1SDFA

Solution structure of stromal cell-derived factor-1 (sdf-1), nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
67
structure length
67
Chain Sequence
b'KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMAL CELL-DERIVED FACTOR-1
publication title Solution structure and basis for functional activity of stromal cell-derived factor-1; dissociation of CXCR4 activation from binding and inhibition of HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 7
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1997-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sdfA00
1WTXA 1B3AA 2BDNA 3UI2A 4ZLTF 1IKMA 2B2UC 2B2TC 2K1BA 2R3ZA 1J8IA 1B53A 2FJ2A 1O80A 1NCVA 3HP3A 5EKIA 1PFNA 5EPKA 5EQ0A 4O42A 1DZ1A 1QE6A 4MN3A 4HCSA 1DONA 1GUWA 3I3CA 1WTRA 2MGSA 1HUMA 4MHEA 1WD1A 1HA6A 1AP0A 5T1GA 5E4XA 1MSGA 2KECA 3DEOA 3IFDA 4CJ1B 2MJ8A 2RA4A 4IUTA 1NR4A 1WTVA 1ILPA 2RVLA 2Q8TA 2X6LA 1DOLA 2MPMA 2NWGA 4OIJA 4X3TA 2B2UA 2B2TA 1JICA 2HUGA 2K03A 5JJZA 3MWYW 4XDXA 2VXWA 2X6GA 3I90A 1WTWA 2N55A 1C8CA 1BF4A 4CJ2C 3GV3A 1PFMA 4HEDA 2D9UA 2X69A 1WTQA 2EPBA 1O7YA 2B2WC 1RODA 2DY8A 1M8AA 1Q3LA 2Q8RE 3H91A 3Q6SA 4ZAIA 5D14A 3I8ZA 1VMCA 5DNFA 2B2YC 1WD0A 1VMPA 2M2LA 3N52A 1RJTA 4IUUA 1XX8A 4UAIA 1RHPA 1X3QA 2EOTA 2HDMA 2HCIA 1U4LA 1S4ZA 2CVRA 2L9HA 1B50A 5COYA 2KUMA 1X32A 3MTSA 5CMDA 1BO0A 1PDQA 1O7ZA 2JYOA 2SDFA 3IL8A 1G2SA 1MGSA 1RTOA 4RA8A 4U68A 3SVMA 1KNAA 5CORA 1BNZA 3KUPA 1A15A 2RSOA 2FINB 2FHTA 5CBAE 1EIHA 2JP1A 1CM9A 1WTOA 1LV9A 2K04A 1SDFA 2H1EA 2KEEA 2XIWA 1AZPA 4R8IA 1XYIA 1B2TA 1RTNA 1BBXC 2B2WA 1G6ZA 2DY7A 4HAEA 2B2YA 2FFKB 5EPJA 1IL8A 1WVLA 1X3PA 2L12A 4RWSC 2MP1A 3TN2A 3QO2A 2RSNA 2FMMA 4CJ0B 1PFBA 2KVMA 3D6WA 1ML0D 3G7LA 1HFNA 4XT3B 3DM1A 3DEPA 4DN4M 1HRJA 4IURA 2B2VC 1EL0A 3FDTA 1TVXA 4IUQA 5T1IA 2L4NA 1U4MA 1F9QA 2IL8A 1MI2A 4IUVA 4NW2A 1ICWA 2N88A 4OIKA 4X3KA 3I91A 1F9SA 2K05A 1MSHA 5EPLA 3GV6A 1NR2A 2J7ZA 3LWEA 1SSOA 4X3SA 1DOMA 4HSVA 1EQTA 4XT1B 4ZK9B 1IKLA 1U4PA 1CA6A 2K01A 3F2UA 1PLFA 1J9OA 1QG7A 1ZXTA 1HUNA 1EIGA 1U4RA 1E0BA 5CBEE 1DOKA 2L11A 2B2VA 2K28A 1JE4A 1F9RA 5AFWA 4QUFA 4R9WA 4LMQD 4RAUC 1HHVA 2L1BA 5E4WC 1NAPA 3P7JA 1AZQA 1G2TA 2NZ1D 1ILQA 1G91A 4QUCA 1F9PA 2EE1A 1KNEA 4IUPA 1F2LA 1QNKA 3ONAB 3R93A 4ZKCB 1ESRA 1SAPA 3TZDA 1HFGA 5D65A 1WTPA 4ZKBB 3FPUB 2KEDA 4X3UA 1CA5A 1B4OA 2HCCA 2HDLA 3KBXA 5EJWA 2KOLA 1EOTA 2NYZD
chains in the Genus database with same CATH superfamily
2B3GA 4KY6A 3CCVA 3UI2A 2R3ZA 3VYUA 1HPCA 2BH8A 1SNMA 3I2ZA 4L5QA 1I4HA 4BY7H 4J1MA 3NTHA 3VYTA 4A3EH 2I0QA 3F8TA 4IPDA 1VQIA 5T1GA 2A69C 2EQSA 2JA6H 4AYBG 3PUXA 5FLMG 1B3QA 2N8NA 1FR3A 1I50H 2PMZE 3NBIA 5M5YH 1VQ7A 3EIVA 3HOVB 1BCPC 3GTPB 3I7FA 4OIJA 2B2TA 5HURA 1A2TA 4LW1A 2X6GA 1V1PA 1W6JA 4LF6L 5K36G 2UUCQ 2Q2TA 1M90C 3GV3A 5M3MG 3H91A 2QEXA 2ENBA 4QIWB 4AQYL 3ND8A 5JJLA 4L5TA 4K5VA 4ZK9B 1JORA 3S1MB 1NE3A 2KUMA 1X32A 3IL8A 3H15A 4F87A 2RSOA 1DYQA 1VQHA 4BY7G 3S2DH 4A3EG 3S2HH 1BBXC 4GOPC 1CT1D 2JA6G 1K8AC 2UU9Q 2NVQB 3MHBA 4UP7A 3IRBA 3AEVA 3OHXC 3KF6A 4C3IB 3H3VI 2AUJD 3CRLC 4DV2Q 1XWEA 2F0NA 1GJXA 4X64L 3FDTA 2OEOA 4ZRZA 3EA6A 1XPUA 1E1OA 3QJYA 1STNA 3SK8A 2N88A 4DGZA 1KQSA 3OW7A 2AKWB 1EEID 3P20A 1IW7C 2LY7A 2MNAA 1I5FA 1G51A 1Q12A 3ITPA 1D6EC 4DU9A 4G7OC 4KN7C 3NE5B 2B2VA 2Z6KC 1ZYRC 1ENCA 2UUAQ 4O0AA 1NAPA 2BA0A 3K5OA 2E75C 4QUCA 2Y0SB 3D3RA 3FPPA 4IUPA 4NB3A 3TP6A 1SE4A 1SAPA 3LGJA 4CHTB 5C3XA 2F1MA 1HXYD 3S24A 2E74C 4B3MQ 2K5VA 1JMCA 2MHVA 1LT3D 2B2TC 1J8IA 4IJLA 4TQUS 1KC8C 3RN2A 1II3A 1QE6A 1EY5A 4K2KA 4DF7A 3TQYA 5M3FG 3T1YQ 3GTOB 4A3LH 1L1OB 1YHBA 2ID0A 1A3TA 4RH6A 1VQBA 3G6JB 5JVG3 1TIID 4OONA 4MIUA 3M4QA 4QJFA 2R61A 4B3RQ 4DAYA 3GQBA 4DR4L 3A8JE 1EEFD 1ASYA 1DD2A 1SLJA 4LF7L 1WTQA 1TWFH 4DK0A 1Q3LA 2F0LA 4IUNA 4EX5A 1D2BA 1VMCA 4JBMA 3PUZA 2NVXH 2IT1A 1W2BA 1PH3A 3J7A5 1FJGQ 3N52A 1IZ6A 2HDMA 2JN4A 5COYA 2D0PA 2NBFA 3S9WA 4FF2A 2RDFA 1B44D 4FP5D 5DLQE 4A3GB 4BBRB 3A74A 2D62A 3VA7A 2NVYH 4QCLA 4AH6A 2EYMA 4I7AA 3H3VC 4A3LG 4HAEA 3J80E 4JI6L 1MD2D 1T5EA 2L12A 2QKIC 3EBEA 1SMYD 1MJCA 4APVA 3HOXB 2KVMA 3T56B 3CCUA 3P75A 3CAMA 3TEHB 3DEPA 4BWGB 1QVGA 1HZBA 2B2VC 1TVXA 4BS9A 1SE2A 2PCFB 4LF8Q 4A3CG 2ZXPA 4OWWB 1KL9A 1KHIA 3EROA 1Q86C 4IOAA 2N3SA 1NR2A 4X3SA 4BY1B 1EIYB 4BA2I 1RKNA 5C4XB 3TSSA 3W1BA 3I4NH 2F0MA 2F0IA 4DK1A 4N9PA 1MJEA 4A93H 1TWAH 3FP9A 1Z47A 4LFAL 1SYFA 4OO1H 1E22A 4F7XA 1B9MA 4YWLA 4GNXA 1EQQA 1HHVA 2A73B 2Q2IA 3AU7A 2Z1CA 1N34Q 2NZ1D 4JI7Q 1KNEA 3HEJA 3ONAB 2R93G 3A8KE 1DXMA 3A56A 3OMGA 2E2HH 4EQNA 5JJKA 1EY7A 3NELA 4F88A 1QNUA 1O80A 3L2PA 1S3OA 2KBNA 1D5ZC 1OXUA 2RKSA 4JI8Q 3PIPA 5IYCH 3M3YH 4X65Q 1VQAA 1ENAA 4Y7NH 1MSGA 4BBSB 2KECA 2EJMA 4H02A 3I4NG 3AFPA 3K81C 3MFGA 1PH9A 4A93G 4RGOS 4DV0Q 2RVLA 3A5ZB 3OMCA 3UE0A 4EGVA 4OO1G 1TS5A 1V9PA 1ET9A 2F0GA 4PZ6A 2M00A 2LMCB 5NUCA 1C8CA 1R9TH 2D9UA 4KJOA 1LT6D 5M3FB 1LTRD 4A3FG 2CH4W 3KLSA 5DNFA 1Z9FA 4IUUA 1HTPA 3MFYA 2BH2A 5CC4A 3GTQH 2EXDA 2QDLA 2SDFA 1AFPA 5HY6A 3KYHC 1VQDA 3K58A 3HRZC 1EY8A 1E3PA 3ULJA 4TSSA 2F4VL 1B2TA 4YY3L 4KHZA 1C9OA 1SYBA 5IYCG 4DV1Q 2UXBL 1LUZA 3O13A 5LMUL 5ELBA 2RSNA 2VY3A 3RZDB 4MNOA 4R4IA 3G7LA 3GTGB 2DNEA 4CKCA 3M7NA 4X62L 4DUZL 4FNFA 1SMXA 2VL6A 3HOUB 5JOBA 1TQOA 3PUVA 2A74C 4GNXC 1K3BC 2PW7A 3TP7A 2K32A 3TP5A 1ICWA 1TWHH 1CKOA 4P71A 3V96A 1C0AA 3AB9A 3HS0C 2MQHA 2KCMA 3LWEA 3NXWA 1KXLA 3BDLA 2IHEA 4B3SQ 2K5HA 4GLVB 1CQVA 2C5CA 1I94L 1OTCA 4Z9CB 4E6IA 1LABA 1Y1WB 4JK1C 4JV5L 3BDOA 4LFCQ 2G9DA 3E9IA 4HIKA 3IAYA 1OXTA 1LTGD 2EVBA 3MC0B 3F2CA 5JPNC 4IFDH 1F2LA 2ALYB 3S1NH 2NN6I 1VQCA 1Y1VB 3Q22A 4DR5Q 1STYA 4DKAC 5IODA 3I4OA 2HD3A 4C3JG 1IBKL 1VQ4A 2PZTA 1VQFA 1XTDA 4PMBA 4Q0FA 2MGSA 1PYSB 2B39A 3FMCA 3U58A 1J6QA 3LNNA 3A0JA 3A54A 4IUTA 3OW2A 2ZTDA 1QZHA 3J7AF 3K5NA 1AE3A 3NHHA 4A3BH 4XTCS 5CV4A 1UE5A 2B2UA 2K03A 4C2MH 2JA7G 2K7VA 4P73A 4GKKL 5EKLA 3F2DA 1IYUA 2AUKA 3CPWA 4CJ2C 3CQZB 1KABA 2VUMH 1RODA 2F0WA 2JA8H 5M5XB 4NP5A 1PA6A 1CZGA 4IFDG 1KRTA 4JVZA 2G9HD 5L37A 1B50A 4RKLA 3EQLC 1PH4A 2ES2A 4L5RC 1N32Q 3GTKB 5IP7H 2E2IB 1GUSA 2MO1A 2EYOA 1HR0L 3W5OA 1YNNC 4K14A 4K6LA 4BA1I 5C0XH 1MIUA 4OX9L 1GD7A 4YCWA 5EKKA 1SFOB 4A3FB 1TXYA 4TVAB 3SK4A 2LFNA 4DAMA 3GDEA 1EYGA 4L5SA 1PFBA 4A3BG 1VS0A 3DM1A 2B63B 3A5UA 3KFUA 1X56A 1F2MA 1V1QA 1MI2A 2PQEA 2A19A 3NENA 2VUMG 3PV0A 1PRTD 4NPSA 2JA8G 2J7ZA 3ND9A 4DXGA 3G48A 4KY7A 2CQOA 4A3JB 2H4OA 2XVSA 3Q24A 2ZJRA 4HMIA 2I5MX 5FJ8H 1Z7TA 3ULLA 1A63A 2JA9A 4U673 1JCKB 5IP7G 3HOYH 1STHA 2A6ED 1B1ZA 1HZCA 5BR8L 4R9WA 4RAUC 3TBIB 1RL2A 5LMNL 1G2TA 1PFSA 5EBDA 2O2LD 5C0XG 3M4OB 1HZAA 1S5FD 3L0OA 3QOJA 3TZDA 5JAVA 1XMQL 2PNHA 5GAHC 3HOWH 1Y69U 3M85A 3SE0A 2KOLA 2N78A 1L1OC 2EY6A 4DK3C 3PO3B 1SYDA 2B2UC 3UDFA 4DNIA 4L63B 1N36Q 2QCPX 2ZT9C 4IN3A 4GLAC 2YTVA 4GZYC 1OXXK 1EQVA 3FRPB 3NWSA 4OELB 3TRZA 2XGTA 5FJ8G 1D5MC 4JYAL 1P8LA 4MTNA 2XRQD 3HOYG 1C48A 5M5WB 2N49A 4NXML 1BBUA 1HJPA 1LTLA 1LT4D 4C3JB 2R7FA 1V43A 5E7NA 2BE5C 4ME5A 4H0LC 3GP7A 3MXGA 1JOKA 2ZJQA 4JCVE 2EJGC 1IXRA 3HOWG 1PDQA 2R6GA 1FYCA 1UUPA 2I46A 1AP0A 2SNSA 2PNRC 1EY9A 1S5DD 3ULPA 1F2ZA 4OWXB 2K04A 2XSCA 3STBC 1QVFA 2JA5B 4PZ8A 2WAQB 2Z9HA 5ELEA 1JT8A 3BJUA 2DY7A 1IHZA 2J4XA 2O5IC 1SJHD 1PZJD 2E2JB 4PZ7A 1KAAA 3TN2A 1YNXA 4N8FA 5I4DA 1BUVT 1HNXQ 3PGZA 3CPFA 2IJ0A 4XQNA 2HQEA 4JBWA 3DLLA 1R4QB 4JOIC 4X3KA 3K57A 3D31A 1DOMA 4EQ5A 3MEHA 4CDEC 1JB7A 4XYOA 3E6ZX 3CCMA 4A3DH 1PLFA 1SNCA 1U4RA 1E7ZA 1E0BA 2L15A 5DEHA 2UU9L 3GTJH 3K8AA 4DNTB 4CDFC 2NN6H 4A3IH 1HNZQ 4UHVA 4DV2L 4DV7Q 4BXXG 1AZQA 1SNDA 5BN5A 2NVTH 3H0GH 5CV5A 1L0WA 4K2LA 4X3UA 2K5NA 1B4OA 1JOOA 4B08A 1PH6A 1VQ5A 1PYWD 4PG3A 4DR1Q 1WTXA 1B3AA 5GROA 4UY8C 4WFN3 3VA5A 4MN3A 2BCOA 4HCSA 4K6DA 4KTAA 2UUAL 3L9AX 3F2BA 3E0EA 1HR0W 3QG1A 4A3MH 1NR4A 1FL0A 4KHPQ 3T13A 4ME3A 1TWCH 4A3DG 1WCMB 3NPPA 3K7AH 3BVMA 2PZWA 3MWYW 4QY7A 5D3DA 4A3IG 1VQOA 4B3ML 4XXEA 1GUNA 3SEBA 1K8OA 5DM73 1T9HA 3SHLA 3T1YL 3T53B 2Z6BA 3T1HQ 1S4ZA 4K5XA 3MTSA 1X3FA 4JI5Q 1LTAD 2HT1A 4DR3Q 2LXJA 4LWCA 4FO2A 2CQAA 2I5LX 1YJNA 1LYLA 3TZUA 4B3RL 5C4JB 1KLGD 4QQBX 2OF1A 2B29A 1X3PA 4A3MG 2QW7A 4GKJQ 5LMNW 4HJ9A 4ZUJA 1KTKA 1FJGL 3WOEA 5D3IB 4H7BA 1HCZA 2L4NA 3GTMH 3KLSX 3TMEA 3L7ZC 2YYZA 1QZGA 2MO0A 1OO9B 3NSWA 2WIIB 3PO2B 5GQOA 1HNWQ 1T5XD 2WACA 3UDGA 4KHVA 1EIGA 3QOLA 3T4AC 4DAVA 2L11A 3PIOA 3BYYB 4LUVA 4IZ8A 1JWMD 1EZ8A 2EE1A 3Q8DA 4C3HB 1QNKA 4POFA 4LF8L 4ZKCB 5FOBB 3RD4A 1CKMA 1KDCA 3S1QB 1D8LA 3MA2B 4ID6A 1Z6HA 3RR5A 2BDNA 1MBYA 3CCQA 1SRUA 2FJ2A 5CV8A 4ZCKA 5IWAQ 1XNRQ 4N8X1 5FLXc 2SNMA 