1Y8PB

Crystal structure of the pdk3-l2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
97
Chain Sequence
b'SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8pB00
2AUJD 3PUVA 3GD7A 2E76C 4HR7B 3WDNA 2DNCA 1G291 2K32A 1O7LA 3D4RA 3ND8A 2A69C 3FMCA 1EWHA 4IQZA 1H9JA 2L5TA 3TZUA 3CRKC 1OXTA 2A69D 3A8KE 4DK0A 2PCFB 1GJXA 3ND9A 3PUWA 4KHZA 2JEBI 4H0LC 2K33A 4KN4C 2E75C 4TKOB 3M7NA 3HGBA 1Z7TA 3I72A 4JK1C 1LABA 5KNDA 1CTMA 3OW7A 3IFTA 1Y8NB 3SE0A 1Y8PB 4KKTA 1H9MA 2O5JC 2BA1A 2F1MA 1SMYC 3BDOA 3VR4A 5K36G 2JE6I 2B8FA 4G7ZC 1DD2A 2IT1A 3IKJA 2R6GA 1VDZA 2K7VA 1H9SA 2NN6I 1K8OA 4LJZC 4DNRB 5C0XG 1Z6HA 1H9KA 1ZKOA 2DNEA 1OXXK 3LWUA 1OXUA 2O5IC 4KKUA 3H94A 4RCNA 3MFYA 1B9MA 4JBWA 1Y69U 5BN4A 4GZYC 2B8GA 3PUXA 4KI0A 3PV0A 5BN3A 1I6VC 3QIAA 1GHJA 1H9SB 1OXVA 5BN5A 4OO1G 2EJGC 2CW0C 3LNNA 3VR5A 4L8JA 4PV1C 2DN8A 1BDOA 1E2VA 1YNJC 1PMRA 4G7HC 2YYZA 4XTCS 1CI3M 1VF5C 3KLRA 5K36H 3RLFA 1DXMA 1Q1BA 2V4DA 2JEAI 1HQMC 1HCZA 1GUOA 1Y8OB 3AB9A 4BA1I 3L7ZC 1VF7A 4DK1A 2D2CC 4KKSA 4OGQC 3QJYA 5C0XH 1Q12A 3A8IE 4KN7C 3M85A 2NN6G 3QG1A 1V8QA 4H13C 5KNCA 1FYCA 1IW7C 3OPOA 3P20A 1HPCA 5JEAG 1IW7D 2EDGA 4IFDG 2D62A 1DCZA 1ZYRC 4I7ZC 4DNTB 3M4YA 1OXSC 3FPPA 1IYVA 2QF7A 4OO1H 4KMUC 2BDOA 1QJOA 3VR3A 2PPBC 2EVBA 2KCCA 3T53B 3BG3A 3VA7A 3EQLC 4LK1C 4TQUS 1E2WA 5A35A 5KNBA 2A6HC 1H9RA 3W3AA 2JXMB 3I73A 3A7LA 1O78A 2A6HD 3VR2A 2D5DA 3NE5B 1GUNA 2BA0A 3PUZA 3SDZA 3OOCA 1YNNC 1HTPA 1V43A 1K8MA 3DXJC 4XIGS 3VR6A 1VCIA 3U9SA 1Q1EA 2KA7A 2EJFC 3N6RA 1T5EA 1GHKA 2PNRC 2A6EC 2EJMA 1IYUA 2AUKA 1GUTA 2NN6H 2A6ED 1A6XA 1CFMA 1GUGA 4BA2I 3A8JE 2Q8IB 5JEAH 4IFDH 3MXUA 2A68C 3A7AB 3I4LA 1E2ZA 2A68D 2BE5C 2E74C 1FR3A 3T51B 1TKWB 1TU2B 2BE5D 1B9NA 1Q90A 2LMCB 3D31A 2AWOA 1GUSA 1LACA 4H44C 3CRLC 2ZT9C 1ONLA 4G7OC 3GQBA 3T56B 3PUYA
chains in the Genus database with same CATH superfamily
4DR2Q 4RKBA 3VYTA 4R8IA 4HR7B 3KLSA 4TRDA 3MTSA 4LF4Q 1AEXA 1A0IA 3I8ZA 3HKZG 2L5TA 4Q5VA 2Q2HA 4IPCA 2FMMA 2L1BA 3M7NA 4DF7A 3PIPA 4DV6L 3JAMi 5C4JH 1E22A 1CZGA 2UXBQ 4K14A 4DR1Q 4ZRZA 5IE8A 4A3JG 1F77A 1T9HA 1SN8A 2IT1A 3G48A 5EKLA 2KHIA 2AQ3B 3GV6A 4YWLA 1EQRA 4K2LA 1Y1VH 2B63G 3RLNA 5EPLA 4FVMA 2UXDQ 1SNOA 2FMCA 3HOXH 4GN4B 3C46A 1HR0W 2CH4A 1OXVA 2HHHQ 1QUQA 2EXZA 5IGEA 2F0NA 2PMZE 1HTLD 4DV3Q 4LFBQ 3CHBD 3KDFB 3PO3B 1YIJA 1BUVT 4GNXC 4WJ3M 2V4DA 3R2TA 1V9PA 1E1TA 4O0AA 2R7FA 4PNYA 2L4NA 2K5WA 2RQXA 2OQKA 2IL8A 5CV9A 4CKEA 3NTHA 3KFUA 5ELNA 1UUPA 4C3IH 1E1OA 5COYA 4HJ9A 2AMCB 1PH3A 2CHBD 1CUKA 4OO1H 1D5XC 1SE8A 1G6PA 5KNBA 4DR4Q 1HA5A 4RCOA 2KHSA 4UP7A 1D5ZC 3NE5B 1BBWA 1CKOA 1YNNC 4ME3A 5KIXA 1KRTA 3L9AX 2E2JB 3SHLA 2K01A 1D6EC 3GTLH 4BY7G 4JI2L 1CM9A 3MEFA 3TZDA 2PZTA 3I4MG 1BXTA 1WTWA 2KCTA 3PIP3 3MXUA 4IFDH 2JQOA 1N36L 1VQ7A 3PQIA 1NR2A 3UE0A 2JP1A 4TSSA 1B70B 2ZXOA 4IPDA 1WCMG 4B3SQ 3DWAA 1Q82C 4A93B 1T5XD 4DV1L 4QL5A 1PFSA 2CQAA 4LF8L 3CCJA 4JBJA 3WDNA 1V1PA 1AE2A 2UUCL 1SRUA 2R92H 4DK0A 4ZYSA 4A3EB 3KBXA 1K83H 4TKOB 2K03A 1YHBA 2K14A 2UUBL 2F4IA 3IFTA 1TR5A 1N8RC 4LFAL 3S2HB 3OTOL 4KKTA 1W6KA 2DY7A 4PMWA 2MP1A 1VQFA 4UP9A 3OWFA 3VR4A 1DD2A 1PH6A 1VQDA 1I50B 2F0HA 1LV9A 3N52A 1PYBA 1SFOH 1Y1WB 4O42A 1M4VA 2K52A 2QDLA 3G4SA 4G4KA 1OXUA 5CORA 1JOQA 1N34Q 1B9MA 5IP9G 1I6VC 4BBRG 5FLMG 3M4OB 1B53A 4J6HA 4GKJQ 2K5VA 3ER0A 4CJ1B 1I3QB 1EY4A 4A3MB 1CI3M 4L63B 1X3EA 2IWHA 4ZKCB 1M1KC 2YTXA 3W1GA 3GTQH 4KY6A 1SYEA 1IBKL 1EQVA 2K75A 1UE6A 5C4XG 1CKNA 4IFDJ 1KLUD 2VNUD 4H13C 4IO9A 2D62A 3H0GB 4KTAA 1IBLQ 4MIUA 4X66Q 1BF4A 1FNWA 3M4YA 5F2DA 5FJ8G 5AJ3L 5CGKA 3GTPB 2F3VA 2PZUA 5HURA 1N32Q 2A6HD 3CAMA 4NPSA 2M2LA 4CKCA 1K8MA 2EY5A 4P75A 1KXLA 3DUZA 2G9HD 1FL0A 4A3BB 2EJMA 4A3IB 2PW5A 2A6ED 3P75A 1OTCA 1HNWL 1Z9FA 1M90C 2R61A 2BE5C 1J5EQ 1AP0A 5EBCA 1I94L 2ICIA 4WFN3 2ZT9C 4NW2A 3T56B 3BDLA 5C0XI 3BZCA 3TBIB 1YNXA 2I5LX 1NR4A 1SXTA 2R93G 1LYLA 4DAYA 1A2UA 2TMPA 3HOWH 1E24A 1GM5A 1TIID 3FMCA 3A8KE 2A69D 4JBKA 1GJXA 2WB1E 5EAYA 1HZ9A 5G3LF 4J15A 3PUWA 5IWAL 3PO3G 2I07B 4IN3A 5ELBA 4KJOA 4RHSA 3SK5A 2VQEQ 2F0WA 3BDOA 2NBFA 2XVSA 1RJTA 4IUUA 2Y0SB 1WJJA 1EFWA 4ULLA 2L55A 5CMDA 4AIMA 1XMQQ 2UU9Q 1PH4A 2EY1A 3MFYA 1WTQA 4Y7NB 2I5MX 1JQYD 2EYFA 4JCVE 1HUMA 1DYQA 2WP8J 2Z8LA 1F9PA 2PNHA 3KJPA 4GKKQ 4DR5L 3BYYB 1KD1C 3CQZH 3TRZA 4A3DB 2IW3A 4CDDC 1VQMA 1ILQA 3OIPA 3L7ZC 3CC7A 3MHBA 3ICEA 4L5QA 5GAHC 3UDGA 3CCLA 1EY5A 1GXDC 1SNCA 5KNCA 3OPOA 3K5LA 1B3AA 4K5VA 2ATWA 4OHJA 4DNTB 4A4IA 1ZYRD 3D6CA 1HZCA 4A93G 3VA7A 2F4VQ 2ZTDA 1SYFA 3W3AA 1WTXA 3SK6A 1MGSA 4DUZQ 4OWXB 3GTJB 4C3HB 4N9TA 4JYAL 4XXEA 2ZJRA 1GUWA 3STBC 1GUTA 2I5HA 1HNZQ 4F7XA 4BA2I 1VQGA 5FLXL 3AU7A 4WJ4A 1LT4D 3GTGB 1LTGD 5H1SE 3CF5A 2LSSA 1XX8A 1EZ8A 4DXGA 1Q7YC 4LFCL 2G5DA 3R8BA 1A3UA 2A5HA 1Y1WG 2EE1A 2F0JA 4BBSG 5IYBH 2NVXB 2B2UC 4JI8Q 2Z6KA 2LKVA 1PRTC 3NK9A 4K5WA 2F0PA 2Q2IA 4LUVA 4JI6L 1LUZA 2PQAA 2E75C 2VQFQ 4JI4L 4IPHA 3I72A 4A3FG 2L9HA 4A3MG 1CTMA 1VQ8A 1Y8NB 4YHHQ 4HJ8A 3D0FA 1PYWD 2HD3A 4JI3L 1XWEA 1VQOA 5K36G 4NKLA 2OQ0A 1HNXL 2R6GA 5EGTA 4FO2A 2O4XA 3VYUA 5C3EB 1DONA 3CCSA 2JA7H 1QUQB 5GADC 3K7AB 3H0GG 1OXXK 3V05A 3NBHA 1TQOA 5IT9L 4C3JB 1BKBA 2KCNA 5CYUA 1B1ZA 3KLSX 2JSOA 3A55A 2EZVA 2FXQA 3K5OA 2QKIC 1E7ZA 4J1MA 1MJEA 2PW7A 1SNPA 1X3FA 4DR7L 3M3YB 4LW1A 1IZ6A 1KNEA 1L1OB 4A3BG 4DV2Q 4A3IG 1HHVA 2EXDA 3QJYA 1KDCA 4APVA 3NP8A 1YITA 2IX0A 1CHPD 4UY8C 2R3ZA 1FYCA 1U4RA 1PH8A 2QA4A 3HKZB 5JVG3 2BCOA 1YI2A 4FF2A 4K8IA 5FLXE 2PPBC 4XT1B 4ZUIA 2KECA 2YU9H 1TWHB 4YCWA 1SYDA 4J8QA 2JXMB 3I4OA 3VR2A 4TVAB 5M3FG 1GUNA 2NVTH 1ASYA 5IP7G 4HJ7A 2QEXA 1PTOC 4A3EH 3BVZA 1WD1A 1Y14B 3VYSA 1MI2A 3H09A 3J7ZC 3UDIA 1JC7A 3S2HH 1XJVA 4QUFA 2Q2TA 4GNXA 2B63B 2A68D 1U4PA 1AZPA 3FRPB 1UE1A 1F2MA 2OWOA 4JW0A 1V1PB 2A74C 1I50H 2Y0SG 3A56A 4G7OC 1ONLA 5KYIA 2XRSD 1A2TA 3S9WA 4ZAIA 4HMJA 5IODA 3PUYA 4B3MQ 2ZM6L 1LTSD 4UPAA 5M5XB 2N49A 1KDBA 3VDYA 4P71A 2UXCL 3NWTA 2EY6A 4U68A 3C2PA 4XQJA 3TP5A 1VMCA 4S3SA 3GTMB 3QOJA 3F2DA 3M4OH 2YTYA 3OSOA 3Q8DA 1ESRA 1FNVA 5CV4A 3A5UA 5IT9E 4JK1C 1AW7A 4RGMA 1P16A 4LF5Q 3GTOB 4DU9A 4GLAC 3FP9A 4A3DG 3D3RA 3B6YA 3TS0A 4EQPA 4XT3B 3IKJA 5EKIA 2A73B 1I4XA 3DMUA 3CCUA 1CHQD 1K8OA 1JWUD 3M7GA 1JE4A 3PGZA 4UHVA 3MXNA 3H15A 4YY3L 2JA6G 1MKHA 4BY7B 5BN4A 3CP0A 5I6WA 3GV3A 3QIAA 4IZ8A 4NMZA 2K4KA 1K0RA 3K6OA 4G7HC 3HOVG 3I56A 4KJNA 4C3HG 1X56A 1RCVD 3OHXC 3I70A 1TWFB 4P73A 5C0XH 3F2UA 1X6OA 1ZXTA 2I0QA 3NQTA 1J8IA 1I6HB 4DV6Q 1X3QA 3NTKA 1XXGA 4DNIA 1HPCA 5JEAG 2RSOA 2VS1A 1NBWA 1PFNA 4NXNL 3GDEA 4R4QA 4C2MB 5C3XA 1A8VA 4FYDA 2BH8A 1EY6A 3Q24A 4A3LH 3HOYB 3EQLC 5M5YB 2B2TC 3OMGA 4DR6L 1JR0D 4HTHA 4H7BA 3OOCA 1MSHA 3PF4A 1PZKD 1SROA 1BCPB 1YNND 4DUYL 5GQOA 1Q1EA 1KC8C 1T5EA 4POGA 2EYPA 5E3FA 4C1NK 3SR1A 4KHPL 4FDBA 5ELDA 4Q0FA 5E4XA 4ABNA 1ET6A 2M00A 2A19A 2VL6A 4UAIA 1QNUA 1QVGA 1II3A 2KENA 2V1CC 2MHVA 1X3PA 3I4NB 1JMCA 1TWCB 2Q8TA 2WKDA 4GOPB 4C3JG 4DKAC 1U5KA 3NELA 3HOZG 3TZUA 4KY7A 3S15B 1VQBA 1I4PA 3J81L 1DOMA 4CJ2C 5C3WA 5J3BA 4LNQA 1UWVA 1XNRL 2F0MA 3R93A 3T1HL 2F0IA 5D14A 5FK9C 5JPNC 3KOJA 4ME5A 1SE4A 5CBAE 1W6JA 2E2HH 5C0XJ 1PA6A 4X3UA 4JI2Q 2K04A 4LF9L 4BY1G 2N8NA 4LJZC 4BXXG 4OWTB 4JI0L 1L2FA 4N8X1 3TREA 5J1ZA 3HRZC 1XTCD 1H9KA 2O5IC 2JA8H 3TP7A 4L5TA 1N36Q 4KI0A 4F88A 1G51A 1XYIA 3TP6A 1H9SB 4EQOA 3KYHC 3S14B 1DOKA 4DV1Q 3SEBA 2EQSA 1Q1BA 4LF8Q 3J81i 4BA1I 2UUCQ 1K73C 1QNKA 3IL8A 1QOHA 4DV7L 5ELFA 3TMEA 2JYOA 2R93B 3QR8A 1ENCA 2UUBQ 3X3NA 1EYGA 1DJRD 3HP3A 1F2YA 5JJLA 1LTAD 4LFAQ 3OTOQ 5M9OA 2NVXH 2IX1A 1N9WA 5M3MB 4M1UB 5IYCH 3LWEA 1TWGB 3HZXA 1O78A 4DV0L 2JA5B 3VR6A 1LTTD 1NMGA 2ZJQA 2KHJA 2UUAQ 4DV4L 4MTNA 3MFGA 2AUKA 1EZ6A 1A6XA 5EBDA 3J7AV 1BO0A 1D2BA 4QY7A 3A8JE 5JAVA 1FVIA 1XPRA 4RAUC 3J81E 2E8GA 4KD4A 5CBEE 1Z47A 3G71A 2BE5D 1B9NA 3FHWA 5C3EH 3PF5A 2NVYH 1VQ4A 3P1HA 3DEOA 1IBKQ 1LM0A 4IUTA 4QQBX 1B4OA 1S5ED 3K7AH 3KF8A 1ENAA 4B3RL 4DV5L 1O7ZA 1PZJD 4JV5L 2RBMA 3FKIH 2PO4A 4IUPA 3MAQA 5LMNL 4L6TB 3BZKA 2NVQB 3OW2A 3RR5A 3C1EA 3ND9A 5AJ3Q 4JG2A 4RGNA 3SVMA 3M3YH 4MZ9A 1Z7TA 5KNDA 4XQQA 1STGA 4X3KA 3SE0A 3HFZB 3M9BA 3T16A 5LL6X 1H9MA 1KQSA 4IOCA 1JB7A 3NBHB 1NUCA 2E2IB 1QWYA 2H1EA 3AFQA 1WOCA 4KY5A 2ASBA 2WV6D 3CU7A 1VQ9A 1HNWQ 5CV6A 3J80c 4P74A 4GN5A 2GVAA 2B3GA 5EJWA 1TWHH 3HOYG 1I94Q 3EJIA 1R9TB 4FXDA 3O13A 1GHJA 2B2UA 3URYA 2AQ1B 5IOCA 1HA6A 2Z6BA 2DN8A 4A3JH 4GN3B 2AKWB 2F0TA 1VF5C 4EVOA 3S17H 1EIHA 3S1RB 1IHZA 4FXGC 1QVFA 1JT8A 4BBSB 2FJ2A 4KHVA 4IURA 1A3VA 4KN7C 1WFQA 