1B2TA

Solution structure of the cx3c chemokine domain of fractalkine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
MQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemokine
molecule keywords PROTEIN (FRACTALKINE)
publication title Solution structure and dynamics of the CX3C chemokine domain of fractalkine and its interaction with an N-terminal fragment of CX3CR1.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b2tA00
1QNKA 1MSGA 5DNFA 2VXWA 2RSOA 1DOMA 2D9UA 3D6WA 1F9SA 2IL8A 4CJ2C 1C8CA 4ZAIA 1NR2A 2FHTA 1RJTA 3KUPA 3MWYW 2HUGA 1MGSA 1RTNA 2FMMA 1X32A 2XIWA 3I91A 1PFBA 1VMCA 3R93A 1EL0A 1WD0A 1U4LA 3IL8A 2Q8RE 1WVLA 1O7ZA 1DOLA 2K01A 2B2YA 2X6LA 1PLFA 2B2VC 2HCIA 4HAEA 4IUPA 3KBXA 4X3KA 2KEEA 3P7JA 4XT1B 1B2TA 1B53A 4LMQD 1HHVA 2MJ8A 1EOTA 5EKIA 2B2WC 2X69A 2L12A 1EIHA 1F2LA 2K03A 5EJWA 1KNAA 4X3TA 3FDTA 1IKLA 4R9WA 1G2TA 1DOKA 5E4WC 4RWSC 1TVXA 3FPUB 1RTOA 3I90A 5EPKA 2MPMA 2KECA 5AFWA 1B4OA 1WTOA 1BO0A 1RODA 5CBAE 1EIGA 4CJ0B 1QE6A 2NWGA 4IUTA 2M2LA 2HCCA 1ILPA 4ZLTF 3TZDA 3DEPA 1WTVA 2RSNA 1CA6A 1LV9A 1MI2A 1PDQA 1IKMA 2SDFA 3UI2A 3H91A 1WTWA 1CA5A 2R3ZA 1S4ZA 1DZ1A 2JP1A 1WTQA 4X3UA 1WTRA 2JYOA 1O7YA 1U4PA 1AP0A 1HRJA 3IFDA 4XDXA 4DN4M 1NR4A 2DY7A 1ESRA 3GV6A 1KNEA 3Q6SA 3I8ZA 4IUUA 5CORA 1BBXC 1AZQA 1CM9A 3TN2A 4OIKA 2L1BA 2L9HA 1BF4A 2K05A 2HDMA 2B2YC 1NAPA 1X3PA 3DEOA 2H1EA 2NYZD 4HCSA 1ZXTA 3HP3A 4QUCA 1X3QA 5D65A 5T1GA 4ZK9B 1J8IA 2B2TA 3G7LA 5E4XA 1WD1A 1WTPA 1VMPA 1NCVA 4IUQA 2RVLA 1SDFA 4IUVA 1ILQA 2B2VA 1WTXA 1AZPA 3N52A 1Q3LA 2RA4A 1XYIA 1B50A 3QO2A 2FINB 2FJ2A 2KEDA 1BNZA 2Q8TA 5COYA 1G91A 3MTSA 4MHEA 1DONA 1XX8A 1JICA 3SVMA 2KUMA 3F2UA 5EPJA 1RHPA 1M8AA 2EPBA 4HEDA 2KOLA 2B2UA 5T1IA 5CBEE 1ML0D 2EE1A 4UAIA 1HA6A 1HUMA 2EOTA 4RA8A 3LWEA 4OIJA 4XT3B 4O42A 1U4RA 2CVRA 2L11A 1G6ZA 4HSVA 2DY8A 4MN3A 2N88A 1HFGA 1GUWA 4CJ1B 1F9PA 2K1BA 5EQ0A 1SSOA 1EQTA 1B3AA 2MGSA 3I3CA 2L4NA 2NZ1D 2N55A 1HUNA 1F9RA 2K28A 5D14A 2B2TC 1O80A 4IURA 4R8IA 1A15A 2B2WA 2MP1A 4ZKBB 1J9OA 1E0BA 4U68A 3DM1A 1HFNA 2BDNA 5CMDA 4NW2A 2K04A 2KVMA 3ONAB 1JE4A 1QG7A 2J7ZA 1PFNA 4RAUC 5JJZA 2X6GA 1IL8A 3GV3A 4X3SA 4ZKCB 4QUFA 2HDLA 1SAPA 1ICWA 1G2SA 1PFMA 1U4MA 1F9QA 1MSHA 2B2UC 5EPLA 2FFKB
chains in the Genus database with same CATH superfamily
4NXML 3SHLA 4BA1I 3K6OA 5JVG3 3SEBA 1CKOA 2A19A 1MKHA 3PIPA 2KHJA 1M90C 1PH3A 1BDOA 4A3BB 1MIUA 2XRQD 3QJYA 3M3YH 4X3KA 2FMCA 1WCMH 4HJ7A 4JI2Q 3T1YL 1I3QB 4OEMB 1EY0A 1ZYRC 4C3JB 2SEBD 2F03A 3CMEA 1IKLA 1HNWL 1H9SB 1TVXA 3FPUB 1RTOA 2EXZA 3GTLB 5BR8Q 3PMFA 5EAYA 2E8GA 4AIMA 4LUVA 3BDCA 3KJOA 1CUKA 2GVAA 1EQQA 2VQEL 1KAWA 3QG1A 2RDHA 5IT9E 4DR2L 5HGQA 2UUBL 1JOOA 3EQLC 3PSIA 3X3MA 2HD3A 4NMZA 4LFAQ 2F0UA 1E1OA 1EQVA 1SYDA 2F0NA 2PYKA 1FVIA 2GVBA 3BZKA 1G6PA 2PMZB 2HDMA 3K7AB 4HCSA 3S15H 4P2CB 3I56A 4DK1A 1WTPA 4PG3A 1FGUA 3GD7A 1WTXA 2GN5A 4OWXB 4DR5Q 1AZPA 2A6EC 4TSSA 4C56C 3STBC 1S3OA 1HR0L 4HJ5A 4QIWB 1G91A 4DV5L 2ES2A 1DONA 5C0XI 4R4TA 2PPBC 2KENA 3T51B 3FPPA 1Y14B 2PQAA 1NE3A 3GQBA 1IYVA 1J6QA 2NZHA 3I4MG 2HT1A 5KYIA 2R61A 1X3FA 2B8FA 1SRUA 1QB5D 3RLFA 1EEID 5IYCG 2PI2E 4B08A 2L55A 5LMNL 4POGA 3W1GA 3L2PA 1B8AA 5EQ0A 5JJKA 3WWVA 1EZ8A 3HEJA 1PZKD 4A3DG 2JJQA 2N3SA 3V96A 4C3HH 2OCEA 2FXQA 4H7BA 1SFOB 1X3GA 4JYAL 4RAUC 1EIYB 3GV3A 4R4QA 1N34Q 3KDFA 1JR0D 5GADC 5C3EB 4A3EH 3E5SA 3I2ZA 5E4XA 4M1UB 2KA7A 3S17H 1X55A 3M3YB 4OL7A 4J1MA 1MGSA 4YWLA 4H02A 1SJHD 1PHJA 1DOLA 4DR4L 3J80c 1PLFA 3A8KE 4HAEA 2ZTEA 5FO8B 3HOXH 3HOWH 1EWIA 3OW2A 2AQ1B 2MJ8A 1HA5A 1BCPD 4K8IA 3A55A 1EIHA 5TSSA 1KNAA 5CC4A 1K9MC 4NXMQ 4RKBA 1YNND 4JI7L 3I90A 1CI3M 1PRTF 2I07B 3M85A 3J7YW 2WFWA 2Q8IB 1CQFA 1RODA 5FLXL 3I7FA 4EQPA 4GLAC 5IT9c 4ABNA 2JA7H 2EVBA 3R3OA 4JBJA 2O5JC 1E2VA 5FJ8G 2R93G 1TWFB 3TS2A 1I4GA 5M3FH 3T1YQ 4J6HA 3S15B 4IFDI 5CYUA 2ZJRA 2A69C 3ULJA 2P5ZX 1PH5A 1PXUA 3A5UA 3BZCA 3S1NH 4RG1A 1B9MA 3FHWA 4RHSA 5FKAC 5I4DA 4BXXG 4OONA 3GTKB 2EY6A 1VMPA 2SNMA 3I4NH 3NQTA 2VQEQ 3CCUA 1STAA 1B7YB 2YTYA 3H3VH 3SR1A 1N8RC 2KEDA 2UUBQ 4RMFA 1K3RA 3MC0B 4P75A 2KOLA 2B2UA 2Z8LA 1SLJA 2MFIA 1PH6A 3A56A 2HQLA 2PNRC 1Q46A 4KHPL 4G7OC 1EEFD 1E22A 4A93B 1GD7A 1T9HA 1QILA 2YTXA 3CRKC 3PUZA 1HR0Q 2AHOB 1EY6A 3AFPA 3W5OA 4DV5Q 4XIGS 1D5ZC 1NY4A 1ZKOA 2NZ1D 1SE3A 2E5LL 4J15A 2JK8A 4UP9A 2Z6BA 1O80A 2F0GA 2IWHA 3PF5A 5IGGA 3K5MA 1K8MA 2BDNA 1TIID 2SOBA 2CKZB 1BQQT 4C2MH 4A3GG 2F0JA 4BY7B 3TREA 1F9QA 2N78A 3A74A 2B2UC 1B70B 1L2FA 5ELNA 3ER0A 4CJ2C 3UE1A 2F0QA 4DV4L 3KUPA 3HOWB 4HCEA 1EYCA 1O7LA 3R93A 3GTOB 3OOCA 1U4LA 4CDDC 4GN3B 2AMCB 1S5FD 3F2CA 2KEEA 3CU7A 1VQ6A 2LXJA 2Z9HA 3H94A 3KF6B 1Q7YC 3PO2H 3CCMA 2JA7B 5C5LA 1HNXL 1KRTA 4QY7A 3D8GA 4ME5A 5C4XG 2XGTA 2M00A 2RHQB 2CQOA 4P74A 1GUGA 2M2LA 1ENCA 1UEBA 1WCMG 3ZJYC 3Q0AA 5JAVA 3S1NB 2K6AA 5JJLA 4ALPA 4A3IB 3SXHA 4IPDA 3M4PA 4BY1G 4JI7Q 4RCNA 1GM5A 1EYDA 1CM9A 5IYDH 3DEOA 2RDFA 1X3PA 1SXTA 1PYSB 1X65A 3KF8A 1NCVA 3JAML 1SDFA 1VQJA 3DHQA 1YBYA 2RBMA 2MQHA 1XMOQ 4DV7L 4MHEA 2R92G 2XSCA 1RCVD 1PRTC 2DUDA 1K73C 3W3AA 1TWCH 4TQUS 2EOTA 4LWCA 2LY7A 2RCNA 2Y0SB 2F0OA 4OIJA 4WJ3M 1GO3E 1F77A 3OPOA 3AU7A 2V4DA 1YI2A 4OO1H 1VQGA 3J7ZC 1JWMD 1R4PB 2K1BA 4KMUC 3J81L 2MGSA 2NB0A 1IBLL 1HPCA 4JI8L 3WOFA 4DV6L 2E2JH 1LTLA 2C5CA 3PUWA 4C2MB 2VB3X 1VQOA 4HR7B 5HY6A 3A8IE 2ASBA 4KHPQ 5C5MA 1V8QA 2K04A 1SMYD 1VQHA 1Q86C 2UXCQ 2IY5B 3M4YA 4YIJA 1KAAA 1TWGB 2LSSA 2HDLA 1U4MA 3M9BA 5ELCA 3QO2A 1I94L 3S1QH 2YU9H 4A3FH 2CH4A 2E5LQ 3FKIB 2A73B 4C3HG 3CQZB 2E2HH 1RTNA 4C1NK 2RF4A 2PI2A 1A2TA 1VMCA 2UUAL 3KOJA 1WVLA 1C48A 2UXBL 4HSPA 4EX5A 3R2TA 1Y8PB 1VQAA 2EJGC 1ESFA 4LFBQ 3GTMH 4R9WA 1NTGA 1IYJB 4K2KA 4DV4Q 3RN2A 3UDIA 1Q81C 1HR0W 4S3SA 1BBWA 4GLVB 3TS0A 3CPFA 2PZTA 3A5ZB 1TT2A 3HOXG 3CCEA 2MO1A 1IKMA 3Q22A 2R7ZH 3KDFB 1WTQA 1E3PA 2JYOA 2HIVA 5I9PA 3BS1A 5IYBG 1P16A 4IZ8A 3S16H 1HNXQ 5LMNW 4WFN3 4KN7C 4BBSB 2H1EA 4QL5A 2B2TA 3PO3G 1Y1VH 2JA8H 3CCQA 4LAAA 1B50A 5M3FG 2FJ2A 2Q8TA 3ZYYX 4LJZC 1AEXA 3VYSA 3BDLA 2EE1A 1LABA 1L0WA 4G7HC 1GUOA 2F0WA 1HCZA 1D2BA 1OXTA 3I4NG 1E2WA 1MHWC 1ZYRD 2KHIA 4O0AA 4LF4L 4FO2A 4DU9A 3UDGA 1VQ5A 3H15A 2G5DA 3I3CA 2F0LA 3D6CA 3U9OA 2B2TC 4DF7A 2QKIC 4UPAA 4DXGA 1R9TH 3F2DA 2XWBB 2B39A 3KLWA 1F2MA 1XTDA 3M7GA 4TVAB 1YVCA 2I5HA 2EYOA 3W2DA 4QUFA 5M5WB 4LNQA 2E2HB 3HOYH 4LF7L 3HKZB 3EVQA 3NTIA 1IBLQ 4KKSA 4DV6Q 1NR2A 2ZM6Q 1AFPA 4A3KH 1VQFA 3GP7A 2A6ED 2XN9C 3IL8A 3STBD 4C3IH 4R4IA 4HIMA 3S1RB 3GTMB 2IX0A 2X6LA 4MNOA 3P7JA 2XTIA 3MXUA 4H44C 5IE8A 2ENBA 1KLGD 5J39A 4HJAA 1N33L 1TY0A 3BZDB 3RUZA 2IPKD 4Y7NB 3AEVA 2ZT9C 3TEHB 2R7ZB 2KECA 2RQXA 3OMGA 1WTHA 2Z6KA 2K5NA 2Z4IA 5E7NA 1D5XC 3L3OC 2KCNA 2UXBQ 2WAQE 4JBWA 3URYA 1W2BA 4MZ9A 4A3JG 2AWNA 5EBCA 3UI2A 1CA5A 3BVMA 1UWVA 4XQNA 3BDOA 2JP1A 2K75A 1VQDA 1G51A 4KV6A 4OWWB 3PO2G 3T53B 4DN4M 4V190 2ZTDA 1Y1VB 5CORA 4AQYQ 2EY5A 3G6EA 3Q8DA 4DV1L 4WJ4A 1TY2A 1XWEA 3QIAA 4CKEA 5I6YA 1WD1A 4A3BH 1JORA 2NYZD 1J8IA 5E1FA 1X3QA 4DAYA 5LHY1 1KQSA 4JI4L 4IUQA 1I3QH 4C3JH 3CCRA 1CFMA 1HNZQ 4LK1C 4ZUJA 4FF4A 5G3LD 4YHHL 2K5QA 2K5HA 4HTHA 3F2UA 4UHVA 5IGCA 2ZTCA 2Z6KC 4FYDA 1SYEA 1Y1WB 3AFQA 2A5HA 1EFID 3LWEA 1DD2A 1E7ZA 4HMIA 1JMCA 3S1MH 1G6ZA 1LTRD 2I5LX 1Q82C 2WKDA 2BH8A 1PRTB 4HSVA 2DY8A 3BVGA 3PGZA 1S5CD 4KK7A 3J80L 4LF9L 1F9PA 5KNBA 4B3ML 4FDBA 5AJ3Q 3RZDB 4ZYSA 4AYBB 4PQXA 4JG2A 3PIOA 1HTPA 2MP1A 2JA5B 3HOYB 2WAQG 3F2BA 3PCOB 2Z0SA 2VUMH 2EZVA 3DXJC 4BBRB 3ONAB 3I55A 2DJFC 3KF8B 1HQRD 1E24A 3MEHA 5FLMH 1GOZA 4P72A 3T1HL 4DNRB 4DUZL 4OO1G 3CPWA 4BS9A 4LF4Q 2A69D 4A3KB 1WFQA 3HZXA 5DNFA 2RSOA 5DEHA 4A3DB 4UY8C 4HMJA 3TP7A 2KHSA 3S9WA 4JI6Q 1Q1BA 2D2CC 3AMUA 2B2VC 2I46A 1F2YA 3BG3A 3C2PA 2JN4A 3KYHC 4LF7Q 5EKIA 3KBGA 4A3FG 1VF7A 2XVSA 2M9VA 4DA2A 1G2TA 5E4WC 3M4OH 1IW7C 2WB1B 4QJFA 1SFOH 1YITA 3HKSA 1QOHA 4YWMA 4A3MG 2JA6G 2F3IA 1VQPA 4KD3A 1EIGA 5M5YH 2HCCA 2Q2TA 4ZLTF 3FP9A 2VNUD 4JCVE 4KD4A 1PDQA 5C3EH 2E74C 3H91A 1WTWA 2PNHA 4JI3L 2ICIA 1DZ1A 3HOZG 3I4OA 1TWHB 4L8JA 1A3TA 1CK1A 1N33Q 2DY7A 5M5XB 3CCJA 3KLRA 3CC2A 1Q90A 3NENA 4ZAIA 3I70A 5T1GA 1HZBA 3MEFA 2RVLA 1BOSA 3N52A 1H9MA 2KCCA 4NXNL 4DR1Q 1IL2A 2E2IB 3P20A 1SN8A 3S1MB 2A74C 1H9RA 1M8AA 2EYPA 3MXGA 4DV1Q 4A3CH 3NTHA 3GDEA 4IFDH 4JI4Q 1YNXA 1TWFH 2CQAA 4POFA 5FK9C 2JA8G 2UXDQ 4FF1A 1WJJA 5CV6A 1AE3A 5LL6X 2K5WA 5EGTA 4X64L 2VUMB 1EQTA 2PZUA 5D14A 3MA2B 2B63G 4E6IA 1LTAD 3I73A 3GTKH 1S72A 2K14A 1HFNA 1SBBB 2XRSD 1TS3A 3L0OA 3QOJA 4Q0FA 2WACA 2RKSA 1FNVA 2DJGC 4IUNA 5C4JB 2VW9A 1U5KA 2N49A 4GOPA 3IKJA 4B3MQ 3J7A5 1C8CA 3SDZA 