1Y8PB

Crystal structure of the pdk3-l2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
97
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8pB00
4DNTB 5C0XG 1GUNA 1H9SA 1VF7A 2DNCA 1Q1BA 2L5TA 1K8MA 1FYCA 2KCCA 4PV1C 1GUOA 3A8KE 3GD7A 2NN6G 3A8JE 2BA0A 3GQBA 3M85A 1Y8OB 4L8JA 3VR5A 4G7HC 3I73A 2K7VA 3PUZA 1PMRA 3I72A 2BE5C 4I7ZC 3D4RA 3QIAA 2AUJD 3SE0A 1GUTA 2A68D 3LNNA 3VR4A 4KI0A 1LACA 1T5EA 1B9MA 1TU2B 3IKJA 3AB9A 3QJYA 2B8GA 1H9JA 5BN5A 1IYVA 1GHKA 4BA2I 3PUYA 3SDZA 2IT1A 2JE6I 1GHJA 2A6HC 3LWUA 2D5DA 4XIGS 4LJZC 1H9SB 4RCNA 4KKTA 3KLRA 2A6EC 1YNJC 1DD2A 2EJGC 1V43A 2NN6I 1E2WA 1GUSA 5KNCA 2O5JC 2A69D 3MXUA 3CRKC 3VR6A 1IYUA 1E2VA 3ND8A 4DK0A 3RLFA 3M7NA 1ONLA 4TKOB 2BDOA 1OXSC 3T51B 1Q90A 4H13C 4G7ZC 1QJOA 3VA7A 3HGBA 2DN8A 1H9MA 1OXXK 1GUGA 2QF7A 1SMYC 2EJMA 2V4DA 3W3AA 2KA7A 2BA1A 3PUVA 3OOCA 4XTCS 2F1MA 3A7AB 2YYZA 4JK1C 2Q8IB 2EJFC 1Y69U 1Y8PB 5K36H 1CFMA 2E75C 2PCFB 5KNDA 4IFDH 2A6HD 1Z6HA 2JEBI 3EQLC 3DXJC 3PUXA 3NE5B 1IW7D 1B9NA 2K33A 3OW7A 4H44C 4OO1H 4KN7C 3BDOA 1TKWB 2K32A 3N6RA 3P20A 4TQUS 3L7ZC 1A6XA 1LABA 2AUKA 2EDGA 4GZYC 3A7LA 2O5IC 1H9KA 2B8FA 5KNBA 4DK1A 3A8IE 1OXUA 1CTMA 4IQZA 3VR3A 2JEAI 4OGQC 1O7LA 4IFDG 1Q12A 3M4YA 2BE5D 4KN4C 1K8OA 3FMCA 3ND9A 1V8QA 4OO1G 1HQMC 1VCIA 3BG3A 1OXTA 1HTPA 2R6GA 4KMUC 1FR3A 1DXMA 3VR2A 2A69C 2PPBC 1G291 2LMCB 1E2ZA 3CRLC 3WDNA 2JXMB 5JEAH 1YNNC 2D2CC 3T56B 5A35A 1GJXA 1BDOA 2CW0C 1Y8NB 1VF5C 3IFTA 2E76C 1I6VC 2DNEA 3PUWA 1EWHA 1O78A 2A6ED 5BN4A 3T53B 4KKSA 3OPOA 2A68C 3PV0A 1HPCA 4HR7B 2PNRC 5C0XH 1ZYRC 2EVBA 3U9SA 2E74C 4KHZA 3I4LA 4BA1I 4LK1C 5BN3A 1DCZA 5K36G 1VDZA 1OXVA 2NN6H 1H9RA 1Q1EA 2AWOA 3D31A 5JEAG 3MFYA 4H0LC 1CI3M 3TZUA 4G7OC 3FPPA 4KKUA 4DNRB 2ZT9C 1ZKOA 1HCZA 2D62A 3H94A 4JBWA 1IW7C 1Z7TA 3QG1A
chains in the Genus database with same CATH superfamily
5C0XG 1TT2A 5CBEE 4KHPQ 1VQDA 4LFAQ 2E2JH 3GQBA 1WTRA 3UE1A 1TWAH 3CCSA 4GOPC 5J3BA 4RCOA 3J81i 1MJCA 3FEWX 4LF4L 4HIKA 1PH3A 2CWAA 1EQQA 2XRQD 4C1NK 2IL8A 4POFA 1JB7A 3LNNA 1F9QA 4GLVB 4C3JB 1UE7A 1KD1C 1CHPD 1LTLA 2N88A 3S14H 3W1GA 4LUVA 3GTJH 3TP7A 2J4XA 4X62Q 3A55A 4DV3Q 1BBWA 5M5YB 5M5WB 1NUCA 2K04A 2HCIA 4HJ7A 2O5JC 4BY7G 3KF8A 4XDXA 1Y1VB 4WFN3 2QDLA 2JP1A 1V1QA 2EXZA 2RCFA 4C1NI 2I0QA 4R4IA 5E7NA 5C4ZA 3GTKH 3I8ZA 1YJ9A 4X3SA 3HOVB 2VQEL 2L0CA 4G7ZC 4JYAL 4OELB 3JAME 4A3JB 4FF4A 4IOAA 4DXGA 1C4QA 4X6AH 3K7UC 2A6HD 1HH2P 3HS0C 3UDIA 3GTQH 1LABA 1SNOA 1AW7A 4KK7A 3SR1A 1TIID 3PO3H 4IJLA 5EPKA 4DK1A 2F0EA 1M1KC 5EQ0A 1UEAB 2RF4A 3GTMB 1EY9A 2EYFA 1JICA 1PFNA 2LMCB 3CRLC 4LFCQ 1BDOA 2NVXH 2E76C 1CKNB 1BBXC 5J39A 4Y7NB 4KHPL 4A3KB 1NMGA 4LFAL 5EJWA 2C9OA 2E74C 1STGA 3GTLH 1EYCA 3I7FA 1QVCA 3D31A 1RTOA 1JB3A 1E3PA 4O42A 1Z47A 3BZKA 5LMUQ 4FYDA 3O13A 3NWSA 2VS1A 3AFQA 1WTHA 1Q86C 1Y14B 1KDBA 3NEMA 4GNXA 3OHXC 4X62L 3M85A 1I3QB 4DV3L 4N9PA 1SLJA 4KHVA 1HA5A 5C5LA 4DV5L 1XNQL 3J80L 3K81C 1QVGA 2NWGA 1ILPA 1GUTA 3F2UA 1XNRQ 2R7FA 1PA6A 4R4CA 4LF8Q 3DWQA 1G8ZD 1R4PB 3RZDH 2C5CA 1L1OB 2K6AA 1Q81C 2N55A 1D1IA 5H1SE 4K8JA 3CCQA 2KEDA 4BY7B 2CFMA 4XXEA 1STBA 4OIJA 1KDCA 1JOOA 1E22A 4TKOB 2O4XA 1EZ6A 1VQLA 5EKLA 1YHQA 4DAMA 3I4NG 1VQGA 3MXNB 2NUCA 2YTVA 4WJWA 2VQFQ 1H9MA 5I4DA 4DV0Q 1ZYRD 2CH4A 4JBKA 2R7ZH 5G3LD 4B9XA 3A7AB 1SBBB 1L2FA 4GN5A 1NE3A 3RZOH 2PCFB 4A3GH 1S5ED 3J7A5 1UE1A 3HFZB 3HOUG 3EFXD 3NE5B 4MN3A 4K2LA 5M3FH 1B9NA 2JA5B 1BVSA 1TWFH 4OO1H 1X9NA 2RBMA 1A6XA 2DGYA 3E9HA 2JQOA 3D8GA 3GTPB 2F0OA 1HJPA 4L5TA 5C3EB 2R93H 2PYKA 1OXUA 4DPGA 4IFDI 4WORA 2XGTA 5JPMC 1CKOA 4AIMA 4C3HH 3TS2A 2JSOA 2UUCQ 2UXBQ 1ICFB 1RKNA 3M4YA 4HJ9A 3DWPA 3KBGA 2R3ZA 2OF1A 4KY6A 4KJOA 2FXQA 3DEOA 2K03A 2R6GA 3D6WA 4AYBE 5LMUL 2A69C 4MHEA 2OTLA 3DHQA 2BCOA 2OT2A 2VZAA 5IGDA 4CGYB 1GM5A 2RDHA 3H91A 3UDGA 1HPCA 4HR7B 2K01A 1CA6A 1R4QB 4JV5Q 2EVBA 4A4IA 2X6LA 4BA1I 4EQ5A 1MBYA 1RD9D 1IL2A 3I4MH 1YIJA 1WCMG 3TZUA 1E0BA 1PRTF 1XNRL 2Y0SE 4UP8A 2L12A 4LF8L 5I9PA 5IYCH 5IYDG 2HD3A 2I5MX 2KCCA 1QUQB 2J7ZA 1FGBD 1LT3D 1VQ6A 2EYPA 3E0JA 1ASZA 2RHSB 2K7VA 3OIPA 4Y52H 3NSWA 4A3IH 4FP5D 2NBFA 3VR4A 3BVGA 1IXRA 4O2DA 1PHJA 1G6ZA 4FO2A 3QJYA 2AQ1B 1HHVA 3PUYA 1EZ8A 1VQNA 3RD4A 2VQFL 1SYCA 3M4OB 4DV0L 1NCVA 1U4LA 3ONAB 1VQ9A 2JK8A 1SNPA 5C4HA 5I6YA 2F0JA 3BDCA 1KL9A 3CRKC 1E1OA 4DK0A 2IHEA 3M7NA 3M3YB 4IUTA 4B3MQ 1FGUA 1HUNA 3T51B 1EIGA 1XPRA 2NVQB 3I4NB 3VA7A 5ELOA 5CYUA 1JE5A 2H5XA 4R1JA 3U4ZA 2UUCL 2UXBL 4JK1C 4GNXC 2DJFC 3VYUA 3NQIA 1A3VA 3HOUB 4RFBA 1K9MC 3A56A 1F9SA 1PH9A 1YNXA 2A19A 1CQFA 2B2UC 5FLXc 3F2BA 3GTGB 1EIFA 2L15A 2Z6KA 3V2TA 4K5WA 1NNXA 1LTTD 5C6AA 4P72A 4JV5L 3K7AB 4UAIA 1KABA 1Q82C 3IRBA 1R9TH 4LUZA 2QDBA 2RSOA 3QB3A 2PPBC 4ID6A 4A3LH 3GO5A 5JEAH 3NK9A 2XRSD 2ASBA 3CPFA 4GN4B 5HURA 4UY8C 3S2HB 2DNEA 2A6ED 2NVYB 1VQHA 2IJ0A 1C9OA 2LSSA 2UU9Q 3EN2A 2CKZB 1WCMB 1LTSD 3HOYH 1X6OA 3BVZA 4A3BG 3STBD 4DK3C 1B8AA 3X3NA 5IGBA 2RDFA 5ELFA 3F1ZA 2Z9HA 3TSSA 3KDFB 2ALYB 1HZAA 4CDFC 4CHTB 2EYHA 4F88A 4HSPA 5M5XB 1S5DD 4I7ZC 5KIXA 2AUJD 1Y1WG 4B3ML 4KI0A 1L0XB 3AB9A 3IFDA 3SK5A 2IHFA 2DUDA 2IT1A 1YJWA 4R8NA 4XQJA 2D5DA 1CT1D 3DM3A 1PVOA 1IBMQ 4HIOA 4HJ8A 1JJCB 1JOQA 1GUSA 2EQSA 2LKVA 3AEVA 3FVQA 1SNQA 3Q6SA 2XNAC 1SYFA 2PZWA 3JAMi 4FXKC 4XYQA 4P75A 2YV5A 2Q8RE 3PO2G 1TXYA 2V4DA 2MPMA 2LFNA 4XTCS 4HIDA 1CKMA 1LLRD 2E2IB 4I65A 4GS3A 3BYYB 2E75C 1PZKD 1F77A 1P16A 2XVSA 1I6HH 4TQUS 1F9PA 1GO3E 4GLAC 3G6EA 2AUKA 4TRDA 1MGSA 1RCVD 2H4OA 2LXKA 1KRTA 3HOWB 2YU9B 2JA6G 2I5LX 4DV6Q 1HUMA 3VR2A 3H6MA 3OTOQ 1ZXTA 1EY8A 2PZUA 4DUZQ 4IO9A 4HN7A 3T16A 2B63G 1YNJD 2NYZD 3H0GH 1DOLA 3L9AX 5CGKA 1LM0A 1VMPA 3W1BA 1VDZA 1AE3A 4OWTB 3MFYA 1F9RA 5EKIA 3MC0B 4UHVA 2RQXA 1EQRA 3K5MA 4ZKCB 4OO1I 3H94A 1GOZA 5C4JB 1N33Q 3NTHA 1Q1BA 1KAWA 3ZYYX 4KJNA 4DV7Q 3A8KE 2KEEA 4BXXH 3RMHA 1X56A 3CW2C 4KV6A 1IBML 3GTOB 3J80E 4C3IH 1S4ZA 3SE0A 1G51A 1Y1WB 2KHSA 3ERSX 2CQOA 4A3MH 4YCUA 4BS9A 2JA8G 3MXNA 4IUQA 1KNEA 1CA5A 2NZOA 2Q2HA 2K14A 2EIFA 1U0LA 2EYJA 3P75A 1X54A 5M9OA 4KKTA 2KQ3A 1WYDA 3MFGA 1GUWA 1JOKA 2KBNA 1SYGA 4X3UA 5C44H 4LFBQ 4XQQA 2A5HA 3S16H 1JWSD 1WTQA 2K5QA 1K83H 4DK6C 2BDOA 4POGA 3CAMA 4H13C 5FJ8G 4KD4A 1T9HA 4DN4M 1FVIA 1PYBA 3PO2B 2VB2X 3PUVA 2I07B 1PRTD 4IPHA 4A3FG 2YYZA 2KHIA 1SXTA 3GDEA 4DV6L 4DR1Q 1F2YA 1SMXA 2NTSA 5GAHC 4IFDH 5FOBB 2JEBI 3PUXA 3EQLC 3DXJC 5COYA 2R92H 1UEBA 3OTOL 1EYAA 2KCTA 3S1RB 4WRDA 3CPWA 1WTOA 1CZGA 4APVA 3FPUB 3KYHC 4GZYC 1FD7D 1PTOD 3OMCA 4HMIA 5A2QL 1STYA 3HOVG 1I50H 2JA6B 1OTCA 2CCZA 2Q2TA 4L5SA 2B2YC 3M4PA 3VDYA 1Q8IA 2VUMH 2EY5A 5ELEA 1V8QA 1HTPA 2K5NA 3KUPA 1PH2A 2PI2A 5IOCA 2HHHQ 2D2CC 1N33L 1I94Q 3MEFA 1LV9A 2ZTCA 2GA4B 2B63B 1QUQA 2K5WA 2A68C 3PV0A 1JCKB 1EIHA 2PNRC 4KD3A 2Q2UA 2CH4W 2PQAB 2Z4IA 3L3OC 4OWWB 4LK1C 2RKSA 1DCZA 4AH6A 5D65A 1PZJD 1LTBD 4DAVA 2BOSA 3Q0AA 2PW7A 3FPPA 4P71A 1WTPA 2E5LQ 4IUVA 5IYBH 2ZTEA 3HOZH 4OWXB 3ZJYC 2V1CC 4JBJA 1BCPC 1PXUA 2CVRA 4C3JH 1LT4D 3SK4A 4OEMB 3TP8A 3VR5A 1MKHA 4LFBL 3PUZA 4BBRH 1F2MA 3K0YA 5M5YH 5M5WH 4PQXA 5M3MG 2F0QA 1TY0A 1RL2A 4A3CH 1K28A 1ASYA 4RG1A 3OYYA 2JA8B 4OX9Q 2AQ3B 1Y1VH 4DV1Q 1AZQA 2JE6I 2Z4HA 2XN9C 4DUYQ 5IGFA 1FNWA 2JA9A 3CC7A 3UDFA 3ITPA 1VQ8A 1B7YB 2PI2E 4K14A 1NJIC 4A3JH 1IYJB 4DR1L 2ENBA 3NHHA 1XTDA 4QF4A 3FDTA 3VR6A 2B2WC 2WIIB 4IPGA 4EQPA 3G6JB 2F0SA 3G48A 4Q0FA 3HOXG 2RSNA 3TN2A 4LF6Q 1H95A 1M4VA 2KJXA 3BYTB 2QCPX 3M4QA 2F0PA 4EX5A 5AFWA 3R2TA 2WKCA 2EY2A 4FNFA 4RGMA 4A3FB 2Q8IB 3CCVA 1L1OC 1II3A 1MHWC 4K6LA 3TQYA 4FDBA 3KLWA 4A76A 4YIJA 2I5HA 3GP7A 3J7ZC 1IW7D 4DV5Q 2HHHL 5FLMH 5IP7H 3GTMH 1XNQQ 3W2DA 1I94L 2JJQA 4K5VA 1A2TA 4N8X1 4ZKBB 1KIXA 4GKKQ 2F4IA 5DAUA 1WD0A 4JG2A 5DM73 3ICEA 4QIWE 5J22A 5I9OA 2UXDQ 2B2TC 4Y7NH 4A3KH 1X3FA 1PDQA 1QG7A 5CR3A 2E5LL 1YJNA 1AEXA 2A73B 1JE4A 3L0OA 3M9BA 5DLQE 4DF7A 1LT5D 1QZHA 1EU4A 1I6VC 1HRJA 2JA5G 4PG3A 5IE8A 4KKSA 1RDPD 4JI5Q 5C0XH 3ULJA 1K0RA 4RAUC 5C3EG 4XT1B 1I3QH 1QE6A 4TSSA 2P5ZX 3T1YL 1KRSA 2NZHA 1S72A 2HUGA 5FLXL 5J1ZA 1HCZA 2L9HA 2G9HD 4MZ9A 4K6DA 4OX9L 4DR4Q 3QG1A 2EYOA 4WJ3M 4DV1L 1SMYD 3AU7A 3NWTA 1BCPB 4DUYL 2QEXA 2NN6G 2QEJC 5E4WC 2Q2IA 4ZAIA 3CCEA 4HJ5A 1JJ2A 2XIWA 4HTHA 2OEOA 5M3MB 1AP0A 4L6TB 3QIAA 5EPJA 2N49A 1BR9A 1JWMD 4DU9A 4LF6L 4HCSA 4BY7H 1IZ6A 3CHBD 2KHJA 2WAQE 3J7AF 4BA2I 3F8TA 3HG9A 1N36Q 4LJZC 3KLRA 1WOCA 4DA2A 3CF5A 4CDEC 3RNUA 4UP7A 4IUPA 3NBHB 1GKHA 2ID0A 3HOXB 3RLFA 1YNND 2F52A 2CW0D 5D3DA 1OXSC 1SJHD 1V9PA 4A3DG 2B2UA 1K8AC 1SE2A 2A74C 1ILQA 4GKKL 