2NN6G 2B63H 4HIMA 4GS3A 5IWAQ 2OT2A 3I3CA 4EQNA 1UE5A 3FPPA 4HIDA 2K5NA 1IYVA 1VS0A 4DPGA 3I4NG 1KAAA 4OXPA 1Q86C 2NTTA 1EL0A 3AEVA 4IUNA 1FGUA 4C1NI 2D0PA 4A3FB 5I2YA 1EEID 1K9MC 1AFPA 2DJFC 2RDFA 4XQNA 2XWJB 2CH4W 3GTMH 3JAMc 3FPUB 4ZLTF 3N6RA 2PNRC 4IUVA 1LT3D 1TWAH 4QJFA 2B2VA 3STBD 4CDCC 4EGVA 1JICA 2B2WA 4R4OA 1E2ZA 5M5WB 4R9WA 1L0XB 3F2BA 3L3OC 4DR5Q 2AWOA 1LACA 4IJHA 1XTDA 1S72A 3UE1A 4YCUA 1TS4A 3CCMA 1M8AA 1SNQA 4QGUA 1O7LA 1C4QA 1PRTD 4BY7H 4KV6A 1HH2P 3CRKC 3H91A 5GROA 2F0UA 2PCFB 2ALYB 3I4MH 4K0KL 2K33A 2SNSA 4FXKC 3Q0AA 4QB4A 2HQEA 3AMUA 2QW7A 1XMOL 1TS3A 2KQ3A 4A76A 3FEWX 1ENFA 4BS9A 2EYMA 3BJUA 3NPPA 2B8FA 1WCMH 1S4ZA 2EYJA 2K7VA 4JYAQ 1QILA 1I6HH 3U58A 1JE5A 2WINB 5M3FB 1PTOH 3RZOH 1HR0L 1TT2A 3LWUA 2DNEA 5TSSA 2VUMB 2P5ZX 4B3TL 1NJIC 4QIWB 2JA9A 5M5YH 5M3MG 4G57A 3PUXA 3F8TA 4LFCQ 2L15A 5E1FA 1X54A 3I91A 3S1QB 2JA5G 2A8VA 3H3VH 3RLFA 3S1MB 5LMUL 1B2TA 1HQMC 4ALPA 2NTSA 3EFXD 1WTVA 4JI6Q 1HZBA 4OELB 4JI4Q 2VZAA 4X65L 1KHIA 1PVOA 1SEBD 2QEJC 4A3GB 4DR3L 1NAPA 5IP9H 1S40A 3I2ZA 1YZ6A 4HJ5A 4JI3Q 2MPMA 2QF7A 3UDFA 4BBRH 1TWCH 1C7YA 5FLMH 1HNXQ 1TXYA 1MSGA 5A35A 3KF6B 3MZ5A 3A7LA 3AFPA 1LT6D 5JPMC 1HJPA 3K5MA 1S5DD 1HTPA 4XIGS 3KJOA 3A0JA 1K3RA 2KA7A 3ERSX 1PTOD 1LLRD 5C4XH 3HEJA 1RHPA 3VA5A 1ILPA 5HGQA 2KJXA 3KUPA 4A3KB 2CQOA 3EIVA 3OWEB 4RG1A 4DR7Q 5FJ8H 4A3CG 1L1OC 2VXWA 1EIGA 3K8AA 3E5SA 1GUSA 2JA6B 2OF1A 4K6DA 1AZQA 3C1FA 1QE6A 1R4PB 5LHY1 4RGOS 5GAEC 2E76C 3PO2B 1X65A 3HOVB 2NZOA 4I7AA 1LO5D 3ULPA 1K0SA 3E3XA 1H9JA 3TS2A 3Q6SA 3CKIB 2B2TA 5C4ZA 1I5FA 1RF2D 2K5HA 2WKCA 3ZJYC 1UNSA 2Y0SE 5C4JB 1S5CD 3CCVA 1A62A 2JE6I 1NE3A 2F0VA 2R93H 1BVSA 5IYDG 2F52A 3T13A 4CKBA 1WTHA 1KNAA 2XRQD 1QB5D 4LAAA 4HMIA 3W5OA 1CQFA 2XN9C 3BVGA 1HZAA 2F0EA 2SEBD 3NEMA 5DEHA 2D9UA 2XSCA 4JBWA 3HOUG 1K8GA 5KGUA 3RZDB 3PSIA 3PO3H 2CVRA 3C3LA 2ZM6Q 2CW0C 5DM63 1E2VA 4Z9CB 1YNJC 1PMRA 2ZXPA 2RKSA 2EYHA 1DXMA 3GO5A 2JN4A 3TQYA 1SE2A 5IY0A 2D2CC 2F0GA 2F0DA 3A8IE 2WAQG 2TSSA 2Z0SA 4IPGA 3QG1A 1ICWA 2WB1G 1EIFA 3P20A 2ZTCA 4YIJA 3HOZB 1EIYB 2OXPA 1VQKA 2JJQA 2R7ZG 1SJHD 4KMUC 1NSNS 4C3IB 3UDXA 5DAUA 1Q81C 2F0OA 5C44G 3IFDA 2F0KA 3CD6A 2E2JH 1SNDA 1W3SA 2NVQH 1VQIA 4YY3Q 4AYBB 1VQCA 2LY7A 1D8LA 1E3PA 1GUGA 3T1YL 4BY1B 3GTLB 3RN2A 2RHQB 1SYCA 3A7AB 3NBIA 2F3WA 1TU2B 4A93H 1FJGL 1PH5A 2C5CA 1CSQA 1NY4A 4RWSC 1AN8A 2VUMG 4WJWA 4V190 1PFMA 1VQ5A 3D4WA 4NXNQ 2KEEA 1UAPA 4KN4C 4KD3A 1W2BA 2R92B 1GKHA 4K6LA 4DR6Q 4A3LG 1K83B 5BR8L 2C9OA 4LWCA 4U673 1BCPC 1SNMA 3H3VC 3W2DA 1Y1WH 4DUYQ 4G7ZC 4BBSH 3ITPA 2MO1A 3NXWA 4NXML 4CHTB 3TN2A 5CV7A 4KHPQ 4KK7A 3J81j 4A3GG 3CMEA 3M4PA 1Z6HA 3K80C 2ENBA 4DK6C 2RDGA 1D1KA 1B50A 4KKUA 3G6JB 4MN3A 5KEEA 5EKKA 2CWPA 5HGTA 2KOLA 1EY7A 1Y69U 5JJIA 1F9QA 2F0FA 1EYAA 3TEHB 1CK1A 2B2YC 1SMXA 3PV0A 1I3QH 1RTNA 2K50A 5BN3A 4A3FH 4A3MH 4OX9L 4GOPC 1EOVA 1PRTF 1C9OA 4RGTA 2E5LL 2RHSB 5K36H 1VQHA 3ULJA 3U9OA 2J4XA 5J22A 2HIVA 1JWSD 1F2ZA 1F9RA 1U9RA 3HKZE 4A3KG 4K8JA 5IGDA 2JK8A 2Z4IA 3H0GH 3QOLA 5E7NA 1XNRQ 3T1HQ 2OTJA 3GTPH 2K6AA 2YV5A 2K1BA 4I7ZC 1CKMA 1OXSC 4MNOA 4FNFA 3VR3A 1QJOA 1E0BA 3IAYA 4P2CB 2EVBA 3I90A 1IYJB 3L0OA 4QMGA 1H95A 2F0QA 1E2WA 4JI5L 3PO2G 1NCVA 1CKNB 4HEDA 1U0LA 4LF9Q 3PCOB 4JI0Q 3AYHB 4LF6L 2B29A 4A3BH 2PI2E 4A3IH 1VCIA 1O7IA 1RKNA 2EJFC 5J39A 2K5DA 2O2LD 2YTVA 3NWSA 4RH6A 2XIWA 5I9OA 3A54A 3ZYYX 1STNA 3K57A 1EWCA 5FLXc 1IBML 1OO9B 4NDXA 4FP5D 5JVH3 3BZDB 4X64L 2LMCB 2HT1A 3D31A 1EYDA 4H44C 2RF4A 4CGYB 3I7FA 3GQBA 1KL9A 3U4VA 1EU4A 4DV7Q 2Q8RE 5I6YA 5I2XA 5IP7H 1MBYA 4B08A 1Y1VG 5IGFA 3BYTB 1EWHA 1JORA 1CQVA 1OXTA 1BBXC 4YWMA 1RODA 3HOWB 4RMFA 4X3TA 3HOXG 4K5XA 2IHEA 3HGBA 4AQYL 2F0LA 1XNQL 1JCKB 5IGGA 3H3VI 4DAYB 1PTOF 1Y8PB 4DV0Q 4FF3A 3RNUA 1XPUA 1GVPA 1JJ2A 4ODGA 5KRUA 3CCQA 4DV4Q 2NN6I 4JPBW 1N33L 3T4AC 4XYOA 2D0OA 4Y7NH 3H94A 4O2DA 1FNUA 5IT9c 3LGJA 5JJKA 4C3IG 2VW9A 1B8AA 2B8GA 2Q2UA 1VQPA 1IL2A 1BNZA 4OO1G 4R8NA 3TP8A 4X62L 3VR5A 4ZQ3A 4A3DH 5IGCA 2SOBA 4RKLA 4B3RQ 4DV5Q 4IUQA 4JV5Q 2BDNA 4CJ0B 1Y8OB 3CW2C 5EPKA 3K59A 4R4IA 5LMNQ 4AYBG 5GAGC 3CQZB 3FKIG 4OWWB 5DLQE 5ELEA 1IW7C 1PZID 1F2LA 3G6EA 4DAPA 2J7ZA 4IFDG 2JA6H 2N78A 1DCZA 2X6GA 1PXUA 3DHQA 4JI1L 2BDOA 4DK3C 1DOLA 2CFMA 1KDAA 1H9RA 4OONA 2EPBA 3HOVH 3GTJH 4ZK9B 4C3HH 4N9PA 1EOTA 1Q3LA 2LXJA 4ZUJA 2MJ8A 3PIOA 1O7YA 1WTPA 1SLJA 3J80E 2R92G 1CT1D 3GTGH 5ELCA 5JEAH 2N55A 4M8AA 3FDTA 1UE7A 1KTKA 1NNXA 3T51B 5CR3A 3CXCA 1R4QB 1V1QA 4E6IA 4R4TA 1L0WA 4LMQD 3E9IA 3DM3A 1XPOA 1WI5A 2WIIB 1MIUA 4JC0A 2K32A 1V1OA 1KRSA 2H5XA 5K5PA 4IQZA 3RZDH 1PH9A 1VQEA 1X32A 3AQQA 2K5QA 3NENA 4KHZA 1D7QA 1PDQA 2N3SA 3E6ZX 2R7DA 1O80A 2BH2A 2CWAA 1PH7A 1C48A 1YJ9A 1KABA 2O5JC 2F1MA 1SMYC 2FINB 1BQQT 1ICFB 2AQ2B 1VDZA 4JI7L 3S24A 2PQAB 3S16B 2L11A 4HSVA 4C3JH 4FF1A 3JAME 1PH1A 5JJZA 3HOZH 1ZKOA 1L1OA 2JA7B 4RCNA 4HSPA 3EVQA 1YJNA 2Z9HA 2C35B 4WORA 5C4HA 4LF7L 1DZ1A 1STHA 2H4OA 1GD7A 5BN5A 1P8LA 3LNNA 4PV1C 1I4HA 4XTCS 1CZWA 2JEAI 1EFID 1HCZA 1IL8A 2KVMA 5I9PA 3CCEA 4PMCA 4IOAA 2MNAA 4DR2L 4BY1H 4BXXH 3PIO3 2EOTA 4KLKA 1PYSB 5JEAJ 3M85A 4K0KQ 2J0TD 5AFWA 4LF4L 1WYDA 3ONAB 2EDGA 1XMOQ 1LT5D 4DN4M 4HJAA 1EWIA 3KLWA 1RL2A 4PZ6A 1PLFA 2KCCA 5A2QL 1EQQA 2XNAC 2PI2A 1TY0A 3I73A 2UXBL 4DR1L 1HFNA 2YU9B 3DXJC 1HR0Q 1K3BC 4DA2A 4CBVA 4X3SA 5L37A 4OIJA 1Q8KA 3HOWG 2GVBA 4B3TQ 4C56C 3F2CA 1X3GA 2NVTB 4ZKBB 4DAMA 1UEBA 1PHJA 3RN5A 2UXDL 1JWMD 4HCEA 3W1BA 5LMUQ 5M5XH 3R3OA 3HOUB 2HHHL 2L12A 2FHTA 1ET9A 4DV3L 2ZTEA 4LFBL 3V2TA 3GD7A 4X65Q 1K28A 3DWQA 4GNXB 1WTRA 2MFIA 4DR3Q 3FVQA 3S2DB 1G8ZD 2UUAL 3J7YW 1D1IA 2XWBB 3GTOH 3J81c 2WAQB 2QILA 1PH2A 2K05A 1DM0B 1SDFA 4F87A 2LFNA 1HXYD 4JBMA 2WB1B 1RTOA 2RVLA 4XDXA 2AWNA 4OIKA 3J7AF 2R7ZB 2NYZD 2LXKA 3RD4A 5IIFA 1MJCA 2HUGA 4JOIC 4DR4L 2ES2A 4DNRB 5C44B 3UI2A 4XYQA 2PZWA 5HY6A 1ASZA 1QVCA 1TS5A 3L2PA 2RCFA 5CV8A 2EJGC 1NTGA 4X6AH 1EUJA 2MUYA 2CW0D 1EYCA 2HCIA 4B9XA 1TWFH 4HIOA 1YNJD 5A2QE 1QZGA 3RUZA 1Q46A 3MXNB 3CMAA 4B3SL 2AHOB 4PMBA 1Q12A 2DY8A 3MA2B 1AH9A 5EQ0A 4ZCKA 2OEOA 2MQHA 4C2MH 4HN7A 3HOYH 3M4QA 3S1NB 4PQXA 4A75A 3K0YA 3HKSA 5D3IB 1WTOA 5IYBG 1EEFD 2FFKB 3R2IA 2WAQE 3MXPA 4QUCA 2F0SA 1GHKA 3DM1A 2B2YA 3OMCA 2NN6H 1U4LA 1ESFA 3VYRA 4GOPA 1I4QA 2Z4HA 3MVVA 4LUZA 4NP5A 1SE3A 3BDCA 3OIQA 1N34L 3I4NH 1Q90A 1STYA 1SR3A 4OL7A 4DGZA 4GKJL 3A74A 3PUVA 2SDFA 2EYLA 2HCCA 2JA7G 3S15H 2DNCA 3D4RA 1S3OA 4LUOA 1VQNA 3HG9A 4EX5A 4MHEA 3MWYW 1VQJA 3K81C 2JEBI 1SSOA 2ZXRA 5CC4A 5E4WC 2WACA 1EY8A 1IBLL 4X66L 3A5ZB 4PZ7A 1BCPD 1SYGA 3QB3A 3CCRA 1H9SA 1N32L 2KCMA 2E2HB 3CPWA 3GTKB 1D5MC 4AH6A 3T1YQ 4QIWE 3D6WA 4V0BA 1C0AA 4O1NA 5ELOA 5I4DA 1KIXA 4HCSA 4RA8A 2JA8B 3JC66 1FJGQ 1A15A 3S14H 3SGIA 2IJ0A 4UDUC 1IKMA 1GOZA 2CKZB 1JB3A 1BDOA 2IPKD 3WOFA 2YYZA 1J5EL 1J6QA 1SBBB 3E9HA 4OGQC 4A3EG 2ID0A 3DEPA 3KDFA 3EA6A 3WOEA 3DWPA 3BU2A 2GN5A 3EN2A 5BR8Q 1Y1VB 2NB0A 5M3MH 1JOOA 1TWGH 4I65A 3HOXB 3T53B 1BBUA 3E0JA 5ISRA 2JA5H 4NXMQ 2A6HC 5C6AA 2UXCQ 2D5DA 3PUZA 3SDZA 1WD0A 2VQEL 2QCPX 2RSNA 2I46A 1VQ6A 2EYOA 1PV4A 4L5SA 1S5FD 4R1JA 2CCZA 2F3IA 2G9DA 2A6EC 3SK4A 5FKAC 1CSPA 1CFMA 1G2TA 1XMQL 2UU9L 4OX9Q 2NZHA 1WVLA 3K5NA 3E0EA 4WRDA 2E5LQ 2L0CA 2VB2X 2E74C 3BVMA 3F1ZA 4PZ8A 4GLXA 3G7LA 3CRLC 3S16H 1VMPA 3NQIA 1AE3A 2M9VA 1I4RA 3GP7A 3ULLA 4GKKL 2NVYB 2IX3A 5DM73 1K8AC 2A69C 5T1GA 3V96A 2XGTA 4HIKA 1RIPA 1TS2A 3U4ZA 4OO1I 2OCEA 3FKIB 3CC4A 3I55A 4HAEA 4H0LC 2OTLA 1F9SA 5KYLA 1LABA 3KF8B 4JI5Q 2B2VC 4A3CH 2NWGA 2E2IH 1LTLA 2B2WC 1EQTA 1B3QA 2BA1A 4LF6Q 1YHQA 1STEA 2F4VL 1Q8IA 1EU3A 1QCBD 2EIFA 2ICEC 5C0XG 5D65A 4IFDI 3IRBA 4DUZL 1JJGA 1R9TH 1IBMQ 1IKLA 1LTBD 4X64Q 4GZYC 1HNZL 3ERQA 1JOKA 3RLOA 2N88A 5D3DA 2IY5B 1QG7A 2KEDA 1SJED 3QWNA 1I4GA 3S1RH 3KLRA 4YWKA 1UEAB 5FOBB 3AB9A 4A3JB 3WWVA 1VF7A 4FF4A 3S17B 5IYDH 2KBNA 4H02A 1A63A 3TDQA 4JI8L 3K0XA 1G2SA 5FO9B 2PYKA 4IALA 5CV5A 3DLLA 2MO0A 1G91A 4AQYQ 5FO8B 1L0YB 1TVXA 1SFOB 2GA4B 1PRTB 3CPFA 3U50C 3MXGA 1XNQQ 3J7A5 1IW7D 4DXFA 3HOUH 1J9OA 1ZYRC 4RHRA 1C8CA 1KLGD 2VQFL 4L5RC 4TQUS 5JOBA 1ML0D 1S5BD 4YCVA 4POFA 2QGQA 1N33Q 4YHHL 1HRJA 4AYBE 2BA0A 1BR9A 1KAWA 3S2DH 4ID6A 3K7UC 5NUCA 5C5MA 4R4CA 3GTQB 1IYUA 1SAPA 1G6ZA 5M5WH 3EBEA 1STBA 1IXRA 3D4DA 4BWGB 1ZEQX 4X62Q 2E2DC 2Z1CA 1TWAB 2R7ZH 2PQEA 5DNFA 4EQ5A 3MC0B 5FO7B 1YEZA 2XTIA 1EY9A 2HDLA 3RMHA 3Q23A 4DFAA 1MHWC 2LS01 1VQAA 5C44H 1YVCA 4P72A 1FGBD 4RFBA 2AUJD 2RDHA 3BS1A 2ZJPA 1G291 3ND8A 4DV2L 1YJWA 2JA8G 3KK7A 1FD7D 4MTKA 4JI1Q 2HQLA 3SXHA 3D8GA 4QF4A 5LMNW 3OW7A 3I4MB 2BOSA 1VQLA 1STAA 1PFBA 3H6MA 2VY3A 1YBYA 1DGSA 1SMYD 2HDMA 5M3FH 1SYBA 2VUMH 1B44D 5EPJA 1WCMB 1EY0A 4ILWA 4F8MA 3J80L 2B39A 4NB3A 2DGYA 1U4MA 2VB3X 1CA6A 4Y52H 2QDBA 3S1NH 2DUDA 2SNMA 1PTOB 3RZOB 2IHFA 4K2KA 3SK8A 1HFGA 5LL6S 3S1QH 3S1MH 2MGSA 4L8JA 5IYCG 4IJLA 1X9NA 1JJCB 2RCNA 1B7YB 3NSWA 2A1AA 2NZ1D 2RA4A 3HS0C 3Q22A 1GUOA 3P7JA 3X3MA 4QCLA 4DK1A 4B3ML 4KKSA 1HUNA 1QZHA 1LTID 1RDPD 3KF6A 4A3GH 5C5LA 3QO2A 1V8QA 2Z6KC 1HQRD 2EY2A 2K28A 1BCPF 2WFWA 2X6LA 2KUMA 4N8FA 3MEHA 2NUCA 4JOIA 3J80i 3BG3A 3EROA 2HIXA 4LK1C 5C3EG 3KBGA 3NTIA 4LF5L 4JVZA 3PMFA 1NMFA 1A3TA 4BBRB 3NUCA 4PG3A 5G3LD 4JI7Q 1V43A 3JAML 1LTRD 5IGBA 1MD2D 2PMZB 3U9SA 2X69A 4GLVB 4A3KH 1TY2A 4CDEC 3CC2A 3OYYA 4LF7Q 2F03A 4CDFC 2Q8IB 2DJGC 5C4XB 2A68C 4OEMB 3K58A 3I4LA 4UP8A 3NHHA 1GO3E 1FR3A 4B9WA 1TKWB 1RD9D 1X55A 4DAVA 1CA5A 1BOSA 3GTKH 5T1IA 1YHAA 3TSSA 3LX0A 3PO2H
