4B3TQ

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3tQ00
3OYYA 1YHBA 3PUYA 4KHPL 3CXCA 5GROA 1Y1VG 4BBRH 2R93G 2NZOA 3S1NH 1VQBA 4AIMA 2PNHA 2OQ0A 4C3JH 4HIDA 1H95A 4A3GH 4A3KG 4R4IA 1Q8KA 2WP8J 4GKKQ 1KXLA 4IPHA 4EX5A 4GKKL 1KHIA 1LM0A 2K4KA 2K14A 3K80C 4UP7A 3A74A 5J3BA 5IYBG 3S1RH 1PA6A 1CKNB 4AYBE 2GVBA 1VQMA 1IBMQ 4BY1H 1VQ8A 1IBML 1QVFA 4Y7NH 4JC0A 3F2BA 5C4XG 1QUQA 5M5XH 3Q8DA 5LMNW 2F52A 2K5HA 2OCEA 2Z0SA 3E9IA 3S1QH 1D8LA 4JOIA 2CCZA 3TRZA 2OTJA 5GAGC 1LUZA 2GN5A 2KBNA 2PI2A 2QEXA 1Y1WG 3CCVA 1PH1A 3I4MH 3HKZE 2YV5A 1DGSA 3G4SA 2RF4A 1HZAA 1SR3A 4YWMA 4A3JG 5DLQE 1UE6A 5FLMH 3JAMi 3HOUG 5ELOA 3TS2A 3J81j 1I50H 2Y0SG 2Z6KA 2ES2A 4GLAC 5JEAG 2H5XA 1EIFA 1PYSB 3RLOA 1JMCA 1BBWA 1SRUA 1VCIA 2HQLA 4PZ7A 2AHOB 4O2DA 1GVPA 3PO3G 3NBHB 1X3GA 2BH8A 4LF7Q 4A3MH 1PH2A 4A3IG 4LF7L 1OTCA 2E5LQ 4A3BG 4KI0A 2E5LL 1GD7A 2XTIA 4P72A 2VY3A 2V1CC 1W3SA 1TXYA 3GO5A 3HOYG 1P16A 1VS0A 3BU2A 4LUOA 1BKBA 1CKNA 4TQUS 2CWAA 2HIXA 4DR7Q 4DR7L 1EYGA 4BA2I 3ZJYC 3CW2C 3RN2A 2VL6A 2KCTA 4RG1A 1E7ZA 2ZJRA 3AYHB 3T1YQ 4DV3Q 2CWPA 3T1YL 1VQ4A 4DV3L 1VQPA 1E22A 4BXXH 2IHEA 4K0KL 1UE5A 1WCMH 4JOIC 1FJGQ 1NMFA 1FJGL 2ZTCA 1PH4A 4JI6Q 4DV2Q 3CD6A 4JI6L 4A3DH 4GNXC 4NXNQ 3M3YH 3KOJA 4NXNL 3NELA 5HY6A 4A3CG 3K8AA 5LMNQ 1VQIA 2OTLA 5LMNL 1S40A 3PV0A 4ME3A 1R9TH 1SFOH 4R4CA 3F8TA 4UPAA 1KAWA 1ASYA 2JA6G 3TQYA 5JEAJ 2JE6I 2Q2HA 3GTPH 2LSSA 1VQNA 5IYCG 3J7ZC 3CC4A 1XPUA 1D7QA 1CSQA 1A63A 4LF5Q 1TWGH 2JA5H 4LF5L 2VQEQ 3CCUA 4OWWB 1N34Q 2VQEL 1YEZA 2ZTDA 1Q12A 4HJ7A 3FKIH 1N34L 2Q2IA 1VQ5A 4DAMA 3L2PA 1IL2A 1SLJA 3SGIA 1UE1A 1UE7A 1GKHA 3RR5A 3HOWG 5M3MG 2ALYB 5LMUQ 1VQKA 5LMUL 2JA8G 1V43A 3UE1A 1K9MC 1SN8A 5C44G 4JI0Q 3H3VI 1VQAA 5C3EH 5M3FH 3BJUA 4JI0L 2Y0SE 4B3TQ 3S24A 2MO0A 2VZAA 3KDFB 3U50C 5IP7G 1VQLA 4B3TL 1BVSA 3AEVA 1TWCH 4A3GG 4A93H 3CC2A 4KLKA 1OXXK 4J15A 1P8LA 2I5LX 4IPCA 5M5WH 4IOCA 1TWHH 1YI2A 2R92G 2K52A 1Q81C 4LFBQ 4LFBL 1IZ6A 3D31A 4LFAQ 4GLXA 4LFCQ 2IY5B 2K50A 4LFCL 1YVCA 4LFAL 1X3EA 2AMCB 1Q86C 3L7ZC 3OTOQ 1O7IA 1HNXQ 1PV4A 1GM5A 1HNZQ 1HNXL 2JQOA 2RCNA 4DR1Q 1HNZL 4NB3A 4DR1L 4MNOA 4YHHQ 4AQYQ 1XJVA 3I4MG 3W1GA 4YHHL 4AQYL 3CCMA 3IRBA 3CPWA 3CCRA 2IX0A 3TS0A 1PYBA 2CFMA 4QY7A 3GDEA 5GADC 2KENA 2ASBA 2VUMH 1N32Q 2HIVA 3PUVA 1OXUA 1L1OB 1QZGA 3E0EA 1J5EQ 2HT1A 2FXQA 4OWXB 1Q1BA 1VQHA 2E8GA 3UDFA 5FJ8G 3CCQA 5M5YH 1J5EL 3S16H 3KJOA 3D0FA 1L0WA 1M90C 1Z9FA 2AWOA 2PMZE 4JBWA 2R92H 3S2HH 2DGYA 3UDIA 4A3MG 1N33Q 1N33L 2N78A 3W1BA 4R1JA 3AQQA 4X62Q 2NN6G 2D0OA 3KJPA 1IBLL 1IBLQ 5EAYA 4X62L 3KDFA 4DV5Q 2R7ZH 3PGZA 1AE2A 1RIPA 4DV5L 3STBD 4IJHA 4UY8C 2VNUD 3CAMA 4C3IH 2E2HH 2VW9A 4KHZA 3F2DA 3KFUA 2ZTEA 2R7DA 4GN3B 3PF4A 2MQHA 2ZJPA 3JC66 3JAMc 3GTQH 1VQGA 2AWNA 4A3FH 3VDYA 4LF9Q 2N3SA 4JI1Q 4LF9L 1HZ9A 4JI1L 4LUZA 3K7UC 4GN5A 2F4VQ 2B63H 1WCMG 3CC7A 1HH2P 5IE8A 2NVXH 2F4VL 1M1KC 2JJQA 3PUWA 2YTYA 2N8NA 3AFQA 4LNQA 4DUYQ 3J7A5 3M4OH 4A3DG 3U4VA 4B3SQ 3UDXA 4DUYL 4P71A 1EOVA 3J80i 3J80c 1YJ9A 1IBKQ 3M9BA 4DKAC 2ATWA 5HGQA 4BBSH 3H15A 1IBKL 3GTMH 3MEFA 1MIUA 3A5UA 2YU9H 2YYZA 4JBKA 4JYAQ 1L1OA 3TREA 4JBMA 4JYAL 1OXSC 3HKSA 1PH5A 3RNUA 1GO3E 3STBC 4B3RQ 4MTNA 5H1SE 1U0LA 4B3RL 4DR4Q 4PZ6A 1YITA 1WOCA 2E2JH 4DR4L 3ULPA 4MZ9A 4L5QA 4HJ8A 3CQZH 4GKJQ 1C9OA 3I4NH 3F1ZA 1VQ7A 4GKJL 5ELNA 5JJIA 3RLFA 4OONA 2KHIA 3EIVA 2EQSA 5IYBH 3S15H 1EQRA 4A4IA 4JI7Q 3H0GH 4JI7L 1S72A 1KIXA 4DV4Q 1EQQA 1I6HH 2DUDA 5C4XH 4LF4Q 4DV4L 1KRTA 4DV2L 1VQ6A 4LF4L 3DM3A 3NEMA 1X9NA 2BA1A 4DV0Q 4POGA 1LYLA 2Z6KC 2C35B 4DV0L 3RZDH 4X65Q 1YJNA 2NN6I 1B7YB 3RZOH 4DR3Q 3RN5A 1NY4A 1KL9A 2LXJA 3FHWA 4X65L 5C3EG 3ERSX 5M3FG 4DUZQ 1V1QA 2KHJA 2WB1G 2WFWA 4LWCA 3HOXG 4DUZL 4A3JH 1HR0W 1PVOA 5GAHC 3G6EA 1WI5A 3GTJH 3KYHC 2OWOA 1NE3A 4GOPB 4IO9A 1KC8C 4TVAB 3S2DH 3WWVA 5FLXc 2NVTH 1IXRA 3G48A 1G51A 5IYDG 1VQ9A 1ASZA 1YJWA 1JJGA 2JA7G 4IPDA 2N49A 1TWFH 4P74A 4L5RC 3AFPA 4IPGA 1XMOQ 1XMOL 4XIGS 4RMFA 1X56A 1N36Q 1N36L 1K8AC 1T9HA 2VQFQ 1C7YA 1AH9A 3MXNB 2VQFL 4IOAA 1UWVA 4A76A 3T1HQ 1C0AA 2JEAI 3T1HL 1PH7A 3HOVH 3PF5A 3HOYH 1E1TA 1YNXA 2VUMG 4C2MH 4JI5Q 4BBRG 3PO2H 5E7NA 4JI5L 3KLWA 2UXDQ 1CSPA 3CCSA 2UXDL 1I3QH 3PCOB 4O0AA 4DAYB 4HIOA 3W5OA 4QGUA 5GQOA 1XPRA 1LTLA 1VQFA 1JE5A 3ULJA 4BY1G 4OO1G 1CKMA 4OXPA 3CP0A 2UUBQ 4IFDG 2B3GA 2UUBL 1QVGA 1EUJA 3FP9A 3U4ZA 3GTGH 1CUKA 1KQSA 1L2FA 4GS3A 3CCEA 2KCMA 4GOPA 1EWIA 3OTOL 4X64Q 2ZJQA 1MJCA 3GD7A 4JG2A 4X64L 1TWAH 4YCUA 1RL2A 1HNWQ 1XNRQ 1Q7YC 2JA6H 1BBUA 1WFQA 3PUZA 1XNRL 2A19A 4JI8Q 5FLMG 3GTOH 1JJ2A 4JI8L 3M85A 4A3FG 1N32L 3S17H 4P75A 1YHAA 1K83H 1Y14B 4IJLA 5IYCH 4X6AH 4HIMA 4NPSA 1B8AA 4DK6C 2K5VA 2B63G 3U58A 1I94Q 1I94L 3PUXA 2UUAQ 2MNAA 1YZ6A 2UUAL 2I5MX 3B6YA 2BH2A 1X54A 2B29A 3GTKH 4EQ5A 4POFA 5IY0A 1NTGA 4C3HH 5JJKA 4JI3Q 3HOWH 1HZBA 4JI3L 2K75A 5M3MH 2JA8H 4DR6Q 3CCLA 4HJ9A 4DR6L 3KF6B 2WB1E 4DR2Q 1E3PA 5C44H 4DR2L 4A3LH 1B70B 1HJPA 2NVYH 1N9WA 2EIFA 5IP7H 3I4NG 1WYDA 3I2ZA 1KRSA 4A3EH 3ER0A 1YIJA 4P73A 4IFDJ 3TEHB 4GOPC 4BXXG 3I56A 3H0GG 3S1MH 2ZM6Q 2ZM6L 1X55A 3I4OA 1X6OA 1FL0A 3NENA 1VQOA 3ICEA 2A1AA 3KF8B 1QZHA 4DNIA 1SMXA 1SE8A 4R4QA 3CMEA 2I0QA 4B3SL 4LF6Q 4LF6L 4OO1I 4OX9Q 2I5HA 4IFDI 4L5TA 1VQDA 4OX9L 1A62A 5IP9H 3PIPA 1N8RC 4BY7H 4R4OA 4GNXA 4QQBX 4HJAA 3EBEA 3K81C 4QJFA 3HFZB 1XTDA 2D62A 2R93H 1Y1VH 4DPGA 3BZCA 4DV6Q 4YCVA 1FGUA 4PMWA 4DV6L 2CQOA 2NVQH 3ULLA 3F2CA 4A3KH 1KD1C 5C4JH 2UXBQ 3K0XA 5FJ8H 2UXBL 1CKOA 5GAEC 2JA5G 3UDGA 1HZCA 4APVA 3LGJA 3KF6A 1X65A 1XNQQ 1JT8A 2WAQG 2PQAB 3FKIG 1XNQL 2QGQA 1OXVA 2GVAA 1VQJA 1NMGA 2R6GA 1OXTA 4GN4B 2AKWB 1WJJA 2IHFA 1K0RA 3J81i 3HOVG 3J81c 1VQEA 4R4TA 4DR3L 2ID0A 3G71A 1Q46A 4YWKA 2UU9Q 1PH8A 3PO2G 1JJCB 2LXKA 4OWTB 3PIOA 1Y1WH 2UU9L 2EXDA 3HOZG 4LF8Q 4A93G 2Q2TA 5JJLA 3HOUH 4LF8L 4WJ4A 4HJ5A 4QL5A 3RLNA 3A0JA 4H02A 3E9HA 4PG3A 4K0KQ 1J6QA 4JV5Q 3BZKA 4DV7Q 1QVCA 4LW1A 1AE3A 4BA1I 2BA0A 2QA4A 4DV7L 4JV5L 1E1OA 1L1OC 3EN2A 4YWLA 4AYBG 4HIKA 1MKHA 4JI2Q 5BR8Q 5C0XG 3K7AH 3DLLA 1NJIC 3PO3H 4JI2L 5BR8L 5K36G 1UEBA 4FDBA 4JBJA 4A3BH 1A8VA 4A3IH 3CMAA 4PZ8A 1FVIA 2XGTA 1G6PA 4DR5Q 4YCWA 3H3VH 4DR5L 1MJEA 3I55A 2IX1A 1JB7A 2MFIA 2PI2E 1NBWA 3CCJA 1XMQQ 1K8GA 2L15A 4NXMQ 3HKZG 1XMQL 4NXML 4Y52H 4B3MQ 2CKZB 2PQAA 4B3ML 2YTVA 2JEBI 4DK3C 5IT9c 1YHQA 3S14H 1YBYA 1SROA 3M4PA 1I5FA 1K3RA 2IT1A 3UE0A 1PHJA 1VQCA 1A0IA 3CPFA 2MO1A 1S3OA 1U5KA 2UUCQ 2UXCQ 2R7ZG 2UUCL 4GLVB 4UP9A 2UXCL 2K5NA 1Q1EA 3CF5A 3M4QA 4DV1Q 4QIWE 4A3CH 1E24A 4DV1L 1X3FA 4A3LG 5IWAQ 3PSIA 1EFWA 4JI4Q 5IWAL 3I7FA 3HOXH 3GTLH 1QUQB 4WJ3M 4JI4L 4JCVE 1EIYB 1HNWL 2OQKA 2E2IH 4A3EG 1PH3A 1HR0Q 2HHHQ 2VS1A 2JA9A 1IYJB 3A5ZB 3OW2A 1HR0L 2HHHL 2A8VA 4AH6A 5IYDH 2D0PA 4A75A 5C0XJ 1PH9A 1PH6A 2JA7H 3L0OA 1Q82C 2RHQB 4GNXB 2WAQE 1PFSA 2F3IA 4L5SA 1G291 4ALPA 1V9PA 2R7FA 3HOZH 4BBSG 4YY3Q 4UP8A 4YY3L 5AJ3Q 1XPOA 4XTCS 5C0XI 5AJ3L 1Z47A 5IP9G 3M7NA 2YTXA 2Q2UA 2JK8A 2RHSB 4LUVA 4X66Q 1W2BA 1K73C 4BY7G 4X66L 4KHPQ 2NZHA
chains in the Genus database with same CATH superfamily
2R93G 1EEFD 1CFMA 2XWJB 2IJ0A 2NZOA 2F0EA 3S1NH 3RZOB 4AIMA 1EWHA 2RDFA 4R4IA 1E2WA 4IPHA 4MHEA 1KHIA 1LM0A 2DY7A 2K14A 5J3BA 3S1RH 3R2TA 2F0DA 2GVBA 1VQMA 5C4HA 5EKLA 5LHY1 4Y7NH 4DXFA 1TWFB 1LT4D 1TS5A 3Q8DA 5LMNW 2F52A 3S1QH 4RGTA 2CCZA 2OTJA 3DWAA 1HQRD 1PH1A 1Y1WG 1SYGA 4DK0A 2RF4A 5ELOA 3OMGA 1IL8A 1PZKD 1HFGA 4R8IA 2N55A 2H5XA 1EIFA 1I3QB 2VXWA 4C56C 3Q24A 1JMCA 1BBWA 4K6DA 1PDQA 1TWHB 2Z4IA 4BS9A 3K5LA 2AQ3B 4A3MH 4KI0A 2NN6H 5EKIA 4NP5A 2KUMA 1EZ8A 2KECA 2V1CC 4FF4A 3HOYG 1VS0A 2AUJD 1CT1D 1TWAB 3FEWX 4DR7Q 1AEXA 3V96A 2PW7A 4FYDA 4DR7L 3ZJYC 3RN2A 1GUNA 4JW0A 1O7LA 4NMZA 1E22A 2X69A 4BXXH 5IGDA 1FJGQ 4JOIC 1M4VA 1NMFA 1FJGL 1SJED 5L37A 2K28A 4NXNQ 3J7AF 4NXNL 1GUSA 4DNRB 4A3CG 4EVOA 3K8AA 2EDGA 1G8ZD 3ONAB 2R7ZB 2F0FA 2JA8B 1DXMA 1KAWA 1U4PA 5JEAJ 2JE6I 3GP7A 1DOLA 5IYCG 4OEMB 3CC4A 1CSQA 1A63A 3D4RA 3HZXA 4LF5Q 1TWGH 3GTQB 4LF5L 1AZPA 3K59A 1HHVA 1I6VC 2Q2IA 2Z4HA 1SLJA 3KK7A 1PZJD 2V4DA 3L3OC 3RR5A 5FO9B 5M3MG 1GHKA 3UI2A 3VA7A 4FXKC 2Z9HA 3EA6A 5C3EH 3U50C 5IP7G 1C0AA 4A93H 3DEOA 4ID6A 4RGNA 1OXXK 1X32A 4DA2A 1S5CD 5ELFA 4RHSA 2O4XA 4WORA 2ZXRA 4LFCQ 2K50A 4LFCL 2RCNA 2EJGC 4MNOA 4YHHQ 4PNYA 4AQYQ 1XJVA 5C4XB 4YHHL 4AQYL 3CCMA 5E3FA 2CFMA 2ENBA 5GADC 5A2QE 2KENA 1SDFA 4F7XA 1QCBD 1HRJA 3PUVA 4OWXB 1VQHA 3S16H 1XTCD 1AZQA 1MSGA 2PMZE 3S2HH 2DJFC 4A3MG 3KJPA 4R1JA 2M00A 2NN6G 1KAAA 1SMYC 3PGZA 4IJHA 3CAMA 4A3IB 4F8MA 2VW9A 2FHTA 4GN3B 5G3LD 1STAA 3AB9A 3MVVA 3T51B 4LF9Q 4JI1Q 2EYLA 4LF9L 4JI1L 3TP8A 4GN5A 1S5BD 1SYEA 2F3WA 1PTOH 4TKOB 1F2MA 2NUCA 5EJWA 3FDTA 3M4OH 3UDXA 3QR8A 4RGMA 4BBSH 3M9BA 4FNFA 3H15A 3A56A 3MEFA 1WTWA 1MIUA 4H0LC 2PMZB 4JBMA 1FGBD 3RNUA 5H1SE 1WTXA 1BXTA 1YITA 4L5QA 2QILA 3CQZH 3HOXB 4K14A 1RODA 5EPLA 5JJIA 3RLFA 1E2VA 4K6LA 5I6YA 1RTOA 5IYBH 1EQRA 2F0IA 4JI7Q 4JI7L 3VYTA 3A54A 1I6HH 4HN7A 1KRTA 1F9SA 4DV2L 4F88A 4DV0Q 1EFID 4POGA 1LYLA 2Z6KC 1V1OA 3A7LA 4C3HB 4DV0L 2NN6I 3RZOH 1NY4A 5C3EG 2PYKA 3DEPA 3HRZC 3ERSX 1V1QA 2KHJA 4LWCA 1ZXTA 1PVOA 1I4GA 1W6KA 3GTJH 1IXRA 1STNA 3G48A 1SAPA 2NVYB 2BE5D 1ASZA 1YJWA 1PRTF 2IWHA 1TWFH 2KJXA 2Z1CA 1TIID 4RMFA 3J7YW 1N36Q 1N36L 1K8AC 3S1MB 2EJFC 4L8JA 3MXNB 4L6TB 3C1FA 2JEAI 1IW7D 1PH7A 3NTKA 1HQMC 1B1ZA 4BBRG 3MHBA 1CSPA 3I4MB 1I3QH 2C9OA 2K5QA 4O0AA 4DAYB 5FLXE 4IUUA 3W5OA 1JE5A 