1Y8PB

Crystal structure of the pdk3-l2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
97
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8pB00
4HR7B 3M7NA 3GQBA 1GHJA 4IQZA 1CTMA 1IW7D 2R6GA 3NE5B 3VR2A 2AUJD 3A7LA 3A8KE 1TKWB 2KCCA 3WDNA 4XTCS 1Y69U 1GUTA 1H9SA 4IFDH 1DCZA 2LMCB 3I72A 3A8JE 1ZYRC 4KKUA 1EWHA 4GZYC 1A6XA 1LABA 1Z6HA 1Q1BA 2K33A 1I6VC 2A6EC 1OXXK 2A6HC 4I7ZC 3EQLC 4DNTB 4TKOB 3W3AA 1VCIA 4IFDG 2A69D 2PCFB 4JBWA 2NN6G 5JEAG 2AUKA 2A68D 2EJFC 1Q12A 2JXMB 1YNJC 3OPOA 3PUWA 4XIGS 3SDZA 3T53B 2BE5D 1GUNA 2KA7A 1FR3A 2EVBA 4BA1I 3PV0A 3TZUA 1Y8OB 1GUSA 3I4LA 4DK0A 1IW7C 1DD2A 3CRKC 2BDOA 4H0LC 4TQUS 2JEBI 3PUZA 3IKJA 1DXMA 3QG1A 2BA1A 1E2VA 1OXUA 1OXVA 1V8QA 2E76C 4KKSA 1K8MA 3MFYA 4KKTA 1B9MA 3A8IE 2NN6I 3BDOA 3VR3A 4G7OC 1H9MA 4KHZA 4G7ZC 4RCNA 3LNNA 4JK1C 1K8OA 1GUGA 1VDZA 1H9RA 2DNCA 1O7LA 1QJOA 1V43A 2A68C 1G291 2EDGA 2IT1A 3PUXA 3OOCA 4KI0A 2BE5C 1B9NA 5KNCA 3CRLC 3VA7A 3QIAA 5A35A 4DNRB 4KMUC 3M85A 1IYUA 1BDOA 2K7VA 5BN5A 1H9SB 1H9JA 2L5TA 3GD7A 3N6RA 4OGQC 1GJXA 4PV1C 3FMCA 3FPPA 1HPCA 3U9SA 4H44C 2B8GA 2ZT9C 3ND9A 3T51B 2EJMA 4OO1H 1IYVA 4G7HC 3MXUA 1HTPA 1E2WA 1CFMA 2PNRC 1T5EA 2A69C 3HGBA 1HQMC 1Q1EA 2D5DA 3VR5A 2CW0C 3ND8A 3OW7A 5KNBA 1Y8NB 2F1MA 2E75C 1TU2B 1GHKA 1Y8PB 2Q8IB 2O5JC 2D2CC 3BG3A 3IFTA 5K36H 4DK1A 3PUYA 1OXSC 1GUOA 1PMRA 2B8FA 5BN3A 1VF7A 1Q90A 1H9KA 1YNNC 4KN4C 4LK1C 3T56B 3DXJC 3SE0A 3KLRA 5C0XH 3AB9A 2NN6H 3PUVA 5JEAH 1HCZA 1OXTA 1LACA 1ZKOA 5K36G 1ONLA 3D31A 3LWUA 1O78A 3QJYA 4H13C 1E2ZA 2E74C 2JE6I 3A7AB 2YYZA 2A6ED 2A6HD 3I73A 4L8JA 2O5IC 3P20A 5C0XG 2JEAI 4LJZC 1VF5C 2PPBC 1Z7TA 2K32A 2V4DA 4KN7C 2DNEA 2DN8A 2AWOA 3VR4A 2D62A 3RLFA 3VR6A 5KNDA 3L7ZC 1SMYC 1FYCA 3M4YA 2QF7A 2EJGC 3D4RA 4BA2I 4OO1G 2BA0A 1CI3M 3H94A 5BN4A
chains in the Genus database with same CATH superfamily
4R8NA 5C3XA 1LTID 5IWAL 2WINB 2L0CA 1L2FA 3N52A 4R4QA 1BBXC 4BY7B 3TS2A 1LTTD 1A8VA 4I7ZC 4Z9CB 1O7YA 4GNXC 4DR3L 4A3KB 2GVAA 2PQAA 5JEAG 5C5MA 4OO1I 3CW2C 3DM3A 2BE5D 1FGUA 1EYCA 4NXMQ 1I4PA 3RLOA 2SNSA 1WVLA 4ZQ3A 1HR0Q 1GUSA 4DK0A 5JVH3 1IW7C 1YNND 2NYZD 5IP9G 2UU9Q 4UHVA 2NZHA 2JQOA 1YHQA 3IAYA 1STBA 4A93G 3AQQA 4IPHA 4OX9Q 2B39A 5LMUQ 1NY4A 1CSPA 4DUYL 3MFYA 2NN6I 3VR3A 2LY7A 5IGBA 4GKJL 1Q8KA 1VQ5A 5IT9c 5JJZA 4L5RC 1WCMG 1RODA 1TXYA 5IT9E 4ZUIA 3OIQA 3SK5A 4IN3A 3HOZG 5C3EB 4HAEA 4R4CA 2F0WA 4Y7NH 1GM5A 4X65Q 5JJLA 1YIJA 3I56A 1VQBA 1Y1WH 1F2YA 1Q8IA 3H0GH 1LO5D 2NUCA 4DR2Q 5M3FB 4IUUA 1W6JA 2RCNA 1VQOA 4TVAB 1I50B 2AHOB 2L9HA 3U4VA 3BG3A 3K0XA 3NWSA 2BOSA 1YNNC 3PO3G 3AFQA 3GTQH 5M3MG 1SRUA 2F0LA 1EQQA 3F2UA 4MHEA 1I94Q 1F2ZA 3I8ZA 1CHPD 2B2UA 1QILA 3G7LA 4E6IA 2VB2X 5C4JH 1LUZA 4HCSA 4AQYL 4OO1G 3ICEA 3GTKH 4ODGA 1QVGA 3CP0A 1HRJA 1JWSD 2R6GA 1TWCH 4X3SA 3A8KE 2LSSA 4IJLA 4IZ8A 1H9SA 1PFMA 2K6AA 1CQFA 2HUGA 3K5MA 1TWHB 1SE2A 2ZJQA 1V1PA 1SNPA 1LT4D 2IX1A 1A2TA 2WB1G 4NB3A 4NP5A 3HOUH 4KJNA 1B70B 2NN6G 2QGQA 3NELA 2AUKA 1PHJA 3J7AV 3CAMA 1A63A 2VZAA 4DN4M 3QR8A 5JPMC 2CH4W 2HQEA 3BJUA 4DR6Q 1C0AA 4J15A 4RGMA 3M3YB 2MGSA 1EY7A 4MIUA 4L5QA 2KOLA 3W5OA 4H0LC 1HZAA 1S5DD 1SYBA 2B2VA 1N8RC 1EQTA 5EKKA 1AZQA 1JWUD 2BH8A 1L0YB 2IX3A 4DV3L 1H95A 1S3OA 1SNDA 3BDOA 1IL2A 4A93B 4A3BH 2UUCQ 1D1KA 2DNCA 4MTKA 1NE3A 5AJ3Q 2I0QA 1N34Q 1UE6A 4KI0A 2OTLA 3KK7A 1EUJA 3UDFA 4J8QA 5A35A 4DNRB 2Z9HA 4MN3A 1WCMB 2Z6BA 3V2TA 5H1SE 4FF3A 1X32A 4DKAC 2QW7A 1SJHD 3HOZB 2UXDL 1SYCA 3S1QB 3FMCA 1PTOC 2H5XA 3U9SA 3HOVG 3HZXA 1LTGD 1Y1VG 1MD2D 2F4IA 3D4WA 4GN4B 4JI2L 1HQMC 2K52A 2OCEA 3ND8A 5CV8A 2VQEL 1WD1A 4K0KL 1GHKA 3T1YL 4DR4L 2EXDA 2D2CC 4DR7Q 1BBWA 3RUZA 5C0XJ 1KRSA 2E2HH 3GTOB 1K83H 2WB1E 1FJGL 4H13C 1ZYRD 2K04A 5FLXL 4GKKL 4JI6Q 3PO3B 3I7FA 1BKBA 2RBMA 5M3MB 2O5IC 5G3LD 3HKZG 1SFOB 3UE1A 4X66Q 4HSPA 1ASYA 1WTWA 2JA8H 3TDQA 5I2XA 4K5XA 3GTGB 1VQDA 3S9WA 2BDNA 3FDTA 5DAUA 1SMYC 5CV4A 1O80A 2AKWB 1IKLA 1JOQA 1VQJA 5ELDA 3CKIB 4JW0A 1WTOA 4R1JA 4V190 2AUJD 3E6ZX 1TKWB 4XTCS 1A3TA 2NZOA 3Q8DA 2A6HC 2EQSA 1N36L 1IL8A 2F0QA 3J80L 1A3VA 3PUWA 1AFPA 1EZ8A 1KDCA 1QOHA 1JORA 4DU9A 3L9AX 2WB1B 3TP5A 5C4XG 3TZUA 2F4VQ 1SJED 5FO9B 3EIVA 3K5OA 4LF9L 2OT2A 1D7QA 2B3GA 5I6WA 2R92G 4X64Q 2B2WC 4N8FA 3TQYA 1K8MA 1XPOA 3A8IE 1WTVA 3HOWG 4AH6A 4KY5A 4YHHL 4G7OC 1JT8A 4CKEA 1CKNB 1HJPA 3LNNA 4JI1L 2OQ0A 3MEHA 4LFAQ 2JSOA 2EDGA 1UAPA 2IX0A 3W2DA 4R4TA 4LF7Q 4CGYB 2F0FA 4ALPA 4JOIA 2E8GA 4X6AH 5F2DA 3RN2A 4OEMB 2R61A 3FHWA 3VYSA 1K0SA 2HDMA 4B3RL 1I4HA 1NAPA 1TWAB 3L3OC 2H1EA 3K6OA 4C1NK 1S4ZA 2B2TA 3CCMA 2QA4A 3MXNA 1JB7A 4GS3A 5HGQA 3GTJB 1E3PA 4QIWE 3PCOB 3SHLA 5IWAQ 1Q7YC 1TS3A 4BBSH 3S16H 1Y1VB 4XT3B 4R8IA 2WKCA 2E2JB 3NHHA 2Z6KA 5FLXc 4OHJA 1I3QB 2IJ0A 1Q90A 4QL5A 5FLXE 1MJEA 1EYGA 1SSOA 2KUMA 4DR3Q 1HQRD 4YCVA 2WKDA 3AYHB 4FF2A 1GKHA 5IP7G 2UUBL 3R2IA 4YY3L 1KABA 2YYZA 2UXBL 1KL9A 5LL6X 1MGSA 1STNA 1ENFA 3FEWX 2DNEA 2DN8A 4JI0Q 3UDGA 4XDXA 3PQIA 3HKZB 1CI3M 3GO5A 4DUYQ 1VQ6A 2BCOA 3ULLA 4GKJQ 3STBD 5JEAJ 4QIWB 1GVPA 1T9HA 4HTHA 4EQNA 2OXPA 3M7GA 3J80c 3A8JE 1LABA 4L5SA 2MJ8A 5GQOA 1XWEA 5C3WA 3W3AA 3PF5A 4CBVA 4DPGA 3OIPA 1I4QA 3OW2A 3HKSA 1QUQB 3PSIA 1S5FD 2AQ2B 2E2IH 1GD7A 1PFBA 4NPSA 1VQMA 2KHJA 3EN2A 1U0LA 5M5WB 2ENBA 3F2BA 2Z4IA 3S15H 5FJ8H 4DFAA 5C4XB 1U9RA 3IRBA 2EIFA 4KLKA 1H9MA 1RTOA 4A3CH 2F0NA 2GN5A 4A3EH 4RCNA 5EGTA 4UAIA 1VDZA 2A68C 3G48A 4Y52H 5L37A 3HOWB 2KHIA 1STAA 3VYUA 1BO0A 4PZ8A 1S5CD 1TY0A 2D0OA 1OO9B 4K2LA 4FNFA 1X55A 3K7AB 1PH9A 1H9JA 3N6RA 4CDFC 3DHQA 4GOPB 5IYDH 4HJ7A 1YJ9A 2P5ZX 4KJOA 3EFXD 3I70A 4KK7A 4AQYQ 5JJIA 3VYTA 1KTKA 1HZBA 2J4XA 1V1OA 2D5DA 3J7ZC 5IY0A 1EIHA 5CBEE 2MO0A 1D5XC 4H02A 3H0GG 2Q8IB 3WOFA 1B8AA 3F1ZA 1ZEQX 4KN4C 4C3IG 5ELOA 2A8VA 4DXGA 2TMPA 3TZDA 1OXTA 4O0AA 3Q24A 4FXKC 4JI3L 1I6HB 3IFDA 1NNXA 1O7IA 3A7AB 4S3SA 2A6ED 5E1FA 2F0PA 1RF2D 4A3MH 3IL8A 2CWAA 2R7FA 3G6EA 5EAYA 3UDXA 4V0BA 4QB4A 4DV3Q 2C35B 3M7NA 1B1ZA 3K81C 4XXEA 5AFWA 5AJ3L 2VL6A 2VUMG 2FMCA 4DV1L 3SEBA 1JQYD 1EIYB 2V1CC 5DNFA 1D2BA 2H4OA 1Q1BA 1IZ6A 4NDXA 2ES2A 5T1GA 3GTPH 1AE2A 2BH2A 5I9PA 1HZ9A 2JA6H 1PH3A 3M4OH 2UXDQ 3PV0A 3HOUG 1VMPA 4A3LH 2F0VA 5LMNQ 4BXXH 2FXQA 3A74A 2K1BA 5CV5A 4JI2Q 4EGVA 5M5XH 4GOPC 2QCPX 3B6YA 1V1PB 4B08A 2VQEQ 3EBEA 4K0KQ 3T1YQ 3JC66 4DR4Q 2CCZA 1RIPA 3BVMA 1SYGA 1G291 3NEMA 2NWGA 1GO3E 1AN8A 1LT3D 4L6TB 1VQIA 3A5ZB 2EY6A 1PH5A 1FJGQ 5FO8B 3KFUA 3CCEA 4A3BG 4EQ5A 3VYRA 2LFNA 1CZWA 1EFWA 3E3XA 3S17H 3BYTB 3H3VH 2ZT9C 3OMGA 1EWIA 1OTCA 1P16A 3TP7A 1IYVA 4B9XA 4JG2A 2PNRC 3Q23A 1BCPB 4ZYSA 5CV7A 4ZCKA 3NQIA 4CJ1B 1PH6A 1XTCD 4Y7NB 1TU2B 4OWWB 1PMRA 4DV7L 4UP7A 2R7DA 2F0OA 3C46A 1PZID 3S1RB 1PLFA 1UNSA 1JOKA 1N36Q 3KF6A 1KRTA 3T4AC 4NXNQ 3H0GB 3PUVA 1WTXA 5J39A 1K9MC 1ZKOA 4K14A 1E2ZA 2F0KA 4C3IB 1A2UA 3HS0C 2JEAI 3RZOH 4LJZC 1VF5C 5C44G 1Z7TA 4FDBA 3T13A 5ISRA 4K8IA 1DOLA 4OL7A 3GTQB 3H94A 2A1AA 4BY1G 2B2YA 4YHHQ 1IW7D 2JYOA 3J81L 4JI1Q 1PFSA 1Y14B 3Q22A 4K8JA 2WIIB 2LMCB 3A5UA 3D8GA 1CT1D 3E9HA 1DGSA 1FL0A 5C4JB 3HP3A 1OXXK 5EJWA 2VUMB 1KAWA 5ELNA 3GTKB 3AEVA 4JYAL 2PZWA 3OPOA 5C4ZA 4B3RQ 1SBBB 4LF4Q 2EXZA 2R93G 1GUNA 2XWJB 3HOXH 3OSOA 4LMQD 4P2CB 3I4OA 3MAQA 2PQEA 3CRKC 1BOSA 1FGBD 1PA6A 3HOUB 2NVTH 5T1IA 2NVXH 1FVIA 2VNUD 3ER0A 2Z8LA 2WP8J 2K5QA 1BCPC 3FPUB 3U9OA 3CCVA 3S2DB 1KAAA 3GV3A 2UUBQ 4A3FB 4YY3Q 2IW3A 2ALYB 2UXBQ 3E9IA 1B3AA 4JI0L 3I4MG 4MNOA 1PYWD 3SXHA 2KCTA 1AW7A 4LF8L 4YCUA 5M5YH 4RHRA 1GOZA 1HTPA 1HR0W 4IURA 3HGBA 1TT2A 4HMIA 1Q81C 4ILWA 1EYAA 3CQZB 2K28A 4BS9A 2PW5A 1SYFA 2CFMA 4C3JG 5EPKA 5JJKA 4M1UB 4DV4L 3QB3A 4ME3A 5LL6S 4DK1A 1VQ7A 4JVZA 2B8FA 1ZXTA 1P8LA 2F0IA 4LWCA 4BBSG 3KBGA 4F88A 1Z47A 5IYCH 1HNXL 2Y0SG 4KD4A 1ONLA 1QWYA 1EWCA 2KCMA 1IKMA 2HIVA 4ZRZA 5BR8L 2K50A 4UP9A 2PPBC 2HCIA 4WORA 3CU7A 1YVCA 2Q2IA 2SNMA 4RFBA 3J81c 4N8X1 2D62A 2E2HB 1IBKL 4JI5L 3D4RA 1D6EC 1EYDA 1SMXA 3AU7A 3CC7A 5C44B 2MFIA 3Q0AA 2QEXA 3SK6A 3P1HA 4BY1B 4FYDA 1SAPA 3JAML 5FO7B 1EEID 1EWHA 2RDGA 4FF4A 1I6VC 4QUCA 3ITPA 4TKOB 4A3JH 4ZAIA 5I4DA 3BVGA 1TWFH 3VA5A 3T53B 2AQ3B 1YI2A 2KA7A 3TBIB 1R4QB 3MWYW 1JB3A 2CVRA 2N88A 4POGA 2JA9A 2R93B 2Q8TA 1UEBA 3MHBA 2PNHA 2BA1A 1KQSA 1OXVA 3TEHB 1PTOD 4ME5A 3KDFA 1J8IA 5A2QL 1X65A 4G7ZC 1QVCA 2EYFA 2NTSA 3RZDH 1VQAA 4LFBQ 5I9OA 3TRZA 3U4ZA 5E7NA 4A3IH 4TSSA 1VQGA 3CRLC 3UI2A 4A3EG 3C2PA 4RHSA 1G8ZD 2FINB 1II3A 5CV9A 3H15A 4JI3Q 4B3ML 2JN4A 1U5KA 5FLMH 2JA5H 3GD7A 3R8BA 3S2DH 4DV2L 1B53A 5HY6A 1VQ4A 1A15A 1EY5A 2F0HA 4JPBW 4EVOA 