4HSVA

Crystal structure of cxcl4l1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet factor 4 variant
publication title Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hsvA00
1DOKA 1X3PA 4CJ2C 2K1BA 1QG7A 1QE6A 1JE4A 1NR4A 2Q8TA 1ILPA 1O80A 3FDTA 4NW2A 1WTPA 2HUGA 1MI2A 2RSNA 1ML0D 3I3CA 2J7ZA 5T1GA 3KBXA 1AZPA 1E0BA 1F9QA 1U4PA 2EOTA 1EOTA 2KEDA 4ZKCB 1O7ZA 1HFNA 3FPUB 1JICA 2Q8RE 4ZLTF 1G6ZA 4O42A 2JYOA 1Q3LA 3DEOA 2DY7A 2HDMA 5CORA 5E4XA 5EKIA 3UI2A 4ZKBB 1IKMA 5EJWA 2D9UA 3ONAB 4HEDA 2FHTA 1TVXA 1WTRA 1S4ZA 1F9PA 4IUTA 5D14A 1HHVA 4HAEA 1WTWA 1B3AA 1HFGA 1U4MA 4R9WA 1X3QA 1CA5A 1BO0A 1RODA 3MWYW 1IKLA 1PDQA 1RHPA 5EPLA 2K28A 1EQTA 2DY8A 1F9SA 2RVLA 4IUQA 3GV6A 2FMMA 2K04A 1MSHA 1SAPA 1MGSA 1SDFA 4RA8A 1DONA 2MJ8A 1WTQA 2HCIA 1F2LA 1SSOA 2VXWA 1B2TA 1GUWA 2B2UA 1U4RA 2B2UC 1B50A 1KNAA 4ZAIA 1WD0A 5CBAE 1RTOA 4RAUC 1XX8A 2KEEA 5EPKA 1EL0A 1VMCA 4IUPA 1J9OA 1M8AA 2NYZD 2R3ZA 3DEPA 4QUFA 1WTVA 2HCCA 2X69A 4X3UA 1WD1A 2FINB 3P7JA 1G2SA 1PFNA 2HDLA 1NR2A 4OIJA 4XT1B 5T1IA 1LV9A 2X6GA 1DZ1A 2N88A 4X3SA 2RSOA 3G7LA 1EIGA 4XT3B 4UAIA 2B2YA 4XDXA 2SDFA 1X32A 1ESRA 2B2YC 5COYA 2L12A 4RWSC 1WVLA 2L9HA 1BF4A 2MGSA 1MSGA 3I91A 1NAPA 2MPMA 4MN3A 1PFBA 2L11A 4QUCA 1O7YA 4HCSA 2EE1A 2FJ2A 1DOLA 2X6LA 2L4NA 3IL8A 5EPJA 4R8IA 1XYIA 1CA6A 1HUMA 2BDNA 2XIWA 3D6WA 1ILQA 3IFDA 4OIKA 5D65A 1G91A 2KECA 1WTXA 2K05A 2JP1A 5CBEE 2KVMA 3LWEA 5JJZA 3GV3A 1NCVA 2KOLA 5E4WC 1VMPA 2B2TA 4ZK9B 2EPBA 1BNZA 1AP0A 2B2TC 4CJ0B 1CM9A 2CVRA 2N55A 1HRJA 1PLFA 1B53A 3R93A 1C8CA 4IUVA 3I8ZA 1F9RA 3TZDA 4IURA 1RTNA 1U4LA 1QNKA 2FFKB 3H91A 5DNFA 3KUPA 3F2UA 2L1BA 1J8IA 2M2LA 1EIHA 1HUNA 4DN4M 2NZ1D 3TN2A 4X3KA 4U68A 3DM1A 3N52A 2IL8A 2RA4A 2NWGA 3MTSA 2KUMA 4LMQD 2H1EA 5AFWA 3QO2A 1BBXC 4X3TA 2K01A 1G2TA 1KNEA 5CMDA 1ZXTA 1HA6A 1AZQA 4HSVA 1RJTA 1DOMA 2B2WA 4IUUA 2B2WC 4CJ1B 3Q6SA 3SVMA 1B4OA 1ICWA 1PFMA 1WTOA 2MP1A 3HP3A 2B2VA 1IL8A 3I90A 1A15A 2B2VC 5EQ0A 2K03A 4MHEA
chains in the Genus database with same CATH superfamily
3J80E 5C4JB 2K1BA 2K32A 1LT5D 5CV4A 2B8GA 1BUVT 1MI2A 2HUGA 3I3CA 3OSOA 3KLSX 1EIYB 1U4PA 2K50A 4B3RQ 3H94A 2Q8RE 4O42A 2D5DA 5LMNL 1I6HH 5C0XH 3NQIA 3L0OA 3PIOA 2C9OA 4P74A 5IP7H 2E75C 1EOVA 1HA5A 4K8IA 4EGVA 4JPBW 1TWCB 1JWUD 4QMGA 4YWMA 1XXGA 4HN7A 1QVFA 4UY8C 2CQOA 5I2YA 1XMOQ 5E3FA 1PVOA 4DV1Q 1SDFA 2K7VA 4G7OC 2F0IA 1M4VA 2EJGC 2NTSA 1ENCA 1OTCA 3ND8A 5M5YH 1TKWB 1O7IA 5CBAE 2AHOB 3SEBA 3DEPA 1AH9A 2Y0SE 4XIGS 2NVTH 2CH4A 4DUYQ 2F0MA 1CKNB 1TS4A 4KD4A 4DV3Q 1CQVA 4B3RL 2E2DC 1NUCA 3B6YA 1LTAD 4HSPA 4UP9A 1SMXA 2DGYA 2XGTA 5COYA 3EBEA 5M3MH 1NAPA 4JI5L 2LKVA 1I6HB 1J5EL 2V1CC 2XVSA 2DUDA 2BDNA 4KHVA 3S9WA 3I4OA 3Q24A 5CV5A 3UDFA 2KVMA 3AEVA 1XMOL 1I50H 1PTOF 4JI6Q 1FR3A 2EPBA 1YJ9A 2F4VQ 5IYDH 1VQIA 2CVRA 2N55A 3E9HA 3BJUA 2Q2UA 1EYDA 1EIHA 1YZ6A 3PUYA 1D6EC 1GXDC 1N34L 4V190 1DCZA 5C4ZA 1YIJA 1G291 1W2BA 5M5YB 1T5EA 2LMCB 4DV3L 2ICIA 2Z0SA 3NENA 3SE0A 2J0TD 2NVTB 1AZQA 5DM63 1SE4A 2L55A 3PO3H 2D2CC 4IFDH 2B2VA 4OO1G 3Q6SA 2F3WA 3I72A 4KKTA 4XTCS 3KK7A 3PO2G 1GUTA 5IP9G 2GVAA 3PF5A 3C46A 3HOZG 5M3MB 2PQAB 1VQOA 3BDLA 3MEFA 2B63G 4JI6L 1TR5A 2IT1A 2MO0A 2F4VL 2Z6KC 4DAYB 1VQ7A 3GQBA 4UP7A 3NELA 1HFNA 1CKNA 1G6ZA 3GDEA 2XTIA 5GQOA 1VS0A 4ZKBB 5LL6X 1I50B 1VQ5A 2VL6A 3KF6B 5DAUA 1BBWA 3AB9A 2ZM6Q 1FJGQ 4DNTB 1F9PA 1MJCA 3OYYA 4BY7H 1CI3M 1WCMG 3MFGA 1CHQD 4A3KH 1IKLA 3OWFA 1Z7TA 1YBYA 3MVVA 4DU9A 2JA6G 1D2BA 1F2LA 1TT2A 4DR7Q 1AW7A 1SNQA 1KNAA 1EQRA 5CV6A 4JI3Q 5DLQE 4RGNA 3K58A 3PO3B 4LFAQ 1UEAB 2Z8LA 4A3LH 4NPSA 1Q1EA 1R4PB 1GUSA 2C5CA 1N32L 1EY0A 1G8ZD 1EIGA 4A3BG 1FJGL 2CWAA 5C5MA 3TDQA 4BBRG 3CC2A 2EDGA 3J7A5 1W6KA 1L0XB 2RCNA 2K05A 1UNSA 2KOLA 1FNWA 3OHXC 4BY7B 2PQAA 2OWOA 3K7UC 4CJ0B 4DR7L 2FMCA 1CUKA 1C8CA 2A1AA 4IURA 2I5LX 4DAYA 1XPOA 4DV0Q 5LMUQ 3AU7A 4JI3L 1EWCA 5CGKA 4LFAL 5GAHC 2NBFA 1OXSC 1SYEA 2BDOA 2XN9C 5M3FG 2R92H 5LHY1 2AQ3B 1IYUA 1BDOA 1YVCA 4LF7L 1HA6A 2PW5A 1JJGA 4X62L 3K7AH 2IX1A 1B4OA 1I5FA 4K14A 4HJAA 1S5CD 1YHQA 1DOKA 4PZ6A 5M5WH 3J7YW 1HJPA 1QG7A 4N8FA 5C44H 1HR0W 4BBSH 4OO1I 4PMWA 4RG1A 2Q2TA 1L0YB 1F2MA 3T4AC 2Z6KA 3CCVA 1Q3LA 2SOBA 1V9PA 5EKIA 4DV0L 2ZJRA 2CFMA 1X9NA 5K5PA 1TY0A 1JOQA 1TIID 1U4MA 1Y1VG 1X3QA 4B08A 4HR7B 1BO0A 2ENBA 3IFTA 4LF5Q 4JI1Q 3KBGA 2JXMB 1WOCA 3CC7A 2O4XA 1GUGA 3HKZB 3A8IE 4ILWA 2R92B 1U4RA 1UE6A 2PZUA 1R9TH 4IUPA 3K7AB 4QF4A 3P20A 5JEAJ 2KCCA 5M5WB 1CKMA 5C44B 1K28A 4BBSB 4M8AA 2RSOA 2NN6H 2A5HA 3W2DA 1SNDA 4C3IG 1ET9A 4BS9A 3CCJA 1X32A 2EY1A 4JI2Q 1JC7A 1E2VA 2MPMA 2B8FA 4UPAA 4OX9Q 3FMCA 2IPKD 1PH1A 1MIUA 3IL8A 4GKKQ 2F3IA 4LF5L 1ILQA 4JI1L 4P73A 4IPGA 3LWEA 1IBKQ 3PIPA 1HH2P 1SYDA 4TKOB 4CDFC 1BNZA 2K75A 1HR0Q 3GTOH 1D8LA 1PLFA 3L9AX 2DNCA 4A3MH 3D4RA 2FFKB 3KUPA 3F2UA 2BE5C 4DK3C 1P8LA 4A3FG 2R7DA 1TQOA 4WJWA 1Z47A 3PMFA 4DGZA 1TWGH 3K0YA 2BE5D 3K6OA 5FJ8G 1R9TB 3LX0A 5ELFA 2QW7A 1V1QA 1HTLD 1RJTA 3A7LA 4DR6Q 2B2WC 3VR3A 2ZTCA 1Q90A 3IKJA 1LTID 3I90A 5JOBA 1A6XA 1Z9FA 4OX9L 4ME3A 1F77A 5IT9c 3BZCA 3D8GA 2CQAA 1HXYD 1YNXA 4EQNA 3K81C 4LW1A 4DAVA 2J7ZA 5T1GA 1XNQQ 3L3OC 2UUBQ 4DR5Q 1EOTA 1KLGD 3C2PA 4F7XA 4NB3A 2JYOA 2Y0SG 3UI2A 1PH3A 3RR5A 2F03A 2ALYB 1Q86C 3GTOB 1Q8IA 3GTLH 4A3MB 2JN4A 4RMFA 4A3GH 4IUQA 1JR0D 4JI4Q 1GHJA 5K36G 2JSOA 3VR2A 1MGSA 1TWGB 3BS1A 4KKSA 2OTLA 1LT4D 1B2TA 1DONA 1SSOA 1VQAA 2R7ZG 4FF2A 1B9MA 1B50A 2TMPA 3SR1A 1YHBA 3ULJA 3I4NG 5IE8A 2CWPA 3X3MA 2X69A 3Q22A 4DR2L 3S1MH 1KXLA 1G2SA 1XNQL 2QDBA 1I4HA 4H02A 1IBLQ 1DZ1A 4GN3B 1U0LA 1PZKD 2YU9H 4IQZA 4RCOA 1LT6D 1GD7A 4A3CG 1QB5D 2BA0A 1BF4A 4MN3A 5D3IB 3HOWG 1YNJC 4C56C 4C3JH 2PPBC 1GOZA 3CW2C 2EXDA 1YNJD 1Y8PB 4JI4L 1RKNA 4U673 4QL5A 4ZK9B 3U9OA 2V4DA 3M9BA 4A3GB 4KMUC 4PZ8A 4JVZA 3R93A 3R8BA 1SEBD 2JA5B 3U4VA 1XNRQ 4M1UB 1SNOA 4F88A 4E6IA 4FF3A 1KRSA 2OTJA 4CDEC 4ID6A 2L0CA 2LFNA 4HTHA 1IBLL 1BBXC 1D7QA 2SNSA 5EBCA 2VQEQ 4LF6Q 1SJED 4AYBB 3AMUA 3S1MB 1EIFA 2ZJQA 1DOMA 2B2WA 1PFMA 1UE5A 1IL8A 1ET6A 3S1NH 5EQ0A 3FPPA 2YU9B 2HQEA 1KQSA 4BY1H 3EA6A 1EWIA 3O13A 5C4XH 1H9JA 4C3JB 2FXQA 1VDZA 3FPUB 3CCUA 3STBD 2JK8A 2HDMA 2KQ3A 2QDLA 3KF8B 2UXBQ 5FKAC 2D9UA 5I9OA 2XSCA 4HIKA 3P75A 1STGA 1HQMC 1EYAA 5IT9E 4CBVA 1LTLA 3MWYW 2F0OA 2F0LA 3I2ZA 5M5XH 3HOXH 1PTOH 5JEAG 1OXXK 3RD4A 2VQEL 1I4XA 4A3EH 1E2WA 3GV6A 1JJ2A 2JA7H 5LMNW 3MXUA 4HCEA 4NDXA 3J81c 2WV6D 1PTOC 3E3XA 3KLRA 4RAUC 1X65A 2EYOA 4UP8A 4LF9Q 1ZKOA 4ZYSA 3GO5A 4KK7A 3S1NB 4JYAQ 1PTOD 4KHPQ 1KLUD 2MFIA 4OWXB 4YY3Q 3QB3A 1FNUA 4RHRA 3H15A 1Y8NB 3G7LA 2ES2A 2EYJA 3H0GH 5LL6S 2HQLA 1NSNS 5FLXc 4LFBQ 2UXBL 4YIJA 3A5UA 3S16H 1HZBA 2WAQE 3CRKC 4OL7A 3I55A 2YYZA 3I73A 4HCSA 2EE1A 4JBWA 1PHJA 4B3TL 3ITPA 4CKEA 3NEMA 2JP1A 4KHZA 2HIXA 4C2MH 3KLWA 2ZXRA 1ONLA 2BH8A 1VQ9A 5M5XB 3HOXB 1PTOB 2VUMG 3S15H 1B53A 1DD2A 1BKBA 1XPUA 1MHWC 2CW0D 1KL9A 4A3EB 2WINB 3ZJYC 3NBHB 2PNHA 4LF9L 4QJFA 3KF8A 2OEOA 2K5VA 1IHZA 4JCVE 2MHVA 1EY9A 4KHPL 4YY3L 1VF5C 4XQJA 1V43A 4K0KQ 3K8AA 3ER0A 4OWWB 2Z1CA 5D3DA 4KY5A 4LFBL 3EN2A 1FVIA 3G6JB 3HP3A 2F0JA 3MXPA 2G9HD 3RN2A 5IGFA 1LABA 1QE6A 1SJHD 2ZJPA 5ISRA 4DAMA 1SYFA 2BCOA 2XWJB 3PUXA 5FK9C 2Q2IA 3J7AF 1LTTD 3TQYA 2MO1A 2CH4W 1JICA 1LM0A 4NXNQ 1VQBA 1IBMQ 4C2MB 5JJLA 3M4YA 2F0SA 1S4ZA 3S15B 1GUNA 1G51A 1M90C 2F0DA 1C7YA 4X6AH 4K0KL 1XTCD 3W1BA 3S14H 4FO2A 3LGJA 1BQQT 5IP9H 5FO7B 5KNDA 1C0AA 3DWPA 2VXWA 2K4KA 4YWLA 1Q8KA 1CK1A 5L37A 3R2TA 3HFZB 2HD3A 1RCVD 4ZAIA 1VQ8A 4AQYL 2H5XA 3CKIB 3BU2A 3NBHA 2OCEA 5JVH3 5KNBA 3HOYH 3CCRA 1X54A 4JI5Q 4JK1C 1J5EQ 5HY6A 2N88A 4NXNL 3T1HL 5ELNA 4XQNA 1IBML 2XNAC 4JBMA 5NUCA 3J81E 2MGSA 4ULLA 1MSGA 3D3RA 1KIXA 1CA6A 1LTGD 1XJVA 2EYHA 1MBYA 3Q0AA 1NBWA 3K59A 1STHA 5J1ZA 5CBEE 1N34Q 4KTAA 3AFQA 1AP0A 1UUPA 3S14B 1G91A 1O78A 1F9RA 4EQ5A 4FF4A 1L2FA 1QCBD 5FLXE 5DNFA 1BVSA 4JI0Q 3C1FA 4N9PA 2NZ1D 2R61A 3OIPA 4EQOA 2NVQH 4APVA 5FLMG 4A3BH 2DN8A 2KUMA 1CT1D 1XPRA 3AFPA 1VQ4A 4YHHL 4DR4Q 4OONA 3L2PA 3HOYB 4N9TA 1CKOA 1YNNC 3OMGA 4MTKA 1HNWL 1YNND 1A8VA 2ZT9C 5ELDA 2WKDA 2JA6B 1PH8A 2MQHA 1SYBA 3GTKH 1TWHH 3NP8A 1OXVA 3RNUA 5AJ3L 4JI0L 2CHBD 3ONAB 1N36L 2EXZA 4L8JA 1YJNA 1UE1A 3HG9A 4OXPA 4KI0A 2I5HA 1CA5A 4GKJQ 5EPLA 3VR4A 4DR3Q 4KV6A 5IYCH 3T13A 3OTOQ 4DR4L 2NVQB 4UHVA 4A3BB 2FMMA 4MNOA 2JA8H 2MJ8A 2F0QA 1J6QA 1PZID 2B3GA 3JAMi 1N32Q 3NWSA 1ENAA 4EX5A 1TWAH 1Q46A 1QUQB 3H6MA 4FF1A 1WD1A 1TS3A 1JB7A 2SEBD 4JV5Q 1EZ8A 1XMQQ 1SMYC 4B3MQ 1PV4A 1L0WA 4IJLA 1SE3A 3WDNA 3MHBA 1SMYD 1LACA 3DWQA 3S24A 2WIIB 2RBMA 4L6TB 3V05A 5A2QE 1O7LA 