4HSVA

Crystal structure of cxcl4l1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
b'GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet factor 4 variant
publication title Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hsvA00
1HUMA 5D14A 2BDNA 2NWGA 2Q8TA 2K04A 2N55A 3D6WA 2FFKB 4UAIA 4OIJA 1WTVA 2K05A 2FMMA 2KVMA 2KEDA 2NZ1D 4NW2A 2B2WC 1RHPA 1WTOA 2KEEA 1EQTA 2KOLA 1HFNA 5EPKA 4RAUC 3HP3A 2JP1A 2FHTA 1F9RA 4RA8A 4HCSA 1PLFA 2CVRA 2HUGA 1WTRA 2FINB 2MJ8A 1RTOA 2B2VA 2Q8RE 2R3ZA 3MWYW 2L4NA 3MTSA 5EQ0A 4R8IA 5EPJA 2K1BA 4U68A 4IURA 5EPLA 1NR4A 3I91A 4O42A 4MN3A 5DNFA 2DY8A 1Q3LA 2HDMA 3DM1A 1AP0A 2EOTA 2J7ZA 5CBAE 1WD1A 1J9OA 1G6ZA 1B3AA 5CMDA 1ML0D 3ONAB 1KNEA 2K03A 3SVMA 1SAPA 1BNZA 2MP1A 1ICWA 4IUUA 4X3TA 3TZDA 1BO0A 1G91A 4HEDA 1KNAA 1CA5A 1WTPA 4LMQD 4ZLTF 3KBXA 1HRJA 2B2UC 2VXWA 4ZKBB 3QO2A 1TVXA 2XIWA 2B2TA 1G2TA 1HHVA 4QUFA 4HAEA 1A15A 1B4OA 2RSNA 1MSHA 2IL8A 3H91A 1PFMA 4IUVA 4CJ2C 1PDQA 3LWEA 3I90A 4RWSC 3N52A 2X6GA 2MGSA 4X3UA 2RVLA 4XDXA 5E4WC 1LV9A 1BF4A 5D65A 2EPBA 3TN2A 1NR2A 1XX8A 2L12A 4X3SA 2SDFA 2B2TC 2B2YA 1WTQA 2EE1A 2HCIA 1XYIA 1ZXTA 1AZPA 2RA4A 2K01A 1F9SA 1PFBA 1U4LA 5AFWA 2B2VC 1U4RA 1QNKA 4CJ1B 2RSOA 5CBEE 1EIHA 2L11A 3G7LA 4OIKA 2L9HA 5COYA 1EIGA 3I8ZA 1WVLA 1NCVA 2HDLA 3GV6A 1AZQA 3DEPA 1F2LA 3UI2A 1DONA 4IUTA 4ZAIA 3FPUB 1IKLA 2N88A 1DOLA 2D9UA 3FDTA 1HFGA 5EKIA 5T1GA 1C8CA 4IUPA 3KUPA 2K28A 1WTWA 2M2LA 2HCCA 1DOKA 4XT1B 1E0BA 4CJ0B 1X32A 1B53A 1F9QA 2KECA 1JICA 1WTXA 4QUCA 3P7JA 4XT3B 1HUNA 5JJZA 4IUQA 2H1EA 3F2UA 1F9PA 1ILPA 1U4PA 4X3KA 1CM9A 1B50A 4HSVA 1VMCA 3I3CA 1QG7A 2X6LA 5EJWA 3R93A 1GUWA 1U4MA 4R9WA 3IFDA 1MI2A 2X69A 1SSOA 1X3PA 4ZKCB 1S4ZA 1RTNA 2L1BA 5T1IA 1WD0A 1ILQA 1RJTA 1JE4A 1EOTA 1PFNA 1O7ZA 1M8AA 3DEOA 5CORA 1J8IA 4DN4M 2FJ2A 4ZK9B 1SDFA 2B2YC 1B2TA 1MGSA 1EL0A 1DOMA 1HA6A 1DZ1A 1O7YA 1MSGA 1ESRA 1NAPA 1O80A 1QE6A 2JYOA 3Q6SA 1RODA 2B2WA 2MPMA 4MHEA 1BBXC 1IL8A 2NYZD 1VMPA 2KUMA 3GV3A 3IL8A 2DY7A 1CA6A 2B2UA 5E4XA 1X3QA 1G2SA 1IKMA
chains in the Genus database with same CATH superfamily
3K5OA 4QB4A 1AFPA 2XWJB 3BS1A 5IYBG 2FMMA 1HFNA 1NJIC 1PYBA 1TY0A 4B3TL 2PPBC 4FXGC 2BDOA 3BJUA 3NELA 4JOIA 1QNUA 5I9OA 2E2HB 2CVRA 5C6AA 1GUGA 2ZJPA 1WTRA 1IBKL 4RH6A 2XWBB 1Y1VG 1X3GA 2GN5A 1XMQL 1KC8C 3FMCA 4LF4Q 4BY7G 2C9OA 1PRTC 4C2MH 1Q3LA 1D7QA 1JOKA 1AP0A 4NXMQ 4K5WA 1G6ZA 1J9OA 3S1MH 1B3AA 1GKHA 2NVYB 4FXDA 3H3VH 4QIWB 4JI0L 1SNDA 2JA7H 1QCBD 4AYBE 4P2CB 2VB3X 2R7ZB 1ESFA 3AQQA 1D2BA 1F2ZA 1ET9A 2I07B 2OQKA 4RKLA 4A3DG 4JI1Q 1HHVA 2R92H 2B2TA 1S5ED 4GLXA 3U4ZA 4RGTA 1K0SA 4R4TA 1QILA 2YTXA 2D62A 1W6JA 1D1KA 1AEXA 1STEA 1VQBA 2F0HA 1NR2A 2E8GA 3D4RA 3OWEB 2QEJC 3GQBA 3TN2A 4IFDG 3CF5A 4Z9CB 4AYBG 2IT1A 1N9WA 4ABNA 1S40A 1D5MC 1E3PA 1H9RA 1M90C 2CKZB 4R8NA 5IT9E 3KK7A 3VR4A 1XMOQ 1JE5A 5CV7A 1JCKB 2ASBA 2K33A 1K83B 4C3IG 1TWHB 3GTQH 1TWFB 4PG3A 1KTKA 1LTRD 3H3VC 3CCRA 3OTOQ 4JI3Q 5M9OA 3W2DA 3CHBD 2RDGA 3MFYA 3I3CA 4DR6Q 1JB3A 5CV4A 1QVCA 3PF5A 4KN4C 3GTMH 1YHAA 2K5QA 3PQIA 2L1BA 4EQNA 4DV5L 1SBBB 4C3JH 3KYHC 3U9SA 1GD7A 1FGUA 4KK7A 4JVZA 4DR2Q 3HOXB 2QA4A 3P1HA 3H09A 4A3EB 3NE5B 2F0QA 4GN4B 2EYMA 2NWGA 2K04A 1ENAA 1JOOA 2B63B 1N32L 3NP8A 1L0XB 1UNSA 1WTOA 4UDUC 3VA5A 1HNXL 1EQTA 1LM0A 5GAHC 3K7AB 3M4PA 2KHIA 2YU9H 3EROA 4L6TB 1VQNA 5HY6A 2HHHL 4A3KH 3NEMA 1LTAD 2L4NA 5M5YB 5EPJA 3VYTA 1EQVA 2BOSA 3EFXD 1VQJA 4BBRG 3HOZB 1EQQA 2HIXA 3L0OA 2ZJRA 4HTHA 2ZM6L 3K58A 1SJHD 3RNUA 1SAPA 4FF3A 2I5MX 4IFDJ 4HEDA 2VW9A 1Z47A 3QO2A 1QWYA 4LF4L 3OIQA 1XNRQ 4H7BA 4NXML 4DK1A 4LF7Q 1PFSA 2MGSA 5M3FH 5CV6A 3M3YH 1Y1WG 1Q86C 2SDFA 1W3SA 1UE7A 1JWMD 3H0GG 1JJCB 4A3GH 4A3IH 1TWGB 1Y14B 3GTGB 1PMRA 2PZWA 1U4LA 3CRLC 2H5XA 4GNXA 4Y52H 1I4GA 1GOZA 1LT5D 3H6MA 3GD7A 3LX0A 4NXNQ 1NCVA 1MJEA 4DV3L 3OMGA 2O4XA 4ZAIA 3W5OA 3BDCA 1N34Q 2E2HH 1H9MA 1LLRD 5M3MB 2K75A 1IW7C 4DR5L 5IYCH 1XMOL 3H3VI 4L63B 4KKSA 3UDFA 4B3SL 4BWGB 1B3QA 1GUWA 1LO5D 1PH4A 2TMPA 3BDLA 3PO2G 3S1QB 2I5LX 1WI5A 4H13C 4OL7A 1WCMB 2NVYH 4JI4Q 2R7ZH 4BA2I 2WAQG 3A5ZB 3SK6A 2FJ2A 3K6OA 4JI7L 2B2YC 4JV5L 1E1TA 2Z6KA 4IJHA 5ELFA 1O7YA 2WIIB 3CPFA 4DR6L 2EQSA 4BBSG 1EY4A 3MXUA 3CXCA 5GAGC 2Q8TA 1CHQD 2IPKD 2K32A 5FLXL 4DR4L 1JORA 5DAUA 4NW2A 2OF1A 3A7AB 2CQAA 5EPKA 5ISRA 5IWAL 4DR2L 3TSSA 2SOBA 5FO7B 1K83H 5JEAG 3PIO3 1TWHH 2HUGA 2FINB 4OWTB 2OTJA 1Y8NB 3VA7A 4R4CA 2B2VA 1TWFH 4IQZA 3MWYW 1U0LA 1U5KA 1IZ6A 2E2IB 1EFID 4R4QA 2ZT9C 2ALYB 1T5XD 2QDLA 4QMGA 3SK5A 5IGDA 5EBCA 1VQKA 2V1CC 1KXLA 1O7LA 2K03A 3F2DA 1PH5A 1B8AA 1CA5A 4RG1A 5LL6X 1YI2A 2K6AA 1VQEA 1BXTA 3NQTA 1R4PB 3LWUA 1VQAA 1A6XA 5KIXA 1JB7A 4LF6Q 1DYQA 3HOXH 1PH1A 1EY9A 1G8ZD 3ICEA 1YVCA 1KDCA 4A3EH 1V9PA 1XYIA 3PUVA 4RKBA 1XTCD 3QG1A 5IP7G 2B63H 1XNRL 1EY6A 2KA7A 4EQPA 3K7AH 2B8GA 4DPGA 3FDTA 1UE6A 1JOQA 4CKEA 5EKIA 5CGKA 2K28A 3DLLA 1NBWA 3D0FA 1B53A 4XT3B 4C3HB 1ILPA 5AJ3Q 4NXNL 4L5SA 2F0IA 3HOZH 4UP7A 4KHVA 3C46A 1TWAB 3RUZA 1N34L 1RTNA 1BBUA 1A3TA 4DU9A 1YNND 1DZ1A 2O5IC 4MHEA 5JEAJ 3IL8A 4A4IA 4X62Q 3K57A 2G5DA 2VS1A 2PO4A 2EYPA 2KHSA 4GNXB 5I6WA 4JI4L 1V8QA 4OIJA 5FLXc 2K05A 1MJCA 2K4KA 1TWGH 1AE2A 3GTGH 4JI6L 2AQ2B 2XRQD 4UP8A 2KOLA 5JPMC 4KI0A 1UEAB 3GDEA 1CKOA 2XSCA 4RA8A 3BZCA 4Y7NB 3I4NG 1PTOD 3IFTA 1E7ZA 5G3LF 3Q0AA 1EU3A 3K7UC 2BE5D 1PTOB 2EYLA 2SEBD 4JC0A 2YTYA 4OELB 1ENCA 1L0YB 5IGFA 4N9PA 5CBAE 1RD9D 2ATWA 4ZRZA 5CV5A 3BDOA 3J81j 2LMCB 1LUZA 1PVOA 3CCEA 3S1QH 4JBWA 4RCOA 1VQ6A 1WCMH 2OQ0A 4C1NI 4CDFC 1S5CD 1PH9A 4G4KA 2CCZA 1D5ZC 2A73B 3I4OA 3FPPA 4V0BA 2ICIA 2ZTEA 2PCFB 4JPBW 4ZUJA 1CKNA 4X64Q 4WJ4A 2O2LD 2EPBA 3C2PA 3E6ZX 4JOIC 2AUKA 3EA6A 3EIVA 5K5PA 3PIPA 1SYDA 2JJQA 1JJGA 1FYCA 4LFAQ 1PRTD 4S3SA 4EVOA 3L2PA 1IBML 1D5XC 3CP0A 2L11A 5M5WB 1PRTB 3JC66 3UE0A 1A0IA 1EUJA 4OHJA 4Q5VA 2ZXOA 2IJ0A 3ND9A 4MTNA 4OX9Q 1A3VA 2FMCA 1CSPA 3TQYA 4J1MA 1E1OA 3T13A 3N6RA 3S17B 1UE1A 2K7VA 2E2IH 4BXXG 1U4PA 2HQEA 3HS0C 5CC4A 1B50A 3RLFA 3C3LA 5IY0A 4DAMA 2F0JA 3FKIB 2AWNA 3IRBA 2YYZA 1XTDA 3CCUA 4FP5D 3PUWA 2JA6H 3PCOB 1A3UA 3QOLA 1CQVA 1DM0B 4QCLA 1JMCA 2N49A 2TSSA 4OEMB 3J7ZC 1VCIA 5AJ3L 5FJ8H 1T9HA 3J7YW 4QJFA 4G7HC 2PI2A 1FGBD 3TS0A 3PF4A 1CTMA 2MHVA 2A19A 2JSOA 1D6EC 1EYDA 2OXPA 4UAIA 2UUCQ 3TRZA 2KQ3A 3AFQA 2KVMA 4L5QA 1TR5A 2KEEA 5IP9H 4KY7A 1S5FD 4YCVA 5IT9L 2UXDQ 3QJYA 5KNDA 3G48A 4HJ8A 1BQQT 2QCPX 1EY8A 1TT2A 2DJGC 3RLNA 4X62L 3QR8A 2EXZA 5EPLA 4MN3A 1IBKQ 5KNBA 4C3HH 1A62A 1EY0A 3T53B 1UWVA 4G7OC 2KHJA 4LAAA 4HIDA 4FNFA 4BY7B 1TWAH 4A3MG 4EX5A 1WTPA 2Y0SE 4LMQD 4ZLTF 5HGQA 1B4OA 4KJNA 4JI0Q 1TWCB 5DM63 4K0KQ 1PDQA 1IYVA 3N52A 3F2BA 1G91A 1EWHA 3RLOA 3S1NB 4ME3A 5I6YA 2WACA 3K8AA 4H02A 1YNJD 1OXXK 2Y0SG 3KOJA 2RCFA 1KQSA 4OWXB 5GROA 1B44D 4G57A 4DAVA 3G7LA 4HJ9A 4AYBB 4RCNA 4X64L 1SE8A 2R6GA 3UI2A 4IUTA 2R93G 5C0XG 2D0PA 1C4QA 4DR3Q 4RMFA 3WDNA 1WTWA 2PW5A 3T16A 4C3IB 2VB2X 1E0BA 4LFAL 4GN5A 2KECA 1JICA 1EZ8A 2G9DA 3STBD 1PTOH 1I4RA 3VYUA 4LFCQ 3J80E 3KLRA 4J15A 2MFIA 2X69A 4IPHA 4DNIA 2A69D 1HZAA 5CYUA 5KYLA 1Y8PB 4ZKCB 3KBGA 1E24A 1YNNC 1ZEQX 1SYFA 4GNXC 4FF4A 3CC2A 3TP7A 1S72A 1XNQL 2EXDA 2GVBA 2F0NA 4PZ8A 3WWVA 2A8VA 2B29A 2GA4B 2UXBL 1STBA 1IL8A 4FO2A 1VMPA 1IW7D 2RCNA 1HZCA 3DEPA 1Y8OB 3FRPB 2BDNA 4ID6A 1FNUA 2NN6H 5C3EG 3EBEA 2DNCA 4K5VA 4XYOA 2UUAL 4IPCA 2J4XA 3CMEA 5IGGA 1PTOC 3R2IA 5IT9c 2CWPA 1WFQA 2VY3A 2LXKA 5M5WH 1PLFA 1LACA 1N32Q 1IYUA 2MJ8A 2BE5C 4K5XA 1RTOA 1HNXQ 2F4VQ 4OGQC 1SMXA 1SROA 4A3CG 3OMCA 3T4AC 2F0GA 1EIFA 2UUCL 3ZJYC 4A3JH 1K9MC 3S17H 4JBMA 1SXTA 2UXDL 2WKDA 3DMUA 3NQIA 3KLSA 2Z6KC 1CZGA 1JWUD 1ML0D 3SVMA 1H9JA 1X3EA 3FKIH 4X3TA 4IUUA 1AE3A 4MNOA 1KNAA 1RCVD 1SYGA 3VYSA 4DV1Q 4H0LC 4B9XA 4ZKBB 1VQCA 2DGYA 2XIWA 2ZM6Q 3HOVG 1MSHA 3WOEA 3HKZG 3L7ZC 2X6GA 2RVLA 3JAME 1Q8IA 4IALA 1XX8A 1SNQA 5C0XJ 1TS3A 5E7NA 2HQLA 4ZYSA 4EGVA 3NPPA 1PYSB 5A2QL 1O78A 1LT3D 5NUCA 1HTPA 4ALPA 2B2VC 1Y1WB 1PXUA 3H0GB 5COYA 2P5ZX 4K0KL 5CR3A 1W6KA 5J39A 2V4DA 3I70A 2JA8B 2EY5A 3GO5A 2ZTDA 2PQAA 1N36Q 3P20A 3SK4A 2OT2A 4LF5Q 3LGJA 5KRUA 2IW3A 5IYBH 5FK9C 2HCCA 4I7ZC 3TZUA 4LNQA 3CCSA 4HIKA 3OPOA 4DV3Q 2Z6BA 4KTAA 3P7JA 4A3BG 5BN5A 1QJOA 2C5CA 4O0AA 4R9WA 3J81E 4PNYA 2OWOA 4DR5Q 3S16B 5FOBB 1SSOA 3BG3A 3CD6A 4BY1G 4DR3L 1KDAA 4MTKA 1QVGA 4B3SQ 2PMZE 2OTLA 1J8IA 4NB3A 3BZDB 4FDBA 4BY7H 5I2XA 4PMWA 3E9IA 3GTPB 2XVSA 4DV0L 1VS0A 4A3LG 4LFCL 1TWCH 1TXYA 2WAQB 4KD4A 4JI7Q 4JV5Q 4YWKA 4NPSA 1PA6A 4IUNA 3MXGA 3S1NH 3SK8A 3U58A 2Q2HA 1V1OA 1SNPA 1YHQA 1HNWL 4X6AH 4BBSB 4XQNA 4NP5A 1HJPA 