1SDFA

Solution structure of stromal cell-derived factor-1 (sdf-1), nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
67
structure length
67
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords STROMAL CELL-DERIVED FACTOR-1
publication title Solution structure and basis for functional activity of stromal cell-derived factor-1; dissociation of CXCR4 activation from binding and inhibition of HIV-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1997-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sdfA00
3I90A 3DM1A 4R8IA 4X3TA 1G2TA 1PFBA 2FMMA 2HDLA 2KEEA 2KVMA 2B2TC 3TZDA 4ZLTF 1EQTA 2B2WA 2KOLA 3IL8A 1U4RA 4IUQA 4LMQD 5T1IA 2NZ1D 1BF4A 1ESRA 1MSGA 3LWEA 4CJ0B 5JJZA 1G91A 2RVLA 1B2TA 1DONA 2CVRA 3IFDA 5CMDA 4O42A 3I91A 1SSOA 4X3KA 2K05A 2J7ZA 5EKIA 1RODA 1XX8A 3SVMA 1NAPA 2L9HA 4CJ2C 1AZQA 3P7JA 2JP1A 1SAPA 1GUWA 2B2UC 1S4ZA 2FFKB 4HSVA 1WTWA 3TN2A 2B2VA 4UAIA 2Q8TA 1DOKA 2FINB 2B2TA 1CA5A 4IUUA 5T1GA 1WD0A 2KUMA 3FPUB 2DY8A 5EQ0A 1IKMA 5EPKA 2RSNA 5CBAE 2B2VC 1SDFA 1X3QA 1HFNA 4ZAIA 1F9QA 1ILQA 1WVLA 5CBEE 1EIGA 1EL0A 1A15A 2KEDA 2HCIA 2K01A 2MPMA 4ZKCB 1B53A 1G2SA 3MWYW 1AZPA 2B2YC 2K03A 1DOLA 1F9PA 1HRJA 1Q3LA 1X32A 5E4XA 2K28A 2IL8A 4NW2A 2D9UA 2EOTA 1PDQA 5D65A 1DZ1A 5DNFA 3G7LA 3GV6A 2X69A 1MGSA 1RHPA 2BDNA 2EE1A 1NR4A 2HDMA 2B2UA 3QO2A 4X3SA 1KNEA 2R3ZA 4XT1B 1J8IA 2K04A 1EIHA 1PLFA 4RA8A 5EJWA 2RSOA 3R93A 5CORA 1M8AA 5E4WC 1MSHA 2MP1A 1LV9A 1B50A 1PFNA 3MTSA 1O7ZA 1QNKA 1JICA 1RTOA 1F9RA 1B4OA 1HUMA 3I3CA 1WTXA 2KECA 1G6ZA 4RAUC 1F9SA 1QE6A 4QUFA 3H91A 1MI2A 3N52A 4IUVA 1ILPA 1JE4A 4ZKBB 1ML0D 5EPJA 1ICWA 1U4PA 1VMPA 2B2YA 1AP0A 1KNAA 2Q8RE 1PFMA 4MHEA 2JYOA 3D6WA 4IUTA 2N88A 3Q6SA 1WTRA 1HA6A 4QUCA 1WD1A 2L11A 4RWSC 3DEPA 2L1BA 1WTVA 1X3PA 4IURA 4OIKA 1WTOA 1C8CA 4U68A 1HFGA 1O80A 4XDXA 4XT3B 1F2LA 1ZXTA 2K1BA 3KUPA 2VXWA 3DEOA 1U4LA 1HHVA 2HCCA 2L12A 2M2LA 1VMCA 1BNZA 2L4NA 4IUPA 2MGSA 2SDFA 3HP3A 1IL8A 1NR2A 1WTPA 2X6GA 4MN3A 2B2WC 2RA4A 3FDTA 4CJ1B 1U4MA 1DOMA 1RTNA 3ONAB 4HCSA 2HUGA 5AFWA 3UI2A 4DN4M 4HAEA 1EOTA 4X3UA 1BBXC 3I8ZA 1CA6A 1QG7A 1B3AA 5COYA 5D14A 2NWGA 4OIJA 4HEDA 1HUNA 1TVXA 2DY7A 1XYIA 1WTQA 2X6LA 1E0BA 1J9OA 4R9WA 3F2UA 1BO0A 2N55A 1NCVA 1IKLA 2MJ8A 2XIWA 3GV3A 2NYZD 3KBXA 5EPLA 2H1EA 2EPBA 4ZK9B 2FJ2A 1RJTA 1CM9A 1O7YA 2FHTA
chains in the Genus database with same CATH superfamily
3DM1A 1K3RA 3U4VA 2QILA 3D31A 3Q24A 1ENCA 4IUQA 4QCLA 3NSWA 1PH2A 5JJZA 3I2ZA 1L0WA 1IYJB 4B08A 1FNWA 2SEBD 4X66L 5EGTA 1TKWB 4OGQC 3HOZH 2Q2TA 2WINB 3VA7A 2B63H 4YWLA 2FFKB 4G57A 4JBKA 3I4NB 1AH9A 1JMCA 4C1NK 3I4MB 4HIMA 1U5KA 3OIQA 2RF4A 2ZXRA 4A3BB 4ZAIA 4DFAA 4FDBA 3D6CA 1ET6A 3CCVA 1KXLA 1Q3LA 3VR3A 5ELCA 1EEFD 3A5ZB 4JOIC 1UNSA 2BCOA 1M8AA 4YWKA 4HTHA 4QGUA 1B50A 2SOBA 1LUZA 2F4VL 4FXKC 2Z4HA 4H44C 3HEJA 4A3DH 4K2KA 2B39A 3VYUA 1T9HA 4PMBA 4V190 2WKCA 5FLMH 2A68C 1K9MC 1F77A 3CP0A 1I50H 1VCIA 4DF7A 3AFPA 5C3EH 1II3A 3S16H 3I56A 2I46A 4KV6A 4DAPA 4DV3Q 4HJ5A 5FO7B 3H94A 3CCLA 2F3IA 4KN7C 1TQOA 4JI3Q 1U4MA 3ONAB 2XRSD 4IFDH 2NVXB 2AUKA 2L55A 2PNRC 5I2YA 4Q0FA 4JI8Q 1TWAB 5LHY1 4KK7A 1BBXC 4BY1B 4X62L 1CKNB 4UP8A 1XYIA 2F52A 3QJYA 4KJNA 1STEA 4JI2Q 1IYVA 5CV6A 4BY7G 1CTMA 4DV4L 3R3OA 5IGGA 1JE5A 1R4PB 3CCUA 2H1EA 1O7YA 1I3QB 1VQKA 3CKIB 3K7UC 2VUMG 2HDLA 1CK1A 4ZYSA 1ZYRD 4DNRB 2B8FA 4LF9L 1CZGA 1EUJA 1DGSA 1ICFB 2ZT9C 4DV6Q 3J80E 1YVCA 1UAPA 1TXYA 3GDEA 1EYDA 2A69C 2DNCA 4L5RC 3ND9A 1NMGA 1SE8A 5C3XA 2L9HA 3CPWA 3HOVG 2F0QA 3GTJB 2ZXOA 3CCEA 3PF4A 4JI2L 1CA5A 4IUUA 3HOXG 3MXGA 4QL5A 3CCRA 3AU7A 2XWBB 1PTOH 3WWVA 1FNUA 1JWUD 1UE7A 2CH4W 3U58A 2R7DA 4DV6L 4Q5VA 2F03A 1SRUA 4ZUIA 2HDMA 4CDFC 1HCZA 4JI7L 2IPKD 3ITPA 2BDOA 2XTIA 2JSOA 4DU9A 2LSSA 4H02A 3A56A 1L1OA 2QEXA 2EYHA 4HCEA 3GTLB 4DUZL 1OXVA 1WTXA 1TIID 3HOYB 1Y1VG 1MI2A 2G5DA 3GO5A 5JVH3 1SFOB 4AIMA 1BBUA 1GUNA 3BYTB 4C3IG 2CW0D 1PVOA 3FEWX 1IZ6A 2K14A 4KLKA 3PIPA 4B3ML 3ICEA 3DMUA 1CZWA 4DR3L 2M2LA 4O2DA 1XPUA 4RMFA 2F0SA 2YV5A 1NR2A 2SNMA 2E2HB 3BJUA 5BN5A 4MN3A 3KYHC 5C0XG 4HCSA 4A3MG 3K7AB 5JJLA 1EWIA 4HEDA 4KTAA 1S5BD 2OQKA 4OX9Q 4DR6L 1K3BC 1FD7D 2D5DA 1CHPD 2UUAL 1KC8C 1T5EA 1QUQB 1TWGH 2A19A 5IP7G 1VQ4A 4RH6A 4X3TA 3KFUA 3H0GG 1PH9A 2BOSA 3AMUA 2RHQB 1BUVT 3S2HH 3TP7A 1LT4D 4QB4A 4YHHL 1N8RC 2OTLA 4IPGA 4BWGB 1PRTB 1EIFA 2R6GA 1A2TA 3OTOL 3WOFA 4PZ6A 2AWOA 2K05A 5ELNA 3G6EA 5C3WA 3I4LA 5LMUL 2CFMA 4LFCQ 3CU7A 4GNXC 4PZ7A 1IBML 2AKWB 4DR1Q 5AJ3Q 2JA6H 4A3IH 1HA5A 1SYDA 3PF5A 1DOKA 1I94L 1EOVA 4KKTA 3OW7A 2FINB 4HJAA 3HOZG 3QOJA 3J81L 3LWUA 2B63G 4TVAB 4YY3L 3SDZA 1HNXQ 1EQRA 2B3GA 1DZ1A 1B3QA 1EY9A 2BH8A 4PMWA 1IW7D 2ICIA 3JAMc 4N9TA 1SE2A 5C4XH 1J6QA 5C44B 1TR5A 2HT1A 4GKKL 4EQNA 2E76C 3D8GA 4DV7L 1O7ZA 4H13C 1XTCD 4AQYL 4FF3A 1F9SA 1G291 2NZHA 4BBSH 3BZKA 1JOOA 1QOHA 2IX0A 2B29A 3Q8DA 2Q8RE 1YHBA 3DWPA 1IXRA 1WTRA 4XYQA 3I4OA 1IBKL 4ME3A 3OMCA 5KNCA 4A3DG 1FR3A 3RZOB 1E3PA 1HFGA 3W3AA 1J5EQ 1Q8IA 4GN3B 2YTVA 2PQAA 1K0SA 1MHWC 1AFPA 5FLMG 1BQQT 4CKBA 5M3FH 3OSOA 1S40A 3S14H 4L6TB 4A3JB 4LF8L 3A8IE 3K81C 1Y8PB 5C3EG 1CT1D 2N49A 2RA4A 3VA5A 1RTNA 3MXNA 2I5HA 2RHSB 3M7NA 1SMYD 1OXTA 2EY6A 5GQOA 5H1SE 4A3KB 1JJGA 2Q2IA 3CPFA 3KLRA 4GOPA 4R9WA 3O13A 2M9VA 1R9TH 4Z9CB 2XNAC 4F87A 4IFDG 2KHSA 2R7FA 1E2ZA 3MVVA 3M7GA 3DWQA 1Y14B 2A6ED 3A55A 2Y0SB 4WJWA 3NTKA 4CBVA 1U4RA 2HHHQ 4NDXA 1V1PB 3T53B 2V1CC 1A3VA 1Z7TA 1N32Q 3CRLC 2UXCQ 1QVCA 3IFDA 4E6IA 4AH6A 3SVMA 2XN9C 3WDNA 1Q86C 3P7JA 2EQSA 3N6RA 1GUWA 1SAPA 4TSSA 3RLNA 3CMEA 1TY2A 1GUGA 5CV8A 1PTOC 4RKBA 3T56B 2E2JB 3SK6A 1ET9A 1WOCA 3FPUB 1EY5A 5EQ0A 4DK6C 4RHSA 2H4OA 1FJGL 3GTQB 3E9IA 4KY6A 3G71A 4DAVA 3QR8A 5FO8B 4OL7A 4OWXB 2LKVA 2KENA 4JCVE 3LNNA 3OWFA 3T4AC 4MTNA 4QIWE 4X65Q 1BXTA 3FKIH 1SBBB 5JPNC 3R93A 4Y7NB 5M5WH 1CKMA 4K6DA 1PFNA 2TMPA 3AYHB 3S2DH 1O7LA 4UP9A 2F0IA 2F3WA 2OTJA 1D8LA 1TWFH 4MHEA 1BCPB 5CC4A 1I6HH 1PZID 1HA6A 2RBMA 3H09A 1RL2A 2L11A 3RNUA 2E75C 2RDGA 1CSPA 2AUJD 4NP5A 2L1BA 3IRBA 4L5SA 2L0CA 1Y1WB 1WI5A 2CHBD 1B1ZA 2EYOA 1ZXTA 1M1KC 4IOCA 3CHBD 3S1MB 1YNJC 4OEMB 3S1RH 1N34L 4BBRB 1A2UA 3AQQA 4FF2A 1EWCA 4I7AA 2KBNA 1FYCA 1N36Q 4X65L 4CKEA 1KABA 1PYWD 1STHA 2DNEA 1CKNA 1LTAD 5AFWA 3GP7A 5M5YH 3I8ZA 1KIXA 1B3AA 2D0OA 4QQBX 1TVXA 1HUNA 2DY7A 1ENFA 3VYSA 2QKIC 2X6LA 3AFQA 1G8ZD 4F7XA 1SLJA 1LTSD 1YHAA 2F3VA 2MJ8A 5C4JB 3VYTA 1XJVA 3OOCA 1MJCA 3U4ZA 3RUZA 3SEBA 2AQ3B 4ZLTF 5D3IB 1F2YA 1MBYA 4CKCA 3S15H 3IFTA 4IN3A 3ULLA 1G91A 1SNCA 2ASBA 5ISRA 5FLXE 5C4ZA 3A7LA 1XX8A 3ERSX 3J7YW 1Q81C 1TWCB 5M9OA 1HPCA 3ND8A 4A3LH 2UXDQ 4FP5D 3C3LA 1BCPD 3HKZG 5DM73 3F2DA 4LFBQ 4JI1L 3NBIA 4XTCS 5T1GA 2NZOA 1X3QA 3VR6A 1KRSA 2EDGA 2JA6G 2F0JA 2MQHA 4CDEC 2WFWA 3H6MA 2D9UA 4ME5A 5D65A 3PCOB 1KAWA 1JB7A 2RCFA 2OXPA 2JA8H 4DV1Q 5I2XA 3T1YL 2LMCB 1WJJA 1VQ5A 1PRTF 1SNDA 1TS3A 3EVQA 5IY0A 1Q1BA 1A63A 4QF4A 4GKJQ 3HGBA 3RN5A 1KDAA 4JBJA 1SXTA 2XWJB 2UXDL 5C4XG 4ILWA 1KHIA 4IOAA 5J3BA 3A74A 5FJ8H 4K6LA 2N88A 4QUCA 3UDFA 3LX0A 4B3SL 1NTGA 3BDOA 1X3PA 1YHQA 1C8CA 4BBSG 2E2IB 1TY0A 2WB1G 1GHJA 1W6KA 1MIUA 2K1BA 4EQ5A 3HKZE 3DEOA 1JOQA 3CCSA 3CC7A 2F0PA 4GN4B 4BY7B 5JPMC 4AYBG 2FMCA 1QWYA 2ENBA 3W2DA 2F0GA 2UUCQ 4B3TQ 2VUMB 1GUSA 5GADC 2XSCA 4NXNQ 5M3FG 3EQLC 1QUQA 3RZDB 4LF5L 1F2ZA 4O1NA 3CQZB 3F2UA 4YIJA 1SYEA 1FGUA 3MAQA 3HOVB 3PUVA 3D0FA 4ALPA 2NVQH 5LL6X 2ALYB 1ASZA 1L2FA 4B3RL 4X66Q 5C0XJ 3I4MH 2ID0A 4K0KL 4L63B 4X64L 4IJHA 1RIPA 1VQIA 1IBLL 3HOXB 1M90C 4DR4Q 2NN6I 5CMDA 3KF8A 1H9RA 3NUCA 3PUYA 1RODA 3TS0A 1NAPA 4B3TL 2UUCL 3J7A5 2WB1E 4HR7B 1JOKA 2I5LX 1V1OA 4P71A 1L1OC 2QDBA 1DYQA 4ZCKA 2JA5H 2NUCA 4AYBE 2EY5A 1I4GA 1I4HA 2UU9L 2KUMA 2PW7A 2A68D 2K01A 2CWAA 2MPMA 3QB3A 2N8NA 5BN4A 1Y1VB 2R61A 1VQPA 3PIP3 4A76A 2R93H 2OF1A 5E4XA 1B8AA 3NTIA 1Y69U 3GV6A 5J22A 1PH7A 1WYDA 2NTSA 2XGTA 1J8IA 2F4VQ 4DR4L 2P5ZX 4C3IB 4LWCA 4K2LA 3MZ5A 1P16A 1LV9A 3SR1A 1YJWA 2K6AA 2DJFC 4OXPA 4RKLA 4DK1A 2ZJPA 1K28A 3DUZA 3FKIG 4RHRA 1JE4A 3MEFA 3JAML 3HS0C 3M4PA 1EU3A 1A0IA 4J15A 1HZ9A 2CWPA 1SNQA 2V4DA 4Y52H 2JA9A 1WTVA 4JI4L 1TWHH 1HTLD 1VQ8A 4LF6L 4IJLA 3UDXA 2VQFL 3KF6B 4XQJA 1TS2A 1KDCA 1LTID 1STAA 4FO2A 1IL8A 2A69D 1PH3A 4KJOA 2ZJQA 4X62Q 1XPOA 3TS2A 1BBWA 1NUCA 3X3NA 2IJ0A 4OWWB 5GAGC 3H0GB 4KN4C 4DV4Q 4DGZA 5D14A 1NMFA 3R2IA 3K59A 2ZTEA 5A2QE 3K5NA 1E0BA 2YU9H 5M5XB 1QNUA 2XIWA 4RCOA 2SNSA 3HZXA 1JWMD 4RGTA 4ZK9B 4LF9Q 2NN6H 2DGYA 1BCPF 4UHVA 3EN2A 2KEEA 2G9DA 1MSGA 3K80C 2Q2UA 4CDDC 3HOZB 1RDPD 2A6HC 1DONA 2B63B 4NB3A 3MC0B 5I9OA 2EXZA 2IY5B 1XPRA 1S72A 4IFDJ 2F0VA 