4DR5L 3ND9A 3GTMB 1NMGA 3I4MB 2R7ZH 4IUQA 1DONA 3CMEA 3NPPA 2CW0C 5IIFA 1SMYD 4ZK9B 4DV1Q 1JWMD 1Y8PB 3OMCA 1YJWA 5CBAE 2B63G 2IHEA 1HA6A 1HA5A 3D3RA 3S2HH 5E4WC 4ZUJA 1AZPA 4C3JB 5D65A 5DEHA 4R9WA 1RKNA 1DYQA 3LWUA 4BBSB 2MQHA 2PZTA 3H3VI 1VQHA 1CA6A 3HEJA 2A6HD 5LMNL 2Y0SB 4GNXA 5C6AA 1EU3A 2K32A 1SE3A 1G2TA 1HNWL 2AWOA 5KNDA 2OWOA 3G4SA 2F3VA 2KBNA 2NVQH 3I55A 2K5DA 3JAMc 4A3MG 2KVMA 1E7ZA 4HR7B 4RKBA 1HNZL 3JAME 4IFDH 2KCCA 5C3EH 1KXLA 5E3FA 3DEPA 1Z6HA 2I5LX 1MHWC 5GADC 4C3HH 2XRQD 4CJ0B 4JBWA 1AE3A 2NVYB 3FP9A 4O2DA 1XPUA 4MTNA 3J7A5 1VS0A 1PVOA 3ERSX 1FR3A 4K2KA 1HFGA 2F0EA 3M9BA 1GUWA 3PF4A 4L63B 1LTAD 1CSQA 3I4LA 1I50H 2CH4A 4TQUS 1DXMA 2J7ZA 5A2QE 3KJPA 2XSCA 1E2VA 1YJNA 1QZGA 2E76C 3S14H 1CUKA 3CCQA 2OTJA 4BXXG 2CKZB 2X6GA 4ZKBB 2RHQB 2VS1A 1PTOH 4JK1C 1F9QA 3FKIG 4DV7Q 1O7LA 4NXNL 1SLJA 2IT1A 1STGA 2QDBA 4ABNA 4A3GG 2NB0A 1PRTB 4NW2A 3MVVA 1MKHA 5EBDA 1LTRD 4CJ2C 4M8AA 1L1OA 5EKLA 2PI2A 4X62L 1U4MA 1C9OA 1GJXA 2XNAC 5DM63 2C9OA 1T5EA 2KECA 1QG7A 1JOOA 1TWHH 3L2PA 4J6HA 4OIKA 1KLGD 2SDFA 1E1TA 2LKVA 1QVFA 4QUFA 1K28A 5K36H 5KGUA 4ZKCB 1J9OA 3BDCA 1ENCA 3KLWA 3SE0A 3PO2H 3KLRA 3M3YH 2YTVA 4LF4L 5JEAH 3I2ZA 2B63B 4JYAQ 1MI2A 1IXRA 3HKZE 3QJYA 1XPRA 5EPLA 4JI4L 4UPAA 3NBHA 5KEEA 1X56A 2V4DA 1UE1A 5GAEC 1RDPD 2LS01 3RLFA 2RSOA 3HOVB 3L7ZC 4A93H 2HDLA 2QILA 1CKMA 2E5LL 1R9TB 1BXTA 1S5ED 3NE5B 1VQEA 3A7LA 1PH1A 1WCMH 4A3MB 1HH2P 1G6PA 1NCVA 1X3GA 4GZYC 1SR3A 3HOYH 5KIXA 4LFCL 3HOZH 2OF1A 3S1QH 3K59A 1FNUA 1ILPA 1M4VA 2CQOA 4X3TA 1XNQL 2A68D 1N32L 2EJFC 2JXMB 1CK1A 4OWTB 2OEOA 4DV5L 2EVBA 1WOCA 2Z1CA 1EOVA 1QB5D 2M9VA 1ICFB 2FFKB 5CORA 3CCUA 4LF8Q 1BCPF 1VQKA 1W2BA 1C7YA 1EY9A 4G57A 5ELFA 3FRPB 3HOXG 3KBXA 4KKSA 3GTOH 1ESFA 1MJCA 1STHA 2NBFA 4K5VA 3J80E 4KHZA 1NSNS 4DV4Q 2MNAA 4OIJA 3MFGA 2L12A 2ZTCA 3PUXA 2EY5A 3BU2A 3GTLB 3PO3H 4F7XA 1HNXQ 1TWGB 1GXDC 3FKIB 4XYQA 5M5XB 3GTGH 5BR8Q 1NJIC 4A3GB 1BDOA 2K7VA 3ERQA 5EBCA 2F0MA 1BF4A 4PMWA 4DK3C 1HPCA 3BS1A 2PW7A 1IBKQ 4JI5Q 1D1IA 4OO1H 5TSSA 2R92B 2PQAB 4A4IA 1YEZA 3Q6SA 2F3IA 4KHPL 1HHVA 2KEDA 4OELB 3I4NH 4C1NI 2RF4A 5KYLA 1KD1C 1KDBA 2RVLA 1VQFA 1F77A 3CMAA 1WFQA 1J5EL 1TY2A 4DR1L 2NN6H 1C8CA 3ONAB 3CC4A 2F0TA 2KENA 1CQVA 3OWFA 1FNVA 3H91A 3C1EA 3PGZA 2UUAL 3KOJA 2LXKA 4K6DA 1Y1WG 2EOTA 3ULJA 1JJGA 5JOBA 1TS2A 4IUTA 4RH6A 1Q86C 1TS5A 3DWAA 4IQZA 2IHFA 4LFBL 2D0PA 3SK8A 4JBKA 3S1NH 2B2WA 1WTPA 3RD4A 5CMDA 4IJHA 4WJWA 4JBMA 1TWAH 4B3MQ 2PCFB 4C2MB 3GTJH 3TN2A 3DWPA 1YNXA 4BBRH 1V1QA 4DV2Q 1NR2A 1ENAA 4A3JG 4DR5Q 1Y1VH 2E2JH 1U4RA 3NWTA 1XTDA 2K75A 4IFDI 1RL2A 4O1NA 1KLUD 1X6OA 3CXCA 2Q2UA 3HFZB 1JE5A 3NTHA 3AMUA 2JJQA 3HOXB 3SVMA 5IGDA 1Q3LA 2YTXA 3A56A 1E22A 3G6JB 1B9NA 1TIID 3VA7A 5IGCA 3H09A 1J6QA 2EYJA 1F2LA 5FK9C 3M85A 1EY6A 3X3NA 5IGEA 4X3UA 4DGZA 3MEFA 4LNQA 1H9SB 3CCRA 5JVG3 1HNWQ 1F9RA 2KCNA 2DGYA 3KDFB 1PZKD 2A19A 1D8LA 3MXUA 1T5XD 2A5HA 1DOMA 5IE8A 1HNZQ 2WACA 5IYBH 1R4PB 3NP8A 2K05A 4HIKA 4RMFA 2L1BA 3IFTA 2R7ZG 4YWMA 1OXSC 2YV5A 3VDYA 3T56B 1K8GA 4HSVA 3OTOL 2ZJRA 4RCOA 1PYBA 5M5WH 2E74C 2PMZE 1JC7A 4P73A 4FP5D 3I73A 3RN5A 5C4XH 4LF5L 1N33L 4N9PA 1QE6A 4JV5L 2KHSA 3KLSA 3PIPA 3BDLA 2VY3A 4QMGA 4B3SL 4XQJA 4BA2I 1HXYD 4QQBX 2DY8A 1Y1WB 2EYLA 3R2TA 3K5LA 1LLRD 4BWGB 2DJFC 1KNEA 4Q0FA 5ELBA 4GNXB 2B2UC 1HZCA 4PMCA 5GAHC 4IFDG 2CWPA 4DV0L 1EOTA 1TS4A 2X6LA 4X62Q 1BCPD 3TS0A 1NBWA 1M1KC 1QZHA 3C3LA 2RHSB 1LT5D 2FMMA 4EQPA 4C3HG 3H6MA 3QWNA 2PMZB 3K0YA 3CCSA 2JA8G 2JEBI 3PUZA 3CD6A 1FD7D 2G5DA 1YITA 4JCVE 4A3JB 1TWFB 4KKTA 4QY7A 1X3QA 3T1HQ 4RGNA 1RCVD 1G2SA 3V05A 1K8OA 4IUNA 4HIMA 1LT6D 2VXWA 3R93A 2VQFL 5KNCA 3OHXC 1TWCB 2N78A 2SOBA 3RR5A 5IP7H 3NBIA 1CHQD 4DK6C 4JI4Q 3DWQA 1WI5A 2I46A 3T16A 2EE1A 2K5WA 2B2VC 2MPMA 3RNUA 2YU9H 1JICA 2I5HA 3PMFA 1A0IA 1ET6A 1NTGA 1JJ2A 1D5MC 4H44C 2B8GA 5I6YA 3W1GA 1LM0A 3KF8A 2XTIA 4QJFA 2RA4A 1CFMA 2E5LQ 4FXDA 4A3DH 3D6CA 2ZTEA 4GLXA 1IBLL 1G6ZA 2QEJC 1WTHA 1BQQT 5G3LF 2CHBD 1L1OB 2O5JC 5EQ0A 1ET9A 2EPBA 1S5BD 1M8AA 3KYHC 2JA7H 1H9KA 4LFCQ 3JAMi 1B50A 1RHPA 2TSSA 1U4LA 1XNQQ 2WFWA 5EKIA 2M00A 3LWEA 4A3BB 5DM73 1N32Q 2R7ZB 5K36G 2JE6I 1LYLA 1YZ6A 4DV5Q 3K58A 5FKAC 1EIFA 3PO2G 1K8AC 4LW1A 4I65A 1RJTA 4ID6A 1LTLA 5LHY1 3S2HB 3KLSX 4I7AA 1ILQA 2BA0A 2RQXA 3NK9A 2B29A 2ID0A 4LF6L 1GHJA 1CTMA 2XVSA 1BVSA 3CHBD 4RGOS 3K80C 2EZVA 1EQRA 1STYA 2MUYA 1GUTA 1BBUA 2HHHQ 4GOPA 1PRTF 4B3TL 4QGUA 3MXNB 3NBHB 5K5PA 4DUZL 2N3SA 2NVQB 2QKIC 3KUPA 3E0JA 2IY5B 5J1ZA 3HOYG 1XJVA 4OXPA 1K83B 3J81E 1UE5A 4KHVA 4N9TA 5D3IB 4JBJA 5JAVA 3S1MH 1PXUA 4RAUC 2EYOA 1STEA 4IPGA 4HJAA 2HD3A 4FVMA 4C3HB 3S1RH 4HIDA 2JA8B 4KHPQ 4FO2A 1E0BA 2K14A 4NKLA 1B4OA 3DLLA 1XMQL 2AQ1B 1LTSD 2ZJPA 1J5EQ 1X3PA 2IL8A 4C3IH 2CW0D 4DR1Q 2BE5C 4KD3A 2HT1A 1VQLA 4RWSC 1C4QA 1BR9A 1L1OC 1E24A 2RCFA 3S14B 1VQNA 4WJ3M 4LAAA 2UUAQ 4CDDC 1PTOB 4OGQC 3DUZA 4PV1C 3QO2A 2K01A 1XNRL 3MC0B 5E4XA 1HUMA 2F3WA 3I90A 3F8TA 3URYA 1EY8A 1EIGA 1KDAA 5JPNC 5FJ8G 4G4KA 1YNJD 3VR5A 2VUMH 2XIWA 4UDUC 4HIOA 4JOIC 4A3CG 3UDIA 4CDEC 4P75A 4R4OA 3PUYA 2Y0SE 5M9OA 2OQKA 1VF7A 4LK1C 4RGTA 5C0XH 3I4NG 1B44D 5EPJA 3WOEA 1WD0A 2LXJA 1EZ6A 2B2TC 1YHBA 2QDLA 4PZ7A 2VW9A 3QOJA 5GROA 3R3OA 3P75A 3PIP3 2PZUA 3GDEA 1G91A 2HQLA 4RKLA 5IYDG 1VQPA 4BY7H 1L0XB 2AMCB 1U4PA 2EJGC 3U50C 3PO2B 4DV6L 4A3KH 2Z6KC 2L55A 3GQBA 2FHTA 2XWBB 4AIMA 1A62A 1IBML 1Y69U 1LV9A 4MZ9A 1DCZA 4A3FH 3NUCA 4IO9A 3G71A 4DAMA 4JI7L 2A73B 4UP8A 3J80i 3S16B 4A76A 4U673 1JJCB 1QNKA 2ICIA 5NUCA 1AP0A 4RA8A 1YNJC 4XIGS 1WJJA 3SDZA 1TVXA 1X54A 4P74A 4EX5A 2G9HD 4H7BA 1AEXA 3CQZH 1IHZA 4YWLA 4DXFA 4DAYA 3HOYB 3DMUA 3QG1A 4BBRG 1MSHA 3NTIA 5COYA 1PH8A 3KJOA 1IYJB 5CYUA 1GUGA 3V96A 1VQ9A 1UE7A 4KY7A 2L11A 3OOCA 3MZ5A 3OTOQ 1EFID 3F2CA 2VB3X 4YWKA 1VMCA 4JI8L 3QIAA 2MHVA 4GLAC 4KMUC 5M3FH 3SGIA 1XMOL 5CC4A 3EA6A 4LF5Q 1N33Q 2JA6G 3LGJA 5C44H 1PZJD 4CKCA 4JV5Q 5D14A 2L15A 1ML0D 2N49A 4A3LG 2UXCL 3ZYYX 4B3SQ 3D0FA 2DJGC 2KQ3A 4BY1H 1KC8C 1S40A 2IPKD 1F9SA 4CDCC 5DLQE 2E2IB 1BNZA 4IPDA 3D6WA 1Q46A 1Y8NB 1SNOA 2E75C 1EEFD 1WYDA 2YTYA 2DY7A 1UEAB 3CF5A 1EQVA 5BN3A 3S15B 4F87A 5FOBB 5IYBG 4LUVA 1DM0B 4DV0Q 2CQAA 4R4IA 1PH4A 1A3UA 3MXGA 4A3EB 1LACA 1O78A 4ZLTF 2R93H 4QCLA 4PG3A 2O2LD 1VQCA 4L8JA 3I4NB 3PIOA 2ZXRA 1Q82C 3MTSA 2ICEC 1W3SA 3P7JA 3TP6A 1PRTD 3T1HL 3TREA 5CR3A 2KJXA 3I91A 4A75A 2GA4B 1PV4A 4IFDJ 2J0TD 4CHTB 3K7UC 2MO1A 5ELCA 3CC2A 1CZGA 3ZJYC 4DF7A 1K73C 2VQFQ 3NTKA 4PMBA 1ZYRC 1A6XA 5IGFA 3RMHA 2K33A 4EQOA 2ZXPA 4DNTB 2RDFA 4IALA 3L0OA 2AWNA 2Z0SA 2ZM6L 3K57A 5IP9H 3GTMH 1DOKA 2K4KA 1VQ8A 3I4MH 5I2YA 3S1NB 2NTTA 2XRSD 2ZXOA 4BA1I 3NENA 4RG1A 4TRDA 3HRZC 1BUVT 2EY1A 2KEEA 3KF6B 3CPFA 1EY4A 3GV6A 3IKJA 3U58A 1L0WA 3SR1A 3K8AA 3FVQA 4HMJA 3NQTA 1OXUA 1IBLQ 1SDFA 1V8QA 4HJ8A 1AH9A 2GVBA 1B9MA 4C3JH 5C4HA 4BBRB 4DAVA 1MIUA 1QCBD 1E1OA 4GN3B 2Q2HA 3M4QA 4IPCA 5J22A 1FNWA 4NMZA 1PRTC 4O42A 1IYUA 4F8MA 2N8NA 3EROA 2L5TA 4NXML 3DM1A 3GTPB 2PO4A 1HR0L 2SEBD 1O7ZA 3T51B 2EJMA 3EJIA 2JA6B 5KRUA 2UU9L 3M4OB 2L4NA 1PDQA 4LF6Q 4OX9L 5LMUL 2HHHL 1B7YB 2R3ZA 1ICWA 5M3MH 1SFOH 1NR4A 2NVYH 4B3TQ 1CKOA 1B2TA 4A3DG 1GUOA 5CGKA 4P71A 1C48A 4XQQA 4DUZQ 5HURA 4B9WA 3DXJC 3AB9A 1EU4A 1RD9D 4YCWA 3KF8B 4UY8C 3BVZA 2HCCA 3CCLA 2E2DC 3TP8A 1SNMA 2JA7G 1JCKB 4QF4A 1LTBD 1N9WA 5IOCA 4X65L 1K3RA 4IOAA 3A54A 1UUPA 4GLVB 3VR6A 4LUOA 3F2DA 1FYCA 2Z4HA 3E0EA 3S17B 3D4DA 2F03A 1MSGA 1DZ1A 4L5TA 5ELEA 4CKBA 2Q8RE 4DR2L 2F0GA 2K5HA 2ASBA 1YBYA 1DJRD 2RSNA 1F9PA 3M4PA 1XMQQ 1KHIA 5GAGC 3AFPA 2RDHA 5C0XI 3J7YW 1PH2A 1XYIA 2ZTDA 1VCIA 1KIXA 1K3BC 3NSWA 5IYCG 5HGTA 1Q12A 1X9NA 1XXGA 1I94L 2NZ1D 1D5ZC 1F2MA 1XNRQ 5IODA 2FJ2A 2D9UA 2EYMA 2B2YC 1DD2A 1I4XA 2WAQG 3STBC 1ESRA 1CM9A 1RTNA 4HN7A 3RZOB 1QNUA 1I4RA 4OWXB 3BZKA 2I07B 1I4GA 2EYPA 1KNAA 3BZCA 2B63H 4DAPA 1QJOA 1V43A 3OWEB 1EL0A 4K5WA 1X3EA 3J81j 3WWVA 1JR0D 1SE4A 1Z9FA 1ASZA 4IOCA 3HOVH 3S24A 3O13A 1WTRA 4DR6L 1R9TH 3BZDB 3CPWA 1I3QH 2G9DA 4IUVA 2K5NA 4AYBG 4DV6Q 4G7HC 1SNCA 1E2WA 4K6LA 4HJ9A 2MP1A 3OW7A 1JMCA 2F1MA 1SE8A 1IBMQ 2YU9B 4ULLA 2F0JA 2K03A 3GP7A 1W6KA 3SK4A 2UUCL 5IGGA 4HJ5A 2NVTB 2M2LA 4JI7Q 3H3VC 1N34L 4J1MA 2NVXB 1JE4A 4A3IG 2DUDA 2F52A 4Q5VA 3ULPA 5D3DA 2K5VA 4A3DB 3PIO3 3NXWA 5FLMG 3X3MA 2JA5G 3P20A 5C0XG 4YIJA 5LMNW 3VR4A 3W1BA 2JA7B 1M90C 4XT1B 2QF7A 2WAQE 3A0JA 5BN4A 3J81i 4FF1A 4HCEA 3GTLH 4BY7G 4POFA 1TWGH 3VR2A 3TSSA 4DA2A 5M5YB 3FKIH 3WDNA 1TQOA 4A3KG 3I72A 4DNIA 4A3GH 4DR7L 4KKUA 1SYEA 2A6EC 1PFNA 4APVA 3EQLC 3DEOA 2XN9C 4JI8Q 3CCJA 2A69D 1CKNA 4P72A 4A3FG 1XMOQ 2C5CA 1PTOF 1SNQA 4PZ6A 4X3KA 1G51A 2R92H 4JI6L 4GN5A 1XX8A 4GKKQ 4X66L 2O4XA 1Y8OB 2UXCQ 3HOWH 2BDOA 1NMFA 1V9PA 4AYBE 1PH7A 4KTAA 3J7AF 4WFN3 4WRDA 4PQXA 4KV6A 2EYHA 2WAQB 1CA5A 1HTLD 3K7AH 1SN8A 1MBYA 4OONA 3HG9A 1X3FA 1H9RA 5C3EG 2A74C 1I5FA 1SROA 3UE0A 3S1MB 2WV6D 1HUNA 3A55A 5C5LA 3MA2B 3LX0A 1WTQA 5CV6A 2JP1A 4DAYB 5IT9L 3RLNA 2RKSA 4IUPA 4LUZA 5BN5A 4XYOA 4PNYA 1UWVA 3FPPA 2F4VL 5M3FG 2PI2E 4KY6A 3I3CA 4WJ4A 2F0UA 4X64L 3C1FA 2A69C 4XQNA 1TR5A 4LF9Q 1Q1EA 1I6HH 2ATWA 1YHAA 5KNBA 4AYBB 1EY0A 2XGTA 4C2MH 3K5NA 1HFNA 4LFAL 3E5SA 3MXPA 2F0SA 4HEDA 4JC0A 2Q2TA 4LF7L 2JK8A 2I5MX 1HCZA 3EVQA 4FXGC 3RZDB 2ZM6Q 3D31A 3BYYB 3QOLA 1PYSB 3OYYA 1SXTA 4C56C 4A3IB 3TMEA 1K0RA 2IWHA 2N55A 2EY2A 4KN7C 4U68A 2F0DA 1S72A 2X69A 1SEBD 3M4YA 1NUCA 5KYIA 2HIXA 2JA5B 1B3QA 1SYDA 5J3BA 2PYKA 1QUQA
