4JI7Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji7Q00
1VQGA 1K9MC 4DR4L 2N78A 4X6AH 1SMXA 3S24A 2VS1A 3GTOH 2KBNA 4DR6Q 1IL2A 2E5LQ 4P75A 4A3KG 4BA2I 1XMOQ 4PZ8A 2R92G 1WCMG 1Q1EA 3U4ZA 3D0FA 5JEAG 3CCUA 4DR5Q 5FLMH 3Q8DA 1U0LA 2IHEA 2R7DA 4LF9L 4NXMQ 5IT9c 1N34L 2E2HH 2LXKA 5FJ8H 1I5FA 4YY3Q 3HOXH 1XTDA 4GNXC 1DGSA 4JYAQ 1L0WA 3F2CA 4IOCA 4GLVB 4GN3B 3HOXG 1V1QA 4IOAA 1YNXA 2YTYA 4XTCS 3PO2H 1YITA 1Z9FA 1Y1VG 3WWVA 2Q2IA 1TWFH 1C9OA 4JI2L 1FVIA 3KYHC 3PUZA 1N8RC 5HGQA 2A1AA 4UY8C 1I6HH 1KRTA 3PUYA 1E1TA 1K8GA 3CCLA 3D31A 3RNUA 2VL6A 5IE8A 5JJKA 2B3GA 4A3JH 2NVQH 2PI2E 3GTQH 4BBSG 3FP9A 1Y1WG 4AYBE 4X62L 2VQFL 4YWLA 5IYDH 3E9HA 1VQIA 2UUCL 4POFA 5IWAL 1NMGA 1SROA 2K14A 3KF8B 4JI4Q 1E3PA 2Y0SE 1QVCA 2QGQA 3RN5A 2ES2A 2R93G 1VCIA 1UE7A 4P73A 3PO3G 1KHIA 1XMOL 3CXCA 4NXNQ 1SFOH 2N3SA 2IX0A 2Q2TA 4P72A 4POGA 3HOYH 1GD7A 2E5LL 3HOUH 4DNIA 1IZ6A 1I3QH 1VQAA 2WP8J 4YCUA 3H0GH 4A3JG 1IBLQ 1RIPA 1O7IA 4OWWB 3CCRA 4DV4Q 2VQEQ 3NENA 1N34Q 4APVA 1CUKA 2EQSA 1VQLA 4A3IH 2A19A 2JA5G 1HZCA 3CQZH 3OW2A 1B7YB 3UE1A 3UDXA 4HIMA 4R4TA 3A5UA 1W2BA 1LUZA 3J81c 1NJIC 1VQEA 4OWTB 3JAMi 3KFUA 4JV5L 3NEMA 1JJ2A 3GTLH 2E2JH 4DR6L 3I56A 3CP0A 3ICEA 3G6EA 1HNZL 2WB1E 4JC0A 4A3DG 5IYBH 1C0AA 3CCJA 3S17H 3F2DA 1EOVA 4JBMA 1UE5A 1B70B 1WI5A 1TWCH 3I4NH 5IYBG 4IO9A 4DUYQ 1WCMH 2UUAL 3RR5A 3GO5A 2HHHL 1S72A 1L2FA 2CFMA 3BU2A 1VQDA 4A3KH 1HZ9A 1I94L 3S2DH 2EXDA 3B6YA 1P16A 4QY7A 3G4SA 3W1BA 1Q81C 1ASYA 1XJVA 4WJ4A 3H3VH 2UXBQ 5M3FH 2R7ZG 1VQNA 3S2HH 4UPAA 2N8NA 3CW2C 4JI1L 4JI4L 3L7ZC 4OWXB 2K4KA 4X64L 2JA5H 3S15H 2JEAI 4BA1I 4O2DA 4DR7Q 3TQYA 1IYJB 4X62Q 2YTVA 2VQFQ 5M3FG 2R7ZH 1CSQA 2H5XA 1QVFA 4IFDG 4HIDA 3KF6B 1GO3E 4PZ6A 3RN2A 1I94Q 2I5LX 2OQ0A 2FXQA 3CCEA 4DV2L 3HOYG 4DR2L 4DK3C 2D0OA 4NPSA 1ASZA 4LF7Q 1IXRA 3CD6A 1YEZA 5IP9G 4C2MH 2BH2A 1G51A 1XPUA 3U50C 3A0JA 1N36Q 1X56A 3DM3A 3ULJA 3KDFA 4DV7L 3HKZE 1J5EQ 4IJLA 1C7YA 3CMEA 3KDFB 5M3MH 3EBEA 1PH6A 4JYAL 4GKJQ 2OQKA 3FHWA 3PIOA 1PYBA 4HIOA 4BBSH 2UXDQ 2HIVA 1E7ZA 4X66L 4AQYQ 4LF9Q 4NXML 4MZ9A 4OONA 1CSPA 3K0XA 2PMZE 2ZJRA 1OXSC 4A3MH 1Q7YC 1BVSA 1HNXL 1D8LA 4JI6Q 2KENA 4OO1I 1VQHA 4DK6C 5C4XH 3PO2G 4LF8L 4GS3A 5C0XI 4YHHQ 3J81j 1EUJA 4PMWA 4NB3A 3HOUG 3G48A 3TRZA 5GAHC 2CQOA 1YHBA 5IYCH 1XMQQ 1VQ6A 1G6PA 3FKIH 5LMNL 4DR4Q 2HIXA 4JI6L 4A93G 4HJ7A 3PO3H 5AJ3L 4A3LG 4LFCQ 5IWAQ 5IP9H 4A3EH 4A3GH 1QVGA 5FLMG 4GNXA 5HY6A 3M4QA 2K50A 2R6GA 1G291 4IPCA 4LFCL 4A76A 1KC8C 3ZJYC 5AJ3Q 1N32Q 3M4PA 4YWKA 3AFPA 4GKJL 3EN2A 1KQSA 2JK8A 3KOJA 1K73C 1VQFA 2I0QA 5LMNQ 3LGJA 1YI2A 4R4QA 1FJGQ 1FL0A 1HH2P 3OYYA 1QUQB 5GAEC 4DV1L 2K5HA 4HJ5A 1X9NA 4HIKA 1UWVA 3GTJH 1VQPA 4ME3A 1HJPA 2I5HA 1YJWA 4GLAC 2RF4A 5ELOA 4LF7L 5K36G 4OX9Q 1NBWA 2VZAA 3KLWA 5C4JH 4A93H 3CC4A 1VQOA 4AQYL 4TQUS 4X66Q 2IHFA 3E9IA 3HKZG 5IYCG 1PH7A 4L5RC 1WOCA 4L5QA 5ELNA 2V1CC 4YY3L 4DPGA 3K80C 4AH6A 3I4NG 4DAYB 2Z0SA 1N33L 3S14H 4LFBL 4X65Q 2AWOA 2JA9A 4FDBA 1IBKL 4OO1G 4DR5L 4A3MG 2KCTA 2YV5A 1Q82C 4UP7A 4LFAL 1MJEA 5LMNW 2CCZA 3I55A 4J15A 1PH2A 4A3DH 1GKHA 3K7UC 2HHHQ 2F4VL 2AKWB 4JI3L 1KIXA 3EIVA 4PG3A 3RLNA 3I4MH 4IFDJ 2F4VQ 1MIUA 1V43A 3HOVG 1T9HA 4A3IG 4K0KL 2WAQE 5M5XH 4B3TL 4A3BG 1CKOA 3PUWA 3CF5A 3ULPA 4A3FH 3A74A 2YYZA 4LUOA 1SRUA 3J80c 1YZ6A 1HNZQ 4R4IA 2IT1A 1HZAA 2E8GA 3H0GG 2L15A 2CWPA 2ZTCA 3S1RH 4P74A 1Q86C 1PA6A 1VQ5A 3S16H 3BJUA 4R1JA 3AYHB 4JI5Q 3STBC 4A3CG 4B3SL 3TS0A 1OXUA 5LMUQ 1PH3A 1WJJA 4C3HH 4R4OA 5JJLA 1JJGA 5BR8L 2R93H 3ER0A 1TWGH 4DV4L 2MFIA 4OXPA 3GD7A 3M4OH 1NTGA 1QZGA 3H15A 1IBLL 1XNQQ 1OXTA 3L2PA 1PH9A 4DV1Q 3JAMc 1FJGL 1AE3A 5BR8Q 3K81C 3TREA 4QQBX 2OWOA 2MO0A 2Q2UA 4GKKQ 4GLXA 2IY5B 1XNRL 2UXCL 1L1OC 3ERSX 1JT8A 4DV6Q 4DR1L 3T1HL 2CKZB 4YCVA 3GDEA 4A3EG 2YU9H 2RHQB 4LF5Q 1PVOA 1OXVA 1Y1VH 2PQAA 1A8VA 1CKMA 4DUZL 4R4CA 4UP8A 1IBML 3RLFA 4KLKA 2ZM6L 2B63G 1M1KC 3K7AH 4GN4B 3HOWH 4BY7G 1EQQA 4JI0L 1Q8KA 1XMQL 3M85A 4KHPQ 1LYLA 3J7ZC 5FJ8G 2GVAA 1HR0Q 1LM0A 1X6OA 5C4XG 4LFAQ 5M5YH 3UDGA 3CCVA 4HJ8A 1VQMA 4IJHA 3W5OA 1CKNA 1VQKA 2MNAA 4AIMA 1SN8A 2C35B 5C0XJ 2R92H 2XTIA 4Y7NH 1CKNB 4KHPL 2PNHA 1BBUA 2OTLA 2CWAA 4LF4Q 2K52A 1SLJA 4GOPC 1YJNA 4BXXG 5IP7G 2Z6KA 3T1YQ 1EIFA 4MNOA 1RL2A 1Q12A 1PFSA 4HJAA 1PYSB 5FLXc 3TS2A 2Z6KC 4KHZA 5GROA 5C44H 1SE8A 1WYDA 1X65A 1K83H 1Y14B 3FKIG 4IPHA 1K8AC 1XNRQ 4A3CH 1PH1A 4GKKL 1YBYA 5GQOA 1X3FA 2LXJA 2Y0SG 3PCOB 3PIPA 2QA4A 4DV2Q 1WFQA 2K75A 2E2IH 1J6QA 3MEFA 2ZM6Q 3CCQA 4JBKA 1JJCB 1U5KA 1XNQL 4XIGS 4BBRH 3PUVA 4DUZQ 1X54A 4A3FG 1H95A 2N49A 3G71A 1KRSA 3E0EA 4DV5Q 2HT1A 4LUVA 4JOIA 3J81i 2UXCQ 1YVCA 5H1SE 2IX1A 2ATWA 3I4MG 3HKSA 1Q46A 4DR3L 4BY7H 4C3JH 3CC7A 2JA6G 1KL9A 2DUDA 4YHHL 4DUYL 4RMFA 4LF8Q 1NY4A 5E7NA 3CCMA 3M3YH 1X55A 2BH8A 2AWNA 3HOZH 4B3TQ 3HOZG 3I4OA 4O0AA 4JI8L 4EQ5A 1E22A 1HNXQ 2A8VA 2VNUD 1EYGA 4K0KQ 1NMFA 3KF6A 4IPGA 3S1MH 1W3SA 1PHJA 3KJPA 4JI3Q 1Q1BA 1Z47A 5EAYA 2VW9A 4B3MQ 2UXDL 1AH9A 2KHJA 2PQAB 1K3RA 1PV4A 1VQBA 4B3RL 4QL5A 2ZTDA 4EX5A 4QGUA 4B3RQ 2KHIA 2XGTA 2VQEL 3DLLA 4BBRG 4Y52H 1FGUA 4QIWE 4LUZA 4UP9A 2DGYA 3UE0A 1A63A 3S1NH 1X3GA 4DKAC 2JQOA 2ZJPA 3J7A5 3I7FA 5C3EH 2WB1G 1XPRA 4NXNL 3CPFA 3AFQA 1HNWL 1HZBA 2AHOB 2EIFA 2LSSA 1EQRA 2K5NA 4P71A 3OTOQ 1S40A 4AYBG 1HR0L 4JI7Q 4BY1G 4DR7L 4X65L 4JBWA 3S1QH 4LFBQ 2JA6H 4DV0Q 4LWCA 5JJIA 2JA8H 4PZ7A 1UEBA 4JI0Q 1KAWA 4DR3Q 1Y1WH 3M9BA 5IP7H 1L1OB 1MJCA 2WAQG 3UDFA 4L5TA 4LNQA 2Q2HA 3L0OA 3VDYA 4LW1A 4TVAB 1GM5A 3RLOA 3GTGH 2QEXA 3MXNB 1QUQA 3RZDH 1XPOA 2UUBL 4OX9L 4GN5A 2GN5A 2PI2A 3STBD 3CCSA 4DR1Q 4JOIC 3GTPH 1VQ7A 2MQHA 1E1OA 1TWHH 2NN6I 4JI2Q 2JEBI 1A62A 5GAGC 1R9TH 4GNXB 3J80i 3K8AA 2NVXH 1I50H 2OCEA 3TEHB 3HFZB 3AQQA 2F52A 5M3MG 3M7NA 1A0IA 1VQJA 2B63H 4DAMA 4GOPA 1NE3A 1PH5A 4JV5Q 2KCMA 3ULLA 5C44G 1VQCA 3H3VI 2NVYH 4RG1A 2WFWA 3BZCA 1E24A 1PH4A 3A5ZB 2UUBQ 3U4VA 3AEVA 1BKBA 5M5WH 5IYDG 1SR3A 5LMUL 1VQ9A 4B3SQ 3T1YL 2AMCB 4ALPA 5JEAJ 1GVPA 4BXXH 3PGZA 4LF4L 1OTCA 1PH8A 1D7QA 3SGIA 2D62A 1YJ9A 2ZTEA 3JC66 3KJOA 1VQ8A 2GVBA 3CAMA 3F1ZA 3OTOL 4DV7Q 2HQLA 1JB7A 3UDIA 1QZHA 4A3GG 1HR0W 1KXLA 2I5MX 1VQ4A 5IY0A 1YHQA 3CC2A 4A3LH 3W1GA 4LF6L 2UUCQ 2BA0A 3IRBA 3PV0A 4JBJA 4IPDA 5DLQE 4DR2Q 1S3OA 1TXYA 4L5SA 2OTJA 2VUMG 1BBWA 3HOWG 2D0PA 3F8TA 1L1OA 3PF5A 4WJ3M 1B8AA 2ALYB 4YWMA 1IBMQ 3RZOH 1M90C 5C0XG 1LTLA 2YTXA 2VY3A 1V9PA 2R7FA 1J5EL 1IBKQ 1JMCA 4LF5L 2F3IA 4DV0L 1N36L 2NN6G 1YIJA 1N33Q 1EWIA 2RCNA 4MTNA 4DV6L 3T1HQ 4JI1Q 2NZOA 4A3BH 1JE5A 4JCVE 4JI7L 2ASBA 1YHAA 3NBHB 3HOVH 2UU9L 1TWAH 3NELA 3PSIA 1HNWQ 2BA1A 4DV3L 1EIYB 2K5VA 1KD1C 4H02A 3PUXA 2B29A 1MKHA 3U58A 2NVTH 1P8LA 4DV3Q 3PF4A 2UUAQ 4JI8Q 2JA8G 2UU9Q 2JE6I 4GOPB 1VS0A 3GTKH 4BY1H 4A75A 1X3EA 2RHSB 1K0RA 3I2ZA 5J3BA 2JJQA 3CMAA 2NZHA 4X64Q 2JA7H 4QJFA 4YCWA 1N9WA 2ZJQA 2UXBL 4JI5L 4C3IH 5C3EG 5GADC 3CPWA 1N32L 3GTMH 4B3ML 4HJ9A 2VUMH 2ID0A 3BZKA 3F2BA 4A4IA 1OXXK 4DV5L 1UE6A 4KI0A 1AE2A 1EFWA 2JA7G 4LF6Q 4IFDI 2MO1A 1UE1A 4JG2A
chains in the Genus database with same CATH superfamily
1HCZA 4WFN3 1DONA 1SNDA 2N78A 5L37A 1AW7A 3HOVB 2E5LQ 3CKIB 1SNQA 1R4PB 4P75A 3C1FA 1IW7D 1Q1EA 3I72A 3Q8DA 4K8JA 1BCPC 2R7DA 3M4OB 5IT9c 5I4DA 1KTKA 1STYA 1HHVA 1D1IA 4GNXC 4JYAQ 3PO3B 3T53B 4IOAA 3QWNA 1Y1VG 1KAAA 1F9QA 3WWVA 1C9OA 1N8RC 1TWGB 4UAIA 1KNAA 5IGEA 4AYBB 1EU4A 3PUYA 1K8GA 3OPOA 1S5ED 3N6RA 2B3GA 2DY7A 1SYEA 4I7ZC 1Y1WG 3MXUA 5M5YB 3M3YB 5IWAL 1SROA 2MHVA 4QUCA 1BBXC 1U4MA 1E3PA 2B8FA 2HQEA 3RN5A 2ES2A 3EQLC 1JWMD 4OL7A 4P73A 5FKAC 1KHIA 2F03A 1XMOL 4RCOA 2L9HA 4NXNQ 2IX0A 4C3IG 4DNIA 4YCUA 3NPPA 3RUZA 1STEA 4DV4Q 2VQEQ 2K1BA 5IODA 4APVA 1SMYD 3KBXA 1HZCA 4LMQD 3Q24A 4R4TA 4ZCKA 3TP6A 1EWHA 1LUZA 1HPCA 2E2JH 4DR6L 3I56A 4A3DG 3ICEA 1ILPA 3A56A 1HQRD 3VYUA 4EVOA 2K32A 3F2DA 2B2UA 1L0XB 2CH4A 2OT2A 5IYBG 4DUYQ 1WCMH 2RVLA 2CFMA 1VQDA 1ZYRC 1EIHA 4A3KH 3S2DH 3OMCA 1GOZA 1H9KA 1RTOA 1CZGA 5EPKA 4CBVA 4DAVA 1XJVA 4WJ4A 4IUTA 5M3FH 4ZUIA 1O7LA 3CW2C 2JA5H 1QOHA 5CR3A 5CBAE 5DNFA 4X62Q 2VQFQ 3W2DA 1CSQA 4DFAA 4IFDG 4U68A 3KF6B 2OQ0A 3CCEA 1EZ8A 1CQVA 1ASZA 1DZ1A 1IXRA 4MN3A 1F9SA 2R3ZA 1ONLA 3BZDB 4R8NA 4QF4A 3NWTA 1J5EQ 1CA6A 4IJLA 1STNA 1PH6A 4JYAL 5J22A 2OQKA 3PIOA 4HIOA 1PYBA 4X3KA 1M8AA 4J1MA 4LF9Q 1F2LA 4NXML 5BN4A 2F1MA 2WV6D 4J6HA 1CA5A 2ZJRA 1OXSC 1HNXL 1D8LA 5JVG3 2KENA 4OO1I 1VQHA 1CM9A 3S15B 3FKIB 3MA2B 4GS3A 5C0XI 4KKTA 3HOUG 1EUJA 4NB3A 1G6PA 5LMNL 4A3KB 4A93G 1ML0D 1SNCA 1DYQA 4JK1C 2M2LA 5JVH3 3K58A 1QVGA 5FLMG 4GNXA 1IHZA 2EYLA 4IPCA 4LFCL 1KC8C 1F2MA 1BCPD 1KQSA 3I70A 1YI2A 3E3XA 2PZWA 1FJGQ 1FL0A 1HH2P 3OYYA 1QUQB 2IW3A 4DAYA 1G6ZA 2F0NA 3GTJH 3GTGB 1GUWA 1PYWD 1YJWA 1WTXA 4PNYA 4LF7L 1SE4A 3KLWA 4QUFA 4A93H 2DNEA 3E9IA 3HKZG 3T16A 3UI2A 2DN8A 1TS2A 2V1CC 4L8JA 4HMJA 4DAYB 3NK9A 4X65Q 2AWOA 4FYDA 3A7AB 1D5MC 4OO1G 1Q82C 4ZKBB 4A3DH 1D5XC 3J7AV 1GKHA 1UAPA 2F4VL 4JI3L 3EIVA 2V4DA 2PNRC 4PG3A 3RLNA 1BNZA 3H3VC 5TSSA 3M7GA 4IFDJ 1MIUA 5FOBB 4K0KL 1T9HA 1CHPD 1PTOH 3CF5A 3ULPA 3IFTA 3K59A 1HZAA 2CWPA 2KEEA 3S1RH 2KCCA 5IT9L 3BJUA 1QNKA 1ZEQX 2L55A 4JI5Q 3STBC 4B3SL 3TS0A 1OXUA 5LMUQ 1JJGA 3MTSA 5BR8L 1TWGH 1SXTA 3T13A 3FRPB 1Q8IA 3TDQA 3L2PA 4DV1Q 2EYHA 5EKLA 3I8ZA 4F88A 3FPUB 4QQBX 2KQ3A 2Q2UA 4GKKQ 3H09A 1GUTA 2IY5B 1XNRL 1NUCA 4DR1L 5HGTA 4A3EG 4LF5Q 2BDOA 1Y1VH 2PQAA 4N9TA 4UP8A 3NP8A 2ZM6L 1FR3A 4IUNA 4BY7G 4JI0L 3J81E 1Q8KA 