2MNAA 1KLGD 3PSIA 1HR0Q 3GTPH 1K73C 1P8LA 2UXDL 5C3EH 2JA7G 2L4NA 2XWJB 2OQ0A 3H15A 2NTTA 3T4AC 2ICIA 1UE5A 2K33A 4JVZA 4B3RQ 1Q8KA 3C46A 3TREA 1AN8A 3BVMA 1PFSA 2F0HA 4DR7Q 1CTMA 4JI5L 3HKZG 4DV4Q 4OIKA 5E1FA 1VCIA 1DJRD 1WVLA 1HXYD 1PFMA 1IKLA 4RHSA 3WDNA 5NUCA 4DXFA 4FXGC 3T56B 1C8CA 1I4QA 4DR4L 5IT9c 3J81c 3S17B 2MO0A 3W5OA 4A93G 1ZYRC 3U9SA 3K5NA 1N8RC 4MIUA 5FKAC 5K36G 1G2TA 5HGTA 2R61A 2WV6D 2K5DA 2MO1A 4RKBA 1BUVT 1X3QA 1BQQT 3UE0A 1N34Q 4QMGA 1MIUA 1PH5A 4C2MB 1KHIA 2PO4A 1EY6A 1WJJA 2K5VA 1TS2A 1VF7A 2AKWB 4JOIC 1N36L 1C7YA 3A54A 4L8JA 1LUZA 3FKIG 4IURA 3J80i 1D7QA 4NXNQ 3C1EA 3RLNA 4C56C 1J6QA 2Z8LA 4PMBA 1SNMA 2FMMA 5ELCA 3M3YH 1NSNS 1GHJA 4QUCA 4O0AA 1HR0L 3MA2B 1VQ5A 3G71A 2NVQH 3I4NH 3NP8A 3PCOB 4ZK9B 1K3RA 5CORA 5EPLA 1A3UA 1ET9A 4FF1A 2KCNA 3E9IA 2LY7A 1FNVA 3ND8A 1FNUA 1W6JA 4LWCA 2F0UA 1TS3A 4B3RL 1WD1A 3HOUH 3I90A 4A3DB 5GQOA 2KCMA 4X66Q 3CCLA 2UUAQ 4DR7L 1OXXK 2K50A 1I4GA 3GTGH 4ALPA 1EY7A 2JA7B 2IW3A 5K36H 1IHZA 1Y8PB 4XT3B 1HNXQ 4DV4L 4LF5Q 4HMJA 1A0IA 5D3IB 3K7AH 1ML0D 4NKLA 1DM0B 3AFPA 3OW7A 2FJ2A 2WFWA 3L7ZC 3RR5A 1YITA 1H9KA 3GV6A 2ZXRA 1JWUD 3LGJA 3PF4A 1CM9A 4OHJA 5IP9G 2BE5D 2MQHA 2NVYH 3HKZB 4ULLA 3KF6B 1NBWA 4K2KA 5CV5A 5HY6A 1N34L 4R8IA 5TSSA 1QILA 2QGQA 1KAAA 1WCMH 1BCPF 2MGSA 1TWCB 3PUWA 3NUCA 4JI3L 1QNUA 1E1TA 4PNYA 2E2HB 3AQQA 4XQNA 4A93B 3CCMA 1HR0W 5IY0A 1EFWA 5IYDH 1BNZA 1HNZQ 4DR5Q 3HOWG 2JYOA 4NXNL 1Q7YC 4ZLTF 3TDQA 4M1UB 3OW2A 3S1QB 3JC66 1QWYA 1LYLA 5M5XH 1ESRA 3K8AA 2F0MA 4CBVA 3DWAA 1RHPA 4XYOA 2F03A 3FKIB 2A8VA 1QB5D 3U50C 1U4MA 1TWGB 1UE6A 1PLFA 5CV8A 1LTRD 4E6IA 1FJGQ 1S5FD 2K28A 2N8NA 1XX8A 4X66L 1EEFD 5CV9A 2UUAL 3K0XA 2A6EC 5C0XI 1LTAD 1SYEA 2EJGC 3I70A 5F2DA 1HNXL 4LF5L 4QUFA 2E2IH 1TWHB 4IPCA 4MTKA 3OSOA 4GKJQ 1MI2A 1QJOA 2Y0SG 1IBLQ 3STBC 1XWEA 3CCJA 4DR3Q 4CKEA 3S9WA 1QCBD 4YHHL 1MJEA 5GAEC 2CQAA 2B2YA 1STHA 1CFMA 2B29A 2YU9H 4X3KA 4ABNA 3CC4A 1D6EC 3K6OA 3PQIA 1R9TB 1SE8A 5FO8B 3KJPA 4HJAA 1JJGA 2FINB 4LMQD 4B3SQ 2JEAI 1B3AA 5I2YA 1HNZL 4DR5L 2HCCA 4DKAC 3ND9A 4V190 2SEBD 4DAPA 3TBIB 2AWNA 2PZTA 4RH6A 2EYLA 5LMNQ 3HKSA 3S1MB 1Y8NB 4B3TQ 4ME5A 3BZCA 3OPOA 1I5FA 1S40A 1JMCA 4A3BH 5C4JH 5C4XG 1CKNA 2AQ2B 3U4VA 2EZVA 1J8IA 2SOBA 2NVTB 1HNWQ 2VW9A 3OWEB 1F2LA 1Q1EA 3K57A 4B08A 1B70B 5FLXE 4JI8Q 4BY1G 1V1PB 5JJKA 3GTOH 3ERQA 4QJFA 2D62A 3MZ5A 4JBWA 1FJGL 4L5RC 1Y1WH 3J7AV 2ZXOA 5BR8L 1GUNA 1VQPA 1W2BA 2DNCA 2K5HA 2XWBB 4F87A 3CP0A 3FRPB 5IODA 3P7JA 1SE3A 4EGVA 1X55A 4ZUIA 2MUYA 2J0TD 3CMAA 1JORA 1AFPA 3NBHA 4HIMA 3SHLA 3TEHB 4BBSB 5EKKA 2PNHA 1N9WA 4OL7A 2IX3A 1B50A 2B2WA 2K52A 4PMCA 4DFAA 4GKJL 5DNFA 1WTXA 2KVMA 3A0JA 1IBLL 1LTGD 2RCNA 4DR3L 1YNJC 1EEID 1L1OA 3T13A 3PO2H 1B53A 3AMUA 4IALA 1IYUA 2ICEC 3K59A 2EOTA 3R8BA 3EA6A 1Q90A 3G7LA 2Y0SB 4K5XA 1I4HA 3S1RH 2BDNA 1B3QA 1EWIA 1MD2D 2O2LD 4IUNA 1EQVA 4B3SL 2F0IA 3RUZA 5K5PA 3SGIA 2F1MA 1TS5A 2B2TA 1Y69U 3FHWA 3TRZA 5KGUA 2JA6H 4UPAA 3EJIA 5KNDA 1RJTA 3NTKA 5EAYA 3PIOA 1SFOB 1XTCD 5LMNL 4KN7C 3EROA 1EOTA 4LW1A 4B3TL 4ZYSA 3NQTA 5I2XA 3H3VC 1G91A 3TP6A 1AH9A 1U9RA 1Q12A 2B63H 5G3LF 1RIPA 3S1NB 1K8OA 5EBDA 1HNWL 4A75A 3MTSA 4OXPA 4JI8L 3S15B 1FR3A 1O80A 1ET6A 1DXMA 4IPDA 1GJXA 3QOLA 5T1GA 3BS1A 1EIYB 1EWHA 1O78A 4A3EG 3CU7A 4KY5A 5C4XB 1PH6A 4X65Q 1H9RA 5JEAJ 1MSHA 1XMQL 4BY1B 1CI3M 3I56A 4OONA 2ZT9C 5JPNC 4MNOA 4QGUA 1PYWD 1SROA 3C3LA 4MTNA 2JA8H 1PTOC 2KUMA 3RN5A 3GD7A 3OWFA 3J81j 2KECA 4ILWA 1KTKA 5ISRA 1VQ7A 2F0DA 2L55A 4RWSC 3JAMc 1PMRA 1L0YB 2KENA 5IT9L 2ES2A 2LXJA 1QOHA 4YWKA 3J81L 2A68D 3KLSA 1T5EA 1X32A 4EQOA 2X69A 4YWLA 5LMNW 3U9OA 1GHKA 3BJUA 1XYIA 5FO9B 2XSCA 4XIGS 1H9SB 4ME3A 1PZID 5FJ8H 3H3VH 1GD7A 1TQOA 1DD2A 1FL0A 2AHOB 1BXTA 5JAVA 1GVPA 1E2WA 1EOVA 3HRZC 4A3FH 2I46A 3I91A 1CK1A 3C1FA 5L37A 3T1HQ 2D0PA 1XPOA 3LWEA 4QL5A 3T1YQ 4EVOA 5JVH3 2F4VQ 1U4RA 2RHQB 4Q5VA 1KXLA 2QF7A 1YZ6A 1QZGA 4JI6Q 3MHBA 1RF2D 1BF4A 3HOVH 1YBYA 3KF6A 5FK9C 2EPBA 5T1IA 3CC2A 2Z1CA 1Z6HA 2F0GA 1W6KA 4P73A 4PZ7A 2EE1A 4CKBA 2VUMB 1T5XD 1TKWB 1CQVA 3N6RA 5KYLA 4NP5A 3KJOA 1IL8A 4HEDA 1SE4A 4J8QA 2RDGA 1DOKA 3TZDA 3VR3A 1JQYD 1PFBA 3B6YA 2M00A 4IUUA 1I4PA 3K5LA 4X65L 4RA8A 1CZWA 2WKDA 3E3XA 1S5CD 1NR2A 4DAYB 2EY1A 1E2ZA 2WB1G 1IBKQ 1WTWA 3PO3G 3S2DB 1CSPA 1B1ZA 4JOIA 4A3EB 1YVCA 4X3TA 3HOZB 1SN8A 3UI2A 1OXVA 1PRTB 5C3XA 1VQMA 4JPBW 2F3IA 1SNDA 4DNRB 3CQZB 1EQTA 4V0BA 1IW7C 4BBRB 5M3MH 3HKZE 4DNTB 3L2PA 2HIVA 1EWCA 1KLUD 4QQBX 1VQIA 1PTOB 2BA0A 3P1HA 3TP5A 1VS0A 1TR5A 1Z9FA 4LNQA 3HZXA 1SEBD 3KDFA 1K3BC 2QA4A 3T1HL 1B9MA 2OXPA 1PH8A 2PMZB 1X3EA 1SSOA 2GVBA 2E2JB 1TWAB 3HOXH 2F4VL 2A6HC 5ELDA 3LWUA 1M90C 2ATWA 4H7BA 4RCNA 3I2ZA 4JI6L 3C2PA 1GXDC 3D4WA 5KNCA 1A2UA 2L1BA 4RKLA 4EQNA 2UUBQ 4RGNA 3F2CA 3S14B 1ONLA 3U58A 3GTJB 1SNCA 2M9VA 5ELNA 1L0WA 2DN8A 2WINB 3A5UA 1SMYC 2NB0A 2KA7A 4DR6Q 1PH7A 1U5KA 3VA5A 1STAA 4R4QA 2ZJQA 4N8FA 1WI5A 1LT6D 1K8GA 3R3OA 3GTKB 1W3SA 4UDUC 1IBKL 1E24A 3GV3A 1STEA 2AMCB 3P20A 1XPUA 1DOMA 3DEPA 3OIQA 1A15A 1JC7A 2R7ZG 2O5IC 2QW7A 3IL8A 4RGOS 2VY3A 5KNBA 2GN5A 4A3GG 1S3OA 3S17H 4IFDJ 2JA5H 3VYTA 5LL6S 5M3FG 1VMCA 3K5OA 1X65A 4U68A 2WACA 4OO1G 1V1PA 1D2BA 1XJVA 3QR8A 4P2CB 3GTQB 4L5QA 1WTVA 2WB1B 3PO3B 1EYDA 1Q46A 1YNNC 5DM63 2R93G 2CW0C 4DGZA 4AQYQ 4C3HG 4GOPB 1HQRD 1XMOQ 4C2MH 3QWNA 2DY7A 4KHZA 5BN3A 2NN6H 3KK7A 4JI1Q 2QILA 1D8LA 4H0LC 2NVXB 2K1BA 2VXWA 1SDFA 1ZEQX 1HFGA 1HTLD 3H09A 4J6HA 1CHQD 4PMWA 3GTLB 1K8MA 4U673 4NDXA 4PV1C 1SJED 3K58A 4DV2Q 3I4MG 1SYDA 2HDMA 1PH4A 1D5MC 4G7HC 3I73A 1JT8A 3F2DA 2UUBL 5GAGC 3PGZA 1NAPA 1O7YA 3NPPA 5IYCG 4KTAA 2F0LA 4R9WA 3IKJA 4CJ0B 2B8GA 2H1EA 3PIPA 1IYVA 3SDZA 1X3GA 1SAPA 2F0VA 2B2VA 2E8GA 1EY4A 4YCVA 1DGSA 1TVXA 4A3IG 5I6WA 4DR6L 4A3DH 1D5XC 2XTIA 4NPSA 3D4DA 1VQBA 2F0KA 5LHY1 4JI3Q 1N32Q 3NTIA 1C0AA 3CKIB 4LFCL 2DJGC 2A69D 3PIO3 1A62A 5FO7B 1M8AA 2JA7H 4HCEA 3MXGA 3X3MA 3M4OH 1D1KA 2IWHA 3RZDB 1HFNA 4RHRA 4CJ2C 4ZUJA 1ENAA 4L63B 3W3AA 2BA1A 4GN3B 5IGCA 3AYHB 4J15A 5ELBA 1MSGA 4QCLA 4YY3Q 5C5MA 2MP1A 1OO9B 1WFQA 4IZ8A 2K32A 1UUPA 5IWAQ 3NELA 2EYMA 4AQYL 2R7ZB 1XMOL 2WAQG 3H3VI 2CWPA 2A1AA 2F0FA 4A3GB 3RZOB 1TS4A 2IPKD 4CJ1B 1TWCH 1LTID 4PZ8A 5M3FB 2E2HH 2BH2A 1TWFB 4LF9Q 4A93H 4YCWA 1UAPA 4JI1L 3SXHA 5IGGA 2RVLA 1HZCA 5A35A 2R93B 2CHBD 2IY5B 3S1QH 4C3HB 5AJ3Q 1PTOF 1U4PA 3HP3A 1STNA 4DV2L 5KEEA 5A2QE 4A3LG 4DR2Q 2K05A 5JEAG 2PQAA 4YHHQ 3EBEA 3FKIH 3S2HH 4BWGB 4G7OC 3VYRA 3EVQA 3E0EA 1Z7TA 1TWGH 1BBUA 5DEHA 3MXPA 5C0XJ 1H9SA 1A3TA 5CC4A 5C3WA 2B3GA 4QY7A 2BH8A 1VQAA 1J5EQ 3A8JE 2PQEA 3I4MB 4S3SA 1Y8OB 4JW0A 3V05A 2G5DA 1N32L 1YHAA 3HOYG 3PF5A 4QIWB 5IT9E 3J81E 2BE5C 1ESFA 3SK8A 1PH1A 2DY8A 3MWYW 1YHBA 2X6GA 2F0TA 1CUKA 1TWHH 3D6CA 5IIFA 3G4SA 3CCUA 4JC0A 3KFUA 2F0NA 4A3IB 4FF3A 3E6ZX 2ZJRA 3KOJA 1VQ4A 3K80C 2TMPA 4YY3L 5HGQA 5CMDA 5JOBA 4B9WA 1E7ZA 4BBSG 1ENFA 5IWAL 2HDLA 3HGBA 1EY0A 3LX0A 3Q23A 1NMFA 4QB4A 3I3CA 4AYBG 3JAML 5CV7A 3OOCA 5BR8Q 2OCEA 1UWVA 3DLLA 1YI2A 4LF9L 1DONA 4TVAB 1SR3A 2NZ1D 1O7IA 3KF8B 4DAYA 5IP9H 3D3RA 2IX1A 4M8AA 4H44C 3BDOA 4IJHA 4X64Q 4K0KQ 4K8IA 2GVAA 1SRUA 5AJ3L 1O7ZA 2B8FA 2WAQB 3S1MH 3HEJA 4OGQC 3CXCA 1O7LA 1PYSB 3QOJA 2B2VC 1DZ1A 4DR2L 4IOCA 5KYIA 1G291 2NVTH 3HOWH 2HT1A 5EGTA 1D5ZC 3J80c 4J1MA 3IFTA 5BN4A 1J5EL 3CD6A 2MHVA 4ZCKA 4RGTA 1G2SA 3SK6A 5CBAE 5GADC 4F8MA 2K4KA 1EL0A 2VB3X 3NXWA 4P74A 5JJIA 3QO2A 5CV6A 3M7GA 1QVFA 3H0GG 3MEHA 4BBSH 1DYQA 1B4OA 1QNKA 2UXCQ 2SDFA 4JCVE 4JI4Q 2TSSA 1FYCA 3Q24A 1GUOA 4NMZA 2B39A 3WOEA 3CMEA 2Z6BA 3HOYB 3IAYA 3VYSA 1C48A 2ZM6Q 3E5SA 2WP8J 2E2DC 1XXGA 1LACA 2OQKA 1TU2B 1G6PA 3DUZA 5EBCA 1ENCA 1PV4A 4BXXG 3R2IA 4GNXB 2MJ8A 2R7DA 4JI2Q 3I4OA 4NW2A 4C3IG 4IN3A 5E4XA 2NN6I 1S5BD 4A3MG 4JBMA 1E2VA 1EU3A 1AE2A 5CV4A 4X64L 1XMQQ 4K0KL 1SFOH 1BOSA 4YWMA 4R4TA 2UU9L 2JN4A 3RLOA 1GUGA 4AYBB 5C44G 2C35B 1EYGA 1IKMA 3NBIA 3KBXA 4ZRZA 2PMZE 2MFIA 2LS01 1HZ9A 1VQEA 1I4RA 4JI7Q 3Q22A 2KOLA 4LUOA 4GLXA 3S1NH 4CKCA 3MVVA 3OMGA 2YTXA 1HA6A 5D14A 3I55A 3R93A 3S15H 2G9DA 2QKIC 4GOPA 3A7LA 3A8IE 1VQOA 4IQZA 3CCRA 1SYBA 4IFDG 4FXDA 4LF7Q 4CDDC 4O1NA 1EUJA 2R92G 4KN4C 4ZQ3A 3FMCA 2N3SA 4N9TA 5JJLA 1CSQA 1I6HB 3BG3A 5C4XH 2RA4A 4A3BB 2VNUD 5JJZA 4KMUC 3TMEA 2ZJPA 4HSVA 3BZDB 4BY1H 4JI0Q 2UXCL 2D9UA 1VF5C 3N52A 4JI4L 1RTNA 4WJ4A 2Z6KC 1AZPA 2VUMG 4NXMQ 4UP9A 2FHTA 1KDAA 2YTYA 1VQFA 3BDLA 2ZM6L 1KNAA 2ZXPA 3WOFA 3DMUA 3PIP3 3H0GB 1NR4A 4HAEA 2HQLA 5IGEA 2L5TA 1J9OA 4PZ6A 1BKBA 3S24A 2WB1E 4RMFA 4JI2L 1KQSA 2ZTDA 1TY2A 3I72A 4F7XA 5IYBG 1B2TA 1EFID 2HIXA 3D4RA 3HOZG 3RN2A 1PRTC 3A74A 4C3JG 1Q3LA 1HZBA 1VQJA 1H9JA 5BN5A 1ICWA 4I7AA 4CDCC 3A5ZB 2Z0SA 4H02A 4BBRG 1NTGA 2F3WA 1A63A 3V96A 3KLSX 4C3IB 1I4XA 4DNIA 2SNSA 4A3CG 3DM1A 1V43A 1RODA 4LF4Q 4A3MB 4KY7A 4Z9CB 4DUZL 3MXUA 4JI7L 3WWVA 1Y1VG 2PW5A 2EY6A 2M2LA 1V1OA 1LO5D 4LAAA 5E3FA 1NY4A 1X3PA 4R4OA 4G4KA 2Q8TA 4A3JG 5C44B 2EJMA 3Q8DA 4FF2A 1B44D 3S16B 4KLKA 4LF7L 2VL6A 2EJFC 1K83B 3UDXA 4G57A 2L11A 2EXDA 3FP9A 2K75A 2F3VA 4DV7L 2OWOA 1BCPD 5KRUA 2VQEQ 4JI0L 4NB3A 2EDGA 4JYAQ 3S2DH 3NENA 4NXML 5GROA 1KC8C 2R92B 2HQEA 1EY5A 3D0FA 3EIVA 3TS0A 4A3EH 5FLMG 5IP7G 1HQMC 5JVG3 1OXTA 4FVMA 2OTJA 5LL6X 1UNSA 2JXMB 4ODGA 2SNMA 1K0SA 1I50B 3ULLA 3PMFA 1VQCA 3CQZH 3ULPA 3J7YW 3MAQA 1VQKA 3T53B 4A3KG 1A8VA 1F2ZA 1JR0D 3I4LA 3URYA 2FMCA 1PTOH 2AWOA 1YEZA 3ER0A 2IX0A 2FFKB 2N78A 2F0WA 4KKUA 3BU2A 1ZKOA 1BO0A 3SEBA 2D0OA 3SVMA