chains in the Genus database with same CATH topology
4RKBA 3VYTA 4R8IA 4HR7B 3KLSA 4TRDA 3MTSA 1AEXA 3I8ZA 2L5TA 4Q5VA 2FMMA 2L1BA 3M7NA 4DF7A 1CZGA 4K14A 4ZRZA 1F77A 2IT1A 5EKLA 2AQ3B 3GV6A 4K2LA 5EPLA 4FVMA 1SNOA 2FMCA 3C46A 1OXVA 2EXZA 5IGEA 2F0NA 1HTLD 3CHBD 3PO3B 1BUVT 2V4DA 3R2TA 4PNYA 2L4NA 2K5WA 2RQXA 2IL8A 5CV9A 4CKEA 3NTHA 1UUPA 5COYA 2CHBD 4OO1H 1D5XC 5KNBA 1HA5A 4RCOA 2KHSA 1D5ZC 3NE5B 1YNNC 5KIXA 3L9AX 2E2JB 3SHLA 2K01A 1D6EC 1CM9A 3TZDA 2PZTA 1BXTA 1WTWA 3PIP3 3MXUA 4IFDH 1NR2A 2JP1A 4TSSA 2ZXOA 4A93B 3DWAA 1T5XD 2CQAA 3WDNA 1V1PA 4DK0A 4ZYSA 4A3EB 3KBXA 4TKOB 2K03A 2F4IA 3IFTA 1TR5A 3S2HB 4KKTA 1W6KA 2DY7A 4PMWA 2MP1A 3OWFA 3VR4A 1DD2A 1I50B 2F0HA 1LV9A 3N52A 1Y1WB 4O42A 1M4VA 4G4KA 1OXUA 5CORA 1JOQA 1B9MA 1I6VC 3M4OB 1B53A 4J6HA 4CJ1B 1I3QB 1EY4A 4A3MB 1CI3M 4L63B 2IWHA 4ZKCB 4KY6A 1SYEA 1EQVA 4IFDJ 1KLUD 2VNUD 4H13C 2D62A 3H0GB 4KTAA 4MIUA 1BF4A 1FNWA 3M4YA 5F2DA 5CGKA 3GTPB 2F3VA 2PZUA 5HURA 2A6HD 2M2LA 4CKCA 1K8MA 2EY5A 3DUZA 2G9HD 4A3BB 2EJMA 4A3IB 2PW5A 2A6ED 3P75A 2R61A 2BE5C 1AP0A 5EBCA 2ICIA 4WFN3 2ZT9C 4NW2A 3T56B 3BDLA 5C0XI 3TBIB 1NR4A 1SXTA 4DAYA 1A2UA 2TMPA 1TIID 3FMCA 3A8KE 2A69D 1GJXA 5G3LF 3PUWA 2I07B 4IN3A 5ELBA 4KJOA 4RHSA 3SK5A 2F0WA 3BDOA 2NBFA 2XVSA 1RJTA 4IUUA 2Y0SB 4ULLA 2L55A 5CMDA 2EY1A 3MFYA 1WTQA 4Y7NB 1JQYD 2EYFA 1HUMA 1DYQA 2WP8J 2Z8LA 1F9PA 3BYYB 4A3DB 2IW3A 1ILQA 3OIPA 3L7ZC 3MHBA 1EY5A 1GXDC 1SNCA 5KNCA 3OPOA 3K5LA 1B3AA 4K5VA 4OHJA 4DNTB 1ZYRD 3D6CA 3VA7A 1SYFA 3W3AA 1WTXA 3SK6A 1MGSA 3GTJB 4C3HB 4N9TA 4XXEA 1GUWA 1GUTA 4F7XA 4BA2I 5FLXL 3AU7A 1LT4D 3GTGB 1LTGD 1XX8A 1EZ8A 4DXGA 3R8BA 1A3UA 2A5HA 2EE1A 2F0JA 2NVXB 2B2UC 2LKVA 1PRTC 3NK9A 4K5WA 2F0PA 2E75C 3I72A 2L9HA 1CTMA 1Y8NB 1PYWD 1XWEA 5K36G 4NKLA 2R6GA 5EGTA 4FO2A 2O4XA 3VYUA 5C3EB 1DONA 3K7AB 1OXXK 3V05A 3NBHA 1TQOA 5IT9L 4C3JB 2KCNA 5CYUA 1B1ZA 3KLSX 2JSOA 3A55A 2EZVA 3K5OA 2QKIC 4J1MA 2PW7A 1SNPA 3M3YB 1KNEA 1HHVA 3QJYA 1KDCA 3NP8A 2IX0A 1CHPD 2R3ZA 1FYCA 1U4RA 3HKZB 5JVG3 2BCOA 4FF2A 4K8IA 5FLXE 2PPBC 4XT1B 4ZUIA 2KECA 1TWHB 1SYDA 4J8QA 2JXMB 3VR2A 1GUNA 1PTOC 3BVZA 1WD1A 3VYSA 1MI2A 3H09A 1JC7A 4QUFA 2B63B 2A68D 1U4PA 1AZPA 3FRPB 1F2MA 1V1PB 2A74C 3A56A 4G7OC 1ONLA 5KYIA 2XRSD 1A2TA 3S9WA 4ZAIA 4HMJA 5IODA 3PUYA 1LTSD 5M5XB 1KDBA 3NWTA 2EY6A 4U68A 3C2PA 4XQJA 3TP5A 1VMCA 4S3SA 3GTMB 3QOJA 3OSOA 1ESRA 1FNVA 5CV4A 5IT9E 4JK1C 1AW7A 4RGMA 3GTOB 4DU9A 3D3RA 4EQPA 4XT3B 3IKJA 5EKIA 2A73B 1I4XA 3DMUA 1CHQD 1K8OA 1JWUD 3M7GA 1JE4A 3MXNA 4BY7B 5BN4A 5I6WA 3GV3A 3QIAA 4IZ8A 4NMZA 3K6OA 4G7HC 4KJNA 4C3HG 1RCVD 3OHXC 3I70A 1TWFB 5C0XH 3F2UA 1ZXTA 3NQTA 1J8IA 1I6HB 1X3QA 3NTKA 1XXGA 1HPCA 5JEAG 2RSOA 1PFNA 4C2MB 5C3XA 4FYDA 1EY6A 3Q24A 3HOYB 3EQLC 5M5YB 2B2TC 3OMGA 1JR0D 4HTHA 4H7BA 3OOCA 1MSHA 1PZKD 1BCPB 1YNND 1Q1EA 1T5EA 2EYPA 5E3FA 4C1NK 3SR1A 5ELDA 4Q0FA 5E4XA 4ABNA 1ET6A 2M00A 4UAIA 1QNUA 1II3A 2MHVA 1X3PA 3I4NB 1TWCB 2Q8TA 2WKDA 4C3JG 3TZUA 4KY7A 3S15B 1I4PA 3J81L 1DOMA 4CJ2C 5C3WA 2F0MA 3R93A 2F0IA 5D14A 5FK9C 5JPNC 4ME5A 1SE4A 5CBAE 1W6JA 5C0XJ 4X3UA 2K04A 4LJZC 5J1ZA 3HRZC 1XTCD 1H9KA 2O5IC 3TP7A 4KI0A 4F88A 1XYIA 3TP6A 1H9SB 4EQOA 3S14B 1DOKA 3SEBA 1Q1BA 4BA1I 1QNKA 3IL8A 1QOHA 5ELFA 3TMEA 2JYOA 2R93B 1ENCA 3X3NA 1DJRD 3HP3A 1F2YA 1LTAD 5M9OA 2IX1A 5M3MB 4M1UB 3LWEA 1TWGB 3HZXA 1O78A 2JA5B 3VR6A 1LTTD 3MFGA 2AUKA 1EZ6A 1A6XA 5EBDA 3J7AV 1BO0A 1D2BA 3A8JE 5JAVA 4RAUC 3J81E 4KD4A 5CBEE 1Z47A 2BE5D 1B9NA 3P1HA 3DEOA 4IUTA 1B4OA 1S5ED 3KF8A 1ENAA 1O7ZA 1PZJD 2RBMA 4IUPA 2PO4A 3MAQA 4L6TB 2NVQB 3C1EA 3ND9A 4RGNA 3SVMA 1Z7TA 5KNDA 4XQQA 1STGA 4X3KA 3SE0A 3T16A 5LL6X 1H9MA 1NUCA 2E2IB 1QWYA 2H1EA 4KY5A 2WV6D 3CU7A 5CV6A 5EJWA 3EJIA 1R9TB 4FXDA 3O13A 1GHJA 2B2UA 3URYA 2AQ1B 5IOCA 1HA6A 2DN8A 2F0TA 1VF5C 4EVOA 1EIHA 3S1RB 1IHZA 4FXGC 4BBSB 2FJ2A 4KHVA 4IURA 1A3VA 4KN7C 2NN6G 2OT2A 3I3CA 4EQNA 3FPPA 1IYVA 1KAAA 1EL0A 2NTTA 4IUNA 4C1NI 4A3FB 5I2YA 1EEID 1AFPA 2RDFA 4XQNA 2XWJB 3FPUB 4ZLTF 3N6RA 2PNRC 4IUVA 1LT3D 2B2VA 4EGVA 1JICA 2B2WA 1E2ZA 5M5WB 4R9WA 1L0XB 3L3OC 2AWOA 1LACA 1TS4A 1M8AA 1SNQA 1O7LA 1C4QA 1PRTD 4KV6A 3CRKC 3H91A 2F0UA 2PCFB 2K33A 2SNSA 4FXKC 3Q0AA 4QB4A 2HQEA 3AMUA 1TS3A 2KQ3A 3FEWX 1ENFA 4BS9A 2EYMA 3NPPA 2B8FA 1S4ZA 2EYJA 2K7VA 1QILA 5M3FB 2WINB 1PTOH 1TT2A 3LWUA 2DNEA 5TSSA 2VUMB 4QIWB 4G57A 3PUXA 5E1FA 3I91A 3S1QB 3RLFA 3S1MB 1B2TA 1HQMC 2NTSA 3EFXD 1WTVA 1SEBD 2QEJC 4A3GB 1NAPA 2MPMA 2QF7A 1MSGA 5A35A 3MZ5A 3A7LA 1LT6D 5JPMC 3K5MA 1S5DD 1HTPA 4XIGS 2KA7A 1PTOD 1LLRD 3HEJA 1RHPA 3VA5A 1ILPA 2KJXA 3KUPA 4A3KB 3OWEB 2VXWA 1EIGA 3E5SA 1GUSA 2JA6B 2OF1A 4K6DA 1AZQA 3C1FA 1QE6A 1R4PB 5LHY1 4RGOS 2E76C 3PO2B 3HOVB 1LO5D 1H9JA 3Q6SA 3CKIB 2B2TA 5C4ZA 1RF2D 2WKCA 1UNSA 5C4JB 1S5CD 2JE6I 2F0VA 3T13A 4CKBA 1KNAA 2XRQD 1QB5D 4LAAA 4HMIA 1CQFA 2XN9C 3BVGA 2F0EA 2SEBD 5DEHA 2D9UA 2XSCA 4JBWA 5KGUA 3RZDB 2CVRA 3C3LA 2CW0C 5DM63 1E2VA 4Z9CB 1YNJC 1PMRA 2ZXPA 2RKSA 2EYHA 1DXMA 3GO5A 1SE2A 2D2CC 2F0GA 2F0DA 3A8IE 2TSSA 3QG1A 1ICWA 3P20A 4YIJA 3HOZB 2OXPA 1SJHD 4KMUC 1NSNS 4C3IB 5DAUA 2F0OA 3IFDA 2F0KA 1SNDA 4AYBB 2LY7A 1GUGA 4BY1B 3GTLB 1SYCA 3A7AB 3NBIA 2F3WA 1TU2B 2C5CA 4RWSC 1AN8A 4WJWA 4V190 1PFMA 3D4WA 2KEEA 1UAPA 4KN4C 4KD3A 2R92B 4K6LA 1K83B 2C9OA 4U673 1BCPC 1SNMA 3H3VC 3W2DA 4G7ZC 3ITPA 3NXWA 4CHTB 3TN2A 5CV7A 4KK7A 1Z6HA 2ENBA 2RDGA 1D1KA 1B50A 4KKUA 3G6JB 4MN3A 5KEEA 5EKKA 5HGTA 2KOLA 1EY7A 1Y69U 1F9QA 2F0FA 1EYAA 1CK1A 2B2YC 3PV0A 5BN3A 1RTNA 1PRTF 4RGTA 5K36H 3U9OA 2J4XA 5J22A 1JWSD 1F2ZA 1F9RA 1U9RA 4K8JA 5IGDA 2Z4IA 3QOLA 2K6AA 2K1BA 4I7ZC 1OXSC 4FNFA 3VR3A 1QJOA 1E0BA 3IAYA 4P2CB 2EVBA 3I90A 4QMGA 2F0QA 1E2WA 1NCVA 4HEDA 1VCIA 1RKNA 2EJFC 5J39A 2K5DA 2O2LD 3NWSA 4RH6A 2XIWA 5I9OA 3A54A 3ZYYX 1STNA 3K57A 1EWCA 1OO9B 4NDXA 4FP5D 5JVH3 3BZDB 2LMCB 3D31A 1EYDA 4H44C 4CGYB 3GQBA 1EU4A 2Q8RE 5I6YA 5I2XA 1MBYA 4B08A 5IGFA 3BYTB 1EWHA 1JORA 1CQVA 1OXTA 1BBXC 3HOWB 1RODA 4X3TA 4K5XA 3HGBA 2F0LA 1JCKB 5IGGA 1PTOF 1Y8PB 4FF3A 4ODGA 5KRUA 2NN6I 3T4AC 4XYOA 3H94A 1FNUA 4C3IG 2B8GA 1BNZA 4OO1G 4R8NA 3TP8A 3VR5A 4ZQ3A 5IGCA 2SOBA 4RKLA 4IUQA 2BDNA 4CJ0B 1Y8OB 5EPKA 3K59A 3CQZB 5ELEA 1IW7C 1PZID 1F2LA 4DAPA 2J7ZA 4IFDG 1DCZA 2X6GA 1PXUA 3DHQA 2BDOA 1DOLA 1KDAA 1H9RA 2EPBA 4ZK9B 4N9PA 1EOTA 1Q3LA 4ZUJA 2MJ8A 1O7YA 1WTPA 3J80E 1CT1D 5ELCA 5JEAH 2N55A 4M8AA 3FDTA 1KTKA 3T51B 5CR3A 1R4QB 4E6IA 4LMQD 2WIIB 2K32A 1V1OA 5K5PA 4IQZA 1X32A 2K5QA 4KHZA 1PDQA 3E6ZX 1O80A 1C48A 1KABA 2O5JC 2F1MA 1SMYC 2FINB 1BQQT 2AQ2B 1VDZA 3S16B 2L11A 4HSVA 4FF1A 3JAME 5JJZA 1ZKOA 2JA7B 4RCNA 4HSPA 3EVQA 4WORA 5C4HA 1DZ1A 1STHA 2H4OA 5BN5A 3LNNA 4PV1C 1I4HA 4XTCS 1CZWA 2JEAI 1EFID 1HCZA 1IL8A 2KVMA 5I9PA 4PMCA 3PIO3 2EOTA 5JEAJ 3M85A 2J0TD 5AFWA 3ONAB 2EDGA 1LT5D 4DN4M 1PLFA 2KCCA 5A2QL 2XNAC 1TY0A 3I73A 1HFNA 2YU9B 3DXJC 4DA2A 4CBVA 4X3SA 4OIJA 4C56C 2NVTB 4ZKBB 1JWMD 4HCEA 3R3OA 3HOUB 2L12A 2FHTA 1ET9A 3V2TA 3GD7A 3DWQA 1WTRA 3FVQA 3S2DB 1G8ZD 3J7YW 1D1IA 2XWBB 2WAQB 2QILA 2K05A 1DM0B 1SDFA 4F87A 2LFNA 1HXYD 2WB1B 1RTOA 2RVLA 4XDXA 2AWNA 4OIKA 3J7AF 2R7ZB 2NYZD 3RD4A 5IIFA 2HUGA 4DNRB 5C44B 3UI2A 4XYQA 2PZWA 1TS5A 5CV8A 2EJGC 2MUYA 2CW0D 1EYCA 2HCIA 4B9XA 1YNJD 5A2QE 3RUZA 4PMBA 1Q12A 2DY8A 3MA2B 5EQ0A 2OEOA 4HN7A 3S1NB 4PQXA 3K0YA 5D3IB 1WTOA 1EEFD 2FFKB 3R2IA 3MXPA 4QUCA 2F0SA 1GHKA 3DM1A 2B2YA 3OMCA 2NN6H 1U4LA 1ESFA 3VYRA 1I4QA 2Z4HA 3MVVA 4NP5A 1SE3A 3BDCA 3OIQA 1Q90A 1STYA 4OL7A 4DGZA 3PUVA 2SDFA 2EYLA 2HCCA 2DNCA 3D4RA 3HG9A 4MHEA 3MWYW 