1K8GA 3HOUG 3I56A 1F2YA 1SYCA 3D4WA 1TWHB 3GTKB 2ZTDA 1AN8A 1PXUA 4WRDA 2A68C 4KN4C 3GTQH 3PV0A 2F0EA 2BA1A 1PRTB 2RDGA 4GKJL 5IP7G 1UEBA 5D65A 4DR3L 1STEA 5JJZA 3OTOL 4FXKC 5JJKA 2JJQA 3SK6A 3U4ZA 1I4GA 1W3SA 2EVBA 1STBA 1QNKA 4LF7Q 2D62A 1VQFA 2JA8B 4IPDA 2K5DA 1GJXA 4X62Q 4C3IH 1SN8A 2N3SA 3F2CA 3N52A 4L5SA 4JV5L 4RH6A 1XMQL 4LMQD 4B3ML 1KDBA 1TWAB 2H1EA 5AFWA 2E2JH 3EIVA 4OWTB 1G2TA 1PMRA 4X64L 3FKIG 2RHQB 2RHSB 3NXWA 3DLLA 1FGUA 4F87A 3QJYA 3CXCA 4QIWB 5CORA 1Y1VB 3AYHB 4MIUA 4K6DA 3CMAA 3NWTA 1A0IA 5CC4A 2Q8TA 5I6YA 5ELOA 1Y14B 5J22A 1QUQA 2CKZB 2WP8J 3KBXA 3QOLA 3GTQB 3KF6A 4L5QA 1I3QH 3J80i 3M4OB 4IPCA 1A63A 1JE5A 5I4DA 4AYBE 5FJ8H 5EJWA 3M3YH 3RUZA 1Q81C 4J1MA 1EQVA 1R4QB 1RODA 2R93G 4C3HH 3H3VI 2IX3A 1D1KA 2JA9A 4C3IB 1DXMA 1KTKA 2WAQG 1DYQA 1MSHA 3FVQA 1GUWA 2A74C 2E2JB 2G5DA 1B70B 2B2UC 3Q8DA 3F2BA 4NKLA 1SNCA 4JW0A 3MA2B 4OHJA 3A55A 2FINB 5T1IA 1EY4A 2C35B 4RHSA 1STNA 2NTTA 3NUCA 5CV8A 3VYSA 3SHLA 2F0VA 3P1HA 3HOVG 1KHIA 3U9SA 1ESRA 1I3QB 3AQQA 1C4QA 3GP7A 3A0JA 5I6WA 2LXKA 1BCPB 3S1RH 1EQQA 1SE2A 3M3YB 3L7ZC 5C0XI 1Q7YC 1NCVA 4JC0A 3M85A 2WFWA 4DV2L 4A3KG 1JCKB 4C3HB 2Q8IB 1JB3A 3U58A 1K83B 1RL2A 4JI8L 3GTPH 4G7ZC 2D0PA 4BA1I 3CD6A 4GZYC 5ELEA 5KIXA 4DUZQ 1GM5A 4J8QA 4FVMA 4A3CH 1PRTF 3JAML 3FHWA 4DV5L 4X3TA 2EYPA 2Y0SB 4CKBA 2KCMA 4GN4B 5C3EG 2A73B 4GLVB 4IZ8A 1U9RA 4QCLA 1Y1WG 1WTOA 5E1FA 5IYBH 1VF7A 4HMIA 4P2CB 4OEMB 5EBDA 3SDZA 1GO3E 3S1RB 2R7ZB 4X66Q 4KY6A 1A62A 2DY7A 4IN3A 4A3IH 5I2XA 1QWYA 2KBNA 2YTVA 1N8RC 4IJHA 4ALPA 3BYYB 3CPWA 5DEHA 5CV9A 4DUZL 3TEHB 3GTPB 3JC66 1PDQA 3C1EA 4ODGA 4Q5VA 1BOSA 3CU7A 4DR2Q 1VQMA 5BN3A 1P16A 2B2UA 2KA7A 4LUVA 3EQLC 4HIDA 2CCZA 2UUAQ 1WD0A 4DV7Q 5FO9B 2JE6I 5KGUA 4DR1Q 5DM73 1H9KA 5C44G 3DHQA 3ICEA 4IFDI 1L1OB 4X66L 2HHHQ 4IOAA 2O5JC 3DMUA 3DWAA 5KEEA 4MTNA 2B2YC 5JEAH 2JA5H 3K80C 2L9HA 3I91A 2L11A 4K8JA 3TSSA 4A3IB 3MEHA 3I70A 1DJRD 3D6WA 1S5FD 3G6EA 2IHFA 4DKAC 1A2TA 1A3TA 1X56A 1OXTA 4DNIA 1VQCA 3VR5A 1CTMA 1VQKA 3DUZA 4JBKA 4A4IA 3I8ZA 2QCPX 2UUAL 3TMEA 2F0WA 4DV7L 1G6PA 2LY7A 2I46A 4DR1L 2IL8A 2F4IA 4DXFA 1SBBB 2E74C 1BCPF 2HHHL 3IAYA 5IGCA 1FNVA 3M7NA 5GAGC 2BH2A 3TP7A 2NN6G 5EGTA 1KABA 2UXDQ 2OF1A 4LAAA 2VUMH 1ILPA 2AWNA 3MXGA 1H9RA 1QNUA 4RFBA 5KNCA 2RF4A 1SFOH 4A3JG 3PQIA 1L1OA 1X6OA 3RLOA 2VW9A 3RZDH 2AMCB 5F2DA 4K6LA 4KN7C 4DAPA 5JPNC 4A3DH 2F0PA 5GROA 1TS5A 2ZXPA 4H13C 4RGTA 2NVXH 1RHPA 1NJIC 3BVMA 2MNAA 2RVLA 1HNZL 5CR3A 1B3QA 4LNQA 2K04A 3HEJA 3LNNA 1CHPD 2H4OA 1B9NA 1PYBA 3N6RA 2UXDL 2R6GA 1OO9B 1E22A 2B39A 3K5LA 4BXXG 3RLNA 3I7FA 1CSPA 1EL0A 4G4KA 1WTVA 1M8AA 2NYZD 4G57A 1HTPA 3ERQA 3MZ5A 3V96A 1DGSA 3KFUA 3BVZA 2VUMB 4B3TQ 2G9DA 1HZ9A 2B2YA 2I5MX 1LO5D 3TP8A 4CGYB 1I4QA 4CKCA 1SFOB 4GS3A 1WVLA 2QGQA 1YITA 1EUJA 1S5BD 5JPMC 2XRSD 1YI2A 5IODA 1QZGA 4LJZC 5BN5A 3BZDB 2F52A 5EPJA 3RZDB 2NUCA 1D1IA 4A3DB 3U50C 3I4MG 3BZKA 4KJOA 2F0NA 1VMPA 3OPOA 2B2TC 2NVXB 2WB1B 2JEBI 4TSSA 1VQJA 2EIFA 3UE0A 3J7AV 3QG1A 2I0QA 1WFQA 1IXRA 3KJOA 2AQ2B 3MTSA 2EQSA 4DPGA 4AYBG 1AEXA 2OQKA 3H09A 2PYKA 3SVMA 2N78A 2A6EC 1X3EA 3Q23A 1K3BC 1VCIA 2B29A 4R4OA 2A6ED 3M4QA 3TBIB 1O80A 2NN6I 3VA5A 2P5ZX 2VZAA 5C0XJ 3A74A 4FYDA 4R8NA 4O2DA 2PQEA 5FLMH 5IOCA 4R4CA 1K0RA 5IGEA 4BA2I 1CZWA 1Z6HA 3GTJB 2KHJA 4HEDA 2ATWA 4I7ZC 3DXJC 4L63B 4HAEA 1WTWA 1EY8A 4DV4L 4XXEA 4QIWE 4XYOA 1AFPA 4AQYQ 3OWEB 4JOIC 4BWGB 5ELBA 4ZCKA 2LSSA 3KJPA 3EFXD 2E2IH 1A3UA 4DFAA 4RA8A 4KJNA 3CRLC 1FD7D 4PMCA 3NE5B 3SK4A 1JMCA 2O2LD 1RTOA 4QB4A 2EYMA 3T1HQ 4NXML 4Z9CB 3PF4A 4A93G 5EKLA 3W1GA 1EWHA 2YV5A 3K5NA 1EY7A 1VQLA 2K5NA 4TQUS 4BY1G 2OXPA 4POGA 1M1KC 1SE8A 2N49A 3CP0A 4B3SL 4OO1H 5C4XG 4WJ3M 4Q0FA 3VA7A 3PO2H 1HZCA 1Y8OB 2XWBB 4R1JA 3HOZH 1JORA 4PG3A 4A76A 1NY4A 1DOLA 1E7ZA 3PUWA 2B63H 1AE3A 1VQDA 2XIWA 3IFDA 1V1PB 1KDAA 2Q2HA 4DXGA 4WJ4A 2B2TA 3HOXG 2F0FA 1GVPA 4DK6C 2N8NA 4AH6A 2EY2A 4A3EG 2E5LQ 4HIOA 5HGTA 3UDXA 4YHHQ 1LTBD 1XTDA 2JA7G 3H91A 1QJOA 2E2IB 1WCMH 2L1BA 2MUYA 1HUNA 2KJXA 3OW7A 1EFWA 1SLJA 4U68A 1S5DD 3HKZE 1S72A 4IFDJ 3HOUH 1HNWQ 2JA6H 3MFYA 1V1OA 2K01A 1K8OA 1KNEA 3K57A 5H1SE 4YWKA 4QY7A 2PZWA 2K52A 1IW7C 1ICWA 2MP1A 4DK1A 5G3LF 1I6VC 3H0GG 3J7ZC 2RDFA 1EU4A 3S2HH 2RDHA 3CAMA 4ZQ3A 1IW7D 1ZEQX 2PW7A 2L5TA 3FEWX 3FRPB 5I9PA 5AJ3Q 3PO2B 4PMBA 5BR8Q 2VB3X 1N36Q 3HOZB 2Z4IA 2B63B 1E0BA 4PZ7A 4BBRH 4JI7Q 2E5LL 4Y52H 1A2UA 1ZYRC 3DEOA 2PCFB 5E4XA 1IKMA 4LK1C 1N9WA 3BYTB 3EROA 2K5HA 1TVXA 4L5TA 1WTRA 4IUTA 3FKIH 1ZYRD 1HFGA 4FNFA 5FO8B 1K8MA 2DJGC 3HKSA 1WCMB 1K8AC 4JOIA 3GTGH 1EU3A 1B8AA 1V1PA 3OMCA 4S3SA 2J4XA 3HOUB 5IWAQ 4YCVA 1UE7A 3G71A 4QGUA 1Y69U 2Z4HA 1XX8A 1RF2D 5IY0A 3UE1A 1I4RA 2HCCA 4X3UA 5BR8L 5M3FH 1D5MC 4I7AA 4DV1L 3S2HB 1QZHA 1LV9A 2X6GA 2D0OA 2K33A 4ZRZA 4JI7L 1JQYD 4POFA 2IY5B 1II3A 1JWMD 2R93H 1PRTC 2AWOA 2L12A 3WOEA 4HIMA 4DUYL 4BBRB 2DJFC 2PMZB 3NTIA 5C4HA 1PRTD 2X6LA 4ABNA 2L4NA 1XYIA 2O5IC 2K5WA 2AUJD 4GLAC 3V2TA 2KECA 3FKIB 3QIAA 5E4WC 3EVQA 5IWAL 1QVGA 3M7GA 3GTGB 4N8X1 4B9XA 5A35A 4XYQA 2RQXA 3PSIA 4X64Q 1Y1VH 5KRUA 1TXYA 3HOVH 4NP5A 2M9VA 1EZ6A 3CHBD 3D6CA 2PNRC 3T16A 5C0XG 2EJFC 2E2HH 3G4SA 3G48A 5M3FB 1H9SB 3M4OH 3HOYG 4JG2A 4HSVA 3D0FA 2A68D 4R4IA 3CF5A 4IUUA 3PCOB 3NK9A 3E0EA 3BVGA 1A15A 4DN4M 4PV1C 4MHEA 1ESFA 1TS2A 4GNXC 1NMFA 2R93B 2K6AA 1JE4A 1V8QA 4RKBA 4MZ9A 1X3GA 1JT8A 1E24A 1JWSD 4CDCC 2WAQB 1YJWA 2BOSA 1ICFB 1IZ6A 4DK0A 4ZKCB 3GTMH 3IRBA 3SK8A 3ZYYX 2ASBA 3NTHA 1SNMA 1PA6A 1E1OA 4ZUJA 1S5ED 5D14A 3S1QH 2XRQD 1B3AA 5C3EH 3TRZA 2WKCA 1GHKA 1D5ZC 2PI2A 1Y1WH 4JBJA 1Q1BA 4YCUA 2NZHA 1BR9A 3HOVB 5M3MG 2ZM6L 1HQRD 3X3NA 1PH5A 2ID0A 2HCIA 4GNXB 4OGQC 1FYCA 2E2HB 5KYLA 4K2KA 1H95A 2EJMA 4A3FH 1K0SA 2EY6A 2K5QA 2KEEA 2KCTA 1VMCA 3VDYA 5EKKA 5IYDG 4X65Q 4XQQA 1B7YB 4J15A 4WORA 3P7JA 2HDLA 4A3KB 3T53B 1PH2A 3BG3A 3OIQA 1N33Q 1PH7A 3BDOA 4FDBA 1MD2D 4IO9A 1LTSD 1WTHA 1H9SA 1BCPC 1EY6A 1OXUA 5CV7A 1K83H 4DV2Q 4RKLA 4V0BA 4H44C 5IGDA 3GTMB 4UDUC 1TWFH 3S17H 1BCPD 4R4TA 5TSSA 4LF8Q 3A56A 4JI8Q 1HUMA 3RMHA 3S1QB 2A19A 2LS01 1TY2A 3PO3G 4IFDG 3J81i 3GV3A 5C3EB 4IALA 3PIO3 1Y1WB 4HJ8A 5IYCG 1NNXA 4CDDC 4NMZA 5EAYA 4DV5Q 2K14A 2JA8G 1U5KA 1E3PA 1PH4A 4X65L 4R4QA 1ENFA 1EYGA 5IT9L 4A3FB 3PUVA 1STAA 3T1YQ 5K36H 1F2ZA 1N33L 3KLSA 3NTKA 3BDCA 5LMUL 4IOCA 2R7ZH 4G7HC 4HJ9A 3SGIA 4BY7G 3VYUA 4CJ1B 3ULLA 4LFCQ 3I4NH 3HS0C 2M00A 4GNXA 2WB1E 2K03A 4CJ2C 1SYGA 3CCQA 1NE3A 4LF8L 3FDTA 3CCMA 3EJIA 4O1NA 1XWEA 2YTYA 2RSNA 3TREA 1ML0D 3NPPA 1ASZA 1TWFB 3UDGA 3S17B 4K5XA 3CQZH 1NMGA 5BN4A 1T5XD 1O7ZA 4GLXA 4A3LG 1UWVA 2UU9Q 3HOWH 3PUZA 2EY5A 1GUOA 4O0AA 4RGMA 2IJ0A 4R9WA 5CYUA 4PQXA 3T1YL 2OQ0A 4GOPC 1WJJA 5IIFA 2K28A 1EQTA 4P71A 3ERSX 1BXTA 4H7BA 4KKUA 3NBIA 1JOOA 1LT3D 1WI5A 4LFCL 4HJ5A 1UAPA 1FGBD 4A3JH 3KDFB 1L1OC 3TS2A 1VQGA 1J9OA 4QUFA 2R3ZA 3I4NB 3HZXA 3K5OA 3QOJA 3QWNA 1S40A 1C48A 2VNUD 2VB2X 2AKWB 2EYLA 4KLKA 2QF7A 4XT3B 1HPCA 5C3XA 4XDXA 5ELCA 2VS1A 2UU9L 3HKZG 3F8TA 3CQZB 1KD1C 2R92G 4GOPB 4H0LC 3VYTA 1PFBA 4QUCA 4R8IA 2WACA 4DV6Q 4TRDA 3HOWB 2F0GA 3E6ZX 1WTXA 4BXXH 2IX0A 2ZXOA 4JI2L 4C3HG 3K5MA 4RCNA 4BBSG 4IUVA 3TZDA 4GKKL 3RZOH 2I07B 3R3OA 1J8IA 4IPHA 3TP6A 1IBKL 1VQ6A 1YHAA 3KYHC 2RA4A 1HR0L 1VQPA 1AE2A 4A3JB 3KOJA 4LWCA 3J80L 1D5XC 3S2DH 2QEJC 5CMDA 1HZAA 1K3RA 3E5SA 5C3WA 3E9IA 3I4MH 1KAWA 2KHIA 5JAVA 3MXNB 1X3PA 1Q82C 3CMEA 1PH9A 1S3OA 1SNPA 4P72A 4DV6L 1CZGA 1EY5A 4NW2A 3JAMc 3K0XA 3KDFA 2NVYH 3SK5A 4DR6L 3M4PA 2EYFA 3NHHA 4L5RC 4TVAB 2EOTA 4DA2A 5JVG3 2KEDA 1LUZA 3E0JA 3CCSA 2UXCQ 1HNZQ 1IYJB 5HURA 2A8VA 3J81L 2FHTA 4QQBX 2SNMA 2F1MA 2VY3A 3GD7A 2LXJA 4KY7A 3SXHA 2UUBL 3CCLA 4DR5L 3R2IA 3HGBA 3RZOB 4GOPA 3CC4A 4OELB 2DY8A 4FXGC 2QKIC 3PGZA 1B44D 2UUCQ 3CCEA 1SAPA 4AIMA 2IW3A 1WTQA 3W3AA 2IHEA 5J39A 3W5OA 3S2DB 2L15A 3A8KE 1SXTA 1HNXQ 5FLXL 1IYVA 1BBUA 5EPKA 3I4MB 3GTLB 2A6HC 1PZJD 5IYBG 1PFNA 2DNEA 1NR2A 2E76C 4OIJA 3DM3A 4A3MG 2A6HD 1NTGA 4HMJA 1PH6A 4X3SA 4YCWA 2HT1A 3J81j 2NVYB 5GAEC 1MJEA 2UXCL 2F0HA 3RN5A 4HJ7A 2QILA 1KAAA 1ASYA 4A3IG 4LUOA 1O7YA 3MXNA 3HRZC 1HCZA 5C6AA 3MAQA 4OIKA 4DF7A 1LTRD 4Y7NH 1EEFD 1QOHA 4J6HA 2UUCL 1VQNA 4F8MA 1PFSA 4A93H 5G3LD 1CM9A 1HHVA 1RTNA 4K2LA 4FXDA 4I65A 1HNXL 2ICEC 1PYSB 2AUKA 3J80c 1RIPA 1X3FA 1RD9D 2M2LA 2NZOA 4KD3A 3TN2A 1VQHA 3STBC 4X3KA 1X55A 4EQPA 3DM1A 2NWGA 1PYWD 4RGOS 2PI2E 3ND9A 2KHSA 2PMZE 4C1NI 3QO2A 3RLFA 1XNRL 1QVCA 2F0TA 2Z6BA 3TS0A 1WYDA 4ME5A 1EFID 1E1TA 2EZVA 5IGGA 3GTJH 3CPFA 4EVOA 5JJIA 1A3VA 1T9HA 4A3GG 3OW2A 4PNYA 3A7AB 4B9WA 1LYLA 3C3LA 2JA5G 1NR4A 3T56B 3VYRA 1MKHA 4LF6L 1WTPA 3D4DA 2KCNA 4CHTB 3WOFA 1DM0B 1K9MC 5FOBB 4DV4Q 1AZPA 1F9QA 4ZLTF 5J3BA 4Y7NB 2OT2A 2R7FA 2AQ1B 5A2QL 4A93B 3ULPA 4C1NK 3D31A 1W6JA 3PIP3 3F1ZA 2IWHA 4BY1B 3MC0B 3NSWA 5M9OA 1I94Q 3JAME 2F3VA 4ZUIA 1KRTA 2YTXA 1EYCA 4WFN3 5C4XB 4NXMQ 1F9SA 4K5VA 4IUNA 3QR8A 1K73C 4C3JG 1SRUA 3T51B 3I4LA 3UDIA 3URYA 1IL2A 4B3SQ 2JQOA 4FP5D 1JOKA 2CW0C 4XT1B 3TZUA 1CQFA 2A69C 2GA4B 4UAIA 2F0KA 5E7NA 2JA7B 2GVBA 5C4JH 2SDFA 2ZTEA 2A69D 4RWSC 3A54A 4DNRB 5GADC 2VQFQ 4JYAL 1VQEA 4LF4Q 3OOCA 3NQTA 1E2ZA 1Q12A 2FJ2A 4A3DG 2QA4A 1JJCB 5KYIA 2RCFA 1KC8C 3TP5A 1I94L 2PO4A 3VR6A 1CSQA 1YEZA 1KDCA 1I4PA 2Z9HA 2WB1G 3FP9A 3H0GB 1HRJA 4GN5A 1SROA 3A8JE 2TSSA 1TWCH 5LMNQ 1U4LA 3H3VH 3S16B 4P75A 1B1ZA 1QILA 5C5LA 2JEAI 3LWUA 1GKHA 2KENA 3F2DA 3WWVA 2HIVA 2NB0A 5IGBA 1STYA 2RKSA 2E8GA 4A75A 2QEXA 1CFMA 2GN5A 2PZTA 1LLRD 3H3VC 1SR3A 1TU2B 4K5WA 1EEID 1ZXTA 2F0UA 5HGQA 4LF4L 1C9OA 1RDPD 3A5ZB 1FL0A 1H9MA 2VQFL 4LUZA 2B2VC