2SDFA 1EY7A 3ULJA 1G2TA 3K57A 4IFDG 1QVGA 3OMCA 1CUKA 1BQQT 3U9OA 1EWIA 5IIFA 1A6XA 5EKKA 3A8IE 4JG2A 1TWAH 1RHPA 2LMCB 1N32L 4IJLA 4X6AH 4NPSA 3H6MA 2B8GA 1SXTA 1PRTB 2MNAA 1NSNS 1BCPB 2MGSA 1LTID 1WCMB 1DJRD 1ZYRC 5EBDA 3HOWH 4A3DB 2JA8H 3I73A 3KF6B 2D2CC 3RUZA 1E3PA 5C44H 1PZID 3X3NA 4KN4C 2F0QA 5CV4A 1WYDA 3I2ZA 1UAPA 4GOPC 1TVXA 2CHBD 4RKLA 1AP0A 1SE3A 2J4XA 5J39A 1EY5A 4B3SL 1SE8A 3FKIB 2I5HA 4IFDI 1V1PB 4QF4A 4DXGA 1EY0A 4V0BA 1U4LA 3K81C 3HFZB 2D62A 1CHQD 4DPGA 3BZCA 1BR9A 1FGUA 4PMWA 4MIUA 5JAVA 4KY7A 2PQEA 2UXBQ 1PXUA 3CRKC 4HSPA 3K0XA 5FJ8H 2UXBL 2JA5G 3UDGA 5D3IB 1WTVA 5M5WB 3D4DA 3KF6A 5KYLA 1GUGA 2PQAB 2GVAA 3NXWA 2R6GA 3KBGA 3FVQA 2AKWB 1WJJA 3SHLA 1XYIA 1Z6HA 3PIOA 2EXDA 1ENCA 1LO5D 5JJLA 2A69C 2QF7A 2FMCA 3A0JA 4H02A 3OPOA 3H91A 2IW3A 3VR3A 4DV7Q 4BA1I 2QA4A 1AE3A 4DV7L 1V1PA 4HIKA 3DLLA 5CC4A 2RA4A 1LT6D 1A15A 4A3IH 3CMAA 1FVIA 4Y7NB 4DR5Q 1YNJC 3H3VH 4DR5L 4XT3B 2OEOA 2MFIA 1ICWA 1SBBB 4Y52H 2PQAA 2JEBI 3VYRA 3SEBA 3NUCA 2TSSA 3IAYA 1DOKA 1A3TA 1A0IA 1QOHA 3A7AB 5I9PA 5JVH3 2NVXB 1U5KA 2UUCQ 5IGFA 2R7ZG 2UUCL 4GLVB 3I3CA 2K5NA 4C3IG 5KGUA 1E24A 1X3FA 3GTMB 2NTSA 1EFWA 1NR2A 3HOXH 1QUQB 4JCVE 1LLRD 4G4KA 1PH3A 1T5XD 3OW2A 5IT9E 2E2JB 4AH6A 3I91A 1SNDA 1EYDA 4FXGC 2WKCA 3L0OA 1B53A 1ET6A 1WVLA 1PFSA 2F3IA 1V9PA 1EIGA 3EVQA 4UP8A 4N8X1 5AJ3Q 1XPOA 4H44C 5AJ3L 2Q2UA 4LUVA 1VQLA 2LFNA 3CXCA 5GROA 1LTTD 2OQ0A 4KMUC 1H95A 4G57A 1Q8KA 2WP8J 2HQEA 2EY2A 1F77A 4UP7A 1PA6A 4AYBE 3BVMA 2WV6D 1QVFA 4JC0A 1TWGB 4KV6A 1VMCA 5C4XG 1QUQA 1EY8A 3E9IA 1HUMA 2K5HA 2Z0SA 1D8LA 2XNAC 5GAGC 1LUZA 2KBNA 3I4MH 1DGSA 1HZAA 4YWMA 5DLQE 5FLMH 2B8FA 3JAMi 1CQVA 4C2MB 1SE2A 2Z6KA 4GLAC 1Q3LA 5JEAG 2QKIC 1PYSB 2XVSA 4ZKCB 4A93B 4KY5A 2AHOB 4O2DA 3NBHB 4LF7Q 5HURA 1BDOA 1Q8IA 4A3IG 4LF7L 2E5LQ 1SNMA 1PTOF 2E5LL 3Q23A 1SNCA 2A6EC 4AYBB 3J80L 5CBEE 3GO5A 4LUOA 2E76C 1BKBA 3PIO3 4TQUS 4KKUA 2VL6A 4RG1A 2SOBA 3AYHB 1PLFA 3T1YQ 3KBXA 2CWPA 4DV3Q 1NNXA 3T1YL 1VQPA 4DV3L 3S17B 2IHEA 2WINB 1UE5A 3IL8A 1WCMH 5FO8B 2KVMA 4A3DH 4GNXC 4P2CB 1GXDC 2F0PA 1Y8PB 3J7AV 2OTLA 2BDOA 1F9RA 3PV0A 4ME3A 4O42A 3F8TA 2Q2HA 1HXYD 1B9MA 3NBHA 5JVG3 4WJWA 2LSSA 2E75C 3X3MA 5DM63 1JE4A 1WTQA 4K2KA 4A3EB 5FLXL 1TS4A 5J1ZA 2VQEQ 4RA8A 1N34Q 2VQEL 1YEZA 2ZTDA 1CA5A 1SJHD 1N34L 3FKIH 1VQ5A 4C3HG 1UE1A 5CBAE 2ALYB 4S3SA 5C5LA 4BBSB 1V43A 3UE1A 1K9MC 1HUNA 3I90A 3H3VI 1VQAA 3BJUA 2Y0SE 3EFXD 4FF3A 3KDFB 2EY5A 4HMJA 1F2LA 5IGEA 2GA4B 4J15A 2WACA 1P8LA 1JOKA 1O7ZA 5M5WH 1YI2A 2K52A 4EGVA 4A3KB 2RSNA 5CORA 1IZ6A 4GLXA 4LFAQ 1RCVD 1SMYD 4I7ZC 1SYBA 5CR3A 4LFAL 3ERQA 4I65A 1IYVA 5BN3A 3L7ZC 3OTOQ 1EWCA 1PV4A 1GM5A 2RBMA 4DR1Q 4B9XA 4DR1L 3I4MG 3O13A 2MPMA 3IRBA 1CM9A 1JB3A 3HP3A 4XT1B 1RF2D 2M9VA 1QB5D 1OXUA 2B2TA 1X3QA 3L9AX 3E0EA 2L11A 1K28A 1U4RA 3HEJA 1WTHA 2FXQA 2HT1A 3HOUB 3UDFA 1F9PA 5C3XA 5M5YH 3GTJB 2L55A 2Y0SB 3D0FA 1EQTA 1Z9FA 1RD9D 2DGYA 3UDIA 1IBLQ 2LS01 2D0OA 3SR1A 4PV1C 1IBLL 5EAYA 4DV5Q 3KDFA 1ESRA 3PO3B 1AE2A 4DV5L 1U9RA 4UY8C 2EOTA 4ZUIA 2F4IA 2VNUD 4KHZA 3KFUA 2ZTEA 2P5ZX 2MQHA 2ZJPA 1EYAA 1K0SA 1VQGA 2AWNA 4J8QA 2N3SA 4RAUC 4DF7A 3FPUB 1CI3M 3C1EA 1WCMG 3CC7A 1HH2P 1UNSA 2NVXH 1TS3A 4F87A 3PUWA 2N8NA 2CQAA 2A5HA 2FFKB 3J7A5 4A3DG 4P71A 3PF4A 1IBKQ 4BWGB 5HGQA 1IBKL 3GTMH 4CKCA 3NTIA 4JBKA 4JYAQ 5FOBB 1TKWB 4JYAL 4DN4M 1PH5A 1GO3E 4IUQA 3STBC 4MTNA 1U0LA 4PZ6A 1WOCA 2E2JH 2F0GA 4CDCC 1VQ7A 3RD4A 3H94A 2E74C 2DJGC 5C6AA 2A74C 1C8CA 4OL7A 3OHXC 5FKAC 4LF4Q 4LF4L 3DM3A 2BA1A 3HOZB 2C35B 1B7YB 4DR3Q 1GUOA 1KL9A 2LXJA 3HOWB 4DR3L 1JC7A 1HR0W 4A3JH 1D5MC 5GAHC 2X6GA 3KYHC 4ILWA 4N9TA 5C44B 2KQ3A 1D1KA 1FNUA 4A3GB 1JWMD 1LTGD 4P74A 1FNWA 2XWBB 1GJXA 2BDNA 1Y69U 4XIGS 4BY1B 3BS1A 3VR6A 3T4AC 3BDOA 1C7YA 2B2WC 1AH9A 4A76A 4KY6A 3PF5A 3MEHA 4C2MH 4JI5Q 4JI5L 3DUZA 5AFWA 2UXDQ 2KA7A 3CCSA 4H13C 2UXDL 1JWUD 4HIOA 2J0TD 3VYSA 3M7GA 4IUPA 1IHZA 3MXUA 4QGUA 1I50B 5IT9L 1EIHA 4IUNA 5IOCA 3CP0A 2UUBQ 2UUBL 5K36H 1L2FA 3T13A 3CCEA 2FINB 1SEBD 1CZWA 2ZJQA 4X64Q 4KTAA 3GD7A 3NSWA 4X64L 4YCUA 1RL2A 4G7HC 1XNRQ 1B3AA 2JA6H 1WFQA 1XNRL 3TP5A 3M85A 3S17H 4QCLA 3I8ZA 1XWEA 4HIMA 3BG3A 3U58A 2K1BA 3DMUA 3PUXA 3ZYYX 2PZWA 2I5MX 4HEDA 2BH2A 2PPBC 2F1MA 1NTGA 5CGKA 4JI3Q 1HZBA 4JI3L 1ESFA 4DR6Q 3M3YB 3DXJC 2MUYA 1D2BA 4HJ9A 4DR6L 1HA6A 2WB1E 2R61A 4DR2Q 4A3LH 4DR2L 4CGYB 2A68C 2TMPA 1RDPD 3URYA 1R9TB 3D4WA 2K33A 1KRSA 4A3EH 3R8BA 3G6JB 3V05A 4ZKBB 2DN8A 1M8AA 4BXXG 2F03A 2KCCA 1F2ZA 3I4OA 5D3DA 1FL0A 2CW0C 3ICEA 1QZHA 4LF6Q 1SMXA 4R4QA 3CMEA 4LF6L 4L5TA 1VQDA 3LX0A 5I4DA 1SSOA 4R4OA 4GNXA 3MA2B 4QQBX 2A69D 1NUCA 4ODGA 3OIPA 2BOSA 1LV9A 2WB1B 3F2CA 4A3KH 1MBYA 1FNVA 1TWCB 4XQQA 4ZUJA 3N6RA 4ZRZA 3P20A 4APVA 2ICEC 1XNQQ 1XNQL 2QGQA 1JOOA 1OXVA 2ICIA 1YNJD 2PW5A 4GN4B 3SDZA 3J80E 4CKEA 2IHFA 1K0RA 5A35A 3J81i 3J81c 4R4TA 3G71A 4YWKA 4OWTB 3G7LA 4A93G 2Q2TA 3HOUH 3NTHA 3MC0B 2VUMB 1WD0A 4K0KQ 4PG3A 1J6QA 4JV5Q 2JYOA 3BZKA 4JV5L 3QO2A 1E1OA 1L1OC 4EQNA 4YWLA 4AYBG 1NJIC 1MKHA 5BR8Q 3OIQA 1BCPF 3PO3H 4B9WA 5BR8L 1Q90A 1UEBA 5K36G 3TZUA 1A8VA 4PZ8A 3C2PA 1G6PA 3LWUA 1KNAA 3KLSA 1MJEA 3I55A 1L0YB 2HCCA 2E2HB 4NXMQ 2L15A 4ZCKA 2F3VA 4NXML 4R8NA 2YTVA 4DK3C 3S14H 2AQ2B 2IPKD 1K3RA 2IT1A 2XN9C 3QJYA 1PHJA 2B63B 5HGTA 3CPFA 1S3OA 1U4MA 4K5WA 4UP9A 2FJ2A 3QG1A 1Q1EA 3T16A 2XRQD 2J7ZA 4DV1Q 4ZK9B 2RCFA 4DV1L 4A3LG 5IODA 3HG9A 3MFGA 2YU9B 3SK6A 4MN3A 1PFNA 4IUVA 3TZDA 2X6LA 2F0LA 4A3EG 1HR0Q 1VF5C 2F0MA 2VS1A 2A8VA 1HR0L 1HCZA 5IYDH 5I2XA 4A75A 1FR3A 2ZXPA 2JA7H 3I4NB 2RHQB 1B3QA 2ZT9C 2WAQE 1STYA 4ALPA 3VA5A 3HOZH 4BBSG 1DD2A 3H0GB 1LTRD 2KHSA 3A8KE 4XTCS 3M7NA 5JPMC 3I72A 1TY2A 2RHSB 1W2BA 1K73C 3OYYA 1F2YA 1YHBA 3PUYA 4IZ8A 3RZDB 1VQBA 4OIJA 2PNHA 4C3JH 4HIDA 4A3GH 4A3KG 1C4QA 4NKLA 1JWSD 2K4KA 3K80C 5IYBG 3A74A 2F0NA 1CKNB 1IBMQ 3OW7A 4CJ1B 1VQ8A 1A3UA 2H1EA 1IBML 4BY1H 4OO1H 1HFNA 1EL0A 2A6ED 3F2BA 1MGSA 1O80A 5M5XH 4E6IA 2WAQB 2I07B 1JQYD 4JOIA 3TRZA 2RVLA 2GN5A 3Q6SA 2QEXA 4KD4A 5E1FA 4JVZA 3HKZE 2LKVA 2YV5A 3G4SA 1D6EC 1SR3A 3HOVB 3HOUG 4RCOA 3J81j 1I50H 2Y0SG 4KJNA 5KYIA 2RDHA 1SRUA 1VCIA 2HQLA 4PZ7A 5I9OA 1II3A 5I2YA 3PO3G 1X3GA 2BH8A 1PH2A 1JCKB 1ONLA 1QWYA 1QG7A 4XQNA 2XTIA 3GTGB 4DK1A 2VY3A 4IUTA 1PTOC 1W3SA 5COYA 2IL8A 3BU2A 1CKNA 2B2WA 3D3RA 1TQOA 4CBVA 1H9SA 2DY8A 4BA2I 4X3KA 2ZJRA 3HS0C 3HKZB 2MJ8A 1K83B 1SYFA 1TS2A 1R4PB 4RGOS 2RDGA 4JI6Q 4JI6L 5M5YB 3M3YH 5HY6A 2EVBA 2D5DA 3GTKB 4UHVA 1R9TH 5M3MB 1SFOH 1ASYA 4UPAA 3TQYA 1S5ED 3GTPH 5IGBA 1VQNA 3RMHA 1KNEA 1B50A 3R3OA 1RKNA 5ISRA 3KLSX 5E4WC 2K01A 2F0OA 2EZVA 3BZDB 3HOZG 4WFN3 1CQFA 1IL2A 3SGIA 1UE7A 3VR2A 1H9JA 3HOWG 3K6OA 5LMUQ 1VQKA 2EPBA 2HDMA 4IQZA 5LMUL 4QB4A 2JA8G 4RKBA 2DNCA 4XDXA 4RWSC 5C44G 1KTKA 1STEA 4B3TQ 3BVZA 4A3GG 4BY7B 4B3TL 1TWCH 3NHHA 3LWEA 4KLKA 1Y1VB 4L63B 2I5LX 4KN7C 1Q81C 2NVQB 4ABNA 4EQOA 3K5NA 2G5DA 4EQPA 3SK8A 2IY5B 1TY0A 5C0XH 1ZEQX 1H9KA 1O7IA 1HNXQ 2A6HC 1HNZQ 4J1MA 2JQOA 1HNXL 1EU3A 1I4QA 2QDLA 4NB3A 3I70A 1HNZL 1K8OA 3CPWA 3CCRA 3TS0A 1PYBA 1QJOA 4QY7A 3GDEA 5CV6A 3HGBA 2ASBA 3M4YA 2VUMH 2HIVA 1D5XC 3P7JA 1MI2A 1L1OB 1I4XA 1QZGA 1J5EQ 4A3JB 1MSHA 3PMFA 1Q1BA 1J5EL 5FJ8G 3CCQA 1S5FD 3CU7A 1AN8A 1WTOA 1L0WA 2O2LD 3EJIA 2AUKA 2AWOA 4XQJA 2Q8IB 2N78A 3W1BA 3AQQA 2B2UC 5CMDA 5J22A 3FPPA 3PQIA 3STBD 1A2TA 4A3BB 2E2HH 5EBCA 3F2DA 4K5XA 1KDBA 2R7DA 1TT2A 1I4PA 2F0SA 3NE5B 1EY9A 2HD3A 3JC66 1IKMA 3JAMc 1DONA 3E0JA 1D1IA 1SE4A 2G9DA 3VDYA 1BBXC 1HZ9A 1UUPA 3OWFA 4X3UA 2B63H 2L1BA 4ZYSA 1M1KC 5NUCA 4LNQA 2YTYA 1EOVA 2ATWA 1YJ9A 4DKAC 2YU9H 5DNFA 1L1OA 2EJMA 1OXSC 1YNNC 3HKSA 4ZAIA 5G3LF 3BDCA 4B3RQ 4B3RL 2A73B 4MZ9A 4HJ8A 3GTLB 4GKJQ 1C9OA 3I4NH 1WD1A 2JA6B 5ELNA 4GKJL 1ILPA 1LT5D 2KHIA 2EQSA 2K04A 4A4IA 3H0GH 5T1GA 1K8MA 1S72A 1KIXA 4HTHA 1EQQA 1K3BC 1GUWA 1VQ6A 1RTNA 1D5ZC 2KCNA 3NEMA 2MHVA 1YJNA 3RZDH 4PQXA 3RN5A 3FHWA 1AFPA 4DUZQ 2WB1G 2WFWA 3HOXG 4DUZL 4CJ0B 1WI5A 4GOPB 2F0UA 4TVAB 4XYQA 4GZYC 1VQ9A 3E3XA 4HCEA 1JOQA 4IPDA 5I6WA 2PZTA 3AFPA 4LMQD 2R92B 3NPPA 4U68A 4M1UB 1T9HA 2IX3A 4IOAA 3T1HQ 2K32A 3T1HL 3HOVH 2E2DC 3HOYH 4HSVA 1EQVA 3CKIB 2VUMG 1PMRA 5E7NA 1ZKOA 3KLWA 4QMGA 3PCOB 3H3VC 4FF2A 1LTLA 5D14A 4RH6A 1CKMA 3AU7A 4MTKA 2B3GA 3E5SA 1EUJA 3FP9A 3U4ZA 3GTGH 3OSOA 1ENAA 3D8GA 2KCMA 4GOPA 3OTOL 2A68D 1HNWQ 4CDFC 2F0HA 4K8IA 1Q7YC 5CYUA 1BBUA 4JI8Q 5FLMG 4DFAA 1JJ2A 1B2TA 4JI8L 1K83H 5IYCH 1B8AA 4DK6C 1H9RA 2K5VA 2B63G 2CW0D 2UUAQ 2DNEA 3MTSA 5FK9C 2UUAL 2SEBD 2B29A 2EE1A 3GTKH 4EQ5A 1EOTA 1BNZA 2OF1A 4N8FA 5M3MH 4G7OC 2Q8RE 3CCLA 5EGTA 1G2SA 3W2DA 1HJPA 4K2LA 5IP7H 2SNSA 2BCOA 3I4NG 1A2UA 2WIIB 1DM0B 4TRDA 3ER0A 1YIJA 4DAVA 3TEHB 3NBIA 3SK4A 1B44D 3I56A 3H0GG 3S14B 1NR4A 1X55A 1CA6A 4H7BA 2JA5B 3NENA 4DNIA 2I0QA 2VB3X 5ELDA 3PIP3 1A62A 4BY7H 5BN4A 5C4ZA 1J9OA 2M2LA 4N9PA 3EBEA 2EY1A 1LT3D 1XTDA 1MD2D 1Y1VH 4YCVA 5CV7A 5M3FB 2CQOA 2NVQH 2EYJA 3ULLA 3JAML 1CKOA 3IFTA 1HZCA 4LJZC 4Q5VA 3NP8A 1X65A 1JT8A 2WAQG 3FKIG 4NW2A 2JA7B 1VQJA 4OGQC 1A3VA 1OXTA 1CZGA 2R3ZA 3D6WA 3HOVG 2UU9Q 1CHPD 1PH8A 1JJCB 2LXKA 2UU9L 3LNNA 4LF8Q 4LF8L 3W3AA 2PNRC 3RLNA 1TU2B 2PCFB 4C3JB 1QVCA 1TR5A 5JJZA 3EQLC 1EZ6A 3EN2A 4JI2Q 1S4ZA 4JI2L 1PRTC 4FDBA 4A3BH 3K5MA 1BCPC 4XYOA 1VMPA 3J81E 5ELCA 3WOEA 5M5XB 4JK1C 2IX1A 1JB7A 2O5IC 3CCJA 2PI2E 1EU4A 1NBWA 4C3IB 1XMQQ 4K8JA 3HKZG 1XMQL 4B3MQ 4B3ML 3H09A 1YBYA 4HCSA 1SROA 