IFD J;  1N36 Q;  2BCO A;  3NTK A;  3DWQ A;  4UDU C;  2R7F A;  4IZ8 A;  2EXD A;  3BZK A;  5BR8 L;  1NY4 A;  1RCV D;  2DGY A;  2RCN A;  1D6E C;  4A93 G;  3J81 E;  1FGU A;  2WKD A;  2EYJ A;  3FMC A;  4PV1 C;  4DV2 L;  4WJW A;  1PLF A;  1KDA A;  1YHA A;  3ERO A;  2B2U A;  2NWG A;  1E0B A;  3TN2 A;  1S5E D;  5EAY A;  2K5Q A;  4HMJ A;  4C2M H;  5C5M A;  3I4M G;  3GTM H;  4BXX G;  2B39 A;  1VQ7 A;  1XNR L;  2GVB A;  3S1R B;  2CCZ A;  2RKS A;  1JIC A;  1SYF A;  2PZU A;  1W2B A;  2RDH A;  3FEW X;  4A93 B;  1PH6 A;  1I3Q B;  5G3L F;  1DM0 B;  4L5Q A;  1CK1 A;  4L8J A;  4QL5 A;  5M9O A;  1TWH H;  3MTS A;  4DV5 L;  3M7G A;  4XXE A;  4LW1 A;  3FPP A;  2HQE A;  2EYP A;  3P7J A;  4HID A;  1SMY D;  1NSN S;  4OIJ A;  1YI2 A;  1GUS A;  2KEE A;  4O42 A;  2CKZ B;  3NUC A;  1B8A A;  4KKS A;  4ZUJ A;  2NN6 I;  4X64 Q;  1LTA D;  4DV6 Q;  2MJ8 A;  1RTN A;  4CDD C;  4HR7 B;  4K6D A;  2BDO A;  5COY A;  1Y14 B;  2A8V A;  4O2D A;  1LLR D;  1MJC A;  2XSC A;  4IPD A;  1IBK L;  1AZQ A;  3PGZ A;  1TR5 A;  1LTI D;  4UP8 A;  1LAC A;  2WP8 J;  1GHK A;  1FR3 A;  4RG1 A;  3U4V A;  3T16 A;  4KHP L;  4R8N A;  1AN8 A;  1E1T A;  2KHI A;  1CZG A;  3TSS A;  4L5T A;  1O7Z A;  5EBD A;  1YIJ A;  4BBS B;  3QB3 A;  3RZO H;  1NUC A;  1JB3 A;  4Q5V A;  1K73 C;  1CKN B;  3ZJY C;  4HCE A;  5JPM C;  2HHH Q;  2XN9 C;  2F0F A;  2KUM A;  2Q2H A;  1OO9 B;  4P75 A;  3MEF A;  2ZXR A;  2IX3 A;  4JVZ A;  3EQL C;  1SE3 A;  2ID0 A;  2K5H A;  2WIN B;  1W6K A;  4CGY B;  2ASB A;  2A6E C;  1PHJ A;  1IBL L;  4KJN A;  3PO3 B;  3OSO A;  3I4L A;  2UU9 Q;  2E75 C;  3AMU A;  1RKN A;  3UE1 A;  5FJ8 H;  1A63 A;  3AFP A;  4ZUI A;  5C44 G;  5M3M G;  3CW2 C;  5BN4 A;  2F4I A;  2DJF C;  2Y0S E;  2A69 C;  1Q90 A;  3NWT A;  2Z6B A;  1D2B A;  4NXM Q;  5L37 A;  2B63 H;  4C3J H;  4AIM A;  1STY A;  4ALP A;  5CBA E;  2BDN A;  4A76 A;  4DR6 Q;  3MHB A;  1HR0 W;  3S2H H;  3NPP A;  2ZTE A;  2G5D A;  5GAG C;  2F03 A;  4U68 A;  3W2D A;  1T5X D;  1EEI D;  2IJ0 A;  5J3B A;  3X3N A;  3A7L A;  5C44 B;  1MBY A;  5M3M B;  1VQO A;  2R7D A;  1JWM D;  4CDE C;  2PMZ B;  3DMU A;  5I2Y A;  1J5E Q;  1RD9 D;  1N34 Q;  4RKL A;  4DR4 L;  1EIH A;  3G6J B;  2TSS A;  2N88 A;  1PRT D;  5FLM H;  3CC2 A;  1CSQ A;  3OWE B;  3TZU A;  4CJ1 B;  1I6V C;  4JI1 Q;  2JA6 H;  4B3M Q;  1DJR D;  4P72 A;  2GA4 B;  1Y8N B;  2UUB Q;  5DM7 3;  1EY4 A;  5I9O A;  1STB A;  1TWG H;  1MGS A;  4GOP C;  4HSP A;  4BBR H;  1M90 C;  1RTO A;  4BY1 H;  1U4M A;  4A3J B;  1JOK A;  4B9W A;  4IUN A;  5GAD C;  4GN4 B;  1MD2 D;  1K83 H;  2XWJ B;  1JR0 D;  2PI2 A;  1XXG A;  3AYH B;  4X6A H;  4CKB A;  2R93 G;  4YY3 Q;  1HNW Q;  4DV4 Q;  3L0O A;  2UXB L;  1K8M A;  1I5F A;  4R4C A;  2AHO B;  2KEN A;  1JE4 A;  3PIO 3;  2MFI A;  4A3C G;  4NXN Q;  4RAU C;  1HNZ Q;  3MXN B;  1F2Y A;  3BDL A;  2HDM A;  2F0W A;  2RQX A;  2VL6 A;  3S1N H;  2G9D A;  2LSS A;  1K28 A;  2AUJ D;  2YYZ A;  3RUZ A;  3MXU A;  2VB3 X;  4JK1 C;  3H6M A;  4FXK C;  1WVL A;  4DR7 Q;  4CJ0 B;  4K2L A;  4ZKC B;  4R9W A;  1VF7 A;  5FO9 B;  5D3I B;  3KF6 A;  1BUV T;  1HA5 A;  4ZKB B;  3CCL A;  1KIX A;  1DGS A;  3PIO A;  4AYB G;  3NXW A;  3CU7 A;  3GO5 A;  2ZJP A;  4G7Z C;  1C7Y A;  2E2D C;  2QGQ A;  5IIF A;  4RGT A;  1EYA A;  2R92 H;  5E4X A;  3M4P A;  1KAB A;  3NEM A;  3EJI A;  5IT9 c;  2EIF A;  4PZ8 A;  4CHT B;  1Y1V H;  3S9W