4B3TQ

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3tQ00
1VQCA 1Z9FA 4APVA 4LFAQ 2VQFL 1N8RC 3PO3G 2WP8J 4OX9Q 1VQ7A 2R7ZG 2IX1A 1MKHA 5BR8Q 4A3EH 1WJJA 1Q12A 1Q46A 1IBLQ 3VDYA 1C9OA 2UUBQ 3PUVA 2JEBI 3PF5A 3OTOL 3S1RH 3FP9A 1VQFA 1GM5A 2F4VL 3E9HA 1PH4A 4DV6Q 4YCWA 4TVAB 1NMGA 4K0KQ 1E1OA 2K14A 1H95A 1KRSA 1FGUA 2ES2A 4LUVA 1OXVA 1OXUA 2MQHA 4X66L 4UP9A 1YHBA 4GN5A 4UPAA 1FL0A 1V9PA 3U4VA 4A3JG 1VQGA 4DK3C 2MO0A 4FDBA 4R1JA 2NN6I 4DV7L 2RHQB 4OO1G 1YZ6A 1GKHA 3M4QA 2VL6A 3I7FA 5GAGC 3K8AA 1FJGQ 2B63G 3J80c 1J5EL 2C35B 4A93H 3PF4A 1KC8C 1X6OA 4JOIC 5E7NA 1M90C 1YHAA 3J81i 3UDXA 2Z6KA 5FLXc 4JV5L 1CKNB 1HNWL 4GS3A 5IYDG 2ZM6Q 4A3KH 1X3FA 4R4TA 3CMEA 4A3FH 2OQ0A 4B3TL 4A3LH 4KHPL 4HJ5A 4NPSA 5J3BA 1OTCA 3KFUA 4OO1I 1OXTA 3ZJYC 1K8GA 1PYBA 2NVYH 4GKKQ 2VNUD 4DUZQ 1KL9A 1VQHA 3HFZB 4HJ7A 1X9NA 4GOPB 4DR6Q 4DR4Q 3BU2A 1T9HA 4EQ5A 3A0JA 5IWAL 4OONA 2UXDL 1S72A 5GADC 4IFDJ 2HHHQ 3CMAA 3F1ZA 2VQEL 2PQAA 1WOCA 1S40A 4JI5Q 1Z47A 1MIUA 2ZJRA 3TRZA 1YHQA 4QIWE 3GTJH 2K50A 4YWMA 2N3SA 4LF5L 4POGA 2JEAI 4OX9L 1GO3E 3PSIA 3PO3H 1JT8A 1YITA 3JC66 3L0OA 3H15A 4BY1G 4HJAA 5FJ8H 1IBLL 1GD7A 1PVOA 4DR5Q 1VQ4A 1XTDA 3G6EA 2YTYA 4QJFA 2VW9A 1CKNA 1Q7YC 4LF6Q 4X64Q 3GTMH 4IFDG 5C44G 1YNXA 4DV5Q 5M3FH 4JI8L 4DR7Q 4AH6A 4L5QA 1IBMQ 1Q81C 1PH9A 2KCMA 1IZ6A 3UDFA 4A3BG 1E7ZA 1WYDA 2R7DA 2L15A 1W2BA 4DV3L 3CCLA 4YCUA 2UUAQ 4YCVA 4A3KG 4JYAL 1D7QA 3M4PA 4R4QA 1IYJB 1KIXA 2NZHA 1XMQL 1NMFA 4H02A 3TQYA 2Y0SE 3NBHB 2K75A 3H3VH 2CWPA 1XJVA 1JE5A 1EQQA 1G51A 4UY8C 2JJQA 4MTNA 4QY7A 4BA1I 4DAYB 4GLXA 2ATWA 4BA2I 4A3LG 1HNWQ 2R93G 3CXCA 3RR5A 1X54A 3UDIA 4X62L 4DV0L 3S15H 3I56A 3G71A 4GKJL 1E3PA 1CSQA 3GD7A 4RMFA 1QUQA 1ASYA 4LF8Q 5LMNW 4IOAA 3RLFA 2WFWA 1K8AC 2UXCL 1TXYA 4B3RL 2BA1A 1Y1VG 1OXXK 2H5XA 3CAMA 4YWKA 1N33Q 2UUCL 1HZ9A 1Q8KA 3F8TA 3WWVA 3KOJA 1VCIA 4LFBQ 3PGZA 5LMUL 1P8LA 1E22A 1XMQQ 3PUXA 1YJNA 1N32Q 3PO2G 4UP7A 4JI2L 3J7ZC 4ALPA 3RN5A 4DKAC 5IP7G 5BR8L 1EOVA 3T1HQ 1UE5A 1CUKA 3FHWA 4JI5L 2ZTCA 1HR0L 3PO2H 2E8GA 3HOWH 4IO9A 1NBWA 3H0GG 3PUWA 1M1KC 2BH8A 5C4XH 3CC2A 1L1OA 2E5LQ 2CKZB 3RZDH 1VQ6A 2PI2E 1PH1A 5GAEC 3CCEA 3HKSA 3AEVA 1A62A 2OCEA 4PZ6A 4AQYL 4QQBX 2EIFA 1OXSC 2KHIA 5GROA 3KJOA 2UUCQ 2JA9A 3HOYH 4JI4Q 2BH2A 2WB1G 1EIYB 2JE6I 5FJ8G 4DV5L 4A3EG 3AQQA 3J7A5 2NVTH 3ULJA 1HZAA 1LYLA 4DV7Q 1V43A 2OTLA 1A8VA 1GVPA 4O2DA 3OYYA 5IY0A 4YHHL 5JEAG 1VS0A 3BJUA 1WFQA 4P73A 4JI6Q 3RZOH 2BA0A 1Y14B 2UXBL 1X56A 1JB7A 3DLLA 4LF4Q 3HOUH 2JA6G 1J6QA 3D31A 1QVFA 2HIXA 4DR1Q 2ZTEA 4LUOA 3L2PA 2HT1A 3JAMi 1SR3A 2HQLA 3K81C 5AJ3L 4JI1L 4GOPC 5C4XG 5C3EH 4B3MQ 4L5TA 3DM3A 4P72A 3CPWA 2WB1E 2PI2A 4A3MG 4LF9L 5IYBG 5JJLA 4HJ9A 3ULPA 3JAMc 1EFWA 2CCZA 3HOWG 1E24A 5GQOA 4GNXC 1VQPA 1R9TH 3M7NA 2KHJA 4JC0A 1QVCA 4C3HH 4L5RC 4AIMA 1JJGA 3HOVG 3M9BA 1SROA 4DR3Q 3M85A 3NEMA 1SFOH 4BY7H 2JA7H 2MNAA 4DV0Q 4LWCA 5LMNQ 1TWHH 3S2HH 2OWOA 2JK8A 1XMOL 1N36Q 1EWIA 4LW1A 4JI3Q 4LFCL 4JBWA 1KXLA 1NY4A 1IBKQ 1BKBA 3ERSX 1HNXL 3HKZG 3KF8B 3HOXH 4OWXB 1YEZA 3OTOQ 2UXBQ 2Y0SG 4UP8A 3J81c 3CF5A 2MO1A 1G6PA 3GTQH 4HIMA 4A3DH 1K83H 5LMUQ 1SE8A 1Y1WH 3J80i 4JI0Q 2E2JH 1AH9A 2DUDA 2QEXA 1TWAH 3U50C 3W1GA 2LXJA 3CCSA 1PH2A 4DV4Q 4JBJA 3FKIG 1HJPA 4A4IA 2VQEQ 1Q86C 4A76A 1A0IA 3GTLH 1EYGA 1XNRQ 2IHEA 2XGTA 3STBD 1XNQL 4JBKA 4DR2Q 1IL2A 1X65A 4B3TQ 2I5HA 2IHFA 2D0OA 4J15A 4QL5A 2R7FA 1HZCA 3KDFA 3W5OA 3CC4A 1Q1EA 5JJKA 4JI7L 5FLMG 1LM0A 5IP7H 3RNUA 4DUZL 1VQKA 4OWWB 1XPUA 2YTVA 1U5KA 3HOZH 4A3DG 4X65Q 2VUMG 2ZM6L 2F3IA 1MJCA 2Q2HA 1QUQB 4Y7NH 2Q2TA 4DR6L 4DV2L 3STBC 2YV5A 2R6GA 4IPCA 4DV1L 1VQNA 4PZ7A 3FKIH 1VQ9A 1PH3A 2K5NA 1KQSA 2Q2IA 4BBSG 1EQRA 1VQMA 1AE2A 2ASBA 3CQZH 4PG3A 1JJ2A 2A8VA 3CPFA 5C0XI 4BY1H 3I4MG 1BBUA 4LF5Q 3CD6A 1Y1WG 3HOXG 5IWAQ 3UE1A 2RHSB 1J5EQ 4A3BH 3I4NH 1PHJA 4X62Q 1PH5A 3PIOA 4IPHA 3ER0A 1VQAA 4NXMQ 1WCMH 1VQOA 3S1MH 2JA7G 1I94Q 2VS1A 4C2MH 5K36G 1SN8A 2NZOA 4B3RQ 1CKOA 1SMXA 5GAHC 3KJPA 4DR7L 5JEAJ 3K80C 4BBRH 1WCMG 3RLNA 5LMNL 4A3GG 3HOVH 4PZ8A 3AFPA 5ELOA 4DUYQ 3GTGH 3S1QH 1I5FA 3I4NG 1PV4A 2K52A 1PA6A 1VQ8A 3CCRA 4X64L 1UE7A 5IE8A 2VY3A 4HIOA 4GN3B 1PH6A 1B8AA 1CSPA 2CFMA 3PUZA 3K7AH 4KI0A 2PNHA 3CCMA 4HIKA 3OW2A 4BBSH 4C3IH 1DGSA 5IP9H 5IYCH 4LUZA 2JA6H 3K0XA 3S2DH 1HNZL 5C4JH 4IPDA 1PYSB 4NB3A 1I94L 4R4OA 3EIVA 2A19A 2N78A 4C3JH 4TQUS 3GTOH 4DAMA 5H1SE 4P71A 3B6YA 2V1CC 1K0RA 2YYZA 1Q1BA 3F2CA 1RIPA 2N8NA 1U0LA 3BZCA 4XTCS 4A75A 4P74A 3KDFB 4A3IH 2B3GA 1I50H 2FXQA 1YIJA 5FLMH 3Q8DA 1L0WA 3CCQA 4JCVE 4A3JH 1XPRA 5HY6A 1N34Q 1VQ5A 2K5HA 4JG2A 5C0XG 2UU9Q 1PH7A 4RG1A 1YJ9A 4K0KL 1NJIC 3H0GH 3I4OA 3S14H 2F4VQ 4GOPA 3LGJA 4DV2Q 2Z0SA 3KYHC 2I5MX 4JOIA 1TWCH 4DK6C 4YHHQ 3A5UA 4R4IA 2VUMH 1QVGA 2JQOA 2ZJQA 5IT9c 1L1OC 3G4SA 4IFDI 3TEHB 1YVCA 2D0PA 4DNIA 4OWTB 4MNOA 2R7ZH 1B7YB 1VQDA 1C7YA 2NVXH 1V1QA 1QZGA 2B29A 2WAQE 2I0QA 4DR3L 3S1NH 2LSSA 2DGYA 5IYCG 1QZHA 2RCNA 2UUBL 2NN6G 1O7IA 3CCVA 4LFCQ 4YWLA 4JV5Q 1YBYA 5DLQE 4GKKL 4B3SL 2KCTA 1YJWA 2JA5H 4NXNL 4GKJQ 4KHPQ 1FVIA 3ULLA 3A74A 1K3RA 4WJ3M 3IRBA 5IYBH 2Q2UA 4AQYQ 1UEBA 1TWFH 3MEFA 1WI5A 2HHHL 3M4OH 4LF4L 1X55A 2LXKA 4DV4L 5M5WH 5M3MH 1N9WA 1VQEA 1UE1A 4JI6L 1N32L 5IP9G 1UWVA 3M3YH 4A3GH 4IJLA 5C3EG 2YU9H 3HOUG 4DR2L 4BBRG 4LF9Q 4BY7G 4LFBL 3A5ZB 5M5YH 3U58A 2RF4A 3T1YQ 1HR0W 4JI1Q 5M5XH 1FJGL 1IXRA 1VQJA 4XIGS 1HNZQ 3PV0A 4YY3L 2CWAA 4HJ8A 3HKZE 2IX0A 1A63A 2GVBA 4IJHA 5ELNA 4LF6L 1LTLA 3TS0A 1PH8A 1X3GA 4B3SQ 4DR1L 1I6HH 3AFQA 4A3CH 1RL2A 4HIDA 5M3FG 2JA5G 2MFIA 4L5SA 5HGQA 2ZTDA 1TWGH 1HNXQ 2QA4A 3AYHB 3GTKH 3KF6B 1XMOQ 1SLJA 3E9IA 4MZ9A 1N36L 2OQKA 4GLVB 1Q82C 3U4ZA 1YI2A 4KLKA 4BXXH 2UUAL 1KRTA 3KF6A 1BBWA 3F2DA 2KENA 3EBEA 4O0AA 3EN2A 4P75A 1MJEA 4JBMA 1KAWA 3D0FA 4DV1Q 1B70B 3I4MH 2I5LX 2IT1A 3GDEA 4JI0L 4GLAC 2Z6KC 4KHZA 4POFA 3NENA 2D62A 3CCJA 2OTJA 1IBKL 1IBML 1CKMA 1D8LA 2HIVA 3I2ZA 4A3FG 3L7ZC 3BZKA 1X3EA 3F2BA 2AWOA 3CW2C 3RLOA 2ID0A 4EX5A 2VQFQ 4LFAL 4OXPA 2PMZE 2NVQH 1HZBA 3PIPA 3CCUA 3NELA 5M3MG 3RN2A 1JMCA 2E2HH 2XTIA 3S17H 4GN4B 4ME3A 2E5LL 4DR5L 1ASZA 1VQLA 3HOZG 1SRUA 1L2FA 4JI7Q 1NE3A 2F52A 2K4KA 2IY5B 4LF7Q 3CP0A 1VQBA 1K9MC 1N33L 1XNQQ 2EQSA 2JA8G 3S24A 4X6AH 2AKWB 4NXNQ 2A1AA 4JI4L 4X65L 3S16H 3I55A 4LF8L 3TS2A 4JI3L 2KBNA 3H3VI 5IYDH 2EXDA 1AE3A 1EUJA 2ALYB 3W1BA 2VZAA 4GNXB 3E0EA 1Y1VH 1KHIA 4BXXG 4A93G 4Y52H 2GVAA 5C0XJ 3K7UC 2UXCQ 1P16A 2WAQG 4JYAQ 4JI8Q 2R93H 2AWNA 3PCOB 3ICEA 1W3SA 2B63H 5JJIA 1UE6A 2ZJPA 4DPGA 2GN5A 3PUYA 3T1YL 5AJ3Q 2QGQA 1XNRL 1LUZA 2K5VA 1HR0Q 3GO5A 4DV3Q 4IPGA 4YY3Q 4A3MH 1S3OA 1PFSA 4B3ML 4LF7L 1E1TA 2PQAB 3SGIA 4NXML 4AYBE 3G48A 2CQOA 1EIFA 3MXNB 2YTXA 3GTPH 1KD1C 1C0AA 1HH2P 2E2IH 3CC7A 2AHOB 1BVSA 2R92H 4QGUA 1I3QH 1L1OB 1NTGA 1N34L 4DUYL 4A3IG 2N49A 2JA8H 4WJ4A 4PMWA 1JJCB 2UU9L 2AMCB 4A3CG 4LNQA 3KLWA 5EAYA 3TREA 1K73C 4DV6L 4DR4L 5C44H 4GNXA 1VQIA 3UE0A 4JI2Q 4IOCA 4AYBG 1XPOA 3HOYG 2UXDQ 3UDGA 4R4CA 4X66Q 2R92G 1G291 3T1HL 3J81j
chains in the Genus database with same CATH superfamily
4APVA 1WD1A 2XIWA 3ND8A 1EY4A 5JEAH 2MPMA 5A2QL 2HCIA 1VQ7A 1MKHA 5BR8Q 1IBLQ 1PZKD 1C9OA 1KLUD 2NTTA 1LT3D 3PF5A 2SNMA 1VQFA 1EYCA 3OIQA 2R7ZB 1H95A 1FGUA 1ICWA 5C3EB 2MQHA 1CQFA 1HQRD 1YHBA 4GN5A 4UPAA 1BCPF 5IGEA 3U4VA 1EEID 1VQGA 4XDXA 4R1JA 2NN6I 4DV7L 3J80L 1WD0A 1KC8C 4O1NA 2O5JC 4OIJA 3J81i 2ZM6Q 3CHBD 4R4TA 2MHVA 4A3FH 4OELB 4KHPL 3GTOB 2Y0SB 5J3BA 5A35A 2F0MA 3ZJYC 4OO1I 4GKKQ 1NUCA 3GTQB 3HFZB 2JA6B 3S2DB 4GOPB 4DR6Q 1S5BD 3QR8A 5IGCA 1CQVA 3BDOA 3BG3A 4Y7NB 4OONA 2UXDL 1V1OA 1S72A 1TY2A 3E0JA 5GADC 1GUOA 1MBYA 1S40A 5M9OA 4QIWE 5TSSA 1W6KA 3KLRA 2N3SA 4POGA 5KGUA 3PSIA 1YITA 3L0OA 2D5DA 2KEEA 2RDHA 3V96A 4FO2A 4DR5Q 1XTDA 3P7JA 3G6EA 3T53B 1PFMA 1WCMB 1K3BC 1CKNA 3I4LA 1LACA 4X64Q 3GTMH 4IFDG 1S5FD 1YNXA 2B39A 3T16A 4DA2A 4AH6A 3KUPA 4XQNA 1HUMA 4RCNA 2XWBB 2A69C 3HOXB 4YCVA 5KYIA 5G3LD 1KIXA 1XMQL 3TQYA 1SYGA 1PRTB 2Y0SE 3DUZA 4ZCKA 3H3VH 2CWPA 3I90A 5DNFA 2JA7B 1BCPB 1G51A 1ESRA 2KCNA 3R2IA 4BA2I 1B1ZA 3PO2B 1X54A 2WACA 3AU7A 1SE3A 4C3IB 5IGBA 4DV0L 3S15H 1F9QA 4LF8Q 3GV6A 1BCPC 2WKCA 3C2PA 4H13C 2UXCL 5DAUA 4YWKA 3F8TA 3WWVA 5LMUL 1WTXA 1P8LA 3PUXA 4K8IA 3PO2G 1A3UA 3TZUA 3J7ZC 3RN5A 1JB3A 2B2WC 3T1HQ 4JI5L 3OW7A 2E8GA 1JOKA 2NVYB 5CV6A 1Q8IA 1NBWA 3H0GG 3PUWA 4ZRZA 2F0SA 4OIKA 5C4XH 2QDBA 1L1OA 1SFOB 2F0NA 2E5LQ 1PTOD 1CT1D 1VQ6A 1K8OA 4ID6A 5ELCA 4PZ6A 2EIFA 3PIP3 2KHIA 3L3OC 3KJOA 5K5PA 3HOYH 1ZKOA 1EIYB 2JE6I 5ELFA 4ZYSA 5E4WC 4A3EG 2OTLA 1F77A 1ET9A 4KY5A 5IY0A 2BDNA 3OYYA 2SEBD 4YHHL 5JEAG 4RKLA 4BS9A 1EEFD 1RODA 5I4DA 3MXUA 3TN2A 2IX3A 4ZUJA 3DLLA 3D31A 1QVFA 4DR1Q 1SNCA 1I3QB 5C4XG 4CDEC 1PRTF 5KNCA 5JJLA 3A7LA 5EJWA 5IYBG 3K5NA 2HDLA 3NTHA 4GZYC 4XT1B 2M00A 4C3HH 2SOBA 3GTLB 2QDLA 3GV3A 5LMNQ 3I4NB 1A3VA 2OWOA 1N36Q 4LW1A 2L9HA 1MHWC 4LFCL 1F2LA 4JI3Q 1JORA 4JBWA 2O5IC 3HKZG 3KF8B 3HOXH 1YEZA 3OTOQ 2Y0SG 1G6PA 2MO1A 2WIIB 1TY0A 3V05A 3AB9A 3PIO3 3J80i 5J22A 4DV4Q 3FKIG 2VQEQ 4A76A 1EYGA 2IHEA 4FF4A 1IL2A 4IUPA 2EYOA 3A54A 1HZCA 1SYCA 4DK1A 1LM0A 3QO2A 4OWWB 2YTVA 1MSHA 5CORA 2HD3A 3HOZH 4ZK9B 1B9NA 2N88A 4ZKCB 1U9RA 3OIPA 4X65Q 3RZOB 2ZM6L 2F3IA 2EYHA 2F0WA 4ABNA 2F03A 3STBC 3I4MB 3FKIH 4RAUC 1VQ9A 2NVTB 1EQRA 4FNFA 2FJ2A 2MGSA 3HS0C 4PG3A 3D4DA 1RJTA 3AMUA 4FP5D 3GTKB 3CD6A 2K1BA 3HOXG 3UE1A 3I4NH 4X62Q 3ER0A 2A68D 2VS1A 5K36G 