1B2TA

Solution structure of the cx3c chemokine domain of fractalkine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
MQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FRACTALKINE)
publication title Solution structure and dynamics of the CX3C chemokine domain of fractalkine and its interaction with an N-terminal fragment of CX3CR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b2tA00
1F2LA 1AZQA 4X3TA 1XYIA 1QG7A 2R3ZA 1B4OA 3GV3A 4IUUA 2L11A 1MSHA 4IUVA 4XDXA 2B2YA 5DNFA 5E4XA 1AZPA 1HRJA 2B2TC 2NZ1D 1ZXTA 1CA5A 1VMPA 1NCVA 2FHTA 1Q3LA 1QE6A 2B2UA 1WD0A 2B2YC 2MP1A 2RA4A 1RJTA 2FINB 4ZAIA 2MGSA 1WD1A 2NYZD 4QUCA 4HSVA 2EOTA 1J9OA 2VXWA 1WTWA 4RAUC 4QUFA 2DY8A 1KNAA 5EQ0A 1X32A 2M2LA 2SDFA 2L12A 5EKIA 1BF4A 1F9RA 1TVXA 3DEOA 1IL8A 1ML0D 1HFNA 2K1BA 2FJ2A 1SSOA 4HAEA 2FFKB 5D14A 1B3AA 1DZ1A 1B50A 2J7ZA 1NR2A 2HUGA 2KEEA 2KVMA 1CM9A 1BO0A 3I90A 3MWYW 5EPJA 1BBXC 1AP0A 3KUPA 1M8AA 1RODA 3IL8A 1WTQA 3I8ZA 1WTRA 1IKMA 4R8IA 1SAPA 1LV9A 3GV6A 5AFWA 2DY7A 2EPBA 4ZLTF 1EIGA 1PLFA 3LWEA 1U4LA 1CA6A 5T1IA 2H1EA 4RA8A 4CJ1B 1XX8A 2HDLA 2K28A 4MN3A 4CJ2C 1G2TA 4IUQA 4UAIA 1WTVA 3FDTA 2B2VA 4XT1B 3N52A 3Q6SA 1IKLA 2BDNA 4ZKBB 1HUNA 1ILQA 1ICWA 2B2UC 5CBAE 5CORA 1WTOA 4U68A 1EL0A 1HFGA 1JICA 1O80A 3MTSA 1BNZA 1VMCA 4OIJA 5EPKA 4CJ0B 2K04A 2B2VC 4ZKCB 1G2SA 3TZDA 2IL8A 1U4RA 2XIWA 5COYA 3FPUB 5CMDA 3P7JA 2HCCA 1EIHA 4X3SA 5D65A 2CVRA 1A15A 1KNEA 5EJWA 1O7ZA 1EOTA 1E0BA 3R93A 2L1BA 1J8IA 5EPLA 4O42A 1B53A 4OIKA 1MI2A 1DOKA 3SVMA 1F9PA 4XT3B 4HCSA 1JE4A 3ONAB 2L9HA 2X6LA 1S4ZA 2K01A 3F2UA 4MHEA 2RSNA 2KOLA 1ESRA 2N55A 4LMQD 4R9WA 1HHVA 2KEDA 1G91A 1MGSA 2FMMA 2EE1A 2JYOA 2N88A 2L4NA 3D6WA 2KUMA 3TN2A 4NW2A 1DONA 2K05A 3KBXA 1NAPA 4IUPA 4X3UA 3IFDA 5T1GA 1PDQA 2Q8RE 1B2TA 2RVLA 4RWSC 1G6ZA 3I91A 1HA6A 1RHPA 1X3QA 2RSOA 3QO2A 2B2TA 4IURA 4IUTA 4X3KA 5E4WC 2D9UA 4ZK9B 5CBEE 1WVLA 1WTXA 2X6GA 1DOLA 2B2WA 3UI2A 1PFMA 1ILPA 2X69A 1O7YA 3I3CA 1F9SA 2Q8TA 1RTNA 2B2WC 2KECA 1EQTA 2MJ8A 3DEPA 1SDFA 3HP3A 3DM1A 1PFBA 1QNKA 2MPMA 1U4MA 1GUWA 2HDMA 1MSGA 3G7LA 2JP1A 1PFNA 1NR4A 1X3PA 1DOMA 3H91A 1F9QA 1WTPA 5JJZA 1C8CA 1HUMA 1RTOA 1U4PA 4DN4M 4HEDA 2HCIA 2NWGA 2K03A
chains in the Genus database with same CATH superfamily
1YNXA 4UP7A 3HS0C 2XWJB 4AYBB 5E4XA 3P1HA 2AQ3B 1EIFA 1Q12A 4JI4Q 2YU9B 5LL6X 1QE6A 2FINB 2B63G 1Y1WB 2N8NA 3A7AB 2CQAA 3FKIB 3H09A 3HZXA 1Q46A 4NDXA 2XRSD 3V2TA 5IWAQ 5JJKA 1LT6D 5D14A 5GAHC 4LNQA 2J7ZA 4C3HH 1ONLA 3PIP3 2UXDQ 4C3IB 1RODA 1UNSA 3I8ZA 3GP7A 3S1RH 4HIKA 5AFWA 3UDFA 5I9PA 3I4MG 2HHHQ 4CKBA 2WB1B 1EY0A 3JAMi 1SNPA 1XX8A 2VQEL 1NY4A 4CGYB 1LTAD 4U68A 4CKEA 1O80A 2E8GA 2JJQA 4Q5VA 1XXGA 5C0XI 1JC7A 1G6PA 1Q1BA 3P7JA 2GA4B 5D65A 1UUPA 2Z4HA 3CCMA 3VR5A 2L1BA 5IGFA 4JI8Q 3UE1A 1MI2A 4IPDA 3URYA 4CDCC 5IY0A 3TP5A 1JWMD 3FP9A 4DAPA 3HG9A 2X6LA 2NVXB 2F0QA 5M5XH 3NTKA 4GN5A 1QWYA 3K80C 5LMNW 3D6WA 4RGTA 1PTOH 3S2HB 4NW2A 2K05A 3DWAA 2WINB 4UPAA 3SE0A 3U58A 1JCKB 1ZEQX 4ZUIA 3TP8A 1VQJA 4IO9A 1GHJA 4DKAC 3RN5A 4IPHA 1SJED 2OCEA 4A3FG 1WI5A 3D31A 4JV5Q 2GN5A 3CQZB 1G8ZD 3G7LA 3BJUA 2F0MA 3KLWA 3K0YA 2VB2X 3MEHA 1X3PA 3K5LA 1F9QA 2R92B 3D4RA 1XPUA 1BCPC 2K03A 5DLQE 1AZQA 4DF7A 4X64Q 1TS4A 1MSHA 1BCPD 1LTTD 5C3XA 3TS2A 1EU4A 2KCNA 4B3RL 2HQLA 2BA0A 4JOIA 3QWNA 2VB3X 1PHJA 4XTCS 1IBKQ 4JI6L 1IYVA 4QIWE 5C44G 3GTPB 4DV6Q 1V1QA 5IGEA 2EXDA 4YY3L 1I3QH 4RMFA 4LFCL 2I5LX 3S16H 1JQYD 1X32A 1X56A 2BOSA 2H4OA 4BXXH 3HOZB 1SNDA 4DV3Q 4R4IA 2E2IH 1WTQA 3J81c 2AKWB 1PH4A 1JOKA 1IBLL 3E9IA 3VR2A 1N33L 2UUAQ 1CZGA 2UUCL 1SNCA 3HGBA 5AJ3L 3RMHA 3IFTA 2BDNA 2D5DA 1OTCA 1YIJA 4C3JH 2F4VL 4CJ0B 3S24A 2A73B 4NXMQ 1DGSA 3NEMA 3FPUB 2HCCA 5M5YH 1TQOA 3PO2H 1QNUA 4I65A 4A3JB 2EVBA 1AH9A 3O13A 4OHJA 1B53A 3LWUA 2KJXA 1HNXQ 5IP7G 3LGJA 4LF7L 2B29A 4R9WA 3KF8A 1EYAA 5CV5A 3QOJA 1C9OA 4G7HC 1K8MA 4H7BA 2E2JB 3M4YA 4K8JA 4RHSA 2E5LL 2CW0C 5I2XA 1HA6A 1D1IA 2CW0D 2NB0A 2QW7A 4QQBX 5BN3A 2E75C 4WJ3M 3B6YA 1CK1A 3S9WA 4FXKC 1IYUA 1N34Q 2KCCA 4A3LG 4MTKA 2QGQA 2V1CC 2LXJA 3NHHA 3JAMc 1VQCA 4MTNA 4DU9A 1U4MA 3OHXC 1W3SA 4LFAL 4A3IH 3VDYA 1XPOA 1I94L 3PIO3 2JA7B 3NELA 3PUVA 4QF4A 1YZ6A 3TMEA 4G7ZC 2A1AA 1X54A 2JA9A 4HEDA 2R7ZH 1B44D 1PZJD 2JEBI 2R3ZA 4YCVA 2JK8A 2Q8IB 3HOWB 1DM0B 3GTMB 2B2YA 2UXCL 4JK1C 3EROA 3QB3A 4FXGC 4N9PA 3F2DA 4A3KH 3CHBD 3KLRA 4RKBA 2FHTA 5G3LF 1JORA 1PFSA 5C0XJ 1PRTF 4DR4L 5BN4A 2JA5B 4RAUC 4DV7L 3HOXG 4FNFA 3J7ZC 1PV4A 3ULJA 4B3SL 1W6KA 3UDXA 2AQ2B 2FFKB 1QZHA 4K6DA 1WJJA 1CM9A 3KFUA 3M3YH 3IL8A 2CWAA 5FO9B 3NUCA 4TVAB 5ELBA 3KJPA 5LMUQ 4K2KA 3VYTA 5HGQA 4S3SA 5FLMG 4B9XA 1UEAB 3J80L 3S17B 1SMYC 5ELCA 3PO3H 1TWHB 1K8GA 3AU7A 5JJLA 1SMYD 3DHQA 3CP0A 2B39A 3C46A 3C1FA 2Q2UA 1WOCA 5C5LA 1U4RA 1HQMC 4YHHQ 4IJLA 5CMDA 2R93H 2AUKA 2JA8G 3A0JA 1HZ9A 2RDHA 3BYYB 1D5XC 3F1ZA 3H94A 1NTGA 4HTHA 3MXGA 1AN8A 4TQUS 1EY6A 3Q23A 3F2UA 4MHEA 4BBRH 1T5XD 2PCFB 1MGSA 4GOPB 1I6VC 4LJZC 1SMXA 4GKKQ 1AFPA 2YV5A 2NVQB 2Z8LA 4LF9Q 1JJGA 1Z6HA 1XNRL 1EUJA 2X6GA 3K8AA 4HSPA 1D8LA 5CV6A 1UE5A 3UI2A 2BE5C 3GTKH 2EYMA 3PO3G 1LTSD 1DD2A 1Y8OB 1X3GA 4IPGA 1TT2A 2ALYB 3I2ZA 3HOYG 1XTDA 5ISRA 1SROA 2YU9H 1HR0L 1AEXA 2JQOA 1D5MC 2JA6B 2R93G 2CCZA 1CKMA 2AMCB 5E1FA 4ZCKA 4OEMB 3EFXD 1Y1WH 1C8CA 3FKIH 3F2BA 4A3EB 3GV3A 4IUUA 4XQQA 3J81j 1HRJA 4OX9L 3CCLA 3K57A 4C3IH 1VMPA 1NCVA 2WAQB 1CHPD 4B08A 1L1OA 4BY1B 2RBMA 3KLSA 1B7YB 1FJGQ 1SFOB 2WP8J 1WTWA 2NN6H 3KDFA 4QUFA 3J81L 2PQAA 1EQQA 4OGQC 4AYBE 1L2FA 4UHVA 4IFDG 4AYBG 4TKOB 4LFBL 1BCPF 2AWNA 1NR2A 1S5BD 2KEEA 3MWYW 1SE3A 1WTRA 3C1EA 4DV1Q 4G4KA 3GV6A 2KCTA 3LWEA 3KF6B 1VQIA 4UY8C 2J4XA 3PUYA 1KQSA 5T1IA 1HNWL 5A2QL 3FKIG 2EZVA 1G2TA 3OWEB 3AEVA 4IOCA 2NVXH 4C3IG 3KF8B 4G57A 3ER0A 1KHIA 4JI3L 4DR3Q 4LF8L 5FLXE 3GTGB 3S2DB 3K5OA 3PIPA 1CZWA 2WB1G 1V1PA 3OTOQ 1CKNA 4P75A 1E0BA 1KC8C 1VQDA 1PYWD 4WFN3 4PMWA 4LF4Q 4P72A 1ZKOA 5D3IB 2FMMA 1ENAA 4DK3C 1W2BA 1K83H 4K0KL 5KNBA 1VQGA 2JSOA 4A3BG 4HMJA 1NAPA 2HT1A 3SGIA 3JAML 5EKKA 1L0WA 2R92H 1GD7A 3V05A 1WTXA 1Y14B 3CMAA 1VQOA 2X69A 1F2YA 3D4WA 5CGKA 5EGTA 3GTOH 3K58A 2HIXA 2KECA 5C3EB 1YNNC 5C5MA 1B9NA 4J6HA 1PRTB 2P5ZX 4N8X1 1YNND 2Y0SB 4DV4Q 4C3JB 1HPCA 4JVZA 4GOPC 3D6CA 3GTPH 4RFBA 1NSNS 3H91A 3J7AF 4LAAA 3E0EA 1VQPA 1AE2A 5M5YB 1RTOA 1Q86C 3HOZH 1Y1VB 1B1ZA 1YNJC 2NZ1D 1KRSA 4U673 1EZ8A 1YNJD 2YTXA 3PUZA 2ID0A 2QILA 2Z0SA 5KGUA 2R92G 1KDCA 2Z1CA 3SK6A 1TU2B 4QB4A 1FGUA 3Q22A 3TRZA 2OTLA 4XYOA 1JB3A 4EQ5A 3W1GA 1STEA 3GD7A 1KABA 4I7AA 4NXNL 1HCZA 4FF1A 3K7AH 2F0UA 5A35A 4K5WA 1U4LA 4A3JH 4PV1C 4KKSA 4QL5A 4ZKBB 3K6OA 2F0FA 5I9OA 3VR6A 1LACA 1I4RA 5KIXA 1SE2A 4DR5L 4X62L 2E2JH 1VF7A 2A5HA 1E2VA 4LW1A 2ZXOA 4EQPA 2ZTDA 4A3KB 1VQ4A 2O2LD 3DM3A 2F0IA 3OSOA 3U4VA 4AQYL 5EPLA 1JWSD 2O4XA 4OIKA 4PZ6A 3OW7A 1OXXK 1RIPA 2ES2A 1I4HA 4AIMA 2NZOA 2OXPA 2A6HC 4HJAA 4JI2L 3TN2A 4A93B 1NNXA 2JA7H 2A6HD 5IYBG 3OWFA 1IBML 1L0YB 1WVLA 2G9DA 3DLLA 1Y8PB 4OONA 5DEHA 5IP9H 1PH2A 3T53B 2BH2A 2VQEQ 1F9SA 3TQYA 3HOWH 3GTMH 1U0LA 5K36H 1X3EA 2QA4A 1CUKA 1FR3A 5JEAJ 3EN2A 1DJRD 2MQHA 3G6JB 3CCVA 3C2PA 4EVOA 1L1OB 2JP1A 1PH3A 1Y8NB 1WTPA 2JA5H 1V8QA 2OF1A 1A3UA 4TSSA 4EGVA 2UXBL 2MNAA 5JAVA 1VQKA 3AYHB 1F2LA 1XMOQ 4ZRZA 1MIUA 1K3RA 4XDXA 1ESFA 1AZPA 1N32Q 1LABA 3KLSX 4QJFA 1QVGA 4IZ8A 3I4NB 1A62A 1EWHA 4GLAC 4JW0A 2B2YC 2JA7G 2UUBL 3OOCA 1S40A 1PRTC 2BH8A 1XMQL 2I07B 1WFQA 5G3LD 2KHSA 3PIOA 1KNAA 1PRTD 1QUQA 1KTKA 2ATWA 5IP9G 3T51B 1KL9A 1N36L 1GUSA 1EEFD 1K73C 3HOWG 3SHLA 5C4XB 1TWHH 1E2ZA 2FJ2A 4GZYC 2KBNA 5JOBA 1NUCA 3NP8A 4MZ9A 3T1HL 2A68C 3HKZB 3L3OC 3I4OA 4OO1H 1M4VA 1TWCB 2DNEA 2A68D 3SK8A 1TXYA 3UDGA 4BBSB 4Z9CB 4L63B 2R61A 4IUQA 4A3MH 2QKIC 2B2UC 3H3VI 1SR3A 1TY2A 5GQOA 1U9RA 1PH8A 2JXMB 4DR6L 3T1YL 1S5DD 4JI1Q 2UU9L 2K75A 2ZJPA 3W3AA 4YIJA 3I7FA 3OIPA 4KJNA 4JI7L 3RZOB 4K5VA 1A15A 2ZM6L 4JI6Q 2NVQH 2C5CA 1A6XA 5CV7A 4YY3Q 5GROA 4BY7B 2XSCA 3GTJB 2AQ1B 5M3FB 1DOKA 3X3MA 4LFCQ 4C1NK 4QCLA 4C56C 2H5XA 2KOLA 1B3QA 1EY8A 3AQQA 4DR1L 4BWGB 1JMCA 4YWLA 4DR2Q 4LUOA 2Z6KA 4BA2I 2JA6H 4OWWB 2K5VA 1UE1A 2PW7A 5BR8L 2NTTA 1IBLQ 4ILWA 3AMUA 2R6GA 4NMZA 3OMGA 3PMFA 1EY4A 4C2MB 5KEEA 3J80c 1YJ9A 1PFMA 4JI0L 4JBJA 2PZWA 4A3EH 3CKIB 5LL6S 1RTNA 3DEPA 3BU2A 5ELDA 3BVGA 1QJOA 2NBFA 4P2CB 2A69C 3ULPA 1Q90A 2E2HB 5IYDH 1SXTA 4C3HG 2A69D 4BY1H 2R7FA 5JPNC 1SFOH 1ET9A 1I50B 2PPBC 2F0WA 2QDBA 1RDPD 1C4QA 2K14A 3SDZA 5FO8B 1JJCB 5C4HA 5IT9E 1GUTA 2EYHA 1SYCA 4PMBA 5J22A 4DV2Q 5I6WA 3P75A 4ZUJA 1WD0A 4B3ML 3S15B 1SBBB 2EJMA 2VQFQ 1SYGA 3A5UA 1K83B 