1GUWA

Structure of the chromodomain from mouse hp1beta in complex with the lysine 9-methyl histone h3 n-terminal peptide, nmr, 25 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
73
structure length
73
Chain Sequence
HMVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chromatin-binding
molecule keywords CHROMOBOX PROTEIN HOMOLOG 1
publication title Structure of the Hp1 Chromodomain Bound to Histone H3 Methylated at Lysine 9
pubmed doi rcsb
source organism Mus musculus
total genus 6
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2002-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1guwA00
2B2WC 2IL8A 4X3TA 3I3CA 5EJWA 1ML0D 3SVMA 2B2VC 4IUVA 1WD0A 4XDXA 1WTQA 2DY8A 1SAPA 1TVXA 4HAEA 5E4XA 5CMDA 4QUCA 1SDFA 1WTVA 1LV9A 2MPMA 1ICWA 1JE4A 1PFBA 2EPBA 1X3QA 3Q6SA 3KBXA 2HDMA 4O42A 2B2UA 1O7YA 4RWSC 5D14A 2HUGA 2K01A 4ZAIA 1G6ZA 1DOKA 4IUTA 3DEPA 4HCSA 4ZKCB 2EE1A 1DOMA 4RA8A 3DEOA 1XX8A 2L1BA 5CBAE 3D6WA 1HUNA 1X32A 1DOLA 2FJ2A 4XT1B 2EOTA 2B2YC 1ZXTA 4RAUC 3DM1A 3FPUB 4MN3A 4LMQD 3MWYW 4X3SA 1VMPA 5EKIA 1NAPA 2NYZD 2KVMA 1DZ1A 5CORA 1WTWA 1EQTA 2H1EA 2NZ1D 3H91A 3IFDA 4IUUA 2XIWA 1PDQA 1G91A 1CM9A 5AFWA 5E4WC 4CJ2C 1PLFA 1EL0A 1HUMA 2B2TA 2L9HA 2X69A 3ONAB 1C8CA 1WD1A 1DONA 5COYA 3R93A 2B2UC 2CVRA 4CJ1B 3FDTA 1CA5A 4IURA 3IL8A 3I8ZA 5EPLA 1X3PA 2K28A 1PFNA 1QNKA 1NR2A 2MGSA 2Q8RE 5EQ0A 5CBEE 1WVLA 1QE6A 5JJZA 2K03A 1B2TA 1EIHA 1BBXC 3G7LA 4MHEA 1WTXA 3I91A 1MGSA 2JP1A 1AZPA 1IKMA 2RA4A 2KOLA 2N88A 1HFGA 2K04A 3GV3A 2Q8TA 4ZK9B 1O7ZA 2KUMA 4XT3B 1M8AA 1E0BA 1EIGA 1MSGA 1J9OA 1F9QA 2HCIA 2SDFA 1G2SA 4X3UA 5D65A 2L12A 4DN4M 1CA6A 5T1IA 2B2TC 2D9UA 3TZDA 1VMCA 2R3ZA 3QO2A 1MSHA 4HEDA 2KECA 2MP1A 1B53A 4X3KA 1J8IA 1HRJA 1RODA 2JYOA 1SSOA 2RVLA 1ILPA 1BO0A 4HSVA 1ESRA 1HHVA 1RTOA 2MJ8A 1KNEA 2KEDA 4R8IA 4R9WA 2HDLA 1ILQA 1F9SA 1XYIA 1JICA 1EOTA 2DY7A 1AP0A 3F2UA 1MI2A 1F9RA 1F2LA 4NW2A 5EPKA 1WTRA 1RTNA 4OIJA 1NR4A 1B50A 4UAIA 2J7ZA 2RSNA 2K1BA 5DNFA 1BNZA 3TN2A 4OIKA 1A15A 2FMMA 2X6LA 1BF4A 1WTOA 1AZQA 3P7JA 1S4ZA 1GUWA 4IUQA 5EPJA 2B2WA 2K05A 1IL8A 2L11A 3GV6A 1PFMA 1U4PA 2B2VA 2FINB 2VXWA 1NCVA 4U68A 1HA6A 1O80A 2X6GA 1WTPA 1Q3LA 3HP3A 1HFNA 2M2LA 1B4OA 4ZLTF 2BDNA 2FFKB 1U4RA 2FHTA 1F9PA 2RSOA 1QG7A 1IKLA 3N52A 3MTSA 2L4NA 3KUPA 4ZKBB 4CJ0B 3LWEA 1KNAA 3I90A 1B3AA 2KEEA 5T1GA 2NWGA 1G2TA 3UI2A 2N55A 1RJTA 2B2YA 4QUFA 1RHPA 4IUPA 1U4LA 1U4MA 2HCCA
chains in the Genus database with same CATH superfamily
3TMEA 2JEAI 1GKHA 4G4KA 3TZUA 3RN2A 3H09A 1E22A 1SN8A 5M5XB 1TVXA 4DR4Q 1X3FA 3J7YW 4H0LC 4X62Q 1LTSD 3WOEA 1EYGA 3K7UC 4LF5L 1X3QA 1K0RA 2A6ED 1XNRL 2K7VA 2RDFA 5KEEA 3LWUA 3NBHB 1Q8KA 1ESFA 4QQBX 5CBAE 2FJ2A 3NHHA 1O78A 4DPGA 2EYMA 1L0WA 1GUNA 4IN3A 1NAPA 4C3HG 4JYAQ 4KN4C 1PDQA 5IP9G 1HR0L 4X6AH 1S5BD 4ABNA 4KHPL 5COYA 2RF4A 5KNDA 1WTHA 1HZ9A 2A68C 3IL8A 4GLAC 2A69C 5ELFA 5IY0A 2F0QA 2A6HC 4DV5Q 2JE6I 3K0XA 3R3OA 2AKWB 1NMFA 5EGTA 5CC4A 5FO7B 1JJ2A 1B8AA 4R4OA 3QO2A 1EFWA 2E2IH 3NSWA 5IP7H 3PQIA 2LMCB 4DV7Q 1BO0A 4R1JA 3PIO3 1YZ6A 3CPFA 3K58A 1CKMA 2RCFA 1BBWA 5GAEC 3EN2A 3A8JE 1TU2B 4OIJA 3DXJC 1GVPA 2RKSA 2K1BA 3CMEA 1PZJD 4G7HC 4XYOA 2QCPX 1JB7A 4YCUA 1SE2A 5IWAQ 4JOIA 3PUWA 1I3QH 2M9VA 3HS0C 2XWJB 2HQEA 4DR5L 2C9OA 2NBFA 4BBSG 1UUPA 5FO9B 3BZCA 1F9PA 3T53B 4B3SL 3J7A5 2RSOA 2IY5B 1GO3E 4HJ7A 1N33L 2KCNA 3MTSA 3H94A 1D8LA 3S17B 2ID0A 5FK9C 4KD3A 1YVCA 3UDIA 2ZXRA 1V8QA 1K3BC 1Y14B 2NN6I 2SNMA 4A93B 3T1YL 5EJWA 4J1MA 1PH8A 4MNOA 2K4KA 1N34L 3M4OH 1RCVD 1PFSA 4B9WA 2KBNA 4DN4M 4FP5D 5EKKA 3HOUB 2VZAA 4DR2Q 1II3A 1PYWD 2HUGA 1VQIA 2K01A 4C1NK 3OTOL 3QJYA 3DEPA 4DK6C 1LO5D 3TP5A 4IALA 4JBMA 2O2LD 3F1ZA 4XT1B 1U9RA 2EYJA 5HGQA 3I4NG 2PW5A 4BY1G 1LTLA 2L55A 5GAHC 3J80E 4PZ6A 4B3MQ 4DAMA 2QW7A 4AH6A 4GOPB 2X69A 1WD1A 4DU9A 4QJFA 4NKLA 3HKSA 1X3PA 5EKLA 4A3DH 5CBEE 5AJ3Q 2FMCA 3GTGB 4LF9L 4NMZA 4HMJA 1DXMA 4LK1C 1EY6A 1XMQQ 3MA2B 5HY6A 1QNUA 1NSNS 1WCMH 4ZK9B 2SNSA 4KN7C 1CA6A 1E24A 3C46A 4J6HA 3OPOA 1MJCA 4FYDA 2Q2TA 2OTJA 2L0CA 4NXNL 2A1AA 3GQBA 2P5ZX 2ZTDA 2F4VL 3S16H 1GXDC 4P72A 3KOJA 3H6MA 1SR3A 1I4RA 4A3MH 2NVTB 4LF6L 5TSSA 5IGFA 3FPPA 4RGNA 5IYDH 1F2LA 4FXKC 5EPKA 3T13A 2NTSA 5IYCG 1NR4A 3CC4A 1SXTA 1OXVA 3U9OA 2A73B 2RQXA 2L15A 3CCVA 2PCFB 2HHHQ 1NBWA 4A75A 3A7AB 3GTMH 5G3LD 4F88A 2L11A 3D3RA 1J5EQ 2QA4A 1S3OA 1RDPD 2VXWA 3CP0A 4KKTA 4OONA 1AE3A 3A5ZB 4GN5A 4DR7Q 4GN4B 4KY6A 1EZ6A 3PGZA 1F2MA 5IOCA 3BZKA 5K5PA 2NN6G 3KUPA 3S1RH 1ZYRD 1ET6A 5J39A 5T1GA 4J15A 1G2TA 3GTPH 2D62A 2B39A 1VQBA 1GUSA 3URYA 1RJTA 1L0YB 1H9SA 3S2HB 2EYHA 1NJIC 1LTGD 1KDCA 4YCVA 4FXGC 2A8VA 1GHJA 1SRUA 3HOZB 4EVOA 4HJ5A 1LTRD 1FNVA 4R4QA 4IUVA 2R61A 1Y8NB 5FOBB 1STEA 2AUJD 3J7AV 1CQFA 3PSIA 4CKEA 4C2MH 3FKIB 2WIIB 3KLWA 1X3EA 2MNAA 4DUZQ 3EQLC 3G71A 4DR2L 4DF7A 1JOQA 3DM1A 2AQ3B 5EKIA 5LMUL 1KDAA 2R92H 1AEXA 4JPBW 3KLSA 1CM9A 4MTKA 3D4RA 3R8BA 4O1NA 3T16A 1EL0A 3QIAA 3W1BA 1EZ8A 2EY6A 2VB2X 2KQ3A 4KHVA 1EYAA 1GOZA 3VYRA 1SYDA 3J80i 3I4MH 3PF4A 4JI7Q 1HTPA 3HOWG 3GTJH 1YIJA 3TS2A 1Y1VG 4IQZA 3SK8A 5DM73 4DA2A 4MHEA 1WFQA 2R93B 3PMFA 1YHAA 1AE2A 1IW7D 3HOVG 2D2CC 2Q8TA 3G4SA 4JI2Q 1XMQL 3K0YA 4BA2I 4A3FB 1K73C 1X65A 5C4JB 1MSHA 3CU7A 4QIWE 2WAQB 3D4DA 3L7ZC 1IBKQ 2RVLA 3TEHB 4HSVA 5BN5A 2OQKA 3PUYA 4FO2A 1C0AA 2R7ZG 1STNA 5BR8L 3EIVA 4IFDG 4DV4Q 2NVQB 3U58A 4TSSA 3I4NH 3CCEA 3KLSX 3CW2C 1GUGA 3G6JB 3MHBA 1BXTA 1LUZA 1E3PA 2A6EC 5C4HA 1NCVA 1O80A 1SJED 1B4OA 2H5XA 4RCNA 3AB9A 3H0GG 3RLFA 2F1MA 3E9HA 3RLOA 4PMWA 1Z47A 2A68D 4NDXA 2NZHA 4DV6L 2A69D 1V1PA 2ZXPA 2GN5A 2A6HD 4A93H 2XWBB 1XPUA 1A6XA 5FLXL 4GZYC 4DR3Q 5C3EG 3M85A 2BA0A 3I2ZA 3MEHA 1X56A 2MPMA 4HSPA 1GJXA 1TT2A 1JWMD 3M4PA 1NMGA 3DEOA 1XX8A 4RFBA 2AWNA 2JK8A 2ZXOA 2UXCL 3HOXH 3CQZB 3KF6B 1D5MC 2Q8IB 4C56C 1EWHA 2KA7A 4KJNA 3UE0A 1EQTA 3H91A 4B9XA 1K8AC 4DR6L 5K36G 1I4GA 1PLFA 5M9OA 2JA6G 1W6KA 2VNUD 4JI0L 2ALYB 5HURA 3F2DA 1PV4A 3HKZG 4IUNA 2K28A 1QVFA 1JC7A 1PH2A 1VQ6A 2LXJA 1BBXC 4DUYL 3GTGH 3OHXC 2B29A 2NN6H 2R7DA 1VQFA 1HNZL 1TWCH 3I70A 5CV6A 4C3IH 1KQSA 1H9SB 1O7ZA 4O2DA 3MXNA 4JI1Q 2Y0SG 4HIMA 1CKOA 1PH4A 4O0AA 2CKZB 1DD2A 2MP1A 1ZKOA 4KMUC 2K75A 2VL6A 3TSSA 2PW7A 1KNEA 3OMGA 3S1QH 4YWMA 3PO2H 5KGUA 1F9SA 1D5XC 1I50B 3F2UA 3EJIA 4OWTB 1BCPB 3BDCA 1BCPD 1IBLQ 4LW1A 1FNUA 2XNAC 4BBRG 3D8GA 3J7AF 4OIKA 4YY3Q 4NXMQ 5M5YB 2PI2A 1H9JA 3AEVA 3U4ZA 1B1ZA 3S24A 2K6AA 4XQQA 1Q3LA 4V0BA 2KHJA 4ME5A 3HOWH 4WJ4A 1ET9A 2E2JH 2SEBD 4A3IB 4JI6L 4CJ0B 3LWEA 1KD1C 4FDBA 1QUQA 3UI2A 1VQCA 2DGYA 2E76C 4GOPC 4DV1L 1JQYD 3CCMA 5LMNL 2I0QA 4LF4L 3PO3H 4ZYSA 3SXHA 4QUCA 5JJLA 4X65Q 1PFBA 4RWSC 2KHIA 3R2IA 1KDBA 5D3DA 2UXBL 2JA9A 2EY2A 3ND9A 4IOCA 1I4QA 2IHFA 4MTNA 1O7IA 1UE1A 3RNUA 1TWAB 1PTOB 4POFA 4RAUC 2DJFC 1PTOD 1TWHB 2VQEL 1M90C 2YV5A 2JA7H 1STYA 3CMAA 3JC66 4PZ8A 1YNXA 2HD3A 4IJHA 4IUUA 1PH3A 4DXFA 1SFOH 1EFID 2F0HA 3ZYYX 5EBCA 4LF5Q 1K8OA 1XNRQ 1DONA 4HIOA 1VS0A 4CJ1B 1HNWQ 2BCOA 1WVLA 2I5LX 5IGGA 2RHQB 2F0EA 2K52A 3K7AB 2K5HA 2WAQE 1MGSA 2JP1A 1N32Q 5BN4A 1V1PB 2CQAA 4RGTA 2JA8H 4LF8L 1HR0Q 2OQ0A 4JBWA 4KHPQ 5DM63 3PUVA 1ICFB 2YYZA 1A2TA 5KNCA 2JJQA 3HOYH 4X3KA 4BY7B 3L3OC 1E1OA 4A3KG 1ILPA 3AU7A 1IYJB 1Q90A 2B3GA 1HHVA 5ELOA 1K8MA 4R9WA 4JC0A 4RKLA 2JN4A 1A3VA 1L2FA 5JEAH 1S5DD 4BS9A 1G8ZD 2F0GA 1IBLL 2EY5A 3OW2A 5IGDA 1CKNA 2KCTA 2E2HH 5K36H 4ODGA 2XRSD 3BG3A 1BVSA 4RHSA 4YY3L 4NXML 4QB4A 5ELNA 1CFMA 5I6WA 1R9TH 3A74A 5LMNW 2LKVA 3RN5A 1D6EC 2FFKB 2KCMA 1JJCB 3D31A 3OMCA 1NUCA 3NPPA 2IWHA 1DM0B 2EJGC 4LF7L 2QF7A 1VQ7A 2GVBA 2WB1G 2OF1A 4UP7A 1NNXA 3VDYA 2XVSA 3PCOB 2R7FA 1NY4A 3QOJA 3S1MB 4JOIC 3MXNB 4IPCA 5FLXc 4DV3L 2PZWA 1QCBD 5IGBA 3GTKB 4O42A 3KBXA 1N33Q 4LFCQ 1TWFB 4K14A 4A3DG 4X65L 4Y7NB 3RZOB 1MBYA 2ATWA 5A2QE 3T1YQ 5E1FA 1WCMG 4C3HB 1PH5A 1A3UA 1EY0A 2QGQA 1VQGA 4YCWA 1SEBD 2LY7A 1GHKA 3V96A 1LLRD 4KLKA 4A3EB 3IFDA 1N34Q 4IFDJ 3BJUA 1G91A 1YJNA 1IL2A 3SDZA 5IGCA 4EQOA 2ZTEA 3NENA 4N9PA 3OTOQ 1CHPD 2MHVA 3CRLC 1CA5A 4WRDA 4A3MG 1XPRA 4K2LA 2XSCA 3AQQA 2K03A 3LX0A 2N3SA 2MQHA 5IYDG 1HNWL 3MFGA 1WTXA 3OOCA 3ITPA 4HTHA 1QUQB 4EGVA 2K04A 2I5HA 3BVZA 1N32L 2C5CA 2DNCA 2F3VA 2PNHA 1Z7TA 4WORA 1CI3M 4OXPA 1HRJA 4DNRB 1YEZA 3SK5A 1LYLA 2AQ1B 4LF9Q 3T56B 3W3AA 4AYBE 4DGZA 5I4DA 5M3MH 5IIFA 1F9RA 4JBJA 3KBGA 3MXPA 4HJ9A 2K5DA 3NE5B 2AWOA 1VQLA 2VUMH 1B50A 4GNXA 3ER0A 4S3SA 4L5RC 4K5WA 3GTLB 1A15A 2CHBD 1S4ZA 4NXNQ 5KIXA 2F4VQ 5KYIA 5EBDA 1PFMA 2B2VA 5CV5A 4U68A 2CWAA 3A0JA 1FJGL 2F3IA 4LF6Q 1EY5A 3BZDB 3BDOA 3HG9A 1U5KA 4DV0L 4FVMA 1SMYD 3K6OA 1EUJA 2CH4W 