4HSVA

Crystal structure of cxcl4l1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords Platelet factor 4 variant
publication title Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hsvA00
4QUFA 2DY7A 2X6GA 4HAEA 1WTPA 4R9WA 1B4OA 4IUQA 1F9PA 3I3CA 4MHEA 2HCIA 4IURA 1HHVA 2FFKB 2IL8A 5CORA 1PFBA 1ML0D 2EOTA 3KUPA 4MN3A 1XX8A 3D6WA 2NZ1D 3IFDA 1B53A 5T1IA 1DZ1A 1F9QA 1F9RA 1AP0A 4IUPA 4RAUC 1LV9A 3H91A 4XT1B 2HDLA 1J9OA 3I8ZA 5CMDA 2FJ2A 1M8AA 1KNAA 1NCVA 1BBXC 1X3PA 1WTVA 5T1GA 2B2UC 1B3AA 1A15A 5E4XA 1U4LA 3SVMA 3MTSA 4HSVA 1BNZA 3R93A 2B2UA 2FHTA 4NW2A 4RA8A 1G91A 3DEPA 1WD0A 1O7YA 5E4WC 3I90A 2VXWA 2K03A 3DM1A 2MGSA 5EPLA 5EQ0A 4IUVA 3TN2A 5CBEE 1GUWA 1XYIA 1DOMA 2JYOA 4X3KA 4XT3B 1C8CA 2DY8A 1ESRA 5JJZA 1WVLA 1HA6A 1HRJA 5COYA 1MSHA 1B2TA 1HFGA 2JP1A 1WTQA 4OIKA 4HEDA 4U68A 1PFMA 1PLFA 1NR2A 2CVRA 2BDNA 1SAPA 4XDXA 1KNEA 1BF4A 1EOTA 1HUMA 2B2WC 1HUNA 2N88A 1DOKA 2RVLA 3P7JA 2FINB 1MI2A 1DONA 2B2WA 1IKLA 3IL8A 2EPBA 2K1BA 3DEOA 3FDTA 3UI2A 1EIHA 1E0BA 1RJTA 2HCCA 2L12A 4O42A 1WTWA 2RSOA 1HFNA 4HCSA 1PFNA 1EIGA 1RODA 2EE1A 2B2VC 2XIWA 2KVMA 2L1BA 3LWEA 1NAPA 3GV3A 1RTOA 1QG7A 1IKMA 4IUTA 4ZKBB 5EKIA 2B2VA 2HDMA 1SSOA 1TVXA 2H1EA 4ZK9B 2KEEA 2B2YC 3F2UA 2K28A 2J7ZA 4RWSC 2KUMA 1U4PA 1QE6A 1MGSA 4R8IA 4X3UA 2R3ZA 1ILPA 2HUGA 5CBAE 4CJ1B 2B2YA 5D65A 2K01A 4ZAIA 3TZDA 4X3SA 2Q8RE 3GV6A 5D14A 3N52A 5EJWA 4ZLTF 2M2LA 1WTRA 1S4ZA 1AZPA 1BO0A 1JE4A 1VMPA 4UAIA 1VMCA 2KOLA 1X3QA 1JICA 1CM9A 2B2TC 1B50A 2RA4A 2L9HA 2NYZD 5AFWA 1U4MA 1WTOA 1IL8A 1ZXTA 3Q6SA 1QNKA 4ZKCB 1NR4A 4QUCA 2MP1A 1ICWA 2B2TA 2L11A 1WTXA 3FPUB 2D9UA 1PDQA 2NWGA 2X6LA 5EPKA 2X69A 3HP3A 1AZQA 1CA5A 2L4NA 1F2LA 3ONAB 1O7ZA 1U4RA 2KEDA 1DOLA 2Q8TA 1EL0A 2RSNA 1G2SA 4DN4M 4CJ2C 1WD1A 1G6ZA 4OIJA 4X3TA 1EQTA 1RHPA 2K04A 2KECA 2MPMA 3KBXA 3MWYW 4LMQD 1SDFA 3G7LA 1ILQA 1O80A 3QO2A 1G2TA 2SDFA 1Q3LA 1X32A 2K05A 3I91A 1RTNA 5DNFA 1F9SA 4CJ0B 1CA6A 4IUUA 1J8IA 2FMMA 2N55A 5EPJA 1MSGA 2MJ8A
chains in the Genus database with same CATH superfamily
5FJ8H 5IYCH 3S14H 4GKJL 2XNAC 3M4QA 1TR5A 3PO2G 2NN6H 4M8AA 2YU9H 1K0RA 2Z6KA 1HHVA 1KDBA 1IXRA 2EJMA 4P75A 3CCLA 1VQ5A 2VUMB 1E2ZA 2M9VA 2DN8A 2QEJC 4XQJA 1Q8IA 1Y14B 3RMHA 3W3AA 4HJ5A 4JK1C 3KJPA 5KRUA 1T5XD 3NSWA 3K58A 1B8AA 3E0EA 3S2HB 3T56B 2V1CC 3H94A 2A6EC 1K9MC 2PI2A 4JI5Q 4H7BA 4UDUC 1LTTD 1NMGA 1BF4A 1ICFB 1JWMD 1HUNA 2A74C 3A56A 3WOEA 5BN5A 4G7HC 1KLUD 1CZGA 4RCNA 1CTMA 3PIPA 4DR3Q 1E1TA 4DK1A 3LX0A 3T1YL 4YWLA 2H1EA 4ZK9B 2UUBQ 2J7ZA 1WYDA 3M7GA 5IP9G 1YBYA 5C3EB 3M3YB 1WTRA 1JWSD 2SOBA 1S4ZA 3ULJA 1NNXA 2JA8H 5M5YB 2B2TC 5GROA 2F0IA 2RA4A 3JAME 5AFWA 4NDXA 1QNKA 3FKIB 1SFOH 3PO3G 4RGNA 1Z9FA 5LMUL 2UUAL 4Q0FA 2AKWB 1SN8A 5C3WA 1JORA 4A3MH 5IYBH 2XGTA 3ONAB 2PNRC 5HURA 4HJ7A 4QJFA 4JI6L 2G9HD 1S5CD 2K04A 1TS5A 1A6XA 5EKLA 3RZOB 4IOCA 4JBJA 4CJ0B 1J8IA 3RNUA 2OT2A 3CF5A 5EPJA 1SMYD 3P1HA 1JT8A 4JI8Q 3OWEB 4A3EG 3MA2B 5IT9L 2L15A 3I3CA 3BDOA 4JVZA 4P71A 2UUCL 2E2HH 1MJCA 5FK9C 4E6IA 1KRTA 4X62Q 4DV6L 2B63G 2CW0D 5IP7H 2EY5A 5I6YA 2FJ2A 3HEJA 3NUCA 5CV4A 1VQ4A 3SXHA 1N34L 3S16B 3SVMA 4TVAB 5KYIA 1U0LA 3K7AB 3ER0A 3M85A 4L63B 4B08A 3Q22A 4XXEA 1XPRA 1ZKOA 1HNXQ 4BBRG 1PV4A 4KD4A 3HOWH 1AN8A 4POGA 3S1QH 1SJED 1LABA 1MI2A 2RBMA 3IL8A 1A3VA 3ULPA 4JI0L 1PFNA 5J3BA 1VS0A 1J5EL 5KEEA 2KBNA 1JJGA 4C3JH 1AE3A 1E2VA 3H3VI 2JQOA 1VQHA 5AJ3L 1JOOA 1FD7D 3R3OA 3WWVA 1BO0A 2PNHA 4A93B 2AQ1B 3PO2H 1FNVA 4KY7A 5IGFA 2ICIA 3VA5A 4EQPA 4ZKCB 2ZJPA 3KJOA 2L11A 3KDFA 1FNWA 3PV0A 2NWGA 1U4RA 2Q8TA 5JAVA 2MFIA 2XSCA 5IYDG 1EEFD 2RSNA 3PUYA 2JA6B 2R7ZG 4DU9A 5C44B 3A74A 1ZEQX 3BVMA 1G51A 5C4JH 4B3SQ 2Z6KC 2DY7A 3MXNB 4O2DA 4F88A 4J1MA 3AQQA 3C3LA 2BA1A 4PG3A 3S2DH 3L3OC 2HHHL 1ENFA 4FXGC 2PYKA 5H1SE 2ZT9C 1WTHA 3I4LA 4YY3L 3H91A 1C0AA 1LM0A 4RGMA 5E4XA 4AYBE 3OWFA 3S24A 5CV7A 2NUCA 2OWOA 1XNRQ 4RA8A 4LF9Q 1G91A 1WD0A 2VQFQ 1VCIA 5IP9H 2QW7A 1UAPA 2CKZB 3VR3A 4IFDG 4R8NA 1B2TA 4ABNA 1PFMA 1X6OA 1YHAA 2NVYH 2CVRA 4DV2L 3MHBA 1TWHH 4B3TL 1HQRD 1TWGH 4XDXA 4JI7L 4TKOB 4HJAA 3KF6A 1TXYA 4RKLA 4K0KL 2PCFB 4QQBX 3PO3H 3HOVB 2UXBL 4CKCA 3TQYA 1L0WA 1RKNA 3HGBA 4DV5L 4DNRB 1TY2A 3NQTA 1PTOD 3U4ZA 3DM3A 2NZOA 4PV1C 4CDFC 2D2CC 1HPCA 4A3BG 3NTIA 2D0OA 1L1OA 1SNQA 1V9PA 4LF6Q 4DV1Q 2B2YA 4JG2A 3GQBA 3NELA 5D65A 4LF7Q 1WI5A 2K75A 4LF4L 1PYSB 3GV6A 3ZYYX 4U673 1AZPA 4J6HA 1VDZA 4A3EH 4B9WA 1R9TH 2K32A 1YNND 1Q82C 1EFWA 3NK9A 4OL7A 1CUKA 2B63H 3JAMc 2FXQA 3BZDB 3ITPA 1ESFA 1SMYC 5JJKA 4A75A 5JVH3 2BA0A 4KI0A 1PHJA 3HOZG 2L4NA 4A3KG 2YTYA 4JPBW 4R4QA 4HIMA 1PH8A 1ASZA 1LACA 2WINB 5JJIA 3QOJA 1ZYRD 1QB5D 4IALA 4LK1C 5ELCA 3S1NH 5CC4A 1UUPA 2E5LQ 2CW0C 1QVCA 1Q3LA 4BBRH 1I94Q 3SK6A 4I65A 2Q2UA 5LL6X 4V190 3NBHA 4JOIA 1GUGA 3SHLA 4A76A 2Z4HA 4UHVA 3C46A 2XRSD 3A5ZB 3IFDA 2B39A 4DR2L 1Q90A 4RAUC 1J9OA 4CKBA 2BH2A 1UE6A 5IGEA 1D2BA 4HSVA 4BA2I 3KDFB 3R93A 5DLQE 1KQSA 2PMZB 1OO9B 3EROA 2HQEA 3BDCA 4LFAQ 4H0LC 4N9TA 4NXNL 1VQFA 1A3UA 1JOQA 3UDIA 4OGQC 4OWXB 2VUMG 1MBYA 4EX5A 5BN3A 5BR8L 2IT1A 3SK4A 1Y1WG 2JA7H 1EOTA 3GD7A 3D31A 5FOBB 2I5MX 1SYEA 3CQZB 1PH6A 4MNOA 3ULLA 2EY1A 1I4PA 4HCSA 2CFMA 1YJ9A 2ZJQA 2E2JB 3CPWA 5IYDH 2R7ZH 1I4HA 3FVQA 1RTOA 4ZKBB 1TWFH 2B2VA 3KLRA 2XVSA 2K28A 2K52A 2EZVA 3FRPB 1EU3A 4GS3A 5LMNQ 4OONA 4Y52H 2CWPA 4DR6Q 4JI5L 1K3RA 1N8RC 1EIYB 4X66L 2IY5B 4YCVA 3R8BA 5K36G 2WB1B 1JE4A 1PRTF 2KOLA 2JN4A 1NY4A 2PW5A 2Q2IA 2NVQB 2NYZD 1I6VC 1C7YA 3Q6SA 4GN5A 3R2IA 2F0KA 2G5DA 3CMAA 1LYLA 1SYDA 2B3GA 1PTOB 2UU9Q 4DR3L 1O7ZA 1DCZA 1WCMB 2JK8A 5HGQA 4JI1Q 3PSIA 2F03A 2XWBB 3H6MA 4C2MB 1W6KA 1A8VA 1YZ6A 1G8ZD 3BVZA 3J7ZC 3A54A 2QCPX 1HQMC 3I91A 1NMFA 4IFDH 1VQAA 4B3RQ 1SR3A 5M5XH 3PMFA 3VR6A 3FKIG 4A3IB 1XJVA 4H02A 2EVBA 5C0XG 1BQQT 1JE5A 3RZDB 3I4NG 2Y0SG 2EXZA 3URYA 3D6WA 4X64Q 1XTCD 4DGZA 2L0CA 1DJRD 1F9RA 1VQMA 1BBUA 1KNAA 1STHA 5FLXL 1QZGA 3AFQA 4GLXA 1HA5A 5CR3A 1V1QA 4A3BH 4NW2A 1VQIA 1B9NA 3CW2C 2K03A 2IPKD 5EPLA 1GUWA 5C4XB 4BWGB 4DR7L 3WOFA 1L2FA 4LUZA 1C8CA 2GN5A 1XMQQ 2B8GA 5COYA 4JI8L 2HQLA 1EUJA 1PTOC 2Z4IA 5GADC 1KC8C 3E9HA 2BDNA 3PUXA 2F0MA 2UXCQ 4KJOA 2F0NA 4UY8C 1TIID 4DK3C 3UDGA 4ID6A 4JBWA 2HCCA 4DFAA 1YNJD 1NBWA 3H3VC 4A3KH 3HOZH 1S40A 2L1BA 2H4OA 4BY1G 1YNNC 4IUTA 2DGYA 5GAGC 5JJLA 4KHPQ 5BN4A 2B2YC 3DLLA 4BY7G 1NTGA 4J8QA 3T13A 1TKWB 3T1HQ 4X3UA 4FNFA 1AE2A 4K14A 3S1MB 4QIWB 3S17B 1YHBA 1LT3D 2F0QA 2I07B 1Y69U 1J6QA 1ZYRC 4C3HB 2HT1A 4UAIA 1K8MA 2DNEA 2ZXOA 1LTSD 1JICA 5EBDA 2WIIB 4P74A 3MXPA 1N36Q 1ZXTA 2PPBC 4YCUA 2OF1A 2F52A 4GKKL 2KCMA 1CA5A 3CXCA 4DUZL 1C48A 2RDFA 3TREA 4APVA 4O1NA 4HIKA 4OEMB 3I2ZA 3MWYW 1EOVA 4EGVA 4KJNA 4A93G 3V96A 2SDFA 1X3EA 1X32A 3W5OA 1EY7A 4KLKA 1G6PA 1CA6A 4NP5A 2IX1A 1N32Q 2ZTDA 4WJWA 4JOIC 5HY6A 1PVOA 2SEBD 3H0GB 5K5PA 1Y1WH 1WTPA 2KHIA 1QILA 2F0TA 4A3GH 3E9IA 4PNYA 2FFKB 1YI2A 1I4GA 2F0SA 4CBVA 2YV5A 5CV5A 3CCSA 4FO2A 2K5DA 4DUYQ 4DV3L 1S72A 2ZXPA 1G6ZA 1QUQB 3J7AV 4LFCQ 1HNZQ 4IUVA 1XYIA 2K33A 5EKKA 5K36H 2K14A 4OIKA 5M3FH 1EYCA 2R61A 3G6EA 1XMOQ 1G291 1D1KA 4ZCKA 3SDZA 2N88A 2NVXB 2JE6I 3AYHB 4RFBA 3J81c 1DONA 3SK5A 3PF4A 5I2YA 1RJTA 2F3WA 1ET6A 1SYFA 3A5UA 3TP7A 1MKHA 1LTRD 4GN3B 1EIFA 1NJIC 5ELFA 1Y1VB 1RODA 4KMUC 2B2VC 1B1ZA 2KVMA 2F3VA 1K8GA 5JOBA 2K5HA 2PQAB 1DGSA 1TS3A 1SSOA 1U5KA 3TEHB 4QCLA 1EY4A 1SEBD 3PF5A 4GLVB 4DR4Q 3FKIH 4B3MQ 3UE0A 5E3FA 2ZM6Q 4K6DA 4POFA 2F0GA 2WP8J 4BBSB 4LAAA 3CC2A 4BXXG 2AMCB 2F0WA 3I4NH 4P72A 1EEID 4DK0A 3QJYA 1RCVD 1K3BC 3VYRA 3QWNA 2H5XA 4Y7NB 3K8AA 1IBMQ 1KRSA 3W1GA 1GUOA 3GTLB 4DXFA 4UPAA 1DOLA 2K7VA 2EIFA 2R93G 4FXKC 3S14B 4LFBQ 1RHPA 3KBXA 3S15H 4A3FG 3G7LA 3TSSA 1RL2A 5FO9B 2K05A 1ET9A 5C0XJ 5ELBA 1HR0Q 4LF7L 2EYHA 4HCEA 2K4KA 4DAPA 2QDBA 1KL9A 1PYWD 4YIJA 1CKNA 3DWQA 1JR0D 3A55A 3HOYG 5GAHC 1JQYD 2AQ2B 1Q7YC 2CHBD 2EYJA 4JV5Q 1QNUA 3MVVA 2UXDQ 3TS2A 3K7AH 3CP0A 3PIO3 2FMCA 2Y0SE 4JI2L 1AP0A 3CCJA 3C2PA 4BY1H 3VA7A 4IPGA 4R4IA 4DA2A 4BY7H 2N8NA 3CU7A 4X65L 1IBKQ 1YNJC 1Y8OB 1XNQQ 4WRDA 4NXMQ 2Z1CA 1PH2A 1FVIA 4KKUA 1BCPD 4PZ8A 1KIXA 3HG9A 5IWAQ 1IL2A 2I5HA 2O5JC 4I7ZC 1KLGD 3L0OA 2K1BA 3DEOA 3UI2A 4EQ5A 2KCTA 1LTBD 1MHWC 2RSOA 3STBD 1D5ZC 1JB3A 3ZJYC 4I7AA 2K5WA 3MAQA 2CQOA 3BZKA 2RCFA 1BXTA 3VDYA 2Z9HA 2JA8B 1DXMA 1UWVA 2MUYA 3FPPA 4ZAIA 3VR2A 3CRLC 2I5LX 2DNCA 5D14A 3OIPA 2E74C 1STYA 4JW0A 4PMBA 2RKSA 2JSOA 3GTJH 3NTHA 1FJGQ 4L5QA 4UP7A 1N33L 3RUZA 2ES2A 3EVQA 3X3MA 4RGTA 1CFMA 2KA7A 1STBA 4DF7A 2VL6A 5A2QL 4GOPA 1VQ7A 2EJGC 1EL0A 2CH4A 4K5XA 4JYAL 1WD1A 1T9HA 