1Y8PB

Crystal structure of the pdk3-l2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
97
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
total genus 14
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8pB00
1ZYRC 1V8QA 4KN7C 3W3AA 4JK1C 2EDGA 1Y8NB 2BA1A 2O5IC 3T56B 1H9RA 2AWOA 1DD2A 1K8MA 1HTPA 1VDZA 3A8IE 3HGBA 5C0XG 2A6HC 3PUZA 3CRKC 1GHKA 3RLFA 1DCZA 2EJGC 1Q1BA 3MXUA 3TZUA 3ND9A 1TKWB 3QIAA 4OO1G 4RCNA 2NN6G 3PUWA 3NE5B 2EJFC 2ZT9C 1YNNC 2A68C 2PCFB 3I73A 3VR6A 3M7NA 1IYVA 3A7AB 3A8JE 4G7OC 4H13C 2NN6I 1G291 3OW7A 5KNCA 3M4YA 2BE5C 2A69D 4H44C 4OO1H 2V4DA 3I4LA 3FPPA 2A69C 1PMRA 2BE5D 3OOCA 3PUYA 2K33A 4KN4C 1E2ZA 1OXUA 2DNCA 2E76C 2PNRC 3QJYA 5C0XH 3M85A 1Y8PB 3I72A 4XTCS 1OXXK 2EVBA 3CRLC 2JEAI 4GZYC 2YYZA 1B9MA 4DNRB 3MFYA 1Q90A 1K8OA 1HPCA 2LMCB 2O5JC 1E2WA 2DN8A 3BG3A 4HR7B 4L8JA 1E2VA 1IW7D 5BN5A 1HQMC 1OXVA 1FR3A 4IFDG 1GUOA 1T5EA 3T51B 4JBWA 4LJZC 4OGQC 2JE6I 1H9SB 1CFMA 2KA7A 2R6GA 3D4RA 4LK1C 5A35A 4KKUA 2QF7A 5JEAG 5KNDA 3VR2A 1GUGA 1O7LA 1V43A 2L5TA 2E75C 2K32A 2B8FA 2JEBI 2K7VA 3A7LA 2E74C 4PV1C 2BDOA 4DK1A 2B8GA 4KMUC 3D31A 3WDNA 3KLRA 5KNBA 1Q1EA 4KI0A 4IQZA 1CI3M 2A6HD 5K36H 3VR4A 1CTMA 1H9MA 3AB9A 3VR3A 3LNNA 3GQBA 1Z7TA 2AUKA 4KHZA 1BDOA 3T53B 1GJXA 3BDOA 1H9KA 2A6ED 2D5DA 1YNJC 1GHJA 3DXJC 1B9NA 1LACA 3GD7A 4DK0A 2PPBC 2EJMA 3VR5A 3PV0A 3SDZA 2AUJD 2IT1A 2A68D 1I6VC 2BA0A 2DNEA 4G7ZC 1O78A 1TU2B 4TKOB 2NN6H 4KKTA 4BA2I 1QJOA 1VF7A 4H0LC 3OPOA 3ND8A 3PUXA 1IYUA 3IKJA 3L7ZC 5BN4A 1VCIA 1Y8OB 3FMCA 2A6EC 2KCCA 1GUSA 1Z6HA 4G7HC 1H9SA 1Q12A 3U9SA 1OXSC 2D2CC 2D62A 3PUVA 4KKSA 3EQLC 1A6XA 2Q8IB 5K36G 3QG1A 3P20A 4BA1I 2JXMB 1SMYC 4I7ZC 5BN3A 3LWUA 1EWHA 1IW7C 1FYCA 4TQUS 1ONLA 1LABA 4DNTB 2CW0C 3N6RA 5JEAH 2F1MA 1DXMA 3A8KE 1HCZA 3H94A 3VA7A 1OXTA 3SE0A 3IFTA 1Y69U 1GUTA 1GUNA 4XIGS 1VF5C 4IFDH 1ZKOA 1H9JA
chains in the Genus database with same CATH superfamily
3UDIA 2UU9L 5G3LD 1KIXA 3W3AA 4J8QA 5C44B 3PO2H 1BCPF 5AFWA 2AMCB 3BZCA 4LAAA 3IL8A 2RA4A 2WP8J 4KTAA 3KK7A 3L2PA 2L55A 4MNOA 4B08A 1MI2A 3CW2C 2DY8A 1J5EQ 4FF1A 1VQNA 1HXYD 3VR6A 4LF5L 4RGTA 5IGGA 1QCBD 5CV7A 4NDXA 4M1UB 1X3GA 2RVLA 3K57A 5KYLA 1PMRA 4A3MG 3BJUA 1Q46A 1K3BC 4NB3A 1OXUA 1PH1A 2Q2UA 3UDFA 2CWAA 1PZKD 5C4XG 4B3TL 1Q8IA 4DAVA 1PTOB 3KDFB 1SNDA 4C3JB 4JOIA 2IW3A 2HQEA 4H02A 2R61A 3SK4A 2PI2A 3T51B 2RSOA 4HCSA 1STYA 2OWOA 4KKUA 2D9UA 4KJNA 1JB7A 3BVZA 1KDCA 1B70B 3M4QA 3ULJA 3OW2A 1KQSA 2YU9B 1PTOD 4DXFA 1X65A 1K0RA 4ILWA 2ENBA 5D65A 2AQ1B 3TS0A 3AU7A 5EPKA 3CCVA 1SEBD 2EOTA 1F2YA 2QEXA 1RTNA 4DGZA 3U50C 3HOXB 5M3MG 3OPOA 4QQBX 1SYGA 1QILA 3IKJA 1VCIA 2G5DA 2EYLA 4DAMA 2R7ZB 4KHPQ 3K5LA 3NENA 3K58A 4I7ZC 2Y0SB 2R92G 1K3RA 1IW7C 4EGVA 1TVXA 1TXYA 3U9OA 1GUWA 4DAYB 2SDFA 4UAIA 1X3EA 3T1YQ 1Y69U 1L1OA 5EKIA 3FHWA 1V9PA 4K5WA 2E2HH 1IBKL 4IURA 1IZ6A 4ZAIA 4C1NI 4NXNL 1VQDA 1QVFA 2Y0SE 3D6WA 3I70A 4OWXB 5IGCA 1QE6A 4A3GB 4HIMA 2RDGA 2B63G 1F9QA 2KOLA 3G7LA 5LL6X 2EJGC 3KJPA 2Q8TA 2Z0SA 3S1RH 2NVTB 3WWVA 2NN6G 4ZYSA 1JE5A 5CBAE 4JI2L 1I4QA 4B3RL 3M4YA 1SR3A 1JORA 1AEXA 4GOPC 4OIKA 2A5HA 4P75A 1L0XB 4IUNA 1RL2A 4RWSC 4ULLA 1B9MA 1TQOA 4X66Q 4FNFA 1QUQA 3GTOB 2K1BA 1XPOA 2IX1A 3DWQA 5GAGC 1FR3A 1EY6A 1KDAA 1BVSA 5A35A 4RG1A 1GKHA 2WIIB 1KC8C 2Z4IA 5LMUL 1OO9B 3MXNA 3TS2A 3RD4A 1J5EL 2B2UA 5EGTA 1Z7TA 3TBIB 4UP7A 1KLGD 2B3GA 2M00A 4J1MA 1GHJA 3VR5A 3STBC 4A3KH 3DM3A 2DNEA 5H1SE 1GD7A 1S40A 3I8ZA 1HZAA 3KOJA 3RLOA 3R3OA 2VQFL 1VQEA 4DN4M 1R4PB 3U9SA 4DV0L 4Q0FA 4DAYA 4A3DB 1EWCA 1EYAA 3LWUA 1YITA 1XMOL 1HR0W 4JI1Q 1TS4A 5IP9H 1IBMQ 1QNKA 2ALYB 2F1MA 3T16A 2HDLA 1OXTA 5C4XB 1B7YB 4JI8Q 4ZKBB 3I2ZA 2PQAB 1H9JA 3S24A 1AZPA 5T1IA 2R7ZG 4R4CA 3GDEA 1PFNA 5C4JH 4BBSH 2A73B 1H9RA 1RDPD 1PH9A 1T9HA 3J7AF 5JJIA 2XWBB 1VDZA 4DR7Q 3PUZA 1GHKA 1WTOA 1DCZA 2VZAA 1X55A 1LTGD 3MXUA 4DR2L 2MO1A 2NB0A 2QILA 3E5SA 4LFCQ 1LTBD 4R8NA 2PCFB 4JPBW 1HNWL 3JAMi 1DM0B 1Z9FA 4L6TB 2K6AA 1EQTA 4H44C 1CA6A 1A62A 5BR8L 3GTLB 2A69C 3FKIH 4NP5A 2MPMA 2WINB 1SYEA 3PO3B 3OTOL 1KHIA 4A3JH 1XMOQ 3CF5A 4DUYL 1HPCA 3PIPA 2PMZE 2LMCB 2YU9H 4JI0L 1SBBB 3MFGA 4WORA 3MEHA 1WD1A 3AEVA 1CFMA 3LGJA 4HIOA 4CJ1B 5KIXA 2KEEA 1V43A 5CV5A 4A3DH 2CQAA 3HOUG 2VQFQ 3EIVA 4GS3A 4O42A 5IIFA 1WCMG 1TWFH 1NMFA 2B2VC 2PZUA 3VR3A 1IKMA 2ZTEA 4H7BA 1GJXA 3PF5A 5J3BA 3BS1A 2JA5G 3GD7A 2PPBC 4U68A 1IBLQ 2KCMA 2NVYB 1AP0A 1O78A 1PDQA 3NTIA 1KABA 4LFAQ 3NXWA 2MHVA 1RKNA 4X62L 4JI8L 2ZJPA 2JA8G 4LFBL 2IHEA 5FO8B 1WYDA 4HIDA 2B63H 4G4KA 1NNXA 3P20A 4Z9CB 4BA1I 2B2YA 2XSCA 4IUVA 3HOVH 2E2JB 1ONLA 3HOYB 2KUMA 2NTTA 3H3VC 3T4AC 3KJOA 1I3QB 1Y1VH 1B1ZA 3S1MH 1I50H 2PYKA 1LLRD 3PSIA 1ML0D 3KFUA 1QG7A 3EA6A 4DPGA 1HNXL 4YCUA 3T56B 3J7ZC 4GKJL 2L12A 5NUCA 2F4VL 5IYCH 4HTHA 5J22A 2EY6A 3U4VA 5IGBA 4HJ8A 1YHBA 4RHRA 1CK1A 5DEHA 4PMCA 3HOZG 1YNNC 3I7FA 1SROA 3J7YW 1M90C 4LFAL 2N49A 2NUCA 3PCOB 4BY1B 1EOVA 3T1YL 1I6HH 1STEA 3Q24A 2JYOA 4N8X1 4QUCA 4C3IB 2JEAI 1RTOA 1O7ZA 1BCPB 1S5CD 2NVYH 2I07B 5GADC 1A3TA 3NWSA 1J9OA 4LF5Q 3ZYYX 5EAYA 3TP7A 1DONA 2EYMA 5FLMH 1L0WA 4A75A 2IX0A 1H9SB 2NVXH 5FLMG 2L9HA 1X3QA 1C9OA 3HOVG 2TSSA 4FVMA 5IT9c 4LUZA 3RZDB 2UUCQ 4QIWB 5K36H 1CHQD 1SE2A 4X6AH 1NTGA 4HSPA 4O0AA 3KLSX 2B39A 4ZK9B 4LUVA 1KTKA 1I5FA 2D5DA 1TS3A 5E3FA 4XQJA 2LS01 1NR2A 4LF4L 2AUJD 3D6CA 4PZ6A 1YNND 4Y52H 3TP6A 2ICEC 4A3IH 4ZQ3A 1UE5A 2KCTA 4KKTA 3KBXA 4BA2I 1QJOA 4A3BG 2SEBD 5IT9E 5M5XB 2D0OA 4GKKL 1A8VA 1X6OA 4LFCL 3VYUA 1JJGA 4DR2Q 2XRSD 1F9SA 4HJ9A 5LMUQ 4A3FH 4BBSB 1UNSA 2H4OA 4WJ4A 3VYRA 4XQNA 1CZWA 3PO2G 3VA5A 1VQ8A 1I6HB 3N6RA 1M4VA 4CJ0B 2BH2A 4K0KQ 4NXNQ 1D8LA 1QNUA 1R9TH 3IFTA 5C3EH 3S2DH 1VF5C 3PO2B 4EQPA 3KLWA 3N52A 1Y8NB 1EIGA 4V0BA 4DU9A 2OEOA 1AW7A 1ZEQX 1DOLA 1NCVA 2PO4A 5CV6A 3V05A 1K73C 1D7QA 1DD2A 1HZBA 2KECA 5IWAL 4BWGB 3UI2A 4DUZL 2I46A 1ZXTA 2HT1A 2NVQB 2QW7A 4RCNA 3LX0A 4JI3Q 4A3IG 1IYVA 2B29A 3CHBD 3A8JE 3EROA 2NN6I 1L1OC 1NE3A 2RDFA 1XPRA 2PZWA 5D3IB 1ENAA 1CQFA 3I4LA 2BE5D 4C2MB 3M4PA 1V1PA 3H09A 5C0XH 3HOWB 3SHLA 1R4QB 2X6GA 4PZ7A 5JVH3 3HOUH 4GN5A 3BU2A 2BOSA 2D0PA 3TSSA 1Q8KA 1E2WA 4EQ5A 1IKLA 4KK7A 2NVTH 1T5EA 1F2LA 2JA7B 3D4RA 4KD4A 4ABNA 1N32Q 2K5WA 1GUGA 3NBHB 3J80c 4J6HA 2RBMA 3KLRA 3D4DA 1ASYA 1EL0A 3AB9A 4FDBA 4XT1B 4GLXA 3F2UA 1W6KA 4ME5A 1LUZA 1CT1D 3BDOA 5F2DA 5M3MH 4X65L 3RN2A 1W2BA 3HRZC 1FNUA 4BBRH 5LHY1 1CSPA 2E8GA 5AJ3Q 4LNQA 3J80L 2EYHA 3AFPA 3Q22A 4BBRG 3OWEB 5A2QL 1SN8A 2X69A 1Q12A 3HKSA 1SAPA 1JWMD 2K50A 2Q8IB 3GTGH 4CBVA 1TS2A 3BYTB 1KNEA 4UY8C 4BBSG 2CH4A 4FF3A 3HZXA 2VUMG 1S5DD 1FYCA 4QCLA 3NEMA 2RDHA 4IALA 3CCUA 4DNTB 3MXGA 5CYUA 4DV4L 3GTQB 4C2MH 3VA7A 1BUVT 2JA6G 1ASZA 1D5ZC 1JT8A 2OQ0A 5ELCA 1GOZA 2F0LA 2ZTDA 1AE2A 4IJLA 5CV9A 2ZM6L 3CAMA 1BBWA 5CBEE 4LMQD 1WFQA 2I5HA 4K6DA 4A3MH 3CCJA 3G48A 2EJFC 2ZT9C 4APVA 3DHQA 4K6LA 3CCLA 4FXKC 2C5CA 3STBD 4JI4Q 1ILPA 2ICIA 4FYDA 2BE5C 2JA5H 3H3VI 4DV6Q 2VQEQ 5LL6S 1KAWA 4DV7L 3CC2A 2BDNA 1PRTC 4R9WA 5FJ8H 2EVBA 2RHSB 2R3ZA 2YYZA 3EN2A 2EIFA 1CHPD 4A3DG 3KUPA 2CFMA 3X3NA 1A3VA 3NHHA 3D4WA 2KVMA 1SJED 4DAPA 1BOSA 4RKBA 5IYBG 4JI6L 2CWPA 5DAUA 2A19A 2RCFA 1VQBA 4NPSA 2K32A 4PV1C 5ELEA 2VUMH 4DK1A 1WD0A 4A93H 1I4XA 2B8GA 3RNUA 1X54A 4DR5L 2F0IA 3OMGA 2EY5A 3HP3A 1MD2D 4NKLA 1MGSA 3GQBA 2AUKA 3PO3H 5JAVA 1M8AA 2UUBL 1G8ZD 3D8GA 2KEDA 4I65A 1YEZA 1EIFA 1B50A 2R93B 3A5UA 2Z1CA 2K04A 1QB5D 1Q81C 2PNHA 1YI2A 1EOTA 4OIJA 2M2LA 1PH4A 4Q5VA 5ELBA 3UE1A 3S16H 1BO0A 3SR1A 2ASBA 5C3EB 4BXXH 5C3XA 1L0YB 3FEWX 3HKZB 4AYBG 1NY4A 1EIHA 3EQLC 2JA7G 2HCCA 1AFPA 5BN3A 2BH8A 1IBLL 3ER0A 3J81i 4IOCA 4YWMA 5JOBA 2R93G 1B8AA 2WFWA 2VB3X 1QOHA 2XTIA 1KD1C 4JYAQ 3NELA 1I4PA 3H91A 2F4VQ 3CD6A 3SXHA 2AWOA 3HKZG 1X3FA 4KY5A 4X3UA 3CU7A 5IGDA 1HJPA 5E1FA 2UUBQ 2F0OA 2FINB 1CKOA 1B4OA 4JV5L 1VQKA 3P1HA 2RHQB 1O80A 3NTHA 3K6OA 1JMCA 4IOAA 2E2JH 4A76A 3K5MA 3RZOB 3NUCA 1N36Q 1VS0A 1YIJA 3GTLH 1SNPA 5JJZA 1K83B 2CKZB 1EWIA 4GKJQ 2NYZD 4YY3Q 1S3OA 3PUYA 4DV0Q 1C0AA 1FGBD 1N33L 4XTCS 5E7NA 4UP8A 4CDCC 3PF4A 2XRQD 2F0EA 2LFNA 3M7GA 4A93B 3WOFA 3NQTA 1G6ZA 3NPPA 1IL8A 3A5ZB 3KF6B 3H0GG 1N34Q 4Y7NH 4LF9L 2SNSA 4WRDA 5HGTA 3TDQA 2QF7A 1EZ6A 2VL6A 3CCMA 1I4RA 2K7VA 1IHZA 4P73A 2BDOA 2EPBA 4RGOS 3VR4A 3SK8A 1EYCA 3CPFA 1VQPA 3LNNA 1D6EC 5EKLA 3J81j 1A0IA 4LUOA 2L0CA 4IPDA 5IYDH 3CC7A 1QVGA 5ELDA 3S17B 1HZ9A 1JWUD 2B63B 1Y8OB 3KBGA 2A6EC 3M3YB 3I4MB 3HOYG 3ERSX 1D5MC 1PYWD 1WCMH 3FRPB 5EBCA 2L4NA 4K8JA 3HG9A 1FNWA 1T5XD 4LF9Q 1SRUA 