2F0TA 2D2CC 4GNXB 3F2BA 1SN8A 3V05A 3PO3H 2H5XA 2PMZE 5CV9A 1HNWL 5JAVA 1A3UA 1IKMA 2A8VA 2AQ2B 1RF2D 4A3LG 1G2SA 2UXBQ 3HOUH 4JI7Q 4ID6A 1ESFA 1F9PA 3TP8A 2R7ZH 5IWAL 4DV5L 2EJFC 1RCVD 3TBIB 2B2UA 4LAAA 4DUZQ 2R3ZA 4MZ9A 4M8AA 4LUOA 1CQFA 2C5CA 2K52A 2VQEL 3NQTA 5G3LF 1N33L 1YJNA 1B7YB 4A3DB 1UE5A 2A73B 1IL2A 1HR0L 3NE5B 2JA8G 4UY8C 4N8FA 3GTMH 4RAUC 1U9RA 5KRUA 4HJ9A 1U4PA 2KCNA 1STGA 1I50B 5FLXL 1Q8KA 4B3MQ 4IUTA 2O5IC 2MFIA 3J81i 1D5ZC 5C3EB 3S16B 3K7AH 2JEBI 1LTGD 1OO9B 4DR3Q 1VQMA 2TSSA 2N78A 2UXBL 4GOPC 3GTKH 3MA2B 4JVZA 1PV4A 3T13A 1VQCA 3QWNA 5JOBA 2HCCA 5FJ8G 4HIKA 4WRDA 4QIWB 1SYGA 3NP8A 4XYOA 1K73C 3KDFB 5D3DA 1GXDC 1WTPA 1LT3D 2F0UA 5ELEA 1X3EA 3TRZA 2KQ3A 4DR6Q 1M4VA 5CV4A 4A3GH 2K5DA 1K8AC 2UUAQ 1JCKB 1WTQA 1JQYD 2KCCA 2PI2A 5HURA 1GKHA 3R8BA 3NWTA 4ZQ3A 3NBHB 5JEAH 3GTPH 1JJCB 3K5MA 1D5MC 4YHHQ 3DHQA 1EY4A 1SE4A 3OTOQ 3I73A 5BR8L 2F0WA 3ERQA 3CD6A 2KCTA 3PO2B 5LMUQ 2WACA 1D1IA 4DR7L 1B2TA 1IBMQ 2VB3X 2QDLA 2E74C 1I94Q 1KL9A 2O2LD 3I4MG 1GHKA 4EQPA 1I5FA 2E5LL 1W2BA 1WTWA 4PQXA 2B2VA 2JN4A 3MFGA 1GD7A 4XQQA 3FMCA 4PV1C 4YY3Q 3SK8A 2IHEA 1PTOB 1D1KA 1KD1C 2MHVA 2PPBC 4HMIA 4ZKCB 1S5CD 2JA5G 4IQZA 5EKKA 1HRJA 1FGBD 2K28A 1Y8NB 2KHIA 4FF1A 3A54A 4GKKQ 2C35B 4DV7Q 3FPPA 1NR4A 4C3HB 4AQYQ 2K04A 1KLGD 2WKDA 4R4TA 3A8KE 2R93G 2JJQA 1NBWA 5IP9H 1UWVA 2BH2A 4R4CA 1KQSA 2E2DC 3UE0A 1VQFA 4DAYB 1LACA 3BDLA 3HKSA 4K8JA 1IBKQ 1ML0D 1VMPA 3ULJA 1LYLA 5BN3A 2A1AA 1WD1A 4WJ4A 4DV0L 5LMNL 2O4XA 1EQVA 1WTOA 4RGMA 5FKAC 1X9NA 4EGVA 1XMQL 4LF8Q 3STBD 1GM5A 2WP8J 2O5JC 3J7AF 4P73A 1E1TA 5IT9c 5GAHC 3S17H 2UXCL 1X3FA 2LXKA 3RR5A 4DN4M 1UEAB 2Z6KA 1Q90A 4X3UA 5M3MH 3M4QA 1QG7A 3J80i 2PZWA 1YNND 4NXML 1VQHA 3ZYYX 1TWGB 1PXUA 1PTOD 2VB2X 3AEVA 4LF4L 4PMCA 3KBXA 2VZAA 1R4QB 1PRTD 1RJTA 3S2HB 3P1HA 1YEZA 2EY2A 1HR0W 2ZXPA 1HJPA 4K8IA 3TZDA 2B2WA 2I07B 3IL8A 2E2JH 1UEBA 3HKZB 4YCVA 3HG9A 2KJXA 3DWAA 5ELFA 4APVA 4DAMA 2GVAA 3GTOB 2NN6G 4X6AH 3TEHB 3S1NH 1SROA 1D5XC 1K0RA 5EKIA 2F0DA 2JA6B 4A3IB 1JWSD 1AZQA 3KJPA 4GLXA 2GVBA 4XIGS 3S9WA 3CXCA 1FJGQ 3I72A 2GN5A 4PZ8A 1WCMH 2IHFA 2R92H 2VW9A 5ELDA 5IGEA 3PUXA 3KK7A 1A15A 1XNQL 1MKHA 2FXQA 1ENAA 3MWYW 4A3EH 4LNQA 3K5OA 1C4QA 1DOLA 3PO3G 4EVOA 1K83H 3JAME 5A2QL 1LO5D 3K57A 5C4XB 3BVGA 1YNJD 1V9PA 1GJXA 4UDUC 5DNFA 2LY7A 2X69A 2JA7B 2F0FA 4LFAL 3BYYB 1XXGA 1OXXK 3BDCA 4RA8A 1UUPA 1WTHA 4C3JH 4C2MB 2CCZA 3HOUG 1ZKOA 2R7ZG 4BBSB 3K0XA 1JICA 3KLWA 1MJEA 2QCPX 2WB1B 1G6ZA 1QE6A 5EBCA 3VR4A 2IX3A 5DAUA 4ZKBB 3S1QH 1E2VA 4AYBB 4B9WA 5GAEC 2JYOA 1EU4A 3BS1A 1JB3A 3L3OC 1SNOA 5IE8A 1N34Q 4DV2L 2K5WA 2K5NA 3T16A 2ZTCA 1EY0A 1VQBA 2C9OA 3P20A 3TQYA 5M3FB 2NVYB 1IYUA 2RCNA 4JW0A 1B9MA 4R4QA 5C4JH 2AMCB 4KY5A 4PNYA 4JK1C 4A3FB 3GTGH 2BA1A 2ZM6L 4S3SA 3M4OH 2IWHA 1L0YB 4HAEA 4XQNA 2NWGA 1R9TB 2G9HD 3ER0A 4BA1I 1HQMC 4R4IA 5DLQE 1IKLA 4A3GG 2EPBA 4WFN3 1SNMA 3W1BA 3HOWH 1CI3M 4FF4A 3BZDB 3K8AA 4DNTB 1Q7YC 1G2TA 1V43A 1EQTA 1SR3A 4A3CH 4CHTB 3M3YH 4IPCA 4ULLA 5JEAG 3OHXC 4FYDA 1C48A 4JYAL 3W1GA 4DUYL 4N8X1 3T1HL 1CQVA 2Z0SA 3I55A 3G4SA 5LMNW 1QZGA 3NPPA 5E1FA 3F1ZA 4JI1Q 1GOZA 4JV5L 5KIXA 1ZEQX 1DM0B 3MXUA 4DR2L 3PQIA 1PFSA 3BZCA 3E0EA 5EKLA 1L1OB 1WD0A 2RSNA 4IPHA 1HNZL 4N9PA 1ILQA 4MIUA 2PQEA 1B53A 4I7ZC 3T1YQ 1PA6A 2NVTH 3FKIB 1QVGA 2NB0A 3HRZC 5M5WB 1SEBD 1RHPA 2EE1A 1NSNS 1VQGA 4JI0L 1VF7A 2RSOA 3S2DB 1S3OA 4R8NA 1VS0A 1X55A 1RTOA 1HUMA 4A93H 1H9SB 3CRKC 3E9HA 4QUFA 1TWFB 3UDGA 4P75A 1DJRD 1I6HB 1ICWA 4B3SQ 1VQNA 5HGQA 3F2CA 1AP0A 4DXGA 1X65A 2PMZB 1Z6HA 1D6EC 2N3SA 4HIOA 5IP9G 2QGQA 3AB9A 3S1RB 3A0JA 1PTOF 1HH2P 3RLOA 4M1UB 3JC66 5CGKA 2K75A 3G48A 2UUBL 5M5YB 4HIDA 2HIXA 2K32A 3FDTA 2DJGC 4EQOA 4LF5Q 4P2CB 1NY4A 4TRDA 3SK4A 3J81c 4LUVA 1G6PA 3K0YA 5ELOA 4OIJA 1YI2A 1I4XA 1PYBA 1C7YA 3PMFA 3QG1A 4B3RQ 1PHJA 4K0KQ 4IUNA 5G3LD 5M3MG 3GQBA 2EVBA 4X64Q 3PUZA 3CCJA 3FVQA 3S15B 5HGTA 4R8IA 1IBLQ 3TDQA 2KVMA 3R2TA 2NTTA 4TKOB 2KOLA 4H7BA 4PG3A 2EXDA 4KI0A 1XMOL 1SSOA 1EQQA 1KAAA 2HQEA 4POFA 2B2UC 2CQAA 3A7AB 2UU9Q 3V2TA 4P74A 3ZJYC 4JI5L 3I4NH 1G51A 3C46A 1EYGA 2L5TA 5C5MA 1SYFA 2HCIA 2K5HA 1QCBD 4YCWA 2JA8B 2EZVA 3TMEA 2K03A 1RD9D 4A3BH 3E6ZX 1WCMG 5HY6A 4KHPQ 4G4KA 2R92G 2HD3A 1E1OA 2BDNA 4K5WA 1KNEA 4GS3A 2Z6BA 4HJ7A 3IKJA 1YIJA 4A3EG 1BDOA 2D0PA 2WAQG 2D62A 4U673 2JXMB 3MHBA 1QNKA 4K5XA 1F9RA 2KECA 1B9NA 4OONA 2ICEC 3QIAA 1S5DD 1EEID 2B2YA 4C3JG 4JI4Q 4G7ZC 2EYJA 4K5VA 3MXNB 4LF6Q 2VQFQ 2K4KA 1CSQA 1F2MA 1O80A 4IFDI 2F0KA 1TS4A 3U9SA 5M5XH 4GOPB 3CCMA 4KHPL 1VMCA 2ES2A 2L4NA 2A6HD 4KD3A 2HIVA 1BKBA 5IGCA 4KHZA 2LFNA 4CJ1B 3SK5A 1P8LA 5KEEA 2QEJC 2A5HA 2ATWA 2XRQD 3PSIA 2NVXH 1E24A 3H3VI 2L15A 1TWAH 4RG1A 4A3MB 5IT9L 4BY1H 5E7NA 3L7ZC 1BO0A 2BE5C 4JC0A 2NVQB 1EYCA 1S5ED 2WAQE 3M4YA 2NYZD 2B2VC 4LF7L 1K8MA 3I90A 3TP6A 1XNRL 1H9MA 1TT2A 1CFMA 1L0XB 4LMQD 1I3QH 1VDZA 4UP7A 1DD2A 2JE6I 2RVLA 3J80c 3HOWG 5IYBH 2J0TD 1PZKD 4G7HC 2J7ZA 3BU2A 1EY6A 5CYUA 2Z8LA 3P75A 2VNUD 4A3CG 2JA5B 1E2WA 1HNWQ 3UDIA 3FHWA 3EJIA 3QOLA 1X54A 3TSSA 1V1PA 2VY3A 2B2TA 3GTJH 1JORA 1A62A 1CUKA 5CBAE 1HFNA 2R93B 2CQOA 1EL0A 5IWAQ 4DV5Q 1H95A 4OELB 1AZPA 1I4PA 1SJED 1AW7A 2PI2E 3KOJA 3RMHA 3M85A 3C2PA 3BG3A 1PH1A 4RGOS 2VQEQ 4QY7A 1N33Q 1ASYA 3HFZB 2AWNA 2F0NA 3L0OA 1HR0Q 1SYCA 2QA4A 1Y8OB 4GLVB 4RCNA 3KBGA 4KHVA 2EIFA 3L9AX 2VS1A 2RDHA 3N52A 3GTLH 2QW7A 5EPJA 4GLAC 3HOYH 1KNAA 4L8JA 2Z6KC 1TWHB 1VQJA 1I6VC 4DKAC 1PH4A 4A93G 1C0AA 2J4XA 2K50A 1SFOH 5IOCA 1QB5D 3SGIA 1VQLA 4XT3B 2ZJRA 5IODA 1F2LA 1HHVA 2IT1A 2L12A 1Q46A 2RDFA 5CR3A 1PH6A 1CHQD 1GUOA 3S24A 4HN7A 2MGSA 4GZYC 3H3VH 1SNPA 4LUZA 2PZTA 4FXGC 2OWOA 2X6GA 3WOEA 2B2WC 4DV3L 5KNDA 4O0AA 3UI2A 5KNBA 2E2HH 4OO1I 2YU9B 4ZRZA 1CA6A 3NENA 3PO2H 5IGDA 1QZHA 4JI3L 1J9OA 4JI8L 1SMXA 2N55A 5BR8Q 1V1QA 3CC2A 5KYIA 2Q2HA 5TSSA 1PFBA 4DR7Q 2K5QA 4FNFA 3OPOA 1ESRA 1QVFA 1AEXA 1PZJD 4IPDA 3D4RA 2E5LQ 3I91A 1I4RA 1UE1A 4X3KA 2GA4B 4V0BA 5DEHA 1LT6D 1Q1EA 1D2BA 4LJZC 1SYBA 3PO3B 5I9PA 4HSVA 4UPAA 3TN2A 5A35A 4DK0A 4C3HH 4BS9A 5I6WA 3K6OA 3PIOA 2OEOA 3GD7A 4BXXH 2EYMA 3HOUB 2LXJA 1Q82C 4F88A 2PYKA 5F2DA 5CBEE 4IO9A 2R7ZB 2KEDA 3NXWA 3RLFA 3ULPA 4ZUJA 5JEAJ 3KJOA 1ZYRC 2IL8A 3VR2A 3KLSA 3I4NG 1D7QA 1MGSA 2NBFA 2KA7A 2OCEA 1EY7A 4JBMA 1UE6A 1EIHA 1BOSA 1H9SA 2IW3A 1N9WA 5CORA 4NKLA 1YITA 3GTMB 3OYYA 5E3FA 4A3BG 4HSPA 3MTSA 2IX1A 5C44H 3I3CA 2I0QA 3PUWA 1LABA 3H91A 1GVPA 4DK3C 4J1MA 3Q22A 4BA2I 1ILPA 4DV0Q 5LMNQ 4G7OC 1PH8A 2YTXA 1LT5D 2Z9HA 3Q6SA 1XMQQ 3D3RA 3GTKB 1X56A 2OQ0A 5IYCH 3NK9A 4JOIA 2XVSA 4KD4A 1Q12A 4KY7A 2E8GA 2BA0A 4XDXA 1VQ6A 4JI6Q 3KUPA 4OO1H 5EAYA 2F0HA 3RZOH 4TQUS 4CDCC 3DM3A 4IUPA 1E7ZA 2JQOA 2Z1CA 4MTKA 3D4WA 3MXPA 3NEMA 4A3GB 5K36H 4IZ8A 4NXMQ 4RGNA 1HZAA 3OWEB 1VQOA 4C1NI 4A3JH 4JG2A 2JEAI 4LF4Q 1EYAA 3GTOH 3EA6A 1C9OA 2PW5A 3KF8B 3GTPB 4A3KH 5JJIA 2RQXA 2PO4A 3GV3A 1OXUA 2CW0C 2EYLA 5EPLA 4OX9L 4P72A 1CM9A 5IYDH 3BVMA 3VDYA 2FMMA 5L37A 1DXMA 4JI6L 4BY1G 3LWEA 2KCMA 1T5XD 1VQ7A 4O42A 3E5SA 3RN2A 1QJOA 2F0OA 4HMJA 1VQAA 1SJHD 3DXJC 1LTLA 1S4ZA 2JA7H 3URYA 1LTRD 4UAIA 3EROA 5IYBG 1EWHA 4LFCL 1XNQQ 4KKUA 3X3MA 4C2MH 5GROA 2LS01 4DR1L 1VF5C 3C1EA 5AJ3L 4QMGA 1F9QA 1HXYD 1JC7A 1STNA 4LFAQ 2Q8IB 3A8JE 3GTQH 1KDBA 3Q23A 4NW2A 2RKSA 1PDQA 3OIPA 4WJ3M 1STYA 2F0EA 3G7LA 4X3SA 5C4HA 1HNXL 2YTYA 3J81j 5E4WC 5I6YA 1A6XA 2MP1A 3CC4A 4Y7NH 3CF5A 3EIVA 1JR0D 5NUCA 1S5FD 2NVYH 2A74C 3I70A 4IUVA 4LK1C 2EY1A 1EFID 4DV2Q 4A3FH 2DUDA 1A3TA 1H9KA 2Z4IA 3E3XA 1KTKA 4RWSC 4DXFA 4OIKA 4U68A 3H3VC 1I4QA 2WV6D 3EFXD 3BVZA 4C56C 3HOYG 1U4LA 3S17B 2ZM6Q 2B8GA 1Z9FA 5IT9E 1HTPA 1IW7C 1Y1WH 5IGBA 1BNZA 5EBDA 3HP3A 4L5QA 3STBC 3S1MH 1J5EL 4FXDA 5M3MB 4BBRH 1CKOA 4H0LC 4R4OA 1FVIA 1U0LA 5COYA 5I4DA 1KLUD 5DM63 2WIIB 1SE3A 4NPSA 2I5MX 4J6HA 4J8QA 1NE3A 1H9JA 1RKNA 3KF6A 1KRTA 3UE1A 1NCVA 3CW2C 1YNNC 3DLLA 3CCQA 1O78A 3S14B 4MNOA 3NELA 2FHTA 3PO2G 4POGA 3SE0A 5KGUA 1OTCA 4OHJA 4FVMA 3FRPB 4EX5A 4JYAQ 5T1IA 1PRTC 3T1HQ 3NHHA 4DUYQ 5C5LA 4KMUC 3S1NB 4CJ0B 4A4IA 1YNXA 4JV5Q 1YZ6A 2HHHL 4DR2Q 4XXEA 1HZBA 4HJ8A 1IHZA 3CMAA 1N32L 4CJ2C 1SMYC 1LTBD 1LM0A 1K8GA 1O7IA 2JP1A 4LW1A 5C6AA 1HQRD 3Q0AA 5FLXc 1XWEA 3SXHA 1LLRD 2K7VA 5IGFA 1WCMB 3G6JB 4YCUA 1HNZQ 2R92B 1EIYB 4OWTB 2CH4A 1TWCH 1ONLA 4QJFA 3J80L 1AN8A 1XTDA 2MUYA 4A3EB 5JVG3 5EPKA 2WAQB 1DCZA 2MNAA 1K83B 1VQDA 1EIGA 3FP9A 4IALA 2A6EC 3E0JA 2B2YC 1X6OA 4L5TA 4C3HG 4JI0Q 2CKZB 1B44D 2K33A 4BXXG 1FL0A 4C3JB 4K14A 2PCFB 4GNXA 3QO2A 4A75A 1AE3A 4CGYB 3MEHA 1NNXA 5FOBB 1LTTD 1B4OA 4DR5Q 3S1QB 1YJ9A 2F0LA 5J1ZA 5LL6S 1EZ6A 1PFMA 