4B3TQ

Crystal structure of the 30s ribosome in complex with compound 39
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3tQ00
4LF7L 1E22A 4LF5Q 4GKKL 2K14A 2GN5A 1K8GA 1W2BA 1YZ6A 1V43A 3RZDH 4DAMA 1SR3A 3PSIA 1E3PA 1YI2A 3PF5A 2YV5A 3G48A 2ZM6L 3I7FA 1GKHA 1JB7A 1OXSC 4H02A 3S24A 4GOPC 3GTJH 4L5RC 2WFWA 3G6EA 1KHIA 2K75A 1HZBA 4POFA 4IFDG 1PV4A 4A3IH 4GN4B 4JOIC 3NBHB 1ASZA 1G51A 1HNWL 2B63G 3KOJA 3BZCA 3CCRA 2BA1A 2EXDA 2K5HA 4BA1I 2ZJPA 4A93H 2B29A 3B6YA 3HOZG 4A3DH 2UXDL 2AKWB 3AEVA 4UPAA 1UE6A 5IWAQ 3CCMA 1DGSA 3DM3A 4MZ9A 2WB1E 3W5OA 1TWHH 3W1GA 2ES2A 4QQBX 4JI5L 1M90C 2BH2A 1KIXA 2A8VA 1LYLA 1SROA 4FDBA 4YCVA 5C3EH 3RN5A 4JI3Q 4YY3Q 5M3MG 2AWOA 4A4IA 1IBML 2CCZA 4JI0Q 3H3VI 3A74A 2VNUD 1Y1WH 2Y0SG 2WAQG 3K81C 4HIDA 4LFAQ 2EIFA 4PZ6A 2HHHQ 5LMUQ 3H15A 2Q2UA 1Y1VH 4GNXC 3UE0A 1L0WA 4LF6Q 5IY0A 1VQ4A 1VQFA 1IBLQ 4DV2L 4JI7Q 2OQKA 2PMZE 4BY1G 2V1CC 3GD7A 4DPGA 3TS2A 4KHPL 3PO2H 3CCUA 1CKNA 3PUYA 2F4VQ 5IWAL 3H3VH 2ID0A 2D0OA 1Z47A 2GVBA 2MNAA 1GD7A 4DV3Q 3CCSA 1WYDA 1EWIA 1CKNB 1VCIA 2VW9A 4A3MH 5FLXc 5GADC 1VQ7A 3ICEA 4JI1Q 5M3FH 1PYSB 2PI2E 3K80C 4JCVE 1A62A 4C3HH 2Z0SA 3M4PA 3KDFA 4R4TA 1U5KA 4YY3L 4EQ5A 3CF5A 4IO9A 1K73C 1HR0Q 5IYDH 1G291 1WFQA 1OXXK 1E24A 2OQ0A 4AH6A 3HOUG 5IP9H 4P72A 2N3SA 1FL0A 5C4XH 1P8LA 2XTIA 3J7ZC 2NVQH 4A3LG 1C0AA 3KDFB 4YWKA 4LFAL 4YCWA 5LMUL 4OX9Q 4A3BH 4PZ7A 3HOXG 1HZ9A 3L7ZC 3HKZE 1N32Q 4IJLA 4JI7L 1IBLL 1NJIC 4X62L 4P71A 1VQJA 4DV5L 1NY4A 3TRZA 3ZJYC 4DAYB 4BXXH 4PZ8A 3CP0A 1X6OA 2Z6KC 3STBD 2JA5G 2PQAB 3CCLA 2F4VL 1JJGA 4A3CG 1YEZA 4AYBG 4DV3L 3PO3G 2Q2HA 2ZJRA 3GTOH 1K83H 1A0IA 3ULJA 3KF6A 4DUZQ 4DR1L 3RN2A 4JI1L 3F1ZA 3CW2C 1UWVA 3JC66 2KCMA 4GN5A 3FP9A 1XNRQ 1AE3A 3KFUA 1N9WA 4GLAC 1RL2A 2LSSA 1VQ8A 1VQKA 1NE3A 1IBKQ 5LMNW 2Q2TA 2N8NA 4NXMQ 4BBSH 1WCMH 4B3ML 1H95A 2IT1A 3RLFA 3I4NG 4GKJQ 4A76A 2MO1A 4UP9A 1E1OA 3KJPA 1FGUA 3GTKH 5IYCG 1E1TA 1X56A 1Q81C 5IYBG 3S1RH 3CQZH 1Q46A 1BKBA 4GOPA 4GS3A 5GQOA 4A3JG 4AQYQ 1CUKA 3HOZH 3J81i 2FXQA 3M7NA 4LFCL 1VQCA 2DGYA 4HIOA 5GAGC 3T1YL 5LMNQ 1OXTA 1HZAA 4LUZA 4GOPB 3STBC 4IPCA 4R4QA 4DUZL 2IHFA 1T9HA 3I4MH 2QGQA 1GVPA 3KF8B 2IX0A 2JA8G 1GM5A 2YU9H 4HJAA 5M3MH 1XNRL 2UU9Q 4DK6C 3JAMc 4B3SL 2WP8J 5DLQE 4O0AA 4LF4Q 2CQOA 3AYHB 1IBKL 4NXML 5JJLA 5C0XI 3PIOA 1HJPA 4JC0A 4NXNL 4NB3A 5GROA 3HOYH 4A3EH 4GKJL 1Q12A 3Q8DA 4PG3A 2UUBL 2NZHA 1N33L 4K0KL 1VQGA 5C4JH 2A19A 4JI6Q 2R93G 1S72A 3CC7A 4OWWB 1PH4A 1AH9A 3RZOH 2MQHA 1YVCA 3PV0A 4L5TA 2VZAA 1BBUA 1YHAA 3U50C 3BZKA 2OTLA 1LUZA 4BY1H 1VQHA 4KHZA 1K9MC 4AQYL 3E9IA 4JBMA 2IHEA 4LUOA 1U0LA 1J6QA 1I5FA 1NTGA 4GNXA 1N36Q 4JBJA 2NN6G 4LF5L 2UXBQ 2K4KA 1PFSA 2E8GA 4UP7A 4PMWA 2UUAQ 1WOCA 3RNUA 1YHBA 1BBWA 1FJGQ 5EAYA 4GNXB 1SRUA 4Y7NH 1UE7A 4JI4Q 4BBRG 3PUVA 4YWMA 2UU9L 2N78A 2ASBA 5ELNA 1IZ6A 2D62A 3K7UC 2JJQA 4LF4L 1JT8A 1QUQA 4OO1G 1PH1A 1XMQQ 2KCTA 2YYZA 4DV6Q 1Q1EA 3CC4A 4A3LH 4X64Q 3K0XA 5FLMH 4C3JH 3U58A 3I56A 3UE1A 1QUQB 3KYHC 3J80c 4TQUS 2VQFQ 1HNZQ 4JI6L 1A8VA 4KLKA 2AMCB 1EIYB 5M5XH 2JA6H 2K50A 3PGZA 5BR8Q 2VQEQ 1XPOA 3GTGH 3F8TA 2JQOA 5AJ3Q 5IE8A 4QGUA 3L2PA 1YJWA 2RCNA 4B3TQ 4DUYQ 4A3IG 4JG2A 1P16A 5IP7G 2JA5H 4R4OA 1UE1A 4A3KG 1IL2A 4JI3L 3MEFA 1N36L 4A3CH 4JBKA 4A93G 1XJVA 1QVFA 1O7IA 5JEAJ 2I0QA 2NZOA 1XMOQ 2UUAL 1VQDA 1C7YA 2NVYH 4P74A 2PNHA 3FKIH 4JI0L 3I2ZA 5M5WH 2D0PA 3M4OH 1IYJB 1FJGL 4A3FH 4DR7Q 3NEMA 3I55A 1OXVA 4DKAC 4JI4L 1UEBA 1I50H 3EBEA 4DR3Q 3TS0A 3CD6A 3S2DH 1WJJA 4R4CA 2HHHL 1PYBA 4POGA 4DV0Q 2K5NA 5C3EG 4DV6L 2PQAA 1S40A 4X64L 4LF6L 1SN8A 3KLWA 4QJFA 3I4NH 1E7ZA 2CWAA 2R7ZG 4QL5A 1KXLA 5JJIA 3ULLA 2KHJA 2VQFL 1K3RA 1C9OA 1I3QH 4OWTB 1Y1WG 1NMGA 1X65A 3LGJA 2VQEL 1Q86C 2MO0A 3G4SA 2E5LQ 2IY5B 3VDYA 1X9NA 3BJUA 4IPHA 4OXPA 4IOCA 4A3GH 2VUMH 1B7YB 4RG1A 4X66Q 4A3JH 1XNQQ 1XTDA 3PF4A 4O2DA 4IFDI 1Y1VG 1Y14B 2WB1G 3HFZB 3K8AA 1LTLA 2ZJQA 2GVAA 3A0JA 5GAEC 2UUCQ 3PO2G 1NBWA 5C0XJ 1LM0A 1TXYA 3HKSA 1HR0L 4MTNA 4DR7L 2CKZB 1EOVA 2C35B 3F2BA 4IPGA 1Q82C 2JA7G 3E9HA 2JA8H 2HIXA 2F3IA 4DR3L 3M85A 5FJ8G 4LFBQ 1GO3E 4ME3A 2JEAI 4P73A 4OX9L 4DV0L 1Q8KA 2Q2IA 1WI5A 2UUBQ 1S3OA 1JE5A 3S17H 1VQMA 1N32L 2OCEA 2UXCQ 4GKKQ 2ZTEA 4WJ3M 2NN6I 4HJ5A 5IYDG 2Y0SE 4ALPA 1SLJA 3TEHB 3OW2A 2B63H 1QVCA 2WAQE 5IP9G 2LXKA 1YIJA 3UDGA 2R93H 3M3YH 4DR2Q 5C4XG 3OTOQ 1X55A 2RHSB 2ZM6Q 2QEXA 4HJ8A 4JOIA 2E5LL 3HOVG 3H0GG 4YWLA 4HJ7A 4A3BG 3RLNA 4X66L 3IRBA 1M1KC 1JJCB 1XNQL 3S1NH 3TREA 4LW1A 1PH8A 4JV5Q 1TWCH 4AIMA 5JJKA 3GTLH 1EIFA 4BXXG 4QIWE 3EIVA 2UUCL 4IOAA 1VQIA 1I94Q 1KRSA 2UXDQ 2YTXA 1V9PA 1VQ9A 4DR6Q 3NENA 4KI0A 1PH7A 1QZHA 1VQBA 2AWNA 2A1AA 5HGQA 4HIMA 3PUWA 4BY7G 2BA0A 4LFBL 3AQQA 3D31A 4YHHQ 3ERSX 1V1QA 1X3EA 3M9BA 3PIPA 2HT1A 1R9TH 2H5XA 1TWFH 2UXCL 2NVXH 1L1OC 5C44G 5HY6A 1IBMQ 3HKZG 4L5SA 3DLLA 4BBSG 1WCMG 4DR2L 3OTOL 1EQQA 1D7QA 4X65Q 2R92G 3RLOA 4P75A 4A75A 4C2MH 3CAMA 5LMNL 2R6GA 3S1QH 3CCQA 1YBYA 2R7FA 3ER0A 4IPDA 5IP7H 2E2HH 4JV5L 1N8RC 4B3RQ 4GLVB 2OWOA 4A3KH 4DV2Q 3F2CA 2HQLA 3KJOA 3CCJA 2NVTH 1K8AC 1AE2A 1I94L 4X6AH 4AYBE 1CSQA 1NMFA 3HOWG 1YNXA 1Z9FA 5JEAG 5IT9c 3PUXA 1EYGA 3EN2A 2QA4A 1VQNA 1TWAH 3HOUH 4DR6L 4Y52H 1G6PA 3MXNB 1PH5A 4DV4Q 2N49A 3E0EA 1EQRA 2F52A 2KHIA 2OTJA 3S16H 4YHHL 1OXUA 3CMEA 3I4MG 4DV1Q 3F2DA 1L2FA 3BU2A 4JI8Q 4BA2I 3HOXH 2ALYB 2RF4A 1MJEA 4KHPQ 1PA6A 1VQ6A 2R7ZH 2YTVA 2PI2A 4IFDJ 4XTCS 1CKOA 2BH8A 1MIUA 1VQEA 3D0FA 1I6HH 1MKHA 1CKMA 1SFOH 2MFIA 3HOYG 1QVGA 1PHJA 4X65L 3CXCA 4UP8A 3CCEA 4DR5Q 3T1HQ 4A3EG 1KRTA 3J81c 3NELA 5ELOA 2HIVA 2I5HA 3PO3H 3PUZA 2VS1A 4J15A 1VQ5A 2UXBL 4A3DG 2RHQB 4C3IH 4DK3C 3RR5A 3SGIA 1HR0W 5K36G 4B3RL 1IXRA 2Z6KA 4JYAQ 2KENA 4X62Q 4DV5Q 1X3FA 2I5MX 2AHOB 3TQYA 1PH2A 5H1SE 1HZCA 4GLXA 1B70B 2JK8A 4LWCA 5C0XG 3CC2A 2IX1A 1XPUA 1XMQL 1SMXA 2JEBI 4DV4L 1VS0A 2K52A 2K5VA 2JA7H 4WJ4A 2XGTA 5J3BA 5FJ8H 4DR4Q 1N34Q 1KD1C 4DR1Q 3GO5A 1KAWA 5IYCH 1VQPA 3UDFA 4TVAB 4DV1L 1HNZL 1JMCA 5IYBH 3CPWA 4JI8L 3JAMi 3K7AH 1EUJA 5BR8L 4JBWA 1PH6A 1B8AA 5AJ3L 2ATWA 3CMAA 4NPSA 4LF9Q 3U4VA 4B3TL 1YHQA 1PH9A 4DUYL 2ZTDA 3S14H 1X3GA 4OONA 3T1HL 4DR5L 4B3MQ 5FLMG 4OWXB 3WWVA 3HOVH 3H0GH 1CSPA 1VQOA 2I5LX 3PCOB 4RMFA 4HJ9A 2JA6G 2EQSA 1A63A 1YJ9A 1XMOL 3FHWA 5M5YH 3CCVA 4HIKA 2DUDA 3W1BA 1JJ2A 3AFQA 4LF8Q 5E7NA 4DNIA 1KC8C 4APVA 1TWGH 4JYAL 2B3GA 4DV7Q 3J81j 1PH3A 1KQSA 1YJNA 5GAHC 2JE6I 1VQAA 4A3MG 3S1MH 4JI2Q 1J5EQ 1HNXQ 3A5ZB 4MNOA 1OTCA 1Q1BA 2R7DA 4LFCQ 1HH2P 5M3FG 1ASYA 3OYYA 3U4ZA 3T1YQ 4LF7Q 4BY7H 3M4QA 1K0RA 1EFWA 3J7A5 4DR4L 1N34L 3FKIG 1QZGA 1MJCA 1SE8A 3S15H 4A3FG 3GTMH 4R4IA 3UDIA 1VQLA 3GDEA 3GTPH 2KBNA 2ZTCA 3L0OA 5C44H 3KF6B 4B3SQ 1KL9A 2L15A 4LF9L 2CFMA 4L5QA 1PVOA 4OO1I 3CPFA 4NXNQ 2VY3A 2R92H 3J80i 1HNWQ 3I4OA 1BVSA 1L1OA 1RIPA 2VL6A 1N33Q 4K0KQ 1UE5A 3G71A 1Q7YC 3A5UA 3S2HH 4QY7A 3ULPA 4LF8L 4IJHA 1FVIA 2YTYA 2CWPA 4XIGS 3UDXA 4GN3B 4R1JA 4EX5A 1W3SA 4DV7L 4LNQA 4A3GG 1L1OB 3AFPA 2E2IH 2VUMG 4BBRH 1XPRA 4JI5Q 3HOWH 1X54A 4YCUA 4JI2L 1J5EL 1HNXL 4UY8C 2LXJA 4LUVA 3GTQH 1D8LA 2E2JH 1YITA 2JA9A
chains in the Genus database with same CATH superfamily
2EYOA 1LTID 1K8GA 2GN5A 5I9OA 3RZDH 4DAMA 4IUNA 3PQIA 3PSIA 2F0JA 1SNQA 2JA6B 2RA4A 4IUTA 2YV5A 2ZM6L 1CQVA 1ONLA 4P2CB 4GOPC 4JW0A 4L5RC 1BCPF 1KHIA 1HZBA 4POFA 4JOIC 1Y8NB 3NBHB 1RD9D 3KOJA 3CCRA 3HOZG 3N52A 4ZUJA 3SEBA 3CCMA 3DM1A 3DM3A 4MZ9A 1SYDA 5M5WB 1G2SA 1SE3A 3C1FA 3VA5A 4YCVA 3RN5A 4JI3Q 1NNXA 3I73A 4YY3Q 2EDGA 1NCVA 3E3XA 4JI0Q 5CV4A 3A74A 1A3TA 2WAQG 1CHQD 4HIDA 3K5LA 2FJ2A 3G6JB 2HHHQ 3GTOB 4U673 1Y1VH 2A6HD 3UE0A 1L0WA 5IY0A 2Q8TA 2OQKA 2IJ0A 3GD7A 4QMGA 5CV5A 2KEEA 1CKNA 3QOJA 4RHRA 5IWAL 3VR6A 3I3CA 1XXGA 2MNAA 4DV3Q 3QO2A 3SXHA 2JA8B 3MA2B 1CKNB 4ZUIA 4K6LA 3NPPA 1VQ7A 2WACA 1UAPA 1O78A 1PYSB 4JCVE 2F0TA 3M4PA 4R4TA 3CF5A 1U5KA 4IO9A 1K73C 2BDNA 3SK8A 1G6ZA 1S4ZA 2B63B 2DJFC 5IP9H 2N3SA 3GV3A 5C4XH 2XTIA 2NVQH 1DOKA 5C5LA 2M2LA 3BYTB 2E76C 4HSPA 3MFYA 2IW3A 3BDOA 5LMUL 3EJIA 1Q90A 4DF7A 4A3BH 3TP7A 1HZ9A 3L7ZC 3JAME 4JI7L 1IBLL 5CORA 5DM73 3CP0A 3MXPA 1LT3D 2F4VL 5M3MB 4ZCKA 1JJGA 3QJYA 2A69C 2E75C 1FYCA 2ZXRA 4A3CG 2ZJRA 3GTOH 1LTSD 3GQBA 1K83H 5T1GA 1PMRA 4PMBA 1CQFA 2KHSA 1UWVA 3QOLA 1LACA 2KCMA 1SE4A 4F88A 4OHJA 1IBKQ 4BY1B 1PLFA 5KYLA 4QIWB 3FPPA 5CGKA 1WTPA 3MEHA 2BE5C 4IZ8A 3S1RH 1O7ZA 1Q46A 3E6ZX 1PRTF 4GOPA 5GQOA 1YNND 5EPJA 2DGYA 3J80E 4FXKC 3KF8A 3HOUB 1OXTA 4GOPB 1ML0D 4IPCA 4C3JB 1CA5A 1QNUA 3S16B 3I4MH 1GVPA 3KF8B 4FO2A 2IX0A 3VYTA 1GM5A 2YU9H 2JA8G 3HOXB 5M3MH 2UU9Q 4FF3A 5CV6A 2WP8J 3CRKC 2DY8A 1MSHA 3FDTA 4NXML 5C0XI 1ZYRD 2CH4A 1ENCA 4F8MA 4CHTB 3Q8DA 3T4AC 2UUBL 3DUZA 2AQ1B 1HA5A 1HTLD 3A8JE 4LK1C 3ONAB 3CC7A 5K36H 4C3IB 4OWWB 1PH4A 3RZOH 3PV0A 1YVCA 3S2HB 4BY1H 3BZKA 3BZDB 1EYCA 1VQHA 4KHZA 3Q24A 1TR5A 4LUOA 3R2TA 3TP8A 1J6QA 4XT3B 4JBJA 2NN6G 4X3UA 4LF5L 2O5JC 2UXBQ 2K4KA 1CZGA 3K58A 4UP7A 4B9WA 1FJGQ 5EAYA 5JPNC 1EWCA 3H3VC 3EQLC 4HMJA 4JI4Q 3K7AB 5ELNA 3K7UC 4LF4L 2IPKD 2X6LA 1H9SA 1XMQQ 2KCTA 3I4LA 2B2UC 4A3JB 4A3LH 4C3JH 2J7ZA 2KJXA 1H9SB 1SYEA 2AMCB 4H13C 3PGZA 4H44C 3IFDA 4MHEA 4EVOA 5IE8A 4QGUA 3LX0A 5EPLA 3HG9A 4ZKCB 2IWHA 3G7LA 1JWMD 5JEAJ 2I0QA 2NZOA 3S2HH 2NVYH 4P74A 3NEMA 3I55A 3HEJA 4PQXA 4DKAC 3KLSX 3ZYYX 3GTMB 1TU2B 3CD6A 3TS0A 3GTPB 4R4CA 4DAYA 1PYBA 3FRPB 4DV0Q 2N88A 4DV6L 2PQAA 4QJFA 3KLWA 1E7ZA 3FVQA 1SDFA 1EU3A 3I91A 3ULLA 2VQFL 1I3QH 