4B3TQ

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3tQ00
2UXDQ 2R93H 4A3IG 5JJIA 4PMWA 4P71A 2A19A 2JJQA 2F52A 3JC66 2ALYB 2JEBI 1FL0A 1K8AC 2F4VL 1KXLA 2B3GA 4A3MG 3PIOA 2R6GA 1OXVA 4LFAL 4IPHA 1VQBA 2OQKA 2VQFL 1YHQA 3KF6A 3J81j 3HOZH 2KBNA 2MNAA 1D8LA 1G291 1QUQB 4DV4Q 1M1KC 3OW2A 4HJ9A 1SFOH 4WJ4A 3W1BA 1K8GA 1B70B 4C3IH 1WOCA 4C3JH 3I4MH 4MTNA 2HHHQ 4GOPB 1J5EL 4L5RC 1OXSC 3NBHB 1CKNB 4DR1L 1PH9A 2CKZB 2KCMA 4JBJA 1KRTA 2K50A 4JI1Q 4JI3Q 1CSQA 3GDEA 1LYLA 1R9TH 3S24A 2IX0A 3T1YQ 1W2BA 3DM3A 2I5MX 5IYBH 1VQKA 1XNRQ 1VQPA 5M3MH 4YWKA 3RLNA 4LF6L 3STBC 1JMCA 2V1CC 1CSPA 3PF5A 1YHBA 5JJLA 4WJ3M 1X65A 2UUAL 4L5TA 4L5SA 3TS2A 4LW1A 1MJEA 3PUZA 1E1TA 3W1GA 4KHPL 5M3MG 4IFDG 1NTGA 1IBML 4X6AH 1N34Q 4A3DG 3CC2A 5GQOA 1IXRA 1VQGA 4LF7L 4OWWB 2N49A 1VQ5A 4LWCA 3NELA 4UP8A 1PH1A 4AYBE 2UXBQ 1S3OA 1YJ9A 4B3TL 1E7ZA 4O0AA 3U50C 4LF8L 1U0LA 3CD6A 2GVBA 4LFCL 1E24A 1BBUA 4DV3L 4NXNQ 4YCWA 3I4NH 4R1JA 1H95A 1Q1BA 2K5NA 3DLLA 2BH2A 2K75A 3M4QA 5E7NA 4X64L 4X65L 5GADC 1KC8C 4BBSG 1C7YA 4DR7Q 4IFDI 2NN6G 1I6HH 2UXDL 3PGZA 1TXYA 3HOUH 1XNQL 4A3FH 2ZJPA 3UDGA 1X55A 3HOYH 4A4IA 5DLQE 3H0GG 1Q46A 3E0EA 2UXCQ 1FJGQ 4JI7Q 2PQAB 3M85A 1QUQA 3HOUG 3B6YA 1V9PA 5C4XH 5M5WH 4A3FG 2JE6I 1KD1C 2RF4A 5HY6A 4JI5Q 2VY3A 4IOCA 3GTOH 3GTLH 3HOYG 4Y7NH 4DV4L 1YBYA 3HOWH 1DGSA 3S16H 5IYDH 4BA2I 1EWIA 4BY7H 4GOPA 4IJHA 4P72A 1EQRA 1HZBA 2DUDA 2IHFA 2YTVA 2LXKA 3AFQA 1CKNA 3J80i 3CAMA 2VQEQ 2HHHL 2LXJA 5C4XG 4O2DA 2JA6G 3HOWG 1YJNA 2ZM6Q 1K9MC 4JI3L 1VQHA 4BY7G 4YY3L 1HZAA 3CQZH 4MNOA 3T1YL 1B7YB 1TWGH 4DAMA 1XNRL 2K5HA 4GLAC 1PH3A 2A1AA 3HOXH 2A8VA 1C9OA 5C3EH 1VQ9A 4KI0A 1MKHA 3VDYA 4YWLA 2NVYH 4EX5A 1N36Q 1Z9FA 1YZ6A 3CCVA 1VQ6A 4A3CH 4A3GH 1VQDA 2CCZA 2HIVA 3F2DA 1TWHH 1GKHA 3I4OA 1KRSA 4DV2Q 1EIFA 4GNXC 2IX1A 1AE3A 1A63A 1LUZA 4KHZA 4XIGS 3J81i 2N8NA 2BA1A 1P8LA 5GAHC 1PV4A 3KFUA 1UE7A 3CC7A 1JT8A 2JA7H 1FVIA 4X62Q 4BA1I 1BVSA 3FHWA 4A3JH 3KJPA 5LMNW 1PH2A 4NXNL 3RN5A 2Q2TA 3U4VA 3TS0A 1XJVA 4K0KL 3FKIH 1WCMH 4DNIA 2JA7G 3GD7A 2VS1A 1J6QA 3A74A 3AYHB 4MZ9A 5JJKA 1JJ2A 2OCEA 4JV5Q 5IY0A 3KLWA 2PMZE 1CKOA 1EQQA 1PH7A 1VQCA 2H5XA 3G48A 1IZ6A 5C0XG 2NVQH 4BY1G 3CCEA 1SMXA 4B3SQ 3CMAA 4DR6L 1XTDA 3PUWA 4B3RQ 5GAGC 4AQYL 1OXXK 4QJFA 4DR4Q 2PQAA 1KQSA 1Q1EA 3CW2C 2RCNA 2AHOB 4JOIC 4A3MH 1PA6A 4JBMA 3GTPH 4AYBG 3W5OA 1X56A 4JI7L 5HGQA 3F1ZA 1GO3E 5C0XJ 3KJOA 1XMOL 4JI5L 5K36G 2YV5A 4GKJQ 2AWNA 2WB1E 5LMNQ 2K14A 4DV6L 1EOVA 3M4PA 2R7DA 3RLOA 3CF5A 1QVFA 2UUCL 4OO1I 2VQEL 1SR3A 2AMCB 2JK8A 1E1OA 4IJLA 3A5UA 1S40A 3M9BA 4LFBL 1KL9A 2PI2E 2D0OA 1IBLQ 3HKZE 3K7AH 2KENA 4QQBX 4A93G 3ZJYC 4DV5Q 4QL5A 2UU9L 2ZTCA 1Y1VG 1Q81C 3ULLA 1LTLA 1HNZQ 4DAYB 1SLJA 2BA0A 4QIWE 3OTOL 2UUBL 4JYAQ 4Y52H 3GO5A 3I7FA 3F2CA 2CQOA 4GN3B 4JI2L 1L2FA 3AEVA 4DV1Q 1HZCA 5JEAJ 5H1SE 4A3DH 1Q7YC 4DV2L 4DR5Q 2AKWB 3G6EA 1X9NA 1VQEA 1XPOA 4H02A 5BR8Q 4DUYQ 3CCUA 2OTLA 2ZJQA 1N33L 1RL2A 4DV7L 4X62L 1Y1WG 3M3YH 5C4JH 3MXNB 4JBKA 2OTJA 4NXMQ 3PO2G 1JJCB 3PUYA 1KIXA 3J7A5 1VQ4A 4DR3Q 4JCVE 4JV5L 5M5YH 1FGUA 4HIDA 5EAYA 1VS0A 1PVOA 1UE6A 2I5LX 2D62A 4B3RL 1VQIA 2VL6A 3TQYA 3BZCA 4YCVA 1UWVA 3GTGH 3H0GH 4HJAA 1YIJA 2NVTH 1E3PA 2QEXA 1G6PA 1TWAH 4A75A 4POFA 4GKJL 4ME3A 3G4SA 5LMNL 1K83H 5GROA 2WFWA 4OWTB 4LF9Q 2MO1A 2D0PA 3TREA 4YHHQ 2KHIA 3I56A 3T1HQ 3GTQH 4LUZA 1AH9A 1VQOA 1C0AA 3PUVA 4KLKA 5ELNA 4GLXA 1HNXQ 1A62A 1YVCA 3LGJA 1IBLL 3D0FA 3EN2A 2JA6H 5C44H 4R4IA 2Q2UA 1W3SA 3HFZB 4GLVB 4JI4Q 2E2HH 1VQFA 1HNZL 4JI6Q 1PH8A 2R92G 4IPCA 3EIVA 4JI0Q 2Y0SE 4JI8Q 1Q86C 1D7QA 2NN6I 5AJ3Q 5C44G 4JI1L 1V1QA 2E8GA 4PZ8A 4IO9A 4AIMA 4LUOA 4JYAL 4IPDA 4HJ7A 4JBWA 4FDBA 3CCJA 1K73C 2WB1G 4OX9Q 4PZ7A 4LF5Q 3ICEA 1JJGA 2B29A 1X3GA 1MJCA 5FLXc 4DR5L 4UP7A 4A3KH 4P74A 2QGQA 1VQJA 4HIOA 4A3BG 2Z6KA 4PZ6A 5M5XH 5BR8L 3CCQA 4DUYL 4HJ5A 4A3LG 4LFAQ 3TRZA 1CKMA 3HKZG 1N34L 3F2BA 5IT9c 5FLMH 3CMEA 4DV0Q 4A3KG 2VQFQ 1Q8KA 5M3FH 2IT1A 2RHSB 1BKBA 1SRUA 5IYCG 1O7IA 2UXBL 2ZTDA 2JA5H 4HJ8A 2WAQE 3ULJA 4GOPC 5IE8A 5FLMG 4DR3L 3J7ZC 1QVGA 3CCMA 3MEFA 5IP9G 2MQHA 5M3FG 4DPGA 2Q2IA 1PYSB 2K5VA 2L15A 1UEBA 1AE2A 4DR1Q 2JA5G 2EQSA 3RR5A 4BY1H 1EFWA 3JAMc 2Z0SA 4DR7L 2HIXA 2KHJA 4RMFA 1NBWA 4QY7A 4LF6Q 1HZ9A 4R4QA 1YNXA 3S14H 3GTMH 4BXXG 1IL2A 3L7ZC 1XPUA 3H3VH 4UPAA 2JEAI 5IWAQ 1OXUA 3AQQA 1XMQQ 1ASZA 2UUAQ 3K8AA 2ZJRA 4LF9L 3ERSX 2YTXA 3T1HL 1B8AA 1FJGL 1IBMQ 2AWOA 3PV0A 2PNHA 1QVCA 2UXCL 4LF7Q 4AH6A 1PYBA 1HNXL 1ASYA 1IBKQ 3IRBA 1PH5A 1Z47A 1X3FA 4B3TQ 3RLFA 1PH4A 4LF8Q 3UDXA 3PO3G 4A93H 2MO0A 4TQUS 1SN8A 1Y1VH 5ELOA 3AFPA 4LFCQ 2B63G 5IP7G 5AJ3L 4UP9A 3I2ZA 3NEMA 2ZM6L 2HT1A 3E9IA 3S2HH 5C0XI 2EIFA 3M4OH 3PCOB 3ER0A 2EXDA 2VUMG 4X64Q 4X65Q 2R7FA 3KF8B 4OX9L 4YWMA 4A3EH 1NY4A 4LF5L 1N9WA 1I3QH 5JEAG 2E5LQ 2DGYA 3H3VI 1A0IA 3BU2A 1XNQQ 1N32Q 4GKKQ 1TWFH 2OQ0A 3G71A 3ULPA 1N36L 2YTYA 1EYGA 1HR0W 3S1NH 1HNWQ 4A3EG 3KOJA 1EUJA 2K52A 1OTCA 2R93G 4DV0L 3FP9A 1Y1WH 2N3SA 4DK6C 2OWOA 3S1MH 1HH2P 4GNXB 2Y0SG 3L0OA 3PO2H 1HJPA 1L0WA 2FXQA 3L2PA 3PUXA 1VQMA 4OXPA 3KYHC 3J81c 4C3HH 2GVAA 2NZOA 1YI2A 3HOZG 5GAEC 1A8VA 3WWVA 3A0JA 4YY3Q 1PFSA 5LMUQ 1YJWA 3I4MG 1I94Q 2YU9H 1HR0Q 1SE8A 1VCIA 1YEZA 4B3MQ 2NVXH 1JB7A 1VQ7A 1QZHA 4APVA 3K7UC 1EIYB 1L1OB 1VQLA 5IWAL 3Q8DA 1UE1A 1XMQL 4B3SL 4LNQA 2JQOA 4EQ5A 4DR4L 2C35B 3TEHB 5IYBG 1NMGA 1OXTA 1JE5A 4LF4Q 2IY5B 3BJUA 1BBWA 2WAQG 1X3EA 3UE1A 1IBKL 2ES2A 1TWCH 4GN5A 2XGTA 4IOAA 3EBEA 4IFDJ 4IPGA 4ALPA 1E22A 1CUKA 3JAMi 2R92H 1KHIA 1VQNA 3RZDH 2E2IH 2JA9A 4RG1A 4R4TA 3RNUA 4K0KQ 4DV5L 3KDFB 4DUZQ 3NENA 3S15H 1X6OA 1NE3A 1PH6A 2F3IA 3GTKH 3CC4A 3CPFA 3K80C 3PIPA 3I4NG 3S17H 1S72A 2E5LL 3HOVH 4JC0A 2GN5A 3CPWA 4UY8C 1N32L 4P73A 1KAWA 4DR6Q 4GKKL 2I5HA 4J15A 4AQYQ 2YYZA 4X66Q 1HNWL 4A3BH 1RIPA 4DR2Q 4A3LH 1WI5A 3HOVG 4OONA 4DV1L 2ASBA 3H15A 1XMOQ 4GNXA 1GM5A 4R4OA 1T9HA 4P75A 2F4VQ 4XTCS 1LM0A 4NB3A 5IYCH 4DV6Q 2QA4A 2UUCQ 2HQLA 1QZGA 1GD7A 3F8TA 1MIUA 1WFQA 4QGUA 1Y14B 3K81C 3U58A 2K4KA 5IP9H 4LFBQ 5IYDG 2LSSA 4NXML 2NZHA 5LMUL 1V43A 3KF6B 3CCLA 2JA8H 1I94L 1NJIC 2WP8J 1I50H 3UDIA 3E9HA 1HR0L 2UU9Q 4A76A 3RZOH 1NMFA 3K0XA 1UE5A 4DK3C 1J5EQ 4B3ML 1L1OA 2PI2A 2ATWA 1P16A 3UDFA 2CWAA 3UE0A 3OTOQ 2UUBQ 4BXXH 2JA8G 2KCTA 3U4ZA 2N78A 1GVPA 2BH8A 1Q82C 4JOIA 4JI2Q 4OWXB 1G51A 4LF4L 1N8RC 3HOXG 2RHQB 4GN4B 2MFIA 2ID0A 3A5ZB 4NPSA 1Q12A 2CFMA 5C3EG 3S2DH 1IYJB 3PF4A 1PHJA 4A3CG 4PG3A 1VQAA 5J3BA 1X54A 3STBD 3GTJH 1YITA 2IHEA 3PSIA 3M7NA 4A3GG 2Z6KC 1N33Q 4KHPQ 1I5FA 4GS3A 4YHHL 1U5KA 1K3RA 4DV7Q 1SROA 1M90C 4JG2A 4BBRH 3PO3H 3HKSA 3S1QH 4BBSH 3D31A 3SGIA 5FJ8H 3KDFA 4TVAB 4YCUA 1K0RA 5IP7H 2B63H 3CCSA 2R7ZH 3I55A 2VNUD 3CP0A 4HIMA 4R4CA 4JI4L 4DUZL 2VZAA 1WJJA 3BZKA 4BBRG 4OO1G 4DKAC 3CCRA 2CWPA 3CXCA 4LUVA 1VQ8A 4A3JG 2VW9A 4JI6L 4POGA 4JI0L 2VUMH 3OYYA 5FJ8G 4JI8L 2R7ZG 4C2MH 3S1RH 1L1OC 4DV3Q 2I0QA 4L5QA 3J80c 3RN2A 2ZTEA 3FKIG 1WCMG 4HIKA 4A3IH 1XPRA 2E2JH 4X66L 1WYDA 1YHAA 2Q2HA 4DR2L 2XTIA
chains in the Genus database with same CATH superfamily
1BXTA 5EBDA 2RVLA 2R93H 4A3IG 1K8AC 3VR6A 1B1ZA 2JEBI 1FL0A 2B3GA 4NMZA 4R9WA 1Z7TA 1TVXA 1SNOA 2IWHA 2OQKA 2R61A 2KOLA 3HOZH 3I73A 2MNAA 2MUYA 5IGEA 2E2IB 4WJ4A 5FKAC 3W1BA 1D1KA 1B70B 1EY8A 1STNA 2F0GA 1J5EL 1OXSC 2CKZB 2KCMA 1FNVA 2WB1B 2EXZA 3GDEA 4K14A 1LYLA 4G7HC 3S24A 2IX0A 4C3IG 1NNXA 1RCVD 2LFNA 5IYBH 1VQKA 1LO5D 4LF6L 1J8IA 3K58A 1SMYC 5JJLA 1X65A 2UUAL 5CBEE 1YNJC 1MJEA 2F0WA 1E1TA 3PUZA 4RCNA 3W1GA 2B8FA 5M3MG 4KHPL 3S16B 5GQOA 1LABA 2F0JA 2N49A 4LWCA 4JK1C 3T51B 2B2VA 4AYBE 4IALA 1W6JA 1S3OA 4O0AA 3U50C 1U0LA 3NBIA 2K03A 4F7XA 4LFCL 1A3TA 4DV3L 1JORA 1Q1BA 2BH2A 2K75A 1EOTA 4DR7Q 4IFDI 1ESRA 2RDFA 1ENCA 4RGOS 2NTSA 1X55A 3HOYH 2UXCQ 1FJGQ 1ONLA 4JI7Q 4B9XA 3B6YA 5ELEA 4PNYA 1C48A 5D3IB 2B2WC 4KHVA 2NYZD 2YTVA 2LXKA 4O42A 4S3SA 2HHHL 2D5DA 4KJOA 2VUMB 3C3LA 1BOSA 1SNDA 3T1YL 3T56B 4A3IB 1FNWA 2P5ZX 1PLFA 2A1AA 2QCPX 2F0SA 2G9DA 1PTOH 1RD9D 1MKHA 1UEAB 4YWLA 4EX5A 4A3GH 1YZ6A 3CCVA 1EY4A 1F9SA 2CCZA 3F2DA 3J7AF 1DJRD 1TWHH 3DWQA 2IX1A 1CZWA 2DY7A 3BVGA 4KHZA 2KCCA 3QO2A 3T16A 3T53B 1LTTD 2F0PA 2BA1A 2F0TA 5GAHC 1JT8A 4OHJA 1E2ZA 3LWEA 3PMFA 4BA1I 1BVSA 5FK9C 3KJPA 2K01A 4C3IB 1PH2A 5EGTA 4IURA 2F0OA 4XQNA 4DXGA 3GD7A 5CMDA 5E4WC 1BCPB 5M9OA 4TKOB 5IY0A 3DMUA 1EQQA 2H5XA 1ZYRD 5BN5A 4RCOA 5C0XG 5CYUA 4BY1G 3CCEA 5M3MB 1SMXA 1T5XD 3CMAA 1XTDA 1G2TA 1OXXK 3NHHA 4L8JA 1XMOL 4JI5L 5K36G 2SEBD 1EQVA 4OIJA 4RGNA 5C4JB 3RLOA 1QVFA 1SR3A 3IL8A 4ZKCB 2JK8A 4IJLA 4LFBL 1KL9A 1IBLQ 4KD4A 1PZID 4QQBX 4A93G 4QL5A 3NQIA 2EYPA 2CW0C 1JOOA 4HEDA 4DAVA 4Y52H 1HRJA 1V1PB 5NUCA 5IT9L 1SYBA 4IFDH 2L0CA 5D14A 5JEAJ 5H1SE 4K5VA 4A3DH 5CBAE 1Q7YC 1SNMA 4DV2L 4DR5Q 2QEJC 4HN7A 1EEID 1TS3A 2F0NA 3OPOA 4DUYQ 2OTLA 1D2BA 4XYOA 1B44D 1Y1WG 4HAEA 3M3YH 2X6GA 3MXNB 5FO9B 3A54A 4JBKA 2XNAC 3CQZB 1G2SA 4JV5L 4HSVA 4DU9A 4HIDA 2A68D 3Q6SA 1VS0A 2D62A 3OWEB 1IKLA 5C3EB 4YCVA 2A69D 1UWVA 3GTGH 3H0GH 4HJAA 5IIFA 3TP6A 1AN8A 1TS4A 1K83H 5GROA 2WFWA 4OWTB 1AZQA 5KYIA 4LF9Q 4RFBA 2KHIA 3C1EA 4IUPA 1MI2A 3T1HQ 1C0AA 1I4PA 5JJZA 1A62A 3IFTA 2HD3A 2Q2UA 1TY2A 4JI4Q 4XQJA 3VR5A 2F0UA 1HNZL 4JI6Q 4LAAA 2Z4IA 5AJ3Q 1EY7A 1V1PA 2EPBA 1H9KA 1V1QA 2E8GA 4PZ8A 3NK9A 1B9MA 1Z6HA 3GTMB 4OX9Q 3OHXC 4PZ7A 1R4PB 2D2CC 3ICEA 1MJCA 3D6WA 1VQJA 2Z6KA 4PZ6A 5M5XH 1I4RA 1CKMA 3HKZG 3MXNA 4ZQ3A 1PFBA 