2JEBI 1SSOA 2ZXRA 5CC4A 5E4WC 2WACA 1EY8A 1BCPD 1SYGA 3QB3A 1H9SA 2E2HB 3GTKB 1D5MC 3D6WA 4V0BA 4O1NA 5I4DA 4HCSA 4RA8A 2JA8B 1A15A 2IJ0A 4UDUC 1IKMA 1GOZA 1JB3A 1BDOA 2IPKD 3WOFA 2YYZA 1SBBB 4OGQC 2ID0A 3DEPA 3EA6A 3WOEA 3DWPA 1Y1VB 2NB0A 1JOOA 4I65A 3HOXB 3T53B 3E0JA 5ISRA 2A6HC 5C6AA 2D5DA 3PUZA 3SDZA 1WD0A 2QCPX 2RSNA 2I46A 2EYOA 1S5FD 2G9DA 3SK4A 2A6EC 5FKAC 1CFMA 1G2TA 1WVLA 3K5NA 4WRDA 2L0CA 2VB2X 2E74C 3BVMA 3G7LA 3CRLC 1VMPA 3NQIA 2M9VA 1I4RA 3GP7A 2NVYB 2IX3A 5DM73 2A69C 5T1GA 3V96A 1TS2A 4OO1I 3FKIB 4HAEA 4H0LC 1F9SA 5KYLA 1LABA 2B2VC 2NWGA 2B2WC 1EQTA 2BA1A 1STEA 1Q8IA 1EU3A 1QCBD 2ICEC 5C0XG 5D65A 4IFDI 1IKLA 1LTBD 4GZYC 3ERQA 1JOKA 2N88A 5D3DA 1QG7A 2KEDA 1SJED 3QWNA 1I4GA 3KLRA 1UEAB 5FOBB 3AB9A 4A3JB 1VF7A 4FF4A 3S17B 3TDQA 1G2SA 5FO9B 2PYKA 4IALA 5CV5A 1G91A 1SFOB 5FO8B 1L0YB 1TVXA 2GA4B 1PRTB 3MXGA 1IW7D 4DXFA 1J9OA 1ZYRC 4RHRA 1C8CA 1KLGD 4TQUS 5JOBA 1ML0D 1S5BD 1HRJA 2BA0A 1BR9A 4ID6A 5NUCA 5C5MA 3GTQB 1IYUA 1SAPA 1G6ZA 1STBA 3D4DA 4BWGB 1ZEQX 2E2DC 2Z1CA 1TWAB 2PQEA 5DNFA 3MC0B 5FO7B 1EY9A 2HDLA 3RMHA 3Q23A 4DFAA 2LS01 1FGBD 4RFBA 2AUJD 2RDHA 3BS1A 1G291 3ND8A 3KK7A 1FD7D 3SXHA 3D8GA 4QF4A 3OW7A 3I4MB 2BOSA 1STAA 1PFBA 3H6MA 1SMYD 2HDMA 1SYBA 1B44D 5EPJA 1WCMB 1EY0A 4ILWA 4F8MA 3J80L 2B39A 1U4MA 2VB3X 1CA6A 2QDBA 2SNMA 1PTOB 3RZOB 4K2KA 3SK8A 1HFGA 5LL6S 2MGSA 4L8JA 3NSWA 2NZ1D 2RA4A 3HS0C 3Q22A 1GUOA 3P7JA 3X3MA 4QCLA 4DK1A 4KKSA 1HUNA 1LTID 1RDPD 5C5LA 3QO2A 1V8QA 1HQRD 2EY2A 2K28A 1BCPF 2X6LA 2KUMA 3MEHA 2NUCA 3BG3A 3EROA 4LK1C 3KBGA 3NTIA 3PMFA 4BBRB 1A3TA 3NUCA 5G3LD 1V43A 3JAML 1LTRD 5IGBA 1MD2D 2PMZB 3U9SA 2X69A 1TY2A 2F03A 2Q8IB 5C4XB 2A68C 3K58A 3I4LA 3NHHA 1FR3A 4B9WA 1TKWB 1RD9D 4DAVA 1CA5A 1BOSA 5T1IA 3TSSA 3LX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUJ D;  3PUV A;  3GD7 A;  2E76 C;  4HR7 B;  3WDN A;  2DNC A;  1G29 1;  2K32 A;  1O7L A;  3D4R A;  3ND8 A;  2A69 C;  3FMC A;  1EWH A;  4IQZ A;  1H9J A;  2L5T A;  3TZU A;  3CRK C;  1OXT A;  2A69 D;  3A8K E;  4DK0 A;  2PCF B;  1GJX A;  3ND9 A;  3PUW A;  4KHZ A;  2JEB I;  4H0L C;  2K33 A;  4KN4 C;  2E75 C;  4TKO B;  3M7N A;  3HGB A;  1Z7T A;  3I72 A;  4JK1 C;  1LAB A;  5KND A;  1CTM A;  3OW7 A;  3IFT A;  1Y8N B;  3SE0 A;  1Y8P B;  4KKT A;  1H9M A;  2O5J C;  2BA1 A;  2F1M A;  1SMY C;  3BDO A;  3VR4 A;  5K36 G;  2JE6 I;  2B8F A;  4G7Z C;  1DD2 A;  2IT1 A;  3IKJ A;  2R6G A;  1VDZ A;  2K7V A;  1H9S A;  2NN6 I;  1K8O A;  4LJZ C;  4DNR B;  5C0X G;  1Z6H A;  1H9K A;  1ZKO A;  2DNE A;  1OXX K;  3LWU A;  1OXU A;  2O5I C;  4KKU A;  3H94 A;  4RCN A;  3MFY A;  1B9M A;  4JBW A;  1Y69 U;  5BN4 A;  4GZY C;  2B8G A;  3PUX A;  4KI0 A;  3PV0 A;  5BN3 A;  1I6V C;  3QIA A;  1GHJ A;  1H9S B;  1OXV A;  5BN5 A;  4OO1 G;  2EJG C;  2CW0 C;  3LNN A;  3VR5 A;  4L8J A;  4PV1 C;  2DN8 A;  1BDO A;  1E2V A;  1YNJ C;  1PMR A;  4G7H C;  2YYZ A;  4XTC S;  1CI3 M;  1VF5 C;  3KLR A;  5K36 H;  3RLF A;  1DXM A;  1Q1B A;  2V4D A;  2JEA I;  1HQM C;  1HCZ A;  1GUO A;  1Y8O B;  3AB9 A;  4BA1 I;  3L7Z C;  1VF7 A;  4DK1 A;  2D2C C;  4KKS A;  4OGQ C;  3QJY A;  5C0X H;  1Q12 A;  3A8I E;  4KN7 C;  3M85 A;  2NN6 G;  3QG1 A;  1V8Q A;  4H13 C;  5KNC A;  1FYC A;  1IW7 C;  3OPO A;  3P20 A;  1HPC A;  5JEA G;  1IW7 D;  2EDG A;  4IFD G;  2D62 A;  1DCZ A;  1ZYR C;  4I7Z C;  4DNT B;  3M4Y A;  1OXS C;  3FPP A;  1IYV A;  2QF7 A;  4OO1 H;  4KMU C;  2BDO A;  1QJO A;  3VR3 A;  2PPB C;  2EVB A;  2KCC A;  3T53 B;  3BG3 A;  3VA7 A;  3EQL C;  4LK1 C;  4TQU S;  1E2W A;  5A35 A;  5KNB A;  2A6H C;  1H9R A;  3W3A A;  2JXM B;  3I73 A;  3A7L A;  1O78 A;  2A6H D;  3VR2 A;  2D5D A;  3NE5 B;  1GUN A;  2BA0 A;  3PUZ A;  3SDZ A;  3OOC A;  1YNN C;  1HTP A;  1V43 A;  1K8M A;  3DXJ C;  4XIG S;  3VR6 A;  1VCI A;  3U9S A;  1Q1E A;  2KA7 A;  2EJF C;  3N6R A;  1T5E A;  1GHK A;  2PNR C;  2A6E C;  2EJM A;  1IYU A;  2AUK A;  1GUT A;  2NN6 H;  2A6E D;  1A6X A;  1CFM A;  1GUG A;  4BA2 I;  3A8J E;  2Q8I B;  5JEA H;  4IFD H;  3MXU A;  2A68 C;  3A7A B;  3I4L A;  1E2Z A;  2A68 D;  2BE5 C;  2E74 C;  1FR3 A;  3T51 B;  1TKW B;  1TU2 B;  2BE5 D;  1B9N A;  1Q90 A;  2LMC B;  3D31 A;  2AWO A;  1GUS A;  1LAC A;  4H44 C;  3CRL C;  2ZT9 C;  1ONL A;  4G7O C;  3GQB A;  3T56 B;  3PUY A; 
#chains in the Genus database with same CATH topology
 4DR2 Q;  4RKB A;  3VYT A;  4R8I A;  4HR7 B;  3KLS A;  4TRD A;  3MTS A;  4LF4 Q;  1AEX A;  1A0I A;  3I8Z A;  3HKZ G;  2L5T A;  4Q5V A;  2Q2H A;  4IPC A;  2FMM A;  2L1B A;  3M7N A;  4DF7 A;  3PIP A;  4DV6 L;  3JAM i;  5C4J H;  1E22 A;  1CZG A;  2UXB Q;  4K14 A;  4DR1 Q;  4ZRZ A;  5IE8 A;  4A3J G;  1F77 A;  1T9H A;  1SN8 A;  2IT1 A;  3G48 A;  5EKL A;  2KHI A;  2AQ3 B;  3GV6 A;  4YWL A;  1EQR A;  4K2L A;  1Y1V H;  2B63 G;  3RLN A;  5EPL A;  4FVM A;  2UXD Q;  1SNO A;  2FMC A;  3HOX H;  4GN4 B;  3C46 A;  1HR0 W;  2CH4 A;  1OXV A;  2HHH Q;  1QUQ A;  2EXZ A;  5IGE A;  2F0N A;  2PMZ E;  1HTL D;  4DV3 Q;  4LFB Q;  3CHB D;  3KDF B;  3PO3 B;  1YIJ A;  1BUV T;  4GNX C;  4WJ3 M;  2V4D A;  3R2T A;  1V9P A;  1E1T A;  4O0A A;  2R7F A;  4PNY A;  2L4N A;  2K5W A;  2RQX A;  2OQK A;  2IL8 A;  5CV9 A;  4CKE A;  3NTH A;  3KFU A;  5ELN A;  1UUP A;  4C3I H;  1E1O A;  5COY A;  4HJ9 A;  2AMC B;  1PH3 A;  2CHB D;  1CUK A;  4OO1 H;  1D5X C;  1SE8 A;  1G6P A;  5KNB A;  4DR4 Q;  1HA5 A;  4RCO A;  2KHS A;  4UP7 A;  1D5Z C;  3NE5 B;  1BBW A;  1CKO A;  1YNN C;  4ME3 A;  5KIX A;  1KRT A;  3L9A X;  2E2J B;  3SHL A;  2K01 A;  1D6E C;  3GTL H;  4BY7 G;  4JI2 L;  1CM9 A;  3MEF A;  3TZD A;  2PZT A;  3I4M G;  1BXT A;  1WTW A;  2KCT A;  3PIP 3;  3MXU A;  4IFD H;  2JQO A;  1N36 L;  1VQ7 A;  3PQI A;  1NR2 A;  3UE0 A;  2JP1 A;  4TSS A;  1B70 B;  2ZXO A;  4IPD A;  1WCM G;  4B3S Q;  3DWA A;  1Q82 C;  4A93 B;  1T5X D;  4DV1 L;  4QL5 A;  1PFS A;  2CQA A;  4LF8 L;  3CCJ A;  4JBJ A;  3WDN A;  1V1P A;  1AE2 A;  2UUC L;  1SRU A;  2R92 H;  4DK0 A;  4ZYS A;  4A3E B;  3KBX A;  1K83 H;  4TKO B;  2K03 A;  1YHB A;  2K14 A;  2UUB L;  2F4I A;  3IFT A;  1TR5 A;  1N8R C;  4LFA L;  3S2H B;  3OTO L;  4KKT A;  1W6K A;  2DY7 A;  4PMW A;  2MP1 A;  1VQF A;  4UP9 A;  3OWF A;  3VR4 A;  1DD2 A;  1PH6 A;  1VQD A;  1I50 B;  2F0H A;  1LV9 A;  3N52 A;  1PYB A;  1SFO H;  1Y1W B;  4O42 A;  1M4V A;  2K52 A;  2QDL A;  3G4S A;  4G4K A;  1OXU A;  5COR A;  1JOQ A;  1N34 Q;  1B9M A;  5IP9 G;  1I6V C;  4BBR G;  5FLM G;  3M4O B;  1B53 A;  4J6H A;  4GKJ Q;  2K5V A;  3ER0 A;  4CJ1 B;  1I3Q B;  1EY4 A;  4A3M B;  1CI3 M;  4L63 B;  1X3E A;  2IWH A;  4ZKC B;  1M1K C;  2YTX A;  3W1G A;  3GTQ H;  4KY6 A;  1SYE A;  1IBK L;  1EQV A;  2K75 A;  1UE6 A;  5C4X G;  1CKN A;  4IFD J;  1KLU D;  2VNU D;  4H13 C;  4IO9 A;  2D62 A;  3H0G B;  4KTA A;  1IBL Q;  4MIU A;  4X66 Q;  1BF4 A;  1FNW A;  3M4Y A;  5F2D A;  5FJ8 G;  5AJ3 L;  5CGK A;  3GTP B;  2F3V A;  2PZU A;  5HUR A;  1N32 Q;  2A6H D;  3CAM A;  4NPS A;  2M2L A;  4CKC A;  1K8M A;  2EY5 A;  4P75 A;  1KXL A;  3DUZ A;  2G9H D;  1FL0 A;  4A3B B;  2EJM A;  4A3I B;  2PW5 A;  2A6E D;  3P75 A;  1OTC A;  1HNW L;  1Z9F A;  1M90 C;  2R61 A;  2BE5 C;  1J5E Q;  1AP0 A;  5EBC A;  1I94 L;  2ICI A;  4WFN 3;  2ZT9 C;  4NW2 A;  3T56 B;  3BDL A;  5C0X I;  3BZC A;  3TBI B;  1YNX A;  2I5L X;  1NR4 A;  1SXT A;  2R93 G;  1LYL A;  4DAY A;  1A2U A;  2TMP A;  3HOW H;  1E24 A;  1GM5 A;  1TII D;  3FMC A;  3A8K E;  2A69 D;  4JBK A;  1GJX A;  2WB1 E;  5EAY A;  1HZ9 A;  5G3L F;  4J15 A;  3PUW A;  5IWA L;  3PO3 G;  2I07 B;  4IN3 A;  5ELB A;  4KJO A;  4RHS A;  3SK5 A;  2VQE Q;  2F0W A;  3BDO A;  2NBF A;  2XVS A;  1RJT A;  4IUU A;  2Y0S B;  1WJJ A;  1EFW A;  4ULL A;  2L55 A;  5CMD A;  4AIM A;  1XMQ Q;  2UU9 Q;  1PH4 A;  2EY1 A;  3MFY A;  1WTQ A;  4Y7N B;  2I5M X;  1JQY D;  2EYF A;  4JCV E;  1HUM A;  1DYQ A;  2WP8 J;  2Z8L A;  1F9P A;  2PNH A;  3KJP A;  4GKK Q;  4DR5 L;  3BYY B;  1KD1 C;  3CQZ H;  3TRZ A;  4A3D B;  2IW3 A;  4CDD C;  1VQM A;  1ILQ A;  3OIP A;  3L7Z C;  3CC7 A;  3MHB A;  3ICE A;  4L5Q A;  5GAH C;  3UDG A;  3CCL A;  1EY5 A;  1GXD C;  1SNC A;  5KNC A;  3OPO A;  3K5L A;  1B3A A;  4K5V A;  2ATW A;  4OHJ A;  4DNT B;  4A4I A;  1ZYR D;  3D6C A;  1HZC A;  4A93 G;  3VA7 A;  2F4V Q;  2ZTD A;  1SYF A;  3W3A A;  1WTX A;  3SK6 A;  1MGS A;  4DUZ Q;  4OWX B;  3GTJ B;  4C3H B;  4N9T A;  4JYA L;  4XXE A;  2ZJR A;  1GUW A;  3STB C;  1GUT A;  2I5H A;  1HNZ Q;  