2B2WC 4OWTB 4DAVA 1Y1WG 4XQQA 2E5LQ 2IY5B 4OXPA 4K5WA 1PFMA 4A3JH 1XTDA 3HFZB 4KJOA 1EL0A 1LTLA 2Q8RE 1F2ZA 3PO2G 1NBWA 4QF4A 5E4WC 5C0XJ 1HR0L 1PZJD 1TS2A 2CKZB 5CC4A 2D9UA 3KUPA 2F3WA 3E9HA 1HHVA 4DR3L 1STAA 5I6WA 2ICIA 4P73A 1Q8KA 2Q2IA 5COYA 1JE5A 5EPKA 4GKKQ 2E2HB 1SLJA 1C48A 2F0QA 2LXKA 3DMUA 2NVTB 3M3YH 4DR2Q 3NWSA 1X55A 3D8GA 4PNYA 5DAUA 1LV9A 5AFWA 2Z9HA 4LW1A 1PH8A 1TWCH 4CJ2C 1EIFA 4QIWE 3EIVA 1IKLA 2UXDQ 2HDMA 2WIIB 2MHVA 2R7ZB 4RGOS 1QZHA 2AWNA 4HIMA 1SFOB 4BY7G 2ZXOA 4LFBL 4YHHQ 3ERSX 3MXUA 2VB3X 2O4XA 1C8CA 2H5XA 2UXCL 2TSSA 1L1OC 5C44G 3K59A 1EQQA 1EY7A 1AN8A 3H94A 4F87A 4X65Q 2R92G 1GUOA 1PZKD 2BCOA 1G8ZD 5FLXL 4OL7A 1GUTA 3S1QH 3CCQA 1QILA 5I2YA 4JV5L 2E2HH 3KJOA 2NVTH 2EYLA 4C3HB 1I94L 2SNMA 4J8QA 5JEAG 2D5DA 5IT9c 3PUXA 3E5SA 4EQNA 4DV4Q 3A55A 1ZKOA 5D3DA 4ZKBB 5D3IB 3F2DA 4PMCA 2B2VA 1MJEA 1KTKA 3MHBA 1Y8PB 2XIWA 3W2DA 1PA6A 2R7ZH 5TSSA 1DD2A 1CKOA 2BH8A 3D0FA 1SFOH 1NR2A 5I2XA 5CV9A 4DK0A 3CCEA 3MAQA 3J81c 3PO3H 2VS1A 5JOBA 1VQ5A 2GA4B 2RHQB 4ULLA 3RR5A 4X62Q 4DV5Q 5G3LD 1IYUA 1U4RA 4C1NI 2I5MX 2AHOB 1LTTD 1PXUA 1B70B 4LWCA 1TKWB 5C0XG 1D6EC 2IX1A 3HRZC 3HKZB 1LTBD 1KLUD 1VS0A 4BBSB 4DR4Q 4DR1Q 1KAWA 5IYCH 1JMCA 3GTKB 1RKNA 3T13A 3CPWA 1NUCA 1EUJA 2AUKA 1D5XC 2ATWA 2F0WA 1BCPD 3U4VA 4XQNA 1X3GA 1LT4D 4B3MQ 1B9MA 4RA8A 4IUUA 3WWVA 2SDFA 4HSVA 5CBAE 1CSPA 1MI2A 3KK7A 1A15A 3FHWA 1KNEA 2DUDA 3AFQA 3NK9A 5E7NA 4APVA 4ZK9B 2B3GA 4CKCA 5IGFA 1EZ8A 1QE6A 1KQSA 1YJNA 1VQAA 3A5ZB 4MNOA 4R9WA 2R7DA 1HH2P 5M3FG 3OYYA 3T1YQ 1GJXA 3M4QA 3J7A5 4A3EB 1N34L 3FKIG 4FYDA 1DOLA 1MJCA 1SE8A 2OEOA 5D14A 3EFXD 2ZTCA 1ICFB 3IAYA 1W6KA 2L15A 4OO1I 5C4ZA 4HAEA 1HNWQ 5D65A 2C9OA 1L1OA 1RIPA 4K0KQ 1UE5A 1Q7YC 2PQEA 1SJHD 1FVIA 2CWPA 4XIGS 4RCNA 4GN3B 3UDXA 5IT9L 1HPCA 1W3SA 1L1OB 3AFPA 3LWEA 2VUMG 1K0SA 4DK1A 3AB9A 1I4XA 1X54A 3A56A 4JI2L 4UY8C 4RKLA 1SJED 4G7ZC 1D8LA 1DM0B 3W1BA 3TP6A 2JA9A 4LF7L 1F2LA 5C5MA 2G9DA 1YNJD 3VYRA 1SR3A 2XWBB 5KEEA 1GKHA 3S24A 3GTJH 1MHWC 3GTGB 3J81L 1PV4A 2WV6D 3WDNA 4A3IH 4GN4B 1ASZA 2JA5B 3V2TA 2EY5A 4A93H 4BA1I 5IIFA 3SVMA 5EKKA 1ZXTA 4KK7A 2A68D 1DGSA 4A3FB 3OW7A 3A7LA 1M90C 2BH2A 1LYLA 1SROA 1KABA 3TN2A 5C3EH 1YNNC 1IBML 3NUCA 2Y0SG 3SR1A 4I7AA 3E0JA 4PZ6A 2SNSA 4A3GB 5EBCA 1ET6A 1EOTA 4GNXC 4LF6Q 1VQ4A 4DV2L 1PRTD 2V1CC 4J1MA 1ZYRC 3D3RA 1ENAA 1TS3A 1F77A 1ZEQX 3CCSA 1WYDA 1VMCA 2XSCA 2PPBC 3ERQA 1VCIA 2VW9A 2KUMA 1S5DD 1U4LA 1CZWA 3K5NA 1B2TA 3S17B 1A62A 4YY3L 4KHPL 3KDFA 4V0BA 4N8X1 5DM63 2F0PA 1G291 4AH6A 3URYA 1HTPA 4P72A 1FL0A 2R61A 1PTOC 3HOZB 3KDFB 4KV6A 2Z8LA 4OX9Q 3HKZE 1N32Q 1RJTA 4P71A 1VQJA 3OWEB 3GTLB 4X3SA 4PZ8A 3STBD 2JA5G 2K04A 1WD0A 4TKOB 2EVBA 1B3QA 1YEZA 4DV3L 2K03A 3A7AB 1A0IA 1B50A 3KF6A 2WAQB 4IUVA 3FPUB 4DUZQ 3RN2A 3F1ZA 4HCSA 3JC66 4GN5A 4FF2A 1TWFB 1XNRQ 1AE3A 2CQAA 1N9WA 4GLAC 2LSSA 1L0YB 4K5XA 1VQKA 5LMNW 2N8NA 1WCMH 4ID6A 2KECA 1VDZA 4BWGB 2MO1A 1WTXA 1E1OA 1FGUA 4IN3A 3TDQA 1E1TA 1SAPA 4C2MB 3UI2A 1FNUA 1ILQA 4ZQ3A 4A3KB 1BNZA 4GS3A 4OELB 4ZYSA 4AQYQ 1CUKA 3HOZH 3J81i 2SEBD 1L0XB 1EEFD 1SEBD 1VQCA 2HQEA 5GAGC 1BO0A 1TWAB 4N8FA 1HFGA 2EXZA 2I07B 2CVRA 2IHFA 1T9HA 4K2KA 1QWYA 2QGQA 4EQPA 3NBHA 2CHBD 5FO8B 5FLXE 4B3SL 5DLQE 1STGA 1IBKL 1DONA 4IALA 3HOYH 2KCCA 2FFKB 2NZHA 2F0DA 1N33L 5C4JH 2A19A 2R93G 2F0HA 1II3A 2D2CC 4L5TA 2VZAA 1JR0D 1YHAA 4WRDA 1LUZA 5CV7A 2OTLA 4JBMA 1K3BC 2IHEA 1I5FA 4GNXA 1WTVA 1N36Q 3K6OA 1I4GA 5C3WA 2E8GA 4PMWA 3RNUA 4GNXB 4BBRG 2CW0D 4F7XA 2F0UA 2K28A 4YWMA 2UU9L 3VYUA 2KQ3A 4OO1G 1EIHA 1CHPD 3Q6SA 3S14B 3W3AA 3KYHC 3HOVB 1HNZQ 4TQUS 2JA6H 4KLKA 4G7OC 2K50A 5M5YB 5BR8Q 4RHSA 3M4YA 5HGTA 3ND9A 1XPOA 2RSOA 3MFGA 4CKBA 3L2PA 1SMYD 2LS01 1T5EA 5ELCA 4B3TQ 4DUYQ 5IP7G 5L37A 4A3KG 1PTOB 4L63B 4A3CH 3EA6A 4JBKA 2JYOA 1XJVA 1QVFA 1O7IA 2ZT9C 1VQDA 2PNHA 2FINB 5M5WH 1FJGL 2X69A 4JI4L 5EKIA 4UHVA 1D1KA 4IUPA 1VF5C 1B1ZA 3P1HA 1KXLA 1STYA 2KHJA 1K3RA 1C9OA 2F0FA 1EFID 1FNVA 1I4PA 1Q86C 2B39A 5I6YA 3VDYA 4IPHA 1B7YB 4X66Q 1XNQQ 5KNBA 1Y1VG 2WB1G 3HOWB 1HUNA 3X3MA 4FXGC 1K8OA 2GVAA 2F1MA 5GAEC 1LM0A 2NVXB 4MTNA 1KDCA 3OIQA 4L8JA 3F2BA 5CYUA 4LMQD 2JA7G 2JA8H 2EJGC 2HIXA 2Q8IB 5FJ8G 1GO3E 2QF7A 3OIPA 4DV0L 2UUBQ 4IFDH 1WI5A 1S3OA 4JVZA 2OCEA 2X6GA 4WJ3M 4HJ5A 4ALPA 2B63H 1WTHA 2WAQE 5IP9G 3DEPA 5C4XG 5IGBA 3OTOQ 3QIAA 2PCFB 1AZPA 2ZM6Q 4HJ8A 5IGDA 4JOIA 2E5LL 3HOVG 4HJ7A 4A3BG 3RLNA 1G91A 4EGVA 1JJCB 1TWHB 4V190 4OEMB 1Q8IA 3TZUA 1EIGA 2NN6H 3DWQA 3J81E 1TY0A 1V9PA 2YTXA 5LL6X 4DR6Q 1FNWA 3NENA 3BVGA 4KI0A 4XXEA 4RKBA 4FF4A 4KN7C 1Y1WB 3P7JA 2BA0A 1A2UA 5IGCA 3AQQA 3AU7A 1X3EA 1MD2D 3MC0B 3J7AF 4G4KA 4LJZC 1F9RA 2NVXH 1EU4A 2K05A 1EYAA 4QUCA 3BDLA 1SNCA 3DLLA 4RFBA 4DR2L 4KD3A 3PO2B 4K6DA 4P75A 2A6ED 5LMNL 1YBYA 3NTIA 4FVMA 1SNMA 4GLVB 2OWOA 3F2CA 3MXNA 3CCJA 1AE2A 4X6AH 2B8GA 3HOWG 4FF1A 1EYGA 3IKJA 3HOUH 1E2ZA 4FXDA 4Y52H 3MXNB 3R2IA 1JWUD 1PH5A 2KHIA 3S16H 4YHHL 1OXUA 2K5QA 3CKIB 3RD4A 1SYGA 3I4MG 4DV1Q 1HXYD 4JI8Q 3LWUA 3HOXH 2PZWA 4K8JA 1VQ6A 1VMPA 2PI2A 1MIUA 1MKHA 1PHJA 4X65L 3CXCA 4UP8A 4DR5Q 3T1HQ 3C46A 2SOBA 1KRTA 3S1MB 5ELOA 4J15A 4A3DG 5FK9C 4C3IH 4BY7B 3SGIA 5K36G 1HQMC 3S15B 3MTSA 3I72A 1STBA 3M7GA 5C44B 3VYSA 3CC2A 1SMXA 1UNSA 4DV4L 2K5VA 4WJ4A 5J3BA 2R92B 3GO5A 4TVAB 5IYBH 3K7AH 5AJ3L 3CMAA 4LF9Q 2L5TA 4E6IA 2EJFC 4JPBW 2PZUA 1B4OA 3GTQB 4MIUA 1VQOA 5CMDA 3EROA 4RMFA 1PFBA 1A63A 3TMEA 1XMOL 3CCVA 2H1EA 3J7AV 1KC8C 3SK4A 4A3MG 3S1MH 3HZXA 1LABA 1Q1BA 1ASYA 3P20A 1Y8OB 2KEDA 4BY7H 4KY5A 1K0RA 4DR4L 3I90A 4I65A 3S15H 3GTMH 4R4IA 3VA7A 3UDIA 2DN8A 3GTPH 5C44H 1UUPA 3A8IE 4L5QA 3Q0AA 4WJWA 2VY3A 2R92H 2EY2A 1BVSA 2VL6A 2B2TC 3C1EA 3GV6A 2NBFA 3SDZA 5FOBB 3NQTA 4CBVA 4R1JA 2A74C 2RBMA 2HUGA 4Y7NB 4JI5Q 2PO4A 2K7VA 2ENBA 2PNRC 3GTQH 2K32A 1UEAB 2RCFA 2YYZA 4ME5A 4LF5Q 1W2BA 1YZ6A 2F0VA 1LT6D 3RMHA 3PF5A 3G48A 1DCZA 3I7FA 2B2UA 1JB7A 1OXSC 3VR4A 2O2LD 1HRJA 5E4XA 1HNWL 3NXWA 2L1BA 3BZCA 2EXDA 2K5HA 5M3FB 3BVMA 1BQQT 3B6YA 3AEVA 1MGSA 2K1BA 3FKIB 3M4OB 3W5OA 2ES2A 4N9PA 4ABNA 1NSNS 2LMCB 1KIXA 1I50B 3S2DB 3DWPA 3RUZA 4FDBA 4YIJA 4B08A 4S3SA 4K2LA 1EYDA 2AWOA 1EY5A 2CCZA 4PV1C 2EZVA 1WTWA 1S5BD 5C6AA 4LFAQ 1CT1D 3H15A 1SNOA 2VUMB 2B2WA 2Q2UA 3NHHA 3CCUA 3H3VH 2ID0A 1GD7A 2F0LA 1EWIA 4H7BA 2PZTA 3F2UA 3X3NA 5FO9B 3ICEA 4JI1Q 5M3FH 1CM9A 3R8BA 2PI2E 4C3HH 2Z0SA 2Z6BA 2HCIA 5A2QL 4EQ5A 3CQZB 1HR0Q 2L55A 5IYDH 3TSSA 1WFQA 2OQ0A 1E24A 1EY9A 2F0SA 2BE5D 1T5XD 3GP7A 3J7ZC 1X3QA 1C0AA 2IX3A 3U9SA 4YCWA 3S1NB 2C5CA 1NJIC 4R8IA 1NY4A 3SK5A 3TRZA 4BXXH 2Z6KC 1NAPA 2A6HC 3PO3G 2IL8A 4AYBG 2Q2HA 2VXWA 2Y0SB 3ULJA 1BUVT 2NWGA 1LTGD 3CW2C 2F0IA 1ENFA 1SMYC 1R9TB 4WORA 1KNAA 3QWNA 3KFUA 4KHVA 3DWAA 1RL2A 5FO7B 1VQ8A 5E3FA 4HMIA 1NE3A 2Q2TA 1RTNA 4BBSH 1H95A 2IT1A 3I4NG 1O7LA 4GKJQ 4A76A 4UP9A 1EY4A 5IYCG 3GTKH 4EQOA 3N6RA 2KVMA 3CQZH 4M1UB 4IQZA 1BKBA 2F0OA 4ODGA 1JCKB 2FXQA 3M7NA 4LFCL 4HIOA 1DOMA 1W6JA 1HZAA 4DNRB 2EPBA 4R4QA 4DUZL 2WINB 1O7YA 2RDGA 5ISRA 3QB3A 4HJAA 5M5XB 1XNRL 1TS4A 4DK6C 1D5ZC 4O0AA 2HDLA 2CQOA 3AYHB 5A35A 5JJLA 1TIID 1KAAA 2CH4W 1I6HB 1HJPA 4JC0A 4NXNL 4A3EH 2E2JH 3KBGA 1VQGA 1SSOA 4JI6Q 1S72A 3WOFA 1TT2A 1B9NA 1BBUA 1LLRD 4MTKA 1K9MC 4AQYL 3E9IA 1XWEA 4O1NA 1DJRD 2J0TD 1NTGA 2VB2X 4DNTB 3DEOA 1PFSA 1U4MA 2UUAQ 4RGNA 5CR3A 1YHBA 1LTAD 1STEA 1XTCD 1SRUA 4HN7A 3PUVA 1CFMA 4H0LC 2ASBA 2JJQA 1QUQA 2MUYA 1PH1A 1LT5D 1Q1EA 1A3VA 5J39A 4X64Q 5FLMH 1V1OA 3K5MA 1S5ED 2XWJB 1GHJA 1QUQB 4TRDA 1EIYB 5M5XH 1AFPA 3D4DA 2VQEQ 4DN4M 3GTGH 1TWGB 3F8TA 1YJWA 2ZXPA 4A3IG 4JG2A 1P16A 2JA5H 1B53A 3V05A 4R4OA 2F0NA 1UE1A 5EGTA 1IL2A 4JI3L 3MEFA 1N36L 4A93G 4CDFC 3D4RA 1MSGA 1C7YA 4JI0L 4DR7Q 3I2ZA 2D0PA 1IYJB 2B8FA 4A3FH 2A6EC 1IKMA 1OXVA 2R93B 2L0CA 2NYZD 4CDCC 2HHHL 4POGA 2K5NA 5C3EG 1ESRA 2AUJD 3HGBA 1S40A 2EJMA 1WTRA 1KLGD 1SN8A 2F0KA 2PYKA 2CWAA 4QL5A 1JOQA 5JJIA 5JPMC 3K5OA 5CBEE 3L3OC 4DGZA 4A3GH 1BDOA 4IOCA 4K8IA 3BS1A 4QB4A 1FGBD 3PF4A 4O2DA 4BBRB 4IFDI 1QJOA 2ZJQA 1QB5D 2E2JB 2UUCQ 4Z9CB 2N55A 3HKSA 4KY7A 2K33A 3RZDB 3OMGA 4IPGA 1Q82C 1SNPA 4NP5A 2AQ3B 5T1IA 5JJZA 3M85A 3H09A 2EY1A 1EY8A 3S17H 2F3VA 4Q0FA 1VQMA 4CGYB 2NN6I 1H9RA 2Y0SE 1QVCA 3QG1A 5ELFA 2R93H 2O5IC 2QEXA 1M8AA 3H0GG 4YWLA 4R8NA 4KTAA 4X66L 1M1KC 1XNQL 5K5PA 4AIMA 2MJ8A 1XYIA 3GTLH 1F9SA 5KIXA 4IOAA 2B2YC 4NKLA 5BN5A 1VQ9A 5JVH3 2OF1A 1PH7A 1D2BA 1QG7A 5HGQA 2RKSA 3U9OA 1V1QA 3M9BA 4XDXA 3PIO3 3H91A 3TBIB 1AEXA 1TWFH 3OOCA 2E74C 1Y1VB 2WB1B 3HP3A 2I46A 1IBMQ 2EYMA 1SNDA 4L5SA 1WCMG 3OTOL 1D7QA 1EY6A 3RLOA 5JVG3 4C2MH 4RWSC 3CAMA 1HQRD 2EY6A 4CDEC 1CTMA 2JA7B 2R7FA 3ER0A 5IP7H 1N8RC 4B3RQ 1F2MA 2DY7A 3MXGA 4A3KH 4DV2Q 1H9MA 1CSQA 1NMFA 1Z9FA 4DR6L 3EN2A 2QA4A 1G6PA 1TWAH 1I4RA 5C4XB 2NVQB 2F52A 2OTJA 2PMZB 2HCCA 2MGSA 2EYHA 1SYFA 1WTOA 3CMEA 5ELDA 1L2FA 4A3BB 4BA2I 2G9HD 2ALYB 2RF4A 4KHPQ 1QOHA 3ITPA 1JOKA 1LO5D 4IFDJ 1VQEA 1CKMA 3S9WA 2QDBA 3HOYG 3NELA 2HIVA 5A2QE 4NW2A 2UXBL 4DK3C 4N9TA 1DXMA 4DXGA 1K83B 1HR0W 1IXRA 4JYAQ 2KENA 1E0BA 1QCBD 3NTKA 2Z1CA 1X3FA 3VR2A 3V96A 3TQYA 5H1SE 4GLXA 1JICA 2FMMA 2JEBI 1XMQL 2K52A 2JA7H 1WTQA 2XGTA 5FJ8H 1ESFA 1KD1C 1VQPA 3UDFA 4DV1L 3I8ZA 4JI8L 4RGMA 1I6VC 2AQ2B 2RDHA 2XRSD 3S1RB 4JBWA 1EQTA 1B44D 1YHQA 3S14H 2E2IB 4OONA 3T1HL 4DR5L 2L4NA 3HOVH 2I5LX 2JA6G 1TQOA 4HJ9A 1IHZA 2EQSA 3MZ5A 5HURA 1JJ2A 5M5YH 4LF8Q 4HIKA 1QNKA 4G7HC 2QW7A 3O13A 1EZ6A 4DNIA 