1B2TA

Solution structure of the cx3c chemokine domain of fractalkine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
b'MQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FRACTALKINE)
publication title Solution structure and dynamics of the CX3C chemokine domain of fractalkine and its interaction with an N-terminal fragment of CX3CR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b2tA00
1RODA 3DEOA 4MHEA 1B53A 1J9OA 2JYOA 1G2SA 1CA5A 1PFBA 2L1BA 1VMCA 1WTOA 1EIHA 1HUNA 2KVMA 2EOTA 4UAIA 5EPKA 2B2VA 1CA6A 1WTRA 1DOKA 1M8AA 1B3AA 2K03A 2MP1A 3G7LA 4R9WA 2DY7A 1S4ZA 2FFKB 2KEDA 5EPJA 2B2TC 2HUGA 1WTWA 4XT3B 1NAPA 4X3UA 3UI2A 1B2TA 1G2TA 1CM9A 4MN3A 3I3CA 1ILPA 4U68A 2FJ2A 1DONA 5CBEE 1EIGA 4OIKA 1MGSA 1ZXTA 2R3ZA 4IUVA 5D14A 5EJWA 3I91A 4X3SA 3I8ZA 1WTQA 1G6ZA 4QUCA 1ICWA 1MSHA 2L12A 2HCIA 1JICA 3N52A 2X6LA 4IUPA 2KECA 1AZPA 4ZAIA 1RTOA 2B2WA 1KNAA 4QUFA 1EQTA 5CMDA 1ILQA 4HCSA 1WTVA 1B4OA 1ML0D 2H1EA 2KEEA 1IKLA 1KNEA 4HAEA 1MSGA 2B2UA 1QE6A 3GV3A 4HSVA 1NR4A 1SAPA 2K05A 3I90A 3H91A 1J8IA 1HHVA 1TVXA 4X3KA 5EKIA 1PFNA 1BBXC 1XX8A 3KUPA 3Q6SA 5E4XA 2XIWA 3HP3A 4ZLTF 1O80A 2KUMA 2B2YC 1HUMA 1DZ1A 2CVRA 3FDTA 5DNFA 1X32A 1GUWA 2N55A 2FINB 3GV6A 2L9HA 3D6WA 2BDNA 1WTXA 2K28A 3F2UA 2M2LA 3TN2A 1X3QA 3SVMA 5AFWA 2DY8A 2K04A 3DEPA 1WVLA 4IUQA 2HCCA 2RVLA 4OIJA 2D9UA 1BO0A 1WD1A 4O42A 3R93A 1WD0A 2NZ1D 2EE1A 1EL0A 1E0BA 3MTSA 1AZQA 1U4PA 3IFDA 1DOLA 1O7ZA 1PFMA 2MPMA 3KBXA 2HDMA 4DN4M 1G91A 2Q8RE 2X6GA 5D65A 2MJ8A 2X69A 2B2VC 3P7JA 4NW2A 3FPUB 1MI2A 2K01A 2NWGA 4CJ1B 1PLFA 1HA6A 4CJ0B 1C8CA 1A15A 3LWEA 2SDFA 1U4LA 1RJTA 1X3PA 2K1BA 5E4WC 3TZDA 5COYA 5JJZA 1SSOA 1U4MA 1NR2A 4IUUA 4ZKCB 1SDFA 1LV9A 2VXWA 4X3TA 1XYIA 1NCVA 2J7ZA 2MGSA 2N88A 5EPLA 5EQ0A 4ZK9B 5CBAE 4R8IA 1HFNA 2EPBA 1VMPA 3IL8A 2B2WC 2RSOA 2JP1A 4LMQD 5T1GA 1F9SA 1HFGA 3MWYW 2B2UC 1F9PA 1RTNA 3DM1A 1O7YA 1F9RA 2HDLA 4IURA 5CORA 1PDQA 4CJ2C 1IKMA 5T1IA 1BF4A 1AP0A 2B2YA 2FHTA 2L4NA 1F2LA 1F9QA 2Q8TA 1JE4A 4HEDA 1QG7A 2B2TA 2L11A 1EOTA 1IL8A 1Q3LA 2NYZD 1B50A 4IUTA 1U4RA 2RSNA 4RAUC 1QNKA 4RWSC 4XDXA 3QO2A 2KOLA 1DOMA 1WTPA 1HRJA 4ZKBB 1ESRA 1RHPA 4XT1B 1BNZA 4RA8A 2IL8A 2RA4A 3ONAB 2FMMA
chains in the Genus database with same CATH superfamily
5C4ZA 5M5YB 1B53A 1IW7C 2JA5B 1SNQA 3VYUA 5AJ3L 3GP7A 2ID0A 1I6VC 3PUYA 5KYLA 1JWUD 5C3EH 1MBYA 2F0UA 4DUZL 1Y8PB 2K50A 2VB2X 4S3SA 1HXYD 2K7VA 1WTQA 1K8GA 3TEHB 4LF8Q 4A3CH 3S2HH 4KHZA 1E22A 3U58A 3RLFA 2DUDA 3SXHA 1VQPA 3GTJH 3RMHA 2Y0SB 3G4SA 5F2DA 1L0XB 3MEHA 4X3KA 2GVAA 4BBRG 2F0SA 1KIXA 2B2YC 3PO3G 1HUMA 2M9VA 1XXGA 5DNFA 3GV6A 1HPCA 1Y8NB 1Z9FA 3HFZB 4KD3A 1WTXA 3HOUH 5JEAH 1VDZA 2WB1G 3DEPA 1LUZA 2AQ3B 4POFA 4CKCA 4O42A 2JA7H 4ILWA 4HN7A 3NBHB 1FNWA 1E2VA 1YNJC 5C3EB 1K8MA 2I5MX 4JBWA 2R92G 4WJ3M 4KN7C 1PLFA 5IWAL 1B9MA 2F0OA 1O78A 1ENFA 1ZYRC 3TZDA 2IX1A 1QUQA 2YYZA 1KLGD 5G3LD 4CDCC 2F0DA 1N36Q 1LV9A 1WYDA 2VXWA 2WV6D 3GTJB 1L0WA 3KYHC 4PZ8A 1SFOB 3CF5A 4YIJA 1ESFA 5C44B 4MTNA 1PTOH 3PUVA 3J80L 2AUJD 2EYOA 5GAEC 1BF4A 3J81j 1EQVA 4BS9A 4G7ZC 3V05A 2NUCA 2EJGC 2LY7A 1JR0D 2BCOA 4BY1G 4KHPL 1W6JA 3A5UA 4PZ6A 1HTPA 2PZUA 4K2KA 1WCMG 5GAGC 1QNKA 5ELDA 4JBKA 3LWUA 2SNSA 4GS3A 1E2WA 3M9BA 3H3VI 1I5FA 1RODA 4IPDA 1CHQD 4DNIA 2ICIA 4P2CB 3HOVG 4R4IA 1B44D 4B3MQ 2KVMA 4QMGA 1CA6A 2E2JB 1EIYB 1PZKD 1A3TA 3DUZA 2GN5A 3KOJA 3S24A 2YTVA 2ZJQA 1PVOA 4OO1G 1G2TA 1HQMC 3QOLA 4Z9CB 1WTHA 2ASBA 1XNQQ 4X65Q 1I4QA 1MSHA 2B63H 1VQ4A 1CK1A 1PH9A 1T5XD 4ZYSA 1L0YB 1KNAA 4ALPA 4G4KA 3A0JA 4ULLA 2Y0SG 2KQ3A 3KF8B 4DFAA 1H9SB 1BCPF 1VQFA 1TVXA 4QB4A 4A3DG 3K58A 4HIMA 3FKIB 2RHQB 1TWAH 3MFYA 2JE6I 3T56B 3J7YW 2DY8A 4IJHA 4JW0A 1WVLA 4NXMQ 1STBA 3ER0A 1AE2A 1LLRD 1SMXA 4MTKA 4LF8L 2A6HC 5I9PA 3LNNA 4BBSB 1GUGA 2K14A 2EY2A 1O7ZA 1PFMA 1EZ8A 5C4JH 3WWVA 4DN4M 2R7ZH 4B9WA 4DV0Q 4YY3Q 2A68C 1X55A 2X69A 2OEOA 3NXWA 5C3EG 5FKAC 3IRBA 1JOKA 5LMUQ 5J1ZA 5I2YA 3OIQA 1RJTA 5KIXA 4A3EH 4A3CG 2L15A 3M4PA 4ZKCB 1I50B 2HT1A 3BZDB 1NCVA 3CMEA 3HOYB 3MZ5A 5GROA 2PZTA 4J1MA 1XPOA 1W3SA 3IL8A 2WACA 2ZTDA 1ASYA 4LMQD 3M4YA 3MWYW 1LTTD 2D0OA 4A3BH 5T1IA 4DR5L 1TWAB 2CQAA 3J80c 3EQLC 4DR7Q 3HOUG 3G6JB 3U4ZA 1CZWA 1I4RA 4APVA 5JEAG 1C48A 4DR1L 4DV4Q 2ZXOA 1KABA 2NVYH 3OHXC 2JA7G 5G3LF 1D8LA 1HRJA 1ESRA 1FR3A 2XGTA 1IL2A 3K59A 4GNXB 4IOAA 1N36L 4KKSA 5CC4A 1ENCA 1WTRA 1DOKA 4F8MA 3H94A 4RKLA 4XQNA 2LXKA 2K4KA 2DJFC 1QVFA 2LFNA 4DV6Q 4JK1C 4DAVA 2CFMA 1ICWA 1VQ6A 2IX0A 3K5OA 4EX5A 1X3EA 1PH6A 5M9OA 2KCMA 2MHVA 2SOBA 5EBDA 4N8FA 5ELNA 3M7NA 4A3BB 4HAEA 1J8IA 1VCIA 1VQEA 4MIUA 4IFDH 2XRQD 2XIWA 5KNCA 1GM5A 3OW7A 4YWLA 2IW3A 3OTOQ 2QDLA 1GHKA 4B3ML 4R4OA 3TZUA 2HQLA 4QJFA 3CD6A 1Q1BA 1I3QB 4RCNA 1UE7A 2C9OA 4PQXA 3S1MB 1V1OA 4DAPA 2C35B 2F0IA 5HY6A 4N9PA 1LTGD 3STBC 1XNQL 3J7AF 5I6WA 2F0GA 1E7ZA 2LSSA 1ZEQX 4DF7A 1EY6A 4JYAQ 1X65A 4XXEA 4X64L 3DHQA 2B2VC 1Q81C 4LF9L 4YHHQ 3FMCA 4JI5Q 1A8VA 1HJPA 3NP8A 4F87A 1XJVA 3NELA 2B63G 2OQ0A 4IUUA 2VQEL 1OXTA 1JJ2A 4LUVA 5CBAE 2KA7A 1QILA 2PO4A 1X9NA 1D2BA 2IHEA 1CKOA 2KCCA 4C3JH 3RN5A 4NXML 4GLAC 3ERSX 3HGBA 1PDQA 2A69D 2P5ZX 4LUZA 1H9RA 1YZ6A 1RKNA 2G5DA 4LWCA 4LJZC 5BN5A 1Q86C 3OIPA 2FHTA 3DM3A 4DV0L 1XPUA 4YY3L 5H1SE 1K8AC 4IUTA 1D5ZC 3BVZA 4QGUA 5LMUL 2UUBQ 4OO1I 4RGNA 3S1QB 1FGUA 4L5SA 2VUMB 1HZAA 1S3OA 4UP9A 4B3SQ 2IL8A 4NKLA 1JORA 1UE1A 2R7ZG 2PQAA 5FO8B 3NWSA 3H09A 1IZ6A 5DM73 5C3WA 4UAIA 1D5XC 2RDFA 1HUNA 1F2ZA 2HUGA 1TWFH 4A3EG 1ILPA 1V1PA 4C3IH 5JVH3 2R93H 3T1HQ 5E3FA 3MEFA 1SJHD 2UXCQ 2YU9H 4IUPA 3PUZA 1G8ZD 3J7A5 4DV4L 4QUFA 1ILQA 1B8AA 4ME3A 4IO9A 4NPSA 1B7YB 2AQ1B 3KLRA 2M00A 2O4XA 2HHHQ 4A3FH 1PRTB 1JOQA 1E3PA 1EEFD 4DR2L 3M4OH 2PMZB 1U5KA 5JOBA 1A6XA 2CVRA 2TSSA 3KBGA 5JJIA 1YJNA 2A73B 4POGA 5C0XI 4HR7B 4EQ5A 4DV3L 3FEWX 3PIP3 2E5LL 4DAYA 1B3QA 5KNDA 4J6HA 4Q5VA 4H44C 2EVBA 3SGIA 3PF4A 2IT1A 3FVQA 2K6AA 1JT8A 4HSPA 4PMCA 3KJOA 3CP0A 3SDZA 1KC8C 4PMWA 1TWFB 3VR4A 4AQYL 2VS1A 3ZYYX 5M3FH 1GXDC 3MXPA 1JB3A 4IOCA 4A3IH 3TDQA 4M1UB 2K1BA 1H9JA 4WJ4A 2I5LX 4ZUIA 1YJ9A 3HOWB 3EJIA 3OTOL 3E9IA 4QL5A 4R8IA 3IFTA 1PXUA 1VQDA 3I70A 3GDEA 2EYPA 1QWYA 1F9PA 3M4OB 1CKNB 5KRUA 3AQQA 3VYSA 4KJOA 2UXDQ 4LF7Q 2PZWA 1EOTA 2QF7A 1M4VA 5JJKA 2OCEA 2KBNA 4YHHL 1K0RA 4JI5L 4RAUC 1EYGA 3HOXB 5FO9B 1Y1VH 5E1FA 5E7NA 3UDFA 4JVZA 3NUCA 1KXLA 5AJ3Q 5M5WH 2JA9A 2CW0D 2GA4B 2FMMA 1LT6D 1T5EA 1K83H 1EU4A 4ME5A 1PFBA 4DR3Q 3HZXA 4A3IB 3F2BA 4DUZQ 4XTCS 2CWPA 4X3UA 1A2TA 1LM0A 4A75A 1ET9A 4JI8L 1R9TH 5EKLA 2IHFA 1OXXK 1TS3A 4ZUJA 3GTGH 4X3SA 1S5FD 4HTHA 4UDUC 2O5IC 2VY3A 3MAQA 4C3JG 5LMNQ 3HKZE 1H9KA 2PYKA 3R8BA 1VQIA 5C4XH 1XMQL 3B6YA 3Q6SA 1EWCA 1DJRD 2F0LA 2F0EA 1JCKB 1LYLA 2N55A 1Q46A 1S40A 1S5BD 4BA2I 5CV4A 2L0CA 1Y1VB 3TN2A 2CCZA 2R7DA 4DAMA 3OMCA 2F0PA 2QCPX 5DAUA 4K5WA 3T1HL 1D7QA 4PMBA 5HGQA 1I6HB 2UXCL 1E0BA 2IJ0A 2NVQH 1STAA 1AZQA 1U4PA 1DOLA 1UUPA 3KBXA 1LTLA 1GUOA 2AUKA 2MJ8A 5D65A 4CJ1B 4LNQA 1R9TB 4FXDA 4EQNA 3SEBA 2K5VA 3TREA 4C3IG 1U4LA 2R93G 5E4WC 2Z6KC 3K6OA 3U9SA 3I4MB 4A3MH 1JQYD 1S5DD 5EQ0A 1KL9A 4CDEC 1PHJA 3M85A 2B2WC 5C4XB 4QIWE 1TWHH 4A3FG 5D3DA 1D5MC 1IBML 2E2DC 2HDLA 4K8IA 2Q2UA 1STGA 2JA5H 2LKVA 4M8AA 5CGKA 1PH5A 1VQ8A 4NXNL 2WAQE 2KHJA 1OXUA 3D31A 3AFPA 1C7YA 4XDXA 3W3AA 4L5TA 2JA8B 1SNPA 1RHPA 2RCNA 4XT1B 3TP7A 3PCOB 4RA8A 2BE5D 4NB3A 1PMRA 1WFQA 5JEAJ 4G57A 1WTOA 2PI2A 5M3FG 3AMUA 2KENA 4A3IG 3OSOA 1CQFA 2Q2IA 4XT3B 1OTCA 4IZ8A 3DLLA 1JJGA 2UXDL 4LF7L 2IX3A 3MXNA 2WFWA 4QQBX 1AE3A 3K81C 1EWHA 1RTOA 1TWHB 4V190 1EQTA 2DNEA 3R2IA 4HCSA 3A5ZB 3UE0A 2B2UA 3RLNA 2JN4A 3MA2B 3I4OA 1FJGQ 3EFXD 1VQOA 1W6KA 1SYFA 4UP7A 4DR3L 1QCBD 1K3RA 2K5HA 3IKJA 1N34Q 1Y1VG 3QG1A 2D5DA 5AFWA 1MHWC 1T9HA 4F88A 2DN8A 4X62L 4GLXA 1LTSD 2L55A 1J6QA 2NZOA 5ISRA 1N33Q 1F2YA 4KLKA 3K8AA 2I0QA 2NZ1D 2E2IB 2EE1A 3F2DA 3MTSA 3IFDA 1Y1WB 1Q8IA 1SFOH 1QVGA 2A1AA 5C44H 5LMNL 2X6GA 4GKJL 1V1QA 3L2PA 4EVOA 1GD7A 4RGOS 1AN8A 2Q2HA 3U4VA 1A15A 2ATWA 1LT3D 2E8GA 3K7UC 3OMGA 4TRDA 5JJZA 1SSOA 1XPRA 3BYTB 4KK7A 4OX9Q 4JOIC 3WOFA 1IHZA 3UE1A 4WJWA 4Q0FA 1EWIA 1PTOD 5IY0A 1LO5D 3C2PA 5IE8A 1QOHA 1CQVA 4DR5Q 1SR3A 5C4XG 1IYVA 4MZ9A 1HZBA 1UEBA 1L1OC 1TY2A 3U9OA 3PQIA 1AP0A 3NQIA 1BQQT 4DR1Q 1EY8A 1XNRL 1K9MC 2E2JH 1GUTA 4I65A 3QJYA 1YNNC 2XWBB 1HCZA 3RLOA 1FD7D 3T13A 2NN6I 4HIOA 1QUQB 4WORA 2BA0A 1NMGA 1M90C 3TRZA 1EY4A 1NE3A 2L1BA 2EOTA 3CPFA 2F0MA 4R4TA 1B3AA 2DY7A 2O2LD 4A3KB 1LTAD 3NENA 3DXJC 3CKIB 4A3MG 3D4DA 3G71A 1DONA 3M4QA 1JJCB 2MUYA 5CBEE 1EIGA 5D14A 5ELFA 3FKIH 2K32A 3P20A 3F1ZA 3ZJYC 