1B2TA

Solution structure of the cx3c chemokine domain of fractalkine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
MQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FRACTALKINE)
publication title Solution structure and dynamics of the CX3C chemokine domain of fractalkine and its interaction with an N-terminal fragment of CX3CR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1b2tA00
2KECA 1PFNA 4X3SA 2B2VA 1ICWA 1PFBA 3FPUB 5CBAE 1DOLA 3G7LA 4MN3A 1B4OA 2DY7A 1ILPA 5EPJA 1RJTA 5EJWA 4X3KA 4CJ1B 1EIHA 1G91A 1Q3LA 3HP3A 2R3ZA 3MWYW 3LWEA 4MHEA 5DNFA 1NR2A 3GV3A 3IL8A 1KNAA 1U4RA 1NCVA 2NYZD 5E4WC 2RA4A 3I3CA 3I90A 2EPBA 4IUUA 2RSOA 5EQ0A 4X3UA 1IKLA 1X32A 3DM1A 2MGSA 1X3QA 3Q6SA 4LMQD 4O42A 4IUTA 1B53A 2B2YC 1NR4A 2B2WA 2K03A 1QNKA 4HAEA 2RVLA 4ZK9B 2N55A 5AFWA 1WVLA 1WD1A 3IFDA 1HHVA 4IUQA 5EPLA 1HUNA 1PFMA 1NAPA 3SVMA 2B2YA 1SSOA 3N52A 3MTSA 1ILQA 2B2UA 1EL0A 1O80A 2JP1A 1M8AA 2K01A 2BDNA 3KUPA 3QO2A 1JICA 1MI2A 5EKIA 2K05A 2MPMA 1WTRA 1X3PA 5CMDA 2KOLA 2FJ2A 4ZLTF 4XT3B 2K04A 4HCSA 3UI2A 1U4PA 2KUMA 2IL8A 1SAPA 1TVXA 2J7ZA 1DOMA 4DN4M 2HCIA 4IUPA 4UAIA 3H91A 1EIGA 1RHPA 1SDFA 4NW2A 4ZKCB 5E4XA 3FDTA 1U4LA 1XX8A 1PDQA 1JE4A 1S4ZA 2NWGA 4OIKA 4U68A 1CA5A 3ONAB 4HEDA 1WTWA 2L12A 2M2LA 1HA6A 4RAUC 2JYOA 1HRJA 1G2TA 2HCCA 1B3AA 3R93A 4ZKBB 1U4MA 2FINB 2L11A 1B50A 2HUGA 2XIWA 3D6WA 3GV6A 3I8ZA 2CVRA 5JJZA 1HUMA 4RWSC 1KNEA 1QG7A 2L4NA 3P7JA 1BNZA 5D14A 1ML0D 5CBEE 1J8IA 1G6ZA 2FHTA 1O7ZA 3F2UA 1VMPA 2FFKB 2B2TC 4OIJA 1IL8A 1AZPA 1F9QA 3TN2A 1EOTA 3TZDA 1C8CA 4ZAIA 2Q8RE 2SDFA 4IUVA 2X69A 4HSVA 4RA8A 1IKMA 4QUFA 3DEOA 2L9HA 1J9OA 1A15A 1O7YA 1PLFA 2B2VC 1MGSA 2EE1A 5T1GA 1RODA 5CORA 1ESRA 2KEDA 2KEEA 4IURA 2H1EA 2Q8TA 1MSGA 4QUCA 2VXWA 5COYA 4R8IA 2K28A 1WTXA 4X3TA 1WTQA 2MP1A 2EOTA 2KVMA 1F2LA 1BBXC 1WTVA 2HDLA 1WTPA 1MSHA 1RTOA 2L1BA 1F9PA 1EQTA 2HDMA 2X6LA 1E0BA 1F9RA 2DY8A 2N88A 4R9WA 5T1IA 4CJ2C 4CJ0B 3KBXA 1WD0A 1BF4A 2NZ1D 1DZ1A 1DOKA 1VMCA 1HFNA 1AP0A 2D9UA 1QE6A 2B2WC 5EPKA 2K1BA 1ZXTA 4XT1B 2RSNA 1CA6A 1GUWA 1CM9A 2MJ8A 1WTOA 2B2TA 1BO0A 1RTNA 4XDXA 5D65A 3DEPA 1F9SA 2B2UC 3I91A 1G2SA 1B2TA 1LV9A 2X6GA 2FMMA 1HFGA 1XYIA 1DONA 1AZQA
chains in the Genus database with same CATH superfamily
1LTLA 5CC4A 3DWPA 4DR6Q 4C3IG 3BVMA 4MN3A 2F4VL 1E1TA 2PI2A 2JA6G 4K6LA 2K14A 2I5LX 5FKAC 3PF4A 3S2HB 2UUAL 1K9MC 1FJGL 3DLLA 4DR5Q 3KYHC 1BOSA 2R7ZB 3J7A5 3CP0A 2Q2UA 1GO3E 2NZOA 3PIP3 2LMCB 3E9IA 4K2KA 3H6MA 4BY1H 1E22A 4IUTA 2UUCL 5JEAJ 3KLWA 4DV4Q 3GTJB 4A3DB 2LSSA 5E1FA 4DUZQ 3FHWA 2IWHA 3K57A 3K7UC 3J80c 5F2DA 5JJIA 4LF6L 2JA5H 1PHJA 4KD3A 2NBFA 4L63B 1STAA 1ZYRC 3CCJA 3FMCA 2A19A 4GN4B 1RKNA 3F2BA 1PRTB 1SBBB 1GUOA 4QCLA 1PZKD 4IJHA 3TDQA 4JCVE 1VQJA 1SE2A 5D3IB 2F0HA 1HR0L 3PF5A 4MTNA 2ICEC 5ELDA 4BY1G 3RLFA 3RN5A 2K5NA 2JYOA 4DKAC 4K5VA 4RGTA 1CHPD 2NVTB 1EY8A 1B3AA 4DV0Q 2CW0C 3LGJA 3OW7A 3NWTA 2EIFA 2DNEA 2XWJB 1RD9D 4GKJL 4LUVA 3MC0B 3OIPA 4JI6L 2JA5G 1VMPA 4NP5A 4OIJA 1PFSA 1S72A 3I4MB 2R93B 5L37A 4L5TA 3BDCA 3H0GB 1PH3A 1HNXQ 1RL2A 3QB3A 4BXXH 1BCPF 1XMOL 4C56C 4TRDA 4RKBA 2ZXPA 4PG3A 3J81E 4CKCA 1X9NA 3CC4A 1RTOA 1KIXA 1F9PA 2HDMA 1UE7A 1KRSA 1JJ2A 3CMAA 1I4GA 1DOKA 2K5DA 4JI3L 3D4RA 2F3IA 1EEFD 3IKJA 2KECA 4K6DA 4CKBA 2B2VA 4BXXG 4JI5Q 5IGCA 5LHY1 1R4QB 5EJWA 4IOAA 3VA7A 4DR3Q 1EIHA 3A56A 3LWEA 3STBC 4A3IH 3C1EA 3SE0A 2Z6BA 2UXBL 1JC7A 1D8LA 3M4OH 5I9PA 1TU2B 4G57A 1Z9FA 5HGTA 4IO9A 2RVLA 4K2LA 4A93G 4R4IA 1NAPA 1JB7A 4A3MB 2PMZE 2B2UA 2QDLA 5EKKA 2VL6A 2JP1A 2K01A 2WB1E 2PNHA 4XYQA 4AYBB 2F52A 3T51B 4CBVA 3OW2A 1TWCH 1SYEA 2K75A 4JBMA 2A73B 4KN7C 2HCIA 3S1MH 4TVAB 4QIWB 2XRSD 3VDYA 2Q2TA 4YHHQ 4G7HC 5C3EB 2C9OA 2GVAA 4WJWA 1FVIA 1CSPA 3H09A 4RCNA 1WJJA 3KF8B 4KY6A 1MKHA 2XGTA 4LF7Q 1G2TA 4P2CB 3V05A 4A3EB 2RDHA 4ZKBB 5C0XJ 2FINB 3PQIA 4R1JA 3W2DA 3EROA 1UEAB 1EY4A 1HUMA 4PV1C 3BG3A 4POFA 1PTOD 4DNTB 1GHJA 3W1GA 1II3A 2K4KA 4JPBW 5K36H 3FEWX 4Y52H 1W6JA 5JEAH 1H9KA 2UU9Q 4J8QA 5T1GA 3PIPA 2JA9A 1ESRA 3OPOA 1IBLL 2E2IH 5IYBH 4KTAA 5LMNL 4UDUC 3A54A 2AKWB 2F0OA 4A3BG 1WTQA 2MP1A 1VQHA 5FLXc 2NVYH 4FF3A 3KK7A 1YNJD 1WTVA 1D5XC 1MSHA 3I72A 3Q23A 1SNPA 4DAMA 3PGZA 4ZYSA 4TKOB 4JC0A 1WCMB 2PQAB 1HNZQ 1B44D 5IGDA 2RF4A 1ZXTA 5D65A 3NHHA 1V9PA 5JEAG 2O5JC 2KCNA 3ERQA 2X6GA 4C3JB 3MAQA 3SK8A 2K5QA 3B6YA 2YYZA 3J81L 5IYBG 2UXCL 1FNUA 1FR3A 2E2HH 3SK6A 4YY3Q 3GTJH 3HP3A 1XTDA 4BWGB 3I4OA 1W3SA 2K5WA 2QCPX 3FKIB 3I3CA 3I90A 3K5OA 4DXGA 4X64Q 1IKLA 1B53A 2VB2X 3MXNA 3A8IE 3NELA 2R7ZG 3TP5A 1V1QA 2P5ZX 3TQYA 3WWVA 5ELCA 4PMBA 2NVTH 3IAYA 3HOUB 1LTSD 4UHVA 4OO1H 4A3DG 2QW7A 2K50A 1ET9A 3KDFB 2EQSA 1SYDA 1SYGA 5LMUQ 2VW9A 1MIUA 1SDFA 2DUDA 4RGNA 3I4MH 2ZJPA 2R93H 1JE4A 1CA5A 4GNXA 5LL6X 3H0GH 3ONAB 2VQFQ 1WTWA 1WTHA 4RFBA 2V4DA 3M4QA 4FNFA 2KBNA 1C9OA 1KABA 3J7YW 5M3FB 4GLAC 1ML0D 4LF4Q 1JB3A 4DA2A 5GAHC 4OO1G 2SDFA 1K0SA 1L1OC 1YHBA 3FRPB 3W1BA 5IOCA 3PV0A 3CD6A 1DJRD 1Q86C 3NQTA 4LUOA 2IW3A 1K8MA 5CV9A 1I4XA 4OO1I 3I4MG 2BA0A 2R93G 4XQJA 3RLNA 2EOTA 2KVMA 1EYCA 3H0GG 4B3TQ 4DAYA 1A62A 2MFIA 3KF6B 5KRUA 3IRBA 3HG9A 3MEHA 4NXNL 4CDCC 3CCEA 2JN4A 3EA6A 2CWAA 1V1PA 2AQ3B 5JPMC 1ZYRD 4HR7B 2OTLA 1BO0A 4WRDA 2C5CA 3JC66 3I73A 3VR3A 4FYDA 5LL6S 4R4TA 1PFBA 4H7BA 1XNRQ 2AHOB 2DY7A 3SEBA 4X3KA 1ESFA 2R3ZA 3G6EA 2CW0D 3IL8A 4TQUS 4DNRB 4A3MH 4GS3A 3GO5A 1EYGA 1A3UA 1NBWA 3BZDB 1R9TB 1AE2A 4LWCA 3EQLC 3CQZB 2RSOA 4OONA 2EJFC 2QGQA 3T16A 4X3UA 2RQXA 3N6RA 3CMEA 4AQYL 5C3XA 5C6AA 1BBWA 1N36L 4ZK9B 2B63H 4HJ7A 3D31A 4M8AA 1L0YB 2N8NA 5C3EH 1VQGA 3CW2C 4G7OC 1IL2A 2EYMA 2K32A 4YWLA 1FNWA 2G5DA 4K8JA 5IODA 4A3EH 5CMDA 2JEAI 4A3MG 4A3LH 1SNOA 1V43A 2K5HA 5IGFA 3ULLA 1N32Q 2KHJA 3HOYB 4AYBG 5GAGC 4ZKCB 1TWHB 3CRKC 2XNAC 4NMZA 1UE1A 3JAMi 3OHXC 3HZXA 2B63G 2HCCA 5C3EG 2EYHA 5AJ3Q 1QG7A 3OMGA 2VZAA 3OOCA 3KJOA 4NB3A 4DU9A 3STBD 3F2UA 2FFKB 2B2TC 1KDCA 4A3EG 1T9HA 1M90C 3QIAA 3Q8DA 3F8TA 1RCVD 4ZAIA 3TZDA 3UDIA 4QUFA 3DEOA 4A3LG 4K8IA 3RR5A 1XPOA 2JQOA 3NXWA 5CORA 1X3FA 4EQPA 1NNXA 1G6PA 3MXUA 3R2TA 1IW7C 4JI8L 1I94L 4C3JH 4BBSB 4NPSA 2L1BA 2BH8A 1N34Q 1AW7A 2NZ1D 5NUCA 1U0LA 1Q1BA 4OWTB 5EBDA 1CM9A 3NPPA 3GDEA 2QF7A 2WV6D 4GKKL 2UXDL 2E5LQ 1G2SA 1LV9A 1WCMG 3UE0A 5CBAE 4ABNA 1KDBA 3NBHB 5C44B 4FF2A 1NTGA 3RZDH 4C3JG 1JT8A 3ULPA 2D62A 1HNWL 3D4DA 3HOUH 3WDNA 2RA4A 2BE5C 3A5ZB 1VQFA 4IPHA 4DR7L 4XIGS 4KY7A 5EQ0A 4PZ6A 2CQOA 1NR4A 1K3RA 2NB0A 1VF7A 2G9HD 2M00A 3FKIG 3A55A 3NEMA 5HGQA 3T1HL 3K5MA 2XTIA 5IY0A 4ZUJA 3KUPA 1YITA 1NUCA 2F0QA 2ZJRA 4FXKC 1I50H 1X3PA 4PZ7A 4B3MQ 1PZID 4IFDH 2BA1A 1U4PA 4QB4A 5M3FH 3GTQH 4DR4L 1H9JA 1SLJA 3H91A 1SYCA 4XQNA 4JI4Q 3K58A 3HOUG 2MQHA 1XMQL 1B8AA 5EKLA 1HH2P 3Q24A 1H9SB 1SNMA 4HSPA 2ZT9C 3SXHA 4X65Q 4DK3C 4NXML 1LTAD 1TIID 4HCEA 5D3DA 4A3IB 4EGVA 2E76C 2KA7A 3GV6A 3CCRA 2CVRA 1SYFA 1F2MA 5DEHA 1FNVA 1YEZA 2EXZA 1E7ZA 1PTOF 5G3LD 4LF5L 3HGBA 2LS01 4LFCQ 1D5MC 4DFAA 4IALA 5M3FG 1Q8KA 1GUNA 2H1EA 4QIWE 2ZTDA 4KHPL 5COYA 4IFDI 1KC8C 1GUTA 3AQQA 2HDLA 1KD1C 2ALYB 3K0XA 4X6AH 1JCKB 1KRTA 1IYVA 3I56A 1J5EQ 1A0IA 4X66L 3S1MB 4PMCA 1HFNA 2O2LD 3D0FA 5E3FA 2DN8A 4LNQA 3QG1A 2I0QA 1HZAA 4A3FB 4DR6L 3AB9A 3K6OA 1R9TH 4N9PA 3E0EA 2KJXA 3CQZH 4PMWA 4QJFA 4B3RQ 4J1MA 3BJUA 4HTHA 1PRTC 1K83H 2AQ2B 4DR5L 3VYRA 1GXDC 2XSCA 4UP9A 4JOIA 4DV6Q 1SNCA 4MHEA 2K7VA 4GOPA 1NE3A 2D2CC 3DUZA 1C7YA 1JQYD 1D1IA 3J7AF 4DV4L 1I4HA 2GA4B 1KDAA 2QDBA 2EPBA 4LFAQ 4DUZL 1QOHA 3MXGA 3SK5A 3DM1A 3EIVA 4HJ9A 1LM0A 3HOYH 1WI5A 2Y0SG 1EFWA 4IPGA 3D3RA 3TMEA 3UDFA 4OL7A 5EKIA 1SNDA 5IGGA 1XPRA 2Z1CA 1A2UA 4ZLTF 1VQLA 2K5VA 1DYQA 1Y8PB 4WFN3 5JPNC 4DV0L 4IOCA 4NW2A 4FF1A 3GP7A 3FDTA 1XNQQ 2A68C 4KKTA 2WKDA 4JBWA 2TMPA 2F0FA 4BA1I 4ID6A 1X6OA 1K0RA 2ID0A 4EQOA 5ELBA 2E2HB 3HOYG 3VR5A 1VQ9A 4KHZA 1KNEA 1HNXL 5D14A 5CBEE 3J80E 1O7ZA 2Z9HA 2A8VA 4BBSH 3DHQA 2O4XA 1F9QA 4DV7Q 1N8RC 2X69A 3S1NB 1DXMA 1HJPA 2EYOA 4MTKA 1V1OA 1N33Q 2EE1A 2EXDA 2E8GA 1S5ED 2EJGC 3BDLA 2E74C 1EU4A 3QOLA 2WIIB 2VY3A 1PV4A 1AE3A 2PW7A 2K52A 1B3QA 2DY8A 1QUQB 5C4JB 5C44H 1PH9A 4CJ0B 5JJKA 1TY2A 1YJNA 5EPKA 4A3CH 4JI5L 2K1BA 4BBSG 4XT1B 1STGA 4KJOA 1GUWA 2SEBD 3G6JB 4DR3L 2JA7B 1W2BA 1JOQA 2PZUA 3Q22A 3K5LA 1XYIA 1DONA 1X55A 4C2MB 3FPUB 3HFZB 2WKCA 1B4OA 1ILPA 4Y7NH 4RH6A 1LT4D 1ICFB 4EQNA 4KN4C 4Z9CB 3CKIB 1LACA 4OEMB 4QGUA 5C44G 4CHTB 2EY6A 1B1ZA 4XTCS 1HXYD 4A3CG 3V2TA 1I3QH 3GTGB 4OHJA 2K03A 4HJAA 2AQ1B 1OXTA 1JWMD 1WD1A 2IHFA 3IFDA 3MA2B 3SVMA 3A74A 1ET6A 4OX9Q 1YI2A 1TS3A 3QO2A 3ICEA 2V1CC 1Y14B 3T1YQ 2EY2A 3U4VA 