4JI7Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7Q00
1LTLA 1WCMG 4A3EH 2BH8A 4ALPA 2ZTEA 1B7YB 1LM0A 2K50A 4LW1A 3K81C 4A4IA 4HJAA 4GOPC 2K4KA 3ER0A 4MNOA 4RMFA 2R92H 3F8TA 2V1CC 4GKJQ 5GAEC 1W2BA 1V1QA 1YIJA 1KQSA 4DAMA 3KJPA 3K0XA 4X65Q 4DR4Q 5ELNA 4DR3Q 1UE5A 4JOIC 4BBSG 4DV1L 1Q82C 1PH8A 3ULLA 4DUYQ 4ME3A 4DV5L 1FJGQ 1L1OA 1J5EQ 3MEFA 3JAMc 2AHOB 1I94L 3H0GH 3PUZA 5C4XG 2L15A 4PG3A 2ZJRA 4LFAL 1C9OA 1LYLA 2MO0A 4OX9L 4DKAC 1IL2A 1QUQA 1YHQA 4C3HH 2KENA 3G48A 1E3PA 1XMOL 1HNXL 2Z0SA 4YY3L 1Q1EA 3UE0A 2UUAQ 3GTQH 2I5HA 4YHHL 4JV5L 2IY5B 2UU9L 4POGA 2IX0A 2C35B 1E24A 1SN8A 2RHSB 1XMQQ 3HKZG 3NEMA 2IX1A 1SRUA 1YI2A 4DK3C 4NXMQ 4O0AA 1VQ8A 4JI6L 4DPGA 1O7IA 2QEXA 5LMNW 1Q1BA 4DV0Q 3CPFA 3TS2A 3S1QH 4FDBA 2LXJA 4AIMA 4LF6L 3BJUA 3CP0A 3PIOA 2ZJPA 3ICEA 1XPUA 1VQEA 2KHIA 1U0LA 3GD7A 4A3KH 3OYYA 1CUKA 2ATWA 4GN5A 1CKOA 1JE5A 3E9HA 4DV1Q 2NVTH 3A0JA 4JI2L 1D8LA 5IWAL 1YEZA 4B3TL 1VCIA 2BA1A 4QIWE 3HOVG 5C0XJ 4R4TA 1VQ5A 3M3YH 4AYBG 2CWPA 1XTDA 2GN5A 1K83H 3RLFA 2YTYA 5AJ3Q 1JJGA 2EQSA 2CFMA 1RIPA 3KLWA 1YNXA 4YY3Q 4YHHQ 4A3MH 4JI7L 4XIGS 4A3GH 1TWGH 2IHFA 1IXRA 4BA2I 2GVBA 4TQUS 1L2FA 4LUZA 5M5WH 4IJLA 4YCWA 4B3SL 3PUXA 3BU2A 5C0XI 3KF6A 3HOUH 4DV4L 3Q8DA 4JI6Q 3BZKA 5C44G 4AH6A 2VUMG 1R9TH 3CCSA 3AFPA 4GS3A 2N78A 4GOPA 1DGSA 5EAYA 2F4VQ 1YITA 2YU9H 2PMZE 4DR5L 4UP7A 3E0EA 5FLMH 1UEBA 3PCOB 3FHWA 4P71A 1QVFA 4P75A 1IYJB 2UUBL 3PO3G 4DV2Q 1A0IA 2CQOA 3RR5A 3U4ZA 4JOIA 4DR2L 4LF9L 1E1OA 4DV3L 1HNZL 4YCUA 5M5YH 1YJNA 2YTXA 4L5QA 3UDXA 1HNWQ 1UE7A 3W1BA 1BVSA 4C2MH 1GO3E 1I5FA 2KCTA 2JJQA 3JC66 4B3RL 1VQAA 3HOZG 4A3IH 1HZAA 1VQPA 4X64L 5K36G 1TWAH 2VS1A 4DV6L 4GLXA 3PSIA 1ASZA 1VQBA 1IBKL 2WB1E 1PH3A 4IOAA 2PQAB 1NJIC 3HOXG 4JCVE 4B3SQ 2LXKA 1Q7YC 1PYBA 3J81c 2R7DA 4A3EG 1J6QA 4L5SA 3K7AH 4A3BH 2PI2E 1BKBA 3I4MH 4GLVB 4APVA 2WP8J 2R93H 1KRSA 3L0OA 4DR5Q 1N8RC 3FP9A 3G6EA 5IYBG 4JBWA 1FVIA 1JMCA 3OTOQ 5IYCH 3A74A 1NBWA 3MXNB 2E2JH 4X65L 3GTLH 1MIUA 4Y7NH 4DR3L 1PA6A 1GD7A 4A3FH 4X66Q 4DR2Q 2GVAA 4LF9Q 4DUYL 3FKIH 2HT1A 3S16H 5FJ8H 1FJGL 4Y52H 1J5EL 1MJEA 4IO9A 3K8AA 1W3SA 3CW2C 3J7ZC 1V9PA 3ULJA 1G291 1CKNB 2JEBI 4NB3A 3RN2A 3VDYA 4B3RQ 5HY6A 4X64Q 1AH9A 3TREA 5M3MH 3GTMH 3H3VI 5HGQA 5BR8Q 2I5MX 4HJ9A 1HR0Q 2R7ZH 4A3LH 3HFZB 5C0XG 4KI0A 1SR3A 2K5HA 1EUJA 2RF4A 4IPDA 2DUDA 3CCMA 2BH2A 3K80C 5M5XH 1XMQL 1B8AA 4IOCA 1VQNA 4X6AH 4NXML 1E7ZA 5GAGC 4GNXA 2VNUD 2JK8A 1E1TA 4DV0L 1GKHA 3M9BA 2JA5G 2JA6G 5IYDH 4LUOA 4PMWA 1YHBA 3GO5A 1BBWA 4PZ7A 3RNUA 3U4VA 3I7FA 1SE8A 4C3JH 1S72A 2ZTCA 2R7FA 5DLQE 3CQZH 4DUZQ 3GTGH 1M1KC 1Q81C 1S3OA 1PFSA 1VQDA 4DV7Q 4JI5Q 3T1YQ 3KDFB 3CC7A 1PH1A 3F2CA 3M85A 1XNQQ 1X65A 4BBRG 4A93G 1EQRA 4K0KQ 3HOYH 1K9MC 1L0WA 2B63H 3I56A 1XNRQ 3HKSA 4P74A 3BZCA 5C4JH 2YYZA 4TVAB 5IP7G 3E9IA 5AJ3L 1K8GA 3J81i 1YHAA 3UDGA 1Y1VG 3M4QA 1XPOA 1PVOA 1K0RA 1G51A 2NZHA 4LNQA 2Q2IA 3CD6A 4JI4Q 3CCEA 2Z6KC 4HJ7A 3HOWH 1CSQA 4OWTB 4OXPA 1PYSB 4DR1Q 1EQQA 1ASYA 1QVCA 3PO2H 4LF4Q 4QGUA 1QVGA 1V43A 2VQFQ 1X3FA 3S1MH 2F52A 3H15A 2F4VL 1PHJA 3CCQA 4B3MQ 2FXQA 4DR7L 4QQBX 4NXNQ 1XPRA 2NZOA 2ID0A 5IP9H 1WFQA 4A3CG 1X3GA 1VQ6A 4DV2L 3PF4A 1KD1C 4HIKA 3I2ZA 1HZCA 4LFBQ 1N33Q 1Z9FA 4JBMA 1PH5A 2UXDQ 3M4PA 2EIFA 1HNWL 4UP9A 1L1OB 2WAQE 2H5XA 1NMGA 1UE6A 1WCMH 2KCMA 1WJJA 3PF5A 4A3DG 1BBUA 5JJIA 1HZBA 3K7UC 2AKWB 1AE3A 3SGIA 1K3RA 1HJPA 2I0QA 1QUQB 4LFCQ 1VQFA 1OXUA 1VQLA 3J80i 3TRZA 1MJCA 3L2PA 3PIPA 2NVYH 1MKHA 1GM5A 3I4NG 1IBMQ 4LF5Q 4OWWB 1FL0A 2UXBQ 4JI0Q 4BBSH 4R4IA 2OQ0A 4LF8Q 3CMEA 4OO1I 3I4MG 5JEAG 4X62Q 3DM3A 4BY7H 3PUWA 2Q2HA 4DR7Q 1X3EA 5C4XH 3AQQA 3U50C 1KXLA 3OTOL 1C0AA 4DR6L 5M3FG 1H95A 1T9HA 2UUCQ 2NN6I 1E22A 2JE6I 4LF7L 4X66L 3FKIG 5ELOA 3B6YA 3ZJYC 3GTOH 1Q86C 1U5KA 4P72A 4A3JG 4UPAA 4JYAQ 4EQ5A 1X54A 2OTJA 1Q46A 5M3MG 4RG1A 4HIMA 1Y1WG 1QZHA 5BR8L 2QA4A 2R7ZG 1HR0L 1A63A 4MTNA 2HHHL 3GDEA 2NVXH 2Y0SG 1JJCB 4HJ5A 2N3SA 3S15H 1N34Q 3S2HH 4KHPQ 3W5OA 4IPGA 4R4QA 1L1OC 3NELA 2OQKA 2HIVA 1N36Q 4BY1H 4UY8C 3KF6B 5LMNQ 2R92G 4PZ6A 4IPHA 3HOVH 1CKNA 4AYBE 3F2DA 4L5TA 2N8NA 2UXCQ 2MFIA 2VY3A 3CXCA 4HIDA 3T1HL 4DUZL 4WJ4A 4DR6Q 4YWKA 4C3IH 1YZ6A 4A76A 3RLOA 3STBC 1PV4A 2OWOA 4LF7Q 4DV7L 3J7A5 1WI5A 4UP8A 4JI5L 2IHEA 3DLLA 3T1YL 3J81j 3H0GG 4JI1Q 1XNQL 4KHZA 4BA1I 4IFDG 2JA8H 3UDIA 2CKZB 3CCVA 4K0KL 2Q2TA 1OXSC 1FGUA 3W1GA 4HJ8A 1XNRL 3S17H 2VUMH 4AQYL 3G71A 4L5RC 1VQIA 4NPSA 2K14A 4QL5A 2HHHQ 1YJWA 3I55A 4A75A 1SMXA 5JEAJ 1TXYA 5C3EH 4OO1G 3I4OA 4JI4L 3PO3H 1EFWA 5LMUL 1YBYA 3J80c 3KDFA 4DR1L 4JC0A 3GTKH 1HZ9A 3AYHB 2KBNA 4MZ9A 3A5ZB 1K73C 4LF4L 2VQFL 3STBD 3KF8B 3F2BA 4B3ML 1KHIA 1Y14B 2NN6G 4NXNL 3T1HQ 4A3KG 1VQ4A 1SFOH 3HOZH 1VQCA 1A62A 2HIXA 3M4OH 2MNAA 4JI3L 3TS0A 3S1RH 1VQOA 1LUZA 4GN4B 4LFBL 4KLKA 1N33L 4H02A 4WJ3M 2UXDL 1M90C 3S2DH 3HOXH 2ZM6L 2E8GA 2I5LX 2WFWA 4DAYB 4GKKL 2MO1A 3D0FA 5GQOA 1C7YA 4GN3B 4YWMA 2WAQG 2JQOA 4AQYQ 1G6PA 2RCNA 1NE3A 2VQEL 1Q8KA 2K5VA 4A3MG 4BXXH 4A3GG 4LFCL 3CCJA 4QY7A 1X9NA 1NMFA 1P16A 5IYBH 2VZAA 4JBKA 2JA7H 1EOVA 1TWCH 5LMUQ 1IBML 4LF5L 2YV5A 2E5LQ 2ASBA 3HOUG 5IE8A 4JI0L 1WYDA 2JEAI 2UXBL 4LF8L 2K5NA 1X56A 3D31A 3S1NH 4X62L 4GNXB 4BY7G 4JI8Q 1D7QA 5FLMG 2QGQA 3CCUA 3NENA 1IBLQ 3LGJA 1S40A 3ERSX 4IFDJ 2N49A 4JI3Q 1VS0A 3TEHB 3PUYA 2UUCL 1KC8C 1PH6A 5GADC 3UDFA 2B29A 2ZM6Q 2E2HH 4JBJA 1KAWA 1PH7A 2RHQB 4GKKQ 4JYAL 5E7NA 5GAHC 1N9WA 2B3GA 1K8AC 4OWXB 4A3IG 2VQEQ 3RZOH 4IFDI 2JA6H 3CAMA 2JA5H 4JG2A 3UE1A 1KRTA 3PUVA 3KFUA 4HIOA 1B70B 3TQYA 2WB1G 2XTIA 2KHJA 2OCEA 2AWNA 1N34L 4KHPL 4A3BG 3AFQA 4IPCA 4LUVA 3S24A 2R6GA 1I50H 4DV5Q 1JB7A 1P8LA 4BY1G 1N36L 4DNIA 1OTCA 5LMNL 1I94Q 2MQHA 2D62A 2R93G 1TWHH 4BBRH 1Q12A 4LFAQ 4GLAC 4OX9Q 2UXCL 1EWIA 5IYCG 4O2DA 3M7NA 4XTCS 4A93H 3EIVA 5JJKA 1XMOQ 1HR0W 4OONA 1HNXQ 3GTJH 1VQHA 5H1SE 2PQAA 4A3FG 1YJ9A 5IP7H 4JV5Q 5FJ8G 3CCLA 5FLXc 1Y1VH 2UU9Q 2K52A 2DGYA 3HKZE 3PV0A 3WWVA 4JI1L 3GTPH 1JT8A 1CSPA 1SLJA 4R4OA 4GNXC 4R1JA 2JA8G 1N32L 1CKMA 3A5UA 1SROA 3EBEA 1RL2A 4LF6Q 2A19A 4A3LG 1KIXA 5IY0A 5C3EG 2OTLA 3NBHB 3KOJA 3RN5A 4A3CH 1PH4A 3S14H 3EN2A 2Z6KA 3JAMi 5GROA 3CCRA 1AE2A 1JJ2A 4JI2Q 5IWAQ 5IYDG 3CF5A 1UE1A 2ZJQA 1OXXK 3CPWA 4B3TQ 2F3IA 2YTVA 2K75A 3IRBA 2D0OA 3H3VH 4YWLA 2ALYB 4EX5A 4GOPB 4A3DH 2CCZA 1VQKA 1NTGA 2ZTDA 1OXTA 3CC4A 2NVQH 1OXVA 1EYGA 2PNHA 4JI7Q 2A8VA 3RLNA 3KYHC 4DK6C 2XGTA 1QZGA 2AWOA 2EXDA 2BA0A 4LWCA 3I4NH 1N32Q 1PH2A 1VQJA 1EIFA 2E2IH 1I3QH 4DV4Q 4J15A 3HOYG 5C44H 3CMAA 2B63G 5JJLA 1X55A 2A1AA 4BXXG 4R4CA 3KJOA 3OW2A 2LSSA 3U58A 1UWVA 1A8VA 1KL9A 2AMCB 2Q2UA 5J3BA 2JA7G 2UUBQ 2VL6A 3L7ZC 3CC2A 5M3FH 3HOWG 4DR4L 3RZDH 2E5LL 1Z47A 3PO2G 1HH2P 1YVCA 4DV3Q 1HNZQ 3F1ZA 2VW9A 4QJFA 1EIYB 1VQGA 4A3JH 4JI8L 1IZ6A 2IT1A 1VQ7A 1WOCA 4GKJL 1GVPA 3G4SA 4POFA 4IJHA 4YCVA 1TWFH 5IP9G 1PH9A 1IBLL 1XJVA 4DV6Q 2CWAA 1Y1WH 2Y0SE 1VQMA 1NY4A 1X6OA 4P73A 3AEVA 2UUAL 2HQLA 1IBKQ 2JA9A 4PZ8A 5IT9c 1I6HH 3PGZA 2PI2A 1VQ9A 2D0PA 2ES2A 3ULPA
chains in the Genus database with same CATH superfamily
1LTLA 1WCMG 1IYVA 3G7LA 4HTHA 4LW1A 3K81C 3ER0A 1TS2A 4ZYSA 3QWNA 2HDMA 1V1QA 3K7AB 5EKKA 5C5LA 4LJZC 4DAMA 5BN4A 4X65Q 4BBSG 5DEHA 3FVQA 1J5EQ 5JVH3 3H0GH 2RKSA 2L15A 3N52A 4OX9L 4C1NK 4DKAC 1E3PA 2H1EA 5C4ZA 1F9PA 1Q1EA 1U4RA 2I5HA 3EVQA 4JV5L 2IY5B 3MFYA 2JA8B 2FFKB 2IX1A 4XQQA 3T56B 4DPGA 2M2LA 2LXJA 1ICFB 4AIMA 3JAME 3BJUA 5C3EB 4RAUC 2NN6H 1CKOA 1LV9A 4KTAA 4CKEA 1HFNA 1CHQD 1JOOA 5IWAL 4B3TL 1YEZA 3PQIA 2BA1A 2LMCB 1CZGA 1VQ5A 3M4OB 1SNMA 1S5CD 2GN5A 2YTYA 1JJGA 3TZUA 4A3MH 1RIPA 4A3GH 2MHVA 3HOXB 1FD7D 1SE2A 4CKBA 2G9HD 1GUTA 2GVBA 4TQUS 1L2FA 1I4HA 5DM63 1WTRA 3PUXA 4B3SL 2F0DA 3HOUH 2MPMA 3Q8DA 4N8X1 1H9JA 3M7GA 4GOPA 5EAYA 2F4VQ 3J7YW 2PMZE 3GP7A 5EBDA 4P75A 1A0IA 1BR9A 2PCFB 4JOIA 3IFDA 4YCUA 2O5JC 4KY5A 2YTXA 3W1BA 4R9WA 1I5FA 4B3RL 3HOZG 1HZAA 5K36G 3QOJA 2VS1A 4DV6L 4GLXA 1V1PA 1VQBA 1EY4A 2G9DA 2PQAB 3HOXG 4B3SQ 1PLFA 1F9SA 2RA4A 1KRSA 1Y8NB 2XRSD 1JMCA 3OTOQ 5IYCH 3R2TA 2GA4B 3MXNB 1PA6A 1GD7A 2GVAA 2HT1A 1A15A 3J80L 1QWYA 3R2IA 3CRKC 3TP6A 3K8AA 1W3SA 4TRDA 3J7ZC 4G4KA 4B3RQ 3RN2A 5HY6A 5M3MH 1TQOA 1O7ZA 5HGQA 2I5MX 2OXPA 3OIPA 4HJ9A 3OWEB 4KI0A 3QOLA 3I90A 4JPBW 4DGZA 1BDOA 4IOCA 5DNFA 4GNXA 2JK8A 2NVXB 5IYDH 2JA6G 2EVBA 1WD0A 4NP5A 1HUMA 4PV1C 3GO5A 3RNUA 4RCNA 3I7FA 2ZTCA 2R7FA 4ILWA 4QMGA 4DUZQ 1M4VA 1Q81C 3NTHA 1PFSA 4N9TA 4JI5Q 3T1YQ 3VR4A 3GV3A 3F2CA 3M85A 1BBXC 1Q3LA 3KK7A 4A93G 1EQRA 4K0KQ 3HOYH 2EYPA 1L0WA 2B63H 3I56A 5IOCA 5ELFA 4P74A 4BS9A 5AJ3L 3E9IA 1K8GA 3UDGA 3R3OA 1XPOA 1PVOA 2NZHA 1H9SB 3S9WA 2IW3A 1CQFA 2Z6KC 4HJ7A 1CSQA 2K32A 1DZ1A 2OEOA 4KJNA 4LF4Q 1QVGA 3S1MH 1V43A 1X3FA 4B3MQ 2NZOA 3D6WA 1WFQA 1X3GA 4RKBA 1VQ6A 1CHPD 1HZCA 5DAUA 4LFBQ 1LO5D 1WTQA 1D1IA 1PFNA 3M4PA 4FP5D 1WTXA 1ILPA 2WV6D 1TWFB 1SFOB 1L1OB 4DN4M 1UE6A 4TSSA 2F0KA 3K7UC 3H09A 1K3RA 2Y0SB 3MWYW 2IX3A 3S2DB 1VQFA 3NBHA 1HA6A 2F0WA 4ZUJA 1BOSA 4KK7A 1F2MA 1PRTB 1TY2A 4LF5Q 2UXBQ 1LT6D 2C5CA 2OQ0A 3P20A 4LF8Q 1AP0A 4OO1I 1SXTA 2Q2HA 2K03A 3A56A 3U50C 3GQBA 3OSOA 3G6JB 1AFPA 4DR6L 4J8QA 3S1NB 2UUCQ 1EWCA 1E22A 2JE6I 4X66L 1B44D 2MUYA 3Q6SA 3E3XA 1X54A 5M3MG 1Y1WG 4PMBA 2F0NA 1HR0L 2Y0SG 1JJCB 1PTOH 2FMCA 3BDCA 3S2HH 4H44C 4KHPQ 1F9RA 2Z1CA 4R4QA 2OQKA 2HIVA 1X3PA 4IUQA 3Q0AA 2R92G 3URYA 4PZ6A 4IPHA 1CKNA 2D5DA 3CU7A 5EKLA 4HIDA 4DR6Q 1PV4A 1SE3A 3RLOA 1A2UA 