4JI7Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7Q00
2R7DA 3IRBA 1YHBA 2B29A 5FLMG 1XMOQ 3CMEA 2OTLA 1PH1A 2BH8A 5IWAL 3S1NH 2UU9L 3EBEA 4B3RL 4DV0L 2VUMG 5M5YH 1CUKA 2OCEA 2NVQH 1B70B 1AE2A 4RMFA 3TRZA 4K0KL 1XPRA 4PG3A 1JE5A 1GKHA 1WFQA 2KCTA 3D0FA 4JOIC 4GNXC 1J5EQ 1X56A 1KIXA 3HOYG 2MFIA 5M3MH 4IPCA 4DPGA 3PV0A 4JV5L 2UUAL 3GTPH 1RIPA 3PCOB 2ALYB 3K7UC 2WB1E 4GLVB 4OWXB 1YNXA 4DR1Q 2FXQA 4JI6L 1QVFA 2VQEL 2HIVA 1VQDA 4R4OA 3PUZA 2IT1A 1JJCB 3E0EA 4GKKQ 1OXXK 5IYDG 1K83H 1IYJB 3KDFA 5C0XJ 4DV1L 2QGQA 3M4QA 4LFAQ 4DV5Q 1KL9A 3PO2G 3S1QH 4QJFA 3PO3G 4LW1A 1KC8C 1IBML 4P74A 5IE8A 1N36L 4Y52H 3CCLA 1PYSB 4GN3B 3FKIG 1YHQA 3CQZH 4GOPC 2NZHA 1MIUA 1NBWA 1PH4A 2K5VA 1OXSC 1FGUA 1CKNB 3H0GH 2RCNA 2VQFQ 2JJQA 5C3EG 1O7IA 1N33Q 4QL5A 4QIWE 5M3MG 1HR0Q 1KRSA 1S3OA 2UXBL 2OQKA 1JJ2A 1QUQB 1WCMH 3BJUA 4X66L 4O2DA 2JE6I 2UUAQ 2KCMA 4L5QA 5JJIA 4ALPA 4B3SL 1BKBA 3L0OA 2A1AA 4UP9A 3F2BA 3S1MH 1PVOA 3CAMA 4A75A 1SLJA 4DR7Q 1SROA 3U50C 1W2BA 3OYYA 1E7ZA 2K75A 1VQJA 5IYCG 3A0JA 3ULLA 3ER0A 3PGZA 2GVAA 4Y7NH 1VQ6A 4DNIA 1N32Q 3BU2A 2UXBQ 4JI2Q 1LYLA 4DR2L 2HHHL 3DLLA 4KI0A 4FDBA 2OTJA 4C2MH 2WP8J 5M3FH 3CPWA 1TXYA 1VQOA 2JA5H 4A3LG 1V9PA 3CMAA 3RZDH 4H02A 1NMGA 3I4MG 4LFCQ 3KDFB 3KLWA 4YHHL 1IBLL 3HKSA 3G71A 1LUZA 2EQSA 3AEVA 5IP7G 4PMWA 1FL0A 2KBNA 1J6QA 1YI2A 1L1OC 3MEFA 3CPFA 4NPSA 3ICEA 4LF7Q 2MNAA 1YIJA 1HR0W 2E2JH 1N8RC 2VS1A 4A3IH 4GN4B 4L5TA 1XTDA 4JBKA 3JAMi 2B63G 5IYCH 3TQYA 1Q7YC 1XNRQ 5JEAJ 4DUZL 3ERSX 2ES2A 4LFBQ 1VQGA 4A93G 2NN6I 2PNHA 2K5HA 4OO1I 1QUQA 4DK3C 2UUCL 4OO1G 3AYHB 1IBLQ 4BY1G 1GM5A 1V43A 3I4MH 2K14A 3HOVH 1Q1EA 4YY3Q 1GVPA 2LSSA 4AIMA 2UXCL 4JI4L 5K36G 5C4XH 2I5MX 1EUJA 1UEBA 3NBHB 4GS3A 4JYAQ 5LMNL 4NB3A 4GKJQ 1HR0L 4DAMA 1VQ8A 1PH3A 3UDGA 2PI2A 1K9MC 1Y1VH 4DUZQ 2WAQG 3K81C 2XTIA 3CF5A 4DR6Q 2JA7G 1CSQA 3U4VA 1NTGA 3PF5A 1YZ6A 5C44H 1OXUA 4BY7G 1VS0A 2AWNA 4POFA 2VW9A 3S1RH 4LF9Q 4AH6A 4DR5L 4DR6L 3BZCA 4IJHA 4BXXH 3TS2A 4HJ7A 4IPGA 1BVSA 2E8GA 2L15A 2HHHQ 4LF4L 2E2HH 2NVYH 4J15A 1C7YA 4BA2I 4LWCA 4HJ8A 1N32L 3GTLH 1M90C 3GTOH 1H95A 1WYDA 3A74A 5IT9c 3GTKH 4A3CG 3LGJA 2PI2E 4X65Q 2JA7H 1PH6A 1M1KC 1P8LA 4YHHQ 4DR3Q 2KHJA 3AFPA 3RLFA 4NXNL 2F3IA 2IX0A 4JI1L 5IY0A 3J7ZC 3CCRA 4IO9A 1Y1WH 1NJIC 4B3MQ 4BY7H 1B7YB 4MTNA 1SR3A 1T9HA 3H0GG 5IP9H 3Q8DA 3TEHB 2RHSB 3GTJH 4DV5L 3T1YL 4LF8Q 4LF6L 4DV2L 1YEZA 5EAYA 2ASBA 4LF4Q 3I55A 1WJJA 4X66Q 2N49A 3AFQA 1XNRL 3E9IA 1W3SA 2R92G 2R7ZH 2BA0A 3D31A 4DK6C 3W5OA 1XMQL 1PA6A 4AYBE 4A3JH 4UPAA 1I5FA 1K8GA 1KAWA 1YITA 3F2CA 1TWFH 2K5NA 1N33L 4JCVE 5GAHC 4LF6Q 4DV4Q 1X54A 2JK8A 3ZJYC 1Q86C 2PMZE 1SRUA 3HKZE 4P71A 3M3YH 1VQLA 2K50A 3PUWA 3RN5A 1XJVA 3J81j 1Y1WG 1AE3A 2AKWB 2QA4A 3F8TA 4P72A 2IHFA 1DGSA 5BR8Q 1A0IA 4X62L 4A3DH 3HOUG 4LFBL 3HKZG 4C3IH 2F52A 4A3LH 3K8AA 1MKHA 3HFZB 1L1OB 3PIPA 1Q8KA 1VCIA 2R7ZG 1Q46A 2VY3A 1FJGQ 2IY5B 2AHOB 5M5WH 4DV4L 3HOZH 1G51A 5LMUQ 2V1CC 1GD7A 3KYHC 4WJ4A 1UE6A 2LXKA 1VQNA 3OTOL 4LF5L 3PO2H 3PO3H 2D0PA 3SGIA 1KHIA 4B3RQ 1E3PA 1I3QH 1U0LA 4LUVA 3FKIH 4DV7L 4L5RC 1I50H 1G291 3ULJA 1SFOH 5GADC 4P73A 4HJ9A 2B63H 3CW2C 5BR8L 1N34L 1L0WA 1IL2A 1VQ7A 1LTLA 5C3EH 3S2DH 4KLKA 4HJAA 4JV5Q 3UDXA 3I2ZA 4JI7L 3FHWA 4OWWB 4YY3L 4IFDG 4A3GH 1K0RA 4JI4Q 1I94L 5C4JH 2JQOA 4P75A 1CKMA 1QZGA 1YJ9A 1E22A 2UU9Q 2JEAI 3M4PA 5C4XG 1YJNA 1MJCA 2LXJA 3UDIA 3CCUA 5C0XI 1HZ9A 4GLAC 4PZ8A 4IPDA 1CSPA 3B6YA 1ASZA 1N34Q 2ZTDA 1OTCA 3NENA 4A3BG 2CWPA 5HY6A 4A3EG 3W1GA 3S17H 4DV3Q 2Q2IA 3KF8B 4JI6Q 2CKZB 3GD7A 3DM3A 4R4CA 1D7QA 1PH7A 4LUZA 2R93G 3G4SA 1I94Q 1L1OA 1QVCA 4AQYQ 3WWVA 2QEXA 4A3GG 1FJGL 1KXLA 4OX9L 4ME3A 4IJLA 3J80c 4JI5Q 2N3SA 2RF4A 3KOJA 3K7AH 4YWMA 2Q2UA 2CCZA 4IPHA 4MZ9A 1QZHA 4BBSH 1XMOL 4BXXG 3W1BA 2A8VA 1VQPA 2DUDA 5IP7H 1PFSA 3CC4A 1KQSA 4GOPA 4A3KG 5E7NA 2Q2TA 4B3ML 2YU9H 2R7FA 1HNWQ 3KF6A 5FLMH 1BBUA 2NVXH 1E1TA 1B8AA 1IXRA 4C3JH 1D8LA 4OX9Q 2YV5A 2YTXA 3EN2A 4GNXB 5FJ8G 4LNQA 4RG1A 1VQKA 3M9BA 3PF4A 1IBKL 3RR5A 2R93H 1HJPA 1YHAA 1VQMA 1XMQQ 2IHEA 4HIMA 3HOYH 3S16H 1UE1A 1L2FA 4QY7A 4XIGS 1TWGH 4BA1I 4DR1L 3G6EA 5GROA 3HOVG 4A3FG 4JI0Q 1HZBA 1K3RA 4O0AA 4JI3L 3STBC 3I4NH 4BBSG 2WAQE 3KJPA 4EQ5A 3U58A 4LF8L 1OXVA 2GN5A 1PH2A 1JB7A 5IYDH 4L5SA 1Z47A 3RNUA 4A3KH 2UUBQ 5JJLA 1EIYB 1VQ5A 2Z0SA 3CD6A 1N36Q 3CCEA 4JI7Q 4JBWA 3L2PA 2YTVA 1GO3E 5FJ8H 4LFCL 3PUXA 2RHQB 4DUYL 3HOWH 3NEMA 4C3HH 1HNWL 1MJEA 4DV1Q 3J80i 4GLXA 4X62Q 1S40A 4IFDJ 1VQ4A 2N78A 4A76A 2F4VL 1EFWA 5DLQE 4UP8A 3PUVA 2ID0A 1EQRA 2VUMH 3OW2A 4DV6Q 2NN6G 3I7FA 2ZJQA 1A63A 3EIVA 4A3FH 3TREA 3CC2A 1PV4A 1XNQL 5LMNW 4TVAB 5JJKA 2E2IH 2NVTH 4GOPB 1RL2A 2MQHA 1EWIA 4LF5Q 3JC66 4JG2A 4DUYQ 2UUCQ 4BY1H 3HOZG 4YCWA 4X6AH 3CCSA 4JI1Q 3PSIA 4YWLA 4B3TL 1KD1C 2JA8H 2A19A 1XPUA 2C35B 4UP7A 2HIXA 2E5LQ 1VQCA 1VQFA 2YYZA 1JT8A 1VQAA 1Y1VG 4DR2Q 1E24A 5GAEC 2CQOA 2YTYA 1YJWA 4JYAL 3A5ZB 2B3GA 1TWHH 2N8NA 4R4IA 3U4ZA 5C44G 2JA9A 4DR5Q 4A3MH 2UXDQ 5H1SE 1TWCH 4X64Q 2R92H 1S72A 1HNZQ 2VNUD 1UE7A 2UUBL 4PZ6A 1TWAH 3AQQA 5GQOA 2EIFA 1C9OA 1SE8A 1IBMQ 3CXCA 1JMCA 4BBRG 2EXDA 4B3SQ 2AMCB 4R4TA 2WFWA 2Z6KA 1PHJA 1CKOA 4NXML 1XNQQ 1V1QA 4MNOA 4YCVA 3T1HQ 4R4QA 3M85A 1WCMG 2JA8G 1I6HH 2Z6KC 3F2DA 2ZM6Q 4A3BH 4A3IG 4JI3Q 3JAMc 4A3EH 5JEAG 4LF9L 1WI5A 2JEBI 1UWVA 2Y0SE 3MXNB 5ELNA 4QQBX 3T1YQ 1PH5A 5AJ3L 3I4OA 1AH9A 4A3CH 3RLOA 3CCMA 3TS0A 1Q1BA 1X3EA 1J5EL 2D62A 2I0QA 4A93H 4A3DG 3ULPA 2IX1A 1HNZL 1X65A 3J81c 2MO0A 4A3MG 1NMFA 4TQUS 1A8VA 5IWAQ 3F1ZA 4IFDI 4X65L 4DV2Q 3J7A5 3M7NA 1NY4A 1Q12A 1X3GA 5M3FG 2PQAB 4BBRH 3HOXH 2GVBA 4GKKL 3UDFA 5AJ3Q 2ZM6L 3GDEA 3PUYA 2JA6H 1VQ9A 1UE5A 1FVIA 2E5LL 2XGTA 2Y0SG 4OONA 2DGYA 4JI8L 4HIOA 4A3JG 3UE1A 1WOCA 2Q2HA 2VL6A 2WB1G 2VZAA 4YWKA 5HGQA 3T1HL 1PH9A 4XTCS 2BH2A 4WJ3M 2K4KA 3G48A 1NE3A 1CKNA 3KF6B 4LFAL 1Z9FA 4OWTB 2UXDL 1IZ6A 4HIDA 3GTGH 4X64L 1HZAA 4IOCA 4GNXA 1E1OA 3CP0A 3PIOA 1JJGA 1G6PA 4KHZA 3KFUA 3S24A 4JI8Q 2CWAA 1PYBA 1Y14B 4LUOA 4DV3L 3S2HH 2OWOA 3H15A 2KENA 1HZCA 3H3VH 1VQHA 3HOUH 3I4NG 3M4OH 4LF7L 3HOXG 3K0XA 3A5UA 1X55A 5LMNQ 4GKJL 2I5HA 3K80C 4JC0A 4DAYB 1VQIA 5GAGC 2ZTCA 2VQFL 4DR4Q 1X3FA 3NELA 5M5XH 2I5LX 4JI5L 1Q82C 4DR7L 3BZKA 1LM0A 5C0XG 3L7ZC 4DR3L 2CFMA 1XPOA 3CC7A 4HJ5A 4AQYL 1HNXQ 3CCVA 5LMUL 3S14H 4JBMA 1EYGA 1R9TH 1VQBA 5IP9G 4QGUA 1KRTA 2JA6G 3E9HA 2ZJRA 1YBYA 4DV6L 3H3VI 2H5XA 2HQLA 2VQEQ 4AYBG 1YVCA 4NXMQ 1K73C 1EQQA 2PQAA 2NZOA 4R1JA 5ELOA 1X9NA 4DV7Q 2BA1A 5IYBG 2F4VQ 1OXTA 4PZ7A 1Q81C 2R6GA 2JA5G 4POGA 1BBWA 3GTQH 3STBD 2ZTEA 1HNXL 4YCUA 2ATWA 4KHPL 1QVGA 4A4IA 1P16A 4OXPA 2AWOA 2KHIA 3RLNA 4DR4L 2HT1A 3UE0A 3RZOH 3J81i 1A62A 4EX5A 1U5KA 1EIFA 4JI0L 1SN8A 4IOAA 2OQ0A 1VQEA 4APVA 1SMXA 2D0OA 1ASYA 4B3TQ 1C0AA 3CCQA 2UXCQ 2ZJPA 4KHPQ 5J3BA 3VDYA 3I56A 5IYBH 1IBKQ 2MO1A 3OTOQ 3S15H 3KJOA 1HH2P 1K8AC 4HIKA 3GO5A 4NXNQ 4GN5A 1EOVA 4DV0Q 2K52A 4UY8C 4K0KQ 4JBJA 1N9WA 4DKAC 4JOIA 5FLXc 3GTMH 3CCJA 3FP9A 3HOWG 4JI2L 1PH8A 3RN2A 1X6OA
chains in the Genus database with same CATH superfamily
3IRBA 4ME5A 5FLMG 1IW7D 1UUPA 5IWAL 1PTOF 2VUMG 5M5YH 1II3A 4K0KL 4RMFA 1GKHA 2KEEA 2KCTA 1SYGA 4GNXC 3A55A 3QOJA 3HOYG 4UAIA 2K5QA 1R9TB 1S5FD 3K7UC 3DWAA 4OWXB 3FMCA 3MXGA 3K7AB 2FXQA 1QVFA 1ZYRD 4CKCA 1I4RA 2QDBA 3E0EA 5IYDG 3KDFA 3SDZA 5C0XJ 4DV1L 4DV5Q 1KL9A 2K32A 5EPLA 4LW1A 1EU3A 1KC8C 1IBML 1H9RA 5EGTA 5COYA 2AQ1B 1SNOA 2V4DA 3PO2B 1OXSC 2RCNA 4ZYSA 2JJQA 1N33Q 1I50B 1NSNS 2L12A 3V96A 2D2CC 1ESRA 2UXBL 3K58A 3EA6A 1JJ2A 1QUQB 4X66L 2L5TA 3NTIA 3Q22A 3TSSA 1XYIA 4B3SL 1IYUA 4KY7A 1QNKA 3Q23A 2A1AA 2EE1A 4UP9A 2MHVA 1V1PA 3CAMA 5J22A 3S1MH 3NE5B 3SK4A 2K75A 2M2LA 3A0JA 4Y7NH 2GVAA 5A2QL 3BU2A 2JA8B 4JI2Q 4DR2L 1S5CD 3DLLA 3SK8A 1CTMA 3OOCA 4CBVA 1NMGA 4HR7B 4PMCA 4LFCQ 3KLWA 4YHHL 1IBLL 4C3IB 4FXDA 2EYLA 2EQSA 3DEPA 3AEVA 2F1MA 4PMWA 1L1OC 4C3HG 4LF7Q 2MNAA 1SJED 1N8RC 3MFGA 1UEAB 4A3IH 4NW2A 2HDLA 3JAMi 1XNRQ 3TQYA 5CYUA 3I70A 5JEAJ 4DUZL 3S9WA 2YU9B 1HXYD 4F8MA 4A3MB 4CDEC 4A93G 3TP5A 1SE3A 2PNHA 2K5HA 2UUCL 3T4AC 4BY1G 1LTGD 3I4MH 4YY3Q 1G8ZD 4JI4L 5K36G 2I5MX 1UEBA 3NBHB 4GS3A 4UHVA 4K14A 1D5XC 5LL6X 1KDBA 3UDGA 2OT2A 3VR2A 2XTIA 5DAUA 4IQZA 5IODA 2F0EA 1CSQA 3U4VA 3PF5A 1BOSA 1YZ6A 3NBIA 4YIJA 1QE6A 1VS0A 3BVMA 2DY7A 3S1RH 1DZ1A 4DR5L 1D6EC 4IJHA 3TS2A 1ZKOA 2H1EA 1BVSA 1B9MA 2O5IC 4LF4L 2E2HH 1HTPA 4J15A 4M8AA 5C3EB 1N32L 1H95A 3GTOH 4A3CG 5C5MA 1F9SA 3LGJA 4DA2A 3RLFA 5IY0A 1Y1WH 4BY7H 1SR3A 2DNCA 3H0GG 2JA6H 4LF4Q 1JCKB 1SNQA 2N49A 1TS3A 2A5HA 2R92G 3W5OA 1XMQL 4BS9A 1TVXA 4AYBE 4UPAA 1KAWA 1YITA 3F2CA 5GAHC 5E3FA 4G7OC 2JK8A 1SRUA 1VQLA 3BVZA 3PUWA 3RN5A 3AU7A 1GOZA 1V1PB 2QA4A 4P72A 2IHFA 1DGSA 3LWUA 1A0IA 4X62L 4A3JB 3K57A 2Z9HA 3HFZB 1S5ED 1L1OB 3MA2B 4HAEA 2R7ZG 2A69C 2XSCA 1PRTB 2VY3A 2IY5B 3VYRA 1G91A 1G51A 3KYHC 4ZQ3A 1UE6A 2SEBD 2FMMA 1YNND 3MFYA 1EEID 4FF4A 1TR5A 1U0LA 4CDFC 4A3EB 3HZXA 3I72A 3ULJA 3J7YW 1L0WA 1IL2A 3I4NB 1SE2A 4KLKA 3I2ZA 1SYDA 3DUZA 1PDQA 1QCBD 2F0TA 5BN4A 4OWWB 4YY3L 2RA4A 1BCPD 4N8FA 2CH4A 3U9SA 4A3GH 4JI4Q 1I94L 2R7ZB 1A3UA 5C4JH 4P75A 1YJ9A 2UU9Q 2JEAI 1U4LA 2EYFA 5I6WA 4KMUC 1RKNA 3M4PA 5C4XG 1VMPA 1E2WA 1MJCA 2LXJA 3UDIA 3CCUA 3OIQA 4PZ8A 4IPDA 4RAUC 2WV6D 3NTHA 4XT1B 3R8BA 1ASZA 1N34Q 1FGBD 2ZTDA 4RKLA 4ZRZA 1CZWA 2NVYB 1OTCA 3S17H 4RH6A 4Q0FA 2X69A 1G2SA 3RZDB 1CFMA 3QWNA 4ZUJA 4KK7A 1QJOA 3IKJA 3G4SA 