3M4PA 1BOSA 4QUFA 4A3FB 3OWEB 4C1NI 2JXMB 2L12A 3BYYB 1ZYRD 4IN3A 4OHJA 1VQCA 1PFMA 4DU9A 2I46A 1STHA 1Y8OB 3TP6A 4ULLA 3M4QA 4Q0FA 4QIWE 1DCZA 2B39A 1J8IA 2XIWA 2B2UA 3NK9A 4JI4Q 3GTLH 4WJ3M 1GUTA 4JI4L 2F0JA 1G6ZA 1KDCA 2JA9A 1IYJB 2QCPX 3A5ZB 2G9HD 5C0XJ 1PH9A 1Q82C 4GNXB 1SNPA 4UDUC 4B08A 4C1NK 1LABA 4ZLTF 1G291 4L5SA 3S15B 1H9MA 4PMCA 3BVGA 2NBFA 1Z7TA 1Z47A 2YTXA 2JK8A 4X66Q 4BY7G 5DAUA 4X66L 4LW1A 3QB3A 4KHPQ 2RSOA 1VF7A 4KHPL 4BBRH 1Y1VG 3FMCA 3Q22A 1BUVT 4QIWB 5ELBA 1SFOB 4GKKQ 1KXLA 4KKTA 4EX5A 4GKKL 3GTPB 2R92H 2LY7A 3TP7A 3S2DB 1SYDA 2NVTB 3TSSA 1DYQA 1KABA 3GV6A 5CV9A 4IFDH 3MAQA 2EYFA 3SVMA 1PTOD 4CDDC 2OCEA 1HPCA 2OXPA 5KEEA 2PI2A 3CCVA 4X3TA 3BYTB 4A3JG 1UE6A 3TS2A 1IKLA 4ZQ3A 2QW7A 4DGZA 1O7YA 2ES2A 3PO2B 3QOJA 3RLOA 1GOZA 3KUPA 1OO9B 3EROA 2EXZA 1GVPA 2NZ1D 4A3BG 1OTCA 1GD7A 1O78A 4P72A 3K58A 1TXYA 2HCIA 1P16A 1IYUA 2FMMA 2CWAA 5D65A 2HIXA 2B2VC 3K5OA 1EYGA 3CW2C 2KCTA 1E7ZA 3GTOB 3TDQA 2B2YC 1C48A 4XXEA 3VR5A 1VQ4A 1ML0D 3IFDA 4K0KL 3MZ5A 3WDNA 4DNTB 4G7ZC 2QEJC 2ZTCA 1PH4A 2N88A 4DV2Q 3CD6A 1SNOA 4RCNA 3KOJA 3NELA 3A8JE 5F2DA 2QDBA 5LMNQ 4RHRA 1VQIA 3R93A 5LMNL 4OIKA 3I4LA 1S40A 4J6HA 3MXGA 5JOBA 4R4CA 1ET9A 2EYMA 3MXPA 2JA6G 4PMBA 1WTPA 1BF4A 3E6ZX 3J7ZC 1XPUA 1D7QA 2KEEA 1PYWD 5K5PA 4UAIA 2JA5H 3K0YA 4OWWB 3CCUA 1Q12A 4HJ7A 2A6HD 4DAMA 5LL6X 1SNQA 3L2PA 4TSSA 1GKHA 1L0XB 4I7AA 3C46A 1SN8A 2XSCA 3OOCA 4JI0Q 3NQTA 5M3FH 3TMEA 4JI0L 1EEID 3S24A 2MO0A 2VZAA 3DHQA 1BVSA 3AEVA 3NQIA 3CC2A 2R93B 3AMUA 4IPCA 4IOCA 2R92G 1TWHH 1RJTA 4LFBQ 4LFBL 5C4JB 3D31A 1YVCA 1FYCA 1X3EA 2AMCB 2JP1A 1Q86C 2RQXA 2F0KA 3FRPB 3W1GA 2IX0A 1N32Q 2F0VA 1S5DD 3BDLA 5M9OA 1Y1WB 3MXNA 1FD7D 2E8GA 1V8QA 4IALA 4KK7A 3VYUA 2Z6BA 3KJOA 2Z8LA 3V2TA 1M90C 4JBWA 4O1NA 1N33Q 1H9SB 1N33L 2PO4A 4X62Q 2R7ZH 4X62L 3P75A 3K7AB 1YNND 1RIPA 4DAYA 4M8AA 4C3IH 3Q0AA 3ND9A 5LL6S 2D9UA 4KJOA 3GTQH 3HOYB 4A3FH 2F0WA 2L5TA 1KLGD 4Z9CB 4LUZA 1LACA 3K7UC 2F4VQ 2K5WA 2F4VL 5IE8A 2JJQA 1NCVA 4CHTB 3AFQA 3R2IA 4DUYQ 3U4VA 4B3SQ 4DUYL 3J80i 3MFYA 3J80c 2EY6A 2VB2X 3A5UA 2YYZA 2B2TC 5EPKA 3TREA 5KNBA 4FXDA 3C3LA 2Q8TA 1MHWC 4DR4Q 5EQ0A 2NYZD 4DR4L 1UEAB 3ULPA 3JAME 5C5MA 4RFBA 3F1ZA 4HAEA 4IURA 4OONA 2E2IB 3EIVA 2ZXOA 1HA5A 5TSSA 3S15H 3NWTA 1GHJA 4FVMA 1T5EA 3QWNA 3ITPA 4DV4Q 2DUDA 3QOLA 5C4XH 4DV4L 4WRDA 1X9NA 3T53B 3IKJA 1CK1A 4X65Q 1BO0A 4X65L 1WTRA 5M3FG 3J81L 3A55A 4LAAA 5DEHA 4NDXA 3G6EA 2OWOA 1NE3A 1KC8C 4IO9A 3S2DH 3WWVA 5FLXc 2NVTH 3S1NB 5JEAH 4JPBW 5IYDG 1G51A 3MWYW 5C3WA 1I4RA 3CHBD 2JA7G 1JJGA 2N49A 5KIXA 4L5RC 4IPGA 1XMOQ 1XMOL 2XRSD 2AQ1B 1HTPA 3S1RB 1X56A 4CJ2C 1Y8NB 2VQFQ 1DZ1A 1CTMA 4CDEC 2VQFL 1UWVA 4QUCA 3S1QB 5IGGA 1E1TA 1YNXA 1F9QA 3PO2H 1I4HA 1JR0D 4C3JG 1EY6A 4KD3A 1PFBA 3TN2A 2F0TA 3QIAA 2HUGA 5GQOA 1XPRA 1VQFA 1HTLD 4BY1G 4OO1G 4OXPA 3WOFA 2BE5C 2K5DA 1KQSA 1XXGA 4GS3A 3F2UA 4A3MB 1MJCA 2KEDA 1IW7C 1W6JA 3PUZA 2CH4A 2A19A 3GTOH 2CH4W 3KLRA 4ME5A 5A2QL 4A3FG 4P75A 1YHAA 1Y14B 2KOLA 1I94Q 3VR4A 1I94L 1SYCA 5CV8A 2HDLA 1ILQA 2WKDA 1YZ6A 3B6YA 1X54A 4POFA 5IY0A 4C3HH 5JJKA 2K75A 5T1IA 4KHVA 5BN5A 1KDAA 4DAPA 2O5JC 1STGA 1B70B 1G91A 3P1HA 2NVYH 1LTSD 1N9WA 2EIFA 1QE6A 1XX8A 5ELEA 4P73A 4IFDJ 1QILA 2B2VA 3S1MH 4OELB 2ZM6Q 2RKSA 2ZM6L 1X6OA 2B2YA 1E0BA 1VQOA 3T56B 2A1AA 3KF8B 4OO1I 4HR7B 2C5CA 2SNMA 4V190 4OX9Q 4OX9L 5IP9H 3PIPA 1N8RC 3ND8A 4HJAA 4QJFA 1B4OA 2R93H 3SE0A 3D6CA 4DV6Q 1LTAD 1KLUD 5C3EB 4DV6L 1KD1C 5C4JH 1R4QB 5GAEC 1PRTD 3LGJA 4X3SA 1BCPD 1NMGA 2K7VA 1NAPA 3DWQA 1VQEA 2ID0A 1Q46A 2JN4A 3GQBA 3PO2G 1Y1WH 5EPJA 1JORA 1EYCA 5CV5A 4FP5D 4WJ4A 4HJ5A 4QL5A 4BBRB 1JICA 1B9NA 3KF8A 3E9HA 2NTTA 3S9WA 2NWGA 2JSOA 2L0CA 4FO2A 2BA0A 4K5VA 2K6AA 1AW7A 4YIJA 3S16B 5C0XG 1DOMA 3K7AH 4KKSA 4JBJA 2K03A 3S2HB 2XGTA 2CVRA 2OT2A 2L4NA 3SXHA 1X3PA 4YCWA 3DM1A 3TBIB 2EYPA 3CRLC 1K8GA 5FO7B 5KNCA 2CKZB 2EYOA 5IT9c 1YHQA 5KRUA 5KNDA 1I5FA 1VDZA 4LK1C 2EYHA 3UE0A 5IGCA 1QNKA 5JPNC 2MO1A 1E2ZA 2UXCQ 1PTOB 1LTBD 2UXCL 3M4OB 3CF5A 4A3CH 5E4XA 5IWAQ 3PSIA 5IWAL 3I7FA 1HNWL 1EIYB 2OQKA 2E2IH 5DM73 2HHHQ 4CKBA 1QNUA 3GV3A 2HHHL 4FF1A 2D0PA 3N52A 1ICFB 2L9HA 3CQZB 3NWSA 1PH6A 2K05A 4HMIA 2MP1A 2PZUA 4U673 2NB0A 1EY4A 2R7FA 3DWPA 4R9WA 4YY3Q 1ENFA 1STBA 3U9SA 4YY3L 5C0XI 1I6HB 5IP9G 3SK5A 2H4OA 2NZHA
chains in the Genus database with same CATH topology
3OYYA 1YHBA 3PUYA 4KHPL 3CXCA 5GROA 1Y1VG 4BBRH 2R93G 2NZOA 3S1NH 1VQBA 4AIMA 2PNHA 2OQ0A 4C3JH 4HIDA 1H95A 4A3GH 4A3KG 4R4IA 1Q8KA 2WP8J 4GKKQ 1KXLA 4IPHA 4EX5A 4GKKL 1KHIA 1LM0A 2K4KA 2K14A 3K80C 4UP7A 3A74A 5J3BA 5IYBG 3S1RH 1PA6A 1CKNB 4AYBE 2GVBA 1VQMA 1IBMQ 4BY1H 1VQ8A 1IBML 1QVFA 4Y7NH 4JC0A 3F2BA 5C4XG 1QUQA 5M5XH 3Q8DA 5LMNW 2F52A 2K5HA 2OCEA 2Z0SA 3E9IA 3S1QH 1D8LA 4JOIA 2CCZA 3TRZA 2OTJA 5GAGC 1LUZA 2GN5A 2KBNA 2PI2A 2QEXA 1Y1WG 3CCVA 1PH1A 3I4MH 3HKZE 2YV5A 1DGSA 3G4SA 2RF4A 1HZAA 1SR3A 4YWMA 4A3JG 5DLQE 1UE6A 5FLMH 3JAMi 3HOUG 5ELOA 3TS2A 3J81j 1I50H 2Y0SG 2Z6KA 2ES2A 4GLAC 5JEAG 2H5XA 1EIFA 1PYSB 3RLOA 1JMCA 1BBWA 1SRUA 1VCIA 2HQLA 4PZ7A 2AHOB 4O2DA 1GVPA 3PO3G 3NBHB 1X3GA 2BH8A 4LF7Q 4A3MH 1PH2A 4A3IG 4LF7L 1OTCA 2E5LQ 4A3BG 4KI0A 2E5LL 1GD7A 2XTIA 4P72A 2VY3A 2V1CC 1W3SA 1TXYA 3GO5A 3HOYG 1P16A 1VS0A 3BU2A 4LUOA 1BKBA 1CKNA 4TQUS 2CWAA 2HIXA 4DR7Q 4DR7L 1EYGA 4BA2I 3ZJYC 3CW2C 3RN2A 2VL6A 2KCTA 4RG1A 1E7ZA 2ZJRA 3AYHB 3T1YQ 4DV3Q 2CWPA 3T1YL 1VQ4A 4DV3L 1VQPA 1E22A 4BXXH 2IHEA 4K0KL 1UE5A 1WCMH 4JOIC 1FJGQ 1NMFA 1FJGL 2ZTCA 1PH4A 4JI6Q 4DV2Q 3CD6A 4JI6L 4A3DH 4GNXC 4NXNQ 3M3YH 3KOJA 4NXNL 3NELA 5HY6A 4A3CG 3K8AA 5LMNQ 1VQIA 2OTLA 5LMNL 1S40A 3PV0A 4ME3A 1R9TH 1SFOH 4R4CA 3F8TA 4UPAA 1KAWA 1ASYA 2JA6G 3TQYA 5JEAJ 2JE6I 2Q2HA 3GTPH 2LSSA 1VQNA 5IYCG 3J7ZC 3CC4A 1XPUA 1D7QA 1CSQA 1A63A 4LF5Q 1TWGH 2JA5H 4LF5L 2VQEQ 3CCUA 4OWWB 1N34Q 2VQEL 1YEZA 2ZTDA 1Q12A 4HJ7A 3FKIH 1N34L 2Q2IA 1VQ5A 4DAMA 3L2PA 1IL2A 1SLJA 3SGIA 1UE1A 1UE7A 1GKHA 3RR5A 3HOWG 5M3MG 2ALYB 5LMUQ 1VQKA 5LMUL 2JA8G 1V43A 3UE1A 1K9MC 1SN8A 5C44G 4JI0Q 3H3VI 1VQAA 5C3EH 5M3FH 3BJUA 4JI0L 2Y0SE 4B3TQ 3S24A 2MO0A 2VZAA 3KDFB 3U50C 5IP7G 1VQLA 4B3TL 1BVSA 3AEVA 1TWCH 4A3GG 4A93H 3CC2A 4KLKA 1OXXK 4J15A 1P8LA 2I5LX 4IPCA 5M5WH 4IOCA 1TWHH 1YI2A 2R92G 2K52A 1Q81C 4LFBQ 4LFBL 1IZ6A 3D31A 4LFAQ 4GLXA 4LFCQ 2IY5B 2K50A 4LFCL 1YVCA 4LFAL 1X3EA 2AMCB 1Q86C 3L7ZC 3OTOQ 1O7IA 1HNXQ 1PV4A 1GM5A 1HNZQ 1HNXL 2JQOA 2RCNA 4DR1Q 1HNZL 4NB3A 4DR1L 4MNOA 4YHHQ 4AQYQ 1XJVA 3I4MG 3W1GA 4YHHL 4AQYL 3CCMA 3IRBA 3CPWA 3CCRA 2IX0A 3TS0A 1PYBA 2CFMA 4QY7A 3GDEA 5GADC 2KENA 2ASBA 2VUMH 1N32Q 2HIVA 3PUVA 1OXUA 1L1OB 1QZGA 3E0EA 1J5EQ 2HT1A 2FXQA 4OWXB 1Q1BA 1VQHA 2E8GA 3UDFA 5FJ8G 3CCQA 5M5YH 1J5EL 3S16H 3KJOA 3D0FA 1L0WA 1M90C 1Z9FA 2AWOA 2PMZE 4JBWA 2R92H 3S2HH 2DGYA 3UDIA 4A3MG 1N33Q 1N33L 2N78A 3W1BA 4R1JA 3AQQA 4X62Q 2NN6G 2D0OA 3KJPA 1IBLL 1IBLQ 5EAYA 4X62L 3KDFA 4DV5Q 2R7ZH 3PGZA 1AE2A 1RIPA 4DV5L 3STBD 4IJHA 4UY8C 2VNUD 3CAMA 4C3IH 2E2HH 2VW9A 4KHZA 3F2DA 3KFUA 2ZTEA 2R7DA 4GN3B 3PF4A 2MQHA 2ZJPA 3JC66 3JAMc 3GTQH 1VQGA 2AWNA 4A3FH 3VDYA 4LF9Q 2N3SA 4JI1Q 4LF9L 1HZ9A 4JI1L 4LUZA 3K7UC 4GN5A 2F4VQ 2B63H 1WCMG 3CC7A 1HH2P 5IE8A 2NVXH 2F4VL 1M1KC 2JJQA 3PUWA 2YTYA 2N8NA 3AFQA 4LNQA 4DUYQ 3J7A5 3M4OH 4A3DG 3U4VA 4B3SQ 3UDXA 4DUYL 4P71A 1EOVA 3J80i 3J80c 1YJ9A 1IBKQ 3M9BA 4DKAC 2ATWA 5HGQA 4BBSH 3H15A 1IBKL 3GTMH 3MEFA 1MIUA 3A5UA 2YU9H 2YYZA 4JBKA 4JYAQ 1L1OA 3TREA 4JBMA 4JYAL 1OXSC 3HKSA 1PH5A 3RNUA 1GO3E 3STBC 4B3RQ 4MTNA 5H1SE 1U0LA 4B3RL 4DR4Q 4PZ6A 1YITA 1WOCA 2E2JH 4DR4L 3ULPA 4MZ9A 4L5QA 4HJ8A 3CQZH 4GKJQ 1C9OA 3I4NH 3F1ZA 1VQ7A 4GKJL 5ELNA 5JJIA 3RLFA 4OONA 2KHIA 3EIVA 2EQSA 5IYBH 3S15H 1EQRA 4A4IA 4JI7Q 3H0GH 4JI7L 1S72A 1KIXA 4DV4Q 1EQQA 1I6HH 2DUDA 5C4XH 4LF4Q 4DV4L 1KRTA 4DV2L 1VQ6A 4LF4L 3DM3A 3NEMA 1X9NA 2BA1A 4DV0Q 4POGA 1LYLA 2Z6KC 2C35B 4DV0L 3RZDH 4X65Q 1YJNA 2NN6I 1B7YB 3RZOH 4DR3Q 3RN5A 1NY4A 1KL9A 2LXJA 3FHWA 4X65L 5C3EG 3ERSX 5M3FG 4DUZQ 1V1QA 2KHJA 2WB1G 2WFWA 4LWCA 3HOXG 4DUZL 4A3JH 1HR0W 1PVOA 5GAHC 3G6EA 1WI5A 3GTJH 3KYHC 2OWOA 1NE3A 4GOPB 4IO9A 1KC8C 4TVAB 3S2DH 3WWVA 5FLXc 2NVTH 1IXRA 3G48A 1G51A 5IYDG 1VQ9A 1ASZA 1YJWA 1JJGA 2JA7G 4IPDA 2N49A 1TWFH 4P74A 4L5RC 3AFPA 4IPGA 1XMOQ 1XMOL 4XIGS 4RMFA 1X56A 1N36Q 1N36L 1K8AC 1T9HA 2VQFQ 1C7YA 1AH9A 3MXNB 2VQFL 4IOAA 1UWVA 4A76A 3T1HQ 1C0AA 2JEAI 3T1HL 1PH7A 3HOVH 3PF5A 3HOYH 1E1TA 1YNXA 2VUMG 4C2MH 4JI5Q 4BBRG 3PO2H 5E7NA 4JI5L 3KLWA 2UXDQ 1CSPA 3CCSA 2UXDL 1I3QH 3PCOB 4O0AA 4DAYB 4HIOA 3W5OA 4QGUA 5GQOA 1XPRA 1LTLA 1VQFA 1JE5A 3ULJA 4BY1G 4OO1G 1CKMA 4OXPA 3CP0A 2UUBQ 4IFDG 2B3GA 2UUBL 1QVGA 1EUJA 3FP9A 3U4ZA 3GTGH 1CUKA 1KQSA 1L2FA 4GS3A 3CCEA 2KCMA 4GOPA 1EWIA 3OTOL 4X64Q 2ZJQA 1MJCA 3GD7A 4JG2A 4X64L 1TWAH 4YCUA 1RL2A 1HNWQ 1XNRQ 1Q7YC 2JA6H 1BBUA 1WFQA 3PUZA 1XNRL 2A19A 4JI8Q 5FLMG 3GTOH 1JJ2A 4JI8L 3M85A 4A3FG 1N32L 3S17H 4P75A 1YHAA 1K83H 1Y14B 4IJLA 5IYCH 4X6AH 4HIMA 4NPSA 1B8AA 4DK6C 2K5VA 2B63G 3U58A 1I94Q 1I94L 3PUXA 2UUAQ 2MNAA 1YZ6A 2UUAL 2I5MX 3B6YA 2BH2A 1X54A 2B29A 3GTKH 4EQ5A 4POFA 5IY0A 1NTGA 4C3HH 5JJKA 4JI3Q 3HOWH 1HZBA 4JI3L 2K75A 5M3MH 2JA8H 4DR6Q 3CCLA 4HJ9A 4DR6L 3KF6B 2WB1E 4DR2Q 1E3PA 5C44H 4DR2L 4A3LH 1B70B 1HJPA 2NVYH 1N9WA 2EIFA 5IP7H 3I4NG 1WYDA 3I2ZA 1KRSA 4A3EH 3ER0A 1YIJA 4P73A 4IFDJ 3TEHB 4GOPC 4BXXG 3I56A 3H0GG 3S1MH 2ZM6Q 2ZM6L 1X55A 3I4OA 1X6OA 