2EQSA 3H94A 1HCZA 5C3EG 4DV6L 2DUDA 2QEJC 5L37A 1KXLA 3O13A 1XNQL 4IFDH 1V1PB 4JK1C 1KNAA 3JAML 2MFIA 3J80E 2HHHL 1LTLA 4IPCA 5LMNW 1U0LA 2PI2E 1IL2A 3HOZB 5T1GA 3HGBA 1TWAH 3X3MA 2MNAA 3J81L 1A15A 3GP7A 4IUTA 3FKIG 2Y0SG 4WJ3M 4YWLA 5EPLA 5M5YB 4QJFA 1QUQB 1UE7A 4DV1Q 4MTNA 3RMHA 2OTJA 1S5FD 3CPWA 3DWAA 2GVBA 5D14A 4JI7L 5CORA 2A69D 3HOXG 3VDYA 3L0OA 3S2DB 2V4DA 3S2HH 2ZXOA 3ERQA 4IZ8A 3R93A 5DM73 3CRLC 4QB4A 3J7A5 5HGQA 5FK9C 4DFAA 5IYCG 3S14H 4CHTB 1JE4A 4JI7Q 5IGEA 4C3HB 3ZJYC 1UWVA 4B9WA 4M8AA 3UDXA 2VS1A 2ATWA 1F9RA 1OXVA 4O2DA 4IFDG 2NVXB 4K8IA 2Q8RE 1GXDC 4LJZC 2K75A 3PIP3 2R93H 4JI5Q 1DOMA 1IXRA 4RKLA 4DA2A 1LYLA 4X64L 3S16B 3BVMA 1U4LA 5EKKA 5KYIA 1SLJA 5FLXc 2MUYA 1GM5A 3MHBA 1FJGQ 1CI3M 3CCSA 3S9WA 4C1NK 1CTMA 5E4WC 2F0KA 1XMQQ 4FP5D 3IRBA 2F0GA 2MO0A 2A6ED 4ID6A 4QMGA 4R4OA 4TRDA 1HH2P 4C3HG 3SDZA 2BA0A 3L3OC 4TKOB 3HOZH 5JPMC 3K7UC 1VQ4A 1UAPA 2OQKA 2QA4A 2RCNA 1Y1WG 2MGSA 2F3VA 1Z6HA 3W5OA 1H9SA 1WTWA 1EU4A 2CHBD 3E3XA 1ENCA 3C2PA 4GLVB 1A6XA 3A74A 4ZCKA 4JV5Q 1Y1WB 1VQ9A 4CKCA 4TQUS 4CDEC 3URYA 3OIPA 2JJQA 3QR8A 5CV8A 1F2MA 2E5LL 1QWYA 4CJ2C 3A8KE 1JQYD 2QCPX 5M3MB 4GKKQ 3T1HL 2A74C 5FOBB 1SE4A 1STBA 4AQYQ 4X66L 2FXQA 1ZKOA 4LF8L 1B3QA 3D3RA 5I6YA 3H0GB 4RGMA 4ZRZA 1TWFB 3GTPB 1K83H 1E22A 2OXPA 4MIUA 2BA1A 2O5IC 1TIID 1WJJA 3ITPA 2UU9Q 4F87A 1EIYB 2KHIA 3S2HB 4EQOA 1WTHA 3KDFA 4PQXA 2ZJQA 3V96A 1SE3A 2A68C 2MQHA 4X62Q 2O4XA 4ODGA 1SNMA 5IYDG 3UE0A 4C3HH 1VQFA 3OW7A 3P75A 2KCNA 2Z6BA 2JN4A 2CW0D 3S1NH 1E7ZA 3FPPA 2UXDL 3HOWH 4R4IA 1E2ZA 3MWYW 3M85A 5GROA 1BKBA 2B2WA 4OONA 2KHJA 1WTQA 3HOVB 1PRTD 1QVCA 1K28A 1PVOA 1BR9A 3K7AB 1J8IA 1FJGL 1XNQQ 1HR0L 3MAQA 1V1OA 5HURA 2KENA 3SGIA 4L5TA 1HQMC 1N8RC 1EY8A 1GUOA 4HCEA 4RH6A 1MJEA 4JBWA 1MIUA 1JR0D 2P5ZX 3K8AA 1YJNA 5IP9G 2B2UC 4B3ML 1EQVA 5IT9L 3NK9A 2XIWA 4A3JG 4XYOA 2I0QA 1YNJD 1EFID 4JVZA 2WAQB 1XWEA 1RCVD 5C0XI 3HOXH 1VQ5A 4X3KA 1LACA 2EJMA 5IP7H 2FJ2A 1VMPA 4A3LH 1EEID 4BY1H 4A3KG 1VMCA 5J1ZA 2ES2A 1TU2B 3K80C 1EUJA 2HCIA 1C8CA 3Q23A 1P8LA 2G9HD 4JCVE 3FMCA 4GOPA 2UUAQ 1OXSC 2Z6KA 1EU3A 1O7IA 3OWFA 2E2IB 5IOCA 2DY7A 1CQVA 2VW9A 3TEHB 1SMXA 3OYYA 1LT6D 1NR4A 1S5ED 2F0UA 5GAHC 4P74A 3H6MA 3NBIA 1Q86C 3RUZA 2B2TA 2K5QA 3AYHB 1ESFA 2EDGA 3R2IA 4F7XA 1XTDA 2EYPA 2J7ZA 1PRTF 3K7AH 4BY7H 5JPNC 5GQOA 2XWJB 4HMIA 1GVPA 3TMEA 1HTPA 1B2TA 1FNVA 3S1NB 1H95A 5FLXL 1VQIA 4HIKA 4DV5L 4BXXG 4K2KA 2G9DA 1HQRD 1SFOB 1YHAA 4KLKA 2SOBA 1LTAD 4JYAL 1D2BA 4DNIA 4G7OC 1O7YA 4H13C 1K8GA 3C46A 4L5QA 3F8TA 4OO1H 1RHPA 3EVQA 1P16A 1CUKA 4KN4C 1BXTA 2PQAA 4L5SA 3NSWA 2LXJA 1TWGB 4JI0Q 1BCPD 1WTPA 1I3QH 3HKZE 4DNRB 2UXBL 2ZXRA 4JI4L 2K52A 2K14A 1SE8A 3G6EA 2JQOA 1PYBA 1S4ZA 1JWSD 2XGTA 2F0SA 4O1NA 2JA6H 1LTTD 4OGQC 2KHSA 2QKIC 5BR8Q 2R6GA 1HZCA 4OL7A 4LF6L 1HRJA 1AZQA 2L5TA 4YHHL 1IYJB 3RZOH 2C9OA 1ICWA 2UUAL 4GNXA 1I4GA 1XX8A 2JK8A 1TWCB 5EQ0A 2TMPA 3M4OH 4JBJA 2B2YC 1PHJA 4LWCA 4P72A 1EEFD 4AQYL 4L63B 1YNJC 4OXPA 3Q0AA 4YCVA 4DR3L 2E2IH 4JOIC 1W6JA 1PH2A 2K5DA 3C1EA 1PV4A 4KD3A 4JI1L 1BQQT 1QZHA 4IFDI 5IP7G 3F2BA 4K5XA 4B9XA 1XJVA 2WAQE 3EBEA 3NBHA 2F0DA 4YWKA 4P71A 1RF2D 3P7JA 5JEAJ 1G6PA 1E1OA 1VQOA 1HR0Q 2RF4A 3NWTA 4IUUA 1FD7D 3L9AX 4ALPA 1HNZL 3GTJH 4IJHA 1E0BA 1EWHA 4BY7G 4OX9L 1X9NA 1SSOA 1LABA 3NQIA 3PGZA 5EJWA 5G3LF 1DOKA 1JOKA 1LTSD 4ZKCB 2MP1A 3RZDH 4DV5Q 1EY5A 2GA4B 4GOPB 1YBYA 1V8QA 5C4ZA 4LW1A 1SFOH 4RMFA 1HNWQ 5C4XH 4FO2A 3K0XA 2L1BA 4X65Q 3DM1A 3KF8B 1YJWA 3E6ZX 3RN5A 4RCOA 2YV5A 5C4JB 4HJ7A 4MZ9A 1B3AA 1WOCA 5M5XH 4XXEA 3I56A 5K5PA 1SYDA 4A3LG 1LM0A 2F0PA 5KNCA 4DR7L 4LF6Q 2K5HA 2GN5A 3K81C 1ICFB 1PH8A 3PO3G 2HHHQ 2E76C 3OSOA 4C56C 1XTCD 2KQ3A 4GLAC 2K5VA 1U5KA 3NTKA 3MTSA 1LT4D 2R92B 1K8OA 4PG3A 3GTQH 3GV3A 1TWCH 2Z6KC 3FDTA 1TWAB 2O5JC 3R2TA 4CKBA 2IHFA 2WAQG 4U673 2I5MX 4TSSA 2NZOA 1E24A 4DUZQ 2JE6I 4LK1C 4S3SA 1O7LA 2H1EA 3W1BA 2XVSA 4NXMQ 1SDFA 4N9TA 4HMJA 1FGUA 1LTID 1A2UA 4A3MB 1XMQL 1ET6A 4J15A 2J4XA 2M9VA 1MHWC 2MJ8A 2O2LD 1QZGA 1UEBA 3S17H 1HUMA 2NZHA 4LF7L 4B3TQ 1NSNS 2NN6H 3OIQA 1NBWA 3HOUB 1C48A 1IYUA 3GV6A 4A3GG 4X64Q 3CCEA 1SJHD 1J6QA 1EFWA 1SYFA 3QG1A 2RSNA 1S72A 4F8MA 1MJCA 1N34L 1PRTB 5JEAH 2WACA 2A1AA 1EZ8A 2H5XA 4HN7A 3CQZB 3FVQA 4YCWA 1C7YA 1GUNA 1PFSA 3TZDA 2VUMB 3ONAB 3DMUA 2CVRA 1PZID 4CDFC 2R92H 4DV1L 3S1MB 1CKNB 1AH9A 3WOEA 4A3FG 5JJKA 4YIJA 1PTOC 4XYQA 4XQQA 3J7AV 2PZTA 4ZUJA 2DJFC 3SK6A 3E9HA 4KV6A 4KJOA 4F88A 1U9RA 4AIMA 3J81c 1Y1WH 3T1HQ 2EYJA 2F0MA 3QIAA 4A3BH 3F2CA 3PUWA 1FVIA 4QF4A 4BY1G 1Q82C 1RIPA 1EY0A 1I94L 4UHVA 1SXTA 4N9PA 1JJCB 1N9WA 5IE8A 1HFGA 1PXUA 2JSOA 4K14A 4HJ5A 1F2ZA 1IBKQ 1PLFA 1U4MA 5C4HA 1KAAA 2N55A 3BDLA 3A56A 1PH6A 3CP0A 2AHOB 3PMFA 2DN8A 3KF8A 1VQAA 2EE1A 3HFZB 5C5MA 2IJ0A 1K8AC 3IAYA 1JOQA 3F1ZA 2UXDQ 4HAEA 2L11A 2WKDA 4OELB 4JI2Q 3AMUA 5IY0A 4LF4Q 2E2HB 1JJ2A 4HSVA 5M9OA 4C3IG 1EY7A 4KMUC 1JICA 1HFNA 3W1GA 1HUNA 4DR6L 2HQLA 1HA6A 1STHA 1OTCA 1H9KA 1D1KA 1LT5D 3DXJC 3TRZA 4FXDA 1BCPC 4CGYB 3QO2A 4JW0A 3K0YA 1TY0A 1SNOA 4PNYA 2N3SA 2EZVA 1GUSA 2XN9C 3JAME 3CXCA 4OHJA 1NUCA 2N88A 1SMYC 3K59A 3T13A 5E4XA 1STAA 3D0FA 2ZJRA 1PZJD 3CC4A 1E3PA 3BZDB 4X3TA 2AKWB 4POGA 3VYSA 3MEFA 1KL9A 3SE0A 1KLUD 5LMNL 1GUTA 1MSGA 3H0GH 3GTPH 4DR4L 2IY5B 3UDGA 2ZM6Q 2JA9A 2PMZB 3JAMc 1N33Q 1R9TB 4IPGA 3MC0B 3A54A 4XT3B 1K8MA 1STNA 2K5NA 3G6JB 2FMCA 4EVOA 2A6HC 4DXGA 2OTLA 2N8NA 2OF1A 4DR4Q 3DUZA 1Q1BA 4JG2A 4HJAA 1G51A 1NAPA 1B44D 1TKWB 4OO1G 3TP5A 3I73A 4DR5Q 4NW2A 2LSSA 3A7AB 3V2TA 3I4MG 1JC7A 4NXML 1VQMA 3HEJA 1G2TA 1LT3D 2LKVA 3QWNA 2NVQH 2F3WA 4AYBB 2J0TD 2K05A 5KRUA 2LXKA 4UPAA 1X56A 1PFBA 1WCMB 2DGYA 3K5NA 2A8VA 1OXXK 3ICEA 4DR1Q 3JC66 4DR6Q 4KHPL 4RHSA 4E6IA 4OWWB 4AH6A 2E5LQ 4HR7B 3PQIA 3G4SA 3I4NB 5M5WB 1CKMA 4YHHQ 4EQNA 5I6WA 3CCRA 4P2CB 1I50B 1Z47A 3D31A 5CMDA 1NMGA 2JA7H 3U58A 2F0VA 1SYBA 4G57A 4KI0A 4UDUC 4XDXA 5I9PA 2C35B 5C3WA 1N32L 4OO1I 2UXBQ 1MKHA 1JOOA 2F4IA 5I4DA 2F3IA 2IT1A 3RR5A 1BF4A 3S15H 2AWNA 5CV4A 4IUPA 1XNRL 2JA6B 2K01A 1VF7A 2VNUD 3PUXA 5ISRA 2EYOA 3L7ZC 1X3PA 4IUQA 5JVG3 3S14B 1I4HA 4CKEA 3I3CA 5ELOA 5C6AA 4Y7NB 1NJIC 4OX9Q 4JI5L 3M4OB 1ILQA 5IWAQ 2R7ZH 3G71A 3FPUB 2JP1A 5DNFA 4ZUIA 2WB1B 3CMEA 5IYBH 4DUYQ 5C5LA 2AQ3B 1JB3A 3NP8A 4KHVA 1KRTA 4BY7B 1ZYRC 3PIO3 5TSSA 3C3LA 2Z4HA 2FMMA 5IGFA 1Q7YC 5JJLA 4I7AA 3AQQA 2FFKB 1SNCA 2VQEL 4HEDA 2EYFA 1U4RA 5C0XG 4A3GH 5FO9B 3RLFA 5M3FG 4IFDJ 3HOWG 3TZUA 3DWPA 3MXPA 3OMCA 2IWHA 5HY6A 1JCKB 5FO7B 3CMAA 3M3YH 3A0JA 2F0WA 1G291 2HD3A 1A3UA 2DJGC 2BCOA 4FF4A 3RLNA 1EY4A 1UE1A 1TWGH 2X6LA 3I4NH 5M3FH 4C3JG 3QJYA 1LO5D 1G91A 4RGNA 3I72A 3KYHC 1TWHB 4MTKA 2QGQA 3GTKB 3S1QB 2ZTCA 3QB3A 5LMNQ 3BZKA 2EXZA 2CQOA 4TVAB 4L8JA 3I55A 2F0HA 1E2VA 1WTRA 1IBML 2ZXPA 5I2YA 4DV3L 2OT2A 3MZ5A 5ELNA 3TREA 2HDMA 1AN8A 2K28A 3BDCA 1VQ6A 4PMBA 1CKNA 2F0JA 4GNXB 1ET9A 1VQLA 1PFMA 1V1QA 1D1IA 2NTSA 3GTMB 2IL8A 4JI3L 3TN2A 3WDNA 4X3SA 1RODA 2KJXA 5M5YH 3S15B 1TT2A 1H9MA 2FHTA 1B53A 3HS0C 1EY9A 2PW5A 1BDOA 3SVMA 3I4NG 1Q3LA 1CSQA 1PH7A 2AQ2B 3FP9A 1W3SA 1FL0A 3GO5A 2F03A 3EJIA 5FKAC 2HUGA 1I6VC 2WB1E 1TS5A 3Q8DA 4N8FA 2PW7A 3ND8A 3MVVA 5IODA 1K0SA 4G7HC 1VQJA 3PUVA 5I9OA 3Q6SA 1PYSB 2E2DC 2QDLA 4A3EG 1STGA 5EBDA 5K36G 2K4KA 1EYDA 3KF6A 4C3IH 4IO9A 1EQQA 1Y14B 3H3VH 4AYBE 2IX3A 1CM9A 2F0TA 1PH5A 1DXMA 2EY2A 3CCQA 1MBYA 2UXCL 4KY6A 4B3RQ 4MHEA 4DR1L 5I2XA 1KDBA 4KN7C 3DEPA 4DKAC 4RA8A 4A3EH 3A8IE 4OEMB 1N36L 1WVLA 5CR3A 1BNZA 3CRKC 5M3FB 1KRSA 2NWGA 1TWHH 3M7NA 2F52A 5D3DA 2CCZA 2UUCL 5C0XJ 4A4IA 2SNMA 3SEBA 1LTRD 5C44G 4A3CH 3CQZH 3E9IA 3DEOA 4JI6Q 4BBRB 4A3IB 3C1FA 3OOCA 2PNRC 4R4TA 4LFBQ 3FKIB 4GZYC 3B6YA 4FXGC 3MFYA 4JBKA 2ID0A 1F77A 4CDDC 1XNRQ 4A3FB 1M1KC 3GTMH 1II3A 5BN5A 4DK6C 3R8BA 3QOLA 5GAEC 1F9PA 1YZ6A 4DR3Q 2EY1A 4YY3L 1GO3E 1PH3A 1BBXC 2KA7A 1UUPA 4MN3A 2E75C 3ULPA 1PTOF 4RFBA 1AE3A 2Q2HA 2Z9HA 1HNXQ 2K03A 1Q1EA 5DLQE 1YJ9A 4GNXC 1K9MC 5FJ8G 4LF8Q 4JBMA 3T53B 4C3JH 2JA8H 2EXDA 5DM63 1E1TA 2L15A 1D5XC 3J80i 2YTVA 4DK3C 4DK0A 2N78A 2Z8LA 4NMZA 2IPKD 3PV0A 3I4MH 2A68D 2HIXA 3M9BA 2OCEA 3A55A 4ZLTF 4G7ZC 5KEEA 4POFA 5J39A 5CC4A 2VB2X 2UXCQ 2NBFA 2Q2TA 1L1OB 1TY2A 2D62A 4QL5A 4QIWE 1HA5A 4B3MQ 4QY7A 2JXMB 3F2DA 3KLSA 4JC0A 2RKSA 1XXGA 4DV3Q 3W2DA 1SYCA 1VQGA 2CW0C 1YHQA 4FF2A 1SNQA 1RJTA 2F0FA 2PQEA 3U4ZA 4EX5A 4PMWA 1ZYRD 1A63A 2WV6D 4R4QA 3PIOA 3ULLA 2NZ1D 1RD9D 4ME3A 1DGSA 5KGUA 2I5LX 1ESRA 3DLLA 4A3JB 3LWEA 1CZGA 3I91A 4PZ8A 4QGUA 1EYGA 1TR5A 3EFXD 1UEAB 4A3BB 1A2TA 1S5BD 1DJRD 3ND9A 3GTKH 3S1QH 2F0NA 1YNXA 3I4OA 4A3CG 3NE5B 5C44H 4K0KL 5FLXE 4L5RC 2WKCA 1HTLD 4R1JA 4B3SL 1XYIA 3CKIB 4R8IA 1G2SA 4WJWA 2CH4W 5AJ3L 4DV4Q 2K33A 2VXWA 2DNCA 1Y8PB 3TQYA 3GTJB 2XNAC 1CA5A 4UP9A 1DYQA 3S1RB 1Q90A 1X32A 3OHXC 2Q2IA 1VQHA 2V1CC 3GTGB 3BYYB 4DF7A 1WI5A 3OTOQ 3BG3A 1YVCA 1IW7D 4DV2Q 2RQXA 1VQ7A 5A2QE 1XPUA 2JA8B 5COYA 5JEAG 4LF7Q 4QUFA 5KNDA 3VR2A 1HNZQ 1BBUA 1U4PA 2B2VA 1PA6A 2B8FA 2JEBI 3A7LA 2E74C 1PTOH 4V190 2F0QA 1L2FA 5KNBA 4IQZA 2A6HD 3GTOH 2QDBA 2LY7A 3HOYH 4KHZA 4IN3A 2VY3A 3MA2B 3SK5A 5EPJA 3E0EA 1Y1VB 2R7DA 4DV7Q 1B9NA 4WFN3 3K5OA 3BVGA 4K2LA 2KBNA 3IFDA 1I94Q 1C4QA 4GN3B 1VQCA 2GVAA 5M5WH 2R7FA 3MXNB 1WTXA 1UE6A 4H0LC 4RAUC 1MSHA 3AFQA 2YTYA 1LV9A 5BN4A 2WB1G 2JA5B 2KCCA 5CGKA 1EQRA 3VYTA 1HHVA 2B2WC 2D2CC 1SMYD 4KKSA 3QOJA 3H15A 1ENFA 3TP8A 4A3EB 4GN4B 4A93G 3E0JA 4K5VA 3J81E 1WTVA 2B2TC 4DV2L 4A3KB 4BS9A 2YTXA 2HIVA 4KY7A 4IPHA 4OWTB 1Y1VG 4XIGS 3I90A 1DZ1A 5ELFA 4B3SQ