1NBWA 3T4AC 1K0SA 3CMEA 1L1OC 5EQ0A 4A76A 2RCNA 3TDQA 1J6QA 2EY5A 5EKIA 1F9RA 2YYZA 1HFNA 2CH4W 3G48A 3NENA 1TWGH 2K5HA 3I90A 5EPJA 1H9RA 5IGBA 4BY1G 2XVSA 3GTOB 3GTGH 1NMGA 1SAPA 3S2DH 1WYDA 3VYUA 2EPBA 3IKJA 1I94Q 1EIGA 4E6IA 3G4SA 5FJ8H 4V0BA 2PNHA 1SYEA 3PUWA 1O78A 3BZDB 2IPKD 1A2UA 5CORA 3MXNA 1JICA 1SNQA 4LF6Q 1VMCA 2K04A 5ELFA 1CSQA 1STBA 4GN3B 5IWAL 4KI0A 1IHZA 4DK0A 1O7ZA 1EZ6A 1TS2A 2K5QA 2F0HA 2WKCA 4DV7Q 5KYIA 4XT3B 3M7NA 4P71A 5IODA 2K01A 1KD1C 2EXZA 2HHHL 4K8IA 5C3EH 4JBWA 2JYOA 3OW2A 4KHPL 2KUMA 1VQNA 5CV4A 3AFQA 2F1MA 5E7NA 5EKLA 1YEZA 1RHPA 2EQSA 3ERQA 4K14A 1XNQQ 4KY6A 3NXWA 3FVQA 1TR5A 1YVCA 3WWVA 3K7AB 1Q7YC 4DNTB 4L6TB 1LT5D 1Y1VH 4DPGA 4I7ZC 4BXXG 2WIIB 4X65L 1SDFA 4IALA 1QNKA 2E76C 4LF5L 4R4QA 2NVYB 3NSWA 4CDDC 4YCWA 2G9HD 4IFDI 1VF5C 1B70B 4WJ4A 2JEAI 4GNXA 3G6EA 4Q0FA 3E6ZX 1KIXA 3BZCA 1B4OA 2SOBA 2B8GA 1PXUA 1A2TA 3A55A 4OWTB 5HY6A 4ME5A 3FMCA 4UDUC 4C3JG 4ZAIA 2AUJD 3W2DA 2VXWA 2DY8A 1JOQA 1PH5A 1YBYA 3PO2G 3BDOA 5J3BA 4ZQ3A 4JV5L 1GVPA 1HNZQ 1XNRQ 3KOJA 1Y1VG 4LUZA 1BOSA 3MA2B 1WCMB 1CTMA 4J15A 4XYQA 1R9TB 5NUCA 2K50A 4CKCA 3ND9A 1EFWA 4ZLTF 4X64L 2LKVA 2RDFA 1QVFA 3VA5A 2F0NA 4DAYA 1L0XB 1HJPA 2OTJA 1VQHA 3PGZA 4RA8A 3N52A 1ILQA 2RKSA 4NPSA 1EL0A 1IXRA 3NBHA 4DV6L 1ASYA 1JT8A 1LTID 2IL8A 5FK9C 2EYLA 2F0SA 1YHAA 4A93H 4CBVA 1GUOA 1SJHD 3D0FA 1F77A 4A3IG 4A3CH 2BDOA 1I4XA 1TWAB 4PG3A 3CCEA 4K6LA 2IX0A 5EBDA 1YJWA 2R7ZG 3MFGA 2EE1A 2Z4IA 2L4NA 2KQ3A 2MO0A 2NTSA 5F2DA 2B63B 3VA7A 4A3KG 4JI5L 4KHVA 2YTYA 4RWSC 2PI2E 3T56B 1VDZA 1X3QA 4KKTA 4YCUA 5D3DA 2EYJA 5E4WC 1HNWQ 1LT3D 1Q1EA 2K52A 1NMFA 3E5SA 3CC4A 1QZGA 4L8JA 3I4NH 4A3MB 4H13C 3I4MB 2HDMA 2D2CC 4M1UB 1PA6A 4JI3Q 5M5WH 1S5FD 5BN5A 4KTAA 1NJIC 1HNXL 2D62A 4PZ8A 4ALPA 3HOUH 1PFNA 1NR4A 1TY0A 1YJNA 1UE7A 3GTLB 1QOHA 2NWGA 5C4XH 1BUVT 5DNFA 3I70A 1IL2A 3S14B 3MAQA 2C9OA 1PH7A 1ZXTA 1JJ2A 1GHKA 3GDEA 2Q2HA 2BE5D 1T9HA 3OIQA 4B3TL 1N34L 1YI2A 3DMUA 1TWCH 5JJIA 3NE5B 4BBSH 3H0GH 5J39A 2PQEA 1X9NA 1UE6A 2L15A 1BF4A 1TVXA 2M00A 2PI2A 3SR1A 3I4NG 4X66Q 3DWQA 2IX3A 2PMZE 4CDFC 4FYDA 4BBRG 1H9SA 1CFMA 1B8AA 3RZOH 2PNRC 1SYBA 3S1NH 4BY7H 3GTJH 5M3FH 5M3MH 5C4XG 3PCOB 5IIFA 5CV8A 3HOVB 3A8JE 1ICWA 5CBAE 1HFGA 2KENA 1OO9B 2BA1A 4BBSG 1EOTA 4XIGS 1VQ8A 4C2MH 5FLXL 4HCEA 1LTGD 1Y1WG 4IFDJ 1JE5A 3OMCA 4LUVA 1CT1D 1STAA 5LMUL 3VR4A 3ICEA 5C44B 1F2ZA 5FKAC 2RQXA 2E2HH 4X6AH 2K5WA 4QIWB 1TWGB 3BZKA 4IUPA 4ID6A 5KYLA 3FEWX 1I50H 1LT4D 4RGNA 2WB1E 4BY7G 1D2BA 2F0GA 5M3FG 4GKJQ 3BDLA 2NN6G 3R2TA 4YHHL 4DUYL 4JC0A 1PZID 1BR9A 2Q8TA 4JPBW 2RHSB 2ZTEA 1OXUA 3DM1A 5I4DA 1FGBD 4K5XA 3RNUA 1FYCA 2DJGC 1MSGA 1AW7A 1BXTA 4KKUA 3S15H 4CHTB 1CSPA 5TSSA 2E2DC 5I2YA 4WORA 3M4OB 3W5OA 4GS3A 3L7ZC 1RCVD 1SE8A 4IJHA 2L0CA 3RLFA 4O1NA 4MIUA 2L11A 2WACA 4GKKL 4GN4B 1F2MA 3N6RA 4LF9L 1ENCA 1IW7C 1TS3A 2K7VA 3GO5A 2NYZD 4KLKA 2F0JA 2MFIA 4DA2A 1JR0D 4DAYB 3U9SA 4DV0Q 3NTHA 1HTLD 2IHFA 4J1MA 1ML0D 2K1BA 2I5HA 4KY5A 4C1NI 2HUGA 3RLOA 3CC2A 2ASBA 1IZ6A 2HIVA 1CQFA 2K5NA 3J7YW 4H0LC 2SEBD 1EIYB 1AE3A 2H1EA 1OXVA 4DUZL 1RL2A 4UAIA 4XT1B 3Q6SA 1IKLA 4JOIC 1E7ZA 4L5SA 3V96A 3EQLC 1FJGL 3MTSA 1VQ5A 3AB9A 3HRZC 4RH6A 4OO1I 4A3GB 1V1OA 2IWHA 5COYA 3VYSA 5DM63 2Q2TA 1OXSC 2A8VA 2UUBQ 2Z9HA 5L37A 1XMQQ 3TREA 1PH9A 3NWTA 3MHBA 1A8VA 1C0AA 5CYUA 4DV1L 1TS5A 3A5ZB 1X6OA 4IUNA 1JE4A 5GAEC 4JYAL 1ESRA 1GO3E 3HOZG 4Y52H 3J7A5 4XQNA 4FVMA 2NVYH 3HOXB 3KBXA 3TSSA 3A8KE 1PDQA 1GM5A 2F0OA 4IURA 2D9UA 4R1JA 3DWPA 1P16A 1ILPA 4IQZA 4ME3A 3S1QB 5JEAH 2MJ8A 3OTOL 1C7YA 3HEJA 1PFBA 1N8RC 3CCJA 4PMCA 2ZXPA 3TEHB 2DGYA 2K4KA 4PZ7A 3HFZB 4XXEA 1VQ7A 4EX5A 3WOEA 1BQQT 4M8AA 4KN4C 4RHRA 4RCOA 3VYRA 5T1GA 1I4GA 1K9MC 1E24A 4A3JG 1FVIA 1STYA 4GLVB 3I55A 1WCMH 3STBC 1LLRD 1R9TH 2SNMA 2JA8B 3H15A 3IRBA 4DR1Q 1SEBD 2IX1A 5BR8Q 1BDOA 4KN7C 3QG1A 4FP5D 3NQTA 2M2LA 4EQOA 5IYCH 4DV4L 1FD7D 4HAEA 3KDFB 4ZYSA 3ITPA 2PQAB 4DR7L 2OT2A 4KK7A 4RCNA 3FRPB 4R8IA 3PF5A 1K8AC 4KV6A 4K2LA 1P8LA 1MD2D 1TWAH 5M5WB 1E1OA 4CJ2C 3CPFA 3HOUB 2F03A 1HUNA 2F0DA 4OIJA 5K5PA 1QILA 2E74C 3H3VC 3MFYA 2B63H 5K36G 2HD3A 5JPMC 3K59A 1ZYRC 3PSIA 3QIAA 1FNUA 1LTLA 3RD4A 3SK5A 2AWOA 1MBYA 1ZYRD 2JA5G 5IYCG 4L5QA 3P20A 3SVMA 2N78A 4L5RC 1V1PB 3H0GB 1V43A 1CKNB 3LNNA 1I6HH 4OL7A 2RSNA 4R4TA 2SNSA 3UDIA 3A7LA 2KEDA 5LMNL 4IN3A 3I4MH 2N88A 4O2DA 2IJ0A 1DONA 4X3UA 1LUZA 3IFDA 2NZHA 1QB5D 1E3PA 1DCZA 1STGA 2Q8RE 3RZDB 4B3RQ 4KMUC 2ZJQA 3GTLH 1JB7A 2B2WA 1PVOA 3L0OA 5CR3A 1SNMA 2O5IC 3S1NB 4UP9A 1GOZA 3S14H 5M3MB 2I46A 2MPMA 4ODGA 3D8GA 1I4QA 1LM0A 1VQAA 2VY3A 4H02A 3CW2C 2KA7A 4HR7B 1XPRA 1EQVA 2F0TA 2F3VA 4OO1G 2B2TA 2KVMA 4QGUA 2HCIA 1HZCA 2XTIA 1XYIA 1N33Q 3DXJC 1MJEA 1MHWC 4N9TA 1LO5D 3U4ZA 2UUCQ 4A3MG 1YITA 2VNUD 1K0RA 5AJ3Q 1TKWB 2RDGA 1CA5A 1NE3A 2RA4A 3WOFA 1EQRA 1RJTA 2F0LA 4KHPQ 4QUCA 1VQMA 2F4VQ 5IT9L 1J9OA 3U9OA 3M9BA 1J5EL 1LTBD 3MVVA 2I0QA 3DEOA 4A3FH 1K3BC 3L9AX 3CF5A 3HOVH 1STNA 4LK1C 1BKBA 1SSOA 2XWBB 3PQIA 4A3BB 1BBXC 2BCOA 2FXQA 1AP0A 4X65Q 1M8AA 5E3FA 2VL6A 1IKMA 4LF5Q 1A63A 2EDGA 1XMOL 1H9KA 2VUMB 1ET6A 1PYBA 4LF7Q 2F0KA 3EVQA 2WFWA 2JA6G 1N32L 2N49A 2F0EA 3PUXA 3TP6A 3DUZA 1KDBA 2HDLA 4POGA 1ICFB 2E5LQ 1WTVA 4DV5L 2B2VA 1FNVA 2R7DA 1EWIA 4QMGA 3NBIA 4J8QA 1WTOA 5HGTA 1EEID 4NB3A 4A3EG 5C3WA 5C44H 2XIWA 2WAQE 3R2IA 3AFPA 2EY6A 2WAQG 5IYDG 3U50C 4HJ8A 3F8TA 5GADC 1EWCA 1CKOA 3MC0B 3A56A 4LFAQ 4DAVA 1VCIA 2F52A 2FMCA 4GOPA 3HOVG 1D6EC 1F9PA 4G7OC 2QCPX 2CH4A 3EJIA 4DXGA 3K5MA 4JI4L 5C6AA 4BA1I 1DXMA 2K33A 3E0JA 1Q8IA 2QEJC 1JOOA 1B2TA 2UXCQ 2RVLA 2MO1A 3M4OH 4X3KA 2CKZB 2XNAC 1UEBA 2Z6BA 5CC4A 4DK6C 5J1ZA 4JI1L 4DR4Q 1M1KC 2UXDL 4IOAA 2MUYA 4DFAA 4DNRB 1A3TA 4B3SQ 3EA6A 2D0OA 4RG1A 4CDEC 1DOMA 2GVBA 5JJZA 5FLXc 4F88A 1XJVA 1U4PA 5IP7H 2IW3A 4R8NA 4DN4M 4R4CA 4DR2L 1QG7A 5FJ8G 3CD6A 4XQJA 1BVSA 2HQEA 3H3VH 2K32A 1PYSB 2A19A 4WRDA 3I4LA 3E9HA 1KLUD 1Z7TA 1PTOF 4OXPA 4JI5Q 4JI8L 3OPOA 1I5FA 4A3LH 2SDFA 2L12A 2EY1A 1B3AA 3R8BA 2F3IA 3KF6A 2IY5B 3TS0A 1QUQB 2A74C 4A3GH 1C48A 3BG3A 5C3EG 3KBGA 2DY7A 2Y0SE 2EIFA 2ZXRA 1UAPA 2PZUA 1OXTA 4A3DB 5C0XH 2Y0SG 2D0PA 1SNOA 5JVH3 3CCUA 4KJOA 5C4JB 3GTQH 1CQVA 2EY2A 2K28A 4DV2L 1VQ6A 5DM73 1R4QB 1TWFB 1H9MA 2VQFL 3NTIA 1YHQA 3E3XA 1XWEA 4F8MA 3BVZA 4FF4A 2EJGC 3ULLA 3HOXH 2PYKA 1EIHA 5C4ZA 1SRUA 4B3TQ 1H9JA 2CVRA 5EJWA 3R93A 2NN6I 1HR0Q 2QDLA 5IGCA 4P73A 2ZTCA 3BYTB 1KAWA 1S4ZA 1E2WA 4LMQD 3S1QH 2V4DA 1HHVA 2CWPA 4A3GG 1PZKD 2O5JC 5IGGA 1VQEA 1IBKL 2OEOA 2LS01 2RF4A 5C0XG 2Q2IA 5FLMH 4OX9Q 4H44C 1KDAA 4KD4A 3T16A 5CBEE 4LF6L 2NUCA 4ABNA 2AHOB 1CHQD 4DV3L 1O7YA 2QEXA 1O7LA 2IT1A 3RR5A 2VW9A 1HH2P 5KNDA 2DNCA 3Q8DA 5IGDA 2JA8H 4PNYA 1EYDA 4LFBQ 2UUAL 2DUDA 2TSSA 2G5DA 5EBCA 3M4QA 1CI3M 1II3A 2LFNA 3CC7A 1GJXA 3CCQA 1KAAA 1FNWA 1GKHA 4X3TA 1N9WA 4DAMA 1PH1A 4IUVA 1HZAA 4Y7NB 4NXML 1GUGA 3RUZA 3SXHA 1IYJB 1T5EA 4N8FA 3KK7A 1XNQL 2ZT9C 3D4DA 3GQBA 5ELNA 5IOCA 1I6HB 2B2UA 1FL0A 2KCMA 4HSVA 3EBEA 3KYHC 3MEFA 1GXDC 4A93G 3S1MH 4LF8Q 2ENBA 4JCVE 1A3VA 4RGOS 4A3CG 3HOYH 1LYLA 1ENFA 1RF2D 4BS9A 4R4OA 2B8FA 4DUYQ 2C35B 2IHEA 1EY9A 2RHQB 3WDNA 4HJ7A 3EIVA 5KRUA 3K7UC 3J80E 1LV9A 1SYDA 2NVTH 4FXDA 1SLJA 1X3FA 3MXUA 3I72A 2F3WA 1LTRD 4PQXA 1CA6A 4IPCA 3CAMA 3RLNA 2M9VA 4CJ1B 4K0KQ 1HQRD 4POFA 3FDTA 1Z9FA 4F7XA 2OQ0A 4TRDA 2PW5A 1U5KA 2N3SA 4C3HB 3NK9A 3MZ5A 2CFMA 3J7AV 1G2SA 2OWOA 3S1RB 1HNZL 3MXNB 1RD9D 3K0XA 3RZDH 3SEBA 5H1SE 4IFDH 1J8IA 3HOUG 5ELOA 4O42A 2L5TA 1S3OA 1R4PB 2L9HA 3X3NA 4EQNA 1Y69U 2LMCB 4A3FB 4NKLA 1EY7A 2XGTA 3HKZE 1G6ZA 3I91A 5FOBB 3QO2A 4ZK9B 3HKZG 3BS1A 1M90C 1DOLA 4RGMA 4DXFA 3ZYYX 4DUZQ 1D5ZC 3H0GG 2L55A 2KHIA 1S72A 5M5XB 2B2WC 3QR8A 4JBMA 1HZBA 3Q0AA 1PTOB 2XRQD 1Q81C 1PMRA 1WTHA 2B3GA 2WV6D 2PZTA 4UP8A 3VR3A 5I6YA 1HUMA 3TBIB 4NXNQ 4HIOA 3A74A 1B9MA 3JC66 2Z6KC 3Q24A 2ZJRA 4APVA 5M3MG 2B2TC 4JYAQ 5GAGC 4A3BH 4JG2A 4GNXB 4OWXB 3J81E 1RKNA 1Q3LA 2MP1A 4FO2A 3ND8A 1EU3A 1GUNA 3OYYA 2VUMH 2EYFA 3MXPA 3TP7A 2EOTA 5HURA 2ICEC 4DR5Q 1HR0W 4X62Q 1EFID 5ELEA 3T13A 1S5ED 2LY7A 1IL8A 1W6JA 4V190 2MHVA 3A8IE 3S2HH 1DZ1A 4AQYQ 1BO0A 3K81C 5A2QE 2GVAA 3BVMA 5EAYA 1BBWA 1PLFA 4LWCA 3K5NA 1E1TA 4KHZA 4B9WA 1E22A 3H6MA 1I3QB 4JI2Q 2VZAA 5IE8A 5M9OA 5JVG3 1IW7D 3S16B 4HIMA 3CQZH 1IBMQ 3UE0A 5EPKA 2CQOA 2B2VC 2E2IB 3TZDA 3CRLC 4YWMA 1SN8A 2VUMG 4ULLA 2DJFC 5IT9c 3A54A 4X3SA 3NBHB 1Z47A 3M85A 1KNEA 2QF7A 4X66L 1MKHA 1TIID 1XTCD 1G51A 2TMPA 3PV0A 1BBUA 1K28A 1A0IA 2PO4A 3ONAB 3CXCA 1HA5A 3IAYA 3JAME 2UXBQ 2XN9C 1KXLA 1D7QA 4DR7Q 2EJFC 2LSSA 1YHBA 3PO2B 2YTVA 1VQFA 2RSOA 4IUTA 2J0TD 4FF2A 3CRKC 2OQKA 4P74A 4F87A 5LHY1 4A75A 1DYQA 3GTQB 2EYOA 1Q82C 3QOLA 5KNCA 1QVCA 2CHBD 1STHA 2JE6I 1N36Q 1EYGA 2WKDA 4AH6A 4DGZA 3R3OA 3NQIA 3G71A 1O7IA 3T1HQ 1V9PA 3NWSA 3J80i 4KD3A 1HTPA 1HXYD 1EOVA 2JN4A 4DNIA 3W1BA 2K6AA 4DR3L 2F4IA 5IYBH 3SK4A 5LMNQ 4A3IB 4QY7A 2RCFA 4NP5A 3ZJYC 1X65A 1UWVA 4GKJL 2MGSA 1WD1A 4A3DH 4O0AA 1PTOC 4DR6Q 3T1YQ 4FF3A 1VS0A 4L5TA 5C4JH 1S5CD 2UU9Q 1PTOD 2F0VA 2R7ZB 3PF4A 4LF4L 1VQBA 4JI7Q 1TWFH 1EYCA 2ZM6Q 1EY5A 1JWUD 2EYPA 2F0PA 3C3LA 1B50A 4OELB 3KUPA 4GNXC 3L2PA 4HN7A 1QCBD 3I56A 4HIDA 4GLXA 3STBD 4MN3A 1H9SB 3CPWA 4WJWA 3ERSX 5DAUA 4YWKA 2K5DA 3HKSA 1BNZA 3M3YB 3I73A 3M4PA 4JI0Q 3FHWA 1SE4A 2VS1A 5JEAG 1VQ9A 4DV0L 4A3DG 3M7GA 2ICIA 3CCRA 3BDCA 4HJ9A 4FDBA 1D1KA 1I4PA 2LXKA 1J5EQ 3PO3B 3F2CA 4HCSA 3CU7A 5CV9A 4RKLA 5FO7B 3S1MB 2N55A 1G91A 3HOYB 2KHJA 1KRTA 1ASZA 1WCMG 3CCSA 3RN2A 2R93B 1Q8KA 1X55A 4A4IA 3KJOA 1PH6A 2A6EC 4MNOA 1KLGD 1K8OA 1BCPB 2NVTB 1MJCA 2A6ED 4B3MQ 3J81i 3QJYA 3I3CA 4DV5Q 1G291 4HMIA 4HJ5A 4Y7NH 3D3RA 3FPPA 1EQTA 1SYFA 4BBRB 3TZUA 2PMZB 3HP3A 3LX0A 1GUWA 1H95A 3NPPA 2DN8A 3S17H 2I5MX 4KY7A 4DK1A 3GTKB 1VQLA 4ZKCB 4JBKA