1A6XA 1HR0Q 1LM0A 2EJFC 3TN2A 3UDGA 2Z4HA 4HJ8A 5NUCA 3W5OA 1WVLA 5I2XA 4AIMA 5C0XJ 2XWJB 1CKNB 3ERQA 4CJ0B 1BBUA 2Z1CA 1A3UA 1WCMB 3AU7A 1YNJC 4NP5A 4GOPC 4BXXG 5IP7G 3J7YW 3VR3A 3T1YQ 1EY9A 5ELCA 4DA2A 1I4QA 2NVTB 3A55A 2XIWA 1RTNA 3PCOB 3RZOB 3VR2A 1WFQA 2J0TD 4EGVA 2PCFB 3MHBA 5A35A 3CCQA 4A3IB 1JJCB 5EPJA 2OF1A 1PLFA 1HTPA 3PUVA 4DUZQ 1TY0A 4A3FG 3U9OA 3HGBA 3EJIA 4DV5Q 2UXCQ 2B2WC 3QO2A 2IX1A 2VB3X 1GUOA 2RDHA 5IGBA 2ATWA 1VMPA 4BBRB 1H9MA 1EQTA 4DNRB 2JA6G 4DUYL 5J1ZA 1X55A 3HOZH 3I4OA 4JI8L 4DN4M 1HNXQ 4XXEA 5FK9C 4K0KQ 3S1MH 2E2DC 1W3SA 1PHJA 5M9OA 1Z47A 3K5LA 5EBDA 1K3RA 4IUUA 4K2LA 4B3RL 3HEJA 4EX5A 4QGUA 4QIWE 4LUZA 4PV1C 4CDDC 4MTKA 1EY8A 2EYOA 4OIJA 1TQOA 2F0EA 2WB1G 4NXNL 1HXYD 2AHOB 2LSSA 5C3WA 1S40A 4DR7L 4AYBG 4JBWA 2NTSA 3N52A 1CTMA 4LWCA 5CC4A 1JOKA 2WAQG 4L5TA 2Q2HA 3GTGH 5JPNC 1TT2A 1QUQA 2NVYB 3CCSA 3GTPH 2MQHA 4RGOS 4JI2Q 5GAGC 1A62A 3J80i 1TU2B 1JR0D 3CHBD 1I50H 3HFZB 3SEBA 3GTQB 4F87A 2BOSA 1EYAA 4DAMA 1GUNA 1NE3A 5ELBA 3H3VI 3OW7A 1E24A 1EWCA 1PH4A 1Y8OB 3U4VA 3S16B 3AEVA 3SHLA 1SAPA 1GVPA 2FFKB 1VQ8A 2B39A 1JB7A 2Q8RE 1QZHA 4A3GG 1HR0W 2I5MX 4A3LH 3VR4A 3W1GA 5M3MB 2P5ZX 4LF6L 4JBJA 5DLQE 2F3VA 1BBWA 4FVMA 2X6GA 3HOWG 2ZXRA 1B1ZA 1L1OA 1JQYD 1IBMQ 2J7ZA 4K8IA 3QOLA 1PFMA 1LTLA 2QILA 1V9PA 2VY3A 1N36L 1WTRA 3QJYA 2NN6G 2F0LA 2L4NA 1EWIA 1GHJA 4K5XA 4MTNA 5DM73 5I9OA 1YHAA 4C3JG 2E2IB 1HNWQ 4DV3L 1KD1C 1I4PA 4DV3Q 1SJHD 1TWFB 2UUAQ 2UU9Q 2JE6I 4GOPB 1ICFB 4A75A 4K6DA 3I2ZA 4JW0A 3EA6A 2XSCA 2ZJQA 1S5CD 5C3EG 5GADC 3GTMH 3DEPA 2ID0A 4DV5L 1SMYC 4QCLA 1HFGA 4S3SA 2MO1A 3GP7A 1IYUA 1UNSA 4DR4L 1V8QA 3ONAB 4RHRA 5I9PA 1AP0A 1IL2A 1I6VC 1QNUA 1Z7TA 1WTVA 3IFDA 4BA2I 1U4PA 3NWSA 1XMOQ 4PZ8A 4HSPA 5JEAG 1FYCA 2NWGA 5ELFA 1LTBD 5DAUA 4DGZA 4R8IA 2LXKA 4XYOA 1SEBD 2K7VA 3HOXH 1PRTB 2J4XA 1DGSA 3E5SA 1L0WA 4IOCA 1JWUD 4GN3B 5C3XA 1YNXA 2YTYA 2BCOA 4XTCS 3MAQA 3PO2H 3FMCA 1Z9FA 2Y0SB 2Q2IA 1TWFH 4JI2L 3HZXA 1Y8PB 3PUZA 4UY8C 4CKCA 1KRTA 3I3CA 1D2BA 3P1HA 4XQQA 2L12A 2IL8A 4A3JH 4ZLTF 2PI2E 3GTQH 1F9RA 1G8ZD 1U4LA 3A8KE 2KJXA 5G3LD 2K14A 5LL6S 4A3DB 1H9JA 2Y0SE 4OGQC 1QVCA 1CI3M 1JCKB 3J81L 1HUNA 3PIO3 2Q2TA 3HOYH 2K04A 1VQAA 1I3QH 4A3JG 3H0GH 2L1BA 1O7IA 3MVVA 3I73A 1N34Q 4C2MB 2EXZA 4A3IH 1DD2A 4ZYSA 3CQZH 4X3SA 1NJIC 4JV5L 3JAMi 3KFUA 3EVQA 3NEMA 3GTLH 3CP0A 4XQNA 2WB1E 3CCJA 4RGNA 1EOVA 2K03A 1WI5A 1TWCH 5KYLA 5JEAH 2UUAL 3KLSX 1L2FA 5BN3A 1I94L 2EXDA 3B6YA 4QY7A 1Q81C 3W1BA 3H3VH 2WACA 4KTAA 2R7ZG 4JI1L 4A3EB 4JVZA 3L7ZC 3D4WA 4X64L 4KJOA 2JEAI 1PTOC 4CDFC 2ICIA 1STAA 2MJ8A 4DR7Q 2WIIB 1E2ZA 5D3DA 1QVFA 3M4YA 4PZ6A 5FO9B 1XYIA 3R3OA 2FXQA 3VR6A 3HOZB 4NPSA 2Q8IB 1YEZA 5IP9G 3Q22A 4IALA 4IUQA 3U50C 5EGTA 3DM3A 2PW7A 5M3MH 3DMUA 2F0QA 4C3HB 4LJZC 4BBSH 1ENCA 3C1EA 2R61A 1DOKA 4M8AA 4ID6A 3K0XA 1BVSA 1CQFA 2L0CA 3EFXD 2RKSA 2G5DA 2QF7A 1SJED 3VR5A 3PO3H 3C2PA 4A3LG 4ME5A 4K5WA 4M1UB 4A3EH 4A3GH 3M4QA 2R6GA 4FP5D 3ZJYC 5AJ3Q 3J80L 4YWKA 1AZPA 1KNEA 3KOJA 2I0QA 1VQFA 3SK6A 3LGJA 2WKCA 4R4QA 1LV9A 4DV1L 1RDPD 4HJ5A 2K5HA 2I5HA 4GLAC 2F0VA 3CQZB 3K57A 1U9RA 4OX9Q 5IGDA 3D6CA 1SNPA 5C4JH 4A3BB 3GTLB 3CC4A 1GJXA 4AQYL 4X66Q 2IHFA 5IYCG 1EL0A 1T5XD 4L5RC 1WOCA 5ELNA 2Z4IA 4YY3L 3H0GB 3K0YA 2TSSA 4DPGA 3MXGA 1LO5D 2Z0SA 1N33L 1II3A 3TZUA 2JN4A 3F2UA 1ENFA 4O42A 5M3FB 4DR5L 4A3MG 2A6EC 2KCTA 2YV5A 4UP7A 4LFAL 5CGKA 5LMNW 4J15A 1B4OA 5LHY1 3K7UC 5FLXL 2VB2X 3I4MH 3URYA 3VYTA 2F4VQ 4FF2A 1TS4A 5KYIA 3HOVG 4CKBA 3PMFA 2O5IC 5IGCA 2K6AA 4LUOA 3J80c 2IJ0A 1S5DD 2E8GA 1PA6A 1Q86C 4P74A 4A3CG 1STBA 3S2DB 1LT5D 4A3MB 1PTOB 2O5JC 1PZID 2B63B 2R93H 5M5XB 1E2WA 2CW0D 4C3JB 2MFIA 1I4XA 4F7XA 2EJMA 3GD7A 1QZGA 2E2HB 1IYVA 3ITPA 3JAMc 1FJGL 5BR8Q 2F0MA 3SXHA 1JORA 2B2WA 2LFNA 2Z8LA 2X6LA 5ELEA 3SK5A 2XVSA 3NTKA 1IKLA 3TP7A 1Q90A 1JWSD 4DV6Q 1JT8A 5CV8A 1CKMA 1K28A 3DWQA 5C0XH 2LMCB 1NNXA 3RLFA 2B63G 2C9OA 2KUMA 1LYLA 4G4KA 5FJ8G 3D3RA 3D6WA 2EYJA 3CCVA 1VQMA 3T56B 3BVGA 3C3LA 1CKNA 2MNAA 4Y7NH 3GTKB 3VYRA 1H9SA 2CWAA 4H0LC 1VDZA 1WTOA 1EIFA 4MNOA 4C1NI 1FNUA 3BVZA 2F0PA 2Z6KC 4DNTB 2JA6B 4KKSA 5GROA 1TR5A 1SE8A 1X65A 5CV9A 1K83H 1ZXTA 2HDLA 5EQ0A 1XNRQ 4A3CH 1PRTF 3PO2B 4GKKL 4N8X1 2LXJA 3PIPA 1EFID 3G6JB 2K75A 5CV6A 4HCSA 1I4GA 2AQ2B 5E4WC 1U5KA 2L5TA 3ND9A 1H95A 2N49A 1KRSA 5CMDA 1DOLA 2PMZB 2D2CC 1YVCA 5H1SE 3FPPA 3VA5A 3I4MG 4DR3L 4BY7H 1K8MA 3CC7A 1A3TA 1KLUD 3DXJC 2DUDA 2JP1A 4YHHL 1SYCA 4LF8Q 5E7NA 4PMBA 1YNJD 3ZYYX 4KV6A 4EQ5A 4O0AA 3C46A 1VF7A 2A8VA 2VNUD 3KF6A 5C6AA 2EY6A 3KLRA 2NVQB 4V0BA 4JI3Q 5EAYA 2VUMB 2VW9A 1SYBA 2B8GA 1JE4A 4KN4C 1ZKOA 2VQEL 1K0SA 4HCEA 1LACA 1FGUA 5CV4A 1X3GA 4DKAC 4EQPA 2ZJPA 3BG3A 2PYKA 3J7A5 2BDNA 3I7FA 4PMCA 3CPFA 3AFQA 5D3IB 2K01A 1EQRA 3W3AA 2SOBA 4BY1G 3X3NA 1M4VA 5JJIA 2H4OA 1Y1WH 3M9BA 2I46A 2ZXOA 3UDFA 2K5QA 4HAEA 5C3EB 3L0OA 3NHHA 2K28A 2F0OA 2QEXA 2EZVA 3T51B 1EYDA 1XPOA 4OX9L 2GN5A 2NB0A 1G91A 2EYMA 4FNFA 2NN6I 3A8JE 3HOYB 1RKNA 1R9TH 2BE5C 3DHQA 3TEHB 5LL6X 2F0FA 5M3MG 3M7NA 3D8GA 2B63H 1PH5A 3GV3A 3GTPB 1LABA 3NQTA 4L6TB 4RG1A 2WFWA 1JOQA 3A5ZB 3LX0A 2UUBQ 3R8BA 1BKBA 1SR3A 5IOCA 3MZ5A 1DM0B 1EY7A 1OTCA 4LF4L 1D7QA 3JC66 4KD3A 1HFNA 1D1KA 4UDUC 3TP5A 3UDIA 1KDBA 1K8OA 1NR4A 2UUCQ 1DXMA 2OTJA 4IPDA 4DR2Q 1HUMA 4QMGA 4KJNA 1BUVT 2PPBC 1B8AA 2ALYB 3RZOH 2EY2A 5C0XG 4TRDA 2YTXA 2A6HC 1JMCA 5JJZA 3T1HQ 2NZOA 3MFGA 4JCVE 5D65A 3NBHB 3HOVH 5EPLA 2F0JA 1CZWA 4U673 2K5VA 4H02A 4DU9A 4EQOA 3U58A 1P8LA 1STGA 4C3IB 3S2HB 1BO0A 4JI8Q 2JA8G 4WRDA 4DAPA 2HUGA 4Y7NB 3GTKH 2RHSB 4C1NK 1K0RA 5J3BA 2JJQA 4YCWA 4IN3A 1N9WA 2UXBL 3I4NB 3OSOA 1T5EA 3KUPA 4HJ9A 2VUMH 3BZKA 4FXGC 4A4IA 1OXXK 2B2TA 1UE1A 2F0SA 1VQGA 5CBEE 5EKIA 1HTLD 1SDFA 3DM1A 1QB5D 3K5NA 1SMXA 4X6AH 1E0BA 3GTOH 2KBNA 4CDCC 5G3LF 3K7AB 4KY7A 4A3KG 4A93B 1S4ZA 2R92G 1WCMG 3D0FA 5IGFA 4DR5Q 1MSGA 1U0LA 2E2HH 1N34L 1TVXA 1DCZA 5KGUA 3F2CA 4GLVB 1EY4A 1H9SB 1V1QA 3HOXG 1YITA 4YIJA 1FVIA 2NTTA 3KYHC 3H6MA 4UHVA 1ZYRD 5HGQA 1I6HH 1MI2A 1QCBD 1E1TA 3RNUA 2XNAC 5IE8A 1WTHA 2NVQH 1EEID 2AQ1B 4BBSG 3FP9A 4AYBE 4YWLA 1LTRD 5IYDH 1LTAD 2E74C 2F0WA 4POFA 1NMGA 4JI4Q 1EU3A 4NDXA 2HDMA 1VCIA 3PO3G 3K5OA 3CXCA 2N3SA 1LTGD 2MGSA 4FF1A 4K6LA 2NYZD 4P72A 2E5LL 1SE3A 4POGA 1IZ6A 1IBLQ 1RIPA 5E1FA 3CCRA 3NENA 1O7YA 2IWHA 1AEXA 1VQLA 4KN7C 2A19A 1KDAA 2LKVA 3P20A 2EJGC 1J9OA 1B7YB 3UE1A 1W2BA 3A5UA 5M5WB 3J81c 2C5CA 1VQEA 4OWTB 3TP8A 2MPMA 3G6EA 4JC0A 3NXWA 5EJWA 4H7BA 3S17H 2NN6H 1UE5A 1B70B 3GTJB 1PRTC 1ILQA 5ELDA 2NVXB 3I4NH 5A2QE 1G2SA 3RR5A 1S72A 3BU2A 1EY0A 3Q0AA 1P16A 2B2YA 1ASYA 2R92B 1AFPA 3HKZB 2UXBQ 1PMRA 4UPAA 2N8NA 4JI4L 2XRSD 4OWXB 4G7ZC 3S15H 2CH4W 4BA1I 1U4RA 2YTVA 1CT1D 3NBHA 2EOTA 2R7ZH 4HIDA 4ZUJA 3RN2A 4IURA 5CYUA 1I94Q 2I5LX 1DOMA 4DV2L 3HOYG 4HSVA 4DK3C 1V1PA 4LF7Q 4OHJA 2BH2A 2KCNA 1XPUA 1SNOA 4HTHA 3ULJA 4DV7L 4P2CB 3HKZE 2PW5A 2E75C 2RSNA 3CMEA 1SYDA 3KDFB 4RGMA 3EBEA 3K5MA 4GKJQ 5KRUA 2UXDQ 3WOFA 2HIVA 1A2TA 1RD9D 1E7ZA 2DJFC 4X66L 4AQYQ 3K6OA 4MZ9A 1LT6D 4WORA 3V05A 1CSPA 5K5PA 3J80E 2SDFA 1HA6A 4XDXA 3PO2G 4RKLA 3J81j 3TRZA 3VA7A 1XMQQ 1XXGA 2HIXA 4JI6L 3MFYA 4A3FB 5AJ3L 2NUCA 4E6IA 4LFCQ 3MEHA 1BR9A 1TWCB 2K50A 2A74C 4A76A 1Z6HA 5D14A 5ISRA 3AFPA 2SNSA 3EN2A 4ABNA 3MWYW 1S5FD 2JK8A 2QEJC 4RCNA 1G2TA 5A2QL 1X9NA 1R4QB 3H91A 1UWVA 4NMZA 1VQPA 1C48A 1HJPA 2NZ1D 3IKJA 2RF4A 5ELOA 3LWEA 5K36G 1D6EC 2WINB 1E2VA 2N55A 4V190 1PH7A 1TS3A 1FGBD 3K80C 3I4NG 3X3MA 1OO9B 3S14H 2WKDA 2JA9A 4FDBA 5KNCA 4NKLA 2L11A 1B53A 2OXPA 3KLSA 4L63B 2JA7B 4ULLA 2CCZA 3I55A 1PH2A 3TSSA 2HHHQ 1KIXA 1ET9A 1V43A 1MSHA 5JPMC 1SYFA 3DWAA 4BS9A 1HA5A 1CKOA 4A3FH 3A74A 2YYZA 3MXNA 1YZ6A 4R4IA 2IT1A 1I6HB 2L15A 3S16H 2WAQB 1WJJA 4C3HH 5JJLA 3HRZC 2O2LD 4DV4L 1NCVA 1BQQT 1NTGA 2EY1A 1B44D 1JC7A 1PDQA 1AE3A 1QG7A 2F0IA 3TREA 2LS01 1LT4D 2MUYA 2KECA 2O4XA 2B2YC 1L1OC 3ERSX 3T1HL 3Q6SA 4YCVA 2YU9H 3GDEA 3T4AC 4DK0A 1PVOA 1EYCA 1LTTD 1IBML 1TKWB 3K7AH 4GN4B 3HOWH 1XMQL 4IUPA 1I3QB 3M85A 4KHPQ 3J7ZC 2GVAA 1YNND 4QB4A 3OWFA 1X6OA 5C4XG 3V96A 5M5YH 4RAUC 3QOJA 1AN8A 1SSOA 2M9VA 5KNBA 1VQKA 1YNNC 2ICEC 4Q0FA 4X3UA 2R92H 2ZT9C 4LF4Q 3RZDB 1SLJA 3I90A 1F9PA 2Z6KA 2B2TC 1Q12A 1A2UA 1TWAB 5CV5A 1PYSB 2F0KA 4NW2A 2EVBA 2A5HA 4KHZA 3S1MB 1Y14B 4IPHA 3FKIG 5EBCA 5J39A 1YBYA 5GQOA 2Y0SG 4RHSA 5I2YA 1QE6A 2QA4A 4DV2Q 5C4XB 1A15A 2ZM6Q 1RJTA 4JBKA 1XNQL 3S1QB 4XIGS 2A73B 3DWPA 4G7OC 1X54A 3G71A 3BDCA 2HT1A 2FMMA 1F77A 2E76C 4KMUC 1Q46A 5JAVA 4XT3B 1KL9A 4RMFA 2RBMA 3HG9A 3CCMA 3M3YH 4OO1H 3TBIB 4B3TQ 3HOZG 1X32A 1EYGA 3NSWA 1STHA 2PZUA 1Q1BA 2UXDL 1QWYA 2RA4A 1VQBA 2RCFA 4QL5A 3BYYB 3OWEB 2ZTDA 3RD4A 3HP3A 3CU7A 2D5DA 2KHIA 2XGTA 3DLLA 4Y52H 4UP9A 2DGYA 3UE0A 1CHQD 3S1NH 1VMCA 5I6YA 3A8IE 4IZ8A 3GV6A 3TZDA 1XPRA 3L9AX 3SK4A 2AQ3B 3D4DA 1PFBA 1WD1A 1HNWL 2EIFA 2K5NA 1VF5C 1HR0L 4KK7A 2JA6H 3EROA 2JA8H 4JI0Q 1KAWA 4DR3Q 3NBIA 2MP1A 5IP7H 1L1OB 4CGYB 2KOLA 3VDYA 2A68C 1GM5A 4LAAA 3MXNB 3STBD 4JOIC 2EYPA 1VQ7A 1E1OA 1TWHH 2F0UA 4A3GB 3J7AF 2OCEA 2F52A 5FO7B 4GOPA 4BY1B 2KCMA 2IX3A 1VQCA 1TY2A 2NVYH 3BZCA 4IQZA 5M5WH 5LMUL 3T1YL 3SK8A 2AMCB 1WTQA 4ALPA 5JEAJ 4BXXH 3PGZA 1PH8A 3SGIA 2D62A 2N88A 3AB9A 4B9WA 1PZJD 1ESRA 3SVMA 2GVBA 2K05A 1PXUA 3F1ZA 3OTOL 4DV7Q 2HQLA 3U9SA 1EEFD 1VQ4A 1WD0A 5IY0A 4TKOB 1YHQA 3CC2A 2BA0A 3IRBA 1S3OA 2QCPX 1MBYA 2I07B 4XQJA 3DUZA 3F8TA 3S14B 4R9WA 