4HSVA

Crystal structure of cxcl4l1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords Platelet factor 4 variant
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hsvA00
4ZKCB 2EOTA 1AP0A 1ZXTA 1ML0D 4XT3B 1NR2A 1BBXC 1RTNA 3FDTA 1HUMA 2K04A 1HA6A 1HRJA 3DEOA 1G2TA 4CJ0B 1J8IA 2MPMA 4ZK9B 1B2TA 1S4ZA 4XDXA 1MSHA 1VMCA 4NW2A 4RAUC 1WTQA 1DONA 1G91A 2NYZD 5CMDA 1PFNA 2DY7A 1HUNA 1EOTA 2D9UA 2B2UC 2HDMA 4X3SA 1X3QA 4QUFA 1WTVA 1HHVA 2EE1A 2MGSA 5CBAE 1E0BA 3ONAB 1QE6A 2B2YA 4MN3A 1B50A 2M2LA 1Q3LA 1F9PA 2B2YC 2KEEA 1RODA 2HDLA 1NR4A 4O42A 2BDNA 2J7ZA 2RSOA 4XT1B 1IKMA 3P7JA 1DZ1A 1PLFA 2IL8A 4UAIA 2B2TC 1ESRA 4ZAIA 2VXWA 4X3UA 1B53A 2Q8RE 4IURA 1IKLA 2EPBA 3H91A 2K05A 3KBXA 1M8AA 2B2UA 3IL8A 3MTSA 1DOMA 5T1IA 1WD0A 1F9QA 4U68A 3I8ZA 1DOLA 2MJ8A 2HCIA 4MHEA 2L4NA 2RA4A 2K28A 2DY8A 2KUMA 3DM1A 3GV3A 1EIGA 5EQ0A 4IUUA 1VMPA 1NAPA 1WTOA 1AZPA 3KUPA 1PFMA 3FPUB 4CJ2C 1U4MA 2B2TA 2B2VA 1PFBA 1C8CA 5T1GA 2RSNA 4IUVA 4ZKBB 5CBEE 1WTRA 3I90A 2Q8TA 3TZDA 1X32A 1MSGA 3R93A 1LV9A 4X3TA 1CA6A 1CA5A 1SSOA 2SDFA 3DEPA 4DN4M 3GV6A 1RHPA 5D14A 2CVRA 1F2LA 1EQTA 1O7YA 2FHTA 1F9SA 2FJ2A 1O7ZA 5E4WC 3QO2A 4IUQA 1JE4A 1XX8A 4CJ1B 1EL0A 1U4PA 5EJWA 1DOKA 1KNAA 1SAPA 2L11A 2K03A 3I3CA 3TN2A 3IFDA 4IUTA 1MGSA 4QUCA 4RWSC 1BF4A 2N55A 1HFNA 2B2VC 1RTOA 2NZ1D 5EPLA 1TVXA 3Q6SA 1JICA 1SDFA 4HEDA 1G6ZA 4X3KA 2MP1A 2H1EA 4OIJA 4IUPA 4HSVA 3HP3A 5DNFA 2K01A 4LMQD 1G2SA 2N88A 1A15A 1X3PA 2B2WA 1KNEA 2B2WC 1F9RA 4HCSA 4RA8A 5JJZA 1ILPA 1RJTA 2KVMA 1PDQA 1QNKA 5E4XA 1WTPA 5EPKA 2JYOA 2KEDA 4ZLTF 5AFWA 1WTWA 2FFKB 2FMMA 2HCCA 2L9HA 2NWGA 1AZQA 2XIWA 3MWYW 2KECA 3G7LA 1J9OA 4R9WA 1BNZA 1EIHA 2KOLA 2L12A 1WTXA 1NCVA 2FINB 1WD1A 1ICWA 3D6WA 2K1BA 1IL8A 4OIKA 2X6LA 1MI2A 3N52A 4R8IA 2X69A 1U4LA 2RVLA 5D65A 1HFGA 2X6GA 2HUGA 1B3AA 1BO0A 5EKIA 5CORA 3F2UA 4HAEA 5EPJA 1U4RA 2JP1A 2R3ZA 1O80A 1CM9A 3LWEA 1WVLA 1XYIA 3I91A 1ILQA 1QG7A 5COYA 3UI2A 2L1BA 1GUWA 1B4OA 3SVMA
chains in the Genus database with same CATH superfamily
2D5DA 2KHJA 2F0NA 3FDTA 2K04A 1VQ8A 2Q8IB 3HOWG 4RAUC 2VQFQ 3OIPA 3IAYA 4OWXB 1E2ZA 1VQAA 1EY5A 1FL0A 5C44G 2SNSA 3NBIA 1H9KA 1B70B 1XNQL 3BU2A 2F0OA 1NR4A 3PIPA 1DZ1A 1X3GA 4GS3A 3M4OB 1TXYA 1X54A 4JYAQ 3J7ZC 3E9IA 4X3UA 4FYDA 3GTGH 5BR8L 2AWOA 2HT1A 1Y8OB 4NMZA 1HQMC 2Y0SG 4JI3Q 4IJHA 1F2ZA 4EQNA 3PO3B 1K28A 4M1UB 1GOZA 1X9NA 3NTHA 3EN2A 2RDHA 1SNPA 4KN4C 4NXNL 2E2DC 4K14A 4LW1A 3QJYA 1CA5A 4KY7A 4DNRB 5C0XI 1VQMA 3I4MG 2KCTA 1HNWQ 3AYHB 2XGTA 3GV6A 3AB9A 4JC0A 5JEAH 3A5UA 1E1OA 1EQTA 3CD6A 5EAYA 3IFTA 1D7QA 2AQ2B 3E5SA 1SAPA 3LX0A 2I46A 2K03A 4DR3Q 2K32A 2RHSB 2K5VA 4OGQC 1HQRD 3H3VH 4HEDA 4DV4Q 1EY7A 3TZUA 4ZUIA 1WOCA 2H1EA 4Y7NB 1VQKA 3H3VC 1WJJA 4IALA 1HNZL 1VQ9A 5LL6X 3HOZG 5DEHA 4DR7L 1G8ZD 3HOWH 1SNMA 1UE7A 4KHPL 4V0BA 4ZLTF 4KJNA 1UE6A 2HCCA 2NWGA 4R4OA 2HHHQ 4G4KA 1N33Q 4LNQA 1YNJC 4LFAL 1EQQA 2EXZA 2F4IA 1HFGA 3EJIA 3FPPA 4F88A 3NTIA 4WJ4A 4DV5L 4XT3B 1V9PA 2VUMG 3U4VA 1XXGA 1Q8IA 4Q0FA 4AIMA 5KEEA 5JJKA 3HOYB 3OIQA 2OF1A 1JWSD 3Q23A 5IP7G 4X3SA 1PH1A 1WTVA 3Q22A 2YTXA 1K0RA 2F0MA 2EQSA 2IWHA 4LF4Q 1B50A 1A62A 1Y1WB 3I7FA 2HDLA 2E74C 4LFBL 1FNVA 1WFQA 1H9SA 1LABA 4CDDC 1BUVT 5C44B 3PUWA 2CQOA 3M4PA 5T1IA 2R7DA 3U9SA 2CWPA 3FEWX 1STAA 2HCIA 1I4GA 5KNDA 2GN5A 1RIPA 1TWCB 3A7LA 3TP8A 2ALYB 3HOYH 4EQ5A 1SROA 2RDFA 3QG1A 3EA6A 4BA1I 4MTNA 1TWAH 3A7AB 3TZDA 3M4YA 4DR4L 1X32A 3K6OA 1I94L 1N36Q 3DEPA 2K14A 3HOUB 1RHPA 2R7FA 4BWGB 5DM63 3OTOQ 2A68C 1FYCA 1O7ZA 1X56A 2ZXPA 4A3FG 1LTBD 3K7UC 3PUVA 2K4KA 5FOBB 3NQTA 3KF6A 1TVXA 3U58A 1SDFA 1ET9A 3EBEA 3S1NB 4DK3C 4OX9Q 3DMUA 3X3MA 2JA5H 5AJ3L 3HP3A 3WOEA 2JA6H 5FJ8H 2I07B 4KY5A 5M3FG 4RA8A 1BKBA 1G51A 2QEJC 4GLVB 5FO7B 2QILA 2VUMH 1KL9A 5FO9B 3RD4A 5M5WH 3ICEA 1N33L 4RKLA 3H0GH 3L7ZC 3J81E 1J5EQ 3CCQA 2R7ZG 4KD3A 3BJUA 4CKCA 1A8VA 4ID6A 4PMWA 1U4LA 4A3IB 1EY8A 2R93B 1VQCA 1HXYD 1U4RA 2YU9B 4GN3B 1DJRD 2ZXOA 1STGA 2EYJA 1OO9B 2MUYA 2ZTCA 5G3LF 4X64Q 5I9OA 2AQ1B 2DUDA 2JA8G 1OXUA 1Q90A 4I7ZC 4GKKQ 1A6XA 3D0FA 4YCVA 1QZHA 3J7A5 1SYGA 4A3BG 2R7ZB 5JVG3 3UE1A 1PZKD 1DONA 4PQXA 3A5ZB 1KQSA 1X3FA 1O78A 4OO1G 1HTLD 2YU9H 1X3QA 3QWNA 1KXLA 3S15B 3M3YB 5L37A 2VQEQ 4N9TA 2L5TA 2N3SA 1D6EC 3SK5A 1IZ6A 3S1MH 3P75A 5IP9G 5C4ZA 2LS01 3A8KE 3OW2A 4ULLA 1S5BD 4DV3L 2ZXRA 1HZCA 3AEVA 4HIOA 1SE4A 4HJAA 5CV9A 5HGTA 1AZPA 2F0JA 1PFMA 4MTKA 1U4MA 3DM3A 2RSNA 4C3JH 2PPBC 4X3TA 1CA6A 1SSOA 1DXMA 1M4VA 4JI1L 5JJLA 1PRTC 4YWKA 5I2XA 1LUZA 3J80i 4NXMQ 1I6VC 3I73A 4IUQA 3MHBA 3HOUH 4IZ8A 1U4PA 4EQPA 1K73C 1VQHA 4L5TA 3GTJH 3F2DA 4JYAL 1UEAB 1YITA 3H0GG 2JEBI 4X3KA 3NTKA 4IUPA 1B9MA 5DNFA 5C6AA 1I6HH 1SYDA 1YNNC 2A69D 5JPNC 4MIUA 1F9RA 3L9AX 4C3HH 2JQOA 3H0GB 4F87A 1RD9D 3GTPH 4QMGA 1FJGQ 3D4DA 1AZQA 2A6ED 1DGSA 3MXUA 5J1ZA 2KHSA 3SXHA 3JAMc 4IPDA 1NJIC 1Y1WH 4HIKA 4JCVE 5D65A 3CU7A 5ELNA 4DXFA 5ELDA 5CORA 4DAYA 5I4DA 2ZJQA 1I4PA 1GJXA 3K81C 3KF8B 5E3FA 4KHVA 1LT4D 5C5LA 4QCLA 1LTRD 4MNOA 1CKOA 1E7ZA 2HHHL 2ZT9C 4R8NA 1K8OA 4DV5Q 3DWAA 4TQUS 3RZDH 4B3RL 4N8X1 2E2IH 1I3QH 3T4AC 5HY6A 4ZUJA 4L5QA 2B3GA 2RSOA 2L55A 2K6AA 4BXXG 1Y69U 1CKNB 5A2QE 3L2PA 3HKZB 3NUCA 4A3DH 4HN7A 2BDOA 3RMHA 1DOMA 1SMYD 2MJ8A 1IBKL 3GDEA 1HR0Q 1SE2A 4A3BB 5IP7H 5I2YA 3R2TA 3H15A 1W2BA 4FF2A 4LF8L 2JA8B 3PQIA 4O1NA 2Z6KC 2BA0A 2PZWA 3I4MB 4OO1I 1E2VA 1X55A 5CBEE 5C4HA 1MKHA 5KIXA 1T5XD 3C2PA 3S14H 3KF8A 2PZTA 3R3OA 3TMEA 3I55A 3J7YW 1YNXA 1YIJA 1M90C 5D3IB 2A6HC 3I70A 4A3CH 1DOKA 3QIAA 5K5PA 2DNEA 4DUYL 4IUTA 1B9NA 1QB5D 1RDPD 1TY0A 1PH3A 2TMPA 3Q6SA 3PUYA 2CHBD 3NK9A 2KA7A 5J39A 4HJ7A 3BVGA 1MIUA 2H5XA 2H4OA 2K01A 4LUOA 3NPPA 3RN5A 5GAEC 4PMBA 5LMUQ 2L0CA 5I9PA 2EIFA 2OTLA 2XN9C 1VCIA 1DCZA 5E4XA 3DUZA 3CCUA 5BR8Q 2NVXB 1WTWA 1PH7A 3OTOL 3T13A 2KCCA 5E1FA 3HG9A 4HJ5A 1WD1A 3HOWB 2K1BA 4WJ3M 3VR5A 1K8MA 4PZ8A 1XPOA 4KK7A 3N52A 1VQLA 1UE5A 4XQQA 1Y8NB 3H09A 1MJCA 3FHWA 3F2UA 4HAEA 4OX9L 5IGGA 1WVLA 3CC4A 3BDOA 1YNND 5C4JB 3UDGA 3E0EA 2KHIA 1HUMA 3PGZA 4C3IG 2F0DA 1CI3M 4J15A 5IIFA 3I4LA 4NP5A 2WKCA 1MSHA 4G7OC 4PG3A 1LYLA 4ZCKA 4AYBG 2MHVA 1SNOA 1STNA 1HR0L 1QJOA 4HSPA 3K5MA 5CBAE 1QVFA 1QE6A 2F0QA 4L6TB 3QB3A 4O42A 1ASYA 2NTSA 5J3BA 3CCVA 1EIFA 4UAIA 4DAVA 1JOKA 2G9HD 1YHQA 2OQ0A 3D4RA 1E2WA 1NNXA 2B2UA 3J7AV 3O13A 4F7XA 2K5WA 1F9QA 3NBHA 2NN6H 3F2BA 5JAVA 2AUKA 4CDFC 3HOYG 1JE5A 2RBMA 5M5WB 2VUMB 2V4DA 1I5FA 2ICIA 3QOJA 3SK8A 4DU9A 1VQ4A 1LV9A 2VL6A 5IODA 3MZ5A 4B08A 3FKIH 5K36H 4P71A 1I4XA 4BY7G 2NN6G 1BCPD 5FLMG 4B3SQ 3BZDB 3HZXA 3OW7A 1EYDA 4KMUC 4YWLA 4JOIC 1YNJD 1GXDC 3VYSA 3PIP3 4P73A 1SYBA 3C3LA 1L1OB 3K0YA 5J22A 1UWVA 2EY1A 1KRTA 4DR6L 3ND9A 4JI6Q 2PZUA 4KKSA 2K5HA 2B63G 3HOZB 1BCPF 3CKIB 4ODGA 4A93G 2KVMA 3A8JE 4IPHA 5IT9L 3I4OA 2JYOA 1V43A 5NUCA 4R4CA 1EWHA 1NSNS 5M5YH 2R61A 4JI3L 1K8AC 3GTOH 4P72A 2KOLA 1TU2B 1ENFA 3OYYA 4YCUA 3D6WA 3OSOA 1IL8A 4QIWE 3GTKB 4A3KH 4KHZA 4DFAA 3KJPA 1XMOQ 3K5OA 1TS2A 3M9BA 4FF3A 1EU4A 1O80A 3PIO3 5GAGC 2ID0A 4Q5VA 3W3AA 4KKTA 5C4XH 4JI4Q 2R7ZH 3HS0C 4XQJA 4OWTB 3PUXA 3PO2B 1SBBB 3QR8A 1SNQA 1JQYD 1LO5D 3BDCA 5M5XH 1H95A 4ME5A 3NHHA 3HOXG 4DV2L 1PFSA 4LWCA 4QY7A 1VQIA 1EOTA 1FNUA 1TWHB 5DLQE 5LHY1 3UDIA 1QUQA 4CHTB 2E5LL 4FNFA 2AWNA 2R92H 3VYRA 2UUCL 2BDNA 3PO2H 5ELEA 5IYCG 4OWWB 1PZID 1XJVA 2C5CA 1B53A 2Q8RE 4A3MB 4A3CG 1IKLA 3K58A 1JJGA 4IJLA 1IBKQ 3NENA 3S1RB 2A74C 2F1MA 3CXCA 4KV6A 2R92B 1P8LA 3FPUB 3RNUA 2UUAQ 2O4XA 4HIDA 1A0IA 1XPUA 5C5MA 4JI2Q 1WTRA 4JI5Q 3RZOH 3NSWA 1LLRD 3NXWA 3FP9A 3VR3A 4B3SL 1JT8A 4GKKL 2D0PA 4YHHQ 4A3JG 4K5XA 4A3DG 1U9RA 3M3YH 2LFNA 1BCPB 1JICA 5IYBH 3CMEA 1I6HB 2GVAA 1VS0A 3CCJA 3HOVG 1VQGA 1MHWC 1ZEQX 1K83B 4OEMB 4WRDA 1Y1VG 3Q8DA 3W1BA 1CFMA 5JJZA 1RJTA 1HZAA 1QNKA 4BBRB 4A93H 5KRUA 1NE3A 2IPKD 1HNXQ 3AU7A 3D31A 1CHQD 1EIHA 3MWYW 3K57A 5IY0A 2F0HA 2FINB 4FDBA 1HZBA 1S72A 2Y0SE 2VNUD 3CW2C 2E75C 5M3FH 5I6WA 1IBMQ 2UXDL 3HKZE 1B3AA 4AQYQ 1PH5A 3CC2A 1QZGA 2XWJB 2F0KA 2NVQB 5CMDA 1BOSA 4MZ9A 1PYSB 1LTLA 3GTLB 5DM73 4LF6L 2UU9L 1YJNA 2MPMA 2RKSA 3S2HB 1VMCA 1KTKA 2B2UC 2XWBB 2EYHA 1SFOB 1B3QA 2JK8A 1IYUA 1Q3LA 2IT1A 3RUZA 3UDXA 4FF4A 4JBWA 4KJOA 1EQVA 4C56C 5CV5A 2PNRC 1EY9A 1V1OA 1GUNA 4LAAA 2JJQA 4BY1B 3FKIB 3ULPA 4U68A 2L4NA 4ZRZA 1W6JA 1VF7A 4FXGC 3H6MA 1VF5C 4KTAA 1EWCA 3KUPA 4CJ2C 4DV7L 2KQ3A 3Q24A 1GUGA 2B2TA 2B2VA 1PFBA 2ICEC 4LF5Q 2JA5G 1TWCH 2Z8LA 1V1PA 4IN3A 5FLXL 2KCNA 1D1KA 4X64L 4DN4M 2E8GA 2QEXA 1EU3A 3JAME 2VS1A 5M3MG 3DWPA 3TSSA 3J81i 5C4JH 2YYZA 1XX8A 4CGYB 1EL0A 2WAQG 