chains in the Genus database with same CATH topology
3HS0C 2XWJB 4AYBB 5E4XA 3P1HA 2AQ3B 1Q12A 2YU9B 5LL6X 1QE6A 2FINB 1Y1WB 3A7AB 2CQAA 3FKIB 3H09A 3HZXA 4NDXA 2XRSD 3V2TA 1LT6D 5D14A 2J7ZA 1ONLA 3PIP3 4C3IB 1RODA 1UNSA 3I8ZA 3GP7A 5AFWA 5I9PA 4CKBA 2WB1B 1EY0A 1SNPA 1XX8A 4CGYB 1LTAD 4U68A 4CKEA 1O80A 4Q5VA 1XXGA 5C0XI 1JC7A 1Q1BA 3P7JA 2GA4B 5D65A 1UUPA 2Z4HA 3VR5A 2L1BA 5IGFA 1MI2A 3URYA 3TP5A 1JWMD 4DAPA 3HG9A 2X6LA 2NVXB 2F0QA 3NTKA 1QWYA 3D6WA 4RGTA 1PTOH 3S2HB 4NW2A 2K05A 3DWAA 2WINB 3SE0A 1JCKB 1ZEQX 4ZUIA 3TP8A 1GHJA 1SJED 3D31A 3CQZB 1G8ZD 3G7LA 2F0MA 3K0YA 2VB2X 3MEHA 1X3PA 3K5LA 1F9QA 2R92B 3D4RA 1BCPC 2K03A 1AZQA 4DF7A 1TS4A 1MSHA 1BCPD 1LTTD 5C3XA 1EU4A 2KCNA 2BA0A 3QWNA 2VB3X 4XTCS 1IYVA 3GTPB 5IGEA 1JQYD 1X32A 2BOSA 2H4OA 3HOZB 1SNDA 1WTQA 1JOKA 3VR2A 1CZGA 1SNCA 3HGBA 3RMHA 3IFTA 2BDNA 2D5DA 4CJ0B 2A73B 3FPUB 2HCCA 1TQOA 1QNUA 4I65A 4A3JB 2EVBA 3O13A 4OHJA 1B53A 3LWUA 2KJXA 4R9WA 3KF8A 1EYAA 5CV5A 3QOJA 4G7HC 1K8MA 4H7BA 2E2JB 3M4YA 4K8JA 4RHSA 2CW0C 5I2XA 1HA6A 1D1IA 2CW0D 2NB0A 5BN3A 2E75C 3S9WA 1CK1A 4FXKC 1IYUA 2KCCA 3NHHA 4DU9A 1U4MA 3OHXC 3PIO3 2JA7B 3PUVA 4QF4A 3TMEA 4G7ZC 4HEDA 1B44D 1PZJD 2JEBI 2R3ZA 2Q8IB 3HOWB 1DM0B 3GTMB 2B2YA 4JK1C 3EROA 3QB3A 4FXGC 4N9PA 3CHBD 3KLRA 4RKBA 2FHTA 5G3LF 1JORA 5C0XJ 1PRTF 5BN4A 2JA5B 4RAUC 4FNFA 1W6KA 2AQ2B 2FFKB 4K6DA 1CM9A 3IL8A 5FO9B 3NUCA 5ELBA 4K2KA 3VYTA 4S3SA 4B9XA 1UEAB 3J80L 3S17B 1SMYC 5ELCA 1TWHB 3AU7A 1SMYD 3DHQA 2B39A 3C46A 3C1FA 5C5LA 1U4RA 1HQMC 5CMDA 2AUKA 2RDHA 3BYYB 1D5XC 3H94A 4HTHA 3MXGA 1AN8A 4TQUS 1EY6A 3Q23A 3F2UA 4MHEA 1T5XD 2PCFB 1MGSA 1I6VC 4LJZC 1AFPA 2NVQB 2Z8LA 1Z6HA 2X6GA 4HSPA 5CV6A 3UI2A 2BE5C 2EYMA 1LTSD 1DD2A 1Y8OB 1TT2A 5ISRA 1AEXA 2JA6B 1D5MC 5E1FA 3EFXD 1C8CA 4A3EB 4XQQA 3GV3A 4IUUA 1HRJA 3K57A 1VMPA 1NCVA 2WAQB 1CHPD 4B08A 4BY1B 2RBMA 3KLSA 1SFOB 2WP8J 1WTWA 2NN6H 4QUFA 3J81L 4OGQC 4IFDG 4TKOB 1BCPF 2AWNA 1NR2A 1S5BD 2KEEA 3MWYW 1SE3A 1WTRA 3C1EA 4G4KA 3GV6A 3LWEA 2J4XA 3PUYA 5T1IA 5A2QL 2EZVA 1G2TA 3OWEB 4C3IG 4G57A 3GTGB 5FLXE 3S2DB 3K5OA 1CZWA 1V1PA 1E0BA 1PYWD 4WFN3 4PMWA 1ZKOA 5D3IB 2FMMA 1ENAA 5KNBA 2JSOA 4HMJA 1NAPA 3JAML 5EKKA 3V05A 1WTXA 2X69A 1F2YA 3D4WA 5CGKA 5EGTA 3K58A 2KECA 5C3EB 1YNNC 5C5MA 4J6HA 1B9NA 1PRTB 1YNND 2Y0SB 4C3JB 1HPCA 3D6CA 4RFBA 1NSNS 3H91A 3J7AF 4LAAA 5M5YB 1RTOA 1Y1VB 1B1ZA 1YNJC 2NZ1D 4U673 1EZ8A 1YNJD 3PUZA 2ID0A 2QILA 5KGUA 1KDCA 2Z1CA 3SK6A 1TU2B 4QB4A 3Q22A 4XYOA 1JB3A 1STEA 3GD7A 1KABA 1HCZA 4FF1A 2F0UA 5A35A 4K5WA 1U4LA 4PV1C 4KKSA 4ZKBB 3K6OA 2F0FA 5I9OA 3VR6A 1LACA 1I4RA 5KIXA 1SE2A 1VF7A 2A5HA 1E2VA 2ZXOA 4EQPA 4A3KB 2O2LD 2F0IA 3OSOA 5EPLA 1JWSD 2O4XA 4OIKA 3OW7A 1OXXK 1I4HA 2OXPA 2A6HC 3TN2A 4A93B 2A6HD 3OWFA 1L0YB 1WVLA 2G9DA 1Y8PB 5DEHA 3T53B 1F9SA 5K36H 1FR3A 5JEAJ 1DJRD 3G6JB 3C2PA 4EVOA 2JP1A 1Y8NB 1WTPA 1V8QA 2OF1A 1A3UA 4TSSA 4EGVA 5JAVA 1F2LA 4ZRZA 4XDXA 1AZPA 1ESFA 1LABA 3KLSX 4IZ8A 3I4NB 1EWHA 2B2YC 3OOCA 1PRTC 2I07B 5G3LD 2KHSA 1KNAA 1PRTD 1KTKA 3T51B 1GUSA 1EEFD 3SHLA 5C4XB 1E2ZA 2FJ2A 4GZYC 5JOBA 1NUCA 3NP8A 2A68C 3HKZB 3L3OC 4OO1H 1M4VA 1TWCB 2DNEA 2A68D 3SK8A 4BBSB 4Z9CB 4L63B 2R61A 4IUQA 2QKIC 2B2UC 1TY2A 1U9RA 2JXMB 1S5DD 3W3AA 4YIJA 3OIPA 4KJNA 3RZOB 4K5VA 1A15A 2C5CA 1A6XA 5CV7A 4BY7B 2XSCA 3GTJB 2AQ1B 5M3FB 1DOKA 3X3MA 4C1NK 4QCLA 4C56C 2KOLA 1EY8A 4BWGB 4BA2I 2PW7A 2NTTA 4ILWA 3AMUA 2R6GA 4NMZA 3OMGA 3PMFA 1EY4A 4C2MB 5KEEA 1PFMA 2PZWA 3CKIB 5LL6S 1RTNA 3DEPA 5ELDA 3BVGA 1QJOA 2NBFA 4P2CB 2A69C 1Q90A 2E2HB 1SXTA 4C3HG 2A69D 5JPNC 1ET9A 1I50B 2PPBC 2F0WA 2QDBA 1RDPD 1C4QA 3SDZA 5FO8B 5C4HA 5IT9E 1GUTA 2EYHA 1SYCA 4PMBA 5J22A 5I6WA 3P75A 4ZUJA 1WD0A 3S15B 1SBBB 2EJMA 1SYGA 1K83B 3T4AC 5EQ0A 3TDQA 2EY5A 5EKIA 1F9RA 2YYZA 1HFNA 3I90A 5EPJA 1H9RA 5IGBA 3GTOB 2XVSA 1SAPA 3VYUA 2EPBA 3IKJA 1EIGA 4E6IA 4V0BA 1SYEA 3PUWA 1O78A 3BZDB 2IPKD 1A2UA 5CORA 3MXNA 1JICA 1SNQA 1VMCA 2K04A 5ELFA 1STBA 4KI0A 1IHZA 4DK0A 1O7ZA 1EZ6A 1TS2A 2K5QA 2F0HA 2WKCA 5KYIA 4XT3B 3M7NA 5IODA 2K01A 2EXZA 4K8IA 4JBWA 2JYOA 2KUMA 5CV4A 2F1MA 5EKLA 1RHPA 3ERQA 4K14A 4KY6A 3NXWA 3FVQA 1TR5A 3K7AB 4DNTB 4L6TB 1LT5D 4I7ZC 2WIIB 1SDFA 4IALA 1QNKA 2E76C 2NVYB 3NSWA 2G9HD 4IFDI 1VF5C 2JEAI 4Q0FA 3E6ZX 1B4OA 2SOBA 2B8GA 1PXUA 1A2TA 3A55A 4ME5A 3FMCA 4UDUC 4C3JG 4ZAIA 2AUJD 3W2DA 2VXWA 2DY8A 1JOQA 3BDOA 4ZQ3A 1BOSA 3MA2B 1WCMB 1CTMA 4XYQA 1R9TB 5NUCA 4CKCA 3ND9A 4ZLTF 2LKVA 2RDFA 3VA5A 2F0NA 4DAYA 1L0XB 4RA8A 3N52A 1ILQA 2RKSA 1EL0A 3NBHA 1LTID 2IL8A 5FK9C 2EYLA 2F0SA 4CBVA 1GUOA 1SJHD 1F77A 2BDOA 1I4XA 1TWAB 4K6LA 2IX0A 5EBDA 3MFGA 2EE1A 2Z4IA 2L4NA 2KQ3A 5F2DA 2NTSA 2B63B 3VA7A 4KHVA 4RWSC 3T56B 1VDZA 1X3QA 4KKTA 5E4WC 5D3DA 2EYJA 1LT3D 1Q1EA 3E5SA 4L8JA 4A3MB 4H13C 3I4MB 2HDMA 2D2CC 4M1UB 1S5FD 5BN5A 4KTAA 2D62A 1PFNA 1NR4A 1TY0A 3GTLB 1QOHA 2NWGA 1BUVT 5DNFA 3I70A 3S14B 3MAQA 2C9OA 1ZXTA 1GHKA 2BE5D 3OIQA 3DMUA 3NE5B 5J39A 2PQEA 1BF4A 1TVXA 2M00A 3SR1A 3DWQA 2IX3A 4FYDA 1H9SA 1CFMA 2PNRC 1SYBA 5IIFA 5CV8A 3HOVB 3A8JE 1ICWA 5CBAE 1HFGA 1OO9B 2BA1A 1EOTA 4XIGS 5FLXL 4HCEA 1LTGD 4IFDJ 3OMCA 1CT1D 1STAA 3VR4A 5C44B 1F2ZA 5FKAC 2RQXA 2K5WA 4QIWB 1TWGB 4IUPA 4ID6A 5KYLA 3FEWX 1LT4D 4RGNA 1D2BA 2F0GA 3BDLA 2NN6G 3R2TA 1PZID 1BR9A 2Q8TA 3DM1A 1OXUA 5I4DA 1FGBD 4K5XA 1FYCA 1AW7A 1MSGA 1BXTA 4KKUA 4CHTB 5TSSA 2E2DC 5I2YA 4WORA 3M4OB 3L7ZC 1RCVD 2L0CA 3RLFA 4O1NA 4MIUA 2L11A 2WACA 1F2MA 3N6RA 1ENCA 1IW7C 1TS3A 2K7VA 3GO5A 2NYZD 2F0JA 4DA2A 1JR0D 3U9SA 3NTHA 1HTLD 4J1MA 1ML0D 2K1BA 4KY5A 4C1NI 2HUGA 1CQFA 3J7YW 4H0LC 2SEBD 2H1EA 1OXVA 4UAIA 4XT1B 3Q6SA 1IKLA 3V96A 3EQLC 3MTSA 3AB9A 3HRZC 4RH6A 4OO1I 4A3GB 1V1OA 2IWHA 5COYA 3VYSA 5DM63 1OXSC 3NWTA 3MHBA 5CYUA 1TS5A 4IUNA 1JE4A 1ESRA 4XQNA 4FVMA 3HOXB 3KBXA 3TSSA 3A8KE 1PDQA 2F0OA 4IURA 2D9UA 3DWPA 1ILPA 4IQZA 3S1QB 5JEAH 2MJ8A 3HEJA 1PFBA 4PMCA 2ZXPA 4XXEA 3WOEA 1BQQT 4M8AA 4KN4C 4RHRA 4RCOA 3VYRA 5T1GA 1I4GA 1STYA 1LLRD 2SNMA 2JA8B 1SEBD 2IX1A 1BDOA 4KN7C 3QG1A 4FP5D 3NQTA 2M2LA 4EQOA 1FD7D 4HAEA 4ZYSA 3ITPA 2OT2A 4KK7A 4RCNA 3FRPB 4R8IA 4KV6A 4K2LA 1MD2D 5M5WB 4CJ2C 3HOUB 2F03A 1HUNA 2F0DA 4OIJA 5K5PA 1QILA 2E74C 3H3VC 3MFYA 5K36G 5JPMC 3K59A 1ZYRC 3QIAA 1FNUA 3RD4A 3SK5A 2AWOA 1MBYA 1ZYRD 3P20A 3SVMA 1V1PB 3H0GB 1V43A 3LNNA 4OL7A 2RSNA 2SNSA 3A7LA 2KEDA 4IN3A 2N88A 2IJ0A 1DONA 4X3UA 3IFDA 2Q8RE 1QB5D 1STGA 1DCZA 3RZDB 4KMUC 2B2WA 5CR3A 1SNMA 2O5IC 3S1NB 1GOZA 5M3MB 2I46A 2MPMA 4ODGA 3D8GA 1I4QA 2KA7A 4HR7B 1EQVA 2F0TA 2F3VA 4OO1G 2B2TA 2KVMA 2HCIA 1XYIA 3DXJC 4N9TA 1LO5D 2VNUD 1TKWB 2RDGA 1CA5A 2RA4A 3WOFA 1RJTA 2F0LA 4QUCA 5IT9L 1J9OA 3U9OA 1LTBD 3MVVA 3DEOA 3L9AX 1STNA 4LK1C 1SSOA 2XWBB 4A3BB 1BBXC 2BCOA 1AP0A 1M8AA 5E3FA 1IKMA 2EDGA 1H9KA 2VUMB 1ET6A 2F0KA 3EVQA 2F0EA 3PUXA 3TP6A 3DUZA 1KDBA 2HDLA 1WTVA 2B2VA 1FNVA 4QMGA 3NBIA 4J8QA 1WTOA 5HGTA 1EEID 5C3WA 2XIWA 3R2IA 2EY6A 1EWCA 3MC0B 3A56A 4DAVA 1VCIA 2FMCA 4G7OC 1D6EC 1F9PA 2QCPX 3EJIA 4DXGA 3K5MA 5C6AA 4BA1I 1DXMA 2K33A 3E0JA 1Q8IA 2QEJC 1JOOA 1B2TA 2RVLA 4X3KA 2XNAC 5CC4A 5J1ZA 2MUYA 4DFAA 4DNRB 1A3TA 3EA6A 1DOMA 5JJZA 4F88A 1U4PA 4DN4M 2IW3A 4R8NA 1QG7A 4XQJA 2HQEA 2K32A 4WRDA 3I4LA 1KLUD 1Z7TA 1PTOF 3OPOA 2SDFA 2L12A 2EY1A 1B3AA 3R8BA 2A74C 1C48A 3BG3A 3KBGA 2DY7A 2ZXRA 4A3DB 1UAPA 2PZUA 1OXTA 5C0XH 1SNOA 5JVH3 4KJOA 5C4JB 1CQVA 2EY2A 2K28A 5DM73 1R4QB 