3SXHA 3J7AV 1QILA 4JI1Q 2HUGA 4KHZA 4BA1I 1O78A 3NHHA 3UDIA 2CKZB 1HTLD 2NUCA 4HJ8A 3N6RA 3W1GA 5I4DA 2VUMH 4AQYL 1TWGB 3G71A 4NPSA 2K14A 1KNEA 3NTIA 1S5ED 1O7LA 4A75A 2L9HA 1ZXTA 1FNVA 1IYUA 4ULLA 4DR1L 4K8IA 1A3UA 3KF8B 2PMZB 1ICWA 3QO2A 1CQVA 4NXNL 4A3KG 2CH4W 2ICEC 1VQCA 3NPPA 1NUCA 2MNAA 3S1RH 3R8BA 1VQOA 4C2MB 1N33L 4IUTA 4IALA 4A3DB 2E8GA 2F4IA 4GKKL 3TBIB 1C7YA 2F3VA 4GN3B 4AQYQ 3TN2A 2RCNA 1YNNC 1DXMA 3LWEA 5A35A 4QCLA 2K5DA 1NSNS 1I3QB 4ZQ3A 1BCPC 2JA7H 4A3BB 3HEJA 3WOEA 2YV5A 1IBML 2E5LQ 3I4MB 1I4PA 4UDUC 2K5NA 4DA2A 1STYA 4FVMA 4HMJA 4CDFC 1D7QA 5M3FB 5FLMG 4Y7NB 3NENA 1IBLQ 1LT3D 2N49A 1PH6A 2EYOA 1LACA 1YNND 2B29A 2WINB 4GKKQ 1Z6HA 1TY0A 2D9UA 2B3GA 2ZT9C 4A3IG 3RZOH 2NYZD 4IFDI 2JA5H 2NBFA 4JG2A 3UE1A 1A6XA 2LS01 2AWNA 2VB2X 1N34L 1X3QA 4A3BG 2O4XA 4DV5Q 2N88A 4DXFA 3CQZB 4G57A 2R93G 1TWHH 5FKAC 4KV6A 1Q12A 4GLAC 1EWIA 2ZXRA 3M7NA 1HNXQ 3GTJH 1VQHA 4CJ1B 3I91A 1DOMA 2UU9Q 4HCSA 3GTPH 4OEMB 1CKMA 1KTKA 2Q8TA 1LABA 3PIO3 3FMCA 4LF6Q 5IY0A 3VR5A 4FO2A 3T13A 3PO2B 3KOJA 4A3CH 4K2LA 2Z6KA 3JAMi 1SNPA 4XYOA 3CCRA 4FXDA 2KEEA 5FLXE 2K75A 1VMCA 5BN3A 2ALYB 2NVTB 1VQKA 1SSOA 1OXTA 3IKJA 1EYGA 4JI7Q 2A8VA 4I7ZC 4MHEA 3HRZC 1VQJA 1EIFA 5C44H 5FO7B 5JEAH 2PZUA 2LSSA 1A3VA 2JA7G 1G2TA 1RD9D 3RZDH 4LMQD 1X32A 3PO2G 1HH2P 2SEBD 2HCIA 2VW9A 1LT4D 1PXUA 1RJTA 1STBA 2F0VA 3U9SA 4IJHA 1PH9A 1WTHA 2CWAA 3FEWX 1SDFA 1CA6A 1B1ZA 2KHSA 4UHVA 2JA9A 5JJZA 4KHVA 3ULPA 2M00A 4WRDA 4A3EH 2BH8A 2ZTEA 4A4IA 4GOPC 4RMFA 1CA5A 4GKJQ 3S15B 3TP8A 2RSNA 4F87A 3KJPA 4BY1B 3K5LA 4JOIC 4DV1L 1Q82C 3HOVB 2Q8IB 4XDXA 3JAMc 5CV6A 3VYUA 5C4XG 1DD2A 3DWQA 4PG3A 4DAPA 1MI2A 4LFAL 2E74C 4A3FB 1IL2A 1YHQA 5K5PA 3G48A 1XMOL 2Z0SA 4YY3L 3GTQH 4YHHL 3A8IE 1FGBD 1DJRD 3DWPA 4POGA 2IX0A 3R93A 1B4OA 4OO1H 1SN8A 1XMQQ 1U4PA 3S17B 3GTMB 1SRUA 4DK3C 4O0AA 2JP1A 4DV0Q 3CPFA 4MTKA 3TS2A 4M8AA 3DWAA 1JE4A 3CP0A 3PIOA 2ZJPA 5M5XB 3ICEA 1XPUA 1VQEA 2KHIA 3PO3B 1RF2D 3VYRA 4GN5A 4DK1A 1JE5A 4DV1Q 4FYDA 4CJ2C 4JI2L 2CW0C 2B8GA 3RMHA 1EOTA 1VCIA 4K14A 1EU4A 3HOVG 3GTGB 4NKLA 1SNCA 3C3LA 1UEAB 2E75C 4R4TA 1SAPA 1S5DD 2CWPA 1XTDA 2PO4A 1K83H 2KOLA 4YY3Q 4YHHQ 2MP1A 2XIWA 4XIGS 2NZ1D 2IHFA 1PDQA 2IJ0A 5M5WH 1STGA 2SNSA 5C0XI 4DV4L 2F0SA 5HGTA 5C44G 1C48A 1HRJA 1RCVD 2YU9H 4DR5L 1QVFA 3OOCA 2UUBL 1XWEA 3PO3G 4DV2Q 2JXMB 3OWFA 5CYUA 3RR5A 1E2WA 1E1OA 5M5YH 3K5OA 2KCNA 3UDXA 1HNWQ 4KKTA 1WD1A 3VR2A 5IGCA 4YIJA 3T4AC 2WKDA 3K57A 1JOQA 2JJQA 2CHBD 1VQPA 1PYWD 1IBKL 1EIHA 2P5ZX 4IOAA 1A2TA 1PMRA 1ET9A 4U68A 2L12A 4A3EG 5LL6X 3K7AH 2PI2E 4ODGA 1BQQT 4GLVB 2WP8J 1HPCA 4L6TB 5C5MA 4DR5Q 1E2VA 2K28A 4EQPA 2J4XA 1NBWA 4X65L 1MIUA 1O7YA 3BZDB 1ESFA 5IGFA 5FJ8H 1J5EL 1MJEA 3J81E 3CW2C 3A54A 1V9PA 3ULJA 1BUVT 4C56C 3KLSX 3VDYA 1UUPA 5A2QE 2BOSA 3D3RA 2R7ZH 2AQ3B 4A3LH 3HFZB 5IODA 1TVXA 1TT2A 1EUJA 4HAEA 5F2DA 3MXUA 3KLSA 3CCMA 1C4QA 1RDPD 3K80C 4WJWA 2BH2A 2HDLA 3A7AB 1II3A 1VQNA 4X6AH 2ZXOA 1HFGA 2K6AA 2H4OA 4LUOA 4PMWA 4PZ7A 2NTSA 4C3JH 1S72A 3S14B 4K5WA 1M1KC 3ND8A 4ABNA 1S3OA 2K05A 4DV7Q 1DCZA 5ELEA 1PH1A 1XNQQ 1X65A 4BBRG 2XSCA 4IFDH 4HSVA 1KABA 1XNRQ 4IUVA 2YYZA 1GUSA 1Y1VG 3M4QA 3NWTA 4KJOA 2XVSA 2E2IB 4LNQA 1EYCA 4JI4Q 1IKMA 1PYSB 1QVCA 2EYFA 2VQFQ 2F52A 4HSPA 4FF1A 3L3OC 3E0JA 2F4VL 2FXQA 1RTOA 2IL8A 2QDBA 4HIKA 3I2ZA 4JBMA 3A7LA 4UP9A 3HOZB 3PF5A 1LTTD 1PTOC 1WJJA 1BBUA 1HZBA 1LLRD 4I7AA 4LFCQ 4MN3A 2XN9C 5FOBB 1MJCA 2O5IC 1O80A 2NVYH 1GM5A 3I4NG 1Y69U 1EU3A 3MFGA 5E4XA 1AZQA 2MJ8A 1TWCB 1X3EA 1KXLA 3OTOL 1SBBB 2J7ZA 2DJFC 1RKNA 1PTOD 3C1EA 3H0GB 1SYDA 2EYJA 3ZJYC 2AUJD 2Z4HA 4A3JG 4P72A 2V4DA 1FNWA 3C46A 1STEA 4PQXA 4OL7A 4JYAQ 3OW7A 1CFMA 3E5SA 5EQ0A 4R8NA 2R7ZG 5CMDA 4MTNA 2NVXH 3GDEA 5EPKA 1AN8A 2JA6B 4B08A 5G3LF 3NELA 1N36Q 4UY8C 5EPJA 2SNMA 3MVVA 4AYBE 4XYQA 4L5TA 2UXCQ 1PRTF 3CXCA 3NTKA 3T1HL 2NB0A 4DUZL 2HCCA 1HA5A 4YWKA 4C3IH 1D6EC 3STBC 4JI5L 3T1YL 5E4WC 5KIXA 3J81j 3H0GG 4A93B 4IFDG 3A55A 3O13A 3I73A 3CCVA 4K0KL 1FGUA 4WORA 1XTCD 3T16A 4L5RC 1MGSA 2WIIB 1SMXA 3HOUB 1TR5A 1V1PB 2B2TA 2WKCA 2A73B 5D3IB 5IT9L 3GTKH 4KD4A 5FK9C 3VYTA 5JVG3 3AYHB 4N8FA 4LF4L 3U9OA 3SK4A 1B3QA 3STBD 2A69C 4B3ML 5JAVA 5ISRA 1KDBA 2NN6G 3T1HQ 1SEBD 3W3AA 1SFOH 3IAYA 4JI3L 2L11A 1H9SA 4LFBL 1GOZA 2K33A 4F8MA 3V96A 3S2DH 2L55A 3X3MA 4ZLTF 2I5LX 3D0FA 5GQOA 3J80E 4Q5VA 3MAQA 2WAQG 1G6PA 2VQEL 1Q8KA 4A3MG 1MHWC 4BXXH 1MSHA 2F0UA 3C2PA 4A3GG 1I4RA 2RDFA 1X9NA 5IYBH 1G91A 4EQNA 5IIFA 1JWSD 4LF5L 2ASBA 2A69D 4J6HA 2HQEA 3HOUG 2UXBL 5CV7A 2EE1A 4LF8L 3S1NH 2EJFC 5E1FA 4GNXB 4DK0A 4JI8Q 1JR0D 3RD4A 2WACA 1JICA 3ERSX 4IFDJ 3K6OA 4JI3Q 2UUCL 3TEHB 3PUYA 1KC8C 3RUZA 5GADC 5C0XH 1LTSD 2A6EC 1TS3A 1Y8OB 2EPBA 3MHBA 4PMCA 2E2HH 1RHPA 1PH7A 5M3MB 1Y1WB 4H7BA 1C8CA 1W6KA 1ZYRC 1EYAA 1RODA 2EJMA 2F0LA 2VQEQ 4DFAA 3M4YA 4L63B 2DJGC 3PUVA 2KCCA 3ZYYX 1T5EA 2OCEA 4KHPL 2R92B 3AFQA 3LNNA 4IPCA 4LUVA 2R6GA 1I50H 1L0XB 2A6HC 2IWHA 1I94Q 3SK5A 5IYCG 2A6ED 3UI2A 2EY5A 4FXKC 4OONA 1LTGD 5IP7H 2EYHA 2F0JA 1ZYRD 5FLXc 2K52A 3PV0A 4JI1L 5CV8A 2B63B 3V2TA 2L5TA 4R1JA 1F2YA 2KEDA 3EBEA 2EXZA 4G7OC 2CH4A 5NUCA 1GUNA 1KIXA 2PPBC 4ZRZA 3EJIA 2A6HD 3NBHB 3S1QB 4J1MA 3MZ5A 2PZWA 5IYDG 3CF5A 1UE1A 1OXXK 3MA2B 4A3KB 2YTVA 3IRBA 4EGVA 2ICIA 4A3DH 4X3SA 2CCZA 2ZTDA 3CC4A 2NVQH 1EEFD 1F9QA 3KYHC 2F0EA 4L8JA 1WTOA 2EXDA 4LWCA 3SEBA 3BYYB 1I3QH 1JC7A 3HOYG 2B63G 3KF8A 3BVGA 3CMAA 2A1AA 3ONAB 4BXXG 3OW2A 1A8VA 2AMCB 2VL6A 3L7ZC 1R9TB 5M3FH 1SNQA 2E5LL 1B3AA 4QF4A 4DV3Q 1HNZQ 4QJFA 5HURA 3X3NA 3HS0C 3G4SA 1EEID 1IBLL 2F0HA 5CV9A 4RFBA 1VQMA 1X6OA 4O1NA 3AEVA 1QNUA 2BE5C 2Z4IA 2F0FA 4AH6A 4A3IB 5KYIA 3IL8A 3CKIB 5D3DA 4ALPA 2K50A 4HJAA 2RCFA 2AQ2B 1HXYD 3GV6A 1YIJA 1QG7A 1JB3A 4DR3Q 1UE5A 1PH8A 1STHA 2R93B 4DUYQ 3TP5A 4ME3A 4DV5L 1FJGQ 3A8JE 3FPPA 1U4LA 1PZID 3PUZA 2ZJRA 1C9OA 2MO0A 3SE0A 1QUQA 4C3HH 5D14A 1HNXL 4GZYC 4XQJA 2FJ2A 2UU9L 1K0SA 4RKLA 1E24A 2RHSB 1SYEA 3HKZG 2VUMB 1CTMA 1YI2A 3TZDA 4NXMQ 1SYFA 2CVRA 4RHRA 4JI6L 1BCPD 1U9RA 4LF6L 1XX8A 5L37A 2XWJB 4IUPA 1U0LA 3OYYA 4DXGA 2KVMA 5FO8B 2NVTH 3QR8A 4ZKCB 1D8LA 3FPUB 4K6DA 2B2WA 4QIWE 2DN8A 5C0XJ 3M3YH 4AYBG 1DONA 1QOHA 1WTPA 2EQSA 2CFMA 3KLWA 4JI7L 3SK8A 1ET6A 4BA2I 5C3XA 2RSOA 4IJLA 5E3FA 2JN4A 5FLXL 3KF6A 3NK9A 4RA8A 4UAIA 5C4JB 4JI6Q 2PQEA 3BZKA 1Z7TA 2QILA 1QNKA 2VUMG 3CCSA 3AFPA 3NSWA 3HG9A 2N78A 4P2CB 3DMUA 5CBAE 1YITA 3QB3A 2JA7B 3PCOB 4P71A 4B9XA 1IYJB 1EY0A 1D5MC 4HMIA 4DR2L 4LF9L 1S5BD 3T51B 1XXGA 1GO3E 1MD2D 2L4NA 2KCTA 3F2UA 3JC66 3H6MA 2KUMA 4X64L 1TWAH 2E76C 4DF7A 4BWGB 1U4MA 3PIP3 2WB1E 1NJIC 1G2SA 3NQTA 2LXKA 3K0YA 1PYBA 3J81c 2A74C 1SNOA 4TKOB 2JA5B 1BKBA 1IW7C 2E2DC 2QCPX 4APVA 2NWGA 4GKJL 3FP9A 1QB5D 3G6EA 4JBWA 1FVIA 1JOKA 2E2JH 3GTLH 2OT2A 4A3FH 3H91A 4DR2Q 1RTNA 4LF9Q 1TWHB 3FKIH 4RGTA 3S16H 5C4XB 1H9KA 1ML0D 4KN4C 4DAYA 1KDCA 1Q90A 3NWSA 5ELCA 3GTJB 1G291 4NB3A 3D4RA 4X64Q 1KDAA 3TREA 3GTMH 4FNFA 3H3VI 3GTOB 5BR8Q 1AZPA 2SOBA 2K5HA 3GTPB 1IW7D 5M5XH 1XMQL 2F0GA 2K7VA 5KRUA 4DV0L 1XYIA 2N55A 2JA5G 4XQNA 1ENAA 1BBWA 1J8IA 3U4VA 5DLQE 3GTGH 2PW5A 1EIGA 4JW0A 3EROA 3I8ZA 1VQDA 2KQ3A 5I9OA 3VA5A 1EQTA 3C1FA 2Z8LA 3KDFB 4FF3A 1G8ZD 2PNRC 3TP7A 4S3SA 4G7HC 3HKSA 2RVLA 4TVAB 2A68C 4X3KA 1I4GA 4K5XA 1K0RA 1G51A 5C44B 3CCEA 1KLUD 3HOWH 1UAPA 4CDCC 4QGUA 2DNEA 1M8AA 3MXPA 1PHJA 4QQBX 1E0BA 1XPRA 1IKLA 3RZDB 5IP9H 4A3CG 2NTTA 1VDZA 1S4ZA 4DV2L 1MSGA 1Z9FA 1PH5A 4ZKBB 2UXDQ 2EIFA 1HNWL 3HZXA 3OHXC 2H5XA 2WAQE 3Q24A 1NMGA 1WCMH 2KCMA 4M1UB 4DNTB 5JJIA 1AE3A 1HJPA 4V190 4RWSC 1OXUA 2RQXA 1VQLA 3J80i 2B2TC 4A3EB 2Z6BA 2KA7A 3L2PA 3PIPA 1MKHA 3NE5B 3H3VC 4IZ8A 4FF2A 4JI0Q 4BBSH 2F1MA 3CMEA 5JEAG 4X62Q 3DM3A 4HN7A 3PUWA 4PNYA 4BY7H 2B2UC 2CW0D 1HCZA 1I4QA 1JWUD 1C0AA 4OHJA 1H95A 1T9HA 3VYSA 4OIKA 3K5NA 3FKIG 5ELOA 3B6YA 1ZKOA 1Q86C 3I3CA 4UPAA 3OMGA 1CM9A 2EDGA 3I70A 3PMFA 4EQ5A 2OTJA 1NR4A 2AUKA 1QZHA 1KAAA 4G7ZC 2HHHL 4HJ5A 2K5WA 1NR2A 3W2DA 2N3SA 2K5QA 3FRPB 3Q23A 1DYQA 4FXGC 4IPGA 1L0YB 1L1OC 5ELBA 2M9VA 4XT3B 5LMNQ 3CRLC 5D65A 3F2DA 2N8NA 2VY3A 2EY6A 4ME5A 4A76A 1EY6A 2ENBA 3EA6A 1PRTC 4DV7L 5EGTA 3J7A5 1WI5A 1BCPB 2LY7A 4BBRB 4EVOA 4UP8A 2IHEA 2FINB 4QIWB 4ZCKA 4WFN3 4RH6A 1XNQL 1K83B 2JA8H 1HTPA 3I4LA 3P1HA 1XNRL 1Y1VB 1JQYD 5M5WB 2HHHQ 5JEAJ 2FMMA 5C3EH 4OO1G 3I4OA 5I2YA 4JI4L 1ILQA 3J80c 5I9PA 5G3LD 1HZ9A 3H94A 4MZ9A 3A5ZB 2F0IA 2YU9B 2VQFL 1PRTD 2KECA 1CZWA 2EOTA 2K01A 1VQ4A 2R61A 3HOZH 5K36H 2HIXA 3M4OH 1B9MA 3OIQA 4H02A 1M90C 3HOXH 2ZM6L 3JAML 4XT1B 1NE3A 1SMYC 2TSSA 2DNCA 4LFCL 2B2YC 1AW7A 4QY7A 2WB1B 3I4NB 4JBKA 1EOVA 1TWCH 1EY7A 2A5HA 2JEAI 3K58A 1X56A 3D31A 3NXWA 2F0OA 2LKVA 4BY7G 1CT1D 1SE4A 3CCUA 3LGJA 1WVLA 4A3JB 1LTAD 1JCKB 1PFBA 1SMYD 1ENFA 2ZM6Q 3MXGA 3DEPA 4JYAL 5E7NA 5GAHC 2R7ZB 1K8AC 2F03A 4OWXB 1EYDA 2BCOA 1DM0B 2JA6H 3CAMA 1FNUA 1I6HB 4HIOA 1EFID 2WB1G 2XTIA 2KHJA 3TSSA 1D2BA 3ITPA 3S24A 4IN3A 3D6CA 1P8LA 1N36L 1OTCA 4C3JB 2MQHA 2D62A 3DHQA 3ERQA 4OX9Q 2UXCL 1MBYA 4O2DA 4EQOA 4XTCS 4A93H 3EIVA 5JJKA 3J7AF 3KBGA 5H1SE 2PQAA 3BYTB 1HHVA 4ZAIA 4JV5Q 5FJ8G 3CCLA 3NQIA 2DGYA 2IPKD 3HKZE 3WWVA 3KLRA 1E2ZA 1FYCA 4IUUA 4R4OA 2JA8G 2OF1A 4Q0FA 3MTSA 2A19A 4A3LG 1D5ZC 3MXNA 4V0BA 5C3EG 1B53A 3RN5A 1PH4A 3EN2A 4E6IA 5GROA 4IUNA 1JJ2A 5IWAQ 4B3TQ 1TKWB 2ZJQA 2F3IA 1CK1A 3H3VH 4YWLA 4C3JG 4GOPB 1TIID 1OXVA 2EZVA 1EWHA 2QF7A 5KGUA 2XGTA 1QZGA 2AWOA 