A;  1HR0 L;  1EWI A;  4C2M B;  3A56 A;  2K5V A;  3UDF A;  3GTM B;  1ONL A;  3S16 H;  2CWP A;  4KKU A;  3V05 A;  4DAY B;  3E6Z X;  3MZ5 A;  4Q0F A;  2Q8R E;  1YNJ C;  4MN3 A;  3OYY A;  1TS3 A;  1VQ4 A;  3T56 B;  5I2X A;  1SN8 A;  1N33 L;  1V1Q A;  5DNF A;  2IWH A;  4B3R L;  5BR8 Q;  1Y8O B;  4K14 A;  1VQJ A;  3ZYY X;  1VQI A;  1LTR D;  1B50 A;  3PO2 G;  5IYB H;  1Q81 C;  3PQI A;  5T1G A;  4A3K G;  1Q1B A;  3V2T A;  2F0L A;  4IJL A;  2JK8 A;  5JOB A;  4GKJ L;  2EYH A;  1UEB A;  4MNO A;  4NP5 A;  1I4X A;  5JEA J;  1S5F D;  4X3T A;  2WAQ G;  5ISR A;  2QEX A;  1E1O A;  2E2H H;  2A5H A;  1CA6 A;  1PRT B;  3G6E A;  1XNR Q;  2UXD L;  4QIW E;  1GUN A;  3B6Y A;  3RLF A;  4DUZ L;  4DUY L;  3HOU H;  3PO2 B;  4DK6 C;  1EOV A;  1YNN D;  2AWO A;  1VQB A;  2EY1 A;  3G7L A;  1QJO A;  3K80 C;  3IKJ A;  3N6R A;  5K5P A;  2YU9 H;  4B3T L;  2R7Z G;  5COR A;  2VQF L;  4K6L A;  1EOT A;  2CWA A;  1RIP A;  5C4X G;  3SK4 A;  5KGU A;  1K3B C;  3VR5 A;  5K36 H;  3CCJ A;  2KA7 A;  2K4K A;  1LM0 A;  5JJK A;  3SE0 A;  1Q7Y C;  2JA8 H;  2BA1 A;  4KK7 A;  2P5Z X;  4DK1 A;  3BVM A;  2VS1 A;  5LMU L;  2I5L X;  1XNQ L;  2KCT A;  1IKL A;  1QOH A;  2UXC L;  3LGJ A;  1IYU A;  1B3Q A;  3AFQ A;  5M5X H;  4GKK L;  3CHB D;  1YJN A;  2SOB A;  4A3F G;  2PMZ E;  1LTG D;  3F2C A;  2V1C C;  3E0J A;  1TQO A;  5C4X B;  2K5N A;  1RF2 D;  5JVH 3;  4DAP A;  1IBK Q;  3SHL A;  2EJF C;  2KCM A;  2JP1 A;  4KY6 A;  5M5W H;  2N55 A;  4R4Q A;  1XPR A;  1PYB A;  3SVM A;  5IP7 G;  5BN5 A;  1MI2 A;  2RVL A;  3DHQ A;  3SK5 A;  5FO8 B;  5CYU A;  3M4O H;  3K0X A;  2BH2 A;  3GTL B;  1D7Q A;  3F8T A;  1QE6 A;  3D4R A;  1LTL A;  1XPO A;  3DUZ A;  5EGT A;  4YWM A;  3OHX C;  1RHP A;  3T53 B;  2KCN A;  4KKT A;  2N3S A;  3NSW A;  1VMP A;  3U4Z A;  3OIP A;  4DV3 L;  3HOW H;  4RH6 A;  2YV5 A;  3S2H B;  3WWV A;  2K01 A;  4JOI C;  1YIT A;  1I94 L;  1BCP F;  3RZD H;  5FLX c;  1LT4 D;  5IGD A;  1TU2 B;  4POG A;  2FHT A;  3KF8 A;  4DNI A;  4RGN A;  4HIM A;  4OWW B;  5E7N A;  2E2J B;  3IL8 A;  1FJG L;  1LT3 D;  2JXM B;  3OTO Q;  2LKV A;  3HOY H;  1HNX Q;  1X55 A;  1UE1 A;  3H0G G;  3VR2 A;  2XRS D;  1H9K A;  2KED A;  1BBW A;  4X62 L;  1Q8I A;  1A15 A;  2JA6 B;  3I70 A;  2F0J A;  3CCU A;  1A3V A;  2VQE L;  4JW0 A;  1TWG B;  1PH1 A;  5CV5 A;  2ZXO A;  2CHB D;  4BBR B;  4BY1 B;  1ET6 A;  3S2D B;  5ELN A;  1O7Y A;  3TEH B;  1QCB D;  1TWA H;  3TME A;  3ITP A;  4PQX A;  2SNS A;  4A3L H;  4IUQ A;  3K7A H;  1GJX A;  3BVZ A;  3CCR A;  5T1I A;  3BZC A;  4WFN 3;  4MTN A;  4OGQ C;  1VMC A;  4X66 Q;  4DR4 Q;  3GV6 A;  1I4G A;  1S40 A;  1EFI D;  3I4O A;  4M1U B;  3U50 C;  3J7A V;  4YWL A;  4OO1 H;  4V19 0;  3S1N B;  2CQO A;  2NN6 G;  1VQ5 A;  4LF8 L;  2YTX A;  3NBI A;  4IO9 A;  2HD3 A;  3G71 A;  3W1B A;  1EZ8 A;  4EVO A;  4HJ7 A;  2QKI C;  4C3H H;  1EIY B;  1RL2 A;  1IKM A;  1BVS A;  1EUJ A;  1L1O B;  1KL9 A;  2B3G A;  3D8G A;  3KK7 A;  4KY5 A;  2EY6 A;  5C6A A;  4AH6 A;  1PFN A;  1Z9F A;  1F9P A;  3DWP A;  1NMG A;  1QG7 A;  2L5T A;  2SDF A;  4GLX A;  2UXB Q;  4A3B G;  1KQS A;  2R92 B;  1HRJ A;  2AUK A;  3EVQ A;  2O4X A;  4PMB A;  2KVM A;  2IW3 A;  3JAM L;  1Y1V B;  4OIK A;  1K8O A;  4LJZ C;  2QIL A;  2PQE A;  2WII B;  3S16 B;  4K0K L;  2B2W C;  4JI7 Q;  1LYL A;  1F2Z A;  5DM6 3;  4LUZ A;  2HT1 A;  1F9S A;  4H7B A;  4A3M G;  3S17 