1TWFB 1H9MA 3NTIA 4FF4A 1XWEA 4F8MA 3BVZA 2EJGC 2PYKA 1EIHA 5C4ZA 1H9JA 2CVRA 5EJWA 3R93A 2NN6I 5IGCA 3BYTB 1S4ZA 1E2WA 4LMQD 2V4DA 1HHVA 1PZKD 2O5JC 5IGGA 2OEOA 2LS01 5C0XG 4H44C 1KDAA 4KD4A 3T16A 5CBEE 2NUCA 4ABNA 1CHQD 1O7YA 1O7LA 2IT1A 5KNDA 2DNCA 5IGDA 4PNYA 1EYDA 2TSSA 5EBCA 1CI3M 1II3A 2LFNA 1GJXA 1KAAA 1FNWA 4X3TA 4IUVA 4Y7NB 1GUGA 3RUZA 3SXHA 1T5EA 3KK7A 2ZT9C 3D4DA 3GQBA 5IOCA 1I6HB 2B2UA 4HSVA 1GXDC 2ENBA 1A3VA 4RGOS 1ENFA 1RF2D 4BS9A 2B8FA 1EY9A 3WDNA 5KRUA 3J80E 1LV9A 1SYDA 4FXDA 3MXUA 3I72A 2F3WA 1LTRD 4PQXA 1CA6A 2M9VA 4CJ1B 1HQRD 3FDTA 4F7XA 4TRDA 2PW5A 4C3HB 3NK9A 3MZ5A 3J7AV 1G2SA 3S1RB 1RD9D 3SEBA 4IFDH 1J8IA 4O42A 2L5TA 1R4PB 2L9HA 3X3NA 4EQNA 1Y69U 2LMCB 4A3FB 4NKLA 1EY7A 1G6ZA 3I91A 5FOBB 3QO2A 4ZK9B 3BS1A 1DOLA 4RGMA 4DXFA 3ZYYX 1D5ZC 2L55A 5M5XB 2B2WC 3Q0AA 1PTOB 2XRQD 1PMRA 2WV6D 2PZTA 5I6YA 3VR3A 1HUMA 3TBIB 1B9MA 3Q24A 2B2TC 3J81E 1RKNA 1Q3LA 2MP1A 4FO2A 3ND8A 1EU3A 1GUNA 2EYFA 3MXPA 3TP7A 2EOTA 5HURA 2ICEC 1EFID 5ELEA 3T13A 1S5ED 2LY7A 1IL8A 1W6JA 4V190 2MHVA 3A8IE 1DZ1A 1BO0A 5A2QE 3BVMA 1PLFA 3K5NA 4KHZA 4B9WA 3H6MA 1I3QB 5JVG3 3S16B 5M9OA 1IW7D 5EPKA 2B2VC 2E2IB 3TZDA 3CRLC 4ULLA 3A54A 4X3SA 1Z47A 3M85A 1KNEA 2QF7A 1TIID 1XTCD 2TMPA 3PV0A 2PO4A 3ONAB 1HA5A 3IAYA 3JAME 2XN9C 2EJFC 3PO2B 2RSOA 4IUTA 2J0TD 4FF2A 3CRKC 4F87A 5LHY1 1DYQA 3GTQB 2EYOA 3QOLA 5KNCA 2CHBD 1STHA 2JE6I 2WKDA 4DGZA 3R3OA 3NQIA 3NWSA 4KD3A 1HTPA 1HXYD 2K6AA 2F4IA 3SK4A 4A3IB 4NP5A 2MGSA 1WD1A 1PTOC 4FF3A 1S5CD 1PTOD 2F0VA 2R7ZB 1EYCA 1EY5A 1JWUD 2EYPA 2F0PA 3C3LA 1B50A 3KUPA 4HN7A 1QCBD 4MN3A 1H9SB 4WJWA 5DAUA 2K5DA 1BNZA 3M3YB 3I73A 1SE4A 5JEAG 3M7GA 2ICIA 3BDCA 1D1KA 1I4PA 3PO3B 4HCSA 3CU7A 5CV9A 4RKLA 5FO7B 3S1MB 2N55A 1G91A 3HOYB 2R93B 2A6EC 1KLGD 1K8OA 1BCPB 2NVTB 2A6ED 3QJYA 3I3CA 1G291 4HMIA 3D3RA 3FPPA 1EQTA 1SYFA 4BBRB 3TZUA 2PMZB 3HP3A 3LX0A 1GUWA 3NPPA 2DN8A 4KY7A 4DK1A 3GTKB 4ZKCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2L A;  1AZQ A;  4X3T A;  1XYI A;  1QG7 A;  2R3Z A;  1B4O A;  3GV3 A;  4IUU A;  2L11 A;  1MSH A;  4IUV A;  4XDX A;  2B2Y A;  5DNF A;  5E4X A;  1AZP A;  1HRJ A;  2B2T C;  2NZ1 D;  1ZXT A;  1CA5 A;  1VMP A;  1NCV A;  2FHT A;  1Q3L A;  1QE6 A;  2B2U A;  1WD0 A;  2B2Y C;  2MP1 A;  2RA4 A;  1RJT A;  2FIN B;  4ZAI A;  2MGS A;  1WD1 A;  2NYZ D;  4QUC A;  4HSV A;  2EOT A;  1J9O A;  2VXW A;  1WTW A;  4RAU C;  4QUF A;  2DY8 A;  1KNA A;  5EQ0 A;  1X32 A;  2M2L A;  2SDF A;  2L12 A;  5EKI A;  1BF4 A;  1F9R A;  1TVX A;  3DEO A;  1IL8 A;  1ML0 D;  1HFN A;  2K1B A;  2FJ2 A;  1SSO A;  4HAE A;  2FFK B;  5D14 A;  1B3A A;  1DZ1 A;  1B50 A;  2J7Z A;  1NR2 A;  2HUG A;  2KEE A;  2KVM A;  1CM9 A;  1BO0 A;  3I90 A;  3MWY W;  5EPJ A;  1BBX C;  1AP0 A;  3KUP A;  1M8A A;  1ROD A;  3IL8 A;  1WTQ A;  3I8Z A;  1WTR A;  1IKM A;  4R8I A;  1SAP A;  1LV9 A;  3GV6 A;  5AFW A;  2DY7 A;  2EPB A;  4ZLT F;  1EIG A;  1PLF A;  3LWE A;  1U4L A;  1CA6 A;  5T1I A;  2H1E A;  4RA8 A;  4CJ1 B;  1XX8 A;  2HDL A;  2K28 A;  4MN3 A;  4CJ2 C;  1G2T A;  4IUQ A;  4UAI A;  1WTV A;  3FDT A;  2B2V A;  4XT1 B;  3N52 A;  3Q6S A;  1IKL A;  2BDN A;  4ZKB B;  1HUN A;  1ILQ A;  1ICW A;  2B2U C;  5CBA E;  5COR A;  1WTO A;  4U68 A;  1EL0 A;  1HFG A;  1JIC A;  1O80 A;  3MTS A;  1BNZ A;  1VMC A;  4OIJ A;  5EPK A;  4CJ0 B;  2K04 A;  2B2V C;  4ZKC B;  1G2S A;  3TZD A;  2IL8 A;  1U4R A;  2XIW A;  5COY A;  3FPU B;  5CMD A;  3P7J A;  2HCC A;  1EIH A;  4X3S A;  5D65 A;  2CVR A;  1A15 A;  1KNE A;  5EJW A;  1O7Z A;  1EOT A;  1E0B A;  3R93 A;  2L1B A;  1J8I A;  5EPL A;  4O42 A;  1B53 A;  4OIK A;  1MI2 A;  1DOK A;  3SVM A;  1F9P A;  4XT3 B;  4HCS A;  1JE4 A;  3ONA B;  2L9H A;  2X6L A;  1S4Z A;  2K01 A;  3F2U A;  4MHE A;  2RSN A;  2KOL A;  1ESR A;  2N55 A;  4LMQ D;  4R9W A;  1HHV A;  2KED A;  1G91 A;  1MGS A;  2FMM A;  2EE1 A;  2JYO A;  2N88 A;  2L4N A;  3D6W A;  2KUM A;  3TN2 A;  4NW2 A;  1DON A;  2K05 A;  3KBX A;  1NAP A;  4IUP A;  4X3U A;  3IFD A;  5T1G A;  1PDQ A;  2Q8R E;  1B2T A;  2RVL A;  4RWS C;  1G6Z A;  3I91 A;  1HA6 A;  1RHP A;  1X3Q A;  2RSO A;  3QO2 A;  2B2T A;  4IUR A;  4IUT A;  4X3K A;  5E4W C;  2D9U A;  4ZK9 B;  5CBE E;  1WVL A;  1WTX A;  2X6G A;  1DOL A;  2B2W A;  3UI2 A;  1PFM A;  1ILP A;  2X69 A;  1O7Y A;  3I3C A;  1F9S A;  2Q8T A;  1RTN A;  2B2W C;  2KEC A;  1EQT A;  2MJ8 A;  3DEP A;  1SDF A;  3HP3 A;  3DM1 A;  1PFB A;  1QNK A;  2MPM A;  1U4M A;  1GUW A;  2HDM A;  1MSG A;  3G7L A;  2JP1 A;  1PFN A;  1NR4 A;  1X3P A;  1DOM A;  3H91 A;  1F9Q A;  1WTP A;  5JJZ A;  1C8C A;  1HUM A;  1RTO A;  1U4P A;  4DN4 M;  4HED A;  2HCI A;  2NWG A;  2K03 A; 
#chains in the Genus database with same CATH topology
 1YNX A;  4UP7 A;  3HS0 C;  2XWJ B;  4AYB B;  5E4X A;  3P1H A;  2AQ3 B;  1EIF A;  1Q12 A;  4JI4 Q;  2YU9 B;  5LL6 X;  1QE6 A;  2FIN B;  2B63 G;  1Y1W B;  2N8N A;  3A7A B;  2CQA A;  3FKI B;  3H09 A;  3HZX A;  1Q46 A;  4NDX A;  2XRS D;  3V2T A;  5IWA Q;  5JJK A;  1LT6 D;  5D14 A;  5GAH C;  4LNQ A;  2J7Z A;  4C3H H;  1ONL A;  3PIP 3;  2UXD Q;  4C3I B;  1ROD A;  1UNS A;  3I8Z A;  3GP7 A;  3S1R H;  4HIK A;  5AFW A;  3UDF A;  5I9P A;  3I4M G;  2HHH Q;  4CKB A;  2WB1 B;  1EY0 A;  3JAM i;  1SNP A;  1XX8 A;  2VQE L;  1NY4 A;  4CGY B;  1LTA D;  4U68 A;  4CKE A;  1O80 A;  2E8G A;  2JJQ A;  4Q5V A;  1XXG A;  5C0X I;  1JC7 A;  1G6P A;  1Q1B A;  3P7J A;  2GA4 B;  5D65 A;  1UUP A;  2Z4H A;  3CCM A;  3VR5 A;  2L1B A;  5IGF A;  4JI8 Q;  3UE1 A;  1MI2 A;  4IPD A;  3URY A;  4CDC C;  5IY0 A;  3TP5 A;  1JWM D;  3FP9 A;  4DAP A;  3HG9 A;  2X6L A;  2NVX B;  2F0Q A;  5M5X H;  3NTK A;  4GN5 A;  1QWY A;  3K80 C;  5LMN W;  3D6W A;  4RGT A;  1PTO H;  3S2H B;  4NW2 A;  2K05 A;  3DWA A;  2WIN B;  4UPA A;  3SE0 A;  3U58 A;  1JCK B;  1ZEQ X;  4ZUI A;  3TP8 A;  1VQJ A;  4IO9 A;  1GHJ A;  4DKA C;  3RN5 A;  4IPH A;  1SJE D;  2OCE A;  4A3F G;  1WI5 A;  3D31 A;  4JV5 Q;  2GN5 A;  3CQZ B;  1G8Z D;  3G7L A;  3BJU A;  2F0M A;  3KLW A;  3K0Y A;  2VB2 X;  3MEH A;  1X3P A;  3K5L A;  1F9Q A;  2R92 B;  3D4R A;  1XPU A;  1BCP C;  2K03 A;  5DLQ E;  1AZQ A;  4DF7 A;  4X64 Q;  1TS4 A;  1MSH A;  1BCP D;  1LTT D;  5C3X A;  3TS2 A;  1EU4 A;  2KCN A;  4B3R L;  2HQL A;  2BA0 A;  4JOI A;  3QWN A;  2VB3 X;  1PHJ A;  4XTC S;  1IBK Q;  4JI6 L;  1IYV A;  4QIW E;  5C44 G;  3GTP B;  4DV6 Q;  1V1Q A;  5IGE A;  2EXD A;  4YY3 L;  1I3Q H;  4RMF A;  4LFC L;  2I5L X;  3S16 H;  1JQY D;  1X32 A;  1X56 A;  2BOS A;  2H4O A;  4BXX H;  3HOZ B;  1SND A;  4DV3 Q;  4R4I A;  2E2I H;  1WTQ A;  3J81 c;  2AKW B;  1PH4 A;  1JOK A;  1IBL L;  3E9I A;  3VR2 A;  1N33 L;  2UUA Q;  1CZG A;  2UUC L;  1SNC A;  3HGB A;  5AJ3 L;  3RMH A;  3IFT A;  2BDN A;  2D5D A;  1OTC A;  1YIJ A;  4C3J H;  2F4V L;  4CJ0 B;  3S24 A;  2A73 B;  4NXM Q;  1DGS A;  3NEM A;  3FPU B;  2HCC A;  5M5Y H;  1TQO A;  3PO2 H;  1QNU A;  4I65 A;  4A3J B;  2EVB A;  1AH9 A;  3O13 A;  4OHJ A;  1B53 A;  3LWU A;  2KJX A;  1HNX Q;  5IP7 G;  3LGJ A;  4LF7 L;  2B29 A;  4R9W A;  3KF8 A;  1EYA A;  5CV5 A;  3QOJ A;  1C9O A;  4G7H C;  1K8M A;  4H7B A;  2E2J B;  3M4Y A;  4K8J A;  4RHS A;  2E5L L;  2CW0 C;  5I2X A;  1HA6 A;  1D1I A;  2CW0 D;  2NB0 A;  2QW7 A;  4QQB X;  5BN3 A;  2E75 C;  4WJ3 M;  3B6Y A;  1CK1 A;  3S9W A;  4FXK C;  1IYU A;  1N34 Q;  2KCC A;  4A3L G;  4MTK A;  2QGQ A;  2V1C C;  2LXJ A;  3NHH A;  3JAM c;  1VQC A;  4MTN A;  4DU9 A;  1U4M A;  3OHX C;  1W3S A;  4LFA L;  4A3I H;  3VDY A;  1XPO A;  1I94 L;  3PIO 3;  2JA7 B;  3NEL A;  3PUV A;  4QF4 A;  1YZ6 A;  3TME A;  4G7Z C;  2A1A A;  1X54 A;  2JA9 A;  4HED A;  2R7Z H;  1B44 D;  1PZJ D;  2JEB I;  2R3Z A;  4YCV A;  2JK8 A;  2Q8I B;  3HOW B;  1DM0 B;  3GTM B;  2B2Y A;  2UXC L;  4JK1 C;  3ERO A;  3QB3 A;  4FXG C;  4N9P A;  3F2D A;  4A3K H;  3CHB D;  3KLR A;  4RKB A;  2FHT A;  5G3L F;  1JOR A;  1PFS A;  5C0X J;  1PRT F;  4DR4 L;  5BN4 A;  2JA5 B;  4RAU C;  4DV7 L;  3HOX G;  4FNF A;  3J7Z C;  1PV4 A;  3ULJ A;  4B3S L;  1W6K A;  3UDX A;  2AQ2 B;  2FFK B;  1QZH A;  4K6D A;  1WJJ A;  1CM9 A;  3KFU A;  3M3Y H;  3IL8 A;  2CWA A;  5FO9 B;  3NUC A;  4TVA B;  5ELB A;  3KJP A;  5LMU Q;  4K2K A;  3VYT A;  5HGQ A;  4S3S A;  5FLM G;  4B9X A;  1UEA B;  3J80 L;  3S17 B;  1SMY C;  5ELC A;  3PO3 H;  1TWH B;  1K8G A;  3AU7 A;  5JJL A;  1SMY D;  3DHQ A;  3CP0 A;  2B39 A;  3C46 A;  3C1F A;  2Q2U A;  1WOC A;  5C5L A;  1U4R A;  1HQM C;  4YHH Q;  4IJL A;  5CMD A;  2R93 H;  2AUK A;  2JA8 G;  3A0J