1CI3M 4B3RQ 1CKOA 1SMXA 4DR7L 2A69D 4BBRH 2B2YA 4H7BA 5D65A 1WCMG 4A3GG 3QJYA 4PZ8A 3GTGH 1DYQA 1VQ8A 3CCRA 5C5MA 1UE7A 3HG9A 3SE0A 3ONAB 3VYRA 2EY2A 1WTQA 1CSPA 1T5EA 5IYCH 3K0XA 4DU9A 2Z4HA 2FHTA 1I94L 4R4OA 5DM73 4C3JH 1UUPA 2N78A 1R4QB 4DAMA 4P71A 3B6YA 1K0RA 2JYOA 2N8NA 3P75A 4XTCS 1DZ1A 1WTWA 4A3IH 2JA8G 5FLMH 1XXGA 2OF1A 5HY6A 4DNRB 5C0XG 4A93B 3H0GH 2PZUA 4GOPA 1D1IA 4JOIA 2Z0SA 3R2TA 2VUMH 4HMJA 4R4IA 5IT9L 4C1NK 2BDOA 1I4XA 1BF4A 5CV5A 3TEHB 2D0PA 4C3JG 3G7LA 1VQDA 2B29A 3QIAA 4FXDA 4DR3L 2LSSA 1XTCD 5IYCG 2RCNA 2KQ3A 1ZEQX 2RBMA 2KCTA 1H9SA 4G7HC 4GKJQ 1PZID 2JN4A 1FVIA 4BBSB 5FKAC 1QCBD 3JAME 1QB5D 3TSSA 1V1PB 4H0LC 3J81L 1EU3A 1GUNA 4DN4M 3S9WA 2F0DA 4BY7G 1TWCB 4N8X1 4JI1Q 4XIGS 5HURA 1HNZQ 3PV0A 4HJ8A 2IX0A 3S16B 3QWNA 1A63A 4I65A 1LTLA 4KMUC 3DWAA 1SEBD 4DR1L 1EIGA 5I2XA 5M3FG 4HIDA 4A3IB 2MFIA 1STHA 3IL8A 3I73A 2ZTDA 4G4KA 4IUNA 4UDUC 1N36L 3E9IA 4QIWB 3BVMA 2PW7A 3U4ZA 4KLKA 4C3JB 2UUAL 1KRTA 4O0AA 2RCFA 4FXGC 4MN3A 1SYFA 1D5ZC 2IT1A 3GDEA 2TSSA 1SNDA 2D62A 3CCJA 1IBML 1D8LA 2DY7A 2HIVA 4A3FG 3L7ZC 1X3EA 3F2BA 4LFAL 3CW2C 4EX5A 3SK8A 1HZBA 1DOKA 2KECA 4HCSA 5LL6X 2Z1CA 3S17H 1I6HB 1HCZA 3HOZG 1B3QA 3DXJC 4JI7Q 4N8FA 1NE3A 2K4KA 3DHQA 4CHTB 4C2MB 5CBAE 3T56B 4NXNQ 1EY5A 2A1AA 2KJXA 4X65L 3TS2A 2N55A 3I55A 3WOFA 4CBVA 1IW7D 5M5XB 1SE4A 2ALYB 4Y52H 3E0EA 1Y1VH 4LJZC 2AUKA 2CHBD 1J9OA 2D2CC 1CZWA 3EA6A 1EYDA 4JYAQ 4JI8Q 3PCOB 4DPGA 1Q90A 3PUYA 5ELBA 3A56A 1Z6HA 3O13A 3T1YL 1AZPA 2E2IB 1LUZA 2K5VA 4DXFA 4DV3Q 4YY3Q 3GTPB 4NKLA 4KHVA 1EIFA 4B08A 3GTPH 2YTXA 4X3UA 1HH2P 2AHOB 2WB1B 4X3KA 2N49A 4PMWA 1JJCB 2AMCB 1F9PA 2G9HD 3NBIA 4LNQA 2A6HD 1K73C 4DV6L 1Y1VB 5C44H 4DR4L 1O7ZA 4X3SA 4AYBG 4CKBA 3T1HL 3NE5B 4BBRB 1Z9FA 2VQFL 1QWYA 5EKKA 3S1MB 2EYMA 3RZDB 4A3EH 1XX8A 2R92B 1Q46A 2EYFA 4JW0A 3NPPA 4EQOA 3J80E 3S1RH 5C3WA 2F4VL 3E9HA 1PH4A 4YCWA 1ZYRD 4TVAB 1NMGA 1SNPA 3K7AB 3NK9A 3FKIB 4RH6A 4UP9A 3TMEA 1EWCA 4JK1C 2AQ1B 5IGGA 4RGTA 2B2VC 4A3JG 4FDBA 3SDZA 1A15A 5GAGC 1FJGQ 2HUGA 3DWPA 2C35B 4A93H 2Z6KA 2WINB 5FLXc 2IL8A 3M7GA 3ERQA 5IYDG 4B3TL 5T1IA 1TS2A 3P20A 1GHKA 1EY9A 1OXTA 4WJWA 2NVYH 1VQHA 1AN8A 4HJ7A 5T1GA 4F88A 5IWAL 1CA6A 4IUVA 3C1EA 4IFDJ 5BN3A 2VQEL 1Z7TA 1AZQA 4LF5L 1JWMD 1X3QA 1GO3E 5BN5A 3PO3H 1JT8A 3JC66 3H15A 1NNXA 2EXZA 2J7ZA 1GD7A 1PVOA 1Q3LA 2IWHA 3Q6SA 3EJIA 5C4ZA 4LF6Q 1ENAA 1SJED 4L5QA 1Q81C 1IZ6A 2XRQD 2Z9HA 1WYDA 3S14B 2R7DA 1X3PA 1W2BA 4QF4A 4YCUA 2UUAQ 1K83B 4R4QA 2WV6D 2B8GA 4H02A 5IIFA 2QILA 2K75A 3Q24A 4LAAA 1XJVA 2Z6BA 2E74C 4L6TB 1K28A 3I91A 2K01A 2JJQA 4MTNA 4QY7A 4BA1I 2ATWA 1HNWQ 2R93G 4MHEA 1E3PA 1CSQA 2FINB 3G6JB 1QUQA 4RMFA 1SNMA 1K8AC 4B3RL 2TMPA 2BA1A 1Y1VG 2H5XA 1HZ9A 2NWGA 1ILQA 1N32Q 3VYUA 2R61A 4JI2L 2WKDA 5J1ZA 4DKAC 5IP7G 5BR8L 2EE1A 1CFMA 5DEHA 1ENFA 3MA2B 1HR0L 3PO2H 3S1RB 4QB4A 1E2ZA 1EY7A 3H09A 5KEEA 1QE6A 5E4XA 3CC2A 2XWJB 2DNCA 4K5XA 1IKLA 5GAEC 3CCEA 2K5DA 1S4ZA 3OSOA 2EJGC 3URYA 2UUCQ 2WB1G 3VYTA 3LX0A 3J7A5 5JVG3 3BDLA 2NVTH 1HZAA 3SEBA 2A6HC 1SJHD 5C44B 1VS0A 1WFQA 3RZOH 4C1NI 1Y14B 2UXBL 1YNJC 2JA6G 5C5LA 1HTLD 3OWFA 2HIXA 4IUUA 2ZTEA 4LUOA 3L2PA 2HT1A 2PQEA 3JAMi 2OT2A 5AJ3L 4GOPC 5C3EH 4NW2A 4A3MG 1RHPA 3CPWA 3HOWG 3JAMc 2CCZA 1OO9B 5GQOA 2IW3A 3ND9A 4L5RC 3HOVG 1SROA 4DR3Q 1H9MA 2IPKD 3NEMA 1BDOA 2A68C 1TWHH 4KTAA 1EWIA 1ESFA 2RA4A 1IBKQ 1BKBA 3ERSX 4B9XA 2UXBQ 3VYSA 3GTQH 1K83H 1B53A 3CRLC 3KF8A 5EPKA 2E2JH 2QEXA 1GOZA 3CCSA 2EYJA 1PH2A 2EY1A 1Q86C 1HJPA 3GTLH 1ILPA 4A3FB 5M3FB 1KNAA 1F9RA 4JBKA 5CR3A 1EQVA 1X65A 2I5HA 4J15A 2D0OA 3W5OA 3FPUB 3KDFA 1S5CD 5ISRA 3Q0AA 2EPBA 1KNEA 4RHSA 1Q1EA 5JJKA 2A6ED 5FLMG 3LWEA 1AEXA 1YNNC 5EPJA 3VR5A 2PMZB 3DEPA 2KHSA 1FNVA 4A3DG 4WRDA 2VUMG 1MJCA 1I6VC 3BDCA 1SYEA 3KBXA 2YV5A 4IPCA 4DV1L 3MAQA 1PH3A 2K5NA 1LABA 1O7LA 4BBSG 1QNKA 1JR0D 3CQZH 1JJ2A 4UAIA 4DAPA 3CPFA 1RTOA 2PZWA 5IGFA 1BBUA 1F2YA 1Y1WG 1A2TA 1TWHB 2DN8A 1PH5A 1WCMH 5I6YA 1TS3A 1SN8A 3KJPA 1E2WA 1A2UA 1XWEA 5IODA 5ELOA 3MXPA 3S1QH 4K2LA 4HAEA 4MTKA 1BNZA 2K52A 2GA4B 1TR5A 4HIOA 4GN3B 4L8JA 4KI0A 3K7AH 2X6LA 4BBSH 1GUSA 2AQ3B 1DD2A 4IPDA 1PYSB 1NSNS 2M2LA 3GTOH 3VR2A 1LTSD 3J7AV 3F2CA 2FFKB 2FMMA 3J81E 1U0LA 3BS1A 1L0WA 1N34Q 2PCFB 3SXHA 2UU9Q 1F9SA 4RG1A 3HOWB 1YJ9A 4K0KL 1NJIC 4YHHQ 3J7AF 2I5MX 3A5UA 4O42A 2JQOA 2ZJQA 2JXMB 4A3GB 1LLRD 3G4SA 3QG1A 2R7ZH 2NVXH 1QZGA 2WAQE 5JPMC 1EOTA 4Q0FA 4U68A 4CKEA 4DXGA 2JA5B 4YWLA 4JV5Q 1YBYA 5DLQE 4GKKL 2EDGA 2E76C 2JA5H 2C9OA 3RUZA 2K28A 4KHPQ 3PMFA 3A74A 1K3RA 1STEA 4WJ3M 3IRBA 4OL7A 4LF4L 4DV4L 1VQEA 4N9TA 1UE1A 2R93B 5IP9G 1E2VA 3M3YH 4IJLA 2PPBC 5DM63 1FJGL 5M5XH 1FR3A 4LMQD 1STYA 2NUCA 3HKZE 1D1KA 4U673 4K6DA 5ELNA 4IJHA 3MXNA 4FF2A 3VA7A 1X3GA 3H94A 3HRZC 3AFQA 1SXTA 2HDMA 4RFBA 4Q5VA 4L5SA 5HGQA 1QG7A 2NVQB 1STNA 1HNXQ 1DCZA 2QA4A 3PO3B 1H9KA 3GTKH 4GLVB 1Q82C 4HCEA 1E0BA 5JAVA 1GHJA 3EBEA 4WORA 4P75A 5C4JB 2LS01 4KV6A 3I4MH 1B70B 4POFA 3NENA 3FEWX 3K59A 2CW0C 3I2ZA 2A6EC 2VQFQ 2AWOA 4Z9CB 2EJFC 4OXPA 2K5QA 2B2YC 3RN2A 1GUTA 1JMCA 1EY0A 2E2HH 4ULLA 4HEDA 4GN4B 2Z8LA 1VQLA 2DJFC 4FF1A 5D3IB 2F52A 4XXEA 2IY5B 4LF7Q 1VQBA 2BOSA 3U9SA 3S24A 1WVLA 2KVMA 5KNBA 4LF8L 4K5WA 1AE3A 4GNXB 2B2TA 2XN9C 5M3MB 1SE2A 5C0XJ 4KD3A 2UXCQ 2WAQG 1CA5A 1W3SA 1UE6A 1SMYD 2ZJPA 5AJ3Q 3K5OA 1XNRL 3GO5A 1S3OA 4XQJA 1LTGD 2Z4IA 4NXML 1RCVD 2CQOA 3MXNB 2K5WA 3CC7A 4A3EB 2R92H 3T13A 1G6ZA 4G57A 1TU2B 4WJ4A 4K5VA 1UAPA 3KLWA 3TREA 2EY6A 5I9OA 3MWYW 2RDGA 4JI2Q 5LHY1 3H0GB 4X66Q 2R92G 2H4OA 4C3IG 3J81j 1VQCA 3X3MA 4LFAQ 1PTOC 3PO3G 1B3AA 2IX1A 5FLXL 4RGNA 1WJJA 2D9UA 3VDYA 3VR4A 2UUBQ 1PMRA 3PUVA 4AYBB 1SYBA 1FNUA 4DK0A 3NQIA 2B2TC 3OTOL 4ODGA 2MJ8A 1V8QA 1HRJA 3NSWA 4K0KQ 1SNOA 2K14A 2LMCB 2ES2A 1OXVA 1OXUA 1U4MA 2F0GA 4X66L 2NZ1D 1V9PA 4DK3C 2MO0A 1Y69U 2BCOA 2RHQB 4OO1G 1YZ6A 1GKHA 3M4QA 2VL6A 3I7FA 3BVZA 3K8AA 2B63G 2ICEC 3J80c 1J5EL 2A5HA 2EJMA 4HN7A 1X6OA 2K33A 1B44D 4JOIC 4M1UB 1H9SB 4FYDA 4G7ZC 1EY6A 1YHAA 1HXYD 2ZT9C 3D4WA 1STGA 2F0TA 3UDXA 1JICA 4JV5L 1HNWL 4G7OC 3TBIB 1X3FA 4KJOA 4DNTB 2OQ0A 3HZXA 1WTVA 1BUVT 4HJ5A 1U4RA 4NPSA 3KFUA 3OMCA 3IKJA 1K8GA 2VNUD 4EQNA 4DUZQ 1KL9A 2A74C 1X9NA 4DR4Q 3BU2A 2OXPA 4TKOB 4EQ5A 2QKIC 5C0XH 3I8ZA 2MUYA 3L9AX 2CVRA 2PQAA 2HQEA 2EOTA 3TRZA 2ZJRA 1YHQA 4JPBW 2K50A 4OGQC 4OX9L 3OHXC 4HJAA 4BY1G 3FVQA 5ELDA 1VQ4A 2YTYA 2VW9A 4JI8L 4DR7Q 5M5YB 2F0LA 1CZGA 3UDFA 1E7ZA 1CHQD 2K04A 4DV3L 3CCLA 4A3KG 4JYAL 3M4PA 1IYJB 2NZHA 1NMFA 3RD4A 2RVLA 3QOLA 5EQ0A 1ONLA 3NBHB 1XYIA 1JOOA 3I3CA 5IT9E 5D3DA 4BY7B 4NDXA 4UY8C 4F87A 1R9TB 5JPNC 2L0CA 4A3LG 5FO7B 4DAYB 2P5ZX 3CXCA 3RR5A 3NHHA 3UDIA 2DY8A 1ASYA 4OEMB 3A8IE 5LMNW 3MHBA 5C4HA 4IOAA 2WFWA 1TXYA 1KABA 1PDQA 1N33Q 1OXXK 1Q8KA 1EFID 1XMQQ 4NP5A 2QF7A 2VUMB 4ALPA 4A3DB 1CUKA 1BOSA 3KBGA 3JAML 1H9RA 1HQMC 1NR4A 4IO9A 2VXWA 3HOYB 4QUFA 1BCPD 1JQYD 5ELEA 2CKZB 1KLGD 2CW0D 3AEVA 3TZDA 1A62A 3MEHA 1R4PB 4AQYL 4A3KB 3MTSA 4RGMA 2JP1A 4JI4Q 1G2SA 2RSOA 5FJ8G 4DV5L 5FO9B 4ZQ3A 1VF5C 1V43A 1GVPA 1MGSA 3K0YA 4O2DA 1G2TA 4XYOA 3BJUA 4P73A 4JI6Q 4ILWA 1JOQA 2EYLA 4CJ1B 4PNYA 1J6QA 1SR3A 1FNWA 2BE5C 4JI1L 4B3MQ 3HOVB 1T5XD 3FDTA 4KN4C 4B9WA 4HJ9A 3VA5A 4GNXC 1VQPA 1R9TH 2KHJA 3ITPA 4HSVA 4JC0A 5KYLA 4A3MB 3M9BA 4BY7H 2JA7H 2MNAA 2B2UC 3S2HH 2JK8A 1XMOL 1SAPA 1NY4A 3N6RA 2A73B 3DWQA 3J81c 2RSNA 4HIMA 2PO4A 1HFGA 3TP6A 3NBHA 2ZXOA 2DUDA 1TWAH 3U50C 1I4QA 2LXJA 3SHLA 4A4IA 3BZDB 1XNRQ 3SK6A 1QJOA 2F0OA 2XGTA 3STBD 2QEJC 5EPLA 1XNQL 1U4LA 2QW7A 3CRKC 4KK7A 5C6AA 4QL5A 2R7FA 3W3AA 3NP8A 4XYQA 3T4AC 4JI7L 3E5SA 1ZYRC 5IP7H 3RNUA 3GP7A 4DUZL 1VQKA 3M4YA 1MI2A 1PRTD 3HOUB 1B50A 3D3RA 5A2QE 2KUMA 1PZJD 4Y7NH 4DR6L 1VQNA 2R6GA 2B8FA 3A55A 1KQSA 3KLSA 1AE2A 2ASBA 5E3FA 4BY1H 3I4MG 3IAYA 4A3BH 5CC4A 3PIOA 4IPHA 1VQOA 3S1MH 3KK7A 5AFWA 1I94Q 4C2MH 2F1MA 5GAHC 5JVH3 5CV7A 3K80C 5JEAJ 3HKZB 3S17B 2EYPA 4FVMA 3HOVH 3AFPA 4F8MA 4DUYQ 1HA5A 3I4NG 4CDFC 1PA6A 4X64L 1PTOF 1H9JA 3M4OB 5I2YA 2OEOA 1B8AA 2CFMA 3PUZA 1B2TA 1U4PA 1LTRD 5IP9H 1PLFA 2F0EA 3NQTA 3EIVA 2A19A 1EU4A 3H6MA 4TQUS 2V1CC 1Q1BA 1W6JA 4QUCA 4WFN3 4P74A 3RMHA 1TT2A 2B3GA 1I50H 2FXQA 5L37A 3Q8DA 2WAQB 4JCVE 4A3JH 4KD4A 1D5MC 1PH7A 2K03A 3D6WA 2PNRC 3I4OA 3S14H 2F4VQ 4DV2Q 1YNND 1TWCH 4DK6C 1LTAD 3TP5A 2QCPX 3FRPB 1BXTA 5IT9c 4N9PA 4RCOA 1C48A 4EGVA 2I0QA 1QZHA 2UUBL 2NN6G 1O7IA 3CCVA 4ZUIA 3N52A 3KLSX 2O2LD 3FMCA 3GTJB 1FD7D 4OHJA 3CU7A 4EQPA 1L0XB 2PYKA 3ULLA 1EWHA 1UNSA 3VR6A 5IYBH 4AQYQ 1TWFH 3MEFA 1LTTD 1WI5A 2HHHL 1FGBD 5KIXA 5M5WH 5M3MH 1QILA 4IURA 2F3VA 4JI6L 1N32L 3NWTA 1UWVA 5CMDA 1HA6A 3E6ZX 4DR2L 3D4RA 5M5YH 2RF4A 1IXRA 2CWAA 4X3TA 2RDFA 3HEJA 1HUNA 4LF6L 3TS0A 2BE5D 2MP1A 4MIUA 1Y8PB 4A3CH 1SYDA 3V2TA 3MFGA 1BR9A 1XMOQ 4IUQA 1DOMA 3KF6A 1BBWA 3F2DA 2KENA 4JBMA 1MJEA 1I4GA 1KAWA 3D0FA 1GUWA 1KDAA 1S5ED 4DV1Q 2XSCA 4H44C 4KHZA 1NR2A 2Z6KC 4BWGB 1CKMA 1GJXA 3BZKA 2ID0A 5EGTA 2PMZE 2NVQH 3CCUA 4PQXA 3NELA 5M3MG 2K05A 3EROA 4RHRA 1TWGB 5CGKA 4ME3A 3TP8A 3BYYB 2E5LL 4DR5L 1ASZA 1SMYC 3OOCA 1VF7A 4QCLA 4DAYA 1DJRD 3OPOA 1XNQQ 1K9MC 2CH4W 2EQSA 3H91A 4CDDC 5KNDA 2AKWB 2KEDA 4JI4L 5IYDH 2EXDA 2NB0A 1EUJA 4QMGA 3W1BA 2VZAA 2F0HA 3K6OA 1GUGA 1QOHA 1P16A 2L12A 2R93H 2AWNA 3ICEA 2B63H 5JJIA 2GN5A 3OMGA 1HR0Q 4B3ML 1PFSA 2DNEA 2Q8TA 1E1TA 3HOZB 1UEAB 3SGIA 4AYBE 3G48A 3S1NB 1C4QA 2NVXB 2NTSA 3F2UA 2E2IH 3D8GA 1L1OB 1NTGA 