1LTSD 1QILA 1YBYA 4BBSB 5LMNQ 1FR3A 2BA1A 3BVMA 3S2HH 4PZ6A 3E6ZX 5CV7A 2SNMA 2D0OA 4GOPB 4OIJA 1R4PB 2O5JC 4RGTA 3STBD 3GTQH 4UHVA 2TSSA 2PI2E 4LMQD 1X3PA 2OQKA 1TR5A 5TSSA 3MEHA 1WTPA 2WIIB 1VQFA 3S16B 1AH9A 4HTHA 2CQAA 2XIWA 1HCZA 4A3LH 5FKAC 4DR5Q 2Q2IA 3T1HQ 1SR3A 3ZJYC 5JOBA 2JA8H 1WCMB 1ESFA 4LF9Q 5FLXE 2F3VA 4QQBX 3BZKA 4K0KL 2G5DA 4DR6Q 4DXGA 4CDCC 4H7BA 4CDEC 2M9VA 1QVGA 3D6CA 5F2DA 5HURA 1EYGA 1DM0B 2QDBA 4K2KA 1IYJB 1L0XB 2NVQH 3P1HA 2WINB 2VY3A 2EJGC 4NPSA 2WAQE 5ISRA 1XTCD 3S24A 3CQZH 4LJZC 3VR4A 2A68D 4DAMA 1HHVA 3I4MH 1XMQQ 2JA7G 1JJCB 1UEBA 2HIXA 2OWOA 5C3EG 4GNXB 1PRTD 1Q1EA 2WKDA 4BS9A 2MFIA 3K8AA 3F2CA 1N36L 3A8IE 1KABA 1QCBD 4XTCS 1TS3A 4XIGS 4BY1H 1ENCA 4I7AA 1TWGH 3KF6B 3GTMB 3PCOB 3H91A 2PCFB 4ME3A 3K7AB 4A3FH 5CR3A 1RL2A 4JOIA 2KJXA 5GROA 2MO0A 2K28A 2KUMA 3PV0A 1VQJA 4DGZA 4JI7L 5T1GA 1I50B 3URYA 4ZKBB 1VQOA 5AJ3Q 3NP8A 4X65L 5JVH3 1EEFD 4KLKA 3A55A 4A3EG 4Y52H 2N8NA 4KI0A 1K83H 2A73B 1CSPA 1ZKOA 2F4VQ 1SMXA 4FXDA 2OXPA 3CCMA 4BA2I 4DK6C 1S5CD 2NBFA 1BF4A 2NB0A 5EPLA 3RLFA 4RG1A 4DR2L 1SE3A 3U50C 4XYOA 2MP1A 2A5HA 4P74A 3ULJA 3JAML 4QJFA 4DR1Q 2VB3X 4DV0L 1A15A 2B2WA 3SDZA 1KD1C 4A3GG 4N8FA 2JSOA 1UNSA 2HQLA 2NVYB 1D5MC 2ENBA 2FFKB 2K50A 4R9WA 4HR7B 4OHJA 2E2HH 2EY2A 1WTXA 5GAHC 3T1HL 4FF1A 3K7AH 5LMUL 3VA7A 4LFCL 3GTOB 3H3VI 3I56A 1B1ZA 2X69A 5IGCA 4KHPQ 2FMCA 5EKKA 1PVOA 4K0KQ 3I2ZA 3GTJB 1HNZQ 2EYMA 1EZ6A 3VDYA 2K33A 1OXXK 3SVMA 1XMQL 3PO3H 4JBKA 4HCEA 4EX5A 5ELBA 1G2TA 4CJ0B 1B2TA 1JB3A 1JC7A 4LUVA 3CPFA 2F0EA 5JEAJ 3BDLA 2D9UA 2WACA 2Z4HA 3ONAB 2B2YA 2J0TD 1Z47A 5IGEA 3GTMH 2D2CC 1XNRL 1Z9FA 2DGYA 3CAMA 4DV0Q 4CKBA 1IBLL 3GTLH 2B2TC 1ZYRD 1EEID 2I5HA 5IGBA 2VXWA 4LF9L 5C4XG 1AE3A 4IURA 3X3NA 2RDGA 3KLRA 4P75A 4JI8Q 1HJPA 3EFXD 2RA4A 1PTOD 5JEAG 5EQ0A 1D5XC 4OELB 4OO1H 2D62A 1HTPA 4A76A 2PMZE 3M4OH 1JCKB 1SJED 3TDQA 1SEBD 1K3BC 3SE0A 1E24A 5GADC 2F3WA 4C3IH 3R8BA 4C3HG 3KOJA 1E3PA 3AQQA 4B9WA 2JA7H 1H9RA 4IOCA 4QGUA 1O7YA 1BBUA 4X66Q 2EYFA 4DV1L 1CK1A 4DNTB 2K5DA 1I94Q 5H1SE 1TT2A 1HPCA 4C3JB 2L15A 3I4NG 1Q8KA 3GTKH 4DNIA 2PW5A 4H13C 1XNQQ 3P20A 2CW0C 2CH4W 3VYUA 3CF5A 1HR0W 5CC4A 5LL6S 4FVMA 2AKWB 2E5LQ 2ASBA 1GUOA 4DF7A 5C3EB 1NUCA 2UXBL 1MD2D 2JXMB 5AFWA 4C3JG 2JA7B 4JI6L 1VQ7A 5CV6A 3C46A 3TEHB 5C0XJ 2DJFC 4C1NI 2K7VA 2NTTA 3FRPB 1C48A 4J6HA 1H9JA 4F8MA 1EIYB 4CKEA 1JWUD 2WP8J 5KYIA 4UP7A 3T1YQ 1BO0A 4R1JA 5EPJA 2RCNA 3ND8A 3BG3A 1GVPA 1CM9A 1BR9A 3LWEA 1XYIA 3I91A 1CZGA 1EZ8A 2XRQD 5A35A 2L1BA 1L0WA 3U4ZA 2HQEA 4DV7Q 3OOCA 3DEOA 2JEAI 1AW7A 2PW7A 5C0XG 1WCMG 4I65A 2B39A 1JWMD 2QCPX 2PNHA 1W6KA 4JI8L 2AQ3B 1A2TA 4B3RQ 2MGSA 4YCWA 1EUJA 5IOCA 2M2LA 4DAPA 2EZVA 1UUPA 4DR5L 2NVXH 2J7ZA 4XQNA 4XT1B 5G3LD 4HIMA 1GHJA 4K2LA 5K36G 4K5VA 4RCOA 3LGJA 4J8QA 5D3DA 2NUCA 3V96A 2DN8A 4GKJL 3TP6A 1VQPA 4U673 2EVBA 5BN4A 3J80c 3I8ZA 3MA2B 1PH6A 3CP0A 3EQLC 4IOAA 1KLUD 3GV3A 5HGQA 5FO8B 4IUUA 2XSCA 5EBCA 3SHLA 5M3MB 2Z4IA 3S17H 2JA6B 1PH2A 1IBML 2UXDQ 1BCPC 2VQEL 3GP7A 2CCZA 3K5NA 1SLJA 1QWYA 2C9OA 1SRUA 3R93A 5C3XA 1CTMA 1PTOB 1FNWA 4YIJA 1TWFH 3E3XA 5CV8A 2N49A 5D14A 1W3SA 5CYUA 2QKIC 1LTGD 2WB1B 3J81j 2CKZB 3KLSA 1D5ZC 1SFOH 1AE2A 4A3KG 1KNAA 4GN5A 1QNUA 1KAWA 3I3CA 2A6EC 4BY1G 3DHQA 2EY5A 1TWAB 2SOBA 4JV5Q 3PMFA 4NXML 4NB3A 4C1NK 3ER0A 1MBYA 4J1MA 5C3EH 1TWFB 4A3GB 1S40A 2RQXA 3MAQA 1Z7TA 2E2JH 1YZ6A 4RMFA 2QF7A 4WFN3 4GOPA 4L5RC 3M4QA 1BNZA 2BH2A 1V1PB 3KLSX 3HGBA 1RCVD 1G291 4JI5L 5KYLA 4LK1C 3BZCA 3J80E 3CCEA 3TS2A 1Y1VH 1C4QA 2F3IA 2UUAL 1YHAA 2RVLA 4A3EB 4HMJA 2F4VL 2I0QA 3CPWA 1BXTA 4DR2Q 2JP1A 3KK7A 1PV4A 1L2FA 1GUSA 1GUWA 1B4OA 1XWEA 5JPMC 2EOTA 3MXNB 2QW7A 3ULLA 1BBXC 5IGDA 1RTNA 1CT1D 1HA6A 2LSSA 1YJ9A 4G7HC 1STBA 1S4ZA 4NW2A 4LFBQ 2DNCA 2DY7A 5M5XB 1PTOF 1YJWA 3HEJA 3NQIA 1QVCA 2EE1A 1I4HA 1LTID 1BDOA 1WTHA 4KKUA 1KDBA 2EYPA 4DPGA 1X65A 3HOVB 4JI0Q 3SK4A 2DJGC 4TRDA 1FD7D 2IW3A 4ILWA 1XNRQ 1HZ9A 1N8RC 1AFPA 4ZYSA 3SK6A 1DOLA 4NKLA 4H0LC 4KY6A 4QF4A 3MXPA 5EKLA 5LMNW 4A3GH 4JV5L 1NAPA 3ERQA 1JJ2A 5KGUA 3KYHC 4HJ9A 1ONLA 4FP5D 3TP7A 2CH4A 4A75A 3RZDB 1TQOA 2Z6BA 3S1MB 2QDLA 1L1OA 4RGNA 2UXCL 2ES2A 4FO2A 1I4RA 3S16H 1Q7YC 2NZOA 1C9OA 1O7IA 2CVRA 5ELOA 4ALPA 2F0VA 5IWAQ 2FHTA 1IW7C 2FJ2A 1CKMA 1HA5A 3QO2A 3U9OA 5EGTA 3NBHB 5BN5A 2L11A 3D4WA 4B3ML 2N55A 5CGKA 4V190 2JA9A 1SE8A 4JVZA 4GKJQ 2ATWA 1PXUA 3J7AF 2XVSA 4NXNQ 4DR3L 4DK1A 2N88A 1Q12A 5IYDG 2IY5B 4HCSA 1ILPA 3AMUA 1KAAA 5EPKA 1VQDA 2KEDA 4DV6L 1HNWL 4LFCQ 2FMMA 3S14B 2L12A 1NCVA 2UUCQ 3S15H 1ICWA 2F0SA 4OONA 3TP5A 4RGMA 2K52A 3PO2G 5BN3A 1VQBA 4X66L 3NWSA 3T16A 1LT3D 1EYCA 3WOFA 1CQVA 3KDFA 2BOSA 1R9TB 1KC8C 1EWIA 1NR2A 1LTAD 4AYBE 4PMCA 3MXNA 3S1QB 2IJ0A 2LXJA 5ELFA 3FKIG 4DV3Q 4OXPA 2Z9HA 3EIVA 1F77A 3AFPA 1JB7A 1RF2D 4G57A 1EY6A 1BVSA 1R9TH 3J81c 1IKMA 1XTDA 3S17B 4POGA 3RLOA 4JI1Q 2B63B 1YI2A 2GA4B 3I4NB 2ZTEA 1NY4A 1Q46A 1PZJD 3GD7A 3OWFA 5FLXc 5I6YA 3V2TA 4YY3Q 2ZJRA 1SMYC 4A3IH 3S1NH 4TSSA 4E6IA 1N9WA 1WTOA 1STYA 4L5SA 3DXJC 1C8CA 2UU9Q 2HD3A 3OPOA 4IPGA 5C0XH 3I90A 4A3MH 1SYEA 3BS1A 1RKNA 2QA4A 1F2LA 4IPCA 1F9SA 1N32Q 4LF7L 2YTVA 1G6PA 3IFDA 4QUCA 2EYOA 3W5OA 2R93H 4DUZQ 3D8GA 4JI0L 4S3SA 1L1OC 1NTGA 1HNXL 2CWAA 1GO3E 2VW9A 1LTTD 1PRTF 4RCNA 1Q86C 1CSQA 4A3EH 2B2WC 2K5NA 3CMAA 3HOXH 3GTQB 3LNNA 1TY2A 1EYAA 4EVOA 1TS4A 1VQNA 2WB1E 4LF6Q 2IHFA 4A3KB 1II3A 2MNAA 2WB1G 2KCMA 1N34Q 2P5ZX 1ICFB 1CHPD 4HMIA 1OXTA 1TWGB 1QUQB 1D2BA 3FVQA 3HOVH 5M3MH 3UDFA 1S5DD 1ILQA 3UI2A 3ZYYX 1M1KC 3S1QH 1AP0A 2Z6KA 3ERSX 2BCOA 4Y7NH 1J6QA 2JA6G 1F2YA 4JI2L 4APVA 4UY8C 5IT9c 2IX0A 1VQ6A 4LF5L 1PH9A 1YVCA 4GZYC 4XDXA 5GQOA 4B3TQ 1PMRA 1S3OA 3JAMi 2NVTH 2F0GA 3HFZB 3S2DB 3DLLA 4YWMA 3RZOB 1SYFA 4A3MG 5JJIA 1ET6A 2B2YC 2PI2A 1EFID 4G7ZC 3PIOA 2MO1A 4DV2Q 4K8IA 3P7JA 3STBC 1YHBA 3R2IA 3C1FA 3A56A 4FXKC 4ZAIA 2F0FA 3S1RH 1C7YA 4JPBW 2EPBA 3KBXA 4JI4L 1Q1BA 1Y14B 3MTSA 4BBSH 3OMGA 1IYVA 1WD0A 3F1ZA 3HOXB 1B7YB 5FLMH 2UXBQ 1Q82C 3BYTB 2RHQB 1VMPA 3S9WA 1SN8A 2EDGA 3H94A 2PQAA 5IGFA 1X6OA 1PTOH 4O2DA 1ASZA 2E2JB 4IUVA 2K5QA 2OCEA 3T51B 2PO4A 3ITPA 1WYDA 4OL7A 3PUZA 3TRZA 4X62Q 5M5YB 3L3OC 4HJ8A 1PRTB 4Z9CB 2YTYA 3C1EA 4IUNA 5EJWA 3BYYB 3EROA 1TKWB 2B8FA 3W2DA 4B3TL 5IP9H 1B44D 1HFNA 1EQRA 4K6LA 3HKZG 2XTIA 3NELA 4BBRH 4A93B 1Y8PB 1STEA 1JOOA 1G2SA 2I5MX 1SNDA 3CCRA 5IWAL 1A63A 1N34L 1V1QA 2L9HA 1VDZA 2KECA 1JOQA 3PF5A 1FGUA 2F0UA 1KHIA 1I3QB 2B29A 4BXXH 5KNBA 3M7NA 3TREA 1SJHD 3G4SA 1C0AA 1VQEA 1IL2A 4AQYL 1E1TA 2NZHA 2BE5C 4C3HB 1N32L 2B8GA 2Z1CA 2CW0D 3KLWA 3OHXC 1VQ5A 2V1CC 1B8AA 1GM5A 4UDUC 1KIXA 4P2CB 3I4NH 3CC7A 2NN6I 1OTCA 3MFGA 2EJFC 2NYZD 1PFNA 1NBWA 2F0TA 2ZM6L 4IO9A 1TIID 5A2QL 4QUFA 1AEXA 1CZWA 1SYCA 4DR7Q 1JR0D 3F8TA 1T5EA 4GLAC 5C4XB 1F9PA 3VR6A 3A54A 2LXKA 1KDAA 2A19A 2N78A 2K75A 2BE5D 4GN4B 4B3MQ 1ESRA 4R4IA 1LT5D 4IQZA 4H02A 1A3VA 2O5IC 4KN7C 4AYBB 4DAYB 4BBSG 2WAQB 4RGOS 3KJOA 1EIGA 2CFMA 2A6HD 4L8JA 5IYDH 2M00A 3UE0A 2F0IA 3QOLA 2B63H 2EXDA 1A3TA 1FJGL 2AHOB 3G71A 4JW0A 1TS5A 2A69C 5ELCA 2F0WA 1OXVA 4XXEA 4RKBA 4AH6A 3IKJA 2O2LD 4DKAC 3KBGA 3DWQA 2JA5B 5E7NA 2OEOA 2KENA 4YY3L 3N6RA 4IFDJ 4O0AA 1HH2P 4TKOB 2NVYH 4BY7H 3TN2A 4DR1L 4RWSC 1MGSA 4RHRA 2ZTDA 2AMCB 2F52A 2NZ1D 1IW7D 4DK0A 4DV1Q 4JK1C 2IX3A 2Q2HA 3T56B 3AFQA 1V8QA 1DD2A 4DUYQ 4UP9A 4M8AA 2EY6A 5CV4A 4R4TA 1KRSA 4NDXA 1KNEA 1PYWD 1PH8A 5C3WA 3HOZH 1PDQA 3M7GA 3V05A 4JG2A 3MVVA 4LUZA 1UAPA 2SEBD 3K0XA 3G7LA 1CKNA 1F2MA 1H9SB 4WORA 1Z6HA 4OIKA 4DR4Q 1ENAA 2X6LA 2Q2TA 1I4QA 3B6YA 1SNCA 4QL5A 4JBMA 2MQHA 3KDFB 4GNXC 5FJ8G 4GNXA 1L0YB 2HUGA 2AUJD 3VR2A 2R3ZA 1NMFA 4K6DA 3CCSA 3CCLA 1EOVA 4R4QA 2R93G 4ZKCB 1NMGA 4DV4L 4LF8Q 2OT2A 3VA5A 4L63B 3WDNA 4B9XA 1JORA 1TWHH 4UP8A 4ZK9B 5IYBG 3RN2A 3PSIA 1G91A 1HUNA 4TVAB 1WI5A 3G48A 2LY7A 3KFUA 3J80L 3NWTA 4BBRG 1QOHA 3GO5A 5M3FB 4LF7Q 4RHSA 1BBWA 1Y1VB 3I72A 1CUKA 2JN4A 2IL8A 4LFAQ 3G6EA 1GKHA 1S5ED 5FK9C 2VZAA 4EQOA 2QGQA 1IXRA 1R4QB 2YV5A 4WJWA 2JE6I 3CRLC 4POFA 4RFBA 3IL8A 2LMCB 1FVIA 4MHEA 3MXGA 1PYBA 4A3DB 4A3FB 4A3JB 3DM1A 1J5EL 2IHEA 2WFWA 2XNAC 4GOPC 1EY4A 4A4IA 1ZYRC 2Q8TA 3Q0AA 1MSGA 4UPAA 3MC0B 3JC66 2IX1A 1MJEA 3RR5A 3GTPB 2PQAB 3J81L 4JI7Q 3MEFA 2R92G 1A3UA 1JE4A 4CJ1B 2XRSD 3L0OA 1T9HA 2F0LA 4QIWB 3A74A 1K0SA 3TS0A 2PMZB 1G6ZA 3S2DH 3RLNA 2F03A 2NVTB 2Z0SA 3PF4A 3SGIA 3TQYA 4IFDH 2GVBA 1KLGD 1Y1WG 4X65Q 2PYKA 4JBJA 4N9PA 1X3EA 1K8GA 3K59A 4A3BH 3CQZB 1O7LA 5DAUA 2A8VA 1PTOC 1LACA 1XPRA 4PV1C 4XYQA 4PZ7A 3BVZA 3A0JA 3T53B 1MI2A 2A1AA 4R8IA 2R6GA 3HRZC 1IHZA 4K5WA 4A3JH 4PNYA 4X6AH 3CRKC 3E0JA 5EKIA 1GUTA 1P16A 2C35B 3VYTA 5COYA 3HKSA 3NE5B 1STHA 2UUBL 2E76C 3G6JB 2OTJA 1ZXTA 1ML0D 2VB2X 3OWEB 1EFWA 2KBNA 4K8JA 1WCMH 1HRJA 4ZQ3A 4LF4L 1J8IA 3LWUA 2PQEA 2F0PA 3WWVA 4ABNA 2ZJPA 1WTQA 1A2UA 5KNCA 2ZM6Q 1DYQA 2HDMA 4RH6A 1XMOL 1Q81C 5EBDA 1E0BA 3FMCA 4MN3A 1K9MC 2KEEA 2WV6D 3SEBA 1RODA 1OXSC 5IE8A 2EYLA 3TBIB 2VQFL 4KD4A 1PLFA 3K80C 1IBLQ 1PA6A 4C2MH 5IYCH 1SXTA 2J4XA 3IRBA 4DV6Q 2K05A 1M8AA 1AN8A 3CHBD 5LMNL 2E2IB 4DA2A 2DY8A 3GQBA 1H9MA 4H44C 1LM0A 3NEMA 1K3RA 3M85A 1D8LA 1LT6D 4BY7B 1CQFA 3MFYA 4CBVA 3SR1A 5C44H 2SDFA 3OMCA 4DUZL 4A3IG 2G9DA 2FXQA 1PH4A 5E4WC 3K5LA 2UXCQ 1FGBD 1GD7A 1JMCA 2Q2UA 3PO3G 1BQQT 2Y0SB 4QB4A 3W1GA 5IT9E 1I50H 2B2VC 1RTOA 1EY0A 1S5FD 4EGVA 4A3LG 1PHJA 4HSVA 3EVQA 2UUBQ 3GTGB 1E22A 4IFDG 1GHKA 2I5LX 1D1IA 2LKVA 4GLXA 1U0LA 1J9OA 4YHHL 1YEZA 1UE1A 1KDCA 3D3RA 4C3IB 1U5KA 2HIVA 2RCFA 2X6GA 4C2MB 2RF4A 3HOUG 3T1YL 4IFDI 2BH8A 3E9HA 1QG7A 5M9OA 2E2HB 2EJMA 4X62L