chains in the Genus database with same CATH topology
3J80E 5C4JB 2K1BA 2K32A 1LT5D 5CV4A 2B8GA 1BUVT 1MI2A 2HUGA 3I3CA 3OSOA 3KLSX 1U4PA 3H94A 2Q8RE 4O42A 2D5DA 5C0XH 3NQIA 2C9OA 2E75C 1HA5A 4K8IA 4EGVA 1TWCB 1JWUD 4QMGA 1XXGA 4HN7A 5I2YA 5E3FA 4G7OC 1SDFA 2K7VA 2F0IA 1M4VA 2EJGC 2NTSA 1ENCA 3ND8A 1TKWB 5CBAE 3SEBA 3DEPA 4XIGS 2F0MA 1TS4A 4KD4A 1CQVA 2E2DC 1NUCA 1LTAD 4HSPA 5COYA 1NAPA 2LKVA 1I6HB 2XVSA 2BDNA 4KHVA 3S9WA 3Q24A 5CV5A 2KVMA 1PTOF 1FR3A 2EPBA 2CVRA 2N55A 1EYDA 1EIHA 3PUYA 1D6EC 1GXDC 4V190 1DCZA 5C4ZA 1G291 5M5YB 1T5EA 2LMCB 2ICIA 3SE0A 2J0TD 2NVTB 1AZQA 5DM63 1SE4A 2L55A 2D2CC 4IFDH 2B2VA 4OO1G 3Q6SA 2F3WA 3I72A 4KKTA 4XTCS 3KK7A 1GUTA 3C46A 5M3MB 3BDLA 1TR5A 2IT1A 3GQBA 1HFNA 1G6ZA 4ZKBB 5LL6X 1I50B 5DAUA 3AB9A 4DNTB 1F9PA 1CI3M 3MFGA 1CHQD 1IKLA 3OWFA 1Z7TA 3MVVA 4DU9A 1D2BA 1F2LA 1TT2A 1AW7A 1SNQA 1KNAA 5CV6A 4RGNA 3K58A 3PO3B 1UEAB 2Z8LA 1Q1EA 1R4PB 1GUSA 2C5CA 1EY0A 1G8ZD 1EIGA 5C5MA 3TDQA 2EDGA 1W6KA 1L0XB 2K05A 1UNSA 2KOLA 1FNWA 3OHXC 4BY7B 4CJ0B 2FMCA 1C8CA 4IURA 4DAYA 3AU7A 1EWCA 5CGKA 2NBFA 1OXSC 1SYEA 2BDOA 2XN9C 5LHY1 2AQ3B 1IYUA 1BDOA 1HA6A 2PW5A 2IX1A 1B4OA 4K14A 1S5CD 1DOKA 3J7YW 1QG7A 4OO1I 4PMWA 1L0YB 1F2MA 3T4AC 1Q3LA 2SOBA 5EKIA 5K5PA 1TY0A 1JOQA 1TIID 1U4MA 1X3QA 4B08A 4HR7B 1BO0A 2ENBA 3IFTA 3KBGA 2JXMB 2O4XA 1GUGA 3HKZB 3A8IE 4ILWA 2R92B 1U4RA 2PZUA 4IUPA 3K7AB 4QF4A 3P20A 5JEAJ 2KCCA 5M5WB 5C44B 4BBSB 4M8AA 2RSOA 2NN6H 2A5HA 3W2DA 1SNDA 4C3IG 1ET9A 4BS9A 1X32A 2EY1A 1JC7A 1E2VA 2MPMA 2B8FA 3FMCA 2IPKD 3IL8A 1ILQA 3LWEA 1SYDA 4TKOB 1BNZA 1PLFA 3L9AX 2DNCA 2FFKB 3D4RA 3KUPA 3F2UA 2BE5C 1TQOA 4WJWA 1Z47A 3PMFA 4DGZA 3K0YA 2BE5D 3K6OA 1R9TB 3LX0A 5ELFA 1HTLD 1RJTA 3A7LA 2B2WC 3VR3A 1Q90A 3IKJA 1LTID 5JOBA 3I90A 1A6XA 1F77A 3D8GA 2CQAA 1HXYD 4EQNA 4DAVA 2J7ZA 5T1GA 3L3OC 1EOTA 1KLGD 3C2PA 4F7XA 2JYOA 3UI2A 2F03A 3GTOB 1Q8IA 4A3MB 4IUQA 1JR0D 1GHJA 5K36G 2JSOA 3VR2A 1MGSA 1TWGB 3BS1A 4KKSA 1DONA 1LT4D 1B2TA 1SSOA 4FF2A 1B9MA 1B50A 2TMPA 3SR1A 3X3MA 2X69A 3Q22A 1G2SA 2QDBA 1I4HA 1DZ1A 1PZKD 4IQZA 4RCOA 1LT6D 1QB5D 2BA0A 1BF4A 4MN3A 5D3IB 1YNJC 4C56C 2PPBC 1GOZA 1YNJD 1Y8PB 1RKNA 4U673 4ZK9B 3U9OA 2V4DA 4A3GB 4KMUC 3R93A 3R8BA 1SEBD 2JA5B 4M1UB 1SNOA 4F88A 4E6IA 4FF3A 4ID6A 2L0CA 2LFNA 4HTHA 1BBXC 2SNSA 5EBCA 1SJED 4AYBB 3AMUA 3S1MB 1DOMA 2B2WA 1PFMA 1IL8A 1ET6A 5EQ0A 3FPPA 2YU9B 2HQEA 3EA6A 3O13A 1H9JA 4C3JB 1VDZA 3FPUB 2HDMA 2KQ3A 5FKAC 2D9UA 5I9OA 2XSCA 3P75A 1STGA 1HQMC 1EYAA 5IT9E 4CBVA 3MWYW 2F0OA 2F0LA 1PTOH 5JEAG 1OXXK 3RD4A 1I4XA 1E2WA 3GV6A 3MXUA 4HCEA 4NDXA 2WV6D 1PTOC 3KLRA 4RAUC 2EYOA 1ZKOA 4ZYSA 3GO5A 4KK7A 3S1NB 1PTOD 1KLUD 3QB3A 1FNUA 4RHRA 1Y8NB 3G7LA 2EYJA 5LL6S 1NSNS 4YIJA 4OL7A 3CRKC 2YYZA 3I73A 4HCSA 2EE1A 4JBWA 3ITPA 4CKEA 2JP1A 4KHZA 2ZXRA 1ONLA 5M5XB 3HOXB 1PTOB 1B53A 1DD2A 2CW0D 4A3EB 2WINB 3KF8A 2OEOA 1IHZA 2MHVA 1EY9A 1VF5C 4XQJA 1V43A 2Z1CA 5D3DA 4KY5A 3G6JB 3HP3A 2F0JA 3MXPA 2G9HD 5IGFA 1LABA 1QE6A 1SJHD 5ISRA 1SYFA 2BCOA 2XWJB 3PUXA 5FK9C 3J7AF 1LTTD 1JICA 4C2MB 3M4YA 2F0SA 1S4ZA 3S15B 1GUNA 2F0DA 1XTCD 4FO2A 1BQQT 5FO7B 5KNDA 3DWPA 2VXWA 1CK1A 3R2TA 1RCVD 4ZAIA 3CKIB 3NBHA 5JVH3 5KNBA 4JK1C 2N88A 4XQNA 2XNAC 5NUCA 3J81E 2MGSA 4ULLA 1MSGA 3D3RA 1CA6A 1LTGD 2EYHA 1MBYA 3Q0AA 3K59A 1STHA 5J1ZA 5CBEE 4KTAA 1AP0A 1UUPA 3S14B 1G91A 1O78A 1F9RA 4FF4A 1QCBD 5FLXE 5DNFA 3C1FA 4N9PA 2NZ1D 2R61A 3OIPA 4EQOA 2DN8A 2KUMA 1CT1D 3HOYB 4N9TA 1YNNC 3OMGA 1YNND 2ZT9C 5ELDA 2WKDA 2JA6B 1SYBA 3NP8A 1OXVA 2CHBD 3ONAB 2EXZA 4L8JA 3HG9A 4KI0A 1CA5A 5EPLA 3VR4A 4KV6A 3T13A 2NVQB 4A3BB 2FMMA 2MJ8A 2F0QA 1PZID 3NWSA 1ENAA 3H6MA 4FF1A 1WD1A 1TS3A 2SEBD 1EZ8A 1SMYC 1SE3A 3WDNA 3MHBA 1SMYD 1LACA 3DWQA 2WIIB 2RBMA 4L6TB 3V05A 5A2QE 1O7LA 1F2YA 1SYCA 3D4WA 1TWHB 3GTKB 1AN8A 1PXUA 4WRDA 2A68C 4KN4C 3PV0A 2F0EA 2BA1A 1PRTB 2RDGA 5D65A 1STEA 5JJZA 4FXKC 3SK6A 1I4GA 2EVBA 1STBA 1QNKA 2D62A 2JA8B 1GJXA 2K5DA 3N52A 4RH6A 4LMQD 1KDBA 1TWAB 2H1EA 5AFWA 1G2TA 1PMRA 3NXWA 4F87A 3QJYA 5CORA 4QIWB 1Y1VB 4MIUA 4K6DA 3NWTA 5CC4A 2Q8TA 5I6YA 5J22A 2WP8J 3KBXA 3QOLA 3GTQB 3M4OB 5I4DA 5EJWA 3RUZA 4J1MA 1EQVA 1R4QB 1RODA 2IX3A 1D1KA 4C3IB 1DXMA 1KTKA 1DYQA 1MSHA 3FVQA 1GUWA 2A74C 2E2JB 2B2UC 4NKLA 1SNCA 3MA2B 4OHJA 3A55A 2FINB 5T1IA 1EY4A 4RHSA 1STNA 2NTTA 3NUCA 5CV8A 3VYSA 3SHLA 2F0VA 3P1HA 3U9SA 1ESRA 1I3QB 1C4QA 3GP7A 5I6WA 1BCPB 1SE2A 3M3YB 3L7ZC 5C0XI 1NCVA 3M85A 1JCKB 4C3HB 2Q8IB 1JB3A 1K83B 4G7ZC 4BA1I 4GZYC 5ELEA 5KIXA 4J8QA 4FVMA 1PRTF 3JAML 4X3TA 2EYPA 2Y0SB 4CKBA 2A73B 4IZ8A 1U9RA 4QCLA 1WTOA 5E1FA 1VF7A 4HMIA 4P2CB 5EBDA 3SDZA 3S1RB 2R7ZB 4KY6A 2DY7A 4IN3A 5I2XA 1QWYA 3BYYB 5DEHA 5CV9A 3GTPB 1PDQA 3C1EA 4ODGA 4Q5VA 1BOSA 3CU7A 5BN3A 2B2UA 2KA7A 3EQLC 1WD0A 5FO9B 2JE6I 5KGUA 5DM73 1H9KA 3DHQA 4IFDI 2O5JC 3DMUA 3DWAA 5KEEA 2B2YC 5JEAH 2L9HA 3I91A 2L11A 4K8JA 3TSSA 4A3IB 3MEHA 3I70A 1DJRD 3D6WA 1S5FD 1A2TA 1A3TA 1OXTA 3VR5A 1CTMA 3DUZA 3I8ZA 2QCPX 3TMEA 2F0WA 2LY7A 2I46A 2IL8A 2F4IA 4DXFA 1SBBB 2E74C 1BCPF 3IAYA 5IGCA 1FNVA 3M7NA 3TP7A 2NN6G 5EGTA 1KABA 2OF1A 4LAAA 1ILPA 2AWNA 3MXGA 1H9RA 1QNUA 4RFBA 5KNCA 5F2DA 4DAPA 4K6LA 4KN7C 5JPNC 2F0PA 1TS5A 2ZXPA 4H13C 4RGTA 1RHPA 3BVMA 2RVLA 5CR3A 2K04A 3HEJA 3LNNA 1CHPD 2H4OA 1B9NA 3N6RA 2R6GA 1OO9B 2B39A 3K5LA 1EL0A 4G4KA 1WTVA 1M8AA 2NYZD 4G57A 1HTPA 3ERQA 3MZ5A 3V96A 3BVZA 2VUMB 2G9DA 2B2YA 3TP8A 1LO5D 4CGYB 4CKCA 1I4QA 1SFOB 1WVLA 1S5BD 5JPMC 2XRSD 5IODA 4LJZC 5BN5A 3BZDB 5EPJA 3RZDB 2NUCA 1D1IA 4A3DB 4KJOA 2F0NA 1VMPA 3OPOA 2B2TC 2NVXB 2WB1B 2JEBI 4TSSA 3J7AV 3QG1A 2AQ2B 3MTSA 1AEXA 3H09A 2PYKA 3SVMA 2A6EC 3Q23A 1VCIA 2A6ED 3TBIB 1O80A 2NN6I 3VA5A 5C0XJ 4FYDA 4R8NA 2PQEA 5IOCA 4BA2I 5IGEA 1CZWA 1Z6HA 3GTJB 4HEDA 4I7ZC 3DXJC 4L63B 4HAEA 1WTWA 1EY8A 4XXEA 4XYOA 1AFPA 3OWEB 4BWGB 5ELBA 3EFXD 1A3UA 4DFAA 4RA8A 4KJNA 3CRLC 1FD7D 4PMCA 3NE5B 3SK4A 2O2LD 1RTOA 4QB4A 2EYMA 4Z9CB 5EKLA 1EWHA 3K5NA 1EY7A 4TQUS 2OXPA 4OO1H 4Q0FA 3VA7A 1Y8OB 2XWBB 1JORA 1DOLA 3PUWA 2XIWA 3IFDA 1V1PB 1KDAA 4DXGA 2B2TA 2F0FA 2EY2A 5HGTA 1LTBD 3H91A 1QJOA 2E2IB 2L1BA 2MUYA 1HUNA 2KJXA 3OW7A 4U68A 1S5DD 4IFDJ 3MFYA 1V1OA 2K01A 1K8OA 1KNEA 3K57A 2PZWA 1IW7C 1ICWA 2MP1A 4DK1A 5G3LF 1I6VC 2RDFA 1EU4A 2RDHA 4ZQ3A 1IW7D 1ZEQX 2PW7A 2L5TA 3FEWX 5I9PA 3FRPB 3PO2B 4PMBA 2VB3X 3HOZB 2Z4IA 2B63B 1E0BA 1A2UA 1ZYRC 3DEOA 2PCFB 5E4XA 1IKMA 4LK1C 3EROA 3BYTB 1TVXA 1WTRA 4IUTA 1ZYRD 1HFGA 4FNFA 5FO8B 1K8MA 1WCMB 1EU3A 1V1PA 3OMCA 4S3SA 2J4XA 3HOUB 1Y69U 2Z4HA 1XX8A 1RF2D 1I4RA 2HCCA 4X3UA 1D5MC 3S2HB 1LV9A 2X6GA 2K33A 4ZRZA 1JQYD 1II3A 1JWMD 1PRTC 2AWOA 2L12A 3WOEA 4BBRB 2PMZB 3NTIA 5C4HA 1PRTD 2X6LA 4ABNA 2L4NA 1XYIA 2O5IC 2K5WA 2AUJD 3V2TA 2KECA 3FKIB 3QIAA 5E4WC 3EVQA 3M7GA 3GTGB 4B9XA 5A35A 4XYQA 2RQXA 5KRUA 4NP5A 2M9VA 1EZ6A 3CHBD 3D6CA 2PNRC 3T16A 5C0XG 2EJFC 5M3FB 1H9SB 4HSVA 2A68D 4IUUA 3NK9A 3BVGA 1A15A 4DN4M 4PV1C 4MHEA 1ESFA 1TS2A 2R93B 2K6AA 1JE4A 1V8QA 4RKBA 1JWSD 2WAQB 2BOSA 4DK0A 4ZKCB 3SK8A 3ZYYX 3NTHA 1SNMA 4ZUJA 1S5ED 5D14A 2XRQD 1B3AA 2WKCA 1GHKA 1D5ZC 1Q1BA 1BR9A 3HOVB 1HQRD 3X3NA 2ID0A 2HCIA 4OGQC 1FYCA 2E2HB 5KYLA 4K2KA 2EJMA 2EY6A 2K5QA 2KEEA 1VMCA 5EKKA 4XQQA 4WORA 3P7JA 2HDLA 4A3KB 3T53B 3BG3A 3OIQA 3BDOA 1MD2D 1LTSD 1H9SA 1BCPC 1EY6A 1OXUA 5CV7A 4RKLA 4V0BA 4H44C 5IGDA 3GTMB 4UDUC 1BCPD 5TSSA 3A56A 1HUMA 3RMHA 3S1QB 2LS01 1TY2A 4IFDG 3GV3A 5C3EB 4IALA 3PIO3 1Y1WB 4NMZA 1ENFA 5IT9L 4A3FB 3PUVA 1STAA 5K36H 1F2ZA 3KLSA 3NTKA 3BDCA 4G7HC 3VYUA 4CJ1B 3HS0C 2M00A 