chains in the Genus database with same CATH topology
5G3LD 3W3AA 4J8QA 5C44B 1BCPF 5AFWA 4LAAA 3IL8A 2RA4A 2WP8J 4KTAA 3KK7A 2L55A 4B08A 1MI2A 2DY8A 4FF1A 1HXYD 3VR6A 4RGTA 5IGGA 1QCBD 5CV7A 4NDXA 4M1UB 2RVLA 3K57A 5KYLA 1PMRA 1OXUA 1PZKD 1Q8IA 4DAVA 1PTOB 1SNDA 4C3JB 2IW3A 2HQEA 2R61A 3SK4A 3T51B 2RSOA 4HCSA 1STYA 4KKUA 2D9UA 4KJNA 3BVZA 1KDCA 2YU9B 1PTOD 4DXFA 4ILWA 2ENBA 5D65A 2AQ1B 3AU7A 5EPKA 1SEBD 2EOTA 1F2YA 1RTNA 4DGZA 3HOXB 3OPOA 1SYGA 1QILA 3IKJA 1VCIA 2EYLA 2R7ZB 3K5LA 3K58A 4I7ZC 2Y0SB 1IW7C 4EGVA 1TVXA 3U9OA 1GUWA 2SDFA 4UAIA 1Y69U 5EKIA 4K5WA 4IURA 4C1NI 4ZAIA 3D6WA 3I70A 5IGCA 1QE6A 4A3GB 2RDGA 1F9QA 2KOLA 3G7LA 5LL6X 2EJGC 2Q8TA 2NVTB 2NN6G 4ZYSA 5CBAE 1I4QA 3M4YA 1JORA 1AEXA 4OIKA 2A5HA 1L0XB 4IUNA 4RWSC 4ULLA 1B9MA 1TQOA 4FNFA 3GTOB 2K1BA 2IX1A 3DWQA 1FR3A 1EY6A 1KDAA 5A35A 2WIIB 2Z4IA 1OO9B 3MXNA 3RD4A 2B2UA 5EGTA 1Z7TA 3TBIB 1KLGD 2M00A 4J1MA 1GHJA 3VR5A 2DNEA 3I8ZA 3R3OA 4DN4M 1R4PB 3U9SA 4Q0FA 4DAYA 4A3DB 1EWCA 1EYAA 3LWUA 1TS4A 1QNKA 2F1MA 3T16A 2HDLA 1OXTA 5C4XB 4ZKBB 1H9JA 1AZPA 5T1IA 1PFNA 2A73B 1H9RA 1RDPD 3J7AF 2XWBB 1VDZA 3PUZA 1GHKA 1WTOA 1DCZA 3MXUA 1LTGD 2NB0A 2QILA 3E5SA 1LTBD 4R8NA 2PCFB 1DM0B 4L6TB 2K6AA 1EQTA 4H44C 1CA6A 3GTLB 2A69C 4NP5A 2MPMA 2WINB 1SYEA 3PO3B 1HPCA 2LMCB 1SBBB 3MFGA 4WORA 3MEHA 1WD1A 1CFMA 4CJ1B 5KIXA 2KEEA 1V43A 5CV5A 2CQAA 4O42A 5IIFA 2B2VC 2PZUA 3VR3A 1IKMA 4H7BA 1GJXA 3BS1A 3GD7A 2PPBC 4U68A 2NVYB 1AP0A 1O78A 1PDQA 3NTIA 1KABA 3NXWA 2MHVA 1RKNA 5FO8B 4G4KA 4Z9CB 4BA1I 3P20A 2B2YA 2XSCA 4IUVA 2E2JB 1ONLA 3HOYB 2KUMA 2NTTA 3H3VC 3T4AC 1I3QB 1B1ZA 2PYKA 1LLRD 1ML0D 1QG7A 3EA6A 3T56B 2L12A 5NUCA 5J22A 4HTHA 2EY6A 5IGBA 4RHRA 1CK1A 5DEHA 4PMCA 1YNNC 3J7YW 2NUCA 4BY1B 1STEA 3Q24A 2JYOA 4QUCA 4C3IB 2JEAI 1RTOA 1O7ZA 1BCPB 1S5CD 2I07B 1A3TA 3NWSA 1J9OA 3ZYYX 3TP7A 1DONA 2EYMA 2IX0A 1H9SB 2L9HA 1X3QA 2TSSA 4FVMA 3RZDB 4QIWB 5K36H 1CHQD 1SE2A 3KLSX 2B39A 4HSPA 4ZK9B 1KTKA 2D5DA 1TS3A 5E3FA 4XQJA 2LS01 1NR2A 2AUJD 3D6CA 1YNND 3TP6A 2ICEC 4ZQ3A 4KKTA 3KBXA 4BA2I 1QJOA 2SEBD 5IT9E 5M5XB 3VYUA 2XRSD 1F9SA 4BBSB 1UNSA 2H4OA 3VYRA 4XQNA 1CZWA 3VA5A 1I6HB 3N6RA 1M4VA 4CJ0B 1QNUA 3IFTA 1VF5C 3PO2B 4EQPA 3N52A 1Y8NB 1EIGA 4V0BA 4DU9A 2OEOA 1AW7A 1ZEQX 1DOLA 1NCVA 2PO4A 5CV6A 3V05A 1DD2A 2KECA 4BWGB 3UI2A 2I46A 1ZXTA 2NVQB 4RCNA 3LX0A 1IYVA 3CHBD 3A8JE 3EROA 2NN6I 2RDFA 2PZWA 5D3IB 1ENAA 1CQFA 3I4LA 2BE5D 4C2MB 1V1PA 3H09A 5C0XH 3HOWB 3SHLA 1R4QB 2X6GA 5JVH3 2BOSA 3TSSA 1E2WA 1IKLA 4KK7A 1T5EA 1F2LA 2JA7B 3D4RA 4KD4A 4ABNA 2K5WA 1GUGA 4J6HA 2RBMA 3KLRA 3D4DA 1EL0A 3AB9A 4XT1B 3F2UA 1W6KA 4ME5A 1CT1D 3BDOA 5F2DA 3HRZC 1FNUA 5LHY1 3J80L 2EYHA 3Q22A 3OWEB 5A2QL 2X69A 1Q12A 1SAPA 1JWMD 2Q8IB 4CBVA 1TS2A 3BYTB 1KNEA 4FF3A 3HZXA 1S5DD 1FYCA 4QCLA 2RDHA 4IALA 4DNTB 3MXGA 5CYUA 3GTQB 3VA7A 1BUVT 1D5ZC 5ELCA 1GOZA 2F0LA 5CV9A 5CBEE 4LMQD 4K6DA 2EJFC 2ZT9C 3DHQA 4K6LA 4FXKC 2C5CA 1ILPA 2ICIA 4FYDA 2BE5C 5LL6S 2BDNA 1PRTC 4R9WA 2EVBA 2R3ZA 2YYZA 1CHPD 3KUPA 3X3NA 1A3VA 3NHHA 3D4WA 2KVMA 1SJED 4DAPA 1BOSA 4RKBA 5DAUA 2K32A 4PV1C 5ELEA 4DK1A 1WD0A 1I4XA 2B8GA 2F0IA 3OMGA 2EY5A 3HP3A 1MD2D 4NKLA 1MGSA 3GQBA 2AUKA 5JAVA 1M8AA 1G8ZD 3D8GA 2KEDA 4I65A 1B50A 2R93B 2Z1CA 2K04A 1QB5D 1EOTA 4OIJA 2M2LA 4Q5VA 5ELBA 1BO0A 3SR1A 5C3EB 5C3XA 1L0YB 3FEWX 3HKZB 1EIHA 3EQLC 2HCCA 1AFPA 5BN3A 5JOBA 2VB3X 1QOHA 1I4PA 3H91A 3SXHA 2AWOA 4KY5A 4X3UA 3CU7A 5IGDA 5E1FA 2F0OA 2FINB 1B4OA 3P1HA 1O80A 3NTHA 3K6OA 3K5MA 3RZOB 3NUCA 1SNPA 5JJZA 1K83B 2NYZD 3PUYA 1FGBD 4XTCS 2XRQD 2F0EA 2LFNA 3M7GA 4A93B 3WOFA 3NQTA 1G6ZA 3NPPA 1IL8A 2SNSA 4WRDA 5HGTA 3TDQA 2QF7A 1EZ6A 1I4RA 2K7VA 1IHZA 2BDOA 2EPBA 4RGOS 3VR4A 3SK8A 1EYCA 3LNNA 1D6EC 5EKLA 2L0CA 5ELDA 3S17B 1JWUD 2B63B 1Y8OB 3KBGA 2A6EC 3M3YB 3I4MB 1D5MC 1PYWD 3FRPB 5EBCA 2L4NA 4K8JA 3HG9A 1FNWA 1T5XD 3H94A 1HCZA 2QEJC 3O13A 4IFDH 1V1PB 1KNAA 4JK1C 3JAML 3J80E 3HOZB 5T1GA 3HGBA 3X3MA 3J81L 1A15A 3GP7A 4IUTA 5EPLA 5M5YB 3RMHA 1S5FD 3DWAA 5D14A 5CORA 2A69D 3S2DB 2V4DA 2ZXOA 3ERQA 4IZ8A 3R93A 5DM73 3CRLC 4QB4A 5FK9C 4DFAA 4CHTB 1JE4A 5IGEA 4C3HB 4B9WA 4M8AA 1F9RA 1OXVA 2NVXB 4IFDG 4K8IA 2Q8RE 1GXDC 4LJZC 3PIP3 1DOMA 4RKLA 4DA2A 3S16B 3BVMA 1U4LA 5EKKA 5KYIA 2MUYA 3MHBA 1CI3M 3S9WA 4C1NK 1CTMA 5E4WC 2F0KA 4FP5D 2F0GA 2A6ED 4ID6A 4QMGA 4TRDA 4C3HG 3SDZA 2BA0A 3L3OC 4TKOB 5JPMC 1UAPA 2MGSA 2F3VA 1Z6HA 1H9SA 1WTWA 1EU4A 2CHBD 1ENCA 3C2PA 1A6XA 1Y1WB 4CKCA 4TQUS 3URYA 3OIPA 5CV8A 1F2MA 1QWYA 4CJ2C 3A8KE 1JQYD 2QCPX 5M3MB 2A74C 5FOBB 1SE4A 1STBA 1ZKOA 3D3RA 5I6YA 3H0GB 4RGMA 4ZRZA 1TWFB 3GTPB 2OXPA 4MIUA 2BA1A 2O5IC 1TIID 3ITPA 4F87A 3S2HB 4EQOA 4PQXA 3V96A 1SE3A 2A68C 2O4XA 4ODGA 1SNMA 3OW7A 3P75A 2KCNA 2CW0D 3FPPA 1E2ZA 3MWYW 3M85A 2B2WA 1WTQA 3HOVB 1PRTD 1BR9A 3K7AB 1J8IA 3MAQA 1V1OA 5HURA 1HQMC 1EY8A 1GUOA 4HCEA 4RH6A 4JBWA 1JR0D 2B2UC 1EQVA 5IT9L 3NK9A 2XIWA 4XYOA 1YNJD 1EFID 2WAQB 1XWEA 1RCVD 5C0XI 4X3KA 1LACA 2EJMA 2FJ2A 1VMPA 1EEID 1VMCA 5J1ZA 1TU2B 2HCIA 1C8CA 3Q23A 2G9HD 3FMCA 1OXSC 1EU3A 3OWFA 2E2IB 5IOCA 2DY7A 1CQVA 1LT6D 1NR4A 1S5ED 2F0UA 3H6MA 3NBIA 3RUZA 2B2TA 2K5QA 1ESFA 2EDGA 3R2IA 4F7XA 2J7ZA 2EYPA 1PRTF 5JPNC 2XWJB 4HMIA 3TMEA 1HTPA 1B2TA 1FNVA 3S1NB 5FLXL 4K2KA 2G9DA 1HQRD 1SFOB 2SOBA 1LTAD 1D2BA 4G7OC 1O7YA 4H13C 3C46A 4OO1H 1RHPA 3EVQA 4KN4C 1BXTA 3NSWA 1TWGB 1BCPD 1WTPA 4DNRB 2ZXRA 1S4ZA 1JWSD 2F0SA 4O1NA 1LTTD 4OGQC 2KHSA 2QKIC 2R6GA 4OL7A 1HRJA 1AZQA 2L5TA 2C9OA 1ICWA 1I4GA 1XX8A 1TWCB 5EQ0A 2TMPA 2B2YC 1EEFD 4L63B 1YNJC 3Q0AA 1W6JA 2K5DA 3C1EA 4KD3A 1BQQT 4IFDI 4K5XA 4B9XA 3NBHA 2F0DA 1RF2D 3P7JA 5JEAJ 3NWTA 4IUUA 1FD7D 3L9AX 1E0BA 1EWHA 1SSOA 1LABA 3NQIA 5EJWA 5G3LF 1DOKA 1JOKA 1LTSD 4ZKCB 2MP1A 1EY5A 2GA4B 1V8QA 5C4ZA 4FO2A 2L1BA 3DM1A 3E6ZX 4RCOA 5C4JB 1B3AA 4XXEA 5K5PA 1SYDA 2F0PA 5KNCA 2E76C 3OSOA 4C56C 1XTCD 2KQ3A 3NTKA 3MTSA 1LT4D 2R92B 1K8OA 3GV3A 2O5JC 3FDTA 1TWAB 3R2TA 4CKBA 4U673 4TSSA 2JE6I 4LK1C 4S3SA 1O7LA 2H1EA 2XVSA 1SDFA 4N9TA 4HMJA 1LTID 1A2UA 4A3MB 1ET6A 2J4XA 2M9VA 2MJ8A 2O2LD 1HUMA 1NSNS 2NN6H 3OIQA 3HOUB 1C48A 1IYUA 3GV6A 1SJHD 1SYFA 3QG1A 2RSNA 4F8MA 1PRTB 5JEAH 2WACA 4HN7A 1EZ8A 3CQZB 3FVQA 1GUNA 3TZDA 2VUMB 3ONAB 3DMUA 2CVRA 1PZID 3S1MB 3WOEA 4YIJA 1PTOC 4XYQA 4XQQA 3J7AV 2PZTA 4ZUJA 3SK6A 4KV6A 4F88A 4KJOA 1U9RA 2EYJA 2F0MA 3QIAA 3PUWA 4QF4A 1EY0A 1SXTA 4N9PA 1HFGA 1PXUA 2JSOA 4K14A 1F2ZA 1PLFA 1U4MA 5C4HA 1KAAA 2N55A 3BDLA 3A56A 3PMFA 2DN8A 3KF8A 2EE1A 5C5MA 2IJ0A 3IAYA 1JOQA 4HAEA 2L11A 2WKDA 3AMUA 2E2HB 4HSVA 5M9OA 4C3IG 1EY7A 4KMUC 1JICA 1HFNA 1HUNA 1HA6A 1STHA 1H9KA 1D1KA 1LT5D 3DXJC 4FXDA 1BCPC 4CGYB 3QO2A 3K0YA 1TY0A 1SNOA 4PNYA 2EZVA 1GUSA 2XN9C 3JAME 4OHJA 1NUCA 2N88A 1SMYC 3K59A 3T13A 5E4XA 1STAA 1PZJD 3BZDB 4X3TA 3VYSA 3SE0A 1KLUD 1GUTA 1MSGA 2PMZB 1R9TB 3MC0B 3A54A 4XT3B 1K8MA 1STNA 3G6JB 2FMCA 4EVOA 2A6HC 4DXGA 2OF1A 3DUZA 1Q1BA 1NAPA 1B44D 1TKWB 4OO1G 3TP5A 3I73A 4NW2A 3A7AB 3V2TA 1JC7A 3HEJA 1G2TA 1LT3D 2LKVA 3QWNA 2F3WA 4AYBB 2J0TD 2K05A 5KRUA 1PFBA 1WCMB 3K5NA 1OXXK 4RHSA 4E6IA 4HR7B 3I4NB 5M5WB 4EQNA 5I6WA 4P2CB 1I50B 1Z47A 3D31A 5CMDA 2F0VA 1SYBA 4G57A 4KI0A 4UDUC 4XDXA 5I9PA 5C3WA 4OO1I 1JOOA 2F4IA 5I4DA 2IT1A 1BF4A 2AWNA 5CV4A 4IUPA 2JA6B 2K01A 1VF7A 2VNUD 3PUXA 5ISRA 2EYOA 3L7ZC 1X3PA 4IUQA 5JVG3 3S14B 1I4HA 4CKEA 3I3CA 5C6AA 4Y7NB 3M4OB 1ILQA 3FPUB 2JP1A 5DNFA 4ZUIA 2WB1B 5C5LA 2AQ3B 1JB3A 3NP8A 4KHVA 4BY7B 1ZYRC 3PIO3 5TSSA 3C3LA 2Z4HA 2FMMA 5IGFA 2FFKB 1SNCA 4HEDA 2EYFA 1U4RA 