chains in the Genus database with same CATH topology
4R8NA 5C3XA 1LTID 2WINB 2L0CA 3N52A 1BBXC 4BY7B 1LTTD 4I7ZC 4Z9CB 1O7YA 4A3KB 5JEAG 5C5MA 4OO1I 2BE5D 1EYCA 1I4PA 2SNSA 1WVLA 4ZQ3A 1GUSA 4DK0A 5JVH3 1IW7C 1YNND 2NYZD 3IAYA 1STBA 2B39A 3MFYA 2NN6I 3VR3A 2LY7A 5IGBA 5JJZA 1RODA 5IT9E 4ZUIA 3OIQA 3SK5A 4IN3A 5C3EB 4HAEA 2F0WA 1F2YA 1Q8IA 1LO5D 2NUCA 5M3FB 4IUUA 1W6JA 1I50B 2L9HA 3BG3A 3NWSA 2BOSA 1YNNC 2F0LA 3F2UA 4MHEA 1F2ZA 3I8ZA 1CHPD 2B2UA 1QILA 3G7LA 4E6IA 2VB2X 4HCSA 4OO1G 4ODGA 1HRJA 1JWSD 2R6GA 4X3SA 3A8KE 4IZ8A 1H9SA 1PFMA 2K6AA 1CQFA 2HUGA 3K5MA 1TWHB 1SE2A 1V1PA 1SNPA 1LT4D 2IX1A 1A2TA 4NP5A 4KJNA 2NN6G 2AUKA 3J7AV 4DN4M 5JPMC 2HQEA 4RGMA 3M3YB 2MGSA 1EY7A 4MIUA 2KOLA 4H0LC 1S5DD 1SYBA 2B2VA 1EQTA 5EKKA 1AZQA 1JWUD 1L0YB 2IX3A 1SNDA 3BDOA 4A93B 1D1KA 2DNCA 4KI0A 3KK7A 4J8QA 5A35A 4DNRB 4MN3A 1WCMB 3V2TA 4FF3A 1X32A 1SJHD 3HOZB 1SYCA 3S1QB 3FMCA 1PTOC 3U9SA 3HZXA 1LTGD 1MD2D 2F4IA 3D4WA 1HQMC 3ND8A 1WD1A 5CV8A 1GHKA 2D2CC 3RUZA 5C0XJ 3GTOB 4H13C 1ZYRD 2K04A 5FLXL 3PO3B 2RBMA 5M3MB 2O5IC 5G3LD 1SFOB 4HSPA 1WTWA 3TDQA 5I2XA 4K5XA 3GTGB 3S9WA 2BDNA 3FDTA 5DAUA 1SMYC 5CV4A 1O80A 1IKLA 1JOQA 5ELDA 3CKIB 1WTOA 4V190 2AUJD 3E6ZX 1TKWB 4XTCS 1A3TA 2A6HC 1IL8A 2F0QA 3J80L 1A3VA 3PUWA 1AFPA 1EZ8A 1KDCA 1QOHA 1JORA 4DU9A 3L9AX 2WB1B 3TP5A 3TZUA 1SJED 5FO9B 3K5OA 2OT2A 5I6WA 2B2WC 1K8MA 3A8IE 1WTVA 4KY5A 4G7OC 4CKEA 3LNNA 3MEHA 2JSOA 2EDGA 1UAPA 2IX0A 3W2DA 4CGYB 2F0FA 5F2DA 2R61A 3VYSA 2HDMA 1I4HA 1NAPA 1TWAB 3L3OC 2H1EA 3K6OA 4C1NK 1S4ZA 2B2TA 3MXNA 3GTJB 3SHLA 1TS3A 1Y1VB 4XT3B 4R8IA 2WKCA 2E2JB 3NHHA 4OHJA 1I3QB 2IJ0A 1Q90A 5FLXE 1SSOA 2KUMA 1HQRD 2WKDA 4FF2A 3R2IA 1KABA 2YYZA 5LL6X 1MGSA 1STNA 1ENFA 3FEWX 2DNEA 2DN8A 4XDXA 3HKZB 1CI3M 3GO5A 2BCOA 5JEAJ 4QIWB 4EQNA 4HTHA 2OXPA 3M7GA 3A8JE 1LABA 2MJ8A 1XWEA 5C3WA 3W3AA 4CBVA 3OIPA 1I4QA 1S5FD 2AQ2B 1PFBA 5M5WB 2ENBA 2Z4IA 5C4XB 4DFAA 1U9RA 1H9MA 1RTOA 2F0NA 4RCNA 5EGTA 4UAIA 1VDZA 2A68C 3HOWB 1STAA 3VYUA 1BO0A 1S5CD 1TY0A 1OO9B 4K2LA 4FNFA 3K7AB 1H9JA 3N6RA 3DHQA 4KJOA 3EFXD 3I70A 4KK7A 3VYTA 1KTKA 2J4XA 1V1OA 2D5DA 1EIHA 5CBEE 1D5XC 2Q8IB 3WOFA 1ZEQX 4KN4C 4C3IG 4DXGA 2TMPA 3TZDA 1OXTA 3Q24A 4FXKC 1I6HB 3IFDA 3A7AB 4S3SA 2A6ED 5E1FA 2F0PA 1RF2D 3IL8A 4V0BA 4QB4A 3M7NA 1B1ZA 4XXEA 5AFWA 2FMCA 3SEBA 1JQYD 5DNFA 1D2BA 2H4OA 1Q1BA 4NDXA 5T1GA 5I9PA 3PV0A 1VMPA 2F0VA 2K1BA 5CV5A 4EGVA 2QCPX 1V1PB 4B08A 3BVMA 1SYGA 1G291 2NWGA 1AN8A 1LT3D 4L6TB 2EY6A 5FO8B 3VYRA 2LFNA 1CZWA 3BYTB 2ZT9C 3OMGA 3TP7A 1IYVA 4B9XA 2PNRC 3Q23A 1BCPB 4ZYSA 5CV7A 4CJ1B 3NQIA 1XTCD 4Y7NB 1TU2B 1PMRA 3C46A 2F0OA 1PZID 3S1RB 1PLFA 1UNSA 1JOKA 3T4AC 3H0GB 3PUVA 1WTXA 5J39A 1ZKOA 4K14A 1E2ZA 2F0KA 4C3IB 1A2UA 3HS0C 2JEAI 4LJZC 1VF5C 1Z7TA 3T13A 5ISRA 4K8IA 1DOLA 4OL7A 3GTQB 3H94A 2B2YA 1IW7D 2JYOA 3J81L 3Q22A 4K8JA 2WIIB 2LMCB 3D8GA 1CT1D 5C4JB 3HP3A 1OXXK 5EJWA 2VUMB 3GTKB 2PZWA 3OPOA 5C4ZA 1SBBB 2EXZA 1GUNA 2XWJB 3OSOA 4LMQD 4P2CB 3MAQA 2PQEA 3CRKC 1BOSA 1FGBD 3HOUB 5T1IA 2VNUD 2Z8LA 2WP8J 2K5QA 1BCPC 3FPUB 3U9OA 1KAAA 3GV3A 4A3FB 2IW3A 1B3AA 1PYWD 3SXHA 1AW7A 4RHRA 1GOZA 1HTPA 4IURA 3HGBA 1TT2A 4HMIA 4ILWA 1EYAA 3CQZB 2K28A 4BS9A 2PW5A 1SYFA 4C3JG 5EPKA 4M1UB 3QB3A 5LL6S 4DK1A 2B8FA 1ZXTA 2F0IA 3KBGA 4F88A 1Z47A 4KD4A 1ONLA 1QWYA 1EWCA 1IKMA 4ZRZA 2PPBC 2HCIA 4WORA 3CU7A 2SNMA 4RFBA 2D62A 2E2HB 3D4RA 1D6EC 1EYDA 3AU7A 5C44B 3Q0AA 3SK6A 3P1HA 4BY1B 4FYDA 1SAPA 3JAML 5FO7B 1EEID 1EWHA 2RDGA 4FF4A 1I6VC 4QUCA 3ITPA 4TKOB 4ZAIA 5I4DA 3BVGA 3VA5A 3T53B 2AQ3B 2KA7A 3TBIB 1R4QB 3MWYW 1JB3A 2CVRA 2N88A 2R93B 2Q8TA 3MHBA 2BA1A 1OXVA 1PTOD 4ME5A 1J8IA 5A2QL 4G7ZC 2EYFA 2NTSA 5I9OA 4TSSA 3CRLC 3UI2A 3C2PA 4RHSA 1G8ZD 2FINB 1II3A 5CV9A 3GD7A 3R8BA 1B53A 1A15A 1EY5A 2F0HA 4EVOA 3ND9A 3GTMB 3I4MB 4IUQA 1DONA 3NPPA 2CW0C 5IIFA 1SMYD 4ZK9B 1JWMD 1Y8PB 3OMCA 5CBAE 1HA6A 1HA5A 3D3RA 5E4WC 4ZUJA 1AZPA 4C3JB 5D65A 5DEHA 4R9WA 1RKNA 1DYQA 3LWUA 4BBSB 2PZTA 1CA6A 3HEJA 2A6HD 2Y0SB 5C6AA 1EU3A 2K32A 1SE3A 1G2TA 2AWOA 5KNDA 2F3VA 2K5DA 2KVMA 4HR7B 4RKBA 3JAME 4IFDH 2KCCA 5E3FA 3DEPA 1Z6HA 2XRQD 4CJ0B 4JBWA 2NVYB 1FR3A 4K2KA 1HFGA 2F0EA 1GUWA 4L63B 1LTAD 3I4LA 4TQUS 1DXMA 2J7ZA 5A2QE 2XSCA 1E2VA 2E76C 2X6GA 4ZKBB 1PTOH 4JK1C 1F9QA 1O7LA 2IT1A 1STGA 2QDBA 4ABNA 2NB0A 1PRTB 4NW2A 3MVVA 5EBDA 1LTRD 4CJ2C 4M8AA 5EKLA 1U4MA 1GJXA 2XNAC 5DM63 2C9OA 1T5EA 2KECA 1QG7A 1JOOA 4J6HA 4OIKA 1KLGD 2SDFA 2LKVA 5K36H 4QUFA 5KGUA 4ZKCB 1J9OA 3BDCA 1ENCA 3SE0A 3KLRA 5JEAH 2B63B 1MI2A 3QJYA 5EPLA 3NBHA 5KEEA 2V4DA 1RDPD 2LS01 3RLFA 2RSOA 3HOVB 3L7ZC 2HDLA 2QILA 1R9TB 1BXTA 1S5ED 3NE5B 3A7LA 4A3MB 1NCVA 4GZYC 5KIXA 2OF1A 3K59A 1FNUA 1ILPA 1M4VA 4X3TA 2A68D 2EJFC 2JXMB 1CK1A 2OEOA 2EVBA 2Z1CA 1QB5D 2M9VA 5CORA 2FFKB 1BCPF 1EY9A 4G57A 5ELFA 3FRPB 3KBXA 4KKSA 1ESFA 1STHA 2NBFA 4K5VA 3J80E 4KHZA 1NSNS 4OIJA 3MFGA 2L12A 3PUXA 2EY5A 3GTLB 4F7XA 1TWGB 1GXDC 3FKIB 4XYQA 5M5XB 4A3GB 1BDOA 2K7VA 3ERQA 5EBCA 2F0MA 1BF4A 4PMWA 1HPCA 3BS1A 2PW7A 1D1IA 4OO1H 5TSSA 2R92B 3Q6SA 1HHVA 2KEDA 4C1NI 5KYLA 1KDBA 2RVLA 1F77A 1TY2A 2NN6H 1C8CA 3ONAB 2F0TA 1CQVA 3OWFA 1FNVA 3H91A 3C1EA 4K6DA 2EOTA 5JOBA 1TS2A 4IUTA 4RH6A 1TS5A 3DWAA 4IQZA 3SK8A 2B2WA 1WTPA 3RD4A 5CMDA 4WJWA 2PCFB 4C2MB 3TN2A 3DWPA 1NR2A 1ENAA 1U4RA 3NWTA 4IFDI 4O1NA 1KLUD 3AMUA 3NTHA 3HOXB 3SVMA 5IGDA 1Q3LA 3A56A 3G6JB 1B9NA 1TIID 3VA7A 5IGCA 3H09A 2EYJA 1F2LA 5FK9C 3M85A 1EY6A 3X3NA 5IGEA 4X3UA 4DGZA 1H9SB 5JVG3 1F9RA 2KCNA 1PZKD 3MXUA 1T5XD 2A5HA 1DOMA 2WACA 1R4PB 3NP8A 2K05A 2L1BA 3IFTA 1OXSC 3T56B 4HSVA 4RCOA 2E74C 1JC7A 4FP5D 3I73A 4N9PA 1QE6A 2KHSA 3KLSA 3BDLA 4QMGA 4XQJA 4BA2I 1HXYD 2DY8A 1Y1WB 2EYLA 3R2TA 3K5LA 1LLRD 4BWGB 1KNEA 4Q0FA 5ELBA 2B2UC 4PMCA 4IFDG 1EOTA 1TS4A 2X6LA 1BCPD 3C3LA 1LT5D 4EQPA 2FMMA 4C3HG 3H6MA 3QWNA 2PMZB 3K0YA 2JEBI 3PUZA 1FD7D 4A3JB 1TWFB 4KKTA 1X3QA 4RGNA 1RCVD 1G2SA 3V05A 1K8OA 4IUNA 1LT6D 2VXWA 3R93A 5KNCA 3OHXC 1TWCB 2SOBA 3NBIA 1CHQD 3DWQA 2I46A 3T16A 2EE1A 2K5WA 2B2VC 2MPMA 1JICA 3PMFA 1ET6A 1D5MC 4H44C 2B8GA 5I6YA 3KF8A 2RA4A 1CFMA 4FXDA 3D6CA 1G6ZA 2QEJC 1BQQT 5G3LF 2CHBD 2O5JC 5EQ0A 1ET9A 2EPBA 1S5BD 1M8AA 1H9KA 1B50A 1RHPA 2TSSA 1U4LA 2R7ZB 5EKIA 5K36G 2M00A 3LWEA 4A3BB 5DM73 2JE6I 3K58A 5FKAC 4I65A 1RJTA 4ID6A 5LHY1 3S2HB 3KLSX 1ILQA 2BA0A 2RQXA 3NK9A 2ID0A 1GHJA 1CTMA 2XVSA 3CHBD 4RGOS 2EZVA 1STYA 2MUYA 1GUTA 1PRTF 5K5PA 2NVQB 2QKIC 3KUPA 3E0JA 5J1ZA 1K83B 3J81E 5D3IB 4KHVA 4N9TA 5JAVA 1PXUA 4RAUC 2EYOA 1STEA 4FVMA 4C3HB 2JA8B 4FO2A 1E0BA 4NKLA 1B4OA 2AQ1B 1LTSD 1X3PA 2IL8A 2CW0D 2BE5C 4KD3A 4RWSC 1C4QA 1BR9A 3S14B 4LAAA 1PTOB 4OGQC 3DUZA 4PV1C 3QO2A 2K01A 3MC0B 5E4XA 1HUMA 2F3WA 3I90A 3URYA 5JPNC 1EY8A 1EIGA 1KDAA 4G4KA 1YNJD 3VR5A 2XIWA 4UDUC 3PUYA 5M9OA 1VF7A 4LK1C 4RGTA 5C0XH 1B44D 5EPJA 3WOEA 1WD0A 1EZ6A 2B2TC 3QOJA 3R3OA 3P75A 3PIP3 2PZUA 1G91A 4RKLA 1L0XB 1U4PA 2EJGC 3PO2B 2L55A 3GQBA 2FHTA 2XWBB 1Y69U 1LV9A 1DCZA 3NUCA 2A73B 3S16B 4U673 1QNKA 2ICIA 5NUCA 1AP0A 4RA8A 1YNJC 4XIGS 3SDZA 1TVXA 2G9HD 4H7BA 1AEXA 1IHZA 4DXFA 4DAYA 3HOYB 3DMUA 3QG1A 1MSHA 3NTIA 5COYA 5CYUA 1GUGA 3V96A 4KY7A 2L11A 3OOCA 3MZ5A 1EFID 2VB3X 1VMCA 3QIAA 2MHVA 4KMUC 5CC4A 3EA6A 1PZJD 4CKCA 5D14A 1ML0D 3ZYYX 2KQ3A 2IPKD 1F9SA 2E2IB 1BNZA 3D6WA 1Y8NB 1SNOA 2E75C 1EEFD 2DY7A 1UEAB 1EQVA 5BN3A 3S15B 4F87A 5FOBB 1DM0B 2CQAA 1A3UA 3MXGA 4A3EB 1LACA 1O78A 4ZLTF 4QCLA 2O2LD 4L8JA 3I4NB 2ZXRA 3MTSA 2ICEC 3P7JA 3TP6A 1PRTD 5CR3A 2KJXA 3I91A 2GA4B 4IFDJ 2J0TD 4CHTB 5ELCA 1CZGA 4DF7A 3NTKA 4PMBA 1ZYRC 