4DNTB 2E76C 4Y52H 1WJJA 3H6MA 2A6EC 4LF6Q 1ET6A 4X6AH 1SE3A 2JA5G 4JG2A 1VQ9A 1IYUA 1FL0A 5M3MB 4BBSH 2I46A 1UWVA 1K28A 5M5XH 3GTOH 4DV1Q 2UUCL 3F2UA 1IXRA 2M2LA 3PMFA 1Q7YC 3CAMA 3NQTA 3NTHA 2IWHA 2CH4W 3O13A 4OHJA 4TVAB 1PA6A 3I4NH 1I50H 1PRTC 3ITPA 4X64Q 1C0AA 3HOYH 2RQXA 1SYEA 4DV2Q 4LF9Q 4FF2A 1VS0A 1VQMA 4G7HC 1WI5A 2AQ2B 4FNFA 4OXPA 3BDOA 4ZRZA 2JEAI 1IW7D 3NWTA 1FJGL 3CHBD 5DLQE 4DK1A 2VQEQ 2SDFA 3SK6A 5COYA 2WKDA 4V0BA 3BU2A 4C56C 1H9SA 4RMFA 4OEMB 3CCVA 1V8QA 1HFNA 1X3FA 1N34L 5JAVA 4UP8A 4RG1A 1X3GA 4IURA 1N33L 3H3VC 5M5XB 5K36H 3GTOB 4DR4L 2EY5A 3R2TA 3HKZB 4QF4A 4DXGA 4BY7B 3S9WA 4LF5L 2KCTA 2ALYB 1X6OA 3P75A 4IFDJ 3GTMB 1I4XA 1ONLA 3I4NB 2J4XA 1WTPA 2F0WA 2NTTA 1BNZA 3P1HA 4OX9L 4AYBE 2ENBA 5C44G 2MNAA 1PTOF 1STHA 4GLVB 1SRUA 1EY7A 4RGTA 2IY5B 1I4PA 2XN9C 4KJNA 1SLJA 1YNJD 3CU7A 1NUCA 1TY0A 3EVQA 2B29A 5I4DA 2B8FA 5DEHA 1ICFB 3AFQA 3S14H 1I3QH 1ZYRD 1BR9A 1AZPA 3S1MH 3PO2B 5CMDA 1G51A 3VYRA 4OELB 3AU7A 1ML0D 2H1EA 1N32Q 5I9OA 3GV3A 4DR2Q 2EYMA 3PUWA 2Q8IB 3RZOB 2V4DA 4LK1C 3HP3A 5CV8A 1QJOA 4JI3Q 3RZDB 4DV3Q 2D62A 5FLXc 4O2DA 2E5LQ 4QIWB 4GNXA 4QCLA 3SVMA 4XYQA 3VA5A 1ZKOA 4IUQA 1MD2D 2FXQA 5LL6X 2ZM6L 4AQYQ 2WB1E 1IBLL 2HDMA 4B3TL 1XWEA 4LF6L 3A7AB 3DMUA 5NUCA 1KD1C 3FKIG 1O7LA 2EYLA 3S14B 2R7FA 4E6IA 1TWCH 2QA4A 2LXJA 1NTGA 2WINB 3T4AC 3GTKH 1RF2D 3KFUA 3L0OA 4JI2Q 2BH8A 3RN2A 4DV1L 3A7LA 1A3VA 3S1QH 2VUMH 2EYJA 3MHBA 1SYCA 5CV5A 4BBSG 2E2HB 3HKSA 1JWSD 3NEMA 3FPPA 2E75C 3X3MA 4LUOA 2B2YA 3K0XA 4DV2L 1QG7A 1PH8A 1L1OB 2F03A 4WFN3 3ND9A 3GQBA 3I4NG 2RDHA 4G7OC 3KLSA 3HOYG 2X6LA 2WIIB 3ONAB 3PIOA 3DEOA 4JCVE 1G291 1MJEA 3AEVA 4TSSA 4FO2A 3WDNA 3BDCA 4XYOA 1VQ7A 1YIJA 3A74A 2A6HD 1M8AA 2K03A 4GN3B 4JI8Q 5A35A 5IOCA 1VF5C 4X66Q 4I7ZC 3HS0C 3ICEA 1CM9A 1TWCB 3I3CA 3GTLB 1K3BC 5EBCA 5LHY1 1GUSA 2A68D 2F0HA 3GTKB 1ZXTA 3BJUA 2CH4A 4QY7A 2F0KA 4FYDA 2OXPA 4P74A 3Q24A 1XMQQ 3H0GB 4GOPC 1IKLA 2K5DA 2OWOA 3CCMA 3K5MA 4DPGA 5K36G 5JPNC 3HOZH 3MXGA 3T51B 2GVBA 2Y0SE 1X56A 5FJ8H 3TP8A 2F4VL 2YV5A 4IUNA 3SR1A 1EY9A 1IBKL 1UEAB 1X3QA 1D1KA 1EU3A 4RHRA 3H3VH 3G6EA 2LS01 4CGYB 1I4HA 1DD2A 4O0AA 3HOWH 1V1PB 3FRPB 3N6RA 3SHLA 1JB7A 3HRZC 4JI4L 4A3BG 1C4QA 2MPMA 3CC7A 2EJFC 4GN5A 3KF6B 1N32L 3MFGA 3TMEA 4EGVA 1C8CA 2N3SA 2NBFA 2PW5A 4N8X1 4ABNA 1M1KC 1U4MA 3PF5A 2JJQA 4JI3L 3D3RA 1W2BA 1SDFA 1SNOA 1E24A 1SMYC 4R1JA 4LFBL 3E9HA 1IBMQ 1A62A 1BXTA 3HOXH 3HOZB 2JEBI 4DAYB 1G6ZA 1O7YA 3S15B 1O7IA 5HURA 1EEID 2VQFL 4NXNQ 1F2LA 2I07B 1JE4A 1J5EL 2B2TA 2HIVA 3D4WA 1EQRA 2F0QA 2MO0A 1SYGA 3BZKA 5IP7H 2XVSA 2PQEA 3MXUA 2Z4HA 1PZJD 3I73A 3QO2A 1CHPD 1DOMA 3OW2A 1XTCD 1GKHA 4ZKBB 1UAPA 1R4PB 2DJGC 1HNWL 4K5XA 1JE5A 4LF4L 1K8OA 4JI2L 4CHTB 5I6YA 4IFDG 1B1ZA 2C5CA 2K75A 4NP5A 3E6ZX 3STBD 4JI0L 1E2ZA 1QZGA 2ZXPA 3G7LA 2AKWB 2FFKB 2UU9Q 1PRTF 4OWTB 1B2TA 3J7ZC 4YCUA 4DK6C 1I94Q 4U68A 5KNBA 3DWQA 1VF7A 3NBIA 4OIKA 2R3ZA 4IUVA 4A3JB 3W1BA 1DCZA 4KMUC 3A8KE 4F7XA 4CKEA 1CI3M 5IGFA 1CKNA 4DXFA 5IT9E 5C6AA 4ZAIA 1CT1D 2VUMG 3E0EA 1A63A 1IYJB 1KNEA 1MSGA 2DGYA 1NJIC 1HHVA 3I90A 3I4LA 1I6HH 4ZLTF 1EUJA 2J0TD 4OWWB 3W2DA 3CPWA 3E0JA 4HMIA 4BWGB 3K57A 1GUWA 4RH6A 2FINB 4JBMA 1BCPC 3D6WA 4X62Q 3L9AX 5JPMC 3I72A 2OT2A 4X66L 4MNOA 1CTMA 5CV9A 3I4MH 2JSOA 4PV1C 3VYTA 1BO0A 5GQOA 3R93A 4BXXH 2KJXA 2BH2A 5C4HA 1EL0A 4GKJQ 3L7ZC 4RKBA 4H7BA 3CCQA 1A0IA 4IPHA 3ERQA 1EYAA 3PSIA 1G91A 1ENAA 5J22A 2ICEC 2NWGA 3WOEA 3V96A 4IQZA 1QZHA 1VQNA 1RCVD 4AYBB 2RBMA 4OGQC 1HR0L 1MKHA 1SE2A 1Q82C 4FF4A 2N88A 4KKUA 1PYBA 2F4IA 3S1RB 3S1NH 1Q90A 2PW7A 1OXVA 4DK0A 4C2MB 2JA8H 3HOZG 4RGMA 1XNRQ 1C9OA 3NTKA 2N8NA 3W1GA 4EQOA 3I55A 5FJ8G 3E5SA 2VB3X 4HEDA 3BDLA 3E3XA 4XQJA 3F8TA 2CWAA 4FXGC 2FMCA 1GVPA 3HOWG 3JAME 2KOLA 4JI1L 3EN2A 3GTPH 1BDOA 1Z7TA 2SEBD 1Q8KA 4HSVA 1TIID 2Z4IA 3ULJA 4YWMA 4K8JA 4LFAL 1EIHA 4BBRB 3PO3B 1D6EC 2B2VA 5EPJA 3CC2A 3A54A 3KDFB 2FJ2A 4A93H 2WB1B 3I8ZA 1WOCA 1II3A 3S1NB 5FLXE 1HA5A 3CCUA 1JICA 4A4IA 5C0XJ 5IYCH 2KECA 1HNXL 3HOXG 3BYYB 5IGDA 1WTVA 1VQAA 1SAPA 4J15A 3ULPA 2R61A 2E2IH 2R92B 1KTKA 4GOPB 3IAYA 1O80A 1Y1WH 1BUVT 2UUCQ 3EROA 4DNRB 5CV7A 2NTSA 5IP7G 2QEJC 3JC66 2VNUD 2L9HA 2VL6A 3QB3A 2UU9L 2ZJPA 4FVMA 4CDFC 1F2MA 3GTPB 1GUNA 4Y7NB 1TWGH 1S5ED 3J81E 1I94L 4A3LH 2HCCA 5LMNW 4OIJA 2O5JC 1TR5A 2ZTCA 1E1OA 1QB5D 3EA6A 5EAYA 3QOJA 1NY4A 1PYSB 3CRKC 4NW2A 2NVXB 1SEBD 1GJXA 4A93B 4BY1B 2ZXRA 1ASZA 1VQKA 1KHIA 4C3HH 5IT9L 1K73C 1X3PA 1VQLA 3VA7A 3CCLA 5GADC 4JI6Q 2JQOA 2EXDA 3K5NA 1XMOL 5IGGA 4YCVA 3HOVB 2JP1A 3LGJA 2SNMA 5HGTA 1XTDA 4K5VA 3TSSA 4HMJA 4DR4Q 1JC7A 3UDXA 5EKKA 3DWPA 3FHWA 1F9QA 4DUYQ 1KRSA 2F0FA 4DR6Q 4LF5Q 5C0XH 5TSSA 4IFDI 5IGCA 1SNMA 2EYHA 3A56A 3S16B 1OXSC 2NYZD 2QILA 1TWGB 4A3KH 3I4MG 1VQJA 1Y8OB 1YEZA 4BXXG 3LX0A 2JA6H 3QWNA 2MQHA 4K6DA 3GTQB 1Z6HA 2ES2A 1A3UA 2H5XA 4A3DB 1NNXA 3S17B 5A2QE 4C3HB 3CXCA 1HQRD 3QR8A 1SYBA 5CYUA 1YJWA 5L37A 3RR5A 4UY8C 5M3MH 1Q1EA 4AH6A 5K5PA 2B3GA 3J7AV 2EIFA 1EYCA 3A8IE 4QUCA 4LFCL 2IPKD 3NBHA 4LW1A 5EGTA 4J8QA 1UE6A 2JA8G 1B4OA 1LACA 1LABA 4KY7A 1YNXA 2K05A 4B3RL 1V9PA 1HH2P 2D0PA 1P16A 2XNAC 3I56A 3VDYA 1N8RC 3KLSX 1BBXC 2YTXA 3KUPA 3TQYA 2AHOB 4R8NA 4IPCA 5BR8L 4BA1I 3JAML 1HZ9A 3OOCA 3ULLA 3S2HB 3TS0A 3TP5A 1HTLD 2PMZE 3F2CA 2JA6B 3HEJA 2QKIC 2ZM6Q 2RVLA 1IBLQ 2JXMB 1BCPB 2CHBD 4B3TQ 3SE0A 5FK9C 3T1YQ 1FYCA 1SJED 2E74C 2RHSB 3P7JA 4EQPA 2K01A 3K7AH 4HJ9A 4NMZA 3HOUB 4A93G 4CJ0B 5FLXL 3CCSA 3NTIA 5IYDH 5IT9c 2RCFA 5IODA 5IYCG 2JA7B 3OPOA 3PIO3 2D2CC 2MGSA 4BY7H 3DWAA 4ZK9B 4YCWA 1GHJA 5JJLA 1D1IA 3GTMH 2F3VA 2PPBC 3G48A 1KDBA 1EYDA 4L6TB 1Y1WG 1LT5D 4TQUS 4O1NA 2NB0A 3Q8DA 3J81L 4UPAA 4K0KQ 1VQHA 3S2DH 4A3LG 1YHBA 1U4RA 2RSNA 1JMCA 1BBUA 3KF8A 2UUAL 4IN3A 4PG3A 1B70B 1PTOB 2XSCA 4JI6L 2DNCA 3CMAA 2JYOA 3PO2H 3MVVA 3K7AB 3I7FA 3H15A 4GKKQ 4CDDC 2MP1A 1EFID 4C3HG 3CCJA 2B2TC 4RHSA 3RZOH 3C1EA 4A76A 2Z6KA 3URYA 4DUYL 3RZDH 1MGSA 4DR6L 1S5CD 5BN3A 1AFPA 3I91A 1RL2A 3N52A 1TS5A 3U50C 2H4OA 4OWXB 1YHQA 1K0SA 2B39A 2B2WA 2PNHA 2A69C 2KEEA 3BVMA 4DV5Q 4JV5Q 4A3GH 1NR4A 5ELEA 3H91A 3RNUA 1CSQA 3CCRA 5FLMH 5C0XG 2CQOA 2F4VQ 3A8JE 1STYA 3CW2C 1DZ1A 4ID6A 1IBKQ 1V43A 3S2DB 4A3KG 2QDBA 1LTRD 2I5HA 4KKTA 4HIDA 4HJ7A 2B63B 1F77A 4HJ8A 3JAMc 1MJCA 4RCOA 3Q22A 2VZAA 2YTYA 4JI7Q 2JA6G 1YNND 4JI4Q 2D9UA 4ODGA 5A2QL 2EQSA 2Q2TA 3AYHB 1NSNS 4KI0A 1BVSA 3QIAA 5M3MG 2E2HH 1PFSA 3PUXA 3LWEA 1DXMA 2HD3A 2TMPA 3CCEA 3EIVA 1NR2A 4LFBQ 4X3TA 2J7ZA 2F0JA 2EY1A 3Q23A 1R4QB 4A3GB 5C4JB 2F0TA 4DU9A 2R7ZB 2RSOA 4KHVA 1CSPA 2VQFQ 1HFGA 4IALA 2A5HA 1J5EQ 4PNYA 2WAQB 3V2TA 1TQOA 1FGBD 1HNZQ 3T1YL 2L4NA 2Q8TA 2A6ED 4A3EB 4P73A 1MIUA 3CC4A 1GO3E 4HCEA 2KCNA 1KAWA 5KEEA 1SXTA 2G9DA 5KGUA 3J81c 3SK8A 3GTLH 1HNWQ 5IGBA 4LF4Q 2QW7A 2PI2E 4JI0Q 3MC0B 1TXYA 1N9WA 5EPKA 3H0GH 1KDCA 2RKSA 1VQCA 1PRTD 2K5NA 1PH4A 1YVCA 1WTWA 2NVYB 5IYDG 2K5WA 1VQBA 4L5RC 3TBIB 2UXBQ 3HKZG 1KQSA 3FP9A 1Y14B 2RDGA 4JOIA 1PV4A 3TS2A 4BY7G 2L12A 3TP6A 4K14A 4K0KL 1U9RA 4RFBA 1CUKA 4X65L 5I2XA 4YWKA 4U673 1QE6A 4KY5A 1L1OA 5IYBH 3BS1A 2NVTH 1XX8A 5E4XA 2KUMA 2N78A 3RD4A 3CRLC 3I2ZA 1FNUA 3GO5A 2NN6H 3EBEA 4GKKL 4PZ7A 2K28A 1RIPA 3T53B 2CW0C 1SYDA 3PV0A 4KTAA 4R4QA 1EIFA 3PO2G 4DV7Q 2EZVA 2F3WA 3OYYA 3D6CA 1E1TA 1SN8A 2R6GA 3NPPA 5GAHC 5FOBB 1YITA 2Q8RE 3D8GA 3OWFA 2OTJA 1YBYA 1RDPD 4DV5L 2XRSD 4JV5L 1MI2A 3K0YA 2PQAB 3S15H 2K52A 1HR0Q 3M3YH 3K80C 2XTIA 2Z9HA 2EDGA 4P72A 4L5QA 1XYIA 2V1CC 5EPLA 2L5TA 2B8GA 4AIMA 5IP9H 3PGZA 1LTID 2EPBA 4A3GG 2Z1CA 1BOSA 5T1GA 1TS4A 4JI7L 2NVTB 3X3NA 4WRDA 2B2UC 1CFMA 1RTNA 5FLMG 1F9RA 3R3OA 1HZCA 4I7AA 2WAQG 3UDIA 5C3XA 4H0LC 2KHSA 2L11A 1KRTA 1PH3A 1AH9A 1IL8A 1STNA 1SE8A 4H13C 3D4RA 1B50A 2EY6A 4JI1Q 1NMFA 4DR7L 1SE4A 4RWSC 4LAAA 3NHHA 5DM63 4B08A 4C3JB 1PH1A 1DM0B 1STEA 2BOSA 4CBVA 4A3JH 3KF6A 5IIFA 4LFAQ 2QEXA 1J9OA 3VR6A 2LMCB 3JAMi 4DA2A 3L3OC 4P75A 1JOOA 3M3YB 1BKBA 4R9WA 1S4ZA 4R4CA 3UI2A 1NAPA 2ZT9C 4MN3A 1HNZL 1KDAA 1HNXQ 5EJWA 2JK8A 4HJAA 1UE5A 4KY6A 3J80i 2HCIA 1QVCA 4DV6L 4HJ5A 5C5MA 4FF3A 4JPBW 1BBWA 2AMCB 5KYIA 3Q0AA 1AW7A 3AB9A 2XWJB 1EY5A 4NDXA 5CR3A 5EKIA 3NE5B 3NSWA 4L8JA 4C3IB 4OL7A 1YHAA 2R93B 1H95A 1X32A 3K5LA 4HIKA 3VR3A 2YU9B 2BDNA 1KLUD 2BE5C 2VW9A 1PH2A 3ND8A 2K04A 4H02A 1TKWB 2MO1A 2A74C 2G9HD 1WD1A 2UXBL 4A3FB 1P8LA 3SK5A 3H0GG 3J81i 3S1RH 1QNUA 1X54A 4GN4B 4C2MH 1HR0W 1UNSA 2EJMA 4JYAL 2A19A 1HA6A 4IJLA 2PCFB 2Z8LA 5CV6A 1XMOQ 1VQ5A 1EZ6A 4UHVA 2WP8J 1LTBD 1VMPA 3OWEB 3A55A 3VR5A 3BZCA 5BN4A 5IYBG 1AEXA 5M3FB 5CORA 1IKMA 2ZJRA 2AWNA 1EFWA 4DV7L 3KLWA 4K2LA 2NN6G 4BBRH 3PO3H 1S72A 1FNVA 1NBWA 2KHIA 2K5QA 5J3BA 4DKAC 1FVIA 2F0NA 1LT4D 1GOZA 4B9XA 1G6PA 3CQZH 2HIXA 2UUBL 1CKMA 5JVG3 4MHEA 1EQQA 4C1NK 1G2SA 5ELOA 4P71A 1KAAA 2F0VA 1CA5A 3T16A 1VMCA 4B3SL 2ZTEA 1Z47A 4XQQA 4N9TA 1TT2A 2KEDA 1Y69U 2N49A 1SNCA 2PNRC 4GZYC 1DGSA 4LFCQ 2R92H 4KV6A 5J39A 3BG3A 1DYQA 5LL6S 1PTOC 4CKBA 4FXKC 5IP9G 5M5WB 1SROA 3VR2A 1EY0A 1K83B 2WKCA 2HQEA 4B3RQ 3KK7A 4FP5D 3D0FA 4Y7NH 1VQGA 1SMYD 5IWAQ 5BR8Q 1PFNA 2MFIA 5FO7B 2F1MA 1PYWD 4C1NI 3FDTA 2F3IA 2RF4A 3SK4A 2HHHL 3GTGB 3J80E 3C1FA 3RUZA 4DGZA 2NVXH 2OTLA 1CZGA 4BY1H 5IGEA 2BA1A 2CKZB 1L2FA 4KD4A 4A3JG 3CQZB 2OQKA 2BDOA 4JC0A 3W5OA 1WCMH 2EYFA 1WD0A 1SBBB 4K6LA 3KDFA 5C5LA 1JWMD 1B9NA 2OF1A 4IPGA 3HOVH 5M5YH 3GD7A 4KHPQ 1PZID 1H9MA 4ZQ3A 3FPUB 4FF1A 1SNDA 1EOVA 4OONA 2EXZA 4OO1H 5ELCA 3S16H 4FDBA 2QGQA 4DK3C 2NVQB 1A2UA 1Q12A 1U0LA 3HG9A 1TS2A 4GOPA 3NK9A 3UDGA 3M7GA 1I4GA 3PIPA 1F9SA 2A8VA 4ZCKA 3MXNB 4JBJA 3DM1A 2K33A 4CJ2C 5ELBA 3C3LA 5D3IB 4L63B 3GTQH 1OO9B 3C46A 2AWOA 3KJPA 4A3MB 4A3DH 3S17H 1PH7A 1Q3LA 2UUAQ 2F52A 3BVGA 1RD9D 2Z6BA 1TU2B 1WCMB 4XIGS 4AYBG 4GNXC 1YI2A 2Z0SA 4KN4C 4TKOB 1BCPD 2NZHA 2RA4A