2Z4HA 4DV7Q 3HS0C 3I4MB 1GHKA 1PH3A 2YU9B 1PTOH 3VR5A 2PW7A 5I4DA 3PMFA 1J5EQ 5KYIA 1HNXQ 1GUGA 1LTRD 3OWFA 5IT9E 1EFWA 2B2YA 2FHTA 1QZGA 2V4DA 2L11A 3GDEA 2ICEC 1EWHA 4A3DB 1DZ1A 2KBNA 2NB0A 3L0OA 4B3SQ 3RZOB 1KL9A 4KJNA 5EQ0A 3BDCA 3NTHA 4LF9L 2CFMA 1PVOA 3CPFA 3EVQA 1PFNA 1N33Q 1BCPC 3G71A 3A5UA 4TSSA 3ULPA 1SBBB 4HR7B 3OPOA 5LHY1 4EX5A 2LY7A 2E2IH 2TMPA 4DA2A 1XPRA 4ZLTF 4KKTA 3HOWH 3BG3A 4YCUA 5EKLA 1YITA 1E22A 4GKKL 2K14A 1TVXA 3PIP3 3P75A 1V43A 2DJGC 1E3PA 1YI2A 3IL8A 2EE1A 4X3TA 5BN3A 4H02A 1HCZA 2WFWA 3G6EA 2K75A 4IFDG 3LNNA 1G51A 2KOLA 3SE0A 4A3MB 1V8QA 2B63G 2BA1A 2ZJPA 1EEID 2MP1A 4DAPA 2B29A 4A3DH 4QUFA 2UXDL 4DXFA 5IGEA 2AKWB 4UPAA 1UE6A 5IWAQ 1A6XA 2NVYB 3D6WA 1JWSD 2WB1E 1TWHH 4ZRZA 3W1GA 4QQBX 4JI5L 1BF4A 2A8VA 3T16A 1PTOD 2BOSA 5M3MG 2JXMB 1CA6A 4A4IA 3L9AX 3K57A 3H3VI 2VNUD 1V1PA 1WD1A 1Y1WH 1I3QB 2XRQD 2Z4IA 1YNJC 4FP5D 4HCEA 4J6HA 5KGUA 3K81C 4WFN3 1RHPA 2EIFA 2R3ZA 5LMUQ 2JN4A 1V1PB 1X32A 4JI7Q 1IBLQ 1VQFA 2PMZE 4BY1G 4UAIA 4DPGA 3TS2A 3PO2H 3MWYW 3PUYA 2F4VQ 2D0OA 4IUQA 1Z47A 2QEJC 1IW7D 2GVBA 4B9XA 3NBIA 4A3MH 5FLXc 5GADC 2A68C 3K80C 3R3OA 1SXTA 1OXXK 3HOUG 2B2VC 4IURA 1P8LA 3T51B 5BN4A 4A3LG 3M3YB 2P5ZX 4C3JG 4YWKA 4LFAL 1TY2A 4PZ7A 4NDXA 1RF2D 3HOXG 4RAUC 1JORA 4IJLA 1J9OA 1GUSA 2F4IA 1TWCB 3NSWA 4X62L 4ILWA 4DV5L 1EY0A 3ZJYC 4DAYB 1RTOA 1X6OA 3CCLA 2PQAB 1KDBA 1CK1A 2QKIC 5DNFA 1PRTC 4BS9A 4C3IG 3NP8A 4DR1L 4JI1L 2LKVA 3OSOA 1HUMA 2PW5A 5CV8A 1H9KA 1BXTA 1I4QA 3FP9A 1E2WA 1BCPB 2F0GA 2KA7A 1AW7A 4NXMQ 3IFTA 4B3ML 3RLFA 3KJPA 1X56A 1PZID 1Q81C 5IYBG 1G2TA 4KKSA 3S1QB 5KRUA 3Q23A 1WVLA 4QCLA 1C4QA 4A3JG 5F2DA 3K0YA 5JEAH 1K28A 3T1YL 2QILA 5LMNQ 1JC7A 4LUZA 1GUNA 3STBC 3CU7A 1JB3A 4I7ZC 1R4QB 2RVLA 1FR3A 5C3XA 2JP1A 3JAMc 3OHXC 4KKUA 4LF4Q 1RDPD 3PIOA 4NB3A 5GROA 4GKJL 1Q12A 4PG3A 4X3KA 1STNA 3KBXA 4K0KL 3PO3B 5E1FA 3D4WA 4AYBB 2XVSA 1AH9A 2MQHA 4U68A 2WKDA 3U50C 3Q22A 2XN9C 1U0LA 3SHLA 3NWTA 4CKEA 5C0XH 4HEDA 3SK6A 3I4NB 1WOCA 1BBWA 4GZYC 4Y7NH 1UE7A 1STHA 2N78A 1JT8A 1IZ6A 2D62A 4KMUC 1AP0A 4DV6Q 5NUCA 3CC4A 2KCNA 1U9RA 3K0XA 2LFNA 4KY6A 5J22A 2H4OA 3U58A 3BYYB 3I56A 2A69D 3DHQA 3UE1A 5J1ZA 4O42A 3J80c 2VQFQ 4JI6L 1A8VA 4RH6A 1F2YA 2JQOA 5AJ3Q 1ILPA 1F9QA 1GOZA 1O80A 2RCNA 1VF7A 4NMZA 3DXJC 3OMCA 3T56B 1F9PA 5ELBA 1XMOQ 2UUAL 3FKIH 3AMUA 3BVZA 3M4OH 1UEBA 4DFAA 1I50H 3EBEA 4DR3Q 3C2PA 1WJJA 3S2DH 2RSNA 3NE5B 4CDDC 1PYWD 3R93A 1DYQA 2EYJA 3C3LA 2CW0C 4X64L 4LF6L 3I4NH 1PRTB 2R7ZG 1Q3LA 1HA6A 1NMGA 1X65A 1ICWA 2JSOA 3LGJA 1KDAA 2VQEL 2MO0A 3G4SA 1X9NA 3BJUA 5KNDA 2VUMH 4RG1A 5M9OA 4CJ1B 1S5FD 2B2TA 4MN3A 1Y14B 2F0EA 3K8AA 4XT1B 3A0JA 1PTOF 1TXYA 1I4HA 4DR7L 3JAML 1EOVA 2C35B 2L12A 4XYQA 1FD7D 5FKAC 2F3IA 2OXPA 4OIJA 3A8KE 4KD4A 4LFBQ 4ME3A 2JEAI 4OX9L 3GTJB 1SYBA 4C3HG 1N32L 2UXCQ 4A3IB 2ZTEA 5IYDG 5ELEA 3OW2A 3TEHB 1YIJA 4A93B 3UDGA 1OO9B 1X3PA 2RHSB 2NTTA 2G5DA 3S1NH 3IRBA 3TREA 4DU9A 4JV5Q 5JJKA 1IL8A 3WOEA 2E2DC 2F03A 2UUCL 5C3EB 4BXXG 1VQIA 3CHBD 1I94Q 1KRSA 1JE4A 1K8MA 1AZQA 1VQBA 2A1AA 5DEHA 3PUWA 3KLSA 3T53B 3D31A 3PIPA 2F0MA 2HT1A 4UDUC 4XYOA 1R9TH 3J80L 1GXDC 2DNEA 5HY6A 3HKZG 2QCPX 4BBSG 2L9HA 3TP5A 3FEWX 4A75A 2J4XA 1J8IA 2R6GA 4IPDA 4K14A 2HQLA 2M9VA 4C1NK 2HD3A 1K8AC 4AYBE 1MBYA 1YNXA 1VQNA 1D1IA 2EYFA 1TS5A 5C4HA 2N49A 3E0EA 1EQRA 1BR9A 1CI3M 5I9PA 1JQYD 3H0GB 3NQIA 3BU2A 3TZDA 1BOSA 2NTSA 2YTVA 4XTCS 1I6HH 1NR4A 5IOCA 2MFIA 1QVGA 2K5DA 1HFNA 4A3EG 2A5HA 3D6CA 2I5HA 3A54A 4M8AA 3PUZA 4CJ0B 1A2TA 2EYPA 4B3RL 1Y69U 2Z6KA 1A3UA 2MPMA 4JK1C 3I70A 1S5CD 2RDFA 4Q5VA 1PH2A 1HZCA 1R4PB 2JK8A 1PDQA 1SE2A 1XPUA 1JOOA 1B3AA 1EQVA 2K6AA 1E2VA 4LAAA 5EJWA 1GUWA 2A73B 1WCMB 5IGGA 5JAVA 2K01A 2NZ1D 3KLRA 4HTHA 1N34Q 1M4VA 1HNZL 2DNCA 3FMCA 5LL6S 3JAMi 4ZAIA 5BR8L 4G57A 1B8AA 1PH6A 4OGQC 3QR8A 4NPSA 4B3TL 1PH9A 4K5VA 4DUYL 2ZTDA 4KN4C 3J7YW 5FLMG 2EOTA 2WKCA 4OWXB 5EBDA 3H0GH 3PCOB 5KNCA 1YJ9A 3MVVA 2XNAC 1U4PA 4JYAL 1TWGH 1H9JA 1RCVD 3J81j 3ND8A 4XQJA 5GAHC 2JE6I 1BBXC 4JI2Q 1OTCA 1Z6HA 4LFCQ 1SYCA 1RODA 1D5MC 3U4ZA 4LF7Q 1IYVA 5IODA 2NUCA 3HOYB 4OIKA 4RCOA 1IW7C 4A3FG 4L6TB 5C4JB 1VQLA 3VR3A 3KF6B 1XX8A 2RQXA 1ET9A 2OT2A 4NXNQ 2QDLA 3J80i 3I4OA 2BDOA 4RGTA 4QY7A 4LF8L 4IJHA 2YTYA 5G3LF 2M00A 2K5WA 4DV7L 4LNQA 4A3GG 3H6MA 4BBRH 3CRLC 2FMCA 1Z7TA 1J5EL 1HNXL 2LXJA 4LUVA 4OO1H 4C56C 4FNFA
chains in the Genus database with same CATH topology
4LF7L 1E22A 4LF5Q 4GKKL 2K14A 2GN5A 1K8GA 1W2BA 1YZ6A 1V43A 3RZDH 4DAMA 1SR3A 3PSIA 1E3PA 1YI2A 3PF5A 2YV5A 3G48A 2ZM6L 3I7FA 1GKHA 1JB7A 1OXSC 4H02A 3S24A 4GOPC 3GTJH 4L5RC 2WFWA 3G6EA 1KHIA 2K75A 1HZBA 4POFA 4IFDG 1PV4A 4A3IH 4GN4B 4JOIC 3NBHB 1ASZA 1G51A 1HNWL 2B63G 3KOJA 3BZCA 3CCRA 2BA1A 2EXDA 2K5HA 4BA1I 2ZJPA 4A93H 2B29A 3B6YA 3HOZG 4A3DH 2UXDL 2AKWB 3AEVA 4UPAA 1UE6A 5IWAQ 3CCMA 1DGSA 3DM3A 4MZ9A 2WB1E 3W5OA 1TWHH 3W1GA 2ES2A 4QQBX 4JI5L 1M90C 2BH2A 1KIXA 2A8VA 1LYLA 1SROA 4FDBA 4YCVA 5C3EH 3RN5A 4JI3Q 4YY3Q 5M3MG 2AWOA 4A4IA 1IBML 2CCZA 4JI0Q 3H3VI 3A74A 2VNUD 1Y1WH 2Y0SG 2WAQG 3K81C 4HIDA 4LFAQ 2EIFA 4PZ6A 2HHHQ 5LMUQ 3H15A 2Q2UA 1Y1VH 4GNXC 3UE0A 1L0WA 4LF6Q 5IY0A 1VQ4A 1VQFA 1IBLQ 4DV2L 4JI7Q 2OQKA 2PMZE 4BY1G 2V1CC 3GD7A 4DPGA 3TS2A 4KHPL 3PO2H 3CCUA 1CKNA 3PUYA 2F4VQ 5IWAL 3H3VH 2ID0A 2D0OA 1Z47A 2GVBA 2MNAA 1GD7A 4DV3Q 3CCSA 1WYDA 1EWIA 1CKNB 1VCIA 2VW9A 4A3MH 5FLXc 5GADC 1VQ7A 3ICEA 4JI1Q 5M3FH 1PYSB 2PI2E 3K80C 4JCVE 1A62A 4C3HH 2Z0SA 3M4PA 3KDFA 4R4TA 1U5KA 4YY3L 4EQ5A 3CF5A 4IO9A 1K73C 1HR0Q 5IYDH 1G291 1WFQA 1OXXK 1E24A 2OQ0A 4AH6A 3HOUG 5IP9H 4P72A 2N3SA 1FL0A 5C4XH 1P8LA 2XTIA 3J7ZC 2NVQH 4A3LG 1C0AA 3KDFB 4YWKA 4LFAL 4YCWA 5LMUL 4OX9Q 4A3BH 4PZ7A 3HOXG 1HZ9A 3L7ZC 3HKZE 1N32Q 4IJLA 4JI7L 1IBLL 1NJIC 4X62L 4P71A 1VQJA 4DV5L 1NY4A 3TRZA 3ZJYC 4DAYB 4BXXH 4PZ8A 3CP0A 1X6OA 2Z6KC 3STBD 2JA5G 2PQAB 3CCLA 2F4VL 1JJGA 4A3CG 1YEZA 4AYBG 4DV3L 3PO3G 2Q2HA 2ZJRA 3GTOH 1K83H 1A0IA 3ULJA 3KF6A 4DUZQ 4DR1L 3RN2A 4JI1L 3F1ZA 3CW2C 1UWVA 3JC66 2KCMA 4GN5A 3FP9A 1XNRQ 1AE3A 3KFUA 1N9WA 4GLAC 1RL2A 2LSSA 1VQ8A 1VQKA 1NE3A 1IBKQ 5LMNW 2Q2TA 2N8NA 4NXMQ 4BBSH 1WCMH 4B3ML 1H95A 2IT1A 3RLFA 3I4NG 4GKJQ 4A76A 2MO1A 4UP9A 1E1OA 3KJPA 1FGUA 3GTKH 5IYCG 1E1TA 1X56A 1Q81C 5IYBG 3S1RH 3CQZH 1Q46A 1BKBA 4GOPA 4GS3A 5GQOA 4A3JG 4AQYQ 1CUKA 3HOZH 3J81i 2FXQA 3M7NA 4LFCL 1VQCA 2DGYA 4HIOA 5GAGC 3T1YL 5LMNQ 1OXTA 1HZAA 4LUZA 4GOPB 3STBC 4IPCA 4R4QA 4DUZL 2IHFA 1T9HA 3I4MH 2QGQA 1GVPA 3KF8B 2IX0A 2JA8G 1GM5A 2YU9H 4HJAA 5M3MH 1XNRL 2UU9Q 4DK6C 3JAMc 4B3SL 2WP8J 5DLQE 4O0AA 4LF4Q 2CQOA 3AYHB 1IBKL 4NXML 5JJLA 5C0XI 3PIOA 1HJPA 4JC0A 4NXNL 4NB3A 5GROA 3HOYH 4A3EH 4GKJL 1Q12A 3Q8DA 4PG3A 2UUBL 2NZHA 1N33L 4K0KL 1VQGA 5C4JH 2A19A 4JI6Q 2R93G 1S72A 3CC7A 4OWWB 1PH4A 1AH9A 3RZOH 2MQHA 1YVCA 3PV0A 4L5TA 2VZAA 1BBUA 1YHAA 3U50C 3BZKA 2OTLA 1LUZA 4BY1H 1VQHA 4KHZA 1K9MC 4AQYL 3E9IA 4JBMA 2IHEA 4LUOA 1U0LA 1J6QA 1I5FA 1NTGA 4GNXA 1N36Q 4JBJA 2NN6G 4LF5L 2UXBQ 2K4KA 1PFSA 2E8GA 4UP7A 4PMWA 2UUAQ 1WOCA 3RNUA 1YHBA 1BBWA 1FJGQ 5EAYA 4GNXB 1SRUA 4Y7NH 1UE7A 4JI4Q 4BBRG 3PUVA 4YWMA 2UU9L 2N78A 2ASBA 5ELNA 1IZ6A 2D62A 3K7UC 2JJQA 4LF4L 1JT8A 1QUQA 4OO1G 1PH1A 1XMQQ 2KCTA 2YYZA 4DV6Q 1Q1EA 3CC4A 4A3LH 4X64Q 3K0XA 5FLMH 4C3JH 3U58A 3I56A 3UE1A 1QUQB 3KYHC 3J80c 4TQUS 2VQFQ 1HNZQ 4JI6L 1A8VA 4KLKA 2AMCB 1EIYB 5M5XH 2JA6H 2K50A 3PGZA 5BR8Q 2VQEQ 1XPOA 3GTGH 3F8TA 2JQOA 5AJ3Q 5IE8A 4QGUA 3L2PA 1YJWA 2RCNA 4B3TQ 4DUYQ 4A3IG 4JG2A 1P16A 5IP7G 2JA5H 4R4OA 1UE1A 4A3KG 1IL2A 4JI3L 3MEFA 1N36L 4A3CH 4JBKA 4A93G 1XJVA 1QVFA 1O7IA 5JEAJ 2I0QA 2NZOA 1XMOQ 2UUAL 1VQDA 1C7YA 2NVYH 4P74A 2PNHA 3FKIH 4JI0L 3I2ZA 5M5WH 2D0PA 3M4OH 1IYJB 1FJGL 4A3FH 4DR7Q 3NEMA 3I55A 1OXVA 4DKAC 4JI4L 1UEBA 1I50H 3EBEA 4DR3Q 3TS0A 3CD6A 3S2DH 1WJJA 4R4CA 2HHHL 1PYBA 4POGA 4DV0Q 2K5NA 5C3EG 4DV6L 2PQAA 1S40A 4X64L 4LF6L 1SN8A 3KLWA 4QJFA 3I4NH 1E7ZA 2CWAA 2R7ZG 4QL5A 1KXLA 5JJIA 3ULLA 2KHJA 2VQFL 1K3RA 1C9OA 1I3QH 4OWTB 1Y1WG 1NMGA 1X65A 3LGJA 2VQEL 1Q86C 2MO0A 3G4SA 2E5LQ 2IY5B 3VDYA 1X9NA 3BJUA 4IPHA 4OXPA 4IOCA 4A3GH 2VUMH 1B7YB 4RG1A 4X66Q 4A3JH 1XNQQ 1XTDA 3PF4A 4O2DA 4IFDI 1Y1VG 1Y14B 2WB1G 3HFZB 3K8AA 1LTLA 2ZJQA 2GVAA 3A0JA 5GAEC 2UUCQ 3PO2G 1NBWA 5C0XJ 1LM0A 1TXYA 3HKSA 1HR0L 4MTNA 4DR7L 2CKZB 1EOVA 2C35B 3F2BA 4IPGA 1Q82C 2JA7G 3E9HA 2JA8H 2HIXA 2F3IA 4DR3L 3M85A 5FJ8G 4LFBQ 1GO3E 4ME3A 2JEAI 4P73A 4OX9L 4DV0L 1Q8KA 2Q2IA 1WI5A 2UUBQ 1S3OA 1JE5A 3S17H 1VQMA 1N32L 2OCEA 2UXCQ 4GKKQ 2ZTEA 4WJ3M 2NN6I 4HJ5A 5IYDG 2Y0SE 4ALPA 1SLJA 3TEHB 3OW2A 2B63H 1QVCA 2WAQE 5IP9G 2LXKA 1YIJA 3UDGA 2R93H 3M3YH 4DR2Q 5C4XG 3OTOQ 1X55A 2RHSB 2ZM6Q 2QEXA 4HJ8A 4JOIA 2E5LL 3HOVG 3H0GG 4YWLA 4HJ7A 4A3BG 3RLNA 4X66L 3IRBA 1M1KC 1JJCB 1XNQL 3S1NH 3TREA 4LW1A 1PH8A 4JV5Q 1TWCH 4AIMA 5JJKA 3GTLH 1EIFA 4BXXG 4QIWE 3EIVA 2UUCL 4IOAA 1VQIA 1I94Q 1KRSA 2UXDQ 2YTXA 1V9PA 1VQ9A 4DR6Q 3NENA 4KI0A 1PH7A 1QZHA 1VQBA 2AWNA 2A1AA 5HGQA 4HIMA 3PUWA 4BY7G 2BA0A 4LFBL 3AQQA 3D31A 4YHHQ 3ERSX 1V1QA 1X3EA 3M9BA 3PIPA 2HT1A 1R9TH 2H5XA 1TWFH 2UXCL 2NVXH 1L1OC 5C44G 5HY6A 1IBMQ 3HKZG 4L5SA 3DLLA 4BBSG 1WCMG 4DR2L 3OTOL 1EQQA 1D7QA 4X65Q 2R92G 3RLOA 4P75A 4A75A 4C2MH 3CAMA 5LMNL 2R6GA 3S1QH 3CCQA 1YBYA 2R7FA 3ER0A 4IPDA 5IP7H 2E2HH 4JV5L 1N8RC 4B3RQ 4GLVB 2OWOA 4A3KH 4DV2Q 3F2CA 2HQLA 3KJOA 3CCJA 2NVTH 1K8AC 1AE2A 1I94L 4X6AH 4AYBE 1CSQA 1NMFA 3HOWG 1YNXA 1Z9FA 