4HSVA

Crystal structure of cxcl4l1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet factor 4 variant
publication title Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hsvA00
2M2LA 1HUMA 1PFMA 3ONAB 4X3UA 2L12A 2JP1A 4IUQA 5DNFA 1AZQA 2SDFA 2MGSA 4IUPA 5CORA 1DZ1A 4HCSA 2EE1A 1HRJA 1ML0D 4ZAIA 1DOMA 4ZKBB 3DEPA 4CJ0B 1JE4A 4ZK9B 1EIHA 1J9OA 2EOTA 1XX8A 2B2UA 5EKIA 3IFDA 1HUNA 3I8ZA 4HEDA 1F2LA 5EPJA 1B4OA 1F9QA 1SAPA 2L1BA 2XIWA 4X3SA 1HFGA 2NYZD 3N52A 1VMCA 1WD1A 2RSNA 2KEEA 2N88A 2RSOA 2HUGA 3QO2A 3I91A 5CBEE 1AP0A 3SVMA 2L9HA 1PLFA 5EQ0A 5EPKA 4ZKCB 4IURA 1GUWA 3FPUB 1QE6A 1LV9A 2VXWA 2KVMA 1O80A 2B2VA 2EPBA 3IL8A 4UAIA 5COYA 2HDMA 1SDFA 1PDQA 3GV3A 1WTPA 4O42A 1IL8A 1EQTA 1S4ZA 2KEDA 1QNKA 3R93A 5JJZA 1WTQA 1WD0A 4MHEA 2B2WC 1A15A 2X6GA 1RJTA 4RA8A 4QUFA 3H91A 5EJWA 4RAUC 1G2SA 4XT3B 2D9UA 4CJ1B 1WTXA 1DONA 1U4LA 5T1GA 1WTWA 1WTRA 5AFWA 2B2TA 2NWGA 1WVLA 1B50A 5CBAE 1TVXA 1KNEA 3KUPA 1RTOA 1B2TA 1G2TA 2IL8A 2K05A 2DY7A 1ILQA 3GV6A 1MSHA 2B2YA 3G7LA 2MJ8A 2B2UC 3KBXA 1RTNA 1KNAA 1F9SA 4R8IA 1U4MA 1HHVA 2H1EA 3F2UA 3P7JA 4U68A 2B2TC 2L11A 1NR4A 3FDTA 2L4NA 1EIGA 4HAEA 2J7ZA 2K28A 1X32A 1IKLA 2FINB 2HCIA 2K04A 1B3AA 2MP1A 4MN3A 1DOLA 4CJ2C 2K1BA 1HA6A 2X6LA 1M8AA 4R9WA 1VMPA 3I90A 1HFNA 4X3TA 2B2VC 1MSGA 4IUVA 4ZLTF 1WTVA 1X3PA 2N55A 3I3CA 1AZPA 2NZ1D 1G91A 4XDXA 4X3KA 1WTOA 3MWYW 2CVRA 1PFBA 1CM9A 2BDNA 1EOTA 3TZDA 3HP3A 1F9RA 1XYIA 1X3QA 1DOKA 2HCCA 2MPMA 2Q8TA 4HSVA 4NW2A 1G6ZA 5T1IA 1BBXC 1IKMA 2R3ZA 1MI2A 1F9PA 2FHTA 5D65A 2RVLA 3DEOA 2DY8A 2KECA 5CMDA 2K01A 3LWEA 2RA4A 1U4PA 4QUCA 2FJ2A 2Q8RE 1E0BA 2X69A 2K03A 2FMMA 1Q3LA 4RWSC 1CA6A 4DN4M 1RHPA 5D14A 1U4RA 2B2YC 3D6WA 3DM1A 1ZXTA 1J8IA 1B53A 1NAPA 2JYOA 1EL0A 1QG7A 1O7ZA 1ESRA 2KOLA 3UI2A 1BNZA 4OIKA 1PFNA 4XT1B 4IUUA 1NCVA 3MTSA 1BO0A 5E4XA 1BF4A 4LMQD 1C8CA 3TN2A 1RODA 1O7YA 1ILPA 1SSOA 2HDLA 1MGSA 1ICWA 4OIJA 2B2WA 1JICA 5E4WC 2FFKB 2KUMA 4IUTA 1CA5A 3Q6SA 5EPLA 1NR2A
chains in the Genus database with same CATH superfamily
2NZOA 2WKCA 4KHZA 2KA7A 1AE2A 3AYHB 4A3BG 3NXWA 3CC2A 2WB1G 1PH4A 4ME5A 3K57A 4RCOA 5CGKA 1PRTF 3HZXA 4ID6A 1XMOQ 2F0PA 1A2UA 5ELDA 1B9MA 1SNQA 3CMEA 4F8MA 4GKJL 1LM0A 2RSOA 3OIQA 3I55A 4EX5A 3J7AV 3EA6A 4IQZA 5CV4A 3S1QH 5IYBH 5JJIA 1LO5D 4GN4B 2I0QA 1CK1A 4LF8L 5M5YH 3J7A5 2AQ3B 3L9AX 4AH6A 4GKJQ 1WTXA 2K75A 3AFPA 3NBIA 5C6AA 1R9TH 3A56A 5AFWA 2R92G 1TVXA 5C44H 4LF9L 5C4ZA 3CCRA 4P75A 5KNDA 3DWAA 1OXUA 3H09A 4LF8Q 5JOBA 2BA0A 3GV6A 3HOVG 2MJ8A 1B70B 2I5MX 3LWUA 4JPBW 3FDTA 1FJGL 4HAEA 1VQ7A 4YWKA 1TWFB 5J39A 3GTLH 2A69C 3V96A 5M5XB 4LF9Q 1G6PA 1XPRA 3U4VA 2CCZA 4E6IA 1ICFB 4DNIA 3K0XA 2EYJA 4DPGA 2ATWA 4GKKL 3K59A 1FJGQ 1K28A 4OWTB 2KCNA 1TS3A 2R3ZA 1EY5A 3I4NG 2K32A 4DR3L 1SJHD 2K5DA 5D3IB 3QB3A 2PNRC 2ALYB 1BCPB 2A74C 4ZUJA 3HOUH 2HQEA 4Z9CB 2Z8LA 4GNXB 1HTPA 2JA9A 4A3IH 2Y0SB 4GKKQ 3DM1A 2I07B 2EYPA 1LT5D 2SNMA 2XGTA 2EYMA 3SK8A 4OEMB 1I3QH 4DR3Q 3I70A 1WCMB 1JICA 2FFKB 2NUCA 1NR2A 2M2LA 4JI5L 1YNJC 5JJKA 2EJGC 3GTKH 4OO1H 1PRTD 2R61A 1JE4A 4P2CB 1I50H 4JI7L 3H0GB 1K83B 3BZCA 4UHVA 4HEDA 1B4OA 2L1BA 1HFGA 3J80L 1RF2D 4N8FA 2GVAA 1PZJD 2RSNA 2K6AA 1WOCA 2R7ZH 1C9OA 1W6JA 1JCKB 2NN6G 2OWOA 2D0PA 5KRUA 2IHFA 1F2YA 5E7NA 3MXGA 3E9HA 1KIXA 4KTAA 1BBUA 2UU9L 4JI7Q 4A93B 5HURA 2UXBL 4PQXA 4IALA 3HOWB 1JJCB 2F0FA 1K9MC 1RD9D 2K4KA 2LXJA 2E2HH 4KHVA 5HGQA 4XT3B 3CAMA 4JI6L 1JOKA 2EXDA 5G3LF 1PH9A 4A3DH 4GZYC 4APVA 3RR5A 2UU9Q 2UXBQ 1MSHA 1Q90A 1RTNA 3D0FA 1Q81C 4GNXA 1JMCA 2L4NA 4PMWA 3HEJA 2WAQB 3R3OA 4JI6Q 5FLMH 1YZ6A 1M8AA 1VMPA 3R2IA 1VQAA 4DV4Q 5IYCH 3I3CA 2NZ1D 1N8RC 2WACA 4RG1A 1I50B 2IX1A 3CD6A 2Q8TA 1KAWA 4Y7NH 1IYVA 1BBXC 3KYHC 5IYBG 4DGZA 1VQ5A 2Y0SG 1D1KA 4HR7B 1SYCA 1A6XA 2K01A 5KYLA 2LFNA 3CMAA 3E0EA 4PV1C 2JA7B 3A5UA 1GHKA 1GUGA 4GOPA 2NN6I 5C44G 4BBRH 2VL6A 2PQEA 1C8CA 1LT4D 2DN8A 4KN4C 3TDQA 4IUTA 4YHHL 2K5QA 3PIPA 1AEXA 2QDBA 3H0GG 5E3FA 5J22A 1WTHA 3MXNB 3KBGA 4MTNA 1E22A 3PSIA 2LSSA 1DXMA 1PTOH 1JR0D 4PMCA 3VR4A 1EIHA 4DR6L 1TU2B 2R7DA 5EKIA 2C5CA 3IFDA 1PH2A 2FMCA 1HUNA 3VA5A 1IL2A 1IYJB 3RZOB 4YHHQ 2K50A 4JBWA 4DAYB 4IUNA 3WOFA 1KLUD 1JE5A 3WWVA 1QVCA 3T53B 1D5XC 2ZTCA 5COYA 3URYA 3UE1A 3OMCA 4C3JB 1Q1BA 1ESFA 1NTGA 4DR6Q 4LFCL 4JC0A 2KHJA 3HOUG 4Y7NB 5FO7B 1XJVA 1PZID 4A3IG 1EYAA 2E74C 3K5MA 1HTLD 2J0TD 2OT2A 1Q7YC 3NP8A 1G2SA 1Y8NB 1Q12A 4LUOA 1UE7A 2KENA 3PIP3 2ZM6Q 2DNEA 1RTOA 1Z9FA 2QF7A 3CU7A 2E75C 4JI1L 1YHBA 3CCMA 5KNCA 1VQ8A 1HNZQ 3ICEA 4X62L 4EQOA 3G48A 1D7QA 5ELFA 1O78A 4C3HB 2B8FA 2EY1A 2E5LL 3H3VH 2JEBI 3SK6A 5J1ZA 4QCLA 2F0EA 1VQ4A 4JI1Q 1TWGB 2R7ZG 4DV1L 3S17H 3A5ZB 1E24A 2F3IA 2JA6H 1G8ZD 3K5OA 2KQ3A 2E5LQ 1Q82C 1SXTA 3HRZC 3AEVA 5D65A 2RVLA 5I9PA 3TS0A 1TKWB 3TQYA 4QUCA 1W2BA 3FHWA 4HCEA 3S2DB 4JI8Q 4DV1Q 2PI2A 3PUYA 3W1GA 3KF6B 1ENFA 4IJHA 1U9RA 3TEHB 4A3DG 3HOXH 4OWXB 5IT9E 2LXKA 3BZKA 2A1AA 2K33A 4LMQD 3TN2A 1PV4A 3FKIB 4JOIA 2O5JC 4JI3L 1KQSA 3NTHA 3M85A 3BJUA 2UXDQ 3ONAB 2L12A 