1DOMA 2QEXA 1FJGL 4FP5D 1ESFA 4IJLA 2RF4A 1FNVA 4JI5Q 4A3FB 1VMCA 1ET6A 4BWGB 5M3MB 1VQPA 1EQVA 1SYEA 5AFWA 4A3KG 3SK6A 3DEOA 2XWJB 4OX9Q 2NYZD 2YTXA 4ULLA 4JW0A 1VQKA 3PF4A 1HJPA 1K8OA 2AUJD 4HIMA 4LAAA 1L2FA 3CQZB 4BA1I 3G6EA 5CV5A 4DAYA 1XTCD 1CHQD 5D14A 4BBSG 2RDGA 1B2TA 3TDQA 1OXVA 2GN5A 3GTOB 2L1BA 4L5SA 2R93B 3DHQA 2SOBA 1VQ5A 1EIYB 2WINB 1TY2A 5IGFA 1EZ6A 3CCEA 1O7ZA 3W3AA 4JBWA 4BBRB 4EVOA 2RHQB 3WOFA 3NPPA 1EYAA 3KLRA 3NEMA 4DV1Q 1ENFA 4X62Q 4TKOB 1VQ4A 5DLQE 4UP8A 2ID0A 1WTHA 4HSPA 3OW2A 1PFNA 4L6TB 2Z4HA 3JC66 4BY1H 4B9XA 1Q3LA 2QKIC 3HEJA 4B3TL 1NUCA 4UP7A 3HGBA 5JEAH 5DM63 4ZKCB 2YYZA 4ODGA 3S2HB 1JT8A 1Y1VG 1E24A 3S16B 4ZCKA 1GXDC 4JYAL 2N8NA 2F4IA 1HPCA 3U4ZA 3MTSA 4A3MH 2UXDQ 1I4GA 1TWCH 1S72A 2EJGC 2FFKB 2VNUD 2F0KA 1UE7A 2NVXB 1TWAH 2IWHA 1FNWA 4A3IB 1JMCA 1C9OA 1SE8A 3FDTA 4BBRG 1HQRD 2WFWA 1GHJA 2CQAA 4NXML 1XNQQ 1SMYD 4R4QA 1DYQA 2Z6KC 3F2DA 4JI3Q 3FKIB 1S5BD 1ZYRC 3J81L 1AH9A 1PRTD 4A3CH 4QUFA 4J8QA 1X65A 4TQUS 1WD0A 3F1ZA 1HFNA 4Q5VA 3M7NA 3HOXB 2PQAB 4LMQD 3PUYA 1VQ9A 3LNNA 1UE5A 3BDOA 1FVIA 1LTSD 4RA8A 4C1NK 2CW0D 2Y0SG 4AYBB 4HIOA 4A3JG 3R3OA 2VL6A 4I7ZC 1PH9A 2BH2A 4WJ3M 1RF2D 1NE3A 1V8QA 3KF6B 3I73A 4LFAL 2UXDL 4HIDA 3GTGH 2K5WA 4X64L 1HZAA 2A68D 3FVQA 1ENCA 4QIWB 3PIOA 1JJGA 1RD9D 3ERQA 5I9OA 4JI8Q 3S2HH 2OWOA 1JB3A 1HZCA 3HOUH 3IFTA 2B2TC 1GJXA 3C2PA 5E4XA 1VQIA 1SSOA 2ZTCA 3MVVA 1X3FA 5EPJA 4DN4M 2I5LX 1WTOA 1Q82C 4DR7L 3CCVA 2A68C 3H91A 1QB5D 1RDPD 2SNMA 1VQBA 1R9TH 4ZAIA 3ND9A 1KRTA 5FO8B 2ZJRA 1A3TA 2H5XA 3E3XA 3TBIB 2Y0SB 4AYBG 1T5EA 1K73C 2NZOA 5IGBA 4LK1C 1NNXA 4KKUA 5M5YB 3DXJC 3D4WA 1BBWA 2HCIA 3STBD 1HNXL 4YCUA 2EYJA 5BN3A 5F2DA 4G7ZC 4C3JG 2KHIA 3RLNA 1ZEQX 4XYQA 1A62A 3J81i 4CJ0B 3D6WA 4I7AA 1EIFA 3HOWB 1WTWA 1ASYA 1C0AA 1EWHA 5J3BA 5IYBH 3OTOQ 3S15H 4C1NI 3KJOA 3P7JA 4RGMA 1DOKA 1CA6A 1GUNA 1EOVA 4RGNA 3I4LA 4K0KQ 4DKAC 5CR3A 3QB3A 3CCJA 3OMGA 4RGTA 4JI2L 3RN2A 4DV2Q 3I91A 4BY1B 1KTKA 3PO3B 2E75C 1PH1A 2BH8A 3S1NH 1TS4A 3OIPA 3TRZA 1AE2A 2KCCA 3VR4A 1XPRA 3JAML 1J5EQ 4JOIC 1KIXA 2MFIA 2Z4IA 4BBSB 1L0XB 3OWFA 1RIPA 2AUKA 1TY0A 3PCOB 2WB1E 1YNXA 2VQEL 1FNUA 2XVSA 3PUZA 2IT1A 1GUSA 1JJCB 1LT6D 2C5CA 4LFAQ 1I4XA 5FO9B 5IE8A 1YHQA 2NZHA 4FYDA 5KIXA 5C3EG 3TMEA 4JPBW 5C3WA 3SE0A 2XNAC 1H9SA 1PZKD 1ML0D 1WCMH 3BJUA 3EJIA 5JJIA 2F0QA 1DM0B 4ALPA 1BKBA 3Q0AA 2XIWA 1TKWB 1EY5A 1LTID 1PVOA 1PFBA 1IL8A 1SLJA 5D3IB 1K83B 1SROA 3U50C 1W2BA 2F0WA 1E7ZA 2B2VC 1VF5C 3ER0A 3PGZA 2TMPA 2HDMA 3H3VC 1CM9A 4FDBA 4C2MH 2WP8J 1TXYA 1VQOA 1X3QA 1V9PA 4DFAA 3CMAA 3RZDH 4H02A 2B2WC 2DJGC 3I4MG 1Y69U 3OHXC 3G71A 1LUZA 3WDNA 5IP7G 2KEDA 4K8IA 5EBCA 1YI2A 2G9DA 3MEFA 4NPSA 1Z7TA 2E2JH 3MXPA 4L5TA 1XTDA 4JBKA 1B9NA 2OEOA 2VB2X 5CV9A 1Q7YC 4RGOS 3P75A 3SVMA 1M8AA 2ZXPA 4OO1I 1H9SB 5JVG3 2K14A 5I2YA 2KA7A 1GVPA 1HHVA 4AIMA 1JC7A 1AEXA 3A7LA 4DAPA 1EUJA 2LMCB 4XYOA 4R8NA 1HR0L 1PH3A 2PI2A 3E5SA 3J7AV 2RSOA 2WAQG 3CF5A 1QG7A 2DNEA 2JA7G 4RCOA 5C44H 2K6AA 4BY7G 3K6OA 2RBMA 3A8JE 1TS5A 2VW9A 1KLUD 4ZKBB 4LF9Q 4IURA 2Q8IB 2L15A 2HHHQ 1BDOA 1ONLA 4LWCA 1S5DD 2JN4A 2PI2E 1P8LA 3GTGB 1KABA 4DR3Q 2C9OA 1U4MA 1IW7C 3CKIB 1SNMA 4MTNA 1T9HA 3TEHB 1WCMB 2B2VA 2L4NA 3NWSA 1XWEA 4DV2L 5EAYA 2JA6B 1STEA 2NB0A 3I55A 3M4OB 2QILA 4X66Q 5FLXL 3AFQA 3NBHA 3E9IA 2JA7B 5I4DA 2JA5B 2R7ZH 5M3FB 4DK6C 2WB1B 1K8GA 1I5FA 1TQOA 2K5NA 3K5LA 4TSSA 4DV4Q 4DU9A 4P71A 3CHBD 1RTNA 2K50A 1EIGA 1XJVA 2E2JB 1PTOD 1Y1WG 1MSGA 1LTAD 2E2IB 2NVTB 2BCOA 3HS0C 3F8TA 2B8GA 3HKZG 3K8AA 3TN2A 4IFDH 1MKHA 4JVZA 1Y1VB 1FJGQ 1SEBD 5M5WH 5JPNC 3HOZH 2F3VA 2V1CC 1GD7A 5CV8A 4WJ4A 2LXKA 1I4PA 3T51B 3I90A 1JOOA 3PO3H 1KHIA 2BE5D 4NMZA 5IT9L 4B3RQ 4DV7L 2K04A 1I50H 1SFOH 2B63H 3S1QB 1N34L 4OIJA 1IHZA 5J39A 1MD2D 1A3VA 5E1FA 3UDXA 2EY2A 1CK1A 1PRTC 3L9AX 3OMCA 1HRJA 1K0RA 1FYCA 4CKBA 2JQOA 1QZGA 2E76C 2LS01 5TSSA 1YJNA 5C4ZA 4S3SA 1TT2A 5CC4A 5C4HA 2SNSA 5HY6A 4QUCA 3W1GA 4A3EG 2ZT9C 4X3KA 3KF8B 5EQ0A 2CKZB 2M9VA 2EJMA 1D7QA 3BYYB 4DXFA 1QVCA 4PV1C 2B39A 4HSVA 4A3GG 1KXLA 4OX9L 4ME3A 1CZGA 3URYA 4BBSH 1XMOL 1F2MA 1BO0A 2A6HD 4GOPA 2Q2TA 5E7NA 1SJHD 5FLMH 4OIKA 2NVXH 1B8AA 1IXRA 4XXEA 1GUWA 4FO2A 2M00A 3NQTA 3HOVB 1IBKL 4IUPA 3CRKC 1YHAA 3Q6SA 2IHEA 1SBBB 3S16H 1UE1A 2BDNA 5GROA 4A3FG 5JAVA 3NSWA 3G7LA 4E6IA 1IYVA 2PO4A 1SFOB 5IYDH 1Z47A 4KY5A 2Z0SA 2ICEC 3CD6A 1F77A 3J7AF 1LABA 3GV3A 4JI7Q 3EROA 2YTVA 1STBA 3KUPA 4LFCL 3HOWH 2KQ3A 1HNWL 1F2LA 5FLXE 1MJEA 1CT1D 4IN3A 4GLXA 5EKIA 4B9WA 1JORA 2F4VL 3PUVA 5IGCA 4RKBA 5IT9E 2ZJQA 1PTOB 3EIVA 4FF1A 5J1ZA 2K7VA 1PV4A 1XNQL 5LMNW 2E2IH 2NVTH 4PMBA 4A3BB 5C4JB 4X6AH 3PSIA 2G5DA 1CI3M 1PRTF 2JA8H 1XPUA 2C35B 4G4KA 1PXUA 2KVMA 1VQCA 1VQFA 2B2YC 4DR2Q 3S1MB 3A5ZB 1B3QA 2SDFA 2AQ3B 2JA9A 1AZQA 5I2XA 4X64Q 1SYFA 1HNZQ 4DK1A 1TWCB 3MXUA 4PZ6A 4B3SQ 3HOUB 4R4TA 5FKAC 4QMGA 1V1QA 4YCVA 1WCMG 5KGUA 2A74C 1Q90A 2B63B 2ZM6Q 1MHWC 4A3IG 3JAMc 2H4OA 2DJFC 2Y0SE 3DM1A 5ELNA 4WFN3 3KBGA 3T1YQ 1PH5A 3I4OA 1LTRD 1GHKA 3CCMA 2KUMA 2DY8A 1X3EA 4OGQC 3H6MA 5KYIA 1SE4A 2D62A 4A93H 4A3DG 4XDXA 3M4YA 2IX1A 2L11A 2HD3A 3SXHA 3N6RA 1CHPD 3ITPA 1NY4A 4KHVA 3BDLA 3C1EA 3HOXH 2GVBA 3G6JB 2XGTA 4JI8L 3UE1A 5G3LF 2WB1G 1G6ZA 2F0HA 1DXMA 2VZAA 4YWKA 3T1HL 4XTCS 2K4KA 3G48A 1CKNA 1I4HA 1Y1WB 1RJTA 5JPMC 1E1OA 3CP0A 1EZ8A 1SAPA 3ZYYX 2G9HD 3FRPB 4GZYC 3H15A 2KENA 1K8MA 3I4NG 3M4OH 4ZK9B 3A5UA 1STHA 2PQEA 4H0LC 1HTLD 4JC0A 1PZJD 4DR4Q 1CQVA 1JQYD 4JI5L 5C0XG 1XPOA 1EY0A 1HNXQ 2CFMA 2Z1CA 5C3XA 3CC7A 4AQYL 3P1HA 3S14H 1V1OA 1JWMD 4RHSA 3IL8A 3AMUA 2IW3A 3GTPB 5IP9G 4QGUA 1G2TA 1PLFA 1D1KA 4NXMQ 3C46A 2P5ZX 1IKLA 2F0MA 2KJXA 4EGVA 1BNZA 1A2TA 2EY1A 4PZ7A 4POGA 1O7YA 3K59A 2QF7A 2ZTEA 1WTVA 1QVGA 4A4IA 4OXPA 5DEHA 4N8X1 5C44B 3BS1A 1RODA 1TIID 5CMDA 3MAQA 1C8CA 2XN9C 3GV6A 4NDXA 4EQNA 2DN8A 4IOAA 1E2ZA 1VQEA 4APVA 1SMXA 1EFID 3CCQA 3R2IA 3HP3A 1S4ZA 3S2DB 4OO1H 1FR3A 2R3ZA 4NXNQ 4GN5A 4DV0Q 1RHPA 1N9WA 1NCVA 1U9RA 3GTMH 5K5PA 3U9OA 1PH8A 5CORA 1JWUD 3MWYW 1YHBA 2B29A 3CMEA 2OTLA 1VDZA 3CRLC 2I07B 3EBEA 4DV0L 4B3RL 2RSNA 1CUKA 2OCEA 2NVQH 1B70B 1F9PA 3VA7A 3K5OA 1HUNA 1WFQA 5M3MH 4DPGA 3M3YB 4GLVB 4JI6L 2HIVA 4R4OA 4CDCC 2EJFC 4NKLA 4RHRA 3J80L 1K83H 1IYJB 3T13A 5M5XB 2QGQA 3M4QA 3PO2G 3S1QH 1EL0A 3PO3G 1EOTA 1JOQA 4P74A 3HRZC 1N36L 1STYA 3CCLA 4IUTA 1MIUA 1NBWA 1FGUA 1CKNB 4HTHA 2VQFQ 1O7IA 4QL5A 3TP7A 1KRSA 1JWSD 3O13A 2B8FA 2OQKA 3TZUA 2RCFA 4O2DA 2UUAQ 4L5QA 1KDCA 1ICFB 1A15A 4CKEA 1AW7A 1Y8OB 1K0SA 1STAA 4A75A 4LJZC 2E74C 2PZTA 4DR7Q 1Y8NB 4OL7A 3OYYA 5HURA 1VQJA 5IYCG 4M1UB 3ULLA 1NAPA 3PQIA 1SNDA 2HHHL 5M3FH 2B2WA 3CPWA 2JA5H 3PMFA 2KOLA 3D3RA 5ISRA 1BXTA 3BVGA 3S1NB 1WD1A 5A35A 3ICEA 2K01A 2ICIA 2K28A 3CU7A 1YIJA 1HR0W 4IZ8A 3J81E 4GN4B 2B63G 1BCPB 2B2UA 2Z6BA 5I9PA 3ERSX 4LFBQ 3T53B 4ABNA 2F0PA 2MGSA 1AN8A 3I4MB 1QUQA 3ONAB 3AYHB 2QEJC 1YNJC 3HOVH 1Q1EA 4KKSA 3A56A 2O4XA 1Z6HA 2N88A 4K2KA 2AQ2B 5LMNL 3A8KE 3LWEA 1B44D 1K9MC 1Y1VH 3A7AB 3IAYA 3LX0A 1NTGA 4ZUIA 5KNDA 4I65A 1LT4D 1ILPA 1IKMA 1YNJD 1T5XD 4POFA 2BOSA 1DD2A 2D9UA 3DWQA 4DR6L 3BZCA 4BXXH 4HJ7A 4IPGA 2E8GA 2EPBA 1C7YA 1M90C 1WYDA 3JAME 4X65Q 2JA7H 1PH6A 1STNA 1M1KC 3E0JA 2NUCA 3AFPA 1ET9A 4NXNL 1F2ZA 2F3IA 4JI1L 1B53A 1SXTA 2KECA 1NJIC 4B3MQ 5IP9H 3GTJH 3Q8DA 1F9RA 2IX3A 1NR4A 1WJJA 2OXPA 3A8IE 2NWGA 1XNRL 3HG9A 1W3SA 1VF7A 1F9QA 4C2MB 2BA0A 3D31A 1PA6A 2F0IA 1DONA 4A3JH 1TWFH 4KN7C 4JCVE 1HCZA 3ZJYC 1HFGA 1Q86C 3BYTB 3M3YH 5ELCA 3J81j 5M5WB 4EQOA 1AE3A 1AZPA 5T1IA 1EY6A 2RDHA 3FPUB 2NVQB 4A3DH 4MIUA 3HOUG 4C3IH 4X3SA 2Z8LA 5C6AA 4A3LH 4G7HC 4O1NA 1H9MA 3PIPA 1Q8KA 1VCIA 1MI2A 2CH4W 4DNTB 1SYCA 4O42A 2PMZB 3HKZB 1WTRA 1VQNA 4LF5L 2EY5A 3SGIA 4DXGA 5C4XB 4LFBL 1I3QH 4LUVA 3FKIH 1RCVD 5GADC 4P73A 4HJ9A 3CW2C 5BR8L 4KJOA 1LTLA 5C3EH 2K03A 3S2DH 3VA5A 2E2HB 4JV5Q 4HN7A 3FHWA 1EY7A 4IFDG 2B2TA 4R9WA 3X3NA 4FXGC 1O78A 1CKMA 1FD7D 4B08A 1LV9A 2PW7A 5ELDA 4GLAC 1MSHA 1CSPA 3C1FA 3BDCA 3NENA 1EU4A 2CWPA 4DV3Q 2Q2IA 1OO9B 1CQFA 4XQNA 3GD7A 1PH7A 1HA6A 5EJWA 1JOKA 1O80A 3SEBA 1L1OA 4AQYQ 1WTPA 4KKTA 3M7GA 3J80c 2N3SA 3KOJA 3K7AH 4YWMA 1SMYC 3OPOA 5M9OA 2CCZA 3RD4A 3I8ZA 5FOBB 4IALA 3S15B 2A8VA 5IP7H 1PFSA 1L0YB 1KQSA 4JK1C 1E0BA 1AP0A 2YU9H 1HNWQ 1ZXTA 1E1TA 3BG3A 5CV7A 3EN2A 1PTOC 5FJ8G 4LNQA 2EYPA 2WKDA 4RG1A 2R93H 4WJWA 1XMQQ 1F2YA 3BZDB 4A3GB 1TS2A 4K6DA 1R4QB 3FEWX 1TWGH 4XIGS 5EKKA 1K3RA 4O0AA 4JI3L 5KNBA 3I4NH 2EVBA 1J9OA 4RFBA 3U58A 1JB7A 2FHTA 4MN3A 3RNUA 1N36Q 2IPKD 2NTTA 4H13C 4IUQA 1GO3E 5EBDA 2F0NA 4C3HH 4IFDJ 2N55A 2PZWA 4KV6A 2VUMH 2A6ED 3A54A 4DV6Q 3I7FA 4A93B 2L9HA 4A3FH 1A63A 3TREA 3F2UA 1UAPA 3CC2A 3I3CA 4J6HA 4TVAB 3T16A 5KYLA 4GOPB 5JJKA 1EWIA 4LF5Q 5I6YA 4DUYQ 3HOZG 2RQXA 4YCWA 2HCCA 4JI1Q 3CCSA 4DNRB 1KD1C 2A19A 3AB9A 2PNRC 1WTQA 2FJ2A 3VYSA 5FK9C 2OF1A 4CHTB 2YTYA 3EFXD 5A2QE 1TWHH 4DR5Q 3NK9A 3OSOA 4J1MA 2UUBL 4G57A 3D4DA 5GQOA 2EIFA 1GUOA 5D3DA 1PHJA 2Z6KA 1CKOA 4MNOA 3M85A 2JA8G 3K5NA 1BCPF 4A3BH 5IGEA 3VR6A 4A3EH 3MXNB 3OWEB 4QQBX 4OELB 3GTQB 1X32A 3TS0A 1Q1BA 1JR0D 3ULPA 1PYWD 3S1RB 3J81c 2MO0A 1NMFA 1A8VA 3WOEA 4IFDI 3QJYA 3J7A5 1ENAA 1LT3D 1Q12A 2IL8A 1X3GA 5M3FG 4GKKL 1W6JA 3UDFA 2TSSA 3GDEA 1CA5A 3N52A 5L37A 2F0OA 2XRQD 1WOCA 2Q2HA 4L8JA 4CGYB 2X6GA 4NP5A 5CGKA 4K5WA 5FO7B 1W6KA 4OWTB 2EOTA 2F0DA 4IOCA 3R93A 4CJ2C 1MGSA 4DV3L 1DJRD 1PYBA 2L55A 3H3VH 1VQHA 4LF7L 1ICWA 