1N34L 4DUYL 4IQZA 2UU9L 2XRSD 1PXUA 1L0YB 5EAYA 5EKIA 1TWAB 4NMZA 3UE0A 4CKCA 4GNXA 1STBA 1XPOA 2UXDQ 3UDGA 4R4CA 3GTGB 3DM1A 1JC7A 1TS5A 5BN4A 5M5WB 5CBEE 5EBDA 1N8RC 2WP8J 2B2UA 4IN3A 4OX9Q 4CJ0B 2R7ZG 1EZ8A 2EY5A 4ME5A 3S2HB 1Q12A 2JEBI 3E3XA 1PFNA 3FP9A 4XT3B 1GM5A 4DV6Q 2C5CA 2FMCA 1E1OA 4K2KA 1KRSA 3DEOA 2KOLA 4LUVA 5FOBB 1FL0A 4DAVA 1ENCA 2R3ZA 1PYWD 1RTNA 4V0BA 3PF4A 4IALA 5E7NA 5J39A 1M90C 4F7XA 5F2DA 3SK4A 4DF7A 1CKNB 3H3VC 4GS3A 4A3KH 5FK9C 3CMEA 2L4NA 4A3LH 4CGYB 1DOLA 1OTCA 1NCVA 1PYBA 3I72A 2CH4A 1TWFB 1T9HA 3A0JA 1LT5D 1C8CA 2LFNA 5FO8B 4C3HG 4K8JA 2HHHQ 3CMAA 1RF2D 3F1ZA 1WOCA 4JI5Q 1Z47A 1MIUA 4RA8A 1BO0A 2L5TA 3GTJH 4YWMA 4C3HB 2JEAI 1IKMA 3IFTA 5COYA 5FJ8H 5NUCA 1IBLL 4QJFA 1JWSD 1Q7YC 4PMBA 5C44G 2E75C 4P2CB 4DV5Q 2AQ2B 5M3FH 2AUJD 3LNNA 1IBMQ 2B2WA 3BVGA 1PH9A 2KCMA 2F0QA 4V190 5EKLA 4A3BG 2E2JB 1PFBA 2L15A 1Y8NB 1Y1WB 1D7QA 1JE4A 4RWSC 1I50B 3D6CA 4KY6A 3P1HA 5G3LF 1JE5A 1EQQA 5LL6S 3GTMB 4OO1H 1A6XA 3Q23A 4GLXA 1PTOB 1HFNA 2ZXPA 4HR7B 1QNUA 4X62L 1X32A 3I56A 3G71A 4GKJL 3GD7A 3RLFA 1IW7C 1KDCA 1TS4A 1ET6A 1O80A 3CAMA 2UUCL 2F0JA 4PMCA 3KOJA 1VCIA 3PGZA 5FLXE 1E22A 1YJNA 1WTPA 1O78A 4UP7A 3R3OA 3VR3A 2K7VA 1EOVA 1UE5A 2PW5A 3FHWA 3SR1A 2ZTCA 3HOWH 1LV9A 2V4DA 3EFXD 5I9PA 3BYTB 4XQQA 1M1KC 2BH8A 5CYUA 2G9DA 4K6LA 3RZDH 3I70A 2PI2E 1PH1A 3HKSA 4QQBX 2OCEA 1LT4D 1OXSC 4BY1B 1A3TA 5GROA 1GXDC 3T51B 2JA9A 2BH2A 3LWUA 3AQQA 1EL0A 3ULJA 1LYLA 4DV7Q 1A8VA 1IYUA 2SDFA 4KJNA 1EYAA 1V1PA 1NAPA 4FXKC 2BA0A 4KN7C 1X56A 1JB7A 3HOUH 4LF4Q 4LFBQ 5K36H 3NTIA 2HQLA 3K81C 1RDPD 4L5TA 3DM3A 4P72A 2F0KA 2WB1E 2PI2A 4LF9L 3ULPA 4YIJA 1EFWA 1M8AA 1E24A 2K6AA 1MD2D 3M7NA 1RKNA 1TQOA 2ZXRA 3K5MA 1PTOH 1QVCA 2X6GA 4AIMA 1JJGA 1SFOH 4R9WA 3M85A 4DV0Q 5C4XB 4LWCA 2NN6H 1LO5D 4R8NA 2F0FA 2F4IA 1SBBB 3MC0B 2B63B 1KXLA 4K14A 1HNXL 4OWXB 2B2VA 5IGDA 4UP8A 5C3XA 3CF5A 1STAA 4A3DH 5LMUQ 3U9OA 1SE8A 3NWSA 2XVSA 1Y1WH 1KTKA 4JI0Q 1AH9A 4CJ2C 2M9VA 1Y8OB 1SDFA 3W1GA 3A7AB 4JBJA 1A0IA 4DGZA 1I4RA 1AW7A 1WTOA 3K58A 4DR2Q 1RD9D 2VB2X 1HPCA 4TRDA 2IHFA 3CC4A 3GQBA 1LTBD 4B3TQ 1B4OA 1XPUA 3MFYA 1HTPA 1U5KA 2Q2HA 1QUQB 2Q2TA 4DV2L 4L63B 2NBFA 4PZ7A 2Q2IA 1VQMA 3TDQA 5D14A 2A8VA 1LTID 1FYCA 5C0XI 4J6HA 4LF5Q 2EVBA 1K8MA 4ZKBB 5IWAQ 1B9MA 2RHSB 1J5EQ 4IUTA 1PHJA 3SK5A 2LY7A 2XNAC 1VQAA 2J0TD 4NXMQ 1J8IA 3A8JE 2JA7G 3X3NA 2NZOA 3EVQA 1JWUD 1VMPA 2ENBA 3RLNA 5LMNL 3CKIB 4RKBA 1I5FA 2F0VA 3Q22A 1PV4A 2RKSA 4HMIA 5IE8A 2VY3A 4IZ8A 1AP0A 1PH6A 5CV4A 3CCMA 1II3A 1CM9A 3OW2A 1CK1A 2PNHA 4HIKA 4C3IH 3S15B 1DGSA 4FF3A 4LUZA 2JA6H 3S2DH 4HSPA 2NYZD 1HNZL 5C4JH 1KAAA 4CDCC 1G91A 5JOBA 4NB3A 1DXMA 4C56C 3IFDA 5H1SE 2PZTA 2YYZA 3OWEB 5E1FA 1M4VA 4A75A 1RIPA 3BZCA 3FPPA 3KDFB 1YIJA 2VB3X 1MSGA 3CCQA 1XPRA 1EQTA 1VQ5A 2K5HA 4JG2A 4UHVA 2J4XA 3ZYYX 1TVXA 4EVOA 1ICFB 3MZ5A 3W2DA 3LGJA 1KDBA 3KYHC 4J8QA 3J7YW 3K57A 1QVGA 5I6WA 2EZVA 2YU9B 2ICIA 2L1BA 3M3YB 1L1OC 2DJGC 2Q8IB 4IFDI 1D6EC 3HP3A 1YVCA 4DNIA 4OWTB 3PQIA 2Q8RE 4MNOA 4A3JB 1HHVA 1B7YB 1C7YA 1V1QA 4E6IA 4I7ZC 3S1NH 2KA7A 2DGYA 3UI2A 4LFCQ 2F0IA 2L55A 4B3SL 1YJWA 3NUCA 4NXNL 1G8ZD 1IHZA 3C46A 2F0UA 1K0SA 2Q2UA 1UEBA 1VMCA 2RQXA 3QB3A 3WOEA 3M4OH 1X55A 2LXKA 1IYVA 2JSOA 1N9WA 3MXGA 5JJZA 5KRUA 2F0PA 2I07B 4A3GH 5C3EG 2YU9H 3HOUG 1CTMA 3HGBA 4LK1C 4BBRG 4LF9Q 4LFBL 3A5ZB 3U58A 1HR0W 3T1YQ 1TIID 1VQJA 4YY3L 1D5XC 5IOCA 1AFPA 4HTHA 1SNQA 2GVBA 1S5DD 1PH8A 4B3SQ 1I4PA 3NTKA 1I6HH 1EY8A 1RL2A 3MVVA 1YNJD 2JA5G 4A3BB 1TWGH 3AYHB 1EIHA 4PV1C 4IFDH 3KF6B 1SLJA 4MZ9A 4I7AA 1F2ZA 2OQKA 3SVMA 2G5DA 2LKVA 1YI2A 4BXXH 1ZXTA 1CHPD 3EN2A 5EBCA 3A8KE 1O7YA 1WTRA 2I5LX 1I4HA 1PRTC 4JI0L 4GLAC 2OTJA 1IBKL 2HCCA 3QOJA 3RLOA 1JCKB 1ML0D 3PIPA 4M8AA 2K32A 2XTIA 1TKWB 2KCCA 1SRUA 1L2FA 4J1MA 4KKSA 3R93A 3CP0A 2L11A 1N33L 4KY7A 2H1EA 4X6AH 1LT6D 4TSSA 2E2HB 3S16H 4JI3L 2KBNA 3H3VI 1BQQT 3C1FA 1SSOA 1EZ6A 3K5LA 4BXXG 4A93G 2IJ0A 1KHIA 2GVAA 2E2DC 3CQZB 3K7UC 4JVZA 2JA8B 4S3SA 1D2BA 3NXWA 2X69A 2QGQA 1IL8A 1WTHA 2O4XA 4IPGA 1DM0B 4A3MH 4LF7L 2PQAB 3EQLC 1F2MA 3WDNA 1KD1C 1DONA 1C0AA 4KKUA 1VDZA 1BVSA 4QGUA 4R8IA 1I3QH 3C3LA 4A3IG 2JA8H 3R8BA 4DFAA 2F3WA 2CQAA 4RGOS 4A3CG 3DMUA 1BBXC 4ZAIA 5HGTA 3TP7A 5CV8A 4KKTA 5CV9A 1VQIA 2SNSA 4IOCA 3S1QB 3HOYG 4ZLTF 2I46A 1G291
chains in the Genus database with same CATH topology
1VQCA 1Z9FA 4APVA 4LFAQ 2VQFL 1N8RC 3PO3G 2WP8J 4OX9Q 1VQ7A 2R7ZG 2IX1A 1MKHA 5BR8Q 4A3EH 1WJJA 1Q12A 1Q46A 1IBLQ 3VDYA 1C9OA 2UUBQ 3PUVA 2JEBI 3PF5A 3OTOL 3S1RH 3FP9A 1VQFA 1GM5A 2F4VL 3E9HA 1PH4A 4DV6Q 4YCWA 4TVAB 1NMGA 4K0KQ 1E1OA 2K14A 1H95A 1KRSA 1FGUA 2ES2A 4LUVA 1OXVA 1OXUA 2MQHA 4X66L 4UP9A 1YHBA 4GN5A 4UPAA 1FL0A 1V9PA 3U4VA 4A3JG 1VQGA 4DK3C 2MO0A 4FDBA 4R1JA 2NN6I 4DV7L 2RHQB 4OO1G 1YZ6A 1GKHA 3M4QA 2VL6A 3I7FA 5GAGC 3K8AA 1FJGQ 2B63G 3J80c 1J5EL 2C35B 4A93H 3PF4A 1KC8C 1X6OA 4JOIC 5E7NA 1M90C 1YHAA 3J81i 3UDXA 2Z6KA 5FLXc 4JV5L 1CKNB 1HNWL 4GS3A 5IYDG 2ZM6Q 4A3KH 1X3FA 4R4TA 3CMEA 4A3FH 2OQ0A 4B3TL 4A3LH 4KHPL 4HJ5A 4NPSA 5J3BA 1OTCA 3KFUA 4OO1I 1OXTA 3ZJYC 1K8GA 1PYBA 2NVYH 4GKKQ 2VNUD 4DUZQ 1KL9A 1VQHA 3HFZB 4HJ7A 1X9NA 4GOPB 4DR6Q 4DR4Q 3BU2A 1T9HA 4EQ5A 3A0JA 5IWAL 4OONA 2UXDL 1S72A 5GADC 4IFDJ 2HHHQ 3CMAA 3F1ZA 2VQEL 2PQAA 1WOCA 1S40A 4JI5Q 1Z47A 1MIUA 2ZJRA 3TRZA 1YHQA 4QIWE 3GTJH 2K50A 4YWMA 2N3SA 4LF5L 4POGA 2JEAI 4OX9L 1GO3E 3PSIA 3PO3H 1JT8A 1YITA 3JC66 3L0OA 3H15A 4BY1G 4HJAA 5FJ8H 1IBLL 1GD7A 1PVOA 4DR5Q 1VQ4A 1XTDA 3G6EA 2YTYA 4QJFA 2VW9A 1CKNA 1Q7YC 4LF6Q 4X64Q 3GTMH 4IFDG 5C44G 1YNXA 4DV5Q 5M3FH 4JI8L 4DR7Q 4AH6A 4L5QA 1IBMQ 1Q81C 1PH9A 2KCMA 1IZ6A 3UDFA 4A3BG 1E7ZA 1WYDA 2R7DA 2L15A 1W2BA 4DV3L 3CCLA 4YCUA 2UUAQ 4YCVA 4A3KG 4JYAL 1D7QA 3M4PA 4R4QA 1IYJB 1KIXA 2NZHA 1XMQL 1NMFA 4H02A 3TQYA 2Y0SE 3NBHB 2K75A 3H3VH 2CWPA 1XJVA 1JE5A 1EQQA 1G51A 4UY8C 2JJQA 4MTNA 4QY7A 4BA1I 4DAYB 4GLXA 2ATWA 4BA2I 4A3LG 1HNWQ 2R93G 3CXCA 3RR5A 1X54A 3UDIA 4X62L 4DV0L 3S15H 3I56A 3G71A 4GKJL 1E3PA 1CSQA 3GD7A 4RMFA 1QUQA 1ASYA 4LF8Q 5LMNW 4IOAA 3RLFA 2WFWA 1K8AC 2UXCL 1TXYA 4B3RL 2BA1A 1Y1VG 1OXXK 2H5XA 3CAMA 4YWKA 1N33Q 2UUCL 1HZ9A 1Q8KA 3F8TA 3WWVA 3KOJA 1VCIA 4LFBQ 3PGZA 5LMUL 1P8LA 1E22A 1XMQQ 3PUXA 1YJNA 1N32Q 3PO2G 4UP7A 4JI2L 3J7ZC 4ALPA 3RN5A 4DKAC 5IP7G 5BR8L 1EOVA 3T1HQ 1UE5A 1CUKA 3FHWA 4JI5L 2ZTCA 1HR0L 3PO2H 2E8GA 3HOWH 4IO9A 1NBWA 3H0GG 3PUWA 1M1KC 2BH8A 5C4XH 3CC2A 1L1OA 2E5LQ 2CKZB 3RZDH 1VQ6A 2PI2E 1PH1A 5GAEC 3CCEA 3HKSA 3AEVA 1A62A 2OCEA 4PZ6A 4AQYL 4QQBX 2EIFA 1OXSC 2KHIA 5GROA 3KJOA 2UUCQ 2JA9A 3HOYH 4JI4Q 2BH2A 2WB1G 1EIYB 2JE6I 5FJ8G 4DV5L 4A3EG 3AQQA 3J7A5 2NVTH 3ULJA 1HZAA 1LYLA 4DV7Q 1V43A 2OTLA 1A8VA 1GVPA 4O2DA 3OYYA 5IY0A 4YHHL 5JEAG 1VS0A 3BJUA 1WFQA 4P73A 4JI6Q 3RZOH 2BA0A 1Y14B 2UXBL 1X56A 1JB7A 3DLLA 4LF4Q 3HOUH 2JA6G 1J6QA 3D31A 1QVFA 2HIXA 4DR1Q 2ZTEA 4LUOA 3L2PA 2HT1A 3JAMi 1SR3A 2HQLA 3K81C 5AJ3L 4JI1L 4GOPC 5C4XG 5C3EH 4B3MQ 4L5TA 3DM3A 4P72A 3CPWA 2WB1E 2PI2A 4A3MG 4LF9L 5IYBG 5JJLA 4HJ9A 3ULPA 3JAMc 1EFWA 2CCZA 3HOWG 1E24A 5GQOA 4GNXC 1VQPA 1R9TH 3M7NA 2KHJA 4JC0A 1QVCA 4C3HH 4L5RC 4AIMA 1JJGA 3HOVG 3M9BA 1SROA 4DR3Q 3M85A 3NEMA 1SFOH 4BY7H 2JA7H 2MNAA 4DV0Q 4LWCA 5LMNQ 1TWHH 3S2HH 2OWOA 2JK8A 1XMOL 1N36Q 1EWIA 4LW1A 4JI3Q 4LFCL 4JBWA 1KXLA 1NY4A 1IBKQ 1BKBA 3ERSX 1HNXL 3HKZG 3KF8B 3HOXH 4OWXB 1YEZA 3OTOQ 2UXBQ 2Y0SG 4UP8A 3J81c 3CF5A 2MO1A 1G6PA 3GTQH 4HIMA 4A3DH 1K83H 5LMUQ 1SE8A 1Y1WH 3J80i 4JI0Q 2E2JH 1AH9A 2DUDA 2QEXA 1TWAH 3U50C 3W1GA 2LXJA 3CCSA 1PH2A 4DV4Q 4JBJA 3FKIG 1HJPA 4A4IA 2VQEQ 1Q86C 4A76A 1A0IA 3GTLH 1EYGA 1XNRQ 2IHEA 2XGTA 3STBD 1XNQL 4JBKA 4DR2Q 1IL2A 1X65A 4B3TQ 2I5HA 2IHFA 2D0OA 4J15A 4QL5A 2R7FA 1HZCA 3KDFA 3W5OA 3CC4A 1Q1EA 5JJKA 4JI7L 5FLMG 1LM0A 5IP7H 3RNUA 4DUZL 1VQKA 4OWWB 1XPUA 2YTVA 1U5KA 3HOZH 4A3DG 4X65Q 2VUMG 2ZM6L 2F3IA 1MJCA 2Q2HA 1QUQB 4Y7NH 2Q2TA 4DR6L 4DV2L 3STBC 2YV5A 2R6GA 4IPCA 4DV1L 1VQNA 4PZ7A 3FKIH 1VQ9A 1PH3A 2K5NA 1KQSA 2Q2IA 4BBSG 1EQRA 1VQMA 1AE2A 2ASBA 3CQZH 4PG3A 1JJ2A 2A8VA 3CPFA 5C0XI 4BY1H 3I4MG 1BBUA 4LF5Q 3CD6A 1Y1WG 3HOXG 5IWAQ 3UE1A 2RHSB 1J5EQ 4A3BH 3I4NH 1PHJA 4X62Q 1PH5A 3PIOA 4IPHA 3ER0A 1VQAA 4NXMQ 1WCMH 1VQOA 3S1MH 2JA7G 1I94Q 2VS1A 4C2MH 5K36G 1SN8A 2NZOA 4B3RQ 1CKOA 1SMXA 5GAHC 3KJPA 4DR7L 5JEAJ 3K80C 4BBRH 1WCMG 3RLNA 5LMNL 4A3GG 3HOVH 4PZ8A 3AFPA 5ELOA 4DUYQ 3GTGH 3S1QH 1I5FA 3I4NG 1PV4A 2K52A 1PA6A 1VQ8A 3CCRA 4X64L 1UE7A 5IE8A 2VY3A 4HIOA 4GN3B 1PH6A 1B8AA 1CSPA 2CFMA 3PUZA 3K7AH 4KI0A 2PNHA 3CCMA 4HIKA 3OW2A 4BBSH 4C3IH 1DGSA 5IP9H 5IYCH 4LUZA 2JA6H 3K0XA 3S2DH 1HNZL 5C4JH 4IPDA 1PYSB 4NB3A 1I94L 4R4OA 3EIVA 2A19A 2N78A 4C3JH 4TQUS 3GTOH 4DAMA 5H1SE 4P71A 3B6YA 2V1CC 1K0RA 2YYZA 1Q1BA 3F2CA 1RIPA 2N8NA 1U0LA 3BZCA 4XTCS 4A75A 4P74A 3KDFB 4A3IH 2B3GA 1I50H 2FXQA 1YIJA 5FLMH 3Q8DA 1L0WA 3CCQA 4JCVE 4A3JH 1XPRA 5HY6A 1N34Q 1VQ5A 2K5HA 4JG2A 5C0XG 2UU9Q 1PH7A 4RG1A 1YJ9A 4K0KL 1NJIC 3H0GH 3I4OA 3S14H 2F4VQ 4GOPA 3LGJA 4DV2Q 2Z0SA 3KYHC 2I5MX 4JOIA 1TWCH 4DK6C 4YHHQ 3A5UA 4R4IA 2VUMH 1QVGA 2JQOA 2ZJQA 5IT9c 1L1OC 3G4SA 4IFDI 3TEHB 1YVCA 2D0PA 4DNIA 4OWTB 4MNOA 2R7ZH 1B7YB 1VQDA 1C7YA 2NVXH 1V1QA 1QZGA 2B29A 2WAQE 2I0QA 4DR3L 3S1NH 2LSSA 2DGYA 5IYCG 1QZHA 2RCNA 2UUBL 2NN6G 1O7IA 3CCVA 4LFCQ 4YWLA 4JV5Q 1YBYA 5DLQE 4GKKL 4B3SL 2KCTA 1YJWA 2JA5H 4NXNL 4GKJQ 4KHPQ 1FVIA 3ULLA 3A74A 1K3RA 4WJ3M 3IRBA 