5FLMH 2B8GA 4A93B 3D8GA 1B4OA 2B2YA 2IT1A 3BG3A 1DONA 5IYCG 1FGBD 3ULJA 4HCEA 3K7AB 3J7ZC 3MEFA 2MQHA 2Q2IA 4DR1Q 2JA5G 2EQSA 3RR5A 1DM0B 1ZKOA 3JAMc 4K8IA 2Z0SA 1O80A 1DXMA 1LLRD 1A3UA 4DR7L 1SYCA 3S1NB 4HR7B 1NBWA 3DWAA 4R4QA 1SYEA 3L7ZC 4XYQA 4UPAA 2JEAI 1OXUA 1XMQQ 2CH4W 1PRTD 1Y1WB 2K5DA 5EKKA 2KHSA 5A2QL 2ZJRA 2YTXA 2UXCL 1FJGL 2PNHA 4LF7Q 2A5HA 1HNXL 1IBKQ 3IRBA 1VMCA 5FOBB 1WTXA 3RLFA 1PH4A 5LL6X 3PO3G 2XSCA 1SN8A 3SK8A 5J22A 3KLSA 2B63G 5IP7G 3I2ZA 2HT1A 2PPBC 4X3UA 5C0XI 1L0XB 1U4MA 2WACA 5CV9A 2A6EC 1PTOF 4UHVA 3ITPA 2R7FA 1LTBD 4YWMA 1BCPD 3J80E 1IKMA 1WTWA 1A0IA 1EIHA 1XNQQ 1K0SA 4ILWA 5C3WA 3G71A 2K33A 3VR4A 2PCFB 1R4QB 1STAA 5EBCA 2R93G 4IZ8A 4DV0L 3FP9A 2L55A 2RDGA 1MSHA 3L0OA 1L0WA 1F2MA 4OXPA 1YI2A 3HOZG 3K5OA 3A0JA 5FO8B 1SDFA 1HR0Q 1VCIA 1YEZA 4B3MQ 4QB4A 4KN7C 3Q8DA 1UE1A 3PIO3 2C35B 5IYBG 2PZWA 4ZYSA 1BBWA 3I3CA 1ILQA 1TWCH 4QIWB 1FYCA 4IOAA 3EBEA 4ALPA 2JA5B 3A7AB 1X3PA 2R92H 1VQNA 1I50B 5J39A 3RNUA 1E2VA 4K0KQ 3BS1A 5CV6A 4IUUA 3DUZA 2F3IA 3BDCA 2KJXA 1S4ZA 2Q8IB 3S17H 2PZUA 2E5LL 2R3ZA 2AUKA 4P73A 1KAWA 4DR6Q 4GKKL 1BF4A 1HNWL 1QNKA 4A3LH 3HOVG 2H1EA 1HA5A 2HDMA 1HPCA 3H15A 3UI2A 1HUMA 1T9HA 5DM63 4XTCS 4DV6Q 4PQXA 2UUCQ 1CFMA 1EYDA 2F0IA 2HQLA 1QZGA 1SBBB 4ZKBB 4QGUA 1QE6A 4HCSA 5IP9H 1F2LA 1Y1VB 2F3WA 3QJYA 2NZHA 5LMUL 1SYDA 1V1OA 3CCLA 2JA8H 2B2TA 1NJIC 4ABNA 3UDIA 5K5PA 4DK3C 1J5EQ 2PI2A 2UUBQ 4BXXH 2ICIA 2KCTA 2CW0D 1XXGA 2R93B 4JOIA 2NBFA 4U673 1CK1A 4RGMA 3BDLA 2MFIA 3D4DA 4H0LC 3S2DH 3SK6A 2DNCA 1PHJA 4A3GG 3STBD 3GTJH 2JN4A 3GQBA 3QG1A 1A3VA 1HA6A 4KHPQ 1I5FA 4GS3A 1U5KA 3S1QH 1SROA 4BBRH 3HKSA 2EY5A 3D31A 3WOEA 4YCUA 1K0RA 1I6VC 3CCSA 4JI4L 1WJJA 1WTHA 4DKAC 2JYOA 3CCRA 3O13A 1EYAA 3CXCA 4JI6L 4BBSG 2R7ZG 3OYYA 2YU9B 4DV3Q 2I0QA 3DEPA 3RN2A 2ZTEA 3NP8A 3CU7A 1YHAA 2Q2HA 2XRQD 1RKNA 4P71A 2A19A 1RF2D 2JJQA 4NDXA 1MD2D 3PIOA 5KIXA 4IPHA 1HTLD 3J81j 1F77A 1HFNA 3OW2A 1SFOH 1NAPA 3P75A 1NUCA 1WOCA 4C3JH 3I4MH 4MTNA 2HHHQ 4GOPB 4L5RC 5CR3A 3VA7A 4DR1L 1PH9A 4KKUA 2K50A 3HOVB 3T1YQ 4OL7A 4P2CB 1SYGA 2SDFA 1SNQA 3PF5A 1YHBA 4L5SA 4L5TA 3VYRA 4LW1A 2AQ3B 3MC0B 4IFDG 1O7ZA 1JWUD 4X6AH 2RKSA 4A3DG 3CC2A 5KRUA 1IXRA 4LF7L 3KBXA 2AQ2B 4J6HA 1PZKD 3NELA 4FF3A 4CKEA 2UXBQ 2C9OA 2F0HA 3VYSA 1E24A 1RDPD 4O1NA 5LHY1 3RZOB 1DZ1A 4R1JA 4CBVA 4XT1B 3DLLA 3TMEA 5E7NA 1KC8C 1C7YA 1S5BD 4A3GB 3E3XA 3PGZA 1XNQL 4A3FH 3U9OA 1TWHB 4IN3A 3H0GG 1TS5A 5I6YA 2PQAB 3HOUG 5C4XH 1B9NA 4JI5Q 2RF4A 3M4OH 4J1MA 1B53A 4Y7NH 4DV4L 3HOWH 4FXGC 4BBSB 2B2VC 3HS0C 1EWIA 4BY7H 2R7ZB 4Z9CB 4GOPA 1EQRA 3J80i 3OMGA 2LXJA 4O2DA 5L37A 1YJNA 2ZM6Q 1F2ZA 4FYDA 4C2MB 1U4LA 4G4KA 3NQTA 4TRDA 4DK0A 2K5HA 4GLAC 3S9WA 3HOXH 2A8VA 1J9OA 5EJWA 4KI0A 5EKIA 4A3CH 2G5DA 2JXMB 5FLXE 3HP3A 2HIVA 3I4OA 4DV2Q 3AU7A 2RCFA 4CDEC 3R3OA 2N8NA 3DEOA 1PV4A 3KFUA 1FVIA 4XQQA 2LY7A 5HURA 4OO1H 2EZVA 4A3JH 5LMNW 4NXNL 3CRKC 3W3AA 1UNSA 4DK1A 4K0KL 1WCMH 4DNIA 1V8QA 2JA7G 2L5TA 1TY0A 3QOJA 1J6QA 4KY7A 3AYHB 1HUNA 1LTRD 5JJKA 4JV5Q 1BDOA 2PMZE 1CKOA 1VQCA 2NVQH 4JVZA 5I2YA 3QIAA 4B3SQ 4DR6L 1NSNS 5E3FA 2Z9HA 2PQAA 4DR4Q 2RCNA 2AHOB 4JBMA 3GTPH 2K04A 4AYBG 2F0KA 5HGQA 1GO3E 2WB1E 1EY0A 1AEXA 4DV6L 3J7YW 1CHQD 2R7DA 4E6IA 2UUCL 3TP7A 1ZEQX 5JOBA 2AMCB 1E1OA 1JOQA 1RTOA 2D0OA 2D9UA 3LNNA 5T1IA 1VDZA 1TQOA 1D5XC 4LK1C 3ZJYC 2OXPA 1B3AA 2ZTCA 1HNZQ 1CM9A 1O7LA 1PFNA 3BYYB 4DAYB 4FF4A 2BA0A 2UUBL 1I6HB 1PXUA 1F9RA 3ND8A 4DF7A 3F2CA 3HOUB 3HZXA 3I91A 1L2FA 4DV1Q 1WTOA 2AKWB 3BVZA 5M5WB 1X9NA 3N52A 1XPOA 3A7LA 3GTOB 3GTLB 5EPKA 1IW7D 2XRSD 4X62L 3V2TA 4KK7A 2NUCA 1SE4A 2OTJA 3JAML 1CI3M 1X3QA 2EY1A 2IX3A 4OELB 3GV6A 4JCVE 1B2TA 1TWGB 1FGUA 3OMCA 1VF7A 1SAPA 2I5LX 1VQIA 1YNNC 4B3RL 5E4XA 5M5XB 1G6PA 4A75A 3G4SA 5LMNL 1WTQA 3SXHA 4DNTB 3W2DA 1U4RA 1AH9A 1K8MA 4KLKA 1STHA 1HNXQ 2JA7B 1YVCA 2A73B 4RHSA 2JA6H 4I7AA 1ML0D 1EIGA 5JPMC 5KGUA 3HFZB 4N9TA 2O5IC 4DAYA 1VQFA 3RD4A 2R92G 5F2DA 3K5NA 2Y0SE 4JI8Q 1Q86C 4X3TA 5C44G 3H91A 4AYBB 4HJ7A 2O4XA 4FDBA 1K73C 1KLUD 2PW7A 1PTOD 4B9WA 2A6HC 1GUGA 1WD0A 1QG7A 2X6LA 5HGTA 2PQEA 1PRTB 5LL6S 1DOLA 3DXJC 3MA2B 5DNFA 4HIOA 4A3LG 2J0TD 3EQLC 4LFAQ 5EPLA 2V4DA 4DV0Q 3R2TA 4A3KG 2EVBA 5M3FH 2RHSB 2CH4A 2UXBL 1O7IA 4HJ8A 2VB2X 2WAQE 5T1GA 3TP5A 3H09A 4QUFA 1L0YB 3PIP3 4KKTA 3FPPA 4OGQC 5IP9G 4DPGA 4CDFC 5JVG3 1UEBA 1AE2A 2IJ0A 2Z8LA 1IL8A 4BXXG 1A2UA 1IL2A 3H3VH 1GUOA 3A55A 3AQQA 1ASZA 1DYQA 4YIJA 3Q24A 3ERSX 4RWSC 1EZ6A 1B8AA 1GHKA 2Z4HA 1QVCA 1PYBA 2E2DC 2IPKD 2FMCA 4LF8Q 3UDXA 4ZAIA 2PNRC 2ZM6L 3S2HH 4CDDC 5JEAH 2EYLA 3LWUA 5M5YB 3PCOB 3ER0A 2HUGA 3DM1A 4A3EH 3D3RA 2E5LQ 3BU2A 2NVTB 4GKKQ 1TWFH 2OQ0A 2YTYA 3K6OA 1HNWQ 1NR2A 2OEOA 1U9RA 1OTCA 2N3SA 3GTQB 2QF7A 1G6ZA 2R92B 1HH2P 3BZDB 3TZUA 3PO2H 5C44B 5EPJA 2I07B 2AQ1B 2EDGA 3KYHC 1S5FD 4K2LA 3J81c 1KTKA 1XTCD 1A8VA 2OT2A 1CZGA 4YY3Q 5LMUQ 3S17B 3I4MG 4C3JG 3J81E 1BUVT 4C3HG 1SE8A 3SR1A 5CV5A 1L1OB 2HCIA 5IWAL 4NW2A 4B3SL 2Z1CA 4LNQA 4DR4L 4EQPA 4A3KB 1OXTA 1JE5A 4IQZA 2IY5B 4FP5D 1ILPA 4RKBA 4U68A 3UE1A 5IOCA 4RHRA 4MTKA 2QW7A 1Q3LA 4IFDJ 1LT3D 2J4XA 5DM73 1E22A 1CUKA 4X3SA 2O2LD 2O5JC 3RZDH 3WOFA 1KNAA 2JA9A 2E2IH 1JCKB 4DN4M 3FRPB 3D6CA 1X6OA 1NE3A 1IYVA 4BY1B 3EJIA 3MAQA 3PIPA 4CJ1B 4JC0A 2GN5A 1PYWD 1VMPA 1TIID 3CPWA 1N32L 3S14B 2I5HA 4A3BH 5KYLA 1TU2B 3K0YA 1XX8A 4DV1L 2ASBA 1JE4A 2KEDA 1GM5A 1AFPA 3S1QB 2K1BA 4R4OA 1LM0A 3FVQA 2QA4A 1RTNA 1MIUA 1Y14B 3CRLC 3K81C 2K4KA 3U58A 1V43A 2WKDA 3KF6B 2ZXOA 3M4YA 3C1FA 1NMFA 1L1OA 4G57A 3R8BA 1S5DD 5CORA 3OTOQ 1I3QB 2F0FA 1Q82C 2MP1A 4OWXB 4LF4L 3SHLA 2EJFC 3HOXG 3QOLA 3MWYW 1KDAA 1KNEA 2CFMA 4KKSA 3PF4A 4A3CG 3M7NA 1HFGA 2IHEA 3PSIA 2BDOA 1SMYD 2SOBA 1K3RA 4DV7Q 1YNJD 1M90C 4JG2A 1CA6A 3M7GA 3I4MB 2TSSA 2X69A 2VNUD 2KQ3A 4C3HB 4DUZL 3J7AV 2WV6D 3BZKA 4OO1G 2VUMH 1VQ8A 4POGA 4A3JG 5FJ8G 2F03A 4JI8L 2K5QA 3J80c 4HMIA 4A3IH 1WCMG 1XPRA 2FFKB 2NVXB 3MEHA 4PMCA 1D5ZC 4DR2L 1YNND 5JJIA 3HRZC 4PMWA 2F52A 2ALYB 1HQRD 1OXVA 2BE5C 4LFAL 4EVOA 4ZRZA 4F8MA 1EY9A 5I9PA 1EWCA 3KF6A 1YHQA 4K2KA 4QUCA 2HCCA 2PYKA 5CC4A 4DV4Q 1QUQB 1M1KC 4HJ9A 2TMPA 3I70A 1SSOA 1K8GA 2JSOA 4C3IH 4DFAA 4FXKC 3A8KE 3NBHB 3OIPA 1CKNB 3GTKB 1MBYA 1QJOA 1VQPA 5M3MH 1JMCA 5I6WA 1Q8IA 4WJ3M 3HKZB 3TS2A 4IUNA 2H4OA 3D4RA 5ISRA 4OWWB 3VYTA 1VQ5A 4UP8A 1O78A 2K5WA 3R93A 4LF8L 2BOSA 2WIIB 4PV1C 5I4DA 1BBUA 1EU4A 4NXNQ 3I4NH 2SNMA 3NTHA 4ZUJA 2K5NA 3HOXB 3M4QA 3CKIB 5ELDA 3AMUA 2J7ZA 4C1NK 2UXDL 1HXYD 3UDGA 4NKLA 3IFDA 4IUTA 1QUQA 1V9PA 1Y8NB 2JE6I 3HOYG 4IOCA 3PO3B 4QCLA 3OOCA 1DGSA 4A3JB 5IYDH 2B63B 4IJHA 1NR4A 1HZBA 2DUDA 3NBHA 2IHFA 3AFQA 1ASYA 1CKNA 4LMQD 3CAMA 2JA6G 4N8X1 1II3A 1K9MC 4JI3L 1VQHA 5E1FA 4YY3L 5C4HA 1HZAA 3CQZH 4MNOA 3S1RB 1B7YB 2DJGC 5ELBA 4DAMA 1JWMD 1XNRL 2E2JB 1PH3A 2DNEA 1CHPD 5C3EH 5KNBA 1VQ9A 3H94A 3VDYA 2NVYH 4ID6A 1RHPA 1Z9FA 4HSPA 2LKVA 2N88A 1VQ6A 1KDBA 2SNSA 4FF2A 1SJED 4GNXC 2QDLA 4FVMA 1AE3A 1LUZA 4CHTB 4K6DA 2WKCA 3J81i 5IT9E 3HOZB 1ICFB 4X62Q 4QMGA 4ZK9B 1I4QA 1UAPA 4ZUIA 3MTSA 1XJVA 3FKIH 2VS1A 3A74A 1A15A 3KLWA 1PH7A 3G48A 5IGGA 1FD7D 4B3RQ 2Q8RE 4A3MH 3W5OA 1X56A 2RDHA 1GUWA 2EOTA 1AW7A 5C0XJ 3VR2A 2RBMA 2AWNA 5LMNQ 1EOVA 3M4PA 3CF5A 1O7YA 4EGVA 4OO1I 2VQEL 3KK7A 3F2UA 3RMHA 1PZJD 3A5UA 1S40A 1ICWA 3K7AH 2KENA 4KN4C 1GUSA 2FMMA 3ULLA 4CKCA 3OTOL 2KCNA 3H3VC 3I7FA 2CQOA 3IKJA 3HOYB 1TR5A 2OF1A 1GJXA 4K5XA 1QNUA 4M8AA 3AEVA 1HZCA 1H9MA 1LV9A 4H02A 3CCUA 1WTPA 2ZJQA 1PDQA 3WDNA 2JA6B 4DV7L 2L4NA 3PO2G 1JJCB 1BR9A 3T4AC 1LTGD 1ZYRC 1I4XA 2VB3X 4RA8A 2NN6H 1UE6A 2VL6A 3TQYA 5TSSA 1KAAA 1PTOB 1YIJA 1E3PA 1TWAH 2CQAA 4POFA 4GKJL 4ME3A 4HTHA 1EEFD 4RGTA 3TREA 3E6ZX 4YHHQ 3I56A 1SXTA 2Q8TA 1VQOA 5BN3A 3PUVA 4C56C 4GLXA 4GZYC 3LGJA 3D0FA 3EN2A 1TS2A 3FDTA 4ZLTF 1W3SA 4GLVB 5A2QE 2E2HH 2EYMA 4MN3A 4IPCA 3EIVA 1LTSD 4RH6A 3OSOA 4WRDA 4IO9A 4JYAL 1JB3A 4AIMA 2WB1G 1WTVA 2A6ED 1JJGA 2B29A 3SVMA 1X3GA 5FLXc 4UP7A 4N8FA 3X3MA 2IW3A 1D5MC 4A3BG 5BR8L 4HJ5A 3J81L 3I90A 3F2BA 2VQFQ 2BE5D 4MHEA 3G6JB 2EYJA 1BKBA 1SRUA 3LX0A 4V0BA 4DGZA 3PQIA 2JA5H 4L6TB 2K6AA 4FO2A 5FLMG 4DR3L 1QVGA 2A68C 4ME5A 3CCMA 2K5VA 1T5EA 1EFWA 2A69C 4Q0FA 5IGFA 1D6EC 5JVH3 4QY7A 4OIKA 1HZ9A 1YNXA 3NPPA 4KY5A 1A2TA 1XPUA 5IWAQ 1H9RA 4A3DB 1DOMA 1F2YA 4XDXA 1IBMQ 2AWOA 3PV0A 4AH6A 3Q22A 1PH5A 1Z47A 1GHJA 3M3YB 1X3FA 2KEEA 3NWSA 4B3TQ 4RKLA 3GP7A 1Y1VH 3VYUA 4XT3B 4UP9A 3NEMA 1S5CD 2VUMG 2E75C 2EXDA 4X64Q 4X65Q 3KF8B 2MPMA 1NY4A 4LF5L 2ZXPA 1GUNA 1DOKA 3K5LA 3H3VI 3GTGB 1N32Q 3H0GB 1EYGA 3KOJA 1K83B 2AUJD 1BNZA 2F3VA 2B39A 5FO7B 5IGCA 3U9SA 2PMZB 1KABA 3SE0A 2NWGA 4DK6C 2OWOA 3S1MH 2Y0SG 3RZDB 1HJPA 2FXQA 3L2PA 3NE5B 5J1ZA 4DA2A 4JPBW 1QILA 3EROA 1A6XA 2GVAA 2NZOA 3EFXD 4KMUC 1BQQT 2YU9H 1JB7A 1VQ7A 5I9OA 4A3BB 1PRTC 1SJHD 1VQLA 1WTRA 3QB3A 4EQ5A 5JPNC 2F1MA 1NMGA 4LF4Q 3SDZA 3BJUA 1EZ8A 2FJ2A 3OIQA 5G3LF 2WAQG 2L9HA 1X3EA 1KDCA 2MJ8A 2XGTA 4IPGA 3MXGA 3J80L 3DWPA 5A35A 4RG1A 4WFN3 2L12A 4HMJA 4CGYB 3KF8A 1BCPC 4DUZQ 3NENA 3S15H 2PW5A 3CPFA 3K80C 1B50A 1G91A 3I4NG 3HOVH 2K32A 4UY8C 4AQYQ 2YYZA 3ND9A 3H6MA 4DR2Q 4OONA 3NUCA 4DNRB 4P75A 4JW0A 5D3DA 2ICEC 3EVQA 4X3KA 4V190 1STGA 2PZTA 2QILA 3MXUA 1GD7A 1WFQA 5COYA 1BBXC 1EL0A 5IYDG 2LSSA 5IODA 2CHBD 2B2UA 4K6LA 1I94L 2UU9Q 1PVOA 3E9HA 3RZOH 4A76A 3TN2A 2ATWA 1P16A 3UDFA 3ONAB 2JA8G 2RA4A 2N78A 1GVPA 2BH8A 4JI2Q 1G51A 1SE2A 2XIWA 2E76C 