2BA0A 2FHTA 3NUCA 2WAQB 1PH2A 4KY7A 4A3MB 4A3GB 2EY1A 5JJLA 3KJOA 2NVYB 1GUOA 1F2ZA 1KL9A 2Q2UA 5J3BA 1QJOA 2QKIC 4QB4A 3AMUA 4DR4L 2F0QA 3QIAA 4NMZA 2B2WC 5CORA 3F1ZA 2RDGA 1VQGA 4JI8L 1IZ6A 5IGDA 1D1KA 2ZXPA 2B2UA 4RGOS 4POFA 4YCVA 1TWFH 1T5XD 1XJVA 4DV6Q 2C9OA 1Y1WH 2UUAL 2B2VC 4PZ8A 2QEJC 2L0CA 2PI2A 3MC0B 2D0PA 3PGZA 2ES2A 4JVZA 2R3ZA 1B7YB 1LM0A 3IFTA 2K4KA 4K2KA 4MNOA 2R92H 3F8TA 4KMUC 3EFXD 2V1CC 5GAEC 1W2BA 1HQMC 4H0LC 1KQSA 4DR4Q 3K0XA 5ELNA 4RCOA 3QJYA 3ULLA 1L1OA 3MEFA 1EQVA 5EJWA 4KN7C 2AHOB 5IGGA 3P75A 5IT9E 1I94L 4C3IB 1Q8IA 1LYLA 2KENA 2AQ1B 3MEHA 2UUAQ 1SYBA 1ESRA 1CI3M 3UE0A 4KD3A 2TMPA 2C35B 1I6VC 3NEMA 1VQ8A 2QEXA 1O7IA 5LMNW 1Q1BA 3S1QH 4FDBA 2Z9HA 2VXWA 3E6ZX 1DOKA 2EJGC 2G5DA 1SJHD 4A3KH 3GD7A 4RHSA 4U673 1CUKA 2ATWA 3GTKB 3E9HA 3A0JA 5TSSA 1PTOF 3BVZA 1V1OA 2SDFA 4B9WA 4OGQC 3RLFA 4C3IG 1TS5A 1W6JA 5AJ3Q 1YNXA 1SNDA 1TWGH 1IXRA 4XXEA 1HQRD 4DAVA 4LUZA 2MGSA 3HOYB 4ID6A 4YCWA 3BU2A 4H13C 1IHZA 1R9TH 3KUPA 4GS3A 1DGSA 4ZUIA 1BNZA 4UP7A 3E0EA 2B2YA 1UEBA 5FLMH 1K28A 5C6AA 3FHWA 3DEOA 3S1MB 2CQOA 3U4ZA 4LK1C 1SYGA 4KKUA 4JK1C 4DV3L 1SJED 1HNZL 1YJNA 4L5QA 1B9NA 1UE7A 1BVSA 2RDHA 3FDTA 4KKSA 4C2MH 4FF4A 3D4DA 1VQAA 4A3IH 2PW7A 5JOBA 3PSIA 2E2HB 1ASZA 1PH3A 1EL0A 4ZK9B 3D8GA 3K5MA 4JCVE 1Q7YC 2R7DA 5M9OA 1J6QA 4L5SA 4A3BH 2B39A 3BG3A 3I4MH 3DM1A 2R93H 3L0OA 1N8RC 5IYBG 3VR6A 2J0TD 3LWUA 3NP8A 3A74A 1I50B 1WTVA 4Y7NH 4DR3L 1GUWA 4X66Q 3TMEA 4DUYL 5KNCA 5CC4A 5CGKA 1FJGL 4Y52H 1KLGD 1B2TA 4IO9A 2PZTA 1CKNB 2JEBI 2B8FA 1AH9A 3CHBD 4X3TA 4RGMA 5I6YA 1HR0Q 5C0XG 1SR3A 1I4XA 2RF4A 3HKZB 4IPDA 2DUDA 1B8AA 5CV4A 4NXML 1E7ZA 5GAGC 2VNUD 1E1TA 5LHY1 1GKHA 3M9BA 3BDOA 5LL6S 1PTOB 1YHBA 5JPMC 3S2HB 1SE8A 4F7XA 3CQZH 1K3BC 1H9MA 1JWMD 1TS4A 1STAA 3CC7A 4AYBB 2X69A 5KYLA 2L1BA 2BE5D 2NVQB 1G6ZA 1K9MC 3BZCA 5C4JH 5IP7G 3A8KE 3J81i 1YHAA 5FO9B 2EYMA 2Q2IA 4C1NI 3CD6A 4NDXA 2LFNA 5DM73 1S5FD 4OWTB 4OXPA 4DR1Q 1EQQA 1ASYA 3PO2H 1UNSA 1VF7A 2QDLA 3SDZA 3H15A 3CCQA 4DR7L 4NXNQ 1PZJD 2ID0A 4HEDA 5T1IA 3PF4A 1KD1C 5BN5A 4CBVA 1N33Q 1VMPA 5KEEA 2QW7A 1BF4A 2K04A 4CDEC 4OELB 4A3DG 1GUGA 3S1RB 2AKWB 3BDLA 3SGIA 2I0QA 1QUQB 2PYKA 2BDOA 3TRZA 3KBXA 2B2VA 1EY9A 4Z9CB 1IBMQ 4OWWB 1GXDC 1FL0A 4R4IA 3I4MG 4DR7Q 5C4XH 3AQQA 5IGBA 2VB3X 1LTRD 5M3FG 1DOLA 2NN6I 4LF7L 1ZEQX 4MIUA 3GTOH 2DY8A 1A3TA 1U5KA 4C3HB 4CGYB 1ONLA 3SHLA 5EBCA 1Q46A 4RG1A 4HIMA 3V05A 2O2LD 5BR8L 2QA4A 1A63A 5JPNC 3L9AX 1LTID 3S15H 5KNBA 1N34Q 3RZOB 3W5OA 3OPOA 5J1ZA 4BY1H 3KF6B 3HOVH 1GHJA 3P7JA 2MFIA 4WJ4A 5CV5A 2KJXA 1YZ6A 1H9RA 4CKCA 1PFMA 2OWOA 4LF7Q 2EYLA 1Y8PB 3DLLA 3M3YB 4OIJA 3SK6A 4HCEA 4C3HG 2Q2TA 1OXSC 3S17H 3SVMA 3SR1A 1VQIA 1K8OA 4QL5A 1K8MA 1YJWA 3I55A 1TXYA 4HR7B 1GHKA 3PO3H 2I46A 1EFWA 1YNJC 1YBYA 3BS1A 3KDFA 5LMUL 4JC0A 4R8IA 2KBNA 1K73C 1EY8A 4DU9A 5KNDA 3F2BA 1KHIA 1Y14B 5C4HA 4IURA 2F3WA 1A62A 3TS0A 2Q8RE 1LUZA 4GN4B 4KLKA 4WJ3M 2UXDL 2EY2A 2WFWA 4DAYB 1TWAB 2XRQD 2MO1A 4CJ0B 2BDNA 4YWMA 1WTWA 1AEXA 2JQOA 1BCPF 1PZKD 2K5VA 1J9OA 5J39A 1GJXA 1YNJD 3CCJA 1NMFA 1P16A 2VZAA 5J22A 1EZ8A 2I07B 5LMUQ 4I65A 5IE8A 4JI0L 1WYDA 4LAAA 5CR3A 3TDQA 5AFWA 4X62L 1TU2B 2E2JB 4K6LA 3GTLB 2QGQA 2CQAA 2DY7A 1S40A 3FKIB 3S16B 1VS0A 3UDFA 1KNAA 4JBJA 1KAWA 2RHQB 5I2XA 2A68D 1N9WA 2X6LA 3AB9A 3WDNA 3DXJC 1KRTA 3KFUA 1B70B 3TQYA 4QUFA 3Q22A 3DUZA 4QUCA 2XWBB 5C3WA 5EKIA 1LT5D 4KY6A 1EZ6A 3AU7A 1JB7A 4BY1G 4DNIA 5LMNL 2F0PA 1FR3A 3I72A 4BBRH 3BVMA 4LFAQ 4N9PA 2XNAC 1XMOQ 1HR0W 4CDDC 4A3FG 1YJ9A 1Y1VH 5EPLA 3ND9A 1LTBD 1JT8A 1CSPA 1ENCA 1SLJA 3QG1A 1D5XC 4GNXC 1N32L 1JORA 1HUNA 3GTQB 3A5UA 1OO9B 1SROA 1RL2A 2F0MA 4NW2A 1R4QB 3HOWB 4CHTB 2OTLA 3S14H 2JYOA 1BXTA 5IGEA 1AE2A 4JI2Q 3J81L 3WOFA 4K5VA 3CPWA 1SYCA 5A2QL 3OMCA 1R4PB 1STNA 2D0OA 3VR3A 4EX5A 1NTGA 5ELDA 2PNHA 3HGBA 1NNXA 3RLNA 4O42A 4DK6C 1WCMB 1IL8A 4IQZA 3K59A 3I4NH 2E2IH 1N32Q 1VF5C 4DV4Q 4J15A 5COYA 1QCBD 1X55A 4RGNA 4F88A 1F2LA 4X3UA 4R4CA 4DNRB 1QE6A 1NCVA 3U58A 1UWVA 1BO0A 3D4WA 3NBIA 3VA7A 4BBSB 3HP3A 2UUBQ 2JSOA 3CC2A 3HOWG 1Z47A 1EY5A 4BY7B 1YVCA 5I6WA 5CBEE 3LX0A 1EIYB 4A3JH 1V8QA 2IT1A 1VQ7A 1WOCA 3T53B 2K1BA 1GVPA 4K8JA 5IP9G 1NAPA 1F77A 2HD3A 5M5YB 3EQLC 2RBMA 2Y0SE 1NY4A 4P73A 2HQLA 1IBKQ 5T1GA 2D2CC 5IT9c 2F0TA 1I6HH 1B50A 1VQ9A 2X6GA
chains in the Genus database with same CATH topology
1LTLA 1WCMG 4A3EH 2BH8A 4ALPA 2ZTEA 1B7YB 1LM0A 2K50A 4LW1A 3K81C 4A4IA 4HJAA 4GOPC 2K4KA 3ER0A 4MNOA 4RMFA 2R92H 3F8TA 2V1CC 4GKJQ 5GAEC 1W2BA 1V1QA 1YIJA 1KQSA 4DAMA 3KJPA 3K0XA 4X65Q 4DR4Q 5ELNA 4DR3Q 1UE5A 4JOIC 4BBSG 4DV1L 1Q82C 1PH8A 3ULLA 4DUYQ 4ME3A 4DV5L 1FJGQ 1L1OA 1J5EQ 3MEFA 3JAMc 2AHOB 1I94L 3H0GH 3PUZA 5C4XG 2L15A 4PG3A 2ZJRA 4LFAL 1C9OA 1LYLA 2MO0A 4OX9L 4DKAC 1IL2A 1QUQA 1YHQA 4C3HH 2KENA 3G48A 1E3PA 1XMOL 1HNXL 2Z0SA 4YY3L 1Q1EA 3UE0A 2UUAQ 3GTQH 2I5HA 4YHHL 4JV5L 2IY5B 2UU9L 4POGA 2IX0A 2C35B 1E24A 1SN8A 2RHSB 1XMQQ 3HKZG 3NEMA 2IX1A 1SRUA 1YI2A 4DK3C 4NXMQ 4O0AA 1VQ8A 4JI6L 4DPGA 1O7IA 2QEXA 5LMNW 1Q1BA 4DV0Q 3CPFA 3TS2A 3S1QH 4FDBA 2LXJA 4AIMA 4LF6L 3BJUA 3CP0A 3PIOA 2ZJPA 3ICEA 1XPUA 1VQEA 2KHIA 1U0LA 3GD7A 4A3KH 3OYYA 1CUKA 2ATWA 4GN5A 1CKOA 1JE5A 3E9HA 4DV1Q 2NVTH 3A0JA 4JI2L 1D8LA 5IWAL 1YEZA 4B3TL 1VCIA 2BA1A 4QIWE 3HOVG 5C0XJ 4R4TA 1VQ5A 3M3YH 4AYBG 2CWPA 1XTDA 2GN5A 1K83H 3RLFA 2YTYA 5AJ3Q 1JJGA 2EQSA 2CFMA 1RIPA 3KLWA 1YNXA 4YY3Q 4YHHQ 4A3MH 4JI7L 4XIGS 4A3GH 1TWGH 2IHFA 1IXRA 4BA2I 2GVBA 4TQUS 1L2FA 4LUZA 5M5WH 4IJLA 4YCWA 4B3SL 3PUXA 3BU2A 5C0XI 3KF6A 3HOUH 4DV4L 3Q8DA 4JI6Q 3BZKA 5C44G 4AH6A 2VUMG 1R9TH 3CCSA 3AFPA 4GS3A 2N78A 4GOPA 1DGSA 5EAYA 2F4VQ 1YITA 2YU9H 2PMZE 4DR5L 4UP7A 3E0EA 5FLMH 1UEBA 3PCOB 3FHWA 4P71A 1QVFA 4P75A 1IYJB 2UUBL 3PO3G 4DV2Q 1A0IA 2CQOA 3RR5A 3U4ZA 4JOIA 4DR2L 4LF9L 1E1OA 4DV3L 1HNZL 4YCUA 5M5YH 1YJNA 2YTXA 4L5QA 3UDXA 1HNWQ 1UE7A 3W1BA 1BVSA 4C2MH 1GO3E 1I5FA 2KCTA 2JJQA 3JC66 4B3RL 1VQAA 3HOZG 4A3IH 1HZAA 1VQPA 4X64L 5K36G 1TWAH 2VS1A 4DV6L 4GLXA 3PSIA 1ASZA 1VQBA 1IBKL 2WB1E 1PH3A 4IOAA 2PQAB 1NJIC 3HOXG 4JCVE 4B3SQ 2LXKA 1Q7YC 1PYBA 3J81c 2R7DA 4A3EG 1J6QA 4L5SA 3K7AH 4A3BH 2PI2E 1BKBA 3I4MH 4GLVB 4APVA 2WP8J 2R93H 1KRSA 3L0OA 4DR5Q 1N8RC 3FP9A 3G6EA 5IYBG 4JBWA 1FVIA 1JMCA 3OTOQ 5IYCH 3A74A 1NBWA 3MXNB 2E2JH 4X65L 3GTLH 1MIUA 4Y7NH 4DR3L 1PA6A 1GD7A 4A3FH 4X66Q 4DR2Q 2GVAA 4LF9Q 4DUYL 3FKIH 2HT1A 3S16H 5FJ8H 1FJGL 4Y52H 1J5EL 1MJEA 4IO9A 3K8AA 1W3SA 3CW2C 3J7ZC 1V9PA 3ULJA 1G291 1CKNB 2JEBI 4NB3A 3RN2A 3VDYA 4B3RQ 5HY6A 4X64Q 1AH9A 3TREA 5M3MH 3GTMH 3H3VI 5HGQA 5BR8Q 2I5MX 4HJ9A 1HR0Q 2R7ZH 4A3LH 3HFZB 5C0XG 4KI0A 1SR3A 2K5HA 1EUJA 2RF4A 4IPDA 2DUDA 3CCMA 2BH2A 3K80C 5M5XH 1XMQL 1B8AA 4IOCA 1VQNA 4X6AH 4NXML 1E7ZA 5GAGC 4GNXA 2VNUD 2JK8A 1E1TA 4DV0L 1GKHA 3M9BA 2JA5G 2JA6G 5IYDH 4LUOA 4PMWA 1YHBA 3GO5A 1BBWA 4PZ7A 3RNUA 3U4VA 3I7FA 1SE8A 4C3JH 1S72A 2ZTCA 2R7FA 5DLQE 3CQZH 4DUZQ 3GTGH 1M1KC 1Q81C 1S3OA 1PFSA 1VQDA 4DV7Q 4JI5Q 3T1YQ 3KDFB 3CC7A 1PH1A 3F2CA 3M85A 1XNQQ 1X65A 4BBRG 4A93G 1EQRA 4K0KQ 3HOYH 1K9MC 1L0WA 2B63H 3I56A 1XNRQ 3HKSA 4P74A 3BZCA 5C4JH 2YYZA 4TVAB 5IP7G 3E9IA 5AJ3L 1K8GA 3J81i 1YHAA 3UDGA 1Y1VG 3M4QA 1XPOA 1PVOA 1K0RA 1G51A 2NZHA 4LNQA 2Q2IA 3CD6A 4JI4Q 3CCEA 2Z6KC 4HJ7A 3HOWH 1CSQA 4OWTB 4OXPA 1PYSB 4DR1Q 1EQQA 1ASYA 1QVCA 3PO2H 4LF4Q 4QGUA 1QVGA 1V43A 2VQFQ 1X3FA 3S1MH 2F52A 3H15A 2F4VL 1PHJA 3CCQA 4B3MQ 2FXQA 4DR7L 4QQBX 4NXNQ 1XPRA 2NZOA 2ID0A 5IP9H 1WFQA 4A3CG 1X3GA 1VQ6A 4DV2L 3PF4A 1KD1C 4HIKA 3I2ZA 1HZCA 4LFBQ 1N33Q 1Z9FA 4JBMA 1PH5A 2UXDQ 3M4PA 2EIFA 1HNWL 4UP9A 1L1OB 2WAQE 2H5XA 1NMGA 1UE6A 1WCMH 2KCMA 1WJJA 3PF5A 4A3DG 1BBUA 5JJIA 1HZBA 3K7UC 2AKWB 1AE3A 3SGIA 1K3RA 1HJPA 2I0QA 1QUQB 4LFCQ 1VQFA 1OXUA 1VQLA 3J80i 3TRZA 1MJCA 3L2PA 3PIPA 2NVYH 1MKHA 1GM5A 3I4NG 1IBMQ 4LF5Q 4OWWB 1FL0A 2UXBQ 4JI0Q 4BBSH 4R4IA 2OQ0A 4LF8Q 3CMEA 4OO1I 3I4MG 5JEAG 4X62Q 3DM3A 4BY7H 3PUWA 2Q2HA 4DR7Q 1X3EA 5C4XH 3AQQA 3U50C 1KXLA 3OTOL 1C0AA 4DR6L 5M3FG 1H95A 1T9HA 2UUCQ 2NN6I 1E22A 2JE6I 4LF7L 4X66L 3FKIG 5ELOA 3B6YA 3ZJYC 3GTOH 1Q86C 1U5KA 4P72A 4A3JG 4UPAA 4JYAQ 4EQ5A 1X54A 2OTJA 1Q46A 5M3MG 4RG1A 4HIMA 1Y1WG 1QZHA 5BR8L 2QA4A 2R7ZG 1HR0L 1A63A 4MTNA 2HHHL 3GDEA 2NVXH 2Y0SG 1JJCB 4HJ5A 2N3SA 3S15H 1N34Q 3S2HH 4KHPQ 3W5OA 4IPGA 4R4QA 1L1OC 3NELA 2OQKA 2HIVA 1N36Q 4BY1H 4UY8C 3KF6B 5LMNQ 2R92G 4PZ6A 4IPHA 3HOVH 1CKNA 4AYBE 3F2DA 4L5TA 2N8NA 2UXCQ 2MFIA 2VY3A 3CXCA 4HIDA 3T1HL 4DUZL 4WJ4A 4DR6Q 4YWKA 4C3IH 1YZ6A 4A76A 3RLOA 3STBC 1PV4A 2OWOA 4LF7Q 4DV7L 3J7A5 1WI5A 4UP8A 4JI5L 2IHEA 3DLLA 3T1YL 3J81j 3H0GG 4JI1Q 1XNQL 4KHZA 4BA1I 4IFDG 2JA8H 3UDIA 2CKZB 3CCVA 4K0KL 2Q2TA 1OXSC 1FGUA 3W1GA 4HJ8A 1XNRL 3S17H 2VUMH 4AQYL 3G71A 4L5RC 1VQIA 4NPSA 2K14A 4QL5A 2HHHQ 1YJWA 3I55A 4A75A 1SMXA 5JEAJ 1TXYA 5C3EH 4OO1G 3I4OA 4JI4L 3PO3H 1EFWA 5LMUL 1YBYA 3J80c 3KDFA 4DR1L 4JC0A 3GTKH 1HZ9A 3AYHB 2KBNA 4MZ9A 3A5ZB 1K73C 4LF4L 2VQFL 3STBD 3KF8B 3F2BA 4B3ML 1KHIA 1Y14B 2NN6G 4NXNL 3T1HQ 4A3KG 1VQ4A 1SFOH 3HOZH 1VQCA 1A62A 2HIXA 3M4OH 2MNAA 4JI3L 3TS0A 3S1RH 1VQOA 1LUZA 4GN4B 4LFBL 4KLKA 1N33L 4H02A 4WJ3M 2UXDL 1M90C 3S2DH 3HOXH 2ZM6L 2E8GA 2I5LX 2WFWA 4DAYB 4GKKL 2MO1A 3D0FA 5GQOA 1C7YA 4GN3B 4YWMA 2WAQG 2JQOA 4AQYQ 1G6PA 2RCNA 1NE3A 2VQEL 1Q8KA 2K5VA 4A3MG 4BXXH 4A3GG 4LFCL 3CCJA 4QY7A 1X9NA 1NMFA 1P16A 5IYBH 2VZAA 4JBKA 2JA7H 1EOVA 1TWCH 5LMUQ 1IBML 