5C0XG 5FO9B 3RLFA 4IFDJ 3TZUA 3DWPA 3MXPA 3OMCA 2IWHA 1JCKB 5FO7B 2F0WA 1G291 1A3UA 2BCOA 4FF4A 1EY4A 2X6LA 4C3JG 3QJYA 1LO5D 1G91A 4RGNA 3I72A 1TWHB 3GTKB 3S1QB 3QB3A 2EXZA 4L8JA 2F0HA 1E2VA 1WTRA 2ZXPA 5I2YA 2OT2A 3MZ5A 2HDMA 1AN8A 2K28A 3BDCA 4PMBA 2F0JA 1ET9A 1PFMA 1D1IA 2NTSA 3GTMB 2IL8A 3WDNA 3TN2A 3S15B 4X3SA 1RODA 2KJXA 1TT2A 1H9MA 2FHTA 1B53A 3HS0C 1EY9A 2PW5A 1BDOA 3SVMA 1Q3LA 2AQ2B 3GO5A 2F03A 3EJIA 5FKAC 2HUGA 1I6VC 1TS5A 2PW7A 3ND8A 3MVVA 5IODA 4G7HC 3PUVA 5I9OA 3Q6SA 2E2DC 5K36G 1STGA 5EBDA 1EYDA 2IX3A 1CM9A 2F0TA 1DXMA 2EY2A 1MBYA 4KY6A 4MHEA 5I2XA 1KDBA 4KN7C 3DEPA 4RA8A 3A8IE 1WVLA 5CR3A 1BNZA 3CRKC 5M3FB 2NWGA 3M7NA 5D3DA 5C0XJ 2SNMA 3SEBA 1LTRD 3DEOA 4BBRB 4A3IB 3C1FA 3OOCA 2PNRC 3FKIB 4GZYC 4FXGC 3MFYA 2ID0A 1F77A 4A3FB 1II3A 5BN5A 3R8BA 3QOLA 1F9PA 2EY1A 1BBXC 2KA7A 1UUPA 4MN3A 2E75C 1PTOF 4RFBA 2K03A 1Q1EA 3T53B 5DM63 1D5XC 4DK0A 2Z8LA 4NMZA 2IPKD 3PV0A 2A68D 3A55A 4ZLTF 4G7ZC 5KEEA 5J39A 5CC4A 2VB2X 2NBFA 1TY2A 2D62A 1HA5A 2JXMB 3KLSA 2RKSA 1XXGA 3W2DA 1SYCA 2CW0C 4FF2A 1SNQA 1RJTA 2F0FA 2PQEA 4PMWA 1ZYRD 2WV6D 2NZ1D 1RD9D 5KGUA 1ESRA 4A3JB 3LWEA 1CZGA 3I91A 1TR5A 3EFXD 1UEAB 4A3BB 1A2TA 1S5BD 1DJRD 3ND9A 2F0NA 3NE5B 5FLXE 2WKCA 1HTLD 1XYIA 3CKIB 4R8IA 1G2SA 4WJWA 2K33A 2VXWA 2DNCA 1Y8PB 3GTJB 2XNAC 1CA5A 1DYQA 3S1RB 1Q90A 1X32A 3OHXC 3GTGB 3BYYB 4DF7A 3BG3A 1IW7D 2RQXA 5A2QE 2JA8B 5COYA 5JEAG 4QUFA 5KNDA 3VR2A 1U4PA 2B2VA 2B8FA 2JEBI 3A7LA 2E74C 4V190 1PTOH 2F0QA 5KNBA 4IQZA 2A6HD 2QDBA 2LY7A 4KHZA 4IN3A 3MA2B 3SK5A 5EPJA 1Y1VB 1B9NA 4WFN3 3K5OA 3BVGA 4K2LA 3IFDA 1C4QA 1WTXA 4H0LC 4RAUC 1MSHA 5BN4A 1LV9A 2JA5B 2KCCA 5CGKA 3VYTA 1HHVA 2B2WC 2D2CC 1SMYD 4KKSA 3QOJA 1ENFA 3TP8A 4A3EB 3E0JA 4K5VA 3J81E 1WTVA 2B2TC 4A3KB 4BS9A 4KY7A 4XIGS 3I90A 1DZ1A 5ELFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR C;  1V8Q A;  4KN7 C;  3W3A A;  4JK1 C;  2EDG A;  1Y8N B;  2BA1 A;  2O5I C;  3T56 B;  1H9R A;  2AWO A;  1DD2 A;  1K8M A;  1HTP A;  1VDZ A;  3A8I E;  3HGB A;  5C0X G;  2A6H C;  3PUZ A;  3CRK C;  1GHK A;  3RLF A;  1DCZ A;  2EJG C;  1Q1B A;  3MXU A;  3TZU A;  3ND9 A;  1TKW B;  3QIA A;  4OO1 G;  4RCN A;  2NN6 G;  3PUW A;  3NE5 B;  2EJF C;  2ZT9 C;  1YNN C;  2A68 C;  2PCF B;  3I73 A;  3VR6 A;  3M7N A;  1IYV A;  3A7A B;  3A8J E;  4G7O C;  4H13 C;  2NN6 I;  1G29 1;  3OW7 A;  5KNC A;  3M4Y A;  2BE5 C;  2A69 D;  4H44 C;  4OO1 H;  2V4D A;  3I4L A;  3FPP A;  2A69 C;  1PMR A;  2BE5 D;  3OOC A;  3PUY A;  2K33 A;  4KN4 C;  1E2Z A;  1OXU A;  2DNC A;  2E76 C;  2PNR C;  3QJY A;  5C0X H;  3M85 A;  1Y8P B;  3I72 A;  4XTC S;  1OXX K;  2EVB A;  3CRL C;  2JEA I;  4GZY C;  2YYZ A;  1B9M A;  4DNR B;  3MFY A;  1Q90 A;  1K8O A;  1HPC A;  2LMC B;  2O5J C;  1E2W A;  2DN8 A;  3BG3 A;  4HR7 B;  4L8J A;  1E2V A;  1IW7 D;  5BN5 A;  1HQM C;  1OXV A;  1FR3 A;  4IFD G;  1GUO A;  1T5E A;  3T51 B;  4JBW A;  4LJZ C;  4OGQ C;  2JE6 I;  1H9S B;  1CFM A;  2KA7 A;  2R6G A;  3D4R A;  4LK1 C;  5A35 A;  4KKU A;  2QF7 A;  5JEA G;  5KND A;  3VR2 A;  1GUG A;  1O7L A;  1V43 A;  2L5T A;  2E75 C;  2K32 A;  2B8F A;  2JEB I;  2K7V A;  3A7L A;  2E74 C;  4PV1 C;  2BDO A;  4DK1 A;  2B8G A;  4KMU C;  3D31 A;  3WDN A;  3KLR A;  5KNB A;  1Q1E A;  4KI0 A;  4IQZ A;  1CI3 M;  2A6H D;  5K36 H;  3VR4 A;  1CTM A;  1H9M A;  3AB9 A;  3VR3 A;  3LNN A;  3GQB A;  1Z7T A;  2AUK A;  4KHZ A;  1BDO A;  3T53 B;  1GJX A;  3BDO A;  1H9K A;  2A6E D;  2D5D A;  1YNJ C;  1GHJ A;  3DXJ C;  1B9N A;  1LAC A;  3GD7 A;  4DK0 A;  2PPB C;  2EJM A;  3VR5 A;  3PV0 A;  3SDZ A;  2AUJ D;  2IT1 A;  2A68 D;  1I6V C;  2BA0 A;  2DNE A;  4G7Z C;  1O78 A;  1TU2 B;  4TKO B;  2NN6 H;  4KKT A;  4BA2 I;  1QJO A;  1VF7 A;  4H0L C;  3OPO A;  3ND8 A;  3PUX A;  1IYU A;  3IKJ A;  3L7Z C;  5BN4 A;  1VCI A;  1Y8O B;  3FMC A;  2A6E C;  2KCC A;  1GUS A;  1Z6H A;  4G7H C;  1H9S A;  1Q12 A;  3U9S A;  1OXS C;  2D2C C;  2D62 A;  3PUV A;  4KKS A;  3EQL C;  1A6X A;  2Q8I B;  5K36 G;  3QG1 A;  3P20 A;  4BA1 I;  2JXM B;  1SMY C;  4I7Z C;  5BN3 A;  3LWU A;  1EWH A;  1IW7 C;  1FYC A;  4TQU S;  1ONL A;  1LAB A;  4DNT B;  2CW0 C;  3N6R A;  5JEA H;  2F1M A;  1DXM A;  3A8K E;  1HCZ A;  3H94 A;  3VA7 A;  1OXT A;  3SE0 A;  3IFT A;  1Y69 U;  1GUT A;  1GUN A;  4XIG S;  1VF5 C;  4IFD H;  1ZKO A;  1H9J A; 
#chains in the Genus database with same CATH topology
 3UDI A;  2UU9 L;  5G3L D;  1KIX A;  3W3A A;  4J8Q A;  5C44 B;  3PO2 H;  1BCP F;  5AFW A;  2AMC B;  3BZC A;  4LAA A;  3IL8 A;  2RA4 A;  2WP8 J;  4KTA A;  3KK7 A;  3L2P A;  2L55 A;  4MNO A;  4B08 A;  1MI2 A;  3CW2 C;  2DY8 A;  1J5E Q;  4FF1 A;  1VQN A;  1HXY D;  3VR6 A;  4LF5 L;  4RGT A;  5IGG A;  1QCB D;  5CV7 A;  4NDX A;  4M1U B;  1X3G A;  2RVL A;  3K57 A;  5KYL A;  1PMR A;  4A3M G;  3BJU A;  1Q46 A;  1K3B C;  4NB3 A;  1OXU A;  1PH1 A;  2Q2U A;  3UDF A;  2CWA A;  1PZK D;  5C4X G;  4B3T L;  1Q8I A;  4DAV A;  1PTO B;  3KDF B;  1SND A;  4C3J B;  4JOI A;  2IW3 A;  2HQE A;  4H02 A;  2R61 A;  3SK4 A;  2PI2 A;  3T51 B;  2RSO A;  4HCS A;  1STY A;  2OWO A;  4KKU A;  2D9U A;  4KJN A;  1JB7 A;  3BVZ A;  1KDC A;  1B70 B;  3M4Q A;  3ULJ A;  3OW2 A;  1KQS A;  2YU9 B;  1PTO D;  4DXF A;  1X65 A;  1K0R A;  4ILW A;  2ENB A;  5D65 A;  2AQ1 B;  3TS0 A;  3AU7 A;  5EPK A;  3CCV A;  1SEB D;  2EOT A;  1F2Y A;  2QEX A;  1RTN A;  4DGZ A;  3U50 C;  3HOX B;  5M3M G;  3OPO A;  4QQB X;  1SYG A;  1QIL A;  3IKJ A;  1VCI A;  2G5D A;  2EYL A;  4DAM A;  2R7Z B;  4KHP Q;  3K5L A;  3NEN A;  3K58 A;  4I7Z C;  2Y0S B;  2R92 G;  1K3R A;  1IW7 C;  4EGV A;  1TVX A;  1TXY A;  3U9O A;  1GUW A;  4DAY B;  2SDF A;  4UAI A;  1X3E A;  3T1Y Q;  1Y69 U;  1L1O A;  5EKI A;  3FHW A;  1V9P A;  4K5W A;  2E2H H;  1IBK L;  4IUR A;  1IZ6 A;  4ZAI A;  4C1N I;  4NXN L;  1VQD A;  1QVF A;  2Y0S E;  3D6W A;  3I70 A;  4OWX B;  5IGC A;  1QE6 A;  4A3G B;  4HIM A;  2RDG A;  2B63 G;  1F9Q A;  2KOL A;  3G7L A;  5LL6 X;  2EJG C;  3KJP A;  2Q8T A;  2Z0S A;  3S1R H;  2NVT B;  3WWV A;  2NN6 G;  4ZYS A;  1JE5 A;  5CBA E;  4JI2 L;  1I4Q A;  4B3R L;  3M4Y A;  1SR3 A;  1JOR A;  1AEX A;  4GOP C;  4OIK A;  2A5H A;  4P75 A;  1L0X B;  4IUN A;  1RL2 A;  4RWS C;  4ULL A;  1B9M A;  1TQO A;  4X66 Q;  4FNF A;  1QUQ A;  3GTO B;  2K1B A;  1XPO A;  2IX1 A;  3DWQ A;  5GAG C;  1FR3 A;  1EY6 A;  1KDA A;  1BVS A;  5A35 A;  4RG1 A;  1GKH A;  2WII B;  1KC8 C;  2Z4I A;  5LMU L;  1OO9 B;  3MXN A;  3TS2 A;  3RD4 A;  1J5E L;  2B2U A;  5EGT A;  1Z7T A;  3TBI B;  4UP7 A;  1KLG D;  2B3G A;  2M00 A;  4J1M A;  1GHJ A;  3VR5 A;  3STB C;  4A3K H;  3DM3 A;  2DNE A;  5H1S E;  1GD7 A;  1S40 A;  3I8Z A;  1HZA A;  3KOJ A;  3RLO A;  3R3O A;  2VQF L;  1VQE A;  4DN4 M;  1R4P B;  3U9S A;  4DV0 L;  4Q0F A;  4DAY A;  4A3D B;  1EWC A;  1EYA A;  3LWU A;  1YIT A;  1XMO L;  1HR0 W;  4JI1 Q;  1TS4 A;  5IP9 H;  1IBM Q;  1QNK A;  2ALY B;  2F1M A;  3T16 A;  2HDL A;  1OXT A;  5C4X B;  1B7Y B;  4JI8 Q;  4ZKB B;  3I2Z A;  2PQA B;  1H9J A;  3S24 A;  1AZP A;  5T1I A;  2R7Z G;  4R4C A;  3GDE A;  1PFN A;  5C4J H;  4BBS H;  2A73 B;  1H9R A;  1RDP D;  1PH9 A;  1T9H A;  3J7A F;  5JJI A;  2XWB B;  1VDZ A;  4DR7 Q;  3PUZ A;  1GHK A;  1WTO A;  1DCZ A;  2VZA A;  1X55 A;  1LTG D;  3MXU A;  4DR2 L;  2MO1 A;  2NB0 A;  2QIL A;  3E5S A;  4LFC Q;  1LTB D;  4R8N A;  2PCF B;  4JPB W;  1HNW L;  3JAM i;  1DM0 B;  1Z9F A;  4L6T B;  2K6A A;  1EQT A;  4H44 C;  1CA6 A;  1A62 A;  5BR8 L;  3GTL B;  2A69 C;  3FKI H;  4NP5 A;  2MPM A;  2WIN B;  1SYE A;  3PO3 B;  3OTO L;  1KHI A;  4A3J H;  1XMO Q;  3CF5 A;  4DUY L;  1HPC A;  3PIP A;  2PMZ E;  2LMC B;  2YU9 H;  4JI0 L;  1SBB B;  3MFG A;  4WOR A;  3MEH A;  1WD1 A;  3AEV A;  1CFM A;  3LGJ A;  4HIO A;  4CJ1 B;  5KIX A;  2KEE A;  1V43 A;  5CV5 A;  4A3D H;  2CQA A;  3HOU G;  2VQF Q;  3EIV A;  4GS3 A;  4O42 A;  5IIF A;  1WCM G;  1TWF H;  1NMF A;  2B2V C;  2PZU A;  3VR3 A;  1IKM A;  2ZTE A;  4H7B A;  1GJX A;  3PF5 A;  5J3B A;  3BS1 A;  2JA5 G;  3GD7 A;  2PPB C;  4U68 A;  1IBL Q;  2KCM A;  2NVY B;  1AP0 A;  1O78 A;  1PDQ A;  3NTI A;  1KAB A;  4LFA Q;  3NXW A;  2MHV A;  1RKN A;  4X62 L;  4JI8 L;  2ZJP A;  2JA8 G;  4LFB L;  2IHE A;  5FO8 B;  1WYD A;  4HID A;  2B63 H;  4G4K A;  1NNX A;  3P20 A;  4Z9C B;  4BA1 I;  2B2Y A;  2XSC A;  4IUV A;  3HOV H;  2E2J B;  1ONL A;  3HOY B;  2KUM A;  2NTT A;  3H3V C;  3T4A C;  3KJO A;  1I3Q B;  1Y1V H;  1B1Z A;  3S1M H;  1I50 H;  2PYK