4RAUC 1PFMA 1WVLA 1LACA 5C3EG 3A5ZB 1FR3A 2Y0SB 1YITA 2ENBA 1AZPA 4M1UB 1F9QA 2Z6KC 1I4HA 4YHHL 1N33Q 2M9VA 1QCBD 4BBSH 2R7ZH 1JOKA 2B2YC 3I55A 3CP0A 4R4CA 3K57A 4BBRG 2DN8A 4LUVA 1SNCA 4C1NI 3E5SA 3HG9A 4C2MH 1L1OC 2XWBB 4L5QA 3NTIA 3FKIG 3D4WA 2EE1A 2VXWA 1SYFA 2WAQB 4X66L 2XN9C 1IYUA 2XTIA 2DY8A 2UXDQ 4Q5VA 1E0BA 2BDNA 1MHWC 3JC66 4J8QA 2F4VL 5CV8A 1KXLA 4A3MG 3G7LA 2R6GA 2KA7A 1TWCB 2IL8A 1VQBA 2XWJB 2VQFL 1ZXTA 2KBNA 1D8LA 1G291 1QWYA 3NWTA 2F0QA 4KY6A 2MHVA 3I4NB 1JWSD 1D1IA 4MIUA 1W6KA 4JI3Q 4JI1Q 4JBJA 1KRTA 5KEEA 1CSQA 1R9TH 1W2BA 3DM3A 1K8OA 2EJMA 2I5MX 2NTTA 4DAPA 1VF5C 1XNRQ 4YWKA 3RLNA 3STBC 2V1CC 1CSPA 2L11A 1NCVA 2XVSA 1RJTA 1NTGA 1IBML 2LS01 1N34Q 1Y8PB 1S5ED 1VQGA 3QR8A 1PH1A 4FXDA 2QDBA 2B2WA 1YJ9A 4B3TL 4FF1A 3N6RA 1E7ZA 3ZYYX 2HQEA 3TP8A 2RSNA 3CD6A 2GVBA 2JA8B 3MXPA 2EY6A 4N9PA 4YCWA 5AFWA 1M8AA 1H95A 1WD1A 2ZT9C 3FEWX 4X64L 4X65L 5GADC 1LTID 4LJZC 4WORA 1C8CA 2NVYB 2NN6G 1I6HH 1AP0A 3MZ5A 1TXYA 3HOUH 3MVVA 2ZJPA 5JAVA 3S2DB 4A4IA 4G7ZC 5DLQE 3GTJB 1Q46A 3E0EA 3AB9A 1DD2A 3M85A 5M5WH 4A3FG 1CTMA 1KD1C 5HY6A 3GTOH 2VY3A 4BBRB 3GTLH 1YBYA 2PO4A 3S16H 4BA2I 2BCOA 4P72A 3X3NA 2VQEQ 2FINB 5C4XG 3FKIB 4NP5A 1GOZA 3HOWG 4BY7G 1TWGH 3ERQA 2EY2A 5DAUA 1H9JA 4A3MB 3BYTB 1C9OA 4UDUC 3A56A 1ENFA 1N36Q 1Q90A 1K28A 4G7OC 1VQDA 1ESFA 1GKHA 1KRSA 1EIFA 1LT6D 5D65A 1A63A 4XIGS 1P8LA 3P7JA 4R8NA 1UE7A 3CC7A 2F0EA 2JA7H 1SFOB 3FHWA 4C3JB 3VA5A 3RN5A 1LT4D 5KNCA 2Q2TA 3U4VA 3TS0A 2B2TC 4MZ9A 1JJ2A 2OCEA 1X32A 3OWFA 4TSSA 1TT2A 3JAME 1IZ6A 5CV4A 3PUWA 2EYFA 5GAGC 4AQYL 3TBIB 4QJFA 1KQSA 1Q1EA 3CW2C 1PA6A 4JOIC 1UUPA 3NSWA 3URYA 4JI7L 3F1ZA 3KJOA 2YV5A 4GKJQ 2K14A 1RODA 2K7VA 4H44C 3K59A 3SK4A 1U4PA 5DEHA 4ODGA 3M9BA 2PI2E 3HKZE 1E2WA 2RQXA 4DV5Q 4H7BA 1EWHA 2UU9L 1IHZA 1Y1VG 3P1HA 1Q81C 1LTLA 3L3OC 5FLXL 1SLJA 4QIWE 4JYAQ 2DJFC 3GO5A 1TWAB 4EQOA 4GN3B 4A3FB 3NTKA 4JI2L 4BS9A 1B3QA 2A6HD 3G6EA 5C4XB 1ET9A 1VQEA 2A74C 5BR8Q 3M4OB 3KBGA 1N33L 4Y7NB 3HOWB 1RL2A 4BY7B 2E2HB 1LT5D 2G9HD 5C4JH 1H9SB 4K8JA 2NZ1D 4NXMQ 3PUYA 1KIXA 3J7A5 1Y69U 1VQ4A 4DR3Q 5M5YH 5EAYA 1JC7A 3BZCA 2EYHA 2KUMA 2Z6BA 4QF4A 2NVTH 1EFID 1CA5A 2QEXA 1GXDC 1TKWB 2L1BA 4R8IA 2MO1A 2D0PA 4K5WA 4LUZA 4F88A 3GTQH 3FMCA 5ELNA 3IAYA 2F0MA 1IBLL 5C44H 4R4IA 5CGKA 4H13C 1WCMB 1PH8A 4JI0Q 1D7QA 2NN6I 3TDQA 4DXFA 3EA6A 4JI1L 1HHVA 4LUOA 4IPDA 2NVQB 2E74C 1EYCA 4JBWA 3CCJA 4ZCKA 4LF5Q 3GTPB 4DR5L 1OO9B 4A3KH 4P74A 1IW7C 2QGQA 3V96A 3CCQA 4DUYL 4PMBA 4I65A 3TRZA 5EKLA 3GV3A 1H9SA 5IT9c 1N34L 3CMEA 1Q8KA 1FNUA 1EU3A 2ZTDA 2NB0A 4OEMB 4GOPC 5IE8A 1PMRA 1M4VA 1SNPA 5ELCA 5M3FG 5CV7A 1LTAD 3HGBA 3KLSX 1PYSB 2L15A 4WJWA 5C0XH 4IUVA 4BY1H 5C5LA 3I72A 2HIXA 4RMFA 4ULLA 5BN4A 4LF6Q 3S14H 3GTMH 4BWGB 4EQNA 5K36H 2UUAQ 2K05A 4F87A 1ENAA 1MSGA 3K8AA 4CJ0B 4LF9L 3T1HL 3S1MB 3V05A 1CQVA 1G8ZD 1STYA 2EJGC 5G3LD 2MGSA 1I4GA 4A93H 3BVMA 2MO0A 4TQUS 5I2XA 1CT1D 5ELOA 3AFPA 4LFCQ 3Q0AA 1JQYD 1F9PA 5AJ3L 3C2PA 3TSSA 3E9IA 3I4LA 2EIFA 1PTOC 2F0DA 1XWEA 1Y8OB 4I7ZC 4OX9L 3MHBA 1N9WA 1I3QH 3HEJA 5JEAG 2DGYA 3MFYA 3R2IA 1N36L 3ULPA 3S1NH 1HR0W 4A3EG 1C4QA 1EUJA 2K52A 3E0JA 5C4ZA 4CKBA 2FHTA 1Y1WH 1ET6A 5C5MA 1EY6A 3MFGA 4GNXB 3PUXA 1VQMA 4C3HH 3S15B 3BDOA 2WINB 2KVMA 5GAEC 3WWVA 1PFSA 1STEA 3NXWA 1YJWA 1I94Q 1JICA 1KLGD 3K5MA 1CQFA 2NVXH 2N55A 1QZHA 4APVA 3K7UC 1PRTF 1EIYB 5ELFA 1DCZA 2QKIC 4KJNA 1XMQL 3I8ZA 2JQOA 1K3BC 2CVRA 3TEHB 1EY5A 2EYOA 1HQMC 1SE3A 1STBA 2C5CA 1IBKL 2ES2A 2LMCB 1QB5D 2F0VA 4GN5A 5M3FB 3RUZA 3JAMi 1SEBD 3QWNA 2ZXRA 1KHIA 1BO0A 4B08A 4R4TA 5C3XA 3KDFB 3DHQA 1BCPF 5KNDA 4DV5L 2F4IA 1PH6A 3GTKH 3CC4A 3C46A 3Q23A 1S72A 4FNFA 3CHBD 4J15A 4X66Q 3P20A 5C6AA 1RIPA 1WI5A 4XXEA 1XMOQ 4GNXA 2JP1A 1QOHA 2F4VQ 3KLRA 3VR3A 4NB3A 5IYCH 3OW7A 2HDLA 2F0LA 1HTPA 3F8TA 1EQTA 2GA4B 1MGSA 4LFBQ 4NXML 1JR0D 3S2HB 2WP8J 1I50H 1HR0L 3K0XA 1UE5A 4B3ML 1GUTA 2K28A 4UAIA 2CWAA 3UE0A 4A3EB 3A8IE 3U4ZA 2KECA 3SK5A 1TWFB 1N8RC 2RHQB 4L63B 4GN4B 2M00A 2ID0A 4NPSA 1Q12A 3SEBA 3KUPA 1IYJB 4PG3A 1VQAA 5J3BA 1X54A 2I46A 4KD3A 3PO3H 3FPUB 3PO2B 5EQ0A 3SGIA 2B63H 5FJ8H 3KDFA 3L9AX 4TVAB 5IP7H 5IGBA 4HIMA 3T13A 2VZAA 4CJ2C 2B2UC 2CWPA 2RSOA 4KV6A 1R9TB 2VW9A 1HCZA 4CDCC 4JI0L 4IUQA 3TZDA 3S1RH 4HIKA 3A8JE 2E2JH 1XYIA 1WYDA 4KTAA 2KHJA 5IGDA 2M2LA
chains in the Genus database with same CATH topology
2UXDQ 2R93H 4A3IG 5JJIA 4PMWA 4P71A 2A19A 2JJQA 2F52A 3JC66 2ALYB 2JEBI 1FL0A 1K8AC 2F4VL 1KXLA 2B3GA 4A3MG 3PIOA 2R6GA 1OXVA 4LFAL 4IPHA 1VQBA 2OQKA 2VQFL 1YHQA 3KF6A 3J81j 3HOZH 2KBNA 2MNAA 1D8LA 1G291 1QUQB 4DV4Q 1M1KC 3OW2A 4HJ9A 1SFOH 4WJ4A 3W1BA 1K8GA 1B70B 4C3IH 1WOCA 4C3JH 3I4MH 4MTNA 2HHHQ 4GOPB 1J5EL 4L5RC 1OXSC 3NBHB 1CKNB 4DR1L 1PH9A 2CKZB 2KCMA 4JBJA 1KRTA 2K50A 4JI1Q 4JI3Q 1CSQA 3GDEA 1LYLA 1R9TH 3S24A 2IX0A 3T1YQ 1W2BA 3DM3A 2I5MX 5IYBH 1VQKA 1XNRQ 1VQPA 5M3MH 4YWKA 3RLNA 4LF6L 3STBC 1JMCA 2V1CC 1CSPA 3PF5A 1YHBA 5JJLA 4WJ3M 1X65A 2UUAL 4L5TA 4L5SA 3TS2A 4LW1A 1MJEA 3PUZA 1E1TA 3W1GA 4KHPL 5M3MG 4IFDG 1NTGA 1IBML 4X6AH 1N34Q 4A3DG 3CC2A 5GQOA 1IXRA 1VQGA 4LF7L 4OWWB 2N49A 1VQ5A 4LWCA 3NELA 4UP8A 1PH1A 4AYBE 2UXBQ 1S3OA 1YJ9A 4B3TL 1E7ZA 4O0AA 3U50C 4LF8L 1U0LA 3CD6A 2GVBA 4LFCL 1E24A 1BBUA 4DV3L 4NXNQ 4YCWA 3I4NH 4R1JA 1H95A 1Q1BA 2K5NA 3DLLA 2BH2A 2K75A 3M4QA 5E7NA 4X64L 4X65L 5GADC 1KC8C 4BBSG 1C7YA 4DR7Q 4IFDI 2NN6G 1I6HH 2UXDL 3PGZA 1TXYA 3HOUH 1XNQL 4A3FH 2ZJPA 3UDGA 1X55A 3HOYH 4A4IA 5DLQE 3H0GG 1Q46A 3E0EA 2UXCQ 1FJGQ 4JI7Q 2PQAB 3M85A 1QUQA 3HOUG 3B6YA 1V9PA 5C4XH 5M5WH 4A3FG 2JE6I 1KD1C 2RF4A 5HY6A 4JI5Q 2VY3A 4IOCA 3GTOH 3GTLH 3HOYG 4Y7NH 4DV4L 1YBYA 3HOWH 1DGSA 3S16H 5IYDH 4BA2I 1EWIA 4BY7H 4GOPA 4IJHA 4P72A 1EQRA 1HZBA 2DUDA 2IHFA 2YTVA 2LXKA 3AFQA 1CKNA 3J80i 3CAMA 2VQEQ 2HHHL 2LXJA 5C4XG 4O2DA 2JA6G 3HOWG 1YJNA 2ZM6Q 1K9MC 4JI3L 1VQHA 4BY7G 4YY3L 1HZAA 3CQZH 4MNOA 3T1YL 1B7YB 1TWGH 4DAMA 1XNRL 2K5HA 4GLAC 1PH3A 2A1AA 3HOXH 2A8VA 1C9OA 5C3EH 1VQ9A 4KI0A 1MKHA 3VDYA 4YWLA 2NVYH 4EX5A 1N36Q 1Z9FA 1YZ6A 3CCVA 1VQ6A 4A3CH 4A3GH 1VQDA 2CCZA 2HIVA 3F2DA 1TWHH 1GKHA 3I4OA 1KRSA 4DV2Q 1EIFA 4GNXC 2IX1A 1AE3A 1A63A 1LUZA 4KHZA 4XIGS 3J81i 2N8NA 2BA1A 1P8LA 5GAHC 1PV4A 3KFUA 1UE7A 3CC7A 1JT8A 2JA7H 1FVIA 4X62Q 4BA1I 1BVSA 3FHWA 4A3JH 3KJPA 5LMNW 1PH2A 4NXNL 3RN5A 2Q2TA 3U4VA 3TS0A 1XJVA 4K0KL 3FKIH 1WCMH 4DNIA 2JA7G 3GD7A 2VS1A 1J6QA 3A74A 3AYHB 4MZ9A 5JJKA 1JJ2A 2OCEA 4JV5Q 5IY0A 3KLWA 2PMZE 1CKOA 1EQQA 1PH7A 1VQCA 2H5XA 3G48A 1IZ6A 5C0XG 2NVQH 4BY1G 3CCEA 1SMXA 4B3SQ 3CMAA 4DR6L 1XTDA 3PUWA 4B3RQ 5GAGC 4AQYL 1OXXK 4QJFA 4DR4Q 2PQAA 1KQSA 1Q1EA 3CW2C 2RCNA 2AHOB 4JOIC 4A3MH 1PA6A 4JBMA 3GTPH 4AYBG 3W5OA 1X56A 4JI7L 5HGQA 3F1ZA 1GO3E 5C0XJ 3KJOA 1XMOL 4JI5L 5K36G 2YV5A 4GKJQ 2AWNA 2WB1E 5LMNQ 2K14A 4DV6L 1EOVA 3M4PA 2R7DA 3RLOA 3CF5A 1QVFA 2UUCL 4OO1I 2VQEL 1SR3A 2AMCB 2JK8A 1E1OA 4IJLA 3A5UA 1S40A 3M9BA 4LFBL 1KL9A 2PI2E 2D0OA 1IBLQ 3HKZE 3K7AH 2KENA 4QQBX 4A93G 3ZJYC 4DV5Q 4QL5A 2UU9L 2ZTCA 1Y1VG 1Q81C 3ULLA 1LTLA 1HNZQ 4DAYB 1SLJA 2BA0A 4QIWE 3OTOL 2UUBL 4JYAQ 4Y52H 3GO5A 3I7FA 3F2CA 2CQOA 4GN3B 4JI2L 1L2FA 3AEVA 4DV1Q 1HZCA 5JEAJ 5H1SE 4A3DH 1Q7YC 4DV2L 4DR5Q 2AKWB 3G6EA 1X9NA 1VQEA 1XPOA 4H02A 5BR8Q 4DUYQ 3CCUA 2OTLA 2ZJQA 1N33L 1RL2A 4DV7L 4X62L 1Y1WG 3M3YH 5C4JH 3MXNB 4JBKA 2OTJA 4NXMQ 3PO2G 1JJCB 3PUYA 1KIXA 3J7A5 1VQ4A 4DR3Q 4JCVE 4JV5L 5M5YH 1FGUA 4HIDA 5EAYA 1VS0A 1PVOA 1UE6A 2I5LX 2D62A 4B3RL 1VQIA 2VL6A 3TQYA 3BZCA 4YCVA 1UWVA 3GTGH 3H0GH 4HJAA 1YIJA 2NVTH 1E3PA 2QEXA 1G6PA 1TWAH 4A75A 4POFA 4GKJL 4ME3A 3G4SA 5LMNL 1K83H 5GROA 2WFWA 4OWTB 4LF9Q 2MO1A 2D0PA 3TREA 4YHHQ 2KHIA 3I56A 3T1HQ 3GTQH 4LUZA 1AH9A 1VQOA 1C0AA 3PUVA 4KLKA 5ELNA 4GLXA 1HNXQ 1A62A 1YVCA 3LGJA 1IBLL 3D0FA 3EN2A 2JA6H 5C44H 4R4IA 2Q2UA 1W3SA 3HFZB 4GLVB 4JI4Q 2E2HH 1VQFA 1HNZL 4JI6Q 1PH8A 2R92G 4IPCA 3EIVA 4JI0Q 2Y0SE 4JI8Q 1Q86C 1D7QA 2NN6I 5AJ3Q 5C44G 4JI1L 1V1QA 2E8GA 4PZ8A 4IO9A 4AIMA 4LUOA 4JYAL 4IPDA 4HJ7A 4JBWA 4FDBA 3CCJA 1K73C 2WB1G 4OX9Q 4PZ7A 4LF5Q 3ICEA 1JJGA 2B29A 1X3GA 1MJCA 5FLXc 4DR5L 4UP7A 4A3KH 4P74A 2QGQA 1VQJA 4HIOA 4A3BG 2Z6KA 4PZ6A 5M5XH 5BR8L 3CCQA 4DUYL 4HJ5A 4A3LG 4LFAQ 3TRZA 1CKMA 3HKZG 1N34L 3F2BA 5IT9c 5FLMH 3CMEA 4DV0Q 4A3KG 2VQFQ 1Q8KA 5M3FH 2IT1A 2RHSB 1BKBA 1SRUA 5IYCG 1O7IA 2UXBL 2ZTDA 2JA5H 4HJ8A 2WAQE 3ULJA 4GOPC 5IE8A 5FLMG 4DR3L 3J7ZC 1QVGA 3CCMA 3MEFA 5IP9G 2MQHA 5M3FG 4DPGA 2Q2IA 1PYSB 2K5VA 2L15A 1UEBA 1AE2A 4DR1Q 2JA5G 2EQSA 3RR5A 4BY1H 1EFWA 3JAMc 2Z0SA 4DR7L 2HIXA 2KHJA 4RMFA 1NBWA 4QY7A 4LF6Q 1HZ9A 4R4QA 1YNXA 3S14H 3GTMH 4BXXG 1IL2A 3L7ZC 1XPUA 3H3VH 4UPAA 2JEAI 5IWAQ 1OXUA 3AQQA 1XMQQ 1ASZA 2UUAQ 3K8AA 2ZJRA 4LF9L 3ERSX 2YTXA 3T1HL 1B8AA 1FJGL 1IBMQ 2AWOA 3PV0A 2PNHA 1QVCA 2UXCL 4LF7Q 4AH6A 1PYBA 1HNXL 1ASYA 1IBKQ 3IRBA 1PH5A 1Z47A 1X3FA 4B3TQ 3RLFA 1PH4A 4LF8Q 3UDXA 3PO3G 4A93H 2MO0A 4TQUS 1SN8A 1Y1VH 5ELOA 3AFPA 4LFCQ 2B63G 5IP7G 5AJ3L 4UP9A 3I2ZA 3NEMA 2ZM6L 2HT1A 3E9IA 3S2HH 5C0XI 2EIFA 3M4OH 3PCOB 3ER0A 2EXDA 2VUMG 4X64Q 4X65Q 2R7FA 3KF8B 4OX9L 4YWMA 4A3EH 1NY4A 4LF5L 1N9WA 1I3QH 5JEAG 2E5LQ 2DGYA 3H3VI 1A0IA 3BU2A 1XNQQ 1N32Q 4GKKQ 1TWFH 2OQ0A 3G71A 3ULPA 1N36L 2YTYA 1EYGA 1HR0W 3S1NH 1HNWQ 4A3EG 3KOJA 1EUJA 2K52A 1OTCA 2R93G 4DV0L 3FP9A 1Y1WH 2N3SA 4DK6C 2OWOA 3S1MH 1HH2P 4GNXB 2Y0SG 3L0OA 3PO2H 1HJPA 1L0WA 2FXQA 3L2PA 3PUXA 1VQMA 4OXPA 3KYHC 3J81c 4C3HH 