1Y8PB

Crystal structure of the pdk3-l2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
97
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8pB00
2AUKA 3D4RA 1A6XA 4OGQC 3M85A 2BA0A 1GUSA 1B9MA 3GD7A 5K36H 2A6HD 2EJMA 1GUGA 2D5DA 2O5JC 3PUZA 4TQUS 1Z7TA 4DNTB 2A6EC 1HCZA 1SMYC 3T51B 2LMCB 3NE5B 1IYUA 4HR7B 2KA7A 4RCNA 2JXMB 2D2CC 2BE5D 1HTPA 4H0LC 1H9MA 2E74C 3QIAA 1GUNA 3T53B 3U9SA 3CRKC 1CFMA 1T5EA 1OXUA 1DD2A 5A35A 1TKWB 1BDOA 1OXTA 2E75C 3A8JE 1Q1BA 1V43A 3A8KE 2Q8IB 3OW7A 4KI0A 1B9NA 2O5IC 3OPOA 2EJFC 1E2VA 2A68D 3H94A 1K8OA 3KLRA 2JEBI 3LNNA 4L8JA 4XIGS 3BG3A 1DXMA 1EWHA 1ONLA 2DN8A 2KCCA 2DNCA 3VR4A 2QF7A 3OOCA 4IQZA 1LACA 4BA1I 2AUJD 2B8FA 3PUXA 3IFTA 5BN4A 1Y8OB 2JEAI 2IT1A 2B8GA 1LABA 3M4YA 2K7VA 4JBWA 3PUYA 1E2WA 1VCIA 4KN7C 2A68C 3I4LA 4DK0A 1IW7C 1I6VC 4IFDG 4OO1G 3M7NA 2A69D 2EJGC 3RLFA 4LK1C 1H9RA 2A6HC 1OXXK 2BA1A 2E76C 1ZYRC 2F1MA 4I7ZC 2PPBC 1VF5C 4G7HC 5JEAG 3TZUA 4TKOB 5BN3A 1HQMC 3A8IE 1CTMA 2NN6G 4JK1C 4DNRB 5C0XG 3MFYA 1Y8NB 2AWOA 4KN4C 1DCZA 1O7LA 2BE5C 4G7ZC 3FPPA 4G7OC 2PCFB 3PUVA 3VR6A 1HPCA 1YNNC 1H9JA 3HGBA 1Q12A 1Z6HA 3FMCA 2NN6I 3ND9A 1O78A 3GQBA 3VR5A 2D62A 3QG1A 1FR3A 3WDNA 1QJOA 3LWUA 2DNEA 1OXVA 2CW0C 4H13C 3I73A 1GUTA 2V4DA 3SDZA 5K36G 2A6ED 4KKSA 3A7AB 1G291 1K8MA 1PMRA 2PNRC 1GHKA 1CI3M 1H9KA 2BDOA 3P20A 2JE6I 1GHJA 1VDZA 4BA2I 2K33A 1OXSC 5KNCA 4IFDH 2L5TA 2K32A 3DXJC 3PUWA 4OO1H 1GUOA 1FYCA 3EQLC 2A69C 4KHZA 3T56B 5KNDA 1Q1EA 3PV0A 1E2ZA 3N6RA 3VR3A 3ND8A 1TU2B 5JEAH 4GZYC 3QJYA 4KKUA 4H44C 3D31A 4DK1A 2NN6H 1V8QA 4PV1C 5C0XH 3MXUA 3W3AA 1Q90A 1GJXA 2EDGA 2ZT9C 5KNBA 1YNJC 4KMUC 1IYVA 1ZKOA 4LJZC 1Y69U 3SE0A 3L7ZC 3I72A 3VA7A 3IKJA 2YYZA 3CRLC 4KKTA 4XTCS 1H9SA 2EVBA 5BN5A 1VF7A 1H9SB 3AB9A 3A7LA 1Y8PB 3BDOA 2R6GA 3VR2A 1IW7D
chains in the Genus database with same CATH superfamily
4DR7L 4LFCL 3M3YH 1VQDA 1UNSA 3HOXB 1QOHA 1QVCA 3IRBA 3OWFA 1G6ZA 3HOYG 2OTLA 3AMUA 2VL6A 3GTOB 2V1CC 1I4GA 4DV4Q 2CWAA 3DWQA 3K7AH 4H0LC 4R4QA 3T1HL 1UEBA 3HG9A 1VQNA 4PMCA 3T53B 1O7YA 2ZTEA 4RG1A 4QQBX 3FKIB 2IHFA 1BUVT 1HA6A 4NXNL 4CGYB 1A0IA 4J6HA 2SDFA 3M4QA 1SR3A 3GTQH 5IP7H 1K8OA 3DLLA 3HKSA 3KK7A 2K01A 4DR4Q 4KY5A 1DXMA 2DJFC 5DNFA 2R92B 5C4XG 5EKLA 1X6OA 4K5VA 1PH8A 1UAPA 4RKLA 4XDXA 2RF4A 3BDCA 2L55A 4JI2L 4C3HB 4BY1H 5FKAC 2VUMH 5M3MB 4O2DA 3SHLA 1OXXK 1I4HA 1NUCA 1Q8IA 3EN2A 3S1NB 5JEAG 1PTOF 1M4VA 3HOVB 1PYWD 2BE5C 3BVZA 3C1EA 1RJTA 3W1BA 1HNZQ 5CR3A 2HHHQ 1TWHH 2HIXA 1CM9A 4EQNA 1SAPA 4KK7A 2GN5A 4KTAA 2RHSB 5AJ3Q 3U4ZA 3HOUH 3URYA 2TSSA 3TP6A 4A3JB 2KOLA 2VB3X 3AYHB 4B08A 2NVXH 4K5WA 1Q46A 3NWTA 4PMBA 1U0LA 3NBHA 1CT1D 4ID6A 1CA6A 3VYUA 5G3LD 2DUDA 3H3VH 2JA9A 2CVRA 1KL9A 3PUWA 5M3FG 3E0JA 4RA8A 3EQLC 1TWFH 3KLSA 4WFN3 3V05A 3KJPA 4KKUA 2B63B 4KLKA 3DEOA 4JC0A 1VQ8A 1PLFA 2HT1A 1JOKA 5GROA 5C4JB 4P75A 4UDUC 4AQYQ 1JE4A 1H9SA 1SE3A 4JV5Q 4DUYL 3S15H 2PW7A 3LX0A 1Q81C 4OGQC 4WORA 2L4NA 4U673 3CW2C 2MHVA 1ZYRD 4A3GB 3M4OB 2A6EC 3MXGA 1G8ZD 2PQAA 4KD3A 4A75A 1ML0D 2LMCB 2WB1G 1SNQA 2JA8B 1EEID 1KRTA 4AH6A 5GADC 5CV5A 3CU7A 4GOPA 4A93G 4DAMA 1I94Q 1B70B 2XTIA 1GUNA 2NYZD 3HOWH 3D8GA 3GTLB 1VS0A 2PYKA 2Z6KA 3G6JB 3A8JE 4OELB 2EQSA 4N8X1 3EFXD 4HEDA 1A62A 3HEJA 1HR0Q 2F3IA 5EGTA 2L12A 2K5HA 3RR5A 2PZTA 2KCCA 2R61A 1IYJB 3K81C 5IGFA 2B2TA 5JOBA 2FHTA 4GKJQ 3K5NA 2A8VA 3TSSA 2F4VL 4KY7A 3QWNA 1AP0A 1WFQA 1VQJA 4KHVA 2CHBD 2RSNA 3HOZG 3KJOA 1VF5C 3J7AV 1FD7D 1AH9A 4IFDI 3N52A 1PH4A 4DR3Q 4JI0Q 1O7LA 5C4ZA 5I2XA 3VR6A 1VQ9A 1H9JA 2UUBQ 4A3LG 1STHA 4H7BA 1IBKQ 1E0BA 4DR5Q 1HZ9A 5GAEC 3K58A 1LTBD 3KUPA 4OIKA 1JJ2A 1Z9FA 3LWUA 5IT9L 3CPFA 5I9PA 1II3A 5JJKA 3OMCA 2OQKA 1G91A 1BCPD 3BZDB 4LF6L 3HS0C 1KDCA 4A3KH 2F0DA 1VDZA 1VQMA 1D1KA 2CH4A 4OONA 3WWVA 4DXFA 5JVH3 4B3RQ 4UP8A 4DR2Q 3RZDB 2LFNA 1F9RA 1M1KC 2DY8A 4KHZA 2JA6G 1RD9D 1PH2A 1GVPA 4Q0FA 1WCMH 3G4SA 1CQVA 4GZYC 1CK1A 1W2BA 2UUCQ 4LWCA 2UUAQ 1SYFA 4RGOS 1YNJC 5ELBA 3TP5A 5KRUA 1XMQL 1RODA 2BH8A 4LF5L 1ZKOA 3BYYB 1Y69U 4OXPA 1HZBA 5C3EB 1IW7D 3K0YA 3J81i 3GTKH 5EPLA 4YWKA 3HP3A 1OO9B 2WIIB 2R93G 5K36H 3SEBA 2F0PA 2R7ZB 1LTSD 2KQ3A 2EXDA 2LS01 3GDEA 3LGJA 3PIP3 2KA7A 5IE8A 4X3KA 4XQQA 4DK3C 5G3LF 4A3BB 3PO2B 3E5SA 2QW7A 1F2ZA 4UAIA 1E1OA 2YTXA 4PG3A 4POFA 2NVQB 1LTAD 1K3RA 2PMZE 1Q1BA 1MKHA 2Q8IB 1LO5D 1K28A 2FXQA 3JAML 1TS3A 1N8RC 2HQLA 1S5CD 3J81E 3EJIA 4X65Q 4ZUJA 2JEBI 2ICIA 3I55A 2ZTCA 4CDFC 1EQVA 4JOIA 3PUXA 1EZ8A 5BN4A 1L1OC 1R9TH 2OEOA 4HJ5A 4DV3Q 1IL8A 1Y1VB 1TWCB 4EQOA 1A15A 1I4QA 2EYHA 3NK9A 1JWUD 4OO1G 2RDFA 2QEJC 1N33Q 2F1MA 5HGTA 3IFDA 4HIOA 5LMNQ 1VQEA 1D1IA 4FYDA 3MFYA 3HKZB 1SJED 4GLAC 3WOEA 4R8IA 2PCFB 5E3FA 1YJ9A 2Z8LA 2K75A 4DV4L 3I56A 5GQOA 4JI1Q 1YHAA 3EVQA 5F2DA 3FDTA 2UXBQ 4HJ8A 2D0PA 2QDBA 2FINB 5I4DA 2ALYB 1GD7A 4NPSA 1Q86C 1JOQA 5A2QL 4S3SA 1UE7A 3BVMA 2WAQE 1VQ7A 1SMYD 2E5LQ 5IIFA 3J80L 2Z4IA 4DR4L 2XVSA 4B3MQ 1TWHB 3NBHB 2QGQA 1JCKB 3Q0AA 2MQHA 1J5EQ 2B29A 4IUQA 1X54A 3HOUB 1M8AA 3T56B 5J22A 3NPPA 1STAA 3PCOB 1EFWA 3D31A 3T16A 1V1PA 4CKEA 4HCSA 4F87A 3OTOQ 2Q8RE 2ZT9C 5CV9A 4B9XA 2NWGA 4LJZC 3PIOA 2QA4A 1EL0A 1YI2A 2OTJA 5EAYA 2EYMA 1EZ6A 1TWFB 4WRDA 1TT2A 1H9SB 3M4PA 2HHHL 4N9TA 1X3FA 3MA2B 3K5MA 3NWSA 1DYQA 2ZTDA 5AJ3L 4YIJA 1B8AA 1SSOA 4A3EH 3CCRA 4A3CH 5HY6A 3NE5B 5E4XA 2M2LA 3CXCA 3I2ZA 5C5LA 1D5ZC 3CQZH 1F2MA 1KDBA 1TY2A 3MZ5A 1E24A 1YNND 1C0AA 1M90C 5DAUA 2EXZA 3QB3A 3GTOH 2Q2UA 4A3IG 3ZYYX 2E2JH 3OMGA 1PRTB 1EWHA 1XX8A 1GKHA 3HOWB 4IQZA 4L5QA 3S1MB 2AUJD 2AQ1B 2I0QA 4AQYL 4JBWA 4FP5D 5NUCA 4HJAA 3H3VC 2R92H 1CZWA 1WTOA 1CKNB 1SNMA 3STBC 4DUZQ 4C3HH 3HOXG 1AZPA 2DGYA 1HUNA 1TIID 4C2MH 1I94L 4CHTB 2NBFA 4DKAC 5C0XI 1FVIA 2IX0A 3GTPB 5D3IB 5CV6A 4IPGA 3P75A 4LAAA 3FKIG 1QVGA 3NELA 1RDPD 1MIUA 1G2SA 4QCLA 2ES2A 2Y0SB 4A3JH 4NB3A 3F2CA 1UE6A 3C46A 2OWOA 3CP0A 5FLMH 4GKJL 1PRTC 4HJ9A 3TBIB 1STYA 1JR0D 4A3KB 2Q2IA 2MJ8A 1AN8A 4ZK9B 5KNBA 1F2YA 2P5ZX 3T1YQ 4CKCA 5M3MG 4PZ7A 3VA7A 4JI0L 4F7XA 3K6OA 2B63H 4J1MA 3S1RH 2K28A 1QVFA 3BVGA 4IPHA 3HOVG 1YZ6A 1IBKL 3OW2A 5DLQE 4DR5L 2R7DA 4ZKCB 5C4JH 2KHIA 3S9WA 2EJMA 3E6ZX 3PUZA 4TQUS 2UXDL 4LFAQ 4L63B 3CCMA 3MAQA 2NZOA 2WP8J 1VQFA 4KD4A 1LTLA 1WVLA 2JQOA 1BDOA 4B3RL 1X3PA 4DR2L 1KD1C 4A3FG 2JA8H 3GV3A 2PZUA 3QOJA 4A76A 1S3OA 1PYBA 2B2UA 2K05A 2A68D 5BR8Q 5CGKA 4IUUA 4XYOA 2H5XA 2UUCL 2UUAL 2I07B 1YJNA 1LTTD 3J81j 3OOCA 3J81L 2F3VA 4AYBB 4C3JG 4R4OA 3DWAA 3EROA 2K5DA 1SN8A 4X3UA 3ERQA 2A69D 3MC0B 4UP9A 1C8CA 4CDEC 2VXWA 1J9OA 2LXJA 1CTMA 1HNXL 4LF6Q 5D14A 3NBIA 3JC66 1HXYD 4K8JA 1S40A 2F0TA 3CC7A 1K0RA 4A3GG 3I91A 1PVOA 5JJZA 1CSPA 3GQBA 3HFZB 1TQOA 2SNMA 3S24A 2CW0C 4POGA 2E2DC 1L2FA 1JQYD 4BY7G 1VQ4A 4KKSA 4DV6Q 1EIGA 1XTCD 3RMHA 1CA5A 2EYFA 4LF5Q 1HTLD 4OEMB 2L5TA 1SE8A 5E4WC 2LY7A 4JPBW 1FYCA 3MVVA 5H1SE 4DV3L 1XJVA 4JI7Q 1G6PA 5IT9E 3PO3H 5IYCH 4FXKC 1QUQA 4NKLA 4RGTA 3TDQA 2NZ1D 1N33L 1MI2A 4MHEA 3RZDH 2OCEA 3CHBD 5LMNL 1NNXA 3RUZA 1KNAA 1CSQA 4R1JA 4JI1L 4IN3A 2KHJA 2MUYA 2UXBL 2PO4A 1JE5A 2F0KA 2D5DA 1P8LA 5CBEE 4BXXH 5ELNA 4DNTB 5IGCA 1HCZA 1BF4A 1PZJD 1DJRD 2IW3A 2E5LL 4B3TQ 4IUTA 4XXEA 1HTPA 2E74C 1QNKA 4B3ML 1CFMA 1T5EA 3Q8DA 1OXUA 1J5EL 3JAMi 5CV8A 1DD2A 1UUPA 2YV5A 1V43A 4A3EB 3J7A5 2O5IC 1H95A 4DAYA 3PO2H 2GVBA 5DM73 3IAYA 4DR1Q 4ALPA 3D6WA 2NVQH 3OTOL 3CCSA 5FLXc 3K80C 1JC7A 2VB2X 1V1OA 3BU2A 3ICEA 3U50C 4O0AA 3R2TA 4GNXA 4LUOA 1IBMQ 2A74C 2QDLA 4RAUC 4JI3Q 1X3EA 3JAME 4ZKBB 2R3ZA 1H9RA 2A6HC 2E2JB 3I8ZA 1EU3A 3TZUA 1Y1VH 5C3EG 1TWCH 2NN6G 5M5XH 4YCWA 2E8GA 4HIMA 2RBMA 3NENA 2KCTA 2PZWA 2N49A 1HNWL 3CCEA 2MPMA 4A3BG 4A4IA 3P1HA 1VQAA 3J80i 3K59A 1QCBD 3BJUA 1N32Q 5C44B 5EPJA 1TWAH 2K4KA 4A3MB 3NXWA 1B2TA 2IL8A 4L5SA 1CI3M 4FNFA 4C2MB 4R4TA 4JI6Q 3NEMA 3NUCA 4IFDH 3KBXA 1GUOA 4ZCKA 1WTPA 3RLOA 3A74A 2K5WA 4CJ0B 2ZM6Q 3CPWA 2K52A 3S14B 5I6WA 2N78A 5A2QE 1TXYA 1STBA 5J3BA 2HDLA 3J80E 4DUZL 4N9PA 2VNUD 4EX5A 1Q3LA 5EPKA 3G7LA 1SRUA 3R3OA 3HKZG 1VQLA 4NP5A 1B9MA 4BY1G 2VUMG 3ULLA 3F2DA 2F0IA 4XQNA 4RCNA 3K57A 3DEPA 5I6YA 1MD2D 2M9VA 3S1RB 2D2CC 2BE5D 1RTNA 1PH9A 2G5DA 3DMUA 3KFUA 1EY9A 3I4MG 1TY0A 1A63A 2I5MX 4ZYSA 1KRSA 5CC4A 4X3SA 1DOLA 2EJFC 1XNQQ 3R2IA 3KLRA 3HOUG 5CV7A 1LTID 3S2HB 3DWPA 3RZOH 2XWJB 5T1IA 4IO9A 4X3TA 3T1YL 2KUMA 1SYBA 4BA1I 4JW0A 2JEAI 1S4ZA 3E9IA 5C3WA 3FP9A 4XQJA 2AQ2B 5LMNW 3RLFA 4JBMA 3S1MH 2KCMA 3KF6B 5BN3A 1KAWA 1C4QA 4LFAL 3I4NB 2AWOA 4G7ZC 3BZKA 3FPPA 3G6EA 3U9OA 4DU9A 3MXNB 1RIPA 3MEFA 1G51A 4A3DG 3IL8A 