4JI7Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7Q00
3CPFA 4HJ7A 4IOCA 1E1OA 4C3JH 4C3HH 1IBKL 4KLKA 1N32Q 1HNZQ 2K5VA 5LMNL 1PH1A 4BBSG 5IE8A 1PH5A 1LM0A 1BKBA 1Z47A 3M3YH 4NPSA 2A8VA 4JYAL 1SR3A 4LFBL 4H02A 3F2DA 4DR2L 4KHPL 4DR4Q 4LFCQ 2HHHQ 3CW2C 1VQEA 4YWKA 3CCMA 3GD7A 3OW2A 1XPOA 1PH4A 5FJ8G 1EQQA 4POFA 5FLMH 1MJCA 1Q1BA 4JOIA 1Y1WG 1I5FA 2H5XA 4A3JH 1SN8A 4B3ML 1OXVA 2YTXA 1SRUA 2RHSB 3L7ZC 2I0QA 4GKKL 1Z9FA 3NENA 4P75A 3TQYA 5JEAG 4OX9L 4DV1Q 1I94Q 3S2HH 1XTDA 2JA5G 2OQ0A 1TWAH 2HIXA 4PZ6A 2HQLA 4DUZQ 5IYBG 5C0XI 3I56A 1HR0L 4LF6L 1YIJA 3PF4A 1Y14B 4P72A 4DR6L 1B7YB 4NB3A 1V1QA 2MO1A 2EIFA 3HOZH 4WJ4A 5GAEC 3WWVA 3HOXG 2VL6A 3VDYA 2L15A 3GTMH 4AQYQ 3I4NG 3UE0A 4UY8C 4IFDJ 2Z6KA 2NZHA 1YHBA 3LGJA 2OWOA 3Q8DA 3DLLA 1EYGA 1U5KA 1K73C 2IX0A 4LF8Q 3GTKH 5JJIA 4QJFA 2NN6G 4HJ8A 5LMNW 4A3DH 2D62A 3D31A 2K50A 2MFIA 4IFDG 4EX5A 1NE3A 3J7A5 3D0FA 3STBD 4Y7NH 2UU9Q 5GADC 1YJ9A 4JI0L 4R4TA 3TEHB 3UDXA 2Z0SA 3NELA 4GLVB 4DV6L 3M7NA 2DGYA 3RZOH 2UXCL 1HZBA 1TWCH 2OTLA 2ID0A 3GO5A 3H0GH 4BY1H 4LF4Q 1XNQL 1A63A 1VCIA 2VNUD 3GTOH 2CFMA 3E9HA 1M1KC 2F3IA 1KRTA 4A3EH 3G48A 2F4VQ 1G6PA 3GTPH 2ZM6L 3UDIA 2K4KA 3E9IA 4R4CA 1UE5A 1X55A 4DAMA 1VQBA 1WCMG 3OTOQ 2JEBI 1XMQQ 1KRSA 2VQEL 1HR0W 2B3GA 3KF6B 4LW1A 2R6GA 2E2JH 4IOAA 1IBML 1GVPA 1N33Q 1YJNA 2ATWA 3ULLA 5IYDH 4DV5Q 4JV5Q 2VZAA 4JBMA 1AE3A 5GROA 1Y1VG 3CC4A 1C0AA 1D7QA 4NXML 1A8VA 3I55A 1VQ6A 1YBYA 4P71A 1JB7A 3H3VI 2N78A 2VUMH 4DR1Q 3CCEA 2E5LQ 3ULPA 1XNRL 3CC2A 4L5RC 1WI5A 4MZ9A 1HH2P 2NZOA 1L0WA 1PV4A 1IBLQ 5IWAQ 2R7DA 5IP9G 3U50C 2Q2HA 2ZJRA 3PO2G 3BU2A 4O2DA 4BXXG 2C35B 4DV2Q 1PYBA 2CQOA 4IPGA 2VY3A 4DKAC 5BR8Q 5HGQA 5IT9c 3HKZE 1KAWA 4JC0A 4DR3Q 4JI7L 4DV0L 2JA6H 3NBHB 3T1YQ 4QGUA 1I50H 3PV0A 3CCQA 1XMOL 2K5HA 4L5TA 4X62L 1PH6A 1YNXA 2KCTA 2WB1E 3PUWA 1YI2A 4ME3A 4DUYQ 2UUCL 4JI6L 4LWCA 5DLQE 3GTJH 3K7AH 2OCEA 2JA8G 2NVTH 4A93H 1JJGA 2IHEA 2XGTA 1VS0A 2WAQG 1UE1A 4A3FH 1QVFA 3J81j 1Q1EA 4JI5Q 4A3MH 3KDFB 4LF5Q 1RL2A 4MNOA 5ELNA 3S2DH 1CKMA 4B3SL 4DV3L 2B63G 3PUYA 2AMCB 2ZTDA 4JI1L 2ZJQA 2OTJA 2NN6I 2RCNA 5IY0A 1YJWA 3HOWH 2BH8A 2Q2IA 3M4QA 5IP7G 2KHJA 3GTQH 1VQJA 1NY4A 4JOIC 3H15A 4IFDI 3PGZA 3CCUA 1SLJA 1S72A 4BBRH 1C7YA 4LNQA 3S15H 4YCVA 1HZ9A 1UEBA 1ASZA 1Q86C 3G4SA 1VQ4A 2DUDA 1JJ2A 4LUOA 1N9WA 4P74A 5GAGC 5IYCH 4GNXA 1N36L 1P16A 1PH3A 4NXNL 2UXBL 3PIOA 2R93G 1K83H 2K5NA 4LUZA 3M85A 1EFWA 4UP7A 3K81C 2K52A 5M3FH 1Q81C 1HNXQ 4LF7L 1J5EQ 1EIYB 2WAQE 1LYLA 1S3OA 1Q12A 4JI8Q 3FKIH 4DV5L 1TWHH 4JG2A 4OXPA 2UUAL 4GLXA 4O0AA 4X66Q 3KLWA 5M3MH 2UUBQ 3ULJA 4JBKA 3EN2A 3NEMA 3U58A 1UWVA 1X56A 1E7ZA 3F1ZA 1V43A 4JCVE 1C9OA 1HZCA 4HJ5A 4PZ8A 1K8AC 2R92G 3KF8B 2JA7G 1IL2A 5C4JH 3UDGA 1JMCA 3GTLH 4DR5Q 3I4MH 3TRZA 4YCWA 4YHHL 1AE2A 1HJPA 5C4XG 2UXDQ 1VQDA 4AYBE 1VQKA 4WJ3M 1OXTA 3M4OH 4YY3Q 2I5LX 1YEZA 4X65L 4KHZA 4JI4L 3CD6A 4OWWB 2Y0SE 4AIMA 2BH2A 1X3EA 2QGQA 2CWPA 2K14A 4A3KH 2Q2UA 2IX1A 4HIMA 2IT1A 3H0GG 4PG3A 4DPGA 4JI3Q 1IYJB 1B70B 5E7NA 2AWNA 5AJ3L 1VQ7A 4L5SA 2NVXH 4A3EG 3DM3A 3PCOB 3S16H 1CUKA 2PNHA 1EIFA 1L1OA 4LF9L 1N34Q 4OWXB 1WOCA 3A5UA 1GKHA 3T1HL 1W2BA 4B3RQ 4QQBX 3PF5A 4DR7Q 2N49A 3AQQA 4A3CG 1QZGA 4UP8A 3J81i 5GAHC 2VQFQ 1GM5A 2JA5H 3K80C 4B3TQ 4DV7Q 1PYSB 4XTCS 1HNWQ 4Y52H 4GLAC 2YTVA 3A5ZB 5LMUQ 1AH9A 1QVCA 4QIWE 3W1BA 3HKZG 1KD1C 1N32L 1HNZL 3KYHC 3CP0A 4R4IA 5H1SE 1J5EL 4LF8L 1X9NA 1BBUA 1LUZA 3CQZH 4X64Q 1CKOA 3CF5A 1FVIA 2BA1A 4IPDA 1KC8C 4GKJQ 2IHFA 3CC7A 3BZCA 1TWFH 5C3EG 1VQ5A 4UPAA 3M4PA 2WB1G 1L2FA 4DR4L 4PMWA 4A4IA 4OO1G 4C3IH 3EIVA 4LFCL 3STBC 4IO9A 3FP9A 4GN5A 3RLNA 1NJIC 2HHHL 3HOVG 2VS1A 1PHJA 4K0KQ 4HJAA 4GOPA 4LFAQ 3KJOA 2LSSA 1IZ6A 3SGIA 2QEXA 2GVAA 1TXYA 4HIDA 3S1NH 3K8AA 3ICEA 4BA2I 1Q8KA 4DV1L 4UP9A 1I94L 3JAMi 2AWOA 1IBKQ 4DK6C 4IPHA 4DUZL 1QZHA 2JA9A 5HY6A 3RLFA 3BJUA 4A93G 4YCUA 4A75A 4BA1I 5C0XJ 2AHOB 4JYAQ 3HOYH 4DR2Q 4A3LH 4KHPQ 1WCMH 4AQYL 3RNUA 4DV4Q 1Q7YC 3FHWA 3F2BA 3RN5A 3PSIA 3HOWG 1K8GA 1VQAA 2ZTEA 3J80i 4RG1A 1W3SA 2LXKA 1YVCA 3F8TA 5C0XG 3G71A 4HIOA 3KOJA 3RN2A 4DNIA 4B3MQ 3PO3H 3B6YA 4BBRG 1YHAA 1MJEA 2V1CC 4OX9Q 1Y1VH 2UU9L 1E24A 2MNAA 3AYHB 5IYCG 4LF6Q 1FGUA 1PH8A 2Q2TA 4P73A 1X65A 4DR6Q 3KFUA 3GTGH 2ASBA 4LF4L 4YWLA 4A3IH 5M3FG 1BBWA 1CSPA 1VQOA 2PMZE 4A3BH 1LTLA 1PH9A 3JC66 4QY7A 2NVQH 2F4VL 4EQ5A 4R4QA 4BXXH 1WFQA 4BY7H 1D8LA 1UE6A 3RZDH 1WYDA 3J81c 5M3MG 1JJCB 1K0RA 3OTOL 1XMQL 3G6EA 3AEVA 2KCMA 3HOUH 4AYBG 5FLMG 2PQAA 4XIGS 4A3JG 3TREA 1N33L 4JI0Q 4RMFA 1E22A 4JV5L 2ALYB 4DV6Q 1QUQA 4A76A 2Z6KC 2Y0SG 1MKHA 1NTGA 2JQOA 2JK8A 3UDFA 1QVGA 2E2IH 4PZ7A 2JA8H 1VQFA 1A62A 3BZKA 3I7FA 4GN3B 1PH2A 3HFZB 4DR1L 2E5LL 2I5MX 2ZM6Q 3U4VA 5C44H 2B63H 2YTYA 3HOZG 4OO1I 1L1OC 1E1TA 2NVYH 3TS0A 2R7ZH 1IBLL 2WFWA 5IWAL 3HKSA 5IP7H 1CSQA 2VQEQ 2XTIA 1P8LA 4DV2L 4A3KG 4YWMA 5BR8L 3S24A 3CCVA 1IBMQ 2MO0A 3S17H 4GS3A 4DR3L 3JAMc 3CCSA 2I5HA 4IPCA 3EBEA 3T1YL 4A3DG 1VQGA 3KF6A 4BBSH 1X3GA 3CCLA 2ZJPA 4ALPA 5JEAJ 3TS2A 2D0PA 2GVBA 4C2MH 4DV4L 4NXMQ 2A1AA 2R93H 1J6QA 2FXQA 4R4OA 4DUYL 2JEAI 1XNRQ 4MTNA 5K36G 4BY1G 3A74A 3H3VH 4LUVA 2BA0A 5JJLA 3MXNB 4JI5L 3PUXA 3CXCA 1SFOH 1VQMA 1IXRA 3J80c 1VQ8A 4LF5L 2HT1A 1OXUA 2A19A 2K75A 2LXJA 1KQSA 3S14H 1VQLA 3F2CA 4JI7Q 2CKZB 3ZJYC 5FJ8H 4DV0Q 1Y1WH 4GOPC 2MQHA 1XPRA 2HIVA 1N8RC 1XMOQ 1XPUA 2ES2A 4L5QA 1K9MC 1OXSC 2OQKA 1H95A 4HJ9A 4GNXB 2ZTCA 3AFQA 1PH7A 4X62Q 2R92H 2JA7H 5IYDG 4JI2Q 1M90C 1K3RA 2UUCQ 1VQCA 4JI6Q 1CKNA 1EUJA 1HZAA 1FJGQ 5IYBH 4J15A 1E3PA 3MEFA 3U4ZA 2PQAB 5C4XH 1R9TH 2EQSA 1YZ6A 1VQPA 5M5XH 1SROA 1GD7A 3L0OA 1QUQB 1A0IA 2VUMG 1HNXL 2KENA 3HOXH 3PUVA 3OYYA 4B3SQ 4DV3Q 3I4NH 4JI1Q 4APVA 2CCZA 4JI8L 1Q82C 3M9BA 4DAYB 2AKWB 3KDFA 4TQUS 1G51A 4IJLA 3UE1A 4A3GH 1TWGH 4DK3C 1OTCA 4X66L 1JT8A 2R7FA 4JBWA 2UUBL 3KJPA 3CAMA 4OONA 1S40A 3GDEA 2JA6G 2KBNA 1KXLA 3RR5A 4X6AH 1VQIA 2WP8J 4IJHA 3HOYG 5M5WH 1PFSA 1VQNA 4A3LG 2UXBQ 1RIPA 2VW9A 1N36Q 3PUZA 4NXNQ 1G291 5J3BA 4HIKA 1NMFA 3S1RH 3CPWA 5LMNQ 4DR5L 4LF7Q 4A3CH 1EWIA 3ERSX 1EOVA 1FL0A 3PO3G 3CMAA 2PI2E 2PI2A 4KI0A 2YV5A 2UXDL 4A3FG 3CCRA 4FDBA 2UUAQ 1DGSA 4YY3L 2F52A 4LFBQ 4A3MG 3I2ZA 4GNXC 1X54A 3K0XA 5ELOA 5JJKA 5FLXc 4OWTB 3S1QH 1YHQA 5EAYA 4JI3L 4A3IG 5GQOA 3W1GA 1L1OB 1WJJA 2JJQA 4AH6A 1NMGA 3CMEA 1JE5A 4POGA 4A3BG 2YYZA 4R1JA 4A3GG 4GKKQ 5C3EH 1XJVA 1Q46A 2E8GA 1X3FA 1VQ9A 1T9HA 3L2PA 1PVOA 1PA6A 3HOVH 3K7UC 1SE8A 1N34L 1HR0Q 4BY7G 1I6HH 4YHHQ 4TVAB 3PIPA 2QA4A 1EQRA 4B3RL 4DR7L 2D0OA 3E0EA 3HOUG 1ASYA 4GN4B 1NBWA 1CKNB 4X65Q 1KHIA 1O7IA 4JI4Q 2KHIA 5IP9H 3PO2H 3RLOA 2VQFL 4JI2L 1I3QH 3FKIG 3ER0A 3AFPA 4B3TL 4DV7L 1FJGL 1VQHA 1HNWL 2CWAA 3W5OA 5LMUL 1B8AA 1MIUA 5M5YH 2IY5B 5AJ3Q 2JE6I 3S1MH 2YU9H 2E2HH 1UE7A 1V9PA 4JBJA 1KL9A 5C44G 1KIXA 4LF9Q 4X64L 3I4OA 1OXXK 3CCJA 2EXDA 2R7ZG 2UXCQ 4GKJL 3T1HQ 2N3SA 4GOPB 3IRBA 2RHQB 1XNQQ 2RF4A 4K0KL 1X6OA 3I4MG 4QL5A 4LFAL 1U0LA 1YITA 1SMXA 2B29A 3J7ZC 1GO3E 2GN5A 2N8NA 1BVSA 3A0JA
chains in the Genus database with same CATH superfamily
4HJ7A 1E1OA 1KNAA 4ILWA 1HNZQ 4F88A 5CMDA 4BBSG 3S1NB 1Q90A 1LM0A 1SR3A 4LFBL 4H02A 3DM1A 4M8AA 4UHVA 1PH4A 4RCOA 4POFA 5FOBB 4A3JH 1WCMB 4K6LA 2I0QA 4GKKL 3SR1A 5JEAG 2B2WA 1PFNA 1E2ZA 1DOMA 4O42A 4RFBA 2HIXA 5C0XI 1D1KA 4V0BA 1MBYA 3PF4A 1Y14B 2L9HA 4P72A 4DR6L 1U4PA 1S5FD 3S2DB 3I4NG 2FFKB 4UY8C 2Z6KA 3NK9A 1LTGD 3GTGB 3Q8DA 2IX0A 3D4DA 5ELDA 1B9MA 4HJ8A 1WTQA 2NVQB 3T4AC 3D31A 5D3DA 2K50A 2MFIA 3TZUA 1YNJC 2B8GA 3D0FA 4ZCKA 1E2WA 4BY7B 3M7NA 3RZOH 1LLRD 1HZBA 1IW7C 3SHLA 2ID0A 3H0GH 2K33A 3GO5A 1SYBA 1M1KC 3MXPA 3GTPH 3UDIA 5EKLA 3E9IA 2C9OA 5ELEA 1VQBA 1ENCA 1A6XA 3OTOQ 2JEBI 1ILQA 2E2JH 2XNAC 1N33Q 4WFN3 4DV5Q 3BYYB 1QE6A 5KIXA 1C0AA 2R3ZA 2A73B 1VF5C 1F9QA 2N78A 2VUMH 3BVMA 4MZ9A 4N8X1 5IP9G 2Q2HA 4O2DA 4BXXG 2C35B 1PYBA 5IT9c 4DR3Q 3S16B 1SFOB 3S14B 1NAPA 3GP7A 1I4GA 2KCTA 1ILPA 1WD1A 1YI2A 1SBBB 4LWCA 1ONLA 2M9VA 2NVTH 5I6YA 1JJGA 2Z1CA 4A3FH 3J81j 1Q1EA 4CHTB 3S2DH 1CKMA 4B3SL 2AMCB 4JI1L 3D4WA 2RCNA 1YJWA 2BH8A 1ENFA 3I73A 4KJNA 1NY4A 4JOIC 4IFDI 1NUCA 1S72A 3RUZA 4BBRH 3I4NB 2JP1A 2FJ2A 2Z4HA 1ASZA 1JJ2A 1O7YA 2BDNA 4LUOA 5GAGC 2UXBL 1N36L 4NXNL 4K8IA 2R93G 1EFWA 2IJ0A 3NTHA 2WAQE 4DV5L 2I07B 3D8GA 4O0AA 3GQBA 1ICWA 5CYUA 3VYSA 4PQXA 2F0KA 3NEMA 3U58A 2KHSA 1X56A 1E7ZA 5JJZA 1V43A 4JCVE 2RSNA 5IGFA 3HKZB 4HJ5A 2JA7G 1CK1A 2CW0C 3DWPA 2B8FA 1JMCA 1HA6A 2B2TC 3TRZA 3MA2B 1IHZA 2KUMA 1YEZA 2SDFA 2Y0SE 2HDMA 4XQQA 4BBSH 4HIMA 2IT1A 5E7NA 1H9RA 5G3LD 5AJ3L 4DK0A 2NVXH 3PCOB 3S16H 2R61A 1XTCD 1L1OA 2AQ2B 3Q22A 5M5YB 4KD4A 3T1HL 4B3RQ 2EY1A 1K3BC 5JEAH 2Z8LA 2P5ZX 5GAHC 5KGUA 1G91A 4OGQC 4EQOA 4B3TQ 2I46A 4DV7Q 1HNWQ 1SYCA 2D5DA 2EYLA 5H1SE 3CP0A 1V1PB 4R4IA 1I4RA 3A55A 1X9NA 3D6WA 3I72A 2AUJD 4DR4L 1YNND 2HHHL 4XDXA 3HOVG 1NJIC 2MGSA 4HJAA 1EQVA 3CRLC 3M3YB 1IZ6A 3SGIA 2QEXA 2GVAA 1T5XD 1D1IA 2ICEC 3NUCA 1BBXC 1EY8A 4DV1L 1I94L 4CJ1B 2AWOA 5I6WA 4IPHA 4DUZL 1TY0A 1R4QB 5HY6A 4A93G 3BJUA 4A75A 3S9WA 4BA1I 5C0XJ 4K2KA 3NPPA 4OL7A 3P20A 5KYLA 4XXEA 4DNTB 1K8GA 1W6JA 3D3RA 4QMGA 1W3SA 1B9NA 5C0XG 2KA7A 3PO3H 1SEBD 2J7ZA 4DNIA 3K0YA 4IQZA 1HQMC 1MJEA 2V1CC 4KTAA 3TZDA 1JR0D 1KDBA 1D2BA 1CSPA 2PMZE 1NSNS 4QF4A 2IWHA 2F4VL 3OPOA 4EQ5A 4RAUC 1TWCB 2DNEA 4BXXH 1JWUD 2DNCA 3EJIA 2RDFA 1JJCB 1XMQL 3GTOB 1Y8PB 2KECA 2L55A 3AEVA 3OWFA 5FLMG 3Q0AA 2FHTA 1E22A 4JV5L 