3HOXG 3K0XA 4DF7A 2I5HA 3K80C 3NELA 3NHHA 5M5XH 3MXNA 5ELFA 2K5DA 5ELBA 3BZKA 1LM0A 3PIO3 1I6VC 4DR3L 1LTBD 4HJ5A 2NZ1D 5LMUL 4FF3A 1BBXC 4JBMA 5CV4A 3H3VI 1H9KA 1E2VA 4KN4C 4QCLA 4DV6L 4QF4A 2HQLA 2VQEQ 1YVCA 1EQQA 1X9NA 5ELOA 2BA1A 5LL6S 2F4VQ 1OXTA 1Q81C 2R6GA 2JA5G 2VXWA 4Y7NB 2VB3X 2JP1A 3GTQH 3NP8A 5C5LA 4KHPL 1P16A 5IGGA 2AWOA 2QDLA 1TWGB 3D8GA 1U5KA 1RTOA 3KLSA 2OQ0A 1KNEA 2D0OA 3VR3A 2UXCQ 4KHPQ 3I56A 2MP1A 2MO1A 2PW5A 2XRSD 1K8AC 4HIKA 4KTAA 3GTLB 2K52A 3GQBA 1B3AA 1J8IA 4IUNA 5K36H 4JOIA 3HOWG 1X6OA 2R7DA 4U673 1XMOQ 4L63B 3V2TA 1QNUA 1TU2B 2IJ0A 1BCPC 2UU9L 4FNFA 2NN6H 4PG3A 1JE5A 3D0FA 1X56A 2JXMB 4IPCA 4JV5L 3PV0A 2JSOA 2UUAL 5JOBA 3GTPH 2JYOA 2GA4B 2ALYB 4FVMA 4DR1Q 2PZUA 1VQDA 1SYBA 2D5DA 1NR2A 3QIAA 4GKKQ 1OXXK 3DWPA 4QJFA 4N9TA 4Y52H 1PYSB 4GN3B 3FKIG 3CQZH 4GOPC 4TRDA 1PH4A 2K5VA 2Q8RE 3H0GH 4QIWE 2WACA 5M3MG 1I3QB 3UI2A 1HR0Q 1KNAA 1S3OA 3TP6A 2JE6I 1EWCA 2KCMA 1A6XA 3L0OA 3F2BA 3IFDA 2F03A 3RZOB 1VQ6A 2K33A 4FF2A 4DNIA 1N32Q 2UXBQ 4F7XA 4A3KB 1C4QA 1LYLA 5IIFA 3VR5A 4KI0A 4OHJA 2OTJA 4A3LG 1JICA 3VYUA 2Q8TA 2EZVA 1SDFA 3KDFB 1TWFB 2A73B 4PNYA 3HKSA 4CDDC 1FL0A 4X3TA 1U4PA 2KBNA 1J6QA 2HUGA 4ID6A 3CPFA 1K3BC 2VS1A 2ENBA 4QB4A 5IYCH 1KAAA 2ES2A 1I4QA 1VQGA 3KBXA 4MTKA 4KD3A 2NN6I 4DK3C 1STGA 1D5MC 4OO1G 2ZXRA 1IBLQ 1LT5D 1GM5A 1V43A 5IOCA 1EIHA 3E6ZX 2PYKA 2LSSA 2A69D 5DNFA 2BE5C 4EQPA 2UXCL 5C4XH 3QOLA 1PZID 4JYAQ 4NB3A 4GKJQ 4DAMA 1VQ8A 2F3WA 4DUZQ 3K81C 4DR6Q 1YNNC 1U4RA 3H94A 1HQMC 2PPBC 2QCPX 1QILA 2R61A 1PTOH 2NTSA 2CHBD 1OXUA 4H44C 4FXKC 2AWNA 2F0SA 4OEMB 4WORA 4DK0A 4P2CB 4AH6A 2J4XA 5KEEA 3PIP3 4KD4A 3S17B 1DCZA 2NVYH 4BA2I 4XQJA 4HJ8A 3GTLH 5IT9c 3A74A 3GTKH 4V190 2O5JC 2F0FA 2K1BA 4YHHQ 2KHJA 3NTKA 2IX0A 3CCRA 4WRDA 2RKSA 3J7ZC 4IO9A 1B7YB 5IGDA 3T1YL 4K5VA 4LF8Q 4LF6L 2RHSB 4DV5L 4BY7B 2ASBA 1YEZA 2RVLA 1LLRD 2RDFA 4DAVA 3NWTA 3L3OC 4RCNA 1D2BA 1N33L 4LF6Q 1X54A 5HGTA 3W2DA 5EKLA 5KRUA 2PMZE 3HKZE 1UNSA 3SK5A 3H09A 1KDAA 2EDGA 2AKWB 2CVRA 1GUGA 5BR8Q 5DM73 3EVQA 1LTTD 4UDUC 2F52A 1KLGD 2EXZA 1Q46A 4IUUA 1AFPA 2AHOB 4DV4L 3SHLA 5C0XH 1BF4A 5T1GA 5LMUQ 3PO2H 2F0UA 3OTOL 4ZLTF 5CV6A 1H9JA 3QO2A 2D0PA 4RWSC 3X3MA 1E3PA 3TP8A 4L5RC 3RZOH 1G291 4V0BA 2WIIB 4IUVA 1B1ZA 4U68A 4X3UA 1VQ7A 4XT3B 4HJAA 3K5MA 4JI7L 2LKVA 5KNCA 2EYHA 3P20A 1EYDA 4XQQA 4R8IA 1Q8IA 1O7LA 4C56C 1E22A 4KJNA 1QWYA 2A6HC 1K28A 4C3JB 5C0XI 1HZ9A 5EPKA 5E4WC 3B6YA 3J80E 3HOZB 2VUMB 4A3BG 3GP7A 4JI6Q 3DM3A 4R4CA 2X6LA 4LUZA 4C3HB 2R93G 1I94Q 3WWVA 1D1IA 3RMHA 3MHBA 2Q2UA 4IPHA 4MZ9A 3NXWA 1QZHA 1EY4A 2F0JA 3QR8A 3W1BA 5JVH3 4BXXG 2DUDA 4F87A 3CC4A 3MZ5A 4B3ML 2PCFB 2R7FA 3KF6A 2F0GA 1BBUA 5NUCA 2MPMA 1WVLA 1PFMA 4C3JH 1D8LA 2YV5A 4GNXB 1BQQT 3M9BA 5ELEA 5LHY1 2BDOA 1LACA 3RR5A 1VQMA 4Z9CB 3GTKB 3HOYH 4QY7A 1ILQA 1SNPA 4DR1L 3HOVG 4JI0Q 1HZBA 1M4VA 3STBC 1A2UA 2WAQE 3KJPA 4EQ5A 3FPPA 4LF8L 1PH2A 5JJLA 4A3KH 2UUBQ 2CW0C 2J7ZA 1HA5A 2FMCA 2B2YA 3L2PA 5FJ8H 1BUVT 3PUXA 4DUYL 1SNCA 3J80i 1S40A 2N78A 4A76A 4N9PA 1EFWA 3Q24A 4K2LA 1EQRA 3KK7A 2NN6G 3D6CA 2B2UC 1RL2A 2MQHA 2UUCQ 4JG2A 4MHEA 4YWLA 1X3PA 3T56B 1EEFD 1XX8A 2HIXA 2E5LQ 1TWAB 3ND8A 1VQAA 3NUCA 1EY9A 4HMIA 5GAEC 1B50A 2CQOA 1YJWA 2B3GA 1PMRA 4R4IA 5C44G 1WTXA 1JE4A 5H1SE 3RUZA 2R92H 4PQXA 3AQQA 1XXGA 1IBMQ 3CXCA 2EXDA 2AMCB 2WKCA 3T1HQ 4F88A 1I6HH 3MEHA 1D5ZC 4A3DB 5JEAG 4LF9L 2LY7A 1WI5A 1EYCA 1UWVA 2JEBI 3VYTA 5AJ3L 3RLOA 3NQIA 1J5EL 2EYMA 4K6LA 4HCSA 2I0QA 5CBEE 3SR1A 4C3IG 1I6HB 1HNZL 3KF8A 4K5XA 4A3MG 2MUYA 5IWAQ 4X65L 1HUMA 2F0VA 2KCNA 3D4RA 3R2TA 4BBRH 4HMJA 5AJ3Q 1LO5D 2ZM6L 1B4OA 2WAQB 2E5LL 4OONA 2DGYA 2EY6A 5HGQA 4CJ1B 3H0GB 2MJ8A 2QW7A 1Z9FA 2J0TD 2HQEA 1IZ6A 2KHSA 4KY6A 1GUTA 4GNXA 2A6EC 1G6PA 3GTMB 4KHZA 3KFUA 3S24A 2CWAA 4LUOA 1Y14B 3KLSX 2I46A 2NBFA 3EQLC 5LMNQ 1X55A 4GKJL 1MBYA 4DAYB 5GAGC 2FINB 2VQFL 2ZXOA 4HCEA 4K8JA 3L7ZC 1TWHB 5BN5A 5D65A 5JJZA 1EYGA 2JA6G 3E9HA 1YBYA 4HEDA 1R4PB 3TZDA 3K0YA 2PQAA 4R1JA 1EY8A 4DV7Q 5G3LD 5IYBG 2EYOA 1QOHA 2XWBB 4ILWA 2ATWA 3HOYB 3QG1A 2K05A 2O2LD 4DR4L 2HT1A 3UE0A 3V05A 4EX5A 4JI0L 1SN8A 2R92B 1EQTA 1Y8PB 4H7BA 3S14B 3GTJB 4B3TQ 5CBAE 2ZJPA 2E2DC 3VDYA 1IBKQ 1C48A 1HH2P 3DMUA 3GO5A 2F0LA 2LFNA 2L0CA 1BR9A 4DGZA 4UY8C 3OW7A 4JBJA 5FLXc 3C3LA 3MC0B 1DOLA 3FP9A
chains in the Genus database with same CATH topology
2R7DA 3IRBA 1YHBA 2B29A 5FLMG 1XMOQ 3CMEA 2OTLA 1PH1A 2BH8A 5IWAL 3S1NH 2UU9L 3EBEA 4B3RL 4DV0L 2VUMG 5M5YH 1CUKA 2OCEA 2NVQH 1B70B 1AE2A 4RMFA 3TRZA 4K0KL 1XPRA 4PG3A 1JE5A 1GKHA 1WFQA 2KCTA 3D0FA 4JOIC 4GNXC 1J5EQ 1X56A 1KIXA 3HOYG 2MFIA 5M3MH 4IPCA 4DPGA 3PV0A 4JV5L 2UUAL 3GTPH 1RIPA 3PCOB 2ALYB 3K7UC 2WB1E 4GLVB 4OWXB 1YNXA 4DR1Q 2FXQA 4JI6L 1QVFA 2VQEL 2HIVA 1VQDA 4R4OA 3PUZA 2IT1A 1JJCB 3E0EA 4GKKQ 1OXXK 5IYDG 1K83H 1IYJB 3KDFA 5C0XJ 4DV1L 2QGQA 3M4QA 4LFAQ 4DV5Q 1KL9A 3PO2G 3S1QH 4QJFA 3PO3G 4LW1A 1KC8C 1IBML 4P74A 5IE8A 1N36L 4Y52H 3CCLA 1PYSB 4GN3B 3FKIG 1YHQA 3CQZH 4GOPC 2NZHA 1MIUA 1NBWA 1PH4A 2K5VA 1OXSC 1FGUA 1CKNB 3H0GH 2RCNA 2VQFQ 2JJQA 5C3EG 1O7IA 1N33Q 4QL5A 4QIWE 5M3MG 1HR0Q 1KRSA 1S3OA 2UXBL 2OQKA 1JJ2A 1QUQB 1WCMH 3BJUA 4X66L 4O2DA 2JE6I 2UUAQ 2KCMA 4L5QA 5JJIA 4ALPA 4B3SL 1BKBA 3L0OA 2A1AA 4UP9A 3F2BA 3S1MH 1PVOA 3CAMA 4A75A 1SLJA 4DR7Q 1SROA 3U50C 1W2BA 3OYYA 1E7ZA 2K75A 1VQJA 5IYCG 3A0JA 3ULLA 3ER0A 3PGZA 2GVAA 4Y7NH 1VQ6A 4DNIA 1N32Q 3BU2A 2UXBQ 4JI2Q 1LYLA 4DR2L 2HHHL 3DLLA 4KI0A 4FDBA 2OTJA 4C2MH 2WP8J 5M3FH 3CPWA 1TXYA 1VQOA 2JA5H 4A3LG 1V9PA 3CMAA 3RZDH 4H02A 1NMGA 3I4MG 4LFCQ 3KDFB 3KLWA 4YHHL 1IBLL 3HKSA 3G71A 1LUZA 2EQSA 3AEVA 5IP7G 4PMWA 1FL0A 2KBNA 1J6QA 1YI2A 1L1OC 3MEFA 3CPFA 4NPSA 3ICEA 4LF7Q 2MNAA 1YIJA 1HR0W 2E2JH 1N8RC 2VS1A 4A3IH 4GN4B 4L5TA 1XTDA 4JBKA 3JAMi 2B63G 5IYCH 3TQYA 1Q7YC 1XNRQ 5JEAJ 4DUZL 3ERSX 2ES2A 4LFBQ 1VQGA 4A93G 2NN6I 2PNHA 2K5HA 4OO1I 1QUQA 4DK3C 2UUCL 4OO1G 3AYHB 1IBLQ 4BY1G 1GM5A 1V43A 3I4MH 2K14A 3HOVH 1Q1EA 4YY3Q 1GVPA 2LSSA 4AIMA 2UXCL 4JI4L 5K36G 5C4XH 2I5MX 1EUJA 1UEBA 3NBHB 4GS3A 4JYAQ 5LMNL 4NB3A 4GKJQ 1HR0L 4DAMA 1VQ8A 1PH3A 3UDGA 2PI2A 1K9MC 1Y1VH 4DUZQ 2WAQG 3K81C 2XTIA 3CF5A 4DR6Q 2JA7G 1CSQA 3U4VA 1NTGA 3PF5A 1YZ6A 5C44H 1OXUA 4BY7G 1VS0A 2AWNA 4POFA 2VW9A 3S1RH 4LF9Q 4AH6A 4DR5L 4DR6L 3BZCA 4IJHA 4BXXH 3TS2A 4HJ7A 4IPGA 1BVSA 2E8GA 2L15A 2HHHQ 4LF4L 2E2HH 2NVYH 4J15A 1C7YA 4BA2I 4LWCA 4HJ8A 1N32L 3GTLH 1M90C 3GTOH 1H95A 1WYDA 3A74A 5IT9c 3GTKH 4A3CG 3LGJA 2PI2E 4X65Q 2JA7H 1PH6A 1M1KC 1P8LA 4YHHQ 4DR3Q 2KHJA 3AFPA 3RLFA 4NXNL 2F3IA 2IX0A 4JI1L 5IY0A 3J7ZC 3CCRA 4IO9A 1Y1WH 1NJIC 4B3MQ 4BY7H 1B7YB 4MTNA 1SR3A 1T9HA 3H0GG 5IP9H 3Q8DA 3TEHB 2RHSB 3GTJH 4DV5L 3T1YL 4LF8Q 4LF6L 4DV2L 1YEZA 5EAYA 2ASBA 4LF4Q 3I55A 1WJJA 4X66Q 2N49A 3AFQA 1XNRL 3E9IA 1W3SA 2R92G 2R7ZH 2BA0A 3D31A 4DK6C 3W5OA 1XMQL 1PA6A 4AYBE 4A3JH 4UPAA 1I5FA 1K8GA 1KAWA 1YITA 3F2CA 1TWFH 2K5NA 1N33L 4JCVE 5GAHC 4LF6Q 4DV4Q 1X54A 2JK8A 3ZJYC 1Q86C 2PMZE 1SRUA 3HKZE 4P71A 3M3YH 1VQLA 2K50A 3PUWA 3RN5A 1XJVA 3J81j 1Y1WG 1AE3A 2AKWB 2QA4A 3F8TA 4P72A 2IHFA 1DGSA 5BR8Q 1A0IA 4X62L 4A3DH 3HOUG 4LFBL 3HKZG 4C3IH 2F52A 4A3LH 3K8AA 1MKHA 3HFZB 1L1OB 3PIPA 1Q8KA 1VCIA 2R7ZG 1Q46A 2VY3A 1FJGQ 2IY5B 2AHOB 5M5WH 4DV4L 3HOZH 1G51A 5LMUQ 2V1CC 1GD7A 3KYHC 4WJ4A 1UE6A 2LXKA 1VQNA 3OTOL 4LF5L 3PO2H 3PO3H 2D0PA 3SGIA 1KHIA 4B3RQ 1E3PA 1I3QH 1U0LA 4LUVA 3FKIH 4DV7L 4L5RC 1I50H 1G291 3ULJA 1SFOH 5GADC 4P73A 4HJ9A 2B63H 3CW2C 5BR8L 1N34L 1L0WA 1IL2A 1VQ7A 1LTLA 5C3EH 3S2DH 4KLKA 4HJAA 4JV5Q 3UDXA 3I2ZA 4JI7L 3FHWA 4OWWB 4YY3L 4IFDG 4A3GH 1K0RA 4JI4Q 1I94L 5C4JH 2JQOA 4P75A 1CKMA 1QZGA 1YJ9A 1E22A 2UU9Q 2JEAI 3M4PA 5C4XG 1YJNA 1MJCA 2LXJA 3UDIA 3CCUA 5C0XI 1HZ9A 4GLAC 4PZ8A 4IPDA 1CSPA 3B6YA 1ASZA 1N34Q 2ZTDA 1OTCA 3NENA 4A3BG 2CWPA 5HY6A 4A3EG 3W1GA 3S17H 4DV3Q 2Q2IA 3KF8B 4JI6Q 2CKZB 3GD7A 3DM3A 4R4CA 1D7QA 1PH7A 4LUZA 2R93G 3G4SA 1I94Q 1L1OA 1QVCA 4AQYQ 3WWVA 2QEXA 4A3GG 1FJGL 1KXLA 4OX9L 4ME3A 4IJLA 3J80c 4JI5Q 2N3SA 2RF4A 3KOJA 3K7AH 4YWMA 2Q2UA 2CCZA 4IPHA 4MZ9A 1QZHA 4BBSH 1XMOL 4BXXG 3W1BA 2A8VA 1VQPA 2DUDA 5IP7H 1PFSA 3CC4A 1KQSA 4GOPA 4A3KG 5E7NA 2Q2TA 4B3ML 2YU9H 2R7FA 1HNWQ 3KF6A 5FLMH 1BBUA 2NVXH 1E1TA 1B8AA 1IXRA 4C3JH 1D8LA 4OX9Q 2YV5A 2YTXA 3EN2A 4GNXB 5FJ8G 4LNQA 4RG1A 1VQKA 3M9BA 3PF4A 1IBKL 3RR5A 2R93H 1HJPA 1YHAA 1VQMA 1XMQQ 2IHEA 4HIMA 3HOYH 3S16H 1UE1A 1L2FA 4QY7A 4XIGS 1TWGH 4BA1I 4DR1L 3G6EA 5GROA 3HOVG 4A3FG 4JI0Q 1HZBA 1K3RA 4O0AA 4JI3L 3STBC 3I4NH 4BBSG 2WAQE 3KJPA 4EQ5A 3U58A 4LF8L 1OXVA 2GN5A 1PH2A 1JB7A 5IYDH 4L5SA 1Z47A 3RNUA 4A3KH 2UUBQ 5JJLA 1EIYB 1VQ5A 2Z0SA 3CD6A 1N36Q 3CCEA 4JI7Q 4JBWA 3L2PA 2YTVA 1GO3E 5FJ8H 4LFCL 3PUXA 2RHQB 4DUYL 3HOWH 3NEMA 4C3HH 1HNWL 1MJEA 4DV1Q 3J80i 4GLXA 4X62Q 1S40A 4IFDJ 1VQ4A 2N78A 4A76A 2F4VL 1EFWA 5DLQE 4UP8A 3PUVA 2ID0A 1EQRA 2VUMH 3OW2A 4DV6Q 2NN6G 3I7FA 2ZJQA 1A63A 3EIVA 4A3FH 3TREA 3CC2A 1PV4A 1XNQL 5LMNW 4TVAB 5JJKA 2E2IH 2NVTH 4GOPB 1RL2A 2MQHA 1EWIA 4LF5Q 3JC66 4JG2A 4DUYQ 2UUCQ 4BY1H 3HOZG 4YCWA 4X6AH 3CCSA 4JI1Q 3PSIA 4YWLA 4B3TL 1KD1C 2JA8H 2A19A 1XPUA 2C35B 4UP7A 2HIXA 2E5LQ 1VQCA 1VQFA 2YYZA 1JT8A 1VQAA 1Y1VG 4DR2Q 1E24A 5GAEC 2CQOA 2YTYA 1YJWA 4JYAL 3A5ZB 2B3GA 1TWHH 2N8NA 4R4IA 3U4ZA 5C44G 2JA9A 4DR5Q 4A3MH 2UXDQ 5H1SE 1TWCH 4X64Q 2R92H 1S72A 1HNZQ 2VNUD 1UE7A 2UUBL 4PZ6A 1TWAH 3AQQA 5GQOA 2EIFA 1C9OA 1SE8A 1IBMQ 