3KLSX 2XIWA 4KKUA 5JVH3 4A93H 4A3LH 3E9IA 3D4RA 4FF3A 1SNOA 2YYZA 4V0BA 4MTNA 2Q8RE 4PMCA 4K0KL 3M4OB 3T1HQ 4DUZQ 3CKIB 1EOVA 5C4ZA 3VR6A 1EOTA 1FJGQ 1PRTD 2D5DA 5M5YB 1JT8A 5ELDA 3OTOQ 3SE0A 3OMCA 4DAPA 2VQFL 5KNDA 4CJ0B 1KD1C 5M9OA 3TZDA 4BY7H 1I50H 2NN6G 2LMCB 3P1HA 1G8ZD 1YHBA 1OXVA 1SNPA 1WI5A 5M3MH 2KQ3A 2ICEC 3GTOH 5HGTA 3CC7A 4DR7Q 5C4XB 2PMZE 1GUSA 2K05A 1I4QA 4EGVA 1X6OA 4LF6L 3O13A 3TQYA 2R6GA 1S5ED 5IOCA 4N9PA 4U673 1KIXA 4QIWE 2DN8A 1BXTA 5DAUA 5LMUL 5C44H 3A54A 3GO5A 1JCKB 2F0MA 4UP7A 1IHZA 4A3BG 3T4AC 2R7FA 2A1AA 4HIDA 1HNWQ 2QF7A 4O42A 2OF1A 1JJ2A 3ULLA 3H6MA 2ZJQA 4C3JG 4OWTB 4A3IH 1PH7A 1JOQA 1HFGA 2WKCA 5KYLA 5JEAG 1FYCA 1YJ9A 4ZUIA 1Z9FA 4DK6C 4DR2Q 1SE4A 2PQEA 4O1NA 3QWNA 3H0GB 4L5TA 4PZ6A 4FVMA 4DAYB 5D3IB 4HIKA 1SYCA 1M4VA 4Q5VA 4RGNA 1RD9D 1STBA 2F0HA 4DR7L 4RGTA 1BCPF 1JB7A 2AUJD 5E3FA 3AB9A 1EY5A 3HOVG 2D9UA 1YJNA 2IL8A 5A2QL 3A8JE 3EROA 5I2YA 1W3SA 3VYRA 4JI5L 3VA7A 4TKOB 4I65A 3MHBA 2NVQH 1SNDA 1K8OA 1TKWB 2F0VA 1IBML 1B53A 2O2LD 2JE6I 4LMQD 5IWAL 1L1OA 3U58A 3P75A 1LACA 3S14B 3NHHA 2XNAC 5EJWA 1QVFA 4XYOA 5LMNQ 4RWSC 1I50B 2MUYA 4CKBA 2MPMA 1DM0B 5CBAE 1OTCA 2GA4B 1TWGH 3D31A 5M3MB 3DEPA 4K0KQ 3FEWX 2F0DA 1K83B 4JYAQ 3WDNA 4X3UA 1WTRA 3U4VA 1SYFA 3FKIH 3IFDA 3CQZH 3NK9A 3S2DH 1SROA 3KJPA 4R4OA 4RH6A 4IJHA 5FLXE 4OHJA 3TBIB 2F1MA 2VQFQ 1PTOF 3G7LA 3E9HA 3IRBA 5CV9A 3K5LA 4KN4C 5C44B 4IUVA 5C3EG 1C0AA 1L1OC 1EIFA 2RA4A 1Q8KA 3JC66 4GKKL 1EFWA 4DR4Q 2F4VL 1JICA 1RDPD 3I72A 3CCSA 5IGFA 2EPBA 4IPGA 1HXYD 5KEEA 1PH8A 3RMHA 1HUMA 1K8AC 3UDFA 1N36L 1GHJA 4LF6Q 1U4RA 1EQRA 1K3BC 1XTCD 3PUYA 1KABA 1B3QA 3GTJB 4JI0L 4N9TA 1A0IA 1ENFA 5LMUQ 2N55A 4BBSH 1PV4A 3MVVA 1VQ7A 1I6VC 3FMCA 4A3CG 2B2WA 4RGMA 4ZKBB 3DM1A 2EDGA 4C1NI 3CAMA 2NBFA 5K36H 4KY5A 4PZ7A 2UUCL 4KKTA 2CH4W 2D0OA 3RLOA 3FDTA 2FFKB 4WORA 3G4SA 4B3RL 1JC7A 4X65L 4NKLA 3H3VI 4JI1L 2NVQB 3DMUA 4B3SL 1TXYA 1I4HA 4HIOA 1PFBA 2AWOA 1EWCA 2K01A 1LT3D 4L5RC 3D4DA 3KBXA 4ODGA 1GHKA 1STYA 3HOUB 4IN3A 3B6YA 3BJUA 1K28A 1NSNS 2B2WC 5ELEA 5C4HA 1RF2D 2JXMB 1E2ZA 1V1QA 4A93G 2EYFA 1YEZA 4DV2L 3CRLC 3PUVA 2K32A 4JI5Q 4DAMA 1A3UA 4F88A 5M5WH 1D1KA 1CA6A 4DUYL 5IGEA 3S2DB 3EJIA 2JEAI 4G57A 2PQAB 1AE2A 2DNCA 3VYTA 5EKKA 4B9WA 4UDUC 3K80C 4IUUA 4A3EG 1V9PA 2F3WA 2WP8J 4OIKA 3S1RH 1ZXTA 2QW7A 1KXLA 1C4QA 3GTGB 2WV6D 1D7QA 1SE8A 4BY7G 4R1JA 4NB3A 2C35B 1H9SA 4H13C 4ULLA 1Q3LA 4BWGB 2FINB 1NMFA 4Y7NH 5COYA 3HOWG 4DK3C 3TP5A 1CSQA 3S2HB 4A76A 1HA6A 2JA9A 3HRZC 4CKCA 2A68C 3JAME 2Y0SE 1FD7D 2OWOA 1PYWD 4MN3A 4XXEA 2VY3A 2JA7G 1C9OA 1S5DD 1CKMA 4J8QA 1IW7D 4YY3L 2F4VQ 1QJOA 2K28A 4JVZA 4ZQ3A 4AH6A 1S5BD 1KTKA 4HJ8A 1PTOC 2ZXRA 5ELOA 1PMRA 2LFNA 2F52A 4A3IG 4L6TB 4M8AA 3OWEB 1HZ9A 3FVQA 1YHQA 2L0CA 3HG9A 1Y1WH 1DOMA 3D3RA 3D6WA 4DGZA 1QZGA 5JPNC 1Q8IA 2BA0A 2FHTA 4DV7Q 2HHHL 1RJTA 3MWYW 3VA5A 1EL0A 4A75A 4LUOA 1LT6D 1HZAA 4LUZA 2K5DA 2XWJB 1DXMA 1X3EA 4K14A 3U50C 4F8MA 1I6HB 4FXDA 1LTSD 2UUCQ 3BVZA 3RZDH 3QB3A 1MJCA 4I7AA 5JOBA 1D5MC 4X65Q 5ELBA 4OO1I 4JI1Q 2JA5H 1BKBA 1DOKA 2Y0SG 3DM3A 3PUXA 4B3SQ 4BBRH 1TWAB 3CC4A 2AUKA 1ENAA 1GJXA 1SYBA 4RKLA 4JI8Q 4Y52H 2A6HC 1EU4A 3LNNA 1ILPA 4QB4A 5FOBB 1WTVA 4ID6A 3J81j 5JEAJ 2OXPA 2EJFC 2H4OA 1UE5A 4A3DH 3HGBA 2MHVA 1QUQA 1EY4A 3LWUA 4JOIA 2EY1A 4DKAC 3RZOH 1I94Q 4DV2Q 3C1FA 2I0QA 2F0TA 2IX1A 4IPHA 4CDEC 5FO7B 4DUYQ 4KHVA 3UDXA 3OWFA 1XYIA 2CW0C 4Z9CB 2UUAQ 1FGBD 3FKIG 5IODA 3MTSA 4DK0A 2AKWB 3ERQA 3SVMA 3MXPA 2KUMA 5EPJA 1L1OB 2G9DA 4N8X1 5DM63 3J7AV 1O7IA 3BYYB 4UAIA 3DLLA 4LW1A 1PH9A 4RA8A 2QCPX 1YNJC 1H9JA 4JI2L 4NPSA 1LT4D 2BH2A 1UEAB 1IYUA 2HQEA 5KGUA 1Y8NB 1V1OA 1VQCA 2LKVA 1TWHH 2VB2X 5M5XH 4JOIC 1VCIA 1VDZA 5BR8L 1CTMA 1SSOA 2L4NA 3OSOA 1Z47A 5KRUA 3DWQA 5GAEC 2I5MX 5CGKA 1E0BA 1QCBD 2BE5C 2KCTA 3ERSX 4XQQA 1CZWA 5IYDG 2E2IH 1HH2P 3MAQA 3RR5A 4CDFC 4KJOA 1PFMA 3G48A 4X3TA 2OTLA 3HKZE 2R7DA 5DLQE 4YY3Q 1EY8A 1STHA 4BBSG 3R8BA 1F9SA 3NEMA 1N32L 3DUZA 1JJCB 1K0SA 4BXXH 4IALA 3GTQB 2HUGA 1X32A 3I91A 2L5TA 1SMYC 3AQQA 1JE5A 1HQMC 1LTTD 1GXDC 3VR5A 1PH4A 4B3TL 5K36G 4IUPA 3I4MB 5C0XH 1B2TA 2IHEA 4CHTB 2BCOA 1AW7A 1LUZA 5IT9L 1Q12A 2EY2A 3KK7A 1L0XB 3K59A 3E3XA 4IOCA 4PMWA 3SK6A 5C4JH 5EBDA 2J4XA 1LV9A 3GTPB 2SDFA 4A4IA 2PW5A 3JAMi 3RZOB 1SYGA 2ID0A 1O7YA 5G3LF 3F1ZA 1ESRA 4JBMA 1BBXC 1AZQA 4JBKA 3K8AA 1BUVT 3IFTA 3KLSA 1BCPB 2EIFA 2WINB 4JC0A 4XT3B 1N34L 2F0IA 1B9NA 1VQ8A 3VDYA 4YCVA 2QDBA 1OXUA 3HKZG 4QMGA 1NNXA 3IAYA 2D62A 1PYBA 4CBVA 4K5WA 3C1EA 1LO5D 1CZGA 3PIP3 4KLKA 2NN6I 5KNCA 4EQ5A 4R8NA 1I4PA 3K57A 5IP9H 1UE1A 1B44D 2KBNA 3TMEA 4NP5A 1CHQD 4B9XA 2QEXA 1STEA 1GUWA 4CJ1B 4RFBA 2PO4A 1EU3A 1NMGA 1A8VA 2R7ZG 5C4XH 2R93B 4AYBE 4F87A 2Z4HA 1VQBA 3ND9A 2CWAA 1QVGA 1DCZA 1S40A 1TQOA 4NW2A 1XPOA 2KVMA 2MO0A 2J7ZA 2X6GA 3J80E 1HZCA 1W6JA 1K8GA 1PTOB 3CMAA 4BY1H 1Y1VG 5JPMC 1F2ZA 1K0RA 2VXWA 4FXGC 3OYYA 3RN5A 1CHPD 1II3A 2NVXB 1VQ4A 2FMMA 1EUJA 2EJMA 3CF5A 4YHHQ 3X3NA 1MBYA 5IGBA 3C3LA 1HTLD 1KHIA 3H3VC 1NBWA 2KJXA 1O7ZA 2R92H 2EQSA 2NTTA 1D1IA 1LT5D 1Y1WG 2X69A 1LLRD 3HOVB 1VQIA 4LF5L 5I6WA 1LYLA 4YCWA 5J22A 4LF9Q 1N32Q 2WB1E 3H0GH 1FNUA 1LTBD 1B4OA 4DFAA 1KLUD 4B3TQ 2F0PA 1ASYA 1GVPA 1MI2A 2UU9L 1VQNA 2N8NA 4RGOS 4AYBG 1LM0A 4I7ZC 1UUPA 1U4PA 4UP8A 4A3GB 2JA5G 3Q6SA 3HOYG 3OIQA 3I4LA 2F4IA 1A63A 4BBRG 3TN2A 1BF4A 4ZK9B 4JK1C 1J5EL 3A7LA 2BA1A 1DYQA 2PCFB 4A3KG 1VQMA 3S14H 4C3IG 4GOPC 2B29A 1VQEA 5IGDA 3D4WA 3H09A 4DAVA 4L5QA 1ML0D 3G71A 1N9WA 3MFGA 3T13A 2Q2IA 5CV8A 2RCFA 4DXFA 1AH9A 2K33A 1K83H 2F3VA 2EYJA 4JW0A 3K7UC 5CR3A 4TRDA 3M4QA 5J3BA 4XYQA 4APVA 1PZID 2N88A 4DPGA 2DGYA 4GZYC 5IP7H 2WB1G 4QGUA 1WCMB 3QOLA 5K5PA 3L9AX 2E2DC 4JI3Q 1JWSD 2C9OA 2K52A 4R8IA 4IURA 3PF4A 1QUQB 4U68A 4CDCC 4BY1B 1JJGA 5FO9B 1IZ6A 1A2UA 1JE4A 1PFNA 4PZ8A 2NTSA 1PA6A 2O4XA 4DNTB 1CT1D 1EYAA 4XTCS 3RNUA 4L5SA 2NWGA 5IYBH 1SNQA 1ICFB 3K0XA 4NXNQ 2BDOA 3PO3H 2R92B 1ONLA 2OEOA 4FP5D 1XMOL 4X66L 1H9KA 3PV0A 3GTJH 3MXNA 3W1BA 3SK4A 4YWKA 2RHSB 1CKNA 1EY9A 1YHAA 2L12A 4H0LC 4JV5L 4L63B 2EYMA 1SE2A 3LGJA 3Q23A 4GN4B 5EPKA 5C3XA 2A68D 1PH1A 2EYLA 2WIIB 3CCVA 4X64Q 1WTOA 3OW7A 2QA4A 1PVOA 2O5IC 2YV5A 5C0XG 2VUMG 3CXCA 3EA6A 5FLMG 1ET6A 1G291 4N8FA 1H95A 1AP0A 4ZCKA 3CHBD 2F0EA 4ME3A 1MJEA 1I5FA 4LF5Q 1PTOD 1NUCA 3I8ZA 4G7ZC 3G6JB 3PQIA 2SNSA 5I2XA 2UXCL 1WYDA 3HFZB 5D65A 4HN7A 1RL2A 1LTID 4C3HB 3SK8A 3HOUH 1ILQA 2UU9Q 1XNQL 1O78A 2TMPA 2MNAA 4X62L 1BNZA 2E75C 3J80i 5A35A 4A3EB 3RD4A 1KDBA 1QVCA 1UNSA 1V1PA 5CBEE 2AQ3B 2NUCA 2QEJC 4DR3L 3S17B 1CQVA 2EYHA 1J5EQ 1ASZA 2H5XA 1EYGA 4ZRZA 3BU2A 1KDAA 5ISRA 4LFBL 3WOEA 4DV0L 4IPCA 4XQJA 3HOXB 1NJIC 2D0PA 4HJ9A 4FXKC 3R2IA 2F0FA 1KRSA 5IP9G 2LS01 2A6HD 4PV1C 3SGIA 3GTGH 2Z1CA 1Z7TA 1T5EA 4A3JH 3ULPA 1IL8A 1PFSA 3KFUA 4RHRA 3PO3B 3NBIA 1G2SA 3SK5A 1MSHA 1JWUD 3S2HH 3EN2A 3EIVA 1MSGA 1P8LA 1SMXA 2ZXPA 5M3FB 1CSPA 1OXXK 2G9HD 1A3VA 4ILWA 5D3DA 2IX3A 1WD0A 2QDLA 2CW0D 2B2YA 4IFDG 5C6AA 1U0LA 1VS0A 4K5VA 2RDGA 1V43A 3I4NB 4EQOA 1HHVA 4KJNA 3E0JA 5A2QE 1F2LA 2K03A 5KIXA 3NQIA 3ND8A 1YNJD 1FNWA 3VR3A 1T5XD 3QR8A 4DR6L 3K0YA 3EFXD 2AQ2B 1SNMA 4WJWA 4WRDA 1QE6A 1XNRL 4IUTA 1EWHA 4F7XA 4IJLA 2OQKA 3U4ZA 4X66Q 2ZXOA 2RSNA 4KY6A 5BN3A 3K5NA 3NBHA 1S4ZA 5HURA 2QGQA 1X54A 1OXSC 4JV5Q 1IXRA 3GV6A 2BOSA 4GNXA 3H0GG 5CV7A 2BE5D 4QCLA 2L9HA 1GUTA 1KDCA 2B2YC 4QUCA 1I6HH 1TR5A 4A3LG 3OHXC 3RLNA 2KCMA 3E0EA 4KHZA 2ZM6L 3CD6A 3TRZA 2F0SA 2IHFA 3ITPA 2QILA 1TWAH 1IBMQ 1I4XA 1BCPC 5IWAQ 3TP6A 5FLXc 1YNNC 4R4CA 3TSSA 3DWAA 4GOPB 1XPUA 4O2DA 1UAPA 2CVRA 1YZ6A 3VR2A 4OELB 4GNXC 1D6EC 4LF8L 4K8JA 1XNQQ 4X62Q 4A3JB 3HS0C 4EQNA 5DM73 4A3MH 2F0KA 2JA6H 1B1ZA 1UE7A 1F9RA 5GROA 5JJIA 2ALYB 3PO2B 5M3MG 4K6DA 4DR3Q 2JQOA 5H1SE 5GQOA 4OX9L 1QG7A 3NP8A 5JJZA 3HOZH 4NDXA 2IT1A 4X3SA 5GAHC 2OT2A 4AQYL 4K6LA 5IP7G 4DV0Q 5IY0A 4KY7A 2K50A 4IOAA 4GKKQ 5C44G 5LL6S 1XMQL 4K2LA 4LFCL 1UE6A 5EKLA 3T56B 4GS3A 1HNZL 2NVYH 3C46A 1DGSA 2L15A 1N36Q 4XT1B 4DV3L 3CW2C 2DNEA 2IW3A 4FF2A 3T16A 3DWPA 3BYTB 1Y69U 3MZ5A 3TDQA 3J81E 4JI0Q 1X56A 5BN4A 2V1CC 5AFWA 3OIPA 2EXDA 1TWCB 4YCUA 1KC8C 2WAQB 2PW7A 1DJRD 2ZJPA 4IQZA 1VF5C 5AJ3L 3VYUA 2R3ZA 1JQYD 1VQ9A 2B63H 1MD2D 3NUCA 1XPRA 3GTQH 1U9RA 1NR4A 1KNEA 2TSSA 1SEBD 4B3RQ 1SNCA 3CCLA 4DR6Q 5GAGC 1YIJA 4CGYB 2E2JB 1XNRQ 3I4MH 4MIUA 3N6RA 1JOKA 3AYHB 3MXNB 5IYCH 2NVTH 4BA2I 4RCOA 2PZWA 1WOCA 1CKNB 1ET9A 1XX8A 3V05A 1RHPA 4JI6L 3S1QB 1A62A 3VR4A 5T1IA 2YU9B 1Z6HA 4A3FB 2CHBD 4X6AH 3A0JA 3GTPH 5J1ZA 1TS5A 3HOUG 4A3MB 3NWTA 3NPPA 2JA6B 3NXWA 2JEBI 1IBKL 1R4QB 4GKJL 4FNFA 3ICEA 1STGA 3UE0A 2JSOA 1B3AA 5BN5A 1GUNA 1Q1EA 1RKNA 1TU2B 1M1KC 5CV4A 3HOZB 1HUNA 1PZJD 1TS4A 1BR9A 1VQLA 1A15A 2VS1A 1J9OA 3D0FA 1W6KA 3JAMc 2NN6H 2K7VA 1X9NA 1EY7A 5C0XJ 5F2DA 4LF8Q 3FRPB 1A6XA 4PMBA 1QNKA 2CWPA 3LX0A 2NVYB 4P71A 3NSWA 1ZEQX 2IJ0A 1V1PB 3S16B 4OX9Q 4DR1L 1PH2A 3J7AF 1Y8OB 1KL9A 2HCIA 1STNA 1XXGA 1RIPA 3NTKA 5FJ8H 1HJPA 1AN8A 2R93H 3J81c 3NE5B 1BVSA 3U9SA 2VZAA 5NUCA 2JA8B 3CP0A 4LFAL 1D8LA 1I4RA 5C3WA 2LXKA 2ATWA 3L7ZC 3EBEA 1XJVA 4DNIA 2UXDL 1BO0A 3A7AB 1XMQQ 4IO9A 3V2TA 2B63B 4LFCQ 1QWYA 5JEAH 1PTOH 4EVOA 4DR5L 2NZOA 3MFYA 3GTLH 2HIXA 3PIO3 4DV3Q 1FL0A 2VL6A 1HRJA 2NVXH 4OGQC 1SR3A 4XDXA 3K58A 1JB3A 2L1BA 2YTVA 1FR3A 1NAPA 3E6ZX 4KI0A 1QZHA 2NVTB 3HP3A 2E76C 1BBUA 2J0TD 5L37A 1R9TB 2HHHQ 1TS2A 4GLXA 1LTGD 2B2VA 1L0YB 1YJWA 2CCZA 4MTKA 2K5VA 3HOVH 3K7AH 4P73A 2Q2UA 5IIFA 2B3GA 5CV5A 1OO9B 4QF4A 4HEDA 2OTJA 2K4KA 3Q24A 2L11A 1FJGL 2A8VA 4IFDJ 4C3IB 3OTOL 4A3GH 3NELA 3NWSA 3TP8A 3KF6A 3NBHB 3K5OA 2OQ0A 1QNUA 3TZUA 4GN5A 5ELFA 3M7NA 2Q2HA 4QQBX 4OXPA 4GNXB 1GKHA 3K81C 4G4KA 5CMDA 3F8TA 1E1TA 3J81i 2CFMA 1SJED 4KTAA 4PNYA 1VQKA 1C7YA 4JPBW 4ZKCB 1IBKQ 5EPLA 5I9OA 4GKJQ 1SAPA 1ICWA 3S24A 1EZ6A 2B8GA 4K5XA