4TSSA 2PNRC 2AKWB 4LJZC 4IFDH 1I6VC 4DR4Q 2KCCA 2F0VA 5C44B 1G6PA 1I4HA 2R3ZA 1HXYD 3RZDB 5IWAQ 3S1RB 4UHVA 2QDBA 4C3IH 1XWEA 4N8X1 4RGMA 1N33L 3DM1A 3E5SA 1A63A 4G7ZC 1PV4A 2JEAI 2J7ZA 4IPDA 5LMNW 1TIID 1GUTA 1S3OA 1EFWA 3RN5A 1SYEA 3HOUG 2RHQB 2F4VL 1I50H 1EQRA 4M1UB 4A3FG 4WFN3 4LF8Q 1T5EA 1A15A 4FF2A 2KCNA 3I2ZA 1VQIA 4JK1C 4JI5Q 2NN6I 5D65A 5E1FA 2XNAC 1YNJC 5ELEA 4WJ3M 4YIJA 1ASYA 3PUXA 1ZXTA 4OO1G 4DV1L 1PFBA 5AFWA 1GUOA 2EZVA 1PH6A 2QILA 3CW2C 3SXHA 1QZHA 3S2HB 2EVBA 1HQMC 1I4PA 3CPWA 5LMNQ 2K14A 3B6YA 3L9AX 1CI3M 3MEFA 1GXDC 4A75A 5HGTA 1DOKA 2CWAA 4XT1B 3STBC 3K80C 3T1HL 1SE2A 4JCVE 3VR5A 3K81C 1VQLA 1QOHA 1D1IA 3OHXC 1ASZA 4CBVA 2A69C 1U4MA 4QIWE 3Q24A 3NENA 3AYHB 1N36L 1TQOA 3R2TA 4DUZL 4L5TA 4LF5L 2D2CC 3KF8A 1RJTA 2E2DC 2QF7A 4UY8C 2RF4A 2BH8A 3KJOA 4HJAA 1KD1C 4R1JA 3PO3G 1K0RA 1AN8A 2K52A 1KABA 3SEBA 2EDGA 3HKSA 1LT4D 3G6JB 4DNRB 3L3OC 2N55A 2O5JC 1R9TB 4JBKA 3EJIA 2QKIC 3CKIB 2RDHA 3E9HA 3HP3A 4LW1A 5C4XB 4ULLA 2PQAB 3Q23A 1Y1WH 2VL6A 4HCSA 3H0GH 3P75A 3VR3A 1K8OA 1B1ZA 1X3FA 5ELOA 4RHRA 4JI6Q 1IBLQ 2JA8H 2MO1A 2Q8RE 5FO8B 2L0CA 4GKKL 4IURA 3I4NB 1SMYD 2UU9L 3K0XA 3V96A 1CT1D 3AU7A 1ZKOA 2B8FA 2ZXRA 1Q1BA 2KCMA 3TREA 5IYDG 3S16H 3I4MG 1JT8A 3PIP3 2CFMA 2NB0A 3S9WA 1PTOF 4K6DA 1NTGA 3NWSA 4PQXA 1E2WA 1TS4A 1SE4A 1LTID 1OXUA 3H91A 3GTPH 3A54A 5DLQE 1L1OA 1JQYD 1D8LA 1O7IA 3HOYB 5IGBA 2CW0D 1HQRD 3IKJA 1WTQA 3PUYA 4NDXA 3BVMA 4DR1Q 4LF8L 4IFDI 1EIHA 2ZJQA 1M1KC 5GQOA 2JN4A 1IL2A 3I8ZA 4UP9A 1PH2A 3M4QA 4JI5L 4BBSH 4IZ8A 4JG2A 1VQ4A 2EYHA 1DONA 1IBMQ 2EYOA 5J1ZA 5FKAC 1BUVT 2LFNA 3QB3A 5C44H 4HJ5A 3R8BA 1SYBA 3Q22A 1GM5A 3RZDH 4GLVB 3S1RH 1EYCA 5JEAH 4NKLA 5F2DA 2RKSA 1PH3A 2I0QA 1PRTF 3RR5A 2DNEA 1K8MA 1S5DD 5LMNL 1X3PA 4OWWB 1MKHA 1S4ZA 5T1IA 5J22A 1EOTA 3DEOA 1FL0A 4ZK9B 3HRZC 2PQEA 3MXNA 1W2BA 1HA6A 2C35B 1MSGA 2JYOA 1O80A 5C5LA 1OXSC 1RODA 2F0FA 1SEBD 1NE3A 2OEOA 5BN4A 3HOWG 1L0WA 1LTLA 3OOCA 3K0YA 5M5YH 1BCPD 5D14A 1OO9B 3W3AA 2FFKB 3NWTA 4F87A 5EKKA 2K5HA 4DV6Q 2NZ1D 1RIPA 3E0EA 2NVTB 5K36G 1BCPB 4CGYB 2G9HD 3MZ5A 1BDOA 3S2HH 3G4SA 2NVXB 5E3FA 5IP7H 5JVG3 1L2FA 2B39A 4HIOA 4RGOS 2LS01 4K8IA 2M9VA 3A5UA 4WORA 4B3MQ 1GJXA 3KF8B 1KNEA 1F2YA 2K5DA 1VQ8A 4B3RL 2PZTA 1IBLL 5JAVA 1B7YB 3CMAA 5A35A 5ELDA 2KBNA 3K5NA 3Q8DA 1SR3A 4K14A 1K28A 2XTIA 4KY6A 2IL8A 4X3UA 4XDXA 5M5XB 2EJGC 4LUOA 5M3MH 3W1GA 3DUZA 2ENBA 2F0WA 5C4ZA 4QQBX 2J0TD 4I65A 3CRKC 1XXGA 1U4RA 2RSOA 1GHJA 2LY7A 2HDLA 3URYA 2Y0SB 3FP9A 3CU7A 1KLGD 5C4XH 3O13A 2D9UA 2AQ3B 4ZCKA 3LNNA 3C1FA 4OONA 4MZ9A 3KF6B 1SNOA 4DR1L 2RQXA 1VDZA 4L8JA 2R93B 2VNUD 1CM9A 3I4NH 2N78A 3R93A 4IOAA 3IFDA 1GUNA 1PZKD 4O2DA 1F2MA 1VQFA 4XYQA 3MFGA 4PV1C 5DEHA 3QWNA 3GTKB 2A1AA 1MGSA 2WB1E 4DK6C 4K2LA 3DWAA 2JA6G 2IHFA 2F0SA 4DV2Q 3A7LA 1L1OB 1EYGA 2Q2UA 1YJWA 1CA6A 1FJGQ 2RHSB 3PIOA 4RFBA 3VYRA 2F3VA 1XNQQ 5FJ8G 3HOYH 2F03A 1X6OA 3MA2B 3J7A5 3MXPA 1STYA 2UXBQ 2KEDA 2WB1G 2VUMG 4FF1A 4HIMA 1YJNA 1K8AC 2F3IA 2JA5G 2YTVA 5EKLA 1QZGA 4XTCS 4FYDA 4TKOB 2F4IA 1VQ9A 2JA9A 3MVVA 4C56C 2UUAQ 4O1NA 3AB9A 1WTHA 1SMYC 3U9OA 4TQUS 5EQ0A 4QF4A 4DV6L 1PH7A 3M9BA 3I91A 3RN2A 5FLXE 2HDMA 2DJFC 2FXQA 2NZHA 1A2TA 2BCOA 2NUCA 2EY2A 4PZ7A 2AQ1B 2EY1A 4DXGA 3MXNB 5L37A 3CAMA 4BXXH 3HG9A 1TVXA 4R4OA 3TEHB 1HTLD 2E76C 4JW0A 3S15B 2IWHA 2UXCQ 1NY4A 1PFMA 3I4LA 4CJ2C 2E5LL 4B3ML 4R4IA 5I9PA 1I4QA 2A6HD 2CW0C 3MC0B 3HOVB 4X3SA 4F88A 1E22A 1LYLA 3QOJA 3HKZB 5JJLA 2HCIA 4JYAQ 1Y1VB 1JC7A 4A93G 4CJ1B 4LUVA 1GVPA 4DV4Q 5I2YA 2E74C 2NVTH 1EIGA 2LKVA 3S24A 3TDQA 2RDFA 2N88A 3GTOB 1C8CA 4XQJA 1VF5C 3BZKA 1X65A 3KUPA 2NVXH 2CHBD 4A3DB 1CK1A 1QUQB 3ITPA 3M4YA 5EBDA 1VMCA 2X6LA 2I46A 1BKBA 2AMCB 2KENA 1G51A 3CQZB 1LTSD 4FVMA 4A3BB 3BVZA 2Q2TA 1ILQA 1KRSA 2AWOA 1VQOA 4KHPL 4PMCA 3EQLC 4DUYQ 4BY1B 4Y7NH 1HZ9A 1EWCA 4KJOA 2EY6A 1Q46A 1BBXC 2F0MA 1BCPC 5C3XA 3GV3A 4POFA 2JXMB 5M5XH 4DV0Q 2K5NA 4JI8Q 5FLMG 3JAMc 2SNSA 2HD3A 1K8GA 3AEVA 3D6WA 4DKAC 3TMEA 1HR0Q 2E2JB 1UEBA 4GN3B 1B70B 4HMIA 3F1ZA 4DV2L 4CDCC 1OXTA 2PMZB 2FHTA 3FEWX 4XXEA 2IX0A 4A76A 1FJGL 2NN6G 1YEZA 2IHEA 1S5BD 1HNWQ 1I3QB 2A5HA 1CSQA 2DUDA 1VQDA 3BVGA 1DCZA 1C48A 1XJVA 2QGQA 3D31A 3WOFA 3CCVA 2BA0A 1SYCA 3NBHA 2R93H 5C0XH 4GZYC 4J6HA 2R7DA 4KV6A 4J8QA 2MP1A 2Z4IA 4A3JG 1N33Q 1HH2P 3KBXA 3I7FA 4DK0A 1Z7TA 4UPAA 3FVQA 3GTKH 3FKIG 3HOUB 3BYTB 4QL5A 3VR6A 1KRTA 3GTLB 3LWEA 1BF4A 4A3FB 1KLUD 4LWCA 1HZBA 4KN7C 1I94L 4YY3Q 4PZ6A 3A55A 1V1QA 2K01A 1NUCA 2Z1CA 4RGNA 3J80i 5LMUL 1JWSD 2UXCL 1KAAA 3A8IE 4BBRB 1LTTD 4DR7L 2Z9HA 2GVAA 1VQGA 1TY2A 1DOLA 2F0UA 4DF7A 3BU2A 4V190 2F3WA 4WRDA 2MNAA 2JA7G 4GKJL 4JYAL 1F9QA 1FNWA 1NNXA 5D3IB 2R92G 4DV4L 1JR0D 1C7YA 4I7AA 5IE8A 4FXKC 3SDZA 3T1HQ 3OSOA 5C3WA 4K6LA 3A74A 1Z9FA 2Z8LA 4A3CH 3K5MA 2A74C 1L1OC 3HFZB 2B3GA 2SNMA 3PV0A 2PYKA 1C0AA 1EL0A 5JOBA 4DUZQ 3S15H 3VDYA 3D3RA 4B08A 2B2UA 4HJ7A 1X3QA 1G2SA 2KJXA 1SN8A 1HUMA 3HOVH 4YWLA 1WTVA 3MHBA 2CH4A 1Q82C 2WINB 5KGUA 4HMJA 3PO3B 1I4XA 1WOCA 3I55A 1Y1VH 4DUYL 1STHA 1TS2A 4RAUC 2F0LA 3S14B 2LXJA 1F9RA 1HNZQ 4P73A 1G291 3PO2B 4IJLA 3M4OB 1YITA 4JI8L 1SNCA 4AIMA 1YIJA 3GTOH 1EEFD 1IXRA 2K1BA 1RKNA 3SHLA 2MO0A 2Q8IB 1HR0L 4C3JG 1KL9A 4A3DH 3JAMi 1U9RA 1VQMA 3EVQA 3E0JA 4DV7Q 5CMDA 4GKKQ 2ZTCA 4P72A 1BNZA 1ICWA 3TZDA 3CQZH 2UU9Q 1X54A 1CUKA 4A3BH 1G2TA 4N9TA 1B9MA 1EIYB 2RSNA 1ICFB 4HCEA 1LTGD 2A6HC 3I4MB 1KHIA 3D6CA 2F0OA 4BY1H 3RZOB 2EJFC 2L12A 2VQFL 3EN2A 3NHHA 3F2CA 2E75C 1K3RA 3K5LA 1SFOB 4YCWA 4A3KG 2H4OA 4CKBA 4A3LH 2BH2A 1Q1EA 3J81i 4IO9A 2E2JH 2L9HA 3MEHA 3NSWA 1VQHA 4HSPA 5HURA 4K8JA 5TSSA 1KAWA 4EQ5A 4YY3L 5C0XI 1I3QH 1PZJD 3SE0A 3NBHB 2CQOA 3F2UA 1X9NA 2K5VA 3KJPA 3CCQA 1ONLA 1GUSA 4N8FA 5C4JB 1CHPD 2EYJA 5M3FG 2DN8A 4K2KA 4A3GG 4A3IG 2PI2E 1UUPA 4LUZA 1HCZA 1ENFA 4KMUC 2N3SA 3IAYA 1B9NA 3HOUH 2L15A 5J3BA 1FVIA 3GTLH 4DAYA 4NMZA 4A3FH 1TS5A 3BYYB 1GHKA 3MAQA 1VQ5A 1BBWA 5EAYA 2A68D 3HOWB 1OTCA 1SLJA 3DWQA 5IYCG 2JP1A 3ERQA 1I6HB 1X55A 1BR9A 2WP8J 3V05A 3UDXA 4TRDA 4BBRH 4OO1H 1IHZA 3NBIA 1SE3A 2ES2A 4JI2Q 1DJRD 1QB5D 3G71A 1NR4A 4F7XA 2R7ZG 4PMBA 2EOTA 1BCPF 3SR1A 1WD1A 2JA8G 3UE1A 4JI1L 3I72A 3GTJB 1HNZL 1STAA 5IGEA 1EY5A 2F0TA 1N8RC 2OCEA 5KEEA 1R4QB 3ULJA 2XGTA 2Z0SA 2I5HA 2M00A 2XN9C 3GP7A 1RL2A 3CCJA 1EOVA 4EQOA 1KIXA 4B3RQ 2WAQE 2RBMA 1LV9A 4DV7L 5JPNC 3R3OA 1OXVA 3ULPA 5IGCA 3KF6A 4IOCA 3A56A 4H44C 2EE1A 3C1EA 1ET6A 1AZPA 4GOPA 1F9SA 1QNKA 4LFBQ 2F0PA 4KD3A 3F8TA 4OIKA 3OTOL 4JI3L 5KYIA 3PO3H 1AZQA 1WVLA 5D3DA 3GV6A 4LK1C 2PW7A 3NXWA 2EIFA 3S14H 1IKLA 1HFGA 1EYAA 2F0DA 3PO2H 4CJ0B 3M4OH 1ZYRD 4CKCA 1LT6D 2A6ED 5A2QE 5JJZA 4IUQA 1VQ7A 3W1BA 1QG7A 4GS3A 3KLSX 2HT1A 5C44G 3CCLA 4XQQA 4C1NK 3D4DA 4ZQ3A 4F8MA 2F52A 3HOXG 1WD0A 3ULLA 3CCMA 1DXMA 3PSIA 4DN4M 4A3EG 1SJED 5EGTA 2NVQB 1XPOA 1PZID 1II3A 5JVH3 2B63G 1MIUA 5IYDH 3I4MH 1Q8KA 3RZOH 5E4XA 1O7ZA 2JA6B 1P8LA 1Q81C 4XIGS 4QY7A 1P16A 4AH6A 3J7AV 2HIVA 2B2WC 1RHPA 1SFOH 3NUCA 3E3XA 4AQYQ 1MHWC 2Z4HA 4DXFA 4APVA 3OYYA 2ID0A 3S2DB 3NTKA 3KFUA 2VQEQ 5GAEC 2R7FA 2WB1B 3HOZG 2ZXPA 1NMGA 2VUMB 1J5EQ 3TBIB 2JA5B 1E2VA 4CHTB 2NTSA 3M7GA 3HEJA 4O42A 3U4VA 1H9SA 3UDGA 3OIPA 3PGZA 4DK3C 3TP8A 3AMUA 4CDDC 5C4JH 2D0OA 4LF7L 2R61A 4BA1I 4JI2L 3TS2A 1RDPD 3T56B 2NZOA 3ND8A 3M85A 4IUVA 1CQFA 4DFAA 2IY5B 3G6EA 1JJ2A 2KCTA 4DAYB 5GADC 1VQPA 1V1PA 2QEXA 3PUZA 5ELCA 1H9KA 1QUQA 4TVAB 2RA4A 2E5LQ 1PH8A 4X66Q 3OW7A 5IODA 4BS9A 3J80L 4OO1I 5LHY1 5M3MG 3HOWH 2JQOA 3FHWA 5CV8A 1F2LA 4HN7A 4KKTA 2UUBQ 1I6HH 4A93B 3DWPA 3RMHA 2F1MA 4YCUA 3DM3A 3TP5A 5K36H 4DGZA 4A3MB 1WTXA 4QUCA 2Q2IA 1EWIA 1X56A 3X3MA 2H1EA 1WCMG 4LFBL 5C4XG 3ERSX 3QIAA 4HSVA 1K3BC 4QGUA 4WJWA 1MI2A 3TP6A 1Q7YC 2N8NA 3GTJH 4M8AA 1JE4A 1PFNA 1R9TH 1LTBD 2EJMA 4Q0FA 1SDFA 1B2TA 3KDFA 1DOMA 1BVSA 4DA2A 1TU2B 5BR8Q 4IN3A 1EZ6A 1QE6A 5IOCA 1WJJA 4KHPQ 2WV6D 5JJKA 4GOPB 3A0JA 3KLWA 2A68C 3D4WA 1H95A 4DAPA 3D8GA 1EY7A 2WFWA 1TKWB 1Q12A 1QVFA 1UAPA 4CDEC 4ZUIA 3M7NA 3HOYG 2VZAA 5KNCA 2D5DA 3K59A 4LF9Q 1LABA 1PYWD 3T51B 1J6QA 4YHHQ 4P71A 2K5WA 2MUYA 2DY8A 4AQYL 1STGA 3JAML 2PZUA 1I5FA 1Q90A 4POGA 1V43A 3DXJC 3VR2A 2VQEL 1BO0A 1J5EL 1HRJA 2B2UC 4LF6L 4KKUA 4KHZA 4QUFA 4HAEA 5JJIA 2JE6I 5C3EB 1FR3A 3CC4A 4ILWA 4A3JB 4RWSC 5IP9G 2NVQH 5E4WC 4L5RC 1RF2D 1YNXA 3T1YQ 4HR7B 4YWMA 2B2TC 4X65Q 1DD2A 2B2YA 1CKMA 3NK9A 4OXPA 1K73C 4KLKA 3J80c 3J81L 1I94Q 3SGIA 1M4VA 1XPUA 4C3HG 1A2UA 1STNA 3CC7A 5LMUQ 1CFMA 1ZYRC 3S2DH 3OWFA 3DHQA 1AW7A 2M2LA 2A6EC 3AFPA 4DR7Q 1X32A 4C2MB 1H9SB 2VUMH 4X66L 2L55A 5C5MA 3U50C 5ELNA 2JA5H 3ER0A 1F9PA 3S1MB 1BOSA 2WKCA 1HPCA 1YZ6A 5EJWA 2JK8A 4ME5A 4GKJQ 2JA7B 5BN3A 2UUBL 1UE5A 4U673 1Y69U 2R92B 5CORA 5IIFA 2F0EA 1WYDA 1A8VA 2AHOB 5G3LD 1NSNS 1PHJA 4B3TQ 1ESRA 1NAPA 1EEID 1V1PB 1HR0W 2B2WA 2MPMA 4IPGA 1EU4A 2PNHA 1IKMA 2EYFA 2NTTA 1XMQQ 5ELBA 1KDBA 2ICEC 4MIUA 2AUJD 2L5TA 5BR8L 3GTQB 4E6IA 4JBJA 3V2TA 3NTHA 4P74A 4A93H 3MTSA 1F77A 4R8IA 1CZWA 1C9OA 4U68A 2IX3A 5DNFA 4A3MH 3I73A 3GTMB 3HGBA 3ONAB 5I4DA 4C3JB 3H15A 4LF9L 3KDFB 4YHHL 2VXWA 3A8KE 1HA5A 5C4HA 3NTIA 1E2ZA 4B9WA 3I90A 3I56A 4RHSA 3RD4A 3ZYYX 5DM73 4KY5A 1VF7A 2CH4W 1YJ9A 1YHBA 1I50B 1GO3E 1AH9A 4OX9L 2VQFQ 5CBEE 2YU9B 5CV9A 3J81c 2NBFA 1DGSA 4A3KB 5FLMH 4ODGA 3H94A 2F0KA 1CKNB 3FPUB 3T1YL 2QW7A 5T1GA 5LL6S 1SRUA 4IUPA 4DV5Q 4X65L 3HZXA 1IYJB 1FD7D 1HUNA 2IX1A 4GLAC 3A8JE 4X3KA 3OW2A 1MBYA 1XPRA 3X3NA 5FO9B 2BA1A 2LSSA 3UDIA 2MQHA 3J7AF 4DNTB 1M8AA 1NMFA 1MD2D 2YV5A 3PMFA 2K50A 4GOPC 4P75A 5M3FB 3M3YB 3Q6SA 5C3EH 5H1SE 1YBYA 1FNVA 4A3GB 4A3IB 2NYZD 2KUMA 2JEBI 2DY7A 2XRSD 2HHHQ 3HKZE 1SNMA 1Z6HA