3TREA 3F8TA 4RFBA 5C44G 3K5LA 3DEPA 1A8VA 1VQEA 3MFYA 2UUBQ 1GO3E 1EY8A 3GTGB 5CV7A 2E2IH 3M9BA 3M4OB 3SHLA 2JK8A 2OT2A 5IYCG 5C0XI 1VQ9A 1PH5A 2AHOB 1X3GA 4BY7H 1V8QA 1DOMA 5IIFA 2HUGA 4JBWA 1PMRA 1N36L 1EOTA 4DR5L 4OO1G 5ELBA 4ABNA 1EZ8A 2VUMH 2ZTDA 4YWMA 1TS5A 3OMGA 5K36G 5J39A 3HOWB 5FK9C 4A3JG 3RZDH 2EJMA 4B9XA 3CQZH 2FJ2A 2YYZA 3KDFA 1YBYA 3M3YB 2F1MA 3TP5A 2B2TC 1XMOQ 1BF4A 3HOVH 3LGJA 2NZ1D 4A3KG 4A3IG 5CV5A 4JPBW 3TZUA 5K5PA 3K58A 1W3SA 2CVRA 2EYPA 3NQIA 2K5VA 5IYDG 3J7AV 1AE2A 3U50C 1B70B 5JJKA 3HOXH 3U9OA 3JAMi 4JI5Q 3NBHA 5FO9B 3J7ZC 2F0MA 2Y0SG 1E22A 1BR9A 3EBEA 2Q8TA 3L2PA 3VYRA 2MO1A 3T51B 1HZCA 3NWSA 2DY8A 4DNIA 3V96A 3I7FA 1SDFA 2NVTB 1WVLA 4LFBL 2AQ1B 2JA7G 4I65A 2PNHA 4WORA 4R1JA 1X32A 4DA2A 2EOTA 1JJ2A 3OW2A 1Y1VH 1JT8A 4XT1B 1K8OA 4A93B 1W6JA 1PLFA 1FNVA 3CAMA 5EJWA 3IAYA 4GN5A 1MSHA 4DV1L 3D4DA 1MD2D 4C3IH 3B6YA 2EYFA 4GKJL 1BCPC 2VL6A 2F4IA 3C1FA 2BE5D 3D6WA 4KKSA 1QILA 1EFWA 3NTHA 1Z47A 4IURA 2Y0SE 5C0XH 4A3FG 1STBA 2VXWA 4A3MH 5KYLA 4DAYA 2PZUA 2SDFA 4NMZA 2PQAB 4ODGA 4F8MA 1TU2B 1PYSB 3J81E 2HQLA 2DN8A 3RD4A 2EJGC 5IP7H 2M00A 2QF7A 1WFQA 1Y1WG 1BVSA 2MO0A 3VR5A 3H0GH 3KLSX 3PGZA 1OXSC 4LF7Q 1NJIC 4BBRG 3PIO3 1XNRQ 3W5OA 4NXNL 4DPGA 3PV0A 3A5UA 3H15A 2KHJA 1GUTA
chains in the Genus database with same CATH topology
3DM1A 2QILA 3D31A 3Q24A 1ENCA 4IUQA 4QCLA 3NSWA 5JJZA 4B08A 1FNWA 2SEBD 5EGTA 1TKWB 4OGQC 2WINB 3VA7A 2FFKB 4G57A 3I4NB 4C1NK 3I4MB 3OIQA 2ZXRA 4A3BB 4ZAIA 4DFAA 3D6CA 1ET6A 1Q3LA 3VR3A 5ELCA 1EEFD 1UNSA 2BCOA 1M8AA 4HTHA 1B50A 2SOBA 4FXKC 2Z4HA 4H44C 3HEJA 4K2KA 2B39A 3VYUA 4PMBA 4V190 2WKCA 2A68C 1F77A 1VCIA 4DF7A 1II3A 2I46A 4KV6A 4DAPA 5FO7B 3H94A 4KN7C 1TQOA 1U4MA 3ONAB 2XRSD 4IFDH 2NVXB 2AUKA 2L55A 2PNRC 5I2YA 4Q0FA 1TWAB 5LHY1 4KK7A 1BBXC 4BY1B 1XYIA 3QJYA 4KJNA 1STEA 1IYVA 5CV6A 1CTMA 3R3OA 5IGGA 1R4PB 2H1EA 1O7YA 1I3QB 3CKIB 2HDLA 1CK1A 4ZYSA 1ZYRD 4DNRB 2B8FA 1CZGA 2ZT9C 3J80E 1UAPA 1EYDA 2A69C 2DNCA 3ND9A 5C3XA 2L9HA 2F0QA 3GTJB 2ZXOA 1CA5A 4IUUA 3MXGA 3AU7A 2XWBB 1PTOH 1FNUA 1JWUD 4Q5VA 2F03A 4ZUIA 2HDMA 1HCZA 2IPKD 3ITPA 2BDOA 2JSOA 4DU9A 3A56A 2EYHA 4HCEA 3GTLB 1OXVA 1WTXA 1TIID 3HOYB 1MI2A 3GO5A 5JVH3 1SFOB 1GUNA 3BYTB 4C3IG 2CW0D 3FEWX 3DMUA 1CZWA 2M2LA 2F0SA 1NR2A 2SNMA 2E2HB 5BN5A 4MN3A 5C0XG 4HCSA 3K7AB 4KTAA 4HEDA 1S5BD 2D5DA 1FD7D 1CHPD 1T5EA 4RH6A 4X3TA 2BOSA 3AMUA 1BUVT 3TP7A 1LT4D 4QB4A 4BWGB 1PRTB 2R6GA 1A2TA 3WOFA 2AWOA 2K05A 5C3WA 3I4LA 3CU7A 1HA5A 1SYDA 1DOKA 4KKTA 3OW7A 2FINB 3QOJA 3J81L 3LWUA 3SDZA 1DZ1A 1EY9A 4PMWA 1IW7D 2ICIA 4N9TA 1SE2A 5C44B 1TR5A 4EQNA 2E76C 3D8GA 1O7ZA 4H13C 1XTCD 4FF3A 1F9SA 1G291 1JOOA 1QOHA 2IX0A 2Q8RE 3DWPA 1WTRA 4XYQA 3OMCA 5KNCA 1FR3A 3RZOB 1HFGA 3W3AA 1Q8IA 1AFPA 1BQQT 4CKBA 3OSOA 4L6TB 4A3JB 3A8IE 1Y8PB 1CT1D 2RA4A 3VA5A 1RTNA 3MXNA 3M7NA 1SMYD 1OXTA 2EY6A 4A3KB 3KLRA 4R9WA 3O13A 2M9VA 4Z9CB 2XNAC 4F87A 4IFDG 2KHSA 1E2ZA 3MVVA 3M7GA 3DWQA 2A6ED 3A55A 2Y0SB 4WJWA 3NTKA 4CBVA 1U4RA 4NDXA 1V1PB 3T53B 1A3VA 1Z7TA 3CRLC 3IFDA 4E6IA 3SVMA 2XN9C 3WDNA 3P7JA 3N6RA 1GUWA 1SAPA 4TSSA 1TY2A 1GUGA 5CV8A 1PTOC 4RKBA 3T56B 2E2JB 3SK6A 1ET9A 3FPUB 5EQ0A 1EY5A 4RHSA 2H4OA 3GTQB 4KY6A 4DAVA 5FO8B 4OL7A 2LKVA 3LNNA 3OWFA 3T4AC 1BXTA 1SBBB 5JPNC 3R93A 4Y7NB 4K6DA 1PFNA 2TMPA 1O7LA 2F0IA 2F3WA 4MHEA 1BCPB 5CC4A 1PZID 1HA6A 2RBMA 3H09A 2L11A 2E75C 2RDGA 4NP5A 2AUJD 2L1BA 2L0CA 1Y1WB 2CHBD 1B1ZA 2EYOA 1ZXTA 3S1MB 3CHBD 1YNJC 4BBRB 1A2UA 4FF2A 1EWCA 1FYCA 4CKEA 1KABA 1PYWD 1STHA 2DNEA 1LTAD 5AFWA 3GP7A 3I8ZA 1B3AA 1HUNA 1TVXA 2DY7A 1ENFA 3VYSA 2QKIC 2X6LA 1G8ZD 4F7XA 1LTSD 2F3VA 2MJ8A 5C4JB 3VYTA 3OOCA 3RUZA 3SEBA 2AQ3B 4ZLTF 5D3IB 1F2YA 1MBYA 4CKCA 3IFTA 4IN3A 1G91A 1SNCA 5ISRA 5FLXE 5C4ZA 3A7LA 1XX8A 3J7YW 1TWCB 5M9OA 1HPCA 3ND8A 4FP5D 3C3LA 1BCPD 5DM73 3NBIA 4XTCS 5T1GA 1X3QA 3VR6A 2EDGA 2F0JA 3H6MA 2D9UA 4ME5A 5D65A 2OXPA 5I2XA 2LMCB 1PRTF 1SNDA 1TS3A 3EVQA 1Q1BA 4QF4A 3HGBA 1KDAA 1SXTA 2XWJB 4ILWA 4K6LA 2N88A 4QUCA 3LX0A 3BDOA 1X3PA 1C8CA 2E2IB 1TY0A 1GHJA 1W6KA 2K1BA 3DEOA 1JOQA 2F0PA 4BY7B 5JPMC 2FMCA 1QWYA 2ENBA 3W2DA 2F0GA 2VUMB 1GUSA 2XSCA 3EQLC 3RZDB 1F2ZA 4O1NA 3CQZB 3F2UA 4YIJA 1SYEA 3MAQA 3HOVB 3PUVA 5LL6X 5C0XJ 2ID0A 4L63B 3HOXB 2NN6I 5CMDA 3KF8A 1H9RA 3NUCA 3PUYA 1RODA 1NAPA 4HR7B 1JOKA 1V1OA 2QDBA 1DYQA 2NUCA 2EY5A 1I4GA 1I4HA 2KUMA 2PW7A 2A68D 2K01A 2MPMA 3QB3A 5BN4A 1Y1VB 2R61A 3PIP3 2OF1A 5E4XA 3NTIA 1Y69U 3GV6A 5J22A 2NTSA 1J8IA 4C3IB 4K2LA 3MZ5A 1LV9A 3SR1A 2K6AA 4RKLA 4DK1A 3DUZA 4RHRA 1JE4A 3JAML 3HS0C 1EU3A 1SNQA 2V4DA 1WTVA 1HTLD 4XQJA 1TS2A 1KDCA 1LTID 1STAA 4FO2A 1IL8A 2A69D 4KJOA 1NUCA 3X3NA 2IJ0A 3H0GB 4KN4C 4DGZA 5D14A 3R2IA 3K59A 5A2QE 3K5NA 1E0BA 5M5XB 1QNUA 2XIWA 4RCOA 2SNSA 3HZXA 1JWMD 4RGTA 4ZK9B 2NN6H 1BCPF 2KEEA 2G9DA 1MSGA 3HOZB 1RDPD 2A6HC 1DONA 2B63B 3MC0B 5I9OA 2EXZA 4IFDJ 2F0VA 2F0TA 2D2CC 3V05A 5CV9A 5JAVA 1A3UA 1IKMA 2AQ2B 1RF2D 1G2SA 4ID6A 1ESFA 1F9PA 3TP8A 2EJFC 1RCVD 3TBIB 2B2UA 4LAAA 2R3ZA 4M8AA 1CQFA 2C5CA 3NQTA 5G3LF 4A3DB 2A73B 3NE5B 4RAUC 1U9RA 5KRUA 1U4PA 2KCNA 1STGA 1I50B 5FLXL 4IUTA 2O5IC 1D5ZC 5C3EB 3S16B 2JEBI 1LTGD 1OO9B 2TSSA 3MA2B 3T13A 3QWNA 5JOBA 2HCCA 4WRDA 4QIWB 1SYGA 3NP8A 4XYOA 5D3DA 1WTPA 1GXDC 1LT3D 2F0UA 5ELEA 2KQ3A 1M4VA 5CV4A 2K5DA 1JCKB 1WTQA 1JQYD 2KCCA 5HURA 3R8BA 3NWTA 4ZQ3A 5JEAH 3K5MA 1D5MC 3DHQA 1EY4A 1SE4A 3I73A 2F0WA 3ERQA 3PO2B 2WACA 1D1IA 1B2TA 2VB3X 2E74C 1GHKA 2O2LD 4EQPA 1WTWA 4PQXA 2B2VA 3MFGA 4XQQA 3FMCA 4PV1C 3SK8A 1PTOB 1D1KA 2MHVA 2PPBC 4HMIA 4ZKCB 1S5CD 4IQZA 5EKKA 1HRJA 1FGBD 2K28A 1Y8NB 4FF1A 3A54A 3FPPA 1NR4A 4C3HB 2K04A 1KLGD 2WKDA 3A8KE 2E2DC 1LACA 3BDLA 4K8JA 1ML0D 1VMPA 5BN3A 1WD1A 2O4XA 1EQVA 1WTOA 4RGMA 5FKAC 4EGVA 2WP8J 2O5JC 3J7AF 4DN4M 1UEAB 1Q90A 4X3UA 1QG7A 2PZWA 1YNND 3ZYYX 1TWGB 1PXUA 1PTOD 2VB2X 4PMCA 3KBXA 1R4QB 1PRTD 1RJTA 3S2HB 3P1HA 2EY2A 2ZXPA 4K8IA 3TZDA 2B2WA 2I07B 3IL8A 3HKZB 3HG9A 2KJXA 3DWAA 5ELFA 3GTOB 2NN6G 1D5XC 5EKIA 2F0DA 2JA6B 4A3IB 1JWSD 1AZQA 4XIGS 3S9WA 3I72A 5ELDA 5IGEA 3PUXA 3KK7A 1A15A 1ENAA 3MWYW 3K5OA 1C4QA 1DOLA 4EVOA 3JAME 5A2QL 1LO5D 3K57A 5C4XB 3BVGA 1YNJD 1GJXA 4UDUC 5DNFA 2LY7A 2X69A 2JA7B 2F0FA 3BYYB 1XXGA 1OXXK 3BDCA 4RA8A 1UUPA 4C2MB 1ZKOA 4BBSB 1JICA 2QCPX 2WB1B 1G6ZA 1QE6A 5EBCA 3VR4A 2IX3A 5DAUA 4ZKBB 1E2VA 4AYBB 4B9WA 2JYOA 1EU4A 3BS1A 1JB3A 3L3OC 1SNOA 2K5WA 3T16A 1EY0A 2C9OA 3P20A 5M3FB 2NVYB 1IYUA 1B9MA 4KY5A 4PNYA 4JK1C 4A3FB 2BA1A 4S3SA 2IWHA 1L0YB 4HAEA 4XQNA 2NWGA 1R9TB 2G9HD 4BA1I 1HQMC 1IKLA 2EPBA 4WFN3 1SNMA 1CI3M 4FF4A 3BZDB 4DNTB 1G2TA 1V43A 1EQTA 4CHTB 4ULLA 5JEAG 3OHXC 4FYDA 1C48A 1CQVA 3NPPA 5E1FA 1GOZA 5KIXA 1ZEQX 1DM0B 3MXUA 5EKLA 1WD0A 2RSNA 4N9PA 1ILQA 4MIUA 2PQEA 1B53A 4I7ZC 3FKIB 2NB0A 3HRZC 5M5WB 1SEBD 1RHPA 2EE1A 1NSNS 1VF7A 2RSOA 3S2DB 4R8NA 1RTOA 1HUMA 1H9SB 3CRKC 4QUFA 1TWFB 1DJRD 1I6HB 1ICWA 1AP0A 4DXGA 2PMZB 1Z6HA 1D6EC 3AB9A 3S1RB 1PTOF 4M1UB 5CGKA 5M5YB 2K32A 3FDTA 4EQOA 4P2CB 4TRDA 3SK4A 3K0YA 4OIJA 1I4XA 3PMFA 3QG1A 4IUNA 5G3LD 3GQBA 2EVBA 3PUZA 3FVQA 3S15B 5HGTA 4R8IA 3TDQA 2KVMA 3R2TA 2NTTA 4TKOB 2KOLA 4H7BA 4KI0A 1SSOA 1KAAA 2HQEA 2B2UC 2CQAA 3A7AB 3V2TA 3C46A 2L5TA 5C5MA 1SYFA 2HCIA 1QCBD 2JA8B 2EZVA 3TMEA 2K03A 1RD9D 3E6ZX 4G4KA 2BDNA 4K5WA 1KNEA 3IKJA 1BDOA 4U673 2D62A 2JXMB 3MHBA 1QNKA 4K5XA 1F9RA 2KECA 1B9NA 2ICEC 3QIAA 1S5DD 1EEID 2B2YA 4C3JG 4G7ZC 2EYJA 4K5VA 1F2MA 1O80A 4IFDI 2F0KA 1TS4A 3U9SA 1VMCA 2L4NA 2A6HD 4KD3A 5IGCA 4KHZA 2LFNA 4CJ1B 3SK5A 5KEEA 2QEJC 2A5HA 2XRQD 4A3MB 5IT9L 3L7ZC 1BO0A 2BE5C 2NVQB 1EYCA 1S5ED 3M4YA 2NYZD 2B2VC 1K8MA 3I90A 3TP6A 1H9MA 1TT2A 1CFMA 1L0XB 4LMQD 1VDZA 1DD2A 2JE6I 2RVLA 2J0TD 1PZKD 4G7HC 2J7ZA 1EY6A 5CYUA 2Z8LA 3P75A 2VNUD 2JA5B 1E2WA 3EJIA 3QOLA 3TSSA 1V1PA 1JORA 2B2TA 5CBAE 1HFNA 2R93B 1EL0A 1AZPA 1I4PA 1SJED 1AW7A 3RMHA 3M85A 3C2PA 3BG3A 4RGOS 2AWNA 2F0NA 1SYCA 1Y8OB 4RCNA 3KBGA 4KHVA 3L9AX 2RDHA 3N52A 5EPJA 1KNAA 4L8JA 1TWHB 1I6VC 2J4XA 5IOCA 1QB5D 4XT3B 5IODA 1F2LA 1HHVA 2IT1A 2L12A 2RDFA 5CR3A 1CHQD 1GUOA 4HN7A 2MGSA 4GZYC 1SNPA 2PZTA 4FXGC 2X6GA 3WOEA 2B2WC 5KNDA 3UI2A 5KNBA 4OO1I 2YU9B 4ZRZA 1CA6A 5IGDA 1J9OA 2N55A 5KYIA 5TSSA 1PFBA 2K5QA 4FNFA 3OPOA 1ESRA 1AEXA 1PZJD 3D4RA 3I91A 1I4RA 4X3KA 2GA4B 4V0BA 5DEHA 1LT6D 1Q1EA 1D2BA 4LJZC 1SYBA 3PO3B 5I9PA 4HSVA 3TN2A 5A35A 4DK0A 4BS9A 5I6WA 3K6OA 2OEOA 3GD7A 2EYMA 3HOUB 4F88A 2PYKA 5F2DA 5CBEE 2R7ZB 2KEDA 3NXWA 3RLFA 4ZUJA 5JEAJ 1ZYRC 2IL8A 3VR2A 3KLSA 1MGSA 2NBFA 2KA7A 1EY7A 1EIHA 1BOSA 1H9SA 2IW3A 5CORA 3GTMB 4NKLA 5E3FA 4HSPA 3MTSA 