2B8GA 4S3SA 3S1RH 3MA2B 4JYAL 2SDFA 1RKNA 1Y1VB 5FLMG 1EY8A 2MFIA 3N6RA 1YHAA 1A3TA 3K7AB 1I94L 3S16B 1LYLA 1SE3A 4L8JA 3W5OA 4IN3A 5LL6S 5IYCG 5ELEA 1XNQQ 3M3YB 2O4XA 4AYBB 4JI3Q 1I4HA 4DNTB 4V0BA 1FD7D 2N88A 2QA4A 4JYAQ 2Q2TA 2WP8J 4OO1I 3U9SA 2CHBD 1SE8A 4KY5A 2LY7A 1I94Q 3TP8A 1YHQA 4XQJA 1Q8KA 3BDOA 1EQTA 1S4ZA 3GTPH 3IKJA 3EQLC 2X6GA 5EGTA 1RJTA 5JEAJ 1E1OA 2VQFL 4C56C 3FRPB 4BBRG 4CDEC 2NWGA 4C2MH 3S1NB 5I9OA 5IP7H 4C3HG 3P1HA 2EY6A 2PQAB 3CQZB 4WJWA 5AJ3L 1F9SA 4IFDG 1SNMA 1EIGA 3PCOB 3J80c 4JI2L 2VQFQ 2Q8IB 5ELOA 3KF6A 4CJ2C 5JEAH 4DR1L 2E2JH 2TSSA 4K2LA 3ULPA 3A7AB 4R9WA 4K5VA 4BXXH 3MXUA 3VYUA 2B63H 3NTIA 5AJ3Q 2HD3A 1STHA 1H9RA 3TZDA 1HNWL 3ZYYX 1KC8C 3GDEA 3TBIB 4JI2Q 5T1IA 1Y14B 1Z6HA 5IE8A 2CFMA 2DGYA 2RCFA 4DR1Q 3OWFA 1EY4A 1I6HH 2QILA 1IBKL 1A3VA 1VQDA 4QQBX 2AQ2B 2F4IA 1GUOA 1VQFA 3NQIA 1EYGA 2RHSB 1C0AA 1AFPA 4CBVA 3FKIG 1HNWQ 2A6HC 3OPOA 1K0SA 1VF5C 3PO3B 1Y69U 3NBHB 3NQTA 4K5XA 3VR2A 5H1SE 1TS2A 1SROA 1GXDC 2J4XA 1IBKQ 1RDPD 3EN2A 4B9XA 4DR7L 2BH8A 1X6OA 1AE3A 1SYEA 1LUZA 1UUPA 1K8GA 1H95A 5DNFA 1IW7C 1YJ9A 2CQAA 1D6EC 2EE1A 3OHXC 4ABNA 3T56B 1TWHB 1NUCA 4WORA 2EOTA 4K2KA 4ULLA 3MEFA 5EPJA 2F3VA 3RZDB 1F9QA 4DR7Q 2VNUD 1HXYD 4RKBA 3UDFA 1JOOA 1B44D 2VUMH 4BBSB 1GUWA 2NVXH 3IAYA 3HOVH 5I4DA 5EKLA 3GTMH 1OXTA 4KJNA 1BR9A 3S2HB 3X3NA 1H9KA 1S3OA 2ICEC 4QY7A 3CCLA 1D5ZC 4HJAA 3CKIB 3S15H 4OWWB 1BCPF 2UUCL 3HOXG 3PIOA 1JC7A 2IL8A 3U4ZA 1MJCA 4HIDA 1ZYRC 3Q0AA 3ULLA 5EBDA 2B2UC 1QB5D 1SFOB 4LUZA 1F2MA 5J3BA 1U4MA 2F0DA 3VA7A 1SNOA 1XTDA 3D4RA 4A4IA 5IYDH 1KD1C 4BY1H 4FF4A 2UUCQ 4R4IA 2XTIA 3B6YA 2X6LA 1WFQA 3EROA 3I90A 1EFWA 3PUZA 4RHRA 1S72A 1BOSA 4LWCA 2EJFC 3G6JB 2BDNA 1EY0A 2YV5A 1PXUA 2PW5A 3H3VI 5C4JB 1STYA 1QWYA 1PYBA 3D31A 1DYQA 5BR8L 1TY0A 1L1OC 2I5HA 3JAMc 2RDHA 2AKWB 3PIO3 2PMZE 1MBYA 4H02A 4B3RL 1U4RA 1PH1A 1PH3A 1UE1A 1TT2A 3L2PA 5M9OA 1PFNA 1Q46A 3MTSA 4N8X1 5FO8B 1K8MA 2EQSA 5BR8Q 3S15B 1SYGA 5E1FA 2WB1E 4WJ3M 3BVZA 4KD3A 4GOPC 1VQOA 4L5SA 1LTRD 1PFMA 3TP5A 4X64L 1Q1EA 2JP1A 4DU9A 2ZJPA 4B3RQ 4B3TL 1E2VA 5JEAG 1R4PB 1CTMA 3NHHA 4CJ0B 5C3EB 5FO9B 1STNA 4BXXG 1PA6A 5DM73 3J81c 4M1UB 4BBSG 4DV3L 5BN5A 2IW3A 2Z9HA 2XIWA 5CR3A 2JE6I 4K8IA 4X64Q 1XNRQ 1V1QA 1UE6A 4FP5D 5EQ0A 4B3TQ 2F0HA 3DLLA 1TWFH 2M00A 2B2VA 2JJQA 3HOZB 2C9OA 5M5XH 2IHEA 1UNSA 3G71A 4IPCA 1SEBD 4DV3Q 2HIXA 3CC4A 4TKOB 2F0VA 3BVMA 4DXGA 1HH2P 4RH6A 4IOAA 2B2WC 5I6WA 4RA8A 4QUFA 1BCPD 1QUQB 3A0JA 1WTRA 2AUKA 3NENA 1T5XD 3STBD 1SRUA 5A2QL 4O0AA 4R8IA 1Y8PB 3M7GA 5JAVA 1HNXL 3I56A 2VW9A 2O2LD 1CHQD 3MZ5A 1YNND 1PRTC 2EYLA 1X3FA 1WCMH 1TR5A 1H9SB 1HNXQ 2VUMG 4POGA 4ZCKA 1G291 1PYSB 4K8JA 4L5RC 1O7IA 4U673 3GP7A 4A3MB 3HFZB 3GTGB 2VS1A 1X65A 3H0GH 2O5IC 1K83H 4KLKA 1FGUA 2RBMA 3F2CA 3KFUA 2BE5D 1LTID 1PMRA 1EL0A 1AW7A 1VQMA 2ZJQA 2KOLA 5M3MB 4XT1B 2N49A 2Z6KA 1W3SA 1L0WA 1SSOA 4A93H 1NNXA 3HOWH 2CVRA 1ENCA 3BG3A 5CV5A 3HKZB 1JB7A 5IYDG 4FNFA 4BY1G 2WKDA 1Y8OB 4CDCC 5FLXE 1QUQA 3CCJA 3TS2A 3DEPA 3CPFA 4X65L 4CGYB 1D2BA 4JCVE 3L0OA 2XN9C 3SR1A 4A3LG 1J5EL 3W1BA 2L0CA 1T5EA 1LTSD 2L9HA 3MC0B 1J6QA 4ZKCB 4XYQA 3E3XA 1QE6A 4Y52H 4HMJA 1PTOF 1YJWA 1X54A 3OSOA 4X65Q 4QL5A 1V9PA 1IXRA 1OXXK 3DUZA 2ID0A 5JJZA 1N9WA 4BA1I 4BY7B 2XRSD 1J5EQ 3LX0A 1H9SA 1SYDA 4NPSA 5HY6A 3WDNA 1WVLA 1LACA 3KLRA 1B2TA 4AIMA 3GQBA 4JI5Q 1DJRD 3M7NA 3C1EA 2LS01 1PFSA 2L55A 4UP8A 4L6TB 2JA7H 2FINB 1BBWA 1O7LA 4TVAB 4DV2L 2K52A 1NMFA 1HFNA 1STBA 3E9IA 3M9BA 4KV6A 2JEAI 3A55A 2NZHA 2K5HA 2JSOA 3HP3A 4NKLA 2Y0SE 4QGUA 4NW2A 4DR4L 1V1PB 1T9HA 3LWEA 3M4PA 5LL6X 5GAHC 4P74A 5M3MG 2A69D 4DXFA 3T1YL 3K8AA 2BA1A 3RZOH 1RL2A 3PO2H 1EY6A 1YEZA 2ENBA 2Z4HA 2WIIB 1EWHA 4DR4Q 3EBEA 1FYCA 1NCVA 4C3JH 3HKZG 1X3EA 2PCFB 2MQHA 5M3FB 3H3VC 2ZJRA 2NVQB 1EWCA 1TQOA 3T1YQ 1JJ2A 4J15A 4PZ8A 2H4OA 2WV6D 4OGQC 4IPGA 4IUPA 4FF3A 2RCNA 1HRJA 4IFDJ 1FGBD 5TSSA 1XX8A 3FPPA 1WCMG 4H44C 2ZTEA 3S14B 1EEID 3NPPA 4HMIA 2NYZD 1U5KA 3L7ZC 3IRBA 1BDOA 4ZUIA 2RF4A 4C3HH 5DEHA 1PTOD 3T13A 3IL8A 3K5NA 4IFDH 4R4CA 4JV5L 3PMFA 1S5BD 1UE5A 3P20A 4O42A 1P8LA 2AMCB 4JBJA 2OQ0A 1CT1D 3CRLC 1TWGH 1BUVT 1EYDA 4CJ1B 4X66L 2NTSA 1TWAB 4AQYL 1DCZA 3LNNA 5T1GA 3Q8DA 2WAQE 4YCVA 3PO2B 4B08A 3IFTA 1SMXA 5I2XA 4JV5Q 4A93G 2F0MA 2M9VA 2B2YA 3HOWG 5CC4A 4J8QA 3BYTB 3S2DH 1SN8A 1HJPA 1VDZA 2E76C 5DAUA 4ZQ3A 4DV7L 2J7ZA 1K0RA 1PH7A 3J7YW 4AQYQ 5LMNL 1P16A 1SMYD 2G9HD 3D3RA 1PVOA 2Q2IA 1HA6A 1VQLA 4X3TA 2F3WA 2MUYA 4IUVA 2ZXRA 2N55A 3FKIH 1G91A 1E2ZA 3JAML 1STAA 4PMBA 2DNCA 3I4MB 5F2DA 1F9RA 4DV7Q 4EQNA 3T4AC 1DOKA 2WAQG 1JT8A 4LFCQ 1Y1VH 5KNBA 4LF7L 3RN5A 1MI2A 4CKBA 4RMFA 2FHTA 3U9OA 3FVQA 3K7AH 3S16H 1SYBA 3M3YH 4G7OC 5CV7A 5D14A 2JN4A 5M5WH 2UUBL 1NAPA 2A19A 1QG7A 4G4KA 5C5MA 5CV9A 1OXSC 2ZXOA 1BNZA 4LF7Q 2K14A 1YNXA 4XIGS 5CV6A 1II3A 4X62Q 3TRZA 4KN7C 2KUMA 4QF4A 1FNUA 3MXNA 3J81L 4A3KB 1SYFA 2JA7G 1JWMD 4TSSA 1VQGA 1CFMA 2PI2E 5C4XH 1AZQA 2UUBQ 2F0WA 4XYOA 1DZ1A 4LF4L 4R1JA 3JC66 1ML0D 4YCWA 4ZK9B 1EY7A 