2K03A 4CJ2C 1SYGA 3FDTA 3EJIA 4O1NA 1XWEA 2RSNA 1ML0D 3NPPA 1TWFB 3S17B 4K5XA 5BN4A 1T5XD 1O7ZA 3PUZA 2EY5A 1GUOA 4RGMA 2IJ0A 4R9WA 5CYUA 4PQXA 5IIFA 2K28A 1EQTA 1BXTA 4H7BA 4KKUA 3NBIA 1JOOA 1LT3D 1UAPA 1FGBD 4QUFA 1J9OA 2R3ZA 3I4NB 3HZXA 3K5OA 3QOJA 3QWNA 1C48A 2VNUD 2VB2X 2EYLA 2QF7A 4XT3B 1HPCA 5C3XA 4XDXA 5ELCA 3CQZB 4H0LC 3VYTA 1PFBA 4QUCA 4R8IA 2WACA 4TRDA 3HOWB 2F0GA 3E6ZX 1WTXA 2IX0A 2ZXOA 4C3HG 3K5MA 4RCNA 4IUVA 3TZDA 2I07B 3R3OA 1J8IA 3TP6A 2RA4A 4A3JB 3J80L 1D5XC 2QEJC 5CMDA 3E5SA 5C3WA 5JAVA 1X3PA 1SNPA 1CZGA 1EY5A 4NW2A 3SK5A 2EYFA 3NHHA 2EOTA 4DA2A 5JVG3 2KEDA 3E0JA 5HURA 3J81L 2FHTA 2SNMA 2F1MA 3GD7A 4KY7A 3SXHA 3R2IA 3HGBA 3RZOB 2DY8A 4FXGC 2QKIC 1B44D 1SAPA 2IW3A 1WTQA 3W3AA 5J39A 3S2DB 3A8KE 1SXTA 5FLXL 1IYVA 5EPKA 3I4MB 3GTLB 2A6HC 1PZJD 1PFNA 2DNEA 1NR2A 2E76C 4OIJA 2A6HD 4HMJA 4X3SA 2NVYB 2F0HA 2QILA 1KAAA 1O7YA 3MXNA 3HRZC 1HCZA 5C6AA 3MAQA 4OIKA 4DF7A 1LTRD 1EEFD 1QOHA 4J6HA 4F8MA 5G3LD 1CM9A 1HHVA 1RTNA 4K2LA 4FXDA 4I65A 2ICEC 2AUKA 2M2LA 1RD9D 4KD3A 3TN2A 4X3KA 4EQPA 3DM1A 2NWGA 1PYWD 4RGOS 3ND9A 2KHSA 4C1NI 3QO2A 3RLFA 2F0TA 4ME5A 1EFID 2EZVA 5IGGA 4EVOA 1A3VA 4PNYA 3A7AB 4B9WA 3C3LA 1NR4A 3T56B 3VYRA 1WTPA 3D4DA 2KCNA 4CHTB 3WOFA 1DM0B 5FOBB 1AZPA 1F9QA 4ZLTF 4Y7NB 2OT2A 2AQ1B 5A2QL 4A93B 4C1NK 3D31A 1W6JA 3PIP3 2IWHA 4BY1B 3MC0B 3NSWA 5M9OA 3JAME 2F3VA 4ZUIA 1EYCA 4WFN3 5C4XB 1F9SA 4K5VA 4IUNA 4C3JG 3T51B 3I4LA 3URYA 4FP5D 1JOKA 2CW0C 4XT1B 3TZUA 1CQFA 2A69C 2GA4B 4UAIA 2F0KA 2JA7B 2SDFA 2A69D 4RWSC 3A54A 4DNRB 3OOCA 3NQTA 1E2ZA 1Q12A 2FJ2A 5KYIA 3TP5A 2PO4A 3VR6A 1KDCA 1I4PA 3H0GB 1HRJA 3A8JE 2TSSA 1U4LA 3S16B 1B1ZA 1QILA 5C5LA 2JEAI 3LWUA 2NB0A 5IGBA 1STYA 2RKSA 1CFMA 2PZTA 1LLRD 3H3VC 1TU2B 4K5WA 1EEID 1ZXTA 2F0UA 1RDPD 1H9MA 2B2VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOK A;  1X3P A;  4CJ2 C;  2K1B A;  1QG7 A;  1QE6 A;  1JE4 A;  1NR4 A;  2Q8T A;  1ILP A;  1O80 A;  3FDT A;  4NW2 A;  1WTP A;  2HUG A;  1MI2 A;  2RSN A;  1ML0 D;  3I3C A;  2J7Z A;  5T1G A;  3KBX A;  1AZP A;  1E0B A;  1F9Q A;  1U4P A;  2EOT A;  1EOT A;  2KED A;  4ZKC B;  1O7Z A;  1HFN A;  3FPU B;  1JIC A;  2Q8R E;  4ZLT F;  1G6Z A;  4O42 A;  2JYO A;  1Q3L A;  3DEO A;  2DY7 A;  2HDM A;  5COR A;  5E4X A;  5EKI A;  3UI2 A;  4ZKB B;  1IKM A;  5EJW A;  2D9U A;  3ONA B;  4HED A;  2FHT A;  1TVX A;  1WTR A;  1S4Z A;  1F9P A;  4IUT A;  5D14 A;  1HHV A;  4HAE A;  1WTW A;  1B3A A;  1HFG A;  1U4M A;  4R9W A;  1X3Q A;  1CA5 A;  1BO0 A;  1ROD A;  3MWY W;  1IKL A;  1PDQ A;  1RHP A;  5EPL A;  2K28 A;  1EQT A;  2DY8 A;  1F9S A;  2RVL A;  4IUQ A;  3GV6 A;  2FMM A;  2K04 A;  1MSH A;  1SAP A;  1MGS A;  1SDF A;  4RA8 A;  1DON A;  2MJ8 A;  1WTQ A;  2HCI A;  1F2L A;  1SSO A;  2VXW A;  1B2T A;  1GUW A;  2B2U A;  1U4R A;  2B2U C;  1B50 A;  1KNA A;  4ZAI A;  1WD0 A;  5CBA E;  1RTO A;  4RAU C;  1XX8 A;  2KEE A;  5EPK A;  1EL0 A;  1VMC A;  4IUP A;  1J9O A;  1M8A A;  2NYZ D;  2R3Z A;  3DEP A;  4QUF A;  1WTV A;  2HCC A;  2X69 A;  4X3U A;  1WD1 A;  2FIN B;  3P7J A;  1G2S A;  1PFN A;  2HDL A;  1NR2 A;  4OIJ A;  4XT1 B;  5T1I A;  1LV9 A;  2X6G A;  1DZ1 A;  2N88 A;  4X3S A;  2RSO A;  3G7L A;  1EIG A;  4XT3 B;  4UAI A;  2B2Y A;  4XDX A;  2SDF A;  1X32 A;  1ESR A;  2B2Y C;  5COY A;  2L12 A;  4RWS C;  1WVL A;  2L9H A;  1BF4 A;  2MGS A;  1MSG A;  3I91 A;  1NAP A;  2MPM A;  4MN3 A;  1PFB A;  2L11 A;  4QUC A;  1O7Y A;  4HCS A;  2EE1 A;  2FJ2 A;  1DOL A;  2X6L A;  2L4N A;  3IL8 A;  5EPJ A;  4R8I A;  1XYI A;  1CA6 A;  1HUM A;  2BDN A;  2XIW A;  3D6W A;  1ILQ A;  3IFD A;  4OIK A;  5D65 A;  1G91 A;  2KEC A;  1WTX A;  2K05 A;  2JP1 A;  5CBE E;  2KVM A;  3LWE A;  5JJZ A;  3GV3 A;  1NCV A;  2KOL A;  5E4W C;  1VMP A;  2B2T A;  4ZK9 B;  2EPB A;  1BNZ A;  1AP0 A;  2B2T C;  4CJ0 B;  1CM9 A;  2CVR A;  2N55 A;  1HRJ A;  1PLF A;  1B53 A;  3R93 A;  1C8C A;  4IUV A;  3I8Z A;  1F9R A;  3TZD A;  4IUR A;  1RTN A;  1U4L A;  1QNK A;  2FFK B;  3H91 A;  5DNF A;  3KUP A;  3F2U A;  2L1B A;  1J8I A;  2M2L A;  1EIH A;  1HUN A;  4DN4 M;  2NZ1 D;  3TN2 A;  4X3K A;  4U68 A;  3DM1 A;  3N52 A;  2IL8 A;  2RA4 A;  2NWG A;  3MTS A;  2KUM A;  4LMQ D;  2H1E A;  5AFW A;  3QO2 A;  1BBX C;  4X3T A;  2K01 A;  1G2T A;  1KNE A;  5CMD A;  1ZXT A;  1HA6 A;  1AZQ A;  4HSV A;  1RJT A;  1DOM A;  2B2W A;  4IUU A;  2B2W C;  4CJ1 B;  3Q6S A;  3SVM A;  1B4O A;  1ICW A;  1PFM A;  1WTO A;  2MP1 A;  3HP3 A;  2B2V A;  1IL8 A;  3I90 A;  1A15 A;  2B2V C;  5EQ0 A;  2K03 A;  4MHE A; 
#chains in the Genus database with same CATH topology
 3J80 E;  5C4J B;  2K1B A;  2K32 A;  1LT5 D;  5CV4 A;  2B8G A;  1BUV T;  1MI2 A;  2HUG A;  3I3C A;  3OSO A;  3KLS X;  1EIY B;  1U4P A;  2K50 A;  4B3R Q;  3H94 A;  2Q8R E;  4O42 A;  2D5D A;  5LMN L;  1I6H H;  5C0X H;  3NQI A;  3L0O A;  3PIO A;  2C9O A;  4P74 A;  5IP7 H;  2E75 C;  1EOV A;  1HA5 A;  4K8I A;  4EGV A;  4JPB W;  1TWC B;  1JWU D;  4QMG A;  4YWM A;  1XXG A;  4HN7 A;  1QVF A;  4UY8 C;  2CQO A;  5I2Y A;  1XMO Q;  5E3F A;  1PVO A;  4DV1 Q;  1SDF A;  2K7V A;  4G7O C;  2F0I A;  1M4V A;  2EJG C;  2NTS A;  1ENC A;  1OTC A;  3ND8 A;  5M5Y H;  1TKW B;  1O7I A;  5CBA E;  2AHO B;  3SEB A;  3DEP A;  1AH9 A;  2Y0S E;  4XIG S;  2NVT H;  2CH4 A;  4DUY Q;  2F0M A;  1CKN B;  1TS4 A;  4KD4 A;  4DV3 Q;  1CQV A;  4B3R L;  2E2D C;  1NUC A;  3B6Y A;  1LTA D;  4HSP A;  4UP9 A;  1SMX A;  2DGY A;  2XGT A;  5COY A;  3EBE A;  5M3M H;  1NAP A;  4JI5 L;  2LKV A;  1I6H B;  1J5E L;  2V1C C;  2XVS A;  2DUD A;  2BDN A;  4KHV A;  3S9W A;  3I4O A;  3Q24 A;  5CV5 A;  3UDF A;  2KVM A;  3AEV A;  1XMO L;  1I50 H;  1PTO F;  4JI6 Q;  1FR3 A;  2EPB A;  1YJ9 A;  2F4V Q;  5IYD H;  1VQI A;  2CVR A;  2N55 A;  3E9H A;  3BJU A;  2Q2U A;  1EYD A;  1EIH A;  1YZ6 A;  3PUY A;  1D6E C;  1GXD C;  1N34 L;  4V19 0;  1DCZ A;  5C4Z A;  1YIJ A;  1G29 1;  1W2B A;  5M5Y B;  1T5E A;  2LMC B;  4DV3 L;  2ICI A;  2Z0S A;  3NEN A;  3SE0 A;  2J0T D;  2NVT B;  1AZQ A;  5DM6 3;  1SE4 A;  2L55 A;  3PO3 H;  2D2C C;  4IFD H;  2B2V A;  4OO1 G;  3Q6S A;  2F3W A;  3I72 A;  4KKT A;  4XTC S;  3KK7 A;  3PO2 G;  1GUT A;  5IP9 G;  2GVA A;  3PF5 A;  3C46 A;  3HOZ G;  5M3M B;  2PQA B;  1VQO A;  3BDL A;  3MEF A;  2B63 G;  4JI6 L;  1TR5 A;  2IT1 A;  2MO0 A;  2F4V L;  2Z6K C;  4DAY B;  1VQ7 A;  3GQB A;  4UP7 A;  3NEL A;  1HFN A;  1CKN A;  1G6Z A;  3GDE A;  2XTI A;  5GQO A;  1VS0 A;  4ZKB B;  5LL6 X;  1I50 B;  1VQ5 A;  2VL6 A;  3KF6 B;  5DAU A;  1BBW A;  3AB9 A;  2ZM6 Q;  1FJG Q;  4DNT B;  1F9P A;  1MJC A;  3OYY A;  4BY7 H;  1CI3 M;  1WCM G;  3MFG A;  1CHQ D;  4A3K H;  1IKL A;  3OWF A;  1Z7T A;  1YBY A;  3MVV A;  4DU9 A;  2JA6 G;  1D2B A;  1F2L A;  1TT2 A;  4DR7 Q;  1AW7 A;  1SNQ A;  1KNA A;  1EQR A;  5CV6 A;  4JI3 Q;  5DLQ E;  4RGN A;  3K58 A;  3PO3 B;  4LFA Q;  1UEA B;  2Z8L A;  4A3L H;  4NPS A;  1Q1E A;  1R4P B;  1GUS A;  2C5C A;  1N32 L;  1EY0 A;  1G8Z D;  1EIG A;  4A3B G;  1FJG L;  2CWA A;  5C5M A;  3TDQ A;  4BBR G;  3CC2 A;  2EDG A;  3J7A 5;  1W6K A;  1L0X B;  2RCN A;  2K05 A;  1UNS A;  2KOL A;  1FNW A;  3OHX C;  4BY7 B;  2PQA A;  2OWO A;  3K7U C;  4CJ0 B;  4DR7 L;  2FMC A;  1CUK A;  1C8C A;  2A1A A;  4IUR A;  2I5L X;  4DAY A;  1XPO A;  4DV0 Q;  5LMU Q;  3AU7 A;  4JI3 L;  1EWC A;  5CGK A;  4LFA L;  5GAH C;  2NBF A;  1OXS C;  1SYE A;  2BDO A;  2XN9 C;  5M3F G;  2R92 H;  5LHY 1;  2AQ3 B;  1IYU A;  1BDO A;  1YVC A;  4LF7 L;  1HA6 A;  2PW5 A;  1JJG A;  4X62 L;  3K7A H;  2IX1 A;  1B4O A;  1I5F A;  4K14 A;  4HJA A;  1S5C D;  1YHQ A;  1DOK A;  4PZ6 A;  5M5W H;  3J7Y W;  1HJP A;  1QG7 A;  4N8F A;  5C44 H;  1HR0 W;  4BBS H;  4OO1 I;  4PMW A;  4RG1 A;  2Q2T A;  1L0Y B;  1F2M A;  3T4A C;  2Z6K A;  3CCV A;  1Q3L A;  2SOB A;  1V9P A;  5EKI A;  4DV0 L;  2ZJR A;  2CFM A;  1X9N A;  5K5P A;  1TY0 A;  1JOQ A;  1TII D;  1U4M A;  1Y1V G;  1X3Q A;  4B08 A;  4HR7 B;  1BO0 A;  2ENB A;  3IFT A;  4LF5 Q;  4JI1 Q;  3KBG A;  2JXM B;  1WOC A;  3CC7 A;  2O4X A;  1GUG A;  3HKZ B;  3A8I E;  4ILW A;  2R92 B;  1U4R A;  1UE6 A;  2PZU A;  1R9T H;  4IUP A;  3K7A B;  4QF4 A;  3P20 A;  5JEA J;  2KCC A;  5M5W B;  1CKM A;  5C44 B;  1K28 A;  4BBS B;  4M8A A;  2RSO A;  2NN6 H;  2A5H A;  3W2D A;  1SND A;  4C3I G;  1ET9 A;  4BS9 A;  3CCJ A;  1X32 A;  2EY1 A;  4JI2 Q;  1JC7 A;  1E2V A;  2MPM A;  2B8F A;  4UPA A;  4OX9 Q;  3FMC A;  2IPK D;  1PH1 A;  1MIU A;  3IL8 A;  4GKK Q;  2F3I A;  4LF5 L;  1ILQ A;  4JI1 L;  4P73 