4CKEA 1M90C 1Y1WB 4HR7B 3H94A 1RHPA 2F3IA 4LF5L 3SDZA 1YIJA 1N33Q 4DV6L 1JE5A 4JI7L 2ASBA 2F3WA 1BF4A 3PSIA 4CJ1B 3GTMB 1MKHA 1RCVD 3S9WA 2JYOA 3PF4A 1SYGA 4FF3A 2PQEA 1ET6A 4BY1H 2QW7A 1JB3A 3KBGA 2B2UC 2NZHA 4X64Q 4G7HC 2JA7H 4QJFA 1KDCA 4JI5L 4C3IH 3CPWA 2FHTA 4B3ML 1TIID 1W6KA 4KI0A 1UE6A 2BE5D 1GHKA 1EFWA 1MHWC 2JA7G 5GAHC 1K9MC 1NSNS 4CHTB 3S24A 2VS1A 1S5BD 4DR6Q 3D4RA 2XRQD 3PQIA 3U4ZA 1ENAA 1I4HA 3CCUA 3AMUA 5FLMH 2GA4B 2IHEA 4LF9L 4NXMQ 5FJ8H 1I5FA 4YY3Q 4ZK9B 1XTDA 5HURA 2DJGC 1V1PB 4CDEC 4F8MA 4Z9CB 2A1AA 3CRKC 3R93A 3CCLA 2EE1A 3D31A 2PZTA 3HOWB 2VL6A 5JJKA 2JA5B 3ND8A 3JAML 1TS5A 4X62L 2VQFL 3E9HA 1VQIA 1B3QA 2A6ED 2UUCL 3KF8B 1ESFA 1EZ6A 3WOEA 2QGQA 2R93G 1UE7A 2G9HD 1NAPA 1ICWA 3JAME 1JICA 1SFOH 3E0JA 1EIGA 1GD7A 4K2KA 3HOUH 2WP8J 3DEOA 3OIPA 4OWWB 4IFDH 2E2JB 1CUKA 2K5DA 2EQSA 1EOTA 2K5WA 2CW0C 2JA5G 1PTOF 3MXPA 2XN9C 3V2TA 3OW2A 3UDXA 4HIMA 1SE2A 3MC0B 4KY6A 1B9MA 1LTID 1JJ2A 3SR1A 1HNZL 1MD2D 5IYBH 1C0AA 4JBMA 2WB1B 1QJOA 4RGTA 2D9UA 4IO9A 3GO5A 1IKMA 2HHHL 2DNCA 2Q8TA 4DXFA 1HZ9A 4KD4A 2A69C 3G4SA 1LTSD 4EQNA 1B3AA 1VQNA 3S2HH 5EKKA 5FLXE 2K4KA 3G7LA 2A69D 2RSOA 1A3VA 4O2DA 3TQYA 1IYJB 5M3FG 3P7JA 2H5XA 4HMIA 1GO3E 2EYFA 5C4HA 4DR2L 2D0OA 3GQBA 3HOUB 5E3FA 1FD7D 1BOSA 3CD6A 1BDOA 4C2MH 1G51A 3OOCA 3A0JA 4TSSA 1X56A 3P75A 1N36Q 1SNMA 3KDFA 1C7YA 3OHXC 2RQXA 3I91A 2JXMB 3FHWA 1XX8A 4ILWA 2EY5A 1O80A 4MHEA 1O78A 5T1IA 3S1RB 1KABA 4OONA 2PMZE 4A3MH 1Q7YC 4RA8A 2R93B 4JI6Q 2OEOA 4DK6C 5C4XH 4LF8L 4I7AA 4ZRZA 4YHHQ 4PMWA 4A3JB 3G48A 2CQOA 1YHBA 5IYCH 1VQ6A 1BXTA 3FKIH 4DR4Q 4OEMB 4HJ7A 2TMPA 3BS1A 5IWAQ 5IP9H 5HY6A 1BCPF 1G291 3I4MB 1N32Q 2F0HA 3M4PA 4GKJL 5CV7A 1K3BC 1K73C 5LMNQ 2KVMA 1PFNA 3IL8A 4K14A 3SE0A 5C5LA 5GAEC 3IAYA 4HIKA 4Q5VA 4ME3A 3TMEA 1Y1VB 5C5MA 5FO8B 1NBWA 2FINB 2VZAA 5C44B 3FDTA 4HN7A 1VQOA 4TQUS 1F2YA 2CVRA 1B9NA 4L5QA 2JSOA 4B08A 1CK1A 4AH6A 4XT1B 1F2ZA 1UUPA 4LFBL 1UEAB 4BWGB 1LLRD 1IBKL 3OMGA 4CJ2C 1L0YB 1FNVA 3QR8A 1MJEA 2SEBD 1HQMC 1PZKD 1DJRD 2AKWB 3HS0C 4FF4A 3BDOA 4A3IG 1JOOA 2WAQE 5M5XH 2KEDA 4B3TL 4A3BG 3PUWA 4PQXA 1SRUA 1HNZQ 1RODA 5AFWA 4C3HG 3QG1A 2ZTCA 3H0GG 1VQ5A 4ZAIA 4R1JA 2HCCA 3AYHB 4ZKCB 5IIFA 2ZXPA 3RMHA 1PH3A 4R4OA 3A7LA 4N9PA 3ER0A 4XYQA 1GUSA 4BY7B 4MIUA 5K36H 1XTCD 1PRTD 1I50B 4OXPA 1IL8A 4N8FA 4RFBA 1WTWA 3M4OH 1MGSA 4DF7A 1XNQQ 3H15A 3R2TA 1IBLL 1OXTA 1PH9A 3S17B 2A68D 4H13C 2CHBD 3K81C 2OWOA 2MO0A 4GLXA 2A6HD 4RWSC 4RH6A 2UXCL 2R7ZB 2CKZB 3NUCA 3OIQA 3KF8A 2RHQB 1OXVA 1A8VA 1K83B 4DUZL 4R4CA 2K33A 4KLKA 3NTIA 5KNDA 1M1KC 3Q23A 1PTOD 5IGGA 1EQQA 4KY5A 2DY8A 4FXDA 4K5VA 3WDNA 2VXWA 4OIKA 4LFAQ 4IJHA 5DM63 2M00A 2RDGA 1SN8A 2C35B 1GXDC 2XTIA 3QB3A 4KHPL 2PNHA 2OTLA 1D5ZC 2K52A 4WJWA 4DXGA 1YJNA 3BVMA 4ODGA 2F0GA 1FNWA 1RL2A 1O7ZA 1PFSA 4HJAA 2Z6BA 1EQVA 5FLXc 3A54A 3TS2A 1QILA 5C44H 1WYDA 5C4JB 1K8AC 1PH1A 2PO4A 1X3FA 3BDLA 3GTOB 2E2IH 3KK7A 1J6QA 3MEFA 1C4QA 1KLGD 5E4XA 4BBRH 2CQAA 3LWUA 4I65A 5IT9E 3E0EA 1B2TA 4LUVA 4BBSB 4JOIA 3J81i 1SFOB 2Z9HA 1NR2A 4C56C 3HKSA 5COYA 3CRLC 2G9DA 4C3JH 1Y8NB 2SNMA 1BCPB 4ZQ3A 1I4RA 1NY4A 2KHSA 4JPBW 2BH8A 2AWNA 4FO2A 1E22A 5T1GA 1NMFA 4IPGA 2EPBA 3KJPA 3I4LA 4B3MQ 4DK1A 2FMCA 1H9RA 1AH9A 2KHJA 2PQAB 1PV4A 1X3QA 2H1EA 4B3RQ 4BBRG 4KHVA 4GZYC 4IUVA 5F2DA 1A63A 2JQOA 4LK1C 4QIWB 1GUGA 5C3EH 4H44C 4G57A 2JA8B 1HZBA 4JI7Q 4P71A 3OTOQ 2RDFA 4X65L 3S1QH 5CORA 4LFBQ 4DV0Q 2F4IA 3FEWX 3L3OC 4PZ7A 1UEBA 3O13A 3PIP3 1MJCA 4RKBA 4LNQA 4LW1A 4TVAB 3RLOA 2UUBL 2AUKA 3RZDH 1V1OA 4GN5A 1Y69U 2PI2A 2B2VA 4DR1Q 2F0TA 5KIXA 5KEEA 2JEBI 4GNXB 1W6JA 3K8AA 1C8CA 1B50A 2LY7A 2NVXH 3E6ZX 4X3TA 3AQQA 5C4ZA 1LT3D 1A0IA 1VQJA 4JV5Q 1J8IA 3ULLA 5C44G 5JOBA 3LNNA 3FVQA 5IYDG 1VQ9A 4B3SQ 2YU9B 3VYSA 1HRJA 2HD3A 2X69A 1AZQA 1YJ9A 1Q3LA 2HCIA 2ZTEA 3KJOA 3CAMA 5DEHA 3QIAA 3HOXB 2NBFA 1IW7C 1R9TB 2B2VC 1KXLA 1WTPA 3PV0A 1TXYA 4L5SA 2VUMG 5BN5A 2D0PA 3PF5A 4WJ3M 2QDBA 4OELB 4YWMA 1SBBB 4O1NA 1J5EL 2R7FA 1IBKQ 4DV0L 2RCNA 4A3BH 4JI1Q 5I6WA 1EY6A 2UU9L 1TWAH 2KA7A 2FJ2A 3NELA 1X3PA 2BA1A 1EIYB 3PUXA 2B29A 2NVTH 3R2IA 3S1NB 2QKIC 2IPKD 1VS0A 1X3EA 2ENBA 1XWEA 3CMAA 2F0DA 3NQIA 3NTHA 4FXKC 1CFMA 1EY5A 2EDGA 1RF2D 4J8QA 1N32L 4KKUA 4HEDA 3F2BA 1TWHB 2XWBB 1AE2A 2AUJD 3BYTB 3NE5B 4LF6Q 4IFDI 4B9XA 2QDLA 4JG2A
chains in the Genus database with same CATH topology
1VQGA 1K9MC 4DR4L 2N78A 4X6AH 1SMXA 3S24A 2VS1A 3GTOH 2KBNA 4DR6Q 1IL2A 2E5LQ 4P75A 4A3KG 4BA2I 1XMOQ 4PZ8A 2R92G 1WCMG 1Q1EA 3U4ZA 3D0FA 5JEAG 3CCUA 4DR5Q 5FLMH 3Q8DA 1U0LA 2IHEA 2R7DA 4LF9L 4NXMQ 5IT9c 1N34L 2E2HH 2LXKA 5FJ8H 1I5FA 4YY3Q 3HOXH 1XTDA 4GNXC 1DGSA 4JYAQ 1L0WA 3F2CA 4IOCA 4GLVB 4GN3B 3HOXG 1V1QA 4IOAA 1YNXA 2YTYA 4XTCS 3PO2H 1YITA 1Z9FA 1Y1VG 3WWVA 2Q2IA 1TWFH 1C9OA 4JI2L 1FVIA 3KYHC 3PUZA 1N8RC 5HGQA 2A1AA 4UY8C 1I6HH 1KRTA 3PUYA 1E1TA 1K8GA 3CCLA 3D31A 3RNUA 2VL6A 5IE8A 5JJKA 2B3GA 4A3JH 2NVQH 2PI2E 3GTQH 4BBSG 3FP9A 1Y1WG 4AYBE 4X62L 2VQFL 4YWLA 5IYDH 3E9HA 1VQIA 2UUCL 4POFA 5IWAL 1NMGA 1SROA 2K14A 3KF8B 4JI4Q 1E3PA 2Y0SE 1QVCA 2QGQA 3RN5A 2ES2A 2R93G 1VCIA 1UE7A 4P73A 3PO3G 1KHIA 1XMOL 3CXCA 4NXNQ 1SFOH 2N3SA 2IX0A 2Q2TA 4P72A 4POGA 3HOYH 1GD7A 2E5LL 3HOUH 4DNIA 1IZ6A 1I3QH 1VQAA 2WP8J 4YCUA 3H0GH 4A3JG 1IBLQ 1RIPA 1O7IA 4OWWB 3CCRA 4DV4Q 2VQEQ 3NENA 1N34Q 4APVA 1CUKA 2EQSA 1VQLA 4A3IH 2A19A 2JA5G 1HZCA 3CQZH 3OW2A 1B7YB 3UE1A 3UDXA 4HIMA 4R4TA 3A5UA 1W2BA 1LUZA 3J81c 1NJIC 1VQEA 4OWTB 3JAMi 3KFUA 4JV5L 3NEMA 1JJ2A 3GTLH 2E2JH 4DR6L 3I56A 3CP0A 3ICEA 3G6EA 1HNZL 2WB1E 4JC0A 4A3DG 5IYBH 1C0AA 3CCJA 3S17H 3F2DA 1EOVA 4JBMA 1UE5A 1B70B 1WI5A 1TWCH 3I4NH 5IYBG 4IO9A 4DUYQ 1WCMH 2UUAL 3RR5A 3GO5A 2HHHL 1S72A 1L2FA 2CFMA 3BU2A 1VQDA 4A3KH 1HZ9A 1I94L 3S2DH 2EXDA 3B6YA 1P16A 4QY7A 3G4SA 3W1BA 1Q81C 1ASYA 1XJVA 4WJ4A 3H3VH 2UXBQ 5M3FH 2R7ZG 1VQNA 3S2HH 4UPAA 2N8NA 3CW2C 4JI1L 4JI4L 3L7ZC 4OWXB 2K4KA 4X64L 2JA5H 3S15H 2JEAI 4BA1I 4O2DA 4DR7Q 3TQYA 1IYJB 4X62Q 2YTVA 2VQFQ 5M3FG 2R7ZH 1CSQA 2H5XA 1QVFA 4IFDG 4HIDA 3KF6B 1GO3E 4PZ6A 3RN2A 1I94Q 2I5LX 2OQ0A 2FXQA 3CCEA 4DV2L 3HOYG 4DR2L 4DK3C 2D0OA 4NPSA 1ASZA 4LF7Q 1IXRA 3CD6A 1YEZA 5IP9G 4C2MH 2BH2A 1G51A 1XPUA 3U50C 3A0JA 1N36Q 1X56A 3DM3A 3ULJA 3KDFA 4DV7L 3HKZE 1J5EQ 4IJLA 1C7YA 3CMEA 3KDFB 5M3MH 3EBEA 1PH6A 4JYAL 4GKJQ 2OQKA 3FHWA 3PIOA 1PYBA 4HIOA 4BBSH 2UXDQ 2HIVA 1E7ZA 4X66L 4AQYQ 4LF9Q 4NXML 4MZ9A 4OONA 1CSPA 3K0XA 2PMZE 2ZJRA 1OXSC 4A3MH 1Q7YC 1BVSA 1HNXL 1D8LA 4JI6Q 2KENA 4OO1I 1VQHA 4DK6C 5C4XH 3PO2G 4LF8L 4GS3A 5C0XI 4YHHQ 3J81j 1EUJA 4PMWA 4NB3A 3HOUG 3G48A 3TRZA 5GAHC 2CQOA 1YHBA 5IYCH 1XMQQ 1VQ6A 1G6PA 3FKIH 5LMNL 4DR4Q 2HIXA 4JI6L 4A93G 4HJ7A 3PO3H 5AJ3L 4A3LG 4LFCQ 5IWAQ 5IP9H 4A3EH 4A3GH 1QVGA 5FLMG 4GNXA 5HY6A 3M4QA 2K50A 2R6GA 1G291 4IPCA 4LFCL 4A76A 1KC8C 3ZJYC 5AJ3Q 1N32Q 3M4PA 4YWKA 3AFPA 4GKJL 3EN2A 1KQSA 2JK8A 3KOJA 1K73C 1VQFA 2I0QA 5LMNQ 3LGJA 1YI2A 4R4QA 1FJGQ 1FL0A 1HH2P 3OYYA 1QUQB 5GAEC 4DV1L 2K5HA 4HJ5A 1X9NA 4HIKA 1UWVA 3GTJH 1VQPA 4ME3A 1HJPA 2I5HA 1YJWA 4GLAC 2RF4A 5ELOA 4LF7L 5K36G 4OX9Q 1NBWA 2VZAA 3KLWA 5C4JH 4A93H 3CC4A 1VQOA 4AQYL 4TQUS 4X66Q 2IHFA 3E9IA 3HKZG 5IYCG 1PH7A 4L5RC 1WOCA 4L5QA 5ELNA 2V1CC 4YY3L 4DPGA 3K80C 4AH6A 3I4NG 4DAYB 2Z0SA 1N33L 3S14H 4LFBL 4X65Q 2AWOA 2JA9A 4FDBA 1IBKL 4OO1G 4DR5L 4A3MG 2KCTA 2YV5A 1Q82C 4UP7A 4LFAL 1MJEA 5LMNW 2CCZA 3I55A 4J15A 1PH2A 4A3DH 1GKHA 3K7UC 2HHHQ 2F4VL 2AKWB 4JI3L 1KIXA 3EIVA 4PG3A 3RLNA 3I4MH 4IFDJ 2F4VQ 1MIUA 1V43A 3HOVG 1T9HA 4A3IG 4K0KL 2WAQE 5M5XH 4B3TL 4A3BG 1CKOA 3PUWA 3CF5A 3ULPA 4A3FH 3A74A 2YYZA 4LUOA 1SRUA 3J80c 1YZ6A 1HNZQ 4R4IA 2IT1A 1HZAA 2E8GA 3H0GG 2L15A 2CWPA 2ZTCA 3S1RH 4P74A 1Q86C 1PA6A 1VQ5A 3S16H 3BJUA 4R1JA 3AYHB 4JI5Q 3STBC 4A3CG 4B3SL 3TS0A 1OXUA 5LMUQ 1PH3A 1WJJA 4C3HH 4R4OA 5JJLA 1JJGA 5BR8L 2R93H 3ER0A 1TWGH 4DV4L 2MFIA 4OXPA 3GD7A 3M4OH 1NTGA 1QZGA 3H15A 1IBLL 1XNQQ 1OXTA 3L2PA 1PH9A 4DV1Q 3JAMc 1FJGL 1AE3A 5BR8Q 3K81C 3TREA 4QQBX 2OWOA 2MO0A 2Q2UA 4GKKQ 4GLXA 2IY5B 1XNRL 2UXCL 1L1OC 3ERSX 1JT8A 4DV6Q 4DR1L 3T1HL 2CKZB 4YCVA 3GDEA 4A3EG 2YU9H 2RHQB 4LF5Q 1PVOA 1OXVA 1Y1VH 2PQAA 1A8VA 1CKMA 4DUZL 4R4CA 4UP8A 1IBML 3RLFA 4KLKA 2ZM6L 2B63G 1M1KC 3K7AH 4GN4B 3HOWH 4BY7G 1EQQA 4JI0L 1Q8KA 1XMQL 3M85A 4KHPQ 1LYLA 3J7ZC 5FJ8G 2GVAA 1HR0Q 1LM0A 1X6OA 5C4XG 4LFAQ 5M5YH 3UDGA 3CCVA 4HJ8A 1VQMA 4IJHA 3W5OA 1CKNA 1VQKA 2MNAA 4AIMA 1SN8A 2C35B 5C0XJ 2R92H 2XTIA 4Y7NH 1CKNB 4KHPL 2PNHA 1BBUA 2OTLA 2CWAA 4LF4Q 2K52A 1SLJA 4GOPC 1YJNA 4BXXG 5IP7G 2Z6KA 3T1YQ 1EIFA 4MNOA 1RL2A 1Q12A 1PFSA 4HJAA 1PYSB 5FLXc 3TS2A 2Z6KC 4KHZA 5GROA 5C44H 1SE8A 1WYDA 1X65A 1K83H 1Y14B 3FKIG 4IPHA 1K8AC 1XNRQ 4A3CH 1PH1A 4GKKL 1YBYA 5GQOA 1X3FA 2LXJA 2Y0SG 3PCOB 3PIPA 2QA4A 4DV2Q 1WFQA 2K75A 2E2IH 1J6QA 3MEFA 2ZM6Q 3CCQA 4JBKA 1JJCB 1U5KA 1XNQL 4XIGS 4BBRH 3PUVA 4DUZQ 1X54A 4A3FG 1H95A 2N49A 3G71A 1KRSA 3E0EA 4DV5Q 2HT1A 4LUVA 4JOIA 3J81i 2UXCQ 1YVCA 5H1SE 2IX1A 2ATWA 3I4MG 3HKSA 1Q46A 4DR3L 4BY7H 4C3JH 3CC7A 2JA6G 1KL9A 2DUDA 4YHHL 4DUYL 4RMFA 4LF8Q 1NY4A 5E7NA 3CCMA 3M3YH 1X55A 2BH8A 2AWNA 3HOZH 4B3TQ 3HOZG 3I4OA 4O0AA 4JI8L 4EQ5A 1E22A 1HNXQ 2A8VA 2VNUD 1EYGA 4K0KQ 1NMFA 3KF6A 4IPGA 3S1MH 1W3SA 1PHJA 3KJPA 4JI3Q 1Q1BA 1Z47A 5EAYA 2VW9A 4B3MQ 2UXDL 1AH9A 2KHJA 2PQAB 1K3RA 1PV4A 1VQBA 4B3RL 4QL5A 2ZTDA 4EX5A 4QGUA 4B3RQ 2KHIA 2XGTA 2VQEL 3DLLA 4BBRG 4Y52H 1FGUA 4QIWE 