1FL0A 3NENA 1VQOA 3ICEA 2A1AA 3KF8B 1QZHA 4DNIA 1SMXA 1SE8A 4R4QA 3CMEA 2I0QA 4B3SL 4LF6Q 4LF6L 4OO1I 4OX9Q 2I5HA 4IFDI 4L5TA 1VQDA 4OX9L 1A62A 5IP9H 3PIPA 1N8RC 4BY7H 4R4OA 4GNXA 4QQBX 4HJAA 3EBEA 3K81C 4QJFA 3HFZB 1XTDA 2D62A 2R93H 1Y1VH 4DPGA 3BZCA 4DV6Q 4YCVA 1FGUA 4PMWA 4DV6L 2CQOA 2NVQH 3ULLA 3F2CA 4A3KH 1KD1C 5C4JH 2UXBQ 3K0XA 5FJ8H 2UXBL 1CKOA 5GAEC 2JA5G 3UDGA 1HZCA 4APVA 3LGJA 3KF6A 1X65A 1XNQQ 1JT8A 2WAQG 2PQAB 3FKIG 1XNQL 2QGQA 1OXVA 2GVAA 1VQJA 1NMGA 2R6GA 1OXTA 4GN4B 2AKWB 1WJJA 2IHFA 1K0RA 3J81i 3HOVG 3J81c 1VQEA 4R4TA 4DR3L 2ID0A 3G71A 1Q46A 4YWKA 2UU9Q 1PH8A 3PO2G 1JJCB 2LXKA 4OWTB 3PIOA 1Y1WH 2UU9L 2EXDA 3HOZG 4LF8Q 4A93G 2Q2TA 5JJLA 3HOUH 4LF8L 4WJ4A 4HJ5A 4QL5A 3RLNA 3A0JA 4H02A 3E9HA 4PG3A 4K0KQ 1J6QA 4JV5Q 3BZKA 4DV7Q 1QVCA 4LW1A 1AE3A 4BA1I 2BA0A 2QA4A 4DV7L 4JV5L 1E1OA 1L1OC 3EN2A 4YWLA 4AYBG 4HIKA 1MKHA 4JI2Q 5BR8Q 5C0XG 3K7AH 3DLLA 1NJIC 3PO3H 4JI2L 5BR8L 5K36G 1UEBA 4FDBA 4JBJA 4A3BH 1A8VA 4A3IH 3CMAA 4PZ8A 1FVIA 2XGTA 1G6PA 4DR5Q 4YCWA 3H3VH 4DR5L 1MJEA 3I55A 2IX1A 1JB7A 2MFIA 2PI2E 1NBWA 3CCJA 1XMQQ 1K8GA 2L15A 4NXMQ 3HKZG 1XMQL 4NXML 4Y52H 4B3MQ 2CKZB 2PQAA 4B3ML 2YTVA 2JEBI 4DK3C 5IT9c 1YHQA 3S14H 1YBYA 1SROA 3M4PA 1I5FA 1K3RA 2IT1A 3UE0A 1PHJA 1VQCA 1A0IA 3CPFA 2MO1A 1S3OA 1U5KA 2UUCQ 2UXCQ 2R7ZG 2UUCL 4GLVB 4UP9A 2UXCL 2K5NA 1Q1EA 3CF5A 3M4QA 4DV1Q 4QIWE 4A3CH 1E24A 4DV1L 1X3FA 4A3LG 5IWAQ 3PSIA 1EFWA 4JI4Q 5IWAL 3I7FA 3HOXH 3GTLH 1QUQB 4WJ3M 4JI4L 4JCVE 1EIYB 1HNWL 2OQKA 2E2IH 4A3EG 1PH3A 1HR0Q 2HHHQ 2VS1A 2JA9A 1IYJB 3A5ZB 3OW2A 1HR0L 2HHHL 2A8VA 4AH6A 5IYDH 2D0PA 4A75A 5C0XJ 1PH9A 1PH6A 2JA7H 3L0OA 1Q82C 2RHQB 4GNXB 2WAQE 1PFSA 2F3IA 4L5SA 1G291 4ALPA 1V9PA 2R7FA 3HOZH 4BBSG 4YY3Q 4UP8A 4YY3L 5AJ3Q 1XPOA 4XTCS 5C0XI 5AJ3L 1Z47A 5IP9G 3M7NA 2YTXA 2Q2UA 2JK8A 2RHSB 4LUVA 4X66Q 1W2BA 1K73C 4BY7G 4X66L 4KHPQ 2NZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYY A;  1YHB A;  3PUY A;  4KHP L;  3CXC A;  5GRO A;  1Y1V G;  4BBR H;  2R93 G;  2NZO A;  3S1N H;  1VQB A;  4AIM A;  2PNH A;  2OQ0 A;  4C3J H;  4HID A;  1H95 A;  4A3G H;  4A3K G;  4R4I A;  1Q8K A;  2WP8 J;  4GKK Q;  1KXL A;  4IPH A;  4EX5 A;  4GKK L;  1KHI A;  1LM0 A;  2K4K A;  2K14 A;  3K80 C;  4UP7 A;  3A74 A;  5J3B A;  5IYB G;  3S1R H;  1PA6 A;  1CKN B;  4AYB E;  2GVB A;  1VQM A;  1IBM Q;  4BY1 H;  1VQ8 A;  1IBM L;  1QVF A;  4Y7N H;  4JC0 A;  3F2B A;  5C4X G;  1QUQ A;  5M5X H;  3Q8D A;  5LMN W;  2F52 A;  2K5H A;  2OCE A;  2Z0S A;  3E9I A;  3S1Q H;  1D8L A;  4JOI A;  2CCZ A;  3TRZ A;  2OTJ A;  5GAG C;  1LUZ A;  2GN5 A;  2KBN A;  2PI2 A;  2QEX A;  1Y1W G;  3CCV A;  1PH1 A;  3I4M H;  3HKZ E;  2YV5 A;  1DGS A;  3G4S A;  2RF4 A;  1HZA A;  1SR3 A;  4YWM A;  4A3J G;  5DLQ E;  1UE6 A;  5FLM H;  3JAM i;  3HOU G;  5ELO A;  3TS2 A;  3J81 j;  1I50 H;  2Y0S G;  2Z6K A;  2ES2 A;  4GLA C;  5JEA G;  2H5X A;  1EIF A;  1PYS B;  3RLO A;  1JMC A;  1BBW A;  1SRU A;  1VCI A;  2HQL A;  4PZ7 A;  2AHO B;  4O2D A;  1GVP A;  3PO3 G;  3NBH B;  1X3G A;  2BH8 A;  4LF7 Q;  4A3M H;  1PH2 A;  4A3I G;  4LF7 L;  1OTC A;  2E5L Q;  4A3B G;  4KI0 A;  2E5L L;  1GD7 A;  2XTI A;  4P72 A;  2VY3 A;  2V1C C;  1W3S A;  1TXY A;  3GO5 A;  3HOY G;  1P16 A;  1VS0 A;  3BU2 A;  4LUO A;  1BKB A;  1CKN A;  4TQU S;  2CWA A;  2HIX A;  4DR7 Q;  4DR7 L;  1EYG A;  4BA2 I;  3ZJY C;  3CW2 C;  3RN2 A;  2VL6 A;  2KCT A;  4RG1 A;  1E7Z A;  2ZJR A;  3AYH B;  3T1Y Q;  4DV3 Q;  2CWP A;  3T1Y L;  1VQ4 A;  4DV3 L;  1VQP A;  1E22 A;  4BXX H;  2IHE A;  4K0K L;  1UE5 A;  1WCM H;  4JOI C;  1FJG Q;  1NMF A;  1FJG L;  2ZTC A;  1PH4 A;  4JI6 Q;  4DV2 Q;  3CD6 A;  4JI6 L;  4A3D H;  4GNX C;  4NXN Q;  3M3Y H;  3KOJ A;  4NXN L;  3NEL A;  5HY6 A;  4A3C G;  3K8A A;  5LMN Q;  1VQI A;  2OTL A;  5LMN L;  1S40 A;  3PV0 A;  4ME3 A;  1R9T H;  1SFO H;  4R4C A;  3F8T A;  4UPA A;  1KAW A;  1ASY A;  2JA6 G;  3TQY A;  5JEA J;  2JE6 I;  2Q2H A;  3GTP H;  2LSS A;  1VQN A;  5IYC G;  3J7Z C;  3CC4 A;  1XPU A;  1D7Q A;  1CSQ A;  1A63 A;  4LF5 Q;  1TWG H;  2JA5 H;  4LF5 L;  2VQE Q;  3CCU A;  4OWW B;  1N34 Q;  2VQE L;  1YEZ A;  2ZTD A;  1Q12 A;  4HJ7 A;  3FKI H;  1N34 L;  2Q2I A;  1VQ5 A;  4DAM A;  3L2P A;  1IL2 A;  1SLJ A;  3SGI A;  1UE1 A;  1UE7 A;  1GKH A;  3RR5 A;  3HOW G;  5M3M G;  2ALY B;  5LMU Q;  1VQK A;  5LMU L;  2JA8 G;  1V43 A;  3UE1 A;  1K9M C;  1SN8 A;  5C44 G;  4JI0 Q;  3H3V I;  1VQA A;  5C3E H;  5M3F H;  3BJU A;  4JI0 L;  2Y0S E;  4B3T Q;  3S24 A;  2MO0 A;  2VZA A;  3KDF B;  3U50 C;  5IP7 G;  1VQL A;  4B3T L;  1BVS A;  3AEV A;  1TWC H;  4A3G G;  4A93 H;  3CC2 A;  4KLK A;  1OXX K;  4J15 A;  1P8L A;  2I5L X;  4IPC A;  5M5W H;  4IOC A;  1TWH H;  1YI2 A;  2R92 G;  2K52 A;  1Q81 C;  4LFB Q;  4LFB L;  1IZ6 A;  3D31 A;  4LFA Q;  4GLX A;  4LFC Q;  2IY5 B;  2K50 A;  4LFC L;  1YVC A;  4LFA L;  1X3E A;  2AMC B;  1Q86 C;  3L7Z C;  3OTO Q;  1O7I A;  1HNX Q;  1PV4 A;  1GM5 A;  1HNZ Q;  1HNX L;  2JQO A;  2RCN A;  4DR1 Q;  1HNZ L;  4NB3 A;  4DR1 L;  4MNO A;  4YHH Q;  4AQY Q;  1XJV A;  3I4M G;  3W1G A;  4YHH L;  4AQY L;  3CCM A;  3IRB A;  3CPW A;  3CCR A;  2IX0 A;  3TS0 A;  1PYB A;  2CFM A;  4QY7 A;  3GDE A;  5GAD C;  2KEN A;  2ASB A;  2VUM H;  1N32 Q;  2HIV A;  3PUV A;  1OXU A;  1L1O B;  1QZG A;  3E0E A;  1J5E Q;  2HT1 A;  2FXQ A;  4OWX B;  1Q1B A;  1VQH A;  2E8G A;  3UDF A;  5FJ8 G;  3CCQ A;  5M5Y H;  1J5E L;  3S16 H;  3KJO A;  3D0F A;  1L0W A;  1M90 C;  1Z9F A;  2AWO A;  2PMZ E;  4JBW A;  2R92 H;  3S2H H;  2DGY A;  3UDI A;  4A3M G;  1N33 Q;  1N33 L;  2N78 A;  3W1B A;  4R1J A;  3AQQ A;  4X62 Q;  2NN6 G;  2D0O A;  3KJP A;  1IBL L;  1IBL Q;  5EAY A;  4X62 L;  3KDF A;  4DV5 Q;  2R7Z H;  3PGZ A;  1AE2 A;  1RIP A;  4DV5 L;  3STB D;  4IJH A;  4UY8 C;  2VNU D;  3CAM A;  4C3I H;  2E2H H;  2VW9 A;  4KHZ A;  3F2D A;  3KFU A;  2ZTE A;  2R7D A;  4GN3 B;  3PF4 A;  2MQH A;  2ZJP A;  3JC6 6;  3JAM c;  3GTQ H;  1VQG A;  2AWN A;  4A3F H;  3VDY A;  4LF9 Q;  2N3S A;  4JI1 Q;  4LF9 L;  1HZ9 A;  4JI1 L;  4LUZ A;  3K7U C;  4GN5 A;  2F4V Q;  2B63 H;  1WCM G;  3CC7 A;  1HH2 P;  5IE8 A;  2NVX H;  2F4V L;  1M1K C;  2JJQ A;  3PUW A;  2YTY A;  2N8N A;  3AFQ A;  4LNQ A;  4DUY Q;  3J7A 5;  3M4O H;  4A3D G;  3U4V A;  4B3S Q;  3UDX A;  4DUY L;  4P71 A;  1EOV A;  3J80 i;  3J80 c;  1YJ9 A;  1IBK Q;  3M9B A;  4DKA C;  2ATW A;  5HGQ A;  4BBS H;  3H15 A;  1IBK L;  3GTM H;  3MEF A;  1MIU A;  3A5U A;  2YU9 H;  2YYZ A;  4JBK A;  4JYA Q;  1L1O A;  3TRE A;  4JBM A;  4JYA L;  1OXS C;  3HKS A;  1PH5 A;  3RNU A;  1GO3 E;  3STB C;  4B3R Q;  4MTN A;  5H1S E;  1U0L A;  4B3R L;  4DR4 Q;  4PZ6 A;  1YIT A;  1WOC A;  2E2J H;  4DR4 L;  3ULP A;  4MZ9 A;  4L5Q A;  4HJ8 A;  3CQZ H;  4GKJ Q;  1C9O A;  3I4N H;  3F1Z A;  1VQ7 A;  4GKJ L;  5ELN A;  5JJI A;  3RLF A;  4OON A;  2KHI A;  3EIV A;  2EQS A;  5IYB H;  3S15 H;  1EQR A;  4A4I A;  4JI7 Q;  3H0G H;  4JI7 L;  1S72 A;  1KIX A;  4DV4 Q;  1EQQ A;  1I6H H;  2DUD A;  5C4X H;  4LF4 Q;  4DV4 L;  1KRT A;  4DV2 L;  1VQ6 A;  4LF4 L;  3DM3 A;  3NEM A;  1X9N A;  2BA1 A;  4DV0 Q;  4POG A;  1LYL A;  2Z6K C;  2C35 B;  4DV0 L;  3RZD H;  4X65 Q;  1YJN A;  2NN6 I;  1B7Y B;  3RZO H;  4DR3 Q;  3RN5 A;  1NY4 A;  1KL9 A;  2LXJ A;  3FHW A;  4X65 L;  5C3E G;  3ERS X;  5M3F G;  4DUZ Q;  1V1Q A;  2KHJ A;  2WB1 G;  2WFW A;  4LWC A;  3HOX G;  4DUZ L;  4A3J H;  1HR0 W;  1PVO A;  5GAH C;  3G6E A;  1WI5 A;  3GTJ H;  3KYH C;  2OWO A;  1NE3 A;  4GOP B;  4IO9 A;  1KC8 C;  4TVA B;  3S2D H;  3WWV A;  5FLX c;  2NVT H;  1IXR A;  3G48 A;  1G51 A;  5IYD G;  1VQ9 A;  1ASZ A;  1YJW A;  1JJG A;  2JA7 G;  4IPD A;  2N49 A;  1TWF H;  4P74 A;  4L5R C;  3AFP A;  4IPG A;  1XMO Q;  1XMO L;  4XIG S;  4RMF A;  1X56 A;  1N36 Q;  1N36 L;  1K8A C;  1T9H A;  2VQF Q;  1C7Y A;  1AH9 A;  3MXN B;  2VQF L;  4IOA A;  1UWV A;  4A76 A;  3T1H Q;  1C0A A;  2JEA I;  3T1H L;  1PH7 A;  3HOV H;  3PF5 A;  3HOY H;  1E1T A;  1YNX A;  2VUM G;  4C2M H;  4JI5 Q;  4BBR G;  3PO2 H;  5E7N A;  4JI5 L;  3KLW A;  2UXD Q;  1CSP A;  3CCS A;  2UXD L;  1I3Q H;  3PCO B;  4O0A A;  4DAY B;  4HIO A;  3W5O A;  4QGU A;  5GQO A;  1XPR A;  1LTL A;  1VQF A;  1JE5 A;  3ULJ A;  4BY1 G;  4OO1 G;  1CKM A;  4OXP A;  3CP0 A;  2UUB Q;  4IFD G;  2B3G A;  2UUB L;  1QVG A;  1EUJ A;  3FP9 A;  3U4Z A;  3GTG H;  1CUK A;  1KQS A;  1L2F A;  4GS3 A;  3CCE A;  2KCM A;  4GOP A;  1EWI A;  3OTO L;  4X64 Q;  2ZJQ A;  1MJC A;  3GD7 A;  4JG2 A;  4X64 L;  1TWA H;  4YCU A;  1RL2 A;  1HNW Q;  1XNR Q;  1Q7Y C;  2JA6 H;  1BBU A;  1WFQ A;  3PUZ A;  1XNR L;  2A19 A;  4JI8 Q;  5FLM G;  3GTO H;  1JJ2 A;  4JI8 L;  3M85 A;  4A3F G;  1N32 L;  3S17 H;  4P75 A;  1YHA A;  1K83 H;  1Y14 B;  4IJL A;  5IYC H;  4X6A H;  4HIM A;  4NPS A;  1B8A A;  4DK6 C;  2K5V A;  2B63 G;  3U58 A;  1I94 Q;  1I94 L;  3PUX A;  2UUA Q;  2MNA A;  1YZ6 A;  2UUA L;  2I5M X;  3B6Y A;  2BH2 A;  1X54 A;  2B29 A;  3GTK H;  4EQ5 A;  4POF A;  5IY0 A;  1NTG A;  4C3H H;  5JJK A;  4JI3 Q;  3HOW H;  1HZB A;  4JI3 L;  2K75 A;  5M3M H;  2JA8 H;  4DR6 Q;  3CCL A;  4HJ9 A;  4DR6 L;  3KF6 B;  2WB1 E;  4DR2 Q;  1E3P A;  5C44 H;  4DR2 L;  4A3L H;  1B70 B;  1HJP A;  2NVY H;  1N9W A;  2EIF A;  5IP7 H;  3I4N G;  1WYD A;  3I2Z A;  1KRS A;  4A3E H;  3ER0 A;  1YIJ A;  4P73 A;  4IFD J;  3TEH B;  4GOP