A;  1LLR D;  3PSI A;  1ML0 D;  3KFU A;  1QG7 A;  3EA6 A;  4DPG A;  1HNX L;  4YCU A;  3T56 B;  3J7Z C;  4GKJ L;  2L12 A;  5NUC A;  2F4V L;  5IYC H;  4HTH A;  5J22 A;  2EY6 A;  3U4V A;  5IGB A;  4HJ8 A;  1YHB A;  4RHR A;  1CK1 A;  5DEH A;  4PMC A;  3HOZ G;  1YNN C;  3I7F A;  1SRO A;  3J7Y W;  1M90 C;  4LFA L;  2N49 A;  2NUC A;  3PCO B;  4BY1 B;  1EOV A;  3T1Y L;  1I6H H;  1STE A;  3Q24 A;  2JYO A;  4N8X 1;  4QUC A;  4C3I B;  2JEA I;  1RTO A;  1O7Z A;  1BCP B;  1S5C D;  2NVY H;  2I07 B;  5GAD C;  1A3T A;  3NWS A;  1J9O A;  4LF5 Q;  3ZYY X;  5EAY A;  3TP7 A;  1DON A;  2EYM A;  5FLM H;  1L0W A;  4A75 A;  2IX0 A;  1H9S B;  2NVX H;  5FLM G;  2L9H A;  1X3Q A;  1C9O A;  3HOV G;  2TSS A;  4FVM A;  5IT9 c;  4LUZ A;  3RZD B;  2UUC Q;  4QIW B;  5K36 H;  1CHQ D;  1SE2 A;  4X6A H;  1NTG A;  4HSP A;  4O0A A;  3KLS X;  2B39 A;  4ZK9 B;  4LUV A;  1KTK A;  1I5F A;  2D5D A;  1TS3 A;  5E3F A;  4XQJ A;  2LS0 1;  1NR2 A;  4LF4 L;  2AUJ D;  3D6C A;  4PZ6 A;  1YNN D;  4Y52 H;  3TP6 A;  2ICE C;  4A3I H;  4ZQ3 A;  1UE5 A;  2KCT A;  4KKT A;  3KBX A;  4BA2 I;  1QJO A;  4A3B G;  2SEB D;  5IT9 E;  5M5X B;  2D0O A;  4GKK L;  1A8V A;  1X6O A;  4LFC L;  3VYU A;  1JJG A;  4DR2 Q;  2XRS D;  1F9S A;  4HJ9 A;  5LMU Q;  4A3F H;  4BBS B;  1UNS A;  2H4O A;  4WJ4 A;  3VYR A;  4XQN A;  1CZW A;  3PO2 G;  3VA5 A;  1VQ8 A;  1I6H B;  3N6R A;  1M4V A;  4CJ0 B;  2BH2 A;  4K0K Q;  4NXN Q;  1D8L A;  1QNU A;  1R9T H;  3IFT A;  5C3E H;  3S2D H;  1VF5 C;  3PO2 B;  4EQP A;  3KLW A;  3N52 A;  1Y8N B;  1EIG A;  4V0B A;  4DU9 A;  2OEO A;  1AW7 A;  1ZEQ X;  1DOL A;  1NCV A;  2PO4 A;  5CV6 A;  3V05 A;  1K73 C;  1D7Q A;  1DD2 A;  1HZB A;  2KEC A;  5IWA L;  4BWG B;  3UI2 A;  4DUZ L;  2I46 A;  1ZXT A;  2HT1 A;  2NVQ B;  2QW7 A;  4RCN A;  3LX0 A;  4JI3 Q;  4A3I G;  1IYV A;  2B29 A;  3CHB D;  3A8J E;  3ERO A;  2NN6 I;  1L1O C;  1NE3 A;  2RDF A;  1XPR A;  2PZW A;  5D3I B;  1ENA A;  1CQF A;  3I4L A;  2BE5 D;  4C2M B;  3M4P A;  1V1P A;  3H09 A;  5C0X H;  3HOW B;  3SHL A;  1R4Q B;  2X6G A;  4PZ7 A;  5JVH 3;  3HOU H;  4GN5 A;  3BU2 A;  2BOS A;  2D0P A;  3TSS A;  1Q8K A;  1E2W A;  4EQ5 A;  1IKL A;  4KK7 A;  2NVT H;  1T5E A;  1F2L A;  2JA7 B;  3D4R A;  4KD4 A;  4ABN A;  1N32 Q;  2K5W A;  1GUG A;  3NBH B;  3J80 c;  4J6H A;  2RBM A;  3KLR A;  3D4D A;  1ASY A;  1EL0 A;  3AB9 A;  4FDB A;  4XT1 B;  4GLX A;  3F2U A;  1W6K A;  4ME5 A;  1LUZ A;  1CT1 D;  3BDO A;  5F2D A;  5M3M H;  4X65 L;  3RN2 A;  1W2B A;  3HRZ C;  1FNU A;  4BBR H;  5LHY 1;  1CSP A;  2E8G A;  5AJ3 Q;  4LNQ A;  3J80 L;  2EYH A;  3AFP A;  3Q22 A;  4BBR G;  3OWE B;  5A2Q L;  1SN8 A;  2X69 A;  1Q12 A;  3HKS A;  1SAP A;  1JWM D;  2K50 A;  2Q8I B;  3GTG H;  4CBV A;  1TS2 A;  3BYT B;  1KNE A;  4UY8 C;  4BBS G;  2CH4 A;  4FF3 A;  3HZX A;  2VUM G;  1S5D D;  1FYC A;  4QCL A;  3NEM A;  2RDH A;  4IAL A;  3CCU A;  4DNT B;  3MXG A;  5CYU A;  4DV4 L;  3GTQ B;  4C2M H;  3VA7 A;  1BUV T;  2JA6 G;  1ASZ A;  1D5Z C;  1JT8 A;  2OQ0 A;  5ELC A;  1GOZ A;  2F0L A;  2ZTD A;  1AE2 A;  4IJL A;  5CV9 A;  2ZM6 L;  3CAM A;  1BBW A;  5CBE E;  4LMQ D;  1WFQ A;  2I5H A;  4K6D A;  4A3M H;  3CCJ A;  3G48 A;  2EJF C;  2ZT9 C;  4APV A;  3DHQ A;  4K6L A;  3CCL A;  4FXK C;  2C5C A;  3STB D;  4JI4 Q;  1ILP A;  2ICI A;  4FYD A;  2BE5 C;  2JA5 H;  3H3V I;  4DV6 Q;  2VQE Q;  5LL6 S;  1KAW A;  4DV7 L;  3CC2 A;  2BDN A;  1PRT C;  4R9W A;  5FJ8 H;  2EVB A;  2RHS B;  2R3Z A;  2YYZ A;  3EN2 A;  2EIF A;  1CHP D;  4A3D G;  3KUP A;  2CFM A;  3X3N A;  1A3V A;  3NHH A;  3D4W A;  2KVM A;  1SJE D;  4DAP A;  1BOS A;  4RKB A;  5IYB G;  4JI6 L;  2CWP A;  5DAU A;  2A19 A;  2RCF A;  1VQB A;  4NPS A;  2K32 A;  4PV1 C;  5ELE A;  2VUM H;  4DK1 A;  1WD0 A;  4A93 H;  1I4X A;  2B8G A;  3RNU A;  1X54 A;  4DR5 L;  2F0I A;  3OMG A;  2EY5 A;  3HP3 A;  1MD2 D;  4NKL A;  1MGS A;  3GQB A;  2AUK A;  3PO3 H;  5JAV A;  1M8A A;  2UUB L;  1G8Z D;  3D8G A;  2KED A;  4I65 A;  1YEZ A;  1EIF A;  1B50 A;  2R93 B;  3A5U A;  2Z1C A;  2K04 A;  1QB5 D;  1Q81 C;  2PNH A;  1YI2 A;  1EOT A;  4OIJ A;  2M2L A;  1PH4 A;  4Q5V A;  5ELB A;  3UE1 A;  3S16 H;  1BO0 A;  3SR1 A;  2ASB A;  5C3E B;  4BXX H;  5C3X A;  1L0Y B;  3FEW X;  3HKZ B;  4AYB G;  1NY4 A;  1EIH A;  3EQL C;  2JA7 G;  2HCC A;  1AFP A;  5BN3 A;  2BH8 A;  1IBL L;  3ER0 A;  3J81 i;  4IOC A;  4YWM A;  5JOB A;  2R93 G;  1B8A A;  2WFW A;  2VB3 X;  1QOH A;  2XTI A;  1KD1 C;  4JYA Q;  3NEL A;  1I4P A;  3H91 A;  2F4V Q;  3CD6 A;  3SXH A;  2AWO A;  3HKZ G;  1X3F A;  4KY5 A;  4X3U A;  3CU7 A;  5IGD A;  1HJP A;  5E1F A;  2UUB Q;  2F0O A;  2FIN B;  1CKO A;  1B4O A;  4JV5 L;  1VQK A;  3P1H A;  2RHQ B;  1O80 A;  3NTH A;  3K6O A;  1JMC A;  4IOA A;  2E2J H;  4A76 A;  3K5M A;  3RZO B;  3NUC A;  1N36 Q;  1VS0 A;  1YIJ A;  3GTL H;  1SNP A;  5JJZ A;  1K83 B;  2CKZ B;  1EWI A;  4GKJ Q;  2NYZ D;  4YY3 Q;  1S3O A;  3PUY A;  4DV0 Q;  1C0A A;  1FGB D;  1N33 L;  4XTC S;  5E7N A;  4UP8 A;  4CDC C;  3PF4 A;  2XRQ D;  2F0E A;  2LFN A;  3M7G A;  4A93 B;  3WOF A;  3NQT A;  1G6Z A;  3NPP A;  1IL8 A;  3A5Z B;  3KF6 B;  3H0G G;  1N34 Q;  4Y7N H;  4LF9 L;  2SNS A;  4WRD A;  5HGT A;  3TDQ A;  2QF7 A;  1EZ6 A;  2VL6 A;  3CCM A;  1I4R A;  2K7V A;  1IHZ A;  4P73 A;  2BDO A;  2EPB A;  4RGO S;  3VR4 A;  3SK8 A;  1EYC A;  3CPF A;  1VQP A;  3LNN A;  1D6E C;  5EKL A;  3J81 j;  1A0I A;  4LUO A;  2L0C A;  4IPD A;  5IYD H;  3CC7 A;  1QVG A;  5ELD A;  3S17 B;  1HZ9 A;  1JWU D;  2B63 B;  1Y8O B;  3KBG A;  2A6E C;  3M3Y B;  3I4M B;  3HOY G;  3ERS X;  1D5M C;  1PYW D;  1WCM H;  3FRP B;  5EBC A;  2L4N A;  4K8J A;  3HG9 A;  1FNW A;  1T5X D;  4LF9 Q;  1SRU A;  2EQS A;  3H94 A;  1HCZ A;  5C3E G;  4DV6 L;  2DUD A;  2QEJ C;  5L37 A;  1KXL A;  3O13 A;  1XNQ L;  4IFD H;  1V1P B;  4JK1 C;  1KNA A;  3JAM L;  2MFI A;  3J80 E;  2HHH L;  1LTL A;  4IPC A;  5LMN W;  1U0L A;  2PI2 E;  1IL2 A;  3HOZ B;  5T1G A;  3HGB A;  1TWA H;  3X3M A;  2MNA A;  3J81 L;  1A15 A;  3GP7 A;  4IUT A;  3FKI G;  2Y0S G;  4WJ3 M;  4YWL A;  5EPL A;  5M5Y B;  4QJF A;  1QUQ B;  1UE7 A;  4DV1 Q;  4MTN A;  3RMH A;  2OTJ A;  1S5F D;  3CPW A;  3DWA A;  2GVB A;  5D14 A;  4JI7 L;  5COR A;  2A69 D;  3HOX G;  3VDY A;  3L0O A;  3S2D B;  2V4D A;  3S2H H;  2ZXO A;  3ERQ A;  4IZ8 A;  3R93 A;  5DM7 3;  3CRL C;  4QB4 A;  3J7A 5;  5HGQ A;  5FK9 C;  4DFA A;  5IYC G;  3S14 H;  4CHT B;  1JE4 A;  4JI7 Q;  5IGE A;  4C3H B;  3ZJY C;  1UWV A;  4B9W A;  4M8A A;  3UDX A;  2VS1 A;  2ATW A;  1F9R A;  1OXV A;  4O2D A;  4IFD G;  2NVX B;  4K8I A;  2Q8R E;  1GXD C;  4LJZ C;  2K75 A;  3PIP 3;  2R93 H;  4JI5 Q;  1DOM A;  1IXR A;  4RKL A;  4DA2 A;  1LYL A;  4X64 L;  3S16 B;  3BVM A;  1U4L A;  5EKK A;  5KYI A;  1SLJ A;  5FLX c;  2MUY A;  1GM5 A;  3MHB A;  1FJG Q;  1CI3 M;  3CCS A;  3S9W A;  4C1N K;  1CTM A;  5E4W C;  2F0K A;  1XMQ Q;  4FP5 D;  3IRB A;  2F0G A;  2MO0 A;  2A6E D;  4ID6 A;  4QMG A;  4R4O A;  4TRD A;  1HH2 P;  4C3H G;  3SDZ A;  2BA0 A;  3L3O C;  4TKO B;  3HOZ H;  5JPM C;  3K7U C;  1VQ4 A;  1UAP A;  2OQK A;  2QA4 A;  2RCN A;  1Y1W G;  2MGS A;  2F3V A;  1Z6H A;  3W5O A;  1H9S A;  1WTW A;  1EU4 A;  2CHB D;  3E3X A;  1ENC A;  3C2P A;  4GLV B;  1A6X A;  3A74 A;  4ZCK A;  4JV5 Q;  1Y1W B;  1VQ9 A;  4CKC A;  4TQU S;  4CDE C;  3URY A;  3OIP A;  2JJQ A;  3QR8 A;  5CV8 A;  1F2M A;  2E5L L;  1QWY A;  4CJ2 C;  3A8K E;  1JQY D;  2QCP X;  5M3M B;  4GKK Q;  3T1H L;  2A74 C;  5FOB B;  1SE4 A;  1STB A;  4AQY Q;  4X66 L;  2FXQ A;  1ZKO A;  4LF8 L;  1B3Q A;  3D3R A;  5I6Y A;  3H0G B;  4RGM A;  4ZRZ A;  1TWF B;  3GTP B;  1K83 H;  1E22 A;  2OXP A;  4MIU A;  2BA1 A;  2O5I C;  1TII D;  1WJJ A;  3ITP A;  2UU9 Q;  4F87 A;  1EIY B;  2KHI A;  3S2H B;  4EQO A;  1WTH A;  3KDF A;  4PQX A;  2ZJQ A;  3V96 A;  1SE3 A;  2A68 C;  2MQH A;  4X62 Q;  2O4X A;  4ODG A;  1SNM A;  5IYD G;  3UE0 A;  4C3H H;  1VQF A;  3OW7 A;  3P75 A;  2KCN A;  2Z6B A;  2JN4 A;  2CW0 D;  3S1N H;  1E7Z A;  3FPP A;  2UXD L;  3HOW H;  4R4I A;  1E2Z A;  3MWY W;  3M85 A;  5GRO A;  1BKB A;  2B2W A;  4OON A;  2KHJ A;  1WTQ A;  3HOV B;  1PRT D;  1QVC A;  1K28 A;  1PVO A;  1BR9 A;  3K7A B;  1J8I A;  1FJG L;  1XNQ Q;  1HR0 L;  3MAQ A;  1V1O A;  5HUR A;  2KEN A;  3SGI A;  4L5T A;  1HQM C;  1N8R C;  1EY8 A;  1GUO A;  4HCE A;  4RH6 A;  1MJE A;  4JBW A;  1MIU A;  1JR0 D;  2P5Z X;  3K8A A;  1YJN A;  5IP9 G;  2B2U C;  4B3M L;  