4L5QA 5IGDA 4F88A 2DJGC 3S1NH 1EU3A 4DAYA 1Y1WB 3S24A 1A63A 2XVSA 1FR3A 3CQZH 1LT6D 2HUGA 1IBML 1B7YB 4YWLA 4A75A 2CW0D 1STGA 4R4TA 1D1IA 4DKAC 4LF4Q 1LV9A 2VB3X 4A3FB 2ZXPA 1KDBA 3G4SA 4KY6A 3S9WA 4P71A 2YTVA 1TS5A 1S5FD 3PO2G 2EZVA 3PUWA 5GADC 2YU9B 1IBMQ 2R6GA 2MO0A 2K7VA 4C3JG 2LKVA 1LT3D 3MVVA 1TWCB 2D2CC 5M5WB 2K05A 2NVTB 4QIWE 2KBNA 1KNAA 4DUYL 4G7HC 3CW2C 2HIVA 4A3CG 3QG1A 1SE2A 1IKLA 2L5TA 3UDXA 4C3IH 4O1NA 2PPBC 3J80i 1EY9A 1F2ZA 4HJ9A 1PHJA 1MD2D 3PO3H 1N36L 4DA2A 4HJ8A 1KL9A 5C4XB 3KDFB 2F4VL 2JXMB 3I7FA 3PUXA 2F0UA 2IWHA 2XWBB 2V1CC 1HR0L 2NVYH 1A2TA 4KK7A 4MIUA 4DK1A 5K36H 1IKMA 3DHQA 1TWHH 3UDGA 1YBYA 4FDBA 2QEJC 3ND9A 1H9JA 3E0JA 4CHTB 1N33L 4JVZA 1TS4A 5DM63 4DAVA 3RZDH 1MJEA 3Q23A 1HR0Q 3S1MB 2MHVA 3OOCA 5FK9C 1K8OA 4NP5A 2A68D 3H6MA 4A3KG 4BBSH 4K14A 1ESRA 1UEAB 1EZ6A 1WJJA 1MKHA 4JI0L 1MGSA 1JB3A 1ICWA 1EZ8A 5CBEE 3HG9A 1N33Q 1YJNA 3S2HH 4LJZC 3I73A 4L5TA 1SR3A 1SE4A 5HGTA 2MGSA 1QVFA 3A8IE 1QVGA 3K81C 1C7YA 2WINB 4CKCA 4DV5L 4UY8C 1VQHA 2AHOB 3QR8A 1J9OA 4A76A 4C3IB 4JI0Q 4EGVA 4A3FG 1STEA 4OL7A 3V2TA 3TP7A 1B1ZA 3BVGA 2QW7A 1SFOH 1KABA 3D4WA 1E7ZA 1Y1VG 3CCUA 1CSPA 4DV5Q 1CHPD 2HDMA 4IOCA 2NVYB 5KIXA 1RIPA 1GJXA 2IJ0A 1WTPA 2QGQA 3KDFA 4AYBG 1VQBA 5ISRA 1GUNA 1RCVD 2C35B 3VYRA 4HIOA 2YTXA 3R8BA 3H91A 3BS1A 3CCSA 1WTWA 5IT9L 1N32L 3KLWA 2B2TA 2B29A 2K5WA 4K6LA 1NE3A 3SEBA 3AB9A 5LMNW 2PQAA 5C4JH 4IFDI 3M4OB 5I6YA 2PZWA 2OTLA 3W3AA 1MHWC 2A6ED 3L3OC 1B9NA 1PH5A 5C4XG 1GUSA 2F0SA 3MHBA 2K28A 1UWVA 2K04A 2QKIC 1DOLA 2SNSA 4POFA 2D62A 1N32Q 2MNAA 3GTJB 2A5HA 4B3ML 5LHY1 3HOYB 2G9DA 3NELA 1LTGD 3GTOB 3GTQH 2E2IB 4H0LC 3T16A 4LFAL 2SOBA 5CV8A 2EIFA 1CM9A 1QOHA 2PMZB 1XPUA 1GVPA 2PNHA 3RLFA 3SE0A 5ELCA 3VR3A 2ZTDA 1A62A 5C3EH 4B3MQ 4KHPL 1LTTD 3DEOA 2DY8A 1XPOA 2PZUA 3JAMi 5EKKA 2Q8RE 1VQ9A 2A8VA 3OYYA 5KYIA 3TREA 4LFAQ 4A3BB 2WB1B 3NBHA 1BCPC 2OXPA 4XXEA 5BN3A 4GNXC 1CKNB 1FNWA 3QWNA 1O7ZA 4TQUS 3UI2A 4IUUA 3DMUA 4A3LH 1BO0A 1KXLA 4KHPQ 2RKSA 3HOZH 1YVCA 3STBC 4NXNL 1EOVA 3Q6SA 5D3DA 4BWGB 4R4OA 3OW2A 4EQPA 4X3UA 1HPCA 4C3IG 4KI0A 1QILA 5DLQE 3PO3G 1VQCA 1JJGA 2A6HD 4NDXA 1MIUA 3SHLA 1HA5A 3J81i 1K3RA 3QJYA 4LK1C 4NXNQ 2R93B 1QNUA 2KCMA 2Z4IA 2KEEA 2GN5A 2OQKA 1XMQL 5K36G 3GTQB 2R92B 2VXWA 3WOEA 2KVMA 1IW7D 3NTKA 3PF4A 5EAYA 1EWIA 3D8GA 1VQPA 1X3GA 4RGOS 2FXQA 2KEDA 1WTQA 5K5PA 4GS3A 1V43A 4BA2I 4MHEA 2XNAC 3A8KE 3FMCA 2BE5C 1GM5A 5EJWA 1XMQQ 2D9UA 2D5DA 4JI4L 1E2WA 3HS0C 1VQKA 4PZ6A 4A3MH 3GTGH 4RGTA 1SJED 3KBXA 1VQ6A 3HOYG 2OTJA 2AWNA 1NR4A 1M90C 1HR0W 4DK0A 4GN3B 1WI5A 4KJOA 2UXCL 1BXTA 3A7LA 4F87A 3I4NB 2K1BA 5M3MH 4DV0L 1E3PA 3T51B 4UP9A 1XMOL 3MWYW 2IX0A 3J80E 1ZYRD 3NUCA 1UAPA 2P5ZX 1AN8A 1X3QA 1XYIA 2EXZA 3NWTA 1G6ZA 1KTKA 1KRSA 5ELBA 2UXCQ 1F9PA 1S40A 4KY7A 5IGBA 4DV0Q 3F2BA 1HZCA 1VCIA 5JPMC 1S5DD 1E0BA 2K03A 1Q3LA 4FO2A 1I4XA 4ZRZA 4ALPA 1D5MC 2JYOA 3U58A 4LFBL 3AMUA 2F52A 2AWOA 4RGMA 1BF4A 2E8GA 4DAPA 1RODA 3RUZA 4H7BA 2NB0A 4OIJA 4C1NI 5C0XJ 2CQOA 3F8TA 1CA5A 3BYYB 1GD7A 3TZUA 3EIVA 2ICIA 1I4RA 4BY7H 1NSNS 5CORA 5JVH3 4YWMA 2R93G 4LFBQ 3GD7A 4YCUA 3SK5A 2R7FA 2PW7A 3I8ZA 3F1ZA 1F2LA 4X3SA 4WRDA 4I65A 5IP9H 1CUKA 1LABA 3SXHA 4K5WA 5C0XH 1OTCA 4IO9A 4GLXA 2LMCB 2EYHA 5EPKA 1GHJA 4DAMA 5C3EG 1JWUD 5IGFA 1QJOA 1ONLA 2DUDA 3G6EA 4B9WA 2NBFA 4JK1C 2EY2A 1QNKA 5C4HA 2EY5A 5EBCA 4JOIC 1DM0B 2HHHL 2F0KA 4FXKC 2CH4W 5IWAL 2JQOA 1VS0A 4R4QA 3CCEA 4DV6L 3BDCA 1KNEA 1VQIA 1G2TA 3HOZG 4HIMA 2IY5B 2DY7A 4UP7A 3DWQA 1HZBA 3C46A 1CSQA 4PG3A 4UPAA 3QIAA 5FJ8H 3QOJA 3PUVA 3F2UA 3K5LA 3P7JA 4U68A 4KKSA 3KJPA 2B39A 1QCBD 2HHHQ 2TMPA 3F2DA 2N78A 3MAQA 3S1QB 5IWAQ 2F0NA 3E5SA 4QMGA 4DV6Q 2EVBA 5FOBB 5M5YB 5GROA 3VYTA 1MSGA 1VF7A 5M3FH 1YI2A 3OMGA 1R4QB 3ERQA 3I2ZA 2XRQD 4X3KA 2NVQH 4KKUA 1PH8A 3HGBA 3RD4A 1CQVA 1EOTA 5LMUL 4LUVA 1R9TB 2HCCA 1L1OB 5C44B 1PTOC 4OHJA 1PYWD 4FF1A 4P72A 4FYDA 2ES2A 1SLJA 5IT9c 1CKMA 1N34L 2KJXA 2RA4A 4G57A 4DR2L 3D6CA 1S5ED 1L0XB 2YYZA 3MEHA 2EYOA 3ULJA 2Z6BA 3S14H 3D6WA 5GAGC 1Q86C 4WFN3 5LMUQ 1HQMC 3VDYA 3ERSX 3GO5A 3HKZE 3GTLB 4BS9A 4ODGA 4GOPB 3JAME 4A3MG 2G5DA 1TIID 3QOLA 1N34Q 1FNVA 1SNDA 3NE5B 4Q5VA 3RNUA 4DR2Q 1IYUA 1KLGD 4DV2Q 3PQIA 5ELNA 1I4PA 2SEBD 2UUAL 4HCSA 4JW0A 1TWAH 3AFQA 1SMYC 1LTBD 1KRTA 1D8LA 3NEMA 3KLSX 3RMHA 3KF8B 2B2UA 4HN7A 2EDGA 3HOUB 4V190 2VQEL 4A3IB 3CHBD 4NB3A 4DV4L 4PNYA 3QO2A 4K0KL 4XQQA 4MTKA 4IURA 1HZAA 2UUAQ 1IZ6A 4Q0FA 2QEXA 1I3QB 3P75A 5FKAC 3UE0A 3J81E 3MFGA 4EVOA 1DGSA 4IZ8A 4DK6C 4B3SL 4A3CH 1IL8A 2VQEQ 1EQVA 1YIJA 4LNQA 1C48A 1DONA 4QJFA 1BQQT 2JK8A 4UDUC 4XTCS 3GTKB 2XSCA 3SK4A 1U4LA 3I4MH 4K0KQ 1L1OA 4RFBA 5CBAE 4N9TA 2BCOA 1I4QA 4EQ5A 4B3SQ 2WFWA 3A54A 2DJFC 2R7ZB 1PH6A 2H1EA 1PRTB 5IGEA 2OF1A 4BY7G 2B2TC 1YNJD 5FLXL 4MN3A 3MFYA 2MP1A 1CQFA 4NXML 2CKZB 1GUTA 3I72A 5NUCA 4GN5A 1ZEQX 1SNPA 5IP9G 5I2YA 2E2HB 4JBMA 3NWSA 1NBWA 5C0XG 1XXGA 4A3KH 2EJMA 2CW0C 2F0IA 4A3DB 1V1PA 1DD2A 4NXMQ 1KDAA 4P73A 2KECA 5CMDA 3KF8A 4X66Q 2FJ2A 3BDLA 