4LUZA 4UP9A 2DGYA 3UE0A 1A63A 3S1NH 1X3GA 4DKAC 2JQOA 2ZJPA 3J7A5 3I7FA 5C3EH 2WB1G 1XPRA 4NXNL 3CPFA 3AFQA 1HNWL 1HZBA 2AHOB 2EIFA 2LSSA 1EQRA 2K5NA 4P71A 3OTOQ 1S40A 4AYBG 1HR0L 4JI7Q 4BY1G 4DR7L 4X65L 4JBWA 3S1QH 4LFBQ 2JA6H 4DV0Q 4LWCA 5JJIA 2JA8H 4PZ7A 1UEBA 4JI0Q 1KAWA 4DR3Q 1Y1WH 3M9BA 5IP7H 1L1OB 1MJCA 2WAQG 3UDFA 4L5TA 4LNQA 2Q2HA 3L0OA 3VDYA 4LW1A 4TVAB 1GM5A 3RLOA 3GTGH 2QEXA 3MXNB 1QUQA 3RZDH 1XPOA 2UUBL 4OX9L 4GN5A 2GN5A 2PI2A 3STBD 3CCSA 4DR1Q 4JOIC 3GTPH 1VQ7A 2MQHA 1E1OA 1TWHH 2NN6I 4JI2Q 2JEBI 1A62A 5GAGC 1R9TH 4GNXB 3J80i 3K8AA 2NVXH 1I50H 2OCEA 3TEHB 3HFZB 3AQQA 2F52A 5M3MG 3M7NA 1A0IA 1VQJA 2B63H 4DAMA 4GOPA 1NE3A 1PH5A 4JV5Q 2KCMA 3ULLA 5C44G 1VQCA 3H3VI 2NVYH 4RG1A 2WFWA 3BZCA 1E24A 1PH4A 3A5ZB 2UUBQ 3U4VA 3AEVA 1BKBA 5M5WH 5IYDG 1SR3A 5LMUL 1VQ9A 4B3SQ 3T1YL 2AMCB 4ALPA 5JEAJ 1GVPA 4BXXH 3PGZA 4LF4L 1OTCA 1PH8A 1D7QA 3SGIA 2D62A 1YJ9A 2ZTEA 3JC66 3KJOA 1VQ8A 2GVBA 3CAMA 3F1ZA 3OTOL 4DV7Q 2HQLA 1JB7A 3UDIA 1QZHA 4A3GG 1HR0W 1KXLA 2I5MX 1VQ4A 5IY0A 1YHQA 3CC2A 4A3LH 3W1GA 4LF6L 2UUCQ 2BA0A 3IRBA 3PV0A 4JBJA 4IPDA 5DLQE 4DR2Q 1S3OA 1TXYA 4L5SA 2OTJA 2VUMG 1BBWA 3HOWG 2D0PA 3F8TA 1L1OA 3PF5A 4WJ3M 1B8AA 2ALYB 4YWMA 1IBMQ 3RZOH 1M90C 5C0XG 1LTLA 2YTXA 2VY3A 1V9PA 2R7FA 1J5EL 1IBKQ 1JMCA 4LF5L 2F3IA 4DV0L 1N36L 2NN6G 1YIJA 1N33Q 1EWIA 2RCNA 4MTNA 4DV6L 3T1HQ 4JI1Q 2NZOA 4A3BH 1JE5A 4JCVE 4JI7L 2ASBA 1YHAA 3NBHB 3HOVH 2UU9L 1TWAH 3NELA 3PSIA 1HNWQ 2BA1A 4DV3L 1EIYB 2K5VA 1KD1C 4H02A 3PUXA 2B29A 1MKHA 3U58A 2NVTH 1P8LA 4DV3Q 3PF4A 2UUAQ 4JI8Q 2JA8G 2UU9Q 2JE6I 4GOPB 1VS0A 3GTKH 4BY1H 4A75A 1X3EA 2RHSB 1K0RA 3I2ZA 5J3BA 2JJQA 3CMAA 2NZHA 4X64Q 2JA7H 4QJFA 4YCWA 1N9WA 2ZJQA 2UXBL 4JI5L 4C3IH 5C3EG 5GADC 3CPWA 1N32L 3GTMH 4B3ML 4HJ9A 2VUMH 2ID0A 3BZKA 3F2BA 4A4IA 1OXXK 4DV5L 1UE6A 4KI0A 1AE2A 1EFWA 2JA7G 4LF6Q 4IFDI 2MO1A 1UE1A 4JG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQG A;  1K9M C;  4DR4 L;  2N78 A;  4X6A H;  1SMX A;  3S24 A;  2VS1 A;  3GTO H;  2KBN A;  4DR6 Q;  1IL2 A;  2E5L Q;  4P75 A;  4A3K G;  4BA2 I;  1XMO Q;  4PZ8 A;  2R92 G;  1WCM G;  1Q1E A;  3U4Z A;  3D0F A;  5JEA G;  3CCU A;  4DR5 Q;  5FLM H;  3Q8D A;  1U0L A;  2IHE A;  2R7D A;  4LF9 L;  4NXM Q;  5IT9 c;  1N34 L;  2E2H H;  2LXK A;  5FJ8 H;  1I5F A;  4YY3 Q;  3HOX H;  1XTD A;  4GNX C;  1DGS A;  4JYA Q;  1L0W A;  3F2C A;  4IOC A;  4GLV B;  4GN3 B;  3HOX G;  1V1Q A;  4IOA A;  1YNX A;  2YTY A;  4XTC S;  3PO2 H;  1YIT A;  1Z9F A;  1Y1V G;  3WWV A;  2Q2I A;  1TWF H;  1C9O A;  4JI2 L;  1FVI A;  3KYH C;  3PUZ A;  1N8R C;  5HGQ A;  2A1A A;  4UY8 C;  1I6H H;  1KRT A;  3PUY A;  1E1T A;  1K8G A;  3CCL A;  3D31 A;  3RNU A;  2VL6 A;  5IE8 A;  5JJK A;  2B3G A;  4A3J H;  2NVQ H;  2PI2 E;  3GTQ H;  4BBS G;  3FP9 A;  1Y1W G;  4AYB E;  4X62 L;  2VQF L;  4YWL A;  5IYD H;  3E9H A;  1VQI A;  2UUC L;  4POF A;  5IWA L;  1NMG A;  1SRO A;  2K14 A;  3KF8 B;  4JI4 Q;  1E3P A;  2Y0S E;  1QVC A;  2QGQ A;  3RN5 A;  2ES2 A;  2R93 G;  1VCI A;  1UE7 A;  4P73 A;  3PO3 G;  1KHI A;  1XMO L;  3CXC A;  4NXN Q;  1SFO H;  2N3S A;  2IX0 A;  2Q2T A;  4P72 A;  4POG A;  3HOY H;  1GD7 A;  2E5L L;  3HOU H;  4DNI A;  1IZ6 A;  1I3Q H;  1VQA A;  2WP8 J;  4YCU A;  3H0G H;  4A3J G;  1IBL Q;  1RIP A;  1O7I A;  4OWW B;  3CCR A;  4DV4 Q;  2VQE Q;  3NEN A;  1N34 Q;  4APV A;  1CUK A;  2EQS A;  1VQL A;  4A3I H;  2A19 A;  2JA5 G;  1HZC A;  3CQZ H;  3OW2 A;  1B7Y B;  3UE1 A;  3UDX A;  4HIM A;  4R4T A;  3A5U A;  1W2B A;  1LUZ A;  3J81 c;  1NJI C;  1VQE A;  4OWT B;  3JAM i;  3KFU A;  4JV5 L;  3NEM A;  1JJ2 A;  3GTL H;  2E2J H;  4DR6 L;  3I56 A;  3CP0 A;  3ICE A;  3G6E A;  1HNZ L;  2WB1 E;  4JC0 A;  4A3D G;  5IYB H;  1C0A A;  3CCJ A;  3S17 H;  3F2D A;  1EOV A;  4JBM A;  1UE5 A;  1B70 B;  1WI5 A;  1TWC H;  3I4N H;  5IYB G;  4IO9 A;  4DUY Q;  1WCM H;  2UUA L;  3RR5 A;  3GO5 A;  2HHH L;  1S72 A;  1L2F A;  2CFM A;  3BU2 A;  1VQD A;  4A3K H;  1HZ9 A;  1I94 L;  3S2D H;  2EXD A;  3B6Y A;  1P16 A;  4QY7 A;  3G4S A;  3W1B A;  1Q81 C;  1ASY A;  1XJV A;  4WJ4 A;  3H3V H;  2UXB Q;  5M3F H;  2R7Z G;  1VQN A;  3S2H H;  4UPA A;  2N8N A;  3CW2 C;  4JI1 L;  4JI4 L;  3L7Z C;  4OWX B;  2K4K A;  4X64 L;  2JA5 H;  3S15 H;  2JEA I;  4BA1 I;  4O2D A;  4DR7 Q;  3TQY A;  1IYJ B;  4X62 Q;  2YTV A;  2VQF Q;  5M3F G;  2R7Z H;  1CSQ A;  2H5X A;  1QVF A;  4IFD G;  4HID A;  3KF6 B;  1GO3 E;  4PZ6 A;  3RN2 A;  1I94 Q;  2I5L X;  2OQ0 A;  2FXQ A;  3CCE A;  4DV2 L;  3HOY G;  4DR2 L;  4DK3 C;  2D0O A;  4NPS A;  1ASZ A;  4LF7 Q;  1IXR A;  3CD6 A;  1YEZ A;  5IP9 G;  4C2M H;  2BH2 A;  1G51 A;  1XPU A;  3U50 C;  3A0J A;  1N36 Q;  1X56 A;  3DM3 A;  3ULJ A;  3KDF A;  4DV7 L;  3HKZ E;  1J5E Q;  4IJL A;  1C7Y A;  3CME A;  3KDF B;  5M3M H;  3EBE A;  1PH6 A;  4JYA L;  4GKJ Q;  2OQK A;  3FHW A;  3PIO A;  1PYB A;  4HIO A;  4BBS H;  2UXD Q;  2HIV A;  1E7Z A;  4X66 L;  4AQY Q;  4LF9 Q;  4NXM L;  4MZ9 A;  4OON A;  1CSP A;  3K0X A;  2PMZ E;  2ZJR A;  1OXS C;  4A3M H;  1Q7Y C;  1BVS A;  1HNX L;  1D8L A;  4JI6 Q;  2KEN A;  4OO1 I;  1VQH A;  4DK6 C;  5C4X H;  3PO2 G;  4LF8 L;  4GS3 A;  5C0X I;  4YHH Q;  3J81 j;  1EUJ A;  4PMW A;  4NB3 A;  3HOU G;  3G48 A;  3TRZ A;  5GAH C;  2CQO A;  1YHB A;  5IYC H;  1XMQ Q;  1VQ6 A;  1G6P A;  3FKI H;  5LMN L;  4DR4 Q;  2HIX A;  4JI6 L;  4A93 G;  4HJ7 A;  3PO3 H;  5AJ3 L;  4A3L G;  4LFC Q;  5IWA Q;  5IP9 H;  4A3E H;  4A3G H;  1QVG A;  5FLM G;  4GNX A;  5HY6 A;  3M4Q A;  2K50 A;  2R6G A;  1G29 1;  4IPC A;  4LFC L;  4A76 A;  1KC8 C;  3ZJY C;  5AJ3 Q;  1N32 Q;  3M4P A;  4YWK A;  3AFP A;  4GKJ L;  3EN2 A;  1KQS A;  2JK8 A;  3KOJ A;  1K73 C;  1VQF A;  2I0Q A;  5LMN Q;  3LGJ A;  1YI2 A;  4R4Q A;  1FJG Q;  1FL0 A;  1HH2 P;  3OYY A;  1QUQ B;  5GAE C;  4DV1 L;  2K5H A;  4HJ5 A;  1X9N A;  4HIK A;  1UWV A;  3GTJ H;  1VQP A;  4ME3 A;  1HJP A;  2I5H A;  1YJW A;  4GLA C;  2RF4 A;  5ELO A;  4LF7 L;  5K36 G;  4OX9 Q;  1NBW A;  2VZA A;  3KLW A;  5C4J H;  4A93 H;  3CC4 A;  1VQO A;  4AQY L;  4TQU S;  4X66 Q;  2IHF A;  3E9I A;  3HKZ G;  5IYC G;  1PH7 A;  4L5R C;  1WOC A;  4L5Q A;  5ELN A;  2V1C C;  4YY3 L;  4DPG A;  3K80 C;  4AH6 A;  3I4N G;  4DAY B;  2Z0S A;  1N33 L;  3S14 H;  4LFB L;  4X65 Q;  2AWO A;  2JA9 A;  4FDB A;  1IBK L;  4OO1 G;  4DR5 L;  4A3M G;  2KCT A;  2YV5 A;  1Q82 C;  4UP7 A;  4LFA L;  1MJE A;  5LMN W;  2CCZ A;  3I55 A;  4J15 A;  1PH2 A;  4A3D H;  1GKH A;  3K7U C;  2HHH Q;  2F4V L;  2AKW B;  4JI3 L;  1KIX A;  3EIV A;  4PG3 A;  3RLN A;  3I4M H;  4IFD J;  2F4V Q;  1MIU A;  1V43 A;  3HOV G;  1T9H A;  4A3I G;  4K0K L;  2WAQ E;  5M5X H;  4B3T L;  4A3B G;  1CKO A;  3PUW A;  3CF5 A;  3ULP A;  4A3F H;  3A74 A;  2YYZ A;  4LUO A;  1SRU A;  3J80 c;  1YZ6 A;  1HNZ Q;  4R4I A;  2IT1 A;  1HZA A;  2E8G A;  3H0G G;  2L15 A;  2CWP A;  2ZTC A;  3S1R H;  4P74 A;  1Q86 C;  1PA6 A;  1VQ5 A;  3S16 H;  3BJU A;  4R1J A;  3AYH B;  4JI5 Q;  3STB C;  4A3C G;  4B3S L;  3TS0 A;  1OXU A;  5LMU Q;  1PH3 A;  1WJJ A;  4C3H H;  4R4O A;  5JJL A;  1JJG A;  5BR8 L;  2R93 H;  3ER0 A;  1TWG H;  4DV4 L;  2MFI A;  4OXP A;  3GD7 A;  3M4O H;  1NTG A;  1QZG A;  3H15 A;  1IBL L;  1XNQ Q;  1OXT A;  3L2P A;  1PH9 A;  4DV1 Q;  3JAM c;  1FJG L;  1AE3 A;  5BR8 Q;  3K81 C;  3TRE A;  4QQB X;  2OWO A;  2MO0 A;  2Q2U A;  4GKK Q;  4GLX A;  2IY5 B;  1XNR L;  2UXC L;  1L1O C;  3ERS X;  1JT8 A;  4DV6 Q;  4DR1 L;  3T1H L;  2CKZ B;  4YCV A;  3GDE A;  4A3E G;  2YU9 H;  2RHQ B;  4LF5 Q;  1PVO A;  1OXV A;  1Y1V H;  2PQA A;  1A8V A;  1CKM A;  4DUZ L;  4R4C A;  4UP8 A;  1IBM L;  3RLF A;  4KLK A;  2ZM6 L;  2B63 G;  1M1K C;  3K7A H;  4GN4 B;  3HOW H;  4BY7 G;  1EQQ A;  4JI0 L;  1Q8K A;  1XMQ L;  3M85 A;  4KHP Q;  1LYL A;  3J7Z C;  5FJ8 G;  2GVA A;  1HR0 Q;  1LM0 A;  1X6O A;  5C4X G;  4LFA Q;  5M5Y H;  3UDG A;  3CCV A;  4HJ8 A;  1VQM A;  4IJH A;  3W5O A;  1CKN A;  1VQK A;  2MNA A;  4AIM A;  1SN8 A;  2C35 B;  5C0X J;  2R92 H;  2XTI A;  4Y7N H;  1CKN B;  4KHP L;  2PNH A;  1BBU A;  2OTL A;  2CWA A;  4LF4 Q;  2K52 A;  1SLJ A;  4GOP C;  1YJN A;  4BXX G;  5IP7 G;  2Z6K A;  3T1Y Q;  1EIF A;  4MNO A;  1RL2 A;  1Q12 A;  1PFS A;  4HJA A;  1PYS B;  5FLX c;  3TS2 A;  2Z6K C;  4KHZ A;  5GRO A;  5C44 H;  1SE8 A;  1WYD A;  1X65 A;  1K83 H;  1Y14 B;  3FKI G;  4IPH A;  1K8A C;  1XNR Q;  4A3C H;  1PH1 A;  4GKK L;  1YBY A;  5GQO A;  1X3F A;  2LXJ A;  2Y0S G;  3PCO B;  3PIP A;  2QA4 A;  4DV2 Q;  1WFQ A;  2K75 A;  2E2I H;  1J6Q A;  3MEF A;  2ZM6 Q;  3CCQ A;  4JBK A;  1JJC B;  1U5K A;  1XNQ L;  4XIG S;  4BBR H;  3PUV A;  4DUZ Q;  1X54 A;  4A3F G;  1H95 A;  2N49 A;  3G71 A;  1KRS A;  3E0E A;  4DV5 Q;  2HT1 A;  4LUV A;  4JOI A;  3J81 i;  2UXC Q;  1YVC A;  5H1S E;  2IX1 A;  2ATW A;  3I4M G;  3HKS A;  1Q46 A;  4DR3 L;  4BY7 H;  4C3J H;  3CC7 A;  2JA6 G;  1KL9 A;  2DUD A;  4YHH L;  4DUY L;  4RMF A;  4LF8 Q;  1NY4 A;  5E7N A;  3CCM A;  3M3Y H;  1X55 A;  2BH8 A;  2AWN A;  3HOZ H;  4B3T Q;  3HOZ G;  3I4O A;  4O0A A;  4JI8 L;  4EQ5 A;  1E22 A;  1HNX Q;  2A8V A;  2VNU D;  1EYG A;  4K0K Q;  1NMF A;  3KF6 A;  4IPG A;  3S1M H;  1W3S A;  1PHJ A;  3KJP A;  4JI3 Q;  1Q1B A;  1Z47 A;  5EAY A;  2VW9 A;  4B3M Q;  2UXD L;  1AH9 A;  2KHJ A;  2PQA B;  1K3R A;  1PV4 A;  1VQB A;  4B3R L;  4QL5 A;  2ZTD A;  4EX5 A;  4QGU