4F7X A;  4BA2 I;  1VQG A;  5FLX L;  3AU7 A;  4WJ4 A;  1LT4 D;  3GTG B;  1LTG D;  5H1S E;  3CF5 A;  2LSS A;  1XX8 A;  1EZ8 A;  4DXG A;  1Q7Y C;  4LFC L;  2G5D A;  3R8B A;  1A3U A;  2A5H A;  1Y1W G;  2EE1 A;  2F0J A;  4BBS G;  5IYB H;  2NVX B;  2B2U C;  4JI8 Q;  2Z6K A;  2LKV A;  1PRT C;  3NK9 A;  4K5W A;  2F0P A;  2Q2I A;  4LUV A;  4JI6 L;  1LUZ A;  2PQA A;  2E75 C;  2VQF Q;  4JI4 L;  4IPH A;  3I72 A;  4A3F G;  2L9H A;  4A3M G;  1CTM A;  1VQ8 A;  1Y8N B;  4YHH Q;  4HJ8 A;  3D0F A;  1PYW D;  2HD3 A;  4JI3 L;  1XWE A;  1VQO A;  5K36 G;  4NKL A;  2OQ0 A;  1HNX L;  2R6G A;  5EGT A;  4FO2 A;  2O4X A;  3VYU A;  5C3E B;  1DON A;  3CCS A;  2JA7 H;  1QUQ B;  5GAD C;  3K7A B;  3H0G G;  1OXX K;  3V05 A;  3NBH A;  1TQO A;  5IT9 L;  4C3J B;  1BKB A;  2KCN A;  5CYU A;  1B1Z A;  3KLS X;  2JSO A;  3A55 A;  2EZV A;  2FXQ A;  3K5O A;  2QKI C;  1E7Z A;  4J1M A;  1MJE A;  2PW7 A;  1SNP A;  1X3F A;  4DR7 L;  3M3Y B;  4LW1 A;  1IZ6 A;  1KNE A;  1L1O B;  4A3B G;  4DV2 Q;  4A3I G;  1HHV A;  2EXD A;  3QJY A;  1KDC A;  4APV A;  3NP8 A;  1YIT A;  2IX0 A;  1CHP D;  4UY8 C;  2R3Z A;  1FYC A;  1U4R A;  1PH8 A;  2QA4 A;  3HKZ B;  5JVG 3;  2BCO A;  1YI2 A;  4FF2 A;  4K8I A;  5FLX E;  2PPB C;  4XT1 B;  4ZUI A;  2KEC A;  2YU9 H;  1TWH B;  4YCW A;  1SYD A;  4J8Q A;  2JXM B;  3I4O A;  3VR2 A;  4TVA B;  5M3F G;  1GUN A;  2NVT H;  1ASY A;  5IP7 G;  4HJ7 A;  2QEX A;  1PTO C;  4A3E H;  3BVZ A;  1WD1 A;  1Y14 B;  3VYS A;  1MI2 A;  3H09 A;  3J7Z C;  3UDI A;  1JC7 A;  3S2H H;  1XJV A;  4QUF A;  2Q2T A;  4GNX A;  2B63 B;  2A68 D;  1U4P A;  1AZP A;  3FRP B;  1UE1 A;  1F2M A;  2OWO A;  4JW0 A;  1V1P B;  2A74 C;  1I50 H;  2Y0S G;  3A56 A;  4G7O C;  1ONL A;  5KYI A;  2XRS D;  1A2T A;  3S9W A;  4ZAI A;  4HMJ A;  5IOD A;  3PUY A;  4B3M Q;  2ZM6 L;  1LTS D;  4UPA A;  5M5X B;  2N49 A;  1KDB A;  3VDY A;  4P71 A;  2UXC L;  3NWT A;  2EY6 A;  4U68 A;  3C2P A;  4XQJ A;  3TP5 A;  1VMC A;  4S3S A;  3GTM B;  3QOJ A;  3F2D A;  3M4O H;  2YTY A;  3OSO A;  3Q8D A;  1ESR A;  1FNV A;  5CV4 A;  3A5U A;  5IT9 E;  4JK1 C;  1AW7 A;  4RGM A;  1P16 A;  4LF5 Q;  3GTO B;  4DU9 A;  4GLA C;  3FP9 A;  4A3D G;  3D3R A;  3B6Y A;  3TS0 A;  4EQP A;  4XT3 B;  3IKJ A;  5EKI A;  2A73 B;  1I4X A;  3DMU A;  3CCU A;  1CHQ D;  1K8O A;  1JWU D;  3M7G A;  1JE4 A;  3PGZ A;  4UHV A;  3MXN A;  3H15 A;  4YY3 L;  2JA6 G;  1MKH A;  4BY7 B;  5BN4 A;  3CP0 A;  5I6W A;  3GV3 A;  3QIA A;  4IZ8 A;  4NMZ A;  2K4K A;  1K0R A;  3K6O A;  4G7H C;  3HOV G;  3I56 A;  4KJN A;  4C3H G;  1X56 A;  1RCV D;  3OHX C;  3I70 A;  1TWF B;  4P73 A;  5C0X H;  3F2U A;  1X6O A;  1ZXT A;  2I0Q A;  3NQT A;  1J8I A;  1I6H B;  4DV6 Q;  1X3Q A;  3NTK A;  1XXG A;  4DNI A;  1HPC A;  5JEA G;  2RSO A;  2VS1 A;  1NBW A;  1PFN A;  4NXN L;  3GDE A;  4R4Q A;  4C2M B;  5C3X A;  1A8V A;  4FYD A;  2BH8 A;  1EY6 A;  3Q24 A;  4A3L H;  3HOY B;  3EQL C;  5M5Y B;  2B2T C;  3OMG A;  4DR6 L;  1JR0 D;  4HTH A;  4H7B A;  3OOC A;  1MSH A;  3PF4 A;  1PZK D;  1SRO A;  1BCP B;  1YNN D;  4DUY L;  5GQO A;  1Q1E A;  1KC8 C;  1T5E A;  4POG A;  2EYP A;  5E3F A;  4C1N K;  3SR1 A;  4KHP L;  4FDB A;  5ELD A;  4Q0F A;  5E4X A;  4ABN A;  1ET6 A;  2M00 A;  2A19 A;  2VL6 A;  4UAI A;  1QNU A;  1QVG A;  1II3 A;  2KEN A;  2V1C C;  2MHV A;  1X3P A;  3I4N B;  1JMC A;  1TWC B;  2Q8T A;  2WKD A;  4GOP B;  4C3J G;  4DKA C;  1U5K A;  3NEL A;  3HOZ G;  3TZU A;  4KY7 A;  3S15 B;  1VQB A;  1I4P A;  3J81 L;  1DOM A;  4CJ2 C;  5C3W A;  5J3B A;  4LNQ A;  1UWV A;  1XNR L;  2F0M A;  3R93 A;  3T1H L;  2F0I A;  5D14 A;  5FK9 C;  5JPN C;  3KOJ A;  4ME5 A;  1SE4 A;  5CBA E;  1W6J A;  2E2H H;  5C0X J;  1PA6 A;  4X3U A;  4JI2 Q;  2K04 A;  4LF9 L;  4BY1 G;  2N8N A;  4LJZ C;  4BXX G;  4OWT B;  4JI0 L;  1L2F A;  4N8X 1;  3TRE A;  5J1Z A;  3HRZ C;  1XTC D;  1H9K A;  2O5I C;  2JA8 H;  3TP7 A;  4L5T A;  1N36 Q;  4KI0 A;  4F88 A;  1G51 A;  1XYI A;  3TP6 A;  1H9S B;  4EQO A;  3KYH C;  3S14 B;  1DOK A;  4DV1 Q;  3SEB A;  2EQS A;  1Q1B A;  4LF8 Q;  3J81 i;  4BA1 I;  2UUC Q;  1K73 C;  1QNK A;  3IL8 A;  1QOH A;  4DV7 L;  5ELF A;  3TME A;  2JYO A;  2R93 B;  3QR8 A;  1ENC A;  2UUB Q;  3X3N A;  1EYG A;  1DJR D;  3HP3 A;  1F2Y A;  5JJL A;  1LTA D;  4LFA Q;  3OTO Q;  5M9O A;  2NVX H;  2IX1 A;  1N9W A;  5M3M B;  4M1U B;  5IYC H;  3LWE A;  1TWG B;  3HZX A;  1O78 A;  4DV0 L;  2JA5 B;  3VR6 A;  1LTT D;  1NMG A;  2ZJQ A;  2KHJ A;  2UUA Q;  4DV4 L;  4MTN A;  3MFG A;  2AUK A;  1EZ6 A;  1A6X A;  5EBD A;  3J7A V;  1BO0 A;  1D2B A;  4QY7 A;  3A8J E;  5JAV A;  1FVI A;  1XPR A;  4RAU C;  3J81 E;  2E8G A;  4KD4 A;  5CBE E;  1Z47 A;  3G71 A;  2BE5 D;  1B9N A;  3FHW A;  5C3E H;  3PF5 A;  2NVY H;  1VQ4 A;  3P1H A;  3DEO A;  1IBK Q;  1LM0 A;  4IUT A;  4QQB X;  1B4O A;  1S5E D;  3K7A H;  3KF8 A;  1ENA A;  4B3R L;  4DV5 L;  1O7Z A;  1PZJ D;  4JV5 L;  2RBM A;  3FKI H;  2PO4 A;  4IUP A;  3MAQ A;  5LMN L;  4L6T B;  3BZK A;  2NVQ B;  3OW2 A;  3RR5 A;  3C1E A;  3ND9 A;  5AJ3 Q;  4JG2 A;  4RGN A;  3SVM A;  3M3Y H;  4MZ9 A;  1Z7T A;  5KND A;  4XQQ A;  1STG A;  4X3K A;  3SE0 A;  3HFZ B;  3M9B A;  3T16 A;  5LL6 X;  1H9M A;  1KQS A;  4IOC A;  1JB7 A;  3NBH B;  1NUC A;  2E2I B;  1QWY A;  2H1E A;  3AFQ A;  1WOC A;  4KY5 A;  2ASB A;  2WV6 D;  3CU7 A;  1VQ9 A;  1HNW Q;  5CV6 A;  3J80 c;  4P74 A;  4GN5 A;  2GVA A;  2B3G A;  5EJW A;  1TWH H;  3HOY G;  1I94 Q;  3EJI A;  1R9T B;  4FXD A;  3O13 A;  1GHJ A;  2B2U A;  3URY A;  2AQ1 B;  5IOC A;  1HA6 A;  2Z6B A;  2DN8 A;  4A3J H;  4GN3 B;  2AKW B;  2F0T A;  1VF5 C;  4EVO A;  3S17 H;  1EIH A;  3S1R B;  1IHZ A;  4FXG C;  1QVF A;  1JT8 A;  4BBS B;  2FJ2 A;  4KHV A;  4IUR A;  1A3V A;  4KN7 C;  1WFQ A;  2NN6 G;  2B63 H;  4HIM A;  4GS3 A;  5IWA Q;  2OT2 A;  3I3C A;  4EQN A;  1UE5 A;  3FPP A;  4HID A;  2K5N A;  1IYV A;  1VS0 A;  4DPG A;  3I4N G;  1KAA A;  4OXP A;  1Q86 C;  2NTT A;  1EL0 A;  3AEV A;  4IUN A;  1FGU A;  4C1N I;  2D0P A;  4A3F B;  5I2Y A;  1EEI D;  1K9M C;  1AFP A;  2DJF C;  2RDF A;  4XQN A;  2XWJ B;  2CH4 W;  3GTM H;  3JAM c;  3FPU B;  4ZLT F;  3N6R A;  2PNR C;  4IUV A;  1LT3 D;  1TWA H;  4QJF A;  2B2V A;  3STB D;  4CDC C;  4EGV A;  1JIC A;  2B2W A;  4R4O A;  1E2Z A;  5M5W B;  4R9W A;  1L0X B;  3F2B A;  3L3O C;  4DR5 Q;  2AWO A;  1LAC A;  4IJH A;  1XTD A;  1S72 A;  3UE1 A;  4YCU A;  1TS4 A;  3CCM A;  1M8A A;  1SNQ A;  4QGU A;  1O7L A;  1C4Q A;  1PRT D;  4BY7 H;  4KV6 A;  1HH2 P;  3CRK C;  3H91 A;  5GRO A;  2F0U A;  2PCF B;  2ALY B;  3I4M H;  4K0K L;  2K33 A;  2SNS A;  4FXK C;  3Q0A A;  4QB4 A;  2HQE A;  3AMU A;  2QW7 A;  1XMO L;  1TS3 A;  2KQ3 A;  4A76 A;  3FEW X;  1ENF A;  4BS9 A;  2EYM A;  3BJU A;  3NPP A;  2B8F A;  1WCM H;  1S4Z A;  2EYJ A;  2K7V A;  4JYA Q;  1QIL A;  1I6H H;  3U58 A;  1JE5 A;  2WIN B;  5M3F B;  1PTO H;  3RZO H;  1HR0 L;  1TT2 A;  3LWU A;  2DNE A;  5TSS A;  2VUM B;  2P5Z X;  4B3T L;  1NJI C;  4QIW B;  2JA9 A;  5M5Y H;  5M3M G;  4G57 A;  3PUX A;  3F8T A;  4LFC Q;  2L15 A;  5E1F A;  1X54 A;  3I91 A;  3S1Q B;  2JA5 G;  2A8V A;  3H3V H;  3RLF A;  3S1M B;  5LMU L;  1B2T A;  1HQM C;  4ALP A;  2NTS A;  3EFX D;  1WTV A;  4JI6 Q;  1HZB A;  4OEL B;  4JI4 Q;  2VZA A;  4X65 L;  1KHI A;  1PVO A;  1SEB D;  2QEJ C;  4A3G B;  4DR3 L;  1NAP A;  5IP9 H;  1S40 A;  3I2Z A;  1YZ6 A;  4HJ5 A;  4JI3 Q;  2MPM A;  2QF7 A;  3UDF A;  4BBR H;  1TWC H;  1C7Y A;  5FLM H;  1HNX Q;  1TXY A;  1MSG A;  5A35 A;  3KF6 B;  3MZ5 A;  3A7L A;  3AFP A;  1LT6 D;  5JPM C;  1HJP A;  3K5M A;  1S5D D;  1HTP A;  4XIG S;  3KJO A;  3A0J A;  1K3R A;  2KA7 A;  3ERS X;  1PTO D;  1LLR D;  5C4X H;  3HEJ A;  1RHP A;  3VA5 A;  1ILP A;  5HGQ A;  2KJX A;  3KUP A;  4A3K B;  2CQO A;  3EIV A;  3OWE B;  4RG1 A;  4DR7 Q;  5FJ8 H;  4A3C G;  1L1O C;  2VXW A;  1EIG A;  3K8A A;  3E5S A;  1GUS A;  2JA6 B;  2OF1 A;  4K6D A;  1AZQ A;  3C1F A;  1QE6 A;  1R4P B;  5LHY 1;  4RGO S;  5GAE C;  2E76 C;  3PO2 B;  1X65 A;  3HOV B;  2NZO A;  4I7A A;  1LO5 D;  3ULP A;  1K0S A;  3E3X A;  1H9J A;  3TS2 A;  3Q6S A;  3CKI B;  2B2T A;  5C4Z A;  1I5F A;  1RF2 D;  2K5H A;  2WKC A;  3ZJY C;  1UNS A;  2Y0S E;  5C4J B;  1S5C D;  3CCV A;  1A62 A;  2JE6 I;  1NE3 A;  2F0V A;  2R93 H;  1BVS A;  5IYD G;  2F52 A;  3T13 A;  4CKB A;  1WTH A;  1KNA A;  2XRQ D;  1QB5 D;  4LAA A;  4HMI A;  3W5O A;  1CQF A;  2XN9 C;  3BVG A;  1HZA A;  2F0E A;  2SEB D;  3NEM A;  