H;  5IP9 G;  3KLS A;  1GD7 A;  4QUC A;  3KBX A;  3ND8 A;  1TS5 A;  4KHV A;  1F2L A;  1HQM C;  5AFW A;  1KLU D;  3K59 A;  4JI5 L;  2Y0S G;  5I6W A;  4XQJ A;  4KTA A;  4LF5 L;  4YCV A;  1Q46 A;  3GTJ H;  4DF7 A;  2MNA A;  3CME A;  3HOV G;  4GLV B;  2WB1 E;  1AP0 A;  4A3I H;  2RSN A;  1KAA A;  2G9H D;  5FKA C;  3FPU B;  2B2Y C;  4ME3 A;  2VUM G;  4EQ5 A;  2Z4H A;  2LXJ A;  4NKL A;  4J15 A;  4WRD A;  1BCP B;  1QVG A;  5JEA G;  4A3M B;  2E2H B;  1XMQ Q;  3NQI A;  4XTC S;  1DYQ A;  3QG1 A;  1NBW A;  2F0I A;  5M5Y B;  1AE2 A;  4C3I G;  4LF9 L;  3JC6 6;  1LTS D;  1UE6 A;  4MIU A;  1B1Z A;  4JI2 L;  1EL0 A;  1TT2 A;  3AB9 A;  2F4V L;  2Q2I A;  3HOU B;  5IYD G;  5F2D A;  4C1N I;  3GTQ H;  1LO5 D;  1X56 A;  2JN4 A;  3TP5 A;  1N33 Q;  2I5H A;  3HOV B;  2KBN A;  2XNA C;  3FP9 A;  2B2W A;  4B3R Q;  4DR3 L;  4DN4 M;  1AZP A;  2NVQ H;  1XX8 A;  3L3O C;  1P8L A;  2BOS A;  2CH4 W;  5KEE A;  1LT6 D;  2MP1 A;  5ELO A;  1JE5 A;  3UDX A;  3UE0 A;  4DV1 L;  1FNU A;  3TZD A;  1BO0 A;  1IL8 A;  4JI3 Q;  4C3I B;  4OWT B;  3UDI A;  2LMC B;  4Y7N H;  4HIO A;  5C0X H;  2JA8 B;  3GD7 A;  2QW7 A;  2MPM A;  5JPN C;  2LY7 A;  1EY7 A;  5EJW A;  1B44 D;  4QJF A;  2B2Y A;  3LWU A;  1BOS A;  4DUY Q;  5M5X B;  2VXW A;  5I6Y A;  2F3I A;  1EY6 A;  1ILQ A;  1STE A;  3OWF A;  3S15 B;  2Q2T A;  3C46 A;  2SEB D;  3I56 A;  2I5M X;  1WCM H;  2DNC A;  1NNX A;  2Z8L A;  5IGE A;  1HFG A;  4CJ2 C;  1DOL A;  1K3R A;  2TMP A;  1J9O A;  4RCO A;  2VQF Q;  2O5I C;  1Z47 A;  1EIG A;  1PTO C;  4K5X A;  3TS0 A;  3I4N G;  2AMC B;  4XYO A;  1EQQ A;  3M4O B;  3M4Y A;  1KDB A;  3AQQ A;  1H9S A;  2NZ1 D;  3TRE A;  3C3L A;  3VYT A;  5FK9 C;  1AH9 A;  3QO2 A;  2MO1 A;  2OEO A;  1XNQ Q;  3J81 i;  3H15 A;  1CQV A;  1HUN A;  1EWC A;  1CA5 A;  3FKI B;  1NCV A;  3HOW B;  1BNZ A;  4LUV A;  4M8A A;  2Z4I A;  3D3R A;  4LAA A;  4FXG C;  5CR3 A;  2IHF A;  5HUR A;  1PH3 A;  4IFD H;  5KNB A;  3J80 E;  3AU7 A;  2K03 A;  1ICW A;  1U9R A;  3KJO A;  3I4N B;  2IPK D;  1GUW A;  1WOC A;  1KAW A;  5J39 A;  3E3X A;  1GUT A;  3C2P A;  1C48 A;  4PZ7 A;  4IPG A;  2F0N A;  3MA2 B;  2J4X A;  1SR3 A;  3HOY B;  2EYO A;  5IE8 A;  1SBB B;  3GQB A;  1PFS A;  3M85 A;  2ZJQ A;  2UUA L;  1PVO A;  4IUR A;  2PI2 E;  3I2Z A;  1HJP A;  4BBS G;  1QUQ A;  3QWN A;  2WFW A;  2H1E A;  3KDF B;  4FF1 A;  4ZYS A;  1BKB A;  4DV3 Q;  2B8G A;  4OEM B;  4R4O A;  2J0T D;  4X3S A;  5EKI A;  1TWA B;  3R2T A;  1G2S A;  2B8F A;  1X54 A;  1GHJ A;  4BY7 G;  2R6G A;  1FJG Q;  3K7A B;  3MXG A;  2B29 A;  4IQZ A;  4P74 A;  3PO3 G;  1CHP D;  1EY9 A;  2F0G A;  1SYG A;  2K7V A;  2QCP X;  2XTI A;  3DLL A;  2L9H A;  3QIA A;  5ELC A;  3UDG A;  4X65 L;  1HCZ A;  3CCE A;  1EY8 A;  1VQ8 A;  4TKO B;  5M3F H;  1X3G A;  1U4P A;  3ONA B;  4KD3 A;  1UE7 A;  3DEO A;  4MZ9 A;  1UEA B;  2D62 A;  1PTO H;  3BVG A;  2JA7 H;  4PZ6 A;  3R3O A;  1ESR A;  3PUZ A;  4ZAI A;  2VQE Q;  4AQY L;  2MO0 A;  2E5L L;  1CT1 D;  1UWV A;  4QIW B;  3QOJ A;  4RA8 A;  3HOZ G;  5H1S E;  4BY7 B;  4YHH Q;  2NZO A;  4LWC A;  3JAM E;  4L5R C;  3GTO H;  1WFQ A;  5KYI A;  4ULL A;  1Y1W H;  2O2L D;  3HOX G;  1WTQ A;  2CW0 C;  4K5W A;  4KI0 A;  2C5C A;  3OPO A;  4DR1 L;  2NVT H;  4H02 A;  1F9Q A;  4ZRZ A;  3A8K E;  3CPW A;  3CCQ A;  4A3E H;  1QIL A;  1STH A;  5ELF A;  3AEV A;  2F0V A;  1F9R A;  2MGS A;  1SAP A;  