5JEAG 5IT9c 3PUXA 1EYGA 3EN2A 2QA4A 1VQNA 1TWAH 3HOUH 4DR6L 4Y52H 1G6PA 3MXNB 1PH5A 4DV4Q 2N49A 3E0EA 1EQRA 2F52A 2KHIA 2OTJA 3S16H 4YHHL 1OXUA 3CMEA 3I4MG 4DV1Q 3F2DA 1L2FA 3BU2A 4JI8Q 4BA2I 3HOXH 2ALYB 2RF4A 1MJEA 4KHPQ 1PA6A 1VQ6A 2R7ZH 2YTVA 2PI2A 4IFDJ 4XTCS 1CKOA 2BH8A 1MIUA 1VQEA 3D0FA 1I6HH 1MKHA 1CKMA 1SFOH 2MFIA 3HOYG 1QVGA 1PHJA 4X65L 3CXCA 4UP8A 3CCEA 4DR5Q 3T1HQ 4A3EG 1KRTA 3J81c 3NELA 5ELOA 2HIVA 2I5HA 3PO3H 3PUZA 2VS1A 4J15A 1VQ5A 2UXBL 4A3DG 2RHQB 4C3IH 4DK3C 3RR5A 3SGIA 1HR0W 5K36G 4B3RL 1IXRA 2Z6KA 4JYAQ 2KENA 4X62Q 4DV5Q 1X3FA 2I5MX 2AHOB 3TQYA 1PH2A 5H1SE 1HZCA 4GLXA 1B70B 2JK8A 4LWCA 5C0XG 3CC2A 2IX1A 1XPUA 1XMQL 1SMXA 2JEBI 4DV4L 1VS0A 2K52A 2K5VA 2JA7H 4WJ4A 2XGTA 5J3BA 5FJ8H 4DR4Q 1N34Q 1KD1C 4DR1Q 3GO5A 1KAWA 5IYCH 1VQPA 3UDFA 4TVAB 4DV1L 1HNZL 1JMCA 5IYBH 3CPWA 4JI8L 3JAMi 3K7AH 1EUJA 5BR8L 4JBWA 1PH6A 1B8AA 5AJ3L 2ATWA 3CMAA 4NPSA 4LF9Q 3U4VA 4B3TL 1YHQA 1PH9A 4DUYL 2ZTDA 3S14H 1X3GA 4OONA 3T1HL 4DR5L 4B3MQ 5FLMG 4OWXB 3WWVA 3HOVH 3H0GH 1CSPA 1VQOA 2I5LX 3PCOB 4RMFA 4HJ9A 2JA6G 2EQSA 1A63A 1YJ9A 1XMOL 3FHWA 5M5YH 3CCVA 4HIKA 2DUDA 3W1BA 1JJ2A 3AFQA 4LF8Q 5E7NA 4DNIA 1KC8C 4APVA 1TWGH 4JYAL 2B3GA 4DV7Q 3J81j 1PH3A 1KQSA 1YJNA 5GAHC 2JE6I 1VQAA 4A3MG 3S1MH 4JI2Q 1J5EQ 1HNXQ 3A5ZB 4MNOA 1OTCA 1Q1BA 2R7DA 4LFCQ 1HH2P 5M3FG 1ASYA 3OYYA 3U4ZA 3T1YQ 4LF7Q 4BY7H 3M4QA 1K0RA 1EFWA 3J7A5 4DR4L 1N34L 3FKIG 1QZGA 1MJCA 1SE8A 3S15H 4A3FG 3GTMH 4R4IA 3UDIA 1VQLA 3GDEA 3GTPH 2KBNA 2ZTCA 3L0OA 5C44H 3KF6B 4B3SQ 1KL9A 2L15A 4LF9L 2CFMA 4L5QA 1PVOA 4OO1I 3CPFA 4NXNQ 2VY3A 2R92H 3J80i 1HNWQ 3I4OA 1BVSA 1L1OA 1RIPA 2VL6A 1N33Q 4K0KQ 1UE5A 3G71A 1Q7YC 3A5UA 3S2HH 4QY7A 3ULPA 4LF8L 4IJHA 1FVIA 2YTYA 2CWPA 4XIGS 3UDXA 4GN3B 4R1JA 4EX5A 1W3SA 4DV7L 4LNQA 4A3GG 1L1OB 3AFPA 2E2IH 2VUMG 4BBRH 1XPRA 4JI5Q 3HOWH 1X54A 4YCUA 4JI2L 1J5EL 1HNXL 4UY8C 2LXJA 4LUVA 3GTQH 1D8LA 2E2JH 1YITA 2JA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 L;  1E22 A;  4LF5 Q;  4GKK L;  2K14 A;  2GN5 A;  1K8G A;  1W2B A;  1YZ6 A;  1V43 A;  3RZD H;  4DAM A;  1SR3 A;  3PSI A;  1E3P A;  1YI2 A;  3PF5 A;  2YV5 A;  3G48 A;  2ZM6 L;  3I7F A;  1GKH A;  1JB7 A;  1OXS C;  4H02 A;  3S24 A;  4GOP C;  3GTJ H;  4L5R C;  2WFW A;  3G6E A;  1KHI A;  2K75 A;  1HZB A;  4POF A;  4IFD G;  1PV4 A;  4A3I H;  4GN4 B;  4JOI C;  3NBH B;  1ASZ A;  1G51 A;  1HNW L;  2B63 G;  3KOJ A;  3BZC A;  3CCR A;  2BA1 A;  2EXD A;  2K5H A;  4BA1 I;  2ZJP A;  4A93 H;  2B29 A;  3B6Y A;  3HOZ G;  4A3D H;  2UXD L;  2AKW B;  3AEV A;  4UPA A;  1UE6 A;  5IWA Q;  3CCM A;  1DGS A;  3DM3 A;  4MZ9 A;  2WB1 E;  3W5O A;  1TWH H;  3W1G A;  2ES2 A;  4QQB X;  4JI5 L;  1M90 C;  2BH2 A;  1KIX A;  2A8V A;  1LYL A;  1SRO A;  4FDB A;  4YCV A;  5C3E H;  3RN5 A;  4JI3 Q;  4YY3 Q;  5M3M G;  2AWO A;  4A4I A;  1IBM L;  2CCZ A;  4JI0 Q;  3H3V I;  3A74 A;  2VNU D;  1Y1W H;  2Y0S G;  2WAQ G;  3K81 C;  4HID A;  4LFA Q;  2EIF A;  4PZ6 A;  2HHH Q;  5LMU Q;  3H15 A;  2Q2U A;  1Y1V H;  4GNX C;  3UE0 A;  1L0W A;  4LF6 Q;  5IY0 A;  1VQ4 A;  1VQF A;  1IBL Q;  4DV2 L;  4JI7 Q;  2OQK A;  2PMZ E;  4BY1 G;  2V1C C;  3GD7 A;  4DPG A;  3TS2 A;  4KHP L;  3PO2 H;  3CCU A;  1CKN A;  3PUY A;  2F4V Q;  5IWA L;  3H3V H;  2ID0 A;  2D0O A;  1Z47 A;  2GVB A;  2MNA A;  1GD7 A;  4DV3 Q;  3CCS A;  1WYD A;  1EWI A;  1CKN B;  1VCI A;  2VW9 A;  4A3M H;  5FLX c;  5GAD C;  1VQ7 A;  3ICE A;  4JI1 Q;  5M3F H;  1PYS B;  2PI2 E;  3K80 C;  4JCV E;  1A62 A;  4C3H H;  2Z0S A;  3M4P A;  3KDF A;  4R4T A;  1U5K A;  4YY3 L;  4EQ5 A;  3CF5 A;  4IO9 A;  1K73 C;  1HR0 Q;  5IYD H;  1G29 1;  1WFQ A;  1OXX K;  1E24 A;  2OQ0 A;  4AH6 A;  3HOU G;  5IP9 H;  4P72 A;  2N3S A;  1FL0 A;  5C4X H;  1P8L A;  2XTI A;  3J7Z C;  2NVQ H;  4A3L G;  1C0A A;  3KDF B;  4YWK A;  4LFA L;  4YCW A;  5LMU L;  4OX9 Q;  4A3B H;  4PZ7 A;  3HOX G;  1HZ9 A;  3L7Z C;  3HKZ E;  1N32 Q;  4IJL A;  4JI7 L;  1IBL L;  1NJI C;  4X62 L;  4P71 A;  1VQJ A;  4DV5 L;  1NY4 A;  3TRZ A;  3ZJY C;  4DAY B;  4BXX H;  4PZ8 A;  3CP0 A;  1X6O A;  2Z6K C;  3STB D;  2JA5 G;  2PQA B;  3CCL A;  2F4V L;  1JJG A;  4A3C G;  1YEZ A;  4AYB G;  4DV3 L;  3PO3 G;  2Q2H A;  2ZJR A;  3GTO H;  1K83 H;  1A0I A;  3ULJ A;  3KF6 A;  4DUZ Q;  4DR1 L;  3RN2 A;  4JI1 L;  3F1Z A;  3CW2 C;  1UWV A;  3JC6 6;  2KCM A;  4GN5 A;  3FP9 A;  1XNR Q;  1AE3 A;  3KFU A;  1N9W A;  4GLA C;  1RL2 A;  2LSS A;  1VQ8 A;  1VQK A;  1NE3 A;  1IBK Q;  5LMN W;  2Q2T A;  2N8N A;  4NXM Q;  4BBS H;  1WCM H;  4B3M L;  1H95 A;  2IT1 A;  3RLF A;  3I4N G;  4GKJ Q;  4A76 A;  2MO1 A;  4UP9 A;  1E1O A;  3KJP A;  1FGU A;  3GTK H;  5IYC G;  1E1T A;  1X56 A;  1Q81 C;  5IYB G;  3S1R H;  3CQZ H;  1Q46 A;  1BKB A;  4GOP A;  4GS3 A;  5GQO A;  4A3J G;  4AQY Q;  1CUK A;  3HOZ H;  3J81 i;  2FXQ A;  3M7N A;  4LFC L;  1VQC A;  2DGY A;  4HIO A;  5GAG C;  3T1Y L;  5LMN Q;  1OXT A;  1HZA A;  4LUZ A;  4GOP B;  3STB C;  4IPC A;  4R4Q A;  4DUZ L;  2IHF A;  1T9H A;  3I4M H;  2QGQ A;  1GVP A;  3KF8 B;  2IX0 A;  2JA8 G;  1GM5 A;  2YU9 H;  4HJA A;  5M3M H;  1XNR L;  2UU9 Q;  4DK6 C;  3JAM c;  4B3S L;  2WP8 J;  5DLQ E;  4O0A A;  4LF4 Q;  2CQO A;  3AYH B;  1IBK L;  4NXM L;  5JJL A;  5C0X I;  3PIO A;  1HJP A;  4JC0 A;  4NXN L;  4NB3 A;  5GRO A;  3HOY H;  4A3E H;  4GKJ L;  1Q12 A;  3Q8D A;  4PG3 A;  2UUB L;  2NZH A;  1N33 L;  4K0K L;  1VQG A;  5C4J H;  2A19 A;  4JI6 Q;  2R93 G;  1S72 A;  3CC7 A;  4OWW B;  1PH4 A;  1AH9 A;  3RZO H;  2MQH A;  1YVC A;  3PV0 A;  4L5T A;  2VZA A;  1BBU A;  1YHA A;  3U50 C;  3BZK A;  2OTL A;  1LUZ A;  4BY1 H;  1VQH A;  4KHZ A;  1K9M C;  4AQY L;  3E9I A;  4JBM A;  2IHE A;  4LUO A;  1U0L A;  1J6Q A;  1I5F A;  1NTG A;  4GNX A;  1N36 Q;  4JBJ A;  2NN6 G;  4LF5 L;  2UXB Q;  2K4K A;  1PFS A;  2E8G A;  4UP7 A;  4PMW A;  2UUA Q;  1WOC A;  3RNU A;  1YHB A;  1BBW A;  1FJG Q;  5EAY A;  4GNX B;  1SRU A;  4Y7N H;  1UE7 A;  4JI4 Q;  4BBR G;  3PUV A;  4YWM A;  2UU9 L;  2N78 A;  2ASB A;  5ELN A;  1IZ6 A;  2D62 A;  3K7U C;  2JJQ A;  4LF4 L;  1JT8 A;  1QUQ A;  4OO1 G;  1PH1 A;  1XMQ Q;  2KCT A;  2YYZ A;  4DV6 Q;  1Q1E A;  3CC4 A;  4A3L H;  4X64 Q;  3K0X A;  5FLM H;  4C3J H;  3U58 A;  3I56 A;  3UE1 A;  1QUQ B;  3KYH C;  3J80 c;  4TQU S;  2VQF Q;  1HNZ Q;  4JI6 L;  1A8V A;  4KLK A;  2AMC B;  1EIY B;  5M5X H;  2JA6 H;  2K50 A;  3PGZ A;  5BR8 Q;  2VQE Q;  1XPO A;  3GTG H;  3F8T A;  2JQO A;  5AJ3 Q;  5IE8 A;  4QGU A;  3L2P A;  1YJW A;  2RCN A;  4B3T Q;  4DUY Q;  4A3I G;  4JG2 A;  1P16 A;  5IP7 G;  2JA5 H;  4R4O A;  1UE1 A;  4A3K G;  1IL2 A;  4JI3 L;  3MEF A;  1N36 L;  4A3C H;  4JBK A;  4A93 G;  1XJV A;  1QVF A;  1O7I A;  5JEA J;  2I0Q A;  2NZO A;  1XMO Q;  2UUA L;  1VQD A;  1C7Y A;  2NVY H;  4P74 A;  2PNH A;  3FKI H;  4JI0 L;  3I2Z A;  5M5W H;  2D0P A;  3M4O H;  1IYJ B;  1FJG L;  4A3F H;  4DR7 Q;  3NEM A;  3I55 A;  1OXV A;  4DKA C;  4JI4 L;  1UEB A;  1I50 H;  3EBE A;  4DR3 Q;  3TS0 A;  3CD6 A;  3S2D H;  1WJJ A;  4R4C A;  2HHH L;  1PYB A;  4POG A;  4DV0 Q;  2K5N A;  5C3E G;  4DV6 L;  2PQA A;  1S40 A;  4X64 L;  4LF6 L;  1SN8 A;  3KLW A;  4QJF A;  3I4N H;  1E7Z A;  2CWA A;  2R7Z G;  4QL5 A;  1KXL A;  5JJI A;  3ULL A;  2KHJ A;  2VQF L;  1K3R A;  1C9O A;  1I3Q H;  4OWT B;  1Y1W G;  1NMG A;  1X65 A;  3LGJ A;  2VQE L;  1Q86 C;  2MO0 A;  3G4S A;  2E5L Q;  2IY5 B;  3VDY A;  1X9N A;  3BJU A;  4IPH A;  4OXP A;  4IOC A;  4A3G H;  2VUM H;  1B7Y B;  4RG1 A;  4X66 Q;  4A3J H;  1XNQ Q;  1XTD A;  3PF4 A;  4O2D A;  4IFD I;  1Y1V G;  1Y14 B;  2WB1 G;  3HFZ B;  3K8A A;  1LTL A;  2ZJQ A;  2GVA A;  3A0J A;  5GAE C;  2UUC Q;  3PO2 G;  1NBW A;  5C0X J;  1LM0 A;  1TXY A;  3HKS A;  1HR0 L;  4MTN A;  4DR7 L;  2CKZ B;  1EOV A;  2C35 B;  3F2B A;  4IPG A;  1Q82 C;  2JA7 G;  3E9H A;  2JA8 H;  2HIX A;  2F3I A;  4DR3 L;  3M85 A;  5FJ8 G;  4LFB Q;  1GO3 E;  4ME3 A;  2JEA I;  4P73 A;  4OX9 L;  4DV0 L;  1Q8K A;  2Q2I A;  1WI5 A;  2UUB Q;  1S3O A;  1JE5 A;  3S17 H;  1VQM A;  1N32 L;  2OCE A;  2UXC Q;  4GKK Q;  2ZTE A;  4WJ3 M;  2NN6 I;  4HJ5 A;  5IYD G;  2Y0S E;  4ALP A;  1SLJ A;  3TEH B;  3OW2 A;  2B63 H;  1QVC A;  2WAQ E;  5IP9 G;  2LXK A;  1YIJ A;  3UDG A;  2R93 H;  3M3Y H;  4DR2 Q;  5C4X G;  3OTO Q;  1X55 A;  2RHS B;  2ZM6 Q;  2QEX A;  4HJ8 A;  4JOI A;  2E5L L;  3HOV G;  3H0G G;  4YWL A;  4HJ7 A;  4A3B G;  3RLN A;  4X66 L;  3IRB A;  1M1K C;  1JJC B;  1XNQ L;  3S1N H;  3TRE A;  4LW1 A;  1PH8 A;  4JV5 Q;  1TWC H;  4AIM A;  5JJK A;  3GTL H;  1EIF A;  4BXX G;  4QIW E;  3EIV A;  2UUC L;  4IOA A;  1VQI A;  1I94 Q;  1KRS A;  2UXD Q;  2YTX A;  1V9P A;  1VQ9 A;  4DR6 Q;  3NEN A;  4KI0 A;  1PH7 A;  1QZH A;  1VQB A;  2AWN A;  2A1A A;  5HGQ A;  4HIM A;  3PUW A;  4BY7 G;  2BA0 A;  4LFB L;  3AQQ A;  3D31 A;  4YHH Q;  3ERS X;  1V1Q A;  1X3E A;  3M9B A;  3PIP A;  2HT1 A;  1R9T H;  2H5X A;  1TWF H;  2UXC L;  2NVX H;  1L1O C;  5C44 G;  5HY6 A;  1IBM Q;  3HKZ G;  4L5S A;  3DLL A;  4BBS G;  1WCM G;  4DR2 L;  3OTO L;  1EQQ A;  1D7Q A;  4X65 Q;  2R92 G;  3RLO A;  4P75 A;  4A75 A;  4C2M H;  3CAM A;  5LMN L;  2R6G A;  3S1Q H;  3CCQ A;  1YBY A;  2R7F A;  3ER0 A;  4IPD A;  5IP7 H;  2E2H H;  4JV5 L;  1N8R C;  4B3R Q;  4GLV B;  2OWO A;  4A3K H;  4DV2 Q;  3F2C A;  2HQL A;  3KJO A;  3CCJ A;  2NVT H;  1K8A C;  1AE2 A;  1I94 L;  4X6A H;  