C;  4BXX G;  3I56 A;  3H0G G;  3S1M H;  2ZM6 Q;  2ZM6 L;  1X55 A;  3I4O A;  1X6O A;  1FL0 A;  3NEN A;  1VQO A;  3ICE A;  2A1A A;  3KF8 B;  1QZH A;  4DNI A;  1SMX A;  1SE8 A;  4R4Q A;  3CME A;  2I0Q A;  4B3S L;  4LF6 Q;  4LF6 L;  4OO1 I;  4OX9 Q;  2I5H A;  4IFD I;  4L5T A;  1VQD A;  4OX9 L;  1A62 A;  5IP9 H;  3PIP A;  1N8R C;  4BY7 H;  4R4O A;  4GNX A;  4QQB X;  4HJA A;  3EBE A;  3K81 C;  4QJF A;  3HFZ B;  1XTD A;  2D62 A;  2R93 H;  1Y1V H;  4DPG A;  3BZC A;  4DV6 Q;  4YCV A;  1FGU A;  4PMW A;  4DV6 L;  2CQO A;  2NVQ H;  3ULL A;  3F2C A;  4A3K H;  1KD1 C;  5C4J H;  2UXB Q;  3K0X A;  5FJ8 H;  2UXB L;  1CKO A;  5GAE C;  2JA5 G;  3UDG A;  1HZC A;  4APV A;  3LGJ A;  3KF6 A;  1X65 A;  1XNQ Q;  1JT8 A;  2WAQ G;  2PQA B;  3FKI G;  1XNQ L;  2QGQ A;  1OXV A;  2GVA A;  1VQJ A;  1NMG A;  2R6G A;  1OXT A;  4GN4 B;  2AKW B;  1WJJ A;  2IHF A;  1K0R A;  3J81 i;  3HOV G;  3J81 c;  1VQE A;  4R4T A;  4DR3 L;  2ID0 A;  3G71 A;  1Q46 A;  4YWK A;  2UU9 Q;  1PH8 A;  3PO2 G;  1JJC B;  2LXK A;  4OWT B;  3PIO A;  1Y1W H;  2UU9 L;  2EXD A;  3HOZ G;  4LF8 Q;  4A93 G;  2Q2T A;  5JJL A;  3HOU H;  4LF8 L;  4WJ4 A;  4HJ5 A;  4QL5 A;  3RLN A;  3A0J A;  4H02 A;  3E9H A;  4PG3 A;  4K0K Q;  1J6Q A;  4JV5 Q;  3BZK A;  4DV7 Q;  1QVC A;  4LW1 A;  1AE3 A;  4BA1 I;  2BA0 A;  2QA4 A;  4DV7 L;  4JV5 L;  1E1O A;  1L1O C;  3EN2 A;  4YWL A;  4AYB G;  4HIK A;  1MKH A;  4JI2 Q;  5BR8 Q;  5C0X G;  3K7A H;  3DLL A;  1NJI C;  3PO3 H;  4JI2 L;  5BR8 L;  5K36 G;  1UEB A;  4FDB A;  4JBJ A;  4A3B H;  1A8V A;  4A3I H;  3CMA A;  4PZ8 A;  1FVI A;  2XGT A;  1G6P A;  4DR5 Q;  4YCW A;  3H3V H;  4DR5 L;  1MJE A;  3I55 A;  2IX1 A;  1JB7 A;  2MFI A;  2PI2 E;  1NBW A;  3CCJ A;  1XMQ Q;  1K8G A;  2L15 A;  4NXM Q;  3HKZ G;  1XMQ L;  4NXM L;  4Y52 H;  4B3M Q;  2CKZ B;  2PQA A;  4B3M L;  2YTV A;  2JEB I;  4DK3 C;  5IT9 c;  1YHQ A;  3S14 H;  1YBY A;  1SRO A;  3M4P A;  1I5F A;  1K3R A;  2IT1 A;  3UE0 A;  1PHJ A;  1VQC A;  1A0I A;  3CPF A;  2MO1 A;  1S3O A;  1U5K A;  2UUC Q;  2UXC Q;  2R7Z G;  2UUC L;  4GLV B;  4UP9 A;  2UXC L;  2K5N A;  1Q1E A;  3CF5 A;  3M4Q A;  4DV1 Q;  4QIW E;  4A3C H;  1E24 A;  4DV1 L;  1X3F A;  4A3L G;  5IWA Q;  3PSI A;  1EFW A;  4JI4 Q;  5IWA L;  3I7F A;  3HOX H;  3GTL H;  1QUQ B;  4WJ3 M;  4JI4 L;  4JCV E;  1EIY B;  1HNW L;  2OQK A;  2E2I H;  4A3E G;  1PH3 A;  1HR0 Q;  2HHH Q;  2VS1 A;  2JA9 A;  1IYJ B;  3A5Z B;  3OW2 A;  1HR0 L;  2HHH L;  2A8V A;  4AH6 A;  5IYD H;  2D0P A;  4A75 A;  5C0X J;  1PH9 A;  1PH6 A;  2JA7 H;  3L0O A;  1Q82 C;  2RHQ B;  4GNX B;  2WAQ E;  1PFS A;  2F3I A;  4L5S A;  1G29 1;  4ALP A;  1V9P A;  2R7F A;  3HOZ H;  4BBS G;  4YY3 Q;  4UP8 A;  4YY3 L;  5AJ3 Q;  1XPO A;  4XTC S;  5C0X I;  5AJ3 L;  1Z47 A;  5IP9 G;  3M7N A;  2YTX A;  2Q2U A;  2JK8 A;  2RHS B;  4LUV A;  4X66 Q;  1W2B A;  1K73 C;  4BY7 G;  4X66 L;  4KHP Q;  2NZH A; 
#chains in the Genus database with same CATH topology
 2R93 G;  1EEF D;  1CFM A;  2XWJ B;  2IJ0 A;  2NZO A;  2F0E A;  3S1N H;  3RZO B;  4AIM A;  1EWH A;  2RDF A;  4R4I A;  1E2W A;  4IPH A;  4MHE A;  1KHI A;  1LM0 A;  2DY7 A;  2K14 A;  5J3B A;  3S1R H;  3R2T A;  2F0D A;  2GVB A;  1VQM A;  5C4H A;  5EKL A;  5LHY 1;  4Y7N H;  4DXF A;  1TWF B;  1LT4 D;  1TS5 A;  3Q8D A;  5LMN W;  2F52 A;  3S1Q H;  4RGT A;  2CCZ A;  2OTJ A;  3DWA A;  1HQR D;  1PH1 A;  1Y1W G;  1SYG A;  4DK0 A;  2RF4 A;  5ELO A;  3OMG A;  1IL8 A;  1PZK D;  1HFG A;  4R8I A;  2N55 A;  2H5X A;  1EIF A;  1I3Q B;  2VXW A;  4C56 C;  3Q24 A;  1JMC A;  1BBW A;  4K6D A;  1PDQ A;  1TWH B;  2Z4I A;  4BS9 A;  3K5L A;  2AQ3 B;  4A3M H;  4KI0 A;  2NN6 H;  5EKI A;  4NP5 A;  2KUM A;  1EZ8 A;  2KEC A;  2V1C C;  4FF4 A;  3HOY G;  1VS0 A;  2AUJ D;  1CT1 D;  1TWA B;  3FEW X;  4DR7 Q;  1AEX A;  3V96 A;  2PW7 A;  4FYD A;  4DR7 L;  3ZJY C;  3RN2 A;  1GUN A;  4JW0 A;  1O7L A;  4NMZ A;  1E22 A;  2X69 A;  4BXX H;  5IGD A;  1FJG Q;  4JOI C;  1M4V A;  1NMF A;  1FJG L;  1SJE D;  5L37 A;  2K28 A;  4NXN Q;  3J7A F;  4NXN L;  1GUS A;  4DNR B;  4A3C G;  4EVO A;  3K8A A;  2EDG A;  1G8Z D;  3ONA B;  2R7Z B;  2F0F A;  2JA8 B;  1DXM A;  1KAW A;  1U4P A;  5JEA J;  2JE6 I;  3GP7 A;  1DOL A;  5IYC G;  4OEM B;  3CC4 A;  1CSQ A;  1A63 A;  3D4R A;  3HZX A;  4LF5 Q;  1TWG H;  3GTQ B;  4LF5 L;  1AZP A;  3K59 A;  1HHV A;  1I6V C;  2Q2I A;  2Z4H A;  1SLJ A;  3KK7 A;  1PZJ D;  2V4D A;  3L3O C;  3RR5 A;  5FO9 B;  5M3M G;  1GHK A;  3UI2 A;  3VA7 A;  4FXK C;  2Z9H A;  3EA6 A;  5C3E H;  3U50 C;  5IP7 G;  1C0A A;  4A93 H;  3DEO A;  4ID6 A;  4RGN A;  1OXX K;  1X32 A;  4DA2 A;  1S5C D;  5ELF A;  4RHS A;  2O4X A;  4WOR A;  2ZXR A;  4LFC Q;  2K50 A;  4LFC L;  2RCN A;  2EJG C;  4MNO A;  4YHH Q;  4PNY A;  4AQY Q;  1XJV A;  5C4X B;  4YHH L;  4AQY L;  3CCM A;  5E3F A;  2CFM A;  2ENB A;  5GAD C;  5A2Q E;  2KEN A;  1SDF A;  4F7X A;  1QCB D;  1HRJ A;  3PUV A;  4OWX B;  1VQH A;  3S16 H;  1XTC D;  1AZQ A;  1MSG A;  2PMZ E;  3S2H H;  2DJF C;  4A3M G;  3KJP A;  4R1J A;  2M00 A;  2NN6 G;  1KAA A;  1SMY C;  3PGZ A;  4IJH A;  3CAM A;  4A3I B;  4F8M A;  2VW9 A;  2FHT A;  4GN3 B;  5G3L D;  1STA A;  3AB9 A;  3MVV A;  3T51 B;  4LF9 Q;  4JI1 Q;  2EYL A;  4LF9 L;  4JI1 L;  3TP8 A;  4GN5 A;  1S5B D;  1SYE A;  2F3W A;  1PTO H;  4TKO B;  1F2M A;  2NUC A;  5EJW A;  3FDT A;  3M4O H;  3UDX A;  3QR8 A;  4RGM A;  4BBS H;  3M9B A;  4FNF A;  3H15 A;  3A56 A;  3MEF A;  1WTW A;  1MIU A;  4H0L C;  2PMZ B;  4JBM A;  1FGB D;  3RNU A;  5H1S E;  1WTX A;  1BXT A;  1YIT A;  4L5Q A;  2QIL A;  3CQZ H;  3HOX B;  4K14 A;  1ROD A;  5EPL A;  5JJI A;  3RLF A;  1E2V A;  4K6L A;  5I6Y A;  1RTO A;  5IYB H;  1EQR A;  2F0I A;  4JI7 Q;  4JI7 L;  3VYT A;  3A54 A;  1I6H H;  4HN7 A;  1KRT A;  1F9S A;  4DV2 L;  4F88 A;  4DV0 Q;  1EFI D;  4POG A;  1LYL A;  2Z6K C;  1V1O A;  3A7L A;  4C3H B;  4DV0 L;  2NN6 I;  3RZO H;  1NY4 A;  5C3E G;  2PYK A;  3DEP A;  3HRZ C;  3ERS X;  1V1Q A;  2KHJ A;  4LWC A;  1ZXT A;  1PVO A;  1I4G A;  1W6K A;  3GTJ H;  1IXR A;  1STN A;  3G48 A;  1SAP A;  2NVY B;  2BE5 D;  1ASZ A;  1YJW A;  1PRT F;  2IWH A;  1TWF H;  2KJX A;  2Z1C A;  1TII D;  4RMF A;  3J7Y W;  1N36 Q;  1N36 L;  1K8A C;  3S1M B;  2EJF C;  4L8J A;  3MXN B;  4L6T B;  3C1F A;  2JEA I;  1IW7 D;  1PH7 A;  3NTK A;  1HQM C;  1B1Z A;  4BBR G;  3MHB A;  1CSP A;  3I4M B;  1I3Q H;  2C9O A;  2K5Q A;  4O0A A;  4DAY B;  5FLX E;  4IUU A;  3W5O A;  1JE5 A;  2SDF A;  1EY7 A;  3ULJ A;  1G2T A;  3K57 A;  4IFD G;  1QVG A;  3OMC A;  1CUK A;  1BQQ T;  3U9O A;  1EWI A;  5IIF A;  1A6X A;  5EKK A;  3A8I E;  4JG2 A;  1TWA H;  1RHP A;  2LMC B;  1N32 L;  4IJL A;  4X6A H;  4NPS A;  3H6M A;  2B8G A;  1SXT A;  1PRT B;  2MNA A;  1NSN S;  1BCP B;  2MGS A;  1LTI D;  1WCM B;  1DJR D;  1ZYR C;  5EBD A;  3HOW H;  4A3D B;  2JA8 H;  3I73 A;  3KF6 B;  2D2C C;  3RUZ A;  1E3P A;  5C44 H;  1PZI D;  3X3N A;  4KN4 C;  2F0Q A;  5CV4 A;  1WYD A;  3I2Z A;  1UAP A;  4GOP C;  1TVX A;  2CHB D;  4RKL A;  1AP0 A;  1SE3 A;  2J4X A;  5J39 A;  1EY5 A;  4B3S L;  1SE8 A;  3FKI B;  2I5H A;  4IFD I;  1V1P B;  4QF4 A;  4DXG A;  1EY0 A;  4V0B A;  1U4L A;  3K81 C;  3HFZ B;  2D62 A;  1CHQ D;  4DPG A;  3BZC A;  1BR9 A;  1FGU A;  4PMW A;  4MIU A;  5JAV A;  4KY7 A;  2PQE A;  2UXB Q;  1PXU A;  3CRK C;  4HSP A;  3K0X A;  5FJ8 H;  2UXB L;  2JA5 G;  3UDG A;  5D3I B;  1WTV A;  5M5W B;  3D4D A;  3KF6 A;  5KYL A;  1GUG A;  2PQA B;  2GVA A;  3NXW A;  2R6G A;  3KBG A;  3FVQ A;  2AKW B;  1WJJ A;  3SHL A;  1XYI A;  1Z6H A;  3PIO A;  2EXD A;  1ENC A;  1LO5 D;  5JJL A;  2A69 C;  2QF7 A;  2FMC A;  3A0J A;  4H02 A;  3OPO A;  3H91 A;  2IW3 A;  3VR3 A;  4DV7 Q;  4BA1 I;  2QA4 A;  1AE3 A;  4DV7 L;  1V1P A;  4HIK A;  3DLL A;  5CC4 A;  2RA4 A;  1LT6 D;  1A15 A;  4A3I H;  3CMA A;  1FVI A;  4Y7N B;  4DR5 Q;  1YNJ C;  3H3V H;  4DR5 L;  4XT3 B;  2OEO A;  2MFI A;  1ICW A;  1SBB B;  4Y52 H;  2PQA A;  2JEB I;  3VYR A;  3SEB A;  3NUC A;  2TSS A;  3IAY A;  1DOK A;  1A3T A;  1A0I A;  1QOH A;  3A7A B;  5I9P A;  5JVH 3;  2NVX B;  1U5K A;  2UUC Q;  5IGF A;  2R7Z G;  2UUC L;  4GLV B;  3I3C A;  2K5N A;  4C3I G;  5KGU A;  1E24 A;  1X3F A;  3GTM B;  2NTS A;  1EFW A;  1NR2 A;  3HOX H;  1QUQ B;  4JCV E;  1LLR D;  4G4K A;  1PH3 A;  1T5X D;  3OW2 A;  5IT9 E;  2E2J B;  4AH6 A;  3I91 A;  1SND A;  1EYD A;  4FXG C;  2WKC A;  3L0O A;  1B53 A;  1ET6 A;  1WVL A;  1PFS A;  2F3I A;  1V9P A;  1EIG A;  3EVQ A;  4UP8 A;  4N8X 1;  5AJ3 Q;  1XPO A;  4H44 C;  5AJ3 L;  2Q2U A;  4LUV A;  1VQL A;  2LFN A;  3CXC A;  5GRO A;  1LTT D;  2OQ0 A;  4KMU C;  1H95 A;  4G57 A;  1Q8K A;  2WP8 J;  2HQE A;  2EY2 A;  1F77 A;  4UP7 A;  1PA6 A;  4AYB E;  3BVM A;  2WV6 D;  1QVF A;  4JC0 A;  1TWG B;  4KV6 A;  1VMC A;  5C4X G;  1QUQ A;  1EY8 A;  3E9I A;  1HUM A;  2K5H A;  2Z0S A;  1D8L A;  2XNA C;  5GAG C;  1LUZ A;  2KBN A;  3I4M H;  1DGS A;  1HZA A;  4YWM A;  5DLQ E;  5FLM H;  2B8F A;  3JAM i;  1CQV A;  4C2M B;  1SE2 A;  2Z6K A;  4GLA C;  1Q3L A;  5JEA G;  2QKI C;  1PYS B;  2XVS A;  4ZKC B;  4A93 B;  4KY5 A;  2AHO B;  4O2D A;  3NBH B;  4LF7 Q;  5HUR A;  1BDO A;  1Q8I A;  4A3I G;  4LF7 L;  2E5L Q;  1SNM A;  1PTO F;  2E5L L;  3Q23 A;  1SNC A;  2A6E C;  4AYB B;  3J80 L;  5CBE E;  3GO5 A;  4LUO A;  2E76 C;  1BKB A;  3PIO 3;  