2OQK A;  1Z7T A;  1OXS C;  5E3F A;  2RDF A;  2PNH A;  3EBE A;  2F0D A;  1MJE A;  3HOZ B;  4P71 A;  4LF8 Q;  3D6W A;  2JA9 A;  1LTB D;  4QCL A;  2JSO A;  3S17 B;  1IYJ B;  3HOX B;  4TRD A;  4A3D H;  4LUO A;  1SE4 A;  4NW2 A;  1RJT A;  5IWA L;  3EIV A;  4UAI A;  5JAV A;  1U4L A;  1PRT F;  1BR9 A;  4A3J G;  2AQ3 B;  5AJ3 L;  1SNQ A;  2A73 B;  3GTJ B;  2ZM6 Q;  4A3G G;  1WTH A;  1R9T B;  3R2I A;  3I91 A;  4K5V A;  3BU2 A;  3SGI A;  1V43 A;  3CQZ H;  3RLO A;  5IP7 H;  3FVQ A;  5IGF A;  3KYH C;  4APV A;  4JCV E;  1IBM L;  3U9O A;  4DNR B;  3STB C;  3SXH A;  1P16 A;  5CV6 A;  4QY7 A;  2EJG C;  4K0K Q;  1PH9 A;  2PQA A;  4RMF A;  2K14 A;  2UUC Q;  4N8F A;  2F1M A;  1GXD C;  1CUK A;  2BH8 A;  4ODG A;  1XMO L;  1ENA A;  2OTL A;  1DOM A;  3H3V I;  1PZI D;  1A62 A;  4GLA C;  4A3G B;  1K0S A;  3OIQ A;  1TVX A;  2NVQ B;  5A35 A;  2EY5 A;  4JI5 Q;  2Z6K C;  4LF5 Q;  5I4D A;  4YWK A;  3NBH B;  4X3K A;  1PH2 A;  2A68 C;  1TXY A;  3EN2 A;  5C4J H;  1IYV A;  1BCP C;  2RBM A;  3GTK H;  4GS3 A;  1PTO D;  1KRT A;  3S24 A;  4ID6 A;  3M4Q A;  1UUP A;  4TQU S;  4DV0 L;  3HS0 C;  3IFD A;  3TP8 A;  2I0Q A;  3NP8 A;  1PV4 A;  3KLS X;  2F4V Q;  2HDL A;  3QR8 A;  4KLK A;  5D14 A;  3DM1 A;  3EA6 A;  1CZW A;  5IOD A;  4GOP A;  4DR3 Q;  3R8B A;  4QGU A;  1HPC A;  3G48 A;  4FYD A;  1WCM B;  5C3E H;  4LFC Q;  3LNN A;  4GNX C;  1EQR A;  1C4Q A;  3D6C A;  3PSI A;  2K50 A;  1FD7 D;  2M9V A;  1AE3 A;  1TWF H;  1AFP A;  2EDG A;  3HG9 A;  3I72 A;  1F77 A;  2DN8 A;  3S1Q H;  2Z6K A;  2L15 A;  3NHH A;  3O13 A;  1I6H H;  1UNS A;  3EFX D;  3SDZ A;  1ASZ A;  3X3M A;  3T1H L;  1IHZ A;  1B9M A;  1TWH B;  4J6H A;  1KD1 C;  3NTH A;  1TII D;  4XT3 B;  1BQQ T;  1W6J A;  4RHS A;  1D1I A;  2F52 A;  1U5K A;  5IYC H;  4DV2 Q;  4J1M A;  1TS4 A;  1ESF A;  3HKZ E;  1VF5 C;  5KYL A;  3Q8D A;  3A0J A;  3KLW A;  5D3D A;  2Q8I B;  2KHS A;  1O7L A;  3MFG A;  1HA6 A;  5E1F A;  2ZXP A;  2PNR C;  2H5X A;  3VR4 A;  1S5B D;  2JQO A;  3C1E A;  3SR1 A;  2WB1 G;  3ND9 A;  2Z1C A;  3VA7 A;  3GTG H;  3E9H A;  3H3V C;  4DPG A;  4UHV A;  1E24 A;  4DKA C;  1J6Q A;  4IPC A;  1H9M A;  1JCK B;  4JV5 L;  2JA5 H;  2EY2 A;  4DV5 Q;  4LF4 L;  4HCS A;  1E3P A;  1C0A A;  1FL0 A;  3CCS A;  1CTM A;  3FDT A;  2A6E D;  3A74 A;  4HTH A;  2KOL A;  5CV8 A;  4DK0 A;  1X65 A;  3D4W A;  3RZO B;  3BYT B;  2I46 A;  1IZ6 A;  2WB1 B;  1PH4 A;  4BWG B;  1T5E A;  3RNU A;  2FJ2 A;  1PZK D;  2BE5 C;  5M3F B;  5JEA H;  2NTS A;  1I4P A;  3ULJ A;  1QUQ B;  3KUP A;  2A69 D;  2JA7 B;  4ABN A;  2F3W A;  5HGQ A;  2B63 G;  4C3J G;  2YTY A;  5EKL A;  2ICI A;  2NUC A;  2DY7 A;  2LXK A;  1LUZ A;  1K9M C;  3RN5 A;  1M1K C;  5E4W C;  3GTO B;  1S4Z A;  1STN A;  2B2V C;  4YCW A;  1Y1W B;  1EYC A;  1WTR A;  1FYC A;  5ELB A;  2EJM A;  4KHP Q;  1VQN A;  4F7X A;  4U67 3;  1KNE A;  1SNO A;  1ZYR C;  2XVS A;  1WI5 A;  1V1P A;  1HTP A;  5LHY 1;  4DGZ A;  2B63 B;  4C3J B;  4X65 Q;  4LF7 L;  1SMX A;  2AQ1 B;  4K8J A;  3TRZ A;  5FLM G;  3NE5 B;  1EYD A;  1BDO A;  3QOL A;  2JA6 G;  4MHE A;  4N9P A;  1IXR A;  2X6G A;  3SK6 A;  5HY6 A;  3K58 A;  4ZCK A;  1BBX C;  1H95 A;  4AQY Q;  4A3D B;  4RGM A;  4BBR G;  3J81 c;  2F0S A;  4BY1 G;  1CKM A;  2Q2U A;  1IBL Q;  1VQF A;  4J8Q A;  5CV4 A;  4A93 H;  2K28 A;  3DWA A;  4IUT A;  1QZH A;  1KHI A;  4DR1 Q;  2EPB A;  4UY8 C;  3J80 