1A6XA 5IGFA 3RMHA 2K33A 4EQOA 2ZXPA 4DNTB 2RDFA 4IALA 2AWNA 3K57A 1DOKA 5I2YA 3S1NB 2NTTA 2XRSD 2ZXOA 4BA1I 4TRDA 3HRZC 1BUVT 2EY1A 2KEEA 3GV6A 1EY4A 3IKJA 3SR1A 3FVQA 4HMJA 3NQTA 1OXUA 1SDFA 1V8QA 1B9MA 5C4HA 4BBRB 4DAVA 1QCBD 5J22A 1FNWA 4NMZA 1PRTC 4O42A 1IYUA 4F8MA 3EROA 2L5TA 3DM1A 3GTPB 2PO4A 2SEBD 1O7ZA 3T51B 2EJMA 3EJIA 2JA6B 5KRUA 3M4OB 2L4NA 1PDQA 2R3ZA 1ICWA 1NR4A 1B2TA 1GUOA 5CGKA 1C48A 4XQQA 5HURA 4B9WA 3DXJC 3AB9A 1EU4A 1RD9D 3BVZA 2HCCA 2E2DC 3TP8A 1SNMA 1JCKB 4QF4A 1LTBD 5IOCA 3A54A 1UUPA 3VR6A 1FYCA 2Z4HA 3S17B 3D4DA 2F03A 1MSGA 1DZ1A 5ELEA 4CKBA 2Q8RE 2F0GA 1DJRD 2RSNA 1F9PA 2RDHA 5C0XI 3J7YW 1XYIA 1VCIA 3NSWA 5HGTA 1Q12A 1XXGA 2NZ1D 1D5ZC 1F2MA 5IODA 2FJ2A 2D9UA 2EYMA 2B2YC 1DD2A 1I4XA 1ESRA 1CM9A 1RTNA 4HN7A 3RZOB 1QNUA 1I4RA 2I07B 1I4GA 2EYPA 1KNAA 4DAPA 1QJOA 1V43A 3OWEB 1EL0A 4K5WA 1JR0D 1SE4A 3O13A 1WTRA 3BZDB 2G9DA 4IUVA 4G7HC 1SNCA 1E2WA 4K6LA 2MP1A 3OW7A 2F1MA 2YU9B 4ULLA 2F0JA 2K03A 3GP7A 1W6KA 3SK4A 5IGGA 2NVTB 2M2LA 3H3VC 4J1MA 2NVXB 1JE4A 4Q5VA 5D3DA 4A3DB 3PIO3 3NXWA 3X3MA 3P20A 5C0XG 4YIJA 3VR4A 2JA7B 4XT1B 2QF7A 5BN4A 4FF1A 4HCEA 3VR2A 3TSSA 4DA2A 5M5YB 3WDNA 1TQOA 3I72A 4KKUA 1SYEA 2A6EC 1PFNA 3EQLC 3DEOA 2XN9C 2A69D 2C5CA 1PTOF 1SNQA 4X3KA 1XX8A 2O4XA 1Y8OB 2BDOA 4KTAA 3J7AF 4WFN3 4WRDA 4PQXA 4KV6A 2EYHA 2WAQB 1CA5A 1HTLD 1MBYA 3HG9A 1H9RA 2A74C 3S1MB 2WV6D 1HUNA 3A55A 5C5LA 3MA2B 3LX0A 1WTQA 5CV6A 2JP1A 5IT9L 2RKSA 4IUPA 5BN5A 4XYOA 4PNYA 3FPPA 4KY6A 3I3CA 2F0UA 3C1FA 2A69C 4XQNA 1TR5A 1Q1EA 5KNBA 4AYBB 1EY0A 3K5NA 1HFNA 3E5SA 3MXPA 2F0SA 4HEDA 3EVQA 1HCZA 4FXGC 3RZDB 3D31A 3BYYB 3QOLA 1SXTA 4C56C 4A3IB 3TMEA 2IWHA 2N55A 2EY2A 4KN7C 4U68A 2F0DA 2X69A 1SEBD 3M4YA 1NUCA 5KYIA 2JA5B 1SYDA 2PYKA 3S2DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HR7 B;  3M7N A;  3GQB A;  1GHJ A;  4IQZ A;  1CTM A;  1IW7 D;  2R6G A;  3NE5 B;  3VR2 A;  2AUJ D;  3A7L A;  3A8K E;  1TKW B;  2KCC A;  3WDN A;  4XTC S;  1Y69 U;  1GUT A;  1H9S A;  4IFD H;  1DCZ A;  2LMC B;  3I72 A;  3A8J E;  1ZYR C;  4KKU A;  1EWH A;  4GZY C;  1A6X A;  1LAB A;  1Z6H A;  1Q1B A;  2K33 A;  1I6V C;  2A6E C;  1OXX K;  2A6H C;  4I7Z C;  3EQL C;  4DNT B;  4TKO B;  3W3A A;  1VCI A;  4IFD G;  2A69 D;  2PCF B;  4JBW A;  2NN6 G;  5JEA G;  2AUK A;  2A68 D;  2EJF C;  1Q12 A;  2JXM B;  1YNJ C;  3OPO A;  3PUW A;  4XIG S;  3SDZ A;  3T53 B;  2BE5 D;  1GUN A;  2KA7 A;  1FR3 A;  2EVB A;  4BA1 I;  3PV0 A;  3TZU A;  1Y8O B;  1GUS A;  3I4L A;  4DK0 A;  1IW7 C;  1DD2 A;  3CRK C;  2BDO A;  4H0L C;  4TQU S;  2JEB I;  3PUZ A;  3IKJ A;  1DXM A;  3QG1 A;  2BA1 A;  1E2V A;  1OXU A;  1OXV A;  1V8Q A;  2E76 C;  4KKS A;  1K8M A;  3MFY A;  4KKT A;  1B9M A;  3A8I E;  2NN6 I;  3BDO A;  3VR3 A;  4G7O C;  1H9M A;  4KHZ A;  4G7Z C;  4RCN A;  3LNN A;  4JK1 C;  1K8O A;  1GUG A;  1VDZ A;  1H9R A;  2DNC A;  1O7L A;  1QJO A;  1V43 A;  2A68 C;  1G29 1;  2EDG A;  2IT1 A;  3PUX A;  3OOC A;  4KI0 A;  2BE5 C;  1B9N A;  5KNC A;  3CRL C;  3VA7 A;  3QIA A;  5A35 A;  4DNR B;  4KMU C;  3M85 A;  1IYU A;  1BDO A;  2K7V A;  5BN5 A;  1H9S B;  1H9J A;  2L5T A;  3GD7 A;  3N6R A;  4OGQ C;  1GJX A;  4PV1 C;  3FMC A;  3FPP A;  1HPC A;  3U9S A;  4H44 C;  2B8G A;  2ZT9 C;  3ND9 A;  3T51 B;  2EJM A;  4OO1 H;  1IYV A;  4G7H C;  3MXU A;  1HTP A;  1E2W A;  1CFM A;  2PNR C;  1T5E A;  2A69 C;  3HGB A;  1HQM C;  1Q1E A;  2D5D A;  3VR5 A;  2CW0 C;  3ND8 A;  3OW7 A;  5KNB A;  1Y8N B;  2F1M A;  2E75 C;  1TU2 B;  1GHK A;  1Y8P B;  2Q8I B;  2O5J C;  2D2C C;  3BG3 A;  3IFT A;  5K36 H;  4DK1 A;  3PUY A;  1OXS C;  1GUO A;  1PMR A;  2B8F A;  5BN3 A;  1VF7 A;  1Q90 A;  1H9K A;  1YNN C;  4KN4 C;  4LK1 C;  3T56 B;  3DXJ C;  3SE0 A;  3KLR A;  5C0X H;  3AB9 A;  2NN6 H;  3PUV A;  5JEA H;  1HCZ A;  1OXT A;  1LAC A;  1ZKO A;  5K36 G;  1ONL A;  3D31 A;  3LWU A;  1O78 A;  3QJY A;  4H13 C;  1E2Z A;  2E74 C;  2JE6 I;  3A7A B;  2YYZ A;  2A6E D;  2A6H D;  3I73 A;  4L8J A;  2O5I C;  3P20 A;  5C0X G;  2JEA I;  4LJZ C;  1VF5 C;  2PPB C;  1Z7T A;  2K32 A;  2V4D A;  4KN7 C;  2DNE A;  2DN8 A;  2AWO A;  3VR4 A;  2D62 A;  3RLF A;  3VR6 A;  5KND A;  3L7Z C;  1SMY C;  1FYC A;  3M4Y A;  2QF7 A;  2EJG C;  3D4R A;  4BA2 I;  4OO1 G;  2BA0 A;  1CI3 M;  3H94 A;  5BN4 A; 
#chains in the Genus database with same CATH topology
 4R8N A;  5C3X A;  1LTI D;  5IWA L;  2WIN B;  2L0C A;  1L2F A;  3N52 A;  4R4Q A;  1BBX C;  4BY7 B;  3TS2 A;  1LTT D;  1A8V A;  4I7Z C;  4Z9C B;  1O7Y A;  4GNX C;  4DR3 L;  4A3K B;  2GVA A;  2PQA A;  5JEA G;  5C5M A;  4OO1 I;  3CW2 C;  3DM3 A;  2BE5 D;  1FGU A;  1EYC A;  4NXM Q;  1I4P A;  3RLO A;  2SNS A;  1WVL A;  4ZQ3 A;  1HR0 Q;  1GUS A;  4DK0 A;  5JVH 3;  1IW7 C;  1YNN D;  2NYZ D;  5IP9 G;  2UU9 Q;  4UHV A;  2NZH A;  2JQO A;  1YHQ A;  3IAY A;  1STB A;  4A93 G;  3AQQ A;  4IPH A;  4OX9 Q;  2B39 A;  5LMU Q;  1NY4 A;  1CSP A;  4DUY L;  3MFY A;  2NN6 I;  3VR3 A;  2LY7 A;  5IGB A;  4GKJ L;  1Q8K A;  1VQ5 A;  5IT9 c;  5JJZ A;  4L5R C;  1WCM G;  1ROD A;  1TXY A;  5IT9 E;  4ZUI A;  3OIQ A;  3SK5 A;  4IN3 A;  3HOZ G;  5C3E B;  4HAE A;  4R4C A;  2F0W A;  4Y7N H;  1GM5 A;  4X65 Q;  5JJL A;  1YIJ A;  3I56 A;  1VQB A;  1Y1W H;  1F2Y A;  1Q8I A;  3H0G H;  1LO5 D;  2NUC A;  4DR2 Q;  5M3F B;  4IUU A;  1W6J A;  2RCN A;  1VQO A;  4TVA B;  1I50 B;  2AHO B;  2L9H A;  3U4V A;  3BG3 A;  3K0X A;  3NWS A;  2BOS A;  1YNN C;  3PO3 G;  3AFQ A;  3GTQ H;  5M3M G;  1SRU A;  2F0L A;  1EQQ A;  3F2U A;  4MHE A;  1I94 Q;  1F2Z A;  3I8Z A;  1CHP D;  2B2U A;  1QIL A;  3G7L A;  4E6I A;  2VB2 X;  5C4J H;  1LUZ A;  4HCS A;  4AQY L;  4OO1 G;  3ICE A;  3GTK H;  4ODG A;  1QVG A;  3CP0 A;  1HRJ A;  1JWS D;  2R6G A;  1TWC H;  4X3S A;  3A8K E;  2LSS A;  4IJL A;  4IZ8 A;  1H9S A;  1PFM A;  2K6A A;  1CQF A;  2HUG A;  3K5M A;  1TWH B;  1SE2 A;  2ZJQ A;  1V1P A;  1SNP A;  1LT4 D;  2IX1 A;  1A2T A;  2WB1 G;  4NB3 A;  4NP5 A;  3HOU H;  4KJN A;  1B70 B;  2NN6 G;  2QGQ A;  3NEL A;  2AUK A;  1PHJ A;  3J7A V;  3CAM A;  1A63 A;  2VZA A;  4DN4 M;  3QR8 A;  5JPM C;  2CH4 W;  2HQE A;  3BJU A;  4DR6 Q;  1C0A A;  4J15 A;  4RGM A;  3M3Y B;  2MGS A;  1EY7 A;  4MIU A;  4L5Q A;  2KOL A;  3W5O A;  4H0L C;  1HZA A;  1S5D D;  1SYB A;  2B2V A;  1N8R C;  1EQT A;  5EKK A;  1AZQ A;  1JWU D;  2BH8 A;  1L0Y B;  2IX3 A;  4DV3 L;  1H95 A;  1S3O A;  1SND A;  3BDO A;  1IL2 A;  4A93 B;  4A3B H;  2UUC Q;  1D1K A;  2DNC A;  4MTK A;  1NE3 A;  5AJ3 Q;  2I0Q A;  1N34 Q;  1UE6 A;  4KI0 A;  2OTL A;  3KK7 A;  1EUJ A;  3UDF A;  4J8Q A;  5A35 A;  4DNR B;  2Z9H A;  4MN3 A;  1WCM B;  2Z6B A;  3V2T A;  5H1S E;  4FF3 A;  1X32 A;  4DKA C;  2QW7 A;  1SJH D;  3HOZ B;  2UXD L;  1SYC A;  3S1Q B;  3FMC A;  1PTO C;  2H5X A;  3U9S A;  3HOV G;  3HZX A;  1LTG D;  1Y1V G;  1MD2 D;  2F4I A;  3D4W A;  4GN4 B;  4JI2 L;  1HQM C;  2K52 A;  2OCE A;  3ND8 A;  5CV8 A;  2VQE L;  1WD1 A;  4K0K L;  1GHK A;  3T1Y L;  4DR4 L;  2EXD A;  2D2C C;  4DR7 Q;  1BBW A;  3RUZ A;  5C0X J;  1KRS A;  2E2H H;  3GTO B;  1K83 H;  2WB1 E;  1FJG L;  4H13 C;  1ZYR D;  2K04 A;  5FLX L;  4GKK L;  4JI6 Q;  3PO3 B;  3I7F A;  1BKB A;  2RBM A;  5M3M B;  2O5I C;  5G3L D;  3HKZ G;  1SFO B;  3UE1 A;  4X66 Q;  4HSP A;  1ASY A;  1WTW A;  2JA8 H;  3TDQ A;  5I2X A;  4K5X A;  3GTG B;  1VQD A;  3S9W A;  2BDN A;  3FDT A;  5DAU A;  1SMY C;  5CV4 A;  1O80 A;  2AKW B;  1IKL A;  1JOQ A;  1VQJ A;  5ELD A;  3CKI B;  4JW0 A;  1WTO A;  4R1J A;  4V19 0;  2AUJ D;  3E6Z X;  1TKW B;  4XTC S;  1A3T A;  2NZO A;  3Q8D A;  2A6H C;  2EQS A;  1N36 L;  1IL8 A;  2F0Q A;  3J80 L;  1A3V A;  3PUW A;  1AFP A;  1EZ8 A;  1KDC A;  1QOH A;  1JOR A;  4DU9 A;  3L9A X;  2WB1 B;  3TP5 A;  5C4X G;  3TZU A;  2F4V Q;  1SJE D;  5FO9 B;  3EIV A;  3K5O A;  4LF9 L;  2OT2 A;  1D7Q A;  2B3G A;  5I6W A;  2R92 G;  4X64 Q;  2B2W C;  4N8F A;  3TQY A;  1K8M A;  1XPO A;  3A8I E;  1WTV A;  3HOW G;  4AH6 A;  4KY5 A;  4YHH L;  4G7O C;  1JT8 A;  4CKE A;  1CKN B;  1HJP A;  3LNN A;  4JI1 L;  2OQ0 A;  3MEH A;  4LFA Q;  2JSO A;  2EDG A;  1UAP A;  2IX0 A;  3W2D A;  4R4T A;  4LF7 Q;  4CGY B;  2F0F A;  4ALP A;  4JOI A;  2E8G A;  4X6A H;  5F2D A;  3RN2 A;  4OEM B;  2R61 A;  3FHW A;  3VYS A;  1K0S A;  2HDM A;  4B3R L;  1I4H A;  1NAP A;  1TWA B;  3L3O C;  2H1E A;  3K6O A;  4C1N K;  1S4Z A;  2B2T A;  3CCM A;  2QA4 A;  3MXN A;  1JB7 A;  4GS3 A;  5HGQ A;  3GTJ B;  1E3P A;  4QIW E;  3PCO B;  