1HUMA 2OQ0A 2IX1A 1FR3A 1GUWA 1XNRQ 2AKWB 3BYTB 4FF1A 1OXVA 2E2HB 5J1ZA 2RA4A 5BR8L 2A6ED 1EYGA 5KGUA 5FJ8H 2L1BA 2A5HA 3GTPH 1L0XB 1SNDA 4BA2I 2PMZB 4MN3A 1X3GA 5KNCA 4UP7A 2HCIA 1PTOH 1SFOH 1LYLA 4L6TB 2SNSA 2F0LA 2EYJA 3ND8A 1YITA 4KJOA 3CCUA 2K03A 3KF8B 1S5FD 5L37A 2EDGA 4DK6C 2UXDQ 3EIVA 4RH6A 3L7ZC 4ILWA 4XTCS 5C4HA 1MJCA 1UEAB 2L9HA 1VF7A 3PO3B 2RQXA 3NQTA 3AFPA 4LUVA 2AUKA 3SK5A 3KDFA 4M1UB 3SK8A 1EY7A 1PH3A 2F0NA 1AW7A 1EUJA 1GXDC 1EY6A 1O80A 1SNPA 5JPMC 3T51B 4BBRG 1L1OB 2JXMB 2EPBA 2EYPA 4JI4L 1HFNA 2PI2A 4DV6L 2PQEA 4JG2A 4DAPA 4HSPA 3SXHA 1OXTA 4QL5A 4PZ6A 1TS5A 3G48A 3E0EA 3OSOA 4JI7L 2O2LD 2WAQB 1TWGB 4DAVA 2QILA 3FEWX 5IYBH 1WTXA 4MZ9A 1KLUD 2H1EA 3U58A 2JK8A 4L8JA 3H0GH 1VQCA 2EY1A 5LL6X 4IFDJ 2QF7A 4A3KG 1HNXQ 3CKIB 1XPUA 2O4XA 3FPUB 2CFMA 1SJHD 2Z6BA 4KN7C 4HMJA 1J8IA 3GTGH 3M7NA 4XT3B 4LK1C 3SK4A 3L0OA 1SXTA 1WCMG 2OXPA 1YNJD 1NY4A 3MHBA 1Y8NB 2F0JA 4B3TL 1EYAA 2VY3A 2B2VC 3HGBA 3TQYA 4MTKA 3ER0A 1AFPA 2J7ZA 3T13A 4TRDA 4K6DA 5C4XB 1PFMA 2ATWA 1D5MC 1B53A 3WDNA 2Q2HA 4R9WA 3C3LA 5M5XB 1GUTA 3EBEA 5FO8B 5K36G 1SEBD 3A7AB 4DR1L 2B2WC 1H9KA 4DR6Q 3AQQA 1WD0A 4DV2Q 2K33A 3GO5A 2ASBA 2KCNA 1IBML 4JI3L 5KNDA 4KY6A 1TWAB 4WJ3M 1TU2B 4AYBG 2MO1A 5CBAE 2XRSD 5C0XH 3MXUA 3UDXA 3NQIA 3E3XA 2B3GA 5EBDA 4IOCA 1EIHA 3PF5A 1S72A 1BQQT 2AWNA 2YYZA 1EIYB 3S2DB 4OIJA 4C1NK 2KJXA 4O1NA 3V2TA 5IGDA 1HA5A 4B9WA 3BDOA 2EY2A 4K2KA 3KYHC 1A3VA 5M3FB 1U4RA 1X65A 2UXCQ 1E22A 4LF7Q 2EZVA 4LFBQ 2CH4W 1N32L 4GS3A 4IUNA 4HR7B 3OYYA 1STNA 5JJLA 1O7ZA 4RCOA 1H9MA 4JI6L 3CRKC 4GLVB 4I7AA 4K2LA 4ZRZA 2PNHA 3A55A 3A8KE 3OPOA 1E2VA 2ZM6L 3I4OA 3CAMA 4C1NI 2SEBD 1BCPF 2NVTH 3L3OC 1VQIA 2J0TD 4TVAB 3IFTA 2NTTA 4IURA 2PQAB 4P74A 4APVA 4GLXA 4BS9A 4CDCC 2B2YA 3I4LA 4A93B 3H6MA 1SLJA 3KBGA 3NHHA 4GOPB 5KYLA 1YHBA 1Z47A 1HNWQ 3RZOB 1ICFB 4UY8C 1STEA 3AU7A 1QNUA 4QUFA 1IKMA 1DZ1A 4OO1I 5IWAQ 1YIJA 2E2IB 1XXGA 2F03A 3CC2A 5CYUA 1DGSA 3I3CA 1CHQD 2VQEQ 5FO7B 4QUCA 4DV5Q 4X62Q 1GM5A 2XSCA 1NSNS 1QJOA 4E6IA 3I73A 2NB0A 3NP8A 3SDZA 3Q24A 2H4OA 1XNQL 2BCOA 3KLWA 1B7YB 3HOZB 4A3CG 4CDDC 2RDHA 1A3UA 4IALA 3MEHA 2PW5A 3DXJC 5C44H 4A3MH 2WFWA 3NTKA 3K0XA 4B3SQ 4FF2A 5HURA 2CKZB 4DA2A 2VW9A 1EQRA 1BXTA 3OIQA 1V8QA 4ZAIA 5IY0A 1EY0A 1QZHA 5EJWA 5K5PA 1ESRA 1PFSA 3I72A 1WTRA 4LF8Q 1EYDA 3CC4A 4GOPC 3S14H 5FLXE 1PTOB 4QF4A 3V96A 1SFOB 2EVBA 1VQ6A 1RTOA 2Z6KC 3GD7A 1QWYA 1XNRL 3A5ZB 2JA6B 1PV4A 2C35B 2WB1E 2R92G 1QILA 1SYDA 1JMCA 1IYUA 3STBD 3CMAA 1WI5A 3AFQA 4ZUIA 1PZKD 4K14A 2ZJPA 4QMGA 1EOTA 1MBYA 1QG7A 2EY6A 4C3HG 2B2TC 4X66Q 4HAEA 3F1ZA 1WTVA 5IYDH 1B9NA 2K50A 2HUGA 2F0VA 4ZQ3A 1CHPD 1GOZA 2QCPX 5D3DA 1O7IA 2OT2A 5TSSA 3BDLA 1PXUA 2N8NA 2AMCB 2CQOA 3H15A 2AHOB 4X64Q 3PF4A 1EWIA 2JA7H 1KABA 3PUYA 2A68C 3BZCA 3S2HH 1Y1WH 1V9PA 3PIO3 4A3JG 3SVMA 2EJGC 1PRTD 5C0XJ 2NZHA 3LWEA 1SBBB 2A1AA 3H0GB 2E76C 1EOVA 2F0HA 1PTOC 4C3JH 4EQPA 2CQAA 1EWCA 5ELFA 1K83H 1BOSA 4GKKL 3GTGB 1Z6HA 2JN4A 2GA4B 2MNAA 3VR5A 2B63G 2F0EA 3SK6A 3QG1A 3I4NH 4CJ1B 2DNEA 4K5XA 3HRZC 1U9RA 2Q8TA 1CQFA 1SNOA 4ABNA 2JA5H 2K5QA 1KNEA 5I9OA 2F0SA 3J7AF 1K8MA 1PMRA 2EYLA 3D4DA 2KECA 3MFGA 2E2HH 1FJGQ 1ENAA 1YBYA 1V1QA 2K32A 2XIWA 3ULPA 3GV6A 1XMOQ 2HDMA 4OWXB 1D8LA 3PV0A 1E2ZA 2F3WA 2X69A 2JA8G 1PA6A 4PV1C 1Q8KA 2PI2E 4C3IH 1Q90A 4AIMA 5IP9H 1MJEA 1IZ6A 3F2BA 3TZDA 2ZJQA 3ULJA 1IKLA 4QGUA 1B50A 5COYA 3CRLC 2QEXA 4KKTA 2RDGA 1LUZA 3GP7A 1T9HA 4JI4Q 1JT8A 3WOFA 5C6AA 1YHQA 3MTSA 1EU4A 3TS2A 4HIDA 1T5XD 2O5JC 1BR9A 4RWSC 2UU9Q 1HQRD 1WJJA 1EQQA 3FHWA 4DGZA 3QOLA 1AE2A 1PDQA 1GO3E 4WJ4A 4JOIC 1V1PB 4DR6L 5IGBA 1NAPA 4DV2L 1A8VA 1B3QA 5ELOA 3CCQA 1XPOA 1YVCA 5D65A 1XYIA 3PSIA 4KJNA 2YU9B 4KI0A 4P71A 4NXMQ 2F0MA 2ZXRA 1RL2A 1VMCA 2CW0D 1ENCA 2F0GA 4TSSA 4BBSH 3OWEB 1CKOA 3L9AX 2DNCA 2AQ3B 4DV7Q 1TWGH 3K7UC 1B4OA 3K8AA 2IT1A 4YY3Q 3NTIA 3C1FA 3Q22A 1F9QA 2CWPA 1HRJA 5ISRA 2BDNA 2NUCA 3TP7A 3CCLA 3HOYH 2PPBC 1NR2A 4G7HC 3PO3G 2UXCL 4HSVA 1VQ5A 4LF7L 4LFBL 5IYCG 4HMIA 2NVTB 3A8IE 4IJHA 3RNUA 1ZXTA 4KN4C 4A3IB 1HPCA 3GTJB 3FMCA 2FJ2A 4LF4Q 1MGSA 5FK9C 4X6AH 2I46A 4U68A 5M5WH 5C4XH 4FF4A 1G291 3TN2A 1VQOA 4BXXG 2WAQG 4GN3B 3UDFA 3UE0A 1F9PA 2I5LX 2RHQB 1SE2A 2X6GA 2X6LA 2R7ZG 2IY5B 2C5CA 2L0CA 4FVMA 1PRTF 5JEAH 2XWBB 2K14A 3FRPB 1KQSA 3PO2G 4KMUC 1NR4A 3S1QH 3TP8A 2HCCA 5IWAL 4DV0L 4K8IA 1I5FA 2B2YC 1D2BA 1BNZA 2VQEL 1SYCA 2WINB 3AB9A 3A7LA 1Y8PB 2RVLA 5FLXL 4DV5L 4FO2A 4X62L 3KLSX 2WACA 2ZJRA 2A6HD 3PGZA 3S2DH 1AZQA 2M00A 1KXLA 2LSSA 2N3SA 5HGQA 1CUKA 2C9OA 2A73B 1I4XA 1Y1VG 5M3FH 5KEEA 5IP7G 4QJFA 1FGBD 3G71A 4OX9Q 2K04A 4QIWB 1FL0A 5KIXA 3TRZA 2KHSA 4B3SL 1C9OA 4ME3A 3A54A 4Y52H 1NBWA 3I4MH 2IJ0A 1WTQA 2F0FA 4DV1Q 4I65A 4RMFA 1LACA 2B8FA 2KEDA 4LF8L 3RLNA 1LV9A 3M4YA 1W3SA 3H09A 1K73C 1VQHA 4IFDG 1SROA 2FMMA 4QB4A 4CJ2C 3I90A 3E9HA 1X3QA 1ZYRC 4I7ZC 2RCFA 4A3FB 4TKOB 1HQMC 4BWGB 1TS2A 5C5MA 4A93H 1R4PB 2KENA 2JA7B 1BCPB 1B1ZA 1QB5D 1Y1WB 1NMFA 1JORA 2NN6I 5I2YA 4X66L 1ZEQX 2YTYA 3GTMB 3PIPA 4JVZA 2E2IH 4JYAQ 2XNAC 4C3JB 2N88A 4KHPQ 4RHRA 3RD4A 4XT1B 4HCEA 3B6YA 2ID0A 4HTHA 5LHY1 1K83B 4N8FA 4A3DH 3CCJA 2KBNA 2EYOA 3P20A 4MNOA 3F8TA 3BS1A 2MFIA 4X64L 1KIXA 1EFID 1RHPA 5AFWA 3S16H 2JA5B 3HOZH 1HZCA 1P16A 3DUZA 1ESFA 4H44C 4DK1A 4YCUA 4V0BA 1BBXC 1F9SA 1BVSA 1I3QH 3RN5A 5IT9c 3QR8A 3ERSX 4LUZA 4QIWE 4A3LH 1I6HH 4BY7B 1NMGA 4WJWA 1HJPA 2F4IA 1E3PA 1U4MA 3S17H 3VR2A 1VQBA 4PZ8A 3W5OA 1PH1A 2OF1A 2XRQD 3ITPA 4C3IB 3CCVA 3TMEA 3MXPA 1IBLQ 4Y7NH 1BCPC 3NTHA 2B2UC 2XGTA 3HOWG 4K0KQ 2R7FA 2LXKA 2I5HA 1JJCB 1BKBA 3CF5A 1PZID 2ZXPA 4JBKA 1W6JA 1QUQB 5DEHA 4JI8Q 4RHSA 1STGA 3DHQA 3U9SA 5CV4A 2N55A 2FMCA 2JA6H 5A35A 4LF9Q 4BBRH 1FJGL 2MO0A 3J7YW 4QY7A 5JVG3 1CKNA 3KOJA 1XMOL 1K8AC 2L15A 2BH2A 1DOKA 1I50H 1ICWA 1ET9A 1U4LA 1RKNA 5CMDA 4XIGS 1F2LA 4CBVA 3TEHB 1QZGA 2DN8A 2F52A 1JWMD 2TMPA 5FJ8G 2VS1A 1X9NA 2IHEA 1LABA 3VA5A 5IGEA 1E2WA 5ELDA 1JB3A 2K6AA 5JEAJ 4F8MA 4GKKQ 1IW7C 4BBSB 2R93H 3TS0A 4DPGA 1N36Q 4YHHQ 2Z9HA 3H3VI 2ENBA 4JK1C 2EE1A 5ELCA 3UE1A 5LMUQ 4OL7A 2UU9L 2Y0SG 3AEVA 1YJWA 3JAMc 1CKMA 1K0SA 4DAYB 1A2UA 3C2PA 4ULLA 1X32A 2MP1A 1NCVA 4JBJA 2D62A 2EY5A 3HOYB 4RKBA 2VQFL 1NE3A 1N9WA 4OWWB 1VQGA 2F0OA 4NXML 4GNXB 2V4DA 4C56C 3VYSA 4P73A 1GHKA 5E1FA 3OHXC 2NTSA 1PH7A 4IUVA 2DJGC 2JE6I 4OHJA 2QKIC 1LT3D 3M9BA 1EIFA 3Q6SA 5LL6S 4DV7L 1ET6A 4ME5A 4OO1H 4JI5Q 4YY3L 5IODA 2G9DA 5M5WB 3VR3A 1AE3A 1FNUA 4LMQD 3QJYA 4P72A 1PFBA 1Y14B 5IYBG 1EYCA 1WTWA 3SE0A 3M3YB 1TVXA 3H0GG 1D7QA 4YCVA 4H02A 3PMFA 4G57A 1B44D 2JYOA 1UE1A 3J80c 2K5VA 1DONA 3M85A 2BA0A 1GUSA 3K7AB 4LF4L 1IXRA 2WKDA 4YWLA 1AEXA 3S1QB 4EQ5A 1SMYC 4IPCA 1HZAA 2IX3A 2K1BA 3GTQB 1N34Q 4XYQA 5JJIA 4GNXC 1TKWB 1UE5A 1SDFA 4IPDA 4GN5A 3OW7A 5M5YH 2EOTA 1MSGA 3W1GA 3QO2A 1NTGA 1PH6A 4BY1B 3VR4A 5EKKA 2VUMB 2YU9H 3L2PA 1LT5D 1HH2P 2FFKB 1ILQA 2RCNA 1MSHA 4ODGA 1I6VC 5J39A 3I4MB 1X55A 4L5RC 4PNYA 2MGSA 5C0XG 2IWHA 5ELEA 1K3BC 1DCZA 2VZAA 3H91A 4G7OC 4FXGC 3PUVA 5EKIA 1YNNC 1Q12A 2NVXB 3ND9A 4DR7Q 1O78A 1OTCA 4LFCQ 4CKBA 3P7JA 2WB1B 4OX9L 2CCZA 3O13A 4A3IH 5GAGC 4EVOA 2Z1CA 1MHWC 1I4PA 1Q82C 1SYGA 3VYRA 4F88A 3GTJH 4Z9CB 4DF7A 4LNQA 3A5UA 1SE4A 4J8QA 1HNZL 5JAVA 1I4RA 3T1HQ 2BDOA 2YTVA 4DV1L 4MIUA 4DV0Q 1OXSC 2Q2TA 1E1TA 1UWVA 2KVMA 4NXNQ 4IOAA 4JCVE 2NVYH 5IOCA 3TREA 3K5OA 4DNIA 1K8GA 1TS4A 3UDGA 4A3DB 1WYDA 1B3AA 3W3AA 3HOXH 2HQEA 3S15B 3ZJYC 5E7NA 4G4KA 3VDYA 3IKJA 1PFNA 4HIKA 4A3EG 2J4XA 3S16B 1IL2A 4JI2Q 3HKZE 1ILPA 1A3TA 1EQTA 3X3NA 1EY4A 3D4RA 3VYTA 3OIPA 3FKIH 1FNWA 4JYAL 5JPNC 5CORA 4PMWA 3R93A 4KHPL 1I3QB 1Z7TA 2EIFA 1JICA 1I6HB 1HFGA 3SR1A 4FXDA 1QE6A 2D0OA 1K9MC 3QIAA 1DM0B 3S17B 4JV5L 3MWYW 2F0QA 4Y7NB 4EGVA 2L11A 1PHJA 1F77A 4M8AA 3NSWA 4DXGA 5M3MH 3BG3A 3KDFB 3M7GA 1ONLA 3S1NH 1S5DD 4BBRB 1G2TA 1Q7YC 1FNVA 2WKCA 4IJLA 3HOVH 2B8GA 2D9UA 2K7VA 1VCIA 1I50B 4DK0A 1L0YB 1U5KA 2G9HD 1E7ZA 4NMZA 5T1GA 5FOBB 5C44G 4A3MG 1HR0L 4RGMA 1JJGA 1BBWA 1IBLL 2K5NA 4PQXA 3R8BA 4K0KL 4DNRB 1KTKA 1VMPA 1NJIC 3K5LA 4KV6A 1VQPA 2R93B 2BOSA 4JI8L 4Q5VA 4DUYQ 4A3FH 1HHVA 2LKVA 3Q23A 4R4CA 4LF9L 4V190 1KHIA 2RSOA 3J81c 2A19A 3ONAB 4RGNA 4FF3A 1D5XC 1LTRD 4DR3L 3I7FA 2JP1A 1WTHA 4P2CB 5FLMG 3GTMH 1FGUA 1KLGD 4YWMA 2WV6D 1GHJA 1WCMB 2KEEA 4IZ8A 2UUBL 3CD6A 1BO0A 1C48A 2A69C 1Q1EA 1L0WA 2GVAA 4R4IA 1N36L 4UPAA 5IYDG 4YHHL 1GJXA 1R4QB 2ICEC 4RFBA 4A3GH 3GTKB 1U4PA 3SGIA 5LMUL 1C7YA 3M4OH 1X56A 4L5TA 1LLRD 1XPRA 3D3RA 2IPKD 2F4VQ 1S5BD 1S5ED 2HIVA 1A6XA 2JA7G 4J15A 4ZLTF 3GTLH 1Y1WG 1EY8A 1SNCA 4GN4B 1ASZA 4BY7H 1GUGA 1KC8C 1EY5A 1EEFD 4K6LA 2F0WA 5DM63 3I70A 1PTOD 4IUPA 5GAHC 3CMEA 1WD1A 3DM1A 1BBUA 1RCVD 3J7ZC 1ENFA 3W2DA 5EQ0A 2F0UA 5EBCA 3KF6A 2E75C 4JI5L 2Y0SE 1R9TB 3I4NG 3H94A 3MXNA 3LNNA 3PQIA 3HZXA 2JA5G 1LT4D 3DM3A 1LM0A 2Z0SA 1Y8OB 1J6QA 5KYIA 5M5YB 3F2UA 1W6KA 1KDAA 3UDIA 4LW1A 2DY7A 5IGGA 2JJQA 4X65L 2BA1A 2B39A 4R8NA 2VQFQ 1XMQQ 3A56A 4C3IG 3UI2A 5IP9G 1A2TA 4FDBA 3X3MA 1YNXA 3EA6A 2Z4HA 1YEZA 1DOMA 3FVQA 3KF8A 3T4AC 1N34L 2HD3A 4OWTB 5C3XA 3D4WA 1CZGA 4DFAA 1PH5A 1ASYA 4H13C 1WOCA 1JOOA 5FO9B 4O42A 5M9OA 4NW2A 2PNRC 1XWEA 4HN7A 1PYSB 1XTDA 3A0JA 2B2VA 3D0FA 4NDXA 1SYEA 3RN2A 1L1OA 4AYBE 1LTGD 3N6RA 1VQKA 5C3EH 4DN4M 2NN6H 3D6CA 2ZXOA 1LT6D 1JB7A 1JWSD 4BBSG 1SMXA 2RKSA 2SOBA 2B2WA 1IHZA 2JSOA 1IYVA 1TR5A 2R7ZH 3U4VA 1HR0W 2NVYB 5BN5A 1D6EC 1KAAA 4A3BH 2XN9C 4UHVA 4MTNA 4HJ7A 1RF2D 2R6GA 3CQZB