chains in the Genus database with same CATH topology
5C0XG 1TT2A 5CBEE 3GQBA 1WTRA 4RCOA 3FEWX 2XRQD 4C1NK 2IL8A 3LNNA 1F9QA 4C3JB 1CHPD 2N88A 3TP7A 2J4XA 3A55A 5M5YB 5M5WB 1NUCA 2K04A 2HCIA 2O5JC 3KF8A 4XDXA 1Y1VB 4WFN3 2JP1A 2EXZA 4C1NI 5C4ZA 3I8ZA 4X3SA 3HOVB 2L0CA 4G7ZC 3JAME 4A3JB 4FF4A 4DXGA 1C4QA 2A6HD 3HS0C 1SNOA 1LABA 1AW7A 4KK7A 3SR1A 1TIID 5EPKA 4DK1A 2F0EA 5EQ0A 1UEAB 3GTMB 1EY9A 2EYFA 1JICA 1PFNA 2LMCB 3CRLC 1BDOA 2E76C 1BBXC 5J39A 4Y7NB 4A3KB 5EJWA 2C9OA 2E74C 1STGA 1EYCA 3D31A 1RTOA 1JB3A 4O42A 1Z47A 4FYDA 3O13A 3NWSA 1KDBA 3OHXC 3M85A 1I3QB 4N9PA 4KHVA 1HA5A 5C5LA 3J80L 1ILPA 2NWGA 1GUTA 3F2UA 3DWQA 1G8ZD 1R4PB 2C5CA 2K6AA 2N55A 1D1IA 4K8JA 2KEDA 4BY7B 4XXEA 1STBA 4OIJA 1KDCA 1JOOA 4TKOB 2O4XA 1EZ6A 5EKLA 2NUCA 4WJWA 1H9MA 5I4DA 1ZYRD 5G3LD 4B9XA 3A7AB 1SBBB 2PCFB 1S5ED 3EFXD 3NE5B 4MN3A 4K2LA 2JA5B 1B9NA 4OO1H 2RBMA 1A6XA 3GTPB 3D8GA 2F0OA 5C3EB 2PYKA 1OXUA 4IFDI 4WORA 5JPMC 2JSOA 1RKNA 3M4YA 3DWPA 3KBGA 2R3ZA 2OF1A 4KY6A 4KJOA 3DEOA 2K03A 2R6GA 3D6WA 2A69C 4MHEA 3DHQA 2BCOA 2OT2A 5IGDA 4CGYB 2RDHA 3H91A 1HPCA 4HR7B 2K01A 1CA6A 1R4QB 2EVBA 2X6LA 4BA1I 1MBYA 1RD9D 3TZUA 1E0BA 1PRTF 2L12A 5I9PA 2KCCA 2J7ZA 1FGBD 1LT3D 2EYPA 3E0JA 2K7VA 3OIPA 3NSWA 4FP5D 2NBFA 3VR4A 3BVGA 1G6ZA 4FO2A 3QJYA 2AQ1B 1HHVA 3PUYA 1EZ8A 3RD4A 1SYCA 3M4OB 1NCVA 1U4LA 3ONAB 1SNPA 5C4HA 5I6YA 2F0JA 3BDCA 3CRKC 4DK0A 3M7NA 3M3YB 4IUTA 1HUNA 3T51B 1EIGA 2NVQB 3I4NB 3VA7A 5CYUA 4JK1C 3VYUA 3NQIA 1A3VA 3HOUB 4RFBA 3A56A 1F9SA 1CQFA 2B2UC 3GTGB 3V2TA 4K5WA 1LTTD 5C6AA 3K7AB 4UAIA 1KABA 2QDBA 2RSOA 3QB3A 2PPBC 4ID6A 3GO5A 5JEAH 3NK9A 2XRSD 5HURA 3S2HB 2DNEA 2A6ED 2NVYB 2IJ0A 1WCMB 1LTSD 3BVZA 3X3NA 5IGBA 2RDFA 5ELFA 3TSSA 4CHTB 2EYHA 4F88A 4HSPA 5M5XB 1S5DD 4I7ZC 5KIXA 2AUJD 4KI0A 1L0XB 3AB9A 3IFDA 3SK5A 2IT1A 4R8NA 4XQJA 2D5DA 1CT1D 1JOQA 1GUSA 2LKVA 3FVQA 1SNQA 3Q6SA 2XNAC 1SYFA 2PZWA 4FXKC 4XYQA 2Q8RE 2V4DA 2MPMA 2LFNA 4XTCS 1LLRD 2E2IB 4I65A 3BYYB 2E75C 1PZKD 1F77A 2XVSA 4TQUS 1F9PA 2AUKA 4TRDA 1MGSA 1RCVD 2H4OA 3HOWB 2YU9B 1HUMA 3VR2A 3H6MA 1ZXTA 1EY8A 2PZUA 4HN7A 3T16A 1YNJD 2NYZD 1DOLA 3L9AX 5CGKA 1VMPA 1VDZA 3MFYA 1F9RA 5EKIA 3MC0B 2RQXA 3K5MA 4ZKCB 4OO1I 3H94A 1GOZA 5C4JB 3NTHA 1Q1BA 3ZYYX 4KJNA 3A8KE 2KEEA 3RMHA 4KV6A 3GTOB 3J80E 1S4ZA 3SE0A 1Y1WB 2KHSA 4BS9A 3MXNA 4IUQA 1KNEA 1CA5A 5M9OA 3P75A 2EYJA 4KKTA 2KQ3A 3MFGA 1GUWA 1JOKA 1SYGA 4X3UA 4XQQA 2A5HA 1JWSD 1WTQA 2K5QA 2BDOA 4H13C 4KD4A 4DN4M 3PO2B 2VB2X 3PUVA 2I07B 1PRTD 2YYZA 1SXTA 1F2YA 2NTSA 4IFDH 5FOBB 2JEBI 3PUXA 3EQLC 3DXJC 5COYA 1EYAA 3S1RB 4WRDA 1WTOA 1CZGA 3FPUB 4GZYC 1FD7D 1PTOD 3OMCA 4HMIA 5A2QL 1STYA 2JA6B 2B2YC 1Q8IA 2EY5A 5ELEA 1V8QA 1HTPA 3KUPA 5IOCA 2D2CC 1LV9A 2B63B 2GA4B 2K5WA 2A68C 3PV0A 1JCKB 1EIHA 2PNRC 4KD3A 2Z4IA 3L3OC 4LK1C 2RKSA 1DCZA 5D65A 1PZJD 1LTBD 4DAVA 2BOSA 3Q0AA 2PW7A 3FPPA 1WTPA 4IUVA 1BCPC 1PXUA 2CVRA 1LT4D 3SK4A 3TP8A 3VR5A 3PUZA 1F2MA 3K0YA 4PQXA 2F0QA 1TY0A 2JA8B 2AQ3B 1AZQA 2JE6I 2Z4HA 2XN9C 5IGFA 1FNWA 3ITPA 4K14A 2ENBA 3NHHA 4QF4A 3FDTA 3VR6A 2B2WC 2WIIB 4EQPA 3G6JB 2F0SA 4Q0FA 2RSNA 3TN2A 1M4VA 2KJXA 3BYTB 2QCPX 2F0PA 5AFWA 3R2TA 2WKCA 2EY2A 4FNFA 4RGMA 4A3FB 2Q8IB 1II3A 4K6LA 4YIJA 3GP7A 1IW7D 3W2DA 4K5VA 1A2TA 4ZKBB 2F4IA 5DAUA 1WD0A 5DM73 5J22A 5I9OA 2B2TC 1PDQA 1QG7A 5CR3A 1AEXA 2A73B 1JE4A 4DF7A 1LT5D 1EU4A 1I6VC 1HRJA 4KKSA 1RDPD 5C0XH 4RAUC 4XT1B 4TSSA 1QE6A 2HUGA 5FLXL 5J1ZA 1HCZA 2L9HA 2G9HD 4K6DA 3QG1A 2EYOA 1SMYD 3AU7A 3NWTA 1BCPB 2NN6G 2QEJC 5E4WC 4ZAIA 2XIWA 4HTHA 2OEOA 5M3MB 1AP0A 4L6TB 3QIAA 5EPJA 1BR9A 1JWMD 4DU9A 4HCSA 3CHBD 3J7AF 4BA2I 3HG9A 4LJZC 3KLRA 4DA2A 4IUPA 2ID0A 3HOXB 3RLFA 1YNND 2CW0D 5D3DA 1OXSC 1SJHD 2B2UA 1SE2A 2A74C 1ILQA 1KLGD 2L4NA 2XWJB 2NTTA 3T4AC 2ICIA 2K33A 3C46A 1AN8A 3BVMA 2F0HA 1CTMA 4OIKA 5E1FA 1VCIA 1DJRD 1WVLA 1HXYD 1PFMA 1IKLA 4RHSA 3WDNA 5NUCA 4DXFA 4FXGC 3T56B 1C8CA 1I4QA 3S17B 1ZYRC 3U9SA 3K5NA 4MIUA 5FKAC 5K36G 1G2TA 5HGTA 2R61A 2WV6D 2K5DA 4RKBA 1BUVT 1X3QA 1BQQT 4QMGA 4C2MB 2PO4A 1EY6A 1TS2A 1VF7A 3A54A 4L8JA 4IURA 3C1EA 4C56C 2Z8LA 4PMBA 1SNMA 2FMMA 5ELCA 1NSNS 1GHJA 4QUCA 3MA2B 3NP8A 4ZK9B 5CORA 5EPLA 1A3UA 1ET9A 4FF1A 2KCNA 2LY7A 1FNVA 3ND8A 1FNUA 1W6JA 2F0UA 1TS3A 1WD1A 3I90A 4A3DB 1OXXK 1I4GA 1EY7A 2JA7B 2IW3A 5K36H 1IHZA 1Y8PB 4XT3B 4HMJA 5D3IB 1ML0D 4NKLA 1DM0B 3OW7A 2FJ2A 3L7ZC 1H9KA 3GV6A 2ZXRA 1JWUD 1CM9A 4OHJA 2BE5D 3HKZB 4ULLA 4K2KA 5CV5A 4R8IA 5TSSA 1QILA 1KAAA 1BCPF 2MGSA 1TWCB 3PUWA 3NUCA 1QNUA 4PNYA 2E2HB 4XQNA 4A93B 1BNZA 2JYOA 4ZLTF 3TDQA 4M1UB 3S1QB 1QWYA 1ESRA 2F0MA 4CBVA 3DWAA 1RHPA 4XYOA 2F03A 3FKIB 1QB5D 1U4MA 1TWGB 1PLFA 5CV8A 1LTRD 4E6IA 1S5FD 2K28A 1XX8A 1EEFD 5CV9A 2A6EC 5C0XI 1LTAD 1SYEA 2EJGC 3I70A 5F2DA 4QUFA 1TWHB 3OSOA 1MI2A 1QJOA 1XWEA 4CKEA 3S9WA 1QCBD 2CQAA 2B2YA 1STHA 1CFMA 4X3KA 4ABNA 1D6EC 3K6OA 1R9TB 5FO8B 2FINB 4LMQD 2JEAI 1B3AA 5I2YA 2HCCA 3ND9A 4V190 2SEBD 4DAPA 3TBIB 2AWNA 2PZTA 4RH6A 2EYLA 3S1MB 1Y8NB 4ME5A 3OPOA 2AQ2B 2EZVA 1J8IA 2SOBA 2NVTB 3OWEB 1F2LA 1Q1EA 3K57A 4B08A 5FLXE 1V1PB 3ERQA 2D62A 3MZ5A 4JBWA 3J7AV 2ZXOA 1GUNA 2DNCA 2XWBB 4F87A 5IODA 3FRPB 3P7JA 1SE3A 4EGVA 4ZUIA 2MUYA 2J0TD 1JORA 1AFPA 3NBHA 3SHLA 4BBSB 5EKKA 4OL7A 2IX3A 1B50A 2B2WA 4PMCA 4DFAA 5DNFA 1WTXA 2KVMA 1LTGD 1YNJC 1EEID 3T13A 1B53A 3AMUA 4IALA 1IYUA 2ICEC 3K59A 2EOTA 3R8BA 3EA6A 1Q90A 3G7LA 2Y0SB 4K5XA 1I4HA 2BDNA 2O2LD 1MD2D 4IUNA 1EQVA 2F0IA 3RUZA 5K5PA 2F1MA 1TS5A 2B2TA 1Y69U 5KGUA 5KNDA 3EJIA 1RJTA 3NTKA 1SFOB 1XTCD 4KN7C 3EROA 1EOTA 4ZYSA 3NQTA 5I2XA 3H3VC 1G91A 3TP6A 1U9RA 1Q12A 5G3LF 3S1NB 1K8OA 5EBDA 3MTSA 3S15B 1FR3A 1O80A 1ET6A 1DXMA 1GJXA 3QOLA 5T1GA 3BS1A 1EWHA 1O78A 3CU7A 4KY5A 5C4XB 1H9RA 5JEAJ 1MSHA 4BY1B 1CI3M 2ZT9C 5JPNC 1PYWD 3C3LA 1PTOC 2KUMA 3GD7A 3OWFA 2KECA 4ILWA 1KTKA 5ISRA 2F0DA 2L55A 4RWSC 1PMRA 1L0YB 5IT9L 1QOHA 3J81L 2A68D 3KLSA 1T5EA 1X32A 4EQOA 2X69A 3U9OA 1GHKA 1XYIA 5FO9B 2XSCA 4XIGS 1H9SB 1PZID 1TQOA 1DD2A 1BXTA 5JAVA 1E2WA 3HRZC 2I46A 3I91A 1CK1A 3C1FA 3LWEA 4EVOA 5JVH3 1U4RA 4Q5VA 2QF7A 3MHBA 1RF2D 1BF4A 5FK9C 2EPBA 5T1IA 2Z1CA 1Z6HA 2F0GA 1W6KA 2EE1A 4CKBA 2VUMB 1T5XD 1TKWB 1CQVA 3N6RA 5KYLA 4NP5A 1IL8A 4HEDA 1SE4A 4J8QA 2RDGA 1DOKA 3TZDA 3VR3A 1JQYD 1PFBA 2M00A 4IUUA 1I4PA 3K5LA 4RA8A 1CZWA 2WKDA 1S5CD 1NR2A 2EY1A 1E2ZA 3S2DB 1WTWA 1B1ZA 4A3EB 4X3TA 3HOZB 3UI2A 1OXVA 1PRTB 5C3XA 1SNDA 4DNRB 3CQZB 1EQTA 4V0BA 1IW7C 4BBRB 4DNTB 1EWCA 1KLUD 1PTOB 2BA0A 3P1HA 3TP5A 1TR5A 3HZXA 1SEBD 1B9MA 2OXPA 2PMZB 2E2JB 1SSOA 1TWAB 2A6HC 5ELDA 3LWUA 4H7BA 4RCNA 3C2PA 1GXDC 3D4WA 5KNCA 1A2UA 2L1BA 4RKLA 4EQNA 4RGNA 3S14B 1ONLA 3GTJB 1SNCA 2M9VA 2DN8A 2WINB 1SMYC 2NB0A 2KA7A 3VA5A 1STAA 1LT6D 3GTKB 3R3OA 4UDUC 3GV3A 1STEA 3P20A 1DOMA 3DEPA 3OIQA 1A15A 1JC7A 2O5IC 3IL8A 4RGOS 5KNBA 4IFDJ 3VYTA 5LL6S 1VMCA 3K5OA 4U68A 4OO1G 2WACA 1D2BA 1V1PA 3GTQB 4P2CB 1WTVA 2WB1B 3PO3B 1EYDA 1YNNC 5DM63 2CW0C 4DGZA 4C3HG 1HQRD 3QWNA 2DY7A 4KHZA 5BN3A 2NN6H 3KK7A 2QILA 4H0LC 2NVXB 2K1BA 2VXWA 1SDFA 1ZEQX 1HFGA 1HTLD 3H09A 4J6HA 1CHQD 4PMWA 3GTLB 1K8MA 4U673 4NDXA 4PV1C 1SJED 3K58A 1SYDA 2HDMA 1D5MC 4G7HC 3I73A 1NAPA 1O7YA 3NPPA 4KTAA 2F0LA 4R9WA 3IKJA 4CJ0B 2B8GA 2H1EA 1IYVA 3SDZA 1SAPA 2F0VA 2B2VA 1EY4A 1TVXA 5I6WA 1D5XC 3D4DA 5LHY1 2F0KA 3NTIA 3CKIB 2A69D 3PIO3 5FO7B 1M8AA 4HCEA 3MXGA 3X3MA 1D1KA 2IWHA 3RZDB 1HFNA 4RHRA 4CJ2C 4ZUJA 1ENAA 4L63B 3W3AA 2BA1A 5IGCA 5ELBA 1MSGA 4QCLA 5C5MA 2MP1A 1OO9B 4IZ8A 2K32A 1UUPA 2EYMA 2R7ZB 4A3GB 3RZOB 2F0FA 1TS4A 2IPKD 4CJ1B 1LTID 5M3FB 1TWFB 