2IX1A 3I3CA 3PUWA 1LABA 3H91A 3Q22A 4J1MA 4BA2I 1ILPA 4G7OC 1LT5D 3Q6SA 3D3RA 3GTKB 3NK9A 2XVSA 4KD4A 1Q12A 4KY7A 2BA0A 4XDXA 3KUPA 4OO1H 2F0HA 4TQUS 4IUPA 2Z1CA 3D4WA 3MXPA 4A3GB 5K36H 4IZ8A 4RGNA 3OWEB 4C1NI 2JEAI 1EYAA 3EA6A 2PW5A 3GTPB 2RQXA 2PO4A 3GV3A 1OXUA 2CW0C 2EYLA 5EPLA 1CM9A 3BVMA 2FMMA 1DXMA 3LWEA 1T5XD 4O42A 3E5SA 1QJOA 2F0OA 4HMJA 1SJHD 3DXJC 1S4ZA 3URYA 1LTRD 4UAIA 3EROA 1EWHA 4KKUA 3X3MA 2LS01 1VF5C 3C1EA 4QMGA 1F9QA 1HXYD 1JC7A 1STNA 2Q8IB 3A8JE 1KDBA 3Q23A 4NW2A 2RKSA 1PDQA 3OIPA 1STYA 2F0EA 3G7LA 4X3SA 5C4HA 5E4WC 5I6YA 1A6XA 2MP1A 1JR0D 5NUCA 1S5FD 2A74C 3I70A 4IUVA 4LK1C 2EY1A 1EFID 1A3TA 1H9KA 2Z4IA 1KTKA 4RWSC 4DXFA 4OIKA 4U68A 3H3VC 1I4QA 2WV6D 3EFXD 3BVZA 4C56C 1U4LA 3S17B 5IT9E 2B8GA 1HTPA 1IW7C 5IGBA 1BNZA 5EBDA 3HP3A 4FXDA 5M3MB 4H0LC 5COYA 5I4DA 1KLUD 5DM63 2WIIB 1SE3A 4J6HA 4J8QA 1H9JA 1RKNA 1NCVA 1YNNC 1O78A 3S14B 2FHTA 3SE0A 5KGUA 4OHJA 4FVMA 3FRPB 5T1IA 1PRTC 3NHHA 5C5LA 4KMUC 3S1NB 4CJ0B 4XXEA 1IHZA 4CJ2C 1SMYC 1LTBD 2JP1A 5C6AA 1HQRD 3Q0AA 1XWEA 3SXHA 1LLRD 2K7VA 5IGFA 1WCMB 3G6JB 2R92B 1ONLA 3J80L 1AN8A 2MUYA 4A3EB 5JVG3 5EPKA 2WAQB 1DCZA 1K83B 1EIGA 4IALA 2A6EC 3E0JA 2B2YC 4C3HG 1B44D 2K33A 4C3JB 4K14A 2PCFB 3QO2A 4CGYB 3MEHA 5FOBB 1LTTD 1B4OA 3S1QB 2F0LA 5J1ZA 5LL6S 1EZ6A 1PFMA 4RFBA 3K5LA 3DEPA 3MFYA 1EY8A 3GTGB 5CV7A 3M4OB 3SHLA 2OT2A 5C0XI 1V8QA 1DOMA 5IIFA 2HUGA 4JBWA 1PMRA 4OO1G 1EOTA 5ELBA 4ABNA 1EZ8A 1TS5A 3OMGA 5K36G 5J39A 3HOWB 5FK9C 2EJMA 4B9XA 2FJ2A 2YYZA 3M3YB 2F1MA 3TP5A 2B2TC 1BF4A 2NZ1D 5CV5A 3TZUA 5K5PA 3K58A 2CVRA 2EYPA 3NQIA 3J7AV 3U9OA 3NBHA 5FO9B 2F0MA 1BR9A 2Q8TA 3VYRA 3T51B 3NWSA 2DY8A 3V96A 1SDFA 2NVTB 1WVLA 2AQ1B 4I65A 4WORA 1X32A 4DA2A 2EOTA 4XT1B 1K8OA 4A93B 1W6JA 1PLFA 1FNVA 5EJWA 3IAYA 1MSHA 3D4DA 1MD2D 2EYFA 1BCPC 2F4IA 3C1FA 2BE5D 3D6WA 4KKSA 1QILA 3NTHA 1Z47A 4IURA 5C0XH 1STBA 2VXWA 5KYLA 4DAYA 2PZUA 2SDFA 4NMZA 4ODGA 4F8MA 1TU2B 3J81E 2DN8A 3RD4A 2EJGC 2M00A 2QF7A 3VR5A 3KLSX 1OXSC 3PIO3 3PV0A 1GUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I90 A;  3DM1 A;  4R8I A;  4X3T A;  1G2T A;  1PFB A;  2FMM A;  2HDL A;  2KEE A;  2KVM A;  2B2T C;  3TZD A;  4ZLT F;  1EQT A;  2B2W A;  2KOL A;  3IL8 A;  1U4R A;  4IUQ A;  4LMQ D;  5T1I A;  2NZ1 D;  1BF4 A;  1ESR A;  1MSG A;  3LWE A;  4CJ0 B;  5JJZ A;  1G91 A;  2RVL A;  1B2T A;  1DON A;  2CVR A;  3IFD A;  5CMD A;  4O42 A;  3I91 A;  1SSO A;  4X3K A;  2K05 A;  2J7Z A;  5EKI A;  1ROD A;  1XX8 A;  3SVM A;  1NAP A;  2L9H A;  4CJ2 C;  1AZQ A;  3P7J A;  2JP1 A;  1SAP A;  1GUW A;  2B2U C;  1S4Z A;  2FFK B;  4HSV A;  1WTW A;  3TN2 A;  2B2V A;  4UAI A;  2Q8T A;  1DOK A;  2FIN B;  2B2T A;  1CA5 A;  4IUU A;  5T1G A;  1WD0 A;  2KUM A;  3FPU B;  2DY8 A;  5EQ0 A;  1IKM A;  5EPK A;  2RSN A;  5CBA E;  2B2V C;  1SDF A;  1X3Q A;  1HFN A;  4ZAI A;  1F9Q A;  1ILQ A;  1WVL A;  5CBE E;  1EIG A;  1EL0 A;  1A15 A;  2KED A;  2HCI A;  2K01 A;  2MPM A;  4ZKC B;  1B53 A;  1G2S A;  3MWY W;  1AZP A;  2B2Y C;  2K03 A;  1DOL A;  1F9P A;  1HRJ A;  1Q3L A;  1X32 A;  5E4X A;  2K28 A;  2IL8 A;  4NW2 A;  2D9U A;  2EOT A;  1PDQ A;  5D65 A;  1DZ1 A;  5DNF A;  3G7L A;  3GV6 A;  2X69 A;  1MGS A;  1RHP A;  2BDN A;  2EE1 A;  1NR4 A;  2HDM A;  2B2U A;  3QO2 A;  4X3S A;  1KNE A;  2R3Z A;  4XT1 B;  1J8I A;  2K04 A;  1EIH A;  1PLF A;  4RA8 A;  5EJW A;  2RSO A;  3R93 A;  5COR A;  1M8A A;  5E4W C;  1MSH A;  2MP1 A;  1LV9 A;  1B50 A;  1PFN A;  3MTS A;  1O7Z A;  1QNK A;  1JIC A;  1RTO A;  1F9R A;  1B4O A;  1HUM A;  3I3C A;  1WTX A;  2KEC A;  1G6Z A;  4RAU C;  1F9S A;  1QE6 A;  4QUF A;  3H91 A;  1MI2 A;  3N52 A;  4IUV A;  1ILP A;  1JE4 A;  4ZKB B;  1ML0 D;  5EPJ A;  1ICW A;  1U4P A;  1VMP A;  2B2Y A;  1AP0 A;  1KNA A;  2Q8R E;  1PFM A;  4MHE A;  2JYO A;  3D6W A;  4IUT A;  2N88 A;  3Q6S A;  1WTR A;  1HA6 A;  4QUC A;  1WD1 A;  2L11 A;  4RWS C;  3DEP A;  2L1B A;  1WTV A;  1X3P A;  4IUR A;  4OIK A;  1WTO A;  1C8C A;  4U68 A;  1HFG A;  1O80 A;  4XDX A;  4XT3 B;  1F2L A;  1ZXT A;  2K1B A;  3KUP A;  2VXW A;  3DEO A;  1U4L A;  1HHV A;  2HCC A;  2L12 A;  2M2L A;  1VMC A;  1BNZ A;  2L4N A;  4IUP A;  2MGS A;  2SDF A;  3HP3 A;  1IL8 A;  1NR2 A;  1WTP A;  2X6G A;  4MN3 A;  2B2W C;  2RA4 A;  3FDT A;  4CJ1 B;  1U4M A;  1DOM A;  1RTN A;  3ONA B;  4HCS A;  2HUG A;  5AFW A;  3UI2 A;  4DN4 M;  4HAE A;  1EOT A;  4X3U A;  1BBX C;  3I8Z A;  1CA6 A;  1QG7 A;  1B3A A;  5COY A;  5D14 A;  2NWG A;  4OIJ A;  4HED A;  1HUN A;  1TVX A;  2DY7 A;  1XYI A;  1WTQ A;  2X6L A;  1E0B A;  1J9O A;  4R9W A;  3F2U A;  1BO0 A;  2N55 A;  1NCV A;  1IKL A;  2MJ8 A;  2XIW A;  3GV3 A;  2NYZ D;  3KBX A;  5EPL A;  2H1E A;  2EPB A;  4ZK9 B;  2FJ2 A;  1RJT A;  1CM9 A;  1O7Y A;  2FHT A; 
#chains in the Genus database with same CATH topology
 3DM1 A;  1K3R A;  3U4V A;  2QIL A;  3D31 A;  3Q24 A;  1ENC A;  4IUQ A;  4QCL A;  3NSW A;  1PH2 A;  5JJZ A;  3I2Z A;  1L0W A;  1IYJ B;  4B08 A;  1FNW A;  2SEB D;  4X66 L;  5EGT A;  1TKW B;  4OGQ C;  3HOZ H;  2Q2T A;  2WIN B;  3VA7 A;  2B63 H;  4YWL A;  2FFK B;  4G57 A;  4JBK A;  3I4N B;  1AH9 A;  1JMC A;  4C1N K;  3I4M B;  4HIM A;  1U5K A;  3OIQ A;  2RF4 A;  2ZXR A;  4A3B B;  4ZAI A;  4DFA A;  4FDB A;  3D6C A;  1ET6 A;  3CCV A;  1KXL A;  1Q3L A;  3VR3 A;  5ELC A;  1EEF D;  3A5Z B;  4JOI C;  1UNS A;  2BCO A;  1M8A A;  4YWK A;  4HTH A;  4QGU A;  1B50 A;  2SOB A;  1LUZ A;  2F4V L;  4FXK C;  2Z4H A;  4H44 C;  3HEJ A;  4A3D H;  4K2K A;  2B39 A;  3VYU A;  1T9H A;  4PMB A;  4V19 0;  2WKC A;  5FLM H;  2A68 C;  1K9M C;  1F77 A;  3CP0 A;  1I50 H;  1VCI A;  4DF7 A;  3AFP A;  5C3E H;  1II3 A;  3S16 H;  3I56 A;  2I46 A;  4KV6 A;  4DAP A;  4DV3 Q;  4HJ5 A;  5FO7 B;  3H94 A;  3CCL A;  2F3I A;  4KN7 C;  1TQO A;  4JI3 Q;  1U4M A;  3ONA B;  2XRS D;  4IFD H;  2NVX B;  2AUK A;  2L55 A;  2PNR C;  5I2Y A;  4Q0F A;  4JI8 Q;  1TWA B;  5LHY 1;  4KK7 A;  1BBX C;  4BY1 B;  4X62 L;  1CKN B;  4UP8 A;  1XYI A;  2F52 A;  3QJY A;  4KJN A;  1STE A;  4JI2 Q;  1IYV A;  5CV6 A;  4BY7 G;  1CTM A;  4DV4 L;  3R3O A;  5IGG A;  1JE5 A;  1R4P B;  3CCU A;  2H1E A;  1O7Y A;  1I3Q B;  1VQK A;  3CKI B;  3K7U C;  2VUM G;  2HDL A;  1CK1 A;  4ZYS A;  1ZYR D;  4DNR B;  2B8F A;  4LF9 L;  1CZG A;  1EUJ A;  1DGS A;  1ICF B;  2ZT9 C;  4DV6 Q;  3J80 E;  1YVC A;  1UAP A;  1TXY A;  3GDE A;  1EYD A;  2A69 C;  2DNC A;  4L5R C;  3ND9 A;  1NMG A;  1SE8 A;  5C3X A;  2L9H A;  3CPW A;  3HOV G;  2F0Q A;  3GTJ B;  2ZXO A;  3CCE A;  3PF4 A;  4JI2 L;  1CA5 A;  4IUU A;  3HOX G;  3MXG A;  4QL5 A;  3CCR A;  3AU7 A;  2XWB B;  1PTO H;  3WWV A;  1FNU A;  1JWU D;  1UE7 A;  2CH4 W;  3U58 A;  2R7D A;  4DV6 L;  4Q5V A;  2F03 A;  1SRU A;  4ZUI A;  2HDM A;  4CDF C;  1HCZ A;  4JI7 L;  2IPK D;  3ITP A;  2BDO A;  2XTI A;  2JSO A;  4DU9 A;  2LSS A;  4H02 A;  3A56 A;  1L1O A;  2QEX A;  2EYH A;  4HCE A;  3GTL B;  4DUZ L;  1OXV A;  1WTX A;  1TII D;  3HOY B;  1Y1V G;  1MI2 A;  2G5D A;  3GO5 A;  5JVH 3;  1SFO B;  4AIM A;  1BBU A;  1GUN A;  3BYT B;  4C3I G;  2CW0 D;  1PVO A;  3FEW X;  1IZ6 A;  2K14 A;  4KLK A;  3PIP A;  4B3M L;  3ICE A;  3DMU A;  1CZW A;  4DR3 L;  2M2L A;  4O2D A;  1XPU A;  4RMF A;  2F0S A;  2YV5 A;  1NR2 A;  2SNM A;  2E2H B;  3BJU A;  5BN5 A;  4MN3 A;  3KYH C;  5C0X G;  4HCS A;  4A3M G;  3K7A B;  5JJL A;  1EWI A;  4HED A;  4KTA A;  1S5B D;  2OQK A;  4OX9 Q;  4DR6 L;  1K3B C;  1FD7 D;  2D5D A;  1CHP D;  2UUA L;  1KC8 C;  1T5E A;  1QUQ B;  1TWG H;  2A19 A;  5IP7 G;  1VQ4 A;  4RH6 A;  4X3T A;  3KFU A;  3H0G G;  1PH9 A;  2BOS A;  3AMU A;  2RHQ B;  1BUV T;  3S2H H;  3TP7 A;  1LT4 D;  4QB4 A;  4YHH L;  1N8R C;  2OTL A;  4IPG A;  4BWG B;  1PRT B;  1EIF A;  2R6G A;  1A2T A;  3OTO L;  3WOF A;  4PZ6 A;  2AWO A;  2K05 A;  5ELN A;  3G6E A;  5C3W A;  3I4L A;  5LMU L;  2CFM A;  4LFC Q;  3CU7 A;  4GNX C;  4PZ7 A;  1IBM L;  2AKW B;  4DR1 Q;  5AJ3 Q;  2JA6 H;  4A3I H;  1HA5 A;  1SYD A;  3PF5 A;  1DOK A;  1I94 L;  1EOV A;  4KKT A;  3OW7 A;  2FIN B;  4HJA A;  3HOZ G;  3QOJ A;  3J81 L;  3LWU A;  2B63 G;  4TVA B;  4YY3 L;  3SDZ A;  1HNX Q;  1EQR A;  2B3G A;  1DZ1 A;  1B3Q A;  1EY9 A;  2BH8 A;  4PMW A;  1IW7 D;  2ICI A;  3JAM c;  4N9T A;  1SE2 A;  5C4X H;  1J6Q A;  5C44 B;  1TR5 A;  2HT1 A;  4GKK L;  4EQN A;  2E76 C;  3D8G A;  4DV7 L;  1O7Z A;  4H13 C;  1XTC D;  4AQY L;  4FF3 A;  1F9S A;  1G29 1;  2NZH A;  4BBS H;  3BZK A;  1JOO A;  1QOH A;  2IX0 A;  2B29 A;  3Q8D A;  2Q8R E;  1YHB A;  3DWP A;  1IXR A;  1WTR A;  4XYQ A;  3I4O