5DEH A;  2D9U A;  2XSC A;  4JBW A;  3HOU G;  1K8G A;  5KGU A;  3RZD B;  3PSI A;  3PO3 H;  2CVR A;  3C3L A;  2ZM6 Q;  2CW0 C;  5DM6 3;  1E2V A;  4Z9C B;  1YNJ C;  1PMR A;  2ZXP A;  2RKS A;  2EYH A;  1DXM A;  3GO5 A;  2JN4 A;  3TQY A;  1SE2 A;  5IY0 A;  2D2C C;  2F0G A;  2F0D A;  3A8I E;  2WAQ G;  2TSS A;  2Z0S A;  4IPG A;  3QG1 A;  1ICW A;  2WB1 G;  1EIF A;  3P20 A;  2ZTC A;  4YIJ A;  3HOZ B;  1EIY B;  2OXP A;  1VQK A;  2JJQ A;  2R7Z G;  1SJH D;  4KMU C;  1NSN S;  4C3I B;  3UDX A;  5DAU A;  1Q81 C;  2F0O A;  5C44 G;  3IFD A;  2F0K A;  3CD6 A;  2E2J H;  1SND A;  1W3S A;  2NVQ H;  1VQI A;  4YY3 Q;  4AYB B;  1VQC A;  2LY7 A;  1D8L A;  1E3P A;  1GUG A;  3T1Y L;  4BY1 B;  3GTL B;  3RN2 A;  2RHQ B;  1SYC A;  3A7A B;  3NBI A;  2F3W A;  1TU2 B;  4A93 H;  1FJG L;  1PH5 A;  2C5C A;  1CSQ A;  1NY4 A;  4RWS C;  1AN8 A;  2VUM G;  4WJW A;  4V19 0;  1PFM A;  1VQ5 A;  3D4W A;  4NXN Q;  2KEE A;  1UAP A;  4KN4 C;  4KD3 A;  1W2B A;  2R92 B;  1GKH A;  4K6L A;  4DR6 Q;  4A3L G;  1K83 B;  5BR8 L;  2C9O A;  4LWC A;  4U67 3;  1BCP C;  1SNM A;  3H3V C;  3W2D A;  1Y1W H;  4DUY Q;  4G7Z C;  4BBS H;  3ITP A;  2MO1 A;  3NXW A;  4NXM L;  4CHT B;  3TN2 A;  5CV7 A;  4KHP Q;  4KK7 A;  3J81 j;  4A3G G;  3CME A;  3M4P A;  1Z6H A;  3K80 C;  2ENB A;  4DK6 C;  2RDG A;  1D1K A;  1B50 A;  4KKU A;  3G6J B;  4MN3 A;  5KEE A;  5EKK A;  2CWP A;  5HGT A;  2KOL A;  1EY7 A;  1Y69 U;  5JJI A;  1F9Q A;  2F0F A;  1EYA A;  3TEH B;  1CK1 A;  2B2Y C;  1SMX A;  3PV0 A;  1I3Q H;  1RTN A;  2K50 A;  5BN3 A;  4A3F H;  4A3M H;  4OX9 L;  4GOP C;  1EOV A;  1PRT F;  1C9O A;  4RGT A;  2E5L L;  2RHS B;  5K36 H;  1VQH A;  3ULJ A;  3U9O A;  2J4X A;  5J22 A;  2HIV A;  1JWS D;  1F2Z A;  1F9R A;  1U9R A;  3HKZ E;  4A3K G;  4K8J A;  5IGD A;  2JK8 A;  2Z4I A;  3H0G H;  3QOL A;  5E7N A;  1XNR Q;  3T1H Q;  2OTJ A;  3GTP H;  2K6A A;  2YV5 A;  2K1B A;  4I7Z C;  1CKM A;  1OXS C;  4MNO A;  4FNF A;  3VR3 A;  1QJO A;  1E0B A;  3IAY A;  4P2C B;  2EVB A;  3I90 A;  1IYJ B;  3L0O A;  4QMG A;  1H95 A;  2F0Q A;  1E2W A;  4JI5 L;  3PO2 G;  1NCV A;  1CKN B;  4HED A;  1U0L A;  4LF9 Q;  3PCO B;  4JI0 Q;  3AYH B;  4LF6 L;  2B29 A;  4A3B H;  2PI2 E;  4A3I H;  1VCI A;  1O7I A;  1RKN A;  2EJF C;  5J39 A;  2K5D A;  2O2L D;  2YTV A;  3NWS A;  4RH6 A;  2XIW A;  5I9O A;  3A54 A;  3ZYY X;  1STN A;  3K57 A;  1EWC A;  5FLX c;  1IBM L;  1OO9 B;  4NDX A;  4FP5 D;  5JVH 3;  3BZD B;  4X64 L;  2LMC B;  2HT1 A;  3D31 A;  1EYD A;  4H44 C;  2RF4 A;  4CGY B;  3I7F A;  3GQB A;  1KL9 A;  3U4V A;  1EU4 A;  4DV7 Q;  2Q8R E;  5I6Y A;  5I2X A;  5IP7 H;  1MBY A;  4B08 A;  1Y1V G;  5IGF A;  3BYT B;  1EWH A;  1JOR A;  1CQV A;  1OXT A;  1BBX C;  4YWM A;  1ROD A;  3HOW B;  4RMF A;  4X3T A;  3HOX G;  4K5X A;  2IHE A;  3HGB A;  4AQY L;  2F0L A;  1XNQ L;  1JCK B;  5IGG A;  3H3V I;  4DAY B;  1PTO F;  1Y8P B;  4DV0 Q;  4FF3 A;  3RNU A;  1XPU A;  1GVP A;  1JJ2 A;  4ODG A;  5KRU A;  3CCQ A;  4DV4 Q;  2NN6 I;  4JPB W;  1N33 L;  3T4A C;  4XYO A;  2D0O A;  4Y7N H;  3H94 A;  4O2D A;  1FNU A;  5IT9 c;  3LGJ A;  5JJK A;  4C3I G;  2VW9 A;  1B8A A;  2B8G A;  2Q2U A;  1VQP A;  1IL2 A;  1BNZ A;  4OO1 G;  4R8N A;  3TP8 A;  4X62 L;  3VR5 A;  4ZQ3 A;  4A3D H;  5IGC A;  2SOB A;  4RKL A;  4B3R Q;  4DV5 Q;  4IUQ A;  4JV5 Q;  2BDN A;  4CJ0 B;  1Y8O B;  3CW2 C;  5EPK A;  3K59 A;  4R4I A;  5LMN Q;  4AYB G;  5GAG C;  3CQZ B;  3FKI G;  4OWW B;  5DLQ E;  5ELE A;  1IW7 C;  1PZI D;  1F2L A;  3G6E A;  4DAP A;  2J7Z A;  4IFD G;  2JA6 H;  2N78 A;  1DCZ A;  2X6G A;  1PXU A;  3DHQ A;  4JI1 L;  2BDO A;  4DK3 C;  1DOL A;  2CFM A;  1KDA A;  1H9R A;  4OON A;  2EPB A;  3HOV H;  3GTJ H;  4ZK9 B;  4C3H H;  4N9P A;  1EOT A;  1Q3L A;  2LXJ A;  4ZUJ A;  2MJ8 A;  3PIO A;  1O7Y A;  1WTP A;  1SLJ A;  3J80 E;  2R92 G;  1CT1 D;  3GTG H;  5ELC A;  5JEA H;  2N55 A;  4M8A A;  3FDT A;  1UE7 A;  1KTK A;  1NNX A;  3T51 B;  5CR3 A;  3CXC A;  1R4Q B;  1V1Q A;  4E6I A;  4R4T A;  1L0W A;  4LMQ D;  3E9I A;  3DM3 A;  1XPO A;  1WI5 A;  2WII B;  1MIU A;  4JC0 A;  2K32 A;  1V1O A;  1KRS A;  2H5X A;  5K5P A;  4IQZ A;  3RZD H;  1PH9 A;  1VQE A;  1X32 A;  3AQQ A;  2K5Q A;  3NEN A;  4KHZ A;  1D7Q A;  1PDQ A;  2N3S A;  3E6Z X;  2R7D A;  1O80 A;  2BH2 A;  2CWA A;  1PH7 A;  1C48 A;  1YJ9 A;  1KAB A;  2O5J C;  2F1M A;  1SMY C;  2FIN B;  1BQQ T;  1ICF B;  2AQ2 B;  1VDZ A;  4JI7 L;  3S24 A;  2PQA B;  3S16 B;  2L11 A;  4HSV A;  4C3J H;  4FF1 A;  3JAM E;  1PH1 A;  5JJZ A;  3HOZ H;  1ZKO A;  1L1O A;  2JA7 B;  4RCN A;  4HSP A;  3EVQ A;  1YJN A;  2Z9H A;  2C35 B;  4WOR A;  5C4H A;  4LF7 L;  1DZ1 A;  1STH A;  2H4O A;  1GD7 A;  5BN5 A;  1P8L A;  3LNN A;  4PV1 C;  1I4H A;  4XTC S;  1CZW A;  2JEA I;  1EFI D;  1HCZ A;  1IL8 A;  2KVM A;  5I9P A;  3CCE A;  4PMC A;  4IOA A;  2MNA A;  4DR2 L;  4BY1 H;  4BXX H;  3PIO 3;  2EOT A;  4KLK A;  1PYS B;  5JEA J;  3M85 A;  4K0K Q;  2J0T D;  5AFW A;  4LF4 L;  1WYD A;  3ONA B;  2EDG A;  1XMO Q;  1LT5 D;  4DN4 M;  4HJA A;  1EWI A;  3KLW A;  1RL2 A;  4PZ6 A;  1PLF A;  2KCC A;  5A2Q L;  1EQQ A;  2XNA C;  2PI2 A;  1TY0 A;  3I73 A;  2UXB L;  4DR1 L;  1HFN A;  2YU9 B;  3DXJ C;  1HR0 Q;  1K3B C;  4DA2 A;  4CBV A;  4X3S A;  5L37 A;  4OIJ A;  1Q8K A;  3HOW G;  2GVB A;  4B3T Q;  4C56 C;  3F2C A;  1X3G A;  2NVT B;  4ZKB B;  4DAM A;  1UEB A;  1PHJ A;  3RN5 A;  2UXD L;  1JWM D;  4HCE A;  3W1B A;  5LMU Q;  5M5X H;  3R3O A;  3HOU B;  2HHH L;  2L12 A;  2FHT A;  1ET9 A;  4DV3 L;  2ZTE A;  4LFB L;  3V2T A;  3GD7 A;  4X65 Q;  1K28 A;  3DWQ A;  4GNX B;  1WTR A;  2MFI A;  4DR3 Q;  3FVQ A;  3S2D B;  1G8Z D;  2UUA L;  3J7Y W;  1D1I A;  2XWB B;  3GTO H;  3J81 c;  2WAQ B;  2QIL A;  1PH2 A;  2K05 A;  1DM0 B;  1SDF A;  4F87 A;  2LFN A;  1HXY D;  4JBM A;  2WB1 B;  1RTO A;  2RVL A;  4XDX A;  2AWN A;  4OIK A;  3J7A F;  2R7Z B;  2NYZ D;  2LXK A;  3RD4 A;  5IIF A;  1MJC A;  2HUG A;  4JOI C;  4DR4 L;  2ES2 A;  4DNR B;  5C44 B;  3UI2 A;  4XYQ A;  2PZW A;  5HY6 A;  1ASZ A;  1QVC A;  1TS5 A;  3L2P A;  2RCF A;  5CV8 A;  2EJG C;  1NTG A;  4X6A H;  1EUJ A;  2MUY A;  2CW0 D;  1EYC A;  2HCI A;  4B9X A;  1TWF H;  4HIO A;  1YNJ D;  5A2Q E;  1QZG A;  3RUZ A;  1Q46 A;  3MXN B;  3CMA A;  4B3S L;  2AHO B;  4PMB A;  1Q12 A;  2DY8 A;  3MA2 B;  1AH9 A;  5EQ0 A;  4ZCK A;  2OEO A;  2MQH A;  4C2M H;  4HN7 A;  3HOY H;  3M4Q A;  3S1N B;  4PQX A;  4A75 A;  3K0Y A;  3HKS A;  5D3I B;  1WTO A;  5IYB G;  1EEF D;  2FFK B;  3R2I A;  2WAQ E;  3MXP A;  4QUC A;  2F0S A;  1GHK A;  3DM1 A;  2B2Y A;  3OMC A;  2NN6 H;  1U4L A;  1ESF A;  3VYR A;  4GOP A;  1I4Q A;  2Z4H A;  3MVV A;  4LUZ A;  4NP5 A;  1SE3 A;  3BDC A;  3OIQ A;  1N34 L;  3I4N H;  1Q90 A;  1STY A;  1SR3 A;  4OL7 A;  4DGZ A;  4GKJ L;  3A74 A;  3PUV A;  2SDF A;  2EYL A;  2HCC A;  2JA7 G;  3S15 H;  2DNC A;  3D4R A;  1S3O A;  4LUO A;  1VQN A;  3HG9 A;  4EX5 A;  4MHE A;  3MWY W;  1VQJ A;  3K81 C;  2JEB I;  1SSO A;  2ZXR A;  5CC4 A;  5E4W C;  2WAC A;  1EY8 A;  1IBL L;  4X66 L;  3A5Z B;  4PZ7 A;  1BCP D;  1SYG A;  3QB3 A;  3CCR A;  1H9S A;  1N32 L;  2KCM A;  2E2H B;  3CPW A;  3GTK B;  1D5M C;  4AH6 A;  3T1Y Q;  4QIW E;  3D6W A;  4V0B A;  1C0A A;  4O1N A;  5ELO A;  5I4D A;  1KIX A;  4HCS A;  4RA8 A;  2JA8 B;  3JC6 6;  1FJG Q;  1A15 A;  3S14 H;  3SGI A;  2IJ0 A;  4UDU C;  1IKM A;  1GOZ A;  2CKZ B;  1JB3 A;  1BDO A;  2IPK D;  3WOF A;  2YYZ A;  1J5E L;  1J6Q A;  1SBB B;  3E9H A;  4OGQ C;  4A3E G;  2ID0 A;  3DEP A;  3KDF A;  3EA6 A;  3WOE A;  3DWP A;  3BU2 A;  2GN5 A;  3EN2 A;  5BR8 Q;  1Y1V B;  2NB0 A;  5M3M H;  1JOO A;  1TWG H;  4I65 A;  3HOX B;  3T53 B;  1BBU A;  3E0J A;  5ISR A;  2JA5 H;  4NXM Q;  2A6H C;  5C6A A;  2UXC Q;  2D5D A;  3PUZ A;  3SDZ A;  1WD0 A;  2VQE L;  2QCP X;  2RSN A;  2I46 A;  1VQ6 A;  2EYO A;  1PV4 A;  4L5S A;  1S5F D;  4R1J A;  2CCZ A;  2F3I A;  2G9D A;  2A6E C;  3SK4 A;  5FKA C;  1CSP A;  1CFM A;  1G2T A;  1XMQ L;  2UU9 L;  4OX9 Q;  2NZH A;  1WVL A;  3K5N A;  3E0E A;  4WRD A;  2E5L Q;  2L0C A;  2VB2 X;  2E74 C;  3BVM A;  3F1Z A;  4PZ8 A;  4GLX A;  3G7L A;  3CRL C;  3S16 H;  1VMP A;  3NQI A;  1AE3 A;  2M9V A;  1I4R A;  3GP7 A;  3ULL A;  4GKK L;  2NVY B;  2IX3 A;  5DM7 3;  1K8A C;  2A69 C;  5T1G A;  3V96 A;  2XGT A;  4HIK A;  1RIP A;  1TS2 A;  3U4Z A;  4OO1 I;  2OCE A;  3FKI B;  3CC4 A;  3I55 A;  4HAE A;  4H0L C;  2OTL A;  1F9S A;  5KYL A;  1LAB A;  3KF8 B;  