1JQYD 2EYFA 2KCTA 3ER0A 2QDLA 1Y1WH 3DM3A 1RHPA 4YIJA 1B53A 1IHZA 4KKTA 2JA8H 5C5LA 5GAEC 2OCEA 4A3FH 1EYCA 3FP9A 2KHIA 2ZM6L 2L15A 5FJ8G 2B2WA 3K80C 2A73B 2F0TA 4RWSC 5IIFA 5LMNQ 5C3XA 5IODA 1K3BC 1ENAA 2YU9H 1HNZL 1DOMA 3Q22A 3TMEA 3VYSA 2E2DC 1TWCH 5M3FG 5G3LD 2D0OA 2Q2UA 2NVTH 1SAPA 5GQOA 1NMGA 1LTLA 3M4QA 1BVSA 4GLVB 1WD1A 4NMZA 1K8AC 3SVMA 3ZJYC 4KMUC 4BBRB 1O80A 2EPBA 1B3QA 1PDQA 4A3EH 1NY4A 1OXVA 3HKSA 4JBKA 5L37A 4OO1G 2RDFA 4HSPA 3MXPA 4O2DA 5C3WA 1E1TA 4CDFC 5C0XI 4QIWB 2I5LX 2F0QA 1PTOB 4JI8L 1FL0A 1ZKOA 2A68C 4RKLA 4LAAA 3KUPA 4DK3C 4RGNA 2PYKA 2JA8B 4A3GH 4F7XA 3G7LA 4LF6L 4OONA 3V05A 4IUQA 2L11A 2BOSA 3H94A 3S1MH 5A35A 2JA5H 2UXDL 2F0GA 3Q24A 3K0YA 4OELB 2F0LA 1EUJA 1CZWA 2B2VC 4WJ4A 4DNRB 1A8VA 2F0OA 3EVQA 4XDXA 2NTTA 4LF6Q 1WTOA 4QB4A 2K5VA 1UEBA 4H13C 2HT1A 3I4OA 1XNQL 1TXYA 2VZAA 3W2DA 1A0IA 1Q8IA 2PO4A 2MPMA 2N3SA 3EJIA 4OXPA 2PZTA 4ZYSA 1F77A 1B8AA 3BZDB 1M1KC 1U0LA 4L63B 1TY2A 3A8JE 4A3EB 1SBBB 1HZ9A 3I4MG 2CH4A 4FF2A 1JOQA 2MO1A 4J6HA 1ASYA 4DFAA 1EEFD 1YITA 1KHIA 5E4XA 2Q2HA 4DUYQ 5CYUA 1QZGA 1O7YA 2HDLA 4J1MA 5E4WC 2H5XA 2A6EC 3D4DA 3NK9A 4M8AA 3S17B 1N36Q 2JA6B 2F4VQ 4A3GB 2CWAA 3OWEB 1Z47A 5IGGA 1XTCD 1OO9B 3U50C 3M4OH 2JA5B 1SNCA 1VMCA 2F0JA 4C1NK 4HJ7A 3I91A 3RN2A 1AP0A 1HCZA 1PLFA 4XQNA 4K6DA 4A3JH 4KD4A 3HOXB 5JVG3 4UAIA 4AYBE 3X3MA 3GTJH 2GVBA 3EFXD 3LGJA 3HOYH 1S5CD 3AU7A 2Z6KC 1WYDA 3OW7A 1Y1WG 1WD0A 3GTOH 2E2IH 3S1RB 1JWSD 1A15A 3K58A 2N8NA 1LLRD 1VQJA 2JA8G 3KOJA 3AQQA 1VQNA 1I4GA 1X56A 1CKOA 4FVMA 4ILWA 1X55A 2F1MA 3OIPA 3CXCA 2BDOA 1BKBA 1HHVA 1IBLL 4DUZL 2VB2X 3PGZA 4ZKBB 2HCIA 4HTHA 4A3BH 3CP0A 1B3AA 3CF5A 3CCQA 3J81j 4RCNA 2KHSA 4YY3L 4G7ZC 2RQXA 3GTPB 2IX3A 1CZGA 4IPDA 1IBLQ 4DUZQ 3R2TA 2IPKD 1G51A 4HSVA 1I5FA 4C2MB 3CCVA 1EFID 3RLNA 1I6VC 4YY3Q 3C3LA 4A3EG 5IGCA 3J7AF 2RDGA 4I7ZC 1U4PA 1GOZA 4A3JB 5JJLA 1ASZA 3K6OA 3KJOA 5KEEA 2CWPA 1XWEA 2OEOA 3ITPA 2R93H 1ZXTA 1J8IA 1PZKD 2E2JB 3OTOL 4OIKA 5FLXc 2R92H 2I46A 4HJ5A 2JA6G 2QCPX 1GO3E 1ILPA 4A3GG 2B63B 4DR5L 1K73C 1V8QA 5A2QE 4CDDC 1HUMA 2B3GA 1C4QA 3VR5A 2JA5G 4ZAIA 3E6ZX 3BU2A 1I6HB 3OTOQ 4IPHA 1L0YB 4PZ7A 2AUJD 3C1FA 4DR5Q 1L2FA 2ZT9C 3FEWX 3N52A 4N9PA 4HIKA 2VY3A 2HQLA 3PF5A 3A74A 3M4YA 3K7UC 4FXDA 1V1OA 3FPUB 1EQRA 1VQEA 3I4NH 1SDFA 4MZ9A 1EQQA 3GV3A 4FXGC 3R93A 1EIYB 2ASBA 1GKHA 3ND8A 2F03A 1YNNC 3J7ZC 4RAUC 3KK7A 3O13A 4JG2A 1X9NA 1Z7TA 1JORA 1B50A 1ET6A 4CKEA 3DXJC 1ILQA 2BH2A 5KGUA 4LF5L 5JPNC 3H15A 3C2PA 2VUMB 2XWJB 2Z1CA 3VR6A 1X32A 4R8NA 4RHSA 4DF7A 2NVXB 1QZHA 3HOVB 4IJLA 3NSWA 3SDZA 4MNOA 1LTAD 3GTMB 1EIFA 2V4DA 4ZLTF 1WTVA 1X3PA 1AZPA 3UDIA 5IP7G 4OX9L 3TP6A 4LF5Q 5IY0A 1PFBA 5IOCA 2Z0SA 1H9MA 2KCCA 2K5NA 4TRDA 5BN4A 4X6AH 1AH9A 1A3UA 4I7AA 2AQ1B 4A3JG 3SGIA 1EU4A 2YTYA 3RLOA 2NN6H 1FVIA 1XNRL 1KDCA 1M4VA 3T1HL 2X69A 1HQRD 2FMMA 1CA6A 4JI4Q 3DWPA 3CC7A 1KAAA 4DN4M 4OX9Q 3CRKC 2RHQB 1CKNA 2B2YC 3CPWA 2B63G 3I4LA 4BY1B 3TSSA 3PV0A 3KLSA 1NJIC 4GLAC 1ET9A 4ME3A 3T1HQ 2IT1A 1CI3M 4LW1A 2GA4B 1W6KA 5EPLA
chains in the Genus database with same CATH topology
2WKCA 4KHZA 2KA7A 3NXWA 4ME5A 3K57A 4RCOA 5CGKA 1PRTF 3HZXA 4ID6A 2F0PA 1A2UA 5ELDA 1B9MA 1SNQA 4F8MA 2RSOA 3OIQA 3J7AV 3EA6A 4IQZA 5CV4A 1LO5D 1CK1A 2AQ3B 3L9AX 1WTXA 3NBIA 5C6AA 3A56A 5AFWA 1TVXA 5C4ZA 5KNDA 3DWAA 1OXUA 3H09A 5JOBA 2BA0A 3GV6A 2MJ8A 3LWUA 3FDTA 4HAEA 1TWFB 5J39A 2A69C 3V96A 5M5XB 4E6IA 2EYJA 3K59A 2KCNA 1TS3A 2R3ZA 1EY5A 2K32A 1SJHD 2K5DA 5D3IB 3QB3A 2PNRC 1BCPB 2A74C 4ZUJA 2HQEA 4Z9CB 2Z8LA 1HTPA 2Y0SB 3DM1A 2I07B 2EYPA 1LT5D 2SNMA 2EYMA 3SK8A 3I70A 1WCMB 1JICA 2FFKB 2NUCA 1NR2A 2M2LA 1YNJC 2EJGC 4OO1H 1PRTD 2R61A 1JE4A 4P2CB 3H0GB 1K83B 4HEDA 1B4OA 2L1BA 1HFGA 3J80L 1RF2D 1PZJD 2RSNA 2K6AA 1W6JA 1JCKB 2NN6G 5KRUA 1F2YA 3MXGA 4KTAA 4A93B 5HURA 4PQXA 4IALA 3HOWB 2F0FA 1RD9D 4KHVA 4XT3B 1JOKA 5G3LF 4GZYC 1MSHA 1Q90A 1RTNA 2L4NA 4PMWA 3HEJA 2WAQB 3R3OA 1M8AA 1VMPA 3R2IA 3I3CA 2NZ1D 2WACA 1I50B 2IX1A 2Q8TA 1IYVA 1BBXC 4DGZA 1D1KA 4HR7B 1SYCA 1A6XA 2K01A 5KYLA 2LFNA 4PV1C 2JA7B 1GHKA 1GUGA 2NN6I 2PQEA 1C8CA 1LT4D 2DN8A 4KN4C 3TDQA 4IUTA 2K5QA 1AEXA 2QDBA 5E3FA 5J22A 3KBGA 1DXMA 1PTOH 1JR0D 4PMCA 3VR4A 1EIHA 1TU2B 5EKIA 2C5CA 3IFDA 1HUNA 2FMCA 3VA5A 3RZOB 4JBWA 4IUNA 3WOFA 1KLUD 3T53B 1D5XC 5COYA 3URYA 4C3JB 3OMCA 1Q1BA 1ESFA 4Y7NB 5FO7B 1PZID 1EYAA 2E74C 3K5MA 1HTLD 2J0TD 2OT2A 3NP8A 1G2SA 1Y8NB 1Q12A 3PIP3 2DNEA 1RTOA 3CU7A 2QF7A 2E75C 5KNCA 4EQOA 5ELFA 1O78A 4C3HB 2B8FA 2EY1A 2JEBI 3SK6A 5J1ZA 4QCLA 2F0EA 1TWGB 1G8ZD 3K5OA 2KQ3A 1SXTA 3HRZC 5D65A 2RVLA 5I9PA 1TKWB 4QUCA 4HCEA 3S2DB 3PUYA 1ENFA 1U9RA 5IT9E 4LMQD 2K33A 3TN2A 3FKIB 2O5JC 3NTHA 3M85A 3ONAB 2L12A 2B8GA 4S3SA 3MA2B 2SDFA 1RKNA 1Y1VB 1EY8A 3N6RA 1A3TA 3K7AB 3S16B 1SE3A 4L8JA 4IN3A 5LL6S 3M3YB 5ELEA 2O4XA 4AYBB 1I4HA 4DNTB 4V0BA 1FD7D 2N88A 2WP8J 4OO1I 3U9SA 2CHBD 4KY5A 2LY7A 3TP8A 4XQJA 3BDOA 1EQTA 1S4ZA 3IKJA 3EQLC 2X6GA 5EGTA 1RJTA 5JEAJ 4C56C 3FRPB 2NWGA 3S1NB 5I9OA 4C3HG 