3K80C 4K2KA 4AQYL 1SDFA 2WB1G 3VYUA 2KHJA 1SE2A 1STEA 5LMNL 4JI3Q 4DR6L 2E2HB 1F9SA 2A6HD 1PH5A 4QB4A 2LSSA 1CQFA 3R2TA 1I50H 4DR1Q 1TWCB 3B6YA 4KY5A 3V05A 4IUQA 1HCZA 1VQCA 4TSSA 1WCMG 3L9AX 3HOXB 1F2YA 2HD3A 1OXSC 3CD6A 4DV0L 1GOZA 2WAQG 3IAYA 2UU9L 5M5WH 4DV7Q 2F4VQ 3AEVA 3EN2A 3I8ZA 3O13A 3I72A 1SLJA 4FXDA 4FF4A 1A63A 1A15A 3NQIA 3GTMB 3HOWB 1EU4A 3K6OA 3GO5A 5FO7B 2EYFA 3CC7A 3S1QB 3OOCA 2F0JA 2EXDA 3D4RA 3MC0B 4KHVA 3HKZE 4HJ8A 4CGYB 1WFQA 4A3DB 1BVSA 3EA6A 3HZXA 4HEDA 4R4CA 4C3IG 4BXXH 3M4YA 4RGOS 1ENCA 1HUMA 3BVGA 3D8GA 4C3JB 4KKSA 3F2BA 4X64L 1IKLA 4IFDI 4DXGA 1CKNB 2HIVA 5ELOA 2BOSA 1D5XC 2NVTH 2R93H 1QVFA 5C4XG 2B29A 3TMEA 2R7FA 2HDMA 2IX0A 2IW3A 4A3FH 2E8GA 4LUVA 2A69D 3F2UA 4LF8L 4XIGS 2KUMA 1B44D 1MGSA 1VF5C 1S5FD 1X9NA 1XMQL 1BCPB 4AYBB 3A7AB 4ZLTF 1JJCB 3U50C 2RCNA 1SNOA 3HOYH 1TU2B 2ZXRA 1BBWA 3CCVA 1SNDA 1UEBA 4FF3A 1B50A 3LGJA 4EQNA 1UEAB 4XQQA 3FPUB 3GP7A 1GD7A 5DM63 1I6HB 4OWWB 5C4JB 1VQEA 1SE3A 3CCQA 1I5FA 2TMPA 2PQEA 3GTPB 1K73C 4OIJA 4FF2A 5CV8A 3J80i 1NSNS 4XQNA 1H9SA 2OQ0A 3F8TA 3OIQA 5M3MG 3T1HL 4ZUJA 2P5ZX 1P16A 4LW1A 3S2DB 1RTNA 4IO9A 1A62A 2R92G 1LT4D 4DKAC 3SR1A 3TZUA 4CKEA 3T1YQ 4AIMA 4IPHA 4AH6A 4DAYA 5JVG3 1CSPA 5EGTA 3VR5A 1X56A 4YHHL 3KF8A 4G7ZC 3AMUA 4NPSA 1GUNA 1A2UA 4ZQ3A 1BCPC 2EJFC 3I4OA 1I3QH 1W2BA 1WTVA 5I2XA 5T1GA 2EY2A 1BNZA 4OX9L 4EQOA 1X3GA 2XWJB 1TWGB 2FHTA 3H0GG 3BS1A 4Z9CB 3DEPA 5F2DA 1TQOA 4L5SA 1KABA 1RF2D 3STBC 2XTIA 5I4DA 4BS9A 1DOMA 1Q86C 3PO3B 2JA5B 5E7NA 4IUNA 3CQZH 5LMNW 2F0UA 2RDHA 3OHXC 3MXUA 2I46A 2WKCA 2E2JH 1HZAA 3I4MG 3D3RA 1CHPD 4Q5VA 4FF1A 5I9OA 3GTGH 3U9OA 1JC7A 4MTNA 1IBLQ 2VQEL 3AB9A 2PZUA 5JEAG 4JI4L 4ALPA 3GTQH 3J80L 4A4IA 2UUCQ 3NBIA 2XIWA 5CV6A 4DV6Q 3M7NA 3E6ZX 4OWTB 4A3EB 4PZ7A 3TDQA 1D6EC 1HNZL 1PMRA 2B63B 1A2TA 2VNUD 2M2LA 1XMOL 1YIJA 1PTOH 3I73A 4PMCA 3OSOA 2IHEA 2VY3A 3A8KE 1A0IA 1N9WA 1SYGA 3ERQA 4L6TB 4C2MH 1IL8A 2A6HC 1K83B 4RHRA 3M4PA 2OTLA 2D9UA 2VS1A 1STAA 2ZTCA 2NN6I 2ATWA 4LWCA 4JI0Q 2KECA 4MZ9A 2VB2X 2CQAA 2GA4B 1PZID 3RZDH 1BOSA 1GHJA 2F0HA 1MD2D 3G71A 2WB1E 3K5NA 2ZM6L 2ICEC 4NKLA 3QIAA 4C3IH 5FLXE 3CCUA 1HZBA 4UP8A 4K2LA 1JCKB 1F9PA 5AJ3Q 1GUSA 1JJ2A 2DJGC 2EDGA 3EBEA 3KF6B 1IBML 1S5ED 5C3EG 3GTOB 5C4XH 2UUBL 3HOUB 4KN4C 1BBXC 3FEWX 4LFBL 2WAQE 4FVMA 3FHWA 3NWTA 2JJQA 5D3DA 1MIUA 5KYLA 2JA7B 4IOAA 5C3XA 2BE5D 4IJLA 3WDNA 1L1OB 2QGQA 4C1NK 1HA6A 3J81L 1YVCA 3EQLC 3Q24A 3I55A 4PQXA 1KTKA 1SYBA 3PIP3 1I4RA 5IGGA 4LF5Q 1CKOA 2A69C 4A3JB 2R7ZB 1YJWA 3KFUA 2UXDL 4R1JA 4JV5L 4S3SA 3G4SA 3F1ZA 1EY8A 1EIGA 2VB3X 3DWAA 3KF8B 1PH9A 2HHHQ 3GV3A 4KN7C 3GTKH 4DR5Q 1SNCA 1IZ6A 5M3MH 4YY3Q 1QVGA 2EYOA 2KEEA 3OMGA 5KNBA 3ND8A 3S1RH 2R92H 1H9RA 1E7ZA 1BUVT 4NXML 4X3SA 4P2CB 3CC4A 4R4OA 3L2PA 3J81j 2KCCA 3NBHB 4X62L 2ZJRA 1R4PB 4F87A 1B3QA 1FGUA 2RDGA 1WTOA 3J7YW 1AW7A 1EY5A 4DV2Q 1ICWA 1WTXA 4B3TQ 4JI7Q 1XWEA 2XN9C 1Z6HA 1H9JA 1L1OC 4XYOA 4DNTB 1L0YB 1Q46A 2Z8LA 2A68D 1D5MC 2Q2HA 2C5CA 3JC66 5ELNA 2UXBQ 4UP9A 2KQ3A 2SNMA 2RHQB 1HNXL 3H0GH 3RD4A 3K7UC 4LMQD 2QKIC 4QL5A 3KLSX 2CCZA 4QIWE 2LXKA 1EY6A 1PZKD 1KDCA 1PH1A 1B9MA 2D62A 4CDDC 5J39A 1IYJB 5C5LA 5NUCA 3I4MH 3A0JA 1KAAA 2D0PA 5JPNC 4IURA 5IOCA 3Q8DA 4LF4Q 1FL0A 3F2CA 2JEAI 4ZRZA 1PFBA 4RH6A 2EOTA 3MEFA 3M4OB 2QILA 4DV4Q 5JEAH 1V1PA 2DJFC 4WFN3 4C1NI 5T1IA 1DZ1A 3Q23A 5GAEC 2CH4W 3UDFA 4B9XA 2J0TD 3PCOB 1IHZA 3KBGA 1EZ6A 1Y8NB 3CCRA 2B2UA 2VUMH 2NB0A 4L5TA 1XXGA 1S5DD 2NVXH 1XPUA 4KKTA 2AUJD 3TN2A 1TWAB 1CKMA 4TRDA 3HOXG 3K57A 1WVLA 5JJZA 4IN3A 1MSHA 4DR1L 1ONLA 4QMGA 3RLNA 1PLFA 4A3KB 2JA6G 3S2HH 5JEAJ 5IY0A 5C44G 2RVLA 4K6LA 3CPFA 3LWUA 2JXMB 4A3LG 3J7AF 3IRBA 5IODA 1EFID 1LUZA 1GJXA 2F0VA 2PZTA 4N8FA 1E22A 1QG7A 2EYPA 2MHVA 4XTCS 4A3DG 4B3SL 1SNPA 2LMCB 1TVXA 4GZYC 1LO5D 1VQ6A 3IFTA 4RWSC 4OHJA 4HJ9A 2LFNA 1KD1C 3TZDA 1K28A 3G6JB 2LXJA 2Q8RE 2GVAA 2XRQD 4N9PA 1HR0W 3UDXA 4Y7NH 1AH9A 5CV9A 3GTLH 1VMPA 1WJJA 4OO1G 1VMCA 3X3NA 4KV6A 5KNCA 1EY0A 1L0XB 1HJPA 2A5HA 2ZTEA 5C5MA 1MJEA 1UE7A 5BR8Q 3I56A 2MP1A 5C3EH 3M3YH 1TS4A 4NB3A 1XNRL 4LF9L 1FGBD 3RLFA 2VQFL 1EYAA 5M5YH 4AYBG 1Y1WB 1RIPA 1SYCA 4IQZA 4C56C 4A3GB 1O80A 1EQQA 3EIVA 3HOVG 2NBFA 2E2IB 1HTLD 5C0XH 2FMMA 1LTAD 1PZJD 2E76C 3MXGA 3M9BA 1VQLA 2MJ8A 3QB3A 3RR5A 2N3SA 5FLXc 1PRTD 4K5WA 5C4HA 3RZOH 3A7LA 2BE5C 2EYLA 3DXJC 4X66Q 1M4VA 3E5SA 3DWPA 3T16A 5J1ZA 2MO1A 5IT9E 5DEHA 2PW7A 5JPMC 4DNIA 4HMJA 1NCVA 3NTKA 2YU9B 1SRUA 4DV1L 2E75C 5M3FB 1PTOF 2J4XA 1Q1BA 1U4LA 5I6WA 4LF6L 1H9MA 1QWYA 2R6GA 2GVBA 2BDOA 1F2MA 1FNUA 2WKDA 1D8LA 5HGTA 2N49A 1VQJA 3JAMi 1HFGA 3MXNA 1WTQA 1Z7TA 3S16H 2OCEA 5E1FA 2EY6A 1H9KA 3C1EA 1BKBA 2EPBA 3HS0C 3FDTA 1EIHA 3T4AC 1SJHD 1X54A 5M9OA 2IHFA 2DUDA 4F8MA 2IX3A 2OTJA 2E5LL 2JA5G 1YNXA 1HXYD 1V1PB 2OEOA 5EKIA 1TY0A 3OTOQ 1I94L 4CHTB 1AEXA 3I4NB 2Y0SB 2E2DC 2O5IC 4R8IA 3HKSA 2R3ZA 2HUGA 2F0FA 2K5NA 2A68C 1R4QB 5A2QE 5C4ZA 3N52A 3D4DA 3U9SA 5TSSA 2IJ0A 4DR7Q 3D0FA 3SGIA 1K0SA 3SEBA 1YEZA 3K0XA 3NWSA 2QEXA 1FYCA 1IBLL 2MO0A 4G7OC 1EQVA 3PUVA 3S15B 2QA4A 4LUOA 1NR4A 1Q1EA 3MFYA 2K6AA 3I70A 1F77A 4CDEC 4A93H 3TP8A 3HP3A 1ASYA 1QOHA 5ELEA 4LFAL 2NTSA 3HRZC 1EQTA 3T53B 4HTHA 1SFOB 1TWCH 4ME5A 2F1MA 3VR4A 1JMCA 3JAML 3HOXH 1EQRA 4A3MB 4IUUA 4BA1I 2N55A 1Z47A 4YWMA 2JA6H 1LTLA 5C44H 2X6GA 2C35B 1B70B 3DMUA 4R9WA 1EYDA 4BY1B 2HCIA 3OPOA 2PZWA 5CORA 1EWHA 3GTMH 3KUPA 4A3LH 4BY7B 1CI3M 1EWIA 5G3LF 3FP9A 3I7FA 3PGZA 5FKAC 1AFPA 4XT1B 1M1KC 3NXWA 4ME3A 1F2ZA 2B2UC 4A3DH 1A3TA 2A1AA 1EZ8A 1C9OA 1II3A 4FDBA 1SMXA 4GKKQ 1O7YA 5E4WC 3I90A 4DUZQ 4FP5D 2PI2E 2HIXA 5CBEE 2DY8A 2VW9A 1PRTB 4IPDA 4EVOA 1OXXK 2ID0A 1BR9A 3ICEA 4U68A 4OO1H 1HNWQ 3RLOA 2NTTA 3HOUG 1JWUD 2ALYB 4ZYSA 4J15A 1CT1D 2C9OA 2MNAA 4JI1L 3BDLA 4O42A 2JA7G 3NP8A 4A3IG 2EE1A 3LNNA 3K5MA 1NAPA 2RQXA 2LKVA 4B3RL 4WJ4A 2KJXA 3HOVH 5LL6S 3GTJB 1TS2A 1U4PA 1JOKA 4A3JG 1Q81C 1SXTA 4MIUA 2K01A 1GUTA 4DV3Q 3BG3A 4OXPA 3IKJA 1GHKA 1Q8KA 2YYZA 3D4WA 1VQOA 5EBCA 1CZWA 4LF5L 1VF7A 4GKJQ 1I6HH 1W3SA 1STNA 3KK7A 3GTPH 2F4IA 2D5DA 3HKZB 1X55A 1VQNA 2G9DA 2K5QA 4KK7A 4QUCA 2V4DA 1D1IA 5ELDA 1KHIA 2AUKA 5IGDA 3PO2B 1V43A 3SK8A 1AZQA 1PRTC 1F2LA 2F0PA 2KEDA 1Y8PB 1I50B 1E3PA 1G2SA 4CJ2C 4DR5L 1H95A 4X3TA 2MPMA 3L7ZC 1ILQA 4GN4B 5GQOA 5DNFA 1GO3E 4F7XA 2WFWA 5KGUA 1KAWA 2JA9A 3W1BA 1UE5A 2UXCL 4K8JA 1EY9A 1GKHA 1SE8A 5M5WB 4QUFA 3MZ5A 1HZCA 2F0DA 1YHQA 4HIDA 1GXDC 3CCEA 2AHOB 3KOJA 3K5LA 1V1OA 3NPPA 1ML0D 3OW2A 4JBKA 1UNSA 2L5TA 2NZ1D 2K5VA 1B53A 1SNMA 4KHZA 5CMDA 4KHPL 4TQUS 5IT9c 2A73B 2O2LD 3AU7A 1M8AA 4C3HG 2JA5H 5D3IB 3QOLA 2OXPA 3A8IE 1CK1A 3TP5A 3PIOA 2MGSA 2N78A 5EQ0A 3CKIB 2JYOA 2SNSA 1HRJA 3KYHC 3GDEA 1ESRA 5J22A 1LTGD 3J80E 3TP6A 3RN2A 4O0AA 1N36L 1CHQD 4CDCC 4DK6C 5IGBA 4ULLA 2R93B 2NVTB 1CSQA 1PXUA 4JCVE 4G57A 1VQKA 4A3FB 3P7JA 4DV4L 2B2WA 4GNXA 4H44C 2OQKA 1V8QA 1SE4A 3BYTB 3G48A 5LMUQ 2NVYB 2UUAQ 1SBBB 1T5EA 1DD2A 1TWHB 1KDAA 2A8VA 4DAVA 1ENAA 4GOPB 1IKMA 4IPCA 4JI2Q 3UE1A 2WACA 4JI6Q 2Z0SA 3HOYB 1N32L 1KXLA 3K0YA 4KTAA 4JBMA 1IW7D 1SROA 1VQ8A 1ILPA 4CJ1B 1K83H 5DM73 5L37A 3NHHA 4X65Q 1O7LA 3P20A 3FMCA 2MQHA 2AWOA 1X3QA 2F0OA 2L55A 2Z6BA 1PA6A 1X65A 3TBIB 2L9HA 1U4MA 4ILWA 4WORA 2PMZE 1PDQA 4DUYL 4ODGA 4M1UB 1HH2P 1R9TB 1DM0B 1OXTA 2F3IA 2K50A 4LFCL 3D6CA 3OW7A 1LTID 5CGKA 2NVQH 1QJOA 1N34Q 4PMWA 2F0LA 4NMZA 1G2TA 3QG1A 1C4QA 2PO4A 3VYSA 5KIXA 3J81i 4L8JA 1WOCA 4PZ6A 1Y1VG 1WCMH 4QY7A 3BJUA 2YTXA 3GTOH 1O7IA 3S1NB 3HOUH 1I3QB 1HTPA 1DYQA 1W6JA 4GOPC 1EWCA 2IL8A 3CAMA 4BBRB 4R4TA 1VQDA 4HSPA 3H3VH 1VQPA 3J81E 4XYQA 1PYBA 1F9QA 2AQ3B 4A3GG 4IJHA 4A3IH 1LV9A 2HDLA 5C6AA 2EYMA 4HIOA 1N33Q 1IYVA 4BBSG 1E24A 1X3PA 1J5EQ 2O4XA 3K5OA 3Q0AA 1PH3A 1B3AA 5G3LD 2TSSA 4DR4L 4B3ML 1STGA 1UE1A 2VZAA 4A3JH 3GTGB 5FLMG 3DM1A 4JYAQ 1I4XA 4A3CG 3H09A 4XT3B 3A8JE 4AQYQ 4LNQA 5IYCG 5FJ8G 3GTQB 1NR2A 4FYDA 3EJIA 1D7QA 3N6RA 1LT6D 2NN6G 1LT5D 4HN7A 2FINB 4RMFA 5M3FG 2F0EA 1PH4A 5IIFA 5KNDA 5C0XI 3KLSA 1QZHA 1WTWA 2A6ED 2BCOA 3U58A 3RN5A 4V0BA 4OELB 1K8AC 1QCBD 4DV0Q 1HR0L 3OYYA 4P73A 5ISRA 1QUQA 2QDLA 2QF7A 3NE5B 4RG1A 1LLRD 1H9SB 1QE6A 4H13C 3CRKC 3K81C 5CBAE 2WAQB 1K8OA 4HR7B 5EJWA 4DAMA 3H15A 1Q12A 3PUZA 3F2DA 1TWFB 1NUCA 1JB7A 4DAYB 4ZUIA 3QR8A 4HMIA 3CMEA 5IE8A 2ASBA 5CYUA 5A35A 2IWHA 2KCNA 3S1MH 2KHSA 2B2TA 3S17H 4YWKA 1VQGA 1YITA 4YCWA 2X69A 1B7YB 4C3HH 1IBKL 2PQAA 3ERSX 4C3IB 4GNXB 3OTOL 1IYUA 1XNQL 4KD3A 3QO2A 3MEHA 3BU2A 4IFDJ 1PH7A 4K8IA 4RCOA 5IWAL 3DUZA 3M4OH 1GM5A 1MSGA 4LF8Q 3TRZA 3E0JA 4HAEA 1BCPF 2M00A 1B4OA 5IGCA 4MHEA 2JA8G 1OXUA 1X3FA 1XPOA 2Q2TA 1E2WA 4MN3A 5M5XB 4K0KQ 3NENA 1XX8A 1TT2A 2KENA 1U9RA 4IUPA 3CCMA 1GVPA 1TWAH 4DV5Q 4A3MG 5IYBG 3W2DA 2CWAA 1PFSA 2LY7A 3MTSA 1M90C 2Q8IB 2BH8A 2VXWA 3C1FA 3BYYB 3AFPA 3KLWA 3PUWA 5DAUA 4X3KA 3CHBD 3P75A 1FJGL 1S3OA 2JP1A 1BDOA 1EYGA 3E3XA 3J80c 2B8FA 4A3BB 1SAPA 1RD9D 1KNEA 2R7DA 4GLAC 2B2WC 3EFXD 4GNXC 1IW7C 3DHQA 1OTCA 1DOKA 3GTKB 2AWNA 5M3MB 3TS0A 1RDPD 1E0BA 4LJZC 3NEMA 2L12A 3S1RB 2R92B 1HFNA 4K5VA 5IP7G 4YHHQ 1FR3A 3LWEA 4JI3L 1HZ9A 3MFGA 2LS01 4JC0A 1NE3A 4L5RC 3J7A5 4KY6A 2A19A 1YJNA 3SE0A 3HOZB 3PQIA 1Y1VH 1O78A 2RHSB 4OX9Q 1HNWL 1XTDA 3OMCA 4QF4A 3T51B 4IZ8A 3HOWG 1OXVA 4RKBA 3HFZB 4DV7L 2F4VL 1CM9A 2JEBI 3S9WA 3ND9A 2YTVA 3V2TA 2WV6D 4RHSA 3VYTA 4X6AH 1I4QA 1S5BD 2I0QA 4MTKA 5EAYA 5FO8B 2ENBA 2E2IH 4DR2Q 4G4KA 1E1OA 2X6LA 5EPKA 5LHY1 3BZCA 4BBSH 4OO1I 4WJ3M 2NZHA 2VQEQ 4DN4M 3K59A 2EQSA 4C3JG 4QGUA 3I4MB 1CQVA 4JI4Q 1P8LA 1VQ9A 4DPGA 5FLMH 1VQBA 3U4VA 2RF4A 5I9PA 4A3CH 4N8X1 4NXNQ 3HKZG