2GVAA 2NZOA 1YI2A 3HOZG 5GAEC 1A8VA 3WWVA 3A0JA 4YY3Q 1PFSA 5LMUQ 1YJWA 3I4MG 1I94Q 2YU9H 1HR0Q 1SE8A 1VCIA 1YEZA 4B3MQ 2NVXH 1JB7A 1VQ7A 1QZHA 4APVA 3K7UC 1EIYB 1L1OB 1VQLA 5IWAL 3Q8DA 1UE1A 1XMQL 4B3SL 4LNQA 2JQOA 4EQ5A 4DR4L 2C35B 3TEHB 5IYBG 1NMGA 1OXTA 1JE5A 4LF4Q 2IY5B 3BJUA 1BBWA 2WAQG 1X3EA 3UE1A 1IBKL 2ES2A 1TWCH 4GN5A 2XGTA 4IOAA 3EBEA 4IFDJ 4IPGA 4ALPA 1E22A 1CUKA 3JAMi 2R92H 1KHIA 1VQNA 3RZDH 2E2IH 2JA9A 4RG1A 4R4TA 3RNUA 4K0KQ 4DV5L 3KDFB 4DUZQ 3NENA 3S15H 1X6OA 1NE3A 1PH6A 2F3IA 3GTKH 3CC4A 3CPFA 3K80C 3PIPA 3I4NG 3S17H 1S72A 2E5LL 3HOVH 4JC0A 2GN5A 3CPWA 4UY8C 1N32L 4P73A 1KAWA 4DR6Q 4GKKL 2I5HA 4J15A 4AQYQ 2YYZA 4X66Q 1HNWL 4A3BH 1RIPA 4DR2Q 4A3LH 1WI5A 3HOVG 4OONA 4DV1L 2ASBA 3H15A 1XMOQ 4GNXA 1GM5A 4R4OA 1T9HA 4P75A 2F4VQ 4XTCS 1LM0A 4NB3A 5IYCH 4DV6Q 2QA4A 2UUCQ 2HQLA 1QZGA 1GD7A 3F8TA 1MIUA 1WFQA 4QGUA 1Y14B 3K81C 3U58A 2K4KA 5IP9H 4LFBQ 5IYDG 2LSSA 4NXML 2NZHA 5LMUL 1V43A 3KF6B 3CCLA 2JA8H 1I94L 1NJIC 2WP8J 1I50H 3UDIA 3E9HA 1HR0L 2UU9Q 4A76A 3RZOH 1NMFA 3K0XA 1UE5A 4DK3C 1J5EQ 4B3ML 1L1OA 2PI2A 2ATWA 1P16A 3UDFA 2CWAA 3UE0A 3OTOQ 2UUBQ 4BXXH 2JA8G 2KCTA 3U4ZA 2N78A 1GVPA 2BH8A 1Q82C 4JOIA 4JI2Q 4OWXB 1G51A 4LF4L 1N8RC 3HOXG 2RHQB 4GN4B 2MFIA 2ID0A 3A5ZB 4NPSA 1Q12A 2CFMA 5C3EG 3S2DH 1IYJB 3PF4A 1PHJA 4A3CG 4PG3A 1VQAA 5J3BA 1X54A 3STBD 3GTJH 1YITA 2IHEA 3PSIA 3M7NA 4A3GG 2Z6KC 1N33Q 4KHPQ 1I5FA 4GS3A 4YHHL 1U5KA 1K3RA 4DV7Q 1SROA 1M90C 4JG2A 4BBRH 3PO3H 3HKSA 3S1QH 4BBSH 3D31A 3SGIA 5FJ8H 3KDFA 4TVAB 4YCUA 1K0RA 5IP7H 2B63H 3CCSA 2R7ZH 3I55A 2VNUD 3CP0A 4HIMA 4R4CA 4JI4L 4DUZL 2VZAA 1WJJA 3BZKA 4BBRG 4OO1G 4DKAC 3CCRA 2CWPA 3CXCA 4LUVA 1VQ8A 4A3JG 2VW9A 4JI6L 4POGA 4JI0L 2VUMH 3OYYA 5FJ8G 4JI8L 2R7ZG 4C2MH 3S1RH 1L1OC 4DV3Q 2I0QA 4L5QA 3J80c 3RN2A 2ZTEA 3FKIG 1WCMG 4HIKA 4A3IH 1XPRA 2E2JH 4X66L 1WYDA 1YHAA 2Q2HA 4DR2L 2XTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD Q;  2R93 H;  4A3I G;  5JJI A;  4PMW A;  4P71 A;  2A19 A;  2JJQ A;  2F52 A;  3JC6 6;  2ALY B;  2JEB I;  1FL0 A;  1K8A C;  2F4V L;  1KXL A;  2B3G A;  4A3M G;  3PIO A;  2R6G A;  1OXV A;  4LFA L;  4IPH A;  1VQB A;  2OQK A;  2VQF L;  1YHQ A;  3KF6 A;  3J81 j;  3HOZ H;  2KBN A;  2MNA A;  1D8L A;  1G29 1;  1QUQ B;  4DV4 Q;  1M1K C;  3OW2 A;  4HJ9 A;  1SFO H;  4WJ4 A;  3W1B A;  1K8G A;  1B70 B;  4C3I H;  1WOC A;  4C3J H;  3I4M H;  4MTN A;  2HHH Q;  4GOP B;  1J5E L;  4L5R C;  1OXS C;  3NBH B;  1CKN B;  4DR1 L;  1PH9 A;  2CKZ B;  2KCM A;  4JBJ A;  1KRT A;  2K50 A;  4JI1 Q;  4JI3 Q;  1CSQ A;  3GDE A;  1LYL A;  1R9T H;  3S24 A;  2IX0 A;  3T1Y Q;  1W2B A;  3DM3 A;  2I5M X;  5IYB H;  1VQK A;  1XNR Q;  1VQP A;  5M3M H;  4YWK A;  3RLN A;  4LF6 L;  3STB C;  1JMC A;  2V1C C;  1CSP A;  3PF5 A;  1YHB A;  5JJL A;  4WJ3 M;  1X65 A;  2UUA L;  4L5T A;  4L5S A;  3TS2 A;  4LW1 A;  1MJE A;  3PUZ A;  1E1T A;  3W1G A;  4KHP L;  5M3M G;  4IFD G;  1NTG A;  1IBM L;  4X6A H;  1N34 Q;  4A3D G;  3CC2 A;  5GQO A;  1IXR A;  1VQG A;  4LF7 L;  4OWW B;  2N49 A;  1VQ5 A;  4LWC A;  3NEL A;  4UP8 A;  1PH1 A;  4AYB E;  2UXB Q;  1S3O A;  1YJ9 A;  4B3T L;  1E7Z A;  4O0A A;  3U50 C;  4LF8 L;  1U0L A;  3CD6 A;  2GVB A;  4LFC L;  1E24 A;  1BBU A;  4DV3 L;  4NXN Q;  4YCW A;  3I4N H;  4R1J A;  1H95 A;  1Q1B A;  2K5N A;  3DLL A;  2BH2 A;  2K75 A;  3M4Q A;  5E7N A;  4X64 L;  4X65 L;  5GAD C;  1KC8 C;  4BBS G;  1C7Y A;  4DR7 Q;  4IFD I;  2NN6 G;  1I6H H;  2UXD L;  3PGZ A;  1TXY A;  3HOU H;  1XNQ L;  4A3F H;  2ZJP A;  3UDG A;  1X55 A;  3HOY H;  4A4I A;  5DLQ E;  3H0G G;  1Q46 A;  3E0E A;  2UXC Q;  1FJG Q;  4JI7 Q;  2PQA B;  3M85 A;  1QUQ A;  3HOU G;  3B6Y A;  1V9P A;  5C4X H;  5M5W H;  4A3F G;  2JE6 I;  1KD1 C;  2RF4 A;  5HY6 A;  4JI5 Q;  2VY3 A;  4IOC A;  3GTO H;  3GTL H;  3HOY G;  4Y7N H;  4DV4 L;  1YBY A;  3HOW H;  1DGS A;  3S16 H;  5IYD H;  4BA2 I;  1EWI A;  4BY7 H;  4GOP A;  4IJH A;  4P72 A;  1EQR A;  1HZB A;  2DUD A;  2IHF A;  2YTV A;  2LXK A;  3AFQ A;  1CKN A;  3J80 i;  3CAM A;  2VQE Q;  2HHH L;  2LXJ A;  5C4X G;  4O2D A;  2JA6 G;  3HOW G;  1YJN A;  2ZM6 Q;  1K9M C;  4JI3 L;  1VQH A;  4BY7 G;  4YY3 L;  1HZA A;  3CQZ H;  4MNO A;  3T1Y L;  1B7Y B;  1TWG H;  4DAM A;  1XNR L;  2K5H A;  4GLA C;  1PH3 A;  2A1A A;  3HOX H;  2A8V A;  1C9O A;  5C3E H;  1VQ9 A;  4KI0 A;  1MKH A;  3VDY A;  4YWL A;  2NVY H;  4EX5 A;  1N36 Q;  1Z9F A;  1YZ6 A;  3CCV A;  1VQ6 A;  4A3C H;  4A3G H;  1VQD A;  2CCZ A;  2HIV A;  3F2D A;  1TWH H;  1GKH A;  3I4O A;  1KRS A;  4DV2 Q;  1EIF A;  4GNX C;  2IX1 A;  1AE3 A;  1A63 A;  1LUZ A;  4KHZ A;  4XIG S;  3J81 i;  2N8N A;  2BA1 A;  1P8L A;  5GAH C;  1PV4 A;  3KFU A;  1UE7 A;  3CC7 A;  1JT8 A;  2JA7 H;  1FVI A;  4X62 Q;  4BA1 I;  1BVS A;  3FHW A;  4A3J H;  3KJP A;  5LMN W;  1PH2 A;  4NXN L;  3RN5 A;  2Q2T A;  3U4V A;  3TS0 A;  1XJV A;  4K0K L;  3FKI H;  1WCM H;  4DNI A;  2JA7 G;  3GD7 A;  2VS1 A;  1J6Q A;  3A74 A;  3AYH B;  4MZ9 A;  5JJK A;  1JJ2 A;  2OCE A;  4JV5 Q;  5IY0 A;  3KLW A;  2PMZ E;  1CKO A;  1EQQ A;  1PH7 A;  1VQC A;  2H5X A;  3G48 A;  1IZ6 A;  5C0X G;  2NVQ H;  4BY1 G;  3CCE A;  1SMX A;  4B3S Q;  3CMA A;  4DR6 L;  1XTD A;  3PUW A;  4B3R Q;  5GAG C;  4AQY L;  1OXX K;  4QJF A;  4DR4 Q;  2PQA A;  1KQS A;  1Q1E A;  3CW2 C;  2RCN A;  2AHO B;  4JOI C;  4A3M H;  1PA6 A;  4JBM A;  3GTP H;  4AYB G;  3W5O A;  1X56 A;  4JI7 L;  5HGQ A;  3F1Z A;  1GO3 E;  5C0X J;  3KJO A;  1XMO L;  4JI5 L;  5K36 G;  2YV5 A;  4GKJ Q;  2AWN A;  2WB1 E;  5LMN Q;  2K14 A;  4DV6 L;  1EOV A;  3M4P A;  2R7D A;  3RLO A;  3CF5 A;  1QVF A;  2UUC L;  4OO1 I;  2VQE L;  1SR3 A;  2AMC B;  2JK8 A;  1E1O A;  4IJL A;  3A5U A;  1S40 A;  3M9B A;  4LFB L;  1KL9 A;  2PI2 E;  2D0O A;  1IBL Q;  3HKZ E;  3K7A H;  2KEN A;  4QQB X;  4A93 G;  3ZJY C;  4DV5 Q;  4QL5 A;  2UU9 L;  2ZTC A;  1Y1V G;  1Q81 C;  3ULL A;  1LTL A;  1HNZ Q;  4DAY B;  1SLJ A;  2BA0 A;  4QIW E;  3OTO L;  2UUB L;  4JYA Q;  4Y52 H;  3GO5 A;  3I7F A;  3F2C A;  2CQO A;  4GN3 B;  4JI2 L;  1L2F A;  3AEV A;  4DV1 Q;  1HZC A;  5JEA J;  5H1S E;  4A3D H;  1Q7Y C;  4DV2 L;  4DR5 Q;  2AKW B;  3G6E A;  1X9N A;  1VQE A;  1XPO A;  4H02 A;  5BR8 Q;  4DUY Q;  3CCU A;  2OTL A;  2ZJQ A;  1N33 L;  1RL2 A;  4DV7 L;  4X62 L;  1Y1W G;  3M3Y H;  5C4J H;  3MXN B;  4JBK A;  2OTJ A;  4NXM Q;  3PO2 G;  1JJC B;  3PUY A;  1KIX A;  3J7A 5;  1VQ4 A;  4DR3 Q;  4JCV E;  4JV5 L;  5M5Y H;  1FGU A;  4HID A;  5EAY A;  1VS0 A;  1PVO A;  1UE6 A;  2I5L X;  2D62 A;  4B3R L;  1VQI A;  2VL6 A;  3TQY A;  3BZC A;  4YCV A;  1UWV A;  3GTG H;  3H0G H;  4HJA A;  1YIJ A;  2NVT H;  1E3P A;  2QEX A;  1G6P A;  1TWA H;  4A75 A;  4POF A;  4GKJ L;  4ME3 A;  3G4S A;  5LMN L;  1K83 H;  5GRO A;  2WFW A;  4OWT B;  4LF9 Q;  2MO1 A;  2D0P A;  3TRE A;  4YHH Q;  2KHI A;  3I56 A;  3T1H Q;  3GTQ H;  4LUZ A;  1AH9 A;  1VQO A;  1C0A A;  3PUV A;  4KLK A;  5ELN A;  4GLX A;  1HNX Q;  1A62 A;  1YVC A;  3LGJ A;  1IBL L;  3D0F A;  3EN2 A;  2JA6 H;  5C44 H;  4R4I A;  2Q2U A;  1W3S A;  3HFZ B;  4GLV B;  4JI4 Q;  2E2H H;  1VQF A;  1HNZ L;  4JI6 Q;  1PH8 A;  2R92 G;  4IPC A;  3EIV A;  4JI0 Q;  2Y0S E;  4JI8 Q;  1Q86 C;  1D7Q A;  2NN6 I;  5AJ3 Q;  5C44 G;  4JI1 L;  1V1Q A;  2E8G A;  4PZ8 A;  4IO9 A;  4AIM A;  4LUO A;  4JYA L;  4IPD A;  4HJ7 A;  4JBW A;  4FDB A;  3CCJ A;  1K73 C;  2WB1 G;  4OX9 Q;  4PZ7 A;  4LF5 Q;  3ICE A;  1JJG A;  2B29 A;  1X3G A;  1MJC A;  5FLX c;  4DR5 L;  4UP7 A;  4A3K H;  4P74 A;  2QGQ A;  1VQJ A;  4HIO A;  4A3B G;  2Z6K A;  4PZ6 A;  5M5X H;  5BR8 L;  3CCQ A;  4DUY L;  4HJ5 A;  4A3L G;  4LFA Q;  3TRZ A;  1CKM A;  3HKZ G;  1N34 L;  3F2B A;  5IT9 c;  5FLM H;  3CME A;  4DV0 Q;  4A3K G;  2VQF Q;  1Q8K A;  5M3F H;  2IT1 A;  2RHS B;  1BKB A;  1SRU A;  5IYC G;  1O7I A;  2UXB L;  2ZTD A;  2JA5 H;  4HJ8 A;  2WAQ E;  3ULJ A;  4GOP C;  5IE8 A;  5FLM G;  4DR3 L;  3J7Z C;  1QVG A;  3CCM A;  3MEF A;  5IP9 G;  2MQH A;  5M3F G;  4DPG A;  2Q2I A;  1PYS B;  2K5V A;  2L15 A;  1UEB A;  1AE2 A;  4DR1 Q;  2JA5 G;  2EQS A;  3RR5 A;  4BY1 H;  1EFW A;  3JAM c;  2Z0S A;  4DR7 L;  2HIX A;  2KHJ A;  4RMF A;  1NBW A;  4QY7 A;  4LF6 Q;  1HZ9 A;  4R4Q A;  1YNX A;  3S14 H;  3GTM H;  4BXX G;  1IL2 A;  3L7Z C;  1XPU A;  3H3V H;  4UPA A;  2JEA I;  5IWA Q;  1OXU A;  3AQQ A;  1XMQ Q;  1ASZ A;  2UUA Q;  3K8A A;  2ZJR A;  4LF9 L;  3ERS X;  2YTX A;  3T1H L;  1B8A A;  1FJG L;  1IBM Q;  2AWO A;  3PV0 A;  2PNH A;  1QVC A;  2UXC L;  4LF7 Q;  4AH6 A;  1PYB A;  1HNX L;  1ASY A;  1IBK Q;  3IRB A;  1PH5 A;  1Z47 A;  1X3F A;  4B3T Q;  3RLF A;  1PH4 A;  4LF8 Q;  3UDX A;  3PO3 G;  4A93 H;  2MO0 A;  4TQU S;  1SN8 A;  1Y1V H;  5ELO A;  3AFP A;  4LFC Q;  2B63 G;  5IP7 G;  5AJ3 L;  4UP9 A;  3I2Z A;  3NEM A;  2ZM6 L;  2HT1 A;  3E9I A;  3S2H H;  5C0X I;  2EIF A;  3M4O H;  3PCO B;  3ER0 A;  2EXD A;  2VUM G;  4X64 Q;  4X65 Q;  2R7F A;  3KF8 B;  4OX9 L;  4YWM A;  4A3E H;  1NY4 A;  4LF5 L;  1N9W A;  1I3Q H;  5JEA G;  2E5L Q;  2DGY A;  3H3V I;  1A0I A;  3BU2 A;  1XNQ Q;  1N32 Q;  4GKK Q;  1TWF H;  2OQ0 A;  3G71 A;  3ULP A;  1N36 L;  2YTY A;  1EYG A;  1HR0 W;  3S1N H;  1HNW Q;  4A3E G;  3KOJ A;  1EUJ A;  2K52 A;  1OTC A;  2R93 G;  4DV0 L;  3FP9 A;  1Y1W H;  2N3S A;  4DK6 C;  2OWO A;  3S1M H;  1HH2 P;  4GNX B;  2Y0S G;  3L0O A;  3PO2 H;  1HJP