5IYBH 2Q2UA 4AQYQ 1UEBA 1TWFH 3MEFA 1WI5A 2HHHL 3M4OH 4LF4L 1X55A 2LXKA 4DV4L 5M5WH 5M3MH 1N9WA 1VQEA 1UE1A 4JI6L 1N32L 5IP9G 1UWVA 3M3YH 4A3GH 4IJLA 5C3EG 2YU9H 3HOUG 4DR2L 4BBRG 4LF9Q 4BY7G 4LFBL 3A5ZB 5M5YH 3U58A 2RF4A 3T1YQ 1HR0W 4JI1Q 5M5XH 1FJGL 1IXRA 1VQJA 4XIGS 1HNZQ 3PV0A 4YY3L 2CWAA 4HJ8A 3HKZE 2IX0A 1A63A 2GVBA 4IJHA 5ELNA 4LF6L 1LTLA 3TS0A 1PH8A 1X3GA 4B3SQ 4DR1L 1I6HH 3AFQA 4A3CH 1RL2A 4HIDA 5M3FG 2JA5G 2MFIA 4L5SA 5HGQA 2ZTDA 1TWGH 1HNXQ 2QA4A 3AYHB 3GTKH 3KF6B 1XMOQ 1SLJA 3E9IA 4MZ9A 1N36L 2OQKA 4GLVB 1Q82C 3U4ZA 1YI2A 4KLKA 4BXXH 2UUAL 1KRTA 3KF6A 1BBWA 3F2DA 2KENA 3EBEA 4O0AA 3EN2A 4P75A 1MJEA 4JBMA 1KAWA 3D0FA 4DV1Q 1B70B 3I4MH 2I5LX 2IT1A 3GDEA 4JI0L 4GLAC 2Z6KC 4KHZA 4POFA 3NENA 2D62A 3CCJA 2OTJA 1IBKL 1IBML 1CKMA 1D8LA 2HIVA 3I2ZA 4A3FG 3L7ZC 3BZKA 1X3EA 3F2BA 2AWOA 3CW2C 3RLOA 2ID0A 4EX5A 2VQFQ 4LFAL 4OXPA 2PMZE 2NVQH 1HZBA 3PIPA 3CCUA 3NELA 5M3MG 3RN2A 1JMCA 2E2HH 2XTIA 3S17H 4GN4B 4ME3A 2E5LL 4DR5L 1ASZA 1VQLA 3HOZG 1SRUA 1L2FA 4JI7Q 1NE3A 2F52A 2K4KA 2IY5B 4LF7Q 3CP0A 1VQBA 1K9MC 1N33L 1XNQQ 2EQSA 2JA8G 3S24A 4X6AH 2AKWB 4NXNQ 2A1AA 4JI4L 4X65L 3S16H 3I55A 4LF8L 3TS2A 4JI3L 2KBNA 3H3VI 5IYDH 2EXDA 1AE3A 1EUJA 2ALYB 3W1BA 2VZAA 4GNXB 3E0EA 1Y1VH 1KHIA 4BXXG 4A93G 4Y52H 2GVAA 5C0XJ 3K7UC 2UXCQ 1P16A 2WAQG 4JYAQ 4JI8Q 2R93H 2AWNA 3PCOB 3ICEA 1W3SA 2B63H 5JJIA 1UE6A 2ZJPA 4DPGA 2GN5A 3PUYA 3T1YL 5AJ3Q 2QGQA 1XNRL 1LUZA 2K5VA 1HR0Q 3GO5A 4DV3Q 4IPGA 4YY3Q 4A3MH 1S3OA 1PFSA 4B3ML 4LF7L 1E1TA 2PQAB 3SGIA 4NXML 4AYBE 3G48A 2CQOA 1EIFA 3MXNB 2YTXA 3GTPH 1KD1C 1C0AA 1HH2P 2E2IH 3CC7A 2AHOB 1BVSA 2R92H 4QGUA 1I3QH 1L1OB 1NTGA 1N34L 4DUYL 4A3IG 2N49A 2JA8H 4WJ4A 4PMWA 1JJCB 2UU9L 2AMCB 4A3CG 4LNQA 3KLWA 5EAYA 3TREA 1K73C 4DV6L 4DR4L 5C44H 4GNXA 1VQIA 3UE0A 4JI2Q 4IOCA 4AYBG 1XPOA 3HOYG 2UXDQ 3UDGA 4R4CA 4X66Q 2R92G 1G291 3T1HL 3J81j
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQC A;  1Z9F A;  4APV A;  4LFA Q;  2VQF L;  1N8R C;  3PO3 G;  2WP8 J;  4OX9 Q;  1VQ7 A;  2R7Z G;  2IX1 A;  1MKH A;  5BR8 Q;  4A3E H;  1WJJ A;  1Q12 A;  1Q46 A;  1IBL Q;  3VDY A;  1C9O A;  2UUB Q;  3PUV A;  2JEB I;  3PF5 A;  3OTO L;  3S1R H;  3FP9 A;  1VQF A;  1GM5 A;  2F4V L;  3E9H A;  1PH4 A;  4DV6 Q;  4YCW A;  4TVA B;  1NMG A;  4K0K Q;  1E1O A;  2K14 A;  1H95 A;  1KRS A;  1FGU A;  2ES2 A;  4LUV A;  1OXV A;  1OXU A;  2MQH A;  4X66 L;  4UP9 A;  1YHB A;  4GN5 A;  4UPA A;  1FL0 A;  1V9P A;  3U4V A;  4A3J G;  1VQG A;  4DK3 C;  2MO0 A;  4FDB A;  4R1J A;  2NN6 I;  4DV7 L;  2RHQ B;  4OO1 G;  1YZ6 A;  1GKH A;  3M4Q A;  2VL6 A;  3I7F A;  5GAG C;  3K8A A;  1FJG Q;  2B63 G;  3J80 c;  1J5E L;  2C35 B;  4A93 H;  3PF4 A;  1KC8 C;  1X6O A;  4JOI C;  5E7N A;  1M90 C;  1YHA A;  3J81 i;  3UDX A;  2Z6K A;  5FLX c;  4JV5 L;  1CKN B;  1HNW L;  4GS3 A;  5IYD G;  2ZM6 Q;  4A3K H;  1X3F A;  4R4T A;  3CME A;  4A3F H;  2OQ0 A;  4B3T L;  4A3L H;  4KHP L;  4HJ5 A;  4NPS A;  5J3B A;  1OTC A;  3KFU A;  4OO1 I;  1OXT A;  3ZJY C;  1K8G A;  1PYB A;  2NVY H;  4GKK Q;  2VNU D;  4DUZ Q;  1KL9 A;  1VQH A;  3HFZ B;  4HJ7 A;  1X9N A;  4GOP B;  4DR6 Q;  4DR4 Q;  3BU2 A;  1T9H A;  4EQ5 A;  3A0J A;  5IWA L;  4OON A;  2UXD L;  1S72 A;  5GAD C;  4IFD J;  2HHH Q;  3CMA A;  3F1Z A;  2VQE L;  2PQA A;  1WOC A;  1S40 A;  4JI5 Q;  1Z47 A;  1MIU A;  2ZJR A;  3TRZ A;  1YHQ A;  4QIW E;  3GTJ H;  2K50 A;  4YWM A;  2N3S A;  4LF5 L;  4POG A;  2JEA I;  4OX9 L;  1GO3 E;  3PSI A;  3PO3 H;  1JT8 A;  1YIT A;  3JC6 6;  3L0O A;  3H15 A;  4BY1 G;  4HJA A;  5FJ8 H;  1IBL L;  1GD7 A;  1PVO A;  4DR5 Q;  1VQ4 A;  1XTD A;  3G6E A;  2YTY A;  4QJF A;  2VW9 A;  1CKN A;  1Q7Y C;  4LF6 Q;  4X64 Q;  3GTM H;  4IFD G;  5C44 G;  1YNX A;  4DV5 Q;  5M3F H;  4JI8 L;  4DR7 Q;  4AH6 A;  4L5Q A;  1IBM Q;  1Q81 C;  1PH9 A;  2KCM A;  1IZ6 A;  3UDF A;  4A3B G;  1E7Z A;  1WYD A;  2R7D A;  2L15 A;  1W2B A;  4DV3 L;  3CCL A;  4YCU A;  2UUA Q;  4YCV A;  4A3K G;  4JYA L;  1D7Q A;  3M4P A;  4R4Q A;  1IYJ B;  1KIX A;  2NZH A;  1XMQ L;  1NMF A;  4H02 A;  3TQY A;  2Y0S E;  3NBH B;  2K75 A;  3H3V H;  2CWP A;  1XJV A;  1JE5 A;  1EQQ A;  1G51 A;  4UY8 C;  2JJQ A;  4MTN A;  4QY7 A;  4BA1 I;  4DAY B;  4GLX A;  2ATW A;  4BA2 I;  4A3L G;  1HNW Q;  2R93 G;  3CXC A;  3RR5 A;  1X54 A;  3UDI A;  4X62 L;  4DV0 L;  3S15 H;  3I56 A;  3G71 A;  4GKJ L;  1E3P A;  1CSQ A;  3GD7 A;  4RMF A;  1QUQ A;  1ASY A;  4LF8 Q;  5LMN W;  4IOA A;  3RLF A;  2WFW A;  1K8A C;  2UXC L;  1TXY A;  4B3R L;  2BA1 A;  1Y1V G;  1OXX K;  2H5X A;  3CAM A;  4YWK A;  1N33 Q;  2UUC L;  1HZ9 A;  1Q8K A;  3F8T A;  3WWV A;  3KOJ A;  1VCI A;  4LFB Q;  3PGZ A;  5LMU L;  1P8L A;  1E22 A;  1XMQ Q;  3PUX A;  1YJN A;  1N32 Q;  3PO2 G;  4UP7 A;  4JI2 L;  3J7Z C;  4ALP A;  3RN5 A;  4DKA C;  5IP7 G;  5BR8 L;  1EOV A;  3T1H Q;  1UE5 A;  1CUK A;  3FHW A;  4JI5 L;  2ZTC A;  1HR0 L;  3PO2 H;  2E8G A;  3HOW H;  4IO9 A;  1NBW A;  3H0G G;  3PUW A;  1M1K C;  2BH8 A;  5C4X H;  3CC2 A;  1L1O A;  2E5L Q;  2CKZ B;  3RZD H;  1VQ6 A;  2PI2 E;  1PH1 A;  5GAE C;  3CCE A;  3HKS A;  3AEV A;  1A62 A;  2OCE A;  4PZ6 A;  4AQY L;  4QQB X;  2EIF A;  1OXS C;  2KHI A;  5GRO A;  3KJO A;  2UUC Q;  2JA9 A;  3HOY H;  4JI4 Q;  2BH2 A;  2WB1 G;  1EIY B;  2JE6 I;  5FJ8 G;  4DV5 L;  4A3E G;  3AQQ A;  3J7A 5;  2NVT H;  3ULJ A;  1HZA A;  1LYL A;  4DV7 Q;  1V43 A;  2OTL A;  1A8V A;  1GVP A;  4O2D A;  3OYY A;  5IY0 A;  4YHH L;  5JEA G;  1VS0 A;  3BJU A;  1WFQ A;  4P73 A;  4JI6 Q;  3RZO H;  2BA0 A;  1Y14 B;  2UXB L;  1X56 A;  1JB7 A;  3DLL A;  4LF4 Q;  3HOU H;  2JA6 G;  1J6Q A;  3D31 A;  1QVF A;  2HIX A;  4DR1 Q;  2ZTE A;  4LUO A;  3L2P A;  2HT1 A;  3JAM i;  1SR3 A;  2HQL A;  3K81 C;  5AJ3 L;  4JI1 L;  4GOP C;  5C4X G;  5C3E H;  4B3M Q;  4L5T A;  3DM3 A;  4P72 A;  3CPW A;  2WB1 E;  2PI2 A;  4A3M G;  4LF9 L;  5IYB G;  5JJL A;  4HJ9 A;  3ULP A;  3JAM c;  1EFW A;  2CCZ A;  3HOW G;  1E24 A;  5GQO A;  4GNX C;  1VQP A;  1R9T H;  3M7N A;  2KHJ A;  4JC0 A;  1QVC A;  4C3H H;  4L5R C;  4AIM A;  1JJG A;  3HOV G;  3M9B A;  1SRO A;  4DR3 Q;  3M85 A;  3NEM A;  1SFO H;  4BY7 H;  2JA7 H;  2MNA A;  4DV0 Q;  4LWC A;  5LMN Q;  1TWH H;  3S2H H;  2OWO A;  2JK8 A;  1XMO L;  1N36 Q;  1EWI A;  4LW1 A;  4JI3 Q;  4LFC L;  4JBW A;  1KXL A;  1NY4 A;  1IBK Q;  1BKB A;  3ERS X;  1HNX L;  3HKZ G;  3KF8 B;  3HOX H;  4OWX B;  1YEZ A;  3OTO Q;  2UXB Q;  2Y0S G;  4UP8 A;  3J81 c;  3CF5 A;  2MO1 A;  1G6P A;  3GTQ H;  4HIM A;  4A3D H;  1K83 H;  5LMU Q;  1SE8 A;  1Y1W H;  3J80 i;  4JI0 Q;  2E2J H;  1AH9 A;  2DUD A;  2QEX A;  1TWA H;  3U50 C;  3W1G A;  2LXJ A;  3CCS A;  1PH2 A;  4DV4 Q;  4JBJ A;  3FKI G;  1HJP A;  4A4I A;  2VQE Q;  1Q86 C;  4A76 A;  1A0I A;  3GTL H;  1EYG A;  1XNR Q;  2IHE A;  2XGT A;  3STB D;  1XNQ L;  4JBK A;  4DR2 Q;  1IL2 A;  1X65 A;  4B3T Q;  2I5H A;  2IHF A;  2D0O A;  4J15 A;  4QL5 A;  2R7F A;  1HZC A;  3KDF A;  3W5O A;  3CC4 A;  1Q1E A;  5JJK A;  4JI7 L;  5FLM G;  1LM0 A;  5IP7 H;  3RNU A;  4DUZ L;  1VQK A;  4OWW B;  1XPU A;  2YTV A;  1U5K A;  3HOZ H;  4A3D G;  4X65 Q;  2VUM G;  2ZM6 L;  2F3I A;  1MJC A;  2Q2H A;  1QUQ B;  4Y7N H;  2Q2T A;  4DR6 L;  4DV2 L;  3STB C;  2YV5 A;  2R6G A;  4IPC A;  4DV1 L;  1VQN A;  4PZ7 A;  3FKI H;  1VQ9 A;  1PH3 A;  2K5N A;  1KQS A;  2Q2I A;  4BBS G;  1EQR A;  1VQM A;  1AE2 A;  2ASB A;  3CQZ H;  4PG3 A;  1JJ2 A;  2A8V A;  3CPF A;  5C0X I;  4BY1 H;  3I4M G;  1BBU A;  4LF5 Q;  3CD6 A;  1Y1W G;  3HOX G;  5IWA Q;  3UE1 A;  2RHS B;  1J5E Q;  4A3B H;  3I4N H;  1PHJ A;  4X62 Q;  1PH5 A;  3PIO A;  4IPH A;  3ER0 A;  1VQA A;  4NXM Q;  1WCM H;  1VQO A;  3S1M H;  2JA7 G;  1I94 Q;  2VS1 A;  4C2M H;  5K36 G;  1SN8 A;  2NZO A;  4B3R Q;  1CKO A;  1SMX A;  5GAH C;  3KJP A;  4DR7 L;  5JEA J;  3K80 C;  4BBR H;  1WCM G;  3RLN A;  5LMN L;  4A3G G;  3HOV H;  4PZ8 A;  3AFP A;  5ELO A;  4DUY Q;  3GTG H;  3S1Q H;  1I5F A;  3I4N G;  1PV4 A;  2K52 A;  1PA6 A;  1VQ8 A;  3CCR A;  4X64 L;  1UE7 A;  5IE8 A;  2VY3 A;  4HIO A;  4GN3 B;  1PH6 A;  1B8A A;  1CSP A;  2CFM A;  3PUZ A;  3K7A H;  4KI0 A;  2PNH A;  3CCM A;  4HIK A;  3OW2 A;  4BBS H;  4C3I H;  1DGS A;  5IP9 H;  5IYC H;  4LUZ A;  2JA6 H;  3K0X A;  3S2D H;  1HNZ L;  5C4J H;  4IPD A;  1PYS B;  4NB3 A;  1I94 L;  4R4O A;  3EIV A;  2A19 A;  2N78 A;  4C3J H;  4TQU S;  3GTO H;  4DAM A;  5H1S E;  4P71 A;  3B6Y A;  2V1C C;  1K0R A;  2YYZ A;  1Q1B A;  3F2C A;  1RIP A;  2N8N A;  1U0L A;  3BZC A;  4XTC S;  4A75 A;  4P74 A;  3KDF B;  4A3I H;  2B3G A;  1I50 H;  2FXQ A;  1YIJ A;  5FLM H;  3Q8D A;  1L0W A;  3CCQ A;  4JCV E;  4A3J H;  1XPR A;  5HY6 A;  1N34 Q;  1VQ5 A;  2K5H A;  4JG2 A;  5C0X G;  2UU9 Q;  1PH7 A;  4RG1 A;  1YJ9 A;  4K0K L;  1NJI C;  3H0G H;  3I4O A;  3S14 H;  2F4V Q;  4GOP A;  3LGJ A;  4DV2 Q;  2Z0S A;  3KYH C;  2I5M X;  4JOI A;  1TWC H;  4DK6 C;  4YHH Q;  3A5U A;  4R4I A;  2VUM H;  1QVG A;  2JQO A;  2ZJQ A;  5IT9 c;  1L1O C;  3G4S A;  4IFD I;  3TEH B;  1YVC A;  2D0P A;  4DNI A;  4OWT B;  4MNO A;  2R7Z H;  1B7Y B;  1VQD A;  1C7Y A;  2NVX H;  1V1Q A;  1QZG A;  2B29 A;  2WAQ E;  2I0Q A;  4DR3 L;  3S1N H;  2LSS A;  2DGY A;  5IYC G;  1QZH A;  2RCN A;  2UUB L;  2NN6 G;  1O7I A;  3CCV A;  4LFC Q;  4YWL A;  4JV5 Q;  1YBY A;  5DLQ E;  4GKK L;  4B3S L;  2KCT A;  1YJW A;  2JA5 