4K6LA 2EIFA 3DWAA 2F03A 1SYFA 1G51A 3CD6A 4QIWB 1W6JA 2OCEA 1YBYA 2EYPA 3C1EA 1T9HA 1U4LA 2R92G 3VYUA 2MO1A 2QDLA 5C4XB 4UDUC 4TQUS 4JW0A 1ML0D 1EQVA 1EIFA 1WTQA 1U0LA 1JR0D 1PH6A 1LTAD 1IXRA 2CW0C 3NWSA 1I6HH 2QKIC 3BYYB 1SLJA 5DNFA 4A3KH 3I4MG 1N8RC 1E1TA 1CQVA 4G7ZC 3I4OA 1EWIA 1FYCA 2NVYB 3TQYA 4LFCL 1X32A 4BY1B 2PYKA 2F0MA 4LMQD 4X3SA 5H1SE 3HFZB 1TWHH 2NVXB 1EEID 2NZ1D 5C44B 5CV7A 3TREA 2BH2A 1CKNB 4HN7A 1Q1EA 3K81C 4DFAA 3NBIA 4BWGB 1HR0W 1EIYB 1XXGA 2EDGA 4K2KA 1EIHA 1BCPC 2JEBI 1FGUA 4N8X1 5FJ8H 1QWYA 1V43A 5LMUQ 4OL7A 1TS4A 2RBMA 3PV0A 1M8AA 4HMIA 1L0XB 4LUOA 5D65A 5GQOA 3RZDH 4LAAA 3V05A 3KYHC 2KECA 1OXXK 1B53A 2BE5C 1G291 4JI5L 1RODA 4P73A 3CPWA 1STAA 1GUTA 4KK7A 3S14H 1PXUA 2MUYA 1HPCA 4R8IA 3X3MA 3M3YH 2ZTCA 2E8GA 3RUZA 1K8GA 3S9WA 2HQLA 1XMOL 3I73A 5KYLA 4BA1I 1AH9A 1BNZA 1PRTF 1M4VA 1TQOA 3AYHB 1Y1WH 3MZ5A 1BKBA 1CK1A 5M3FH 4A93G 5I2XA 2V4DA 4IUQA 1K0SA 4GKJL 1QOHA 1ONLA 4QCLA 1KC8C 5CV9A 4IZ8A 5BR8Q 1SYCA 4IJLA 2Z4HA 1GUOA 1PRTB 3J7ZC 1PTOC 1EQRA 2IHEA 3HOXG 2JQOA 4L63B 3S15H 3L0OA 4OO1I 4QUFA 1VQ9A 1TXYA 5IE8A 4RCOA 5JJIA 3CCQA 1ICWA 3SEBA 1VQ8A 5DLQE 1HJPA 4YHHQ 1TWFH 2PI2E 4DV6Q 3VA5A 4Y7NH 1DOLA 3WDNA 1N36L 4IPHA 4HIDA 4B3RQ 2F0WA 4C3JH 2ZM6L 3FEWX 4C3IG 1STGA 2N78A 2RCNA 5CORA 4GLVB 4F87A 3SR1A 2RDHA 3S1NB 2Z8LA 2I07B 4A3GB 2OXPA 5M5XH 2DN8A 1Y1VB 1OXSC 1QNKA 3PO2G 1NR2A 2UXCQ 1B9MA 2AMCB 1QE6A 5JJZA 4PMBA 1E2ZA 1KIXA 4AQYL 2EYFA 1L1OA 1C4QA 3DM3A 2N88A 3GV3A 4HR7B 4DR6Q 3FVQA 1EIGA 2JSOA 1EOVA 4A3LH 1YHBA 2D9UA 2YU9B 1KLUD 3FRPB 4JI0Q 1W2BA 2B63B 1J8IA 5J1ZA 1ENAA 1TS2A 2R7ZB 4OX9L 2KEDA 1I4PA 4DUYQ 1Q86C 4I65A 1YNJC 1ILQA 3L2PA 4DAVA 1HNZQ 4LFBL 2A19A 3ULJA 4XTCS 4Y52H 1AFPA 3NUCA 3H3VC 2EXDA 1YNNC 1TR5A 3PUZA 1BF4A 4DR1L 3P7JA 1HQRD 3NEMA 3Q22A 2J0TD 1VQDA 3HOZG 3PO3G 1U4PA 2X6GA 1KAAA 3H0GB 2A5HA 1R4QB 1VQOA 2MO0A 3ND8A 5C5LA 2K14A 1GM5A 2WINB 3FKIG 4OO1G 3N52A 1HQMC 2JA7G 1HXYD 4IUPA 3GP7A 1EU4A 1EYDA 2JA5B 1MKHA 2F3WA 4L5QA 4H7BA 4HAEA 5CMDA 1SNCA 3FMCA 2EPBA 1WJJA 4JG2A 2I5MX 2B2UA 4ZAIA 1A2UA 3NK9A 1WOCA 3STBC 4JI6Q 1DOMA 1BOSA 2F0JA 1C7YA 1MJEA 1D2BA 1AW7A 4YHHL 3S2DB 3MWYW 2JA8G 4DV1Q 2EY1A 3S17H 2Z0SA 5LMNQ 4A3JB 4LF4Q 1P16A 3NELA 4RHRA 3I55A 2JA6B 1E7ZA 2Z6BA 4B3RL 5AFWA 4UP8A 1N9WA 3HOYG 4RKBA 2L9HA 2B2TA 1TWGB 3I56A 2F0SA 5C6AA 3DLLA 4KTAA 3R93A 4XIGS 2UXBQ 1OXUA 1E2VA 2OWOA 5EPLA 3F2BA 2UUCL 2MGSA 3GTOB 3HOUH 3KJPA 3KK7A 3O13A 2VQEQ 1KL9A 3K5OA 5M5WB 2CH4A 4HJAA 5JEAG 3J81c 1LACA 4FF1A 4CBVA 2KUMA 1SNDA 5CR3A 3K8AA 3RMHA 1M1KC 1SMYC 4A3BB 3E9IA 2CW0D 1YI2A 3E3XA 5IT9L 1NTGA 2M00A 1MI2A 3GTQB 2F0NA 1RL2A 5E7NA 4LF8Q 3VR3A 4OWWB 4CKBA 4KV6A 2D5DA 3E0JA 1LT6D 3PIP3 2NTTA 3HZXA 1HFNA 2K32A 2DUDA 3DHQA 2FHTA 3SK6A 1QVCA 4ALPA 1UEAB 4PQXA 2UXDL 2NVTH 1UE6A 1I6VC 4UP9A 5CV8A 3T1HQ 4K8JA 4DK0A 3BS1A 1KHIA 1WTWA 2HCCA 1V9PA 1C9OA 2IL8A 1Y8PB 4R4CA 4X3TA 4G7OC 4AYBB 2F0KA 3KJOA 4BXXH 2BOSA 5E4XA 2Q2UA 1EY8A 3C1FA 1SDFA 3KFUA 1XJVA 5D14A 4PV1C 4LF7Q 2BE5D 1EYCA 4HCSA 1QZHA 4ZKCB 4PMCA 1OTCA 2V1CC 4C1NI 1Z6HA 2IX3A 4JI8L 3MVVA 1CT1D 3ZJYC 4JI4L 2YTXA 4DV3Q 1YHQA 3S2HH 3TBIB 4KJOA 2DJGC 1SE3A 3HOZH 2K5WA 3EVQA 5FKAC 4MIUA 4CHTB 1DJRD 5M3MG 3ERQA 3FKIH 4OO1H 2YTVA 2VUMG 3J81j 1X3GA 1FNWA 2IX1A 1AN8A 1Q12A 1MSGA 1I3QB 2SDFA 5J22A 1VQMA 3A8IE 5NUCA 4HEDA 3DMUA 3VYSA 3R2TA 1ESRA 1YITA 1LTTD 1PRTC 1BQQT 3ICEA 3CHBD 4DK1A 2KCCA 2VQFL 3OIQA 2PPBC 1V1OA 1VCIA 4G57A 2R93H 5IYBH 2R6GA 1SMXA 1S5ED 2YTYA 1HNXL 5FLXE 1B3QA 3K80C 1PVOA 3M4OB 2OEOA 1WTOA 2H4OA 1IL8A 1B9NA 3DWQA 4A3FH 1BR9A 5C4JH 3H3VI 4OWXB 3CCSA 1F2YA 5I9PA 4WJ3M 1Y69U 1IYVA 2I46A 3G6EA 2WB1B 1QG7A 4QF4A 1R4PB 4P74A 4RG1A 4GNXC 5C0XI 4H13C 1B70B 2NVQH 4LNQA 1PA6A 3T1HL 1FJGQ 2B2VC 4DXGA 2PNRC 2Q2IA 4DV0Q 3VR6A 1SAPA 5CGKA 5IT9E 4A3DB 4IUTA 3Q24A 3SHLA 2PQAA 5LHY1 5FLMH 4KHZA 2Z9HA 4RA8A 4E6IA 2L1BA 1VQEA 5J3BA 3HKZE 4X64L 5FJ8G 1Q1BA 1YNJD 1BBUA 5HGTA 3OWFA 5A35A 1EY7A 1DZ1A 1ASZA 2H1EA 5ELBA 2UUAQ 4JBKA 1CHQD 4A3JH 1YNND 4RH6A 3S16B 1STBA 1SROA 4A3MB 2Y0SE 3HRZC 4I7AA 4K0KL 1JOOA 1VQ5A 3MC0B 5JPMC 4ZRZA 3NTIA 2UU9L 5EQ0A 1T5XD 1QB5D 2KHSA 2WACA 3EROA 4K5VA 1H9KA 4NPSA 4U673 5M5WH 3NQTA 4CDFC 3CQZH 1Y1WG 1H9MA 3PF5A 1E0BA 1IHZA 5M3FG 1KRTA 3GTMB 2LFNA 1G2SA 1JWUD 2L12A 5T1IA 3T51B 1VMCA 3LNNA 3UDXA 2BDOA 3F8TA 1SSOA 2RHSB 2PMZB 1KXLA 1A3TA 1SYEA 2E74C 2HIVA 4CKCA 1AP0A 4JVZA 3OW7A 4NW2A 1WTRA 5IT9c 2QEXA 4LUVA 3GTQH 3STBD 3K5NA 4K8IA 3CAMA 1S5CD 5IGEA 3PIPA 4POGA 1O7LA 2X6LA 3MAQA 1GUWA 1I5FA 3KLRA 4JI5Q 2B2WA 1UE7A 3MEFA 5I9OA 4IPDA 5C3WA 1DYQA 4JI3Q 4H02A 4C2MB 2K50A 3I72A 1U4RA 1STHA 3V2TA 5C0XG 1XMOQ 2ES2A 1IBML 3H15A 4FF3A 1IKLA 4ID6A 1I50H 3DWPA 1XTCD 5ISRA 4FXDA 1KAWA 2R92B 1JORA 1J6QA 4C3JG 2B2YA 4WFN3 1RHPA 2Q2HA 3MXGA 5D3IB 1XNQL 4ZUIA 1VQ4A 4GKJQ 2F0TA 3DUZA 2LXKA 4A3EG 5JEAJ 1DCZA 1QVGA 1SNOA 2TMPA 5M5YH 1Z9FA 1IYUA 3I4MB 4BBSB 3UDFA 1WTVA 1CZWA 3GTJB 4R8NA 3WWVA 4A3CH 1HA5A 4PG3A 1DOKA 1SNPA 3FP9A 4Q0FA 4GKKQ 4I7ZC 3NQIA 1H9RA 2LSSA 1JE5A 2UUBL 1KABA 1PMRA 4A3IH 3IKJA 3P75A 5JOBA 3C3LA 3MXUA 2NYZD 3JAML 2HIXA 2GVAA 5JPNC 4A3LG 1P8LA 4RMFA 4XYQA 4DV2L 4KKSA 3N6RA 5E4WC 1RD9D 4IO9A 4DNTB 2UUAL 2N8NA 1TS3A 4M1UB 4B3TL 2ENBA 4CDEC 2QDBA 3P1HA 2EJMA 2E5LL 4JV5L 1N36Q 3D0FA 3QWNA 3GO5A 2ZM6Q 3I4NB 3M4QA 2ZJRA 1HFGA 1CSQA 1TWAH 1PTOH 3CCRA 4TKOB 4L5SA 1J9OA 2HCIA 2PZUA 2Z1CA 3W5OA 3AFPA 4DAYA 2HT1A 1K9MC 2AHOB 1TIID 2Z4IA 3HEJA 4K5XA 3VR2A 4AQYQ 2PQAB 2QEJC 2VW9A 1JICA 1L1OC 2F0VA 1PH9A 2K33A 4GLXA 5ELEA 3EBEA 4N8FA 2K5VA 2VY3A 3K7AH 4X66Q 3J81L 4QMGA 1SBBB 3TN2A 4Z9CB 3BU2A 1S5FD 2CFMA 4RGMA 2WB1E 1E2WA 3QB3A 3Q23A 3RR5A 3A7LA 1MD2D 5C4XG 1D1IA 4PNYA 4OX9Q 4JCVE 3ERSX 1WTPA 1PHJA 5E3FA 2M2LA 4BY7H 4ZLTF 4DR4L 4X62L 3A55A 1VQPA 2EYOA 4JI3L 4LFBQ 3SGIA 3HOXB 1X55A 3Q8DA 2L4NA 5DEHA 1LT4D 4YWKA 3CCLA 2N55A 4DR1Q 3GV6A 4GN3B 2WKDA 1HTLD 3WOFA 3I3CA 5C44G 1PYBA 1FVIA 2EVBA 1WD0A 3E6ZX 2IT1A 4JYAL 3CC7A 1B44D 1LV9A 1JE4A 3Q6SA 1RIPA 3CF5A 3K5LA 1G6ZA 1G6PA 1Q81C 4DNIA 3HOUG 3D6WA 4GKKL 3W1GA 4KD4A 1PRTD 3BVGA 1TWCB 4C3IB 1TS5A 1CZGA 4CDDC 4DV5L 2EQSA 4OEMB 3UE1A 3H3VH 3S1MH 4NB3A 3GD7A 3ONAB 3S1QB 2B2UC 2EJFC 1MIUA 5G3LF 1ASYA 3PO2B 1SJHD 4YIJA 3GTKH 4DV7L 4IOAA 2F0DA 3IFTA 3B6YA 5C0XH 3KF6A 2BH8A 1LT3D 3I91A 1IKMA 1XPOA 3RZOH 2RA4A 1D5ZC 1VQJA 4KY7A 2LS01 2PMZE 4B08A 4GNXB 4IFDI 1D7QA 3X3NA 1K28A 1KLGD 4C3HH 5IP9H 2B2TC 4A3EH 4F7XA 3J80c 5IWAL 3M9BA 3SE0A 2UUCQ 3MFYA 5C5MA 3HOWB 1RTOA 1VQAA 1X6OA 3NTKA 2OT2A 3I7FA 4LUZA 1SE8A 2CQOA 2E2JB 1X54A 5ELCA 1TY2A 1EOTA 2DY7A 4APVA 3F2CA 1F2ZA 4A76A 1XYIA 2ASBA 5L37A 1RTNA 3TP8A 3JAME 1V1QA 2L5TA 4A4IA 3HOVB 4UAIA 2J7ZA 2RSNA 4P75A 2ZT9C 4X66L 1AZQA 3PO3B 5EPJA 1H95A 3EA6A 2B8FA 4BXXG 1HA6A 1A0IA 4OELB 4MZ9A 5ELDA 2PZTA 5LL6S 3OIPA 1ZEQX 3W2DA 2CCZA 1OO9B 3FHWA 2JA7B 4ZKBB 4UPAA 5C4ZA 1JWSD 1EU3A 3EFXD 3ULLA 1F77A 3D6CA 2F52A 4H44C 1SFOB 3AMUA 1VF5C 3NTHA 3GTLH 4N9TA 4L6TB 1EQQA 3A8KE 4DAYB 4XDXA 2DY8A 4B3ML 4GS3A 4BBSH 4EQNA 1O7YA 4A3GG 2UXDQ 3K59A 4RGOS 1EWCA 4F8MA 1JMCA 1GD7A 3J81E 1VQNA 1EY4A 2JA8B 5AJ3L 3OWEB 1T5EA 2EOTA 2CWPA 4L5TA 4MN3A 2KVMA 2WV6D 3HOYB 3JAMc 5C3EB 1JT8A 4Q5VA 3PIOA 5C4XH 1HH2P 3KDFA 1BUVT 1DGSA 2B63G 1X9NA 3C2PA 3I8ZA 1PFNA 2G5DA 2ZJQA 4JI8Q 5I2YA 2GA4B 1AZPA 2O5IC 1JOKA 2NVYH 2JXMB 5IYBG 4JI4Q 5C0XJ 5CYUA 2R93G 4BY1H 2FXQA 2E2HB 2NB0A 2VS1A 4X3UA 3NWTA 2NVXH 4FNFA 2F0PA 3TZDA 5C44H 2D0OA 2HHHL 4A3FG 1R9TB 3E5SA 2E75C 1CTMA 3TP7A 3U4VA 2BA1A 3HKZB 4WJWA 4DKAC 1J5EL 1SYGA 2WAQG 4DR7L 2F4IA 2HDLA 5JVG3 4ZCKA 1HCZA 4YWLA 1XWEA 1TKWB 4R4TA 1K83B 1C48A 3M4YA 3KF8A 2Y0SB 3RLNA 1I94Q 2JA5G 1A62A 3JAMi 2FINB 1I4HA 3HP3A 5JVH3 2XRQD 2VQFQ 5FLMG 3TS0A 2Z6KC 3I4LA 3M7GA 3A5UA 5IYCH 2F0OA 1HNXQ 1KNAA 4BBRB 1B3AA 2KEEA 4OGQC 4DUZL 4TRDA 1Q46A 5EAYA 3K57A 4EQ5A 5GROA 4EQPA 4A3JG 4P71A 3UDGA 4ME3A 1MHWC 2WP8J 1Q82C 2G9HD 2HDMA 3TP6A 2EE1A 4QL5A 4JI7L 4FF4A 4HCEA 4ULLA 3VYTA 3CC2A 1L1OB 2DNEA 3FPUB 1FL0A 1BCPF 3CRKC 4R4IA 2N49A 1EY9A 3QG1A 3AFQA 1SNMA 3Q0AA 3J81i 1RKNA 1CSPA 5KRUA 4JI2L 2KENA 1IZ6A 1ENCA 1JCKB 2CVRA 2PQEA 2G9DA 5GADC 1FD7D 5M3MB 1A8VA 1IBKL 2Q8RE 3L9AX 3BYTB 4X64Q 4A3BG 1FR3A 1WI5A 1YJ9A 1B2TA 2VUMB 3G7LA 4L8JA 4NP5A 1SNQA 5F2DA 2TSSA 1LT5D 1K3RA 4ILWA 2XTIA 1PYSB 5A2QL 2KOLA 3HGBA 4QY7A 3SK4A 3ULPA 1S40A 2E2DC 4DV4L 4IPGA 4XT3B 2ZJPA 1F9QA 2E2IB 3A54A 2EYLA 4K0KQ 5JJKA 1I4XA 2IX0A 3S1NH 2JYOA 2UU9Q 2MJ8A 4DAPA 2EZVA 4A3GH 1HZBA 3NBHA 1Y1VH 4XXEA 1SE4A 1QILA 1WYDA 4CDCC 3VA7A 4K6DA 3HOVH 3T4AC 1PTOF 2FMMA 2MFIA 3D4WA 2NUCA 1I6HB 2K5QA 3TRZA 