3CXCA 1JMCA 4BBRG 2EXDA 4B3SQ 2AMCB 4R4TA 2WFWA 2Z6KA 1PHJA 1CKOA 4NXML 1XNQQ 1V1QA 4MNOA 4YCVA 3T1HQ 4R4QA 3M85A 1WCMG 2JA8G 1I6HH 2Z6KC 3F2DA 2ZM6Q 4A3BH 4A3IG 4JI3Q 3JAMc 4A3EH 5JEAG 4LF9L 1WI5A 2JEBI 1UWVA 2Y0SE 3MXNB 5ELNA 4QQBX 3T1YQ 1PH5A 5AJ3L 3I4OA 1AH9A 4A3CH 3RLOA 3CCMA 3TS0A 1Q1BA 1X3EA 1J5EL 2D62A 2I0QA 4A93H 4A3DG 3ULPA 2IX1A 1HNZL 1X65A 3J81c 2MO0A 4A3MG 1NMFA 4TQUS 1A8VA 5IWAQ 3F1ZA 4IFDI 4X65L 4DV2Q 3J7A5 3M7NA 1NY4A 1Q12A 1X3GA 5M3FG 2PQAB 4BBRH 3HOXH 2GVBA 4GKKL 3UDFA 5AJ3Q 2ZM6L 3GDEA 3PUYA 2JA6H 1VQ9A 1UE5A 1FVIA 2E5LL 2XGTA 2Y0SG 4OONA 2DGYA 4JI8L 4HIOA 4A3JG 3UE1A 1WOCA 2Q2HA 2VL6A 2WB1G 2VZAA 4YWKA 5HGQA 3T1HL 1PH9A 4XTCS 2BH2A 4WJ3M 2K4KA 3G48A 1NE3A 1CKNA 3KF6B 4LFAL 1Z9FA 4OWTB 2UXDL 1IZ6A 4HIDA 3GTGH 4X64L 1HZAA 4IOCA 4GNXA 1E1OA 3CP0A 3PIOA 1JJGA 1G6PA 4KHZA 3KFUA 3S24A 4JI8Q 2CWAA 1PYBA 1Y14B 4LUOA 4DV3L 3S2HH 2OWOA 3H15A 2KENA 1HZCA 3H3VH 1VQHA 3HOUH 3I4NG 3M4OH 4LF7L 3HOXG 3K0XA 3A5UA 1X55A 5LMNQ 4GKJL 2I5HA 3K80C 4JC0A 4DAYB 1VQIA 5GAGC 2ZTCA 2VQFL 4DR4Q 1X3FA 3NELA 5M5XH 2I5LX 4JI5L 1Q82C 4DR7L 3BZKA 1LM0A 5C0XG 3L7ZC 4DR3L 2CFMA 1XPOA 3CC7A 4HJ5A 4AQYL 1HNXQ 3CCVA 5LMUL 3S14H 4JBMA 1EYGA 1R9TH 1VQBA 5IP9G 4QGUA 1KRTA 2JA6G 3E9HA 2ZJRA 1YBYA 4DV6L 3H3VI 2H5XA 2HQLA 2VQEQ 4AYBG 1YVCA 4NXMQ 1K73C 1EQQA 2PQAA 2NZOA 4R1JA 5ELOA 1X9NA 4DV7Q 2BA1A 5IYBG 2F4VQ 1OXTA 4PZ7A 1Q81C 2R6GA 2JA5G 4POGA 1BBWA 3GTQH 3STBD 2ZTEA 1HNXL 4YCUA 2ATWA 4KHPL 1QVGA 4A4IA 1P16A 4OXPA 2AWOA 2KHIA 3RLNA 4DR4L 2HT1A 3UE0A 3RZOH 3J81i 1A62A 4EX5A 1U5KA 1EIFA 4JI0L 1SN8A 4IOAA 2OQ0A 1VQEA 4APVA 1SMXA 2D0OA 1ASYA 4B3TQ 1C0AA 3CCQA 2UXCQ 2ZJPA 4KHPQ 5J3BA 3VDYA 3I56A 5IYBH 1IBKQ 2MO1A 3OTOQ 3S15H 3KJOA 1HH2P 1K8AC 4HIKA 3GO5A 4NXNQ 4GN5A 1EOVA 4DV0Q 2K52A 4UY8C 4K0KQ 4JBJA 1N9WA 4DKAC 4JOIA 5FLXc 3GTMH 3CCJA 3FP9A 3HOWG 4JI2L 1PH8A 3RN2A 1X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7D A;  3IRB A;  1YHB A;  2B29 A;  5FLM G;  1XMO Q;  3CME A;  2OTL A;  1PH1 A;  2BH8 A;  5IWA L;  3S1N H;  2UU9 L;  3EBE A;  4B3R L;  4DV0 L;  2VUM G;  5M5Y H;  1CUK A;  2OCE A;  2NVQ H;  1B70 B;  1AE2 A;  4RMF A;  3TRZ A;  4K0K L;  1XPR A;  4PG3 A;  1JE5 A;  1GKH A;  1WFQ A;  2KCT A;  3D0F A;  4JOI C;  4GNX C;  1J5E Q;  1X56 A;  1KIX A;  3HOY G;  2MFI A;  5M3M H;  4IPC A;  4DPG A;  3PV0 A;  4JV5 L;  2UUA L;  3GTP H;  1RIP A;  3PCO B;  2ALY B;  3K7U C;  2WB1 E;  4GLV B;  4OWX B;  1YNX A;  4DR1 Q;  2FXQ A;  4JI6 L;  1QVF A;  2VQE L;  2HIV A;  1VQD A;  4R4O A;  3PUZ A;  2IT1 A;  1JJC B;  3E0E A;  4GKK Q;  1OXX K;  5IYD G;  1K83 H;  1IYJ B;  3KDF A;  5C0X J;  4DV1 L;  2QGQ A;  3M4Q A;  4LFA Q;  4DV5 Q;  1KL9 A;  3PO2 G;  3S1Q H;  4QJF A;  3PO3 G;  4LW1 A;  1KC8 C;  1IBM L;  4P74 A;  5IE8 A;  1N36 L;  4Y52 H;  3CCL A;  1PYS B;  4GN3 B;  3FKI G;  1YHQ A;  3CQZ H;  4GOP C;  2NZH A;  1MIU A;  1NBW A;  1PH4 A;  2K5V A;  1OXS C;  1FGU A;  1CKN B;  3H0G H;  2RCN A;  2VQF Q;  2JJQ A;  5C3E G;  1O7I A;  1N33 Q;  4QL5 A;  4QIW E;  5M3M G;  1HR0 Q;  1KRS A;  1S3O A;  2UXB L;  2OQK A;  1JJ2 A;  1QUQ B;  1WCM H;  3BJU A;  4X66 L;  4O2D A;  2JE6 I;  2UUA Q;  2KCM A;  4L5Q A;  5JJI A;  4ALP A;  4B3S L;  1BKB A;  3L0O A;  2A1A A;  4UP9 A;  3F2B A;  3S1M H;  1PVO A;  3CAM A;  4A75 A;  1SLJ A;  4DR7 Q;  1SRO A;  3U50 C;  1W2B A;  3OYY A;  1E7Z A;  2K75 A;  1VQJ A;  5IYC G;  3A0J A;  3ULL A;  3ER0 A;  3PGZ A;  2GVA A;  4Y7N H;  1VQ6 A;  4DNI A;  1N32 Q;  3BU2 A;  2UXB Q;  4JI2 Q;  1LYL A;  4DR2 L;  2HHH L;  3DLL A;  4KI0 A;  4FDB A;  2OTJ A;  4C2M H;  2WP8 J;  5M3F H;  3CPW A;  1TXY A;  1VQO A;  2JA5 H;  4A3L G;  1V9P A;  3CMA A;  3RZD H;  4H02 A;  1NMG A;  3I4M G;  4LFC Q;  3KDF B;  3KLW A;  4YHH L;  1IBL L;  3HKS A;  3G71 A;  1LUZ A;  2EQS A;  3AEV A;  5IP7 G;  4PMW A;  1FL0 A;  2KBN A;  1J6Q A;  1YI2 A;  1L1O C;  3MEF A;  3CPF A;  4NPS A;  3ICE A;  4LF7 Q;  2MNA A;  1YIJ A;  1HR0 W;  2E2J H;  1N8R C;  2VS1 A;  4A3I H;  4GN4 B;  4L5T A;  1XTD A;  4JBK A;  3JAM i;  2B63 G;  5IYC H;  3TQY A;  1Q7Y C;  1XNR Q;  5JEA J;  4DUZ L;  3ERS X;  2ES2 A;  4LFB Q;  1VQG A;  4A93 G;  2NN6 I;  2PNH A;  2K5H A;  4OO1 I;  1QUQ A;  4DK3 C;  2UUC L;  4OO1 G;  3AYH B;  1IBL Q;  4BY1 G;  1GM5 A;  1V43 A;  3I4M H;  2K14 A;  3HOV H;  1Q1E A;  4YY3 Q;  1GVP A;  2LSS A;  4AIM A;  2UXC L;  4JI4 L;  5K36 G;  5C4X H;  2I5M X;  1EUJ A;  1UEB A;  3NBH B;  4GS3 A;  4JYA Q;  5LMN L;  4NB3 A;  4GKJ Q;  1HR0 L;  4DAM A;  1VQ8 A;  1PH3 A;  3UDG A;  2PI2 A;  1K9M C;  1Y1V H;  4DUZ Q;  2WAQ G;  3K81 C;  2XTI A;  3CF5 A;  4DR6 Q;  2JA7 G;  1CSQ A;  3U4V A;  1NTG A;  3PF5 A;  1YZ6 A;  5C44 H;  1OXU A;  4BY7 G;  1VS0 A;  2AWN A;  4POF A;  2VW9 A;  3S1R H;  4LF9 Q;  4AH6 A;  4DR5 L;  4DR6 L;  3BZC A;  4IJH A;  4BXX H;  3TS2 A;  4HJ7 A;  4IPG A;  1BVS A;  2E8G A;  2L15 A;  2HHH Q;  4LF4 L;  2E2H H;  2NVY H;  4J15 A;  1C7Y A;  4BA2 I;  4LWC A;  4HJ8 A;  1N32 L;  3GTL H;  1M90 C;  3GTO H;  1H95 A;  1WYD A;  3A74 A;  5IT9 c;  3GTK H;  4A3C G;  3LGJ A;  2PI2 E;  4X65 Q;  2JA7 H;  1PH6 A;  1M1K C;  1P8L A;  4YHH Q;  4DR3 Q;  2KHJ A;  3AFP A;  3RLF A;  4NXN L;  2F3I A;  2IX0 A;  4JI1 L;  5IY0 A;  3J7Z C;  3CCR A;  4IO9 A;  1Y1W H;  1NJI C;  4B3M Q;  4BY7 H;  1B7Y B;  4MTN A;  1SR3 A;  1T9H A;  3H0G G;  5IP9 H;  3Q8D A;  3TEH B;  2RHS B;  3GTJ H;  4DV5 L;  3T1Y L;  4LF8 Q;  4LF6 L;  4DV2 L;  1YEZ A;  5EAY A;  2ASB A;  4LF4 Q;  3I55 A;  1WJJ A;  4X66 Q;  2N49 A;  3AFQ A;  1XNR L;  3E9I A;  1W3S A;  2R92 G;  2R7Z H;  2BA0 A;  3D31 A;  4DK6 C;  3W5O A;  1XMQ L;  1PA6 A;  4AYB E;  4A3J H;  4UPA A;  1I5F A;  1K8G A;  1KAW A;  1YIT A;  3F2C A;  1TWF H;  2K5N A;  1N33 L;  4JCV E;  5GAH C;  4LF6 Q;  4DV4 Q;  1X54 A;  2JK8 A;  3ZJY C;  1Q86 C;  2PMZ E;  1SRU A;  3HKZ E;  4P71 A;  3M3Y H;  1VQL A;  2K50 A;  3PUW A;  3RN5 A;  1XJV A;  3J81 j;  1Y1W G;  1AE3 A;  2AKW B;  2QA4 A;  3F8T A;  4P72 A;  2IHF A;  1DGS A;  5BR8 Q;  1A0I A;  4X62 L;  4A3D H;  3HOU G;  4LFB L;  3HKZ G;  4C3I H;  2F52 A;  4A3L H;  3K8A A;  1MKH A;  3HFZ B;  1L1O B;  3PIP A;  1Q8K A;  1VCI A;  2R7Z G;  1Q46 A;  2VY3 A;  1FJG Q;  2IY5 B;  2AHO B;  5M5W H;  4DV4 L;  3HOZ H;  1G51 A;  5LMU Q;  2V1C C;  1GD7 A;  3KYH C;  4WJ4 A;  1UE6 A;  2LXK A;  1VQN A;  3OTO L;  4LF5 L;  3PO2 H;  3PO3 H;  2D0P A;  3SGI A;  1KHI A;  4B3R Q;  1E3P A;  1I3Q H;  1U0L A;  4LUV A;  3FKI H;  4DV7 L;  4L5R C;  1I50 H;  1G29 1;  3ULJ A;  1SFO H;  5GAD C;  4P73 A;  4HJ9 A;  2B63 H;  3CW2 C;  5BR8 L;  1N34 L;  1L0W A;  1IL2 A;  1VQ7 A;  1LTL A;  5C3E H;  3S2D H;  4KLK A;  4HJA A;  4JV5 Q;  3UDX A;  3I2Z A;  4JI7 L;  3FHW A;  4OWW B;  4YY3 L;  4IFD G;  4A3G H;  1K0R A;  4JI4 Q;  1I94 L;  5C4J H;  2JQO A;  4P75 A;  1CKM A;  1QZG A;  1YJ9 A;  1E22 A;  2UU9 Q;  2JEA I;  3M4P A;  5C4X G;  1YJN A;  1MJC A;  2LXJ A;  3UDI A;  3CCU A;  5C0X I;  1HZ9 A;  4GLA C;  4PZ8 A;  4IPD A;  1CSP A;  3B6Y A;  1ASZ A;  1N34 Q;  2ZTD A;  1OTC A;  3NEN A;  4A3B G;  2CWP A;  5HY6 A;  4A3E G;  3W1G A;  3S17 H;  4DV3 Q;  2Q2I A;  3KF8 B;  4JI6 Q;  2CKZ B;  3GD7 A;  3DM3 A;  4R4C A;  1D7Q A;  1PH7 A;  4LUZ A;  2R93 G;  3G4S A;  1I94 Q;  1L1O A;  1QVC A;  4AQY Q;  3WWV A;  2QEX A;  4A3G G;  1FJG L;  1KXL A;  4OX9 L;  4ME3 A;  4IJL A;  3J80 c;  4JI5 Q;  2N3S A;  2RF4 A;  3KOJ A;  3K7A H;  4YWM A;  2Q2U A;  2CCZ A;  4IPH A;  4MZ9 A;  1QZH A;  4BBS H;  1XMO L;  4BXX G;  3W1B A;  2A8V A;  1VQP A;  2DUD A;  5IP7 H;  1PFS A;  3CC4 A;  1KQS A;  4GOP A;  4A3K G;  5E7N A;  2Q2T A;  4B3M L;  2YU9 H;  2R7F A;  1HNW Q;  3KF6 A;  5FLM H;  1BBU A;  2NVX H;  1E1T A;  1B8A A;  1IXR A;  4C3J H;  1D8L A;  4OX9 Q;  2YV5 A;  2YTX A;  3EN2 A;  4GNX B;  5FJ8 G;  4LNQ A;  4RG1 A;  1VQK A;  3M9B A;  3PF4 A;  1IBK L;  3RR5 A;  2R93 H;  1HJP A;  1YHA A;  1VQM A;  1XMQ Q;  2IHE A;  4HIM A;  3HOY H;  3S16 H;  1UE1 A;  1L2F A;  4QY7 A;  4XIG S;  1TWG H;  4BA1 I;  4DR1 L;  3G6E A;  5GRO A;  3HOV G;  4A3F G;  4JI0 Q;  1HZB A;  1K3R A;  4O0A A;  4JI3 L;  3STB C;  3I4N H;  4BBS G;  2WAQ E;  3KJP A;  4EQ5 A;  3U58 A;  4LF8 L;  1OXV A;  2GN5 A;  1PH2 A;  1JB7 A;  5IYD H;  4L5S A;  1Z47 A;  3RNU A;  4A3K H;  2UUB Q;  5JJL A;  1EIY B;  1VQ5 A;  2Z0S A;  3CD6 A;  1N36 Q;  3CCE A;  4JI7 Q;  4JBW A;  3L2P A;  2YTV A;  1GO3 E;  5FJ8 H;  4LFC L;  3PUX A;  2RHQ B;  4DUY L;  3HOW H;  3NEM A;  4C3H H;  1HNW L;  1MJE A;  4DV1 Q;  3J80 i;  4GLX A;  4X62 Q;  1S40 A;  4IFD J;  1VQ4 A;  2N78 A;  4A76 A;  2F4V L;  1EFW A;  5DLQ E;  4UP8 A;  3PUV A;  2ID0 A;  1EQR A;  2VUM H;  3OW2 A;  4DV6 Q;  2NN6 G;  3I7F A;  2ZJQ A;  1A63 A;  3EIV A;  4A3F H;  3TRE A;  3CC2 A;  1PV4 A;  1XNQ L;  5LMN W;  4TVA B;  5JJK A;  2E2I H;  2NVT H;  4GOP B;  1RL2 A;  2MQH A;  1EWI A;  4LF5 Q;  3JC6 6;  4JG2 A;  4DUY Q;  2UUC Q;  4BY1 H;  3HOZ G;  4YCW A;  4X6A H;  3CCS A;  4JI1 Q;  3PSI A;  4YWL A;  4B3T L;  1KD1 C;  2JA8 H;  2A19 A;  1XPU A;  2C35 B;  4UP7 A;  2HIX A;  2E5L Q;  1VQC A;  1VQF A;  2YYZ A;  1JT8 A;  1VQA A;  1Y1V G;  4DR2 Q;  1E24 A;  5GAE C;  2CQO A;  2YTY A;  1YJW A;  4JYA L;  3A5Z B;  2B3G A;  1TWH H;  2N8N A;  4R4I A;  3U4Z A;  5C44 G;  2JA9 A;  4DR5 Q;  4A3M H;  2UXD Q;  5H1S E;  1TWC H;  4X64 Q;  2R92 H;  1S72 A;  1HNZ Q;  2VNU D;  1UE7 A;  