A;  1HZ9 A;  2RDH A;  3BYY B;  1D5X C;  3F1Z A;  3H94 A;  1NTG A;  4HTH A;  3MXG A;  1AN8 A;  4TQU S;  1EY6 A;  3Q23 A;  3F2U A;  4MHE A;  4BBR H;  1T5X D;  2PCF B;  1MGS A;  4GOP B;  1I6V C;  4LJZ C;  1SMX A;  4GKK Q;  1AFP A;  2YV5 A;  2NVQ B;  2Z8L A;  4LF9 Q;  1JJG A;  1Z6H A;  1XNR L;  1EUJ A;  2X6G A;  3K8A A;  4HSP A;  1D8L A;  5CV6 A;  1UE5 A;  3UI2 A;  2BE5 C;  3GTK H;  2EYM A;  3PO3 G;  1LTS D;  1DD2 A;  1Y8O B;  1X3G A;  4IPG A;  1TT2 A;  2ALY B;  3I2Z A;  3HOY G;  1XTD A;  5ISR A;  1SRO A;  2YU9 H;  1HR0 L;  1AEX A;  2JQO A;  1D5M C;  2JA6 B;  2R93 G;  2CCZ A;  1CKM A;  2AMC B;  5E1F A;  4ZCK A;  4OEM B;  3EFX D;  1Y1W H;  1C8C A;  3FKI H;  3F2B A;  4A3E B;  3GV3 A;  4IUU A;  4XQQ A;  3J81 j;  1HRJ A;  4OX9 L;  3CCL A;  3K57 A;  4C3I H;  1VMP A;  1NCV A;  2WAQ B;  1CHP D;  4B08 A;  1L1O A;  4BY1 B;  2RBM A;  3KLS A;  1B7Y B;  1FJG Q;  1SFO B;  2WP8 J;  1WTW A;  2NN6 H;  3KDF A;  4QUF A;  3J81 L;  2PQA A;  1EQQ A;  4OGQ C;  4AYB E;  1L2F A;  4UHV A;  4IFD G;  4AYB G;  4TKO B;  4LFB L;  1BCP F;  2AWN A;  1NR2 A;  1S5B D;  2KEE A;  3MWY W;  1SE3 A;  1WTR A;  3C1E A;  4DV1 Q;  4G4K A;  3GV6 A;  2KCT A;  3LWE A;  3KF6 B;  1VQI A;  4UY8 C;  2J4X A;  3PUY A;  1KQS A;  5T1I A;  1HNW L;  5A2Q L;  3FKI G;  2EZV A;  1G2T A;  3OWE B;  3AEV A;  4IOC A;  2NVX H;  4C3I G;  3KF8 B;  4G57 A;  3ER0 A;  1KHI A;  4JI3 L;  4DR3 Q;  4LF8 L;  5FLX E;  3GTG B;  3S2D B;  3K5O A;  3PIP A;  1CZW A;  2WB1 G;  1V1P A;  3OTO Q;  1CKN A;  4P75 A;  1E0B A;  1KC8 C;  1VQD A;  1PYW D;  4WFN 3;  4PMW A;  4LF4 Q;  4P72 A;  1ZKO A;  5D3I B;  2FMM A;  1ENA A;  4DK3 C;  1W2B A;  1K83 H;  4K0K L;  5KNB A;  1VQG A;  2JSO A;  4A3B G;  4HMJ A;  1NAP A;  2HT1 A;  3SGI A;  3JAM L;  5EKK A;  1L0W A;  2R92 H;  1GD7 A;  3V05 A;  1WTX A;  1Y14 B;  3CMA A;  1VQO A;  2X69 A;  1F2Y A;  3D4W A;  5CGK A;  5EGT A;  3GTO H;  3K58 A;  2HIX A;  2KEC A;  5C3E B;  1YNN C;  5C5M A;  1B9N A;  4J6H A;  1PRT B;  2P5Z X;  4N8X 1;  1YNN D;  2Y0S B;  4DV4 Q;  4C3J B;  1HPC A;  4JVZ A;  4GOP C;  3D6C A;  3GTP H;  4RFB A;  1NSN S;  3H91 A;  3J7A F;  4LAA A;  3E0E A;  1VQP A;  1AE2 A;  5M5Y B;  1RTO A;  1Q86 C;  3HOZ H;  1Y1V B;  1B1Z A;  1YNJ C;  2NZ1 D;  1KRS A;  4U67 3;  1EZ8 A;  1YNJ D;  2YTX A;  3PUZ A;  2ID0 A;  2QIL A;  2Z0S A;  5KGU A;  2R92 G;  1KDC A;  2Z1C A;  3SK6 A;  1TU2 B;  4QB4 A;  1FGU A;  3Q22 A;  3TRZ A;  2OTL A;  4XYO A;  1JB3 A;  4EQ5 A;  3W1G A;  1STE A;  3GD7 A;  1KAB A;  4I7A A;  4NXN L;  1HCZ A;  4FF1 A;  3K7A H;  2F0U A;  5A35 A;  4K5W A;  1U4L A;  4A3J H;  4PV1 C;  4KKS A;  4QL5 A;  4ZKB B;  3K6O A;  2F0F A;  5I9O A;  3VR6 A;  1LAC A;  1I4R A;  5KIX A;  1SE2 A;  4DR5 L;  4X62 L;  2E2J H;  1VF7 A;  2A5H A;  1E2V A;  4LW1 A;  2ZXO A;  4EQP A;  2ZTD A;  4A3K B;  1VQ4 A;  2O2L D;  3DM3 A;  2F0I A;  3OSO A;  3U4V A;  4AQY L;  5EPL A;  1JWS D;  2O4X A;  4OIK A;  4PZ6 A;  3OW7 A;  1OXX K;  1RIP A;  2ES2 A;  1I4H A;  4AIM A;  2NZO A;  2OXP A;  2A6H C;  4HJA A;  4JI2 L;  3TN2 A;  4A93 B;  1NNX A;  2JA7 H;  2A6H D;  5IYB G;  3OWF A;  1IBM L;  1L0Y B;  1WVL A;  2G9D A;  3DLL A;  1Y8P B;  4OON A;  5DEH A;  5IP9 H;  1PH2 A;  3T53 B;  2BH2 A;  2VQE Q;  1F9S A;  3TQY A;  3HOW H;  3GTM H;  1U0L A;  5K36 H;  1X3E A;  2QA4 A;  1CUK A;  1FR3 A;  5JEA J;  3EN2 A;  1DJR D;  2MQH A;  3G6J B;  3CCV A;  3C2P A;  4EVO A;  1L1O B;  2JP1 A;  1PH3 A;  1Y8N B;  1WTP A;  2JA5 H;  1V8Q A;  2OF1 A;  1A3U A;  4TSS A;  4EGV A;  2UXB L;  2MNA A;  5JAV A;  1VQK A;  3AYH B;  1F2L A;  1XMO Q;  4ZRZ A;  1MIU A;  1K3R A;  4XDX A;  1ESF A;  1AZP A;  1N32 Q;  1LAB A;  3KLS X;  4QJF A;  1QVG A;  4IZ8 A;  3I4N B;  1A62 A;  1EWH A;  4GLA C;  4JW0 A;  2B2Y C;  2JA7 G;  2UUB L;  3OOC A;  1S40 A;  1PRT C;  2BH8 A;  1XMQ L;  2I07 B;  1WFQ A;  5G3L D;  2KHS A;  3PIO A;  1KNA A;  1PRT D;  1QUQ A;  1KTK A;  2ATW A;  5IP9 G;  3T51 B;  1KL9 A;  1N36 L;  1GUS A;  1EEF D;  1K73 C;  3HOW G;  3SHL A;  5C4X B;  1TWH H;  1E2Z A;  2FJ2 A;  4GZY C;  2KBN A;  5JOB A;  1NUC A;  3NP8 A;  4MZ9 A;  3T1H L;  2A68 C;  3HKZ B;  3L3O C;  3I4O A;  4OO1 H;  1M4V A;  1TWC B;  2DNE A;  2A68 D;  3SK8 A;  1TXY A;  3UDG A;  4BBS B;  4Z9C B;  4L63 B;  2R61 A;  4IUQ A;  4A3M H;  2QKI C;  2B2U C;  3H3V I;  1SR3 A;  1TY2 A;  5GQO A;  1U9R A;  1PH8 A;  2JXM B;  4DR6 L;  3T1Y L;  1S5D D;  4JI1 Q;  2UU9 L;  2K75 A;  2ZJP A;  3W3A A;  4YIJ A;  3I7F A;  3OIP A;  4KJN A;  4JI7 L;  3RZO B;  4K5V A;  1A15 A;  2ZM6 L;  4JI6 Q;  2NVQ H;  2C5C A;  1A6X A;  5CV7 A;  4YY3 Q;  5GRO A;  4BY7 B;  2XSC A;  3GTJ B;  2AQ1 B;  5M3F B;  1DOK A;  3X3M A;  4LFC Q;  4C1N K;  4QCL A;  4C56 C;  2H5X A;  2KOL A;  1B3Q A;  1EY8 A;  3AQQ A;  4DR1 L;  4BWG B;  1JMC A;  4YWL A;  4DR2 Q;  4LUO A;  2Z6K A;  4BA2 I;  2JA6 H;  4OWW B;  2K5V A;  1UE1 A;  2PW7 A;  5BR8 L;  2NTT A;  1IBL Q;  4ILW A;  3AMU A;  2R6G A;  4NMZ A;  3OMG A;  3PMF A;  1EY4 A;  4C2M B;  5KEE A;  3J80 c;  1YJ9 A;  1PFM A;  4JI0 L;  4JBJ A;  2PZW A;  4A3E H;  3CKI B;  5LL6 S;  1RTN A;  3DEP A;  3BU2 A;  5ELD A;  3BVG A;  1QJO A;  2NBF A;  4P2C B;  2A69 C;  3ULP A;  1Q90 A;  2E2H B;  5IYD H;  1SXT A;  4C3H G;  2A69 D;  4BY1 H;  2R7F A;  5JPN C;  1SFO H;  1ET9 A;  1I50 B;  2PPB C;  2F0W A;  2QDB A;  1RDP D;  1C4Q A;  2K14 A;  3SDZ A;  5FO8 B;  1JJC B;  5C4H A;  5IT9 E;  1GUT A;  2EYH A;  1SYC A;  4PMB A;  5J22 A;  4DV2 Q;  5I6W A;  3P75 A;  4ZUJ A;  1WD0 A;  4B3M L;  3S15 B;  1SBB B;  2EJM A;  2VQF Q;  1SYG A;  3A5U A;  1K83 B;  1NBW A;  3T4A C;  1K0S A;  3CME A;  1L1O C;  5EQ0 A;  4A76 A;  2RCN A;  3TDQ A;  1J6Q A;  2EY5 A;  5EKI A;  1F9R A;  2YYZ A;  1HFN A;  2CH4 W;  3G48 A;  3NEN A;  1TWG H;  2K5H A;  3I90 A;  5EPJ A;  1H9R A;  5IGB A;  4BY1 G;  2XVS A;  3GTO B;  3GTG H;  1NMG A;  1SAP A;  3S2D H;  1WYD A;  3VYU A;  2EPB A;  3IKJ A;  1I94 Q;  1EIG A;  4E6I A;  3G4S A;  5FJ8 H;  4V0B A;  2PNH A;  1SYE A;  3PUW A;  1O78 A;  3BZD B;  2IPK D;  1A2U A;  5COR A;  3MXN A;  1JIC A;  1SNQ A;  4LF6 Q;  1VMC A;  2K04 A;  5ELF A;  1CSQ A;  1STB A;  4GN3 B;  5IWA L;  4KI0 A;  1IHZ A;  4DK0 A;  1O7Z A;  1EZ6 A;  1TS2 A;  2K5Q A;  2F0H A;  2WKC A;  4DV7 Q;  5KYI A;  4XT3 B;  3M7N A;  4P71 A;  5IOD A;  2K01 A;  1KD1 C;  2EXZ A;  2HHH L;  4K8I A;  5C3E H;  4JBW A;  2JYO A;  3OW2 A;  4KHP L;  2KUM A;  1VQN A;  5CV4 A;  3AFQ A;  2F1M A;  5E7N A;  5EKL A;  1YEZ A;  1RHP A;  2EQS A;  3ERQ A;  4K14 A;  1XNQ Q;  4KY6 A;  3NXW A;  3FVQ A;  1TR5 A;  1YVC A;  3WWV A;  3K7A B;  1Q7Y C;  4DNT B;  4L6T B;  1LT5 D;  1Y1V H;  4DPG A;  4I7Z C;  4BXX G;  2WII B;  4X65 L;  1SDF A;  4IAL A;  1QNK A;  2E76 C;  4LF5 L;  4R4Q A;  2NVY B;  3NSW A;  4CDD C;  4YCW A;  2G9H D;  4IFD I;  1VF5 C;  1B70 B;  4WJ4 A;  2JEA I;  4GNX A;  3G6E A;  4Q0F A;  3E6Z X;  1KIX A;  3BZC A;  1B4O A;  2SOB A;  2B8G A;  1PXU A;  1A2T A;  3A55 A;  4OWT B;  5HY6 A;  4ME5 A;  3FMC A;  4UDU C;  4C3J G;  4ZAI A;  2AUJ D;  3W2D A;  2VXW A;  2DY8 A;  1JOQ A;  1PH5 A;  1YBY A;  3PO2 G;  3BDO A;  5J3B A;  4ZQ3 A;  4JV5 L;  1GVP A;  1HNZ Q;  1XNR Q;  3KOJ A;  1Y1V G;  4LUZ A;  1BOS A;  3MA2 B;  1WCM B;  1CTM A;  4J15 A;  4XYQ A;  1R9T B;  5NUC A;  2K50 A;  4CKC A;  3ND9 A;  1EFW A;  4ZLT F;  4X64 L;  2LKV A;  2RDF A;  1QVF A;  3VA5 A;  2F0N A;  4DAY A;  1L0X B;  1HJP A;  2OTJ A;  1VQH A;  3PGZ A;  4RA8 A;  3N52 A;  1ILQ A;  2RKS A;  4NPS A;  1EL0 A;  1IXR A;  3NBH A;  4DV6 L;  1ASY A;  1JT8 A;  1LTI D;  2IL8 A;  5FK9 C;  2EYL A;  2F0S A;  1YHA A;  4A93 H;  4CBV A;  1GUO A;  1SJH D;  3D0F A;  1F77 A;  4A3I G;  4A3C H;  2BDO A;  1I4X A;  1TWA B;  4PG3 A;  3CCE A;  4K6L A;  2IX0 A;  5EBD A;  1YJW A;  2R7Z G;  3MFG A;  2EE1 A;  2Z4I A;  2L4N A;  2KQ3 A;  2MO0 A;  2NTS A;  5F2D A;  2B63 B;  3VA7 A;  4A3K G;  4JI5 L;  4KHV A;  2YTY A;  4RWS C;  2PI2 E;  3T56 B;  1VDZ A;  1X3Q A;  4KKT A;  4YCU A;  5D3D A;  2EYJ A;  5E4W C;  1HNW Q;  1LT3 D;  1Q1E A;  2K52 A;  1NMF A;  3E5S A;  3CC4 A;  1QZG A;  4L8J A;  3I4N H;  4A3M B;  4H13 C;  3I4M B;  2HDM A;  2D2C C;  4M1U B;  1PA6 A;  4JI3 Q;  5M5W H;  1S5F D;  5BN5 A;  4KTA A;  1NJI C;  1HNX L;  2D62 A;  4PZ8 A;  4ALP A;  3HOU H;  1PFN A;  1NR4 A;  1TY0 A;  1YJN A;  1UE7 A;  3GTL B;  1QOH A;  2NWG A;  5C4X H;  1BUV T;  5DNF A;  3I70 A;  1IL2 A;  3S14 B;  3MAQ A;  2C9O A;  1PH7 A;  1ZXT A;  1JJ2 A;  1GHK A;  3GDE A;  2Q2H A;  2BE5 D;  1T9H A;  3OIQ A;  4B3T L;  1N34 L;  