chains in the Genus database with same CATH topology
3SHLA 4BA1I 3K6OA 5JVG3 3SEBA 1BDOA 4A3BB 2XRQD 3QJYA 4X3KA 2FMCA 1I3QB 1EY0A 1ZYRC 4C3JB 2SEBD 2F03A 1IKLA 1H9SB 1TVXA 3FPUB 1RTOA 2EXZA 3GTLB 3PMFA 3BDCA 3QG1A 2RDHA 5IT9E 1JOOA 3EQLC 3X3MA 4NMZA 2F0UA 1EQVA 1SYDA 2F0NA 2PYKA 2PMZB 2HDMA 3K7AB 4HCSA 4P2CB 4DK1A 1WTPA 3GD7A 1WTXA 1AZPA 2A6EC 4TSSA 4C56C 4QIWB 1G91A 1DONA 5C0XI 2PPBC 3T51B 3FPPA 1IYVA 3GQBA 5KYIA 2R61A 2B8FA 1QB5D 3RLFA 1EEID 4B08A 2L55A 5EQ0A 1EZ8A 3HEJA 1PZKD 3V96A 4H7BA 1SFOB 4RAUC 3GV3A 1JR0D 5C3EB 3E5SA 5E4XA 4M1UB 2KA7A 3M3YB 4OL7A 4J1MA 1MGSA 1SJHD 1DOLA 1PLFA 3A8KE 4HAEA 5FO8B 2AQ1B 2MJ8A 1HA5A 1BCPD 4K8IA 3A55A 1EIHA 5TSSA 5CC4A 1KNAA 4RKBA 1YNND 3I90A 1CI3M 1PRTF 2I07B 3M85A 3J7YW 2Q8IB 1CQFA 1RODA 5FLXL 4EQPA 4ABNA 2EVBA 3R3OA 2O5JC 1E2VA 1TWFB 1I4GA 4J6HA 3S15B 4IFDI 5CYUA 2A69C 1PXUA 1B9MA 4RHSA 5FKAC 5I4DA 3GTKB 2EY6A 1VMPA 2SNMA 3NQTA 1STAA 3SR1A 2KEDA 3MC0B 2KOLA 2B2UA 2Z8LA 3A56A 2PNRC 4G7OC 1EEFD 4A93B 1QILA 3CRKC 3PUZA 1EY6A 4XIGS 1D5ZC 1ZKOA 2NZ1D 1SE3A 1O80A 2F0GA 2IWHA 5IGGA 3K5MA 1K8MA 2BDNA 1TIID 2SOBA 1BQQT 2F0JA 4BY7B 1F9QA 2B2UC 4CJ2C 2F0QA 3KUPA 3HOWB 4HCEA 1EYCA 1O7LA 3R93A 3GTOB 3OOCA 1U4LA 1S5FD 2KEEA 3CU7A 3H94A 2JA7B 5C5LA 3D8GA 4ME5A 2M00A 1GUGA 2M2LA 1ENCA 3Q0AA 5JAVA 3S1NB 2K6AA 4A3IB 3SXHA 4RCNA 1EYDA 1CM9A 3DEOA 2RDFA 1X3PA 1SXTA 3KF8A 1NCVA 3JAML 1SDFA 3DHQA 2RBMA 4MHEA 2XSCA 1RCVD 1PRTC 3W3AA 4TQUS 2EOTA 2LY7A 2Y0SB 2F0OA 4OIJA 1F77A 3OPOA 3AU7A 2V4DA 4OO1H 1JWMD 1R4PB 2K1BA 4KMUC 3J81L 2MGSA 2NB0A 1HPCA 3WOFA 2C5CA 4C2MB 3PUWA 2VB3X 4HR7B 3A8IE 5C5MA 1V8QA 2K04A 1SMYD 3M4YA 4YIJA 1KAAA 1TWGB 2HDLA 2B8GA 1U4MA 5ELCA 3QO2A 3FKIB 2A73B 4C3HG 3CQZB 1RTNA 4C1NK 1A2TA 1VMCA 1WVLA 1C48A 4HSPA 3R2TA 1Y8PB 2EJGC 1ESFA 4R9WA 4K2KA 4S3SA 2PZTA 1TT2A 1IKMA 3Q22A 1WTQA 2JYOA 5I9PA 3BS1A 4IZ8A 4WFN3 4KN7C 4BBSB 2H1EA 2B2TA 4LAAA 1B50A 2FJ2A 2Q8TA 3ZYYX 4LJZC 1AEXA 3VYSA 3BDLA 2EE1A 1LABA 4G7HC 1GUOA 2F0WA 1HCZA 1D2BA 1OXTA 1E2WA 1ZYRD 4FO2A 4DU9A 3I3CA 2F0LA 3D6CA 3U9OA 2B2TC 4DF7A 2QKIC 4DXGA 2XWBB 2B39A 1F2MA 3M7GA 2EYOA 3W2DA 4QUFA 5M5WB 2E2HB 3HKZB 3EVQA 3NTIA 4KKSA 1NR2A 1AFPA 3GP7A 2A6ED 2XN9C 3IL8A 3GTMB 3S1RB 2IX0A 2X6LA 3P7JA 3MXUA 4H44C 2ENBA 1KLGD 5J39A 1TY0A 3BZDB 3RUZA 2IPKD 4Y7NB 2ZT9C 2R7ZB 2KECA 2RQXA 3OMGA 2Z4IA 1D5XC 3L3OC 2KCNA 4JBWA 3URYA 2AWNA 5EBCA 3UI2A 1CA5A 3BVMA 4XQNA 3BDOA 2JP1A 4KV6A 3T53B 4DN4M 4V190 1Y1VB 5CORA 2EY5A 1TY2A 1XWEA 3QIAA 4CKEA 5I6YA 1WD1A 1JORA 2NYZD 1J8IA 5E1FA 1X3QA 4DAYA 5LHY1 4IUQA 1CFMA 4LK1C 4ZUJA 4FF4A 5G3LD 2K5QA 4HTHA 3F2UA 5IGCA 4FYDA 1SYEA 1Y1WB 2A5HA 1EFID 3LWEA 1DD2A 4HMIA 1G6ZA 1LTRD 2WKDA 1PRTB 4HSVA 2DY8A 3BVGA 1S5CD 4KK7A 3J80L 1F9PA 5KNBA 3RZDB 4ZYSA 4AYBB 4PQXA 1HTPA 2MP1A 2JA5B 3HOYB 2EZVA 3DXJC 4BBRB 3ONAB 1HQRD 3MEHA 1GOZA 4DNRB 4OO1G 4BS9A 2A69D 4A3KB 3HZXA 5DNFA 2RSOA 5DEHA 4A3DB 4HMJA 3TP7A 2KHSA 3S9WA 1Q1BA 2D2CC 3AMUA 2B2VC 2I46A 1F2YA 3BG3A 3C2PA 5EKIA 3KBGA 1VF7A 2XVSA 2M9VA 4DA2A 1G2TA 5E4WC 1IW7C 2WB1B 1QOHA 4KD3A 1EIGA 2HCCA 4ZLTF 2VNUD 4KD4A 1PDQA 2E74C 3H91A 1WTWA 2ICIA 1DZ1A 1TWHB 4L8JA 1A3TA 1CK1A 2DY7A 5M5XB 3KLRA 1Q90A 4ZAIA 3I70A 5T1GA 2RVLA 1BOSA 3N52A 1H9MA 2KCCA 2E2IB 3P20A 3S1MB 2A74C 1H9RA 1M8AA 2EYPA 3MXGA 3NTHA 4IFDH 2CQAA 5FK9C 4FF1A 5CV6A 5LL6X 2K5WA 5EGTA 2VUMB 1EQTA 2PZUA 5D14A 3MA2B 4E6IA 1LTAD 3I73A 1HFNA 1SBBB 2XRSD 1TS3A 3QOJA 4Q0FA 2WACA 2RKSA 1FNVA 4IUNA 5C4JB 3IKJA 1C8CA 3SDZA 3KLSX 2XIWA 4KKUA 5JVH3 3D4RA 4FF3A 1SNOA 2YYZA 4V0BA 2Q8RE 4PMCA 3M4OB 3CKIB 5C4ZA 3VR6A 1EOTA 1PRTD 2D5DA 5M5YB 5ELDA 3SE0A 3OMCA 4DAPA 5KNDA 4CJ0B 5M9OA 3TZDA 2NN6G 2LMCB 3P1HA 1G8ZD 1OXVA 1SNPA 2KQ3A 2ICEC 5HGTA 5C4XB 1GUSA 2K05A 1I4QA 4EGVA 3O13A 2R6GA 1S5ED 5IOCA 4N9PA 4U673 2DN8A 1BXTA 5DAUA 3A54A 3GO5A 1JCKB 2F0MA 1IHZA 3T4AC 2QF7A 4O42A 2OF1A 3H6MA 4C3JG 1JOQA 1HFGA 2WKCA 5KYLA 5JEAG 1FYCA 4ZUIA 1SE4A 2PQEA 4O1NA 3QWNA 3H0GB 4FVMA 5D3IB 1SYCA 1M4VA 4Q5VA 4RGNA 1RD9D 1STBA 2F0HA 4RGTA 1BCPF 2AUJD 5E3FA 3AB9A 1EY5A 2D9UA 2IL8A 5A2QL 3A8JE 3EROA 5I2YA 3VYRA 3VA7A 4TKOB 4I65A 3MHBA 1SNDA 1K8OA 1TKWB 2F0VA 1B53A 2O2LD 2JE6I 4LMQD 3P75A 1LACA 3S14B 3NHHA 2XNAC 5EJWA 4XYOA 4RWSC 1I50B 2MUYA 4CKBA 2MPMA 1DM0B 5CBAE 2GA4B 3D31A 5M3MB 3DEPA 3FEWX 2F0DA 1K83B 3WDNA 4X3UA 1WTRA 1SYFA 3IFDA 3NK9A 4RH6A 5FLXE 4OHJA 3TBIB 2F1MA 1PTOF 3G7LA 5CV9A 3K5LA 4KN4C 5C44B 4IUVA 2RA4A 1JICA 1RDPD 3I72A 5IGFA 2EPBA 1HXYD 5KEEA 3RMHA 1HUMA 1GHJA 1U4RA 1XTCD 3PUYA 1KABA 3GTJB 4N9TA 1ENFA 2N55A 3MVVA 1I6VC 3FMCA 2B2WA 4RGMA 4ZKBB 3DM1A 2EDGA 4C1NI 2NBFA 5K36H 4KY5A 4KKTA 3FDTA 4WORA 2FFKB 1JC7A 4NKLA 2NVQB 3DMUA 1I4HA 1PFBA 2AWOA 1EWCA 2K01A 1LT3D 3D4DA 3KBXA 4ODGA 1GHKA 1STYA 3HOUB 4IN3A 1NSNS 2B2WC 5ELEA 5C4HA 1RF2D 2JXMB 1E2ZA 2EYFA 3CRLC 3PUVA 2K32A 1A3UA 4F88A 1D1KA 1CA6A 3S2DB 5IGEA 3EJIA 2JEAI 4G57A 2DNCA 3VYTA 5EKKA 4B9WA 4UDUC 4IUUA 2WP8J 2F3WA 4OIKA 1ZXTA 1C4QA 3GTGB 2WV6D 1H9SA 4H13C 4ULLA 1Q3LA 4BWGB 2FINB 5COYA 3TP5A 3S2HB 1HA6A 3HRZC 4CKCA 2A68C 3JAME 1FD7D 1PYWD 4MN3A 4XXEA 1S5DD 4J8QA 1IW7D 1QJOA 2K28A 4ZQ3A 1S5BD 1KTKA 1PTOC 2ZXRA 1PMRA 2LFNA 4L6TB 4M8AA 3OWEB 3FVQA 2L0CA 3HG9A 1DOMA 3D3RA 3D6WA 4DGZA 5JPNC 1Q8IA 2BA0A 2FHTA 1RJTA 3MWYW 3VA5A 1EL0A 1LT6D 2K5DA 2XWJB 1DXMA 4K14A 4F8MA 1I6HB 4FXDA 1LTSD 3BVZA 3QB3A 5JOBA 1D5MC 5ELBA 4OO1I 1DOKA 3PUXA 1TWAB 1GJXA 2AUKA 1ENAA 1SYBA 4RKLA 2A6HC 1EU4A 3LNNA 1ILPA 4QB4A 5FOBB 1WTVA 4ID6A 5JEAJ 2OXPA 2EJFC 2H4OA 3HGBA 2MHVA 1EY4A 3LWUA 2EY1A 3C1FA 2F0TA 2IX1A 5FO7B 4KHVA 3OWFA 1XYIA 2CW0C 4Z9CB 1FGBD 5IODA 3MTSA 4DK0A 3ERQA 3SVMA 3MXPA 2KUMA 5EPJA 2G9DA 5DM63 3J7AV 3BYYB 4UAIA 4RA8A 2QCPX 1YNJC 1H9JA 1LT4D 1UEAB 1IYUA 2HQEA 5KGUA 1Y8NB 1V1OA 2LKVA 2VB2X 1VCIA 1VDZA 1CTMA 1SSOA 2L4NA 3OSOA 1Z47A 5KRUA 3DWQA 5CGKA 1E0BA 1QCBD 2BE5C 4XQQA 1CZWA 3MAQA 4KJOA 1PFMA 4X3TA 1EY8A 1STHA 3R8BA 1F9SA 3DUZA 4IALA 3GTQB 2HUGA 1X32A 3I91A 2L5TA 1SMYC 1HQMC 1LTTD 1GXDC 3VR5A 5K36G 4IUPA 3I4MB 5C0XH 1B2TA 4CHTB 2BCOA 1AW7A 5IT9L 1Q12A 2EY2A 3KK7A 1L0XB 3K59A 4PMWA 3SK6A 5EBDA 2J4XA 1LV9A 3GTPB 2SDFA 2PW5A 3RZOB 1SYGA 2ID0A 1O7YA 5G3LF 1ESRA 1BBXC 1AZQA 1BUVT 3IFTA 3KLSA 1BCPB 2WINB 4XT3B 2F0IA 1B9NA 2QDBA 1OXUA 4QMGA 3IAYA 2D62A 4CBVA 4K5WA 3C1EA 1LO5D 1CZGA 3PIP3 2NN6I 5KNCA 4R8NA 1I4PA 3K57A 1B44D 3TMEA 4NP5A 1CHQD 4B9XA 1STEA 1GUWA 4CJ1B 4RFBA 2PO4A 1EU3A 2R93B 4F87A 2Z4HA 3ND9A 1DCZA 1TQOA 4NW2A 2KVMA 2J7ZA 2X6GA 3J80E 1W6JA 1PTOB 5JPMC 1F2ZA 2VXWA 4FXGC 1CHPD 1II3A 2NVXB 2FMMA 2EJMA 3X3NA 1MBYA 5IGBA 3C3LA 1HTLD 3H3VC 2KJXA 1O7ZA 2NTTA 1D1IA 1LT5D 2X69A 1LLRD 3HOVB 5I6WA 5J22A 1FNUA 1LTBD 1B4OA 4DFAA 1KLUD 2F0PA 1MI2A 4RGOS 4I7ZC 1UUPA 1U4PA 4A3GB 3Q6SA 3OIQA 3I4LA 2F4IA 3TN2A 1BF4A 4ZK9B 4JK1C 3A7LA 2BA1A 1DYQA 2PCFB 4C3IG 5IGDA 3D4WA 3H09A 4DAVA 1ML0D 3MFGA 3T13A 5CV8A 4DXFA 2K33A 2F3VA 2EYJA 5CR3A 4TRDA 4XYQA 1PZID 2N88A 4GZYC 1WCMB 3QOLA 5K5PA 3L9AX 2E2DC 1JWSD 2C9OA 4R8IA 4IURA 4U68A 4BY1B 5FO9B 1A2UA 1JE4A 1PFNA 2NTSA 2O4XA 4DNTB 1CT1D 1EYAA 4XTCS 2NWGA 1SNQA 2BDOA 2R92B 1ONLA 2OEOA 4FP5D 1H9KA 3PV0A 3MXNA 3SK4A 1EY9A 2L12A 4H0LC 4L63B 2EYMA 1SE2A 3Q23A 5C3XA 5EPKA 2A68D 2EYLA 2WIIB 1WTOA 3OW7A 2O5IC 5C0XG 3EA6A 1ET6A 1G291 1AP0A 3CHBD 2F0EA 1PTOD 1NUCA 3I8ZA 4G7ZC 3G6JB 2SNSA 5I2XA 5D65A 4HN7A 1LTID 