A;  1IBK L;  4ME3 A;  3OMC A;  5KNC A;  4A3D G;  1FR3 A;  3RZO B;  1E3P A;  1HFG A;  3W3A A;  1J5E Q;  1Q8I A;  4GN3 B;  2YTV A;  2PQA A;  1K0S A;  1MHW C;  1AFP A;  5FLM G;  1BQQ T;  4CKB A;  5M3F H;  3OSO A;  1S40 A;  3S14 H;  4L6T B;  4A3J B;  4LF8 L;  3A8I E;  3K81 C;  1Y8P B;  5C3E G;  1CT1 D;  2N49 A;  2RA4 A;  3VA5 A;  1RTN A;  3MXN A;  2I5H A;  2RHS B;  3M7N A;  1SMY D;  1OXT A;  2EY6 A;  5GQO A;  5H1S E;  4A3K B;  1JJG A;  2Q2I A;  3CPF A;  3KLR A;  4GOP A;  4R9W A;  3O13 A;  2M9V A;  1R9T H;  4Z9C B;  2XNA C;  4F87 A;  4IFD G;  2KHS A;  2R7F A;  1E2Z A;  3MVV A;  3M7G A;  3DWQ A;  1Y14 B;  2A6E D;  3A55 A;  2Y0S B;  4WJW A;  3NTK A;  4CBV A;  1U4R A;  2HHH Q;  4NDX A;  1V1P B;  3T53 B;  2V1C C;  1A3V A;  1Z7T A;  1N32 Q;  3CRL C;  2UXC Q;  1QVC A;  3IFD A;  4E6I A;  4AH6 A;  3SVM A;  2XN9 C;  3WDN A;  1Q86 C;  3P7J A;  2EQS A;  3N6R A;  1GUW A;  1SAP A;  4TSS A;  3RLN A;  3CME A;  1TY2 A;  1GUG A;  5CV8 A;  1PTO C;  4RKB A;  3T56 B;  2E2J B;  3SK6 A;  1ET9 A;  1WOC A;  3FPU B;  1EY5 A;  5EQ0 A;  4DK6 C;  4RHS A;  2H4O A;  1FJG L;  3GTQ B;  3E9I A;  4KY6 A;  3G71 A;  4DAV A;  3QR8 A;  5FO8 B;  4OL7 A;  4OWX B;  2LKV A;  2KEN A;  4JCV E;  3LNN A;  3OWF A;  3T4A C;  4MTN A;  4QIW E;  4X65 Q;  1BXT A;  3FKI H;  1SBB B;  5JPN C;  3R93 A;  4Y7N B;  5M5W H;  1CKM A;  4K6D A;  1PFN A;  2TMP A;  3AYH B;  3S2D H;  1O7L A;  4UP9 A;  2F0I A;  2F3W A;  2OTJ A;  1D8L A;  1TWF H;  4MHE A;  1BCP B;  5CC4 A;  1I6H H;  1PZI D;  1HA6 A;  2RBM A;  3H09 A;  1RL2 A;  2L11 A;  3RNU A;  2E75 C;  2RDG A;  1CSP A;  2AUJ D;  4NP5 A;  2L1B A;  3IRB A;  4L5S A;  2L0C A;  1Y1W B;  1WI5 A;  2CHB D;  1B1Z A;  2EYO A;  1ZXT A;  1M1K C;  4IOC A;  3CHB D;  3S1M B;  1YNJ C;  4OEM B;  3S1R H;  1N34 L;  4BBR B;  1A2U A;  3AQQ A;  4FF2 A;  1EWC A;  4I7A A;  2KBN A;  1FYC A;  1N36 Q;  4X65 L;  4CKE A;  1KAB A;  1PYW D;  1STH A;  2DNE A;  1CKN A;  1LTA D;  5AFW A;  3GP7 A;  5M5Y H;  3I8Z A;  1KIX A;  1B3A A;  2D0O A;  4QQB X;  1TVX A;  1HUN A;  2DY7 A;  1ENF A;  3VYS A;  2QKI C;  2X6L A;  3AFQ A;  1G8Z D;  4F7X A;  1SLJ A;  1LTS D;  1YHA A;  2F3V A;  2MJ8 A;  5C4J B;  3VYT A;  1XJV A;  3OOC A;  1MJC A;  3U4Z A;  3RUZ A;  3SEB A;  2AQ3 B;  4ZLT F;  5D3I B;  1F2Y A;  1MBY A;  4CKC A;  3S15 H;  3IFT A;  4IN3 A;  3ULL A;  1G91 A;  1SNC A;  2ASB A;  5ISR A;  5FLX E;  5C4Z A;  3A7L A;  1XX8 A;  3ERS X;  3J7Y W;  1Q81 C;  1TWC B;  5M9O A;  1HPC A;  3ND8 A;  4A3L H;  2UXD Q;  4FP5 D;  3C3L A;  1BCP D;  3HKZ G;  5DM7 3;  3F2D A;  4LFB Q;  4JI1 L;  3NBI A;  4XTC S;  5T1G A;  2NZO A;  1X3Q A;  3VR6 A;  1KRS A;  2EDG A;  2JA6 G;  2F0J A;  2MQH A;  4CDE C;  2WFW A;  3H6M A;  2D9U A;  4ME5 A;  5D65 A;  3PCO B;  1KAW A;  1JB7 A;  2RCF A;  2OXP A;  2JA8 H;  4DV1 Q;  5I2X A;  3T1Y L;  2LMC B;  1WJJ A;  1VQ5 A;  1PRT F;  1SND A;  1TS3 A;  3EVQ A;  5IY0 A;  1Q1B A;  1A63 A;  4QF4 A;  4GKJ Q;  3HGB A;  3RN5 A;  1KDA A;  4JBJ A;  1SXT A;  2XWJ B;  2UXD L;  5C4X G;  4ILW A;  1KHI A;  4IOA A;  5J3B A;  3A74 A;  5FJ8 H;  4K6L A;  2N88 A;  4QUC A;  3UDF A;  3LX0 A;  4B3S L;  1NTG A;  3BDO A;  1X3P A;  1YHQ A;  1C8C A;  4BBS G;  2E2I B;  1TY0 A;  2WB1 G;  1GHJ A;  1W6K A;  1MIU A;  2K1B A;  4EQ5 A;  3HKZ E;  3DEO A;  1JOQ A;  3CCS A;  3CC7 A;  2F0P A;  4GN4 B;  4BY7 B;  5JPM C;  4AYB G;  2FMC A;  1QWY A;  2ENB A;  3W2D A;  2F0G A;  2UUC Q;  4B3T Q;  2VUM B;  1GUS A;  5GAD C;  2XSC A;  4NXN Q;  5M3F G;  3EQL C;  1QUQ A;  3RZD B;  4LF5 L;  1F2Z A;  4O1N A;  3CQZ B;  3F2U A;  4YIJ A;  1SYE A;  1FGU A;  3MAQ A;  3HOV B;  3PUV A;  3D0F A;  4ALP A;  2NVQ H;  5LL6 X;  2ALY B;  1ASZ A;  1L2F A;  4B3R L;  4X66 Q;  5C0X J;  3I4M H;  2ID0 A;  4K0K L;  4L63 B;  4X64 L;  4IJH A;  1RIP A;  1VQI A;  1IBL L;  3HOX B;  1M90 C;  4DR4 Q;  2NN6 I;  5CMD A;  3KF8 A;  1H9R A;  3NUC A;  3PUY A;  1ROD A;  3TS0 A;  1NAP A;  4B3T L;  2UUC L;  3J7A 5;  2WB1 E;  4HR7 B;  1JOK A;  2I5L X;  1V1O A;  4P71 A;  1L1O C;  2QDB A;  1DYQ A;  4ZCK A;  2JA5 H;  2NUC A;  4AYB E;  2EY5 A;  1I4G A;  1I4H A;  2UU9 L;  2KUM A;  2PW7 A;  2A68 D;  2K01 A;  2CWA A;  2MPM A;  3QB3 A;  2N8N A;  5BN4 A;  1Y1V B;  2R61 A;  1VQP A;  3PIP 3;  4A76 A;  2R93 H;  2OF1 A;  5E4X A;  1B8A A;  3NTI A;  1Y69 U;  3GV6 A;  5J22 A;  1PH7 A;  1WYD A;  2NTS A;  2XGT A;  1J8I A;  2F4V Q;  4DR4 L;  2P5Z X;  4C3I B;  4LWC A;  4K2L A;  3MZ5 A;  1P16 A;  1LV9 A;  3SR1 A;  1YJW A;  2K6A A;  2DJF C;  4OXP A;  4RKL A;  4DK1 A;  2ZJP A;  1K28 A;  3DUZ A;  3FKI G;  4RHR A;  1JE4 A;  3MEF A;  3JAM L;  3HS0 C;  3M4P A;  1EU3 A;  1A0I A;  4J15 A;  1HZ9 A;  2CWP A;  1SNQ A;  2V4D A;  4Y52 H;  2JA9 A;  1WTV A;  4JI4 L;  1TWH H;  1HTL D;  1VQ8 A;  4LF6 L;  4IJL A;  3UDX A;  2VQF L;  3KF6 B;  4XQJ A;  1TS2 A;  1KDC A;  1LTI D;  1STA A;  4FO2 A;  1IL8 A;  2A69 D;  1PH3 A;  4KJO A;  2ZJQ A;  4X62 Q;  1XPO A;  3TS2 A;  1BBW A;  1NUC A;  3X3N A;  2IJ0 A;  4OWW B;  5GAG C;  3H0G B;  4KN4 C;  4DV4 Q;  4DGZ A;  5D14 A;  1NMF A;  3R2I A;  3K59 A;  2ZTE A;  5A2Q E;  3K5N A;  1E0B A;  2YU9 H;  5M5X B;  1QNU A;  2XIW A;  4RCO A;  2SNS A;  3HZX A;  1JWM D;  4RGT A;  4ZK9 B;  4LF9 Q;  2NN6 H;  2DGY A;  1BCP F;  4UHV A;  3EN2 A;  2KEE A;  2G9D A;  1MSG A;  3K80 C;  2Q2U A;  4CDD C;  3HOZ B;  1RDP D;  2A6H C;  1DON A;  2B63 B;  4NB3 A;  3MC0 B;  5I9O A;  2EXZ A;  2IY5 B;  1XPR A;  1S72 A;  4IFD J;  2F0V A;  2F0T A;  2D2C C;  4GNX B;  3F2B A;  1SN8 A;  3V05 A;  3PO3 H;  2H5X A;  2PMZ E;  5CV9 A;  1HNW L;  5JAV A;  1A3U A;  1IKM A;  2A8V A;  2AQ2 B;  1RF2 D;  4A3L G;  1G2S A;  2UXB Q;  3HOU H;  4JI7 Q;  4ID6 A;  1ESF A;  1F9P A;  3TP8 A;  2R7Z H;  5IWA L;  4DV5 L;  2EJF C;  1RCV D;  3TBI B;  2B2U A;  4LAA A;  4DUZ Q;  2R3Z A;  4MZ9 A;  4M8A A;  4LUO A;  1CQF A;  2C5C A;  2K52 A;  2VQE L;  3NQT A;  5G3L F;  1N33 L;  1YJN A;  1B7Y B;  4A3D B;  1UE5 A;  2A73 B;  1IL2 A;  1HR0 L;  3NE5 B;  2JA8 G;  4UY8 C;  4N8F A;  3GTM H;  4RAU C;  1U9R A;  5KRU A;  4HJ9 A;  1U4P A;  2KCN A;  1STG A;  1I50 B;  5FLX L;  1Q8K A;  4B3M Q;  4IUT A;  2O5I C;  2MFI A;  3J81 i;  1D5Z C;  5C3E B;  3S16 B;  3K7A H;  2JEB I;  1LTG D;  1OO9 B;  4DR3 Q;  1VQM A;  2TSS A;  2N78 A;  2UXB L;  4GOP C;  3GTK H;  3MA2 B;  4JVZ A;  1PV4 A;  3T13 A;  1VQC A;  3QWN A;  5JOB A;  2HCC A;  5FJ8 G;  4HIK A;  4WRD A;  4QIW B;  1SYG A;  3NP8 A;  4XYO A;  1K73 C;  3KDF B;  5D3D A;  1GXD C;  1WTP A;  1LT3 D;  2F0U A;  5ELE A;  1X3E A;  3TRZ A;  2KQ3 A;  4DR6 Q;  1M4V A;  5CV4 A;  4A3G H;  2K5D A;  1K8A C;  2UUA Q;  1JCK B;  1WTQ A;  1JQY D;  2KCC A;  2PI2 A;  5HUR A;  1GKH A;  3R8B A;  3NWT A;  4ZQ3 A;  3NBH B;  5JEA H;  3GTP H;  1JJC B;  3K5M A;  1D5M C;  4YHH Q;  3DHQ A;  1EY4 A;  1SE4 A;  3OTO Q;  3I73 A;  5BR8 L;  2F0W A;  3ERQ A;  3CD6 A;  2KCT A;  3PO2 B;  5LMU Q;  2WAC A;  1D1I A;  4DR7 L;  1B2T A;  1IBM Q;  2VB3 X;  2QDL A;  2E74 C;  1I94 Q;  1KL9 A;  2O2L D;  3I4M G;  1GHK A;  4EQP A;  1I5F A;  2E5L L;  1W2B A;  1WTW A;  4PQX A;  2B2V A;  2JN4 A;  3MFG A;  1GD7 A;  4XQQ A;  3FMC A;  4PV1 C;  4YY3 Q;  3SK8 A;  2IHE A;  1PTO B;  1D1K A;  1KD1 C;  2MHV A;  2PPB C;  4HMI A;  4ZKC B;  1S5C D;  2JA5 G;  4IQZ A;  5EKK A;  1HRJ A;  1FGB D;  2K28 A;  1Y8N B;  2KHI A;  4FF1 A;  3A54 A;  4GKK Q;  2C35 B;  4DV7 Q;  3FPP A;  1NR4 A;  4C3H B;  4AQY Q;  2K04 A;  1KLG D;  2WKD A;  4R4T A;  3A8K E;  2R93 G;  2JJQ A;  1NBW A;  5IP9 H;  1UWV A;  2BH2 A;  4R4C A;  1KQS A;  2E2D C;  3UE0 A;  1VQF A;  4DAY B;  1LAC A;  3BDL A;  3HKS A;  4K8J A;  1IBK Q;  1ML0 D;  1VMP A;  3ULJ A;  1LYL A;  5BN3 A;  2A1A A;  1WD1 A;  4WJ4 A;  4DV0 L;  5LMN L;  2O4X A;  1EQV A;  1WTO A;  4RGM A;  5FKA C;  1X9N A;  4EGV A;  1XMQ L;  4LF8 Q;  3STB D;  1GM5 A;  2WP8 J;  2O5J C;  3J7A F;  4P73 A;  1E1T A;  5IT9 c;  5GAH C;  3S17 H;  2UXC L;  1X3F A;  2LXK A;  3RR5 A;  4DN4 M;  1UEA B;  2Z6K A;  1Q90 A;  4X3U A;  5M3M H;  3M4Q A;  1QG7 A;  3J80 i;  2PZW A;  1YNN D;  4NXM L;  1VQH A;  3ZYY X;  1TWG B;  1PXU A;  1PTO D;  2VB2 X;  3AEV A;  4LF4 L;  4PMC A;  3KBX A;  2VZA A;  1R4Q B;  1PRT D;  1RJT A;  3S2H B;  3P1H A;  1YEZ A;  2EY2 A;  1HR0 W;  2ZXP A;  1HJP A;  4K8I A;  3TZD A;  2B2W A;  2I07 B;  3IL8 A;  2E2J H;  1UEB A;  3HKZ B;  4YCV A;  3HG9 A;  2KJX A;  3DWA A;  5ELF A;  4APV A;  4DAM A;  2GVA A;  3GTO B;  2NN6 G;  4X6A H;  3TEH B;  3S1N H;  1SRO A;  1D5X C;  1K0R A;  5EKI A;  2F0D A;  2JA6 B;  4A3I B;  1JWS D;  