3P1HA 2EY6A 3CQZB 4WJWA 1F9SA 4IFDG 1SNMA 1EIGA 2Q8IB 4CJ2C 5JEAH 2TSSA 4K2LA 3A7AB 4R9WA 4K5VA 3MXUA 3VYUA 3NTIA 1STHA 1H9RA 3TZDA 3ZYYX 3TBIB 5T1IA 1Z6HA 3OWFA 1EY4A 2QILA 1A3VA 2AQ2B 2F4IA 1GUOA 3NQIA 1AFPA 4CBVA 2A6HC 3OPOA 1VF5C 3PO3B 1Y69U 3NQTA 4K5XA 3VR2A 1TS2A 1GXDC 2J4XA 1RDPD 4B9XA 1SYEA 1UUPA 5DNFA 1IW7C 2CQAA 1D6EC 2EE1A 3OHXC 4ABNA 3T56B 1TWHB 1NUCA 4WORA 2EOTA 4K2KA 4ULLA 5EPJA 2F3VA 3RZDB 1F9QA 2VNUD 1HXYD 4RKBA 1JOOA 1B44D 4BBSB 1GUWA 3IAYA 5I4DA 5EKLA 1OXTA 4KJNA 1BR9A 3S2HB 3X3NA 1H9KA 2ICEC 1D5ZC 3CKIB 1BCPF 1JC7A 2IL8A 1ZYRC 3Q0AA 5EBDA 2B2UC 1QB5D 1SFOB 1F2MA 1U4MA 2F0DA 3VA7A 1SNOA 3D4RA 4FF4A 2X6LA 3EROA 3I90A 3PUZA 4RHRA 1BOSA 2EJFC 3G6JB 2BDNA 1EY0A 1PXUA 2PW5A 5C4JB 1STYA 1QWYA 3D31A 1DYQA 1TY0A 2RDHA 3PIO3 1MBYA 1U4RA 1TT2A 5M9OA 1PFNA 3MTSA 5FO8B 1K8MA 3S15B 1SYGA 5E1FA 3BVZA 4KD3A 1LTRD 1PFMA 3TP5A 1Q1EA 2JP1A 4DU9A 1E2VA 5JEAG 1R4PB 1CTMA 3NHHA 4CJ0B 5C3EB 5FO9B 1STNA 5DM73 4M1UB 5BN5A 2IW3A 2XIWA 5CR3A 2JE6I 4K8IA 4FP5D 5EQ0A 2F0HA 2M00A 2B2VA 3HOZB 2C9OA 1UNSA 1SEBD 4TKOB 2F0VA 3BVMA 4DXGA 4RH6A 2B2WC 5I6WA 4RA8A 4QUFA 1BCPD 1WTRA 2AUKA 1T5XD 5A2QL 4R8IA 1Y8PB 3M7GA 5JAVA 2O2LD 1CHQD 3MZ5A 1YNND 1PRTC 2EYLA 1TR5A 1H9SB 1G291 4K8JA 4U673 3GP7A 4A3MB 3GTGB 2O5IC 2RBMA 2BE5D 1LTID 1PMRA 1EL0A 1AW7A 2KOLA 5M3MB 4XT1B 1SSOA 2CVRA 1ENCA 3BG3A 5CV5A 3HKZB 4FNFA 2WKDA 1Y8OB 5FLXE 3DEPA 4CGYB 1D2BA 2XN9C 3SR1A 2L0CA 1T5EA 1LTSD 2L9HA 3MC0B 4ZKCB 4XYQA 1QE6A 4HMJA 1PTOF 3OSOA 1OXXK 3DUZA 2ID0A 5JJZA 4BA1I 4BY7B 2XRSD 3LX0A 1H9SA 1SYDA 3WDNA 1WVLA 1LACA 3KLRA 1B2TA 3GQBA 1DJRD 3M7NA 3C1EA 2LS01 2L55A 4L6TB 2FINB 1O7LA 1HFNA 1STBA 4KV6A 2JEAI 3A55A 2JSOA 3HP3A 4NKLA 4NW2A 1V1PB 3LWEA 5LL6X 2A69D 4DXFA 2BA1A 1EY6A 2ENBA 2Z4HA 2WIIB 1EWHA 1FYCA 1NCVA 2PCFB 5M3FB 3H3VC 2NVQB 1EWCA 1TQOA 2H4OA 2WV6D 4OGQC 4IUPA 4FF3A 1HRJA 4IFDJ 1FGBD 5TSSA 1XX8A 3FPPA 4H44C 3S14B 1EEID 3NPPA 4HMIA 2NYZD 3L7ZC 1BDOA 4ZUIA 5DEHA 1PTOD 3T13A 3IL8A 3K5NA 4IFDH 3PMFA 1S5BD 3P20A 4O42A 1CT1D 3CRLC 1BUVT 1EYDA 4CJ1B 2NTSA 1TWAB 1DCZA 3LNNA 5T1GA 3PO2B 4B08A 3IFTA 5I2XA 2F0MA 2M9VA 2B2YA 5CC4A 4J8QA 3BYTB 5DAUA 1VDZA 4ZQ3A 2E76C 2J7ZA 3J7YW 1SMYD 2G9HD 3D3RA 1HA6A 4X3TA 2F3WA 2MUYA 4IUVA 2ZXRA 2N55A 1G91A 1E2ZA 3JAML 1STAA 4PMBA 2DNCA 3I4MB 5F2DA 1F9RA 4EQNA 3T4AC 1DOKA 5KNBA 1MI2A 4CKBA 2FHTA 3U9OA 3FVQA 1SYBA 4G7OC 5CV7A 5D14A 1NAPA 5C5MA 1QG7A 4G4KA 5CV9A 1OXSC 2ZXOA 1BNZA 4XIGS 5CV6A 1II3A 4KN7C 2KUMA 4QF4A 1FNUA 3MXNA 3J81L 4A3KB 1SYFA 1JWMD 4TSSA 1CFMA 1AZQA 2F0WA 4XYOA 1DZ1A 1ML0D 4ZK9B 1EY7A 5IGDA 4F88A 1EU3A 4DAYA 1Y1WB 2XVSA 1FR3A 1LT6D 2HUGA 2CW0D 1STGA 1D1IA 1LV9A 2VB3X 4A3FB 2ZXPA 1KDBA 4KY6A 3S9WA 1TS5A 1S5FD 2EZVA 3PUWA 2YU9B 2R6GA 2K7VA 4C3JG 2LKVA 1LT3D 3MVVA 1TWCB 2D2CC 5M5WB 2K05A 2NVTB 1KNAA 4G7HC 3QG1A 1SE2A 1IKLA 2L5TA 4O1NA 2PPBC 1EY9A 1F2ZA 1MD2D 4DA2A 5C4XB 2JXMB 3PUXA 2F0UA 2IWHA 2XWBB 1A2TA 4KK7A 4MIUA 4DK1A 5K36H 1IKMA 3DHQA 2QEJC 3ND9A 1H9JA 3E0JA 4CHTB 1TS4A 5DM63 4DAVA 3Q23A 3S1MB 2MHVA 3OOCA 5FK9C 1K8OA 4NP5A 2A68D 3H6MA 4K14A 1ESRA 1UEAB 1EZ6A 1MGSA 1JB3A 1ICWA 1EZ8A 5CBEE 3HG9A 4LJZC 3I73A 1SE4A 5HGTA 2MGSA 3A8IE 2WINB 4CKCA 1J9OA 4C3IB 4EGVA 1STEA 4OL7A 3V2TA 3TP7A 1B1ZA 3BVGA 1KABA 3D4WA 1CHPD 2HDMA 2NVYB 5KIXA 1GJXA 2IJ0A 1WTPA 5ISRA 1GUNA 1RCVD 3VYRA 3R8BA 3H91A 3BS1A 1WTWA 5IT9L 2B2TA 2K5WA 4K6LA 3SEBA 3AB9A 4IFDI 3M4OB 5I6YA 2PZWA 3W3AA 2A6ED 3L3OC 1B9NA 1GUSA 2F0SA 3MHBA 2K28A 2K04A 2QKIC 1DOLA 2SNSA 2D62A 3GTJB 2A5HA 5LHY1 3HOYB 2G9DA 1LTGD 3GTOB 2E2IB 4H0LC 3T16A 2SOBA 5CV8A 2PMZB 1CM9A 1QOHA 3RLFA 3SE0A 5ELCA 3VR3A 1LTTD 3DEOA 2DY8A 2PZUA 5EKKA 2Q8RE 5KYIA 4A3BB 2WB1B 3NBHA 1BCPC 2OXPA 4XXEA 5BN3A 1FNWA 3QWNA 1O7ZA 4TQUS 3UI2A 4IUUA 3DMUA 1BO0A 2RKSA 3Q6SA 5D3DA 4BWGB 4EQPA 4X3UA 1HPCA 4C3IG 4KI0A 1QILA 2A6HD 4NDXA 3SHLA 1HA5A 3QJYA 4LK1C 2R93B 1QNUA 2Z4IA 2KEEA 5K36G 3GTQB 2R92B 2VXWA 3WOEA 2KVMA 1IW7D 3NTKA 3D8GA 4RGOS 2KEDA 1WTQA 5K5PA 1V43A 4BA2I 4MHEA 2XNAC 3A8KE 3FMCA 2BE5C 5EJWA 2D9UA 2D5DA 1E2WA 3HS0C 4RGTA 1SJED 3KBXA 2AWNA 1NR4A 4DK0A 4KJOA 1BXTA 3A7LA 4F87A 3I4NB 2K1BA 3T51B 3MWYW 2IX0A 3J80E 1ZYRD 1UAPA 3NUCA 1XYIA 1AN8A 1X3QA 2EXZA 3NWTA 1G6ZA 1KTKA 5ELBA 1F9PA 4KY7A 5IGBA 1VCIA 5JPMC 1S5DD 1E0BA 2K03A 1Q3LA 4FO2A 1I4XA 4ZRZA 1D5MC 2JYOA 3AMUA 2AWOA 4RGMA 1BF4A 4DAPA 1RODA 3RUZA 4H7BA 2NB0A 4OIJA 4C1NI 5C0XJ 1CA5A 3BYYB 3TZUA 2ICIA 1I4RA 1NSNS 5CORA 5JVH3 3GD7A 3SK5A 2PW7A 3I8ZA 1F2LA 4X3SA 4WRDA 4I65A 1LABA 3SXHA 4K5WA 5C0XH 2LMCB 2EYHA 5EPKA 1GHJA 1JWUD 5IGFA 1QJOA 1ONLA 4B9WA 2NBFA 4JK1C 2EY2A 1QNKA 5C4HA 2EY5A 5EBCA 1DM0B 2F0KA 4FXKC 3BDCA 1KNEA 1G2TA 2DY7A 3C46A 3DWQA 3QIAA 3QOJA 3PUVA 3F2UA 3K5LA 3P7JA 4U68A 4KKSA 2B39A 1QCBD 2TMPA 3MAQA 3S1QB 2F0NA 3E5SA 4QMGA 2EVBA 5FOBB 5M5YB 3VYTA 1MSGA 1VF7A 3OMGA 1R4QB 3ERQA 2XRQD 4X3KA 4KKUA 3HGBA 3RD4A 1CQVA 1EOTA 1R9TB 2HCCA 5C44B 1PTOC 4OHJA 1PYWD 4FF1A 4FYDA 2KJXA 2RA4A 4G57A 3D6CA 1S5ED 1L0XB 2YYZA 3MEHA 