1GUWA 3I3CA 3I4LA 1WD1A 4MHEA 1K83B 3HKZE 4DAPA 3I4MB 3HFZB 4A3KH 4S3SA 1JC7A 4CJ1B 1N34L 1PH5A 1SNPA 1JOQA 3CCJA 4JI7L 2K4KA 3E9HA 3TDQA 4GLXA 4X3TA 4JG2A 1VF7A 1PYBA 4FXKC 2WINB 2KENA 1NUCA 2CWAA 4A76A 4X66Q 1BF4A 5IP9H 1PFMA 1VQ6A 4J8QA 2HIXA 5C5LA 4LK1C 1EWHA 4ZAIA 3QIAA 4JI8L 2YV5A 1CUKA 4X65L 2E5LQ 4HCEA 1VMPA 2M2LA 5HGTA 5HGQA 3HOZH 2L9HA 2CVRA 1FGUA 4JI0Q 1SE8A 3T51B 1ZEQX 2KCNA 1CFMA 1NMFA 1TS2A 5CYUA 2KCTA 4KLKA 4DV0L 3QWNA 2ZM6Q 2KEEA 1JE5A 1JWSD 3C1FA 2VQFQ 1G6ZA 1PXUA 2K52A 2Q2UA 1VDZA 2HHHQ 4A3KG 4JPBW 2VZAA 1X65A 3OWEB 3CXCA 5KNCA 1H9KA 2PI2E 4YHHQ 3DUZA 4AYBB 1YJWA 1NMGA 4XT3B 3RMHA 4B9WA 3PMFA 4YIJA 1TWGB 5IP9G 3C46A 2Q2HA 3TS0A 2UXDQ 3HKZG 2FXQA 4DV1L 1IKLA 4RGMA 3HOZG 4LUZA 5M3MB 4FXDA 4FF4A 1QG7A 1IW7D 4RG1A 4AQYQ 1QILA 2WB1G 1IBLQ 3HG9A 3DMUA 1F9RA 1G291 3W2DA 2K5QA 2A68C 1IYVA 2Q8IB 4B9XA 2QF7A 1ZYRD 5IGBA 4NXNQ 1W3SA 1ILQA 1F9PA 2O5JC 1GOZA 4BY7B 4A3EB 4KN4C 3RN5A 5A35A 1G6PA 1ZKOA 4XQQA 4JI4Q 3CD6A 2MPMA 4RCOA 2JA6B 4ZLTF 5C3WA 4B3SL 2ZJPA 1Y8PB 1I50B 1BBWA 3HKSA 5M5YB 3S15H 3CCEA 3R8BA 3D0FA 4LF4L 4JI1Q 5DM63 3PQIA 1YNJC 1FVIA 4DR2Q 4LFCL 3MXPA 3SDZA 1LO5D 3FVQA 4HIOA 3X3MA 3NBHB 1JJGA 1GKHA 1Q90A 1I6HH 4DV6Q 1EY4A 1QJOA 1JICA 5BN4A 3CU7A 4H44C 1X3GA 2PMZB 2EYPA 3J81i 4DR5L 4JI3Q 4G4KA 1F77A 1O7YA 2EYHA 2EY2A 1J5EQ 1LM0A 4KV6A 4GS3A 3S2DB 4CKBA 4LF5Q 1EIFA 3S2HB 5FO8B 3BDCA 1JR0D 4U68A 3S16H 4P74A 2A8VA 5CBAE 4DV5Q 1LLRD 5IIFA 4IPCA 4GN3B 4P2CB 3UE1A 4IOCA 2WP8J 3I70A 1QVCA 2FFKB 4Y52H 2EYLA 2OXPA 1NTGA 4RGNA 5IT9c 2KHJA 4KD3A 4HTHA 3AQQA 2K50A 5C4HA 1PZID 3S14H 1N32L 2F0VA 5FKAC 1JJ2A 3P1HA 1MSHA 3NWTA 4FXGC 4OL7A 4R1JA 3GTLH 4RHSA 1I3QH 3H3VH 2R92H 5KYIA 5C3EH 1Q81C 3MEFA 1PV4A 2P5ZX 5IGEA 4WJ4A 1HA5A 3K0XA 1DOKA 1JE4A 1YBYA 1O78A 3BU2A 1PTOC 1XPRA 1XNQQ 4EQPA 1KDAA 1RD9D 2IW3A 1E24A 3BYTB 4ZKBB 3RLOA 5J39A 1DCZA 5IGFA 1TY0A 1WTWA 3S17H 1CHPD 3NTIA 2AQ2B 5KYLA 3H94A 1NCVA 1GVPA 5FLXL 2GA4B 2E76C 2IWHA 1D5XC 5G3LD 2G5DA 3E0JA 3S1RB 1KLUD 1PMRA 1STEA 4EVOA 2CWPA 4ZYSA 2F3IA 3DEOA 2R92G 3KK7A 5IOCA 1N8RC 5C3EG 3JAMc 1AEXA 1N9WA 1TWFB 4QMGA 3FKIH 3CKIB 2JSOA 4XT1B 1A3VA 2NVXB 3EVQA 2N55A 3OTOQ 2PYKA 1VQLA 1SEBD 4HJ7A 4HEDA 1BKBA 2MUYA 4LUOA 4LFAQ 1SNOA 2Q8RE 1SE3A 1N36L 1EYAA 4V190 4DV3Q 3A7LA 2CW0C 4UAIA 5E3FA 1RHPA 1TY2A 2NVYB 5I9OA 4R4TA 1A6XA 4P72A 3LX0A 1BO0A 4RA8A 4RHRA 4HIDA 4LFBQ 2R93B 4YWMA 1Y8OB 3RLNA 1EIHA 4DPGA 3J80i 2JP1A 1WYDA 2H1EA 2I5HA 5C44H 1Q1BA 2PW5A 1KDBA 3SR1A 3RZOH 1FNWA 1EWIA 3A8IE 4TRDA 2C35B 1HQRD 4QGUA 2YU9H 2AHOB 2UUBQ 1H9RA 1H95A 2K14A 3FKIG 1YJ9A 1X3EA 3I4NB 4RMFA 1S5BD 2PO4A 4DV4Q 1LTTD 4A93B 1TWAB 1CQFA 1ASZA 4POGA 2DNCA 4CDDC 2K05A 4WRDA 2R7ZH 4KK7A 1K9MC 1SYGA 4O2DA 2EZVA 2KA7A 5CR3A 4ALPA 1YZ6A 3Q23A 4DR7Q 3D4RA 2ICIA 1SYEA 4ZUIA 3J7ZC 1SROA 2MFIA 4R4OA 4QUFA 1PTOH 3F1ZA 1HNXL 3CCRA 3KJPA 1JB3A 3JC66 2E2HB 2L5TA 1TU2B 3C2PA 3DXJC 1KAWA 3MAQA 3D4WA 1CA5A 3M3YB 2LXKA 2A6HC 2L0CA 1TR5A 3CW2C 4Y7NB 1SNQA 1IKMA 1BR9A 3K5LA 2QA4A 3BZKA 1K8GA 4H13C 2A1AA 1DONA 1HNZL 5I6YA 2R7ZG 1NBWA 2ZTCA 3IFDA 2E8GA 3ZJYC 1R9TB 1GUOA 4QIWE 3I90A 3NBHA 4DR1L 2RBMA 3GTQB 3D6CA 1AW7A 1FNVA 1BVSA 3K80C 3CC7A 1UE1A 2EXZA 1EWCA 3HOVH 3GTPH 1M8AA 1VQNA 1LACA 2OCEA 4JW0A 1EFID 2Z4HA 3J81j 1IBMQ 2ICEC 4PQXA 4UP9A 3T16A 3PSIA 5IE8A 2F0TA 1N33Q 3ICEA 1G2SA 1RTOA 2CH4A 4KHPL 2FINB 2FHTA 3J81c 5KIXA 1BDOA 3CC2A 3SK5A 5ELFA 2NTTA 4UP8A 4QB4A 3S1MH 1JQYD 2B2WA 1EU4A 1YNND 2B2YA 1C7YA 2F0SA 1VQEA 2JEAI 3PO2H 1TWHB 3D4DA 5IT9L 2FMMA 3D6WA 3T1HL 2K75A 3VDYA 4QL5A 4JI5L 1F9QA 1OXVA 3MXNB 2NVQH 3IFTA 4DR3L 1DM0B 5I2YA 3KDFB 3W1GA 4C3IH 2JA7B 3Q0AA 1D1IA 1L0YB 2XWBB 3GO5A 3NTKA 3PUWA 3LWUA 1KRSA 5CGKA 2KHIA 1QOHA 2UUCL 4DR6Q 1QUQB 2RDGA 4V0BA 3PCOB 4O1NA 1O7LA 4GKJL 2DUDA 3S1NB 1WFQA 3BVGA 4KKUA 1UE6A 4M1UB 3P7JA 3BZDB 2QEJC 5LHY1 3R93A 2R7DA 1ESFA 1S72A 2D2CC 4RFBA 1PRTF 2OQ0A 2VB2X 1KD1C 3PUYA 4OX9Q 1K73C 1EOTA 4PMWA 5EPKA 1EZ6A 4K5WA 2JJQA 1NY4A 4A3BB 2TSSA 5J3BA 4C2MB 4C3IG 1DGSA 1YIJA 5C5MA 1M4VA 1D1KA 2PQAB 4WJWA 3DWQA 2VUMB 5FO7B 4B3TQ 2JA8B 4JI2Q 1CSPA 3GTOH 5JJZA 1M1KC 1YHQA 4XDXA 2CHBD 3BVZA 4XYQA 3B6YA 2IHFA 3KLRA 1PH1A 4ULLA 3H6MA 2AWNA 2B2WC 5IWAL 4XQJA 1XNRL 1XMOQ 2B2YC 4RGTA 2H5XA 3KLWA 2BE5D 2EJFC 3EFXD 2JYOA 3G4SA 2JQOA 3C1EA 3OOCA 3K0YA 4DFAA 5I6WA 3IKJA 2PZUA 2Y0SG 1GHJA 1STGA 1X6OA 1XYIA 5A2QE 2JK8A 2UXCQ 2NN6G 3KF8B 1TWGH 3STBD 4X66L 3BG3A 4HSPA 2ZXOA 5J22A 3A55A 4A3GH 4BBRH 3H0GG 1BQQT 5TSSA 1ML0D 2E5LL 2F4IA 4X6AH 1HFNA 3CHBD 4JC0A 4DN4M 1PH7A 4JI0L 1NSNS 3J80c 1U4MA 4OEMB 4WORA 4FYDA 2GVBA 4NMZA 4DA2A 2VNUD 4OO1I 4OIKA 3HOXH 2ZM6L 3HOYB 5KNDA 1Q1EA 1SSOA 2PPBC 4M8AA 3HGBA 2HIVA 1U4PA 2VQFL 2Z6KA 1GO3E 1PRTB 3F2UA 2HHHL 1CI3M 3D8GA 1UE7A 4BY1H 5C4XH 4YHHL 5AFWA 3KJOA 5A2QL 3HOWB 2L1BA 5ISRA 4L8JA 1Q8IA 1ESRA 2WV6D 1EY0A 4I7ZC 1C4QA 3E5SA 4A3GG 2UXDL 4BBRG 4J6HA 1GUTA 2D0OA 4HR7B 2A5HA 3NQIA 2EDGA 1CHQD 3KBGA 3CC4A 1WOCA 3CP0A 4O42A 3J81E 5DAUA 2AMCB 5E1FA 2FMCA 1IBLL 4IPHA 1GM5A 3PIO3 4OWTB 3HOXG 4K8IA 5JEAJ 3MZ5A 4NXNL 2RA4A 1VCIA 1WTVA 2ZTEA 2CCZA 4HIMA 5IGCA 1TS4A 2X6LA 3TS2A 2EYJA 3JAMi 4KMUC 4BY1G 3VYSA 4BBSH 4JI4L 5C4XG 1OXSC 3OIQA 1I4PA 1CK1A 3RUZA 1SR3A 2RF4A 4Q5VA 1O7IA 2F0OA 5IYDH 4JI1L 1EOVA 3NEMA 1RJTA 4I65A 1X3QA 2VQEQ 4DR2L 1U4LA 1XTCD 5CMDA 4LF9Q 3FEWX 1O7ZA 1MGSA 2VB3X 5M3FH 1X54A 3SVMA 4K0KQ 2A69D 3J81L 3BZCA 4DV6L 3ERQA 1G8ZD 2WB1E 1EUJA 1EYDA 1SDFA 2E2DC 3ERSX 4PNYA 5EAYA 1BCPD 4L6TB 4DUYQ 4JI3L 3K6OA 1SMYC 1AN8A 1UEAB 1FGBD 2WFWA 5AJ3Q 1J5EL 1A3UA 1CTMA 4LF5L 4KKSA 2F0EA 1HRJA 4IUQA 4BBSG 4A3DB 2DJFC 4IUVA 3I91A 1F9SA 4DV5L 2AWOA 3RZDH 3GTJB 4A3IB 3GTGH 5IY0A 1I4XA 3MXNA 5CV9A 3GD7A 2LKVA 3A7AB 3HOUH 5IYDG 1CA6A 3KDFA 4IFDI 1A0IA 3U4ZA 1PVOA 2NVTB 3H0GB 4YWKA 3W3AA 2GVAA 1VQKA 2QILA 1VQGA 1EU3A 2IX0A 4LMQD 1CKNB 1QUQA 1K0SA 1GHKA 2RQXA 2KHSA 3DWAA 5F2DA 5C6AA 2DN8A 1Y1WH 3ZYYX 3S1RH 2HDLA 2NTSA 4NDXA 4OHJA 4LF6Q 2XN9C 1X9NA 3NK9A 2KJXA 2K1BA 3U9SA 4A3CH 5EQ0A 4A3MB 3HP3A 2F0JA 3FHWA 5EKIA 2M9VA 2B8FA 1TWCB 1Y1VH 1Q7YC 3AYHB 2JXMB 3K7AB 2F0KA 1HUMA 3VYRA 3NUCA 2YTYA 3QB3A 2AQ1B 4HMJA 4WJ3M 1B8AA 2BOSA 4XIGS 3HOUG 1XNQL 4ABNA 1L0XB 1D7QA 1FD7D 1IYJB 1RF2D 5M9OA 2BDOA 2C9OA 2PQAA 2I07B 3DWPA 2R93H 1YVCA 1I4RA 2EPBA 2DY8A 2EY1A 4IALA 1Y1WG 1VQPA 5C0XI 4X64Q 3TREA 3CQZH 2XWJB 4MZ9A 2GN5A 3V2TA 5JJIA 1KNAA 3KUPA 2QDBA 5M5XH 4IQZA 1Q46A 3I73A 1A2UA 1UAPA 2K5DA 1LV9A 2XIWA 4R8IA 1Y1VG 3I55A 1RTNA 1BCPF 3RLFA 5I2XA 3OTOL 3GTKH 2E2IH 5EPJA 3GTMB 2EY5A 1HZ9A 1STAA 4ODGA 4IO9A 4JBJA 3KF8A 3UDIA 3PIP3 4DV3L 3X3NA 2OWOA 4IURA 3J80L 1NNXA 1SFOH 2SOBA 5KNBA 4A3FH 4R4QA 3ER0A 4LFBL 2WKDA 1S40A 1DJRD 4J15A 1YITA 1U5KA 1W6KA 1HQMC 2XNAC 3M9BA 3L3OC 2B63H 4GN4B 2OT2A 2VW9A 1PHJA 1ZXTA 5CBEE 1PH8A 3G71A 2UUBL 3CCLA 3DHQA 3CRKC 1UEBA 4A3JH 4LNQA 1G91A 4DV4L 2A68D 1HTLD 1I4GA 1X55A 4MTKA 1L2FA 2EYFA 5FLXE 1HFGA 5LL6X 5KEEA 1Y8NB 4DR4Q 2Z0SA 4KD4A 4A3KB 4LF7Q 2D5DA 1H9MA 2DGYA 3M4OH 4DR7L 1V1OA 1WI5A 1WTRA 3OPOA 3N6RA 3OIPA 3PO3H 5IYBH 1YNJD 2B63G 3AFQA 5ELOA 2RHQB 3OYYA 1RDPD 3VR6A 5GADC 1RIPA 3K7UC 1E2VA 2Q8TA 3HKZB 2HUGA 3PF5A 5ELCA 2ZXRA 3OSOA 3U4VA 3SGIA 3HOZB 4EQOA 3CF5A 4A3JG 2F0QA 4JBKA 4JI6Q 1TKWB 2WB1B 1BCPB 2OQKA 3J7YW 1S5CD 2NUCA 1WD0A 4FDBA 4G7HC 5M5WH 2EIFA 1ET6A 2HCIA 3DM3A 2WAQE 5GAGC 4C3JH 4OGQC 1BXTA 3PF4A 3I72A 5CORA 1LTID 3C3LA 1H9SB 1CM9A 4UPAA 3MXUA 3VR3A 4NKLA 4CBVA 1U0LA 3PO3G 5IYBG 2JA7H 4LF4Q 2JA5H 1FNUA 3OWFA 3R3OA 1IBML 4GOPB 3K5MA 2WKCA 1N33L 1PRTC 2IL8A 2E2JH 2ATWA 1ONLA 4NW2A 1SXTA 4HJ5A 1GUGA 3GV6A 1B9NA 3H09A 4CKEA 1VQ9A 1STBA 2A6EC 1HUNA 4DK6C 1XPOA 2TMPA 5KRUA 2K28A 1F2YA 1TS3A 2L55A 1A8VA 2HQLA 3CMAA 2V1CC 1QWYA 3KOJA 4KY5A 4G7ZC 1L1OA 2K5WA 1CKNA 1PTOD 2KQ3A 3S15B 1K3RA 4F8MA 5GAEC 1YEZA 4RKBA 1Q82C 2HCCA 2OTJA 1XJVA 3CCSA 2JA5G 2WAQG 5LL6S 3V05A 4DR6L 2Z8LA 4GN5A 4ZQ3A 1PFNA 2F3VA 1DZ1A 2F0HA 1EFWA 1I6HB 1K28A 1HA6A 1B7YB 5C44G 2IX3A 2MJ8A 4HJ8A 4UDUC 3TP8A 1V1PB 2NZOA 2CKZB 4DNRB 2F03A 4R8NA 2NWGA 2F4VQ 1ICFB 1K0RA 1SN8A 4YY3Q 2BA1A 2UXBQ 1VQJA 1SJED 1E2ZA 1WTHA 3S16B 5LMUQ 3SXHA 1WCMH 3Q6SA 5G3LF 5IGDA 4ILWA 3SK6A 1XX8A 4X62Q 2EOTA 4DUZQ 5ELDA 4DV7L 3R2TA 1Y14B 2CW0D 4A4IA 1BNZA 3RNUA 3R2IA 2YTXA 2IPKD 5K5PA 4N9TA 4B3TL 2IX1A 1WTOA 1H9JA 4JI2L 2J0TD 3VR5A 5IT9E 4G57A 1EY6A 3KF6B 4YCVA 2NB0A 5I9PA 5ELNA 1MKHA 1I94Q 3S14B 1JWUD 3WOFA 1WJJA 3BS1A 1AH9A 2MP1A 4IFDJ 4JV5Q 3QO2A 5CV6A 2K6AA 5FO9B 2QGQA 1I4QA 2F0FA 1XMOL 1VQ8A 1CZWA 4PMCA 4P75A 4AIMA 5C4JH 4QF4A 1I3QB 3GTLB 4JOIA 2R92B 5C3EB 5T1IA 1XXGA 2OTLA 1E2WA 1HH2P 