H;  4NXN L;  4GKJ Q;  4KHP Q;  1FVI A;  3ULL A;  3A74 A;  1K3R A;  4WJ3 M;  3IRB A;  5IYB H;  2Q2U A;  4AQY Q;  1UEB A;  1TWF H;  3MEF A;  1WI5 A;  2HHH L;  3M4O H;  4LF4 L;  1X55 A;  2LXK A;  4DV4 L;  5M5W H;  5M3M H;  1N9W A;  1VQE A;  1UE1 A;  4JI6 L;  1N32 L;  5IP9 G;  1UWV A;  3M3Y H;  4A3G H;  4IJL A;  5C3E G;  2YU9 H;  3HOU G;  4DR2 L;  4BBR G;  4LF9 Q;  4BY7 G;  4LFB L;  3A5Z B;  5M5Y H;  3U58 A;  2RF4 A;  3T1Y Q;  1HR0 W;  4JI1 Q;  5M5X H;  1FJG L;  1IXR A;  1VQJ A;  4XIG S;  1HNZ Q;  3PV0 A;  4YY3 L;  2CWA A;  4HJ8 A;  3HKZ E;  2IX0 A;  1A63 A;  2GVB A;  4IJH A;  5ELN A;  4LF6 L;  1LTL A;  3TS0 A;  1PH8 A;  1X3G A;  4B3S Q;  4DR1 L;  1I6H H;  3AFQ A;  4A3C H;  1RL2 A;  4HID A;  5M3F G;  2JA5 G;  2MFI A;  4L5S A;  5HGQ A;  2ZTD A;  1TWG H;  1HNX Q;  2QA4 A;  3AYH B;  3GTK H;  3KF6 B;  1XMO Q;  1SLJ A;  3E9I A;  4MZ9 A;  1N36 L;  2OQK A;  4GLV B;  1Q82 C;  3U4Z A;  1YI2 A;  4KLK A;  4BXX H;  2UUA L;  1KRT A;  3KF6 A;  1BBW A;  3F2D A;  2KEN A;  3EBE A;  4O0A A;  3EN2 A;  4P75 A;  1MJE A;  4JBM A;  1KAW A;  3D0F A;  4DV1 Q;  1B70 B;  3I4M H;  2I5L X;  2IT1 A;  3GDE A;  4JI0 L;  4GLA C;  2Z6K C;  4KHZ A;  4POF A;  3NEN A;  2D62 A;  3CCJ A;  2OTJ A;  1IBK L;  1IBM L;  1CKM A;  1D8L A;  2HIV A;  3I2Z A;  4A3F G;  3L7Z C;  3BZK A;  1X3E A;  3F2B A;  2AWO A;  3CW2 C;  3RLO A;  2ID0 A;  4EX5 A;  2VQF Q;  4LFA L;  4OXP A;  2PMZ E;  2NVQ H;  1HZB A;  3PIP A;  3CCU A;  3NEL A;  5M3M G;  3RN2 A;  1JMC A;  2E2H H;  2XTI A;  3S17 H;  4GN4 B;  4ME3 A;  2E5L L;  4DR5 L;  1ASZ A;  1VQL A;  3HOZ G;  1SRU A;  1L2F A;  4JI7 Q;  1NE3 A;  2F52 A;  2K4K A;  2IY5 B;  4LF7 Q;  3CP0 A;  1VQB A;  1K9M C;  1N33 L;  1XNQ Q;  2EQS A;  2JA8 G;  3S24 A;  4X6A H;  2AKW B;  4NXN Q;  2A1A A;  4JI4 L;  4X65 L;  3S16 H;  3I55 A;  4LF8 L;  3TS2 A;  4JI3 L;  2KBN A;  3H3V I;  5IYD H;  2EXD A;  1AE3 A;  1EUJ A;  2ALY B;  3W1B A;  2VZA A;  4GNX B;  3E0E A;  1Y1V H;  1KHI A;  4BXX G;  4A93 G;  4Y52 H;  2GVA A;  5C0X J;  3K7U C;  2UXC Q;  1P16 A;  2WAQ G;  4JYA Q;  4JI8 Q;  2R93 H;  2AWN A;  3PCO B;  3ICE A;  1W3S A;  2B63 H;  5JJI A;  1UE6 A;  2ZJP A;  4DPG A;  2GN5 A;  3PUY A;  3T1Y L;  5AJ3 Q;  2QGQ A;  1XNR L;  1LUZ A;  2K5V A;  1HR0 Q;  3GO5 A;  4DV3 Q;  4IPG A;  4YY3 Q;  4A3M H;  1S3O A;  1PFS A;  4B3M L;  4LF7 L;  1E1T A;  2PQA B;  3SGI A;  4NXM L;  4AYB E;  3G48 A;  2CQO A;  1EIF A;  3MXN B;  2YTX A;  3GTP H;  1KD1 C;  1C0A A;  1HH2 P;  2E2I H;  3CC7 A;  2AHO B;  1BVS A;  2R92 H;  4QGU A;  1I3Q H;  1L1O B;  1NTG A;  1N34 L;  4DUY L;  4A3I G;  2N49 A;  2JA8 H;  4WJ4 A;  4PMW A;  1JJC B;  2UU9 L;  2AMC B;  4A3C G;  4LNQ A;  3KLW A;  5EAY A;  3TRE A;  1K73 C;  4DV6 L;  4DR4 L;  5C44 H;  4GNX A;  1VQI A;  3UE0 A;  4JI2 Q;  4IOC A;  4AYB G;  1XPO A;  3HOY G;  2UXD Q;  3UDG A;  4R4C A;  4X66 Q;  2R92 G;  1G29 1;  3T1H L;  3J81 j; 
#chains in the Genus database with same CATH topology
 4APV A;  1WD1 A;  2XIW A;  3ND8 A;  1EY4 A;  5JEA H;  2MPM A;  5A2Q L;  2HCI A;  1VQ7 A;  1MKH A;  5BR8 Q;  1IBL Q;  1PZK D;  1C9O A;  1KLU D;  2NTT A;  1LT3 D;  3PF5 A;  2SNM A;  1VQF A;  1EYC A;  3OIQ A;  2R7Z B;  1H95 A;  1FGU A;  1ICW A;  5C3E B;  2MQH A;  1CQF A;  1HQR D;  1YHB A;  4GN5 A;  4UPA A;  1BCP F;  5IGE A;  3U4V A;  1EEI D;  1VQG A;  4XDX A;  4R1J A;  2NN6 I;  4DV7 L;  3J80 L;  1WD0 A;  1KC8 C;  4O1N A;  2O5J C;  4OIJ A;  3J81 i;  2ZM6 Q;  3CHB D;  4R4T A;  2MHV A;  4A3F H;  4OEL B;  4KHP L;  3GTO B;  2Y0S B;  5J3B A;  5A35 A;  2F0M A;  3ZJY C;  4OO1 I;  4GKK Q;  1NUC A;  3GTQ B;  3HFZ B;  2JA6 B;  3S2D B;  4GOP B;  4DR6 Q;  1S5B D;  3QR8 A;  5IGC A;  1CQV A;  3BDO A;  3BG3 A;  4Y7N B;  4OON A;  2UXD L;  1V1O A;  1S72 A;  1TY2 A;  3E0J A;  5GAD C;  1GUO A;  1MBY A;  1S40 A;  5M9O A;  4QIW E;  5TSS A;  1W6K A;  3KLR A;  2N3S A;  4POG A;  5KGU A;  3PSI A;  1YIT A;  3L0O A;  2D5D A;  2KEE A;  2RDH A;  3V96 A;  4FO2 A;  4DR5 Q;  1XTD A;  3P7J A;  3G6E A;  3T53 B;  1PFM A;  1WCM B;  1K3B C;  1CKN A;  3I4L A;  1LAC A;  4X64 Q;  3GTM H;  4IFD G;  1S5F D;  1YNX A;  2B39 A;  3T16 A;  4DA2 A;  4AH6 A;  3KUP A;  4XQN A;  1HUM A;  4RCN A;  2XWB B;  2A69 C;  3HOX B;  4YCV A;  5KYI A;  5G3L D;  1KIX A;  1XMQ L;  3TQY A;  1SYG A;  1PRT B;  2Y0S E;  3DUZ A;  4ZCK A;  3H3V H;  2CWP A;  3I90 A;  5DNF A;  2JA7 B;  1BCP B;  1G51 A;  1ESR A;  2KCN A;  3R2I A;  4BA2 I;  1B1Z A;  3PO2 B;  1X54 A;  2WAC A;  3AU7 A;  1SE3 A;  4C3I B;  5IGB A;  4DV0 L;  3S15 H;  1F9Q A;  4LF8 Q;  3GV6 A;  1BCP C;  2WKC A;  3C2P A;  4H13 C;  2UXC L;  5DAU A;  4YWK A;  3F8T A;  3WWV A;  5LMU L;  1WTX A;  1P8L A;  3PUX A;  4K8I A;  3PO2 G;  1A3U A;  3TZU A;  3J7Z C;  3RN5 A;  1JB3 A;  2B2W C;  3T1H Q;  4JI5 L;  3OW7 A;  2E8G A;  1JOK A;  2NVY B;  5CV6 A;  1Q8I A;  1NBW A;  3H0G G;  3PUW A;  4ZRZ A;  2F0S A;  4OIK A;  5C4X H;  2QDB A;  1L1O A;  1SFO B;  2F0N A;  2E5L Q;  1PTO D;  1CT1 D;  1VQ6 A;  1K8O A;  4ID6 A;  5ELC A;  4PZ6 A;  2EIF A;  3PIP 3;  2KHI A;  3L3O C;  3KJO A;  5K5P A;  3HOY H;  1ZKO A;  1EIY B;  2JE6 I;  5ELF A;  4ZYS A;  5E4W C;  4A3E G;  2OTL A;  1F77 A;  1ET9 A;  4KY5 A;  5IY0 A;  2BDN A;  3OYY A;  2SEB D;  4YHH L;  5JEA G;  4RKL A;  4BS9 A;  1EEF D;  1ROD A;  5I4D A;  3MXU A;  3TN2 A;  2IX3 A;  4ZUJ A;  3DLL A;  3D31 A;  1QVF A;  4DR1 Q;  1SNC A;  1I3Q B;  5C4X G;  4CDE C;  1PRT F;  5KNC A;  5JJL A;  3A7L A;  5EJW A;  5IYB G;  3K5N A;  2HDL A;  3NTH A;  4GZY C;  4XT1 B;  2M00 A;  4C3H H;  2SOB A;  3GTL B;  2QDL A;  3GV3 A;  5LMN Q;  3I4N B;  1A3V A;  2OWO A;  1N36 Q;  4LW1 A;  2L9H A;  1MHW C;  4LFC L;  1F2L A;  4JI3 Q;  1JOR A;  4JBW A;  2O5I C;  3HKZ G;  3KF8 B;  3HOX H;  1YEZ A;  3OTO Q;  2Y0S G;  1G6P A;  2MO1 A;  2WII B;  1TY0 A;  3V05 A;  3AB9 A;  3PIO 3;  3J80 i;  5J22 A;  4DV4 Q;  3FKI G;  2VQE Q;  4A76 A;  1EYG A;  2IHE A;  4FF4 A;  1IL2 A;  4IUP A;  2EYO A;  3A54 A;  1HZC A;  1SYC A;  4DK1 A;  1LM0 A;  3QO2 A;  4OWW B;  2YTV A;  1MSH A;  5COR A;  2HD3 A;  3HOZ H;  4ZK9 B;  1B9N A;  2N88 A;  4ZKC B;  1U9R A;  3OIP A;  4X65 Q;  3RZO B;  2ZM6 L;  2F3I A;  2EYH A;  2F0W A;  4ABN A;  2F03 A;  3STB C;  3I4M B;  3FKI H;  4RAU C;  1VQ9 A;  2NVT B;  1EQR A;  4FNF A;  2FJ2 A;  2MGS A;  3HS0 C;  4PG3 A;  3D4D A;  1RJT A;  3AMU A;  4FP5 D;  3GTK B;  3CD6 A;  2K1B A;  3HOX G;  3UE1 A;  3I4N H;  4X62 Q;  3ER0 A;  2A68 D;  2VS1 A;  5K36 G;  1CI3 M;  4B3R Q;  1CKO A;  1SMX A;  4DR7 L;  2A69 D;  4BBR H;  2B2Y A;  4H7B A;  5D65 A;  1WCM G;  4A3G G;  3QJY A;  4PZ8 A;  3GTG H;  1DYQ A;  1VQ8 A;  3CCR A;  5C5M A;  1UE7 A;  3HG9 A;  3SE0 A;  3ONA B;  3VYR A;  2EY2 A;  1WTQ A;  1CSP A;  1T5E A;  5IYC H;  3K0X A;  4DU9 A;  2Z4H A;  2FHT A;  1I94 L;  4R4O A;  5DM7 3;  4C3J H;  1UUP A;  2N78 A;  1R4Q B;  4DAM A;  4P71 A;  3B6Y A;  1K0R A;  2JYO A;  2N8N A;  3P75 A;  4XTC S;  1DZ1 A;  1WTW A;  4A3I H;  2JA8 G;  5FLM H;  1XXG A;  2OF1 A;  5HY6 A;  4DNR B;  5C0X G;  4A93 B;  3H0G H;  2PZU A;  4GOP A;  1D1I A;  4JOI A;  2Z0S A;  3R2T A;  2VUM H;  4HMJ A;  4R4I A;  5IT9 L;  4C1N K;  2BDO A;  1I4X A;  1BF4 A;  5CV5 A;  3TEH B;  2D0P A;  4C3J G;  3G7L A;  1VQD A;  2B29 A;  3QIA A;  4FXD A;  4DR3 L;  2LSS A;  1XTC D;  5IYC G;  2RCN A;  2KQ3 A;  1ZEQ X;  2RBM A;  2KCT A;  1H9S A;  4G7H C;  4GKJ Q;  1PZI D;  2JN4 A;  1FVI A;  4BBS B;  5FKA C;  1QCB D;  3JAM E;  1QB5 D;  3TSS A;  1V1P B;  4H0L C;  3J81 L;  1EU3 A;  1GUN A;  4DN4 M;  3S9W A;  2F0D A;  4BY7 G;  1TWC B;  4N8X 1;  4JI1 Q;  4XIG S;  5HUR A;  1HNZ Q;  3PV0 A;  4HJ8 A;  2IX0 A;  3S16 B;  3QWN A;  1A63 A;  4I65 A;  1LTL A;  4KMU C;  3DWA A;  1SEB D;  4DR1 L;  1EIG A;  5I2X A;  5M3F G;  4HID A;  4A3I B;  2MFI A;  1STH A;  3IL8 A;  3I73 A;  2ZTD A;  4G4K A;  4IUN A;  4UDU C;  1N36 L;  3E9I A;  4QIW B;  3BVM A;  2PW7 A;  3U4Z A;  4KLK A;  4C3J B;  2UUA L;  1KRT A;  4O0A A;  2RCF A;  4FXG C;  4MN3 A;  1SYF A;  1D5Z C;  2IT1 A;  3GDE A;  2TSS A;  1SND A;  2D62 A;  3CCJ A;  1IBM L;  1D8L A;  2DY7 A;  2HIV A;  4A3F G;  3L7Z C;  1X3E A;  3F2B A;  4LFA L;  3CW2 C;  4EX5 A;  3SK8 A;  1HZB A;  1DOK A;  2KEC A;  4HCS A;  5LL6 X;  2Z1C A;  3S17 H;  1I6H B;  1HCZ A;  3HOZ G;  1B3Q A;  3DXJ C;  4JI7 Q;  4N8F A;  1NE3 A;  2K4K A;  3DHQ A;  4CHT B;  4C2M B;  5CBA E;  3T56 B;  4NXN Q;  1EY5 A;  2A1A A;  2KJX A;  4X65 L;  3TS2 A;  2N55 A;  3I55 A;  3WOF A;  4CBV A;  1IW7 D;  5M5X B;  1SE4 A;  2ALY B;  4Y52 H;  3E0E A;  1Y1V H;  4LJZ C;  2AUK A;  2CHB D;  1J9O A;  2D2C C;  1CZW A;  3EA6 A;  1EYD A;  4JYA Q;  4JI8 Q;  3PCO B;  4DPG A;  1Q90 A;  3PUY A;  5ELB A;  3A56 A;  1Z6H A;  3O13 A;  3T1Y L;  1AZP A;  2E2I B;  1LUZ A;  2K5V A;  4DXF A;  4DV3 Q;  4YY3 Q;  3GTP B;  4NKL A;  4KHV A;  1EIF A;  4B08 A;  3GTP H;  2YTX A;  4X3U A;  1HH2 P;  2AHO B;  2WB1 B;  4X3K A;  2N49 A;  4PMW A;  1JJC B;  2AMC B;  1F9P A;  2G9H D;  3NBI A;  4LNQ A;  2A6H D;  1K73 C;  4DV6 L;  1Y1V B;  5C44 H;  4DR4 L;  1O7Z A;  4X3S A;  4AYB G;  4CKB A;  3T1H L;  3NE5 B;  4BBR B;  1Z9F A;  2VQF L;  1QWY A;  5EKK A;  3S1M B;  2EYM A;  3RZD B;  4A3E H;  1XX8 A;  2R92 B;  1Q46 A;  2EYF A;  4JW0 A;  3NPP A;  4EQO A;  3J80 E;  3S1R H;  5C3W A;  2F4V L;  3E9H A;  1PH4 A;  4YCW A;  1ZYR D;  4TVA B;  