chains in the Genus database with same CATH topology
3HOXB 1UNSA 1QOHA 3OWFA 1G6ZA 3AMUA 3GTOB 1I4GA 3DWQA 4H0LC 3HG9A 4PMCA 3T53B 1O7YA 3FKIB 1HA6A 1BUVT 4CGYB 4J6HA 2SDFA 1K8OA 3KK7A 2K01A 4KY5A 1DXMA 5DNFA 2R92B 5EKLA 4K5VA 1UAPA 4RKLA 4XDXA 3BDCA 2L55A 4C3HB 5FKAC 5M3MB 3SHLA 1OXXK 1I4HA 1NUCA 1Q8IA 3S1NB 5JEAG 1PTOF 1M4VA 3HOVB 1PYWD 2BE5C 3BVZA 3C1EA 1RJTA 5CR3A 1CM9A 4EQNA 1SAPA 4KK7A 4KTAA 3URYA 2TSSA 3TP6A 4A3JB 2KOLA 2VB3X 4B08A 4K5WA 3NWTA 4PMBA 3NBHA 1CT1D 4ID6A 1CA6A 3VYUA 5G3LD 2CVRA 3PUWA 3E0JA 4RA8A 3EQLC 3KLSA 4WFN3 3V05A 4KKUA 2B63B 3DEOA 1PLFA 1JOKA 5C4JB 4UDUC 1JE4A 1H9SA 1SE3A 2PW7A 3LX0A 4OGQC 4WORA 2L4NA 4U673 2MHVA 1ZYRD 4A3GB 3M4OB 2A6EC 3MXGA 1G8ZD 4KD3A 1ML0D 2LMCB 1SNQA 2JA8B 1EEID 5CV5A 3CU7A 1GUNA 2NYZD 3D8GA 3GTLB 2PYKA 3G6JB 3A8JE 3EFXD 4HEDA 3HEJA 5EGTA 2L12A 2PZTA 2KCCA 2R61A 5IGFA 2B2TA 5JOBA 2FHTA 3K5NA 3TSSA 4KY7A 3QWNA 1AP0A 4KHVA 2CHBD 2RSNA 3J7AV 1VF5C 1FD7D 4IFDI 3N52A 1O7LA 5C4ZA 5I2XA 3VR6A 1H9JA 1STHA 4H7BA 1E0BA 3K58A 1LTBD 3KUPA 4OIKA 3LWUA 5IT9L 5I9PA 1II3A 3OMCA 1G91A 1BCPD 3BZDB 3HS0C 1KDCA 2F0DA 1VDZA 1D1KA 4DXFA 5JVH3 3RZDB 2LFNA 1F9RA 2DY8A 4KHZA 1RD9D 4Q0FA 4GZYC 1CQVA 1CK1A 1SYFA 4RGOS 1YNJC 5ELBA 3TP5A 5KRUA 1RODA 1ZKOA 3BYYB 1Y69U 5C3EB 1IW7D 3K0YA 5EPLA 3HP3A 1OO9B 2WIIB 5K36H 3SEBA 2F0PA 2R7ZB 1LTSD 2KQ3A 2LS01 3PIP3 2KA7A 4X3KA 4XQQA 5G3LF 4A3BB 3PO2B 3E5SA 1F2ZA 4UAIA 2NVQB 1LTAD 1Q1BA 2Q8IB 1LO5D 3JAML 1TS3A 1S5CD 3J81E 3EJIA 4ZUJA 2JEBI 2ICIA 1EQVA 1EZ8A 3PUXA 5BN4A 2OEOA 1IL8A 1Y1VB 1TWCB 4EQOA 1A15A 1I4QA 2EYHA 3NK9A 1JWUD 4OO1G 2RDFA 2QEJC 2F1MA 5HGTA 3IFDA 1D1IA 4FYDA 3MFYA 3HKZB 1SJED 3WOEA 4R8IA 2PCFB 5E3FA 2Z8LA 3EVQA 5F2DA 3FDTA 2QDBA 2FINB 5I4DA 1JOQA 5A2QL 4S3SA 3BVMA 1SMYD 5IIFA 3J80L 2Z4IA 2XVSA 1TWHB 1JCKB 3Q0AA 4IUQA 3HOUB 1M8AA 3T56B 5J22A 3NPPA 1STAA 3D31A 3T16A 1V1PA 4CKEA 4HCSA 4F87A 2Q8RE 2ZT9C 5CV9A 4B9XA 2NWGA 4LJZC 1EL0A 2EYMA 1EZ6A 1TWFB 4WRDA 1TT2A 1H9SB 4N9TA 3MA2B 3K5MA 3NWSA 1DYQA 4YIJA 1SSOA 3NE5B 5E4XA 2M2LA 5C5LA 1D5ZC 1F2MA 1KDBA 1TY2A 3MZ5A 1YNND 5DAUA 2EXZA 3QB3A 3ZYYX 3OMGA 1PRTB 1EWHA 1XX8A 3HOWB 4IQZA 3S1MB 2AUJD 2AQ1B 4JBWA 4FP5D 5NUCA 3H3VC 1CZWA 1WTOA 1SNMA 1AZPA 1HUNA 1TIID 4CHTB 2NBFA 5C0XI 2IX0A 3GTPB 5D3IB 5CV6A 3P75A 4LAAA 1RDPD 1G2SA 4QCLA 2Y0SB 3C46A 1PRTC 3TBIB 1STYA 1JR0D 4A3KB 2MJ8A 1AN8A 4ZK9B 5KNBA 1F2YA 4CKCA 3VA7A 4F7XA 3K6OA 4J1MA 2K28A 3BVGA 4ZKCB 3S9WA 2EJMA 3E6ZX 3PUZA 4TQUS 4L63B 3MAQA 2WP8J 4KD4A 1WVLA 1BDOA 1X3PA 3GV3A 2PZUA 3QOJA 2B2UA 2K05A 2A68D 5CGKA 4IUUA 4XYOA 2I07B 1LTTD 3OOCA 3J81L 2F3VA 4AYBB 4C3JG 3DWAA 3EROA 2K5DA 4X3UA 3ERQA 2A69D 3MC0B 1C8CA 2VXWA 1J9OA 1CTMA 5D14A 3NBIA 1HXYD 4K8JA 2F0TA 3I91A 5JJZA 3GQBA 1TQOA 2SNMA 2CW0C 2E2DC 1JQYD 4KKSA 1EIGA 1XTCD 3RMHA 1CA5A 2EYFA 1HTLD 2L5TA 5E4WC 2LY7A 1FYCA 3MVVA 5IT9E 4FXKC 4RGTA 4NKLA 3TDQA 2NZ1D 1MI2A 4MHEA 3CHBD 3RUZA 1KNAA 4IN3A 2MUYA 2PO4A 2F0KA 2D5DA 5CBEE 4DNTB 5IGCA 1HCZA 1BF4A 1PZJD 1DJRD 2IW3A 4IUTA 4XXEA 1HTPA 2E74C 1QNKA 1CFMA 1T5EA 1OXUA 1DD2A 5CV8A 1UUPA 4A3EB 1V43A 2O5IC 4DAYA 5DM73 3IAYA 3D6WA 1JC7A 2VB2X 1V1OA 3R2TA 2A74C 4RAUC 3JAME 4ZKBB 2R3ZA 1H9RA 2A6HC 2E2JB 3I8ZA 1EU3A 3TZUA 2NN6G 2RBMA 2PZWA 2MPMA 3P1HA 3K59A 1QCBD 5C44B 5EPJA 4A3MB 3NXWA 1B2TA 2IL8A 1CI3M 4FNFA 4C2MB 3NUCA 4IFDH 3KBXA 1GUOA 1WTPA 2K5WA 4CJ0B 3S14B 5I6WA 5A2QE 1STBA 2HDLA 3J80E 4N9PA 2VNUD 1Q3LA 5EPKA 3G7LA 3R3OA 4NP5A 1B9MA 2F0IA 4XQNA 4RCNA 3K57A 3DEPA 5I6YA 1MD2D 2M9VA 3S1RB 2D2CC 2BE5D 1RTNA 3DMUA 1EY9A 1TY0A 4ZYSA 5CC4A 4X3SA 1DOLA 2EJFC 3R2IA 3KLRA 5CV7A 1LTID 3S2HB 3DWPA 2XWJB 5T1IA 4X3TA 2KUMA 1SYBA 4BA1I 2JEAI 1S4ZA 5C3WA 4XQJA 2AQ2B 3RLFA 5BN3A 1C4QA 3I4NB 2AWOA 4G7ZC 3FPPA 3U9OA 4DU9A 3IL8A 1HUMA 2IX1A 1FR3A 1GUWA 4FF1A 3BYTB 1OXVA 2E2HB 5J1ZA 2RA4A 2A6ED 5KGUA 2L1BA 2A5HA 1L0XB 1SNDA 4BA2I 2PMZB 4MN3A 5KNCA 2HCIA 1PTOH 4L6TB 2SNSA 2F0LA 2EYJA 3ND8A 4KJOA 2K03A 1S5FD 2EDGA 4RH6A 3L7ZC 4ILWA 4XTCS 5C4HA 1UEAB 2L9HA 1VF7A 3PO3B 2RQXA 3NQTA 2AUKA 3SK5A 4M1UB 3SK8A 1EY7A 2F0NA 1AW7A 1GXDC 1EY6A 1O80A 1SNPA 5JPMC 3T51B 2JXMB 2EPBA 2EYPA 1HFNA 2PQEA 4DAPA 4HSPA 3SXHA 1OXTA 1TS5A 3OSOA 2O2LD 2WAQB 1TWGB 4DAVA 2QILA 3FEWX 1WTXA 1KLUD 2H1EA 4L8JA 2EY1A 5LL6X 4IFDJ 2QF7A 3CKIB 2O4XA 3FPUB 1SJHD 4KN7C 4HMJA 1J8IA 3M7NA 4XT3B 4LK1C 3SK4A 1SXTA 2OXPA 1YNJD 3MHBA 1Y8NB 2F0JA 1EYAA 2B2VC 3HGBA 1AFPA 2J7ZA 3T13A 4TRDA 4K6DA 5C4XB 1PFMA 1D5MC 1B53A 3WDNA 4R9WA 3C3LA 5M5XB 1GUTA 5FO8B 5K36G 1SEBD 3A7AB 2B2WC 1H9KA 1WD0A 2K33A 3GO5A 2KCNA 5KNDA 4KY6A 1TWAB 1TU2B 5CBAE 2XRSD 5C0XH 3MXUA 3NQIA 1EIHA 5EBDA 1BQQT 2AWNA 2YYZA 3S2DB 4OIJA 4C1NK 2KJXA 4O1NA 3V2TA 5IGDA 1HA5A 4B9WA 3BDOA 2EY2A 4K2KA 1A3VA 5M3FB 1U4RA 2EZVA 4IUNA 4HR7B 1STNA 1O7ZA 4RCOA 1H9MA 3CRKC 4K2LA 4ZRZA 3A55A 3A8KE 3OPOA 1E2VA 4C1NI 2SEBD 1BCPF 3L3OC 2J0TD 3IFTA 2NTTA 4IURA 4BS9A 2B2YA 3I4LA 4A93B 3H6MA 3KBGA 3NHHA 5KYLA 1Z47A 3RZOB 1STEA 3AU7A 1QNUA 4QUFA 1IKMA 1DZ1A 4OO1I 2E2IB 1XXGA 2F03A 5CYUA 3I3CA 1CHQD 5FO7B 4QUCA 2XSCA 1NSNS 1QJOA 4E6IA 3I73A 2NB0A 3NP8A 3SDZA 3Q24A 2H4OA 2BCOA 3HOZB 2RDHA 1A3UA 4IALA 3MEHA 2PW5A 3DXJC 3NTKA 4FF2A 5HURA 4DA2A 1BXTA 3OIQA 1V8QA 4ZAIA 1EY0A 5EJWA 5K5PA 1ESRA 3I72A 1WTRA 1EYDA 5FLXE 1PTOB 4QF4A 3V96A 1SFOB 2EVBA 1RTOA 3GD7A 1QWYA 2JA6B 1QILA 1SYDA 1IYUA 4ZUIA 1PZKD 4K14A 4QMGA 1EOTA 1MBYA 1QG7A 2EY6A 4C3HG 2B2TC 4HAEA 1WTVA 1B9NA 2HUGA 2F0VA 4ZQ3A 1CHPD 1GOZA 2QCPX 5D3DA 2OT2A 5TSSA 3BDLA 1PXUA 1KABA 3PUYA 2A68C 3PIO3 3SVMA 2EJGC 1PRTD 5C0XJ 3LWEA 1SBBB 3H0GB 2E76C 4EQPA 2F0HA 1PTOC 2CQAA 1EWCA 5ELFA 1BOSA 3GTGB 1Z6HA 2GA4B 3VR5A 2F0EA 3SK6A 3QG1A 4CJ1B 2DNEA 4K5XA 3HRZC 1U9RA 2Q8TA 4ABNA 1CQFA 1SNOA 2K5QA 1KNEA 5I9OA 2F0SA 3J7AF 1K8MA 1PMRA 2EYLA 3D4DA 2KECA 3MFGA 1ENAA 2K32A 2XIWA 3GV6A 2HDMA 3PV0A 1E2ZA 2F3WA 2X69A 4PV1C 1Q90A 3TZDA 1IKLA 1B50A 5COYA 3CRLC 4KKTA 2RDGA 3GP7A 3WOFA 5C6AA 3MTSA 1EU4A 1T5XD 2O5JC 1BR9A 4RWSC 1HQRD 4DGZA 3QOLA 1PDQA 1V1PB 5IGBA 1NAPA 5D65A 1XYIA 4KJNA 2YU9B 4KI0A 2F0MA 2ZXRA 1VMCA 2CW0D 1ENCA 2F0GA 4TSSA 3OWEB 3L9AX 2DNCA 2AQ3B 1B4OA 2IT1A 3NTIA 3C1FA 3Q22A 1F9QA 1HRJA 5ISRA 2BDNA 2NUCA 3TP7A 2PPBC 1NR2A 4G7HC 4HSVA 4HMIA 2NVTB 3A8IE 1ZXTA 4KN4C 4A3IB 1HPCA 3GTJB 3FMCA 2FJ2A 1MGSA 5FK9C 2I46A 4U68A 4FF4A 1G291 3TN2A 1F9PA 1SE2A 2X6GA 2X6LA 2C5CA 2L0CA 4FVMA 1PRTF 5JEAH 2XWBB 3FRPB 4KMUC 1NR4A 3TP8A 2HCCA 4K8IA 2B2YC 1D2BA 1BNZA 1SYCA 2WINB 3AB9A 3A7LA 1Y8PB 2RVLA 5FLXL 4FO2A 3KLSX 2WACA 2A6HD 1AZQA 2M00A 2C9OA 2A73B 1I4XA 5KEEA 1FGBD 2K04A 4QIWB 5KIXA 2KHSA 3A54A 2IJ0A 1WTQA 2F0FA 4I65A 1LACA 2B8FA 2KEDA 1LV9A 3M4YA 3H09A 4IFDG 2FMMA 4QB4A 4CJ2C 3I90A 1X3QA 1ZYRC 4I7ZC 4A3FB 4TKOB 1HQMC 4BWGB 1TS2A 5C5MA 1R4PB 2JA7B 1BCPB 1B1ZA 1QB5D 1Y1WB 1JORA 2NN6I 5I2YA 1ZEQX 3GTMB 2XNAC 4C3JB 2N88A 4RHRA 3RD4A 4XT1B 4HCEA 2ID0A 4HTHA 5LHY1 1K83B 2EYOA 3P20A 3BS1A 1EFID 1RHPA 5AFWA 2JA5B 3DUZA 1ESFA 4H44C 4DK1A 4V0BA 1BBXC 1F9SA 4BY7B 4WJWA 2F4IA 1U4MA 3VR2A 2OF1A 2XRQD 3ITPA 4C3IB 3TMEA 3MXPA 1BCPC 3NTHA 2B2UC 1PZID 2ZXPA 1W6JA 5DEHA 4RHSA 1STGA 3DHQA 3U9SA 5CV4A 2N55A 2FMCA 5A35A 3J7YW 5JVG3 1DOKA 1ICWA 1ET9A 1U4LA 1RKNA 5CMDA 4XIGS 1F2LA 4CBVA 2DN8A 1JWMD 2TMPA 1LABA 3VA5A 5IGEA 1E2WA 5ELDA 1JB3A 2K6AA 4F8MA 5JEAJ 4BBSB 1IW7C 2ENBA 4JK1C 2EE1A 5ELCA 4OL7A 1A2UA 3C2PA 4ULLA 1X32A 2MP1A 1NCVA 2D62A 2EY5A 3HOYB 4RKBA 2F0OA 2V4DA 4C56C 3VYSA 1GHKA 5E1FA 3OHXC 2NTSA 4IUVA 2JE6I 4OHJA 2QKIC 1LT3D 5LL6S 3Q6SA 1ET6A 4ME5A 4OO1H 5IODA 2G9DA 5M5WB 3VR3A 1FNUA 