5EPLA 4HN7A 1WCMG 3I56A 4HSVA 2NZHA 3E3XA 2UXCL 2K01A 3QR8A 3WDNA 2DJGC 1YI2A 4RCNA 5C4ZA 1K8MA 1RCVD 1UWVA 4IPGA 1IBKQ 1R4PB 2JEBI 4KJNA 2F0UA 1P16A 4LJZC 3G6EA 2V4DA 2RDHA 1LT5D 5E4WC 1V8QA 3S17B 4R4CA 5FK9C 1EYCA 3VR4A 4C1NK 1PTOF 5D65A 1VQMA 3HOVG 3FPUB 2KEDA 4TKOB 2JE6I 1KIXA 2VS1A 3KBXA 3M7GA 4GKKQ 5IGGA 2NYZD 1VF5C 1LTSD 1B53A 2A6HD 4C3HH 3JAME 2ASBA 4FVMA 3U50C 1QB5D 3M4PA 3FKIB 2Y0SE 1GXDC 3S1QH 1IL2A 2SEBD 5E4XA 2AQ3B 2F3WA 2IY5B 5C0XJ 4C56C 4DAYB 1LTBD 2K33A 3CMEA 1ILPA 2B8GA 4A75A 1HR0Q 1WTPA 1DOLA 3WWVA 4BXXH 1K83H 3I4MH 2VXWA 3PO2G 1BOSA 4KI0A 2RCFA 1HNWL 2F0DA 2XRSD 2X69A 4LAAA 4PV1C 1SBBB 5D14A 3I8ZA 1PZKD 1AE2A 5KGUA 5C44B 5CV7A 1U9RA 5EBCA 1Q8KA 4KKTA 3RZOB 1JJCB 2F0PA 2Z4IA 3U9OA 3URYA 3NP8A 3K59A 3JAML 1A15A 1I6VC 4C3HG 2F52A 2YU9B 3M4YA 4IJHA 2CFMA 5JEAH 1NJIC 4AYBE 5J1ZA 3UDXA 4OXPA 1H9SA 1IL8A 1UNSA 5JVH3 1WVLA 4DXFA 4RWSC 3HZXA 1E1TA 1SYCA 4CJ0B 2R7ZB 5BR8Q 2RCNA 4YCUA 2VQEL 5LMNQ 3I4MG 1EL0A 1B70B 4LF9L 3EJIA 2KCCA 1S5ED 2XTIA 4K0KL 5EGTA 1PH2A 4GOPA 3AMUA 4FF1A 1MHWC 1XMQQ 5FLMH 1EQTA 4FF3A 3MVVA 1PTOB 1ENFA 5BN3A 2LS01 2PI2A 4K8JA 4DUYL 4GNXB 5JPMC 2RHSB 4CGYB 1J9OA 3VR2A 1CSQA 2LSSA 5AJ3L 3EN2A 4C1NI 5K36H 1EQRA 4CDCC 3J7AV 1QCBD 4HJAA 3NQTA 5M3MH 2O4XA 5JEAG 4JYAQ 1TT2A 1A62A 1YHAA 5H1SE 5EJWA 4NXMQ 1AZPA
chains in the Genus database with same CATH topology
4KY6A 3UI2A 2R3ZA 3VYUA 1HPCA 1SNMA 1I4HA 4J1MA 3NTHA 3VYTA 5T1GA 2A69C 3PUXA 1FR3A 3NBIA 3HOVB 1BCPC 3GTPB 4OIJA 2B2TA 5HURA 1A2TA 2X6GA 1V1PA 1W6JA 5K36G 3GV3A 3H91A 2ENBA 4QIWB 3ND8A 4K5VA 4ZK9B 1JORA 3S1MB 2KUMA 1X32A 3IL8A 4F87A 2RSOA 1DYQA 1BBXC 1CT1D 2NVQB 3MHBA 3OHXC 4C3IB 2AUJD 3CRLC 1XWEA 2F0NA 1GJXA 3FDTA 2OEOA 4ZRZA 3EA6A 3QJYA 1STNA 3SK8A 2N88A 4DGZA 3OW7A 1EEID 3P20A 1IW7C 2LY7A 1Q12A 3ITPA 1D6EC 4DU9A 4G7OC 4KN7C 3NE5B 2B2VA 1ZYRC 1ENCA 1NAPA 2BA0A 3K5OA 2E75C 4QUCA 2Y0SB 3D3RA 3FPPA 4IUPA 3TP6A 1SE4A 1SAPA 4CHTB 5C3XA 2F1MA 1HXYD 2E74C 2MHVA 1LT3D 2B2TC 1J8IA 4TQUS 1II3A 1QE6A 1EY5A 4K2KA 4DF7A 3GTOB 2ID0A 1A3TA 4RH6A 3G6JB 5JVG3 1TIID 4MIUA 2R61A 4DAYA 3GQBA 3A8JE 1EEFD 1DD2A 1WTQA 4DK0A 1Q3LA 2F0LA 4IUNA 1D2BA 1VMCA 3PUZA 2IT1A 3N52A 2HDMA 5COYA 2NBFA 3S9WA 4FF2A 2RDFA 1B44D 4FP5D 4A3GB 4BBRB 2D62A 3VA7A 4QCLA 2EYMA 3H3VC 4HAEA 3J80E 1MD2D 1T5EA 2L12A 2QKIC 1SMYD 3HOXB 2KVMA 3T56B 3P75A 3DEPA 4BWGB 2B2VC 1TVXA 4BS9A 1SE2A 2PCFB 2ZXPA 3EROA 1NR2A 4X3SA 4BY1B 4BA2I 5C4XB 1RKNA 3TSSA 2F0MA 2F0IA 4DK1A 4N9PA 1Z47A 1SYFA 4OO1H 4F7XA 1B9MA 1HHVA 2A73B 3AU7A 2Z1CA 2NZ1D 1KNEA 3HEJA 3ONAB 3A8KE 1DXMA 3A56A 3OMGA 4EQNA 1EY7A 4F88A 1QNUA 1O80A 1D5ZC 1OXUA 2RKSA 1ENAA 1MSGA 4BBSB 2KECA 2EJMA 3MFGA 4RGOS 2RVLA 3OMCA 4EGVA 4OO1G 1TS5A 1ET9A 2F0GA 1C8CA 2M00A 2LMCB 5NUCA 2D9UA 4KJOA 1LT6D 5M3FB 1LTRD 3KLSA 5DNFA 4IUUA 1HTPA 3MFYA 5CC4A 2SDFA 1AFPA 3K58A 3HRZC 1EY8A 4TSSA 1B2TA 4KHZA 1SYBA 3O13A 5ELBA 2RSNA 3RZDB 3G7LA 3GTGB 2DNEA 4CKCA 3M7NA 4FNFA 3HOUB 5JOBA 1TQOA 3PUVA 2A74C 2PW7A 3TP7A 2K32A 3TP5A 1ICWA 3V96A 3AB9A 3HS0C 3LWEA 3NXWA 3BDLA 1CQVA 2C5CA 4Z9CB 4E6IA 1LABA 1Y1WB 4JK1C 3BDOA 2G9DA 3IAYA 1OXTA 1LTGD 2EVBA 3MC0B 5JPNC 4IFDH 1F2LA 2NN6I 1Y1VB 3Q22A 1STYA 5IODA 4C3JG 2PZTA 4PMBA 4Q0FA 2MGSA 2B39A 3FMCA 3LNNA 3A54A 4IUTA 3J7AF 3K5NA 3NHHA 4XTCS 5CV4A 2B2UA 2K03A 2K7VA 5EKLA 1IYUA 2AUKA 4CJ2C 3CQZB 1KABA 1RODA 2F0WA 5M5XB 4NP5A 1CZGA 4IFDG 2G9HD 1B50A 4RKLA 3EQLC 3GTKB 2E2IB 1GUSA 2EYOA 1YNNC 4K14A 4K6LA 4BA1I 5C0XH 5EKKA 1SFOB 4A3FB 3SK4A 2LFNA 1PFBA 3DM1A 2B63B 1F2MA 1MI2A 2PQEA 3PV0A 1PRTD 2J7ZA 3ND9A 4DXGA 4KY7A 4A3JB 2H4OA 2XVSA 3Q24A 4HMIA 1Z7TA 4U673 1JCKB 1STHA 2A6ED 1B1ZA 4R9WA 4RAUC 3TBIB 1G2TA 5EBDA 2O2LD 5C0XG 3M4OB 1S5FD 3QOJA 3TZDA 5JAVA 1Y69U 3M85A 3SE0A 2KOLA 2EY6A 3PO3B 1SYDA 2B2UC 4L63B 2QCPX 2ZT9C 4IN3A 4GZYC 1OXXK 1EQVA 3FRPB 3NWSA 1D5MC 2XRQD 1C48A 5M5WB 1LT4D 4C3JB 1V43A 2BE5C 4ME5A 4H0LC 3GP7A 3MXGA 1JOKA 2EJGC 1PDQA 2R6GA 1FYCA 1UUPA 2I46A 1AP0A 2SNSA 2PNRC 1EY9A 1S5DD 1F2ZA 2K04A 2XSCA 2JA5B 2WAQB 5ELEA 2DY7A 1IHZA 2J4XA 2O5IC 1SJHD 1PZJD 2E2JB 1KAAA 3TN2A 5I4DA 1BUVT 2IJ0A 4XQNA 2HQEA 4JBWA 1R4QB 4X3KA 3K57A 3D31A 1DOMA 3MEHA 4XYOA 3E6ZX 1PLFA 1SNCA 1U4RA 1E0BA 5DEHA 4DNTB 2NN6H 1AZQA 1SNDA 5BN5A 5CV5A 4K2LA 4X3UA 1B4OA 1JOOA 4B08A 1PYWD 1WTXA 1B3AA 4WFN3 3VA5A 4MN3A 2BCOA 4HCSA 4K6DA 4KTAA 3L9AX 3QG1A 1NR4A 3T13A 1WCMB 3NPPA 3BVMA 2PZWA 3MWYW 5D3DA 4XXEA 1GUNA 3SEBA 1K8OA 5DM73 3SHLA 3T53B 1S4ZA 4K5XA 3MTSA 1LTAD 4FO2A 2CQAA 3TZUA 5C4JB 1KLGD 2OF1A 1X3PA 4ZUJA 1KTKA 3WOEA 5D3IB 4H7BA 1HCZA 2L4NA 3KLSX 3TMEA 3L7ZC 2YYZA 1OO9B 3NSWA 2WIIB 3PO2B 1T5XD 2WACA 4KHVA 1EIGA 3QOLA 3T4AC 4DAVA 2L11A 3BYYB 4IZ8A 1JWMD 1EZ8A 2EE1A 4C3HB 1QNKA 4ZKCB 5FOBB 3RD4A 1KDCA 3S1QB 3MA2B 4ID6A 1Z6HA 2BDNA 1MBYA 2FJ2A 5CV8A 2SNMA 1GUWA 3I3CA 3I4LA 1WD1A 4MHEA 1K83B 4DAPA 3I4MB 4S3SA 1JC7A 4CJ1B 1SNPA 1JOQA 3TDQA 4X3TA 1VF7A 4FXKC 2WINB 1NUCA 1BF4A 1PFMA 4J8QA 5C5LA 4LK1C 1EWHA 4ZAIA 3QIAA 4HCEA 1VMPA 2M2LA 5HGTA 2L9HA 2CVRA 3T51B 1ZEQX 2KCNA 1CFMA 5CYUA 1TS2A 3QWNA 2KEEA 1JWSD 3C1FA 1G6ZA 1PXUA 1VDZA 3OWEB 5KNCA 1H9KA 3DUZA 4AYBB 4XT3B 3RMHA 4B9WA 3PMFA 4YIJA 1TWGB 3C46A 1IKLA 4RGMA 5M3MB 4FXDA 4FF4A 1QG7A 1IW7D 1QILA 3HG9A 3DMUA 1F9RA 1G291 3W2DA 2K5QA 2A68C 1IYVA 2Q8IB 4B9XA 2QF7A 1ZYRD 5IGBA 1ILQA 1F9PA 2O5JC 1GOZA 4BY7B 4A3EB 4KN4C 5A35A 1ZKOA 4XQQA 2MPMA 4RCOA 2JA6B 4ZLTF 5C3WA 1Y8PB 1I50B 5M5YB 3R8BA 5DM63 1YNJC 3MXPA 3SDZA 1LO5D 3FVQA 3X3MA 1Q90A 1EY4A 1QJOA 1JICA 5BN4A 3CU7A 4H44C 2PMZB 2EYPA 4G4KA 1F77A 1O7YA 2EYHA 2EY2A 4KV6A 3S2DB 4CKBA 3S2HB 5FO8B 3BDCA 1JR0D 4U68A 5CBAE 1LLRD 5IIFA 4P2CB 2WP8J 3I70A 2FFKB 2EYLA 2OXPA 4RGNA 4KD3A 4HTHA 5C4HA 1PZID 2F0VA 5FKAC 3P1HA 1MSHA 3NWTA 4FXGC 4OL7A 4RHSA 5KYIA 5IGEA 1HA5A 1DOKA 1JE4A 1O78A 1PTOC 4EQPA 1KDAA 1RD9D 2IW3A 3BYTB 4ZKBB 5J39A 1DCZA 5IGFA 1TY0A 1WTWA 1CHPD 3NTIA 2AQ2B 5KYLA 3H94A 1NCVA 5FLXL 2GA4B 2E76C 2IWHA 1D5XC 5G3LD 3E0JA 3S1RB 1KLUD 1PMRA 1STEA 4EVOA 4ZYSA 3DEOA 3KK7A 5IOCA 1AEXA 1TWFB 4QMGA 3CKIB 2JSOA 4XT1B 1A3VA 2NVXB 3EVQA 2N55A 2PYKA 1SEBD 4HEDA 2MUYA 1SNOA 2Q8RE 1SE3A 1EYAA 4V190 3A7LA 2CW0C 4UAIA 5E3FA 1RHPA 1TY2A 2NVYB 5I9OA 1A6XA 3LX0A 1BO0A 4RA8A 4RHRA 2R93B 1Y8OB 1EIHA 2JP1A 2H1EA 1Q1BA 2PW5A 1KDBA 3SR1A 1FNWA 3A8IE 4TRDA 1HQRD 1H9RA 3I4NB 1S5BD 2PO4A 1LTTD 4A93B 1TWAB 1CQFA 2DNCA 2K05A 4WRDA 4KK7A 1SYGA 2EZVA 2KA7A 5CR3A 3Q23A 3D4RA 2ICIA 1SYEA 4ZUIA 4QUFA 1PTOH 1JB3A 2E2HB 2L5TA 1TU2B 3C2PA 3DXJC 3MAQA 3D4WA 1CA5A 3M3YB 2A6HC 2L0CA 1TR5A 4Y7NB 1SNQA 1IKMA 1BR9A 3K5LA 4H13C 1DONA 5I6YA 3IFDA 1R9TB 1GUOA 3I90A 3NBHA 2RBMA 3GTQB 3D6CA 1AW7A 1FNVA 2EXZA 1EWCA 1M8AA 1LACA 1EFID 2Z4HA 2ICEC 4PQXA 3T16A 2F0TA 1G2SA 1RTOA 2FINB 2FHTA 5KIXA 1BDOA 3SK5A 5ELFA 2NTTA 4QB4A 1JQYD 2B2WA 1EU4A 1YNND 2B2YA 2F0SA 2JEAI 1TWHB 3D4DA 5IT9L 2FMMA 3D6WA 1F9QA 1OXVA 3IFTA 1DM0B 5I2YA 2JA7B 3Q0AA 1D1IA 1L0YB 2XWBB 3GO5A 3NTKA 3PUWA 3LWUA 5CGKA 1QOHA 2RDGA 4V0BA 4O1NA 1O7LA 3S1NB 3BVGA 4KKUA 4M1UB 3P7JA 3BZDB 2QEJC 5LHY1 3R93A 1ESFA 2D2CC 4RFBA 1PRTF 2VB2X 3PUYA 1EOTA 4PMWA 5EPKA 1EZ6A 4K5WA 4A3BB 2TSSA 4C2MB 4C3IG 5C5MA 1M4VA 1D1KA 4WJWA 3DWQA 2VUMB 5FO7B 2JA8B 5JJZA 4XDXA 2CHBD 3BVZA 4XYQA 3KLRA 4ULLA 3H6MA 2AWNA 2B2WC 4XQJA 2B2YC 4RGTA 2BE5D 2EJFC 3EFXD 2JYOA 3C1EA 3OOCA 3K0YA 4DFAA 5I6WA 3IKJA 2PZUA 1GHJA 1STGA 1XYIA 5A2QE 2NN6G 3BG3A 4HSPA 2ZXOA 5J22A 3A55A 1BQQT 5TSSA 1ML0D 2F4IA 1HFNA 3CHBD 4DN4M 1NSNS 1U4MA 4WORA 4FYDA 4NMZA 4DA2A 2VNUD 4OO1I 4OIKA 3HOYB 5KNDA 1Q1EA 1SSOA 2PPBC 4M8AA 3HGBA 1U4PA 1PRTB 3F2UA 1CI3M 3D8GA 5AFWA 5A2QL 3HOWB 2L1BA 5ISRA 4L8JA 1Q8IA 1ESRA 2WV6D 1EY0A 4I7ZC 1C4QA 3E5SA 4J6HA 1GUTA 4HR7B 2A5HA 3NQIA 2EDGA 1CHQD 3KBGA 4O42A 3J81E 5DAUA 5E1FA 2FMCA 3PIO3 4K8IA 5JEAJ 3MZ5A 2RA4A 1VCIA 1WTVA 5IGCA 1TS4A 2X6LA 2EYJA 4KMUC 3VYSA 1OXSC 3OIQA 1I4PA 1CK1A 3RUZA 4Q5VA 2F0OA 1RJTA 4I65A 1X3QA 1U4LA 1XTCD 5CMDA 3FEWX 1O7ZA 1MGSA 2VB3X 3SVMA 2A69D 3J81L 3ERQA 1G8ZD 1EYDA 1SDFA 2E2DC 4PNYA 1BCPD 4L6TB 3K6OA 1SMYC 1AN8A 1UEAB 1FGBD 1A3UA 1CTMA 4KKSA 2F0EA 1HRJA 4IUQA 4A3DB 4IUVA 3I91A 1F9SA 3GTJB 2AWOA 4A3IB 1I4XA 3MXNA 5CV9A 3GD7A 2LKVA 3A7AB 1CA6A 4IFDI 2NVTB 3H0GB 3W3AA 2QILA 1EU3A 2IX0A 4LMQD 1GHKA 2RQXA 2KHSA 3DWAA 5F2DA 5C6AA 2DN8A 3ZYYX 2HDLA 2NTSA 4NDXA 4OHJA 2XN9C 3NK9A 2KJXA 2K1BA 3U9SA 5EQ0A 4A3MB 3HP3A 2F0JA 5EKIA 2M9VA 2B8FA 1TWCB 2JXMB 3K7AB 2F0KA 1HUMA 3VYRA 3NUCA 3QB3A 2AQ1B 4HMJA 2BOSA 4XIGS 4ABNA 1L0XB 1FD7D 1RF2D 5M9OA 2BDOA 2C9OA 2I07B 3DWPA 1I4RA 2EPBA 2DY8A 2EY1A 4IALA 5C0XI 2XWJB 3V2TA 1KNAA 