3K5MA 3A56A 4A3KB 1I94L 2YU9H 3KDFB 4AYBG 1OXTA 4DR3L 2B63H 1FGBD 2BDNA 5IODA 4A3CG 4XQNA 2ICEC 1RF2D 2R7ZH 3CKIB 3CXCA 4LFAQ 4AIMA 1W3SA 4LWCA 1UAPA 4ZQ3A 3GDEA 4IFDH 2Z6KA 3NXWA 2EXZA 2NWGA 4A3IG 4KI0A 2SOBA 4LJZC 1VDZA 3RD4A 4EX5A 2B2WC 3SVMA 3BVMA 2IJ0A 5IP7G 1D1KA 2VB3X 5FO8B 1PZID 2O5JC 1IBMQ 2C35B 3H0GH 2AQ2B 2IW3A 1XTDA 5CV4A 2OTLA 1PZKD 2F0UA 4ZUJA 1HUNA 2F0IA 3QOLA 1KTKA 4XQJA 1YJWA 2B8GA 3PUXA 2B2YC 1ZXTA 1XNQQ 1HZAA 1KRSA 4QGUA 1VMPA 2RDGA 3U9SA 3RZDB 3KF8B 1PH1A 2XIWA 1LTBD 2JA5H 1HZCA 4CJ2C 1VQKA 1HUMA 3TDQA 5C3EH 1ENFA 2WKCA 1C8CA 4JI1L 5DAUA 3S14B 5C3XA 1UEBA 2AUKA 3M3YB 3FDTA 4IURA 5BN3A 4P2CB 1PH7A 1ZYRC 2UUBQ 5GAGC 3U50C 5I6YA 4HIKA 4CGYB 1WCMB 2PO4A 1Y1WB 1EEFD 3QR8A 1QZGA 5M3FB 1LABA 3IRBA 4DV2Q 2F0FA 3OSOA 4V190 3S2DH 4OHJA 1B7YB 4B3TQ 2R3ZA 2WFWA 3G48A 2XGTA 2JA6H 1CUKA 5LL6X 1VF7A 2J4XA 1NE3A 1Q8IA 1QJOA 1TWGH 2XN9C 3CCJA 1S72A 2E5LQ 4BY7G 4JV5Q 2IPKD 1LTID 1LM0A 3S15B 3NP8A 3GTOH 1UE5A 4UHVA 3LGJA 4M8AA 5KNBA 3P20A 1JB3A 1K83H 2K5NA 1TY0A 1JJGA 1SYBA 4DR5Q 2ICIA 2D0PA 2K05A 1Q7YC 1UNSA 3BDLA 4J8QA 4KY5A 3J80L 4GOPA 3IAYA 3CCUA 3E0EA 2A74C 4FF2A 4TVAB 3VR4A 4B3SQ 5JAVA 3M7NA 2QILA 2O4XA 2F0LA 1UWVA 2KJXA 4HJ8A 4UY8C 3VR5A 1IW7C 4A3BH 3S1RB 4PZ7A 4C3JB 1BDOA 1VQHA 2NZOA 3GTPB 3I90A 3OYYA 4LFAL 1A63A 4JK1C 4DK3C 4BBRH 4KKUA 1Y8OB 1U4MA
chains in the Genus database with same CATH topology
3TMEA 2JEAI 4G4KA 3TZUA 3H09A 5M5XB 1TVXA 3J7YW 4H0LC 1LTSD 3WOEA 1X3QA 2A6ED 2K7VA 2RDFA 5KEEA 3LWUA 1ESFA 5CBAE 2FJ2A 3NHHA 1O78A 2EYMA 1GUNA 4IN3A 1NAPA 4C3HG 4KN4C 1PDQA 1S5BD 4ABNA 5COYA 5KNDA 2A68C 3IL8A 2A69C 5ELFA 2F0QA 2A6HC 2JE6I 3R3OA 5EGTA 5CC4A 5FO7B 3QO2A 3NSWA 2LMCB 1BO0A 3PIO3 3K58A 3A8JE 1TU2B 4OIJA 3DXJC 2RKSA 2K1BA 1PZJD 4G7HC 4XYOA 2QCPX 1SE2A 3PUWA 2M9VA 3HS0C 2XWJB 2HQEA 2C9OA 2NBFA 1UUPA 5FO9B 1F9PA 3T53B 2RSOA 2KCNA 3MTSA 3H94A 3S17B 2ID0A 5FK9C 4KD3A 2ZXRA 1V8QA 4A93B 2NN6I 2SNMA 5EJWA 4J1MA 1RCVD 4B9WA 4DN4M 4FP5D 5EKKA 3HOUB 1II3A 1PYWD 2HUGA 2K01A 4C1NK 3QJYA 3DEPA 1LO5D 3TP5A 4IALA 2O2LD 4XT1B 1U9RA 2EYJA 2PW5A 2L55A 3J80E 2X69A 1WD1A 4DU9A 4NKLA 1X3PA 5EKLA 5CBEE 2FMCA 3GTGB 4NMZA 4HMJA 1DXMA 4LK1C 1EY6A 3MA2B 1QNUA 1NSNS 4ZK9B 2SNSA 4KN7C 1CA6A 3C46A 4J6HA 3OPOA 4FYDA 2L0CA 3GQBA 1GXDC 3H6MA 1I4RA 2NVTB 5TSSA 5IGFA 3FPPA 4RGNA 1F2LA 4FXKC 5EPKA 3T13A 2NTSA 1NR4A 1SXTA 1OXVA 3U9OA 2A73B 2RQXA 2PCFB 3A7AB 5G3LD 4F88A 2L11A 3D3RA 2VXWA 1RDPD 4KKTA 4KY6A 1EZ6A 1F2MA 5IOCA 5K5PA 2NN6G 3KUPA 1ZYRD 1ET6A 5J39A 5T1GA 1G2TA 2D62A 2B39A 3URYA 1GUSA 1RJTA 1L0YB 1H9SA 3S2HB 2EYHA 1LTGD 1KDCA 4FXGC 1GHJA 3HOZB 4EVOA 1LTRD 1FNVA 4IUVA 2R61A 1Y8NB 5FOBB 1STEA 2AUJD 3J7AV 1CQFA 4CKEA 3FKIB 2WIIB 3EQLC 4DF7A 1JOQA 3DM1A 2AQ3B 5EKIA 1KDAA 1AEXA 3KLSA 1CM9A 3D4RA 3R8BA 4O1NA 3T16A 1EL0A 3QIAA 1EZ8A 2EY6A 2VB2X 2KQ3A 4KHVA 1EYAA 1GOZA 3VYRA 1SYDA 1HTPA 4IQZA 3SK8A 2R93B 4DA2A 5DM73 4MHEA 3PMFA 1IW7D 2D2CC 2Q8TA 3K0YA 4BA2I 4A3FB 5C4JB 1MSHA 3CU7A 2WAQB 3D4DA 3L7ZC 2RVLA 4HSVA 5BN5A 3PUYA 4FO2A 1STNA 4IFDG 2NVQB 4TSSA 3KLSX 1GUGA 3G6JB 3MHBA 1BXTA 5C4HA 2A6EC 1NCVA 1O80A 1SJED 1B4OA 4RCNA 3AB9A 3RLFA 2F1MA 4PMWA 1Z47A 2A68D 4NDXA 2A69D 1V1PA 2ZXPA 2A6HD 2XWBB 1A6XA 5FLXL 4GZYC 3M85A 2BA0A 3MEHA 2MPMA 4HSPA 1GJXA 1TT2A 1JWMD 3DEOA 1XX8A 4RFBA 2AWNA 2ZXOA 3CQZB 2Q8IB 1D5MC 4C56C 1EWHA 2KA7A 4KJNA 1EQTA 3H91A 4B9XA 5K36G 1I4GA 1PLFA 5M9OA 1W6KA 2VNUD 5HURA 4IUNA 2K28A 1JC7A 1BBXC 3OHXC 2NN6H 3I70A 5CV6A 1H9SB 1O7ZA 3MXNA 1DD2A 2MP1A 1ZKOA 4KMUC 3TSSA 2PW7A 1KNEA 3OMGA 5KGUA 1F9SA 1D5XC 1I50B 3F2UA 3EJIA 1BCPB 3BDCA 1BCPD 1FNUA 2XNAC 3D8GA 3J7AF 4OIKA 5M5YB 1H9JA 1B1ZA 2K6AA 4XQQA 1Q3LA 4V0BA 4ME5A 1ET9A 2SEBD 4A3IB 4CJ0B 3LWEA 3UI2A 2E76C 1JQYD 4ZYSA 3SXHA 4QUCA 1PFBA 4RWSC 3R2IA 1KDBA 5D3DA 2EY2A 3ND9A 1I4QA 1TWAB 1PTOB 4RAUC 1PTOD 1TWHB 1STYA 4IUUA 4DXFA 1EFID 2F0HA 3ZYYX 5EBCA 1K8OA 1DONA 4CJ1B 2BCOA 1WVLA 5IGGA 2F0EA 3K7AB 1MGSA 2JP1A 5BN4A 1V1PB 2CQAA 4RGTA 4JBWA 5DM63 3PUVA 2YYZA 1A2TA 5KNCA 4X3KA 4BY7B 3L3OC 1ILPA 3AU7A 1Q90A 1HHVA 1K8MA 4R9WA 4RKLA 1A3VA 5JEAH 1S5DD 4BS9A 1G8ZD 2F0GA 2EY5A 5IGDA 5K36H 4ODGA 2XRSD 3BG3A 4RHSA 4QB4A 1CFMA 5I6WA 2LKVA 1D6EC 2FFKB 3D31A 3OMCA 1NUCA 3NPPA 2IWHA 1DM0B 2EJGC 2QF7A 2OF1A 2XVSA 3QOJA 3S1MB 2PZWA 1QCBD 5IGBA 3GTKB 4O42A 3KBXA 1TWFB 4K14A 4Y7NB 3RZOB 1MBYA 5A2QE 5E1FA 4C3HB 1GHKA 1A3UA 1EY0A 1SEBD 2LY7A 3V96A 1LLRD 4A3EB 3IFDA 4IFDJ 1G91A 3SDZA 5IGCA 4EQOA 4N9PA 1CHPD 2MHVA 3CRLC 1CA5A 4WRDA 4K2LA 2XSCA 2K03A 3LX0A 3MFGA 1WTXA 3OOCA 3ITPA 4HTHA 4EGVA 2K04A 3BVZA 2C5CA 2DNCA 2F3VA 1Z7TA 4WORA 1CI3M 1HRJA 4DNRB 3SK5A 2AQ1B 3T56B 3W3AA 4DGZA 5I4DA 5IIFA 1F9RA 3KBGA 3MXPA 2K5DA 3NE5B 2AWOA 1B50A 4S3SA 4K5WA 3GTLB 1A15A 2CHBD 1S4ZA 5KIXA 5KYIA 5EBDA 1PFMA 2B2VA 5CV5A 4U68A 1EY5A 3BZDB 3BDOA 3HG9A 4FVMA 1SMYD 3K6OA 4K6LA 3DWAA 2F03A 1SYFA 4QIWB 1W6JA 2EYPA 3C1EA 1U4LA 3VYUA 5C4XB 4UDUC 4TQUS 1ML0D 1EQVA 1WTQA 1JR0D 1LTAD 3NWSA 2CW0C 2QKIC 3BYYB 5DNFA 1CQVA 4G7ZC 1FYCA 2NVYB 1X32A 4BY1B 2PYKA 2F0MA 4LMQD 4X3SA 2NVXB 1EEID 2NZ1D 5C44B 5CV7A 4HN7A 1Q1EA 4DFAA 3NBIA 4BWGB 1XXGA 2EDGA 4K2KA 1EIHA 1BCPC 2JEBI 1QWYA 1V43A 4OL7A 1TS4A 2RBMA 3PV0A 1M8AA 4HMIA 1L0XB 5D65A 4LAAA 3V05A 2KECA 1OXXK 1B53A 2BE5C 1G291 1RODA 1STAA 1GUTA 4KK7A 1PXUA 2MUYA 1HPCA 4R8IA 3X3MA 3RUZA 3S9WA 3I73A 5KYLA 4BA1I 1BNZA 1PRTF 1M4VA 1TQOA 3MZ5A 1CK1A 5I2XA 2V4DA 4IUQA 1QOHA 1ONLA 4QCLA 5CV9A 4IZ8A 1SYCA 2Z4HA 1GUOA 1PRTB 1PTOC 4L63B 4OO1I 4QUFA 4RCOA 1ICWA 3SEBA 3VA5A 1DOLA 3WDNA 2F0WA 3FEWX 4C3IG 1STGA 5CORA 4F87A 3SR1A 2RDHA 3S1NB 2Z8LA 2I07B 4A3GB 2OXPA 2DN8A 1Y1VB 1OXSC 1QNKA 1NR2A 1B9MA 1QE6A 5JJZA 4PMBA 1E2ZA 2EYFA 1C4QA 2N88A 3GV3A 4HR7B 3FVQA 1EIGA 2JSOA 2D9UA 2YU9B 1KLUD 3FRPB 2B63B 1J8IA 5J1ZA 1ENAA 1TS2A 2R7ZB 2KEDA 1I4PA 4I65A 1YNJC 1ILQA 4DAVA 1AFPA 4XTCS 3NUCA 3H3VC 1YNNC 1TR5A 3PUZA 1BF4A 3P7JA 1HQRD 3Q22A 2J0TD 1U4PA 2X6GA 1KAAA 3H0GB 2A5HA 1R4QB 3ND8A 5C5LA 2WINB 4OO1G 3N52A 1HQMC 1HXYD 4IUPA 3GP7A 1EU4A 1EYDA 2JA5B 2F3WA 4H7BA 4HAEA 5CMDA 1SNCA 3FMCA 2EPBA 2B2UA 4ZAIA 1A2UA 3NK9A 1DOMA 1BOSA 2F0JA 1D2BA 1AW7A 3S2DB 3MWYW 2EY1A 4A3JB 4RHRA 2JA6B 5AFWA 4RKBA 2L9HA 2B2TA 1TWGB 2F0SA 5C6AA 4KTAA 3R93A 4XIGS 1OXUA 1E2VA 5EPLA 3GTOB 2MGSA 3KK7A 3O13A 3K5OA 5M5WB 5JEAG 1LACA 4FF1A 4CBVA 2KUMA 1SNDA 5CR3A 3RMHA 1SMYC 4A3BB 2CW0D 5IT9L 2M00A 1MI2A 3GTQB 2F0NA 3VR3A 4CKBA 4KV6A 2D5DA 3E0JA 1LT6D 3PIP3 2NTTA 3HZXA 1HFNA 2K32A 3DHQA 2FHTA 3SK6A 1UEAB 4PQXA 1I6VC 5CV8A 4K8JA 4DK0A 3BS1A 1WTWA 2HCCA 2IL8A 1Y8PB 4G7OC 4X3TA 4AYBB 2F0KA 2BOSA 5E4XA 1EY8A 3C1FA 1SDFA 5D14A 4PV1C 2BE5D 1EYCA 4HCSA 4ZKCB 4PMCA 4C1NI 1Z6HA 2IX3A 3MVVA 1CT1D 3TBIB 4KJOA 1SE3A 2K5WA 3EVQA 5FKAC 4MIUA 4CHTB 1DJRD 3ERQA 4OO1H 2IX1A 1FNWA 1AN8A 1Q12A 1MSGA 1I3QB 2SDFA 5J22A 3A8IE 5NUCA 4HEDA 3DMUA 3VYSA 3R2TA 1ESRA 1LTTD 1PRTC 1BQQT 3CHBD 4DK1A 2KCCA 3OIQA 2PPBC 1V1OA 1VCIA 4G57A 2R6GA 1S5ED 5FLXE 3M4OB 2OEOA 1WTOA 2H4OA 1B9NA 1IL8A 3DWQA 1BR9A 1F2YA 5I9PA 1Y69U 1IYVA 2I46A 2WB1B 1QG7A 4QF4A 1R4PB 5C0XI 4H13C 2B2VC 4DXGA 2PNRC 3VR6A 1SAPA 5CGKA 5IT9E 4A3DB 4IUTA 3Q24A 3SHLA 5LHY1 4KHZA 4E6IA 4RA8A 2L1BA 1Q1BA 1YNJD 5HGTA 3OWFA 5A35A 1EY7A 1DZ1A 2H1EA 5ELBA 1CHQD 1YNND 4RH6A 3S16B 1STBA 4A3MB 3HRZC 1JOOA 3MC0B 5JPMC 4ZRZA 3NTIA 5EQ0A 1T5XD 1QB5D 2KHSA 2WACA 3EROA 4K5VA 1H9KA 4U673 3NQTA 1H9MA 1E0BA 1IHZA 3GTMB 2LFNA 1G2SA 1JWUD 2L12A 5T1IA 3T51B 1VMCA 3LNNA 2BDOA 1SSOA 2PMZB 1A3TA 1SYEA 2E74C 4CKCA 1AP0A 3OW7A 4NW2A 1WTRA 3K5NA 4K8IA 1S5CD 5IGEA 1O7LA 2X6LA 3MAQA 1GUWA 3KLRA 2B2WA 5I9OA 5C3WA 1DYQA 4C2MB 3I72A 1U4RA 1STHA 3V2TA 5C0XG 4FF3A 1IKLA 4ID6A 3DWPA 1XTCD 5ISRA 4FXDA 2R92B 1JORA 4C3JG 2B2YA 4WFN3 1RHPA 3MXGA 5D3IB 4ZUIA 2F0TA 3DUZA 5JEAJ 1DCZA 1SNOA 2TMPA 1IYUA 3I4MB 4BBSB 1WTVA 1CZWA 3GTJB 4R8NA 1HA5A 4Q0FA 1DOKA 1SNPA 4I7ZC 3NQIA 1H9RA 1KABA 1PMRA 3IKJA 3P75A 5JOBA 3C3LA 3MXUA 2NYZD 3JAML 5JPNC 4XYQA 4KKSA 3N6RA 5E4WC 1RD9D 4DNTB 1TS3A 4M1UB 2ENBA 2QDBA 3P1HA 2EJMA 3QWNA 3GO5A 3I4NB 1HFGA 1PTOH 4TKOB 1J9OA 2HCIA 2PZUA 2Z1CA 4DAYA 1TIID 2Z4IA 3HEJA 4K5XA 3VR2A 2QEJC 1JICA 2F0VA 2K33A 5ELEA 3J81L 4QMGA 3TN2A 1SBBB 4Z9CB 1S5FD 4RGMA 1E2WA 3QB3A 3Q23A 3A7LA 1MD2D 1D1IA 4PNYA 1WTPA 5E3FA 2M2LA 4ZLTF 3A55A 2EYOA 3HOXB 2L4NA 5DEHA 1LT4D 2N55A 3GV6A 2WKDA 1HTLD 3WOFA 3I3CA 2EVBA 1WD0A 3E6ZX 2IT1A 1B44D 1LV9A 1JE4A 3Q6SA 3K5LA 1G6ZA 3D6WA 4KD4A 1PRTD 3BVGA 1TWCB 4C3IB 1TS5A 1CZGA 3GD7A 3ONAB 3S1QB 2B2UC 2EJFC 5G3LF 3PO2B 1SJHD 4YIJA 2F0DA 3IFTA 5C0XH 3I91A 1LT3D 1IKMA 2RA4A 1D5ZC 4KY7A 2LS01 