2ALYB 1O78A 1MKHA 1NTGA 1U4RA 2Y0SG 1EEID 4PZ7A 4KKUA 1SNQA 1A62A 3BZKA 4GN3B 4HN7A 2EXZA 1I4XA 3HFZB 2ZM6Q 5C44H 1JE4A 2PPBC 1O7ZA 3TS0A 1D5MC 1AP0A 2QILA 3E6ZX 5HGTA 4HMIA 4DV2L 1BDOA 4YWMA 3S24A 1RF2D 1EY9A 4GS3A 1A15A 4N9TA 5FO9B 1HTPA 4B9WA 3CCLA 1DONA 1EQTA 2K1BA 2D0PA 2GVBA 4FF3A 3TS2A 2A1AA 2JA6B 2R93H 1K8MA 1I50B 1BUVT 2JEAI 1YNJD 3BDCA 1XNRQ 4BY1G 3A74A 5D65A 2QKIC 5JJLA 3MXNB 3PUXA 1IW7D 4RHRA 1IXRA 2D2CC 2A19A 3ERQA 1KQSA 3K7AB 3A56A 1VQLA 4A93B 2B2VC 3F2CA 2K5WA 5FJ8H 4DV0Q 3OMGA 1ZXTA 4GOPC 5A2QE 2A6HC 2ES2A 1S5ED 3AFQA 3NBHA 4HSVA 4N8FA 4K2LA 4X62Q 5IYDG 2NWGA 4JI2Q 1PH7A 2JA7H 1CKNA 2XIWA 1E3PA 3BYTB 3MVVA 2EQSA 3HG9A 2F0JA 1SROA 1KDCA 1AEXA 1A2UA 5AFWA 3NXWA 4DAYB 2E76C 1K83B 2Q8RE 3KDFA 4TQUS 4KK7A 3UE1A 1X3PA 2UUBL 1PRTB 1R4PB 5JPNC 3KJPA 2DJFC 3GDEA 1KXLA 1MHWC 3HOYG 4A3LG 1GUSA 4HIKA 1LO5D 4DR5L 2FINB 1STEA 1EWIA 2FMMA 2G9DA 3A7AB 4ULLA 3CMAA 1LT6D 2PI2A 4KI0A 1H9KA 3CCRA 5C4JB 2F52A 3NQTA 3K0XA 5JJKA 3R2TA 4OWTB 3AU7A 4JI3L 1LTAD 2F3VA 4A3IG 5KRUA 5GQOA 3W1GA 3CMEA 5TSSA 4A3BG 1JE5A 1XJVA 1BR9A 3ND8A 1CQFA 3L2PA 3MXGA 3HOVH 1HR0Q 1I6HH 4YHHQ 4G4KA 3BDOA 4DR7L 3HOUG 1ASYA 1NBWA 5CV9A 1CKNB 4JI4Q 1LT4D 2KHIA 3CRKC 3VYUA 4JI2L 4RA8A 1IYUA 1VQHA 3QOLA 3VYRA 2PZWA 2IY5B 4QCLA 2JE6I 3S1MH 2YU9H 2ZXPA 2XN9C 4DXFA 3BS1A 2R7ZG 4GKJL 1PYWD 2RHQB 5HURA 2RF4A 5LHY1 2B2YC 4KV6A 1CHPD 3DXJC 1TS5A 2EJMA 3C2PA 3I4MG 4QL5A 2CW0D 1SMXA 1GO3E 2GN5A 5FLXc 2F0DA 3CPFA 4MTKA 1CM9A 1GUGA 5IODA 1ESRA 4KLKA 2N88A 4IURA 1EWCA 3H3VC 1EIGA 3QJYA 5KNBA 4XQJA 1Z47A 4NPSA 3G7LA 2A8VA 4DR2L 1GXDC 2K5QA 4CKBA 4LFCQ 3CCMA 1VQEA 4NDXA 3P75A 2EYPA 2F0GA 1RTNA 4RGNA 1XPOA 5FLMH 4NW2A 1Q1BA 1Y1WG 1I5FA 3HOYB 1SN8A 4B3ML 5FLXE 1SRUA 3L7ZC 2O4XA 1H9JA 1V8QA 1ZYRC 2QCPX 3NENA 3MEHA 5E4XA 5JVH3 2JA5G 4XYOA 4M1UB 3GTJB 2E2HB 1HR0L 5IYBG 4LF6L 2PMZB 4ZK9B 5CGKA 3NWTA 2HCIA 4KD3A 4WJ4A 3OHXC 5GAEC 4N9PA 3WWVA 3HOXG 1IYVA 4AQYQ 1J9OA 3MAQA 2NZHA 2OWOA 5EJWA 1EYDA 3DLLA 4A3IB 1EYGA 3SVMA 5JJIA 2Q8IB 4A3BB 5ELFA 4EX5A 4E6IA 3HGBA 1EY5A 3RZDB 2JSOA 1JOQA 1IKLA 3TEHB 3UDXA 2Z0SA 4GLVB 3A7LA 4PV1C 2K05A 4DXGA 2B39A 3HOUB 4BY1H 1SNPA 4LF4Q 4CDDC 5E3FA 1A63A 1VCIA 3J7AF 1EY4A 4ZUIA 2F3IA 1QCBD 1KRTA 4A3EH 3G48A 4R8NA 1KAAA 1AN8A 1F2YA 4R4CA 1WCMG 2RA4A 4LJZC 2VQEL 1HR0W 2B3GA 1JCKB 2OEOA 3KF6B 2RDGA 4LW1A 4IOAA 1M4VA 3SK4A 2NVYB 3QO2A 4DFAA 2R7ZB 5F2DA 5IYDH 3ULLA 2VZAA 1H9MA 5GROA 1BOSA 1Y8NB 1D7QA 2RSOA 1JB7A 2E5LQ 1K0SA 1DM0B 1WI5A 4KN4C 1HH2P 2NZOA 1L0WA 2R7DA 3TP8A 2ZJRA 3BU2A 2F4IA 4Q5VA 2CQOA 5HGQA 2VY3A 4DKAC 2ATWA 3HKZE 1KAWA 3KF8A 1TR5A 1XMOL 4ZYSA 4L5TA 2KVMA 4G7ZC 1PH6A 2WB1E 4EVOA 1Y1WB 4DUYQ 4JI6L 1JWSD 3GTJH 2B2UC 1NR4A 2JA8G 2XGTA 2R92B 5J39A 1UE1A 4JI5Q 2K28A 5DAUA 5ELNA 5D3IB 4DV3L 2B63G 2O2LD 1TIID 2EJGC 5C4XB 2OTJA 2NN6I 2F0LA 5K5PA 5KYIA 3M4QA 4C3JG 1KDAA 2KHJA 4C3HG 2M2LA 3EFXD 3H15A 2K01A 3HOXB 3CCUA 1OO9B 4LNQA 1XX8A 4FF1A 3PIP3 1HZ9A 4A3GB 4DNRB 4P74A 4OEMB 5IYCH 2HD3A 1P16A 4C56C 3PIOA 5ELBA 2K5NA 3K81C 2K52A 4FXKC 1I4HA 5M3FH 1HNXQ 1F9PA 1KTKA 4LF7L 1EIYB 2RDHA 1U4MA 1Q12A 4JI8Q 1TWHH 4H44C 4Q0FA 1GUOA 2LMCB 4C1NI 1FNWA 4X66Q 3KLWA 5M3MH 4TSSA 4KKTA 1FD7D 2PW7A 2MHVA 5EBCA 1DCZA 3QOJA 3QR8A 3F1ZA 3FVQA 3KF8B 3S1QB 3GTLH 2A6HD 3Q24A 4DU9A 3I4MH 5C3XA 1AE2A 1HJPA 1VQDA 4IALA 1VQKA 4WJ3M 1GHKA 4YY3Q 2I5LX 3K5NA 5I2YA 4X65L 1UNSA 4OWWB 2PYKA 2CWPA 2Q2UA 4DPGA 1KNEA 3NTIA 1VQ7A 3F2UA 3DM3A 1CUKA 3NBIA 2F0HA 1EY0A 1N34Q 2EY6A 1DOKA 2EVBA 5K36H 4DA2A 5JAVA 3AQQA 4PMCA 4YIJA 2VQFQ 1GM5A 3ITPA 2JA5H 3TP5A 1TVXA 1PYSB 4XTCS 2JA8B 2YTVA 2VXWA 1AH9A 3W1BA 1A3TA 3HKZG 1HNZL 3ZYYX 2B63B 1BBUA 3CF5A 4X64Q 4IPDA 4C3JB 4C3HB 2IHFA 4GZYC 3HEJA 1A2TA 4UPAA 2F3WA 2WB1G 4A4IA 4OO1G 3BVGA 4C3IH 1HPCA 1STAA 2VS1A 1PHJA 3KJOA 4ZRZA 3S1NH 4BA2I 1SYDA 4UP9A 1IBKQ 3E5SA 4BWGB 1NNXA 3S2HB 4JYAQ 1PZKD 2D9UA 1TWAB 4KHPQ 1WCMH 3RNUA 4DV4Q 1FNVA 3F2BA 3MHBA 3PSIA 1J8IA 3HOWG 2ZTEA 3KLSA 2GA4B 1GOZA 3HOZB 3GTMB 3G71A 1PTOB 1YHAA 4IN3A 4OX9Q 1X3QA 1E24A 4S3SA 3GTKB 5T1GA 4K5WA 5JOBA 2XWBB 1FGUA 1PH8A 5M5XB 1C48A 3GTGH 2F0IA 2EYMA 4YWLA 1II3A 1LTBD 1PH9A 1U9RA 3JC66 4QY7A 1CHQD 1MI2A 2NVQH 5LL6X 4R4QA 4BY7H 3QWNA 1LTID 1D8LA 1UE6A 1QOHA 3OTOL 1K0RA 3R2IA 2F0SA 3WOFA 1ET6A 5A2QL 1N33L 4JI0Q 4A76A 4L8JA 4DV6Q 4QUFA 2JK8A 2BE5C 2PCFB 1QVGA 2HDLA 2JA8H 1VQFA 1DYQA 4J6HA 4KY7A 1ZYRD 1PH2A 3I90A 2I5MX 3U4VA 2B63H 3U9SA 1WTPA 2YTYA 2DY7A 1LTRD 1E1TA 4Z9CB 3I8ZA 1ENAA 3HKSA 5CR3A 1HHVA 2XTIA 4V190 3T16A 5NUCA 4A3KG 1IBMQ 2WIIB 3OOCA 4DR3L 3JAMc 3CCSA 4A3DG 4NMZA 2WB1B 2ZJPA 4ALPA 4DV4L 4NXMQ 5BN5A 4R4OA 1WTVA 1STGA 1G2SA 1PTOF 3PMFA 4LUVA 3H3VH 5EQ0A 3K5LA 1SFOH 3HS0C 3J80c 1VQ8A 2HT1A 3S14H 1QWYA 5C4ZA 1HRJA 1DJRD 4JI7Q 3VR5A 2X6LA 4DK1A 3ZJYC 3MC0B 1A3VA 3JAME 1HQRD 1N8RC 5EBDA 2QW7A 1H95A 1OXSC 3NWSA 4HJ9A 1AW7A 3HOWB 1M90C 1K3RA 2UUCQ 1EUJA 2RQXA 4K6DA 2ENBA 1FJGQ 1DZ1A 3OWEB 3S15B 2K5DA 1VQPA 5M5XH 1A0IA 2KENA 3J80E 3OYYA 3I4NH 3NTKA 5IGEA 4ZLTF 2AKWB 2CVRA 2J4XA 1JT8A 1SXTA 2QDBA 2R7FA 4OONA 4I7AA 4C1NK 2JA6G 3FKIB 4CDFC 2ICIA 1VQIA 2WP8J 1BXTA 2VW9A 2L4NA 3PUZA 3TBIB 4IZ8A 3ERSX 1EOVA 1HA5A 2PI2E 1AFPA 2BCOA 1B53A 2UUAQ 4A3MG 4GNXC 5D14A 2A6ED 2F03A 3H6MA 1YHQA 3M4OB 1L1OB 1B44D 4AH6A 2QF7A 1VF7A 1HFNA 2TSSA 1Q46A 1TY2A 3P7JA 1X3FA 1VQ9A 4A3KB 4OO1H 1E0BA 4I7ZC 1DXMA 2TMPA 3M4YA 4A3DB 2A68C 4TVAB 2QA4A 4B3RL 2D0OA 2RBMA 4Y7NB 5FLXL 5IP9H 1ESFA 4KY5A 1BCPB 4B3TL 4DV7L 1FJGL 3KLRA 1HNWL 2Z4IA 3W5OA 1B8AA 1TS4A 5M5YH 5CBEE 4JPBW 4LF9Q 1OXXK 4ZKCB 2UXCQ 1I4QA 1CFMA 4RGTA 4RHSA 2AUKA 3IRBA 1XNQQ 4ZUJA 4KJOA 3CQZB 1U0LA 4EGVA 3I91A 1BVSA 3RMHA 5CV7A 1VMCA 4IOCA 1NR2A 2JXMB 1N32Q 2K5VA 2HUGA 1SNMA 1PH1A 1SNCA 2L12A 1BKBA 3M3YH 3R93A 1QB5D 3DMUA 2NTSA 3GD7A 2H4OA 1MJCA 4JOIA 2H5XA 1BF4A 1OXVA 1B50A 3ONAB 1I6VC 3TQYA 4CKEA 4PZ6A 2HQLA 4CGYB 3I56A 2BDOA 2C5CA 3R3OA 1Y1VB 4NB3A 1V1QA 2MO1A 5M9OA 4A3MB 2EIFA 1CQVA 4DF7A 2J0TD 3VDYA 2L15A 4J8QA 4IFDJ 1BCPF 1YHBA 4H13C 3GTQB 5JPMC 4LF8Q 4CDEC 3SK6A 1WTHA 2NB0A 4A3DH 2XRSD 2D62A 2NBFA 5I2XA 2MUYA 4IFDG 2E74C 2UU9Q 4Y7NH 1VDZA 5GADC 1EYAA 1G8ZD 2K7VA 2UXCL 1RTOA 4P2CB 1TWCH 1XNQL 2B2TA 2QEJC 3LX0A 3GTOH 1G6PA 1IKMA 2ZM6L 2E2IB 4JVZA 1SNDA 1UE5A 1DD2A 1ICFB 1KRSA 2CH4A 1JC7A 2R6GA 2SNSA 1FGBD 3VA5A 5J1ZA 4HCSA 1A8VA 3S17B 3I55A 1YBYA 4P71A 3H3VI 1RCVD 1EWHA 4DR1Q 3CCEA 3ULPA 1XNRL 3FDTA 3MZ5A 4L5RC 1PV4A 3TN2A 1IBLQ 1A3UA 1STHA 5IWAQ 3U50C 3PO2G 1B4OA 2L0CA 4QUCA 1PRTD 1JQYD 1DOLA 5BR8Q 2F0FA 2JA6H 4JC0A 4DV0L 3NBHB 3T1YQ 4QGUA 1I50H 3CCQA 1SE3A 2LKVA 3SDZA 2NYZD 1CA6A 4X62L 3PUWA 1BQQT 4ME3A 3K7AH 2OCEA 4A93H 5L37A 1VS0A 1PDQA 2EYHA 4A3MH 2BE5D 3KDFB 4LF5Q 1G2TA 1RL2A 2L1BA 4RCNA 5CV8A 3PUYA 2ZTDA 2ZJQA 1R9TB 2Q2IA 3DHQA 5IP7G 3GTQH 1PRTF 5C0XH 3PGZA 1SLJA 2F0UA 4MIUA 5E4WC 1C7YA 2N55A 2B2WC 1KLUD 1UEBA 1TWGB 3G4SA 5IIFA 2DUDA 1D6EC 1VQ4A 4GNXA 1PH3A 1K83H 4LUZA 3M85A 2K03A 5EPKA 1Q81C 1J5EQ 5M5WB 3T13A 1EU3A 1S3OA 4QB4A 4JG2A 4OXPA 1LT5D 3S1RB 4KKSA 3K5MA 2H1EA 3ULJA 3EN2A 1EU4A 2PNRC 3OIQA 1H9SA 1Y69U 2ZXRA 1PTOC 1GJXA 4WRDA 2R92G 1K8AC 1V1OA 5C4JH 3UDGA 5EGTA 1PLFA 1EIHA 2X69A 4YHHL 5C4XG 2UXDQ 4AYBE 5C3EB 1OXTA 1Q8IA 4JI4L 3CD6A 3EQLC 4AIMA 2BH2A 2QGQA 4FNFA 3G6JB 4L63B 2IX1A 2F0WA 1WTRA 4PG3A 3H0GG 5KNCA 4A3GG 3PO2B 1I3QB 3TP7A 1EIFA 3RD4A 4FVMA 4BS9A 4FO2A 4EQNA 2VB3X 4OWXB 5LL6S 1O7LA 3A5UA 4MHEA 4U673 1GKHA 4QQBX 3O13A 3KLSX 3DEPA 3MTSA 4U68A 4HSPA 4A3CG 4UP8A 3A8KE 3K80C 3A54A 3VR6A 5KEEA 5LMUQ 1EFID 2A74C 3KYHC 1J5EL 1Y8OB 1AZPA 2A69C 3MFGA 1KC8C 2BA1A 1S5BD 3BZCA 1MGSA 3BZDB 4PMWA 1D5XC 3EIVA 4LFCL 1F9SA 2B2VA 4GN5A 1H9SB 3FP9A 3STBC 4IO9A 4K0KQ 4GOPA 4JW0A 4LFAQ 4G57A 1WTOA 3MWYW 1AZQA 1TXYA 2F0EA 4HIDA 1EOTA 3K8AA 4XQNA 3ICEA 4ME5A 2K32A 5I9OA 1Q8KA 2A68D 3BVZA 4KHVA 3BG3A 3JAMi 4A3JB 2DY8A 4XT3B 2JA9A 3HRZC 2AHOB 1SDFA 3C3LA 3HOYH 3OMCA 1RHPA 4A3LH 4HCEA 4AQYL 2L11A 5IGCA 3RN5A 1VQAA 3FPPA 3HP3A 3K58A 1SJED 4RG1A 2LXKA 3J80i 1YVCA 3F8TA 2E2HH 3KOJA 1L0XB 1PFMA 4BBRG 2A6EC 3MXUA 1Z6HA 1PFBA 4NKLA 2MNAA 4HAEA 5IOCA 2Q2TA 1X65A 4DR6Q 3KFUA 2ASBA 4LF4L 4A3IH 1BBWA 4A3BH 1STYA 1LTLA 2LS01 4KY6A 2F0QA 4QIWB 3H0GB 3RZDH 2PO4A 1WYDA 3J81c 4LK1C 4KMUC 2MP1A 3JAML 3HOUH 4F8MA 3GTPB 4AYBG 2PQAA 4XIGS 4DN4M 1CZGA 4ZAIA 2JQOA 3UDFA 4IUVA 5COYA 1XWEA 2E2JB 2G5DA 4F87A 3T56B 1CT1D 2E5LL 1SYEA 3J80L 5DM63 1RD9D 3HOZG 1L1OC 2NVYH 5CBAE 1ET9A 2R7ZH 2EYFA 3J81E 5IP7H 1CSQA 5JVG3 2VUMB 1P8LA 3J7AV 2M00A 1EY6A 2KEDA 2MO0A 3H91A 4PNYA 3PIO3 4IPCA 1HTLD 4G7HC 1VQGA 3L3OC 3KUPA 5JEAJ 2XVSA 3FMCA 1JOOA 1RJTA 3Q23A 1J6QA 3SK5A 4DUYL 1BCPC 2IW3A 4MTNA 2RCFA 2B2YA 3C46A 2F0PA 2BA0A 1SAPA 4JI5L 1SJHD 2AQ1B 2K75A 4OELB 3LNNA 2NVTB 3A8IE 4UAIA 2CKZB 4A3FB 1WTWA 1Y1WH 2EZVA 2MQHA 2HIVA 1XPUA 2O5JC 2SOBA 2LY7A 2OQKA 3K6OA 1K9MC 1K8OA 2ZTCA 2R92H 3IL8A 1VQCA 5IYBH 4J15A 4X3UA 3KBGA 3MEFA 4K5XA 2PQAB 3FEWX 3U4ZA 4IUQA 4BBRB 5C4XH 1YZ6A 1SMYD 1U4LA 3K59A 1HNXL 3HOXH 1IL8A 4B3SQ 2OT2A 4K8JA 2XSCA 4JI1Q 2CCZA 4JI8L 1Q82C 4IJLA 4A3GH 1OTCA 4X66L 4JBWA 3N52A 2CH4W 4CBVA 2PZUA 2MPMA 4RKLA 2IL8A 2KBNA 2NZ1D 3RR5A 2G9HD 4X6AH 1VQNA 2UXBQ 1N36Q 5CV4A 4NXNQ 5J3BA 3UI2A 1NMFA 3TDQA 4AYBB 5LMNQ 4NP5A 4A3CH 3QB3A 4MN3A 5DEHA 3PO3G 2YV5A 4X3SA 2F1MA 3SXHA 1DGSA 4YY3L 5BN4A 3K57A 3I2ZA 3WOEA 4FF2A 3S1QH 3PQIA 5EAYA 3NQIA 1QILA 1NMGA 4R1JA 3H09A 1SYFA 