4AYB E;  1CSQ A;  1NMF A;  3HOW G;  1YNX A;  1Z9F A;  5JEA G;  5IT9 c;  3PUX A;  1EYG A;  3EN2 A;  2QA4 A;  1VQN A;  1TWA H;  3HOU H;  4DR6 L;  4Y52 H;  1G6P A;  3MXN B;  1PH5 A;  4DV4 Q;  2N49 A;  3E0E A;  1EQR A;  2F52 A;  2KHI A;  2OTJ A;  3S16 H;  4YHH L;  1OXU A;  3CME A;  3I4M G;  4DV1 Q;  3F2D A;  1L2F A;  3BU2 A;  4JI8 Q;  4BA2 I;  3HOX H;  2ALY B;  2RF4 A;  1MJE A;  4KHP Q;  1PA6 A;  1VQ6 A;  2R7Z H;  2YTV A;  2PI2 A;  4IFD J;  4XTC S;  1CKO A;  2BH8 A;  1MIU A;  1VQE A;  3D0F A;  1I6H H;  1MKH A;  1CKM A;  1SFO H;  2MFI A;  3HOY G;  1QVG A;  1PHJ A;  4X65 L;  3CXC A;  4UP8 A;  3CCE A;  4DR5 Q;  3T1H Q;  4A3E G;  1KRT A;  3J81 c;  3NEL A;  5ELO A;  2HIV A;  2I5H A;  3PO3 H;  3PUZ A;  2VS1 A;  4J15 A;  1VQ5 A;  2UXB L;  4A3D G;  2RHQ B;  4C3I H;  4DK3 C;  3RR5 A;  3SGI A;  1HR0 W;  5K36 G;  4B3R L;  1IXR A;  2Z6K A;  4JYA Q;  2KEN A;  4X62 Q;  4DV5 Q;  1X3F A;  2I5M X;  2AHO B;  3TQY A;  1PH2 A;  5H1S E;  1HZC A;  4GLX A;  1B70 B;  2JK8 A;  4LWC A;  5C0X G;  3CC2 A;  2IX1 A;  1XPU A;  1XMQ L;  1SMX A;  2JEB I;  4DV4 L;  1VS0 A;  2K52 A;  2K5V A;  2JA7 H;  4WJ4 A;  2XGT A;  5J3B A;  5FJ8 H;  4DR4 Q;  1N34 Q;  1KD1 C;  4DR1 Q;  3GO5 A;  1KAW A;  5IYC H;  1VQP A;  3UDF A;  4TVA B;  4DV1 L;  1HNZ L;  1JMC A;  5IYB H;  3CPW A;  4JI8 L;  3JAM i;  3K7A H;  1EUJ A;  5BR8 L;  4JBW A;  1PH6 A;  1B8A A;  5AJ3 L;  2ATW A;  3CMA A;  4NPS A;  4LF9 Q;  3U4V A;  4B3T L;  1YHQ A;  1PH9 A;  4DUY L;  2ZTD A;  3S14 H;  1X3G A;  4OON A;  3T1H L;  4DR5 L;  4B3M Q;  5FLM G;  4OWX B;  3WWV A;  3HOV H;  3H0G H;  1CSP A;  1VQO A;  2I5L X;  3PCO B;  4RMF A;  4HJ9 A;  2JA6 G;  2EQS A;  1A63 A;  1YJ9 A;  1XMO L;  3FHW A;  5M5Y H;  3CCV A;  4HIK A;  2DUD A;  3W1B A;  1JJ2 A;  3AFQ A;  4LF8 Q;  5E7N A;  4DNI A;  1KC8 C;  4APV A;  1TWG H;  4JYA L;  2B3G A;  4DV7 Q;  3J81 j;  1PH3 A;  1KQS A;  1YJN A;  5GAH C;  2JE6 I;  1VQA A;  4A3M G;  3S1M H;  4JI2 Q;  1J5E Q;  1HNX Q;  3A5Z B;  4MNO A;  1OTC A;  1Q1B A;  2R7D A;  4LFC Q;  1HH2 P;  5M3F G;  1ASY A;  3OYY A;  3U4Z A;  3T1Y Q;  4LF7 Q;  4BY7 H;  3M4Q A;  1K0R A;  1EFW A;  3J7A 5;  4DR4 L;  1N34 L;  3FKI G;  1QZG A;  1MJC A;  1SE8 A;  3S15 H;  4A3F G;  3GTM H;  4R4I A;  3UDI A;  1VQL A;  3GDE A;  3GTP H;  2KBN A;  2ZTC A;  3L0O A;  5C44 H;  3KF6 B;  4B3S Q;  1KL9 A;  2L15 A;  4LF9 L;  2CFM A;  4L5Q A;  1PVO A;  4OO1 I;  3CPF A;  4NXN Q;  2VY3 A;  2R92 H;  3J80 i;  1HNW Q;  3I4O A;  1BVS A;  1L1O A;  1RIP A;  2VL6 A;  1N33 Q;  4K0K Q;  1UE5 A;  3G71 A;  1Q7Y C;  3A5U A;  3S2H H;  4QY7 A;  3ULP A;  4LF8 L;  4IJH A;  1FVI A;  2YTY A;  2CWP A;  4XIG S;  3UDX A;  4GN3 B;  4R1J A;  4EX5 A;  1W3S A;  4DV7 L;  4LNQ A;  4A3G G;  1L1O B;  3AFP A;  2E2I H;  2VUM G;  4BBR H;  1XPR A;  4JI5 Q;  3HOW H;  1X54 A;  4YCU A;  4JI2 L;  1J5E L;  1HNX L;  4UY8 C;  2LXJ A;  4LUV A;  3GTQ H;  1D8L A;  2E2J H;  1YIT A;  2JA9 A; 
#chains in the Genus database with same CATH topology
 2EYO A;  1LTI D;  1K8G A;  2GN5 A;  5I9O A;  3RZD H;  4DAM A;  4IUN A;  3PQI A;  3PSI A;  2F0J A;  1SNQ A;  2JA6 B;  2RA4 A;  4IUT A;  2YV5 A;  2ZM6 L;  1CQV A;  1ONL A;  4P2C B;  4GOP C;  4JW0 A;  4L5R C;  1BCP F;  1KHI A;  1HZB A;  4POF A;  4JOI C;  1Y8N B;  3NBH B;  1RD9 D;  3KOJ A;  3CCR A;  3HOZ G;  3N52 A;  4ZUJ A;  3SEB A;  3CCM A;  3DM1 A;  3DM3 A;  4MZ9 A;  1SYD A;  5M5W B;  1G2S A;  1SE3 A;  3C1F A;  3VA5 A;  4YCV A;  3RN5 A;  4JI3 Q;  1NNX A;  3I73 A;  4YY3 Q;  2EDG A;  1NCV A;  3E3X A;  4JI0 Q;  5CV4 A;  3A74 A;  1A3T A;  2WAQ G;  1CHQ D;  4HID A;  3K5L A;  2FJ2 A;  3G6J B;  2HHH Q;  3GTO B;  4U67 3;  1Y1V H;  2A6H D;  3UE0 A;  1L0W A;  5IY0 A;  2Q8T A;  2OQK A;  2IJ0 A;  3GD7 A;  4QMG A;  5CV5 A;  2KEE A;  1CKN A;  3QOJ A;  4RHR A;  5IWA L;  3VR6 A;  3I3C A;  1XXG A;  2MNA A;  4DV3 Q;  3QO2 A;  3SXH A;  2JA8 B;  3MA2 B;  1CKN B;  4ZUI A;  4K6L A;  3NPP A;  1VQ7 A;  2WAC A;  1UAP A;  1O78 A;  1PYS B;  4JCV E;  2F0T A;  3M4P A;  4R4T A;  3CF5 A;  1U5K A;  4IO9 A;  1K73 C;  2BDN A;  3SK8 A;  1G6Z A;  1S4Z A;  2B63 B;  2DJF C;  5IP9 H;  2N3S A;  3GV3 A;  5C4X H;  2XTI A;  2NVQ H;  1DOK A;  5C5L A;  2M2L A;  3BYT B;  2E76 C;  4HSP A;  3MFY A;  2IW3 A;  3BDO A;  5LMU L;  3EJI A;  1Q90 A;  4DF7 A;  4A3B H;  3TP7 A;  1HZ9 A;  3L7Z C;  3JAM E;  4JI7 L;  1IBL L;  5COR A;  5DM7 3;  3CP0 A;  3MXP A;  1LT3 D;  2F4V L;  5M3M B;  4ZCK A;  1JJG A;  3QJY A;  2A69 C;  2E75 C;  1FYC A;  2ZXR A;  4A3C G;  2ZJR A;  3GTO H;  1LTS D;  3GQB A;  1K83 H;  5T1G A;  1PMR A;  4PMB A;  1CQF A;  2KHS A;  1UWV A;  3QOL A;  1LAC A;  2KCM A;  1SE4 A;  4F88 A;  4OHJ A;  1IBK Q;  4BY1 B;  1PLF A;  5KYL A;  4QIW B;  3FPP A;  5CGK A;  1WTP A;  3MEH A;  2BE5 C;  4IZ8 A;  3S1R H;  1O7Z A;  1Q46 A;  3E6Z X;  1PRT F;  4GOP A;  5GQO A;  1YNN D;  5EPJ A;  2DGY A;  3J80 E;  4FXK C;  3KF8 A;  3HOU B;  1OXT A;  4GOP B;  1ML0 D;  4IPC A;  4C3J B;  1CA5 A;  1QNU A;  3S16 B;  3I4M H;  1GVP A;  3KF8 B;  4FO2 A;  2IX0 A;  3VYT A;  1GM5 A;  2YU9 H;  2JA8 G;  3HOX B;  5M3M H;  2UU9 Q;  4FF3 A;  5CV6 A;  2WP8 J;  3CRK C;  2DY8 A;  1MSH A;  3FDT A;  4NXM L;  5C0X I;  1ZYR D;  2CH4 A;  1ENC A;  4F8M A;  4CHT B;  3Q8D A;  3T4A C;  2UUB L;  3DUZ A;  2AQ1 B;  1HA5 A;  1HTL D;  3A8J E;  4LK1 C;  3ONA B;  3CC7 A;  5K36 H;  4C3I B;  4OWW B;  1PH4 A;  3RZO H;  3PV0 A;  1YVC A;  3S2H B;  4BY1 H;  3BZK A;  3BZD B;  1EYC A;  1VQH A;  4KHZ A;  3Q24 A;  1TR5 A;  4LUO A;  3R2T A;  3TP8 A;  1J6Q A;  4XT3 B;  4JBJ A;  2NN6 G;  4X3U A;  4LF5 L;  2O5J C;  2UXB Q;  2K4K A;  1CZG A;  3K58 A;  4UP7 A;  4B9W A;  1FJG Q;  5EAY A;  5JPN C;  1EWC A;  3H3V C;  3EQL C;  4HMJ A;  4JI4 Q;  3K7A B;  5ELN A;  3K7U C;  4LF4 L;  2IPK D;  2X6L A;  1H9S A;  1XMQ Q;  2KCT A;  3I4L A;  2B2U C;  4A3J B;  4A3L H;  4C3J H;  2J7Z A;  2KJX A;  1H9S B;  1SYE A;  2AMC B;  4H13 C;  3PGZ A;  4H44 C;  3IFD A;  4MHE A;  4EVO A;  5IE8 A;  4QGU A;  3LX0 A;  5EPL A;  3HG9 A;  4ZKC B;  2IWH A;  3G7L A;  1JWM D;  5JEA J;  2I0Q A;  2NZO A;  3S2H H;  2NVY H;  4P74 A;  3NEM A;  3I55 A;  3HEJ A;  4PQX A;  4DKA C;  3KLS X;  3ZYY X;  3GTM B;  1TU2 B;  3CD6 A;  3TS0 A;  3GTP B;  4R4C A;  4DAY A;  1PYB A;  3FRP B;  4DV0 Q;  2N88 A;  4DV6 L;  2PQA A;  4QJF A;  3KLW A;  1E7Z A;  3FVQ A;  1SDF A;  1EU3 A;  3I91 A;  3ULL A;  2VQF L;  1I3Q H;  2B2W C;  4OWT B;  4DAV A;  1Y1W G;  4XQQ A;  2E5L Q;  2IY5 B;  4OXP A;  4K5W A;  1PFM A;  4A3J H;  1XTD A;  3HFZ B;  4KJO A;  1EL0 A;  1LTL A;  2Q8R E;  1F2Z A;  3PO2 G;  1NBW A;  4QF4 A;  5E4W C;  5C0X J;  1HR0 L;  1PZJ D;  1TS2 A;  2CKZ B;  5CC4 A;  2D9U A;  3KUP A;  2F3W A;  3E9H A;  1HHV A;  4DR3 L;  1STA A;  5I6W A;  2ICI A;  4P73 A;  1Q8K A;  2Q2I A;  5COY A;  1JE5 A;  5EPK A;  4GKK Q;  2E2H B;  1SLJ A;  1C48 A;  2F0Q A;  2LXK A;  3DMU A;  2NVT B;  3M3Y H;  4DR2 Q;  3NWS A;  1X55 A;  3D8G A;  4PNY A;  5DAU A;  1LV9 A;  5AFW A;  2Z9H A;  4LW1 A;  1PH8 A;  1TWC H;  4CJ2 C;  1EIF A;  4QIW E;  3EIV A;  1IKL A;  2UXD Q;  2HDM A;  2WII B;  2MHV A;  2R7Z B;  4RGO S;  1QZH A;  2AWN A;  4HIM A;  1SFO B;  4BY7 G;  2ZXO A;  4LFB L;  4YHH Q;  3ERS X;  3MXU A;  2VB3 X;  2O4X A;  1C8C A;  2H5X A;  2UXC L;  2TSS A;  1L1O C;  5C44 G;  3K59 A;  1EQQ A;  1EY7 A;  1AN8 A;  3H94 A;  4F87 A;  4X65 Q;  2R92 G;  1GUO A;  1PZK D;  2BCO A;  1G8Z D;  5FLX L;  4OL7 A;  1GUT A;  3S1Q H;  3CCQ A;  1QIL A;  5I2Y A;  4JV5 L;  2E2H H;  3KJO A;  2NVT H;  2EYL A;  4C3H B;  1I94 L;  2SNM A;  4J8Q A;  5JEA G;  2D5D A;  5IT9 c;  3PUX A;  3E5S A;  4EQN A;  4DV4 Q;  3A55 A;  1ZKO A;  5D3D A;  4ZKB B;  5D3I B;  3F2D A;  4PMC A;  2B2V A;  1MJE A;  1KTK A;  3MHB A;  1Y8P B;  2XIW A;  3W2D A;  1PA6 A;  2R7Z H;  5TSS A;  1DD2 A;  1CKO A;  2BH8 A;  3D0F A;  1SFO H;  1NR2 A;  5I2X A;  5CV9 A;  4DK0 A;  3CCE A;  3MAQ A;  3J81 c;  3PO3 H;  2VS1 A;  5JOB A;  1VQ5 A;  2GA4 B;  2RHQ B;  4ULL A;  3RR5 A;  4X62 Q;  4DV5 Q;  5G3L D;  1IYU A;  1U4R A;  4C1N I;  2I5M X;  2AHO B;  1LTT D;  1PXU A;  1B70 B;  4LWC A;  1TKW B;  5C0X G;  1D6E C;  2IX1 A;  3HRZ C;  3HKZ B;  1LTB D;  1KLU D;  1VS0 A;  4BBS B;  4DR4 Q;  4DR1 Q;  1KAW A;  5IYC H;  1JMC A;  3GTK B;  1RKN A;  3T13 A;  3CPW A;  1NUC A;  1EUJ A;  2AUK A;  1D5X C;  2ATW A;  2F0W A;  1BCP D;  3U4V A;  4XQN A;  1X3G A;  1LT4 D;  4B3M Q;  1B9M A;  4RA8 A;  4IUU A;  3WWV A;  2SDF A;  4HSV A;  5CBA E;  1CSP A;  1MI2 A;  3KK7 A;  1A15 A;  3FHW A;  1KNE A;  2DUD A;  3AFQ A;  3NK9 A;  5E7N A;  4APV A;  4ZK9 B;  2B3G A;  4CKC A;  5IGF A;  1EZ8 A;  1QE6 A;  1KQS A;  1YJN A;  1VQA A;  3A5Z B;  4MNO A;  4R9W A;  2R7D A;  1HH2 P;  5M3F G;  3OYY A;  3T1Y Q;  1GJX A;  3M4Q A;  3J7A 5;  4A3E B;  1N34 L;  3FKI G;  4FYD A;  1DOL A;  1MJC A;  1SE8 A;  2OEO A;  5D14 A;  3EFX D;  2ZTC A;  1ICF B;  3IAY A;  1W6K A;  2L15 A;  4OO1 I;  5C4Z A;  4HAE A;  1HNW Q;  5D65 A;  2C9O A;  1L1O A;  1RIP A;  4K0K Q;  1UE5 A;  1Q7Y C;  2PQE A;  1SJH D;  1FVI A;  2CWP A;  4XIG S;  4RCN A;  4GN3 B;  3UDX A;  5IT9 L;  1HPC A;  1W3S A;  1L1O B;  3AFP A;  3LWE A;  2VUM G;  1K0S A;  4DK1 A;  3AB9 A;  1I4X A;  1X54 A;  3A56 A;  4JI2 L;  4UY8 C;  4RKL A;  1SJE D;  4G7Z C;  1D8L A;  1DM0 B;  3W1B A;  3TP6 A;  2JA9 A;  4LF7 L;  1F2L A;  5C5M A;  2G9D