chains in the Genus database with same CATH topology
2XNAC 1TR5A 2NN6H 4M8AA 1HHVA 1KDBA 2EJMA 2VUMB 1E2ZA 2M9VA 2DN8A 2QEJC 4XQJA 1Q8IA 3RMHA 3W3AA 4JK1C 5KRUA 1T5XD 3NSWA 3K58A 3S2HB 3T56B 3H94A 2A6EC 4H7BA 4UDUC 1LTTD 1BF4A 1HUNA 1JWMD 2A74C 3A56A 3WOEA 5BN5A 4G7HC 1KLUD 1CZGA 4RCNA 1CTMA 4DK1A 3LX0A 2H1EA 4ZK9B 2J7ZA 3M7GA 5C3EB 3M3YB 1WTRA 1JWSD 2SOBA 1S4ZA 5M5YB 2B2TC 2F0IA 2RA4A 3JAME 5AFWA 4NDXA 1QNKA 3FKIB 4RGNA 4Q0FA 5C3WA 1JORA 3ONAB 2PNRC 5HURA 2G9HD 1S5CD 2K04A 1TS5A 1A6XA 5EKLA 3RZOB 1J8IA 4CJ0B 2OT2A 5EPJA 1SMYD 3P1HA 3OWEB 3MA2B 5IT9L 3I3CA 3BDOA 5FK9C 4E6IA 2CW0D 2EY5A 5I6YA 2FJ2A 3HEJA 3NUCA 5CV4A 3SXHA 3S16B 3SVMA 5KYIA 3K7AB 3M85A 4L63B 4B08A 3Q22A 4XXEA 1ZKOA 4KD4A 1AN8A 1SJED 1LABA 1MI2A 2RBMA 3IL8A 1A3VA 1PFNA 5KEEA 1E2VA 1JOOA 1FD7D 3R3OA 1BO0A 4A93B 2AQ1B 1FNVA 4KY7A 5IGFA 2ICIA 3VA5A 4EQPA 4ZKCB 2L11A 1FNWA 3PV0A 2NWGA 1U4RA 5JAVA 2Q8TA 2XSCA 1EEFD 2RSNA 3PUYA 2JA6B 4DU9A 5C44B 1ZEQX 3BVMA 2DY7A 4F88A 4J1MA 3C3LA 2BA1A 3L3OC 1ENFA 4FXGC 2PYKA 2ZT9C 3I4LA 3H91A 4RGMA 5E4XA 3OWFA 5CV7A 2NUCA 4RA8A 1G91A 1WD0A 1VCIA 1UAPA 3VR3A 4IFDG 4R8NA 1B2TA 4ABNA 1PFMA 2CVRA 3MHBA 1HQRD 4XDXA 4TKOB 4RKLA 2PCFB 3HOVB 4CKCA 1RKNA 3HGBA 4DNRB 1TY2A 3NQTA 1PTOD 4PV1C 2D2CC 1HPCA 3NTIA 1SNQA 2B2YA 5D65A 3GQBA 4U673 3GV6A 3ZYYX 1AZPA 4J6HA 1VDZA 4B9WA 2K32A 1YNND 3NK9A 4OL7A 3BZDB 3ITPA 1ESFA 1SMYC 5JVH3 2BA0A 4KI0A 2L4NA 1LACA 2WINB 3QOJA 1ZYRD 1QB5D 4IALA 4LK1C 5ELCA 5CC4A 1UUPA 2CW0C 1Q3LA 3SK6A 4I65A 5LL6X 4V190 3NBHA 1GUGA 3SHLA 2Z4HA 3C46A 2XRSD 3IFDA 2B39A 1Q90A 4RAUC 1J9OA 4CKBA 5IGEA 1D2BA 4HSVA 4BA2I 3R93A 2PMZB 1OO9B 2HQEA 3EROA 3BDCA 4H0LC 4N9TA 1A3UA 1JOQA 4OGQC 1MBYA 5BN3A 2IT1A 3SK4A 1EOTA 3GD7A 3D31A 5FOBB 1SYEA 3CQZB 2EY1A 1I4PA 4HCSA 2E2JB 1I4HA 3FVQA 1RTOA 4ZKBB 2B2VA 3KLRA 2XVSA 2K28A 2EZVA 3FRPB 1EU3A 3R8BA 5K36G 2WB1B 1JE4A 1PRTF 2KOLA 2PW5A 2NVQB 2NYZD 1I6VC 3Q6SA 3R2IA 2F0KA 1SYDA 1PTOB 1DCZA 1O7ZA 1WCMB 2F03A 2XWBB 3H6MA 4C2MB 1W6KA 3BVZA 1G8ZD 3A54A 2QCPX 1HQMC 3I91A 4IFDH 3PMFA 3VR6A 4A3IB 2EVBA 5C0XG 1BQQT 3RZDB 2EXZA 3URYA 3D6WA 1XTCD 4DGZA 2L0CA 1DJRD 1F9RA 1KNAA 1STHA 5FLXL 1HA5A 5CR3A 4NW2A 1B9NA 2K03A 2IPKD 5EPLA 1GUWA 5C4XB 4BWGB 3WOFA 1C8CA 2B8GA 5COYA 1PTOC 2Z4IA 2BDNA 3PUXA 2F0MA 4KJOA 2F0NA 1TIID 4ID6A 4JBWA 2HCCA 4DFAA 1YNJD 3H3VC 2L1BA 2H4OA 1YNNC 4IUTA 5BN4A 2B2YC 4J8QA 3T13A 1TKWB 4X3UA 4FNFA 4K14A 3S1MB 4QIWB 3S17B 1LT3D 2F0QA 2I07B 1Y69U 1ZYRC 4C3HB 4UAIA 1K8MA 2DNEA 2ZXOA 1LTSD 1JICA 5EBDA 2WIIB 3MXPA 1ZXTA 2PPBC 2OF1A 1CA5A 1C48A 2RDFA 4O1NA 3MWYW 4EGVA 4KJNA 3V96A 2SDFA 1X32A 1EY7A 1CA6A 4NP5A 2IX1A 4WJWA 2SEBD 3H0GB 5K5PA 1WTPA 1QILA 2F0TA 4PNYA 2FFKB 1I4GA 2F0SA 4CBVA 5CV5A 4FO2A 2K5DA 2ZXPA 1G6ZA 3J7AV 4IUVA 1XYIA 2K33A 5EKKA 5K36H 4OIKA 1EYCA 2R61A 1G291 1D1KA 3SDZA 2N88A 2NVXB 2JE6I 4RFBA 1DONA 3SK5A 5I2YA 1RJTA 2F3WA 1ET6A 1SYFA 3TP7A 1LTRD 5ELFA 1Y1VB 1RODA 4KMUC 2B2VC 1B1ZA 2KVMA 2F3VA 5JOBA 1TS3A 1SSOA 4QCLA 1EY4A 1SEBD 5E3FA 4K6DA 2F0GA 2WP8J 4BBSB 4LAAA 2F0WA 1EEID 4DK0A 3QJYA 1RCVD 3VYRA 3QWNA 4Y7NB 3GTLB 1GUOA 4DXFA 1DOLA 2K7VA 4FXKC 3S14B 1RHPA 3KBXA 3G7LA 3TSSA 5FO9B 2K05A 1ET9A 5C0XJ 5ELBA 2EYHA 4HCEA 4DAPA 2QDBA 1PYWD 4YIJA 3DWQA 1JR0D 3A55A 1JQYD 2AQ2B 2CHBD 2EYJA 1QNUA 3MVVA 3PIO3 2FMCA 1AP0A 3C2PA 3VA7A 4DA2A 3CU7A 1YNJC 1Y8OB 4WRDA 2Z1CA 4KKUA 1BCPD 3HG9A 2O5JC 4I7ZC 1KLGD 2K1BA 3DEOA 3UI2A 1LTBD 2RSOA 1JB3A 1D5ZC 2K5WA 3MAQA 1BXTA 2JA8B 1DXMA 2MUYA 3FPPA 4ZAIA 3VR2A 3CRLC 2DNCA 5D14A 3OIPA 2E74C 1STYA 4PMBA 2RKSA 2JSOA 3NTHA 3RUZA 3EVQA 3X3MA 4RGTA 1CFMA 2KA7A 1STBA 4DF7A 5A2QL 2EJGC 1EL0A 4K5XA 1WD1A 4K2KA 1SDFA 3VYUA 1SE2A 1STEA 2E2HB 1F9SA 2A6HD 4QB4A 1CQFA 3R2TA 1TWCB 4KY5A 3V05A 4IUQA 1HCZA 4TSSA 3L9AX 3HOXB 1F2YA 1OXSC 1GOZA 3IAYA 3I8ZA 3O13A 3I72A 4FXDA 4FF4A 1A15A 3NQIA 3GTMB 3HOWB 1EU4A 3K6OA 3GO5A 5FO7B 2EYFA 3S1QB 3OOCA 2F0JA 3D4RA 3MC0B 4KHVA 4CGYB 4A3DB 3EA6A 3HZXA 4HEDA 4C3IG 3M4YA 4RGOS 1ENCA 1HUMA 3BVGA 3D8GA 4C3JB 4KKSA 1IKLA 4IFDI 4DXGA 2BOSA 1D5XC 3TMEA 2HDMA 2IX0A 2IW3A 2A69D 3F2UA 4XIGS 2KUMA 1B44D 1MGSA 1VF5C 1S5FD 1BCPB 4AYBB 3A7AB 4ZLTF 1SNOA 1TU2B 2ZXRA 1SNDA 4FF3A 1B50A 4EQNA 1UEAB 4XQQA 3FPUB 3GP7A 5DM63 1I6HB 5C4JB 1SE3A 2TMPA 2PQEA 3GTPB 4OIJA 4FF2A 5CV8A 4XQNA 1NSNS 1H9SA 3OIQA 4ZUJA 3S2DB 1RTNA 1LT4D 3SR1A 3TZUA 4CKEA 4DAYA 5JVG3 5EGTA 3VR5A 3KF8A 4G7ZC 3AMUA 1GUNA 1A2UA 4ZQ3A 1BCPC 2EJFC 1WTVA 5I2XA 5T1GA 2EY2A 1BNZA 4EQOA 2XWJB 1TWGB 2FHTA 3BS1A 4Z9CB 3DEPA 5F2DA 1TQOA 1KABA 1RF2D 5I4DA 4BS9A 1DOMA 3PO3B 2JA5B 4IUNA 2F0UA 2RDHA 3OHXC 3MXUA 2I46A 2WKCA 3D3RA 1CHPD 4Q5VA 4FF1A 5I9OA 3U9OA 1JC7A 3AB9A 2PZUA 5JEAG 3J80L 3NBIA 2XIWA 5CV6A 3M7NA 3E6ZX 4A3EB 3TDQA 1D6EC 1PMRA 2B63B 1A2TA 2VNUD 2M2LA 1PTOH 3I73A 4PMCA 3OSOA 3A8KE 1SYGA 3ERQA 4L6TB 1IL8A 2A6HC 1K83B 4RHRA 2D9UA 1STAA 2NN6I 2KECA 2VB2X 2CQAA 2GA4B 1PZID 1BOSA 1GHJA 2F0HA 1MD2D 3K5NA 2ICEC 4NKLA 3QIAA 5FLXE 4K2LA 1JCKB 1F9PA 1GUSA 2EDGA 1S5ED 3GTOB 3HOUB 4KN4C 1BBXC 3FEWX 4FVMA 3NWTA 5D3DA 5KYLA 2JA7B 5C3XA 2BE5D 3WDNA 4C1NK 1HA6A 3J81L 3Q24A 3EQLC 4PQXA 1KTKA 1SYBA 3PIP3 1I4RA 5IGGA 2R7ZB 4A3JB 2A69C 4S3SA 1EY8A 1EIGA 2VB3X 3DWAA 3GV3A 4KN7C 1SNCA 2EYOA 2KEEA 3OMGA 5KNBA 3ND8A 1H9RA 1BUVT 4X3SA 4P2CB 2KCCA 1R4PB 4F87A 2RDGA 1WTOA 3J7YW 1AW7A 1EY5A 1ICWA 1WTXA 1XWEA 2XN9C 1Z6HA 1H9JA 4XYOA 4DNTB 1L0YB 2Z8LA 2A68D 1D5MC 2C5CA 2KQ3A 2SNMA 3RD4A 4LMQD 2QKIC 3KLSX 1EY6A 1PZKD 1KDCA 1B9MA 2D62A 5J39A 5C5LA 5NUCA 1KAAA 5JPNC 4IURA 5IOCA 2JEAI 4ZRZA 1PFBA 4RH6A 2EOTA 3M4OB 2QILA 5JEAH 1V1PA 4WFN3 4C1NI 5T1IA 1DZ1A 3Q23A 4B9XA 2J0TD 1IHZA 3KBGA 1EZ6A 1Y8NB 2B2UA 2NB0A 1XXGA 1S5DD 4KKTA 2AUJD 3TN2A 1TWAB 4TRDA 3K57A 1WVLA 5JJZA 4IN3A 1MSHA 1ONLA 4QMGA 1PLFA 4A3KB 5JEAJ 2RVLA 4K6LA 3LWUA 2JXMB 3J7AF 5IODA 1EFID 1GJXA 2F0VA 2PZTA 1QG7A 2EYPA 2MHVA 4XTCS 1SNPA 2LMCB 1TVXA 4GZYC 1LO5D 3IFTA 4RWSC 4OHJA 2LFNA 3TZDA 3G6JB 2Q8RE 2XRQD 4N9PA 5CV9A 1VMPA 4OO1G 1VMCA 3X3NA 4KV6A 5KNCA 1EY0A 1L0XB 2A5HA 5C5MA 2MP1A 1TS4A 1FGBD 3RLFA 1EYAA 1Y1WB 1SYCA 4IQZA 4C56C 4A3GB 1O80A 2NBFA 2E2IB 1HTLD 5C0XH 2FMMA 1LTAD 1PZJD 2E76C 3MXGA 2MJ8A 3QB3A 1PRTD 4K5WA 5C4HA 3A7LA 2BE5C 2EYLA 3DXJC 1M4VA 3E5SA 3DWPA 3T16A 5J1ZA 5IT9E 5DEHA 2PW7A 5JPMC 4HMJA 1NCVA 3NTKA 2YU9B 2E75C 5M3FB 1PTOF 2J4XA 1Q1BA 1U4LA 5I6WA 1H9MA 1QWYA 2R6GA 2BDOA 1F2MA 1FNUA 2WKDA 5HGTA 1HFGA 3MXNA 1WTQA 1Z7TA 5E1FA 2EY6A 1H9KA 3C1EA 2EPBA 3HS0C 3FDTA 1EIHA 3T4AC 1SJHD 5M9OA 4F8MA 2IX3A 1HXYD 1V1PB 2OEOA 5EKIA 1TY0A 4CHTB 1AEXA 3I4NB 2Y0SB 2E2DC 2O5IC 4R8IA 2R3ZA 2HUGA 2F0FA 2A68C 1R4QB 5A2QE 5C4ZA 3N52A 3D4DA 3U9SA 5TSSA 2IJ0A 3SEBA 3NWSA 1FYCA 4G7OC 1EQVA 3PUVA 3S15B 1NR4A 1Q1EA 3MFYA 2K6AA 3I70A 1F77A 3TP8A 3HP3A 1QOHA 5ELEA 2NTSA 3HRZC 1EQTA 3T53B 4HTHA 1SFOB 4ME5A 2F1MA 3VR4A 3JAML 4A3MB 4IUUA 4BA1I 2N55A 1Z47A 2X6GA 3DMUA 4R9WA 4BY1B 1EYDA 2HCIA 3OPOA 2PZWA 5CORA 1EWHA 3KUPA 4BY7B 1CI3M 5G3LF 5FKAC 1AFPA 4XT1B 3NXWA 1F2ZA 2B2UC 1A3TA 1EZ8A 1II3A 1O7YA 5E4WC 3I90A 4FP5D 5CBEE 2DY8A 1PRTB 4EVOA 1OXXK 2ID0A 1BR9A 4U68A 4OO1H 2NTTA 1JWUD 4ZYSA 1CT1D 2C9OA 3BDLA 4O42A 3NP8A 2EE1A 3LNNA 3K5MA 1NAPA 2RQXA 2LKVA 2KJXA 5LL6S 3GTJB 1TS2A 1U4PA 1JOKA 1SXTA 4MIUA 2K01A 1GUTA 3BG3A 3IKJA 1GHKA 2YYZA 3D4WA 5EBCA 1CZWA 1VF7A 1STNA 3KK7A 2F4IA 2D5DA 3HKZB 2G9DA 2K5QA 4KK7A 4QUCA 2V4DA 1D1IA 5ELDA 2AUKA 5IGDA 3PO2B 1V43A 3SK8A 1AZQA 1PRTC 1F2LA 2F0PA 2KEDA 1Y8PB 1I50B 1G2SA 4CJ2C 4X3TA 2MPMA 3L7ZC 1ILQA 5DNFA 