2E8GA 2WV6D 5IGBA 3VR2A 4BBSB 1T9HA 1NCVA 1PVOA 4ZKBB 1PA6A 1N34L 1SE8A 1SYGA 4K5VA 1GHJA 5FK9C 2NVXB 1EQRA 3E0EA 1JICA 2LFNA 1PRTC 1KHIA 1O7IA 2VQFL 3L9AX 3FKIG 3ER0A 3AFPA 2AQ3B 2CQAA 2CWAA 2OXPA 5CV6A 1PXUA 1MIUA 5ISRA 4R8IA 4H0LC 5AJ3Q 4FXDA 3H94A 1UE7A 1V9PA 5C44G 1KL9A 1KIXA 4X64L 3I4OA 4IUPA 5IT9E 1QJOA 3MFYA 3T1HQ 1STBA 2WKCA 1S5DD 3URYA 3R8BA 1PTOD 1K28A 1TT2A 4HMJA 1S5CD 2B29A 2EDGA 3J7ZC 3A0JA 4C3JH 4C3HH 1IBKL 2B2UA 2EPBA 2PW5A 4DAVA 5LMNL 5IGDA 5IE8A 1PH5A 1V1PA 4JYAL 3F2DA 5FO7B 4KHPL 4DR4Q 2HHHQ 3CW2C 4YWKA 3OW2A 5FJ8G 1EQQA 3CHBD 2EYOA 2YTXA 2RHSB 3LWEA 1Z9FA 4P75A 4OX9L 4DV1Q 1I94Q 3S2HH 1EYCA 3DEOA 1XTDA 2OQ0A 1TWAH 5C5LA 1PZID 4DUZQ 3PO3B 1MSGA 1O80A 1YIJA 2F0TA 1B7YB 1S4ZA 5CV5A 3HOZH 3OW7A 3GTMH 2VL6A 3GV6A 3UE0A 1PTOH 3LGJA 3V96A 2PQEA 1U5KA 1K73C 3GTKH 4QJFA 1LTTD 2A69D 2NN6G 5LMNW 1LTSD 3K5OA 5IGGA 1KABA 4F7XA 1NE3A 3J7A5 3STBD 4JI0L 1YJ9A 3QIAA 4R4TA 3NELA 1JB3A 4DV6L 2OF1A 2DGYA 3LWUA 3NP8A 2OTLA 1UUPA 2Z6BA 2WINB 4RGMA 5EPJA 2VNUD 2NTTA 2CFMA 3E9HA 1RODA 1EEFD 2F4VQ 1QG7A 2XWJB 2K4KA 4WJWA 1LABA 1X55A 4DAMA 3EROA 1XMQQ 3E3XA 3IAYA 1FR3A 2JN4A 5G3LF 5C44B 2DN8A 3A8JE 1IBML 1GVPA 2DJGC 1YJNA 4JV5Q 4JBMA 2MJ8A 1AE3A 3CC4A 1Y1VG 5I9PA 3IKJA 4IUTA 2EYJA 2F0NA 4NXML 3NHHA 1VQ6A 1HXYD 3CC2A 2KOLA 2R93B 2KCCA 1JORA 2BOSA 2KQ3A 4FF4A 4IUUA 4RWSC 4WORA 4ID6A 4DV2Q 3DUZA 4IPGA 4JI7L 3PV0A 2K5HA 1YNXA 5T1IA 2UUCL 2F0MA 2IPKD 5DLQE 5EKIA 4FYDA 2IHEA 2WAQG 2JA7B 5C4HA 3C1FA 4L6TB 1QVFA 2ZXOA 4MNOA 1CZWA 4FXGC 1STNA 5IY0A 3MXNA 3HOWH 1LACA 4X3KA 5CC4A 1VQJA 3NE5B 3D6CA 3S15H 4YCVA 4ABNA 1TWFB 1Q86C 2Z9HA 3T53B 1N9WA 4UP7A 1W6KA 1JOKA 1LYLA 3W2DA 4EQPA 3FKIH 3OSOA 4OIJA 3N6RA 1BCPD 2UUAL 4GLXA 2UUBQ 4DAYA 3BDLA 4JBKA 1B3QA 5C5MA 2EJFC 3V2TA 1UWVA 4G7OC 5BN3A 1C9OA 2EY2A 1HZCA 2HQEA 4PZ8A 1IL2A 1M8AA 5I4DA 2RVLA 3W3AA 5FO8B 4DR5Q 1F2MA 3TSSA 4YCWA 4R9WA 2VB2X 1C4QA 4XYQA 3M4OH 1TU2B 3HOVB 1B3AA 4KHZA 4CKCA 4IUNA 3EA6A 1I6HB 1X3EA 2EY5A 2K14A 4A3KH 4JI3Q 1VMPA 1IYJB 1B70B 2AWNA 2KEEA 3D4RA 4DAPA 4L5SA 4A3EG 4CJ0B 2PNHA 1G6ZA 4LF9L 1BO0A 1F77A 4PMBA 3DWAA 1WOCA 1Q3LA 2L5TA 1W2BA 3S1MB 3PF5A 2YU9B 4DR7Q 2N49A 4RH6A 1HUNA 2V4DA 3ND9A 2WKDA 4RGOS 4LAAA 4CDCC 1QZGA 3J81i 5CORA 1F9RA 3VA7A 3VYTA 2E75C 4Y52H 4GLAC 3A5ZB 2WAQB 2A5HA 1QVCA 4QIWE 3TP6A 4J1MA 1KD1C 1N32L 3SE0A 1JWMD 3CU7A 2E2DC 1LUZA 3CQZH 1CKOA 1FVIA 1RKNA 1SMYC 4GKJQ 3C1EA 5EPLA 3CC7A 1QNUA 1TWFH 3DWQA 3Q6SA 5C3EG 3M4PA 1VQ5A 1L2FA 1UEAB 2NN6H 1EY7A 3RLNA 1ZEQX 3P1HA 3KK7A 4ODGA 2EOTA 3M7GA 1FNUA 2LSSA 4XT1B 3OIPA 4C2MB 2PZTA 3NSWA 3SK8A 4DK6C 1QZHA 3RLFA 3T51B 4OHJA 4YCUA 2Y0SB 1HFGA 3AB9A 4O1NA 4DR2Q 3QG1A 1CI3M 1Q7YC 3J81L 3FHWA 4HIOA 4LF8L 3RN2A 4B3MQ 4FP5D 3I70A 3B6YA 4RKBA 1PMRA 2KJXA 1EZ8A 1Y1VH 3FPUB 2UU9L 1TQOA 3AYHB 5IYCG 4LF6Q 1B2TA 4P73A 5DM73 5M3FG 1VQOA 3U9OA 1UAPA 3E0JA 4BY1B 1WFQA 1MSHA 2SNMA 5E1FA 5M3MG 3G6EA 1WVLA 3WDNA 4LMQD 4A3EB 2K6AA 4OIKA 2KCMA 1E2VA 4A3JG 3TREA 1EZ6A 4UDUC 4RMFA 2Q8TA 2IX3A 4HEDA 1QUQA 2Z6KC 2CHBD 2RKSA 3I3CA 2E2IH 4I65A 1CTMA 4ZQ3A 3HZXA 3I7FA 4DR1L 1RDPD 4OO1I 1IBLL 2WFWA 5IWAL 2XRQD 5FKAC 1QNKA 1KLGD 2VQEQ 5C6AA 1ML0D 1F2ZA 3CCVA 5BR8L 3S17H 1LV9A 1GUTA 3T1YL 2I5HA 3VR3A 3EBEA 3KF6A 4B9XA 1X3GA 1WD0A 4DGZA 1ZKOA 4CJ2C 4C2MH 1TS3A 3X3MA 2FXQA 1WTXA 5K36G 1T5EA 1SE4A 1FYCA 3GV3A 3TMEA 3CXCA 3J7YW 5KNDA 4LF5L 1VQMA 1OXUA 2LXJA 1PZJD 5C3WA 1XPRA 1XMOQ 2KCNA 4L5QA 1I4PA 1X32A 4GNXB 2EE1A 4JI6Q 1HZAA 2SEBD 5EKKA 4C3IG 1R9TH 2QDLA 1GD7A 1XXGA 3L0OA 1QUQB 4K14A 2VUMG 2K04A 3PUVA 1SE2A 4DV3Q 4APVA 3M9BA 1G51A 3KBXA 3VR4A 4KN7C 1TWGH 4DK3C 5M3FB 2ZT9C 3SEBA 3V05A 1SNOA 3CAMA 3X3NA 1S40A 1TWHB 4IFDH 1EL0A 1BNZA 1L0YB 4IJHA 2WACA 2F0VA 1PFSA 1TS2A 5M3MB 5M5WH 1RIPA 3AMUA 3EVQA 5IT9L 1G291 1HCZA 3IFDA 3S1RH 4TRDA 3CPWA 4LF7Q 4JK1C 1FL0A 3I4LA 2UXDL 4A3FG 4FDBA 4LFBQ 3GTLB 4X3TA 3I4MB 1X54A 5ELOA 2NUCA 1SSOA 1YNNC 3IFTA 1WJJA 2JJQA 4B08A 4GKKQ 4POGA 2YYZA 5C3EH 1LT3D 5A35A 3K7UC 4TKOB 4BY7G 1B1ZA 3CKIB 3PIPA 1GUNA 4GN4B 1CA5A 4HR7B 4X65Q 2HCCA 1XYIA 3PO2H 3RLOA 3RZOB 5J22A 1I3QH 2X6GA 1GUWA 2JYOA 5LMUL 1C8CA 2JA5B 1TKWB 5DNFA 2O5IC 4JBJA 1D5ZC 3CCJA 2EXDA 1MD2D 2F0OA 4HTHA 4H7BA 2N3SA 4GOPB 1HUMA 2FMCA 1F2LA 1Z7TA 3FRPB 4K0KL 1X6OA 4LFAL 1YITA 2N8NA 5ELCA 4C3IB
chains in the Genus database with same CATH topology
3CPFA 4HJ7A 4IOCA 1E1OA 4C3JH 4C3HH 1IBKL 4KLKA 1N32Q 1HNZQ 2K5VA 5LMNL 1PH1A 4BBSG 5IE8A 1PH5A 1LM0A 1BKBA 1Z47A 3M3YH 4NPSA 2A8VA 4JYAL 1SR3A 4LFBL 4H02A 3F2DA 4DR2L 4KHPL 4DR4Q 4LFCQ 2HHHQ 3CW2C 1VQEA 4YWKA 3CCMA 3GD7A 3OW2A 1XPOA 1PH4A 5FJ8G 1EQQA 4POFA 5FLMH 1MJCA 1Q1BA 4JOIA 1Y1WG 1I5FA 2H5XA 4A3JH 1SN8A 4B3ML 1OXVA 2YTXA 1SRUA 2RHSB 3L7ZC 2I0QA 4GKKL 1Z9FA 3NENA 4P75A 3TQYA 5JEAG 4OX9L 4DV1Q 1I94Q 3S2HH 1XTDA 2JA5G 2OQ0A 1TWAH 2HIXA 4PZ6A 2HQLA 4DUZQ 5IYBG 5C0XI 3I56A 1HR0L 4LF6L 1YIJA 3PF4A 1Y14B 4P72A 4DR6L 1B7YB 4NB3A 1V1QA 2MO1A 2EIFA 3HOZH 4WJ4A 5GAEC 3WWVA 3HOXG 2VL6A 3VDYA 2L15A 3GTMH 4AQYQ 3I4NG 3UE0A 4UY8C 4IFDJ 2Z6KA 2NZHA 1YHBA 3LGJA 2OWOA 3Q8DA 3DLLA 1EYGA 1U5KA 1K73C 2IX0A 4LF8Q 3GTKH 5JJIA 4QJFA 2NN6G 4HJ8A 5LMNW 4A3DH 2D62A 3D31A 2K50A 2MFIA 4IFDG 4EX5A 1NE3A 3J7A5 3D0FA 3STBD 4Y7NH 2UU9Q 5GADC 1YJ9A 4JI0L 4R4TA 3TEHB 3UDXA 2Z0SA 3NELA 4GLVB 4DV6L 3M7NA 2DGYA 3RZOH 2UXCL 1HZBA 1TWCH 2OTLA 2ID0A 3GO5A 3H0GH 4BY1H 4LF4Q 1XNQL 1A63A 1VCIA 2VNUD 3GTOH 2CFMA 3E9HA 1M1KC 2F3IA 1KRTA 4A3EH 3G48A 2F4VQ 1G6PA 3GTPH 2ZM6L 3UDIA 2K4KA 3E9IA 4R4CA 1UE5A 1X55A 4DAMA 1VQBA 1WCMG 3OTOQ 2JEBI 1XMQQ 1KRSA 2VQEL 1HR0W 2B3GA 3KF6B 4LW1A 2R6GA 2E2JH 4IOAA 1IBML 1GVPA 1N33Q 1YJNA 2ATWA 3ULLA 5IYDH 4DV5Q 4JV5Q 2VZAA 4JBMA 1AE3A 5GROA 1Y1VG 3CC4A 1C0AA 1D7QA 4NXML 1A8VA 3I55A 1VQ6A 1YBYA 4P71A 1JB7A 3H3VI 2N78A 2VUMH 4DR1Q 3CCEA 2E5LQ 3ULPA 1XNRL 3CC2A 4L5RC 1WI5A 4MZ9A 1HH2P 2NZOA 1L0WA 1PV4A 1IBLQ 5IWAQ 2R7DA 5IP9G 3U50C 2Q2HA 2ZJRA 3PO2G 3BU2A 4O2DA 4BXXG 2C35B 4DV2Q 1PYBA 2CQOA 4IPGA 2VY3A 4DKAC 5BR8Q 5HGQA 5IT9c 3HKZE 1KAWA 4JC0A 4DR3Q 4JI7L 4DV0L 2JA6H 3NBHB 3T1YQ 4QGUA 1I50H 3PV0A 3CCQA 1XMOL 2K5HA 4L5TA 4X62L 1PH6A 1YNXA 2KCTA 2WB1E 3PUWA 1YI2A 4ME3A 4DUYQ 2UUCL 4JI6L 4LWCA 5DLQE 3GTJH 3K7AH 2OCEA 2JA8G 2NVTH 4A93H 1JJGA 2IHEA 2XGTA 1VS0A 2WAQG 1UE1A 4A3FH 1QVFA 3J81j 1Q1EA 4JI5Q 4A3MH 3KDFB 4LF5Q 1RL2A 4MNOA 5ELNA 3S2DH 1CKMA 4B3SL 4DV3L 2B63G 3PUYA 2AMCB 2ZTDA 4JI1L 2ZJQA 2OTJA 2NN6I 2RCNA 5IY0A 1YJWA 3HOWH 2BH8A 2Q2IA 3M4QA 5IP7G 2KHJA 3GTQH 1VQJA 1NY4A 4JOIC 3H15A 4IFDI 3PGZA 3CCUA 1SLJA 1S72A 4BBRH 1C7YA 4LNQA 3S15H 4YCVA 1HZ9A 1UEBA 1ASZA 1Q86C 3G4SA 1VQ4A 2DUDA 1JJ2A 4LUOA 1N9WA 4P74A 5GAGC 5IYCH 4GNXA 1N36L 1P16A 1PH3A 4NXNL 2UXBL 3PIOA 2R93G 1K83H 2K5NA 4LUZA 3M85A 1EFWA 4UP7A 3K81C 2K52A 5M3FH 1Q81C 1HNXQ 4LF7L 1J5EQ 1EIYB 2WAQE 1LYLA 1S3OA 1Q12A 4JI8Q 3FKIH 4DV5L 1TWHH 4JG2A 4OXPA 2UUAL 4GLXA 4O0AA 4X66Q 3KLWA 5M3MH 2UUBQ 3ULJA 4JBKA 3EN2A 3NEMA 3U58A 1UWVA 1X56A 1E7ZA 3F1ZA 1V43A 4JCVE 1C9OA 1HZCA 4HJ5A 4PZ8A 1K8AC 2R92G 3KF8B 2JA7G 1IL2A 5C4JH 3UDGA 1JMCA 3GTLH 4DR5Q 3I4MH 3TRZA 4YCWA 4YHHL 1AE2A 1HJPA 5C4XG 2UXDQ 1VQDA 4AYBE 1VQKA 4WJ3M 1OXTA 3M4OH 4YY3Q 2I5LX 1YEZA 4X65L 4KHZA 4JI4L 3CD6A 4OWWB 2Y0SE 4AIMA 2BH2A 1X3EA 2QGQA 2CWPA 2K14A 4A3KH 2Q2UA 2IX1A 4HIMA 2IT1A 3H0GG 4PG3A 4DPGA 4JI3Q 1IYJB 1B70B 5E7NA 2AWNA 5AJ3L 1VQ7A 4L5SA 2NVXH 4A3EG 3DM3A 3PCOB 3S16H 1CUKA 2PNHA 1EIFA 1L1OA 4LF9L 1N34Q 4OWXB 1WOCA 3A5UA 1GKHA 3T1HL 1W2BA 4B3RQ 4QQBX 3PF5A 4DR7Q 2N49A 3AQQA 4A3CG 1QZGA 4UP8A 3J81i 5GAHC 2VQFQ 1GM5A 2JA5H 3K80C 4B3TQ 4DV7Q 1PYSB 4XTCS 1HNWQ 4Y52H 4GLAC 2YTVA 3A5ZB 5LMUQ 1AH9A 1QVCA 4QIWE 3W1BA 3HKZG 1KD1C 1N32L 1HNZL 3KYHC 3CP0A 4R4IA 5H1SE 1J5EL 4LF8L 1X9NA 1BBUA 1LUZA 3CQZH 4X64Q 1CKOA 3CF5A 1FVIA 2BA1A 4IPDA 1KC8C 4GKJQ 2IHFA 3CC7A 3BZCA 1TWFH 5C3EG 1VQ5A 4UPAA 3M4PA 2WB1G 1L2FA 4DR4L 4PMWA 4A4IA 4OO1G 4C3IH 3EIVA 4LFCL 3STBC 4IO9A 3FP9A 4GN5A 3RLNA 1NJIC 2HHHL 3HOVG 2VS1A 1PHJA 4K0KQ 4HJAA 4GOPA 4LFAQ 3KJOA 2LSSA 1IZ6A 3SGIA 2QEXA 2GVAA 1TXYA 4HIDA 3S1NH 3K8AA 3ICEA 4BA2I 1Q8KA 4DV1L 4UP9A 1I94L 3JAMi 2AWOA 1IBKQ 4DK6C 4IPHA 4DUZL 1QZHA 2JA9A 5HY6A 3RLFA 3BJUA 4A93G 4YCUA 4A75A 4BA1I 5C0XJ 2AHOB 4JYAQ 3HOYH 4DR2Q 4A3LH 4KHPQ 1WCMH 4AQYL 3RNUA 4DV4Q 1Q7YC 3FHWA 3F2BA 3RN5A 3PSIA 3HOWG 1K8GA 1VQAA 2ZTEA 3J80i 4RG1A 1W3SA 2LXKA 1YVCA 3F8TA 5C0XG 3G71A 4HIOA 3KOJA 3RN2A 4DNIA 4B3MQ 3PO3H 3B6YA 4BBRG 1YHAA 1MJEA 2V1CC 4OX9Q 1Y1VH 2UU9L 1E24A 2MNAA 3AYHB 5IYCG 4LF6Q 1FGUA 1PH8A 2Q2TA 4P73A 1X65A 4DR6Q 3KFUA 3GTGH 2ASBA 4LF4L 4YWLA 4A3IH 5M3FG 1BBWA 1CSPA 1VQOA 2PMZE 4A3BH 1LTLA 1PH9A 3JC66 4QY7A 2NVQH 2F4VL 4EQ5A 4R4QA 4BXXH 1WFQA 4BY7H 1D8LA 1UE6A 3RZDH 1WYDA 3J81c 5M3MG 1JJCB 1K0RA 3OTOL 1XMQL 3G6EA 3AEVA 2KCMA 3HOUH 4AYBG 5FLMG 2PQAA 4XIGS 4A3JG 3TREA 1N33L 4JI0Q 4RMFA 1E22A 4JV5L 2ALYB 4DV6Q 1QUQA 4A76A 2Z6KC 2Y0SG 1MKHA 1NTGA 2JQOA 2JK8A 3UDFA 1QVGA 2E2IH 4PZ7A 2JA8H 1VQFA 1A62A 3BZKA 3I7FA 4GN3B 1PH2A 3HFZB 4DR1L 2E5LL 2I5MX 2ZM6Q 3U4VA 5C44H 2B63H 2YTYA 3HOZG 4OO1I 1L1OC 1E1TA 2NVYH 3TS0A 2R7ZH 1IBLL 2WFWA 5IWAL 3HKSA 5IP7H 1CSQA 2VQEQ 2XTIA 1P8LA 4DV2L 4A3KG 4YWMA 5BR8L 3S24A 3CCVA 1IBMQ 2MO0A 3S17H 4GS3A 4DR3L 3JAMc 3CCSA 2I5HA 4IPCA 3EBEA 3T1YL 4A3DG 1VQGA 3KF6A 4BBSH 1X3GA 3CCLA 2ZJPA 4ALPA 5JEAJ 3TS2A 2D0PA 2GVBA 4C2MH 4DV4L 4NXMQ 2A1AA 2R93H 1J6QA 2FXQA 4R4OA 4DUYL 