4LMQD 3QJYA 1PFBA 1EYCA 1WTWA 3SE0A 3M3YB 1TVXA 3PMFA 4G57A 1B44D 2JYOA 1DONA 3M85A 2BA0A 1GUSA 3K7AB 2WKDA 1AEXA 3S1QB 1SMYC 2IX3A 2K1BA 3GTQB 4XYQA 1TKWB 1SDFA 3OW7A 2EOTA 1MSGA 3QO2A 4BY1B 3VR4A 5EKKA 2VUMB 1LT5D 2FFKB 1ILQA 1MSHA 4ODGA 1I6VC 5J39A 3I4MB 4PNYA 2MGSA 5C0XG 2IWHA 5ELEA 3H91A 1DCZA 4G7OC 4FXGC 3PUVA 5EKIA 1YNNC 1Q12A 2NVXB 3ND9A 1O78A 4CKBA 3P7JA 2WB1B 3O13A 4EVOA 2Z1CA 1I4PA 1SYGA 3VYRA 4F88A 4Z9CB 4DF7A 1SE4A 4J8QA 5JAVA 1I4RA 2BDOA 4MIUA 1OXSC 2KVMA 5IOCA 3K5OA 1TS4A 4A3DB 1B3AA 3W3AA 2HQEA 3S15B 4G4KA 3IKJA 1PFNA 2J4XA 3S16B 1ILPA 1A3TA 1EQTA 3X3NA 1EY4A 3D4RA 3VYTA 3OIPA 1FNWA 5JPNC 5CORA 4PMWA 3R93A 1I3QB 1Z7TA 1JICA 1I6HB 1HFGA 3SR1A 4FXDA 1QE6A 3QIAA 1DM0B 3S17B 3MWYW 2F0QA 4Y7NB 4EGVA 2L11A 1F77A 4M8AA 3NSWA 4DXGA 3BG3A 3M7GA 1ONLA 1S5DD 4BBRB 1G2TA 1FNVA 2WKCA 2B8GA 2D9UA 2K7VA 1VCIA 1I50B 4DK0A 5FOBB 1L0YB 2G9HD 4NMZA 5T1GA 4RGMA 4PQXA 3R8BA 4DNRB 1KTKA 1VMPA 3K5LA 4KV6A 2R93B 2BOSA 4Q5VA 1HHVA 2LKVA 3Q23A 4V190 2RSOA 3ONAB 4RGNA 4FF3A 1D5XC 1LTRD 2JP1A 4P2CB 1KLGD 2WV6D 1GHJA 1WCMB 2KEEA 4IZ8A 1BO0A 1C48A 2A69C 1Q1EA 1GJXA 1R4QB 2ICEC 4RFBA 3GTKB 1U4PA 1LLRD 3D3RA 2IPKD 1S5BD 1S5ED 1A6XA 4ZLTF 1EY8A 1SNCA 1GUGA 1EY5A 1EEFD 4K6LA 2F0WA 5DM63 3I70A 1PTOD 4IUPA 1WD1A 3DM1A 1RCVD 1ENFA 3W2DA 5EQ0A 2F0UA 5EBCA 2E75C 1R9TB 3H94A 3MXNA 3LNNA 3HZXA 1LT4D 1Y8OB 5KYIA 5M5YB 3F2UA 1W6KA 1KDAA 2DY7A 5IGGA 2BA1A 2B39A 4R8NA 3A56A 4C3IG 3UI2A 1A2TA 3X3MA 3EA6A 2Z4HA 1DOMA 3FVQA 3KF8A 3T4AC 5C3XA 3D4WA 1CZGA 4DFAA 4H13C 1JOOA 5FO9B 4O42A 5M9OA 4NW2A 2PNRC 1XWEA 4HN7A 2B2VA 4NDXA 1SYEA 1LTGD 3N6RA 4DN4M 2NN6H 3D6CA 2ZXOA 1LT6D 1JWSD 2RKSA 2SOBA 2B2WA 1IHZA 2JSOA 1IYVA 1TR5A 2NVYB 5BN5A 1D6EC 1KAAA 2XN9C 1RF2D 2R6GA 3CQZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUK A;  3D4R A;  1A6X A;  4OGQ C;  3M85 A;  2BA0 A;  1GUS A;  1B9M A;  3GD7 A;  5K36 H;  2A6H D;  2EJM A;  1GUG A;  2D5D A;  2O5J C;  3PUZ A;  4TQU S;  1Z7T A;  4DNT B;  2A6E C;  1HCZ A;  1SMY C;  3T51 B;  2LMC B;  3NE5 B;  1IYU A;  4HR7 B;  2KA7 A;  4RCN A;  2JXM B;  2D2C C;  2BE5 D;  1HTP A;  4H0L C;  1H9M A;  2E74 C;  3QIA A;  1GUN A;  3T53 B;  3U9S A;  3CRK C;  1CFM A;  1T5E A;  1OXU A;  1DD2 A;  5A35 A;  1TKW B;  1BDO A;  1OXT A;  2E75 C;  3A8J E;  1Q1B A;  1V43 A;  3A8K E;  2Q8I B;  3OW7 A;  4KI0 A;  1B9N A;  2O5I C;  3OPO A;  2EJF C;  1E2V A;  2A68 D;  3H94 A;  1K8O A;  3KLR A;  2JEB I;  3LNN A;  4L8J A;  4XIG S;  3BG3 A;  1DXM A;  1EWH A;  1ONL A;  2DN8 A;  2KCC A;  2DNC A;  3VR4 A;  2QF7 A;  3OOC A;  4IQZ A;  1LAC A;  4BA1 I;  2AUJ D;  2B8F A;  3PUX A;  3IFT A;  5BN4 A;  1Y8O B;  2JEA I;  2IT1 A;  2B8G A;  1LAB A;  3M4Y A;  2K7V A;  4JBW A;  3PUY A;  1E2W A;  1VCI A;  4KN7 C;  2A68 C;  3I4L A;  4DK0 A;  1IW7 C;  1I6V C;  4IFD G;  4OO1 G;  3M7N A;  2A69 D;  2EJG C;  3RLF A;  4LK1 C;  1H9R A;  2A6H C;  1OXX K;  2BA1 A;  2E76 C;  1ZYR C;  2F1M A;  4I7Z C;  2PPB C;  1VF5 C;  4G7H C;  5JEA G;  3TZU A;  4TKO B;  5BN3 A;  1HQM C;  3A8I E;  1CTM A;  2NN6 G;  4JK1 C;  4DNR B;  5C0X G;  3MFY A;  1Y8N B;  2AWO A;  4KN4 C;  1DCZ A;  1O7L A;  2BE5 C;  4G7Z C;  3FPP A;  4G7O C;  2PCF B;  3PUV A;  3VR6 A;  1HPC A;  1YNN C;  1H9J A;  3HGB A;  1Q12 A;  1Z6H A;  3FMC A;  2NN6 I;  3ND9 A;  1O78 A;  3GQB A;  3VR5 A;  2D62 A;  3QG1 A;  1FR3 A;  3WDN A;  1QJO A;  3LWU A;  2DNE A;  1OXV A;  2CW0 C;  4H13 C;  3I73 A;  1GUT A;  2V4D A;  3SDZ A;  5K36 G;  2A6E D;  4KKS A;  3A7A B;  1G29 1;  1K8M A;  1PMR A;  2PNR C;  1GHK A;  1CI3 M;  1H9K A;  2BDO A;  3P20 A;  2JE6 I;  1GHJ A;  1VDZ A;  4BA2 I;  2K33 A;  1OXS C;  5KNC A;  4IFD H;  2L5T A;  2K32 A;  3DXJ C;  3PUW A;  4OO1 H;  1GUO A;  1FYC A;  3EQL C;  2A69 C;  4KHZ A;  3T56 B;  5KND A;  1Q1E A;  3PV0 A;  1E2Z A;  3N6R A;  3VR3 A;  3ND8 A;  1TU2 B;  5JEA H;  4GZY C;  3QJY A;  4KKU A;  4H44 C;  3D31 A;  4DK1 A;  2NN6 H;  1V8Q A;  4PV1 C;  5C0X H;  3MXU A;  3W3A A;  1Q90 A;  1GJX A;  2EDG A;  2ZT9 C;  5KNB A;  1YNJ C;  4KMU C;  1IYV A;  1ZKO A;  4LJZ C;  1Y69 U;  3SE0 A;  3L7Z C;  3I72 A;  3VA7 A;  3IKJ A;  2YYZ A;  3CRL C;  4KKT A;  4XTC S;  1H9S A;  2EVB A;  5BN5 A;  1VF7 A;  1H9S B;  3AB9 A;  3A7L A;  1Y8P B;  3BDO A;  2R6G A;  3VR2 A;  1IW7 D; 
#chains in the Genus database with same CATH topology
 4DR7 L;  4LFC L;  3M3Y H;  1VQD A;  1UNS A;  3HOX B;  1QOH A;  1QVC A;  3IRB A;  3OWF A;  1G6Z A;  3HOY G;  2OTL A;  3AMU A;  2VL6 A;  3GTO B;  2V1C C;  1I4G A;  4DV4 Q;  2CWA A;  3DWQ A;  3K7A H;  4H0L C;  4R4Q A;  3T1H L;  1UEB A;  3HG9 A;  1VQN A;  4PMC A;  3T53 B;  1O7Y A;  2ZTE A;  4RG1 A;  4QQB X;  3FKI B;  2IHF A;  1BUV T;  1HA6 A;  4NXN L;  4CGY B;  1A0I A;  4J6H A;  2SDF A;  3M4Q A;  1SR3 A;  3GTQ H;  5IP7 H;  1K8O A;  3DLL A;  3HKS A;  3KK7 A;  2K01 A;  4DR4 Q;  4KY5 A;  1DXM A;  2DJF C;  5DNF A;  2R92 B;  5C4X G;  5EKL A;  1X6O A;  4K5V A;  1PH8 A;  1UAP A;  4RKL A;  4XDX A;  2RF4 A;  3BDC A;  2L55 A;  4JI2 L;  4C3H B;  4BY1 H;  5FKA C;  2VUM H;  5M3M B;  4O2D A;  3SHL A;  1OXX K;  1I4H A;  1NUC A;  1Q8I A;  3EN2 A;  3S1N B;  5JEA G;  1PTO F;  1M4V A;  3HOV B;  1PYW D;  2BE5 C;  3BVZ A;  3C1E A;  1RJT A;  3W1B A;  1HNZ Q;  5CR3 A;  2HHH Q;  1TWH H;  2HIX A;  1CM9 A;  4EQN A;  1SAP A;  4KK7 A;  2GN5 A;  4KTA A;  2RHS B;  5AJ3 Q;  3U4Z A;  3HOU H;  3URY A;  2TSS A;  3TP6 A;  4A3J B;  2KOL A;  2VB3 X;  3AYH B;  4B08 A;  2NVX H;  4K5W A;  1Q46 A;  3NWT A;  4PMB A;  1U0L A;  3NBH A;  1CT1 D;  4ID6 A;  1CA6 A;  3VYU A;  5G3L D;  2DUD A;  3H3V H;  2JA9 A;  2CVR A;  1KL9 A;  3PUW A;  5M3F G;  3E0J A;  4RA8 A;  3EQL C;  1TWF H;  3KLS A;  4WFN 3;  3V05 A;  3KJP A;  4KKU A;  2B63 B;  4KLK A;  3DEO A;  4JC0 A;  1VQ8 A;  1PLF A;  2HT1 A;  1JOK A;  5GRO A;  5C4J B;  4P75 A;  4UDU C;  4AQY Q;  1JE4 A;  1H9S A;  1SE3 A;  4JV5 Q;  4DUY L;  3S15 H;  2PW7 A;  3LX0 A;  1Q81 C;  4OGQ C;  4WOR A;  2L4N A;  4U67 3;  3CW2 C;  2MHV A;  1ZYR D;  4A3G B;  3M4O B;  2A6E C;  3MXG A;  1G8Z D;  2PQA A;  4KD3 A;  4A75 A;  1ML0 D;  2LMC B;  2WB1 G;  1SNQ A;  2JA8 B;  1EEI D;  1KRT A;  4AH6 A;  5GAD C;  5CV5 A;  3CU7 A;  4GOP A;  4A93 G;  4DAM A;  1I94 Q;  1B70 B;  2XTI A;  1GUN A;  2NYZ D;  3HOW H;  3D8G A;  3GTL B;  1VS0 A;  2PYK A;  2Z6K A;  3G6J B;  3A8J E;  4OEL B;  2EQS A;  4N8X 1;  3EFX D;  4HED A;  1A62 A;  3HEJ A;  1HR0 Q;  2F3I A;  5EGT A;  2L12 A;  2K5H A;  3RR5 A;  2PZT A;  2KCC A;  2R61 A;  1IYJ B;  3K81 C;  5IGF A;  2B2T A;  5JOB A;  2FHT A;  4GKJ Q;  3K5N A;  2A8V A;  3TSS A;  2F4V L;  4KY7 A;  3QWN A;  1AP0 A;  1WFQ A;  1VQJ A;  4KHV A;  2CHB D;  2RSN A;  3HOZ G;  3KJO A;  1VF5 C;  3J7A V;  1FD7 D;  1AH9 A;  4IFD I;  3N52 A;  1PH4 A;  4DR3 Q;  4JI0 Q;  1O7L A;  5C4Z A;  5I2X A;  3VR6 A;  1VQ9 A;  1H9J A;  2UUB Q;  4A3L G;  1STH A;  4H7B A;  1IBK Q;  1E0B A;  4DR5 Q;  1HZ9 A;  5GAE C;  3K58 A;  1LTB D;  3KUP A;  4OIK A;  1JJ2 A;  1Z9F A;  3LWU A;  5IT9 L;  3CPF A;  5I9P A;  1II3 A;  5JJK A;  3OMC A;  2OQK A;  1G91 A;  1BCP D;  3BZD B;  4LF6 L;  3HS0 C;  1KDC A;  4A3K H;  2F0D A;  1VDZ A;  1VQM A;  1D1K A;  2CH4 A;  4OON A;  3WWV A;  4DXF A;  5JVH 3;  4B3R Q;  4UP8 A;  4DR2 Q;  3RZD B;  2LFN A;  1F9R A;  1M1K C;  2DY8 A;  4KHZ A;  2JA6 G;  1RD9 D;  1PH2 A;  1GVP A;  4Q0F A;  1WCM H;  3G4S A;  1CQV A;  4GZY C;  1CK1 A;  1W2B A;  2UUC Q;  4LWC A;  2UUA Q;  1SYF A;  4RGO S;  1YNJ C;  5ELB A;  3TP5 A;  5KRU A;  1XMQ L;  1ROD A;  2BH8 A;  4LF5 L;  1ZKO A;  3BYY B;  1Y69 U;  4OXP A;  1HZB A;  5C3E B;  1IW7 D;  3K0Y A;  3J81 i;  3GTK H;  5EPL A;  4YWK A;  3HP3 A;  1OO9 B;  2WII B;  2R93 G;  5K36 H;  3SEB A;  2F0P A;  2R7Z B;  1LTS D;  2KQ3 A;  2EXD A;  2LS0 1;  3GDE A;  3LGJ A;  3PIP 3;  2KA7 A;  5IE8 A;  4X3K A;  4XQQ A;  4DK3 C;  5G3L F;  4A3B B;  3PO2 B;  3E5S A;  2QW7 A;  1F2Z A;  4UAI A;  1E1O A;  2YTX A;  4PG3 A;  4POF A;  2NVQ B;  1LTA D;  1K3R A;  2PMZ E;  1Q1B A;  1MKH A;  2Q8I B;  1LO5 D;  1K28 A;  2FXQ A;  3JAM L;  1TS3 A;  1N8R C;  2HQL A;  1S5C D;  3J81 E;  3EJI A;  4X65 Q;  4ZUJ A;  2JEB I;  2ICI A;  3I55 A;  2ZTC A;  4CDF C;  1EQV A;  4JOI A;  3PUX A;  1EZ8 A;  5BN4 A;  1L1O C;  1R9T H;  2OEO A;  4HJ5 A;  4DV3 Q;  1IL8 A;  1Y1V B;  1TWC B;  4EQO A;  1A15 A;  1I4Q A;  2EYH A;  3NK9 A;  1JWU D;  4OO1 G;  2RDF A;  2QEJ C;  1N33 Q;  2F1M A;  5HGT A;  3IFD A;  4HIO A;  5LMN Q;  1VQE A;  