4B08A 4IFDI 3X3NA 1KLGD 2B2TC 4F7XA 3SE0A 3MFYA 5C5MA 3HOWB 1RTOA 3NTKA 2OT2A 2E2JB 5ELCA 1TY2A 1EOTA 2DY7A 1XYIA 1F2ZA 1RTNA 3TP8A 3JAME 2L5TA 3HOVB 4UAIA 2J7ZA 2RSNA 2ZT9C 1AZQA 3PO3B 5EPJA 3EA6A 2B8FA 1HA6A 5ELDA 2PZTA 5LL6S 3OIPA 1ZEQX 3W2DA 1OO9B 2JA7B 4ZKBB 5C4ZA 1JWSD 1EU3A 3EFXD 1F77A 3D6CA 4H44C 1SFOB 3AMUA 1VF5C 3NTHA 4N9TA 4L6TB 3A8KE 4XDXA 2DY8A 4EQNA 1O7YA 3K59A 4RGOS 1EWCA 4F8MA 3J81E 1EY4A 2JA8B 3OWEB 1T5EA 2EOTA 4MN3A 2KVMA 2WV6D 3HOYB 5C3EB 4Q5VA 1BUVT 3C2PA 3I8ZA 1PFNA 5I2YA 2GA4B 1AZPA 2O5IC 1JOKA 2JXMB 5C0XJ 5CYUA 2E2HB 2NB0A 4X3UA 3NWTA 4FNFA 2F0PA 3TZDA 1R9TB 3E5SA 2E75C 1CTMA 3TP7A 2BA1A 3HKZB 4WJWA 1SYGA 2F4IA 2HDLA 5JVG3 1HCZA 1XWEA 1TKWB 1K83B 1C48A 3M4YA 3KF8A 2Y0SB 2FINB 1I4HA 3HP3A 5JVH3 2XRQD 3I4LA 3M7GA 2F0OA 1KNAA 4BBRB 1B3AA 2KEEA 4OGQC 4TRDA 3K57A 4EQPA 2WP8J 2G9HD 2HDMA 3TP6A 2EE1A 4FF4A 4HCEA 4ULLA 3VYTA 2DNEA 3FPUB 1BCPF 3CRKC 1EY9A 3QG1A 1SNMA 3Q0AA 1RKNA 5KRUA 1ENCA 1JCKB 2CVRA 2PQEA 2G9DA 1FD7D 5M3MB 2Q8RE 3L9AX 3BYTB 1FR3A 1B2TA 2VUMB 3G7LA 4L8JA 4NP5A 1SNQA 5F2DA 2TSSA 1LT5D 4ILWA 5A2QL 2KOLA 3HGBA 3SK4A 2E2DC 4XT3B 1F9QA 2E2IB 3A54A 2EYLA 1I4XA 2IX0A 2JYOA 2MJ8A 4DAPA 2EZVA 3NBHA 4XXEA 1SE4A 1QILA 3VA7A 4K6DA 3T4AC 1PTOF 2FMMA 3D4WA 2NUCA 1I6HB 2K5QA 3K5MA 3A56A 4A3KB 1OXTA 1FGBD 2BDNA 5IODA 4XQNA 2ICEC 1RF2D 3CKIB 1UAPA 4ZQ3A 4IFDH 3NXWA 2EXZA 2NWGA 4KI0A 2SOBA 4LJZC 1VDZA 3RD4A 2B2WC 3SVMA 3BVMA 2IJ0A 1D1KA 2VB3X 5FO8B 1PZID 2O5JC 2AQ2B 2IW3A 5CV4A 1PZKD 2F0UA 4ZUJA 1HUNA 2F0IA 3QOLA 1KTKA 4XQJA 2B8GA 3PUXA 2B2YC 1ZXTA 1VMPA 2RDGA 3U9SA 3RZDB 2XIWA 1LTBD 4CJ2C 1HUMA 3TDQA 1ENFA 2WKCA 1C8CA 5DAUA 3S14B 5C3XA 2AUKA 3M3YB 3FDTA 4IURA 5BN3A 4P2CB 1ZYRC 5I6YA 4CGYB 1WCMB 2PO4A 1Y1WB 1EEFD 5M3FB 1LABA 2F0FA 3OSOA 4V190 4OHJA 2R3ZA 5LL6X 1VF7A 2J4XA 1Q8IA 1QJOA 2XN9C 2IPKD 1LTID 3S15B 3NP8A 4M8AA 5KNBA 3P20A 1JB3A 1TY0A 1SYBA 2ICIA 2K05A 1UNSA 3BDLA 4J8QA 4KY5A 3J80L 3IAYA 4FF2A 2A74C 3VR4A 5JAVA 3M7NA 2QILA 2O4XA 2F0LA 2KJXA 3VR5A 1IW7C 3S1RB 4C3JB 1BDOA 3GTPB 3I90A 4JK1C 4KKUA 1Y8OB 1U4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2W C;  2IL8 A;  4X3T A;  3I3C A;  5EJW A;  1ML0 D;  3SVM A;  2B2V C;  4IUV A;  1WD0 A;  4XDX A;  1WTQ A;  2DY8 A;  1SAP A;  1TVX A;  4HAE A;  5E4X A;  5CMD A;  4QUC A;  1SDF A;  1WTV A;  1LV9 A;  2MPM A;  1ICW A;  1JE4 A;  1PFB A;  2EPB A;  1X3Q A;  3Q6S A;  3KBX A;  2HDM A;  4O42 A;  2B2U A;  1O7Y A;  4RWS C;  5D14 A;  2HUG A;  2K01 A;  4ZAI A;  1G6Z A;  1DOK A;  4IUT A;  3DEP A;  4HCS A;  4ZKC B;  2EE1 A;  1DOM A;  4RA8 A;  3DEO A;  1XX8 A;  2L1B A;  5CBA E;  3D6W A;  1HUN A;  1X32 A;  1DOL A;  2FJ2 A;  4XT1 B;  2EOT A;  2B2Y C;  1ZXT A;  4RAU C;  3DM1 A;  3FPU B;  4MN3 A;  4LMQ D;  3MWY W;  4X3S A;  1VMP A;  5EKI A;  1NAP A;  2NYZ D;  2KVM A;  1DZ1 A;  5COR A;  1WTW A;  1EQT A;  2H1E A;  2NZ1 D;  3H91 A;  3IFD A;  4IUU A;  2XIW A;  1PDQ A;  1G91 A;  1CM9 A;  5AFW A;  5E4W C;  4CJ2 C;  1PLF A;  1EL0 A;  1HUM A;  2B2T A;  2L9H A;  2X69 A;  3ONA B;  1C8C A;  1WD1 A;  1DON A;  5COY A;  3R93 A;  2B2U C;  2CVR A;  4CJ1 B;  3FDT A;  1CA5 A;  4IUR A;  3IL8 A;  3I8Z A;  5EPL A;  1X3P A;  2K28 A;  1PFN A;  1QNK A;  1NR2 A;  2MGS A;  2Q8R E;  5EQ0 A;  5CBE E;  1WVL A;  1QE6 A;  5JJZ A;  2K03 A;  1B2T A;  1EIH A;  1BBX C;  3G7L A;  4MHE A;  1WTX A;  3I91 A;  1MGS A;  2JP1 A;  1AZP A;  1IKM A;  2RA4 A;  2KOL A;  2N88 A;  1HFG A;  2K04 A;  3GV3 A;  2Q8T A;  4ZK9 B;  1O7Z A;  2KUM A;  4XT3 B;  1M8A A;  1E0B A;  1EIG A;  1MSG A;  1J9O A;  1F9Q A;  2HCI A;  2SDF A;  1G2S A;  4X3U A;  5D65 A;  2L12 A;  4DN4 M;  1CA6 A;  5T1I A;  2B2T C;  2D9U A;  3TZD A;  1VMC A;  2R3Z A;  3QO2 A;  1MSH A;  4HED A;  2KEC A;  2MP1 A;  1B53 A;  4X3K A;  1J8I A;  1HRJ A;  1ROD A;  2JYO A;  1SSO A;  2RVL A;  1ILP A;  1BO0 A;  4HSV A;  1ESR A;  1HHV A;  1RTO A;  2MJ8 A;  1KNE A;  2KED A;  4R8I A;  4R9W A;  2HDL A;  1ILQ A;  1F9S A;  1XYI A;  1JIC A;  1EOT A;  2DY7 A;  1AP0 A;  3F2U A;  1MI2 A;  1F9R A;  1F2L A;  4NW2 A;  5EPK A;  1WTR A;  1RTN A;  4OIJ A;  1NR4 A;  1B50 A;  4UAI A;  2J7Z A;  2RSN A;  2K1B A;  5DNF A;  1BNZ A;  3TN2 A;  4OIK A;  1A15 A;  2FMM A;  2X6L A;  1BF4 A;  1WTO A;  1AZQ A;  3P7J A;  1S4Z A;  1GUW A;  4IUQ A;  5EPJ A;  2B2W A;  2K05 A;  1IL8 A;  2L11 A;  3GV6 A;  1PFM A;  1U4P A;  2B2V A;  2FIN B;  2VXW A;  1NCV A;  4U68 A;  1HA6 A;  1O80 A;  2X6G A;  1WTP A;  1Q3L A;  3HP3 A;  1HFN A;  2M2L A;  1B4O A;  4ZLT F;  2BDN A;  2FFK B;  1U4R A;  2FHT A;  1F9P A;  2RSO A;  1QG7 A;  1IKL A;  3N52 A;  3MTS A;  2L4N A;  3KUP A;  4ZKB B;  4CJ0 B;  3LWE A;  1KNA A;  3I90 A;  1B3A A;  2KEE A;  5T1G A;  2NWG A;  1G2T A;  3UI2 A;  2N55 A;  1RJT A;  2B2Y A;  4QUF A;  1RHP A;  4IUP A;  1U4L A;  1U4M A;  2HCC A; 
#chains in the Genus database with same CATH topology
 3TME A;  2JEA I;  1GKH A;  4G4K A;  3TZU A;  3RN2 A;  3H09 A;  1E22 A;  1SN8 A;  5M5X B;  1TVX A;  4DR4 Q;  1X3F A;  3J7Y W;  4H0L C;  4X62 Q;  1LTS D;  3WOE A;  1EYG A;  3K7U C;  4LF5 L;  1X3Q A;  1K0R A;  2A6E D;  1XNR L;  2K7V A;  2RDF A;  5KEE A;  3LWU A;  3NBH B;  1Q8K A;  1ESF A;  4QQB X;  5CBA E;  2FJ2 A;  3NHH A;  1O78 A;  4DPG A;  2EYM A;  1L0W A;  1GUN A;  4IN3 A;  1NAP A;  4C3H G;  4JYA Q;  4KN4 C;  1PDQ A;  5IP9 G;  1HR0 L;  4X6A H;  1S5B D;  4ABN A;  4KHP L;  5COY A;  2RF4 A;  5KND A;  1WTH A;  1HZ9 A;  2A68 C;  3IL8 A;  4GLA C;  2A69 C;  5ELF A;  5IY0 A;  2F0Q A;  2A6H C;  4DV5 Q;  2JE6 I;  3K0X A;  3R3O A;  2AKW B;  1NMF A;  5EGT A;  5CC4 A;  5FO7 B;  1JJ2 A;  1B8A A;  4R4O A;  3QO2 A;  1EFW A;  2E2I H;  3NSW A;  5IP7 H;  3PQI A;  2LMC B;  4DV7 Q;  1BO0 A;  4R1J A;  3PIO 3;  1YZ6 A;  3CPF A;  3K58 A;  1CKM A;  2RCF A;  1BBW A;  5GAE C;  3EN2 A;  3A8J E;  1TU2 B;  4OIJ A;  3DXJ C;  1GVP A;  2RKS A;  2K1B A;  3CME A;  1PZJ D;  4G7H C;  4XYO A;  2QCP X;  1JB7 A;  4YCU A;  1SE2 A;  5IWA Q;  4JOI A;  3PUW A;  1I3Q H;  2M9V A;  3HS0 C;  2XWJ B;  2HQE A;  4DR5 L;  2C9O A;  2NBF A;  4BBS G;  1UUP A;  5FO9 B;  3BZC A;  1F9P A;  3T53 B;  4B3S L;  3J7A 5;  2RSO A;  2IY5 B;  1GO3 E;  4HJ7 A;  1N33 L;  2KCN A;  3MTS A;  3H94 A;  1D8L A;  3S17 B;  2ID0 A;  5FK9 C;  4KD3 A;  1YVC A;  3UDI A;  2ZXR A;  1V8Q A;  1K3B C;  1Y14 B;  2NN6 I;  2SNM A;  4A93 B;  3T1Y L;  5EJW A;  4J1M A;  1PH8 A;  4MNO A;  2K4K A;  1N34 L;  3M4O H;  1RCV D;  1PFS A;  4B9W A;  2KBN A;  4DN4 M;  4FP5 D;  5EKK A;  3HOU B;  2VZA A;  4DR2 Q;  1II3 A;  1PYW D;  2HUG A;  1VQI A;  2K01 A;  4C1N K;  3OTO L;  3QJY A;  3DEP A;  4DK6 C;  1LO5 D;  3TP5 A;  4IAL A;  4JBM A;  2O2L D;  3F1Z A;  4XT1 B;  1U9R A;  2EYJ A;  5HGQ A;  3I4N G;  2PW5 A;  4BY1 G;  1LTL A;  2L55 A;  5GAH C;  3J80 E;  4PZ6 A;  4B3M Q;  4DAM A;  2QW7 A;  4AH6 A;  4GOP B;  2X69 A;  1WD1 A;  4DU9 A;  4QJF A;  4NKL A;  3HKS A;  1X3P A;  5EKL A;  4A3D H;  5CBE E;  5AJ3 Q;  2FMC A;  3GTG B;  4LF9 L;  4NMZ A;  4HMJ A;  1DXM A;  4LK1 C;  1EY6 A;  1XMQ Q;  3MA2 B;  5HY6 A;  1QNU A;  1NSN S;  1WCM H;  4ZK9 B;  2SNS A;  4KN7 C;  1CA6 A;  1E24 A;  3C46 A;  4J6H A;  3OPO A;  1MJC A;  4FYD A;  2Q2T A;  2OTJ A;  2L0C A;  4NXN L;  2A1A A;  3GQB A;  2P5Z X;  2ZTD A;  2F4V L;  3S16 H;  1GXD C;  4P72 A;  3KOJ A;  3H6M A;  1SR3 A;  1I4R A;  4A3M H;  2NVT B;  4LF6 L;  5TSS A;  5IGF A;  3FPP A;  4RGN A;  5IYD H;  1F2L A;  4FXK C;  5EPK A;  3T13 A;  2NTS A;  5IYC G;  1NR4 A;  3CC4 A;  1SXT A;  1OXV A;  3U9O A;  2A73 B;  2RQX A;  2L15 A;  3CCV A;  2PCF B;  2HHH Q;  1NBW A;  4A75 A;  3A7A B;  3GTM H;  5G3L D;  4F88 A;  2L11 A;  3D3R A;  1J5E Q;  2QA4 A;  1S3O A;  1RDP D;  2VXW A;  3CP0 A;  4KKT A;  4OON A;  1AE3 A;  3A5Z B;  4GN5 A;  4DR7 Q;  4GN4 B;  4KY6 A;  1EZ6 A;  3PGZ A;  1F2M A;  5IOC A;  3BZK A;  5K5P A;  2NN6 G;  3KUP A;  3S1R H;  1ZYR D;  1ET6 A;  5J39 A;  5T1G A;  4J15 A;  1G2T A;  3GTP H;  2D62 A;  2B39 A;  1VQB A;  1GUS A;  3URY A;  1RJT A;  1L0Y B;  1H9S A;  3S2H B;  2EYH A;  1NJI C;  1LTG D;  1KDC A;  4YCV A;  4FXG C;  2A8V A;  1GHJ A;  1SRU A;  3HOZ B;  4EVO A;  4HJ5 A;  1LTR D;  1FNV A;  4R4Q A;  4IUV A;  2R61 A;  1Y8N B;  5FOB B;  1STE A;  2AUJ D;  3J7A V;  1CQF A;  3PSI A;  4CKE A;  4C2M H;  3FKI B;  2WII B;  3KLW A;  1X3E A;  2MNA A;  4DUZ Q;  3EQL C;  3G71 A;  4DR2 L;  4DF7 A;  1JOQ A;  3DM1 A;  2AQ3 B;  5EKI A;  5LMU L;  1KDA A;  2R92 H;  1AEX A;  4JPB W;  3KLS A;  1CM9 A;  4MTK A;  3D4R A;  3R8B A;  4O1N A;  3T16 A;  1EL0 A;  3QIA A;  3W1B A;  1EZ8 A;  2EY6 