A;  1L0W A;  2FXQ A;  3L2P A;  3PUX A;  1VQM A;  4OXP A;  3KYH C;  3J81 c;  4C3H H;  2GVA A;  2NZO A;  1YI2 A;  3HOZ G;  5GAE C;  1A8V A;  3WWV A;  3A0J A;  4YY3 Q;  1PFS A;  5LMU Q;  1YJW A;  3I4M G;  1I94 Q;  2YU9 H;  1HR0 Q;  1SE8 A;  1VCI A;  1YEZ A;  4B3M Q;  2NVX H;  1JB7 A;  1VQ7 A;  1QZH A;  4APV A;  3K7U C;  1EIY B;  1L1O B;  1VQL A;  5IWA L;  3Q8D A;  1UE1 A;  1XMQ L;  4B3S L;  4LNQ A;  2JQO A;  4EQ5 A;  4DR4 L;  2C35 B;  3TEH B;  5IYB G;  1NMG A;  1OXT A;  1JE5 A;  4LF4 Q;  2IY5 B;  3BJU A;  1BBW A;  2WAQ G;  1X3E A;  3UE1 A;  1IBK L;  2ES2 A;  1TWC H;  4GN5 A;  2XGT A;  4IOA A;  3EBE A;  4IFD J;  4IPG A;  4ALP A;  1E22 A;  1CUK A;  3JAM i;  2R92 H;  1KHI A;  1VQN A;  3RZD H;  2E2I H;  2JA9 A;  4RG1 A;  4R4T A;  3RNU A;  4K0K Q;  4DV5 L;  3KDF B;  4DUZ Q;  3NEN A;  3S15 H;  1X6O A;  1NE3 A;  1PH6 A;  2F3I A;  3GTK H;  3CC4 A;  3CPF A;  3K80 C;  3PIP A;  3I4N G;  3S17 H;  1S72 A;  2E5L L;  3HOV H;  4JC0 A;  2GN5 A;  3CPW A;  4UY8 C;  1N32 L;  4P73 A;  1KAW A;  4DR6 Q;  4GKK L;  2I5H A;  4J15 A;  4AQY Q;  2YYZ A;  4X66 Q;  1HNW L;  4A3B H;  1RIP A;  4DR2 Q;  4A3L H;  1WI5 A;  3HOV G;  4OON A;  4DV1 L;  2ASB A;  3H15 A;  1XMO Q;  4GNX A;  1GM5 A;  4R4O A;  1T9H A;  4P75 A;  2F4V Q;  4XTC S;  1LM0 A;  4NB3 A;  5IYC H;  4DV6 Q;  2QA4 A;  2UUC Q;  2HQL A;  1QZG A;  1GD7 A;  3F8T A;  1MIU A;  1WFQ A;  4QGU A;  1Y14 B;  3K81 C;  3U58 A;  2K4K A;  5IP9 H;  4LFB Q;  5IYD G;  2LSS A;  4NXM L;  2NZH A;  5LMU L;  1V43 A;  3KF6 B;  3CCL A;  2JA8 H;  1I94 L;  1NJI C;  2WP8 J;  1I50 H;  3UDI A;  3E9H A;  1HR0 L;  2UU9 Q;  4A76 A;  3RZO H;  1NMF A;  3K0X A;  1UE5 A;  4DK3 C;  1J5E Q;  4B3M L;  1L1O A;  2PI2 A;  2ATW A;  1P16 A;  3UDF A;  2CWA A;  3UE0 A;  3OTO Q;  2UUB Q;  4BXX H;  2JA8 G;  2KCT A;  3U4Z A;  2N78 A;  1GVP A;  2BH8 A;  1Q82 C;  4JOI A;  4JI2 Q;  4OWX B;  1G51 A;  4LF4 L;  1N8R C;  3HOX G;  2RHQ B;  4GN4 B;  2MFI A;  2ID0 A;  3A5Z B;  4NPS A;  1Q12 A;  2CFM A;  5C3E G;  3S2D H;  1IYJ B;  3PF4 A;  1PHJ A;  4A3C G;  4PG3 A;  1VQA A;  5J3B A;  1X54 A;  3STB D;  3GTJ H;  1YIT A;  2IHE A;  3PSI A;  3M7N A;  4A3G G;  2Z6K C;  1N33 Q;  4KHP Q;  1I5F A;  4GS3 A;  4YHH L;  1U5K A;  1K3R A;  4DV7 Q;  1SRO A;  1M90 C;  4JG2 A;  4BBR H;  3PO3 H;  3HKS A;  3S1Q H;  4BBS H;  3D31 A;  3SGI A;  5FJ8 H;  3KDF A;  4TVA B;  4YCU A;  1K0R A;  5IP7 H;  2B63 H;  3CCS A;  2R7Z H;  3I55 A;  2VNU D;  3CP0 A;  4HIM A;  4R4C A;  4JI4 L;  4DUZ L;  2VZA A;  1WJJ A;  3BZK A;  4BBR G;  4OO1 G;  4DKA C;  3CCR A;  2CWP A;  3CXC A;  4LUV A;  1VQ8 A;  4A3J G;  2VW9 A;  4JI6 L;  4POG A;  4JI0 L;  2VUM H;  3OYY A;  5FJ8 G;  4JI8 L;  2R7Z G;  4C2M H;  3S1R H;  1L1O C;  4DV3 Q;  2I0Q A;  4L5Q A;  3J80 c;  3RN2 A;  2ZTE A;  3FKI G;  1WCM G;  4HIK A;  4A3I H;  1XPR A;  2E2J H;  4X66 L;  1WYD A;  1YHA A;  2Q2H A;  4DR2 L;  2XTI A; 
#chains in the Genus database with same CATH topology
 1BXT A;  5EBD A;  2RVL A;  2R93 H;  4A3I G;  1K8A C;  3VR6 A;  1B1Z A;  2JEB I;  1FL0 A;  2B3G A;  4NMZ A;  4R9W A;  1Z7T A;  1TVX A;  1SNO A;  2IWH A;  2OQK A;  2R61 A;  2KOL A;  3HOZ H;  3I73 A;  2MNA A;  2MUY A;  5IGE A;  2E2I B;  4WJ4 A;  5FKA C;  3W1B A;  1D1K A;  1B70 B;  1EY8 A;  1STN A;  2F0G A;  1J5E L;  1OXS C;  2CKZ B;  2KCM A;  1FNV A;  2WB1 B;  2EXZ A;  3GDE A;  4K14 A;  1LYL A;  4G7H C;  3S24 A;  2IX0 A;  4C3I G;  1NNX A;  1RCV D;  2LFN A;  5IYB H;  1VQK A;  1LO5 D;  4LF6 L;  1J8I A;  3K58 A;  1SMY C;  5JJL A;  1X65 A;  2UUA L;  5CBE E;  1YNJ C;  1MJE A;  2F0W A;  1E1T A;  3PUZ A;  4RCN A;  3W1G A;  2B8F A;  5M3M G;  4KHP L;  3S16 B;  5GQO A;  1LAB A;  2F0J A;  2N49 A;  4LWC A;  4JK1 C;  3T51 B;  2B2V A;  4AYB E;  4IAL A;  1W6J A;  1S3O A;  4O0A A;  3U50 C;  1U0L A;  3NBI A;  2K03 A;  4F7X A;  4LFC L;  1A3T A;  4DV3 L;  1JOR A;  1Q1B A;  2BH2 A;  2K75 A;  1EOT A;  4DR7 Q;  4IFD I;  1ESR A;  2RDF A;  1ENC A;  4RGO S;  2NTS A;  1X55 A;  3HOY H;  2UXC Q;  1FJG Q;  1ONL A;  4JI7 Q;  4B9X A;  3B6Y A;  5ELE A;  4PNY A;  1C48 A;  5D3I B;  2B2W C;  4KHV A;  2NYZ D;  2YTV A;  2LXK A;  4O42 A;  4S3S A;  2HHH L;  2D5D A;  4KJO A;  2VUM B;  3C3L A;  1BOS A;  1SND A;  3T1Y L;  3T56 B;  4A3I B;  1FNW A;  2P5Z X;  1PLF A;  2A1A A;  2QCP X;  2F0S A;  2G9D A;  1PTO H;  1RD9 D;  1MKH A;  1UEA B;  4YWL A;  4EX5 A;  4A3G H;  1YZ6 A;  3CCV A;  1EY4 A;  1F9S A;  2CCZ A;  3F2D A;  3J7A F;  1DJR D;  1TWH H;  3DWQ A;  2IX1 A;  1CZW A;  2DY7 A;  3BVG A;  4KHZ A;  2KCC A;  3QO2 A;  3T16 A;  3T53 B;  1LTT D;  2F0P A;  2BA1 A;  2F0T A;  5GAH C;  1JT8 A;  4OHJ A;  1E2Z A;  3LWE A;  3PMF A;  4BA1 I;  1BVS A;  5FK9 C;  3KJP A;  2K01 A;  4C3I B;  1PH2 A;  5EGT A;  4IUR A;  2F0O A;  4XQN A;  4DXG A;  3GD7 A;  5CMD A;  5E4W C;  1BCP B;  5M9O A;  4TKO B;  5IY0 A;  3DMU A;  1EQQ A;  2H5X A;  1ZYR D;  5BN5 A;  4RCO A;  5C0X G;  5CYU A;  4BY1 G;  3CCE A;  5M3M B;  1SMX A;  1T5X D;  3CMA A;  1XTD A;  1G2T A;  1OXX K;  3NHH A;  4L8J A;  1XMO L;  4JI5 L;  5K36 G;  2SEB D;  1EQV A;  4OIJ A;  4RGN A;  5C4J B;  3RLO A;  1QVF A;  1SR3 A;  3IL8 A;  4ZKC B;  2JK8 A;  4IJL A;  4LFB L;  1KL9 A;  1IBL Q;  4KD4 A;  1PZI D;  4QQB X;  4A93 G;  4QL5 A;  3NQI A;  2EYP A;  2CW0 C;  1JOO A;  4HED A;  4DAV A;  4Y52 H;  1HRJ A;  1V1P B;  5NUC A;  5IT9 L;  1SYB A;  4IFD H;  2L0C A;  5D14 A;  5JEA J;  5H1S E;  4K5V A;  4A3D H;  5CBA E;  1Q7Y C;  1SNM A;  4DV2 L;  4DR5 Q;  2QEJ C;  4HN7 A;  1EEI D;  1TS3 A;  2F0N A;  3OPO A;  4DUY Q;  2OTL A;  1D2B A;  4XYO A;  1B44 D;  1Y1W G;  4HAE A;  3M3Y H;  2X6G A;  3MXN B;  5FO9 B;  3A54 A;  4JBK A;  2XNA C;  3CQZ B;  1G2S A;  4JV5 L;  4HSV A;  4DU9 A;  4HID A;  2A68 D;  3Q6S A;  1VS0 A;  2D62 A;  3OWE B;  1IKL A;  5C3E B;  4YCV A;  2A69 D;  1UWV A;  3GTG H;  3H0G H;  4HJA A;  5IIF A;  3TP6 A;  1AN8 A;  1TS4 A;  1K83 H;  5GRO A;  2WFW A;  4OWT B;  1AZQ A;  5KYI A;  4LF9 Q;  4RFB A;  2KHI A;  3C1E A;  4IUP A;  1MI2 A;  3T1H Q;  1C0A A;  1I4P A;  5JJZ A;  1A62 A;  3IFT A;  2HD3 A;  2Q2U A;  1TY2 A;  4JI4 Q;  4XQJ A;  3VR5 A;  2F0U A;  1HNZ L;  4JI6 Q;  4LAA A;  2Z4I A;  5AJ3 Q;  1EY7 A;  1V1P A;  2EPB A;  1H9K A;  1V1Q A;  2E8G A;  4PZ8 A;  3NK9 A;  1B9M A;  1Z6H A;  3GTM B;  4OX9 Q;  3OHX C;  4PZ7 A;  1R4P B;  2D2C C;  3ICE A;  1MJC A;  3D6W A;  1VQJ A;  2Z6K A;  4PZ6 A;  5M5X H;  1I4R A;  1CKM A;  3HKZ G;  3MXN A;  4ZQ3 A;  1PFB A;  5FLM H;  2B8G A;  4A93 B;  3D8G A;  1B4O A;  2B2Y A;  2IT1 A;  3BG3 A;  1DON A;  5IYC G;  1FGB D;  3ULJ A;  4HCE A;  3K7A B;  3J7Z C;  3MEF A;  2MQH A;  2Q2I A;  4DR1 Q;  2JA5 G;  2EQS A;  3RR5 A;  1DM0 B;  1ZKO A;  3JAM c;  4K8I A;  2Z0S A;  1O80 A;  1DXM A;  1LLR D;  1A3U A;  4DR7 L;  1SYC A;  3S1N B;  4HR7 B;  1NBW A;  3DWA A;  4R4Q A;  1SYE A;  3L7Z C;  4XYQ A;  4UPA A;  2JEA I;  1OXU A;  1XMQ Q;  2CH4 W;  1PRT D;  1Y1W B;  2K5D A;  5EKK A;  2KHS A;  5A2Q L;  2ZJR A;  2YTX A;  2UXC L;  1FJG L;  2PNH A;  4LF7 Q;  2A5H A;  1HNX L;  1IBK Q;  3IRB A;  1VMC A;  5FOB B;  1WTX A;  3RLF A;  1PH4 A;  5LL6 X;  3PO3 G;  2XSC A;  1SN8 A;  3SK8 A;  5J22 A;  3KLS A;  2B63 G;  5IP7 G;  3I2Z A;  2HT1 A;  2PPB C;  4X3U A;  5C0X I;  1L0X B;  1U4M A;  2WAC A;  5CV9 A;  2A6E C;  1PTO F;  4UHV A;  3ITP A;  2R7F A;  1LTB D;  4YWM A;  1BCP D;  3J80 E;  1IKM A;  1WTW A;  1A0I A;  1EIH A;  1XNQ Q;  1K0S A;  4ILW A;  5C3W A;  3G71 A;  2K33 A;  3VR4 A;  2PCF B;  1R4Q B;  1STA A;  5EBC A;  2R93 G;  4IZ8 A;  4DV0 L;  3FP9 A;  2L55 A;  2RDG A;  1MSH A;  3L0O A;  1L0W A;  1F2M A;  4OXP A;  1YI2 A;  3HOZ G;  3K5O A;  3A0J A;  5FO8 B;  1SDF A;  1HR0 Q;  1VCI A;  1YEZ A;  4B3M Q;  4QB4 A;  4KN7 C;  3Q8D A;  1UE1 A;  3PIO 3;  2C35 B;  5IYB G;  2PZW A;  4ZYS A;  1BBW A;  3I3C A;  1ILQ A;  1TWC H;  4QIW B;  1FYC A;  4IOA A;  3EBE A;  4ALP A;  2JA5 B;  3A7A B;  1X3P A;  2R92 H;  1VQN A;  1I50 B;  5J39 A;  3RNU A;  1E2V A;  4K0K Q;  3BS1 A;  5CV6 A;  4IUU A;  3DUZ A;  2F3I A;  3BDC A;  2KJX A;  1S4Z A;  2Q8I B;  3S17 H;  2PZU A;  2E5L L;  2R3Z A;  2AUK A;  4P73 A;  1KAW A;  4DR6 Q;  4GKK L;  1BF4 A;  1HNW L;  1QNK A;  4A3L H;  3HOV G;  2H1E A;  1HA5 A;  2HDM A;  1HPC A;  3H15 A;  3UI2 A;  1HUM A;  1T9H A;  5DM6 3;  4XTC S;  4DV6 Q;  4PQX A;  2UUC Q;  1CFM A;  1EYD A;  2F0I A;  2HQL A;  1QZG A;  1SBB B;  4ZKB B;  4QGU A;  1QE6 A;  4HCS A;  5IP9 H;  1F2L A;  1Y1V B;  2F3W A;  3QJY A;  2NZH A;  5LMU L;  1SYD A;  1V1O A;  3CCL A;  2JA8 H;  2B2T A;  1NJI C;  4ABN A;  3UDI A;  5K5P A;  4DK3 C;  1J5E Q;  2PI2 A;  2UUB Q;  4BXX H;  2ICI A;  2KCT A;  2CW0 D;  1XXG A;  2R93 B;  4JOI A;  2NBF A;  4U67 3;  1CK1 A;  4RGM A;  3BDL A;  2MFI A;  3D4D A;  4H0L C;  3S2D H;  3SK6 A;  2DNC A;  1PHJ A;  4A3G G;  3STB D;  3GTJ H;  2JN4 A;  3GQB A;  3QG1 A;  1A3V A;  1HA6 A;  4KHP Q;  1I5F A;  4GS3 A;  1U5K A;  3S1Q H;  1SRO A;  4BBR H;  3HKS A;  2EY5 A;  3D31 A;  3WOE A;  4YCU A;  1K0R A;  1I6V C;  3CCS A;  4JI4 L;  1WJJ A;  1WTH A;  4DKA C;  2JYO A;  3CCR A;  3O13 A;  1EYA A;  3CXC A;  4JI6 L;  4BBS G;  2R7Z G;  3OYY A;  2YU9 B;  4DV3 Q;  2I0Q A;  3DEP A;  3RN2 A;  2ZTE A;  3NP8 A;  3CU7 A;  1YHA A;  2Q2H A;  2XRQ D;  1RKN A;  4P71 A;  2A19 A;  1RF2 D;  2JJQ A;  4NDX A;  1MD2 D;  3PIO A;  5KIX A;  