L;  1QWY A;  3PUX A;  4V0B A;  3RMH A;  2I07 B;  2B2V A;  1STG A;  3I4M H;  5GAE C;  4BXX H;  4G4K A;  4I7Z C;  4XT1 B;  4IOA A;  3F2U A;  1PDQ A;  5JJL A;  3NEL A;  3T4A C;  4IPH A;  5HGT A;  3J7Z C;  2XGT A;  2K5W A;  3L2P A;  1K83 B;  4JG2 A;  1C9O A;  1NR4 A;  3GV3 A;  1CKN A;  5IWA Q;  4OEL B;  3KOJ A;  3MVV A;  3VR6 A;  1Z6H A;  2EYF A;  2HHH L;  3IRB A;  1E22 A;  4PMC A;  3I90 A;  2IX1 A;  2IHE A;  1EFW A;  3E9I A;  1OXV A;  4JOI A;  5LMN W;  1SMY C;  1YJ9 A;  2R92 G;  1A3U A;  1CFM A;  2XRQ D;  1H9R A;  3P20 A;  1Y1V G;  1Y8P B;  3GTK B;  3A55 A;  3VYS A;  2Q8T A;  3SEB A;  3S1M H;  1NE3 A;  1GO3 E;  1YNJ D;  3CRL C;  1KNA A;  1PZJ D;  2KEC A;  3I7F A;  3KLR A;  1BF4 A;  4NXM L;  3GTP H;  1YEZ A;  3A54 A;  2C9O A;  1SNP A;  5JVG 3;  1ZEQ X;  3PV0 A;  3ULP A;  3KFU A;  2X6L A;  2N8N A;  5IYB G;  4R4T A;  3PMF A;  5KND A;  1TWF B;  2EYM A;  1SXT A;  4JI8 L;  1G29 1;  1YBY A;  2O5J C;  1J5E L;  1PXU A;  3TP7 A;  1N34 L;  2XWB B;  1L0Y B;  3PCO B;  1OXX K;  2PZT A;  1KC8 C;  4DK3 C;  3KF6 B;  1EYG A;  2ZTD A;  3K5N A;  1I4H A;  4K8I A;  3A8J E;  1SSO A;  1JJG A;  5CV7 A;  1YHQ A;  3HOU G;  2UUB L;  4FO2 A;  2EE1 A;  3JAM c;  4G7O C;  4GOP B;  4QF4 A;  1C8C A;  1BXT A;  4LMQ D;  1SE8 A;  3K5O A;  4RWS C;  4ILW A;  5BN3 A;  1EY0 A;  3IFT A;  3K5L A;  2K6A A;  3C1F A;  4RGO S;  4QB4 A;  4TVA B;  1HR0 Q;  4X3U A;  4DV4 L;  2EXZ A;  2D0P A;  4CKC A;  1WD0 A;  3PUY A;  4HN7 A;  4HMI A;  5C44 H;  5M3M H;  5EQ0 A;  1YNX A;  5K36 G;  3PIP 3;  3MFY A;  1VQL A;  2RSO A;  3K57 A;  3MXN A;  2JA8 G;  5LMN L;  3GTG B;  1DON A;  3T1H Q;  3ULL A;  1PH8 A;  4S3S A;  4NB3 A;  4DAM A;  1XYI A;  2JA5 B;  2L4N A;  1N32 L;  3Q6S A;  2K05 A;  1PYS B;  3Q24 A;  2YU9 B;  4GN5 A;  1Q86 C;  4H13 C;  4DR7 L;  5ELE A;  2DY8 A;  1Q3L A;  4KD4 A;  4BA1 I;  1U4R A;  2RF4 A;  1SEB D;  4GKJ Q;  2E2I H;  5JJI A;  2FIN B;  3D4D A;  3T1Y L;  4H44 C;  2YTV A;  3PIP A;  4OXP A;  2ALY B;  3I3C A;  3D31 A;  4F87 A;  4HJ5 A;  2F0M A;  2E74 C;  1G6P A;  1PRT C;  3I8Z A;  2DUD A;  1VQC A;  4LFA L;  2UXD Q;  1ILP A;  4XDX A;  2OTJ A;  3Q22 A;  1EU4 A;  4DUZ Q;  2IL8 A;  3M9B A;  3HKS A;  4A4I A;  5LL6 S;  1EIF A;  4DAY A;  4I65 A;  4JV5 Q;  1CKO A;  4QQB X;  5I9P A;  3FKI G;  3HOW G;  1ASY A;  1ROD A;  5M5W B;  3NQT A;  4B3T Q;  3W5O A;  3K7U C;  2R93 H;  3BDC A;  3BYY B;  1I4R A;  1JMC A;  1G6Z A;  1A3T A;  4JI6 L;  5EPK A;  3CC4 A;  1EU3 A;  4A3C H;  5FLX E;  4FF3 A;  1VS0 A;  3P1H A;  2PYK A;  1OXT A;  4XIG S;  4OHJ A;  5EPL A;  4QUF A;  3HOY G;  3A5U A;  2NTT A;  4JI4 L;  1YZ6 A;  5LMU Q;  1Q82 C;  3DM3 A;  2UXC Q;  3T13 A;  1G2T A;  1E2W A;  1DZ1 A;  4GKK Q;  2F0P A;  2RHQ B;  1PYW D;  1HH2 P;  4UP7 A;  2MHV A;  5IGC A;  1O80 A;  4NDX A;  3TDQ A;  3RZD B;  1LV9 A;  4QMG A;  5LL6 X;  3J7Y W;  2B2T C;  2LFN A;  1TY2 A;  2HIX A;  1DD2 A;  1KTK A;  2M2L A;  1EQV A;  4B3S L;  3K0Y A;  2OQ0 A;  1VCI A;  1L0W A;  4A3L G;  4KMU C;  5IGB A;  1R4Q B;  4L6T B;  4L5S A;  5G3L D;  1V1P B;  5IOC A;  3I4M B;  3ERS X;  3J81 j;  1HFN A;  2K04 A;  2Z9H A;  1VQG A;  1TS2 A;  4LF7 Q; 
#chains in the Genus database with same CATH homology