1EQV A;  5IT9 L;  3NK9 A;  2XIW A;  4A3J G;  4XYO A;  2I0Q A;  1YNJ D;  1EFI D;  4JVZ A;  2WAQ B;  1XWE A;  1RCV D;  5C0X I;  3HOX H;  1VQ5 A;  4X3K A;  1LAC A;  2EJM A;  5IP7 H;  2FJ2 A;  1VMP A;  4A3L H;  1EEI D;  4BY1 H;  4A3K G;  1VMC A;  5J1Z A;  2ES2 A;  1TU2 B;  3K80 C;  1EUJ A;  2HCI A;  1C8C A;  3Q23 A;  1P8L A;  2G9H D;  4JCV E;  3FMC A;  4GOP A;  2UUA Q;  1OXS C;  2Z6K A;  1EU3 A;  1O7I A;  3OWF A;  2E2I B;  5IOC A;  2DY7 A;  1CQV A;  2VW9 A;  3TEH B;  1SMX A;  3OYY A;  1LT6 D;  1NR4 A;  1S5E D;  2F0U A;  5GAH C;  4P74 A;  3H6M A;  3NBI A;  1Q86 C;  3RUZ A;  2B2T A;  2K5Q A;  3AYH B;  1ESF A;  2EDG A;  3R2I A;  4F7X A;  1XTD A;  2EYP A;  2J7Z A;  1PRT F;  3K7A H;  4BY7 H;  5JPN C;  5GQO A;  2XWJ B;  4HMI A;  1GVP A;  3TME A;  1HTP A;  1B2T A;  1FNV A;  3S1N B;  1H95 A;  5FLX L;  1VQI A;  4HIK A;  4DV5 L;  4BXX G;  4K2K A;  2G9D A;  1HQR D;  1SFO B;  1YHA A;  4KLK A;  2SOB A;  1LTA D;  4JYA L;  1D2B A;  4DNI A;  4G7O C;  1O7Y A;  4H13 C;  1K8G A;  3C46 A;  4L5Q A;  3F8T A;  4OO1 H;  1RHP A;  3EVQ A;  1P16 A;  1CUK A;  4KN4 C;  1BXT A;  2PQA A;  4L5S A;  3NSW A;  2LXJ A;  1TWG B;  4JI0 Q;  1BCP D;  1WTP A;  1I3Q H;  3HKZ E;  4DNR B;  2UXB L;  2ZXR A;  4JI4 L;  2K52 A;  2K14 A;  1SE8 A;  3G6E A;  2JQO A;  1PYB A;  1S4Z A;  1JWS D;  2XGT A;  2F0S A;  4O1N A;  2JA6 H;  1LTT D;  4OGQ C;  2KHS A;  2QKI C;  5BR8 Q;  2R6G A;  1HZC A;  4OL7 A;  4LF6 L;  1HRJ A;  1AZQ A;  2L5T A;  4YHH L;  1IYJ B;  3RZO H;  2C9O A;  1ICW A;  2UUA L;  4GNX A;  1I4G A;  1XX8 A;  2JK8 A;  1TWC B;  5EQ0 A;  2TMP A;  3M4O H;  4JBJ A;  2B2Y C;  1PHJ A;  4LWC A;  4P72 A;  1EEF D;  4AQY L;  4L63 B;  1YNJ C;  4OXP A;  3Q0A A;  4YCV A;  4DR3 L;  2E2I H;  4JOI C;  1W6J A;  1PH2 A;  2K5D A;  3C1E A;  1PV4 A;  4KD3 A;  4JI1 L;  1BQQ T;  1QZH A;  4IFD I;  5IP7 G;  3F2B A;  4K5X A;  4B9X A;  1XJV A;  2WAQ E;  3EBE A;  3NBH A;  2F0D A;  4YWK A;  4P71 A;  1RF2 D;  3P7J A;  5JEA J;  1G6P A;  1E1O A;  1VQO A;  1HR0 Q;  2RF4 A;  3NWT A;  4IUU A;  1FD7 D;  3L9A X;  4ALP A;  1HNZ L;  3GTJ H;  4IJH A;  1E0B A;  1EWH A;  4BY7 G;  4OX9 L;  1X9N A;  1SSO A;  1LAB A;  3NQI A;  3PGZ A;  5EJW A;  5G3L F;  1DOK A;  1JOK A;  1LTS D;  4ZKC B;  2MP1 A;  3RZD H;  4DV5 Q;  1EY5 A;  2GA4 B;  4GOP B;  1YBY A;  1V8Q A;  5C4Z A;  4LW1 A;  1SFO H;  4RMF A;  1HNW Q;  5C4X H;  4FO2 A;  3K0X A;  2L1B A;  4X65 Q;  3DM1 A;  3KF8 B;  1YJW A;  3E6Z X;  3RN5 A;  4RCO A;  2YV5 A;  5C4J B;  4HJ7 A;  4MZ9 A;  1B3A A;  1WOC A;  5M5X H;  4XXE A;  3I56 A;  5K5P A;  1SYD A;  4A3L G;  1LM0 A;  2F0P A;  5KNC A;  4DR7 L;  4LF6 Q;  2K5H A;  2GN5 A;  3K81 C;  1ICF B;  1PH8 A;  3PO3 G;  2HHH Q;  2E76 C;  3OSO A;  4C56 C;  1XTC D;  2KQ3 A;  4GLA C;  2K5V A;  1U5K A;  3NTK A;  3MTS A;  1LT4 D;  2R92 B;  1K8O A;  4PG3 A;  3GTQ H;  3GV3 A;  1TWC H;  2Z6K C;  3FDT A;  1TWA B;  2O5J C;  3R2T A;  4CKB A;  2IHF A;  2WAQ G;  4U67 3;  2I5M X;  4TSS A;  2NZO A;  1E24 A;  4DUZ Q;  2JE6 I;  4LK1 C;  4S3S A;  1O7L A;  2H1E A;  3W1B A;  2XVS A;  4NXM Q;  1SDF A;  4N9T A;  4HMJ A;  1FGU A;  1LTI D;  1A2U A;  4A3M B;  1XMQ L;  1ET6 A;  4J15 A;  2J4X A;  2M9V A;  1MHW C;  2MJ8 A;  2O2L D;  1QZG A;  1UEB A;  3S17 H;  1HUM A;  2NZH A;  4LF7 L;  4B3T Q;  1NSN S;  2NN6 H;  3OIQ A;  1NBW A;  3HOU B;  1C48 A;  1IYU A;  3GV6 A;  4A3G G;  4X64 Q;  3CCE A;  1SJH D;  1J6Q A;  1EFW A;  1SYF A;  3QG1 A;  2RSN A;  1S72 A;  4F8M A;  1MJC A;  1N34 L;  1PRT B;  5JEA H;  2WAC A;  2A1A A;  1EZ8 A;  2H5X A;  4HN7 A;  3CQZ B;  3FVQ A;  4YCW A;  1C7Y A;  1GUN A;  1PFS A;  3TZD A;  2VUM B;  3ONA B;  3DMU A;  2CVR A;  1PZI D;  4CDF C;  2R92 H;  4DV1 L;  3S1M B;  1CKN B;  1AH9 A;  3WOE A;  4A3F G;  5JJK A;  4YIJ A;  1PTO C;  4XYQ A;  4XQQ A;  3J7A V;  2PZT A;  4ZUJ A;  2DJF C;  3SK6 A;  3E9H A;  4KV6 A;  4KJO A;  4F88 A;  1U9R A;  4AIM A;  3J81 c;  1Y1W H;  3T1H Q;  2EYJ A;  2F0M A;  3QIA A;  4A3B H;  3F2C A;  3PUW A;  1FVI A;  4QF4 A;  4BY1 G;  1Q82 C;  1RIP A;  1EY0 A;  1I94 L;  4UHV A;  1SXT A;  4N9P A;  1JJC B;  1N9W A;  5IE8 A;  1HFG A;  1PXU A;  2JSO A;  4K14 A;  4HJ5 A;  1F2Z A;  1IBK Q;  1PLF A;  1U4M A;  5C4H A;  1KAA A;  2N55 A;  3BDL A;  3A56 A;  1PH6 A;  3CP0 A;  2AHO B;  3PMF A;  2DN8 A;  3KF8 A;  1VQA A;  2EE1 A;  3HFZ B;  5C5M A;  2IJ0 A;  1K8A C;  3IAY A;  1JOQ A;  3F1Z A;  2UXD Q;  4HAE A;  2L11 A;  2WKD A;  4OEL B;  4JI2 Q;  3AMU A;  5IY0 A;  4LF4 Q;  2E2H B;  1JJ2 A;  4HSV A;  5M9O A;  4C3I G;  1EY7 A;  4KMU C;  1JIC A;  1HFN A;  3W1G A;  1HUN A;  4DR6 L;  2HQL A;  1HA6 A;  1STH A;  1OTC A;  1H9K A;  1D1K A;  1LT5 D;  3DXJ C;  3TRZ A;  4FXD A;  1BCP C;  4CGY B;  3QO2 A;  4JW0 A;  3K0Y A;  1TY0 A;  1SNO A;  4PNY A;  2N3S A;  2EZV A;  1GUS A;  2XN9 C;  3JAM E;  3CXC A;  4OHJ A;  1NUC A;  2N88 A;  1SMY C;  3K59 A;  3T13 A;  5E4X A;  1STA A;  3D0F A;  2ZJR A;  1PZJ D;  3CC4 A;  1E3P A;  3BZD B;  4X3T A;  2AKW B;  4POG A;  3VYS A;  3MEF A;  1KL9 A;  3SE0 A;  1KLU D;  5LMN L;  1GUT A;  1MSG A;  3H0G H;  3GTP H;  4DR4 L;  2IY5 B;  3UDG A;  2ZM6 Q;  2JA9 A;  2PMZ B;  3JAM c;  1N33 Q;  1R9T B;  4IPG A;  3MC0 B;  3A54 A;  4XT3 B;  1K8M A;  1STN A;  2K5N A;  3G6J B;  2FMC A;  4EVO A;  2A6H C;  4DXG A;  2OTL A;  2N8N A;  2OF1 A;  4DR4 Q;  3DUZ A;  1Q1B A;  4JG2 A;  4HJA A;  1G51 A;  1NAP A;  1B44 D;  1TKW B;  4OO1 G;  3TP5 A;  3I73 A;  4DR5 Q;  4NW2 A;  2LSS A;  3A7A B;  3V2T A;  3I4M G;  1JC7 A;  4NXM L;  1VQM A;  3HEJ A;  1G2T A;  1LT3 D;  2LKV A;  3QWN A;  2NVQ H;  2F3W A;  4AYB B;  2J0T D;  2K05 A;  5KRU A;  2LXK A;  4UPA A;  1X56 A;  1PFB A;  1WCM B;  2DGY A;  3K5N A;  2A8V A;  1OXX K;  3ICE A;  4DR1 Q;  3JC6 6;  4DR6 Q;  4KHP L;  4RHS A;  4E6I A;  4OWW B;  4AH6 A;  2E5L Q;  4HR7 B;  3PQI A;  3G4S A;  3I4N B;  5M5W B;  1CKM A;  4YHH Q;  4EQN A;  5I6W A;  3CCR A;  4P2C B;  1I50 B;  1Z47 A;  3D31 A;  5CMD A;  1NMG A;  2JA7 H;  3U58 A;  2F0V A;  1SYB A;  4G57 A;  4KI0 A;  4UDU C;  4XDX A;  5I9P A;  2C35 B;  5C3W A;  1N32 L;  4OO1 I;  2UXB Q;  1MKH A;  1JOO A;  2F4I A;  5I4D A;  2F3I A;  2IT1 A;  3RR5 A;  1BF4 A;  3S15 H;  2AWN A;  5CV4 A;  4IUP A;  1XNR L;  2JA6 B;  2K01 A;  1VF7 A;  2VNU D;  3PUX A;  5ISR A;  2EYO A;  3L7Z C;  1X3P A;  4IUQ A;  5JVG 3;  3S14 B;  1I4H A;  4CKE A;  3I3C A;  5ELO A;  5C6A A;  4Y7N B;  1NJI C;  4OX9 Q;  4JI5 L;  3M4O B;  1ILQ A;  5IWA Q;  2R7Z H;  3G71 A;  3FPU B;  2JP1 A;  5DNF A;  4ZUI A;  2WB1 B;  3CME A;  5IYB H;  4DUY Q;  5C5L A;  2AQ3 B;  1JB3 A;  3NP8 A;  4KHV A;  1KRT A;  4BY7 B;  1ZYR C;  3PIO 3;  5TSS A;  3C3L A;  2Z4H A;  2FMM A;  5IGF A;  1Q7Y C;  5JJL A;  4I7A A;  3AQQ A;  2FFK B;  1SNC A;  2VQE L;  4HED A;  2EYF A;  1U4R A;  5C0X G;  4A3G H;  5FO9 B;  3RLF A;  5M3F G;  4IFD J;  3HOW G;  3TZU A;  3DWP A;  3MXP A;  3OMC A;  2IWH A;  5HY6 A;  1JCK B;  5FO7 B;  3CMA A;  3M3Y H;  3A0J A;  2F0W A;  1G29 1;  2HD3 A;  1A3U A;  2DJG C;  2BCO A;  4FF4 A;  3RLN A;  1EY4 A;  1UE1 A;  1TWG H;  2X6L A;  3I4N H;  5M3F H;  4C3J G;  3QJY A;  1LO5 D;  1G91 A;  4RGN A;  3I72 A;  3KYH C;  1TWH B;  4MTK A;  2QGQ A;  3GTK B;  3S1Q B;  2ZTC A;  3QB3 A;  5LMN Q;  3BZK A;  2EXZ A;  2CQO A;  4TVA B;  4L8J A;  3I55 A;  2F0H A;  1E2V A;  1WTR A;  1IBM L;  2ZXP A;  5I2Y A;  4DV3 L;  2OT2 A;  3MZ5 A;  5ELN A;  3TRE A;  2HDM A;  1AN8 A;  2K28 A;  3BDC A;  1VQ6 A;  4PMB A;  1CKN A;  2F0J A;  4GNX B;  1ET9 A;  1VQL A;  1PFM A;  1V1Q A;  1D1I A;  2NTS A;  3GTM B;  2IL8 A;  4JI3 L;  3TN2 A;  3WDN A;  4X3S A;  1ROD A;  2KJX A;  5M5Y H;  3S15 B;  1TT2 A;  1H9M A;  2FHT A;  1B53 A;  3HS0 C;  1EY9 A;  2PW5 A;  1BDO A;  3SVM A;  3I4N G;  1Q3L A;  1CSQ A;  1PH7 A;  2AQ2 B;  3FP9 A;  1W3S A;  1FL0 A;  3GO5 A;  2F03 A;  3EJI A;  5FKA C;  2HUG A;  1I6V C;  2WB1 E;  1TS5 A;  3Q8D A;  4N8F A;  2PW7 A;  3ND8 A;  3MVV A;  5IOD A;  1K0S A;  4G7H C;  1VQJ A;  3PUV A;  5I9O A;  3Q6S A;  1PYS B;  2E2D C;  2QDL A;  4A3E G;  1STG A;  5EBD A;  5K36 G;  2K4K A;  1EYD A;  3KF6 A;  4C3I H;  4IO9 A;  1EQQ A;  1Y14 B;  3H3V H;  4AYB E;  2IX3 A;  1CM9 A;  2F0T A;  1PH5 A;  1DXM A;  2EY2 A;  3CCQ A;  1MBY A;  2UXC L;  4KY6 A;  4B3R Q;  4MHE A;  4DR1 L;  5I2X A;  1KDB A;  4KN7 C;  3DEP A;  4DKA C;  4RA8 A;  4A3E H;  3A8I E;  4OEM B;  1N36 L;  1WVL A;  5CR3 A;  1BNZ A;  3CRK C;  5M3F B;  1KRS A;  2NWG A;  1TWH H;  3M7N A;  2F52 