chains in the Genus database with same CATH topology
5C4ZA 5M5YB 1B53A 1IW7C 2JA5B 1SNQA 3VYUA 3GP7A 2ID0A 1I6VC 3PUYA 5KYLA 1JWUD 1MBYA 2F0UA 1Y8PB 2VB2X 4S3SA 1HXYD 2K7VA 1WTQA 4KHZA 3RLFA 3SXHA 3RMHA 2Y0SB 5F2DA 1L0XB 3MEHA 4X3KA 2F0SA 2B2YC 1HUMA 2M9VA 1XXGA 5DNFA 3GV6A 1HPCA 1Y8NB 4KD3A 1WTXA 5JEAH 1VDZA 3DEPA 2AQ3B 4CKCA 4O42A 4ILWA 4HN7A 1FNWA 1E2VA 1YNJC 5C3EB 1K8MA 4JBWA 4KN7C 1PLFA 1B9MA 2F0OA 1O78A 1ENFA 1ZYRC 3TZDA 2IX1A 2YYZA 1KLGD 5G3LD 2F0DA 1LV9A 2VXWA 2WV6D 3GTJB 1SFOB 4YIJA 1ESFA 5C44B 1PTOH 3PUVA 3J80L 2AUJD 2EYOA 1BF4A 1EQVA 4BS9A 4G7ZC 3V05A 2NUCA 2EJGC 2LY7A 1JR0D 2BCOA 1W6JA 1HTPA 2PZUA 4K2KA 1QNKA 5ELDA 3LWUA 2SNSA 1E2WA 1RODA 1CHQD 2ICIA 4P2CB 1B44D 2KVMA 4QMGA 1CA6A 2E2JB 1PZKD 1A3TA 3DUZA 4OO1G 1G2TA 1HQMC 3QOLA 4Z9CB 1I4QA 1MSHA 1CK1A 1T5XD 4ZYSA 1L0YB 1KNAA 4G4KA 4ULLA 2KQ3A 4DFAA 1H9SB 1BCPF 1TVXA 4QB4A 3K58A 3FKIB 3MFYA 2JE6I 3T56B 3J7YW 2DY8A 1WVLA 1STBA 1LLRD 2A6HC 5I9PA 3LNNA 4BBSB 1GUGA 2EY2A 1O7ZA 1PFMA 1EZ8A 4DN4M 4B9WA 2A68C 2X69A 3NXWA 2OEOA 5FKAC 1JOKA 5J1ZA 5I2YA 3OIQA 1RJTA 5KIXA 4ZKCB 1I50B 3BZDB 1NCVA 3HOYB 3MZ5A 2PZTA 4J1MA 3IL8A 2WACA 4LMQD 3M4YA 3MWYW 1LTTD 5T1IA 1TWAB 2CQAA 3EQLC 3G6JB 1CZWA 1I4RA 5JEAG 1C48A 2ZXOA 1KABA 3OHXC 5G3LF 1HRJA 1ESRA 1FR3A 3K59A 4KKSA 5CC4A 1ENCA 1WTRA 1DOKA 4F8MA 3H94A 4RKLA 4XQNA 2LFNA 4JK1C 4DAVA 1ICWA 2IX0A 3K5OA 5M9OA 2MHVA 2SOBA 5EBDA 3M7NA 4A3BB 4HAEA 1J8IA 1VCIA 4MIUA 4IFDH 2XRQD 2XIWA 5KNCA 3OW7A 2IW3A 1GHKA 3TZUA 1Q1BA 1I3QB 4RCNA 3S1MB 2C9OA 4PQXA 1V1OA 4DAPA 2F0IA 4N9PA 1LTGD 3J7AF 5I6WA 2F0GA 1ZEQX 4DF7A 1EY6A 4XXEA 3DHQA 2B2VC 3FMCA 3NP8A 4F87A 4IUUA 1OXTA 5CBAE 2KA7A 1QILA 2PO4A 1D2BA 2KCCA 3HGBA 1PDQA 2A69D 1H9RA 1RKNA 4LJZC 5BN5A 3OIPA 2FHTA 4IUTA 1D5ZC 3BVZA 4OO1I 4RGNA 3S1QB 2VUMB 2IL8A 4NKLA 1JORA 5FO8B 3NWSA 3H09A 5DM73 5C3WA 4UAIA 1D5XC 2RDFA 1HUNA 1F2ZA 2HUGA 1ILPA 1V1PA 5JVH3 5E3FA 1SJHD 4IUPA 3PUZA 1G8ZD 4QUFA 1ILQA 2AQ1B 3KLRA 2M00A 2O4XA 1PRTB 1JOQA 1EEFD 1A6XA 2PMZB 5JOBA 2CVRA 2TSSA 3KBGA 2A73B 5C0XI 4HR7B 3FEWX 3PIP3 4DAYA 5KNDA 4J6HA 4Q5VA 4H44C 2EVBA 2IT1A 3FVQA 2K6AA 4HSPA 4PMCA 3SDZA 4PMWA 1TWFB 3VR4A 3ZYYX 1GXDC 3MXPA 1JB3A 3TDQA 4M1UB 2K1BA 1H9JA 4ZUIA 3HOWB 3EJIA 4R8IA 3IFTA 1PXUA 3I70A 2EYPA 1QWYA 1F9PA 3M4OB 5KRUA 3VYSA 4KJOA 2PZWA 1EOTA 2QF7A 1M4VA 4RAUC 3HOXB 5FO9B 5E1FA 3NUCA 2CW0D 2GA4B 2FMMA 1LT6D 1T5EA 1EU4A 4ME5A 1PFBA 3HZXA 4A3IB 4XTCS 4X3UA 1A2TA 1ET9A 5EKLA 1OXXK 1TS3A 4ZUJA 4X3SA 1S5FD 4HTHA 4UDUC 2O5IC 3MAQA 4C3JG 1H9KA 2PYKA 3R8BA 3Q6SA 1EWCA 1DJRD 2F0LA 2F0EA 1JCKB 2N55A 4BA2I 1S5BD 5CV4A 2L0CA 3TN2A 1Y1VB 3OMCA 2F0PA 2QCPX 5DAUA 4K5WA 4PMBA 1I6HB 1E0BA 2IJ0A 1STAA 1AZQA 1U4PA 1DOLA 1UUPA 3KBXA 1GUOA 2AUKA 2MJ8A 5D65A 4CJ1B 1R9TB 4FXDA 4EQNA 3SEBA 4C3IG 1U4LA 5E4WC 3K6OA 3U9SA 3I4MB 1JQYD 1S5DD 5EQ0A 3M85A 2B2WC 5C4XB 5D3DA 1D5MC 2E2DC 2HDLA 4K8IA 1STGA 2LKVA 4M8AA 5CGKA 1OXUA 3D31A 4XDXA 3W3AA 2JA8B 1SNPA 1RHPA 4XT1B 3TP7A 4RA8A 2BE5D 1PMRA 5JEAJ 4G57A 1WTOA 3AMUA 3OSOA 1CQFA 4XT3B 4IZ8A 2IX3A 3MXNA 1EWHA 1RTOA 1TWHB 4V190 1EQTA 2DNEA 3R2IA 4HCSA 2B2UA 3MA2B 3EFXD 1W6KA 1SYFA 1QCBD 3IKJA 3QG1A 2D5DA 5AFWA 4F88A 2DN8A 1LTSD 2L55A 5ISRA 1F2YA 2NZ1D 2E2IB 2EE1A 3MTSA 3IFDA 1Y1WB 1Q8IA 2X6GA 4EVOA 4RGOS 1AN8A 1A15A 1LT3D 3OMGA 4TRDA 5JJZA 1SSOA 3BYTB 4KK7A 3WOFA 1IHZA 4WJWA 4Q0FA 1PTOD 1LO5D 3C2PA 1QOHA 1CQVA 1IYVA 1TY2A 3U9OA 1AP0A 3NQIA 1BQQT 1EY8A 1GUTA 4I65A 3QJYA 1YNNC 2XWBB 1HCZA 3T13A 1FD7D 2NN6I 4WORA 2BA0A 1EY4A 2L1BA 2EOTA 2F0MA 1B3AA 2DY7A 2O2LD 4A3KB 1LTAD 3DXJC 3CKIB 3D4DA 1DONA 5CBEE 2MUYA 1EIGA 5D14A 5ELFA 2K32A 3P20A 4DNTB 2E76C 3H6MA 2A6EC 1ET6A 1SE3A 1IYUA 5M3MB 2I46A 3F2UA 2M2LA 3PMFA 3NQTA 3NTHA 2IWHA 3O13A 4OHJA 1PRTC 3ITPA 2RQXA 1SYEA 4FF2A 4G7HC 2AQ2B 4FNFA 3BDOA 4ZRZA 2JEAI 1IW7D 3NWTA 3CHBD 4DK1A 2SDFA 3SK6A 5COYA 2WKDA 4V0BA 4C56C 1H9SA 1V8QA 1HFNA 5JAVA 4IURA 3H3VC 5M5XB 5K36H 3GTOB 2EY5A 3R2TA 3HKZB 4QF4A 4DXGA 4BY7B 3S9WA 4IFDJ 3P75A 3GTMB 1I4XA 1ONLA 3I4NB 2J4XA 1WTPA 2F0WA 2NTTA 1BNZA 3P1HA 2ENBA 1PTOF 1STHA 1EY7A 4RGTA 1I4PA 2XN9C 4KJNA 1YNJD 3CU7A 1NUCA 1TY0A 3EVQA 5I4DA 2B8FA 5DEHA 1ZYRD 1BR9A 1AZPA 3PO2B 5CMDA 3VYRA 3AU7A 1ML0D 2H1EA 5I9OA 3GV3A 2EYMA 3PUWA 2Q8IB 3RZOB 2V4DA 4LK1C 3HP3A 5CV8A 1QJOA 3RZDB 2D62A 4QIWB 4QCLA 3SVMA 4XYQA 3VA5A 1ZKOA 4IUQA 1MD2D 5LL6X 2HDMA 1XWEA 3A7AB 3DMUA 5NUCA 1O7LA 2EYLA 3S14B 4E6IA 2WINB 3T4AC 1RF2D 3A7LA 1A3VA 2EYJA 3MHBA 1SYCA 5CV5A 2E2HB 1JWSD 3FPPA 2E75C 3X3MA 2B2YA 1QG7A 2F03A 4WFN3 3ND9A 3GQBA 2RDHA 4G7OC 3KLSA 2X6LA 2WIIB 3ONAB 3DEOA 1G291 4TSSA 4FO2A 3WDNA 3BDCA 4XYOA 2A6HD 1M8AA 2K03A 5A35A 5IOCA 1VF5C 4I7ZC 3HS0C 1CM9A 1TWCB 3I3CA 3GTLB 5EBCA 5LHY1 1GUSA 2A68D 2F0HA 3GTKB 1ZXTA 2F0KA 4FYDA 2OXPA 3Q24A 3H0GB 1IKLA 2K5DA 3K5MA 5K36G 5JPNC 3MXGA 3T51B 3TP8A 4IUNA 3SR1A 1EY9A 1UEAB 1X3QA 1D1KA 1EU3A 4RHRA 2LS01 4CGYB 1I4HA 1DD2A 1V1PB 3FRPB 3N6RA 3SHLA 3HRZC 1C4QA 2MPMA 2EJFC 3MFGA 3TMEA 4EGVA 1C8CA 2NBFA 2PW5A 4ABNA 1U4MA 3D3RA 1SDFA 1SNOA 1SMYC 1BXTA 3HOZB 2JEBI 1G6ZA 1O7YA 3S15B 5HURA 1EEID 1F2LA 2I07B 1JE4A 2B2TA 3D4WA 2F0QA 1SYGA 2XVSA 2PQEA 3MXUA 2Z4HA 1PZJD 3I73A 3QO2A 1CHPD 1DOMA 1XTCD 4ZKBB 1UAPA 1R4PB 4K5XA 1K8OA 4CHTB 5I6YA 4IFDG 1B1ZA 2C5CA 4NP5A 3E6ZX 1E2ZA 2ZXPA 3G7LA 2FFKB 1PRTF 1B2TA 4U68A 5KNBA 3DWQA 1VF7A 3NBIA 4OIKA 2R3ZA 4IUVA 4A3JB 1DCZA 4KMUC 3A8KE 4F7XA 4CKEA 1CI3M 5IGFA 4DXFA 5IT9E 5C6AA 4ZAIA 1CT1D 1KNEA 1MSGA 1HHVA 3I90A 3I4LA 4ZLTF 2J0TD 3W2DA 3E0JA 4HMIA 4BWGB 3K57A 1GUWA 4RH6A 2FINB 1BCPC 3D6WA 3L9AX 5JPMC 3I72A 2OT2A 1CTMA 5CV9A 2JSOA 4PV1C 3VYTA 1BO0A 3R93A 2KJXA 5C4HA 1EL0A 3L7ZC 4RKBA 4H7BA 3ERQA 1EYAA 1G91A 1ENAA 5J22A 2ICEC 2NWGA 3WOEA 3V96A 4IQZA 1RCVD 4AYBB 2RBMA 4OGQC 1SE2A 4FF4A 2N88A 4KKUA 2F4IA 3S1RB 1Q90A 2PW7A 1OXVA 4DK0A 4C2MB 4RGMA 3NTKA 4EQOA 3E5SA 2VB3X 4HEDA 3BDLA 4XQJA 4FXGC 2FMCA 3JAME 2KOLA 1BDOA 1Z7TA 2SEBD 4HSVA 1TIID 2Z4IA 1EIHA 4K8JA 4BBRB 3PO3B 1D6EC 2B2VA 5EPJA 3A54A 2FJ2A 2WB1B 3I8ZA 3S1NB 1II3A 5FLXE 1HA5A 1JICA 5C0XJ 2KECA 3BYYB 5IGDA 1WTVA 1SAPA 2R61A 2R92B 1KTKA 3IAYA 1O80A 1BUVT 3EROA 4DNRB 5CV7A 2NTSA 2QEJC 2VNUD 2L9HA 3QB3A 3GTPB 4FVMA 1F2MA 1GUNA 4Y7NB 3J81E 1S5ED 2HCCA 4OIJA 2O5JC 1TR5A 1QB5D 3EA6A 3QOJA 3CRKC 4NW2A 2NVXB 1SEBD 1GJXA 4A93B 4BY1B 2ZXRA 5IT9L 1X3PA 3VA7A 3K5NA 5IGGA 3HOVB 2JP1A 2SNMA 5HGTA 4K5VA 3TSSA 4HMJA 1JC7A 5EKKA 3DWPA 1F9QA 2F0FA 5C0XH 5TSSA 4IFDI 5IGCA 1SNMA 2EYHA 3A56A 3S16B 1OXSC 2NYZD 2QILA 1TWGB 1Y8OB 3LX0A 3QWNA 4K6DA 3GTQB 1Z6HA 1A3UA 4A3DB 3S17B 5A2QE 4C3HB 1HQRD 1SYBA 5CYUA 1Q1EA 5K5PA 3J7AV 1EYCA 3A8IE 4QUCA 2IPKD 3NBHA 5EGTA 4J8QA 1B4OA 1LACA 1LABA 4KY7A 2K05A 2XNAC 3KLSX 1BBXC 3KUPA 4R8NA 4BA1I 3JAML 3OOCA 3S2HB 3TP5A 1HTLD 2JA6B 3HEJA 2QKIC 2RVLA 2JXMB 1BCPB 2CHBD 3SE0A 5FK9C 1FYCA 1SJED 2E74C 3P7JA 4EQPA 2K01A 4NMZA 3HOUB 4CJ0B 5FLXL 3NTIA 2JA7B 5IODA 3OPOA 3PIO3 2D2CC 2MGSA 3DWAA 4ZK9B 1GHJA 1D1IA 2F3VA 2PPBC 1KDBA 1EYDA 4L6TB 1LT5D 4TQUS 4O1NA 2NB0A 3J81L 1U4RA 2RSNA 3KF8A 4IN3A 1PTOB 2XSCA 2DNCA 2JYOA 3MVVA 3K7AB 2MP1A 1EFID 4C3HG 2B2TC 4RHSA 3C1EA 3URYA 1MGSA 1S5CD 5BN3A 1AFPA 3I91A 3N52A 1TS5A 2H4OA 2B39A 2B2WA 2A69C 2KEEA 3BVMA 1NR4A 5ELEA 3H91A 5C0XG 3A8JE 1STYA 1DZ1A 4ID6A 1V43A 3S2DB 2QDBA 1LTRD 4KKTA 2B63B 1F77A 4RCOA 3Q22A 1YNND 2D9UA 4ODGA 5A2QL 1NSNS 4KI0A 