chains in the Genus database with same CATH topology
3K5OA 4QB4A 1AFPA 2XWJB 3BS1A 2FMMA 1HFNA 1TY0A 2PPBC 4FXGC 2BDOA 1QNUA 5I9OA 2E2HB 2CVRA 5C6AA 1GUGA 1WTRA 4RH6A 2XWBB 3FMCA 2C9OA 1PRTC 1Q3LA 1JOKA 1AP0A 4K5WA 1G6ZA 1J9OA 1B3AA 2NVYB 4FXDA 4QIWB 1SNDA 2R7ZB 1QCBD 4P2CB 2VB3X 1ESFA 1D2BA 1F2ZA 1ET9A 2I07B 4RKLA 1HHVA 2B2TA 1S5ED 4RGTA 1QILA 2D62A 1W6JA 1D1KA 1AEXA 1STEA 3OWEB 2F0HA 1NR2A 3D4RA 3TN2A 2QEJC 3GQBA 4IFDG 4Z9CB 2IT1A 4ABNA 1D5MC 1H9RA 4R8NA 5IT9E 3KK7A 3VR4A 5CV7A 1JCKB 2K33A 1K83B 4C3IG 1TWHB 1TWFB 1KTKA 1LTRD 3H3VC 5M9OA 3W2DA 3CHBD 2RDGA 3MFYA 3I3CA 1JB3A 5CV4A 4KN4C 2K5QA 2L1BA 4EQNA 1SBBB 3U9SA 4KK7A 3HOXB 3P1HA 3H09A 4A3EB 3NE5B 2F0QA 2EYMA 2NWGA 2K04A 1ENAA 1JOOA 2B63B 1L0XB 3NP8A 1UNSA 1WTOA 4UDUC 3VA5A 1EQTA 3K7AB 3EROA 4L6TB 1LTAD 2L4NA 5M5YB 5EPJA 3VYTA 1EQVA 2BOSA 3EFXD 3HOZB 4HTHA 3K58A 1SJHD 1SAPA 4FF3A 4IFDJ 4HEDA 1Z47A 3QO2A 1QWYA 3OIQA 4H7BA 4DK1A 2MGSA 5CV6A 2SDFA 1JWMD 1TWGB 3GTGB 1PMRA 2PZWA 1U4LA 3CRLC 1I4GA 1GOZA 1LT5D 3H6MA 3GD7A 3LX0A 1NCVA 3OMGA 2O4XA 4ZAIA 3BDCA 1H9MA 1LLRD 5M3MB 1IW7C 4L63B 4KKSA 4BWGB 1GUWA 1LO5D 2TMPA 3BDLA 3S1QB 4H13C 4OL7A 1WCMB 4BA2I 3SK6A 2FJ2A 3K6OA 2B2YC 5ELFA 1O7YA 2WIIB 1EY4A 3MXUA 2Q8TA 1CHQD 2IPKD 2K32A 5FLXL 1JORA 5DAUA 4NW2A 2OF1A 3A7AB 2CQAA 5EPKA 5ISRA 3TSSA 2SOBA 5FO7B 5JEAG 3PIO3 2HUGA 2FINB 1Y8NB 3VA7A 2B2VA 4IQZA 3MWYW 2E2IB 1EFID 2ZT9C 1T5XD 4QMGA 3SK5A 5IGDA 5EBCA 1O7LA 2K03A 1CA5A 5LL6X 2K6AA 1BXTA 3NQTA 1R4PB 3LWUA 1A6XA 5KIXA 1DYQA 1EY9A 1G8ZD 1KDCA 1XYIA 3PUVA 4RKBA 1XTCD 3QG1A 1EY6A 2KA7A 4EQPA 2B8GA 3FDTA 1JOQA 4CKEA 5EKIA 5CGKA 2K28A 1B53A 4XT3B 4C3HB 1ILPA 2F0IA 3C46A 4KHVA 1TWAB 3RUZA 1RTNA 1A3TA 4DU9A 1YNND 1DZ1A 2O5IC 4MHEA 5JEAJ 3IL8A 3K57A 2PO4A 2EYPA 2KHSA 5I6WA 1V8QA 4OIJA 2K05A 2AQ2B 2XRQD 2KOLA 5JPMC 4KI0A 1UEAB 2XSCA 4RA8A 4Y7NB 1PTOD 3IFTA 5G3LF 3Q0AA 1EU3A 2BE5D 1PTOB 2EYLA 2SEBD 1ENCA 1L0YB 5IGFA 4N9PA 5CBAE 1RD9D 4ZRZA 5CV5A 3BDOA 2LMCB 4JBWA 4RCOA 4C1NI 1S5CD 4G4KA 1D5ZC 2A73B 4V0BA 3FPPA 2ICIA 2PCFB 4ZUJA 2O2LD 2EPBA 3C2PA 3E6ZX 2AUKA 3EA6A 5K5PA 1SYDA 1FYCA 1PRTD 4S3SA 4EVOA 1D5XC 2L11A 5M5WB 1PRTB 4OHJA 4Q5VA 2ZXOA 2IJ0A 3ND9A 1A3VA 2FMCA 4J1MA 3T13A 3N6RA 3S17B 2K7VA 5CC4A 1U4PA 2HQEA 3HS0C 1B50A 3RLFA 3C3LA 2F0JA 3FKIB 2AWNA 2YYZA 4FP5D 3PUWA 1A3UA 3QOLA 1CQVA 1DM0B 4QCLA 2TSSA 1VCIA 3J7YW 4G7HC 1FGBD 1CTMA 2MHVA 2JSOA 1D6EC 1EYDA 2OXPA 4UAIA 2KQ3A 2KVMA 1TR5A 2KEEA 4KY7A 1S5FD 5IT9L 3QJYA 5KNDA 1BQQT 2QCPX 1EY8A 1TT2A 2EXZA 5EPLA 4MN3A 5KNBA 1EY0A 3T53B 4G7OC 4LAAA 4FNFA 4BY7B 1WTPA 4LMQD 4ZLTF 1B4OA 4KJNA 1TWCB 5DM63 1PDQA 1IYVA 3N52A 1G91A 1EWHA 3S1NB 5I6YA 2WACA 1YNJD 1OXXK 1B44D 4G57A 4DAVA 3G7LA 4AYBB 4RCNA 2R6GA 3UI2A 4IUTA 5C0XG 1C4QA 3WDNA 1WTWA 2PW5A 3T16A 4C3IB 2VB2X 1E0BA 2KECA 1JICA 1EZ8A 2G9DA 1PTOH 1I4RA 3VYUA 3J80E 3KLRA 2X69A 2A69D 5CYUA 5KYLA 1Y8PB 4ZKCB 3KBGA 1YNNC 1ZEQX 1SYFA 4FF4A 3TP7A 2F0NA 2GA4B 1STBA 1IL8A 4FO2A 1VMPA 1IW7D 3DEPA 1Y8OB 3FRPB 2BDNA 4ID6A 1FNUA 2NN6H 4K5VA 2DNCA 4XYOA 2J4XA 5IGGA 1PTOC 3R2IA 1PLFA 1LACA 1IYUA 2MJ8A 2BE5C 4K5XA 1RTOA 4OGQC 3OMCA 3T4AC 2F0GA 1SXTA 2WKDA 3DMUA 3NQIA 3KLSA 1CZGA 1JWUD 1ML0D 3SVMA 1H9JA 4X3TA 4IUUA 1KNAA 1RCVD 1SYGA 3VYSA 4H0LC 4B9XA 4ZKBB 2XIWA 1MSHA 3WOEA 3L7ZC 2X6GA 2RVLA 3JAME 1Q8IA 4IALA 1XX8A 1SNQA 5C0XJ 1TS3A 4ZYSA 4EGVA 3NPPA 5A2QL 5NUCA 1O78A 1LT3D 1HTPA 2B2VC 1Y1WB 1PXUA 3H0GB 5COYA 5CR3A 1W6KA 5J39A 2V4DA 3I70A 2JA8B 2EY5A 3GO5A 3P20A 3SK4A 2OT2A 5KRUA 2IW3A 5FK9C 2HCCA 4I7ZC 3TZUA 3OPOA 4KTAA 3P7JA 5BN5A 1QJOA 2C5CA 4R9WA 3J81E 4PNYA 3S16B 5FOBB 1SSOA 3BG3A 1KDAA 1J8IA 3BZDB 5I2XA 4PMWA 3GTPB 2XVSA 2WAQB 4KD4A 4IUNA 3MXGA 3SK8A 1V1OA 1SNPA 4BBSB 4XQNA 4NP5A 4TSSA 2PNRC 4LJZC 4IFDH 1I6VC 2KCCA 2F0VA 5C44B 1I4HA 1HXYD 2R3ZA 3RZDB 3S1RB 2QDBA 1XWEA 4RGMA 3DM1A 3E5SA 4G7ZC 2JEAI 2J7ZA 1TIID 1GUTA 1SYEA 4M1UB 4WFN3 1T5EA 1A15A 4FF2A 2KCNA 4JK1C 2NN6I 5D65A 5E1FA 2XNAC 1YNJC 5ELEA 4YIJA 3PUXA 1ZXTA 4OO1G 1PFBA 5AFWA 1GUOA 2EZVA 2QILA 3SXHA 3S2HB 2EVBA 1HQMC 1I4PA 3L9AX 1CI3M 1GXDC 5HGTA 1DOKA 4XT1B 1SE2A 3VR5A 1QOHA 1D1IA 3OHXC 4CBVA 2A69C 1U4MA 3Q24A 1TQOA 3R2TA 2D2CC 3KF8A 1RJTA 2E2DC 2QF7A 1AN8A 1KABA 3SEBA 2EDGA 1LT4D 3G6JB 4DNRB 3L3OC 2N55A 2O5JC 1R9TB 2QKIC 3EJIA 3CKIB 2RDHA 3HP3A 5C4XB 4ULLA 3Q23A 4HCSA 3P75A 3VR3A 1K8OA 1B1ZA 4RHRA 2Q8RE 5FO8B 2L0CA 4IURA 3I4NB 1SMYD 3V96A 1CT1D 3AU7A 1ZKOA 2B8FA 2ZXRA 1Q1BA 3PIP3 2NB0A 3S9WA 1PTOF 4K6DA 4PQXA 3NWSA 1E2WA 1TS4A 1SE4A 1LTID 1OXUA 3H91A 3A54A 1JQYD 3HOYB 5IGBA 2CW0D 1HQRD 3IKJA 1WTQA 3PUYA 4NDXA 3BVMA 4IFDI 1EIHA 3I8ZA 4IZ8A 1DONA 2EYHA 2EYOA 5J1ZA 5FKAC 1BUVT 2LFNA 3QB3A 3R8BA 1SYBA 3Q22A 1EYCA 5JEAH 4NKLA 5F2DA 2RKSA 1PRTF 2DNEA 1K8MA 1S5DD 1X3PA 1S4ZA 5T1IA 5J22A 1EOTA 3DEOA 4ZK9B 3HRZC 2PQEA 3MXNA 1HA6A 1MSGA 2JYOA 1O80A 5C5LA 1OXSC 1RODA 2F0FA 1SEBD 2OEOA 5BN4A 3OOCA 3K0YA 1BCPD 5D14A 1OO9B 3W3AA 2FFKB 3NWTA 4F87A 5EKKA 2NZ1D 2NVTB 5K36G 1BCPB 4CGYB 2G9HD 3MZ5A 1BDOA 2NVXB 5E3FA 5JVG3 2B39A 4RGOS 2LS01 4K8IA 2M9VA 4WORA 1GJXA 1KNEA 1F2YA 2K5DA 2PZTA 5JAVA 5A35A 5ELDA 3K5NA 4K14A 4KY6A 2IL8A 4X3UA 4XDXA 5M5XB 2EJGC 3DUZA 2ENBA 2F0WA 5C4ZA 2J0TD 4I65A 3CRKC 1XXGA 1U4RA 2RSOA 1GHJA 2LY7A 2HDLA 3URYA 2Y0SB 3CU7A 1KLGD 3O13A 2D9UA 2AQ3B 3LNNA 3C1FA 1SNOA 2RQXA 1VDZA 4L8JA 2R93B 2VNUD 1CM9A 3R93A 3IFDA 1GUNA 1PZKD 1F2MA 4XYQA 3MFGA 4PV1C 5DEHA 3QWNA 3GTKB 1MGSA 4K2LA 3DWAA 2F0SA 3A7LA 1CA6A 4RFBA 3VYRA 2F3VA 2F03A 3MA2B 3MXPA 1STYA 2KEDA 4FF1A 5EKLA 4XTCS 4FYDA 4TKOB 2F4IA 3MVVA 4C56C 4O1NA 3AB9A 1SMYC 3U9OA 4TQUS 5EQ0A 4QF4A 3I91A 5FLXE 2HDMA 1A2TA 2BCOA 2NUCA 2EY2A 2AQ1B 2EY1A 4DXGA 3HG9A 1TVXA 1HTLD 2E76C 3S15B 2IWHA 1PFMA 3I4LA 4CJ2C 5I9PA 1I4QA 2A6HD 2CW0C 3MC0B 3HOVB 4X3SA 4F88A 3QOJA 3HKZB 2HCIA 1Y1VB 1JC7A 4CJ1B 5I2YA 2E74C 1EIGA 2LKVA 3TDQA 2RDFA 2N88A 3GTOB 1C8CA 4XQJA 1VF5C 3KUPA 2CHBD 4A3DB 1CK1A 3ITPA 3M4YA 5EBDA 1VMCA 2X6LA 2I46A 3CQZB 1LTSD 4FVMA 4A3BB 3BVZA 1ILQA 2AWOA 4PMCA 3EQLC 4BY1B 1EWCA 4KJOA 2EY6A 1BBXC 2F0MA 1BCPC 5C3XA 3GV3A 2JXMB 2SNSA 3D6WA 3TMEA 2E2JB 4HMIA 1OXTA 2PMZB 2FHTA 3FEWX 4XXEA 2IX0A 2NN6G 1S5BD 1I3QB 2A5HA 3BVGA 1DCZA 1C48A 3D31A 3WOFA 2BA0A 1SYCA 3NBHA 5C0XH 4GZYC 4J6HA 4KV6A 4J8QA 2MP1A 2Z4IA 3KBXA 4DK0A 1Z7TA 3FVQA 3HOUB 3BYTB 3VR6A 3GTLB 3LWEA 1BF4A 4A3FB 1KLUD 4KN7C 3A55A 2K01A 1NUCA 2Z1CA 4RGNA 1JWSD 1KAAA 3A8IE 4BBRB 1LTTD 1TY2A 1DOLA 2F0UA 4DF7A 4V190 2F3WA 4WRDA 1F9QA 1FNWA 5D3IB 1JR0D 4FXKC 3SDZA 3OSOA 5C3WA 4K6LA 2Z8LA 3K5MA 2A74C 2SNMA 3PV0A 2PYKA 1EL0A 5JOBA 3D3RA 4B08A 2B2UA 1X3QA 1G2SA 2KJXA 1HUMA 1WTVA 3MHBA 2WINB 5KGUA 4HMJA 3PO3B 1I4XA 1STHA 1TS2A 4RAUC 2F0LA 3S14B 1F9RA 1G291 3PO2B 3M4OB 1SNCA 1EEFD 2K1BA 1RKNA 3SHLA 2Q8IB 4C3JG 1U9RA 3EVQA 3E0JA 5CMDA 1BNZA 1ICWA 3TZDA 1G2TA 4N9TA 1B9MA 2RSNA 4HCEA 1LTGD 2A6HC 3I4MB 3D6CA 2F0OA 3RZOB 2EJFC 2L12A 3NHHA 2E75C 3K5LA 1SFOB 2H4OA 4CKBA 1Q1EA 2L9HA 3MEHA 3NSWA 4HSPA 5HURA 4K8JA 5TSSA 5C0XI 3SE0A 1PZJD 3F2UA 1ONLA 1GUSA 5C4JB 1CHPD 2EYJA 2DN8A 4K2KA 1UUPA 1HCZA 1ENFA 4KMUC 3IAYA 1B9NA 4DAYA 4NMZA 1TS5A 3BYYB 1GHKA 3MAQA 3HOWB 2A68D 3DWQA 2JP1A 3ERQA 1I6HB 1BR9A 2WP8J 3V05A 4TRDA 4OO1H 1IHZA 3NBIA 1SE3A 1DJRD 1QB5D 1NR4A 4F7XA 4PMBA 2EOTA 1BCPF 3SR1A 1WD1A 3I72A 3GTJB 1STAA 5IGEA 1EY5A 2F0TA 5KEEA 1R4QB 2M00A 2XN9C 3GP7A 4EQOA 2RBMA 1LV9A 5JPNC 3R3OA 1OXVA 5IGCA 3A56A 4H44C 2EE1A 3C1EA 1ET6A 1AZPA 1F9SA 1QNKA 2F0PA 4KD3A 4OIKA 5KYIA 