1UUPA 4LF7L 1S40A 4J6HA 1TKWB 3GTPB 1U4LA 1NMFA 3AMUA 1EYDA 4A3JB 2OTJA 2F0WA 3D6CA 3ZJYC 4RGOS 2F0TA 1TY0A 1L0WA 2EJMA 5A2QE 2UU9L 4RMFA 1J8IA 1BCPB 5TSSA 1LTTD 1NSNS 4A3IG 2MNAA 2Q8RE 4HSVA 3GTLH 1X3GA 3VR6A 1ASZA 5KNCA 1A15A 1J9OA 1O7YA 2BE5D 3OMCA 5I9OA 2B63B 4K5WA 4A3FH 2KEDA 4P72A 4N9TA 2VQEQ 3L7ZC 3P75A 2EYFA 1HNZL 1EIFA 3WOFA 1CUKA 1VQ4A 1PH7A 1BBXC 1EQTA 3FPPA 3J80L 2VUMH 2G9DA 4CJ2C 1Q12A 1L0XB 1SEBD 3H3VC 4QMGA 1U9RA 2EY5A 4N8X1 3PMFA 1EQVA 1KLUD 4YY3L 1Q1EA 4JI2Q 3L9AX 3KLRA 3W5OA 4ALPA 4A3FG 3ND9A 1K8OA 4RKLA 2CFMA 2RCFA 2Z4HA 5IT9c 1DOLA 4DAPA 4X64L 1AEXA 4FXDA 3NK9A 3U9OA 4MZ9A 5FLXE 1KQSA 3R8BA 1D2BA 1PZJD 4GN3B 4BY7B 4JYAQ 2ICIA 4KKSA 5I6YA 3JAMc 4APVA 2ZXRA 1X54A 4IPCA 4KJNA 4R8NA 5K36G 1TWAB 3GQBA 4JW0A 3HRZC 1B9MA 2R7DA 2PYKA 3TZUA 1Y8OB 3I55A 1T5EA 1HHVA 2XVSA 1YHQA 3E9HA 2ES2A 1XXGA 4LAAA 5JAVA 3HOZB 1JICA 1SROA 2IPKD 4JI1Q 1WTRA 2JXMB 1Q82C 1LTGD 1ASYA 4M1UB 4AH6A 1ONLA 2KENA 2VQFL 4O0AA 4IUPA 1RHPA 1D7QA 2J4XA 3NUCA 4MIUA 4L8JA 1BDOA 2NWGA 3S1NH 3C1FA 1PYSB 4LF4L 5M5XB 3PO2H 1HA6A 1T5XD 3NWSA 3RZDB 1PRTD 2L11A 4Q5VA 4H13C 3T13A 1QJOA 4DR2Q 1SE8A 4CKEA 4JV5Q 1PH4A 5G3LF 3UDXA 4LF8Q 5C4JH 1LO5D 5DAUA 4B3TL 2OQ0A 2F0IA 2FXQA 1A3VA 1QWYA 2IX0A 2WINB 5M3MB 1PLFA 4G7ZC 1VQ8A 2RHSB 2BCOA 5EAYA 2KEEA 1HZ9A 1X65A 2ZJQA 5KGUA 2OCEA 2PZTA 4G4KA 2JA7H 2ATWA 1MJEA 1I50B 4CGYB 2YU9B 5A2QL 3J81i 3I4NH 2HHHQ 2X6LA 4C2MH 4K0KQ 3GTQB 1F9RA 3CAMA 2JA8H 2N88A 5IGBA 4BS9A 1DZ1A 1AP0A 4L5SA 2B2WC 3I4LA 5GADC 3GTMB 1XNRL 3CC7A 1KAWA 2HQEA 2MJ8A 1CQFA 1RTNA 1HQMC 1VDZA 3I91A 1HA5A 2M9VA 3TSSA 1L1OA 3S14B 2A68D 1HQRD 3CCVA 3GTGH 1GD7A 2GVBA 3E0JA 2F0SA 1BR9A 4HJ5A 4F87A 2JA7G 4RG1A 5DNFA 3HKZB 1NR2A 3GV3A 4IZ8A 1KXLA 1TXYA 3CCQA 1HCZA 1VQAA 4FXGC 5C4ZA 3ULJA 4FF4A 4YWKA 4IFDJ 1IYUA 5JVH3 4DV3Q 4KMUC 2RKSA 2B2YC 3M3YB 2K33A 3GD7A 4JI7Q 1PFMA 3GTPH 2B2YA 1SSOA 2OT2A 1MJCA 4PZ8A 5KIXA 1N32L 1EL0A 1O80A 4A3JH 2VB3X 3HOVH 5FLXL 2B8GA 1CKOA 4BBRB 3MXNB 2L15A 4YIJA 3MZ5A 3IFTA 1K73C 2F03A 3T56B 5DM73 3O13A 1TVXA 1Z7TA 4DN4M 4UAIA 2Y0SB 4C3HB 1CK1A 4YWMA 5AJ3L 1DGSA 1K83B 4X62Q 1PDQA 2QEJC 1SFOB 1VQDA 1BQQT 1OXSC 3OYYA 2FMCA 1EY6A 1KTKA 2QKIC 1CHQD 4B3SQ 2N3SA 2HUGA 3I8ZA 2F0LA 3BYTB 2NN6H 2L5TA 4C1NI 4GNXB 2EYPA 4H02A 2I5HA 4A3JG 4O2DA 2A1AA 3MFGA 2F0JA 3S1QB 4KI0A 2ZM6Q 4EX5A 1VQEA 4P71A 2WAQB 2BDOA 3TREA 4DV2Q 3FVQA 1MGSA 1STNA 1Q7YC 4DXFA 1RODA 4GLXA 1CKNA 4IURA 2WB1B 4QQBX 4U673 1N34L 4R8IA 1M1KC 2K28A 3TRZA 4KY5A 3QOJA 2CH4W 3H94A 3WOEA 1LABA 4DV1Q 2JE6I 5IWAQ 3D4WA 2E5LL 4RCOA 2NN6G 2NVXB 2WP8J 3KBXA 2JEBI 4DAVA 1I4PA 1A3TA 4DAYB 3T4AC 1A2TA 4JVZA 1VQOA 5J39A 1WTOA 2B2TA 4FVMA 4BY7H 2NN6I 4ZCKA 1I4RA 1V1PB 4R4OA 1STYA 1IHZA 1TWAH 4L6TB 3U58A 1Q81C 3PIO3 1PH6A 3PUZA 2XRQD 1SN8A 1IBMQ 3CCSA 5C4XB 2PNRC 1A63A 1Y1VH 3HOZH 1GUSA 5E4WC 2D0PA 2B8FA 2PO4A 1KLGD 1OXVA 2AMCB 2OF1A 2IX3A 4ME3A 1X32A 3A8KE 3CXCA 1CI3M 1QNKA 1YBYA 2DJFC 4LJZC 4B3ML 2JJQA 4BY7G 2EYJA 5EPLA 3N52A 5FLMH 1ILQA 3TS0A 3T53B 1F77A 3EJIA 1A8VA 5KYLA 5M5XH 2BDNA 4JI4L 1H9MA 1MI2A 1OO9B 4S3SA 1VQBA 1WOCA 4KD4A 3S24A 4NDXA 4XT3B 1JMCA 2K04A 4HCSA 3UI2A 4DR1Q 2CWPA 1YNXA 2J7ZA 4X65L 1GM5A 5M5WH 3HOZG 5J3BA 1PXUA 3RD4A 2AUJD 2PI2E 3EN2A 3E5SA 4JBJA 4LUZA 1VQ6A 5M3MH 1JJCB 1B70B 4Y7NB 2NTTA 3PUWA 3GTKB 4LFCL 2EVBA 5JJZA 2C35B 1ZKOA 1JWSD 1XWEA 2SNSA 3NP8A 3F2CA 2YU9H 1RIPA 3H15A 1I94Q 3A8JE 3ND8A 2KCCA 1I3QB 1QVCA 2DJGC 3M85A 1IYJB 3L0OA 2SNMA 1IBKQ 1I5FA 3CPFA 3MEFA 2HD3A 3G4SA 3GTMH 1J6QA 1J5EL 1MSGA 2A6HC 2EY1A 4WJ4A 4DK1A 1EZ6A 5DM63 1Q46A 1JORA 4LW1A 5M3MG 3S14H 3NQIA 4F88A 4OWXB 5GQOA 4QY7A 4HMJA 2PCFB 5JJLA 4B3RL 2VNUD 2F3WA 4AYBE 4IFDG 1YZ6A 1GOZA 4DV6L 2QA4A 1PFNA 4UP7A 2HIXA 3M3YH 4K14A 1EWCA 4LFAL 1K8AC 1DM0B 4B08A 1Q3LA 4LF9L 5C3WA 1B7YB 4H0LC 3CCLA 3GTLB 3I70A 3RZOB 4BBRH 4DUYQ 2CCZA 3S2DH 5CV6A 4IN3A 3DXJC 4IJLA 3HKZG 2BOSA 2UUBQ 1Z47A 2YTVA 1SXTA 3CU7A 1I4QA 2NZHA 1SJED 5BR8Q 3R3OA 4A3KB 4C3HH 5AFWA 1WVLA 1HUNA 4PQXA 3MTSA 1K3BC 1SFOH 4A3GB 2XWBB 4ILWA 3CCMA 2VUMB 3K80C 2K6AA 1N9WA 2K05A 1TWFB 1XNQL 1KHIA 1EEID 1KL9A 2KUMA 4XYOA 1DOMA 3DM3A 3S1QH 1P16A 1FGBD 2HQLA 4BBRG 3OTOQ 5FOBB 1PTOB 2NVQB 2JA6H 3HOWB 3BVGA 4DV7L 4JI0Q 4C3HG 4DPGA 3PIOA 1PRTF 1N33L 4DV5Q 1SMYC 1OXXK 1TQOA 1GJXA 2YTXA 1QZHA 2PW5A 1EYAA 4UP8A 1C4QA 4ME5A 4B9XA 4CDDC 1IKMA 1MBYA 2L9HA 1XTCD 2NVXH 2Z6KC 1ENCA 4LFBQ 5IYDH 5CGKA 2Q8TA 2OQKA 1HTPA 2WAQG 5FO8B 3AYHB 4F7XA 5M5YB 5H1SE 2WB1G 4OWWB 2F0PA 3E3XA 4DK6C 2XN9C 5T1IA 4R9WA 4OXPA 4YCVA 5I4DA 1VQPA 4YCUA 2E2JB 1LTBD 5C4XH 3QR8A 3S16B 1JJGA 1VF5C 2RSNA 1LT3D 2F0EA 1YJ9A 2Z4IA 3MFYA 1KAAA 3M7NA 5BN3A 3PO2B 1RDPD 1HTLD 1S5CD 1A6XA 3PO3B 1SR3A 2CKZB 1HFGA 4DF7A 5IYDG 4B9WA 3F2DA 2RDFA 1YJWA 4O1NA 4JBKA 3NTHA 1PYBA 5JOBA 2R92B 2IJ0A 3MWYW 3OWEB 3KLSX 3VYTA 3G48A 1NY4A 1U4RA 4V0BA 1QB5D 3D8GA 4R4CA 4OGQC 4OX9L 2NUCA 2F4VQ 3GTOB 3SHLA 5C4XG 1BCPC 1V8QA 4GOPB 2MGSA 1X3QA 4O42A 2I46A 2UUAQ 4HAEA 1Z6HA 3M4PA 1FJGQ 5CV5A 4IUQA 3T1YL 2B39A 3G71A 3I4NB 3HKSA 4E6IA 2JA8B 1M8AA 3V96A 4WJ3M 2LFNA 4I7AA 2UUCQ 3GTKH 4FDBA 4EVOA 3KOJA 5E7NA 1EQRA 5ELOA 2QILA 1F2ZA 3AU7A 3K7AB 5BN4A 4CDFC 5CV4A 4ZUIA 1DD2A 2EDGA 2OWOA 3HKZE 1EIGA 3KF8A 4TSSA 1YHAA 1FGUA 4LF6Q 1HR0W 5E4XA 5C5LA 1STEA 2HIVA 3BU2A 3J81c 1GKHA 1VCIA 1D1KA 4HEDA 1I6HB 4ZRZA 3S1RB 2F3VA 4P74A 1B50A 3EVQA 2Q2IA 2L4NA 3NE5B 3P7JA 1IW7D 1HR0Q 3NTIA 4YHHL 1PH1A 1G6ZA 2VQEL 4IUVA 5IIFA 2I07B 3URYA 2HT1A 4V190 4A93H 2ENBA 1S5FD 1W6KA 2B2VC 5C5MA 3RUZA 4GKJQ 1TS5A 2F0UA 4JI6Q 2Y0SE 1VQCA 3F1ZA 2PQEA 1EY7A 4A76A 3HOVB 1XJVA 3CC2A 2PQAA 3S17B 4ZQ3A 3K59A 4DK0A 1LT5D 3X3MA 5KYIA 4GLVB 3CPWA 2F0VA 1TWGB 3LNNA 4KKUA 4J15A 5KNBA 4JI2L 3U50C 1XMOQ 4A75A 1FYCA 1MHWC 2B29A 3PUYA 3EFXD 1LYLA 1X3EA 3UDGA 3RZOH 2ZTCA 1UEBA 2R61A 1VQIA 2MO1A 5I2YA 3NBIA 1F9SA 2B2UC 1S5BD 2WAQE 2TSSA 1EZ8A 2B3GA 2L55A 1H95A 1S3OA 1S5DD 4JI3Q 1SE4A 4C1NK 4JYAL 4A3KH 4HJ8A 5EPJA 1RJTA 4CJ1B 1G91A 1ENAA 3TP6A 4A3GH 2F0DA 3RN2A 1NCVA 2IY5B 2NYZD 4NKLA 1TWFH 4K5XA 5FO7B 1YNNC 1E2ZA 1CTMA 1P8LA 2VS1A 1BXTA 3DWAA 1YIJA 1Y8NB 4A3BH 4JI1L 4HIKA 2UXBQ 3KJPA 1PTOH 1K28A 2A6HD 3A5UA 3P20A 4EQ5A 3KDFA 2NVQH 1I6VC 3HOWH 4GZYC 4A3KG 5IT9E 1HPCA 3QWNA 1TT2A 2FJ2A 4A3GG 1SAPA 1EFID 2VUMG 4JG2A 3SGIA 5FJ8H 2KCTA 1AFPA 2CQAA 3JAME 4DR2L 4JV5L 4UPAA 3AFQA 3R93A 4LF8L 4XXEA 5LMUL 1Y1VB 5GROA 2DNCA 4RWSC 1HZCA 1BUVT 5DLQE 3TP7A 1EWIA 4MNOA 3HOWG 1UE5A 1LTRD 3J80i 5M5YH 3CF5A 2A69C 3VYSA 2H5XA 3J7ZC 3S2HH 4KV6A 2E2JH 1O7IA 1WFQA 2R7ZH 5JVG3 5LMNW 4IQZA 2HHHL 2KCMA 3S16H 4K0KL 3KF6A 1OTCA 5IP9H 3K81C 5FJ8G 3RNUA 4WORA 2NTSA 3TBIB 3HS0C 1JE5A 2MO0A 3ITPA 3W3AA 3PO3H 1EOVA 3TS2A 2AWNA 2JSOA 4A3DH 4F8MA 4HN7A 1EU3A 2F0MA 1IBLQ 5LMNQ 2R92H 5M5WB 1VMCA 4N8FA 3MHBA 1QE6A 3HOXB 5J1ZA 2Q8IB 3I7FA 1PVOA 4XDXA 2A6EC 2L0CA 4FP5D 3GTOH 3U4ZA 2E2DC 1QNUA 3KLSA 2FMMA 2N78A 1ICWA 3S15B 5IP9G 2D0OA 3G7LA 2BH2A 4A4IA 3CHBD 4POGA 3PO2G 1QZGA 4DV3L 3K0YA 2IHEA 3PO3G 2Q2HA 1SJHD 3ZYYX 1KNAA 2CHBD 5M9OA 1SMYD 4JI7L 2UXCQ 2R92G 4BA2I 3NTKA 4GNXC 4PNYA 3K7AH 3I2ZA 3PUXA 2F0KA 2B2WA 5IP7H 2N55A 4I7ZC 1E2WA 1LUZA 4AIMA 1Q8IA 3A7AB 3NSWA 1IXRA 1QVFA 1NMGA 4DNIA 3S9WA 3R2IA 1I6HH 3S1RH 1UE6A 3SR1A 4JK1C 2OEOA 4X62L 4I65A 2KOLA 3OIQA 3I4NG 1C48A 2JA8G 1FL0A 1E2VA 1ENFA 4B3SL 2DGYA 1Y1WB 3OWFA 1UNSA 4OIKA 1CFMA 1QILA 5IE8A 5CV7A 1U5KA 2ZM6L 2QEXA 5IP7G 3M4YA 4ULLA 1R4PB 4QF4A 4KLKA 3NENA 1STBA 5IT9L 4DV2L 3S17H 3S2DB 2ZTEA 1O7LA 1PH5A 5CV8A 2O5IC 1TWGH 4DGZA 3KFUA 3UE1A 4DV1L 3JAML 2LY7A 1EY5A 1BCPD 5IWAL 5C0XH 4KHVA 2J0TD 4UY8C 2ZXOA 1CQVA 3L2PA 3QJYA 1WTPA 1SRUA 5EBCA 4HIDA 1E0BA 2KQ3A 1C0AA 4RGMA 1PH2A 1BF4A 1WD0A 3HOVG 2D9UA 2CH4A 1PMRA 5ELEA 5IGEA 2Z8LA 4C3IB 1IBML 1QCBD 3NBHA 2PMZB 3DEPA 4NXNQ 2JA6B 4HMIA 5I6WA 3LX0A 3VA5A 3MVVA 2E75C 5C0XG 1AN8A 1STHA 3K8AA 3PCOB 1EWHA 3TEHB 1L1OB 2MHVA 3BS1A 3MXPA 3L3OC 5ELFA 5C0XI 3LWUA 1VQ7A 1EY9A 3FP9A 1BVSA 4YCWA 2ASBA 1CZWA 3PUVA 1E3PA 2A74C 1LLRD 4KK7A 5HURA 2F4IA 3BZKA 3Q0AA 1JOOA 3K5NA 1EIYB 3BZCA 1JWUD 4HIOA 4DR1L 1LTID 3PSIA 4AQYQ 1D6EC 1K8GA 1N36Q 2KHIA 2YV5A 2F1MA 1X56A 2Z0SA 1TS4A 1Q90A 1H9SA 3BYYB 5FK9C 4BY1B 1TR5A 3HEJA 1WCMH 2KHSA 1VQMA 1S4ZA 4GN5A 3P1HA 4U68A 1VQ5A 2L12A 2M2LA 4RAUC 2JA5B 1HRJA 5KEEA 2I5MX 2WFWA 2XIWA 3D6WA 2EYLA 4RHRA 5BN5A 1PH8A 4R4QA 3A0JA 3A7LA 1IBKL 2OXPA 1PYWD 2FHTA 2PZWA 1O78A 1AZPA 1IL8A 1M4VA 3TN2A 1EOTA 4RA8A 1Y1VG 1EUJA 1UWVA 3VYUA 3E6ZX 1YNND 2R6GA 3FKIH 1DCZA 3HOXH 2SOBA 4P75A 3VR4A 1MD2D 2F0NA 2LXJA 1VQKA 5IYCH 1F2LA 4ODGA 2RDGA 3U9SA 1CT1D 5J22A 1CKNB 5FLMG 3S15H 5ELNA 1H9RA 3H3VH 1SE3A 1CZGA 2JK8A 3X3NA 1VS0A 4JI8Q 1CA6A 1D5ZC 3ER0A 1AH9A 1HZBA 3BDOA 1CSQA 1B2TA 1GVPA 3HOXG 3M7GA 4X3SA 1FD7D 1OXUA 4DUYL 2R7FA 1E24A 1PTOC 4H44C 4L5QA 3TP8A 2UUBL 3J81j 4GKKQ 2UXDQ 5IYCG 5A35A 1JR0D 5BR8L 1F2YA 5HY6A 5GAEC 2LKVA 4A93B 4QL5A 3AFPA 4IUUA 1G291 2A69D 4CDEC 3Q6SA 4LMQD 3C2PA 5K5PA 1VQNA 1EY0A 3H3VI 4L5RC 1Y1WH 1HNWQ 3SK4A 3VR2A 5CR3A 1YNJC 4DR7Q 1E1OA 1BBUA 1GUGA 5C4HA 2MUYA 5ISRA 3OTOL 2IT1A 3M4OB 3CCUA 2MPMA 1G51A 1SYBA 3T1HQ 3DMUA 3RMHA 2IL8A 2H4OA 2N49A 1Y69U 1LT6D 3EBEA 4JI0L 5I2XA 3J7AV 1UAPA 3ERSX 1IZ6A 2RBMA 1TS2A 1XX8A 2IX1A 4DV5L 3RLOA 1SNQA 5FO9B 4DR4Q 2A6ED 3C46A 1B9NA 4FO2A 1Y1WG 1U4MA 1TWCB 2A5HA 2YTYA 1RF2D 3AEVA 1XMQQ 4P73A 1BNZA 4LFBL 3BVZA 2F0GA 4NXMQ 1C8CA 4A3BB 1QVGA 2D5DA 3OSOA 1JOKA 1WYDA 1EQQA 2RHQB 2AWOA 2EZVA 1L2FA 4IUNA 1SMXA 2GN5A 3DWQA 4JOIC 4LF5Q 4QUCA 4C3IH 1GHKA 2VXWA 1QUQA 1YVCA 1WTXA 4X3TA 1BKBA 4GOPC 4RHSA 4HIMA 1NJIC 1AZQA 2WACA 3CRLC 1ZEQX 3C3LA 4LK1C 2AUKA 5CYUA 4KHPQ 5KNDA 1G8ZD 1XPUA 3SDZA 2LXKA 4Q0FA 4OELB 2RCNA 2E2IB 3KBGA 1PA6A 5EGTA 4LF9Q 4IPDA 4XQQA 4X66Q 3M9BA 1CKMA 2NVYB 2PPBC 2Z6KA 1TWHH