2JEAI 1XNRQ 4MTNA 5K36G 4BY1G 3A74A 3H3VH 4LUVA 2BA0A 5JJLA 3MXNB 4JI5L 3PUXA 3CXCA 1SFOH 1VQMA 1IXRA 3J80c 1VQ8A 4LF5L 2HT1A 1OXUA 2A19A 2K75A 2LXJA 1KQSA 3S14H 1VQLA 3F2CA 4JI7Q 2CKZB 3ZJYC 5FJ8H 4DV0Q 1Y1WH 4GOPC 2MQHA 1XPRA 2HIVA 1N8RC 1XMOQ 1XPUA 2ES2A 4L5QA 1K9MC 1OXSC 2OQKA 1H95A 4HJ9A 4GNXB 2ZTCA 3AFQA 1PH7A 4X62Q 2R92H 2JA7H 5IYDG 4JI2Q 1M90C 1K3RA 2UUCQ 1VQCA 4JI6Q 1CKNA 1EUJA 1HZAA 1FJGQ 5IYBH 4J15A 1E3PA 3MEFA 3U4ZA 2PQAB 5C4XH 1R9TH 2EQSA 1YZ6A 1VQPA 5M5XH 1SROA 1GD7A 3L0OA 1QUQB 1A0IA 2VUMG 1HNXL 2KENA 3HOXH 3PUVA 3OYYA 4B3SQ 4DV3Q 3I4NH 4JI1Q 4APVA 2CCZA 4JI8L 1Q82C 3M9BA 4DAYB 2AKWB 3KDFA 4TQUS 1G51A 4IJLA 3UE1A 4A3GH 1TWGH 4DK3C 1OTCA 4X66L 1JT8A 2R7FA 4JBWA 2UUBL 3KJPA 3CAMA 4OONA 1S40A 3GDEA 2JA6G 2KBNA 1KXLA 3RR5A 4X6AH 1VQIA 2WP8J 4IJHA 3HOYG 5M5WH 1PFSA 1VQNA 4A3LG 2UXBQ 1RIPA 2VW9A 1N36Q 3PUZA 4NXNQ 1G291 5J3BA 4HIKA 1NMFA 3S1RH 3CPWA 5LMNQ 4DR5L 4LF7Q 4A3CH 1EWIA 3ERSX 1EOVA 1FL0A 3PO3G 3CMAA 2PI2E 2PI2A 4KI0A 2YV5A 2UXDL 4A3FG 3CCRA 4FDBA 2UUAQ 1DGSA 4YY3L 2F52A 4LFBQ 4A3MG 3I2ZA 4GNXC 1X54A 3K0XA 5ELOA 5JJKA 5FLXc 4OWTB 3S1QH 1YHQA 5EAYA 4JI3L 4A3IG 5GQOA 3W1GA 1L1OB 1WJJA 2JJQA 4AH6A 1NMGA 3CMEA 1JE5A 4POGA 4A3BG 2YYZA 4R1JA 4A3GG 4GKKQ 5C3EH 1XJVA 1Q46A 2E8GA 1X3FA 1VQ9A 1T9HA 3L2PA 1PVOA 1PA6A 3HOVH 3K7UC 1SE8A 1N34L 1HR0Q 4BY7G 1I6HH 4YHHQ 4TVAB 3PIPA 2QA4A 1EQRA 4B3RL 4DR7L 2D0OA 3E0EA 3HOUG 1ASYA 4GN4B 1NBWA 1CKNB 4X65Q 1KHIA 1O7IA 4JI4Q 2KHIA 5IP9H 3PO2H 3RLOA 2VQFL 4JI2L 1I3QH 3FKIG 3ER0A 3AFPA 4B3TL 4DV7L 1FJGL 1VQHA 1HNWL 2CWAA 3W5OA 5LMUL 1B8AA 1MIUA 5M5YH 2IY5B 5AJ3Q 2JE6I 3S1MH 2YU9H 2E2HH 1UE7A 1V9PA 4JBJA 1KL9A 5C44G 1KIXA 4LF9Q 4X64L 3I4OA 1OXXK 3CCJA 2EXDA 2R7ZG 2UXCQ 4GKJL 3T1HQ 2N3SA 4GOPB 3IRBA 2RHQB 1XNQQ 2RF4A 4K0KL 1X6OA 3I4MG 4QL5A 4LFAL 1U0LA 1YITA 1SMXA 2B29A 3J7ZC 1GO3E 2GN5A 2N8NA 1BVSA 3A0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPF A;  4HJ7 A;  4IOC A;  1E1O A;  4C3J H;  4C3H H;  1IBK L;  4KLK A;  1N32 Q;  1HNZ Q;  2K5V A;  5LMN L;  1PH1 A;  4BBS G;  5IE8 A;  1PH5 A;  1LM0 A;  1BKB A;  1Z47 A;  3M3Y H;  4NPS A;  2A8V A;  4JYA L;  1SR3 A;  4LFB L;  4H02 A;  3F2D A;  4DR2 L;  4KHP L;  4DR4 Q;  4LFC Q;  2HHH Q;  3CW2 C;  1VQE A;  4YWK A;  3CCM A;  3GD7 A;  3OW2 A;  1XPO A;  1PH4 A;  5FJ8 G;  1EQQ A;  4POF A;  5FLM H;  1MJC A;  1Q1B A;  4JOI A;  1Y1W G;  1I5F A;  2H5X A;  4A3J H;  1SN8 A;  4B3M L;  1OXV A;  2YTX A;  1SRU A;  2RHS B;  3L7Z C;  2I0Q A;  4GKK L;  1Z9F A;  3NEN A;  4P75 A;  3TQY A;  5JEA G;  4OX9 L;  4DV1 Q;  1I94 Q;  3S2H H;  1XTD A;  2JA5 G;  2OQ0 A;  1TWA H;  2HIX A;  4PZ6 A;  2HQL A;  4DUZ Q;  5IYB G;  5C0X I;  3I56 A;  1HR0 L;  4LF6 L;  1YIJ A;  3PF4 A;  1Y14 B;  4P72 A;  4DR6 L;  1B7Y B;  4NB3 A;  1V1Q A;  2MO1 A;  2EIF A;  3HOZ H;  4WJ4 A;  5GAE C;  3WWV A;  3HOX G;  2VL6 A;  3VDY A;  2L15 A;  3GTM H;  4AQY Q;  3I4N G;  3UE0 A;  4UY8 C;  4IFD J;  2Z6K A;  2NZH A;  1YHB A;  3LGJ A;  2OWO A;  3Q8D A;  3DLL A;  1EYG A;  1U5K A;  1K73 C;  2IX0 A;  4LF8 Q;  3GTK H;  5JJI A;  4QJF A;  2NN6 G;  4HJ8 A;  5LMN W;  4A3D H;  2D62 A;  3D31 A;  2K50 A;  2MFI A;  4IFD G;  4EX5 A;  1NE3 A;  3J7A 5;  3D0F A;  3STB D;  4Y7N H;  2UU9 Q;  5GAD C;  1YJ9 A;  4JI0 L;  4R4T A;  3TEH B;  3UDX A;  2Z0S A;  3NEL A;  4GLV B;  4DV6 L;  3M7N A;  2DGY A;  3RZO H;  2UXC L;  1HZB A;  1TWC H;  2OTL A;  2ID0 A;  3GO5 A;  3H0G H;  4BY1 H;  4LF4 Q;  1XNQ L;  1A63 A;  1VCI A;  2VNU D;  3GTO H;  2CFM A;  3E9H A;  1M1K C;  2F3I A;  1KRT A;  4A3E H;  3G48 A;  2F4V Q;  1G6P A;  3GTP H;  2ZM6 L;  3UDI A;  2K4K A;  3E9I A;  4R4C A;  1UE5 A;  1X55 A;  4DAM A;  1VQB A;  1WCM G;  3OTO Q;  2JEB I;  1XMQ Q;  1KRS A;  2VQE L;  1HR0 W;  2B3G A;  3KF6 B;  4LW1 A;  2R6G A;  2E2J H;  4IOA A;  1IBM L;  1GVP A;  1N33 Q;  1YJN A;  2ATW A;  3ULL A;  5IYD H;  4DV5 Q;  4JV5 Q;  2VZA A;  4JBM A;  1AE3 A;  5GRO A;  1Y1V G;  3CC4 A;  1C0A A;  1D7Q A;  4NXM L;  1A8V A;  3I55 A;  1VQ6 A;  1YBY A;  4P71 A;  1JB7 A;  3H3V I;  2N78 A;  2VUM H;  4DR1 Q;  3CCE A;  2E5L Q;  3ULP A;  1XNR L;  3CC2 A;  4L5R C;  1WI5 A;  4MZ9 A;  1HH2 P;  2NZO A;  1L0W A;  1PV4 A;  1IBL Q;  5IWA Q;  2R7D A;  5IP9 G;  3U50 C;  2Q2H A;  2ZJR A;  3PO2 G;  3BU2 A;  4O2D A;  4BXX G;  2C35 B;  4DV2 Q;  1PYB A;  2CQO A;  4IPG A;  2VY3 A;  4DKA C;  5BR8 Q;  5HGQ A;  5IT9 c;  3HKZ E;  1KAW A;  4JC0 A;  4DR3 Q;  4JI7 L;  4DV0 L;  2JA6 H;  3NBH B;  3T1Y Q;  4QGU A;  1I50 H;  3PV0 A;  3CCQ A;  1XMO L;  2K5H A;  4L5T A;  4X62 L;  1PH6 A;  1YNX A;  2KCT A;  2WB1 E;  3PUW A;  1YI2 A;  4ME3 A;  4DUY Q;  2UUC L;  4JI6 L;  4LWC A;  5DLQ E;  3GTJ H;  3K7A H;  2OCE A;  2JA8 G;  2NVT H;  4A93 H;  1JJG A;  2IHE A;  2XGT A;  1VS0 A;  2WAQ G;  1UE1 A;  4A3F H;  1QVF A;  3J81 j;  1Q1E A;  4JI5 Q;  4A3M H;  3KDF B;  4LF5 Q;  1RL2 A;  4MNO A;  5ELN A;  3S2D H;  1CKM A;  4B3S L;  4DV3 L;  2B63 G;  3PUY A;  2AMC B;  2ZTD A;  4JI1 L;  2ZJQ A;  2OTJ A;  2NN6 I;  2RCN A;  5IY0 A;  1YJW A;  3HOW H;  2BH8 A;  2Q2I A;  3M4Q A;  5IP7 G;  2KHJ A;  3GTQ H;  1VQJ A;  1NY4 A;  4JOI C;  3H15 A;  4IFD I;  3PGZ A;  3CCU A;  1SLJ A;  1S72 A;  4BBR H;  1C7Y A;  4LNQ A;  3S15 H;  4YCV A;  1HZ9 A;  1UEB A;  1ASZ A;  1Q86 C;  3G4S A;  1VQ4 A;  2DUD A;  1JJ2 A;  4LUO A;  1N9W A;  4P74 A;  5GAG C;  5IYC H;  4GNX A;  1N36 L;  1P16 A;  1PH3 A;  4NXN L;  2UXB L;  3PIO A;  2R93 G;  1K83 H;  2K5N A;  4LUZ A;  3M85 A;  1EFW A;  4UP7 A;  3K81 C;  2K52 A;  5M3F H;  1Q81 C;  1HNX Q;  4LF7 L;  1J5E Q;  1EIY B;  2WAQ E;  1LYL A;  1S3O A;  1Q12 A;  4JI8 Q;  3FKI H;  4DV5 L;  1TWH H;  4JG2 A;  4OXP A;  2UUA L;  4GLX A;  4O0A A;  4X66 Q;  3KLW A;  5M3M H;  2UUB Q;  3ULJ A;  4JBK A;  3EN2 A;  3NEM A;  3U58 A;  1UWV A;  1X56 A;  1E7Z A;  3F1Z A;  1V43 A;  4JCV E;  1C9O A;  1HZC A;  4HJ5 A;  4PZ8 A;  1K8A C;  2R92 G;  3KF8 B;  2JA7 G;  1IL2 A;  5C4J H;  3UDG A;  1JMC A;  3GTL H;  4DR5 Q;  3I4M H;  3TRZ A;  4YCW A;  4YHH L;  1AE2 A;  1HJP A;  5C4X G;  2UXD Q;  1VQD A;  4AYB E;  1VQK A;  4WJ3 M;  1OXT A;  3M4O H;  4YY3 Q;  2I5L X;  1YEZ A;  4X65 L;  4KHZ A;  4JI4 L;  3CD6 A;  4OWW B;  2Y0S E;  4AIM A;  2BH2 A;  1X3E A;  2QGQ A;  2CWP A;  2K14 A;  4A3K H;  2Q2U A;  2IX1 A;  4HIM A;  2IT1 A;  3H0G G;  4PG3 A;  4DPG A;  4JI3 Q;  1IYJ B;  1B70 B;  5E7N A;  2AWN A;  5AJ3 L;  1VQ7 A;  4L5S A;  2NVX H;  4A3E G;  3DM3 A;  3PCO B;  3S16 H;  1CUK A;  2PNH A;  1EIF A;  1L1O A;  4LF9 L;  1N34 Q;  4OWX B;  1WOC A;  3A5U A;  1GKH A;  3T1H L;  1W2B A;  4B3R Q;  4QQB X;  3PF5 A;  4DR7 Q;  2N49 A;  3AQQ A;  4A3C G;  1QZG A;  4UP8 A;  3J81 i;  5GAH C;  2VQF Q;  1GM5 A;  2JA5 H;  3K80 C;  4B3T Q;  4DV7 Q;  1PYS B;  4XTC S;  1HNW Q;  4Y52 H;  4GLA C;  2YTV A;  3A5Z B;  5LMU Q;  1AH9 A;  1QVC A;  4QIW E;  3W1B A;  3HKZ G;  1KD1 C;  1N32 L;  1HNZ L;  3KYH C;  3CP0 A;  4R4I A;  5H1S E;  1J5E L;  4LF8 L;  1X9N A;  1BBU A;  1LUZ A;  3CQZ H;  4X64 Q;  1CKO A;  3CF5 A;  1FVI A;  2BA1 A;  4IPD A;  1KC8 C;  4GKJ Q;  2IHF A;  3CC7 A;  3BZC A;  1TWF H;  5C3E G;  1VQ5 A;  4UPA A;  3M4P A;  2WB1 G;  1L2F A;  4DR4 L;  4PMW A;  4A4I A;  4OO1 G;  4C3I H;  3EIV A;  4LFC L;  3STB C;  4IO9 A;  3FP9 A;  4GN5 A;  3RLN A;  1NJI C;  2HHH L;  3HOV G;  2VS1 A;  1PHJ A;  4K0K Q;  4HJA A;  4GOP A;  4LFA Q;  3KJO A;  2LSS A;  1IZ6 A;  3SGI A;  2QEX A;  2GVA A;  1TXY A;  4HID A;  3S1N H;  3K8A A;  3ICE A;  4BA2 I;  1Q8K A;  4DV1 L;  4UP9 A;  1I94 L;  3JAM i;  2AWO A;  1IBK Q;  4DK6 C;  4IPH A;  4DUZ L;  1QZH A;  2JA9 A;  5HY6 A;  3RLF A;  3BJU A;  4A93 G;  4YCU A;  4A75 A;  4BA1 I;  5C0X J;  2AHO B;  4JYA Q;  3HOY H;  4DR2 Q;  4A3L H;  4KHP Q;  1WCM H;  4AQY L;  3RNU A;  4DV4 Q;  1Q7Y C;  3FHW A;  3F2B A;  3RN5 A;  3PSI A;  3HOW G;  1K8G A;  1VQA A;  2ZTE A;  3J80 i;  4RG1 A;  1W3S A;  2LXK A;  1YVC A;  3F8T A;  5C0X G;  3G71 A;  4HIO A;  3KOJ A;  3RN2 A;  4DNI A;  4B3M Q;  3PO3 H;  3B6Y A;  4BBR G;  1YHA A;  1MJE A;  2V1C C;  4OX9 Q;  1Y1V H;  2UU9 L;  1E24 A;  2MNA A;  3AYH B;  5IYC G;  4LF6 Q;  1FGU A;  1PH8 A;  2Q2T A;  4P73 A;  1X65 A;  4DR6 Q;  3KFU A;  3GTG H;  2ASB A;  4LF4 L;  4YWL A;  4A3I H;  5M3F G;  1BBW A;  1CSP A;  1VQO A;  2PMZ E;  4A3B H;  1LTL A;  1PH9 A;  3JC6 6;  4QY7 A;  2NVQ H;  2F4V L;  4EQ5 A;  4R4Q A;  4BXX H;  1WFQ A;  4BY7 H;  1D8L A;  1UE6 A;  3RZD H;  1WYD A;  3J81 c;  5M3M G;  1JJC B;  1K0R A;  3OTO L;  1XMQ L;  3G6E A;  3AEV A;  2KCM A;  3HOU H;  4AYB G;  5FLM G;  2PQA A;  4XIG S;  4A3J G;  3TRE A;  1N33 L;  4JI0 Q;  4RMF A;  1E22 A;  4JV5 L;  2ALY B;  4DV6 Q;  1QUQ A;  4A76 A;  2Z6K C;  2Y0S G;  1MKH A;  1NTG A;  2JQO A;  2JK8 A;  3UDF A;  1QVG A;  2E2I H;  4PZ7 A;  2JA8 H;  1VQF A;  1A62 A;  3BZK A;  3I7F A;  4GN3 B;  1PH2 A;  3HFZ B;  4DR1 L;  2E5L L;  2I5M X;  2ZM6 Q;  3U4V A;  5C44 H;  2B63 H;  2YTY A;  3HOZ G;  4OO1 I;  1L1O C;  1E1T A;  2NVY H;  3TS0 A;  2R7Z H;  1IBL L;  2WFW A;  5IWA L;  3HKS A;  5IP7 H;  1CSQ A;  2VQE Q;  2XTI A;  1P8L A;  4DV2 L;  4A3K G;  4YWM A;  5BR8 L;  3S24 A;  3CCV A;  1IBM Q;  2MO0 A;  3S17 H;  4GS3 A;  4DR3 L;  3JAM c;  3CCS A;  2I5H A;  4IPC A;  3EBE A;  3T1Y L;  4A3D G;  1VQG A;  3KF6 A;  4BBS H;  1X3G A;  3CCL A;  2ZJP A;  4ALP A;  5JEA J;  3TS2 A;  2D0P A;  2GVB A;  