3QIAA 3PUXA 3LWEA 1DXMA 2TMPA 1NR2A 4X3TA 2J7ZA 2F0JA 2EY1A 3Q23A 1R4QB 4A3GB 5C4JB 2F0TA 4DU9A 2R7ZB 2RSOA 4KHVA 1HFGA 4IALA 2A5HA 4PNYA 2WAQB 3V2TA 1TQOA 1FGBD 2L4NA 2Q8TA 2A6ED 4A3EB 4HCEA 2KCNA 5KEEA 1SXTA 2G9DA 5KGUA 3SK8A 5IGBA 3MC0B 5EPKA 1KDCA 2RKSA 1PRTD 1WTWA 2NVYB 2K5WA 3TBIB 2RDGA 2L12A 3TP6A 4K14A 1U9RA 4RFBA 5I2XA 4U673 1QE6A 4KY5A 3BS1A 1XX8A 5E4XA 2KUMA 3RD4A 3CRLC 1FNUA 3GO5A 2NN6H 2K28A 3T53B 2CW0C 1SYDA 3PV0A 4KTAA 2EZVA 2F3WA 3D6CA 2R6GA 3NPPA 5FOBB 2Q8RE 3D8GA 3OWFA 1RDPD 2XRSD 1MI2A 3K0YA 2EDGA 1XYIA 5EPLA 2L5TA 2B8GA 1LTID 2EPBA 2Z1CA 1BOSA 5T1GA 1TS4A 2NVTB 3X3NA 4WRDA 2B2UC 1RTNA 1CFMA 1F9RA 3R3OA 5C3XA 4H0LC 2KHSA 2L11A 1IL8A 1STNA 4H13C 3D4RA 1B50A 2EY6A 1SE4A 4RWSC 4LAAA 3NHHA 5DM63 4B08A 4C3JB 1DM0B 1STEA 2BOSA 4CBVA 5IIFA 1J9OA 3VR6A 2LMCB 4DA2A 3L3OC 1JOOA 3M3YB 4R9WA 1S4ZA 3UI2A 1NAPA 2ZT9C 4MN3A 1KDAA 5EJWA 4KY6A 2HCIA 4FF3A 5C5MA 5KYIA 3Q0AA 1AW7A 3AB9A 2XWJB 1EY5A 4NDXA 5CR3A 5EKIA 3NE5B 3NSWA 4L8JA 4C3IB 4OL7A 2R93B 1X32A 3K5LA 3VR3A 2YU9B 2BDNA 1KLUD 2BE5C 3ND8A 2K04A 1TKWB 1WD1A 2A74C 2G9HD 4A3FB 3SK5A 1QNUA 1UNSA 2EJMA 1HA6A 2PCFB 2Z8LA 5CV6A 1EZ6A 2WP8J 1LTBD 1VMPA 3OWEB 3A55A 3VR5A 5BN4A 1AEXA 5M3FB 5CORA 1IKMA 2AWNA 4K2LA 2NN6G 1FNVA 2K5QA 2F0NA 1LT4D 1GOZA 4B9XA 5JVG3 4MHEA 4C1NK 1G2SA 1KAAA 2F0VA 1CA5A 3T16A 1VMCA 1Z47A 4XQQA 4N9TA 1TT2A 2KEDA 1Y69U 1SNCA 2PNRC 4GZYC 4KV6A 5J39A 3BG3A 1DYQA 5LL6S 1PTOC 4CKBA 4FXKC 5M5WB 3VR2A 1EY0A 1K83B 2WKCA 2HQEA 3KK7A 4FP5D 1SMYD 1PFNA 5FO7B 2F1MA 1PYWD 4C1NI 3FDTA 3SK4A 3GTGB 3J80E 3C1FA 3RUZA 4DGZA 1CZGA 5IGEA 2BA1A 4KD4A 3CQZB 2BDOA 2EYFA 1WD0A 1SBBB 4K6LA 5C5LA 1JWMD 1B9NA 2OF1A 3GD7A 1PZID 1H9MA 4ZQ3A 3FPUB 4FF1A 1SNDA 2EXZA 4OO1H 5ELCA 2NVQB 1A2UA 1Q12A 3HG9A 1TS2A 3NK9A 3M7GA 1I4GA 1F9SA 3DM1A 2K33A 4CJ2C 5ELBA 3C3LA 5D3IB 4L63B 1OO9B 3C46A 2AWOA 4A3MB 1Q3LA 3BVGA 1RD9D 1TU2B 1WCMB 4XIGS 4KN4C 4TKOB 1BCPD 2RA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROD A;  3DEO A;  4MHE A;  1B53 A;  1J9O A;  2JYO A;  1G2S A;  1CA5 A;  1PFB A;  2L1B A;  1VMC A;  1WTO A;  1EIH A;  1HUN A;  2KVM A;  2EOT A;  4UAI A;  5EPK A;  2B2V A;  1CA6 A;  1WTR A;  1DOK A;  1M8A A;  1B3A A;  2K03 A;  2MP1 A;  3G7L A;  4R9W A;  2DY7 A;  1S4Z A;  2FFK B;  2KED A;  5EPJ A;  2B2T C;  2HUG A;  1WTW A;  4XT3 B;  1NAP A;  4X3U A;  3UI2 A;  1B2T A;  1G2T A;  1CM9 A;  4MN3 A;  3I3C A;  1ILP A;  4U68 A;  2FJ2 A;  1DON A;  5CBE E;  1EIG A;  4OIK A;  1MGS A;  1ZXT A;  2R3Z A;  4IUV A;  5D14 A;  5EJW A;  3I91 A;  4X3S A;  3I8Z A;  1WTQ A;  1G6Z A;  4QUC A;  1ICW A;  1MSH A;  2L12 A;  2HCI A;  1JIC A;  3N52 A;  2X6L A;  4IUP A;  2KEC A;  1AZP A;  4ZAI A;  1RTO A;  2B2W A;  1KNA A;  4QUF A;  1EQT A;  5CMD A;  1ILQ A;  4HCS A;  1WTV A;  1B4O A;  1ML0 D;  2H1E A;  2KEE A;  1IKL A;  1KNE A;  4HAE A;  1MSG A;  2B2U A;  1QE6 A;  3GV3 A;  4HSV A;  1NR4 A;  1SAP A;  2K05 A;  3I90 A;  3H91 A;  1J8I A;  1HHV A;  1TVX A;  4X3K A;  5EKI A;  1PFN A;  1BBX C;  1XX8 A;  3KUP A;  3Q6S A;  5E4X A;  2XIW A;  3HP3 A;  4ZLT F;  1O80 A;  2KUM A;  2B2Y C;  1HUM A;  1DZ1 A;  2CVR A;  3FDT A;  5DNF A;  1X32 A;  1GUW A;  2N55 A;  2FIN B;  3GV6 A;  2L9H A;  3D6W A;  2BDN A;  1WTX A;  2K28 A;  3F2U A;  2M2L A;  3TN2 A;  1X3Q A;  3SVM A;  5AFW A;  2DY8 A;  2K04 A;  3DEP A;  1WVL A;  4IUQ A;  2HCC A;  2RVL A;  4OIJ A;  2D9U A;  1BO0 A;  1WD1 A;  4O42 A;  3R93 A;  1WD0 A;  2NZ1 D;  2EE1 A;  1EL0 A;  1E0B A;  3MTS A;  1AZQ A;  1U4P A;  3IFD A;  1DOL A;  1O7Z A;  1PFM A;  2MPM A;  3KBX A;  2HDM A;  4DN4 M;  1G91 A;  2Q8R E;  2X6G A;  5D65 A;  2MJ8 A;  2X69 A;  2B2V C;  3P7J A;  4NW2 A;  3FPU B;  1MI2 A;  2K01 A;  2NWG A;  4CJ1 B;  1PLF A;  1HA6 A;  4CJ0 B;  1C8C A;  1A15 A;  3LWE A;  2SDF A;  1U4L A;  1RJT A;  1X3P A;  2K1B A;  5E4W C;  3TZD A;  5COY A;  5JJZ A;  1SSO A;  1U4M A;  1NR2 A;  4IUU A;  4ZKC B;  1SDF A;  1LV9 A;  2VXW A;  4X3T A;  1XYI A;  1NCV A;  2J7Z A;  2MGS A;  2N88 A;  5EPL A;  5EQ0 A;  4ZK9 B;  5CBA E;  4R8I A;  1HFN A;  2EPB A;  1VMP A;  3IL8 A;  2B2W C;  2RSO A;  2JP1 A;  4LMQ D;  5T1G A;  1F9S A;  1HFG A;  3MWY W;  2B2U C;  1F9P A;  1RTN A;  3DM1 A;  1O7Y A;  1F9R A;  2HDL A;  4IUR A;  5COR A;  1PDQ A;  4CJ2 C;  1IKM A;  5T1I A;  1BF4 A;  1AP0 A;  2B2Y A;  2FHT A;  2L4N A;  1F2L A;  1F9Q A;  2Q8T A;  1JE4 A;  4HED A;  1QG7 A;  2B2T A;  2L11 A;  1EOT A;  1IL8 A;  1Q3L A;  2NYZ D;  1B50 A;  4IUT A;  1U4R A;  2RSN A;  4RAU C;  1QNK A;  4RWS C;  4XDX A;  3QO2 A;  2KOL A;  1DOM A;  1WTP A;  1HRJ A;  4ZKB B;  1ESR A;  1RHP A;  4XT1 B;  1BNZ A;  4RA8 A;  2IL8 A;  2RA4 A;  3ONA B;  2FMM A; 
#chains in the Genus database with same CATH topology
 5C4Z A;  5M5Y B;  1B53 A;  1IW7 C;  2JA5 B;  1SNQ A;  3VYU A;  5AJ3 L;  3GP7 A;  2ID0 A;  1I6V C;  3PUY A;  5KYL A;  1JWU D;  5C3E H;  1MBY A;  2F0U A;  4DUZ L;  1Y8P B;  2K50 A;  2VB2 X;  4S3S A;  1HXY D;  2K7V A;  1WTQ A;  1K8G A;  3TEH B;  4LF8 Q;  4A3C H;  3S2H H;  4KHZ A;  1E22 A;  3U58 A;  3RLF A;  2DUD A;  3SXH A;  1VQP A;  3GTJ H;  3RMH A;  2Y0S B;  3G4S A;  5F2D A;  1L0X B;  3MEH A;  4X3K A;  2GVA A;  4BBR G;  2F0S A;  1KIX A;  2B2Y C;  3PO3 G;  1HUM A;  2M9V A;  1XXG A;  5DNF A;  3GV6 A;  1HPC A;  1Y8N B;  1Z9F A;  3HFZ B;  4KD3 A;  1WTX A;  3HOU H;  5JEA H;  1VDZ A;  2WB1 G;  3DEP A;  1LUZ A;  2AQ3 B;  4POF A;  4CKC A;  4O42 A;  2JA7 H;  4ILW A;  4HN7 A;  3NBH B;  1FNW A;  1E2V A;  1YNJ C;  5C3E B;  1K8M A;  2I5M X;  4JBW A;  2R92 G;  4WJ3 M;  4KN7 C;  1PLF A;  5IWA L;  1B9M A;  2F0O A;  1O78 A;  1ENF A;  1ZYR C;  3TZD A;  2IX1 A;  1QUQ A;  2YYZ A;  1KLG D;  5G3L D;  4CDC C;  2F0D A;  1N36 Q;  1LV9 A;  1WYD A;  2VXW A;  2WV6 D;  3GTJ B;  1L0W A;  3KYH C;  4PZ8 A;  1SFO B;  3CF5 A;  4YIJ A;  1ESF A;  5C44 B;  4MTN A;  1PTO H;  3PUV A;  3J80 L;  2AUJ D;  2EYO A;  5GAE C;  1BF4 A;  3J81 j;  1EQV A;  4BS9 A;  4G7Z C;  3V05 A;  2NUC A;  2EJG C;  2LY7 A;  1JR0 D;  2BCO A;  4BY1 G;  4KHP L;  1W6J A;  3A5U A;  4PZ6 A;  1HTP A;  2PZU A;  4K2K A;  1WCM G;  5GAG C;  1QNK A;  5ELD A;  4JBK A;  3LWU A;  2SNS A;  4GS3 A;  1E2W A;  3M9B A;  3H3V I;  1I5F A;  1ROD A;  4IPD A;  1CHQ D;  4DNI A;  2ICI A;  4P2C B;  3HOV G;  4R4I A;  1B44 D;  4B3M Q;  2KVM A;  4QMG A;  1CA6 A;  2E2J B;  1EIY B;  1PZK D;  1A3T A;  3DUZ A;  2GN5 A;  3KOJ A;  3S24 A;  2YTV A;  2ZJQ A;  1PVO A;  4OO1 G;  1G2T A;  1HQM C;  3QOL A;  4Z9C B;  1WTH A;  2ASB A;  1XNQ Q;  4X65 Q;  1I4Q A;  1MSH A;  2B63 H;  1VQ4 A;  1CK1 A;  1PH9 A;  1T5X D;  4ZYS A;  1L0Y B;  1KNA A;  4ALP A;  4G4K A;  3A0J A;  4ULL A;  2Y0S G;  2KQ3 A;  3KF8 B;  4DFA A;  1H9S B;  1BCP F;  1VQF A;  1TVX A;  4QB4 A;  4A3D G;  3K58 A;  4HIM A;  3FKI B;  2RHQ B;  1TWA H;  3MFY A;  2JE6 I;  3T56 B;  3J7Y W;  2DY8 A;  4IJH A;  4JW0 A;  1WVL A;  4NXM Q;  1STB A;  3ER0 A;  1AE2 A;  1LLR D;  1SMX A;  4MTK A;  4LF8 L;  2A6H C;  5I9P A;  3LNN A;  4BBS B;  1GUG A;  2K14 A;  2EY2 A;  1O7Z A;  1PFM A;  1EZ8 A;  5C4J H;  3WWV A;  4DN4 M;  2R7Z H;  4B9W A;  4DV0 Q;  4YY3 Q;  2A68 C;  1X55 A;  2X69 A;  2OEO A;  3NXW A;  5C3E G;  5FKA C;  3IRB A;  1JOK A;  5LMU Q;  5J1Z A;  5I2Y A;  3OIQ A;  1RJT A;  5KIX A;  4A3E H;  4A3C G;  2L15 A;  3M4P A;  4ZKC B;  1I50 B;  2HT1 A;  3BZD B;  1NCV A;  3CME A;  3HOY B;  3MZ5 A;  5GRO A;  2PZT A;  4J1M A;  1XPO A;  1W3S A;  3IL8 A;  2WAC A;  2ZTD A;  1ASY A;  4LMQ D;  3M4Y A;  3MWY W;  1LTT D;  2D0O A;  4A3B H;  5T1I A;  4DR5 L;  1TWA B;  2CQA A;  3J80 c;  3EQL C;  4DR7 Q;  3HOU G;  3G6J B;  3U4Z A;  1CZW A;  1I4R A;  4APV A;  5JEA G;  1C48 A;  4DR1 L;  4DV4 Q;  2ZXO A;  1KAB A;  2NVY H;  3OHX C;  2JA7 G;  5G3L F;  1D8L A;  1HRJ A;  1ESR A;  1FR3 A;  2XGT A;  1IL2 A;  3K59 A;  4GNX B;  4IOA A;  1N36 L;  4KKS A;  5CC4 A;  1ENC A;  1WTR A;  1DOK A;  4F8M A;  3H94 A;  4RKL A;  4XQN A;  2LXK A;  2K4K A;  2DJF C;  1QVF A;  2LFN A;  4DV6 Q;  4JK1 C;  4DAV A;  2CFM A;  1ICW A;  1VQ6 A;  2IX0 A;  3K5O A;  4EX5 A;  1X3E A;  1PH6 A;  5M9O A;  2KCM A;  2MHV A;  2SOB A;  5EBD A;  4N8F A;  5ELN A;  3M7N A;  4A3B B;  4HAE A;  1J8I A;  1VCI A;  1VQE A;  4MIU A;  4IFD H;  2XRQ D;  2XIW A;  5KNC A;  1GM5 A;  3OW7 A;  4YWL A;  2IW3 A;  3OTO Q;  2QDL A;  1GHK A;  4B3M L;  4R4O A;  3TZU A;  2HQL A;  4QJF A;  3CD6 A;  1Q1B A;  1I3Q B;  4RCN A;  1UE7 A;  2C9O A;  4PQX A;  3S1M B;  1V1O A;  4DAP A;  2C35 B;  2F0I A;  5HY6 A;  4N9P A;  1LTG D;  3STB C;  1XNQ L;  