A;  4IPG A;  3LWE A;  1IBK Q;  3PIP A;  1HH2 P;  1SYD A;  4TKO B;  4CDF C;  1BNZ A;  2K75 A;  1HR0 Q;  3GTO H;  1D8L A;  1PLF A;  3L9A X;  2DNC A;  4A3M H;  3D4R A;  2FFK B;  3KUP A;  3F2U A;  2BE5 C;  4DK3 C;  1P8L A;  4A3F G;  2R7D A;  1TQO A;  4WJW A;  1Z47 A;  3PMF A;  4DGZ A;  1TWG H;  3K0Y A;  2BE5 D;  3K6O A;  5FJ8 G;  1R9T B;  3LX0 A;  5ELF A;  2QW7 A;  1V1Q A;  1HTL D;  1RJT A;  3A7L A;  4DR6 Q;  2B2W C;  3VR3 A;  2ZTC A;  1Q90 A;  3IKJ A;  1LTI D;  3I90 A;  5JOB A;  1A6X A;  1Z9F A;  4OX9 L;  4ME3 A;  1F77 A;  5IT9 c;  3BZC A;  3D8G A;  2CQA A;  1HXY D;  1YNX A;  4EQN A;  3K81 C;  4LW1 A;  4DAV A;  2J7Z A;  5T1G A;  1XNQ Q;  3L3O C;  2UUB Q;  4DR5 Q;  1EOT A;  1KLG D;  3C2P A;  4F7X A;  4NB3 A;  2JYO A;  2Y0S G;  3UI2 A;  1PH3 A;  3RR5 A;  2F03 A;  2ALY B;  1Q86 C;  3GTO B;  1Q8I A;  3GTL H;  4A3M B;  2JN4 A;  4RMF A;  4A3G H;  4IUQ A;  1JR0 D;  4JI4 Q;  1GHJ A;  5K36 G;  2JSO A;  3VR2 A;  1MGS A;  1TWG B;  3BS1 A;  4KKS A;  2OTL A;  1LT4 D;  1B2T A;  1DON A;  1SSO A;  1VQA A;  2R7Z G;  4FF2 A;  1B9M A;  1B50 A;  2TMP A;  3SR1 A;  1YHB A;  3ULJ A;  3I4N G;  5IE8 A;  2CWP A;  3X3M A;  2X69 A;  3Q22 A;  4DR2 L;  3S1M H;  1KXL A;  1G2S A;  1XNQ L;  2QDB A;  1I4H A;  4H02 A;  1IBL Q;  1DZ1 A;  4GN3 B;  1U0L A;  1PZK D;  2YU9 H;  4IQZ A;  4RCO A;  1LT6 D;  1GD7 A;  4A3C G;  1QB5 D;  2BA0 A;  1BF4 A;  4MN3 A;  5D3I B;  3HOW G;  1YNJ C;  4C56 C;  4C3J H;  2PPB C;  1GOZ A;  3CW2 C;  2EXD A;  1YNJ D;  1Y8P B;  4JI4 L;  1RKN A;  4U67 3;  4QL5 A;  4ZK9 B;  3U9O A;  2V4D A;  3M9B A;  4A3G B;  4KMU C;  4PZ8 A;  4JVZ A;  3R93 A;  3R8B A;  1SEB D;  2JA5 B;  3U4V A;  1XNR Q;  4M1U B;  1SNO A;  4F88 A;  4E6I A;  4FF3 A;  1KRS A;  2OTJ A;  4CDE C;  4ID6 A;  2L0C A;  2LFN A;  4HTH A;  1IBL L;  1BBX C;  1D7Q A;  2SNS A;  5EBC A;  2VQE Q;  4LF6 Q;  1SJE D;  4AYB B;  3AMU A;  3S1M B;  1EIF A;  2ZJQ A;  1DOM A;  2B2W A;  1PFM A;  1UE5 A;  1IL8 A;  1ET6 A;  3S1N H;  5EQ0 A;  3FPP A;  2YU9 B;  2HQE A;  1KQS A;  4BY1 H;  3EA6 A;  1EWI A;  3O13 A;  5C4X H;  1H9J A;  4C3J B;  2FXQ A;  1VDZ A;  3FPU B;  3CCU A;  3STB D;  2JK8 A;  2HDM A;  2KQ3 A;  2QDL A;  3KF8 B;  2UXB Q;  5FKA C;  2D9U A;  5I9O A;  2XSC A;  4HIK A;  3P75 A;  1STG A;  1HQM C;  1EYA A;  5IT9 E;  4CBV A;  1LTL A;  3MWY W;  2F0O A;  2F0L A;  3I2Z A;  5M5X H;  3HOX H;  1PTO H;  5JEA G;  1OXX K;  3RD4 A;  2VQE L;  1I4X A;  4A3E H;  1E2W A;  3GV6 A;  1JJ2 A;  2JA7 H;  5LMN W;  3MXU A;  4HCE A;  4NDX A;  3J81 c;  2WV6 D;  1PTO C;  3E3X A;  3KLR A;  4RAU C;  1X65 A;  2EYO A;  4UP8 A;  4LF9 Q;  1ZKO A;  4ZYS A;  3GO5 A;  4KK7 A;  3S1N B;  4JYA Q;  1PTO D;  4KHP Q;  1KLU D;  2MFI A;  4OWX B;  4YY3 Q;  3QB3 A;  1FNU A;  4RHR A;  3H15 A;  1Y8N B;  3G7L A;  2ES2 A;  2EYJ A;  3H0G H;  5LL6 S;  2HQL A;  1NSN S;  5FLX c;  4LFB Q;  2UXB L;  4YIJ A;  3A5U A;  3S16 H;  1HZB A;  2WAQ E;  3CRK C;  4OL7 A;  3I55 A;  2YYZ A;  3I73 A;  4HCS A;  2EE1 A;  4JBW A;  1PHJ A;  4B3T L;  3ITP A;  4CKE A;  3NEM A;  2JP1 A;  4KHZ A;  2HIX A;  4C2M H;  3KLW A;  2ZXR A;  1ONL A;  2BH8 A;  1VQ9 A;  5M5X B;  3HOX B;  1PTO B;  2VUM G;  3S15 H;  1B53 A;  1DD2 A;  1BKB A;  1XPU A;  1MHW C;  2CW0 D;  1KL9 A;  4A3E B;  2WIN B;  3ZJY C;  3NBH B;  2PNH A;  4LF9 L;  4QJF A;  3KF8 A;  2OEO A;  2K5V A;  1IHZ A;  4JCV E;  2MHV A;  1EY9 A;  4KHP L;  4YY3 L;  1VF5 C;  4XQJ A;  1V43 A;  4K0K Q;  3K8A A;  3ER0 A;  4OWW B;  2Z1C A;  5D3D A;  4KY5 A;  4LFB L;  3EN2 A;  1FVI A;  3G6J B;  3HP3 A;  2F0J A;  3MXP A;  2G9H D;  3RN2 A;  5IGF A;  1LAB A;  1QE6 A;  1SJH D;  2ZJP A;  5ISR A;  4DAM A;  1SYF A;  2BCO A;  2XWJ B;  3PUX A;  5FK9 C;  2Q2I A;  3J7A F;  1LTT D;  3TQY A;  2MO1 A;  2CH4 W;  1JIC A;  1LM0 A;  4NXN Q;  1VQB A;  1IBM Q;  4C2M B;  5JJL A;  3M4Y A;  2F0S A;  1S4Z A;  3S15 B;  1GUN A;  1G51 A;  1M90 C;  2F0D A;  1C7Y A;  4X6A H;  4K0K L;  1XTC D;  3W1B A;  3S14 H;  4FO2 A;  3LGJ A;  1BQQ T;  5IP9 H;  5FO7 B;  5KND A;  1C0A A;  3DWP A;  2VXW A;  2K4K A;  4YWL A;  1Q8K A;  1CK1 A;  5L37 A;  3R2T A;  3HFZ B;  2HD3 A;  1RCV D;  4ZAI A;  1VQ8 A;  4AQY L;  2H5X A;  3CKI B;  3BU2 A;  3NBH A;  2OCE A;  5JVH 3;  5KNB A;  3HOY H;  3CCR A;  1X54 A;  4JI5 Q;  4JK1 C;  1J5E Q;  5HY6 A;  2N88 A;  4NXN L;  3T1H L;  5ELN A;  4XQN A;  1IBM L;  2XNA C;  4JBM A;  5NUC A;  3J81 E;  2MGS A;  4ULL A;  1MSG A;  3D3R A;  1KIX A;  1CA6 A;  1LTG D;  1XJV A;  2EYH A;  1MBY A;  3Q0A A;  1NBW A;  3K59 A;  1STH A;  5J1Z A;  5CBE E;  1N34 Q;  4KTA A;  3AFQ A;  1AP0 A;  1UUP A;  3S14 B;  1G91 A;  1O78 A;  1F9R A;  4EQ5 A;  4FF4 A;  1L2F A;  1QCB D;  5FLX E;  5DNF A;  1BVS A;  4JI0 Q;  3C1F A;  4N9P A;  2NZ1 D;  2R61 A;  3OIP A;  4EQO A;  2NVQ H;  4APV A;  5FLM G;  4A3B H;  2DN8 A;  2KUM A;  1CT1 D;  1XPR A;  3AFP A;  1VQ4 A;  4YHH L;  4DR4 Q;  4OON A;  3L2P A;  3HOY B;  4N9T A;  1CKO A;  1YNN C;  3OMG A;  4MTK A;  1HNW L;  1YNN D;  1A8V A;  2ZT9 C;  5ELD A;  2WKD A;  2JA6 B;  1PH8 A;  2MQH A;  1SYB A;  3GTK H;  1TWH H;  3NP8 A;  1OXV A;  3RNU A;  5AJ3 L;  4JI0 L;  2CHB D;  3ONA B;  1N36 L;  2EXZ A;  4L8J A;  1YJN A;  1UE1 A;  3HG9 A;  4OXP A;  4KI0 A;  2I5H A;  1CA5 A;  4GKJ Q;  5EPL A;  3VR4 A;  4DR3 Q;  4KV6 A;  5IYC H;  3T13 A;  3OTO Q;  4DR4 L;  2NVQ B;  4UHV A;  4A3B B;  2FMM A;  4MNO A;  2JA8 H;  2MJ8 A;  2F0Q A;  1J6Q A;  1PZI D;  2B3G A;  3JAM i;  1N32 Q;  3NWS A;  1ENA A;  4EX5 A;  1TWA H;  1Q46 A;  1QUQ B;  3H6M A;  4FF1 A;  1WD1 A;  1TS3 A;  1JB7 A;  2SEB D;  4JV5 Q;  1EZ8 A;  1XMQ Q;  1SMY C;  4B3M Q;  1PV4 A;  1L0W A;  4IJL A;  1SE3 A;  3WDN A;  3MHB A;  1SMY D;  1LAC A;  3DWQ A;  3S24 A;  2WII B;  2RBM A;  4L6T B;  3V05 A;  5A2Q E;  1O7L A;  1K8G A;  3HOU G;  3I56 A;  1F2Y A;  1SYC A;  3D4W A;  1TWH B;  3GTK B;  2ZTD A;  1AN8 A;  1PXU A;  4WRD A;  2A68 C;  4KN4 C;  3GTQ H;  3PV0 A;  2F0E A;  2BA1 A;  1PRT B;  2RDG A;  4GKJ L;  5IP7 G;  1UEB A;  5D65 A;  4DR3 L;  1STE A;  5JJZ A;  3OTO L;  4FXK C;  5JJK A;  2JJQ A;  3SK6 A;  3U4Z A;  1I4G A;  1W3S A;  2EVB A;  1STB A;  1QNK A;  4LF7 Q;  2D62 A;  1VQF A;  2JA8 B;  4IPD A;  2K5D A;  1GJX A;  4X62 Q;  4C3I H;  1SN8 A;  2N3S A;  3F2C A;  3N52 A;  4L5S A;  4JV5 L;  4RH6 A;  1XMQ L;  4LMQ D;  4B3M L;  1KDB A;  1TWA B;  2H1E A;  5AFW A;  2E2J H;  3EIV A;  4OWT B;  1G2T A;  1PMR A;  4X64 L;  3FKI G;  2RHQ B;  2RHS B;  3NXW A;  3DLL A;  1FGU A;  4F87 A;  3QJY A;  3CXC A;  4QIW B;  5COR A;  1Y1V B;  3AYH B;  4MIU A;  4K6D A;  3CMA A;  3NWT A;  1A0I A;  5CC4 A;  2Q8T A;  5I6Y A;  5ELO A;  1Y14 B;  5J22 A;  1QUQ A;  2CKZ B;  2WP8 J;  3KBX A;  3QOL A;  3GTQ B;  3KF6 A;  4L5Q A;  1I3Q H;  3J80 i;  3M4O B;  4IPC A;  1A63 A;  1JE5 A;  5I4D A;  4AYB E;  5FJ8 H;  5EJW A;  3M3Y H;  3RUZ A;  1Q81 C;  4J1M A;  1EQV A;  1R4Q B;  1ROD A;  2R93 G;  4C3H H;  3H3V I;  2IX3 A;  1D1K A;  2JA9 A;  4C3I B;  1DXM A;  1KTK A;  2WAQ G;  1DYQ A;  1MSH A;  3FVQ A;  1GUW A;  2A74 C;  2E2J B;  2G5D A;  1B70 B;  2B2U C;  3Q8D A;  3F2B A;  4NKL A;  1SNC A;  4JW0 A;  3MA2 B;  4OHJ A;  3A55 A;  2FIN B;  5T1I A;  1EY4 A;  2C35 B;  4RHS A;  1STN A;  2NTT A;  3NUC A;  5CV8 A;  3VYS A;  3SHL A;  2F0V A;  3P1H A;  3HOV G;  1KHI A;  3U9S A;  1ESR A;  1I3Q B;  3AQQ A;  1C4Q A;  3GP7 A;  3A0J A;  5I6W A;  2LXK A;  1BCP B;  3S1R H;  1EQQ A;  1SE2 A;  3M3Y B;  3L7Z C;  5C0X I;  1Q7Y C;  1NCV A;  4JC0 A;  3M85 A;  2WFW A;  4DV2 L;  4A3K G;  1JCK B;  4C3H B;  2Q8I B;  1JB3 A;  3U58 A;  1K83 B;  1RL2 A;  4JI8 L;  3GTP H;  4G7Z C;  2D0P A;  4BA1 I;  3CD6 A;  4GZY C;  5ELE A;  5KIX A;  4DUZ Q;  1GM5 A;  4J8Q A;  4FVM A;  4A3C H;  1PRT F;  3JAM L;  3FHW A;  4DV5 L;  4X3T A;  2EYP A;  2Y0S B;  4CKB A;  2KCM A;  4GN4 B;  5C3E G;  2A73 B;  4GLV B;  4IZ8 A;  1U9R A;  4QCL A;  1Y1W G;  1WTO A;  5E1F A;  5IYB H;  1VF7 A;  4HMI A;  4P2C B;  4OEM B;  5EBD A;  3SDZ A;  1GO3 E;  3S1R B;  2R7Z B;  4X66 Q;  4KY6 A;  1A62 A;  2DY7 A;  4IN3 A;  4A3I H;  5I2X A;  1QWY A;  2KBN A;  2YTV A;  1N8R C;  4IJH A;  4ALP A;  3BYY B;  3CPW A;  5DEH A;  5CV9 A;  4DUZ L;  3TEH B;  3GTP B;  3JC6 6;  1PDQ A;  3C1E A;  4ODG A;  4Q5V A;  1BOS A;  3CU7 A;  4DR2 Q;  1VQM A;  5BN3 A;  1P16 A;  2B2U A;  2KA7 A;  4LUV A;  3EQL C;  4HID A;  2CCZ A;  2UUA Q;  1WD0 A;  4DV7 Q;  5FO9 B;  2JE6 I;  5KGU A;  4DR1 Q;  5DM7 3;  1H9K A;  5C44 G;  3DHQ A;  3ICE A;  4IFD I;  1L1O B;  4X66 L;  2HHH Q;  