2EYOA 3D6WA 4WFN3 1HQMC 3GO5A 3GTLB 4BS9A 4ODGA 3JAME 1TIID 3QOLA 1FNVA 1SNDA 3NE5B 4Q5VA 1IYUA 1KLGD 1I4PA 2SEBD 4HCSA 1SMYC 1LTBD 3KLSX 3RMHA 2B2UA 4HN7A 2EDGA 3HOUB 4V190 4A3IB 3CHBD 4PNYA 3QO2A 4XQQA 4IURA 4Q0FA 1I3QB 3P75A 5FKAC 3J81E 3MFGA 4EVOA 4IZ8A 1IL8A 1EQVA 1C48A 1DONA 1BQQT 4UDUC 4XTCS 3GTKB 2XSCA 3SK4A 1U4LA 4RFBA 5CBAE 4N9TA 2BCOA 1I4QA 3A54A 2R7ZB 2H1EA 1PRTB 5IGEA 2OF1A 2B2TC 1YNJD 5FLXL 4MN3A 3MFYA 2MP1A 1CQFA 1GUTA 3I72A 5NUCA 1ZEQX 1SNPA 2E2HB 5I2YA 3NWSA 5C0XG 1XXGA 2EJMA 2CW0C 2F0IA 4A3DB 1V1PA 1DD2A 1KDAA 2KECA 5CMDA 3KF8A 2FJ2A 3BDLA 1JQYD 2EYFA 1RHPA 4YIJA 1B53A 1IHZA 4KKTA 5C5LA 1EYCA 2B2WA 2A73B 2F0TA 4RWSC 5IIFA 5C3XA 5IODA 1ENAA 1DOMA 3Q22A 3TMEA 3VYSA 2E2DC 5G3LD 1SAPA 1WD1A 4NMZA 3SVMA 4KMUC 4BBRB 1O80A 2EPBA 1PDQA 1OXVA 4OO1G 2RDFA 4HSPA 3MXPA 5C3WA 5C0XI 4QIWB 2F0QA 1PTOB 1ZKOA 2A68C 4RKLA 4LAAA 3KUPA 4RGNA 2PYKA 2JA8B 4F7XA 3G7LA 3V05A 4IUQA 2L11A 2BOSA 3H94A 5A35A 2F0GA 3Q24A 3K0YA 2F0LA 1CZWA 2B2VC 4DNRB 2F0OA 3EVQA 4XDXA 2NTTA 1WTOA 4QB4A 4H13C 3W2DA 1Q8IA 2PO4A 2MPMA 3EJIA 2PZTA 4ZYSA 1F77A 3BZDB 4L63B 1TY2A 3A8JE 4A3EB 1SBBB 4FF2A 1JOQA 4J6HA 4DFAA 1EEFD 5E4XA 5CYUA 1O7YA 2HDLA 4J1MA 5E4WC 2A6EC 3D4DA 3NK9A 4M8AA 3S17B 2JA6B 4A3GB 3OWEB 1Z47A 5IGGA 1XTCD 1OO9B 2JA5B 1SNCA 1VMCA 2F0JA 4C1NK 3I91A 1AP0A 1HCZA 1PLFA 4XQNA 4K6DA 4KD4A 3HOXB 5JVG3 4UAIA 3X3MA 3EFXD 1S5CD 3AU7A 3OW7A 1WD0A 3S1RB 1JWSD 1A15A 3K58A 1LLRD 1I4GA 4FVMA 4ILWA 2F1MA 3OIPA 2BDOA 1HHVA 2VB2X 4ZKBB 2HCIA 4HTHA 1B3AA 4RCNA 2KHSA 4G7ZC 2RQXA 3GTPB 2IX3A 1CZGA 3R2TA 2IPKD 4HSVA 4C2MB 1EFID 1I6VC 3C3LA 5IGCA 3J7AF 2RDGA 4I7ZC 1U4PA 1GOZA 4A3JB 3K6OA 5KEEA 2OEOA 1XWEA 3ITPA 1ZXTA 1J8IA 1PZKD 2E2JB 4OIKA 2I46A 2QCPX 1ILPA 2B63B 1V8QA 5A2QE 1HUMA 1C4QA 3VR5A 4ZAIA 3E6ZX 1I6HB 1L0YB 2AUJD 3C1FA 2ZT9C 3FEWX 3N52A 4N9PA 3M4YA 4FXDA 1V1OA 3FPUB 1SDFA 3GV3A 4FXGC 3R93A 3ND8A 2F03A 1YNNC 4RAUC 3KK7A 3O13A 1Z7TA 1JORA 1B50A 1ET6A 4CKEA 3DXJC 1ILQA 5KGUA 5JPNC 3C2PA 2VUMB 2XWJB 2Z1CA 3VR6A 1X32A 4R8NA 4RHSA 4DF7A 2NVXB 3HOVB 3NSWA 3SDZA 1LTAD 3GTMB 2V4DA 4ZLTF 1WTVA 1X3PA 1AZPA 3TP6A 5IOCA 1PFBA 1H9MA 2KCCA 4TRDA 5BN4A 1A3UA 2AQ1B 1EU4A 2NN6H 1KDCA 1M4VA 2X69A 1HQRD 2FMMA 1CA6A 3DWPA 1KAAA 4DN4M 3CRKC 2B2YC 3I4LA 4BY1B 3TSSA 3PV0A 3KLSA 1ET9A 2IT1A 1CI3M 2GA4B 1W6KA 5EPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2L A;  1HUM A;  1PFM A;  3ONA B;  4X3U A;  2L12 A;  2JP1 A;  4IUQ A;  5DNF A;  1AZQ A;  2SDF A;  2MGS A;  4IUP A;  5COR A;  1DZ1 A;  4HCS A;  2EE1 A;  1HRJ A;  1ML0 D;  4ZAI A;  1DOM A;  4ZKB B;  3DEP A;  4CJ0 B;  1JE4 A;  4ZK9 B;  1EIH A;  1J9O A;  2EOT A;  1XX8 A;  2B2U A;  5EKI A;  3IFD A;  1HUN A;  3I8Z A;  4HED A;  1F2L A;  5EPJ A;  1B4O A;  1F9Q A;  1SAP A;  2L1B A;  2XIW A;  4X3S A;  1HFG A;  2NYZ D;  3N52 A;  1VMC A;  1WD1 A;  2RSN A;  2KEE A;  2N88 A;  2RSO A;  2HUG A;  3QO2 A;  3I91 A;  5CBE E;  1AP0 A;  3SVM A;  2L9H A;  1PLF A;  5EQ0 A;  5EPK A;  4ZKC B;  4IUR A;  1GUW A;  3FPU B;  1QE6 A;  1LV9 A;  2VXW A;  2KVM A;  1O80 A;  2B2V A;  2EPB A;  3IL8 A;  4UAI A;  5COY A;  2HDM A;  1SDF A;  1PDQ A;  3GV3 A;  1WTP A;  4O42 A;  1IL8 A;  1EQT A;  1S4Z A;  2KED A;  1QNK A;  3R93 A;  5JJZ A;  1WTQ A;  1WD0 A;  4MHE A;  2B2W C;  1A15 A;  2X6G A;  1RJT A;  4RA8 A;  4QUF A;  3H91 A;  5EJW A;  4RAU C;  1G2S A;  4XT3 B;  2D9U A;  4CJ1 B;  1WTX A;  1DON A;  1U4L A;  5T1G A;  1WTW A;  1WTR A;  5AFW A;  2B2T A;  2NWG A;  1WVL A;  1B50 A;  5CBA E;  1TVX A;  1KNE A;  3KUP A;  1RTO A;  1B2T A;  1G2T A;  2IL8 A;  2K05 A;  2DY7 A;  1ILQ A;  3GV6 A;  1MSH A;  2B2Y A;  3G7L A;  2MJ8 A;  2B2U C;  3KBX A;  1RTN A;  1KNA A;  1F9S A;  4R8I A;  1U4M A;  1HHV A;  2H1E A;  3F2U A;  3P7J A;  4U68 A;  2B2T C;  2L11 A;  1NR4 A;  3FDT A;  2L4N A;  1EIG A;  4HAE A;  2J7Z A;  2K28 A;  1X32 A;  1IKL A;  2FIN B;  2HCI A;  2K04 A;  1B3A A;  2MP1 A;  4MN3 A;  1DOL A;  4CJ2 C;  2K1B A;  1HA6 A;  2X6L A;  1M8A A;  4R9W A;  1VMP A;  3I90 A;  1HFN A;  4X3T A;  2B2V C;  1MSG A;  4IUV A;  4ZLT F;  1WTV A;  1X3P A;  2N55 A;  3I3C A;  1AZP A;  2NZ1 D;  1G91 A;  4XDX A;  4X3K A;  1WTO A;  3MWY W;  2CVR A;  1PFB A;  1CM9 A;  2BDN A;  1EOT A;  3TZD A;  3HP3 A;  1F9R A;  1XYI A;  1X3Q A;  1DOK A;  2HCC A;  2MPM A;  2Q8T A;  4HSV A;  4NW2 A;  1G6Z A;  5T1I A;  1BBX C;  1IKM A;  2R3Z A;  1MI2 A;  1F9P A;  2FHT A;  5D65 A;  2RVL A;  3DEO A;  2DY8 A;  2KEC A;  5CMD A;  2K01 A;  3LWE A;  2RA4 A;  1U4P A;  4QUC A;  2FJ2 A;  2Q8R E;  1E0B A;  2X69 A;  2K03 A;  2FMM A;  1Q3L A;  4RWS C;  1CA6 A;  4DN4 M;  1RHP A;  5D14 A;  1U4R A;  2B2Y C;  3D6W A;  3DM1 A;  1ZXT A;  1J8I A;  1B53 A;  1NAP A;  2JYO A;  1EL0 A;  1QG7 A;  1O7Z A;  1ESR A;  2KOL A;  3UI2 A;  1BNZ A;  4OIK A;  1PFN A;  4XT1 B;  4IUU A;  1NCV A;  3MTS A;  1BO0 A;  5E4X A;  1BF4 A;  4LMQ D;  1C8C A;  3TN2 A;  1ROD A;  1O7Y A;  1ILP A;  1SSO A;  2HDL A;  1MGS A;  1ICW A;  4OIJ A;  2B2W A;  1JIC A;  5E4W C;  2FFK B;  2KUM A;  4IUT A;  1CA5 A;  3Q6S A;  5EPL A;  1NR2 A; 