1AZQA 1WVLA 5D3DA 3GV6A 4LK1C 2PW7A 3NXWA 1IKLA 1HFGA 1EYAA 2F0DA 4CJ0B 1ZYRD 4CKCA 1LT6D 2A6ED 5A2QE 5JJZA 4IUQA 1QG7A 3KLSX 4XQQA 4C1NK 3D4DA 4ZQ3A 4F8MA 1WD0A 1DXMA 4DN4M 1SJED 5EGTA 2NVQB 1PZID 1II3A 5JVH3 5E4XA 1O7ZA 2JA6B 4XIGS 3J7AV 2B2WC 1RHPA 3NUCA 2Z4HA 4DXFA 2ID0A 3S2DB 3NTKA 2WB1B 2ZXPA 2VUMB 3TBIB 2JA5B 1E2VA 4CHTB 2NTSA 3M7GA 3HEJA 4O42A 1H9SA 3OIPA 3TP8A 3AMUA 2R61A 4BA1I 1RDPD 3T56B 3M85A 3ND8A 4IUVA 1CQFA 4DFAA 1V1PA 3PUZA 5ELCA 1H9KA 2RA4A 3OW7A 5IODA 4BS9A 3J80L 4OO1I 5LHY1 5CV8A 1F2LA 4HN7A 4KKTA 4A93B 3DWPA 3RMHA 2F1MA 3TP5A 5K36H 4DGZA 4A3MB 1WTXA 4QUCA 3X3MA 2H1EA 3QIAA 4HSVA 4WJWA 1MI2A 3TP6A 4M8AA 1JE4A 1PFNA 1LTBD 2EJMA 4Q0FA 1SDFA 1B2TA 1DOMA 4DA2A 1TU2B 4IN3A 1EZ6A 1QE6A 5IOCA 2WV6D 2A68C 3D4WA 4DAPA 3D8GA 1EY7A 1TKWB 1Q12A 1UAPA 4ZUIA 3M7NA 5KNCA 2D5DA 3K59A 1LABA 1PYWD 3T51B 2K5WA 2MUYA 2DY8A 1STGA 3JAML 2PZUA 1Q90A 1V43A 3DXJC 3VR2A 1BO0A 1HRJA 2B2UC 4KKUA 4KHZA 4QUFA 4HAEA 2JE6I 5C3EB 1FR3A 4ILWA 4A3JB 4RWSC 5E4WC 1RF2D 4HR7B 2B2TC 1DD2A 2B2YA 3NK9A 3J81L 1M4VA 4C3HG 1A2UA 1STNA 1CFMA 1ZYRC 3OWFA 3DHQA 1AW7A 2M2LA 2A6EC 1X32A 4C2MB 1H9SB 2L55A 5C5MA 1F9PA 3S1MB 1BOSA 2WKCA 1HPCA 5EJWA 4ME5A 2JA7B 5BN3A 4U673 1Y69U 2R92B 5CORA 5IIFA 2F0EA 5G3LD 1NSNS 1ESRA 1NAPA 1EEID 1V1PB 2B2WA 2MPMA 1EU4A 1IKMA 2EYFA 2NTTA 5ELBA 1KDBA 2ICEC 4MIUA 2AUJD 2L5TA 3GTQB 4E6IA 3V2TA 3NTHA 3MTSA 1F77A 4R8IA 1CZWA 4U68A 2IX3A 5DNFA 3I73A 3GTMB 3HGBA 3ONAB 5I4DA 4C3JB 2VXWA 3A8KE 1HA5A 5C4HA 3NTIA 4B9WA 1E2ZA 3I90A 4RHSA 3RD4A 3ZYYX 5DM73 4KY5A 1VF7A 1I50B 2YU9B 5CBEE 5CV9A 2NBFA 4A3KB 4ODGA 3H94A 2F0KA 3FPUB 5LL6S 5T1GA 4IUPA 3HZXA 1FD7D 1HUNA 2IX1A 3A8JE 4X3KA 1MBYA 3X3NA 5FO9B 2BA1A 3J7AF 4DNTB 1M8AA 1MD2D 3PMFA 5M3FB 3M3YB 3Q6SA 1FNVA 4A3GB 4A3IB 2NYZD 2KUMA 2JEBI 2DY7A 2XRSD 1SNMA 1Z6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUM A;  5D14 A;  2BDN A;  2NWG A;  2Q8T A;  2K04 A;  2N55 A;  3D6W A;  2FFK B;  4UAI A;  4OIJ A;  1WTV A;  2K05 A;  2FMM A;  2KVM A;  2KED A;  2NZ1 D;  4NW2 A;  2B2W C;  1RHP A;  1WTO A;  2KEE A;  1EQT A;  2KOL A;  1HFN A;  5EPK A;  4RAU C;  3HP3 A;  2JP1 A;  2FHT A;  1F9R A;  4RA8 A;  4HCS A;  1PLF A;  2CVR A;  2HUG A;  1WTR A;  2FIN B;  2MJ8 A;  1RTO A;  2B2V A;  2Q8R E;  2R3Z A;  3MWY W;  2L4N A;  3MTS A;  5EQ0 A;  4R8I A;  5EPJ A;  2K1B A;  4U68 A;  4IUR A;  5EPL A;  1NR4 A;  3I91 A;  4O42 A;  4MN3 A;  5DNF A;  2DY8 A;  1Q3L A;  2HDM A;  3DM1 A;  1AP0 A;  2EOT A;  2J7Z A;  5CBA E;  1WD1 A;  1J9O A;  1G6Z A;  1B3A A;  5CMD A;  1ML0 D;  3ONA B;  1KNE A;  2K03 A;  3SVM A;  1SAP A;  1BNZ A;  2MP1 A;  1ICW A;  4IUU A;  4X3T A;  3TZD A;  1BO0 A;  1G91 A;  4HED A;  1KNA A;  1CA5 A;  1WTP A;  4LMQ D;  4ZLT F;  3KBX A;  1HRJ A;  2B2U C;  2VXW A;  4ZKB B;  3QO2 A;  1TVX A;  2XIW A;  2B2T A;  1G2T A;  1HHV A;  4QUF A;  4HAE A;  1A15 A;  1B4O A;  2RSN A;  1MSH A;  2IL8 A;  3H91 A;  1PFM A;  4IUV A;  4CJ2 C;  1PDQ A;  3LWE A;  3I90 A;  4RWS C;  3N52 A;  2X6G A;  2MGS A;  4X3U A;  2RVL A;  4XDX A;  5E4W C;  1LV9 A;  1BF4 A;  5D65 A;  2EPB A;  3TN2 A;  1NR2 A;  1XX8 A;  2L12 A;  4X3S A;  2SDF A;  2B2T C;  2B2Y A;  1WTQ A;  2EE1 A;  2HCI A;  1XYI A;  1ZXT A;  1AZP A;  2RA4 A;  2K01 A;  1F9S A;  1PFB A;  1U4L A;  5AFW A;  2B2V C;  1U4R A;  1QNK A;  4CJ1 B;  2RSO A;  5CBE E;  1EIH A;  2L11 A;  3G7L A;  4OIK A;  2L9H A;  5COY A;  1EIG A;  3I8Z A;  1WVL A;  1NCV A;  2HDL A;  3GV6 A;  1AZQ A;  3DEP A;  1F2L A;  3UI2 A;  1DON A;  4IUT A;  4ZAI A;  3FPU B;  1IKL A;  2N88 A;  1DOL A;  2D9U A;  3FDT A;  1HFG A;  5EKI A;  5T1G A;  1C8C A;  4IUP A;  3KUP A;  2K28 A;  1WTW A;  2M2L A;  2HCC A;  1DOK A;  4XT1 B;  1E0B A;  4CJ0 B;  1X32 A;  1B53 A;  1F9Q A;  2KEC A;  1JIC A;  1WTX A;  4QUC A;  3P7J A;  4XT3 B;  1HUN A;  5JJZ A;  4IUQ A;  2H1E A;  3F2U A;  1F9P A;  1ILP A;  1U4P A;  4X3K A;  1CM9 A;  1B50 A;  4HSV A;  1VMC A;  3I3C A;  1QG7 A;  2X6L A;  5EJW A;  3R93 A;  1GUW A;  1U4M A;  4R9W A;  3IFD A;  1MI2 A;  2X69 A;  1SSO A;  1X3P A;  4ZKC B;  1S4Z A;  1RTN A;  2L1B A;  5T1I A;  1WD0 A;  1ILQ A;  1RJT A;  1JE4 A;  1EOT A;  1PFN A;  1O7Z A;  1M8A A;  3DEO A;  5COR A;  1J8I A;  4DN4 M;  2FJ2 A;  4ZK9 B;  1SDF A;  2B2Y C;  1B2T A;  1MGS A;  1EL0 A;  1DOM A;  1HA6 A;  1DZ1 A;  1O7Y A;  1MSG A;  1ESR A;  1NAP A;  1O80 A;  1QE6 A;  2JYO A;  3Q6S A;  1ROD A;  2B2W A;  2MPM A;  4MHE A;  1BBX C;  1IL8 A;  2NYZ D;  1VMP A;  2KUM A;  3GV3 A;  3IL8 A;  2DY7 A;  1CA6 A;  2B2U A;  5E4X A;  1X3Q A;  1G2S A;  1IKM A; 
#chains in the Genus database with same CATH topology
 3K5O A;  4QB4 A;  1AFP A;  2XWJ B;  3BS1 A;  5IYB G;  2FMM A;  1HFN A;  1NJI C;  1PYB A;  1TY0 A;  4B3T L;  2PPB C;  4FXG C;  2BDO A;  3BJU A;  3NEL A;  4JOI A;  1QNU A;  5I9O A;  2E2H B;  2CVR A;  5C6A A;  1GUG A;  2ZJP A;  1WTR A;  1IBK L;  4RH6 A;  2XWB B;  1Y1V G;  1X3G A;  2GN5 A;  1XMQ L;  1KC8 C;  3FMC A;  4LF4 Q;  4BY7 G;  2C9O A;  1PRT C;  4C2M H;  1Q3L A;  1D7Q A;  1JOK A;  1AP0 A;  4NXM Q;  4K5W A;  1G6Z A;  1J9O A;  3S1M H;  1B3A A;  1GKH A;  2NVY B;  4FXD A;  3H3V H;  4QIW B;  4JI0 L;  1SND A;  2JA7 H;  1QCB D;  4AYB E;  4P2C B;  2VB3 X;  2R7Z B;  1ESF A;  3AQQ A;  1D2B A;  1F2Z A;  1ET9 A;  2I07 B;  2OQK A;  4RKL A;  4A3D G;  4JI1 Q;  1HHV A;  2R92 H;  2B2T A;  1S5E D;  4GLX A;  3U4Z A;  4RGT A;  1K0S A;  4R4T A;  1QIL A;  2YTX A;  2D62 A;  1W6J A;  1D1K A;  1AEX A;  1STE A;  1VQB A;  2F0H A;  1NR2 A;  2E8G A;  3D4R A;  3OWE B;  2QEJ C;  3GQB A;  3TN2 A;  4IFD G;  3CF5 A;  4Z9C B;  4AYB G;  2IT1 A;  1N9W A;  4ABN A;  1S40 A;  1D5M C;  1E3P A;  1H9R A;  1M90 C;  2CKZ B;  4R8N A;  5IT9 E;  3KK7 A;  3VR4 A;  1XMO Q;  1JE5 A;  5CV7 A;  1JCK B;  2ASB A;  2K33 A;  1K83 B;  4C3I G;  1TWH B;  3GTQ H;  1TWF B;  4PG3 A;  1KTK A;  1LTR D;  3H3V C;  3CCR A;  3OTO Q;  4JI3 Q;  5M9O A;  3W2D A;  3CHB D;  2RDG A;  3MFY A;  3I3C A;  4DR6 Q;  1JB3 A;  5CV4 A;  1QVC A;  3PF5 A;  4KN4 C;  3GTM H;  1YHA A;  2K5Q A;  3PQI A;  2L1B A;  4EQN A;  4DV5 L;  1SBB B;  4C3J H;  3KYH C;  3U9S A;  1GD7 A;  1FGU A;  4KK7 A;  4JVZ A;  4DR2 Q;  3HOX B;  2QA4 A;  3P1H A;  3H09 A;  4A3E B;  3NE5 B;  2F0Q A;  4GN4 B;  2EYM A;  2NWG A;  2K04 A;  1ENA A;  1JOO A;  2B63 B;  1N32 L;  3NP8 A;  1L0X B;  1UNS A;  1WTO A;  4UDU C;  3VA5 A;  1HNX L;  1EQT A;  1LM0 A;  5GAH C;  3K7A B;  3M4P A;  2KHI A;  2YU9 H;  3ERO A;  4L6T B;  1VQN A;  5HY6 A;  2HHH L;  4A3K H;  3NEM A;  1LTA D;  2L4N A;  5M5Y B;  5EPJ A;  3VYT A;  1EQV A;  2BOS A;  3EFX D;  1VQJ A;  4BBR G;  3HOZ B;  1EQQ A;  2HIX A;  3L0O A;  2ZJR A;  4HTH A;  2ZM6 L;  3K58 A;  1SJH D;  3RNU A;  1SAP A;  4FF3 A;  2I5M X;  4IFD J;  4HED A;  2VW9 A;  1Z47 A;  3QO2 A;  1QWY A;  4LF4 L;  3OIQ A;  1XNR Q;  4H7B A;  4NXM L;  4DK1 A;  4LF7 Q;  1PFS A;  2MGS A;  5M3F H;  5CV6 A;  3M3Y H;  1Y1W G;  1Q86 C;  2SDF A;  1W3S A;  1UE7 A;  1JWM D;  3H0G G;  1JJC B;  4A3G H;  4A3I H;  1TWG B;  1Y14 B;  3GTG B;  1PMR A;  2PZW A;  1U4L A;  3CRL C;  2H5X A;  4GNX A;  4Y52 H;  1I4G A;  1GOZ A;  1LT5 D;  3H6M A;  3GD7 A;  3LX0 A;  4NXN Q;  1NCV A;  1MJE A;  4DV3 L;  3OMG A;  2O4X A;  4ZAI A;  3W5O A;  3BDC A;  1N34 Q;  2E2H H;  1H9M A;  1LLR D;  5M3M B;  2K75 A;  1IW7 C;  4DR5 L;  5IYC H;  1XMO L;  3H3V I;  4L63 B;  4KKS A;  3UDF A;  4B3S L;  4BWG B;  1B3Q A;  1GUW A;  1LO5 D;  1PH4 A;  2TMP A;  3BDL A;  3PO2 G;  3S1Q B;  2I5L X;  1WI5 A;  4H13 C;  4OL7 A;  1WCM B;  2NVY H;  4JI4 Q;  2R7Z H;  4BA2 I;  2WAQ G;  3A5Z B;  3SK6 A;  2FJ2 A;  3K6O A;  4JI7 L;  2B2Y C;  4JV5 L;  1E1T A;  2Z6K A;  4IJH A;  5ELF A;  1O7Y A;  2WII B;  3CPF A;  4DR6 L;  2EQS A;  4BBS G;  1EY4 A;  3MXU A;  3CXC A;  5GAG C;  2Q8T A;  1CHQ D;  2IPK D;  2K32 A;  5FLX L;  4DR4 L;  1JOR A;  5DAU A;  4NW2 A;  2OF1 A;  3A7A B;  2CQA A;  5EPK A;  5ISR A;  5IWA L;  4DR2 L;  3TSS A;  2SOB A;  5FO7 B;  1K83 H;  5JEA G;  3PIO 3;  1TWH H;  2HUG A;  2FIN B;  4OWT B;  2OTJ A;  1Y8N B;  3VA7 A;  4R4C A;  2B2V A;  1TWF H;  4IQZ A;  3MWY W;  1U0L A;  1U5K A;  1IZ6 A;  2E2I B;  1EFI D;  4R4Q A;  2ZT9 C;  2ALY B;  1T5X D;  2QDL A;  4QMG A;  3SK5 A;  5IGD A;  5EBC A;  1VQK A;  2V1C C;  1KXL A;  1O7L A;  2K03 A;  3F2D A;  1PH5 A;  1B8A A;  1CA5 A;  4RG1 A;  5LL6 X;  1YI2 A;  2K6A A;  1VQE A;  1BXT A;  3NQT A;  1R4P B;  3LWU A;  1VQA A;  1A6X A;  5KIX A;  1JB7 A;  4LF6 Q;  1DYQ A;  3HOX H;  1PH1 A;  1EY9 A;  1G8Z D;  