3J7A F;  5I6W A;  2F0G A;  1E7Z A;  2LSS A;  1ZEQ X;  4DF7 A;  1EY6 A;  4JYA Q;  1X65 A;  4XXE A;  4X64 L;  3DHQ A;  2B2V C;  1Q81 C;  4LF9 L;  4YHH Q;  3FMC A;  4JI5 Q;  1A8V A;  1HJP A;  3NP8 A;  4F87 A;  1XJV A;  3NEL A;  2B63 G;  2OQ0 A;  4IUU A;  2VQE L;  1OXT A;  1JJ2 A;  4LUV A;  5CBA E;  2KA7 A;  1QIL A;  2PO4 A;  1X9N A;  1D2B A;  2IHE A;  1CKO A;  2KCC A;  4C3J H;  3RN5 A;  4NXM L;  4GLA C;  3ERS X;  3HGB A;  1PDQ A;  2A69 D;  2P5Z X;  4LUZ A;  1H9R A;  1YZ6 A;  1RKN A;  2G5D A;  4LWC A;  4LJZ C;  5BN5 A;  1Q86 C;  3OIP A;  2FHT A;  3DM3 A;  4DV0 L;  1XPU A;  4YY3 L;  5H1S E;  1K8A C;  4IUT A;  1D5Z C;  3BVZ A;  4QGU A;  5LMU L;  2UUB Q;  4OO1 I;  4RGN A;  3S1Q B;  1FGU A;  4L5S A;  2VUM B;  1HZA A;  1S3O A;  4UP9 A;  4B3S Q;  2IL8 A;  4NKL A;  1JOR A;  1UE1 A;  2R7Z G;  2PQA A;  5FO8 B;  3NWS A;  3H09 A;  1IZ6 A;  5DM7 3;  5C3W A;  4UAI A;  1D5X C;  2RDF A;  1HUN A;  1F2Z A;  2HUG A;  1TWF H;  4A3E G;  1ILP A;  1V1P A;  4C3I H;  5JVH 3;  2R93 H;  3T1H Q;  5E3F A;  3MEF A;  1SJH D;  2UXC Q;  2YU9 H;  4IUP A;  3PUZ A;  1G8Z D;  3J7A 5;  4DV4 L;  4QUF A;  1ILQ A;  1B8A A;  4ME3 A;  4IO9 A;  4NPS A;  1B7Y B;  2AQ1 B;  3KLR A;  2M00 A;  2O4X A;  2HHH Q;  4A3F H;  1PRT B;  1JOQ A;  1E3P A;  1EEF D;  4DR2 L;  3M4O H;  2PMZ B;  1U5K A;  5JOB A;  1A6X A;  2CVR A;  2TSS A;  3KBG A;  5JJI A;  1YJN A;  2A73 B;  4POG A;  5C0X I;  4HR7 B;  4EQ5 A;  4DV3 L;  3FEW X;  3PIP 3;  2E5L L;  4DAY A;  1B3Q A;  5KND A;  4J6H A;  4Q5V A;  4H44 C;  2EVB A;  3SGI A;  3PF4 A;  2IT1 A;  3FVQ A;  2K6A A;  1JT8 A;  4HSP A;  4PMC A;  3KJO A;  3CP0 A;  3SDZ A;  1KC8 C;  4PMW A;  1TWF B;  3VR4 A;  4AQY L;  2VS1 A;  3ZYY X;  5M3F H;  1GXD C;  3MXP A;  1JB3 A;  4IOC A;  4A3I H;  3TDQ A;  4M1U B;  2K1B A;  1H9J A;  4WJ4 A;  2I5L X;  4ZUI A;  1YJ9 A;  3HOW B;  3EJI A;  3OTO L;  3E9I A;  4QL5 A;  4R8I A;  3IFT A;  1PXU A;  1VQD A;  3I70 A;  3GDE A;  2EYP A;  1QWY A;  1F9P A;  3M4O B;  1CKN B;  5KRU A;  3AQQ A;  3VYS A;  4KJO A;  2UXD Q;  4LF7 Q;  2PZW A;  1EOT A;  2QF7 A;  1M4V A;  5JJK A;  2OCE A;  2KBN A;  4YHH L;  1K0R A;  4JI5 L;  4RAU C;  1EYG A;  3HOX B;  5FO9 B;  1Y1V H;  5E1F A;  5E7N A;  3UDF A;  4JVZ A;  3NUC A;  1KXL A;  5AJ3 Q;  5M5W H;  2JA9 A;  2CW0 D;  2GA4 B;  2FMM A;  1LT6 D;  1T5E A;  1K83 H;  1EU4 A;  4ME5 A;  1PFB A;  4DR3 Q;  3HZX A;  4A3I B;  3F2B A;  4DUZ Q;  4XTC S;  2CWP A;  4X3U A;  1A2T A;  1LM0 A;  4A75 A;  1ET9 A;  4JI8 L;  1R9T H;  5EKL A;  2IHF A;  1OXX K;  1TS3 A;  4ZUJ A;  3GTG H;  4X3S A;  1S5F D;  4HTH A;  4UDU C;  2O5I C;  2VY3 A;  3MAQ A;  4C3J G;  5LMN Q;  3HKZ E;  1H9K A;  2PYK A;  3R8B A;  1VQI A;  5C4X H;  1XMQ L;  3B6Y A;  3Q6S A;  1EWC A;  1DJR D;  2F0L A;  2F0E A;  1JCK B;  1LYL A;  2N55 A;  1Q46 A;  1S40 A;  1S5B D;  4BA2 I;  5CV4 A;  2L0C A;  1Y1V B;  3TN2 A;  2CCZ A;  2R7D A;  4DAM A;  3OMC A;  2F0P A;  2QCP X;  5DAU A;  4K5W A;  3T1H L;  1D7Q A;  4PMB A;  5HGQ A;  1I6H B;  2UXC L;  1E0B A;  2IJ0 A;  2NVQ H;  1STA A;  1AZQ A;  1U4P A;  1DOL A;  1UUP A;  3KBX A;  1LTL A;  1GUO A;  2AUK A;  2MJ8 A;  5D65 A;  4CJ1 B;  4LNQ A;  1R9T B;  4FXD A;  4EQN A;  3SEB A;  2K5V A;  3TRE A;  4C3I G;  1U4L A;  2R93 G;  5E4W C;  2Z6K C;  3K6O A;  3U9S A;  3I4M B;  4A3M H;  1JQY D;  1S5D D;  5EQ0 A;  1KL9 A;  4CDE C;  1PHJ A;  3M85 A;  2B2W C;  5C4X B;  4QIW E;  1TWH H;  4A3F G;  5D3D A;  1D5M C;  1IBM L;  2E2D C;  2HDL A;  4K8I A;  2Q2U A;  1STG A;  2JA5 H;  2LKV A;  4M8A A;  5CGK A;  1PH5 A;  1VQ8 A;  4NXN L;  2WAQ E;  2KHJ A;  1OXU A;  3D31 A;  3AFP A;  1C7Y A;  4XDX A;  3W3A A;  4L5T A;  2JA8 B;  1SNP A;  1RHP A;  2RCN A;  4XT1 B;  3TP7 A;  3PCO B;  4RA8 A;  2BE5 D;  4NB3 A;  1PMR A;  1WFQ A;  5JEA J;  4G57 A;  1WTO A;  2PI2 A;  5M3F G;  3AMU A;  2KEN A;  4A3I G;  3OSO A;  1CQF A;  2Q2I A;  4XT3 B;  1OTC A;  4IZ8 A;  3DLL A;  1JJG A;  2UXD L;  4LF7 L;  2IX3 A;  3MXN A;  2WFW A;  4QQB X;  1AE3 A;  3K81 C;  1EWH A;  1RTO A;  1TWH B;  4V19 0;  1EQT A;  2DNE A;  3R2I A;  4HCS A;  3A5Z B;  3UE0 A;  2B2U A;  3RLN A;  2JN4 A;  3MA2 B;  3I4O A;  1FJG Q;  3EFX D;  1VQO A;  1W6K A;  1SYF A;  4UP7 A;  4DR3 L;  1QCB D;  1K3R A;  2K5H A;  3IKJ A;  1N34 Q;  1Y1V G;  3QG1 A;  2D5D A;  5AFW A;  1MHW C;  1T9H A;  4F88 A;  2DN8 A;  4X62 L;  4GLX A;  1LTS D;  2L55 A;  1J6Q A;  2NZO A;  5ISR A;  1N33 Q;  1F2Y A;  4KLK A;  3K8A A;  2I0Q A;  2NZ1 D;  2E2I B;  2EE1 A;  3F2D A;  3MTS A;  3IFD A;  1Y1W B;  1Q8I A;  1SFO H;  1QVG A;  2A1A A;  5C44 H;  5LMN L;  2X6G A;  4GKJ L;  1V1Q A;  3L2P A;  4EVO A;  1GD7 A;  4RGO S;  1AN8 A;  2Q2H A;  3U4V A;  1A15 A;  2ATW A;  1LT3 D;  2E8G A;  3K7U C;  3OMG A;  4TRD A;  5JJZ A;  1SSO A;  1XPR A;  3BYT B;  4KK7 A;  4OX9 Q;  4JOI C;  3WOF A;  1IHZ A;  3UE1 A;  4WJW A;  4Q0F A;  1EWI A;  1PTO D;  5IY0 A;  1LO5 D;  3C2P A;  5IE8 A;  1QOH A;  1CQV A;  4DR5 Q;  1SR3 A;  5C4X G;  1IYV A;  4MZ9 A;  1HZB A;  1UEB A;  1L1O C;  1TY2 A;  3U9O A;  3PQI A;  1AP0 A;  3NQI A;  1BQQ T;  4DR1 Q;  1EY8 A;  1XNR L;  1K9M C;  2E2J H;  1GUT A;  4I65 A;  3QJY A;  1YNN C;  2XWB B;  1HCZ A;  3RLO A;  1FD7 D;  3T13 A;  2NN6 I;  4HIO A;  1QUQ B;  4WOR A;  2BA0 A;  1NMG A;  1M90 C;  3TRZ A;  1EY4 A;  1NE3 A;  2L1B A;  2EOT A;  3CPF A;  2F0M A;  4R4T A;  1B3A A;  2DY7 A;  2O2L D;  4A3K B;  1LTA D;  3NEN A;  3DXJ C;  3CKI B;  4A3M G;  3D4D A;  3G71 A;  1DON A;  3M4Q A;  1JJC B;  2MUY A;  5CBE E;  1EIG A;  5D14 A;  5ELF A;  3FKI H;  2K32 A;  3P20 A;  3F1Z A;  3ZJY C;  4DNT B;  2E76 C;  4Y52 H;  1WJJ A;  3H6M A;  2A6E C;  4LF6 Q;  1ET6 A;  4X6A H;  1SE3 A;  2JA5 G;  4JG2 A;  1VQ9 A;  1IYU A;  1FL0 A;  5M3M B;  4BBS H;  2I46 A;  1UWV A;  1K28 A;  5M5X H;  3GTO H;  4DV1 Q;  2UUC L;  3F2U A;  1IXR A;  2M2L A;  3PMF A;  1Q7Y C;  3CAM A;  3NQT A;  3NTH A;  2IWH A;  2CH4 W;  3O13 A;  4OHJ A;  4TVA B;  1PA6 A;  3I4N H;  1I50 H;  1PRT C;  3ITP A;  4X64 Q;  1C0A A;  3HOY H;  2RQX A;  1SYE A;  4DV2 Q;  4LF9 Q;  4FF2 A;  1VS0 A;  1VQM A;  4G7H C;  1WI5 A;  2AQ2 B;  4FNF A;  4OXP A;  3BDO A;  4ZRZ A;  2JEA I;  1IW7 D;  3NWT A;  1FJG L;  3CHB D;  5DLQ E;  4DK1 A;  2VQE Q;  2SDF A;  3SK6 A;  5COY A;  2WKD A;  4V0B A;  3BU2 A;  4C56 C;  1H9S A;  4RMF A;  4OEM B;  3CCV A;  1V8Q A;  1HFN A;  1X3F A;  1N34 L;  5JAV A;  4UP8 A;  4RG1 A;  1X3G A;  4IUR A;  1N33 L;  3H3V C;  5M5X B;  5K36 H;  3GTO B;  4DR4 L;  2EY5 A;  3R2T A;  3HKZ B;  4QF4 A;  4DXG A;  4BY7 B;  3S9W A;  4LF5 L;  2KCT A;  2ALY B;  1X6O A;  3P75 A;  4IFD J;  3GTM B;  1I4X A;  1ONL A;  3I4N B;  2J4X A;  1WTP A;  2F0W A;  2NTT A;  1BNZ A;  3P1H A;  4OX9 L;  4AYB E;  2ENB A;  5C44 G;  2MNA A;  1PTO F;  1STH A;  4GLV B;  1SRU A;  1EY7 A;  4RGT A;  2IY5 B;  1I4P A;  2XN9 C;  4KJN A;  1SLJ A;  1YNJ D;  3CU7 A;  1NUC A;  1TY0 A;  3EVQ A;  2B29 A;  5I4D A;  2B8F A;  5DEH A;  1ICF B;  3AFQ A;  3S14 H;  1I3Q H;  1ZYR D;  1BR9 A;  1AZP A;  3S1M H;  3PO2 B;  5CMD A;  1G51 A;  3VYR A;  4OEL B;  3AU7 A;  1ML0 D;  2H1E A;  1N32 Q;  5I9O A;  3GV3 A;  4DR2 Q;  2EYM A;  3PUW A;  2Q8I B;  3RZO B;  2V4D A;  4LK1 C;  3HP3 A;  5CV8 A;  1QJO A;  4JI3 Q;  3RZD B;  4DV3 Q;  2D62 A;  5FLX c;  4O2D A;  2E5L Q;  4QIW B;  4GNX A;  4QCL A;  3SVM A;  4XYQ A;  3VA5 A;  1ZKO A;  4IUQ A;  1MD2 D;  2FXQ A;  5LL6 X;  2ZM6 L;  4AQY Q;  2WB1 E;  1IBL L;  2HDM A;  4B3T L;  1XWE A;  4LF6 L;  3A7A B;  3DMU A;  5NUC A;  1KD1 C;  3FKI G;  1O7L A;  2EYL A;  3S14 B;  2R7F A;  4E6I A;  1TWC H;  2QA4 A;  2LXJ A;  1NTG A;  2WIN B;  3T4A C;  3GTK H;  1RF2 D;  3KFU A;  3L0O A;  4JI2 Q;  2BH8 A;  3RN2 A;  4DV1 L;  3A7L A;  1A3V A;  3S1Q H;  2VUM H;  2EYJ A;  3MHB A;  1SYC A;  5CV5 A;  4BBS G;  2E2H B;  3HKS A;  1JWS D;  3NEM A;  3FPP A;  2E75 C;  3X3M A;  4LUO A;  2B2Y A;  3K0X A;  4DV2 L;  1QG7 A;  1PH8 A;  1L1O B;  2F03 A;  4WFN 3;  3ND9 A;  3GQB A;  3I4N G;  2RDH A;  4G7O C;  3KLS A;  3HOY G;  2X6L A;  2WII B;  3ONA B;  3PIO A;  3DEO A;  4JCV E;  1G29 1;  1MJE A;  3AEV A;  4TSS A;  4FO2 A;  3WDN A;  3BDC A;  4XYO A;  1VQ7 A;  1YIJ A;  3A74 A;  2A6H D;  1M8A A;  2K03 A;  4GN3 B;  4JI8 Q;  5A35 A;  5IOC A;  1VF5 C;  4X66 Q;  4I7Z C;  3HS0 C;  3ICE A;  1CM9 A;  1TWC B;  3I3C A;  3GTL B;  1K3B C;  5EBC A;  5LHY 1;  1GUS A;  2A68 D;  2F0H A;  3GTK B;  1ZXT A;  3BJU A;  2CH4 A;  4QY7 A;  2F0K A;  4FYD A;  2OXP A;  4P74 A;  3Q24 A;  1XMQ Q;  3H0G B;  4GOP C;  1IKL A;  2K5D A;  2OWO A;  