chains in the Genus database with same CATH topology
2D5DA 2F0NA 3FDTA 2K04A 2Q8IB 4RAUC 3OIPA 3IAYA 1E2ZA 1EY5A 2SNSA 3NBIA 1H9KA 2F0OA 1NR4A 1DZ1A 3M4OB 4X3UA 4FYDA 2AWOA 1Y8OB 4NMZA 1HQMC 1F2ZA 4EQNA 3PO3B 4M1UB 1GOZA 3NTHA 2RDHA 1SNPA 4KN4C 2E2DC 4K14A 3QJYA 1CA5A 4KY7A 4DNRB 5C0XI 3GV6A 3AB9A 5JEAH 1EQTA 3IFTA 2AQ2B 3E5SA 1SAPA 3LX0A 2I46A 2K03A 2K32A 4OGQC 1HQRD 4HEDA 1EY7A 3TZUA 4ZUIA 2H1EA 4Y7NB 3H3VC 4IALA 5LL6X 5DEHA 1G8ZD 1SNMA 4V0BA 4ZLTF 4KJNA 2HCCA 2NWGA 4G4KA 1YNJC 2EXZA 2F4IA 1HFGA 3EJIA 3FPPA 4F88A 3NTIA 4XT3B 1XXGA 5KEEA 4Q0FA 1Q8IA 3HOYB 3OIQA 2OF1A 1JWSD 3Q23A 4X3SA 1WTVA 3Q22A 2F0MA 2IWHA 1B50A 1Y1WB 2HDLA 2E74C 1FNVA 1H9SA 1LABA 1BUVT 5C44B 3PUWA 5T1IA 3U9SA 3FEWX 1STAA 2HCIA 1I4GA 5KNDA 1TWCB 3A7LA 3TP8A 2RDFA 3QG1A 3EA6A 4BA1I 3A7AB 3TZDA 3M4YA 1X32A 3K6OA 3DEPA 3HOUB 1RHPA 4BWGB 5DM63 2A68C 1FYCA 1O7ZA 2ZXPA 1LTBD 3PUVA 5FOBB 3NQTA 1TVXA 1SDFA 1ET9A 3S1NB 3DMUA 3X3MA 3HP3A 3WOEA 2I07B 4KY5A 4RA8A 2QEJC 5FO7B 2QILA 5FO9B 3RD4A 4RKLA 3L7ZC 3J81E 4KD3A 4CKCA 4ID6A 4PMWA 1U4LA 4A3IB 1EY8A 2R93B 1HXYD 1U4RA 2YU9B 1DJRD 2ZXOA 1STGA 2EYJA 1OO9B 2MUYA 5G3LF 5I9OA 2AQ1B 1OXUA 1Q90A 4I7ZC 1A6XA 2R7ZB 1SYGA 5JVG3 1PZKD 1DONA 4PQXA 1O78A 4OO1G 1HTLD 1X3QA 3QWNA 3S15B 3M3YB 4N9TA 2L5TA 1D6EC 3SK5A 3P75A 5C4ZA 2LS01 3A8KE 4ULLA 1S5BD 2ZXRA 1SE4A 5CV9A 5HGTA 1AZPA 2F0JA 1PFMA 1U4MA 2RSNA 2PPBC 4X3TA 1CA6A 1SSOA 1DXMA 1M4VA 1PRTC 5I2XA 1I6VC 3I73A 4IUQA 3MHBA 4IZ8A 1U4PA 4EQPA 1UEAB 2JEBI 4X3KA 3NTKA 4IUPA 1B9MA 5DNFA 5C6AA 1SYDA 1YNNC 2A69D 5JPNC 4MIUA 1F9RA 3L9AX 3H0GB 4F87A 1RD9D 4QMGA 3D4DA 1AZQA 2A6ED 3MXUA 5J1ZA 2KHSA 3SXHA 5D65A 3CU7A 4DXFA 5ELDA 5CORA 4DAYA 5I4DA 1I4PA 1GJXA 5E3FA 4KHVA 1LT4D 5C5LA 4QCLA 1LTRD 2ZT9C 4R8NA 1K8OA 3DWAA 4TQUS 3T4AC 4ZUJA 2RSOA 2L55A 2K6AA 1Y69U 5A2QE 3HKZB 3NUCA 4HN7A 2BDOA 3RMHA 1DOMA 1SMYD 2MJ8A 1SE2A 4A3BB 5I2YA 3R2TA 4FF2A 2JA8B 4O1NA 2BA0A 2PZWA 3I4MB 4OO1I 1E2VA 5CBEE 5C4HA 5KIXA 1T5XD 3C2PA 3KF8A 2PZTA 3R3OA 3TMEA 3J7YW 5D3IB 2A6HC 3I70A 1DOKA 3QIAA 5K5PA 2DNEA 4IUTA 1B9NA 1QB5D 1RDPD 1TY0A 2TMPA 3Q6SA 3PUYA 2CHBD 3NK9A 2KA7A 5J39A 3BVGA 2K01A 2H4OA 3NPPA 4PMBA 2L0CA 5I9PA 2XN9C 1VCIA 1DCZA 5E4XA 3DUZA 2NVXB 1WTWA 3T13A 2KCCA 5E1FA 3HG9A 1WD1A 3HOWB 2K1BA 3VR5A 1K8MA 4KK7A 3N52A 4XQQA 1Y8NB 3H09A 3F2UA 4HAEA 5IGGA 1WVLA 3BDOA 1YNND 5C4JB 1HUMA 4C3IG 2F0DA 1CI3M 5IIFA 3I4LA 4NP5A 2WKCA 1MSHA 4G7OC 2MHVA 1SNOA 1STNA 1QJOA 4HSPA 3K5MA 5CBAE 1QE6A 2F0QA 4L6TB 3QB3A 4O42A 2NTSA 4UAIA 4DAVA 1JOKA 2G9HD 3D4RA 1E2WA 2B2UA 3J7AV 3O13A 4F7XA 2K5WA 1F9QA 3NBHA 2NN6H 5JAVA 2AUKA 2RBMA 5M5WB 2VUMB 2V4DA 2ICIA 3QOJA 3SK8A 4DU9A 1LV9A 5IODA 3MZ5A 4B08A 5K36H 1I4XA 2NN6G 1BCPD 3BZDB 3HZXA 3OW7A 1EYDA 4KMUC 1YNJD 1GXDC 3VYSA 3PIP3 1SYBA 3C3LA 3K0YA 5J22A 2EY1A 3ND9A 2PZUA 4KKSA 3HOZB 1BCPF 3CKIB 4ODGA 2KVMA 3A8JE 5IT9L 2JYOA 1V43A 5NUCA 1EWHA 1NSNS 2R61A 2KOLA 1TU2B 1ENFA 3D6WA 3OSOA 1IL8A 3GTKB 4KHZA 4DFAA 3K5OA 1TS2A 4FF3A 1EU4A 1O80A 3PIO3 2ID0A 4Q5VA 3W3AA 4KKTA 3HS0C 4XQJA 3PUXA 3PO2B 1SBBB 1SNQA 1JQYD 1LO5D 3BDCA 4ME5A 3NHHA 1EOTA 1FNUA 1TWHB 5LHY1 4CHTB 4FNFA 2AWNA 3VYRA 2BDNA 5ELEA 1PZID 2C5CA 1B53A 2Q8RE 4A3MB 1IKLA 3K58A 3S1RB 2A74C 2F1MA 4KV6A 2R92B 3FPUB 2O4XA 5C5MA 1WTRA 3NSWA 1LLRD 3NXWA 3VR3A 4K5XA 1U9RA 2LFNA 1BCPB 1JICA 1I6HB 1ZEQX 1K83B 4WRDA 1CFMA 5JJZA 1RJTA 4BBRB 1QNKA 5KRUA 2IPKD 3AU7A 3D31A 1CHQD 1EIHA 3MWYW 3K57A 2F0HA 2FINB 2VNUD 2E75C 5I6WA 1B3AA 2XWJB 2F0KA 2NVQB 5CMDA 1BOSA 3GTLB 5DM73 2MPMA 2RKSA 3S2HB 1VMCA 1KTKA 2B2UC 2XWBB 2EYHA 1SFOB 1IYUA 1Q3LA 2IT1A 3RUZA 4FF4A 4JBWA 4KJOA 1EQVA 4C56C 5CV5A 2PNRC 1EY9A 1V1OA 1GUNA 4LAAA 4BY1B 3FKIB 4U68A 2L4NA 4ZRZA 1W6JA 1VF7A 4FXGC 3H6MA 1VF5C 4KTAA 1EWCA 3KUPA 4CJ2C 2KQ3A 3Q24A 1GUGA 2B2TA 2B2VA 1PFBA 2ICEC 2Z8LA 1V1PA 4IN3A 5FLXL 2KCNA 1D1KA 4DN4M 1EU3A 3JAME 3DWPA 3TSSA 2YYZA 1XX8A 4CGYB 1EL0A 1LTSD 1QILA 4BBSB 1FR3A 2BA1A 3BVMA 3E6ZX 5CV7A 2SNMA 4OIJA 1R4PB 2O5JC 4RGTA 2TSSA 4LMQD 1X3PA 1TR5A 5TSSA 3MEHA 1WTPA 2WIIB 3S16B 4HTHA 2CQAA 2XIWA 1HCZA 5FKAC 5JOBA 1WCMB 1ESFA 5FLXE 2F3VA 4DXGA 4H7BA 2M9VA 3D6CA 5F2DA 5HURA 1DM0B 2QDBA 4K2KA 1L0XB 3P1HA 2WINB 2EJGC 5ISRA 1XTCD 4LJZC 3VR4A 2A68D 1HHVA 1PRTD 1Q1EA 2WKDA 4BS9A 3A8IE 1KABA 1QCBD 4XTCS 1TS3A 4XIGS 1ENCA 3GTMB 3H91A 2PCFB 3K7AB 5CR3A 2KJXA 2K28A 2KUMA 3PV0A 4DGZA 5T1GA 1I50B 3URYA 4ZKBB 3NP8A 5JVH3 1EEFD 3A55A 4KI0A 2A73B 1ZKOA 4FXDA 2OXPA 4BA2I 1S5CD 2NBFA 1BF4A 2NB0A 5EPLA 3RLFA 1SE3A 4XYOA 2MP1A 2A5HA 3JAML 2VB3X 1A15A 2B2WA 3SDZA 2JSOA 1UNSA 2NVYB 1D5MC 2ENBA 2FFKB 4R9WA 4HR7B 4OHJA 2EY2A 1WTXA 4FF1A 3VA7A 3GTOB 1B1ZA 2X69A 5IGCA 2FMCA 5EKKA 3GTJB 2EYMA 1EZ6A 2K33A 1OXXK 3SVMA 4HCEA 5ELBA 1G2TA 4CJ0B 1B2TA 1JB3A 1JC7A 2F0EA 5JEAJ 3BDLA 2D9UA 2WACA 2Z4HA 3ONAB 2B2YA 2J0TD 1Z47A 5IGEA 2D2CC 4CKBA 2B2TC 1ZYRD 1EEID 5IGBA 2VXWA 4IURA 3X3NA 2RDGA 3KLRA 3EFXD 2RA4A 1PTOD 5JEAG 5EQ0A 1D5XC 4OO1H 2D62A 1HTPA 1JCKB 1SJED 3TDQA 1SEBD 3SE0A 2F3WA 3R8BA 4C3HG 4B9WA 1H9RA 1O7YA 2EYFA 1CK1A 4DNTB 2K5DA 1TT2A 1HPCA 4C3JB 2PW5A 4H13C 3P20A 2CW0C 3VYUA 5CC4A 5LL6S 4FVMA 1GUOA 4DF7A 5C3EB 1NUCA 1MD2D 2JXMB 5AFWA 4C3JG 2JA7B 5CV6A 3C46A 5C0XJ 4C1NI 2K7VA 2NTTA 3FRPB 1C48A 4J6HA 1H9JA 4F8MA 4CKEA 1JWUD 2WP8J 5KYIA 1BO0A 5EPJA 3ND8A 3BG3A 1CM9A 1BR9A 3LWEA 1XYIA 3I91A 1CZGA 1EZ8A 2XRQD 5A35A 2L1BA 2HQEA 3OOCA 3DEOA 2JEAI 1AW7A 2PW7A 5C0XG 4I65A 2B39A 1JWMD 2QCPX 1W6KA 2AQ3B 1A2TA 2MGSA 5IOCA 2M2LA 4DAPA 2EZVA 1UUPA 4XQNA 2J7ZA 4XT1B 5G3LD 5K36G 1GHJA 4K2LA 4K5VA 4RCOA 3V96A 4J8QA 5D3DA 2NUCA 2DN8A 3TP6A 4U673 2EVBA 5BN4A 3I8ZA 3MA2B 3EQLC 1KLUD 3GV3A 5FO8B 4IUUA 2XSCA 5EBCA 3SHLA 5M3MB 2Z4IA 2JA6B 1BCPC 3GP7A 3K5NA 1QWYA 2C9OA 3R93A 5C3XA 1CTMA 1PTOB 1FNWA 4YIJA 5CV8A 5D14A 5CYUA 2QKIC 1LTGD 2WB1B 3KLSA 1D5ZC 1KNAA 1QNUA 3I3CA 2A6EC 3DHQA 2EY5A 1TWAB 2SOBA 3PMFA 4C1NK 4J1MA 1MBYA 1TWFB 4A3GB 2RQXA 3MAQA 1Z7TA 2QF7A 4WFN3 1BNZA 1V1PB 3KLSX 3HGBA 1RCVD 1G291 5KYLA 4LK1C 3J80E 1C4QA 2RVLA 4A3EB 4HMJA 1BXTA 2JP1A 3KK7A 1GUSA 1GUWA 1B4OA 1XWEA 5JPMC 2EOTA 1BBXC 5IGDA 1RTNA 1CT1D 1HA6A 4G7HC 1STBA 1S4ZA 4NW2A 2DNCA 2DY7A 5M5XB 1PTOF 3HEJA 3NQIA 2EE1A 1I4HA 1LTID 1BDOA 4KKUA 1KDBA 2EYPA 3HOVB 3SK4A 4TRDA 1FD7D 2IW3A 4ILWA 1AFPA 4ZYSA 3SK6A 1DOLA 4NKLA 4H0LC 4KY6A 4QF4A 3MXPA 5EKLA 1NAPA 3ERQA 5KGUA 1ONLA 4FP5D 3TP7A 3RZDB 1TQOA 3S1MB 4RGNA 4FO2A 1I4RA 2CVRA 2F0VA 2FHTA 1IW7C 2FJ2A 1HA5A 3QO2A 3U9OA 5EGTA 5BN5A 2L11A 3D4WA 2N55A 5CGKA 4V190 1PXUA 3J7AF 2XVSA 4DK1A 2N88A 1Q12A 4HCSA 1ILPA 3AMUA 1KAAA 5EPKA 2KEDA 2FMMA 3S14B 2L12A 1NCVA 1ICWA 2F0SA 3TP5A 4RGMA 5BN3A 3NWSA 3T16A 3WOFA 1EYCA 1LT3D 1CQVA 2BOSA 1R9TB 1NR2A 1LTAD 4PMCA 3MXNA 3S1QB 2IJ0A 5ELFA 1F77A 1RF2D 4G57A 1EY6A 1IKMA 3S17B 2B63B 2GA4B 3I4NB 1PZJD 3GD7A 3OWFA 5I6YA 3V2TA 1SMYC 4TSSA 4E6IA 1WTOA 1STYA 3DXJC 1C8CA 3OPOA 5C0XH 3I90A 1SYEA 3BS1A 1RKNA 1F2LA 1F9SA 3IFDA 4QUCA 2EYOA 3D8GA 4S3SA 1LTTD 1PRTF 4RCNA 2B2WC 3GTQB 3LNNA 1TY2A 1EYAA 4EVOA 1TS4A 4A3KB 1II3A 1CHPD 1OXTA 4HMIA 1TWGB 1D2BA 3FVQA 1S5DD 1ILQA 3UI2A 3ZYYX 1AP0A 2BCOA 1F2YA 2IX0A 4GZYC 4XDXA 1PMRA 2F0GA 3S2DB 3RZOB 1SYFA 1ET6A 2B2YC 1EFID 4G7ZC 4K8IA 3P7JA 3R2IA 3C1FA 3A56A 4FXKC 4ZAIA 2F0FA 2EPBA 3KBXA 1Q1BA 3MTSA 3OMGA 1IYVA 1WD0A 3HOXB 3BYTB 1VMPA 3S9WA 2EDGA 3H94A 5IGFA 1PTOH 2E2JB 4IUVA 2K5QA 3T51B 2PO4A 3ITPA 4OL7A 3PUZA 5M5YB 3L3OC 1PRTB 4Z9CB 3C1EA 4IUNA 5EJWA 3BYYB 3EROA 1TKWB 2B8FA 3W2DA 1B44D 1HFNA 4K6LA 4A93B 1Y8PB 1STEA 1JOOA 1G2SA 