1D1I A;  4FYD A;  3MFY A;  3HKZ B;  1SJE D;  4GLA C;  3WOE A;  4R8I A;  2PCF B;  5E3F A;  1YJ9 A;  2Z8L A;  2K75 A;  4DV4 L;  3I56 A;  5GQO A;  4JI1 Q;  1YHA A;  3EVQ A;  5F2D A;  3FDT A;  2UXB Q;  4HJ8 A;  2D0P A;  2QDB A;  2FIN B;  5I4D A;  2ALY B;  1GD7 A;  4NPS A;  1Q86 C;  1JOQ A;  5A2Q L;  4S3S A;  1UE7 A;  3BVM A;  2WAQ E;  1VQ7 A;  1SMY D;  2E5L Q;  5IIF A;  3J80 L;  2Z4I A;  4DR4 L;  2XVS A;  4B3M Q;  1TWH B;  3NBH B;  2QGQ A;  1JCK B;  3Q0A A;  2MQH A;  1J5E Q;  2B29 A;  4IUQ A;  1X54 A;  3HOU B;  1M8A A;  3T56 B;  5J22 A;  3NPP A;  1STA A;  3PCO B;  1EFW A;  3D31 A;  3T16 A;  1V1P A;  4CKE A;  4HCS A;  4F87 A;  3OTO Q;  2Q8R E;  2ZT9 C;  5CV9 A;  4B9X A;  2NWG A;  4LJZ C;  3PIO A;  2QA4 A;  1EL0 A;  1YI2 A;  2OTJ A;  5EAY A;  2EYM A;  1EZ6 A;  1TWF B;  4WRD A;  1TT2 A;  1H9S B;  3M4P A;  2HHH L;  4N9T A;  1X3F A;  3MA2 B;  3K5M A;  3NWS A;  1DYQ A;  2ZTD A;  5AJ3 L;  4YIJ A;  1B8A A;  1SSO A;  4A3E H;  3CCR A;  4A3C H;  5HY6 A;  3NE5 B;  5E4X A;  2M2L A;  3CXC A;  3I2Z A;  5C5L A;  1D5Z C;  3CQZ H;  1F2M A;  1KDB A;  1TY2 A;  3MZ5 A;  1E24 A;  1YNN D;  1C0A A;  1M90 C;  5DAU A;  2EXZ A;  3QB3 A;  3GTO H;  2Q2U A;  4A3I G;  3ZYY X;  2E2J H;  3OMG A;  1PRT B;  1EWH A;  1XX8 A;  1GKH A;  3HOW B;  4IQZ A;  4L5Q A;  3S1M B;  2AUJ D;  2AQ1 B;  2I0Q A;  4AQY L;  4JBW A;  4FP5 D;  5NUC A;  4HJA A;  3H3V C;  2R92 H;  1CZW A;  1WTO A;  1CKN B;  1SNM A;  3STB C;  4DUZ Q;  4C3H H;  3HOX G;  1AZP A;  2DGY A;  1HUN A;  1TII D;  4C2M H;  1I94 L;  4CHT B;  2NBF A;  4DKA C;  5C0X I;  1FVI A;  2IX0 A;  3GTP B;  5D3I B;  5CV6 A;  4IPG A;  3P75 A;  4LAA A;  3FKI G;  1QVG A;  3NEL A;  1RDP D;  1MIU A;  1G2S A;  4QCL A;  2ES2 A;  2Y0S B;  4A3J H;  4NB3 A;  3F2C A;  1UE6 A;  3C46 A;  2OWO A;  3CP0 A;  5FLM H;  4GKJ L;  1PRT C;  4HJ9 A;  3TBI B;  1STY A;  1JR0 D;  4A3K B;  2Q2I A;  2MJ8 A;  1AN8 A;  4ZK9 B;  5KNB A;  1F2Y A;  2P5Z X;  3T1Y Q;  4CKC A;  5M3M G;  4PZ7 A;  3VA7 A;  4JI0 L;  4F7X A;  3K6O A;  2B63 H;  4J1M A;  3S1R H;  2K28 A;  1QVF A;  3BVG A;  4IPH A;  3HOV G;  1YZ6 A;  1IBK L;  3OW2 A;  5DLQ E;  4DR5 L;  2R7D A;  4ZKC B;  5C4J H;  2KHI A;  3S9W A;  2EJM A;  3E6Z X;  3PUZ A;  4TQU S;  2UXD L;  4LFA Q;  4L63 B;  3CCM A;  3MAQ A;  2NZO A;  2WP8 J;  1VQF A;  4KD4 A;  1LTL A;  1WVL A;  2JQO A;  1BDO A;  4B3R L;  1X3P A;  4DR2 L;  1KD1 C;  4A3F G;  2JA8 H;  3GV3 A;  2PZU A;  3QOJ A;  4A76 A;  1S3O A;  1PYB A;  2B2U A;  2K05 A;  2A68 D;  5BR8 Q;  5CGK A;  4IUU A;  4XYO A;  2H5X A;  2UUC L;  2UUA L;  2I07 B;  1YJN A;  1LTT D;  3J81 j;  3OOC A;  3J81 L;  2F3V A;  4AYB B;  4C3J G;  4R4O A;  3DWA A;  3ERO A;  2K5D A;  1SN8 A;  4X3U A;  3ERQ A;  2A69 D;  3MC0 B;  4UP9 A;  1C8C A;  4CDE C;  2VXW A;  1J9O A;  2LXJ A;  1CTM A;  1HNX L;  4LF6 Q;  5D14 A;  3NBI A;  3JC6 6;  1HXY D;  4K8J A;  1S40 A;  2F0T A;  3CC7 A;  1K0R A;  4A3G G;  3I91 A;  1PVO A;  5JJZ A;  1CSP A;  3GQB A;  3HFZ B;  1TQO A;  2SNM A;  3S24 A;  2CW0 C;  4POG A;  2E2D C;  1L2F A;  1JQY D;  4BY7 G;  1VQ4 A;  4KKS A;  4DV6 Q;  1EIG A;  1XTC D;  3RMH A;  1CA5 A;  2EYF A;  4LF5 Q;  1HTL D;  4OEM B;  2L5T A;  1SE8 A;  5E4W C;  2LY7 A;  4JPB W;  1FYC A;  3MVV A;  5H1S E;  4DV3 L;  1XJV A;  4JI7 Q;  1G6P A;  5IT9 E;  3PO3 H;  5IYC H;  4FXK C;  1QUQ A;  4NKL A;  4RGT A;  3TDQ A;  2NZ1 D;  1N33 L;  1MI2 A;  4MHE A;  3RZD H;  2OCE A;  3CHB D;  5LMN L;  1NNX A;  3RUZ A;  1KNA A;  1CSQ A;  4R1J A;  4JI1 L;  4IN3 A;  2KHJ A;  2MUY A;  2UXB L;  2PO4 A;  1JE5 A;  2F0K A;  2D5D A;  1P8L A;  5CBE E;  4BXX H;  5ELN A;  4DNT B;  5IGC A;  1HCZ A;  1BF4 A;  1PZJ D;  1DJR D;  2IW3 A;  2E5L L;  4B3T Q;  4IUT A;  4XXE A;  1HTP A;  2E74 C;  1QNK A;  4B3M L;  1CFM A;  1T5E A;  3Q8D A;  1OXU A;  1J5E L;  3JAM i;  5CV8 A;  1DD2 A;  1UUP A;  2YV5 A;  1V43 A;  4A3E B;  3J7A 5;  2O5I C;  1H95 A;  4DAY A;  3PO2 H;  2GVB A;  5DM7 3;  3IAY A;  4DR1 Q;  4ALP A;  3D6W A;  2NVQ H;  3OTO L;  3CCS A;  5FLX c;  3K80 C;  1JC7 A;  2VB2 X;  1V1O A;  3BU2 A;  3ICE A;  3U50 C;  4O0A A;  3R2T A;  4GNX A;  4LUO A;  1IBM Q;  2A74 C;  2QDL A;  4RAU C;  4JI3 Q;  1X3E A;  3JAM E;  4ZKB B;  2R3Z A;  1H9R A;  2A6H C;  2E2J B;  3I8Z A;  1EU3 A;  3TZU A;  1Y1V H;  5C3E G;  1TWC H;  2NN6 G;  5M5X H;  4YCW A;  2E8G A;  4HIM A;  2RBM A;  3NEN A;  2KCT A;  2PZW A;  2N49 A;  1HNW L;  3CCE A;  2MPM A;  4A3B G;  4A4I A;  3P1H A;  1VQA A;  3J80 i;  3K59 A;  1QCB D;  3BJU A;  1N32 Q;  5C44 B;  5EPJ A;  1TWA H;  2K4K A;  4A3M B;  3NXW A;  1B2T A;  2IL8 A;  4L5S A;  1CI3 M;  4FNF A;  4C2M B;  4R4T A;  4JI6 Q;  3NEM A;  3NUC A;  4IFD H;  3KBX A;  1GUO A;  4ZCK A;  1WTP A;  3RLO A;  3A74 A;  2K5W A;  4CJ0 B;  2ZM6 Q;  3CPW A;  2K52 A;  3S14 B;  5I6W A;  2N78 A;  5A2Q E;  1TXY A;  1STB A;  5J3B A;  2HDL A;  3J80 E;  4DUZ L;  4N9P A;  2VNU D;  4EX5 A;  1Q3L A;  5EPK A;  3G7L A;  1SRU A;  3R3O A;  3HKZ G;  1VQL A;  4NP5 A;  1B9M A;  4BY1 G;  2VUM G;  3ULL A;  3F2D A;  2F0I A;  4XQN A;  4RCN A;  3K57 A;  3DEP A;  5I6Y A;  1MD2 D;  2M9V A;  3S1R B;  2D2C C;  2BE5 D;  1RTN A;  1PH9 A;  2G5D A;  3DMU A;  3KFU A;  1EY9 A;  3I4M G;  1TY0 A;  1A63 A;  2I5M X;  4ZYS A;  1KRS A;  5CC4 A;  4X3S A;  1DOL A;  2EJF C;  1XNQ Q;  3R2I A;  3KLR A;  3HOU G;  5CV7 A;  1LTI D;  3S2H B;  3DWP A;  3RZO H;  2XWJ B;  5T1I A;  4IO9 A;  4X3T A;  3T1Y L;  2KUM A;  1SYB A;  4BA1 I;  4JW0 A;  2JEA I;  1S4Z A;  3E9I A;  5C3W A;  3FP9 A;  4XQJ A;  2AQ2 B;  5LMN W;  3RLF A;  4JBM A;  3S1M H;  2KCM A;  3KF6 B;  5BN3 A;  1KAW A;  1C4Q A;  4LFA L;  3I4N B;  2AWO A;  4G7Z C;  3BZK A;  3FPP A;  3G6E A;  3U9O A;  4DU9 A;  3MXN B;  1RIP A;  3MEF A;  1G51 A;  4A3D G;  3IL8 A;  1HUM A;  2OQ0 A;  2IX1 A;  1FR3 A;  1GUW A;  1XNR Q;  2AKW B;  3BYT B;  4FF1 A;  1OXV A;  2E2H B;  5J1Z A;  2RA4 A;  5BR8 L;  2A6E D;  1EYG A;  5KGU A;  5FJ8 H;  2L1B A;  2A5H A;  3GTP H;  1L0X B;  1SND A;  4BA2 I;  2PMZ B;  4MN3 A;  1X3G A;  5KNC A;  4UP7 A;  2HCI A;  1PTO H;  1SFO H;  1LYL A;  4L6T B;  2SNS A;  2F0L A;  2EYJ A;  3ND8 A;  1YIT A;  4KJO A;  3CCU A;  2K03 A;  3KF8 B;  1S5F D;  5L37 A;  2EDG A;  4DK6 C;  2UXD Q;  3EIV A;  4RH6 A;  3L7Z C;  4ILW A;  4XTC S;  5C4H A;  1MJC A;  1UEA B;  2L9H A;  1VF7 A;  3PO3 B;  2RQX A;  3NQT A;  3AFP A;  4LUV A;  2AUK A;  3SK5 A;  3KDF A;  4M1U B;  3SK8 A;  1EY7 A;  1PH3 A;  2F0N A;  1AW7 A;  1EUJ A;  1GXD C;  1EY6 A;  1O80 A;  1SNP A;  5JPM C;  3T51 B;  4BBR G;  1L1O B;  2JXM B;  2EPB A;  2EYP A;  4JI4 L;  1HFN A;  2PI2 A;  4DV6 L;  2PQE A;  4JG2 A;  4DAP A;  4HSP A;  3SXH A;  1OXT A;  4QL5 A;  4PZ6 A;  1TS5 A;  3G48 A;  3E0E A;  3OSO A;  4JI7 L;  2O2L D;  2WAQ B;  1TWG B;  4DAV A;  2QIL A;  3FEW X;  5IYB H;  1WTX A;  4MZ9 A;  1KLU D;  2H1E A;  3U58 A;  2JK8 A;  4L8J A;  3H0G H;  1VQC A;  2EY1 A;  5LL6 X;  4IFD J;  2QF7 A;  4A3K G;  1HNX Q;  3CKI B;  1XPU A;  2O4X A;  3FPU B;  2CFM A;  1SJH D;  2Z6B A;  4KN7 C;  4HMJ A;  1J8I A;  3GTG H;  3M7N A;  4XT3 B;  4LK1 C;  3SK4 A;  3L0O A;  1SXT A;  1WCM G;  2OXP A;  1YNJ D;  1NY4 A;  3MHB A;  1Y8N B;  2F0J A;  4B3T L;  1EYA A;  2VY3 A;  2B2V C;  3HGB A;  3TQY A;  4MTK A;  3ER0 A;  1AFP A;  2J7Z A;  3T13 A;  4TRD A;  4K6D A;  5C4X B;  1PFM A;  2ATW A;  1D5M C;  1B53 A;  3WDN A;  2Q2H A;  4R9W A;  3C3L A;  5M5X B;  1GUT A;  3EBE A;  5FO8 B;  5K36 G;  1SEB D;  3A7A B;  4DR1 L;  2B2W C;  1H9K A;  4DR6 Q;  3AQQ A;  1WD0 A;  4DV2 Q;  2K33 A;  3GO5 A;  2ASB A;  2KCN A;  1IBM L;  4JI3 L;  5KND A;  4KY6 A;  1TWA B;  4WJ3 M;  1TU2 B;  4AYB G;  2MO1 A;  5CBA E;  2XRS D;  5C0X H;  3MXU A;  3UDX A;  3NQI A;  3E3X A;  2B3G A;  5EBD A;  4IOC A;  1EIH A;  3PF5 A;  1S72 A;  1BQQ T;  2AWN A;  2YYZ A;  1EIY B;  3S2D B;  4OIJ A;  4C1N K;  2KJX A;  4O1N A;  3V2T A;  5IGD A;  1HA5 A;  4B9W A;  3BDO A;  2EY2 A;  4K2K A;  3KYH C;  1A3V A;  5M3F B;  1U4R A;  1X65 A;  2UXC Q;  1E22 A;  4LF7 Q;  2EZV A;  4LFB Q;  2CH4 W;  1N32 L;  4GS3 A;  4IUN A;  4HR7 B;  3OYY A;  1STN A;  5JJL A;  1O7Z A;  4RCO A;  1H9M A;  4JI6 L;  3CRK C;  4GLV B;  4I7A A;  4K2L A;  4ZRZ A;  2PNH A;  3A55 A;  3A8K E;  3OPO A;  1E2V A;  2ZM6 L;  3I4O A;  3CAM A;  4C1N I;  2SEB D;  1BCP F;  2NVT H;  3L3O C;  1VQI A;  2J0T D;  4TVA B;  3IFT A;  2NTT A;  4IUR A;  2PQA B;  4P74 A;  4APV A;  4GLX A;  4BS9 A;  4CDC C;  2B2Y A;  3I4L A;  4A93 B;  