4F7XA 5KGUA 4K8JA 1EY9A 5M5WB 4QUFA 3MZ5A 2F0DA 1GXDC 3K5LA 1V1OA 3NPPA 1ML0D 1UNSA 2L5TA 2NZ1D 1B53A 1SNMA 4KHZA 5CMDA 4TQUS 2A73B 2O2LD 3AU7A 1M8AA 4C3HG 5D3IB 3QOLA 2OXPA 3A8IE 1CK1A 3TP5A 2MGSA 5EQ0A 3CKIB 2JYOA 2SNSA 1HRJA 5J22A 1ESRA 1LTGD 3J80E 3TP6A 1CHQD 5IGBA 4ULLA 2R93B 2NVTB 1PXUA 4G57A 4A3FB 3P7JA 2B2WA 4H44C 1V8QA 1SE4A 3BYTB 2NVYB 1SBBB 1T5EA 1DD2A 1TWHB 1KDAA 4DAVA 1ENAA 1IKMA 2WACA 3HOYB 3K0YA 4KTAA 1IW7D 1ILPA 4CJ1B 5DM73 3NHHA 1O7LA 3FMCA 3P20A 2AWOA 1X3QA 2F0OA 2L55A 3TBIB 2L9HA 1U4MA 4ILWA 4WORA 1PDQA 4ODGA 4M1UB 1R9TB 1DM0B 1OXTA 3D6CA 3OW7A 1LTID 5CGKA 1QJOA 4PMWA 2F0LA 4NMZA 1G2TA 5KIXA 1C4QA 2PO4A 3QG1A 3VYSA 4L8JA 3S1NB 1I3QB 1HTPA 1DYQA 1W6JA 1EWCA 2IL8A 4BBRB 4HSPA 3J81E 4XYQA 2AQ3B 1F9QA 1LV9A 2HDLA 5C6AA 2EYMA 1IYVA 1X3PA 2O4XA 3K5OA 3Q0AA 1B3AA 5G3LD 2TSSA 1STGA 3GTGB 3DM1A 1I4XA 3H09A 4XT3B 3A8JE 3GTQB 1NR2A 4FYDA 3EJIA 3N6RA 1LT6D 2NN6G 1LT5D 4HN7A 2FINB 2F0EA 5IIFA 5KNDA 5C0XI 3KLSA 1WTWA 2A6ED 2BCOA 4V0BA 1QCBD 5ISRA 2QF7A 3NE5B 1LLRD 1H9SB 1QE6A 4H13C 3CRKC 5CBAE 2WAQB 1K8OA 4HR7B 5EJWA 1Q12A 3PUZA 1TWFB 1NUCA 4ZUIA 4HMIA 5CYUA 5A35A 2IWHA 2KCNA 2KHSA 2B2TA 2X69A 4C3IB 1IYUA 4KD3A 3QO2A 3MEHA 4IFDJ 4K8IA 4RCOA 3DUZA 1MSGA 3E0JA 4HAEA 1BCPF 2M00A 1B4OA 5IGCA 4MHEA 1OXUA 1E2WA 4MN3A 5M5XB 1XX8A 1TT2A 1U9RA 4IUPA 3W2DA 3MTSA 2LY7A 2Q8IB 2VXWA 3C1FA 3BYYB 3PUWA 5DAUA 4X3KA 3CHBD 3P75A 2JP1A 1BDOA 2B8FA 4A3BB 1SAPA 1RD9D 1KNEA 2B2WC 3EFXD 1IW7C 3DHQA 1DOKA 3GTKB 2AWNA 5M3MB 1RDPD 1E0BA 4LJZC 2L12A 3S1RB 2R92B 1HFNA 4K5VA 1FR3A 3LWEA 3MFGA 2LS01 4KY6A 3SE0A 3HOZB 1O78A 3OMCA 4QF4A 3T51B 4IZ8A 1OXVA 4RKBA 1CM9A 2JEBI 3S9WA 3ND9A 3VYTA 4RHSA 3V2TA 2WV6D 1I4QA 1S5BD 5FO8B 2ENBA 4G4KA 2X6LA 5EPKA 5LHY1 4OO1I 4DN4M 3K59A 4C3JG 3I4MB 1CQVA 5I9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QUF A;  2DY7 A;  2X6G A;  4HAE A;  1WTP A;  4R9W A;  1B4O A;  4IUQ A;  1F9P A;  3I3C A;  4MHE A;  2HCI A;  4IUR A;  1HHV A;  2FFK B;  2IL8 A;  5COR A;  1PFB A;  1ML0 D;  2EOT A;  3KUP A;  4MN3 A;  1XX8 A;  3D6W A;  2NZ1 D;  3IFD A;  1B53 A;  5T1I A;  1DZ1 A;  1F9Q A;  1F9R A;  1AP0 A;  4IUP A;  4RAU C;  1LV9 A;  3H91 A;  4XT1 B;  2HDL A;  1J9O A;  3I8Z A;  5CMD A;  2FJ2 A;  1M8A A;  1KNA A;  1NCV A;  1BBX C;  1X3P A;  1WTV A;  5T1G A;  2B2U C;  1B3A A;  1A15 A;  5E4X A;  1U4L A;  3SVM A;  3MTS A;  4HSV A;  1BNZ A;  3R93 A;  2B2U A;  2FHT A;  4NW2 A;  4RA8 A;  1G91 A;  3DEP A;  1WD0 A;  1O7Y A;  5E4W C;  3I90 A;  2VXW A;  2K03 A;  3DM1 A;  2MGS A;  5EPL A;  5EQ0 A;  4IUV A;  3TN2 A;  5CBE E;  1GUW A;  1XYI A;  1DOM A;  2JYO A;  4X3K A;  4XT3 B;  1C8C A;  2DY8 A;  1ESR A;  5JJZ A;  1WVL A;  1HA6 A;  1HRJ A;  5COY A;  1MSH A;  1B2T A;  1HFG A;  2JP1 A;  1WTQ A;  4OIK A;  4HED A;  4U68 A;  1PFM A;  1PLF A;  1NR2 A;  2CVR A;  2BDN A;  1SAP A;  4XDX A;  1KNE A;  1BF4 A;  1EOT A;  1HUM A;  2B2W C;  1HUN A;  2N88 A;  1DOK A;  2RVL A;  3P7J A;  2FIN B;  1MI2 A;  1DON A;  2B2W A;  1IKL A;  3IL8 A;  2EPB A;  2K1B A;  3DEO A;  3FDT A;  3UI2 A;  1EIH A;  1E0B A;  1RJT A;  2HCC A;  2L12 A;  4O42 A;  1WTW A;  2RSO A;  1HFN A;  4HCS A;  1PFN A;  1EIG A;  1ROD A;  2EE1 A;  2B2V C;  2XIW A;  2KVM A;  2L1B A;  3LWE A;  1NAP A;  3GV3 A;  1RTO A;  1QG7 A;  1IKM A;  4IUT A;  4ZKB B;  5EKI A;  2B2V A;  2HDM A;  1SSO A;  1TVX A;  2H1E A;  4ZK9 B;  2KEE A;  2B2Y C;  3F2U A;  2K28 A;  2J7Z A;  4RWS C;  2KUM A;  1U4P A;  1QE6 A;  1MGS A;  4R8I A;  4X3U A;  2R3Z A;  1ILP A;  2HUG A;  5CBA E;  4CJ1 B;  2B2Y A;  5D65 A;  2K01 A;  4ZAI A;  3TZD A;  4X3S A;  2Q8R E;  3GV6 A;  5D14 A;  3N52 A;  5EJW A;  4ZLT F;  2M2L A;  1WTR A;  1S4Z A;  1AZP A;  1BO0 A;  1JE4 A;  1VMP A;  4UAI A;  1VMC A;  2KOL A;  1X3Q A;  1JIC A;  1CM9 A;  2B2T C;  1B50 A;  2RA4 A;  2L9H A;  2NYZ D;  5AFW A;  1U4M A;  1WTO A;  1IL8 A;  1ZXT A;  3Q6S A;  1QNK A;  4ZKC B;  1NR4 A;  4QUC A;  2MP1 A;  1ICW A;  2B2T A;  2L11 A;  1WTX A;  3FPU B;  2D9U A;  1PDQ A;  2NWG A;  2X6L A;  5EPK A;  2X69 A;  3HP3 A;  1AZQ A;  1CA5 A;  2L4N A;  1F2L A;  3ONA B;  1O7Z A;  1U4R A;  2KED A;  1DOL A;  2Q8T A;  1EL0 A;  2RSN A;  1G2S A;  4DN4 M;  4CJ2 C;  1WD1 A;  1G6Z A;  4OIJ A;  4X3T A;  1EQT A;  1RHP A;  2K04 A;  2KEC A;  2MPM A;  3KBX A;  3MWY W;  4LMQ D;  1SDF A;  3G7L A;  1ILQ A;  1O80 A;  3QO2 A;  1G2T A;  2SDF A;  1Q3L A;  1X32 A;  2K05 A;  3I91 A;  1RTN A;  5DNF A;  1F9S A;  4CJ0 B;  1CA6 A;  4IUU A;  1J8I A;  2FMM A;  2N55 A;  5EPJ A;  1MSG A;  2MJ8 A; 
#chains in the Genus database with same CATH topology
 5FJ8 H;  5IYC H;  3S14 H;  4GKJ L;  2XNA C;  3M4Q A;  1TR5 A;  3PO2 G;  2NN6 H;  4M8A A;  2YU9 H;  1K0R A;  2Z6K A;  1HHV A;  1KDB A;  1IXR A;  2EJM A;  4P75 A;  3CCL A;  1VQ5 A;  2VUM B;  1E2Z A;  2M9V A;  2DN8 A;  2QEJ C;  4XQJ A;  1Q8I A;  1Y14 B;  3RMH A;  3W3A A;  4HJ5 A;  4JK1 C;  3KJP A;  5KRU A;  1T5X D;  3NSW A;  3K58 A;  1B8A A;  3E0E A;  3S2H B;  3T56 B;  2V1C C;  3H94 A;  2A6E C;  1K9M C;  2PI2 A;  4JI5 Q;  4H7B A;  4UDU C;  1LTT D;  1NMG A;  1BF4 A;  1ICF B;  1JWM D;  1HUN A;  2A74 C;  3A56 A;  3WOE A;  5BN5 A;  4G7H C;  1KLU D;  1CZG A;  4RCN A;  1CTM A;  3PIP A;  4DR3 Q;  1E1T A;  4DK1 A;  3LX0 A;  3T1Y L;  4YWL A;  2H1E A;  4ZK9 B;  2UUB Q;  2J7Z A;  1WYD A;  3M7G A;  5IP9 G;  1YBY A;  5C3E B;  3M3Y B;  1WTR A;  1JWS D;  2SOB A;  1S4Z A;  3ULJ A;  1NNX A;  2JA8 H;  5M5Y B;  2B2T C;  5GRO A;  2F0I A;  2RA4 A;  3JAM E;  5AFW A;  4NDX A;  1QNK A;  3FKI B;  1SFO H;  3PO3 G;  4RGN A;  1Z9F A;  5LMU L;  2UUA L;  4Q0F A;  2AKW B;  1SN8 A;  5C3W A;  1JOR A;  4A3M H;  5IYB H;  2XGT A;  3ONA B;  2PNR C;  5HUR A;  4HJ7 A;  4QJF A;  4JI6 L;  2G9H D;  1S5C D;  2K04 A;  1TS5 A;  1A6X A;  5EKL A;  3RZO B;  4IOC A;  4JBJ A;  4CJ0 B;  1J8I A;  3RNU A;  2OT2 A;  3CF5 A;  5EPJ A;  1SMY D;  3P1H A;  1JT8 A;  4JI8 Q;  3OWE B;  4A3E G;  3MA2 B;  5IT9 L;  2L15 A;  3I3C A;  3BDO A;  4JVZ A;  4P71 A;  2UUC L;  2E2H H;  1MJC A;  5FK9 C;  4E6I A;  1KRT A;  4X62 Q;  4DV6 L;  2B63 G;  2CW0 D;  5IP7 H;  2EY5 A;  5I6Y A;  2FJ2 A;  3HEJ A;  3NUC A;  5CV4 A;  1VQ4 A;  3SXH A;  1N34 L;  3S16 B;  3SVM A;  4TVA B;  5KYI A;  1U0L A;  3K7A B;  3ER0 A;  3M85 A;  4L63 B;  4B08 A;  3Q22 A;  4XXE A;  1XPR A;  1ZKO A;  1HNX Q;  4BBR G;  1PV4 A;  4KD4 A;  3HOW H;  1AN8 A;  4POG A;  3S1Q H;  1SJE D;  1LAB A;  1MI2 A;  2RBM A;  3IL8 A;  1A3V A;  3ULP A;  4JI0 L;  1PFN A;  5J3B A;  1VS0 A;  1J5E L;  5KEE A;  2KBN A;  1JJG A;  4C3J H;  1AE3 A;  1E2V A;  3H3V I;  2JQO A;  1VQH A;  5AJ3 L;  1JOO A;  1FD7 D;  3R3O A;  3WWV A;  1BO0 A;  2PNH A;  4A93 B;  2AQ1 B;  3PO2 H;  1FNV A;  4KY7 A;  5IGF A;  2ICI A;  3VA5 A;  4EQP A;  4ZKC B;  2ZJP A;  3KJO A;  2L11 A;  3KDF A;  1FNW A;  3PV0 A;  2NWG A;  1U4R A;  2Q8T A;  5JAV A;  2MFI A;  2XSC A;  5IYD G;  1EEF D;  2RSN A;  3PUY A;  2JA6 B;  2R7Z G;  4DU9 A;  5C44 B;  3A74 A;  1ZEQ X;  3BVM A;  1G51 A;  5C4J H;  4B3S Q;  2Z6K C;  2DY7 A;  3MXN B;  4O2D A;  4F88 A;  4J1M A;  3AQQ A;  3C3L A;  2BA1 A;  4PG3 A;  3S2D H;  3L3O C;  2HHH L;  1ENF A;  4FXG C;  2PYK A;  5H1S E;  2ZT9 C;  1WTH A;  3I4L A;  4YY3 L;  3H91 A;  1C0A A;  1LM0 A;  4RGM A;  5E4X A;  4AYB E;  3OWF A;  3S24 A;  5CV7 A;  2NUC A;  2OWO A;  1XNR Q;  4RA8 A;  4LF9 Q;  1G91 A;  1WD0 A;  2VQF Q;  1VCI A;  5IP9 H;  2QW7 A;  1UAP A;  2CKZ B;  3VR3 A;  4IFD G;  4R8N A;  1B2T A;  4ABN A;  1PFM A;  1X6O A;  1YHA A;  2NVY H;  2CVR A;  4DV2 L;  3MHB A;  1TWH H;  4B3T L;  1HQR D;  1TWG H;  4XDX A;  4JI7 L;  4TKO B;  4HJA A;  3KF6 A;  1TXY A;  4RKL A;  4K0K L;  2PCF B;  4QQB X;  3PO3 H;  3HOV B;  2UXB L;  4CKC A;  3TQY A;  1L0W A;  1RKN A;  3HGB A;  4DV5 L;  4DNR B;  1TY2 A;  3NQT A;  1PTO D;  3U4Z A;  3DM3 A;  2NZO A;  4PV1 C;  4CDF C;  2D2C C;  1HPC A;  4A3B G;  3NTI A;  2D0O A;  1L1O A;  1SNQ A;  1V9P A;  4LF6 Q;  4DV1 Q;  2B2Y A;  4JG2 A;  3GQB A;  3NEL A;  5D65 A;  4LF7 Q;  1WI5 A;  2K75 A;  4LF4 L;  1PYS B;  3GV6 A;  3ZYY X;  4U67 3;  1AZP A;  4J6H A;  1VDZ A;  4A3E H;  4B9W A;  1R9T H;  2K32 A;  1YNN D;  1Q82 C;  1EFW A;  3NK9 A;  4OL7 A;  1CUK A;  2B63 H;  3JAM c;  2FXQ A;  3BZD B;  3ITP A;  1ESF A;  1SMY C;  5JJK A;  4A75 A;  5JVH 3;  2BA0 A;  4KI0 A;  1PHJ A;  3HOZ G;  2L4N A;  4A3K G;  2YTY A;  4JPB W;  4R4Q A;  4HIM A;  1PH8 A;  1ASZ A;  1LAC A;  2WIN B;  5JJI A;  3QOJ A;  1ZYR D;  1QB5 D;  4IAL A;  4LK1 C;  5ELC A;  3S1N