A;  2VB2 X;  2KQ3 A;  4KHV A;  1EYA A;  1GOZ A;  3VYR A;  1SYD A;  3J80 i;  3I4M H;  3PF4 A;  4JI7 Q;  1HTP A;  3HOW G;  3GTJ H;  1YIJ A;  3TS2 A;  1Y1V G;  4IQZ A;  3SK8 A;  5DM7 3;  4DA2 A;  4MHE A;  1WFQ A;  2R93 B;  3PMF A;  1YHA A;  1AE2 A;  1IW7 D;  3HOV G;  2D2C C;  2Q8T A;  3G4S A;  4JI2 Q;  1XMQ L;  3K0Y A;  4BA2 I;  4A3F B;  1K73 C;  1X65 A;  5C4J B;  1MSH A;  3CU7 A;  4QIW E;  2WAQ B;  3D4D A;  3L7Z C;  1IBK Q;  2RVL A;  3TEH B;  4HSV A;  5BN5 A;  2OQK A;  3PUY A;  4FO2 A;  1C0A A;  2R7Z G;  1STN A;  5BR8 L;  3EIV A;  4IFD G;  4DV4 Q;  2NVQ B;  3U58 A;  4TSS A;  3I4N H;  3CCE A;  3KLS X;  3CW2 C;  1GUG A;  3G6J B;  3MHB A;  1BXT A;  1LUZ A;  1E3P A;  2A6E C;  5C4H A;  1NCV A;  1O80 A;  1SJE D;  1B4O A;  2H5X A;  4RCN A;  3AB9 A;  3H0G G;  3RLF A;  2F1M A;  3E9H A;  3RLO A;  4PMW A;  1Z47 A;  2A68 D;  4NDX A;  2NZH A;  4DV6 L;  2A69 D;  1V1P A;  2ZXP A;  2GN5 A;  2A6H D;  4A93 H;  2XWB B;  1XPU A;  1A6X A;  5FLX L;  4GZY C;  4DR3 Q;  5C3E G;  3M85 A;  2BA0 A;  3I2Z A;  3MEH A;  1X56 A;  2MPM A;  4HSP A;  1GJX A;  1TT2 A;  1JWM D;  3M4P A;  1NMG A;  3DEO A;  1XX8 A;  4RFB A;  2AWN A;  2JK8 A;  2ZXO A;  2UXC L;  3HOX H;  3CQZ B;  3KF6 B;  1D5M C;  2Q8I B;  4C56 C;  1EWH A;  2KA7 A;  4KJN A;  3UE0 A;  1EQT A;  3H91 A;  4B9X A;  1K8A C;  4DR6 L;  5K36 G;  1I4G A;  1PLF A;  5M9O A;  2JA6 G;  1W6K A;  2VNU D;  4JI0 L;  2ALY B;  5HUR A;  3F2D A;  1PV4 A;  3HKZ G;  4IUN A;  2K28 A;  1QVF A;  1JC7 A;  1PH2 A;  1VQ6 A;  2LXJ A;  1BBX C;  4DUY L;  3GTG H;  3OHX C;  2B29 A;  2NN6 H;  2R7D A;  1VQF A;  1HNZ L;  1TWC H;  3I70 A;  5CV6 A;  4C3I H;  1KQS A;  1H9S B;  1O7Z A;  4O2D A;  3MXN A;  4JI1 Q;  2Y0S G;  4HIM A;  1CKO A;  1PH4 A;  4O0A A;  2CKZ B;  1DD2 A;  2MP1 A;  1ZKO A;  4KMU C;  2K75 A;  2VL6 A;  3TSS A;  2PW7 A;  1KNE A;  3OMG A;  3S1Q H;  4YWM A;  3PO2 H;  5KGU A;  1F9S A;  1D5X C;  1I50 B;  3F2U A;  3EJI A;  4OWT B;  1BCP B;  3BDC A;  1BCP D;  1IBL Q;  4LW1 A;  1FNU A;  2XNA C;  4BBR G;  3D8G A;  3J7A F;  4OIK A;  4YY3 Q;  4NXM Q;  5M5Y B;  2PI2 A;  1H9J A;  3AEV A;  3U4Z A;  1B1Z A;  3S24 A;  2K6A A;  4XQQ A;  1Q3L A;  4V0B A;  2KHJ A;  4ME5 A;  3HOW H;  4WJ4 A;  1ET9 A;  2E2J H;  2SEB D;  4A3I B;  4JI6 L;  4CJ0 B;  3LWE A;  1KD1 C;  4FDB A;  1QUQ A;  3UI2 A;  1VQC A;  2DGY A;  2E76 C;  4GOP C;  4DV1 L;  1JQY D;  3CCM A;  5LMN L;  2I0Q A;  4LF4 L;  3PO3 H;  4ZYS A;  3SXH A;  4QUC A;  5JJL A;  4X65 Q;  1PFB A;  4RWS C;  2KHI A;  3R2I A;  1KDB A;  5D3D A;  2UXB L;  2JA9 A;  2EY2 A;  3ND9 A;  4IOC A;  1I4Q A;  2IHF A;  4MTN A;  1O7I A;  1UE1 A;  3RNU A;  1TWA B;  1PTO B;  4POF A;  4RAU C;  2DJF C;  1PTO D;  1TWH B;  2VQE L;  1M90 C;  2YV5 A;  2JA7 H;  1STY A;  3CMA A;  3JC6 6;  4PZ8 A;  1YNX A;  2HD3 A;  4IJH A;  4IUU A;  1PH3 A;  4DXF A;  1SFO H;  1EFI D;  2F0H A;  3ZYY X;  5EBC A;  4LF5 Q;  1K8O A;  1XNR Q;  1DON A;  4HIO A;  1VS0 A;  4CJ1 B;  1HNW Q;  2BCO A;  1WVL A;  2I5L X;  5IGG A;  2RHQ B;  2F0E A;  2K52 A;  3K7A B;  2K5H A;  2WAQ E;  1MGS A;  2JP1 A;  1N32 Q;  5BN4 A;  1V1P B;  2CQA A;  4RGT A;  2JA8 H;  4LF8 L;  1HR0 Q;  2OQ0 A;  4JBW A;  4KHP Q;  5DM6 3;  3PUV A;  1ICF B;  2YYZ A;  1A2T A;  5KNC A;  2JJQ A;  3HOY H;  4X3K A;  4BY7 B;  3L3O C;  1E1O A;  4A3K G;  1ILP A;  3AU7 A;  1IYJ B;  1Q90 A;  2B3G A;  1HHV A;  5ELO A;  1K8M A;  4R9W A;  4JC0 A;  4RKL A;  2JN4 A;  1A3V A;  1L2F A;  5JEA H;  1S5D D;  4BS9 A;  1G8Z D;  2F0G A;  1IBL L;  2EY5 A;  3OW2 A;  5IGD A;  1CKN A;  2KCT A;  2E2H H;  5K36 H;  4ODG A;  2XRS D;  3BG3 A;  1BVS A;  4RHS A;  4YY3 L;  4NXM L;  4QB4 A;  5ELN A;  1CFM A;  5I6W A;  1R9T H;  3A74 A;  5LMN W;  2LKV A;  3RN5 A;  1D6E C;  2FFK B;  2KCM A;  1JJC B;  3D31 A;  3OMC A;  1NUC A;  3NPP A;  2IWH A;  1DM0 B;  2EJG C;  4LF7 L;  2QF7 A;  1VQ7 A;  2GVB A;  2WB1 G;  2OF1 A;  4UP7 A;  1NNX A;  3VDY A;  2XVS A;  3PCO B;  2R7F A;  1NY4 A;  3QOJ A;  3S1M B;  4JOI C;  3MXN B;  4IPC A;  5FLX c;  4DV3 L;  2PZW A;  1QCB D;  5IGB A;  3GTK B;  4O42 A;  3KBX A;  1N33 Q;  4LFC Q;  1TWF B;  4K14 A;  4A3D G;  4X65 L;  4Y7N B;  3RZO B;  1MBY A;  2ATW A;  5A2Q E;  3T1Y Q;  5E1F A;  1WCM G;  4C3H B;  1PH5 A;  1A3U A;  1EY0 A;  2QGQ A;  1VQG A;  4YCW A;  1SEB D;  2LY7 A;  1GHK A;  3V96 A;  1LLR D;  4KLK A;  4A3E B;  3IFD A;  1N34 Q;  4IFD J;  3BJU A;  1G91 A;  1YJN A;  1IL2 A;  3SDZ A;  5IGC A;  4EQO A;  2ZTE A;  3NEN A;  4N9P A;  3OTO Q;  1CHP D;  2MHV A;  3CRL C;  1CA5 A;  4WRD A;  4A3M G;  1XPR A;  4K2L A;  2XSC A;  3AQQ A;  2K03 A;  3LX0 A;  2N3S A;  2MQH A;  5IYD G;  1HNW L;  3MFG A;  1WTX A;  3OOC A;  3ITP A;  4HTH A;  1QUQ B;  4EGV A;  2K04 A;  2I5H A;  3BVZ A;  1N32 L;  2C5C A;  2DNC A;  2F3V A;  2PNH A;  1Z7T A;  4WOR A;  1CI3 M;  4OXP A;  1HRJ A;  4DNR B;  1YEZ A;  3SK5 A;  1LYL A;  2AQ1 B;  4LF9 Q;  3T56 B;  3W3A A;  4AYB E;  4DGZ A;  5I4D A;  5M3M H;  5IIF A;  1F9R A;  4JBJ A;  3KBG A;  3MXP A;  4HJ9 A;  2K5D A;  3NE5 B;  2AWO A;  1VQL A;  2VUM H;  1B50 A;  4GNX A;  3ER0 A;  4S3S A;  4L5R C;  4K5W A;  3GTL B;  1A15 A;  2CHB D;  1S4Z A;  4NXN Q;  5KIX A;  2F4V Q;  5KYI A;  5EBD A;  1PFM A;  2B2V A;  5CV5 A;  4U68 A;  2CWA A;  3A0J A;  1FJG L;  2F3I A;  4LF6 Q;  1EY5 A;  3BZD B;  3BDO A;  3HG9 A;  1U5K A;  4DV0 L;  4FVM A;  1SMY D;  3K6O A;  1EUJ A;  2CH4 W;  4K6L A;  2EIF A;  3DWA A;  2F03 A;  1SYF A;  1G51 A;  3CD6 A;  4QIW B;  1W6J A;  2OCE A;  1YBY A;  2EYP A;  3C1E A;  1T9H A;  1U4L A;  2R92 G;  3VYU A;  2MO1 A;  2QDL A;  5C4X B;  4UDU C;  4TQU S;  4JW0 A;  1ML0 D;  1EQV A;  1EIF A;  1WTQ A;  1U0L A;  1JR0 D;  1PH6 A;  1LTA D;  1IXR A;  2CW0 C;  3NWS A;  1I6H H;  2QKI C;  3BYY B;  1SLJ A;  5DNF A;  4A3K H;  3I4M G;  1N8R C;  1E1T A;  1CQV A;  4G7Z C;  3I4O A;  1EWI A;  1FYC A;  2NVY B;  3TQY A;  4LFC L;  1X32 A;  4BY1 B;  2PYK A;  2F0M A;  4LMQ D;  4X3S A;  5H1S E;  3HFZ B;  1TWH H;  2NVX B;  1EEI D;  2NZ1 D;  5C44 B;  5CV7 A;  3TRE A;  2BH2 A;  1CKN B;  4HN7 A;  1Q1E A;  3K81 C;  4DFA A;  3NBI A;  4BWG B;  1HR0 W;  1EIY B;  1XXG A;  2EDG A;  4K2K A;  1EIH A;  1BCP C;  2JEB I;  1FGU A;  4N8X 1;  5FJ8 H;  1QWY A;  1V43 A;  5LMU Q;  4OL7 A;  1TS4 A;  2RBM A;  3PV0 A;  1M8A A;  4HMI A;  1L0X B;  4LUO A;  5D65 A;  5GQO A;  3RZD H;  4LAA A;  3V05 A;  3KYH C;  2KEC A;  1OXX K;  1B53 A;  2BE5 C;  1G29 1;  4JI5 L;  1ROD A;  4P73 A;  3CPW A;  1STA A;  1GUT A;  4KK7 A;  3S14 H;  1PXU A;  2MUY A;  1HPC A;  4R8I A;  3X3M A;  3M3Y H;  2ZTC A;  2E8G A;  3RUZ A;  1K8G A;  3S9W A;  2HQL A;  1XMO L;  3I73 A;  5KYL A;  4BA1 I;  1AH9 A;  1BNZ A;  1PRT F;  1M4V A;  1TQO A;  3AYH B;  1Y1W H;  3MZ5 A;  1BKB A;  1CK1 A;  5M3F H;  4A93 G;  5I2X A;  2V4D A;  4IUQ A;  1K0S A;  4GKJ L;  1QOH A;  1ONL A;  4QCL A;  1KC8 C;  5CV9 A;  4IZ8 A;  5BR8 Q;  1SYC A;  4IJL A;  2Z4H A;  1GUO A;  1PRT B;  3J7Z C;  1PTO C;  1EQR A;  2IHE A;  3HOX G;  2JQO A;  4L63 B;  3S15 H;  3L0O A;  4OO1 I;  4QUF A;  1VQ9 A;  1TXY A;  5IE8 A;  4RCO A;  5JJI A;  3CCQ A;  1ICW A;  3SEB A;  1VQ8 A;  5DLQ E;  1HJP A;  4YHH Q;  1TWF H;  2PI2 E;  4DV6 Q;  3VA5 A;  4Y7N H;  1DOL A;  3WDN A;  1N36 L;  4IPH A;  4HID A;  4B3R Q;  2F0W A;  4C3J H;  2ZM6 L;  3FEW X;  4C3I G;  1STG A;  2N78 A;  2RCN A;  5COR A;  4GLV B;  4F87 A;  3SR1 A;  2RDH A;  3S1N B;  2Z8L A;  2I07 B;  4A3G B;  2OXP A;  5M5X H;  2DN8 A;  1Y1V B;  1OXS C;  1QNK A;  3PO2 G;  1NR2 A;  2UXC Q;  1B9M A;  2AMC B;  1QE6 A;  5JJZ A;  4PMB A;  1E2Z A;  1KIX A;  4AQY L;  2EYF A;  1L1O A;  1C4Q A;  3DM3 A;  2N88 A;  3GV3 A;  4HR7 B;  4DR6 Q;  3FVQ A;  1EIG A;  2JSO A;  1EOV A;  4A3L H;  1YHB A;  2D9U A;  2YU9 B;  1KLU D;  3FRP B;  4JI0 Q;  1W2B A;  2B63 B;  1J8I A;  5J1Z A;  1ENA A;  1TS2 A;  2R7Z B;  4OX9 L;  2KED A;  1I4P A;  4DUY Q;  1Q86 C;  4I65 A;  1YNJ C;  1ILQ A;  3L2P A;  4DAV A;  1HNZ Q;  4LFB L;  2A19 A;  3ULJ A;  4XTC S;  4Y52 H;  1AFP A;  3NUC A;  3H3V C;  2EXD A;  1YNN C;  1TR5 A;  3PUZ A;  1BF4 A;  4DR1 L;  3P7J A;  1HQR D;  3NEM A;  3Q22 A;  2J0T D;  1VQD A;  3HOZ G;  3PO3 G;  1U4P A;  2X6G A;  1KAA A;  3H0G B;  2A5H A;  1R4Q B;  1VQO A;  2MO0 A;  3ND8 A;  5C5L A;  2K14 A;  1GM5 A;  2WIN B;  3FKI G;  4OO1 G;  3N52 A;  1HQM C;  2JA7 G;  1HXY D;  4IUP A;  3GP7 A;  1EU4 A;  1EYD A;  2JA5 B;  1MKH A;  2F3W A;  4L5Q A;  4H7B A;  4HAE A;  5CMD A;  1SNC A;  3FMC A;  2EPB A;  1WJJ A;  4JG2 A;  2I5M X;  2B2U A;  4ZAI A;  1A2U A;  3NK9 A;  1WOC A;  3STB C;  4JI6 