4C3HB 3SK8A 1ILQA 1O78A 2TMPA 1BNZA 2E75C 5A35A 4A3EB 3RD4A 1KDBA 1UNSA 1V1PA 5CBEE 2AQ3B 2NUCA 2QEJC 3S17B 1CQVA 2EYHA 4ZRZA 1KDAA 5ISRA 3WOEA 3HOXB 4XQJA 4FXKC 3R2IA 2F0FA 2LS01 2A6HD 4PV1C 2Z1CA 1Z7TA 1T5EA 1IL8A 4RHRA 3PO3B 3NBIA 1G2SA 3SK5A 1MSHA 1JWUD 1MSGA 2ZXPA 5M3FB 1OXXK 2G9HD 1A3VA 4ILWA 5D3DA 2IX3A 1WD0A 2CW0D 2B2YA 4IFDG 5C6AA 4K5VA 2RDGA 1V43A 3I4NB 4EQOA 1HHVA 4KJNA 3E0JA 5A2QE 1F2LA 2K03A 5KIXA 3NQIA 3ND8A 1YNJD 1FNWA 3VR3A 1T5XD 3K0YA 3EFXD 2AQ2B 1SNMA 4WJWA 4WRDA 1QE6A 4IUTA 1EWHA 4F7XA 2ZXOA 2RSNA 4KY6A 5BN3A 3K5NA 3NBHA 1S4ZA 5HURA 1OXSC 3GV6A 2BOSA 5CV7A 2BE5D 4QCLA 2L9HA 1GUTA 1KDCA 2B2YC 4QUCA 1TR5A 3OHXC 4KHZA 2F0SA 3ITPA 2QILA 1I4XA 1BCPC 3TP6A 1YNNC 3TSSA 3DWAA 1UAPA 2CVRA 3VR2A 1D6EC 4K8JA 4A3JB 3HS0C 4EQNA 5DM73 2F0KA 1B1ZA 1F9RA 3PO2B 4K6DA 1QG7A 3NP8A 5JJZA 4NDXA 2IT1A 4X3SA 2OT2A 4K6LA 4KY7A 5LL6S 4K2LA 3T56B 5EKLA 3C46A 4XT1B 2DNEA 2IW3A 4FF2A 3T16A 3DWPA 3BYTB 1Y69U 3MZ5A 3TDQA 3J81E 5BN4A 5AFWA 3OIPA 1TWCB 2WAQB 2PW7A 1DJRD 4IQZA 1VF5C 3VYUA 2R3ZA 1JQYD 1MD2D 3NUCA 1U9RA 1NR4A 1KNEA 2TSSA 1SEBD 1SNCA 2E2JB 4CGYB 4MIUA 3N6RA 1JOKA 4BA2I 4RCOA 2PZWA 1ET9A 1XX8A 3V05A 1RHPA 3S1QB 3VR4A 5T1IA 2YU9B 1Z6HA 4A3FB 2CHBD 5J1ZA 1TS5A 4A3MB 3NWTA 3NPPA 2JA6B 3NXWA 2JEBI 1R4QB 4FNFA 1STGA 2JSOA 1B3AA 5BN5A 1GUNA 1Q1EA 1RKNA 1TU2B 3HOZB 5CV4A 1HUNA 1PZJD 1TS4A 1BR9A 1A15A 1J9OA 1W6KA 2NN6H 2K7VA 1EY7A 5C0XJ 5F2DA 3FRPB 1A6XA 4PMBA 1QNKA 3LX0A 2NVYB 3NSWA 1ZEQX 2IJ0A 1V1PB 3S16B 3J7AF 1Y8OB 2HCIA 1STNA 1XXGA 3NTKA 1AN8A 3NE5B 3U9SA 5NUCA 2JA8B 5C3WA 1I4RA 3L7ZC 1BO0A 3A7AB 3V2TA 2B63B 1QWYA 5JEAH 1PTOH 4EVOA 3MFYA 3PIO3 1HRJA 4OGQC 4XDXA 3K58A 1JB3A 2L1BA 1FR3A 1NAPA 3E6ZX 4KI0A 2NVTB 3HP3A 2E76C 1R9TB 2J0TD 1TS2A 1LTGD 2B2VA 1L0YB 5IIFA 5CV5A 1OO9B 4QF4A 4HEDA 3Q24A 2L11A 4IFDJ 4C3IB 3NWSA 3TP8A 3K5OA 1QNUA 3TZUA 3M7NA 5ELFA 4G4KA 5CMDA 1SJED 4KTAA 4PNYA 4ZKCB 5I9OA 1SAPA 1ICWA 1EZ6A 5EPLA 4K5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNK A;  1MSG A;  5DNF A;  2VXW A;  2RSO A;  1DOM A;  2D9U A;  3D6W A;  1F9S A;  2IL8 A;  4CJ2 C;  1C8C A;  4ZAI A;  1NR2 A;  2FHT A;  1RJT A;  3KUP A;  3MWY W;  2HUG A;  1MGS A;  1RTN A;  2FMM A;  1X32 A;  2XIW A;  3I91 A;  1PFB A;  1VMC A;  3R93 A;  1EL0 A;  1WD0 A;  1U4L A;  3IL8 A;  2Q8R E;  1WVL A;  1O7Z A;  1DOL A;  2K01 A;  2B2Y A;  2X6L A;  1PLF A;  2B2V C;  2HCI A;  4HAE A;  4IUP A;  3KBX A;  4X3K A;  2KEE A;  3P7J A;  4XT1 B;  1B2T A;  1B53 A;  4LMQ D;  1HHV A;  2MJ8 A;  1EOT A;  5EKI A;  2B2W C;  2X69 A;  2L12 A;  1EIH A;  1F2L A;  2K03 A;  5EJW A;  1KNA A;  4X3T A;  3FDT A;  1IKL A;  4R9W A;  1G2T A;  1DOK A;  5E4W C;  4RWS C;  1TVX A;  3FPU B;  1RTO A;  3I90 A;  5EPK A;  2MPM A;  2KEC A;  5AFW A;  1B4O A;  1WTO A;  1BO0 A;  1ROD A;  5CBA E;  1EIG A;  4CJ0 B;  1QE6 A;  2NWG A;  4IUT A;  2M2L A;  2HCC A;  1ILP A;  4ZLT F;  3TZD A;  3DEP A;  1WTV A;  2RSN A;  1CA6 A;  1LV9 A;  1MI2 A;  1PDQ A;  1IKM A;  2SDF A;  3UI2 A;  3H91 A;  1WTW A;  1CA5 A;  2R3Z A;  1S4Z A;  1DZ1 A;  2JP1 A;  1WTQ A;  4X3U A;  1WTR A;  2JYO A;  1O7Y A;  1U4P A;  1AP0 A;  1HRJ A;  3IFD A;  4XDX A;  4DN4 M;  1NR4 A;  2DY7 A;  1ESR A;  3GV6 A;  1KNE A;  3Q6S A;  3I8Z A;  4IUU A;  5COR A;  1BBX C;  1AZQ A;  1CM9 A;  3TN2 A;  4OIK A;  2L1B A;  2L9H A;  1BF4 A;  2K05 A;  2HDM A;  2B2Y C;  1NAP A;  1X3P A;  3DEO A;  2H1E A;  2NYZ D;  4HCS A;  1ZXT A;  3HP3 A;  4QUC A;  1X3Q A;  5D65 A;  5T1G A;  4ZK9 B;  1J8I A;  2B2T A;  3G7L A;  5E4X A;  1WD1 A;  1WTP A;  1VMP A;  1NCV A;  4IUQ A;  2RVL A;  1SDF A;  4IUV A;  1ILQ A;  2B2V A;  1WTX A;  1AZP A;  3N52 A;  1Q3L A;  2RA4 A;  1XYI A;  1B50 A;  3QO2 A;  2FIN B;  2FJ2 A;  2KED A;  1BNZ A;  2Q8T A;  5COY A;  1G91 A;  3MTS A;  4MHE A;  1DON A;  1XX8 A;  1JIC A;  3SVM A;  2KUM A;  3F2U A;  5EPJ A;  1RHP A;  1M8A A;  2EPB A;  4HED A;  2KOL A;  2B2U A;  5T1I A;  5CBE E;  1ML0 D;  2EE1 A;  4UAI A;  1HA6 A;  1HUM A;  2EOT A;  4RA8 A;  3LWE A;  4OIJ A;  4XT3 B;  4O42 A;  1U4R A;  2CVR A;  2L11 A;  1G6Z A;  4HSV A;  2DY8 A;  4MN3 A;  2N88 A;  1HFG A;  1GUW A;  4CJ1 B;  1F9P A;  2K1B A;  5EQ0 A;  1SSO A;  1EQT A;  1B3A A;  2MGS A;  3I3C A;  2L4N A;  2NZ1 D;  2N55 A;  1HUN A;  1F9R A;  2K28 A;  5D14 A;  2B2T C;  1O80 A;  4IUR A;  4R8I A;  1A15 A;  2B2W A;  2MP1 A;  4ZKB B;  1J9O A;  1E0B A;  4U68 A;  3DM1 A;  1HFN A;  2BDN A;  5CMD A;  4NW2 A;  2K04 A;  2KVM A;  3ONA B;  1JE4 A;  1QG7 A;  2J7Z A;  1PFN A;  4RAU C;  5JJZ A;  2X6G A;  1IL8 A;  3GV3 A;  4X3S A;  4ZKC B;  4QUF A;  2HDL A;  1SAP A;  1ICW A;  1G2S A;  1PFM A;  1U4M A;  1F9Q A;  1MSH A;  2B2U C;  5EPL A;  2FFK B; 
#chains in the Genus database with same CATH topology
 4NXM L;  3SHL A;  4BA1 I;  3K6O A;  5JVG 3;  3SEB A;  1CKO A;  2A19 A;  1MKH A;  3PIP A;  2KHJ A;  1M90 C;  1PH3 A;  1BDO A;  4A3B B;  1MIU A;  2XRQ D;  3QJY A;  3M3Y H;  4X3K A;  2FMC A;  1WCM H;  4HJ7 A;  4JI2 Q;  3T1Y L;  1I3Q B;  4OEM B;  1EY0 A;  1ZYR C;  4C3J B;  2SEB D;  2F03 A;  3CME A;  1IKL A;  1HNW L;  1H9S B;  1TVX A;  3FPU B;  1RTO A;  2EXZ A;  3GTL B;  5BR8 Q;  3PMF A;  5EAY A;  2E8G A;  4AIM A;  4LUV A;  3BDC A;  3KJO A;  1CUK A;  2GVA A;  1EQQ A;  2VQE L;  1KAW A;  3QG1 A;  2RDH A;  5IT9 E;  4DR2 L;  5HGQ A;  2UUB L;  1JOO A;  3EQL C;  3PSI A;  3X3M A;  2HD3 A;  4NMZ A;  4LFA Q;  2F0U A;  1E1O A;  1EQV A;  1SYD A;  2F0N A;  2PYK A;  1FVI A;  2GVB A;  3BZK A;  1G6P A;  2PMZ B;  2HDM A;  3K7A B;  4HCS A;  3S15 H;  4P2C B;  3I56 A;  4DK1 A;  1WTP A;  4PG3 A;  1FGU A;  3GD7 A;  1WTX A;  2GN5 A;  4OWX B;  4DR5 Q;  1AZP A;  2A6E C;  4TSS A;  4C56 C;  3STB C;  1S3O A;  1HR0 L;  4HJ5 A;  4QIW B;  1G91 A;  4DV5 L;  2ES2 A;  1DON A;  5C0X I;  4R4T A;  2PPB C;  2KEN A;  3T51 B;  3FPP A;  1Y14 B;  2PQA A;  1NE3 A;  3GQB A;  1IYV A;  1J6Q A;  2NZH A;  3I4M G;  2HT1 A;  5KYI A;  2R61 A;  1X3F A;  2B8F A;  1SRU A;  1QB5 D;  3RLF A;  1EEI D;  5IYC G;  2PI2 E;  4B08 A;  2L55 A;  5LMN L;  4POG A;  3W1G A;  3L2P A;  1B8A A;  5EQ0 A;  5JJK A;  3WWV A;  1EZ8 A;  3HEJ A;  1PZK D;  4A3D G;  2JJQ A;  2N3S A;  3V96 A;  4C3H H;  2OCE A;  2FXQ A;  4H7B A;  1SFO B;  1X3G A;  4JYA L;  4RAU C;  1EIY B;  3GV3 A;  4R4Q A;  1N34 Q;  3KDF A;  1JR0 D;  5GAD C;  5C3E B;  4A3E H;  3E5S A;  3I2Z A;  5E4X A;  4M1U B;  2KA7 A;  3S17 H;  1X55 A;  3M3Y B;  4OL7 A;  4J1M A;  1MGS A;  4YWL A;  4H02 A;  1SJH D;  1PHJ A;  1DOL A;  4DR4 L;  3J80 c;  1PLF A;  3A8K E;  4HAE A;  2ZTE A;  5FO8 B;  3HOX H;  3HOW H;  1EWI A;  3OW2 A;  2AQ1 B;  2MJ8 A;  1HA5 A;  1BCP D;  4K8I A;  3A55 A;  1EIH A;  5TSS A;  1KNA A;  5CC4 A;  1K9M C;  4NXM Q;  4RKB A;  1YNN D;  4JI7 L;  3I90 A;  1CI3 M;  1PRT F;  2I07 B;  3M85 A;  3J7Y W;  2WFW A;  2Q8I B;  1CQF A;  1ROD A;  5FLX L;  3I7F A;  4EQP A;  4GLA C;  5IT9 c;  4ABN A;  2JA7 H;  2EVB A;  3R3O A;  4JBJ A;  2O5J C;  1E2V A;  5FJ8 G;  2R93 G;  1TWF B;  3TS2 A;  1I4G A;  5M3F H;  3T1Y Q;  4J6H A;  3S15 B;  4IFD I;  5CYU A;  2ZJR A;  2A69 C;  3ULJ A;  2P5Z X;  1PH5 A;  1PXU A;  3A5U A;  3BZC A;  3S1N H;  4RG1 A;  1B9M A;  3FHW A;  4RHS A;  5FKA C;  5I4D A;  4BXX G;  4OON A;  3GTK B;  2EY6 A;  1VMP A;  2SNM A;  3I4N H;  3NQT A;  2VQE Q;  3CCU A;  1STA A;  1B7Y B;  2YTY A;  3H3V H;  3SR1 A;  1N8R C;  2KED A;  2UUB Q;  4RMF A;  1K3R A;  3MC0 B;  4P75 A;  2KOL A;  2B2U A;  2Z8L A;  1SLJ A;  2MFI A;  1PH6 A;  3A56 A;  2HQL A;  2PNR C;  1Q46 A;  4KHP L;  4G7O C;  1EEF D;  1E22 A;  4A93 B;  1GD7 A;  1T9H A;  1QIL A;  2YTX A;  3CRK C;  3PUZ A;  1HR0 Q;  2AHO B;  1EY6 A;  3AFP A;  3W5O A;  4DV5 Q;  4XIG S;  1D5Z C;  1NY4 A;  1ZKO A;  2NZ1 D;  1SE3 A;  2E5L L;  4J15 A;  2JK8 A;  4UP9 A;  2Z6B A;  1O80 A;  2F0G A;  2IWH A;  3PF5 A;  5IGG A;  3K5M A;  1K8M A;  2BDN A;  1TII D;  2SOB A;  2CKZ B;  1BQQ T;  4C2M H;  4A3G G;  2F0J A;  4BY7 B;  3TRE A;  1F9Q A;  2N78 A;  3A74 A;  2B2U C;  1B70 B;  1L2F A;  5ELN A;  3ER0 A;  4CJ2 C;  3UE1 A;  2F0Q A;  4DV4 L;  3KUP A;  3HOW B;  4HCE A;  1EYC A;  1O7L A;  3R93 A;  3GTO B;  3OOC A;  1U4L A;  4CDD C;  4GN3 B;  2AMC B;  1S5F D;  3F2C A;  2KEE A;  3CU7 A;  1VQ6 A;  2LXJ A;  2Z9H A;  3H94 A;  3KF6 B;  1Q7Y C;  3PO2 H;  3CCM A;  2JA7 B;  5C5L A;  1HNX L;  1KRT A;  4QY7 A;  3D8G A;  4ME5 A;  5C4X G;  2XGT A;  2M00 A;  2RHQ B;  2CQO A;  4P74 A;  1GUG A;  2M2L A;  1ENC A;  1UEB A;  1WCM G;  3ZJY C;  3Q0A A;  5JAV A;  3S1N B;  2K6A A;  5JJL A;  4ALP A;  4A3I