chains in the Genus database with same CATH topology
5CC4A 3DWPA 4C3IG 3BVMA 4MN3A 4K6LA 5FKAC 3S2HB 1BOSA 2R7ZB 3PIP3 2LMCB 4K2KA 3H6MA 4IUTA 5JEAJ 3GTJB 4A3DB 5E1FA 2IWHA 3K57A 5F2DA 4KD3A 2NBFA 4L63B 1STAA 1ZYRC 3FMCA 1RKNA 1PRTB 1SBBB 1GUOA 4QCLA 1PZKD 3TDQA 1SE2A 5D3IB 2F0HA 3RLFA 2ICEC 5ELDA 2JYOA 4K5VA 4RGTA 1CHPD 2NVTB 1EY8A 1B3AA 2CW0C 3OW7A 3NWTA 2DNEA 2XWJB 1RD9D 3MC0B 3OIPA 1VMPA 4NP5A 4OIJA 3I4MB 2R93B 3BDCA 3H0GB 3QB3A 1BCPF 4C56C 4TRDA 4RKBA 2ZXPA 3J81E 4CKCA 1RTOA 1F9PA 2HDMA 1I4GA 1DOKA 2K5DA 3D4RA 1EEFD 3IKJA 2KECA 4K6DA 4CKBA 2B2VA 5IGCA 5LHY1 1R4QB 5EJWA 3VA7A 1EIHA 3A56A 3LWEA 3C1EA 3SE0A 1JC7A 5I9PA 1TU2B 4G57A 5HGTA 2RVLA 4K2LA 1NAPA 4A3MB 2B2UA 5EKKA 2JP1A 2K01A 4XYQA 4AYBB 3T51B 4CBVA 1SYEA 2A73B 4KN7C 2HCIA 4QIWB 2XRSD 4G7HC 5C3EB 2C9OA 4WJWA 3H09A 4RCNA 4KY6A 1G2TA 4P2CB 3V05A 4A3EB 2RDHA 4ZKBB 5C0XJ 2FINB 3W2DA 3EROA 1UEAB 1EY4A 1HUMA 4PV1C 3BG3A 1PTOD 4DNTB 1GHJA 1II3A 5K36H 3FEWX 1W6JA 5JEAH 1H9KA 4J8QA 5T1GA 1ESRA 3OPOA 4KTAA 4UDUC 3A54A 2F0OA 1WTQA 2MP1A 4FF3A 3KK7A 1YNJD 1WTVA 1D5XC 1MSHA 3I72A 3Q23A 1SNPA 4ZYSA 4TKOB 1WCMB 1B44D 5IGDA 1ZXTA 5D65A 3NHHA 5JEAG 2O5JC 2KCNA 3ERQA 2X6GA 4C3JB 3MAQA 3SK8A 2K5QA 2YYZA 3J81L 1FNUA 1FR3A 3SK6A 3HP3A 4BWGB 2K5WA 2QCPX 3FKIB 3I3CA 3I90A 3K5OA 4DXGA 1IKLA 1B53A 2VB2X 3MXNA 3A8IE 3TP5A 5ELCA 4PMBA 3IAYA 3HOUB 1LTSD 4OO1H 1ET9A 1SYDA 1SYGA 1SDFA 4RGNA 1JE4A 1CA5A 5LL6X 3ONAB 1WTWA 4RFBA 2V4DA 4FNFA 1KABA 3J7YW 5M3FB 1ML0D 1JB3A 4DA2A 4OO1G 2SDFA 3FRPB 5IOCA 3PV0A 1DJRD 3NQTA 2IW3A 1K8MA 5CV9A 1I4XA 4OO1I 2BA0A 4XQJA 2EOTA 2KVMA 1EYCA 4DAYA 5KRUA 3HG9A 3MEHA 3EA6A 1V1PA 2AQ3B 5JPMC 1ZYRD 4HR7B 1BO0A 4WRDA 2C5CA 3I73A 3VR3A 4FYDA 5LL6S 1PFBA 4H7BA 2DY7A 3SEBA 4X3KA 1ESFA 2R3ZA 2CW0D 3IL8A 4TQUS 4DNRB 3GO5A 1A3UA 3BZDB 1R9TB 3EQLC 3CQZB 2RSOA 2EJFC 3T16A 4X3UA 2RQXA 3N6RA 5C3XA 5C6AA 4ZK9B 3D31A 4M8AA 1L0YB 4G7OC 2EYMA 2K32A 1FNWA 4K8JA 5IODA 5CMDA 2JEAI 1SNOA 1V43A 5IGFA 3HOYB 4ZKCB 1TWHB 3CRKC 2XNAC 4NMZA 3OHXC 3HZXA 2HCCA 2EYHA 1QG7A 3OMGA 3OOCA 4DU9A 3F2UA 2FFKB 2B2TC 1KDCA 3QIAA 3TZDA 1RCVD 4ZAIA 4QUFA 3DEOA 4K8IA 3NXWA 5CORA 4EQPA 3MXUA 3R2TA 1IW7C 4BBSB 2L1BA 1AW7A 2NZ1D 5NUCA 1Q1BA 5EBDA 1CM9A 3NPPA 2QF7A 2WV6D 1G2SA 1LV9A 5CBAE 4ABNA 1KDBA 5C44B 4FF2A 4C3JG 2D62A 3D4DA 3WDNA 2RA4A 2BE5C 4XIGS 4KY7A 5EQ0A 1NR4A 2NB0A 1VF7A 2G9HD 2M00A 3A55A 3K5MA 4ZUJA 3KUPA 1NUCA 2F0QA 4FXKC 1X3PA 1PZID 4IFDH 2BA1A 1U4PA 4QB4A 1H9JA 3H91A 1SYCA 4XQNA 3K58A 5EKLA 3Q24A 1H9SB 1SNMA 4HSPA 2ZT9C 3SXHA 1LTAD 1TIID 4HCEA 5D3DA 4A3IB 4EGVA 2E76C 2KA7A 3GV6A 2CVRA 1SYFA 1F2MA 5DEHA 1FNVA 2EXZA 1PTOF 5G3LD 3HGBA 2LS01 1D5MC 4DFAA 4IALA 1GUNA 2H1EA 5COYA 4IFDI 1GUTA 2HDLA 1JCKB 1IYVA 3S1MB 4PMCA 1HFNA 2O2LD 5E3FA 2DN8A 3QG1A 4A3FB 3AB9A 3K6OA 4N9PA 2KJXA 4PMWA 4J1MA 4HTHA 1PRTC 2AQ2B 3VYRA 1GXDC 2XSCA 1SNCA 4MHEA 2K7VA 2D2CC 3DUZA 1JQYD 1D1IA 3J7AF 1I4HA 2GA4B 1KDAA 2QDBA 2EPBA 1QOHA 3MXGA 3SK5A 3DM1A 3D3RA 3TMEA 4OL7A 5EKIA 1SNDA 5IGGA 2Z1CA 1A2UA 4ZLTF 1DYQA 1Y8PB 4WFN3 5JPNC 4NW2A 4FF1A 3GP7A 3FDTA 2A68C 4KKTA 2WKDA 4JBWA 2TMPA 2F0FA 4BA1I 4ID6A 2ID0A 4EQOA 5ELBA 2E2HB 3VR5A 4KHZA 1KNEA 5D14A 5CBEE 3J80E 1O7ZA 3DHQA 2O4XA 1F9QA 2X69A 3S1NB 1DXMA 2EYOA 1V1OA 2EE1A 1S5ED 2EJGC 3BDLA 2E74C 1EU4A 3QOLA 2WIIB 2PW7A 2DY8A 5C4JB 4CJ0B 1TY2A 5EPKA 2K1BA 4XT1B 1STGA 4KJOA 1GUWA 2SEBD 3G6JB 2JA7B 1JOQA 2PZUA 3Q22A 3K5LA 1XYIA 1DONA 4C2MB 3FPUB 2WKCA 1B4OA 1ILPA 4RH6A 1LT4D 4EQNA 4KN4C 4Z9CB 3CKIB 1LACA 4CHTB 2EY6A 1B1ZA 4XTCS 1HXYD 3V2TA 3GTGB 4OHJA 2K03A 2AQ1B 1OXTA 1JWMD 1WD1A 3IFDA 3MA2B 3SVMA 1ET6A 1TS3A 3QO2A 2EY2A 1UUPA 4J6HA 1TKWB 3GTPB 1U4LA 3AMUA 1EYDA 4A3JB 2F0WA 3D6CA 4RGOS 2F0TA 1TY0A 2EJMA 5A2QE 1J8IA 1BCPB 5TSSA 1LTTD 1NSNS 2Q8RE 4HSVA 3VR6A 5KNCA 1A15A 1J9OA 1O7YA 2BE5D 3OMCA 5I9OA 2B63B 4K5WA 2KEDA 4N9TA 3L7ZC 3P75A 2EYFA 3WOFA 1BBXC 1EQTA 3FPPA 3J80L 2G9DA 4CJ2C 1Q12A 1L0XB 1SEBD 3H3VC 4QMGA 1U9RA 2EY5A 3PMFA 1EQVA 1KLUD 1Q1EA 3L9AX 3KLRA 3ND9A 1K8OA 4RKLA 2Z4HA 1DOLA 4DAPA 1AEXA 4FXDA 3NK9A 3U9OA 5FLXE 3R8BA 1D2BA 1PZJD 4BY7B 2ICIA 4KKSA 5I6YA 2ZXRA 4KJNA 4R8NA 5K36G 1TWAB 3GQBA 3HRZC 1B9MA 2PYKA 3TZUA 1Y8OB 1T5EA 1HHVA 2XVSA 1XXGA 4LAAA 5JAVA 3HOZB 1JICA 2IPKD 1WTRA 2JXMB 1LTGD 4M1UB 1ONLA 4IUPA 1RHPA 2J4XA 3NUCA 4MIUA 4L8JA 1BDOA 2NWGA 3C1FA 5M5XB 1HA6A 1T5XD 3NWSA 3RZDB 1PRTD 2L11A 4Q5VA 4H13C 3T13A 1QJOA 4CKEA 5G3LF 1LO5D 5DAUA 2F0IA 1A3VA 1QWYA 2IX0A 2WINB 5M3MB 1PLFA 4G7ZC 2BCOA 2KEEA 5KGUA 2PZTA 4G4KA 1I50B 4CGYB 2YU9B 5A2QL 2X6LA 3GTQB 1F9RA 2N88A 5IGBA 4BS9A 1DZ1A 1AP0A 2B2WC 3I4LA 3GTMB 2HQEA 2MJ8A 1CQFA 1RTNA 1HQMC 1VDZA 3I91A 1HA5A 2M9VA 3TSSA 3S14B 2A68D 1HQRD 3E0JA 2F0SA 1BR9A 4F87A 5DNFA 3HKZB 1NR2A 3GV3A 4IZ8A 1HCZA 4FXGC 5C4ZA 4FF4A 4IFDJ 1IYUA 5JVH3 4KMUC 2RKSA 2B2YC 3M3YB 2K33A 3GD7A 1PFMA 2B2YA 1SSOA 2OT2A 5KIXA 1EL0A 1O80A 2VB3X 5FLXL 2B8GA 4BBRB 4YIJA 3MZ5A 3IFTA 2F03A 3T56B 5DM73 3O13A 1TVXA 1Z7TA 4DN4M 4UAIA 2Y0SB 4C3HB 1CK1A 1K83B 1PDQA 2QEJC 1SFOB 1BQQT 1OXSC 2FMCA 1EY6A 1KTKA 2QKIC 1CHQD 2HUGA 3I8ZA 2F0LA 3BYTB 2NN6H 2L5TA 4C1NI 2EYPA 3S1QB 3MFGA 2F0JA 4KI0A 2WAQB 2BDOA 3FVQA 1MGSA 1STNA 4DXFA 1RODA 4IURA 2WB1B 4U673 4R8IA 2K28A 4KY5A 3QOJA 3H94A 3WOEA 1LABA 2JE6I 3D4WA 4RCOA 2NN6G 2NVXB 2WP8J 3KBXA 2JEBI 4DAVA 1I4PA 1A3TA 3T4AC 1A2TA 5J39A 1WTOA 2B2TA 4FVMA 2NN6I 1I4RA 1V1PB 1STYA 1IHZA 4L6TB 3PIO3 3PUZA 2XRQD 5C4XB 2PNRC 1GUSA 5E4WC 2B8FA 2PO4A 1KLGD 1OXVA 2OF1A 2IX3A 1X32A 3A8KE 1CI3M 1QNKA 4LJZC 2EYJA 5EPLA 3N52A 1ILQA 3T53B 1F77A 3EJIA 5KYLA 2BDNA 1H9MA 1MI2A 1OO9B 4S3SA 4KD4A 4NDXA 4XT3B 2K04A 4HCSA 3UI2A 2J7ZA 1PXUA 3RD4A 2AUJD 3E5SA 4Y7NB 2NTTA 3PUWA 3GTKB 2EVBA 5JJZA 1ZKOA 1JWSD 1XWEA 2SNSA 3NP8A 3A8JE 3ND8A 2KCCA 1I3QB 3M85A 2SNMA 1MSGA 2A6HC 2EY1A 4DK1A 1EZ6A 5DM63 1JORA 3NQIA 4F88A 4HMJA 2PCFB 2VNUD 2F3WA 4IFDG 1GOZA 1PFNA 4K14A 1EWCA 1DM0B 4B08A 1Q3LA 5C3WA 4H0LC 3GTLB 3I70A 3RZOB 5CV6A 4IN3A 3DXJC 2BOSA 1Z47A 1SXTA 3CU7A 1I4QA 1SJED 3R3OA 4A3KB 5AFWA 1WVLA 1HUNA 4PQXA 3MTSA 4A3GB 2XWBB 4ILWA 2VUMB 2K6AA 2K05A 1TWFB 1EEID 2KUMA 4XYOA 1DOMA 1FGBD 5FOBB 1PTOB 2NVQB 3HOWB 3BVGA 4C3HG 1PRTF 1SMYC 1OXXK 1TQOA 1GJXA 2PW5A 1EYAA 1C4QA 4ME5A 4B9XA 1IKMA 1MBYA 2L9HA 1XTCD 1ENCA 5CGKA 2Q8TA 1HTPA 5FO8B 4F7XA 5M5YB 2F0PA 2XN9C 5T1IA 4R9WA 5I4DA 2E2JB 1LTBD 3S16B 1VF5C 2RSNA 1LT3D 2F0EA 2Z4IA 3MFYA 1KAAA 3M7NA 5BN3A 3PO2B 1RDPD 1HTLD 1S5CD 1A6XA 3PO3B 1HFGA 4DF7A 4B9WA 2RDFA 4O1NA 3NTHA 5JOBA 2R92B 2IJ0A 3MWYW 3OWEB 3KLSX 3VYTA 1U4RA 4V0BA 1QB5D 3D8GA 4OGQC 2NUCA 3GTOB 3SHLA 1BCPC 1V8QA 2MGSA 1X3QA 4O42A 2I46A 4HAEA 1Z6HA 5CV5A 4IUQA 2B39A 3I4NB 4E6IA 2JA8B 1M8AA 3V96A 2LFNA 4EVOA 2QILA 1F2ZA 3AU7A 3K7AB 5BN4A 5CV4A 4ZUIA 1DD2A 2EDGA 1EIGA 3KF8A 4TSSA 5E4XA 5C5LA 1STEA 1VCIA 1D1KA 4HEDA 1I6HB 4ZRZA 3S1RB 2F3VA 1B50A 3EVQA 2L4NA 3NE5B 3P7JA 1IW7D 3NTIA 1G6ZA 4IUVA 5IIFA 2I07B 3URYA 4V190 2ENBA 1S5FD 1W6KA 2B2VC 5C5MA 3RUZA 1TS5A 2F0UA 2PQEA 1EY7A 3HOVB 3S17B 4ZQ3A 3K59A 4DK0A 1LT5D 3X3MA 5KYIA 2F0VA 1TWGB 3LNNA 4KKUA 5KNBA 1FYCA 3PUYA 3EFXD 2R61A 5I2YA 3NBIA 1F9SA 2B2UC 1S5BD 2TSSA 1EZ8A 2L55A 1S5DD 1SE4A 4C1NK 5EPJA 1RJTA 4CJ1B 1G91A 1ENAA 3TP6A 2F0DA 1NCVA 2NYZD 4NKLA 4K5XA 5FO7B 1YNNC 1E2ZA 1CTMA 1BXTA 3DWAA 1Y8NB 1PTOH 2A6HD 3P20A 1I6VC 4GZYC 5IT9E 1HPCA 3QWNA 1TT2A 2FJ2A 1SAPA 1EFID 