A;  4B3R Q;  2KHI A;  2XGT A;  2VQE L;  3DLL A;  4BBR G;  4Y52 H;  1FGU A;  4QIW E;  4LUZ A;  4UP9 A;  2DGY A;  3UE0 A;  1A63 A;  3S1N H;  1X3G A;  4DKA C;  2JQO A;  2ZJP A;  3J7A 5;  3I7F A;  5C3E H;  2WB1 G;  1XPR A;  4NXN L;  3CPF A;  3AFQ A;  1HNW L;  1HZB A;  2AHO B;  2EIF A;  2LSS A;  1EQR A;  2K5N A;  4P71 A;  3OTO Q;  1S40 A;  4AYB G;  1HR0 L;  4JI7 Q;  4BY1 G;  4DR7 L;  4X65 L;  4JBW A;  3S1Q H;  4LFB Q;  2JA6 H;  4DV0 Q;  4LWC A;  5JJI A;  2JA8 H;  4PZ7 A;  1UEB A;  4JI0 Q;  1KAW A;  4DR3 Q;  1Y1W H;  3M9B A;  5IP7 H;  1L1O B;  1MJC A;  2WAQ G;  3UDF A;  4L5T A;  4LNQ A;  2Q2H A;  3L0O A;  3VDY A;  4LW1 A;  4TVA B;  1GM5 A;  3RLO A;  3GTG H;  2QEX A;  3MXN B;  1QUQ A;  3RZD H;  1XPO A;  2UUB L;  4OX9 L;  4GN5 A;  2GN5 A;  2PI2 A;  3STB D;  3CCS A;  4DR1 Q;  4JOI C;  3GTP H;  1VQ7 A;  2MQH A;  1E1O A;  1TWH H;  2NN6 I;  4JI2 Q;  2JEB I;  1A62 A;  5GAG C;  1R9T H;  4GNX B;  3J80 i;  3K8A A;  2NVX H;  1I50 H;  2OCE A;  3TEH B;  3HFZ B;  3AQQ A;  2F52 A;  5M3M G;  3M7N A;  1A0I A;  1VQJ A;  2B63 H;  4DAM A;  4GOP A;  1NE3 A;  1PH5 A;  4JV5 Q;  2KCM A;  3ULL A;  5C44 G;  1VQC A;  3H3V I;  2NVY H;  4RG1 A;  2WFW A;  3BZC A;  1E24 A;  1PH4 A;  3A5Z B;  2UUB Q;  3U4V A;  3AEV A;  1BKB A;  5M5W H;  5IYD G;  1SR3 A;  5LMU L;  1VQ9 A;  4B3S Q;  3T1Y L;  2AMC B;  4ALP A;  5JEA J;  1GVP A;  4BXX H;  3PGZ A;  4LF4 L;  1OTC A;  1PH8 A;  1D7Q A;  3SGI A;  2D62 A;  1YJ9 A;  2ZTE A;  3JC6 6;  3KJO A;  1VQ8 A;  2GVB A;  3CAM A;  3F1Z A;  3OTO L;  4DV7 Q;  2HQL A;  1JB7 A;  3UDI A;  1QZH A;  4A3G G;  1HR0 W;  1KXL A;  2I5M X;  1VQ4 A;  5IY0 A;  1YHQ A;  3CC2 A;  4A3L H;  3W1G A;  4LF6 L;  2UUC Q;  2BA0 A;  3IRB A;  3PV0 A;  4JBJ A;  4IPD A;  5DLQ E;  4DR2 Q;  1S3O A;  1TXY A;  4L5S A;  2OTJ A;  2VUM G;  1BBW A;  3HOW G;  2D0P A;  3F8T A;  1L1O A;  3PF5 A;  4WJ3 M;  1B8A A;  2ALY B;  4YWM A;  1IBM Q;  3RZO H;  1M90 C;  5C0X G;  1LTL A;  2YTX A;  2VY3 A;  1V9P A;  2R7F A;  1J5E L;  1IBK Q;  1JMC A;  4LF5 L;  2F3I A;  4DV0 L;  1N36 L;  2NN6 G;  1YIJ A;  1N33 Q;  1EWI A;  2RCN A;  4MTN A;  4DV6 L;  3T1H Q;  4JI1 Q;  2NZO A;  4A3B H;  1JE5 A;  4JCV E;  4JI7 L;  2ASB A;  1YHA A;  3NBH B;  3HOV H;  2UU9 L;  1TWA H;  3NEL A;  3PSI A;  1HNW Q;  2BA1 A;  4DV3 L;  1EIY B;  2K5V A;  1KD1 C;  4H02 A;  3PUX A;  2B29 A;  1MKH A;  3U58 A;  2NVT H;  1P8L A;  4DV3 Q;  3PF4 A;  2UUA Q;  4JI8 Q;  2JA8 G;  2UU9 Q;  2JE6 I;  4GOP B;  1VS0 A;  3GTK H;  4BY1 H;  4A75 A;  1X3E A;  2RHS B;  1K0R A;  3I2Z A;  5J3B A;  2JJQ A;  3CMA A;  2NZH A;  4X64 Q;  2JA7 H;  4QJF A;  4YCW A;  1N9W A;  2ZJQ A;  2UXB L;  4JI5 L;  4C3I H;  5C3E G;  5GAD C;  3CPW A;  1N32 L;  3GTM H;  4B3M L;  4HJ9 A;  2VUM H;  2ID0 A;  3BZK A;  3F2B A;  4A4I A;  1OXX K;  4DV5 L;  1UE6 A;  4KI0 A;  1AE2 A;  1EFW A;  2JA7 G;  4LF6 Q;  4IFD I;  2MO1 A;  1UE1 A;  4JG2 A; 
#chains in the Genus database with same CATH topology
 1HCZ A;  4WFN 3;  1DON A;  1SND A;  2N78 A;  5L37 A;  1AW7 A;  3HOV B;  2E5L Q;  3CKI B;  1SNQ A;  1R4P B;  4P75 A;  3C1F A;  1IW7 D;  1Q1E A;  3I72 A;  3Q8D A;  4K8J A;  1BCP C;  2R7D A;  3M4O B;  5IT9 c;  5I4D A;  1KTK A;  1STY A;  1HHV A;  1D1I A;  4GNX C;  4JYA Q;  3PO3 B;  3T53 B;  4IOA A;  3QWN A;  1Y1V G;  1KAA A;  1F9Q A;  3WWV A;  1C9O A;  1N8R C;  1TWG B;  4UAI A;  1KNA A;  5IGE A;  4AYB B;  1EU4 A;  3PUY A;  1K8G A;  3OPO A;  1S5E D;  3N6R A;  2B3G A;  2DY7 A;  1SYE A;  4I7Z C;  1Y1W G;  3MXU A;  5M5Y B;  3M3Y B;  5IWA L;  1SRO A;  2MHV A;  4QUC A;  1BBX C;  1U4M A;  1E3P A;  2B8F A;  2HQE A;  3RN5 A;  2ES2 A;  3EQL C;  1JWM D;  4OL7 A;  4P73 A;  5FKA C;  1KHI A;  2F03 A;  1XMO L;  4RCO A;  2L9H A;  4NXN Q;  2IX0 A;  4C3I G;  4DNI A;  4YCU A;  3NPP A;  3RUZ A;  1STE A;  4DV4 Q;  2VQE Q;  2K1B A;  5IOD A;  4APV A;  1SMY D;  3KBX A;  1HZC A;  4LMQ D;  3Q24 A;  4R4T A;  4ZCK A;  3TP6 A;  1EWH A;  1LUZ A;  1HPC A;  2E2J H;  4DR6 L;  3I56 A;  4A3D G;  3ICE A;  1ILP A;  3A56 A;  1HQR D;  3VYU A;  4EVO A;  2K32 A;  3F2D A;  2B2U A;  1L0X B;  2CH4 A;  2OT2 A;  5IYB G;  4DUY Q;  1WCM H;  2RVL A;  2CFM A;  1VQD A;  1ZYR C;  1EIH A;  4A3K H;  3S2D H;  3OMC A;  1GOZ A;  1H9K A;  1RTO A;  1CZG A;  5EPK A;  4CBV A;  4DAV A;  1XJV A;  4WJ4 A;  4IUT A;  5M3F H;  4ZUI A;  1O7L A;  3CW2 C;  2JA5 H;  1QOH A;  5CR3 A;  5CBA E;  5DNF A;  4X62 Q;  2VQF Q;  3W2D A;  1CSQ A;  4DFA A;  4IFD G;  4U68 A;  3KF6 B;  2OQ0 A;  3CCE A;  1EZ8 A;  1CQV A;  1ASZ A;  1DZ1 A;  1IXR A;  4MN3 A;  1F9S A;  2R3Z A;  1ONL A;  3BZD B;  4R8N A;  4QF4 A;  3NWT A;  1J5E Q;  1CA6 A;  4IJL A;  1STN A;  1PH6 A;  4JYA L;  5J22 A;  2OQK A;  3PIO A;  4HIO A;  1PYB A;  4X3K A;  1M8A A;  4J1M A;  4LF9 Q;  1F2L A;  4NXM L;  5BN4 A;  2F1M A;  2WV6 D;  4J6H A;  1CA5 A;  2ZJR A;  1OXS C;  1HNX L;  1D8L A;  5JVG 3;  2KEN A;  4OO1 I;  1VQH A;  1CM9 A;  3S15 B;  3FKI B;  3MA2 B;  4GS3 A;  5C0X I;  4KKT A;  3HOU G;  1EUJ A;  4NB3 A;  1G6P A;  5LMN L;  4A3K B;  4A93 G;  1ML0 D;  1SNC A;  1DYQ A;  4JK1 C;  2M2L A;  5JVH 3;  3K58 A;  1QVG A;  5FLM G;  4GNX A;  1IHZ A;  2EYL A;  4IPC A;  4LFC L;  1KC8 C;  1F2M A;  1BCP D;  1KQS A;  3I70 A;  1YI2 A;  3E3X A;  2PZW A;  1FJG Q;  1FL0 A;  1HH2 P;  3OYY A;  1QUQ B;  2IW3 A;  4DAY A;  1G6Z A;  2F0N A;  3GTJ H;  3GTG B;  1GUW A;  1PYW D;  1YJW A;  1WTX A;  4PNY A;  4LF7 L;  1SE4 A;  3KLW A;  4QUF A;  4A93 H;  2DNE A;  3E9I A;  3HKZ G;  3T16 A;  3UI2 A;  2DN8 A;  1TS2 A;  2V1C C;  4L8J A;  4HMJ A;  4DAY B;  3NK9 A;  4X65 Q;  2AWO A;  4FYD A;  3A7A B;  1D5M C;  4OO1 G;  1Q82 C;  4ZKB B;  4A3D H;  1D5X C;  3J7A V;  1GKH A;  1UAP A;  2F4V L;  4JI3 L;  3EIV A;  2V4D A;  2PNR C;  4PG3 A;  3RLN A;  1BNZ A;  3H3V C;  5TSS A;  3M7G A;  4IFD J;  1MIU A;  5FOB B;  4K0K L;  1T9H A;  1CHP D;  1PTO H;  3CF5 A;  3ULP A;  3IFT A;  3K59 A;  1HZA A;  2CWP A;  2KEE A;  3S1R H;  2KCC A;  5IT9 L;  3BJU A;  1QNK A;  1ZEQ X;  2L55 A;  4JI5 Q;  3STB C;  4B3S L;  3TS0 A;  1OXU A;  5LMU Q;  1JJG A;  3MTS A;  5BR8 L;  1TWG H;  1SXT A;  3T13 A;  3FRP B;  1Q8I A;  3TDQ A;  3L2P A;  4DV1 Q;  2EYH A;  5EKL A;  3I8Z A;  4F88 A;  3FPU B;  4QQB X;  2KQ3 A;  2Q2U A;  4GKK Q;  3H09 A;  1GUT A;  2IY5 B;  1XNR L;  1NUC A;  4DR1 L;  5HGT A;  4A3E G;  4LF5 Q;  2BDO A;  1Y1V H;  2PQA A;  4N9T A;  4UP8 A;  3NP8 A;  2ZM6 L;  1FR3 A;  4IUN A;  4BY7 G;  4JI0 L;  3J81 E;  1Q8K A;  1A6X A;  1HR0 Q;  1LM0 A;  2EJF C;  3TN2 A;  3UDG A;  2Z4H A;  4HJ8 A;  5NUC A;  3W5O A;  1WVL A;  5I2X A;  4AIM A;  5C0X J;  2XWJ B;  1CKN B;  3ERQ A;  4CJ0 B;  1BBU A;  2Z1C A;  1A3U A;  1WCM B;  3AU7 A;  1YNJ C;  4NP5 A;  4GOP C;  4BXX G;  5IP7 G;  3J7Y W;  3VR3 A;  3T1Y Q;  1EY9 A;  5ELC A;  4DA2 A;  1I4Q A;  2NVT B;  3A55 A;  2XIW A;  1RTN A;  3PCO B;  3RZO B;  3VR2 A;  1WFQ A;  2J0T D;  4EGV A;  2PCF B;  3MHB A;  5A35 A;  3CCQ A;  4A3I B;  1JJC B;  5EPJ A;  2OF1 A;  1PLF A;  1HTP A;  3PUV A;  4DUZ Q;  1TY0 A;  4A3F G;  3U9O A;  3HGB A;  3EJI A;  4DV5 Q;  2UXC Q;  2B2W C;  3QO2 A;  2IX1 A;  2VB3 X;  1GUO A;  2RDH A;  5IGB A;  2ATW A;  1VMP A;  4BBR B;  1H9M A;  1EQT A;  4DNR B;  2JA6 G;  4DUY L;  5J1Z A;  1X55 A;  3HOZ H;  3I4O A;  4JI8 L;  4DN4 M;  1HNX Q;  4XXE A;  5FK9 C;  4K0K Q;  3S1M H;  2E2D C;  1W3S A;  1PHJ A;  5M9O A;  1Z47 A;  3K5L A;  5EBD A;  1K3R A;  4IUU A;  4K2L A;  4B3R L;  3HEJ A;  4EX5 A;  4QGU A;  4QIW E;  4LUZ A;  4PV1 C;  4CDD C;  4MTK A;  1EY8 A;  2EYO A;  4OIJ A;  1TQO A;  2F0E A;  2WB1 G;  4NXN L;  1HXY D;  2AHO B;  2LSS A;  5C3W A;  1S40 A;  4DR7 L;  4AYB G;  4JBW A;  2NTS A;  3N52 A;  1CTM A;  4LWC A;  5CC4 A;  1JOK A;  2WAQ G;  4L5T A;  2Q2H A;  3GTG H;  5JPN C;  1TT2 A;  1QUQ A;  2NVY B;  3CCS A;  3GTP H;  2MQH A;  4RGO S;  4JI2 Q;  5GAG C;  1A62 A;  3J80 i;  1TU2 B;  1JR0 D;  3CHB D;  1I50 H;  3HFZ B;  3SEB A;  3GTQ B;  4F87 A;  2BOS A;  1EYA A;  4DAM A;  1GUN A;  1NE3 A;  5ELB A;  3H3V I;  3OW7 A;  1E24 A;  1EWC A;  1PH4 A;  1Y8O B;  3U4V A;  3S16 B;  3AEV A;  3SHL A;  1SAP A;  1GVP A;  2FFK B;  1VQ8 A;  2B39 A;  1JB7 A;  2Q8R E;  1QZH A;  4A3G G;  1HR0 W;  2I5M X;  4A3L H;  3VR4 A;  3W1G A;  5M3M B;  2P5Z X;  4LF6 L;  4JBJ A;  5DLQ E;  2F3V A;  1BBW A;  4FVM A;  2X6G A;  3HOW G;  2ZXR A;  1B1Z A;  1L1O A;  1JQY D;  1IBM Q;  2J7Z A;  4K8I A;  3QOL A;  1PFM A;  1LTL A;  2QIL A;  1V9P A;  2VY3 A;  1N36 L;  1WTR A;  3QJY A;  2NN6 G;  2F0L A;  2L4N A;  1EWI A;  1GHJ A;  4K5X A;  4MTN A;  5DM7 3;  5I9O A;  1YHA A;  4C3J G;  2E2I B;  1HNW Q;  4DV3 L;  1KD1 C;  1I4P A;  4DV3 Q;  1SJH D;  1TWF B;  2UUA Q;  2UU9 Q;  2JE6 I;  4GOP B;  1ICF B;  4A75 A;  4K6D A;  3I2Z A;  4JW0 A;  3EA6 A;  2XSC A;  2ZJQ A;  1S5C D;  5C3E G;  5GAD C;  3GTM H;  3DEP A;  2ID0 A;  4DV5 L;  1SMY C;  4QCL A;  1HFG A;  4S3S A;  2MO1 A;  3GP7 A;  1IYU A;  1UNS A;  4DR4 L;  1V8Q A;  3ONA B;  4RHR A;  5I9P A;  1AP0 A;  1IL2 A;  1I6V C;  1QNU A;  1Z7T A;  1WTV A;  3IFD A;  4BA2 I;  1U4P A;  3NWS A;  1XMO Q;  4PZ8 A;  4HSP A;  5JEA G;  1FYC A;  2NWG A;  5ELF A;  1LTB D;  5DAU A;  4DGZ A;  4R8I A;  2LXK A;  4XYO A;  1SEB D;  2K7V A;  3HOX H;  1PRT B;  2J4X A;  1DGS A;  3E5S A;  1L0W A;  4IOC A;  1JWU D;  4GN3 B;  5C3X A;  1YNX A;  2YTY A;  2BCO A;  