4C2M H;  4DV4 L;  4NXM Q;  2A1A A;  2R93 H;  1J6Q A;  2FXQ A;  4R4O A;  4DUY L;  2JEA I;  1XNR Q;  4MTN A;  5K36 G;  4BY1 G;  3A74 A;  3H3V H;  4LUV A;  2BA0 A;  5JJL A;  3MXN B;  4JI5 L;  3PUX A;  3CXC A;  1SFO H;  1VQM A;  1IXR A;  3J80 c;  1VQ8 A;  4LF5 L;  2HT1 A;  1OXU A;  2A19 A;  2K75 A;  2LXJ A;  1KQS A;  3S14 H;  1VQL A;  3F2C A;  4JI7 Q;  2CKZ B;  3ZJY C;  5FJ8 H;  4DV0 Q;  1Y1W H;  4GOP C;  2MQH A;  1XPR A;  2HIV A;  1N8R C;  1XMO Q;  1XPU A;  2ES2 A;  4L5Q A;  1K9M C;  1OXS C;  2OQK A;  1H95 A;  4HJ9 A;  4GNX B;  2ZTC A;  3AFQ A;  1PH7 A;  4X62 Q;  2R92 H;  2JA7 H;  5IYD G;  4JI2 Q;  1M90 C;  1K3R A;  2UUC Q;  1VQC A;  4JI6 Q;  1CKN A;  1EUJ A;  1HZA A;  1FJG Q;  5IYB H;  4J15 A;  1E3P A;  3MEF A;  3U4Z A;  2PQA B;  5C4X H;  1R9T H;  2EQS A;  1YZ6 A;  1VQP A;  5M5X H;  1SRO A;  1GD7 A;  3L0O A;  1QUQ B;  1A0I A;  2VUM G;  1HNX L;  2KEN A;  3HOX H;  3PUV A;  3OYY A;  4B3S Q;  4DV3 Q;  3I4N H;  4JI1 Q;  4APV A;  2CCZ A;  4JI8 L;  1Q82 C;  3M9B A;  4DAY B;  2AKW B;  3KDF A;  4TQU S;  1G51 A;  4IJL A;  3UE1 A;  4A3G H;  1TWG H;  4DK3 C;  1OTC A;  4X66 L;  1JT8 A;  2R7F A;  4JBW A;  2UUB L;  3KJP A;  3CAM A;  4OON A;  1S40 A;  3GDE A;  2JA6 G;  2KBN A;  1KXL A;  3RR5 A;  4X6A H;  1VQI A;  2WP8 J;  4IJH A;  3HOY G;  5M5W H;  1PFS A;  1VQN A;  4A3L G;  2UXB Q;  1RIP A;  2VW9 A;  1N36 Q;  3PUZ A;  4NXN Q;  1G29 1;  5J3B A;  4HIK A;  1NMF A;  3S1R H;  3CPW A;  5LMN Q;  4DR5 L;  4LF7 Q;  4A3C H;  1EWI A;  3ERS X;  1EOV A;  1FL0 A;  3PO3 G;  3CMA A;  2PI2 E;  2PI2 A;  4KI0 A;  2YV5 A;  2UXD L;  4A3F G;  3CCR A;  4FDB A;  2UUA Q;  1DGS A;  4YY3 L;  2F52 A;  4LFB Q;  4A3M G;  3I2Z A;  4GNX C;  1X54 A;  3K0X A;  5ELO A;  5JJK A;  5FLX c;  4OWT B;  3S1Q H;  1YHQ A;  5EAY A;  4JI3 L;  4A3I G;  5GQO A;  3W1G A;  1L1O B;  1WJJ A;  2JJQ A;  4AH6 A;  1NMG A;  3CME A;  1JE5 A;  4POG A;  4A3B G;  2YYZ A;  4R1J A;  4A3G G;  4GKK Q;  5C3E H;  1XJV A;  1Q46 A;  2E8G A;  1X3F A;  1VQ9 A;  1T9H A;  3L2P A;  1PVO A;  1PA6 A;  3HOV H;  3K7U C;  1SE8 A;  1N34 L;  1HR0 Q;  4BY7 G;  1I6H H;  4YHH Q;  4TVA B;  3PIP A;  2QA4 A;  1EQR A;  4B3R L;  4DR7 L;  2D0O A;  3E0E A;  3HOU G;  1ASY A;  4GN4 B;  1NBW A;  1CKN B;  4X65 Q;  1KHI A;  1O7I A;  4JI4 Q;  2KHI A;  5IP9 H;  3PO2 H;  3RLO A;  2VQF L;  4JI2 L;  1I3Q H;  3FKI G;  3ER0 A;  3AFP A;  4B3T L;  4DV7 L;  1FJG L;  1VQH A;  1HNW L;  2CWA A;  3W5O A;  5LMU L;  1B8A A;  1MIU A;  5M5Y H;  2IY5 B;  5AJ3 Q;  2JE6 I;  3S1M H;  2YU9 H;  2E2H H;  1UE7 A;  1V9P A;  4JBJ A;  1KL9 A;  5C44 G;  1KIX A;  4LF9 Q;  4X64 L;  3I4O A;  1OXX K;  3CCJ A;  2EXD A;  2R7Z G;  2UXC Q;  4GKJ L;  3T1H Q;  2N3S A;  4GOP B;  3IRB A;  2RHQ B;  1XNQ Q;  2RF4 A;  4K0K L;  1X6O A;  3I4M G;  4QL5 A;  4LFA L;  1U0L A;  1YIT A;  1SMX A;  2B29 A;  3J7Z C;  1GO3 E;  2GN5 A;  2N8N A;  1BVS A;  3A0J A; 
#chains in the Genus database with same CATH topology
 4HJ7 A;  1E1O A;  1KNA A;  4ILW A;  1HNZ Q;  4F88 A;  5CMD A;  4BBS G;  3S1N B;  1Q90 A;  1LM0 A;  1SR3 A;  4LFB L;  4H02 A;  3DM1 A;  4M8A A;  4UHV A;  1PH4 A;  4RCO A;  4POF A;  5FOB B;  4A3J H;  1WCM B;  4K6L A;  2I0Q A;  4GKK L;  3SR1 A;  5JEA G;  2B2W A;  1PFN A;  1E2Z A;  1DOM A;  4O42 A;  4RFB A;  2HIX A;  5C0X I;  1D1K A;  4V0B A;  1MBY A;  3PF4 A;  1Y14 B;  2L9H A;  4P72 A;  4DR6 L;  1U4P A;  1S5F D;  3S2D B;  3I4N G;  2FFK B;  4UY8 C;  2Z6K A;  3NK9 A;  1LTG D;  3GTG B;  3Q8D A;  2IX0 A;  3D4D A;  5ELD A;  1B9M A;  4HJ8 A;  1WTQ A;  2NVQ B;  3T4A C;  3D31 A;  5D3D A;  2K50 A;  2MFI A;  3TZU A;  1YNJ C;  2B8G A;  3D0F A;  4ZCK A;  1E2W A;  4BY7 B;  3M7N A;  3RZO H;  1LLR D;  1HZB A;  1IW7 C;  3SHL A;  2ID0 A;  3H0G H;  2K33 A;  3GO5 A;  1SYB A;  1M1K C;  3MXP A;  3GTP H;  3UDI A;  5EKL A;  3E9I A;  2C9O A;  5ELE A;  1VQB A;  1ENC A;  1A6X A;  3OTO Q;  2JEB I;  1ILQ A;  2E2J H;  2XNA C;  1N33 Q;  4WFN 3;  4DV5 Q;  3BYY B;  1QE6 A;  5KIX A;  1C0A A;  2R3Z A;  2A73 B;  1VF5 C;  1F9Q A;  2N78 A;  2VUM H;  3BVM A;  4MZ9 A;  4N8X 1;  5IP9 G;  2Q2H A;  4O2D A;  4BXX G;  2C35 B;  1PYB A;  5IT9 c;  4DR3 Q;  3S16 B;  1SFO B;  3S14 B;  1NAP A;  3GP7 A;  1I4G A;  2KCT A;  1ILP A;  1WD1 A;  1YI2 A;  1SBB B;  4LWC A;  1ONL A;  2M9V A;  2NVT H;  5I6Y A;  1JJG A;  2Z1C A;  4A3F H;  3J81 j;  1Q1E A;  4CHT B;  3S2D H;  1CKM A;  4B3S L;  2AMC B;  4JI1 L;  3D4W A;  2RCN A;  1YJW A;  2BH8 A;  1ENF A;  3I73 A;  4KJN A;  1NY4 A;  4JOI C;  4IFD I;  1NUC A;  1S72 A;  3RUZ A;  4BBR H;  3I4N B;  2JP1 A;  2FJ2 A;  2Z4H A;  1ASZ A;  1JJ2 A;  1O7Y A;  2BDN A;  4LUO A;  5GAG C;  2UXB L;  1N36 L;  4NXN L;  4K8I A;  2R93 G;  1EFW A;  2IJ0 A;  3NTH A;  2WAQ E;  4DV5 L;  2I07 B;  3D8G A;  4O0A A;  3GQB A;  1ICW A;  5CYU A;  3VYS A;  4PQX A;  2F0K A;  3NEM A;  3U58 A;  2KHS A;  1X56 A;  1E7Z A;  5JJZ A;  1V43 A;  4JCV E;  2RSN A;  5IGF A;  3HKZ B;  4HJ5 A;  2JA7 G;  1CK1 A;  2CW0 C;  3DWP A;  2B8F A;  1JMC A;  1HA6 A;  2B2T C;  3TRZ A;  3MA2 B;  1IHZ A;  2KUM A;  1YEZ A;  2SDF A;  2Y0S E;  2HDM A;  4XQQ A;  4BBS H;  4HIM A;  2IT1 A;  5E7N A;  1H9R A;  5G3L D;  5AJ3 L;  4DK0 A;  2NVX H;  3PCO B;  3S16 H;  2R61 A;  1XTC D;  1L1O A;  2AQ2 B;  3Q22 A;  5M5Y B;  4KD4 A;  3T1H L;  4B3R Q;  2EY1 A;  1K3B C;  5JEA H;  2Z8L A;  2P5Z X;  5GAH C;  5KGU A;  1G91 A;  4OGQ C;  4EQO A;  4B3T Q;  2I46 A;  4DV7 Q;  1HNW Q;  1SYC A;  2D5D A;  2EYL A;  5H1S E;  3CP0 A;  1V1P B;  4R4I A;  1I4R A;  3A55 A;  1X9N A;  3D6W A;  3I72 A;  2AUJ D;  4DR4 L;  1YNN D;  2HHH L;  4XDX A;  3HOV G;  1NJI C;  2MGS A;  4HJA A;  1EQV A;  3CRL C;  3M3Y B;  1IZ6 A;  3SGI A;  2QEX A;  2GVA A;  1T5X D;  1D1I A;  2ICE C;  3NUC A;  1BBX C;  1EY8 A;  4DV1 L;  1I94 L;  4CJ1 B;  2AWO A;  5I6W A;  4IPH A;  4DUZ L;  1TY0 A;  1R4Q B;  5HY6 A;  4A93 G;  3BJU A;  4A75 A;  3S9W A;  4BA1 I;  5C0X J;  4K2K A;  3NPP A;  4OL7 A;  3P20 A;  5KYL A;  4XXE A;  4DNT B;  1K8G A;  1W6J A;  3D3R A;  4QMG A;  1W3S A;  1B9N A;  5C0X G;  2KA7 A;  3PO3 H;  1SEB D;  2J7Z A;  4DNI A;  3K0Y A;  4IQZ A;  1HQM C;  1MJE A;  2V1C C;  4KTA A;  3TZD A;  1JR0 D;  1KDB A;  1D2B A;  1CSP A;  2PMZ E;  1NSN S;  4QF4 A;  2IWH A;  2F4V L;  3OPO A;  4EQ5 A;  4RAU C;  1TWC B;  2DNE A;  4BXX H;  1JWU D;  2DNC A;  3EJI A;  2RDF A;  1JJC B;  1XMQ L;  3GTO B;  1Y8P B;  2KEC A;  2L55 A;  3AEV A;  3OWF A;  5FLM G;  3Q0A A;  2FHT A;  1E22 A;  4JV5 L;  2ALY B;  1O78 A;  1MKH A;  1NTG A;  1U4R A;  2Y0S G;  1EEI D;  4PZ7 A;  4KKU A;  1SNQ A;  1A62 A;  3BZK A;  4GN3 B;  4HN7 A;  2EXZ A;  1I4X A;  3HFZ B;  2ZM6 Q;  5C44 H;  1JE4 A;  2PPB C;  1O7Z A;  3TS0 A;  1D5M C;  1AP0 A;  2QIL A;  3E6Z X;  5HGT A;  4HMI A;  4DV2 L;  1BDO A;  4YWM A;  3S24 A;  1RF2 D;  1EY9 A;  4GS3 A;  1A15 A;  4N9T A;  5FO9 B;  1HTP A;  4B9W A;  3CCL A;  1DON A;  1EQT A;  2K1B A;  2D0P A;  2GVB A;  4FF3 A;  3TS2 A;  2A1A A;  2JA6 B;  2R93 H;  1K8M A;  1I50 B;  1BUV T;  2JEA I;  1YNJ D;  3BDC A;  1XNR Q;  4BY1 G;  3A74 A;  5D65 A;  2QKI C;  5JJL A;  3MXN B;  3PUX A;  1IW7 D;  4RHR A;  1IXR A;  2D2C C;  2A19 A;  3ERQ A;  1KQS A;  3K7A B;  3A56 A;  1VQL A;  4A93 B;  2B2V C;  3F2C A;  2K5W A;  5FJ8 H;  4DV0 Q;  3OMG A;  1ZXT A;  4GOP C;  5A2Q E;  2A6H C;  2ES2 A;  1S5E D;  3AFQ A;  3NBH A;  4HSV A;  4N8F A;  4K2L A;  4X62 Q;  5IYD G;  2NWG A;  4JI2 Q;  1PH7 A;  2JA7 H;  1CKN A;  2XIW A;  1E3P A;  3BYT B;  3MVV A;  2EQS A;  3HG9 A;  2F0J A;  1SRO A;  1KDC A;  1AEX A;  1A2U A;  5AFW A;  3NXW A;  4DAY B;  2E76 C;  1K83 B;  2Q8R E;  3KDF A;  4TQU S;  4KK7 A;  3UE1 A;  1X3P A;  2UUB L;  1PRT B;  1R4P B;  5JPN C;  3KJP A;  2DJF C;  3GDE A;  1KXL A;  1MHW C;  3HOY G;  4A3L G;  1GUS A;  4HIK A;  1LO5 D;  4DR5 L;  2FIN B;  1STE A;  1EWI A;  2FMM A;  2G9D A;  3A7A B;  4ULL A;  3CMA A;  1LT6 D;  2PI2 A;  4KI0 A;  1H9K A;  3CCR A;  5C4J B;  2F52 A;  3NQT A;  3K0X A;  5JJK A;  3R2T A;  4OWT B;  3AU7 A;  4JI3 L;  1LTA D;  2F3V A;  4A3I G;  5KRU A;  5GQO A;  3W1G A;  3CME A;  5TSS A;  4A3B G;  1JE5 A;  1XJV A;  1BR9 A;  3ND8 A;  1CQF A;  3L2P A;  3MXG A;  3HOV H;  1HR0 Q;  1I6H H;  4YHH Q;  4G4K A;  3BDO A;  4DR7 L;  3HOU G;  1ASY A;  1NBW A;  5CV9 A;  1CKN B;  4JI4 Q;  1LT4 D;  2KHI A;  3CRK C;  3VYU A;  4JI2 L;  4RA8 A;  1IYU A;  1VQH A;  3QOL A;  3VYR A;  2PZW A;  2IY5 B;  4QCL A;  2JE6 I;  3S1M H;  2YU9 H;  2ZXP A;  2XN9 C;  4DXF A;  3BS1 A;  2R7Z G;  4GKJ L;  1PYW D;  2RHQ B;  5HUR A;  2RF4 A;  5LHY 1;  2B2Y C;  4KV6 A;  1CHP D;  3DXJ C;  1TS5 A;  2EJM A;  3C2P A;  3I4M G;  4QL5 A;  2CW0 D;  1SMX A;  1GO3 E;  2GN5 A;  5FLX c;  2F0D A;  3CPF A;  4MTK A;  1CM9 A;  1GUG A;  5IOD A;  1ESR A;  4KLK A;  2N88 A;  4IUR A;  1EWC A;  3H3V C;  1EIG A;  3QJY A;  5KNB A;  4XQJ A;  1Z47 A;  4NPS A;  3G7L A;  2A8V A;  4DR2 L;  1GXD C;  2K5Q A;  4CKB A;  4LFC Q;  3CCM A;  1VQE A;  4NDX A;  3P75 A;  2EYP A;  2F0G A;  1RTN A;  4RGN A;  1XPO A;  5FLM H;  4NW2 A;  1Q1B A;  1Y1W G;  1I5F A;  3HOY B;  1SN8 A;  4B3M L;  5FLX E;  1SRU A;  3L7Z C;  2O4X A;  1H9J A;  1V8Q A;  1ZYR C;  2QCP X;  3NEN A;  3MEH A;  5E4X A;  5JVH 3;  2JA5 G;  4XYO A;  4M1U B;  3GTJ B;  2E2H B;  1HR0 L;  5IYB G;  4LF6 L;  2PMZ B;  4ZK9 B;  5CGK A;  3NWT A;  2HCI A;  4KD3 A;  