B;  3SXH A;  4IPD A;  3M4P A;  4BY1 G;  4JI7 Q;  4RCN A;  1GM5 A;  1EYD A;  1CM9 A;  5IYD H;  3DEO A;  2RDF A;  1X3P A;  1SXT A;  1PYS B;  1X65 A;  3KF8 A;  1NCV A;  3JAM L;  1SDF A;  1VQJ A;  3DHQ A;  1YBY A;  2RBM A;  2MQH A;  1XMO Q;  4DV7 L;  4MHE A;  2R92 G;  2XSC A;  1RCV D;  1PRT C;  2DUD A;  1K73 C;  3W3A A;  1TWC H;  4TQU S;  2EOT A;  4LWC A;  2LY7 A;  2RCN A;  2Y0S B;  2F0O A;  4OIJ A;  4WJ3 M;  1GO3 E;  1F77 A;  3OPO A;  3AU7 A;  2V4D A;  1YI2 A;  4OO1 H;  1VQG A;  3J7Z C;  1JWM D;  1R4P B;  2K1B A;  4KMU C;  3J81 L;  2MGS A;  2NB0 A;  1IBL L;  1HPC A;  4JI8 L;  3WOF A;  4DV6 L;  2E2J H;  1LTL A;  2C5C A;  3PUW A;  4C2M B;  2VB3 X;  1VQO A;  4HR7 B;  5HY6 A;  3A8I E;  2ASB A;  4KHP Q;  5C5M A;  1V8Q A;  2K04 A;  1SMY D;  1VQH A;  1Q86 C;  2UXC Q;  2IY5 B;  3M4Y A;  4YIJ A;  1KAA A;  1TWG B;  2LSS A;  2HDL A;  1U4M A;  3M9B A;  5ELC A;  3QO2 A;  1I94 L;  3S1Q H;  2YU9 H;  4A3F H;  2CH4 A;  2E5L Q;  3FKI B;  2A73 B;  4C3H G;  3CQZ B;  2E2H H;  1RTN A;  4C1N K;  2RF4 A;  2PI2 A;  1A2T A;  1VMC A;  2UUA L;  3KOJ A;  1WVL A;  1C48 A;  2UXB L;  4HSP A;  4EX5 A;  3R2T A;  1Y8P B;  1VQA A;  2EJG C;  1ESF A;  4LFB Q;  3GTM H;  4R9W A;  1NTG A;  1IYJ B;  4K2K A;  4DV4 Q;  3RN2 A;  3UDI A;  1Q81 C;  1HR0 W;  4S3S A;  1BBW A;  4GLV B;  3TS0 A;  3CPF A;  2PZT A;  3A5Z B;  1TT2 A;  3HOX G;  3CCE A;  2MO1 A;  1IKM A;  3Q22 A;  2R7Z H;  3KDF B;  1WTQ A;  1E3P A;  2JYO A;  2HIV A;  5I9P A;  3BS1 A;  5IYB G;  1P16 A;  4IZ8 A;  3S16 H;  1HNX Q;  5LMN W;  4WFN 3;  4KN7 C;  4BBS B;  2H1E A;  4QL5 A;  2B2T A;  3PO3 G;  1Y1V H;  2JA8 H;  3CCQ A;  4LAA A;  1B50 A;  5M3F G;  2FJ2 A;  2Q8T A;  3ZYY X;  4LJZ C;  1AEX A;  3VYS A;  3BDL A;  2EE1 A;  1LAB A;  1L0W A;  4G7H C;  1GUO A;  2F0W A;  1HCZ A;  1D2B A;  1OXT A;  3I4N G;  1E2W A;  1MHW C;  1ZYR D;  2KHI A;  4O0A A;  4LF4 L;  4FO2 A;  4DU9 A;  3UDG A;  1VQ5 A;  3H15 A;  2G5D A;  3I3C A;  2F0L A;  3D6C A;  3U9O A;  2B2T C;  4DF7 A;  2QKI C;  4UPA A;  4DXG A;  1R9T H;  3F2D A;  2XWB B;  2B39 A;  3KLW A;  1F2M A;  1XTD A;  3M7G A;  4TVA B;  1YVC A;  2I5H A;  2EYO A;  3W2D A;  4QUF A;  5M5W B;  4LNQ A;  2E2H B;  3HOY H;  4LF7 L;  3HKZ B;  3EVQ A;  3NTI A;  1IBL Q;  4KKS A;  4DV6 Q;  1NR2 A;  2ZM6 Q;  1AFP A;  4A3K H;  1VQF A;  3GP7 A;  2A6E D;  2XN9 C;  3IL8 A;  3STB D;  4C3I H;  4R4I A;  4HIM A;  3S1R B;  3GTM B;  2IX0 A;  2X6L A;  4MNO A;  3P7J A;  2XTI A;  3MXU A;  4H44 C;  5IE8 A;  2ENB A;  1KLG D;  5J39 A;  4HJA A;  1N33 L;  1TY0 A;  3BZD B;  3RUZ A;  2IPK D;  4Y7N B;  3AEV A;  2ZT9 C;  3TEH B;  2R7Z B;  2KEC A;  2RQX A;  3OMG A;  1WTH A;  2Z6K A;  2K5N A;  2Z4I A;  5E7N A;  1D5X C;  3L3O C;  2KCN A;  2UXB Q;  2WAQ E;  4JBW A;  3URY A;  1W2B A;  4MZ9 A;  4A3J G;  2AWN A;  5EBC A;  3UI2 A;  1CA5 A;  3BVM A;  1UWV A;  4XQN A;  3BDO A;  2JP1 A;  2K75 A;  1VQD A;  1G51 A;  4KV6 A;  4OWW B;  3PO2 G;  3T53 B;  4DN4 M;  4V19 0;  2ZTD A;  1Y1V B;  5COR A;  4AQY Q;  2EY5 A;  3G6E A;  3Q8D A;  4DV1 L;  4WJ4 A;  1TY2 A;  1XWE A;  3QIA A;  4CKE A;  5I6Y A;  1WD1 A;  4A3B H;  1JOR A;  2NYZ D;  1J8I A;  5E1F A;  1X3Q A;  4DAY A;  5LHY 1;  1KQS A;  4JI4 L;  4IUQ A;  1I3Q H;  4C3J H;  3CCR A;  1CFM A;  1HNZ Q;  4LK1 C;  4ZUJ A;  4FF4 A;  5G3L D;  4YHH L;  2K5Q A;  2K5H A;  4HTH A;  3F2U A;  4UHV A;  5IGC A;  2ZTC A;  2Z6K C;  4FYD A;  1SYE A;  1Y1W B;  3AFQ A;  2A5H A;  1EFI D;  3LWE A;  1DD2 A;  1E7Z A;  4HMI A;  1JMC A;  3S1M H;  1G6Z A;  1LTR D;  2I5L X;  1Q82 C;  2WKD A;  2BH8 A;  1PRT B;  4HSV A;  2DY8 A;  3BVG A;  3PGZ A;  1S5C D;  4KK7 A;  3J80 L;  4LF9 L;  1F9P A;  5KNB A;  4B3M L;  4FDB A;  5AJ3 Q;  3RZD B;  4ZYS A;  4AYB B;  4PQX A;  4JG2 A;  3PIO A;  1HTP A;  2MP1 A;  2JA5 B;  3HOY B;  2WAQ G;  3F2B A;  3PCO B;  2Z0S A;  2VUM H;  2EZV A;  3DXJ C;  4BBR B;  3ONA B;  3I55 A;  2DJF C;  3KF8 B;  1HQR D;  1E24 A;  3MEH A;  5FLM H;  1GOZ A;  4P72 A;  3T1H L;  4DNR B;  4DUZ L;  4OO1 G;  3CPW A;  4BS9 A;  4LF4 Q;  2A69 D;  4A3K B;  1WFQ A;  3HZX A;  5DNF A;  2RSO A;  5DEH A;  4A3D B;  4UY8 C;  4HMJ A;  3TP7 A;  2KHS A;  3S9W A;  4JI6 Q;  1Q1B A;  2D2C C;  3AMU A;  2B2V C;  2I46 A;  1F2Y A;  3BG3 A;  3C2P A;  2JN4 A;  3KYH C;  4LF7 Q;  5EKI A;  3KBG A;  4A3F G;  1VF7 A;  2XVS A;  2M9V A;  4DA2 A;  1G2T A;  5E4W C;  3M4O H;  1IW7 C;  2WB1 B;  4QJF A;  1SFO H;  1YIT A;  3HKS A;  1QOH A;  4YWM A;  4A3M G;  2JA6 G;  2F3I A;  1VQP A;  4KD3 A;  1EIG A;  5M5Y H;  2HCC A;  2Q2T A;  4ZLT F;  3FP9 A;  2VNU D;  4JCV E;  4KD4 A;  1PDQ A;  5C3E H;  2E74 C;  3H91 A;  1WTW A;  2PNH A;  4JI3 L;  2ICI A;  1DZ1 A;  3HOZ G;  3I4O A;  1TWH B;  4L8J A;  1A3T A;  1CK1 A;  1N33 Q;  2DY7 A;  5M5X B;  3CCJ A;  3KLR A;  3CC2 A;  1Q90 A;  3NEN A;  4ZAI A;  3I70 A;  5T1G A;  1HZB A;  3MEF A;  2RVL A;  1BOS A;  3N52 A;  1H9M A;  2KCC A;  4NXN L;  4DR1 Q;  1IL2 A;  2E2I B;  3P20 A;  1SN8 A;  3S1M B;  2A74 C;  1H9R A;  1M8A A;  2EYP A;  3MXG A;  4DV1 Q;  4A3C H;  3NTH A;  3GDE A;  4IFD H;  4JI4 Q;  1YNX A;  1TWF H;  2CQA A;  4POF A;  5FK9 C;  2JA8 G;  2UXD Q;  4FF1 A;  1WJJ A;  5CV6 A;  1AE3 A;  5LL6 X;  2K5W A;  5EGT A;  4X64 L;  2VUM B;  1EQT A;  2PZU A;  5D14 A;  3MA2 B;  2B63 G;  4E6I A;  1LTA D;  3I73 A;  3GTK H;  1S72 A;  2K14 A;  1HFN A;  1SBB B;  2XRS D;  1TS3 A;  3L0O A;  3QOJ A;  4Q0F A;  2WAC A;  2RKS A;  1FNV A;  2DJG C;  4IUN A;  5C4J B;  2VW9 A;  1U5K A;  2N49 A;  4GOP A;  3IKJ A;  4B3M Q;  3J7A 5;  1C8C A;  3SDZ A;  3KLS X;  2XIW A;  4KKU A;  5JVH 3;  4A93 H;  4A3L H;  3E9I A;  3D4R A;  4FF3 A;  1SNO A;  2YYZ A;  4V0B A;  4MTN A;  2Q8R E;  4PMC A;  4K0K L;  3M4O B;  3T1H Q;  4DUZ Q;  3CKI B;  1EOV A;  5C4Z A;  3VR6 A;  1EOT A;  1FJG Q;  1PRT D;  2D5D A;  5M5Y B;  1JT8 A;  5ELD A;  3OTO Q;  3SE0 A;  3OMC A;  4DAP A;  2VQF L;  5KND A;  4CJ0 B;  1KD1 C;  5M9O A;  3TZD A;  4BY7 H;  1I50 H;  2NN6 G;  2LMC B;  3P1H A;  1G8Z D;  1YHB A;  1OXV A;  1SNP A;  1WI5 A;  5M3M H;  2KQ3 A;  2ICE C;  3GTO H;  5HGT A;  3CC7 A;  4DR7 Q;  5C4X B;  2PMZ E;  1GUS A;  2K05 A;  1I4Q A;  4EGV A;  1X6O A;  4LF6 L;  3O13 A;  3TQY A;  2R6G A;  1S5E D;  5IOC A;  4N9P A;  4U67 3;  1KIX A;  4QIW E;  2DN8 A;  1BXT A;  5DAU A;  5LMU L;  5C44 H;  3A54 A;  3GO5 A;  1JCK B;  2F0M A;  4UP7 A;  1IHZ A;  4A3B G;  3T4A C;  2R7F A;  2A1A A;  4HID A;  1HNW Q;  2QF7 A;  4O42 A;  2OF1 A;  1JJ2 A;  3ULL A;  3H6M A;  2ZJQ A;  4C3J G;  4OWT B;  4A3I H;  1PH7 A;  1JOQ A;  1HFG A;  2WKC A;  5KYL A;  5JEA G;  1FYC A;  1YJ9 A;  4ZUI A;  1Z9F A;  4DK6 C;  4DR2 Q;  1SE4 A;  2PQE A;  4O1N A;  3QWN A;  3H0G B;  4L5T A;  4PZ6 A;  4FVM A;  4DAY B;  5D3I B;  4HIK A;  1SYC A;  1M4V A;  4Q5V A;  4RGN A;  1RD9 D;  1STB A;  2F0H A;  4DR7 L;  4RGT A;  1BCP F;  1JB7 A;  2AUJ D;  5E3F A;  3AB9 A;  1EY5 A;  3HOV G;  2D9U A;  1YJN A;  2IL8 A;  5A2Q L;  3A8J E;  3ERO A;  5I2Y A;  1W3S A;  3VYR A;  4JI5 L;  3VA7 A;  4TKO B;  4I65 A;  3MHB A;  2NVQ H;  1SND A;  1K8O A;  1TKW B;  2F0V A;  1IBM L;  1B53 A;  2O2L D;  2JE6 I;  4LMQ D;  5IWA L;  1L1O A;  3U58 A;  3P75 A;  1LAC A;  3S14 B;  3NHH A;  2XNA C;  5EJW A;  1QVF A;  4XYO A;  5LMN Q;  4RWS C;  1I50 B;  2MUY A;  4CKB A;  2MPM A;  1DM0 B;  5CBA E;  1OTC A;  2GA4 B;  1TWG H;  3D31 A;  5M3M B;  3DEP A;  4K0K Q;  3FEW X;  2F0D A;  1K83 B;  4JYA Q;  3WDN A;  4X3U A;  1WTR A;  3U4V A;  1SYF A;  3FKI H;  3IFD A;  3CQZ H;  3NK9 A;  3S2D H;  1SRO A;  3KJP A;  4R4O A;  4RH6 A;  4IJH A;  5FLX E;  4OHJ A;  3TBI B;  2F1M A;  2VQF Q;  1PTO F;  3G7L A;  3E9H A;  3IRB A;  5CV9 A;  3K5L A;  4KN4 C;  5C44 B;  4IUV A;  5C3E G;  1C0A A;  1L1O C;  1EIF A;  2RA4 A;  1Q8K A;  3JC6 6;  4GKK L;  1EFW A;  4DR4 Q;  2F4V L;  1JIC A;  1RDP D;  3I72 A;  3CCS A;  5IGF A;  2EPB A;  4IPG A;  1HXY D;  5KEE A;  1PH8 A;  3RMH A;  1HUM A;  1K8A C;  3UDF A;  1N36 L;  1GHJ A;  4LF6 Q;  1U4R A;  1EQR A;  1K3B C;  1XTC D;  3PUY A;  1KAB A;  1B3Q A;  3GTJ B;  4JI0 L;  4N9T A;  1A0I A;  1ENF A;  5LMU Q;  2N55 A;  4BBS H;  1PV4 A;  3MVV A;  1VQ7 A;  1I6V C;  3FMC A;  4A3C G;  2B2W A;  4RGM A;  4ZKB B;  3DM1 A;  2EDG A;  4C1N I;  3CAM A;  2NBF A;  5K36 H;  4KY5 A;  4PZ7 A;  2UUC L;  4KKT A;  2CH4 W;  2D0O A;  3RLO A;  3FDT A;  2FFK B;  4WOR A;  3G4S A;  4B3R L;  1JC7 A;  4X65 L;  4NKL A;  3H3V I;  4JI1 L;  2NVQ B;  3DMU A;  4B3S L;  1TXY A;  1I4H A;  4HIO A;  1PFB A;  2AWO A;  1EWC A;  2K01 A;  1LT3 D;  4L5R C;  3D4D