2UUB L;  4PZ6 A;  1TWA H;  3AQQ A;  5GQO A;  2EIF A;  1C9O A;  1SE8 A;  1IBM Q;  3CXC A;  1JMC A;  4BBR G;  2EXD A;  4B3S Q;  2AMC B;  4R4T A;  2WFW A;  2Z6K A;  1PHJ A;  1CKO A;  4NXM L;  1XNQ Q;  1V1Q A;  4MNO A;  4YCV A;  3T1H Q;  4R4Q A;  3M85 A;  1WCM G;  2JA8 G;  1I6H H;  2Z6K C;  3F2D A;  2ZM6 Q;  4A3B H;  4A3I G;  4JI3 Q;  3JAM c;  4A3E H;  5JEA G;  4LF9 L;  1WI5 A;  2JEB I;  1UWV A;  2Y0S E;  3MXN B;  5ELN A;  4QQB X;  3T1Y Q;  1PH5 A;  5AJ3 L;  3I4O A;  1AH9 A;  4A3C H;  3RLO A;  3CCM A;  3TS0 A;  1Q1B A;  1X3E A;  1J5E L;  2D62 A;  2I0Q A;  4A93 H;  4A3D G;  3ULP A;  2IX1 A;  1HNZ L;  1X65 A;  3J81 c;  2MO0 A;  4A3M G;  1NMF A;  4TQU S;  1A8V A;  5IWA Q;  3F1Z A;  4IFD I;  4X65 L;  4DV2 Q;  3J7A 5;  3M7N A;  1NY4 A;  1Q12 A;  1X3G A;  5M3F G;  2PQA B;  4BBR H;  3HOX H;  2GVB A;  4GKK L;  3UDF A;  5AJ3 Q;  2ZM6 L;  3GDE A;  3PUY A;  2JA6 H;  1VQ9 A;  1UE5 A;  1FVI A;  2E5L L;  2XGT A;  2Y0S G;  4OON A;  2DGY A;  4JI8 L;  4HIO A;  4A3J G;  3UE1 A;  1WOC A;  2Q2H A;  2VL6 A;  2WB1 G;  2VZA A;  4YWK A;  5HGQ A;  3T1H L;  1PH9 A;  4XTC S;  2BH2 A;  4WJ3 M;  2K4K A;  3G48 A;  1NE3 A;  1CKN A;  3KF6 B;  4LFA L;  1Z9F A;  4OWT B;  2UXD L;  1IZ6 A;  4HID A;  3GTG H;  4X64 L;  1HZA A;  4IOC A;  4GNX A;  1E1O A;  3CP0 A;  3PIO A;  1JJG A;  1G6P A;  4KHZ A;  3KFU A;  3S24 A;  4JI8 Q;  2CWA A;  1PYB A;  1Y14 B;  4LUO A;  4DV3 L;  3S2H H;  2OWO A;  3H15 A;  2KEN A;  1HZC A;  3H3V H;  1VQH A;  3HOU H;  3I4N G;  3M4O H;  4LF7 L;  3HOX G;  3K0X A;  3A5U A;  1X55 A;  5LMN Q;  4GKJ L;  2I5H A;  3K80 C;  4JC0 A;  4DAY B;  1VQI A;  5GAG C;  2ZTC A;  2VQF L;  4DR4 Q;  1X3F A;  3NEL A;  5M5X H;  2I5L X;  4JI5 L;  1Q82 C;  4DR7 L;  3BZK A;  1LM0 A;  5C0X G;  3L7Z C;  4DR3 L;  2CFM A;  1XPO A;  3CC7 A;  4HJ5 A;  4AQY L;  1HNX Q;  3CCV A;  5LMU L;  3S14 H;  4JBM A;  1EYG A;  1R9T H;  1VQB A;  5IP9 G;  4QGU A;  1KRT A;  2JA6 G;  3E9H A;  2ZJR A;  1YBY A;  4DV6 L;  3H3V I;  2H5X A;  2HQL A;  2VQE Q;  4AYB G;  1YVC A;  4NXM Q;  1K73 C;  1EQQ A;  2PQA A;  2NZO A;  4R1J A;  5ELO A;  1X9N A;  4DV7 Q;  2BA1 A;  5IYB G;  2F4V Q;  1OXT A;  4PZ7 A;  1Q81 C;  2R6G A;  2JA5 G;  4POG A;  1BBW A;  3GTQ H;  3STB D;  2ZTE A;  1HNX L;  4YCU A;  2ATW A;  4KHP L;  1QVG A;  4A4I A;  1P16 A;  4OXP A;  2AWO A;  2KHI A;  3RLN A;  4DR4 L;  2HT1 A;  3UE0 A;  3RZO H;  3J81 i;  1A62 A;  4EX5 A;  1U5K A;  1EIF A;  4JI0 L;  1SN8 A;  4IOA A;  2OQ0 A;  1VQE A;  4APV A;  1SMX A;  2D0O A;  1ASY A;  4B3T Q;  1C0A A;  3CCQ A;  2UXC Q;  2ZJP A;  4KHP Q;  5J3B A;  3VDY A;  3I56 A;  5IYB H;  1IBK Q;  2MO1 A;  3OTO Q;  3S15 H;  3KJO A;  1HH2 P;  1K8A C;  4HIK A;  3GO5 A;  4NXN Q;  4GN5 A;  1EOV A;  4DV0 Q;  2K52 A;  4UY8 C;  4K0K Q;  4JBJ A;  1N9W A;  4DKA C;  4JOI A;  5FLX c;  3GTM H;  3CCJ A;  3FP9 A;  3HOW G;  4JI2 L;  1PH8 A;  3RN2 A;  1X6O A; 
#chains in the Genus database with same CATH topology
 3IRB A;  4ME5 A;  5FLM G;  1IW7 D;  1UUP A;  5IWA L;  1PTO F;  2VUM G;  5M5Y H;  1II3 A;  4K0K L;  4RMF A;  1GKH A;  2KEE A;  2KCT A;  1SYG A;  4GNX C;  3A55 A;  3QOJ A;  3HOY G;  4UAI A;  2K5Q A;  1R9T B;  1S5F D;  3K7U C;  3DWA A;  4OWX B;  3FMC A;  3MXG A;  3K7A B;  2FXQ A;  1QVF A;  1ZYR D;  4CKC A;  1I4R A;  2QDB A;  3E0E A;  5IYD G;  3KDF A;  3SDZ A;  5C0X J;  4DV1 L;  4DV5 Q;  1KL9 A;  2K32 A;  5EPL A;  4LW1 A;  1EU3 A;  1KC8 C;  1IBM L;  1H9R A;  5EGT A;  5COY A;  2AQ1 B;  1SNO A;  2V4D A;  3PO2 B;  1OXS C;  2RCN A;  4ZYS A;  2JJQ A;  1N33 Q;  1I50 B;  1NSN S;  2L12 A;  3V96 A;  2D2C C;  1ESR A;  2UXB L;  3K58 A;  3EA6 A;  1JJ2 A;  1QUQ B;  4X66 L;  2L5T A;  3NTI A;  3Q22 A;  3TSS A;  1XYI A;  4B3S L;  1IYU A;  4KY7 A;  1QNK A;  3Q23 A;  2A1A A;  2EE1 A;  4UP9 A;  2MHV A;  1V1P A;  3CAM A;  5J22 A;  3S1M H;  3NE5 B;  3SK4 A;  2K75 A;  2M2L A;  3A0J A;  4Y7N H;  2GVA A;  5A2Q L;  3BU2 A;  2JA8 B;  4JI2 Q;  4DR2 L;  1S5C D;  3DLL A;  3SK8 A;  1CTM A;  3OOC A;  4CBV A;  1NMG A;  4HR7 B;  4PMC A;  4LFC Q;  3KLW A;  4YHH L;  1IBL L;  4C3I B;  4FXD A;  2EYL A;  2EQS A;  3DEP A;  3AEV A;  2F1M A;  4PMW A;  1L1O C;  4C3H G;  4LF7 Q;  2MNA A;  1SJE D;  1N8R C;  3MFG A;  1UEA B;  4A3I H;  4NW2 A;  2HDL A;  3JAM i;  1XNR Q;  3TQY A;  5CYU A;  3I70 A;  5JEA J;  4DUZ L;  3S9W A;  2YU9 B;  1HXY D;  4F8M A;  4A3M B;  4CDE C;  4A93 G;  3TP5 A;  1SE3 A;  2PNH A;  2K5H A;  2UUC L;  3T4A C;  4BY1 G;  1LTG D;  3I4M H;  4YY3 Q;  1G8Z D;  4JI4 L;  5K36 G;  2I5M X;  1UEB A;  3NBH B;  4GS3 A;  4UHV A;  4K14 A;  1D5X C;  5LL6 X;  1KDB A;  3UDG A;  2OT2 A;  3VR2 A;  2XTI A;  5DAU A;  4IQZ A;  5IOD A;  2F0E A;  1CSQ A;  3U4V A;  3PF5 A;  1BOS A;  1YZ6 A;  3NBI A;  4YIJ A;  1QE6 A;  1VS0 A;  3BVM A;  2DY7 A;  3S1R H;  1DZ1 A;  4DR5 L;  1D6E C;  4IJH A;  3TS2 A;  1ZKO A;  2H1E A;  1BVS A;  1B9M A;  2O5I C;  4LF4 L;  2E2H H;  1HTP A;  4J15 A;  4M8A A;  5C3E B;  1N32 L;  1H95 A;  3GTO H;  4A3C G;  5C5M A;  1F9S A;  3LGJ A;  4DA2 A;  3RLF A;  5IY0 A;  1Y1W H;  4BY7 H;  1SR3 A;  2DNC A;  3H0G G;  2JA6 H;  4LF4 Q;  1JCK B;  1SNQ A;  2N49 A;  1TS3 A;  2A5H A;  2R92 G;  3W5O A;  1XMQ L;  4BS9 A;  1TVX A;  4AYB E;  4UPA A;  1KAW A;  1YIT A;  3F2C A;  5GAH C;  5E3F A;  4G7O C;  2JK8 A;  1SRU A;  1VQL A;  3BVZ A;  3PUW A;  3RN5 A;  3AU7 A;  1GOZ A;  1V1P B;  2QA4 A;  4P72 A;  2IHF A;  1DGS A;  3LWU A;  1A0I A;  4X62 L;  4A3J B;  3K57 A;  2Z9H A;  3HFZ B;  1S5E D;  1L1O B;  3MA2 B;  4HAE A;  2R7Z G;  2A69 C;  2XSC A;  1PRT B;  2VY3 A;  2IY5 B;  3VYR A;  1G91 A;  1G51 A;  3KYH C;  4ZQ3 A;  1UE6 A;  2SEB D;  2FMM A;  1YNN D;  3MFY A;  1EEI D;  4FF4 A;  1TR5 A;  1U0L A;  4CDF C;  4A3E B;  3HZX A;  3I72 A;  3ULJ A;  3J7Y W;  1L0W A;  1IL2 A;  3I4N B;  1SE2 A;  4KLK A;  3I2Z A;  1SYD A;  3DUZ A;  1PDQ A;  1QCB D;  2F0T A;  5BN4 A;  4OWW B;  4YY3 L;  2RA4 A;  1BCP D;  4N8F A;  2CH4 A;  3U9S A;  4A3G H;  4JI4 Q;  1I94 L;  2R7Z B;  1A3U A;  5C4J H;  4P75 A;  1YJ9 A;  2UU9 Q;  2JEA I;  1U4L A;  2EYF A;  5I6W A;  4KMU C;  1RKN A;  3M4P A;  5C4X G;  1VMP A;  1E2W A;  1MJC A;  2LXJ A;  3UDI A;  3CCU A;  3OIQ A;  4PZ8 A;  4IPD A;  4RAU C;  2WV6 D;  3NTH A;  4XT1 B;  3R8B A;  1ASZ A;  1N34 Q;  1FGB D;  2ZTD A;  4RKL A;  4ZRZ A;  1CZW A;  2NVY B;  1OTC A;  3S17 H;  4RH6 A;  4Q0F A;  2X69 A;  1G2S A;  3RZD B;  1CFM A;  3QWN A;  4ZUJ A;  4KK7 A;  1QJO A;  3IKJ A;  3G4S A;  1DOM A;  2QEX A;  1FJG L;  4FP5 D;  1ESF A;  4IJL A;  2RF4 A;  1FNV A;  4JI5 Q;  4A3F B;  1VMC A;  1ET6 A;  4BWG B;  5M3M B;  1VQP A;  1EQV A;  1SYE A;  5AFW A;  4A3K G;  3SK6 A;  3DEO A;  2XWJ B;  4OX9 Q;  2NYZ D;  2YTX A;  4ULL A;  4JW0 A;  1VQK A;  3PF4 A;  1HJP A;  1K8O A;  2AUJ D;  4HIM A;  4LAA A;  1L2F A;  3CQZ B;  4BA1 I;  3G6E A;  5CV5 A;  4DAY A;  1XTC D;  1CHQ D;  5D14 A;  4BBS G;  2RDG A;  1B2T A;  3TDQ A;  1OXV A;  2GN5 A;  3GTO B;  2L1B A;  4L5S A;  2R93 B;  3DHQ A;  2SOB A;  1VQ5 A;  1EIY B;  2WIN B;  1TY2 A;  5IGF A;  1EZ6 A;  3CCE A;  1O7Z A;  3W3A A;  4JBW A;  4BBR B;  4EVO A;  2RHQ B;  3WOF A;  3NPP A;  1EYA A;  3KLR A;  3NEM A;  4DV1 Q;  1ENF A;  4X62 Q;  4TKO B;  1VQ4 A;  5DLQ E;  4UP8 A;  2ID0 A;  1WTH A;  4HSP A;  3OW2 A;  1PFN A;  4L6T B;  2Z4H A;  3JC6 6;  4BY1 H;  4B9X A;  1Q3L A;  2QKI C;  3HEJ A;  4B3T L;  1NUC A;  4UP7 A;  3HGB A;  5JEA H;  5DM6 3;  4ZKC B;  2YYZ A;  4ODG A;  3S2H B;  1JT8 A;  1Y1V G;  1E24 A;  3S16 B;  4ZCK A;  1GXD C;  4JYA L;  2N8N A;  2F4I A;  1HPC A;  3U4Z A;  3MTS A;  4A3M H;  2UXD Q;  1I4G A;  1TWC H;  1S72 A;  2EJG C;  2FFK B;  2VNU D;  2F0K A;  1UE7 A;  2NVX B;  1TWA H;  2IWH A;  1FNW A;  4A3I B;  1JMC A;  1C9O A;  1SE8 A;  3FDT A;  4BBR G;  1HQR D;  2WFW A;  1GHJ A;  2CQA A;  4NXM L;  1XNQ Q;  1SMY D;  4R4Q A;  1DYQ A;  2Z6K C;  3F2D A;  4JI3 Q;  3FKI B;  1S5B D;  1ZYR C;  3J81 L;  1AH9 A;  1PRT D;  4A3C H;  4QUF A;  4J8Q A;  1X65 A;  4TQU S;  1WD0 A;  3F1Z A;  1HFN A;  4Q5V A;  3M7N A;  3HOX B;  2PQA B;  4LMQ D;  3PUY A;  1VQ9 A;  3LNN A;  1UE5 A;  3BDO A;  1FVI A;  1LTS D;  4RA8 A;  4C1N K;  2CW0 D;  2Y0S G;  4AYB B;  4HIO A;  4A3J G;  3R3O A;  2VL6 A;  4I7Z C;  1PH9 A;  2BH2 A;  4WJ3 M;  1RF2 D;  1NE3 A;  1V8Q A;  3KF6 B;  3I73 A;  4LFA L;  2UXD L;  4HID A;  3GTG H;  2K5W A;  4X64 L;  1HZA A;  2A68 D;  3FVQ A;  1ENC A;  4QIW B;  3PIO A;  1JJG A;  1RD9 D;  3ERQ A;  5I9O A;  4JI8 Q;  3S2H H;  2OWO A;  1JB3 A;  1HZC A;  3HOU H;  3IFT A;  2B2T C;  1GJX A;  3C2P A;  5E4X A;  1VQI A;  1SSO A;  2ZTC A;  3MVV A;  1X3F A;  5EPJ A;  4DN4 M;  2I5L X;  1WTO A;  1Q82 C;  4DR7 L;  3CCV A;  2A68 C;  3H91 A;  1QB5 D;  1RDP D;  2SNM A;  1VQB A;  1R9T H;  4ZAI A;  3ND9 A;  1KRT A;  5FO8 B;  2ZJR A;  1A3T A;  2H5X A;  3E3X A;  3TBI B;  2Y0S B;  4AYB G;  1T5E A;  1K73 C;  2NZO A;  5IGB A;  4LK1 C;  1NNX A;  4KKU A;  5M5Y B;  3DXJ C;  3D4W A;  1BBW A;  2HCI A;  3STB D;  1HNX L;  4YCU A;  2EYJ A;  5BN3 A;  5F2D A;  4G7Z C;  4C3J G;  2KHI A;  3RLN A;  1ZEQ X;  4XYQ A;  1A62 A;  3J81 i;  4CJ0 B;  3D6W A;  4I7A A;  1EIF A;  3HOW B;  1WTW A;  1ASY A;  1C0A A;  1EWH A;  5J3B A;  5IYB H;  3OTO Q;  3S15 H;  4C1N I;  3KJO A;  3P7J A;  4RGM A;  1DOK A;  1CA6 A;  1GUN A;  1EOV A;  4RGN A;  3I4L A;  4K0K Q;  4DKA C;  