4WJ4 A;  3OHX C;  5GAE C;  4N9P A;  3WWV A;  3HOX G;  1IYV A;  4AQY Q;  1J9O A;  3MAQ A;  2NZH A;  2OWO A;  5EJW A;  1EYD A;  3DLL A;  4A3I B;  1EYG A;  3SVM A;  5JJI A;  2Q8I B;  4A3B B;  5ELF A;  4EX5 A;  4E6I A;  3HGB A;  1EY5 A;  3RZD B;  2JSO A;  1JOQ A;  1IKL A;  3TEH B;  3UDX A;  2Z0S A;  4GLV B;  3A7L A;  4PV1 C;  2K05 A;  4DXG A;  2B39 A;  3HOU B;  4BY1 H;  1SNP A;  4LF4 Q;  4CDD C;  5E3F A;  1A63 A;  1VCI A;  3J7A F;  1EY4 A;  4ZUI A;  2F3I A;  1QCB D;  1KRT A;  4A3E H;  3G48 A;  4R8N A;  1KAA A;  1AN8 A;  1F2Y A;  4R4C A;  1WCM G;  2RA4 A;  4LJZ C;  2VQE L;  1HR0 W;  2B3G A;  1JCK B;  2OEO A;  3KF6 B;  2RDG A;  4LW1 A;  4IOA A;  1M4V A;  3SK4 A;  2NVY B;  3QO2 A;  4DFA A;  2R7Z B;  5F2D A;  5IYD H;  3ULL A;  2VZA A;  1H9M A;  5GRO A;  1BOS A;  1Y8N B;  1D7Q A;  2RSO A;  1JB7 A;  2E5L Q;  1K0S A;  1DM0 B;  1WI5 A;  4KN4 C;  1HH2 P;  2NZO A;  1L0W A;  2R7D A;  3TP8 A;  2ZJR A;  3BU2 A;  2F4I A;  4Q5V A;  2CQO A;  5HGQ A;  2VY3 A;  4DKA C;  2ATW A;  3HKZ E;  1KAW A;  3KF8 A;  1TR5 A;  1XMO L;  4ZYS A;  4L5T A;  2KVM A;  4G7Z C;  1PH6 A;  2WB1 E;  4EVO A;  1Y1W B;  4DUY Q;  4JI6 L;  1JWS D;  3GTJ H;  2B2U C;  1NR4 A;  2JA8 G;  2XGT A;  2R92 B;  5J39 A;  1UE1 A;  4JI5 Q;  2K28 A;  5DAU A;  5ELN A;  5D3I B;  4DV3 L;  2B63 G;  2O2L D;  1TII D;  2EJG C;  5C4X B;  2OTJ A;  2NN6 I;  2F0L A;  5K5P A;  5KYI A;  3M4Q A;  4C3J G;  1KDA A;  2KHJ A;  4C3H G;  2M2L A;  3EFX D;  3H15 A;  2K01 A;  3HOX B;  3CCU A;  1OO9 B;  4LNQ A;  1XX8 A;  4FF1 A;  3PIP 3;  1HZ9 A;  4A3G B;  4DNR B;  4P74 A;  4OEM B;  5IYC H;  2HD3 A;  1P16 A;  4C56 C;  3PIO A;  5ELB A;  2K5N A;  3K81 C;  2K52 A;  4FXK C;  1I4H A;  5M3F H;  1HNX Q;  1F9P A;  1KTK A;  4LF7 L;  1EIY B;  2RDH A;  1U4M A;  1Q12 A;  4JI8 Q;  1TWH H;  4H44 C;  4Q0F A;  1GUO A;  2LMC B;  4C1N I;  1FNW A;  4X66 Q;  3KLW A;  5M3M H;  4TSS A;  4KKT A;  1FD7 D;  2PW7 A;  2MHV A;  5EBC A;  1DCZ A;  3QOJ A;  3QR8 A;  3F1Z A;  3FVQ A;  3KF8 B;  3S1Q B;  3GTL H;  2A6H D;  3Q24 A;  4DU9 A;  3I4M H;  5C3X A;  1AE2 A;  1HJP A;  1VQD A;  4IAL A;  1VQK A;  4WJ3 M;  1GHK A;  4YY3 Q;  2I5L X;  3K5N A;  5I2Y A;  4X65 L;  1UNS A;  4OWW B;  2PYK A;  2CWP A;  2Q2U A;  4DPG A;  1KNE A;  3NTI A;  1VQ7 A;  3F2U A;  3DM3 A;  1CUK A;  3NBI A;  2F0H A;  1EY0 A;  1N34 Q;  2EY6 A;  1DOK A;  2EVB A;  5K36 H;  4DA2 A;  5JAV A;  3AQQ A;  4PMC A;  4YIJ A;  2VQF Q;  1GM5 A;  3ITP A;  2JA5 H;  3TP5 A;  1TVX A;  1PYS B;  4XTC S;  2JA8 B;  2YTV A;  2VXW A;  1AH9 A;  3W1B A;  1A3T A;  3HKZ G;  1HNZ L;  3ZYY X;  2B63 B;  1BBU A;  3CF5 A;  4X64 Q;  4IPD A;  4C3J B;  4C3H B;  2IHF A;  4GZY C;  3HEJ A;  1A2T A;  4UPA A;  2F3W A;  2WB1 G;  4A4I A;  4OO1 G;  3BVG A;  4C3I H;  1HPC A;  1STA A;  2VS1 A;  1PHJ A;  3KJO A;  4ZRZ A;  3S1N H;  4BA2 I;  1SYD A;  4UP9 A;  1IBK Q;  3E5S A;  4BWG B;  1NNX A;  3S2H B;  4JYA Q;  1PZK D;  2D9U A;  1TWA B;  4KHP Q;  1WCM H;  3RNU A;  4DV4 Q;  1FNV A;  3F2B A;  3MHB A;  3PSI A;  1J8I A;  3HOW G;  2ZTE A;  3KLS A;  2GA4 B;  1GOZ A;  3HOZ B;  3GTM B;  3G71 A;  1PTO B;  1YHA A;  4IN3 A;  4OX9 Q;  1X3Q A;  1E24 A;  4S3S A;  3GTK B;  5T1G A;  4K5W A;  5JOB A;  2XWB B;  1FGU A;  1PH8 A;  5M5X B;  1C48 A;  3GTG H;  2F0I A;  2EYM A;  4YWL A;  1II3 A;  1LTB D;  1PH9 A;  1U9R A;  3JC6 6;  4QY7 A;  1CHQ D;  1MI2 A;  2NVQ H;  5LL6 X;  4R4Q A;  4BY7 H;  3QWN A;  1LTI D;  1D8L A;  1UE6 A;  1QOH A;  3OTO L;  1K0R A;  3R2I A;  2F0S A;  3WOF A;  1ET6 A;  5A2Q L;  1N33 L;  4JI0 Q;  4A76 A;  4L8J A;  4DV6 Q;  4QUF A;  2JK8 A;  2BE5 C;  2PCF B;  1QVG A;  2HDL A;  2JA8 H;  1VQF A;  1DYQ A;  4J6H A;  4KY7 A;  1ZYR D;  1PH2 A;  3I90 A;  2I5M X;  3U4V A;  2B63 H;  3U9S A;  1WTP A;  2YTY A;  2DY7 A;  1LTR D;  1E1T A;  4Z9C B;  3I8Z A;  1ENA A;  3HKS A;  5CR3 A;  1HHV A;  2XTI A;  4V19 0;  3T16 A;  5NUC A;  4A3K G;  1IBM Q;  2WII B;  3OOC A;  4DR3 L;  3JAM c;  3CCS A;  4A3D G;  4NMZ A;  2WB1 B;  2ZJP A;  4ALP A;  4DV4 L;  4NXM Q;  5BN5 A;  4R4O A;  1WTV A;  1STG A;  1G2S A;  1PTO F;  3PMF A;  4LUV A;  3H3V H;  5EQ0 A;  3K5L A;  1SFO H;  3HS0 C;  3J80 c;  1VQ8 A;  2HT1 A;  3S14 H;  1QWY A;  5C4Z A;  1HRJ A;  1DJR D;  4JI7 Q;  3VR5 A;  2X6L A;  4DK1 A;  3ZJY C;  3MC0 B;  1A3V A;  3JAM E;  1HQR D;  1N8R C;  5EBD A;  2QW7 A;  1H95 A;  1OXS C;  3NWS A;  4HJ9 A;  1AW7 A;  3HOW B;  1M90 C;  1K3R A;  2UUC Q;  1EUJ A;  2RQX A;  4K6D A;  2ENB A;  1FJG Q;  1DZ1 A;  3OWE B;  3S15 B;  2K5D A;  1VQP A;  5M5X H;  1A0I A;  2KEN A;  3J80 E;  3OYY A;  3I4N H;  3NTK A;  5IGE A;  4ZLT F;  2AKW B;  2CVR A;  2J4X A;  1JT8 A;  1SXT A;  2QDB A;  2R7F A;  4OON A;  4I7A A;  4C1N K;  2JA6 G;  3FKI B;  4CDF C;  2ICI A;  1VQI A;  2WP8 J;  1BXT A;  2VW9 A;  2L4N A;  3PUZ A;  3TBI B;  4IZ8 A;  3ERS X;  1EOV A;  1HA5 A;  2PI2 E;  1AFP A;  2BCO A;  1B53 A;  2UUA Q;  4A3M G;  4GNX C;  5D14 A;  2A6E D;  2F03 A;  3H6M A;  1YHQ A;  3M4O B;  1L1O B;  1B44 D;  4AH6 A;  2QF7 A;  1VF7 A;  1HFN A;  2TSS A;  1Q46 A;  1TY2 A;  3P7J A;  1X3F A;  1VQ9 A;  4A3K B;  4OO1 H;  1E0B A;  4I7Z C;  1DXM A;  2TMP A;  3M4Y A;  4A3D B;  2A68 C;  4TVA B;  2QA4 A;  4B3R L;  2D0O A;  2RBM A;  4Y7N B;  5FLX L;  5IP9 H;  1ESF A;  4KY5 A;  1BCP B;  4B3T L;  4DV7 L;  1FJG L;  3KLR A;  1HNW L;  2Z4I A;  3W5O A;  1B8A A;  1TS4 A;  5M5Y H;  5CBE E;  4JPB W;  4LF9 Q;  1OXX K;  4ZKC B;  2UXC Q;  1I4Q A;  1CFM A;  4RGT A;  4RHS A;  2AUK A;  3IRB A;  1XNQ Q;  4ZUJ A;  4KJO A;  3CQZ B;  1U0L A;  4EGV A;  3I91 A;  1BVS A;  3RMH A;  5CV7 A;  1VMC A;  4IOC A;  1NR2 A;  2JXM B;  1N32 Q;  2K5V A;  2HUG A;  1SNM A;  1PH1 A;  1SNC A;  2L12 A;  1BKB A;  3M3Y H;  3R93 A;  1QB5 D;  3DMU A;  2NTS A;  3GD7 A;  2H4O A;  1MJC A;  4JOI A;  2H5X A;  1BF4 A;  1OXV A;  1B50 A;  3ONA B;  1I6V C;  3TQY A;  4CKE A;  4PZ6 A;  2HQL A;  4CGY B;  3I56 A;  2BDO A;  2C5C A;  3R3O A;  1Y1V B;  4NB3 A;  1V1Q A;  2MO1 A;  5M9O A;  4A3M B;  2EIF A;  1CQV A;  4DF7 A;  2J0T D;  3VDY A;  2L15 A;  4J8Q A;  4IFD J;  1BCP F;  1YHB A;  4H13 C;  3GTQ B;  5JPM C;  4LF8 Q;  4CDE C;  3SK6 A;  1WTH A;  2NB0 A;  4A3D H;  2XRS D;  2D62 A;  2NBF A;  5I2X A;  2MUY A;  4IFD G;  2E74 C;  2UU9 Q;  4Y7N H;  1VDZ A;  5GAD C;  1EYA A;  1G8Z D;  2K7V A;  2UXC L;  1RTO A;  4P2C B;  1TWC H;  1XNQ L;  2B2T A;  2QEJ C;  3LX0 A;  3GTO H;  1G6P A;  1IKM A;  2ZM6 L;  2E2I B;  4JVZ A;  1SND A;  1UE5 A;  1DD2 A;  1ICF B;  1KRS A;  2CH4 A;  1JC7 A;  2R6G A;  2SNS A;  1FGB D;  3VA5 A;  5J1Z A;  4HCS A;  1A8V A;  3S17 B;  3I55 A;  1YBY A;  4P71 A;  3H3V I;  1RCV D;  1EWH A;  4DR1 Q;  3CCE A;  3ULP A;  1XNR L;  3FDT A;  3MZ5 A;  4L5R C;  1PV4 A;  3TN2 A;  1IBL Q;  1A3U A;  1STH A;  5IWA Q;  3U50 C;  3PO2 G;  1B4O A;  2L0C A;  4QUC A;  1PRT D;  1JQY D;  1DOL A;  5BR8 Q;  2F0F A;  2JA6 H;  4JC0 A;  4DV0 L;  3NBH B;  3T1Y Q;  4QGU A;  1I50 H;  3CCQ A;  1SE3 A;  2LKV A;  3SDZ A;  2NYZ D;  1CA6 A;  4X62 L;  3PUW A;  1BQQ T;  4ME3 A;  3K7A H;  2OCE A;  4A93 H;  5L37 A;  1VS0 A;  1PDQ A;  2EYH A;  4A3M H;  2BE5 D;  3KDF B;  4LF5 Q;  1G2T A;  1RL2 A;  2L1B A;  4RCN A;  5CV8 A;  3PUY A;  2ZTD A;  2ZJQ A;  1R9T B;  2Q2I A;  3DHQ A;  5IP7 G;  3GTQ H;  1PRT F;  5C0X H;  3PGZ A;  1SLJ A;  2F0U A;  4MIU A;  5E4W C;  1C7Y A;  2N55 A;  2B2W C;  1KLU D;  1UEB A;  1TWG B;  3G4S A;  5IIF A;  2DUD A;  1D6E C;  1VQ4 A;  4GNX A;  1PH3 A;  1K83 H;  4LUZ A;  3M85 A;  2K03 A;  5EPK A;  1Q81 C;  1J5E Q;  5M5W B;  3T13 A;  1EU3 A;  1S3O A;  4QB4 A;  4JG2 A;  4OXP A;  1LT5 D;  3S1R B;  4KKS A;  3K5M A;  2H1E A;  3ULJ A;  3EN2 A;  1EU4 A;  2PNR C;  3OIQ A;  1H9S A;  1Y69 U;  2ZXR A;  1PTO C;  1GJX A;  4WRD A;  2R92 G;  1K8A C;  1V1O A;  5C4J H;  3UDG A;  5EGT A;  1PLF A;  1EIH A;  2X69 A;  4YHH L;  5C4X G;  2UXD Q;  4AYB E;  5C3E B;  1OXT A;  1Q8I A;  4JI4 L;  3CD6 A;  3EQL C;  4AIM A;  2BH2 A;  2QGQ A;  4FNF A;  3G6J B;  4L63 B;  2IX1 A;  2F0W A;  1WTR A;  4PG3 A;  3H0G G;  5KNC A;  4A3G G;  3PO2 B;  1I3Q B;  3TP7 A;  1EIF A;  3RD4 A;  4FVM A;  4BS9 A;  4FO2 A;  4EQN A;  2VB3 X;  4OWX B;  5LL6 S;  1O7L A;  3A5U A;  4MHE A;  4U67 3;  1GKH A;  4QQB X;  3O13 A;  3KLS X;  3DEP A;  3MTS A;  4U68 A;  4HSP A;  4A3C G;  4UP8 A;  3A8K E;  3K80 C;  3A54 A;  3VR6 A;  5KEE A;  5LMU Q;  1EFI D;  2A74 C;  3KYH C;  1J5E L;  1Y8O B;  1AZP A;  2A69 C;  3MFG A;  1KC8 C;  2BA1 A;  1S5B D;  3BZC A;  1MGS A;  3BZD B;  4PMW A;  1D5X C;  3EIV A;  4LFC L;  1F9S A;  2B2V A;  4GN5 A;  1H9S B;  3FP9 A;  3STB C;  4IO9 A;  4K0K Q;  4GOP A;  4JW0 A;  4LFA Q;  4G57 A;  1WTO A;  3MWY W;  1AZQ A;  1TXY A;  2F0E A;  4HID A;  1EOT A;  3K8A A;  4XQN A;  3ICE A;  4ME5 A;  2K32 A;  5I9O A;  1Q8K A;  2A68 D;  3BVZ A;  4KHV A;  3BG3 A;  3JAM i;  4A3J B;  2DY8 A;  4XT3 B;  2JA9 A;  3HRZ C;  2AHO B;  1SDF A;  3C3L A;  3HOY H;  3OMC A;  1RHP A;  4A3L H;  4HCE A;  4AQY L;  2L11 A;  5IGC A;  3RN5 A;  1VQA A;  3FPP A;  3HP3 A;  3K58 A;  1SJE D;  4RG1 A;  2LXK A;  3J80 i;  1YVC A;  3F8T A;  2E2H H;  3KOJ A;  1L0X B;  1PFM A;  4BBR G;  2A6E C;  3MXU A;  1Z6H A;  1PFB A;  4NKL A;  2MNA A;  4HAE A;  5IOC A;  2Q2T A;  1X65 A;  4DR6 Q;  3KFU A;  2ASB A;  4LF4 L;  4A3I H;  1BBW A;  4A3B H;  1STY A;  1LTL A;  2LS0 1;  4KY6 