4TQU S;  4KKU A;  2VL6 A;  4RG1 A;  2SOB A;  3AYH B;  1PLF A;  3T1Y Q;  3KBX A;  2CWP A;  4DV3 Q;  1NNX A;  3T1Y L;  1VQP A;  4DV3 L;  3S17 B;  2IHE A;  2WIN B;  1UE5 A;  3IL8 A;  1WCM H;  5FO8 B;  2KVM A;  4A3D H;  4GNX C;  4P2C B;  1GXD C;  2F0P A;  1Y8P B;  3J7A V;  2OTL A;  2BDO A;  1F9R A;  3PV0 A;  4ME3 A;  4O42 A;  3F8T A;  2Q2H A;  1HXY D;  1B9M A;  3NBH A;  5JVG 3;  4WJW A;  2LSS A;  2E75 C;  3X3M A;  5DM6 3;  1JE4 A;  1WTQ A;  4K2K A;  4A3E B;  5FLX L;  1TS4 A;  5J1Z A;  2VQE Q;  4RA8 A;  1N34 Q;  2VQE L;  1YEZ A;  2ZTD A;  1CA5 A;  1SJH D;  1N34 L;  3FKI H;  1VQ5 A;  4C3H G;  1UE1 A;  5CBA E;  2ALY B;  4S3S A;  5C5L A;  4BBS B;  1V43 A;  3UE1 A;  1K9M C;  1HUN A;  3I90 A;  3H3V I;  1VQA A;  3BJU A;  2Y0S E;  3EFX D;  4FF3 A;  3KDF B;  2EY5 A;  4HMJ A;  1F2L A;  5IGE A;  2GA4 B;  4J15 A;  2WAC A;  1P8L A;  1JOK A;  1O7Z A;  5M5W H;  1YI2 A;  2K52 A;  4EGV A;  4A3K B;  2RSN A;  5COR A;  1IZ6 A;  4GLX A;  4LFA Q;  1RCV D;  1SMY D;  4I7Z C;  1SYB A;  5CR3 A;  4LFA L;  3ERQ A;  4I65 A;  1IYV A;  5BN3 A;  3L7Z C;  3OTO Q;  1EWC A;  1PV4 A;  1GM5 A;  2RBM A;  4DR1 Q;  4B9X A;  4DR1 L;  3I4M G;  3O13 A;  2MPM A;  3IRB A;  1CM9 A;  1JB3 A;  3HP3 A;  4XT1 B;  1RF2 D;  2M9V A;  1QB5 D;  1OXU A;  2B2T A;  1X3Q A;  3L9A X;  3E0E A;  2L11 A;  1K28 A;  1U4R A;  3HEJ A;  1WTH A;  2FXQ A;  2HT1 A;  3HOU B;  3UDF A;  1F9P A;  5C3X A;  5M5Y H;  3GTJ B;  2L55 A;  2Y0S B;  3D0F A;  1EQT A;  1Z9F A;  1RD9 D;  2DGY A;  3UDI A;  1IBL Q;  2LS0 1;  2D0O A;  3SR1 A;  4PV1 C;  1IBL L;  5EAY A;  4DV5 Q;  3KDF A;  1ESR A;  3PO3 B;  1AE2 A;  4DV5 L;  1U9R A;  4UY8 C;  2EOT A;  4ZUI A;  2F4I A;  2VNU D;  4KHZ A;  3KFU A;  2ZTE A;  2P5Z X;  2MQH A;  2ZJP A;  1EYA A;  1K0S A;  1VQG A;  2AWN A;  4J8Q A;  2N3S A;  4RAU C;  4DF7 A;  3FPU B;  1CI3 M;  3C1E A;  1WCM G;  3CC7 A;  1HH2 P;  1UNS A;  2NVX H;  1TS3 A;  4F87 A;  3PUW A;  2N8N A;  2CQA A;  2A5H A;  2FFK B;  3J7A 5;  4A3D G;  4P71 A;  3PF4 A;  1IBK Q;  4BWG B;  5HGQ A;  1IBK L;  3GTM H;  4CKC A;  3NTI A;  4JBK A;  4JYA Q;  5FOB B;  1TKW B;  4JYA L;  4DN4 M;  1PH5 A;  1GO3 E;  4IUQ A;  3STB C;  4MTN A;  1U0L A;  4PZ6 A;  1WOC A;  2E2J H;  2F0G A;  4CDC C;  1VQ7 A;  3RD4 A;  3H94 A;  2E74 C;  2DJG C;  5C6A A;  2A74 C;  1C8C A;  4OL7 A;  3OHX C;  5FKA C;  4LF4 Q;  4LF4 L;  3DM3 A;  2BA1 A;  3HOZ B;  2C35 B;  1B7Y B;  4DR3 Q;  1GUO A;  1KL9 A;  2LXJ A;  3HOW B;  4DR3 L;  1JC7 A;  1HR0 W;  4A3J H;  1D5M C;  5GAH C;  2X6G A;  3KYH C;  4ILW A;  4N9T A;  5C44 B;  2KQ3 A;  1D1K A;  1FNU A;  4A3G B;  1JWM D;  1LTG D;  4P74 A;  1FNW A;  2XWB B;  1GJX A;  2BDN A;  1Y69 U;  4XIG S;  4BY1 B;  3BS1 A;  3VR6 A;  3T4A C;  3BDO A;  1C7Y A;  2B2W C;  1AH9 A;  4A76 A;  4KY6 A;  3PF5 A;  3MEH A;  4C2M H;  4JI5 Q;  4JI5 L;  3DUZ A;  5AFW A;  2UXD Q;  2KA7 A;  3CCS A;  4H13 C;  2UXD L;  1JWU D;  4HIO A;  2J0T D;  3VYS A;  3M7G A;  4IUP A;  1IHZ A;  3MXU A;  4QGU A;  1I50 B;  5IT9 L;  1EIH A;  4IUN A;  5IOC A;  3CP0 A;  2UUB Q;  2UUB L;  5K36 H;  1L2F A;  3T13 A;  3CCE A;  2FIN B;  1SEB D;  1CZW A;  2ZJQ A;  4X64 Q;  4KTA A;  3GD7 A;  3NSW A;  4X64 L;  4YCU A;  1RL2 A;  4G7H C;  1XNR Q;  1B3A A;  2JA6 H;  1WFQ A;  1XNR L;  3TP5 A;  3M85 A;  3S17 H;  4QCL A;  3I8Z A;  1XWE A;  4HIM A;  3BG3 A;  3U58 A;  2K1B A;  3DMU A;  3PUX A;  3ZYY X;  2PZW A;  2I5M X;  4HED A;  2BH2 A;  2PPB C;  2F1M A;  1NTG A;  5CGK A;  4JI3 Q;  1HZB A;  4JI3 L;  1ESF A;  4DR6 Q;  3M3Y B;  3DXJ C;  2MUY A;  1D2B A;  4HJ9 A;  4DR6 L;  1HA6 A;  2WB1 E;  2R61 A;  4DR2 Q;  4A3L H;  4DR2 L;  4CGY B;  2A68 C;  2TMP A;  1RDP D;  3URY A;  1R9T B;  3D4W A;  2K33 A;  1KRS A;  4A3E H;  3R8B A;  3G6J B;  3V05 A;  4ZKB B;  2DN8 A;  1M8A A;  4BXX G;  2F03 A;  2KCC A;  1F2Z A;  3I4O A;  5D3D A;  1FL0 A;  2CW0 C;  3ICE A;  1QZH A;  4LF6 Q;  1SMX A;  4R4Q A;  3CME A;  4LF6 L;  4L5T A;  1VQD A;  3LX0 A;  5I4D A;  1SSO A;  4R4O A;  4GNX A;  3MA2 B;  4QQB X;  2A69 D;  1NUC A;  4ODG A;  3OIP A;  2BOS A;  1LV9 A;  2WB1 B;  3F2C A;  4A3K H;  1MBY A;  1FNV A;  1TWC B;  4XQQ A;  4ZUJ A;  3N6R A;  4ZRZ A;  3P20 A;  4APV A;  2ICE C;  1XNQ Q;  1XNQ L;  2QGQ A;  1JOO A;  1OXV A;  2ICI A;  1YNJ D;  2PW5 A;  4GN4 B;  3SDZ A;  3J80 E;  4CKE A;  2IHF A;  1K0R A;  5A35 A;  3J81 i;  3J81 c;  4R4T A;  3G71 A;  4YWK A;  4OWT B;  3G7L A;  4A93 G;  2Q2T A;  3HOU H;  3NTH A;  3MC0 B;  2VUM B;  1WD0 A;  4K0K Q;  4PG3 A;  1J6Q A;  4JV5 Q;  2JYO A;  3BZK A;  4JV5 L;  3QO2 A;  1E1O A;  1L1O C;  4EQN A;  4YWL A;  4AYB G;  1NJI C;  1MKH A;  5BR8 Q;  3OIQ A;  1BCP F;  3PO3 H;  4B9W A;  5BR8 L;  1Q90 A;  1UEB A;  5K36 G;  3TZU A;  1A8V A;  4PZ8 A;  3C2P A;  1G6P A;  3LWU A;  1KNA A;  3KLS A;  1MJE A;  3I55 A;  1L0Y B;  2HCC A;  2E2H B;  4NXM Q;  2L15 A;  4ZCK A;  2F3V A;  4NXM L;  4R8N A;  2YTV A;  4DK3 C;  3S14 H;  2AQ2 B;  2IPK D;  1K3R A;  2IT1 A;  2XN9 C;  3QJY A;  1PHJ A;  2B63 B;  5HGT A;  3CPF A;  1S3O A;  1U4M A;  4K5W A;  4UP9 A;  2FJ2 A;  3QG1 A;  1Q1E A;  3T16 A;  2XRQ D;  2J7Z A;  4DV1 Q;  4ZK9 B;  2RCF A;  4DV1 L;  4A3L G;  5IOD A;  3HG9 A;  3MFG A;  2YU9 B;  3SK6 A;  4MN3 A;  1PFN A;  4IUV A;  3TZD A;  2X6L A;  2F0L A;  4A3E G;  1HR0 Q;  1VF5 C;  2F0M A;  2VS1 A;  2A8V A;  1HR0 L;  1HCZ A;  5IYD H;  5I2X A;  4A75 A;  1FR3 A;  2ZXP A;  2JA7 H;  3I4N B;  2RHQ B;  1B3Q A;  2ZT9 C;  2WAQ E;  1STY A;  4ALP A;  3VA5 A;  3HOZ H;  4BBS G;  1DD2 A;  3H0G B;  1LTR D;  2KHS A;  3A8K E;  4XTC S;  3M7N A;  5JPM C;  3I72 A;  1TY2 A;  2RHS B;  1W2B A;  1K73 C;  3OYY A;  1F2Y A;  1YHB A;  3PUY A;  4IZ8 A;  3RZD B;  1VQB A;  4OIJ A;  2PNH A;  4C3J H;  4HID A;  4A3G H;  4A3K G;  1C4Q A;  4NKL A;  1JWS D;  2K4K A;  3K80 C;  5IYB G;  3A74 A;  2F0N A;  1CKN B;  1IBM Q;  3OW7 A;  4CJ1 B;  1VQ8 A;  1A3U A;  2H1E A;  1IBM L;  4BY1 H;  4OO1 H;  1HFN A;  1EL0 A;  2A6E D;  3F2B A;  1MGS A;  1O80 A;  5M5X H;  4E6I A;  2WAQ B;  2I07 B;  1JQY D;  4JOI A;  3TRZ A;  2RVL A;  2GN5 A;  3Q6S A;  2QEX A;  4KD4 A;  5E1F A;  4JVZ A;  3HKZ E;  2LKV A;  2YV5 A;  3G4S A;  1D6E C;  1SR3 A;  3HOV B;  3HOU G;  4RCO A;  3J81 j;  1I50 H;  2Y0S G;  4KJN A;  5KYI A;  2RDH A;  1SRU A;  1VCI A;  2HQL A;  4PZ7 A;  5I9O A;  1II3 A;  5I2Y A;  3PO3 G;  1X3G A;  2BH8 A;  1PH2 A;  1JCK B;  1ONL A;  1QWY A;  1QG7 A;  4XQN A;  2XTI A;  3GTG B;  4DK1 A;  2VY3 A;  4IUT A;  1PTO C;  1W3S A;  5COY A;  2IL8 A;  3BU2 A;  1CKN A;  2B2W A;  3D3R A;  1TQO A;  4CBV A;  1H9S A;  2DY8 A;  4BA2 I;  4X3K A;  2ZJR A;  3HS0 C;  3HKZ B;  2MJ8 A;  1K83 B;  1SYF A;  1TS2 A;  1R4P B;  4RGO S;  2RDG A;  4JI6 Q;  4JI6 L;  5M5Y B;  3M3Y H;  5HY6 A;  2EVB A;  2D5D A;  3GTK B;  4UHV A;  1R9T H;  5M3M B;  1SFO H;  1ASY A;  4UPA A;  3TQY A;  1S5E D;  3GTP H;  5IGB A;  1VQN A;  3RMH A;  1KNE A;  1B50 A;  3R3O A;  1RKN A;  5ISR A;  3KLS X;  5E4W C;  2K01 A;  2F0O A;  2EZV A;  3BZD B;  3HOZ G;  4WFN 3;  1CQF A;  1IL2 A;  3SGI A;  1UE7 A;  3VR2 A;  1H9J A;  3HOW G;  3K6O A;  5LMU Q;  1VQK A;  2EPB A;  2HDM A;  4IQZ A;  5LMU L;  4QB4 A;  2JA8 G;  4RKB A;  2DNC A;  4XDX A;  4RWS C;  5C44 G;  1KTK A;  1STE A;  4B3T Q;  3BVZ A;  4A3G G;  4BY7 B;  4B3T L;  1TWC H;  3NHH A;  3LWE A;  4KLK A;  1Y1V B;  4L63 B;  2I5L X;  4KN7 C;  1Q81 C;  2NVQ B;  4ABN A;  4EQO A;  3K5N A;  2G5D A;  4EQP A;  3SK8 A;  2IY5 B;  1TY0 A;  5C0X H;  1ZEQ X;  1H9K A;  1O7I A;  1HNX Q;  2A6H C;  1HNZ Q;  4J1M A;  2JQO A;  1HNX L;  1EU3 A;  1I4Q A;  2QDL A;  4NB3 A;  3I70 A;  1HNZ L;  1K8O A;  3CPW A;  3CCR A;  3TS0 A;  1PYB A;  1QJO A;  4QY7 A;  3GDE A;  5CV6 A;  3HGB A;  2ASB A;  3M4Y A;  2VUM H;  2HIV A;  1D5X C;  3P7J A;  1MI2 A;  1L1O B;  1I4X A;  1QZG A;  1J5E Q;  4A3J B;  1MSH A;  3PMF A;  1Q1B A;  1J5E L;  5FJ8 G;  3CCQ A;  1S5F D;  3CU7 A;  1AN8 A;  1WTO A;  1L0W A;  2O2L D;  3EJI A;  2AUK A;  2AWO A;  4XQJ A;  2Q8I B;  2N78 A;  3W1B A;  3AQQ A;  2B2U C;  5CMD A;  5J22 A;  3FPP A;  3PQI A;  3STB D;  1A2T A;  4A3B B;  2E2H H;  5EBC A;  3F2D A;  4K5X A;  1KDB A;  2R7D A;  1TT2 A;  1I4P A;  2F0S A;  3NE5 B;  1EY9 A;  2HD3 A;  3JC6 6;  1IKM A;  3JAM c;  1DON A;  3E0J A;  1D1I A;  1SE4 A;  2G9D A;  3VDY A;  1BBX C;  1HZ9 A;  1UUP A;  3OWF A;  4X3U A;  2B63 H;  2L1B A;  4ZYS A;  1M1K C;  5NUC A;  4LNQ A;  2YTY A;  1EOV A;  2ATW A;  1YJ9 A;  4DKA C;  2YU9 H;  5DNF A;  1L1O A;  2EJM A;  1OXS C;  1YNN C;  3HKS A;  4ZAI A;  5G3L F;  3BDC A;  4B3R Q;  4B3R L;  2A73 B;  4MZ9 A;  4HJ8 A;  3GTL B;  4GKJ Q;  1C9O A;  3I4N H;  1WD1 A;  2JA6 B;  5ELN A;  4GKJ L;  1ILP A;  1LT5 D;  2KHI A;  2EQS A;  2K04 A;  4A4I A;  3H0G H;  5T1G A;  1K8M A;  1S72 A;  1KIX A;  4HTH A;  1EQQ A;  1K3B C;  1GUW A;  1VQ6 A;  1RTN A;  1D5Z C;  2KCN A;  3NEM A;  2MHV A;  1YJN A;  3RZD H;  4PQX A;  3RN5 A;  3FHW A;  1AFP A;  4DUZ Q;  2WB1 G;  2WFW A;  3HOX G;  4DUZ L;  4CJ0 B;  1WI5 A;  4GOP B;  2F0U A;  4TVA B;  4XYQ A;  4GZY C;  1VQ9 A;  3E3X A;  4HCE A;  1JOQ A;  4IPD A;  5I6W A;  2PZT A;  3AFP A;  4LMQ D;  2R92 B;  3NPP A;  4U68 A;  4M1U B;  1T9H A;  2IX3 A;  4IOA A;  3T1H Q;  2K32 A;  3T1H L;  3HOV H;  2E2D C;  3HOY H;  4HSV A;  1EQV A;  3CKI B;  2VUM G;  1PMR A;  5E7N A;  1ZKO A;  3KLW A;  4QMG A;  3PCO B;  3H3V