A;  1YNJ D;  3VYR A;  1SR3 A;  2XWB B;  5KEE A;  1GKH A;  3S24 A;  3GTJ H;  1MHW C;  3GTG B;  3J81 L;  1PV4 A;  2WV6 D;  3WDN A;  4A3I H;  4GN4 B;  1ASZ A;  2JA5 B;  3V2T A;  2EY5 A;  4A93 H;  4BA1 I;  5IIF A;  3SVM A;  5EKK A;  1ZXT A;  4KK7 A;  2A68 D;  1DGS A;  4A3F B;  3OW7 A;  3A7L A;  1M90 C;  2BH2 A;  1LYL A;  1SRO A;  1KAB A;  3TN2 A;  5C3E H;  1YNN C;  1IBM L;  3NUC A;  2Y0S G;  3SR1 A;  4I7A A;  3E0J A;  4PZ6 A;  2SNS A;  4A3G B;  5EBC A;  1ET6 A;  1EOT A;  4GNX C;  4LF6 Q;  1VQ4 A;  4DV2 L;  1PRT D;  2V1C C;  4J1M A;  1ZYR C;  3D3R A;  1ENA A;  1TS3 A;  1F77 A;  1ZEQ X;  3CCS A;  1WYD A;  1VMC A;  2XSC A;  2PPB C;  3ERQ A;  1VCI A;  2VW9 A;  2KUM A;  1S5D D;  1U4L A;  1CZW A;  3K5N A;  1B2T A;  3S17 B;  1A62 A;  4YY3 L;  4KHP L;  3KDF A;  4V0B A;  4N8X 1;  5DM6 3;  2F0P A;  1G29 1;  4AH6 A;  3URY A;  1HTP A;  4P72 A;  1FL0 A;  2R61 A;  1PTO C;  3HOZ B;  3KDF B;  4KV6 A;  2Z8L A;  4OX9 Q;  3HKZ E;  1N32 Q;  1RJT A;  4P71 A;  1VQJ A;  3OWE B;  3GTL B;  4X3S A;  4PZ8 A;  3STB D;  2JA5 G;  2K04 A;  1WD0 A;  4TKO B;  2EVB A;  1B3Q A;  1YEZ A;  4DV3 L;  2K03 A;  3A7A B;  1A0I A;  1B50 A;  3KF6 A;  2WAQ B;  4IUV A;  3FPU B;  4DUZ Q;  3RN2 A;  3F1Z A;  4HCS A;  3JC6 6;  4GN5 A;  4FF2 A;  1TWF B;  1XNR Q;  1AE3 A;  2CQA A;  1N9W A;  4GLA C;  2LSS A;  1L0Y B;  4K5X A;  1VQK A;  5LMN W;  2N8N A;  1WCM H;  4ID6 A;  2KEC A;  1VDZ A;  4BWG B;  2MO1 A;  1WTX A;  1E1O A;  1FGU A;  4IN3 A;  3TDQ A;  1E1T A;  1SAP A;  4C2M B;  3UI2 A;  1FNU A;  1ILQ A;  4ZQ3 A;  4A3K B;  1BNZ A;  4GS3 A;  4OEL B;  4ZYS A;  4AQY Q;  1CUK A;  3HOZ H;  3J81 i;  2SEB D;  1L0X B;  1EEF D;  1SEB D;  1VQC A;  2HQE A;  5GAG C;  1BO0 A;  1TWA B;  4N8F A;  1HFG A;  2EXZ A;  2I07 B;  2CVR A;  2IHF A;  1T9H A;  4K2K A;  1QWY A;  2QGQ A;  4EQP A;  3NBH A;  2CHB D;  5FO8 B;  5FLX E;  4B3S L;  5DLQ E;  1STG A;  1IBK L;  1DON A;  4IAL A;  3HOY H;  2KCC A;  2FFK B;  2NZH A;  2F0D A;  1N33 L;  5C4J H;  2A19 A;  2R93 G;  2F0H A;  1II3 A;  2D2C C;  4L5T A;  2VZA A;  1JR0 D;  1YHA A;  4WRD A;  1LUZ A;  5CV7 A;  2OTL A;  4JBM A;  1K3B C;  2IHE A;  1I5F A;  4GNX A;  1WTV A;  1N36 Q;  3K6O A;  1I4G A;  5C3W A;  2E8G A;  4PMW A;  3RNU A;  4GNX B;  4BBR G;  2CW0 D;  4F7X A;  2F0U A;  2K28 A;  4YWM A;  2UU9 L;  3VYU A;  2KQ3 A;  4OO1 G;  1EIH A;  1CHP D;  3Q6S A;  3S14 B;  3W3A A;  3KYH C;  3HOV B;  1HNZ Q;  4TQU S;  2JA6 H;  4KLK A;  4G7O C;  2K50 A;  5M5Y B;  5BR8 Q;  4RHS A;  3M4Y A;  5HGT A;  3ND9 A;  1XPO A;  2RSO A;  3MFG A;  4CKB A;  3L2P A;  1SMY D;  2LS0 1;  1T5E A;  5ELC A;  4B3T Q;  4DUY Q;  5IP7 G;  5L37 A;  4A3K G;  1PTO B;  4L63 B;  4A3C H;  3EA6 A;  4JBK A;  2JYO A;  1XJV A;  1QVF A;  1O7I A;  2ZT9 C;  1VQD A;  2PNH A;  2FIN B;  5M5W H;  1FJG L;  2X69 A;  4JI4 L;  5EKI A;  4UHV A;  1D1K A;  4IUP A;  1VF5 C;  1B1Z A;  3P1H A;  1KXL A;  1STY A;  2KHJ A;  1K3R A;  1C9O A;  2F0F A;  1EFI D;  1FNV A;  1I4P A;  1Q86 C;  2B39 A;  5I6Y A;  3VDY A;  4IPH A;  1B7Y B;  4X66 Q;  1XNQ Q;  5KNB A;  1Y1V G;  2WB1 G;  3HOW B;  1HUN A;  3X3M A;  4FXG C;  1K8O A;  2GVA A;  2F1M A;  5GAE C;  1LM0 A;  2NVX B;  4MTN A;  1KDC A;  3OIQ A;  4L8J A;  3F2B A;  5CYU A;  4LMQ D;  2JA7 G;  2JA8 H;  2EJG C;  2HIX A;  2Q8I B;  5FJ8 G;  1GO3 E;  2QF7 A;  3OIP A;  4DV0 L;  2UUB Q;  4IFD H;  1WI5 A;  1S3O A;  4JVZ A;  2OCE A;  2X6G A;  4WJ3 M;  4HJ5 A;  4ALP A;  2B63 H;  1WTH A;  2WAQ E;  5IP9 G;  3DEP A;  5C4X G;  5IGB A;  3OTO Q;  3QIA A;  2PCF B;  1AZP A;  2ZM6 Q;  4HJ8 A;  5IGD A;  4JOI A;  2E5L L;  3HOV G;  4HJ7 A;  4A3B G;  3RLN A;  1G91 A;  4EGV A;  1JJC B;  1TWH B;  4V19 0;  4OEM B;  1Q8I A;  3TZU A;  1EIG A;  2NN6 H;  3DWQ A;  3J81 E;  1TY0 A;  1V9P A;  2YTX A;  5LL6 X;  4DR6 Q;  1FNW A;  3NEN A;  3BVG A;  4KI0 A;  4XXE A;  4RKB A;  4FF4 A;  4KN7 C;  1Y1W B;  3P7J A;  2BA0 A;  1A2U A;  5IGC A;  3AQQ A;  3AU7 A;  1X3E A;  1MD2 D;  3MC0 B;  3J7A F;  4G4K A;  4LJZ C;  1F9R A;  2NVX H;  1EU4 A;  2K05 A;  1EYA A;  4QUC A;  3BDL A;  1SNC A;  3DLL A;  4RFB A;  4DR2 L;  4KD3 A;  3PO2 B;  4K6D A;  4P75 A;  2A6E D;  5LMN L;  1YBY A;  3NTI A;  4FVM A;  1SNM A;  4GLV B;  2OWO A;  3F2C A;  3MXN A;  3CCJ A;  1AE2 A;  4X6A H;  2B8G A;  3HOW G;  4FF1 A;  1EYG A;  3IKJ A;  3HOU H;  1E2Z A;  4FXD A;  4Y52 H;  3MXN B;  3R2I A;  1JWU D;  1PH5 A;  2KHI A;  3S16 H;  4YHH L;  1OXU A;  2K5Q A;  3CKI B;  3RD4 A;  1SYG A;  3I4M G;  4DV1 Q;  1HXY D;  4JI8 Q;  3LWU A;  3HOX H;  2PZW A;  4K8J A;  1VQ6 A;  1VMP A;  2PI2 A;  1MIU A;  1MKH A;  1PHJ A;  4X65 L;  3CXC A;  4UP8 A;  4DR5 Q;  3T1H Q;  3C46 A;  2SOB A;  1KRT A;  3S1M B;  5ELO A;  4J15 A;  4A3D G;  5FK9 C;  4C3I H;  4BY7 B;  3SGI A;  5K36 G;  1HQM C;  3S15 B;  3MTS A;  3I72 A;  1STB A;  3M7G A;  5C44 B;  3VYS A;  3CC2 A;  1SMX A;  1UNS A;  4DV4 L;  2K5V A;  4WJ4 A;  5J3B A;  2R92 B;  3GO5 A;  4TVA B;  5IYB H;  3K7A H;  5AJ3 L;  3CMA A;  4LF9 Q;  2L5T A;  4E6I A;  2EJF C;  4JPB W;  2PZU A;  1B4O A;  3GTQ B;  4MIU A;  1VQO A;  5CMD A;  3ERO A;  4RMF A;  1PFB A;  1A63 A;  3TME A;  1XMO L;  3CCV A;  2H1E A;  3J7A V;  1KC8 C;  3SK4 A;  4A3M G;  3S1M H;  3HZX A;  1LAB A;  1Q1B A;  1ASY A;  3P20 A;  1Y8O B;  2KED A;  4BY7 H;  4KY5 A;  1K0R A;  4DR4 L;  3I90 A;  4I65 A;  3S15 H;  3GTM H;  4R4I A;  3VA7 A;  3UDI A;  2DN8 A;  3GTP H;  5C44 H;  1UUP A;  3A8I E;  4L5Q A;  3Q0A A;  4WJW A;  2VY3 A;  2R92 H;  2EY2 A;  1BVS A;  2VL6 A;  2B2T C;  3C1E A;  3GV6 A;  2NBF A;  3SDZ A;  5FOB B;  3NQT A;  4CBV A;  4R1J A;  2A74 C;  2RBM A;  2HUG A;  4Y7N B;  4JI5 Q;  2PO4 A;  2K7V A;  2ENB A;  2PNR C;  3GTQ H;  2K32 A;  1UEA B;  2RCF A;  2YYZ A;  4ME5 A;  4LF5 Q;  1W2B A;  1YZ6 A;  2F0V A;  1LT6 D;  3RMH A;  3PF5 A;  3G48 A;  1DCZ A;  3I7F A;  2B2U A;  1JB7 A;  1OXS C;  3VR4 A;  2O2L D;  1HRJ A;  5E4X A;  1HNW L;  3NXW A;  2L1B A;  3BZC A;  2EXD A;  2K5H A;  5M3F B;  3BVM A;  1BQQ T;  3B6Y A;  3AEV A;  1MGS A;  2K1B A;  3FKI B;  3M4O B;  3W5O A;  2ES2 A;  4N9P A;  4ABN A;  1NSN S;  2LMC B;  1KIX A;  1I50 B;  3S2D B;  3DWP A;  3RUZ A;  4FDB A;  4YIJ A;  4B08 A;  4S3S A;  4K2L A;  1EYD A;  2AWO A;  1EY5 A;  2CCZ A;  4PV1 C;  2EZV A;  1WTW A;  1S5B D;  5C6A A;  4LFA Q;  1CT1 D;  3H15 A;  1SNO A;  2VUM B;  2B2W A;  2Q2U A;  3NHH A;  3CCU A;  3H3V H;  2ID0 A;  1GD7 A;  2F0L A;  1EWI A;  4H7B A;  2PZT A;  3F2U A;  3X3N A;  5FO9 B;  3ICE A;  4JI1 Q;  5M3F H;  1CM9 A;  3R8B A;  2PI2 E;  4C3H H;  2Z0S A;  2Z6B A;  2HCI A;  5A2Q L;  4EQ5 A;  3CQZ B;  1HR0 Q;  2L55 A;  5IYD H;  3TSS A;  1WFQ A;  2OQ0 A;  1E24 A;  1EY9 A;  2F0S A;  2BE5 D;  1T5X D;  3GP7 A;  3J7Z C;  1X3Q A;  1C0A A;  2IX3 A;  3U9S A;  4YCW A;  3S1N B;  2C5C A;  1NJI C;  4R8I A;  1NY4 A;  3SK5 A;  3TRZ A;  4BXX H;  2Z6K C;  1NAP A;  2A6H C;  3PO3 G;  2IL8 A;  4AYB G;  2Q2H A;  2VXW A;  2Y0S B;  3ULJ A;  1BUV T;  2NWG A;  1LTG D;  3CW2 C;  2F0I A;  1ENF A;  1SMY C;  1R9T B;  4WOR A;  1KNA A;  3QWN A;  3KFU A;  4KHV A;  3DWA A;  1RL2 A;  5FO7 B;  1VQ8 A;  5E3F A;  4HMI A;  1NE3 A;  2Q2T A;  1RTN A;  4BBS H;  1H95 A;  2IT1 A;  3I4N G;  1O7L A;  4GKJ Q;  4A76 A;  4UP9 A;  1EY4 A;  5IYC G;  3GTK H;  4EQO A;  3N6R A;  2KVM A;  3CQZ H;  4M1U B;  4IQZ A;  1BKB A;  2F0O A;  4ODG A;  1JCK B;  2FXQ A;  3M7N A;  4LFC L;  4HIO A;  1DOM A;  1W6J A;  1HZA A;  4DNR B;  2EPB A;  4R4Q A;  4DUZ L;  2WIN B;  1O7Y A;  2RDG A;  5ISR A;  3QB3 A;  4HJA A;  5M5X B;  1XNR L;  1TS4 A;  4DK6 C;  1D5Z C;  4O0A A;  2HDL A;  2CQO A;  3AYH B;  5A35 A;  5JJL A;  1TII D;  1KAA A;  2CH4 W;  1I6H B;  1HJP A;  4JC0 A;  4NXN L;  4A3E H;  2E2J H;  3KBG A;  1VQG A;  1SSO A;  4JI6 Q;  1S72 A;  3WOF A;  1TT2 A;  1B9N A;  1BBU A;  1LLR D;  4MTK A;  1K9M C;  4AQY L;  3E9I A;  1XWE A;  4O1N A;  1DJR D;  2J0T D;  1NTG A;  2VB2 X;  4DNT B;  3DEO A;  1PFS A;  1U4M A;  2UUA Q;  4RGN A;  5CR3 A;  1YHB A;  1LTA D;  1STE A;  1XTC D;  1SRU A;  4HN7 A;  3PUV A;  1CFM A;  4H0L C;  2ASB A;  2JJQ A;  1QUQ A;  2MUY A;  1PH1 A;  1LT5 D;  1Q1E A;  1A3V A;  5J39 A;  4X64 Q;  5FLM H;  1V1O A;  3K5M A;  1S5E D;  2XWJ B;  1GHJ A;  1QUQ B;  4TRD A;  1EIY B;  5M5X H;  1AFP A;  3D4D A;  2VQE Q;  4DN4 M;  3GTG H;  1TWG B;  3F8T A;  1YJW A;  2ZXP A;  4A3I G;  4JG2 A;  1P16 A;  2JA5 H;  1B53 A;  3V05 A;  4R4O A;  2F0N A;  1UE1 A;  5EGT A;  1IL2 A;  4JI3 L;  3MEF A;  1N36 L;  4A93 G;  4CDF C;  3D4R A;  1MSG A;  1C7Y A;  4JI0 L;  4DR7 Q;  3I2Z A;  2D0P A;  1IYJ B;  2B8F A;  4A3F H;  2A6E C;  1IKM A;  1OXV A;  2R93 B;  2L0C A;  2NYZ D;  4CDC C;  2HHH L;  4POG A;  2K5N A;  5C3E G;  1ESR A;  2AUJ D;  3HGB A;  1S40 A;  2EJM A;  1WTR A;  1KLG D;  1SN8 A;  2F0K A;  2PYK A;  2CWA A;  4QL5 A;  1JOQ A;  5JJI A;  5JPM C;  3K5O A;  5CBE E;  3L3O C;  4DGZ A;  4A3G H;  1BDO A;  4IOC A;  4K8I A;  3BS1 A;  4QB4 A;  1FGB D;  3PF4 A;  4O2D A;  4BBR B;  4IFD I;  1QJO A;  2ZJQ A;  1QB5 D;  2E2J B;  2UUC Q;  4Z9C B;  2N55 A;  3HKS A;  4KY7 A;  2K33 A;  3RZD B;  3OMG A;  4IPG A;  1Q82 C;  1SNP A;  4NP5 A;  2AQ3 B;  5T1I A;  5JJZ A;  3M85 A;  3H09 A;  2EY1 A;  1EY8 A;  3S17 H;  2F3V A;  4Q0F A;  1VQM A;  4CGY B;  2NN6 I;  1H9R A;  2Y0S E;  1QVC A;  3QG1 A;  5ELF A;  2R93 H;  2O5I C;  2QEX A;  1M8A A;  3H0G G;  