1AZQ A;  3KJP A;  4GLX A;  2GVB A;  4XIG S;  3S9W A;  3CXC A;  1FJG Q;  3I72 A;  2GN5 A;  4PZ8 A;  1WCM H;  2IHF A;  2R92 H;  2VW9 A;  5ELD A;  5IGE A;  3PUX A;  3KK7 A;  1A15 A;  1XNQ L;  1MKH A;  2FXQ A;  1ENA A;  3MWY W;  4A3E H;  4LNQ A;  3K5O A;  1C4Q A;  1DOL A;  3PO3 G;  4EVO A;  1K83 H;  3JAM E;  5A2Q L;  1LO5 D;  3K57 A;  5C4X B;  3BVG A;  1YNJ D;  1V9P A;  1GJX A;  4UDU C;  5DNF A;  2LY7 A;  2X69 A;  2JA7 B;  2F0F A;  4LFA L;  3BYY B;  1XXG A;  1OXX K;  3BDC A;  4RA8 A;  1UUP A;  1WTH A;  4C3J H;  4C2M B;  2CCZ A;  3HOU G;  1ZKO A;  2R7Z G;  4BBS B;  3K0X A;  1JIC A;  3KLW A;  1MJE A;  2QCP X;  2WB1 B;  1G6Z A;  1QE6 A;  5EBC A;  3VR4 A;  2IX3 A;  5DAU A;  4ZKB B;  3S1Q H;  1E2V A;  4AYB B;  4B9W A;  5GAE C;  2JYO A;  1EU4 A;  3BS1 A;  1JB3 A;  3L3O C;  1SNO A;  5IE8 A;  1N34 Q;  4DV2 L;  2K5W A;  2K5N A;  3T16 A;  2ZTC A;  1EY0 A;  1VQB A;  2C9O A;  3P20 A;  3TQY A;  5M3F B;  2NVY B;  1IYU A;  2RCN A;  4JW0 A;  1B9M A;  4R4Q A;  5C4J H;  2AMC B;  4KY5 A;  4PNY A;  4JK1 C;  4A3F B;  3GTG H;  2BA1 A;  2ZM6 L;  4S3S A;  3M4O H;  2IWH A;  1L0Y B;  4HAE A;  4XQN A;  2NWG A;  1R9T B;  2G9H D;  3ER0 A;  4BA1 I;  1HQM C;  4R4I A;  5DLQ E;  1IKL A;  4A3G G;  2EPB A;  4WFN 3;  1SNM A;  3W1B A;  3HOW H;  1CI3 M;  4FF4 A;  3BZD B;  3K8A A;  4DNT B;  1Q7Y C;  1G2T A;  1V43 A;  1EQT A;  1SR3 A;  4A3C H;  4CHT B;  3M3Y H;  4IPC A;  4ULL A;  5JEA G;  3OHX C;  4FYD A;  1C48 A;  4JYA L;  3W1G A;  4DUY L;  4N8X 1;  3T1H L;  1CQV A;  2Z0S A;  3I55 A;  3G4S A;  5LMN W;  1QZG A;  3NPP A;  5E1F A;  3F1Z A;  4JI1 Q;  1GOZ A;  4JV5 L;  5KIX A;  1ZEQ X;  1DM0 B;  3MXU A;  4DR2 L;  3PQI A;  1PFS A;  3BZC A;  3E0E A;  5EKL A;  1L1O B;  1WD0 A;  2RSN A;  4IPH A;  1HNZ L;  4N9P A;  1ILQ A;  4MIU A;  2PQE A;  1B53 A;  4I7Z C;  3T1Y Q;  1PA6 A;  2NVT H;  3FKI B;  1QVG A;  2NB0 A;  3HRZ C;  5M5W B;  1SEB D;  1RHP A;  2EE1 A;  1NSN S;  1VQG A;  4JI0 L;  1VF7 A;  2RSO A;  3S2D B;  1S3O A;  4R8N A;  1VS0 A;  1X55 A;  1RTO A;  1HUM A;  4A93 H;  1H9S B;  3CRK C;  3E9H A;  4QUF A;  1TWF B;  3UDG A;  4P75 A;  1DJR D;  1I6H B;  1ICW A;  4B3S Q;  1VQN A;  5HGQ A;  3F2C A;  1AP0 A;  4DXG A;  1X65 A;  2PMZ B;  1Z6H A;  1D6E C;  2N3S A;  4HIO A;  5IP9 G;  2QGQ A;  3AB9 A;  3S1R B;  3A0J A;  1PTO F;  1HH2 P;  3RLO A;  4M1U B;  3JC6 6;  5CGK A;  2K75 A;  3G48 A;  2UUB L;  5M5Y B;  4HID A;  2HIX A;  2K32 A;  3FDT A;  2DJG C;  4EQO A;  4LF5 Q;  4P2C B;  1NY4 A;  4TRD A;  3SK4 A;  3J81 c;  4LUV A;  1G6P A;  3K0Y A;  5ELO A;  4OIJ A;  1YI2 A;  1I4X A;  1PYB A;  1C7Y A;  3PMF A;  3QG1 A;  4B3R Q;  1PHJ A;  4K0K Q;  4IUN A;  5G3L D;  5M3M G;  3GQB A;  2EVB A;  4X64 Q;  3PUZ A;  3CCJ A;  3FVQ A;  3S15 B;  5HGT A;  4R8I A;  1IBL Q;  3TDQ A;  2KVM A;  3R2T A;  2NTT A;  4TKO B;  2KOL A;  4H7B A;  4PG3 A;  2EXD A;  4KI0 A;  1XMO L;  1SSO A;  1EQQ A;  1KAA A;  2HQE A;  4POF A;  2B2U C;  2CQA A;  3A7A B;  2UU9 Q;  3V2T A;  4P74 A;  3ZJY C;  4JI5 L;  3I4N H;  1G51 A;  3C46 A;  1EYG A;  2L5T A;  5C5M A;  1SYF A;  2HCI A;  2K5H A;  1QCB D;  4YCW A;  2JA8 B;  2EZV A;  3TME A;  2K03 A;  1RD9 D;  4A3B H;  3E6Z X;  1WCM G;  5HY6 A;  4KHP Q;  4G4K A;  2R92 G;  2HD3 A;  1E1O A;  2BDN A;  4K5W A;  1KNE A;  4GS3 A;  2Z6B A;  4HJ7 A;  3IKJ A;  1YIJ A;  4A3E G;  1BDO A;  2D0P A;  2WAQ G;  2D62 A;  4U67 3;  2JXM B;  3MHB A;  1QNK A;  4K5X A;  1F9R A;  2KEC A;  1B9N A;  4OON A;  2ICE C;  3QIA A;  1S5D D;  1EEI D;  2B2Y A;  4C3J G;  4JI4 Q;  4G7Z C;  2EYJ A;  4K5V A;  3MXN B;  4LF6 Q;  2VQF Q;  2K4K A;  1CSQ A;  1F2M A;  1O80 A;  4IFD I;  2F0K A;  1TS4 A;  3U9S A;  5M5X H;  4GOP B;  3CCM A;  4KHP L;  1VMC A;  2ES2 A;  2L4N A;  2A6H D;  4KD3 A;  2HIV A;  1BKB A;  5IGC A;  4KHZ A;  2LFN A;  4CJ1 B;  3SK5 A;  1P8L A;  5KEE A;  2QEJ C;  2A5H A;  2ATW A;  2XRQ D;  3PSI A;  2NVX H;  1E24 A;  3H3V I;  2L15 A;  1TWA H;  4RG1 A;  4A3M B;  5IT9 L;  4BY1 H;  5E7N A;  3L7Z C;  1BO0 A;  2BE5 C;  4JC0 A;  2NVQ B;  1EYC A;  1S5E D;  2WAQ E;  3M4Y A;  2NYZ D;  2B2V C;  4LF7 L;  1K8M A;  3I90 A;  3TP6 A;  1XNR L;  1H9M A;  1TT2 A;  1CFM A;  1L0X B;  4LMQ D;  1I3Q H;  1VDZ A;  4UP7 A;  1DD2 A;  2JE6 I;  2RVL A;  3J80 c;  3HOW G;  5IYB H;  2J0T D;  1PZK D;  4G7H C;  2J7Z A;  3BU2 A;  1EY6 A;  5CYU A;  2Z8L A;  3P75 A;  2VNU D;  4A3C G;  2JA5 B;  1E2W A;  1HNW Q;  3UDI A;  3FHW A;  3EJI A;  3QOL A;  1X54 A;  3TSS A;  1V1P A;  2VY3 A;  2B2T A;  3GTJ H;  1JOR A;  1A62 A;  1CUK A;  5CBA E;  1HFN A;  2R93 B;  2CQO A;  1EL0 A;  5IWA Q;  4DV5 Q;  1H95 A;  4OEL B;  1AZP A;  1I4P A;  1SJE D;  1AW7 A;  2PI2 E;  3KOJ A;  3RMH A;  3M85 A;  3C2P A;  3BG3 A;  1PH1 A;  4RGO S;  2VQE Q;  4QY7 A;  1N33 Q;  1ASY A;  3HFZ B;  2AWN A;  2F0N A;  3L0O A;  1HR0 Q;  1SYC A;  2QA4 A;  1Y8O B;  4GLV B;  4RCN A;  3KBG A;  4KHV A;  2EIF A;  3L9A X;  2VS1 A;  2RDH A;  3N52 A;  3GTL H;  2QW7 A;  5EPJ A;  4GLA C;  3HOY H;  1KNA A;  4L8J A;  2Z6K C;  1TWH B;  1VQJ A;  1I6V C;  4DKA C;  1PH4 A;  4A93 G;  1C0A A;  2J4X A;  2K50 A;  1SFO H;  5IOC A;  1QB5 D;  3SGI A;  1VQL A;  4XT3 B;  2ZJR A;  5IOD A;  1F2L A;  1HHV A;  2IT1 A;  2L12 A;  1Q46 A;  2RDF A;  5CR3 A;  1PH6 A;  1CHQ D;  1GUO A;  3S24 A;  4HN7 A;  2MGS A;  4GZY C;  3H3V H;  1SNP A;  4LUZ A;  2PZT A;  4FXG C;  2OWO A;  2X6G A;  3WOE A;  2B2W C;  4DV3 L;  5KND A;  4O0A A;  3UI2 A;  5KNB A;  2E2H H;  4OO1 I;  2YU9 B;  4ZRZ A;  1CA6 A;  3NEN A;  3PO2 H;  5IGD A;  1QZH A;  4JI3 L;  1J9O A;  4JI8 L;  1SMX A;  2N55 A;  5BR8 Q;  1V1Q A;  3CC2 A;  5KYI A;  2Q2H A;  5TSS A;  1PFB A;  4DR7 Q;  2K5Q A;  4FNF A;  3OPO A;  1ESR A;  1QVF A;  1AEX A;  1PZJ D;  4IPD A;  3D4R A;  2E5L Q;  3I91 A;  1I4R A;  1UE1 A;  4X3K A;  2GA4 B;  4V0B A;  5DEH A;  1LT6 D;  1Q1E A;  1D2B A;  4LJZ C;  1SYB A;  3PO3 B;  5I9P A;  4HSV A;  4UPA A;  3TN2 A;  5A35 A;  4DK0 A;  4C3H H;  4BS9 A;  5I6W A;  3K6O A;  3PIO A;  2OEO A;  3GD7 A;  4BXX H;  2EYM A;  3HOU B;  2LXJ A;  1Q82 C;  4F88 A;  2PYK A;  5F2D A;  5CBE E;  4IO9 A;  2R7Z B;  2KED A;  3NXW A;  3RLF A;  3ULP A;  4ZUJ A;  5JEA J;  3KJO A;  1ZYR C;  2IL8 A;  3VR2 A;  3KLS A;  3I4N G;  1D7Q A;  1MGS A;  2NBF A;  2KA7 A;  2OCE A;  1EY7 A;  4JBM A;  1UE6 A;  1EIH A;  1BOS A;  1H9S A;  2IW3 A;  1N9W A;  5COR A;  4NKL A;  1YIT A;  3GTM B;  3OYY A;  5E3F A;  4A3B G;  4HSP A;  3MTS A;  2IX1 A;  5C44 H;  3I3C A;  2I0Q A;  3PUW A;  1LAB A;  3H91 A;  1GVP A;  4DK3 C;  4J1M A;  3Q22 A;  4BA2 I;  1ILP A;  4DV0 Q;  5LMN Q;  4G7O C;  1PH8 A;  2YTX A;  1LT5 D;  2Z9H A;  3Q6S A;  1XMQ Q;  3D3R A;  3GTK B;  1X56 A;  2OQ0 A;  5IYC H;  3NK9 A;  4JOI A;  2XVS A;  4KD4 A;  1Q12 A;  4KY7 A;  2E8G A;  2BA0 A;  4XDX A;  1VQ6 A;  4JI6 Q;  3KUP A;  4OO1 H;  5EAY A;  2F0H A;  3RZO H;  4TQU S;  4CDC C;  3DM3 A;  4IUP A;  1E7Z A;  2JQO A;  2Z1C A;  4MTK A;  3D4W A;  3MXP A;  3NEM A;  4A3G B;  5K36 H;  4IZ8 A;  4NXM Q;  4RGN A;  1HZA A;  3OWE B;  1VQO A;  4C1N I;  4A3J H;  4JG2 A;  2JEA I;  4LF4 Q;  1EYA A;  3GTO H;  3EA6 A;  1C9O A;  2PW5 A;  3KF8 B;  3GTP B;  4A3K H;  5JJI A;  2RQX A;  2PO4 A;  3GV3 A;  1OXU A;  2CW0 C;  2EYL A;  5EPL A;  4OX9 L;  4P72 A;  1CM9 A;  5IYD H;  3BVM A;  3VDY A;  2FMM A;  5L37 A;  1DXM A;  4JI6 L;  4BY1 G;  3LWE A;  2KCM A;  1T5X D;  1VQ7 A;  4O42 A;  3E5S A;  3RN2 A;  1QJO A;  2F0O A;  4HMJ A;  1VQA A;  1SJH D;  3DXJ C;  1LTL A;  1S4Z A;  2JA7 H;  3URY A;  1LTR D;  4UAI A;  3ERO A;  5IYB G;  1EWH A;  4LFC L;  1XNQ Q;  4KKU A;  3X3M A;  4C2M H;  5GRO A;  2LS0 1;  4DR1 L;  1VF5 C;  3C1E A;  5AJ3 L;  4QMG A;  1F9Q A;  1HXY D;  1JC7 A;  1STN A;  4LFA Q;  2Q8I B;  3A8J E;  3GTQ H;  1KDB A;  3Q23 A;  4NW2 A;  2RKS A;  1PDQ A;  3OIP A;  4WJ3 M;  1STY A;  2F0E A;  3G7L A;  4X3S A;  5C4H A;  1HNX L;  2YTY A;  3J81 j;  5E4W C;  5I6Y A;  1A6X A;  2MP1 A;  3CC4 A;  4Y7N H;  3CF5 A;  3EIV A;  1JR0 D;  5NUC A;  1S5F D;  2NVY H;  2A74 C;  3I70 A;  4IUV A;  4LK1 C;  2EY1 A;  1EFI D;  4DV2 Q;  4A3F H;  2DUD A;  1A3T A;  1H9K A;  2Z4I A;  3E3X A;  1KTK A;  4RWS C;  4DXF A;  4OIK A;  4U68 A;  3H3V C;  1I4Q A;  2WV6 D;  3EFX D;  3BVZ A;  4C56 C;  3HOY G;  1U4L A;  3S17 B;  2ZM6 Q;  2B8G A;  1Z9F A;  5IT9 E;  1HTP A;  1IW7 C;  1Y1W H;  5IGB A;  1BNZ A;  5EBD A;  3HP3 A;  4L5Q A;  3STB C;  3S1M H;  1J5E L;  4FXD A;  5M3M B;  4BBR H;  1CKO A;  4H0L C;  4R4O A;  1FVI A;  1U0L A;  5COY A;  5I4D A;  1KLU D;  5DM6 3;  2WII B;  1SE3 A;  4NPS