1AFPA 2CQAA 3JAME 3R93A 4XXEA 1Y1VB 2DNCA 4RWSC 1BUVT 3TP7A 1LTRD 2A69C 3VYSA 4KV6A 5JVG3 4IQZA 4WORA 2NTSA 3TBIB 3HS0C 3ITPA 3W3AA 2AWNA 2JSOA 4F8MA 4HN7A 1EU3A 2F0MA 5M5WB 1VMCA 3MHBA 1QE6A 3HOXB 5J1ZA 2Q8IB 4XDXA 2A6EC 2L0CA 4FP5D 2E2DC 1QNUA 3KLSA 2FMMA 1ICWA 3S15B 3G7LA 3CHBD 3K0YA 1SJHD 3ZYYX 1KNAA 2CHBD 5M9OA 1SMYD 4BA2I 3NTKA 4PNYA 3PUXA 2F0KA 2B2WA 2N55A 4I7ZC 1E2WA 1Q8IA 3A7AB 3NSWA 3S9WA 3R2IA 3SR1A 4JK1C 2OEOA 4I65A 2KOLA 3OIQA 1C48A 1E2VA 1ENFA 1Y1WB 3OWFA 1UNSA 4OIKA 1CFMA 1QILA 5CV7A 3M4YA 4ULLA 1R4PB 4QF4A 1STBA 5IT9L 3S2DB 1O7LA 5CV8A 2O5IC 4DGZA 3JAML 2LY7A 1EY5A 1BCPD 5C0XH 4KHVA 2J0TD 2ZXOA 1CQVA 3QJYA 1WTPA 5EBCA 1E0BA 2KQ3A 4RGMA 1BF4A 1WD0A 2D9UA 1PMRA 5ELEA 5IGEA 2Z8LA 4C3IB 1QCBD 3NBHA 2PMZB 3DEPA 2JA6B 4HMIA 5I6WA 3LX0A 3VA5A 3MVVA 2E75C 5C0XG 1AN8A 1STHA 1EWHA 3BS1A 2MHVA 3MXPA 3L3OC 5ELFA 5C0XI 3LWUA 1EY9A 1CZWA 3PUVA 2A74C 1LLRD 5HURA 4KK7A 2F4IA 3Q0AA 1JOOA 3K5NA 1JWUD 1LTID 1D6EC 2F1MA 1TS4A 1Q90A 1H9SA 3BYYB 5FK9C 4BY1B 1TR5A 3HEJA 2KHSA 1S4ZA 3P1HA 4U68A 2L12A 2M2LA 4RAUC 2JA5B 1HRJA 5KEEA 2XIWA 3D6WA 2EYLA 4RHRA 5BN5A 3A7LA 2OXPA 1PYWD 2FHTA 2PZWA 1O78A 1AZPA 1IL8A 1M4VA 3TN2A 1EOTA 4RA8A 3VYUA 3E6ZX 1YNND 2R6GA 1DCZA 2SOBA 3VR4A 1MD2D 2F0NA 1F2LA 4ODGA 2RDGA 3U9SA 1CT1D 5J22A 1H9RA 1SE3A 1CZGA 3X3NA 1CA6A 1D5ZC 3BDOA 1B2TA 3M7GA 4X3SA 1FD7D 1OXUA 1PTOC 4H44C 3TP8A 5A35A 1JR0D 1F2YA 2LKVA 4A93B 4IUUA 1G291 2A69D 3Q6SA 4LMQD 3C2PA 5K5PA 1EY0A 3SK4A 3VR2A 5CR3A 1YNJC 1GUGA 5C4HA 2MUYA 5ISRA 2IT1A 3M4OB 2MPMA 1SYBA 3DMUA 3RMHA 2IL8A 2H4OA 1Y69U 1LT6D 5I2XA 3J7AV 1UAPA 2RBMA 1TS2A 1XX8A 2IX1A 1SNQA 5FO9B 2A6ED 3C46A 1B9NA 4FO2A 1U4MA 1TWCB 2A5HA 1RF2D 1BNZA 3BVZA 2F0GA 1C8CA 4A3BB 2D5DA 3OSOA 1JOKA 2AWOA 2EZVA 4IUNA 3DWQA 4QUCA 1GHKA 2VXWA 1WTXA 4X3TA 4RHSA 1AZQA 2WACA 3CRLC 1ZEQX 3C3LA 4LK1C 2AUKA 5CYUA 5KNDA 1G8ZD 3SDZA 4Q0FA 2E2IB 3KBGA 5EGTA 4XQQA 2NVYB 2PPBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEC A;  1PFN A;  4X3S A;  2B2V A;  1ICW A;  1PFB A;  3FPU B;  5CBA E;  1DOL A;  3G7L A;  4MN3 A;  1B4O A;  2DY7 A;  1ILP A;  5EPJ A;  1RJT A;  5EJW A;  4X3K A;  4CJ1 B;  1EIH A;  1G91 A;  1Q3L A;  3HP3 A;  2R3Z A;  3MWY W;  3LWE A;  4MHE A;  5DNF A;  1NR2 A;  3GV3 A;  3IL8 A;  1KNA A;  1U4R A;  1NCV A;  2NYZ D;  5E4W C;  2RA4 A;  3I3C A;  3I90 A;  2EPB A;  4IUU A;  2RSO A;  5EQ0 A;  4X3U A;  1IKL A;  1X32 A;  3DM1 A;  2MGS A;  1X3Q A;  3Q6S A;  4LMQ D;  4O42 A;  4IUT A;  1B53 A;  2B2Y C;  1NR4 A;  2B2W A;  2K03 A;  1QNK A;  4HAE A;  2RVL A;  4ZK9 B;  2N55 A;  5AFW A;  1WVL A;  1WD1 A;  3IFD A;  1HHV A;  4IUQ A;  5EPL A;  1HUN A;  1PFM A;  1NAP A;  3SVM A;  2B2Y A;  1SSO A;  3N52 A;  3MTS A;  1ILQ A;  2B2U A;  1EL0 A;  1O80 A;  2JP1 A;  1M8A A;  2K01 A;  2BDN A;  3KUP A;  3QO2 A;  1JIC A;  1MI2 A;  5EKI A;  2K05 A;  2MPM A;  1WTR A;  1X3P A;  5CMD A;  2KOL A;  2FJ2 A;  4ZLT F;  4XT3 B;  2K04 A;  4HCS A;  3UI2 A;  1U4P A;  2KUM A;  2IL8 A;  1SAP A;  1TVX A;  2J7Z A;  1DOM A;  4DN4 M;  2HCI A;  4IUP A;  4UAI A;  3H91 A;  1EIG A;  1RHP A;  1SDF A;  4NW2 A;  4ZKC B;  5E4X A;  3FDT A;  1U4L A;  1XX8 A;  1PDQ A;  1JE4 A;  1S4Z A;  2NWG A;  4OIK A;  4U68 A;  1CA5 A;  3ONA B;  4HED A;  1WTW A;  2L12 A;  2M2L A;  1HA6 A;  4RAU C;  2JYO A;  1HRJ A;  1G2T A;  2HCC A;  1B3A A;  3R93 A;  4ZKB B;  1U4M A;  2FIN B;  2L11 A;  1B50 A;  2HUG A;  2XIW A;  3D6W A;  3GV6 A;  3I8Z A;  2CVR A;  5JJZ A;  1HUM A;  4RWS C;  1KNE A;  1QG7 A;  2L4N A;  3P7J A;  1BNZ A;  5D14 A;  1ML0 D;  5CBE E;  1J8I A;  1G6Z A;  2FHT A;  1O7Z A;  3F2U A;  1VMP A;  2FFK B;  2B2T C;  4OIJ A;  1IL8 A;  1AZP A;  1F9Q A;  3TN2 A;  1EOT A;  3TZD A;  1C8C A;  4ZAI A;  2Q8R E;  2SDF A;  4IUV A;  2X69 A;  4HSV A;  4RA8 A;  1IKM A;  4QUF A;  3DEO A;  2L9H A;  1J9O A;  1A15 A;  1O7Y A;  1PLF A;  2B2V C;  1MGS A;  2EE1 A;  5T1G A;  1ROD A;  5COR A;  1ESR A;  2KED A;  2KEE A;  4IUR A;  2H1E A;  2Q8T A;  1MSG A;  4QUC A;  2VXW A;  5COY A;  4R8I A;  2K28 A;  1WTX A;  4X3T A;  1WTQ A;  2MP1 A;  2EOT A;  2KVM A;  1F2L A;  1BBX C;  1WTV A;  2HDL A;  1WTP A;  1MSH A;  1RTO A;  2L1B A;  1F9P A;  1EQT A;  2HDM A;  2X6L A;  1E0B A;  1F9R A;  2DY8 A;  2N88 A;  4R9W A;  5T1I A;  4CJ2 C;  4CJ0 B;  3KBX A;  1WD0 A;  1BF4 A;  2NZ1 D;  1DZ1 A;  1DOK A;  1VMC A;  1HFN A;  1AP0 A;  2D9U A;  1QE6 A;  2B2W C;  5EPK A;  2K1B A;  1ZXT A;  4XT1 B;  2RSN A;  1CA6 A;  1GUW A;  1CM9 A;  2MJ8 A;  1WTO A;  2B2T A;  1BO0 A;  1RTN A;  4XDX A;  5D65 A;  3DEP A;  1F9S A;  2B2U C;  3I91 A;  1G2S A;  1B2T A;  1LV9 A;  2X6G A;  2FMM A;  1HFG A;  1XYI A;  1DON A;  1AZQ A; 
#chains in the Genus database with same CATH topology
 1LTL A;  5CC4 A;  3DWP A;  4DR6 Q;  4C3I G;  3BVM A;  4MN3 A;  2F4V L;  1E1T A;  2PI2 A;  2JA6 G;  4K6L A;  2K14 A;  2I5L X;  5FKA C;  3PF4 A;  3S2H B;  2UUA L;  1K9M C;  1FJG L;  3DLL A;  4DR5 Q;  3KYH C;  1BOS A;  2R7Z B;  3J7A 5;  3CP0 A;  2Q2U A;  1GO3 E;  2NZO A;  3PIP 3;  2LMC B;  3E9I A;  4K2K A;  3H6M A;  4BY1 H;  1E22 A;  4IUT A;  2UUC L;  5JEA J;  3KLW A;  4DV4 Q;  3GTJ B;  4A3D B;  2LSS A;  5E1F A;  4DUZ Q;  3FHW A;  2IWH A;  3K57 A;  3K7U C;  3J80 c;  5F2D A;  5JJI A;  4LF6 L;  2JA5 H;  1PHJ A;  4KD3 A;  2NBF A;  4L63 B;  1STA A;  1ZYR C;  3CCJ A;  3FMC A;  2A19 A;  4GN4 B;  1RKN A;  3F2B A;  1PRT B;  1SBB B;  1GUO A;  4QCL A;  1PZK D;  4IJH A;  3TDQ A;  4JCV E;  1VQJ A;  1SE2 A;  5D3I B;  2F0H A;  1HR0 L;  3PF5 A;  4MTN A;  2ICE C;  5ELD A;  4BY1 G;  3RLF A;  3RN5 A;  2K5N A;  2JYO A;  4DKA C;  4K5V A;  4RGT A;  1CHP D;  2NVT B;  1EY8 A;  1B3A A;  4DV0 Q;  2CW0 C;  3LGJ A;  3OW7 A;  3NWT A;  2EIF A;  2DNE A;  2XWJ B;  1RD9 D;  4GKJ L;  4LUV A;  3MC0 B;  3OIP A;  4JI6 L;  2JA5 G;  1VMP A;  4NP5 A;  4OIJ A;  1PFS A;  1S72 A;  3I4M B;  2R93 B;  5L37 A;  4L5T A;  3BDC A;  3H0G B;  1PH3 A;  1HNX Q;  1RL2 A;  3QB3 A;  4BXX H;  1BCP F;  1XMO L;  4C56 C;  4TRD A;  4RKB A;  2ZXP A;  4PG3 A;  3J81 E;  4CKC A;  1X9N A;  3CC4 A;  1RTO A;  1KIX A;  1F9P A;  2HDM A;  1UE7 A;  1KRS A;  1JJ2 A;  3CMA A;  1I4G A;  1DOK A;  2K5D A;  4JI3 L;  3D4R A;  2F3I A;  1EEF D;  3IKJ A;  2KEC A;  4K6D A;  4CKB A;  2B2V A;  4BXX G;  4JI5 Q;  5IGC A;  5LHY 1;  1R4Q B;  5EJW A;  4IOA A;  3VA7 A;  4DR3 Q;  1EIH A;  3A56 A;  3LWE A;  3STB C;  4A3I H;  3C1E A;  3SE0 A;  2Z6B A;  2UXB L;  1JC7 A;  1D8L A;  3M4O H;  5I9P A;  1TU2 B;  4G57 A;  1Z9F A;  5HGT A;  4IO9 A;  2RVL A;  4K2L A;  4A93 G;  4R4I A;  1NAP A;  1JB7 A;  4A3M B;  2PMZ E;  2B2U A;  2QDL A;  5EKK A;  2VL6 A;  2JP1 A;  2K01 A;  2WB1 E;  2PNH A;  4XYQ A;  4AYB B;  2F52 A;  3T51 B;  4CBV A;  3OW2 A;  1TWC H;  1SYE A;  2K75 A;  4JBM A;  2A73 B;  4KN7 C;  2HCI A;  3S1M H;  4TVA B;  4QIW B;  2XRS D;  3VDY A;  2Q2T A;  4YHH Q;  4G7H C;  5C3E B;  2C9O A;  2GVA A;  4WJW A;  1FVI A;  1CSP A;  3H09 A;  4RCN A;  1WJJ A;  3KF8 B;  4KY6 A;  1MKH A;  2XGT A;  4LF7 Q;  1G2T A;  4P2C B;  3V05 A;  4A3E B;  2RDH A;  4ZKB B;  5C0X J;  2FIN B;  3PQI A;  4R1J A;  3W2D A;  3ERO A;  1UEA B;  1EY4 A;  1HUM A;  4PV1 C;  3BG3 A;  4POF A;  1PTO D;  4DNT B;  1GHJ A;  3W1G A;  1II3 A;  2K4K A;  4JPB W;  5K36 H;  3FEW X;  4Y52 H;  1W6J A;  5JEA H;  1H9K A;  2UU9 Q;  4J8Q A;  5T1G A;  3PIP A;  2JA9 A;  1ESR A;  3OPO A;  1IBL L;  2E2I H;  5IYB H;  4KTA A;  5LMN L;  4UDU C;  3A54 A;  2AKW B;  2F0O A;  4A3B G;  1WTQ A;  2MP1 A;  1VQH A;  5FLX c;  2NVY H;  4FF3 A;  3KK7 A;  1YNJ D;  1WTV A;  1D5X C;  1MSH A;  3I72 A;  3Q23 A;  1SNP A;  4DAM A;  3PGZ A;  4ZYS A;  4TKO B;  4JC0 A;  1WCM B;  2PQA B;  1HNZ Q;  1B44 D;  5IGD A;  2RF4 A;  1ZXT A;  5D65 A;  3NHH A;  1V9P A;  5JEA G;  2O5J C;  2KCN A;  3ERQ A;  2X6G A;  4C3J B;  3MAQ A;  3SK8 A;  2K5Q A;  3B6Y A;  2YYZ A;  3J81 L;  5IYB G;  2UXC L;  1FNU A;  1FR3 A;  2E2H H;  3SK6 A;  4YY3 Q;  3GTJ H;  3HP3 A;  1XTD A;  4BWG B;  3I4O A;  1W3S A;  2K5W A;  2QCP X;  3FKI B;  3I3C A;  3I90 A;  3K5O A;  4DXG A;  4X64 Q;  1IKL A;  1B53 A;  2VB2 X;  3MXN A;  3A8I E;  3NEL A;  2R7Z G;  3TP5 A;  1V1Q A;  2P5Z X;  3TQY A;  3WWV A;  5ELC A;  4PMB A;  2NVT H;  3IAY A;  3HOU B;  1LTS D;  4UHV A;  4OO1 H;  4A3D G;  2QW7 A;  2K50 A;  1ET9 A;  3KDF B;  2EQS A;  1SYD A;  1SYG A;  5LMU Q;  2VW9 A;  1MIU A;  1SDF A;  2DUD A;  4RGN A;  3I4M H;  2ZJP A;  2R93 H;  1JE4 A;  1CA5 A;  4GNX A;  5LL6 X;  3H0G H;  3ONA B;  2VQF Q;  1WTW A;  1WTH A;  4RFB A;  2V4D A;  3M4Q