4YWL A;  4R8N A;  4KTA A;  4X66 L;  1M1K C;  1XNQ L;  5K5P A;  4AIM A;  2MJ8 A;  1XYI A;  3GTL H;  1F9S A;  5KIX A;  4IOA A;  2B2Y C;  4NKL A;  5BN5 A;  1VQ9 A;  5JVH 3;  2OF1 A;  1PH7 A;  1D2B A;  1QG7 A;  5HGQ A;  2RKS A;  3U9O A;  1V1Q A;  3M9B A;  4XDX A;  3PIO 3;  3H91 A;  3TBI B;  1AEX A;  1TWF H;  3OOC A;  2E74 C;  1Y1V B;  2WB1 B;  3HP3 A;  2I46 A;  1IBM Q;  2EYM A;  1SND A;  4L5S A;  1WCM G;  3OTO L;  1D7Q A;  1EY6 A;  3RLO A;  5JVG 3;  4C2M H;  4RWS C;  3CAM A;  1HQR D;  2EY6 A;  4CDE C;  1CTM A;  2JA7 B;  2R7F A;  3ER0 A;  5IP7 H;  1N8R C;  4B3R Q;  1F2M A;  2DY7 A;  3MXG A;  4A3K H;  4DV2 Q;  1H9M A;  1CSQ A;  1NMF A;  1Z9F A;  4DR6 L;  3EN2 A;  2QA4 A;  1G6P A;  1TWA H;  1I4R A;  5C4X B;  2NVQ B;  2F52 A;  2OTJ A;  2PMZ B;  2HCC A;  2MGS A;  2EYH A;  1SYF A;  1WTO A;  3CME A;  5ELD A;  1L2F A;  4A3B B;  4BA2 I;  2G9H D;  2ALY B;  2RF4 A;  4KHP Q;  1QOH A;  3ITP A;  1JOK A;  1LO5 D;  4IFD J;  1VQE A;  1CKM A;  3S9W A;  2QDB A;  3HOY G;  3NEL A;  2HIV A;  5A2Q E;  4NW2 A;  2UXB L;  4DK3 C;  4N9T A;  1DXM A;  4DXG A;  1K83 B;  1HR0 W;  1IXR A;  4JYA Q;  2KEN A;  1E0B A;  1QCB D;  3NTK A;  2Z1C A;  1X3F A;  3VR2 A;  3V96 A;  3TQY A;  5H1S E;  4GLX A;  1JIC A;  2FMM A;  2JEB I;  1XMQ L;  2K52 A;  2JA7 H;  1WTQ A;  2XGT A;  5FJ8 H;  1ESF A;  1KD1 C;  1VQP A;  3UDF A;  4DV1 L;  3I8Z A;  4JI8 L;  4RGM A;  1I6V C;  2AQ2 B;  2RDH A;  2XRS D;  3S1R B;  4JBW A;  1EQT A;  1B44 D;  1YHQ A;  3S14 H;  2E2I B;  4OON A;  3T1H L;  4DR5 L;  2L4N A;  3HOV H;  2I5L X;  2JA6 G;  1TQO A;  4HJ9 A;  1IHZ A;  2EQS A;  3MZ5 A;  5HUR A;  1JJ2 A;  5M5Y H;  4LF8 Q;  4HIK A;  1QNK A;  4G7H C;  2QW7 A;  3O13 A;  1EZ6 A;  4DNI A;  2Z4H A;  4DV7 Q;  3HS0 C;  3I4M B;  1GHK A;  1PH3 A;  2YU9 B;  1PTO H;  3VR5 A;  2PW7 A;  5I4D A;  3PMF A;  1J5E Q;  5KYI A;  1HNX Q;  1GUG A;  1LTR D;  3OWF A;  5IT9 E;  1EFW A;  2B2Y A;  2FHT A;  1QZG A;  2V4D A;  2L11 A;  3GDE A;  2ICE C;  1EWH A;  4A3D B;  1DZ1 A;  2KBN A;  2NB0 A;  3L0O A;  4B3S Q;  3RZO B;  1KL9 A;  4KJN A;  5EQ0 A;  3BDC A;  3NTH A;  4LF9 L;  2CFM A;  1PVO A;  3CPF A;  3EVQ A;  1PFN A;  1N33 Q;  1BCP C;  3G71 A;  3A5U A;  4TSS A;  3ULP A;  1SBB B;  4HR7 B;  3OPO A;  5LHY 1;  4EX5 A;  2LY7 A;  2E2I H;  2TMP A;  4DA2 A;  1XPR A;  4ZLT F;  4KKT A;  3HOW H;  3BG3 A;  4YCU A;  5EKL A;  1YIT A;  1E22 A;  4GKK L;  2K14 A;  1TVX A;  3PIP 3;  3P75 A;  1V43 A;  2DJG C;  1E3P A;  1YI2 A;  3IL8 A;  2EE1 A;  4X3T A;  5BN3 A;  4H02 A;  1HCZ A;  2WFW A;  3G6E A;  2K75 A;  4IFD G;  3LNN A;  1G51 A;  2KOL A;  3SE0 A;  4A3M B;  1V8Q A;  2B63 G;  2BA1 A;  2ZJP A;  1EEI D;  2MP1 A;  4DAP A;  2B29 A;  4A3D H;  4QUF A;  2UXD L;  4DXF A;  5IGE A;  2AKW B;  4UPA A;  1UE6 A;  5IWA Q;  1A6X A;  2NVY B;  3D6W A;  1JWS D;  2WB1 E;  1TWH H;  4ZRZ A;  3W1G A;  4QQB X;  4JI5 L;  1BF4 A;  2A8V A;  3T16 A;  1PTO D;  2BOS A;  5M3M G;  2JXM B;  1CA6 A;  4A4I A;  3L9A X;  3K57 A;  3H3V I;  2VNU D;  1V1P A;  1WD1 A;  1Y1W H;  1I3Q B;  2XRQ D;  2Z4I A;  1YNJ C;  4FP5 D;  4HCE A;  4J6H A;  5KGU A;  3K81 C;  4WFN 3;  1RHP A;  2EIF A;  2R3Z A;  5LMU Q;  2JN4 A;  1V1P B;  1X32 A;  4JI7 Q;  1IBL Q;  1VQF A;  2PMZ E;  4BY1 G;  4UAI A;  4DPG A;  3TS2 A;  3PO2 H;  3MWY W;  3PUY A;  2F4V Q;  2D0O A;  4IUQ A;  1Z47 A;  2QEJ C;  1IW7 D;  2GVB A;  4B9X A;  3NBI A;  4A3M H;  5FLX c;  5GAD C;  2A68 C;  3K80 C;  3R3O A;  1SXT A;  1OXX K;  3HOU G;  2B2V C;  4IUR A;  1P8L A;  3T51 B;  5BN4 A;  4A3L G;  3M3Y B;  2P5Z X;  4C3J G;  4YWK A;  4LFA L;  1TY2 A;  4PZ7 A;  4NDX A;  1RF2 D;  3HOX G;  4RAU C;  1JOR A;  4IJL A;  1J9O A;  1GUS A;  2F4I A;  1TWC B;  3NSW A;  4X62 L;  4ILW A;  4DV5 L;  1EY0 A;  3ZJY C;  4DAY B;  1RTO A;  1X6O A;  3CCL A;  2PQA B;  1KDB A;  1CK1 A;  2QKI C;  5DNF A;  1PRT C;  4BS9 A;  4C3I G;  3NP8 A;  4DR1 L;  4JI1 L;  2LKV A;  3OSO A;  1HUM A;  2PW5 A;  5CV8 A;  1H9K A;  1BXT A;  1I4Q A;  3FP9 A;  1E2W A;  1BCP B;  2F0G A;  2KA7 A;  1AW7 A;  4NXM Q;  3IFT A;  4B3M L;  3RLF A;  3KJP A;  1X56 A;  1PZI D;  1Q81 C;  5IYB G;  1G2T A;  4KKS A;  3S1Q B;  5KRU A;  3Q23 A;  1WVL A;  4QCL A;  1C4Q A;  4A3J G;  5F2D A;  3K0Y A;  5JEA H;  1K28 A;  3T1Y L;  2QIL A;  5LMN Q;  1JC7 A;  4LUZ A;  1GUN A;  3STB C;  3CU7 A;  1JB3 A;  4I7Z C;  1R4Q B;  2RVL A;  1FR3 A;  5C3X A;  2JP1 A;  3JAM c;  3OHX C;  4KKU A;  4LF4 Q;  1RDP D;  3PIO A;  4NB3 A;  5GRO A;  4GKJ L;  1Q12 A;  4PG3 A;  4X3K A;  1STN A;  3KBX A;  4K0K L;  3PO3 B;  5E1F A;  3D4W A;  4AYB B;  2XVS A;  1AH9 A;  2MQH A;  4U68 A;  2WKD A;  3U50 C;  3Q22 A;  2XN9 C;  1U0L A;  3SHL A;  3NWT A;  4CKE A;  5C0X H;  4HED A;  3SK6 A;  3I4N B;  1WOC A;  1BBW A;  4GZY C;  4Y7N H;  1UE7 A;  1STH A;  2N78 A;  1JT8 A;  1IZ6 A;  2D62 A;  4KMU C;  1AP0 A;  4DV6 Q;  5NUC A;  3CC4 A;  2KCN A;  1U9R A;  3K0X A;  2LFN A;  4KY6 A;  5J22 A;  2H4O A;  3U58 A;  3BYY B;  3I56 A;  2A69 D;  3DHQ A;  3UE1 A;  5J1Z A;  4O42 A;  3J80 c;  2VQF Q;  4JI6 L;  1A8V A;  4RH6 A;  1F2Y A;  2JQO A;  5AJ3 Q;  1ILP A;  1F9Q A;  1GOZ A;  1O80 A;  2RCN A;  1VF7 A;  4NMZ A;  3DXJ C;  3OMC A;  3T56 B;  1F9P A;  5ELB A;  1XMO Q;  2UUA L;  3FKI H;  3AMU A;  3BVZ A;  3M4O H;  1UEB A;  4DFA A;  1I50 H;  3EBE A;  4DR3 Q;  3C2P A;  1WJJ A;  3S2D H;  2RSN A;  3NE5 B;  4CDD C;  1PYW D;  3R93 A;  1DYQ A;  2EYJ A;  3C3L A;  2CW0 C;  4X64 L;  4LF6 L;  3I4N H;  1PRT B;  2R7Z G;  1Q3L A;  1HA6 A;  1NMG A;  1X65 A;  1ICW A;  2JSO A;  3LGJ A;  1KDA A;  2VQE L;  2MO0 A;  3G4S A;  1X9N A;  3BJU A;  5KND A;  2VUM H;  4RG1 A;  5M9O A;  4CJ1 B;  1S5F D;  2B2T A;  4MN3 A;  1Y14 B;  2F0E A;  3K8A A;  4XT1 B;  3A0J A;  1PTO F;  1TXY A;  1I4H A;  4DR7 L;  3JAM L;  1EOV A;  2C35 B;  2L12 A;  4XYQ A;  1FD7 D;  5FKA C;  2F3I A;  2OXP A;  4OIJ A;  3A8K E;  4KD4 A;  4LFB Q;  4ME3 A;  2JEA I;  4OX9 L;  3GTJ B;  1SYB A;  4C3H G;  1N32 L;  2UXC Q;  4A3I B;  2ZTE A;  5IYD G;  5ELE A;  3OW2 A;  3TEH B;  1YIJ A;  4A93 B;  3UDG A;  1OO9 B;  1X3P A;  2RHS B;  2NTT A;  2G5D A;  3S1N H;  3IRB A;  3TRE A;  4DU9 A;  4JV5 Q;  5JJK A;  1IL8 A;  3WOE A;  2E2D C;  2F03 A;  2UUC L;  5C3E B;  4BXX G;  1VQI A;  3CHB D;  1I94 Q;  1KRS A;  1JE4 A;  1K8M A;  1AZQ A;  1VQB A;  2A1A A;  5DEH A;  3PUW A;  3KLS A;  3T53 B;  3D31 A;  3PIP A;  2F0M A;  2HT1 A;  4UDU C;  4XYO A;  1R9T H;  3J80 L;  1GXD C;  2DNE A;  5HY6 A;  3HKZ G;  2QCP X;  4BBS G;  2L9H A;  3TP5 A;  3FEW X;  4A75 A;  2J4X A;  1J8I A;  2R6G A;  4IPD A;  4K14 A;  2HQL A;  2M9V A;  4C1N K;  2HD3 A;  1K8A C;  4AYB E;  1MBY A;  1YNX A;  1VQN A;  1D1I A;  2EYF A;  1TS5 A;  5C4H A;  2N49 A;  3E0E A;  1EQR A;  1BR9 A;  1CI3 M;  5I9P A;  1JQY D;  3H0G B;  3NQI A;  3BU2 A;  3TZD A;  1BOS A;  2NTS A;  2YTV A;  4XTC S;  1I6H H;  1NR4 A;  5IOC A;  2MFI A;  1QVG A;  2K5D A;  1HFN A;  4A3E G;  2A5H A;  3D6C A;  2I5H A;  3A54 A;  4M8A A;  3PUZ A;  4CJ0 B;  1A2T A;  2EYP A;  4B3R L;  1Y69 U;  2Z6K A;  1A3U A;  2MPM A;  4JK1 C;  3I70 A;  1S5C D;  2RDF A;  4Q5V A;  1PH2 A;  1HZC A;  1R4P B;  2JK8 A;  1PDQ A;  1SE2 A;  1XPU A;  1JOO A;  1B3A A;  1EQV A;  2K6A A;  1E2V A;  4LAA A;  5EJW A;  1GUW A;  2A73 B;  1WCM B;  5IGG A;  5JAV A;  2K01 A;  2NZ1 D;  3KLR A;  4HTH A;  1N34 Q;  1M4V A;  1HNZ L;  2DNC A;  3FMC A;  5LL6 S;  3JAM i;  4ZAI A;  5BR8 L;  4G57 A;  1B8A A;  1PH6 A;  4OGQ C;  3QR8 A;  4NPS A;  4B3T L;  1PH9 A;  4K5V A;  4DUY L;  2ZTD A;  4KN4 C;  3J7Y W;  5FLM G;  2EOT A;  2WKC A;  4OWX B;  5EBD A;  3H0G H;  3PCO B;  5KNC A;  1YJ9 A;  3MVV A;  2XNA C;  1U4P A;  4JYA L;  1TWG H;  1H9J A;  1RCV D;  3J81 j;  3ND8 A;  4XQJ A;  5GAH C;  2JE6 I;  1BBX C;  4JI2 Q;  1OTC A;  1Z6H A;  4LFC Q;  1SYC A;  1ROD A;  1D5M C;  3U4Z A;  4LF7 Q;  1IYV A;  5IOD A;  2NUC A;  3HOY B;  4OIK A;  4RCO A;  1IW7 C;  4A3F G;  4L6T B;  5C4J B;  1VQL A;  3VR3 A;  3KF6 B;  1XX8 A;  2RQX A;  1ET9 A;  2OT2 A;  4NXN Q;  2QDL A;  3J80 i;  3I4O A;  2BDO A;  4RGT A;  4QY7 A;  4LF8 L;  4IJH A;  2YTY A;  5G3L F;  2M00 A;  2K5W A;  4DV7 L;  4LNQ A;  4A3G G;  3H6M A;  4BBR H;  3CRL C;  2FMC A;  1Z7T A;  1J5E L;  1HNX L;  2LXJ A;  4LUV A;  4OO1 H;  4C56 C;  4FNF A; 
#chains in the Genus database with same CATH homology