1NMG A;  1SNP A;  3K7A B;  3NK9 A;  3FKI B;  4RH6 A;  4UP9 A;  3TME A;  1EWC A;  4JK1 C;  2AQ1 B;  5IGG A;  4RGT A;  2B2V C;  4A3J G;  4FDB A;  3SDZ A;  1A15 A;  5GAG C;  1FJG Q;  2HUG A;  3DWP A;  2C35 B;  4A93 H;  2Z6K A;  2WIN B;  5FLX c;  2IL8 A;  3M7G A;  3ERQ A;  5IYD G;  4B3T L;  5T1I A;  1TS2 A;  3P20 A;  1GHK A;  1EY9 A;  1OXT A;  4WJW A;  2NVY H;  1VQH A;  1AN8 A;  4HJ7 A;  5T1G A;  4F88 A;  5IWA L;  1CA6 A;  4IUV A;  3C1E A;  4IFD J;  5BN3 A;  2VQE L;  1Z7T A;  1AZQ A;  4LF5 L;  1JWM D;  1X3Q A;  1GO3 E;  5BN5 A;  3PO3 H;  1JT8 A;  3JC6 6;  3H15 A;  1NNX A;  2EXZ A;  2J7Z A;  1GD7 A;  1PVO A;  1Q3L A;  2IWH A;  3Q6S A;  3EJI A;  5C4Z A;  4LF6 Q;  1ENA A;  1SJE D;  4L5Q A;  1Q81 C;  1IZ6 A;  2XRQ D;  2Z9H A;  1WYD A;  3S14 B;  2R7D A;  1X3P A;  1W2B A;  4QF4 A;  4YCU A;  2UUA Q;  1K83 B;  4R4Q A;  2WV6 D;  2B8G A;  4H02 A;  5IIF A;  2QIL A;  2K75 A;  3Q24 A;  4LAA A;  1XJV A;  2Z6B A;  2E74 C;  4L6T B;  1K28 A;  3I91 A;  2K01 A;  2JJQ A;  4MTN A;  4QY7 A;  4BA1 I;  2ATW A;  1HNW Q;  2R93 G;  4MHE A;  1E3P A;  1CSQ A;  2FIN B;  3G6J B;  1QUQ A;  4RMF A;  1SNM A;  1K8A C;  4B3R L;  2TMP A;  2BA1 A;  1Y1V G;  2H5X A;  1HZ9 A;  2NWG A;  1ILQ A;  1N32 Q;  3VYU A;  2R61 A;  4JI2 L;  2WKD A;  5J1Z A;  4DKA C;  5IP7 G;  5BR8 L;  2EE1 A;  1CFM A;  5DEH A;  1ENF A;  3MA2 B;  1HR0 L;  3PO2 H;  3S1R B;  4QB4 A;  1E2Z A;  1EY7 A;  3H09 A;  5KEE A;  1QE6 A;  5E4X A;  3CC2 A;  2XWJ B;  2DNC A;  4K5X A;  1IKL A;  5GAE C;  3CCE A;  2K5D A;  1S4Z A;  3OSO A;  2EJG C;  3URY A;  2UUC Q;  2WB1 G;  3VYT A;  3LX0 A;  3J7A 5;  5JVG 3;  3BDL A;  2NVT H;  1HZA A;  3SEB A;  2A6H C;  1SJH D;  5C44 B;  1VS0 A;  1WFQ A;  3RZO H;  4C1N I;  1Y14 B;  2UXB L;  1YNJ C;  2JA6 G;  5C5L A;  1HTL D;  3OWF A;  2HIX A;  4IUU A;  2ZTE A;  4LUO A;  3L2P A;  2HT1 A;  2PQE A;  3JAM i;  2OT2 A;  5AJ3 L;  4GOP C;  5C3E H;  4NW2 A;  4A3M G;  1RHP A;  3CPW A;  3HOW G;  3JAM c;  2CCZ A;  1OO9 B;  5GQO A;  2IW3 A;  3ND9 A;  4L5R C;  3HOV G;  1SRO A;  4DR3 Q;  1H9M A;  2IPK D;  3NEM A;  1BDO A;  2A68 C;  1TWH H;  4KTA A;  1EWI A;  1ESF A;  2RA4 A;  1IBK Q;  1BKB A;  3ERS X;  4B9X A;  2UXB Q;  3VYS A;  3GTQ H;  1K83 H;  1B53 A;  3CRL C;  3KF8 A;  5EPK A;  2E2J H;  2QEX A;  1GOZ A;  3CCS A;  2EYJ A;  1PH2 A;  2EY1 A;  1Q86 C;  1HJP A;  3GTL H;  1ILP A;  4A3F B;  5M3F B;  1KNA A;  1F9R A;  4JBK A;  5CR3 A;  1EQV A;  1X65 A;  2I5H A;  4J15 A;  2D0O A;  3W5O A;  3FPU B;  3KDF A;  1S5C D;  5ISR A;  3Q0A A;  2EPB A;  1KNE A;  4RHS A;  1Q1E A;  5JJK A;  2A6E D;  5FLM G;  3LWE A;  1AEX A;  1YNN C;  5EPJ A;  3VR5 A;  2PMZ B;  3DEP A;  2KHS A;  1FNV A;  4A3D G;  4WRD A;  2VUM G;  1MJC A;  1I6V C;  3BDC A;  1SYE A;  3KBX A;  2YV5 A;  4IPC A;  4DV1 L;  3MAQ A;  1PH3 A;  2K5N A;  1LAB A;  1O7L A;  4BBS G;  1QNK A;  1JR0 D;  3CQZ H;  1JJ2 A;  4UAI A;  4DAP A;  3CPF A;  1RTO A;  2PZW A;  5IGF A;  1BBU A;  1F2Y A;  1Y1W G;  1A2T A;  1TWH B;  2DN8 A;  1PH5 A;  1WCM H;  5I6Y A;  1TS3 A;  1SN8 A;  3KJP A;  1E2W A;  1A2U A;  1XWE A;  5IOD A;  5ELO A;  3MXP A;  3S1Q H;  4K2L A;  4HAE A;  4MTK A;  1BNZ A;  2K52 A;  2GA4 B;  1TR5 A;  4HIO A;  4GN3 B;  4L8J A;  4KI0 A;  3K7A H;  2X6L A;  4BBS H;  1GUS A;  2AQ3 B;  1DD2 A;  4IPD A;  1PYS B;  1NSN S;  2M2L A;  3GTO H;  3VR2 A;  1LTS D;  3J7A V;  3F2C A;  2FFK B;  2FMM A;  3J81 E;  1U0L A;  3BS1 A;  1L0W A;  1N34 Q;  2PCF B;  3SXH A;  2UU9 Q;  1F9S A;  4RG1 A;  3HOW B;  1YJ9 A;  4K0K L;  1NJI C;  4YHH Q;  3J7A F;  2I5M X;  3A5U A;  4O42 A;  2JQO A;  2ZJQ A;  2JXM B;  4A3G B;  1LLR D;  3G4S A;  3QG1 A;  2R7Z H;  2NVX H;  1QZG A;  2WAQ E;  5JPM C;  1EOT A;  4Q0F A;  4U68 A;  4CKE A;  4DXG A;  2JA5 B;  4YWL A;  4JV5 Q;  1YBY A;  5DLQ E;  4GKK L;  2EDG A;  2E76 C;  2JA5 H;  2C9O A;  3RUZ A;  2K28 A;  4KHP Q;  3PMF A;  3A74 A;  1K3R A;  1STE A;  4WJ3 M;  3IRB A;  4OL7 A;  4LF4 L;  4DV4 L;  1VQE A;  4N9T A;  1UE1 A;  2R93 B;  5IP9 G;  1E2V A;  3M3Y H;  4IJL A;  2PPB C;  5DM6 3;  1FJG L;  5M5X H;  1FR3 A;  4LMQ D;  1STY A;  2NUC A;  3HKZ E;  1D1K A;  4U67 3;  4K6D A;  5ELN A;  4IJH A;  3MXN A;  4FF2 A;  3VA7 A;  1X3G A;  3H94 A;  3HRZ C;  3AFQ A;  1SXT A;  2HDM A;  4RFB A;  4Q5V A;  4L5S A;  5HGQ A;  1QG7 A;  2NVQ B;  1STN A;  1HNX Q;  1DCZ A;  2QA4 A;  3PO3 B;  1H9K A;  3GTK H;  4GLV B;  1Q82 C;  4HCE A;  1E0B A;  5JAV A;  1GHJ A;  3EBE A;  4WOR A;  4P75 A;  5C4J B;  2LS0 1;  4KV6 A;  3I4M H;  1B70 B;  4POF A;  3NEN A;  3FEW X;  3K59 A;  2CW0 C;  3I2Z A;  2A6E C;  2VQF Q;  2AWO A;  4Z9C B;  2EJF C;  4OXP A;  2K5Q A;  2B2Y C;  3RN2 A;  1GUT A;  1JMC A;  1EY0 A;  2E2H H;  4ULL A;  4HED A;  4GN4 B;  2Z8L A;  1VQL A;  2DJF C;  4FF1 A;  5D3I B;  2F52 A;  4XXE A;  2IY5 B;  4LF7 Q;  1VQB A;  2BOS A;  3U9S A;  3S24 A;  1WVL A;  2KVM A;  5KNB A;  4LF8 L;  4K5W A;  1AE3 A;  4GNX B;  2B2T A;  2XN9 C;  5M3M B;  1SE2 A;  5C0X J;  4KD3 A;  2UXC Q;  2WAQ G;  1CA5 A;  1W3S A;  1UE6 A;  1SMY D;  2ZJP A;  5AJ3 Q;  3K5O A;  1XNR L;  3GO5 A;  1S3O A;  4XQJ A;  1LTG D;  2Z4I A;  4NXM L;  1RCV D;  2CQO A;  3MXN B;  2K5W A;  3CC7 A;  4A3E B;  2R92 H;  3T13 A;  1G6Z A;  4G57 A;  1TU2 B;  4WJ4 A;  4K5V A;  1UAP A;  3KLW A;  3TRE A;  2EY6 A;  5I9O A;  3MWY W;  2RDG A;  4JI2 Q;  5LHY 1;  3H0G B;  4X66 Q;  2R92 G;  2H4O A;  4C3I G;  3J81 j;  1VQC A;  3X3M A;  4LFA Q;  1PTO C;  3PO3 G;  1B3A A;  2IX1 A;  5FLX L;  4RGN A;  1WJJ A;  2D9U A;  3VDY A;  3VR4 A;  2UUB Q;  1PMR A;  3PUV A;  4AYB B;  1SYB A;  1FNU A;  4DK0 A;  3NQI A;  2B2T C;  3OTO L;  4ODG A;  2MJ8 A;  1V8Q A;  1HRJ A;  3NSW A;  4K0K Q;  1SNO A;  2K14 A;  2LMC B;  2ES2 A;  1OXV A;  1OXU A;  1U4M A;  2F0G A;  4X66 L;  2NZ1 D;  1V9P A;  4DK3 C;  2MO0 A;  1Y69 U;  2BCO A;  2RHQ B;  4OO1 G;  1YZ6 A;  1GKH A;  3M4Q A;  2VL6 A;  3I7F A;  3BVZ A;  3K8A A;  2B63 G;  2ICE C;  3J80 c;  1J5E L;  2A5H A;  2EJM A;  4HN7 A;  1X6O A;  2K33 A;  1B44 D;  4JOI C;  4M1U B;  1H9S B;  4FYD A;  4G7Z C;  1EY6 A;  1YHA A;  1HXY D;  2ZT9 C;  3D4W A;  1STG A;  2F0T A;  3UDX A;  1JIC A;  4JV5 L;  1HNW L;  4G7O C;  3TBI B;  1X3F A;  4KJO A;  4DNT B;  2OQ0 A;  3HZX A;  1WTV A;  1BUV T;  4HJ5 A;  1U4R A;  4NPS A;  3KFU A;  3OMC A;  3IKJ A;  1K8G A;  2VNU D;  4EQN A;  4DUZ Q;  1KL9 A;  2A74 C;  1X9N A;  4DR4 Q;  3BU2 A;  2OXP A;  4TKO B;  4EQ5 A;  2QKI C;  5C0X H;  3I8Z A;  2MUY A;  3L9A X;  2CVR A;  2PQA A;  2HQE A;  2EOT A;  3TRZ A;  2ZJR A;  1YHQ A;  4JPB W;  2K50 A;  4OGQ C;  4OX9 L;  3OHX C;  4HJA A;  4BY1 G;  3FVQ A;  5ELD A;  1VQ4 A;  2YTY A;  2VW9 A;  4JI8 L;  4DR7 Q;  5M5Y B;  2F0L A;  1CZG A;  3UDF A;  1E7Z A;  1CHQ D;  2K04 A;  4DV3 L;  3CCL A;  4A3K G;  4JYA L;  3M4P A;  1IYJ B;  2NZH A;  1NMF A;  3RD4 A;  2RVL A;  3QOL A;  5EQ0 A;  1ONL A;  3NBH B;  1XYI A;  1JOO A;  3I3C A;  5IT9 E;  5D3D A;  4BY7 B;  4NDX A;  4UY8 C;  4F87 A;  1R9T B;  5JPN C;  2L0C A;  4A3L G;  5FO7 B;  4DAY B;  2P5Z X;  3CXC A;  3RR5 A;  3NHH A;  3UDI A;  2DY8 A;  1ASY A;  4OEM B;  3A8I E;  5LMN W;  3MHB A;  5C4H A;  4IOA A;  2WFW A;  1TXY A;  1KAB A;  1PDQ A;  1N33 Q;  1OXX K;  1Q8K A;  1EFI D;  1XMQ Q;  4NP5 A;  2QF7 A;  2VUM B;  4ALP A;  4A3D B;  1CUK A;  1BOS A;  3KBG A;  3JAM L;  1H9R A;  1HQM C;  1NR4 A;  4IO9 A;  2VXW A;  3HOY B;  4QUF A;  1BCP D;  1JQY D;  5ELE A;  2CKZ B;  1KLG D;  2CW0 D;  3AEV A;  3TZD A;  1A62 A;  3MEH A;  1R4P B;  4AQY L;  4A3K B;  3MTS A;  4RGM A;  2JP1 A;  4JI4 Q;  1G2S A;  2RSO A;  5FJ8 G;  4DV5 L;  5FO9 B;  4ZQ3 A;  1VF5 C;  1V43 A;  1GVP A;  1MGS A;  3K0Y A;  4O2D A;  1G2T A;  4XYO A;  3BJU A;  4P73 A;  4JI6 Q;  4ILW A;  1JOQ A;  2EYL A;  4CJ1 B;  4PNY A;  1J6Q A;  1SR3 A;  1FNW A;  2BE5 C;  4JI1 L;  4B3M Q;  3HOV B;  1T5X D;  3FDT A;  4KN4 C;  4B9W A;  4HJ9 A;  3VA5 A;  4GNX C;  1VQP A;  1R9T H;  2KHJ A;  3ITP A;  4HSV A;  4JC0 A;  5KYL A;  4A3M B;  3M9B A;  4BY7 H;  2JA7 H;  2MNA A;  2B2U C;  3S2H H;  2JK8 A;  1XMO L;  1SAP A;  1NY4 A;  3N6R A;  2A73 B;  3DWQ A;  3J81 c;  2RSN A;  4HIM A;  2PO4 A;  1HFG A;  3TP6 A;  3NBH A;  2ZXO A;  2DUD A;  1TWA H;  3U50 C;  1I4Q A;  2LXJ A;  3SHL A;  4A4I A;  3BZD B;  1XNR Q;  3SK6 A;  1QJO A;  2F0O A;  2XGT A;  3STB D;  2QEJ C;  5EPL A;  1XNQ L;  1U4L A;  2QW7 A;  3CRK C;  4KK7 A;  5C6A A;  4QL5 A;  2R7F A;  3W3A A;  3NP8 A;  4XYQ A;  3T4A C;  4JI7 L;  3E5S A;  1ZYR C;  5IP7 H;  3RNU A;  3GP7 A;  4DUZ L;  1VQK A;  3M4Y A;  1MI2 A;  1PRT D;  3HOU B;  1B50 A;  3D3R A;  5A2Q E;  2KUM A;  1PZJ D;  4Y7N H;  4DR6 L;  1VQN A;  2R6G A;  2B8F A;  3A55 A;  1KQS A;  3KLS A;  1AE2 A;  2ASB A;  5E3F A;  4BY1 H;  3I4M G;  3IAY A;  4A3B H;  5CC4 A;  3PIO A;  4IPH A;  1VQO A;  3S1M H;  3KK7 A;  5AFW A;  1I94 Q;  4C2M H;  2F1M A;  5GAH C;  5JVH 3;  5CV7 A;  3K80 C;  5JEA J;  3HKZ B;  3S17 B;  2EYP A;  4FVM A;  3HOV H;  3AFP A;  4F8M A;  4DUY Q;  1HA5 A;  3I4N G;  4CDF C;  1PA6 A;  4X64 L;  1PTO F;  1H9J A;  3M4O B;  5I2Y A;  2OEO A;  1B8A A;  2CFM A;  3PUZ A;  1B2T A;  1U4P A;  1LTR D;  5IP9 H;  1PLF A;  2F0E A;  3NQT A;  3EIV A;  2A19 A;  1EU4 A;  3H6M A;  4TQU S;  2V1C C;  1Q1B A;  1W6J A;  4QUC A;  4WFN 3;  4P74 A;  3RMH A;  1TT2 A;  2B3G A;  1I50 H;  2FXQ A;  5L37 A;  3Q8D A;  2WAQ B;  4JCV E;  