C;  4FF2 A;  1LTL A;  5D14 A;  4RH6 A;  1CKM A;  3AU7 A;  4MTK A;  2B3G A;  3E5S A;  1EUJ A;  3FP9 A;  3U4Z A;  3GTG H;  3OSO A;  1ENA A;  3D8G A;  2KCM A;  4GOP A;  3OTO L;  2A68 D;  1HNW Q;  4CDF C;  2F0H A;  4K8I A;  1Q7Y C;  5CYU A;  1BBU A;  4JI8 Q;  5FLM G;  4DFA A;  1JJ2 A;  1B2T A;  4JI8 L;  1K83 H;  5IYC H;  1B8A A;  4DK6 C;  1H9R A;  2K5V A;  2B63 G;  2CW0 D;  2UUA Q;  2DNE A;  3MTS A;  5FK9 C;  2UUA L;  2SEB D;  2B29 A;  2EE1 A;  3GTK H;  4EQ5 A;  1EOT A;  1BNZ A;  2OF1 A;  4N8F A;  5M3M H;  4G7O C;  2Q8R E;  3CCL A;  5EGT A;  1G2S A;  3W2D A;  1HJP A;  4K2L A;  5IP7 H;  2SNS A;  2BCO A;  3I4N G;  1A2U A;  2WII B;  1DM0 B;  4TRD A;  3ER0 A;  1YIJ A;  4DAV A;  3TEH B;  3NBI A;  3SK4 A;  1B44 D;  3I56 A;  3H0G G;  3S14 B;  1NR4 A;  1X55 A;  1CA6 A;  4H7B A;  2JA5 B;  3NEN A;  4DNI A;  2I0Q A;  2VB3 X;  5ELD A;  3PIP 3;  1A62 A;  4BY7 H;  5BN4 A;  5C4Z A;  1J9O A;  2M2L A;  4N9P A;  3EBE A;  2EY1 A;  1LT3 D;  1XTD A;  1MD2 D;  1Y1V H;  4YCV A;  5CV7 A;  5M3F B;  2CQO A;  2NVQ H;  2EYJ A;  3ULL A;  3JAM L;  1CKO A;  3IFT A;  1HZC A;  4LJZ C;  4Q5V A;  3NP8 A;  1X65 A;  1JT8 A;  2WAQ G;  3FKI G;  4NW2 A;  2JA7 B;  1VQJ A;  4OGQ C;  1A3V A;  1OXT A;  1CZG A;  2R3Z A;  3D6W A;  3HOV G;  2UU9 Q;  1CHP D;  1PH8 A;  1JJC B;  2LXK A;  2UU9 L;  3LNN A;  4LF8 Q;  4LF8 L;  3W3A A;  2PNR C;  3RLN A;  1TU2 B;  2PCF B;  4C3J B;  1QVC A;  1TR5 A;  5JJZ A;  3EQL C;  1EZ6 A;  3EN2 A;  4JI2 Q;  1S4Z A;  4JI2 L;  1PRT C;  4FDB A;  4A3B H;  3K5M A;  1BCP C;  4XYO A;  1VMP A;  3J81 E;  5ELC A;  3WOE A;  5M5X B;  4JK1 C;  2IX1 A;  1JB7 A;  2O5I C;  3CCJ A;  2PI2 E;  1EU4 A;  1NBW A;  4C3I B;  1XMQ Q;  4K8J A;  3HKZ G;  1XMQ L;  4B3M Q;  4B3M L;  3H09 A;  1YBY A;  4HCS A;  1SRO A;  3M4P A;  1BOS A;  4QUF A;  4A3F B;  3OWE B;  4C1N I;  2JXM B;  2L12 A;  3BYY B;  1ZYR D;  4IN3 A;  4OHJ A;  1VQC A;  1PFM A;  4DU9 A;  2I46 A;  1STH A;  1Y8O B;  3TP6 A;  4ULL A;  3M4Q A;  4Q0F A;  4QIW E;  1DCZ A;  2B39 A;  1J8I A;  2XIW A;  2B2U A;  3NK9 A;  4JI4 Q;  3GTL H;  4WJ3 M;  1GUT A;  4JI4 L;  2F0J A;  1G6Z A;  1KDC A;  2JA9 A;  1IYJ B;  2QCP X;  3A5Z B;  2G9H D;  5C0X J;  1PH9 A;  1Q82 C;  4GNX B;  1SNP A;  4UDU C;  4B08 A;  4C1N K;  1LAB A;  4ZLT F;  1G29 1;  4L5S A;  3S15 B;  1H9M A;  4PMC A;  3BVG A;  2NBF A;  1Z7T A;  1Z47 A;  2YTX A;  2JK8 A;  4X66 Q;  4BY7 G;  5DAU A;  4X66 L;  4LW1 A;  3QB3 A;  4KHP Q;  2RSO A;  1VF7 A;  4KHP L;  4BBR H;  1Y1V G;  3FMC A;  3Q22 A;  1BUV T;  4QIW B;  5ELB A;  1SFO B;  4GKK Q;  1KXL A;  4KKT A;  4EX5 A;  4GKK L;  3GTP B;  2R92 H;  2LY7 A;  3TP7 A;  3S2D B;  1SYD A;  2NVT B;  3TSS A;  1DYQ A;  1KAB A;  3GV6 A;  5CV9 A;  4IFD H;  3MAQ A;  2EYF A;  3SVM A;  1PTO D;  4CDD C;  2OCE A;  1HPC A;  2OXP A;  5KEE A;  2PI2 A;  3CCV A;  4X3T A;  3BYT B;  4A3J G;  1UE6 A;  3TS2 A;  1IKL A;  4ZQ3 A;  2QW7 A;  4DGZ A;  1O7Y A;  2ES2 A;  3PO2 B;  3QOJ A;  3RLO A;  1GOZ A;  3KUP A;  1OO9 B;  3ERO A;  2EXZ A;  1GVP A;  2NZ1 D;  4A3B G;  1OTC A;  1GD7 A;  1O78 A;  4P72 A;  3K58 A;  1TXY A;  2HCI A;  1P16 A;  1IYU A;  2FMM A;  2CWA A;  5D65 A;  2HIX A;  2B2V C;  3K5O A;  1EYG A;  3CW2 C;  2KCT A;  1E7Z A;  3GTO B;  3TDQ A;  2B2Y C;  1C48 A;  4XXE A;  3VR5 A;  1VQ4 A;  1ML0 D;  3IFD A;  4K0K L;  3MZ5 A;  3WDN A;  4DNT B;  4G7Z C;  2QEJ C;  2ZTC A;  1PH4 A;  2N88 A;  4DV2 Q;  3CD6 A;  1SNO A;  4RCN A;  3KOJ A;  3NEL A;  3A8J E;  5F2D A;  2QDB A;  5LMN Q;  4RHR A;  1VQI A;  3R93 A;  5LMN L;  4OIK A;  3I4L A;  1S40 A;  4J6H A;  3MXG A;  5JOB A;  4R4C A;  1ET9 A;  2EYM A;  3MXP A;  2JA6 G;  4PMB A;  1WTP A;  1BF4 A;  3E6Z X;  3J7Z C;  1XPU A;  1D7Q A;  2KEE A;  1PYW D;  5K5P A;  4UAI A;  2JA5 H;  3K0Y A;  4OWW B;  3CCU A;  1Q12 A;  4HJ7 A;  2A6H D;  4DAM A;  5LL6 X;  1SNQ A;  3L2P A;  4TSS A;  1GKH A;  1L0X B;  4I7A A;  3C46 A;  1SN8 A;  2XSC A;  3OOC A;  4JI0 Q;  3NQT A;  5M3F H;  3TME A;  4JI0 L;  1EEI D;  3S24 A;  2MO0 A;  2VZA A;  3DHQ A;  1BVS A;  3AEV A;  3NQI A;  3CC2 A;  2R93 B;  3AMU A;  4IPC A;  4IOC A;  2R92 G;  1TWH H;  1RJT A;  4LFB Q;  4LFB L;  5C4J B;  3D31 A;  1YVC A;  1FYC A;  1X3E A;  2AMC B;  2JP1 A;  1Q86 C;  2RQX A;  2F0K A;  3FRP B;  3W1G A;  2IX0 A;  1N32 Q;  2F0V A;  1S5D D;  3BDL A;  5M9O A;  1Y1W B;  3MXN A;  1FD7 D;  2E8G A;  1V8Q A;  4IAL A;  4KK7 A;  3VYU A;  2Z6B A;  3KJO A;  2Z8L A;  3V2T A;  1M90 C;  4JBW A;  4O1N A;  1N33 Q;  1H9S B;  1N33 L;  2PO4 A;  4X62 Q;  2R7Z H;  4X62 L;  3P75 A;  3K7A B;  1YNN D;  1RIP A;  4DAY A;  4M8A A;  4C3I H;  3Q0A A;  3ND9 A;  5LL6 S;  2D9U A;  4KJO A;  3GTQ H;  3HOY B;  4A3F H;  2F0W A;  2L5T A;  1KLG D;  4Z9C B;  4LUZ A;  1LAC A;  3K7U C;  2F4V Q;  2K5W A;  2F4V L;  5IE8 A;  2JJQ A;  1NCV A;  4CHT B;  3AFQ A;  3R2I A;  4DUY Q;  3U4V A;  4B3S Q;  4DUY L;  3J80 i;  3MFY A;  3J80 c;  2EY6 A;  2VB2 X;  3A5U A;  2YYZ A;  2B2T C;  5EPK A;  3TRE A;  5KNB A;  4FXD A;  3C3L A;  2Q8T A;  1MHW C;  4DR4 Q;  5EQ0 A;  2NYZ D;  4DR4 L;  1UEA B;  3ULP A;  3JAM E;  5C5M A;  4RFB A;  3F1Z A;  4HAE A;  4IUR A;  4OON A;  2E2I B;  3EIV A;  2ZXO A;  1HA5 A;  5TSS A;  3S15 H;  3NWT A;  1GHJ A;  4FVM A;  1T5E A;  3QWN A;  3ITP A;  4DV4 Q;  2DUD A;  3QOL A;  5C4X H;  4DV4 L;  4WRD A;  1X9N A;  3T53 B;  3IKJ A;  1CK1 A;  4X65 Q;  1BO0 A;  4X65 L;  1WTR A;  5M3F G;  3J81 L;  3A55 A;  4LAA A;  5DEH A;  4NDX A;  3G6E A;  2OWO A;  1NE3 A;  1KC8 C;  4IO9 A;  3S2D H;  3WWV A;  5FLX c;  2NVT H;  3S1N B;  5JEA H;  4JPB W;  5IYD G;  1G51 A;  3MWY W;  5C3W A;  1I4R A;  3CHB D;  2JA7 G;  1JJG A;  2N49 A;  5KIX A;  4L5R C;  4IPG A;  1XMO Q;  1XMO L;  2XRS D;  2AQ1 B;  1HTP A;  3S1R B;  1X56 A;  4CJ2 C;  1Y8N B;  2VQF Q;  1DZ1 A;  1CTM A;  4CDE C;  2VQF L;  1UWV A;  4QUC A;  3S1Q B;  5IGG A;  1E1T A;  1YNX A;  1F9Q A;  3PO2 H;  1I4H A;  1JR0 D;  4C3J G;  1EY6 A;  4KD3 A;  1PFB A;  3TN2 A;  2F0T A;  3QIA A;  2HUG A;  5GQO A;  1XPR A;  1VQF A;  1HTL D;  4BY1 G;  4OO1 G;  4OXP A;  3WOF A;  2BE5 C;  2K5D A;  1KQS A;  1XXG A;  4GS3 A;  3F2U A;  4A3M B;  1MJC A;  2KED A;  1IW7 C;  1W6J A;  3PUZ A;  2CH4 A;  2A19 A;  3GTO H;  2CH4 W;  3KLR A;  4ME5 A;  5A2Q L;  4A3F G;  4P75 A;  1YHA A;  1Y14 B;  2KOL A;  1I94 Q;  3VR4 A;  1I94 L;  1SYC A;  5CV8 A;  2HDL A;  1ILQ A;  2WKD A;  1YZ6 A;  3B6Y A;  1X54 A;  4POF A;  5IY0 A;  4C3H H;  5JJK A;  2K75 A;  5T1I A;  4KHV A;  5BN5 A;  1KDA A;  4DAP A;  2O5J C;  1STG A;  1B70 B;  1G91 A;  3P1H A;  2NVY H;  1LTS D;  1N9W A;  2EIF A;  1QE6 A;  1XX8 A;  5ELE A;  4P73 A;  4IFD J;  1QIL A;  2B2V A;  3S1M H;  4OEL B;  2ZM6 Q;  2RKS A;  2ZM6 L;  1X6O A;  2B2Y A;  1E0B A;  1VQO A;  3T56 B;  2A1A A;  3KF8 B;  4OO1 I;  4HR7 B;  2C5C A;  2SNM A;  4V19 0;  4OX9 Q;  4OX9 L;  5IP9 H;  3PIP A;  1N8R C;  3ND8 A;  4HJA A;  4QJF A;  1B4O A;  2R93 H;  3SE0 A;  3D6C A;  4DV6 Q;  1LTA D;  1KLU D;  5C3E B;  4DV6 L;  1KD1 C;  5C4J H;  1R4Q B;  5GAE C;  1PRT D;  3LGJ A;  4X3S A;  1BCP D;  1NMG A;  2K7V A;  1NAP A;  3DWQ A;  1VQE A;  2ID0 A;  1Q46 A;  2JN4 A;  3GQB A;  3PO2 G;  1Y1W H;  5EPJ A;  1JOR A;  1EYC A;  5CV5 A;  4FP5 D;  4WJ4 A;  4HJ5 A;  4QL5 A;  4BBR B;  1JIC A;  1B9N A;  3KF8 A;  3E9H A;  2NTT A;  3S9W A;  2NWG A;  2JSO A;  2L0C A;  4FO2 A;  2BA0 A;  4K5V A;  2K6A A;  1AW7 A;  4YIJ A;  3S16 B;  5C0X G;  1DOM A;  3K7A H;  4KKS A;  4JBJ A;  2K03 A;  3S2H B;  2XGT A;  2CVR A;  2OT2 A;  2L4N A;  3SXH A;  1X3P A;  4YCW A;  3DM1 A;  3TBI B;  2EYP A;  3CRL C;  1K8G A;  5FO7 B;  5KNC A;  2CKZ B;  2EYO A;  5IT9 c;  1YHQ A;  5KRU A;  5KND A;  1I5F A;  1VDZ A;  4LK1 C;  2EYH A;  3UE0 A;  5IGC A;  1QNK A;  5JPN C;  2MO1 A;  1E2Z A;  2UXC Q;  1PTO B;  1LTB D;  2UXC L;  3M4O B;  3CF5 A;  4A3C H;  5E4X A;  5IWA Q;  3PSI A;  5IWA L;  3I7F A;  1HNW L;  1EIY B;  2OQK A;  2E2I H;  5DM7 3;  2HHH Q;  4CKB A;  1QNU A;  3GV3 A;  2HHH L;  4FF1 A;  2D0P A;  3N52 A;  1ICF B;  2L9H A;  3CQZ B;  3NWS A;  1PH6 A;  2K05 A;  4HMI A;  2MP1 A;  2PZU A;  4U67 3;  2NB0 A;  1EY4 A;  2R7F A;  3DWP A;  4R9W A;  4YY3 Q;  1ENF A;  1STB A;  3U9S A;  4YY3 L;  5C0X I;  1I6H B;  5IP9 G;  3SK5 A;  2H4O A;  2NZH A; 
#chains in the Genus database with same CATH homology