 4LF7 L;  1E22 A;  4LF5 Q;  4GKK L;  2K14 A;  2GN5 A;  1K8G A;  1W2B A;  1YZ6 A;  1V43 A;  3RZD H;  4DAM A;  1SR3 A;  3PSI A;  1E3P A;  1YI2 A;  3PF5 A;  2YV5 A;  3G48 A;  2ZM6 L;  3I7F A;  1GKH A;  1JB7 A;  1OXS C;  4H02 A;  3S24 A;  4GOP C;  3GTJ H;  4L5R C;  2WFW A;  3G6E A;  1KHI A;  2K75 A;  1HZB A;  4POF A;  4IFD G;  1PV4 A;  4A3I H;  4GN4 B;  4JOI C;  3NBH B;  1ASZ A;  1G51 A;  1HNW L;  2B63 G;  3KOJ A;  3BZC A;  3CCR A;  2BA1 A;  2EXD A;  2K5H A;  4BA1 I;  2ZJP A;  4A93 H;  2B29 A;  3B6Y A;  3HOZ G;  4A3D H;  2UXD L;  2AKW B;  3AEV A;  4UPA A;  1UE6 A;  5IWA Q;  3CCM A;  1DGS A;  3DM3 A;  4MZ9 A;  2WB1 E;  3W5O A;  1TWH H;  3W1G A;  2ES2 A;  4QQB X;  4JI5 L;  1M90 C;  2BH2 A;  1KIX A;  2A8V A;  1LYL A;  1SRO A;  4FDB A;  4YCV A;  5C3E H;  3RN5 A;  4JI3 Q;  4YY3 Q;  5M3M G;  2AWO A;  4A4I A;  1IBM L;  2CCZ A;  4JI0 Q;  3H3V I;  3A74 A;  2VNU D;  1Y1W H;  2Y0S G;  2WAQ G;  3K81 C;  4HID A;  4LFA Q;  2EIF A;  4PZ6 A;  2HHH Q;  5LMU Q;  3H15 A;  2Q2U A;  1Y1V H;  4GNX C;  3UE0 A;  1L0W A;  4LF6 Q;  5IY0 A;  1VQ4 A;  1VQF A;  1IBL Q;  4DV2 L;  4JI7 Q;  2OQK A;  2PMZ E;  4BY1 G;  2V1C C;  3GD7 A;  4DPG A;  3TS2 A;  4KHP L;  3PO2 H;  3CCU A;  1CKN A;  3PUY A;  2F4V Q;  5IWA L;  3H3V H;  2ID0 A;  2D0O A;  1Z47 A;  2GVB A;  2MNA A;  1GD7 A;  4DV3 Q;  3CCS A;  1WYD A;  1EWI A;  1CKN B;  1VCI A;  2VW9 A;  4A3M H;  5FLX c;  5GAD C;  1VQ7 A;  3ICE A;  4JI1 Q;  5M3F H;  1PYS B;  2PI2 E;  3K80 C;  4JCV E;  1A62 A;  4C3H H;  2Z0S A;  3M4P A;  3KDF A;  4R4T A;  1U5K A;  4YY3 L;  4EQ5 A;  3CF5 A;  4IO9 A;  1K73 C;  1HR0 Q;  5IYD H;  1G29 1;  1WFQ A;  1OXX K;  1E24 A;  2OQ0 A;  4AH6 A;  3HOU G;  5IP9 H;  4P72 A;  2N3S A;  1FL0 A;  5C4X H;  1P8L A;  2XTI A;  3J7Z C;  2NVQ H;  4A3L G;  1C0A A;  3KDF B;  4YWK A;  4LFA L;  4YCW A;  5LMU L;  4OX9 Q;  4A3B H;  4PZ7 A;  3HOX G;  1HZ9 A;  3L7Z C;  3HKZ E;  1N32 Q;  4IJL A;  4JI7 L;  1IBL L;  1NJI C;  4X62 L;  4P71 A;  1VQJ A;  4DV5 L;  1NY4 A;  3TRZ A;  3ZJY C;  4DAY B;  4BXX H;  4PZ8 A;  3CP0 A;  1X6O A;  2Z6K C;  3STB D;  2JA5 G;  2PQA B;  3CCL A;  2F4V L;  1JJG A;  4A3C G;  1YEZ A;  4AYB G;  4DV3 L;  3PO3 G;  2Q2H A;  2ZJR A;  3GTO H;  1K83 H;  1A0I A;  3ULJ A;  3KF6 A;  4DUZ Q;  4DR1 L;  3RN2 A;  4JI1 L;  3F1Z A;  3CW2 C;  1UWV A;  3JC6 6;  2KCM A;  4GN5 A;  3FP9 A;  1XNR Q;  1AE3 A;  3KFU A;  1N9W A;  4GLA C;  1RL2 A;  2LSS A;  1VQ8 A;  1VQK A;  1NE3 A;  1IBK Q;  5LMN W;  2Q2T A;  2N8N A;  4NXM Q;  4BBS H;  1WCM H;  4B3M L;  1H95 A;  2IT1 A;  3RLF A;  3I4N G;  4GKJ Q;  4A76 A;  2MO1 A;  4UP9 A;  1E1O A;  3KJP A;  1FGU A;  3GTK H;  5IYC G;  1E1T A;  1X56 A;  1Q81 C;  5IYB G;  3S1R H;  3CQZ H;  1Q46 A;  1BKB A;  4GOP A;  4GS3 A;  5GQO A;  4A3J G;  4AQY Q;  1CUK A;  3HOZ H;  3J81 i;  2FXQ A;  3M7N A;  4LFC L;  1VQC A;  2DGY A;  4HIO A;  5GAG C;  3T1Y L;  5LMN Q;  1OXT A;  1HZA A;  4LUZ A;  4GOP B;  3STB C;  4IPC A;  4R4Q A;  4DUZ L;  2IHF A;  1T9H A;  3I4M H;  2QGQ A;  1GVP A;  3KF8 B;  2IX0 A;  2JA8 G;  1GM5 A;  2YU9 H;  4HJA A;  5M3M H;  1XNR L;  2UU9 Q;  4DK6 C;  3JAM c;  4B3S L;  2WP8 J;  5DLQ E;  4O0A A;  4LF4 Q;  2CQO A;  3AYH B;  1IBK L;  4NXM L;  5JJL A;  5C0X I;  3PIO A;  1HJP A;  4JC0 A;  4NXN L;  4NB3 A;  5GRO A;  3HOY H;  4A3E H;  4GKJ L;  1Q12 A;  3Q8D A;  4PG3 A;  2UUB L;  2NZH A;  1N33 L;  4K0K L;  1VQG A;  5C4J H;  2A19 A;  4JI6 Q;  2R93 G;  1S72 A;  3CC7 A;  4OWW B;  1PH4 A;  1AH9 A;  3RZO H;  2MQH A;  1YVC A;  3PV0 A;  4L5T A;  2VZA A;  1BBU A;  1YHA A;  3U50 C;  3BZK A;  2OTL A;  1LUZ A;  4BY1 H;  1VQH A;  4KHZ A;  1K9M C;  4AQY L;  3E9I A;  4JBM A;  2IHE A;  4LUO A;  1U0L A;  1J6Q A;  1I5F A;  1NTG A;  4GNX A;  1N36 Q;  4JBJ A;  2NN6 G;  4LF5 L;  2UXB Q;  2K4K A;  1PFS A;  2E8G A;  4UP7 A;  4PMW A;  2UUA Q;  1WOC A;  3RNU A;  1YHB A;  1BBW A;  1FJG Q;  5EAY A;  4GNX B;  1SRU A;  4Y7N H;  1UE7 A;  4JI4 Q;  4BBR G;  3PUV A;  4YWM A;  2UU9 L;  2N78 A;  2ASB A;  5ELN A;  1IZ6 A;  2D62 A;  3K7U C;  2JJQ A;  4LF4 L;  1JT8 A;  1QUQ A;  4OO1 G;  1PH1 A;  1XMQ Q;  2KCT A;  2YYZ A;  4DV6 Q;  1Q1E A;  3CC4 A;  4A3L H;  4X64 Q;  3K0X A;  5FLM H;  4C3J H;  3U58 A;  3I56 A;  3UE1 A;  1QUQ B;  3KYH C;  3J80 c;  4TQU S;  2VQF Q;  1HNZ Q;  4JI6 L;  1A8V A;  4KLK A;  2AMC B;  1EIY B;  5M5X H;  2JA6 H;  2K50 A;  3PGZ A;  5BR8 Q;  2VQE Q;  1XPO A;  3GTG H;  3F8T A;  2JQO A;  5AJ3 Q;  5IE8 A;  4QGU A;  3L2P A;  1YJW A;  2RCN A;  4B3T Q;  4DUY Q;  4A3I G;  4JG2 A;  1P16 A;  5IP7 G;  2JA5 H;  4R4O A;  1UE1 A;  4A3K G;  1IL2 A;  4JI3 L;  3MEF A;  1N36 L;  4A3C H;  4JBK A;  4A93 G;  1XJV A;  1QVF A;  1O7I A;  5JEA J;  2I0Q A;  2NZO A;  1XMO Q;  2UUA L;  1VQD A;  1C7Y A;  2NVY H;  4P74 A;  2PNH A;  3FKI H;  4JI0 L;  3I2Z A;  5M5W H;  2D0P A;  3M4O H;  1IYJ B;  1FJG L;  4A3F H;  4DR7 Q;  3NEM A;  3I55 A;  1OXV A;  4DKA C;  4JI4 L;  1UEB A;  1I50 H;  3EBE A;  4DR3 Q;  3TS0 A;  3CD6 A;  3S2D H;  1WJJ A;  4R4C A;  2HHH L;  1PYB A;  4POG A;  4DV0 Q;  2K5N A;  5C3E G;  4DV6 L;  2PQA A;  1S40 A;  4X64 L;  4LF6 L;  1SN8 A;  3KLW A;  4QJF A;  3I4N H;  1E7Z A;  2CWA A;  2R7Z G;  4QL5 A;  1KXL A;  5JJI A;  3ULL A;  2KHJ A;  2VQF L;  1K3R A;  1C9O A;  1I3Q H;  4OWT B;  1Y1W G;  1NMG A;  1X65 A;  3LGJ A;  2VQE L;  1Q86 C;  2MO0 A;  3G4S A;  2E5L Q;  2IY5 B;  3VDY A;  1X9N A;  3BJU A;  4IPH A;  4OXP A;  4IOC A;  4A3G H;  2VUM H;  1B7Y B;  4RG1 A;  4X66 Q;  4A3J H;  1XNQ Q;  1XTD A;  3PF4 A;  4O2D A;  4IFD I;  1Y1V G;  1Y14 B;  2WB1 G;  3HFZ B;  3K8A A;  1LTL A;  2ZJQ A;  2GVA A;  3A0J A;  5GAE C;  2UUC Q;  3PO2 G;  1NBW A;  5C0X J;  1LM0 A;  1TXY A;  3HKS A;  1HR0 L;  4MTN A;  4DR7 L;  2CKZ B;  1EOV A;  2C35 B;  3F2B A;  4IPG A;  1Q82 C;  2JA7 G;  3E9H A;  2JA8 H;  2HIX A;  2F3I A;  4DR3 L;  3M85 A;  5FJ8 G;  4LFB Q;  1GO3 E;  4ME3 A;  2JEA I;  4P73 A;  4OX9 L;  4DV0 L;  1Q8K A;  2Q2I A;  1WI5 A;  2UUB Q;  1S3O A;  1JE5 A;  3S17 H;  1VQM A;  1N32 L;  2OCE A;  2UXC Q;  4GKK Q;  2ZTE A;  4WJ3 M;  2NN6 I;  4HJ5 A;  5IYD G;  2Y0S E;  4ALP A;  1SLJ A;  3TEH B;  3OW2 A;  2B63 H;  1QVC A;  2WAQ E;  5IP9 G;  2LXK A;  1YIJ A;  3UDG A;  2R93 H;  3M3Y H;  4DR2 Q;  5C4X G;  3OTO Q;  1X55 A;  2RHS B;  2ZM6 Q;  2QEX A;  4HJ8 A;  4JOI A;  2E5L L;  3HOV G;  3H0G G;  4YWL A;  4HJ7 A;  4A3B G;  3RLN A;  4X66 L;  3IRB A;  1M1K C;  1JJC B;  1XNQ L;  3S1N H;  3TRE A;  4LW1 A;  1PH8 A;  4JV5 Q;  1TWC H;  4AIM A;  5JJK A;  3GTL H;  1EIF A;  4BXX G;  4QIW E;  3EIV A;  2UUC L;  4IOA A;  1VQI A;  1I94 Q;  1KRS A;  2UXD Q;  2YTX A;  1V9P A;  1VQ9 A;  4DR6 Q;  3NEN A;  4KI0 A;  1PH7 A;  1QZH A;  1VQB A;  2AWN A;  2A1A A;  5HGQ A;  4HIM A;  3PUW A;  4BY7 G;  2BA0 A;  4LFB L;  3AQQ A;  3D31 A;  4YHH Q;  3ERS X;  1V1Q A;  1X3E A;  3M9B A;  3PIP A;  2HT1 A;  1R9T H;  2H5X A;  1TWF H;  2UXC L;  2NVX H;  1L1O C;  5C44 G;  5HY6 A;  1IBM Q;  3HKZ G;  4L5S A;  3DLL A;  4BBS G;  1WCM G;  4DR2 L;  3OTO L;  1EQQ A;  1D7Q A;  4X65 Q;  2R92 G;  3RLO A;  4P75 A;  4A75 A;  4C2M H;  3CAM A;  5LMN L;  2R6G A;  3S1Q H;  3CCQ A;  1YBY A;  2R7F A;  3ER0 A;  4IPD A;  5IP7 H;  2E2H H;  4JV5 L;  1N8R C;  4B3R Q;  4GLV B;  2OWO A;  4A3K H;  4DV2 Q;  3F2C A;  2HQL A;  3KJO A;  3CCJ A;  2NVT H;  1K8A C;  1AE2 A;  1I94 L;  4X6A H;  4AYB E;  1CSQ A;  1NMF A;  3HOW G;  1YNX A;  1Z9F A;  5JEA G;  5IT9 c;  3PUX A;  1EYG A;  3EN2 A;  2QA4 A;  1VQN A;  1TWA H;  3HOU H;  4DR6 L;  4Y52 H;  1G6P A;  3MXN B;  1PH5 A;  4DV4 Q;  2N49 A;  3E0E A;  1EQR A;  2F52 A;  2KHI A;  2OTJ A;  3S16 H;  4YHH L;  1OXU A;  3CME A;  3I4M G;  4DV1 Q;  3F2D A;  1L2F A;  3BU2 A;  4JI8 Q;  4BA2 I;  3HOX H;  2ALY B;  2RF4 A;  1MJE A;  4KHP Q;  1PA6 A;  1VQ6 A;  2R7Z H;  2YTV A;  2PI2 A;  4IFD J;  4XTC S;  1CKO A;  2BH8 A;  1MIU A;  1VQE A;  3D0F A;  1I6H H;  1MKH A;  1CKM A;  1SFO H;  2MFI A;  3HOY G;  1QVG A;  1PHJ A;  4X65 L;  3CXC A;  4UP8 A;  3CCE A;  4DR5 Q;  3T1H Q;  4A3E G;  1KRT A;  3J81 c;  3NEL A;  5ELO A;  2HIV A;  2I5H A;  3PO3 H;  3PUZ A;  2VS1 A;  4J15 A;  1VQ5 A;  2UXB L;  4A3D G;  2RHQ B;  4C3I H;  4DK3 C;  3RR5 A;  3SGI A;  1HR0 W;  5K36 G;  4B3R L;  1IXR A;  2Z6K A;  4JYA Q;  2KEN A;  4X62 Q;  4DV5 Q;  1X3F A;  2I5M X;  2AHO B;  3TQY A;  1PH2 A;  5H1S E;  1HZC A;  4GLX A;  1B70 B;  2JK8 A;  4LWC A;  5C0X G;  3CC2 A;  2IX1 A;  1XPU A;  1XMQ L;  1SMX A;  2JEB I;  4DV4 L;  1VS0 A;  2K52 A;  2K5V A;  2JA7 H;  4WJ4 A;  2XGT A;  5J3B A;  5FJ8 H;  4DR4 Q;  1N34 Q;  1KD1 C;  4DR1 Q;  3GO5 A;  1KAW A;  5IYC H;  1VQP A;  3UDF A;  4TVA B;  4DV1 L;  1HNZ L;  1JMC A;  5IYB H;  3CPW A;  4JI8 L;  3JAM i;  3K7A H;  1EUJ A;  5BR8 L;  4JBW A;  1PH6 A;  1B8A A;  5AJ3 L;  2ATW A;  3CMA A;  4NPS A;  4LF9 Q;  3U4V A;  4B3T L;  1YHQ A;  1PH9 A;  4DUY L;  2ZTD A;  3S14 H;  1X3G A;  4OON A;  3T1H L;  4DR5 L;  4B3M Q;  5FLM G;  4OWX B;  3WWV A;  3HOV H;  3H0G H;  1CSP A;  1VQO A;  2I5L X;  3PCO B;  4RMF A;  4HJ9 A;  2JA6 G;  2EQS A;  1A63 A;  1YJ9 A;  1XMO L;  3FHW A;  5M5Y H;  3CCV A;  4HIK A;  2DUD A;  3W1B A;  1JJ2 A;  3AFQ A;  4LF8 Q;  5E7N A;  4DNI A;  1KC8 C;  4APV A;  1TWG H;  4JYA L;  2B3G A;  4DV7 Q;  3J81 j;  1PH3 A;  1KQS A;  1YJN A;  5GAH C;  2JE6 I;  1VQA A;  4A3M G;  3S1M H;  4JI2 Q;  1J5E Q;  1HNX Q;  3A5Z B;  4MNO A;  1OTC A;  1Q1B A;  2R7D A;  4LFC Q;  1HH2 P;  5M3F G;  1ASY A;  3OYY A;  3U4Z A;  3T1Y Q;  4LF7 Q;  4BY7 H;  3M4Q A;  1K0R A;  1EFW A;  3J7A 5;  4DR4 L;  1N34 L;  3FKI G;  1QZG A;  1MJC A;  1SE8 A;  3S15 H;  4A3F G;  3GTM H;  4R4I A;  3UDI A;  1VQL A;  3GDE A;  3GTP H;  2KBN A;  2ZTC A;  3L0O A;  5C44 H;  3KF6 B;  4B3S Q;  1KL9 A;  2L15 A;  4LF9 L;  2CFM A;  4L5Q A;  1PVO A;  4OO1 I;  3CPF A;  4NXN Q;  2VY3 A;  2R92 H;  3J80 i;  1HNW Q;  3I4O A;  1BVS A;  1L1O A;  1RIP A;  2VL6 A;  1N33 Q;  4K0K Q;  1UE5 A;  3G71 A;  1Q7Y C;  3A5U A;  3S2H H;  4QY7 A;  3ULP A;  4LF8 L;  4IJH A;  1FVI A;  2YTY A;  2CWP A;  4XIG S;  3UDX A;  4GN3 B;  4R1J A;  4EX5 A;  1W3S A;  4DV7 L;  4LNQ A;  4A3G G;  1L1O B;  3AFP A;  2E2I H;  2VUM G;  4BBR H;  1XPR A;  4JI5 Q;  3HOW H;  1X54 A;  4YCU A;  4JI2 L;  1J5E L;  1HNX L;  4UY8 C;  2LXJ A;  4LUV A;  3GTQ H;  1D8L A;  2E2J H;  1YIT A;  2JA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...