Q;  1DOM A;  1BOS A;  2F0J A;  1C7Y A;  1MJE A;  1D2B A;  1AW7 A;  4YHH L;  3S2D B;  3MWY W;  2JA8 G;  4DV1 Q;  2EY1 A;  3S17 H;  2Z0S A;  5LMN Q;  4A3J B;  4LF4 Q;  1P16 A;  3NEL A;  4RHR A;  3I55 A;  2JA6 B;  1E7Z A;  2Z6B A;  4B3R L;  5AFW A;  4UP8 A;  1N9W A;  3HOY G;  4RKB A;  2L9H A;  2B2T A;  1TWG B;  3I56 A;  2F0S A;  5C6A A;  3DLL A;  4KTA A;  3R93 A;  4XIG S;  2UXB Q;  1OXU A;  1E2V A;  2OWO A;  5EPL A;  3F2B A;  2UUC L;  2MGS A;  3GTO B;  3HOU H;  3KJP A;  3KK7 A;  3O13 A;  2VQE Q;  1KL9 A;  3K5O A;  5M5W B;  2CH4 A;  4HJA A;  5JEA G;  3J81 c;  1LAC A;  4FF1 A;  4CBV A;  2KUM A;  1SND A;  5CR3 A;  3K8A A;  3RMH A;  1M1K C;  1SMY C;  4A3B B;  3E9I A;  2CW0 D;  1YI2 A;  3E3X A;  5IT9 L;  1NTG A;  2M00 A;  1MI2 A;  3GTQ B;  2F0N A;  1RL2 A;  5E7N A;  4LF8 Q;  3VR3 A;  4OWW B;  4CKB A;  4KV6 A;  2D5D A;  3E0J A;  1LT6 D;  3PIP 3;  2NTT A;  3HZX A;  1HFN A;  2K32 A;  2DUD A;  3DHQ A;  2FHT A;  3SK6 A;  1QVC A;  4ALP A;  1UEA B;  4PQX A;  2UXD L;  2NVT H;  1UE6 A;  1I6V C;  4UP9 A;  5CV8 A;  3T1H Q;  4K8J A;  4DK0 A;  3BS1 A;  1KHI A;  1WTW A;  2HCC A;  1V9P A;  1C9O A;  2IL8 A;  1Y8P B;  4R4C A;  4X3T A;  4G7O C;  4AYB B;  2F0K A;  3KJO A;  4BXX H;  2BOS A;  5E4X A;  2Q2U A;  1EY8 A;  3C1F A;  1SDF A;  3KFU A;  1XJV A;  5D14 A;  4PV1 C;  4LF7 Q;  2BE5 D;  1EYC A;  4HCS A;  1QZH A;  4ZKC B;  4PMC A;  1OTC A;  2V1C C;  4C1N I;  1Z6H A;  2IX3 A;  4JI8 L;  3MVV A;  1CT1 D;  3ZJY C;  4JI4 L;  2YTX A;  4DV3 Q;  1YHQ A;  3S2H H;  3TBI B;  4KJO A;  2DJG C;  1SE3 A;  3HOZ H;  2K5W A;  3EVQ A;  5FKA C;  4MIU A;  4CHT B;  1DJR D;  5M3M G;  3ERQ A;  3FKI H;  4OO1 H;  2YTV A;  2VUM G;  3J81 j;  1X3G A;  1FNW A;  2IX1 A;  1AN8 A;  1Q12 A;  1MSG A;  1I3Q B;  2SDF A;  5J22 A;  1VQM A;  3A8I E;  5NUC A;  4HED A;  3DMU A;  3VYS A;  3R2T A;  1ESR A;  1YIT A;  1LTT D;  1PRT C;  1BQQ T;  3ICE A;  3CHB D;  4DK1 A;  2KCC A;  2VQF L;  3OIQ A;  2PPB C;  1V1O A;  1VCI A;  4G57 A;  2R93 H;  5IYB H;  2R6G A;  1SMX A;  1S5E D;  2YTY A;  1HNX L;  5FLX E;  1B3Q A;  3K80 C;  1PVO A;  3M4O B;  2OEO A;  1WTO A;  2H4O A;  1IL8 A;  1B9N A;  3DWQ A;  4A3F H;  1BR9 A;  5C4J H;  3H3V I;  4OWX B;  3CCS A;  1F2Y A;  5I9P A;  4WJ3 M;  1Y69 U;  1IYV A;  2I46 A;  3G6E A;  2WB1 B;  1QG7 A;  4QF4 A;  1R4P B;  4P74 A;  4RG1 A;  4GNX C;  5C0X I;  4H13 C;  1B70 B;  2NVQ H;  4LNQ A;  1PA6 A;  3T1H L;  1FJG Q;  2B2V C;  4DXG A;  2PNR C;  2Q2I A;  4DV0 Q;  3VR6 A;  1SAP A;  5CGK A;  5IT9 E;  4A3D B;  4IUT A;  3Q24 A;  3SHL A;  2PQA A;  5LHY 1;  5FLM H;  4KHZ A;  2Z9H A;  4RA8 A;  4E6I A;  2L1B A;  1VQE A;  5J3B A;  3HKZ E;  4X64 L;  5FJ8 G;  1Q1B A;  1YNJ D;  1BBU A;  5HGT A;  3OWF A;  5A35 A;  1EY7 A;  1DZ1 A;  1ASZ A;  2H1E A;  5ELB A;  2UUA Q;  4JBK A;  1CHQ D;  4A3J H;  1YNN D;  4RH6 A;  3S16 B;  1STB A;  1SRO A;  4A3M B;  2Y0S E;  3HRZ C;  4I7A A;  4K0K L;  1JOO A;  1VQ5 A;  3MC0 B;  5JPM C;  4ZRZ A;  3NTI A;  2UU9 L;  5EQ0 A;  1T5X D;  1QB5 D;  2KHS A;  2WAC A;  3ERO A;  4K5V A;  1H9K A;  4NPS A;  4U67 3;  5M5W H;  3NQT A;  4CDF C;  3CQZ H;  1Y1W G;  1H9M A;  3PF5 A;  1E0B A;  1IHZ A;  5M3F G;  1KRT A;  3GTM B;  2LFN A;  1G2S A;  1JWU D;  2L12 A;  5T1I A;  3T51 B;  1VMC A;  3LNN A;  3UDX A;  2BDO A;  3F8T A;  1SSO A;  2RHS B;  2PMZ B;  1KXL A;  1A3T A;  1SYE A;  2E74 C;  2HIV A;  4CKC A;  1AP0 A;  4JVZ A;  3OW7 A;  4NW2 A;  1WTR A;  5IT9 c;  2QEX A;  4LUV A;  3GTQ H;  3STB D;  3K5N A;  4K8I A;  3CAM A;  1S5C D;  5IGE A;  3PIP A;  4POG A;  1O7L A;  2X6L A;  3MAQ A;  1GUW A;  1I5F A;  3KLR A;  4JI5 Q;  2B2W A;  1UE7 A;  3MEF A;  5I9O A;  4IPD A;  5C3W A;  1DYQ A;  4JI3 Q;  4H02 A;  4C2M B;  2K50 A;  3I72 A;  1U4R A;  1STH A;  3V2T A;  5C0X G;  1XMO Q;  2ES2 A;  1IBM L;  3H15 A;  4FF3 A;  1IKL A;  4ID6 A;  1I50 H;  3DWP A;  1XTC D;  5ISR A;  4FXD A;  1KAW A;  2R92 B;  1JOR A;  1J6Q A;  4C3J G;  2B2Y A;  4WFN 3;  1RHP A;  2Q2H A;  3MXG A;  5D3I B;  1XNQ L;  4ZUI A;  1VQ4 A;  4GKJ Q;  2F0T A;  3DUZ A;  2LXK A;  4A3E G;  5JEA J;  1DCZ A;  1QVG A;  1SNO A;  2TMP A;  5M5Y H;  1Z9F A;  1IYU A;  3I4M B;  4BBS B;  3UDF A;  1WTV A;  1CZW A;  3GTJ B;  4R8N A;  3WWV A;  4A3C H;  1HA5 A;  4PG3 A;  1DOK A;  1SNP A;  3FP9 A;  4Q0F A;  4GKK Q;  4I7Z C;  3NQI A;  1H9R A;  2LSS A;  1JE5 A;  2UUB L;  1KAB A;  1PMR A;  4A3I H;  3IKJ A;  3P75 A;  5JOB A;  3C3L A;  3MXU A;  2NYZ D;  3JAM L;  2HIX A;  2GVA A;  5JPN C;  4A3L G;  1P8L A;  4RMF A;  4XYQ A;  4DV2 L;  4KKS A;  3N6R A;  5E4W C;  1RD9 D;  4IO9 A;  4DNT B;  2UUA L;  2N8N A;  1TS3 A;  4M1U B;  4B3T L;  2ENB A;  4CDE C;  2QDB A;  3P1H A;  2EJM A;  2E5L L;  4JV5 L;  1N36 Q;  3D0F A;  3QWN A;  3GO5 A;  2ZM6 Q;  3I4N B;  3M4Q A;  2ZJR A;  1HFG A;  1CSQ A;  1TWA H;  1PTO H;  3CCR A;  4TKO B;  4L5S A;  1J9O A;  2HCI A;  2PZU A;  2Z1C A;  3W5O A;  3AFP A;  4DAY A;  2HT1 A;  1K9M C;  2AHO B;  1TII D;  2Z4I A;  3HEJ A;  4K5X A;  3VR2 A;  4AQY Q;  2PQA B;  2QEJ C;  2VW9 A;  1JIC A;  1L1O C;  2F0V A;  1PH9 A;  2K33 A;  4GLX A;  5ELE A;  3EBE A;  4N8F A;  2K5V A;  2VY3 A;  3K7A H;  4X66 Q;  3J81 L;  4QMG A;  1SBB B;  3TN2 A;  4Z9C B;  3BU2 A;  1S5F D;  2CFM A;  4RGM A;  2WB1 E;  1E2W A;  3QB3 A;  3Q23 A;  3RR5 A;  3A7L A;  1MD2 D;  5C4X G;  1D1I A;  4PNY A;  4OX9 Q;  4JCV E;  3ERS X;  1WTP A;  1PHJ A;  5E3F A;  2M2L A;  4BY7 H;  4ZLT F;  4DR4 L;  4X62 L;  3A55 A;  1VQP A;  2EYO A;  4JI3 L;  4LFB Q;  3SGI A;  3HOX B;  1X55 A;  3Q8D A;  2L4N A;  5DEH A;  1LT4 D;  4YWK A;  3CCL A;  2N55 A;  4DR1 Q;  3GV6 A;  4GN3 B;  2WKD A;  1HTL D;  3WOF A;  3I3C A;  5C44 G;  1PYB A;  1FVI A;  2EVB A;  1WD0 A;  3E6Z X;  2IT1 A;  4JYA L;  3CC7 A;  1B44 D;  1LV9 A;  1JE4 A;  3Q6S A;  1RIP A;  3CF5 A;  3K5L A;  1G6Z A;  1G6P A;  1Q81 C;  4DNI A;  3HOU G;  3D6W A;  4GKK L;  3W1G A;  4KD4 A;  1PRT D;  3BVG A;  1TWC B;  4C3I B;  1TS5 A;  1CZG A;  4CDD C;  4DV5 L;  2EQS A;  4OEM B;  3UE1 A;  3H3V H;  3S1M H;  4NB3 A;  3GD7 A;  3ONA B;  3S1Q B;  2B2U C;  2EJF C;  1MIU A;  5G3L F;  1ASY A;  3PO2 B;  1SJH D;  4YIJ A;  3GTK H;  4DV7 L;  4IOA A;  2F0D A;  3IFT A;  3B6Y A;  5C0X H;  3KF6 A;  2BH8 A;  1LT3 D;  3I91 A;  1IKM A;  1XPO A;  3RZO H;  2RA4 A;  1D5Z C;  1VQJ A;  4KY7 A;  2LS0 1;  2PMZ E;  4B08 A;  4GNX B;  4IFD I;  1D7Q A;  3X3N A;  1K28 A;  1KLG D;  4C3H H;  5IP9 H;  2B2T C;  4A3E H;  4F7X A;  3J80 c;  5IWA L;  3M9B A;  3SE0 A;  2UUC Q;  3MFY A;  5C5M A;  3HOW B;  1RTO A;  1VQA A;  1X6O A;  3NTK A;  2OT2 A;  3I7F A;  4LUZ A;  1SE8 A;  2CQO A;  2E2J B;  1X54 A;  5ELC A;  1TY2 A;  1EOT A;  2DY7 A;  4APV A;  3F2C A;  1F2Z A;  4A76 A;  1XYI A;  2ASB A;  5L37 A;  1RTN A;  3TP8 A;  3JAM E;  1V1Q A;  2L5T A;  4A4I A;  3HOV B;  4UAI A;  2J7Z A;  2RSN A;  4P75 A;  2ZT9 C;  4X66 L;  1AZQ A;  3PO3 B;  5EPJ A;  1H95 A;  3EA6 A;  2B8F A;  4BXX G;  1HA6 A;  1A0I A;  4OEL B;  4MZ9 A;  5ELD A;  2PZT A;  5LL6 S;  3OIP A;  1ZEQ X;  3W2D A;  2CCZ A;  1OO9 B;  3FHW A;  2JA7 B;  4ZKB B;  4UPA A;  5C4Z A;  1JWS D;  1EU3 A;  3EFX D;  3ULL A;  1F77 A;  3D6C A;  2F52 A;  4H44 C;  1SFO B;  3AMU A;  1VF5 C;  3NTH A;  3GTL H;  4N9T A;  4L6T B;  1EQQ A;  3A8K E;  4DAY B;  4XDX A;  2DY8 A;  4B3M L;  4GS3 A;  4BBS H;  4EQN A;  1O7Y A;  4A3G G;  2UXD Q;  3K59 A;  4RGO S;  1EWC A;  4F8M A;  1JMC A;  1GD7 A;  3J81 E;  1VQN A;  1EY4 A;  2JA8 B;  5AJ3 L;  3OWE B;  1T5E A;  2EOT A;  2CWP A;  4L5T A;  4MN3 A;  2KVM A;  2WV6 D;  3HOY B;  3JAM c;  5C3E B;  1JT8 A;  4Q5V A;  3PIO A;  5C4X H;  1HH2 P;  3KDF A;  1BUV T;  1DGS A;  2B63 G;  1X9N A;  3C2P A;  3I8Z A;  1PFN A;  2G5D A;  2ZJQ A;  4JI8 Q;  5I2Y A;  2GA4 B;  1AZP A;  2O5I C;  1JOK A;  2NVY H;  2JXM B;  5IYB G;  4JI4 Q;  5C0X J;  5CYU A;  2R93 G;  4BY1 H;  2FXQ A;  2E2H B;  2NB0 A;  2VS1 A;  4X3U A;  3NWT A;  2NVX H;  4FNF A;  2F0P A;  3TZD A;  5C44 H;  2D0O A;  2HHH L;  4A3F G;  1R9T B;  3E5S A;  2E75 C;  1CTM A;  3TP7 A;  3U4V A;  2BA1 A;  3HKZ B;  4WJW A;  4DKA C;  1J5E L;  1SYG A;  2WAQ G;  4DR7 L;  2F4I A;  2HDL A;  5JVG 3;  4ZCK A;  1HCZ A;  4YWL A;  1XWE A;  1TKW B;  4R4T A;  1K83 B;  1C48 A;  3M4Y A;  3KF8 A;  2Y0S B;  3RLN A;  1I94 Q;  2JA5 G;  1A62 A;  3JAM i;  2FIN B;  1I4H A;  3HP3 A;  5JVH 3;  2XRQ D;  2VQF Q;  5FLM G;  3TS0 A;  2Z6K C;  3I4L A;  3M7G A;  3A5U A;  5IYC H;  2F0O A;  1HNX Q;  1KNA A;  4BBR B;  1B3A A;  2KEE A;  4OGQ C;  4DUZ L;  4TRD A;  1Q46 A;  5EAY A;  3K57 A;  4EQ5 A;  5GRO A;  