A;  3KBX A;  4ODG A;  1GHK A;  1STY A;  3HOU B;  4IN3 A;  3B6Y A;  3BJU A;  1K28 A;  1NSN S;  2B2W C;  5ELE A;  5C4H A;  1RF2 D;  2JXM B;  1E2Z A;  1V1Q A;  4A93 G;  2EYF A;  1YEZ A;  4DV2 L;  3CRL C;  3PUV A;  2K32 A;  4JI5 Q;  4DAM A;  1A3U A;  4F88 A;  5M5W H;  1D1K A;  1CA6 A;  4DUY L;  5IGE A;  3S2D B;  3EJI A;  2JEA I;  4G57 A;  2PQA B;  1AE2 A;  2DNC A;  3VYT A;  5EKK A;  4B9W A;  4UDU C;  3K80 C;  4IUU A;  4A3E G;  1V9P A;  2F3W A;  2WP8 J;  4OIK A;  3S1R H;  1ZXT A;  2QW7 A;  1KXL A;  1C4Q A;  3GTG B;  2WV6 D;  1D7Q A;  1SE8 A;  4BY7 G;  4R1J A;  4NB3 A;  2C35 B;  1H9S A;  4H13 C;  4ULL A;  1Q3L A;  4BWG B;  2FIN B;  1NMF A;  4Y7N H;  5COY A;  3HOW G;  4DK3 C;  3TP5 A;  1CSQ A;  3S2H B;  4A76 A;  1HA6 A;  2JA9 A;  3HRZ C;  4CKC A;  2A68 C;  3JAM E;  2Y0S E;  1FD7 D;  2OWO A;  1PYW D;  4MN3 A;  4XXE A;  2VY3 A;  2JA7 G;  1C9O A;  1S5D D;  1CKM A;  4J8Q A;  1IW7 D;  4YY3 L;  2F4V Q;  1QJO A;  2K28 A;  4JVZ A;  4ZQ3 A;  4AH6 A;  1S5B D;  1KTK A;  4HJ8 A;  1PTO C;  2ZXR A;  5ELO A;  1PMR A;  2LFN A;  2F52 A;  4A3I G;  4L6T B;  4M8A A;  3OWE B;  1HZ9 A;  3FVQ A;  1YHQ A;  2L0C A;  3HG9 A;  1Y1W H;  1DOM A;  3D3R A;  3D6W A;  4DGZ A;  1QZG A;  5JPN C;  1Q8I A;  2BA0 A;  2FHT A;  4DV7 Q;  2HHH L;  1RJT A;  3MWY W;  3VA5 A;  1EL0 A;  4A75 A;  4LUO A;  1LT6 D;  1HZA A;  4LUZ A;  2K5D A;  2XWJ B;  1DXM A;  1X3E A;  4K14 A;  3U50 C;  4F8M A;  1I6H B;  4FXD A;  1LTS D;  2UUC Q;  3BVZ A;  3RZD H;  3QB3 A;  1MJC A;  4I7A A;  5JOB A;  1D5M C;  4X65 Q;  5ELB A;  4OO1 I;  4JI1 Q;  2JA5 H;  1BKB A;  1DOK A;  2Y0S G;  3DM3 A;  3PUX A;  4B3S Q;  4BBR H;  1TWA B;  3CC4 A;  2AUK A;  1ENA A;  1GJX A;  1SYB A;  4RKL A;  4JI8 Q;  4Y52 H;  2A6H C;  1EU4 A;  3LNN A;  1ILP A;  4QB4 A;  5FOB B;  1WTV A;  4ID6 A;  3J81 j;  5JEA J;  2OXP A;  2EJF C;  2H4O A;  1UE5 A;  4A3D H;  3HGB A;  2MHV A;  1QUQ A;  1EY4 A;  3LWU A;  4JOI A;  2EY1 A;  4DKA C;  3RZO H;  1I94 Q;  4DV2 Q;  3C1F A;  2I0Q A;  2F0T A;  2IX1 A;  4IPH A;  4CDE C;  5FO7 B;  4DUY Q;  4KHV A;  3UDX A;  3OWF A;  1XYI A;  2CW0 C;  4Z9C B;  2UUA Q;  1FGB D;  3FKI G;  5IOD A;  3MTS A;  4DK0 A;  2AKW B;  3ERQ A;  3SVM A;  3MXP A;  2KUM A;  5EPJ A;  1L1O B;  2G9D A;  4N8X 1;  5DM6 3;  3J7A V;  1O7I A;  3BYY B;  4UAI A;  3DLL A;  4LW1 A;  1PH9 A;  4RA8 A;  2QCP X;  1YNJ C;  1H9J A;  4JI2 L;  4NPS A;  1LT4 D;  2BH2 A;  1UEA B;  1IYU A;  2HQE A;  5KGU A;  1Y8N B;  1V1O A;  1VQC A;  2LKV A;  1TWH H;  2VB2 X;  5M5X H;  4JOI C;  1VCI A;  1VDZ A;  5BR8 L;  1CTM A;  1SSO A;  2L4N A;  3OSO A;  1Z47 A;  5KRU A;  3DWQ A;  5GAE C;  2I5M X;  5CGK A;  1E0B A;  1QCB D;  2BE5 C;  2KCT A;  3ERS X;  4XQQ A;  1CZW A;  5IYD G;  2E2I H;  1HH2 P;  3MAQ A;  3RR5 A;  4CDF C;  4KJO A;  1PFM A;  3G48 A;  4X3T A;  2OTL A;  3HKZ E;  2R7D A;  5DLQ E;  4YY3 Q;  1EY8 A;  1STH A;  4BBS G;  3R8B A;  1F9S A;  3NEM A;  1N32 L;  3DUZ A;  1JJC B;  1K0S A;  4BXX H;  4IAL A;  3GTQ B;  2HUG A;  1X32 A;  3I91 A;  2L5T A;  1SMY C;  3AQQ A;  1JE5 A;  1HQM C;  1LTT D;  1GXD C;  3VR5 A;  1PH4 A;  4B3T L;  5K36 G;  4IUP A;  3I4M B;  5C0X H;  1B2T A;  2IHE A;  4CHT B;  2BCO A;  1AW7 A;  1LUZ A;  5IT9 L;  1Q12 A;  2EY2 A;  3KK7 A;  1L0X B;  3K59 A;  3E3X A;  4IOC A;  4PMW A;  3SK6 A;  5C4J H;  5EBD A;  2J4X A;  1LV9 A;  3GTP B;  2SDF A;  4A4I A;  2PW5 A;  3JAM i;  3RZO B;  1SYG A;  2ID0 A;  1O7Y A;  5G3L F;  3F1Z A;  1ESR A;  4JBM A;  1BBX C;  1AZQ A;  4JBK A;  3K8A A;  1BUV T;  3IFT A;  3KLS A;  1BCP B;  2EIF A;  2WIN B;  4JC0 A;  4XT3 B;  1N34 L;  2F0I A;  1B9N A;  1VQ8 A;  3VDY A;  4YCV A;  2QDB A;  1OXU A;  3HKZ G;  4QMG A;  1NNX A;  3IAY A;  2D62 A;  1PYB A;  4CBV A;  4K5W A;  3C1E A;  1LO5 D;  1CZG A;  3PIP 3;  4KLK A;  2NN6 I;  5KNC A;  4EQ5 A;  4R8N A;  1I4P A;  3K57 A;  5IP9 H;  1UE1 A;  1B44 D;  2KBN A;  3TME A;  4NP5 A;  1CHQ D;  4B9X A;  2QEX A;  1STE A;  1GUW A;  4CJ1 B;  4RFB A;  2PO4 A;  1EU3 A;  1NMG A;  1A8V A;  2R7Z G;  5C4X H;  2R93 B;  4AYB E;  4F87 A;  2Z4H A;  1VQB A;  3ND9 A;  2CWA A;  1QVG A;  1DCZ A;  1S40 A;  1TQO A;  4NW2 A;  1XPO A;  2KVM A;  2MO0 A;  2J7Z A;  2X6G A;  3J80 E;  1HZC A;  1W6J A;  1K8G A;  1PTO B;  3CMA A;  4BY1 H;  1Y1V G;  5JPM C;  1F2Z A;  1K0R A;  2VXW A;  4FXG C;  3OYY A;  3RN5 A;  1CHP D;  1II3 A;  2NVX B;  1VQ4 A;  2FMM A;  1EUJ A;  2EJM A;  3CF5 A;  4YHH Q;  3X3N A;  1MBY A;  5IGB A;  3C3L A;  1HTL D;  1KHI A;  3H3V C;  1NBW A;  2KJX A;  1O7Z A;  2R92 H;  2EQS A;  2NTT A;  1D1I A;  1LT5 D;  1Y1W G;  2X69 A;  1LLR D;  3HOV B;  1VQI A;  4LF5 L;  5I6W A;  1LYL A;  4YCW A;  5J22 A;  4LF9 Q;  1N32 Q;  2WB1 E;  3H0G H;  1FNU A;  1LTB D;  1B4O A;  4DFA A;  1KLU D;  4B3T Q;  2F0P A;  1ASY A;  1GVP A;  1MI2 A;  2UU9 L;  1VQN A;  2N8N A;  4RGO S;  4AYB G;  1LM0 A;  4I7Z C;  1UUP A;  1U4P A;  4UP8 A;  4A3G B;  2JA5 G;  3Q6S A;  3HOY G;  3OIQ A;  3I4L A;  2F4I A;  1A63 A;  4BBR G;  3TN2 A;  1BF4 A;  4ZK9 B;  4JK1 C;  1J5E L;  3A7L A;  2BA1 A;  1DYQ A;  2PCF B;  4A3K G;  1VQM A;  3S14 H;  4C3I G;  4GOP C;  2B29 A;  1VQE A;  5IGD A;  3D4W A;  3H09 A;  4DAV A;  4L5Q A;  1ML0 D;  3G71 A;  1N9W A;  3MFG A;  3T13 A;  2Q2I A;  5CV8 A;  2RCF A;  4DXF A;  1AH9 A;  2K33 A;  1K83 H;  2F3V A;  2EYJ A;  4JW0 A;  3K7U C;  5CR3 A;  4TRD A;  3M4Q A;  5J3B A;  4XYQ A;  4APV A;  1PZI D;  2N88 A;  4DPG A;  2DGY A;  4GZY C;  5IP7 H;  2WB1 G;  4QGU A;  1WCM B;  3QOL A;  5K5P A;  3L9A X;  2E2D C;  4JI3 Q;  1JWS D;  2C9O A;  2K52 A;  4R8I A;  4IUR A;  3PF4 A;  1QUQ B;  4U68 A;  4CDC C;  4BY1 B;  1JJG A;  5FO9 B;  1IZ6 A;  1A2U A;  1JE4 A;  1PFN A;  4PZ8 A;  2NTS A;  1PA6 A;  2O4X A;  4DNT B;  1CT1 D;  1EYA A;  4XTC S;  3RNU A;  4L5S A;  2NWG A;  5IYB H;  1SNQ A;  1ICF B;  3K0X A;  4NXN Q;  2BDO A;  3PO3 H;  2R92 B;  1ONL A;  2OEO A;  4FP5 D;  1XMO L;  4X66 L;  1H9K A;  3PV0 A;  3GTJ H;  3MXN A;  3W1B A;  3SK4 A;  4YWK A;  2RHS B;  1CKN A;  1EY9 A;  1YHA A;  2L12 A;  4H0L C;  4JV5 L;  4L63 B;  2EYM A;  1SE2 A;  3LGJ A;  3Q23 A;  4GN4 B;  5EPK A;  5C3X A;  2A68 D;  1PH1 A;  2EYL A;  2WII B;  3CCV A;  4X64 Q;  1WTO A;  3OW7 A;  2QA4 A;  1PVO A;  2O5I C;  2YV5 A;  5C0X G;  2VUM G;  3CXC A;  3EA6 A;  5FLM G;  1ET6 A;  1G29 1;  4N8F A;  1H95 A;  1AP0 A;  4ZCK A;  3CHB D;  2F0E A;  4ME3 A;  1MJE A;  1I5F A;  4LF5 Q;  1PTO D;  1NUC A;  3I8Z A;  4G7Z C;  3G6J B;  3PQI A;  2SNS A;  5I2X A;  2UXC L;  1WYD A;  3HFZ B;  5D65 A;  4HN7 A;  1RL2 A;  1LTI D;  4C3H B;  3SK8 A;  3HOU H;  1ILQ A;  2UU9 Q;  1XNQ L;  1O78 A;  2TMP A;  2MNA A;  4X62 L;  1BNZ A;  2E75 C;  3J80 i;  5A35 A;  4A3E B;  3RD4 A;  1KDB A;  1QVC A;  1UNS A;  1V1P A;  5CBE E;  2AQ3 B;  2NUC A;  2QEJ C;  4DR3 L;  3S17 B;  1CQV A;  2EYH A;  1J5E Q;  1ASZ A;  2H5X A;  1EYG A;  4ZRZ A;  3BU2 A;  1KDA A;  5ISR A;  4LFB L;  3WOE A;  4DV0 L;  4IPC A;  4XQJ A;  3HOX B;  1NJI C;  2D0P A;  4HJ9 A;  4FXK C;  3R2I A;  2F0F A;  1KRS A;  5IP9 G;  2LS0 1;  2A6H D;  4PV1 C;  3SGI A;  3GTG H;  2Z1C A;  1Z7T A;  1T5E A;  4A3J H;  3ULP A;  1IL8 A;  1PFS A;  3KFU A;  4RHR A;  3PO3 B;  3NBI A;  1G2S A;  3SK5 A;  1MSH A;  1JWU D;  3S2H H;  3EN2 A;  3EIV A;  1MSG A;  1P8L A;  1SMX A;  2ZXP A;  5M3F B;  1CSP A;  1OXX K;  2G9H D;  1A3V A;  4ILW A;  5D3D A;  2IX3 A;  1WD0 A;  2QDL A;  2CW0 D;  2B2Y A;  4IFD G;  5C6A A;  1U0L A;  1VS0 A;  4K5V A;  2RDG A;  1V43 A;  3I4N B;  4EQO A;  1HHV A;  4KJN A;  3E0J A;  5A2Q E;  1F2L A;  2K03 A;  5KIX A;  3NQI A;  3ND8 A;  1YNJ D;  1FNW A;  3VR3 A;  1T5X D;  3QR8 A;  4DR6 L;  3K0Y A;  3EFX D;  2AQ2 B;  1SNM A;  4WJW A;  4WRD A;  1QE6 A;  1XNR L;  4IUT A;  1EWH A;  4F7X A;  4IJL A;  2OQK A;  3U4Z A;  4X66 Q;  2ZXO A;  2RSN A;  4KY6 A;  5BN3 A;  3K5N A;  3NBH A;  1S4Z A;  5HUR A;  2QGQ A;  1X54 A;  1OXS C;  4JV5 Q;  1IXR A;  3GV6 A;  2BOS A;  4GNX A;  3H0G G;  5CV7 A;  2BE5 D;  4QCL A;  2L9H A;  1GUT A;  1KDC A;  2B2Y C;  4QUC A;  1I6H H;  1TR5 A;  4A3L G;  3OHX C;  3RLN A;  2KCM A;  3E0E A;  4KHZ A;  2ZM6 L;  3CD6 A;  3TRZ A;  2F0S A;  2IHF A;  3ITP A;  2QIL A;  1TWA H;  1IBM Q;  1I4X A;  1BCP C;  5IWA Q;  3TP6 A;  5FLX c;  1YNN C;  4R4C A;  3TSS A;  3DWA A;  4GOP B;  1XPU A;  4O2D A;  1UAP A;  2CVR A;  1YZ6 A;  3VR2 A;  4OEL B;  4GNX C;  1D6E C;  4LF8 L;  4K8J A;  1XNQ Q;  4X62 Q;  4A3J B;  3HS0 C;  4EQN A;  5DM7 3;  4A3M H;  2F0K A;  2JA6 H;  1B1Z A;  1UE7 A;  1F9R A;  5GRO A;  5JJI A;  2ALY B;  3PO2 B;  