4IPH A;  1HTL D;  3J81 j;  1F77 A;  1HFN A;  3OW2 A;  1SFO H;  1NAP A;  3P75 A;  1NUC A;  1WOC A;  4C3J H;  3I4M H;  4MTN A;  2HHH Q;  4GOP B;  4L5R C;  5CR3 A;  3VA7 A;  4DR1 L;  1PH9 A;  4KKU A;  2K50 A;  3HOV B;  3T1Y Q;  4OL7 A;  4P2C B;  1SYG A;  2SDF A;  1SNQ A;  3PF5 A;  1YHB A;  4L5S A;  4L5T A;  3VYR A;  4LW1 A;  2AQ3 B;  3MC0 B;  4IFD G;  1O7Z A;  1JWU D;  4X6A H;  2RKS A;  4A3D G;  3CC2 A;  5KRU A;  1IXR A;  4LF7 L;  3KBX A;  2AQ2 B;  4J6H A;  1PZK D;  3NEL A;  4FF3 A;  4CKE A;  2UXB Q;  2C9O A;  2F0H A;  3VYS A;  1E24 A;  1RDP D;  4O1N A;  5LHY 1;  3RZO B;  1DZ1 A;  4R1J A;  4CBV A;  4XT1 B;  3DLL A;  3TME A;  5E7N A;  1KC8 C;  1C7Y A;  1S5B D;  4A3G B;  3E3X A;  3PGZ A;  1XNQ L;  4A3F H;  3U9O A;  1TWH B;  4IN3 A;  3H0G G;  1TS5 A;  5I6Y A;  2PQA B;  3HOU G;  5C4X H;  1B9N A;  4JI5 Q;  2RF4 A;  3M4O H;  4J1M A;  1B53 A;  4Y7N H;  4DV4 L;  3HOW H;  4FXG C;  4BBS B;  2B2V C;  3HS0 C;  1EWI A;  4BY7 H;  2R7Z B;  4Z9C B;  4GOP A;  1EQR A;  3J80 i;  3OMG A;  2LXJ A;  4O2D A;  5L37 A;  1YJN A;  2ZM6 Q;  1F2Z A;  4FYD A;  4C2M B;  1U4L A;  4G4K A;  3NQT A;  4TRD A;  4DK0 A;  2K5H A;  4GLA C;  3S9W A;  3HOX H;  2A8V A;  1J9O A;  5EJW A;  4KI0 A;  5EKI A;  4A3C H;  2G5D A;  2JXM B;  5FLX E;  3HP3 A;  2HIV A;  3I4O A;  4DV2 Q;  3AU7 A;  2RCF A;  4CDE C;  3R3O A;  2N8N A;  3DEO A;  1PV4 A;  3KFU A;  1FVI A;  4XQQ A;  2LY7 A;  5HUR A;  4OO1 H;  2EZV A;  4A3J H;  5LMN W;  4NXN L;  3CRK C;  3W3A A;  1UNS A;  4DK1 A;  4K0K L;  1WCM H;  4DNI A;  1V8Q A;  2JA7 G;  2L5T A;  1TY0 A;  3QOJ A;  1J6Q A;  4KY7 A;  3AYH B;  1HUN A;  1LTR D;  5JJK A;  4JV5 Q;  1BDO A;  2PMZ E;  1CKO A;  1VQC A;  2NVQ H;  4JVZ A;  5I2Y A;  3QIA A;  4B3S Q;  4DR6 L;  1NSN S;  5E3F A;  2Z9H A;  2PQA A;  4DR4 Q;  2RCN A;  2AHO B;  4JBM A;  3GTP H;  2K04 A;  4AYB G;  2F0K A;  5HGQ A;  1GO3 E;  2WB1 E;  1EY0 A;  1AEX A;  4DV6 L;  3J7Y W;  1CHQ D;  2R7D A;  4E6I A;  2UUC L;  3TP7 A;  1ZEQ X;  5JOB A;  2AMC B;  1E1O A;  1JOQ A;  1RTO A;  2D0O A;  2D9U A;  3LNN A;  5T1I A;  1VDZ A;  1TQO A;  1D5X C;  4LK1 C;  3ZJY C;  2OXP A;  1B3A A;  2ZTC A;  1HNZ Q;  1CM9 A;  1O7L A;  1PFN A;  3BYY B;  4DAY B;  4FF4 A;  2BA0 A;  2UUB L;  1I6H B;  1PXU A;  1F9R A;  3ND8 A;  4DF7 A;  3F2C A;  3HOU B;  3HZX A;  3I91 A;  1L2F A;  4DV1 Q;  1WTO A;  2AKW B;  3BVZ A;  5M5W B;  1X9N A;  3N52 A;  1XPO A;  3A7L A;  3GTO B;  3GTL B;  5EPK A;  1IW7 D;  2XRS D;  4X62 L;  3V2T A;  4KK7 A;  2NUC A;  1SE4 A;  2OTJ A;  3JAM L;  1CI3 M;  1X3Q A;  2EY1 A;  2IX3 A;  4OEL B;  3GV6 A;  4JCV E;  1B2T A;  1TWG B;  1FGU A;  3OMC A;  1VF7 A;  1SAP A;  2I5L X;  1VQI A;  1YNN C;  4B3R L;  5E4X A;  5M5X B;  1G6P A;  4A75 A;  3G4S A;  5LMN L;  1WTQ A;  3SXH A;  4DNT B;  3W2D A;  1U4R A;  1AH9 A;  1K8M A;  4KLK A;  1STH A;  1HNX Q;  2JA7 B;  1YVC A;  2A73 B;  4RHS A;  2JA6 H;  4I7A A;  1ML0 D;  1EIG A;  5JPM C;  5KGU A;  3HFZ B;  4N9T A;  2O5I C;  4DAY A;  1VQF A;  3RD4 A;  2R92 G;  5F2D A;  3K5N A;  2Y0S E;  4JI8 Q;  1Q86 C;  4X3T A;  5C44 G;  3H91 A;  4AYB B;  4HJ7 A;  2O4X A;  4FDB A;  1K73 C;  1KLU D;  2PW7 A;  1PTO D;  4B9W A;  2A6H C;  1GUG A;  1WD0 A;  1QG7 A;  2X6L A;  5HGT A;  2PQE A;  1PRT B;  5LL6 S;  1DOL A;  3DXJ C;  3MA2 B;  5DNF A;  4HIO A;  4A3L G;  2J0T D;  3EQL C;  4LFA Q;  5EPL A;  2V4D A;  4DV0 Q;  3R2T A;  4A3K G;  2EVB A;  5M3F H;  2RHS B;  2CH4 A;  2UXB L;  1O7I A;  4HJ8 A;  2VB2 X;  2WAQ E;  5T1G A;  3TP5 A;  3H09 A;  4QUF A;  1L0Y B;  3PIP 3;  4KKT A;  3FPP A;  4OGQ C;  5IP9 G;  4DPG A;  4CDF C;  5JVG 3;  1UEB A;  1AE2 A;  2IJ0 A;  2Z8L A;  1IL8 A;  4BXX G;  1A2U A;  1IL2 A;  3H3V H;  1GUO A;  3A55 A;  3AQQ A;  1ASZ A;  1DYQ A;  4YIJ A;  3Q24 A;  3ERS X;  4RWS C;  1EZ6 A;  1B8A A;  1GHK A;  2Z4H A;  1QVC A;  1PYB A;  2E2D C;  2IPK D;  2FMC A;  4LF8 Q;  3UDX A;  4ZAI A;  2PNR C;  2ZM6 L;  3S2H H;  4CDD C;  5JEA H;  2EYL A;  3LWU A;  5M5Y B;  3PCO B;  3ER0 A;  2HUG A;  3DM1 A;  4A3E H;  3D3R A;  2E5L Q;  3BU2 A;  2NVT B;  4GKK Q;  1TWF H;  2OQ0 A;  2YTY A;  3K6O A;  1HNW Q;  1NR2 A;  2OEO A;  1U9R A;  1OTC A;  2N3S A;  3GTQ B;  2QF7 A;  1G6Z A;  2R92 B;  1HH2 P;  3BZD B;  3TZU A;  3PO2 H;  5C44 B;  5EPJ A;  2I07 B;  2AQ1 B;  2EDG A;  3KYH C;  1S5F D;  4K2L A;  3J81 c;  1KTK A;  1XTC D;  1A8V A;  2OT2 A;  1CZG A;  4YY3 Q;  5LMU Q;  3S17 B;  3I4M G;  4C3J G;  3J81 E;  1BUV T;  4C3H G;  1SE8 A;  3SR1 A;  5CV5 A;  1L1O B;  2HCI A;  5IWA L;  4NW2 A;  4B3S L;  2Z1C A;  4LNQ A;  4DR4 L;  4EQP A;  4A3K B;  1OXT A;  1JE5 A;  4IQZ A;  2IY5 B;  4FP5 D;  1ILP A;  4RKB A;  4U68 A;  3UE1 A;  5IOC A;  4RHR A;  4MTK A;  2QW7 A;  1Q3L A;  4IFD J;  1LT3 D;  2J4X A;  5DM7 3;  1E22 A;  1CUK A;  4X3S A;  2O2L D;  2O5J C;  3RZD H;  3WOF A;  1KNA A;  2JA9 A;  2E2I H;  1JCK B;  4DN4 M;  3FRP B;  3D6C A;  1X6O A;  1NE3 A;  1IYV A;  4BY1 B;  3EJI A;  3MAQ A;  3PIP A;  4CJ1 B;  4JC0 A;  2GN5 A;  1PYW D;  1VMP A;  1TII D;  3CPW A;  1N32 L;  3S14 B;  2I5H A;  4A3B H;  5KYL A;  1TU2 B;  3K0Y A;  1XX8 A;  4DV1 L;  2ASB A;  1JE4 A;  2KED A;  1GM5 A;  1AFP A;  3S1Q B;  2K1B A;  4R4O A;  1LM0 A;  3FVQ A;  2QA4 A;  1RTN A;  1MIU A;  1Y14 B;  3CRL C;  3K81 C;  2K4K A;  3U58 A;  1V43 A;  2WKD A;  3KF6 B;  2ZXO A;  3M4Y A;  3C1F A;  1NMF A;  1L1O A;  4G57 A;  3R8B A;  1S5D D;  5COR A;  3OTO Q;  1I3Q B;  2F0F A;  1Q82 C;  2MP1 A;  4OWX B;  4LF4 L;  3SHL A;  2EJF C;  3HOX G;  3QOL A;  3MWY W;  1KDA A;  1KNE A;  2CFM A;  4KKS A;  3PF4 A;  4A3C G;  3M7N A;  1HFG A;  2IHE A;  3PSI A;  2BDO A;  1SMY D;  2SOB A;  1K3R A;  4DV7 Q;  1YNJ D;  1M90 C;  4JG2 A;  1CA6 A;  3M7G A;  3I4M B;  2TSS A;  2X69 A;  2VNU D;  2KQ3 A;  4C3H B;  4DUZ L;  3J7A V;  2WV6 D;  3BZK A;  4OO1 G;  2VUM H;  1VQ8 A;  4POG A;  4A3J G;  5FJ8 G;  2F03 A;  4JI8 L;  2K5Q A;  3J80 c;  4HMI A;  4A3I H;  1WCM G;  1XPR A;  2FFK B;  2NVX B;  3MEH A;  4PMC A;  1D5Z C;  4DR2 L;  1YNN D;  5JJI A;  3HRZ C;  4PMW A;  2F52 A;  2ALY B;  1HQR D;  1OXV A;  2BE5 C;  4LFA L;  4EVO A;  4ZRZ A;  4F8M A;  1EY9 A;  5I9P A;  1EWC A;  3KF6 A;  1YHQ A;  4K2K A;  4QUC A;  2HCC A;  2PYK A;  5CC4 A;  4DV4 Q;  1QUQ B;  1M1K C;  4HJ9 A;  2TMP A;  3I70 A;  1SSO A;  1K8G A;  2JSO A;  4C3I H;  4DFA A;  4FXK C;  3A8K E;  3NBH B;  3OIP A;  1CKN B;  3GTK B;  1MBY A;  1QJO A;  1VQP A;  5M3M H;  1JMC A;  5I6W A;  1Q8I A;  4WJ3 M;  3HKZ B;  3TS2 A;  4IUN A;  2H4O A;  3D4R A;  5ISR A;  4OWW B;  3VYT A;  1VQ5 A;  4UP8 A;  1O78 A;  2K5W A;  3R93 A;  4LF8 L;  2BOS A;  2WII B;  4PV1 C;  5I4D A;  1BBU A;  1EU4 A;  4NXN Q;  3I4N H;  2SNM A;  3NTH A;  4ZUJ A;  2K5N A;  3HOX B;  3M4Q A;  3CKI B;  5ELD A;  3AMU A;  2J7Z A;  4C1N K;  2UXD L;  1HXY D;  3UDG A;  4NKL A;  3IFD A;  4IUT A;  1QUQ A;  1V9P A;  1Y8N B;  2JE6 I;  3HOY G;  4IOC A;  3PO3 B;  4QCL A;  3OOC A;  1DGS A;  4A3J B;  5IYD H;  2B63 B;  4IJH A;  1NR4 A;  1HZB A;  2DUD A;  3NBH A;  2IHF A;  3AFQ A;  1ASY A;  1CKN A;  4LMQ D;  3CAM A;  2JA6 G;  4N8X 1;  1II3 A;  1K9M C;  4JI3 L;  1VQH A;  5E1F A;  4YY3 L;  5C4H A;  1HZA A;  3CQZ H;  4MNO A;  3S1R B;  1B7Y B;  2DJG C;  5ELB A;  4DAM A;  1JWM D;  1XNR L;  2E2J B;  1PH3 A;  2DNE A;  1CHP D;  5C3E H;  5KNB A;  1VQ9 A;  3H94 A;  3VDY A;  2NVY H;  4ID6 A;  1RHP A;  1Z9F A;  4HSP A;  2LKV A;  2N88 A;  1VQ6 A;  1KDB A;  2SNS A;  4FF2 A;  1SJE D;  4GNX C;  2QDL A;  4FVM A;  1AE3 A;  1LUZ A;  4CHT B;  4K6D A;  2WKC A;  3J81 i;  5IT9 E;  3HOZ B;  1ICF B;  4X62 Q;  4QMG A;  4ZK9 B;  1I4Q A;  1UAP A;  4ZUI A;  3MTS A;  1XJV A;  3FKI H;  2VS1 A;  3A74 A;  1A15 A;  3KLW A;  1PH7 A;  3G48 A;  5IGG A;  1FD7 D;  4B3R Q;  2Q8R E;  4A3M H;  3W5O A;  1X56 A;  2RDH A;  1GUW A;  2EOT A;  1AW7 A;  5C0X J;  3VR2 A;  2RBM A;  2AWN A;  5LMN Q;  1EOV A;  3M4P A;  3CF5 A;  1O7Y A;  4EGV A;  4OO1 I;  2VQE L;  3KK7 A;  3F2U A;  3RMH A;  1PZJ D;  3A5U A;  1S40 A;  1ICW A;  3K7A H;  2KEN A;  4KN4 C;  1GUS A;  2FMM A;  3ULL A;  4CKC A;  3OTO L;  2KCN A;  3H3V C;  3I7F A;  2CQO A;  3IKJ A;  3HOY B;  1TR5 A;  2OF1 A;  1GJX A;  4K5X A;  1QNU A;  4M8A A;  3AEV A;  1HZC A;  1H9M A;  1LV9 A;  4H02 A;  3CCU A;  1WTP A;  2ZJQ A;  1PDQ A;  3WDN A;  2JA6 B;  4DV7 L;  2L4N A;  3PO2 G;  1JJC B;  1BR9 A;  3T4A C;  1LTG D;  1ZYR C;  1I4X A;  2VB3 X;  4RA8 A;  2NN6 H;  1UE6 A;  2VL6 A;  3TQY A;  5TSS A;  1KAA A;  1PTO B;  1YIJ A;  1E3P A;  1TWA H;  2CQA A;  4POF A;  4GKJ L;  4ME3 A;  4HTH A;  1EEF D;  4RGT A;  3TRE A;  3E6Z X;  4YHH Q;  3I56 A;  1SXT A;  2Q8T A;  1VQO A;  5BN3 A;  3PUV A;  4C56 C;  4GLX A;  4GZY C;  3LGJ A;  3D0F A;  3EN2 A;  1TS2 A;  3FDT A;  4ZLT F;  1W3S A;  4GLV B;  5A2Q E;  2E2H H;  2EYM A;  4MN3 A;  4IPC A;  3EIV A;  1LTS D;  4RH6 A;  3OSO A;  4WRD A;  4IO9 A;  4JYA L;  1JB3 A;  4AIM A;  2WB1 G;  1WTV A;  2A6E D;  1JJG A;  2B29 A;  3SVM A;  1X3G A;  5FLX c;  4UP7 A;  4N8F A;  3X3M A;  2IW3 A;  1D5M C;  4A3B G;  5BR8 L;  4HJ5 A;  3J81 L;  3I90 A;  3F2B A;  2VQF Q;  2BE5 D;  4MHE A;  3G6J B;  2EYJ A;  1BKB A;  1SRU A;  3LX0 A;  4V0B A;  4DGZ A;  3PQI A;  2JA5 H;  4L6T B;  2K6A A;  4FO2 A;  5FLM G;  4DR3 L;  1QVG A;  2A68 C;  4ME5 A;  3CCM A;  2K5V A;  1T5E A;  1EFW A;  2A69 C;  4Q0F A;  5IGF A;  1D6E C;  5JVH 