3SHL A;  5IWA Q;  1Q7Y C;  1TS3 A;  4BBS H;  3S16 H;  1Y1V B;  4XT3 B;  4R8I A;  2WKC A;  2E2J B;  3NHH A;  2Z6K A;  5FLX c;  4OHJ A;  1I3Q B;  2IJ0 A;  1Q90 A;  4QL5 A;  5FLX E;  1MJE A;  1EYG A;  1SSO A;  2KUM A;  4DR3 Q;  1HQR D;  4YCV A;  2WKD A;  3AYH B;  4FF2 A;  1GKH A;  5IP7 G;  2UUB L;  3R2I A;  4YY3 L;  1KAB A;  2YYZ A;  2UXB L;  1KL9 A;  5LL6 X;  1MGS A;  1STN A;  1ENF A;  3FEW X;  2DNE A;  2DN8 A;  4JI0 Q;  3UDG A;  4XDX A;  3PQI A;  3HKZ B;  1CI3 M;  3GO5 A;  4DUY Q;  1VQ6 A;  2BCO A;  3ULL A;  4GKJ Q;  3STB D;  5JEA J;  4QIW B;  1GVP A;  1T9H A;  4HTH A;  4EQN A;  2OXP A;  3M7G A;  3J80 c;  3A8J E;  1LAB A;  4L5S A;  2MJ8 A;  5GQO A;  1XWE A;  5C3W A;  3W3A A;  3PF5 A;  4CBV A;  4DPG A;  3OIP A;  1I4Q A;  3OW2 A;  3HKS A;  1QUQ B;  3PSI A;  1S5F D;  2AQ2 B;  2E2I H;  1GD7 A;  1PFB A;  4NPS A;  1VQM A;  2KHJ A;  3EN2 A;  1U0L A;  5M5W B;  2ENB A;  3F2B A;  2Z4I A;  3S15 H;  5FJ8 H;  4DFA A;  5C4X B;  1U9R A;  3IRB A;  2EIF A;  4KLK A;  1H9M A;  1RTO A;  4A3C H;  2F0N A;  2GN5 A;  4A3E H;  4RCN A;  5EGT A;  4UAI A;  1VDZ A;  2A68 C;  3G48 A;  4Y52 H;  5L37 A;  3HOW B;  2KHI A;  1STA A;  3VYU A;  1BO0 A;  4PZ8 A;  1S5C D;  1TY0 A;  2D0O A;  1OO9 B;  4K2L A;  4FNF A;  1X55 A;  3K7A B;  1PH9 A;  1H9J A;  3N6R A;  4CDF C;  3DHQ A;  4GOP B;  5IYD H;  4HJ7 A;  1YJ9 A;  2P5Z X;  4KJO A;  3EFX D;  3I70 A;  4KK7 A;  4AQY Q;  5JJI A;  3VYT A;  1KTK A;  1HZB A;  2J4X A;  1V1O A;  2D5D A;  3J7Z C;  5IY0 A;  1EIH A;  5CBE E;  2MO0 A;  1D5X C;  4H02 A;  3H0G G;  2Q8I B;  3WOF A;  1B8A A;  3F1Z A;  1ZEQ X;  4KN4 C;  4C3I G;  5ELO A;  2A8V A;  4DXG A;  2TMP A;  3TZD A;  1OXT A;  4O0A A;  3Q24 A;  4FXK C;  4JI3 L;  1I6H B;  3IFD A;  1NNX A;  1O7I A;  3A7A B;  4S3S A;  2A6E D;  5E1F A;  2F0P A;  1RF2 D;  4A3M H;  3IL8 A;  2CWA A;  2R7F A;  3G6E A;  5EAY A;  3UDX A;  4V0B A;  4QB4 A;  4DV3 Q;  2C35 B;  3M7N A;  1B1Z A;  3K81 C;  4XXE A;  5AFW A;  5AJ3 L;  2VL6 A;  2VUM G;  2FMC A;  4DV1 L;  3SEB A;  1JQY D;  1EIY B;  2V1C C;  5DNF A;  1D2B A;  2H4O A;  1Q1B A;  1IZ6 A;  4NDX A;  2ES2 A;  5T1G A;  3GTP H;  1AE2 A;  2BH2 A;  5I9P A;  1HZ9 A;  2JA6 H;  1PH3 A;  3M4O H;  2UXD Q;  3PV0 A;  3HOU G;  1VMP A;  4A3L H;  2F0V A;  5LMN Q;  4BXX H;  2FXQ A;  3A74 A;  2K1B A;  5CV5 A;  4JI2 Q;  4EGV A;  5M5X H;  4GOP C;  2QCP X;  3B6Y A;  1V1P B;  4B08 A;  2VQE Q;  3EBE A;  4K0K Q;  3T1Y Q;  3JC6 6;  4DR4 Q;  2CCZ A;  1RIP A;  3BVM A;  1SYG A;  1G29 1;  3NEM A;  2NWG A;  1GO3 E;  1AN8 A;  1LT3 D;  4L6T B;  1VQI A;  3A5Z B;  2EY6 A;  1PH5 A;  1FJG Q;  5FO8 B;  3KFU A;  3CCE A;  4A3B G;  4EQ5 A;  3VYR A;  2LFN A;  1CZW A;  1EFW A;  3E3X A;  3S17 H;  3BYT B;  3H3V H;  2ZT9 C;  3OMG A;  1EWI A;  1OTC A;  1P16 A;  3TP7 A;  1IYV A;  4B9X A;  4JG2 A;  2PNR C;  3Q23 A;  1BCP B;  4ZYS A;  5CV7 A;  4ZCK A;  3NQI A;  4CJ1 B;  1PH6 A;  1XTC D;  4Y7N B;  1TU2 B;  4OWW B;  1PMR A;  4DV7 L;  4UP7 A;  2R7D A;  2F0O A;  3C46 A;  1PZI D;  3S1R B;  1PLF A;  1UNS A;  1JOK A;  1N36 Q;  3KF6 A;  1KRT A;  3T4A C;  4NXN Q;  3H0G B;  3PUV A;  1WTX A;  5J39 A;  1K9M C;  1ZKO A;  4K14 A;  1E2Z A;  2F0K A;  4C3I B;  1A2U A;  3HS0 C;  2JEA I;  3RZO H;  4LJZ C;  1VF5 C;  5C44 G;  1Z7T A;  4FDB A;  3T13 A;  5ISR A;  4K8I A;  1DOL A;  4OL7 A;  3GTQ B;  3H94 A;  2A1A A;  4BY1 G;  2B2Y A;  4YHH Q;  1IW7 D;  2JYO A;  3J81 L;  4JI1 Q;  1PFS A;  1Y14 B;  3Q22 A;  4K8J A;  2WII B;  2LMC B;  3A5U A;  3D8G A;  1CT1 D;  3E9H A;  1DGS A;  1FL0 A;  5C4J B;  3HP3 A;  1OXX K;  5EJW A;  2VUM B;  1KAW A;  5ELN A;  3GTK B;  3AEV A;  4JYA L;  2PZW A;  3OPO A;  5C4Z A;  4B3R Q;  1SBB B;  4LF4 Q;  2EXZ A;  2R93 G;  1GUN A;  2XWJ B;  3HOX H;  3OSO A;  4LMQ D;  4P2C B;  3I4O A;  3MAQ A;  2PQE A;  3CRK C;  1BOS A;  1FGB D;  1PA6 A;  3HOU B;  2NVT H;  5T1I A;  2NVX H;  1FVI A;  2VNU D;  3ER0 A;  2Z8L A;  2WP8 J;  2K5Q A;  1BCP C;  3FPU B;  3U9O A;  3CCV A;  3S2D B;  1KAA A;  3GV3 A;  2UUB Q;  4A3F B;  4YY3 Q;  2IW3 A;  2ALY B;  2UXB Q;  3E9I A;  1B3A A;  4JI0 L;  3I4M G;  4MNO A;  1PYW D;  3SXH A;  2KCT A;  1AW7 A;  4LF8 L;  4YCU A;  5M5Y H;  4RHR A;  1GOZ A;  1HTP A;  1HR0 W;  4IUR A;  3HGB A;  1TT2 A;  4HMI A;  1Q81 C;  4ILW A;  1EYA A;  3CQZ B;  2K28 A;  4BS9 A;  2PW5 A;  1SYF A;  2CFM A;  4C3J G;  5EPK A;  5JJK A;  4M1U B;  4DV4 L;  3QB3 A;  4ME3 A;  5LL6 S;  4DK1 A;  1VQ7 A;  4JVZ A;  2B8F A;  1ZXT A;  1P8L A;  2F0I A;  4LWC A;  4BBS G;  3KBG A;  4F88 A;  1Z47 A;  5IYC H;  1HNX L;  2Y0S G;  4KD4 A;  1ONL A;  1QWY A;  1EWC A;  2KCM A;  1IKM A;  2HIV A;  4ZRZ A;  5BR8 L;  2K50 A;  4UP9 A;  2PPB C;  2HCI A;  4WOR A;  3CU7 A;  1YVC A;  2Q2I A;  2SNM A;  4RFB A;  3J81 c;  4N8X 1;  2D62 A;  2E2H B;  1IBK L;  4JI5 L;  3D4R A;  1D6E C;  1EYD A;  1SMX A;  3AU7 A;  3CC7 A;  5C44 B;  2MFI A;  3Q0A A;  2QEX A;  3SK6 A;  3P1H A;  4BY1 B;  4FYD A;  1SAP A;  3JAM L;  5FO7 B;  1EEI D;  1EWH A;  2RDG A;  4FF4 A;  1I6V C;  4QUC A;  3ITP A;  4TKO B;  4A3J H;  4ZAI A;  5I4D A;  3BVG A;  1TWF H;  3VA5 A;  3T53 B;  2AQ3 B;  1YI2 A;  2KA7 A;  3TBI B;  1R4Q B;  3MWY W;  1JB3 A;  2CVR A;  2N88 A;  4POG A;  2JA9 A;  2R93 B;  2Q8T A;  1UEB A;  3MHB A;  2PNH A;  2BA1 A;  1KQS A;  1OXV A;  3TEH B;  1PTO D;  4ME5 A;  3KDF A;  1J8I A;  5A2Q L;  1X65 A;  4G7Z C;  1QVC A;  2EYF A;  2NTS A;  3RZD H;  1VQA A;  4LFB Q;  5I9O A;  3TRZ A;  3U4Z A;  5E7N A;  4A3I H;  4TSS A;  1VQG A;  3CRL C;  3UI2 A;  4A3E G;  3C2P A;  4RHS A;  1G8Z D;  2FIN B;  1II3 A;  5CV9 A;  3H15 A;  4JI3 Q;  4B3M L;  2JN4 A;  1U5K A;  5FLM H;  2JA5 H;  3GD7 A;  3R8B A;  3S2D H;  4DV2 L;  1B53 A;  5HY6 A;  1VQ4 A;  1A15 A;  1EY5 A;  2F0H A;  4JPB W;  4EVO A;  4DR5 L;  3ND9 A;  3GTM B;  1NMG A;  3I4M B;  2R7Z H;  4IUQ A;  1DON A;  3CME A;  3NPP A;  2CW0 C;  5IIF A;  1SMY D;  4ZK9 B;  4DV1 Q;  1JWM D;  1Y8P B;  3OMC A;  1YJW A;  5CBA E;  2B63 G;  2IHE A;  1HA6 A;  1HA5 A;  3D3R A;  3S2H H;  5E4W C;  4ZUJ A;  1AZP A;  4C3J B;  5D65 A;  5DEH A;  4R9W A;  1RKN A;  1DYQ A;  3LWU A;  4BBS B;  2MQH A;  2PZT A;  3H3V I;  1VQH A;  1CA6 A;  3HEJ A;  2A6H D;  5LMN L;  2Y0S B;  4GNX A;  5C6A A;  1EU3 A;  2K32 A;  1SE3 A;  1G2T A;  1HNW L;  2AWO A;  5KND A;  2OWO A;  3G4S A;  2F3V A;  2KBN A;  2NVQ H;  3I55 A;  2K5D A;  3JAM c;  4A3M G;  2KVM A;  1E7Z A;  4HR7 B;  4RKB A;  1HNZ L;  3JAM E;  4IFD H;  2KCC A;  5C3E H;  1KXL A;  5E3F A;  3DEP A;  1Z6H A;  2I5L X;  1MHW C;  5GAD C;  4C3H H;  2XRQ D;  4CJ0 B;  4JBW A;  1AE3 A;  2NVY B;  3FP9 A;  4O2D A;  1XPU A;  4MTN A;  3J7A 5;  1VS0 A;  1PVO A;  3ERS X;  1FR3 A;  4K2K A;  1HFG A;  2F0E A;  3M9B A;  1GUW A;  3PF4 A;  4L63 B;  1LTA D;  1CSQ A;  3I4L A;  1I50 H;  2CH4 A;  4TQU S;  1DXM A;  2J7Z A;  5A2Q E;  3KJP A;  2XSC A;  1E2V A;  1YJN A;  1QZG A;  2E76 C;  3S14 H;  1CUK A;  3CCQ A;  2OTJ A;  4BXX G;  2CKZ B;  2X6G A;  4ZKB B;  2RHQ B;  2VS1 A;  1PTO H;  4JK1 C;  1F9Q A;  3FKI G;  4DV7 Q;  1O7L A;  4NXN L;  1SLJ A;  2IT1 A;  1STG A;  2QDB A;  4ABN A;  4A3G G;  2NB0 A;  1PRT B;  4NW2 A;  3MVV A;  1MKH A;  5EBD A;  1LTR D;  4CJ2 C;  4M8A A;  1L1O A;  5EKL A;  2PI2 A;  4X62 L;  1U4M A;  1C9O A;  1GJX A;  2XNA C;  5DM6 3;  2C9O A;  1T5E A;  2KEC A;  1QG7 A;  1JOO A;  1TWH H;  3L2P A;  4J6H A;  4OIK A;  1KLG D;  2SDF A;  1E1T A;  2LKV A;  1QVF A;  4QUF A;  1K28 A;  5K36 H;  5KGU A;  4ZKC B;  1J9O A;  3BDC A;  1ENC A;  3KLW A;  3SE0 A;  3PO2 H;  3KLR A;  3M3Y H;  2YTV A;  4LF4 L;  5JEA H;  3I2Z A;  2B63 B;  4JYA Q;  1MI2 A;  1IXR A;  3HKZ E;  3QJY A;  1XPR A;  5EPL A;  4JI4 L;  4UPA A;  3NBH A;  5KEE A;  1X56 A;  2V4D A;  1UE1 A;  5GAE C;  1RDP D;  2LS0 1;  3RLF A;  2RSO A;  3HOV B;  3L7Z C;  4A93 H;  2HDL A;  2QIL A;  1CKM A;  2E5L L;  1R9T B;  1BXT A;  1S5E D;  3NE5 B;  1VQE A;  3A7L A;  1PH1 A;  1WCM H;  4A3M B;  1HH2 P;  1G6P A;  1NCV A;  1X3G A;  4GZY C;  1SR3 A;  3HOY H;  5KIX A;  4LFC L;  3HOZ H;  2OF1 A;  3S1Q H;  3K59 A;  1FNU A;  1ILP A;  1M4V A;  2CQO A;  4X3T A;  1XNQ L;  2A68 D;  1N32 L;  2EJF C;  2JXM B;  1CK1 A;  4OWT B;  2OEO A;  4DV5 L;  2EVB A;  1WOC A;  2Z1C A;  1EOV A;  1QB5 D;  2M9V A;  1ICF B;  2FFK B;  5COR A;  3CCU A;  4LF8 Q;  1BCP F;  1VQK A;  1W2B A;  1C7Y A;  1EY9 A;  4G57 A;  5ELF A;  3FRP B;  3HOX G;  3KBX A;  4KKS A;  3GTO H;  1ESF A;  1MJC A;  1STH A;  2NBF A;  4K5V A;  