5M3M G;  4K6D A;  4DR3 Q;  2JQO A;  5H1S E;  5GQO A;  4OX9 L;  1QG7 A;  3NP8 A;  5JJZ A;  3HOZ H;  4NDX A;  2IT1 A;  4X3S A;  5GAH C;  2OT2 A;  4AQY L;  4K6L A;  5IP7 G;  4DV0 Q;  5IY0 A;  4KY7 A;  2K50 A;  4IOA A;  4GKK Q;  5C44 G;  5LL6 S;  1XMQ L;  4K2L A;  4LFC L;  1UE6 A;  5EKL A;  3T56 B;  4GS3 A;  1HNZ L;  2NVY H;  3C46 A;  1DGS A;  2L15 A;  1N36 Q;  4XT1 B;  4DV3 L;  3CW2 C;  2DNE A;  2IW3 A;  4FF2 A;  3T16 A;  3DWP A;  3BYT B;  1Y69 U;  3MZ5 A;  3TDQ A;  3J81 E;  4JI0 Q;  1X56 A;  5BN4 A;  2V1C C;  5AFW A;  3OIP A;  2EXD A;  1TWC B;  4YCU A;  1KC8 C;  2WAQ B;  2PW7 A;  1DJR D;  2ZJP A;  4IQZ A;  1VF5 C;  5AJ3 L;  3VYU A;  2R3Z A;  1JQY D;  1VQ9 A;  2B63 H;  1MD2 D;  3NUC A;  1XPR A;  3GTQ H;  1U9R A;  1NR4 A;  1KNE A;  2TSS A;  1SEB D;  4B3R Q;  1SNC A;  3CCL A;  4DR6 Q;  5GAG C;  1YIJ A;  4CGY B;  2E2J B;  1XNR Q;  3I4M H;  4MIU A;  3N6R A;  1JOK A;  3AYH B;  3MXN B;  5IYC H;  2NVT H;  4BA2 I;  4RCO A;  2PZW A;  1WOC A;  1CKN B;  1ET9 A;  1XX8 A;  3V05 A;  1RHP A;  4JI6 L;  3S1Q B;  1A62 A;  3VR4 A;  5T1I A;  2YU9 B;  1Z6H A;  4A3F B;  2CHB D;  4X6A H;  3A0J A;  3GTP H;  5J1Z A;  1TS5 A;  3HOU G;  4A3M B;  3NWT A;  3NPP A;  2JA6 B;  3NXW A;  2JEB I;  1IBK L;  1R4Q B;  4GKJ L;  4FNF A;  3ICE A;  1STG A;  3UE0 A;  2JSO A;  1B3A A;  5BN5 A;  1GUN A;  1Q1E A;  1RKN A;  1TU2 B;  1M1K C;  5CV4 A;  3HOZ B;  1HUN A;  1PZJ D;  1TS4 A;  1BR9 A;  1VQL A;  1A15 A;  2VS1 A;  1J9O A;  3D0F A;  1W6K A;  3JAM c;  2NN6 H;  2K7V A;  1X9N A;  1EY7 A;  5C0X J;  5F2D A;  4LF8 Q;  3FRP B;  1A6X A;  4PMB A;  1QNK A;  2CWP A;  3LX0 A;  2NVY B;  4P71 A;  3NSW A;  1ZEQ X;  2IJ0 A;  1V1P B;  3S16 B;  4OX9 Q;  4DR1 L;  1PH2 A;  3J7A F;  1Y8O B;  1KL9 A;  2HCI A;  1STN A;  1XXG A;  1RIP A;  3NTK A;  5FJ8 H;  1HJP A;  1AN8 A;  2R93 H;  3J81 c;  3NE5 B;  1BVS A;  3U9S A;  2VZA A;  5NUC A;  2JA8 B;  3CP0 A;  4LFA L;  1D8L A;  1I4R A;  5C3W A;  2LXK A;  2ATW A;  3L7Z C;  3EBE A;  1XJV A;  4DNI A;  2UXD L;  1BO0 A;  3A7A B;  1XMQ Q;  4IO9 A;  3V2T A;  2B63 B;  4LFC Q;  1QWY A;  5JEA H;  1PTO H;  4EVO A;  4DR5 L;  2NZO A;  3MFY A;  3GTL H;  2HIX A;  3PIO 3;  4DV3 Q;  1FL0 A;  2VL6 A;  1HRJ A;  2NVX H;  4OGQ C;  1SR3 A;  4XDX A;  3K58 A;  1JB3 A;  2L1B A;  2YTV A;  1FR3 A;  1NAP A;  3E6Z X;  4KI0 A;  1QZH A;  2NVT B;  3HP3 A;  2E76 C;  1BBU A;  2J0T D;  5L37 A;  1R9T B;  2HHH Q;  1TS2 A;  4GLX A;  1LTG D;  2B2V A;  1L0Y B;  1YJW A;  2CCZ A;  4MTK A;  2K5V A;  3HOV H;  3K7A H;  4P73 A;  2Q2U A;  5IIF A;  2B3G A;  5CV5 A;  1OO9 B;  4QF4 A;  4HED A;  2OTJ A;  2K4K A;  3Q24 A;  2L11 A;  1FJG L;  2A8V A;  4IFD J;  4C3I B;  3OTO L;  4A3G H;  3NEL A;  3NWS A;  3TP8 A;  3KF6 A;  3NBH B;  3K5O A;  2OQ0 A;  1QNU A;  3TZU A;  4GN5 A;  5ELF A;  3M7N A;  2Q2H A;  4QQB X;  4OXP A;  4GNX B;  1GKH A;  3K81 C;  4G4K A;  5CMD A;  3F8T A;  1E1T A;  3J81 i;  2CFM A;  1SJE D;  4KTA A;  4PNY A;  1VQK A;  1C7Y A;  4JPB W;  4ZKC B;  1IBK Q;  5EPL A;  5I9O A;  4GKJ Q;  1SAP A;  1ICW A;  3S24 A;  1EZ6 A;  2B8G A;  4K5X A; 
#chains in the Genus database with same CATH homology
 3SHL A;  4BA1 I;  3K6O A;  5JVG 3;  3SEB A;  1BDO A;  4A3B B;  2XRQ D;  3QJY A;  4X3K A;  2FMC A;  1I3Q B;  1EY0 A;  1ZYR C;  4C3J B;  2SEB D;  2F03 A;  1IKL A;  1H9S B;  1TVX A;  3FPU B;  1RTO A;  2EXZ A;  3GTL B;  3PMF A;  3BDC A;  3QG1 A;  2RDH A;  5IT9 E;  1JOO A;  3EQL C;  3X3M A;  4NMZ A;  2F0U A;  1EQV A;  1SYD A;  2F0N A;  2PYK A;  2PMZ B;  2HDM A;  3K7A B;  4HCS A;  4P2C B;  4DK1 A;  1WTP A;  3GD7 A;  1WTX A;  1AZP A;  2A6E C;  4TSS A;  4C56 C;  4QIW B;  1G91 A;  1DON A;  5C0X I;  2PPB C;  3T51 B;  3FPP A;  1IYV A;  3GQB A;  5KYI A;  2R61 A;  2B8F A;  1QB5 D;  3RLF A;  1EEI D;  4B08 A;  2L55 A;  5EQ0 A;  1EZ8 A;  3HEJ A;  1PZK D;  3V96 A;  4H7B A;  1SFO B;  4RAU C;  3GV3 A;  1JR0 D;  5C3E B;  3E5S A;  5E4X A;  4M1U B;  2KA7 A;  3M3Y B;  4OL7 A;  4J1M A;  1MGS A;  1SJH D;  1DOL A;  1PLF A;  3A8K E;  4HAE A;  5FO8 B;  2AQ1 B;  2MJ8 A;  1HA5 A;  1BCP D;  4K8I A;  3A55 A;  1EIH A;  5TSS A;  5CC4 A;  1KNA A;  4RKB A;  1YNN D;  3I90 A;  1CI3 M;  1PRT F;  2I07 B;  3M85 A;  3J7Y W;  2Q8I B;  1CQF A;  1ROD A;  5FLX L;  4EQP A;  4ABN A;  2EVB A;  3R3O A;  2O5J C;  1E2V A;  1TWF B;  1I4G A;  4J6H A;  3S15 B;  4IFD I;  5CYU A;  2A69 C;  1PXU A;  1B9M A;  4RHS A;  5FKA C;  5I4D A;  3GTK B;  2EY6 A;  1VMP A;  2SNM A;  3NQT A;  1STA A;  3SR1 A;  2KED A;  3MC0 B;  2KOL A;  2B2U A;  2Z8L A;  3A56 A;  2PNR C;  4G7O C;  1EEF D;  4A93 B;  1QIL A;  3CRK C;  3PUZ A;  1EY6 A;  4XIG S;  1D5Z C;  1ZKO A;  2NZ1 D;  1SE3 A;  1O80 A;  2F0G A;  2IWH A;  5IGG A;  3K5M A;  1K8M A;  2BDN A;  1TII D;  2SOB A;  1BQQ T;  2F0J A;  4BY7 B;  1F9Q A;  2B2U C;  4CJ2 C;  2F0Q A;  3KUP A;  3HOW B;  4HCE A;  1EYC A;  1O7L A;  3R93 A;  3GTO B;  3OOC A;  1U4L A;  1S5F D;  2KEE A;  3CU7 A;  3H94 A;  2JA7 B;  5C5L A;  3D8G A;  4ME5 A;  2M00 A;  1GUG A;  2M2L A;  1ENC A;  3Q0A A;  5JAV A;  3S1N B;  2K6A A;  4A3I B;  3SXH A;  4RCN A;  1EYD A;  1CM9 A;  3DEO A;  2RDF A;  1X3P A;  1SXT A;  3KF8 A;  1NCV A;  3JAM L;  1SDF A;  3DHQ A;  2RBM A;  4MHE A;  2XSC A;  1RCV D;  1PRT C;  3W3A A;  4TQU S;  2EOT A;  2LY7 A;  2Y0S B;  2F0O A;  4OIJ A;  1F77 A;  3OPO A;  3AU7 A;  2V4D A;  4OO1 H;  1JWM D;  1R4P B;  2K1B A;  4KMU C;  3J81 L;  2MGS A;  2NB0 A;  1HPC A;  3WOF A;  2C5C A;  4C2M B;  3PUW A;  2VB3 X;  4HR7 B;  3A8I E;  5C5M A;  1V8Q A;  2K04 A;  1SMY D;  3M4Y A;  4YIJ A;  1KAA A;  1TWG B;  2HDL A;  2B8G A;  1U4M A;  5ELC A;  3QO2 A;  3FKI B;  2A73 B;  4C3H G;  3CQZ B;  1RTN A;  4C1N K;  1A2T A;  1VMC A;  1WVL A;  1C48 A;  4HSP A;  3R2T A;  1Y8P B;  2EJG C;  1ESF A;  4R9W A;  4K2K A;  4S3S A;  2PZT A;  1TT2 A;  1IKM A;  3Q22 A;  1WTQ A;  2JYO A;  5I9P A;  3BS1 A;  4IZ8 A;  4WFN 3;  4KN7 C;  4BBS B;  2H1E A;  2B2T A;  4LAA A;  1B50 A;  2FJ2 A;  2Q8T A;  3ZYY X;  4LJZ C;  1AEX A;  3VYS A;  3BDL A;  2EE1 A;  1LAB A;  4G7H C;  1GUO A;  2F0W A;  1HCZ A;  1D2B A;  1OXT A;  1E2W A;  1ZYR D;  4FO2 A;  4DU9 A;  3I3C A;  2F0L A;  3D6C A;  3U9O A;  2B2T C;  4DF7 A;  2QKI C;  4DXG A;  2XWB B;  2B39 A;  1F2M A;  3M7G A;  2EYO A;  3W2D A;  4QUF A;  5M5W B;  2E2H B;  3HKZ B;  3EVQ A;  3NTI A;  4KKS A;  1NR2 A;  1AFP A;  3GP7 A;  2A6E D;  2XN9 C;  3IL8 A;  3GTM B;  3S1R B;  2IX0 A;  2X6L A;  3P7J A;  3MXU A;  4H44 C;  2ENB A;  1KLG D;  5J39 A;  1TY0 A;  3BZD B;  3RUZ A;  2IPK D;  4Y7N B;  2ZT9 C;  2R7Z B;  2KEC A;  2RQX A;  3OMG A;  2Z4I A;  1D5X C;  3L3O C;  2KCN A;  4JBW A;  3URY A;  2AWN A;  5EBC A;  3UI2 A;  1CA5 A;  3BVM A;  4XQN A;  3BDO A;  2JP1 A;  4KV6 A;  3T53 B;  4DN4 M;  4V19 0;  1Y1V B;  5COR A;  2EY5 A;  1TY2 A;  1XWE A;  3QIA A;  4CKE A;  5I6Y A;  1WD1 A;  1JOR A;  2NYZ D;  1J8I A;  5E1F A;  1X3Q A;  4DAY A;  5LHY 1;  4IUQ A;  1CFM A;  4LK1 C;  4ZUJ A;  4FF4 A;  5G3L D;  2K5Q A;  4HTH A;  3F2U A;  5IGC A;  4FYD A;  1SYE A;  1Y1W B;  2A5H A;  1EFI D;  3LWE A;  1DD2 A;  4HMI A;  1G6Z A;  1LTR D;  2WKD A;  1PRT B;  4HSV A;  2DY8 A;  3BVG A;  1S5C D;  4KK7 A;  3J80 L;  1F9P A;  5KNB A;  3RZD B;  4ZYS A;  4AYB B;  4PQX A;  1HTP A;  2MP1 A;  2JA5 B;  3HOY B;  2EZV A;  3DXJ C;  4BBR B;  3ONA B;  1HQR D;  3MEH A;  1GOZ A;  4DNR B;  4OO1 G;  4BS9 A;  2A69 D;  4A3K B;  3HZX A;  5DNF A;  2RSO A;  5DEH A;  4A3D B;  4HMJ A;  3TP7 A;  2KHS A;  3S9W A;  1Q1B A;  2D2C C;  3AMU A;  2B2V C;  2I46 A;  1F2Y A;  3BG3 A;  3C2P A;  5EKI A;  3KBG A;  1VF7 A;  2XVS A;  2M9V A;  4DA2 A;  1G2T A;  5E4W C;  1IW7 C;  2WB1 B;  1QOH A;  4KD3 A;  1EIG A;  2HCC A;  4ZLT F;  2VNU D;  4KD4 A;  1PDQ A;  2E74 C;  3H91 A;  1WTW A;  2ICI A;  1DZ1 A;  1TWH B;  4L8J A;  1A3T A;  1CK1 A;  2DY7 A;  5M5X B;  3KLR A;  1Q90 A;  4ZAI A;  3I70 A;  5T1G A;  2RVL A;  1BOS A;  3N52 A;  1H9M A;  2KCC A;  2E2I B;  3P20 A;  3S1M B;  2A74 C;  1H9R A;  1M8A A;  2EYP A;  3MXG A;  3NTH A;  4IFD H;  2CQA A;  5FK9 C;  4FF1 A;  5CV6 A;  5LL6 X;  2K5W A;  5EGT A;  2VUM B;  1EQT A;  2PZU A;  5D14 A;  3MA2 B;  4E6I A;  1LTA D;  3I73 A;  1HFN A;  1SBB B;  2XRS D;  1TS3 A;  3QOJ A;  4Q0F A;  2WAC A;  2RKS A;  1FNV A;  4IUN A;  5C4J B;  3IKJ A;  1C8C A;  3SDZ A;  3KLS X;  2XIW A;  4KKU A;  5JVH 3;  3D4R A;  4FF3 A;  1SNO A;  2YYZ A;  4V0B A;  2Q8R E;  4PMC A;  3M4O B;  3CKI B;  5C4Z A;  3VR6 A;  1EOT A;  1PRT D;  2D5D A;  5M5Y B;  5ELD A;  3SE0 A;  3OMC A;  