H;  5CC4 A;  1UUP A;  2E5L Q;  2CW0 C;  1QVC A;  1Q3L A;  4BBR H;  1I94 Q;  3SK6 A;  4I65 A;  2Q2U A;  5LL6 X;  4V19 0;  3NBH A;  4JOI A;  1GUG A;  3SHL A;  4A76 A;  2Z4H A;  4UHV A;  3C46 A;  2XRS D;  3A5Z B;  3IFD A;  2B39 A;  4DR2 L;  1Q90 A;  4RAU C;  1J9O A;  4CKB A;  2BH2 A;  1UE6 A;  5IGE A;  1D2B A;  4HSV A;  4BA2 I;  3KDF B;  3R93 A;  5DLQ E;  1KQS A;  2PMZ B;  1OO9 B;  3ERO A;  2HQE A;  3BDC A;  4LFA Q;  4H0L C;  4N9T A;  4NXN L;  1VQF A;  1A3U A;  1JOQ A;  3UDI A;  4OGQ C;  4OWX B;  2VUM G;  1MBY A;  4EX5 A;  5BN3 A;  5BR8 L;  2IT1 A;  3SK4 A;  1Y1W G;  2JA7 H;  1EOT A;  3GD7 A;  3D31 A;  5FOB B;  2I5M X;  1SYE A;  3CQZ B;  1PH6 A;  4MNO A;  3ULL A;  2EY1 A;  1I4P A;  4HCS A;  2CFM A;  1YJ9 A;  2ZJQ A;  2E2J B;  3CPW A;  5IYD H;  2R7Z H;  1I4H A;  3FVQ A;  1RTO A;  4ZKB B;  1TWF H;  2B2V A;  3KLR A;  2XVS A;  2K28 A;  2K52 A;  2EZV A;  3FRP B;  1EU3 A;  4GS3 A;  5LMN Q;  4OON A;  4Y52 H;  2CWP A;  4DR6 Q;  4JI5 L;  1K3R A;  1N8R C;  1EIY B;  4X66 L;  2IY5 B;  4YCV A;  3R8B A;  5K36 G;  2WB1 B;  1JE4 A;  1PRT F;  2KOL A;  2JN4 A;  1NY4 A;  2PW5 A;  2Q2I A;  2NVQ B;  2NYZ D;  1I6V C;  1C7Y A;  3Q6S A;  4GN5 A;  3R2I A;  2F0K A;  2G5D A;  3CMA A;  1LYL A;  1SYD A;  2B3G A;  1PTO B;  2UU9 Q;  4DR3 L;  1O7Z A;  1DCZ A;  1WCM B;  2JK8 A;  5HGQ A;  4JI1 Q;  3PSI A;  2F03 A;  2XWB B;  3H6M A;  4C2M B;  1W6K A;  1A8V A;  1YZ6 A;  1G8Z D;  3BVZ A;  3J7Z C;  3A54 A;  2QCP X;  1HQM C;  3I91 A;  1NMF A;  4IFD H;  1VQA A;  4B3R Q;  1SR3 A;  5M5X H;  3PMF A;  3VR6 A;  3FKI G;  4A3I B;  1XJV A;  4H02 A;  2EVB A;  5C0X G;  1BQQ T;  1JE5 A;  3RZD B;  3I4N G;  2Y0S G;  2EXZ A;  3URY A;  3D6W A;  4X64 Q;  1XTC D;  4DGZ A;  2L0C A;  1DJR D;  1F9R A;  1VQM A;  1BBU A;  1KNA A;  1STH A;  5FLX L;  1QZG A;  3AFQ A;  4GLX A;  1HA5 A;  5CR3 A;  1V1Q A;  4A3B H;  4NW2 A;  1VQI A;  1B9N A;  3CW2 C;  2K03 A;  2IPK D;  5EPL A;  1GUW A;  5C4X B;  4BWG B;  4DR7 L;  3WOF A;  1L2F A;  4LUZ A;  1C8C A;  2GN5 A;  1XMQ Q;  2B8G A;  5COY A;  4JI8 L;  2HQL A;  1EUJ A;  1PTO C;  2Z4I A;  5GAD C;  1KC8 C;  3E9H A;  2BDN A;  3PUX A;  2F0M A;  2UXC Q;  4KJO A;  2F0N A;  4UY8 C;  1TII D;  4DK3 C;  3UDG A;  4ID6 A;  4JBW A;  2HCC A;  4DFA A;  1YNJ D;  1NBW A;  3H3V C;  4A3K H;  3HOZ H;  1S40 A;  2L1B A;  2H4O A;  4BY1 G;  1YNN C;  4IUT A;  2DGY A;  5GAG C;  5JJL A;  4KHP Q;  5BN4 A;  2B2Y C;  3DLL A;  4BY7 G;  1NTG A;  4J8Q A;  3T13 A;  1TKW B;  3T1H Q;  4X3U A;  4FNF A;  1AE2 A;  4K14 A;  3S1M B;  4QIW B;  3S17 B;  1YHB A;  1LT3 D;  2F0Q A;  2I07 B;  1Y69 U;  1J6Q A;  1ZYR C;  4C3H B;  2HT1 A;  4UAI A;  1K8M A;  2DNE A;  2ZXO A;  1LTS D;  1JIC A;  5EBD A;  2WII B;  4P74 A;  3MXP A;  1N36 Q;  1ZXT A;  2PPB C;  4YCU A;  2OF1 A;  2F52 A;  4GKK L;  2KCM A;  1CA5 A;  3CXC A;  4DUZ L;  1C48 A;  2RDF A;  3TRE A;  4APV A;  4O1N A;  4HIK A;  4OEM B;  3I2Z A;  3MWY W;  1EOV A;  4EGV A;  4KJN A;  4A93 G;  3V96 A;  2SDF A;  1X3E A;  1X32 A;  3W5O A;  1EY7 A;  4KLK A;  1G6P A;  1CA6 A;  4NP5 A;  2IX1 A;  1N32 Q;  2ZTD A;  4WJW A;  4JOI C;  5HY6 A;  1PVO A;  2SEB D;  3H0G B;  5K5P A;  1Y1W H;  1WTP A;  2KHI A;  1QIL A;  2F0T A;  4A3G H;  3E9I A;  4PNY A;  2FFK B;  1YI2 A;  1I4G A;  2F0S A;  4CBV A;  2YV5 A;  5CV5 A;  3CCS A;  4FO2 A;  2K5D A;  4DUY Q;  4DV3 L;  1S72 A;  2ZXP A;  1G6Z A;  1QUQ B;  3J7A V;  4LFC Q;  1HNZ Q;  4IUV A;  1XYI A;  2K33 A;  5EKK A;  5K36 H;  2K14 A;  4OIK A;  5M3F H;  1EYC A;  2R61 A;  3G6E A;  1XMO Q;  1G29 1;  1D1K A;  4ZCK A;  3SDZ A;  2N88 A;  2NVX B;  2JE6 I;  3AYH B;  4RFB A;  3J81 c;  1DON A;  3SK5 A;  3PF4 A;  5I2Y A;  1RJT A;  2F3W A;  1ET6 A;  1SYF A;  3A5U A;  3TP7 A;  1MKH A;  1LTR D;  4GN3 B;  1EIF A;  1NJI C;  5ELF A;  1Y1V B;  1ROD A;  4KMU C;  2B2V C;  1B1Z A;  2KVM A;  2F3V A;  1K8G A;  5JOB A;  2K5H A;  2PQA B;  1DGS A;  1TS3 A;  1SSO A;  1U5K A;  3TEH B;  4QCL A;  1EY4 A;  1SEB D;  3PF5 A;  4GLV B;  4DR4 Q;  3FKI H;  4B3M Q;  3UE0 A;  5E3F A;  2ZM6 Q;  4K6D A;  4POF A;  2F0G A;  2WP8 J;  4BBS B;  4LAA A;  3CC2 A;  4BXX G;  2AMC B;  2F0W A;  3I4N H;  4P72 A;  1EEI D;  4DK0 A;  3QJY A;  1RCV D;  1K3B C;  3VYR A;  3QWN A;  2H5X A;  4Y7N B;  3K8A A;  1IBM Q;  1KRS A;  3W1G A;  1GUO A;  3GTL B;  4DXF A;  4UPA A;  1DOL A;  2K7V A;  2EIF A;  2R93 G;  4FXK C;  3S14 B;  4LFB Q;  1RHP A;  3KBX A;  3S15 H;  4A3F G;  3G7L A;  3TSS A;  1RL2 A;  5FO9 B;  2K05 A;  1ET9 A;  5C0X J;  5ELB A;  1HR0 Q;  4LF7 L;  2EYH A;  4HCE A;  2K4K A;  4DAP A;  2QDB A;  1KL9 A;  1PYW D;  4YIJ A;  1CKN A;  3DWQ A;  1JR0 D;  3A55 A;  3HOY G;  5GAH C;  1JQY D;  2AQ2 B;  1Q7Y C;  2CHB D;  2EYJ A;  4JV5 Q;  1QNU A;  3MVV A;  2UXD Q;  3TS2 A;  3K7A H;  3CP0 A;  3PIO 3;  2FMC A;  2Y0S E;  4JI2 L;  1AP0 A;  3CCJ A;  3C2P A;  4BY1 H;  3VA7 A;  4IPG A;  4R4I A;  4DA2 A;  4BY7 H;  2N8N A;  3CU7 A;  4X65 L;  1IBK Q;  1YNJ C;  1Y8O B;  1XNQ Q;  4WRD A;  4NXM Q;  2Z1C A;  1PH2 A;  1FVI A;  4KKU A;  1BCP D;  4PZ8 A;  1KIX A;  3HG9 A;  5IWA Q;  1IL2 A;  2I5H A;  2O5J C;  4I7Z C;  1KLG D;  3L0O A;  2K1B A;  3DEO A;  3UI2 A;  4EQ5 A;  2KCT A;  1LTB D;  1MHW C;  2RSO A;  3STB D;  1D5Z C;  1JB3 A;  3ZJY C;  4I7A A;  2K5W A;  3MAQ A;  2CQO A;  3BZK A;  2RCF A;  1BXT A;  3VDY A;  2Z9H A;  2JA8 B;  1DXM A;  1UWV A;  2MUY A;  3FPP A;  4ZAI A;  3VR2 A;  3CRL C;  2I5L X;  2DNC A;  5D14 A;  3OIP A;  2E74 C;  1STY A;  4JW0 A;  4PMB A;  2RKS A;  2JSO A;  3GTJ H;  3NTH A;  1FJG Q;  4L5Q A;  4UP7 A;  1N33 L;  3RUZ A;  2ES2 A;  3EVQ A;  3X3M A;  4RGT A;  1CFM A;  2KA7 A;  1STB A;  4DF7 A;  2VL6 A;  5A2Q L;  4GOP A;  1VQ7 A;  2EJG C;  1EL0 A;  2CH4 A;  4K5X A;  4JYA L;  1WD1 A;  1T9H A;  3K80 C;  4K2K A;  4AQY L;  1SDF A;  2WB1 G;  3VYU A;  2KHJ A;  1SE2 A;  1STE A;  5LMN L;  4JI3 Q;  4DR6 L;  2E2H B;  1F9S A;  2A6H D;  1PH5 A;  4QB4 A;  2LSS A;  1CQF A;  3R2T A;  1I50 H;  4DR1 Q;  1TWC B;  3B6Y A;  4KY5 A;  3V05 A;  4IUQ A;  1HCZ A;  1VQC A;  4TSS A;  1WCM G;  3L9A X;  3HOX B;  1F2Y A;  2HD3 A;  1OXS C;  3CD6 A;  4DV0 L;  1GOZ A;  2WAQ G;  3IAY A;  2UU9 L;  5M5W H;  4DV7 Q;  2F4V Q;  3AEV A;  3EN2 A;  3I8Z A;  3O13 A;  3I72 A;  1SLJ A;  4FXD A;  4FF4 A;  1A63 A;  1A15 A;  3NQI A;  3GTM B;  3HOW B;  1EU4 A;  3K6O A;  3GO5 A;  5FO7 B;  2EYF A;  3CC7 A;  3S1Q B;  3OOC A;  2F0J A;  2EXD A;  3D4R A;  3MC0 B;  4KHV A;  3HKZ E;  4HJ8 A;  4CGY B;  1WFQ A;  4A3D B;  1BVS A;  3EA6 A;  3HZX A;  4HED A;  4R4C A;  4C3I G;  4BXX H;  3M4Y A;  4RGO S;  1ENC A;  1HUM A;  3BVG A;  3D8G A;  4C3J B;  4KKS A;  3F2B A;  4X64 L;  1IKL A;  4IFD I;  4DXG A;  1CKN B;  2HIV A;  5ELO A;  2BOS A;  1D5X C;  2NVT H;  2R93 H;  1QVF A;  5C4X G;  2B29 A;  3TME A;  2R7F A;  2HDM A;  2IX0 A;  2IW3 A;  4A3F H;  2E8G A;  4LUV A;  2A69 D;  3F2U A;  4LF8 L;  4XIG S;  2KUM A;  1B44 D;  1MGS A;  1VF5 C;  1S5F D;  1X9N A;  1XMQ L;  1BCP B;  4AYB B;  3A7A B;  4ZLT F;  1JJC B;  3U50 C;  2RCN A;  1SNO A;  3HOY H;  1TU2 B;  2ZXR A;  1BBW A;  3CCV A;  1SND A;  1UEB A;  4FF3 A;  1B50 A;  3LGJ A;  4EQN A;  1UEA B;  4XQQ A;  3FPU B;  3GP7 A;  1GD7 A;  5DM6 3;  1I6H B;  4OWW B;  5C4J B;  1VQE A;  1SE3 A;  3CCQ A;  1I5F A;  2TMP A;  2PQE A;  3GTP B;  1K73 C;  4OIJ A;  4FF2 A;  5CV8 A;  3J80 i;  1NSN S;  4XQN A;  1H9S A;  2OQ0 A;  3F8T A;  3OIQ A;  5M3M G;  3T1H L;  4ZUJ A;  2P5Z X;  1P16 A;  4LW1 A;  3S2D B;  1RTN A;  4IO9 A;  1A62 A;  2R92 G;  1LT4 D;  4DKA C;  3SR1 A;  3TZU A;  4CKE A;  3T1Y Q;  4AIM A;  4IPH A;  4AH6 A;  4DAY A;  5JVG 3;  1CSP A;  5EGT A;  3VR5 A;  1X56 A;  4YHH L;  3KF8 A;  4G7Z C;  3AMU A;  4NPS A;  1GUN A;  1A2U A;  4ZQ3 A;  1BCP C;  2EJF C;  3I4O A;  1I3Q H;  1W2B A;  1WTV A;  5I2X A;  5T1G A;  2EY2 A;  1BNZ A;  4OX9 L;  4EQO A;  1X3G A;  2XWJ B;  1TWG B;  2FHT A;  3H0G G;  3BS1 A;  4Z9C B;  3DEP A;  5F2D A;  1TQO A;  4L5S A;  1KAB A;  1RF2 D;  3STB C;  2XTI A;  5I4D A;  4BS9 A;  1DOM A;  1Q86 C;  3PO3 B;  2JA5 B;  5E7N A;  4IUN A;  3CQZ H;  5LMN W;  2F0U A;  2RDH A;  3OHX C;  3MXU A;  2I46 A;  2WKC A;  2E2J H;  1HZA A;  3I4M G;  3D3R A;  1CHP D;  4Q5V A;  4FF1 A;  5I9O A;  3GTG H;  3U9O A;  1JC7 A;  4MTN A;  1IBL Q;  2VQE L;  3AB9 A;  2PZU A;  5JEA G;  4JI4 L;  4ALP A;  3GTQ H;  3J80 L;  4A4I A;  2UUC Q;  3NBI A;  2XIW A;  5CV6 A;  4DV6 Q;  3M7N A;  3E6Z X;  4OWT B;  4A3E B;  4PZ7 A;  3TDQ A;  1D6E C;  1HNZ L;  1PMR A;  2B63 B;  1A2T