3ICE A;  1YVC A;  1KDC A;  4A3E H;  1V9P A;  1XYI A;  3PUV A;  4RKB A;  1XTC D;  3QG1 A;  5IP7 G;  2B63 H;  1XNR L;  1EY6 A;  2KA7 A;  4EQP A;  3K7A H;  2B8G A;  4DPG A;  3FDT A;  1UE6 A;  1JOQ A;  4CKE A;  5EKI A;  5CGK A;  2K28 A;  3DLL A;  1NBW A;  3D0F A;  1B53 A;  4XT3 B;  4C3H B;  1ILP A;  5AJ3 Q;  4NXN L;  4L5S A;  2F0I A;  3HOZ H;  4UP7 A;  4KHV A;  3C46 A;  1TWA B;  3RUZ A;  1N34 L;  1RTN A;  1BBU A;  1A3T A;  4DU9 A;  1YNN D;  1DZ1 A;  2O5I C;  4MHE A;  5JEA J;  3IL8 A;  4A4I A;  4X62 Q;  3K57 A;  2G5D A;  2VS1 A;  2PO4 A;  2EYP A;  2KHS A;  4GNX B;  5I6W A;  4JI4 L;  1V8Q A;  4OIJ A;  5FLX c;  2K05 A;  1MJC A;  2K4K A;  1TWG H;  1AE2 A;  3GTG H;  4JI6 L;  2AQ2 B;  2XRQ D;  4UP8 A;  2KOL A;  5JPM C;  4KI0 A;  1UEA B;  3GDE A;  1CKO A;  2XSC A;  4RA8 A;  3BZC A;  4Y7N B;  3I4N G;  1PTO D;  3IFT A;  1E7Z A;  5G3L F;  3Q0A A;  1EU3 A;  3K7U C;  2BE5 D;  1PTO B;  2EYL A;  2SEB D;  4JC0 A;  2YTY A;  4OEL B;  1ENC A;  1L0Y B;  5IGF A;  4N9P A;  5CBA E;  1RD9 D;  2ATW A;  4ZRZ A;  5CV5 A;  3BDO A;  3J81 j;  2LMC B;  1LUZ A;  1PVO A;  3CCE A;  3S1Q H;  4JBW A;  4RCO A;  1VQ6 A;  1WCM H;  2OQ0 A;  4C1N I;  4CDF C;  1S5C D;  1PH9 A;  4G4K A;  2CCZ A;  1D5Z C;  2A73 B;  3I4O A;  3FPP A;  4V0B A;  2ICI A;  2ZTE A;  2PCF B;  4JPB W;  4ZUJ A;  1CKN A;  4X64 Q;  4WJ4 A;  2O2L D;  2EPB A;  3C2P A;  3E6Z X;  4JOI C;  2AUK A;  3EA6 A;  3EIV A;  5K5P A;  3PIP A;  1SYD A;  2JJQ A;  1JJG A;  1FYC A;  4LFA Q;  1PRT D;  4S3S A;  4EVO A;  3L2P A;  1IBM L;  1D5X C;  3CP0 A;  2L11 A;  5M5W B;  1PRT B;  3JC6 6;  3UE0 A;  1A0I A;  1EUJ A;  4OHJ A;  4Q5V A;  2ZXO A;  2IJ0 A;  3ND9 A;  4MTN A;  4OX9 Q;  1A3V A;  2FMC A;  1CSP A;  3TQY A;  4J1M A;  1E1O A;  3T13 A;  3N6R A;  3S17 B;  1UE1 A;  2K7V A;  2E2I H;  4BXX G;  1U4P A;  2HQE A;  3HS0 C;  5CC4 A;  1B50 A;  3RLF A;  3C3L A;  5IY0 A;  4DAM A;  2F0J A;  3FKI B;  2AWN A;  3IRB A;  2YYZ A;  1XTD A;  3CCU A;  4FP5 D;  3PUW A;  2JA6 H;  3PCO B;  1A3U A;  3QOL A;  1CQV A;  1DM0 B;  4QCL A;  1JMC A;  2N49 A;  2TSS A;  4OEM B;  3J7Z C;  1VCI A;  5AJ3 L;  5FJ8 H;  1T9H A;  3J7Y W;  4QJF A;  4G7H C;  2PI2 A;  1FGB D;  3TS0 A;  3PF4 A;  1CTM A;  2MHV A;  2A19 A;  2JSO A;  1D6E C;  1EYD A;  2OXP A;  4UAI A;  2UUC Q;  3TRZ A;  2KQ3 A;  3AFQ A;  2KVM A;  4L5Q A;  1TR5 A;  2KEE A;  5IP9 H;  4KY7 A;  1S5F D;  4YCV A;  5IT9 L;  2UXD Q;  3QJY A;  5KND A;  3G48 A;  4HJ8 A;  1BQQ T;  2QCP X;  1EY8 A;  1TT2 A;  2DJG C;  3RLN A;  4X62 L;  3QR8 A;  2EXZ A;  5EPL A;  4MN3 A;  1IBK Q;  5KNB A;  4C3H H;  1A62 A;  1EY0 A;  3T53 B;  1UWV A;  4G7O C;  2KHJ A;  4LAA A;  4HID A;  4FNF A;  4BY7 B;  1TWA H;  4A3M G;  4EX5 A;  1WTP A;  2Y0S E;  4LMQ D;  4ZLT F;  5HGQ A;  1B4O A;  4KJN A;  4JI0 Q;  1TWC B;  5DM6 3;  4K0K Q;  1PDQ A;  1IYV A;  3N52 A;  3F2B A;  1G91 A;  1EWH A;  3RLO A;  3S1N B;  4ME3 A;  5I6Y A;  2WAC A;  3K8A A;  4H02 A;  1YNJ D;  1OXX K;  2Y0S G;  3KOJ A;  2RCF A;  1KQS A;  4OWX B;  5GRO A;  1B44 D;  4G57 A;  4DAV A;  3G7L A;  4HJ9 A;  4AYB B;  4RCN A;  4X64 L;  1SE8 A;  2R6G A;  3UI2 A;  4IUT A;  2R93 G;  5C0X G;  2D0P A;  1C4Q A;  4DR3 Q;  4RMF A;  3WDN A;  1WTW A;  2PW5 A;  3T16 A;  4C3I B;  2VB2 X;  1E0B A;  4LFA L;  4GN5 A;  2KEC A;  1JIC A;  1EZ8 A;  2G9D A;  3STB D;  1PTO H;  1I4R A;  3VYU A;  4LFC Q;  3J80 E;  3KLR A;  4J15 A;  2MFI A;  2X69 A;  4IPH A;  4DNI A;  2A69 D;  1HZA A;  5CYU A;  5KYL A;  1Y8P B;  4ZKC B;  3KBG A;  1E24 A;  1YNN C;  1ZEQ X;  1SYF A;  4GNX C;  4FF4 A;  3CC2 A;  3TP7 A;  1S72 A;  1XNQ L;  2EXD A;  2GVB A;  2F0N A;  4PZ8 A;  3WWV A;  2A8V A;  2B29 A;  2GA4 B;  2UXB L;  1STB A;  1IL8 A;  4FO2 A;  1VMP A;  1IW7 D;  2RCN A;  1HZC A;  3DEP A;  1Y8O B;  3FRP B;  2BDN A;  4ID6 A;  1FNU A;  2NN6 H;  5C3E G;  3EBE A;  2DNC A;  4K5V A;  4XYO A;  2UUA L;  4IPC A;  2J4X A;  3CME A;  5IGG A;  1PTO C;  3R2I A;  5IT9 c;  2CWP A;  1WFQ A;  2VY3 A;  2LXK A;  5M5W H;  1PLF A;  1LAC A;  1N32 Q;  1IYU A;  2MJ8 A;  2BE5 C;  4K5X A;  1RTO A;  1HNX Q;  2F4V Q;  4OGQ C;  1SMX A;  1SRO A;  4A3C G;  3OMC A;  3T4A C;  2F0G A;  1EIF A;  2UUC L;  3ZJY C;  4A3J H;  1K9M C;  3S17 H;  4JBM A;  1SXT A;  2UXD L;  2WKD A;  3DMU A;  3NQI A;  3KLS A;  2Z6K C;  1CZG A;  1JWU D;  1ML0 D;  3SVM A;  1H9J A;  1X3E A;  3FKI H;  4X3T A;  4IUU A;  1AE3 A;  4MNO A;  1KNA A;  1RCV D;  1SYG A;  3VYS A;  4DV1 Q;  4H0L C;  4B9X A;  4ZKB B;  1VQC A;  2DGY A;  2XIW A;  2ZM6 Q;  3HOV G;  1MSH A;  3WOE A;  3HKZ G;  3L7Z C;  2X6G A;  2RVL A;  3JAM E;  1Q8I A;  4IAL A;  1XX8 A;  1SNQ A;  5C0X J;  1TS3 A;  5E7N A;  2HQL A;  4ZYS A;  4EGV A;  3NPP A;  1PYS B;  5A2Q L;  1O78 A;  1LT3 D;  5NUC A;  1HTP A;  4ALP A;  2B2V C;  1Y1W B;  1PXU A;  3H0G B;  5COY A;  2P5Z X;  4K0K L;  5CR3 A;  1W6K A;  5J39 A;  2V4D A;  3I70 A;  2JA8 B;  2EY5 A;  3GO5 A;  2ZTD A;  2PQA A;  1N36 Q;  3P20 A;  3SK4 A;  2OT2 A;  4LF5 Q;  3LGJ A;  5KRU A;  2IW3 A;  5IYB H;  5FK9 C;  2HCC A;  4I7Z C;  3TZU A;  4LNQ A;  3CCS A;  4HIK A;  3OPO A;  4DV3 Q;  2Z6B A;  4KTA A;  3P7J A;  4A3B G;  5BN5 A;  1QJO A;  2C5C A;  4O0A A;  4R9W A;  3J81 E;  4PNY A;  2OWO A;  4DR5 Q;  3S16 B;  5FOB B;  1SSO A;  3BG3 A;  3CD6 A;  4BY1 G;  4DR3 L;  1KDA A;  4MTK A;  1QVG A;  4B3S Q;  2PMZ E;  2OTL A;  1J8I A;  4NB3 A;  3BZD B;  4FDB A;  4BY7 H;  5I2X A;  4PMW A;  3E9I A;  3GTP B;  2XVS A;  4DV0 L;  1VS0 A;  4A3L G;  4LFC L;  1TWC H;  1TXY A;  2WAQ B;  4KD4 A;  4JI7 Q;  4JV5 Q;  4YWK A;  4NPS A;  1PA6 A;  4IUN A;  3MXG A;  3S1N H;  3SK8 A;  3U58 A;  2Q2H A;  1V1O A;  1SNP A;  1YHQ A;  1HNW L;  4X6A H;  4BBS B;  4XQN A;  4NP5 A;  1HJP A;  4TSS A;  2PNR C;  2AKW B;  4LJZ C;  4IFD H;  1I6V C;  4DR4 Q;  2KCC A;  2F0V A;  5C44 B;  1G6P A;  1I4H A;  2R3Z A;  1HXY D;  3RZD B;  5IWA Q;  3S1R B;  4UHV A;  2QDB A;  4C3I H;  1XWE A;  4N8X 1;  4RGM A;  1N33 L;  3DM1 A;  3E5S A;  1A63 A;  4G7Z C;  1PV4 A;  2JEA I;  2J7Z A;  4IPD A;  5LMN W;  1TII D;  1GUT A;  1S3O A;  1EFW A;  3RN5 A;  1SYE A;  3HOU G;  2RHQ B;  2F4V L;  1I50 H;  1EQR A;  4M1U B;  4A3F G;  4WFN 3;  4LF8 Q;  1T5E A;  1A15 A;  4FF2 A;  2KCN A;  3I2Z A;  1VQI A;  4JK1 C;  4JI5 Q;  2NN6 I;  5D65 A;  5E1F A;  2XNA C;  1YNJ C;  5ELE A;  4WJ3 M;  4YIJ A;  1ASY A;  3PUX A;  1ZXT A;  4OO1 G;  4DV1 L;  1PFB A;  5AFW A;  1GUO A;  2EZV A;  1PH6 A;  2QIL A;  3CW2 C;  3SXH A;  1QZH A;  3S2H B;  2EVB A;  1HQM C;  1I4P A;  3CPW A;  5LMN Q;  2K14 A;  3B6Y A;  3L9A X;  1CI3 M;  3MEF A;  1GXD C;  4A75 A;  5HGT A;  1DOK A;  2CWA A;  4XT1 B;  3STB C;  3K80 C;  3T1H L;  1SE2 A;  4JCV E;  3VR5 A;  3K81 C;  1VQL A;  1QOH A;  1D1I A;  3OHX C;  1ASZ A;  4CBV A;  2A69 C;  1U4M A;  4QIW E;  3Q24 A;  3NEN A;  3AYH B;  1N36 L;  1TQO A;  3R2T A;  4DUZ L;  4L5T A;  4LF5 L;  2D2C C;  3KF8 A;  1RJT A;  2E2D C;  2QF7 A;  4UY8 C;  2RF4 A;  2BH8 A;  3KJO A;  4HJA A;  1KD1 C;  4R1J A;  3PO3 G;  1K0R A;  1AN8 A;  2K52 A;  1KAB A;  3SEB A;  2EDG A;  3HKS A;  1LT4 D;  3G6J B;  4DNR B;  3L3O C;  2N55 A;  2O5J C;  1R9T B;  4JBK A;  3EJI A;  2QKI C;  3CKI B;  2RDH A;  3E9H A;  3HP3 A;  4LW1 A;  5C4X B;  4ULL A;  2PQA B;  3Q23 A;  1Y1W H;  2VL6 A;  4HCS A;  3H0G H;  3P75 A;  3VR3 A;  1K8O A;  1B1Z A;  1X3F A;  5ELO A;  4RHR A;  4JI6 Q;  1IBL Q;  2JA8 H;  2MO1 A;  2Q8R E;  5FO8 B;  2L0C A;  4GKK L;  4IUR A;  3I4N B;  1SMY D;  2UU9 L;  3K0X A;  3V96 A;  1CT1 D;  3AU7 A;  1ZKO A;  2B8F A;  2ZXR A;  1Q1B A;  2KCM A;  3TRE A;  5IYD G;  3S16 H;  3I4M G;  1JT8 A;  3PIP 3;  2CFM A;  2NB0 A;  3S9W A;  1PTO F;  4K6D A;  1NTG A;  3NWS A;  4PQX A;  1E2W A;  1TS4 A;  1SE4 A;  1LTI D;  1OXU A;  3H91 A;  3GTP H;  3A54 A;  5DLQ E;  1L1O A;  1JQY D;  1D8L A;  1O7I A;  3HOY B;  5IGB A;  2CW0 D;  1HQR D;  3IKJ A;  1WTQ A;  3PUY A;  4NDX A;  3BVM A;  4DR1 Q;  4LF8 L;  4IFD I;  1EIH A;  2ZJQ A;  1M1K C;  5GQO A;  2JN4 A;  1IL2 A;  3I8Z A;  4UP9 A;  1PH2 A;  3M4Q A;  4JI5 L;  4BBS H;  4IZ8 A;  4JG2 A;  1VQ4 A;  2EYH A;  1DON A;  1IBM Q;  2EYO A;  5J1Z A;  5FKA C;  1BUV T;  2LFN A;  3QB3 A;  5C44 H;  4HJ5 A;  3R8B A;  1SYB A;  3Q22 A;  1GM5 A;  3RZD H;  4GLV B;  3S1R H;  1EYC A;  5JEA H;  4NKL A;  5F2D A;  2RKS A;  1PH3 A;  2I0Q A;  1PRT F;  3RR5 A;  2DNE A;  1K8M A;  1S5D D;  5LMN L;  1X3P A;  4OWW B;  1MKH A;  1S4Z A;  5T1I A;  5J22 A;  1EOT A;  3DEO A;  1FL0 A;  4ZK9 B;  3HRZ C;  2PQE A;  3MXN A;  1W2B A;  1HA6 A;  