 3OYY A;  1YHB A;  3PUY A;  4KHP L;  3CXC A;  5GRO A;  1Y1V G;  4BBR H;  2R93 G;  2NZO A;  3S1N H;  1VQB A;  4AIM A;  2PNH A;  2OQ0 A;  4C3J H;  4HID A;  1H95 A;  4A3G H;  4A3K G;  4R4I A;  1Q8K A;  2WP8 J;  4GKK Q;  1KXL A;  4IPH A;  4EX5 A;  4GKK L;  1KHI A;  1LM0 A;  2K4K A;  2K14 A;  3K80 C;  4UP7 A;  3A74 A;  5J3B A;  5IYB G;  3S1R H;  1PA6 A;  1CKN B;  4AYB E;  2GVB A;  1VQM A;  1IBM Q;  4BY1 H;  1VQ8 A;  1IBM L;  1QVF A;  4Y7N H;  4JC0 A;  3F2B A;  5C4X G;  1QUQ A;  5M5X H;  3Q8D A;  5LMN W;  2F52 A;  2K5H A;  2OCE A;  2Z0S A;  3E9I A;  3S1Q H;  1D8L A;  4JOI A;  2CCZ A;  3TRZ A;  2OTJ A;  5GAG C;  1LUZ A;  2GN5 A;  2KBN A;  2PI2 A;  2QEX A;  1Y1W G;  3CCV A;  1PH1 A;  3I4M H;  3HKZ E;  2YV5 A;  1DGS A;  3G4S A;  2RF4 A;  1HZA A;  1SR3 A;  4YWM A;  4A3J G;  5DLQ E;  1UE6 A;  5FLM H;  3JAM i;  3HOU G;  5ELO A;  3TS2 A;  3J81 j;  1I50 H;  2Y0S G;  2Z6K A;  2ES2 A;  4GLA C;  5JEA G;  2H5X A;  1EIF A;  1PYS B;  3RLO A;  1JMC A;  1BBW A;  1SRU A;  1VCI A;  2HQL A;  4PZ7 A;  2AHO B;  4O2D A;  1GVP A;  3PO3 G;  3NBH B;  1X3G A;  2BH8 A;  4LF7 Q;  4A3M H;  1PH2 A;  4A3I G;  4LF7 L;  1OTC A;  2E5L Q;  4A3B G;  4KI0 A;  2E5L L;  1GD7 A;  2XTI A;  4P72 A;  2VY3 A;  2V1C C;  1W3S A;  1TXY A;  3GO5 A;  3HOY G;  1P16 A;  1VS0 A;  3BU2 A;  4LUO A;  1BKB A;  1CKN A;  4TQU S;  2CWA A;  2HIX A;  4DR7 Q;  4DR7 L;  1EYG A;  4BA2 I;  3ZJY C;  3CW2 C;  3RN2 A;  2VL6 A;  2KCT A;  4RG1 A;  1E7Z A;  2ZJR A;  3AYH B;  3T1Y Q;  4DV3 Q;  2CWP A;  3T1Y L;  1VQ4 A;  4DV3 L;  1VQP A;  1E22 A;  4BXX H;  2IHE A;  4K0K L;  1UE5 A;  1WCM H;  4JOI C;  1FJG Q;  1NMF A;  1FJG L;  2ZTC A;  1PH4 A;  4JI6 Q;  4DV2 Q;  3CD6 A;  4JI6 L;  4A3D H;  4GNX C;  4NXN Q;  3M3Y H;  3KOJ A;  4NXN L;  3NEL A;  5HY6 A;  4A3C G;  3K8A A;  5LMN Q;  1VQI A;  2OTL A;  5LMN L;  1S40 A;  3PV0 A;  4ME3 A;  1R9T H;  1SFO H;  4R4C A;  3F8T A;  4UPA A;  1KAW A;  1ASY A;  2JA6 G;  3TQY A;  5JEA J;  2JE6 I;  2Q2H A;  3GTP H;  2LSS A;  1VQN A;  5IYC G;  3J7Z C;  3CC4 A;  1XPU A;  1D7Q A;  1CSQ A;  1A63 A;  4LF5 Q;  1TWG H;  2JA5 H;  4LF5 L;  2VQE Q;  3CCU A;  4OWW B;  1N34 Q;  2VQE L;  1YEZ A;  2ZTD A;  1Q12 A;  4HJ7 A;  3FKI H;  1N34 L;  2Q2I A;  1VQ5 A;  4DAM A;  3L2P A;  1IL2 A;  1SLJ A;  3SGI A;  1UE1 A;  1UE7 A;  1GKH A;  3RR5 A;  3HOW G;  5M3M G;  2ALY B;  5LMU Q;  1VQK A;  5LMU L;  2JA8 G;  1V43 A;  3UE1 A;  1K9M C;  1SN8 A;  5C44 G;  4JI0 Q;  3H3V I;  1VQA A;  5C3E H;  5M3F H;  3BJU A;  4JI0 L;  2Y0S E;  4B3T Q;  3S24 A;  2MO0 A;  2VZA A;  3KDF B;  3U50 C;  5IP7 G;  1VQL A;  4B3T L;  1BVS A;  3AEV A;  1TWC H;  4A3G G;  4A93 H;  3CC2 A;  4KLK A;  1OXX K;  4J15 A;  1P8L A;  2I5L X;  4IPC A;  5M5W H;  4IOC A;  1TWH H;  1YI2 A;  2R92 G;  2K52 A;  1Q81 C;  4LFB Q;  4LFB L;  1IZ6 A;  3D31 A;  4LFA Q;  4GLX A;  4LFC Q;  2IY5 B;  2K50 A;  4LFC L;  1YVC A;  4LFA L;  1X3E A;  2AMC B;  1Q86 C;  3L7Z C;  3OTO Q;  1O7I A;  1HNX Q;  1PV4 A;  1GM5 A;  1HNZ Q;  1HNX L;  2JQO A;  2RCN A;  4DR1 Q;  1HNZ L;  4NB3 A;  4DR1 L;  4MNO A;  4YHH Q;  4AQY Q;  1XJV A;  3I4M G;  3W1G A;  4YHH L;  4AQY L;  3CCM A;  3IRB A;  3CPW A;  3CCR A;  2IX0 A;  3TS0 A;  1PYB A;  2CFM A;  4QY7 A;  3GDE A;  5GAD C;  2KEN A;  2ASB A;  2VUM H;  1N32 Q;  2HIV A;  3PUV A;  1OXU A;  1L1O B;  1QZG A;  3E0E A;  1J5E Q;  2HT1 A;  2FXQ A;  4OWX B;  1Q1B A;  1VQH A;  2E8G A;  3UDF A;  5FJ8 G;  3CCQ A;  5M5Y H;  1J5E L;  3S16 H;  3KJO A;  3D0F A;  1L0W A;  1M90 C;  1Z9F A;  2AWO A;  2PMZ E;  4JBW A;  2R92 H;  3S2H H;  2DGY A;  3UDI A;  4A3M G;  1N33 Q;  1N33 L;  2N78 A;  3W1B A;  4R1J A;  3AQQ A;  4X62 Q;  2NN6 G;  2D0O A;  3KJP A;  1IBL L;  1IBL Q;  5EAY A;  4X62 L;  3KDF A;  4DV5 Q;  2R7Z H;  3PGZ A;  1AE2 A;  1RIP A;  4DV5 L;  3STB D;  4IJH A;  4UY8 C;  2VNU D;  3CAM A;  4C3I H;  2E2H H;  2VW9 A;  4KHZ A;  3F2D A;  3KFU A;  2ZTE A;  2R7D A;  4GN3 B;  3PF4 A;  2MQH A;  2ZJP A;  3JC6 6;  3JAM c;  3GTQ H;  1VQG A;  2AWN A;  4A3F H;  3VDY A;  4LF9 Q;  2N3S A;  4JI1 Q;  4LF9 L;  1HZ9 A;  4JI1 L;  4LUZ A;  3K7U C;  4GN5 A;  2F4V Q;  2B63 H;  1WCM G;  3CC7 A;  1HH2 P;  5IE8 A;  2NVX H;  2F4V L;  1M1K C;  2JJQ A;  3PUW A;  2YTY A;  2N8N A;  3AFQ A;  4LNQ A;  4DUY Q;  3J7A 5;  3M4O H;  4A3D G;  3U4V A;  4B3S Q;  3UDX A;  4DUY L;  4P71 A;  1EOV A;  3J80 i;  3J80 c;  1YJ9 A;  1IBK Q;  3M9B A;  4DKA C;  2ATW A;  5HGQ A;  4BBS H;  3H15 A;  1IBK L;  3GTM H;  3MEF A;  1MIU A;  3A5U A;  2YU9 H;  2YYZ A;  4JBK A;  4JYA Q;  1L1O A;  3TRE A;  4JBM A;  4JYA L;  1OXS C;  3HKS A;  1PH5 A;  3RNU A;  1GO3 E;  3STB C;  4B3R Q;  4MTN A;  5H1S E;  1U0L A;  4B3R L;  4DR4 Q;  4PZ6 A;  1YIT A;  1WOC A;  2E2J H;  4DR4 L;  3ULP A;  4MZ9 A;  4L5Q A;  4HJ8 A;  3CQZ H;  4GKJ Q;  1C9O A;  3I4N H;  3F1Z A;  1VQ7 A;  4GKJ L;  5ELN A;  5JJI A;  3RLF A;  4OON A;  2KHI A;  3EIV A;  2EQS A;  5IYB H;  3S15 H;  1EQR A;  4A4I A;  4JI7 Q;  3H0G H;  4JI7 L;  1S72 A;  1KIX A;  4DV4 Q;  1EQQ A;  1I6H H;  2DUD A;  5C4X H;  4LF4 Q;  4DV4 L;  1KRT A;  4DV2 L;  1VQ6 A;  4LF4 L;  3DM3 A;  3NEM A;  1X9N A;  2BA1 A;  4DV0 Q;  4POG A;  1LYL A;  2Z6K C;  2C35 B;  4DV0 L;  3RZD H;  4X65 Q;  1YJN A;  2NN6 I;  1B7Y B;  3RZO H;  4DR3 Q;  3RN5 A;  1NY4 A;  1KL9 A;  2LXJ A;  3FHW A;  4X65 L;  5C3E G;  3ERS X;  5M3F G;  4DUZ Q;  1V1Q A;  2KHJ A;  2WB1 G;  2WFW A;  4LWC A;  3HOX G;  4DUZ L;  4A3J H;  1HR0 W;  1PVO A;  5GAH C;  3G6E A;  1WI5 A;  3GTJ H;  3KYH C;  2OWO A;  1NE3 A;  4GOP B;  4IO9 A;  1KC8 C;  4TVA B;  3S2D H;  3WWV A;  5FLX c;  2NVT H;  1IXR A;  3G48 A;  1G51 A;  5IYD G;  1VQ9 A;  1ASZ A;  1YJW A;  1JJG A;  2JA7 G;  4IPD A;  2N49 A;  1TWF H;  4P74 A;  4L5R C;  3AFP A;  4IPG A;  1XMO Q;  1XMO L;  4XIG S;  4RMF A;  1X56 A;  1N36 Q;  1N36 L;  1K8A C;  1T9H A;  2VQF Q;  1C7Y A;  1AH9 A;  3MXN B;  2VQF L;  4IOA A;  1UWV A;  4A76 A;  3T1H Q;  1C0A A;  2JEA I;  3T1H L;  1PH7 A;  3HOV H;  3PF5 A;  3HOY H;  1E1T A;  1YNX A;  2VUM G;  4C2M H;  4JI5 Q;  4BBR G;  3PO2 H;  5E7N A;  4JI5 L;  3KLW A;  2UXD Q;  1CSP A;  3CCS A;  2UXD L;  1I3Q H;  3PCO B;  4O0A A;  4DAY B;  4HIO A;  3W5O A;  4QGU A;  5GQO A;  1XPR A;  1LTL A;  1VQF A;  1JE5 A;  3ULJ A;  4BY1 G;  4OO1 G;  1CKM A;  4OXP A;  3CP0 A;  2UUB Q;  4IFD G;  2B3G A;  2UUB L;  1QVG A;  1EUJ A;  3FP9 A;  3U4Z A;  3GTG H;  1CUK A;  1KQS A;  1L2F A;  4GS3 A;  3CCE A;  2KCM A;  4GOP A;  1EWI A;  3OTO L;  4X64 Q;  2ZJQ A;  1MJC A;  3GD7 A;  4JG2 A;  4X64 L;  1TWA H;  4YCU A;  1RL2 A;  1HNW Q;  1XNR Q;  1Q7Y C;  2JA6 H;  1BBU A;  1WFQ A;  3PUZ A;  1XNR L;  2A19 A;  4JI8 Q;  5FLM G;  3GTO H;  1JJ2 A;  4JI8 L;  3M85 A;  4A3F G;  1N32 L;  3S17 H;  4P75 A;  1YHA A;  1K83 H;  1Y14 B;  4IJL A;  5IYC H;  4X6A H;  4HIM A;  4NPS A;  1B8A A;  4DK6 C;  2K5V A;  2B63 G;  3U58 A;  1I94 Q;  1I94 L;  3PUX A;  2UUA Q;  2MNA A;  1YZ6 A;  2UUA L;  2I5M X;  3B6Y A;  2BH2 A;  1X54 A;  2B29 A;  3GTK H;  4EQ5 A;  4POF A;  5IY0 A;  1NTG A;  4C3H H;  5JJK A;  4JI3 Q;  3HOW H;  1HZB A;  4JI3 L;  2K75 A;  5M3M H;  2JA8 H;  4DR6 Q;  3CCL A;  4HJ9 A;  4DR6 L;  3KF6 B;  2WB1 E;  4DR2 Q;  1E3P A;  5C44 H;  4DR2 L;  4A3L H;  1B70 B;  1HJP A;  2NVY H;  1N9W A;  2EIF A;  5IP7 H;  3I4N G;  1WYD A;  3I2Z A;  1KRS A;  4A3E H;  3ER0 A;  1YIJ A;  4P73 A;  4IFD J;  3TEH B;  4GOP C;  4BXX G;  3I56 A;  3H0G G;  3S1M H;  2ZM6 Q;  2ZM6 L;  1X55 A;  3I4O A;  1X6O A;  1FL0 A;  3NEN A;  1VQO A;  3ICE A;  2A1A A;  3KF8 B;  1QZH A;  4DNI A;  1SMX A;  1SE8 A;  4R4Q A;  3CME A;  2I0Q A;  4B3S L;  4LF6 Q;  4LF6 L;  4OO1 I;  4OX9 Q;  2I5H A;  4IFD I;  4L5T A;  1VQD A;  4OX9 L;  1A62 A;  5IP9 H;  3PIP A;  1N8R C;  4BY7 H;  4R4O A;  4GNX A;  4QQB X;  4HJA A;  3EBE A;  3K81 C;  4QJF A;  3HFZ B;  1XTD A;  2D62 A;  2R93 H;  1Y1V H;  4DPG A;  3BZC A;  4DV6 Q;  4YCV A;  1FGU A;  4PMW A;  4DV6 L;  2CQO A;  2NVQ H;  3ULL A;  3F2C A;  4A3K H;  1KD1 C;  5C4J H;  2UXB Q;  3K0X A;  5FJ8 H;  2UXB L;  1CKO A;  5GAE C;  2JA5 G;  3UDG A;  1HZC A;  4APV A;  3LGJ A;  3KF6 A;  1X65 A;  1XNQ Q;  1JT8 A;  2WAQ G;  2PQA B;  3FKI G;  1XNQ L;  2QGQ A;  1OXV A;  2GVA A;  1VQJ A;  1NMG A;  2R6G A;  1OXT A;  4GN4 B;  2AKW B;  1WJJ A;  2IHF A;  1K0R A;  3J81 i;  3HOV G;  3J81 c;  1VQE A;  4R4T A;  4DR3 L;  2ID0 A;  3G71 A;  1Q46 A;  4YWK A;  2UU9 Q;  1PH8 A;  3PO2 G;  1JJC B;  2LXK A;  4OWT B;  3PIO A;  1Y1W H;  2UU9 L;  2EXD A;  3HOZ G;  4LF8 Q;  4A93 G;  2Q2T A;  5JJL A;  3HOU H;  4LF8 L;  4WJ4 A;  4HJ5 A;  4QL5 A;  3RLN A;  3A0J A;  4H02 A;  3E9H A;  4PG3 A;  4K0K Q;  1J6Q A;  4JV5 Q;  3BZK A;  4DV7 Q;  1QVC A;  4LW1 A;  1AE3 A;  4BA1 I;  2BA0 A;  2QA4 A;  4DV7 L;  4JV5 L;  1E1O A;  1L1O C;  3EN2 A;  4YWL A;  4AYB G;  4HIK A;  1MKH A;  4JI2 Q;  5BR8 Q;  5C0X G;  3K7A H;  3DLL A;  1NJI C;  3PO3 H;  4JI2 L;  5BR8 L;  5K36 G;  1UEB A;  4FDB A;  4JBJ A;  4A3B H;  1A8V A;  4A3I H;  3CMA A;  4PZ8 A;  1FVI A;  2XGT A;  1G6P A;  4DR5 Q;  4YCW A;  3H3V H;  4DR5 L;  1MJE A;  3I55 A;  2IX1 A;  1JB7 A;  2MFI A;  2PI2 E;  1NBW A;  3CCJ A;  1XMQ Q;  1K8G A;  2L15 A;  4NXM Q;  3HKZ G;  1XMQ L;  4NXM L;  4Y52 H;  4B3M Q;  2CKZ B;  2PQA A;  4B3M L;  2YTV A;  2JEB I;  4DK3 C;  5IT9 c;  1YHQ A;  3S14 H;  1YBY A;  1SRO A;  3M4P A;  1I5F A;  1K3R A;  2IT1 A;  3UE0 A;  1PHJ A;  1VQC A;  1A0I A;  3CPF A;  2MO1 A;  1S3O A;  1U5K A;  2UUC Q;  2UXC Q;  2R7Z G;  2UUC L;  4GLV B;  4UP9 A;  2UXC L;  2K5N A;  1Q1E A;  3CF5 A;  3M4Q A;  4DV1 Q;  4QIW E;  4A3C H;  1E24 A;  4DV1 L;  1X3F A;  4A3L G;  5IWA Q;  3PSI A;  1EFW A;  4JI4 Q;  5IWA L;  3I7F A;  3HOX H;  3GTL H;  1QUQ B;  4WJ3 M;  4JI4 L;  4JCV E;  1EIY B;  1HNW L;  2OQK A;  2E2I H;  4A3E G;  1PH3 A;  1HR0 Q;  2HHH Q;  2VS1 A;  2JA9 A;  1IYJ B;  3A5Z B;  3OW2 A;  1HR0 L;  2HHH L;  2A8V A;  4AH6 A;  5IYD H;  2D0P A;  4A75 A;  5C0X J;  1PH9 A;  1PH6 A;  2JA7 H;  3L0O A;  1Q82 C;  2RHQ B;  4GNX B;  2WAQ E;  1PFS A;  2F3I A;  4L5S A;  1G29 1;  4ALP A;  1V9P A;  2R7F A;  3HOZ H;  4BBS G;  4YY3 Q;  4UP8 A;  4YY3 L;  5AJ3 Q;  1XPO A;  4XTC S;  5C0X I;  5AJ3 L;  1Z47 A;  5IP9 G;  3M7N A;  2YTX A;  2Q2U A;  2JK8 A;  2RHS B;  4LUV A;  4X66 Q;  1W2B A;  1K73 C;  4BY7 G;  4X66 L;  4KHP Q;  2NZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...