#chains in the Genus database with same CATH topology
 2NZO A;  2WKC A;  4KHZ A;  2KA7 A;  1AE2 A;  3AYH B;  4A3B G;  3NXW A;  3CC2 A;  2WB1 G;  1PH4 A;  4ME5 A;  3K57 A;  4RCO A;  5CGK A;  1PRT F;  3HZX A;  4ID6 A;  1XMO Q;  2F0P A;  1A2U A;  5ELD A;  1B9M A;  1SNQ A;  3CME A;  4F8M A;  4GKJ L;  1LM0 A;  2RSO A;  3OIQ A;  3I55 A;  4EX5 A;  3J7A V;  3EA6 A;  4IQZ A;  5CV4 A;  3S1Q H;  5IYB H;  5JJI A;  1LO5 D;  4GN4 B;  2I0Q A;  1CK1 A;  4LF8 L;  5M5Y H;  3J7A 5;  2AQ3 B;  3L9A X;  4AH6 A;  4GKJ Q;  1WTX A;  2K75 A;  3AFP A;  3NBI A;  5C6A A;  1R9T H;  3A56 A;  5AFW A;  2R92 G;  1TVX A;  5C44 H;  4LF9 L;  5C4Z A;  3CCR A;  4P75 A;  5KND A;  3DWA A;  1OXU A;  3H09 A;  4LF8 Q;  5JOB A;  2BA0 A;  3GV6 A;  3HOV G;  2MJ8 A;  1B70 B;  2I5M X;  3LWU A;  4JPB W;  3FDT A;  1FJG L;  4HAE A;  1VQ7 A;  4YWK A;  1TWF B;  5J39 A;  3GTL H;  2A69 C;  3V96 A;  5M5X B;  4LF9 Q;  1G6P A;  1XPR A;  3U4V A;  2CCZ A;  4E6I A;  1ICF B;  4DNI A;  3K0X A;  2EYJ A;  4DPG A;  2ATW A;  4GKK L;  3K59 A;  1FJG Q;  1K28 A;  4OWT B;  2KCN A;  1TS3 A;  2R3Z A;  1EY5 A;  3I4N G;  2K32 A;  4DR3 L;  1SJH D;  2K5D A;  5D3I B;  3QB3 A;  2PNR C;  2ALY B;  1BCP B;  2A74 C;  4ZUJ A;  3HOU H;  2HQE A;  4Z9C B;  2Z8L A;  4GNX B;  1HTP A;  2JA9 A;  4A3I H;  2Y0S B;  4GKK Q;  3DM1 A;  2I07 B;  2EYP A;  1LT5 D;  2SNM A;  2XGT A;  2EYM A;  3SK8 A;  4OEM B;  1I3Q H;  4DR3 Q;  3I70 A;  1WCM B;  1JIC A;  2FFK B;  2NUC A;  1NR2 A;  2M2L A;  4JI5 L;  1YNJ C;  5JJK A;  2EJG C;  3GTK H;  4OO1 H;  1PRT D;  2R61 A;  1JE4 A;  4P2C B;  1I50 H;  4JI7 L;  3H0G B;  1K83 B;  3BZC A;  4UHV A;  4HED A;  1B4O A;  2L1B A;  1HFG A;  3J80 L;  1RF2 D;  4N8F A;  2GVA A;  1PZJ D;  2RSN A;  2K6A A;  1WOC A;  2R7Z H;  1C9O A;  1W6J A;  1JCK B;  2NN6 G;  2OWO A;  2D0P A;  5KRU A;  2IHF A;  1F2Y A;  5E7N A;  3MXG A;  3E9H A;  1KIX A;  4KTA A;  1BBU A;  2UU9 L;  4JI7 Q;  4A93 B;  5HUR A;  2UXB L;  4PQX A;  4IAL A;  3HOW B;  1JJC B;  2F0F A;  1K9M C;  1RD9 D;  2K4K A;  2LXJ A;  2E2H H;  4KHV A;  5HGQ A;  4XT3 B;  3CAM A;  4JI6 L;  1JOK A;  2EXD A;  5G3L F;  1PH9 A;  4A3D H;  4GZY C;  4APV A;  3RR5 A;  2UU9 Q;  2UXB Q;  1MSH A;  1Q90 A;  1RTN A;  3D0F A;  1Q81 C;  4GNX A;  1JMC A;  2L4N A;  4PMW A;  3HEJ A;  2WAQ B;  3R3O A;  4JI6 Q;  5FLM H;  1YZ6 A;  1M8A A;  1VMP A;  3R2I A;  1VQA A;  4DV4 Q;  5IYC H;  3I3C A;  2NZ1 D;  1N8R C;  2WAC A;  4RG1 A;  1I50 B;  2IX1 A;  3CD6 A;  2Q8T A;  1KAW A;  4Y7N H;  1IYV A;  1BBX C;  3KYH C;  5IYB G;  4DGZ A;  1VQ5 A;  2Y0S G;  1D1K A;  4HR7 B;  1SYC A;  1A6X A;  2K01 A;  5KYL A;  2LFN A;  3CMA A;  3E0E A;  4PV1 C;  2JA7 B;  3A5U A;  1GHK A;  1GUG A;  4GOP A;  2NN6 I;  5C44 G;  4BBR H;  2VL6 A;  2PQE A;  1C8C A;  1LT4 D;  2DN8 A;  4KN4 C;  3TDQ A;  4IUT A;  4YHH L;  2K5Q A;  3PIP A;  1AEX A;  2QDB A;  3H0G G;  5E3F A;  5J22 A;  1WTH A;  3MXN B;  3KBG A;  4MTN A;  1E22 A;  3PSI A;  2LSS A;  1DXM A;  1PTO H;  1JR0 D;  4PMC A;  3VR4 A;  1EIH A;  4DR6 L;  1TU2 B;  2R7D A;  5EKI A;  2C5C A;  3IFD A;  1PH2 A;  2FMC A;  1HUN A;  3VA5 A;  1IL2 A;  1IYJ B;  3RZO B;  4YHH Q;  2K50 A;  4JBW A;  4DAY B;  4IUN A;  3WOF A;  1KLU D;  1JE5 A;  3WWV A;  1QVC A;  3T53 B;  1D5X C;  2ZTC A;  5COY A;  3URY A;  3UE1 A;  3OMC A;  4C3J B;  1Q1B A;  1ESF A;  1NTG A;  4DR6 Q;  4LFC L;  4JC0 A;  2KHJ A;  3HOU G;  4Y7N B;  5FO7 B;  1XJV A;  1PZI D;  4A3I G;  1EYA A;  2E74 C;  3K5M A;  1HTL D;  2J0T D;  2OT2 A;  1Q7Y C;  3NP8 A;  1G2S A;  1Y8N B;  1Q12 A;  4LUO A;  1UE7 A;  2KEN A;  3PIP 3;  2ZM6 Q;  2DNE A;  1RTO A;  1Z9F A;  2QF7 A;  3CU7 A;  2E75 C;  4JI1 L;  1YHB A;  3CCM A;  5KNC A;  1VQ8 A;  1HNZ Q;  3ICE A;  4X62 L;  4EQO A;  3G48 A;  1D7Q A;  5ELF A;  1O78 A;  4C3H B;  2B8F A;  2EY1 A;  2E5L L;  3H3V H;  2JEB I;  3SK6 A;  5J1Z A;  4QCL A;  2F0E A;  1VQ4 A;  4JI1 Q;  1TWG B;  2R7Z G;  4DV1 L;  3S17 H;  3A5Z B;  1E24 A;  2F3I A;  2JA6 H;  1G8Z D;  3K5O A;  2KQ3 A;  2E5L Q;  1Q82 C;  1SXT A;  3HRZ C;  3AEV A;  5D65 A;  2RVL A;  5I9P A;  3TS0 A;  1TKW B;  3TQY A;  4QUC A;  1W2B A;  3FHW A;  4HCE A;  3S2D B;  4JI8 Q;  4DV1 Q;  2PI2 A;  3PUY A;  3W1G A;  3KF6 B;  1ENF A;  4IJH A;  1U9R A;  3TEH B;  4A3D G;  3HOX H;  4OWX B;  5IT9 E;  2LXK A;  3BZK A;  2A1A A;  2K33 A;  4LMQ D;  3TN2 A;  1PV4 A;  3FKI B;  4JOI A;  2O5J C;  4JI3 L;  1KQS A;  3NTH A;  3M85 A;  3BJU A;  2UXD Q;  3ONA B;  2L12 A;  2B8G A;  4S3S A;  3S1R H;  3MA2 B;  4JYA L;  2SDF A;  1RKN A;  1Y1V B;  5FLM G;  1EY8 A;  2MFI A;  3N6R A;  1YHA A;  1A3T A;  3K7A B;  1I94 L;  3S16 B;  1LYL A;  1SE3 A;  4L8J A;  3W5O A;  4IN3 A;  5LL6 S;  5IYC G;  5ELE A;  1XNQ Q;  3M3Y B;  2O4X A;  4AYB B;  4JI3 Q;  1I4H A;  4DNT B;  4V0B A;  1FD7 D;  2N88 A;  2QA4 A;  4JYA Q;  2Q2T A;  2WP8 J;  4OO1 I;  3U9S A;  2CHB D;  1SE8 A;  4KY5 A;  2LY7 