2C35 B;  1MSG A;  2JYO A;  1O80 A;  5C5L A;  1OXS C;  1ROD A;  2F0F A;  1SEB D;  1NE3 A;  2OEO A;  5BN4 A;  3HOW G;  1L0W A;  1LTL A;  3OOC A;  3K0Y A;  5M5Y H;  1BCP D;  5D14 A;  1OO9 B;  3W3A A;  2FFK B;  3NWT A;  4F87 A;  5EKK A;  2K5H A;  4DV6 Q;  2NZ1 D;  1RIP A;  3E0E A;  2NVT B;  5K36 G;  1BCP B;  4CGY B;  2G9H D;  3MZ5 A;  1BDO A;  3S2H H;  3G4S A;  2NVX B;  5E3F A;  5IP7 H;  5JVG 3;  1L2F A;  2B39 A;  4HIO A;  4RGO S;  2LS0 1;  4K8I A;  2M9V A;  3A5U A;  4WOR A;  4B3M Q;  1GJX A;  3KF8 B;  1KNE A;  1F2Y A;  2K5D A;  1VQ8 A;  4B3R L;  2PZT A;  1IBL L;  5JAV A;  1B7Y B;  3CMA A;  5A35 A;  5ELD A;  2KBN A;  3K5N A;  3Q8D A;  1SR3 A;  4K14 A;  1K28 A;  2XTI A;  4KY6 A;  2IL8 A;  4X3U A;  4XDX A;  5M5X B;  2EJG C;  4LUO A;  5M3M H;  3W1G A;  3DUZ A;  2ENB A;  2F0W A;  5C4Z A;  4QQB X;  2J0T D;  4I65 A;  3CRK C;  1XXG A;  1U4R A;  2RSO A;  1GHJ A;  2LY7 A;  2HDL A;  3URY A;  2Y0S B;  3FP9 A;  3CU7 A;  1KLG D;  5C4X H;  3O13 A;  2D9U A;  2AQ3 B;  4ZCK A;  3LNN A;  3C1F A;  4OON A;  4MZ9 A;  3KF6 B;  1SNO A;  4DR1 L;  2RQX A;  1VDZ A;  4L8J A;  2R93 B;  2VNU D;  1CM9 A;  3I4N H;  2N78 A;  3R93 A;  4IOA A;  3IFD A;  1GUN A;  1PZK D;  4O2D A;  1F2M A;  1VQF A;  4XYQ A;  3MFG A;  4PV1 C;  5DEH A;  3QWN A;  3GTK B;  2A1A A;  1MGS A;  2WB1 E;  4DK6 C;  4K2L A;  3DWA A;  2JA6 G;  2IHF A;  2F0S A;  4DV2 Q;  3A7L A;  1L1O B;  1EYG A;  2Q2U A;  1YJW A;  1CA6 A;  1FJG Q;  2RHS B;  3PIO A;  4RFB A;  3VYR A;  2F3V A;  1XNQ Q;  5FJ8 G;  3HOY H;  2F03 A;  1X6O A;  3MA2 B;  3J7A 5;  3MXP A;  1STY A;  2UXB Q;  2KED A;  2WB1 G;  2VUM G;  4FF1 A;  4HIM A;  1YJN A;  1K8A C;  2F3I A;  2JA5 G;  2YTV A;  5EKL A;  1QZG A;  4XTC S;  4FYD A;  4TKO B;  2F4I A;  1VQ9 A;  2JA9 A;  3MVV A;  4C56 C;  2UUA Q;  4O1N A;  3AB9 A;  1WTH A;  1SMY C;  3U9O A;  4TQU S;  5EQ0 A;  4QF4 A;  4DV6 L;  1PH7 A;  3M9B A;  3I91 A;  3RN2 A;  5FLX E;  2HDM A;  2DJF C;  2FXQ A;  2NZH A;  1A2T A;  2BCO A;  2NUC A;  2EY2 A;  4PZ7 A;  2AQ1 B;  2EY1 A;  4DXG A;  3MXN B;  5L37 A;  3CAM A;  4BXX H;  3HG9 A;  1TVX A;  4R4O A;  3TEH B;  1HTL D;  2E76 C;  4JW0 A;  3S15 B;  2IWH A;  2UXC Q;  1NY4 A;  1PFM A;  3I4L A;  4CJ2 C;  2E5L L;  4B3M L;  4R4I A;  5I9P A;  1I4Q A;  2A6H D;  2CW0 C;  3MC0 B;  3HOV B;  4X3S A;  4F88 A;  1E22 A;  1LYL A;  3QOJ A;  3HKZ B;  5JJL A;  2HCI A;  4JYA Q;  1Y1V B;  1JC7 A;  4A93 G;  4CJ1 B;  4LUV A;  1GVP A;  4DV4 Q;  5I2Y A;  2E74 C;  2NVT H;  1EIG A;  2LKV A;  3S24 A;  3TDQ A;  2RDF A;  2N88 A;  3GTO B;  1C8C A;  4XQJ A;  1VF5 C;  3BZK A;  1X65 A;  3KUP A;  2NVX H;  2CHB D;  4A3D B;  1CK1 A;  1QUQ B;  3ITP A;  3M4Y A;  5EBD A;  1VMC A;  2X6L A;  2I46 A;  1BKB A;  2AMC B;  2KEN A;  1G51 A;  3CQZ B;  1LTS D;  4FVM A;  4A3B B;  3BVZ A;  2Q2T A;  1ILQ A;  1KRS A;  2AWO A;  1VQO A;  4KHP L;  4PMC A;  3EQL C;  4DUY Q;  4BY1 B;  4Y7N H;  1HZ9 A;  1EWC A;  4KJO A;  2EY6 A;  1Q46 A;  1BBX C;  2F0M A;  1BCP C;  5C3X A;  3GV3 A;  4POF A;  2JXM B;  5M5X H;  4DV0 Q;  2K5N A;  4JI8 Q;  5FLM G;  3JAM c;  2SNS A;  2HD3 A;  1K8G A;  3AEV A;  3D6W A;  4DKA C;  3TME A;  1HR0 Q;  2E2J B;  1UEB A;  4GN3 B;  1B70 B;  4HMI A;  3F1Z A;  4DV2 L;  4CDC C;  1OXT A;  2PMZ B;  2FHT A;  3FEW X;  4XXE A;  2IX0 A;  4A76 A;  1FJG L;  2NN6 G;  1YEZ A;  2IHE A;  1S5B D;  1HNW Q;  1I3Q B;  2A5H A;  1CSQ A;  2DUD A;  1VQD A;  3BVG A;  1DCZ A;  1C48 A;  1XJV A;  2QGQ A;  3D31 A;  3WOF A;  3CCV A;  2BA0 A;  1SYC A;  3NBH A;  2R93 H;  5C0X H;  4GZY C;  4J6H A;  2R7D A;  4KV6 A;  4J8Q A;  2MP1 A;  2Z4I A;  4A3J G;  1N33 Q;  1HH2 P;  3KBX A;  3I7F A;  4DK0 A;  1Z7T A;  4UPA A;  3FVQ A;  3GTK H;  3FKI G;  3HOU B;  3BYT B;  4QL5 A;  3VR6 A;  1KRT A;  3GTL B;  3LWE A;  1BF4 A;  4A3F B;  1KLU D;  4LWC A;  1HZB A;  4KN7 C;  1I94 L;  4YY3 Q;  4PZ6 A;  3A55 A;  1V1Q A;  2K01 A;  1NUC A;  2Z1C A;  4RGN A;  3J80 i;  5LMU L;  1JWS D;  2UXC L;  1KAA A;  3A8I E;  4BBR B;  1LTT D;  4DR7 L;  2Z9H A;  2GVA A;  1VQG A;  1TY2 A;  1DOL A;  2F0U A;  4DF7 A;  3BU2 A;  4V19 0;  2F3W A;  4WRD A;  2MNA A;  2JA7 G;  4GKJ L;  4JYA L;  1F9Q A;  1FNW A;  1NNX A;  5D3I B;  2R92 G;  4DV4 L;  1JR0 D;  1C7Y A;  4I7A A;  5IE8 A;  4FXK C;  3SDZ A;  3T1H Q;  3OSO A;  5C3W A;  4K6L A;  3A74 A;  1Z9F A;  2Z8L A;  4A3C H;  3K5M A;  2A74 C;  1L1O C;  3HFZ B;  2B3G A;  2SNM A;  3PV0 A;  2PYK A;  1C0A A;  1EL0 A;  5JOB A;  4DUZ Q;  3S15 H;  3VDY A;  3D3R A;  4B08 A;  2B2U A;  4HJ7 A;  1X3Q A;  1G2S A;  2KJX A;  1SN8 A;  1HUM A;  3HOV H;  4YWL A;  1WTV A;  3MHB A;  2CH4 A;  1Q82 C;  2WIN B;  5KGU A;  4HMJ A;  3PO3 B;  1I4X A;  1WOC A;  3I55 A;  1Y1V H;  4DUY L;  1STH A;  1TS2 A;  4RAU C;  2F0L A;  3S14 B;  2LXJ A;  1F9R A;  1HNZ Q;  4P73 A;  1G29 1;  3PO2 B;  4IJL A;  3M4O B;  1YIT A;  4JI8 L;  1SNC A;  4AIM A;  1YIJ A;  3GTO H;  1EEF D;  1IXR A;  2K1B A;  1RKN A;  3SHL A;  2MO0 A;  2Q8I B;  1HR0 L;  4C3J G;  1KL9 A;  4A3D H;  3JAM i;  1U9R A;  1VQM A;  3EVQ A;  3E0J A;  4DV7 Q;  5CMD A;  4GKK Q;  2ZTC A;  4P72 A;  1BNZ A;  1ICW A;  3TZD A;  3CQZ H;  2UU9 Q;  1X54 A;  1CUK A;  4A3B H;  1G2T A;  4N9T A;  1B9M A;  1EIY B;  2RSN A;  1ICF B;  4HCE A;  1LTG D;  2A6H C;  3I4M B;  1KHI A;  3D6C A;  2F0O A;  4BY1 H;  3RZO B;  2EJF C;  2L12 A;  2VQF L;  3EN2 A;  3NHH A;  3F2C A;  2E75 C;  1K3R A;  3K5L A;  1SFO B;  4YCW A;  4A3K G;  2H4O A;  4CKB A;  4A3L H;  2BH2 A;  1Q1E A;  3J81 i;  4IO9 A;  2E2J H;  2L9H A;  3MEH A;  3NSW A;  1VQH A;  4HSP A;  5HUR A;  4K8J A;  5TSS A;  1KAW A;  4EQ5 A;  4YY3 L;  5C0X I;  1I3Q H;  1PZJ D;  3SE0 A;  3NBH B;  2CQO A;  3F2U A;  1X9N A;  2K5V A;  3KJP A;  3CCQ A;  1ONL A;  1GUS A;  4N8F A;  5C4J B;  1CHP D;  2EYJ A;  5M3F G;  2DN8 A;  4K2K A;  4A3G G;  4A3I G;  2PI2 E;  1UUP A;  4LUZ A;  1HCZ A;  1ENF A;  4KMU C;  2N3S A;  3IAY A;  1B9N A;  3HOU H;  2L15 A;  5J3B A;  1FVI A;  3GTL H;  4DAY A;  4NMZ A;  4A3F H;  1TS5 A;  3BYY B;  1GHK A;  3MAQ A;  1VQ5 A;  1BBW A;  5EAY A;  2A68 D;  3HOW B;  1OTC A;  1SLJ A;  3DWQ A;  5IYC G;  2JP1 A;  3ERQ A;  1I6H B;  1X55 A;  1BR9 A;  2WP8 J;  3V05 A;  3UDX A;  4TRD A;  4BBR H;  4OO1 H;  1IHZ A;  3NBI A;  1SE3 A;  2ES2 A;  4JI2 Q;  1DJR D;  1QB5 D;  3G71 A;  1NR4 A;  4F7X A;  2R7Z G;  4PMB A;  2EOT A;  1BCP F;  3SR1 A;  1WD1 A;  2JA8 G;  3UE1 A;  4JI1 L;  3I72 A;  3GTJ B;  1HNZ L;  1STA A;  5IGE A;  1EY5 A;  2F0T A;  1N8R C;  2OCE A;  5KEE A;  1R4Q B;  3ULJ A;  2XGT A;  2Z0S A;  2I5H A;  2M00 A;  2XN9 C;  3GP7 A;  1RL2 A;  3CCJ A;  1EOV A;  4EQO A;  1KIX A;  4B3R Q;  2WAQ E;  2RBM A;  1LV9 A;  4DV7 L;  5JPN C;  3R3O A;  1OXV A;  3ULP A;  5IGC A;  3KF6 A;  4IOC A;  3A56 A;  4H44 C;  2EE1 A;  3C1E A;  1ET6 A;  1AZP A;  4GOP A;  1F9S A;  1QNK A;  4LFB Q;  2F0P A;  4KD3 A;  3F8T A;  4OIK A;  3OTO L;  4JI3 L;  5KYI A;  3PO3 H;  1AZQ A;  1WVL A;  5D3D A;  3GV6 A;  4LK1 C;  2PW7 A;  3NXW A;  2EIF A;  3S14 H;  1IKL A;  1HFG A;  1EYA A;  2F0D A;  3PO2 H;  4CJ0 B;  3M4O H;  1ZYR D;  4CKC A;  1LT6 D;  2A6E D;  5A2Q E;  5JJZ A;  4IUQ A;  1VQ7 A;  3W1B A;  1QG7 A;  4GS3 A;  3KLS X;  2HT1 A;  5C44 G;  3CCL A;  4XQQ A;  4C1N K;  3D4D A;  4ZQ3 A;  4F8M A;  2F52 A;  3HOX G;  1WD0 A;  3ULL A;  3CCM A;  1DXM A;  3PSI A;  4DN4 M;  4A3E G;  1SJE D;  5EGT A;  2NVQ B;  1XPO A;  1PZI D;  1II3 A;  5JVH 3;  2B63 G;  1MIU A;  5IYD H;  3I4M H;  1Q8K A;  3RZO H;  5E4X A;  1O7Z A;  2JA6 B;  1P8L A;  1Q81 C;  4XIG S;  4QY7 A;  1P16 A;  4AH6 A;  3J7A V;  2HIV A;  2B2W C;  1RHP A;  1SFO H;  3NUC A;  3E3X A;  4AQY Q;  1MHW C;  2Z4H A;  4DXF A;  4APV A;  3OYY A;  2ID0 A;  3S2D B;  3NTK A;  3KFU A;  2VQE Q;  5GAE C;  2R7F A;  2WB1 B;  3HOZ G;  2ZXP A;  1NMG A;  2VUM B;  1J5E Q;  3TBI B;  2JA5 B;  1E2V A;  4CHT B;  2NTS A;  3M7G A;  3HEJ A;  4O42 A;  3U4V A;  1H9S A;  3UDG A;  3OIP A;  3PGZ A;  4DK3 C;  3TP8 A;  3AMU A;  4CDD C;  5C4J H;  2D0O A;  4LF7 L;  2R61 A;  4BA1 I;  4JI2 L;  3TS2 A;  1RDP D;  3T56 B;  2NZO A;  3ND8 A;  3M85 A;  4IUV A;  1CQF A;  4DFA A;  2IY5 B;  3G6E A;  1JJ2 A;  2KCT A;  4DAY B;  5GAD C;  1VQP A;  1V1P A;  2QEX A;  3PUZ A;  5ELC A;  1H9K A;  1QUQ A;  4TVA B;  2RA4 A;  2E5L Q;  1PH8 A;  4X66 Q;  3OW7 A;  5IOD A;  4BS9 A;  3J80 L;  4OO1 I;  5LHY 1;  5M3M G;  3HOW H;  2JQO A;  3FHW A;  5CV8 A;  1F2L A;  4HN7 A;  4KKT A;  2UUB Q;  1I6H H;  4A93 B;  3DWP A;  3RMH A;  2F1M A;  4YCU A;  3DM3 A;  3TP5 A;  5K36 