4A3J H;  4KD4 A;  1D5M C;  1PH7 A;  2K03 A;  3D6W A;  2PNR C;  3I4O A;  3S14 H;  2F4V Q;  4DV2 Q;  1YNN D;  1TWC H;  4DK6 C;  1LTA D;  3TP5 A;  2QCP X;  3FRP B;  1BXT A;  5IT9 c;  4N9P A;  4RCO A;  1C48 A;  4EGV A;  2I0Q A;  1QZH A;  2UUB L;  2NN6 G;  1O7I A;  3CCV A;  4ZUI A;  3N52 A;  3KLS X;  2O2L D;  3FMC A;  3GTJ B;  1FD7 D;  4OHJ A;  3CU7 A;  4EQP A;  1L0X B;  2PYK A;  3ULL A;  1EWH A;  1UNS A;  3VR6 A;  5IYB H;  4AQY Q;  1TWF H;  3MEF A;  1LTT D;  1WI5 A;  2HHH L;  1FGB D;  5KIX A;  5M5W H;  5M3M H;  1QIL A;  4IUR A;  2F3V A;  4JI6 L;  1N32 L;  3NWT A;  1UWV A;  5CMD A;  1HA6 A;  3E6Z X;  4DR2 L;  3D4R A;  5M5Y H;  2RF4 A;  1IXR A;  2CWA A;  4X3T A;  2RDF A;  3HEJ A;  1HUN A;  4LF6 L;  3TS0 A;  2BE5 D;  2MP1 A;  4MIU A;  1Y8P B;  4A3C H;  1SYD A;  3V2T A;  3MFG A;  1BR9 A;  1XMO Q;  4IUQ A;  1DOM A;  3KF6 A;  1BBW A;  3F2D A;  2KEN A;  4JBM A;  1MJE A;  1I4G A;  1KAW A;  3D0F A;  1GUW A;  1KDA A;  1S5E D;  4DV1 Q;  2XSC A;  4H44 C;  4KHZ A;  1NR2 A;  2Z6K C;  4BWG B;  1CKM A;  1GJX A;  3BZK A;  2ID0 A;  5EGT A;  2PMZ E;  2NVQ H;  3CCU A;  4PQX A;  3NEL A;  5M3M G;  2K05 A;  3ERO A;  4RHR A;  1TWG B;  5CGK A;  4ME3 A;  3TP8 A;  3BYY B;  2E5L L;  4DR5 L;  1ASZ A;  1SMY C;  3OOC A;  1VF7 A;  4QCL A;  4DAY A;  1DJR D;  3OPO A;  1XNQ Q;  1K9M C;  2CH4 W;  2EQS A;  3H91 A;  4CDD C;  5KND A;  2AKW B;  2KED A;  4JI4 L;  5IYD H;  2EXD A;  2NB0 A;  1EUJ A;  4QMG A;  3W1B A;  2VZA A;  2F0H A;  3K6O A;  1GUG A;  1QOH A;  1P16 A;  2L12 A;  2R93 H;  2AWN A;  3ICE A;  2B63 H;  5JJI A;  2GN5 A;  3OMG A;  1HR0 Q;  4B3M L;  1PFS A;  2DNE A;  2Q8T A;  1E1T A;  3HOZ B;  1UEA B;  3SGI A;  4AYB E;  3G48 A;  3S1N B;  1C4Q A;  2NVX B;  2NTS A;  3F2U A;  2E2I H;  3D8G A;  1L1O B;  1NTG A;  1N34 L;  4DUY L;  4IQZ A;  2UU9 L;  2XRS D;  1PXU A;  1L0Y B;  5EAY A;  5EKI A;  1TWA B;  4NMZ A;  3UE0 A;  4CKC A;  4GNX A;  1STB A;  1XPO A;  2UXD Q;  3UDG A;  4R4C A;  3GTG B;  3DM1 A;  1JC7 A;  1TS5 A;  5BN4 A;  5M5W B;  5CBE E;  5EBD A;  1N8R C;  2WP8 J;  2B2U A;  4IN3 A;  4OX9 Q;  4CJ0 B;  2R7Z G;  1EZ8 A;  2EY5 A;  4ME5 A;  3S2H B;  1Q12 A;  2JEB I;  3E3X A;  1PFN A;  3FP9 A;  4XT3 B;  1GM5 A;  4DV6 Q;  2C5C A;  2FMC A;  1E1O A;  4K2K A;  1KRS A;  3DEO A;  2KOL A;  4LUV A;  5FOB B;  1FL0 A;  4DAV A;  1ENC A;  2R3Z A;  1PYW D;  1RTN A;  4V0B A;  3PF4 A;  4IAL A;  5E7N A;  5J39 A;  1M90 C;  4F7X A;  5F2D A;  3SK4 A;  4DF7 A;  1CKN B;  3H3V C;  4GS3 A;  4A3K H;  5FK9 C;  3CME A;  2L4N A;  4A3L H;  4CGY B;  1DOL A;  1OTC A;  1NCV A;  1PYB A;  3I72 A;  2CH4 A;  1TWF B;  1T9H A;  3A0J A;  1LT5 D;  1C8C A;  2LFN A;  5FO8 B;  4C3H G;  4K8J A;  2HHH Q;  3CMA A;  1RF2 D;  3F1Z A;  1WOC A;  4JI5 Q;  1Z47 A;  1MIU A;  4RA8 A;  1BO0 A;  2L5T A;  3GTJ H;  4YWM A;  4C3H B;  2JEA I;  1IKM A;  3IFT A;  5COY A;  5FJ8 H;  5NUC A;  1IBL L;  4QJF A;  1JWS D;  1Q7Y C;  4PMB A;  5C44 G;  2E75 C;  4P2C B;  4DV5 Q;  2AQ2 B;  5M3F H;  2AUJ D;  3LNN A;  1IBM Q;  2B2W A;  3BVG A;  1PH9 A;  2KCM A;  2F0Q A;  4V19 0;  5EKL A;  4A3B G;  2E2J B;  1PFB A;  2L15 A;  1Y8N B;  1Y1W B;  1D7Q A;  1JE4 A;  4RWS C;  1I50 B;  3D6C A;  4KY6 A;  3P1H A;  5G3L F;  1JE5 A;  1EQQ A;  5LL6 S;  3GTM B;  4OO1 H;  1A6X A;  3Q23 A;  4GLX A;  1PTO B;  1HFN A;  2ZXP A;  4HR7 B;  1QNU A;  4X62 L;  1X32 A;  3I56 A;  3G71 A;  4GKJ L;  3GD7 A;  3RLF A;  1IW7 C;  1KDC A;  1TS4 A;  1ET6 A;  1O80 A;  3CAM A;  2UUC L;  2F0J A;  4PMC A;  3KOJ A;  1VCI A;  3PGZ A;  5FLX E;  1E22 A;  1YJN A;  1WTP A;  1O78 A;  4UP7 A;  3R3O A;  3VR3 A;  2K7V A;  1EOV A;  1UE5 A;  2PW5 A;  3FHW A;  3SR1 A;  2ZTC A;  3HOW H;  1LV9 A;  2V4D A;  3EFX D;  5I9P A;  3BYT B;  4XQQ A;  1M1K C;  2BH8 A;  5CYU A;  2G9D A;  4K6L A;  3RZD H;  3I70 A;  2PI2 E;  1PH1 A;  3HKS A;  4QQB X;  2OCE A;  1LT4 D;  1OXS C;  4BY1 B;  1A3T A;  5GRO A;  1GXD C;  3T51 B;  2JA9 A;  2BH2 A;  3LWU A;  3AQQ A;  1EL0 A;  3ULJ A;  1LYL A;  4DV7 Q;  1A8V A;  1IYU A;  2SDF A;  4KJN A;  1EYA A;  1V1P A;  1NAP A;  4FXK C;  2BA0 A;  4KN7 C;  1X56 A;  1JB7 A;  3HOU H;  4LF4 Q;  4LFB Q;  5K36 H;  3NTI A;  2HQL A;  3K81 C;  1RDP D;  4L5T A;  3DM3 A;  4P72 A;  2F0K A;  2WB1 E;  2PI2 A;  4LF9 L;  3ULP A;  4YIJ A;  1EFW A;  1M8A A;  1E24 A;  2K6A A;  1MD2 D;  3M7N A;  1RKN A;  1TQO A;  2ZXR A;  3K5M A;  1PTO H;  1QVC A;  2X6G A;  4AIM A;  1JJG A;  1SFO H;  4R9W A;  3M85 A;  4DV0 Q;  5C4X B;  4LWC A;  2NN6 H;  1LO5 D;  4R8N A;  2F0F A;  2F4I A;  1SBB B;  3MC0 B;  2B63 B;  1KXL A;  4K14 A;  1HNX L;  4OWX B;  2B2V A;  5IGD A;  4UP8 A;  5C3X A;  3CF5 A;  1STA A;  4A3D H;  5LMU Q;  3U9O A;  1SE8 A;  3NWS A;  2XVS A;  1Y1W H;  1KTK A;  4JI0 Q;  1AH9 A;  4CJ2 C;  2M9V A;  1Y8O B;  1SDF A;  3W1G A;  3A7A B;  4JBJ A;  1A0I A;  4DGZ A;  1I4R A;  1AW7 A;  1WTO A;  3K58 A;  4DR2 Q;  1RD9 D;  2VB2 X;  1HPC A;  4TRD A;  2IHF A;  3CC4 A;  3GQB A;  1LTB D;  4B3T Q;  1B4O A;  1XPU A;  3MFY A;  1HTP A;  1U5K A;  2Q2H A;  1QUQ B;  2Q2T A;  4DV2 L;  4L63 B;  2NBF A;  4PZ7 A;  2Q2I A;  1VQM A;  3TDQ A;  5D14 A;  2A8V A;  1LTI D;  1FYC A;  5C0X I;  4J6H A;  4LF5 Q;  2EVB A;  1K8M A;  4ZKB B;  5IWA Q;  1B9M A;  2RHS B;  1J5E Q;  4IUT A;  1PHJ A;  3SK5 A;  2LY7 A;  2XNA C;  1VQA A;  2J0T D;  4NXM Q;  1J8I A;  3A8J E;  2JA7 G;  3X3N A;  2NZO A;  3EVQ A;  1JWU D;  1VMP A;  2ENB A;  3RLN A;  5LMN L;  3CKI B;  4RKB A;  1I5F A;  2F0V A;  3Q22 A;  1PV4 A;  2RKS A;  4HMI A;  5IE8 A;  2VY3 A;  4IZ8 A;  1AP0 A;  1PH6 A;  5CV4 A;  3CCM A;  1II3 A;  1CM9 A;  3OW2 A;  1CK1 A;  2PNH A;  4HIK A;  4C3I H;  3S15 B;  1DGS A;  4FF3 A;  4LUZ A;  2JA6 H;  3S2D H;  4HSP A;  2NYZ D;  1HNZ L;  5C4J H;  1KAA A;  4CDC C;  1G91 A;  5JOB A;  4NB3 A;  1DXM A;  4C56 C;  3IFD A;  5H1S E;  2PZT A;  2YYZ A;  3OWE B;  5E1F A;  1M4V A;  4A75 A;  1RIP A;  3BZC A;  3FPP A;  3KDF B;  1YIJ A;  2VB3 X;  1MSG A;  3CCQ A;  1XPR A;  1EQT A;  1VQ5 A;  2K5H A;  4JG2 A;  4UHV A;  2J4X A;  3ZYY X;  1TVX A;  4EVO A;  1ICF B;  3MZ5 A;  3W2D A;  3LGJ A;  1KDB A;  3KYH C;  4J8Q A;  3J7Y W;  3K57 A;  1QVG A;  5I6W A;  2EZV A;  2YU9 B;  2ICI A;  2L1B A;  3M3Y B;  1L1O C;  2DJG C;  2Q8I B;  4IFD I;  1D6E C;  3HP3 A;  1YVC A;  4DNI A;  4OWT B;  3PQI A;  2Q8R E;  4MNO A;  4A3J B;  1HHV A;  1B7Y B;  1C7Y A;  1V1Q A;  4E6I A;  4I7Z C;  3S1N H;  2KA7 A;  2DGY A;  3UI2 A;  4LFC Q;  2F0I A;  2L55 A;  4B3S L;  1YJW A;  3NUC A;  4NXN L;  1G8Z D;  1IHZ A;  3C46 A;  2F0U A;  1K0S A;  2Q2U A;  1UEB A;  1VMC A;  2RQX A;  3QB3 A;  3WOE A;  3M4O H;  1X55 A;  2LXK A;  1IYV A;  2JSO A;  1N9W A;  3MXG A;  5JJZ A;  5KRU A;  2F0P A;  2I07 B;  4A3G H;  5C3E G;  2YU9 H;  3HOU G;  1CTM A;  3HGB A;  4LK1 C;  4BBR G;  4LF9 Q;  4LFB L;  3A5Z B;  3U58 A;  1HR0 W;  3T1Y Q;  1TII D;  1VQJ A;  4YY3 L;  1D5X C;  5IOC A;  1AFP A;  4HTH A;  1SNQ A;  2GVB A;  1S5D D;  1PH8 A;  4B3S Q;  1I4P A;  3NTK A;  1I6H H;  1EY8 A;  1RL2 A;  3MVV A;  1YNJ D;  2JA5 G;  4A3B B;  1TWG H;  3AYH B;  1EIH A;  4PV1 C;  4IFD H;  3KF6 B;  1SLJ A;  4MZ9 A;  4I7A A;  1F2Z A;  2OQK A;  3SVM A;  2G5D A;  2LKV A;  1YI2 A;  4BXX H;  1ZXT A;  1CHP D;  3EN2 A;  5EBC A;  3A8K E;  1O7Y A;  1WTR A;  2I5L X;  1I4H A;  1PRT C;  4JI0 L;  4GLA C;  2OTJ A;  1IBK L;  2HCC A;  3QOJ A;  3RLO A;  1JCK B;  1ML0 D;  3PIP A;  4M8A A;  2K32 A;  2XTI A;  1TKW B;  2KCC A;  1SRU A;  1L2F A;  4J1M A;  4KKS A;  3R93 A;  3CP0 A;  2L11 A;  1N33 L;  4KY7 A;  2H1E A;  4X6A H;  1LT6 D;  4TSS A;  2E2H B;  3S16 H;  4JI3 L;  2KBN A;  3H3V I;  1BQQ T;  3C1F A;  1SSO A;  1EZ6 A;  3K5L A;  4BXX G;  4A93 G;  2IJ0 A;  1KHI A;  2GVA A;  2E2D C;  3CQZ B;  3K7U C;  4JVZ A;  2JA8 B;  4S3S A;  1D2B A;  3NXW A;  2X69 A;  2QGQ A;  1IL8 A;  1WTH A;  2O4X A;  4IPG A;  1DM0 B;  4A3M H;  4LF7 L;  2PQA B;  3EQL C;  1F2M A;  3WDN A;  1KD1 C;  1DON A;  1C0A A;  4KKU A;  1VDZ A;  1BVS A;  4QGU A;  4R8I A;  1I3Q H;  3C3L A;  4A3I G;  2JA8 H;  3R8B A;  4DFA A;  2F3W A;  2CQA A;  4RGO S;  4A3C G;  3DMU A;  1BBX C;  4ZAI A;  5HGT A;  3TP7 A;  5CV8 A;  4KKT A;  5CV9 A;  1VQI A;  2SNS A;  4IOC A;  3S1Q B;  3HOY G;  4ZLT F;  2I46 A;  1G29 1; 
#chains in the Genus database with same CATH homology