A;  4FNF A;  2KBN A;  1C9O A;  1KAB A;  3J7Y W;  5M3F B;  4GLA C;  1ML0 D;  4LF4 Q;  1JB3 A;  4DA2 A;  5GAH C;  4OO1 G;  2SDF A;  1K0S A;  1L1O C;  1YHB A;  3FRP B;  3W1B A;  5IOC A;  3PV0 A;  3CD6 A;  1DJR D;  1Q86 C;  3NQT A;  4LUO A;  2IW3 A;  1K8M A;  5CV9 A;  1I4X A;  4OO1 I;  3I4M G;  2BA0 A;  2R93 G;  4XQJ A;  3RLN A;  2EOT A;  2KVM A;  1EYC A;  3H0G G;  4B3T Q;  4DAY A;  1A62 A;  2MFI A;  3KF6 B;  5KRU A;  3IRB A;  3HG9 A;  3MEH A;  4NXN L;  4CDC C;  3CCE A;  2JN4 A;  3EA6 A;  2CWA A;  1V1P A;  2AQ3 B;  5JPM C;  1ZYR D;  4HR7 B;  2OTL A;  1BO0 A;  4WRD A;  2C5C A;  3JC6 6;  3I73 A;  3VR3 A;  4FYD A;  5LL6 S;  4R4T A;  1PFB A;  4H7B A;  1XNR Q;  2AHO B;  2DY7 A;  3SEB A;  4X3K A;  1ESF A;  2R3Z A;  3G6E A;  2CW0 D;  3IL8 A;  4TQU S;  4DNR B;  4A3M H;  4GS3 A;  3GO5 A;  1EYG A;  1A3U A;  1NBW A;  3BZD B;  1R9T B;  1AE2 A;  4LWC A;  3EQL C;  3CQZ B;  2RSO A;  4OON A;  2EJF C;  2QGQ A;  3T16 A;  4X3U A;  2RQX A;  3N6R A;  3CME A;  4AQY L;  5C3X A;  5C6A A;  1BBW A;  1N36 L;  4ZK9 B;  2B63 H;  4HJ7 A;  3D31 A;  4M8A A;  1L0Y B;  2N8N A;  5C3E H;  1VQG A;  3CW2 C;  4G7O C;  1IL2 A;  2EYM A;  2K32 A;  4YWL A;  1FNW A;  2G5D A;  4K8J A;  5IOD A;  4A3E H;  5CMD A;  2JEA I;  4A3M G;  4A3L H;  1SNO A;  1V43 A;  2K5H A;  5IGF A;  3ULL A;  1N32 Q;  2KHJ A;  3HOY B;  4AYB G;  5GAG C;  4ZKC B;  1TWH B;  3CRK C;  2XNA C;  4NMZ A;  1UE1 A;  3JAM i;  3OHX C;  3HZX A;  2B63 G;  2HCC A;  5C3E G;  2EYH A;  5AJ3 Q;  1QG7 A;  3OMG A;  2VZA A;  3OOC A;  3KJO A;  4NB3 A;  4DU9 A;  3STB D;  3F2U A;  2FFK B;  2B2T C;  1KDC A;  4A3E G;  1T9H A;  1M90 C;  3QIA A;  3Q8D A;  3F8T A;  1RCV D;  4ZAI A;  3TZD A;  3UDI A;  4QUF A;  3DEO A;  4A3L G;  4K8I A;  3RR5 A;  1XPO A;  2JQO A;  3NXW A;  5COR A;  1X3F A;  4EQP A;  1NNX A;  1G6P A;  3MXU A;  3R2T A;  1IW7 C;  4JI8 L;  1I94 L;  4C3J H;  4BBS B;  4NPS A;  2L1B A;  2BH8 A;  1N34 Q;  1AW7 A;  2NZ1 D;  5NUC A;  1U0L A;  1Q1B A;  4OWT B;  5EBD A;  1CM9 A;  3NPP A;  3GDE A;  2QF7 A;  2WV6 D;  4GKK L;  2UXD L;  2E5L Q;  1G2S A;  1LV9 A;  1WCM G;  3UE0 A;  5CBA E;  4ABN A;  1KDB A;  3NBH B;  5C44 B;  4FF2 A;  1NTG A;  3RZD H;  4C3J G;  1JT8 A;  3ULP A;  2D62 A;  1HNW L;  3D4D A;  3HOU H;  3WDN A;  2RA4 A;  2BE5 C;  3A5Z B;  1VQF A;  4IPH A;  4DR7 L;  4XIG S;  4KY7 A;  5EQ0 A;  4PZ6 A;  2CQO A;  1NR4 A;  1K3R A;  2NB0 A;  1VF7 A;  2G9H D;  2M00 A;  3FKI G;  3A55 A;  3NEM A;  5HGQ A;  3T1H L;  3K5M A;  2XTI A;  5IY0 A;  4ZUJ A;  3KUP A;  1YIT A;  1NUC A;  2F0Q A;  2ZJR A;  4FXK C;  1I50 H;  1X3P A;  4PZ7 A;  4B3M Q;  1PZI D;  4IFD H;  2BA1 A;  1U4P A;  4QB4 A;  5M3F H;  3GTQ H;  4DR4 L;  1H9J A;  1SLJ A;  3H91 A;  1SYC A;  4XQN A;  4JI4 Q;  3K58 A;  3HOU G;  2MQH A;  1XMQ L;  1B8A A;  5EKL A;  1HH2 P;  3Q24 A;  1H9S B;  1SNM A;  4HSP A;  2ZT9 C;  3SXH A;  4X65 Q;  4DK3 C;  4NXM L;  1LTA D;  1TII D;  4HCE A;  5D3D A;  4A3I B;  4EGV A;  2E76 C;  2KA7 A;  3GV6 A;  3CCR A;  2CVR A;  1SYF A;  1F2M A;  5DEH A;  1FNV A;  1YEZ A;  2EXZ A;  1E7Z A;  1PTO F;  5G3L D;  4LF5 L;  3HGB A;  2LS0 1;  4LFC Q;  1D5M C;  4DFA A;  4IAL A;  5M3F G;  1Q8K A;  1GUN A;  2H1E A;  4QIW E;  2ZTD A;  4KHP L;  5COY A;  4IFD I;  1KC8 C;  1GUT A;  3AQQ A;  2HDL A;  1KD1 C;  2ALY B;  3K0X A;  4X6A H;  1JCK B;  1KRT A;  1IYV A;  3I56 A;  1J5E Q;  1A0I A;  4X66 L;  3S1M B;  4PMC A;  1HFN A;  2O2L D;  3D0F A;  5E3F A;  2DN8 A;  4LNQ A;  3QG1 A;  2I0Q A;  1HZA A;  4A3F B;  4DR6 L;  3AB9 A;  3K6O A;  1R9T H;  4N9P A;  3E0E A;  2KJX A;  3CQZ H;  4PMW A;  4QJF A;  4B3R Q;  4J1M A;  3BJU A;  4HTH A;  1PRT C;  1K83 H;  2AQ2 B;  4DR5 L;  3VYR A;  1GXD C;  2XSC A;  4UP9 A;  4JOI A;  4DV6 Q;  1SNC A;  4MHE A;  2K7V A;  4GOP A;  1NE3 A;  2D2C C;  3DUZ A;  1C7Y A;  1JQY D;  1D1I A;  3J7A F;  4DV4 L;  1I4H A;  2GA4 B;  1KDA A;  2QDB A;  2EPB A;  4LFA Q;  4DUZ L;  1QOH A;  3MXG A;  3SK5 A;  3DM1 A;  3EIV A;  4HJ9 A;  1LM0 A;  3HOY H;  1WI5 A;  2Y0S G;  1EFW A;  4IPG A;  3D3R A;  3TME A;  3UDF A;  4OL7 A;  5EKI A;  1SND A;  5IGG A;  1XPR A;  2Z1C A;  1A2U A;  4ZLT F;  1VQL A;  2K5V A;  1DYQ A;  1Y8P B;  4WFN 3;  5JPN C;  4DV0 L;  4IOC A;  4NW2 A;  4FF1 A;  3GP7 A;  3FDT A;  1XNQ Q;  2A68 C;  4KKT A;  2WKD A;  4JBW A;  2TMP A;  2F0F A;  4BA1 I;  4ID6 A;  1X6O A;  1K0R A;  2ID0 A;  4EQO A;  5ELB A;  2E2H B;  3HOY G;  3VR5 A;  1VQ9 A;  4KHZ A;  1KNE A;  1HNX L;  5D14 A;  5CBE E;  3J80 E;  1O7Z A;  2Z9H A;  2A8V A;  4BBS H;  3DHQ A;  2O4X A;  1F9Q A;  4DV7 Q;  1N8R C;  2X69 A;  3S1N B;  1DXM A;  1HJP A;  2EYO A;  4MTK A;  1V1O A;  1N33 Q;  2EE1 A;  2EXD A;  2E8G A;  1S5E D;  2EJG C;  3BDL A;  2E74 C;  1EU4 A;  3QOL A;  2WII B;  2VY3 A;  1PV4 A;  1AE3 A;  2PW7 A;  2K52 A;  1B3Q A;  2DY8 A;  1QUQ B;  5C4J B;  5C44 H;  1PH9 A;  4CJ0 B;  5JJK A;  1TY2 A;  1YJN A;  5EPK A;  4A3C H;  4JI5 L;  2K1B A;  4BBS G;  4XT1 B;  1STG A;  4KJO A;  1GUW A;  2SEB D;  3G6J B;  4DR3 L;  2JA7 B;  1W2B A;  1JOQ A;  2PZU A;  3Q22 A;  3K5L A;  1XYI A;  1DON A;  1X55 A;  4C2M B;  3FPU B;  3HFZ B;  2WKC A;  1B4O A;  1ILP A;  4Y7N H;  4RH6 A;  1LT4 D;  1ICF B;  4EQN A;  4KN4 C;  4Z9C B;  3CKI B;  1LAC A;  4OEM B;  4QGU A;  5C44 G;  4CHT B;  2EY6 A;  1B1Z A;  4XTC S;  1HXY D;  4A3C G;  3V2T A;  1I3Q H;  3GTG B;  4OHJ A;  2K03 A;  4HJA A;  2AQ1 B;  1OXT A;  1JWM D;  1WD1 A;  2IHF A;  3IFD A;  3MA2 B;  3SVM A;  3A74 A;  1ET6 A;  4OX9 Q;  1YI2 A;  1TS3 A;  3QO2 A;  3ICE A;  2V1C C;  1Y14 B;  3T1Y Q;  2EY2 A;  3U4V A;  1UUP A;  4LF7 L;  1S40 A;  4J6H A;  1TKW B;  3GTP B;  1U4L A;  1NMF A;  3AMU A;  1EYD A;  4A3J B;  2OTJ A;  2F0W A;  3D6C A;  3ZJY C;  4RGO S;  2F0T A;  1TY0 A;  1L0W A;  2EJM A;  5A2Q E;  2UU9 L;  4RMF A;  1J8I A;  1BCP B;  5TSS A;  1LTT D;  1NSN S;  4A3I G;  2MNA A;  2Q8R E;  4HSV A;  3GTL H;  1X3G A;  3VR6 A;  1ASZ A;  5KNC A;  1A15 A;  1J9O A;  1O7Y A;  2BE5 D;  3OMC A;  5I9O A;  2B63 B;  4K5W A;  4A3F H;  2KED A;  4P72 A;  4N9T A;  2VQE Q;  3L7Z C;  3P75 A;  2EYF A;  1HNZ L;  1EIF A;  3WOF A;  1CUK A;  1VQ4 A;  1PH7 A;  1BBX C;  1EQT A;  3FPP A;  3J80 L;  2VUM H;  2G9D A;  4CJ2 C;  1Q12 A;  1L0X B;  1SEB D;  3H3V C;  4QMG A;  1U9R A;  2EY5 A;  4N8X 1;  3PMF A;  1EQV A;  1KLU D;  4YY3 L;  1Q1E A;  4JI2 Q;  3L9A X;  3KLR A;  3W5O A;  4ALP A;  4A3F G;  3ND9 A;  1K8O A;  4RKL A;  2CFM A;  2RCF A;  2Z4H A;  5IT9 c;  1DOL A;  4DAP A;  4X64 L;  1AEX A;  4FXD A;  3NK9 A;  3U9O A;  4MZ9 A;  5FLX E;  1KQS A;  3R8B A;  1D2B A;  1PZJ D;  4GN3 B;  4BY7 B;  4JYA Q;  2ICI A;  4KKS A;  5I6Y A;  3JAM c;  4APV A;  2ZXR A;  1X54 A;  4IPC A;  4KJN A;  4R8N A;  5K36 G;  1TWA B;  3GQB A;  4JW0 A;  3HRZ C;  1B9M A;  2R7D A;  2PYK A;  3TZU A;  1Y8O B;  3I55 A;  1T5E A;  1HHV A;  2XVS A;  1YHQ A;  3E9H A;  2ES2 A;  1XXG A;  4LAA A;  5JAV A;  3HOZ B;  1JIC A;  1SRO A;  2IPK D;  4JI1 Q;  1WTR A;  2JXM B;  1Q82 C;  1LTG D;  1ASY A;  4M1U B;  4AH6 A;  1ONL A;  2KEN A;  2VQF L;  4O0A A;  4IUP A;  1RHP A;  1D7Q A;  2J4X A;  3NUC A;  4MIU A;  4L8J A;  1BDO A;  2NWG A;  3S1N H;  3C1F A;  1PYS B;  4LF4 L;  5M5X B;  3PO2 H;  1HA6 A;  1T5X D;  3NWS A;  3RZD B;  1PRT D;  2L11 A;  4Q5V A;  4H13 C;  3T13 A;  1QJO A;  4DR2 Q;  1SE8 A;  4CKE A;  4JV5 Q;  1PH4 A;  5G3L F;  3UDX A;  4LF8 Q;  5C4J H;  1LO5 D;  5DAU A;  4B3T L;  2OQ0 A;  2F0I A;  2FXQ A;  1A3V A;  1QWY A;  2IX0 A;  2WIN B;  5M3M B;  1PLF A;  4G7Z C;  1VQ8 A;  2RHS B;  2BCO A;  5EAY A;  2KEE A;  1HZ9 A;  1X65 A;  2ZJQ A;  5KGU A;  2OCE A;  2PZT A;  4G4K A;  2JA7 H;  2ATW A;  1MJE A;  1I50 B;  4CGY B;  2YU9 B;  5A2Q L;  3J81 i;  3I4N H;  2HHH Q;  2X6L A;  4C2M H;  4K0K Q;  3GTQ B;  1F9R A;  3CAM A;  2JA8 H;  2N88 A;  5IGB A;  4BS9 A;  1DZ1 A;  1AP0 A;  4L5S A;  2B2W C;  3I4L A;  5GAD C;  3GTM B;  1XNR L;  3CC7 A;  1KAW A;  2HQE A;  2MJ8 A;  1CQF A;  1RTN A;  1HQM C;  1VDZ A;  3I91 A;  1HA5 A;  2M9V A;  3TSS A;  1L1O A;  3S14 B;  2A68 D;  1HQR D;  3CCV A;  3GTG H;  1GD7 A;  2GVB A;  3E0J A;  2F0S A;  1BR9 A;  4HJ5 A;  4F87 A;  2JA7 G;  4RG1 A;  5DNF A;  3HKZ B;  1NR2 A;  3GV3 A;  4IZ8 A;  1KXL A;  1TXY A;  3CCQ A;  1HCZ A;  1VQA A;  4FXG C;  5C4Z A;  3ULJ A;  4FF4 A;  4YWK A;  4IFD J;  1IYU A;  5JVH 3;  4DV3 Q;  4KMU C;  2RKS A;  2B2Y C;  3M3Y B;  2K33 A;  3GD7 A;  4JI7 Q;  1PFM A;  3GTP H;  2B2Y A;  1SSO A;  2OT2 A;  1MJC A;  4PZ8 A;  5KIX A;  1N32 L;  1EL0 A;  1O80 A;  4A3J H;  2VB3 X;  