H;  4DGZ A;  4A3M B;  1WTX A;  4QUC A;  2Q2I A;  1EWI A;  1X56 A;  3X3M A;  2H1E A;  1WCM G;  4LFB L;  5C4X G;  3ERS X;  3QIA A;  4HSV A;  1K3B C;  4QGU A;  4WJW A;  1MI2 A;  3TP6 A;  1Q7Y C;  2N8N A;  3GTJ H;  4M8A A;  1JE4 A;  1PFN A;  1R9T H;  1LTB D;  2EJM A;  4Q0F A;  1SDF A;  1B2T A;  3KDF A;  1DOM A;  1BVS A;  4DA2 A;  1TU2 B;  5BR8 Q;  4IN3 A;  1EZ6 A;  1QE6 A;  5IOC A;  1WJJ A;  4KHP Q;  2WV6 D;  5JJK A;  4GOP B;  3A0J A;  3KLW A;  2A68 C;  3D4W A;  1H95 A;  4DAP A;  3D8G A;  1EY7 A;  2WFW A;  1TKW B;  1Q12 A;  1QVF A;  1UAP A;  4CDE C;  4ZUI A;  3M7N A;  3HOY G;  2VZA A;  5KNC A;  2D5D A;  3K59 A;  4LF9 Q;  1LAB A;  1PYW D;  3T51 B;  1J6Q A;  4YHH Q;  4P71 A;  2K5W A;  2MUY A;  2DY8 A;  4AQY L;  1STG A;  3JAM L;  2PZU A;  1I5F A;  1Q90 A;  4POG A;  1V43 A;  3DXJ C;  3VR2 A;  2VQE L;  1BO0 A;  1J5E L;  1HRJ A;  2B2U C;  4LF6 L;  4KKU A;  4KHZ A;  4QUF A;  4HAE A;  5JJI A;  2JE6 I;  5C3E B;  1FR3 A;  3CC4 A;  4ILW A;  4A3J B;  4RWS C;  5IP9 G;  2NVQ H;  5E4W C;  4L5R C;  1RF2 D;  1YNX A;  3T1Y Q;  4HR7 B;  4YWM A;  2B2T C;  4X65 Q;  1DD2 A;  2B2Y A;  1CKM A;  3NK9 A;  4OXP A;  1K73 C;  4KLK A;  3J80 c;  3J81 L;  1I94 Q;  3SGI A;  1M4V A;  1XPU A;  4C3H G;  1A2U A;  1STN A;  3CC7 A;  5LMU Q;  1CFM A;  1ZYR C;  3S2D H;  3OWF A;  3DHQ A;  1AW7 A;  2M2L A;  2A6E C;  3AFP A;  4DR7 Q;  1X32 A;  4C2M B;  1H9S B;  2VUM H;  4X66 L;  2L55 A;  5C5M A;  3U50 C;  5ELN A;  2JA5 H;  3ER0 A;  1F9P A;  3S1M B;  1BOS A;  2WKC A;  1HPC A;  1YZ6 A;  5EJW A;  2JK8 A;  4ME5 A;  4GKJ Q;  2JA7 B;  5BN3 A;  2UUB L;  1UE5 A;  4U67 3;  1Y69 U;  2R92 B;  5COR A;  5IIF A;  2F0E A;  1WYD A;  1A8V A;  2AHO B;  5G3L D;  1NSN S;  1PHJ A;  4B3T Q;  1ESR A;  1NAP A;  1EEI D;  1V1P B;  1HR0 W;  2B2W A;  2MPM A;  4IPG A;  1EU4 A;  2PNH A;  1IKM A;  2EYF A;  2NTT A;  1XMQ Q;  5ELB A;  1KDB A;  2ICE C;  4MIU A;  2AUJ D;  2L5T A;  5BR8 L;  3GTQ B;  4E6I A;  4JBJ A;  3V2T A;  3NTH A;  4P74 A;  4A93 H;  3MTS A;  1F77 A;  4R8I A;  1CZW A;  1C9O A;  4U68 A;  2IX3 A;  5DNF A;  4A3M H;  3I73 A;  3GTM B;  3HGB A;  3ONA B;  5I4D A;  4C3J B;  3H15 A;  4LF9 L;  3KDF B;  4YHH L;  2VXW A;  3A8K E;  1HA5 A;  5C4H A;  3NTI A;  1E2Z A;  4B9W A;  3I90 A;  3I56 A;  4RHS A;  3RD4 A;  3ZYY X;  5DM7 3;  4KY5 A;  1VF7 A;  2CH4 W;  1YJ9 A;  1YHB A;  1I50 B;  1GO3 E;  1AH9 A;  4OX9 L;  2VQF Q;  5CBE E;  2YU9 B;  5CV9 A;  3J81 c;  2NBF A;  1DGS A;  4A3K B;  5FLM H;  4ODG A;  3H94 A;  2F0K A;  1CKN B;  3FPU B;  3T1Y L;  2QW7 A;  5T1G A;  5LL6 S;  1SRU A;  4IUP A;  4DV5 Q;  4X65 L;  3HZX A;  1IYJ B;  1FD7 D;  1HUN A;  2IX1 A;  4GLA C;  3A8J E;  4X3K A;  3OW2 A;  1MBY A;  1XPR A;  3X3N A;  5FO9 B;  2BA1 A;  2LSS A;  3UDI A;  2MQH A;  3J7A F;  4DNT B;  1M8A A;  1NMF A;  1MD2 D;  2YV5 A;  3PMF A;  2K50 A;  4GOP C;  4P75 A;  5M3F B;  3M3Y B;  3Q6S A;  5C3E H;  5H1S E;  1YBY A;  1FNV A;  4A3G B;  4A3I B;  2NYZ D;  2KUM A;  2JEB I;  2DY7 A;  2XRS D;  2HHH Q;  3HKZ E;  1SNM A;  1Z6H A; 
#chains in the Genus database with same CATH homology
 3K5O A;  4QB4 A;  1AFP A;  2XWJ B;  3BS1 A;  2FMM A;  1HFN A;  1TY0 A;  2PPB C;  4FXG C;  2BDO A;  1QNU A;  5I9O A;  2E2H B;  2CVR A;  5C6A A;  1GUG A;  1WTR A;  4RH6 A;  2XWB B;  3FMC A;  2C9O A;  1PRT C;  1Q3L A;  1JOK A;  1AP0 A;  4K5W A;  1G6Z A;  1J9O A;  1B3A A;  2NVY B;  4FXD A;  4QIW B;  1SND A;  2R7Z B;  1QCB D;  4P2C B;  2VB3 X;  1ESF A;  1D2B A;  1F2Z A;  1ET9 A;  2I07 B;  4RKL A;  1HHV A;  2B2T A;  1S5E D;  4RGT A;  1QIL A;  2D62 A;  1W6J A;  1D1K A;  1AEX A;  1STE A;  3OWE B;  2F0H A;  1NR2 A;  3D4R A;  3TN2 A;  2QEJ C;  3GQB A;  4IFD G;  4Z9C B;  2IT1 A;  4ABN A;  1D5M C;  1H9R A;  4R8N A;  5IT9 E;  3KK7 A;  3VR4 A;  5CV7 A;  1JCK B;  2K33 A;  1K83 B;  4C3I G;  1TWH B;  1TWF B;  1KTK A;  1LTR D;  3H3V C;  5M9O A;  3W2D A;  3CHB D;  2RDG A;  3MFY A;  3I3C A;  1JB3 A;  5CV4 A;  4KN4 C;  2K5Q A;  2L1B A;  4EQN A;  1SBB B;  3U9S A;  4KK7 A;  3HOX B;  3P1H A;  3H09 A;  4A3E B;  3NE5 B;  2F0Q A;  2EYM A;  2NWG A;  2K04 A;  1ENA A;  1JOO A;  2B63 B;  1L0X B;  3NP8 A;  1UNS A;  1WTO A;  4UDU C;  3VA5 A;  1EQT A;  3K7A B;  3ERO A;  4L6T B;  1LTA D;  2L4N A;  5M5Y B;  5EPJ A;  3VYT A;  1EQV A;  2BOS A;  3EFX D;  3HOZ B;  4HTH A;  3K58 A;  1SJH D;  1SAP A;  4FF3 A;  4IFD J;  4HED A;  1Z47 A;  3QO2 A;  1QWY A;  3OIQ A;  4H7B A;  4DK1 A;  2MGS A;  5CV6 A;  2SDF A;  1JWM D;  1TWG B;  3GTG B;  1PMR A;  2PZW A;  1U4L A;  3CRL C;  1I4G A;  1GOZ A;  1LT5 D;  3H6M A;  3GD7 A;  3LX0 A;  1NCV A;  3OMG A;  2O4X A;  4ZAI A;  3BDC A;  1H9M A;  1LLR D;  5M3M B;  1IW7 C;  4L63 B;  4KKS A;  4BWG B;  1GUW A;  1LO5 D;  2TMP A;  3BDL A;  3S1Q B;  4H13 C;  4OL7 A;  1WCM B;  4BA2 I;  3SK6 A;  2FJ2 A;  3K6O A;  2B2Y C;  5ELF A;  1O7Y A;  2WII B;  1EY4 A;  3MXU A;  2Q8T A;  1CHQ D;  2IPK D;  2K32 A;  5FLX L;  1JOR A;  5DAU A;  4NW2 A;  2OF1 A;  3A7A B;  2CQA A;  5EPK A;  5ISR A;  3TSS A;  2SOB A;  5FO7 B;  5JEA G;  3PIO 3;  2HUG A;  2FIN B;  1Y8N B;  3VA7 A;  2B2V A;  4IQZ A;  3MWY W;  2E2I B;  1EFI D;  2ZT9 C;  1T5X D;  4QMG A;  3SK5 A;  5IGD A;  5EBC A;  1O7L A;  2K03 A;  1CA5 A;  5LL6 X;  2K6A A;  1BXT A;  3NQT A;  1R4P B;  3LWU A;  1A6X A;  5KIX A;  1DYQ A;  1EY9 A;  1G8Z D;  1KDC A;  1XYI A;  3PUV A;  4RKB A;  1XTC D;  3QG1 A;  1EY6 A;  2KA7 A;  4EQP A;  2B8G A;  3FDT A;  1JOQ A;  4CKE A;  5EKI A;  5CGK A;  2K28 A;  1B53 A;  4XT3 B;  4C3H B;  1ILP A;  2F0I A;  3C46 A;  4KHV A;  1TWA B;  3RUZ A;  1RTN A;  1A3T A;  4DU9 A;  1YNN D;  1DZ1 A;  2O5I C;  4MHE A;  5JEA J;  3IL8 A;  3K57 A;  2PO4 A;  2EYP A;  2KHS A;  5I6W A;  1V8Q A;  4OIJ A;  2K05 A;  2AQ2 B;  2XRQ D;  2KOL A;  5JPM C;  4KI0 A;  1UEA B;  2XSC A;  4RA8 A;  4Y7N B;  1PTO D;  3IFT A;  5G3L F;  3Q0A A;  1EU3 A;  2BE5 D;  1PTO B;  2EYL A;  2SEB D;  1ENC A;  1L0Y B;  5IGF A;  4N9P A;  5CBA E;  1RD9 D;  4ZRZ A;  5CV5 A;  3BDO A;  2LMC B;  4JBW A;  4RCO A;  4C1N I;  1S5C D;  4G4K A;  1D5Z C;  2A73 B;  4V0B A;  3FPP A;  2ICI A;  2PCF B;  4ZUJ A;  2O2L D;  2EPB A;  3C2P A;  3E6Z X;  2AUK A;  3EA6 A;  5K5P A;  1SYD A;  1FYC A;  1PRT D;  4S3S A;  4EVO A;  1D5X C;  2L11 A;  5M5W B;  1PRT B;  4OHJ A;  4Q5V A;  2ZXO A;  2IJ0 A;  3ND9 A;  1A3V A;  2FMC A;  4J1M A;  3T13 A;  3N6R A;  3S17 B;  2K7V A;  5CC4 A;  1U4P A;  2HQE A;  3HS0 C;  1B50 A;  3RLF A;  3C3L A;  2F0J A;  3FKI B;  2AWN A;  2YYZ A;  4FP5 D;  3PUW A;  1A3U A;  3QOL A;  1CQV A;  1DM0 B;  4QCL A;  2TSS A;  1VCI A;  3J7Y W;  4G7H C;  1FGB D;  1CTM A;  2MHV A;  2JSO A;  1D6E C;  1EYD A;  2OXP A;  4UAI A;  2KQ3 A;  2KVM A;  1TR5 A;  2KEE A;  4KY7 A;  1S5F D;  5IT9 L;  3QJY A;  5KND A;  1BQQ T;  2QCP X;  1EY8 A;  1TT2 A;  2EXZ A;  5EPL A;  4MN3 A;  5KNB A;  1EY0 A;  3T53 B;  4G7O C;  4LAA A;  4FNF A;  4BY7 B;  1WTP A;  4LMQ D;  4ZLT F;  1B4O A;  4KJN A;  1TWC B;  5DM6 3;  1PDQ A;  1IYV A;  3N52 A;  1G91 A;  1EWH A;  3S1N B;  5I6Y A;  2WAC A;  1YNJ D;  1OXX K;  1B44 D;  4G57 A;  4DAV A;  3G7L A;  4AYB B;  4RCN A;  2R6G A;  3UI2 A;  4IUT A;  5C0X G;  1C4Q A;  3WDN A;  1WTW A;  2PW5 A;  3T16 A;  4C3I B;  2VB2 X;  1E0B A;  2KEC A;  1JIC A;  1EZ8 A;  2G9D A;  1PTO H;  1I4R A;  3VYU A;  3J80 E;  3KLR A;  2X69 A;  2A69 D;  5CYU A;  5KYL A;  1Y8P B;  4ZKC B;  3KBG A;  1YNN C;  1ZEQ X;  1SYF A;  4FF4 A;  3TP7 A;  2F0N A;  2GA4 B;  1STB A;  1IL8 A;  4FO2 A;  1VMP A;  1IW7 D;  3DEP A;  1Y8O B;  3FRP B;  2BDN A;  4ID6 A;  1FNU A;  2NN6 H;  4K5V A;  2DNC A;  4XYO A;  2J4X A;  5IGG A;  1PTO C;  3R2I A;  1PLF A;  1LAC A;  1IYU A;  2MJ8 A;  2BE5 C;  4K5X A;  1RTO A;  4OGQ C;  3OMC A;  3T4A C;  2F0G A;  1SXT A;  2WKD A;  3DMU A;  3NQI A;  3KLS A;  1CZG A;  1JWU D;  1ML0 D;  3SVM A;  1H9J A;  4X3T A;  4IUU A;  1KNA A;  1RCV D;  1SYG A;  3VYS A;  4H0L C;  4B9X A;  4ZKB B;  2XIW A;  1MSH A;  3WOE A;  3L7Z C;  2X6G A;  2RVL A;  3JAM E;  1Q8I A;  4IAL A;  1XX8 A;  1SNQ A;  5C0X J;  1TS3 A;  4ZYS A;  4EGV A;  3NPP A;  5A2Q L;  5NUC A;  1O78 A;  1LT3 D;  1HTP A;  2B2V C;  1Y1W B;  1PXU A;  3H0G B;  5COY A;  5CR3 A;  1W6K A;  5J39 A;  2V4D A;  3I70 A;  2JA8 B;  2EY5 A;  3GO5 A;  3P20 A;  3SK4 A;  2OT2 A;  5KRU A;  2IW3 A;  5FK9 C;  2HCC A;  4I7Z C;  3TZU A;  3OPO A;  4KTA A;  3P7J A;  5BN5 A;  1QJO A;  2C5C A;  4R9W A;  3J81 E;  4PNY A;  3S16 B;  5FOB B;  1SSO A;  3BG3 A;  1KDA A;  1J8I A;  3BZD B;  5I2X A;  