4LF5L 2YV5A 2E5LQ 2ASBA 3HOUG 5IE8A 4JI0L 1WYDA 2JEAI 2UXBL 4LF8L 2K5NA 1X56A 3D31A 3S1NH 4X62L 4GNXB 4BY7G 4JI8Q 1D7QA 5FLMG 2QGQA 3CCUA 3NENA 1IBLQ 3LGJA 1S40A 3ERSX 4IFDJ 2N49A 4JI3Q 1VS0A 3TEHB 3PUYA 2UUCL 1KC8C 1PH6A 5GADC 3UDFA 2B29A 2ZM6Q 2E2HH 4JBJA 1KAWA 1PH7A 2RHQB 4GKKQ 4JYAL 5E7NA 5GAHC 1N9WA 2B3GA 1K8AC 4OWXB 4A3IG 2VQEQ 3RZOH 4IFDI 2JA6H 3CAMA 2JA5H 4JG2A 3UE1A 1KRTA 3PUVA 3KFUA 4HIOA 1B70B 3TQYA 2WB1G 2XTIA 2KHJA 2OCEA 2AWNA 1N34L 4KHPL 4A3BG 3AFQA 4IPCA 4LUVA 3S24A 2R6GA 1I50H 4DV5Q 1JB7A 1P8LA 4BY1G 1N36L 4DNIA 1OTCA 5LMNL 1I94Q 2MQHA 2D62A 2R93G 1TWHH 4BBRH 1Q12A 4LFAQ 4GLAC 4OX9Q 2UXCL 1EWIA 5IYCG 4O2DA 3M7NA 4XTCS 4A93H 3EIVA 5JJKA 1XMOQ 1HR0W 4OONA 1HNXQ 3GTJH 1VQHA 5H1SE 2PQAA 4A3FG 1YJ9A 5IP7H 4JV5Q 5FJ8G 3CCLA 5FLXc 1Y1VH 2UU9Q 2K52A 2DGYA 3HKZE 3PV0A 3WWVA 4JI1L 3GTPH 1JT8A 1CSPA 1SLJA 4R4OA 4GNXC 4R1JA 2JA8G 1N32L 1CKMA 3A5UA 1SROA 3EBEA 1RL2A 4LF6Q 2A19A 4A3LG 1KIXA 5IY0A 5C3EG 2OTLA 3NBHB 3KOJA 3RN5A 4A3CH 1PH4A 3S14H 3EN2A 2Z6KA 3JAMi 5GROA 3CCRA 1AE2A 1JJ2A 4JI2Q 5IWAQ 5IYDG 3CF5A 1UE1A 2ZJQA 1OXXK 3CPWA 4B3TQ 2F3IA 2YTVA 2K75A 3IRBA 2D0OA 3H3VH 4YWLA 2ALYB 4EX5A 4GOPB 4A3DH 2CCZA 1VQKA 1NTGA 2ZTDA 1OXTA 3CC4A 2NVQH 1OXVA 1EYGA 2PNHA 4JI7Q 2A8VA 3RLNA 3KYHC 4DK6C 2XGTA 1QZGA 2AWOA 2EXDA 2BA0A 4LWCA 3I4NH 1N32Q 1PH2A 1VQJA 1EIFA 2E2IH 1I3QH 4DV4Q 4J15A 3HOYG 5C44H 3CMAA 2B63G 5JJLA 1X55A 2A1AA 4BXXG 4R4CA 3KJOA 3OW2A 2LSSA 3U58A 1UWVA 1A8VA 1KL9A 2AMCB 2Q2UA 5J3BA 2JA7G 2UUBQ 2VL6A 3L7ZC 3CC2A 5M3FH 3HOWG 4DR4L 3RZDH 2E5LL 1Z47A 3PO2G 1HH2P 1YVCA 4DV3Q 1HNZQ 3F1ZA 2VW9A 4QJFA 1EIYB 1VQGA 4A3JH 4JI8L 1IZ6A 2IT1A 1VQ7A 1WOCA 4GKJL 1GVPA 3G4SA 4POFA 4IJHA 4YCVA 1TWFH 5IP9G 1PH9A 1IBLL 1XJVA 4DV6Q 2CWAA 1Y1WH 2Y0SE 1VQMA 1NY4A 1X6OA 4P73A 3AEVA 2UUAL 2HQLA 1IBKQ 2JA9A 4PZ8A 5IT9c 1I6HH 3PGZA 2PI2A 1VQ9A 2D0PA 2ES2A 3ULPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTL A;  1WCM G;  4A3E H;  2BH8 A;  4ALP A;  2ZTE A;  1B7Y B;  1LM0 A;  2K50 A;  4LW1 A;  3K81 C;  4A4I A;  4HJA A;  4GOP C;  2K4K A;  3ER0 A;  4MNO A;  4RMF A;  2R92 H;  3F8T A;  2V1C C;  4GKJ Q;  5GAE C;  1W2B A;  1V1Q A;  1YIJ A;  1KQS A;  4DAM A;  3KJP A;  3K0X A;  4X65 Q;  4DR4 Q;  5ELN A;  4DR3 Q;  1UE5 A;  4JOI C;  4BBS G;  4DV1 L;  1Q82 C;  1PH8 A;  3ULL A;  4DUY Q;  4ME3 A;  4DV5 L;  1FJG Q;  1L1O A;  1J5E Q;  3MEF A;  3JAM c;  2AHO B;  1I94 L;  3H0G H;  3PUZ A;  5C4X G;  2L15 A;  4PG3 A;  2ZJR A;  4LFA L;  1C9O A;  1LYL A;  2MO0 A;  4OX9 L;  4DKA C;  1IL2 A;  1QUQ A;  1YHQ A;  4C3H H;  2KEN A;  3G48 A;  1E3P A;  1XMO L;  1HNX L;  2Z0S A;  4YY3 L;  1Q1E A;  3UE0 A;  2UUA Q;  3GTQ H;  2I5H A;  4YHH L;  4JV5 L;  2IY5 B;  2UU9 L;  4POG A;  2IX0 A;  2C35 B;  1E24 A;  1SN8 A;  2RHS B;  1XMQ Q;  3HKZ G;  3NEM A;  2IX1 A;  1SRU A;  1YI2 A;  4DK3 C;  4NXM Q;  4O0A A;  1VQ8 A;  4JI6 L;  4DPG A;  1O7I A;  2QEX A;  5LMN W;  1Q1B A;  4DV0 Q;  3CPF A;  3TS2 A;  3S1Q H;  4FDB A;  2LXJ A;  4AIM A;  4LF6 L;  3BJU A;  3CP0 A;  3PIO A;  2ZJP A;  3ICE A;  1XPU A;  1VQE A;  2KHI A;  1U0L A;  3GD7 A;  4A3K H;  3OYY A;  1CUK A;  2ATW A;  4GN5 A;  1CKO A;  1JE5 A;  3E9H A;  4DV1 Q;  2NVT H;  3A0J A;  4JI2 L;  1D8L A;  5IWA L;  1YEZ A;  4B3T L;  1VCI A;  2BA1 A;  4QIW E;  3HOV G;  5C0X J;  4R4T A;  1VQ5 A;  3M3Y H;  4AYB G;  2CWP A;  1XTD A;  2GN5 A;  1K83 H;  3RLF A;  2YTY A;  5AJ3 Q;  1JJG A;  2EQS A;  2CFM A;  1RIP A;  3KLW A;  1YNX A;  4YY3 Q;  4YHH Q;  4A3M H;  4JI7 L;  4XIG S;  4A3G H;  1TWG H;  2IHF A;  1IXR A;  4BA2 I;  2GVB A;  4TQU S;  1L2F A;  4LUZ A;  5M5W H;  4IJL A;  4YCW A;  4B3S L;  3PUX A;  3BU2 A;  5C0X I;  3KF6 A;  3HOU H;  4DV4 L;  3Q8D A;  4JI6 Q;  3BZK A;  5C44 G;  4AH6 A;  2VUM G;  1R9T H;  3CCS A;  3AFP A;  4GS3 A;  2N78 A;  4GOP A;  1DGS A;  5EAY A;  2F4V Q;  1YIT A;  2YU9 H;  2PMZ E;  4DR5 L;  4UP7 A;  3E0E A;  5FLM H;  1UEB A;  3PCO B;  3FHW A;  4P71 A;  1QVF A;  4P75 A;  1IYJ B;  2UUB L;  3PO3 G;  4DV2 Q;  1A0I A;  2CQO A;  3RR5 A;  3U4Z A;  4JOI A;  4DR2 L;  4LF9 L;  1E1O A;  4DV3 L;  1HNZ L;  4YCU A;  5M5Y H;  1YJN A;  2YTX A;  4L5Q A;  3UDX A;  1HNW Q;  1UE7 A;  3W1B A;  1BVS A;  4C2M H;  1GO3 E;  1I5F A;  2KCT A;  2JJQ A;  3JC6 6;  4B3R L;  1VQA A;  3HOZ G;  4A3I H;  1HZA A;  1VQP A;  4X64 L;  5K36 G;  1TWA H;  2VS1 A;  4DV6 L;  4GLX A;  3PSI A;  1ASZ A;  1VQB A;  1IBK L;  2WB1 E;  1PH3 A;  4IOA A;  2PQA B;  1NJI C;  3HOX G;  4JCV E;  4B3S Q;  2LXK A;  1Q7Y C;  1PYB A;  3J81 c;  2R7D A;  4A3E G;  1J6Q A;  4L5S A;  3K7A H;  4A3B H;  2PI2 E;  1BKB A;  3I4M H;  4GLV B;  4APV A;  2WP8 J;  2R93 H;  1KRS A;  3L0O A;  4DR5 Q;  1N8R C;  3FP9 A;  3G6E A;  5IYB G;  4JBW A;  1FVI A;  1JMC A;  3OTO Q;  5IYC H;  3A74 A;  1NBW A;  3MXN B;  2E2J H;  4X65 L;  3GTL H;  1MIU A;  4Y7N H;  4DR3 L;  1PA6 A;  1GD7 A;  4A3F H;  4X66 Q;  4DR2 Q;  2GVA A;  4LF9 Q;  4DUY L;  3FKI H;  2HT1 A;  3S16 H;  5FJ8 H;  1FJG L;  4Y52 H;  1J5E L;  1MJE A;  4IO9 A;  3K8A A;  1W3S A;  3CW2 C;  3J7Z C;  1V9P A;  3ULJ A;  1G29 1;  1CKN B;  2JEB I;  4NB3 A;  3RN2 A;  3VDY A;  4B3R Q;  5HY6 A;  4X64 Q;  1AH9 A;  3TRE A;  5M3M H;  3GTM H;  3H3V I;  5HGQ A;  5BR8 Q;  2I5M X;  4HJ9 A;  1HR0 Q;  2R7Z H;  4A3L H;  3HFZ B;  5C0X G;  4KI0 A;  1SR3 A;  2K5H A;  1EUJ A;  2RF4 A;  4IPD A;  2DUD A;  3CCM A;  2BH2 A;  3K80 C;  5M5X H;  1XMQ L;  1B8A A;  4IOC A;  1VQN A;  4X6A H;  4NXM L;  1E7Z A;  5GAG C;  4GNX A;  2VNU D;  2JK8 A;  1E1T A;  4DV0 L;  1GKH A;  3M9B A;  2JA5 G;  2JA6 G;  5IYD H;  4LUO A;  4PMW A;  1YHB A;  3GO5 A;  1BBW A;  4PZ7 A;  3RNU A;  3U4V A;  3I7F A;  1SE8 A;  4C3J H;  1S72 A;  2ZTC A;  2R7F A;  5DLQ E;  3CQZ H;  4DUZ Q;  3GTG H;  1M1K C;  1Q81 C;  1S3O A;  1PFS A;  1VQD A;  4DV7 Q;  4JI5 Q;  3T1Y Q;  3KDF B;  3CC7 A;  1PH1 A;  3F2C A;  3M85 A;  1XNQ Q;  1X65 A;  4BBR G;  4A93 G;  1EQR A;  4K0K Q;  3HOY H;  1K9M C;  1L0W A;  2B63 H;  3I56 A;  1XNR Q;  3HKS A;  4P74 A;  3BZC A;  5C4J H;  2YYZ A;  4TVA B;  5IP7 G;  3E9I A;  5AJ3 L;  1K8G A;  3J81 i;  1YHA A;  3UDG A;  1Y1V G;  3M4Q A;  1XPO A;  1PVO A;  1K0R A;  1G51 A;  2NZH A;  4LNQ A;  2Q2I A;  3CD6 A;  4JI4 Q;  3CCE A;  2Z6K C;  4HJ7 A;  3HOW H;  1CSQ A;  4OWT B;  4OXP A;  1PYS B;  4DR1 Q;  1EQQ A;  1ASY A;  1QVC A;  3PO2 H;  4LF4 Q;  4QGU A;  1QVG A;  1V43 A;  2VQF Q;  1X3F A;  3S1M H;  2F52 A;  3H15 A;  2F4V L;  1PHJ A;  3CCQ A;  4B3M Q;  2FXQ A;  4DR7 L;  4QQB X;  4NXN Q;  1XPR A;  2NZO A;  2ID0 A;  5IP9 H;  1WFQ A;  4A3C G;  1X3G A;  1VQ6 A;  4DV2 L;  3PF4 A;  1KD1 C;  4HIK A;  3I2Z A;  1HZC A;  4LFB Q;  1N33 Q;  1Z9F A;  4JBM A;  1PH5 A;  2UXD Q;  3M4P A;  2EIF A;  1HNW L;  4UP9 A;  1L1O B;  2WAQ E;  2H5X A;  1NMG A;  1UE6 A;  1WCM H;  2KCM A;  1WJJ A;  3PF5 A;  4A3D G;  1BBU A;  5JJI A;  1HZB A;  3K7U C;  2AKW B;  1AE3 A;  3SGI A;  1K3R A;  1HJP A;  2I0Q A;  1QUQ B;  4LFC Q;  1VQF A;  1OXU A;  1VQL A;  3J80 i;  3TRZ A;  1MJC A;  3L2P A;  3PIP A;  2NVY H;  1MKH A;  1GM5 A;  3I4N G;  1IBM Q;  4LF5 Q;  4OWW B;  1FL0 A;  2UXB Q;  4JI0 Q;  4BBS H;  4R4I A;  2OQ0 A;  4LF8 Q;  3CME A;  4OO1 I;  3I4M G;  5JEA G;  4X62 Q;  3DM3 A;  4BY7 H;  3PUW A;  2Q2H A;  4DR7 Q;  1X3E A;  5C4X H;  3AQQ A;  3U50 C;  1KXL A;  3OTO L;  1C0A A;  4DR6 L;  5M3F G;  1H95 A;  1T9H A;  2UUC Q;  2NN6 I;  1E22 A;  2JE6 I;  4LF7 L;  4X66 L;  3FKI G;  5ELO A;  3B6Y A;  3ZJY C;  3GTO H;  1Q86 C;  1U5K A;  4P72 A;  4A3J G;  4UPA A;  4JYA Q;  4EQ5 A;  1X54 A;  2OTJ A;  1Q46 A;  5M3M G;  4RG1 A;  4HIM A;  1Y1W G;  1QZH A;  5BR8 L;  2QA4 A;  2R7Z G;  1HR0 L;  1A63 A;  4MTN A;  2HHH L;  3GDE A;  2NVX H;  2Y0S G;  1JJC B;  4HJ5 A;  2N3S A;  3S15 H;  1N34 Q;  3S2H H;  4KHP Q;  3W5O A;  4IPG A;  4R4Q A;  1L1O C;  3NEL A;  2OQK A;  2HIV A;  1N36 Q;  4BY1 H;  4UY8 C;  3KF6 B;  5LMN Q;  2R92 G;  4PZ6 A;  4IPH A;  3HOV H;  1CKN A;  4AYB E;  3F2D A;  4L5T A;  2N8N A;  2UXC Q;  2MFI A;  2VY3 A;  3CXC A;  4HID A;  3T1H L;  4DUZ L;  4WJ4 A;  4DR6 Q;  4YWK A;  4C3I H;  1YZ6 A;  4A76 A;  3RLO A;  3STB C;  1PV4 A;  2OWO A;  4LF7 Q;  4DV7 L;  3J7A 5;  1WI5 A;  4UP8 A;  4JI5 L;  2IHE A;  3DLL A;  3T1Y L;  3J81 j;  3H0G G;  4JI1 Q;  1XNQ L;  4KHZ A;  4BA1 I;  4IFD G;  2JA8 H;  3UDI A;  2CKZ B;  3CCV A;  4K0K L;  2Q2T A;  1OXS C;  1FGU A;  3W1G A;  4HJ8 A;  1XNR L;  3S17 H;  2VUM H;  4AQY L;  3G71 A;  4L5R C;  1VQI A;  4NPS A;  2K14 A;  4QL5 A;  2HHH Q;  1YJW A;  3I55 A;  4A75 A;  1SMX A;  5JEA J;  1TXY A;  5C3E H;  4OO1 G;  3I4O A;  4JI4 L;  3PO3 H;  1EFW A;  5LMU L;  1YBY A;  3J80 c;  3KDF A;  4DR1 L;  4JC0 A;  3GTK H;  1HZ9 A;  3AYH B;  2KBN A;  4MZ9 A;  3A5Z B;  1K73 C;  4LF4 L;  2VQF L;  3STB D;  3KF8 B;  3F2B A;  4B3M L;  1KHI A;  1Y14 B;  2NN6 G;  4NXN L;  3T1H Q;  4A3K G;  1VQ4 A;  1SFO H;  3HOZ H;  1VQC A;  1A62 A;  2HIX A;  3M4O H;  2MNA A;  4JI3 L;  3TS0 A;  3S1R H;  1VQO A;  1LUZ A;  4GN4 B;  4LFB L;  4KLK A;  1N33 L;  4H02 A;  4WJ3 M;  2UXD L;  1M90 C;  3S2D H;  3HOX H;  2ZM6 L;  2E8G A;  2I5L X;  2WFW A;  4DAY B;  4GKK L;  2MO1 A;  3D0F A;  5GQO A;  1C7Y A;  4GN3 B;  4YWM A;  2WAQ G;  2JQO A;  4AQY Q;  1G6P A;  2RCN A;  1NE3 A;  2VQE L;  1Q8K A;  2K5V A;  4A3M G;  4BXX H;  4A3G G;  4LFC L;  3CCJ A;  4QY7 A;  1X9N A;  1NMF A;  