3KUPA 2QDBA 4IQZA 3I73A 1A2UA 1UAPA 2K5DA 1LV9A 2XIWA 4R8IA 1RTNA 1BCPF 3RLFA 5I2XA 5EPJA 3GTMB 2EY5A 1STAA 4ODGA 3KF8A 3PIP3 3X3NA 4IURA 3J80L 2SOBA 5KNBA 2WKDA 1DJRD 1W6KA 1HQMC 2XNAC 3L3OC 2OT2A 1ZXTA 5CBEE 3DHQA 3CRKC 1G91A 2A68D 1HTLD 1I4GA 2EYFA 5FLXE 1HFGA 5LL6X 5KEEA 1Y8NB 4KD4A 4A3KB 2D5DA 1H9MA 1V1OA 1WTRA 3OPOA 3N6RA 3OIPA 1YNJD 1RDPD 3VR6A 2Q8TA 1E2VA 3HKZB 2HUGA 5ELCA 2ZXRA 3OSOA 3HOZB 4EQOA 2F0QA 1TKWB 2WB1B 1BCPB 3J7YW 1S5CD 2NUCA 1WD0A 4G7HC 1ET6A 2HCIA 4OGQC 1BXTA 3I72A 5CORA 1LTID 3C3LA 1H9SB 1CM9A 3MXUA 3VR3A 4NKLA 4CBVA 1FNUA 3OWFA 3R3OA 3K5MA 2WKCA 1PRTC 2IL8A 1ONLA 4NW2A 1SXTA 1GUGA 3GV6A 1B9NA 3H09A 4CKEA 1STBA 2A6EC 1HUNA 2TMPA 5KRUA 2K28A 1F2YA 1TS3A 2L55A 1QWYA 4KY5A 4G7ZC 2K5WA 1PTOD 2KQ3A 3S15B 4F8MA 4RKBA 2HCCA 5LL6S 3V05A 4ZQ3A 2Z8LA 1PFNA 2F3VA 1DZ1A 2F0HA 1I6HB 1HA6A 2IX3A 2MJ8A 4UDUC 3TP8A 1V1PB 4DNRB 2F03A 4R8NA 2NWGA 2BA1A 1SJED 1E2ZA 3S16B 3SXHA 3Q6SA 5G3LF 5IGDA 4ILWA 3SK6A 1XX8A 2EOTA 5ELDA 3R2TA 2CW0D 1BNZA 3R2IA 2IPKD 5K5PA 4N9TA 2IX1A 1WTOA 1H9JA 2J0TD 3VR5A 5IT9E 4G57A 1EY6A 2NB0A 5I9PA 3S14B 1JWUD 3WOFA 3BS1A 2MP1A 4IFDJ 3QO2A 5CV6A 2K6AA 5FO9B 1I4QA 2F0FA 1CZWA 4PMCA 3GTLB 4QF4A 1I3QB 2R92B 5C3EB 5T1IA 1XXGA 1E2WA 5EPLA 4HN7A 4HSVA 2K01A 3WDNA 4RCNA 5C4ZA 1K8MA 1RCVD 1R4PB 2JEBI 4KJNA 2F0UA 4LJZC 2V4DA 2RDHA 1LT5D 5E4WC 1V8QA 3S17B 5FK9C 1EYCA 3VR4A 4C1NK 1PTOF 5D65A 3FPUB 2KEDA 4TKOB 2JE6I 3KBXA 3M7GA 5IGGA 2NYZD 1VF5C 1LTSD 1B53A 2A6HD 3JAME 4FVMA 1QB5D 3FKIB 1GXDC 2SEBD 5E4XA 2AQ3B 2F3WA 5C0XJ 4C56C 1LTBD 2K33A 1ILPA 2B8GA 1WTPA 1DOLA 2VXWA 1BOSA 4KI0A 2F0DA 2XRSD 2X69A 4LAAA 4PV1C 1SBBB 5D14A 3I8ZA 1PZKD 5KGUA 5C44B 5CV7A 1U9RA 5EBCA 4KKTA 3RZOB 2F0PA 2Z4IA 3U9OA 3URYA 3NP8A 3K59A 3JAML 1A15A 1I6VC 4C3HG 2YU9B 3M4YA 5JEAH 5J1ZA 1H9SA 1IL8A 1UNSA 5JVH3 1WVLA 4DXFA 4RWSC 3HZXA 1SYCA 4CJ0B 2R7ZB 1EL0A 3EJIA 2KCCA 1S5ED 5EGTA 3AMUA 4FF1A 1EQTA 4FF3A 3MVVA 1PTOB 1ENFA 5BN3A 2LS01 4K8JA 5JPMC 4CGYB 1J9OA 3VR2A 4C1NI 5K36H 3J7AV 1QCBD 3NQTA 5JEAG 2O4XA 1TT2A 5EJWA 1AZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTX A;  1B3A A;  2BDN A;  3UI2 A;  4ZLT F;  1IKM A;  2B2U C;  2B2T C;  2K1B A;  2R3Z A;  1J8I A;  1B53 A;  2FJ2 A;  1O80 A;  1NCV A;  3HP3 A;  5EKI A;  1PFN A;  5EPK A;  5EQ0 A;  4O42 A;  1DZ1 A;  1QE6 A;  4MN3 A;  4HCS A;  1DON A;  1GUW A;  3I3C A;  1WTR A;  2MGS A;  1HUM A;  4MHE A;  1WD1 A;  1HA6 A;  1AP0 A;  5T1G A;  5E4X A;  1MSG A;  2KEC A;  3DEO A;  3IFD A;  4CJ1 B;  2MJ8 A;  2RA4 A;  4IUT A;  1NR4 A;  1WTV A;  1ILP A;  2RVL A;  2Q8T A;  2X6L A;  1DOL A;  2MPM A;  2NWG A;  4OIJ A;  4X3T A;  2B2U A;  2B2T A;  1JIC A;  2HUG A;  2K03 A;  5JJZ A;  3MWY W;  4XDX A;  2VXW A;  2X6G A;  3I90 A;  1WTW A;  2N55 A;  1C8C A;  1BF4 A;  4CJ2 C;  3GV3 A;  1PFM A;  4HED A;  2D9U A;  2X69 A;  1WTQ A;  2EPB A;  1O7Y A;  2B2W C;  1ROD A;  2DY8 A;  1M8A A;  1Q3L A;  2Q8R E;  3H91 A;  3Q6S A;  4ZAI A;  5D14 A;  3I8Z A;  1VMC A;  5DNF A;  2B2Y C;  1WD0 A;  1VMP A;  2M2L A;  3N52 A;  1RJT A;  4IUU A;  1XX8 A;  4UAI A;  1RHP A;  1X3Q A;  2EOT A;  2HDM A;  2HCI A;  1U4L A;  1S4Z A;  2CVR A;  2L9H A;  1B50 A;  5COY A;  2KUM A;  1X32 A;  3MTS A;  5CMD A;  1BO0 A;  1PDQ A;  1O7Z A;  2JYO A;  2SDF A;  3IL8 A;  1G2S A;  1MGS A;  1RTO A;  4RA8 A;  4U68 A;  3SVM A;  1KNA A;  5COR A;  1BNZ A;  3KUP A;  1A15 A;  2RSO A;  2FIN B;  2FHT A;  5CBA E;  1EIH A;  2JP1 A;  1CM9 A;  1WTO A;  1LV9 A;  2K04 A;  1SDF A;  2H1E A;  2KEE A;  2XIW A;  1AZP A;  4R8I A;  1XYI A;  1B2T A;  1RTN A;  1BBX C;  2B2W A;  1G6Z A;  2DY7 A;  4HAE A;  2B2Y A;  2FFK B;  5EPJ A;  1IL8 A;  1WVL A;  1X3P A;  2L12 A;  4RWS C;  2MP1 A;  3TN2 A;  3QO2 A;  2RSN A;  2FMM A;  4CJ0 B;  1PFB A;  2KVM A;  3D6W A;  1ML0 D;  3G7L A;  1HFN A;  4XT3 B;  3DM1 A;  3DEP A;  4DN4 M;  1HRJ A;  4IUR A;  2B2V C;  1EL0 A;  3FDT A;  1TVX A;  4IUQ A;  5T1I A;  2L4N A;  1U4M A;  1F9Q A;  2IL8 A;  1MI2 A;  4IUV A;  4NW2 A;  1ICW A;  2N88 A;  4OIK A;  4X3K A;  3I91 A;  1F9S A;  2K05 A;  1MSH A;  5EPL A;  3GV6 A;  1NR2 A;  2J7Z A;  3LWE A;  1SSO A;  4X3S A;  1DOM A;  4HSV A;  1EQT A;  4XT1 B;  4ZK9 B;  1IKL A;  1U4P A;  1CA6 A;  2K01 A;  3F2U A;  1PLF A;  1J9O A;  1QG7 A;  1ZXT A;  1HUN A;  1EIG A;  1U4R A;  1E0B A;  5CBE E;  1DOK A;  2L11 A;  2B2V A;  2K28 A;  1JE4 A;  1F9R A;  5AFW A;  4QUF A;  4R9W A;  4LMQ D;  4RAU C;  1HHV A;  2L1B A;  5E4W C;  1NAP A;  3P7J A;  1AZQ A;  1G2T A;  2NZ1 D;  1ILQ A;  1G91 A;  4QUC A;  1F9P A;  2EE1 A;  1KNE A;  4IUP A;  1F2L A;  1QNK A;  3ONA B;  3R93 A;  4ZKC B;  1ESR A;  1SAP A;  3TZD A;  1HFG A;  5D65 A;  1WTP A;  4ZKB B;  3FPU B;  2KED A;  4X3U A;  1CA5 A;  1B4O A;  2HCC A;  2HDL A;  3KBX A;  5EJW A;  2KOL A;  1EOT A;  2NYZ D; 
#chains in the Genus database with same CATH topology
 2B3G A;  4KY6 A;  3CCV A;  3UI2 A;  2R3Z A;  3VYU A;  1HPC A;  2BH8 A;  1SNM A;  3I2Z A;  4L5Q A;  1I4H A;  4BY7 H;  4J1M A;  3NTH A;  3VYT A;  4A3E H;  2I0Q A;  3F8T A;  4IPD A;  1VQI A;  5T1G A;  2A69 C;  2EQS A;  2JA6 H;  4AYB G;  3PUX A;  5FLM G;  1B3Q A;  2N8N A;  1FR3 A;  1I50 H;  2PMZ E;  3NBI A;  5M5Y H;  1VQ7 A;  3EIV A;  3HOV B;  1BCP C;  3GTP B;  3I7F A;  4OIJ A;  2B2T A;  5HUR A;  1A2T A;  4LW1 A;  2X6G A;  1V1P A;  1W6J A;  4LF6 L;  5K36 G;  2UUC Q;  2Q2T A;  1M90 C;  3GV3 A;  5M3M G;  3H91 A;  2QEX A;  2ENB A;  4QIW B;  4AQY L;  3ND8 A;  5JJL A;  4L5T A;  4K5V A;  4ZK9 B;  1JOR A;  3S1M B;  1NE3 A;  2KUM A;  1X32 A;  3IL8 A;  3H15 A;  4F87 A;  2RSO A;  1DYQ A;  1VQH A;  4BY7 G;  3S2D H;  4A3E G;  3S2H H;  1BBX C;  4GOP C;  1CT1 D;  2JA6 G;  1K8A C;  2UU9 Q;  2NVQ B;  3MHB A;  4UP7 A;  3IRB A;  3AEV A;  3OHX C;  3KF6 A;  4C3I B;  3H3V I;  2AUJ D;  3CRL C;  4DV2 Q;  1XWE A;  2F0N A;  1GJX A;  4X64 L;  3FDT A;  2OEO A;  4ZRZ A;  3EA6 A;  1XPU A;  1E1O A;  3QJY A;  1STN A;  3SK8 A;  2N88 A;  4DGZ A;  1KQS A;  3OW7 A;  2AKW B;  1EEI D;  3P20 A;  1IW7 C;  2LY7 A;  2MNA A;  1I5F A;  1G51 A;  1Q12 A;  3ITP A;  1D6E C;  4DU9 A;  4G7O C;  4KN7 C;  3NE5 B;  2B2V A;  2Z6K C;  1ZYR C;  1ENC A;  2UUA Q;  4O0A A;  1NAP A;  2BA0 A;  3K5O A;  2E75 C;  4QUC A;  2Y0S B;  3D3R A;  3FPP A;  4IUP A;  4NB3 A;  3TP6 A;  1SE4 A;  1SAP A;  3LGJ A;  4CHT B;  5C3X A;  2F1M A;  1HXY D;  3S24 A;  2E74 C;  4B3M Q;  2K5V A;  1JMC A;  2MHV A;  1LT3 D;  2B2T C;  1J8I A;  4IJL A;  4TQU S;  1KC8 C;  3RN2 A;  1II3 A;  1QE6 A;  1EY5 A;  4K2K A;  4DF7 A;  3TQY A;  5M3F G;  3T1Y Q;  3GTO B;  4A3L H;  1L1O B;  1YHB A;  2ID0 A;  1A3T A;  4RH6 A;  1VQB A;  3G6J B;  5JVG 3;  1TII D;  4OON A;  4MIU A;  3M4Q A;  4QJF A;  2R61 A;  4B3R Q;  4DAY A;  3GQB A;  4DR4 L;  3A8J E;  1EEF D;  1ASY A;  1DD2 A;  1SLJ A;  4LF7 L;  1WTQ A;  1TWF H;  4DK0 A;  1Q3L A;  2F0L A;  4IUN A;  4EX5 A;  1D2B A;  1VMC A;  4JBM A;  3PUZ A;  2NVX H;  2IT1 A;  1W2B A;  1PH3 A;  3J7A 5;  1FJG Q;  3N52 A;  1IZ6 A;  2HDM A;  2JN4 A;  5COY A;  2D0P A;  2NBF A;  3S9W A;  4FF2 A;  2RDF A;  1B44 D;  4FP5 D;  5DLQ E;  4A3G B;  4BBR B;  3A74 A;  2D62 A;  3VA7 A;  2NVY H;  4QCL A;  4AH6 A;  2EYM A;  4I7A A;  3H3V C;  4A3L G;  4HAE A;  3J80 E;  4JI6 L;  1MD2 D;  1T5E A;  2L12 A;  2QKI C;  3EBE A;  1SMY D;  1MJC A;  4APV A;  3HOX B;  2KVM A;  3T56 B;  3CCU A;  3P75 A;  3CAM A;  3TEH B;  3DEP A;  4BWG B;  1QVG A;  1HZB A;  2B2V C;  1TVX A;  4BS9 A;  1SE2 A;  2PCF B;  4LF8 Q;  4A3C G;  2ZXP A;  4OWW B;  1KL9 A;  1KHI A;  3ERO A;  1Q86 C;  4IOA A;  2N3S A;  1NR2 A;  4X3S A;  4BY1 B;  1EIY B;  4BA2 I;  1RKN A;  5C4X B;  3TSS A;  3W1B A;  3I4N H;  2F0M A;  2F0I A;  4DK1 A;  4N9P A;  1MJE A;  4A93 H;  1TWA H;  3FP9 A;  1Z47 A;  4LFA L;  1SYF A;  4OO1 H;  1E22 A;  4F7X A;  1B9M A;  4YWL A;  4GNX A;  1EQQ A;  1HHV A;  2A73 B;  2Q2I A;  3AU7 A;  2Z1C A;  1N34 Q;  2NZ1 D;  4JI7 Q;  1KNE A;  3HEJ A;  3ONA B;  2R93 G;  3A8K E;  1DXM A;  3A56 A;  3OMG A;  2E2H H;  4EQN A;  5JJK A;  1EY7 A;  3NEL A;  4F88 A;  1QNU A;  1O80 A;  3L2P A;  1S3O A;  2KBN A;  1D5Z C;  1OXU A;  2RKS A;  4JI8 Q;  3PIP A;  5IYC H;  3M3Y H;  4X65 Q;  1VQA A;  1ENA A;  4Y7N H;  1MSG A;  4BBS B;  2KEC A;  2EJM A;  4H02 A;  3I4N G;  3AFP A;  3K81 C;  3MFG A;  1PH9 A;  4A93 G;  4RGO S;  4DV0 Q;  2RVL A;  3A5Z B;  3OMC A;  3UE0 A;  4EGV A;  4OO1 G;  1TS5 A;  1V9P A;  1ET9 A;  2F0G A;  4PZ6 A;  2M00 A;  2LMC B;  5NUC A;  1C8C A;  1R9T H;  2D9U A;  4KJO A;  1LT6 D;  5M3F B;  1LTR D;  4A3F G;  2CH4 W;  3KLS A;  5DNF A;  