1YI2 A;  3DMU A;  1TWC H;  5JJI A;  3NE5 B;  4BBS H;  3H0G H;  5J39 A;  2PQE A;  1X9N A;  1UE6 A;  2L15 A;  1BF4 A;  1TVX A;  2M00 A;  2PI2 A;  3SR1 A;  3I4N G;  4X66 Q;  3DWQ A;  2IX3 A;  2PMZ E;  4CDF C;  4FYD A;  4BBR G;  1H9S A;  1CFM A;  1B8A A;  3RZO H;  2PNR C;  1SYB A;  3S1N H;  4BY7 H;  3GTJ H;  5M3F H;  5M3M H;  5C4X G;  3PCO B;  5IIF A;  5CV8 A;  3HOV B;  3A8J E;  1ICW A;  5CBA E;  1HFG A;  2KEN A;  1OO9 B;  2BA1 A;  4BBS G;  1EOT A;  4XIG S;  1VQ8 A;  4C2M H;  5FLX L;  4HCE A;  1LTG D;  1Y1W G;  4IFD J;  1JE5 A;  3OMC A;  4LUV A;  1CT1 D;  1STA A;  5LMU L;  3VR4 A;  3ICE A;  5C44 B;  1F2Z A;  5FKA C;  2RQX A;  2E2H H;  4X6A H;  2K5W A;  4QIW B;  1TWG B;  3BZK A;  4IUP A;  4ID6 A;  5KYL A;  3FEW X;  1I50 H;  1LT4 D;  4RGN A;  2WB1 E;  4BY7 G;  1D2B A;  2F0G A;  5M3F G;  4GKJ Q;  3BDL A;  2NN6 G;  3R2T A;  4YHH L;  4DUY L;  4JC0 A;  1PZI D;  1BR9 A;  2Q8T A;  4JPB W;  2RHS B;  2ZTE A;  1OXU A;  3DM1 A;  5I4D A;  1FGB D;  4K5X A;  3RNU A;  1FYC A;  2DJG C;  1MSG A;  1AW7 A;  1BXT A;  4KKU A;  3S15 H;  4CHT B;  1CSP A;  5TSS A;  2E2D C;  5I2Y A;  4WOR A;  3M4O B;  3W5O A;  4GS3 A;  3L7Z C;  1RCV D;  1SE8 A;  4IJH A;  2L0C A;  3RLF A;  4O1N A;  4MIU A;  2L11 A;  2WAC A;  4GKK L;  4GN4 B;  1F2M A;  3N6R A;  4LF9 L;  1ENC A;  1IW7 C;  1TS3 A;  2K7V A;  3GO5 A;  2NYZ D;  4KLK A;  2F0J A;  2MFI A;  4DA2 A;  1JR0 D;  4DAY B;  3U9S A;  4DV0 Q;  3NTH A;  1HTL D;  2IHF A;  4J1M A;  1ML0 D;  2K1B A;  2I5H A;  4KY5 A;  4C1N I;  2HUG A;  3RLO A;  3CC2 A;  2ASB A;  1IZ6 A;  2HIV A;  1CQF A;  2K5N A;  3J7Y W;  4H0L C;  2SEB D;  1EIY B;  1AE3 A;  2H1E A;  1OXV A;  4DUZ L;  1RL2 A;  4UAI A;  4XT1 B;  3Q6S A;  1IKL A;  4JOI C;  1E7Z A;  4L5S A;  3V96 A;  3EQL C;  1FJG L;  3MTS A;  1VQ5 A;  3AB9 A;  3HRZ C;  4RH6 A;  4OO1 I;  4A3G B;  1V1O A;  2IWH A;  5COY A;  3VYS A;  5DM6 3;  2Q2T A;  1OXS C;  2A8V A;  2UUB Q;  2Z9H A;  5L37 A;  1XMQ Q;  3TRE A;  1PH9 A;  3NWT A;  3MHB A;  1A8V A;  1C0A A;  5CYU A;  4DV1 L;  1TS5 A;  3A5Z B;  1X6O A;  4IUN A;  1JE4 A;  5GAE C;  4JYA L;  1ESR A;  1GO3 E;  3HOZ G;  4Y52 H;  3J7A 5;  4XQN A;  4FVM A;  2NVY H;  3HOX B;  3KBX A;  3TSS A;  3A8K E;  1PDQ A;  1GM5 A;  2F0O A;  4IUR A;  2D9U A;  4R1J A;  3DWP A;  1P16 A;  1ILP A;  4IQZ A;  4ME3 A;  3S1Q B;  5JEA H;  2MJ8 A;  3OTO L;  1C7Y A;  3HEJ A;  1PFB A;  1N8R C;  3CCJ A;  4PMC A;  2ZXP A;  3TEH B;  2DGY A;  2K4K A;  4PZ7 A;  3HFZ B;  4XXE A;  1VQ7 A;  4EX5 A;  3WOE A;  1BQQ T;  4M8A A;  4KN4 C;  4RHR A;  4RCO A;  3VYR A;  5T1G A;  1I4G A;  1K9M C;  1E24 A;  4A3J G;  1FVI A;  1STY A;  4GLV B;  3I55 A;  1WCM H;  3STB C;  1LLR D;  1R9T H;  2SNM A;  2JA8 B;  3H15 A;  3IRB A;  4DR1 Q;  1SEB D;  2IX1 A;  5BR8 Q;  1BDO A;  4KN7 C;  3QG1 A;  4FP5 D;  3NQT A;  2M2L A;  4EQO A;  5IYC H;  4DV4 L;  1FD7 D;  4HAE A;  3KDF B;  4ZYS A;  3ITP A;  2PQA B;  4DR7 L;  2OT2 A;  4KK7 A;  4RCN A;  3FRP B;  4R8I A;  3PF5 A;  1K8A C;  4KV6 A;  4K2L A;  1P8L A;  1MD2 D;  1TWA H;  5M5W B;  1E1O A;  4CJ2 C;  3CPF A;  3HOU B;  2F03 A;  1HUN A;  2F0D A;  4OIJ A;  5K5P A;  1QIL A;  2E74 C;  3H3V C;  3MFY A;  2B63 H;  5K36 G;  2HD3 A;  5JPM C;  3K59 A;  1ZYR C;  3PSI A;  3QIA A;  1FNU A;  1LTL A;  3RD4 A;  3SK5 A;  2AWO A;  1MBY A;  1ZYR D;  2JA5 G;  5IYC G;  4L5Q A;  3P20 A;  3SVM A;  2N78 A;  4L5R C;  1V1P B;  3H0G B;  1V43 A;  1CKN B;  3LNN A;  1I6H H;  4OL7 A;  2RSN A;  4R4T A;  2SNS A;  3UDI A;  3A7L A;  2KED A;  5LMN L;  4IN3 A;  3I4M H;  2N88 A;  4O2D A;  2IJ0 A;  1DON A;  4X3U A;  1LUZ A;  3IFD A;  2NZH A;  1QB5 D;  1E3P A;  1DCZ A;  1STG A;  2Q8R E;  3RZD B;  4B3R Q;  4KMU C;  2ZJQ A;  3GTL H;  1JB7 A;  2B2W A;  1PVO A;  3L0O A;  5CR3 A;  1SNM A;  2O5I C;  3S1N B;  4UP9 A;  1GOZ A;  3S14 H;  5M3M B;  2I46 A;  2MPM A;  4ODG A;  3D8G A;  1I4Q A;  1LM0 A;  1VQA A;  2VY3 A;  4H02 A;  3CW2 C;  2KA7 A;  4HR7 B;  1XPR A;  1EQV A;  2F0T A;  2F3V A;  4OO1 G;  2B2T A;  2KVM A;  4QGU A;  2HCI A;  1HZC A;  2XTI A;  1XYI A;  1N33 Q;  3DXJ C;  1MJE A;  1MHW C;  4N9T A;  1LO5 D;  3U4Z A;  2UUC Q;  4A3M G;  1YIT A;  2VNU D;  1K0R A;  5AJ3 Q;  1TKW B;  2RDG A;  1CA5 A;  1NE3 A;  2RA4 A;  3WOF A;  1EQR A;  1RJT A;  2F0L A;  4KHP Q;  4QUC A;  1VQM A;  2F4V Q;  5IT9 L;  1J9O A;  3U9O A;  3M9B A;  1J5E L;  1LTB D;  3MVV A;  2I0Q A;  3DEO A;  4A3F H;  1K3B C;  3L9A X;  3CF5 A;  3HOV H;  1STN A;  4LK1 C;  1BKB A;  1SSO A;  2XWB B;  3PQI A;  4A3B B;  1BBX C;  2BCO A;  2FXQ A;  1AP0 A;  4X65 Q;  1M8A A;  5E3F A;  2VL6 A;  1IKM A;  4LF5 Q;  1A63 A;  2EDG A;  1XMO L;  1H9K A;  2VUM B;  1ET6 A;  1PYB A;  4LF7 Q;  2F0K A;  3EVQ A;  2WFW A;  2JA6 G;  1N32 L;  2N49 A;  2F0E A;  3PUX A;  3TP6 A;  3DUZ A;  1KDB A;  2HDL A;  4POG A;  1ICF B;  2E5L Q;  1WTV A;  4DV5 L;  2B2V A;  1FNV A;  2R7D A;  1EWI A;  4QMG A;  3NBI A;  4J8Q A;  1WTO A;  5HGT A;  1EEI D;  4NB3 A;  4A3E G;  5C3W A;  5C44 H;  2XIW A;  2WAQ E;  3R2I A;  3AFP A;  2EY6 A;  2WAQ G;  5IYD G;  3U50 C;  4HJ8 A;  3F8T A;  5GAD C;  1EWC A;  1CKO A;  3MC0 B;  3A56 A;  4LFA Q;  4DAV A;  1VCI A;  2F52 A;  2FMC A;  4GOP A;  3HOV G;  1D6E C;  1F9P A;  4G7O C;  2QCP X;  2CH4 A;  3EJI A;  4DXG A;  3K5M A;  4JI4 L;  5C6A A;  4BA1 I;  1DXM A;  2K33 A;  3E0J A;  1Q8I A;  2QEJ C;  1JOO A;  1B2T A;  2UXC Q;  2RVL A;  2MO1 A;  3M4O H;  4X3K A;  2CKZ B;  2XNA C;  1UEB A;  2Z6B A;  5CC4 A;  4DK6 C;  5J1Z A;  4JI1 L;  4DR4 Q;  1M1K C;  2UXD L;  4IOA A;  2MUY A;  4DFA A;  4DNR B;  1A3T A;  4B3S Q;  3EA6 A;  2D0O A;  4RG1 A;  4CDE C;  1DOM A;  2GVB A;  5JJZ A;  5FLX c;  4F88 A;  1XJV A;  1U4P A;  5IP7 H;  2IW3 A;  4R8N A;  4DN4 M;  4R4C A;  4DR2 L;  1QG7 A;  5FJ8 G;  3CD6 A;  4XQJ A;  1BVS A;  2HQE A;  3H3V H;  2K32 A;  1PYS B;  2A19 A;  4WRD A;  3I4L A;  3E9H A;  1KLU D;  1Z7T A;  1PTO F;  4OXP A;  4JI5 Q;  4JI8 L;  3OPO A;  1I5F A;  4A3L H;  2SDF A;  2L12 A;  2EY1 A;  1B3A A;  3R8B A;  2F3I A;  3KF6 A;  2IY5 B;  3TS0 A;  1QUQ B;  2A74 C;  4A3G H;  1C48 A;  3BG3 A;  5C3E G;  3KBG A;  2DY7 A;  2Y0S E;  2EIF A;  2ZXR A;  1UAP A;  2PZU A;  1OXT A;  4A3D B;  5C0X H;  2Y0S G;  2D0P A;  1SNO A;  5JVH 3;  3CCU A;  4KJO A;  5C4J B;  3GTQ H;  1CQV A;  2EY2 A;  2K28 A;  4DV2 L;  1VQ6 A;  5DM7 3;  1R4Q B;  1TWF B;  1H9M A;  2VQF L;  3NTI A;  1YHQ A;  3E3X A;  1XWE A;  4F8M A;  3BVZ A;  4FF4 A;  2EJG C;  3ULL A;  3HOX H;  2PYK A;  1EIH A;  5C4Z A;  1SRU A;  4B3T Q;  1H9J A;  2CVR A;  5EJW A;  3R93 A;  2NN6 I;  1HR0 Q;  2QDL A;  5IGC A;  4P73 A;  2ZTC A;  3BYT B;  1KAW A;  1S4Z A;  1E2W A;  4LMQ D;  3S1Q H;  2V4D A;  1HHV A;  2CWP A;  4A3G G;  1PZK D;  2O5J C;  5IGG A;  1VQE A;  1IBK L;  2OEO A;  2LS0 1;  2RF4 A;  5C0X G;  2Q2I A;  5FLM H;  4OX9 Q;  4H44 C;  1KDA A;  4KD4 A;  3T16 A;  5CBE E;  4LF6 L;  2NUC A;  4ABN A;  2AHO B;  1CHQ D;  4DV3 L;  1O7Y A;  2QEX A;  1O7L A;  2IT1 A;  3RR5 A;  2VW9 A;  1HH2 P;  5KND A;  2DNC A;  3Q8D A;  5IGD A;  2JA8 H;  4PNY A;  1EYD A;  4LFB Q;  2UUA L;  2DUD A;  2TSS A;  2G5D A;  5EBC A;  3M4Q A;  1CI3 M;  1II3 A;  2LFN A;  3CC7 A;  1GJX A;  3CCQ A;  1KAA A;  1FNW A;  1GKH A;  4X3T A;  1N9W A;  4DAM A;  1PH1 A;  4IUV A;  1HZA A;  4Y7N B;  4NXM L;  1GUG A;  3RUZ A;  3SXH A;  1IYJ B;  1T5E A;  4N8F A;  3KK7 A;  1XNQ L;  2ZT9 C;  3D4D A;  3GQB A;  5ELN A;  5IOC A;  1I6H B;  2B2U A;  1FL0 A;  2KCM A;  4HSV A;  3EBE A;  3KYH C;  3MEF A;  1GXD C;  4A93 G;  3S1M H;  4LF8 Q;  2ENB A;  4JCV E;  1A3V A;  4RGO S;  4A3C G;  3HOY H;  1LYL A;  1ENF A;  1RF2 D;  4BS9 A;  4R4O A;  2B8F A;  4DUY Q;  2C35 B;  2IHE A;  1EY9 A;  2RHQ B;  3WDN A;  4HJ7 A;  3EIV A;  5KRU A;  3K7U C;  3J80 E;  1LV9 A;  1SYD A;  2NVT H;  4FXD A;  1SLJ A;  1X3F A;  3MXU A;  3I72 A;  2F3W A;  1LTR D;  4PQX A;  1CA6 A;  4IPC A;  3CAM A;  3RLN A;  2M9V A;  4CJ1 B;  4K0K Q;  1HQR D;  4POF A;  3FDT A;  1Z9F A;  4F7X A;  2OQ0 A;  4TRD A;  2PW5 A;  1U5K A;  2N3S A;  4C3H B;  3NK9 A;  3MZ5 A;  2CFM A;  3J7A V;  1G2S A;  2OWO A;  3S1R B;  1HNZ L;  3MXN B;  1RD9 D;  3K0X A;  3RZD H;  3SEB A;  5H1S E;  4IFD H;  1J8I A;  3HOU G;  5ELO A;  4O42 A;  2L5T A;  1S3O A;  1R4P B;  2L9H A;  3X3N A;  4EQN A;  1Y69 U;  2LMC B;  4A3F B;  4NKL A;  1EY7 A;  2XGT A;  3HKZ E;  1G6Z A;  3I91 A;  5FOB B;  3QO2 A;  4ZK9 B;  3HKZ G;  3BS1 A;  1M90 C;  1DOL A;  4RGM A;  4DXF A;  3ZYY X;  4DUZ Q;  1D5Z C;  3H0G G;  2L55 A;  2KHI A;  1S72 A;  5M5X B;  2B2W C;  