A;  2I5M X;  4J6H A;  4J8Q A;  1NE3 A;  1H9J A;  1RKN A;  3KF6 A;  1KRT A;  3UE1 A;  1NCV A;  3CW2 C;  1YNN C;  3DLL A;  3CCQ A;  1O78 A;  3S14 B;  4MNO A;  3NEL A;  2FHT A;  3PO2 G;  4POG A;  3SE0 A;  5KGU A;  1OTC A;  4OHJ A;  4FVM A;  3FRP B;  4EX5 A;  4JYA Q;  5T1I A;  1PRT C;  3T1H Q;  3NHH A;  4DUY Q;  5C5L A;  4KMU C;  3S1N B;  4CJ0 B;  4A4I A;  1YNX A;  4JV5 Q;  1YZ6 A;  2HHH L;  4DR2 Q;  4XXE A;  1HZB A;  4HJ8 A;  1IHZ A;  3CMA A;  1N32 L;  4CJ2 C;  1SMY C;  1LTB D;  1LM0 A;  1K8G A;  1O7I A;  2JP1 A;  4LW1 A;  5C6A A;  1HQR D;  3Q0A A;  5FLX c;  1XWE A;  3SXH A;  1LLR D;  2K7V A;  5IGF A;  1WCM B;  3G6J B;  4YCU A;  1HNZ Q;  2R92 B;  1EIY B;  4OWT B;  2CH4 A;  1TWC H;  1ONL A;  4QJF A;  3J80 L;  1AN8 A;  1XTD A;  2MUY A;  4A3E B;  5JVG 3;  5EPK A;  2WAQ B;  1DCZ A;  2MNA A;  1K83 B;  1VQD A;  1EIG A;  3FP9 A;  4IAL A;  2A6E C;  3E0J A;  2B2Y C;  1X6O A;  4L5T A;  4C3H G;  4JI0 Q;  2CKZ B;  1B44 D;  2K33 A;  4BXX G;  1FL0 A;  4C3J B;  4K14 A;  2PCF B;  4GNX A;  3QO2 A;  4A75 A;  1AE3 A;  4CGY B;  3MEH A;  1NNX A;  5FOB B;  1LTT D;  1B4O A;  4DR5 Q;  3S1Q B;  1YJ9 A;  2F0L A;  5J1Z A;  5LL6 S;  1EZ6 A;  1PFM A;  3TRE A;  3F8T A;  4RFB A;  5C44 G;  3K5L A;  3DEP A;  1A8V A;  1VQE A;  3MFY A;  2UUB Q;  1GO3 E;  1EY8 A;  3GTG B;  5CV7 A;  2E2I H;  3M9B A;  3M4O B;  3SHL A;  2JK8 A;  2OT2 A;  5IYC G;  5C0X I;  1VQ9 A;  1PH5 A;  2AHO B;  1X3G A;  4BY7 H;  1V8Q A;  1DOM A;  5IIF A;  2HUG A;  4JBW A;  1PMR A;  1N36 L;  1EOT A;  4DR5 L;  4OO1 G;  5ELB A;  4ABN A;  1EZ8 A;  2VUM H;  2ZTD A;  4YWM A;  1TS5 A;  3OMG A;  5K36 G;  5J39 A;  3HOW B;  5FK9 C;  4A3J G;  3RZD H;  2EJM A;  4B9X A;  3CQZ H;  2FJ2 A;  2YYZ A;  3KDF A;  1YBY A;  3M3Y B;  2F1M A;  3TP5 A;  2B2T C;  1XMO Q;  1BF4 A;  3HOV H;  3LGJ A;  2NZ1 D;  4A3K G;  4A3I G;  5CV5 A;  4JPB W;  3TZU A;  5K5P A;  3K58 A;  1W3S A;  2CVR A;  2EYP A;  3NQI A;  2K5V A;  5IYD G;  3J7A V;  1AE2 A;  3U50 C;  1B70 B;  5JJK A;  3HOX H;  3U9O A;  3JAM i;  4JI5 Q;  3NBH A;  5FO9 B;  3J7Z C;  2F0M A;  2Y0S G;  1E22 A;  1BR9 A;  3EBE A;  2Q8T A;  3L2P A;  3VYR A;  2MO1 A;  3T51 B;  1HZC A;  3NWS A;  2DY8 A;  4DNI A;  3V96 A;  3I7F A;  1SDF A;  2NVT B;  1WVL A;  4LFB L;  2AQ1 B;  2JA7 G;  4I65 A;  2PNH A;  4WOR A;  4R1J A;  1X32 A;  4DA2 A;  2EOT A;  1JJ2 A;  3OW2 A;  1Y1V H;  1JT8 A;  4XT1 B;  1K8O A;  4A93 B;  1W6J A;  1PLF A;  1FNV A;  3CAM A;  5EJW A;  3IAY A;  4GN5 A;  1MSH A;  4DV1 L;  3D4D A;  1MD2 D;  4C3I H;  3B6Y A;  2EYF A;  4GKJ L;  1BCP C;  2VL6 A;  2F4I A;  3C1F A;  2BE5 D;  3D6W A;  4KKS A;  1QIL A;  1EFW A;  3NTH A;  1Z47 A;  4IUR A;  2Y0S E;  5C0X H;  4A3F G;  1STB A;  2VXW A;  4A3M H;  5KYL A;  4DAY A;  2PZU A;  2SDF A;  4NMZ A;  2PQA B;  4ODG A;  4F8M A;  1TU2 B;  1PYS B;  3J81 E;  2HQL A;  2DN8 A;  3RD4 A;  2EJG C;  5IP7 H;  2M00 A;  2QF7 A;  1WFQ A;  1Y1W G;  1BVS A;  2MO0 A;  3VR5 A;  3H0G H;  3KLS X;  3PGZ A;  1OXS C;  4LF7 Q;  1NJI C;  4BBR G;  3PIO 3;  1XNR Q;  3W5O A;  4NXN L;  4DPG A;  3PV0 A;  3A5U A;  3H15 A;  2KHJ A;  1GUT A; 
#chains in the Genus database with same CATH homology
 3DM1 A;  2QIL A;  3D31 A;  3Q24 A;  1ENC A;  4IUQ A;  4QCL A;  3NSW A;  5JJZ A;  4B08 A;  1FNW A;  2SEB D;  5EGT A;  1TKW B;  4OGQ C;  2WIN B;  3VA7 A;  2FFK B;  4G57 A;  3I4N B;  4C1N K;  3I4M B;  3OIQ A;  2ZXR A;  4A3B B;  4ZAI A;  4DFA A;  3D6C A;  1ET6 A;  1Q3L A;  3VR3 A;  5ELC A;  1EEF D;  1UNS A;  2BCO A;  1M8A A;  4HTH A;  1B50 A;  2SOB A;  4FXK C;  2Z4H A;  4H44 C;  3HEJ A;  4K2K A;  2B39 A;  3VYU A;  4PMB A;  4V19 0;  2WKC A;  2A68 C;  1F77 A;  1VCI A;  4DF7 A;  1II3 A;  2I46 A;  4KV6 A;  4DAP A;  5FO7 B;  3H94 A;  4KN7 C;  1TQO A;  1U4M A;  3ONA B;  2XRS D;  4IFD H;  2NVX B;  2AUK A;  2L55 A;  2PNR C;  5I2Y A;  4Q0F A;  1TWA B;  5LHY 1;  4KK7 A;  1BBX C;  4BY1 B;  1XYI A;  3QJY A;  4KJN A;  1STE A;  1IYV A;  5CV6 A;  1CTM A;  3R3O A;  5IGG A;  1R4P B;  2H1E A;  1O7Y A;  1I3Q B;  3CKI B;  2HDL A;  1CK1 A;  4ZYS A;  1ZYR D;  4DNR B;  2B8F A;  1CZG A;  2ZT9 C;  3J80 E;  1UAP A;  1EYD A;  2A69 C;  2DNC A;  3ND9 A;  5C3X A;  2L9H A;  2F0Q A;  3GTJ B;  2ZXO A;  1CA5 A;  4IUU A;  3MXG A;  3AU7 A;  2XWB B;  1PTO H;  1FNU A;  1JWU D;  4Q5V A;  2F03 A;  4ZUI A;  2HDM A;  1HCZ A;  2IPK D;  3ITP A;  2BDO A;  2JSO A;  4DU9 A;  3A56 A;  2EYH A;  4HCE A;  3GTL B;  1OXV A;  1WTX A;  1TII D;  3HOY B;  1MI2 A;  3GO5 A;  5JVH 3;  1SFO B;  1GUN A;  3BYT B;  4C3I G;  2CW0 D;  3FEW X;  3DMU A;  1CZW A;  2M2L A;  2F0S A;  1NR2 A;  2SNM A;  2E2H B;  5BN5 A;  4MN3 A;  5C0X G;  4HCS A;  3K7A B;  4KTA A;  4HED A;  1S5B D;  2D5D A;  1FD7 D;  1CHP D;  1T5E A;  4RH6 A;  4X3T A;  2BOS A;  3AMU A;  1BUV T;  3TP7 A;  1LT4 D;  4QB4 A;  4BWG B;  1PRT B;  2R6G A;  1A2T A;  3WOF A;  2AWO A;  2K05 A;  5C3W A;  3I4L A;  3CU7 A;  1HA5 A;  1SYD A;  1DOK A;  4KKT A;  3OW7 A;  2FIN B;  3QOJ A;  3J81 L;  3LWU A;  3SDZ A;  1DZ1 A;  1EY9 A;  4PMW A;  1IW7 D;  2ICI A;  4N9T A;  1SE2 A;  5C44 B;  1TR5 A;  4EQN A;  2E76 C;  3D8G A;  1O7Z A;  4H13 C;  1XTC D;  4FF3 A;  1F9S A;  1G29 1;  1JOO A;  1QOH A;  2IX0 A;  2Q8R E;  3DWP A;  1WTR A;  4XYQ A;  3OMC A;  5KNC A;  1FR3 A;  3RZO B;  1HFG A;  3W3A A;  1Q8I A;  1AFP A;  1BQQ T;  4CKB A;  3OSO A;  4L6T B;  4A3J B;  3A8I E;  1Y8P B;  1CT1 D;  2RA4 A;  3VA5 A;  1RTN A;  3MXN A;  3M7N A;  1SMY D;  1OXT A;  2EY6 A;  4A3K B;  3KLR A;  4R9W A;  3O13 A;  2M9V A;  4Z9C B;  2XNA C;  4F87 A;  4IFD G;  2KHS A;  1E2Z A;  3MVV A;  3M7G A;  3DWQ A;  2A6E D;  3A55 A;  2Y0S B;  4WJW A;  3NTK A;  4CBV A;  1U4R A;  4NDX A;  1V1P B;  3T53 B;  1A3V A;  1Z7T A;  3CRL C;  3IFD A;  4E6I A;  3SVM A;  2XN9 C;  3WDN A;  3P7J A;  3N6R A;  1GUW A;  1SAP A;  4TSS A;  1TY2 A;  1GUG A;  5CV8 A;  1PTO C;  4RKB A;  3T56 B;  2E2J B;  3SK6 A;  1ET9 A;  3FPU B;  5EQ0 A;  1EY5 A;  4RHS A;  2H4O A;  3GTQ B;  4KY6 A;  4DAV A;  5FO8 B;  4OL7 A;  2LKV A;  3LNN A;  3OWF A;  3T4A C;  1BXT A;  1SBB B;  5JPN C;  3R93 A;  4Y7N B;  4K6D A;  1PFN A;  2TMP A;  1O7L A;  2F0I A;  2F3W A;  4MHE A;  1BCP B;  5CC4 A;  1PZI D;  1HA6 A;  2RBM A;  3H09 A;  2L11 A;  2E75 C;  2RDG A;  4NP5 A;  2AUJ D;  2L1B A;  2L0C A;  1Y1W B;  2CHB D;  1B1Z A;  2EYO A;  1ZXT A;  3S1M B;  3CHB D;  1YNJ C;  4BBR B;  1A2U A;  4FF2 A;  1EWC A;  1FYC A;  4CKE A;  1KAB A;  1PYW D;  1STH A;  2DNE A;  1LTA D;  5AFW A;  3GP7 A;  3I8Z A;  1B3A A;  1HUN A;  1TVX A;  2DY7 A;  1ENF A;  3VYS A;  2QKI C;  2X6L A;  1G8Z D;  4F7X A;  1LTS D;  2F3V A;  2MJ8 A;  5C4J B;  3VYT A;  3OOC A;  3RUZ A;  3SEB A;  2AQ3 B;  4ZLT F;  5D3I B;  1F2Y A;  1MBY A;  4CKC A;  3IFT A;  4IN3 A;  1G91 A;  1SNC A;  5ISR A;  5FLX E;  5C4Z A;  3A7L A;  1XX8 A;  3J7Y W;  1TWC B;  5M9O A;  1HPC A;  3ND8 A;  4FP5 D;  3C3L A;  1BCP D;  5DM7 3;  3NBI A;  4XTC S;  5T1G A;  1X3Q A;  3VR6 A;  2EDG A;  2F0J A;  3H6M A;  2D9U A;  4ME5 A;  5D65 A;  2OXP A;  5I2X A;  2LMC B;  1PRT F;  1SND A;  1TS3 A;  3EVQ A;  1Q1B A;  4QF4 A;  3HGB A;  1KDA A;  1SXT A;  2XWJ B;  4ILW A;  4K6L A;  2N88 A;  4QUC A;  3LX0 A;  3BDO A;  1X3P A;  1C8C A;  2E2I B;  1TY0 A;  1GHJ A;  1W6K A;  2K1B A;  3DEO A;  1JOQ A;  2F0P A;  4BY7 B;  5JPM C;  2FMC A;  1QWY A;  2ENB A;  3W2D A;  2F0G A;  2VUM B;  1GUS A;  2XSC A;  3EQL C;  3RZD B;  1F2Z A;  4O1N A;  3CQZ B;  3F2U A;  4YIJ A;  1SYE A;  3MAQ A;  3HOV B;  3PUV A;  5LL6 X;  5C0X J;  2ID0 A;  4L63 B;  3HOX B;  2NN6 I;  5CMD A;  3KF8 A;  1H9R A;  3NUC A;  3PUY A;  1ROD A;  1NAP A;  4HR7 B;  1JOK A;  1V1O A;  2QDB A;  1DYQ A;  2NUC A;  2EY5 A;  1I4G A;  1I4H A;  2KUM A;  2PW7 A;  2A68 D;  2K01 A;  2MPM A;  3QB3 A;  5BN4 A;  1Y1V B;  2R61 A;  3PIP 3;  2OF1 A;  5E4X A;  3NTI A;  1Y69 U;  3GV6 A;  5J22 A;  2NTS A;  1J8I A;  4C3I B;  4K2L A;  3MZ5 A;  1LV9 A;  3SR1 A;  2K6A A;  4RKL A;  4DK1 A;  3DUZ A;  4RHR A;  1JE4 A;  3JAM L;  3HS0 C;  1EU3 A;  1SNQ A;  2V4D A;  1WTV A;  1HTL D;  4XQJ A;  1TS2 A;  1KDC A;  1LTI D;  1STA A;  4FO2 A;  1IL8 A;  2A69 D;  4KJO A;  1NUC A;  3X3N A;  2IJ0 A;  3H0G B;  4KN4 C;  4DGZ A;  5D14 A;  3R2I A;  3K59 A;  5A2Q E;  3K5N A;  1E0B A;  5M5X B;  1QNU A;  2XIW A;  4RCO A;  2SNS A;  3HZX A;  1JWM D;  4RGT A;  4ZK9 B;  2NN6 H;  1BCP F;  2KEE A;  2G9D A;  1MSG A;  3HOZ B;  1RDP D;  2A6H C;  1DON A;  2B63 B;  3MC0 B;  5I9O A;  2EXZ A;  4IFD J;  2F0V A;  2F0T A;  2D2C C;  3V05 A;  5CV9 A;  5JAV A;  1A3U A;  