4JI5 Q;  2B2V C;  4A3C H;  2NWG A;  2E2I H;  1LTL A;  2B2W C;  1EQT A;  1B3Q A;  2BA1 A;  4LF6 Q;  1YHQ A;  1STE A;  2F4V L;  1Q8I A;  1EU3 A;  1QCB D;  2EIF A;  2ICE C;  5C0X G;  5D65 A;  4IFD I;  3IRB A;  4DUZ L;  1JJG A;  1R9T H;  1IBM Q;  1IKL A;  1LTB D;  4X64 Q;  4GZY C;  1HNZ L;  3ERQ A;  1JOK A;  3RLO A;  2N88 A;  5D3D A;  2IY5 B;  1QG7 A;  2KED A;  1SJE D;  3QWN A;  1I4G A;  3S1R H;  3KLR A;  4YWK A;  1UEA B;  5FOB B;  3AB9 A;  4A3J B;  3WWV A;  1VF7 A;  4FF4 A;  3S17 B;  5IYD H;  2KBN A;  4H02 A;  1A63 A;  3TDQ A;  4JI8 L;  3K0X A;  1G2S A;  5FO9 B;  2PYK A;  4IAL A;  5CV5 A;  3DLL A;  2MO0 A;  1G91 A;  4AQY Q;  5FO8 B;  1L0Y B;  1TVX A;  1SFO B;  2GA4 B;  1PRT B;  3CPF A;  3U50 C;  3MXG A;  1XNQ Q;  3J7A 5;  1IW7 D;  4DXF A;  3HOU H;  1J9O A;  1ZYR C;  4RHR A;  1C8C A;  1KLG D;  2VQF L;  4L5R C;  4TQU S;  5JOB A;  1ML0 D;  1S5B D;  4YCV A;  4POF A;  2QGQ A;  1N33 Q;  4YHH L;  1HRJ A;  4AYB E;  2BA0 A;  1BR9 A;  1KAW A;  3S2D H;  4ID6 A;  3K7U C;  5NUC A;  5C5M A;  4R4C A;  3GTQ B;  1IYU A;  1SAP A;  1G6Z A;  5M5W H;  3EBE A;  1STB A;  1IXR A;  3D4D A;  4BWG B;  1ZEQ X;  4X62 Q;  2E2D C;  2Z1C A;  1TWA B;  2R7Z H;  2PQE A;  5DNF A;  4EQ5 A;  3MC0 B;  5FO7 B;  1YEZ A;  2XTI A;  1EY9 A;  2HDL A;  3RMH A;  3Q23 A;  4DFA A;  1MHW C;  2LS0 1;  1VQA A;  5C44 H;  1YVC A;  4P72 A;  1FGB D;  4RFB A;  2AUJ D;  2RDH A;  3BS1 A;  2ZJP A;  1G29 1;  3ND8 A;  4DV2 L;  1YJW A;  2JA8 G;  3KK7 A;  1FD7 D;  4MTK A;  4JI1 Q;  2HQL A;  3SXH A;  3D8G A;  4QF4 A;  5LMN W;  3OW7 A;  3I4M B;  2BOS A;  1VQL A;  1STA A;  1PFB A;  3H6M A;  2VY3 A;  1YBY A;  1DGS A;  1SMY D;  2HDM A;  5M3F H;  1SYB A;  2VUM H;  1B44 D;  5EPJ A;  1WCM B;  1EY0 A;  4ILW A;  4F8M A;  3J80 L;  2B39 A;  4NB3 A;  2DGY A;  1U4M A;  2VB3 X;  1CA6 A;  4Y52 H;  2QDB A;  3S1N H;  2DUD A;  2SNM A;  1PTO B;  3RZO B;  2IHF A;  4K2K A;  3SK8 A;  1HFG A;  5LL6 S;  3S1Q H;  3S1M H;  2MGS A;  4L8J A;  5IYC G;  4IJL A;  1X9N A;  1JJC B;  2RCN A;  1B7Y B;  3NSW A;  2A1A A;  2NZ1 D;  2RA4 A;  3HS0 C;  3Q22 A;  1GUO A;  3P7J A;  3X3M A;  4QCL A;  4DK1 A;  4B3M L;  4KKS A;  1HUN A;  1QZH A;  1LTI D;  1RDP D;  3KF6 A;  4A3G H;  5C5L A;  3QO2 A;  1V8Q A;  2Z6K C;  1HQR D;  2EY2 A;  2K28 A;  1BCP F;  2WFW A;  2X6L A;  2KUM A;  4N8F A;  3MEH A;  2NUC A;  4JOI A;  3J80 i;  3BG3 A;  3ERO A;  2HIX A;  4LK1 C;  5C3E G;  3KBG A;  3NTI A;  4LF5 L;  4JVZ A;  3PMF A;  1NMF A;  1A3T A;  4BBR B;  3NUC A;  4PG3 A;  5G3L D;  4JI7 Q;  1V43 A;  3JAM L;  1LTR D;  5IGB A;  1MD2 D;  2PMZ B;  3U9S A;  2X69 A;  4GLV B;  4A3K H;  1TY2 A;  4CDE C;  3CC2 A;  3OYY A;  4LF7 Q;  2F03 A;  4CDF C;  2Q8I B;  2DJG C;  5C4X B;  2A68 C;  4OEM B;  3K58 A;  3I4L A;  4UP8 A;  3NHH A;  1GO3 E;  1FR3 A;  4B9W A;  1TKW B;  1RD9 D;  1X55 A;  4DAV A;  1CA5 A;  1BOS A;  3GTK H;  5T1I A;  1YHA A;  3TSS A;  3LX0 A;  3PO2 H; 
#chains in the Genus database with same CATH homology
 4RKB A;  3VYT A;  4R8I A;  4HR7 B;  3KLS A;  4TRD A;  3MTS A;  1AEX A;  3I8Z A;  2L5T A;  4Q5V A;  2FMM A;  2L1B A;  3M7N A;  4DF7 A;  1CZG A;  4K14 A;  4ZRZ A;  1F77 A;  2IT1 A;  5EKL A;  2AQ3 B;  3GV6 A;  4K2L A;  5EPL A;  4FVM A;  1SNO A;  2FMC A;  3C46 A;  1OXV A;  2EXZ A;  5IGE A;  2F0N A;  1HTL D;  3CHB D;  3PO3 B;  1BUV T;  2V4D A;  3R2T A;  4PNY A;  2L4N A;  2K5W A;  2RQX A;  2IL8 A;  5CV9 A;  4CKE A;  3NTH A;  1UUP A;  5COY A;  2CHB D;  4OO1 H;  1D5X C;  5KNB A;  1HA5 A;  4RCO A;  2KHS A;  1D5Z C;  3NE5 B;  1YNN C;  5KIX A;  3L9A X;  2E2J B;  3SHL A;  2K01 A;  1D6E C;  1CM9 A;  3TZD A;  2PZT A;  1BXT A;  1WTW A;  3PIP 3;  3MXU A;  4IFD H;  1NR2 A;  2JP1 A;  4TSS A;  2ZXO A;  4A93 B;  3DWA A;  1T5X D;  2CQA A;  3WDN A;  1V1P A;  4DK0 A;  4ZYS A;  4A3E B;  3KBX A;  4TKO B;  2K03 A;  2F4I A;  3IFT A;  1TR5 A;  3S2H B;  4KKT A;  1W6K A;  2DY7 A;  4PMW A;  2MP1 A;  3OWF A;  3VR4 A;  1DD2 A;  1I50 B;  2F0H A;  1LV9 A;  3N52 A;  1Y1W B;  4O42 A;  1M4V A;  4G4K A;  1OXU A;  5COR A;  1JOQ A;  1B9M A;  1I6V C;  3M4O B;  1B53 A;  4J6H A;  4CJ1 B;  1I3Q B;  1EY4 A;  4A3M B;  1CI3 M;  4L63 B;  2IWH A;  4ZKC B;  4KY6 A;  1SYE A;  1EQV A;  4IFD J;  1KLU D;  2VNU D;  4H13 C;  2D62 A;  3H0G B;  4KTA A;  4MIU A;  1BF4 A;  1FNW A;  3M4Y A;  5F2D A;  5CGK A;  3GTP B;  2F3V A;  2PZU A;  5HUR A;  2A6H D;  2M2L A;  4CKC A;  1K8M A;  2EY5 A;  3DUZ A;  2G9H D;  4A3B B;  2EJM A;  4A3I B;  2PW5 A;  2A6E D;  3P75 A;  2R61 A;  2BE5 C;  1AP0 A;  5EBC A;  2ICI A;  4WFN 3;  2ZT9 C;  4NW2 A;  3T56 B;  3BDL A;  5C0X I;  3TBI B;  1NR4 A;  1SXT A;  4DAY A;  1A2U A;  2TMP A;  1TII D;  3FMC A;  3A8K E;  2A69 D;  1GJX A;  5G3L F;  3PUW A;  2I07 B;  4IN3 A;  5ELB A;  4KJO A;  4RHS A;  3SK5 A;  2F0W A;  3BDO A;  2NBF A;  2XVS A;  1RJT A;  4IUU A;  2Y0S B;  4ULL A;  2L55 A;  5CMD A;  2EY1 A;  3MFY A;  1WTQ A;  4Y7N B;  1JQY D;  2EYF A;  1HUM A;  1DYQ A;  2WP8 J;  2Z8L A;  1F9P A;  3BYY B;  4A3D B;  2IW3 A;  1ILQ A;  3OIP A;  3L7Z C;  3MHB A;  1EY5 A;  1GXD C;  1SNC A;  5KNC A;  3OPO A;  3K5L A;  1B3A A;  4K5V A;  4OHJ A;  4DNT B;  1ZYR D;  3D6C A;  3VA7 A;  1SYF A;  3W3A A;  1WTX A;  3SK6 A;  1MGS A;  3GTJ B;  4C3H B;  4N9T A;  4XXE A;  1GUW A;  1GUT A;  4F7X A;  4BA2 I;  5FLX L;  3AU7 A;  1LT4 D;  3GTG B;  1LTG D;  1XX8 A;  1EZ8 A;  4DXG A;  3R8B A;  1A3U A;  2A5H A;  2EE1 A;  2F0J A;  2NVX B;  2B2U C;  2LKV A;  1PRT C;  3NK9 A;  4K5W A;  2F0P A;  2E75 C;  3I72 A;  2L9H A;  1CTM A;  1Y8N B;  1PYW D;  1XWE A;  5K36 G;  4NKL A;  2R6G A;  5EGT A;  4FO2 A;  2O4X A;  3VYU A;  5C3E B;  1DON A;  3K7A B;  1OXX K;  3V05 A;  3NBH A;  1TQO A;  5IT9 L;  4C3J B;  2KCN A;  5CYU A;  1B1Z A;  3KLS X;  2JSO A;  3A55 A;  2EZV A;  3K5O A;  2QKI C;  4J1M A;  2PW7 A;  1SNP A;  3M3Y B;  1KNE A;  1HHV A;  3QJY A;  1KDC A;  3NP8 A;  2IX0 A;  1CHP D;  2R3Z A;  1FYC A;  1U4R A;  3HKZ B;  5JVG 3;  2BCO A;  4FF2 A;  4K8I A;  5FLX E;  2PPB C;  4XT1 B;  4ZUI A;  2KEC A;  1TWH B;  1SYD A;  4J8Q A;  2JXM B;  3VR2 A;  1GUN A;  1PTO C;  3BVZ A;  1WD1 A;  3VYS A;  1MI2 A;  3H09 A;  1JC7 A;  4QUF A;  2B63 B;  2A68 D;  1U4P A;  1AZP A;  3FRP B;  1F2M A;  1V1P B;  2A74 C;  3A56 A;  4G7O C;  1ONL A;  5KYI A;  2XRS D;  1A2T A;  3S9W A;  4ZAI A;  4HMJ A;  5IOD A;  3PUY A;  1LTS D;  5M5X B;  1KDB A;  3NWT A;  2EY6 A;  4U68 A;  3C2P A;  4XQJ A;  3TP5 A;  1VMC A;  4S3S A;  3GTM B;  3QOJ A;  3OSO A;  1ESR A;  1FNV A;  5CV4 A;  5IT9 E;  4JK1 C;  1AW7 A;  4RGM A;  3GTO B;  4DU9 A;  3D3R A;  4EQP A;  4XT3 B;  3IKJ A;  5EKI A;  2A73 B;  1I4X A;  3DMU A;  1CHQ D;  1K8O A;  1JWU D;  3M7G A;  1JE4 A;  3MXN A;  4BY7 B;  5BN4 A;  5I6W A;  3GV3 A;  3QIA A;  4IZ8 A;  4NMZ A;  3K6O A;  4G7H C;  4KJN A;  4C3H G;  1RCV D;  3OHX C;  3I70 A;  1TWF B;  5C0X H;  3F2U A;  1ZXT A;  3NQT A;  1J8I A;  1I6H B;  1X3Q A;  3NTK A;  1XXG A;  1HPC A;  5JEA G;  2RSO A;  1PFN A;  4C2M B;  5C3X A;  4FYD A;  1EY6 A;  3Q24 A;  3HOY B;  3EQL C;  5M5Y B;  2B2T C;  3OMG A;  1JR0 D;  4HTH A;  4H7B A;  3OOC A;  1MSH A;  1PZK D;  1BCP B;  1YNN D;  1Q1E A;  1T5E A;  2EYP A;  5E3F A;  4C1N K;  3SR1 A;  5ELD A;  4Q0F A;  5E4X A;  4ABN A;  1ET6 A;  2M00 A;  4UAI A;  1QNU A;  1II3 A;  2MHV A;  1X3P A;  3I4N B;  1TWC B;  2Q8T A;  2WKD A;  4C3J G;  3TZU A;  4KY7 A;  3S15 B;  1I4P A;  3J81 L;  1DOM A;  4CJ2 C;  5C3W A;  2F0M A;  3R93 A;  2F0I A;  5D14 A;  5FK9 C;  5JPN C;  4ME5 A;  1SE4 A;  5CBA E;  1W6J A;  5C0X J;  4X3U A;  2K04 A;  4LJZ C;  5J1Z A;  3HRZ C;  1XTC D;  1H9K A;  2O5I C;  3TP7 A;  4KI0 A;  4F88 A;  1XYI A;  3TP6 A;  1H9S B;  4EQO A;  3S14 B;  1DOK A;  3SEB A;  1Q1B A;  4BA1 I;  1QNK A;  3IL8 A;  1QOH A;  5ELF A;  3TME A;  2JYO A;  2R93 B;  1ENC A;  3X3N A;  1DJR D;  3HP3 A;  1F2Y A;  1LTA D;  5M9O A;  2IX1 A;  5M3M B;  4M1U B;  3LWE A;  1TWG B;  3HZX A;  1O78 A;  2JA5 B;  3VR6 A;  1LTT D;  3MFG A;  2AUK A;  1EZ6 A;  1A6X A;  5EBD A;  3J7A V;  1BO0 A;  1D2B A;  3A8J E;  5JAV A;  4RAU C;  3J81 E;  4KD4 A;  5CBE E;  1Z47 A;  2BE5 D;  1B9N A;  3P1H A;  3DEO A;  4IUT A;  1B4O A;  1S5E D;  3KF8 A;  1ENA A;  1O7Z A;  1PZJ D;  2RBM A;  4IUP A;  2PO4 A;  3MAQ A;  4L6T B;  2NVQ B;  3C1E A;  3ND9 A;  4RGN A;  3SVM A;  1Z7T A;  5KND A;  4XQQ A;  1STG A;  4X3K A;  3SE0 A;  3T16 A;  5LL6 X;  1H9M A;  1NUC A;  2E2I B;  1QWY A;  2H1E A;  4KY5 