5CR3 A;  3QB3 A;  3CCJ A;  3OMG A;  4RGT A;  4JI2 L;  3RN2 A;  4DV2 Q;  3I91 A;  4BY1 B;  1KTK A;  3PO3 B;  2E75 C;  1PH1 A;  2BH8 A;  3S1N H;  1TS4 A;  3OIP A;  3TRZ A;  1AE2 A;  2KCC A;  3VR4 A;  1XPR A;  3JAM L;  1J5E Q;  4JOI C;  1KIX A;  2MFI A;  2Z4I A;  4BBS B;  1L0X B;  3OWF A;  1RIP A;  2AUK A;  1TY0 A;  3PCO B;  2WB1 E;  1YNX A;  2VQE L;  1FNU A;  2XVS A;  3PUZ A;  2IT1 A;  1GUS A;  1JJC B;  1LT6 D;  2C5C A;  4LFA Q;  1I4X A;  5FO9 B;  5IE8 A;  1YHQ A;  2NZH A;  4FYD A;  5KIX A;  5C3E G;  3TME A;  4JPB W;  5C3W A;  3SE0 A;  2XNA C;  1H9S A;  1PZK D;  1ML0 D;  1WCM H;  3BJU A;  3EJI A;  5JJI A;  2F0Q A;  1DM0 B;  4ALP A;  1BKB A;  3Q0A A;  2XIW A;  1TKW B;  1EY5 A;  1LTI D;  1PVO A;  1PFB A;  1IL8 A;  1SLJ A;  5D3I B;  1K83 B;  1SRO A;  3U50 C;  1W2B A;  2F0W A;  1E7Z A;  2B2V C;  1VF5 C;  3ER0 A;  3PGZ A;  2TMP A;  2HDM A;  3H3V C;  1CM9 A;  4FDB A;  4C2M H;  2WP8 J;  1TXY A;  1VQO A;  1X3Q A;  1V9P A;  4DFA A;  3CMA A;  3RZD H;  4H02 A;  2B2W C;  2DJG C;  3I4M G;  1Y69 U;  3OHX C;  3G71 A;  1LUZ A;  3WDN A;  5IP7 G;  2KED A;  4K8I A;  5EBC A;  1YI2 A;  2G9D A;  3MEF A;  4NPS A;  1Z7T A;  2E2J H;  3MXP A;  4L5T A;  1XTD A;  4JBK A;  1B9N A;  2OEO A;  2VB2 X;  5CV9 A;  1Q7Y C;  4RGO S;  3P75 A;  3SVM A;  1M8A A;  2ZXP A;  4OO1 I;  1H9S B;  5JVG 3;  2K14 A;  5I2Y A;  2KA7 A;  1GVP A;  1HHV A;  4AIM A;  1JC7 A;  1AEX A;  3A7L A;  4DAP A;  1EUJ A;  2LMC B;  4XYO A;  4R8N A;  1HR0 L;  1PH3 A;  2PI2 A;  3E5S A;  3J7A V;  2RSO A;  2WAQ G;  3CF5 A;  1QG7 A;  2DNE A;  2JA7 G;  4RCO A;  5C44 H;  2K6A A;  4BY7 G;  3K6O A;  2RBM A;  3A8J E;  1TS5 A;  2VW9 A;  1KLU D;  4ZKB B;  4LF9 Q;  4IUR A;  2Q8I B;  2L15 A;  2HHH Q;  1BDO A;  1ONL A;  4LWC A;  1S5D D;  2JN4 A;  2PI2 E;  1P8L A;  3GTG B;  1KAB A;  4DR3 Q;  2C9O A;  1U4M A;  1IW7 C;  3CKI B;  1SNM A;  4MTN A;  1T9H A;  3TEH B;  1WCM B;  2B2V A;  2L4N A;  3NWS A;  1XWE A;  4DV2 L;  5EAY A;  2JA6 B;  1STE A;  2NB0 A;  3I55 A;  3M4O B;  2QIL A;  4X66 Q;  5FLX L;  3AFQ A;  3NBH A;  3E9I A;  2JA7 B;  5I4D A;  2JA5 B;  2R7Z H;  5M3F B;  4DK6 C;  2WB1 B;  1K8G A;  1I5F A;  1TQO A;  2K5N A;  3K5L A;  4TSS A;  4DV4 Q;  4DU9 A;  4P71 A;  3CHB D;  1RTN A;  2K50 A;  1EIG A;  1XJV A;  2E2J B;  1PTO D;  1Y1W G;  1MSG A;  1LTA D;  2E2I B;  2NVT B;  2BCO A;  3HS0 C;  3F8T A;  2B8G A;  3HKZ G;  3K8A A;  3TN2 A;  4IFD H;  1MKH A;  4JVZ A;  1Y1V B;  1FJG Q;  1SEB D;  5M5W H;  5JPN C;  3HOZ H;  2F3V A;  2V1C C;  1GD7 A;  5CV8 A;  4WJ4 A;  2LXK A;  1I4P A;  3T51 B;  3I90 A;  1JOO A;  3PO3 H;  1KHI A;  2BE5 D;  4NMZ A;  5IT9 L;  4B3R Q;  4DV7 L;  2K04 A;  1I50 H;  1SFO H;  2B63 H;  3S1Q B;  1N34 L;  4OIJ A;  1IHZ A;  5J39 A;  1MD2 D;  1A3V A;  5E1F A;  3UDX A;  2EY2 A;  1CK1 A;  1PRT C;  3L9A X;  3OMC A;  1HRJ A;  1K0R A;  1FYC A;  4CKB A;  2JQO A;  1QZG A;  2E76 C;  2LS0 1;  5TSS A;  1YJN A;  5C4Z A;  4S3S A;  1TT2 A;  5CC4 A;  5C4H A;  2SNS A;  5HY6 A;  4QUC A;  3W1G A;  4A3E G;  2ZT9 C;  4X3K A;  3KF8 B;  5EQ0 A;  2CKZ B;  2M9V A;  2EJM A;  1D7Q A;  3BYY B;  4DXF A;  1QVC A;  4PV1 C;  2B39 A;  4HSV A;  4A3G G;  1KXL A;  4OX9 L;  4ME3 A;  1CZG A;  3URY A;  4BBS H;  1XMO L;  1F2M A;  1BO0 A;  2A6H D;  4GOP A;  2Q2T A;  5E7N A;  1SJH D;  5FLM H;  4OIK A;  2NVX H;  1B8A A;  1IXR A;  4XXE A;  1GUW A;  4FO2 A;  2M00 A;  3NQT A;  3HOV B;  1IBK L;  4IUP A;  3CRK C;  1YHA A;  3Q6S A;  2IHE A;  1SBB B;  3S16 H;  1UE1 A;  2BDN A;  5GRO A;  4A3F G;  5JAV A;  3NSW A;  3G7L A;  4E6I A;  1IYV A;  2PO4 A;  1SFO B;  5IYD H;  1Z47 A;  4KY5 A;  2Z0S A;  2ICE C;  3CD6 A;  1F77 A;  3J7A F;  1LAB A;  3GV3 A;  4JI7 Q;  3ERO A;  2YTV A;  1STB A;  3KUP A;  4LFC L;  3HOW H;  2KQ3 A;  1HNW L;  1F2L A;  5FLX E;  1MJE A;  1CT1 D;  4IN3 A;  4GLX A;  5EKI A;  4B9W A;  1JOR A;  2F4V L;  3PUV A;  5IGC A;  4RKB A;  5IT9 E;  2ZJQ A;  1PTO B;  3EIV A;  4FF1 A;  5J1Z A;  2K7V A;  1PV4 A;  1XNQ L;  5LMN W;  2E2I H;  2NVT H;  4PMB A;  4A3B B;  5C4J B;  4X6A H;  3PSI A;  2G5D A;  1CI3 M;  1PRT F;  2JA8 H;  1XPU A;  2C35 B;  4G4K A;  1PXU A;  2KVM A;  1VQC A;  1VQF A;  2B2Y C;  4DR2 Q;  3S1M B;  3A5Z B;  1B3Q A;  2SDF A;  2AQ3 B;  2JA9 A;  1AZQ A;  5I2X A;  4X64 Q;  1SYF A;  1HNZ Q;  4DK1 A;  1TWC B;  3MXU A;  4PZ6 A;  4B3S Q;  3HOU B;  4R4T A;  5FKA C;  4QMG A;  1V1Q A;  4YCV A;  1WCM G;  5KGU A;  2A74 C;  1Q90 A;  2B63 B;  2ZM6 Q;  1MHW C;  4A3I G;  3JAM c;  2H4O A;  2DJF C;  2Y0S E;  3DM1 A;  5ELN A;  4WFN 3;  3KBG A;  3T1Y Q;  1PH5 A;  3I4O A;  1LTR D;  1GHK A;  3CCM A;  2KUM A;  2DY8 A;  1X3E A;  4OGQ C;  3H6M A;  5KYI A;  1SE4 A;  2D62 A;  4A93 H;  4A3D G;  4XDX A;  3M4Y A;  2IX1 A;  2L11 A;  2HD3 A;  3SXH A;  3N6R A;  1CHP D;  3ITP A;  1NY4 A;  4KHV A;  3BDL A;  3C1E A;  3HOX H;  2GVB A;  3G6J B;  2XGT A;  4JI8 L;  3UE1 A;  5G3L F;  2WB1 G;  1G6Z A;  2F0H A;  1DXM A;  2VZA A;  4YWK A;  3T1H L;  4XTC S;  2K4K A;  3G48 A;  1CKN A;  1I4H A;  1Y1W B;  1RJT A;  5JPM C;  1E1O A;  3CP0 A;  1EZ8 A;  1SAP A;  3ZYY X;  2G9H D;  3FRP B;  4GZY C;  3H15 A;  2KEN A;  1K8M A;  3I4N G;  3M4O H;  4ZK9 B;  3A5U A;  1STH A;  2PQE A;  4H0L C;  1HTL D;  4JC0 A;  1PZJ D;  4DR4 Q;  1CQV A;  1JQY D;  4JI5 L;  5C0X G;  1XPO A;  1EY0 A;  1HNX Q;  2CFM A;  2Z1C A;  5C3X A;  3CC7 A;  4AQY L;  3P1H A;  3S14 H;  1V1O A;  1JWM D;  4RHS A;  3IL8 A;  3AMU A;  2IW3 A;  3GTP B;  5IP9 G;  4QGU A;  1G2T A;  1PLF A;  1D1K A;  4NXM Q;  3C46 A;  2P5Z X;  1IKL A;  2F0M A;  2KJX A;  4EGV A;  1BNZ A;  1A2T A;  2EY1 A;  4PZ7 A;  4POG A;  1O7Y A;  3K59 A;  2QF7 A;  2ZTE A;  1WTV A;  1QVG A;  4A4I A;  4OXP A;  5DEH A;  4N8X 1;  5C44 B;  3BS1 A;  1ROD A;  1TII D;  5CMD A;  3MAQ A;  1C8C A;  2XN9 C;  3GV6 A;  4NDX A;  4EQN A;  2DN8 A;  4IOA A;  1E2Z A;  1VQE A;  4APV A;  1SMX A;  1EFI D;  3CCQ A;  3R2I A;  3HP3 A;  1S4Z A;  3S2D B;  4OO1 H;  1FR3 A;  2R3Z A;  4NXN Q;  4GN5 A;  4DV0 Q;  1RHP A;  1N9W A;  1NCV A;  1U9R A;  3GTM H;  5K5P A;  3U9O A;  1PH8 A;  5COR A;  1JWU D;  3MWY W;  1YHB A;  2B29 A;  3CME A;  2OTL A;  1VDZ A;  3CRL C;  2I07 B;  3EBE A;  4DV0 L;  4B3R L;  2RSN A;  1CUK A;  2OCE A;  2NVQ H;  1B70 B;  1F9P A;  3VA7 A;  3K5O A;  1HUN A;  1WFQ A;  5M3M H;  4DPG A;  3M3Y B;  4GLV B;  4JI6 L;  2HIV A;  4R4O A;  4CDC C;  2EJF C;  4NKL A;  4RHR A;  3J80 L;  1K83 H;  1IYJ B;  3T13 A;  5M5X B;  2QGQ A;  3M4Q A;  3PO2 G;  3S1Q H;  1EL0 A;  3PO3 G;  1EOT A;  1JOQ A;  4P74 A;  3HRZ C;  1N36 L;  1STY A;  3CCL A;  4IUT A;  1MIU A;  1NBW A;  1FGU A;  1CKN B;  4HTH A;  2VQF Q;  1O7I A;  4QL5 A;  3TP7 A;  1KRS A;  1JWS D;  3O13 A;  2B8F A;  2OQK A;  3TZU A;  2RCF A;  4O2D A;  2UUA Q;  4L5Q A;  1KDC A;  1ICF B;  1A15 A;  4CKE A;  1AW7 A;  1Y8O B;  1K0S A;  1STA A;  4A75 A;  4LJZ C;  2E74 C;  2PZT A;  4DR7 Q;  1Y8N B;  4OL7 A;  3OYY A;  5HUR A;  1VQJ A;  5IYC G;  4M1U B;  3ULL A;  1NAP A;  3PQI A;  1SND A;  2HHH L;  5M3F H;  2B2W A;  3CPW A;  2JA5 H;  3PMF A;  2KOL A;  3D3R A;  5ISR A;  1BXT A;  3BVG A;  3S1N B;  1WD1 A;  5A35 A;  3ICE A;  2K01 A;  2ICI A;  2K28 A;  3CU7 A;  1YIJ A;  1HR0 W;  4IZ8 A;  3J81 E;  4GN4 B;  2B63 G;  1BCP B;  2B2U A;  2Z6B A;  5I9P A;  3ERS X;  4LFB Q;  3T53 B;  4ABN A;  2F0P A;  2MGS A;  1AN8 A;  3I4M B;  1QUQ A;  3ONA B;  3AYH B;  2QEJ C;  1YNJ C;  3HOV H;  1Q1E A;  4KKS A;  3A56 A;  2O4X A;  1Z6H A;  2N88 A;  4K2K A;  2AQ2 B;  5LMN L;  3A8K E;  3LWE A;  1B44 D;  1K9M C;  1Y1V H;  3A7A B;  3IAY A;  3LX0 A;  1NTG A;  4ZUI A;  5KND A;  4I65 A;  1LT4 D;  1ILP A;  1IKM A;  1YNJ D;  1T5X D;  4POF A;  2BOS A;  1DD2 A;  2D9U A;  3DWQ A;  4DR6 L;  3BZC A;  4BXX H;  4HJ7 A;  4IPG A;  2E8G A;  2EPB A;  1C7Y A;  1M90 C;  1WYD A;  3JAM E;  4X65 Q;  2JA7 H;  1PH6 A;  1STN A;  1M1K C;  3E0J A;  2NUC A;  3AFP A;  1ET9 A;  4NXN L;  1F2Z A;  2F3I A;  4JI1 L;  1B53 A;  1SXT A;  2KEC A;  1NJI C;  4B3M Q;  5IP9 H;  3GTJ H;  3Q8D A;  1F9R A;  2IX3 A;  1NR4 A;  1WJJ A;  2OXP A;  3A8I E;  2NWG A;  1XNR L;  3HG9 A;  1W3S A;  1VF7 A;  1F9Q A;  4C2M B;  2BA0 A;  3D31 A;  1PA6 A;  2F0I A;  1DON A;  4A3J H;  1TWF H;  4KN7 C;  4JCV E;  1HCZ A;  3ZJY C;  1HFG A;  1Q86 C;  3BYT B;  3M3Y H;  5ELC A;  3J81 j;  5M5W B;  4EQO A;  1AE3 A;  1AZP A;  5T1I A;  1EY6 A;  2RDH A;  3FPU B;  2NVQ B;  4A3D H;  4MIU A;  3HOU G;  4C3I H;  4X3S A;  2Z8L A;  5C6A A;  4A3L H;  4G7H C;  4O1N A;  1H9M A;  3PIP A;  1Q8K A;  1VCI A;  1MI2 A;  2CH4 W;  4DNT B;  1SYC A;  4O42 A;  2PMZ B;  3HKZ B;  1WTR A;  1VQN A;  4LF5 L;  2EY5 A;  3SGI A;  4DXG A;  5C4X B;  4LFB L;  1I3Q H;  4LUV A;  3FKI H;  1RCV D;  5GAD C;  4P73 A;  4HJ9 A;  3CW2 C;  5BR8 L;  4KJO A;  1LTL A;  5C3E H;  2K03 A;  3S2D H;  3VA5 A;  2E2H B;  4JV5 Q;  4HN7 A;  3FHW A;  1EY7 A;  4IFD G;  2B2T A;  4R9W A;  3X3N A;  4FXG C;  1O78 A;  1CKM A;  1FD7 D;  4B08 A;  1LV9 A;  2PW7 A;  5ELD A;  4GLA C;  1MSH A;  1CSP A;  3C1F A;  3BDC A;  3NEN A;  1EU4 A;  2CWP A;  4DV3 Q;  2Q2I A;  1OO9 B;  1CQF A;  4XQN A;  3GD7 A;  1PH7 A;  1HA6 A;  5EJW A;  1JOK A;  1O80 A;  3SEB A;  1L1O A;  4AQY Q;  1WTP A;  4KKT A;  3M7G A;  3J80 c;  2N3S A;  3KOJ A;  3K7A H;  4YWM A;  1SMY C;  3OPO A;  5M9O A;  2CCZ A;  3RD4 A;  3I8Z A;  5FOB B;  4IAL A;  3S15 