3H6M A;  1SLJ A;  3KBG A;  3NHH A;  4GOP B;  5KYL A;  1YHB A;  1Z47 A;  1HNW Q;  3RZO B;  1ICF B;  4UY8 C;  1STE A;  3AU7 A;  1QNU A;  4QUF A;  1IKM A;  1DZ1 A;  4OO1 I;  5IWA Q;  1YIJ A;  2E2I B;  1XXG A;  2F03 A;  3CC2 A;  5CYU A;  1DGS A;  3I3C A;  1CHQ D;  2VQE Q;  5FO7 B;  4QUC A;  4DV5 Q;  4X62 Q;  1GM5 A;  2XSC A;  1NSN S;  1QJO A;  4E6I A;  3I73 A;  2NB0 A;  3NP8 A;  3SDZ A;  3Q24 A;  2H4O A;  1XNQ L;  2BCO A;  3KLW A;  1B7Y B;  3HOZ B;  4A3C G;  4CDD C;  2RDH A;  1A3U A;  4IAL A;  3MEH A;  2PW5 A;  3DXJ C;  5C44 H;  4A3M H;  2WFW A;  3NTK A;  3K0X A;  4B3S Q;  4FF2 A;  5HUR A;  2CKZ B;  4DA2 A;  2VW9 A;  1EQR A;  1BXT A;  3OIQ A;  1V8Q A;  4ZAI A;  5IY0 A;  1EY0 A;  1QZH A;  5EJW A;  5K5P A;  1ESR A;  1PFS A;  3I72 A;  1WTR A;  4LF8 Q;  1EYD A;  3CC4 A;  4GOP C;  3S14 H;  5FLX E;  1PTO B;  4QF4 A;  3V96 A;  1SFO B;  2EVB A;  1VQ6 A;  1RTO A;  2Z6K C;  3GD7 A;  1QWY A;  1XNR L;  3A5Z B;  2JA6 B;  1PV4 A;  2C35 B;  2WB1 E;  2R92 G;  1QIL A;  1SYD A;  1JMC A;  1IYU A;  3STB D;  3CMA A;  1WI5 A;  3AFQ A;  4ZUI A;  1PZK D;  4K14 A;  2ZJP A;  4QMG A;  1EOT A;  1MBY A;  1QG7 A;  2EY6 A;  4C3H G;  2B2T C;  4X66 Q;  4HAE A;  3F1Z A;  1WTV A;  5IYD H;  1B9N A;  2K50 A;  2HUG A;  2F0V A;  4ZQ3 A;  1CHP D;  1GOZ A;  2QCP X;  5D3D A;  1O7I A;  2OT2 A;  5TSS A;  3BDL A;  1PXU A;  2N8N A;  2AMC B;  2CQO A;  3H15 A;  2AHO B;  4X64 Q;  3PF4 A;  1EWI A;  2JA7 H;  1KAB A;  3PUY A;  2A68 C;  3BZC A;  3S2H H;  1Y1W H;  1V9P A;  3PIO 3;  4A3J G;  3SVM A;  2EJG C;  1PRT D;  5C0X J;  2NZH A;  3LWE A;  1SBB B;  2A1A A;  3H0G B;  2E76 C;  1EOV A;  2F0H A;  1PTO C;  4C3J H;  4EQP A;  2CQA A;  1EWC A;  5ELF A;  1K83 H;  1BOS A;  4GKK L;  3GTG B;  1Z6H A;  2JN4 A;  2GA4 B;  2MNA A;  3VR5 A;  2B63 G;  2F0E A;  3SK6 A;  3QG1 A;  3I4N H;  4CJ1 B;  2DNE A;  4K5X A;  3HRZ C;  1U9R A;  2Q8T A;  1CQF A;  1SNO A;  4ABN A;  2JA5 H;  2K5Q A;  1KNE A;  5I9O A;  2F0S A;  3J7A F;  1K8M A;  1PMR A;  2EYL A;  3D4D A;  2KEC A;  3MFG A;  2E2H H;  1FJG Q;  1ENA A;  1YBY A;  1V1Q A;  2K32 A;  2XIW A;  3ULP A;  3GV6 A;  1XMO Q;  2HDM A;  4OWX B;  1D8L A;  3PV0 A;  1E2Z A;  2F3W A;  2X69 A;  2JA8 G;  1PA6 A;  4PV1 C;  1Q8K A;  2PI2 E;  4C3I H;  1Q90 A;  4AIM A;  5IP9 H;  1MJE A;  1IZ6 A;  3F2B A;  3TZD A;  2ZJQ A;  3ULJ A;  1IKL A;  4QGU A;  1B50 A;  5COY A;  3CRL C;  2QEX A;  4KKT A;  2RDG A;  1LUZ A;  3GP7 A;  1T9H A;  4JI4 Q;  1JT8 A;  3WOF A;  5C6A A;  1YHQ A;  3MTS A;  1EU4 A;  3TS2 A;  4HID A;  1T5X D;  2O5J C;  1BR9 A;  4RWS C;  2UU9 Q;  1HQR D;  1WJJ A;  1EQQ A;  3FHW A;  4DGZ A;  3QOL A;  1AE2 A;  1PDQ A;  1GO3 E;  4WJ4 A;  4JOI C;  1V1P B;  4DR6 L;  5IGB A;  1NAP A;  4DV2 L;  1A8V A;  1B3Q A;  5ELO A;  3CCQ A;  1XPO A;  1YVC A;  5D65 A;  1XYI A;  3PSI A;  4KJN A;  2YU9 B;  4KI0 A;  4P71 A;  4NXM Q;  2F0M A;  2ZXR A;  1RL2 A;  1VMC A;  2CW0 D;  1ENC A;  2F0G A;  4TSS A;  4BBS H;  3OWE B;  1CKO A;  3L9A X;  2DNC A;  2AQ3 B;  4DV7 Q;  1TWG H;  3K7U C;  1B4O A;  3K8A A;  2IT1 A;  4YY3 Q;  3NTI A;  3C1F A;  3Q22 A;  1F9Q A;  2CWP A;  1HRJ A;  5ISR A;  2BDN A;  2NUC A;  3TP7 A;  3CCL A;  3HOY H;  2PPB C;  1NR2 A;  4G7H C;  3PO3 G;  2UXC L;  4HSV A;  1VQ5 A;  4LF7 L;  4LFB L;  5IYC G;  4HMI A;  2NVT B;  3A8I E;  4IJH A;  3RNU A;  1ZXT A;  4KN4 C;  4A3I B;  1HPC A;  3GTJ B;  3FMC A;  2FJ2 A;  4LF4 Q;  1MGS A;  5FK9 C;  4X6A H;  2I46 A;  4U68 A;  5M5W H;  5C4X H;  4FF4 A;  1G29 1;  3TN2 A;  1VQO A;  4BXX G;  2WAQ G;  4GN3 B;  3UDF A;  3UE0 A;  1F9P A;  2I5L X;  2RHQ B;  1SE2 A;  2X6G A;  2X6L A;  2R7Z G;  2IY5 B;  2C5C A;  2L0C A;  4FVM A;  1PRT F;  5JEA H;  2XWB B;  2K14 A;  3FRP B;  1KQS A;  3PO2 G;  4KMU C;  1NR4 A;  3S1Q H;  3TP8 A;  2HCC A;  5IWA L;  4DV0 L;  4K8I A;  1I5F A;  2B2Y C;  1D2B A;  1BNZ A;  2VQE L;  1SYC A;  2WIN B;  3AB9 A;  3A7L A;  1Y8P B;  2RVL A;  5FLX L;  4DV5 L;  4FO2 A;  4X62 L;  3KLS X;  2WAC A;  2ZJR A;  2A6H D;  3PGZ A;  3S2D H;  1AZQ A;  2M00 A;  1KXL A;  2LSS A;  2N3S A;  5HGQ A;  1CUK A;  2C9O A;  2A73 B;  1I4X A;  1Y1V G;  5M3F H;  5KEE A;  5IP7 G;  4QJF A;  1FGB D;  3G71 A;  4OX9 Q;  2K04 A;  4QIW B;  1FL0 A;  5KIX A;  3TRZ A;  2KHS A;  4B3S L;  1C9O A;  4ME3 A;  3A54 A;  4Y52 H;  1NBW A;  3I4M H;  2IJ0 A;  1WTQ A;  2F0F A;  4DV1 Q;  4I65 A;  4RMF A;  1LAC A;  2B8F A;  2KED A;  4LF8 L;  3RLN A;  1LV9 A;  3M4Y A;  1W3S A;  3H09 A;  1K73 C;  1VQH A;  4IFD G;  1SRO A;  2FMM A;  4QB4 A;  4CJ2 C;  3I90 A;  3E9H A;  1X3Q A;  1ZYR C;  4I7Z C;  2RCF A;  4A3F B;  4TKO B;  1HQM C;  4BWG B;  1TS2 A;  5C5M A;  4A93 H;  1R4P B;  2KEN A;  2JA7 B;  1BCP B;  1B1Z A;  1QB5 D;  1Y1W B;  1NMF A;  1JOR A;  2NN6 I;  5I2Y A;  4X66 L;  1ZEQ X;  2YTY A;  3GTM B;  3PIP A;  4JVZ A;  2E2I H;  4JYA Q;  2XNA C;  4C3J B;  2N88 A;  4KHP Q;  4RHR A;  3RD4 A;  4XT1 B;  4HCE A;  3B6Y A;  2ID0 A;  4HTH A;  5LHY 1;  1K83 B;  4N8F A;  4A3D H;  3CCJ A;  2KBN A;  2EYO A;  3P20 A;  4MNO A;  3F8T A;  3BS1 A;  2MFI A;  4X64 L;  1KIX A;  1EFI D;  1RHP A;  5AFW A;  3S16 H;  2JA5 B;  3HOZ H;  1HZC A;  1P16 A;  3DUZ A;  1ESF A;  4H44 C;  4DK1 A;  4YCU A;  4V0B A;  1BBX C;  1F9S A;  1BVS A;  1I3Q H;  3RN5 A;  5IT9 c;  3QR8 A;  3ERS X;  4LUZ A;  4QIW E;  4A3L H;  1I6H H;  4BY7 B;  1NMG A;  4WJW A;  1HJP A;  2F4I A;  1E3P A;  1U4M A;  3S17 H;  3VR2 A;  1VQB A;  4PZ8 A;  3W5O A;  1PH1 A;  2OF1 A;  2XRQ D;  3ITP A;  4C3I B;  3CCV A;  3TME A;  3MXP A;  1IBL Q;  4Y7N H;  1BCP C;  3NTH A;  2B2U C;  2XGT A;  3HOW G;  4K0K Q;  2R7F A;  2LXK A;  2I5H A;  1JJC B;  1BKB A;  3CF5 A;  1PZI D;  2ZXP A;  4JBK A;  1W6J A;  1QUQ B;  5DEH A;  4JI8 Q;  4RHS A;  1STG A;  3DHQ A;  3U9S A;  5CV4 A;  2N55 A;  2FMC A;  2JA6 H;  5A35 A;  4LF9 Q;  4BBR H;  1FJG L;  2MO0 A;  3J7Y W;  4QY7 A;  5JVG 3;  1CKN A;  3KOJ A;  1XMO L;  1K8A C;  2L15 A;  2BH2 A;  1DOK A;  1I50 H;  1ICW A;  1ET9 A;  1U4L A;  1RKN A;  5CMD A;  4XIG S;  1F2L A;  4CBV A;  3TEH B;  1QZG A;  2DN8 A;  2F52 A;  1JWM D;  2TMP A;  5FJ8 G;  2VS1 A;  1X9N A;  2IHE A;  1LAB A;  3VA5 A;  5IGE A;  1E2W A;  5ELD A;  1JB3 A;  2K6A A;  5JEA J;  4F8M A;  4GKK Q;  1IW7 C;  4BBS B;  2R93 H;  3TS0 A;  4DPG A;  1N36 Q;  4YHH Q;  2Z9H A;  3H3V I;  2ENB A;  4JK1 C;  2EE1 A;  5ELC A;  3UE1 A;  5LMU Q;  4OL7 A;  2UU9 L;  2Y0S G;  3AEV A;  1YJW A;  3JAM c;  1CKM A;  1K0S A;  4DAY B;  1A2U A;  3C2P A;  4ULL A;  1X32 A;  2MP1 A;  1NCV A;  4JBJ A;  2D62 A;  2EY5 A;  3HOY B;  4RKB A;  2VQF L;  1NE3 A;  1N9W A;  4OWW B;  1VQG A;  2F0O A;  4NXM L;  4GNX B;  2V4D A;  4C56 C;  3VYS A;  4P73 A;  1GHK A;  5E1F A;  3OHX C;  2NTS A;  1PH7 A;  4IUV A;  2DJG C;  2JE6 I;  4OHJ A;  2QKI C;  1LT3 D;  3M9B A;  1EIF A;  3Q6S A;  5LL6 S;  4DV7 L;  1ET6 A;  4ME5 A;  4OO1 H;  4JI5 Q;  4YY3 L;  5IOD A;  2G9D A;  5M5W B;  3VR3 A;  1AE3 A;  1FNU A;  4LMQ D;  3QJY A;  4P72 A;  1PFB A;  1Y14 B;  5IYB G;  1EYC A;  1WTW A;  3SE0 A;  3M3Y B;  1TVX A;  3H0G G;  1D7Q A;  4YCV A;  4H02 A;  3PMF A;  4G57 A;  1B44 D;  2JYO A;  1UE1 A;  3J80 c;  2K5V A;  1DON A;  3M85 A;  2BA0 A;  1GUS A;  3K7A B;  4LF4 L;  1IXR A;  2WKD A;  4YWL A;  1AEX A;  3S1Q B;  4EQ5 A;  1SMY C;  4IPC A;  1HZA A;  2IX3 A;  2K1B A;  3GTQ B;  1N34 Q;  4XYQ A;  5JJI A;  4GNX C;  1TKW B;  1UE5 A;  1SDF A;  4IPD A;  4GN5 A;  3OW7 A;  5M5Y H;  2EOT A;  1MSG A;  3W1G A;  3QO2 A;  1NTG A;  1PH6 A;  4BY1 B;  3VR4 A;  5EKK A;  2VUM B;  2YU9 H;  3L2P A;  1LT5 D;  1HH2 P;  2FFK B;  1ILQ A;  2RCN A;  1MSH A;  4ODG A;  1I6V C;  5J39 A;  3I4M B;  1X55 A;  4L5R C;  4PNY A;  2MGS A;  5C0X G;  2IWH A;  5ELE A;  1K3B C;  1DCZ A;  2VZA A;  3H91 A;  4G7O C;  4FXG C;  3PUV A;  5EKI A;  1YNN C;  1Q12 A;  2NVX B;  3ND9 A;  4DR7 Q;  1O78 A;  1OTC A;  4LFC Q;  4CKB A;  3P7J A;  2WB1 B;  4OX9 L;  2CCZ A;  3O13 A;  4A3I H;  5GAG C;  4EVO A;  2Z1C A;  1MHW C;  1I4P A;  1Q82 C;  1SYG A;  3VYR A;  4F88 A;  3GTJ H;  4Z9C B;  4DF7 A;  4LNQ A;  3A5U A;  1SE4 A;  4J8Q A;  1HNZ L;  5JAV A;  1I4R A;  3T1H Q;  2BDO A;  2YTV A;  4DV1 L;  4MIU A;  4DV0 Q;  1OXS C;  2Q2T A;  1E1T A;  1UWV A;  2KVM A;  4NXN Q;  4IOA A;  4JCV E;  2NVY H;  5IOC A;  3TRE A;  3K5O A;  4DNI A;  1K8G A;  1TS4 A;  3UDG A;  4A3D B;  1WYD A;  1B3A A;  3W3A A;  3HOX H;  2HQE A;  3S15 B;  3ZJY C;  5E7N A;  4G4K A;  3VDY A;  3IKJ A;  1PFN A;  4HIK A;  4A3E