4DAP A;  5KND A;  4CJ0 B;  5M9O A;  3TZD A;  2NN6 G;  2LMC B;  3P1H A;  1G8Z D;  1OXV A;  1SNP A;  2KQ3 A;  2ICE C;  5HGT A;  5C4X B;  1GUS A;  2K05 A;  1I4Q A;  4EGV A;  3O13 A;  2R6G A;  1S5E D;  5IOC A;  4N9P A;  4U67 3;  2DN8 A;  1BXT A;  5DAU A;  3A54 A;  3GO5 A;  1JCK B;  2F0M A;  1IHZ A;  3T4A C;  2QF7 A;  4O42 A;  2OF1 A;  3H6M A;  4C3J G;  1JOQ A;  1HFG A;  2WKC A;  5KYL A;  5JEA G;  1FYC A;  4ZUI A;  1SE4 A;  2PQE A;  4O1N A;  3QWN A;  3H0G B;  4FVM A;  5D3I B;  1SYC A;  1M4V A;  4Q5V A;  4RGN A;  1RD9 D;  1STB A;  2F0H A;  4RGT A;  1BCP F;  2AUJ D;  5E3F A;  3AB9 A;  1EY5 A;  2D9U A;  2IL8 A;  5A2Q L;  3A8J E;  3ERO A;  5I2Y A;  3VYR A;  3VA7 A;  4TKO B;  4I65 A;  3MHB A;  1SND A;  1K8O A;  1TKW B;  2F0V A;  1B53 A;  2O2L D;  2JE6 I;  4LMQ D;  3P75 A;  1LAC A;  3S14 B;  3NHH A;  2XNA C;  5EJW A;  4XYO A;  4RWS C;  1I50 B;  2MUY A;  4CKB A;  2MPM A;  1DM0 B;  5CBA E;  2GA4 B;  3D31 A;  5M3M B;  3DEP A;  3FEW X;  2F0D A;  1K83 B;  3WDN A;  4X3U A;  1WTR A;  1SYF A;  3IFD A;  3NK9 A;  4RH6 A;  5FLX E;  4OHJ A;  3TBI B;  2F1M A;  1PTO F;  3G7L A;  5CV9 A;  3K5L A;  4KN4 C;  5C44 B;  4IUV A;  2RA4 A;  1JIC A;  1RDP D;  3I72 A;  5IGF A;  2EPB A;  1HXY D;  5KEE A;  3RMH A;  1HUM A;  1GHJ A;  1U4R A;  1XTC D;  3PUY A;  1KAB A;  3GTJ B;  4N9T A;  1ENF A;  2N55 A;  3MVV A;  1I6V C;  3FMC A;  2B2W A;  4RGM A;  4ZKB B;  3DM1 A;  2EDG A;  4C1N I;  2NBF A;  5K36 H;  4KY5 A;  4KKT A;  3FDT A;  4WOR A;  2FFK B;  1JC7 A;  4NKL A;  2NVQ B;  3DMU A;  1I4H A;  1PFB A;  2AWO A;  1EWC A;  2K01 A;  1LT3 D;  3D4D A;  3KBX A;  4ODG A;  1GHK A;  1STY A;  3HOU B;  4IN3 A;  1NSN S;  2B2W C;  5ELE A;  5C4H A;  1RF2 D;  2JXM B;  1E2Z A;  2EYF A;  3CRL C;  3PUV A;  2K32 A;  1A3U A;  4F88 A;  1D1K A;  1CA6 A;  3S2D B;  5IGE A;  3EJI A;  2JEA I;  4G57 A;  2DNC A;  3VYT A;  5EKK A;  4B9W A;  4UDU C;  4IUU A;  2WP8 J;  2F3W A;  4OIK A;  1ZXT A;  1C4Q A;  3GTG B;  2WV6 D;  1H9S A;  4H13 C;  4ULL A;  1Q3L A;  4BWG B;  2FIN B;  5COY A;  3TP5 A;  3S2H B;  1HA6 A;  3HRZ C;  4CKC A;  2A68 C;  3JAM E;  1FD7 D;  1PYW D;  4MN3 A;  4XXE A;  1S5D D;  4J8Q A;  1IW7 D;  1QJO A;  2K28 A;  4ZQ3 A;  1S5B D;  1KTK A;  1PTO C;  2ZXR A;  1PMR A;  2LFN A;  4L6T B;  4M8A A;  3OWE B;  3FVQ A;  2L0C A;  3HG9 A;  1DOM A;  3D3R A;  3D6W A;  4DGZ A;  5JPN C;  1Q8I A;  2BA0 A;  2FHT A;  1RJT A;  3MWY W;  3VA5 A;  1EL0 A;  1LT6 D;  2K5D A;  2XWJ B;  1DXM A;  4K14 A;  4F8M A;  1I6H B;  4FXD A;  1LTS D;  3BVZ A;  3QB3 A;  5JOB A;  1D5M C;  5ELB A;  4OO1 I;  1DOK A;  3PUX A;  1TWA B;  1GJX A;  2AUK A;  1ENA A;  1SYB A;  4RKL A;  2A6H C;  1EU4 A;  3LNN A;  1ILP A;  4QB4 A;  5FOB B;  1WTV A;  4ID6 A;  5JEA J;  2OXP A;  2EJF C;  2H4O A;  3HGB A;  2MHV A;  1EY4 A;  3LWU A;  2EY1 A;  3C1F A;  2F0T A;  2IX1 A;  5FO7 B;  4KHV A;  3OWF A;  1XYI A;  2CW0 C;  4Z9C B;  1FGB D;  5IOD A;  3MTS A;  4DK0 A;  3ERQ A;  3SVM A;  3MXP A;  2KUM A;  5EPJ A;  2G9D A;  5DM6 3;  3J7A V;  3BYY B;  4UAI A;  4RA8 A;  2QCP X;  1YNJ C;  1H9J A;  1LT4 D;  1UEA B;  1IYU A;  2HQE A;  5KGU A;  1Y8N B;  1V1O A;  2LKV A;  2VB2 X;  1VCI A;  1VDZ A;  1CTM A;  1SSO A;  2L4N A;  3OSO A;  1Z47 A;  5KRU A;  3DWQ A;  5CGK A;  1E0B A;  1QCB D;  2BE5 C;  4XQQ A;  1CZW A;  3MAQ A;  4KJO A;  1PFM A;  4X3T A;  1EY8 A;  1STH A;  3R8B A;  1F9S A;  3DUZ A;  4IAL A;  3GTQ B;  2HUG A;  1X32 A;  3I91 A;  2L5T A;  1SMY C;  1HQM C;  1LTT D;  1GXD C;  3VR5 A;  5K36 G;  4IUP A;  3I4M B;  5C0X H;  1B2T A;  4CHT B;  2BCO A;  1AW7 A;  5IT9 L;  1Q12 A;  2EY2 A;  3KK7 A;  1L0X B;  3K59 A;  4PMW A;  3SK6 A;  5EBD A;  2J4X A;  1LV9 A;  3GTP B;  2SDF A;  2PW5 A;  3RZO B;  1SYG A;  2ID0 A;  1O7Y A;  5G3L F;  1ESR A;  1BBX C;  1AZQ A;  1BUV T;  3IFT A;  3KLS A;  1BCP B;  2WIN B;  4XT3 B;  2F0I A;  1B9N A;  2QDB A;  1OXU A;  4QMG A;  3IAY A;  2D62 A;  4CBV A;  4K5W A;  3C1E A;  1LO5 D;  1CZG A;  3PIP 3;  2NN6 I;  5KNC A;  4R8N A;  1I4P A;  3K57 A;  1B44 D;  3TME A;  4NP5 A;  1CHQ D;  4B9X A;  1STE A;  1GUW A;  4CJ1 B;  4RFB A;  2PO4 A;  1EU3 A;  2R93 B;  4F87 A;  2Z4H A;  3ND9 A;  1DCZ A;  1TQO A;  4NW2 A;  2KVM A;  2J7Z A;  2X6G A;  3J80 E;  1W6J A;  1PTO B;  5JPM C;  1F2Z A;  2VXW A;  4FXG C;  1CHP D;  1II3 A;  2NVX B;  2FMM A;  2EJM A;  3X3N A;  1MBY A;  5IGB A;  3C3L A;  1HTL D;  3H3V C;  2KJX A;  1O7Z A;  2NTT A;  1D1I A;  1LT5 D;  2X69 A;  1LLR D;  3HOV B;  5I6W A;  5J22 A;  1FNU A;  1LTB D;  1B4O A;  4DFA A;  1KLU D;  2F0P A;  1MI2 A;  4RGO S;  4I7Z C;  1UUP A;  1U4P A;  4A3G B;  3Q6S A;  3OIQ A;  3I4L A;  2F4I A;  3TN2 A;  1BF4 A;  4ZK9 B;  4JK1 C;  3A7L A;  2BA1 A;  1DYQ A;  2PCF B;  4C3I G;  5IGD A;  3D4W A;  3H09 A;  4DAV A;  1ML0 D;  3MFG A;  3T13 A;  5CV8 A;  4DXF A;  2K33 A;  2F3V A;  2EYJ A;  5CR3 A;  4TRD A;  4XYQ A;  1PZI D;  2N88 A;  4GZY C;  1WCM B;  3QOL A;  5K5P A;  3L9A X;  2E2D C;  1JWS D;  2C9O A;  4R8I A;  4IUR A;  4U68 A;  4BY1 B;  5FO9 B;  1A2U A;  1JE4 A;  1PFN A;  2NTS A;  2O4X A;  4DNT B;  1CT1 D;  1EYA A;  4XTC S;  2NWG A;  1SNQ A;  2BDO A;  2R92 B;  1ONL A;  2OEO A;  4FP5 D;  1H9K A;  3PV0 A;  3MXN A;  3SK4 A;  1EY9 A;  2L12 A;  4H0L C;  4L63 B;  2EYM A;  1SE2 A;  3Q23 A;  5C3X A;  5EPK A;  2A68 D;  2EYL A;  2WII B;  1WTO A;  3OW7 A;  2O5I C;  5C0X G;  3EA6 A;  1ET6 A;  1G29 1;  1AP0 A;  3CHB D;  2F0E A;  1PTO D;  1NUC A;  3I8Z A;  4G7Z C;  3G6J B;  2SNS A;  5I2X A;  5D65 A;  4HN7 A;  1LTI D;  4C3H B;  3SK8 A;  1ILQ A;  1O78 A;  2TMP A;  1BNZ A;  2E75 C;  5A35 A;  4A3E B;  3RD4 A;  1KDB A;  1UNS A;  1V1P A;  5CBE E;  2AQ3 B;  2NUC A;  2QEJ C;  3S17 B;  1CQV A;  2EYH A;  4ZRZ A;  1KDA A;  5ISR A;  3WOE A;  3HOX B;  4XQJ A;  4FXK C;  3R2I A;  2F0F A;  2LS0 1;  2A6H D;  4PV1 C;  2Z1C A;  1Z7T A;  1T5E A;  1IL8 A;  4RHR A;  3PO3 B;  3NBI A;  1G2S A;  3SK5 A;  1MSH A;  1JWU D;  1MSG A;  2ZXP A;  5M3F B;  1OXX K;  2G9H D;  1A3V A;  4ILW A;  5D3D A;  2IX3 A;  1WD0 A;  2CW0 D;  2B2Y A;  4IFD G;  5C6A A;  4K5V A;  2RDG A;  1V43 A;  3I4N B;  4EQO A;  1HHV A;  4KJN A;  3E0J A;  5A2Q E;  1F2L A;  2K03 A;  5KIX A;  3NQI A;  3ND8 A;  1YNJ D;  1FNW A;  3VR3 A;  1T5X D;  3K0Y A;  3EFX D;  2AQ2 B;  1SNM A;  4WJW A;  4WRD A;  1QE6 A;  4IUT A;  1EWH A;  4F7X A;  2ZXO A;  2RSN A;  4KY6 A;  5BN3 A;  3K5N A;  3NBH A;  1S4Z A;  5HUR A;  1OXS C;  3GV6 A;  2BOS A;  5CV7 A;  2BE5 D;  4QCL A;  2L9H A;  1GUT A;  1KDC A;  2B2Y C;  4QUC A;  1TR5 A;  3OHX C;  4KHZ A;  2F0S A;  3ITP A;  2QIL A;  1I4X A;  1BCP C;  3TP6 A;  1YNN C;  3TSS A;  3DWA A;  1UAP A;  2CVR A;  3VR2 A;  1D6E C;  4K8J A;  4A3J B;  3HS0 C;  4EQN A;  5DM7 3;  2F0K A;  1B1Z A;  1F9R A;  3PO2 B;  4K6D A;  1QG7 A;  3NP8 A;  5JJZ A;  4NDX A;  2IT1 A;  4X3S A;  2OT2 A;  4K6L A;  4KY7 A;  5LL6 S;  4K2L A;  3T56 B;  5EKL A;  3C46 A;  4XT1 B;  2DNE A;  2IW3 A;  4FF2 A;  3T16 A;  3DWP A;  3BYT B;  1Y69 U;  3MZ5 A;  3TDQ A;  3J81 E;  5BN4 A;  5AFW A;  3OIP A;  1TWC B;  2WAQ B;  2PW7 A;  1DJR D;  4IQZ A;  1VF5 C;  3VYU A;  2R3Z A;  1JQY D;  1MD2 D;  3NUC A;  1U9R A;  1NR4 A;  1KNE A;  2TSS A;  1SEB D;  1SNC A;  2E2J B;  4CGY B;  4MIU A;  3N6R A;  1JOK A;  4BA2 I;  4RCO A;  2PZW A;  1ET9 A;  1XX8 A;  3V05 A;  1RHP A;  3S1Q B;  3VR4 A;  5T1I A;  2YU9 B;  1Z6H A;  4A3F B;  2CHB D;  5J1Z A;  1TS5 A;  4A3M B;  3NWT A;  3NPP A;  2JA6 B;  3NXW A;  2JEB I;  1R4Q B;  4FNF A;  1STG A;  2JSO A;  1B3A A;  5BN5 A;  1GUN A;  1Q1E A;  1RKN A;  1TU2 B;  3HOZ B;  5CV4 A;  1HUN A;  1PZJ D;  1TS4 A;  1BR9 A;  1A15 A;  1J9O A;  1W6K A;  2NN6 H;  2K7V A;  1EY7 A;  5C0X J;  5F2D A;  3FRP B;  1A6X A;  4PMB A;  1QNK A;  3LX0 A;  2NVY B;  3NSW A;  1ZEQ X;  2IJ0 A;  1V1P B;  3S16 B;  3J7A F;  1Y8O B;  2HCI A;  1STN A;  1XXG A;  3NTK A;  1AN8 A;  3NE5 B;  3U9S A;  5NUC A;  2JA8 B;  5C3W A;  1I4R A;  3L7Z C;  1BO0 A;  3A7A B;  3V2T A;  2B63 B;  1QWY A;  5JEA H;  1PTO H;  4EVO A;  3MFY A;  3PIO 3;  1HRJ A;  4OGQ C;  4XDX A;  3K58 A;  1JB3 A;  2L1B A;  1FR3 A;  1NAP A;  3E6Z X;  4KI0 A;  2NVT B;  3HP3 A;  2E76 C;  1R9T B;  2J0T D;  1TS2 A;  1LTG D;  2B2V A;  1L0Y B;  5IIF A;  5CV5 A;  1OO9 B;  4QF4 A;  4HED A;  3Q24 A;  2L11 A;  4IFD J;  4C3I B;  3NWS A;  3TP8 A;  3K5O A;  1QNU A;  3TZU A;  3M7N A;  5ELF A;  4G4K A;  5CMD A;  1SJE D;  4KTA A;  4PNY A;  4ZKC B;  5I9O A;  1SAP A;  1ICW A;  1EZ6 A;  5EPL A;  4K5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...