B;  2A8V A;  5IP7 H;  1PFS A;  1L0Y B;  1KQS A;  4JK1 C;  1E0B A;  1AP0 A;  2YU9 H;  1HNW Q;  1ZXT A;  1E1T A;  3BG3 A;  5CV7 A;  3EN2 A;  1PTO C;  5FJ8 G;  4LNQ A;  2EYP A;  2WKD A;  4RG1 A;  2R93 H;  4WJW A;  1XMQ Q;  1F2Y A;  3BZD B;  4A3G B;  1TS2 A;  4K6D A;  1R4Q B;  3FEW X;  1TWG H;  4XIG S;  5EKK A;  1K3R A;  4O0A A;  4JI3 L;  5KNB A;  3I4N H;  2EVB A;  1J9O A;  4RFB A;  3U58 A;  1JB7 A;  2FHT A;  4MN3 A;  3RNU A;  1N36 Q;  2IPK D;  2NTT A;  4H13 C;  4IUQ A;  1GO3 E;  5EBD A;  2F0N A;  4C3H H;  4IFD J;  2N55 A;  2PZW A;  4KV6 A;  2VUM H;  2A6E D;  3A54 A;  4DV6 Q;  3I7F A;  4A93 B;  2L9H A;  4A3F H;  1A63 A;  3TRE A;  3F2U A;  1UAP A;  3CC2 A;  3I3C A;  4J6H A;  4TVA B;  3T16 A;  5KYL A;  4GOP B;  5JJK A;  1EWI A;  4LF5 Q;  5I6Y A;  4DUY Q;  3HOZ G;  2RQX A;  4YCW A;  2HCC A;  4JI1 Q;  3CCS A;  4DNR B;  1KD1 C;  2A19 A;  3AB9 A;  2PNR C;  1WTQ A;  2FJ2 A;  3VYS A;  5FK9 C;  2OF1 A;  4CHT B;  2YTY A;  3EFX D;  5A2Q E;  1TWH H;  4DR5 Q;  3NK9 A;  3OSO A;  4J1M A;  2UUB L;  4G57 A;  3D4D A;  5GQO A;  2EIF A;  1GUO A;  5D3D A;  1PHJ A;  2Z6K A;  1CKO A;  4MNO A;  3M85 A;  2JA8 G;  3K5N A;  1BCP F;  4A3B H;  5IGE A;  3VR6 A;  4A3E H;  3MXN B;  3OWE B;  4QQB X;  4OEL B;  3GTQ B;  1X32 A;  3TS0 A;  1Q1B A;  1JR0 D;  3ULP A;  1PYW D;  3S1R B;  3J81 c;  2MO0 A;  1NMF A;  1A8V A;  3WOE A;  4IFD I;  3QJY A;  3J7A 5;  1ENA A;  1LT3 D;  1Q12 A;  2IL8 A;  1X3G A;  5M3F G;  4GKK L;  1W6J A;  3UDF A;  2TSS A;  3GDE A;  1CA5 A;  3N52 A;  5L37 A;  2F0O A;  2XRQ D;  1WOC A;  2Q2H A;  4L8J A;  4CGY B;  2X6G A;  4NP5 A;  5CGK A;  4K5W A;  5FO7 B;  1W6K A;  4OWT B;  2EOT A;  2F0D A;  4IOC A;  3R93 A;  4CJ2 C;  1MGS A;  4DV3 L;  1DJR D;  1PYB A;  2L55 A;  3H3V H;  1VQH A;  4LF7 L;  1ICW A;  3HOX G;  3K0X A;  4DF7 A;  2I5H A;  3K80 C;  3NEL A;  3NHH A;  5M5X H;  3MXN A;  5ELF A;  2K5D A;  5ELB A;  3BZK A;  1LM0 A;  3PIO 3;  1I6V C;  4DR3 L;  1LTB D;  4HJ5 A;  2NZ1 D;  5LMU L;  4FF3 A;  1BBX C;  4JBM A;  5CV4 A;  3H3V I;  1H9K A;  1E2V A;  4KN4 C;  4QCL A;  4DV6 L;  4QF4 A;  2HQL A;  2VQE Q;  1YVC A;  1EQQ A;  1X9N A;  5ELO A;  2BA1 A;  5LL6 S;  2F4V Q;  1OXT A;  1Q81 C;  2R6G A;  2JA5 G;  2VXW A;  4Y7N B;  2VB3 X;  2JP1 A;  3GTQ H;  3NP8 A;  5C5L A;  4KHP L;  1P16 A;  5IGG A;  2AWO A;  2QDL A;  1TWG B;  3D8G A;  1U5K A;  1RTO A;  3KLS A;  2OQ0 A;  1KNE A;  2D0O A;  3VR3 A;  2UXC Q;  4KHP Q;  3I56 A;  2MP1 A;  2MO1 A;  2PW5 A;  2XRS D;  1K8A C;  4HIK A;  4KTA A;  3GTL B;  2K52 A;  3GQB A;  1B3A A;  1J8I A;  4IUN A;  5K36 H;  4JOI A;  3HOW G;  1X6O A;  2R7D A;  4U67 3;  1XMO Q;  4L63 B;  3V2T A;  1QNU A;  1TU2 B;  2IJ0 A;  1BCP C;  2UU9 L;  4FNF A;  2NN6 H;  4PG3 A;  1JE5 A;  3D0F A;  1X56 A;  2JXM B;  4IPC A;  4JV5 L;  3PV0 A;  2JSO A;  2UUA L;  5JOB A;  3GTP H;  2JYO A;  2GA4 B;  2ALY B;  4FVM A;  4DR1 Q;  2PZU A;  1VQD A;  1SYB A;  2D5D A;  1NR2 A;  3QIA A;  4GKK Q;  1OXX K;  3DWP A;  4QJF A;  4N9T A;  4Y52 H;  1PYS B;  4GN3 B;  3FKI G;  3CQZ H;  4GOP C;  4TRD A;  1PH4 A;  2K5V A;  2Q8R E;  3H0G H;  4QIW E;  2WAC A;  5M3M G;  1I3Q B;  3UI2 A;  1HR0 Q;  1KNA A;  1S3O A;  3TP6 A;  2JE6 I;  1EWC A;  2KCM A;  1A6X A;  3L0O A;  3F2B A;  3IFD A;  2F03 A;  3RZO B;  1VQ6 A;  2K33 A;  4FF2 A;  4DNI A;  1N32 Q;  2UXB Q;  4F7X A;  4A3K B;  1C4Q A;  1LYL A;  5IIF A;  3VR5 A;  4KI0 A;  4OHJ A;  2OTJ A;  4A3L G;  1JIC A;  3VYU A;  2Q8T A;  2EZV A;  1SDF A;  3KDF B;  1TWF B;  2A73 B;  4PNY A;  3HKS A;  4CDD C;  1FL0 A;  4X3T A;  1U4P A;  2KBN A;  1J6Q A;  2HUG A;  4ID6 A;  3CPF A;  1K3B C;  2VS1 A;  2ENB A;  4QB4 A;  5IYC H;  1KAA A;  2ES2 A;  1I4Q A;  1VQG A;  3KBX A;  4MTK A;  4KD3 A;  2NN6 I;  4DK3 C;  1STG A;  1D5M C;  4OO1 G;  2ZXR A;  1IBL Q;  1LT5 D;  1GM5 A;  1V43 A;  5IOC A;  1EIH A;  3E6Z X;  2PYK A;  2LSS A;  2A69 D;  5DNF A;  2BE5 C;  4EQP A;  2UXC L;  5C4X H;  3QOL A;  1PZI D;  4JYA Q;  4NB3 A;  4GKJ Q;  4DAM A;  1VQ8 A;  2F3W A;  4DUZ Q;  3K81 C;  4DR6 Q;  1YNN C;  1U4R A;  3H94 A;  1HQM C;  2PPB C;  2QCP X;  1QIL A;  2R61 A;  1PTO H;  2NTS A;  2CHB D;  1OXU A;  4H44 C;  4FXK C;  2AWN A;  2F0S A;  4OEM B;  4WOR A;  4DK0 A;  4P2C B;  4AH6 A;  2J4X A;  5KEE A;  3PIP 3;  4KD4 A;  3S17 B;  1DCZ A;  2NVY H;  4BA2 I;  4XQJ A;  4HJ8 A;  3GTL H;  5IT9 c;  3A74 A;  3GTK H;  4V19 0;  2O5J C;  2F0F A;  2K1B A;  4YHH Q;  2KHJ A;  3NTK A;  2IX0 A;  3CCR A;  4WRD A;  2RKS A;  3J7Z C;  4IO9 A;  1B7Y B;  5IGD A;  3T1Y L;  4K5V A;  4LF8 Q;  4LF6 L;  2RHS B;  4DV5 L;  4BY7 B;  2ASB A;  1YEZ A;  2RVL A;  1LLR D;  2RDF A;  4DAV A;  3NWT A;  3L3O C;  4RCN A;  1D2B A;  1N33 L;  4LF6 Q;  1X54 A;  5HGT A;  3W2D A;  5EKL A;  5KRU A;  2PMZ E;  3HKZ E;  1UNS A;  3SK5 A;  3H09 A;  1KDA A;  2EDG A;  2AKW B;  2CVR A;  1GUG A;  5BR8 Q;  5DM7 3;  3EVQ A;  1LTT D;  4UDU C;  2F52 A;  1KLG D;  2EXZ A;  1Q46 A;  4IUU A;  1AFP A;  2AHO B;  4DV4 L;  3SHL A;  5C0X H;  1BF4 A;  5T1G A;  5LMU Q;  3PO2 H;  2F0U A;  3OTO L;  4ZLT F;  5CV6 A;  1H9J A;  3QO2 A;  2D0P A;  4RWS C;  3X3M A;  1E3P A;  3TP8 A;  4L5R C;  3RZO H;  1G29 1;  4V0B A;  2WII B;  4IUV A;  1B1Z A;  4U68 A;  4X3U A;  1VQ7 A;  4XT3 B;  4HJA A;  3K5M A;  4JI7 L;  2LKV A;  5KNC A;  2EYH A;  3P20 A;  1EYD A;  4XQQ A;  4R8I A;  1Q8I A;  1O7L A;  4C56 C;  1E22 A;  4KJN A;  1QWY A;  2A6H C;  1K28 A;  4C3J B;  5C0X I;  1HZ9 A;  5EPK A;  5E4W C;  3B6Y A;  3J80 E;  3HOZ B;  2VUM B;  4A3B G;  3GP7 A;  4JI6 Q;  3DM3 A;  4R4C A;  2X6L A;  4LUZ A;  4C3H B;  2R93 G;  1I94 Q;  3WWV A;  1D1I A;  3RMH A;  3MHB A;  2Q2U A;  4IPH A;  4MZ9 A;  3NXW A;  1QZH A;  1EY4 A;  2F0J A;  3QR8 A;  3W1B A;  5JVH 3;  4BXX G;  2DUD A;  4F87 A;  3CC4 A;  3MZ5 A;  4B3M L;  2PCF B;  2R7F A;  3KF6 A;  2F0G A;  1BBU A;  5NUC A;  2MPM A;  1WVL A;  1PFM A;  4C3J H;  1D8L A;  2YV5 A;  4GNX B;  1BQQ T;  3M9B A;  5ELE A;  5LHY 1;  2BDO A;  1LAC A;  3RR5 A;  1VQM A;  4Z9C B;  3GTK B;  3HOY H;  4QY7 A;  1ILQ A;  1SNP A;  4DR1 L;  3HOV G;  4JI0 Q;  1HZB A;  1M4V A;  3STB C;  1A2U A;  2WAQ E;  3KJP A;  4EQ5 A;  3FPP A;  4LF8 L;  1PH2 A;  5JJL A;  4A3K H;  2UUB Q;  2CW0 C;  2J7Z A;  1HA5 A;  2FMC A;  2B2Y A;  3L2P A;  5FJ8 H;  1BUV T;  3PUX A;  4DUY L;  1SNC A;  3J80 i;  1S40 A;  2N78 A;  4A76 A;  4N9P A;  1EFW A;  3Q24 A;  4K2L A;  1EQR A;  3KK7 A;  2NN6 G;  3D6C A;  2B2U C;  1RL2 A;  2MQH A;  2UUC Q;  4JG2 A;  4MHE A;  4YWL A;  1X3P A;  3T56 B;  1EEF D;  1XX8 A;  2HIX A;  2E5L Q;  1TWA B;  3ND8 A;  1VQA A;  3NUC A;  1EY9 A;  4HMI A;  5GAE C;  1B50 A;  2CQO A;  1YJW A;  2B3G A;  1PMR A;  4R4I A;  5C44 G;  1WTX A;  1JE4 A;  5H1S E;  3RUZ A;  2R92 H;  4PQX A;  3AQQ A;  1XXG A;  1IBM Q;  3CXC A;  2EXD A;  2AMC B;  2WKC A;  3T1H Q;  4F88 A;  1I6H H;  3MEH A;  1D5Z C;  4A3D B;  5JEA G;  4LF9 L;  2LY7 A;  1WI5 A;  1EYC A;  1UWV A;  2JEB I;  3VYT A;  5AJ3 L;  3RLO A;  3NQI A;  1J5E L;  2EYM A;  4K6L A;  4HCS A;  2I0Q A;  5CBE E;  3SR1 A;  4C3I G;  1I6H B;  1HNZ L;  3KF8 A;  4K5X A;  4A3M G;  2MUY A;  5IWA Q;  4X65 L;  1HUM A;  2F0V A;  2KCN A;  3D4R A;  3R2T A;  4BBR H;  4HMJ A;  5AJ3 Q;  1LO5 D;  2ZM6 L;  1B4O A;  2WAQ B;  2E5L L;  4OON A;  2DGY A;  2EY6 A;  5HGQ A;  4CJ1 B;  3H0G B;  2MJ8 A;  2QW7 A;  1Z9F A;  2J0T D;  2HQE A;  1IZ6 A;  2KHS A;  4KY6 A;  1GUT A;  4GNX A;  2A6E C;  1G6P A;  3GTM B;  4KHZ A;  3KFU A;  3S24 A;  2CWA A;  4LUO A;  1Y14 B;  3KLS X;  2I46 A;  2NBF A;  3EQL C;  5LMN Q;  1X55 A;  4GKJ L;  1MBY A;  4DAY B;  5GAG C;  2FIN B;  2VQF L;  2ZXO A;  4HCE A;  4K8J A;  3L7Z C;  1TWH B;  5BN5 A;  5D65 A;  5JJZ A;  1EYG A;  2JA6 G;  3E9H A;  1YBY A;  4HED A;  1R4P B;  3TZD A;  3K0Y A;  2PQA A;  4R1J A;  1EY8 A;  4DV7 Q;  5G3L D;  5IYB G;  2EYO A;  1QOH A;  2XWB B;  4ILW A;  2ATW A;  3HOY B;  3QG1 A;  2K05 A;  2O2L D;  4DR4 L;  2HT1 A;  3UE0 A;  3V05 A;  4EX5 A;  4JI0 L;  1SN8 A;  2R92 B;  1EQT A;  1Y8P B;  4H7B A;  3S14 B;  3GTJ B;  4B3T Q;  5CBA E;  2ZJP A;  2E2D C;  3VDY A;  1IBK Q;  1C48 A;  1HH2 P;  3DMU A;  3GO5 A;  2F0L A;  2LFN A;  2L0C A;  1BR9 A;  4DGZ A;  4UY8 C;  3OW7 A;  4JBJ A;  5FLX c;  3C3L A;  3MC0 B;  1DOL A;  3FP9 A; 
#chains in the Genus database with same CATH homology