G;  2J4X A;  3S16 B;  1IL2 A;  4JI2 Q;  3HKZ E;  1ILP A;  1A3T A;  1EQT A;  3X3N A;  1EY4 A;  3D4R A;  3VYT A;  3OIP A;  3FKI H;  1FNW A;  4JYA L;  5JPN C;  5COR A;  4PMW A;  3R93 A;  4KHP L;  1I3Q B;  1Z7T A;  2EIF A;  1JIC A;  1I6H B;  1HFG A;  3SR1 A;  4FXD A;  1QE6 A;  2D0O A;  1K9M C;  3QIA A;  1DM0 B;  3S17 B;  4JV5 L;  3MWY W;  2F0Q A;  4Y7N B;  4EGV A;  2L11 A;  1PHJ A;  1F77 A;  4M8A A;  3NSW A;  4DXG A;  5M3M H;  3BG3 A;  3KDF B;  3M7G A;  1ONL A;  3S1N H;  1S5D D;  4BBR B;  1G2T A;  1Q7Y C;  1FNV A;  2WKC A;  4IJL A;  3HOV H;  2B8G A;  2D9U A;  2K7V A;  1VCI A;  1I50 B;  4DK0 A;  1L0Y B;  1U5K A;  2G9H D;  1E7Z A;  4NMZ A;  5T1G A;  5FOB B;  5C44 G;  4A3M G;  1HR0 L;  4RGM A;  1JJG A;  1BBW A;  1IBL L;  2K5N A;  4PQX A;  3R8B A;  4K0K L;  4DNR B;  1KTK A;  1VMP A;  1NJI C;  3K5L A;  4KV6 A;  1VQP A;  2R93 B;  2BOS A;  4JI8 L;  4Q5V A;  4DUY Q;  4A3F H;  1HHV A;  2LKV A;  3Q23 A;  4R4C A;  4LF9 L;  4V19 0;  1KHI A;  2RSO A;  3J81 c;  2A19 A;  3ONA B;  4RGN A;  4FF3 A;  1D5X C;  1LTR D;  4DR3 L;  3I7F A;  2JP1 A;  1WTH A;  4P2C B;  5FLM G;  3GTM H;  1FGU A;  1KLG D;  4YWM A;  2WV6 D;  1GHJ A;  1WCM B;  2KEE A;  4IZ8 A;  2UUB L;  3CD6 A;  1BO0 A;  1C48 A;  2A69 C;  1Q1E A;  1L0W A;  2GVA A;  4R4I A;  1N36 L;  4UPA A;  5IYD G;  4YHH L;  1GJX A;  1R4Q B;  2ICE C;  4RFB A;  4A3G H;  3GTK B;  1U4P A;  3SGI A;  5LMU L;  1C7Y A;  3M4O H;  1X56 A;  4L5T A;  1LLR D;  1XPR A;  3D3R A;  2IPK D;  2F4V Q;  1S5B D;  1S5E D;  2HIV A;  1A6X A;  2JA7 G;  4J15 A;  4ZLT F;  3GTL H;  1Y1W G;  1EY8 A;  1SNC A;  4GN4 B;  1ASZ A;  4BY7 H;  1GUG A;  1KC8 C;  1EY5 A;  1EEF D;  4K6L A;  2F0W A;  5DM6 3;  3I70 A;  1PTO D;  4IUP A;  5GAH C;  3CME A;  1WD1 A;  3DM1 A;  1BBU A;  1RCV D;  3J7Z C;  1ENF A;  3W2D A;  5EQ0 A;  2F0U A;  5EBC A;  3KF6 A;  2E75 C;  4JI5 L;  2Y0S E;  1R9T B;  3I4N G;  3H94 A;  3MXN A;  3LNN A;  3PQI A;  3HZX A;  2JA5 G;  1LT4 D;  3DM3 A;  1LM0 A;  2Z0S A;  1Y8O B;  1J6Q A;  5KYI A;  5M5Y B;  3F2U A;  1W6K A;  1KDA A;  3UDI A;  4LW1 A;  2DY7 A;  5IGG A;  2JJQ A;  4X65 L;  2BA1 A;  2B39 A;  4R8N A;  2VQF Q;  1XMQ Q;  3A56 A;  4C3I G;  3UI2 A;  5IP9 G;  1A2T A;  4FDB A;  3X3M A;  1YNX A;  3EA6 A;  2Z4H A;  1YEZ A;  1DOM A;  3FVQ A;  3KF8 A;  3T4A C;  1N34 L;  2HD3 A;  4OWT B;  5C3X A;  3D4W A;  1CZG A;  4DFA A;  1PH5 A;  1ASY A;  4H13 C;  1WOC A;  1JOO A;  5FO9 B;  4O42 A;  5M9O A;  4NW2 A;  2PNR C;  1XWE A;  4HN7 A;  1PYS B;  1XTD A;  3A0J A;  2B2V A;  3D0F A;  4NDX A;  1SYE A;  3RN2 A;  1L1O A;  4AYB E;  1LTG D;  3N6R A;  1VQK A;  5C3E H;  4DN4 M;  2NN6 H;  3D6C A;  2ZXO A;  1LT6 D;  1JB7 A;  1JWS D;  4BBS G;  1SMX A;  2RKS A;  2SOB A;  2B2W A;  1IHZ A;  2JSO A;  1IYV A;  1TR5 A;  2R7Z H;  3U4V A;  1HR0 W;  2NVY B;  5BN5 A;  1D6E C;  1KAA A;  4A3B H;  2XN9 C;  4UHV A;  4MTN A;  4HJ7 A;  1RF2 D;  2R6G A;  3CQZ B; 
#chains in the Genus database with same CATH homology
 3HOX B;  1UNS A;  1QOH A;  3OWF A;  1G6Z A;  3AMU A;  3GTO B;  1I4G A;  3DWQ A;  4H0L C;  3HG9 A;  4PMC A;  3T53 B;  1O7Y A;  3FKI B;  1HA6 A;  1BUV T;  4CGY B;  4J6H A;  2SDF A;  1K8O A;  3KK7 A;  2K01 A;  4KY5 A;  1DXM A;  5DNF A;  2R92 B;  5EKL A;  4K5V A;  1UAP A;  4RKL A;  4XDX A;  3BDC A;  2L55 A;  4C3H B;  5FKA C;  5M3M B;  3SHL A;  1OXX K;  1I4H A;  1NUC A;  1Q8I A;  3S1N B;  5JEA G;  1PTO F;  1M4V A;  3HOV B;  1PYW D;  2BE5 C;  3BVZ A;  3C1E A;  1RJT A;  5CR3 A;  1CM9 A;  4EQN A;  1SAP A;  4KK7 A;  4KTA A;  3URY A;  2TSS A;  3TP6 A;  4A3J B;  2KOL A;  2VB3 X;  4B08 A;  4K5W A;  3NWT A;  4PMB A;  3NBH A;  1CT1 D;  4ID6 A;  1CA6 A;  3VYU A;  5G3L D;  2CVR A;  3PUW A;  3E0J A;  4RA8 A;  3EQL C;  3KLS A;  4WFN 3;  3V05 A;  4KKU A;  2B63 B;  3DEO A;  1PLF A;  1JOK A;  5C4J B;  4UDU C;  1JE4 A;  1H9S A;  1SE3 A;  2PW7 A;  3LX0 A;  4OGQ C;  4WOR A;  2L4N A;  4U67 3;  2MHV A;  1ZYR D;  4A3G B;  3M4O B;  2A6E C;  3MXG A;  1G8Z D;  4KD3 A;  1ML0 D;  2LMC B;  1SNQ A;  2JA8 B;  1EEI D;  5CV5 A;  3CU7 A;  1GUN A;  2NYZ D;  3D8G A;  3GTL B;  2PYK A;  3G6J B;  3A8J E;  3EFX D;  4HED A;  3HEJ A;  5EGT A;  2L12 A;  2PZT A;  2KCC A;  2R61 A;  5IGF A;  2B2T A;  5JOB A;  2FHT A;  3K5N A;  3TSS A;  4KY7 A;  3QWN A;  1AP0 A;  4KHV A;  2CHB D;  2RSN A;  3J7A V;  1VF5 C;  1FD7 D;  4IFD I;  3N52 A;  1O7L A;  5C4Z A;  5I2X A;  3VR6 A;  1H9J A;  1STH A;  4H7B A;  1E0B A;  3K58 A;  1LTB D;  3KUP A;  4OIK A;  3LWU A;  5IT9 L;  5I9P A;  1II3 A;  3OMC A;  1G91 A;  1BCP D;  3BZD B;  3HS0 C;  1KDC A;  2F0D A;  1VDZ A;  1D1K A;  4DXF A;  5JVH 3;  3RZD B;  2LFN A;  1F9R A;  2DY8 A;  4KHZ A;  1RD9 D;  4Q0F A;  4GZY C;  1CQV A;  1CK1 A;  1SYF A;  4RGO S;  1YNJ C;  5ELB A;  3TP5 A;  5KRU A;  1ROD A;  1ZKO A;  3BYY B;  1Y69 U;  5C3E B;  1IW7 D;  3K0Y A;  5EPL A;  3HP3 A;  1OO9 B;  2WII B;  5K36 H;  3SEB A;  2F0P A;  2R7Z B;  1LTS D;  2KQ3 A;  2LS0 1;  3PIP 3;  2KA7 A;  4X3K A;  4XQQ A;  5G3L F;  4A3B B;  3PO2 B;  3E5S A;  1F2Z A;  4UAI A;  2NVQ B;  1LTA D;  1Q1B A;  2Q8I B;  1LO5 D;  3JAM L;  1TS3 A;  1S5C D;  3J81 E;  3EJI A;  4ZUJ A;  2JEB I;  2ICI A;  1EQV A;  1EZ8 A;  3PUX A;  5BN4 A;  2OEO A;  1IL8 A;  1Y1V B;  1TWC B;  4EQO A;  1A15 A;  1I4Q A;  2EYH A;  3NK9 A;  1JWU D;  4OO1 G;  2RDF A;  2QEJ C;  2F1M A;  5HGT A;  3IFD A;  1D1I A;  4FYD A;  3MFY A;  3HKZ B;  1SJE D;  3WOE A;  4R8I A;  2PCF B;  5E3F A;  2Z8L A;  3EVQ A;  5F2D A;  3FDT A;  2QDB A;  2FIN B;  5I4D A;  1JOQ A;  5A2Q L;  4S3S A;  3BVM A;  1SMY D;  5IIF A;  3J80 L;  2Z4I A;  2XVS A;  1TWH B;  1JCK B;  3Q0A A;  4IUQ A;  3HOU B;  1M8A A;  3T56 B;  5J22 A;  3NPP A;  1STA A;  3D31 A;  3T16 A;  1V1P A;  4CKE A;  4HCS A;  4F87 A;  2Q8R E;  2ZT9 C;  5CV9 A;  4B9X A;  2NWG A;  4LJZ C;  1EL0 A;  2EYM A;  1EZ6 A;  1TWF B;  4WRD A;  1TT2 A;  1H9S B;  4N9T A;  3MA2 B;  3K5M A;  3NWS A;  1DYQ A;  4YIJ A;  1SSO A;  3NE5 B;  5E4X A;  2M2L A;  5C5L A;  1D5Z C;  1F2M A;  1KDB A;  1TY2 A;  3MZ5 A;  1YNN D;  5DAU A;  2EXZ A;  3QB3 A;  3ZYY X;  3OMG A;  1PRT B;  1EWH A;  1XX8 A;  3HOW B;  4IQZ A;  3S1M B;  2AUJ D;  2AQ1 B;  4JBW A;  4FP5 D;  5NUC A;  3H3V C;  1CZW A;  1WTO A;  1SNM A;  1AZP A;  1HUN A;  1TII D;  4CHT B;  2NBF A;  5C0X I;  2IX0 A;  3GTP B;  5D3I B;  5CV6 A;  3P75 A;  4LAA A;  1RDP D;  1G2S A;  4QCL A;  2Y0S B;  3C46 A;  1PRT C;  3TBI B;  1STY A;  1JR0 D;  4A3K B;  2MJ8 A;  1AN8 A;  4ZK9 B;  5KNB A;  1F2Y A;  4CKC A;  3VA7 A;  4F7X A;  3K6O A;  4J1M A;  2K28 A;  3BVG A;  4ZKC B;  3S9W A;  2EJM A;  3E6Z X;  3PUZ A;  4TQU S;  4L63 B;  3MAQ A;  2WP8 J;  4KD4 A;  1WVL A;  1BDO A;  1X3P A;  3GV3 A;  2PZU A;  3QOJ A;  2B2U A;  2K05 A;  2A68 D;  5CGK A;  4IUU A;  4XYO A;  2I07 B;  1LTT D;  3OOC A;  3J81 L;  2F3V A;  4AYB B;  4C3J G;  3DWA A;  3ERO A;  2K5D A;  4X3U A;  3ERQ A;  2A69 D;  3MC0 B;  1C8C A;  2VXW A;  1J9O A;  1CTM A;  5D14 A;  3NBI A;  1HXY D;  4K8J A;  2F0T A;  3I91 A;  5JJZ A;  3GQB A;  1TQO A;  2SNM A;  2CW0 C;  2E2D C;  1JQY D;  4KKS A;  1EIG A;  1XTC D;  3RMH A;  1CA5 A;  2EYF A;  1HTL D;  2L5T A;  5E4W C;  2LY7 A;  1FYC A;  3MVV A;  5IT9 E;  4FXK C;  4RGT A;  4NKL A;  3TDQ A;  2NZ1 D;  1MI2 A;  4MHE A;  3CHB D;  3RUZ A;  1KNA A;  4IN3 A;  2MUY A;  2PO4 A;  2F0K A;  2D5D A;  5CBE E;  4DNT B;  5IGC A;  1HCZ A;  1BF4 A;  1PZJ D;  1DJR D;  2IW3 A;  4IUT A;  4XXE A;  1HTP A;  2E74 C;  1QNK A;  1CFM A;  1T5E A;  1OXU A;  1DD2 A;  5CV8 A;  1UUP A;  4A3E B;  1V43 A;  2O5I C;  4DAY A;  5DM7 3;  3IAY A;  3D6W A;  1JC7 A;  2VB2 X;  1V1O A;  3R2T A;  2A74 C;  4RAU C;  3JAM E;  4ZKB B;  2R3Z A;  1H9R A;  2A6H C;  2E2J B;  3I8Z A;  1EU3 A;  3TZU A;  2NN6 G;  2RBM A;  2PZW A;  2MPM A;  3P1H A;  3K59 A;  1QCB D;  5C44 B;  5EPJ A;  4A3M B;  3NXW A;  1B2T A;  2IL8 A;  1CI3 M;  4FNF A;  4C2M B;  3NUC A;  4IFD H;  3KBX A;  1GUO A;  1WTP A;  2K5W A;  4CJ0 B;  3S14 B;  5I6W A;  5A2Q E;  1STB A;  2HDL A;  3J80 E;  4N9P A;  2VNU D;  1Q3L A;  5EPK A;  3G7L A;  3R3O A;  4NP5 A;  1B9M A;  2F0I A;  4XQN A;  4RCN A;  3K57 A;  3DEP A;  5I6Y A;  1MD2 D;  2M9V A;  3S1R B;  2D2C C;  2BE5 D;  1RTN A;  3DMU A;  1EY9 A;  1TY0 A;  4ZYS A;  5CC4 A;  4X3S A;  1DOL A;  2EJF C;  3R2I A;  3KLR A;  5CV7 A;  1LTI D;  3S2H B;  3DWP A;  2XWJ B;  5T1I A;  4X3T A;  2KUM A;  1SYB A;  4BA1 I;  2JEA I;  1S4Z A;  5C3W A;  4XQJ A;  