1SNDA 2L9HA 1VDZA 2KECA 1JOQA 2F0UA 1I3QB 5KNBA 3M7NA 1SJHD 2BE5C 4C3HB 2B8GA 2Z1CA 2CW0D 3OHXC 4UDUC 4P2CB 2NN6I 3MFGA 2EJFC 2NYZD 1PFNA 2F0TA 1TIID 5A2QL 4QUFA 1AEXA 1CZWA 1SYCA 1JR0D 1T5EA 5C4XB 1F9PA 3VR6A 3A54A 1KDAA 2BE5D 1ESRA 1LT5D 4IQZA 1A3VA 2O5IC 4KN7C 4AYBB 2WAQB 4RGOS 1EIGA 2A6HD 4L8JA 2M00A 2F0IA 3QOLA 1A3TA 1TS5A 2A69C 5ELCA 2F0WA 1OXVA 4XXEA 4RKBA 2JA5B 3IKJA 2O2LD 3KBGA 3DWQA 2OEOA 4IFDJ 3N6RA 4TKOB 3TN2A 4RWSC 1MGSA 4RHRA 2NZ1D 1IW7D 4DK0A 4JK1C 2IX3A 3T56B 1V8QA 1DD2A 4M8AA 2EY6A 5CV4A 4NDXA 1KNEA 1PYWD 5C3WA 1PDQA 3M7GA 3V05A 3MVVA 1UAPA 2SEBD 3G7LA 1F2MA 1H9SB 4WORA 1Z6HA 4OIKA 1ENAA 2X6LA 1I4QA 1SNCA 1L0YB 2HUGA 2AUJD 3VR2A 2R3ZA 4K6DA 4ZKCB 2OT2A 3VA5A 4L63B 3WDNA 4B9XA 1JORA 4ZK9B 1G91A 1HUNA 2LY7A 3J80L 3NWTA 1QOHA 3GO5A 5M3FB 4RHSA 1Y1VB 3I72A 2IL8A 1S5ED 5FK9C 4EQOA 1R4QB 4WJWA 2JE6I 3CRLC 4RFBA 3IL8A 2LMCB 4MHEA 3MXGA 4A3DB 4A3FB 4A3JB 3DM1A 2XNAC 1EY4A 1ZYRC 2Q8TA 3Q0AA 1MSGA 3MC0B 2IX1A 3GTPB 3J81L 1A3UA 1JE4A 4CJ1B 2XRSD 2F0LA 4QIWB 2PMZB 1G6ZA 2F03A 2NVTB 4IFDH 1KLGD 2PYKA 4N9PA 3K59A 3CQZB 1O7LA 5DAUA 1PTOC 1LACA 4PV1C 4XYQA 3BVZA 3T53B 1MI2A 4R8IA 2R6GA 3HRZC 1IHZA 4K5WA 4PNYA 3CRKC 3E0JA 5EKIA 1GUTA 3VYTA 5COYA 3NE5B 1STHA 2E76C 3G6JB 1ZXTA 1ML0D 2VB2X 3OWEB 4K8JA 1HRJA 4ZQ3A 1J8IA 3LWUA 2PQEA 2F0PA 4ABNA 1WTQA 1A2UA 5KNCA 1DYQA 2HDMA 4RH6A 5EBDA 1E0BA 3FMCA 4MN3A 2KEEA 2WV6D 3SEBA 1RODA 1OXSC 2EYLA 3TBIB 4KD4A 1PLFA 1SXTA 2J4XA 2K05A 1M8AA 1AN8A 3CHBD 2E2IB 4DA2A 2DY8A 3GQBA 1H9MA 4H44C 3M85A 1LT6D 4BY7B 1CQFA 3MFYA 4CBVA 3SR1A 2SDFA 3OMCA 2G9DA 5E4WC 3K5LA 1FGBD 1BQQT 2Y0SB 4QB4A 5IT9E 4EGVA 2B2VC 1RTOA 1EY0A 1S5FD 4HSVA 3EVQA 3GTGB 4IFDG 1GHKA 1D1IA 2LKVA 1J9OA 1KDCA 3D3RA 4C3IB 2X6GA 4C2MB 4IFDI 1QG7A 5M9OA 2E2HB 2EJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKC B;  2EOT A;  1AP0 A;  1ZXT A;  1ML0 D;  4XT3 B;  1NR2 A;  1BBX C;  1RTN A;  3FDT A;  1HUM A;  2K04 A;  1HA6 A;  1HRJ A;  3DEO A;  1G2T A;  4CJ0 B;  1J8I A;  2MPM A;  4ZK9 B;  1B2T A;  1S4Z A;  4XDX A;  1MSH A;  1VMC A;  4NW2 A;  4RAU C;  1WTQ A;  1DON A;  1G91 A;  2NYZ D;  5CMD A;  1PFN A;  2DY7 A;  1HUN A;  1EOT A;  2D9U A;  2B2U C;  2HDM A;  4X3S A;  1X3Q A;  4QUF A;  1WTV A;  1HHV A;  2EE1 A;  2MGS A;  5CBA E;  1E0B A;  3ONA B;  1QE6 A;  2B2Y A;  4MN3 A;  1B50 A;  2M2L A;  1Q3L A;  1F9P A;  2B2Y C;  2KEE A;  1ROD A;  2HDL A;  1NR4 A;  4O42 A;  2BDN A;  2J7Z A;  2RSO A;  4XT1 B;  1IKM A;  3P7J A;  1DZ1 A;  1PLF A;  2IL8 A;  4UAI A;  2B2T C;  1ESR A;  4ZAI A;  2VXW A;  4X3U A;  1B53 A;  2Q8R E;  4IUR A;  1IKL A;  2EPB A;  3H91 A;  2K05 A;  3KBX A;  1M8A A;  2B2U A;  3IL8 A;  3MTS A;  1DOM A;  5T1I A;  1WD0 A;  1F9Q A;  4U68 A;  3I8Z A;  1DOL A;  2MJ8 A;  2HCI A;  4MHE A;  2L4N A;  2RA4 A;  2K28 A;  2DY8 A;  2KUM A;  3DM1 A;  3GV3 A;  1EIG A;  5EQ0 A;  4IUU A;  1VMP A;  1NAP A;  1WTO A;  1AZP A;  3KUP A;  1PFM A;  3FPU B;  4CJ2 C;  1U4M A;  2B2T A;  2B2V A;  1PFB A;  1C8C A;  5T1G A;  2RSN A;  4IUV A;  4ZKB B;  5CBE E;  1WTR A;  3I90 A;  2Q8T A;  3TZD A;  1X32 A;  1MSG A;  3R93 A;  1LV9 A;  4X3T A;  1CA6 A;  1CA5 A;  1SSO A;  2SDF A;  3DEP A;  4DN4 M;  3GV6 A;  1RHP A;  5D14 A;  2CVR A;  1F2L A;  1EQT A;  1O7Y A;  2FHT A;  1F9S A;  2FJ2 A;  1O7Z A;  5E4W C;  3QO2 A;  4IUQ A;  1JE4 A;  1XX8 A;  4CJ1 B;  1EL0 A;  1U4P A;  5EJW A;  1DOK A;  1KNA A;  1SAP A;  2L11 A;  2K03 A;  3I3C A;  3TN2 A;  3IFD A;  4IUT A;  1MGS A;  4QUC A;  4RWS C;  1BF4 A;  2N55 A;  1HFN A;  2B2V C;  1RTO A;  2NZ1 D;  5EPL A;  1TVX A;  3Q6S A;  1JIC A;  1SDF A;  4HED A;  1G6Z A;  4X3K A;  2MP1 A;  2H1E A;  4OIJ A;  4IUP A;  4HSV A;  3HP3 A;  5DNF A;  2K01 A;  4LMQ D;  1G2S A;  2N88 A;  1A15 A;  1X3P A;  2B2W A;  1KNE A;  2B2W C;  1F9R A;  4HCS A;  4RA8 A;  5JJZ A;  1ILP A;  1RJT A;  2KVM A;  1PDQ A;  1QNK A;  5E4X A;  1WTP A;  5EPK A;  2JYO A;  2KED A;  4ZLT F;  5AFW A;  1WTW A;  2FFK B;  2FMM A;  2HCC A;  2L9H A;  2NWG A;  1AZQ A;  2XIW A;  3MWY W;  2KEC A;  3G7L A;  1J9O A;  4R9W A;  1BNZ A;  1EIH A;  2KOL A;  2L12 A;  1WTX A;  1NCV A;  2FIN B;  1WD1 A;  1ICW A;  3D6W A;  2K1B A;  1IL8 A;  4OIK A;  2X6L A;  1MI2 A;  3N52 A;  4R8I A;  2X69 A;  1U4L A;  2RVL A;  5D65 A;  1HFG A;  2X6G A;  2HUG A;  1B3A A;  1BO0 A;  5EKI A;  5COR A;  3F2U A;  4HAE A;  5EPJ A;  1U4R A;  2JP1 A;  2R3Z A;  1O80 A;  1CM9 A;  3LWE A;  1WVL A;  1XYI A;  3I91 A;  1ILQ A;  1QG7 A;  5COY A;  3UI2 A;  2L1B A;  1GUW A;  1B4O A;  3SVM A; 
#chains in the Genus database with same CATH topology
 2D5D A;  2KHJ A;  2F0N A;  3FDT A;  2K04 A;  1VQ8 A;  2Q8I B;  3HOW G;  4RAU C;  2VQF Q;  3OIP A;  3IAY A;  4OWX B;  1E2Z A;  1VQA A;  1EY5 A;  1FL0 A;  5C44 G;  2SNS A;  3NBI A;  1H9K A;  1B70 B;  1XNQ L;  3BU2 A;  2F0O A;  1NR4 A;  3PIP A;  1DZ1 A;  1X3G A;  4GS3 A;  3M4O B;  1TXY A;  1X54 A;  4JYA Q;  3J7Z C;  3E9I A;  4X3U A;  4FYD A;  3GTG H;  5BR8 L;  2AWO A;  2HT1 A;  1Y8O B;  4NMZ A;  1HQM C;  2Y0S G;  4JI3 Q;  4IJH A;  1F2Z A;  4EQN A;  3PO3 B;  1K28 A;  4M1U B;  1GOZ A;  1X9N A;  3NTH A;  3EN2 A;  2RDH A;  1SNP A;  4KN4 C;  4NXN L;  2E2D C;  4K14 A;  4LW1 A;  3QJY A;  1CA5 A;  4KY7 A;  4DNR B;  5C0X I;  1VQM A;  3I4M G;  2KCT A;  1HNW Q;  3AYH B;  2XGT A;  3GV6 A;  3AB9 A;  4JC0 A;  5JEA H;  3A5U A;  1E1O A;  1EQT A;  3CD6 A;  5EAY A;  3IFT A;  1D7Q A;  2AQ2 B;  3E5S A;  1SAP A;  3LX0 A;  2I46 A;  2K03 A;  4DR3 Q;  2K32 A;  2RHS B;  2K5V A;  4OGQ C;  1HQR D;  3H3V H;  4HED A;  4DV4 Q;  1EY7 A;  3TZU A;  4ZUI A;  1WOC A;  2H1E A;  4Y7N B;  1VQK A;  3H3V C;  1WJJ A;  4IAL A;  1HNZ L;  1VQ9 A;  5LL6 X;  3HOZ G;  5DEH A;  4DR7 L;  1G8Z D;  3HOW H;  1SNM A;  1UE7 A;  4KHP L;  4V0B A;  4ZLT F;  4KJN A;  1UE6 A;  2HCC A;  2NWG A;  4R4O A;  2HHH Q;  4G4K A;  1N33 Q;  4LNQ A;  1YNJ C;  4LFA L;  1EQQ A;  2EXZ A;  2F4I A;  1HFG A;  3EJI A;  3FPP A;  4F88 A;  3NTI A;  4WJ4 A;  4DV5 L;  4XT3 B;  1V9P A;  2VUM G;  3U4V A;  1XXG A;  1Q8I A;  4Q0F A;  4AIM A;  5KEE A;  5JJK A;  3HOY B;  3OIQ A;  2OF1 A;  1JWS D;  3Q23 A;  5IP7 G;  4X3S A;  1PH1 A;  1WTV A;  3Q22 A;  2YTX A;  1K0R A;  2F0M A;  2EQS A;  2IWH A;  4LF4 Q;  1B50 A;  1A62 A;  1Y1W B;  3I7F A;  2HDL A;  2E74 C;  4LFB L;  1FNV A;  1WFQ A;  1H9S A;  1LAB A;  4CDD C;  1BUV T;  5C44 B;  3PUW A;  2CQO A;  3M4P A;  5T1I A;  2R7D A;  3U9S A;  2CWP A;  3FEW X;  1STA A;  2HCI A;  1I4G A;  5KND A;  2GN5 A;  1RIP A;  1TWC B;  3A7L A;  3TP8 A;  2ALY B;  3HOY H;  4EQ5 A;  1SRO A;  2RDF A;  3QG1 A;  3EA6 A;  4BA1 I;  4MTN A;  1TWA H;  3A7A B;  3TZD A;  3M4Y A;  4DR4 L;  1X32 A;  3K6O A;  1I94 L;  1N36 Q;  3DEP A;  2K14 A;  3HOU B;  1RHP A;  2R7F A;  4BWG B;  5DM6 3;  3OTO Q;  2A68 C;  1FYC A;  1O7Z A;  1X56 A;  2ZXP A;  4A3F G;  1LTB D;  3K7U C;  3PUV A;  2K4K A;  5FOB B;  3NQT A;  3KF6 A;  1TVX A;  3U58 A;  1SDF A;  1ET9 A;  3EBE A;  3S1N B;  4DK3 C;  4OX9 Q;  3DMU A;  3X3M A;  2JA5 H;  5AJ3 L;  3HP3 A;  3WOE A;  2JA6 H;  5FJ8 H;  2I07 B;  4KY5 A;  5M3F G;  4RA8 A;  1BKB A;  1G51 A;  2QEJ C;  4GLV B;  5FO7 B;  2QIL A;  2VUM H;  1KL9 A;  5FO9 B;  3RD4 A;  5M5W H;  3ICE A;  1N33 L;  4RKL A;  3H0G H;  3L7Z C;  3J81 E;  1J5E Q;  3CCQ A;  2R7Z G;  4KD3 A;  3BJU A;  4CKC A;  1A8V A;  4ID6 A;  4PMW A;  1U4L A;  4A3I B;  1EY8 A;  2R93 B;  1VQC A;  1HXY D;  1U4R A;  2YU9 B;  4GN3 B;  1DJR D;  2ZXO A;  1STG A;  2EYJ A;  1OO9 B;  2MUY A;  2ZTC A;  5G3L F;  4X64 Q;  5I9O A;  2AQ1 B;  2DUD A;  2JA8 G;  1OXU A;  1Q90 A;  4I7Z C;  4GKK Q;  1A6X A;  3D0F A;  4YCV A;  1QZH A;  3J7A 5;  1SYG A;  4A3B G;  2R7Z B;  5JVG 3;  3UE1 A;  1PZK D;  1DON A;  4PQX A;  3A5Z B;  1KQS A;  1X3F A;  1O78 A;  4OO1 G;  1HTL D;  2YU9 H;  1X3Q A;  3QWN A;  1KXL A;  3S15 B;  3M3Y B;  5L37 A;  2VQE Q;  4N9T A;  2L5T A;  2N3S A;  1D6E C;  3SK5 A;  1IZ6 A;  3S1M H;  3P75 A;  5IP9 G;  5C4Z A;  2LS0 1;  3A8K E;  3OW2 A;  4ULL A;  1S5B D;  4DV3 L;  2ZXR A;  1HZC A;  3AEV A;  4HIO A;  1SE4 A;  4HJA A;  5CV9 A;  5HGT A;  1AZP A;  2F0J A;  1PFM A;  4MTK A;  1U4M A;  3DM3 A;  2RSN A;  4C3J H;  2PPB C;  4X3T A;  1CA6 A;  1SSO A;  1DXM A;  1M4V A;  4JI1 L;  5JJL A;  1PRT C;  4YWK A;  5I2X A;  1LUZ A;  3J80 i;  4NXM Q;  1I6V C;  3I73 A;  4IUQ A;  3MHB A;  3HOU H;  4IZ8 A;  1U4P A;  4EQP A;  1K73 C;  1VQH A;  4L5T A;  3GTJ H;  3F2D A;  4JYA L;  1UEA B;  1YIT A;  3H0G G;  2JEB I;  4X3K A;  3NTK A;  4IUP A;  1B9M