1UAPA 3SXHA 5IGGA 2RVLA 5A35A 2R93B 2CHBD 4C3HB 1PTOF 1U4PA 3HP3A 1STNA 5KEEA 5A2QE 2K05A 5JEAG 4BWGB 4G7OC 3VYRA 3EVQA 1Z7TA 5DEHA 3MXPA 5C0XJ 1H9SA 1A3TA 5CC4A 5C3WA 3A8JE 2PQEA 3I4MB 4S3SA 1Y8OB 3V05A 4QIWB 5IT9E 3J81E 2BE5C 1ESFA 3SK8A 2DY8A 3MWYW 2X6GA 2F0TA 3D6CA 5IIFA 2F0NA 4A3IB 4FF3A 3E6ZX 2TMPA 5CMDA 5JOBA 4B9WA 1ENFA 2HDLA 3HGBA 1EY0A 3LX0A 3Q23A 4QB4A 3I3CA 3JAML 5CV7A 3OOCA 1DONA 2NZ1D 4DAYA 3D3RA 2IX1A 4M8AA 4H44C 3BDOA 4K8IA 1O7ZA 2B8FA 2WAQB 3HEJA 4OGQC 1O7LA 3QOJA 2B2VC 1DZ1A 5KYIA 1G291 5EGTA 1D5ZC 4J1MA 3IFTA 5BN4A 2MHVA 4RGTA 1G2SA 3SK6A 5CBAE 4F8MA 1EL0A 2VB3X 3NXWA 3QO2A 5CV6A 3M7GA 3MEHA 1DYQA 1B4OA 1QNKA 2SDFA 2TSSA 1FYCA 3Q24A 1GUOA 4NMZA 2B39A 3WOEA 3HOYB 3IAYA 3VYSA 1C48A 3E5SA 2WP8J 2E2DC 1XXGA 1LACA 1TU2B 3DUZA 5EBCA 1ENCA 3R2IA 2MJ8A 4NW2A 4C3IG 4IN3A 5E4XA 2NN6I 1S5BD 1E2VA 1EU3A 5CV4A 1BOSA 1GUGA 4AYBB 1IKMA 3NBIA 3KBXA 4ZRZA 2LS01 1I4RA 3Q22A 2KOLA 4CKCA 3MVVA 3OMGA 1HA6A 5D14A 3R93A 2G9DA 2QKIC 3A7LA 3A8IE 4IQZA 1SYBA 4IFDG 4FXDA 4O1NA 4KN4C 4ZQ3A 3FMCA 4N9TA 1I6HB 3BG3A 2RA4A 4A3BB 2VNUD 5JJZA 4KMUC 3TMEA 4HSVA 3BZDB 2D9UA 1VF5C 3N52A 1RTNA 1AZPA 2FHTA 1KDAA 3BDLA 1KNAA 2ZXPA 3WOFA 3DMUA 3PIP3 3H0GB 1NR4A 4HAEA 5IGEA 2L5TA 1J9OA 1TY2A 3I72A 4F7XA 1B2TA 1EFID 3D4RA 1PRTC 4C3JG 1Q3LA 1H9JA 5BN5A 1ICWA 2F3WA 3V96A 3KLSX 4C3IB 1I4XA 2SNSA 3DM1A 1V43A 1RODA 4A3MB 4Z9CB 4KY7A 3MXUA 2PW5A 2EY6A 2M2LA 1V1OA 1LO5D 4LAAA 5E3FA 1X3PA 4G4KA 2Q8TA 5C44B 2EJMA 4FF2A 1B44D 3S16B 2EJFC 1K83B 4G57A 2L11A 2F3VA 1BCPD 5KRUA 2EDGA 2R92B 2HQEA 1EY5A 1HQMC 5JVG3 1OXTA 4FVMA 5LL6X 1UNSA 2JXMB 4ODGA 2SNMA 1I50B 3PMFA 3J7YW 3MAQA 3T53B 1F2ZA 1JR0D 3I4LA 3URYA 2FMCA 1PTOH 2AWOA 2IX0A 2FFKB 2F0WA 4KKUA 1ZKOA 1BO0A 3SEBA 3SVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNT B;  5C0X G;  1GUN A;  1H9S A;  1VF7 A;  2DNC A;  1Q1B A;  2L5T A;  1K8M A;  1FYC A;  2KCC A;  4PV1 C;  1GUO A;  3A8K E;  3GD7 A;  2NN6 G;  3A8J E;  2BA0 A;  3GQB A;  3M85 A;  1Y8O B;  4L8J A;  3VR5 A;  4G7H C;  3I73 A;  2K7V A;  3PUZ A;  1PMR A;  3I72 A;  2BE5 C;  4I7Z C;  3D4R A;  3QIA A;  2AUJ D;  3SE0 A;  1GUT A;  2A68 D;  3LNN A;  3VR4 A;  4KI0 A;  1LAC A;  1T5E A;  1B9M A;  1TU2 B;  3IKJ A;  3AB9 A;  3QJY A;  2B8G A;  1H9J A;  5BN5 A;  1IYV A;  1GHK A;  4BA2 I;  3PUY A;  3SDZ A;  2IT1 A;  2JE6 I;  1GHJ A;  2A6H C;  3LWU A;  2D5D A;  4XIG S;  4LJZ C;  1H9S B;  4RCN A;  4KKT A;  3KLR A;  2A6E C;  1YNJ C;  1DD2 A;  2EJG C;  1V43 A;  2NN6 I;  1E2W A;  1GUS A;  5KNC A;  2O5J C;  2A69 D;  3MXU A;  3CRK C;  3VR6 A;  1IYU A;  1E2V A;  3ND8 A;  4DK0 A;  3RLF A;  3M7N A;  1ONL A;  4TKO B;  2BDO A;  1OXS C;  3T51 B;  1Q90 A;  4H13 C;  4G7Z C;  1QJO A;  3VA7 A;  3HGB A;  2DN8 A;  1H9M A;  1OXX K;  1GUG A;  2QF7 A;  1SMY C;  2EJM A;  2V4D A;  3W3A A;  2KA7 A;  2BA1 A;  3PUV A;  3OOC A;  4XTC S;  2F1M A;  3A7A B;  2YYZ A;  4JK1 C;  2Q8I B;  2EJF C;  1Y69 U;  1Y8P B;  5K36 H;  1CFM A;  2E75 C;  2PCF B;  5KND A;  4IFD H;  2A6H D;  1Z6H A;  2JEB I;  3EQL C;  3DXJ C;  3PUX A;  3NE5 B;  1IW7 D;  1B9N A;  2K33 A;  3OW7 A;  4H44 C;  4OO1 H;  4KN7 C;  3BDO A;  1TKW B;  2K32 A;  3N6R A;  3P20 A;  4TQU S;  3L7Z C;  1A6X A;  1LAB A;  2AUK A;  2EDG A;  4GZY C;  3A7L A;  2O5I C;  1H9K A;  2B8F A;  5KNB A;  4DK1 A;  3A8I E;  1OXU A;  1CTM A;  4IQZ A;  3VR3 A;  2JEA I;  4OGQ C;  1O7L A;  4IFD G;  1Q12 A;  3M4Y A;  2BE5 D;  4KN4 C;  1K8O A;  3FMC A;  3ND9 A;  1V8Q A;  4OO1 G;  1HQM C;  1VCI A;  3BG3 A;  1OXT A;  1HTP A;  2R6G A;  4KMU C;  1FR3 A;  1DXM A;  3VR2 A;  2A69 C;  2PPB C;  1G29 1;  2LMC B;  1E2Z A;  3CRL C;  3WDN A;  2JXM B;  5JEA H;  1YNN C;  2D2C C;  3T56 B;  5A35 A;  1GJX A;  1BDO A;  2CW0 C;  1Y8N B;  1VF5 C;  3IFT A;  2E76 C;  1I6V C;  2DNE A;  3PUW A;  1EWH A;  1O78 A;  2A6E D;  5BN4 A;  3T53 B;  4KKS A;  3OPO A;  2A68 C;  3PV0 A;  1HPC A;  4HR7 B;  2PNR C;  5C0X H;  1ZYR C;  2EVB A;  3U9S A;  2E74 C;  4KHZ A;  3I4L A;  4BA1 I;  4LK1 C;  5BN3 A;  1DCZ A;  5K36 G;  1VDZ A;  1OXV A;  2NN6 H;  1H9R A;  1Q1E A;  2AWO A;  3D31 A;  5JEA G;  3MFY A;  4H0L C;  1CI3 M;  3TZU A;  4G7O C;  3FPP A;  4KKU A;  4DNR B;  2ZT9 C;  1ZKO A;  1HCZ A;  2D62 A;  3H94 A;  4JBW A;  1IW7 C;  1Z7T A;  3QG1 A; 
#chains in the Genus database with same CATH topology
 5C0X G;  1TT2 A;  5CBE E;  4KHP Q;  1VQD A;  4LFA Q;  2E2J H;  3GQB A;  1WTR A;  3UE1 A;  1TWA H;  3CCS A;  4GOP C;  5J3B A;  4RCO A;  3J81 i;  1MJC A;  3FEW X;  4LF4 L;  4HIK A;  1PH3 A;  2CWA A;  1EQQ A;  2XRQ D;  4C1N K;  2IL8 A;  4POF A;  1JB7 A;  3LNN A;  1F9Q A;  4GLV B;  4C3J B;  1UE7 A;  1KD1 C;  1CHP D;  1LTL A;  2N88 A;  3S14 H;  3W1G A;  4LUV A;  3GTJ H;  3TP7 A;  2J4X A;  4X62 Q;  3A55 A;  4DV3 Q;  1BBW A;  5M5Y B;  5M5W B;  1NUC A;  2K04 A;  2HCI A;  4HJ7 A;  2O5J C;  4BY7 G;  3KF8 A;  4XDX A;  1Y1V B;  4WFN 3;  2QDL A;  2JP1 A;  1V1Q A;  2EXZ A;  2RCF A;  4C1N I;  2I0Q A;  4R4I A;  5E7N A;  5C4Z A;  3GTK H;  3I8Z A;  1YJ9 A;  4X3S A;  3HOV B;  2VQE L;  2L0C A;  4G7Z C;  4JYA L;  4OEL B;  3JAM E;  4A3J B;  4FF4 A;  4IOA A;  4DXG A;  1C4Q A;  4X6A H;  3K7U C;  2A6H D;  1HH2 P;  3HS0 C;  3UDI A;  3GTQ H;  1LAB A;  1SNO A;  1AW7 A;  4KK7 A;  3SR1 A;  1TII D;  3PO3 H;  4IJL A;  5EPK A;  4DK1 A;  2F0E A;  1M1K C;  5EQ0 A;  1UEA B;  2RF4 A;  3GTM B;  1EY9 A;  2EYF A;  1JIC A;  1PFN A;  2LMC B;  3CRL C;  4LFC Q;  1BDO A;  2NVX H;  2E76 C;  1CKN B;  1BBX C;  5J39 A;  4Y7N B;  4KHP L;  4A3K B;  1NMG A;  4LFA L;  5EJW A;  2C9O A;  2E74 C;  1STG A;  3GTL H;  1EYC A;  3I7F A;  1QVC A;  3D31 A;  1RTO A;  1JB3 A;  1E3P A;  4O42 A;  1Z47 A;  3BZK A;  5LMU Q;  4FYD A;  3O13 A;  3NWS A;  2VS1 A;  3AFQ A;  1WTH A;  1Q86 C;  1Y14 B;  1KDB A;  3NEM A;  4GNX A;  3OHX C;  4X62 L;  3M85 A;  1I3Q B;  4DV3 L;  4N9P A;  1SLJ A;  4KHV A;  1HA5 A;  5C5L A;  4DV5 L;  1XNQ L;  3J80 L;  3K81 C;  1QVG A;  2NWG A;  1ILP A;  1GUT A;  3F2U A;  1XNR Q;  2R7F A;  1PA6 A;  4R4C A;  4LF8 Q;  3DWQ A;  1G8Z D;  1R4P B;  3RZD H;  2C5C A;  1L1O B;  2K6A A;  1Q81 C;  2N55 A;  1D1I A;  5H1S E;  4K8J A;  3CCQ A;  2KED A;  4BY7 B;  2CFM A;  4XXE A;  1STB A;  4OIJ A;  1KDC A;  1JOO A;  1E22 A;  4TKO B;  2O4X A;  1EZ6 A;  1VQL A;  5EKL A;  1YHQ A;  4DAM A;  3I4N G;  1VQG A;  3MXN B;  2NUC A;  2YTV A;  4WJW A;  2VQF Q;  1H9M A;  5I4D A;  4DV0 Q;  1ZYR D;  2CH4 A;  4JBK A;  2R7Z H;  5G3L D;  4B9X A;  3A7A B;  1SBB B;  1L2F A;  4GN5 A;  1NE3 A;  3RZO H;  2PCF B;  4A3G H;  1S5E D;  3J7A 5;  1UE1 A;  3HFZ B;  3HOU G;  3EFX D;  3NE5 B;  4MN3 A;  4K2L A;  5M3F H;  1B9N A;  2JA5 B;  1BVS A;  1TWF H;  4OO1 H;  1X9N A;  2RBM A;  1A6X A;  2DGY A;  3E9H A;  2JQO A;  3D8G A;  3GTP B;  2F0O A;  1HJP A;  4L5T A;  5C3E B;  2R93 H;  2PYK A;  1OXU A;  4DPG A;  4IFD I;  4WOR A;  2XGT A;  5JPM C;  1CKO A;  4AIM A;  4C3H H;  3TS2 A;  2JSO A;  2UUC Q;  2UXB Q;  1ICF B;  1RKN A;  3M4Y A;  4HJ9 A;  3DWP A;  3KBG A;  2R3Z A;  2OF1 A;  4KY6 A;  4KJO A;  2FXQ A;  3DEO A;  2K03 A;  2R6G A;  3D6W A;  4AYB E;  5LMU L;  2A69 C;  4MHE A;  2OTL A;  3DHQ A;  2BCO A;  2OT2 A;  2VZA A;  5IGD A;  4CGY B;  1GM5 A;  2RDH A;  3H91 A;  3UDG A;  1HPC A;  4HR7 B;  2K01 A;  1CA6 A;  1R4Q B;  4JV5 Q;  2EVB A;  4A4I A;  2X6L A;  4BA1 I;  4EQ5 A;  1MBY A;  1RD9 D;  1IL2 A;  3I4M H;  1YIJ A;  1WCM G;  3TZU A;  1E0B A;  1PRT F;  1XNR L;  2Y0S E;  4UP8 A;  2L12 A;  4LF8 L;  5I9P A;  5IYC H;  5IYD G;  2HD3 A;  2I5M X;  2KCC A;  1QUQ B;  2J7Z A;  1FGB D;  1LT3 D;  1VQ6 A;  2EYP A;  3E0J A;  1ASZ A;  2RHS B;  2K7V A;  3OIP A;  4Y52 H;  3NSW A;  4A3I H;  4FP5 D;  2NBF A;  3VR4 A;  3BVG A;  1IXR A;  4O2D A;  1PHJ A;  1G6Z A;  4FO2 A;  3QJY A;  2AQ1 B;  1HHV A;  3PUY A;  1EZ8 A;  1VQN A;  3RD4 A;  2VQF L;  1SYC A;  3M4O B;  4DV0 L;  1NCV A;  1U4L A;  3ONA B;  1VQ9 A;  2JK8 A;  1SNP A;  5C4H A;  5I6Y A;  2F0J A;  3BDC A;  1KL9 A;  3CRK C;  1E1O A;  4DK0 A;  2IHE A;  3M7N A;  3M3Y B;  4IUT A;  4B3M Q;  1FGU A;  1HUN A;  3T51 B;  1EIG A;  1XPR A;  2NVQ B;  3I4N B;  3VA7 A;  5ELO A;  5CYU A;  1JE5 A;  2H5X A;  4R1J A;  3U4Z A;  2UUC L;  2UXB L;  4JK1 C;  4GNX C;  2DJF C;  3VYU A;  3NQI A;  1A3V A;  3HOU B;  4RFB A;  1K9M C;  3A56 A;  1F9S A;  1PH9 A;  1YNX A;  2A19 A;  1CQF A;  2B2U C;  5FLX c;  3F2B A;  3GTG B;  1EIF A;  2L15 A;  2Z6K A;  3V2T A;  4K5W A;  1NNX A;  1LTT D;  5C6A A;  4P72 A;  4JV5 L;  3K7A B;  4UAI A;  1KAB A;  1Q82 C;  3IRB A;  1R9T H;  4LUZ A;  2QDB A;  2RSO A;  3QB3 A;  2PPB C;  4ID6 A;  4A3L H;  3GO5 A;  5JEA H;  3NK9 A;  2XRS D;  2ASB A;  3CPF A;  4GN4 B;  5HUR A;  4UY8 C;  3S2H B;  2DNE A;  2A6E D;  2NVY B;  1VQH A;  2IJ0 A;  1C9O A;  2LSS A;  2UU9 Q;  3EN2 A;  2CKZ B;  1WCM B;  1LTS D;  3HOY H;  1X6O A;  3BVZ A;  4A3B G;  3STB D;  4DK3 C;  1B8A A;  3X3N A;  5IGB A;  2RDF A;  5ELF A;  3F1Z A;  2Z9H A;  3TSS A;  3KDF B;  2ALY B;  1HZA A;  4CDF C;  4CHT B;  2EYH A;  4F88 A;  4HSP A;  5M5X B;  1S5D D;  4I7Z C;  5KIX A;  2AUJ D;  1Y1W G;  4B3M L;  4KI0 A;  1L0X B;  3AB9 A;  3IFD A;  3SK5 A;  2IHF A;  2DUD A;  2IT1 A;  1YJW A;  4R8N A;  4XQJ A;  2D5D A;  1CT1 D;  3DM3 A;  1PVO A;  1IBM Q;  4HIO A;  4HJ8 A;  1JJC B;  1JOQ A;  1GUS A;  2EQS A;  2LKV A;  3AEV A;  3FVQ A;  1SNQ A;  3Q6S A;  2XNA C;  1SYF A;  2PZW A;  3JAM i;  4FXK C;  4XYQ A;  4P75 A;  2YV5 A;  2Q8R E;  3PO2 G;  1TXY A;  2V4D A;  2MPM A;  2LFN A;  4XTC S;  4HID A;  1CKM A;  1LLR D;  2E2I B;  4I65 A;  4GS3 A;  3BYY B;  2E75 C;  1PZK D;  1F77 A;  1P16 A;  2XVS A;  1I6H H;  4TQU S;  1F9P A;  1GO3 E;  4GLA C;  3G6E A;  2AUK A;  4TRD A;  1MGS A;  1RCV D;  2H4O A;  2LXK A;  1KRT A;  3HOW B;  2YU9 B;  2JA6 G;  2I5L X;  4DV6 Q;  1HUM A;  3VR2 A;  3H6M A;  3OTO Q;  1ZXT A;  1EY8 A;  2PZU A;  4DUZ Q;  4IO9 A;  4HN7 A;  3T16 A;  2B63 G;  1YNJ D;  2NYZ D;  3H0G H;  1DOL A;  3L9A X;  5CGK A;  1LM0 A;  1VMP A;  3W1B A;  1VDZ A;  1AE3 A;  4OWT B;  3MFY A;  1F9R A;  5EKI A;  3MC0 B;  4UHV A;  2RQX A;  1EQR A;  3K5M A;  4ZKC B;  4OO1 I;  3H94 A;  1GOZ A;  5C4J B;  1N33 Q;  3NTH A;  1Q1B A;  1KAW A;  3ZYY X;  4KJN A;  4DV7 Q;  3A8K E;  2KEE A;  4BXX H;  3RMH A;  1X56 A;  3CW2 C;  4KV6 A;  1IBM L;  3GTO B;  3J80 E;  4C3I H;  1S4Z A;  3SE0 A;  1G51 A;  1Y1W B;  2KHS A;  3ERS X;  2CQO A;  4A3M H;  4YCU A;  4BS9 A;  2JA8 G;  3MXN A;  4IUQ A;  1KNE A;  1CA5 A;  2NZO A;  2Q2H A;  2K14 A;  2EIF A;  1U0L A;  2EYJ A;  3P75 A;  1X54 A;  5M9O A;  4KKT A;  2KQ3 A;  1WYD A;  3MFG A;  1GUW A;  1JOK A;  2KBN A;  1SYG A;  4X3U A;  5C44 H;  4LFB Q;  4XQQ A;  2A5H A;  3S16 H;  1JWS D;  1WTQ A;  2K5Q A;  1K83 H;  4DK6 C;  2BDO A;  4POG A;  3CAM A;  4H13 C;  5FJ8 G;  4KD4 A;  1T9H A;  4DN4 M;  1FVI A;  1PYB A;  3PO2 B;  2VB2 X;  3PUV A;  2I07 B;  1PRT D;  4IPH A;  4A3F G;  2YYZ A;  2KHI A;  1SXT A;  3GDE A;  4DV6 L;  4DR1 Q;  1F2Y A;  1SMX A;  2NTS A;  5GAH C;  4IFD H;  5FOB B;  2JEB I;  3PUX A;  3EQL C;  3DXJ C;  5COY A;  2R92 H;  1UEB A;  3OTO L;  1EYA A;  2KCT A;  3S1R B;  4WRD A;  3CPW A;  1WTO A;  1CZG A;  4APV A;  3FPU B;  3KYH C;  4GZY C;  1FD7 D;  1PTO D;  3OMC A;  4HMI A;  5A2Q L;  1STY A;  3HOV G;  1I50 H;  2JA6 B;  1OTC A;  2CCZ A;  2Q2T A;  4L5S A;  2B2Y C;  3M4P A;  3VDY A;  1Q8I A;  2VUM H;  2EY5 A;  5ELE A;  1V8Q A;  1HTP A;  2K5N A;  3KUP A;  1PH2 A;  2PI2 A;  5IOC A;  2HHH Q;  2D2C C;  1N33 L;  1I94 Q;  3MEF A;  1LV9 A;  2ZTC A;  2GA4 B;  2B63 B;  1QUQ A;  2K5W A;  2A68 C;  3PV0 A;  1JCK B;  1EIH A;  2PNR C;  4KD3 A;  2Q2U A;  2CH4 W;  2PQA B;  2Z4I A;  3L3O C;  4OWW B;  4LK1 C;  2RKS A;  1DCZ A;  4AH6 A;  5D65 A;  1PZJ D;  1LTB D;  4DAV A;  2BOS A;  3Q0A A;  2PW7 A;  3FPP A;  4P71 A;  1WTP A;  2E5L Q;  4IUV A;  5IYB H;  2ZTE A;  3HOZ H;  4OWX B;  3ZJY C;  2V1C C;  4JBJ A;  1BCP C;  1PXU A;  2CVR A;  4C3J H;  1LT4 D;  3SK4 A;  4OEM B;  3TP8 A;  3VR5 A;  1MKH A;  4LFB L;  3PUZ A;  4BBR H;  1F2M A;  3K0Y A;  5M5Y H;  5M5W H;  4PQX A;  5M3M G;  2F0Q A;  1TY0 A;  1RL2 A;  4A3C H;  1K28 A;  1ASY A;  4RG1 A;  3OYY A;  2JA8 B;  4OX9 Q;  2AQ3 B;  1Y1V H;  4DV1 Q;  1AZQ A;  2JE6 I;  2Z4H A;  2XN9 C;  4DUY Q;  5IGF A;  1FNW A;  2JA9 A;  3CC7 A;  3UDF A;  3ITP A;  1VQ8 A;  1B7Y B;  2PI2 E;  4K14 A;  1NJI C;  4A3J H;  1IYJ B;  4DR1 L;  2ENB A;  3NHH A;  1XTD A;  4QF4 A;  3FDT A;  3VR6 A;  2B2W C;  2WII B;  4IPG A;  4EQP A;  3G6J B;  2F0S A;  3G48 A;  4Q0F A;  3HOX G;  2RSN A;  3TN2 A;  4LF6 Q;  1H95 A;  1M4V A;  2KJX A;  3BYT B;  2QCP X;  3M4Q A;  2F0P A;  4EX5 A;  5AFW A;  3R2T A;  2WKC A;  2EY2 A;  4FNF A;  4RGM A;  4A3F B;  2Q8I B;  3CCV A;  1L1O C;  1II3 A;  1MHW C;  4K6L A;  3TQY A;  4FDB A;  3KLW A;  4A76 A;  4YIJ A;  2I5H A;  3GP7 A;  3J7Z C;  1IW7 D;  4DV5 Q;  2HHH L;  5FLM H;  5IP7 H;  3GTM H;  1XNQ Q;  3W2D A;  1I94 L;  2JJQ A;  4K5V A;  1A2T A;  4N8X 1;  4ZKB B;  1KIX A;  4GKK Q;  2F4I A;  5DAU A;  1WD0 A;  4JG2 A;  5DM7 3;  3ICE A;  4QIW E;  5J22 A;  5I9O A;  2UXD Q;  2B2T C;  4Y7N H;  4A3K H;  1X3F A;  1PDQ A;  1QG7 A;  5CR3 A;  2E5L L;  1YJN A;  1AEX A;  2A73 B;  1JE4 A;  3L0O A;  3M9B A;  5DLQ E;  4DF7 A;  1LT5 D;  1QZH A;  1EU4 A;  1I6V C;  1HRJ A;  2JA5 G;  4PG3 A;  5IE8 A;  4KKS A;  1RDP D;  4JI5 Q;  5C0X H;  3ULJ A;  1K0R A;  4RAU C;  5C3E G;  4XT1 B;  1I3Q H;  1QE6 A;  4TSS A;  2P5Z X;  3T1Y L;  1KRS A;  2NZH A;  1S72 A;  2HUG A;  5FLX L;  5J1Z A;  1HCZ A;  2L9H A;  2G9H D;  4MZ9 A;  4K6D A;  4OX9 L;  4DR4 Q;  3QG1 A;  2EYO A;  4WJ3 M;  4DV1 L;  1SMY D;  3AU7 A;  3NWT A;  1BCP B;  4DUY L;  2QEX A;  2NN6 G;  2QEJ C;  5E4W C;  2Q2I A;  4ZAI A;  3CCE A;  4HJ5 A;  1JJ2 A;  2XIW A;  4HTH A;  2OEO A;  5M3M B;  1AP0 A;  4L6T B;  3QIA A;  5EPJ A;  2N49 A;  1BR9 A;  1JWM D;  4DU9 A;  4LF6 L;  4HCS A;  4BY7 H;  1IZ6 A;  3CHB D;  2KHJ A;  2WAQ E;  3J7A F;  4BA2 I;  3F8T A;  3HG9 A;  1N36 Q;  4LJZ C;  3KLR A;  1WOC A;  4DA2 A;  3CF5 A;  4CDE C;  3RNU A;  4UP7 A;  4IUP A;  3NBH B;  1GKH A;  2ID0 A;  3HOX B;  3RLF A;  1YNN D;  2F52 A;  2CW0 D;  5D3D A;  1OXS C;  1SJH D;  1V9P A;  4A3D G;  2B2U A;  1K8A C;  1SE2 A;  2A74 C;  1ILQ A;  4GKK L;  2MNA A;  1KLG D;  3PSI A;  1HR0 Q;  3GTP H;  1K73 C;  1P8L A;  2UXD L;  5C3E H;  2JA7 G;  2L4N A;  2XWJ B;  2OQ0 A;  3H15 A;  2NTT A;  3T4A C;  2ICI A;  1UE5 A;  2K33 A;  4JVZ A;  4B3R Q;  1Q8K A;  3C46 A;  3TRE A;  1AN8 A;  3BVM A;  1PFS A;  2F0H A;  4DR7 Q;  1CTM A;  4JI5 L;  3HKZ G;  4DV4 Q;  4OIK A;  5E1F A;  1VCI A;  1DJR D;  1WVL A;  1HXY D;  1PFM A;  1IKL A;  4RHS A;  3WDN A;  5NUC A;  4DXF A;  4FXG C;  3T56 B;  1C8C A;  1I4Q A;  4DR4 L;  5IT9 c;  3J81 c;  3S17 B;  2MO0 A;  3W5O A;  4A93 G;  1ZYR C;  3U9S A;  3K5N A;  1N8R C;  4MIU A;  5FKA C;  5K36 G;  1G2T A;  5HGT A;  2R61 A;  2WV6 D;  2K5D A;  2MO1 A;  4RKB A;  1BUV T;  1X3Q A;  1BQQ T;  3UE0 A;  1N34 Q;  4QMG A;  1MIU A;  1PH5 A;  4C2M B;  1KHI A;  2PO4 A;  1EY6 A;  1WJJ A;  2K5V A;  1TS2 A;  1VF7 A;  2AKW B;  4JOI C;  1N36 L;  1C7Y A;  3A54 A;  4L8J A;  1LUZ A;  3FKI G;  4IUR A;  3J80 i;  1D7Q A;  4NXN Q;  3C1E A;  3RLN A;  4C56 C;  1J6Q A;  2Z8L A;  4PMB A;  1SNM A;  2FMM A;  5ELC A;  3M3Y H;  1NSN S;  1GHJ A;  4QUC A;  4O0A A;  1HR0 L;  3MA2 B;  1VQ5 A;  3G71 A;  2NVQ H;  3I4N H;  3NP8 A;  3PCO B;  4ZK9 B;  1K3R A;  5COR A;  5EPL A;  1A3U A;  1ET9 A;  4FF1 A;  2KCN A;  3E9I A;  2LY7 A;  1FNV A;  3ND8 A;  1FNU A;  1W6J A;  4LWC A;  2F0U A;  1TS3 A;  4B3R L;  1WD1 A;  3HOU H;  3I90 A;  4A3D B;  5GQO A;  2KCM A;  4X66 Q;  3CCL A;  2UUA Q;  4DR7 L;  1OXX K;  2K50 A;  1I4G A;  3GTG H;  4ALP A;  1EY7 A;  2JA7 B;  2IW3 A;  5K36 H;  1IHZ A;  1Y8P B;  4XT3 B;  1HNX Q;  4DV4 L;  4LF5 Q;  4HMJ A;  1A0I A;  5D3I B;  3K7A H;  1ML0 D;  4NKL A;  1DM0 B;  3AFP A;  3OW7 A;  2FJ2 A;  2WFW A;  3L7Z C;  3RR5 A;  1YIT A;  1H9K A;  3GV6 A;  2ZXR A;  1JWU D;  3LGJ A;  3PF4 A;  1CM9 A;  4OHJ A;  5IP9 G;  2BE5 D;  2MQH A;  2NVY H;  3HKZ B;  4ULL A;  3KF6 B;  1NBW A;  4K2K A;  5CV5 A;  5HY6 A;  1N34 L;  4R8I A;  5TSS A;  1QIL A;  2QGQ A;  1KAA A;  1WCM H;  1BCP F;  2MGS A;  1TWC B;  3PUW A;  3NUC A;  4JI3 L;  1QNU A;  1E1T A;  4PNY A;  2E2H B;  3AQQ A;  4XQN A;  4A93 B;  3CCM A;  1HR0 W;  5IY0 A;  1EFW A;  5IYD H;  1BNZ A;  1HNZ Q;  4DR5 Q;  3HOW G;  2JYO A;  4NXN L;  1Q7Y C;  4ZLT F;  3TDQ A;  4M1U B;  3OW2 A;  3S1Q B;  3JC6 6;  1QWY A;  1LYL A;  5M5X H;  1ESR A;  3K8A A;  2F0M A;  4CBV A;  3DWA A;  1RHP A;  4XYO A;  2F03 A;  3FKI B;  2A8V A;  1QB5 D;  3U50 C;  1U4M A;  1TWG B;  1UE6 A;  1PLF A;  5CV8 A;  1LTR D;  4E6I A;  1FJG Q;  1S5F D;  2K28 A;  2N8N A;  1XX8 A;  4X66 L;  1EEF D;  5CV9 A;  2UUA L;  3K0X A;  2A6E C;  5C0X I;  1LTA D;  1SYE A;  2EJG C;  3I70 A;  5F2D A;  1HNX L;  4LF5 L;  4QUF A;  2E2I H;  1TWH B;  4IPC A;  4MTK A;  