3QR8 A;  4JBM A;  1HZB A;  3Q0A A;  1PTO B;  2XRQ D;  1Q81 C;  1PMR A;  1WTH A;  2B3G A;  2WV6 D;  2PZT A;  4UP8 A;  3VR3 A;  5I6Y A;  1HUM A;  3TBI B;  4NXN Q;  4HIO A;  3A74 A;  1B9M A;  3JC6 6;  2Z6K C;  3Q24 A;  2ZJR A;  4APV A;  5M3M G;  2B2T C;  4JYA Q;  5GAG C;  4A3B H;  4JG2 A;  4GNX B;  4OWX B;  3J81 E;  1RKN A;  1Q3L A;  2MP1 A;  4FO2 A;  3ND8 A;  1EU3 A;  1GUN A;  3OYY A;  2VUM H;  2EYF A;  3MXP A;  3TP7 A;  2EOT A;  5HUR A;  2ICE C;  4DR5 Q;  1HR0 W;  4X62 Q;  1EFI D;  5ELE A;  3T13 A;  1S5E D;  2LY7 A;  1IL8 A;  1W6J A;  4V19 0;  2MHV A;  3A8I E;  3S2H H;  1DZ1 A;  4AQY Q;  1BO0 A;  3K81 C;  5A2Q E;  2GVA A;  3BVM A;  5EAY A;  1BBW A;  1PLF A;  4LWC A;  3K5N A;  1E1T A;  4KHZ A;  4B9W A;  1E22 A;  3H6M A;  1I3Q B;  4JI2 Q;  2VZA A;  5IE8 A;  5M9O A;  5JVG 3;  1IW7 D;  3S16 B;  4HIM A;  3CQZ H;  1IBM Q;  3UE0 A;  5EPK A;  2CQO A;  2B2V C;  2E2I B;  3TZD A;  3CRL C;  4YWM A;  1SN8 A;  2VUM G;  4ULL A;  2DJF C;  5IT9 c;  3A54 A;  4X3S A;  3NBH B;  1Z47 A;  3M85 A;  1KNE A;  2QF7 A;  4X66 L;  1MKH A;  1TII D;  1XTC D;  1G51 A;  2TMP A;  3PV0 A;  1BBU A;  1K28 A;  1A0I A;  2PO4 A;  3ONA B;  3CXC A;  1HA5 A;  3IAY A;  3JAM E;  2UXB Q;  2XN9 C;  1KXL A;  1D7Q A;  4DR7 Q;  2EJF C;  2LSS A;  1YHB A;  3PO2 B;  2YTV A;  1VQF A;  2RSO A;  4IUT A;  2J0T D;  4FF2 A;  3CRK C;  2OQK A;  4P74 A;  4F87 A;  5LHY 1;  4A75 A;  1DYQ A;  3GTQ B;  2EYO A;  1Q82 C;  3QOL A;  5KNC A;  1QVC A;  2CHB D;  1STH A;  2JE6 I;  1N36 Q;  1EYG A;  2WKD A;  4AH6 A;  4DGZ A;  3R3O A;  3NQI A;  3G71 A;  1O7I A;  3T1H Q;  1V9P A;  3NWS A;  3J80 i;  4KD3 A;  1HTP A;  1HXY D;  1EOV A;  2JN4 A;  4DNI A;  3W1B A;  2K6A A;  4DR3 L;  2F4I A;  5IYB H;  3SK4 A;  5LMN Q;  4A3I B;  4QY7 A;  2RCF A;  4NP5 A;  3ZJY C;  1X65 A;  1UWV A;  4GKJ L;  2MGS A;  1WD1 A;  4A3D H;  4O0A A;  1PTO C;  4DR6 Q;  3T1Y Q;  4FF3 A;  1VS0 A;  4L5T A;  5C4J H;  1S5C D;  2UU9 Q;  1PTO D;  2F0V A;  2R7Z B;  3PF4 A;  4LF4 L;  1VQB A;  4JI7 Q;  1TWF H;  1EYC A;  2ZM6 Q;  1EY5 A;  1JWU D;  2EYP A;  2F0P A;  3C3L A;  1B50 A;  4OEL B;  3KUP A;  4GNX C;  3L2P A;  4HN7 A;  1QCB D;  3I56 A;  4HID A;  4GLX A;  3STB D;  4MN3 A;  1H9S B;  3CPW A;  4WJW A;  3ERS X;  5DAU A;  4YWK A;  2K5D A;  3HKS A;  1BNZ A;  3M3Y B;  3I73 A;  3M4P A;  4JI0 Q;  3FHW A;  1SE4 A;  2VS1 A;  5JEA G;  1VQ9 A;  4DV0 L;  4A3D G;  3M7G A;  2ICI A;  3CCR A;  3BDC A;  4HJ9 A;  4FDB A;  1D1K A;  1I4P A;  2LXK A;  1J5E Q;  3PO3 B;  3F2C A;  4HCS A;  3CU7 A;  5CV9 A;  4RKL A;  5FO7 B;  3S1M B;  2N55 A;  1G91 A;  3HOY B;  2KHJ A;  1KRT A;  1ASZ A;  1WCM G;  3CCS A;  3RN2 A;  2R93 B;  1Q8K A;  1X55 A;  4A4I A;  3KJO A;  1PH6 A;  2A6E C;  4MNO A;  1KLG D;  1K8O A;  1BCP B;  2NVT B;  1MJC A;  2A6E D;  4B3M Q;  3J81 i;  3QJY A;  3I3C A;  4DV5 Q;  1G29 1;  4HMI A;  4HJ5 A;  4Y7N H;  3D3R A;  3FPP A;  1EQT A;  1SYF A;  4BBR B;  3TZU A;  2PMZ B;  3HP3 A;  3LX0 A;  1GUW A;  1H95 A;  3NPP A;  2DN8 A;  3S17 H;  2I5M X;  4KY7 A;  4DK1 A;  3GTK B;  1VQL A;  4ZKC B;  4JBK A; 
#chains in the Genus database with same CATH homology
 3HS0 C;  2XWJ B;  4AYB B;  5E4X A;  3P1H A;  2AQ3 B;  1Q12 A;  2YU9 B;  5LL6 X;  1QE6 A;  2FIN B;  1Y1W B;  3A7A B;  2CQA A;  3FKI B;  3H09 A;  3HZX A;  4NDX A;  2XRS D;  3V2T A;  1LT6 D;  5D14 A;  2J7Z A;  1ONL A;  3PIP 3;  4C3I B;  1ROD A;  1UNS A;  3I8Z A;  3GP7 A;  5AFW A;  5I9P A;  4CKB A;  2WB1 B;  1EY0 A;  1SNP A;  1XX8 A;  4CGY B;  1LTA D;  4U68 A;  4CKE A;  1O80 A;  4Q5V A;  1XXG A;  5C0X I;  1JC7 A;  1Q1B A;  3P7J A;  2GA4 B;  5D65 A;  1UUP A;  2Z4H A;  3VR5 A;  2L1B A;  5IGF A;  1MI2 A;  3URY A;  3TP5 A;  1JWM D;  4DAP A;  3HG9 A;  2X6L A;  2NVX B;  2F0Q A;  3NTK A;  1QWY A;  3D6W A;  4RGT A;  1PTO H;  3S2H B;  4NW2 A;  2K05 A;  3DWA A;  2WIN B;  3SE0 A;  1JCK B;  1ZEQ X;  4ZUI A;  3TP8 A;  1GHJ A;  1SJE D;  3D31 A;  3CQZ B;  1G8Z D;  3G7L A;  2F0M A;  3K0Y A;  2VB2 X;  3MEH A;  1X3P A;  3K5L A;  1F9Q A;  2R92 B;  3D4R A;  1BCP C;  2K03 A;  1AZQ A;  4DF7 A;  1TS4 A;  1MSH A;  1BCP D;  1LTT D;  5C3X A;  1EU4 A;  2KCN A;  2BA0 A;  3QWN A;  2VB3 X;  4XTC S;  1IYV A;  3GTP B;  5IGE A;  1JQY D;  1X32 A;  2BOS A;  2H4O A;  3HOZ B;  1SND A;  1WTQ A;  1JOK A;  3VR2 A;  1CZG A;  1SNC A;  3HGB A;  3RMH A;  3IFT A;  2BDN A;  2D5D A;  4CJ0 B;  2A73 B;  3FPU B;  2HCC A;  1TQO A;  1QNU A;  4I65 A;  4A3J B;  2EVB A;  3O13 A;  4OHJ A;  1B53 A;  3LWU A;  2KJX A;  4R9W A;  3KF8 A;  1EYA A;  5CV5 A;  3QOJ A;  4G7H C;  1K8M A;  4H7B A;  2E2J B;  3M4Y A;  4K8J A;  4RHS A;  2CW0 C;  5I2X A;  1HA6 A;  1D1I A;  2CW0 D;  2NB0 A;  5BN3 A;  2E75 C;  3S9W A;  1CK1 A;  4FXK C;  1IYU A;  2KCC A;  3NHH A;  4DU9 A;  1U4M A;  3OHX C;  3PIO 3;  2JA7 B;  3PUV A;  4QF4 A;  3TME A;  4G7Z C;  4HED A;  1B44 D;  1PZJ D;  2JEB I;  2R3Z A;  2Q8I B;  3HOW B;  1DM0 B;  3GTM B;  2B2Y A;  4JK1 C;  3ERO A;  3QB3 A;  4FXG C;  4N9P A;  3CHB D;  3KLR A;  4RKB A;  2FHT A;  5G3L F;  1JOR A;  5C0X J;  1PRT F;  5BN4 A;  2JA5 B;  4RAU C;  4FNF A;  1W6K A;  2AQ2 B;  2FFK B;  4K6D A;  1CM9 A;  3IL8 A;  5FO9 B;  3NUC A;  5ELB A;  4K2K A;  3VYT A;  4S3S A;  4B9X A;  1UEA B;  3J80 L;  3S17 B;  1SMY C;  5ELC A;  1TWH B;  3AU7 A;  1SMY D;  3DHQ A;  2B39 A;  3C46 A;  3C1F A;  5C5L A;  1U4R A;  1HQM C;  5CMD A;  2AUK A;  2RDH A;  3BYY B;  1D5X C;  3H94 A;  4HTH A;  3MXG A;  1AN8 A;  4TQU S;  1EY6 A;  3Q23 A;  3F2U A;  4MHE A;  1T5X D;  2PCF B;  1MGS A;  1I6V C;  4LJZ C;  1AFP A;  2NVQ B;  2Z8L A;  1Z6H A;  2X6G A;  4HSP A;  5CV6 A;  3UI2 A;  2BE5 C;  2EYM A;  1LTS D;  1DD2 A;  1Y8O B;  1TT2 A;  5ISR A;  1AEX A;  2JA6 B;  1D5M C;  5E1F A;  3EFX D;  1C8C A;  4A3E B;  4XQQ A;  3GV3 A;  4IUU A;  1HRJ A;  3K57 A;  1VMP A;  1NCV A;  2WAQ B;  1CHP D;  4B08 A;  4BY1 B;  2RBM A;  3KLS A;  1SFO B;  2WP8 J;  1WTW A;  2NN6 H;  4QUF A;  3J81 L;  4OGQ C;  4IFD G;  4TKO B;  1BCP F;  2AWN A;  1NR2 A;  1S5B D;  2KEE A;  3MWY W;  1SE3 A;  1WTR A;  3C1E A;  4G4K A;  3GV6 A;  3LWE A;  2J4X A;  3PUY A;  5T1I A;  5A2Q L;  2EZV A;  1G2T A;  3OWE B;  4C3I G;  4G57 A;  3GTG B;  5FLX E;  3S2D B;  3K5O A;  1CZW A;  1V1P A;  1E0B A;  1PYW D;  4WFN 3;  4PMW A;  1ZKO A;  5D3I B;  2FMM A;  1ENA A;  5KNB A;  2JSO A;  4HMJ A;  1NAP A;  3JAM L;  5EKK A;  3V05 A;  1WTX A;  2X69 A;  1F2Y A;  3D4W A;  5CGK A;  5EGT A;  3K58 A;  2KEC A;  5C3E B;  1YNN C;  5C5M A;  4J6H A;  1B9N A;  1PRT B;  1YNN D;  2Y0S B;  4C3J B;  1HPC A;  3D6C A;  4RFB A;  1NSN S;  3H91 A;  3J7A F;  4LAA A;  5M5Y B;  1RTO A;  1Y1V B;  1B1Z A;  1YNJ C;  2NZ1 D;  4U67 3;  1EZ8 A;  1YNJ D;  3PUZ A;  2ID0 A;  2QIL A;  5KGU A;  1KDC A;  2Z1C A;  3SK6 A;  1TU2 B;  4QB4 A;  3Q22 A;  4XYO A;  1JB3 A;  1STE A;  3GD7 A;  1KAB A;  1HCZ A;  4FF1 A;  2F0U A;  5A35 A;  4K5W A;  1U4L A;  4PV1 C;  4KKS A;  4ZKB B;  3K6O A;  2F0F A;  5I9O A;  3VR6 A;  1LAC A;  1I4R A;  5KIX A;  1SE2 A;  1VF7 A;  2A5H A;  1E2V A;  2ZXO A;  4EQP A;  4A3K B;  2O2L D;  2F0I A;  3OSO A;  5EPL A;  1JWS D;  2O4X A;  4OIK A;  3OW7 A;  1OXX K;  1I4H A;  2OXP A;  2A6H C;  3TN2 A;  4A93 B;  2A6H D;  3OWF A;  1L0Y B;  1WVL A;  2G9D A;  1Y8P B;  5DEH A;  3T53 B;  1F9S A;  5K36 H;  1FR3 A;  5JEA J;  1DJR D;  3G6J B;  3C2P A;  4EVO A;  2JP1 A;  1Y8N B;  1WTP A;  1V8Q A;  2OF1 A;  1A3U A;  4TSS A;  4EGV A;  5JAV A;  1F2L A;  4ZRZ A;  4XDX A;  1AZP A;  1ESF A;  1LAB A;  3KLS X;  4IZ8 A;  3I4N B;  1EWH A;  2B2Y C;  3OOC A;  1PRT C;  2I07 B;  5G3L D;  2KHS A;  1KNA A;  1PRT D;  1KTK A;  3T51 B;  1GUS A;  1EEF D;  3SHL A;  5C4X B;  1E2Z A;  2FJ2 A;  4GZY C;  5JOB A;  1NUC A;  3NP8 A;  2A68 C;  3HKZ B;  3L3O C;  4OO1 H;  1M4V A;  1TWC B;  2DNE A;  2A68 D;  3SK8 A;  4BBS B;  4Z9C B;  4L63 B;  2R61 A;  4IUQ A;  2QKI C;  2B2U C;  1TY2 A;  1U9R A;  2JXM B;  1S5D D;  3W3A A;  4YIJ A;  3OIP A;  4KJN A;  3RZO B;  4K5V A;  1A15 A;  2C5C A;  1A6X A;  5CV7 A;  4BY7 B;  2XSC A;  3GTJ B;  2AQ1 B;  5M3F B;  1DOK A;  3X3M A;  4C1N K;  4QCL A;  4C56 C;  2KOL A;  1EY8 A;  4BWG B;  4BA2 I;  2PW7 A;  2NTT A;  4ILW A;  3AMU A;  2R6G A;  4NMZ A;  3OMG A;  3PMF A;  1EY4 A;  4C2M B;  5KEE A;  1PFM A;  2PZW A;  3CKI B;  5LL6 S;  1RTN A;  3DEP A;  5ELD A;  3BVG A;  1QJO A;  2NBF A;  4P2C B;  2A69 C;  1Q90 A;  2E2H B;  1SXT A;  4C3H G;  2A69 D;  5JPN C;  1ET9 A;  1I50 B;  2PPB C;  2F0W A;  2QDB A;  1RDP D;  1C4Q A;  3SDZ A;  5FO8 B;  5C4H A;  5IT9 E;  