 1E7Z A;  4O0A A;  4LF6 L;  1IBK Q;  4Y52 H;  2UUC L;  3J80 i;  1TXY A;  2KCM A;  3EN2 A;  3HKZ G;  4OON A;  5C4J H;  4OO1 G;  3FHW A;  1K8G A;  2JA5 G;  5M5W H;  4R4Q A;  2Z0S A;  1X9N A;  4LNQ A;  2WAQ E;  1XPR A;  1PYB A;  1Q12 A;  1T9H A;  5IP7 G;  4GS3 A;  3HOX H;  1PA6 A;  3GTK H;  2IY5 B;  1KRT A;  3S24 A;  1I94 Q;  4JC0 A;  3M4Q A;  4R4I A;  4YY3 L;  1HNW L;  4TQU S;  3KF8 B;  4WJ4 A;  4DV0 L;  5DLQ E;  3M4O H;  4DR2 Q;  3K0X A;  2JEA I;  1YJW A;  2I0Q A;  1VQD A;  2BH2 A;  3PO2 H;  4NXN L;  3HFZ B;  1PV4 A;  2F4V Q;  1D7Q A;  1HNZ L;  5C0X J;  3F8T A;  2A1A A;  4KLK A;  1LTL A;  4JI0 L;  4A3K H;  1XPO A;  1R9T H;  4YWM A;  4BA2 I;  1VQH A;  1N9W A;  4GOP A;  4DR3 Q;  2N3S A;  4QGU A;  3U4Z A;  4X62 Q;  4DV3 L;  3G48 A;  5GRO A;  5GQO A;  2GN5 A;  1IL2 A;  1NTG A;  1NMF A;  3HOW H;  5C3E H;  1YVC A;  2YV5 A;  4LFC Q;  4DR5 Q;  3WWV A;  4GNX C;  4UPA A;  1EQR A;  4JOI C;  1YIT A;  1I94 L;  4JYA L;  4JBW A;  3PSI A;  2K50 A;  5FLX c;  3RZD H;  4POG A;  4HJ8 A;  4GN3 B;  4DNI A;  1AE3 A;  1TWF H;  4HIM A;  4OWW B;  5E7N A;  4A3J H;  1FJG L;  3S1Q H;  4JBK A;  1FVI A;  3OTO Q;  2Z6K A;  2L15 A;  1VQP A;  1WJJ A;  3E0E A;  1CSP A;  3HOY H;  4A3G H;  1I6H H;  1HNX Q;  1X55 A;  1ASZ A;  1UE1 A;  2VZA A;  3H0G G;  3T1H L;  1BBW A;  2FXQ A;  4X62 L;  4EX5 A;  2R7Z H;  4LFC L;  3NEN A;  1KD1 C;  4GNX B;  1VQA A;  3CCU A;  2HQL A;  4OX9 L;  5C4X H;  2VQE L;  2F52 A;  3M7N A;  1PH1 A;  3A5Z B;  1U5K A;  5IYC H;  4DV2 Q;  1SRU A;  4A3I G;  1G51 A;  3OTO L;  2ZJR A;  3HKZ E;  1B70 B;  2AKW B;  3CC7 A;  5ELN A;  3Q8D A;  4P73 A;  3A0J A;  3PUW A;  3TEH B;  3JAM i;  1HNX L;  4LF4 Q;  1TWA H;  4IFD J;  1N36 Q;  3KLW A;  3K81 C;  4A3L H;  1Q1E A;  3RR5 A;  2R7F A;  1B7Y B;  1L1O C;  2EXD A;  3BZK A;  5BR8 L;  3K7A H;  2H5X A;  3GTL H;  3CCR A;  3BZC A;  4MTN A;  1NY4 A;  2DGY A;  4A3F H;  2RCN A;  4UP9 A;  4A93 G;  4X66 Q;  1FGU A;  2JQO A;  4DR4 Q;  2WB1 G;  1S40 A;  3GTG H;  3E9H A;  4DV2 L;  3I4O A;  3U50 C;  1YHA A;  4DPG A;  4YCU A;  4YWL A;  1E24 A;  4DKA C;  1J6Q A;  2CQO A;  4IPC A;  2NN6 G;  5EAY A;  1S72 A;  1VQ5 A;  2JA5 H;  4LF8 L;  4JV5 L;  2YTX A;  4DV5 Q;  4IO9 A;  4A75 A;  1JT8 A;  4C2M H;  4LF4 L;  3G71 A;  3I4M G;  3GTM H;  3W1B A;  1E3P A;  4HJ7 A;  4BXX G;  4IJH A;  4C3H H;  3D0F A;  1EIY B;  1RL2 A;  1VQ7 A;  2C35 B;  1FL0 A;  3CCS A;  2E2J H;  2GVB A;  1XNR L;  1C0A A;  1BVS A;  1EUJ A;  1L1O B;  2CCZ A;  4JI8 Q;  1KL9 A;  2B3G A;  3CCV A;  1W2B A;  3A74 A;  4AH6 A;  4X66 L;  1Z9F A;  2BA0 A;  1PH6 A;  5C0X G;  1NMG A;  1X65 A;  4GLX A;  1PH4 A;  1IZ6 A;  4L5Q A;  2UXB Q;  4NPS A;  4QL5 A;  3CD6 A;  3RNU A;  4A3B G;  1KQS A;  2ZTC A;  1TWH H;  4DV5 L;  1VQ9 A;  1A8V A;  3ULJ A;  1QUQ B;  4DV7 L;  4HIK A;  4LW1 A;  4PMW A;  5HGQ A;  2B63 G;  2YTY A;  4HJ9 A;  3S2D H;  4HJA A;  4K0K L;  4HID A;  2LXK A;  1L1O A;  1LYL A;  1LUZ A;  1JB7 A;  2D0O A;  4JI7 Q;  1YI2 A;  1K9M C;  4LUZ A;  3RN5 A;  1M1K C;  2HT1 A;  1WCM G;  1GVP A;  2CKZ B;  1I50 H;  4YCW A;  2IX0 A;  4A3M G;  3S17 H;  1B8A A;  4KHZ A;  5IP9 G;  1GD7 A;  1VQM A;  1TWC H;  2NN6 I;  3H0G H;  4X64 Q;  4KHP Q;  1QVC A;  1VQN A;  1XPU A;  1QZG A;  4LF9 Q;  4DV6 Q;  4LFB L;  4JI2 Q;  2Y0S G;  4JI5 L;  4LF5 L;  1GKH A;  4YCV A;  1WI5 A;  2NVY H;  1Q46 A;  3GTJ H;  5LMN Q;  2MNA A;  1X3F A;  3CME A;  1VQ6 A;  4GLV B;  3HOV G;  1Y14 B;  2WB1 E;  4X65 Q;  2A8V A;  4O2D A;  4A3I H;  4JI7 L;  4LF7 L;  1SMX A;  3TRZ A;  1MJC A;  1S3O A;  