3J80 E;  4KHZ A;  1NSN S;  4DV4 Q;  2MNA A;  4OIJ A;  3MFG A;  2L12 A;  2ZTC A;  3PUX A;  2EY5 A;  3BU2 A;  3GTL B;  3PO3 H;  4F7X A;  1HNX Q;  1TWG B;  1GXD C;  3FKI B;  4XYQ A;  5M5X B;  3GTG H;  5BR8 Q;  1NJI C;  4A3G B;  1BDO A;  2K7V A;  3ERQ A;  5EBC A;  2F0M A;  1BF4 A;  4PMW A;  4DK3 C;  1HPC A;  3BS1 A;  2PW7 A;  1IBK Q;  4JI5 Q;  1D1I A;  4OO1 H;  5TSS A;  2R92 B;  2PQA B;  4A4I A;  1YEZ A;  3Q6S A;  2F3I A;  4KHP L;  1HHV A;  2KED A;  4OEL B;  3I4N H;  4C1N I;  2RF4 A;  5KYL A;  1KD1 C;  1KDB A;  2RVL A;  1VQF A;  1F77 A;  3CMA A;  1WFQ A;  1J5E L;  1TY2 A;  4DR1 L;  2NN6 H;  1C8C A;  3ONA B;  3CC4 A;  2F0T A;  2KEN A;  1CQV A;  3OWF A;  1FNV A;  3H91 A;  3C1E A;  3PGZ A;  2UUA L;  3KOJ A;  2LXK A;  4K6D A;  1Y1W G;  2EOT A;  3ULJ A;  1JJG A;  5JOB A;  1TS2 A;  4IUT A;  4RH6 A;  1Q86 C;  1TS5 A;  3DWA A;  4IQZ A;  2IHF A;  4LFB L;  2D0P A;  3SK8 A;  4JBK A;  3S1N H;  2B2W A;  1WTP A;  3RD4 A;  5CMD A;  4IJH A;  4WJW A;  4JBM A;  1TWA H;  4B3M Q;  2PCF B;  4C2M B;  3GTJ H;  3TN2 A;  3DWP A;  1YNX A;  4BBR H;  1V1Q A;  4DV2 Q;  1NR2 A;  1ENA A;  4A3J G;  4DR5 Q;  1Y1V H;  2E2J H;  1U4R A;  3NWT A;  1XTD A;  2K75 A;  4IFD I;  1RL2 A;  4O1N A;  1KLU D;  1X6O A;  3CXC A;  2Q2U A;  3HFZ B;  1JE5 A;  3NTH A;  3AMU A;  2JJQ A;  3HOX B;  3SVM A;  5IGD A;  1Q3L A;  2YTX A;  3A56 A;  1E22 A;  3G6J B;  1B9N A;  1TII D;  3VA7 A;  5IGC A;  3H09 A;  1J6Q A;  2EYJ A;  1F2L A;  5FK9 C;  3M85 A;  1EY6 A;  3X3N A;  5IGE A;  4X3U A;  4DGZ A;  3MEF A;  4LNQ A;  1H9S B;  3CCR A;  5JVG 3;  1HNW Q;  1F9R A;  2KCN A;  2DGY A;  3KDF B;  1PZK D;  2A19 A;  1D8L A;  3MXU A;  1T5X D;  2A5H A;  1DOM A;  5IE8 A;  1HNZ Q;  2WAC A;  5IYB H;  1R4P B;  3NP8 A;  2K05 A;  4HIK A;  4RMF A;  2L1B A;  3IFT A;  2R7Z G;  4YWM A;  1OXS C;  2YV5 A;  3VDY A;  3T56 B;  1K8G A;  4HSV A;  3OTO L;  2ZJR A;  4RCO A;  1PYB A;  5M5W H;  2E74 C;  2PMZ E;  1JC7 A;  4P73 A;  4FP5 D;  3I73 A;  3RN5 A;  5C4X H;  4LF5 L;  1N33 L;  4N9P A;  1QE6 A;  4JV5 L;  2KHS A;  3KLS A;  3PIP A;  3BDL A;  2VY3 A;  4QMG A;  4B3S L;  4XQJ A;  4BA2 I;  1HXY D;  4QQB X;  2DY8 A;  1Y1W B;  2EYL A;  3R2T A;  3K5L A;  1LLR D;  4BWG B;  2DJF C;  1KNE A;  4Q0F A;  5ELB A;  4GNX B;  2B2U C;  1HZC A;  4PMC A;  5GAH C;  4IFD G;  2CWP A;  4DV0 L;  1EOT A;  1TS4 A;  2X6L A;  4X62 Q;  1BCP D;  3TS0 A;  1NBW A;  1M1K C;  1QZH A;  3C3L A;  2RHS B;  1LT5 D;  2FMM A;  4EQP A;  4C3H G;  3H6M A;  3QWN A;  2PMZ B;  3K0Y A;  3CCS A;  2JA8 G;  2JEB I;  3PUZ A;  3CD6 A;  1FD7 D;  2G5D A;  1YIT A;  4JCV E;  4A3J B;  1TWF B;  4KKT A;  4QY7 A;  1X3Q A;  3T1H Q;  4RGN A;  1RCV D;  1G2S A;  3V05 A;  1K8O A;  4IUN A;  4HIM A;  1LT6 D;  2VXW A;  3R93 A;  2VQF L;  5KNC A;  3OHX C;  1TWC B;  2N78 A;  2SOB A;  3RR5 A;  5IP7 H;  3NBI A;  1CHQ D;  4DK6 C;  4JI4 Q;  3DWQ A;  1WI5 A;  2I46 A;  3T16 A;  2EE1 A;  2K5W A;  2B2V C;  2MPM A;  3RNU A;  2YU9 H;  1JIC A;  2I5H A;  3PMF A;  1A0I A;  1ET6 A;  1NTG A;  1JJ2 A;  1D5M C;  4H44 C;  2B8G A;  5I6Y A;  3W1G A;  1LM0 A;  3KF8 A;  2XTI A;  4QJF A;  2RA4 A;  1CFM A;  2E5L Q;  4FXD A;  4A3D H;  3D6C A;  2ZTE A;  4GLX A;  1IBL L;  1G6Z A;  2QEJ C;  1WTH A;  1BQQ T;  5G3L F;  2CHB D;  1L1O B;  2O5J C;  5EQ0 A;  1ET9 A;  2EPB A;  1S5B D;  1M8A A;  3KYH C;  2JA7 H;  1H9K A;  4LFC Q;  3JAM i;  1B50 A;  1RHP A;  2TSS A;  1U4L A;  1XNQ Q;  2WFW A;  5EKI A;  2M00 A;  3LWE A;  4A3B B;  5DM7 3;  1N32 Q;  2R7Z B;  5K36 G;  2JE6 I;  1LYL A;  1YZ6 A;  4DV5 Q;  3K58 A;  5FKA C;  1EIF A;  3PO2 G;  1K8A C;  4LW1 A;  4I65 A;  1RJT A;  4ID6 A;  1LTL A;  5LHY 1;  3S2H B;  3KLS X;  4I7A A;  1ILQ A;  2BA0 A;  2RQX A;  3NK9 A;  2B29 A;  2ID0 A;  4LF6 L;  1GHJ A;  1CTM A;  2XVS A;  1BVS A;  3CHB D;  4RGO S;  3K80 C;  2EZV A;  1EQR A;  1STY A;  2MUY A;  1GUT A;  1BBU A;  2HHH Q;  4GOP A;  1PRT F;  4B3T L;  4QGU A;  3MXN B;  3NBH B;  5K5P A;  4DUZ L;  2N3S A;  2NVQ B;  2QKI C;  3KUP A;  3E0J A;  2IY5 B;  5J1Z A;  3HOY G;  1XJV A;  4OXP A;  1K83 B;  3J81 E;  1UE5 A;  4KHV A;  4N9T A;  5D3I B;  4JBJ A;  5JAV A;  3S1M H;  1PXU A;  4RAU C;  2EYO A;  1STE A;  4IPG A;  4HJA A;  2HD3 A;  4FVM A;  4C3H B;  3S1R H;  4HID A;  2JA8 B;  4KHP Q;  4FO2 A;  1E0B A;  2K14 A;  4NKL A;  1B4O A;  3DLL A;  1XMQ L;  2AQ1 B;  1LTS D;  2ZJP A;  1J5E Q;  1X3P A;  2IL8 A;  4C3I H;  2CW0 D;  4DR1 Q;  2BE5 C;  4KD3 A;  2HT1 A;  1VQL A;  4RWS C;  1C4Q A;  1BR9 A;  1L1O C;  1E24 A;  2RCF A;  3S14 B;  1VQN A;  4WJ3 M;  4LAA A;  2UUA Q;  4CDD C;  1PTO B;  4OGQ C;  3DUZ A;  4PV1 C;  3QO2 A;  2K01 A;  1XNR L;  3MC0 B;  5E4X A;  1HUM A;  2F3W A;  3I90 A;  3F8T A;  3URY A;  1EY8 A;  1EIG A;  1KDA A;  5JPN C;  5FJ8 G;  4G4K A;  1YNJ D;  3VR5 A;  2VUM H;  2XIW A;  4UDU C;  4HIO A;  4JOI C;  4A3C G;  3UDI A;  4CDE C;  4P75 A;  4R4O A;  3PUY A;  2Y0S E;  5M9O A;  2OQK A;  1VF7 A;  4LK1 C;  4RGT A;  5C0X H;  3I4N G;  1B44 D;  5EPJ A;  3WOE A;  1WD0 A;  2LXJ A;  1EZ6 A;  2B2T C;  1YHB A;  2QDL A;  4PZ7 A;  2VW9 A;  3QOJ A;  5GRO A;  3R3O A;  3P75 A;  3PIP 3;  2PZU A;  3GDE A;  1G91 A;  2HQL A;  4RKL A;  5IYD G;  1VQP A;  4BY7 H;  1L0X B;  2AMC B;  1U4P A;  2EJG C;  3U50 C;  3PO2 B;  4DV6 L;  4A3K H;  2Z6K C;  2L55 A;  3GQB A;  2FHT A;  2XWB B;  4AIM A;  1A62 A;  1IBM L;  1Y69 U;  1LV9 A;  4MZ9 A;  1DCZ A;  4A3F H;  3NUC A;  4IO9 A;  3G71 A;  4DAM A;  4JI7 L;  2A73 B;  4UP8 A;  3J80 i;  3S16 B;  4A76 A;  4U67 3;  1JJC B;  1QNK A;  2ICI A;  5NUC A;  1AP0 A;  4RA8 A;  1YNJ C;  4XIG S;  1WJJ A;  3SDZ A;  1TVX A;  1X54 A;  4P74 A;  4EX5 A;  2G9H D;  4H7B A;  1AEX A;  3CQZ H;  1IHZ A;  4YWL A;  4DXF A;  4DAY A;  3HOY B;  3DMU A;  3QG1 A;  4BBR G;  1MSH A;  3NTI A;  5COY A;  1PH8 A;  3KJO A;  1IYJ B;  5CYU A;  1GUG A;  3V96 A;  1VQ9 A;  1UE7 A;  4KY7 A;  2L11 A;  3OOC A;  3MZ5 A;  3OTO Q;  1EFI D;  3F2C A;  2VB3 X;  4YWK A;  1VMC A;  4JI8 L;  3QIA A;  2MHV A;  4GLA C;  4KMU C;  5M3F H;  3SGI A;  1XMO L;  5CC4 A;  3EA6 A;  4LF5 Q;  1N33 Q;  2JA6 G;  3LGJ A;  5C44 H;  1PZJ D;  4CKC A;  4JV5 Q;  5D14 A;  2L15 A;  1ML0 D;  2N49 A;  4A3L G;  2UXC L;  3ZYY X;  4B3S Q;  3D0F A;  2DJG C;  2KQ3 A;  4BY1 H;  1KC8 C;  1S40 A;  2IPK D;  1F9S A;  4CDC C;  5DLQ E;  2E2I B;  1BNZ A;  4IPD A;  3D6W A;  1Q46 A;  1Y8N B;  1SNO A;  2E75 C;  1EEF D;  1WYD A;  2YTY A;  2DY7 A;  1UEA B;  3CF5 A;  1EQV A;  5BN3 A;  3S15 B;  4F87 A;  5FOB B;  5IYB G;  4LUV A;  1DM0 B;  4DV0 Q;  2CQA A;  4R4I A;  1PH4 A;  1A3U A;  3MXG A;  4A3E B;  1LAC A;  1O78 A;  4ZLT F;  2R93 H;  4QCL A;  4PG3 A;  2O2L D;  1VQC A;  4L8J A;  3I4N B;  3PIO A;  2ZXR A;  1Q82 C;  3MTS A;  2ICE C;  1W3S A;  3P7J A;  3TP6 A;  1PRT D;  3T1H L;  3TRE A;  5CR3 A;  2KJX A;  3I91 A;  4A75 A;  2GA4 B;  1PV4 A;  4IFD J;  2J0T D;  4CHT B;  3K7U C;  2MO1 A;  5ELC A;  3CC2 A;  1CZG A;  3ZJY C;  4DF7 A;  1K73 C;  2VQF Q;  3NTK A;  4PMB A;  1ZYR C;  1A6X A;  5IGF A;  3RMH A;  2K33 A;  4EQO A;  2ZXP A;  4DNT B;  2RDF A;  4IAL A;  3L0O A;  2AWN A;  2Z0S A;  2ZM6 L;  3K57 A;  5IP9 H;  3GTM H;  1DOK A;  2K4K A;  1VQ8 A;  3I4M H;  5I2Y A;  3S1N B;  2NTT A;  2XRS D;  2ZXO A;  4BA1 I;  3NEN A;  4RG1 A;  4TRD A;  3HRZ C;  1BUV T;  2EY1 A;  2KEE A;  3KF6 B;  3CPF A;  1EY4 A;  3GV6 A;  3IKJ A;  3U58 A;  1L0W A;  3SR1 A;  3K8A A;  3FVQ A;  4HMJ A;  3NQT A;  1OXU A;  1IBL Q;  1SDF A;  1V8Q A;  4HJ8 A;  1AH9 A;  2GVB A;  1B9M A;  4C3J H;  5C4H A;  4BBR B;  4DAV A;  1MIU A;  1QCB D;  1E1O A;  4GN3 B;  2Q2H A;  3M4Q A;  4IPC A;  5J22 A;  1FNW A;  4NMZ A;  1PRT C;  4O42 A;  1IYU A;  4F8M A;  2N8N A;  3ERO A;  2L5T A;  4NXM L;  3DM1 A;  3GTP B;  2PO4 A;  1HR0 L;  2SEB D;  1O7Z A;  3T51 B;  2EJM A;  3EJI A;  2JA6 B;  5KRU A;  2UU9 L;  3M4O B;  2L4N A;  1PDQ A;  4LF6 Q;  4OX9 L;  5LMU L;  2HHH L;  1B7Y B;  2R3Z A;  1ICW A;  5M3M H;  1SFO H;  1NR4 A;  2NVY H;  4B3T Q;  1CKO A;  1B2T A;  4A3D G;  1GUO A;  5CGK A;  4P71 A;  1C48 A;  4XQQ A;  4DUZ Q;  5HUR A;  4B9W A;  3DXJ C;  3AB9 A;  1EU4 A;  1RD9 D;  4YCW A;  3KF8 B;  4UY8 C;  3BVZ A;  2HCC A;  3CCL A;  2E2D C;  3TP8 A;  1SNM A;  2JA7 G;  1JCK B;  4QF4 A;  1LTB D;  1N9W A;  5IOC A;  4X65 L;  1K3R A;  4IOA A;  3A54 A;  1UUP A;  4GLV B;  3VR6 A;  4LUO A;  3F2D A;  1FYC A;  2Z4H A;  3E0E A;  3S17 B;  3D4D A;  2F03 A;  1MSG A;  1DZ1 A;  4L5T A;  5ELE A;  4CKB