A;  5D3D A;  2CCZ A;  2UUC L;  5C0X J;  4A4I A;  2SNM A;  3SEB A;  1LTR D;  5C44 G;  4A3C H;  3CQZ H;  3E9I A;  3DEO A;  4JI6 Q;  4BBR B;  4A3I B;  3C1F A;  3OOC A;  2PNR C;  4R4T A;  4LFB Q;  3FKI B;  4GZY C;  3B6Y A;  4FXG C;  3MFY A;  4JBK A;  2ID0 A;  1F77 A;  4CDD C;  1XNR Q;  4A3F B;  1M1K C;  3GTM H;  1II3 A;  5BN5 A;  4DK6 C;  3R8B A;  3QOL A;  5GAE C;  1F9P A;  1YZ6 A;  4DR3 Q;  2EY1 A;  4YY3 L;  1GO3 E;  1PH3 A;  1BBX C;  2KA7 A;  1UUP A;  4MN3 A;  2E75 C;  3ULP A;  1PTO F;  4RFB A;  1AE3 A;  2Q2H A;  2Z9H A;  1HNX Q;  2K03 A;  1Q1E A;  5DLQ E;  1YJ9 A;  4GNX C;  1K9M C;  5FJ8 G;  4LF8 Q;  4JBM A;  3T53 B;  4C3J H;  2JA8 H;  2EXD A;  5DM6 3;  1E1T A;  2L15 A;  1D5X C;  3J80 i;  2YTV A;  4DK3 C;  4DK0 A;  2N78 A;  2Z8L A;  4NMZ A;  2IPK D;  3PV0 A;  3I4M H;  2A68 D;  2HIX A;  3M9B A;  2OCE A;  3A55 A;  4ZLT F;  4G7Z C;  5KEE A;  4POF A;  5J39 A;  5CC4 A;  2VB2 X;  2UXC Q;  2NBF A;  2Q2T A;  1L1O B;  1TY2 A;  2D62 A;  4QL5 A;  4QIW E;  1HA5 A;  4B3M Q;  4QY7 A;  2JXM B;  3F2D A;  3KLS A;  4JC0 A;  2RKS A;  1XXG A;  4DV3 Q;  3W2D A;  1SYC A;  1VQG A;  2CW0 C;  1YHQ A;  4FF2 A;  1SNQ A;  1RJT A;  2F0F A;  2PQE A;  3U4Z A;  4EX5 A;  4PMW A;  1ZYR D;  1A63 A;  2WV6 D;  4R4Q A;  3PIO A;  3ULL A;  2NZ1 D;  1RD9 D;  4ME3 A;  1DGS A;  5KGU A;  2I5L X;  1ESR A;  3DLL A;  4A3J B;  3LWE A;  1CZG A;  3I91 A;  4PZ8 A;  4QGU A;  1EYG A;  1TR5 A;  3EFX D;  1UEA B;  4A3B B;  1A2T A;  1S5B D;  1DJR D;  3ND9 A;  3GTK H;  3S1Q H;  2F0N A;  1YNX A;  3I4O A;  4A3C G;  3NE5 B;  5C44 H;  4K0K L;  5FLX E;  4L5R C;  2WKC A;  1HTL D;  4R1J A;  4B3S L;  1XYI A;  3CKI B;  4R8I A;  1G2S A;  4WJW A;  2CH4 W;  5AJ3 L;  4DV4 Q;  2K33 A;  2VXW A;  2DNC A;  1Y8P B;  3TQY A;  3GTJ B;  2XNA C;  1CA5 A;  4UP9 A;  1DYQ A;  3S1R B;  1Q90 A;  1X32 A;  3OHX C;  2Q2I A;  1VQH A;  2V1C C;  3GTG B;  3BYY B;  4DF7 A;  1WI5 A;  3OTO Q;  3BG3 A;  1YVC A;  1IW7 D;  4DV2 Q;  2RQX A;  1VQ7 A;  5A2Q E;  1XPU A;  2JA8 B;  5COY A;  5JEA G;  4LF7 Q;  4QUF A;  5KND A;  3VR2 A;  1HNZ Q;  1BBU A;  1U4P A;  2B2V A;  1PA6 A;  2B8F A;  2JEB I;  3A7L A;  2E74 C;  1PTO H;  4V19 0;  2F0Q A;  1L2F A;  5KNB A;  4IQZ A;  2A6H D;  3GTO H;  2QDB A;  2LY7 A;  3HOY H;  4KHZ A;  4IN3 A;  2VY3 A;  3MA2 B;  3SK5 A;  5EPJ A;  3E0E A;  1Y1V B;  2R7D A;  4DV7 Q;  1B9N A;  4WFN 3;  3K5O A;  3BVG A;  4K2L A;  2KBN A;  3IFD A;  1I94 Q;  1C4Q A;  4GN3 B;  1VQC A;  2GVA A;  5M5W H;  2R7F A;  3MXN B;  1WTX A;  1UE6 A;  4H0L C;  4RAU C;  1MSH A;  3AFQ A;  2YTY A;  1LV9 A;  5BN4 A;  2WB1 G;  2JA5 B;  2KCC A;  5CGK A;  1EQR A;  3VYT A;  1HHV A;  2B2W C;  2D2C C;  1SMY D;  4KKS A;  3QOJ A;  3H15 A;  1ENF A;  3TP8 A;  4A3E B;  4GN4 B;  4A93 G;  3E0J A;  4K5V A;  3J81 E;  1WTV A;  2B2T C;  4DV2 L;  4A3K B;  4BS9 A;  2YTX A;  2HIV A;  4KY7 A;  4IPH A;  4OWT B;  1Y1V G;  4XIG S;  3I90 A;  1DZ1 A;  5ELF A;  4B3S Q; 
#chains in the Genus database with same CATH homology
 5G3L D;  3W3A A;  4J8Q A;  5C44 B;  1BCP F;  5AFW A;  4LAA A;  3IL8 A;  2RA4 A;  2WP8 J;  4KTA A;  3KK7 A;  2L55 A;  4B08 A;  1MI2 A;  2DY8 A;  4FF1 A;  1HXY D;  3VR6 A;  4RGT A;  5IGG A;  1QCB D;  5CV7 A;  4NDX A;  4M1U B;  2RVL A;  3K57 A;  5KYL A;  1PMR A;  1OXU A;  1PZK D;  1Q8I A;  4DAV A;  1PTO B;  1SND A;  4C3J B;  2IW3 A;  2HQE A;  2R61 A;  3SK4 A;  3T51 B;  2RSO A;  4HCS A;  1STY A;  4KKU A;  2D9U A;  4KJN A;  3BVZ A;  1KDC A;  2YU9 B;  1PTO D;  4DXF A;  4ILW A;  2ENB A;  5D65 A;  2AQ1 B;  3AU7 A;  5EPK A;  1SEB D;  2EOT A;  1F2Y A;  1RTN A;  4DGZ A;  3HOX B;  3OPO A;  1SYG A;  1QIL A;  3IKJ A;  1VCI A;  2EYL A;  2R7Z B;  3K5L A;  3K58 A;  4I7Z C;  2Y0S B;  1IW7 C;  4EGV A;  1TVX A;  3U9O A;  1GUW A;  2SDF A;  4UAI A;  1Y69 U;  5EKI A;  4K5W A;  4IUR A;  4C1N I;  4ZAI A;  3D6W A;  3I70 A;  5IGC A;  1QE6 A;  4A3G B;  2RDG A;  1F9Q A;  2KOL A;  3G7L A;  5LL6 X;  2EJG C;  2Q8T A;  2NVT B;  2NN6 G;  4ZYS A;  5CBA E;  1I4Q A;  3M4Y A;  1JOR A;  1AEX A;  4OIK A;  2A5H A;  1L0X B;  4IUN A;  4RWS C;  4ULL A;  1B9M A;  1TQO A;  4FNF A;  3GTO B;  2K1B A;  2IX1 A;  3DWQ A;  1FR3 A;  1EY6 A;  1KDA A;  5A35 A;  2WII B;  2Z4I A;  1OO9 B;  3MXN A;  3RD4 A;  2B2U A;  5EGT A;  1Z7T A;  3TBI B;  1KLG D;  2M00 A;  4J1M A;  1GHJ A;  3VR5 A;  2DNE A;  3I8Z A;  3R3O A;  4DN4 M;  1R4P B;  3U9S A;  4Q0F A;  4DAY A;  4A3D B;  1EWC A;  1EYA A;  3LWU A;  1TS4 A;  1QNK A;  2F1M A;  3T16 A;  2HDL A;  1OXT A;  5C4X B;  4ZKB B;  1H9J A;  1AZP A;  5T1I A;  1PFN A;  2A73 B;  1H9R A;  1RDP D;  3J7A F;  2XWB B;  1VDZ A;  3PUZ A;  1GHK A;  1WTO A;  1DCZ A;  3MXU A;  1LTG D;  2NB0 A;  2QIL A;  3E5S A;  1LTB D;  4R8N A;  2PCF B;  1DM0 B;  4L6T B;  2K6A A;  1EQT A;  4H44 C;  1CA6 A;  3GTL B;  2A69 C;  4NP5 A;  2MPM A;  2WIN B;  1SYE A;  3PO3 B;  1HPC A;  2LMC B;  1SBB B;  3MFG A;  4WOR A;  3MEH A;  1WD1 A;  1CFM A;  4CJ1 B;  5KIX A;  2KEE A;  1V43 A;  5CV5 A;  2CQA A;  4O42 A;  5IIF A;  2B2V C;  2PZU A;  3VR3 A;  1IKM A;  4H7B A;  1GJX A;  3BS1 A;  3GD7 A;  2PPB C;  4U68 A;  2NVY B;  1AP0 A;  1O78 A;  1PDQ A;  3NTI A;  1KAB A;  3NXW A;  2MHV A;  1RKN A;  5FO8 B;  4G4K A;  4Z9C B;  4BA1 I;  3P20 A;  2B2Y A;  2XSC A;  4IUV A;  2E2J B;  1ONL A;  3HOY B;  2KUM A;  2NTT A;  3H3V C;  3T4A C;  1I3Q B;  1B1Z A;  2PYK A;  1LLR D;  1ML0 D;  1QG7 A;  3EA6 A;  3T56 B;  2L12 A;  5NUC A;  5J22 A;  4HTH A;  2EY6 A;  5IGB A;  4RHR A;  1CK1 A;  5DEH A;  4PMC A;  1YNN C;  3J7Y W;  2NUC A;  4BY1 B;  1STE A;  3Q24 A;  2JYO A;  4QUC A;  4C3I B;  2JEA I;  1RTO A;  1O7Z A;  1BCP B;  1S5C D;  2I07 B;  1A3T A;  3NWS A;  1J9O A;  3ZYY X;  3TP7 A;  1DON A;  2EYM A;  2IX0 A;  1H9S B;  2L9H A;  1X3Q A;  2TSS A;  4FVM A;  3RZD B;  4QIW B;  5K36 H;  1CHQ D;  1SE2 A;  3KLS X;  2B39 A;  4HSP A;  4ZK9 B;  1KTK A;  2D5D A;  1TS3 A;  5E3F A;  4XQJ A;  2LS0 1;  1NR2 A;  2AUJ D;  3D6C A;  1YNN D;  3TP6 A;  2ICE C;  4ZQ3 A;  4KKT A;  3KBX A;  4BA2 I;  1QJO A;  2SEB D;  5IT9 E;  5M5X B;  3VYU A;  2XRS D;  1F9S A;  4BBS B;  1UNS A;  2H4O A;  3VYR A;  4XQN A;  1CZW A;  3VA5 A;  1I6H B;  3N6R A;  1M4V A;  4CJ0 B;  1QNU A;  3IFT A;  1VF5 C;  3PO2 B;  4EQP A;  3N52 A;  1Y8N B;  1EIG A;  4V0B A;  4DU9 A;  2OEO A;  1AW7 A;  1ZEQ X;  1DOL A;  1NCV A;  2PO4 A;  5CV6 A;  3V05 A;  1DD2 A;  2KEC A;  4BWG B;  3UI2 A;  2I46 A;  1ZXT A;  2NVQ B;  4RCN A;  3LX0 A;  1IYV A;  3CHB D;  3A8J E;  3ERO A;  2NN6 I;  2RDF A;  2PZW A;  5D3I B;  1ENA A;  1CQF A;  3I4L A;  2BE5 D;  4C2M B;  1V1P A;  3H09 A;  5C0X H;  3HOW B;  3SHL A;  1R4Q B;  2X6G A;  5JVH 3;  2BOS A;  3TSS A;  1E2W A;  1IKL A;  4KK7 A;  1T5E A;  1F2L A;  2JA7 B;  3D4R A;  4KD4 A;  4ABN A;  2K5W A;  1GUG A;  4J6H A;  2RBM A;  3KLR A;  3D4D A;  1EL0 A;  3AB9 A;  4XT1 B;  3F2U A;  1W6K A;  4ME5 A;  1CT1 D;  3BDO A;  5F2D A;  3HRZ C;  1FNU A;  5LHY 1;  3J80 L;  2EYH A;  3Q22 A;  3OWE B;  5A2Q L;  2X69 A;  1Q12 A;  1SAP A;  1JWM D;  2Q8I B;  4CBV A;  1TS2 A;  3BYT B;  1KNE A;  4FF3 A;  3HZX A;  1S5D D;  1FYC A;  4QCL A;  2RDH A;  4IAL A;  4DNT B;  3MXG A;  5CYU A;  3GTQ B;  3VA7 A;  1BUV T;  1D5Z C;  5ELC A;  1GOZ A;  2F0L A;  5CV9 A;  5CBE E;  4LMQ D;  4K6D A;  2EJF C;  2ZT9 C;  3DHQ A;  4K6L A;  4FXK C;  2C5C A;  1ILP A;  2ICI A;  4FYD A;  2BE5 C;  5LL6 S;  2BDN A;  1PRT C;  4R9W A;  2EVB A;  2R3Z A;  2YYZ A;  1CHP D;  3KUP A;  3X3N A;  1A3V A;  3NHH A;  3D4W A;  2KVM A;  1SJE D;  4DAP A;  1BOS A;  4RKB A;  5DAU A;  2K32 A;  4PV1 C;  5ELE A;  4DK1 A;  1WD0 A;  1I4X A;  2B8G A;  2F0I A;  3OMG A;  2EY5 A;  3HP3 A;  1MD2 D;  4NKL A;  1MGS A;  3GQB A;  2AUK A;  5JAV A;  1M8A A;  1G8Z D;  3D8G A;  2KED A;  4I65 A;  1B50 A;  2R93 B;  2Z1C A;  2K04 A;  1QB5 D;  1EOT A;  4OIJ A;  2M2L A;  4Q5V A;  5ELB A;  1BO0 A;  3SR1 A;  5C3E B;  5C3X A;  1L0Y B;  3FEW X;  3HKZ B;  1EIH A;  3EQL C;  2HCC A;  1AFP A;  5BN3 A;  5JOB A;  2VB3 X;  1QOH A;  1I4P A;  3H91 A;  3SXH A;  2AWO A;  4KY5 A;  4X3U A;  3CU7 A;  5IGD A;  5E1F A;  2F0O A;  2FIN B;  1B4O A;  3P1H A;  1O80 A;  3NTH A;  3K6O A;  3K5M A;  3RZO B;  3NUC A;  1SNP A;  5JJZ A;  1K83 B;  2NYZ D;  3PUY A;  1FGB D;  4XTC S;  2XRQ D;  2F0E A;  2LFN A;  3M7G A;  4A93 B;  3WOF A;  3NQT A;  1G6Z A;  3NPP A;  1IL8 A;  2SNS A;  4WRD A;  5HGT A;  3TDQ A;  2QF7 A;  1EZ6 A;  1I4R A;  2K7V A;  1IHZ A;  2BDO A;  2EPB A;  