1P16 A;  5IYB H;  2VZA A;  4JBK A;  2JA7 H;  1EOV A;  1TWC H;  5LMU Q;  1IBM L;  4LF5 L;  2YV5 A;  2E5L Q;  2ASB A;  3HOU G;  5IE8 A;  4JI0 L;  1WYD A;  2JEA I;  2UXB L;  4LF8 L;  2K5N A;  1X56 A;  3D31 A;  3S1N H;  4X62 L;  4GNX B;  4BY7 G;  4JI8 Q;  1D7Q A;  5FLM G;  2QGQ A;  3CCU A;  3NEN A;  1IBL Q;  3LGJ A;  1S40 A;  3ERS X;  4IFD J;  2N49 A;  4JI3 Q;  1VS0 A;  3TEH B;  3PUY A;  2UUC L;  1KC8 C;  1PH6 A;  5GAD C;  3UDF A;  2B29 A;  2ZM6 Q;  2E2H H;  4JBJ A;  1KAW A;  1PH7 A;  2RHQ B;  4GKK Q;  4JYA L;  5E7N A;  5GAH C;  1N9W A;  2B3G A;  1K8A C;  4OWX B;  4A3I G;  2VQE Q;  3RZO H;  4IFD I;  2JA6 H;  3CAM A;  2JA5 H;  4JG2 A;  3UE1 A;  1KRT A;  3PUV A;  3KFU A;  4HIO A;  1B70 B;  3TQY A;  2WB1 G;  2XTI A;  2KHJ A;  2OCE A;  2AWN A;  1N34 L;  4KHP L;  4A3B G;  3AFQ A;  4IPC A;  4LUV A;  3S24 A;  2R6G A;  1I50 H;  4DV5 Q;  1JB7 A;  1P8L A;  4BY1 G;  1N36 L;  4DNI A;  1OTC A;  5LMN L;  1I94 Q;  2MQH A;  2D62 A;  2R93 G;  1TWH H;  4BBR H;  1Q12 A;  4LFA Q;  4GLA C;  4OX9 Q;  2UXC L;  1EWI A;  5IYC G;  4O2D A;  3M7N A;  4XTC S;  4A93 H;  3EIV A;  5JJK A;  1XMO Q;  1HR0 W;  4OON A;  1HNX Q;  3GTJ H;  1VQH A;  5H1S E;  2PQA A;  4A3F G;  1YJ9 A;  5IP7 H;  4JV5 Q;  5FJ8 G;  3CCL A;  5FLX c;  1Y1V H;  2UU9 Q;  2K52 A;  2DGY A;  3HKZ E;  3PV0 A;  3WWV A;  4JI1 L;  3GTP H;  1JT8 A;  1CSP A;  1SLJ A;  4R4O A;  4GNX C;  4R1J A;  2JA8 G;  1N32 L;  1CKM A;  3A5U A;  1SRO A;  3EBE A;  1RL2 A;  4LF6 Q;  2A19 A;  4A3L G;  1KIX A;  5IY0 A;  5C3E G;  2OTL A;  3NBH B;  3KOJ A;  3RN5 A;  4A3C H;  1PH4 A;  3S14 H;  3EN2 A;  2Z6K A;  3JAM i;  5GRO A;  3CCR A;  1AE2 A;  1JJ2 A;  4JI2 Q;  5IWA Q;  5IYD G;  3CF5 A;  1UE1 A;  2ZJQ A;  1OXX K;  3CPW A;  4B3T Q;  2F3I A;  2YTV A;  2K75 A;  3IRB A;  2D0O A;  3H3V H;  4YWL A;  2ALY B;  4EX5 A;  4GOP B;  4A3D H;  2CCZ A;  1VQK A;  1NTG A;  2ZTD A;  1OXT A;  3CC4 A;  2NVQ H;  1OXV A;  1EYG A;  2PNH A;  4JI7 Q;  2A8V A;  3RLN A;  3KYH C;  4DK6 C;  2XGT A;  1QZG A;  2AWO A;  2EXD A;  2BA0 A;  4LWC A;  3I4N H;  1N32 Q;  1PH2 A;  1VQJ A;  1EIF A;  2E2I H;  1I3Q H;  4DV4 Q;  4J15 A;  3HOY G;  5C44 H;  3CMA A;  2B63 G;  5JJL A;  1X55 A;  2A1A A;  4BXX G;  4R4C A;  3KJO A;  3OW2 A;  2LSS A;  3U58 A;  1UWV A;  1A8V A;  1KL9 A;  2AMC B;  2Q2U A;  5J3B A;  2JA7 G;  2UUB Q;  2VL6 A;  3L7Z C;  3CC2 A;  5M3F H;  3HOW G;  4DR4 L;  3RZD H;  2E5L L;  1Z47 A;  3PO2 G;  1HH2 P;  1YVC A;  4DV3 Q;  1HNZ Q;  3F1Z A;  2VW9 A;  4QJF A;  1EIY B;  1VQG A;  4A3J H;  4JI8 L;  1IZ6 A;  2IT1 A;  1VQ7 A;  1WOC A;  4GKJ L;  1GVP A;  3G4S A;  4POF A;  4IJH A;  4YCV A;  1TWF H;  5IP9 G;  1PH9 A;  1IBL L;  1XJV A;  4DV6 Q;  2CWA A;  1Y1W H;  2Y0S E;  1VQM A;  1NY4 A;  1X6O A;  4P73 A;  3AEV A;  2UUA L;  2HQL A;  1IBK Q;  2JA9 A;  4PZ8 A;  5IT9 c;  1I6H H;  3PGZ A;  2PI2 A;  1VQ9 A;  2D0P A;  2ES2 A;  3ULP A; 
#chains in the Genus database with same CATH topology
 1LTL A;  1WCM G;  1IYV A;  3G7L A;  4HTH A;  4LW1 A;  3K81 C;  3ER0 A;  1TS2 A;  4ZYS A;  3QWN A;  2HDM A;  1V1Q A;  3K7A B;  5EKK A;  5C5L A;  4LJZ C;  4DAM A;  5BN4 A;  4X65 Q;  4BBS G;  5DEH A;  3FVQ A;  1J5E Q;  5JVH 3;  3H0G H;  2RKS A;  2L15 A;  3N52 A;  4OX9 L;  4C1N K;  4DKA C;  1E3P A;  2H1E A;  5C4Z A;  1F9P A;  1Q1E A;  1U4R A;  2I5H A;  3EVQ A;  4JV5 L;  2IY5 B;  3MFY A;  2JA8 B;  2FFK B;  2IX1 A;  4XQQ A;  3T56 B;  4DPG A;  2M2L A;  2LXJ A;  1ICF B;  4AIM A;  3JAM E;  3BJU A;  5C3E B;  4RAU C;  2NN6 H;  1CKO A;  1LV9 A;  4KTA A;  4CKE A;  1HFN A;  1CHQ D;  1JOO A;  5IWA L;  4B3T L;  1YEZ A;  3PQI A;  2BA1 A;  2LMC B;  1CZG A;  1VQ5 A;  3M4O B;  1SNM A;  1S5C D;  2GN5 A;  2YTY A;  1JJG A;  3TZU A;  4A3M H;  1RIP A;  4A3G H;  2MHV A;  3HOX B;  1FD7 D;  1SE2 A;  4CKB A;  2G9H D;  1GUT A;  2GVB A;  4TQU S;  1L2F A;  1I4H A;  5DM6 3;  1WTR A;  3PUX A;  4B3S L;  2F0D A;  3HOU H;  2MPM A;  3Q8D A;  4N8X 1;  1H9J A;  3M7G A;  4GOP A;  5EAY A;  2F4V Q;  3J7Y W;  2PMZ E;  3GP7 A;  5EBD A;  4P75 A;  1A0I A;  1BR9 A;  2PCF B;  4JOI A;  3IFD A;  4YCU A;  2O5J C;  4KY5 A;  2YTX A;  3W1B A;  4R9W A;  1I5F A;  4B3R L;  3HOZ G;  1HZA A;  5K36 G;  3QOJ A;  2VS1 A;  4DV6 L;  4GLX A;  1V1P A;  1VQB A;  1EY4 A;  2G9D A;  2PQA B;  3HOX G;  4B3S Q;  1PLF A;  1F9S A;  2RA4 A;  1KRS A;  1Y8N B;  2XRS D;  1JMC A;  3OTO Q;  5IYC H;  3R2T A;  2GA4 B;  3MXN B;  1PA6 A;  1GD7 A;  2GVA A;  2HT1 A;  1A15 A;  3J80 L;  1QWY A;  3R2I A;  3CRK C;  3TP6 A;  3K8A A;  1W3S A;  4TRD A;  3J7Z C;  4G4K A;  4B3R Q;  3RN2 A;  5HY6 A;  5M3M H;  1TQO A;  1O7Z A;  5HGQ A;  2I5M X;  2OXP A;  3OIP A;  4HJ9 A;  3OWE B;  4KI0 A;  3QOL A;  3I90 A;  4JPB W;  4DGZ A;  1BDO A;  4IOC A;  5DNF A;  4GNX A;  2JK8 A;  2NVX B;  5IYD H;  2JA6 G;  2EVB A;  1WD0 A;  4NP5 A;  1HUM A;  4PV1 C;  3GO5 A;  3RNU A;  4RCN A;  3I7F A;  2ZTC A;  2R7F A;  4ILW A;  4QMG A;  4DUZ Q;  1M4V A;  1Q81 C;  3NTH A;  1PFS A;  4N9T A;  4JI5 Q;  3T1Y Q;  3VR4 A;  3GV3 A;  3F2C A;  3M85 A;  1BBX C;  1Q3L A;  3KK7 A;  4A93 G;  1EQR A;  4K0K Q;  3HOY H;  2EYP A;  1L0W A;  2B63 H;  3I56 A;  5IOC A;  5ELF A;  4P74 A;  4BS9 A;  5AJ3 L;  3E9I A;  1K8G A;  3UDG A;  3R3O A;  1XPO A;  1PVO A;  2NZH A;  1H9S B;  3S9W A;  2IW3 A;  1CQF A;  2Z6K C;  4HJ7 A;  1CSQ A;  2K32 A;  1DZ1 A;  2OEO A;  4KJN A;  4LF4 Q;  1QVG A;  3S1M H;  1V43 A;  1X3F A;  4B3M Q;  2NZO A;  3D6W A;  1WFQ A;  1X3G A;  4RKB A;  1VQ6 A;  1CHP D;  1HZC A;  5DAU A;  4LFB Q;  1LO5 D;  1WTQ A;  1D1I A;  1PFN A;  3M4P A;  4FP5 D;  1WTX A;  1ILP A;  2WV6 D;  1TWF B;  1SFO B;  1L1O B;  4DN4 M;  1UE6 A;  4TSS A;  2F0K A;  3K7U C;  3H09 A;  1K3R A;  2Y0S B;  3MWY W;  2IX3 A;  3S2D B;  1VQF A;  3NBH A;  1HA6 A;  2F0W A;  4ZUJ A;  1BOS A;  4KK7 A;  1F2M A;  1PRT B;  1TY2 A;  4LF5 Q;  2UXB Q;  1LT6 D;  2C5C A;  2OQ0 A;  3P20 A;  4LF8 Q;  1AP0 A;  4OO1 I;  1SXT A;  2Q2H A;  2K03 A;  3A56 A;  3U50 C;  3GQB A;  3OSO A;  3G6J B;  1AFP A;  4DR6 L;  4J8Q A;  3S1N B;  2UUC Q;  1EWC A;  1E22 A;  2JE6 I;  4X66 L;  1B44 D;  2MUY A;  3Q6S A;  3E3X A;  1X54 A;  5M3M G;  1Y1W G;  4PMB A;  2F0N A;  1HR0 L;  2Y0S G;  1JJC B;  1PTO H;  2FMC A;  3BDC A;  3S2H H;  4H44 C;  4KHP Q;  1F9R A;  2Z1C A;  4R4Q A;  2OQK A;  2HIV A;  1X3P A;  4IUQ A;  3Q0A A;  2R92 G;  3URY A;  4PZ6 A;  4IPH A;  1CKN A;  2D5D A;  3CU7 A;  5EKL A;  4HID A;  4DR6 Q;  1PV4 A;  1SE3 A;  3RLO A;  1A2U A;  3SXH A;  3J7A V;  1QIL A;  4JI1 Q;  2HUG A;  4KHZ A;  4BA1 I;  1O78 A;  3NHH A;  3UDI A;  2CKZ B;  1HTL D;  2NUC A;  4HJ8 A;  3N6R A;  3W1G A;  5I4D A;  2VUM H;  4AQY L;  1TWG B;  3G71 A;  4NPS A;  2K14 A;  1KNE A;  3NTI A;  1S5E D;  1O7L A;  4A75 A;  2L9H A;  1ZXT A;  1FNV A;  1IYU A;  4ULL A;  4DR1 L;  4K8I A;  1A3U A;  3KF8 B;  2PMZ B;  1ICW A;  3QO2 A;  1CQV A;  4NXN L;  4A3K G;  2CH4 W;  2ICE C;  1VQC A;  3NPP A;  1NUC A;  2MNA A;  3S1R H;  3R8B A;  1VQO A;  4C2M B;  1N33 L;  4IUT A;  4IAL A;  4A3D B;  2E8G A;  2F4I A;  4GKK L;  3TBI B;  1C7Y A;  2F3V A;  4GN3 B;  4AQY Q;  3TN2 A;  2RCN A;  1YNN C;  1DXM A;  3LWE A;  5A35 A;  4QCL A;  2K5D A;  1NSN S;  1I3Q B;  4ZQ3 A;  1BCP C;  2JA7 H;  4A3B B;  3HEJ A;  3WOE A;  2YV5 A;  1IBM L;  2E5L Q;  3I4M B;  1I4P A;  4UDU C;  2K5N A;  4DA2 A;  1STY A;  4FVM A;  4HMJ A;  4CDF C;  1D7Q A;  5M3F B;  5FLM G;  4Y7N B;  3NEN A;  1IBL Q;  1LT3 D;  2N49 A;  1PH6 A;  2EYO A;  1LAC A;  1YNN D;  2B29 A;  2WIN B;  4GKK Q;  1Z6H A;  1TY0 A;  2D9U A;  2B3G A;  2ZT9 C;  4A3I G;  3RZO H;  2NYZ D;  4IFD I;  2JA5 H;  2NBF A;  4JG2 A;  3UE1 A;  1A6X A;  2LS0 1;  2AWN A;  2VB2 X;  1N34 L;  1X3Q A;  4A3B G;  2O4X A;  4DV5 Q;  2N88 A;  4DXF A;  3CQZ B;  4G57 A;  2R93 G;  1TWH H;  5FKA C;  4KV6 A;  1Q12 A;  4GLA C;  1EWI A;  2ZXR A;  3M7N A;  1HNX Q;  3GTJ H;  1VQH A;  4CJ1 B;  3I91 A;  1DOM A;  2UU9 Q;  4HCS A;  3GTP H;  4OEM B;  1CKM A;  1KTK A;  2Q8T A;  1LAB A;  3PIO 3;  3FMC A;  4LF6 Q;  5IY0 A;  3VR5 A;  4FO2 A;  3T13 A;  3PO2 B;  3KOJ A;  4A3C H;  4K2L A;  2Z6K A;  3JAM i;  1SNP A;  4XYO A;  3CCR A;  4FXD A;  2KEE A;  5FLX E;  2K75 A;  1VMC A;  5BN3 A;  2ALY B;  2NVT B;  1VQK A;  1SSO A;  1OXT A;  3IKJ A;  1EYG A;  4JI7 Q;  2A8V A;  4I7Z C;  4MHE A;  3HRZ C;  1VQJ A;  1EIF A;  5C44 H;  5FO7 B;  5JEA H;  2PZU A;  2LSS A;  1A3V A;  2JA7 G;  1G2T A;  1RD9 D;  3RZD H;  4LMQ D;  1X32 A;  3PO2 G;  1HH2 P;  2SEB D;  2HCI A;  2VW9 A;  1LT4 D;  1PXU A;  1RJT A;  1STB A;  2F0V A;  3U9S A;  4IJH A;  1PH9 A;  1WTH A;  2CWA A;  3FEW X;  1SDF A;  1CA6 A;  1B1Z A;  2KHS A;  4UHV A;  2JA9 A;  5JJZ A;  4KHV A;  3ULP A;  2M00 A;  4WRD A;  4A3E H;  2BH8 A;  2ZTE A;  4A4I A;  4GOP C;  4RMF A;  1CA5 A;  4GKJ Q;  3S15 B;  3TP8 A;  2RSN A;  4F87 A;  3KJP A;  4BY1 B;  3K5L A;  4JOI C;  4DV1 L;  1Q82 C;  3HOV B;  2Q8I B;  4XDX A;  3JAM c;  5CV6 A;  3VYU A;  5C4X G;  1DD2 A;  3DWQ A;  4PG3 A;  4DAP A;  1MI2 A;  4LFA L;  2E74 C;  4A3F B;  1IL2 A;  1YHQ A;  5K5P A;  3G48 A;  1XMO L;  2Z0S A;  4YY3 L;  3GTQ H;  4YHH L;  3A8I E;  1FGB D;  1DJR D;  3DWP A;  4POG A;  2IX0 A;  3R93 A;  1B4O A;  4OO1 H;  1SN8 A;  1XMQ Q;  1U4P A;  3S17 B;  3GTM B;  1SRU A;  4DK3 C;  4O0A A;  2JP1 A;  4DV0 Q;  3CPF A;  4MTK A;  3TS2 A;  4M8A A;  3DWA A;  