4XTC S;  3MAQ A;  3PO2 H;  3FMC A;  1Z9F A;  2Y0S B;  2Q2I A;  1TWF H;  4JI2 L;  3HZX A;  1Y8P B;  3PUZ A;  4UY8 C;  4CKC A;  1KRT A;  3I3C A;  1D2B A;  3P1H A;  4XQQ A;  2L12 A;  2IL8 A;  4A3J H;  4ZLT F;  2PI2 E;  3GTQ H;  1F9R A;  1G8Z D;  1U4L A;  3A8K E;  2KJX A;  5G3L D;  2K14 A;  5LL6 S;  4A3D B;  1H9J A;  2Y0S E;  4OGQ C;  1QVC A;  1CI3 M;  1JCK B;  3J81 L;  1HUN A;  3PIO 3;  2Q2T A;  3HOY H;  2K04 A;  1VQA A;  1I3Q H;  4A3J G;  3H0G H;  2L1B A;  1O7I A;  3MVV A;  3I73 A;  1N34 Q;  4C2M B;  2EXZ A;  4A3I H;  1DD2 A;  4ZYS A;  3CQZ H;  4X3S A;  1NJI C;  4JV5 L;  3JAM i;  3KFU A;  3EVQ A;  3NEM A;  3GTL H;  3CP0 A;  4XQN A;  2WB1 E;  3CCJ A;  4RGN A;  1EOV A;  2K03 A;  1WI5 A;  1TWC H;  5KYL A;  5JEA H;  2UUA L;  3KLS X;  1L2F A;  5BN3 A;  1I94 L;  2EXD A;  3B6Y A;  4QY7 A;  1Q81 C;  3W1B A;  3H3V H;  2WAC A;  4KTA A;  2R7Z G;  4JI1 L;  4A3E B;  4JVZ A;  3L7Z C;  3D4W A;  4X64 L;  4KJO A;  2JEA I;  1PTO C;  4CDF C;  2ICI A;  1STA A;  2MJ8 A;  4DR7 Q;  2WII B;  1E2Z A;  5D3D A;  1QVF A;  3M4Y A;  4PZ6 A;  5FO9 B;  1XYI A;  3R3O A;  2FXQ A;  3VR6 A;  3HOZ B;  4NPS A;  2Q8I B;  1YEZ A;  5IP9 G;  3Q22 A;  4IAL A;  4IUQ A;  3U50 C;  5EGT A;  3DM3 A;  2PW7 A;  5M3M H;  3DMU A;  2F0Q A;  4C3H B;  4LJZ C;  4BBS H;  1ENC A;  3C1E A;  2R61 A;  1DOK A;  4M8A A;  4ID6 A;  3K0X A;  1BVS A;  1CQF A;  2L0C A;  3EFX D;  2RKS A;  2G5D A;  2QF7 A;  1SJE D;  3VR5 A;  3PO3 H;  3C2P A;  4A3L G;  4ME5 A;  4K5W A;  4M1U B;  4A3E H;  4A3G H;  3M4Q A;  2R6G A;  4FP5 D;  3ZJY C;  5AJ3 Q;  3J80 L;  4YWK A;  1AZP A;  1KNE A;  3KOJ A;  2I0Q A;  1VQF A;  3SK6 A;  3LGJ A;  2WKC A;  4R4Q A;  1LV9 A;  4DV1 L;  1RDP D;  4HJ5 A;  2K5H A;  2I5H A;  4GLA C;  2F0V A;  3CQZ B;  3K57 A;  1U9R A;  4OX9 Q;  5IGD A;  3D6C A;  1SNP A;  5C4J H;  4A3B B;  3GTL B;  3CC4 A;  1GJX A;  4AQY L;  4X66 Q;  2IHF A;  5IYC G;  1EL0 A;  1T5X D;  4L5R C;  1WOC A;  5ELN A;  2Z4I A;  4YY3 L;  3H0G B;  3K0Y A;  2TSS A;  4DPG A;  3MXG A;  1LO5 D;  2Z0S A;  1N33 L;  1II3 A;  3TZU A;  2JN4 A;  3F2U A;  1ENF A;  4O42 A;  5M3F B;  4DR5 L;  4A3M G;  2A6E C;  2KCT A;  2YV5 A;  4UP7 A;  4LFA L;  5CGK A;  5LMN W;  4J15 A;  1B4O A;  5LHY 1;  3K7U C;  5FLX L;  2VB2 X;  3I4M H;  3URY A;  3VYT A;  2F4V Q;  4FF2 A;  1TS4 A;  5KYI A;  3HOV G;  4CKB A;  3PMF A;  2O5I C;  5IGC A;  2K6A A;  4LUO A;  3J80 c;  2IJ0 A;  1S5D D;  2E8G A;  1PA6 A;  1Q86 C;  4P74 A;  4A3C G;  1STB A;  3S2D B;  1LT5 D;  4A3M B;  1PTO B;  2O5J C;  1PZI D;  2B63 B;  2R93 H;  5M5X B;  1E2W A;  2CW0 D;  4C3J B;  2MFI A;  1I4X A;  4F7X A;  2EJM A;  3GD7 A;  1QZG A;  2E2H B;  1IYV A;  3ITP A;  3JAM c;  1FJG L;  5BR8 Q;  2F0M A;  3SXH A;  1JOR A;  2B2W A;  2LFN A;  2Z8L A;  2X6L A;  5ELE A;  3SK5 A;  2XVS A;  3NTK A;  1IKL A;  3TP7 A;  1Q90 A;  1JWS D;  4DV6 Q;  1JT8 A;  5CV8 A;  1CKM A;  1K28 A;  3DWQ A;  5C0X H;  2LMC B;  1NNX A;  3RLF A;  2B63 G;  2C9O A;  2KUM A;  1LYL A;  4G4K A;  5FJ8 G;  3D3R A;  3D6W A;  2EYJ A;  3CCV A;  1VQM A;  3T56 B;  3BVG A;  3C3L A;  1CKN A;  2MNA A;  4Y7N H;  3GTK B;  3VYR A;  1H9S A;  2CWA A;  4H0L C;  1VDZ A;  1WTO A;  1EIF A;  4MNO A;  4C1N I;  1FNU A;  3BVZ A;  2F0P A;  2Z6K C;  4DNT B;  2JA6 B;  4KKS A;  5GRO A;  1TR5 A;  1SE8 A;  1X65 A;  5CV9 A;  1K83 H;  1ZXT A;  2HDL A;  5EQ0 A;  1XNR Q;  4A3C H;  1PRT F;  3PO2 B;  4GKK L;  4N8X 1;  2LXJ A;  3PIP A;  1EFI D;  3G6J B;  2K75 A;  5CV6 A;  4HCS A;  1I4G A;  2AQ2 B;  5E4W C;  1U5K A;  2L5T A;  3ND9 A;  1H95 A;  2N49 A;  1KRS A;  5CMD A;  1DOL A;  2PMZ B;  2D2C C;  1YVC A;  5H1S E;  3FPP A;  3VA5 A;  3I4M G;  4DR3 L;  4BY7 H;  1K8M A;  3CC7 A;  1A3T A;  1KLU D;  3DXJ C;  2DUD A;  2JP1 A;  4YHH L;  1SYC A;  4LF8 Q;  5E7N A;  4PMB A;  1YNJ D;  3ZYY X;  4KV6 A;  4EQ5 A;  4O0A A;  3C46 A;  1VF7 A;  2A8V A;  2VNU D;  3KF6 A;  5C6A A;  2EY6 A;  3KLR A;  2NVQ B;  4V0B A;  4JI3 Q;  5EAY A;  2VUM B;  2VW9 A;  1SYB A;  2B8G A;  1JE4 A;  4KN4 C;  1ZKO A;  2VQE L;  1K0S A;  4HCE A;  1LAC A;  1FGU A;  5CV4 A;  1X3G A;  4DKA C;  4EQP A;  2ZJP A;  3BG3 A;  2PYK A;  3J7A 5;  2BDN A;  3I7F A;  4PMC A;  3CPF A;  3AFQ A;  5D3I B;  2K01 A;  1EQR A;  3W3A A;  2SOB A;  4BY1 G;  3X3N A;  1M4V A;  5JJI A;  2H4O A;  1Y1W H;  3M9B A;  2I46 A;  2ZXO A;  3UDF A;  2K5Q A;  4HAE A;  5C3E B;  3L0O A;  3NHH A;  2K28 A;  2F0O A;  2QEX A;  2EZV A;  3T51 B;  1EYD A;  1XPO A;  4OX9 L;  2GN5 A;  2NB0 A;  1G91 A;  2EYM A;  4FNF A;  2NN6 I;  3A8J E;  3HOY B;  1RKN A;  1R9T H;  2BE5 C;  3DHQ A;  3TEH B;  5LL6 X;  2F0F A;  5M3M G;  3M7N A;  3D8G A;  2B63 H;  1PH5 A;  3GV3 A;  3GTP B;  1LAB A;  3NQT A;  4L6T B;  4RG1 A;  2WFW A;  1JOQ A;  3A5Z B;  3LX0 A;  2UUB Q;  3R8B A;  1BKB A;  1SR3 A;  5IOC A;  3MZ5 A;  1DM0 B;  1EY7 A;  1OTC A;  4LF4 L;  1D7Q A;  3JC6 6;  4KD3 A;  1HFN A;  1D1K A;  4UDU C;  3TP5 A;  3UDI A;  1KDB A;  1K8O A;  1NR4 A;  2UUC Q;  1DXM A;  2OTJ A;  4IPD A;  4DR2 Q;  1HUM A;  4QMG A;  4KJN A;  1BUV T;  2PPB C;  1B8A A;  2ALY B;  3RZO H;  2EY2 A;  5C0X G;  4TRD A;  2YTX A;  2A6H C;  1JMC A;  5JJZ A;  3T1H Q;  2NZO A;  3MFG A;  4JCV E;  5D65 A;  3NBH B;  3HOV H;  5EPL A;  2F0J A;  1CZW A;  4U67 3;  2K5V A;  4H02 A;  4DU9 A;  4EQO A;  3U58 A;  1P8L A;  1STG A;  4C3I B;  3S2H B;  1BO0 A;  4JI8 Q;  2JA8 G;  4WRD A;  4DAP A;  2HUG A;  4Y7N B;  3GTK H;  2RHS B;  4C1N K;  1K0R A;  5J3B A;  2JJQ A;  4YCW A;  4IN3 A;  1N9W A;  2UXB L;  3I4N B;  3OSO A;  1T5E A;  3KUP A;  4HJ9 A;  2VUM H;  3BZK A;  4FXG C;  4A4I A;  1OXX K;  2B2T A;  1UE1 A;  2F0S A;  1VQG A;  5CBE E;  5EKI A;  1HTL D;  1SDF A;  3DM1 A;  1QB5 D;  3K5N A;  1SMX A;  4X6A H;  1E0B A;  3GTO H;  2KBN A;  4CDC C;  5G3L F;  3K7A B;  4KY7 A;  4A3K G;  4A93 B;  1S4Z A;  2R92 G;  1WCM G;  3D0F A;  5IGF A;  4DR5 Q;  1MSG A;  1U0L A;  2E2H H;  1N34 L;  1TVX A;  1DCZ A;  5KGU A;  3F2C A;  4GLV B;  1EY4 A;  1H9S B;  1V1Q A;  3HOX G;  1YIT A;  4YIJ A;  1FVI A;  2NTT A;  3KYH C;  3H6M A;  4UHV A;  1ZYR D;  5HGQ A;  1I6H H;  1MI2 A;  1QCB D;  1E1T A;  3RNU A;  2XNA C;  5IE8 A;  1WTH A;  2NVQ H;  1EEI D;  2AQ1 B;  4BBS G;  3FP9 A;  4AYB E;  4YWL A;  1LTR D;  5IYD H;  1LTA D;  2E74 C;  2F0W A;  4POF A;  1NMG A;  4JI4 Q;  1EU3 A;  4NDX A;  2HDM A;  1VCI A;  3PO3 G;  3K5O A;  3CXC A;  2N3S A;  1LTG D;  2MGS A;  4FF1 A;  4K6L A;  2NYZ D;  4P72 A;  2E5L L;  1SE3 A;  4POG A;  1IZ6 A;  1IBL Q;  1RIP A;  5E1F A;  3CCR A;  3NEN A;  1O7Y A;  2IWH A;  1AEX A;  1VQL A;  4KN7 C;  2A19 A;  1KDA A;  2LKV A;  3P20 A;  2EJG C;  1J9O A;  1B7Y B;  3UE1 A;  1W2B A;  3A5U A;  5M5W B;  3J81 c;  2C5C A;  1VQE A;  4OWT B;  3TP8 A;  2MPM A;  3G6E A;  4JC0 A;  3NXW A;  5EJW A;  4H7B A;  3S17 H;  2NN6 H;  1UE5 A;  1B70 B;  3GTJ B;  1PRT C;  1ILQ A;  5ELD A;  2NVX B;  3I4N H;  5A2Q E;  1G2S A;  3RR5 A;  1S72 A;  3BU2 A;  1EY0 A;  3Q0A A;  1P16 A;  2B2Y A;  1ASY A;  2R92 B;  1AFP A;  3HKZ B;  2UXB Q;  1PMR A;  4UPA A;  2N8N A;  4JI4 L;  2XRS D;  4OWX B;  4G7Z C;  3S15 H;  2CH4 W;  4BA1 I;  1U4R A;  2YTV A;  1CT1 D;  3NBH A;  2EOT A;  2R7Z H;  4HID A;  4ZUJ A;  3RN2 A;  4IUR A;  5CYU A;  1I94 Q;  2I5L X;  1DOM A;  4DV2 L;  3HOY G;  4HSV A;  4DK3 C;  1V1P A;  4LF7 Q;  4OHJ A;  2BH2 A;  2KCN A;  1XPU A;  1SNO A;  4HTH A;  3ULJ A;  4DV7 L;  4P2C B;  3HKZ E;  2PW5 A;  2E75 C;  2RSN A;  3CME A;  1SYD A;  3KDF B;  4RGM A;  3EBE A;  3K5M A;  4GKJ Q;  5KRU A;  2UXD Q;  3WOF A;  2HIV A;  1A2T A;  1RD9 D;  1E7Z A;  2DJF C;  4X66 L;  4AQY Q;  3K6O A;  4MZ9 A;  1LT6 D;  4WOR A;  3V05 A;  1CSP A;  5K5P A;  3J80 E;  2SDF A;  1HA6 A;  4XDX A;  3PO2 G;  4RKL A;  3J81 j;  3TRZ A;  3VA7 A;  1XMQ Q;  1XXG A;  2HIX A;  4JI6 L;  3MFY A;  4A3F B;  5AJ3 L;  2NUC A;  4E6I A;  4LFC Q;  3MEH A;  1BR9 A;  1TWC B;  2K50 A;  2A74 C;  4A76 A;  1Z6H A;  5D14 A;  5ISR A;  3AFP A;  2SNS A;  3EN2 A;  4ABN A;  3MWY W;  1S5F D;  2JK8 A;  2QEJ C;  4RCN A;  1G2T A;  5A2Q L;  1X9N A;  1R4Q B;  3H91 A;  1UWV A;  4NMZ A;  1VQP A;  1C48 A;  1HJP A;  2NZ1 D;  3IKJ A;  2RF4 A;  5ELO A;  3LWE A;  5K36 G;  1D6E C;  2WIN B;  1E2V A;  2N55 A;  4V19 0;  1PH7 A;  1TS3 A;  1FGB D;  3K80 C;  3I4N G;  3X3M A;  1OO9 B;  3S14 H;  2WKD A;  2JA9 A;  4FDB A;  5KNC A;  4NKL A;  2L11 A;  1B53 A;  2OXP A;  3KLS A;  4L63 B;  2JA7 B;  4ULL A;  2CCZ A;  3I55 A;  1PH2 A;  3TSS A;  2HHH Q;  1KIX A;  1ET9 A;  1V43 A;  1MSH A;  5JPM C;  1SYF A;  3DWA A;  4BS9 A;  1HA5 A;  1CKO A;  4A3F H;  3A74 A;  2YYZ A;  3MXN A;  1YZ6 A;  4R4I A;  2IT1 A;  1I6H B;  2L15 A;  3S16 H;  2WAQ B;  1WJJ A;  4C3H H;  5JJL A;  3HRZ C;  2O2L D;  4DV4 L;  1NCV A;  1BQQ T;  1NTG A;  2EY1 A;  1B44 D;  1JC7 A;  1PDQ A;  1AE3 A;  1QG7 A;  2F0I A;  3TRE A;  2LS0 1;  1LT4 D;  2MUY A;  2KEC A;  2O4X A;  2B2Y C;  1L1O C;  3ERS X;  3T1H L;  3Q6S A;  4YCV A;  2YU9 H;  3GDE A;  3T4A C;  4DK0 A;  1PVO A;  1EYC A;  1LTT D;  1IBM L;  1TKW B;  3K7A H;  4GN4 B;  3HOW H;  1XMQ L;  4IUP A;  1I3Q B;  3M85 A;  4KHP Q;  3J7Z C;  2GVA A;  1YNN D;  4QB4 A;  3OWF A;  1X6O A;  5C4X G;  3V96 A;  5M5Y H;  4RAU C;  3QOJ A;  1AN8 A;  1SSO A;  2M9V A;  5KNB A;  1VQK A;  1YNN C;  2ICE C;  4Q0F A;  4X3U A;  2R92 H;  2ZT9 C;  4LF4 Q;  3RZD B;  1SLJ A;  3I90 A;  1F9P