A;  5DNF A;  5C6A A;  1I6H H;  1SYD A;  1YNN C;  2A69 D;  5JPN C;  4MIU A;  1F9R A;  3L9A X;  4C3H H;  2JQO A;  3H0G B;  4F87 A;  1RD9 D;  3GTP H;  4QMG A;  1FJG Q;  3D4D A;  1AZQ A;  2A6E D;  1DGS A;  3MXU A;  5J1Z A;  2KHS A;  3SXH A;  3JAM c;  4IPD A;  1NJI C;  1Y1W H;  4HIK A;  4JCV E;  5D65 A;  3CU7 A;  5ELN A;  4DXF A;  5ELD A;  5COR A;  4DAY A;  5I4D A;  2ZJQ A;  1I4P A;  1GJX A;  3K81 C;  3KF8 B;  5E3F A;  4KHV A;  1LT4 D;  5C5L A;  4QCL A;  1LTR D;  4MNO A;  1CKO A;  1E7Z A;  2HHH L;  2ZT9 C;  4R8N A;  1K8O A;  4DV5 Q;  3DWA A;  4TQU S;  3RZD H;  4B3R L;  4N8X 1;  2E2I H;  1I3Q H;  3T4A C;  5HY6 A;  4ZUJ A;  4L5Q A;  2B3G A;  2RSO A;  2L55 A;  2K6A A;  4BXX G;  1Y69 U;  1CKN B;  5A2Q E;  3L2P A;  3HKZ B;  3NUC A;  4A3D H;  4HN7 A;  2BDO A;  3RMH A;  1DOM A;  1SMY D;  2MJ8 A;  1IBK L;  3GDE A;  1HR0 Q;  1SE2 A;  4A3B B;  5IP7 H;  5I2Y A;  3R2T A;  3H15 A;  1W2B A;  4FF2 A;  4LF8 L;  2JA8 B;  3PQI A;  4O1N A;  2Z6K C;  2BA0 A;  2PZW A;  3I4M B;  4OO1 I;  1E2V A;  1X55 A;  5CBE E;  5C4H A;  1MKH A;  5KIX A;  1T5X D;  3C2P A;  3S14 H;  3KF8 A;  2PZT A;  3R3O A;  3TME A;  3I55 A;  3J7Y W;  1YNX A;  1YIJ A;  1M90 C;  5D3I B;  2A6H C;  3I70 A;  4A3C H;  1DOK A;  3QIA A;  5K5P A;  2DNE A;  4DUY L;  4IUT A;  1B9N A;  1QB5 D;  1RDP D;  1TY0 A;  1PH3 A;  2TMP A;  3Q6S A;  3PUY A;  2CHB D;  3NK9 A;  2KA7 A;  5J39 A;  4HJ7 A;  3BVG A;  1MIU A;  2H5X A;  2H4O A;  2K01 A;  4LUO A;  3NPP A;  3RN5 A;  5GAE C;  4PMB A;  5LMU Q;  2L0C A;  5I9P A;  2EIF A;  2OTL A;  2XN9 C;  1VCI A;  1DCZ A;  5E4X A;  3DUZ A;  3CCU A;  5BR8 Q;  2NVX B;  1WTW A;  1PH7 A;  3OTO L;  3T13 A;  2KCC A;  5E1F A;  3HG9 A;  4HJ5 A;  1WD1 A;  3HOW B;  2K1B A;  4WJ3 M;  3VR5 A;  1K8M A;  4PZ8 A;  1XPO A;  4KK7 A;  3N52 A;  1VQL A;  1UE5 A;  4XQQ A;  1Y8N B;  3H09 A;  1MJC A;  3FHW A;  3F2U A;  4HAE A;  4OX9 L;  5IGG A;  1WVL A;  3CC4 A;  3BDO A;  1YNN D;  5C4J B;  3UDG A;  3E0E A;  2KHI A;  1HUM A;  3PGZ A;  4C3I G;  2F0D A;  1CI3 M;  4J15 A;  5IIF A;  3I4L A;  4NP5 A;  2WKC A;  1MSH A;  4G7O C;  4PG3 A;  1LYL A;  4ZCK A;  4AYB G;  2MHV A;  1SNO A;  1STN A;  1HR0 L;  1QJO A;  4HSP A;  3K5M A;  5CBA E;  1QVF A;  1QE6 A;  2F0Q A;  4L6T B;  3QB3 A;  4O42 A;  1ASY A;  2NTS A;  5J3B A;  3CCV A;  1EIF A;  4UAI A;  4DAV A;  1JOK A;  2G9H D;  1YHQ A;  2OQ0 A;  3D4R A;  1E2W A;  1NNX A;  2B2U A;  3J7A V;  3O13 A;  4F7X A;  2K5W A;  1F9Q A;  3NBH A;  2NN6 H;  3F2B A;  5JAV A;  2AUK A;  4CDF C;  3HOY G;  1JE5 A;  2RBM A;  5M5W B;  2VUM B;  2V4D A;  1I5F A;  2ICI A;  3QOJ A;  3SK8 A;  4DU9 A;  1VQ4 A;  1LV9 A;  2VL6 A;  5IOD A;  3MZ5 A;  4B08 A;  3FKI H;  5K36 H;  4P71 A;  1I4X A;  4BY7 G;  2NN6 G;  1BCP D;  5FLM G;  4B3S Q;  3BZD B;  3HZX A;  3OW7 A;  1EYD A;  4KMU C;  4YWL A;  4JOI C;  1YNJ D;  1GXD C;  3VYS A;  3PIP 3;  4P73 A;  1SYB A;  3C3L A;  1L1O B;  3K0Y A;  5J22 A;  1UWV A;  2EY1 A;  1KRT A;  4DR6 L;  3ND9 A;  4JI6 Q;  2PZU A;  4KKS A;  2K5H A;  2B63 G;  3HOZ B;  1BCP F;  3CKI B;  4ODG A;  4A93 G;  2KVM A;  3A8J E;  4IPH A;  5IT9 L;  3I4O A;  2JYO A;  1V43 A;  5NUC A;  4R4C A;  1EWH A;  1NSN S;  5M5Y H;  2R61 A;  4JI3 L;  1K8A C;  3GTO H;  4P72 A;  2KOL A;  1TU2 B;  1ENF A;  3OYY A;  4YCU A;  3D6W A;  3OSO A;  1IL8 A;  4QIW E;  3GTK B;  4A3K H;  4KHZ A;  4DFA A;  3KJP A;  1XMO Q;  3K5O A;  1TS2 A;  3M9B A;  4FF3 A;  1EU4 A;  1O80 A;  3PIO 3;  5GAG C;  2ID0 A;  4Q5V A;  3W3A A;  4KKT A;  5C4X H;  4JI4 Q;  2R7Z H;  3HS0 C;  4XQJ A;  4OWT B;  3PUX A;  3PO2 B;  1SBB B;  3QR8 A;  1SNQ A;  1JQY D;  1LO5 D;  3BDC A;  5M5X H;  1H95 A;  4ME5 A;  3NHH A;  3HOX G;  4DV2 L;  1PFS A;  4LWC A;  4QY7 A;  1VQI A;  1EOT A;  1FNU A;  1TWH B;  5DLQ E;  5LHY 1;  3UDI A;  1QUQ A;  4CHT B;  2E5L L;  4FNF A;  2AWN A;  2R92 H;  3VYR A;  2UUC L;  2BDN A;  3PO2 H;  5ELE A;  5IYC G;  4OWW B;  1PZI D;  1XJV A;  2C5C A;  1B53 A;  2Q8R E;  4A3M B;  4A3C G;  1IKL A;  3K58 A;  1JJG A;  4IJL A;  1IBK Q;  3NEN A;  3S1R B;  2A74 C;  2F1M A;  3CXC A;  4KV6 A;  2R92 B;  1P8L A;  3FPU B;  3RNU A;  2UUA Q;  2O4X A;  4HID A;  1A0I A;  1XPU A;  5C5M A;  4JI2 Q;  1WTR A;  4JI5 Q;  3RZO H;  3NSW A;  1LLR D;  3NXW A;  3FP9 A;  3VR3 A;  4B3S L;  1JT8 A;  4GKK L;  2D0P A;  4YHH Q;  4A3J G;  4K5X A;  4A3D G;  1U9R A;  3M3Y H;  2LFN A;  1BCP B;  1JIC A;  5IYB H;  3CME A;  1I6H B;  2GVA A;  1VS0 A;  3CCJ A;  3HOV G;  1VQG A;  1MHW C;  1ZEQ X;  1K83 B;  4OEM B;  4WRD A;  1Y1V G;  3Q8D A;  3W1B A;  1CFM A;  5JJZ A;  1RJT A;  1HZA A;  1QNK A;  4BBR B;  4A93 H;  5KRU A;  1NE3 A;  2IPK D;  1HNX Q;  3AU7 A;  3D31 A;  1CHQ D;  1EIH A;  3MWY W;  3K57 A;  5IY0 A;  2F0H A;  2FIN B;  4FDB A;  1HZB A;  1S72 A;  2Y0S E;  2VNU D;  3CW2 C;  2E75 C;  5M3F H;  5I6W A;  1IBM Q;  2UXD L;  3HKZ E;  1B3A A;  4AQY Q;  1PH5 A;  3CC2 A;  1QZG A;  2XWJ B;  2F0K A;  2NVQ B;  5CMD A;  1BOS A;  4MZ9 A;  1PYS B;  1LTL A;  3GTL B;  5DM7 3;  4LF6 L;  2UU9 L;  1YJN A;  2MPM A;  2RKS A;  3S2H B;  1VMC A;  1KTK A;  2B2U C;  2XWB B;  2EYH A;  1SFO B;  1B3Q A;  2JK8 A;  1IYU A;  1Q3L A;  2IT1 A;  3RUZ A;  3UDX A;  4FF4 A;  4JBW A;  4KJO A;  1EQV A;  4C56 C;  5CV5 A;  2PNR C;  1EY9 A;  1V1O A;  1GUN A;  4LAA A;  2JJQ A;  4BY1 B;  3FKI B;  3ULP A;  4U68 A;  2L4N A;  4ZRZ A;  1W6J A;  1VF7 A;  4FXG C;  3H6M A;  1VF5 C;  4KTA A;  1EWC A;  3KUP A;  4CJ2 C;  4DV7 L;  2KQ3 A;  3Q24 A;  1GUG A;  2B2T A;  2B2V A;  1PFB A;  2ICE C;  4LF5 Q;  2JA5 G;  1TWC H;  2Z8L A;  1V1P A;  4IN3 A;  5FLX L;  2KCN A;  1D1K A;  4X64 L;  4DN4 M;  2E8G A;  2QEX A;  1EU3 A;  3JAM E;  2VS1 A;  5M3M G;  3DWP A;  3TSS A;  3J81 i;  5C4J H;  2YYZ A;  1XX8 A;  4CGY B;  1EL0 A;  2WAQ G;  1LTS D;  1QIL A;  1YBY A;  4BBS B;  5LMN Q;  1FR3 A;  2BA1 A;  3BVM A;  3S2H H;  4PZ6 A;  3E6Z X;  5CV7 A;  2SNM A;  2D0O A;  4GOP B;  4OIJ A;  1R4P B;  2O5J C;  4RGT A;  3STB D;  3GTQ H;  4UHV A;  2TSS A;  2PI2 E;  4LMQ D;  1X3P A;  2OQK A;  1TR5 A;  5TSS A;  3MEH A;  1WTP A;  2WII B;  1VQF A;  3S16 B;  1AH9 A;  4HTH A;  2CQA A;  2XIW A;  1HCZ A;  4A3L H;  5FKA C;  4DR5 Q;  2Q2I A;  3T1H Q;  1SR3 A;  3ZJY C;  5JOB A;  2JA8 H;  1WCM B;  1ESF A;  4LF9 Q;  5FLX E;  2F3V A;  4QQB X;  3BZK A;  4K0K L;  2G5D A;  4DR6 Q;  4DXG A;  4CDC C;  4H7B A;  4CDE C;  2M9V A;  1QVG A;  3D6C A;  5F2D A;  5HUR A;  1EYG A;  1DM0 B;  2QDB A;  4K2K A;  1IYJ B;  1L0X B;  2NVQ H;  3P1H A;  2WIN B;  2VY3 A;  2EJG C;  4NPS A;  2WAQ E;  5ISR A;  1XTC D;  3S24 A;  3CQZ H;  4LJZ C;  3VR4 A;  2A68 D;  4DAM A;  1HHV A;  3I4M H;  1XMQ Q;  2JA7 G;  1JJC B;  1UEB A;  2HIX A;  2OWO A;  5C3E G;  4GNX B;  1PRT D;  1Q1E A;  2WKD A;  4BS9 A;  2MFI A;  3K8A A;  3F2C A;  1N36 L;  3A8I E;  1KAB A;  1QCB D;  4XTC S;  1TS3 A;  4XIG S;  4BY1 H;  1ENC A;  4I7A A;  1TWG H;  3KF6 B;  3GTM B;  3PCO B;  3H91 A;  2PCF B;  4ME3 A;  3K7A B;  4A3F H;  5CR3 A;  1RL2 A;  4JOI A;  2KJX A;  5GRO A;  2MO0 A;  2K28 A;  2KUM A;  3PV0 A;  1VQJ A;  4DGZ A;  4JI7 L;  5T1G A;  1I50 B;  3URY A;  4ZKB B;  1VQO A;  5AJ3 Q;  3NP8 A;  4X65 L;  5JVH 3;  1EEF D;  4KLK A;  3A55 A;  4A3E G;  4Y52 H;  2N8N A;  4KI0 A;  1K83 H;  2A73 B;  1CSP A;  1ZKO A;  2F4V Q;  1SMX A;  4FXD A;  2OXP A;  3CCM A;  4BA2 I;  4DK6 C;  1S5C D;  2NBF A;  1BF4 A;  2NB0 A;  5EPL A;  3RLF A;  4RG1 A;  4DR2 L;  1SE3 A;  3U50 C;  4XYO A;  2MP1 A;  2A5H A;  4P74 A;  3ULJ A;  3JAM L;  4QJF A;  4DR1 Q;  2VB3 X;  4DV0 L;  1A15 A;  2B2W A;  3SDZ A;  1KD1 C;  4A3G G;  4N8F A;  2JSO A;  1UNS A;  2HQL A;  2NVY B;  1D5M C;  2ENB A;  2FFK B;  2K50 A;  4R9W A;  4HR7 B;  4OHJ A;  2E2H H;  2EY2 A;  1WTX A;  5GAH C;  3T1H L;  4FF1 A;  3K7A H;  5LMU L;  3VA7 A;  4LFC L;  3GTO B;  3H3V I;  3I56 A;  1B1Z A;  2X69 A;  5IGC A;  4KHP Q;  2FMC A;  5EKK A;  1PVO A;  4K0K Q;  3I2Z A;  3GTJ B;  1HNZ Q;  2EYM A;  1EZ6 A;  3VDY A;  2K33 A;  1OXX K;  3SVM A;  1XMQ L;  3PO3 H;  4JBK A;  4HCE A;  4EX5 A;  5ELB A;  1G2T A;  4CJ0 B;  1B2T A;  1JB3 A;  1JC7 A;  4LUV A;  3CPF A;  2F0E A;  5JEA J;  3BDL A;  2D9U A;  2WAC A;  2Z4H A;  3ONA B;  2B2Y A;  2J0T D;  1Z47 A;  5IGE A;  3GTM H;  2D2C C;  1XNR L;  1Z9F A;  2DGY A;  3CAM A;  4DV0 Q;  4CKB A;  1IBL L;  3GTL H;  2B2T C;  1ZYR D;  1EEI D;  2I5H A;  5IGB A;  2VXW A;  4LF9 L;  5C4X G;  1AE3 A;  4IUR A;  3X3N A;  2RDG A;  3KLR A;  4P75 A;  4JI8 Q;  1HJP A;  3EFX D;  2RA4 A;  1PTO D;  5JEA G;  5EQ0 