1JE4 A;  3CP0 A;  3PIO A;  2ZJP A;  5M5X B;  3ICE A;  1XPU A;  1VQE A;  2KHI A;  3PO3 B;  1RF2 D;  3VYR A;  4GN5 A;  4DK1 A;  1JE5 A;  4DV1 Q;  4FYD A;  4CJ2 C;  4JI2 L;  2CW0 C;  2B8G A;  3RMH A;  1EOT A;  1VCI A;  4K14 A;  1EU4 A;  3HOV G;  3GTG B;  4NKL A;  1SNC A;  3C3L A;  1UEA B;  2E75 C;  4R4T A;  1SAP A;  1S5D D;  2CWP A;  1XTD A;  2PO4 A;  1K83 H;  2KOL A;  4YY3 Q;  4YHH Q;  2MP1 A;  2XIW A;  4XIG S;  2NZ1 D;  2IHF A;  1PDQ A;  2IJ0 A;  5M5W H;  1STG A;  2SNS A;  5C0X I;  4DV4 L;  2F0S A;  5HGT A;  5C44 G;  1C48 A;  1HRJ A;  1RCV D;  2YU9 H;  4DR5 L;  1QVF A;  3OOC A;  2UUB L;  1XWE A;  3PO3 G;  4DV2 Q;  2JXM B;  3OWF A;  5CYU A;  3RR5 A;  1E2W A;  1E1O A;  5M5Y H;  3K5O A;  2KCN A;  3UDX A;  1HNW Q;  4KKT A;  1WD1 A;  3VR2 A;  5IGC A;  4YIJ A;  3T4A C;  2WKD A;  3K57 A;  1JOQ A;  2JJQ A;  2CHB D;  1VQP A;  1PYW D;  1IBK L;  1EIH A;  2P5Z X;  4IOA A;  1A2T A;  1PMR A;  1ET9 A;  4U68 A;  2L12 A;  4A3E G;  5LL6 X;  3K7A H;  2PI2 E;  4ODG A;  1BQQ T;  4GLV B;  2WP8 J;  1HPC A;  4L6T B;  5C5M A;  4DR5 Q;  1E2V A;  2K28 A;  4EQP A;  2J4X A;  1NBW A;  4X65 L;  1MIU A;  1O7Y A;  3BZD B;  1ESF A;  5IGF A;  5FJ8 H;  1J5E L;  1MJE A;  3J81 E;  3CW2 C;  3A54 A;  1V9P A;  3ULJ A;  1BUV T;  4C56 C;  3KLS X;  3VDY A;  1UUP A;  5A2Q E;  2BOS A;  3D3R A;  2R7Z H;  2AQ3 B;  4A3L H;  3HFZ B;  5IOD A;  1TVX A;  1TT2 A;  1EUJ A;  4HAE A;  5F2D A;  3MXU A;  3KLS A;  3CCM A;  1C4Q A;  1RDP D;  3K80 C;  4WJW A;  2BH2 A;  2HDL A;  3A7A B;  1II3 A;  1VQN A;  4X6A H;  2ZXO A;  1HFG A;  2K6A A;  2H4O A;  4LUO A;  4PMW A;  4PZ7 A;  2NTS A;  4C3J H;  1S72 A;  3S14 B;  4K5W A;  1M1K C;  3ND8 A;  4ABN A;  1S3O A;  2K05 A;  4DV7 Q;  1DCZ A;  5ELE A;  1PH1 A;  1XNQ Q;  1X65 A;  4BBR G;  2XSC A;  4IFD H;  4HSV A;  1KAB A;  1XNR Q;  4IUV A;  2YYZ A;  1GUS A;  1Y1V G;  3M4Q A;  3NWT A;  4KJO A;  2XVS A;  2E2I B;  4LNQ A;  1EYC A;  4JI4 Q;  1IKM A;  1PYS B;  1QVC A;  2EYF A;  2VQF Q;  2F52 A;  4HSP A;  4FF1 A;  3L3O C;  3E0J A;  2F4V L;  2FXQ A;  1RTO A;  2IL8 A;  2QDB A;  4HIK A;  3I2Z A;  4JBM A;  3A7L A;  4UP9 A;  3HOZ B;  3PF5 A;  1LTT D;  1PTO C;  1WJJ A;  1BBU A;  1HZB A;  1LLR D;  4I7A A;  4LFC Q;  4MN3 A;  2XN9 C;  5FOB B;  1MJC A;  2O5I C;  1O80 A;  2NVY H;  1GM5 A;  3I4N G;  1Y69 U;  1EU3 A;  3MFG A;  5E4X A;  1AZQ A;  2MJ8 A;  1TWC B;  1X3E A;  1KXL A;  3OTO L;  1SBB B;  2J7Z A;  2DJF C;  1RKN A;  1PTO D;  3C1E A;  3H0G B;  1SYD A;  2EYJ A;  3ZJY C;  2AUJ D;  2Z4H A;  4A3J G;  4P72 A;  2V4D A;  1FNW A;  3C46 A;  1STE A;  4PQX A;  4OL7 A;  4JYA Q;  3OW7 A;  1CFM A;  3E5S A;  5EQ0 A;  4R8N A;  2R7Z G;  5CMD A;  4MTN A;  2NVX H;  3GDE A;  5EPK A;  1AN8 A;  2JA6 B;  4B08 A;  5G3L F;  3NEL A;  1N36 Q;  4UY8 C;  5EPJ A;  2SNM A;  3MVV A;  4AYB E;  4XYQ A;  4L5T A;  2UXC Q;  1PRT F;  3CXC A;  3NTK A;  3T1H L;  2NB0 A;  4DUZ L;  2HCC A;  1HA5 A;  4YWK A;  4C3I H;  1D6E C;  3STB C;  4JI5 L;  3T1Y L;  5E4W C;  5KIX A;  3J81 j;  3H0G G;  4A93 B;  4IFD G;  3A55 A;  3O13 A;  3I73 A;  3CCV A;  4K0K L;  1FGU A;  4WOR A;  1XTC D;  3T16 A;  4L5R C;  1MGS A;  2WII B;  1SMX A;  3HOU B;  1TR5 A;  1V1P B;  2B2T A;  2WKC A;  2A73 B;  5D3I B;  5IT9 L;  3GTK H;  4KD4 A;  5FK9 C;  3VYT A;  5JVG 3;  3AYH B;  4N8F A;  4LF4 L;  3U9O A;  3SK4 A;  1B3Q A;  3STB D;  2A69 C;  4B3M L;  5JAV A;  5ISR A;  1KDB A;  2NN6 G;  3T1H Q;  1SEB D;  3W3A A;  1SFO H;  3IAY A;  4JI3 L;  2L11 A;  1H9S A;  4LFB L;  1GOZ A;  2K33 A;  4F8M A;  3V96 A;  3S2D H;  2L55 A;  3X3M A;  4ZLT F;  2I5L X;  3D0F A;  5GQO A;  3J80 E;  4Q5V A;  3MAQ A;  2WAQ G;  1G6P A;  2VQE L;  1Q8K A;  4A3M G;  1MHW C;  4BXX H;  1MSH A;  2F0U A;  3C2P A;  4A3G G;  1I4R A;  2RDF A;  1X9N A;  5IYB H;  1G91 A;  4EQN A;  5IIF A;  1JWS D;  4LF5 L;  2ASB A;  2A69 D;  4J6H A;  2HQE A;  3HOU G;  2UXB L;  5CV7 A;  2EE1 A;  4LF8 L;  3S1N H;  2EJF C;  5E1F A;  4GNX B;  4DK0 A;  4JI8 Q;  1JR0 D;  3RD4 A;  2WAC A;  1JIC A;  3ERS X;  4IFD J;  3K6O A;  4JI3 Q;  2UUC L;  3TEH B;  3PUY A;  1KC8 C;  3RUZ A;  5GAD C;  5C0X H;  1LTS D;  2A6E C;  1TS3 A;  1Y8O B;  2EPB A;  3MHB A;  4PMC A;  2E2H H;  1RHP A;  1PH7 A;  5M3M B;  1Y1W B;  4H7B A;  1C8C A;  1W6K A;  1ZYR C;  1EYA A;  1ROD A;  2EJM A;  2F0L A;  2VQE Q;  4DFA A;  3M4Y A;  4L63 B;  2DJG C;  3PUV A;  2KCC A;  3ZYY X;  1T5E A;  2OCE A;  4KHP L;  2R92 B;  3AFQ A;  3LNN A;  4IPC A;  4LUV A;  2R6G A;  1I50 H;  1L0X B;  2A6H C;  2IWH A;  1I94 Q;  3SK5 A;  5IYC G;  2A6E D;  3UI2 A;  2EY5 A;  4FXK C;  4OON A;  1LTG D;  5IP7 H;  2EYH A;  2F0J A;  1ZYR D;  5FLX c;  2K52 A;  3PV0 A;  4JI1 L;  5CV8 A;  2B63 B;  3V2T A;  2L5T A;  4R1J A;  1F2Y A;  2KED A;  3EBE A;  2EXZ A;  4G7O C;  2CH4 A;  5NUC A;  1GUN A;  1KIX A;  2PPB C;  4ZRZ A;  3EJI A;  2A6H D;  3NBH B;  3S1Q B;  4J1M A;  3MZ5 A;  2PZW A;  5IYD G;  3CF5 A;  1UE1 A;  1OXX K;  3MA2 B;  4A3K B;  2YTV A;  3IRB A;  4EGV A;  2ICI A;  4A3D H;  4X3S A;  2CCZ A;  2ZTD A;  3CC4 A;  2NVQ H;  1EEF D;  1F9Q A;  3KYH C;  2F0E A;  4L8J A;  1WTO A;  2EXD A;  4LWC A;  3SEB A;  3BYY B;  1I3Q H;  1JC7 A;  3HOY G;  2B63 G;  3KF8 A;  3BVG A;  3CMA A;  2A1A A;  3ONA B;  4BXX G;  3OW2 A;  1A8V A;  2AMC B;  2VL6 A;  3L7Z C;  1R9T B;  5M3F H;  1SNQ A;  2E5L L;  1B3A A;  4QF4 A;  4DV3 Q;  1HNZ Q;  4QJF A;  5HUR A;  3X3N A;  3HS0 C;  3G4S A;  1EEI D;  1IBL L;  2F0H A;  5CV9 A;  4RFB A;  1VQM A;  1X6O A;  4O1N A;  3AEV A;  1QNU A;  2BE5 C;  2Z4I A;  2F0F A;  4AH6 A;  4A3I B;  5KYI A;  3IL8 A;  3CKI B;  5D3D A;  4ALP A;  2K50 A;  4HJA A;  2RCF A;  2AQ2 B;  1HXY D;  3GV6 A;  1YIJ A;  1QG7 A;  1JB3 A;  4DR3 Q;  1UE5 A;  1PH8 A;  1STH A;  2R93 B;  4DUY Q;  3TP5 A;  4ME3 A;  4DV5 L;  1FJG Q;  3A8J E;  3FPP A;  1U4L A;  1PZI D;  3PUZ A;  2ZJR A;  1C9O A;  2MO0 A;  3SE0 A;  1QUQ A;  4C3H H;  5D14 A;  1HNX L;  4GZY C;  4XQJ A;  2FJ2 A;  2UU9 L;  1K0S A;  4RKL A;  1E24 A;  2RHS B;  1SYE A;  3HKZ G;  2VUM B;  1CTM A;  1YI2 A;  3TZD A;  4NXM Q;  1SYF A;  2CVR A;  4RHR A;  4JI6 L;  1BCP D;  1U9R A;  4LF6 L;  1XX8 A;  5L37 A;  2XWJ B;  4IUP A;  1U0L A;  3OYY A;  4DXG A;  2KVM A;  5FO8 B;  2NVT H;  3QR8 A;  4ZKC B;  1D8L A;  3FPU B;  4K6D A;  2B2W A;  4QIW E;  2DN8 A;  5C0X J;  3M3Y H;  4AYB G;  1DON A;  1QOH A;  1WTP A;  2EQS A;  2CFM A;  3KLW A;  4JI7 L;  3SK8 A;  1ET6 A;  4BA2 I;  5C3X A;  2RSO A;  4IJL A;  5E3F A;  2JN4 A;  5FLX L;  3KF6 A;  3NK9 A;  4RA8 A;  4UAI A;  5C4J B;  4JI6 Q;  2PQE A;  3BZK A;  1Z7T A;  2QIL A;  1QNK A;  2VUM G;  3CCS A;  3AFP A;  3NSW A;  3HG9 A;  2N78 A;  4P2C B;  3DMU A;  5CBA E;  1YIT A;  3QB3 A;  2JA7 B;  3PCO B;  4P71 A;  4B9X A;  1IYJ B;  1EY0 A;  1D5M C;  4HMI A;  4DR2 L;  4LF9 L;  1S5B D;  3T51 B;  1XXG A;  1GO3 E;  1MD2 D;  2L4N A;  2KCT A;  3F2U A;  3JC6 6;  3H6M A;  2KUM A;  4X64 L;  1TWA H;  2E76 C;  4DF7 A;  4BWG B;  1U4M A;  3PIP 3;  2WB1 E;  1NJI C;  1G2S A;  3NQT A;  2LXK A;  3K0Y A;  1PYB A;  3J81 c;  2A74 C;  1SNO A;  4TKO B;  2JA5 B;  1BKB A;  1IW7 C;  2E2D C;  2QCP X;  4APV A;  2NWG A;  4GKJ L;  3FP9 A;  1QB5 D;  3G6E A;  4JBW A;  1FVI A;  1JOK A;  2E2J H;  3GTL H;  2OT2 A;  4A3F H;  3H91 A;  4DR2 Q;  1RTN A;  4LF9 Q;  1TWH B;  3FKI H;  4RGT A;  3S16 H;  5C4X B;  1H9K A;  1ML0 D;  4KN4 C;  4DAY A;  1KDC A;  1Q90 A;  3NWS A;  5ELC A;  3GTJ B;  1G29 1;  4NB3 A;  3D4R A;  4X64 Q;  1KDA A;  3TRE A;  3GTM H;  4FNF A;  3H3V I;  3GTO B;  5BR8 Q;  1AZP A;  2SOB A;  2K5H A;  3GTP B;  1IW7 D;  5M5X H;  1XMQ L;  2F0G A;  2K7V A;  5KRU A;  4DV0 L;  1XYI A;  2N55 A;  2JA5 G;  4XQN A;  1ENA A;  1BBW A;  1J8I A;  3U4V A;  5DLQ E;  3GTG H;  2PW5 A;  1EIG A;  4JW0 A;  3ERO A;  3I8Z A;  1VQD A;  2KQ3 A;  5I9O A;  3VA5 A;  1EQT A;  3C1F A;  2Z8L A;  3KDF B;  4FF3 A;  1G8Z D;  2PNR C;  3TP7 A;  4S3S A;  4G7H C;  3HKS A;  2RVL A;  4TVA B;  2A68 C;  4X3K A;  1I4G A;  4K5X A;  1K0R A;  1G51 A;  5C44 B;  3CCE A;  1KLU D;  3HOW H;  1UAP A;  4CDC C;  4QGU A;  2DNE A;  1M8A A;  3MXP A;  1PHJ A;  4QQB X;  1E0B A;  1XPR A;  1IKL A;  3RZD B;  5IP9 H;  4A3C G;  2NTT A;  1VDZ A;  1S4Z A;  4DV2 L;  1MSG A;  1Z9F A;  1PH5 A;  4ZKB B;  2UXD Q;  2EIF A;  1HNW L;  3HZX A;  3OHX C;  2H5X A;  2WAQ E;  3Q24 A;  1NMG A;  1WCM H;  2KCM A;  4M1U B;  4DNT B;  5JJI A;  1AE3 A;  1HJP A;  4V19 0;  4RWS C;  1OXU A;  2RQX A;  1VQL A;  3J80 i;  2B2T C;  4A3E B;  2Z6B A;  2KA7 A;  3L2P A;  3PIP A;  1MKH A;  3NE5 B;  3H3V C;  4IZ8 A;  4FF2 A;  4JI0 Q;  4BBS H;  2F1M A;  3CME A;  5JEA G;  4X62 Q;  3DM3 A;  4HN7 A;  3PUW A;  4PNY A;  4BY7 H;  2B2U C;  2CW0 D;  1HCZ A;  1I4Q A;  1JWU D;  1C0A A;  4OHJ A;  1H95 A;  1T9H A;  3VYS A;  4OIK A;  3K5N A;  3FKI G;  5ELO A;  3B6Y A;  1ZKO A;  1Q86 C;  3I3C A;  4UPA A;  3OMG A;  1CM9 A;  2EDG A;  3I70 A;  3PMF A;  4EQ5 A;  2OTJ A;  1NR4 A;  2AUK A;  1QZH A;  1KAA A;  4G7Z C;  2HHH L;  4HJ5 A;  2K5W A;  1NR2 A;  3W2D A;  2N3S A;  2K5Q A;  3FRP B;  3Q23 A;  1DYQ A;  4FXG C;  4IPG A;  1L0Y B;  1L1O C;  5ELB A;  2M9V A;  4XT3 B;  5LMN Q;  3CRL C;  5D65 A;  3F2D A;  2N8N A;  2VY3 A;  2EY6 A;  4ME5 A;  4A76 A;  1EY6 A;  2ENB A;  3EA6 A;  1PRT C;  4DV7 L;  5EGT A;  3J7A 5;  1WI5 A;  1BCP B;  2LY7 A;  4BBR B;  4EVO A;  4UP8 A;  2IHE