A;  2VNU D;  2M2L A;  1XMO L;  1YIJ A;  1PTO H;  3I73 A;  4PMC A;  3OSO A;  2IHE A;  2VY3 A;  3A8K E;  1A0I A;  1N9W A;  1SYG A;  3ERQ A;  4L6T B;  4C2M H;  1IL8 A;  2A6H C;  1K83 B;  4RHR A;  3M4P A;  2OTL A;  2D9U A;  2VS1 A;  1STA A;  2ZTC A;  2NN6 I;  2ATW A;  4LWC A;  4JI0 Q;  2KEC A;  4MZ9 A;  2VB2 X;  2CQA A;  2GA4 B;  1PZI D;  3RZD H;  1BOS A;  1GHJ A;  2F0H A;  1MD2 D;  3G71 A;  2WB1 E;  3K5N A;  2ZM6 L;  2ICE C;  4NKL A;  3QIA A;  4C3I H;  5FLX E;  3CCU A;  1HZB A;  4UP8 A;  4K2L A;  1JCK B;  1F9P A;  5AJ3 Q;  1GUS A;  1JJ2 A;  2DJG C;  2EDG A;  3EBE A;  3KF6 B;  1IBM L;  1S5E D;  5C3E G;  3GTO B;  5C4X H;  2UUB L;  3HOU B;  4KN4 C;  1BBX C;  3FEW X;  4LFB L;  2WAQ E;  4FVM A;  3FHW A;  3NWT A;  2JJQ A;  5D3D A;  1MIU A;  5KYL A;  2JA7 B;  4IOA A;  5C3X A;  2BE5 D;  4IJL A;  3WDN A;  1L1O B;  2QGQ A;  4C1N K;  1HA6 A;  3J81 L;  1YVC A;  3EQL C;  3Q24 A;  3I55 A;  4PQX A;  1KTK A;  1SYB A;  3PIP 3;  1I4R A;  5IGG A;  4LF5 Q;  1CKO A;  2A69 C;  4A3J B;  2R7Z B;  1YJW A;  3KFU A;  2UXD L;  4R1J A;  4JV5 L;  4S3S A;  3G4S A;  3F1Z A;  1EY8 A;  1EIG A;  2VB3 X;  3DWA A;  3KF8 B;  1PH9 A;  2HHH Q;  3GV3 A;  4KN7 C;  3GTK H;  4DR5 Q;  1SNC A;  1IZ6 A;  5M3M H;  4YY3 Q;  1QVG A;  2EYO A;  2KEE A;  3OMG A;  5KNB A;  3ND8 A;  3S1R H;  2R92 H;  1H9R A;  1E7Z A;  1BUV T;  4NXM L;  4X3S A;  4P2C B;  3CC4 A;  4R4O A;  3L2P A;  3J81 j;  2KCC A;  3NBH B;  4X62 L;  2ZJR A;  1R4P B;  4F87 A;  1B3Q A;  1FGU A;  2RDG A;  1WTO A;  3J7Y W;  1AW7 A;  1EY5 A;  4DV2 Q;  1ICW A;  1WTX A;  4B3T Q;  4JI7 Q;  1XWE A;  2XN9 C;  1Z6H A;  1H9J A;  1L1O C;  4XYO A;  4DNT B;  1L0Y B;  1Q46 A;  2Z8L A;  2A68 D;  1D5M C;  2Q2H A;  2C5C A;  3JC6 6;  5ELN A;  2UXB Q;  4UP9 A;  2KQ3 A;  2SNM A;  2RHQ B;  1HNX L;  3H0G H;  3RD4 A;  3K7U C;  4LMQ D;  2QKI C;  4QL5 A;  3KLS X;  2CCZ A;  4QIW E;  2LXK A;  1EY6 A;  1PZK D;  1KDC A;  1PH1 A;  1B9M A;  2D62 A;  4CDD C;  5J39 A;  1IYJ B;  5C5L A;  5NUC A;  3I4M H;  3A0J A;  1KAA A;  2D0P A;  5JPN C;  4IUR A;  5IOC A;  3Q8D A;  4LF4 Q;  1FL0 A;  3F2C A;  2JEA I;  4ZRZ A;  1PFB A;  4RH6 A;  2EOT A;  3MEF A;  3M4O B;  2QIL A;  4DV4 Q;  5JEA H;  1V1P A;  2DJF C;  4WFN 3;  4C1N I;  5T1I A;  1DZ1 A;  3Q23 A;  5GAE C;  2CH4 W;  3UDF A;  4B9X A;  2J0T D;  3PCO B;  1IHZ A;  3KBG A;  1EZ6 A;  1Y8N B;  3CCR A;  2B2U A;  2VUM H;  2NB0 A;  4L5T A;  1XXG A;  1S5D D;  2NVX H;  1XPU A;  4KKT A;  2AUJ D;  3TN2 A;  1TWA B;  1CKM A;  4TRD A;  3HOX G;  3K57 A;  1WVL A;  5JJZ A;  4IN3 A;  1MSH A;  4DR1 L;  1ONL A;  4QMG A;  3RLN A;  1PLF A;  4A3K B;  2JA6 G;  3S2H H;  5JEA J;  5IY0 A;  5C44 G;  2RVL A;  4K6L A;  3CPF A;  3LWU A;  2JXM B;  4A3L G;  3J7A F;  3IRB A;  5IOD A;  1EFI D;  1LUZ A;  1GJX A;  2F0V A;  2PZT A;  4N8F A;  1E22 A;  1QG7 A;  2EYP A;  2MHV A;  4XTC S;  4A3D G;  4B3S L;  1SNP A;  2LMC B;  1TVX A;  4GZY C;  1LO5 D;  1VQ6 A;  3IFT A;  4RWS C;  4OHJ A;  4HJ9 A;  2LFN A;  1KD1 C;  3TZD A;  1K28 A;  3G6J B;  2LXJ A;  2Q8R E;  2GVA A;  2XRQ D;  4N9P A;  1HR0 W;  3UDX A;  4Y7N H;  1AH9 A;  5CV9 A;  3GTL H;  1VMP A;  1WJJ A;  4OO1 G;  1VMC A;  3X3N A;  4KV6 A;  5KNC A;  1EY0 A;  1L0X B;  1HJP A;  2A5H A;  2ZTE A;  5C5M A;  1MJE A;  1UE7 A;  5BR8 Q;  3I56 A;  2MP1 A;  5C3E H;  3M3Y H;  1TS4 A;  4NB3 A;  1XNR L;  4LF9 L;  1FGB D;  3RLF A;  2VQF L;  1EYA A;  5M5Y H;  4AYB G;  1Y1W B;  1RIP A;  1SYC A;  4IQZ A;  4C56 C;  4A3G B;  1O80 A;  1EQQ A;  3EIV A;  3HOV G;  2NBF A;  2E2I B;  1HTL D;  5C0X H;  2FMM A;  1LTA D;  1PZJ D;  2E76 C;  3MXG A;  3M9B A;  1VQL A;  2MJ8 A;  3QB3 A;  3RR5 A;  2N3S A;  5FLX c;  1PRT D;  4K5W A;  5C4H A;  3RZO H;  3A7L A;  2BE5 C;  2EYL A;  3DXJ C;  4X66 Q;  1M4V A;  3E5S A;  3DWP A;  3T16 A;  5J1Z A;  2MO1 A;  5IT9 E;  5DEH A;  2PW7 A;  5JPM C;  4DNI A;  4HMJ A;  1NCV A;  3NTK A;  2YU9 B;  1SRU A;  4DV1 L;  2E75 C;  5M3F B;  1PTO F;  2J4X A;  1Q1B A;  1U4L A;  5I6W A;  4LF6 L;  1H9M A;  1QWY A;  2R6G A;  2GVB A;  2BDO A;  1F2M A;  1FNU A;  2WKD A;  1D8L A;  5HGT A;  2N49 A;  1VQJ A;  3JAM i;  1HFG A;  3MXN A;  1WTQ A;  1Z7T A;  3S16 H;  2OCE A;  5E1F A;  2EY6 A;  1H9K A;  3C1E A;  1BKB A;  2EPB A;  3HS0 C;  3FDT A;  1EIH A;  3T4A C;  1SJH D;  1X54 A;  5M9O A;  2IHF A;  2DUD A;  4F8M A;  2IX3 A;  2OTJ A;  2E5L L;  2JA5 G;  1YNX A;  1HXY D;  1V1P B;  2OEO A;  5EKI A;  1TY0 A;  3OTO Q;  1I94 L;  4CHT B;  1AEX A;  3I4N B;  2Y0S B;  2E2D C;  2O5I C;  4R8I A;  3HKS A;  2R3Z A;  2HUG A;  2F0F A;  2K5N A;  2A68 C;  1R4Q B;  5A2Q E;  5C4Z A;  3N52 A;  3D4D A;  3U9S A;  5TSS A;  2IJ0 A;  4DR7 Q;  3D0F A;  3SGI A;  1K0S A;  3SEB A;  1YEZ A;  3K0X A;  3NWS A;  2QEX A;  1FYC A;  1IBL L;  2MO0 A;  4G7O C;  1EQV A;  3PUV A;  3S15 B;  2QA4 A;  4LUO A;  1NR4 A;  1Q1E A;  3MFY A;  2K6A A;  3I70 A;  1F77 A;  4CDE C;  4A93 H;  3TP8 A;  3HP3 A;  1ASY A;  1QOH A;  5ELE A;  4LFA L;  2NTS A;  3HRZ C;  1EQT A;  3T53 B;  4HTH A;  1SFO B;  1TWC H;  4ME5 A;  2F1M A;  3VR4 A;  1JMC A;  3JAM L;  3HOX H;  1EQR A;  4A3M B;  4IUU A;  4BA1 I;  2N55 A;  1Z47 A;  4YWM A;  2JA6 H;  1LTL A;  5C44 H;  2X6G A;  2C35 B;  1B70 B;  3DMU A;  4R9W A;  1EYD A;  4BY1 B;  2HCI A;  3OPO A;  2PZW A;  5COR A;  1EWH A;  3GTM H;  3KUP A;  4A3L H;  4BY7 B;  1CI3 M;  1EWI A;  5G3L F;  3FP9 A;  3I7F A;  3PGZ A;  5FKA C;  1AFP A;  4XT1 B;  1M1K C;  3NXW A;  4ME3 A;  1F2Z A;  2B2U C;  4A3D H;  1A3T A;  2A1A A;  1EZ8 A;  1C9O A;  1II3 A;  4FDB A;  1SMX A;  4GKK Q;  1O7Y A;  5E4W C;  3I90 A;  4DUZ Q;  4FP5 D;  2PI2 E;  2HIX A;  5CBE E;  2DY8 A;  2VW9 A;  1PRT B;  4IPD A;  4EVO A;  1OXX K;  2ID0 A;  1BR9 A;  3ICE A;  4U68 A;  4OO1 H;  1HNW Q;  3RLO A;  2NTT A;  3HOU G;  1JWU D;  2ALY B;  4ZYS A;  4J15 A;  1CT1 D;  2C9O A;  2MNA A;  4JI1 L;  3BDL A;  4O42 A;  2JA7 G;  3NP8 A;  4A3I G;  2EE1 A;  3LNN A;  3K5M A;  1NAP A;  2RQX A;  2LKV A;  4B3R L;  4WJ4 A;  2KJX A;  3HOV H;  5LL6 S;  3GTJ B;  1TS2 A;  1U4P A;  1JOK A;  4A3J G;  1Q81 C;  1SXT A;  4MIU A;  2K01 A;  1GUT A;  4DV3 Q;  3BG3 A;  4OXP A;  3IKJ A;  1GHK A;  1Q8K A;  2YYZ A;  3D4W A;  1VQO A;  5EBC A;  1CZW A;  4LF5 L;  1VF7 A;  4GKJ Q;  1I6H H;  1W3S A;  1STN A;  3KK7 A;  3GTP H;  2F4I A;  2D5D A;  3HKZ B;  1X55 A;  1VQN A;  2G9D A;  2K5Q A;  4KK7 A;  4QUC A;  2V4D A;  1D1I A;  5ELD A;  1KHI A;  2AUK A;  5IGD A;  3PO2 B;  1V43 A;  3SK8 A;  1AZQ A;  1PRT C;  1F2L A;  2F0P A;  2KED A;  1Y8P B;  1I50 B;  1E3P A;  1G2S A;  4CJ2 C;  4DR5 L;  1H95 A;  4X3T A;  2MPM A;  3L7Z C;  1ILQ A;  4GN4 B;  5GQO A;  5DNF A;  1GO3 E;  4F7X A;  2WFW A;  5KGU A;  1KAW A;  2JA9 A;  3W1B A;  1UE5 A;  2UXC L;  4K8J A;  1EY9 A;  1GKH A;  1SE8 A;  5M5W B;  4QUF A;  3MZ5 A;  1HZC A;  2F0D A;  1YHQ A;  4HID A;  1GXD C;  3CCE A;  2AHO B;  3KOJ A;  3K5L A;  1V1O A;  3NPP A;  1ML0 D;  3OW2 A;  4JBK A;  1UNS A;  2L5T A;  2NZ1 D;  2K5V A;  1B53 A;  1SNM A;  4KHZ A;  5CMD A;  4KHP L;  4TQU S;  5IT9 c;  2A73 B;  2O2L D;  3AU7 A;  1M8A A;  4C3H G;  2JA5 H;  5D3I B;  3QOL A;  2OXP A;  3A8I E;  1CK1 A;  3TP5 A;  3PIO A;  2MGS A;  2N78 A;  5EQ0 A;  3CKI B;  2JYO A;  2SNS A;  1HRJ A;  3KYH C;  3GDE A;  1ESR A;  5J22 A;  1LTG D;  3J80 E;  3TP6 A;  3RN2 A;  4O0A A;  1N36 L;  1CHQ D;  4CDC C;  4DK6 C;  5IGB A;  4ULL A;  2R93 B;  2NVT B;  1CSQ A;  1PXU A;  4JCV E;  4G57 A;  1VQK A;  4A3F B;  3P7J A;  4DV4 L;  2B2W A;  4GNX A;  4H44 C;  2OQK A;  1V8Q A;  1SE4 A;  3BYT B;  3G48 A;  5LMU Q;  2NVY B;  2UUA Q;  1SBB B;  1T5E A;  1DD2 A;  1TWH B;  1KDA A;  2A8V A;  4DAV A;  1ENA A;  4GOP B;  1IKM A;  4IPC A;  4JI2 Q;  3UE1 A;  2WAC A;  4JI6 Q;  2Z0S A;  3HOY B;  1N32 L;  1KXL A;  3K0Y A;  4KTA A;  4JBM A;  1IW7 D;  1SRO A;  1VQ8 A;  1ILP A;  4CJ1 B;  1K83 H;  5DM7 3;  5L37 A;  3NHH A;  4X65 Q;  1O7L A;  3P20 A;  3FMC A;  2MQH A;  2AWO A;  1X3Q A;  2F0O A;  2L55 A;  2Z6B A;  1PA6 A;  1X65 A;  3TBI B;  2L9H A;  1U4M A;  4ILW A;  4WOR A;  2PMZ E;  1PDQ A;  4DUY L;  4ODG A;  4M1U B;  1HH2 P;  1R9T B;  1DM0 B;  1OXT A;  2F3I A;  2K50 A;  4LFC L;  3D6C A;  3OW7 A;  1LTI D;  5CGK A;  2NVQ H;  1QJO A;  1N34 Q;  4PMW A;  2F0L A;  4NMZ A;  1G2T A;  3QG1 A;  1C4Q A;  2PO4 A;  3VYS A;  5KIX A;  3J81 i;  4L8J A;  1WOC A;  4PZ6 A;  1Y1V G;  1WCM H;  4QY7 A;  3BJU A;  2YTX A;  3GTO H;  1O7I A;  3S1N B;  3HOU H;  1I3Q B;  1HTP A;  1DYQ A;  1W6J A;  4GOP C;  1EWC A;  2IL8 A;  3CAM