3OSO A;  4GKJ Q;  1MI2 A;  1QJO A;  2Y0S G;  1IBL Q;  3STB C;  1XWE A;  3CCJ A;  4DR3 Q;  4CKE A;  3S9W A;  1QCB D;  4YHH L;  1MJE A;  5GAE C;  2CQA A;  2B2Y A;  1STH A;  1CFM A;  2B29 A;  2YU9 H;  4X3K A;  4ABN A;  3CC4 A;  1D6E C;  3K6O A;  3PQI A;  1R9T B;  1SE8 A;  5FO8 B;  3KJP A;  4HJA A;  1JJG A;  2FIN B;  4LMQ D;  4B3S Q;  2JEA I;  1B3A A;  5I2Y A;  1HNZ L;  4DR5 L;  2HCC A;  4DKA C;  3ND9 A;  4V19 0;  2SEB D;  4DAP A;  3TBI B;  2AWN A;  2PZT A;  4RH6 A;  2EYL A;  5LMN Q;  3HKS A;  3S1M B;  1Y8N B;  4B3T Q;  4ME5 A;  3BZC A;  3OPO A;  1I5F A;  1S40 A;  1JMC A;  4A3B H;  5C4J H;  5C4X G;  1CKN A;  2AQ2 B;  3U4V A;  2EZV A;  1J8I A;  2SOB A;  2NVT B;  1HNW Q;  2VW9 A;  3OWE B;  1F2L A;  1Q1E A;  3K57 A;  4B08 A;  1B70 B;  5FLX E;  4JI8 Q;  4BY1 G;  1V1P B;  5JJK A;  3GTO H;  3ERQ A;  4QJF A;  2D62 A;  3MZ5 A;  4JBW A;  1FJG L;  4L5R C;  1Y1W H;  3J7A V;  2ZXO A;  5BR8 L;  1GUN A;  1VQP A;  1W2B A;  2DNC A;  2K5H A;  2XWB B;  4F87 A;  3CP0 A;  3FRP B;  5IOD A;  3P7J A;  1SE3 A;  4EGV A;  1X55 A;  4ZUI A;  2MUY A;  2J0T D;  3CMA A;  1JOR A;  1AFP A;  3NBH A;  4HIM A;  3SHL A;  3TEH B;  4BBS B;  5EKK A;  2PNH A;  1N9W A;  4OL7 A;  2IX3 A;  1B50 A;  2B2W A;  2K52 A;  4PMC A;  4DFA A;  4GKJ L;  5DNF A;  1WTX A;  2KVM A;  3A0J A;  1IBL L;  1LTG D;  2RCN A;  4DR3 L;  1YNJ C;  1EEI D;  1L1O A;  3T13 A;  3PO2 H;  1B53 A;  3AMU A;  4IAL A;  1IYU A;  2ICE C;  3K59 A;  2EOT A;  3R8B A;  3EA6 A;  1Q90 A;  3G7L A;  2Y0S B;  4K5X A;  1I4H A;  3S1R H;  2BDN A;  1B3Q A;  1EWI A;  1MD2 D;  2O2L D;  4IUN A;  1EQV A;  4B3S L;  2F0I A;  3RUZ A;  5K5P A;  3SGI A;  2F1M A;  1TS5 A;  2B2T A;  1Y69 U;  3FHW A;  3TRZ A;  5KGU A;  2JA6 H;  4UPA A;  3EJI A;  5KND A;  1RJT A;  3NTK A;  5EAY A;  3PIO A;  1SFO B;  1XTC D;  5LMN L;  4KN7 C;  3ERO A;  1EOT A;  4LW1 A;  4B3T L;  4ZYS A;  3NQT A;  5I2X A;  3H3V C;  1G91 A;  3TP6 A;  1AH9 A;  1U9R A;  1Q12 A;  2B63 H;  5G3L F;  1RIP A;  3S1N B;  1K8O A;  5EBD A;  1HNW L;  4A75 A;  3MTS A;  4OXP A;  4JI8 L;  3S15 B;  1FR3 A;  1O80 A;  1ET6 A;  1DXM A;  4IPD A;  1GJX A;  3QOL A;  5T1G A;  3BS1 A;  1EIY B;  1EWH A;  1O78 A;  4A3E G;  3CU7 A;  4KY5 A;  5C4X B;  1PH6 A;  4X65 Q;  1H9R A;  5JEA J;  1MSH A;  1XMQ L;  4BY1 B;  1CI3 M;  3I56 A;  4OON A;  2ZT9 C;  5JPN C;  4MNO A;  4QGU A;  1PYW D;  1SRO A;  3C3L A;  4MTN A;  2JA8 H;  1PTO C;  2KUM A;  3RN5 A;  3GD7 A;  3OWF A;  3J81 j;  2KEC A;  4ILW A;  1KTK A;  5ISR A;  1VQ7 A;  2F0D A;  2L55 A;  4RWS C;  3JAM c;  1PMR A;  1L0Y B;  2KEN A;  5IT9 L;  2ES2 A;  2LXJ A;  1QOH A;  4YWK A;  3J81 L;  2A68 D;  3KLS A;  1T5E A;  1X32 A;  4EQO A;  2X69 A;  4YWL A;  5LMN W;  3U9O A;  1GHK A;  3BJU A;  1XYI A;  5FO9 B;  2XSC A;  4XIG S;  1H9S B;  4ME3 A;  1PZI D;  5FJ8 H;  3H3V H;  1GD7 A;  1TQO A;  1DD2 A;  1FL0 A;  2AHO B;  1BXT A;  5JAV A;  1GVP A;  1E2W A;  1EOV A;  3HRZ C;  4A3F H;  2I46 A;  3I91 A;  1CK1 A;  3C1F A;  5L37 A;  3T1H Q;  2D0P A;  1XPO A;  3LWE A;  4QL5 A;  3T1Y Q;  4EVO A;  5JVH 3;  2F4V Q;  1U4R A;  2RHQ B;  4Q5V A;  1KXL A;  2QF7 A;  1YZ6 A;  1QZG A;  4JI6 Q;  3MHB A;  1RF2 D;  1BF4 A;  3HOV H;  1YBY A;  3KF6 A;  5FK9 C;  2EPB A;  5T1I A;  3CC2 A;  2Z1C A;  1Z6H A;  2F0G A;  1W6K A;  4P73 A;  4PZ7 A;  2EE1 A;  4CKB A;  2VUM B;  1T5X D;  1TKW B;  1CQV A;  3N6R A;  5KYL A;  4NP5 A;  3KJO A;  1IL8 A;  4HED A;  1SE4 A;  4J8Q A;  2RDG A;  1DOK A;  3TZD A;  3VR3 A;  1JQY D;  1PFB A;  3B6Y A;  2M00 A;  4IUU A;  1I4P A;  3K5L A;  4X65 L;  4RA8 A;  1CZW A;  2WKD A;  3E3X A;  1S5C D;  1NR2 A;  4DAY B;  2EY1 A;  1E2Z A;  2WB1 G;  1IBK Q;  1WTW A;  3PO3 G;  3S2D B;  1CSP A;  1B1Z A;  4JOI A;  4A3E B;  1YVC A;  4X3T A;  3HOZ B;  1SN8 A;  3UI2 A;  1OXV A;  1PRT B;  5C3X A;  1VQM A;  4JPB W;  2F3I A;  1SND A;  4DNR B;  3CQZ B;  1EQT A;  4V0B A;  1IW7 C;  4BBR B;  5M3M H;  3HKZ E;  4DNT B;  3L2P A;  2HIV A;  1EWC A;  1KLU D;  4QQB X;  1VQI A;  1PTO B;  2BA0 A;  3P1H A;  3TP5 A;  1VS0 A;  1TR5 A;  1Z9F A;  4LNQ A;  3HZX A;  1SEB D;  3KDF A;  1K3B C;  2QA4 A;  3T1H L;  1B9M A;  2OXP A;  1PH8 A;  2PMZ B;  1X3E A;  1SSO A;  2GVB A;  2E2J B;  1TWA B;  3HOX H;  2F4V L;  2A6H C;  5ELD A;  3LWU A;  1M90 C;  2ATW A;  4H7B A;  4RCN A;  3I2Z A;  4JI6 L;  3C2P A;  1GXD C;  3D4W A;  5KNC A;  1A2U A;  2L1B A;  4RKL A;  4EQN A;  2UUB Q;  4RGN A;  3F2C A;  3S14 B;  1ONL A;  3U58 A;  3GTJ B;  1SNC A;  2M9V A;  5ELN A;  1L0W A;  2DN8 A;  2WIN B;  3A5U A;  1SMY C;  2NB0 A;  2KA7 A;  4DR6 Q;  1PH7 A;  1U5K A;  3VA5 A;  1STA A;  4R4Q A;  2ZJQ A;  4N8F A;  1WI5 A;  1LT6 D;  1K8G A;  3R3O A;  3GTK B;  1W3S A;  4UDU C;  1IBK L;  1E24 A;  3GV3 A;  1STE A;  2AMC B;  3P20 A;  1XPU A;  1DOM A;  3DEP A;  3OIQ A;  1A15 A;  1JC7 A;  2R7Z G;  2O5I C;  2QW7 A;  3IL8 A;  4RGO S;  2VY3 A;  5KNB A;  2GN5 A;  4A3G G;  1S3O A;  3S17 H;  4IFD J;  2JA5 H;  3VYT A;  5LL6 S;  5M3F G;  1VMC A;  3K5O A;  1X65 A;  4U68 A;  2WAC A;  4OO1 G;  1V1P A;  1D2B A;  1XJV A;  3QR8 A;  4P2C B;  3GTQ B;  4L5Q A;  1WTV A;  2WB1 B;  3PO3 B;  1EYD A;  1Q46 A;  1YNN C;  5DM6 3;  2R93 G;  2CW0 C;  4DGZ A;  4AQY Q;  4C3H G;  4GOP B;  1HQR D;  1XMO Q;  4C2M H;  3QWN A;  2DY7 A;  4KHZ A;  5BN3 A;  2NN6 H;  3KK7 A;  4JI1 Q;  2QIL A;  1D8L A;  4H0L C;  2NVX B;  2K1B A;  2VXW A;  1SDF A;  1ZEQ X;  1HFG A;  1HTL D;  3H09 A;  4J6H A;  1CHQ D;  4PMW A;  3GTL B;  1K8M A;  4U67 3;  4NDX A;  4PV1 C;  1SJE D;  3K58 A;  4DV2 Q;  3I4M G;  1SYD A;  2HDM A;  1PH4 A;  1D5M C;  4G7H C;  3I73 A;  1JT8 A;  3F2D A;  2UUB L;  5GAG C;  3PGZ A;  1NAP A;  1O7Y A;  3NPP A;  5IYC G;  4KTA A;  2F0L A;  4R9W A;  3IKJ A;  4CJ0 B;  2B8G A;  2H1E A;  3PIP A;  1IYV A;  3SDZ A;  1X3G A;  1SAP A;  2F0V A;  2B2V A;  2E8G A;  1EY4 A;  4YCV A;  1DGS A;  1TVX A;  4A3I G;  5I6W A;  4DR6 L;  4A3D H;  1D5X C;  2XTI A;  4NPS A;  3D4D A;  1VQB A;  2F0K A;  5LHY 1;  4JI3 Q;  1N32 Q;  3NTI A;  1C0A A;  3CKI B;  4LFC L;  2DJG C;  2A69 D;  3PIO 3;  1A62 A;  5FO7 B;  1M8A A;  2JA7 H;  4HCE A;  3MXG A;  3X3M A;  3M4O H;  1D1K A;  2IWH A;  3RZD B;  1HFN A;  4RHR A;  4CJ2 C;  4ZUJ A;  1ENA A;  4L63 B;  3W3A A;  2BA1 A;  4GN3 B;  5IGC A;  3AYH B;  4J15 A;  5ELB A;  1MSG A;  4QCL A;  4YY3 Q;  5C5M A;  2MP1 A;  1OO9 B;  1WFQ A;  4IZ8 A;  2K32 A;  1UUP A;  5IWA Q;  3NEL A;  2EYM A;  4AQY L;  2R7Z B;  1XMO L;  2WAQ G;  3H3V I;  2CWP A;  2A1A A;  2F0F A;  4A3G B;  3RZO B;  1TS4 A;  2IPK D;  4CJ1 B;  1TWC H;  1LTI D;  4PZ8 A;  5M3F B;  2E2H H;  2BH2 A;  1TWF B;  4LF9 Q;  4A93 H;  4YCW A;  1UAP A;  4JI1 L;  3SXH A;  5IGG A;  2RVL A;  1HZC A;  5A35 A;  2R93 B;  2CHB D;  2IY5 B;  3S1Q H;  4C3H B;  5AJ3 Q;  1PTO F;  1U4P A;  3HP3 A;  1STN A;  4DV2 L;  5KEE A;  5A2Q E;  4A3L G;  4DR2 Q;  2K05 A;  5JEA G;  2PQA A;  4YHH Q;  3EBE A;  3FKI H;  3S2H H;  4BWG B;  4G7O C;  3VYR A;  3EVQ A;  3E0E A;  1Z7T A;  1TWG H;  1BBU A;  5DEH A;  3MXP A;  5C0X J;  1H9S A;  1A3T A;  5CC4 A;  5C3W A;  2B3G A;  4QY7 A;  2BH8 A;  1VQA A;  1J5E Q;  3A8J E;  2PQE A;  3I4M B;  4S3S A;  1Y8O B;  4JW0 A;  3V05 A;  2G5D A;  1N32 L;  1YHA A;  3HOY G;  3PF5 A;  4QIW B;  5IT9 E;  3J81 E;  2BE5 C;  1ESF A;  3SK8 A;  1PH1 A;  2DY8 A;  3MWY W;  1YHB A;  2X6G A;  2F0T A;  1CUK A;  1TWH H;  3D6C A;  5IIF A;  3G4S A;  3CCU A;  4JC0 A;  3KFU A;  2F0N A;  4A3I B;  4FF3 A;  3E6Z X;  2ZJR A;  3KOJ A;  1VQ4 A;  3K80 C;  2TMP A;  4YY3 L;  5HGQ A;  5CMD A;  5JOB A;  4B9W A;  1E7Z A;  4BBS G;  1ENF A;  5IWA L;  2HDL A;  3HGB A;  1EY0 A;  3LX0 A;  3Q23 A;  1NMF A;  4QB4 A;  3I3C A;  4AYB G;  3JAM L;  5CV7 A;  3OOC A;  5BR8 Q;  2OCE A;  1UWV A;  3DLL A;  1YI2 A;  4LF9 L;  1DON A;  4TVA B;  1SR3 A;  2NZ1 D;  1O7I A;  3KF8 B;  4DAY A;  5IP9 H;  3D3R A;  2IX1 A;  4M8A A;  4H44 C;  3BDO A;  4IJH A;  4X64 Q;  4K0K Q;  4K8I A;  2GVA A;  1SRU A;  5AJ3 L;  1O7Z A;  2B8F A;  2WAQ B;  3S1M H;  3HEJ A;  4OGQ C;  3CXC A;  1O7L A;  1PYS B;  3QOJ A;  2B2V C;  1DZ1 A;  4DR2 L;  4IOC A;  5KYI A;  1G29 1;  2NVT H;  3HOW H;  2HT1 A;  5EGT A;  1D5Z C;  3J80 c;  4J1M A;  3IFT A;  5BN4 A;  1J5E L;  3CD6 A;  2MHV A;  4ZCK A;  4RGT A;  1G2S A;  3SK6 A;  5CBA E;  5GAD C;  4F8M A;  2K4K A;  1EL0 A;  2VB3 X;  3NXW A;  4P74 A;  5JJI A;  3QO2 A;  5CV6 A;  3M7G A;  1QVF A;  3H0G G;  3MEH A;  4BBS H;  1DYQ A;  1B4O A;  1QNK A;  2UXC