3CCM A;  3K5M A;  4DPG A;  5K36 G;  5JPN C;  3HOZ H;  3MXG A;  3T51 B;  2GVB A;  2Y0S E;  1X56 A;  5FJ8 H;  3TP8 A;  2F4V L;  2YV5 A;  4IUN A;  3SR1 A;  1EY9 A;  1IBK L;  1UEA B;  1X3Q A;  1D1K A;  1EU3 A;  4RHR A;  3H3V H;  3G6E A;  2LS0 1;  4CGY B;  1I4H A;  1DD2 A;  4O0A A;  3HOW H;  1V1P B;  3FRP B;  3N6R A;  3SHL A;  1JB7 A;  3HRZ C;  4JI4 L;  4A3B G;  1C4Q A;  2MPM A;  3CC7 A;  2EJF C;  4GN5 A;  3KF6 B;  1N32 L;  3MFG A;  3TME A;  4EGV A;  1C8C A;  2N3S A;  2NBF A;  2PW5 A;  4N8X 1;  4ABN A;  1M1K C;  1U4M A;  3PF5 A;  2JJQ A;  4JI3 L;  3D3R A;  1W2B A;  1SDF A;  1SNO A;  1E24 A;  1SMY C;  4R1J A;  4LFB L;  3E9H A;  1IBM Q;  1A62 A;  1BXT A;  3HOX H;  3HOZ B;  2JEB I;  4DAY B;  1G6Z A;  1O7Y A;  3S15 B;  1O7I A;  5HUR A;  1EEI D;  2VQF L;  4NXN Q;  1F2L A;  2I07 B;  1JE4 A;  1J5E L;  2B2T A;  2HIV A;  3D4W A;  1EQR A;  2F0Q A;  2MO0 A;  1SYG A;  3BZK A;  5IP7 H;  2XVS A;  2PQE A;  3MXU A;  2Z4H A;  1PZJ D;  3I73 A;  3QO2 A;  1CHP D;  1DOM A;  3OW2 A;  1XTC D;  1GKH A;  4ZKB B;  1UAP A;  1R4P B;  2DJG C;  1HNW L;  4K5X A;  1JE5 A;  4LF4 L;  1K8O A;  4JI2 L;  4CHT B;  5I6Y A;  4IFD G;  1B1Z A;  2C5C A;  2K75 A;  4NP5 A;  3E6Z X;  3STB D;  4JI0 L;  1E2Z A;  1QZG A;  2ZXP A;  3G7L A;  2AKW B;  2FFK B;  2UU9 Q;  1PRT F;  4OWT B;  1B2T A;  3J7Z C;  4YCU A;  4DK6 C;  1I94 Q;  4U68 A;  5KNB A;  3DWQ A;  1VF7 A;  3NBI A;  4OIK A;  2R3Z A;  4IUV A;  4A3J B;  3W1B A;  1DCZ A;  4KMU C;  3A8K E;  4F7X A;  4CKE A;  1CI3 M;  5IGF A;  1CKN A;  4DXF A;  5IT9 E;  5C6A A;  4ZAI A;  1CT1 D;  2VUM G;  3E0E A;  1A63 A;  1IYJ B;  1KNE A;  1MSG A;  2DGY A;  1NJI C;  1HHV A;  3I90 A;  3I4L A;  1I6H H;  4ZLT F;  1EUJ A;  2J0T D;  4OWW B;  3W2D A;  3CPW A;  3E0J A;  4HMI A;  4BWG B;  3K57 A;  1GUW A;  4RH6 A;  2FIN B;  4JBM A;  1BCP C;  3D6W A;  4X62 Q;  3L9A X;  5JPM C;  3I72 A;  2OT2 A;  4X66 L;  4MNO A;  1CTM A;  5CV9 A;  3I4M H;  2JSO A;  4PV1 C;  3VYT A;  1BO0 A;  5GQO A;  3R93 A;  4BXX H;  2KJX A;  2BH2 A;  5C4H A;  1EL0 A;  4GKJ Q;  3L7Z C;  4RKB A;  4H7B A;  3CCQ A;  1A0I A;  4IPH A;  3ERQ A;  1EYA A;  3PSI A;  1G91 A;  1ENA A;  5J22 A;  2ICE C;  2NWG A;  3WOE A;  3V96 A;  4IQZ A;  1QZH A;  1VQN A;  1RCV D;  4AYB B;  2RBM A;  4OGQ C;  1HR0 L;  1MKH A;  1SE2 A;  1Q82 C;  4FF4 A;  2N88 A;  4KKU A;  1PYB A;  2F4I A;  3S1R B;  3S1N H;  1Q90 A;  2PW7 A;  1OXV A;  4DK0 A;  4C2M B;  2JA8 H;  3HOZ G;  4RGM A;  1XNR Q;  1C9O A;  3NTK A;  2N8N A;  3W1G A;  4EQO A;  3I55 A;  5FJ8 G;  3E5S A;  2VB3 X;  4HED A;  3BDL A;  3E3X A;  4XQJ A;  3F8T A;  2CWA A;  4FXG C;  2FMC A;  1GVP A;  3HOW G;  3JAM E;  2KOL A;  4JI1 L;  3EN2 A;  3GTP H;  1BDO A;  1Z7T A;  2SEB D;  1Q8K A;  4HSV A;  1TII D;  2Z4I A;  3ULJ A;  4YWM A;  4K8J A;  4LFA L;  1EIH A;  4BBR B;  3PO3 B;  1D6E C;  2B2V A;  5EPJ A;  3CC2 A;  3A54 A;  3KDF B;  2FJ2 A;  4A93 H;  2WB1 B;  3I8Z A;  1WOC A;  1II3 A;  3S1N B;  5FLX E;  1HA5 A;  3CCU A;  1JIC A;  4A4I A;  5C0X J;  5IYC H;  2KEC A;  1HNX L;  3HOX G;  3BYY B;  5IGD A;  1WTV A;  1VQA A;  1SAP A;  4J15 A;  3ULP A;  2R61 A;  2E2I H;  2R92 B;  1KTK A;  4GOP B;  3IAY A;  1O80 A;  1Y1W H;  1BUV T;  2UUC Q;  3ERO A;  4DNR B;  5CV7 A;  2NTS A;  5IP7 G;  2QEJ C;  3JC6 6;  2VNU D;  2L9H A;  2VL6 A;  3QB3 A;  2UU9 L;  2ZJP A;  4FVM A;  4CDF C;  1F2M A;  3GTP B;  1GUN A;  4Y7N B;  1TWG H;  1S5E D;  3J81 E;  1I94 L;  4A3L H;  2HCC A;  5LMN W;  4OIJ A;  2O5J C;  1TR5 A;  2ZTC A;  1E1O A;  1QB5 D;  3EA6 A;  5EAY A;  3QOJ A;  1NY4 A;  1PYS B;  3CRK C;  4NW2 A;  2NVX B;  1SEB D;  1GJX A;  4A93 B;  4BY1 B;  2ZXR A;  1ASZ A;  1VQK A;  1KHI A;  4C3H H;  5IT9 L;  1K73 C;  1X3P A;  1VQL A;  3VA7 A;  3CCL A;  5GAD C;  4JI6 Q;  2JQO A;  2EXD A;  3K5N A;  1XMO L;  5IGG A;  4YCV A;  3HOV B;  2JP1 A;  3LGJ A;  2SNM A;  5HGT A;  1XTD A;  4K5V A;  3TSS A;  4HMJ A;  4DR4 Q;  1JC7 A;  3UDX A;  5EKK A;  3DWP A;  3FHW A;  1F9Q A;  4DUY Q;  1KRS A;  2F0F A;  4DR6 Q;  4LF5 Q;  5C0X H;  5TSS A;  4IFD I;  5IGC A;  1SNM A;  2EYH A;  3A56 A;  3S16 B;  1OXS C;  2NYZ D;  2QIL A;  1TWG B;  4A3K H;  3I4M G;  1VQJ A;  1Y8O B;  1YEZ A;  4BXX G;  3LX0 A;  2JA6 H;  3QWN A;  2MQH A;  4K6D A;  3GTQ B;  1Z6H A;  2ES2 A;  1A3U A;  2H5X A;  4A3D B;  1NNX A;  3S17 B;  5A2Q E;  4C3H B;  3CXC A;  1HQR D;  3QR8 A;  1SYB A;  5CYU A;  1YJW A;  5L37 A;  3RR5 A;  4UY8 C;  5M3M H;  1Q1E A;  4AH6 A;  5K5P A;  2B3G A;  3J7A V;  2EIF A;  1EYC A;  3A8I E;  4QUC A;  4LFC L;  2IPK D;  3NBH A;  4LW1 A;  5EGT A;  4J8Q A;  1UE6 A;  2JA8 G;  1B4O A;  1LAC A;  1LAB A;  4KY7 A;  1YNX A;  2K05 A;  4B3R L;  1V9P A;  1HH2 P;  2D0P A;  1P16 A;  2XNA C;  3I56 A;  3VDY A;  1N8R C;  3KLS X;  1BBX C;  2YTX A;  3KUP A;  3TQY A;  2AHO B;  4R8N A;  4IPC A;  5BR8 L;  4BA1 I;  3JAM L;  1HZ9 A;  3OOC A;  3ULL A;  3S2H B;  3TS0 A;  3TP5 A;  1HTL D;  2PMZ E;  3F2C A;  2JA6 B;  3HEJ A;  2QKI C;  2ZM6 Q;  2RVL A;  1IBL Q;  2JXM B;  1BCP B;  2CHB D;  4B3T Q;  3SE0 A;  5FK9 C;  3T1Y Q;  1FYC A;  1SJE D;  2E74 C;  2RHS B;  3P7J A;  4EQP A;  2K01 A;  3K7A H;  4HJ9 A;  4NMZ A;  3HOU B;  4A93 G;  4CJ0 B;  5FLX L;  3CCS A;  3NTI A;  5IYD H;  5IT9 c;  2RCF A;  5IOD A;  5IYC G;  2JA7 B;  3OPO A;  3PIO 3;  2D2C C;  2MGS A;  4BY7 H;  3DWA A;  4ZK9 B;  4YCW A;  1GHJ A;  5JJL A;  1D1I A;  3GTM H;  2F3V A;  2PPB C;  3G48 A;  1KDB A;  1EYD A;  4L6T B;  1Y1W G;  1LT5 D;  4TQU S;  4O1N A;  2NB0 A;  3Q8D A;  3J81 L;  4UPA A;  4K0K Q;  1VQH A;  3S2D H;  4A3L G;  1YHB A;  1U4R A;  2RSN A;  1JMC A;  1BBU A;  3KF8 A;  2UUA L;  4IN3 A;  4PG3 A;  1B70 B;  1PTO B;  2XSC A;  4JI6 L;  2DNC A;  3CMA A;  2JYO A;  3PO2 H;  3MVV A;  3K7A B;  3I7F A;  3H15 A;  4GKK Q;  4CDD C;  2MP1 A;  1EFI D;  4C3H G;  3CCJ A;  2B2T C;  4RHS A;  3RZO H;  3C1E A;  4A76 A;  2Z6K A;  3URY A;  4DUY L;  3RZD H;  1MGS A;  4DR6 L;  1S5C D;  5BN3 A;  1AFP A;  3I91 A;  1RL2 A;  3N52 A;  1TS5 A;  3U50 C;  2H4O A;  4OWX B;  1YHQ A;  1K0S A;  2B39 A;  2B2W A;  2PNH A;  2A69 C;  2KEE A;  3BVM A;  4DV5 Q;  4JV5 Q;  4A3G H;  1NR4 A;  5ELE A;  3H91 A;  3RNU A;  1CSQ A;  3CCR A;  5FLM H;  5C0X G;  2CQO A;  2F4V Q;  3A8J E;  1STY A;  3CW2 C;  1DZ1 A;  4ID6 A;  1IBK Q;  1V43 A;  3S2D B;  4A3K G;  2QDB A;  1LTR D;  2I5H A;  4KKT A;  4HID A;  4HJ7 A;  2B63 B;  1F77 A;  4HJ8 A;  3JAM c;  1MJC A;  4RCO A;  3Q22 A;  2VZA A;  2YTY A;  4JI7 Q;  2JA6 G;  1YNN D;  4JI4 Q;  2D9U A;  4ODG A;  5A2Q L;  2EQS A;  2Q2T A;  3AYH B;  1NSN S;  4KI0 A;  1BVS A;  3QIA A;  5M3M G;  2E2H H;  1PFS A;  3PUX A;  3LWE A;  1DXM A;  2HD3 A;  2TMP A;  3CCE A;  3EIV A;  1NR2 A;  4LFB Q;  4X3T A;  2J7Z A;  2F0J A;  2EY1 A;  3Q23 A;  1R4Q B;  4A3G B;  5C4J B;  2F0T A;  4DU9 A;  2R7Z B;  2RSO A;  4KHV A;  1CSP A;  2VQF Q;  1HFG A;  4IAL A;  2A5H A;  1J5E Q;  4PNY A;  2WAQ B;  3V2T A;  1TQO A;  1FGB D;  1HNZ Q;  3T1Y L;  2L4N A;  2Q8T A;  2A6E D;  4A3E B;  4P73 A;  1MIU A;  3CC4 A;  1GO3 E;  4HCE A;  2KCN A;  1KAW A;  5KEE A;  1SXT A;  2G9D A;  5KGU A;  3J81 c;  3SK8 A;  3GTL H;  1HNW Q;  5IGB A;  4LF4 Q;  2QW7 A;  2PI2 E;  4JI0 Q;  3MC0 B;  1TXY A;  1N9W A;  5EPK A;  3H0G H;  1KDC A;  2RKS A;  1VQC A;  1PRT D;  2K5N A;  1PH4 A;  1YVC A;  1WTW A;  2NVY B;  5IYD G;  2K5W A;  1VQB A;  4L5R C;  3TBI B;  2UXB Q;  3HKZ G;  1KQS A;  3FP9 A;  1Y14 B;  2RDG A;  4JOI A;  1PV4 A;  3TS2 A;  4BY7 G;  2L12 A;  3TP6 A;  4K14 A;  4K0K L;  1U9R A;  4RFB A;  1CUK A;  4X65 L;  5I2X A;  4YWK A;  4U67 3;  1QE6 A;  4KY5 A;  1L1O A;  5IYB H;  3BS1 A;  2NVT H;  1XX8 A;  5E4X A;  2KUM A;  2N78 A;  3RD4 A;  3CRL C;  3I2Z A;  1FNU A;  3GO5 A;  2NN6 H;  3EBE A;  4GKK L;  4PZ7 A;  2K28 A;  1RIP A;  3T53 B;  2CW0 C;  1SYD A;  3PV0 A;  4KTA A;  4R4Q A;  1EIF A;  3PO2 G;  4DV7 Q;  2EZV A;  2F3W A;  3OYY A;  3D6C A;  1E1T A;  1SN8 A;  2R6G A;  3NPP A;  5GAH C;  5FOB B;  1YIT A;  2Q8R E;  3D8G A;  3OWF A;  2OTJ A;  1YBY A;  1RDP D;  4DV5 L;  2XRS D;  4JV5 L;  1MI2 A;  3K0Y A;  2PQA B;  3S15 H;  2K52 A;  1HR0 Q;  3M3Y H;  3K80 C;  2XTI A;  2Z9H A;  2EDG A;  4P72 A;  4L5Q A;  1XYI A;  2V1C C;  5EPL A;  2L5T A;  2B8G A;  4AIM A;  5IP9 H;  3PGZ A;  1LTI D;  2EPB A;  4A3G G;  2Z1C A;  1BOS A;  5T1G A;  1TS4 A;  4JI7 L;  2NVT B;  3X3N A;  4WRD A;  2B2U C;  1CFM A;  1RTN A;  5FLM G;  1F9R A;  3R3O A;  1HZC A;  4I7A A;  2WAQ G;  3UDI A;  5C3X A;  4H0L C;  2KHS A;  2L11 A;  1KRT A;  1PH3 A;  1AH9 A;  1IL8 A;  