A;  1D5X C;  4OEL B;  4OO1 H;  2D62 A;  1HTP A;  4A76 A;  2PMZ E;  3M4O H;  1JCK B;  1SJE D;  3TDQ A;  1SEB D;  1K3B C;  3SE0 A;  1E24 A;  5GAD C;  2F3W A;  4C3I H;  3R8B A;  4C3H G;  3KOJ A;  1E3P A;  3AQQ A;  4B9W A;  2JA7 H;  1H9R A;  4IOC A;  4QGU A;  1O7Y A;  1BBU A;  4X66 Q;  2EYF A;  4DV1 L;  1CK1 A;  4DNT B;  2K5D A;  1I94 Q;  5H1S E;  1TT2 A;  1HPC A;  4C3J B;  2L15 A;  3I4N G;  1Q8K A;  3GTK H;  4DNI A;  2PW5 A;  4H13 C;  1XNQ Q;  3P20 A;  2CW0 C;  2CH4 W;  3VYU A;  3CF5 A;  1HR0 W;  5CC4 A;  5LL6 S;  4FVM A;  2AKW B;  2E5L Q;  2ASB A;  1GUO A;  4DF7 A;  5C3E B;  1NUC A;  2UXB L;  1MD2 D;  2JXM B;  5AFW A;  4C3J G;  2JA7 B;  4JI6 L;  1VQ7 A;  5CV6 A;  3C46 A;  3TEH B;  5C0X J;  2DJF C;  4C1N I;  2K7V A;  2NTT A;  3FRP B;  1C48 A;  4J6H A;  1H9J A;  4F8M A;  1EIY B;  4CKE A;  1JWU D;  2WP8 J;  5KYI A;  4UP7 A;  3T1Y Q;  1BO0 A;  4R1J A;  5EPJ A;  2RCN A;  3ND8 A;  3BG3 A;  1GVP A;  1CM9 A;  1BR9 A;  3LWE A;  1XYI A;  3I91 A;  1CZG A;  1EZ8 A;  2XRQ D;  5A35 A;  2L1B A;  1L0W A;  3U4Z A;  2HQE A;  4DV7 Q;  3OOC A;  3DEO A;  2JEA I;  1AW7 A;  2PW7 A;  5C0X G;  1WCM G;  4I65 A;  2B39 A;  1JWM D;  2QCP X;  2PNH A;  1W6K A;  4JI8 L;  2AQ3 B;  1A2T A;  4B3R Q;  2MGS A;  4YCW A;  1EUJ A;  5IOC A;  2M2L A;  4DAP A;  2EZV A;  1UUP A;  4DR5 L;  2NVX H;  2J7Z A;  4XQN A;  4XT1 B;  5G3L D;  4HIM A;  1GHJ A;  4K2L A;  5K36 G;  4K5V A;  4RCO A;  3LGJ A;  4J8Q A;  5D3D A;  2NUC A;  3V96 A;  2DN8 A;  4GKJ L;  3TP6 A;  1VQP A;  4U67 3;  2EVB A;  5BN4 A;  3J80 c;  3I8Z A;  3MA2 B;  1PH6 A;  3CP0 A;  3EQL C;  4IOA A;  1KLU D;  3GV3 A;  5HGQ A;  5FO8 B;  4IUU A;  2XSC A;  5EBC A;  3SHL A;  5M3M B;  2Z4I A;  3S17 H;  2JA6 B;  1PH2 A;  1IBM L;  2UXD Q;  1BCP C;  2VQE L;  3GP7 A;  2CCZ A;  3K5N A;  1SLJ A;  1QWY A;  2C9O A;  1SRU A;  3R93 A;  5C3X A;  1CTM A;  1PTO B;  1FNW A;  4YIJ A;  1TWF H;  3E3X A;  5CV8 A;  2N49 A;  5D14 A;  1W3S A;  5CYU A;  2QKI C;  1LTG D;  2WB1 B;  3J81 j;  2CKZ B;  3KLS A;  1D5Z C;  1SFO H;  1AE2 A;  4A3K G;  1KNA A;  4GN5 A;  1QNU A;  1KAW A;  3I3C A;  2A6E C;  4BY1 G;  3DHQ A;  2EY5 A;  1TWA B;  2SOB A;  4JV5 Q;  3PMF A;  4NXM L;  4NB3 A;  4C1N K;  3ER0 A;  1MBY A;  4J1M A;  5C3E H;  1TWF B;  4A3G B;  1S40 A;  2RQX A;  3MAQ A;  1Z7T A;  2E2J H;  1YZ6 A;  4RMF A;  2QF7 A;  4WFN 3;  4GOP A;  4L5R C;  3M4Q A;  1BNZ A;  2BH2 A;  1V1P B;  3KLS X;  3HGB A;  1RCV D;  1G29 1;  4JI5 L;  5KYL A;  4LK1 C;  3BZC A;  3J80 E;  3CCE A;  3TS2 A;  1Y1V H;  1C4Q A;  2F3I A;  2UUA L;  1YHA A;  2RVL A;  4A3E B;  4HMJ A;  2F4V L;  2I0Q A;  3CPW A;  1BXT A;  4DR2 Q;  2JP1 A;  3KK7 A;  1PV4 A;  1L2F A;  1GUS A;  1GUW A;  1B4O A;  1XWE A;  5JPM C;  2EOT A;  3MXN B;  2QW7 A;  3ULL A;  1BBX C;  5IGD A;  1RTN A;  1CT1 D;  1HA6 A;  2LSS A;  1YJ9 A;  4G7H C;  1STB A;  1S4Z A;  4NW2 A;  4LFB Q;  2DNC A;  2DY7 A;  5M5X B;  1PTO F;  1YJW A;  3HEJ A;  3NQI A;  1QVC A;  2EE1 A;  1I4H A;  1LTI D;  1BDO A;  1WTH A;  4KKU A;  1KDB A;  2EYP A;  4DPG A;  1X65 A;  3HOV B;  4JI0 Q;  3SK4 A;  2DJG C;  4TRD A;  1FD7 D;  2IW3 A;  4ILW A;  1XNR Q;  1HZ9 A;  1N8R C;  1AFP A;  4ZYS A;  3SK6 A;  1DOL A;  4NKL A;  4H0L C;  4KY6 A;  4QF4 A;  3MXP A;  5EKL A;  5LMN W;  4A3G H;  4JV5 L;  1NAP A;  3ERQ A;  1JJ2 A;  5KGU A;  3KYH C;  4HJ9 A;  1ONL A;  4FP5 D;  3TP7 A;  2CH4 A;  4A75 A;  3RZD B;  1TQO A;  2Z6B A;  3S1M B;  2QDL A;  1L1O A;  4RGN A;  2UXC L;  2ES2 A;  4FO2 A;  1I4R A;  3S16 H;  1Q7Y C;  2NZO A;  1C9O A;  1O7I A;  2CVR A;  5ELO A;  4ALP A;  2F0V A;  5IWA Q;  2FHT A;  1IW7 C;  2FJ2 A;  1CKM A;  1HA5 A;  3QO2 A;  3U9O A;  5EGT A;  3NBH B;  5BN5 A;  2L11 A;  3D4W A;  4B3M L;  2N55 A;  5CGK A;  4V19 0;  2JA9 A;  1SE8 A;  4JVZ A;  4GKJ Q;  2ATW A;  1PXU A;  3J7A F;  2XVS A;  4NXN Q;  4DR3 L;  4DK1 A;  2N88 A;  1Q12 A;  5IYD G;  2IY5 B;  4HCS A;  1ILP A;  3AMU A;  1KAA A;  5EPK A;  1VQD A;  2KED A;  4DV6 L;  1HNW L;  4LFC Q;  2FMM A;  3S14 B;  2L12 A;  1NCV A;  2UUC Q;  3S15 H;  1ICW A;  2F0S A;  4OON A;  3TP5 A;  4RGM A;  2K52 A;  3PO2 G;  5BN3 A;  1VQB A;  4X66 L;  3NWS A;  3T16 A;  1LT3 D;  1EYC A;  3WOF A;  1CQV A;  3KDF A;  2BOS A;  1R9T B;  1KC8 C;  1EWI A;  1NR2 A;  1LTA D;  4AYB E;  4PMC A;  3MXN A;  3S1Q B;  2IJ0 A;  2LXJ A;  5ELF A;  3FKI G;  4DV3 Q;  4OXP A;  2Z9H A;  3EIV A;  1F77 A;  3AFP A;  1JB7 A;  1RF2 D;  4G57 A;  1EY6 A;  1BVS A;  1R9T H;  3J81 c;  1IKM A;  1XTD A;  3S17 B;  4POG A;  3RLO A;  4JI1 Q;  2B63 B;  1YI2 A;  2GA4 B;  3I4N B;  2ZTE A;  1NY4 A;  1Q46 A;  1PZJ D;  3GD7 A;  3OWF A;  5FLX c;  5I6Y A;  3V2T A;  4YY3 Q;  2ZJR A;  1SMY C;  4A3I H;  3S1N H;  4TSS A;  4E6I A;  1N9W A;  1WTO A;  1STY A;  4L5S A;  3DXJ C;  1C8C A;  2UU9 Q;  2HD3 A;  3OPO A;  4IPG A;  5C0X H;  3I90 A;  4A3M H;  1SYE A;  3BS1 A;  1RKN A;  2QA4 A;  1F2L A;  4IPC A;  1F9S A;  1N32 Q;  4LF7 L;  2YTV A;  1G6P A;  3IFD A;  4QUC A;  2EYO A;  3W5O A;  2R93 H;  4DUZ Q;  3D8G A;  4JI0 L;  4S3S A;  1L1O C;  1NTG A;  1HNX L;  2CWA A;  1GO3 E;  2VW9 A;  1LTT D;  1PRT F;  4RCN A;  1Q86 C;  1CSQ A;  4A3E H;  2B2W C;  2K5N A;  3CMA A;  3HOX H;  3GTQ B;  3LNN A;  1TY2 A;  1EYA A;  4EVO A;  1TS4 A;  1VQN A;  2WB1 E;  4LF6 Q;  2IHF A;  4A3K B;  1II3 A;  2MNA A;  2WB1 G;  2KCM A;  1N34 Q;  2P5Z X;  1ICF B;  1CHP D;  4HMI A;  1OXT A;  1TWG B;  1QUQ B;  1D2B A;  3FVQ A;  3HOV H;  5M3M H;  3UDF A;  1S5D D;  1ILQ A;  3UI2 A;  3ZYY X;  1M1K C;  3S1Q H;  1AP0 A;  2Z6K A;  3ERS X;  2BCO A;  4Y7N H;  1J6Q A;  2JA6 G;  1F2Y A;  4JI2 L;  4APV A;  4UY8 C;  5IT9 c;  2IX0 A;  1VQ6 A;  4LF5 L;  1PH9 A;  1YVC A;  4GZY C;  4XDX A;  5GQO A;  4B3T Q;  1PMR A;  1S3O A;  3JAM i;  2NVT H;  2F0G A;  3HFZ B;  3S2D B;  3DLL A;  4YWM A;  3RZO B;  1SYF A;  4A3M G;  5JJI A;  1ET6 A;  2B2Y C;  2PI2 A;  1EFI D;  4G7Z C;  3PIO A;  2MO1 A;  4DV2 Q;  4K8I A;  3P7J A;  3STB C;  1YHB A;  3R2I A;  3C1F A;  3A56 A;  4FXK C;  4ZAI A;  2F0F A;  3S1R H;  1C7Y A;  4JPB W;  2EPB A;  3KBX A;  4JI4 L;  1Q1B A;  1Y14 B;  3MTS A;  4BBS H;  3OMG A;  1IYV A;  1WD0 A;  3F1Z A;  3HOX B;  1B7Y B;  5FLM H;  2UXB Q;  1Q82 C;  3BYT B;  2RHQ B;  1VMP A;  3S9W A;  1SN8 A;  2EDG A;  3H94 A;  2PQA A;  5IGF A;  1X6O A;  1PTO H;  4O2D A;  1ASZ A;  2E2J B;  4IUV A;  2K5Q A;  2OCE A;  3T51 B;  2PO4 A;  3ITP A;  1WYD A;  4OL7 A;  3PUZ A;  3TRZ A;  4X62 Q;  5M5Y B;  3L3O C;  4HJ8 A;  1PRT B;  4Z9C B;  2YTY A;  3C1E A;  4IUN A;  5EJW A;  3BYY B;  3ERO A;  1TKW B;  2B8F A;  3W2D A;  4B3T L;  5IP9 H;  1B44 D;  1HFN A;  1EQR A;  4K6L A;  3HKZ G;  2XTI A;  3NEL A;  4BBR H;  4A93 B;  1Y8P B;  1STE A;  1JOO A;  1G2S A;  2I5M X;  1SND A;  3CCR A;  5IWA L;  1A63 A;  1N34 L;  1V1Q A;  2L9H A;  1VDZ A;  2KEC A;  1JOQ A;  3PF5 A;  1FGU A;  2F0U A;  1KHI A;  1I3Q B;  2B29 A;  4BXX H;  5KNB A;  3M7N A;  3TRE A;  1SJH D;  3G4S A;  1C0A A;  1VQE A;  1IL2 A;  4AQY L;  1E1T A;  2NZH A;  2BE5 C;  4C3H B;  1N32 L;  2B8G A;  2Z1C A;  2CW0 D;  3KLW A;  3OHX C;  1VQ5 A;  2V1C C;  1B8A A;  1GM5 A;  4UDU C;  1KIX A;  4P2C B;  3I4N H;  3CC7 A;  2NN6 I;  1OTC A;  3MFG A;  2EJF C;  2NYZ D;  1PFN A;  1NBW A;  2F0T A;  2ZM6 L;  4IO9 A;  1TII D;  5A2Q L;  4QUF A;  1AEX A;  1CZW A;  1SYC A;  4DR7 Q;  1JR0 D;  3F8T A;  1T5E A;  4GLA C;  5C4X B;  1F9P A;  3VR6 A;  3A54 A;  2LXK A;  1KDA A;  2A19 A;  2N78 A;  2K75 A;  2BE5 D;  4GN4 B;  4B3M Q;  1ESR A;  4R4I A;  1LT5 D;  4IQZ A;  4H02 A;  1A3V A;  2O5I C;  4KN7 C;  4AYB B;  4DAY B;  4BBS G;  2WAQ B;  4RGO S;  3KJO A;  1EIG A;  2CFM A;  2A6H D;  4L8J A;  5IYD H;  2M00 A;  3UE0 A;  2F0I A;  3QOL A;  2B63 H;  2EXD A;  1A3T A;  1FJG L;  2AHO B;  3G71 A;  4JW0 A;  1TS5 A;  2A69 C;  5ELC A;  2F0W A;  1OXV A;  4XXE A;  4RKB A;  4AH6 A;  3IKJ A;  2O2L D;  4DKA C;  3KBG A;  3DWQ A;  2JA5 B;  5E7N A;  2OEO A;  2KEN A;  4YY3 L;  3N6R A;  4IFD J;  4O0A A;  1HH2 P;  4TKO B;  2NVY H;  4BY7 H;  3TN2 A;  4DR1 L;  4RWS C;  1MGS A;  4RHR A;  2ZTD A;  2AMC B;  2F52 A;  2NZ1 D;  1IW7 D;  4DK0 A;  4DV1 Q;  4JK1 C;  2IX3 A;  2Q2H A;  3T56 B;  3AFQ A;  1V8Q A;  1DD2 A;  4DUY Q;  4UP9 A;  4M8A A;  2EY6 A;  5CV4 A;  4R4T A;  1KRS A;  4NDX A;  1KNE A;  1PYW D;  1PH8 A;  5C3W A;  3HOZ H;  1PDQ A;  3M7G A;  3V05 A;  4JG2 A;  3MVV A;  4LUZ A;  1UAP A;  2SEB D;  3K0X A;  3G7L A;  1CKN A;  1F2M A;  1H9S B;  4WOR A;  1Z6H A;  4OIK A;  4DR4 Q;  1ENA A;  2X6L A;  