1GUT A;  2EYH A;  1SYC A;  4PMB A;  5J22 A;  5I6W A;  3P75 A;  4ZUJ A;  1WD0 A;  3S15 B;  1SBB B;  2EJM A;  1SYG A;  1K83 B;  3T4A C;  5EQ0 A;  3TDQ A;  2EY5 A;  5EKI A;  1F9R A;  2YYZ A;  1HFN A;  3I90 A;  5EPJ A;  1H9R A;  5IGB A;  3GTO B;  2XVS A;  1SAP A;  3VYU A;  2EPB A;  3IKJ A;  1EIG A;  4E6I A;  4V0B A;  1SYE A;  3PUW A;  1O78 A;  3BZD B;  2IPK D;  1A2U A;  5COR A;  3MXN A;  1JIC A;  1SNQ A;  1VMC A;  2K04 A;  5ELF A;  1STB A;  4KI0 A;  1IHZ A;  4DK0 A;  1O7Z A;  1EZ6 A;  1TS2 A;  2K5Q A;  2F0H A;  2WKC A;  5KYI A;  4XT3 B;  3M7N A;  5IOD A;  2K01 A;  2EXZ A;  4K8I A;  4JBW A;  2JYO A;  2KUM A;  5CV4 A;  2F1M A;  5EKL A;  1RHP A;  3ERQ A;  4K14 A;  4KY6 A;  3NXW A;  3FVQ A;  1TR5 A;  3K7A B;  4DNT B;  4L6T B;  1LT5 D;  4I7Z C;  2WII B;  1SDF A;  4IAL A;  1QNK A;  2E76 C;  2NVY B;  3NSW A;  2G9H D;  4IFD I;  1VF5 C;  2JEA I;  4Q0F A;  3E6Z X;  1B4O A;  2SOB A;  2B8G A;  1PXU A;  1A2T A;  3A55 A;  4ME5 A;  3FMC A;  4UDU C;  4C3J G;  4ZAI A;  2AUJ D;  3W2D A;  2VXW A;  2DY8 A;  1JOQ A;  3BDO A;  4ZQ3 A;  1BOS A;  3MA2 B;  1WCM B;  1CTM A;  4XYQ A;  1R9T B;  5NUC A;  4CKC A;  3ND9 A;  4ZLT F;  2LKV A;  2RDF A;  3VA5 A;  2F0N A;  4DAY A;  1L0X B;  4RA8 A;  3N52 A;  1ILQ A;  2RKS A;  1EL0 A;  3NBH A;  1LTI D;  2IL8 A;  5FK9 C;  2EYL A;  2F0S A;  4CBV A;  1GUO A;  1SJH D;  1F77 A;  2BDO A;  1I4X A;  1TWA B;  4K6L A;  2IX0 A;  5EBD A;  3MFG A;  2EE1 A;  2Z4I A;  2L4N A;  2KQ3 A;  5F2D A;  2NTS A;  2B63 B;  3VA7 A;  4KHV A;  4RWS C;  3T56 B;  1VDZ A;  1X3Q A;  4KKT A;  5E4W C;  5D3D A;  2EYJ A;  1LT3 D;  1Q1E A;  3E5S A;  4L8J A;  4A3M B;  4H13 C;  3I4M B;  2HDM A;  2D2C C;  4M1U B;  1S5F D;  5BN5 A;  4KTA A;  2D62 A;  1PFN A;  1NR4 A;  1TY0 A;  3GTL B;  1QOH A;  2NWG A;  1BUV T;  5DNF A;  3I70 A;  3S14 B;  3MAQ A;  2C9O A;  1ZXT A;  1GHK A;  2BE5 D;  3OIQ A;  3DMU A;  3NE5 B;  5J39 A;  2PQE A;  1BF4 A;  1TVX A;  2M00 A;  3SR1 A;  3DWQ A;  2IX3 A;  4FYD A;  1H9S A;  1CFM A;  2PNR C;  1SYB A;  5IIF A;  5CV8 A;  3HOV B;  3A8J E;  1ICW A;  5CBA E;  1HFG A;  1OO9 B;  2BA1 A;  1EOT A;  4XIG S;  5FLX L;  4HCE A;  1LTG D;  4IFD J;  3OMC A;  1CT1 D;  1STA A;  3VR4 A;  5C44 B;  1F2Z A;  5FKA C;  2RQX A;  2K5W A;  4QIW B;  1TWG B;  4IUP A;  4ID6 A;  5KYL A;  3FEW X;  1LT4 D;  4RGN A;  1D2B A;  2F0G A;  3BDL A;  2NN6 G;  3R2T A;  1PZI D;  1BR9 A;  2Q8T A;  3DM1 A;  1OXU A;  5I4D A;  1FGB D;  4K5X A;  1FYC A;  1AW7 A;  1MSG A;  1BXT A;  4KKU A;  4CHT B;  5TSS A;  2E2D C;  5I2Y A;  4WOR A;  3M4O B;  3L7Z C;  1RCV D;  2L0C A;  3RLF A;  4O1N A;  4MIU A;  2L11 A;  2WAC A;  1F2M A;  3N6R A;  1ENC A;  1IW7 C;  1TS3 A;  2K7V A;  3GO5 A;  2NYZ D;  2F0J A;  4DA2 A;  1JR0 D;  3U9S A;  3NTH A;  1HTL D;  4J1M A;  1ML0 D;  2K1B A;  4KY5 A;  4C1N I;  2HUG A;  1CQF A;  3J7Y W;  4H0L C;  2SEB D;  2H1E A;  1OXV A;  4UAI A;  4XT1 B;  3Q6S A;  1IKL A;  3V96 A;  3EQL C;  3MTS A;  3AB9 A;  3HRZ C;  4RH6 A;  4OO1 I;  4A3G B;  1V1O A;  2IWH A;  5COY A;  3VYS A;  5DM6 3;  1OXS C;  3NWT A;  3MHB A;  5CYU A;  1TS5 A;  4IUN A;  1JE4 A;  1ESR A;  4XQN A;  4FVM A;  3HOX B;  3KBX A;  3TSS A;  3A8K E;  1PDQ A;  2F0O A;  4IUR A;  2D9U A;  3DWP A;  1ILP A;  4IQZ A;  3S1Q B;  5JEA H;  2MJ8 A;  3HEJ A;  1PFB A;  4PMC A;  2ZXP A;  4XXE A;  3WOE A;  1BQQ T;  4M8A A;  4KN4 C;  4RHR A;  4RCO A;  3VYR A;  5T1G A;  1I4G A;  1STY A;  1LLR D;  2SNM A;  2JA8 B;  1SEB D;  2IX1 A;  1BDO A;  4KN7 C;  3QG1 A;  4FP5 D;  3NQT A;  2M2L A;  4EQO A;  1FD7 D;  4HAE A;  4ZYS A;  3ITP A;  2OT2 A;  4KK7 A;  4RCN A;  3FRP B;  4R8I A;  4KV6 A;  4K2L A;  1MD2 D;  5M5W B;  4CJ2 C;  3HOU B;  2F03 A;  1HUN A;  2F0D A;  4OIJ A;  5K5P A;  1QIL A;  2E74 C;  3H3V C;  3MFY A;  5K36 G;  5JPM C;  3K59 A;  1ZYR C;  3QIA A;  1FNU A;  3RD4 A;  3SK5 A;  2AWO A;  1MBY A;  1ZYR D;  3P20 A;  3SVM A;  1V1P B;  3H0G B;  1V43 A;  3LNN A;  4OL7 A;  2RSN A;  2SNS A;  3A7L A;  2KED A;  4IN3 A;  2N88 A;  2IJ0 A;  1DON A;  4X3U A;  3IFD A;  2Q8R E;  1QB5 D;  1STG A;  1DCZ A;  3RZD B;  4KMU C;  2B2W A;  5CR3 A;  1SNM A;  2O5I C;  3S1N B;  1GOZ A;  5M3M B;  2I46 A;  2MPM A;  4ODG A;  3D8G A;  1I4Q A;  2KA7 A;  4HR7 B;  1EQV A;  2F0T A;  2F3V A;  4OO1 G;  2B2T A;  2KVM A;  2HCI A;  1XYI A;  3DXJ C;  4N9T A;  1LO5 D;  2VNU D;  1TKW B;  2RDG A;  1CA5 A;  2RA4 A;  3WOF A;  1RJT A;  2F0L A;  4QUC A;  5IT9 L;  1J9O A;  3U9O A;  1LTB D;  3MVV A;  3DEO A;  3L9A X;  1STN A;  4LK1 C;  1SSO A;  2XWB B;  4A3B B;  1BBX C;  2BCO A;  1AP0 A;  1M8A A;  5E3F A;  1IKM A;  2EDG A;  1H9K A;  2VUM B;  1ET6 A;  2F0K A;  3EVQ A;  2F0E A;  3PUX A;  3TP6 A;  3DUZ A;  1KDB A;  2HDL A;  1WTV A;  2B2V A;  1FNV A;  4QMG A;  3NBI A;  4J8Q A;  1WTO A;  5HGT A;  1EEI D;  5C3W A;  2XIW A;  3R2I A;  2EY6 A;  1EWC A;  3MC0 B;  3A56 A;  4DAV A;  1VCI A;  2FMC A;  4G7O C;  1D6E C;  1F9P A;  2QCP X;  3EJI A;  4DXG A;  3K5M A;  5C6A A;  4BA1 I;  1DXM A;  2K33 A;  3E0J A;  1Q8I A;  2QEJ C;  1JOO A;  1B2T A;  2RVL A;  4X3K A;  2XNA C;  5CC4 A;  5J1Z A;  2MUY A;  4DFA A;  4DNR B;  1A3T A;  3EA6 A;  1DOM A;  5JJZ A;  4F88 A;  1U4P A;  4DN4 M;  2IW3 A;  4R8N A;  1QG7 A;  4XQJ A;  2HQE A;  2K32 A;  4WRD A;  3I4L A;  1KLU D;  1Z7T A;  1PTO F;  3OPO A;  2SDF A;  2L12 A;  2EY1 A;  1B3A A;  3R8B A;  2A74 C;  1C48 A;  3BG3 A;  3KBG A;  2DY7 A;  2ZXR A;  4A3D B;  1UAP A;  2PZU A;  1OXT A;  5C0X H;  1SNO A;  5JVH 3;  4KJO A;  5C4J B;  1CQV A;  2EY2 A;  2K28 A;  5DM7 3;  1R4Q B;  1TWF B;  1H9M A;  3NTI A;  4FF4 A;  1XWE A;  4F8M A;  3BVZ A;  2EJG C;  2PYK A;  1EIH A;  5C4Z A;  1H9J A;  2CVR A;  5EJW A;  3R93 A;  2NN6 I;  5IGC A;  3BYT B;  1S4Z A;  1E2W A;  4LMQ D;  2V4D A;  1HHV A;  1PZK D;  2O5J C;  5IGG A;  2OEO A;  2LS0 1;  5C0X G;  4H44 C;  1KDA A;  4KD4 A;  3T16 A;  5CBE E;  2NUC A;  4ABN A;  1CHQ D;  1O7Y A;  1O7L A;  2IT1 A;  5KND A;  2DNC A;  5IGD A;  4PNY A;  1EYD A;  2TSS A;  5EBC A;  1CI3 M;  1II3 A;  2LFN A;  1GJX A;  1KAA A;  1FNW A;  4X3T A;  4IUV A;  4Y7N B;  1GUG A;  3RUZ A;  3SXH A;  1T5E A;  3KK7 A;  2ZT9 C;  3D4D A;  3GQB A;  5IOC A;  1I6H B;  2B2U A;  4HSV A;  1GXD C;  2ENB A;  1A3V A;  4RGO S;  1ENF A;  1RF2 D;  4BS9 A;  2B8F A;  1EY9 A;  3WDN A;  5KRU A;  3J80 E;  1LV9 A;  1SYD A;  4FXD A;  3MXU A;  3I72 A;  2F3W A;  1LTR D;  4PQX A;  1CA6 A;  2M9V A;  4CJ1 B;  1HQR D;  3FDT A;  4F7X A;  4TRD A;  2PW5 A;  4C3H B;  3NK9 A;  3MZ5 A;  3J7A V;  1G2S A;  3S1R B;  1RD9 D;  3SEB A;  4IFD H;  1J8I A;  4O42 A;  2L5T A;  1R4P B;  2L9H A;  3X3N A;  4EQN A;  1Y69 U;  2LMC B;  4A3F B;  4NKL A;  1EY7 A;  1G6Z A;  3I91 A;  5FOB B;  3QO2 A;  4ZK9 B;  3BS1 A;  1DOL A;  4RGM A;  4DXF A;  3ZYY X;  1D5Z C;  2L55 A;  5M5X B;  2B2W C;  3Q0A A;  1PTO B;  2XRQ D;  1PMR A;  2WV6 D;  2PZT A;  5I6Y A;  3VR3 A;  1HUM A;  3TBI B;  1B9M A;  3Q24 A;  2B2T C;  3J81 E;  1RKN A;  1Q3L A;  2MP1 A;  4FO2 A;  3ND8 A;  1EU3 A;  1GUN A;  2EYF A;  3MXP A;  3TP7 A;  2EOT A;  5HUR A;  2ICE C;  1EFI D;  5ELE A;  3T13 A;  1S5E D;  2LY7 A;  1IL8 A;  1W6J A;  4V19 0;  2MHV A;  3A8I E;  1DZ1 A;  1BO0 A;  5A2Q E;  3BVM A;  1PLF A;  3K5N A;  4KHZ A;  4B9W A;  3H6M A;  1I3Q B;  5JVG 3;  3S16 B;  5M9O A;  1IW7 D;  5EPK A;  2B2V C;  2E2I B;  3TZD A;  3CRL C;  4ULL A;  3A54 A;  4X3S A;  1Z47 A;  3M85 A;  1KNE A;  2QF7 A;  1TII D;  1XTC D;  2TMP A;  3PV0 A;  2PO4 A;  3ONA B;  1HA5 A;  3IAY A;  3JAM E;  2XN9 C;  2EJF C;  3PO2 B;  2RSO A;  4IUT A;  2J0T D;  4FF2 A;  3CRK C;  4F87 A;  5LHY 1;  1DYQ A;  3GTQ B;  2EYO A;  3QOL A;  5KNC A;  2CHB D;  1STH A;  2JE6 I;  2WKD A;  4DGZ A;  3R3O A;  3NQI A;  3NWS A;  4KD3 A;  1HTP A;  1HXY D;  2K6A A;  2F4I A;  3SK4 A;  4A3I B;  4NP5 A;  2MGS A;  1WD1 A;  1PTO C;  4FF3 A;  1S5C D;  1PTO D;  2F0V A;  2R7Z B;  1EYC A;  1EY5 A;  1JWU D;  2EYP A;  2F0P A;  3C3L A;  1B50 A;  3KUP A;  4HN7 A;  1QCB D;  4MN3 A;  1H9S B;  4WJW A;  5DAU A;  2K5D A;  1BNZ A;  3M3Y B;  3I73 A;  1SE4 A;  5JEA G;  3M7G A;  2ICI A;  3BDC A;  1D1K A;  1I4P A;  3PO3 B;  4HCS A;  3CU7 A;  5CV9 A;  4RKL A;  5FO7 B;  3S1M B;  2N55 A;  1G91 A;  3HOY B;  2R93 B;  2A6E C;  1KLG D;  1K8O A;  1BCP B;  2NVT B;  2A6E D;  3QJY A;  3I3C A;  1G29 1;  4HMI A;  3D3R A;  3FPP A;  1EQT A;  1SYF A;  4BBR B;  3TZU A;  2PMZ B;  3HP3 A;  3LX0 A;  1GUW A;  3NPP A;  2DN8 A;  4KY7 A;  4DK1 A;  3GTK B;  4ZKC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...