A;  2Q8R E;  4DR2 L;  2F0G A;  2K5H A;  2ASB A;  1YBY A;  1DJR D;  2RSN A;  1F9P A;  3M4P A;  1XMQ Q;  1KHI A;  5GAG C;  3AFP A;  2RDH A;  5C0X I;  3J7Y W;  1PH2 A;  1XYI A;  2ZTD A;  1VCI A;  1KIX A;  1K3B C;  3NSW A;  5IYC G;  5HGT A;  1Q12 A;  1X9N A;  1XXG A;  1I94 L;  2NZ1 D;  1D5Z C;  1F2M A;  1XNR Q;  5IOD A;  2FJ2 A;  2D9U A;  2EYM A;  2B2Y C;  1DD2 A;  1I4X A;  2WAQ G;  3STB C;  1ESR A;  1CM9 A;  1RTN A;  4HN7 A;  3RZO B;  1QNU A;  1I4R A;  4OWX B;  3BZK A;  2I07 B;  1I4G A;  2EYP A;  1KNA A;  3BZC A;  2B63 H;  4DAP A;  1QJO A;  1V43 A;  3OWE B;  1EL0 A;  4K5W A;  1X3E A;  3J81 j;  3WWV A;  1JR0 D;  1SE4 A;  1Z9F A;  1ASZ A;  4IOC A;  3HOV H;  3S24 A;  3O13 A;  1WTR A;  4DR6 L;  1R9T H;  3BZD B;  3CPW A;  1I3Q H;  2G9D A;  4IUV A;  2K5N A;  4AYB G;  4DV6 Q;  4G7H C;  1SNC A;  1E2W A;  4K6L A;  4HJ9 A;  2MP1 A;  3OW7 A;  1JMC A;  2F1M A;  1SE8 A;  1IBM Q;  2YU9 B;  4ULL A;  2F0J A;  2K03 A;  3GP7 A;  1W6K A;  3SK4 A;  2UUC L;  5IGG A;  4HJ5 A;  2NVT B;  2M2L A;  4JI7 Q;  3H3V C;  1N34 L;  4J1M A;  2NVX B;  1JE4 A;  4A3I G;  2DUD A;  2F52 A;  4Q5V A;  3ULP A;  5D3D A;  2K5V A;  4A3D B;  3PIO 3;  3NXW A;  5FLM G;  3X3M A;  2JA5 G;  3P20 A;  5C0X G;  4YIJ A;  5LMN W;  3VR4 A;  3W1B A;  2JA7 B;  1M90 C;  4XT1 B;  2QF7 A;  2WAQ E;  3A0J A;  5BN4 A;  3J81 i;  4FF1 A;  4HCE A;  3GTL H;  4BY7 G;  4POF A;  1TWG H;  3VR2 A;  3TSS A;  4DA2 A;  5M5Y B;  3FKI H;  3WDN A;  1TQO A;  4A3K G;  3I72 A;  4DNI A;  4A3G H;  4DR7 L;  4KKU A;  1SYE A;  2A6E C;  1PFN A;  4APV A;  3EQL C;  3DEO A;  2XN9 C;  4JI8 Q;  3CCJ A;  2A69 D;  1CKN A;  4P72 A;  4A3F G;  1XMO Q;  2C5C A;  1PTO F;  1SNQ A;  4PZ6 A;  4X3K A;  1G51 A;  2R92 H;  4JI6 L;  4GN5 A;  1XX8 A;  4GKK Q;  4X66 L;  2O4X A;  1Y8O B;  2UXC Q;  3HOW H;  2BDO A;  1NMF A;  1V9P A;  4AYB E;  1PH7 A;  4KTA A;  3J7A F;  4WFN 3;  4WRD A;  4PQX A;  4KV6 A;  2EYH A;  2WAQ B;  1CA5 A;  1HTL D;  3K7A H;  1SN8 A;  1MBY A;  4OON A;  3HG9 A;  1X3F A;  1H9R A;  5C3E G;  2A74 C;  1I5F A;  1SRO A;  3UE0 A;  3S1M B;  2WV6 D;  1HUN A;  3A55 A;  5C5L A;  3MA2 B;  3LX0 A;  1WTQ A;  5CV6 A;  2JP1 A;  4DAY B;  5IT9 L;  3RLN A;  2RKS A;  4IUP A;  4LUZ A;  5BN5 A;  4XYO A;  4PNY A;  1UWV A;  3FPP A;  2F4V L;  5M3F G;  2PI2 E;  4KY6 A;  3I3C A;  4WJ4 A;  2F0U A;  4X64 L;  3C1F A;  2A69 C;  4XQN A;  1TR5 A;  4LF9 Q;  1Q1E A;  1I6H H;  2ATW A;  1YHA A;  5KNB A;  4AYB B;  1EY0 A;  2XGT A;  4C2M H;  3K5N A;  1HFN A;  4LFA L;  3E5S A;  3MXP A;  2F0S A;  4HED A;  4JC0 A;  2Q2T A;  4LF7 L;  2JK8 A;  2I5M X;  1HCZ A;  3EVQ A;  4FXG C;  3RZD B;  2ZM6 Q;  3D31 A;  3BYY B;  3QOL A;  1PYS B;  3OYY A;  1SXT A;  4C56 C;  4A3I B;  3TME A;  1K0R A;  2IWH A;  2N55 A;  2EY2 A;  4KN7 C;  4U68 A;  2F0D A;  1S72 A;  2X69 A;  1SEB D;  3M4Y A;  1NUC A;  5KYI A;  2HIX A;  2JA5 B;  1B3Q A;  1SYD A;  5J3B A;  2PYK A;  1QUQ A; 
#chains in the Genus database with same CATH homology
 4R8N A;  5C3X A;  1LTI D;  2WIN B;  2L0C A;  3N52 A;  1BBX C;  4BY7 B;  1LTT D;  4I7Z C;  4Z9C B;  1O7Y A;  4A3K B;  5JEA G;  5C5M A;  4OO1 I;  2BE5 D;  1EYC A;  1I4P A;  2SNS A;  1WVL A;  4ZQ3 A;  1GUS A;  4DK0 A;  5JVH 3;  1IW7 C;  1YNN D;  2NYZ D;  3IAY A;  1STB A;  2B39 A;  3MFY A;  2NN6 I;  3VR3 A;  2LY7 A;  5IGB A;  5JJZ A;  1ROD A;  5IT9 E;  4ZUI A;  3OIQ A;  3SK5 A;  4IN3 A;  5C3E B;  4HAE A;  2F0W A;  1F2Y A;  1Q8I A;  1LO5 D;  2NUC A;  5M3F B;  4IUU A;  1W6J A;  1I50 B;  2L9H A;  3BG3 A;  3NWS A;  2BOS A;  1YNN C;  2F0L A;  3F2U A;  4MHE A;  1F2Z A;  3I8Z A;  1CHP D;  2B2U A;  1QIL A;  3G7L A;  4E6I A;  2VB2 X;  4HCS A;  4OO1 G;  4ODG A;  1HRJ A;  1JWS D;  2R6G A;  4X3S A;  3A8K E;  4IZ8 A;  1H9S A;  1PFM A;  2K6A A;  1CQF A;  2HUG A;  3K5M A;  1TWH B;  1SE2 A;  1V1P A;  1SNP A;  1LT4 D;  2IX1 A;  1A2T A;  4NP5 A;  4KJN A;  2NN6 G;  2AUK A;  3J7A V;  4DN4 M;  5JPM C;  2HQE A;  4RGM A;  3M3Y B;  2MGS A;  1EY7 A;  4MIU A;  2KOL A;  4H0L C;  1S5D D;  1SYB A;  2B2V A;  1EQT A;  5EKK A;  1AZQ A;  1JWU D;  1L0Y B;  2IX3 A;  1SND A;  3BDO A;  4A93 B;  1D1K A;  2DNC A;  4KI0 A;  3KK7 A;  4J8Q A;  5A35 A;  4DNR B;  4MN3 A;  1WCM B;  3V2T A;  4FF3 A;  1X32 A;  1SJH D;  3HOZ B;  1SYC A;  3S1Q B;  3FMC A;  1PTO C;  3U9S A;  3HZX A;  1LTG D;  1MD2 D;  2F4I A;  3D4W A;  1HQM C;  3ND8 A;  1WD1 A;  5CV8 A;  1GHK A;  2D2C C;  3RUZ A;  5C0X J;  3GTO B;  4H13 C;  1ZYR D;  2K04 A;  5FLX L;  3PO3 B;  2RBM A;  5M3M B;  2O5I C;  5G3L D;  1SFO B;  4HSP A;  1WTW A;  3TDQ A;  5I2X A;  4K5X A;  3GTG B;  3S9W A;  2BDN A;  3FDT A;  5DAU A;  1SMY C;  5CV4 A;  1O80 A;  1IKL A;  1JOQ A;  5ELD A;  3CKI B;  1WTO A;  4V19 0;  2AUJ D;  3E6Z X;  1TKW B;  4XTC S;  1A3T A;  2A6H C;  1IL8 A;  2F0Q A;  3J80 L;  1A3V A;  3PUW A;  1AFP A;  1EZ8 A;  1KDC A;  1QOH A;  1JOR A;  4DU9 A;  3L9A X;  2WB1 B;  3TP5 A;  3TZU A;  1SJE D;  5FO9 B;  3K5O A;  2OT2 A;  5I6W A;  2B2W C;  1K8M A;  3A8I E;  1WTV A;  4KY5 A;  4G7O C;  4CKE A;  3LNN A;  3MEH A;  2JSO A;  2EDG A;  1UAP A;  2IX0 A;  3W2D A;  4CGY B;  2F0F A;  5F2D A;  2R61 A;  3VYS A;  2HDM A;  1I4H A;  1NAP A;  1TWA B;  3L3O C;  2H1E A;  3K6O A;  4C1N K;  1S4Z A;  2B2T A;  3MXN A;  3GTJ B;  3SHL A;  1TS3 A;  1Y1V B;  4XT3 B;  4R8I A;  2WKC A;  2E2J B;  3NHH A;  4OHJ A;  1I3Q B;  2IJ0 A;  1Q90 A;  5FLX E;  1SSO A;  2KUM A;  1HQR D;  2WKD A;  4FF2 A;  3R2I A;  1KAB A;  2YYZ A;  5LL6 X;  1MGS A;  1STN A;  1ENF A;  3FEW X;  2DNE A;  2DN8 A;  4XDX A;  3HKZ B;  1CI3 M;  3GO5 A;  2BCO A;  5JEA J;  4QIW B;  4EQN A;  4HTH A;  2OXP A;  3M7G A;  3A8J E;  1LAB A;  2MJ8 A;  1XWE A;  5C3W A;  3W3A A;  4CBV A;  3OIP A;  1I4Q A;  1S5F D;  2AQ2 B;  1PFB A;  5M5W B;  2ENB A;  2Z4I A;  5C4X B;  4DFA A;  1U9R A;  1H9M A;  1RTO A;  2F0N A;  4RCN A;  5EGT A;  4UAI A;  1VDZ A;  2A68 C;  3HOW B;  1STA A;  3VYU A;  1BO0 A;  1S5C D;  1TY0 A;  1OO9 B;  4K2L A;  4FNF A;  3K7A B;  1H9J A;  3N6R A;  3DHQ A;  4KJO A;  3EFX D;  3I70 A;  4KK7 A;  3VYT A;  1KTK A;  2J4X A;  1V1O A;  2D5D A;  1EIH A;  5CBE E;  1D5X C;  2Q8I B;  3WOF A;  1ZEQ X;  4KN4 C;  4C3I G;  4DXG A;  2TMP A;  3TZD A;  1OXT A;  3Q24 A;  4FXK C;  1I6H B;  3IFD A;  3A7A B;  4S3S A;  2A6E D;  5E1F A;  2F0P A;  1RF2 D;  3IL8 A;  4V0B A;  4QB4 A;  3M7N A;  1B1Z A;  4XXE A;  5AFW A;  2FMC A;  3SEB A;  1JQY D;  5DNF A;  1D2B A;  2H4O A;  1Q1B A;  4NDX A;  5T1G A;  5I9P A;  3PV0 A;  1VMP A;  2F0V A;  2K1B A;  5CV5 A;  4EGV A;  2QCP X;  1V1P B;  4B08 A;  3BVM A;  1SYG A;  1G29 1;  2NWG A;  1AN8 A;  1LT3 D;  4L6T B;  2EY6 A;  5FO8 B;  3VYR A;  2LFN A;  1CZW A;  3BYT B;  2ZT9 C;  3OMG A;  3TP7 A;  1IYV A;  4B9X A;  2PNR C;  3Q23 A;  1BCP B;  4ZYS A;  5CV7 A;  4CJ1 B;  3NQI A;  1XTC D;  4Y7N B;  1TU2 B;  1PMR A;  3C46 A;  2F0O A;  1PZI D;  3S1R B;  1PLF A;  1UNS A;  1JOK A;  3T4A C;  3H0G B;  3PUV A;  1WTX A;  5J39 A;  1ZKO A;  4K14 A;  1E2Z A;  2F0K A;  4C3I B;  1A2U A;  3HS0 C;  2JEA I;  4LJZ C;  1VF5 C;  1Z7T A;  3T13 A;  5ISR A;  4K8I A;  1DOL A;  4OL7 A;  3GTQ B;  3H94 A;  2B2Y A;  1IW7 D;  2JYO A;  3J81 L;  3Q22 A;  4K8J A;  2WII B;  2LMC B;  3D8G A;  1CT1 D;  5C4J B;  3HP3 A;  1OXX K;  5EJW A;  2VUM B;  3GTK B;  2PZW A;  3OPO A;  5C4Z A;  1SBB B;  2EXZ A;  1GUN A;  2XWJ B;  3OSO A;  4LMQ D;  4P2C B;  3MAQ A;  2PQE A;  3CRK C;  1BOS A;  1FGB D;  3HOU B;  5T1I A;  2VNU D;  2Z8L A;  2WP8 J;  2K5Q A;  1BCP C;  3FPU B;  3U9O A;  1KAA A;  3GV3 A;  4A3F B;  2IW3 A;  1B3A A;  1PYW D;  3SXH A;  1AW7 A;  4RHR A;  1GOZ A;  1HTP A;  4IUR A;  3HGB A;  1TT2 A;  4HMI A;  4ILW A;  1EYA A;  3CQZ B;  2K28 A;  4BS9 A;  2PW5 A;  1SYF A;  4C3J G;  5EPK A;  4M1U B;  3QB3 A;  5LL6 S;  4DK1 A;  2B8F A;  1ZXT A;  2F0I A;  3KBG A;  4F88 A;  1Z47 A;  4KD4 A;  1ONL A;  1QWY A;  1EWC A;  1IKM A;  4ZRZ A;  2PPB C;  2HCI A;  4WOR A;  3CU7 A;  2SNM A;  4RFB A;  2D62 A;  2E2H B;  3D4R A;  1D6E C;  1EYD A;  3AU7 A;  5C44 B;  3Q0A A;  3SK6 A;  3P1H A;  4BY1 B;  4FYD A;  1SAP A;  3JAM L;  5FO7 B;  1EEI D;  1EWH A;  2RDG A;  4FF4 A;  1I6V C;  4QUC A;  3ITP A;  4TKO B;  4ZAI A;  5I4D A;  3BVG A;  3VA5 A;  3T53 B;  2AQ3 B;  2KA7 A;  3TBI B;  1R4Q B;  3MWY W;  1JB3 A;  2CVR A;  2N88 A;  2R93 B;  2Q8T A;  3MHB A;  2BA1 A;  1OXV A;  1PTO D;  4ME5 A;  1J8I A;  5A2Q L;  4G7Z C;  2EYF A;  2NTS A;  5I9O A;  4TSS A;  3CRL C;  