1STN A;  1SE8 A;  4H13 C;  3D4R A;  1B50 A;  2EY6 A;  4JI1 Q;  1NMF A;  4DR7 L;  1SE4 A;  4RWS C;  4LAA A;  3NHH A;  5DM6 3;  4B08 A;  4C3J B;  1PH1 A;  1DM0 B;  1STE A;  2BOS A;  4CBV A;  4A3J H;  3KF6 A;  5IIF A;  4LFA Q;  2QEX A;  1J9O A;  3VR6 A;  2LMC B;  3JAM i;  4DA2 A;  3L3O C;  4P75 A;  1JOO A;  3M3Y B;  1BKB A;  4R9W A;  1S4Z A;  4R4C A;  3UI2 A;  1NAP A;  2ZT9 C;  4MN3 A;  1HNZ L;  1KDA A;  1HNX Q;  5EJW A;  2JK8 A;  4HJA A;  1UE5 A;  4KY6 A;  3J80 i;  2HCI A;  1QVC A;  4DV6 L;  4HJ5 A;  5C5M A;  4FF3 A;  4JPB W;  1BBW A;  2AMC B;  5KYI A;  3Q0A A;  1AW7 A;  3AB9 A;  2XWJ B;  1EY5 A;  4NDX A;  5CR3 A;  5EKI A;  3NE5 B;  3NSW A;  4L8J A;  4C3I B;  4OL7 A;  1YHA A;  2R93 B;  1H95 A;  1X32 A;  3K5L A;  4HIK A;  3VR3 A;  2YU9 B;  2BDN A;  1KLU D;  2BE5 C;  2VW9 A;  1PH2 A;  3ND8 A;  2K04 A;  4H02 A;  1TKW B;  2MO1 A;  2A74 C;  2G9H D;  1WD1 A;  2UXB L;  4A3F B;  1P8L A;  3SK5 A;  3H0G G;  3J81 i;  3S1R H;  1QNU A;  1X54 A;  4GN4 B;  4C2M H;  1HR0 W;  1UNS A;  2EJM A;  4JYA L;  2A19 A;  1HA6 A;  4IJL A;  2PCF B;  2Z8L A;  5CV6 A;  1XMO Q;  1VQ5 A;  1EZ6 A;  4UHV A;  2WP8 J;  1LTB D;  1VMP A;  3OWE B;  3A55 A;  3VR5 A;  3BZC A;  5BN4 A;  5IYB G;  1AEX A;  5M3F B;  5COR A;  1IKM A;  2ZJR A;  2AWN A;  1EFW A;  4DV7 L;  3KLW A;  4K2L A;  2NN6 G;  4BBR H;  3PO3 H;  1S72 A;  1FNV A;  1NBW A;  2KHI A;  2K5Q A;  5J3B A;  4DKA C;  1FVI A;  2F0N A;  1LT4 D;  1GOZ A;  4B9X A;  1G6P A;  3CQZ H;  2HIX A;  2UUB L;  1CKM A;  5JVG 3;  4MHE A;  1EQQ A;  4C1N K;  1G2S A;  5ELO A;  4P71 A;  1KAA A;  2F0V A;  1CA5 A;  3T16 A;  1VMC A;  4B3S L;  2ZTE A;  1Z47 A;  4XQQ A;  4N9T A;  1TT2 A;  2KED A;  1Y69 U;  2N49 A;  1SNC A;  2PNR C;  4GZY C;  1DGS A;  4LFC Q;  2R92 H;  4KV6 A;  5J39 A;  3BG3 A;  1DYQ A;  5LL6 S;  1PTO C;  4CKB A;  4FXK C;  5IP9 G;  5M5W B;  1SRO A;  3VR2 A;  1EY0 A;  1K83 B;  2WKC A;  2HQE A;  4B3R Q;  3KK7 A;  4FP5 D;  3D0F A;  4Y7N H;  1VQG A;  1SMY D;  5IWA Q;  5BR8 Q;  1PFN A;  2MFI A;  5FO7 B;  2F1M A;  1PYW D;  4C1N I;  3FDT A;  2F3I A;  2RF4 A;  3SK4 A;  2HHH L;  3GTG B;  3J80 E;  3C1F A;  3RUZ A;  4DGZ A;  2NVX H;  2OTL A;  1CZG A;  4BY1 H;  5IGE A;  2BA1 A;  2CKZ B;  1L2F A;  4KD4 A;  4A3J G;  3CQZ B;  2OQK A;  2BDO A;  4JC0 A;  3W5O A;  1WCM H;  2EYF A;  1WD0 A;  1SBB B;  4K6L A;  3KDF A;  5C5L A;  1JWM D;  1B9N A;  2OF1 A;  4IPG A;  3HOV H;  5M5Y H;  3GD7 A;  4KHP Q;  1PZI D;  1H9M A;  4ZQ3 A;  3FPU B;  4FF1 A;  1SND A;  1EOV A;  4OON A;  2EXZ A;  4OO1 H;  5ELC A;  3S16 H;  4FDB A;  2QGQ A;  4DK3 C;  2NVQ B;  1A2U A;  1Q12 A;  1U0L A;  3HG9 A;  1TS2 A;  4GOP A;  3NK9 A;  3UDG A;  3M7G A;  1I4G A;  3PIP A;  1F9S A;  2A8V A;  4ZCK A;  3MXN B;  4JBJ A;  3DM1 A;  2K33 A;  4CJ2 C;  5ELB A;  3C3L A;  5D3I B;  4L63 B;  3GTQ H;  1OO9 B;  3C46 A;  2AWO A;  3KJP A;  4A3M B;  4A3D H;  3S17 H;  1PH7 A;  1Q3L A;  2UUA Q;  2F52 A;  3BVG A;  1RD9 D;  2Z6B A;  1TU2 B;  1WCM B;  4XIG S;  4AYB G;  4GNX C;  1YI2 A;  2Z0S A;  4KN4 C;  4TKO B;  1BCP D;  2NZH A;  2RA4 A; 
#chains in the Genus database with same CATH homology
 5C4Z A;  5M5Y B;  1B53 A;  1IW7 C;  2JA5 B;  1SNQ A;  3VYU A;  3GP7 A;  2ID0 A;  1I6V C;  3PUY A;  5KYL A;  1JWU D;  1MBY A;  2F0U A;  1Y8P B;  2VB2 X;  4S3S A;  1HXY D;  2K7V A;  1WTQ A;  4KHZ A;  3RLF A;  3SXH A;  3RMH A;  2Y0S B;  5F2D A;  1L0X B;  3MEH A;  4X3K A;  2F0S A;  2B2Y C;  1HUM A;  2M9V A;  1XXG A;  5DNF A;  3GV6 A;  1HPC A;  1Y8N B;  4KD3 A;  1WTX A;  5JEA H;  1VDZ A;  3DEP A;  2AQ3 B;  4CKC A;  4O42 A;  4ILW A;  4HN7 A;  1FNW A;  1E2V A;  1YNJ C;  5C3E B;  1K8M A;  4JBW A;  4KN7 C;  1PLF A;  1B9M A;  2F0O A;  1O78 A;  1ENF A;  1ZYR C;  3TZD A;  2IX1 A;  2YYZ A;  1KLG D;  5G3L D;  2F0D A;  1LV9 A;  2VXW A;  2WV6 D;  3GTJ B;  1SFO B;  4YIJ A;  1ESF A;  5C44 B;  1PTO H;  3PUV A;  3J80 L;  2AUJ D;  2EYO A;  1BF4 A;  1EQV A;  4BS9 A;  4G7Z C;  3V05 A;  2NUC A;  2EJG C;  2LY7 A;  1JR0 D;  2BCO A;  1W6J A;  1HTP A;  2PZU A;  4K2K A;  1QNK A;  5ELD A;  3LWU A;  2SNS A;  1E2W A;  1ROD A;  1CHQ D;  2ICI A;  4P2C B;  1B44 D;  2KVM A;  4QMG A;  1CA6 A;  2E2J B;  1PZK D;  1A3T A;  3DUZ A;  4OO1 G;  1G2T A;  1HQM C;  3QOL A;  4Z9C B;  1I4Q A;  1MSH A;  1CK1 A;  1T5X D;  4ZYS A;  1L0Y B;  1KNA A;  4G4K A;  4ULL A;  2KQ3 A;  4DFA A;  1H9S B;  1BCP F;  1TVX A;  4QB4 A;  3K58 A;  3FKI B;  3MFY A;  2JE6 I;  3T56 B;  3J7Y W;  2DY8 A;  1WVL A;  1STB A;  1LLR D;  2A6H C;  5I9P A;  3LNN A;  4BBS B;  1GUG A;  2EY2 A;  1O7Z A;  1PFM A;  1EZ8 A;  4DN4 M;  4B9W A;  2A68 C;  2X69 A;  3NXW A;  2OEO A;  5FKA C;  1JOK A;  5J1Z A;  5I2Y A;  3OIQ A;  1RJT A;  5KIX A;  4ZKC B;  1I50 B;  3BZD B;  1NCV A;  3HOY B;  3MZ5 A;  2PZT A;  4J1M A;  3IL8 A;  2WAC A;  4LMQ D;  3M4Y A;  3MWY W;  1LTT D;  5T1I A;  1TWA B;  2CQA A;  3EQL C;  3G6J B;  1CZW A;  1I4R A;  5JEA G;  1C48 A;  2ZXO A;  1KAB A;  3OHX C;  5G3L F;  1HRJ A;  1ESR A;  1FR3 A;  3K59 A;  4KKS A;  5CC4 A;  1ENC A;  1WTR A;  1DOK A;  4F8M A;  3H94 A;  4RKL A;  4XQN A;  2LFN A;  4JK1 C;  4DAV A;  1ICW A;  2IX0 A;  3K5O A;  5M9O A;  2MHV A;  2SOB A;  5EBD A;  3M7N A;  4A3B B;  4HAE A;  1J8I A;  1VCI A;  4MIU A;  4IFD H;  2XRQ D;  2XIW A;  5KNC A;  3OW7 A;  2IW3 A;  1GHK A;  3TZU A;  1Q1B A;  1I3Q B;  4RCN A;  3S1M B;  2C9O A;  4PQX A;  1V1O A;  4DAP A;  2F0I A;  4N9P A;  1LTG D;  3J7A F;  5I6W A;  2F0G A;  1ZEQ X;  4DF7 A;  1EY6 A;  4XXE A;  3DHQ A;  2B2V C;  3FMC A;  3NP8 A;  4F87 A;  4IUU A;  1OXT A;  5CBA E;  2KA7 A;  1QIL A;  2PO4 A;  1D2B A;  2KCC A;  3HGB A;  1PDQ A;  2A69 D;  1H9R A;  1RKN A;  4LJZ C;  5BN5 A;  3OIP A;  2FHT A;  4IUT A;  1D5Z C;  3BVZ A;  4OO1 I;  4RGN A;  3S1Q B;  2VUM B;  2IL8 A;  4NKL A;  1JOR A;  5FO8 B;  3NWS A;  3H09 A;  5DM7 3;  5C3W A;  4UAI A;  1D5X C;  2RDF A;  1HUN A;  1F2Z A;  2HUG A;  1ILP A;  1V1P A;  5JVH 3;  5E3F A;  1SJH D;  4IUP A;  3PUZ A;  1G8Z D;  4QUF A;  1ILQ A;  2AQ1 B;  3KLR A;  2M00 A;  2O4X A;  1PRT B;  1JOQ A;  1EEF D;  1A6X A;  2PMZ B;  5JOB A;  2CVR A;  2TSS A;  3KBG A;  2A73 B;  5C0X I;  4HR7 B;  3FEW X;  3PIP 3;  4DAY A;  5KND A;  4J6H A;  4Q5V A;  4H44 C;  2EVB A;  2IT1 A;  3FVQ A;  2K6A A;  4HSP A;  4PMC A;  3SDZ A;  4PMW A;  1TWF B;  3VR4 A;  3ZYY X;  1GXD C;  3MXP A;  1JB3 A;  3TDQ A;  4M1U B;  2K1B A;  1H9J A;  4ZUI A;  3HOW B;  3EJI A;  4R8I A;  3IFT A;  1PXU A;  3I70 A;  2EYP A;  1QWY A;  1F9P A;  3M4O B;  5KRU A;  3VYS A;  4KJO A;  2PZW A;  1EOT A;  2QF7 A;  1M4V A;  4RAU C;  3HOX B;  5FO9 B;  5E1F A;  3NUC A;  2CW0 D;  2GA4 B;  2FMM A;  1LT6 D;  1T5E A;  1EU4 A;  4ME5 A;  1PFB A;  3HZX A;  4A3I B;  4XTC S;  4X3U A;  1A2T A;  1ET9 A;  5EKL A;  1OXX K;  1TS3 A;  4ZUJ A;  4X3S A;  1S5F D;  4HTH A;  4UDU C;  2O5I C;  3MAQ A;  4C3J G;  1H9K A;  2PYK A;  3R8B A;  3Q6S A;  1EWC A;  1DJR D;  2F0L A;  2F0E A;  1JCK B;  2N55 A;  4BA2 I;  1S5B D;  5CV4 A;  2L0C A;  3TN2 A;  1Y1V B;  3OMC A;  2F0P A;  2QCP X;  5DAU A;  4K5W A;  4PMB A;  1I6H B;  1E0B A;  2IJ0 A;  1STA A;  1AZQ A;  1U4P A;  1DOL A;  1UUP A;  3KBX A;  1GUO A;  2AUK A;  2MJ8 A;  5D65 A;  4CJ1 B;  1R9T B;  4FXD A;  4EQN A;  3SEB A;  4C3I G;  1U4L A;  5E4W C;  3K6O A;  3U9S A;  3I4M B;  1JQY D;  1S5D D;  5EQ0 A;  3M85 A;  2B2W C;  5C4X B;  5D3D A;  1D5M C;  2E2D C;  2HDL A;  4K8I A;  1STG A;  2LKV A;  4M8A A;  5CGK A;  1OXU A;  3D31 A;  4XDX A;  3W3A A;  2JA8 B;  1SNP A;  1RHP A;  4XT1 B;  3TP7 A;  4RA8 A;  2BE5 D;  1PMR A;  5JEA J;  4G57 A;  1WTO A;  3AMU A;  3OSO A;  1CQF A;  4XT3 B;  4IZ8 A;  2IX3 A;  3MXN A;  1EWH A;  1RTO A;  1TWH B;  4V19 0;  1EQT A;  2DNE A;  3R2I A;  4HCS A;  2B2U A;  3MA2 B;  3EFX D;  1W6K A;  1SYF A;  1QCB D;  3IKJ A;  3QG1 A;  2D5D A;  5AFW A;  4F88 A;  2DN8 A;  1LTS D;  2L55 A;  5ISR A;  1F2Y A;  2NZ1 D;  2E2I B;  2EE1 A;  3MTS A;  3IFD A;  1Y1W B;  1Q8I A;  2X6G A;  4EVO A;  4RGO S;  1AN8 A;  1A15 A;  1LT3 D;  3OMG A;  4TRD A;  5JJZ A;  1SSO A;  3BYT B;  4KK7 A;  3WOF A;  1IHZ A;  4WJW A;  4Q0F A;  1PTO D;  1LO5 D;  3C2P A;  1QOH A;  1CQV A;  1IYV A;  1TY2 A;  3U9O A;  1AP0 A;  3NQI A;  1BQQ T;  1EY8 A;  1GUT A;  4I65 A;  3QJY A;  1YNN C;  2XWB B;  1HCZ A;  3T13 A;  1FD7 D;  2NN6 I;  4WOR A;  2BA0 A;  1EY4 A;  2L1B A;  2EOT A;  2F0M A;  1B3A A;  2DY7 A;  2O2L D;  4A3K B;  1LTA D;  3DXJ C;  3CKI B;  3D4D A;  1DON A;  5CBE E;  2MUY A;  1EIG A;  5D14 A;  5ELF A;  2K32 A;  3P20 