4IOA A;  2O5J C;  3DMU A;  3DWA A;  5KEE A;  4MTN A;  2B2Y C;  5JEA H;  2JA5 H;  3K80 C;  2L9H A;  3I91 A;  2L11 A;  4K8J A;  3TSS A;  4A3I B;  3MEH A;  3I70 A;  1DJR D;  3D6W A;  1S5F D;  3G6E A;  2IHF A;  4DKA C;  1A2T A;  1A3T A;  1X56 A;  1OXT A;  4DNI A;  1VQC A;  3VR5 A;  1CTM A;  1VQK A;  3DUZ A;  4JBK A;  4A4I A;  3I8Z A;  2QCP X;  2UUA L;  3TME A;  2F0W A;  4DV7 L;  1G6P A;  2LY7 A;  2I46 A;  4DR1 L;  2IL8 A;  2F4I A;  4DXF A;  1SBB B;  2E74 C;  1BCP F;  2HHH L;  3IAY A;  5IGC A;  1FNV A;  3M7N A;  5GAG C;  2BH2 A;  3TP7 A;  2NN6 G;  5EGT A;  1KAB A;  2UXD Q;  2OF1 A;  4LAA A;  2VUM H;  1ILP A;  2AWN A;  3MXG A;  1H9R A;  1QNU A;  4RFB A;  5KNC A;  2RF4 A;  1SFO H;  4A3J G;  3PQI A;  1L1O A;  1X6O A;  3RLO A;  2VW9 A;  3RZD H;  2AMC B;  5F2D A;  4K6L A;  4KN7 C;  4DAP A;  5JPN C;  4A3D H;  2F0P A;  5GRO A;  1TS5 A;  2ZXP A;  4H13 C;  4RGT A;  2NVX H;  1RHP A;  1NJI C;  3BVM A;  2MNA A;  2RVL A;  1HNZ L;  5CR3 A;  1B3Q A;  4LNQ A;  2K04 A;  3HEJ A;  3LNN A;  1CHP D;  2H4O A;  1B9N A;  1PYB A;  3N6R A;  2UXD L;  2R6G A;  1OO9 B;  1E22 A;  2B39 A;  3K5L A;  4BXX G;  3RLN A;  3I7F A;  1CSP A;  1EL0 A;  4G4K A;  1WTV A;  1M8A A;  2NYZ D;  4G57 A;  1HTP A;  3ERQ A;  3MZ5 A;  3V96 A;  1DGS A;  3KFU A;  3BVZ A;  2VUM B;  4B3T Q;  2G9D A;  1HZ9 A;  2B2Y A;  2I5M X;  1LO5 D;  3TP8 A;  4CGY B;  1I4Q A;  4CKC A;  1SFO B;  4GS3 A;  1WVL A;  2QGQ A;  1YIT A;  1EUJ A;  1S5B D;  5JPM C;  2XRS D;  1YI2 A;  5IOD A;  1QZG A;  4LJZ C;  5BN5 A;  3BZD B;  2F52 A;  5EPJ A;  3RZD B;  2NUC A;  1D1I A;  4A3D B;  3U50 C;  3I4M G;  3BZK A;  4KJO A;  2F0N A;  1VMP A;  3OPO A;  2B2T C;  2NVX B;  2WB1 B;  2JEB I;  4TSS A;  1VQJ A;  2EIF A;  3UE0 A;  3J7A V;  3QG1 A;  2I0Q A;  1WFQ A;  1IXR A;  3KJO A;  2AQ2 B;  3MTS A;  2EQS A;  4DPG A;  4AYB G;  1AEX A;  2OQK A;  3H09 A;  2PYK A;  3SVM A;  2N78 A;  2A6E C;  1X3E A;  3Q23 A;  1K3B C;  1VCI A;  2B29 A;  4R4O A;  2A6E D;  3M4Q A;  3TBI B;  1O80 A;  2NN6 I;  3VA5 A;  2P5Z X;  2VZA A;  5C0X J;  3A74 A;  4FYD A;  4R8N A;  4O2D A;  2PQE A;  5FLM H;  5IOC A;  4R4C A;  1K0R A;  5IGE A;  4BA2 I;  1CZW A;  1Z6H A;  3GTJ B;  2KHJ A;  4HED A;  2ATW A;  4I7Z C;  3DXJ C;  4L63 B;  4HAE A;  1WTW A;  1EY8 A;  4DV4 L;  4XXE A;  4QIW E;  4XYO A;  1AFP A;  4AQY Q;  3OWE B;  4JOI C;  4BWG B;  5ELB A;  4ZCK A;  2LSS A;  3KJP A;  3EFX D;  2E2I H;  1A3U A;  4DFA A;  4RA8 A;  4KJN A;  3CRL C;  1FD7 D;  4PMC A;  3NE5 B;  3SK4 A;  1JMC A;  2O2L D;  1RTO A;  4QB4 A;  2EYM A;  3T1H Q;  4NXM L;  4Z9C B;  3PF4 A;  4A93 G;  5EKL A;  3W1G A;  1EWH A;  2YV5 A;  3K5N A;  1EY7 A;  1VQL A;  2K5N A;  4TQU S;  4BY1 G;  2OXP A;  4POG A;  1M1K C;  1SE8 A;  2N49 A;  3CP0 A;  4B3S L;  4OO1 H;  5C4X G;  4WJ3 M;  4Q0F A;  3VA7 A;  3PO2 H;  1HZC A;  1Y8O B;  2XWB B;  4R1J A;  3HOZ H;  1JOR A;  4PG3 A;  4A76 A;  1NY4 A;  1DOL A;  1E7Z A;  3PUW A;  2B63 H;  1AE3 A;  1VQD A;  2XIW A;  3IFD A;  1V1P B;  1KDA A;  2Q2H A;  4DXG A;  4WJ4 A;  2B2T A;  3HOX G;  2F0F A;  1GVP A;  4DK6 C;  2N8N A;  4AH6 A;  2EY2 A;  4A3E G;  2E5L Q;  4HIO A;  5HGT A;  3UDX A;  4YHH Q;  1LTB D;  1XTD A;  2JA7 G;  3H91 A;  1QJO A;  2E2I B;  1WCM H;  2L1B A;  2MUY A;  1HUN A;  2KJX A;  3OW7 A;  1EFW A;  1SLJ A;  4U68 A;  1S5D D;  3HKZ E;  1S72 A;  4IFD J;  3HOU H;  1HNW Q;  2JA6 H;  3MFY A;  1V1O A;  2K01 A;  1K8O A;  1KNE A;  3K57 A;  5H1S E;  4YWK A;  4QY7 A;  2PZW A;  2K52 A;  1IW7 C;  1ICW A;  2MP1 A;  4DK1 A;  5G3L F;  1I6V C;  3H0G G;  3J7Z C;  2RDF A;  1EU4 A;  3S2H H;  2RDH A;  3CAM A;  4ZQ3 A;  1IW7 D;  1ZEQ X;  2PW7 A;  2L5T A;  3FEW X;  3FRP B;  5I9P A;  5AJ3 Q;  3PO2 B;  4PMB A;  5BR8 Q;  2VB3 X;  1N36 Q;  3HOZ B;  2Z4I A;  2B63 B;  1E0B A;  4PZ7 A;  4BBR H;  4JI7 Q;  2E5L L;  4Y52 H;  1A2U A;  1ZYR C;  3DEO A;  2PCF B;  5E4X A;  1IKM A;  4LK1 C;  1N9W A;  3BYT B;  3ERO A;  2K5H A;  1TVX A;  4L5T A;  1WTR A;  4IUT A;  3FKI H;  1ZYR D;  1HFG A;  4FNF A;  5FO8 B;  1K8M A;  2DJG C;  3HKS A;  1WCM B;  1K8A C;  4JOI A;  3GTG H;  1EU3 A;  1B8A A;  1V1P A;  3OMC A;  4S3S A;  2J4X A;  3HOU B;  5IWA Q;  4YCV A;  1UE7 A;  3G71 A;  4QGU A;  1Y69 U;  2Z4H A;  1XX8 A;  1RF2 D;  5IY0 A;  3UE1 A;  1I4R A;  2HCC A;  4X3U A;  5BR8 L;  5M3F H;  1D5M C;  4I7A A;  4DV1 L;  3S2H B;  1QZH A;  1LV9 A;  2X6G A;  2D0O A;  2K33 A;  4ZRZ A;  4JI7 L;  1JQY D;  4POF A;  2IY5 B;  1II3 A;  1JWM D;  2R93 H;  1PRT C;  2AWO A;  2L12 A;  3WOE A;  4HIM A;  4DUY L;  4BBR B;  2DJF C;  2PMZ B;  3NTI A;  5C4H A;  1PRT D;  2X6L A;  4ABN A;  2L4N A;  1XYI A;  2O5I C;  2K5W A;  2AUJ D;  4GLA C;  3V2T A;  2KEC A;  3FKI B;  3QIA A;  5E4W C;  3EVQ A;  5IWA L;  1QVG A;  3M7G A;  3GTG B;  4N8X 1;  4B9X A;  5A35 A;  4XYQ A;  2RQX A;  3PSI A;  4X64 Q;  1Y1V H;  5KRU A;  1TXY A;  3HOV H;  4NP5 A;  2M9V A;  1EZ6 A;  3CHB D;  3D6C A;  2PNR C;  3T16 A;  5C0X G;  2EJF C;  2E2H H;  3G4S A;  3G48 A;  5M3F B;  1H9S B;  3M4O H;  3HOY G;  4JG2 A;  4HSV A;  3D0F A;  2A68 D;  4R4I A;  3CF5 A;  4IUU A;  3PCO B;  3NK9 A;  3E0E A;  3BVG A;  1A15 A;  4DN4 M;  4PV1 C;  4MHE A;  1ESF A;  1TS2 A;  4GNX C;  1NMF A;  2R93 B;  2K6A A;  1JE4 A;  1V8Q A;  4RKB A;  4MZ9 A;  1X3G A;  1JT8 A;  1E24 A;  1JWS D;  4CDC C;  2WAQ B;  1YJW A;  2BOS A;  1ICF B;  1IZ6 A;  4DK0 A;  4ZKC B;  3GTM H;  3IRB A;  3SK8 A;  3ZYY X;  2ASB A;  3NTH A;  1SNM A;  1PA6 A;  1E1O A;  4ZUJ A;  1S5E D;  5D14 A;  3S1Q H;  2XRQ D;  1B3A A;  5C3E H;  3TRZ A;  2WKC A;  1GHK A;  1D5Z C;  2PI2 A;  1Y1W H;  4JBJ A;  1Q1B A;  4YCU A;  2NZH A;  1BR9 A;  3HOV B;  5M3M G;  2ZM6 L;  1HQR D;  3X3N A;  1PH5 A;  2ID0 A;  2HCI A;  4GNX B;  4OGQ C;  1FYC A;  2E2H B;  5KYL A;  4K2K A;  1H95 A;  2EJM A;  4A3F H;  1K0S A;  2EY6 A;  2K5Q A;  2KEE A;  2KCT A;  1VMC A;  3VDY A;  5EKK A;  5IYD G;  4X65 Q;  4XQQ A;  1B7Y B;  4J15 A;  4WOR A;  3P7J A;  2HDL A;  4A3K B;  3T53 B;  1PH2 A;  3BG3 A;  3OIQ A;  1N33 Q;  1PH7 A;  3BDO A;  4FDB A;  1MD2 D;  4IO9 A;  1LTS D;  1WTH A;  1H9S A;  1BCP C;  1EY6 A;  1OXU A;  5CV7 A;  1K83 H;  4DV2 Q;  4RKL A;  4V0B A;  4H44 C;  5IGD A;  3GTM B;  4UDU C;  1TWF H;  3S17 H;  1BCP D;  4R4T A;  5TSS A;  4LF8 Q;  3A56 A;  4JI8 Q;  1HUM A;  3RMH A;  3S1Q B;  2A19 A;  2LS0 1;  1TY2 A;  3PO3 G;  4IFD G;  3J81 i;  3GV3 A;  5C3E B;  4IAL A;  3PIO 3;  1Y1W B;  4HJ8 A;  5IYC G;  1NNX A;  4CDD C;  4NMZ A;  5EAY A;  4DV5 Q;  2K14 A;  2JA8 G;  1U5K A;  1E3P A;  1PH4 A;  4X65 L;  4R4Q A;  1ENF A;  1EYG A;  5IT9 L;  4A3F B;  3PUV A;  1STA A;  3T1Y Q;  5K36 H;  1F2Z A;  1N33 L;  3KLS A;  3NTK A;  3BDC A;  5LMU L;  4IOC A;  2R7Z H;  4G7H C;  4HJ9 A;  3SGI A;  4BY7 G;  3VYU A;  4CJ1 B;  3ULL A;  4LFC Q;  3I4N H;  3HS0 C;  2M00 A;  4GNX A;  2WB1 E;  2K03 A;  4CJ2 C;  1SYG A;  3CCQ A;  1NE3 A;  4LF8 L;  3FDT A;  3CCM A;  3EJI A;  4O1N A;  1XWE A;  2YTY A;  2RSN A;  3TRE A;  1ML0 D;  3NPP A;  1ASZ A;  1TWF B;  3UDG A;  3S17 B;  4K5X A;  3CQZ H;  1NMG A;  5BN4 A;  1T5X D;  1O7Z A;  4GLX A;  4A3L G;  1UWV A;  2UU9 Q;  3HOW H;  3PUZ A;  2EY5 A;  1GUO A;  4O0A A;  4RGM A;  2IJ0 A;  4R9W A;  5CYU A;  4PQX A;  3T1Y L;  2OQ0 A;  4GOP C;  1WJJ A;  5IIF A;  2K28 A;  1EQT A;  4P71 A;  3ERS X;  1BXT A;  4H7B A;  4KKU A;  3NBI A;  1JOO A;  1LT3 D;  1WI5 A;  4LFC L;  4HJ5 A;  1UAP A;  1FGB D;  4A3J H;  3KDF B;  1L1O C;  3TS2 A;  1VQG A;  1J9O A;  4QUF A;  2R3Z A;  3I4N B;  3HZX A;  3K5O A;  3QOJ A;  3QWN A;  1S40 A;  1C48 A;  2VNU D;  2VB2 X;  2AKW B;  2EYL A;  4KLK A;  2QF7 A;  4XT3 B;  1HPC A;  5C3X A;  4XDX A;  5ELC A;  2VS1 A;  2UU9 L;  3HKZ G;  3F8T A;  3CQZ B;  1KD1 C;  2R92 G;  4GOP B;  4H0L C;  3VYT A;  1PFB A;  4QUC A;  4R8I A;  2WAC A;  4DV6 Q;  4TRD A;  3HOW B;  2F0G A;  3E6Z X;  1WTX A;  4BXX H;  2IX0 A;  2ZXO A;  4JI2 L;  4C3H G;  3K5M A;  4RCN A;  4BBS G;  4IUV A;  3TZD A;  4GKK L;  3RZO H;  2I07 B;  3R3O A;  1J8I A;  4IPH A;  3TP6 A;  1IBK L;  1VQ6 A;  1YHA A;  3KYH C;  2RA4 A;  1HR0 L;  1VQP A;  1AE2 A;  4A3J B;  3KOJ A;  4LWC A;  3J80 L;  1D5X C;  3S2D H;  2QEJ C;  5CMD A;  1HZA A;  1K3R A;  3E5S A;  5C3W A;  3E9I A;  3I4M H;  1KAW A;  2KHI A;  5JAV A;  3MXN B;  1X3P A;  1Q82 C;  3CME A;  1PH9 A;  1S3O A;  1SNP A;  4P72 A;  4DV6 L;  1CZG A;  1EY5 A;  4NW2 A;  3JAM c;  3K0X A;  3KDF A;  2NVY H;  3SK5 A;  4DR6 L;  3M4P A;  2EYF A;  3NHH A;  4L5R C;  4TVA B;  2EOT A;  4DA2 A;  5JVG 3;  