4PMW A;  3GTP B;  2XVS A;  2WAQ B;  4KD4 A;  4IUN A;  3MXG A;  3SK8 A;  1V1O A;  1SNP A;  4BBS B;  4XQN A;  4NP5 A;  4TSS A;  2PNR C;  4LJZ C;  4IFD H;  1I6V C;  2KCC A;  2F0V A;  5C44 B;  1I4H A;  1HXY D;  2R3Z A;  3RZD B;  3S1R B;  2QDB A;  1XWE A;  4RGM A;  3DM1 A;  3E5S A;  4G7Z C;  2JEA I;  2J7Z A;  1TII D;  1GUT A;  1SYE A;  4M1U B;  4WFN 3;  1T5E A;  1A15 A;  4FF2 A;  2KCN A;  4JK1 C;  2NN6 I;  5D65 A;  5E1F A;  2XNA C;  1YNJ C;  5ELE A;  4YIJ A;  3PUX A;  1ZXT A;  4OO1 G;  1PFB A;  5AFW A;  1GUO A;  2EZV A;  2QIL A;  3SXH A;  3S2H B;  2EVB A;  1HQM C;  1I4P A;  3L9A X;  1CI3 M;  1GXD C;  5HGT A;  1DOK A;  4XT1 B;  1SE2 A;  3VR5 A;  1QOH A;  1D1I A;  3OHX C;  4CBV A;  2A69 C;  1U4M A;  3Q24 A;  1TQO A;  3R2T A;  2D2C C;  3KF8 A;  1RJT A;  2E2D C;  2QF7 A;  1AN8 A;  1KAB A;  3SEB A;  2EDG A;  1LT4 D;  3G6J B;  4DNR B;  3L3O C;  2N55 A;  2O5J C;  1R9T B;  2QKI C;  3EJI A;  3CKI B;  2RDH A;  3HP3 A;  5C4X B;  4ULL A;  3Q23 A;  4HCS A;  3P75 A;  3VR3 A;  1K8O A;  1B1Z A;  4RHR A;  2Q8R E;  5FO8 B;  2L0C A;  4IUR A;  3I4N B;  1SMY D;  3V96 A;  1CT1 D;  3AU7 A;  1ZKO A;  2B8F A;  2ZXR A;  1Q1B A;  3PIP 3;  2NB0 A;  3S9W A;  1PTO F;  4K6D A;  4PQX A;  3NWS A;  1E2W A;  1TS4 A;  1SE4 A;  1LTI D;  1OXU A;  3H91 A;  3A54 A;  1JQY D;  3HOY B;  5IGB A;  2CW0 D;  1HQR D;  3IKJ A;  1WTQ A;  3PUY A;  4NDX A;  3BVM A;  4IFD I;  1EIH A;  3I8Z A;  4IZ8 A;  1DON A;  2EYH A;  2EYO A;  5J1Z A;  5FKA C;  1BUV T;  2LFN A;  3QB3 A;  3R8B A;  1SYB A;  3Q22 A;  1EYC A;  5JEA H;  4NKL A;  5F2D A;  2RKS A;  1PRT F;  2DNE A;  1K8M A;  1S5D D;  1X3P A;  1S4Z A;  5T1I A;  5J22 A;  1EOT A;  3DEO A;  4ZK9 B;  3HRZ C;  2PQE A;  3MXN A;  1HA6 A;  1MSG A;  2JYO A;  1O80 A;  5C5L A;  1OXS C;  1ROD A;  2F0F A;  1SEB D;  2OEO A;  5BN4 A;  3OOC A;  3K0Y A;  1BCP D;  5D14 A;  1OO9 B;  3W3A A;  2FFK B;  3NWT A;  4F87 A;  5EKK A;  2NZ1 D;  2NVT B;  5K36 G;  1BCP B;  4CGY B;  2G9H D;  3MZ5 A;  1BDO A;  2NVX B;  5E3F A;  5JVG 3;  2B39 A;  4RGO S;  2LS0 1;  4K8I A;  2M9V A;  4WOR A;  1GJX A;  1KNE A;  1F2Y A;  2K5D A;  2PZT A;  5JAV A;  5A35 A;  5ELD A;  3K5N A;  4K14 A;  4KY6 A;  2IL8 A;  4X3U A;  4XDX A;  5M5X B;  2EJG C;  3DUZ A;  2ENB A;  2F0W A;  5C4Z A;  2J0T D;  4I65 A;  3CRK C;  1XXG A;  1U4R A;  2RSO A;  1GHJ A;  2LY7 A;  2HDL A;  3URY A;  2Y0S B;  3CU7 A;  1KLG D;  3O13 A;  2D9U A;  2AQ3 B;  3LNN A;  3C1F A;  1SNO A;  2RQX A;  1VDZ A;  4L8J A;  2R93 B;  2VNU D;  1CM9 A;  3R93 A;  3IFD A;  1GUN A;  1PZK D;  1F2M A;  4XYQ A;  3MFG A;  4PV1 C;  5DEH A;  3QWN A;  3GTK B;  1MGS A;  4K2L A;  3DWA A;  2F0S A;  3A7L A;  1CA6 A;  4RFB A;  3VYR A;  2F3V A;  2F03 A;  3MA2 B;  3MXP A;  1STY A;  2KED A;  4FF1 A;  5EKL A;  4XTC S;  4FYD A;  4TKO B;  2F4I A;  3MVV A;  4C56 C;  4O1N A;  3AB9 A;  1SMY C;  3U9O A;  4TQU S;  5EQ0 A;  4QF4 A;  3I91 A;  5FLX E;  2HDM A;  1A2T A;  2BCO A;  2NUC A;  2EY2 A;  2AQ1 B;  2EY1 A;  4DXG A;  3HG9 A;  1TVX A;  1HTL D;  2E76 C;  3S15 B;  2IWH A;  1PFM A;  3I4L A;  4CJ2 C;  5I9P A;  1I4Q A;  2A6H D;  2CW0 C;  3MC0 B;  3HOV B;  4X3S A;  4F88 A;  3QOJ A;  3HKZ B;  2HCI A;  1Y1V B;  1JC7 A;  4CJ1 B;  5I2Y A;  2E74 C;  1EIG A;  2LKV A;  3TDQ A;  2RDF A;  2N88 A;  3GTO B;  1C8C A;  4XQJ A;  1VF5 C;  3KUP A;  2CHB D;  4A3D B;  1CK1 A;  3ITP A;  3M4Y A;  5EBD A;  1VMC A;  2X6L A;  2I46 A;  3CQZ B;  1LTS D;  4FVM A;  4A3B B;  3BVZ A;  1ILQ A;  2AWO A;  4PMC A;  3EQL C;  4BY1 B;  1EWC A;  4KJO A;  2EY6 A;  1BBX C;  2F0M A;  1BCP C;  5C3X A;  3GV3 A;  2JXM B;  2SNS A;  3D6W A;  3TME A;  2E2J B;  4HMI A;  1OXT A;  2PMZ B;  2FHT A;  3FEW X;  4XXE A;  2IX0 A;  2NN6 G;  1S5B D;  1I3Q B;  2A5H A;  3BVG A;  1DCZ A;  1C48 A;  3D31 A;  3WOF A;  2BA0 A;  1SYC A;  3NBH A;  5C0X H;  4GZY C;  4J6H A;  4KV6 A;  4J8Q A;  2MP1 A;  2Z4I A;  3KBX A;  4DK0 A;  1Z7T A;  3FVQ A;  3HOU B;  3BYT B;  3VR6 A;  3GTL B;  3LWE A;  1BF4 A;  4A3F B;  1KLU D;  4KN7 C;  3A55 A;  2K01 A;  1NUC A;  2Z1C A;  4RGN A;  1JWS D;  1KAA A;  3A8I E;  4BBR B;  1LTT D;  1TY2 A;  1DOL A;  2F0U A;  4DF7 A;  4V19 0;  2F3W A;  4WRD A;  1F9Q A;  1FNW A;  5D3I B;  1JR0 D;  4FXK C;  3SDZ A;  3OSO A;  5C3W A;  4K6L A;  2Z8L A;  3K5M A;  2A74 C;  2SNM A;  3PV0 A;  2PYK A;  1EL0 A;  5JOB A;  3D3R A;  4B08 A;  2B2U A;  1X3Q A;  1G2S A;  2KJX A;  1HUM A;  1WTV A;  3MHB A;  2WIN B;  5KGU A;  4HMJ A;  3PO3 B;  1I4X A;  1STH A;  1TS2 A;  4RAU C;  2F0L A;  3S14 B;  1F9R A;  1G29 1;  3PO2 B;  3M4O B;  1SNC A;  1EEF D;  2K1B A;  1RKN A;  3SHL A;  2Q8I B;  4C3J G;  1U9R A;  3EVQ A;  3E0J A;  5CMD A;  1BNZ A;  1ICW A;  3TZD A;  1G2T A;  4N9T A;  1B9M A;  2RSN A;  4HCE A;  1LTG D;  2A6H C;  3I4M B;  3D6C A;  2F0O A;  3RZO B;  2EJF C;  2L12 A;  3NHH A;  2E75 C;  3K5L A;  1SFO B;  2H4O A;  4CKB A;  1Q1E A;  2L9H A;  3MEH A;  3NSW A;  4HSP A;  5HUR A;  4K8J A;  5TSS A;  5C0X I;  3SE0 A;  1PZJ D;  3F2U A;  1ONL A;  1GUS A;  5C4J B;  1CHP D;  2EYJ A;  2DN8 A;  4K2K A;  1UUP A;  1HCZ A;  1ENF A;  4KMU C;  3IAY A;  1B9N A;  4DAY A;  4NMZ A;  1TS5 A;  3BYY B;  1GHK A;  3MAQ A;  3HOW B;  2A68 D;  3DWQ A;  2JP1 A;  3ERQ A;  1I6H B;  1BR9 A;  2WP8 J;  3V05 A;  4TRD A;  4OO1 H;  1IHZ A;  3NBI A;  1SE3 A;  1DJR D;  1QB5 D;  1NR4 A;  4F7X A;  4PMB A;  2EOT A;  1BCP F;  3SR1 A;  1WD1 A;  3I72 A;  3GTJ B;  1STA A;  5IGE A;  1EY5 A;  2F0T A;  5KEE A;  1R4Q B;  2M00 A;  2XN9 C;  3GP7 A;  4EQO A;  2RBM A;  1LV9 A;  5JPN C;  3R3O A;  1OXV A;  5IGC A;  3A56 A;  4H44 C;  2EE1 A;  3C1E A;  1ET6 A;  1AZP A;  1F9S A;  1QNK A;  2F0P A;  4KD3 A;  4OIK A;  5KYI A;  1AZQ A;  1WVL A;  5D3D A;  3GV6 A;  4LK1 C;  2PW7 A;  3NXW A;  1IKL A;  1HFG A;  1EYA A;  2F0D A;  4CJ0 B;  1ZYR D;  4CKC A;  1LT6 D;  2A6E D;  5A2Q E;  5JJZ A;  4IUQ A;  1QG7 A;  3KLS X;  4XQQ A;  4C1N K;  3D4D A;  4ZQ3 A;  4F8M A;  1WD0 A;  1DXM A;  4DN4 M;  1SJE D;  5EGT A;  2NVQ B;  1PZI D;  1II3 A;  5JVH 3;  5E4X A;  1O7Z A;  2JA6 B;  4XIG S;  3J7A V;  2B2W C;  1RHP A;  3NUC A;  2Z4H A;  4DXF A;  2ID0 A;  3S2D B;  3NTK A;  2WB1 B;  2ZXP A;  2VUM B;  3TBI B;  2JA5 B;  1E2V A;  4CHT B;  2NTS A;  3M7G A;  3HEJ A;  4O42 A;  1H9S A;  3OIP A;  3TP8 A;  3AMU A;  2R61 A;  4BA1 I;  1RDP D;  3T56 B;  3M85 A;  3ND8 A;  4IUV A;  1CQF A;  4DFA A;  1V1P A;  3PUZ A;  5ELC A;  1H9K A;  2RA4 A;  3OW7 A;  5IOD A;  4BS9 A;  3J80 L;  4OO1 I;  5LHY 1;  5CV8 A;  1F2L A;  4HN7 A;  4KKT A;  4A93 B;  3DWP A;  3RMH A;  2F1M A;  3TP5 A;  5K36 H;  4DGZ A;  4A3M B;  1WTX A;  4QUC A;  3X3M A;  2H1E A;  3QIA A;  4HSV A;  4WJW A;  1MI2 A;  3TP6 A;  4M8A A;  1JE4 A;  1PFN A;  1LTB D;  2EJM A;  4Q0F A;  1SDF A;  1B2T A;  1DOM A;  4DA2 A;  1TU2 B;  4IN3 A;  1EZ6 A;  1QE6 A;  5IOC A;  2WV6 D;  2A68 C;  3D4W A;  4DAP A;  3D8G A;  1EY7 A;  1TKW B;  1Q12 A;  1UAP A;  4ZUI A;  3M7N A;  5KNC A;  2D5D A;  3K59 A;  1LAB A;  1PYW D;  3T51 B;  2K5W A;  2MUY A;  2DY8 A;  1STG A;  3JAM L;  2PZU A;  1Q90 A;  1V43 A;  3DXJ C;  3VR2 A;  1BO0 A;  1HRJ A;  2B2U C;  4KKU A;  4KHZ A;  4QUF A;  4HAE A;  2JE6 I;  5C3E B;  1FR3 A;  4ILW A;  4A3J B;  4RWS C;  5E4W C;  1RF2 D;  4HR7 B;  2B2T C;  1DD2 A;  2B2Y A;  3NK9 A;  3J81 L;  1M4V A;  4C3H G;  1A2U A;  1STN A;  1CFM A;  1ZYR C;  3OWF A;  3DHQ A;  1AW7 A;  2M2L A;  2A6E C;  1X32 A;  4C2M B;  1H9S B;  2L55 A;  5C5M A;  1F9P A;  3S1M B;  1BOS A;  2WKC A;  1HPC A;  5EJW A;  4ME5 A;  2JA7 B;  5BN3 A;  4U67 3;  1Y69 U;  2R92 B;  5COR A;  5IIF A;  2F0E A;  5G3L D;  1NSN S;  1ESR A;  1NAP A;  1EEI D;  1V1P B;  2B2W A;  2MPM A;  1EU4 A;  1IKM A;  2EYF A;  2NTT A;  5ELB A;  1KDB A;  2ICE C;  4MIU A;  2AUJ D;  2L5T A;  3GTQ B;  4E6I A;  3V2T A;  3NTH A;  3MTS A;  1F77 A;  4R8I A;  1CZW A;  4U68 A;  2IX3 A;  5DNF A;  3I73 A;  3GTM B;  3HGB A;  3ONA B;  5I4D A;  4C3J B;  2VXW A;  3A8K E;  1HA5 A;  5C4H A;  3NTI A;  4B9W A;  1E2Z A;  3I90 A;  4RHS A;  3RD4 A;  3ZYY X;  5DM7 3;  4KY5 A;  1VF7 A;  1I50 B;  2YU9 B;  5CBE E;  5CV9 A;  2NBF A;  4A3K B;  4ODG A;  3H94 A;  2F0K A;  3FPU B;  5LL6 S;  5T1G A;  4IUP A;  3HZX A;  1FD7 D;  1HUN A;  2IX1 A;  3A8J E;  4X3K A;  1MBY A;  3X3N A;  5FO9 B;  2BA1 A;  3J7A F;  4DNT B;  1M8A A;  1MD2 D;  3PMF A;  5M3F B;  3M3Y B;  3Q6S A;  1FNV A;  4A3G B;  4A3I B;  2NYZ D;  2KUM A;  2JEB I;  2DY7 A;  2XRS D;  1SNM A;  1Z6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...