4IPD A;  3CAM A;  5FLM G;  3RN2 A;  1IBK L;  3PGZ A;  4ME3 A;  2VUM G;  1N32 Q;  4EQ5 A;  2JJQ A;  4UP8 A;  2LXJ A;  4J15 A;  2JA6 G;  1QVG A;  1H95 A;  5JEA G;  1IXR A;  2WP8 J;  1PH7 A;  5HY6 A;  4AQY Q;  4RG1 A;  3U4V A;  1XMQ Q;  4XTC S;  1SFO H;  4KHP L;  4IFD G;  4DV1 Q;  1E1T A;  1NBW A;  1OXU A;  2KHI A;  1AE2 A;  4BBR G;  3J81 c;  4DR2 L;  4LF9 L;  4BY1 G;  3OW2 A;  1CKM A;  3JC6 6;  1SLJ A;  3CP0 A;  1UE6 A;  3T1Y Q;  2Q2U A;  1IBL Q;  4L5T A;  1VQF A;  4JI2 L;  4A93 H;  2F4V L;  2Q2I A;  1YIJ A;  5IYD G;  1QZH A;  3RZO H;  1KHI A;  2EQS A;  3GTQ H;  1X56 A;  1GM5 A;  3M3Y H;  3S14 H;  4DR1 Q;  1K73 C;  1N33 Q;  1CKN B;  2I5H A;  3ZJY C;  2KBN A;  4OO1 I;  3FP9 A;  4LFA Q;  4UY8 C;  4B3R Q;  4WJ3 M;  4DR3 L;  2JE6 I;  2OCE A;  3PUX A;  2NVQ H;  1HZA A;  3K8A A;  2HHH Q;  1P8L A;  4DR5 L;  2Q2H A;  3I4M H;  5GAE C;  4P75 A;  3MEF A;  1XMQ L;  5ELO A;  4BXX H;  1WYD A;  2N78 A;  1K8A C;  4IOA A;  1JE5 A;  2CFM A;  3UDX A;  3UE0 A;  2K5H A;  1HZ9 A;  2ID0 A;  3CXC A;  1MIU A;  4DV1 L;  2ASB A;  5JJL A;  3NEL A;  2MQH A;  4JI3 Q;  1PHJ A;  4OWT B;  1KRS A;  1IBL L;  3UDI A;  4IPH A;  4Y7N H;  3J7Z C;  2XGT A;  4HIO A;  3L2P A;  4JG2 A;  1C9O A;  2UU9 Q;  1PH5 A;  3GD7 A;  3UE1 A;  5FJ8 H;  1CKN A;  5IWA Q;  1A63 A;  3AFP A;  4A3B H;  3KOJ A;  4JI6 Q;  4QJF A;  5C44 G;  2HHH L;  5M3M G;  3IRB A;  1E22 A;  4DUY Q;  3CW2 C;  3I55 A;  2IX1 A;  2F3I A;  1HZC A;  2IHE A;  2Y0S E;  1EFW A;  3E9I A;  4GNX A;  1OXV A;  3L7Z C;  4JOI A;  5LMN W;  4C3J H;  2Q2T A;  4NXM Q;  2B63 H;  4AIM A;  4JI4 Q;  1XJV A;  4JI3 L;  1QVF A;  4ALP A;  3I56 A;  2R92 G;  2I5M X;  1YJ9 A;  4A76 A;  1WCM H;  4DR6 Q;  3W1G A;  5M3F G;  1HR0 W;  3S2H H;  4A3M H;  1K3R A;  1X6O A;  1Y1V G;  2RHS B;  5IP9 H;  2ZTE A;  5GAG C;  2VQF Q;  2JA7 G;  2JEB I;  1N36 L;  1Z47 A;  3TS0 A;  5M5Y H;  3F2B A;  3I4N G;  2AMC B;  2NVX H;  3TS2 A;  5J3B A;  1EQQ A;  3S1M H;  1NE3 A;  1VQO A;  1X3E A;  1GO3 E;  2R7D A;  3AQQ A;  3U58 A;  2NZH A;  3TRE A;  1J5E Q;  3GTP H;  3I7F A;  1JJC B;  1Y1W G;  2MO1 A;  1N34 Q;  1A0I A;  1YEZ A;  3CPF A;  2ES2 A;  4B3S Q;  4NXM L;  3HOV H;  4DR4 L;  1O7I A;  1XNQ Q;  3J81 i;  3CCM A;  3H15 A;  4POF A;  2AWN A;  5FLM H;  3CC2 A;  1CSQ A;  5FJ8 G;  4IOC A;  4FDB A;  3BJU A;  2VUM H;  3PV0 A;  4DR7 L;  3ULP A;  4A3E G;  4JI1 Q;  2UUA Q;  4LUV A;  4B3M Q;  2JA6 H;  3KFU A;  1N8R C;  4P72 A;  2N8N A;  1PH3 A;  5IYB G;  2IHF A;  4R4T A;  2UUB Q;  1TWG H;  4GOP C;  4JBJ A;  4BBR H;  4C3I H;  3KJO A;  1M90 C;  4LF6 Q;  4BY1 H;  4JI8 L;  1WOC A;  2VW9 A;  1KAW A;  3G4S A;  1G29 1;  5GAD C;  4GN4 B;  1YBY A;  4PZ7 A;  3CMA A;  1K83 H;  4IPG A;  1J5E L;  5IYD H;  1N34 L;  2PI2 A;  3AYH B;  1SR3 A;  3PCO B;  1OXX K;  5IE8 A;  2ATW A;  2R93 G;  4YY3 Q;  4X6A H;  1KC8 C;  1HNW Q;  4DV4 Q;  1VQK A;  3L0O A;  4A3D G;  4DK3 C;  1PFS A;  2UXB L;  3KF6 B;  1I5F A;  2VNU D;  1EYG A;  4R4C A;  2AHO B;  2ZTD A;  2KEN A;  3M85 A;  2ZJQ A;  2MFI A;  1JJG A;  2UUA L;  4A3C G;  1PVO A;  4NXN Q;  1OTC A;  1HNZ Q;  3MXN B;  5IY0 A;  4JI0 Q;  2PI2 E;  3I2Z A;  1YHQ A;  1HJP A;  2A19 A;  2UUB L;  3HOU G;  3JAM c;  3S15 H;  1QUQ A;  4BBS G;  1VQE A;  4PG3 A;  2WFW A;  4GOP B;  3KDF B;  4R1J A;  1SE8 A;  2VL6 A;  3S1N H;  1BKB A;  1D8L A;  2LSS A;  4DV3 Q;  2HIV A;  5C0X I;  2YYZ A;  4R4O A;  1HR0 Q;  4TVA B;  4JYA Q;  4DV4 L;  4DR7 Q;  4X64 L;  3STB D;  2D0P A;  3PUY A;  3S1R H;  2E5L Q;  1X54 A;  3KF6 A;  5C44 H;  4BY7 G;  5M3M H;  2R6G A;  1FJG Q;  1YNX A;  3TQY A;  5K36 G;  1VQL A;  1KIX A;  4DV6 L;  2B29 A;  2N49 A;  3CCL A;  1DGS A;  4P74 A;  3PIO A;  4AYB G;  3KJP A;  3PO3 G;  1I3Q H;  1W3S A;  3GO5 A;  2JA8 G;  2XTI A;  3DLL A;  2ZJP A;  3CF5 A;  5LMN L;  3UDG A;  1C7Y A;  3H3V H;  2QGQ A;  4X65 L;  3T1H Q;  3KDF A;  3ULL A;  1PH8 A;  2R92 H;  3M4P A;  3CCE A;  3FKI H;  1U0L A;  1VQ8 A;  4NB3 A;  3NEM A;  4DAM A;  5M3F H;  5IT9 c;  1N32 L;  1X3G A;  1XTD A;  2EIF A;  1UE7 A;  4MZ9 A;  1Y1V H;  2D62 A;  4PZ8 A;  1PYS B;  1HR0 L;  1EWI A;  4JBM A;  4GN5 A;  1Q86 C;  2JA7 H;  4PZ6 A;  3PUZ A;  2K5V A;  3GDE A;  3UDF A;  4AQY L;  2VQE Q;  1NJI C;  4OX9 Q;  2MO0 A;  3ICE A;  3I4N H;  3S16 H;  3PF5 A;  2K75 A;  2E5L L;  2CWP A;  4BA1 I;  1UWV A;  4DAY B;  1UE5 A;  2RF4 A;  3HOZ G;  5H1S E;  4GKJ Q;  2E2I H;  4YHH Q;  5JJI A;  3T1Y L;  2NZO A;  4LWC A;  3OYY A;  4L5R C;  3GTO H;  1WFQ A;  2YTV A;  3PIP A;  4OXP A;  2ALY B;  1Y1W H;  1VQ4 A;  3D31 A;  4HJ5 A;  3HOX G;  1SN8 A;  4KI0 A;  1SRO A;  4DR1 L;  2NVT H;  1N33 L;  1G6P A;  1V1Q A;  1KXL A;  1YHB A;  2DUD A;  1VQC A;  4H02 A;  4LFA L;  2UXD Q;  4B3R L;  3CPW A;  5BR8 Q;  3CCQ A;  2OTJ A;  4A3E H;  1VQJ A;  1VQI A;  3J80 c;  3F1Z A;  4DUZ Q;  5AJ3 Q;  3AEV A;  3PO2 G;  5IYB H;  4IFD I;  1Q81 C;  2E8G A;  2OQK A;  3M9B A;  1OXS C;  4A3K G;  3EBE A;  2PNH A;  3HKS A;  4A4I A;  1Q1B A;  4IJL A;  2JK8 A;  1MJE A;  1EIF A;  4GKJ L;  4YHH L;  4JV5 Q;  1CKO A;  4P71 A;  1UEB A;  4MNO A;  4LF8 Q;  4QQB X;  5JEA J;  3FKI G;  2JA9 A;  2WAQ G;  3HOW G;  1ASY A;  5C3E G;  1E1O A;  2QEX A;  3W5O A;  2E2H H;  2UU9 L;  2OWO A;  3K7U C;  4B3T Q;  3J7A 5;  2R93 H;  1AH9 A;  1IYJ B;  1IBM Q;  1JMC A;  4A3D H;  4LUO A;  3G6E A;  1XNR Q;  5IWA L;  2UXD L;  3EIV A;  2PQA B;  4QIW E;  4JI6 L;  3CC4 A;  3B6Y A;  4A3J G;  3RLF A;  4A3C H;  4DUZ L;  5AJ3 L;  2QA4 A;  4DUY L;  1VS0 A;  2IT1 A;  1OXT A;  3HOU H;  4BBS H;  1XMO Q;  4DK6 C;  4AYB E;  4XIG S;  1Q8K A;  2ZM6 Q;  3HOY G;  3A5U A;  3PF4 A;  4A3G G;  4JI4 L;  1EOV A;  1YZ6 A;  2AWO A;  5LMU Q;  1VQB A;  1Q82 C;  3DM3 A;  3BU2 A;  2UXC Q;  3SGI A;  3K80 C;  2VY3 A;  1V43 A;  3CQZ H;  3ER0 A;  3RLO A;  4DR6 L;  5IP7 H;  4GKK Q;  2YU9 H;  4B3T L;  2R7Z G;  2RHQ B;  3KYH C;  4APV A;  4DV7 Q;  4JCV E;  1HH2 P;  4UP7 A;  1IBM L;  2VQF L;  3STB C;  2CWA A;  1P16 A;  1RIP A;  3VDY A;  4QY7 A;  5C4X G;  2KHJ A;  4BY7 H;  4K0K Q;  5IYC G;  1PH9 A;  3F2D A;  2PQA A;  3CCJ A;  4RMF A;  2K14 A;  2UUC Q;  1L2F A;  1LM0 A;  2K4K A;  3PO3 H;  1HZB A;  5JJK A;  2HIX A;  2BH8 A;  1CUK A;  1XMO L;  1Q7Y C;  2K52 A;  2OTL A;  2JA8 H;  2BA1 A;  3H3V I;  2ZM6 L;  4B3S L;  1MKH A;  1A62 A;  2GVA A;  2OQ0 A;  4GLA C;  2VS1 A;  5LMU L;  1VCI A;  2I5L X;  3RLN A;  1XNQ L;  1K0R A;  1L0W A;  1BBU A;  2KCT A;  4OWX B;  4DV0 Q;  2UXC L;  4A3L G;  3LGJ A;  3AFQ A;  5M5X H;  4GKK L;  4LFB Q;  1V9P A;  4JI1 L;  2Z6K C;  1YJN A;  4JI5 Q;  4B3M L;  4L5S A;  4LF5 Q;  4A3F G;  2PMZ E;  3ERS X;  3F2C A;  2V1C C;  4YWK A;  3J81 j;  1JJ2 A;  3NBH B;  1VQG A;  1PH2 A;  5GAH C;  2K5N A;  3PUV A;  4LF7 Q;  3HOZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...