2KED A;  1LUZ A;  3E0J A;  3CCS A;  2UXC Q;  1HNZ Q;  1IYJ B;  5HUR A;  2A8V A;  3J81 L;  2FHT A;  4QQB X;  2SNM A;  2F1M A;  2VY3 A;  3GD7 A;  2LXJ A;  4KY7 A;  3SXH A;  2UUB L;  3CCL A;  4DR5 L;  3R2I A;  3HGB A;  3RZO B;  4GOP A;  3CC4 A;  4OEL B;  2DY8 A;  4FXG C;  2QKI C;  3PGZ A;  1B44 D;  2UUC Q;  3CCE A;  1SAP A;  4AIM A;  2IW3 A;  1WTQ A;  3W3A A;  2IHE A;  5J39 A;  3W5O A;  3S2D B;  2L15 A;  3A8K E;  1SXT A;  1HNX Q;  5FLX L;  1IYV A;  1BBU A;  5EPK A;  3I4M B;  3GTL B;  2A6H C;  1PZJ D;  5IYB G;  1PFN A;  2DNE A;  1NR2 A;  2E76 C;  4OIJ A;  3DM3 A;  4A3M G;  2A6H D;  1NTG A;  4HMJ A;  1PH6 A;  4X3S A;  4YCW A;  2HT1 A;  3J81 j;  2NVY B;  5GAE C;  1MJE A;  2UXC L;  2F0H A;  3RN5 A;  4HJ7 A;  2QIL A;  1KAA A;  1ASY A;  4A3I G;  4LUO A;  1O7Y A;  3MXN A;  3HRZ C;  1HCZ A;  5C6A A;  3MAQ A;  4OIK A;  4DF7 A;  1LTR D;  4Y7N H;  1EEF D;  1QOH A;  4J6H A;  2UUC L;  1VQN A;  4F8M A;  1PFS A;  4A93 H;  5G3L D;  1CM9 A;  1HHV A;  1RTN A;  4K2L A;  4FXD A;  4I65 A;  1HNX L;  2ICE C;  1PYS B;  2AUK A;  3J80 c;  1RIP A;  1X3F A;  1RD9 D;  2M2L A;  2NZO A;  4KD3 A;  3TN2 A;  1VQH A;  3STB C;  4X3K A;  1X55 A;  4EQP A;  3DM1 A;  2NWG A;  1PYW D;  4RGO S;  2PI2 E;  3ND9 A;  2KHS A;  2PMZ E;  4C1N I;  3QO2 A;  3RLF A;  1XNR L;  1QVC A;  2F0T A;  2Z6B A;  3TS0 A;  1WYD A;  4ME5 A;  1EFI D;  1E1T A;  2EZV A;  5IGG A;  3GTJ H;  3CPF A;  4EVO A;  5JJI A;  1A3V A;  1T9H A;  4A3G G;  3OW2 A;  4PNY A;  3A7A B;  4B9W A;  1LYL A;  3C3L A;  2JA5 G;  1NR4 A;  3T56 B;  3VYR A;  1MKH A;  4LF6 L;  1WTP A;  3D4D A;  2KCN A;  4CHT B;  3WOF A;  1DM0 B;  1K9M C;  5FOB B;  4DV4 Q;  1AZP A;  1F9Q A;  4ZLT F;  5J3B A;  4Y7N B;  2OT2 A;  2R7F A;  2AQ1 B;  5A2Q L;  4A93 B;  3ULP A;  4C1N K;  3D31 A;  1W6J A;  3PIP 3;  3F1Z A;  2IWH A;  4BY1 B;  3MC0 B;  3NSW A;  5M9O A;  1I94 Q;  3JAM E;  2F3V A;  4ZUI A;  1KRT A;  2YTX A;  1EYC A;  4WFN 3;  5C4X B;  4NXM Q;  1F9S A;  4K5V A;  4IUN A;  3QR8 A;  1K73 C;  4C3J G;  1SRU A;  3T51 B;  3I4L A;  3UDI A;  3URY A;  1IL2 A;  4B3S Q;  2JQO A;  4FP5 D;  1JOK A;  2CW0 C;  4XT1 B;  3TZU A;  1CQF A;  2A69 C;  2GA4 B;  4UAI A;  2F0K A;  5E7N A;  2JA7 B;  2GVB A;  5C4J H;  2SDF A;  2ZTE A;  2A69 D;  4RWS C;  3A54 A;  4DNR B;  5GAD C;  2VQF Q;  4JYA L;  1VQE A;  4LF4 Q;  3OOC A;  3NQT A;  1E2Z A;  1Q12 A;  2FJ2 A;  4A3D G;  2QA4 A;  1JJC B;  5KYI A;  2RCF A;  1KC8 C;  3TP5 A;  1I94 L;  2PO4 A;  3VR6 A;  1CSQ A;  1YEZ A;  1KDC A;  1I4P A;  2Z9H A;  2WB1 G;  3FP9 A;  3H0G B;  1HRJ A;  4GN5 A;  1SRO A;  3A8J E;  2TSS A;  1TWC H;  5LMN Q;  1U4L A;  3H3V H;  3S16 B;  4P75 A;  1B1Z A;  1QIL A;  5C5L A;  2JEA I;  3LWU A;  1GKH A;  2KEN A;  3F2D A;  3WWV A;  2HIV A;  2NB0 A;  5IGB A;  1STY A;  2RKS A;  2E8G A;  4A75 A;  2QEX A;  1CFM A;  2GN5 A;  2PZT A;  1LLR D;  3H3V C;  1SR3 A;  1TU2 B;  4K5W A;  1EEI D;  1ZXT A;  2F0U A;  5HGQ A;  4LF4 L;  1C9O A;  1RDP D;  3A5Z B;  1FL0 A;  1H9M A;  2VQF L;  4LUZ A;  2B2V C; 
#chains in the Genus database with same CATH homology
 3J80 E;  5C4J B;  2K1B A;  2K32 A;  1LT5 D;  5CV4 A;  2B8G A;  1BUV T;  1MI2 A;  2HUG A;  3I3C A;  3OSO A;  3KLS X;  1U4P A;  3H94 A;  2Q8R E;  4O42 A;  2D5D A;  5C0X H;  3NQI A;  2C9O A;  2E75 C;  1HA5 A;  4K8I A;  4EGV A;  1TWC B;  1JWU D;  4QMG A;  1XXG A;  4HN7 A;  5I2Y A;  5E3F A;  4G7O C;  1SDF A;  2K7V A;  2F0I A;  1M4V A;  2EJG C;  2NTS A;  1ENC A;  3ND8 A;  1TKW B;  5CBA E;  3SEB A;  3DEP A;  4XIG S;  2F0M A;  1TS4 A;  4KD4 A;  1CQV A;  2E2D C;  1NUC A;  1LTA D;  4HSP A;  5COY A;  1NAP A;  2LKV A;  1I6H B;  2XVS A;  2BDN A;  4KHV A;  3S9W A;  3Q24 A;  5CV5 A;  2KVM A;  1PTO F;  1FR3 A;  2EPB A;  2CVR A;  2N55 A;  1EYD A;  1EIH A;  3PUY A;  1D6E C;  1GXD C;  4V19 0;  1DCZ A;  5C4Z A;  1G29 1;  5M5Y B;  1T5E A;  2LMC B;  2ICI A;  3SE0 A;  2J0T D;  2NVT B;  1AZQ A;  5DM6 3;  1SE4 A;  2L55 A;  2D2C C;  4IFD H;  2B2V A;  4OO1 G;  3Q6S A;  2F3W A;  3I72 A;  4KKT A;  4XTC S;  3KK7 A;  1GUT A;  3C46 A;  5M3M B;  3BDL A;  1TR5 A;  2IT1 A;  3GQB A;  1HFN A;  1G6Z A;  4ZKB B;  5LL6 X;  1I50 B;  5DAU A;  3AB9 A;  4DNT B;  1F9P A;  1CI3 M;  3MFG A;  1CHQ D;  1IKL A;  3OWF A;  1Z7T A;  3MVV A;  4DU9 A;  1D2B A;  1F2L A;  1TT2 A;  1AW7 A;  1SNQ A;  1KNA A;  5CV6 A;  4RGN A;  3K58 A;  3PO3 B;  1UEA B;  2Z8L A;  1Q1E A;  1R4P B;  1GUS A;  2C5C A;  1EY0 A;  1G8Z D;  1EIG A;  5C5M A;  3TDQ A;  2EDG A;  1W6K A;  1L0X B;  2K05 A;  1UNS A;  2KOL A;  1FNW A;  3OHX C;  4BY7 B;  4CJ0 B;  2FMC A;  1C8C A;  4IUR A;  4DAY A;  3AU7 A;  1EWC A;  5CGK A;  2NBF A;  1OXS C;  1SYE A;  2BDO A;  2XN9 C;  5LHY 1;  2AQ3 B;  1IYU A;  1BDO A;  1HA6 A;  2PW5 A;  2IX1 A;  1B4O A;  4K14 A;  1S5C D;  1DOK A;  3J7Y W;  1QG7 A;  4OO1 I;  4PMW A;  1L0Y B;  1F2M A;  3T4A C;  1Q3L A;  2SOB A;  5EKI A;  5K5P A;  1TY0 A;  1JOQ A;  1TII D;  1U4M A;  1X3Q A;  4B08 A;  4HR7 B;  1BO0 A;  2ENB A;  3IFT A;  3KBG A;  2JXM B;  2O4X A;  1GUG A;  3HKZ B;  3A8I E;  4ILW A;  2R92 B;  1U4R A;  2PZU A;  4IUP A;  3K7A B;  4QF4 A;  3P20 A;  5JEA J;  2KCC A;  5M5W B;  5C44 B;  4BBS B;  4M8A A;  2RSO A;  2NN6 H;  2A5H A;  3W2D A;  1SND A;  4C3I G;  1ET9 A;  4BS9 A;  1X32 A;  2EY1 A;  1JC7 A;  1E2V A;  2MPM A;  2B8F A;  3FMC A;  2IPK D;  3IL8 A;  1ILQ A;  3LWE A;  1SYD A;  4TKO B;  1BNZ A;  1PLF A;  3L9A X;  2DNC A;  2FFK B;  3D4R A;  3KUP A;  3F2U A;  2BE5 C;  1TQO A;  4WJW A;  1Z47 A;  3PMF A;  4DGZ A;  3K0Y A;  2BE5 D;  3K6O A;  1R9T B;  3LX0 A;  5ELF A;  1HTL D;  1RJT A;  3A7L A;  2B2W C;  3VR3 A;  1Q90 A;  3IKJ A;  1LTI D;  5JOB A;  3I90 A;  1A6X A;  1F77 A;  3D8G A;  2CQA A;  1HXY D;  4EQN A;  4DAV A;  2J7Z A;  5T1G A;  3L3O C;  1EOT A;  1KLG D;  3C2P A;  4F7X A;  2JYO A;  3UI2 A;  2F03 A;  3GTO B;  1Q8I A;  4A3M B;  4IUQ A;  1JR0 D;  1GHJ A;  5K36 G;  2JSO A;  3VR2 A;  1MGS A;  1TWG B;  3BS1 A;  4KKS A;  1DON A;  1LT4 D;  1B2T A;  1SSO A;  4FF2 A;  1B9M A;  1B50 A;  2TMP A;  3SR1 A;  3X3M A;  2X69 A;  3Q22 A;  1G2S A;  2QDB A;  1I4H A;  1DZ1 A;  1PZK D;  4IQZ A;  4RCO A;  1LT6 D;  1QB5 D;  2BA0 A;  1BF4 A;  4MN3 A;  5D3I B;  1YNJ C;  4C56 C;  2PPB C;  1GOZ A;  1YNJ D;  1Y8P B;  1RKN A;  4U67 3;  4ZK9 B;  3U9O A;  2V4D A;  4A3G B;  4KMU C;  3R93 A;  3R8B A;  1SEB D;  2JA5 B;  4M1U B;  1SNO A;  4F88 A;  4E6I A;  4FF3 A;  4ID6 A;  2L0C A;  2LFN A;  4HTH A;  1BBX C;  2SNS A;  5EBC A;  1SJE D;  4AYB B;  3AMU A;  3S1M B;  1DOM A;  2B2W A;  1PFM A;  1IL8 A;  1ET6 A;  5EQ0 A;  3FPP A;  2YU9 B;  2HQE A;  3EA6 A;  3O13 A;  1H9J A;  4C3J B;  1VDZ A;  3FPU B;  2HDM A;  2KQ3 A;  5FKA C;  2D9U A;  5I9O A;  2XSC A;  3P75 A;  1STG A;  1HQM C;  1EYA A;  5IT9 E;  4CBV A;  3MWY W;  2F0O A;  2F0L A;  1PTO H;  5JEA G;  1OXX K;  3RD4 A;  1I4X A;  1E2W A;  3GV6 A;  3MXU A;  4HCE A;  4NDX A;  2WV6 D;  1PTO C;  3KLR A;  4RAU C;  2EYO A;  1ZKO A;  4ZYS A;  3GO5 A;  4KK7 A;  3S1N B;  1PTO D;  1KLU D;  3QB3 A;  1FNU A;  4RHR A;  1Y8N B;  3G7L A;  2EYJ A;  5LL6 S;  1NSN S;  4YIJ A;  4OL7 A;  3CRK C;  2YYZ A;  3I73 A;  4HCS A;  2EE1 A;  4JBW A;  3ITP A;  4CKE A;  2JP1 A;  4KHZ A;  2ZXR A;  1ONL A;  5M5X B;  3HOX B;  1PTO B;  1B53 A;  1DD2 A;  2CW0 D;  4A3E B;  2WIN B;  3KF8 A;  2OEO A;  1IHZ A;  2MHV A;  1EY9 A;  1VF5 C;  4XQJ A;  1V43 A;  2Z1C A;  5D3D A;  4KY5 A;  3G6J B;  3HP3 A;  2F0J A;  3MXP A;  2G9H D;  5IGF A;  1LAB A;  1QE6 A;  1SJH D;  5ISR A;  1SYF A;  2BCO A;  2XWJ B;  3PUX A;  5FK9 C;  3J7A F;  1LTT D;  1JIC A;  4C2M B;  3M4Y A;  2F0S A;  1S4Z A;  3S15 B;  1GUN A;  2F0D A;  1XTC D;  4FO2 A;  1BQQ T;  5FO7 B;  5KND A;  3DWP A;  2VXW A;  1CK1 A;  3R2T A;  1RCV D;  4ZAI A;  3CKI B;  3NBH A;  5JVH 3;  5KNB A;  4JK1 C;  2N88 A;  4XQN A;  2XNA C;  5NUC A;  3J81 E;  2MGS A;  4ULL A;  1MSG A;  3D3R A;  1CA6 A;  1LTG D;  2EYH A;  1MBY A;  3Q0A A;  3K59 A;  1STH A;  5J1Z A;  5CBE E;  4KTA A;  1AP0 A;  1UUP A;  3S14 B;  1G91 A;  1O78 A;  1F9R A;  4FF4 A;  1QCB D;  5FLX E;  5DNF A;  3C1F A;  4N9P A;  2NZ1 D;  2R61 A;  3OIP A;  4EQO A;  2DN8 A;  2KUM A;  1CT1 D;  3HOY B;  4N9T A;  1YNN C;  3OMG A;  1YNN D;  2ZT9 C;  5ELD A;  2WKD A;  2JA6 B;  1SYB A;  3NP8 A;  1OXV A;  2CHB D;  3ONA B;  2EXZ A;  4L8J A;  3HG9 A;  4KI0 A;  1CA5 A;  5EPL A;  3VR4 A;  4KV6 A;  3T13 A;  2NVQ B;  4A3B B;  2FMM A;  2MJ8 A;  2F0Q A;  1PZI D;  3NWS A;  1ENA A;  3H6M A;  4FF1 A;  1WD1 A;  