 1VQC A;  1Z9F A;  4APV A;  4LFA Q;  2VQF L;  1N8R C;  3PO3 G;  2WP8 J;  4OX9 Q;  1VQ7 A;  2R7Z G;  2IX1 A;  1MKH A;  5BR8 Q;  4A3E H;  1WJJ A;  1Q12 A;  1Q46 A;  1IBL Q;  3VDY A;  1C9O A;  2UUB Q;  3PUV A;  2JEB I;  3PF5 A;  3OTO L;  3S1R H;  3FP9 A;  1VQF A;  1GM5 A;  2F4V L;  3E9H A;  1PH4 A;  4DV6 Q;  4YCW A;  4TVA B;  1NMG A;  4K0K Q;  1E1O A;  2K14 A;  1H95 A;  1KRS A;  1FGU A;  2ES2 A;  4LUV A;  1OXV A;  1OXU A;  2MQH A;  4X66 L;  4UP9 A;  1YHB A;  4GN5 A;  4UPA A;  1FL0 A;  1V9P A;  3U4V A;  4A3J G;  1VQG A;  4DK3 C;  2MO0 A;  4FDB A;  4R1J A;  2NN6 I;  4DV7 L;  2RHQ B;  4OO1 G;  1YZ6 A;  1GKH A;  3M4Q A;  2VL6 A;  3I7F A;  5GAG C;  3K8A A;  1FJG Q;  2B63 G;  3J80 c;  1J5E L;  2C35 B;  4A93 H;  3PF4 A;  1KC8 C;  1X6O A;  4JOI C;  5E7N A;  1M90 C;  1YHA A;  3J81 i;  3UDX A;  2Z6K A;  5FLX c;  4JV5 L;  1CKN B;  1HNW L;  4GS3 A;  5IYD G;  2ZM6 Q;  4A3K H;  1X3F A;  4R4T A;  3CME A;  4A3F H;  2OQ0 A;  4B3T L;  4A3L H;  4KHP L;  4HJ5 A;  4NPS A;  5J3B A;  1OTC A;  3KFU A;  4OO1 I;  1OXT A;  3ZJY C;  1K8G A;  1PYB A;  2NVY H;  4GKK Q;  2VNU D;  4DUZ Q;  1KL9 A;  1VQH A;  3HFZ B;  4HJ7 A;  1X9N A;  4GOP B;  4DR6 Q;  4DR4 Q;  3BU2 A;  1T9H A;  4EQ5 A;  3A0J A;  5IWA L;  4OON A;  2UXD L;  1S72 A;  5GAD C;  4IFD J;  2HHH Q;  3CMA A;  3F1Z A;  2VQE L;  2PQA A;  1WOC A;  1S40 A;  4JI5 Q;  1Z47 A;  1MIU A;  2ZJR A;  3TRZ A;  1YHQ A;  4QIW E;  3GTJ H;  2K50 A;  4YWM A;  2N3S A;  4LF5 L;  4POG A;  2JEA I;  4OX9 L;  1GO3 E;  3PSI A;  3PO3 H;  1JT8 A;  1YIT A;  3JC6 6;  3L0O A;  3H15 A;  4BY1 G;  4HJA A;  5FJ8 H;  1IBL L;  1GD7 A;  1PVO A;  4DR5 Q;  1VQ4 A;  1XTD A;  3G6E A;  2YTY A;  4QJF A;  2VW9 A;  1CKN A;  1Q7Y C;  4LF6 Q;  4X64 Q;  3GTM H;  4IFD G;  5C44 G;  1YNX A;  4DV5 Q;  5M3F H;  4JI8 L;  4DR7 Q;  4AH6 A;  4L5Q A;  1IBM Q;  1Q81 C;  1PH9 A;  2KCM A;  1IZ6 A;  3UDF A;  4A3B G;  1E7Z A;  1WYD A;  2R7D A;  2L15 A;  1W2B A;  4DV3 L;  3CCL A;  4YCU A;  2UUA Q;  4YCV A;  4A3K G;  4JYA L;  1D7Q A;  3M4P A;  4R4Q A;  1IYJ B;  1KIX A;  2NZH A;  1XMQ L;  1NMF A;  4H02 A;  3TQY A;  2Y0S E;  3NBH B;  2K75 A;  3H3V H;  2CWP A;  1XJV A;  1JE5 A;  1EQQ A;  1G51 A;  4UY8 C;  2JJQ A;  4MTN A;  4QY7 A;  4BA1 I;  4DAY B;  4GLX A;  2ATW A;  4BA2 I;  4A3L G;  1HNW Q;  2R93 G;  3CXC A;  3RR5 A;  1X54 A;  3UDI A;  4X62 L;  4DV0 L;  3S15 H;  3I56 A;  3G71 A;  4GKJ L;  1E3P A;  1CSQ A;  3GD7 A;  4RMF A;  1QUQ A;  1ASY A;  4LF8 Q;  5LMN W;  4IOA A;  3RLF A;  2WFW A;  1K8A C;  2UXC L;  1TXY A;  4B3R L;  2BA1 A;  1Y1V G;  1OXX K;  2H5X A;  3CAM A;  4YWK A;  1N33 Q;  2UUC L;  1HZ9 A;  1Q8K A;  3F8T A;  3WWV A;  3KOJ A;  1VCI A;  4LFB Q;  3PGZ A;  5LMU L;  1P8L A;  1E22 A;  1XMQ Q;  3PUX A;  1YJN A;  1N32 Q;  3PO2 G;  4UP7 A;  4JI2 L;  3J7Z C;  4ALP A;  3RN5 A;  4DKA C;  5IP7 G;  5BR8 L;  1EOV A;  3T1H Q;  1UE5 A;  1CUK A;  3FHW A;  4JI5 L;  2ZTC A;  1HR0 L;  3PO2 H;  2E8G A;  3HOW H;  4IO9 A;  1NBW A;  3H0G G;  3PUW A;  1M1K C;  2BH8 A;  5C4X H;  3CC2 A;  1L1O A;  2E5L Q;  2CKZ B;  3RZD H;  1VQ6 A;  2PI2 E;  1PH1 A;  5GAE C;  3CCE A;  3HKS A;  3AEV A;  1A62 A;  2OCE A;  4PZ6 A;  4AQY L;  4QQB X;  2EIF A;  1OXS C;  2KHI A;  5GRO A;  3KJO A;  2UUC Q;  2JA9 A;  3HOY H;  4JI4 Q;  2BH2 A;  2WB1 G;  1EIY B;  2JE6 I;  5FJ8 G;  4DV5 L;  4A3E G;  3AQQ A;  3J7A 5;  2NVT H;  3ULJ A;  1HZA A;  1LYL A;  4DV7 Q;  1V43 A;  2OTL A;  1A8V A;  1GVP A;  4O2D A;  3OYY A;  5IY0 A;  4YHH L;  5JEA G;  1VS0 A;  3BJU A;  1WFQ A;  4P73 A;  4JI6 Q;  3RZO H;  2BA0 A;  1Y14 B;  2UXB L;  1X56 A;  1JB7 A;  3DLL A;  4LF4 Q;  3HOU H;  2JA6 G;  1J6Q A;  3D31 A;  1QVF A;  2HIX A;  4DR1 Q;  2ZTE A;  4LUO A;  3L2P A;  2HT1 A;  3JAM i;  1SR3 A;  2HQL A;  3K81 C;  5AJ3 L;  4JI1 L;  4GOP C;  5C4X G;  5C3E H;  4B3M Q;  4L5T A;  3DM3 A;  4P72 A;  3CPW A;  2WB1 E;  2PI2 A;  4A3M G;  4LF9 L;  5IYB G;  5JJL A;  4HJ9 A;  3ULP A;  3JAM c;  1EFW A;  2CCZ A;  3HOW G;  1E24 A;  5GQO A;  4GNX C;  1VQP A;  1R9T H;  3M7N A;  2KHJ A;  4JC0 A;  1QVC A;  4C3H H;  4L5R C;  4AIM A;  1JJG A;  3HOV G;  3M9B A;  1SRO A;  4DR3 Q;  3M85 A;  3NEM A;  1SFO H;  4BY7 H;  2JA7 H;  2MNA A;  4DV0 Q;  4LWC A;  5LMN Q;  1TWH H;  3S2H H;  2OWO A;  2JK8 A;  1XMO L;  1N36 Q;  1EWI A;  4LW1 A;  4JI3 Q;  4LFC L;  4JBW A;  1KXL A;  1NY4 A;  1IBK Q;  1BKB A;  3ERS X;  1HNX L;  3HKZ G;  3KF8 B;  3HOX H;  4OWX B;  1YEZ A;  3OTO Q;  2UXB Q;  2Y0S G;  4UP8 A;  3J81 c;  3CF5 A;  2MO1 A;  1G6P A;  3GTQ H;  4HIM A;  4A3D H;  1K83 H;  5LMU Q;  1SE8 A;  1Y1W H;  3J80 i;  4JI0 Q;  2E2J H;  1AH9 A;  2DUD A;  2QEX A;  1TWA H;  3U50 C;  3W1G A;  2LXJ A;  3CCS A;  1PH2 A;  4DV4 Q;  4JBJ A;  3FKI G;  1HJP A;  4A4I A;  2VQE Q;  1Q86 C;  4A76 A;  1A0I A;  3GTL H;  1EYG A;  1XNR Q;  2IHE A;  2XGT A;  3STB D;  1XNQ L;  4JBK A;  4DR2 Q;  1IL2 A;  1X65 A;  4B3T Q;  2I5H A;  2IHF A;  2D0O A;  4J15 A;  4QL5 A;  2R7F A;  1HZC A;  3KDF A;  3W5O A;  3CC4 A;  1Q1E A;  5JJK A;  4JI7 L;  5FLM G;  1LM0 A;  5IP7 H;  3RNU A;  4DUZ L;  1VQK A;  4OWW B;  1XPU A;  2YTV A;  1U5K A;  3HOZ H;  4A3D G;  4X65 Q;  2VUM G;  2ZM6 L;  2F3I A;  1MJC A;  2Q2H A;  1QUQ B;  4Y7N H;  2Q2T A;  4DR6 L;  4DV2 L;  3STB C;  2YV5 A;  2R6G A;  4IPC A;  4DV1 L;  1VQN A;  4PZ7 A;  3FKI H;  1VQ9 A;  1PH3 A;  2K5N A;  1KQS A;  2Q2I A;  4BBS G;  1EQR A;  1VQM A;  1AE2 A;  2ASB A;  3CQZ H;  4PG3 A;  1JJ2 A;  2A8V A;  3CPF A;  5C0X I;  4BY1 H;  3I4M G;  1BBU A;  4LF5 Q;  3CD6 A;  1Y1W G;  3HOX G;  5IWA Q;  3UE1 A;  2RHS B;  1J5E Q;  4A3B H;  3I4N H;  1PHJ A;  4X62 Q;  1PH5 A;  3PIO A;  4IPH A;  3ER0 A;  1VQA A;  4NXM Q;  1WCM H;  1VQO A;  3S1M H;  2JA7 G;  1I94 Q;  2VS1 A;  4C2M H;  5K36 G;  1SN8 A;  2NZO A;  4B3R Q;  1CKO A;  1SMX A;  5GAH C;  3KJP A;  4DR7 L;  5JEA J;  3K80 C;  4BBR H;  1WCM G;  3RLN A;  5LMN L;  4A3G G;  3HOV H;  4PZ8 A;  3AFP A;  5ELO A;  4DUY Q;  3GTG H;  3S1Q H;  1I5F A;  3I4N G;  1PV4 A;  2K52 A;  1PA6 A;  1VQ8 A;  3CCR A;  4X64 L;  1UE7 A;  5IE8 A;  2VY3 A;  4HIO A;  4GN3 B;  1PH6 A;  1B8A A;  1CSP A;  2CFM A;  3PUZ A;  3K7A H;  4KI0 A;  2PNH A;  3CCM A;  4HIK A;  3OW2 A;  4BBS H;  4C3I H;  1DGS A;  5IP9 H;  5IYC H;  4LUZ A;  2JA6 H;  3K0X A;  3S2D H;  1HNZ L;  5C4J H;  4IPD A;  1PYS B;  4NB3 A;  1I94 L;  4R4O A;  3EIV A;  2A19 A;  2N78 A;  4C3J H;  4TQU S;  3GTO H;  4DAM A;  5H1S E;  4P71 A;  3B6Y A;  2V1C C;  1K0R A;  2YYZ A;  1Q1B A;  3F2C A;  1RIP A;  2N8N A;  1U0L A;  3BZC A;  4XTC S;  4A75 A;  4P74 A;  3KDF B;  4A3I H;  2B3G A;  1I50 H;  2FXQ A;  1YIJ A;  5FLM H;  3Q8D A;  1L0W A;  3CCQ A;  4JCV E;  4A3J H;  1XPR A;  5HY6 A;  1N34 Q;  1VQ5 A;  2K5H A;  4JG2 A;  5C0X G;  2UU9 Q;  1PH7 A;  4RG1 A;  1YJ9 A;  4K0K L;  1NJI C;  3H0G H;  3I4O A;  3S14 H;  2F4V Q;  4GOP A;  3LGJ A;  4DV2 Q;  2Z0S A;  3KYH C;  2I5M X;  4JOI A;  1TWC H;  4DK6 C;  4YHH Q;  3A5U A;  4R4I A;  2VUM H;  1QVG A;  2JQO A;  2ZJQ A;  5IT9 c;  1L1O C;  3G4S A;  4IFD I;  3TEH B;  1YVC A;  2D0P A;  4DNI A;  4OWT B;  4MNO A;  2R7Z H;  1B7Y B;  1VQD A;  1C7Y A;  2NVX H;  1V1Q A;  1QZG A;  2B29 A;  2WAQ E;  2I0Q A;  4DR3 L;  3S1N H;  2LSS A;  2DGY A;  5IYC G;  1QZH A;  2RCN A;  2UUB L;  2NN6 G;  1O7I A;  3CCV A;  4LFC Q;  4YWL A;  4JV5 Q;  1YBY A;  5DLQ E;  4GKK L;  4B3S L;  2KCT A;  1YJW A;  2JA5 H;  4NXN L;  4GKJ Q;  4KHP Q;  1FVI A;  3ULL A;  3A74 A;  1K3R A;  4WJ3 M;  3IRB A;  5IYB H;  2Q2U A;  4AQY Q;  1UEB A;  1TWF H;  3MEF A;  1WI5 A;  2HHH L;  3M4O H;  4LF4 L;  1X55 A;  2LXK A;  4DV4 L;  5M5W H;  5M3M H;  1N9W A;  1VQE A;  1UE1 A;  4JI6 L;  1N32 L;  5IP9 G;  1UWV A;  3M3Y H;  4A3G H;  4IJL A;  5C3E G;  2YU9 H;  3HOU G;  4DR2 L;  4BBR G;  4LF9 Q;  4BY7 G;  4LFB L;  3A5Z B;  5M5Y H;  3U58 A;  2RF4 A;  3T1Y Q;  1HR0 W;  4JI1 Q;  5M5X H;  1FJG L;  1IXR A;  1VQJ A;  4XIG S;  1HNZ Q;  3PV0 A;  4YY3 L;  2CWA A;  4HJ8 A;  3HKZ E;  2IX0 A;  1A63 A;  2GVB A;  4IJH A;  5ELN A;  4LF6 L;  1LTL A;  3TS0 A;  1PH8 A;  1X3G A;  4B3S Q;  4DR1 L;  1I6H H;  3AFQ A;  4A3C H;  1RL2 A;  4HID A;  5M3F G;  2JA5 G;  2MFI A;  4L5S A;  5HGQ A;  2ZTD A;  1TWG H;  1HNX Q;  2QA4 A;  3AYH B;  3GTK H;  3KF6 B;  1XMO Q;  1SLJ A;  3E9I A;  4MZ9 A;  1N36 L;  2OQK A;  4GLV B;  1Q82 C;  3U4Z A;  1YI2 A;  4KLK A;  4BXX H;  2UUA L;  1KRT A;  3KF6 A;  1BBW A;  3F2D A;  2KEN A;  3EBE A;  4O0A A;  3EN2 A;  4P75 A;  1MJE A;  4JBM A;  1KAW A;  3D0F A;  4DV1 Q;  1B70 B;  3I4M H;  2I5L X;  2IT1 A;  3GDE A;  4JI0 L;  4GLA C;  2Z6K C;  4KHZ A;  4POF A;  3NEN A;  2D62 A;  3CCJ A;  2OTJ A;  1IBK L;  1IBM L;  1CKM A;  1D8L A;  2HIV A;  3I2Z A;  4A3F G;  3L7Z C;  3BZK A;  1X3E A;  3F2B A;  2AWO A;  3CW2 C;  3RLO A;  2ID0 A;  4EX5 A;  2VQF Q;  4LFA L;  4OXP A;  2PMZ E;  2NVQ H;  1HZB A;  3PIP A;  3CCU A;  3NEL A;  5M3M G;  3RN2 A;  1JMC A;  2E2H H;  2XTI A;  3S17 H;  4GN4 B;  4ME3 A;  2E5L L;  4DR5 L;  1ASZ A;  1VQL A;  3HOZ G;  1SRU A;  1L2F A;  4JI7 Q;  1NE3 A;  2F52 A;  2K4K A;  2IY5 B;  4LF7 Q;  3CP0 A;  1VQB A;  1K9M C;  1N33 L;  1XNQ Q;  2EQS A;  2JA8 G;  3S24 A;  4X6A H;  2AKW B;  4NXN Q;  2A1A A;  4JI4 L;  4X65 L;  3S16 H;  3I55 A;  4LF8 L;  3TS2 A;  4JI3 L;  2KBN A;  3H3V I;  5IYD H;  2EXD A;  1AE3 A;  1EUJ A;  2ALY B;  3W1B A;  2VZA A;  4GNX B;  3E0E A;  1Y1V H;  1KHI A;  4BXX G;  4A93 G;  4Y52 H;  2GVA A;  5C0X J;  3K7U C;  2UXC Q;  1P16 A;  2WAQ G;  4JYA Q;  4JI8 Q;  2R93 H;  2AWN A;  3PCO B;  3ICE A;  1W3S A;  2B63 H;  5JJI A;  1UE6 A;  2ZJP A;  4DPG A;  2GN5 A;  3PUY A;  3T1Y L;  5AJ3 Q;  2QGQ A;  1XNR L;  1LUZ A;  2K5V A;  1HR0 Q;  3GO5 A;  4DV3 Q;  4IPG A;  4YY3 Q;  4A3M H;  1S3O A;  1PFS A;  4B3M L;  4LF7 L;  1E1T A;  2PQA B;  3SGI A;  4NXM L;  4AYB E;  3G48 A;  2CQO A;  1EIF A;  3MXN B;  2YTX A;  3GTP H;  1KD1 C;  1C0A A;  1HH2 P;  2E2I H;  3CC7 A;  2AHO B;  1BVS A;  2R92 H;  4QGU A;  1I3Q H;  1L1O B;  1NTG A;  1N34 L;  4DUY L;  4A3I G;  2N49 A;  2JA8 H;  4WJ4 A;  4PMW A;  1JJC B;  2UU9 L;  2AMC B;  4A3C G;  4LNQ A;  3KLW A;  5EAY A;  3TRE A;  1K73 C;  4DV6 L;  4DR4 L;  5C44 H;  4GNX A;  1VQI A;  3UE0 A;  4JI2 Q;  4IOC A;  4AYB G;  1XPO A;  3HOY G;  2UXD Q;  3UDG A;  4R4C A;  4X66 Q;  2R92 G;  1G29 1;  3T1H L;  3J81 j; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...