3UI2 A;  3C2P A;  4RHS A;  1G8Z D;  2FIN B;  1II3 A;  5CV9 A;  3GD7 A;  3R8B A;  1B53 A;  1A15 A;  1EY5 A;  2F0H A;  4EVO A;  3ND9 A;  3GTM B;  3I4M B;  4IUQ A;  1DON A;  3NPP A;  2CW0 C;  5IIF A;  1SMY D;  4ZK9 B;  1JWM D;  1Y8P B;  3OMC A;  5CBA E;  1HA6 A;  1HA5 A;  3D3R A;  5E4W C;  4ZUJ A;  1AZP A;  4C3J B;  5D65 A;  5DEH A;  4R9W A;  1RKN A;  1DYQ A;  3LWU A;  4BBS B;  2PZT A;  1CA6 A;  3HEJ A;  2A6H D;  2Y0S B;  5C6A A;  1EU3 A;  2K32 A;  1SE3 A;  1G2T A;  2AWO A;  5KND A;  2F3V A;  2K5D A;  2KVM A;  4HR7 B;  4RKB A;  3JAM E;  4IFD H;  2KCC A;  5E3F A;  3DEP A;  1Z6H A;  2XRQ D;  4CJ0 B;  4JBW A;  2NVY B;  1FR3 A;  4K2K A;  1HFG A;  2F0E A;  1GUW A;  4L63 B;  1LTA D;  3I4L A;  4TQU S;  1DXM A;  2J7Z A;  5A2Q E;  2XSC A;  1E2V A;  2E76 C;  2X6G A;  4ZKB B;  1PTO H;  4JK1 C;  1F9Q A;  1O7L A;  2IT1 A;  1STG A;  2QDB A;  4ABN A;  2NB0 A;  1PRT B;  4NW2 A;  3MVV A;  5EBD A;  1LTR D;  4CJ2 C;  4M8A A;  5EKL A;  1U4M A;  1GJX A;  2XNA C;  5DM6 3;  2C9O A;  1T5E A;  2KEC A;  1QG7 A;  1JOO A;  4J6H A;  4OIK A;  1KLG D;  2SDF A;  2LKV A;  5K36 H;  4QUF A;  5KGU A;  4ZKC B;  1J9O A;  3BDC A;  1ENC A;  3SE0 A;  3KLR A;  5JEA H;  2B63 B;  1MI2 A;  3QJY A;  5EPL A;  3NBH A;  5KEE A;  2V4D A;  1RDP D;  2LS0 1;  3RLF A;  2RSO A;  3HOV B;  3L7Z C;  2HDL A;  2QIL A;  1R9T B;  1BXT A;  1S5E D;  3NE5 B;  3A7L A;  4A3M B;  1NCV A;  4GZY C;  5KIX A;  2OF1 A;  3K59 A;  1FNU A;  1ILP A;  1M4V A;  4X3T A;  2A68 D;  2EJF C;  2JXM B;  1CK1 A;  2OEO A;  2EVB A;  2Z1C A;  1QB5 D;  2M9V A;  5COR A;  2FFK B;  1BCP F;  1EY9 A;  4G57 A;  5ELF A;  3FRP B;  3KBX A;  4KKS A;  1ESF A;  1STH A;  2NBF A;  4K5V A;  3J80 E;  4KHZ A;  1NSN S;  4OIJ A;  3MFG A;  2L12 A;  3PUX A;  2EY5 A;  3GTL B;  4F7X A;  1TWG B;  1GXD C;  3FKI B;  4XYQ A;  5M5X B;  4A3G B;  1BDO A;  2K7V A;  3ERQ A;  5EBC A;  2F0M A;  1BF4 A;  4PMW A;  1HPC A;  3BS1 A;  2PW7 A;  1D1I A;  4OO1 H;  5TSS A;  2R92 B;  3Q6S A;  1HHV A;  2KED A;  4C1N I;  5KYL A;  1KDB A;  2RVL A;  1F77 A;  1TY2 A;  2NN6 H;  1C8C A;  3ONA B;  2F0T A;  1CQV A;  3OWF A;  1FNV A;  3H91 A;  3C1E A;  4K6D A;  2EOT A;  5JOB A;  1TS2 A;  4IUT A;  4RH6 A;  1TS5 A;  3DWA A;  4IQZ A;  3SK8 A;  2B2W A;  1WTP A;  3RD4 A;  5CMD A;  4WJW A;  2PCF B;  4C2M B;  3TN2 A;  3DWP A;  1NR2 A;  1ENA A;  1U4R A;  3NWT A;  4IFD I;  4O1N A;  1KLU D;  3AMU A;  3NTH A;  3HOX B;  3SVM A;  5IGD A;  1Q3L A;  3A56 A;  3G6J B;  1B9N A;  1TII D;  3VA7 A;  5IGC A;  3H09 A;  2EYJ A;  1F2L A;  5FK9 C;  3M85 A;  1EY6 A;  3X3N A;  5IGE A;  4X3U A;  4DGZ A;  1H9S B;  5JVG 3;  1F9R A;  2KCN A;  1PZK D;  3MXU A;  1T5X D;  2A5H A;  1DOM A;  2WAC A;  1R4P B;  3NP8 A;  2K05 A;  2L1B A;  3IFT A;  1OXS C;  3T56 B;  4HSV A;  4RCO A;  2E74 C;  1JC7 A;  4FP5 D;  3I73 A;  4N9P A;  1QE6 A;  2KHS A;  3KLS A;  3BDL A;  4QMG A;  4XQJ A;  4BA2 I;  1HXY D;  2DY8 A;  1Y1W B;  2EYL A;  3R2T A;  3K5L A;  1LLR D;  4BWG B;  1KNE A;  4Q0F A;  5ELB A;  2B2U C;  4PMC A;  4IFD G;  1EOT A;  1TS4 A;  2X6L A;  1BCP D;  3C3L A;  1LT5 D;  4EQP A;  2FMM A;  4C3H G;  3H6M A;  3QWN A;  2PMZ B;  3K0Y A;  2JEB I;  3PUZ A;  1FD7 D;  4A3J B;  1TWF B;  4KKT A;  1X3Q A;  4RGN A;  1RCV D;  1G2S A;  3V05 A;  1K8O A;  4IUN A;  1LT6 D;  2VXW A;  3R93 A;  5KNC A;  3OHX C;  1TWC B;  2SOB A;  3NBI A;  1CHQ D;  3DWQ A;  2I46 A;  3T16 A;  2EE1 A;  2K5W A;  2B2V C;  2MPM A;  1JIC A;  3PMF A;  1ET6 A;  1D5M C;  4H44 C;  2B8G A;  5I6Y A;  3KF8 A;  2RA4 A;  1CFM A;  4FXD A;  3D6C A;  1G6Z A;  2QEJ C;  1BQQ T;  5G3L F;  2CHB D;  2O5J C;  5EQ0 A;  1ET9 A;  2EPB A;  1S5B D;  1M8A A;  1H9K A;  1B50 A;  1RHP A;  2TSS A;  1U4L A;  2R7Z B;  5EKI A;  5K36 G;  2M00 A;  3LWE A;  4A3B B;  5DM7 3;  2JE6 I;  3K58 A;  5FKA C;  4I65 A;  1RJT A;  4ID6 A;  5LHY 1;  3S2H B;  3KLS X;  1ILQ A;  2BA0 A;  2RQX A;  3NK9 A;  2ID0 A;  1GHJ A;  1CTM A;  2XVS A;  3CHB D;  4RGO S;  2EZV A;  1STY A;  2MUY A;  1GUT A;  1PRT F;  5K5P A;  2NVQ B;  2QKI C;  3KUP A;  3E0J A;  5J1Z A;  1K83 B;  3J81 E;  5D3I B;  4KHV A;  4N9T A;  5JAV A;  1PXU A;  4RAU C;  2EYO A;  1STE A;  4FVM A;  4C3H B;  2JA8 B;  4FO2 A;  1E0B A;  4NKL A;  1B4O A;  2AQ1 B;  1LTS D;  1X3P A;  2IL8 A;  2CW0 D;  2BE5 C;  4KD3 A;  4RWS C;  1C4Q A;  1BR9 A;  3S14 B;  4LAA A;  1PTO B;  4OGQ C;  3DUZ A;  4PV1 C;  3QO2 A;  2K01 A;  3MC0 B;  5E4X A;  1HUM A;  2F3W A;  3I90 A;  3URY A;  5JPN C;  1EY8 A;  1EIG A;  1KDA A;  4G4K A;  1YNJ D;  3VR5 A;  2XIW A;  4UDU C;  3PUY A;  5M9O A;  1VF7 A;  4LK1 C;  4RGT A;  5C0X H;  1B44 D;  5EPJ A;  3WOE A;  1WD0 A;  1EZ6 A;  2B2T C;  3QOJ A;  3R3O A;  3P75 A;  3PIP 3;  2PZU A;  1G91 A;  4RKL A;  1L0X B;  1U4P A;  2EJG C;  3PO2 B;  2L55 A;  3GQB A;  2FHT A;  2XWB B;  1Y69 U;  1LV9 A;  1DCZ A;  3NUC A;  2A73 B;  3S16 B;  4U67 3;  1QNK A;  2ICI A;  5NUC A;  1AP0 A;  4RA8 A;  1YNJ C;  4XIG S;  3SDZ A;  1TVX A;  2G9H D;  4H7B A;  1AEX A;  1IHZ A;  4DXF A;  4DAY A;  3HOY B;  3DMU A;  3QG1 A;  1MSH A;  3NTI A;  5COY A;  5CYU A;  1GUG A;  3V96 A;  4KY7 A;  2L11 A;  3OOC A;  3MZ5 A;  1EFI D;  2VB3 X;  1VMC A;  3QIA A;  2MHV A;  4KMU C;  5CC4 A;  3EA6 A;  1PZJ D;  4CKC A;  5D14 A;  1ML0 D;  3ZYY X;  2KQ3 A;  2IPK D;  1F9S A;  2E2I B;  1BNZ A;  3D6W A;  1Y8N B;  1SNO A;  2E75 C;  1EEF D;  2DY7 A;  1UEA B;  1EQV A;  5BN3 A;  3S15 B;  4F87 A;  5FOB B;  1DM0 B;  2CQA A;  1A3U A;  3MXG A;  4A3E B;  1LAC A;  1O78 A;  4ZLT F;  4QCL A;  2O2L D;  4L8J A;  3I4N B;  2ZXR A;  3MTS A;  2ICE C;  3P7J A;  3TP6 A;  1PRT D;  5CR3 A;  2KJX A;  3I91 A;  2GA4 B;  4IFD J;  2J0T D;  4CHT B;  5ELC A;  1CZG A;  4DF7 A;  3NTK A;  4PMB A;  1ZYR C;  1A6X A;  5IGF A;  3RMH A;  2K33 A;  4EQO A;  2ZXP A;  4DNT B;  2RDF A;  4IAL A;  2AWN A;  3K57 A;  1DOK A;  5I2Y A;  3S1N B;  2NTT A;  2XRS D;  2ZXO A;  4BA1 I;  4TRD A;  3HRZ C;  1BUV T;  2EY1 A;  2KEE A;  3GV6 A;  1EY4 A;  3IKJ A;  3SR1 A;  3FVQ A;  4HMJ A;  3NQT A;  1OXU A;  1SDF A;  1V8Q A;  1B9M A;  5C4H A;  4BBR B;  4DAV A;  1QCB D;  5J22 A;  1FNW A;  4NMZ A;  1PRT C;  4O42 A;  1IYU A;  4F8M A;  3ERO A;  2L5T A;  3DM1 A;  3GTP B;  2PO4 A;  2SEB D;  1O7Z A;  3T51 B;  2EJM A;  3EJI A;  2JA6 B;  5KRU A;  3M4O B;  2L4N A;  1PDQ A;  2R3Z A;  1ICW A;  1NR4 A;  1B2T A;  1GUO A;  5CGK A;  1C48 A;  4XQQ A;  5HUR A;  4B9W A;  3DXJ C;  3AB9 A;  1EU4 A;  1RD9 D;  3BVZ A;  2HCC A;  2E2D C;  3TP8 A;  1SNM A;  1JCK B;  4QF4 A;  1LTB D;  5IOC A;  3A54 A;  1UUP A;  3VR6 A;  1FYC A;  2Z4H A;  3S17 B;  3D4D A;  2F03 A;  1MSG A;  1DZ1 A;  5ELE A;  4CKB A;  2Q8R E;  2F0G A;  1DJR D;  2RSN A;  1F9P A;  2RDH A;  5C0X I;  3J7Y W;  1XYI A;  1VCI A;  3NSW A;  5HGT A;  1Q12 A;  1XXG A;  2NZ1 D;  1D5Z C;  1F2M A;  5IOD A;  2FJ2 A;  2D9U A;  2EYM A;  2B2Y C;  1DD2 A;  1I4X A;  1ESR A;  1CM9 A;  1RTN A;  4HN7 A;  3RZO B;  1QNU A;  1I4R A;  2I07 B;  1I4G A;  2EYP A;  1KNA A;  4DAP A;  1QJO A;  1V43 A;  3OWE B;  1EL0 A;  4K5W A;  1JR0 D;  1SE4 A;  3O13 A;  1WTR A;  3BZD B;  2G9D A;  4IUV A;  4G7H C;  1SNC A;  1E2W A;  4K6L A;  2MP1 A;  3OW7 A;  2F1M A;  2YU9 B;  4ULL A;  2F0J A;  2K03 A;  3GP7 A;  1W6K A;  3SK4 A;  5IGG A;  2NVT B;  2M2L A;  3H3V C;  4J1M A;  2NVX B;  1JE4 A;  4Q5V A;  5D3D A;  4A3D B;  3PIO 3;  3NXW A;  3X3M A;  3P20 A;  5C0X G;  4YIJ A;  3VR4 A;  2JA7 B;  4XT1 B;  2QF7 A;  5BN4 A;  4FF1 A;  4HCE A;  3VR2 A;  3TSS A;  4DA2 A;  5M5Y B;  3WDN A;  1TQO A;  3I72 A;  4KKU A;  1SYE A;  2A6E C;  1PFN A;  3EQL C;  3DEO A;  2XN9 C;  2A69 D;  2C5C A;  1PTO F;  1SNQ A;  4X3K A;  1XX8 A;  2O4X A;  1Y8O B;  2BDO A;  4KTA A;  3J7A F;  4WFN 3;  4WRD A;  4PQX A;  4KV6 A;  2EYH A;  2WAQ B;  1CA5 A;  1HTL D;  1MBY A;  3HG9 A;  1H9R A;  2A74 C;  3S1M B;  2WV6 D;  1HUN A;  3A55 A;  5C5L A;  3MA2 B;  3LX0 A;  1WTQ A;  5CV6 A;  2JP1 A;  5IT9 L;  2RKS A;  4IUP A;  5BN5 A;  4XYO A;  4PNY A;  3FPP A;  4KY6 A;  3I3C A;  2F0U A;  3C1F A;  2A69 C;  4XQN A;  1TR5 A;  1Q1E A;  5KNB A;  4AYB B;  1EY0 A;  3K5N A;  1HFN A;  3E5S A;  3MXP A;  2F0S A;  4HED A;  3EVQ A;  1HCZ A;  4FXG C;  3RZD B;  3D31 A;  3BYY B;  3QOL A;  1SXT A;  4C56 C;  4A3I B;  3TME A;  2IWH A;  2N55 A;  2EY2 A;  4KN7 C;  4U68 A;  2F0D A;  2X69 A;  1SEB D;  3M4Y A;  1NUC A;  5KYI A;  2JA5 B;  1SYD A;  2PYK A;  3S2D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...