1TS3 A;  2SEB D;  1EZ8 A;  1SMY C;  1SE3 A;  3WDN A;  3MHB A;  1SMY D;  1LAC A;  3DWQ A;  2WII B;  2RBM A;  4L6T B;  3V05 A;  5A2Q E;  1O7L A;  1F2Y A;  1SYC A;  3D4W A;  1TWH B;  3GTK B;  1AN8 A;  1PXU A;  4WRD A;  2A68 C;  4KN4 C;  3PV0 A;  2F0E A;  2BA1 A;  1PRT B;  2RDG A;  5D65 A;  1STE A;  5JJZ A;  4FXK C;  3SK6 A;  1I4G A;  2EVB A;  1STB A;  1QNK A;  2D62 A;  2JA8 B;  1GJX A;  2K5D A;  3N52 A;  4RH6 A;  4LMQ D;  1KDB A;  1TWA B;  2H1E A;  5AFW A;  1G2T A;  1PMR A;  3NXW A;  4F87 A;  3QJY A;  5COR A;  4QIW B;  1Y1V B;  4MIU A;  4K6D A;  3NWT A;  5CC4 A;  2Q8T A;  5I6Y A;  5J22 A;  2WP8 J;  3KBX A;  3QOL A;  3GTQ B;  3M4O B;  5I4D A;  5EJW A;  3RUZ A;  4J1M A;  1EQV A;  1R4Q B;  1ROD A;  2IX3 A;  1D1K A;  4C3I B;  1DXM A;  1KTK A;  1DYQ A;  1MSH A;  3FVQ A;  1GUW A;  2A74 C;  2E2J B;  2B2U C;  4NKL A;  1SNC A;  3MA2 B;  4OHJ A;  3A55 A;  2FIN B;  5T1I A;  1EY4 A;  4RHS A;  1STN A;  2NTT A;  3NUC A;  5CV8 A;  3VYS A;  3SHL A;  2F0V A;  3P1H A;  3U9S A;  1ESR A;  1I3Q B;  1C4Q A;  3GP7 A;  5I6W A;  1BCP B;  1SE2 A;  3M3Y B;  3L7Z C;  5C0X I;  1NCV A;  3M85 A;  1JCK B;  4C3H B;  2Q8I B;  1JB3 A;  1K83 B;  4G7Z C;  4BA1 I;  4GZY C;  5ELE A;  5KIX A;  4J8Q A;  4FVM A;  1PRT F;  3JAM L;  4X3T A;  2EYP A;  2Y0S B;  4CKB A;  2A73 B;  4IZ8 A;  1U9R A;  4QCL A;  1WTO A;  5E1F A;  1VF7 A;  4HMI A;  4P2C B;  5EBD A;  3SDZ A;  3S1R B;  2R7Z B;  4KY6 A;  2DY7 A;  4IN3 A;  5I2X A;  1QWY A;  3BYY B;  5DEH A;  5CV9 A;  3GTP B;  1PDQ A;  3C1E A;  4ODG A;  4Q5V A;  1BOS A;  3CU7 A;  5BN3 A;  2B2U A;  2KA7 A;  3EQL C;  1WD0 A;  5FO9 B;  2JE6 I;  5KGU A;  5DM7 3;  1H9K A;  3DHQ A;  4IFD I;  2O5J C;  3DMU A;  3DWA A;  5KEE A;  2B2Y C;  5JEA H;  2L9H A;  3I91 A;  2L11 A;  4K8J A;  3TSS A;  4A3I B;  3MEH A;  3I70 A;  1DJR D;  3D6W A;  1S5F D;  1A2T A;  1A3T A;  1OXT A;  3VR5 A;  1CTM A;  3DUZ A;  3I8Z A;  2QCP X;  3TME A;  2F0W A;  2LY7 A;  2I46 A;  2IL8 A;  2F4I A;  4DXF A;  1SBB B;  2E74 C;  1BCP F;  3IAY A;  5IGC A;  1FNV A;  3M7N A;  3TP7 A;  2NN6 G;  5EGT A;  1KAB A;  2OF1 A;  4LAA A;  1ILP A;  2AWN A;  3MXG A;  1H9R A;  1QNU A;  4RFB A;  5KNC A;  5F2D A;  4DAP A;  4K6L A;  4KN7 C;  5JPN C;  2F0P A;  1TS5 A;  2ZXP A;  4H13 C;  4RGT A;  1RHP A;  3BVM A;  2RVL A;  5CR3 A;  2K04 A;  3HEJ A;  3LNN A;  1CHP D;  2H4O A;  1B9N A;  3N6R A;  2R6G A;  1OO9 B;  2B39 A;  3K5L A;  1EL0 A;  4G4K A;  1WTV A;  1M8A A;  2NYZ D;  4G57 A;  1HTP A;  3ERQ A;  3MZ5 A;  3V96 A;  3BVZ A;  2VUM B;  2G9D A;  2B2Y A;  3TP8 A;  1LO5 D;  4CGY B;  4CKC A;  1I4Q A;  1SFO B;  1WVL A;  1S5B D;  5JPM C;  2XRS D;  5IOD A;  4LJZ C;  5BN5 A;  3BZD B;  5EPJ A;  3RZD B;  2NUC A;  1D1I A;  4A3D B;  4KJO A;  2F0N A;  1VMP A;  3OPO A;  2B2T C;  2NVX B;  2WB1 B;  2JEB I;  4TSS A;  3J7A V;  3QG1 A;  2AQ2 B;  3MTS A;  1AEX A;  3H09 A;  2PYK A;  3SVM A;  2A6E C;  3Q23 A;  1VCI A;  2A6E D;  3TBI B;  1O80 A;  2NN6 I;  3VA5 A;  5C0X J;  4FYD A;  4R8N A;  2PQE A;  5IOC A;  4BA2 I;  5IGE A;  1CZW A;  1Z6H A;  3GTJ B;  4HED A;  4I7Z C;  3DXJ C;  4L63 B;  4HAE A;  1WTW A;  1EY8 A;  4XXE A;  4XYO A;  1AFP A;  3OWE B;  4BWG B;  5ELB A;  3EFX D;  1A3U A;  4DFA A;  4RA8 A;  4KJN A;  3CRL C;  1FD7 D;  4PMC A;  3NE5 B;  3SK4 A;  2O2L D;  1RTO A;  4QB4 A;  2EYM A;  4Z9C B;  5EKL A;  1EWH A;  3K5N A;  1EY7 A;  4TQU S;  2OXP A;  4OO1 H;  4Q0F A;  3VA7 A;  1Y8O B;  2XWB B;  1JOR A;  1DOL A;  3PUW A;  2XIW A;  3IFD A;  1V1P B;  1KDA A;  4DXG A;  2B2T A;  2F0F A;  2EY2 A;  5HGT A;  1LTB D;  3H91 A;  1QJO A;  2E2I B;  2L1B A;  2MUY A;  1HUN A;  2KJX A;  3OW7 A;  4U68 A;  1S5D D;  4IFD J;  3MFY A;  1V1O A;  2K01 A;  1K8O A;  1KNE A;  3K57 A;  2PZW A;  1IW7 C;  1ICW A;  2MP1 A;  4DK1 A;  5G3L F;  1I6V C;  2RDF A;  1EU4 A;  2RDH A;  4ZQ3 A;  1IW7 D;  1ZEQ X;  2PW7 A;  2L5T A;  3FEW X;  5I9P A;  3FRP B;  3PO2 B;  4PMB A;  2VB3 X;  3HOZ B;  2Z4I A;  2B63 B;  1E0B A;  1A2U A;  1ZYR C;  3DEO A;  2PCF B;  5E4X A;  1IKM A;  4LK1 C;  3ERO A;  3BYT B;  1TVX A;  1WTR A;  4IUT A;  1ZYR D;  1HFG A;  4FNF A;  5FO8 B;  1K8M A;  1WCM B;  1EU3 A;  1V1P A;  3OMC A;  4S3S A;  2J4X A;  3HOU B;  1Y69 U;  2Z4H A;  1XX8 A;  1RF2 D;  1I4R A;  2HCC A;  4X3U A;  1D5M C;  3S2H B;  1LV9 A;  2X6G A;  2K33 A;  4ZRZ A;  1JQY D;  1II3 A;  1JWM D;  1PRT C;  2AWO A;  2L12 A;  3WOE A;  4BBR B;  2PMZ B;  3NTI A;  5C4H A;  1PRT D;  2X6L A;  4ABN A;  2L4N A;  1XYI A;  2O5I C;  2K5W A;  2AUJ D;  3V2T A;  2KEC A;  3FKI B;  3QIA A;  5E4W C;  3EVQ A;  3M7G A;  3GTG B;  4B9X A;  5A35 A;  4XYQ A;  2RQX A;  5KRU A;  4NP5 A;  2M9V A;  1EZ6 A;  3CHB D;  3D6C A;  2PNR C;  3T16 A;  5C0X G;  2EJF C;  5M3F B;  1H9S B;  4HSV A;  2A68 D;  4IUU A;  3NK9 A;  3BVG A;  1A15 A;  4DN4 M;  4PV1 C;  4MHE A;  1ESF A;  1TS2 A;  2R93 B;  2K6A A;  1JE4 A;  1V8Q A;  4RKB A;  1JWS D;  2WAQ B;  2BOS A;  4DK0 A;  4ZKC B;  3SK8 A;  3ZYY X;  3NTH A;  1SNM A;  4ZUJ A;  1S5E D;  5D14 A;  2XRQ D;  1B3A A;  2WKC A;  1GHK A;  1D5Z C;  1Q1B A;  1BR9 A;  3HOV B;  1HQR D;  3X3N A;  2ID0 A;  2HCI A;  4OGQ C;  1FYC A;  2E2H B;  5KYL A;  4K2K A;  2EJM A;  2EY6 A;  2K5Q A;  2KEE A;  1VMC A;  5EKK A;  4XQQ A;  4WOR A;  3P7J A;  2HDL A;  4A3K B;  3T53 B;  3BG3 A;  3OIQ A;  3BDO A;  1MD2 D;  1LTS D;  1H9S A;  1BCP C;  1EY6 A;  1OXU A;  5CV7 A;  4RKL A;  4V0B A;  4H44 C;  5IGD A;  3GTM B;  4UDU C;  1BCP D;  5TSS A;  3A56 A;  1HUM A;  3RMH A;  3S1Q B;  2LS0 1;  1TY2 A;  4IFD G;  3GV3 A;  5C3E B;  4IAL A;  3PIO 3;  1Y1W B;  4NMZ A;  1ENF A;  5IT9 L;  4A3F B;  3PUV A;  1STA A;  5K36 H;  1F2Z A;  3KLS A;  3NTK A;  3BDC A;  4G7H C;  3VYU A;  4CJ1 B;  3HS0 C;  2M00 A;  2K03 A;  4CJ2 C;  1SYG A;  3FDT A;  3EJI A;  4O1N A;  1XWE A;  2RSN A;  1ML0 D;  3NPP A;  1TWF B;  3S17 B;  4K5X A;  5BN4 A;  1T5X D;  1O7Z A;  3PUZ A;  2EY5 A;  1GUO A;  4RGM A;  2IJ0 A;  4R9W A;  5CYU A;  4PQX A;  5IIF A;  2K28 A;  1EQT A;  1BXT A;  4H7B A;  4KKU A;  3NBI A;  1JOO A;  1LT3 D;  1UAP A;  1FGB D;  4QUF A;  1J9O A;  2R3Z A;  3I4N B;  3HZX A;  3K5O A;  3QOJ A;  3QWN A;  1C48 A;  2VNU D;  2VB2 X;  2EYL A;  2QF7 A;  4XT3 B;  1HPC A;  5C3X A;  4XDX A;  5ELC A;  3CQZ B;  4H0L C;  3VYT A;  1PFB A;  4QUC A;  4R8I A;  2WAC A;  4TRD A;  3HOW B;  2F0G A;  3E6Z X;  1WTX A;  2IX0 A;  2ZXO A;  4C3H G;  3K5M A;  4RCN A;  4IUV A;  3TZD A;  2I07 B;  3R3O A;  1J8I A;  3TP6 A;  2RA4 A;  4A3J B;  3J80 L;  1D5X C;  2QEJ C;  5CMD A;  3E5S A;  5C3W A;  5JAV A;  1X3P A;  1SNP A;  1CZG A;  1EY5 A;  4NW2 A;  3SK5 A;  2EYF A;  3NHH A;  2EOT A;  4DA2 A;  5JVG 3;  2KED A;  3E0J A;  5HUR A;  3J81 L;  2FHT A;  2SNM A;  2F1M A;  3GD7 A;  4KY7 A;  3SXH A;  3R2I A;  3HGB A;  3RZO B;  2DY8 A;  4FXG C;  2QKI C;  1B44 D;  1SAP A;  2IW3 A;  1WTQ A;  3W3A A;  5J39 A;  3S2D B;  3A8K E;  1SXT A;  5FLX L;  1IYV A;  5EPK A;  3I4M B;  3GTL B;  2A6H C;  1PZJ D;  1PFN A;  2DNE A;  1NR2 A;  2E76 C;  4OIJ A;  2A6H D;  4HMJ A;  4X3S A;  2NVY B;  2F0H A;  2QIL A;  1KAA A;  1O7Y A;  3MXN A;  3HRZ C;  1HCZ A;  5C6A A;  3MAQ A;  4OIK A;  4DF7 A;  1LTR D;  1EEF D;  1QOH A;  4J6H A;  4F8M A;  5G3L D;  1CM9 A;  1HHV A;  1RTN A;  4K2L A;  4FXD A;  4I65 A;  2ICE C;  2AUK A;  2M2L A;  1RD9 D;  4KD3 A;  3TN2 A;  4X3K A;  4EQP A;  3DM1 A;  2NWG A;  1PYW D;  4RGO S;  3ND9 A;  2KHS A;  4C1N I;  3QO2 A;  3RLF A;  2F0T A;  4ME5 A;  1EFI D;  2EZV A;  5IGG A;  4EVO A;  1A3V A;  4PNY A;  3A7A B;  4B9W A;  3C3L A;  1NR4 A;  3T56 B;  3VYR A;  1WTP A;  3D4D A;  2KCN A;  4CHT B;  3WOF A;  1DM0 B;  5FOB B;  1AZP A;  1F9Q A;  4ZLT F;  4Y7N B;  2OT2 A;  2AQ1 B;  5A2Q L;  4A93 B;  4C1N K;  3D31 A;  1W6J A;  3PIP 3;  2IWH A;  4BY1 B;  3MC0 B;  3NSW A;  5M9O A;  3JAM E;  2F3V A;  4ZUI A;  1EYC A;  4WFN 3;  5C4X B;  1F9S A;  4K5V A;  4IUN A;  4C3J G;  3T51 B;  3I4L A;  3URY A;  4FP5 D;  1JOK A;  2CW0 C;  4XT1 B;  3TZU A;  1CQF A;  2A69 C;  2GA4 B;  4UAI A;  2F0K A;  2JA7 B;  2SDF A;  2A69 D;  4RWS C;  3A54 A;  4DNR B;  3OOC A;  3NQT A;  1E2Z A;  1Q12 A;  2FJ2 A;  5KYI A;  3TP5 A;  2PO4 A;  3VR6 A;  1KDC A;  1I4P A;  3H0G B;  1HRJ A;  3A8J E;  2TSS A;  1U4L A;  3S16 B;  1B1Z A;  1QIL A;  5C5L A;  2JEA I;  3LWU A;  2NB0 A;  5IGB A;  1STY A;  2RKS A;  1CFM A;  2PZT A;  1LLR D;  3H3V C;  1TU2 B;  4K5W A;  1EEI D;  1ZXT A;  2F0U A;  1RDP D;  1H9M A;  2B2V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...