Q;  2SDF A;  4JCV E;  4JI4 Q;  2TSS A;  1FYC A;  3Q24 A;  1GUO A;  4NMZ A;  2B39 A;  3WOE A;  3CME A;  2Z6B A;  3HOY B;  3IAY A;  3VYS A;  1C48 A;  2ZM6 Q;  3E5S A;  2WP8 J;  2E2D C;  1XXG A;  1LAC A;  2OQK A;  1TU2 B;  1G6P A;  3DUZ A;  5EBC A;  1ENC A;  1PV4 A;  4BXX G;  3R2I A;  4GNX B;  2MJ8 A;  2R7D A;  4JI2 Q;  3I4O A;  4NW2 A;  4C3I G;  4IN3 A;  5E4X A;  2NN6 I;  1S5B D;  4A3M G;  4JBM A;  1E2V A;  1EU3 A;  1AE2 A;  5CV4 A;  4X64 L;  1XMQ Q;  4K0K L;  1SFO H;  1BOS A;  4YWM A;  4R4T A;  2UU9 L;  2JN4 A;  3RLO A;  1GUG A;  4AYB B;  5C44 G;  2C35 B;  1EYG A;  1IKM A;  3NBI A;  3KBX A;  4ZRZ A;  2PMZ E;  2MFI A;  2LS0 1;  1HZ9 A;  1VQE A;  1I4R A;  4JI7 Q;  3Q22 A;  2KOL A;  4LUO A;  4GLX A;  3S1N H;  4CKC A;  3MVV A;  3OMG A;  2YTX A;  1HA6 A;  5D14 A;  3I55 A;  3R93 A;  3S15 H;  2G9D A;  2QKI C;  4GOP A;  3A7L A;  3A8I E;  1VQO A;  4IQZ A;  3CCR A;  1SYB A;  4IFD G;  4FXD A;  4LF7 Q;  4CDD C;  4O1N A;  1EUJ A;  2R92 G;  4KN4 C;  4ZQ3 A;  3FMC A;  2N3S A;  4N9T A;  5JJL A;  1CSQ A;  1I6H B;  3BG3 A;  5C4X H;  2RA4 A;  4A3B B;  2VNU D;  5JJZ A;  4KMU C;  3TME A;  2ZJP A;  4HSV A;  3BZD B;  4BY1 H;  4JI0 Q;  2UXC L;  2D9U A;  1VF5 C;  3N52 A;  4JI4 L;  1RTN A;  4WJ4 A;  2Z6K C;  1AZP A;  2VUM G;  4NXM Q;  4UP9 A;  2FHT A;  1KDA A;  2YTY A;  1VQF A;  3BDL A;  2ZM6 L;  1KNA A;  2ZXP A;  3WOF A;  3DMU A;  3PIP 3;  3H0G B;  1NR4 A;  4HAE A;  2HQL A;  5IGE A;  2L5T A;  1J9O A;  4PZ6 A;  1BKB A;  3S24 A;  2WB1 E;  4RMF A;  4JI2 L;  1KQS A;  2ZTD A;  1TY2 A;  3I72 A;  4F7X A;  5IYB G;  1B2T A;  1EFI D;  2HIX A;  3D4R A;  3HOZ G;  3RN2 A;  1PRT C;  3A74 A;  4C3J G;  1Q3L A;  1HZB A;  1VQJ A;  1H9J A;  5BN5 A;  1ICW A;  4I7A A;  4CDC C;  3A5Z B;  2Z0S A;  4H02 A;  4BBR G;  1NTG A;  2F3W A;  1A63 A;  3V96 A;  3KLS X;  4C3I B;  1I4X A;  4DNI A;  2SNS A;  4A3C G;  3DM1 A;  1V43 A;  1ROD A;  4LF4 Q;  4A3M B;  4KY7 A;  4Z9C B;  4DUZ L;  3MXU A;  4JI7 L;  3WWV A;  1Y1V G;  2PW5 A;  2EY6 A;  2M2L A;  1V1O A;  1LO5 D;  4LAA A;  5E3F A;  1NY4 A;  1X3P A;  4R4O A;  4G4K A;  2Q8T A;  4A3J G;  5C44 B;  2EJM A;  3Q8D A;  4FF2 A;  1B44 D;  3S16 B;  4KLK A;  4LF7 L;  2VL6 A;  2EJF C;  1K83 B;  3UDX A;  4G57 A;  2L11 A;  2EXD A;  3FP9 A;  2K75 A;  2F3V A;  4DV7 L;  2OWO A;  1BCP D;  5KRU A;  2VQE Q;  4JI0 L;  4NB3 A;  2EDG A;  4JYA Q;  3S2D H;  3NEN A;  4NXM L;  5GRO A;  1KC8 C;  2R92 B;  2HQE A;  1EY5 A;  3D0F A;  3EIV A;  3TS0 A;  4A3E H;  5FLM G;  5IP7 G;  1HQM C;  5JVG 3;  1OXT A;  4FVM A;  2OTJ A;  5LL6 X;  1UNS A;  2JXM B;  4ODG A;  2SNM A;  1K0S A;  1I50 B;  3ULL A;  3PMF A;  1VQC A;  3CQZ H;  3ULP A;  3J7Y W;  3MAQ A;  1VQK A;  3T53 B;  4A3K G;  1A8V A;  1F2Z A;  1JR0 D;  3I4L A;  3URY A;  2FMC A;  1PTO H;  2AWO A;  1YEZ A;  3ER0 A;  2IX0 A;  2FFK B;  2N78 A;  2F0W A;  4KKU A;  3BU2 A;  1ZKO A;  1BO0 A;  3SEB A;  2D0O A;  3SVM A; 
#chains in the Genus database with same CATH homology
 5C0X G;  1TT2 A;  5CBE E;  3GQB A;  1WTR A;  4RCO A;  3FEW X;  2XRQ D;  4C1N K;  2IL8 A;  3LNN A;  1F9Q A;  4C3J B;  1CHP D;  2N88 A;  3TP7 A;  2J4X A;  3A55 A;  5M5Y B;  5M5W B;  1NUC A;  2K04 A;  2HCI A;  2O5J C;  3KF8 A;  4XDX A;  1Y1V B;  4WFN 3;  2JP1 A;  2EXZ A;  4C1N I;  5C4Z A;  3I8Z A;  4X3S A;  3HOV B;  2L0C A;  4G7Z C;  3JAM E;  4A3J B;  4FF4 A;  4DXG A;  1C4Q A;  2A6H D;  3HS0 C;  1SNO A;  1LAB A;  1AW7 A;  4KK7 A;  3SR1 A;  1TII D;  5EPK A;  4DK1 A;  2F0E A;  5EQ0 A;  1UEA B;  3GTM B;  1EY9 A;  2EYF A;  1JIC A;  1PFN A;  2LMC B;  3CRL C;  1BDO A;  2E76 C;  1BBX C;  5J39 A;  4Y7N B;  4A3K B;  5EJW A;  2C9O A;  2E74 C;  1STG A;  1EYC A;  3D31 A;  1RTO A;  1JB3 A;  4O42 A;  1Z47 A;  4FYD A;  3O13 A;  3NWS A;  1KDB A;  3OHX C;  3M85 A;  1I3Q B;  4N9P A;  4KHV A;  1HA5 A;  5C5L A;  3J80 L;  1ILP A;  2NWG A;  1GUT A;  3F2U A;  3DWQ A;  1G8Z D;  1R4P B;  2C5C A;  2K6A A;  2N55 A;  1D1I A;  4K8J A;  2KED A;  4BY7 B;  4XXE A;  1STB A;  4OIJ A;  1KDC A;  1JOO A;  4TKO B;  2O4X A;  1EZ6 A;  5EKL A;  2NUC A;  4WJW A;  1H9M A;  5I4D A;  1ZYR D;  5G3L D;  4B9X A;  3A7A B;  1SBB B;  2PCF B;  1S5E D;  3EFX D;  3NE5 B;  4MN3 A;  4K2L A;  2JA5 B;  1B9N A;  4OO1 H;  2RBM A;  1A6X A;  3GTP B;  3D8G A;  2F0O A;  5C3E B;  2PYK A;  1OXU A;  4IFD I;  4WOR A;  5JPM C;  2JSO A;  1RKN A;  3M4Y A;  3DWP A;  3KBG A;  2R3Z A;  2OF1 A;  4KY6 A;  4KJO A;  3DEO A;  2K03 A;  2R6G A;  3D6W A;  2A69 C;  4MHE A;  3DHQ A;  2BCO A;  2OT2 A;  5IGD A;  4CGY B;  2RDH A;  3H91 A;  1HPC A;  4HR7 B;  2K01 A;  1CA6 A;  1R4Q B;  2EVB A;  2X6L A;  4BA1 I;  1MBY A;  1RD9 D;  3TZU A;  1E0B A;  1PRT F;  2L12 A;  5I9P A;  2KCC A;  2J7Z A;  1FGB D;  1LT3 D;  2EYP A;  3E0J A;  2K7V A;  3OIP A;  3NSW A;  4FP5 D;  2NBF A;  3VR4 A;  3BVG A;  1G6Z A;  4FO2 A;  3QJY A;  2AQ1 B;  1HHV A;  3PUY A;  1EZ8 A;  3RD4 A;  1SYC A;  3M4O B;  1NCV A;  1U4L A;  3ONA B;  1SNP A;  5C4H A;  5I6Y A;  2F0J A;  3BDC A;  3CRK C;  4DK0 A;  3M7N A;  3M3Y B;  4IUT A;  1HUN A;  3T51 B;  1EIG A;  2NVQ B;  3I4N B;  3VA7 A;  5CYU A;  4JK1 C;  3VYU A;  3NQI A;  1A3V A;  3HOU B;  4RFB A;  3A56 A;  1F9S A;  1CQF A;  2B2U C;  3GTG B;  3V2T A;  4K5W A;  1LTT D;  5C6A A;  3K7A B;  4UAI A;  1KAB A;  2QDB A;  2RSO A;  3QB3 A;  2PPB C;  4ID6 A;  3GO5 A;  5JEA H;  3NK9 A;  2XRS D;  5HUR A;  3S2H B;  2DNE A;  2A6E D;  2NVY B;  2IJ0 A;  1WCM B;  1LTS D;  3BVZ A;  3X3N A;  5IGB A;  2RDF A;  5ELF A;  3TSS A;  4CHT B;  2EYH A;  4F88 A;  4HSP A;  5M5X B;  1S5D D;  4I7Z C;  5KIX A;  2AUJ D;  4KI0 A;  1L0X B;  3AB9 A;  3IFD A;  3SK5 A;  2IT1 A;  4R8N A;  4XQJ A;  2D5D A;  1CT1 D;  1JOQ A;  1GUS A;  2LKV A;  3FVQ A;  1SNQ A;  3Q6S A;  2XNA C;  1SYF A;  2PZW A;  4FXK C;  4XYQ A;  2Q8R E;  2V4D A;  2MPM A;  2LFN A;  4XTC S;  1LLR D;  2E2I B;  4I65 A;  3BYY B;  2E75 C;  1PZK D;  1F77 A;  2XVS A;  4TQU S;  1F9P A;  2AUK A;  4TRD A;  1MGS A;  1RCV D;  2H4O A;  3HOW B;  2YU9 B;  1HUM A;  3VR2 A;  3H6M A;  1ZXT A;  1EY8 A;  2PZU A;  4HN7 A;  3T16 A;  1YNJ D;  2NYZ D;  1DOL A;  3L9A X;  5CGK A;  1VMP A;  1VDZ A;  3MFY A;  1F9R A;  5EKI A;  3MC0 B;  2RQX A;  3K5M A;  4ZKC B;  4OO1 I;  3H94 A;  1GOZ A;  5C4J B;  3NTH A;  1Q1B A;  3ZYY X;  4KJN A;  3A8K E;  2KEE A;  3RMH A;  4KV6 A;  3GTO B;  3J80 E;  1S4Z A;  3SE0 A;  1Y1W B;  2KHS A;  4BS9 A;  3MXN A;  4IUQ A;  1KNE A;  1CA5 A;  5M9O A;  3P75 A;  2EYJ A;  4KKT A;  2KQ3 A;  3MFG A;  1GUW A;  1JOK A;  1SYG A;  4X3U A;  4XQQ A;  2A5H A;  1JWS D;  1WTQ A;  2K5Q A;  2BDO A;  4H13 C;  4KD4 A;  4DN4 M;  3PO2 B;  2VB2 X;  3PUV A;  2I07 B;  1PRT D;  2YYZ A;  1SXT A;  1F2Y A;  2NTS A;  4IFD H;  5FOB B;  2JEB I;  3PUX A;  3EQL C;  3DXJ C;  5COY A;  1EYA A;  3S1R B;  4WRD A;  1WTO A;  1CZG A;  3FPU B;  4GZY C;  1FD7 D;  1PTO D;  3OMC A;  4HMI A;  5A2Q L;  1STY A;  2JA6 B;  2B2Y C;  1Q8I A;  2EY5 A;  5ELE A;  1V8Q A;  1HTP A;  3KUP A;  5IOC A;  2D2C C;  1LV9 A;  2B63 B;  2GA4 B;  2K5W A;  2A68 C;  3PV0 A;  1JCK B;  1EIH A;  2PNR C;  4KD3 A;  2Z4I A;  3L3O C;  4LK1 C;  2RKS A;  1DCZ A;  5D65 A;  1PZJ D;  1LTB D;  4DAV A;  2BOS A;  3Q0A A;  2PW7 A;  3FPP A;  1WTP A;  4IUV A;  1BCP C;  1PXU A;  2CVR A;  1LT4 D;  3SK4 A;  3TP8 A;  3VR5 A;  3PUZ A;  1F2M A;  3K0Y A;  4PQX A;  2F0Q A;  1TY0 A;  2JA8 B;  2AQ3 B;  1AZQ A;  2JE6 I;  2Z4H A;  2XN9 C;  5IGF A;  1FNW A;  3ITP A;  4K14 A;  2ENB A;  3NHH A;  4QF4 A;  3FDT A;  3VR6 A;  2B2W C;  2WII B;  4EQP A;  3G6J B;  2F0S A;  4Q0F A;  2RSN A;  3TN2 A;  1M4V A;  2KJX A;  3BYT B;  2QCP X;  2F0P A;  5AFW A;  3R2T A;  2WKC A;  2EY2 A;  4FNF A;  4RGM A;  4A3F B;  2Q8I B;  1II3 A;  4K6L A;  4YIJ A;  3GP7 A;  1IW7 D;  3W2D A;  4K5V A;  1A2T A;  4ZKB B;  2F4I A;  5DAU A;  1WD0 A;  5DM7 3;  5J22 A;  5I9O A;  2B2T C;  1PDQ A;  1QG7 A;  5CR3 A;  1AEX A;  2A73 B;  1JE4 A;  4DF7 A;  1LT5 D;  1EU4 A;  1I6V C;  1HRJ A;  4KKS A;  1RDP D;  5C0X H;  4RAU C;  4XT1 B;  4TSS A;  1QE6 A;  2HUG A;  5FLX L;  5J1Z A;  1HCZ A;  2L9H A;  2G9H D;  4K6D A;  3QG1 A;  2EYO A;  1SMY D;  3AU7 A;  3NWT A;  1BCP B;  2NN6 G;  2QEJ C;  5E4W C;  4ZAI A;  2XIW A;  4HTH A;  2OEO A;  5M3M B;  1AP0 A;  4L6T B;  3QIA A;  5EPJ A;  1BR9 A;  1JWM D;  4DU9 A;  4HCS A;  3CHB D;  3J7A F;  4BA2 I;  3HG9 A;  4LJZ C;  3KLR A;  4DA2 A;  4IUP A;  2ID0 A;  3HOX B;  3RLF A;  1YNN D;  2CW0 D;  5D3D A;  