1Z9F A;  4IUU A;  1HTP A;  3MFY A;  2BH2 A;  5CC4 A;  3GTQ H;  2EXD A;  2QDL A;  2SDF A;  1AFP A;  5HY6 A;  3KYH C;  1VQD A;  3K58 A;  3HRZ C;  1EY8 A;  1E3P A;  3ULJ A;  4TSS A;  2F4V L;  1B2T A;  4YY3 L;  4KHZ A;  1C9O A;  1SYB A;  5IYC G;  4DV1 Q;  2UXB L;  1LUZ A;  3O13 A;  5LMU L;  5ELB A;  2RSN A;  2VY3 A;  3RZD B;  4MNO A;  4R4I A;  3G7L A;  3GTG B;  2DNE A;  4CKC A;  3M7N A;  4X62 L;  4DUZ L;  4FNF A;  1SMX A;  2VL6 A;  3HOU B;  5JOB A;  1TQO A;  3PUV A;  2A74 C;  4GNX C;  1K3B C;  2PW7 A;  3TP7 A;  2K32 A;  3TP5 A;  1ICW A;  1TWH H;  1CKO A;  4P71 A;  3V96 A;  1C0A A;  3AB9 A;  3HS0 C;  2MQH A;  2KCM A;  3LWE A;  3NXW A;  1KXL A;  3BDL A;  2IHE A;  4B3S Q;  2K5H A;  4GLV B;  1CQV A;  2C5C A;  1I94 L;  1OTC A;  4Z9C B;  4E6I A;  1LAB A;  1Y1W B;  4JK1 C;  4JV5 L;  3BDO A;  4LFC Q;  2G9D A;  3E9I A;  4HIK A;  3IAY A;  1OXT A;  1LTG D;  2EVB A;  3MC0 B;  3F2C A;  5JPN C;  4IFD H;  1F2L A;  2ALY B;  3S1N H;  2NN6 I;  1VQC A;  1Y1V B;  3Q22 A;  4DR5 Q;  1STY A;  4DKA C;  5IOD A;  3I4O A;  2HD3 A;  4C3J G;  1IBK L;  1VQ4 A;  2PZT A;  1VQF A;  1XTD A;  4PMB A;  4Q0F A;  2MGS A;  1PYS B;  2B39 A;  3FMC A;  3U58 A;  1J6Q A;  3LNN A;  3A0J A;  3A54 A;  4IUT A;  3OW2 A;  2ZTD A;  1QZH A;  3J7A F;  3K5N A;  1AE3 A;  3NHH A;  4A3B H;  4XTC S;  5CV4 A;  1UE5 A;  2B2U A;  2K03 A;  4C2M H;  2JA7 G;  2K7V A;  4P73 A;  4GKK L;  5EKL A;  3F2D A;  1IYU A;  2AUK A;  3CPW A;  4CJ2 C;  3CQZ B;  1KAB A;  2VUM H;  1ROD A;  2F0W A;  2JA8 H;  5M5X B;  4NP5 A;  1PA6 A;  1CZG A;  4IFD G;  1KRT A;  4JVZ A;  2G9H D;  5L37 A;  1B50 A;  4RKL A;  3EQL C;  1PH4 A;  2ES2 A;  4L5R C;  1N32 Q;  3GTK B;  5IP7 H;  2E2I B;  1GUS A;  2MO1 A;  2EYO A;  1HR0 L;  3W5O A;  1YNN C;  4K14 A;  4K6L A;  4BA1 I;  5C0X H;  1MIU A;  4OX9 L;  1GD7 A;  4YCW A;  5EKK A;  1SFO B;  4A3F B;  1TXY A;  4TVA B;  3SK4 A;  2LFN A;  4DAM A;  3GDE A;  1EYG A;  4L5S A;  1PFB A;  4A3B G;  1VS0 A;  3DM1 A;  2B63 B;  3A5U A;  3KFU A;  1X56 A;  1F2M A;  1V1Q A;  1MI2 A;  2PQE A;  2A19 A;  3NEN A;  2VUM G;  3PV0 A;  1PRT D;  4NPS A;  2JA8 G;  2J7Z A;  3ND9 A;  4DXG A;  3G48 A;  4KY7 A;  2CQO A;  4A3J B;  2H4O A;  2XVS A;  3Q24 A;  2ZJR A;  4HMI A;  2I5M X;  5FJ8 H;  1Z7T A;  3ULL A;  1A63 A;  2JA9 A;  4U67 3;  1JCK B;  5IP7 G;  3HOY H;  1STH A;  2A6E D;  1B1Z A;  1HZC A;  5BR8 L;  4R9W A;  4RAU C;  3TBI B;  1RL2 A;  5LMN L;  1G2T A;  1PFS A;  5EBD A;  2O2L D;  5C0X G;  3M4O B;  1HZA A;  1S5F D;  3L0O A;  3QOJ A;  3TZD A;  5JAV A;  1XMQ L;  2PNH A;  5GAH C;  3HOW H;  1Y69 U;  3M85 A;  3SE0 A;  2KOL A;  2N78 A;  1L1O C;  2EY6 A;  4DK3 C;  3PO3 B;  1SYD A;  2B2U C;  3UDF A;  4DNI A;  4L63 B;  1N36 Q;  2QCP X;  2ZT9 C;  4IN3 A;  4GLA C;  2YTV A;  4GZY C;  1OXX K;  1EQV A;  3FRP B;  3NWS A;  4OEL B;  3TRZ A;  2XGT A;  5FJ8 G;  1D5M C;  4JYA L;  1P8L A;  4MTN A;  2XRQ D;  3HOY G;  1C48 A;  5M5W B;  2N49 A;  4NXM L;  1BBU A;  1HJP A;  1LTL A;  1LT4 D;  4C3J B;  2R7F A;  1V43 A;  5E7N A;  2BE5 C;  4ME5 A;  4H0L C;  3GP7 A;  3MXG A;  1JOK A;  2ZJQ A;  4JCV E;  2EJG C;  1IXR A;  3HOW G;  1PDQ A;  2R6G A;  1FYC A;  1UUP A;  2I46 A;  1AP0 A;  2SNS A;  2PNR C;  1EY9 A;  1S5D D;  3ULP A;  1F2Z A;  4OWX B;  2K04 A;  2XSC A;  3STB C;  1QVF A;  2JA5 B;  4PZ8 A;  2WAQ B;  2Z9H A;  5ELE A;  1JT8 A;  3BJU A;  2DY7 A;  1IHZ A;  2J4X A;  2O5I C;  1SJH D;  1PZJ D;  2E2J B;  4PZ7 A;  1KAA A;  3TN2 A;  1YNX A;  4N8F A;  5I4D A;  1BUV T;  1HNX Q;  3PGZ A;  3CPF A;  2IJ0 A;  4XQN A;  2HQE A;  4JBW A;  3DLL A;  1R4Q B;  4JOI C;  4X3K A;  3K57 A;  3D31 A;  1DOM A;  4EQ5 A;  3MEH A;  4CDE C;  1JB7 A;  4XYO A;  3E6Z X;  3CCM A;  4A3D H;  1PLF A;  1SNC A;  1U4R A;  1E7Z A;  1E0B A;  2L15 A;  5DEH A;  2UU9 L;  3GTJ H;  3K8A A;  4DNT B;  4CDF C;  2NN6 H;  4A3I H;  1HNZ Q;  4UHV A;  4DV2 L;  4DV7 Q;  4BXX G;  1AZQ A;  1SND A;  5BN5 A;  2NVT H;  3H0G H;  5CV5 A;  1L0W A;  4K2L A;  4X3U A;  2K5N A;  1B4O A;  1JOO A;  4B08 A;  1PH6 A;  1VQ5 A;  1PYW D;  4PG3 A;  4DR1 Q;  1WTX A;  1B3A A;  5GRO A;  4UY8 C;  4WFN 3;  3VA5 A;  4MN3 A;  2BCO A;  4HCS A;  4K6D A;  4KTA A;  2UUA L;  3L9A X;  3F2B A;  3E0E A;  1HR0 W;  3QG1 A;  4A3M H;  1NR4 A;  1FL0 A;  4KHP Q;  3T13 A;  4ME3 A;  1TWC H;  4A3D G;  1WCM B;  3NPP A;  3K7A H;  3BVM A;  2PZW A;  3MWY W;  4QY7 A;  5D3D A;  4A3I G;  1VQO A;  4B3M L;  4XXE A;  1GUN A;  3SEB A;  1K8O A;  5DM7 3;  1T9H A;  3SHL A;  3T1Y L;  3T53 B;  2Z6B A;  3T1H Q;  1S4Z A;  4K5X A;  3MTS A;  1X3F A;  4JI5 Q;  1LTA D;  2HT1 A;  4DR3 Q;  2LXJ A;  4LWC A;  4FO2 A;  2CQA A;  2I5L X;  1YJN A;  1LYL A;  3TZU A;  4B3R L;  5C4J B;  1KLG D;  4QQB X;  2OF1 A;  2B29 A;  1X3P A;  4A3M G;  2QW7 A;  4GKJ Q;  5LMN W;  4HJ9 A;  4ZUJ A;  1KTK A;  1FJG L;  3WOE A;  5D3I B;  4H7B A;  1HCZ A;  2L4N A;  3GTM H;  3KLS X;  3TME A;  3L7Z C;  2YYZ A;  1QZG A;  2MO0 A;  1OO9 B;  3NSW A;  2WII B;  3PO2 B;  5GQO A;  1HNW Q;  1T5X D;  2WAC A;  3UDG A;  4KHV A;  1EIG A;  3QOL A;  3T4A C;  4DAV A;  2L11 A;  3PIO A;  3BYY B;  4LUV A;  4IZ8 A;  1JWM D;  1EZ8 A;  2EE1 A;  3Q8D A;  4C3H B;  1QNK A;  4POF A;  4LF8 L;  4ZKC B;  5FOB B;  3RD4 A;  1CKM A;  1KDC A;  3S1Q B;  1D8L A;  3MA2 B;  4ID6 A;  1Z6H A;  3RR5 A;  2BDN A;  1MBY A;  3CCQ A;  1SRU A;  2FJ2 A;  5CV8 A;  4ZCK A;  5IWA Q;  1XNR Q;  4N8X 1;  5FLX c;  2SNM A;  1GUW A;  3I3C A;  3I4L A;  1WD1 A;  4MHE A;  1K83 B;  3HKZ E;  4DAP A;  3I4M B;  3HFZ B;  4A3K H;  4S3S A;  1JC7 A;  4CJ1 B;  1N34 L;  1PH5 A;  1SNP A;  1JOQ A;  3CCJ A;  4JI7 L;  2K4K A;  3E9H A;  3TDQ A;  4GLX A;  4X3T A;  4JG2 A;  1VF7 A;  1PYB A;  4FXK C;  2WIN B;  2KEN A;  1NUC A;  2CWA A;  4A76 A;  4X66 Q;  1BF4 A;  5IP9 H;  1PFM A;  1VQ6 A;  4J8Q A;  2HIX A;  5C5L A;  4LK1 C;  1EWH A;  4ZAI A;  3QIA A;  4JI8 L;  2YV5 A;  1CUK A;  4X65 L;  2E5L Q;  4HCE A;  1VMP A;  2M2L A;  5HGT A;  5HGQ A;  3HOZ H;  2L9H A;  2CVR A;  1FGU A;  4JI0 Q;  1SE8 A;  3T51 B;  1ZEQ X;  2KCN A;  1CFM A;  1NMF A;  1TS2 A;  5CYU A;  2KCT A;  4KLK A;  4DV0 L;  3QWN A;  2ZM6 Q;  2KEE A;  1JE5 A;  1JWS D;  3C1F A;  2VQF Q;  1G6Z A;  1PXU A;  2K52 A;  2Q2U A;  1VDZ A;  2HHH Q;  4A3K G;  4JPB W;  2VZA A;  1X65 A;  3OWE B;  3CXC A;  5KNC A;  1H9K A;  2PI2 E;  4YHH Q;  3DUZ A;  4AYB B;  1YJW A;  1NMG A;  4XT3 B;  3RMH A;  4B9W A;  3PMF A;  4YIJ A;  1TWG B;  5IP9 G;  3C46 A;  2Q2H A;  3TS0 A;  2UXD Q;  3HKZ G;  2FXQ A;  4DV1 L;  1IKL A;  4RGM A;  3HOZ G;  4LUZ A;  5M3M B;  4FXD A;  4FF4 A;  1QG7 A;  1IW7 D;  4RG1 A;  4AQY Q;  1QIL A;  2WB1 G;  1IBL Q;  3HG9 A;  3DMU A;  1F9R A;  1G29 1;  3W2D A;  2K5Q A;  2A68 C;  1IYV A;  2Q8I B;  4B9X A;  2QF7 A;  1ZYR D;  5IGB A;  4NXN Q;  1W3S A;  1ILQ A;  1F9P A;  2O5J C;  1GOZ A;  4BY7 B;  4A3E B;  4KN4 C;  3RN5 A;  5A35 A;  1G6P A;  1ZKO A;  4XQQ A;  4JI4 Q;  3CD6 A;  2MPM A;  4RCO A;  2JA6 B;  4ZLT F;  5C3W A;  4B3S L;  2ZJP A;  1Y8P B;  1I50 B;  1BBW A;  3HKS A;  5M5Y B;  3S15 H;  3CCE A;  3R8B A;  3D0F A;  4LF4 L;  4JI1 Q;  5DM6 3;  3PQI A;  1YNJ C;  1FVI A;  4DR2 Q;  4LFC L;  3MXP A;  3SDZ A;  1LO5 D;  3FVQ A;  4HIO A;  3X3M A;  3NBH B;  1JJG A;  1GKH A;  1Q90 A;  1I6H H;  4DV6 Q;  1EY4 A;  1QJO A;  1JIC A;  5BN4 A;  3CU7 A;  4H44 C;  1X3G A;  2PMZ B;  2EYP A;  3J81 i;  4DR5 L;  4JI3 Q;  4G4K A;  1F77 A;  1O7Y A;  2EYH A;  2EY2 A;  1J5E Q;  1LM0 A;  4KV6 A;  4GS3 A;  3S2D B;  4CKB A;  4LF5 Q;  1EIF A;  3S2H B;  5FO8 B;  3BDC A;  1JR0 D;  4U68 A;  3S16 H;  4P74 A;  2A8V A;  5CBA E;  4DV5 Q;  1LLR D;  5IIF A;  4IPC A;  4GN3 B;  4P2C B;  3UE1 A;  4IOC A;  2WP8 J;  3I70 A;  1QVC A;  2FFK B;  4Y52 H;  2EYL A;  2OXP A;  1NTG A;  4RGN A;  5IT9 c;  2KHJ A;  4KD3 A;  4HTH A;  3AQQ A;  2K50 A;  5C4H A;  1PZI D;  3S14 H;  1N32 L;  2F0V A;  5FKA C;  1JJ2 A;  3P1H A;  1MSH A;  3NWT A;  4FXG C;  4OL7 A;  4R1J A;  3GTL H;  4RHS A;  1I3Q H;  3H3V H;  2R92 H;  5KYI A;  5C3E H;  1Q81 C;  3MEF A;  1PV4 A;  2P5Z X;  5IGE A;  4WJ4 A;  1HA5 A;  3K0X A;  1DOK A;  1JE4 A;  1YBY A;  1O78 A;  3BU2 A;  1PTO C;  1XPR A;  1XNQ Q;  4EQP A;  1KDA A;  1RD9 D;  2IW3 A;  1E24 A;  3BYT B;  4ZKB B;  3RLO A;  5J39 A;  1DCZ A;  5IGF A;  1TY0 A;  1WTW A;  3S17 H;  1CHP D;  3NTI A;  2AQ2 B;  5KYL A;  3H94 A;  1NCV A;  1GVP A;  5FLX L;  2GA4 B;  2E76 C;  2IWH A;  1D5X C;  5G3L D;  2G5D A;  3E0J A;  3S1R B;  1KLU D;  1PMR A;  1STE A;  4EVO A;  2CWP A;  4ZYS A;  2F3I A;  3DEO A;  2R92 G;  3KK7 A;  5IOC A;  1N8R