4EQP A;  4A3J G;  4P71 A;  3UDG A;  4ME3 A;  1MHW C;  2WP8 J;  1Q82 C;  2G9H D;  2HDM A;  3TP6 A;  2EE1 A;  4QL5 A;  4JI7 L;  4FF4 A;  4HCE A;  4ULL A;  3VYT A;  3CC2 A;  1L1O B;  2DNE A;  3FPU B;  1FL0 A;  1BCP F;  3CRK C;  4R4I A;  2N49 A;  1EY9 A;  3QG1 A;  3AFQ A;  1SNM A;  3Q0A A;  3J81 i;  1RKN A;  1CSP A;  5KRU A;  4JI2 L;  2KEN A;  1IZ6 A;  1ENC A;  1JCK B;  2CVR A;  2PQE A;  2G9D A;  5GAD C;  1FD7 D;  5M3M B;  1A8V A;  1IBK L;  2Q8R E;  3L9A X;  3BYT B;  4X64 Q;  4A3B G;  1FR3 A;  1WI5 A;  1YJ9 A;  1B2T A;  2VUM B;  3G7L A;  4L8J A;  4NP5 A;  1SNQ A;  5F2D A;  2TSS A;  1LT5 D;  1K3R A;  4ILW A;  2XTI A;  1PYS B;  5A2Q L;  2KOL A;  3HGB A;  4QY7 A;  3SK4 A;  3ULP A;  1S40 A;  2E2D C;  4DV4 L;  4IPG A;  4XT3 B;  2ZJP A;  1F9Q A;  2E2I B;  3A54 A;  2EYL A;  4K0K Q;  5JJK A;  1I4X A;  2IX0 A;  3S1N H;  2JYO A;  2UU9 Q;  2MJ8 A;  4DAP A;  2EZV A;  4A3G H;  1HZB A;  3NBH A;  1Y1V H;  4XXE A;  1SE4 A;  1QIL A;  1WYD A;  4CDC C;  3VA7 A;  4K6D A;  3HOV H;  3T4A C;  1PTO F;  2FMM A;  2MFI A;  3D4W A;  2NUC A;  1I6H B;  2K5Q A;  3TRZ A;  3K5M A;  3A56 A;  4A3K B;  1I94 L;  2YU9 H;  3KDF B;  4AYB G;  1OXT A;  4DR3 L;  2B63 H;  1FGB D;  2BDN A;  5IOD A;  4A3C G;  4XQN A;  2ICE C;  1RF2 D;  2R7Z H;  3CKI B;  3CXC A;  4LFA Q;  4AIM A;  1W3S A;  4LWC A;  1UAP A;  4ZQ3 A;  3GDE A;  4IFD H;  2Z6K A;  3NXW A;  2EXZ A;  2NWG A;  4A3I G;  4KI0 A;  2SOB A;  4LJZ C;  1VDZ A;  3RD4 A;  4EX5 A;  2B2W C;  3SVM A;  3BVM A;  2IJ0 A;  5IP7 G;  1D1K A;  2VB3 X;  5FO8 B;  1PZI D;  2O5J C;  1IBM Q;  2C35 B;  3H0G H;  2AQ2 B;  2IW3 A;  1XTD A;  5CV4 A;  2OTL A;  1PZK D;  2F0U A;  4ZUJ A;  1HUN A;  2F0I A;  3QOL A;  1KTK A;  4XQJ A;  1YJW A;  2B8G A;  3PUX A;  2B2Y C;  1ZXT A;  1XNQ Q;  1HZA A;  1KRS A;  4QGU A;  1VMP A;  2RDG A;  3U9S A;  3RZD B;  3KF8 B;  1PH1 A;  2XIW A;  1LTB D;  2JA5 H;  1HZC A;  4CJ2 C;  1VQK A;  1HUM A;  3TDQ A;  5C3E H;  1ENF A;  2WKC A;  1C8C A;  4JI1 L;  5DAU A;  3S14 B;  5C3X A;  1UEB A;  2AUK A;  3M3Y B;  3FDT A;  4IUR A;  5BN3 A;  4P2C B;  1PH7 A;  1ZYR C;  2UUB Q;  5GAG C;  3U50 C;  5I6Y A;  4HIK A;  4CGY B;  1WCM B;  2PO4 A;  1Y1W B;  1EEF D;  3QR8 A;  1QZG A;  5M3F B;  1LAB A;  3IRB A;  4DV2 Q;  2F0F A;  3OSO A;  4V19 0;  3S2D H;  4OHJ A;  1B7Y B;  4B3T Q;  2R3Z A;  2WFW A;  3G48 A;  2XGT A;  2JA6 H;  1CUK A;  5LL6 X;  1VF7 A;  2J4X A;  1NE3 A;  1Q8I A;  1QJO A;  1TWG H;  2XN9 C;  3CCJ A;  1S72 A;  2E5L Q;  4BY7 G;  4JV5 Q;  2IPK D;  1LTI D;  1LM0 A;  3S15 B;  3NP8 A;  3GTO H;  1UE5 A;  4UHV A;  3LGJ A;  4M8A A;  5KNB A;  3P20 A;  1JB3 A;  1K83 H;  2K5N A;  1TY0 A;  1JJG A;  1SYB A;  4DR5 Q;  2ICI A;  2D0P A;  2K05 A;  1Q7Y C;  1UNS A;  3BDL A;  4J8Q A;  4KY5 A;  3J80 L;  4GOP A;  3IAY A;  3CCU A;  3E0E A;  2A74 C;  4FF2 A;  4TVA B;  3VR4 A;  4B3S Q;  5JAV A;  3M7N A;  2QIL A;  2O4X A;  2F0L A;  1UWV A;  2KJX A;  4HJ8 A;  4UY8 C;  3VR5 A;  1IW7 C;  4A3B H;  3S1R B;  4PZ7 A;  4C3J B;  1BDO A;  1VQH A;  2NZO A;  3GTP B;  3I90 A;  3OYY A;  4LFA L;  1A63 A;  4JK1 C;  4DK3 C;  4BBR H;  4KKU A;  1Y8O B;  1U4M A; 
#chains in the Genus database with same CATH homology
 3TME A;  2JEA I;  4G4K A;  3TZU A;  3H09 A;  5M5X B;  1TVX A;  3J7Y W;  4H0L C;  1LTS D;  3WOE A;  1X3Q A;  2A6E D;  2K7V A;  2RDF A;  5KEE A;  3LWU A;  1ESF A;  5CBA E;  2FJ2 A;  3NHH A;  1O78 A;  2EYM A;  1GUN A;  4IN3 A;  1NAP A;  4C3H G;  4KN4 C;  1PDQ A;  1S5B D;  4ABN A;  5COY A;  5KND A;  2A68 C;  3IL8 A;  2A69 C;  5ELF A;  2F0Q A;  2A6H C;  2JE6 I;  3R3O A;  5EGT A;  5CC4 A;  5FO7 B;  3QO2 A;  3NSW A;  2LMC B;  1BO0 A;  3PIO 3;  3K58 A;  3A8J E;  1TU2 B;  4OIJ A;  3DXJ C;  2RKS A;  2K1B A;  1PZJ D;  4G7H C;  4XYO A;  2QCP X;  1SE2 A;  3PUW A;  2M9V A;  3HS0 C;  2XWJ B;  2HQE A;  2C9O A;  2NBF A;  1UUP A;  5FO9 B;  1F9P A;  3T53 B;  2RSO A;  2KCN A;  3MTS A;  3H94 A;  3S17 B;  2ID0 A;  5FK9 C;  4KD3 A;  2ZXR A;  1V8Q A;  4A93 B;  2NN6 I;  2SNM A;  5EJW A;  4J1M A;  1RCV D;  4B9W A;  4DN4 M;  4FP5 D;  5EKK A;  3HOU B;  1II3 A;  1PYW D;  2HUG A;  2K01 A;  4C1N K;  3QJY A;  3DEP A;  1LO5 D;  3TP5 A;  4IAL A;  2O2L D;  4XT1 B;  1U9R A;  2EYJ A;  2PW5 A;  2L55 A;  3J80 E;  2X69 A;  1WD1 A;  4DU9 A;  4NKL A;  1X3P A;  5EKL A;  5CBE E;  2FMC A;  3GTG B;  4NMZ A;  4HMJ A;  1DXM A;  4LK1 C;  1EY6 A;  3MA2 B;  1QNU A;  1NSN S;  4ZK9 B;  2SNS A;  4KN7 C;  1CA6 A;  3C46 A;  4J6H A;  3OPO A;  4FYD A;  2L0C A;  3GQB A;  1GXD C;  3H6M A;  1I4R A;  2NVT B;  5TSS A;  5IGF A;  3FPP A;  4RGN A;  1F2L A;  4FXK C;  5EPK A;  3T13 A;  2NTS A;  1NR4 A;  1SXT A;  1OXV A;  3U9O A;  2A73 B;  2RQX A;  2PCF B;  3A7A B;  5G3L D;  4F88 A;  2L11 A;  3D3R A;  2VXW A;  1RDP D;  4KKT A;  4KY6 A;  1EZ6 A;  1F2M A;  5IOC A;  5K5P A;  2NN6 G;  3KUP A;  1ZYR D;  1ET6 A;  5J39 A;  5T1G A;  1G2T A;  2D62 A;  2B39 A;  3URY A;  1GUS A;  1RJT A;  1L0Y B;  1H9S A;  3S2H B;  2EYH A;  1LTG D;  1KDC A;  4FXG C;  1GHJ A;  3HOZ B;  4EVO A;  1LTR D;  1FNV A;  4IUV A;  2R61 A;  1Y8N B;  5FOB B;  1STE A;  2AUJ D;  3J7A V;  1CQF A;  4CKE A;  3FKI B;  2WII B;  3EQL C;  4DF7 A;  1JOQ A;  3DM1 A;  2AQ3 B;  5EKI A;  1KDA A;  1AEX A;  3KLS A;  1CM9 A;  3D4R A;  3R8B A;  4O1N A;  3T16 A;  1EL0 A;  3QIA A;  1EZ8 A;  2EY6 A;  2VB2 X;  2KQ3 A;  4KHV A;  1EYA A;  1GOZ A;  3VYR A;  1SYD A;  1HTP A;  4IQZ A;  3SK8 A;  2R93 B;  4DA2 A;  5DM7 3;  4MHE A;  3PMF A;  1IW7 D;  2D2C C;  2Q8T A;  3K0Y A;  4BA2 I;  4A3F B;  5C4J B;  1MSH A;  3CU7 A;  2WAQ B;  3D4D A;  3L7Z C;  2RVL A;  4HSV A;  5BN5 A;  3PUY A;  4FO2 A;  1STN A;  4IFD G;  2NVQ B;  4TSS A;  3KLS X;  1GUG A;  3G6J B;  3MHB A;  1BXT A;  5C4H A;  2A6E C;  1NCV A;  1O80 A;  1SJE D;  1B4O A;  4RCN A;  3AB9 A;  3RLF A;  2F1M A;  4PMW A;  1Z47 A;  2A68 D;  4NDX A;  2A69 D;  1V1P A;  2ZXP A;  2A6H D;  2XWB B;  1A6X A;  5FLX L;  4GZY C;  3M85 A;  2BA0 A;  3MEH A;  2MPM A;  4HSP A;  1GJX A;  1TT2 A;  1JWM D;  3DEO A;  1XX8 A;  4RFB A;  2AWN A;  2ZXO A;  3CQZ B;  2Q8I B;  1D5M C;  4C56 C;  1EWH A;  2KA7 A;  4KJN A;  1EQT A;  3H91 A;  4B9X A;  5K36 G;  1I4G A;  1PLF A;  5M9O A;  1W6K A;  2VNU D;  5HUR A;  4IUN A;  2K28 A;  1JC7 A;  1BBX C;  3OHX C;  2NN6 H;  3I70 A;  5CV6 A;  1H9S B;  1O7Z A;  3MXN A;  1DD2 A;  2MP1 A;  1ZKO A;  4KMU C;  3TSS A;  2PW7 A;  1KNE A;  3OMG A;  5KGU A;  1F9S A;  1D5X C;  1I50 B;  3F2U A;  3EJI A;  1BCP B;  3BDC A;  1BCP D;  1FNU A;  2XNA C;  3D8G A;  3J7A F;  4OIK A;  5M5Y B;  1H9J A;  1B1Z A;  2K6A A;  4XQQ A;  1Q3L A;  4V0B A;  4ME5 A;  1ET9 A;  2SEB D;  4A3I B;  4CJ0 B;  3LWE A;  3UI2 A;  2E76 C;  1JQY D;  4ZYS A;  3SXH A;  4QUC A;  1PFB A;  4RWS C;  3R2I A;  1KDB A;  5D3D A;  2EY2 A;  3ND9 A;  1I4Q A;  1TWA B;  1PTO B;  4RAU C;  1PTO D;  1TWH B;  1STY A;  4IUU A;  4DXF A;  1EFI D;  2F0H A;  3ZYY X;  5EBC A;  1K8O A;  1DON A;  4CJ1 B;  2BCO A;  1WVL A;  5IGG A;  2F0E A;  3K7A B;  1MGS A;  2JP1 A;  5BN4 A;  1V1P B;  2CQA A;  4RGT A;  4JBW A;  5DM6 3;  3PUV A;  2YYZ A;  1A2T A;  5KNC A;  4X3K A;  4BY7 B;  3L3O C;  1ILP A;  3AU7 A;  1Q90 A;  1HHV A;  1K8M A;  4R9W A;  4RKL A;  1A3V A;  5JEA H;  1S5D D;  4BS9 A;  1G8Z D;  2F0G A;  2EY5 A;  5IGD A;  5K36 H;  4ODG A;  2XRS D;  3BG3 A;  4RHS A;  4QB4 A;  1CFM A;  5I6W A;  2LKV A;  1D6E C;  2FFK B;  3D31 A;  3OMC A;  1NUC A;  3NPP A;  2IWH A;  1DM0 B;  2EJG C;  2QF7 A;  2OF1 A;  2XVS A;  3QOJ A;  3S1M B;  2PZW A;  1QCB D;  5IGB A;  3GTK B;  4O42 A;  3KBX A;  1TWF B;  4K14 A;  4Y7N B;  3RZO B;  1MBY A;  5A2Q E;  5E1F A;  4C3H B;  1GHK A;  1A3U A;  1EY0 A;  1SEB D;  2LY7 A;  3V96 A;  1LLR D;  4A3E B;  3IFD A;  4IFD J;  1G91 A;  3SDZ A;  5IGC A;  4EQO A;  4N9P A;  1CHP D;  2MHV A;  3CRL C;  1CA5 A;  4WRD A;  4K2L A;  2XSC A;  2K03 A;  3LX0 A;  3MFG A;  1WTX A;  3OOC A;  3ITP A;  4HTH A;  4EGV A;  2K04 A;  3BVZ A;  2C5C A;  2DNC A;  2F3V A;  1Z7T A;  4WOR A;  1CI3 M;  1HRJ A;  4DNR B;  3SK5 A;  2AQ1 B;  3T56 B;  3W3A A;  4DGZ A;  5I4D A;  5IIF A;  1F9R A;  3KBG A;  3MXP A;  2K5D A;  3NE5 B;  2AWO A;  1B50 A;  4S3S A;  4K5W A;  3GTL B;  1A15 A;  2CHB D;  1S4Z A;  5KIX A;  5KYI A;  5EBD A;  1PFM A;  2B2V A;  5CV5 A;  4U68 A;  1EY5 A;  3BZD B;  3BDO A;  3HG9 A;  4FVM A;  1SMY D;  3K6O A;  4K6L A;  3DWA A;  2F03 A;  1SYF A;  4QIW B;  1W6J A;  2EYP A;  3C1E A;  1U4L A;  3VYU A;  5C4X B;  4UDU C;  4TQU S;  1ML0 D;  1EQV A;  1WTQ A;  1JR0 D;  1LTA D;  3NWS A;  2CW0 C;  2QKI