3HOV H;  5FLX L;  2B8G A;  1CKO A;  4BBR B;  3MXN B;  2L15 A;  4YIJ A;  3MZ5 A;  3IFT A;  1K73 C;  2F03 A;  3T56 B;  5DM7 3;  3O13 A;  1TVX A;  1Z7T A;  4DN4 M;  4UAI A;  2Y0S B;  4C3H B;  1CK1 A;  4YWM A;  5AJ3 L;  1DGS A;  1K83 B;  4X62 Q;  1PDQ A;  2QEJ C;  1SFO B;  1VQD A;  1BQQ T;  1OXS C;  3OYY A;  2FMC A;  1EY6 A;  1KTK A;  2QKI C;  1CHQ D;  4B3S Q;  2N3S A;  2HUG A;  3I8Z A;  2F0L A;  3BYT B;  2NN6 H;  2L5T A;  4C1N I;  4GNX B;  2EYP A;  4H02 A;  2I5H A;  4A3J G;  4O2D A;  2A1A A;  3MFG A;  2F0J A;  3S1Q B;  4KI0 A;  2ZM6 Q;  4EX5 A;  1VQE A;  4P71 A;  2WAQ B;  2BDO A;  3TRE A;  4DV2 Q;  3FVQ A;  1MGS A;  1STN A;  1Q7Y C;  4DXF A;  1ROD A;  4GLX A;  1CKN A;  4IUR A;  2WB1 B;  4QQB X;  4U67 3;  1N34 L;  4R8I A;  1M1K C;  2K28 A;  3TRZ A;  4KY5 A;  3QOJ A;  2CH4 W;  3H94 A;  3WOE A;  1LAB A;  4DV1 Q;  2JE6 I;  5IWA Q;  3D4W A;  2E5L L;  4RCO A;  2NN6 G;  2NVX B;  2WP8 J;  3KBX A;  2JEB I;  4DAV A;  1I4P A;  1A3T A;  4DAY B;  3T4A C;  1A2T A;  4JVZ A;  1VQO A;  5J39 A;  1WTO A;  2B2T A;  4FVM A;  4BY7 H;  2NN6 I;  4ZCK A;  1I4R A;  1V1P B;  4R4O A;  1STY A;  1IHZ A;  1TWA H;  4L6T B;  3U58 A;  1Q81 C;  3PIO 3;  1PH6 A;  3PUZ A;  2XRQ D;  1SN8 A;  1IBM Q;  3CCS A;  5C4X B;  2PNR C;  1A63 A;  1Y1V H;  3HOZ H;  1GUS A;  5E4W C;  2D0P A;  2B8F A;  2PO4 A;  1KLG D;  1OXV A;  2AMC B;  2OF1 A;  2IX3 A;  4ME3 A;  1X32 A;  3A8K E;  3CXC A;  1CI3 M;  1QNK A;  1YBY A;  2DJF C;  4LJZ C;  4B3M L;  2JJQ A;  4BY7 G;  2EYJ A;  5EPL A;  3N52 A;  5FLM H;  1ILQ A;  3TS0 A;  3T53 B;  1F77 A;  3EJI A;  1A8V A;  5KYL A;  5M5X H;  2BDN A;  4JI4 L;  1H9M A;  1MI2 A;  1OO9 B;  4S3S A;  1VQB A;  1WOC A;  4KD4 A;  3S24 A;  4NDX A;  4XT3 B;  1JMC A;  2K04 A;  4HCS A;  3UI2 A;  4DR1 Q;  2CWP A;  1YNX A;  2J7Z A;  4X65 L;  1GM5 A;  5M5W H;  3HOZ G;  5J3B A;  1PXU A;  3RD4 A;  2AUJ D;  2PI2 E;  3EN2 A;  3E5S A;  4JBJ A;  4LUZ A;  1VQ6 A;  5M3M H;  1JJC B;  1B70 B;  4Y7N B;  2NTT A;  3PUW A;  3GTK B;  4LFC L;  2EVB A;  5JJZ A;  2C35 B;  1ZKO A;  1JWS D;  1XWE A;  2SNS A;  3NP8 A;  3F2C A;  2YU9 H;  1RIP A;  3H15 A;  1I94 Q;  3A8J E;  3ND8 A;  2KCC A;  1I3Q B;  1QVC A;  2DJG C;  3M85 A;  1IYJ B;  3L0O A;  2SNM A;  1IBK Q;  1I5F A;  3CPF A;  3MEF A;  2HD3 A;  3G4S A;  3GTM H;  1J6Q A;  1J5E L;  1MSG A;  2A6H C;  2EY1 A;  4WJ4 A;  4DK1 A;  1EZ6 A;  5DM6 3;  1Q46 A;  1JOR A;  4LW1 A;  5M3M G;  3S14 H;  3NQI A;  4F88 A;  4OWX B;  5GQO A;  4QY7 A;  4HMJ A;  2PCF B;  5JJL A;  4B3R L;  2VNU D;  2F3W A;  4AYB E;  4IFD G;  1YZ6 A;  1GOZ A;  4DV6 L;  2QA4 A;  1PFN A;  4UP7 A;  2HIX A;  3M3Y H;  4K14 A;  1EWC A;  4LFA L;  1K8A C;  1DM0 B;  4B08 A;  1Q3L A;  4LF9 L;  5C3W A;  1B7Y B;  4H0L C;  3CCL A;  3GTL B;  3I70 A;  3RZO B;  4BBR H;  4DUY Q;  2CCZ A;  3S2D H;  5CV6 A;  4IN3 A;  3DXJ C;  4IJL A;  3HKZ G;  2BOS A;  2UUB Q;  1Z47 A;  2YTV A;  1SXT A;  3CU7 A;  1I4Q A;  2NZH A;  1SJE D;  5BR8 Q;  3R3O A;  4A3K B;  4C3H H;  5AFW A;  1WVL A;  1HUN A;  4PQX A;  3MTS A;  1K3B C;  1SFO H;  4A3G B;  2XWB B;  4ILW A;  3CCM A;  2VUM B;  3K80 C;  2K6A A;  1N9W A;  2K05 A;  1TWF B;  1XNQ L;  1KHI A;  1EEI D;  1KL9 A;  2KUM A;  4XYO A;  1DOM A;  3DM3 A;  3S1Q H;  1P16 A;  1FGB D;  2HQL A;  4BBR G;  3OTO Q;  5FOB B;  1PTO B;  2NVQ B;  2JA6 H;  3HOW B;  3BVG A;  4DV7 L;  4JI0 Q;  4C3H G;  4DPG A;  3PIO A;  1PRT F;  1N33 L;  4DV5 Q;  1SMY C;  1OXX K;  1TQO A;  1GJX A;  2YTX A;  1QZH A;  2PW5 A;  1EYA A;  4UP8 A;  1C4Q A;  4ME5 A;  4B9X A;  4CDD C;  1IKM A;  1MBY A;  2L9H A;  1XTC D;  2NVX H;  2Z6K C;  1ENC A;  4LFB Q;  5IYD H;  5CGK A;  2Q8T A;  2OQK A;  1HTP A;  2WAQ G;  5FO8 B;  3AYH B;  4F7X A;  5M5Y B;  5H1S E;  2WB1 G;  4OWW B;  2F0P A;  3E3X A;  4DK6 C;  2XN9 C;  5T1I A;  4R9W A;  4OXP A;  4YCV A;  5I4D A;  1VQP A;  4YCU A;  2E2J B;  1LTB D;  5C4X H;  3QR8 A;  3S16 B;  1JJG A;  1VF5 C;  2RSN A;  1LT3 D;  2F0E A;  1YJ9 A;  2Z4I A;  3MFY A;  1KAA A;  3M7N A;  5BN3 A;  3PO2 B;  1RDP D;  1HTL D;  1S5C D;  1A6X A;  3PO3 B;  1SR3 A;  2CKZ B;  1HFG A;  4DF7 A;  5IYD G;  4B9W A;  3F2D A;  2RDF A;  1YJW A;  4O1N A;  4JBK A;  3NTH A;  1PYB A;  5JOB A;  2R92 B;  2IJ0 A;  3MWY W;  3OWE B;  3KLS X;  3VYT A;  3G48 A;  1NY4 A;  1U4R A;  4V0B A;  1QB5 D;  3D8G A;  4R4C A;  4OGQ C;  4OX9 L;  2NUC A;  2F4V Q;  3GTO B;  3SHL A;  5C4X G;  1BCP C;  1V8Q A;  4GOP B;  2MGS A;  1X3Q A;  4O42 A;  2I46 A;  2UUA Q;  4HAE A;  1Z6H A;  3M4P A;  1FJG Q;  5CV5 A;  4IUQ A;  3T1Y L;  2B39 A;  3G71 A;  3I4N B;  3HKS A;  4E6I A;  2JA8 B;  1M8A A;  3V96 A;  4WJ3 M;  2LFN A;  4I7A A;  2UUC Q;  3GTK H;  4FDB A;  4EVO A;  3KOJ A;  5E7N A;  1EQR A;  5ELO A;  2QIL A;  1F2Z A;  3AU7 A;  3K7A B;  5BN4 A;  4CDF C;  5CV4 A;  4ZUI A;  1DD2 A;  2EDG A;  2OWO A;  3HKZ E;  1EIG A;  3KF8 A;  4TSS A;  1YHA A;  1FGU A;  4LF6 Q;  1HR0 W;  5E4X A;  5C5L A;  1STE A;  2HIV A;  3BU2 A;  3J81 c;  1GKH A;  1VCI A;  1D1K A;  4HED A;  1I6H B;  4ZRZ A;  3S1R B;  2F3V A;  4P74 A;  1B50 A;  3EVQ A;  2Q2I A;  2L4N A;  3NE5 B;  3P7J A;  1IW7 D;  1HR0 Q;  3NTI A;  4YHH L;  1PH1 A;  1G6Z A;  2VQE L;  4IUV A;  5IIF A;  2I07 B;  3URY A;  2HT1 A;  4V19 0;  4A93 H;  2ENB A;  1S5F D;  1W6K A;  2B2V C;  5C5M A;  3RUZ A;  4GKJ Q;  1TS5 A;  2F0U A;  4JI6 Q;  2Y0S E;  1VQC A;  3F1Z A;  2PQE A;  1EY7 A;  4A76 A;  3HOV B;  1XJV A;  3CC2 A;  2PQA A;  3S17 B;  4ZQ3 A;  3K59 A;  4DK0 A;  1LT5 D;  3X3M A;  5KYI A;  4GLV B;  3CPW A;  2F0V A;  1TWG B;  3LNN A;  4KKU A;  4J15 A;  5KNB A;  4JI2 L;  3U50 C;  1XMO Q;  4A75 A;  1FYC A;  1MHW C;  2B29 A;  3PUY A;  3EFX D;  1LYL A;  1X3E A;  3UDG A;  3RZO H;  2ZTC A;  1UEB A;  2R61 A;  1VQI A;  2MO1 A;  5I2Y A;  3NBI A;  1F9S A;  2B2U C;  1S5B D;  2WAQ E;  2TSS A;  1EZ8 A;  2B3G A;  2L55 A;  1H95 A;  1S3O A;  1S5D D;  4JI3 Q;  1SE4 A;  4C1N K;  4JYA L;  4A3K H;  4HJ8 A;  5EPJ A;  1RJT A;  4CJ1 B;  1G91 A;  1ENA A;  3TP6 A;  4A3G H;  2F0D A;  3RN2 A;  1NCV A;  2IY5 B;  2NYZ D;  4NKL A;  1TWF H;  4K5X A;  5FO7 B;  1YNN C;  1E2Z A;  1CTM A;  1P8L A;  2VS1 A;  1BXT A;  3DWA A;  1YIJ A;  1Y8N B;  4A3B H;  4JI1 L;  4HIK A;  2UXB Q;  3KJP A;  1PTO H;  1K28 A;  2A6H D;  3A5U A;  3P20 A;  4EQ5 A;  3KDF A;  2NVQ H;  1I6V C;  3HOW H;  4GZY C;  4A3K G;  5IT9 E;  1HPC A;  3QWN A;  1TT2 A;  2FJ2 A;  4A3G G;  1SAP A;  1EFI D;  2VUM G;  4JG2 A;  3SGI A;  5FJ8 H;  2KCT A;  1AFP A;  2CQA A;  3JAM E;  4DR2 L;  4JV5 L;  4UPA A;  3AFQ A;  3R93 A;  4LF8 L;  4XXE A;  5LMU L;  1Y1V B;  5GRO A;  2DNC A;  4RWS C;  1HZC A;  1BUV T;  5DLQ E;  3TP7 A;  1EWI A;  4MNO A;  3HOW G;  1UE5 A;  1LTR D;  3J80 i;  5M5Y H;  3CF5 A;  2A69 C;  3VYS A;  2H5X A;  3J7Z C;  3S2H H;  4KV6 A;  2E2J H;  1O7I A;  1WFQ A;  2R7Z H;  5JVG 3;  5LMN W;  4IQZ A;  2HHH L;  2KCM A;  3S16 H;  4K0K L;  3KF6 A;  1OTC A;  5IP9 H;  3K81 C;  5FJ8 G;  3RNU A;  4WOR A;  2NTS A;  3TBI B;  3HS0 C;  1JE5 A;  2MO0 A;  3ITP A;  3W3A A;  3PO3 H;  1EOV A;  3TS2 A;  2AWN A;  2JSO A;  4A3D H;  4F8M A;  4HN7 A;  1EU3 A;  2F0M A;  1IBL Q;  5LMN Q;  2R92 H;  5M5W B;  1VMC A;  4N8F A;  3MHB A;  1QE6 A;  3HOX B;  5J1Z A;  2Q8I B;  3I7F A;  1PVO A;  4XDX A;  2A6E C;  2L0C A;  4FP5 D;  3GTO H;  3U4Z A;  2E2D C;  1QNU A;  3KLS A;  2FMM A;  2N78 A;  1ICW A;  3S15 B;  5IP9 G;  2D0O A;  3G7L A;  2BH2 A;  4A4I A;  3CHB D;  4POG A;  3PO2 G;  1QZG A;  4DV3 L;  3K0Y A;  2IHE A;  3PO3 G;  2Q2H A;  1SJH D;  3ZYY X;  1KNA A;  2CHB D;  5M9O A;  1SMY D;  4JI7 L;  2UXC Q;  2R92 G;  4BA2 I;  3NTK A;  4GNX C;  4PNY A;  3K7A H;  3I2Z A;  3PUX A;  2F0K A;  2B2W A;  5IP7 H;  2N55 A;  4I7Z C;  1E2W A;  1LUZ A;  4AIM A;  1Q8I A;  3A7A B;  3NSW A;  1IXR A;  1QVF A;  1NMG A;  4DNI A;  3S9W A;  3R2I A;  1I6H H;  3S1R H;  1UE6 A;  3SR1 A;  4JK1 C;  2OEO A;  4X62 L;  4I65 A;  2KOL A;  3OIQ A;  3I4N G;  1C48 A;  2JA8 G;  1FL0 A;  1E2V A;  1ENF A;  4B3S L;  2DGY A;  1Y1W B;  3OWF A;  1UNS A;  4OIK A;  1CFM A;  1QIL A;  5IE8 A;  5CV7 A;  1U5K A;  2ZM6 L;  2QEX A;  5IP7 G;  3M4Y A;  4ULL A;  1R4P B;  4QF4 A;  4KLK A;  3NEN A;  1STB A;  5IT9 L;  4DV2 L;  3S17 H;  3S2D B;  2ZTE A;  1O7L A;  1PH5 A;  5CV8 A;  2O5I C;  1TWG H;  4DGZ A;  3KFU A;  3UE1 A;  4DV1 L;  3JAM L;  2LY7 A;  1EY5 A;  1BCP D;  5IWA L;  5C0X H;  4KHV A;  2J0T D;  4UY8 C;  2ZXO A;  1CQV A;  3L2P A;  3QJY A;  1WTP A;  1SRU A;  5EBC A;  4HID A;  1E0B A;  2KQ3 A;  1C0A A;  4RGM A;  1PH2 A;  1BF4 A;  