C;  5C3E G;  3JAM c;  1AEX A;  1N9W A;  1TWF B;  4QMG A;  3FKI H;  3CKI B;  2JSO A;  4XT1 B;  1A3V A;  2NVX B;  3EVQ A;  2N55 A;  3OTO Q;  2PYK A;  1VQL A;  1SEB D;  4HJ7 A;  4HED A;  1BKB A;  2MUY A;  4LUO A;  4LFA Q;  1SNO A;  2Q8R E;  1SE3 A;  1N36 L;  1EYA A;  4V19 0;  4DV3 Q;  3A7L A;  2CW0 C;  4UAI A;  5E3F A;  1RHP A;  1TY2 A;  2NVY B;  5I9O A;  4R4T A;  1A6X A;  4P72 A;  3LX0 A;  1BO0 A;  4RA8 A;  4RHR A;  4HID A;  4LFB Q;  2R93 B;  4YWM A;  1Y8O B;  3RLN A;  1EIH A;  4DPG A;  3J80 i;  2JP1 A;  1WYD A;  2H1E A;  2I5H A;  5C44 H;  1Q1B A;  2PW5 A;  1KDB A;  3SR1 A;  3RZO H;  1FNW A;  1EWI A;  3A8I E;  4TRD A;  2C35 B;  1HQR D;  4QGU A;  2YU9 H;  2AHO B;  2UUB Q;  1H9R A;  1H95 A;  2K14 A;  3FKI G;  1YJ9 A;  1X3E A;  3I4N B;  4RMF A;  1S5B D;  2PO4 A;  4DV4 Q;  1LTT D;  4A93 B;  1TWA B;  1CQF A;  1ASZ A;  4POG A;  2DNC A;  4CDD C;  2K05 A;  4WRD A;  2R7Z H;  4KK7 A;  1K9M C;  1SYG A;  4O2D A;  2EZV A;  2KA7 A;  5CR3 A;  4ALP A;  1YZ6 A;  3Q23 A;  4DR7 Q;  3D4R A;  2ICI A;  1SYE A;  4ZUI A;  3J7Z C;  1SRO A;  2MFI A;  4R4O A;  4QUF A;  1PTO H;  3F1Z A;  1HNX L;  3CCR A;  3KJP A;  1JB3 A;  3JC6 6;  2E2H B;  2L5T A;  1TU2 B;  3C2P A;  3DXJ C;  1KAW A;  3MAQ A;  3D4W A;  1CA5 A;  3M3Y B;  2LXK A;  2A6H C;  2L0C A;  1TR5 A;  3CW2 C;  4Y7N B;  1SNQ A;  1IKM A;  1BR9 A;  3K5L A;  2QA4 A;  3BZK A;  1K8G A;  4H13 C;  2A1A A;  1DON A;  1HNZ L;  5I6Y A;  2R7Z G;  1NBW A;  2ZTC A;  3IFD A;  2E8G A;  3ZJY C;  1R9T B;  1GUO A;  4QIW E;  3I90 A;  3NBH A;  4DR1 L;  2RBM A;  3GTQ B;  3D6C A;  1AW7 A;  1FNV A;  1BVS A;  3K80 C;  3CC7 A;  1UE1 A;  2EXZ A;  1EWC A;  3HOV H;  3GTP H;  1M8A A;  1VQN A;  1LAC A;  2OCE A;  4JW0 A;  1EFI D;  2Z4H A;  3J81 j;  1IBM Q;  2ICE C;  4PQX A;  4UP9 A;  3T16 A;  3PSI A;  5IE8 A;  2F0T A;  1N33 Q;  3ICE A;  1G2S A;  1RTO A;  2CH4 A;  4KHP L;  2FIN B;  2FHT A;  3J81 c;  5KIX A;  1BDO A;  3CC2 A;  3SK5 A;  5ELF A;  2NTT A;  4UP8 A;  4QB4 A;  3S1M H;  1JQY D;  2B2W A;  1EU4 A;  1YNN D;  2B2Y A;  1C7Y A;  2F0S A;  1VQE A;  2JEA I;  3PO2 H;  1TWH B;  3D4D A;  5IT9 L;  2FMM A;  3D6W A;  3T1H L;  2K75 A;  3VDY A;  4QL5 A;  4JI5 L;  1F9Q A;  1OXV A;  3MXN B;  2NVQ H;  3IFT A;  4DR3 L;  1DM0 B;  5I2Y A;  3KDF B;  3W1G A;  4C3I H;  2JA7 B;  3Q0A A;  1D1I A;  1L0Y B;  2XWB B;  3GO5 A;  3NTK A;  3PUW A;  3LWU A;  1KRS A;  5CGK A;  2KHI A;  1QOH A;  2UUC L;  4DR6 Q;  1QUQ B;  2RDG A;  4V0B A;  3PCO B;  4O1N A;  1O7L A;  4GKJ L;  2DUD A;  3S1N B;  1WFQ A;  3BVG A;  4KKU A;  1UE6 A;  4M1U B;  3P7J A;  3BZD B;  2QEJ C;  5LHY 1;  3R93 A;  2R7D A;  1ESF A;  1S72 A;  2D2C C;  4RFB A;  1PRT F;  2OQ0 A;  2VB2 X;  1KD1 C;  3PUY A;  4OX9 Q;  1K73 C;  1EOT A;  4PMW A;  5EPK A;  1EZ6 A;  4K5W A;  2JJQ A;  1NY4 A;  4A3B B;  2TSS A;  5J3B A;  4C2M B;  4C3I G;  1DGS A;  1YIJ A;  5C5M A;  1M4V A;  1D1K A;  2PQA B;  4WJW A;  3DWQ A;  2VUM B;  5FO7 B;  4B3T Q;  2JA8 B;  4JI2 Q;  1CSP A;  3GTO H;  5JJZ A;  1M1K C;  1YHQ A;  4XDX A;  2CHB D;  3BVZ A;  4XYQ A;  3B6Y A;  2IHF A;  3KLR A;  1PH1 A;  4ULL A;  3H6M A;  2AWN A;  2B2W C;  5IWA L;  4XQJ A;  1XNR L;  1XMO Q;  2B2Y C;  4RGT A;  2H5X A;  3KLW A;  2BE5 D;  2EJF C;  3EFX D;  2JYO A;  3G4S A;  2JQO A;  3C1E A;  3OOC A;  3K0Y A;  4DFA A;  5I6W A;  3IKJ A;  2PZU A;  2Y0S G;  1GHJ A;  1STG A;  1X6O A;  1XYI A;  5A2Q E;  2JK8 A;  2UXC Q;  2NN6 G;  3KF8 B;  1TWG H;  3STB D;  4X66 L;  3BG3 A;  4HSP A;  2ZXO A;  5J22 A;  3A55 A;  4A3G H;  4BBR H;  3H0G G;  1BQQ T;  5TSS A;  1ML0 D;  2E5L L;  2F4I A;  4X6A H;  1HFN A;  3CHB D;  4JC0 A;  4DN4 M;  1PH7 A;  4JI0 L;  1NSN S;  3J80 c;  1U4M A;  4OEM B;  4WOR A;  4FYD A;  2GVB A;  4NMZ A;  4DA2 A;  2VNU D;  4OO1 I;  4OIK A;  3HOX H;  2ZM6 L;  3HOY B;  5KND A;  1Q1E A;  1SSO A;  2PPB C;  4M8A A;  3HGB A;  2HIV A;  1U4P A;  2VQF L;  2Z6K A;  1GO3 E;  1PRT B;  3F2U A;  2HHH L;  1CI3 M;  3D8G A;  1UE7 A;  4BY1 H;  5C4X H;  4YHH L;  5AFW A;  3KJO A;  5A2Q L;  3HOW B;  2L1B A;  5ISR A;  4L8J A;  1Q8I A;  1ESR A;  2WV6 D;  1EY0 A;  4I7Z C;  1C4Q A;  3E5S A;  4A3G G;  2UXD L;  4BBR G;  4J6H A;  1GUT A;  2D0O A;  4HR7 B;  2A5H A;  3NQI A;  2EDG A;  1CHQ D;  3KBG A;  3CC4 A;  1WOC A;  3CP0 A;  4O42 A;  3J81 E;  5DAU A;  2AMC B;  5E1F A;  2FMC A;  1IBL L;  4IPH A;  1GM5 A;  3PIO 3;  4OWT B;  3HOX G;  4K8I A;  5JEA J;  3MZ5 A;  4NXN L;  2RA4 A;  1VCI A;  1WTV A;  2ZTE A;  2CCZ A;  4HIM A;  5IGC A;  1TS4 A;  2X6L A;  3TS2 A;  2EYJ A;  3JAM i;  4KMU C;  4BY1 G;  3VYS A;  4BBS H;  4JI4 L;  5C4X G;  1OXS C;  3OIQ A;  1I4P A;  1CK1 A;  3RUZ A;  1SR3 A;  2RF4 A;  4Q5V A;  1O7I A;  2F0O A;  5IYD H;  4JI1 L;  1EOV A;  3NEM A;  1RJT A;  4I65 A;  1X3Q A;  2VQE Q;  4DR2 L;  1U4L A;  1XTC D;  5CMD A;  4LF9 Q;  3FEW X;  1O7Z A;  1MGS A;  2VB3 X;  5M3F H;  1X54 A;  3SVM A;  4K0K Q;  2A69 D;  3J81 L;  3BZC A;  4DV6 L;  3ERQ A;  1G8Z D;  2WB1 E;  1EUJ A;  1EYD A;  1SDF A;  2E2D C;  3ERS X;  4PNY A;  5EAY A;  1BCP D;  4L6T B;  4DUY Q;  4JI3 L;  3K6O A;  1SMY C;  1AN8 A;  1UEA B;  1FGB D;  2WFW A;  5AJ3 Q;  1J5E L;  1A3U A;  1CTM A;  4LF5 L;  4KKS A;  2F0E A;  1HRJ A;  4IUQ A;  4BBS G;  4A3D B;  2DJF C;  4IUV A;  3I91 A;  1F9S A;  4DV5 L;  2AWO A;  3RZD H;  3GTJ B;  4A3I B;  3GTG H;  5IY0 A;  1I4X A;  3MXN A;  5CV9 A;  3GD7 A;  2LKV A;  3A7A B;  3HOU H;  5IYD G;  1CA6 A;  3KDF A;  4IFD I;  1A0I A;  3U4Z A;  1PVO A;  2NVT B;  3H0G B;  4YWK A;  3W3A A;  2GVA A;  1VQK A;  2QIL A;  1VQG A;  1EU3 A;  2IX0 A;  4LMQ D;  1CKN B;  1QUQ A;  1K0S A;  1GHK A;  2RQX A;  2KHS A;  3DWA A;  5F2D A;  5C6A A;  2DN8 A;  1Y1W H;  3ZYY X;  3S1R H;  2HDL A;  2NTS A;  4NDX A;  4OHJ A;  4LF6 Q;  2XN9 C;  1X9N A;  3NK9 A;  2KJX A;  2K1B A;  3U9S A;  4A3C H;  5EQ0 A;  4A3M B;  3HP3 A;  2F0J A;  3FHW A;  5EKI A;  2M9V A;  2B8F A;  1TWC B;  1Y1V H;  1Q7Y C;  3AYH B;  2JXM B;  3K7A B;  2F0K A;  1HUM A;  3VYR A;  3NUC A;  2YTY A;  3QB3 A;  2AQ1 B;  4HMJ A;  4WJ3 M;  1B8A A;  2BOS A;  4XIG S;  3HOU G;  1XNQ L;  4ABN A;  1L0X B;  1D7Q A;  1FD7 D;  1IYJ B;  1RF2 D;  5M9O A;  2BDO A;  2C9O A;  2PQA A;  2I07 B;  3DWP A;  2R93 H;  1YVC A;  1I4R A;  2EPB A;  2DY8 A;  2EY1 A;  4IAL A;  1Y1W G;  1VQP A;  5C0X I;  4X64 Q;  3TRE A;  3CQZ H;  2XWJ B;  4MZ9 A;  2GN5 A;  3V2T A;  5JJI A;  1KNA A;  3KUP A;  2QDB A;  5M5X H;  4IQZ A;  1Q46 A;  3I73 A;  1A2U A;  1UAP A;  2K5D A;  1LV9 A;  2XIW A;  4R8I A;  1Y1V G;  3I55 A;  1RTN A;  1BCP F;  3RLF A;  5I2X A;  3OTO L;  3GTK H;  2E2I H;  5EPJ A;  3GTM B;  2EY5 A;  1HZ9 A;  1STA A;  4ODG A;  4IO9 A;  4JBJ A;  3KF8 A;  3UDI A;  3PIP 3;  4DV3 L;  3X3N A;  2OWO A;  4IUR A;  3J80 L;  1NNX A;  1SFO H;  2SOB A;  5KNB A;  4A3F H;  4R4Q A;  3ER0 A;  4LFB L;  2WKD A;  1S40 A;  1DJR D;  4J15 A;  1YIT A;  1U5K A;  1W6K A;  1HQM C;  2XNA C;  3M9B A;  3L3O C;  2B63 H;  4GN4 B;  2OT2 A;  2VW9 A;  1PHJ A;  1ZXT A;  5CBE E;  1PH8 A;  3G71 A;  2UUB L;  3CCL A;  3DHQ A;  3CRK C;  1UEB A;  4A3J H;  4LNQ A;  1G91 A;  4DV4 L;  2A68 D;  1HTL D;  1I4G A;  1X55 A;  4MTK A;  1L2F A;  2EYF A;  5FLX E;  1HFG A;  5LL6 X;  5KEE A;  1Y8N B;  4DR4 Q;  2Z0S A;  4KD4 A;  4A3K B;  4LF7 Q;  2D5D A;  1H9M A;  2DGY A;  3M4O H;  4DR7 L;  1V1O A;  1WI5 A;  1WTR A;  3OPO A;  3N6R A;  3OIP A;  3PO3 H;  5IYB H;  1YNJ D;  2B63 G;  3AFQ A;  5ELO A;  2RHQ B;  3OYY A;  1RDP D;  3VR6 A;  5GAD C;  1RIP A;  3K7U C;  1E2V A;  2Q8T A;  3HKZ B;  2HUG A;  3PF5 A;  5ELC A;  2ZXR A;  3OSO A;  3U4V A;  3SGI A;  3HOZ B;  4EQO A;  3CF5 A;  4A3J G;  2F0Q A;  4JBK A;  4JI6 Q;  1TKW B;  2WB1 B;  1BCP B;  2OQK A;  3J7Y W;  1S5C D;  2NUC A;  1WD0 A;  4FDB A;  4G7H C;  5M5W H;  2EIF A;  1ET6 A;  2HCI A;  3DM3 A;  2WAQ E;  5GAG C;  4C3J H;  4OGQ C;  1BXT A;  3PF4 A;  3I72 A;  5COR A;  1LTI D;  3C3L A;  1H9S B;  1CM9 A;  4UPA A;  3MXU A;  3VR3 A;  4NKL A;  4CBV A;  1U0L A;  3PO3 G;  5IYB G;  2JA7 H;  4LF4 Q;  2JA5 H;  1FNU A;  3OWF A;  3R3O A;  1IBM L;  4GOP B;  3K5M A;  2WKC A;  1N33 L;  1PRT C;  2IL8 A;  2E2J H;  2ATW A;  1ONL A;  4NW2 A;  1SXT A;  4HJ5 A;  1GUG A;  3GV6 A;  1B9N A;  3H09 A;  4CKE A;  1VQ9 A;  1STB A;  2A6E C;  1HUN A;  4DK6 C;  1XPO A;  2TMP A;  5KRU A;  2K28 A;  1F2Y A;  1TS3 A;  2L55 A;  1A8V A;  2HQL A;  3CMA A;  2V1C C;  1QWY A;  3KOJ A;  4KY5 A;  4G7Z C;  1L1O A;  2K5W A;  1CKN A;  1PTO D;  2KQ3 A;  3S15 B;  1K3R A;  4F8M A;  5GAE C;  1YEZ A;  4RKB A;  1Q82 C;  2HCC A;  2OTJ A;  