A;  2F0Q A;  4QIW B;  3H0G B;  3RZD H;  2PO4 A;  1WYD A;  3J81 c;  4LK1 C;  4KMU C;  2MP1 A;  3JAM L;  3HOU H;  4F8M A;  3GTP B;  4AYB G;  2PQA A;  4XIG S;  4DN4 M;  1CZG A;  4ZAI A;  2JQO A;  3UDF A;  4IUV A;  5COY A;  1XWE A;  2E2J B;  2G5D A;  4F87 A;  3T56 B;  1CT1 D;  2E5L L;  1SYE A;  3J80 L;  5DM6 3;  1RD9 D;  3HOZ G;  1L1O C;  2NVY H;  5CBA E;  1ET9 A;  2R7Z H;  2EYF A;  3J81 E;  5IP7 H;  1CSQ A;  5JVG 3;  2VUM B;  1P8L A;  3J7A V;  2M00 A;  1EY6 A;  2KED A;  2MO0 A;  3H91 A;  4PNY A;  3PIO 3;  4IPC A;  1HTL D;  4G7H C;  1VQG A;  3L3O C;  3KUP A;  5JEA J;  2XVS A;  3FMC A;  1JOO A;  1RJT A;  3Q23 A;  1J6Q A;  3SK5 A;  4DUY L;  1BCP C;  2IW3 A;  4MTN A;  2RCF A;  2B2Y A;  3C46 A;  2F0P A;  2BA0 A;  1SAP A;  4JI5 L;  1SJH D;  2AQ1 B;  2K75 A;  4OEL B;  3LNN A;  2NVT B;  3A8I E;  4UAI A;  2CKZ B;  4A3F B;  1WTW A;  1Y1W H;  2EZV A;  2MQH A;  2HIV A;  1XPU A;  2O5J C;  2SOB A;  2LY7 A;  2OQK A;  3K6O A;  1K9M C;  1K8O A;  2ZTC A;  2R92 H;  3IL8 A;  1VQC A;  5IYB H;  4J15 A;  4X3U A;  3KBG A;  3MEF A;  4K5X A;  2PQA B;  3FEW X;  3U4Z A;  4IUQ A;  4BBR B;  5C4X H;  1YZ6 A;  1SMY D;  1U4L A;  3K59 A;  1HNX L;  3HOX H;  1IL8 A;  4B3S Q;  2OT2 A;  4K8J A;  2XSC A;  4JI1 Q;  2CCZ A;  4JI8 L;  1Q82 C;  4IJL A;  4A3G H;  1OTC A;  4X66 L;  4JBW A;  3N52 A;  2CH4 W;  4CBV A;  2PZU A;  2MPM A;  4RKL A;  2IL8 A;  2KBN A;  2NZ1 D;  3RR5 A;  2G9H D;  4X6A H;  1VQN A;  2UXB Q;  1N36 Q;  5CV4 A;  4NXN Q;  5J3B A;  3UI2 A;  1NMF A;  3TDQ A;  4AYB B;  5LMN Q;  4NP5 A;  4A3C H;  3QB3 A;  4MN3 A;  5DEH A;  3PO3 G;  2YV5 A;  4X3S A;  2F1M A;  3SXH A;  1DGS A;  4YY3 L;  5BN4 A;  3K57 A;  3I2Z A;  3WOE A;  4FF2 A;  3S1Q H;  3PQI A;  5EAY A;  3NQI A;  1QIL A;  1NMG A;  4R1J A;  3H09 A;  1SYF A;  2E8G A;  2WV6 D;  5IGB A;  3VR2 A;  4BBS B;  1T9H A;  1NCV A;  1PVO A;  4ZKB B;  1PA6 A;  1N34 L;  1SE8 A;  1SYG A;  4K5V A;  1GHJ A;  5FK9 C;  2NVX B;  1EQR A;  3E0E A;  1JIC A;  2LFN A;  1PRT C;  1KHI A;  1O7I A;  2VQF L;  3L9A X;  3FKI G;  3ER0 A;  3AFP A;  2AQ3 B;  2CQA A;  2CWA A;  2OXP A;  5CV6 A;  1PXU A;  1MIU A;  5ISR A;  4R8I A;  4H0L C;  5AJ3 Q;  4FXD A;  3H94 A;  1UE7 A;  1V9P A;  5C44 G;  1KL9 A;  1KIX A;  4X64 L;  3I4O A;  4IUP A;  5IT9 E;  1QJO A;  3MFY A;  3T1H Q;  1STB A;  2WKC A;  1S5D D;  3URY A;  3R8B A;  1PTO D;  1K28 A;  1TT2 A;  4HMJ A;  1S5C D;  2B29 A;  2EDG A;  3J7Z C;  3A0J A;  4C3J H;  4C3H H;  1IBK L;  2B2U A;  2EPB A;  2PW5 A;  4DAV A;  5LMN L;  5IGD A;  5IE8 A;  1PH5 A;  1V1P A;  4JYA L;  3F2D A;  5FO7 B;  4KHP L;  4DR4 Q;  2HHH Q;  3CW2 C;  4YWK A;  3OW2 A;  5FJ8 G;  1EQQ A;  3CHB D;  2EYO A;  2YTX A;  2RHS B;  3LWE A;  1Z9F A;  4P75 A;  4OX9 L;  4DV1 Q;  1I94 Q;  3S2H H;  1EYC A;  3DEO A;  1XTD A;  2OQ0 A;  1TWA H;  5C5L A;  1PZI D;  4DUZ Q;  3PO3 B;  1MSG A;  1O80 A;  1YIJ A;  2F0T A;  1B7Y B;  1S4Z A;  5CV5 A;  3HOZ H;  3OW7 A;  3GTM H;  2VL6 A;  3GV6 A;  3UE0 A;  1PTO H;  3LGJ A;  3V96 A;  2PQE A;  1U5K A;  1K73 C;  3GTK H;  4QJF A;  1LTT D;  2A69 D;  2NN6 G;  5LMN W;  1LTS D;  3K5O A;  5IGG A;  1KAB A;  4F7X A;  1NE3 A;  3J7A 5;  3STB D;  4JI0 L;  1YJ9 A;  3QIA A;  4R4T A;  3NEL A;  1JB3 A;  4DV6 L;  2OF1 A;  2DGY A;  3LWU A;  3NP8 A;  2OTL A;  1UUP A;  2Z6B A;  2WIN B;  4RGM A;  5EPJ A;  2VNU D;  2NTT A;  2CFM A;  3E9H A;  1ROD A;  1EEF D;  2F4V Q;  1QG7 A;  2XWJ B;  2K4K A;  4WJW A;  1LAB A;  1X55 A;  4DAM A;  3ERO A;  1XMQ Q;  3E3X A;  3IAY A;  1FR3 A;  2JN4 A;  5G3L F;  5C44 B;  2DN8 A;  3A8J E;  1IBM L;  1GVP A;  2DJG C;  1YJN A;  4JV5 Q;  4JBM A;  2MJ8 A;  1AE3 A;  3CC4 A;  1Y1V G;  5I9P A;  3IKJ A;  4IUT A;  2EYJ A;  2F0N A;  4NXM L;  3NHH A;  1VQ6 A;  1HXY D;  3CC2 A;  2KOL A;  2R93 B;  2KCC A;  1JOR A;  2BOS A;  2KQ3 A;  4FF4 A;  4IUU A;  4RWS C;  4WOR A;  4ID6 A;  4DV2 Q;  3DUZ A;  4IPG A;  4JI7 L;  3PV0 A;  2K5H A;  1YNX A;  5T1I A;  2UUC L;  2F0M A;  2IPK D;  5DLQ E;  5EKI A;  4FYD A;  2IHE A;  2WAQ G;  2JA7 B;  5C4H A;  3C1F A;  4L6T B;  1QVF A;  2ZXO A;  4MNO A;  1CZW A;  4FXG C;  1STN A;  5IY0 A;  3MXN A;  3HOW H;  1LAC A;  4X3K A;  5CC4 A;  1VQJ A;  3NE5 B;  3D6C A;  3S15 H;  4YCV A;  4ABN A;  1TWF B;  1Q86 C;  2Z9H A;  3T53 B;  1N9W A;  4UP7 A;  1W6K A;  1JOK A;  1LYL A;  3W2D A;  4EQP A;  3FKI H;  3OSO A;  4OIJ A;  3N6R A;  1BCP D;  2UUA L;  4GLX A;  2UUB Q;  4DAY A;  3BDL A;  4JBK A;  1B3Q A;  5C5M A;  2EJF C;  3V2T A;  1UWV A;  4G7O C;  5BN3 A;  1C9O A;  2EY2 A;  1HZC A;  2HQE A;  4PZ8 A;  1IL2 A;  1M8A A;  5I4D A;  2RVL A;  3W3A A;  5FO8 B;  4DR5 Q;  1F2M A;  3TSS A;  4YCW A;  4R9W A;  2VB2 X;  1C4Q A;  4XYQ A;  3M4O H;  1TU2 B;  3HOV B;  1B3A A;  4KHZ A;  4CKC A;  4IUN A;  3EA6 A;  1I6H B;  1X3E A;  2EY5 A;  2K14 A;  4A3K H;  4JI3 Q;  1VMP A;  1IYJ B;  1B70 B;  2AWN A;  2KEE A;  3D4R A;  4DAP A;  4L5S A;  4A3E G;  4CJ0 B;  2PNH A;  1G6Z A;  4LF9 L;  1BO0 A;  1F77 A;  4PMB A;  3DWA A;  1WOC A;  1Q3L A;  2L5T A;  1W2B A;  3S1M B;  3PF5 A;  2YU9 B;  4DR7 Q;  2N49 A;  4RH6 A;  1HUN A;  2V4D A;  3ND9 A;  2WKD A;  4RGO S;  4LAA A;  4CDC C;  1QZG A;  3J81 i;  5COR A;  1F9R A;  3VA7 A;  3VYT A;  2E75 C;  4Y52 H;  4GLA C;  3A5Z B;  2WAQ B;  2A5H A;  1QVC A;  4QIW E;  3TP6 A;  4J1M A;  1KD1 C;  1N32 L;  3SE0 A;  1JWM D;  3CU7 A;  2E2D C;  1LUZ A;  3CQZ H;  1CKO A;  1FVI A;  1RKN A;  1SMY C;  4GKJ Q;  3C1E A;  5EPL A;  3CC7 A;  1QNU A;  1TWF H;  3DWQ A;  3Q6S A;  5C3E G;  3M4P A;  1VQ5 A;  1L2F A;  1UEA B;  2NN6 H;  1EY7 A;  3RLN A;  1ZEQ X;  3P1H A;  3KK7 A;  4ODG A;  2EOT A;  3M7G A;  1FNU A;  2LSS A;  4XT1 B;  3OIP A;  4C2M B;  2PZT A;  3NSW A;  3SK8 A;  4DK6 C;  1QZH A;  3RLF A;  3T51 B;  4OHJ A;  4YCU A;  2Y0S B;  1HFG A;  3AB9 A;  4O1N A;  4DR2 Q;  3QG1 A;  1CI3 M;  1Q7Y C;  3J81 L;  3FHW A;  4HIO A;  4LF8 L;  3RN2 A;  4B3M Q;  4FP5 D;  3I70 A;  3B6Y A;  4RKB A;  1PMR A;  2KJX A;  1EZ8 A;  1Y1V H;  3FPU B;  2UU9 L;  1TQO A;  3AYH B;  5IYC G;  4LF6 Q;  1B2T A;  4P73 A;  5DM7 3;  5M3F G;  1VQO A;  3U9O A;  1UAP A;  3E0J A;  4BY1 B;  1WFQ A;  1MSH A;  2SNM A;  5E1F A;  5M3M G;  3G6E A;  1WVL A;  3WDN A;  4LMQ D;  4A3E B;  2K6A A;  4OIK A;  2KCM A;  1E2V A;  4A3J G;  3TRE A;  1EZ6 A;  4UDU C;  4RMF A;  2Q8T A;  2IX3 A;  4HED A;  1QUQ A;  2Z6K C;  2CHB D;  2RKS A;  3I3C A;  2E2I H;  4I65 A;  1CTM A;  4ZQ3 A;  3HZX A;  3I7F A;  4DR1 L;  1RDP D;  4OO1 I;  1IBL L;  2WFW A;  5IWA L;  2XRQ D;  5FKA C;  1QNK A;  1KLG D;  2VQE Q;  5C6A A;  1ML0 D;  1F2Z A;  3CCV A;  5BR8 L;  3S17 H;  1LV9 A;  1GUT A;  3T1Y L;  2I5H A;  3VR3 A;  3EBE A;  3KF6 A;  4B9X A;  1X3G A;  1WD0 A;  4DGZ A;  1ZKO A;  4CJ2 C;  4C2M H;  1TS3 A;  3X3M A;  2FXQ A;  1WTX A;  5K36 G;  1T5E A;  1SE4 A;  1FYC A;  3GV3 A;  3TME A;  3CXC A;  3J7Y W;  5KND A;  4LF5 L;  1VQM A;  1OXU A;  2LXJ A;  1PZJ D;  5C3W A;  1XPR A;  1XMO Q;  2KCN A;  4L5Q A;  1I4P A;  1X32 A;  4GNX B;  2EE1 A;  4JI6 Q;  1HZA A;  2SEB D;  5EKK A;  4C3I G;  1R9T H;  2QDL A;  1GD7 A;  1XXG A;  3L0O A;  1QUQ B;  4K14 A;  2VUM G;  2K04 A;  3PUV A;  1SE2 A;  4DV3 Q;  4APV A;  3M9B A;  1G51 A;  3KBX A;  3VR4 A;  4KN7 C;  1TWG H;  4DK3 C;  5M3F B;  2ZT9 C;  3SEB A;  3V05 A;  1SNO A;  3CAM A;  3X3N A;  1S40 A;  1TWH B;  4IFD H;  1EL0 A;  1BNZ A;  1L0Y B;  4IJH A;  2WAC A;  2F0V A;  1PFS A;  1TS2 A;  5M3M B;  5M5W H;  1RIP A;  3AMU A;  3EVQ A;  5IT9 L;  1G29 1;  1HCZ A;  3IFD A;  3S1R H;  4TRD A;  3CPW A;  4LF7 Q;  4JK1 C;  1FL0 A;  3I4L A;  2UXD L;  4A3F G;  4FDB A;  4LFB Q;  3GTL B;  4X3T A;  3I4M B;  1X54 A;  5ELO A;  2NUC A;  1SSO A;  1YNN C;  3IFT A;  1WJJ A;  2JJQ A;  4B08 A;  4GKK Q;  4POG A;  2YYZ A;  5C3E H;  1LT3 D;  5A35 A;  3K7U C;  4TKO B;  4BY7 G;  1B1Z A;  3CKI B;  3PIP A;  1GUN A;  4GN4 B;  1CA5 A;  4HR7 B;  4X65 Q;  2HCC A;  1XYI A;  3PO2 H;  3RLO A;  3RZO B;  5J22 A;  1I3Q H;  2X6G A;  1GUW A;  2JYO A;  5LMU L;  1C8C A;  2JA5 B;  1TKW B;  5DNF A;  2O5I C;  4JBJ A;  1D5Z C;  3CCJ A;  2EXD A;  1MD2 D;  2F0O A;  4HTH A;  4H7B A;  2N3S A;  4GOP B;  1HUM A;  2FMC A;  1F2L A;  1Z7T A;  3FRP B;  4K0K L;  1X6O A;  4LFA L;  1YIT A;  2N8N A;  5ELC A;  4C3I B; 
#chains in the Genus database with same CATH homology