A;  4BBR B;  4R4T A;  1VQD A;  4HSP A;  3H3V H;  1VQP A;  3J81 E;  4XYQ A;  1PYB A;  1F9Q A;  2AQ3 B;  4A3G G;  4IJH A;  4A3I H;  1LV9 A;  2HDL A;  5C6A A;  2EYM A;  4HIO A;  1N33 Q;  1IYV A;  4BBS G;  1E24 A;  1X3P A;  1J5E Q;  2O4X A;  3K5O A;  3Q0A A;  1PH3 A;  1B3A A;  5G3L D;  2TSS A;  4DR4 L;  4B3M L;  1STG A;  1UE1 A;  2VZA A;  4A3J H;  3GTG B;  5FLM G;  3DM1 A;  4JYA Q;  1I4X A;  4A3C G;  3H09 A;  4XT3 B;  3A8J E;  4AQY Q;  4LNQ A;  5IYC G;  5FJ8 G;  3GTQ B;  1NR2 A;  4FYD A;  3EJI A;  1D7Q A;  3N6R A;  1LT6 D;  2NN6 G;  1LT5 D;  4HN7 A;  2FIN B;  4RMF A;  5M3F G;  2F0E A;  1PH4 A;  5IIF A;  5KND A;  5C0X I;  3KLS A;  1QZH A;  1WTW A;  2A6E D;  2BCO A;  3U58 A;  3RN5 A;  4V0B A;  4OEL B;  1K8A C;  1QCB D;  4DV0 Q;  1HR0 L;  3OYY A;  4P73 A;  5ISR A;  1QUQ A;  2QDL A;  2QF7 A;  3NE5 B;  4RG1 A;  1LLR D;  1H9S B;  1QE6 A;  4H13 C;  3CRK C;  3K81 C;  5CBA E;  2WAQ B;  1K8O A;  4HR7 B;  5EJW A;  4DAM A;  3H15 A;  1Q12 A;  3PUZ A;  3F2D A;  1TWF B;  1NUC A;  1JB7 A;  4DAY B;  4ZUI A;  3QR8 A;  4HMI A;  3CME A;  5IE8 A;  2ASB A;  5CYU A;  5A35 A;  2IWH A;  2KCN A;  3S1M H;  2KHS A;  2B2T A;  3S17 H;  4YWK A;  1VQG A;  1YIT A;  4YCW A;  2X69 A;  1B7Y B;  4C3H H;  1IBK L;  2PQA A;  3ERS X;  4C3I B;  4GNX B;  3OTO L;  1IYU A;  1XNQ L;  4KD3 A;  3QO2 A;  3MEH A;  3BU2 A;  4IFD J;  1PH7 A;  4K8I A;  4RCO A;  5IWA L;  3DUZ A;  3M4O H;  1GM5 A;  1MSG A;  4LF8 Q;  3TRZ A;  3E0J A;  4HAE A;  1BCP F;  2M00 A;  1B4O A;  5IGC A;  4MHE A;  2JA8 G;  1OXU A;  1X3F A;  1XPO A;  2Q2T A;  1E2W A;  4MN3 A;  5M5X B;  4K0K Q;  3NEN A;  1XX8 A;  1TT2 A;  2KEN A;  1U9R A;  4IUP A;  3CCM A;  1GVP A;  1TWA H;  4DV5 Q;  4A3M G;  5IYB G;  3W2D A;  2CWA A;  1PFS A;  2LY7 A;  3MTS A;  1M90 C;  2Q8I B;  2BH8 A;  2VXW A;  3C1F A;  3BYY B;  3AFP A;  3KLW A;  3PUW A;  5DAU A;  4X3K A;  3CHB D;  3P75 A;  1FJG L;  1S3O A;  2JP1 A;  1BDO A;  1EYG A;  3E3X A;  3J80 c;  2B8F A;  4A3B B;  1SAP A;  1RD9 D;  1KNE A;  2R7D A;  4GLA C;  2B2W C;  3EFX D;  4GNX C;  1IW7 C;  3DHQ A;  1OTC A;  1DOK A;  3GTK B;  2AWN A;  5M3M B;  3TS0 A;  1RDP D;  1E0B A;  4LJZ C;  3NEM A;  2L12 A;  3S1R B;  2R92 B;  1HFN A;  4K5V A;  5IP7 G;  4YHH Q;  1FR3 A;  3LWE A;  4JI3 L;  1HZ9 A;  3MFG A;  2LS0 1;  4JC0 A;  1NE3 A;  4L5R C;  3J7A 5;  4KY6 A;  2A19 A;  1YJN A;  3SE0 A;  3HOZ B;  3PQI A;  1Y1V H;  1O78 A;  2RHS B;  4OX9 Q;  1HNW L;  1XTD A;  3OMC A;  4QF4 A;  3T51 B;  4IZ8 A;  3HOW G;  1OXV A;  4RKB A;  3HFZ B;  4DV7 L;  2F4V L;  1CM9 A;  2JEB I;  3S9W A;  3ND9 A;  2YTV A;  3V2T A;  2WV6 D;  4RHS A;  3VYT A;  4X6A H;  1I4Q A;  1S5B D;  2I0Q A;  4MTK A;  5EAY A;  5FO8 B;  2ENB A;  2E2I H;  4DR2 Q;  4G4K A;  1E1O A;  2X6L A;  5EPK A;  5LHY 1;  3BZC A;  4BBS H;  4OO1 I;  4WJ3 M;  2NZH A;  2VQE Q;  4DN4 M;  3K59 A;  2EQS A;  4C3J G;  4QGU A;  3I4M B;  1CQV A;  4JI4 Q;  1P8L A;  1VQ9 A;  4DPG A;  5FLM H;  1VQB A;  3U4V A;  2RF4 A;  5I9P A;  4A3C H;  4N8X 1;  4NXN Q;  3HKZ G; 
#chains in the Genus database with same CATH homology
 2XNA C;  1TR5 A;  2NN6 H;  4M8A A;  1HHV A;  1KDB A;  2EJM A;  2VUM B;  1E2Z A;  2M9V A;  2DN8 A;  2QEJ C;  4XQJ A;  1Q8I A;  3RMH A;  3W3A A;  4JK1 C;  5KRU A;  1T5X D;  3NSW A;  3K58 A;  3S2H B;  3T56 B;  3H94 A;  2A6E C;  4H7B A;  4UDU C;  1LTT D;  1BF4 A;  1HUN A;  1JWM D;  2A74 C;  3A56 A;  3WOE A;  5BN5 A;  4G7H C;  1KLU D;  1CZG A;  4RCN A;  1CTM A;  4DK1 A;  3LX0 A;  2H1E A;  4ZK9 B;  2J7Z A;  3M7G A;  5C3E B;  3M3Y B;  1WTR A;  1JWS D;  2SOB A;  1S4Z A;  5M5Y B;  2B2T C;  2F0I A;  2RA4 A;  3JAM E;  5AFW A;  4NDX A;  1QNK A;  3FKI B;  4RGN A;  4Q0F A;  5C3W A;  1JOR A;  3ONA B;  2PNR C;  5HUR A;  2G9H D;  1S5C D;  2K04 A;  1TS5 A;  1A6X A;  5EKL A;  3RZO B;  1J8I A;  4CJ0 B;  2OT2 A;  5EPJ A;  1SMY D;  3P1H A;  3OWE B;  3MA2 B;  5IT9 L;  3I3C A;  3BDO A;  5FK9 C;  4E6I A;  2CW0 D;  2EY5 A;  5I6Y A;  2FJ2 A;  3HEJ A;  3NUC A;  5CV4 A;  3SXH A;  3S16 B;  3SVM A;  5KYI A;  3K7A B;  3M85 A;  4L63 B;  4B08 A;  3Q22 A;  4XXE A;  1ZKO A;  4KD4 A;  1AN8 A;  1SJE D;  1LAB A;  1MI2 A;  2RBM A;  3IL8 A;  1A3V A;  1PFN A;  5KEE A;  1E2V A;  1JOO A;  1FD7 D;  3R3O A;  1BO0 A;  4A93 B;  2AQ1 B;  1FNV A;  4KY7 A;  5IGF A;  2ICI A;  3VA5 A;  4EQP A;  4ZKC B;  2L11 A;  1FNW A;  3PV0 A;  2NWG A;  1U4R A;  5JAV A;  2Q8T A;  2XSC A;  1EEF D;  2RSN A;  3PUY A;  2JA6 B;  4DU9 A;  5C44 B;  1ZEQ X;  3BVM A;  2DY7 A;  4F88 A;  4J1M A;  3C3L A;  2BA1 A;  3L3O C;  1ENF A;  4FXG C;  2PYK A;  2ZT9 C;  3I4L A;  3H91 A;  4RGM A;  5E4X A;  3OWF A;  5CV7 A;  2NUC A;  4RA8 A;  1G91 A;  1WD0 A;  1VCI A;  1UAP A;  3VR3 A;  4IFD G;  4R8N A;  1B2T A;  4ABN A;  1PFM A;  2CVR A;  3MHB A;  1HQR D;  4XDX A;  4TKO B;  4RKL A;  2PCF B;  3HOV B;  4CKC A;  1RKN A;  3HGB A;  4DNR B;  1TY2 A;  3NQT A;  1PTO D;  4PV1 C;  2D2C C;  1HPC A;  3NTI A;  1SNQ A;  2B2Y A;  5D65 A;  3GQB A;  4U67 3;  3GV6 A;  3ZYY X;  1AZP A;  4J6H A;  1VDZ A;  4B9W A;  2K32 A;  1YNN D;  3NK9 A;  4OL7 A;  3BZD B;  3ITP A;  1ESF A;  1SMY C;  5JVH 3;  2BA0 A;  4KI0 A;  2L4N A;  1LAC A;  2WIN B;  3QOJ A;  1ZYR D;  1QB5 D;  4IAL A;  4LK1 C;  5ELC A;  5CC4 A;  1UUP A;  2CW0 C;  1Q3L A;  3SK6 A;  4I65 A;  5LL6 X;  4V19 0;  3NBH A;  1GUG A;  3SHL A;  2Z4H A;  3C46 A;  2XRS D;  3IFD A;  2B39 A;  1Q90 A;  4RAU C;  1J9O A;  4CKB A;  5IGE A;  1D2B A;  4HSV A;  4BA2 I;  3R93 A;  2PMZ B;  1OO9 B;  2HQE A;  3ERO A;  3BDC A;  4H0L C;  4N9T A;  1A3U A;  1JOQ A;  4OGQ C;  1MBY A;  5BN3 A;  2IT1 A;  3SK4 A;  1EOT A;  3GD7 A;  3D31 A;  5FOB B;  1SYE A;  3CQZ B;  2EY1 A;  1I4P A;  4HCS A;  2E2J B;  1I4H A;  3FVQ A;  1RTO A;  4ZKB B;  2B2V A;  3KLR A;  2XVS A;  2K28 A;  2EZV A;  3FRP B;  1EU3 A;  3R8B A;  5K36 G;  2WB1 B;  1JE4 A;  1PRT F;  2KOL A;  2PW5 A;  2NVQ B;  2NYZ D;  1I6V C;  3Q6S A;  3R2I A;  2F0K A;  1SYD A;  1PTO B;  1DCZ A;  1O7Z A;  1WCM B;  2F03 A;  2XWB B;  3H6M A;  4C2M B;  1W6K A;  3BVZ A;  1G8Z D;  3A54 A;  2QCP X;  1HQM C;  3I91 A;  4IFD H;  3PMF A;  3VR6 A;  4A3I B;  2EVB A;  5C0X G;  1BQQ T;  3RZD B;  2EXZ A;  3URY A;  3D6W A;  1XTC D;  4DGZ A;  2L0C A;  1DJR D;  1F9R A;  1KNA A;  1STH A;  5FLX L;  1HA5 A;  5CR3 A;  4NW2 A;  1B9N A;  2K03 A;  2IPK D;  5EPL A;  1GUW A;  5C4X B;  4BWG B;  3WOF A;  1C8C A;  2B8G A;  5COY A;  1PTO C;  2Z4I A;  2BDN A;  3PUX A;  2F0M A;  4KJO A;  2F0N A;  1TII D;  4ID6 A;  4JBW A;  2HCC A;  4DFA A;  1YNJ D;  3H3V C;  2L1B A;  2H4O A;  1YNN C;  4IUT A;  5BN4 A;  2B2Y C;  4J8Q A;  3T13 A;  1TKW B;  4X3U A;  4FNF A;  4K14 A;  3S1M B;  4QIW B;  3S17 B;  1LT3 D;  2F0Q A;  2I07 B;  1Y69 U;  1ZYR C;  4C3H B;  4UAI A;  1K8M A;  2DNE A;  2ZXO A;  1LTS D;  1JIC A;  5EBD A;  2WII B;  3MXP A;  1ZXT A;  2PPB C;  2OF1 A;  1CA5 A;  1C48 A;  2RDF A;  4O1N A;  3MWY W;  4EGV A;  4KJN A;  3V96 A;  2SDF A;  1X32 A;  1EY7 A;  1CA6 A;  4NP5 A;  2IX1 A;  4WJW A;  2SEB D;  3H0G B;  5K5P A;  1WTP A;  1QIL A;  2F0T A;  4PNY A;  2FFK B;  1I4G A;  2F0S A;  4CBV A;  5CV5 A;  4FO2 A;  2K5D A;  2ZXP A;  1G6Z A;  3J7A V;  4IUV A;  1XYI A;  2K33 A;  5EKK A;  5K36 H;  4OIK A;  1EYC A;  2R61 A;  1G29 1;  1D1K A;  3SDZ A;  2N88 A;  2NVX B;  2JE6 I;  4RFB A;  1DON A;  3SK5 A;  5I2Y A;  1RJT A;  2F3W A;  1ET6 A;  1SYF A;  3TP7 A;  1LTR D;  5ELF A;  1Y1V B;  1ROD A;  4KMU C;  2B2V C;  1B1Z A;  2KVM A;  2F3V A;  5JOB A;  1TS3 A;  1SSO A;  4QCL A;  1EY4 A;  1SEB D;  5E3F A;  4K6D A;  2F0G A;  2WP8 J;  4BBS B;  4LAA A;  2F0W A;  1EEI D;  4DK0 A;  3QJY A;  1RCV D;  3VYR A;  3QWN A;  4Y7N B;  3GTL B;  1GUO A;  4DXF A;  1DOL A;  2K7V A;  4FXK C;  3S14 B;  1RHP A;  3KBX A;  3G7L A;  3TSS A;  5FO9 B;  2K05 A;  1ET9 A;  5C0X J;  5ELB A;  2EYH A;  4HCE A;  4DAP A;  2QDB A;  1PYW D;  4YIJ A;  3DWQ A;  1JR0 D;  3A55 A;  1JQY D;  2AQ2 B;  2CHB D;  2EYJ A;  1QNU A;  3MVV A;  3PIO 3;  2FMC A;  1AP0 A;  3C2P A;  3VA7 A;  4DA2 A;  3CU7 A;  1YNJ C;  1Y8O B;  4WRD A;  2Z1C A;  4KKU A;  1BCP D;  3HG9 A;  2O5J C;  4I7Z C;  1KLG D;  2K1B A;  3DEO A;  3UI2 A;  1LTB D;  2RSO A;  1JB3 A;  1D5Z C;  2K5W A;  3MAQ A;  1BXT A;  2JA8 B;  1DXM A;  2MUY A;  3FPP A;  4ZAI A;  3VR2 A;  3CRL C;  2DNC A;  5D14 A;  3OIP A;  2E74 C;  1STY A;  4PMB A;  2RKS A;  2JSO A;  3NTH A;  3RUZ A;  3EVQ A;  3X3M A;  4RGT A;  1CFM A;  2KA7 A;  1STB A;  4DF7 A;  5A2Q L;  2EJG C;  1EL0 A;  4K5X A;  1WD1 