A;  2FIN B;  4QIW B;  4ZCK A;  4WFN 3;  4RH6 A;  1XNQ L;  1K83 B;  2JA8 H;  1HTP A;  3I4L A;  3P1H A;  1XNR L;  1Y1V B;  1JQY D;  5M5W B;  2HHH Q;  5JEA J;  2FMM A;  5C3E H;  4OO1 G;  3I4O A;  5I2Y A;  4JI4 L;  1ILQ A;  3J80 c;  5I9P A;  5G3L D;  1HZ9 A;  3H94 A;  4MZ9 A;  3A5Z B;  2F0I A;  2YU9 B;  2VQF L;  1PRT D;  2KEC A;  1CZW A;  2EOT A;  2K01 A;  1VQ4 A;  2R61 A;  3HOZ H;  5K36 H;  2HIX A;  3M4O H;  1B9M A;  3OIQ A;  4H02 A;  1M90 C;  3HOX H;  2ZM6 L;  3JAM L;  4XT1 B;  1NE3 A;  1SMY C;  2TSS A;  2DNC A;  4LFC L;  2B2Y C;  1AW7 A;  4QY7 A;  2WB1 B;  3I4N B;  4JBK A;  1EOV A;  1TWC H;  1EY7 A;  2A5H A;  2JEA I;  3K58 A;  1X56 A;  3D31 A;  3NXW A;  2F0O A;  2LKV A;  4BY7 G;  1CT1 D;  1SE4 A;  3CCU A;  3LGJ A;  1WVL A;  4A3J B;  1LTA D;  1JCK B;  1PFB A;  1SMY D;  1ENF A;  2ZM6 Q;  3MXG A;  3DEP A;  4JYA L;  5E7N A;  5GAH C;  2R7Z B;  1K8A C;  2F03 A;  4OWX B;  1EYD A;  2BCO A;  1DM0 B;  2JA6 H;  3CAM A;  1FNU A;  1I6H B;  4HIO A;  1EFI D;  2WB1 G;  2XTI A;  2KHJ A;  3TSS A;  1D2B A;  3ITP A;  3S24 A;  4IN3 A;  3D6C A;  1P8L A;  1N36 L;  1OTC A;  4C3J B;  2MQH A;  2D62 A;  3DHQ A;  3ERQ A;  4OX9 Q;  2UXC L;  1MBY A;  4O2D A;  4EQO A;  4XTC S;  4A93 H;  3EIV A;  5JJK A;  3J7A F;  3KBG A;  5H1S E;  2PQA A;  3BYT B;  1HHV A;  4ZAI A;  4JV5 Q;  5FJ8 G;  3CCL A;  3NQI A;  2DGY A;  2IPK D;  3HKZ E;  3WWV A;  3KLR A;  1E2Z A;  1FYC A;  4IUU A;  4R4O A;  2JA8 G;  2OF1 A;  4Q0F A;  3MTS A;  2A19 A;  4A3L G;  1D5Z C;  3MXN A;  4V0B A;  5C3E G;  1B53 A;  3RN5 A;  1PH4 A;  3EN2 A;  4E6I A;  5GRO A;  4IUN A;  1JJ2 A;  5IWA Q;  4B3T Q;  1TKW B;  2ZJQ A;  2F3I A;  1CK1 A;  3H3V H;  4YWL A;  4C3J G;  4GOP B;  1TII D;  1OXV A;  2EZV A;  1EWH A;  2QF7 A;  5KGU A;  2XGT A;  1QZG A;  2AWO A;  2BA0 A;  2FHT A;  3NUC A;  2WAQ B;  1PH2 A;  4KY7 A;  4A3M B;  4A3G B;  2EY1 A;  5JJL A;  3KJO A;  2NVY B;  1GUO A;  1F2Z A;  1KL9 A;  2Q2U A;  5J3B A;  1QJO A;  2QKI C;  4QB4 A;  3AMU A;  4DR4 L;  2F0Q A;  3QIA A;  4NMZ A;  2B2W C;  5COR A;  3F1Z A;  2RDG A;  1VQG A;  4JI8 L;  1IZ6 A;  5IGD A;  1D1K A;  2ZXP A;  2B2U A;  4RGO S;  4POF A;  4YCV A;  1TWF H;  1T5X D;  1XJV A;  4DV6 Q;  2C9O A;  1Y1W H;  2UUA L;  2B2V C;  4PZ8 A;  2QEJ C;  2L0C A;  2PI2 A;  3MC0 B;  2D0P A;  3PGZ A;  2ES2 A;  4JVZ A;  2R3Z A;  1B7Y B;  1LM0 A;  3IFT A;  2K4K A;  4K2K A;  4MNO A;  2R92 H;  3F8T A;  4KMU C;  3EFX D;  2V1C C;  5GAE C;  1W2B A;  1HQM C;  4H0L C;  1KQS A;  4DR4 Q;  3K0X A;  5ELN A;  4RCO A;  3QJY A;  3ULL A;  1L1O A;  3MEF A;  1EQV A;  5EJW A;  4KN7 C;  2AHO B;  5IGG A;  3P75 A;  5IT9 E;  1I94 L;  4C3I B;  1Q8I A;  1LYL A;  2KEN A;  2AQ1 B;  3MEH A;  2UUA Q;  1SYB A;  1ESR A;  1CI3 M;  3UE0 A;  4KD3 A;  2TMP A;  2C35 B;  1I6V C;  3NEM A;  1VQ8 A;  2QEX A;  1O7I A;  5LMN W;  1Q1B A;  3S1Q H;  4FDB A;  2Z9H A;  2VXW A;  3E6Z X;  1DOK A;  2EJG C;  2G5D A;  1SJH D;  4A3K H;  3GD7 A;  4RHS A;  4U67 3;  1CUK A;  2ATW A;  3GTK B;  3E9H A;  3A0J A;  5TSS A;  1PTO F;  3BVZ A;  1V1O A;  2SDF A;  4B9W A;  4OGQ C;  3RLF A;  4C3I G;  1TS5 A;  1W6J A;  5AJ3 Q;  1YNX A;  1SND A;  1TWG H;  1IXR A;  4XXE A;  1HQR D;  4DAV A;  4LUZ A;  2MGS A;  3HOY B;  4ID6 A;  4YCW A;  3BU2 A;  4H13 C;  1IHZ A;  1R9T H;  3KUP A;  4GS3 A;  1DGS A;  4ZUI A;  1BNZ A;  4UP7 A;  3E0E A;  2B2Y A;  1UEB A;  5FLM H;  1K28 A;  5C6A A;  3FHW A;  3DEO A;  3S1M B;  2CQO A;  3U4Z A;  4LK1 C;  1SYG A;  4KKU A;  4JK1 C;  4DV3 L;  1SJE D;  1HNZ L;  1YJN A;  4L5Q A;  1B9N A;  1UE7 A;  1BVS A;  2RDH A;  3FDT A;  4KKS A;  4C2M H;  4FF4 A;  3D4D A;  1VQA A;  4A3I H;  2PW7 A;  5JOB A;  3PSI A;  2E2H B;  1ASZ A;  1PH3 A;  1EL0 A;  4ZK9 B;  3D8G A;  3K5M A;  4JCV E;  1Q7Y C;  2R7D A;  5M9O A;  1J6Q A;  4L5S A;  4A3B H;  2B39 A;  3BG3 A;  3I4M H;  3DM1 A;  2R93 H;  3L0O A;  1N8R C;  5IYB G;  3VR6 A;  2J0T D;  3LWU A;  3NP8 A;  3A74 A;  1I50 B;  1WTV A;  4Y7N H;  4DR3 L;  1GUW A;  4X66 Q;  3TME A;  4DUY L;  5KNC A;  5CC4 A;  5CGK A;  1FJG L;  4Y52 H;  1KLG D;  1B2T A;  4IO9 A;  2PZT A;  1CKN B;  2JEB I;  2B8F A;  1AH9 A;  3CHB D;  4X3T A;  4RGM A;  5I6Y A;  1HR0 Q;  5C0X G;  1SR3 A;  1I4X A;  2RF4 A;  3HKZ B;  4IPD A;  2DUD A;  1B8A A;  5CV4 A;  4NXM L;  1E7Z A;  5GAG C;  2VNU D;  1E1T A;  5LHY 1;  1GKH A;  3M9B A;  3BDO A;  5LL6 S;  1PTO B;  1YHB A;  5JPM C;  3S2H B;  1SE8 A;  4F7X A;  3CQZ H;  1K3B C;  1H9M A;  1JWM D;  1TS4 A;  1STA A;  3CC7 A;  4AYB B;  2X69 A;  5KYL A;  2L1B A;  2BE5 D;  2NVQ B;  1G6Z A;  1K9M C;  3BZC A;  5C4J H;  5IP7 G;  3A8K E;  3J81 i;  1YHA A;  5FO9 B;  2EYM A;  2Q2I A;  4C1N I;  3CD6 A;  4NDX A;  2LFN A;  5DM7 3;  1S5F D;  4OWT B;  4OXP A;  4DR1 Q;  1EQQ A;  1ASY A;  3PO2 H;  1UNS A;  1VF7 A;  2QDL A;  3SDZ A;  3H15 A;  3CCQ A;  4DR7 L;  4NXN Q;  1PZJ D;  2ID0 A;  4HED A;  5T1I A;  3PF4 A;  1KD1 C;  5BN5 A;  4CBV A;  1N33 Q;  1VMP A;  5KEE A;  2QW7 A;  1BF4 A;  2K04 A;  4CDE C;  4OEL B;  4A3D G;  1GUG A;  3S1R B;  2AKW B;  3BDL A;  3SGI A;  2I0Q A;  1QUQ B;  2PYK A;  2BDO A;  3TRZ A;  3KBX A;  2B2V A;  1EY9 A;  4Z9C B;  1IBM Q;  4OWW B;  1GXD C;  1FL0 A;  4R4I A;  3I4M G;  4DR7 Q;  5C4X H;  3AQQ A;  5IGB A;  2VB3 X;  1LTR D;  5M3F G;  1DOL A;  2NN6 I;  4LF7 L;  1ZEQ X;  4MIU A;  3GTO H;  2DY8 A;  1A3T A;  1U5K A;  4C3H B;  4CGY B;  1ONL A;  3SHL A;  5EBC A;  1Q46 A;  4RG1 A;  4HIM A;  3V05 A;  2O2L D;  5BR8 L;  2QA4 A;  1A63 A;  5JPN C;  3L9A X;  1LTI D;  3S15 H;  5KNB A;  1N34 Q;  3RZO B;  3W5O A;  3OPO A;  5J1Z A;  4BY1 H;  3KF6 B;  3HOV H;  1GHJ A;  3P7J A;  2MFI A;  4WJ4 A;  5CV5 A;  2KJX A;  1YZ6 A;  1H9R A;  4CKC A;  1PFM A;  2OWO A;  4LF7 Q;  2EYL A;  1Y8P B;  3DLL A;  3M3Y B;  4OIJ A;  3SK6 A;  4HCE A;  4C3H G;  2Q2T A;  1OXS C;  3S17 H;  3SVM A;  3SR1 A;  1VQI A;  1K8O A;  4QL5 A;  1K8M A;  1YJW A;  3I55 A;  1TXY A;  4HR7 B;  1GHK A;  3PO3 H;  2I46 A;  1EFW A;  1YNJ C;  1YBY A;  3BS1 A;  3KDF A;  5LMU L;  4JC0 A;  4R8I A;  2KBN A;  1K73 C;  1EY8 A;  4DU9 A;  5KND A;  3F2B A;  1KHI A;  1Y14 B;  5C4H A;  4IUR A;  2F3W A;  1A62 A;  3TS0 A;  2Q8R E;  1LUZ A;  4GN4 B;  4KLK A;  4WJ3 M;  2UXD L;  2EY2 A;  2WFW A;  4DAY B;  1TWA B;  2XRQ D;  2MO1 A;  4CJ0 B;  2BDN A;  4YWM A;  1WTW A;  1AEX A;  2JQO A;  1BCP F;  1PZK D;  2K5V A;  1J9O A;  5J39 A;  1GJX A;  1YNJ D;  3CCJ A;  1NMF A;  1P16 A;  2VZA A;  5J22 A;  1EZ8 A;  2I07 B;  5LMU Q;  4I65 A;  5IE8 A;  4JI0 L;  1WYD A;  4LAA A;  5CR3 A;  3TDQ A;  5AFW A;  4X62 L;  1TU2 B;  2E2J B;  4K6L A;  3GTL B;  2QGQ A;  2CQA A;  2DY7 A;  1S40 A;  3FKI B;  3S16 B;  1VS0 A;  3UDF A;  1KNA A;  4JBJ A;  1KAW A;  2RHQ B;  5I2X A;  2A68 D;  1N9W A;  2X6L A;  3AB9 A;  3WDN A;  3DXJ C;  1KRT A;  3KFU A;  1B70 B;  3TQY A;  4QUF A;  3Q22 A;  3DUZ A;  4QUC A;  2XWB B;  5C3W A;  5EKI A;  1LT5 D;  4KY6 A;  1EZ6 A;  3AU7 A;  1JB7 A;  4BY1 G;  4DNI A;  5LMN L;  2F0P A;  1FR3 A;  3I72 A;  4BBR H;  3BVM A;  4LFA Q;  4N9P A;  2XNA C;  1XMO Q;  1HR0 W;  4CDD C;  4A3F G;  1YJ9 A;  1Y1V H;  5EPL A;  3ND9 A;  1LTB D;  1JT8 A;  1CSP A;  1ENC A;  1SLJ A;  3QG1 A;  1D5X C;  4GNX C;  1N32 L;  1JOR A;  1HUN A;  3GTQ B;  3A5U A;  1OO9 B;  1SRO A;  1RL2 A;  2F0M A;  4NW2 A;  1R4Q B;  3HOW B;  4CHT B;  2OTL A;  3S14 H;  2JYO A;  1BXT A;  5IGE A;  1AE2 A;  4JI2 Q;  3J81 L;  3WOF A;  4K5V A;  3CPW A;  1SYC A;  5A2Q L;  3OMC A;  1R4P B;  1STN A;  2D0O A;  3VR3 A;  4EX5 A;  1NTG A;  5ELD A;  2PNH A;  3HGB A;  1NNX A;  3RLN A;  4O42 A;  4DK6 C;  1WCM B;  1IL8 A;  4IQZ A;  3K59 A;  3I4N H;  2E2I H;  1N32 Q;  1VF5 C;  4DV4 Q;  4J15 A;  5COY A;  1QCB D;  1X55 A;  4RGN A;  4F88 A;  1F2L A;  4X3U A;  4R4C A;  4DNR B;  1QE6 A;  1NCV A;  3U58 A;  1UWV A;  1BO0 A;  3D4W A;  3NBI A;  3VA7 A;  4BBS B;  3HP3 A;  2UUB Q;  2JSO A;  3CC2 A;  3HOW G;  1Z47 A;  1EY5 A;  4BY7 B;  1YVC A;  5I6W A;  5CBE E;  3LX0 A;  1EIY B;  4A3J H;  1V8Q A;  2IT1 A;  1VQ7 A;  1WOC A;  3T53 B;  2K1B A;  1GVP A;  4K8J A;  5IP9 G;  1NAP A;  1F77 A;  2HD3 A;  5M5Y B;  3EQL C;  2RBM A;  2Y0S E;  1NY4 A;  4P73 A;  2HQL A;  1IBK Q;  5T1G A;  2D2C C;  5IT9 c;  2F0T A;  1I6H H;  1B50 A;  1VQ9 A;  2X6G A; 
#chains in the Genus database with same CATH homology