2AQ2 B;  3RLF A;  5BN3 A;  1C4Q A;  3I4N B;  2AWO A;  4G7Z C;  3FPP A;  3U9O A;  4DU9 A;  3IL8 A;  1HUM A;  2IX1 A;  1FR3 A;  1GUW A;  4FF1 A;  3BYT B;  1OXV A;  2E2H B;  5J1Z A;  2RA4 A;  2A6E D;  5KGU A;  2L1B A;  2A5H A;  1L0X B;  1SND A;  4BA2 I;  2PMZ B;  4MN3 A;  5KNC A;  2HCI A;  1PTO H;  4L6T B;  2SNS A;  2F0L A;  2EYJ A;  3ND8 A;  4KJO A;  2K03 A;  1S5F D;  2EDG A;  4RH6 A;  3L7Z C;  4ILW A;  4XTC S;  5C4H A;  1UEA B;  2L9H A;  1VF7 A;  3PO3 B;  2RQX A;  3NQT A;  2AUK A;  3SK5 A;  4M1U B;  3SK8 A;  1EY7 A;  2F0N A;  1AW7 A;  1GXD C;  1EY6 A;  1O80 A;  1SNP A;  5JPM C;  3T51 B;  2JXM B;  2EPB A;  2EYP A;  1HFN A;  2PQE A;  4DAP A;  4HSP A;  3SXH A;  1OXT A;  1TS5 A;  3OSO A;  2O2L D;  2WAQ B;  1TWG B;  4DAV A;  2QIL A;  3FEW X;  1WTX A;  1KLU D;  2H1E A;  4L8J A;  2EY1 A;  5LL6 X;  4IFD J;  2QF7 A;  3CKI B;  2O4X A;  3FPU B;  1SJH D;  4KN7 C;  4HMJ A;  1J8I A;  3M7N A;  4XT3 B;  4LK1 C;  3SK4 A;  1SXT A;  2OXP A;  1YNJ D;  3MHB A;  1Y8N B;  2F0J A;  1EYA A;  2B2V C;  3HGB A;  1AFP A;  2J7Z A;  3T13 A;  4TRD A;  4K6D A;  5C4X B;  1PFM A;  1D5M C;  1B53 A;  3WDN A;  4R9W A;  3C3L A;  5M5X B;  1GUT A;  5FO8 B;  5K36 G;  1SEB D;  3A7A B;  2B2W C;  1H9K A;  1WD0 A;  2K33 A;  3GO5 A;  2KCN A;  5KND A;  4KY6 A;  1TWA B;  1TU2 B;  5CBA E;  2XRS D;  5C0X H;  3MXU A;  3NQI A;  1EIH A;  5EBD A;  1BQQ T;  2AWN A;  2YYZ A;  3S2D B;  4OIJ A;  4C1N K;  2KJX A;  4O1N A;  3V2T A;  5IGD A;  1HA5 A;  4B9W A;  3BDO A;  2EY2 A;  4K2K A;  1A3V A;  5M3F B;  1U4R A;  2EZV A;  4IUN A;  4HR7 B;  1STN A;  1O7Z A;  4RCO A;  1H9M A;  3CRK C;  4K2L A;  4ZRZ A;  3A55 A;  3A8K E;  3OPO A;  1E2V A;  4C1N I;  2SEB D;  1BCP F;  3L3O C;  2J0T D;  3IFT A;  2NTT A;  4IUR A;  4BS9 A;  2B2Y A;  3I4L A;  4A93 B;  3H6M A;  3KBG A;  3NHH A;  5KYL A;  1Z47 A;  3RZO B;  1STE A;  3AU7 A;  1QNU A;  4QUF A;  1IKM A;  1DZ1 A;  4OO1 I;  2E2I B;  1XXG A;  2F03 A;  5CYU A;  3I3C A;  1CHQ D;  5FO7 B;  4QUC A;  2XSC A;  1NSN S;  1QJO A;  4E6I A;  3I73 A;  2NB0 A;  3NP8 A;  3SDZ A;  3Q24 A;  2H4O A;  2BCO A;  3HOZ B;  2RDH A;  1A3U A;  4IAL A;  3MEH A;  2PW5 A;  3DXJ C;  3NTK A;  4FF2 A;  5HUR A;  4DA2 A;  1BXT A;  3OIQ A;  1V8Q A;  4ZAI A;  1EY0 A;  5EJW A;  5K5P A;  1ESR A;  3I72 A;  1WTR A;  1EYD A;  5FLX E;  1PTO B;  4QF4 A;  3V96 A;  1SFO B;  2EVB A;  1RTO A;  3GD7 A;  1QWY A;  2JA6 B;  1QIL A;  1SYD A;  1IYU A;  4ZUI A;  1PZK D;  4K14 A;  4QMG A;  1EOT A;  1MBY A;  1QG7 A;  2EY6 A;  4C3H G;  2B2T C;  4HAE A;  1WTV A;  1B9N A;  2HUG A;  2F0V A;  4ZQ3 A;  1CHP D;  1GOZ A;  2QCP X;  5D3D A;  2OT2 A;  5TSS A;  3BDL A;  1PXU A;  1KAB A;  3PUY A;  2A68 C;  3PIO 3;  3SVM A;  2EJG C;  1PRT D;  5C0X J;  3LWE A;  1SBB B;  3H0G B;  2E76 C;  4EQP A;  2F0H A;  1PTO C;  2CQA A;  1EWC A;  5ELF A;  1BOS A;  3GTG B;  1Z6H A;  2GA4 B;  3VR5 A;  2F0E A;  3SK6 A;  3QG1 A;  4CJ1 B;  2DNE A;  4K5X A;  3HRZ C;  1U9R A;  2Q8T A;  4ABN A;  1CQF A;  1SNO A;  2K5Q A;  1KNE A;  5I9O A;  2F0S A;  3J7A F;  1K8M A;  1PMR A;  2EYL A;  3D4D A;  2KEC A;  3MFG A;  1ENA A;  2K32 A;  2XIW A;  3GV6 A;  2HDM A;  3PV0 A;  1E2Z A;  2F3W A;  2X69 A;  4PV1 C;  1Q90 A;  3TZD A;  1IKL A;  1B50 A;  5COY A;  3CRL C;  4KKT A;  2RDG A;  3GP7 A;  3WOF A;  5C6A A;  3MTS A;  1EU4 A;  1T5X D;  2O5J C;  1BR9 A;  4RWS C;  1HQR D;  4DGZ A;  3QOL A;  1PDQ A;  1V1P B;  5IGB A;  1NAP A;  5D65 A;  1XYI A;  4KJN A;  2YU9 B;  4KI0 A;  2F0M A;  2ZXR A;  1VMC A;  2CW0 D;  1ENC A;  2F0G A;  4TSS A;  3OWE B;  3L9A X;  2DNC A;  2AQ3 B;  1B4O A;  2IT1 A;  3NTI A;  3C1F A;  3Q22 A;  1F9Q A;  1HRJ A;  5ISR A;  2BDN A;  2NUC A;  3TP7 A;  2PPB C;  1NR2 A;  4G7H C;  4HSV A;  4HMI A;  2NVT B;  3A8I E;  1ZXT A;  4KN4 C;  4A3I B;  1HPC A;  3GTJ B;  3FMC A;  2FJ2 A;  1MGS A;  5FK9 C;  2I46 A;  4U68 A;  4FF4 A;  1G29 1;  3TN2 A;  1F9P A;  1SE2 A;  2X6G A;  2X6L A;  2C5C A;  2L0C A;  4FVM A;  1PRT F;  5JEA H;  2XWB B;  3FRP B;  4KMU C;  1NR4 A;  3TP8 A;  2HCC A;  4K8I A;  2B2Y C;  1D2B A;  1BNZ A;  1SYC A;  2WIN B;  3AB9 A;  3A7L A;  1Y8P B;  2RVL A;  5FLX L;  4FO2 A;  3KLS X;  2WAC A;  2A6H D;  1AZQ A;  2M00 A;  2C9O A;  2A73 B;  1I4X A;  5KEE A;  1FGB D;  2K04 A;  4QIW B;  5KIX A;  2KHS A;  3A54 A;  2IJ0 A;  1WTQ A;  2F0F A;  4I65 A;  1LAC A;  2B8F A;  2KED A;  1LV9 A;  3M4Y A;  3H09 A;  4IFD G;  2FMM A;  4QB4 A;  4CJ2 C;  3I90 A;  1X3Q A;  1ZYR C;  4I7Z C;  4A3F B;  4TKO B;  1HQM C;  4BWG B;  1TS2 A;  5C5M A;  1R4P B;  2JA7 B;  1BCP B;  1B1Z A;  1QB5 D;  1Y1W B;  1JOR A;  2NN6 I;  5I2Y A;  1ZEQ X;  3GTM B;  2XNA C;  4C3J B;  2N88 A;  4RHR A;  3RD4 A;  4XT1 B;  4HCE A;  2ID0 A;  4HTH A;  5LHY 1;  1K83 B;  2EYO A;  3P20 A;  3BS1 A;  1EFI D;  1RHP A;  5AFW A;  2JA5 B;  3DUZ A;  1ESF A;  4H44 C;  4DK1 A;  4V0B A;  1BBX C;  1F9S A;  4BY7 B;  4WJW A;  2F4I A;  1U4M A;  3VR2 A;  2OF1 A;  2XRQ D;  3ITP A;  4C3I B;  3TME A;  3MXP A;  1BCP C;  3NTH A;  2B2U C;  1PZI D;  2ZXP A;  1W6J A;  5DEH A;  4RHS A;  1STG A;  3DHQ A;  3U9S A;  5CV4 A;  2N55 A;  2FMC A;  5A35 A;  3J7Y W;  5JVG 3;  1DOK A;  1ICW A;  1ET9 A;  1U4L A;  1RKN A;  5CMD A;  4XIG S;  1F2L A;  4CBV A;  2DN8 A;  1JWM D;  2TMP A;  1LAB A;  3VA5 A;  5IGE A;  1E2W A;  5ELD A;  1JB3 A;  2K6A A;  4F8M A;  5JEA J;  4BBS B;  1IW7 C;  2ENB A;  4JK1 C;  2EE1 A;  5ELC A;  4OL7 A;  1A2U A;  3C2P A;  4ULL A;  1X32 A;  2MP1 A;  1NCV A;  2D62 A;  2EY5 A;  3HOY B;  4RKB A;  2F0O A;  2V4D A;  4C56 C;  3VYS A;  1GHK A;  5E1F A;  3OHX C;  2NTS A;  4IUV A;  2JE6 I;  4OHJ A;  2QKI C;  1LT3 D;  5LL6 S;  3Q6S A;  1ET6 A;  4ME5 A;  4OO1 H;  5IOD A;  2G9D A;  5M5W B;  3VR3 A;  1FNU A;  4LMQ D;  3QJY A;  1PFB A;  1EYC A;  1WTW A;  3SE0 A;  3M3Y B;  1TVX A;  3PMF A;  4G57 A;  1B44 D;  2JYO A;  1DON A;  3M85 A;  2BA0 A;  1GUS A;  3K7A B;  2WKD A;  1AEX A;  3S1Q B;  1SMY C;  2IX3 A;  2K1B A;  3GTQ B;  4XYQ A;  1TKW B;  1SDF A;  3OW7 A;  2EOT A;  1MSG A;  3QO2 A;  4BY1 B;  3VR4 A;  5EKK A;  2VUM B;  1LT5 D;  2FFK B;  1ILQ A;  1MSH A;  4ODG A;  1I6V C;  5J39 A;  3I4M B;  4PNY A;  2MGS A;  5C0X G;  2IWH A;  5ELE A;  3H91 A;  1DCZ A;  4G7O C;  4FXG C;  3PUV A;  5EKI A;  1YNN C;  1Q12 A;  2NVX B;  3ND9 A;  1O78 A;  4CKB A;  3P7J A;  2WB1 B;  3O13 A;  4EVO A;  2Z1C A;  1I4P A;  1SYG A;  3VYR A;  4F88 A;  4Z9C B;  4DF7 A;  1SE4 A;  4J8Q A;  5JAV A;  1I4R A;  2BDO A;  4MIU A;  1OXS C;  2KVM A;  5IOC A;  3K5O A;  1TS4 A;  4A3D B;  1B3A A;  3W3A A;  2HQE A;  3S15 B;  4G4K A;  3IKJ A;  1PFN A;  2J4X A;  3S16 B;  1ILP A;  1A3T A;  1EQT A;  3X3N A;  1EY4 A;  3D4R A;  3VYT A;  3OIP A;  1FNW A;  5JPN C;  5COR A;  4PMW A;  3R93 A;  1I3Q B;  1Z7T A;  1JIC A;  1I6H B;  1HFG A;  3SR1 A;  4FXD A;  1QE6 A;  3QIA A;  1DM0 B;  3S17 B;  3MWY W;  2F0Q A;  4Y7N B;  4EGV A;  2L11 A;  1F77 A;  4M8A A;  3NSW A;  4DXG A;  3BG3 A;  3M7G A;  1ONL A;  1S5D D;  4BBR B;  1G2T A;  1FNV A;  2WKC A;  2B8G A;  2D9U A;  2K7V A;  1VCI A;  1I50 B;  4DK0 A;  5FOB B;  1L0Y B;  2G9H D;  4NMZ A;  5T1G A;  4RGM A;  4PQX A;  3R8B A;  4DNR B;  1KTK A;  1VMP A;  3K5L A;  4KV6 A;  2R93 B;  2BOS A;  4Q5V A;  1HHV A;  2LKV A;  3Q23 A;  4V19 0;  2RSO A;  3ONA B;  4RGN A;  4FF3 A;  1D5X C;  1LTR D;  2JP1 A;  4P2C B;  1KLG D;  2WV6 D;  1GHJ A;  1WCM B;  2KEE A;  4IZ8 A;  1BO0 A;  1C48 A;  2A69 C;  1Q1E A;  1GJX A;  1R4Q B;  2ICE C;  4RFB A;  3GTK B;  1U4P A;  1LLR D;  3D3R A;  2IPK D;  1S5B D;  1S5E D;  1A6X A;  4ZLT F;  1EY8 A;  1SNC A;  1GUG A;  1EY5 A;  1EEF D;  4K6L A;  2F0W A;  5DM6 3;  3I70 A;  1PTO D;  4IUP A;  1WD1 A;  3DM1 A;  1RCV D;  1ENF A;  3W2D A;  5EQ0 A;  2F0U A;  5EBC A;  2E75 C;  1R9T B;  3H94 A;  3MXN A;  3LNN A;  3HZX A;  1LT4 D;  1Y8O B;  5KYI A;  5M5Y B;  3F2U A;  1W6K A;  1KDA A;  2DY7 A;  5IGG A;  2BA1 A;  2B39 A;  4R8N A;  3A56 A;  4C3I G;  3UI2 A;  1A2T A;  3X3M A;  3EA6 A;  2Z4H A;  1DOM A;  3FVQ A;  3KF8 A;  3T4A C;  5C3X A;  3D4W A;  1CZG A;  4DFA A;  4H13 C;  1JOO A;  5FO9 B;  4O42 A;  5M9O A;  4NW2 A;  2PNR C;  1XWE A;  4HN7 A;  2B2V A;  4NDX A;  1SYE A;  1LTG D;  3N6R A;  4DN4 M;  2NN6 H;  3D6C A;  2ZXO A;  1LT6 D;  1JWS D;  2RKS A;  2SOB A;  2B2W A;  1IHZ A;  2JSO A;  1IYV A;  1TR5 A;  2NVY B;  5BN5 A;  1D6E C;  1KAA A;  2XN9 C;  1RF2 D;  2R6G A;  3CQZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...