A;  4K2K A;  1SDF A;  3VYU A;  1SE2 A;  1STE A;  2E2H B;  1F9S A;  2A6H D;  4QB4 A;  1CQF A;  3R2T A;  1TWC B;  4KY5 A;  3V05 A;  4IUQ A;  1HCZ A;  4TSS A;  3L9A X;  3HOX B;  1F2Y A;  1OXS C;  1GOZ A;  3IAY A;  3I8Z A;  3O13 A;  3I72 A;  4FXD A;  4FF4 A;  1A15 A;  3NQI A;  3GTM B;  3HOW B;  1EU4 A;  3K6O A;  3GO5 A;  5FO7 B;  2EYF A;  3S1Q B;  3OOC A;  2F0J A;  3D4R A;  3MC0 B;  4KHV A;  4CGY B;  4A3D B;  3EA6 A;  3HZX A;  4HED A;  4C3I G;  3M4Y A;  4RGO S;  1ENC A;  1HUM A;  3BVG A;  3D8G A;  4C3J B;  4KKS A;  1IKL A;  4IFD I;  4DXG A;  2BOS A;  1D5X C;  3TME A;  2HDM A;  2IX0 A;  2IW3 A;  2A69 D;  3F2U A;  4XIG S;  2KUM A;  1B44 D;  1MGS A;  1VF5 C;  1S5F D;  1BCP B;  4AYB B;  3A7A B;  4ZLT F;  1SNO A;  1TU2 B;  2ZXR A;  1SND A;  4FF3 A;  1B50 A;  4EQN A;  1UEA B;  4XQQ A;  3FPU B;  3GP7 A;  5DM6 3;  1I6H B;  5C4J B;  1SE3 A;  2TMP A;  2PQE A;  3GTP B;  4OIJ A;  4FF2 A;  5CV8 A;  4XQN A;  1NSN S;  1H9S A;  3OIQ A;  4ZUJ A;  3S2D B;  1RTN A;  1LT4 D;  3SR1 A;  3TZU A;  4CKE A;  4DAY A;  5JVG 3;  5EGT A;  3VR5 A;  3KF8 A;  4G7Z C;  3AMU A;  1GUN A;  1A2U A;  4ZQ3 A;  1BCP C;  2EJF C;  1WTV A;  5I2X A;  5T1G A;  2EY2 A;  1BNZ A;  4EQO A;  2XWJ B;  1TWG B;  2FHT A;  3BS1 A;  4Z9C B;  3DEP A;  5F2D A;  1TQO A;  1KAB A;  1RF2 D;  5I4D A;  4BS9 A;  1DOM A;  3PO3 B;  2JA5 B;  4IUN A;  2F0U A;  2RDH A;  3OHX C;  3MXU A;  2I46 A;  2WKC A;  3D3R A;  1CHP D;  4Q5V A;  4FF1 A;  5I9O A;  3U9O A;  1JC7 A;  3AB9 A;  2PZU A;  5JEA G;  3J80 L;  3NBI A;  2XIW A;  5CV6 A;  3M7N A;  3E6Z X;  4A3E B;  3TDQ A;  1D6E C;  1PMR A;  2B63 B;  1A2T A;  2VNU D;  2M2L A;  1PTO H;  3I73 A;  4PMC A;  3OSO A;  3A8K E;  1SYG A;  3ERQ A;  4L6T B;  1IL8 A;  2A6H C;  1K83 B;  4RHR A;  2D9U A;  1STA A;  2NN6 I;  2KEC A;  2VB2 X;  2CQA A;  2GA4 B;  1PZI D;  1BOS A;  1GHJ A;  2F0H A;  1MD2 D;  3K5N A;  2ICE C;  4NKL A;  3QIA A;  5FLX E;  4K2L A;  1JCK B;  1F9P A;  1GUS A;  2EDG A;  1S5E D;  3GTO B;  3HOU B;  4KN4 C;  1BBX C;  3FEW X;  4FVM A;  3NWT A;  5D3D A;  5KYL A;  2JA7 B;  5C3X A;  2BE5 D;  3WDN A;  4C1N K;  1HA6 A;  3J81 L;  3Q24 A;  3EQL C;  4PQX A;  1KTK A;  1SYB A;  3PIP 3;  1I4R A;  5IGG A;  2R7Z B;  4A3J B;  2A69 C;  4S3S A;  1EY8 A;  1EIG A;  2VB3 X;  3DWA A;  3GV3 A;  4KN7 C;  1SNC A;  2EYO A;  2KEE A;  3OMG A;  5KNB A;  3ND8 A;  1H9R A;  1BUV T;  4X3S A;  4P2C B;  2KCC A;  1R4P B;  4F87 A;  2RDG A;  1WTO A;  3J7Y W;  1AW7 A;  1EY5 A;  1ICW A;  1WTX A;  1XWE A;  2XN9 C;  1Z6H A;  1H9J A;  4XYO A;  4DNT B;  1L0Y B;  2Z8L A;  2A68 D;  1D5M C;  2C5C A;  2KQ3 A;  2SNM A;  3RD4 A;  4LMQ D;  2QKI C;  3KLS X;  1EY6 A;  1PZK D;  1KDC A;  1B9M A;  2D62 A;  5J39 A;  5C5L A;  5NUC A;  1KAA A;  5JPN C;  4IUR A;  5IOC A;  2JEA I;  4ZRZ A;  1PFB A;  4RH6 A;  2EOT A;  3M4O B;  2QIL A;  5JEA H;  1V1P A;  4WFN 3;  4C1N I;  5T1I A;  1DZ1 A;  3Q23 A;  4B9X A;  2J0T D;  1IHZ A;  3KBG A;  1EZ6 A;  1Y8N B;  2B2U A;  2NB0 A;  1XXG A;  1S5D D;  4KKT A;  2AUJ D;  3TN2 A;  1TWA B;  4TRD A;  3K57 A;  1WVL A;  5JJZ A;  4IN3 A;  1MSH A;  1ONL A;  4QMG A;  1PLF A;  4A3K B;  5JEA J;  2RVL A;  4K6L A;  3LWU A;  2JXM B;  3J7A F;  5IOD A;  1EFI D;  1GJX A;  2F0V A;  2PZT A;  1QG7 A;  2EYP A;  2MHV A;  4XTC S;  1SNP A;  2LMC B;  1TVX A;  4GZY C;  1LO5 D;  3IFT A;  4RWS C;  4OHJ A;  2LFN A;  3TZD A;  3G6J B;  2Q8R E;  2XRQ D;  4N9P A;  5CV9 A;  1VMP A;  4OO1 G;  1VMC A;  3X3N A;  4KV6 A;  5KNC A;  1EY0 A;  1L0X B;  2A5H A;  5C5M A;  2MP1 A;  1TS4 A;  1FGB D;  3RLF A;  1EYA A;  1Y1W B;  1SYC A;  4IQZ A;  4C56 C;  4A3G B;  1O80 A;  2NBF A;  2E2I B;  1HTL D;  5C0X H;  2FMM A;  1LTA D;  1PZJ D;  2E76 C;  3MXG A;  2MJ8 A;  3QB3 A;  1PRT D;  4K5W A;  5C4H A;  3A7L A;  2BE5 C;  2EYL A;  3DXJ C;  1M4V A;  3E5S A;  3DWP A;  3T16 A;  5J1Z A;  5IT9 E;  5DEH A;  2PW7 A;  5JPM C;  4HMJ A;  1NCV A;  3NTK A;  2YU9 B;  2E75 C;  5M3F B;  1PTO F;  2J4X A;  1Q1B A;  1U4L A;  5I6W A;  1H9M A;  1QWY A;  2R6G A;  2BDO A;  1F2M A;  1FNU A;  2WKD A;  5HGT A;  1HFG A;  3MXN A;  1WTQ A;  1Z7T A;  5E1F A;  2EY6 A;  1H9K A;  3C1E A;  2EPB A;  3HS0 C;  3FDT A;  1EIH A;  3T4A C;  1SJH D;  5M9O A;  4F8M A;  2IX3 A;  1HXY D;  1V1P B;  2OEO A;  5EKI A;  1TY0 A;  4CHT B;  1AEX A;  3I4N B;  2Y0S B;  2E2D C;  2O5I C;  4R8I A;  2R3Z A;  2HUG A;  2F0F A;  2A68 C;  1R4Q B;  5A2Q E;  5C4Z A;  3N52 A;  3D4D A;  3U9S A;  5TSS A;  2IJ0 A;  3SEB A;  3NWS A;  1FYC A;  4G7O C;  1EQV A;  3PUV A;  3S15 B;  1NR4 A;  1Q1E A;  3MFY A;  2K6A A;  3I70 A;  1F77 A;  3TP8 A;  3HP3 A;  1QOH A;  5ELE A;  2NTS A;  3HRZ C;  1EQT A;  3T53 B;  4HTH A;  1SFO B;  4ME5 A;  2F1M A;  3VR4 A;  3JAM L;  4A3M B;  4IUU A;  4BA1 I;  2N55 A;  1Z47 A;  2X6G A;  3DMU A;  4R9W A;  4BY1 B;  1EYD A;  2HCI A;  3OPO A;  2PZW A;  5COR A;  1EWH A;  3KUP A;  4BY7 B;  1CI3 M;  5G3L F;  5FKA C;  1AFP A;  4XT1 B;  3NXW A;  1F2Z A;  2B2U C;  1A3T A;  1EZ8 A;  1II3 A;  1O7Y A;  5E4W C;  3I90 A;  4FP5 D;  5CBE E;  2DY8 A;  1PRT B;  4EVO A;  1OXX K;  2ID0 A;  1BR9 A;  4U68 A;  4OO1 H;  2NTT A;  1JWU D;  4ZYS A;  1CT1 D;  2C9O A;  3BDL A;  4O42 A;  3NP8 A;  2EE1 A;  3LNN A;  3K5M A;  1NAP A;  2RQX A;  2LKV A;  2KJX A;  5LL6 S;  3GTJ B;  1TS2 A;  1U4P A;  1JOK A;  1SXT A;  4MIU A;  2K01 A;  1GUT A;  3BG3 A;  3IKJ A;  1GHK A;  2YYZ A;  3D4W A;  5EBC A;  1CZW A;  1VF7 A;  1STN A;  3KK7 A;  2F4I A;  2D5D A;  3HKZ B;  2G9D A;  2K5Q A;  4KK7 A;  4QUC A;  2V4D A;  1D1I A;  5ELD A;  2AUK A;  5IGD A;  3PO2 B;  1V43 A;  3SK8 A;  1AZQ A;  1PRT C;  1F2L A;  2F0P A;  2KED A;  1Y8P B;  1I50 B;  1G2S A;  4CJ2 C;  4X3T A;  2MPM A;  3L7Z C;  1ILQ A;  5DNF A;  4F7X A;  5KGU A;  4K8J A;  1EY9 A;  5M5W B;  4QUF A;  3MZ5 A;  2F0D A;  1GXD C;  3K5L A;  1V1O A;  3NPP A;  1ML0 D;  1UNS A;  2L5T A;  2NZ1 D;  1B53 A;  1SNM A;  4KHZ A;  5CMD A;  4TQU S;  2A73 B;  2O2L D;  3AU7 A;  1M8A A;  4C3H G;  5D3I B;  3QOL A;  2OXP A;  3A8I E;  1CK1 A;  3TP5 A;  2MGS A;  5EQ0 A;  3CKI B;  2JYO A;  2SNS A;  1HRJ A;  5J22 A;  1ESR A;  1LTG D;  3J80 E;  3TP6 A;  1CHQ D;  5IGB A;  4ULL A;  2R93 B;  2NVT B;  1PXU A;  4G57 A;  4A3F B;  3P7J A;  2B2W A;  4H44 C;  1V8Q A;  1SE4 A;  3BYT B;  2NVY B;  1SBB B;  1T5E A;  1DD2 A;  1TWH B;  1KDA A;  4DAV A;  1ENA A;  1IKM A;  2WAC A;  3HOY B;  3K0Y A;  4KTA A;  1IW7 D;  1ILP A;  4CJ1 B;  5DM7 3;  3NHH A;  1O7L A;  3FMC A;  3P20 A;  2AWO A;  1X3Q A;  2F0O A;  2L55 A;  3TBI B;  2L9H A;  1U4M A;  4ILW A;  4WOR A;  1PDQ A;  4ODG A;  4M1U B;  1R9T B;  1DM0 B;  1OXT A;  3D6C A;  3OW7 A;  1LTI D;  5CGK A;  1QJO A;  4PMW A;  2F0L A;  4NMZ A;  1G2T A;  5KIX A;  1C4Q A;  2PO4 A;  3QG1 A;  3VYS A;  4L8J A;  3S1N B;  1I3Q B;  1HTP A;  1DYQ A;  1W6J A;  1EWC A;  2IL8 A;  4BBR B;  4HSP A;  3J81 E;  4XYQ A;  2AQ3 B;  1F9Q A;  1LV9 A;  2HDL A;  5C6A A;  2EYM A;  1IYV A;  1X3P A;  2O4X A;  3K5O A;  3Q0A A;  1B3A A;  5G3L D;  2TSS A;  1STG A;  3GTG B;  3DM1 A;  1I4X A;  3H09 A;  4XT3 B;  3A8J E;  3GTQ B;  1NR2 A;  4FYD A;  3EJI A;  3N6R A;  1LT6 D;  2NN6 G;  1LT5 D;  4HN7 A;  2FIN B;  2F0E A;  5IIF A;  5KND A;  5C0X I;  3KLS A;  1WTW A;  2A6E D;  2BCO A;  4V0B A;  1QCB D;  5ISR A;  2QF7 A;  3NE5 B;  1LLR D;  1H9S B;  1QE6 A;  4H13 C;  3CRK C;  5CBA E;  2WAQ B;  1K8O A;  4HR7 B;  5EJW A;  1Q12 A;  3PUZ A;  1TWF B;  1NUC A;  4ZUI A;  4HMI A;  5CYU A;  5A35 A;  2IWH A;  2KCN A;  2KHS A;  2B2T A;  2X69 A;  4C3I B;  1IYU A;  4KD3 A;  3QO2 A;  3MEH A;  4IFD J;  4K8I A;  4RCO A;  3DUZ A;  1MSG A;  3E0J A;  4HAE A;  1BCP F;  2M00 A;  1B4O A;  5IGC A;  4MHE A;  1OXU A;  1E2W A;  4MN3 A;  5M5X B;  1XX8 A;  1TT2 A;  1U9R A;  4IUP A;  3W2D A;  3MTS A;  2LY7 A;  2Q8I B;  2VXW A;  3C1F A;  3BYY B;  3PUW A;  5DAU A;  4X3K A;  3CHB D;  3P75 A;  2JP1 A;  1BDO A;  2B8F A;  4A3B B;  1SAP A;  1RD9 D;  1KNE A;  2B2W C;  3EFX D;  1IW7 C;  3DHQ A;  1DOK A;  3GTK B;  2AWN A;  5M3M B;  1RDP D;  1E0B A;  4LJZ C;  2L12 A;  3S1R B;  2R92 B;  1HFN A;  4K5V A;  1FR3 A;  3LWE A;  3MFG A;  2LS0 1;  4KY6 A;  3SE0 A;  3HOZ B;  1O78 A;  3OMC A;  4QF4 A;  3T51 B;  4IZ8 A;  1OXV A;  4RKB A;  1CM9 A;  2JEB I;  3S9W A;  3ND9 A;  3VYT A;  4RHS A;  3V2T A;  2WV6 D;  1I4Q A;  1S5B D;  5FO8 B;  2ENB A;  4G4K A;  2X6L A;  5EPK A;  5LHY 1;  4OO1 I;  4DN4 M;  3K59 A;  4C3J G;  3I4M B;  1CQV A;  5I9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...