A;  2Z6K A;  2B2T C;  1Q12 A;  1A2U A;  1TWA B;  5CV5 A;  1PYS B;  2F0K A;  4NW2 A;  2EVB A;  2A5H A;  4KHZ A;  3S1M B;  1Y14 B;  4IPH A;  3FKI G;  5EBC A;  5J39 A;  1YBY A;  5GQO A;  2Y0S G;  4RHS A;  5I2Y A;  1QE6 A;  2QA4 A;  4DV2 Q;  5C4X B;  1A15 A;  2ZM6 Q;  1RJT A;  4JBK A;  1XNQ L;  3S1Q B;  4XIG S;  2A73 B;  3DWP A;  4G7O C;  1X54 A;  3G71 A;  3BDC A;  2HT1 A;  2FMM A;  1F77 A;  2E76 C;  4KMU C;  1Q46 A;  5JAV A;  4XT3 B;  1KL9 A;  4RMF A;  2RBM A;  3HG9 A;  3CCM A;  3M3Y H;  4OO1 H;  3TBI B;  4B3T Q;  3HOZ G;  1X32 A;  1EYG A;  3NSW A;  1STH A;  2PZU A;  1Q1B A;  2UXD L;  1QWY A;  2RA4 A;  1VQB A;  2RCF A;  4QL5 A;  3BYY B;  3OWE B;  2ZTD A;  3RD4 A;  3HP3 A;  3CU7 A;  2D5D A;  2KHI A;  2XGT A;  3DLL A;  4Y52 H;  4UP9 A;  2DGY A;  3UE0 A;  1CHQ D;  3S1N H;  1VMC A;  5I6Y A;  3A8I E;  4IZ8 A;  3GV6 A;  3TZD A;  1XPR A;  3L9A X;  3SK4 A;  2AQ3 B;  3D4D A;  1PFB A;  1WD1 A;  1HNW L;  2EIF A;  2K5N A;  1VF5 C;  1HR0 L;  4KK7 A;  2JA6 H;  3ERO A;  2JA8 H;  4JI0 Q;  1KAW A;  4DR3 Q;  3NBI A;  2MP1 A;  5IP7 H;  1L1O B;  4CGY B;  2KOL A;  3VDY A;  2A68 C;  1GM5 A;  4LAA A;  3MXN B;  3STB D;  4JOI C;  2EYP A;  1VQ7 A;  1E1O A;  1TWH H;  2F0U A;  4A3G B;  3J7A F;  2OCE A;  2F52 A;  5FO7 B;  4GOP A;  4BY1 B;  2KCM A;  2IX3 A;  1VQC A;  1TY2 A;  2NVY H;  3BZC A;  4IQZ A;  5M5W H;  5LMU L;  3T1Y L;  3SK8 A;  2AMC B;  1WTQ A;  4ALP A;  5JEA J;  4BXX H;  3PGZ A;  1PH8 A;  3SGI A;  2D62 A;  2N88 A;  3AB9 A;  4B9W A;  1PZJ D;  1ESR A;  3SVM A;  2GVB A;  2K05 A;  1PXU A;  3F1Z A;  3OTO L;  4DV7 Q;  2HQL A;  3U9S A;  1EEF D;  1VQ4 A;  1WD0 A;  5IY0 A;  4TKO B;  1YHQ A;  3CC2 A;  2BA0 A;  3IRB A;  1S3O A;  2QCP X;  1MBY A;  2I07 B;  4XQJ A;  3DUZ A;  3F8T A;  3S14 B;  4R9W A;  4CKE A;  1M90 C;  1Y1W B;  4HR7 B;  3H94 A;  1RHP A;  2F3I A;  4LF5 L;  3SDZ A;  1YIJ A;  1N33 Q;  4DV6 L;  1JE5 A;  4JI7 L;  2ASB A;  2F3W A;  1BF4 A;  3PSI A;  4CJ1 B;  3GTM B;  1MKH A;  1RCV D;  3S9W A;  2JYO A;  3PF4 A;  1SYG A;  4FF3 A;  2PQE A;  1ET6 A;  4BY1 H;  2QW7 A;  1JB3 A;  3KBG A;  2B2U C;  2NZH A;  4X64 Q;  4G7H C;  2JA7 H;  4QJF A;  1KDC A;  4JI5 L;  4C3I H;  3CPW A;  2FHT A;  4B3M L;  1TII D;  1W6K A;  4KI0 A;  1UE6 A;  2BE5 D;  1GHK A;  1EFW A;  1MHW C;  2JA7 G;  5GAH C;  1K9M C;  1NSN S;  4CHT B;  3S24 A;  2VS1 A;  1S5B D;  4DR6 Q;  3D4R A;  2XRQ D;  3PQI A;  3U4Z A;  1ENA A;  1I4H A;  3CCU A;  3AMU A;  5FLM H;  2GA4 B;  2IHE A;  4LF9 L;  4NXM Q;  5FJ8 H;  1I5F A;  4YY3 Q;  4ZK9 B;  1XTD A;  5HUR A;  2DJG C;  1V1P B;  4CDE C;  4F8M A;  4Z9C B;  2A1A A;  3CRK C;  3R93 A;  3CCL A;  2EE1 A;  3D31 A;  2PZT A;  3HOW B;  2VL6 A;  5JJK A;  2JA5 B;  3ND8 A;  3JAM L;  1TS5 A;  4X62 L;  2VQF L;  3E9H A;  1VQI A;  1B3Q A;  2A6E D;  2UUC L;  3KF8 B;  1ESF A;  1EZ6 A;  3WOE A;  2QGQ A;  2R93 G;  1UE7 A;  2G9H D;  1NAP A;  1ICW A;  3JAM E;  1JIC A;  1SFO H;  3E0J A;  1EIG A;  1GD7 A;  4K2K A;  3HOU H;  2WP8 J;  3DEO A;  3OIP A;  4OWW B;  4IFD H;  2E2J B;  1CUK A;  2K5D A;  2EQS A;  1EOT A;  2K5W A;  2CW0 C;  2JA5 G;  1PTO F;  3MXP A;  2XN9 C;  3V2T A;  3OW2 A;  3UDX A;  4HIM A;  1SE2 A;  3MC0 B;  4KY6 A;  1B9M A;  1LTI D;  1JJ2 A;  3SR1 A;  1HNZ L;  1MD2 D;  5IYB H;  1C0A A;  4JBM A;  2WB1 B;  1QJO A;  4RGT A;  2D9U A;  4IO9 A;  3GO5 A;  1IKM A;  2HHH L;  2DNC A;  2Q8T A;  4DXF A;  1HZ9 A;  4KD4 A;  2A69 C;  3G4S A;  1LTS D;  4EQN A;  1B3A A;  1VQN A;  3S2H H;  5EKK A;  5FLX E;  2K4K A;  3G7L A;  2A69 D;  2RSO A;  1A3V A;  4O2D A;  3TQY A;  1IYJ B;  5M3F G;  3P7J A;  2H5X A;  4HMI A;  1GO3 E;  2EYF A;  5C4H A;  4DR2 L;  2D0O A;  3GQB A;  3HOU B;  5E3F A;  1FD7 D;  1BOS A;  3CD6 A;  1BDO A;  4C2M H;  1G51 A;  3OOC A;  3A0J A;  4TSS A;  1X56 A;  3P75 A;  1N36 Q;  1SNM A;  3KDF A;  1C7Y A;  3OHX C;  2RQX A;  3I91 A;  2JXM B;  3FHW A;  1XX8 A;  4ILW A;  2EY5 A;  1O80 A;  4MHE A;  1O78 A;  5T1I A;  3S1R B;  1KAB A;  4OON A;  2PMZ E;  4A3M H;  1Q7Y C;  4RA8 A;  2R93 B;  4JI6 Q;  2OEO A;  4DK6 C;  5C4X H;  4LF8 L;  4I7A A;  4ZRZ A;  4YHH Q;  4PMW A;  4A3J B;  3G48 A;  2CQO A;  1YHB A;  5IYC H;  1VQ6 A;  1BXT A;  3FKI H;  4DR4 Q;  4OEM B;  4HJ7 A;  2TMP A;  3BS1 A;  5IWA Q;  5IP9 H;  5HY6 A;  1BCP F;  1G29 1;  3I4M B;  1N32 Q;  2F0H A;  3M4P A;  4GKJ L;  5CV7 A;  1K3B C;  1K73 C;  5LMN Q;  2KVM A;  1PFN A;  3IL8 A;  4K14 A;  3SE0 A;  5C5L A;  5GAE C;  3IAY A;  4HIK A;  4Q5V A;  4ME3 A;  3TME A;  1Y1V B;  5C5M A;  5FO8 B;  1NBW A;  2FIN B;  2VZA A;  5C44 B;  3FDT A;  4HN7 A;  1VQO A;  4TQU S;  1F2Y A;  2CVR A;  1B9N A;  4L5Q A;  2JSO A;  4B08 A;  1CK1 A;  4AH6 A;  4XT1 B;  1F2Z A;  1UUP A;  4LFB L;  1UEA B;  4BWG B;  1LLR D;  1IBK L;  3OMG A;  4CJ2 C;  1L0Y B;  1FNV A;  3QR8 A;  1MJE A;  2SEB D;  1HQM C;  1PZK D;  1DJR D;  2AKW B;  3HS0 C;  4FF4 A;  3BDO A;  4A3I G;  1JOO A;  2WAQ E;  5M5X H;  2KED A;  4B3T L;  4A3B G;  3PUW A;  4PQX A;  1SRU A;  1HNZ Q;  1ROD A;  5AFW A;  4C3H G;  3QG1 A;  2ZTC A;  3H0G G;  1VQ5 A;  4ZAI A;  4R1J A;  2HCC A;  3AYH B;  4ZKC B;  5IIF A;  2ZXP A;  3RMH A;  1PH3 A;  4R4O A;  3A7L A;  4N9P A;  3ER0 A;  4XYQ A;  1GUS A;  4BY7 B;  4MIU A;  5K36 H;  1XTC D;  1PRT D;  1I50 B;  4OXP A;  1IL8 A;  4N8F A;  4RFB A;  1WTW A;  3M4O H;  1MGS A;  4DF7 A;  1XNQ Q;  3H15 A;  3R2T A;  1IBL L;  1OXT A;  1PH9 A;  3S17 B;  2A68 D;  4H13 C;  2CHB D;  3K81 C;  2OWO A;  2MO0 A;  4GLX A;  2A6H D;  4RWS C;  4RH6 A;  2UXC L;  2R7Z B;  2CKZ B;  3NUC A;  3OIQ A;  3KF8 A;  2RHQ B;  1OXV A;  1A8V A;  1K83 B;  4DUZ L;  4R4C A;  2K33 A;  4KLK A;  3NTI A;  5KND A;  1M1K C;  3Q23 A;  1PTO D;  5IGG A;  1EQQ A;  4KY5 A;  2DY8 A;  4FXD A;  4K5V A;  3WDN A;  2VXW A;  4OIK A;  4LFA Q;  4IJH A;  5DM6 3;  2M00 A;  2RDG A;  1SN8 A;  2C35 B;  1GXD C;  2XTI A;  3QB3 A;  4KHP L;  2PNH A;  2OTL A;  1D5Z C;  2K52 A;  4WJW A;  4DXG A;  1YJN A;  3BVM A;  4ODG A;  2F0G A;  1FNW A;  1RL2 A;  1O7Z A;  1PFS A;  4HJA A;  2Z6B A;  1EQV A;  5FLX c;  3A54 A;  3TS2 A;  1QIL A;  5C44 H;  1WYD A;  5C4J B;  1K8A C;  1PH1 A;  2PO4 A;  1X3F A;  3BDL A;  3GTO B;  2E2I H;  3KK7 A;  1J6Q A;  3MEF A;  1C4Q A;  1KLG D;  5E4X A;  4BBR H;  2CQA A;  3LWU A;  4I65 A;  5IT9 E;  3E0E A;  1B2T A;  4LUV A;  4BBS B;  4JOI A;  3J81 i;  1SFO B;  2Z9H A;  1NR2 A;  4C56 C;  3HKS A;  5COY A;  3CRL C;  2G9D A;  4C3J H;  1Y8N B;  2SNM A;  1BCP B;  4ZQ3 A;  1I4R A;  1NY4 A;  2KHS A;  4JPB W;  2BH8 A;  2AWN A;  4FO2 A;  1E22 A;  5T1G A;  1NMF A;  4IPG A;  2EPB A;  3KJP A;  3I4L A;  4B3M Q;  4DK1 A;  2FMC A;  1H9R A;  1AH9 A;  2KHJ A;  2PQA B;  1PV4 A;  1X3Q A;  2H1E A;  4B3R Q;  4BBR G;  4KHV A;  4GZY C;  4IUV A;  5F2D A;  1A63 A;  2JQO A;  4LK1 C;  4QIW B;  1GUG A;  5C3E H;  4H44 C;  4G57 A;  2JA8 B;  1HZB A;  4JI7 Q;  4P71 A;  3OTO Q;  2RDF A;  4X65 L;  3S1Q H;  5COR A;  4LFB Q;  4DV0 Q;  2F4I A;  3FEW X;  3L3O C;  4PZ7 A;  1UEB A;  3O13 A;  3PIP 3;  1MJC A;  4RKB A;  4LNQ A;  4LW1 A;  4TVA B;  3RLO A;  2UUB L;  2AUK A;  3RZD H;  1V1O A;  4GN5 A;  1Y69 U;  2PI2 A;  2B2V A;  4DR1 Q;  2F0T A;  5KIX A;  5KEE A;  2JEB I;  4GNX B;  1W6J A;  3K8A A;  1C8C A;  1B50 A;  2LY7 A;  2NVX H;  3E6Z X;  4X3T A;  3AQQ A;  5C4Z A;  1LT3 D;  1A0I A;  1VQJ A;  4JV5 Q;  1J8I A;  3ULL A;  5C44 G;  5JOB A;  3LNN A;  3FVQ A;  5IYD G;  1VQ9 A;  4B3S Q;  2YU9 B;  3VYS A;  1HRJ A;  2HD3 A;  2X69 A;  1AZQ A;  1YJ9 A;  1Q3L A;  2HCI A;  2ZTE A;  3KJO A;  3CAM A;  5DEH A;  3QIA A;  3HOX B;  2NBF A;  1IW7 C;  1R9T B;  2B2V C;  1KXL A;  1WTP A;  3PV0 A;  1TXY A;  4L5S A;  2VUM G;  5BN5 A;  2D0P A;  3PF5 A;  4WJ3 M;  2QDB A;  4OEL B;  4YWM A;  1SBB B;  4O1N A;  1J5E L;  2R7F A;  1IBK Q;  4DV0 L;  2RCN A;  4A3B H;  4JI1 Q;  5I6W A;  1EY6 A;  2UU9 L;  1TWA H;  2KA7 A;  2FJ2 A;  3NEL A;  1X3P A;  2BA1 A;  1EIY B;  3PUX A;  2B29 A;  2NVT H;  3R2I A;  3S1N B;  2QKI C;  2IPK D;  1VS0 A;  1X3E A;  2ENB A;  1XWE A;  3CMA A;  2F0D A;  3NQI A;  3NTH A;  4FXK C;  1CFM A;  1EY5 A;  2EDG A;  1RF2 D;  4J8Q A;  1N32 L;  4KKU A;  4HED A;  3F2B A;  1TWH B;  2XWB B;  1AE2 A;  2AUJ D;  3BYT B;  3NE5 B;  4LF6 Q;  4IFD I;  4B9X A;  2QDL A;  4JG2 A; 
#chains in the Genus database with same CATH homology