2Q2T A;  1I4Q A;  3B6Y A;  1SNC A;  4QL5 A;  4JBM A;  2MQH A;  3KDF B;  4GNX C;  5FJ8 G;  4GNX A;  1L0Y B;  2HUG A;  2AUJ D;  3VR2 A;  2R3Z A;  1NMF A;  4K6D A;  3CCS A;  3CCL A;  1EOV A;  4R4Q A;  2R93 G;  4ZKC B;  1NMG A;  4DV4 L;  4LF8 Q;  2OT2 A;  3VA5 A;  4L63 B;  3WDN A;  4B9X A;  1JOR A;  1TWH H;  4UP8 A;  4ZK9 B;  5IYB G;  3RN2 A;  3PSI A;  1G91 A;  1HUN A;  4TVA B;  1WI5 A;  3G48 A;  2LY7 A;  3KFU A;  3J80 L;  3NWT A;  4BBR G;  1QOH A;  3GO5 A;  5M3F B;  4LF7 Q;  4RHS A;  1BBW A;  1Y1V B;  3I72 A;  1CUK A;  2JN4 A;  2IL8 A;  4LFA Q;  3G6E A;  1GKH A;  1S5E D;  5FK9 C;  2VZA A;  4EQO A;  2QGQ A;  1IXR A;  1R4Q B;  2YV5 A;  4WJW A;  2JE6 I;  3CRL C;  4POF A;  4RFB A;  3IL8 A;  2LMC B;  1FVI A;  4MHE A;  3MXG A;  1PYB A;  4A3D B;  4A3F B;  4A3J B;  3DM1 A;  1J5E L;  2IHE A;  2WFW A;  2XNA C;  4GOP C;  1EY4 A;  4A4I A;  1ZYR C;  2Q8T A;  3Q0A A;  1MSG A;  4UPA A;  3MC0 B;  3JC6 6;  2IX1 A;  1MJE A;  3RR5 A;  3GTP B;  2PQA B;  3J81 L;  4JI7 Q;  3MEF A;  2R92 G;  1A3U A;  1JE4 A;  4CJ1 B;  2XRS D;  3L0O A;  1T9H A;  2F0L A;  4QIW B;  3A74 A;  1K0S A;  3TS0 A;  2PMZ B;  1G6Z A;  3S2D H;  3RLN A;  2F03 A;  2NVT B;  2Z0S A;  3PF4 A;  3SGI A;  3TQY A;  4IFD H;  2GVB A;  1KLG D;  1Y1W G;  4X65 Q;  2PYK A;  4JBJ A;  4N9P A;  1X3E A;  1K8G A;  3K59 A;  4A3B H;  3CQZ B;  1O7L A;  5DAU A;  2A8V A;  1PTO C;  1LAC A;  1XPR A;  4PV1 C;  4XYQ A;  4PZ7 A;  3BVZ A;  3A0J A;  3T53 B;  1MI2 A;  2A1A A;  4R8I A;  2R6G A;  3HRZ C;  1IHZ A;  4K5W A;  4A3J H;  4PNY A;  4X6A H;  3CRK C;  3E0J A;  5EKI A;  1GUT A;  1P16 A;  2C35 B;  3VYT A;  5COY A;  3HKS A;  3NE5 B;  1STH A;  2UUB L;  2E76 C;  3G6J B;  2OTJ A;  1ZXT A;  1ML0 D;  2VB2 X;  3OWE B;  1EFW A;  2KBN A;  4K8J A;  1WCM H;  1HRJ A;  4ZQ3 A;  4LF4 L;  1J8I A;  3LWU A;  2PQE A;  2F0P A;  3WWV A;  4ABN A;  2ZJP A;  1WTQ A;  1A2U A;  5KNC A;  2ZM6 Q;  1DYQ A;  2HDM A;  4RH6 A;  1XMO L;  1Q81 C;  5EBD A;  1E0B A;  3FMC A;  4MN3 A;  1K9M C;  2KEE A;  2WV6 D;  3SEB A;  1ROD A;  1OXS C;  5IE8 A;  2EYL A;  3TBI B;  2VQF L;  4KD4 A;  1PLF A;  3K80 C;  1IBL Q;  1PA6 A;  4C2M H;  5IYC H;  1SXT A;  2J4X A;  3IRB A;  4DV6 Q;  2K05 A;  1M8A A;  1AN8 A;  3CHB D;  5LMN L;  2E2I B;  4DA2 A;  2DY8 A;  3GQB A;  1H9M A;  4H44 C;  1LM0 A;  3NEM A;  1K3R A;  3M85 A;  1D8L A;  1LT6 D;  4BY7 B;  1CQF A;  3MFY A;  4CBV A;  3SR1 A;  5C44 H;  2SDF A;  3OMC A;  4DUZ L;  4A3I G;  2G9D A;  2FXQ A;  1PH4 A;  5E4W C;  3K5L A;  2UXC Q;  1FGB D;  1GD7 A;  1JMC A;  2Q2U A;  3PO3 G;  1BQQ T;  2Y0S B;  4QB4 A;  3W1G A;  5IT9 E;  1I50 H;  2B2V C;  1RTO A;  1EY0 A;  1S5F D;  4EGV A;  4A3L G;  1PHJ A;  4HSV A;  3EVQ A;  2UUB Q;  3GTG B;  1E22 A;  4IFD G;  1GHK A;  2I5L X;  1D1I A;  2LKV A;  4GLX A;  1U0L A;  1J9O A;  4YHH L;  1YEZ A;  1UE1 A;  1KDC A;  3D3R A;  4C3I B;  1U5K A;  2HIV A;  2RCF A;  2X6G A;  4C2M B;  2RF4 A;  3HOU G;  3T1Y L;  4IFD I;  2BH8 A;  3E9H A;  1QG7 A;  5M9O A;  2E2H B;  2EJM A;  4X62 L; 
#chains in the Genus database with same CATH homology
 2D5D A;  2F0N A;  3FDT A;  2K04 A;  2Q8I B;  4RAU C;  3OIP A;  3IAY A;  1E2Z A;  1EY5 A;  2SNS A;  3NBI A;  1H9K A;  2F0O A;  1NR4 A;  1DZ1 A;  3M4O B;  4X3U A;  4FYD A;  2AWO A;  1Y8O B;  4NMZ A;  1HQM C;  1F2Z A;  4EQN A;  3PO3 B;  4M1U B;  1GOZ A;  3NTH A;  2RDH A;  1SNP A;  4KN4 C;  2E2D C;  4K14 A;  3QJY A;  1CA5 A;  4KY7 A;  4DNR B;  5C0X I;  3GV6 A;  3AB9 A;  5JEA H;  1EQT A;  3IFT A;  2AQ2 B;  3E5S A;  1SAP A;  3LX0 A;  2I46 A;  2K03 A;  2K32 A;  4OGQ C;  1HQR D;  4HED A;  1EY7 A;  3TZU A;  4ZUI A;  2H1E A;  4Y7N B;  3H3V C;  4IAL A;  5LL6 X;  5DEH A;  1G8Z D;  1SNM A;  4V0B A;  4ZLT F;  4KJN A;  2HCC A;  2NWG A;  4G4K A;  1YNJ C;  2EXZ A;  2F4I A;  1HFG A;  3EJI A;  3FPP A;  4F88 A;  3NTI A;  4XT3 B;  1XXG A;  5KEE A;  4Q0F A;  1Q8I A;  3HOY B;  3OIQ A;  2OF1 A;  1JWS D;  3Q23 A;  4X3S A;  1WTV A;  3Q22 A;  2F0M A;  2IWH A;  1B50 A;  1Y1W B;  2HDL A;  2E74 C;  1FNV A;  1H9S A;  1LAB A;  1BUV T;  5C44 B;  3PUW A;  5T1I A;  3U9S A;  3FEW X;  1STA A;  2HCI A;  1I4G A;  5KND A;  1TWC B;  3A7L A;  3TP8 A;  2RDF A;  3QG1 A;  3EA6 A;  4BA1 I;  3A7A B;  3TZD A;  3M4Y A;  1X32 A;  3K6O A;  3DEP A;  3HOU B;  1RHP A;  4BWG B;  5DM6 3;  2A68 C;  1FYC A;  1O7Z A;  2ZXP A;  1LTB D;  3PUV A;  5FOB B;  3NQT A;  1TVX A;  1SDF A;  1ET9 A;  3S1N B;  3DMU A;  3X3M A;  3HP3 A;  3WOE A;  2I07 B;  4KY5 A;  4RA8 A;  2QEJ C;  5FO7 B;  2QIL A;  5FO9 B;  3RD4 A;  4RKL A;  3L7Z C;  3J81 E;  4KD3 A;  4CKC A;  4ID6 A;  4PMW A;  1U4L A;  4A3I B;  1EY8 A;  2R93 B;  1HXY D;  1U4R A;  2YU9 B;  1DJR D;  2ZXO A;  1STG A;  2EYJ A;  1OO9 B;  2MUY A;  5G3L F;  5I9O A;  2AQ1 B;  1OXU A;  1Q90 A;  4I7Z C;  1A6X A;  2R7Z B;  1SYG A;  5JVG 3;  1PZK D;  1DON A;  4PQX A;  1O78 A;  4OO1 G;  1HTL D;  1X3Q A;  3QWN A;  3S15 B;  3M3Y B;  4N9T A;  2L5T A;  1D6E C;  3SK5 A;  3P75 A;  5C4Z A;  2LS0 1;  3A8K E;  4ULL A;  1S5B D;  2ZXR A;  1SE4 A;  5CV9 A;  5HGT A;  1AZP A;  2F0J A;  1PFM A;  1U4M A;  2RSN A;  2PPB C;  4X3T A;  1CA6 A;  1SSO A;  1DXM A;  1M4V A;  1PRT C;  5I2X A;  1I6V C;  3I73 A;  4IUQ A;  3MHB A;  4IZ8 A;  1U4P A;  4EQP A;  1UEA B;  2JEB I;  4X3K A;  3NTK A;  4IUP A;  1B9M A;  5DNF A;  5C6A A;  1SYD A;  1YNN C;  2A69 D;  5JPN C;  4MIU A;  1F9R A;  3L9A X;  3H0G B;  4F87 A;  1RD9 D;  4QMG A;  3D4D A;  1AZQ A;  2A6E D;  3MXU A;  5J1Z A;  2KHS A;  3SXH A;  5D65 A;  3CU7 A;  4DXF A;  5ELD A;  5COR A;  4DAY A;  5I4D A;  1I4P A;  1GJX A;  5E3F A;  4KHV A;  1LT4 D;  5C5L A;  4QCL A;  1LTR D;  2ZT9 C;  4R8N A;  1K8O A;  3DWA A;  4TQU S;  3T4A C;  4ZUJ A;  2RSO A;  2L55 A;  2K6A A;  1Y69 U;  5A2Q E;  3HKZ B;  3NUC A;  4HN7 A;  2BDO A;  3RMH A;  1DOM A;  1SMY D;  2MJ8 A;  1SE2 A;  4A3B B;  5I2Y A;  3R2T A;  4FF2 A;  2JA8 B;  4O1N A;  2BA0 A;  2PZW A;  3I4M B;  4OO1 I;  1E2V A;  5CBE E;  5C4H A;  5KIX A;  1T5X D;  3C2P A;  3KF8 A;  2PZT A;  3R3O A;  3TME A;  3J7Y W;  5D3I B;  2A6H C;  3I70 A;  1DOK A;  3QIA A;  5K5P A;  2DNE A;  4IUT A;  1B9N A;  1QB5 D;  1RDP D;  1TY0 A;  2TMP A;  3Q6S A;  3PUY A;  2CHB D;  3NK9 A;  2KA7 A;  5J39 A;  3BVG A;  2K01 A;  2H4O A;  3NPP A;  4PMB A;  2L0C A;  5I9P A;  2XN9 C;  1VCI A;  1DCZ A;  5E4X A;  3DUZ A;  2NVX B;  1WTW A;  3T13 A;  2KCC A;  5E1F A;  3HG9 A;  1WD1 A;  3HOW B;  2K1B A;  3VR5 A;  1K8M A;  4KK7 A;  3N52 A;  4XQQ A;  1Y8N B;  3H09 A;  3F2U A;  4HAE A;  5IGG A;  1WVL A;  3BDO A;  1YNN D;  5C4J B;  1HUM A;  4C3I G;  2F0D A;  1CI3 M;  5IIF A;  3I4L A;  4NP5 A;  2WKC A;  1MSH A;  4G7O C;  2MHV A;  1SNO A;  1STN A;  1QJO A;  4HSP A;  3K5M A;  5CBA E;  1QE6 A;  2F0Q A;  4L6T B;  3QB3 A;  4O42 A;  2NTS A;  4UAI A;  4DAV A;  1JOK A;  2G9H D;  3D4R A;  1E2W A;  2B2U A;  3J7A V;  3O13 A;  4F7X A;  2K5W A;  1F9Q A;  3NBH A;  2NN6 H;  5JAV A;  2AUK A;  2RBM A;  5M5W B;  2VUM B;  2V4D A;  2ICI A;  3QOJ A;  3SK8 A;  4DU9 A;  1LV9 A;  5IOD A;  3MZ5 A;  4B08 A;  5K36 H;  1I4X A;  2NN6 G;  1BCP D;  3BZD B;  3HZX A;  3OW7 A;  1EYD A;  4KMU C;  1YNJ D;  1GXD C;  3VYS A;  3PIP 3;  1SYB A;  3C3L A;  3K0Y A;  5J22 A;  2EY1 A;  3ND9 A;  2PZU A;  4KKS A;  3HOZ B;  1BCP F;  3CKI B;  4ODG A;  2KVM A;  3A8J E;  5IT9 L;  2JYO A;  1V43 A;  5NUC A;  1EWH A;  1NSN S;  2R61 A;  2KOL A;  1TU2 B;  1ENF A;  3D6W A;  3OSO A;  1IL8 A;  3GTK B;  4KHZ A;  4DFA A;  3K5O A;  1TS2 A;  4FF3 A;  1EU4 A;  1O80 A;  3PIO 3;  2ID0 A;  4Q5V A;  3W3A A;  4KKT A;  3HS0 C;  4XQJ A;  3PUX A;  3PO2 B;  1SBB B;  1SNQ A;  1JQY D;  1LO5 D;  3BDC A;  4ME5 A;  3NHH A;  1EOT A;  1FNU A;  1TWH B;  5LHY 1;  4CHT B;  4FNF A;  2AWN A;  3VYR A;  2BDN A;  5ELE A;  1PZI D;  2C5C A;  1B53 A;  2Q8R E;  4A3M B;  1IKL A;  3K58 A;  3S1R B;  2A74 C;  2F1M A;  4KV6 A;  2R92 B;  3FPU B;  2O4X A;  5C5M A;  1WTR A;  3NSW A;  1LLR D;  3NXW A;  3VR3 A;  4K5X A;  1U9R A;  2LFN A;  1BCP B;  1JIC A;  1I6H B;  1ZEQ X;  1K83 B;  4WRD A;  1CFM A;  5JJZ A;  1RJT A;  4BBR B;  1QNK A;  5KRU A;  2IPK D;  3AU7 A;  3D31 A;  1CHQ D;  1EIH A;  3MWY W;  3K57 A;  2F0H A;  2FIN B;  2VNU D;  2E75 C;  5I6W A;  1B3A A;  2XWJ B;  2F0K A;  2NVQ B;  5CMD A;  1BOS A;  3GTL B;  5DM7 3;  2MPM A;  2RKS A;  3S2H B;  1VMC A;  1KTK A;  2B2U C;  2XWB B;  2EYH A;  1SFO B;  1IYU A;  1Q3L A;  2IT1 A;  3RUZ A;  4FF4 A;  4JBW A;  4KJO A;  1EQV A;  4C56 C;  5CV5 A;  2PNR C;  1EY9 A;  