1IKM A;  2AQ2 B;  1RF2 D;  1G2S A;  4ID6 A;  1ESF A;  1F9P A;  3TP8 A;  2EJF C;  1RCV D;  3TBI B;  2B2U A;  4LAA A;  2R3Z A;  4M8A A;  1CQF A;  2C5C A;  3NQT A;  5G3L F;  4A3D B;  2A73 B;  3NE5 B;  4RAU C;  1U9R A;  5KRU A;  1U4P A;  2KCN A;  1STG A;  1I50 B;  5FLX L;  4IUT A;  2O5I C;  1D5Z C;  5C3E B;  3S16 B;  2JEB I;  1LTG D;  1OO9 B;  2TSS A;  3MA2 B;  3T13 A;  3QWN A;  5JOB A;  2HCC A;  4WRD A;  4QIW B;  1SYG A;  3NP8 A;  4XYO A;  5D3D A;  1WTP A;  1GXD C;  1LT3 D;  2F0U A;  5ELE A;  2KQ3 A;  1M4V A;  5CV4 A;  2K5D A;  1JCK B;  1WTQ A;  1JQY D;  2KCC A;  5HUR A;  3R8B A;  3NWT A;  4ZQ3 A;  5JEA H;  3K5M A;  1D5M C;  3DHQ A;  1EY4 A;  1SE4 A;  3I73 A;  2F0W A;  3ERQ A;  3PO2 B;  2WAC A;  1D1I A;  1B2T A;  2VB3 X;  2E74 C;  1GHK A;  2O2L D;  4EQP A;  1WTW A;  4PQX A;  2B2V A;  3MFG A;  4XQQ A;  3FMC A;  4PV1 C;  3SK8 A;  1PTO B;  1D1K A;  2MHV A;  2PPB C;  4HMI A;  4ZKC B;  1S5C D;  4IQZ A;  5EKK A;  1HRJ A;  1FGB D;  2K28 A;  1Y8N B;  4FF1 A;  3A54 A;  3FPP A;  1NR4 A;  4C3H B;  2K04 A;  1KLG D;  2WKD A;  3A8K E;  2E2D C;  1LAC A;  3BDL A;  4K8J A;  1ML0 D;  1VMP A;  5BN3 A;  1WD1 A;  2O4X A;  1EQV A;  1WTO A;  4RGM A;  5FKA C;  4EGV A;  2WP8 J;  2O5J C;  3J7A F;  4DN4 M;  1UEA B;  1Q90 A;  4X3U A;  1QG7 A;  2PZW A;  1YNN D;  3ZYY X;  1TWG B;  1PXU A;  1PTO D;  2VB2 X;  4PMC A;  3KBX A;  1R4Q B;  1PRT D;  1RJT A;  3S2H B;  3P1H A;  2EY2 A;  2ZXP A;  4K8I A;  3TZD A;  2B2W A;  2I07 B;  3IL8 A;  3HKZ B;  3HG9 A;  2KJX A;  3DWA A;  5ELF A;  3GTO B;  2NN6 G;  1D5X C;  5EKI A;  2F0D A;  2JA6 B;  4A3I B;  1JWS D;  1AZQ A;  4XIG S;  3S9W A;  3I72 A;  5ELD A;  5IGE A;  3PUX A;  3KK7 A;  1A15 A;  1ENA A;  3MWY W;  3K5O A;  1C4Q A;  1DOL A;  4EVO A;  3JAM E;  5A2Q L;  1LO5 D;  3K57 A;  5C4X B;  3BVG A;  1YNJ D;  1GJX A;  4UDU C;  5DNF A;  2LY7 A;  2X69 A;  2JA7 B;  2F0F A;  3BYY B;  1XXG A;  1OXX K;  3BDC A;  4RA8 A;  1UUP A;  4C2M B;  1ZKO A;  4BBS B;  1JIC A;  2QCP X;  2WB1 B;  1G6Z A;  1QE6 A;  5EBC A;  3VR4 A;  2IX3 A;  5DAU A;  4ZKB B;  1E2V A;  4AYB B;  4B9W A;  2JYO A;  1EU4 A;  3BS1 A;  1JB3 A;  3L3O C;  1SNO A;  2K5W A;  3T16 A;  1EY0 A;  2C9O A;  3P20 A;  5M3F B;  2NVY B;  1IYU A;  1B9M A;  4KY5 A;  4PNY A;  4JK1 C;  4A3F B;  2BA1 A;  4S3S A;  2IWH A;  1L0Y B;  4HAE A;  4XQN A;  2NWG A;  1R9T B;  2G9H D;  4BA1 I;  1HQM C;  1IKL A;  2EPB A;  4WFN 3;  1SNM A;  1CI3 M;  4FF4 A;  3BZD B;  4DNT B;  1G2T A;  1V43 A;  1EQT A;  4CHT B;  4ULL A;  5JEA G;  3OHX C;  4FYD A;  1C48 A;  1CQV A;  3NPP A;  5E1F A;  1GOZ A;  5KIX A;  1ZEQ X;  1DM0 B;  3MXU A;  5EKL A;  1WD0 A;  2RSN A;  4N9P A;  1ILQ A;  4MIU A;  2PQE A;  1B53 A;  4I7Z C;  3FKI B;  2NB0 A;  3HRZ C;  5M5W B;  1SEB D;  1RHP A;  2EE1 A;  1NSN S;  1VF7 A;  2RSO A;  3S2D B;  4R8N A;  1RTO A;  1HUM A;  1H9S B;  3CRK C;  4QUF A;  1TWF B;  1DJR D;  1I6H B;  1ICW A;  1AP0 A;  4DXG A;  2PMZ B;  1Z6H A;  1D6E C;  3AB9 A;  3S1R B;  1PTO F;  4M1U B;  5CGK A;  5M5Y B;  2K32 A;  3FDT A;  4EQO A;  4P2C B;  4TRD A;  3SK4 A;  3K0Y A;  4OIJ A;  1I4X A;  3PMF A;  3QG1 A;  4IUN A;  5G3L D;  3GQB A;  2EVB A;  3PUZ A;  3FVQ A;  3S15 B;  5HGT A;  4R8I A;  3TDQ A;  2KVM A;  3R2T A;  2NTT A;  4TKO B;  2KOL A;  4H7B A;  4KI0 A;  1SSO A;  1KAA A;  2HQE A;  2B2U C;  2CQA A;  3A7A B;  3V2T A;  3C46 A;  2L5T A;  5C5M A;  1SYF A;  2HCI A;  1QCB D;  2JA8 B;  2EZV A;  3TME A;  2K03 A;  1RD9 D;  3E6Z X;  4G4K A;  2BDN A;  4K5W A;  1KNE A;  3IKJ A;  1BDO A;  4U67 3;  2D62 A;  2JXM B;  3MHB A;  1QNK A;  4K5X A;  1F9R A;  2KEC A;  1B9N A;  2ICE C;  3QIA A;  1S5D D;  1EEI D;  2B2Y A;  4C3J G;  4G7Z C;  2EYJ A;  4K5V A;  1F2M A;  1O80 A;  4IFD I;  2F0K A;  1TS4 A;  3U9S A;  1VMC A;  2L4N A;  2A6H D;  4KD3 A;  5IGC A;  4KHZ A;  2LFN A;  4CJ1 B;  3SK5 A;  5KEE A;  2QEJ C;  2A5H A;  2XRQ D;  4A3M B;  5IT9 L;  3L7Z C;  1BO0 A;  2BE5 C;  2NVQ B;  1EYC A;  1S5E D;  3M4Y A;  2NYZ D;  2B2V C;  1K8M A;  3I90 A;  3TP6 A;  1H9M A;  1TT2 A;  1CFM A;  1L0X B;  4LMQ D;  1VDZ A;  1DD2 A;  2JE6 I;  2RVL A;  2J0T D;  1PZK D;  4G7H C;  2J7Z A;  1EY6 A;  5CYU A;  2Z8L A;  3P75 A;  2VNU D;  2JA5 B;  1E2W A;  3EJI A;  3QOL A;  3TSS A;  1V1P A;  1JOR A;  2B2T A;  5CBA E;  1HFN A;  2R93 B;  1EL0 A;  1AZP A;  1I4P A;  1SJE D;  1AW7 A;  3RMH A;  3M85 A;  3C2P A;  3BG3 A;  4RGO S;  2AWN A;  2F0N A;  1SYC A;  1Y8O B;  4RCN A;  3KBG A;  4KHV A;  3L9A X;  2RDH A;  3N52 A;  5EPJ A;  1KNA A;  4L8J A;  1TWH B;  1I6V C;  2J4X A;  5IOC A;  1QB5 D;  4XT3 B;  5IOD A;  1F2L A;  1HHV A;  2IT1 A;  2L12 A;  2RDF A;  5CR3 A;  1CHQ D;  1GUO A;  4HN7 A;  2MGS A;  4GZY C;  1SNP A;  2PZT A;  4FXG C;  2X6G A;  3WOE A;  2B2W C;  5KND A;  3UI2 A;  5KNB A;  4OO1 I;  2YU9 B;  4ZRZ A;  1CA6 A;  5IGD A;  1J9O A;  2N55 A;  5KYI A;  5TSS A;  1PFB A;  2K5Q A;  4FNF A;  3OPO A;  1ESR A;  1AEX A;  1PZJ D;  3D4R A;  3I91 A;  1I4R A;  4X3K A;  2GA4 B;  4V0B A;  5DEH A;  1LT6 D;  1Q1E A;  1D2B A;  4LJZ C;  1SYB A;  3PO3 B;  5I9P A;  4HSV A;  3TN2 A;  5A35 A;  4DK0 A;  4BS9 A;  5I6W A;  3K6O A;  2OEO A;  3GD7 A;  2EYM A;  3HOU B;  4F88 A;  2PYK A;  5F2D A;  5CBE E;  2R7Z B;  2KED A;  3NXW A;  3RLF A;  4ZUJ A;  5JEA J;  1ZYR C;  2IL8 A;  3VR2 A;  3KLS A;  1MGS A;  2NBF A;  2KA7 A;  1EY7 A;  1EIH A;  1BOS A;  1H9S A;  2IW3 A;  5COR A;  3GTM B;  4NKL A;  5E3F A;  4HSP A;  3MTS A;  2IX1 A;  3I3C A;  3PUW A;  1LAB A;  3H91 A;  3Q22 A;  4J1M A;  4BA2 I;  1ILP A;  4G7O C;  1LT5 D;  3Q6S A;  3D3R A;  3GTK B;  3NK9 A;  2XVS A;  4KD4 A;  1Q12 A;  4KY7 A;  2BA0 A;  4XDX A;  3KUP A;  4OO1 H;  2F0H A;  4TQU S;  4IUP A;  2Z1C A;  3D4W A;  3MXP A;  4A3G B;  5K36 H;  4IZ8 A;  4RGN A;  3OWE B;  4C1N I;  2JEA I;  1EYA A;  3EA6 A;  2PW5 A;  3GTP B;  2RQX A;  2PO4 A;  3GV3 A;  1OXU A;  2CW0 C;  2EYL A;  5EPL A;  1CM9 A;  3BVM A;  2FMM A;  1DXM A;  3LWE A;  1T5X D;  4O42 A;  3E5S A;  1QJO A;  2F0O A;  4HMJ A;  1SJH D;  3DXJ C;  1S4Z A;  3URY A;  1LTR D;  4UAI A;  3ERO A;  1EWH A;  4KKU A;  3X3M A;  2LS0 1;  1VF5 C;  3C1E A;  4QMG A;  1F9Q A;  1HXY D;  1JC7 A;  1STN A;  2Q8I B;  3A8J E;  1KDB A;  3Q23 A;  4NW2 A;  2RKS A;  1PDQ A;  3OIP A;  1STY A;  2F0E A;  3G7L A;  4X3S A;  5C4H A;  5E4W C;  5I6Y A;  1A6X A;  2MP1 A;  1JR0 D;  5NUC A;  1S5F D;  2A74 C;  3I70 A;  4IUV A;  4LK1 C;  2EY1 A;  1EFI D;  1A3T A;  1H9K A;  2Z4I A;  1KTK A;  4RWS C;  4DXF A;  4OIK A;  4U68 A;  3H3V C;  1I4Q A;  2WV6 D;  3EFX D;  3BVZ A;  4C56 C;  1U4L A;  3S17 B;  5IT9 E;  2B8G A;  1HTP A;  1IW7 C;  5IGB A;  1BNZ A;  5EBD A;  3HP3 A;  4FXD A;  5M3M B;  4H0L C;  5COY A;  5I4D A;  1KLU D;  5DM6 3;  2WII B;  1SE3 A;  4J6H A;  4J8Q A;  1H9J A;  1RKN A;  1NCV A;  1YNN C;  1O78 A;  3S14 B;  2FHT A;  3SE0 A;  5KGU A;  4OHJ A;  4FVM A;  3FRP B;  5T1I A;  1PRT C;  3NHH A;  5C5L A;  4KMU C;  3S1N B;  4CJ0 B;  4XXE A;  1IHZ A;  4CJ2 C;  1SMY C;  1LTB D;  2JP1 A;  5C6A A;  1HQR D;  3Q0A A;  1XWE A;  3SXH A;  1LLR D;  2K7V A;  5IGF A;  1WCM B;  3G6J B;  2R92 B;  1ONL A;  3J80 L;  1AN8 A;  2MUY A;  4A3E B;  5JVG 3;  5EPK A;  2WAQ B;  1DCZ A;  1K83 B;  1EIG A;  4IAL A;  2A6E C;  3E0J A;  2B2Y C;  4C3H G;  1B44 D;  2K33 A;  4C3J B;  4K14 A;  2PCF B;  3QO2 A;  4CGY B;  3MEH A;  5FOB B;  1LTT D;  1B4O A;  3S1Q B;  2F0L A;  5J1Z A;  5LL6 S;  1EZ6 A;  1PFM A;  4RFB A;  3K5L A;  3DEP A;  3MFY A;  1EY8 A;  3GTG B;  5CV7 A;  3M4O B;  3SHL A;  2OT2 A;  5C0X I;  1V8Q A;  1DOM A;  5IIF A;  2HUG A;  4JBW A;  1PMR A;  4OO1 G;  1EOT A;  5ELB A;  4ABN A;  1EZ8 A;  1TS5 A;  3OMG A;  5K36 G;  5J39 A;  3HOW B;  5FK9 C;  2EJM A;  4B9X A;  2FJ2 A;  2YYZ A;  3M3Y B;  2F1M A;  3TP5 A;  2B2T C;  1BF4 A;  2NZ1 D;  5CV5 A;  3TZU A;  5K5P A;  3K58 A;  2CVR A;  2EYP A;  3NQI A;  3J7A V;  3U9O A;  3NBH A;  5FO9 B;  2F0M A;  1BR9 A;  2Q8T A;  3VYR A;  3T51 B;  3NWS A;  2DY8 A;  3V96 A;  1SDF A;  2NVT B;  1WVL A;  2AQ1 B;  4I65 A;  4WOR A;  1X32 A;  4DA2 A;  2EOT A;  4XT1 B;  1K8O A;  4A93 B;  1W6J A;  1PLF A;  1FNV A;  5EJW A;  3IAY A;  1MSH A;  3D4D A;  1MD2 D;  2EYF A;  1BCP C;  2F4I A;  3C1F A;  2BE5 D;  3D6W A;  4KKS A;  1QIL A;  3NTH A;  1Z47 A;  4IUR A;  5C0X H;  1STB A;  2VXW A;  5KYL A;  4DAY A;  2PZU A;  2SDF A;  4NMZ A;  4ODG A;  4F8M A;  1TU2 B;  3J81 E;  2DN8 A;  3RD4 A;  2EJG C;  2M00 A;  2QF7 A;  3VR5 A;  3KLS X;  1OXS C;  3PIO 3;  3PV0 A;  1GUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...