 1VQG A;  1K9M C;  4DR4 L;  2N78 A;  4X6A H;  1SMX A;  3S24 A;  2VS1 A;  3GTO H;  2KBN A;  4DR6 Q;  1IL2 A;  2E5L Q;  4P75 A;  4A3K G;  4BA2 I;  1XMO Q;  4PZ8 A;  2R92 G;  1WCM G;  1Q1E A;  3U4Z A;  3D0F A;  5JEA G;  3CCU A;  4DR5 Q;  5FLM H;  3Q8D A;  1U0L A;  2IHE A;  2R7D A;  4LF9 L;  4NXM Q;  5IT9 c;  1N34 L;  2E2H H;  2LXK A;  5FJ8 H;  1I5F A;  4YY3 Q;  3HOX H;  1XTD A;  4GNX C;  1DGS A;  4JYA Q;  1L0W A;  3F2C A;  4IOC A;  4GLV B;  4GN3 B;  3HOX G;  1V1Q A;  4IOA A;  1YNX A;  2YTY A;  4XTC S;  3PO2 H;  1YIT A;  1Z9F A;  1Y1V G;  3WWV A;  2Q2I A;  1TWF H;  1C9O A;  4JI2 L;  1FVI A;  3KYH C;  3PUZ A;  1N8R C;  5HGQ A;  2A1A A;  4UY8 C;  1I6H H;  1KRT A;  3PUY A;  1E1T A;  1K8G A;  3CCL A;  3D31 A;  3RNU A;  2VL6 A;  5IE8 A;  5JJK A;  2B3G A;  4A3J H;  2NVQ H;  2PI2 E;  3GTQ H;  4BBS G;  3FP9 A;  1Y1W G;  4AYB E;  4X62 L;  2VQF L;  4YWL A;  5IYD H;  3E9H A;  1VQI A;  2UUC L;  4POF A;  5IWA L;  1NMG A;  1SRO A;  2K14 A;  3KF8 B;  4JI4 Q;  1E3P A;  2Y0S E;  1QVC A;  2QGQ A;  3RN5 A;  2ES2 A;  2R93 G;  1VCI A;  1UE7 A;  4P73 A;  3PO3 G;  1KHI A;  1XMO L;  3CXC A;  4NXN Q;  1SFO H;  2N3S A;  2IX0 A;  2Q2T A;  4P72 A;  4POG A;  3HOY H;  1GD7 A;  2E5L L;  3HOU H;  4DNI A;  1IZ6 A;  1I3Q H;  1VQA A;  2WP8 J;  4YCU A;  3H0G H;  4A3J G;  1IBL Q;  1RIP A;  1O7I A;  4OWW B;  3CCR A;  4DV4 Q;  2VQE Q;  3NEN A;  1N34 Q;  4APV A;  1CUK A;  2EQS A;  1VQL A;  4A3I H;  2A19 A;  2JA5 G;  1HZC A;  3CQZ H;  3OW2 A;  1B7Y B;  3UE1 A;  3UDX A;  4HIM A;  4R4T A;  3A5U A;  1W2B A;  1LUZ A;  3J81 c;  1NJI C;  1VQE A;  4OWT B;  3JAM i;  3KFU A;  4JV5 L;  3NEM A;  1JJ2 A;  3GTL H;  2E2J H;  4DR6 L;  3I56 A;  3CP0 A;  3ICE A;  3G6E A;  1HNZ L;  2WB1 E;  4JC0 A;  4A3D G;  5IYB H;  1C0A A;  3CCJ A;  3S17 H;  3F2D A;  1EOV A;  4JBM A;  1UE5 A;  1B70 B;  1WI5 A;  1TWC H;  3I4N H;  5IYB G;  4IO9 A;  4DUY Q;  1WCM H;  2UUA L;  3RR5 A;  3GO5 A;  2HHH L;  1S72 A;  1L2F A;  2CFM A;  3BU2 A;  1VQD A;  4A3K H;  1HZ9 A;  1I94 L;  3S2D H;  2EXD A;  3B6Y A;  1P16 A;  4QY7 A;  3G4S A;  3W1B A;  1Q81 C;  1ASY A;  1XJV A;  4WJ4 A;  3H3V H;  2UXB Q;  5M3F H;  2R7Z G;  1VQN A;  3S2H H;  4UPA A;  2N8N A;  3CW2 C;  4JI1 L;  4JI4 L;  3L7Z C;  4OWX B;  2K4K A;  4X64 L;  2JA5 H;  3S15 H;  2JEA I;  4BA1 I;  4O2D A;  4DR7 Q;  3TQY A;  1IYJ B;  4X62 Q;  2YTV A;  2VQF Q;  5M3F G;  2R7Z H;  1CSQ A;  2H5X A;  1QVF A;  4IFD G;  4HID A;  3KF6 B;  1GO3 E;  4PZ6 A;  3RN2 A;  1I94 Q;  2I5L X;  2OQ0 A;  2FXQ A;  3CCE A;  4DV2 L;  3HOY G;  4DR2 L;  4DK3 C;  2D0O A;  4NPS A;  1ASZ A;  4LF7 Q;  1IXR A;  3CD6 A;  1YEZ A;  5IP9 G;  4C2M H;  2BH2 A;  1G51 A;  1XPU A;  3U50 C;  3A0J A;  1N36 Q;  1X56 A;  3DM3 A;  3ULJ A;  3KDF A;  4DV7 L;  3HKZ E;  1J5E Q;  4IJL A;  1C7Y A;  3CME A;  3KDF B;  5M3M H;  3EBE A;  1PH6 A;  4JYA L;  4GKJ Q;  2OQK A;  3FHW A;  3PIO A;  1PYB A;  4HIO A;  4BBS H;  2UXD Q;  2HIV A;  1E7Z A;  4X66 L;  4AQY Q;  4LF9 Q;  4NXM L;  4MZ9 A;  4OON A;  1CSP A;  3K0X A;  2PMZ E;  2ZJR A;  1OXS C;  4A3M H;  1Q7Y C;  1BVS A;  1HNX L;  1D8L A;  4JI6 Q;  2KEN A;  4OO1 I;  1VQH A;  4DK6 C;  5C4X H;  3PO2 G;  4LF8 L;  4GS3 A;  5C0X I;  4YHH Q;  3J81 j;  1EUJ A;  4PMW A;  4NB3 A;  3HOU G;  3G48 A;  3TRZ A;  5GAH C;  2CQO A;  1YHB A;  5IYC H;  1XMQ Q;  1VQ6 A;  1G6P A;  3FKI H;  5LMN L;  4DR4 Q;  2HIX A;  4JI6 L;  4A93 G;  4HJ7 A;  3PO3 H;  5AJ3 L;  4A3L G;  4LFC Q;  5IWA Q;  5IP9 H;  4A3E H;  4A3G H;  1QVG A;  5FLM G;  4GNX A;  5HY6 A;  3M4Q A;  2K50 A;  2R6G A;  1G29 1;  4IPC A;  4LFC L;  4A76 A;  1KC8 C;  3ZJY C;  5AJ3 Q;  1N32 Q;  3M4P A;  4YWK A;  3AFP A;  4GKJ L;  3EN2 A;  1KQS A;  2JK8 A;  3KOJ A;  1K73 C;  1VQF A;  2I0Q A;  5LMN Q;  3LGJ A;  1YI2 A;  4R4Q A;  1FJG Q;  1FL0 A;  1HH2 P;  3OYY A;  1QUQ B;  5GAE C;  4DV1 L;  2K5H A;  4HJ5 A;  1X9N A;  4HIK A;  1UWV A;  3GTJ H;  1VQP A;  4ME3 A;  1HJP A;  2I5H A;  1YJW A;  4GLA C;  2RF4 A;  5ELO A;  4LF7 L;  5K36 G;  4OX9 Q;  1NBW A;  2VZA A;  3KLW A;  5C4J H;  4A93 H;  3CC4 A;  1VQO A;  4AQY L;  4TQU S;  4X66 Q;  2IHF A;  3E9I A;  3HKZ G;  5IYC G;  1PH7 A;  4L5R C;  1WOC A;  4L5Q A;  5ELN A;  2V1C C;  4YY3 L;  4DPG A;  3K80 C;  4AH6 A;  3I4N G;  4DAY B;  2Z0S A;  1N33 L;  3S14 H;  4LFB L;  4X65 Q;  2AWO A;  2JA9 A;  4FDB A;  1IBK L;  4OO1 G;  4DR5 L;  4A3M G;  2KCT A;  2YV5 A;  1Q82 C;  4UP7 A;  4LFA L;  1MJE A;  5LMN W;  2CCZ A;  3I55 A;  4J15 A;  1PH2 A;  4A3D H;  1GKH A;  3K7U C;  2HHH Q;  2F4V L;  2AKW B;  4JI3 L;  1KIX A;  3EIV A;  4PG3 A;  3RLN A;  3I4M H;  4IFD J;  2F4V Q;  1MIU A;  1V43 A;  3HOV G;  1T9H A;  4A3I G;  4K0K L;  2WAQ E;  5M5X H;  4B3T L;  4A3B G;  1CKO A;  3PUW A;  3CF5 A;  3ULP A;  4A3F H;  3A74 A;  2YYZ A;  4LUO A;  1SRU A;  3J80 c;  1YZ6 A;  1HNZ Q;  4R4I A;  2IT1 A;  1HZA A;  2E8G A;  3H0G G;  2L15 A;  2CWP A;  2ZTC A;  3S1R H;  4P74 A;  1Q86 C;  1PA6 A;  1VQ5 A;  3S16 H;  3BJU A;  4R1J A;  3AYH B;  4JI5 Q;  3STB C;  4A3C G;  4B3S L;  3TS0 A;  1OXU A;  5LMU Q;  1PH3 A;  1WJJ A;  4C3H H;  4R4O A;  5JJL A;  1JJG A;  5BR8 L;  2R93 H;  3ER0 A;  1TWG H;  4DV4 L;  2MFI A;  4OXP A;  3GD7 A;  3M4O H;  1NTG A;  1QZG A;  3H15 A;  1IBL L;  1XNQ Q;  1OXT A;  3L2P A;  1PH9 A;  4DV1 Q;  3JAM c;  1FJG L;  1AE3 A;  5BR8 Q;  3K81 C;  3TRE A;  4QQB X;  2OWO A;  2MO0 A;  2Q2U A;  4GKK Q;  4GLX A;  2IY5 B;  1XNR L;  2UXC L;  1L1O C;  3ERS X;  1JT8 A;  4DV6 Q;  4DR1 L;  3T1H L;  2CKZ B;  4YCV A;  3GDE A;  4A3E G;  2YU9 H;  2RHQ B;  4LF5 Q;  1PVO A;  1OXV A;  1Y1V H;  2PQA A;  1A8V A;  1CKM A;  4DUZ L;  4R4C A;  4UP8 A;  1IBM L;  3RLF A;  4KLK A;  2ZM6 L;  2B63 G;  1M1K C;  3K7A H;  4GN4 B;  3HOW H;  4BY7 G;  1EQQ A;  4JI0 L;  1Q8K A;  1XMQ L;  3M85 A;  4KHP Q;  1LYL A;  3J7Z C;  5FJ8 G;  2GVA A;  1HR0 Q;  1LM0 A;  1X6O A;  5C4X G;  4LFA Q;  5M5Y H;  3UDG A;  3CCV A;  4HJ8 A;  1VQM A;  4IJH A;  3W5O A;  1CKN A;  1VQK A;  2MNA A;  4AIM A;  1SN8 A;  2C35 B;  5C0X J;  2R92 H;  2XTI A;  4Y7N H;  1CKN B;  4KHP L;  2PNH A;  1BBU A;  2OTL A;  2CWA A;  4LF4 Q;  2K52 A;  1SLJ A;  4GOP C;  1YJN A;  4BXX G;  5IP7 G;  2Z6K A;  3T1Y Q;  1EIF A;  4MNO A;  1RL2 A;  1Q12 A;  1PFS A;  4HJA A;  1PYS B;  5FLX c;  3TS2 A;  2Z6K C;  4KHZ A;  5GRO A;  5C44 H;  1SE8 A;  1WYD A;  1X65 A;  1K83 H;  1Y14 B;  3FKI G;  4IPH A;  1K8A C;  1XNR Q;  4A3C H;  1PH1 A;  4GKK L;  1YBY A;  5GQO A;  1X3F A;  2LXJ A;  2Y0S G;  3PCO B;  3PIP A;  2QA4 A;  4DV2 Q;  1WFQ A;  2K75 A;  2E2I H;  1J6Q A;  3MEF A;  2ZM6 Q;  3CCQ A;  4JBK A;  1JJC B;  1U5K A;  1XNQ L;  4XIG S;  4BBR H;  3PUV A;  4DUZ Q;  1X54 A;  4A3F G;  1H95 A;  2N49 A;  3G71 A;  1KRS A;  3E0E A;  4DV5 Q;  2HT1 A;  4LUV A;  4JOI A;  3J81 i;  2UXC Q;  1YVC A;  5H1S E;  2IX1 A;  2ATW A;  3I4M G;  3HKS A;  1Q46 A;  4DR3 L;  4BY7 H;  4C3J H;  3CC7 A;  2JA6 G;  1KL9 A;  2DUD A;  4YHH L;  4DUY L;  4RMF A;  4LF8 Q;  1NY4 A;  5E7N A;  3CCM A;  3M3Y H;  1X55 A;  2BH8 A;  2AWN A;  3HOZ H;  4B3T Q;  3HOZ G;  3I4O A;  4O0A A;  4JI8 L;  4EQ5 A;  1E22 A;  1HNX Q;  2A8V A;  2VNU D;  1EYG A;  4K0K Q;  1NMF A;  3KF6 A;  4IPG A;  3S1M H;  1W3S A;  1PHJ A;  3KJP A;  4JI3 Q;  1Q1B A;  1Z47 A;  5EAY A;  2VW9 A;  4B3M Q;  2UXD L;  1AH9 A;  2KHJ A;  2PQA B;  1K3R A;  1PV4 A;  1VQB A;  4B3R L;  4QL5 A;  2ZTD A;  4EX5 A;  4QGU A;  4B3R Q;  2KHI A;  2XGT A;  2VQE L;  3DLL A;  4BBR G;  4Y52 H;  1FGU A;  4QIW E;  4LUZ A;  4UP9 A;  2DGY A;  3UE0 A;  1A63 A;  3S1N H;  1X3G A;  4DKA C;  2JQO A;  2ZJP A;  3J7A 5;  3I7F A;  5C3E H;  2WB1 G;  1XPR A;  4NXN L;  3CPF A;  3AFQ A;  1HNW L;  1HZB A;  2AHO B;  2EIF A;  2LSS A;  1EQR A;  2K5N A;  4P71 A;  3OTO Q;  1S40 A;  4AYB G;  1HR0 L;  4JI7 Q;  4BY1 G;  4DR7 L;  4X65 L;  4JBW A;  3S1Q H;  4LFB Q;  2JA6 H;  4DV0 Q;  4LWC A;  5JJI A;  2JA8 H;  4PZ7 A;  1UEB A;  4JI0 Q;  1KAW A;  4DR3 Q;  1Y1W H;  3M9B A;  5IP7 H;  1L1O B;  1MJC A;  2WAQ G;  3UDF A;  4L5T A;  4LNQ A;  2Q2H A;  3L0O A;  3VDY A;  4LW1 A;  4TVA B;  1GM5 A;  3RLO A;  3GTG H;  2QEX A;  3MXN B;  1QUQ A;  3RZD H;  1XPO A;  2UUB L;  4OX9 L;  4GN5 A;  2GN5 A;  2PI2 A;  3STB D;  3CCS A;  4DR1 Q;  4JOI C;  3GTP H;  1VQ7 A;  2MQH A;  1E1O A;  1TWH H;  2NN6 I;  4JI2 Q;  2JEB I;  1A62 A;  5GAG C;  1R9T H;  4GNX B;  3J80 i;  3K8A A;  2NVX H;  1I50 H;  2OCE A;  3TEH B;  3HFZ B;  3AQQ A;  2F52 A;  5M3M G;  3M7N A;  1A0I A;  1VQJ A;  2B63 H;  4DAM A;  4GOP A;  1NE3 A;  1PH5 A;  4JV5 Q;  2KCM A;  3ULL A;  5C44 G;  1VQC A;  3H3V I;  2NVY H;  4RG1 A;  2WFW A;  3BZC A;  1E24 A;  1PH4 A;  3A5Z B;  2UUB Q;  3U4V A;  3AEV A;  1BKB A;  5M5W H;  5IYD G;  1SR3 A;  5LMU L;  1VQ9 A;  4B3S Q;  3T1Y L;  2AMC B;  4ALP A;  5JEA J;  1GVP A;  4BXX H;  3PGZ A;  4LF4 L;  1OTC A;  1PH8 A;  1D7Q A;  3SGI A;  2D62 A;  1YJ9 A;  2ZTE A;  3JC6 6;  3KJO A;  1VQ8 A;  2GVB A;  3CAM A;  3F1Z A;  3OTO L;  4DV7 Q;  2HQL A;  1JB7 A;  3UDI A;  1QZH A;  4A3G G;  1HR0 W;  1KXL A;  2I5M X;  1VQ4 A;  5IY0 A;  1YHQ A;  3CC2 A;  4A3L H;  3W1G A;  4LF6 L;  2UUC Q;  2BA0 A;  3IRB A;  3PV0 A;  4JBJ A;  4IPD A;  5DLQ E;  4DR2 Q;  1S3O A;  1TXY A;  4L5S A;  2OTJ A;  2VUM G;  1BBW A;  3HOW G;  2D0P A;  3F8T A;  1L1O A;  3PF5 A;  4WJ3 M;  1B8A A;  2ALY B;  4YWM A;  1IBM Q;  3RZO H;  1M90 C;  5C0X G;  1LTL A;  2YTX A;  2VY3 A;  1V9P A;  2R7F A;  1J5E L;  1IBK Q;  1JMC A;  4LF5 L;  2F3I A;  4DV0 L;  1N36 L;  2NN6 G;  1YIJ A;  1N33 Q;  1EWI A;  2RCN A;  4MTN A;  4DV6 L;  3T1H Q;  4JI1 Q;  2NZO A;  4A3B H;  1JE5 A;  4JCV E;  4JI7 L;  2ASB A;  1YHA A;  3NBH B;  3HOV H;  2UU9 L;  1TWA H;  3NEL A;  3PSI A;  1HNW Q;  2BA1 A;  4DV3 L;  1EIY B;  2K5V A;  1KD1 C;  4H02 A;  3PUX A;  2B29 A;  1MKH A;  3U58 A;  2NVT H;  1P8L A;  4DV3 Q;  3PF4 A;  2UUA Q;  4JI8 Q;  2JA8 G;  2UU9 Q;  2JE6 I;  4GOP B;  1VS0 A;  3GTK H;  4BY1 H;  4A75 A;  1X3E A;  2RHS B;  1K0R A;  3I2Z A;  5J3B A;  2JJQ A;  3CMA A;  2NZH A;  4X64 Q;  2JA7 H;  4QJF A;  4YCW A;  1N9W A;  2ZJQ A;  2UXB L;  4JI5 L;  4C3I H;  5C3E G;  5GAD C;  3CPW A;  1N32 L;  3GTM H;  4B3M L;  4HJ9 A;  2VUM H;  2ID0 A;  3BZK A;  3F2B A;  4A4I A;  1OXX K;  4DV5 L;  1UE6 A;  4KI0 A;  1AE2 A;  1EFW A;  2JA7 G;  4LF6 Q;  4IFD I;  2MO1 A;  1UE1 A;  4JG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...