1XJV A;  3CCS A;  2JA5 G;  2WAQ G;  5LL6 S;  3V05 A;  4DR6 L;  2Z8L A;  4GN5 A;  4ZQ3 A;  1PFN A;  2F3V A;  1DZ1 A;  2F0H A;  1EFW A;  1I6H B;  1K28 A;  1HA6 A;  1B7Y B;  5C44 G;  2IX3 A;  2MJ8 A;  4HJ8 A;  4UDU C;  3TP8 A;  1V1P B;  2NZO A;  2CKZ B;  4DNR B;  2F03 A;  4R8N A;  2NWG A;  2F4V Q;  1ICF B;  1K0R A;  1SN8 A;  4YY3 Q;  2BA1 A;  2UXB Q;  1VQJ A;  1SJE D;  1E2Z A;  1WTH A;  3S16 B;  5LMU Q;  3SXH A;  1WCM H;  3Q6S A;  5G3L F;  5IGD A;  4ILW A;  3SK6 A;  1XX8 A;  4X62 Q;  2EOT A;  4DUZ Q;  5ELD A;  4DV7 L;  3R2T A;  1Y14 B;  2CW0 D;  4A4I A;  1BNZ A;  3RNU A;  3R2I A;  2YTX A;  2IPK D;  5K5P A;  4N9T A;  4B3T L;  2IX1 A;  1WTO A;  1H9J A;  4JI2 L;  2J0T D;  3VR5 A;  5IT9 E;  4G57 A;  1EY6 A;  3KF6 B;  4YCV A;  2NB0 A;  5I9P A;  5ELN A;  1MKH A;  1I94 Q;  3S14 B;  1JWU D;  3WOF A;  1WJJ A;  3BS1 A;  1AH9 A;  2MP1 A;  4IFD J;  4JV5 Q;  3QO2 A;  5CV6 A;  2K6A A;  5FO9 B;  2QGQ A;  1I4Q A;  2F0F A;  1XMO L;  1VQ8 A;  1CZW A;  4PMC A;  4P75 A;  4AIM A;  5C4J H;  4QF4 A;  1I3Q B;  3GTL B;  4JOI A;  2R92 B;  5C3E B;  5T1I A;  1XXG A;  2OTL A;  1E2W A;  1HH2 P;  5EPL A;  4HN7 A;  1WCM G;  3I56 A;  4HSV A;  2NZH A;  3E3X A;  2UXC L;  2K01 A;  3QR8 A;  3WDN A;  2DJG C;  1YI2 A;  4RCN A;  5C4Z A;  1K8M A;  1RCV D;  1UWV A;  4IPG A;  1IBK Q;  1R4P B;  2JEB I;  4KJN A;  2F0U A;  1P16 A;  4LJZ C;  3G6E A;  2V4D A;  2RDH A;  1LT5 D;  5E4W C;  1V8Q A;  3S17 B;  4R4C A;  5FK9 C;  1EYC A;  3VR4 A;  4C1N K;  1PTO F;  5D65 A;  1VQM A;  3HOV G;  3FPU B;  2KED A;  4TKO B;  2JE6 I;  1KIX A;  2VS1 A;  3KBX A;  3M7G A;  4GKK Q;  5IGG A;  2NYZ D;  1VF5 C;  1LTS D;  1B53 A;  2A6H D;  4C3H H;  3JAM E;  2ASB A;  4FVM A;  3U50 C;  1QB5 D;  3M4P A;  3FKI B;  2Y0S E;  1GXD C;  3S1Q H;  1IL2 A;  2SEB D;  5E4X A;  2AQ3 B;  2F3W A;  2IY5 B;  5C0X J;  4C56 C;  4DAY B;  1LTB D;  2K33 A;  3CME A;  1ILP A;  2B8G A;  4A75 A;  1HR0 Q;  1WTP A;  1DOL A;  3WWV A;  4BXX H;  1K83 H;  3I4M H;  2VXW A;  3PO2 G;  1BOS A;  4KI0 A;  2RCF A;  1HNW L;  2F0D A;  2XRS D;  2X69 A;  4LAA A;  4PV1 C;  1SBB B;  5D14 A;  3I8Z A;  1PZK D;  1AE2 A;  5KGU A;  5C44 B;  5CV7 A;  1U9R A;  5EBC A;  1Q8K A;  4KKT A;  3RZO B;  1JJC B;  2F0P A;  2Z4I A;  3U9O A;  3URY A;  3NP8 A;  3K59 A;  3JAM L;  1A15 A;  1I6V C;  4C3H G;  2F52 A;  2YU9 B;  3M4Y A;  4IJH A;  2CFM A;  5JEA H;  1NJI C;  4AYB E;  5J1Z A;  3UDX A;  4OXP A;  1H9S A;  1IL8 A;  1UNS A;  5JVH 3;  1WVL A;  4DXF A;  4RWS C;  3HZX A;  1E1T A;  1SYC A;  4CJ0 B;  2R7Z B;  5BR8 Q;  2RCN A;  4YCU A;  2VQE L;  5LMN Q;  3I4M G;  1EL0 A;  1B70 B;  4LF9 L;  3EJI A;  2KCC A;  1S5E D;  2XTI A;  4K0K L;  5EGT A;  1PH2 A;  4GOP A;  3AMU A;  4FF1 A;  1MHW C;  1XMQ Q;  5FLM H;  1EQT A;  4FF3 A;  3MVV A;  1PTO B;  1ENF A;  5BN3 A;  2LS0 1;  2PI2 A;  4K8J A;  4DUY L;  4GNX B;  5JPM C;  2RHS B;  4CGY B;  1J9O A;  3VR2 A;  1CSQ A;  2LSS A;  5AJ3 L;  3EN2 A;  4C1N I;  5K36 H;  1EQR A;  4CDC C;  3J7A V;  1QCB D;  4HJA A;  3NQT A;  5M3M H;  2O4X A;  5JEA G;  4JYA Q;  1TT2 A;  1A62 A;  1YHA A;  5H1S E;  5EJW A;  4NXM Q;  1AZP A; 
#chains in the Genus database with same CATH homology
 4KY6 A;  3UI2 A;  2R3Z A;  3VYU A;  1HPC A;  1SNM A;  1I4H A;  4J1M A;  3NTH A;  3VYT A;  5T1G A;  2A69 C;  3PUX A;  1FR3 A;  3NBI A;  3HOV B;  1BCP C;  3GTP B;  4OIJ A;  2B2T A;  5HUR A;  1A2T A;  2X6G A;  1V1P A;  1W6J A;  5K36 G;  3GV3 A;  3H91 A;  2ENB A;  4QIW B;  3ND8 A;  4K5V A;  4ZK9 B;  1JOR A;  3S1M B;  2KUM A;  1X32 A;  3IL8 A;  4F87 A;  2RSO A;  1DYQ A;  1BBX C;  1CT1 D;  2NVQ B;  3MHB A;  3OHX C;  4C3I B;  2AUJ D;  3CRL C;  1XWE A;  2F0N A;  1GJX A;  3FDT A;  2OEO A;  4ZRZ A;  3EA6 A;  3QJY A;  1STN A;  3SK8 A;  2N88 A;  4DGZ A;  3OW7 A;  1EEI D;  3P20 A;  1IW7 C;  2LY7 A;  1Q12 A;  3ITP A;  1D6E C;  4DU9 A;  4G7O C;  4KN7 C;  3NE5 B;  2B2V A;  1ZYR C;  1ENC A;  1NAP A;  2BA0 A;  3K5O A;  2E75 C;  4QUC A;  2Y0S B;  3D3R A;  3FPP A;  4IUP A;  3TP6 A;  1SE4 A;  1SAP A;  4CHT B;  5C3X A;  2F1M A;  1HXY D;  2E74 C;  2MHV A;  1LT3 D;  2B2T C;  1J8I A;  4TQU S;  1II3 A;  1QE6 A;  1EY5 A;  4K2K A;  4DF7 A;  3GTO B;  2ID0 A;  1A3T A;  4RH6 A;  3G6J B;  5JVG 3;  1TII D;  4MIU A;  2R61 A;  4DAY A;  3GQB A;  3A8J E;  1EEF D;  1DD2 A;  1WTQ A;  4DK0 A;  1Q3L A;  2F0L A;  4IUN A;  1D2B A;  1VMC A;  3PUZ A;  2IT1 A;  3N52 A;  2HDM A;  5COY A;  2NBF A;  3S9W A;  4FF2 A;  2RDF A;  1B44 D;  4FP5 D;  4A3G B;  4BBR B;  2D62 A;  3VA7 A;  4QCL A;  2EYM A;  3H3V C;  4HAE A;  3J80 E;  1MD2 D;  1T5E A;  2L12 A;  2QKI C;  1SMY D;  3HOX B;  2KVM A;  3T56 B;  3P75 A;  3DEP A;  4BWG B;  2B2V C;  1TVX A;  4BS9 A;  1SE2 A;  2PCF B;  2ZXP A;  3ERO A;  1NR2 A;  4X3S A;  4BY1 B;  4BA2 I;  5C4X B;  1RKN A;  3TSS A;  2F0M A;  2F0I A;  4DK1 A;  4N9P A;  1Z47 A;  1SYF A;  4OO1 H;  4F7X A;  1B9M A;  1HHV A;  2A73 B;  3AU7 A;  2Z1C A;  2NZ1 D;  1KNE A;  3HEJ A;  3ONA B;  3A8K E;  1DXM A;  3A56 A;  3OMG A;  4EQN A;  1EY7 A;  4F88 A;  1QNU A;  1O80 A;  1D5Z C;  1OXU A;  2RKS A;  1ENA A;  1MSG A;  4BBS B;  2KEC A;  2EJM A;  3MFG A;  4RGO S;  2RVL A;  3OMC A;  4EGV A;  4OO1 G;  1TS5 A;  1ET9 A;  2F0G A;  1C8C A;  2M00 A;  2LMC B;  5NUC A;  2D9U A;  4KJO A;  1LT6 D;  5M3F B;  1LTR D;  3KLS A;  5DNF A;  4IUU A;  1HTP A;  3MFY A;  5CC4 A;  2SDF A;  1AFP A;  3K58 A;  3HRZ C;  1EY8 A;  4TSS A;  1B2T A;  4KHZ A;  1SYB A;  3O13 A;  5ELB A;  2RSN A;  3RZD B;  3G7L A;  3GTG B;  2DNE A;  4CKC A;  3M7N A;  4FNF A;  3HOU B;  5JOB A;  1TQO A;  3PUV A;  2A74 C;  2PW7 A;  3TP7 A;  2K32 A;  3TP5 A;  1ICW A;  3V96 A;  3AB9 A;  3HS0 C;  3LWE A;  3NXW A;  3BDL A;  1CQV A;  2C5C A;  4Z9C B;  4E6I A;  1LAB A;  1Y1W B;  4JK1 C;  3BDO A;  2G9D A;  3IAY A;  1OXT A;  1LTG D;  2EVB A;  3MC0 B;  5JPN C;  4IFD H;  1F2L A;  2NN6 I;  1Y1V B;  3Q22 A;  1STY A;  5IOD A;  4C3J G;  2PZT A;  4PMB A;  4Q0F A;  2MGS A;  2B39 A;  3FMC A;  3LNN A;  3A54 A;  4IUT A;  3J7A F;  3K5N A;  3NHH A;  4XTC S;  5CV4 A;  2B2U A;  2K03 A;  2K7V A;  5EKL A;  1IYU A;  2AUK A;  4CJ2 C;  3CQZ B;  1KAB A;  1ROD A;  2F0W A;  5M5X B;  4NP5 A;  1CZG A;  4IFD G;  2G9H D;  1B50 A;  4RKL A;  3EQL C;  3GTK B;  2E2I B;  1GUS A;  2EYO A;  1YNN C;  4K14 A;  4K6L A;  4BA1 I;  5C0X H;  5EKK A;  1SFO B;  4A3F B;  3SK4 A;  2LFN A;  1PFB A;  3DM1 A;  2B63 B;  1F2M A;  1MI2 A;  2PQE A;  3PV0 A;  1PRT D;  2J7Z A;  3ND9 A;  4DXG A;  4KY7 A;  4A3J B;  2H4O A;  2XVS A;  3Q24 A;  4HMI A;  1Z7T A;  4U67 3;  1JCK B;  1STH A;  2A6E D;  1B1Z A;  4R9W A;  4RAU C;  3TBI B;  1G2T A;  5EBD A;  2O2L D;  5C0X G;  3M4O B;  1S5F D;  3QOJ A;  3TZD A;  5JAV A;  1Y69 U;  3M85 A;  3SE0 A;  2KOL A;  2EY6 A;  3PO3 B;  1SYD A;  2B2U C;  4L63 B;  2QCP X;  2ZT9 C;  4IN3 A;  4GZY C;  1OXX K;  1EQV A;  3FRP B;  3NWS A;  1D5M C;  2XRQ D;  1C48 A;  5M5W B;  1LT4 D;  4C3J B;  1V43 A;  2BE5 C;  4ME5 A;  4H0L C;  3GP7 A;  3MXG A;  1JOK A;  2EJG C;  1PDQ A;  2R6G A;  1FYC A;  1UUP A;  2I46 A;  1AP0 A;  2SNS A;  2PNR C;  1EY9 A;  1S5D D;  1F2Z A;  2K04 A;  2XSC A;  2JA5 B;  2WAQ B;  5ELE A;  2DY7 A;  1IHZ A;  2J4X A;  2O5I C;  1SJH D;  1PZJ D;  2E2J B;  1KAA A;  3TN2 A;  5I4D A;  1BUV T;  2IJ0 A;  4XQN A;  2HQE A;  4JBW A;  1R4Q B;  4X3K A;  3K57 A;  3D31 A;  1DOM A;  3MEH A;  4XYO A;  3E6Z X;  1PLF A;  1SNC A;  1U4R A;  1E0B A;  5DEH A;  4DNT B;  2NN6 H;  1AZQ A;  1SND A;  5BN5 A;  5CV5 A;  4K2L A;  4X3U A;  1B4O A;  1JOO A;  4B08 A;  1PYW D;  1WTX A;  1B3A A;  4WFN 3;  3VA5 A;  4MN3 A;  2BCO A;  4HCS A;  4K6D A;  4KTA A;  3L9A X;  3QG1 A;  1NR4 A;  3T13 A;  1WCM B;  3NPP A;  3BVM A;  2PZW A;  3MWY W;  5D3D A;  4XXE A;  1GUN A;  3SEB A;  1K8O A;  5DM7 3;  3SHL A;  3T53 B;  1S4Z A;  4K5X A;  3MTS A;  1LTA D;  4FO2 A;  2CQA A;  3TZU A;  5C4J B;  1KLG D;  2OF1 A;  1X3P A;  4ZUJ A;  1KTK A;  3WOE A;  5D3I B;  4H7B A;  1HCZ A;  2L4N A;  3KLS X;  3TME A;  3L7Z C;  2YYZ A;  1OO9 B;  3NSW A;  2WII B;  3PO2 B;  1T5X D;  2WAC A;  4KHV A;  1EIG A;  3QOL A;  3T4A C;  4DAV A;  2L11 A;  3BYY B;  4IZ8 A;  1JWM D;  1EZ8 A;  2EE1 A;  4C3H B;  1QNK A;  4ZKC B;  5FOB B;  3RD4 A;  1KDC A;  3S1Q B;  3MA2 B;  4ID6 A;  1Z6H A;  2BDN A;  1MBY A;  2FJ2 A;  5CV8 A;  2SNM A;  1GUW A;  3I3C A;  3I4L A;  1WD1 A;  4MHE A;  1K83 B;  4DAP A;  3I4M B;  4S3S A;  1JC7 A;  4CJ1 B;  1SNP A;  1JOQ A;  3TDQ A;  4X3T A;  1VF7 A;  4FXK C;  2WIN B;  1NUC A;  1BF4 A;  1PFM A;  4J8Q A;  5C5L A;  4LK1 C;  