3;  4QY7 A;  4OIK A;  1HZ9 A;  1YNX A;  3NPP A;  4KY5 A;  1A2T A;  1XPU A;  5IWA Q;  1H9R A;  4A3D B;  1DOM A;  1F2Y A;  4XDX A;  1IBM Q;  2AWO A;  3PV0 A;  4AH6 A;  3Q22 A;  1PH5 A;  1Z47 A;  1GHJ A;  3M3Y B;  1X3F A;  2KEE A;  3NWS A;  4B3T Q;  4RKL A;  3GP7 A;  1Y1V H;  3VYU A;  4XT3 B;  4UP9 A;  3NEM A;  1S5C D;  2VUM G;  2E75 C;  2EXD A;  4X64 Q;  4X65 Q;  3KF8 B;  2MPM A;  1NY4 A;  4LF5 L;  2ZXP A;  1GUN A;  1DOK A;  3K5L A;  3H3V I;  3GTG B;  1N32 Q;  3H0G B;  1EYG A;  3KOJ A;  1K83 B;  2AUJ D;  1BNZ A;  2F3V A;  2B39 A;  5FO7 B;  5IGC A;  3U9S A;  2PMZ B;  1KAB A;  3SE0 A;  2NWG A;  4DK6 C;  2OWO A;  3S1M H;  2Y0S G;  3RZD B;  1HJP A;  2FXQ A;  3L2P A;  3NE5 B;  5J1Z A;  4DA2 A;  4JPB W;  1QIL A;  3ERO A;  1A6X A;  2GVA A;  2NZO A;  3EFX D;  4KMU C;  1BQQ T;  2YU9 H;  1JB7 A;  1VQ7 A;  5I9O A;  4A3B B;  1PRT C;  1SJH D;  1VQL A;  1WTR A;  3QB3 A;  4EQ5 A;  5JPN C;  2F1M A;  1NMG A;  4LF4 Q;  3SDZ A;  3BJU A;  1EZ8 A;  2FJ2 A;  3OIQ A;  5G3L F;  2WAQ G;  2L9H A;  1X3E A;  1KDC A;  2MJ8 A;  2XGT A;  4IPG A;  3MXG A;  3J80 L;  3DWP A;  5A35 A;  4RG1 A;  4WFN 3;  2L12 A;  4HMJ A;  4CGY B;  3KF8 A;  1BCP C;  4DUZ Q;  3NEN A;  3S15 H;  2PW5 A;  3CPF A;  3K80 C;  1B50 A;  1G91 A;  3I4N G;  3HOV H;  2K32 A;  4UY8 C;  4AQY Q;  2YYZ A;  3ND9 A;  3H6M A;  4DR2 Q;  4OON A;  3NUC A;  4DNR B;  4P75 A;  4JW0 A;  5D3D A;  2ICE C;  3EVQ A;  4X3K A;  4V19 0;  1STG A;  2PZT A;  2QIL A;  3MXU A;  1GD7 A;  1WFQ A;  5COY A;  1BBX C;  1EL0 A;  5IYD G;  2LSS A;  5IOD A;  2CHB D;  2B2U A;  4K6L A;  1I94 L;  2UU9 Q;  1PVO A;  3E9H A;  3RZO H;  4A76 A;  3TN2 A;  2ATW A;  1P16 A;  3UDF A;  3ONA B;  2JA8 G;  2RA4 A;  2N78 A;  1GVP A;  2BH8 A;  4JI2 Q;  1G51 A;  1SE2 A;  2XIW A;  2E76 C;  4RAU C;  1PFM A;  1WVL A;  1LAC A;  5C3E G;  3A5Z B;  1FR3 A;  2Y0S B;  1YIT A;  2ENB A;  1AZP A;  4M1U B;  1F9Q A;  2Z6K C;  1I4H A;  4YHH L;  1N33 Q;  2M9V A;  1QCB D;  4BBS H;  2R7Z H;  1JOK A;  2B2Y C;  3I55 A;  3CP0 A;  4R4C A;  3K57 A;  4BBR G;  2DN8 A;  4LUV A;  1SNC A;  4C1N I;  3E5S A;  3HG9 A;  4C2M H;  1L1O C;  2XWB B;  4L5Q A;  3NTI A;  3FKI G;  3D4W A;  2EE1 A;  2VXW A;  1SYF A;  2WAQ B;  4X66 L;  2XN9 C;  1IYU A;  2XTI A;  2DY8 A;  2UXD Q;  4Q5V A;  1E0B A;  2BDN A;  1MHW C;  3JC6 6;  4J8Q A;  2F4V L;  5CV8 A;  1KXL A;  4A3M G;  3G7L A;  2R6G A;  2KA7 A;  1TWC B;  2IL8 A;  1VQB A;  2XWJ B;  2VQF L;  1ZXT A;  2KBN A;  1D8L A;  1G29 1;  1QWY A;  3NWT A;  2F0Q A;  4KY6 A;  2MHV A;  3I4N B;  1JWS D;  1D1I A;  4MIU A;  1W6K A;  4JI3 Q;  4JI1 Q;  4JBJ A;  1KRT A;  5KEE A;  1CSQ A;  1R9T H;  1W2B A;  3DM3 A;  1K8O A;  2EJM A;  2I5M X;  2NTT A;  4DAP A;  1VF5 C;  1XNR Q;  4YWK A;  3RLN A;  3STB C;  2V1C C;  1CSP A;  2L11 A;  1NCV A;  2XVS A;  1RJT A;  1NTG A;  1IBM L;  2LS0 1;  1N34 Q;  1Y8P B;  1S5E D;  1VQG A;  3QR8 A;  1PH1 A;  4FXD A;  2QDB A;  2B2W A;  1YJ9 A;  4B3T L;  4FF1 A;  3N6R A;  1E7Z A;  3ZYY X;  2HQE A;  3TP8 A;  2RSN A;  3CD6 A;  2GVB A;  2JA8 B;  3MXP A;  2EY6 A;  4N9P A;  4YCW A;  5AFW A;  1M8A A;  1H95 A;  1WD1 A;  2ZT9 C;  3FEW X;  4X64 L;  4X65 L;  5GAD C;  1LTI D;  4LJZ C;  4WOR A;  1C8C A;  2NVY B;  2NN6 G;  1I6H H;  1AP0 A;  3MZ5 A;  1TXY A;  3HOU H;  3MVV A;  2ZJP A;  5JAV A;  3S2D B;  4A4I A;  4G7Z C;  5DLQ E;  3GTJ B;  1Q46 A;  3E0E A;  3AB9 A;  1DD2 A;  3M85 A;  5M5W H;  4A3F G;  1CTM A;  1KD1 C;  5HY6 A;  3GTO H;  2VY3 A;  4BBR B;  3GTL H;  1YBY A;  2PO4 A;  3S16 H;  4BA2 I;  2BCO A;  4P72 A;  3X3N A;  2VQE Q;  2FIN B;  5C4X G;  3FKI B;  4NP5 A;  1GOZ A;  3HOW G;  4BY7 G;  1TWG H;  3ERQ A;  2EY2 A;  5DAU A;  1H9J A;  4A3M B;  3BYT B;  1C9O A;  4UDU C;  3A56 A;  1ENF A;  1N36 Q;  1Q90 A;  1K28 A;  4G7O C;  1VQD A;  1ESF A;  1GKH A;  1KRS A;  1EIF A;  1LT6 D;  5D65 A;  1A63 A;  4XIG S;  1P8L A;  3P7J A;  4R8N A;  1UE7 A;  3CC7 A;  2F0E A;  2JA7 H;  1SFO B;  3FHW A;  4C3J B;  3VA5 A;  3RN5 A;  1LT4 D;  5KNC A;  2Q2T A;  3U4V A;  3TS0 A;  2B2T C;  4MZ9 A;  1JJ2 A;  2OCE A;  1X32 A;  3OWF A;  4TSS A;  1TT2 A;  3JAM E;  1IZ6 A;  5CV4 A;  3PUW A;  2EYF A;  5GAG C;  4AQY L;  3TBI B;  4QJF A;  1KQS A;  1Q1E A;  3CW2 C;  1PA6 A;  4JOI C;  1UUP A;  3NSW A;  3URY A;  4JI7 L;  3F1Z A;  3KJO A;  2YV5 A;  4GKJ Q;  2K14 A;  1ROD A;  2K7V A;  4H44 C;  3K59 A;  3SK4 A;  1U4P A;  5DEH A;  4ODG A;  3M9B A;  2PI2 E;  3HKZ E;  1E2W A;  2RQX A;  4DV5 Q;  4H7B A;  1EWH A;  2UU9 L;  1IHZ A;  1Y1V G;  3P1H A;  1Q81 C;  1LTL A;  3L3O C;  5FLX L;  1SLJ A;  4QIW E;  4JYA Q;  2DJF C;  3GO5 A;  1TWA B;  4EQO A;  4GN3 B;  4A3F B;  3NTK A;  4JI2 L;  4BS9 A;  1B3Q A;  2A6H D;  3G6E A;  5C4X B;  1ET9 A;  1VQE A;  2A74 C;  5BR8 Q;  3M4O B;  3KBG A;  1N33 L;  4Y7N B;  3HOW B;  1RL2 A;  4BY7 B;  2E2H B;  1LT5 D;  2G9H D;  5C4J H;  1H9S B;  4K8J A;  2NZ1 D;  4NXM Q;  3PUY A;  1KIX A;  3J7A 5;  1Y69 U;  1VQ4 A;  4DR3 Q;  5M5Y H;  5EAY A;  1JC7 A;  3BZC A;  2EYH A;  2KUM A;  2Z6B A;  4QF4 A;  2NVT H;  1EFI D;  1CA5 A;  2QEX A;  1GXD C;  1TKW B;  2L1B A;  4R8I A;  2MO1 A;  2D0P A;  4K5W A;  4LUZ A;  4F88 A;  3GTQ H;  3FMC A;  5ELN A;  3IAY A;  2F0M A;  1IBL L;  5C44 H;  4R4I A;  5CGK A;  4H13 C;  1WCM B;  1PH8 A;  4JI0 Q;  1D7Q A;  2NN6 I;  3TDQ A;  4DXF A;  3EA6 A;  4JI1 L;  1HHV A;  4LUO A;  4IPD A;  2NVQ B;  2E74 C;  1EYC A;  4JBW A;  3CCJ A;  4ZCK A;  4LF5 Q;  3GTP B;  4DR5 L;  1OO9 B;  4A3K H;  4P74 A;  1IW7 C;  2QGQ A;  3V96 A;  3CCQ A;  4DUY L;  4PMB A;  4I65 A;  3TRZ A;  5EKL A;  3GV3 A;  1H9S A;  5IT9 c;  1N34 L;  3CME A;  1Q8K A;  1FNU A;  1EU3 A;  2ZTD A;  2NB0 A;  4OEM B;  4GOP C;  5IE8 A;  1PMR A;  1M4V A;  1SNP A;  5ELC A;  5M3F G;  5CV7 A;  1LTA D;  3HGB A;  3KLS X;  1PYS B;  2L15 A;  4WJW A;  5C0X H;  4IUV A;  4BY1 H;  5C5L A;  3I72 A;  2HIX A;  4RMF A;  4ULL A;  5BN4 A;  4LF6 Q;  3S14 H;  3GTM H;  4BWG B;  4EQN A;  5K36 H;  2UUA Q;  2K05 A;  4F87 A;  1ENA A;  1MSG A;  3K8A A;  4CJ0 B;  4LF9 L;  3T1H L;  3S1M B;  3V05 A;  1CQV A;  1G8Z D;  1STY A;  2EJG C;  5G3L D;  2MGS A;  1I4G A;  4A93 H;  3BVM A;  2MO0 A;  4TQU S;  5I2X A;  1CT1 D;  5ELO A;  3AFP A;  4LFC Q;  3Q0A A;  1JQY D;  1F9P A;  5AJ3 L;  3C2P A;  3TSS A;  3E9I A;  3I4L A;  2EIF A;  1PTO C;  2F0D A;  1XWE A;  1Y8O B;  4I7Z C;  4OX9 L;  3MHB A;  1N9W A;  1I3Q H;  3HEJ A;  5JEA G;  2DGY A;  3MFY A;  3R2I A;  1N36 L;  3ULP A;  3S1N H;  1HR0 W;  4A3E G;  1C4Q A;  1EUJ A;  2K52 A;  3E0J A;  5C4Z A;  4CKB A;  2FHT A;  1Y1W H;  1ET6 A;  5C5M A;  1EY6 A;  3MFG A;  4GNX B;  3PUX A;  1VQM A;  4C3H H;  3S15 B;  3BDO A;  2WIN B;  2KVM A;  5GAE C;  3WWV A;  1PFS A;  1STE A;  3NXW A;  1YJW A;  1I94 Q;  1JIC A;  1KLG D;  3K5M A;  1CQF A;  2NVX H;  2N55 A;  1QZH A;  4APV A;  3K7U C;  1PRT F;  1EIY B;  5ELF A;  1DCZ A;  2QKI C;  4KJN A;  1XMQ L;  3I8Z A;  2JQO A;  1K3B C;  2CVR A;  3TEH B;  1EY5 A;  2EYO A;  1HQM C;  1SE3 A;  1STB A;  2C5C A;  1IBK L;  2ES2 A;  2LMC B;  1QB5 D;  2F0V A;  4GN5 A;  5M3F B;  3RUZ A;  3JAM i;  1SEB D;  3QWN A;  2ZXR A;  1KHI A;  1BO0 A;  4B08 A;  4R4T A;  5C3X A;  3KDF B;  3DHQ A;  1BCP F;  5KND A;  4DV5 L;  2F4I A;  1PH6 A;  3GTK H;  3CC4 A;  3C46 A;  3Q23 A;  1S72 A;  4FNF A;  3CHB D;  4J15 A;  4X66 Q;  3P20 A;  5C6A A;  1RIP A;  1WI5 A;  4XXE A;  1XMO Q;  4GNX A;  2JP1 A;  1QOH A;  2F4V Q;  3KLR A;  3VR3 A;  4NB3 A;  5IYC H;  3OW7 A;  2HDL A;  2F0L A;  1HTP A;  3F8T A;  1EQT A;  2GA4 B;  1MGS A;  4LFB Q;  4NXM L;  1JR0 D;  3S2H B;  2WP8 J;  1I50 H;  1HR0 L;  3K0X A;  1UE5 A;  4B3M L;  1GUT A;  2K28 A;  4UAI A;  2CWA A;  3UE0 A;  4A3E B;  3A8I E;  3U4Z A;  2KEC A;  3SK5 A;  1TWF B;  1N8R C;  2RHQ B;  4L63 B;  4GN4 B;  2M00 A;  2ID0 A;  4NPS A;  1Q12 A;  3SEB A;  3KUP A;  1IYJ B;  4PG3 A;  1VQA A;  5J3B A;  1X54 A;  2I46 A;  4KD3 A;  3PO3 H;  3FPU B;  3PO2 B;  5EQ0 A;  3SGI A;  2B63 H;  5FJ8 H;  3KDF A;  3L9A X;  4TVA B;  5IP7 H;  5IGB A;  4HIM A;  3T13 A;  2VZA A;  4CJ2 C;  2B2U C;  2CWP A;  2RSO A;  4KV6 A;  1R9T B;  2VW9 A;  1HCZ A;  4CDC C;  4JI0 L;  4IUQ A;  3TZD A;  3S1R H;  4HIK A;  3A8J E;  2E2J H;  1XYI A;  1WYD A;  4KTA A;  2KHJ A;  5IGD A;  2M2L A; 
#chains in the Genus database with same CATH homology