A;  4DNT B;  2E76 C;  3H6M A;  2A6E C;  1ET6 A;  1SE3 A;  1IYU A;  5M3M B;  2I46 A;  3F2U A;  2M2L A;  3PMF A;  3NQT A;  3NTH A;  2IWH A;  3O13 A;  4OHJ A;  1PRT C;  3ITP A;  2RQX A;  1SYE A;  4FF2 A;  4G7H C;  2AQ2 B;  4FNF A;  3BDO A;  4ZRZ A;  2JEA I;  1IW7 D;  3NWT A;  3CHB D;  4DK1 A;  2SDF A;  3SK6 A;  5COY A;  2WKD A;  4V0B A;  4C56 C;  1H9S A;  1V8Q A;  1HFN A;  5JAV A;  4IUR A;  3H3V C;  5M5X B;  5K36 H;  3GTO B;  2EY5 A;  3R2T A;  3HKZ B;  4QF4 A;  4DXG A;  4BY7 B;  3S9W A;  4IFD J;  3P75 A;  3GTM B;  1I4X A;  1ONL A;  3I4N B;  2J4X A;  1WTP A;  2F0W A;  2NTT A;  1BNZ A;  3P1H A;  2ENB A;  1PTO F;  1STH A;  1EY7 A;  4RGT A;  1I4P A;  2XN9 C;  4KJN A;  1YNJ D;  3CU7 A;  1NUC A;  1TY0 A;  3EVQ A;  5I4D A;  2B8F A;  5DEH A;  1ZYR D;  1BR9 A;  1AZP A;  3PO2 B;  5CMD A;  3VYR A;  3AU7 A;  1ML0 D;  2H1E A;  5I9O A;  3GV3 A;  2EYM A;  3PUW A;  2Q8I B;  3RZO B;  2V4D A;  4LK1 C;  3HP3 A;  5CV8 A;  1QJO A;  3RZD B;  2D62 A;  4QIW B;  4QCL A;  3SVM A;  4XYQ A;  3VA5 A;  1ZKO A;  4IUQ A;  1MD2 D;  5LL6 X;  2HDM A;  1XWE A;  3A7A B;  3DMU A;  5NUC A;  1O7L A;  2EYL A;  3S14 B;  4E6I A;  2WIN B;  3T4A C;  1RF2 D;  3A7L A;  1A3V A;  2EYJ A;  3MHB A;  1SYC A;  5CV5 A;  2E2H B;  1JWS D;  3FPP A;  2E75 C;  3X3M A;  2B2Y A;  1QG7 A;  2F03 A;  4WFN 3;  3ND9 A;  3GQB A;  2RDH A;  4G7O C;  3KLS A;  2X6L A;  2WII B;  3ONA B;  3DEO A;  1G29 1;  4TSS A;  4FO2 A;  3WDN A;  3BDC A;  4XYO A;  2A6H D;  1M8A A;  2K03 A;  5A35 A;  5IOC A;  1VF5 C;  4I7Z C;  3HS0 C;  1CM9 A;  1TWC B;  3I3C A;  3GTL B;  5EBC A;  5LHY 1;  1GUS A;  2A68 D;  2F0H A;  3GTK B;  1ZXT A;  2F0K A;  4FYD A;  2OXP A;  3Q24 A;  3H0G B;  1IKL A;  2K5D A;  3K5M A;  5K36 G;  5JPN C;  3MXG A;  3T51 B;  3TP8 A;  4IUN A;  3SR1 A;  1EY9 A;  1UEA B;  1X3Q A;  1D1K A;  1EU3 A;  4RHR A;  2LS0 1;  4CGY B;  1I4H A;  1DD2 A;  1V1P B;  3FRP B;  3N6R A;  3SHL A;  3HRZ C;  1C4Q A;  2MPM A;  2EJF C;  3MFG A;  3TME A;  4EGV A;  1C8C A;  2NBF A;  2PW5 A;  4ABN A;  1U4M A;  3D3R A;  1SDF A;  1SNO A;  1SMY C;  1BXT A;  3HOZ B;  2JEB I;  1G6Z A;  1O7Y A;  3S15 B;  5HUR A;  1EEI D;  1F2L A;  2I07 B;  1JE4 A;  2B2T A;  3D4W A;  2F0Q A;  1SYG A;  2XVS A;  2PQE A;  3MXU A;  2Z4H A;  1PZJ D;  3I73 A;  3QO2 A;  1CHP D;  1DOM A;  1XTC D;  4ZKB B;  1UAP A;  1R4P B;  4K5X A;  1K8O A;  4CHT B;  5I6Y A;  4IFD G;  1B1Z A;  2C5C A;  4NP5 A;  3E6Z X;  1E2Z A;  2ZXP A;  3G7L A;  2FFK B;  1PRT F;  1B2T A;  4U68 A;  5KNB A;  3DWQ A;  1VF7 A;  3NBI A;  4OIK A;  2R3Z A;  4IUV A;  4A3J B;  1DCZ A;  4KMU C;  3A8K E;  4F7X A;  4CKE A;  1CI3 M;  5IGF A;  4DXF A;  5IT9 E;  5C6A A;  4ZAI A;  1CT1 D;  1KNE A;  1MSG A;  1HHV A;  3I90 A;  3I4L A;  4ZLT F;  2J0T D;  3W2D A;  3E0J A;  4HMI A;  4BWG B;  3K57 A;  1GUW A;  4RH6 A;  2FIN B;  1BCP C;  3D6W A;  3L9A X;  5JPM C;  3I72 A;  2OT2 A;  1CTM A;  5CV9 A;  2JSO A;  4PV1 C;  3VYT A;  1BO0 A;  3R93 A;  2KJX A;  5C4H A;  1EL0 A;  3L7Z C;  4RKB A;  4H7B A;  3ERQ A;  1EYA A;  1G91 A;  1ENA A;  5J22 A;  2ICE C;  2NWG A;  3WOE A;  3V96 A;  4IQZ A;  1RCV D;  4AYB B;  2RBM A;  4OGQ C;  1SE2 A;  4FF4 A;  2N88 A;  4KKU A;  2F4I A;  3S1R B;  1Q90 A;  2PW7 A;  1OXV A;  4DK0 A;  4C2M B;  4RGM A;  3NTK A;  4EQO A;  3E5S A;  2VB3 X;  4HED A;  3BDL A;  4XQJ A;  4FXG C;  2FMC A;  3JAM E;  2KOL A;  1BDO A;  1Z7T A;  2SEB D;  4HSV A;  1TII D;  2Z4I A;  1EIH A;  4K8J A;  4BBR B;  3PO3 B;  1D6E C;  2B2V A;  5EPJ A;  3A54 A;  2FJ2 A;  2WB1 B;  3I8Z A;  3S1N B;  1II3 A;  5FLX E;  1HA5 A;  1JIC A;  5C0X J;  2KEC A;  3BYY B;  5IGD A;  1WTV A;  1SAP A;  2R61 A;  2R92 B;  1KTK A;  3IAY A;  1O80 A;  1BUV T;  3ERO A;  4DNR B;  5CV7 A;  2NTS A;  2QEJ C;  2VNU D;  2L9H A;  3QB3 A;  3GTP B;  4FVM A;  1F2M A;  1GUN A;  4Y7N B;  3J81 E;  1S5E D;  2HCC A;  4OIJ A;  2O5J C;  1TR5 A;  1QB5 D;  3EA6 A;  3QOJ A;  3CRK C;  4NW2 A;  2NVX B;  1SEB D;  1GJX A;  4A93 B;  4BY1 B;  2ZXR A;  5IT9 L;  1X3P A;  3VA7 A;  3K5N A;  5IGG A;  3HOV B;  2JP1 A;  2SNM A;  5HGT A;  4K5V A;  3TSS A;  4HMJ A;  1JC7 A;  5EKK A;  3DWP A;  1F9Q A;  2F0F A;  5C0X H;  5TSS A;  4IFD I;  5IGC A;  1SNM A;  2EYH A;  3A56 A;  3S16 B;  1OXS C;  2NYZ D;  2QIL A;  1TWG B;  1Y8O B;  3LX0 A;  3QWN A;  4K6D A;  3GTQ B;  1Z6H A;  1A3U A;  4A3D B;  3S17 B;  5A2Q E;  4C3H B;  1HQR D;  1SYB A;  5CYU A;  1Q1E A;  5K5P A;  3J7A V;  1EYC A;  3A8I E;  4QUC A;  2IPK D;  3NBH A;  5EGT A;  4J8Q A;  1B4O A;  1LAC A;  1LAB A;  4KY7 A;  2K05 A;  2XNA C;  3KLS X;  1BBX C;  3KUP A;  4R8N A;  4BA1 I;  3JAM L;  3OOC A;  3S2H B;  3TP5 A;  1HTL D;  2JA6 B;  3HEJ A;  2QKI C;  2RVL A;  2JXM B;  1BCP B;  2CHB D;  3SE0 A;  5FK9 C;  1FYC A;  1SJE D;  2E74 C;  3P7J A;  4EQP A;  2K01 A;  4NMZ A;  3HOU B;  4CJ0 B;  5FLX L;  3NTI A;  2JA7 B;  5IOD A;  3OPO A;  3PIO 3;  2D2C C;  2MGS A;  3DWA A;  4ZK9 B;  1GHJ A;  1D1I A;  2F3V A;  2PPB C;  1KDB A;  1EYD A;  4L6T B;  1LT5 D;  4TQU S;  4O1N A;  2NB0 A;  3J81 L;  1U4R A;  2RSN A;  3KF8 A;  4IN3 A;  1PTO B;  2XSC A;  2DNC A;  2JYO A;  3MVV A;  3K7A B;  2MP1 A;  1EFI D;  4C3H G;  2B2T C;  4RHS A;  3C1E A;  3URY A;  1MGS A;  1S5C D;  5BN3 A;  1AFP A;  3I91 A;  3N52 A;  1TS5 A;  2H4O A;  2B39 A;  2B2W A;  2A69 C;  2KEE A;  3BVM A;  1NR4 A;  5ELE A;  3H91 A;  5C0X G;  3A8J E;  1STY A;  1DZ1 A;  4ID6 A;  1V43 A;  3S2D B;  2QDB A;  1LTR D;  4KKT A;  2B63 B;  1F77 A;  4RCO A;  3Q22 A;  1YNN D;  2D9U A;  4ODG A;  5A2Q L;  1NSN S;  4KI0 A;  3QIA A;  3PUX A;  3LWE A;  1DXM A;  2TMP A;  1NR2 A;  4X3T A;  2J7Z A;  2F0J A;  2EY1 A;  3Q23 A;  1R4Q B;  4A3G B;  5C4J B;  2F0T A;  4DU9 A;  2R7Z B;  2RSO A;  4KHV A;  1HFG A;  4IAL A;  2A5H A;  4PNY A;  2WAQ B;  3V2T A;  1TQO A;  1FGB D;  2L4N A;  2Q8T A;  2A6E D;  4A3E B;  4HCE A;  2KCN A;  5KEE A;  1SXT A;  2G9D A;  5KGU A;  3SK8 A;  5IGB A;  3MC0 B;  5EPK A;  1KDC A;  2RKS A;  1PRT D;  1WTW A;  2NVY B;  2K5W A;  3TBI B;  2RDG A;  2L12 A;  3TP6 A;  4K14 A;  1U9R A;  4RFB A;  5I2X A;  4U67 3;  1QE6 A;  4KY5 A;  3BS1 A;  1XX8 A;  5E4X A;  2KUM A;  3RD4 A;  3CRL C;  1FNU A;  3GO5 A;  2NN6 H;  2K28 A;  3T53 B;  2CW0 C;  1SYD A;  3PV0 A;  4KTA A;  2EZV A;  2F3W A;  3D6C A;  2R6G A;  3NPP A;  5FOB B;  2Q8R E;  3D8G A;  3OWF A;  1RDP D;  2XRS D;  1MI2 A;  3K0Y A;  2EDG A;  1XYI A;  5EPL A;  2L5T A;  2B8G A;  1LTI D;  2EPB A;  2Z1C A;  1BOS A;  5T1G A;  1TS4 A;  2NVT B;  3X3N A;  4WRD A;  2B2U C;  1RTN A;  1CFM A;  1F9R A;  3R3O A;  5C3X A;  4H0L C;  2KHS A;  2L11 A;  1IL8 A;  1STN A;  4H13 C;  3D4R A;  1B50 A;  2EY6 A;  1SE4 A;  4RWS C;  4LAA A;  3NHH A;  5DM6 3;  4B08 A;  4C3J B;  1DM0 B;  1STE A;  2BOS A;  4CBV A;  5IIF A;  1J9O A;  3VR6 A;  2LMC B;  4DA2 A;  3L3O C;  1JOO A;  3M3Y B;  4R9W A;  1S4Z A;  3UI2 A;  1NAP A;  2ZT9 C;  4MN3 A;  1KDA A;  5EJW A;  4KY6 A;  2HCI A;  4FF3 A;  5C5M A;  5KYI A;  3Q0A A;  1AW7 A;  3AB9 A;  2XWJ B;  1EY5 A;  4NDX A;  5CR3 A;  5EKI A;  3NE5 B;  3NSW A;  4L8J A;  4C3I B;  4OL7 A;  2R93 B;  1X32 A;  3K5L A;  3VR3 A;  2YU9 B;  2BDN A;  1KLU D;  2BE5 C;  3ND8 A;  2K04 A;  1TKW B;  1WD1 A;  2A74 C;  2G9H D;  4A3F B;  3SK5 A;  1QNU A;  1UNS A;  2EJM A;  1HA6 A;  2PCF B;  2Z8L A;  5CV6 A;  1EZ6 A;  2WP8 J;  1LTB D;  1VMP A;  3OWE B;  3A55 A;  3VR5 A;  5BN4 A;  1AEX A;  5M3F B;  5COR A;  1IKM A;  2AWN A;  4K2L A;  2NN6 G;  1FNV A;  2K5Q A;  2F0N A;  1LT4 D;  1GOZ A;  4B9X A;  5JVG 3;  4MHE A;  4C1N K;  1G2S A;  1KAA A;  2F0V A;  1CA5 A;  3T16 A;  1VMC A;  1Z47 A;  4XQQ A;  4N9T A;  1TT2 A;  2KED A;  1Y69 U;  1SNC A;  2PNR C;  4GZY C;  4KV6 A;  5J39 A;  3BG3 A;  1DYQ A;  5LL6 S;  1PTO C;  4CKB A;  4FXK C;  5M5W B;  3VR2 A;  1EY0 A;  1K83 B;  2WKC A;  2HQE A;  3KK7 A;  4FP5 D;  1SMY D;  1PFN A;  5FO7 B;  2F1M A;  1PYW D;  4C1N I;  3FDT A;  3SK4 A;  3GTG B;  3J80 E;  3C1F A;  3RUZ A;  4DGZ A;  1CZG A;  5IGE A;  2BA1 A;  4KD4 A;  3CQZ B;  2BDO A;  2EYF A;  1WD0 A;  1SBB B;  4K6L A;  5C5L A;  1JWM D;  1B9N A;  2OF1 A;  3GD7 A;  1PZI D;  1H9M A;  4ZQ3 A;  3FPU B;  4FF1 A;  1SND A;  2EXZ A;  4OO1 H;  5ELC A;  2NVQ B;  1A2U A;  1Q12 A;  3HG9 A;  1TS2 A;  3NK9 A;  3M7G A;  1I4G A;  1F9S A;  3DM1 A;  2K33 A;  4CJ2 C;  5ELB A;  3C3L A;  5D3I B;  4L63 B;  1OO9 B;  3C46 A;  2AWO A;  4A3M B;  1Q3L A;  3BVG A;  1RD9 D;  1TU2 B;  1WCM B;  4XIG S;  4KN4 C;  4TKO B;  1BCP D;  2RA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...