1OXS C;  1SJH D;  2B2U A;  1SE2 A;  2A74 C;  1ILQ A;  1KLG D;  2L4N A;  2XWJ B;  2NTT A;  3T4A C;  2ICI A;  2K33 A;  3C46 A;  1AN8 A;  3BVM A;  2F0H A;  1CTM A;  4OIK A;  5E1F A;  1VCI A;  1DJR D;  1WVL A;  1HXY D;  1PFM A;  1IKL A;  4RHS A;  3WDN A;  5NUC A;  4DXF A;  4FXG C;  3T56 B;  1C8C A;  1I4Q A;  3S17 B;  1ZYR C;  3U9S A;  3K5N A;  4MIU A;  5FKA C;  5K36 G;  1G2T A;  5HGT A;  2R61 A;  2WV6 D;  2K5D A;  4RKB A;  1BUV T;  1X3Q A;  1BQQ T;  4QMG A;  4C2M B;  2PO4 A;  1EY6 A;  1TS2 A;  1VF7 A;  3A54 A;  4L8J A;  4IUR A;  3C1E A;  4C56 C;  2Z8L A;  4PMB A;  1SNM A;  2FMM A;  5ELC A;  1NSN S;  1GHJ A;  4QUC A;  3MA2 B;  3NP8 A;  4ZK9 B;  5COR A;  5EPL A;  1A3U A;  1ET9 A;  4FF1 A;  2KCN A;  2LY7 A;  1FNV A;  3ND8 A;  1FNU A;  1W6J A;  2F0U A;  1TS3 A;  1WD1 A;  3I90 A;  4A3D B;  1OXX K;  1I4G A;  1EY7 A;  2JA7 B;  2IW3 A;  5K36 H;  1IHZ A;  1Y8P B;  4XT3 B;  4HMJ A;  5D3I B;  1ML0 D;  4NKL A;  1DM0 B;  3OW7 A;  2FJ2 A;  3L7Z C;  1H9K A;  3GV6 A;  2ZXR A;  1JWU D;  1CM9 A;  4OHJ A;  2BE5 D;  3HKZ B;  4ULL A;  4K2K A;  5CV5 A;  4R8I A;  5TSS A;  1QIL A;  1KAA A;  1BCP F;  2MGS A;  1TWC B;  3PUW A;  3NUC A;  1QNU A;  4PNY A;  2E2H B;  4XQN A;  4A93 B;  1BNZ A;  2JYO A;  4ZLT F;  3TDQ A;  4M1U B;  3S1Q B;  1QWY A;  1ESR A;  2F0M A;  4CBV A;  3DWA A;  1RHP A;  4XYO A;  2F03 A;  3FKI B;  1QB5 D;  1U4M A;  1TWG B;  1PLF A;  5CV8 A;  1LTR D;  4E6I A;  1S5F D;  2K28 A;  1XX8 A;  1EEF D;  5CV9 A;  2A6E C;  5C0X I;  1LTA D;  1SYE A;  2EJG C;  3I70 A;  5F2D A;  4QUF A;  1TWH B;  3OSO A;  1MI2 A;  1QJO A;  1XWE A;  4CKE A;  3S9W A;  1QCB D;  2CQA A;  2B2Y A;  1STH A;  1CFM A;  4X3K A;  4ABN A;  1D6E C;  3K6O A;  1R9T B;  5FO8 B;  2FIN B;  4LMQ D;  2JEA I;  1B3A A;  5I2Y A;  2HCC A;  3ND9 A;  4V19 0;  2SEB D;  4DAP A;  3TBI B;  2AWN A;  2PZT A;  4RH6 A;  2EYL A;  3S1M B;  1Y8N B;  4ME5 A;  3OPO A;  2AQ2 B;  2EZV A;  1J8I A;  2SOB A;  2NVT B;  3OWE B;  1F2L A;  1Q1E A;  3K57 A;  4B08 A;  5FLX E;  1V1P B;  3ERQ A;  2D62 A;  3MZ5 A;  4JBW A;  3J7A V;  2ZXO A;  1GUN A;  2DNC A;  2XWB B;  4F87 A;  5IOD A;  3FRP B;  3P7J A;  1SE3 A;  4EGV A;  4ZUI A;  2MUY A;  2J0T D;  1JOR A;  1AFP A;  3NBH A;  3SHL A;  4BBS B;  5EKK A;  4OL7 A;  2IX3 A;  1B50 A;  2B2W A;  4PMC A;  4DFA A;  5DNF A;  1WTX A;  2KVM A;  1LTG D;  1YNJ C;  1EEI D;  3T13 A;  1B53 A;  3AMU A;  4IAL A;  1IYU A;  2ICE C;  3K59 A;  2EOT A;  3R8B A;  3EA6 A;  1Q90 A;  3G7L A;  2Y0S B;  4K5X A;  1I4H A;  2BDN A;  2O2L D;  1MD2 D;  4IUN A;  1EQV A;  2F0I A;  3RUZ A;  5K5P A;  2F1M A;  1TS5 A;  2B2T A;  1Y69 U;  5KGU A;  5KND A;  3EJI A;  1RJT A;  3NTK A;  1SFO B;  1XTC D;  4KN7 C;  3ERO A;  1EOT A;  4ZYS A;  3NQT A;  5I2X A;  3H3V C;  1G91 A;  3TP6 A;  1U9R A;  1Q12 A;  5G3L F;  3S1N B;  1K8O A;  5EBD A;  3MTS A;  3S15 B;  1FR3 A;  1O80 A;  1ET6 A;  1DXM A;  1GJX A;  3QOL A;  5T1G A;  3BS1 A;  1EWH A;  1O78 A;  3CU7 A;  4KY5 A;  5C4X B;  1H9R A;  5JEA J;  1MSH A;  4BY1 B;  1CI3 M;  2ZT9 C;  5JPN C;  1PYW D;  3C3L A;  1PTO C;  2KUM A;  3GD7 A;  3OWF A;  2KEC A;  4ILW A;  1KTK A;  5ISR A;  2F0D A;  2L55 A;  4RWS C;  1PMR A;  1L0Y B;  5IT9 L;  1QOH A;  3J81 L;  2A68 D;  3KLS A;  1T5E A;  1X32 A;  4EQO A;  2X69 A;  3U9O A;  1GHK A;  1XYI A;  5FO9 B;  2XSC A;  4XIG S;  1H9S B;  1PZI D;  1TQO A;  1DD2 A;  1BXT A;  5JAV A;  1E2W A;  3HRZ C;  2I46 A;  3I91 A;  1CK1 A;  3C1F A;  3LWE A;  4EVO A;  5JVH 3;  1U4R A;  4Q5V A;  2QF7 A;  3MHB A;  1RF2 D;  1BF4 A;  5FK9 C;  2EPB A;  5T1I A;  2Z1C A;  1Z6H A;  2F0G A;  1W6K A;  2EE1 A;  4CKB A;  2VUM B;  1T5X D;  1TKW B;  1CQV A;  3N6R A;  5KYL A;  4NP5 A;  1IL8 A;  4HED A;  1SE4 A;  4J8Q A;  2RDG A;  1DOK A;  3TZD A;  3VR3 A;  1JQY D;  1PFB A;  2M00 A;  4IUU A;  1I4P A;  3K5L A;  4RA8 A;  1CZW A;  2WKD A;  1S5C D;  1NR2 A;  2EY1 A;  1E2Z A;  3S2D B;  1WTW A;  1B1Z A;  4A3E B;  4X3T A;  3HOZ B;  3UI2 A;  1OXV A;  1PRT B;  5C3X A;  1SND A;  4DNR B;  3CQZ B;  1EQT A;  4V0B A;  1IW7 C;  4BBR B;  4DNT B;  1EWC A;  1KLU D;  1PTO B;  2BA0 A;  3P1H A;  3TP5 A;  1TR5 A;  3HZX A;  1SEB D;  1B9M A;  2OXP A;  2PMZ B;  2E2J B;  1SSO A;  1TWA B;  2A6H C;  5ELD A;  3LWU A;  4H7B A;  4RCN A;  3C2P A;  1GXD C;  3D4W A;  5KNC A;  1A2U A;  2L1B A;  4RKL A;  4EQN A;  4RGN A;  3S14 B;  1ONL A;  3GTJ B;  1SNC A;  2M9V A;  2DN8 A;  2WIN B;  1SMY C;  2NB0 A;  2KA7 A;  3VA5 A;  1STA A;  1LT6 D;  3GTK B;  3R3O A;  4UDU C;  3GV3 A;  1STE A;  3P20 A;  1DOM A;  3DEP A;  3OIQ A;  1A15 A;  1JC7 A;  2O5I C;  3IL8 A;  4RGO S;  5KNB A;  4IFD J;  3VYT A;  5LL6 S;  1VMC A;  3K5O A;  4U68 A;  4OO1 G;  2WAC A;  1D2B A;  1V1P A;  3GTQ B;  4P2C B;  1WTV A;  2WB1 B;  3PO3 B;  1EYD A;  1YNN C;  5DM6 3;  2CW0 C;  4DGZ A;  4C3H G;  1HQR D;  3QWN A;  2DY7 A;  4KHZ A;  5BN3 A;  2NN6 H;  3KK7 A;  2QIL A;  4H0L C;  2NVX B;  2K1B A;  2VXW A;  1SDF A;  1ZEQ X;  1HFG A;  1HTL D;  3H09 A;  4J6H A;  1CHQ D;  4PMW A;  3GTL B;  1K8M A;  4U67 3;  4NDX A;  4PV1 C;  1SJE D;  3K58 A;  1SYD A;  2HDM A;  1D5M C;  4G7H C;  3I73 A;  1NAP A;  1O7Y A;  3NPP A;  4KTA A;  2F0L A;  4R9W A;  3IKJ A;  4CJ0 B;  2B8G A;  2H1E A;  1IYV A;  3SDZ A;  1SAP A;  2F0V A;  2B2V A;  1EY4 A;  1TVX A;  5I6W A;  1D5X C;  3D4D A;  5LHY 1;  2F0K A;  3NTI A;  3CKI B;  2A69 D;  3PIO 3;  5FO7 B;  1M8A A;  4HCE A;  3MXG A;  3X3M A;  1D1K A;  2IWH A;  3RZD B;  1HFN A;  4RHR A;  4CJ2 C;  4ZUJ A;  1ENA A;  4L63 B;  3W3A A;  2BA1 A;  5IGC A;  5ELB A;  1MSG A;  4QCL A;  5C5M A;  2MP1 A;  1OO9 B;  4IZ8 A;  2K32 A;  1UUP A;  2EYM A;  2R7Z B;  4A3G B;  3RZO B;  2F0F A;  1TS4 A;  2IPK D;  4CJ1 B;  1LTI D;  5M3F B;  1TWF B;  1UAP A;  3SXH A;  5IGG A;  2RVL A;  5A35 A;  2R93 B;  2CHB D;  4C3H B;  1PTO F;  1U4P A;  3HP3 A;  1STN A;  5KEE A;  5A2Q E;  2K05 A;  5JEA G;  4BWG B;  4G7O C;  3VYR A;  3EVQ A;  1Z7T A;  5DEH A;  3MXP A;  5C0X J;  1H9S A;  1A3T A;  5CC4 A;  5C3W A;  3A8J E;  2PQE A;  3I4M B;  4S3S A;  1Y8O B;  3V05 A;  4QIW B;  5IT9 E;  3J81 E;  2BE5 C;  1ESF A;  3SK8 A;  2DY8 A;  3MWY W;  2X6G A;  2F0T A;  3D6C A;  5IIF A;  2F0N A;  4A3I B;  4FF3 A;  3E6Z X;  2TMP A;  5CMD A;  5JOB A;  4B9W A;  1ENF A;  2HDL A;  3HGB A;  1EY0 A;  3LX0 A;  3Q23 A;  4QB4 A;  3I3C A;  3JAM L;  5CV7 A;  3OOC A;  1DON A;  2NZ1 D;  4DAY A;  3D3R A;  2IX1 A;  4M8A A;  4H44 C;  3BDO A;  4K8I A;  1O7Z A;  2B8F A;  2WAQ B;  3HEJ A;  4OGQ C;  1O7L A;  3QOJ A;  2B2V C;  1DZ1 A;  5KYI A;  1G29 1;  5EGT A;  1D5Z C;  4J1M A;  3IFT A;  5BN4 A;  2MHV A;  4RGT A;  1G2S A;  3SK6 A;  5CBA E;  4F8M A;  1EL0 A;  2VB3 X;  3NXW A;  3QO2 A;  5CV6 A;  3M7G A;  3MEH A;  1DYQ A;  1B4O A;  1QNK A;  2SDF A;  2TSS A;  1FYC A;  3Q24 A;  1GUO A;  4NMZ A;  2B39 A;  3WOE A;  3HOY B;  3IAY A;  3VYS A;  1C48 A;  3E5S A;  2WP8 J;  2E2D C;  1XXG A;  1LAC A;  1TU2 B;  3DUZ A;  5EBC A;  1ENC A;  3R2I A;  2MJ8 A;  4NW2 A;  4C3I G;  4IN3 A;  5E4X A;  2NN6 I;  1S5B D;  1E2V A;  1EU3 A;  5CV4 A;  1BOS A;  1GUG A;  4AYB B;  1IKM A;  3NBI A;  3KBX A;  4ZRZ A;  2LS0 1;  1I4R A;  3Q22 A;  2KOL A;  4CKC A;  3MVV A;  3OMG A;  1HA6 A;  5D14 A;  3R93 A;  2G9D A;  2QKI C;  3A7L A;  3A8I E;  4IQZ A;  1SYB A;  4IFD G;  4FXD A;  4O1N A;  4KN4 C;  4ZQ3 A;  3FMC A;  4N9T A;  1I6H B;  3BG3 A;  2RA4 A;  4A3B B;  2VNU D;  5JJZ A;  4KMU C;  3TME A;  4HSV A;  3BZD B;  2D9U A;  1VF5 C;  3N52 A;  1RTN A;  1AZP A;  2FHT A;  1KDA A;  3BDL A;  1KNA A;  2ZXP A;  3WOF A;  3DMU A;  3PIP 3;  3H0G B;  1NR4 A;  4HAE A;  5IGE A;  2L5T A;  1J9O A;  1TY2 A;  3I72 A;  4F7X A;  1B2T A;  1EFI D;  3D4R A;  1PRT C;  4C3J G;  1Q3L A;  1H9J A;  5BN5 A;  1ICW A;  2F3W A;  3V96 A;  3KLS X;  4C3I B;  1I4X A;  2SNS A;  3DM1 A;  1V43 A;  1ROD A;  4A3M B;  4Z9C B;  4KY7 A;  3MXU A;  2PW5 A;  2EY6 A;  2M2L A;  1V1O A;  1LO5 D;  4LAA A;  5E3F A;  1X3P A;  4G4K A;  2Q8T A;  5C44 B;  2EJM A;  4FF2 A;  1B44 D;  3S16 B;  2EJF C;  1K83 B;  4G57 A;  2L11 A;  2F3V A;  1BCP D;  5KRU A;  2EDG A;  2R92 B;  2HQE A;  1EY5 A;  1HQM C;  5JVG 3;  1OXT A;  4FVM A;  5LL6 X;  1UNS A;  2JXM B;  4ODG A;  2SNM A;  1I50 B;  3PMF A;  3J7Y W;  3MAQ A;  3T53 B;  1F2Z A;  1JR0 D;  3I4L A;  3URY A;  2FMC A;  1PTO H;  2AWO A;  2IX0 A;  2FFK B;  2F0W A;  4KKU A;  1ZKO A;  1BO0 A;  3SEB A;  3SVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...