 2UXD Q;  2R93 H;  4A3I G;  5JJI A;  4PMW A;  4P71 A;  2A19 A;  2JJQ A;  2F52 A;  3JC6 6;  2ALY B;  2JEB I;  1FL0 A;  1K8A C;  2F4V L;  1KXL A;  2B3G A;  4A3M G;  3PIO A;  2R6G A;  1OXV A;  4LFA L;  4IPH A;  1VQB A;  2OQK A;  2VQF L;  1YHQ A;  3KF6 A;  3J81 j;  3HOZ H;  2KBN A;  2MNA A;  1D8L A;  1G29 1;  1QUQ B;  4DV4 Q;  1M1K C;  3OW2 A;  4HJ9 A;  1SFO H;  4WJ4 A;  3W1B A;  1K8G A;  1B70 B;  4C3I H;  1WOC A;  4C3J H;  3I4M H;  4MTN A;  2HHH Q;  4GOP B;  1J5E L;  4L5R C;  1OXS C;  3NBH B;  1CKN B;  4DR1 L;  1PH9 A;  2CKZ B;  2KCM A;  4JBJ A;  1KRT A;  2K50 A;  4JI1 Q;  4JI3 Q;  1CSQ A;  3GDE A;  1LYL A;  1R9T H;  3S24 A;  2IX0 A;  3T1Y Q;  1W2B A;  3DM3 A;  2I5M X;  5IYB H;  1VQK A;  1XNR Q;  1VQP A;  5M3M H;  4YWK A;  3RLN A;  4LF6 L;  3STB C;  1JMC A;  2V1C C;  1CSP A;  3PF5 A;  1YHB A;  5JJL A;  4WJ3 M;  1X65 A;  2UUA L;  4L5T A;  4L5S A;  3TS2 A;  4LW1 A;  1MJE A;  3PUZ A;  1E1T A;  3W1G A;  4KHP L;  5M3M G;  4IFD G;  1NTG A;  1IBM L;  4X6A H;  1N34 Q;  4A3D G;  3CC2 A;  5GQO A;  1IXR A;  1VQG A;  4LF7 L;  4OWW B;  2N49 A;  1VQ5 A;  4LWC A;  3NEL A;  4UP8 A;  1PH1 A;  4AYB E;  2UXB Q;  1S3O A;  1YJ9 A;  4B3T L;  1E7Z A;  4O0A A;  3U50 C;  4LF8 L;  1U0L A;  3CD6 A;  2GVB A;  4LFC L;  1E24 A;  1BBU A;  4DV3 L;  4NXN Q;  4YCW A;  3I4N H;  4R1J A;  1H95 A;  1Q1B A;  2K5N A;  3DLL A;  2BH2 A;  2K75 A;  3M4Q A;  5E7N A;  4X64 L;  4X65 L;  5GAD C;  1KC8 C;  4BBS G;  1C7Y A;  4DR7 Q;  4IFD I;  2NN6 G;  1I6H H;  2UXD L;  3PGZ A;  1TXY A;  3HOU H;  1XNQ L;  4A3F H;  2ZJP A;  3UDG A;  1X55 A;  3HOY H;  4A4I A;  5DLQ E;  3H0G G;  1Q46 A;  3E0E A;  2UXC Q;  1FJG Q;  4JI7 Q;  2PQA B;  3M85 A;  1QUQ A;  3HOU G;  3B6Y A;  1V9P A;  5C4X H;  5M5W H;  4A3F G;  2JE6 I;  1KD1 C;  2RF4 A;  5HY6 A;  4JI5 Q;  2VY3 A;  4IOC A;  3GTO H;  3GTL H;  3HOY G;  4Y7N H;  4DV4 L;  1YBY A;  3HOW H;  1DGS A;  3S16 H;  5IYD H;  4BA2 I;  1EWI A;  4BY7 H;  4GOP A;  4IJH A;  4P72 A;  1EQR A;  1HZB A;  2DUD A;  2IHF A;  2YTV A;  2LXK A;  3AFQ A;  1CKN A;  3J80 i;  3CAM A;  2VQE Q;  2HHH L;  2LXJ A;  5C4X G;  4O2D A;  2JA6 G;  3HOW G;  1YJN A;  2ZM6 Q;  1K9M C;  4JI3 L;  1VQH A;  4BY7 G;  4YY3 L;  1HZA A;  3CQZ H;  4MNO A;  3T1Y L;  1B7Y B;  1TWG H;  4DAM A;  1XNR L;  2K5H A;  4GLA C;  1PH3 A;  2A1A A;  3HOX H;  2A8V A;  1C9O A;  5C3E H;  1VQ9 A;  4KI0 A;  1MKH A;  3VDY A;  4YWL A;  2NVY H;  4EX5 A;  1N36 Q;  1Z9F A;  1YZ6 A;  3CCV A;  1VQ6 A;  4A3C H;  4A3G H;  1VQD A;  2CCZ A;  2HIV A;  3F2D A;  1TWH H;  1GKH A;  3I4O A;  1KRS A;  4DV2 Q;  1EIF A;  4GNX C;  2IX1 A;  1AE3 A;  1A63 A;  1LUZ A;  4KHZ A;  4XIG S;  3J81 i;  2N8N A;  2BA1 A;  1P8L A;  5GAH C;  1PV4 A;  3KFU A;  1UE7 A;  3CC7 A;  1JT8 A;  2JA7 H;  1FVI A;  4X62 Q;  4BA1 I;  1BVS A;  3FHW A;  4A3J H;  3KJP A;  5LMN W;  1PH2 A;  4NXN L;  3RN5 A;  2Q2T A;  3U4V A;  3TS0 A;  1XJV A;  4K0K L;  3FKI H;  1WCM H;  4DNI A;  2JA7 G;  3GD7 A;  2VS1 A;  1J6Q A;  3A74 A;  3AYH B;  4MZ9 A;  5JJK A;  1JJ2 A;  2OCE A;  4JV5 Q;  5IY0 A;  3KLW A;  2PMZ E;  1CKO A;  1EQQ A;  1PH7 A;  1VQC A;  2H5X A;  3G48 A;  1IZ6 A;  5C0X G;  2NVQ H;  4BY1 G;  3CCE A;  1SMX A;  4B3S Q;  3CMA A;  4DR6 L;  1XTD A;  3PUW A;  4B3R Q;  5GAG C;  4AQY L;  1OXX K;  4QJF A;  4DR4 Q;  2PQA A;  1KQS A;  1Q1E A;  3CW2 C;  2RCN A;  2AHO B;  4JOI C;  4A3M H;  1PA6 A;  4JBM A;  3GTP H;  4AYB G;  3W5O A;  1X56 A;  4JI7 L;  5HGQ A;  3F1Z A;  1GO3 E;  5C0X J;  3KJO A;  1XMO L;  4JI5 L;  5K36 G;  2YV5 A;  4GKJ Q;  2AWN A;  2WB1 E;  5LMN Q;  2K14 A;  4DV6 L;  1EOV A;  3M4P A;  2R7D A;  3RLO A;  3CF5 A;  1QVF A;  2UUC L;  4OO1 I;  2VQE L;  1SR3 A;  2AMC B;  2JK8 A;  1E1O A;  4IJL A;  3A5U A;  1S40 A;  3M9B A;  4LFB L;  1KL9 A;  2PI2 E;  2D0O A;  1IBL Q;  3HKZ E;  3K7A H;  2KEN A;  4QQB X;  4A93 G;  3ZJY C;  4DV5 Q;  4QL5 A;  2UU9 L;  2ZTC A;  1Y1V G;  1Q81 C;  3ULL A;  1LTL A;  1HNZ Q;  4DAY B;  1SLJ A;  2BA0 A;  4QIW E;  3OTO L;  2UUB L;  4JYA Q;  4Y52 H;  3GO5 A;  3I7F A;  3F2C A;  2CQO A;  4GN3 B;  4JI2 L;  1L2F A;  3AEV A;  4DV1 Q;  1HZC A;  5JEA J;  5H1S E;  4A3D H;  1Q7Y C;  4DV2 L;  4DR5 Q;  2AKW B;  3G6E A;  1X9N A;  1VQE A;  1XPO A;  4H02 A;  5BR8 Q;  4DUY Q;  3CCU A;  2OTL A;  2ZJQ A;  1N33 L;  1RL2 A;  4DV7 L;  4X62 L;  1Y1W G;  3M3Y H;  5C4J H;  3MXN B;  4JBK A;  2OTJ A;  4NXM Q;  3PO2 G;  1JJC B;  3PUY A;  1KIX A;  3J7A 5;  1VQ4 A;  4DR3 Q;  4JCV E;  4JV5 L;  5M5Y H;  1FGU A;  4HID A;  5EAY A;  1VS0 A;  1PVO A;  1UE6 A;  2I5L X;  2D62 A;  4B3R L;  1VQI A;  2VL6 A;  3TQY A;  3BZC A;  4YCV A;  1UWV A;  3GTG H;  3H0G H;  4HJA A;  1YIJ A;  2NVT H;  1E3P A;  2QEX A;  1G6P A;  1TWA H;  4A75 A;  4POF A;  4GKJ L;  4ME3 A;  3G4S A;  5LMN L;  1K83 H;  5GRO A;  2WFW A;  4OWT B;  4LF9 Q;  2MO1 A;  2D0P A;  3TRE A;  4YHH Q;  2KHI A;  3I56 A;  3T1H Q;  3GTQ H;  4LUZ A;  1AH9 A;  1VQO A;  1C0A A;  3PUV A;  4KLK A;  5ELN A;  4GLX A;  1HNX Q;  1A62 A;  1YVC A;  3LGJ A;  1IBL L;  3D0F A;  3EN2 A;  2JA6 H;  5C44 H;  4R4I A;  2Q2U A;  1W3S A;  3HFZ B;  4GLV B;  4JI4 Q;  2E2H H;  1VQF A;  1HNZ L;  4JI6 Q;  1PH8 A;  2R92 G;  4IPC A;  3EIV A;  4JI0 Q;  2Y0S E;  4JI8 Q;  1Q86 C;  1D7Q A;  2NN6 I;  5AJ3 Q;  5C44 G;  4JI1 L;  1V1Q A;  2E8G A;  4PZ8 A;  4IO9 A;  4AIM A;  4LUO A;  4JYA L;  4IPD A;  4HJ7 A;  4JBW A;  4FDB A;  3CCJ A;  1K73 C;  2WB1 G;  4OX9 Q;  4PZ7 A;  4LF5 Q;  3ICE A;  1JJG A;  2B29 A;  1X3G A;  1MJC A;  5FLX c;  4DR5 L;  4UP7 A;  4A3K H;  4P74 A;  2QGQ A;  1VQJ A;  4HIO A;  4A3B G;  2Z6K A;  4PZ6 A;  5M5X H;  5BR8 L;  3CCQ A;  4DUY L;  4HJ5 A;  4A3L G;  4LFA Q;  3TRZ A;  1CKM A;  3HKZ G;  1N34 L;  3F2B A;  5IT9 c;  5FLM H;  3CME A;  4DV0 Q;  4A3K G;  2VQF Q;  1Q8K A;  5M3F H;  2IT1 A;  2RHS B;  1BKB A;  1SRU A;  5IYC G;  1O7I A;  2UXB L;  2ZTD A;  2JA5 H;  4HJ8 A;  2WAQ E;  3ULJ A;  4GOP C;  5IE8 A;  5FLM G;  4DR3 L;  3J7Z C;  1QVG A;  3CCM A;  3MEF A;  5IP9 G;  2MQH A;  5M3F G;  4DPG A;  2Q2I A;  1PYS B;  2K5V A;  2L15 A;  1UEB A;  1AE2 A;  4DR1 Q;  2JA5 G;  2EQS A;  3RR5 A;  4BY1 H;  1EFW A;  3JAM c;  2Z0S A;  4DR7 L;  2HIX A;  2KHJ A;  4RMF A;  1NBW A;  4QY7 A;  4LF6 Q;  1HZ9 A;  4R4Q A;  1YNX A;  3S14 H;  3GTM H;  4BXX G;  1IL2 A;  3L7Z C;  1XPU A;  3H3V H;  4UPA A;  2JEA I;  5IWA Q;  1OXU A;  3AQQ A;  1XMQ Q;  1ASZ A;  2UUA Q;  3K8A A;  2ZJR A;  4LF9 L;  3ERS X;  2YTX A;  3T1H L;  1B8A A;  1FJG L;  1IBM Q;  2AWO A;  3PV0 A;  2PNH A;  1QVC A;  2UXC L;  4LF7 Q;  4AH6 A;  1PYB A;  1HNX L;  1ASY A;  1IBK Q;  3IRB A;  1PH5 A;  1Z47 A;  1X3F A;  4B3T Q;  3RLF A;  1PH4 A;  4LF8 Q;  3UDX A;  3PO3 G;  4A93 H;  2MO0 A;  4TQU S;  1SN8 A;  1Y1V H;  5ELO A;  3AFP A;  4LFC Q;  2B63 G;  5IP7 G;  5AJ3 L;  4UP9 A;  3I2Z A;  3NEM A;  2ZM6 L;  2HT1 A;  3E9I A;  3S2H H;  5C0X I;  2EIF A;  3M4O H;  3PCO B;  3ER0 A;  2EXD A;  2VUM G;  4X64 Q;  4X65 Q;  2R7F A;  3KF8 B;  4OX9 L;  4YWM A;  4A3E H;  1NY4 A;  4LF5 L;  1N9W A;  1I3Q H;  5JEA G;  2E5L Q;  2DGY A;  3H3V I;  1A0I A;  3BU2 A;  1XNQ Q;  1N32 Q;  4GKK Q;  1TWF H;  2OQ0 A;  3G71 A;  3ULP A;  1N36 L;  2YTY A;  1EYG A;  1HR0 W;  3S1N H;  1HNW Q;  4A3E G;  3KOJ A;  1EUJ A;  2K52 A;  1OTC A;  2R93 G;  4DV0 L;  3FP9 A;  1Y1W H;  2N3S A;  4DK6 C;  2OWO A;  3S1M H;  1HH2 P;  4GNX B;  2Y0S G;  3L0O A;  3PO2 H;  1HJP A;  1L0W A;  2FXQ A;  3L2P A;  3PUX A;  1VQM A;  4OXP A;  3KYH C;  3J81 c;  4C3H H;  2GVA A;  2NZO A;  1YI2 A;  3HOZ G;  5GAE C;  1A8V A;  3WWV A;  3A0J A;  4YY3 Q;  1PFS A;  5LMU Q;  1YJW A;  3I4M G;  1I94 Q;  2YU9 H;  1HR0 Q;  1SE8 A;  1VCI A;  1YEZ A;  4B3M Q;  2NVX H;  1JB7 A;  1VQ7 A;  1QZH A;  4APV A;  3K7U C;  1EIY B;  1L1O B;  1VQL A;  5IWA L;  3Q8D A;  1UE1 A;  1XMQ L;  4B3S L;  4LNQ A;  2JQO A;  4EQ5 A;  4DR4 L;  2C35 B;  3TEH B;  5IYB G;  1NMG A;  1OXT A;  1JE5 A;  4LF4 Q;  2IY5 B;  3BJU A;  1BBW A;  2WAQ G;  1X3E A;  3UE1 A;  1IBK L;  2ES2 A;  1TWC H;  4GN5 A;  2XGT A;  4IOA A;  3EBE A;  4IFD J;  4IPG A;  4ALP A;  1E22 A;  1CUK A;  3JAM i;  2R92 H;  1KHI A;  1VQN A;  3RZD H;  2E2I H;  2JA9 A;  4RG1 A;  4R4T A;  3RNU A;  4K0K Q;  4DV5 L;  3KDF B;  4DUZ Q;  3NEN A;  3S15 H;  1X6O A;  1NE3 A;  1PH6 A;  2F3I A;  3GTK H;  3CC4 A;  3CPF A;  3K80 C;  3PIP A;  3I4N G;  3S17 H;  1S72 A;  2E5L L;  3HOV H;  4JC0 A;  2GN5 A;  3CPW A;  4UY8 C;  1N32 L;  4P73 A;  1KAW A;  4DR6 Q;  4GKK L;  2I5H A;  4J15 A;  4AQY Q;  2YYZ A;  4X66 Q;  1HNW L;  4A3B H;  1RIP A;  4DR2 Q;  4A3L H;  1WI5 A;  3HOV G;  4OON A;  4DV1 L;  2ASB A;  3H15 A;  1XMO Q;  4GNX A;  1GM5 A;  4R4O A;  1T9H A;  4P75 A;  2F4V Q;  4XTC S;  1LM0 A;  4NB3 A;  5IYC H;  4DV6 Q;  2QA4 A;  2UUC Q;  2HQL A;  1QZG A;  1GD7 A;  3F8T A;  1MIU A;  1WFQ A;  4QGU A;  1Y14 B;  3K81 C;  3U58 A;  2K4K A;  5IP9 H;  4LFB Q;  5IYD G;  2LSS A;  4NXM L;  2NZH A;  5LMU L;  1V43 A;  3KF6 B;  3CCL A;  2JA8 H;  1I94 L;  1NJI C;  2WP8 J;  1I50 H;  3UDI A;  3E9H A;  1HR0 L;  2UU9 Q;  4A76 A;  3RZO H;  1NMF A;  3K0X A;  1UE5 A;  4DK3 C;  1J5E Q;  4B3M L;  1L1O A;  2PI2 A;  2ATW A;  1P16 A;  3UDF A;  2CWA A;  3UE0 A;  3OTO Q;  2UUB Q;  4BXX H;  2JA8 G;  2KCT A;  3U4Z A;  2N78 A;  1GVP A;  2BH8 A;  1Q82 C;  4JOI A;  4JI2 Q;  4OWX B;  1G51 A;  4LF4 L;  1N8R C;  3HOX G;  2RHQ B;  4GN4 B;  2MFI A;  2ID0 A;  3A5Z B;  4NPS A;  1Q12 A;  2CFM A;  5C3E G;  3S2D H;  1IYJ B;  3PF4 A;  1PHJ A;  4A3C G;  4PG3 A;  1VQA A;  5J3B A;  1X54 A;  3STB D;  3GTJ H;  1YIT A;  2IHE A;  3PSI A;  3M7N A;  4A3G G;  2Z6K C;  1N33 Q;  4KHP Q;  1I5F A;  4GS3 A;  4YHH L;  1U5K A;  1K3R A;  4DV7 Q;  1SRO A;  1M90 C;  4JG2 A;  4BBR H;  3PO3 H;  3HKS A;  3S1Q H;  4BBS H;  3D31 A;  3SGI A;  5FJ8 H;  3KDF A;  4TVA B;  4YCU A;  1K0R A;  5IP7 H;  2B63 H;  3CCS A;  2R7Z H;  3I55 A;  2VNU D;  3CP0 A;  4HIM A;  4R4C A;  4JI4 L;  4DUZ L;  2VZA A;  1WJJ A;  3BZK A;  4BBR G;  4OO1 G;  4DKA C;  3CCR A;  2CWP A;  3CXC A;  4LUV A;  1VQ8 A;  4A3J G;  2VW9 A;  4JI6 L;  4POG A;  4JI0 L;  2VUM H;  3OYY A;  5FJ8 G;  4JI8 L;  2R7Z G;  4C2M H;  3S1R H;  1L1O C;  4DV3 Q;  2I0Q A;  4L5Q A;  3J80 c;  3RN2 A;  2ZTE A;  3FKI G;  1WCM G;  4HIK A;  4A3I H;  1XPR A;  2E2J H;  4X66 L;  1WYD A;  1YHA A;  2Q2H A;  4DR2 L;  2XTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...