A;  2WV6 D;  3CU7 A;  5CV6 A;  5EJW A;  3EJI A;  1R9T B;  4FXD A;  3O13 A;  1GHJ A;  2B2U A;  3URY A;  2AQ1 B;  5IOC A;  1HA6 A;  2DN8 A;  2F0T A;  1VF5 C;  4EVO A;  1EIH A;  3S1R B;  1IHZ A;  4FXG C;  4BBS B;  2FJ2 A;  4KHV A;  4IUR A;  1A3V A;  4KN7 C;  2NN6 G;  2OT2 A;  3I3C A;  4EQN A;  3FPP A;  1IYV A;  1KAA A;  1EL0 A;  2NTT A;  4IUN A;  4C1N I;  4A3F B;  5I2Y A;  1EEI D;  1AFP A;  2RDF A;  4XQN A;  2XWJ B;  3FPU B;  4ZLT F;  3N6R A;  2PNR C;  4IUV A;  1LT3 D;  2B2V A;  4EGV A;  1JIC A;  2B2W A;  1E2Z A;  5M5W B;  4R9W A;  1L0X B;  3L3O C;  2AWO A;  1LAC A;  1TS4 A;  1M8A A;  1SNQ A;  1O7L A;  1C4Q A;  1PRT D;  4KV6 A;  3CRK C;  3H91 A;  2F0U A;  2PCF B;  2K33 A;  2SNS A;  4FXK C;  3Q0A A;  4QB4 A;  2HQE A;  3AMU A;  1TS3 A;  2KQ3 A;  3FEW X;  1ENF A;  4BS9 A;  2EYM A;  3NPP A;  2B8F A;  1S4Z A;  2EYJ A;  2K7V A;  1QIL A;  5M3F B;  2WIN B;  1PTO H;  1TT2 A;  3LWU A;  2DNE A;  5TSS A;  2VUM B;  4QIW B;  4G57 A;  3PUX A;  5E1F A;  3I91 A;  3S1Q B;  3RLF A;  3S1M B;  1B2T A;  1HQM C;  2NTS A;  3EFX D;  1WTV A;  1SEB D;  2QEJ C;  4A3G B;  1NAP A;  2MPM A;  2QF7 A;  1MSG A;  5A35 A;  3MZ5 A;  3A7L A;  1LT6 D;  5JPM C;  3K5M A;  1S5D D;  1HTP A;  4XIG S;  2KA7 A;  1PTO D;  1LLR D;  3HEJ A;  1RHP A;  3VA5 A;  1ILP A;  2KJX A;  3KUP A;  4A3K B;  3OWE B;  2VXW A;  1EIG A;  3E5S A;  1GUS A;  2JA6 B;  2OF1 A;  4K6D A;  1AZQ A;  3C1F A;  1QE6 A;  1R4P B;  5LHY 1;  4RGO S;  2E76 C;  3PO2 B;  3HOV B;  1LO5 D;  1H9J A;  3Q6S A;  3CKI B;  2B2T A;  5C4Z A;  1RF2 D;  2WKC A;  1UNS A;  5C4J B;  1S5C D;  2JE6 I;  2F0V A;  3T13 A;  4CKB A;  1KNA A;  2XRQ D;  1QB5 D;  4LAA A;  4HMI A;  1CQF A;  2XN9 C;  3BVG A;  2F0E A;  2SEB D;  5DEH A;  2D9U A;  2XSC A;  4JBW A;  5KGU A;  3RZD B;  2CVR A;  3C3L A;  2CW0 C;  5DM6 3;  1E2V A;  4Z9C B;  1YNJ C;  1PMR A;  2ZXP A;  2RKS A;  2EYH A;  1DXM A;  3GO5 A;  1SE2 A;  2D2C C;  2F0G A;  2F0D A;  3A8I E;  2TSS A;  3QG1 A;  1ICW A;  3P20 A;  4YIJ A;  3HOZ B;  2OXP A;  1SJH D;  4KMU C;  1NSN S;  4C3I B;  5DAU A;  2F0O A;  3IFD A;  2F0K A;  1SND A;  4AYB B;  2LY7 A;  1GUG A;  4BY1 B;  3GTL B;  1SYC A;  3A7A B;  3NBI A;  2F3W A;  1TU2 B;  2C5C A;  4RWS C;  1AN8 A;  4WJW A;  4V19 0;  1PFM A;  3D4W A;  2KEE A;  1UAP A;  4KN4 C;  4KD3 A;  2R92 B;  4K6L A;  1K83 B;  2C9O A;  4U67 3;  1BCP C;  1SNM A;  3H3V C;  3W2D A;  4G7Z C;  3ITP A;  3NXW A;  4CHT B;  3TN2 A;  5CV7 A;  4KK7 A;  1Z6H A;  2ENB A;  2RDG A;  1D1K A;  1B50 A;  4KKU A;  3G6J B;  4MN3 A;  5KEE A;  5EKK A;  5HGT A;  2KOL A;  1EY7 A;  1Y69 U;  1F9Q A;  2F0F A;  1EYA A;  1CK1 A;  2B2Y C;  3PV0 A;  5BN3 A;  1RTN A;  1PRT F;  4RGT A;  5K36 H;  3U9O A;  2J4X A;  5J22 A;  1JWS D;  1F2Z A;  1F9R A;  1U9R A;  4K8J A;  5IGD A;  2Z4I A;  3QOL A;  2K6A A;  2K1B A;  4I7Z C;  1OXS C;  4FNF A;  3VR3 A;  1QJO A;  1E0B A;  3IAY A;  4P2C B;  2EVB A;  3I90 A;  4QMG A;  2F0Q A;  1E2W A;  1NCV A;  4HED A;  1VCI A;  1RKN A;  2EJF C;  5J39 A;  2K5D A;  2O2L D;  3NWS A;  4RH6 A;  2XIW A;  5I9O A;  3A54 A;  3ZYY X;  1STN A;  3K57 A;  1EWC A;  1OO9 B;  4NDX A;  4FP5 D;  5JVH 3;  3BZD B;  2LMC B;  3D31 A;  1EYD A;  4H44 C;  4CGY B;  3GQB A;  1EU4 A;  2Q8R E;  5I6Y A;  5I2X A;  1MBY A;  4B08 A;  5IGF A;  3BYT B;  1EWH A;  1JOR A;  1CQV A;  1OXT A;  1BBX C;  3HOW B;  1ROD A;  4X3T A;  4K5X A;  3HGB A;  2F0L A;  1JCK B;  5IGG A;  1PTO F;  1Y8P B;  4FF3 A;  4ODG A;  5KRU A;  2NN6 I;  3T4A C;  4XYO A;  3H94 A;  1FNU A;  4C3I G;  2B8G A;  1BNZ A;  4OO1 G;  4R8N A;  3TP8 A;  3VR5 A;  4ZQ3 A;  5IGC A;  2SOB A;  4RKL A;  4IUQ A;  2BDN A;  4CJ0 B;  1Y8O B;  5EPK A;  3K59 A;  3CQZ B;  5ELE A;  1IW7 C;  1PZI D;  1F2L A;  4DAP A;  2J7Z A;  4IFD G;  1DCZ A;  2X6G A;  1PXU A;  3DHQ A;  2BDO A;  1DOL A;  1KDA A;  1H9R A;  2EPB A;  4ZK9 B;  4N9P A;  1EOT A;  1Q3L A;  4ZUJ A;  2MJ8 A;  1O7Y A;  1WTP A;  3J80 E;  1CT1 D;  5ELC A;  5JEA H;  2N55 A;  4M8A A;  3FDT A;  1KTK A;  3T51 B;  5CR3 A;  1R4Q B;  4E6I A;  4LMQ D;  2WII B;  2K32 A;  1V1O A;  5K5P A;  4IQZ A;  1X32 A;  2K5Q A;  4KHZ A;  1PDQ A;  3E6Z X;  1O80 A;  1C48 A;  1KAB A;  2O5J C;  2F1M A;  1SMY C;  2FIN B;  1BQQ T;  2AQ2 B;  1VDZ A;  3S16 B;  2L11 A;  4HSV A;  4FF1 A;  3JAM E;  5JJZ A;  1ZKO A;  2JA7 B;  4RCN A;  4HSP A;  3EVQ A;  4WOR A;  5C4H A;  1DZ1 A;  1STH A;  2H4O A;  5BN5 A;  3LNN A;  4PV1 C;  1I4H A;  4XTC S;  1CZW A;  2JEA I;  1EFI D;  1HCZ A;  1IL8 A;  2KVM A;  5I9P A;  4PMC A;  3PIO 3;  2EOT A;  5JEA J;  3M85 A;  2J0T D;  5AFW A;  3ONA B;  2EDG A;  1LT5 D;  4DN4 M;  1PLF A;  2KCC A;  5A2Q L;  2XNA C;  1TY0 A;  3I73 A;  1HFN A;  2YU9 B;  3DXJ C;  4DA2 A;  4CBV A;  4X3S A;  4OIJ A;  4C56 C;  2NVT B;  4ZKB B;  1JWM D;  4HCE A;  3R3O A;  3HOU B;  2L12 A;  2FHT A;  1ET9 A;  3V2T A;  3GD7 A;  3DWQ A;  1WTR A;  3FVQ A;  3S2D B;  1G8Z D;  3J7Y W;  1D1I A;  2XWB B;  2WAQ B;  2QIL A;  2K05 A;  1DM0 B;  1SDF A;  4F87 A;  2LFN A;  1HXY D;  2WB1 B;  1RTO A;  2RVL A;  4XDX A;  2AWN A;  4OIK A;  3J7A F;  2R7Z B;  2NYZ D;  3RD4 A;  5IIF A;  2HUG A;  4DNR B;  5C44 B;  3UI2 A;  4XYQ A;  2PZW A;  1TS5 A;  5CV8 A;  2EJG C;  2MUY A;  2CW0 D;  1EYC A;  2HCI A;  4B9X A;  1YNJ D;  5A2Q E;  3RUZ A;  4PMB A;  1Q12 A;  2DY8 A;  3MA2 B;  5EQ0 A;  2OEO A;  4HN7 A;  3S1N B;  4PQX A;  3K0Y A;  5D3I B;  1WTO A;  1EEF D;  2FFK B;  3R2I A;  3MXP A;  4QUC A;  2F0S A;  1GHK A;  3DM1 A;  2B2Y A;  3OMC A;  2NN6 H;  1U4L A;  1ESF A;  3VYR A;  1I4Q A;  2Z4H A;  3MVV A;  4NP5 A;  1SE3 A;  3BDC A;  3OIQ A;  1Q90 A;  1STY A;  4OL7 A;  4DGZ A;  3PUV A;  2SDF A;  2EYL A;  2HCC A;  2DNC A;  3D4R A;  3HG9 A;  4MHE A;  3MWY W;  2JEB I;  1SSO A;  2ZXR A;  5CC4 A;  5E4W C;  2WAC A;  1EY8 A;  1BCP D;  1SYG A;  3QB3 A;  1H9S A;  2E2H B;  3GTK B;  1D5M C;  3D6W A;  4V0B A;  4O1N A;  5I4D A;  4HCS A;  4RA8 A;  2JA8 B;  1A15 A;  2IJ0 A;  4UDU C;  1IKM A;  1GOZ A;  1JB3 A;  1BDO A;  2IPK D;  3WOF A;  2YYZ A;  1SBB B;  4OGQ C;  2ID0 A;  3DEP A;  3EA6 A;  3WOE A;  3DWP A;  1Y1V B;  2NB0 A;  1JOO A;  4I65 A;  3HOX B;  3T53 B;  3E0J A;  5ISR A;  2A6H C;  5C6A A;  2D5D A;  3PUZ A;  3SDZ A;  1WD0 A;  2QCP X;  2RSN A;  2I46 A;  2EYO A;  1S5F D;  2G9D A;  3SK4 A;  2A6E C;  5FKA C;  1CFM A;  1G2T A;  1WVL A;  3K5N A;  4WRD A;  2L0C A;  2VB2 X;  2E74 C;  3BVM A;  3G7L A;  3CRL C;  1VMP A;  3NQI A;  2M9V A;  1I4R A;  3GP7 A;  2NVY B;  2IX3 A;  5DM7 3;  2A69 C;  5T1G A;  3V96 A;  1TS2 A;  4OO1 I;  3FKI B;  4HAE A;  4H0L C;  1F9S A;  5KYL A;  1LAB A;  2B2V C;  2NWG A;  2B2W C;  1EQT A;  2BA1 A;  1STE A;  1Q8I A;  1EU3 A;  1QCB D;  2ICE C;  5C0X G;  5D65 A;  4IFD I;  1IKL A;  1LTB D;  4GZY C;  3ERQ A;  1JOK A;  2N88 A;  5D3D A;  1QG7 A;  2KED A;  1SJE D;  3QWN A;  1I4G A;  3KLR A;  1UEA B;  5FOB B;  3AB9 A;  4A3J B;  1VF7 A;  4FF4 A;  3S17 B;  3TDQ A;  1G2S A;  5FO9 B;  2PYK A;  4IAL A;  5CV5 A;  1G91 A;  1SFO B;  5FO8 B;  1L0Y B;  1TVX A;  2GA4 B;  1PRT B;  3MXG A;  1IW7 D;  4DXF A;  1J9O A;  1ZYR C;  4RHR A;  1C8C A;  1KLG D;  4TQU S;  5JOB A;  1ML0 D;  1S5B D;  1HRJ A;  2BA0 A;  1BR9 A;  4ID6 A;  5NUC A;  5C5M A;  3GTQ B;  1IYU A;  1SAP A;  1G6Z A;  1STB A;  3D4D A;  4BWG B;  1ZEQ X;  2E2D C;  2Z1C A;  1TWA B;  2PQE A;  5DNF A;  3MC0 B;  5FO7 B;  1EY9 A;  2HDL A;  3RMH A;  3Q23 A;  4DFA A;  2LS0 1;  1FGB D;  4RFB A;  2AUJ D;  2RDH A;  3BS1 A;  1G29 1;  3ND8 A;  3KK7 A;  1FD7 D;  3SXH A;  3D8G A;  4QF4 A;  3OW7 A;  3I4M B;  2BOS A;  1STA A;  1PFB A;  3H6M A;  1SMY D;  2HDM A;  1SYB A;  1B44 D;  5EPJ A;  1WCM B;  1EY0 A;  4ILW A;  4F8M A;  3J80 L;  2B39 A;  1U4M A;  2VB3 X;  1CA6 A;  2QDB A;  2SNM A;  1PTO B;  3RZO B;  4K2K A;  3SK8 A;  1HFG A;  5LL6 S;  2MGS A;  4L8J A;  3NSW A;  2NZ1 D;  2RA4 A;  3HS0 C;  3Q22 A;  1GUO A;  3P7J A;  3X3M A;  4QCL A;  4DK1 A;  4KKS A;  1HUN A;  1LTI D;  1RDP D;  5C5L A;  3QO2 A;  1V8Q A;  1HQR D;  2EY2 A;  2K28 A;  1BCP F;  2X6L A;  2KUM A;  3MEH A;  2NUC A;  3BG3 A;  3ERO A;  4LK1 C;  3KBG A;  3NTI A;  3PMF A;  4BBR B;  1A3T A;  3NUC A;  5G3L D;  1V43 A;  3JAM L;  1LTR D;  5IGB A;  1MD2 D;  2PMZ B;  3U9S A;  2X69 A;  1TY2 A;  2F03 A;  2Q8I B;  5C4X B;  2A68 C;  3K58 A;  3I4L A;  3NHH A;  1FR3 A;  4B9W A;  1TKW B;  1RD9 D;  4DAV A;  1CA5 A;  1BOS A;  5T1I A;  3TSS A;  3LX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...