1WD0 A;  3HOV G;  2D9U A;  2CH4 A;  1PMR A;  5ELE A;  5IGE A;  2Z8L A;  4C3I B;  1IBM L;  1QCB D;  3NBH A;  2PMZ B;  3DEP A;  4NXN Q;  2JA6 B;  4HMI A;  5I6W A;  3LX0 A;  3VA5 A;  3MVV A;  2E75 C;  5C0X G;  1AN8 A;  1STH A;  3K8A A;  3PCO B;  1EWH A;  3TEH B;  1L1O B;  2MHV A;  3BS1 A;  3MXP A;  3L3O C;  5ELF A;  5C0X I;  3LWU A;  1VQ7 A;  1EY9 A;  3FP9 A;  1BVS A;  4YCW A;  2ASB A;  1CZW A;  3PUV A;  1E3P A;  2A74 C;  1LLR D;  4KK7 A;  5HUR A;  2F4I A;  3BZK A;  3Q0A A;  1JOO A;  3K5N A;  1EIY B;  3BZC A;  1JWU D;  4HIO A;  4DR1 L;  1LTI D;  3PSI A;  4AQY Q;  1D6E C;  1K8G A;  1N36 Q;  2KHI A;  2YV5 A;  2F1M A;  1X56 A;  2Z0S A;  1TS4 A;  1Q90 A;  1H9S A;  3BYY B;  5FK9 C;  4BY1 B;  1TR5 A;  3HEJ A;  1WCM H;  2KHS A;  1VQM A;  1S4Z A;  4GN5 A;  3P1H A;  4U68 A;  1VQ5 A;  2L12 A;  2M2L A;  4RAU C;  2JA5 B;  1HRJ A;  5KEE A;  2I5M X;  2WFW A;  2XIW A;  3D6W A;  2EYL A;  4RHR A;  5BN5 A;  1PH8 A;  4R4Q A;  3A0J A;  3A7L A;  1IBK L;  2OXP A;  1PYW D;  2FHT A;  2PZW A;  1O78 A;  1AZP A;  1IL8 A;  1M4V A;  3TN2 A;  1EOT A;  4RA8 A;  1Y1V G;  1EUJ A;  1UWV A;  3VYU A;  3E6Z X;  1YNN D;  2R6G A;  3FKI H;  1DCZ A;  3HOX H;  2SOB A;  4P75 A;  3VR4 A;  1MD2 D;  2F0N A;  2LXJ A;  1VQK A;  5IYC H;  1F2L A;  4ODG A;  2RDG A;  3U9S A;  1CT1 D;  5J22 A;  1CKN B;  5FLM G;  3S15 H;  5ELN A;  1H9R A;  3H3V H;  1SE3 A;  1CZG A;  2JK8 A;  3X3N A;  1VS0 A;  4JI8 Q;  1CA6 A;  1D5Z C;  3ER0 A;  1AH9 A;  1HZB A;  3BDO A;  1CSQ A;  1B2T A;  1GVP A;  3HOX G;  3M7G A;  4X3S A;  1FD7 D;  1OXU A;  4DUY L;  2R7F A;  1E24 A;  1PTO C;  4H44 C;  4L5Q A;  3TP8 A;  2UUB L;  3J81 j;  4GKK Q;  2UXD Q;  5IYC G;  5A35 A;  1JR0 D;  5BR8 L;  1F2Y A;  5HY6 A;  5GAE C;  2LKV A;  4A93 B;  4QL5 A;  3AFP A;  4IUU A;  1G29 1;  2A69 D;  4CDE C;  3Q6S A;  4LMQ D;  3C2P A;  5K5P A;  1VQN A;  1EY0 A;  3H3V I;  4L5R C;  1Y1W H;  1HNW Q;  3SK4 A;  3VR2 A;  5CR3 A;  1YNJ C;  4DR7 Q;  1E1O A;  1BBU A;  1GUG A;  5C4H A;  2MUY A;  5ISR A;  3OTO L;  2IT1 A;  3M4O B;  3CCU A;  2MPM A;  1G51 A;  1SYB A;  3T1H Q;  3DMU A;  3RMH A;  2IL8 A;  2H4O A;  2N49 A;  1Y69 U;  1LT6 D;  3EBE A;  4JI0 L;  5I2X A;  3J7A V;  1UAP A;  3ERS X;  1IZ6 A;  2RBM A;  1TS2 A;  1XX8 A;  2IX1 A;  4DV5 L;  3RLO A;  1SNQ A;  5FO9 B;  4DR4 Q;  2A6E D;  3C46 A;  1B9N A;  4FO2 A;  1Y1W G;  1U4M A;  1TWC B;  2A5H A;  2YTY A;  1RF2 D;  3AEV A;  1XMQ Q;  4P73 A;  1BNZ A;  4LFB L;  3BVZ A;  2F0G A;  4NXM Q;  1C8C A;  4A3B B;  1QVG A;  2D5D A;  3OSO A;  1JOK A;  1WYD A;  1EQQ A;  2RHQ B;  2AWO A;  2EZV A;  1L2F A;  4IUN A;  1SMX A;  2GN5 A;  3DWQ A;  4JOI C;  4LF5 Q;  4QUC A;  4C3I H;  1GHK A;  2VXW A;  1QUQ A;  1YVC A;  1WTX A;  4X3T A;  1BKB A;  4GOP C;  4RHS A;  4HIM A;  1NJI C;  1AZQ A;  2WAC A;  3CRL C;  1ZEQ X;  3C3L A;  4LK1 C;  2AUK A;  5CYU A;  4KHP Q;  5KND A;  1G8Z D;  1XPU A;  3SDZ A;  2LXK A;  4Q0F A;  4OEL B;  2RCN A;  2E2I B;  3KBG A;  1PA6 A;  5EGT A;  4LF9 Q;  4IPD A;  4XQQ A;  4X66 Q;  3M9B A;  1CKM A;  2NVY B;  2PPB C;  2Z6K A;  1TWH H; 
#chains in the Genus database with same CATH homology
 5CC4 A;  3DWP A;  4C3I G;  3BVM A;  4MN3 A;  4K6L A;  5FKA C;  3S2H B;  1BOS A;  2R7Z B;  3PIP 3;  2LMC B;  4K2K A;  3H6M A;  4IUT A;  5JEA J;  3GTJ B;  4A3D B;  5E1F A;  2IWH A;  3K57 A;  5F2D A;  4KD3 A;  2NBF A;  4L63 B;  1STA A;  1ZYR C;  3FMC A;  1RKN A;  1PRT B;  1SBB B;  1GUO A;  4QCL A;  1PZK D;  3TDQ A;  1SE2 A;  5D3I B;  2F0H A;  3RLF A;  2ICE C;  5ELD A;  2JYO A;  4K5V A;  4RGT A;  1CHP D;  2NVT B;  1EY8 A;  1B3A A;  2CW0 C;  3OW7 A;  3NWT A;  2DNE A;  2XWJ B;  1RD9 D;  3MC0 B;  3OIP A;  1VMP A;  4NP5 A;  4OIJ A;  3I4M B;  2R93 B;  3BDC A;  3H0G B;  3QB3 A;  1BCP F;  4C56 C;  4TRD A;  4RKB A;  2ZXP A;  3J81 E;  4CKC A;  1RTO A;  1F9P A;  2HDM A;  1I4G A;  1DOK A;  2K5D A;  3D4R A;  1EEF D;  3IKJ A;  2KEC A;  4K6D A;  4CKB A;  2B2V A;  5IGC A;  5LHY 1;  1R4Q B;  5EJW A;  3VA7 A;  1EIH A;  3A56 A;  3LWE A;  3C1E A;  3SE0 A;  1JC7 A;  5I9P A;  1TU2 B;  4G57 A;  5HGT A;  2RVL A;  4K2L A;  1NAP A;  4A3M B;  2B2U A;  5EKK A;  2JP1 A;  2K01 A;  4XYQ A;  4AYB B;  3T51 B;  4CBV A;  1SYE A;  2A73 B;  4KN7 C;  2HCI A;  4QIW B;  2XRS D;  4G7H C;  5C3E B;  2C9O A;  4WJW A;  3H09 A;  4RCN A;  4KY6 A;  1G2T A;  4P2C B;  3V05 A;  4A3E B;  2RDH A;  4ZKB B;  5C0X J;  2FIN B;  3W2D A;  3ERO A;  1UEA B;  1EY4 A;  1HUM A;  4PV1 C;  3BG3 A;  1PTO D;  4DNT B;  1GHJ A;  1II3 A;  5K36 H;  3FEW X;  1W6J A;  5JEA H;  1H9K A;  4J8Q A;  5T1G A;  1ESR A;  3OPO A;  4KTA A;  4UDU C;  3A54 A;  2F0O A;  1WTQ A;  2MP1 A;  4FF3 A;  3KK7 A;  1YNJ D;  1WTV A;  1D5X C;  1MSH A;  3I72 A;  3Q23 A;  1SNP A;  4ZYS A;  4TKO B;  1WCM B;  1B44 D;  5IGD A;  1ZXT A;  5D65 A;  3NHH A;  5JEA G;  2O5J C;  2KCN A;  3ERQ A;  2X6G A;  4C3J B;  3MAQ A;  3SK8 A;  2K5Q A;  2YYZ A;  3J81 L;  1FNU A;  1FR3 A;  3SK6 A;  3HP3 A;  4BWG B;  2K5W A;  2QCP X;  3FKI B;  3I3C A;  3I90 A;  3K5O A;  4DXG A;  1IKL A;  1B53 A;  2VB2 X;  3MXN A;  3A8I E;  3TP5 A;  5ELC A;  4PMB A;  3IAY A;  3HOU B;  1LTS D;  4OO1 H;  1ET9 A;  1SYD A;  1SYG A;  1SDF A;  4RGN A;  1JE4 A;  1CA5 A;  5LL6 X;  3ONA B;  1WTW A;  4RFB A;  2V4D A;  4FNF A;  1KAB A;  3J7Y W;  5M3F B;  1ML0 D;  1JB3 A;  4DA2 A;  4OO1 G;  2SDF A;  3FRP B;  5IOC A;  3PV0 A;  1DJR D;  3NQT A;  2IW3 A;  1K8M A;  5CV9 A;  1I4X A;  4OO1 I;  2BA0 A;  4XQJ A;  2EOT A;  2KVM A;  1EYC A;  4DAY A;  5KRU A;  3HG9 A;  3MEH A;  3EA6 A;  1V1P A;  2AQ3 B;  5JPM C;  1ZYR D;  4HR7 B;  1BO0 A;  4WRD A;  2C5C A;  3I73 A;  3VR3 A;  4FYD A;  5LL6 S;  1PFB A;  4H7B A;  2DY7 A;  3SEB A;  4X3K A;  1ESF A;  2R3Z A;  2CW0 D;  3IL8 A;  4TQU S;  4DNR B;  3GO5 A;  1A3U A;  3BZD B;  1R9T B;  3EQL C;  3CQZ B;  2RSO A;  2EJF C;  3T16 A;  4X3U A;  2RQX A;  3N6R A;  5C3X A;  5C6A A;  4ZK9 B;  3D31 A;  4M8A A;  1L0Y B;  4G7O C;  2EYM A;  2K32 A;  1FNW A;  4K8J A;  5IOD A;  5CMD A;  2JEA I;  1SNO A;  1V43 A;  5IGF A;  3HOY B;  4ZKC B;  1TWH B;  3CRK C;  2XNA C;  4NMZ A;  3OHX C;  3HZX A;  2HCC A;  2EYH A;  1QG7 A;  3OMG A;  3OOC A;  4DU9 A;  3F2U A;  2FFK B;  2B2T C;  1KDC A;  3QIA A;  3TZD A;  1RCV D;  4ZAI A;  4QUF A;  3DEO A;  4K8I A;  3NXW A;  5COR A;  4EQP A;  3MXU A;  3R2T A;  1IW7 C;  4BBS B;  2L1B A;  1AW7 A;  2NZ1 D;  5NUC A;  1Q1B A;  5EBD A;  1CM9 A;  3NPP A;  2QF7 A;  2WV6 D;  1G2S A;  1LV9 A;  5CBA E;  4ABN A;  1KDB A;  5C44 B;  4FF2 A;  4C3J G;  2D62 A;  3D4D A;  3WDN A;  2RA4 A;  2BE5 C;  4XIG S;  4KY7 A;  5EQ0 A;  1NR4 A;  2NB0 A;  1VF7 A;  2G9H D;  2M00 A;  3A55 A;  3K5M A;  4ZUJ A;  3KUP A;  1NUC A;  2F0Q A;  4FXK C;  1X3P A;  1PZI D;  4IFD H;  2BA1 A;  1U4P A;  4QB4 A;  1H9J A;  3H91 A;  1SYC A;  4XQN A;  3K58 A;  5EKL A;  3Q24 A;  1H9S B;  1SNM A;  4HSP A;  2ZT9 C;  3SXH A;  1LTA D;  1TII D;  4HCE A;  5D3D A;  4A3I B;  4EGV A;  2E76 C;  2KA7 A;  3GV6 A;  2CVR A;  1SYF A;  1F2M A;  5DEH A;  1FNV A;  2EXZ A;  1PTO F;  5G3L D;  3HGB A;  2LS0 1;  1D5M C;  4DFA A;  4IAL A;  1GUN A;  2H1E A;  5COY A;  4IFD I;  1GUT A;  2HDL A;  1JCK B;  1IYV A;  3S1M B;  4PMC A;  1HFN A;  2O2L D;  5E3F A;  2DN8 A;  3QG1 A;  4A3F B;  3AB9 A;  3K6O A;  4N9P A;  2KJX A;  4PMW A;  4J1M A;  4HTH A;  1PRT C;  2AQ2 B;  3VYR A;  1GXD C;  2XSC A;  1SNC A;  4MHE A;  2K7V A;  2D2C C;  3DUZ A;  1JQY D;  1D1I A;  3J7A F;  1I4H A;  2GA4 B;  1KDA A;  2QDB A;  2EPB A;  1QOH A;  3MXG A;  3SK5 A;  3DM1 A;  3D3R A;  3TME A;  4OL7 A;  5EKI A;  1SND A;  5IGG A;  2Z1C A;  1A2U A;  4ZLT F;  1DYQ A;  1Y8P B;  4WFN 3;  5JPN C;  4NW2 A;  4FF1 A;  3GP7 A;  3FDT A;  2A68 C;  4KKT A;  2WKD A;  4JBW A;  2TMP A;  2F0F A;  4BA1 I;  4ID6 A;  2ID0 A;  4EQO A;  5ELB A;  2E2H B;  3VR5 A;  4KHZ A;  1KNE A;  5D14 A;  5CBE E;  3J80 E;  1O7Z A;  3DHQ A;  2O4X A;  1F9Q A;  2X69 A;  3S1N B;  1DXM A;  2EYO A;  1V1O A;  2EE1 A;  1S5E D;  2EJG C;  3BDL A;  2E74 C;  1EU4 A;  3QOL A;  2WII B;  2PW7 A;  2DY8 A;  5C4J B;  4CJ0 B;  1TY2 A;  5EPK A;  2K1B A;  4XT1 B;  1STG A;  4KJO A;  1GUW A;  2SEB D;  3G6J B;  2JA7 B;  1JOQ A;  2PZU A;  3Q22 A;  3K5L A;  1XYI A;  1DON A;  4C2M B;  3FPU B;  2WKC A;  1B4O A;  1ILP A;  4RH6 A;  1LT4 D;  4EQN A;  4KN4 C;  4Z9C B;  3CKI B;  1LAC A;  4CHT B;  2EY6 A;  1B1Z A;  4XTC S;  1HXY D;  3V2T A;  3GTG B;  4OHJ A;  2K03 A;  2AQ1 B;  1OXT A;  1JWM D;  1WD1 A;  3IFD A;  3MA2 B;  3SVM A;  1ET6 A;  1TS3 A;  3QO2 A;  