1EWH A;  4ZAI A;  3QIA A;  4HCE A;  1VMP A;  2M2L A;  5HGT A;  2L9H A;  2CVR A;  3T51 B;  1ZEQ X;  2KCN A;  1CFM A;  5CYU A;  1TS2 A;  3QWN A;  2KEE A;  1JWS D;  3C1F A;  1G6Z A;  1PXU A;  1VDZ A;  3OWE B;  5KNC A;  1H9K A;  3DUZ A;  4AYB B;  4XT3 B;  3RMH A;  4B9W A;  3PMF A;  4YIJ A;  1TWG B;  3C46 A;  1IKL A;  4RGM A;  5M3M B;  4FXD A;  4FF4 A;  1QG7 A;  1IW7 D;  1QIL A;  3HG9 A;  3DMU A;  1F9R A;  1G29 1;  3W2D A;  2K5Q A;  2A68 C;  1IYV A;  2Q8I B;  4B9X A;  2QF7 A;  1ZYR D;  5IGB A;  1ILQ A;  1F9P A;  2O5J C;  1GOZ A;  4BY7 B;  4A3E B;  4KN4 C;  5A35 A;  1ZKO A;  4XQQ A;  2MPM A;  4RCO A;  2JA6 B;  4ZLT F;  5C3W A;  1Y8P B;  1I50 B;  5M5Y B;  3R8B A;  5DM6 3;  1YNJ C;  3MXP A;  3SDZ A;  1LO5 D;  3FVQ A;  3X3M A;  1Q90 A;  1EY4 A;  1QJO A;  1JIC A;  5BN4 A;  3CU7 A;  4H44 C;  2PMZ B;  2EYP A;  4G4K A;  1F77 A;  1O7Y A;  2EYH A;  2EY2 A;  4KV6 A;  3S2D B;  4CKB A;  3S2H B;  5FO8 B;  3BDC A;  1JR0 D;  4U68 A;  5CBA E;  1LLR D;  5IIF A;  4P2C B;  2WP8 J;  3I70 A;  2FFK B;  2EYL A;  2OXP A;  4RGN A;  4KD3 A;  4HTH A;  5C4H A;  1PZI D;  2F0V A;  5FKA C;  3P1H A;  1MSH A;  3NWT A;  4FXG C;  4OL7 A;  4RHS A;  5KYI A;  5IGE A;  1HA5 A;  1DOK A;  1JE4 A;  1O78 A;  1PTO C;  4EQP A;  1KDA A;  1RD9 D;  2IW3 A;  3BYT B;  4ZKB B;  5J39 A;  1DCZ A;  5IGF A;  1TY0 A;  1WTW A;  1CHP D;  3NTI A;  2AQ2 B;  5KYL A;  3H94 A;  1NCV A;  5FLX L;  2GA4 B;  2E76 C;  2IWH A;  1D5X C;  5G3L D;  3E0J A;  3S1R B;  1KLU D;  1PMR A;  1STE A;  4EVO A;  4ZYS A;  3DEO A;  3KK7 A;  5IOC A;  1AEX A;  1TWF B;  4QMG A;  3CKI B;  2JSO A;  4XT1 B;  1A3V A;  2NVX B;  3EVQ A;  2N55 A;  2PYK A;  1SEB D;  4HED A;  2MUY A;  1SNO A;  2Q8R E;  1SE3 A;  1EYA A;  4V19 0;  3A7L A;  2CW0 C;  4UAI A;  5E3F A;  1RHP A;  1TY2 A;  2NVY B;  5I9O A;  1A6X A;  3LX0 A;  1BO0 A;  4RA8 A;  4RHR A;  2R93 B;  1Y8O B;  1EIH A;  2JP1 A;  2H1E A;  1Q1B A;  2PW5 A;  1KDB A;  3SR1 A;  1FNW A;  3A8I E;  4TRD A;  1HQR D;  1H9R A;  3I4N B;  1S5B D;  2PO4 A;  1LTT D;  4A93 B;  1TWA B;  1CQF A;  2DNC A;  2K05 A;  4WRD A;  4KK7 A;  1SYG A;  2EZV A;  2KA7 A;  5CR3 A;  3Q23 A;  3D4R A;  2ICI A;  1SYE A;  4ZUI A;  4QUF A;  1PTO H;  1JB3 A;  2E2H B;  2L5T A;  1TU2 B;  3C2P A;  3DXJ C;  3MAQ A;  3D4W A;  1CA5 A;  3M3Y B;  2A6H C;  2L0C A;  1TR5 A;  4Y7N B;  1SNQ A;  1IKM A;  1BR9 A;  3K5L A;  4H13 C;  1DON A;  5I6Y A;  3IFD A;  1R9T B;  1GUO A;  3I90 A;  3NBH A;  2RBM A;  3GTQ B;  3D6C A;  1AW7 A;  1FNV A;  2EXZ A;  1EWC A;  1M8A A;  1LAC A;  1EFI D;  2Z4H A;  2ICE C;  4PQX A;  3T16 A;  2F0T A;  1G2S A;  1RTO A;  2FIN B;  2FHT A;  5KIX A;  1BDO A;  3SK5 A;  5ELF A;  2NTT A;  4QB4 A;  1JQY D;  2B2W A;  1EU4 A;  1YNN D;  2B2Y A;  2F0S A;  2JEA I;  1TWH B;  3D4D A;  5IT9 L;  2FMM A;  3D6W A;  1F9Q A;  1OXV A;  3IFT A;  1DM0 B;  5I2Y A;  2JA7 B;  3Q0A A;  1D1I A;  1L0Y B;  2XWB B;  3GO5 A;  3NTK A;  3PUW A;  3LWU A;  5CGK A;  1QOH A;  2RDG A;  4V0B A;  4O1N A;  1O7L A;  3S1N B;  3BVG A;  4KKU A;  4M1U B;  3P7J A;  3BZD B;  2QEJ C;  5LHY 1;  3R93 A;  1ESF A;  2D2C C;  4RFB A;  1PRT F;  2VB2 X;  3PUY A;  1EOT A;  4PMW A;  5EPK A;  1EZ6 A;  4K5W A;  4A3B B;  2TSS A;  4C2M B;  4C3I G;  5C5M A;  1M4V A;  1D1K A;  4WJW A;  3DWQ A;  2VUM B;  5FO7 B;  2JA8 B;  5JJZ A;  4XDX A;  2CHB D;  3BVZ A;  4XYQ A;  3KLR A;  4ULL A;  3H6M A;  2AWN A;  2B2W C;  4XQJ A;  2B2Y C;  4RGT A;  2BE5 D;  2EJF C;  3EFX D;  2JYO A;  3C1E A;  3OOC A;  3K0Y A;  4DFA A;  5I6W A;  3IKJ A;  2PZU A;  1GHJ A;  1STG A;  1XYI A;  5A2Q E;  2NN6 G;  3BG3 A;  4HSP A;  2ZXO A;  5J22 A;  3A55 A;  1BQQ T;  5TSS A;  1ML0 D;  2F4I A;  1HFN A;  3CHB D;  4DN4 M;  1NSN S;  1U4M A;  4WOR A;  4FYD A;  4NMZ A;  4DA2 A;  2VNU D;  4OO1 I;  4OIK A;  3HOY B;  5KND A;  1Q1E A;  1SSO A;  2PPB C;  4M8A A;  3HGB A;  1U4P A;  1PRT B;  3F2U A;  1CI3 M;  3D8G A;  5AFW A;  5A2Q L;  3HOW B;  2L1B A;  5ISR A;  4L8J A;  1Q8I A;  1ESR A;  2WV6 D;  1EY0 A;  4I7Z C;  1C4Q A;  3E5S A;  4J6H A;  1GUT A;  4HR7 B;  2A5H A;  3NQI A;  2EDG A;  1CHQ D;  3KBG A;  4O42 A;  3J81 E;  5DAU A;  5E1F A;  2FMC A;  3PIO 3;  4K8I A;  5JEA J;  3MZ5 A;  2RA4 A;  1VCI A;  1WTV A;  5IGC A;  1TS4 A;  2X6L A;  2EYJ A;  4KMU C;  3VYS A;  1OXS C;  3OIQ A;  1I4P A;  1CK1 A;  3RUZ A;  4Q5V A;  2F0O A;  1RJT A;  4I65 A;  1X3Q A;  1U4L A;  1XTC D;  5CMD A;  3FEW X;  1O7Z A;  1MGS A;  2VB3 X;  3SVM A;  2A69 D;  3J81 L;  3ERQ A;  1G8Z D;  1EYD A;  1SDF A;  2E2D C;  4PNY A;  1BCP D;  4L6T B;  3K6O A;  1SMY C;  1AN8 A;  1UEA B;  1FGB D;  1A3U A;  1CTM A;  4KKS A;  2F0E A;  1HRJ A;  4IUQ A;  4A3D B;  4IUV A;  3I91 A;  1F9S A;  3GTJ B;  2AWO A;  4A3I B;  1I4X A;  3MXN A;  5CV9 A;  3GD7 A;  2LKV A;  3A7A B;  1CA6 A;  4IFD I;  2NVT B;  3H0G B;  3W3A A;  2QIL A;  1EU3 A;  2IX0 A;  4LMQ D;  1GHK A;  2RQX A;  2KHS A;  3DWA A;  5F2D A;  5C6A A;  2DN8 A;  3ZYY X;  2HDL A;  2NTS A;  4NDX A;  4OHJ A;  2XN9 C;  3NK9 A;  2KJX A;  2K1B A;  3U9S A;  5EQ0 A;  4A3M B;  3HP3 A;  2F0J A;  5EKI A;  2M9V A;  2B8F A;  1TWC B;  2JXM B;  3K7A B;  2F0K A;  1HUM A;  3VYR A;  3NUC A;  3QB3 A;  2AQ1 B;  4HMJ A;  2BOS A;  4XIG S;  4ABN A;  1L0X B;  1FD7 D;  1RF2 D;  5M9O A;  2BDO A;  2C9O A;  2I07 B;  3DWP A;  1I4R A;  2EPB A;  2DY8 A;  2EY1 A;  4IAL A;  5C0X I;  2XWJ B;  3V2T A;  1KNA A;  3KUP A;  2QDB A;  4IQZ A;  3I73 A;  1A2U A;  1UAP A;  2K5D A;  1LV9 A;  2XIW A;  4R8I A;  1RTN A;  1BCP F;  3RLF A;  5I2X A;  5EPJ A;  3GTM B;  2EY5 A;  1STA A;  4ODG A;  3KF8 A;  3PIP 3;  3X3N A;  4IUR A;  3J80 L;  2SOB A;  5KNB A;  2WKD A;  1DJR D;  1W6K A;  1HQM C;  2XNA C;  3L3O C;  2OT2 A;  1ZXT A;  5CBE E;  3DHQ A;  3CRK C;  1G91 A;  2A68 D;  1HTL D;  1I4G A;  2EYF A;  5FLX E;  1HFG A;  5LL6 X;  5KEE A;  1Y8N B;  4KD4 A;  4A3K B;  2D5D A;  1H9M A;  1V1O A;  1WTR A;  3OPO A;  3N6R A;  3OIP A;  1YNJ D;  1RDP D;  3VR6 A;  2Q8T A;  1E2V A;  3HKZ B;  2HUG A;  5ELC A;  2ZXR A;  3OSO A;  3HOZ B;  4EQO A;  2F0Q A;  1TKW B;  2WB1 B;  1BCP B;  3J7Y W;  1S5C D;  2NUC A;  1WD0 A;  4G7H C;  1ET6 A;  2HCI A;  4OGQ C;  1BXT A;  3I72 A;  5COR A;  1LTI D;  3C3L A;  1H9S B;  1CM9 A;  3MXU A;  3VR3 A;  4NKL A;  4CBV A;  1FNU A;  3OWF A;  3R3O A;  3K5M A;  2WKC A;  1PRT C;  2IL8 A;  1ONL A;  4NW2 A;  1SXT A;  1GUG A;  3GV6 A;  1B9N A;  3H09 A;  4CKE A;  1STB A;  2A6E C;  1HUN A;  2TMP A;  5KRU A;  2K28 A;  1F2Y A;  1TS3 A;  2L55 A;  1QWY A;  4KY5 A;  4G7Z C;  2K5W A;  1PTO D;  2KQ3 A;  3S15 B;  4F8M A;  4RKB A;  2HCC A;  5LL6 S;  3V05 A;  4ZQ3 A;  2Z8L A;  1PFN A;  2F3V A;  1DZ1 A;  2F0H A;  1I6H B;  1HA6 A;  2IX3 A;  2MJ8 A;  4UDU C;  3TP8 A;  1V1P B;  4DNR B;  2F03 A;  4R8N A;  2NWG A;  2BA1 A;  1SJE D;  1E2Z A;  3S16 B;  3SXH A;  3Q6S A;  5G3L F;  5IGD A;  4ILW A;  3SK6 A;  1XX8 A;  2EOT A;  5ELD A;  3R2T A;  2CW0 D;  1BNZ A;  3R2I A;  2IPK D;  5K5P A;  4N9T A;  2IX1 A;  1WTO A;  1H9J A;  2J0T D;  3VR5 A;  5IT9 E;  4G57 A;  1EY6 A;  2NB0 A;  5I9P A;  3S14 B;  1JWU D;  3WOF A;  3BS1 A;  2MP1 A;  4IFD J;  3QO2 A;  5CV6 A;  2K6A A;  5FO9 B;  1I4Q A;  2F0F A;  1CZW A;  4PMC A;  3GTL B;  4QF4 A;  1I3Q B;  2R92 B;  5C3E B;  5T1I A;  1XXG A;  1E2W A;  5EPL A;  4HN7 A;  4HSV A;  2K01 A;  3WDN A;  4RCN A;  5C4Z A;  1K8M A;  1RCV D;  1R4P B;  2JEB I;  4KJN A;  2F0U A;  4LJZ C;  2V4D A;  2RDH A;  1LT5 D;  5E4W C;  1V8Q A;  3S17 B;  5FK9 C;  1EYC A;  3VR4 A;  4C1N K;  1PTO F;  5D65 A;  3FPU B;  2KED A;  4TKO B;  2JE6 I;  3KBX A;  3M7G A;  5IGG A;  2NYZ D;  1VF5 C;  1LTS D;  1B53 A;  2A6H D;  3JAM E;  4FVM A;  1QB5 D;  3FKI B;  1GXD C;  2SEB D;  5E4X A;  2AQ3 B;  2F3W A;  5C0X J;  4C56 C;  1LTB D;  2K33 A;  1ILP A;  2B8G A;  1WTP A;  1DOL A;  2VXW A;  1BOS A;  4KI0 A;  2F0D A;  2XRS D;  2X69 A;  4LAA A;  4PV1 C;  1SBB B;  5D14 A;  3I8Z A;  1PZK D;  5KGU A;  5C44 B;  5CV7 A;  1U9R A;  5EBC A;  4KKT A;  3RZO B;  2F0P A;  2Z4I A;  3U9O A;  3URY A;  3NP8 A;  3K59 A;  3JAM L;  1A15 A;  1I6V C;  4C3H G;  2YU9 B;  3M4Y A;  5JEA H;  5J1Z A;  1H9S A;  1IL8 A;  1UNS A;  5JVH 3;  1WVL A;  4DXF A;  4RWS C;  3HZX A;  1SYC A;  4CJ0 B;  2R7Z B;  1EL0 A;  3EJI A;  2KCC A;  1S5E D;  5EGT A;  3AMU A;  4FF1 A;  1EQT A;  4FF3 A;  3MVV A;  1PTO B;  1ENF A;  5BN3 A;  2LS0 1;  4K8J A;  5JPM C;  4CGY B;  1J9O A;  3VR2 A;  4C1N I;  5K36 H;  3J7A V;  1QCB D;  3NQT A;  5JEA G;  2O4X A;  1TT2 A;  5EJW A;  1AZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...