C;  3BYY B;  5DNF A;  1CQV A;  4G7Z C;  1FYC A;  2NVY B;  1X32 A;  4BY1 B;  2PYK A;  2F0M A;  4LMQ D;  4X3S A;  2NVX B;  1EEI D;  2NZ1 D;  5C44 B;  5CV7 A;  4HN7 A;  1Q1E A;  4DFA A;  3NBI A;  4BWG B;  1XXG A;  2EDG A;  4K2K A;  1EIH A;  1BCP C;  2JEB I;  1QWY A;  1V43 A;  4OL7 A;  1TS4 A;  2RBM A;  3PV0 A;  1M8A A;  4HMI A;  1L0X B;  5D65 A;  4LAA A;  3V05 A;  2KEC A;  1OXX K;  1B53 A;  2BE5 C;  1G29 1;  1ROD A;  1STA A;  1GUT A;  4KK7 A;  1PXU A;  2MUY A;  1HPC A;  4R8I A;  3X3M A;  3RUZ A;  3S9W A;  3I73 A;  5KYL A;  4BA1 I;  1BNZ A;  1PRT F;  1M4V A;  1TQO A;  3MZ5 A;  1CK1 A;  5I2X A;  2V4D A;  4IUQ A;  1QOH A;  1ONL A;  4QCL A;  5CV9 A;  4IZ8 A;  1SYC A;  2Z4H A;  1GUO A;  1PRT B;  1PTO C;  4L63 B;  4OO1 I;  4QUF A;  4RCO A;  1ICW A;  3SEB A;  3VA5 A;  1DOL A;  3WDN A;  2F0W A;  3FEW X;  4C3I G;  1STG A;  5COR A;  4F87 A;  3SR1 A;  2RDH A;  3S1N B;  2Z8L A;  2I07 B;  4A3G B;  2OXP A;  2DN8 A;  1Y1V B;  1OXS C;  1QNK A;  1NR2 A;  1B9M A;  1QE6 A;  5JJZ A;  4PMB A;  1E2Z A;  2EYF A;  1C4Q A;  2N88 A;  3GV3 A;  4HR7 B;  3FVQ A;  1EIG A;  2JSO A;  2D9U A;  2YU9 B;  1KLU D;  3FRP B;  2B63 B;  1J8I A;  5J1Z A;  1ENA A;  1TS2 A;  2R7Z B;  2KED A;  1I4P A;  4I65 A;  1YNJ C;  1ILQ A;  4DAV A;  1AFP A;  4XTC S;  3NUC A;  3H3V C;  1YNN C;  1TR5 A;  3PUZ A;  1BF4 A;  3P7J A;  1HQR D;  3Q22 A;  2J0T D;  1U4P A;  2X6G A;  1KAA A;  3H0G B;  2A5H A;  1R4Q B;  3ND8 A;  5C5L A;  2WIN B;  4OO1 G;  3N52 A;  1HQM C;  1HXY D;  4IUP A;  3GP7 A;  1EU4 A;  1EYD A;  2JA5 B;  2F3W A;  4H7B A;  4HAE A;  5CMD A;  1SNC A;  3FMC A;  2EPB A;  2B2U A;  4ZAI A;  1A2U A;  3NK9 A;  1DOM A;  1BOS A;  2F0J A;  1D2B A;  1AW7 A;  3S2D B;  3MWY W;  2EY1 A;  4A3J B;  4RHR A;  2JA6 B;  5AFW A;  4RKB A;  2L9H A;  2B2T A;  1TWG B;  2F0S A;  5C6A A;  4KTA A;  3R93 A;  4XIG S;  1OXU A;  1E2V A;  5EPL A;  3GTO B;  2MGS A;  3KK7 A;  3O13 A;  3K5O A;  5M5W B;  5JEA G;  1LAC A;  4FF1 A;  4CBV A;  2KUM A;  1SND A;  5CR3 A;  3RMH A;  1SMY C;  4A3B B;  2CW0 D;  5IT9 L;  2M00 A;  1MI2 A;  3GTQ B;  2F0N A;  3VR3 A;  4CKB A;  4KV6 A;  2D5D A;  3E0J A;  1LT6 D;  3PIP 3;  2NTT A;  3HZX A;  1HFN A;  2K32 A;  3DHQ A;  2FHT A;  3SK6 A;  1UEA B;  4PQX A;  1I6V C;  5CV8 A;  4K8J A;  4DK0 A;  3BS1 A;  1WTW A;  2HCC A;  2IL8 A;  1Y8P B;  4G7O C;  4X3T A;  4AYB B;  2F0K A;  2BOS A;  5E4X A;  1EY8 A;  3C1F A;  1SDF A;  5D14 A;  4PV1 C;  2BE5 D;  1EYC A;  4HCS A;  4ZKC B;  4PMC A;  4C1N I;  1Z6H A;  2IX3 A;  3MVV A;  1CT1 D;  3TBI B;  4KJO A;  1SE3 A;  2K5W A;  3EVQ A;  5FKA C;  4MIU A;  4CHT B;  1DJR D;  3ERQ A;  4OO1 H;  2IX1 A;  1FNW A;  1AN8 A;  1Q12 A;  1MSG A;  1I3Q B;  2SDF A;  5J22 A;  3A8I E;  5NUC A;  4HED A;  3DMU A;  3VYS A;  3R2T A;  1ESR A;  1LTT D;  1PRT C;  1BQQ T;  3CHB D;  4DK1 A;  2KCC A;  3OIQ A;  2PPB C;  1V1O A;  1VCI A;  4G57 A;  2R6G A;  1S5E D;  5FLX E;  3M4O B;  2OEO A;  1WTO A;  2H4O A;  1B9N A;  1IL8 A;  3DWQ A;  1BR9 A;  1F2Y A;  5I9P A;  1Y69 U;  1IYV A;  2I46 A;  2WB1 B;  1QG7 A;  4QF4 A;  1R4P B;  5C0X I;  4H13 C;  2B2V C;  4DXG A;  2PNR C;  3VR6 A;  1SAP A;  5CGK A;  5IT9 E;  4A3D B;  4IUT A;  3Q24 A;  3SHL A;  5LHY 1;  4KHZ A;  4E6I A;  4RA8 A;  2L1B A;  1Q1B A;  1YNJ D;  5HGT A;  3OWF A;  5A35 A;  1EY7 A;  1DZ1 A;  2H1E A;  5ELB A;  1CHQ D;  1YNN D;  4RH6 A;  3S16 B;  1STB A;  4A3M B;  3HRZ C;  1JOO A;  3MC0 B;  5JPM C;  4ZRZ A;  3NTI A;  5EQ0 A;  1T5X D;  1QB5 D;  2KHS A;  2WAC A;  3ERO A;  4K5V A;  1H9K A;  4U67 3;  3NQT A;  1H9M A;  1E0B A;  1IHZ A;  3GTM B;  2LFN A;  1G2S A;  1JWU D;  2L12 A;  5T1I A;  3T51 B;  1VMC A;  3LNN A;  2BDO A;  1SSO A;  2PMZ B;  1A3T A;  1SYE A;  2E74 C;  4CKC A;  1AP0 A;  3OW7 A;  4NW2 A;  1WTR A;  3K5N A;  4K8I A;  1S5C D;  5IGE A;  1O7L A;  2X6L A;  3MAQ A;  1GUW A;  3KLR A;  2B2W A;  5I9O A;  5C3W A;  1DYQ A;  4C2M B;  3I72 A;  1U4R A;  1STH A;  3V2T A;  5C0X G;  4FF3 A;  1IKL A;  4ID6 A;  3DWP A;  1XTC D;  5ISR A;  4FXD A;  2R92 B;  1JOR A;  4C3J G;  2B2Y A;  4WFN 3;  1RHP A;  3MXG A;  5D3I B;  4ZUI A;  2F0T A;  3DUZ A;  5JEA J;  1DCZ A;  1SNO A;  2TMP A;  1IYU A;  3I4M B;  4BBS B;  1WTV A;  1CZW A;  3GTJ B;  4R8N A;  1HA5 A;  4Q0F A;  1DOK A;  1SNP A;  4I7Z C;  3NQI A;  1H9R A;  1KAB A;  1PMR A;  3IKJ A;  3P75 A;  5JOB A;  3C3L A;  3MXU A;  2NYZ D;  3JAM L;  5JPN C;  4XYQ A;  4KKS A;  3N6R A;  5E4W C;  1RD9 D;  4DNT B;  1TS3 A;  4M1U B;  2ENB A;  2QDB A;  3P1H A;  2EJM A;  3QWN A;  3GO5 A;  3I4N B;  1HFG A;  1PTO H;  4TKO B;  1J9O A;  2HCI A;  2PZU A;  2Z1C A;  4DAY A;  1TII D;  2Z4I A;  3HEJ A;  4K5X A;  3VR2 A;  2QEJ C;  1JIC A;  2F0V A;  2K33 A;  5ELE A;  3J81 L;  4QMG A;  3TN2 A;  1SBB B;  4Z9C B;  1S5F D;  4RGM A;  1E2W A;  3QB3 A;  3Q23 A;  3A7L A;  1MD2 D;  1D1I A;  4PNY A;  1WTP A;  5E3F A;  2M2L A;  4ZLT F;  3A55 A;  2EYO A;  3HOX B;  2L4N A;  5DEH A;  1LT4 D;  2N55 A;  3GV6 A;  2WKD A;  1HTL D;  3WOF A;  3I3C A;  2EVB A;  1WD0 A;  3E6Z X;  2IT1 A;  1B44 D;  1LV9 A;  1JE4 A;  3Q6S A;  3K5L A;  1G6Z A;  3D6W A;  4KD4 A;  1PRT D;  3BVG A;  1TWC B;  4C3I B;  1TS5 A;  1CZG A;  3GD7 A;  3ONA B;  3S1Q B;  2B2U C;  2EJF C;  5G3L F;  3PO2 B;  1SJH D;  4YIJ A;  2F0D A;  3IFT A;  5C0X H;  3I91 A;  1LT3 D;  1IKM A;  2RA4 A;  1D5Z C;  4KY7 A;  2LS0 1;  4B08 A;  4IFD I;  3X3N A;  1KLG D;  2B2T C;  4F7X A;  3SE0 A;  3MFY A;  5C5M A;  3HOW B;  1RTO A;  3NTK A;  2OT2 A;  2E2J B;  5ELC A;  1TY2 A;  1EOT A;  2DY7 A;  1XYI A;  1F2Z A;  1RTN A;  3TP8 A;  3JAM E;  2L5T A;  3HOV B;  4UAI A;  2J7Z A;  2RSN A;  2ZT9 C;  1AZQ A;  3PO3 B;  5EPJ A;  3EA6 A;  2B8F A;  1HA6 A;  5ELD A;  2PZT A;  5LL6 S;  3OIP A;  1ZEQ X;  3W2D A;  1OO9 B;  2JA7 B;  4ZKB B;  5C4Z A;  1JWS D;  1EU3 A;  3EFX D;  1F77 A;  3D6C A;  4H44 C;  1SFO B;  3AMU A;  1VF5 C;  3NTH A;  4N9T A;  4L6T B;  3A8K E;  4XDX A;  2DY8 A;  4EQN A;  1O7Y A;  3K59 A;  4RGO S;  1EWC A;  4F8M A;  3J81 E;  1EY4 A;  2JA8 B;  3OWE B;  1T5E A;  2EOT A;  4MN3 A;  2KVM A;  2WV6 D;  3HOY B;  5C3E B;  4Q5V A;  1BUV T;  3C2P A;  3I8Z A;  1PFN A;  5I2Y A;  2GA4 B;  1AZP A;  2O5I C;  1JOK A;  2JXM B;  5C0X J;  5CYU A;  2E2H B;  2NB0 A;  4X3U A;  3NWT A;  4FNF A;  2F0P A;  3TZD A;  1R9T B;  3E5S A;  2E75 C;  1CTM A;  3TP7 A;  2BA1 A;  3HKZ B;  4WJW A;  1SYG A;  2F4I A;  2HDL A;  5JVG 3;  1HCZ A;  1XWE A;  1TKW B;  1K83 B;  1C48 A;  3M4Y A;  3KF8 A;  2Y0S B;  2FIN B;  1I4H A;  3HP3 A;  5JVH 3;  2XRQ D;  3I4L A;  3M7G A;  2F0O A;  1KNA A;  4BBR B;  1B3A A;  2KEE A;  4OGQ C;  4TRD A;  3K57 A;  4EQP A;  2WP8 J;  2G9H D;  2HDM A;  3TP6 A;  2EE1 A;  4FF4 A;  4HCE A;  4ULL A;  3VYT A;  2DNE A;  3FPU B;  1BCP F;  3CRK C;  1EY9 A;  3QG1 A;  1SNM A;  3Q0A A;  1RKN A;  5KRU A;  1ENC A;  1JCK B;  2CVR A;  2PQE A;  2G9D A;  1FD7 D;  5M3M B;  2Q8R E;  3L9A X;  3BYT B;  1FR3 A;  1B2T A;  2VUM B;  3G7L A;  4L8J A;  4NP5 A;  1SNQ A;  5F2D A;  2TSS A;  1LT5 D;  4ILW A;  5A2Q L;  2KOL A;  3HGB A;  3SK4 A;  2E2D C;  4XT3 B;  1F9Q A;  2E2I B;  3A54 A;  2EYL A;  1I4X A;  2IX0 A;  2JYO A;  2MJ8 A;  4DAP A;  2EZV A;  3NBH A;  4XXE A;  1SE4 A;  1QIL A;  3VA7 A;  4K6D A;  3T4A C;  1PTO F;  2FMM A;  3D4W A;  2NUC A;  1I6H B;  2K5Q A;  3K5M A;  3A56 A;  4A3K B;  1OXT A;  1FGB D;  2BDN A;  5IOD A;  4XQN A;  2ICE C;  1RF2 D;  3CKI B;  1UAP A;  4ZQ3 A;  4IFD H;  3NXW A;  2EXZ A;  2NWG A;  4KI0 A;  2SOB A;  4LJZ C;  1VDZ A;  3RD4 A;  2B2W C;  3SVM A;  3BVM A;  2IJ0 A;  1D1K A;  2VB3 X;  5FO8 B;  1PZI D;  2O5J C;  2AQ2 B;  2IW3 A;  5CV4 A;  1PZK D;  2F0U A;  4ZUJ A;  1HUN A;  2F0I A;  3QOL A;  1KTK A;  4XQJ A;  2B8G A;  3PUX A;  2B2Y C;  1ZXT A;  1VMP A;  2RDG A;  3U9S A;  3RZD B;  2XIW A;  1LTB D;  4CJ2 C;  1HUM A;  3TDQ A;  1ENF A;  2WKC A;  1C8C A;  5DAU A;  3S14 B;  5C3X A;  2AUK A;  3M3Y B;  3FDT A;  4IUR A;  5BN3 A;  4P2C B;  1ZYR C;  5I6Y A;  4CGY B;  1WCM B;  2PO4 A;  1Y1W B;  1EEF D;  5M3F B;  1LAB A;  2F0F A;  3OSO A;  4V19 0;  4OHJ A;  2R3Z A;  5LL6 X;  1VF7 A;  2J4X A;  1Q8I A;  1QJO A;  2XN9 C;  2IPK D;  1LTI D;  3S15 B;  3NP8 A;  4M8A A;  5KNB A;  3P20 A;  1JB3 A;  1TY0 A;  1SYB A;  2ICI A;  2K05 A;  1UNS A;  3BDL A;  4J8Q A;  4KY5 A;  3J80 L;  3IAY A;  4FF2 A;  2A74 C;  3VR4 A;  5JAV A;  3M7N A;  2QIL A;  2O4X A;  2F0L A;  2KJX A;  3VR5 A;  1IW7 C;  3S1R B;  4C3J B;  1BDO A;  3GTP B;  3I90 A;  4JK1 C;  4KKU A;  1Y8O B;  1U4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...