 2R7D A;  3IRB A;  1YHB A;  2B29 A;  5FLM G;  1XMO Q;  3CME A;  2OTL A;  1PH1 A;  2BH8 A;  5IWA L;  3S1N H;  2UU9 L;  3EBE A;  4B3R L;  4DV0 L;  2VUM G;  5M5Y H;  1CUK A;  2OCE A;  2NVQ H;  1B70 B;  1AE2 A;  4RMF A;  3TRZ A;  4K0K L;  1XPR A;  4PG3 A;  1JE5 A;  1GKH A;  1WFQ A;  2KCT A;  3D0F A;  4JOI C;  4GNX C;  1J5E Q;  1X56 A;  1KIX A;  3HOY G;  2MFI A;  5M3M H;  4IPC A;  4DPG A;  3PV0 A;  4JV5 L;  2UUA L;  3GTP H;  1RIP A;  3PCO B;  2ALY B;  3K7U C;  2WB1 E;  4GLV B;  4OWX B;  1YNX A;  4DR1 Q;  2FXQ A;  4JI6 L;  1QVF A;  2VQE L;  2HIV A;  1VQD A;  4R4O A;  3PUZ A;  2IT1 A;  1JJC B;  3E0E A;  4GKK Q;  1OXX K;  5IYD G;  1K83 H;  1IYJ B;  3KDF A;  5C0X J;  4DV1 L;  2QGQ A;  3M4Q A;  4LFA Q;  4DV5 Q;  1KL9 A;  3PO2 G;  3S1Q H;  4QJF A;  3PO3 G;  4LW1 A;  1KC8 C;  1IBM L;  4P74 A;  5IE8 A;  1N36 L;  4Y52 H;  3CCL A;  1PYS B;  4GN3 B;  3FKI G;  1YHQ A;  3CQZ H;  4GOP C;  2NZH A;  1MIU A;  1NBW A;  1PH4 A;  2K5V A;  1OXS C;  1FGU A;  1CKN B;  3H0G H;  2RCN A;  2VQF Q;  2JJQ A;  5C3E G;  1O7I A;  1N33 Q;  4QL5 A;  4QIW E;  5M3M G;  1HR0 Q;  1KRS A;  1S3O A;  2UXB L;  2OQK A;  1JJ2 A;  1QUQ B;  1WCM H;  3BJU A;  4X66 L;  4O2D A;  2JE6 I;  2UUA Q;  2KCM A;  4L5Q A;  5JJI A;  4ALP A;  4B3S L;  1BKB A;  3L0O A;  2A1A A;  4UP9 A;  3F2B A;  3S1M H;  1PVO A;  3CAM A;  4A75 A;  1SLJ A;  4DR7 Q;  1SRO A;  3U50 C;  1W2B A;  3OYY A;  1E7Z A;  2K75 A;  1VQJ A;  5IYC G;  3A0J A;  3ULL A;  3ER0 A;  3PGZ A;  2GVA A;  4Y7N H;  1VQ6 A;  4DNI A;  1N32 Q;  3BU2 A;  2UXB Q;  4JI2 Q;  1LYL A;  4DR2 L;  2HHH L;  3DLL A;  4KI0 A;  4FDB A;  2OTJ A;  4C2M H;  2WP8 J;  5M3F H;  3CPW A;  1TXY A;  1VQO A;  2JA5 H;  4A3L G;  1V9P A;  3CMA A;  3RZD H;  4H02 A;  1NMG A;  3I4M G;  4LFC Q;  3KDF B;  3KLW A;  4YHH L;  1IBL L;  3HKS A;  3G71 A;  1LUZ A;  2EQS A;  3AEV A;  5IP7 G;  4PMW A;  1FL0 A;  2KBN A;  1J6Q A;  1YI2 A;  1L1O C;  3MEF A;  3CPF A;  4NPS A;  3ICE A;  4LF7 Q;  2MNA A;  1YIJ A;  1HR0 W;  2E2J H;  1N8R C;  2VS1 A;  4A3I H;  4GN4 B;  4L5T A;  1XTD A;  4JBK A;  3JAM i;  2B63 G;  5IYC H;  3TQY A;  1Q7Y C;  1XNR Q;  5JEA J;  4DUZ L;  3ERS X;  2ES2 A;  4LFB Q;  1VQG A;  4A93 G;  2NN6 I;  2PNH A;  2K5H A;  4OO1 I;  1QUQ A;  4DK3 C;  2UUC L;  4OO1 G;  3AYH B;  1IBL Q;  4BY1 G;  1GM5 A;  1V43 A;  3I4M H;  2K14 A;  3HOV H;  1Q1E A;  4YY3 Q;  1GVP A;  2LSS A;  4AIM A;  2UXC L;  4JI4 L;  5K36 G;  5C4X H;  2I5M X;  1EUJ A;  1UEB A;  3NBH B;  4GS3 A;  4JYA Q;  5LMN L;  4NB3 A;  4GKJ Q;  1HR0 L;  4DAM A;  1VQ8 A;  1PH3 A;  3UDG A;  2PI2 A;  1K9M C;  1Y1V H;  4DUZ Q;  2WAQ G;  3K81 C;  2XTI A;  3CF5 A;  4DR6 Q;  2JA7 G;  1CSQ A;  3U4V A;  1NTG A;  3PF5 A;  1YZ6 A;  5C44 H;  1OXU A;  4BY7 G;  1VS0 A;  2AWN A;  4POF A;  2VW9 A;  3S1R H;  4LF9 Q;  4AH6 A;  4DR5 L;  4DR6 L;  3BZC A;  4IJH A;  4BXX H;  3TS2 A;  4HJ7 A;  4IPG A;  1BVS A;  2E8G A;  2L15 A;  2HHH Q;  4LF4 L;  2E2H H;  2NVY H;  4J15 A;  1C7Y A;  4BA2 I;  4LWC A;  4HJ8 A;  1N32 L;  3GTL H;  1M90 C;  3GTO H;  1H95 A;  1WYD A;  3A74 A;  5IT9 c;  3GTK H;  4A3C G;  3LGJ A;  2PI2 E;  4X65 Q;  2JA7 H;  1PH6 A;  1M1K C;  1P8L A;  4YHH Q;  4DR3 Q;  2KHJ A;  3AFP A;  3RLF A;  4NXN L;  2F3I A;  2IX0 A;  4JI1 L;  5IY0 A;  3J7Z C;  3CCR A;  4IO9 A;  1Y1W H;  1NJI C;  4B3M Q;  4BY7 H;  1B7Y B;  4MTN A;  1SR3 A;  1T9H A;  3H0G G;  5IP9 H;  3Q8D A;  3TEH B;  2RHS B;  3GTJ H;  4DV5 L;  3T1Y L;  4LF8 Q;  4LF6 L;  4DV2 L;  1YEZ A;  5EAY A;  2ASB A;  4LF4 Q;  3I55 A;  1WJJ A;  4X66 Q;  2N49 A;  3AFQ A;  1XNR L;  3E9I A;  1W3S A;  2R92 G;  2R7Z H;  2BA0 A;  3D31 A;  4DK6 C;  3W5O A;  1XMQ L;  1PA6 A;  4AYB E;  4A3J H;  4UPA A;  1I5F A;  1K8G A;  1KAW A;  1YIT A;  3F2C A;  1TWF H;  2K5N A;  1N33 L;  4JCV E;  5GAH C;  4LF6 Q;  4DV4 Q;  1X54 A;  2JK8 A;  3ZJY C;  1Q86 C;  2PMZ E;  1SRU A;  3HKZ E;  4P71 A;  3M3Y H;  1VQL A;  2K50 A;  3PUW A;  3RN5 A;  1XJV A;  3J81 j;  1Y1W G;  1AE3 A;  2AKW B;  2QA4 A;  3F8T A;  4P72 A;  2IHF A;  1DGS A;  5BR8 Q;  1A0I A;  4X62 L;  4A3D H;  3HOU G;  4LFB L;  3HKZ G;  4C3I H;  2F52 A;  4A3L H;  3K8A A;  1MKH A;  3HFZ B;  1L1O B;  3PIP A;  1Q8K A;  1VCI A;  2R7Z G;  1Q46 A;  2VY3 A;  1FJG Q;  2IY5 B;  2AHO B;  5M5W H;  4DV4 L;  3HOZ H;  1G51 A;  5LMU Q;  2V1C C;  1GD7 A;  3KYH C;  4WJ4 A;  1UE6 A;  2LXK A;  1VQN A;  3OTO L;  4LF5 L;  3PO2 H;  3PO3 H;  2D0P A;  3SGI A;  1KHI A;  4B3R Q;  1E3P A;  1I3Q H;  1U0L A;  4LUV A;  3FKI H;  4DV7 L;  4L5R C;  1I50 H;  1G29 1;  3ULJ A;  1SFO H;  5GAD C;  4P73 A;  4HJ9 A;  2B63 H;  3CW2 C;  5BR8 L;  1N34 L;  1L0W A;  1IL2 A;  1VQ7 A;  1LTL A;  5C3E H;  3S2D H;  4KLK A;  4HJA A;  4JV5 Q;  3UDX A;  3I2Z A;  4JI7 L;  3FHW A;  4OWW B;  4YY3 L;  4IFD G;  4A3G H;  1K0R A;  4JI4 Q;  1I94 L;  5C4J H;  2JQO A;  4P75 A;  1CKM A;  1QZG A;  1YJ9 A;  1E22 A;  2UU9 Q;  2JEA I;  3M4P A;  5C4X G;  1YJN A;  1MJC A;  2LXJ A;  3UDI A;  3CCU A;  5C0X I;  1HZ9 A;  4GLA C;  4PZ8 A;  4IPD A;  1CSP A;  3B6Y A;  1ASZ A;  1N34 Q;  2ZTD A;  1OTC A;  3NEN A;  4A3B G;  2CWP A;  5HY6 A;  4A3E G;  3W1G A;  3S17 H;  4DV3 Q;  2Q2I A;  3KF8 B;  4JI6 Q;  2CKZ B;  3GD7 A;  3DM3 A;  4R4C A;  1D7Q A;  1PH7 A;  4LUZ A;  2R93 G;  3G4S A;  1I94 Q;  1L1O A;  1QVC A;  4AQY Q;  3WWV A;  2QEX A;  4A3G G;  1FJG L;  1KXL A;  4OX9 L;  4ME3 A;  4IJL A;  3J80 c;  4JI5 Q;  2N3S A;  2RF4 A;  3KOJ A;  3K7A H;  4YWM A;  2Q2U A;  2CCZ A;  4IPH A;  4MZ9 A;  1QZH A;  4BBS H;  1XMO L;  4BXX G;  3W1B A;  2A8V A;  1VQP A;  2DUD A;  5IP7 H;  1PFS A;  3CC4 A;  1KQS A;  4GOP A;  4A3K G;  5E7N A;  2Q2T A;  4B3M L;  2YU9 H;  2R7F A;  1HNW Q;  3KF6 A;  5FLM H;  1BBU A;  2NVX H;  1E1T A;  1B8A A;  1IXR A;  4C3J H;  1D8L A;  4OX9 Q;  2YV5 A;  2YTX A;  3EN2 A;  4GNX B;  5FJ8 G;  4LNQ A;  4RG1 A;  1VQK A;  3M9B A;  3PF4 A;  1IBK L;  3RR5 A;  2R93 H;  1HJP A;  1YHA A;  1VQM A;  1XMQ Q;  2IHE A;  4HIM A;  3HOY H;  3S16 H;  1UE1 A;  1L2F A;  4QY7 A;  4XIG S;  1TWG H;  4BA1 I;  4DR1 L;  3G6E A;  5GRO A;  3HOV G;  4A3F G;  4JI0 Q;  1HZB A;  1K3R A;  4O0A A;  4JI3 L;  3STB C;  3I4N H;  4BBS G;  2WAQ E;  3KJP A;  4EQ5 A;  3U58 A;  4LF8 L;  1OXV A;  2GN5 A;  1PH2 A;  1JB7 A;  5IYD H;  4L5S A;  1Z47 A;  3RNU A;  4A3K H;  2UUB Q;  5JJL A;  1EIY B;  1VQ5 A;  2Z0S A;  3CD6 A;  1N36 Q;  3CCE A;  4JI7 Q;  4JBW A;  3L2P A;  2YTV A;  1GO3 E;  5FJ8 H;  4LFC L;  3PUX A;  2RHQ B;  4DUY L;  3HOW H;  3NEM A;  4C3H H;  1HNW L;  1MJE A;  4DV1 Q;  3J80 i;  4GLX A;  4X62 Q;  1S40 A;  4IFD J;  1VQ4 A;  2N78 A;  4A76 A;  2F4V L;  1EFW A;  5DLQ E;  4UP8 A;  3PUV A;  2ID0 A;  1EQR A;  2VUM H;  3OW2 A;  4DV6 Q;  2NN6 G;  3I7F A;  2ZJQ A;  1A63 A;  3EIV A;  4A3F H;  3TRE A;  3CC2 A;  1PV4 A;  1XNQ L;  5LMN W;  4TVA B;  5JJK A;  2E2I H;  2NVT H;  4GOP B;  1RL2 A;  2MQH A;  1EWI A;  4LF5 Q;  3JC6 6;  4JG2 A;  4DUY Q;  2UUC Q;  4BY1 H;  3HOZ G;  4YCW A;  4X6A H;  3CCS A;  4JI1 Q;  3PSI A;  4YWL A;  4B3T L;  1KD1 C;  2JA8 H;  2A19 A;  1XPU A;  2C35 B;  4UP7 A;  2HIX A;  2E5L Q;  1VQC A;  1VQF A;  2YYZ A;  1JT8 A;  1VQA A;  1Y1V G;  4DR2 Q;  1E24 A;  5GAE C;  2CQO A;  2YTY A;  1YJW A;  4JYA L;  3A5Z B;  2B3G A;  1TWH H;  2N8N A;  4R4I A;  3U4Z A;  5C44 G;  2JA9 A;  4DR5 Q;  4A3M H;  2UXD Q;  5H1S E;  1TWC H;  4X64 Q;  2R92 H;  1S72 A;  1HNZ Q;  2VNU D;  1UE7 A;  2UUB L;  4PZ6 A;  1TWA H;  3AQQ A;  5GQO A;  2EIF A;  1C9O A;  1SE8 A;  1IBM Q;  3CXC A;  1JMC A;  4BBR G;  2EXD A;  4B3S Q;  2AMC B;  4R4T A;  2WFW A;  2Z6K A;  1PHJ A;  1CKO A;  4NXM L;  1XNQ Q;  1V1Q A;  4MNO A;  4YCV A;  3T1H Q;  4R4Q A;  3M85 A;  1WCM G;  2JA8 G;  1I6H H;  2Z6K C;  3F2D A;  2ZM6 Q;  4A3B H;  4A3I G;  4JI3 Q;  3JAM c;  4A3E H;  5JEA G;  4LF9 L;  1WI5 A;  2JEB I;  1UWV A;  2Y0S E;  3MXN B;  5ELN A;  4QQB X;  3T1Y Q;  1PH5 A;  5AJ3 L;  3I4O A;  1AH9 A;  4A3C H;  3RLO A;  3CCM A;  3TS0 A;  1Q1B A;  1X3E A;  1J5E L;  2D62 A;  2I0Q A;  4A93 H;  4A3D G;  3ULP A;  2IX1 A;  1HNZ L;  1X65 A;  3J81 c;  2MO0 A;  4A3M G;  1NMF A;  4TQU S;  1A8V A;  5IWA Q;  3F1Z A;  4IFD I;  4X65 L;  4DV2 Q;  3J7A 5;  3M7N A;  1NY4 A;  1Q12 A;  1X3G A;  5M3F G;  2PQA B;  4BBR H;  3HOX H;  2GVB A;  4GKK L;  3UDF A;  5AJ3 Q;  2ZM6 L;  3GDE A;  3PUY A;  2JA6 H;  1VQ9 A;  1UE5 A;  1FVI A;  2E5L L;  2XGT A;  2Y0S G;  4OON A;  2DGY A;  4JI8 L;  4HIO A;  4A3J G;  3UE1 A;  1WOC A;  2Q2H A;  2VL6 A;  2WB1 G;  2VZA A;  4YWK A;  5HGQ A;  3T1H L;  1PH9 A;  4XTC S;  2BH2 A;  4WJ3 M;  2K4K A;  3G48 A;  1NE3 A;  1CKN A;  3KF6 B;  4LFA L;  1Z9F A;  4OWT B;  2UXD L;  1IZ6 A;  4HID A;  3GTG H;  4X64 L;  1HZA A;  4IOC A;  4GNX A;  1E1O A;  3CP0 A;  3PIO A;  1JJG A;  1G6P A;  4KHZ A;  3KFU A;  3S24 A;  4JI8 Q;  2CWA A;  1PYB A;  1Y14 B;  4LUO A;  4DV3 L;  3S2H H;  2OWO A;  3H15 A;  2KEN A;  1HZC A;  3H3V H;  1VQH A;  3HOU H;  3I4N G;  3M4O H;  4LF7 L;  3HOX G;  3K0X A;  3A5U A;  1X55 A;  5LMN Q;  4GKJ L;  2I5H A;  3K80 C;  4JC0 A;  4DAY B;  1VQI A;  5GAG C;  2ZTC A;  2VQF L;  4DR4 Q;  1X3F A;  3NEL A;  5M5X H;  2I5L X;  4JI5 L;  1Q82 C;  4DR7 L;  3BZK A;  1LM0 A;  5C0X G;  3L7Z C;  4DR3 L;  2CFM A;  1XPO A;  3CC7 A;  4HJ5 A;  4AQY L;  1HNX Q;  3CCV A;  5LMU L;  3S14 H;  4JBM A;  1EYG A;  1R9T H;  1VQB A;  5IP9 G;  4QGU A;  1KRT A;  2JA6 G;  3E9H A;  2ZJR A;  1YBY A;  4DV6 L;  3H3V I;  2H5X A;  2HQL A;  2VQE Q;  4AYB G;  1YVC A;  4NXM Q;  1K73 C;  1EQQ A;  2PQA A;  2NZO A;  4R1J A;  5ELO A;  1X9N A;  4DV7 Q;  2BA1 A;  5IYB G;  2F4V Q;  1OXT A;  4PZ7 A;  1Q81 C;  2R6G A;  2JA5 G;  4POG A;  1BBW A;  3GTQ H;  3STB D;  2ZTE A;  1HNX L;  4YCU A;  2ATW A;  4KHP L;  1QVG A;  4A4I A;  1P16 A;  4OXP A;  2AWO A;  2KHI A;  3RLN A;  4DR4 L;  2HT1 A;  3UE0 A;  3RZO H;  3J81 i;  1A62 A;  4EX5 A;  1U5K A;  1EIF A;  4JI0 L;  1SN8 A;  4IOA A;  2OQ0 A;  1VQE A;  4APV A;  1SMX A;  2D0O A;  1ASY A;  4B3T Q;  1C0A A;  3CCQ A;  2UXC Q;  2ZJP A;  4KHP Q;  5J3B A;  3VDY A;  3I56 A;  5IYB H;  1IBK Q;  2MO1 A;  3OTO Q;  3S15 H;  3KJO A;  1HH2 P;  1K8A C;  4HIK A;  3GO5 A;  4NXN Q;  4GN5 A;  1EOV A;  4DV0 Q;  2K52 A;  4UY8 C;  4K0K Q;  4JBJ A;  1N9W A;  4DKA C;  4JOI A;  5FLX c;  3GTM H;  3CCJ A;  3FP9 A;  3HOW G;  4JI2 L;  1PH8 A;  3RN2 A;  1X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...