 3CPF A;  4HJ7 A;  4IOC A;  1E1O A;  4C3J H;  4C3H H;  1IBK L;  4KLK A;  1N32 Q;  1HNZ Q;  2K5V A;  5LMN L;  1PH1 A;  4BBS G;  5IE8 A;  1PH5 A;  1LM0 A;  1BKB A;  1Z47 A;  3M3Y H;  4NPS A;  2A8V A;  4JYA L;  1SR3 A;  4LFB L;  4H02 A;  3F2D A;  4DR2 L;  4KHP L;  4DR4 Q;  4LFC Q;  2HHH Q;  3CW2 C;  1VQE A;  4YWK A;  3CCM A;  3GD7 A;  3OW2 A;  1XPO A;  1PH4 A;  5FJ8 G;  1EQQ A;  4POF A;  5FLM H;  1MJC A;  1Q1B A;  4JOI A;  1Y1W G;  1I5F A;  2H5X A;  4A3J H;  1SN8 A;  4B3M L;  1OXV A;  2YTX A;  1SRU A;  2RHS B;  3L7Z C;  2I0Q A;  4GKK L;  1Z9F A;  3NEN A;  4P75 A;  3TQY A;  5JEA G;  4OX9 L;  4DV1 Q;  1I94 Q;  3S2H H;  1XTD A;  2JA5 G;  2OQ0 A;  1TWA H;  2HIX A;  4PZ6 A;  2HQL A;  4DUZ Q;  5IYB G;  5C0X I;  3I56 A;  1HR0 L;  4LF6 L;  1YIJ A;  3PF4 A;  1Y14 B;  4P72 A;  4DR6 L;  1B7Y B;  4NB3 A;  1V1Q A;  2MO1 A;  2EIF A;  3HOZ H;  4WJ4 A;  5GAE C;  3WWV A;  3HOX G;  2VL6 A;  3VDY A;  2L15 A;  3GTM H;  4AQY Q;  3I4N G;  3UE0 A;  4UY8 C;  4IFD J;  2Z6K A;  2NZH A;  1YHB A;  3LGJ A;  2OWO A;  3Q8D A;  3DLL A;  1EYG A;  1U5K A;  1K73 C;  2IX0 A;  4LF8 Q;  3GTK H;  5JJI A;  4QJF A;  2NN6 G;  4HJ8 A;  5LMN W;  4A3D H;  2D62 A;  3D31 A;  2K50 A;  2MFI A;  4IFD G;  4EX5 A;  1NE3 A;  3J7A 5;  3D0F A;  3STB D;  4Y7N H;  2UU9 Q;  5GAD C;  1YJ9 A;  4JI0 L;  4R4T A;  3TEH B;  3UDX A;  2Z0S A;  3NEL A;  4GLV B;  4DV6 L;  3M7N A;  2DGY A;  3RZO H;  2UXC L;  1HZB A;  1TWC H;  2OTL A;  2ID0 A;  3GO5 A;  3H0G H;  4BY1 H;  4LF4 Q;  1XNQ L;  1A63 A;  1VCI A;  2VNU D;  3GTO H;  2CFM A;  3E9H A;  1M1K C;  2F3I A;  1KRT A;  4A3E H;  3G48 A;  2F4V Q;  1G6P A;  3GTP H;  2ZM6 L;  3UDI A;  2K4K A;  3E9I A;  4R4C A;  1UE5 A;  1X55 A;  4DAM A;  1VQB A;  1WCM G;  3OTO Q;  2JEB I;  1XMQ Q;  1KRS A;  2VQE L;  1HR0 W;  2B3G A;  3KF6 B;  4LW1 A;  2R6G A;  2E2J H;  4IOA A;  1IBM L;  1GVP A;  1N33 Q;  1YJN A;  2ATW A;  3ULL A;  5IYD H;  4DV5 Q;  4JV5 Q;  2VZA A;  4JBM A;  1AE3 A;  5GRO A;  1Y1V G;  3CC4 A;  1C0A A;  1D7Q A;  4NXM L;  1A8V A;  3I55 A;  1VQ6 A;  1YBY A;  4P71 A;  1JB7 A;  3H3V I;  2N78 A;  2VUM H;  4DR1 Q;  3CCE A;  2E5L Q;  3ULP A;  1XNR L;  3CC2 A;  4L5R C;  1WI5 A;  4MZ9 A;  1HH2 P;  2NZO A;  1L0W A;  1PV4 A;  1IBL Q;  5IWA Q;  2R7D A;  5IP9 G;  3U50 C;  2Q2H A;  2ZJR A;  3PO2 G;  3BU2 A;  4O2D A;  4BXX G;  2C35 B;  4DV2 Q;  1PYB A;  2CQO A;  4IPG A;  2VY3 A;  4DKA C;  5BR8 Q;  5HGQ A;  5IT9 c;  3HKZ E;  1KAW A;  4JC0 A;  4DR3 Q;  4JI7 L;  4DV0 L;  2JA6 H;  3NBH B;  3T1Y Q;  4QGU A;  1I50 H;  3PV0 A;  3CCQ A;  1XMO L;  2K5H A;  4L5T A;  4X62 L;  1PH6 A;  1YNX A;  2KCT A;  2WB1 E;  3PUW A;  1YI2 A;  4ME3 A;  4DUY Q;  2UUC L;  4JI6 L;  4LWC A;  5DLQ E;  3GTJ H;  3K7A H;  2OCE A;  2JA8 G;  2NVT H;  4A93 H;  1JJG A;  2IHE A;  2XGT A;  1VS0 A;  2WAQ G;  1UE1 A;  4A3F H;  1QVF A;  3J81 j;  1Q1E A;  4JI5 Q;  4A3M H;  3KDF B;  4LF5 Q;  1RL2 A;  4MNO A;  5ELN A;  3S2D H;  1CKM A;  4B3S L;  4DV3 L;  2B63 G;  3PUY A;  2AMC B;  2ZTD A;  4JI1 L;  2ZJQ A;  2OTJ A;  2NN6 I;  2RCN A;  5IY0 A;  1YJW A;  3HOW H;  2BH8 A;  2Q2I A;  3M4Q A;  5IP7 G;  2KHJ A;  3GTQ H;  1VQJ A;  1NY4 A;  4JOI C;  3H15 A;  4IFD I;  3PGZ A;  3CCU A;  1SLJ A;  1S72 A;  4BBR H;  1C7Y A;  4LNQ A;  3S15 H;  4YCV A;  1HZ9 A;  1UEB A;  1ASZ A;  1Q86 C;  3G4S A;  1VQ4 A;  2DUD A;  1JJ2 A;  4LUO A;  1N9W A;  4P74 A;  5GAG C;  5IYC H;  4GNX A;  1N36 L;  1P16 A;  1PH3 A;  4NXN L;  2UXB L;  3PIO A;  2R93 G;  1K83 H;  2K5N A;  4LUZ A;  3M85 A;  1EFW A;  4UP7 A;  3K81 C;  2K52 A;  5M3F H;  1Q81 C;  1HNX Q;  4LF7 L;  1J5E Q;  1EIY B;  2WAQ E;  1LYL A;  1S3O A;  1Q12 A;  4JI8 Q;  3FKI H;  4DV5 L;  1TWH H;  4JG2 A;  4OXP A;  2UUA L;  4GLX A;  4O0A A;  4X66 Q;  3KLW A;  5M3M H;  2UUB Q;  3ULJ A;  4JBK A;  3EN2 A;  3NEM A;  3U58 A;  1UWV A;  1X56 A;  1E7Z A;  3F1Z A;  1V43 A;  4JCV E;  1C9O A;  1HZC A;  4HJ5 A;  4PZ8 A;  1K8A C;  2R92 G;  3KF8 B;  2JA7 G;  1IL2 A;  5C4J H;  3UDG A;  1JMC A;  3GTL H;  4DR5 Q;  3I4M H;  3TRZ A;  4YCW A;  4YHH L;  1AE2 A;  1HJP A;  5C4X G;  2UXD Q;  1VQD A;  4AYB E;  1VQK A;  4WJ3 M;  1OXT A;  3M4O H;  4YY3 Q;  2I5L X;  1YEZ A;  4X65 L;  4KHZ A;  4JI4 L;  3CD6 A;  4OWW B;  2Y0S E;  4AIM A;  2BH2 A;  1X3E A;  2QGQ A;  2CWP A;  2K14 A;  4A3K H;  2Q2U A;  2IX1 A;  4HIM A;  2IT1 A;  3H0G G;  4PG3 A;  4DPG A;  4JI3 Q;  1IYJ B;  1B70 B;  5E7N A;  2AWN A;  5AJ3 L;  1VQ7 A;  4L5S A;  2NVX H;  4A3E G;  3DM3 A;  3PCO B;  3S16 H;  1CUK A;  2PNH A;  1EIF A;  1L1O A;  4LF9 L;  1N34 Q;  4OWX B;  1WOC A;  3A5U A;  1GKH A;  3T1H L;  1W2B A;  4B3R Q;  4QQB X;  3PF5 A;  4DR7 Q;  2N49 A;  3AQQ A;  4A3C G;  1QZG A;  4UP8 A;  3J81 i;  5GAH C;  2VQF Q;  1GM5 A;  2JA5 H;  3K80 C;  4B3T Q;  4DV7 Q;  1PYS B;  4XTC S;  1HNW Q;  4Y52 H;  4GLA C;  2YTV A;  3A5Z B;  5LMU Q;  1AH9 A;  1QVC A;  4QIW E;  3W1B A;  3HKZ G;  1KD1 C;  1N32 L;  1HNZ L;  3KYH C;  3CP0 A;  4R4I A;  5H1S E;  1J5E L;  4LF8 L;  1X9N A;  1BBU A;  1LUZ A;  3CQZ H;  4X64 Q;  1CKO A;  3CF5 A;  1FVI A;  2BA1 A;  4IPD A;  1KC8 C;  4GKJ Q;  2IHF A;  3CC7 A;  3BZC A;  1TWF H;  5C3E G;  1VQ5 A;  4UPA A;  3M4P A;  2WB1 G;  1L2F A;  4DR4 L;  4PMW A;  4A4I A;  4OO1 G;  4C3I H;  3EIV A;  4LFC L;  3STB C;  4IO9 A;  3FP9 A;  4GN5 A;  3RLN A;  1NJI C;  2HHH L;  3HOV G;  2VS1 A;  1PHJ A;  4K0K Q;  4HJA A;  4GOP A;  4LFA Q;  3KJO A;  2LSS A;  1IZ6 A;  3SGI A;  2QEX A;  2GVA A;  1TXY A;  4HID A;  3S1N H;  3K8A A;  3ICE A;  4BA2 I;  1Q8K A;  4DV1 L;  4UP9 A;  1I94 L;  3JAM i;  2AWO A;  1IBK Q;  4DK6 C;  4IPH A;  4DUZ L;  1QZH A;  2JA9 A;  5HY6 A;  3RLF A;  3BJU A;  4A93 G;  4YCU A;  4A75 A;  4BA1 I;  5C0X J;  2AHO B;  4JYA Q;  3HOY H;  4DR2 Q;  4A3L H;  4KHP Q;  1WCM H;  4AQY L;  3RNU A;  4DV4 Q;  1Q7Y C;  3FHW A;  3F2B A;  3RN5 A;  3PSI A;  3HOW G;  1K8G A;  1VQA A;  2ZTE A;  3J80 i;  4RG1 A;  1W3S A;  2LXK A;  1YVC A;  3F8T A;  5C0X G;  3G71 A;  4HIO A;  3KOJ A;  3RN2 A;  4DNI A;  4B3M Q;  3PO3 H;  3B6Y A;  4BBR G;  1YHA A;  1MJE A;  2V1C C;  4OX9 Q;  1Y1V H;  2UU9 L;  1E24 A;  2MNA A;  3AYH B;  5IYC G;  4LF6 Q;  1FGU A;  1PH8 A;  2Q2T A;  4P73 A;  1X65 A;  4DR6 Q;  3KFU A;  3GTG H;  2ASB A;  4LF4 L;  4YWL A;  4A3I H;  5M3F G;  1BBW A;  1CSP A;  1VQO A;  2PMZ E;  4A3B H;  1LTL A;  1PH9 A;  3JC6 6;  4QY7 A;  2NVQ H;  2F4V L;  4EQ5 A;  4R4Q A;  4BXX H;  1WFQ A;  4BY7 H;  1D8L A;  1UE6 A;  3RZD H;  1WYD A;  3J81 c;  5M3M G;  1JJC B;  1K0R A;  3OTO L;  1XMQ L;  3G6E A;  3AEV A;  2KCM A;  3HOU H;  4AYB G;  5FLM G;  2PQA A;  4XIG S;  4A3J G;  3TRE A;  1N33 L;  4JI0 Q;  4RMF A;  1E22 A;  4JV5 L;  2ALY B;  4DV6 Q;  1QUQ A;  4A76 A;  2Z6K C;  2Y0S G;  1MKH A;  1NTG A;  2JQO A;  2JK8 A;  3UDF A;  1QVG A;  2E2I H;  4PZ7 A;  2JA8 H;  1VQF A;  1A62 A;  3BZK A;  3I7F A;  4GN3 B;  1PH2 A;  3HFZ B;  4DR1 L;  2E5L L;  2I5M X;  2ZM6 Q;  3U4V A;  5C44 H;  2B63 H;  2YTY A;  3HOZ G;  4OO1 I;  1L1O C;  1E1T A;  2NVY H;  3TS0 A;  2R7Z H;  1IBL L;  2WFW A;  5IWA L;  3HKS A;  5IP7 H;  1CSQ A;  2VQE Q;  2XTI A;  1P8L A;  4DV2 L;  4A3K G;  4YWM A;  5BR8 L;  3S24 A;  3CCV A;  1IBM Q;  2MO0 A;  3S17 H;  4GS3 A;  4DR3 L;  3JAM c;  3CCS A;  2I5H A;  4IPC A;  3EBE A;  3T1Y L;  4A3D G;  1VQG A;  3KF6 A;  4BBS H;  1X3G A;  3CCL A;  2ZJP A;  4ALP A;  5JEA J;  3TS2 A;  2D0P A;  2GVB A;  4C2M H;  4DV4 L;  4NXM Q;  2A1A A;  2R93 H;  1J6Q A;  2FXQ A;  4R4O A;  4DUY L;  2JEA I;  1XNR Q;  4MTN A;  5K36 G;  4BY1 G;  3A74 A;  3H3V H;  4LUV A;  2BA0 A;  5JJL A;  3MXN B;  4JI5 L;  3PUX A;  3CXC A;  1SFO H;  1VQM A;  1IXR A;  3J80 c;  1VQ8 A;  4LF5 L;  2HT1 A;  1OXU A;  2A19 A;  2K75 A;  2LXJ A;  1KQS A;  3S14 H;  1VQL A;  3F2C A;  4JI7 Q;  2CKZ B;  3ZJY C;  5FJ8 H;  4DV0 Q;  1Y1W H;  4GOP C;  2MQH A;  1XPR A;  2HIV A;  1N8R C;  1XMO Q;  1XPU A;  2ES2 A;  4L5Q A;  1K9M C;  1OXS C;  2OQK A;  1H95 A;  4HJ9 A;  4GNX B;  2ZTC A;  3AFQ A;  1PH7 A;  4X62 Q;  2R92 H;  2JA7 H;  5IYD G;  4JI2 Q;  1M90 C;  1K3R A;  2UUC Q;  1VQC A;  4JI6 Q;  1CKN A;  1EUJ A;  1HZA A;  1FJG Q;  5IYB H;  4J15 A;  1E3P A;  3MEF A;  3U4Z A;  2PQA B;  5C4X H;  1R9T H;  2EQS A;  1YZ6 A;  1VQP A;  5M5X H;  1SRO A;  1GD7 A;  3L0O A;  1QUQ B;  1A0I A;  2VUM G;  1HNX L;  2KEN A;  3HOX H;  3PUV A;  3OYY A;  4B3S Q;  4DV3 Q;  3I4N H;  4JI1 Q;  4APV A;  2CCZ A;  4JI8 L;  1Q82 C;  3M9B A;  4DAY B;  2AKW B;  3KDF A;  4TQU S;  1G51 A;  4IJL A;  3UE1 A;  4A3G H;  1TWG H;  4DK3 C;  1OTC A;  4X66 L;  1JT8 A;  2R7F A;  4JBW A;  2UUB L;  3KJP A;  3CAM A;  4OON A;  1S40 A;  3GDE A;  2JA6 G;  2KBN A;  1KXL A;  3RR5 A;  4X6A H;  1VQI A;  2WP8 J;  4IJH A;  3HOY G;  5M5W H;  1PFS A;  1VQN A;  4A3L G;  2UXB Q;  1RIP A;  2VW9 A;  1N36 Q;  3PUZ A;  4NXN Q;  1G29 1;  5J3B A;  4HIK A;  1NMF A;  3S1R H;  3CPW A;  5LMN Q;  4DR5 L;  4LF7 Q;  4A3C H;  1EWI A;  3ERS X;  1EOV A;  1FL0 A;  3PO3 G;  3CMA A;  2PI2 E;  2PI2 A;  4KI0 A;  2YV5 A;  2UXD L;  4A3F G;  3CCR A;  4FDB A;  2UUA Q;  1DGS A;  4YY3 L;  2F52 A;  4LFB Q;  4A3M G;  3I2Z A;  4GNX C;  1X54 A;  3K0X A;  5ELO A;  5JJK A;  5FLX c;  4OWT B;  3S1Q H;  1YHQ A;  5EAY A;  4JI3 L;  4A3I G;  5GQO A;  3W1G A;  1L1O B;  1WJJ A;  2JJQ A;  4AH6 A;  1NMG A;  3CME A;  1JE5 A;  4POG A;  4A3B G;  2YYZ A;  4R1J A;  4A3G G;  4GKK Q;  5C3E H;  1XJV A;  1Q46 A;  2E8G A;  1X3F A;  1VQ9 A;  1T9H A;  3L2P A;  1PVO A;  1PA6 A;  3HOV H;  3K7U C;  1SE8 A;  1N34 L;  1HR0 Q;  4BY7 G;  1I6H H;  4YHH Q;  4TVA B;  3PIP A;  2QA4 A;  1EQR A;  4B3R L;  4DR7 L;  2D0O A;  3E0E A;  3HOU G;  1ASY A;  4GN4 B;  1NBW A;  1CKN B;  4X65 Q;  1KHI A;  1O7I A;  4JI4 Q;  2KHI A;  5IP9 H;  3PO2 H;  3RLO A;  2VQF L;  4JI2 L;  1I3Q H;  3FKI G;  3ER0 A;  3AFP A;  4B3T L;  4DV7 L;  1FJG L;  1VQH A;  1HNW L;  2CWA A;  3W5O A;  5LMU L;  1B8A A;  1MIU A;  5M5Y H;  2IY5 B;  5AJ3 Q;  2JE6 I;  3S1M H;  2YU9 H;  2E2H H;  1UE7 A;  1V9P A;  4JBJ A;  1KL9 A;  5C44 G;  1KIX A;  4LF9 Q;  4X64 L;  3I4O A;  1OXX K;  3CCJ A;  2EXD A;  2R7Z G;  2UXC Q;  4GKJ L;  3T1H Q;  2N3S A;  4GOP B;  3IRB A;  2RHQ B;  1XNQ Q;  2RF4 A;  4K0K L;  1X6O A;  3I4M G;  4QL5 A;  4LFA L;  1U0L A;  1YIT A;  1SMX A;  2B29 A;  3J7Z C;  1GO3 E;  2GN5 A;  2N8N A;  1BVS A;  3A0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...