4RGO S;  3VR4 A;  3SK8 A;  1EYC A;  3LNN A;  1D6E C;  5EKL A;  2L0C A;  5ELD A;  3S17 B;  1JWU D;  2B63 B;  1Y8O B;  3KBG A;  2A6E C;  3M3Y B;  3I4M B;  1D5M C;  1PYW D;  3FRP B;  5EBC A;  2L4N A;  4K8J A;  3HG9 A;  1FNW A;  1T5X D;  3H94 A;  1HCZ A;  2QEJ C;  3O13 A;  4IFD H;  1V1P B;  1KNA A;  4JK1 C;  3JAM L;  3J80 E;  3HOZ B;  5T1G A;  3HGB A;  3X3M A;  3J81 L;  1A15 A;  3GP7 A;  4IUT A;  5EPL A;  5M5Y B;  3RMH A;  1S5F D;  3DWA A;  5D14 A;  5COR A;  2A69 D;  3S2D B;  2V4D A;  2ZXO A;  3ERQ A;  4IZ8 A;  3R93 A;  5DM7 3;  3CRL C;  4QB4 A;  5FK9 C;  4DFA A;  4CHT B;  1JE4 A;  5IGE A;  4C3H B;  4B9W A;  4M8A A;  1F9R A;  1OXV A;  2NVX B;  4IFD G;  4K8I A;  2Q8R E;  1GXD C;  4LJZ C;  3PIP 3;  1DOM A;  4RKL A;  4DA2 A;  3S16 B;  3BVM A;  1U4L A;  5EKK A;  5KYI A;  2MUY A;  3MHB A;  1CI3 M;  3S9W A;  4C1N K;  1CTM A;  5E4W C;  2F0K A;  4FP5 D;  2F0G A;  2A6E D;  4ID6 A;  4QMG A;  4TRD A;  4C3H G;  3SDZ A;  2BA0 A;  3L3O C;  4TKO B;  5JPM C;  1UAP A;  2MGS A;  2F3V A;  1Z6H A;  1H9S A;  1WTW A;  1EU4 A;  2CHB D;  1ENC A;  3C2P A;  1A6X A;  1Y1W B;  4CKC A;  4TQU S;  3URY A;  3OIP A;  5CV8 A;  1F2M A;  1QWY A;  4CJ2 C;  3A8K E;  1JQY D;  2QCP X;  5M3M B;  2A74 C;  5FOB B;  1SE4 A;  1STB A;  1ZKO A;  3D3R A;  5I6Y A;  3H0G B;  4RGM A;  4ZRZ A;  1TWF B;  3GTP B;  2OXP A;  4MIU A;  2BA1 A;  2O5I C;  1TII D;  3ITP A;  4F87 A;  3S2H B;  4EQO A;  4PQX A;  3V96 A;  1SE3 A;  2A68 C;  2O4X A;  4ODG A;  1SNM A;  3OW7 A;  3P75 A;  2KCN A;  2CW0 D;  3FPP A;  1E2Z A;  3MWY W;  3M85 A;  2B2W A;  1WTQ A;  3HOV B;  1PRT D;  1BR9 A;  3K7A B;  1J8I A;  3MAQ A;  1V1O A;  5HUR A;  1HQM C;  1EY8 A;  1GUO A;  4HCE A;  4RH6 A;  4JBW A;  1JR0 D;  2B2U C;  1EQV A;  5IT9 L;  3NK9 A;  2XIW A;  4XYO A;  1YNJ D;  1EFI D;  2WAQ B;  1XWE A;  1RCV D;  5C0X I;  4X3K A;  1LAC A;  2EJM A;  2FJ2 A;  1VMP A;  1EEI D;  1VMC A;  5J1Z A;  1TU2 B;  2HCI A;  1C8C A;  3Q23 A;  2G9H D;  3FMC A;  1OXS C;  1EU3 A;  3OWF A;  2E2I B;  5IOC A;  2DY7 A;  1CQV A;  1LT6 D;  1NR4 A;  1S5E D;  2F0U A;  3H6M A;  3NBI A;  3RUZ A;  2B2T A;  2K5Q A;  1ESF A;  2EDG A;  3R2I A;  4F7X A;  2J7Z A;  2EYP A;  1PRT F;  5JPN C;  2XWJ B;  4HMI A;  3TME A;  1HTP A;  1B2T A;  1FNV A;  3S1N B;  5FLX L;  4K2K A;  2G9D A;  1HQR D;  1SFO B;  2SOB A;  1LTA D;  1D2B A;  4G7O C;  1O7Y A;  4H13 C;  3C46 A;  4OO1 H;  1RHP A;  3EVQ A;  4KN4 C;  1BXT A;  3NSW A;  1TWG B;  1BCP D;  1WTP A;  4DNR B;  2ZXR A;  1S4Z A;  1JWS D;  2F0S A;  4O1N A;  1LTT D;  4OGQ C;  2KHS A;  2QKI C;  2R6G A;  4OL7 A;  1HRJ A;  1AZQ A;  2L5T A;  2C9O A;  1ICW A;  1I4G A;  1XX8 A;  1TWC B;  5EQ0 A;  2TMP A;  2B2Y C;  1EEF D;  4L63 B;  1YNJ C;  3Q0A A;  1W6J A;  2K5D A;  3C1E A;  4KD3 A;  1BQQ T;  4IFD I;  4K5X A;  4B9X A;  3NBH A;  2F0D A;  1RF2 D;  3P7J A;  5JEA J;  3NWT A;  4IUU A;  1FD7 D;  3L9A X;  1E0B A;  1EWH A;  1SSO A;  1LAB A;  3NQI A;  5EJW A;  5G3L F;  1DOK A;  1JOK A;  1LTS D;  4ZKC B;  2MP1 A;  1EY5 A;  2GA4 B;  1V8Q A;  5C4Z A;  4FO2 A;  2L1B A;  3DM1 A;  3E6Z X;  4RCO A;  5C4J B;  1B3A A;  4XXE A;  5K5P A;  1SYD A;  2F0P A;  5KNC A;  2E76 C;  3OSO A;  4C56 C;  1XTC D;  2KQ3 A;  3NTK A;  3MTS A;  1LT4 D;  2R92 B;  1K8O A;  3GV3 A;  2O5J C;  3FDT A;  1TWA B;  3R2T A;  4CKB A;  4U67 3;  4TSS A;  2JE6 I;  4LK1 C;  4S3S A;  1O7L A;  2H1E A;  2XVS A;  1SDF A;  4N9T A;  4HMJ A;  1LTI D;  1A2U A;  4A3M B;  1ET6 A;  2J4X A;  2M9V A;  2MJ8 A;  2O2L D;  1HUM A;  1NSN S;  2NN6 H;  3OIQ A;  3HOU B;  1C48 A;  1IYU A;  3GV6 A;  1SJH D;  1SYF A;  3QG1 A;  2RSN A;  4F8M A;  1PRT B;  5JEA H;  2WAC A;  4HN7 A;  1EZ8 A;  3CQZ B;  3FVQ A;  1GUN A;  3TZD A;  2VUM B;  3ONA B;  3DMU A;  2CVR A;  1PZI D;  3S1M B;  3WOE A;  4YIJ A;  1PTO C;  4XYQ A;  4XQQ A;  3J7A V;  2PZT A;  4ZUJ A;  3SK6 A;  4KV6 A;  4F88 A;  4KJO A;  1U9R A;  2EYJ A;  2F0M A;  3QIA A;  3PUW A;  4QF4 A;  1EY0 A;  1SXT A;  4N9P A;  1HFG A;  1PXU A;  2JSO A;  4K14 A;  1F2Z A;  1PLF A;  1U4M A;  5C4H A;  1KAA A;  2N55 A;  3BDL A;  3A56 A;  3PMF A;  2DN8 A;  3KF8 A;  2EE1 A;  5C5M A;  2IJ0 A;  3IAY A;  1JOQ A;  4HAE A;  2L11 A;  2WKD A;  3AMU A;  2E2H B;  4HSV A;  5M9O A;  4C3I G;  1EY7 A;  4KMU C;  1JIC A;  1HFN A;  1HUN A;  1HA6 A;  1STH A;  1H9K A;  1D1K A;  1LT5 D;  3DXJ C;  4FXD A;  1BCP C;  4CGY B;  3QO2 A;  3K0Y A;  1TY0 A;  1SNO A;  4PNY A;  2EZV A;  1GUS A;  2XN9 C;  3JAM E;  4OHJ A;  1NUC A;  2N88 A;  1SMY C;  3K59 A;  3T13 A;  5E4X A;  1STA A;  1PZJ D;  3BZD B;  4X3T A;  3VYS A;  3SE0 A;  1KLU D;  1GUT A;  1MSG A;  2PMZ B;  1R9T B;  3MC0 B;  3A54 A;  4XT3 B;  1K8M A;  1STN A;  3G6J B;  2FMC A;  4EVO A;  2A6H C;  4DXG A;  2OF1 A;  3DUZ A;  1Q1B A;  1NAP A;  1B44 D;  1TKW B;  4OO1 G;  3TP5 A;  3I73 A;  4NW2 A;  3A7A B;  3V2T A;  1JC7 A;  3HEJ A;  1G2T A;  1LT3 D;  2LKV A;  3QWN A;  2F3W A;  4AYB B;  2J0T D;  2K05 A;  5KRU A;  1PFB A;  1WCM B;  3K5N A;  1OXX K;  4RHS A;  4E6I A;  4HR7 B;  3I4N B;  5M5W B;  4EQN A;  5I6W A;  4P2C B;  1I50 B;  1Z47 A;  3D31 A;  5CMD A;  2F0V A;  1SYB A;  4G57 A;  4KI0 A;  4UDU C;  4XDX A;  5I9P A;  5C3W A;  4OO1 I;  1JOO A;  2F4I A;  5I4D A;  2IT1 A;  1BF4 A;  2AWN A;  5CV4 A;  4IUP A;  2JA6 B;  2K01 A;  1VF7 A;  2VNU D;  3PUX A;  5ISR A;  2EYO A;  3L7Z C;  1X3P A;  4IUQ A;  5JVG 3;  3S14 B;  1I4H A;  4CKE A;  3I3C A;  5C6A A;  4Y7N B;  3M4O B;  1ILQ A;  3FPU B;  2JP1 A;  5DNF A;  4ZUI A;  2WB1 B;  5C5L A;  2AQ3 B;  1JB3 A;  3NP8 A;  4KHV A;  4BY7 B;  1ZYR C;  3PIO 3;  5TSS A;  3C3L A;  2Z4H A;  2FMM A;  5IGF A;  2FFK B;  1SNC A;  4HED A;  2EYF A;  1U4R A;  5C0X G;  5FO9 B;  3RLF A;  4IFD J;  3TZU A;  3DWP A;  3MXP A;  3OMC A;  2IWH A;  1JCK B;  5FO7 B;  2F0W A;  1G29 1;  1A3U A;  2BCO A;  4FF4 A;  1EY4 A;  2X6L A;  4C3J G;  3QJY A;  1LO5 D;  1G91 A;  4RGN A;  3I72 A;  1TWH B;  3GTK B;  3S1Q B;  3QB3 A;  2EXZ A;  4L8J A;  2F0H A;  1E2V A;  1WTR A;  2ZXP A;  5I2Y A;  2OT2 A;  3MZ5 A;  2HDM A;  1AN8 A;  2K28 A;  3BDC A;  4PMB A;  2F0J A;  1ET9 A;  1PFM A;  1D1I A;  2NTS A;  3GTM B;  2IL8 A;  3WDN A;  3TN2 A;  3S15 B;  4X3S A;  1ROD A;  2KJX A;  1TT2 A;  1H9M A;  2FHT A;  1B53 A;  3HS0 C;  1EY9 A;  2PW5 A;  1BDO A;  3SVM A;  1Q3L A;  2AQ2 B;  3GO5 A;  2F03 A;  3EJI A;  5FKA C;  2HUG A;  1I6V C;  1TS5 A;  2PW7 A;  3ND8 A;  3MVV A;  5IOD A;  4G7H C;  3PUV A;  5I9O A;  3Q6S A;  2E2D C;  5K36 G;  1STG A;  5EBD A;  1EYD A;  2IX3 A;  1CM9 A;  2F0T A;  1DXM A;  2EY2 A;  1MBY A;  4KY6 A;  4MHE A;  5I2X A;  1KDB A;  4KN7 C;  3DEP A;  4RA8 A;  3A8I E;  1WVL A;  5CR3 A;  1BNZ A;  3CRK C;  5M3F B;  2NWG A;  3M7N A;  5D3D A;  5C0X J;  2SNM A;  3SEB A;  1LTR D;  3DEO A;  4BBR B;  4A3I B;  3C1F A;  3OOC A;  2PNR C;  3FKI B;  4GZY C;  4FXG C;  3MFY A;  2ID0 A;  1F77 A;  4A3F B;  1II3 A;  5BN5 A;  3R8B A;  3QOL A;  1F9P A;  2EY1 A;  1BBX C;  2KA7 A;  1UUP A;  4MN3 A;  2E75 C;  1PTO F;  4RFB A;  2K03 A;  1Q1E A;  3T53 B;  5DM6 3;  1D5X C;  4DK0 A;  2Z8L A;  4NMZ A;  2IPK D;  3PV0 A;  2A68 D;  3A55 A;  4ZLT F;  4G7Z C;  5KEE A;  5J39 A;  5CC4 A;  2VB2 X;  2NBF A;  1TY2 A;  2D62 A;  1HA5 A;  2JXM B;  3KLS A;  2RKS A;  1XXG A;  3W2D A;  1SYC A;  2CW0 C;  4FF2 A;  1SNQ A;  1RJT A;  2F0F A;  2PQE A;  4PMW A;  1ZYR D;  2WV6 D;  2NZ1 D;  1RD9 D;  5KGU A;  1ESR A;  4A3J B;  3LWE A;  1CZG A;  3I91 A;  1TR5 A;  3EFX D;  1UEA B;  4A3B B;  1A2T A;  1S5B D;  1DJR D;  3ND9 A;  2F0N A;  3NE5 B;  5FLX E;  2WKC A;  1HTL D;  1XYI A;  3CKI B;  4R8I A;  1G2S A;  4WJW A;  2K33 A;  2VXW A;  2DNC A;  1Y8P B;  3GTJ B;  2XNA C;  1CA5 A;  1DYQ A;  3S1R B;  1Q90 A;  1X32 A;  3OHX C;  3GTG B;  3BYY B;  4DF7 A;  3BG3 A;  1IW7 D;  2RQX A;  5A2Q E;  2JA8 B;  5COY A;  5JEA G;  4QUF A;  5KND A;  3VR2 A;  1U4P A;  2B2V A;  2B8F A;  2JEB I;  3A7L A;  2E74 C;  4V19 0;  1PTO H;  2F0Q A;  5KNB A;  4IQZ A;  2A6H D;  2QDB A;  2LY7 A;  4KHZ A;  4IN3 A;  3MA2 B;  3SK5 A;  5EPJ A;  1Y1V B;  1B9N A;  4WFN 3;  3K5O A;  3BVG A;  4K2L A;  3IFD A;  1C4Q A;  1WTX A;  4H0L C;  4RAU C;  1MSH A;  5BN4 A;  1LV9 A;  2JA5 B;  2KCC A;  5CGK A;  3VYT A;  1HHV A;  2B2W C;  2D2C C;  1SMY D;  4KKS A;  3QOJ A;  1ENF A;  3TP8 A;  4A3E B;  3E0J A;  4K5V A;  3J81 E;  1WTV A;  2B2T C;  4A3K B;  4BS9 A;  4KY7 A;  4XIG S;  3I90 A;  1DZ1 A;  5ELF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...