 1LTL A;  1WCM G;  4A3E H;  2BH8 A;  4ALP A;  2ZTE A;  1B7Y B;  1LM0 A;  2K50 A;  4LW1 A;  3K81 C;  4A4I A;  4HJA A;  4GOP C;  2K4K A;  3ER0 A;  4MNO A;  4RMF A;  2R92 H;  3F8T A;  2V1C C;  4GKJ Q;  5GAE C;  1W2B A;  1V1Q A;  1YIJ A;  1KQS A;  4DAM A;  3KJP A;  3K0X A;  4X65 Q;  4DR4 Q;  5ELN A;  4DR3 Q;  1UE5 A;  4JOI C;  4BBS G;  4DV1 L;  1Q82 C;  1PH8 A;  3ULL A;  4DUY Q;  4ME3 A;  4DV5 L;  1FJG Q;  1L1O A;  1J5E Q;  3MEF A;  3JAM c;  2AHO B;  1I94 L;  3H0G H;  3PUZ A;  5C4X G;  2L15 A;  4PG3 A;  2ZJR A;  4LFA L;  1C9O A;  1LYL A;  2MO0 A;  4OX9 L;  4DKA C;  1IL2 A;  1QUQ A;  1YHQ A;  4C3H H;  2KEN A;  3G48 A;  1E3P A;  1XMO L;  1HNX L;  2Z0S A;  4YY3 L;  1Q1E A;  3UE0 A;  2UUA Q;  3GTQ H;  2I5H A;  4YHH L;  4JV5 L;  2IY5 B;  2UU9 L;  4POG A;  2IX0 A;  2C35 B;  1E24 A;  1SN8 A;  2RHS B;  1XMQ Q;  3HKZ G;  3NEM A;  2IX1 A;  1SRU A;  1YI2 A;  4DK3 C;  4NXM Q;  4O0A A;  1VQ8 A;  4JI6 L;  4DPG A;  1O7I A;  2QEX A;  5LMN W;  1Q1B A;  4DV0 Q;  3CPF A;  3TS2 A;  3S1Q H;  4FDB A;  2LXJ A;  4AIM A;  4LF6 L;  3BJU A;  3CP0 A;  3PIO A;  2ZJP A;  3ICE A;  1XPU A;  1VQE A;  2KHI A;  1U0L A;  3GD7 A;  4A3K H;  3OYY A;  1CUK A;  2ATW A;  4GN5 A;  1CKO A;  1JE5 A;  3E9H A;  4DV1 Q;  2NVT H;  3A0J A;  4JI2 L;  1D8L A;  5IWA L;  1YEZ A;  4B3T L;  1VCI A;  2BA1 A;  4QIW E;  3HOV G;  5C0X J;  4R4T A;  1VQ5 A;  3M3Y H;  4AYB G;  2CWP A;  1XTD A;  2GN5 A;  1K83 H;  3RLF A;  2YTY A;  5AJ3 Q;  1JJG A;  2EQS A;  2CFM A;  1RIP A;  3KLW A;  1YNX A;  4YY3 Q;  4YHH Q;  4A3M H;  4JI7 L;  4XIG S;  4A3G H;  1TWG H;  2IHF A;  1IXR A;  4BA2 I;  2GVB A;  4TQU S;  1L2F A;  4LUZ A;  5M5W H;  4IJL A;  4YCW A;  4B3S L;  3PUX A;  3BU2 A;  5C0X I;  3KF6 A;  3HOU H;  4DV4 L;  3Q8D A;  4JI6 Q;  3BZK A;  5C44 G;  4AH6 A;  2VUM G;  1R9T H;  3CCS A;  3AFP A;  4GS3 A;  2N78 A;  4GOP A;  1DGS A;  5EAY A;  2F4V Q;  1YIT A;  2YU9 H;  2PMZ E;  4DR5 L;  4UP7 A;  3E0E A;  5FLM H;  1UEB A;  3PCO B;  3FHW A;  4P71 A;  1QVF A;  4P75 A;  1IYJ B;  2UUB L;  3PO3 G;  4DV2 Q;  1A0I A;  2CQO A;  3RR5 A;  3U4Z A;  4JOI A;  4DR2 L;  4LF9 L;  1E1O A;  4DV3 L;  1HNZ L;  4YCU A;  5M5Y H;  1YJN A;  2YTX A;  4L5Q A;  3UDX A;  1HNW Q;  1UE7 A;  3W1B A;  1BVS A;  4C2M H;  1GO3 E;  1I5F A;  2KCT A;  2JJQ A;  3JC6 6;  4B3R L;  1VQA A;  3HOZ G;  4A3I H;  1HZA A;  1VQP A;  4X64 L;  5K36 G;  1TWA H;  2VS1 A;  4DV6 L;  4GLX A;  3PSI A;  1ASZ A;  1VQB A;  1IBK L;  2WB1 E;  1PH3 A;  4IOA A;  2PQA B;  1NJI C;  3HOX G;  4JCV E;  4B3S Q;  2LXK A;  1Q7Y C;  1PYB A;  3J81 c;  2R7D A;  4A3E G;  1J6Q A;  4L5S A;  3K7A H;  4A3B H;  2PI2 E;  1BKB A;  3I4M H;  4GLV B;  4APV A;  2WP8 J;  2R93 H;  1KRS A;  3L0O A;  4DR5 Q;  1N8R C;  3FP9 A;  3G6E A;  5IYB G;  4JBW A;  1FVI A;  1JMC A;  3OTO Q;  5IYC H;  3A74 A;  1NBW A;  3MXN B;  2E2J H;  4X65 L;  3GTL H;  1MIU A;  4Y7N H;  4DR3 L;  1PA6 A;  1GD7 A;  4A3F H;  4X66 Q;  4DR2 Q;  2GVA A;  4LF9 Q;  4DUY L;  3FKI H;  2HT1 A;  3S16 H;  5FJ8 H;  1FJG L;  4Y52 H;  1J5E L;  1MJE A;  4IO9 A;  3K8A A;  1W3S A;  3CW2 C;  3J7Z C;  1V9P A;  3ULJ A;  1G29 1;  1CKN B;  2JEB I;  4NB3 A;  3RN2 A;  3VDY A;  4B3R Q;  5HY6 A;  4X64 Q;  1AH9 A;  3TRE A;  5M3M H;  3GTM H;  3H3V I;  5HGQ A;  5BR8 Q;  2I5M X;  4HJ9 A;  1HR0 Q;  2R7Z H;  4A3L H;  3HFZ B;  5C0X G;  4KI0 A;  1SR3 A;  2K5H A;  1EUJ A;  2RF4 A;  4IPD A;  2DUD A;  3CCM A;  2BH2 A;  3K80 C;  5M5X H;  1XMQ L;  1B8A A;  4IOC A;  1VQN A;  4X6A H;  4NXM L;  1E7Z A;  5GAG C;  4GNX A;  2VNU D;  2JK8 A;  1E1T A;  4DV0 L;  1GKH A;  3M9B A;  2JA5 G;  2JA6 G;  5IYD H;  4LUO A;  4PMW A;  1YHB A;  3GO5 A;  1BBW A;  4PZ7 A;  3RNU A;  3U4V A;  3I7F A;  1SE8 A;  4C3J H;  1S72 A;  2ZTC A;  2R7F A;  5DLQ E;  3CQZ H;  4DUZ Q;  3GTG H;  1M1K C;  1Q81 C;  1S3O A;  1PFS A;  1VQD A;  4DV7 Q;  4JI5 Q;  3T1Y Q;  3KDF B;  3CC7 A;  1PH1 A;  3F2C A;  3M85 A;  1XNQ Q;  1X65 A;  4BBR G;  4A93 G;  1EQR A;  4K0K Q;  3HOY H;  1K9M C;  1L0W A;  2B63 H;  3I56 A;  1XNR Q;  3HKS A;  4P74 A;  3BZC A;  5C4J H;  2YYZ A;  4TVA B;  5IP7 G;  3E9I A;  5AJ3 L;  1K8G A;  3J81 i;  1YHA A;  3UDG A;  1Y1V G;  3M4Q A;  1XPO A;  1PVO A;  1K0R A;  1G51 A;  2NZH A;  4LNQ A;  2Q2I A;  3CD6 A;  4JI4 Q;  3CCE A;  2Z6K C;  4HJ7 A;  3HOW H;  1CSQ A;  4OWT B;  4OXP A;  1PYS B;  4DR1 Q;  1EQQ A;  1ASY A;  1QVC A;  3PO2 H;  4LF4 Q;  4QGU A;  1QVG A;  1V43 A;  2VQF Q;  1X3F A;  3S1M H;  2F52 A;  3H15 A;  2F4V L;  1PHJ A;  3CCQ A;  4B3M Q;  2FXQ A;  4DR7 L;  4QQB X;  4NXN Q;  1XPR A;  2NZO A;  2ID0 A;  5IP9 H;  1WFQ A;  4A3C G;  1X3G A;  1VQ6 A;  4DV2 L;  3PF4 A;  1KD1 C;  4HIK A;  3I2Z A;  1HZC A;  4LFB Q;  1N33 Q;  1Z9F A;  4JBM A;  1PH5 A;  2UXD Q;  3M4P A;  2EIF A;  1HNW L;  4UP9 A;  1L1O B;  2WAQ E;  2H5X A;  1NMG A;  1UE6 A;  1WCM H;  2KCM A;  1WJJ A;  3PF5 A;  4A3D G;  1BBU A;  5JJI A;  1HZB A;  3K7U C;  2AKW B;  1AE3 A;  3SGI A;  1K3R A;  1HJP A;  2I0Q A;  1QUQ B;  4LFC Q;  1VQF A;  1OXU A;  1VQL A;  3J80 i;  3TRZ A;  1MJC A;  3L2P A;  3PIP A;  2NVY H;  1MKH A;  1GM5 A;  3I4N G;  1IBM Q;  4LF5 Q;  4OWW B;  1FL0 A;  2UXB Q;  4JI0 Q;  4BBS H;  4R4I A;  2OQ0 A;  4LF8 Q;  3CME A;  4OO1 I;  3I4M G;  5JEA G;  4X62 Q;  3DM3 A;  4BY7 H;  3PUW A;  2Q2H A;  4DR7 Q;  1X3E A;  5C4X H;  3AQQ A;  3U50 C;  1KXL A;  3OTO L;  1C0A A;  4DR6 L;  5M3F G;  1H95 A;  1T9H A;  2UUC Q;  2NN6 I;  1E22 A;  2JE6 I;  4LF7 L;  4X66 L;  3FKI G;  5ELO A;  3B6Y A;  3ZJY C;  3GTO H;  1Q86 C;  1U5K A;  4P72 A;  4A3J G;  4UPA A;  4JYA Q;  4EQ5 A;  1X54 A;  2OTJ A;  1Q46 A;  5M3M G;  4RG1 A;  4HIM A;  1Y1W G;  1QZH A;  5BR8 L;  2QA4 A;  2R7Z G;  1HR0 L;  1A63 A;  4MTN A;  2HHH L;  3GDE A;  2NVX H;  2Y0S G;  1JJC B;  4HJ5 A;  2N3S A;  3S15 H;  1N34 Q;  3S2H H;  4KHP Q;  3W5O A;  4IPG A;  4R4Q A;  1L1O C;  3NEL A;  2OQK A;  2HIV A;  1N36 Q;  4BY1 H;  4UY8 C;  3KF6 B;  5LMN Q;  2R92 G;  4PZ6 A;  4IPH A;  3HOV H;  1CKN A;  4AYB E;  3F2D A;  4L5T A;  2N8N A;  2UXC Q;  2MFI A;  2VY3 A;  3CXC A;  4HID A;  3T1H L;  4DUZ L;  4WJ4 A;  4DR6 Q;  4YWK A;  4C3I H;  1YZ6 A;  4A76 A;  3RLO A;  3STB C;  1PV4 A;  2OWO A;  4LF7 Q;  4DV7 L;  3J7A 5;  1WI5 A;  4UP8 A;  4JI5 L;  2IHE A;  3DLL A;  3T1Y L;  3J81 j;  3H0G G;  4JI1 Q;  1XNQ L;  4KHZ A;  4BA1 I;  4IFD G;  2JA8 H;  3UDI A;  2CKZ B;  3CCV A;  4K0K L;  2Q2T A;  1OXS C;  1FGU A;  3W1G A;  4HJ8 A;  1XNR L;  3S17 H;  2VUM H;  4AQY L;  3G71 A;  4L5R C;  1VQI A;  4NPS A;  2K14 A;  4QL5 A;  2HHH Q;  1YJW A;  3I55 A;  4A75 A;  1SMX A;  5JEA J;  1TXY A;  5C3E H;  4OO1 G;  3I4O A;  4JI4 L;  3PO3 H;  1EFW A;  5LMU L;  1YBY A;  3J80 c;  3KDF A;  4DR1 L;  4JC0 A;  3GTK H;  1HZ9 A;  3AYH B;  2KBN A;  4MZ9 A;  3A5Z B;  1K73 C;  4LF4 L;  2VQF L;  3STB D;  3KF8 B;  3F2B A;  4B3M L;  1KHI A;  1Y14 B;  2NN6 G;  4NXN L;  3T1H Q;  4A3K G;  1VQ4 A;  1SFO H;  3HOZ H;  1VQC A;  1A62 A;  2HIX A;  3M4O H;  2MNA A;  4JI3 L;  3TS0 A;  3S1R H;  1VQO A;  1LUZ A;  4GN4 B;  4LFB L;  4KLK A;  1N33 L;  4H02 A;  4WJ3 M;  2UXD L;  1M90 C;  3S2D H;  3HOX H;  2ZM6 L;  2E8G A;  2I5L X;  2WFW A;  4DAY B;  4GKK L;  2MO1 A;  3D0F A;  5GQO A;  1C7Y A;  4GN3 B;  4YWM A;  2WAQ G;  2JQO A;  4AQY Q;  1G6P A;  2RCN A;  1NE3 A;  2VQE L;  1Q8K A;  2K5V A;  4A3M G;  4BXX H;  4A3G G;  4LFC L;  3CCJ A;  4QY7 A;  1X9N A;  1NMF A;  1P16 A;  5IYB H;  2VZA A;  4JBK A;  2JA7 H;  1EOV A;  1TWC H;  5LMU Q;  1IBM L;  4LF5 L;  2YV5 A;  2E5L Q;  2ASB A;  3HOU G;  5IE8 A;  4JI0 L;  1WYD A;  2JEA I;  2UXB L;  4LF8 L;  2K5N A;  1X56 A;  3D31 A;  3S1N H;  4X62 L;  4GNX B;  4BY7 G;  4JI8 Q;  1D7Q A;  5FLM G;  2QGQ A;  3CCU A;  3NEN A;  1IBL Q;  3LGJ A;  1S40 A;  3ERS X;  4IFD J;  2N49 A;  4JI3 Q;  1VS0 A;  3TEH B;  3PUY A;  2UUC L;  1KC8 C;  1PH6 A;  5GAD C;  3UDF A;  2B29 A;  2ZM6 Q;  2E2H H;  4JBJ A;  1KAW A;  1PH7 A;  2RHQ B;  4GKK Q;  4JYA L;  5E7N A;  5GAH C;  1N9W A;  2B3G A;  1K8A C;  4OWX B;  4A3I G;  2VQE Q;  3RZO H;  4IFD I;  2JA6 H;  3CAM A;  2JA5 H;  4JG2 A;  3UE1 A;  1KRT A;  3PUV A;  3KFU A;  4HIO A;  1B70 B;  3TQY A;  2WB1 G;  2XTI A;  2KHJ A;  2OCE A;  2AWN A;  1N34 L;  4KHP L;  4A3B G;  3AFQ A;  4IPC A;  4LUV A;  3S24 A;  2R6G A;  1I50 H;  4DV5 Q;  1JB7 A;  1P8L A;  4BY1 G;  1N36 L;  4DNI A;  1OTC A;  5LMN L;  1I94 Q;  2MQH A;  2D62 A;  2R93 G;  1TWH H;  4BBR H;  1Q12 A;  4LFA Q;  4GLA C;  4OX9 Q;  2UXC L;  1EWI A;  5IYC G;  4O2D A;  3M7N A;  4XTC S;  4A93 H;  3EIV A;  5JJK A;  1XMO Q;  1HR0 W;  4OON A;  1HNX Q;  3GTJ H;  1VQH A;  5H1S E;  2PQA A;  4A3F G;  1YJ9 A;  5IP7 H;  4JV5 Q;  5FJ8 G;  3CCL A;  5FLX c;  1Y1V H;  2UU9 Q;  2K52 A;  2DGY A;  3HKZ E;  3PV0 A;  3WWV A;  4JI1 L;  3GTP H;  1JT8 A;  1CSP A;  1SLJ A;  4R4O A;  4GNX C;  4R1J A;  2JA8 G;  1N32 L;  1CKM A;  3A5U A;  1SRO A;  3EBE A;  1RL2 A;  4LF6 Q;  2A19 A;  4A3L G;  1KIX A;  5IY0 A;  5C3E G;  2OTL A;  3NBH B;  3KOJ A;  3RN5 A;  4A3C H;  1PH4 A;  3S14 H;  3EN2 A;  2Z6K A;  3JAM i;  5GRO A;  3CCR A;  1AE2 A;  1JJ2 A;  4JI2 Q;  5IWA Q;  5IYD G;  3CF5 A;  1UE1 A;  2ZJQ A;  1OXX K;  3CPW A;  4B3T Q;  2F3I A;  2YTV A;  2K75 A;  3IRB A;  2D0O A;  3H3V H;  4YWL A;  2ALY B;  4EX5 A;  4GOP B;  4A3D H;  2CCZ A;  1VQK A;  1NTG A;  2ZTD A;  1OXT A;  3CC4 A;  2NVQ H;  1OXV A;  1EYG A;  2PNH A;  4JI7 Q;  2A8V A;  3RLN A;  3KYH C;  4DK6 C;  2XGT A;  1QZG A;  2AWO A;  2EXD A;  2BA0 A;  4LWC A;  3I4N H;  1N32 Q;  1PH2 A;  1VQJ A;  1EIF A;  2E2I H;  1I3Q H;  4DV4 Q;  4J15 A;  3HOY G;  5C44 H;  3CMA A;  2B63 G;  5JJL A;  1X55 A;  2A1A A;  4BXX G;  4R4C A;  3KJO A;  3OW2 A;  2LSS A;  3U58 A;  1UWV A;  1A8V A;  1KL9 A;  2AMC B;  2Q2U A;  5J3B A;  2JA7 G;  2UUB Q;  2VL6 A;  3L7Z C;  3CC2 A;  5M3F H;  3HOW G;  4DR4 L;  3RZD H;  2E5L L;  1Z47 A;  3PO2 G;  1HH2 P;  1YVC A;  4DV3 Q;  1HNZ Q;  3F1Z A;  2VW9 A;  4QJF A;  1EIY B;  1VQG A;  4A3J H;  4JI8 L;  1IZ6 A;  2IT1 A;  1VQ7 A;  1WOC A;  4GKJ L;  1GVP A;  3G4S A;  4POF A;  4IJH A;  4YCV A;  1TWF H;  5IP9 G;  1PH9 A;  1IBL L;  1XJV A;  4DV6 Q;  2CWA A;  1Y1W H;  2Y0S E;  1VQM A;  1NY4 A;  1X6O A;  4P73 A;  3AEV A;  2UUA L;  2HQL A;  1IBK Q;  2JA9 A;  4PZ8 A;  5IT9 c;  1I6H H;  3PGZ A;  2PI2 A;  1VQ9 A;  2D0P A;  2ES2 A;  3ULP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...