1V1O A;  1GUN A;  4LAA A;  4BY1 B;  3FKI B;  4U68 A;  2L4N A;  4ZRZ A;  1W6J A;  1VF7 A;  4FXG C;  3H6M A;  1VF5 C;  4KTA A;  1EWC A;  3KUP A;  4CJ2 C;  2KQ3 A;  3Q24 A;  1GUG A;  2B2T A;  2B2V A;  1PFB A;  2ICE C;  2Z8L A;  1V1P A;  4IN3 A;  5FLX L;  2KCN A;  1D1K A;  4DN4 M;  1EU3 A;  3JAM E;  3DWP A;  3TSS A;  2YYZ A;  1XX8 A;  4CGY B;  1EL0 A;  1LTS D;  1QIL A;  4BBS B;  1FR3 A;  2BA1 A;  3BVM A;  3E6Z X;  5CV7 A;  2SNM A;  4OIJ A;  1R4P B;  2O5J C;  4RGT A;  2TSS A;  4LMQ D;  1X3P A;  1TR5 A;  5TSS A;  3MEH A;  1WTP A;  2WII B;  3S16 B;  4HTH A;  2CQA A;  2XIW A;  1HCZ A;  5FKA C;  5JOB A;  1WCM B;  1ESF A;  5FLX E;  2F3V A;  4DXG A;  4H7B A;  2M9V A;  3D6C A;  5F2D A;  5HUR A;  1DM0 B;  2QDB A;  4K2K A;  1L0X B;  3P1H A;  2WIN B;  2EJG C;  5ISR A;  1XTC D;  4LJZ C;  3VR4 A;  2A68 D;  1HHV A;  1PRT D;  1Q1E A;  2WKD A;  4BS9 A;  3A8I E;  1KAB A;  1QCB D;  4XTC S;  1TS3 A;  4XIG S;  1ENC A;  3GTM B;  3H91 A;  2PCF B;  3K7A B;  5CR3 A;  2KJX A;  2K28 A;  2KUM A;  3PV0 A;  4DGZ A;  5T1G A;  1I50 B;  3URY A;  4ZKB B;  3NP8 A;  5JVH 3;  1EEF D;  3A55 A;  4KI0 A;  2A73 B;  1ZKO A;  4FXD A;  2OXP A;  4BA2 I;  1S5C D;  2NBF A;  1BF4 A;  2NB0 A;  5EPL A;  3RLF A;  1SE3 A;  4XYO A;  2MP1 A;  2A5H A;  3JAM L;  2VB3 X;  1A15 A;  2B2W A;  3SDZ A;  2JSO A;  1UNS A;  2NVY B;  1D5M C;  2ENB A;  2FFK B;  4R9W A;  4HR7 B;  4OHJ A;  2EY2 A;  1WTX A;  4FF1 A;  3VA7 A;  3GTO B;  1B1Z A;  2X69 A;  5IGC A;  2FMC A;  5EKK A;  3GTJ B;  2EYM A;  1EZ6 A;  2K33 A;  1OXX K;  3SVM A;  4HCE A;  5ELB A;  1G2T A;  4CJ0 B;  1B2T A;  1JB3 A;  1JC7 A;  2F0E A;  5JEA J;  3BDL A;  2D9U A;  2WAC A;  2Z4H A;  3ONA B;  2B2Y A;  2J0T D;  1Z47 A;  5IGE A;  2D2C C;  4CKB A;  2B2T C;  1ZYR D;  1EEI D;  5IGB A;  2VXW A;  4IUR A;  3X3N A;  2RDG A;  3KLR A;  3EFX D;  2RA4 A;  1PTO D;  5JEA G;  5EQ0 A;  1D5X C;  4OO1 H;  2D62 A;  1HTP A;  1JCK B;  1SJE D;  3TDQ A;  1SEB D;  3SE0 A;  2F3W A;  3R8B A;  4C3H G;  4B9W A;  1H9R A;  1O7Y A;  2EYF A;  1CK1 A;  4DNT B;  2K5D A;  1TT2 A;  1HPC A;  4C3J B;  2PW5 A;  4H13 C;  3P20 A;  2CW0 C;  3VYU A;  5CC4 A;  5LL6 S;  4FVM A;  1GUO A;  4DF7 A;  5C3E B;  1NUC A;  1MD2 D;  2JXM B;  5AFW A;  4C3J G;  2JA7 B;  5CV6 A;  3C46 A;  5C0X J;  4C1N I;  2K7V A;  2NTT A;  3FRP B;  1C48 A;  4J6H A;  1H9J A;  4F8M A;  4CKE A;  1JWU D;  2WP8 J;  5KYI A;  1BO0 A;  5EPJ A;  3ND8 A;  3BG3 A;  1CM9 A;  1BR9 A;  3LWE A;  1XYI A;  3I91 A;  1CZG A;  1EZ8 A;  2XRQ D;  5A35 A;  2L1B A;  2HQE A;  3OOC A;  3DEO A;  2JEA I;  1AW7 A;  2PW7 A;  5C0X G;  4I65 A;  2B39 A;  1JWM D;  2QCP X;  1W6K A;  2AQ3 B;  1A2T A;  2MGS A;  5IOC A;  2M2L A;  4DAP A;  2EZV A;  1UUP A;  4XQN A;  2J7Z A;  4XT1 B;  5G3L D;  5K36 G;  1GHJ A;  4K2L A;  4K5V A;  4RCO A;  3V96 A;  4J8Q A;  5D3D A;  2NUC A;  2DN8 A;  3TP6 A;  4U67 3;  2EVB A;  5BN4 A;  3I8Z A;  3MA2 B;  3EQL C;  1KLU D;  3GV3 A;  5FO8 B;  4IUU A;  2XSC A;  5EBC A;  3SHL A;  5M3M B;  2Z4I A;  2JA6 B;  1BCP C;  3GP7 A;  3K5N A;  1QWY A;  2C9O A;  3R93 A;  5C3X A;  1CTM A;  1PTO B;  1FNW A;  4YIJ A;  5CV8 A;  5D14 A;  5CYU A;  2QKI C;  1LTG D;  2WB1 B;  3KLS A;  1D5Z C;  1KNA A;  1QNU A;  3I3C A;  2A6E C;  3DHQ A;  2EY5 A;  1TWA B;  2SOB A;  3PMF A;  4C1N K;  4J1M A;  1MBY A;  1TWF B;  4A3G B;  2RQX A;  3MAQ A;  1Z7T A;  2QF7 A;  4WFN 3;  1BNZ A;  1V1P B;  3KLS X;  3HGB A;  1RCV D;  1G29 1;  5KYL A;  4LK1 C;  3J80 E;  1C4Q A;  2RVL A;  4A3E B;  4HMJ A;  1BXT A;  2JP1 A;  3KK7 A;  1GUS A;  1GUW A;  1B4O A;  1XWE A;  5JPM C;  2EOT A;  1BBX C;  5IGD A;  1RTN A;  1CT1 D;  1HA6 A;  4G7H C;  1STB A;  1S4Z A;  4NW2 A;  2DNC A;  2DY7 A;  5M5X B;  1PTO F;  3HEJ A;  3NQI A;  2EE1 A;  1I4H A;  1LTI D;  1BDO A;  4KKU A;  1KDB A;  2EYP A;  3HOV B;  3SK4 A;  4TRD A;  1FD7 D;  2IW3 A;  4ILW A;  1AFP A;  4ZYS A;  3SK6 A;  1DOL A;  4NKL A;  4H0L C;  4KY6 A;  4QF4 A;  3MXP A;  5EKL A;  1NAP A;  3ERQ A;  5KGU A;  1ONL A;  4FP5 D;  3TP7 A;  3RZD B;  1TQO A;  3S1M B;  4RGN A;  4FO2 A;  1I4R A;  2CVR A;  2F0V A;  2FHT A;  1IW7 C;  2FJ2 A;  1HA5 A;  3QO2 A;  3U9O A;  5EGT A;  5BN5 A;  2L11 A;  3D4W A;  2N55 A;  5CGK A;  4V19 0;  1PXU A;  3J7A F;  2XVS A;  4DK1 A;  2N88 A;  1Q12 A;  4HCS A;  1ILP A;  3AMU A;  1KAA A;  5EPK A;  2KED A;  2FMM A;  3S14 B;  2L12 A;  1NCV A;  1ICW A;  2F0S A;  3TP5 A;  4RGM A;  5BN3 A;  3NWS A;  3T16 A;  3WOF A;  1EYC A;  1LT3 D;  1CQV A;  2BOS A;  1R9T B;  1NR2 A;  1LTA D;  4PMC A;  3MXN A;  3S1Q B;  2IJ0 A;  5ELF A;  1F77 A;  1RF2 D;  4G57 A;  1EY6 A;  1IKM A;  3S17 B;  2B63 B;  2GA4 B;  3I4N B;  1PZJ D;  3GD7 A;  3OWF A;  5I6Y A;  3V2T A;  1SMY C;  4TSS A;  4E6I A;  1WTO A;  1STY A;  3DXJ C;  1C8C A;  3OPO A;  5C0X H;  3I90 A;  1SYE A;  3BS1 A;  1RKN A;  1F2L A;  1F9S A;  3IFD A;  4QUC A;  2EYO A;  3D8G A;  4S3S A;  1LTT D;  1PRT F;  4RCN A;  2B2W C;  3GTQ B;  3LNN A;  1TY2 A;  1EYA A;  4EVO A;  1TS4 A;  4A3K B;  1II3 A;  1CHP D;  1OXT A;  4HMI A;  1TWG B;  1D2B A;  3FVQ A;  1S5D D;  1ILQ A;  3UI2 A;  3ZYY X;  1AP0 A;  2BCO A;  1F2Y A;  2IX0 A;  4GZY C;  4XDX A;  1PMR A;  2F0G A;  3S2D B;  3RZO B;  1SYF A;  1ET6 A;  2B2Y C;  1EFI D;  4G7Z C;  4K8I A;  3P7J A;  3R2I A;  3C1F A;  3A56 A;  4FXK C;  4ZAI A;  2F0F A;  2EPB A;  3KBX A;  1Q1B A;  3MTS A;  3OMG A;  1IYV A;  1WD0 A;  3HOX B;  3BYT B;  1VMP A;  3S9W A;  2EDG A;  3H94 A;  5IGF A;  1PTO H;  2E2J B;  4IUV A;  2K5Q A;  3T51 B;  2PO4 A;  3ITP A;  4OL7 A;  3PUZ A;  5M5Y B;  3L3O C;  1PRT B;  4Z9C B;  3C1E A;  4IUN A;  5EJW A;  3BYY B;  3ERO A;  1TKW B;  2B8F A;  3W2D A;  1B44 D;  1HFN A;  4K6L A;  4A93 B;  1Y8P B;  1STE A;  1JOO A;  1G2S A;  1SND A;  2L9H A;  1VDZ A;  2KEC A;  1JOQ A;  2F0U A;  1I3Q B;  5KNB A;  3M7N A;  1SJH D;  2BE5 C;  4C3H B;  2B8G A;  2Z1C A;  2CW0 D;  3OHX C;  4UDU C;  4P2C B;  2NN6 I;  3MFG A;  2EJF C;  2NYZ D;  1PFN A;  2F0T A;  1TII D;  5A2Q L;  4QUF A;  1AEX A;  1CZW A;  1SYC A;  1JR0 D;  1T5E A;  5C4X B;  1F9P A;  3VR6 A;  3A54 A;  1KDA A;  2BE5 D;  1ESR A;  1LT5 D;  4IQZ A;  1A3V A;  2O5I C;  4KN7 C;  4AYB B;  2WAQ B;  4RGO S;  1EIG A;  2A6H D;  4L8J A;  2M00 A;  2F0I A;  3QOL A;  1A3T A;  1TS5 A;  2A69 C;  5ELC A;  2F0W A;  1OXV A;  4XXE A;  4RKB A;  2JA5 B;  3IKJ A;  2O2L D;  3KBG A;  3DWQ A;  2OEO A;  4IFD J;  3N6R A;  4TKO B;  3TN2 A;  4RWS C;  1MGS A;  4RHR A;  2NZ1 D;  1IW7 D;  4DK0 A;  4JK1 C;  2IX3 A;  3T56 B;  1V8Q A;  1DD2 A;  4M8A A;  2EY6 A;  5CV4 A;  4NDX A;  1KNE A;  1PYW D;  5C3W A;  1PDQ A;  3M7G A;  3V05 A;  3MVV A;  1UAP A;  2SEB D;  3G7L A;  1F2M A;  1H9S B;  4WOR A;  1Z6H A;  4OIK A;  1ENA A;  2X6L A;  1I4Q A;  1SNC A;  1L0Y B;  2HUG A;  2AUJ D;  3VR2 A;  2R3Z A;  4K6D A;  4ZKC B;  2OT2 A;  3VA5 A;  4L63 B;  3WDN A;  4B9X A;  1JOR A;  4ZK9 B;  1G91 A;  1HUN A;  2LY7 A;  3J80 L;  3NWT A;  1QOH A;  3GO5 A;  5M3F B;  4RHS A;  1Y1V B;  3I72 A;  2IL8 A;  1S5E D;  5FK9 C;  4EQO A;  1R4Q B;  4WJW A;  2JE6 I;  3CRL C;  4RFB A;  3IL8 A;  2LMC B;  4MHE A;  3MXG A;  4A3D B;  4A3F B;  4A3J B;  3DM1 A;  2XNA C;  1EY4 A;  1ZYR C;  2Q8T A;  3Q0A A;  1MSG A;  3MC0 B;  2IX1 A;  3GTP B;  3J81 L;  1A3U A;  1JE4 A;  4CJ1 B;  2XRS D;  2F0L A;  4QIW B;  2PMZ B;  1G6Z A;  2F03 A;  2NVT B;  4IFD H;  1KLG D;  2PYK A;  4N9P A;  3K59 A;  3CQZ B;  1O7L A;  5DAU A;  1PTO C;  1LAC A;  4PV1 C;  4XYQ A;  3BVZ A;  3T53 B;  1MI2 A;  4R8I A;  2R6G A;  3HRZ C;  1IHZ A;  4K5W A;  4PNY A;  3CRK C;  3E0J A;  5EKI A;  1GUT A;  3VYT A;  5COY A;  3NE5 B;  1STH A;  2E76 C;  3G6J B;  1ZXT A;  1ML0 D;  2VB2 X;  3OWE B;  4K8J A;  1HRJ A;  4ZQ3 A;  1J8I A;  3LWU A;  2PQE A;  2F0P A;  4ABN A;  1WTQ A;  1A2U A;  5KNC A;  1DYQ A;  2HDM A;  4RH6 A;  5EBD A;  1E0B A;  3FMC A;  4MN3 A;  2KEE A;  2WV6 D;  3SEB A;  1ROD A;  1OXS C;  2EYL A;  3TBI B;  4KD4 A;  1PLF A;  1SXT A;  2J4X A;  2K05 A;  1M8A A;  1AN8 A;  3CHB D;  2E2I B;  4DA2 A;  2DY8 A;  3GQB A;  1H9M A;  4H44 C;  3M85 A;  1LT6 D;  4BY7 B;  1CQF A;  3MFY A;  4CBV A;  3SR1 A;  2SDF A;  3OMC A;  2G9D A;  5E4W C;  3K5L A;  1FGB D;  1BQQ T;  2Y0S B;  4QB4 A;  5IT9 E;  4EGV A;  2B2V C;  1RTO A;  1EY0 A;  1S5F D;  4HSV A;  3EVQ A;  3GTG B;  4IFD G;  1GHK A;  1D1I A;  2LKV A;  1J9O A;  1KDC A;  3D3R A;  4C3I B;  2X6G A;  4C2M B;  4IFD I;  1QG7 A;  5M9O A;  2E2H B;  2EJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...