2EY2 A;  1UUP A;  4J6H A;  1TKW B;  3GTP B;  1U4L A;  3AMU A;  1EYD A;  4A3J B;  2F0W A;  3D6C A;  4RGO S;  2F0T A;  1TY0 A;  2EJM A;  5A2Q E;  1J8I A;  1BCP B;  5TSS A;  1LTT D;  1NSN S;  2Q8R E;  4HSV A;  3VR6 A;  5KNC A;  1A15 A;  1J9O A;  1O7Y A;  2BE5 D;  3OMC A;  5I9O A;  2B63 B;  4K5W A;  2KED A;  4N9T A;  3L7Z C;  3P75 A;  2EYF A;  3WOF A;  1BBX C;  1EQT A;  3FPP A;  3J80 L;  2G9D A;  4CJ2 C;  1Q12 A;  1L0X B;  1SEB D;  3H3V C;  4QMG A;  1U9R A;  2EY5 A;  3PMF A;  1EQV A;  1KLU D;  1Q1E A;  3L9A X;  3KLR A;  3ND9 A;  1K8O A;  4RKL A;  2Z4H A;  1DOL A;  4DAP A;  1AEX A;  4FXD A;  3NK9 A;  3U9O A;  5FLX E;  3R8B A;  1D2B A;  1PZJ D;  4BY7 B;  2ICI A;  4KKS A;  5I6Y A;  2ZXR A;  4KJN A;  4R8N A;  5K36 G;  1TWA B;  3GQB A;  3HRZ C;  1B9M A;  2PYK A;  3TZU A;  1Y8O B;  1T5E A;  1HHV A;  2XVS A;  1XXG A;  4LAA A;  5JAV A;  3HOZ B;  1JIC A;  2IPK D;  1WTR A;  2JXM B;  1LTG D;  4M1U B;  1ONL A;  4IUP A;  1RHP A;  2J4X A;  3NUC A;  4MIU A;  4L8J A;  1BDO A;  2NWG A;  3C1F A;  5M5X B;  1HA6 A;  1T5X D;  3NWS A;  3RZD B;  1PRT D;  2L11 A;  4Q5V A;  4H13 C;  3T13 A;  1QJO A;  4CKE A;  5G3L F;  1LO5 D;  5DAU A;  2F0I A;  1A3V A;  1QWY A;  2IX0 A;  2WIN B;  5M3M B;  1PLF A;  4G7Z C;  2BCO A;  2KEE A;  5KGU A;  2PZT A;  4G4K A;  1I50 B;  4CGY B;  2YU9 B;  5A2Q L;  2X6L A;  3GTQ B;  1F9R A;  2N88 A;  5IGB A;  4BS9 A;  1DZ1 A;  1AP0 A;  2B2W C;  3I4L A;  3GTM B;  2HQE A;  2MJ8 A;  1CQF A;  1RTN A;  1HQM C;  1VDZ A;  3I91 A;  1HA5 A;  2M9V A;  3TSS A;  3S14 B;  2A68 D;  1HQR D;  3E0J A;  2F0S A;  1BR9 A;  4F87 A;  5DNF A;  3HKZ B;  1NR2 A;  3GV3 A;  4IZ8 A;  1HCZ A;  4FXG C;  5C4Z A;  4FF4 A;  4IFD J;  1IYU A;  5JVH 3;  4KMU C;  2RKS A;  2B2Y C;  3M3Y B;  2K33 A;  3GD7 A;  1PFM A;  2B2Y A;  1SSO A;  2OT2 A;  5KIX A;  1EL0 A;  1O80 A;  2VB3 X;  5FLX L;  2B8G A;  4BBR B;  4YIJ A;  3MZ5 A;  3IFT A;  2F03 A;  3T56 B;  5DM7 3;  3O13 A;  1TVX A;  1Z7T A;  4DN4 M;  4UAI A;  2Y0S B;  4C3H B;  1CK1 A;  1K83 B;  1PDQ A;  2QEJ C;  1SFO B;  1BQQ T;  1OXS C;  2FMC A;  1EY6 A;  1KTK A;  2QKI C;  1CHQ D;  2HUG A;  3I8Z A;  2F0L A;  3BYT B;  2NN6 H;  2L5T A;  4C1N I;  2EYP A;  3S1Q B;  3MFG A;  2F0J A;  4KI0 A;  2WAQ B;  2BDO A;  3FVQ A;  1MGS A;  1STN A;  4DXF A;  1ROD A;  4IUR A;  2WB1 B;  4U67 3;  4R8I A;  2K28 A;  4KY5 A;  3QOJ A;  3H94 A;  3WOE A;  1LAB A;  2JE6 I;  3D4W A;  4RCO A;  2NN6 G;  2NVX B;  2WP8 J;  3KBX A;  2JEB I;  4DAV A;  1I4P A;  1A3T A;  3T4A C;  1A2T A;  5J39 A;  1WTO A;  2B2T A;  4FVM A;  2NN6 I;  1I4R A;  1V1P B;  1STY A;  1IHZ A;  4L6T B;  3PIO 3;  3PUZ A;  2XRQ D;  5C4X B;  2PNR C;  1GUS A;  5E4W C;  2B8F A;  2PO4 A;  1KLG D;  1OXV A;  2OF1 A;  2IX3 A;  1X32 A;  3A8K E;  1CI3 M;  1QNK A;  4LJZ C;  2EYJ A;  5EPL A;  3N52 A;  1ILQ A;  3T53 B;  1F77 A;  3EJI A;  5KYL A;  2BDN A;  1H9M A;  1MI2 A;  1OO9 B;  4S3S A;  4KD4 A;  4NDX A;  4XT3 B;  2K04 A;  4HCS A;  3UI2 A;  2J7Z A;  1PXU A;  3RD4 A;  2AUJ D;  3E5S A;  4Y7N B;  2NTT A;  3PUW A;  3GTK B;  2EVB A;  5JJZ A;  1ZKO A;  1JWS D;  1XWE A;  2SNS A;  3NP8 A;  3A8J E;  3ND8 A;  2KCC A;  1I3Q B;  3M85 A;  2SNM A;  1MSG A;  2A6H C;  2EY1 A;  4DK1 A;  1EZ6 A;  5DM6 3;  1JOR A;  3NQI A;  4F88 A;  4HMJ A;  2PCF B;  2VNU D;  2F3W A;  4IFD G;  1GOZ A;  1PFN A;  4K14 A;  1EWC A;  1DM0 B;  4B08 A;  1Q3L A;  5C3W A;  4H0L C;  3GTL B;  3I70 A;  3RZO B;  5CV6 A;  4IN3 A;  3DXJ C;  2BOS A;  1Z47 A;  1SXT A;  3CU7 A;  1I4Q A;  1SJE D;  3R3O A;  4A3K B;  5AFW A;  1WVL A;  1HUN A;  4PQX A;  3MTS A;  4A3G B;  2XWB B;  4ILW A;  2VUM B;  2K6A A;  2K05 A;  1TWF B;  1EEI D;  2KUM A;  4XYO A;  1DOM A;  1FGB D;  5FOB B;  1PTO B;  2NVQ B;  3HOW B;  3BVG A;  4C3H G;  1PRT F;  1SMY C;  1OXX K;  1TQO A;  1GJX A;  2PW5 A;  1EYA A;  1C4Q A;  4ME5 A;  4B9X A;  1IKM A;  1MBY A;  2L9H A;  1XTC D;  1ENC A;  5CGK A;  2Q8T A;  1HTP A;  5FO8 B;  4F7X A;  5M5Y B;  2F0P A;  2XN9 C;  5T1I A;  4R9W A;  5I4D A;  2E2J B;  1LTB D;  3S16 B;  1VF5 C;  2RSN A;  1LT3 D;  2F0E A;  2Z4I A;  3MFY A;  1KAA A;  3M7N A;  5BN3 A;  3PO2 B;  1RDP D;  1HTL D;  1S5C D;  1A6X A;  3PO3 B;  1HFG A;  4DF7 A;  4B9W A;  2RDF A;  4O1N A;  3NTH A;  5JOB A;  2R92 B;  2IJ0 A;  3MWY W;  3OWE B;  3KLS X;  3VYT A;  1U4R A;  4V0B A;  1QB5 D;  3D8G A;  4OGQ C;  2NUC A;  3GTO B;  3SHL A;  1BCP C;  1V8Q A;  2MGS A;  1X3Q A;  4O42 A;  2I46 A;  4HAE A;  1Z6H A;  5CV5 A;  4IUQ A;  2B39 A;  3I4N B;  4E6I A;  2JA8 B;  1M8A A;  3V96 A;  2LFN A;  4EVO A;  2QIL A;  1F2Z A;  3AU7 A;  3K7A B;  5BN4 A;  5CV4 A;  4ZUI A;  1DD2 A;  2EDG A;  1EIG A;  3KF8 A;  4TSS A;  5E4X A;  5C5L A;  1STE A;  1VCI A;  1D1K A;  4HED A;  1I6H B;  4ZRZ A;  3S1R B;  2F3V A;  1B50 A;  3EVQ A;  2L4N A;  3NE5 B;  3P7J A;  1IW7 D;  3NTI A;  1G6Z A;  4IUV A;  5IIF A;  2I07 B;  3URY A;  4V19 0;  2ENB A;  1S5F D;  1W6K A;  2B2V C;  5C5M A;  3RUZ A;  1TS5 A;  2F0U A;  2PQE A;  1EY7 A;  3HOV B;  3S17 B;  4ZQ3 A;  3K59 A;  4DK0 A;  1LT5 D;  3X3M A;  5KYI A;  2F0V A;  1TWG B;  3LNN A;  4KKU A;  5KNB A;  1FYC A;  3PUY A;  3EFX D;  2R61 A;  5I2Y A;  3NBI A;  1F9S A;  2B2U C;  1S5B D;  2TSS A;  1EZ8 A;  2L55 A;  1S5D D;  1SE4 A;  4C1N K;  5EPJ A;  1RJT A;  4CJ1 B;  1G91 A;  1ENA A;  3TP6 A;  2F0D A;  1NCV A;  2NYZ D;  4NKL A;  4K5X A;  5FO7 B;  1YNN C;  1E2Z A;  1CTM A;  1BXT A;  3DWA A;  1Y8N B;  1PTO H;  2A6H D;  3P20 A;  1I6V C;  4GZY C;  5IT9 E;  1HPC A;  3QWN A;  1TT2 A;  2FJ2 A;  1SAP A;  1EFI D;  1AFP A;  2CQA A;  3JAM E;  3R93 A;  4XXE A;  1Y1V B;  2DNC A;  4RWS C;  1BUV T;  3TP7 A;  1LTR D;  2A69 C;  3VYS A;  4KV6 A;  5JVG 3;  4IQZ A;  4WOR A;  2NTS A;  3TBI B;  3HS0 C;  3ITP A;  3W3A A;  2AWN A;  2JSO A;  4F8M A;  4HN7 A;  1EU3 A;  2F0M A;  5M5W B;  1VMC A;  3MHB A;  1QE6 A;  3HOX B;  5J1Z A;  2Q8I B;  4XDX A;  2A6E C;  2L0C A;  4FP5 D;  2E2D C;  1QNU A;  3KLS A;  2FMM A;  1ICW A;  3S15 B;  3G7L A;  3CHB D;  3K0Y A;  1SJH D;  3ZYY X;  1KNA A;  2CHB D;  5M9O A;  1SMY D;  4BA2 I;  3NTK A;  4PNY A;  3PUX A;  2F0K A;  2B2W A;  2N55 A;  4I7Z C;  1E2W A;  1Q8I A;  3A7A B;  3NSW A;  3S9W A;  3R2I A;  3SR1 A;  4JK1 C;  2OEO A;  4I65 A;  2KOL A;  3OIQ A;  1C48 A;  1E2V A;  1ENF A;  1Y1W B;  3OWF A;  1UNS A;  4OIK A;  1CFM A;  1QIL A;  5CV7 A;  3M4Y A;  4ULL A;  1R4P B;  4QF4 A;  1STB A;  5IT9 L;  3S2D B;  1O7L A;  5CV8 A;  2O5I C;  4DGZ A;  3JAM L;  2LY7 A;  1EY5 A;  1BCP D;  5C0X H;  4KHV A;  2J0T D;  2ZXO A;  1CQV A;  3QJY A;  1WTP A;  5EBC A;  1E0B A;  2KQ3 A;  4RGM A;  1BF4 A;  1WD0 A;  2D9U A;  1PMR A;  5ELE A;  5IGE A;  2Z8L A;  4C3I B;  1QCB D;  3NBH A;  2PMZ B;  3DEP A;  2JA6 B;  4HMI A;  5I6W A;  3LX0 A;  3VA5 A;  3MVV A;  2E75 C;  5C0X G;  1AN8 A;  1STH A;  1EWH A;  3BS1 A;  2MHV A;  3MXP A;  3L3O C;  5ELF A;  5C0X I;  3LWU A;  1EY9 A;  1CZW A;  3PUV A;  2A74 C;  1LLR D;  5HUR A;  4KK7 A;  2F4I A;  3Q0A A;  1JOO A;  3K5N A;  1JWU D;  1LTI D;  1D6E C;  2F1M A;  1TS4 A;  1Q90 A;  1H9S A;  3BYY B;  5FK9 C;  4BY1 B;  1TR5 A;  3HEJ A;  2KHS A;  1S4Z A;  3P1H A;  4U68 A;  2L12 A;  2M2L A;  4RAU C;  2JA5 B;  1HRJ A;  5KEE A;  2XIW A;  3D6W A;  2EYL A;  4RHR A;  5BN5 A;  3A7L A;  2OXP A;  1PYW D;  2FHT A;  2PZW A;  1O78 A;  1AZP A;  1IL8 A;  1M4V A;  3TN2 A;  1EOT A;  4RA8 A;  3VYU A;  3E6Z X;  1YNN D;  2R6G A;  1DCZ A;  2SOB A;  3VR4 A;  1MD2 D;  2F0N A;  1F2L A;  4ODG A;  2RDG A;  3U9S A;  1CT1 D;  5J22 A;  1H9R A;  1SE3 A;  1CZG A;  3X3N A;  1CA6 A;  1D5Z C;  3BDO A;  1B2T A;  3M7G A;  4X3S A;  1FD7 D;  1OXU A;  1PTO C;  4H44 C;  3TP8 A;  5A35 A;  1JR0 D;  1F2Y A;  2LKV A;  4A93 B;  4IUU A;  1G29 1;  2A69 D;  3Q6S A;  4LMQ D;  3C2P A;  5K5P A;  1EY0 A;  3SK4 A;  3VR2 A;  5CR3 A;  1YNJ C;  1GUG A;  5C4H A;  2MUY A;  5ISR A;  2IT1 A;  3M4O B;  2MPM A;  1SYB A;  3DMU A;  3RMH A;  2IL8 A;  2H4O A;  1Y69 U;  1LT6 D;  5I2X A;  3J7A V;  1UAP A;  2RBM A;  1TS2 A;  1XX8 A;  2IX1 A;  1SNQ A;  5FO9 B;  2A6E D;  3C46 A;  1B9N A;  4FO2 A;  1U4M A;  1TWC B;  2A5H A;  1RF2 D;  1BNZ A;  3BVZ A;  2F0G A;  1C8C A;  4A3B B;  2D5D A;  3OSO A;  1JOK A;  2AWO A;  2EZV A;  4IUN A;  3DWQ A;  4QUC A;  1GHK A;  2VXW A;  1WTX A;  4X3T A;  4RHS A;  1AZQ A;  2WAC A;  3CRL C;  1ZEQ X;  3C3L A;  4LK1 C;  2AUK A;  5CYU A;  5KND A;  1G8Z D;  3SDZ A;  4Q0F A;  2E2I B;  3KBG A;  5EGT A;  4XQQ A;  2NVY B;  2PPB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...