A;  1I94 Q;  3TP8 A;  1YHQ A;  4XQJ A;  1Q8K A;  3BDO A;  1EQT A;  1S4Z A;  3GTP H;  3IKJ A;  3EQL C;  2X6G A;  5EGT A;  1RJT A;  5JEA J;  1E1O A;  2VQF L;  4C56 C;  3FRP B;  4BBR G;  4CDE C;  2NWG A;  4C2M H;  3S1N B;  5I9O A;  5IP7 H;  4C3H G;  3P1H A;  2EY6 A;  2PQA B;  3CQZ B;  4WJW A;  5AJ3 L;  1F9S A;  4IFD G;  1SNM A;  1EIG A;  3PCO B;  3J80 c;  4JI2 L;  2VQF Q;  2Q8I B;  5ELO A;  3KF6 A;  4CJ2 C;  5JEA H;  4DR1 L;  2E2J H;  2TSS A;  4K2L A;  3ULP A;  3A7A B;  4R9W A;  4K5V A;  4BXX H;  3MXU A;  3VYU A;  2B63 H;  3NTI A;  5AJ3 Q;  2HD3 A;  1STH A;  1H9R A;  3TZD A;  1HNW L;  3ZYY X;  1KC8 C;  3GDE A;  3TBI B;  4JI2 Q;  5T1I A;  1Y14 B;  1Z6H A;  5IE8 A;  2CFM A;  2DGY A;  2RCF A;  4DR1 Q;  3OWF A;  1EY4 A;  1I6H H;  2QIL A;  1IBK L;  1A3V A;  1VQD A;  4QQB X;  2AQ2 B;  2F4I A;  1GUO A;  1VQF A;  3NQI A;  1EYG A;  2RHS B;  1C0A A;  1AFP A;  4CBV A;  3FKI G;  1HNW Q;  2A6H C;  3OPO A;  1K0S A;  1VF5 C;  3PO3 B;  1Y69 U;  3NBH B;  3NQT A;  4K5X A;  3VR2 A;  5H1S E;  1TS2 A;  1SRO A;  1GXD C;  2J4X A;  1IBK Q;  1RDP D;  3EN2 A;  4B9X A;  4DR7 L;  2BH8 A;  1X6O A;  1AE3 A;  1SYE A;  1LUZ A;  1UUP A;  1K8G A;  1H95 A;  5DNF A;  1IW7 C;  1YJ9 A;  2CQA A;  1D6E C;  2EE1 A;  3OHX C;  4ABN A;  3T56 B;  1TWH B;  1NUC A;  4WOR A;  2EOT A;  4K2K A;  4ULL A;  3MEF A;  5EPJ A;  2F3V A;  3RZD B;  1F9Q A;  4DR7 Q;  2VNU D;  1HXY D;  4RKB A;  3UDF A;  1JOO A;  1B44 D;  2VUM H;  4BBS B;  1GUW A;  2NVX H;  3IAY A;  3HOV H;  5I4D A;  5EKL A;  3GTM H;  1OXT A;  4KJN A;  1BR9 A;  3S2H B;  3X3N A;  1H9K A;  1S3O A;  2ICE C;  4QY7 A;  3CCL A;  1D5Z C;  4HJA A;  3CKI B;  3S15 H;  4OWW B;  1BCP F;  2UUC L;  3HOX G;  3PIO A;  1JC7 A;  2IL8 A;  3U4Z A;  1MJC A;  4HID A;  1ZYR C;  3Q0A A;  3ULL A;  5EBD A;  2B2U C;  1QB5 D;  1SFO B;  4LUZ A;  1F2M A;  5J3B A;  1U4M A;  2F0D A;  3VA7 A;  1SNO A;  1XTD A;  3D4R A;  4A4I A;  5IYD H;  1KD1 C;  4BY1 H;  4FF4 A;  2UUC Q;  4R4I A;  2XTI A;  3B6Y A;  2X6L A;  1WFQ A;  3ERO A;  3I90 A;  1EFW A;  3PUZ A;  4RHR A;  1S72 A;  1BOS A;  4LWC A;  2EJF C;  3G6J B;  2BDN A;  1EY0 A;  2YV5 A;  1PXU A;  2PW5 A;  3H3V I;  5C4J B;  1STY A;  1QWY A;  1PYB A;  3D31 A;  1DYQ A;  5BR8 L;  1TY0 A;  1L1O C;  2I5H A;  3JAM c;  2RDH A;  2AKW B;  3PIO 3;  2PMZ E;  1MBY A;  4H02 A;  4B3R L;  1U4R A;  1PH1 A;  1PH3 A;  1UE1 A;  1TT2 A;  3L2P A;  5M9O A;  1PFN A;  1Q46 A;  3MTS A;  4N8X 1;  5FO8 B;  1K8M A;  2EQS A;  5BR8 Q;  3S15 B;  1SYG A;  5E1F A;  2WB1 E;  4WJ3 M;  3BVZ A;  4KD3 A;  4GOP C;  1VQO A;  4L5S A;  1LTR D;  1PFM A;  3TP5 A;  4X64 L;  1Q1E A;  2JP1 A;  4DU9 A;  2ZJP A;  4B3R Q;  4B3T L;  1E2V A;  5JEA G;  1R4P B;  1CTM A;  3NHH A;  4CJ0 B;  5C3E B;  5FO9 B;  1STN A;  4BXX G;  1PA6 A;  5DM7 3;  3J81 c;  4M1U B;  4BBS G;  4DV3 L;  5BN5 A;  2IW3 A;  2Z9H A;  2XIW A;  5CR3 A;  2JE6 I;  4K8I A;  4X64 Q;  1XNR Q;  1V1Q A;  1UE6 A;  4FP5 D;  5EQ0 A;  4B3T Q;  2F0H A;  3DLL A;  1TWF H;  2M00 A;  2B2V A;  2JJQ A;  3HOZ B;  2C9O A;  5M5X H;  2IHE A;  1UNS A;  3G71 A;  4IPC A;  1SEB D;  4DV3 Q;  2HIX A;  3CC4 A;  4TKO B;  2F0V A;  3BVM A;  4DXG A;  1HH2 P;  4RH6 A;  4IOA A;  2B2W C;  5I6W A;  4RA8 A;  4QUF A;  1BCP D;  1QUQ B;  3A0J A;  1WTR A;  2AUK A;  3NEN A;  1T5X D;  3STB D;  1SRU A;  5A2Q L;  4O0A A;  4R8I A;  1Y8P B;  3M7G A;  5JAV A;  1HNX L;  3I56 A;  2VW9 A;  2O2L D;  1CHQ D;  3MZ5 A;  1YNN D;  1PRT C;  2EYL A;  1X3F A;  1WCM H;  1TR5 A;  1H9S B;  1HNX Q;  2VUM G;  4POG A;  4ZCK A;  1G29 1;  1PYS B;  4K8J A;  4L5R C;  1O7I A;  4U67 3;  3GP7 A;  4A3M B;  3HFZ B;  3GTG B;  2VS1 A;  1X65 A;  3H0G H;  2O5I C;  1K83 H;  4KLK A;  1FGU A;  2RBM A;  3F2C A;  3KFU A;  2BE5 D;  1LTI D;  1PMR A;  1EL0 A;  1AW7 A;  1VQM A;  2ZJQ A;  2KOL A;  5M3M B;  4XT1 B;  2N49 A;  2Z6K A;  1W3S A;  1L0W A;  1SSO A;  4A93 H;  1NNX A;  3HOW H;  2CVR A;  1ENC A;  3BG3 A;  5CV5 A;  3HKZ B;  1JB7 A;  5IYD G;  4FNF A;  4BY1 G;  2WKD A;  1Y8O B;  4CDC C;  5FLX E;  1QUQ A;  3CCJ A;  3TS2 A;  3DEP A;  3CPF A;  4X65 L;  4CGY B;  1D2B A;  4JCV E;  3L0O A;  2XN9 C;  3SR1 A;  4A3L G;  1J5E L;  3W1B A;  2L0C A;  1T5E A;  1LTS D;  2L9H A;  3MC0 B;  1J6Q A;  4ZKC B;  4XYQ A;  3E3X A;  1QE6 A;  4Y52 H;  4HMJ A;  1PTO F;  1YJW A;  1X54 A;  3OSO A;  4X65 Q;  4QL5 A;  1V9P A;  1IXR A;  1OXX K;  3DUZ A;  2ID0 A;  5JJZ A;  1N9W A;  4BA1 I;  4BY7 B;  2XRS D;  1J5E Q;  3LX0 A;  1H9S A;  1SYD A;  4NPS A;  5HY6 A;  3WDN A;  1WVL A;  1LAC A;  3KLR A;  1B2T A;  4AIM A;  3GQB A;  4JI5 Q;  1DJR D;  3M7N A;  3C1E A;  2LS0 1;  1PFS A;  2L55 A;  4UP8 A;  4L6T B;  2JA7 H;  2FIN B;  1BBW A;  1O7L A;  4TVA B;  4DV2 L;  2K52 A;  1NMF A;  1HFN A;  1STB A;  3E9I A;  3M9B A;  4KV6 A;  2JEA I;  3A55 A;  2NZH A;  2K5H A;  2JSO A;  3HP3 A;  4NKL A;  2Y0S E;  4QGU A;  4NW2 A;  4DR4 L;  1V1P B;  1T9H A;  3LWE A;  3M4P A;  5LL6 X;  5GAH C;  4P74 A;  5M3M G;  2A69 D;  4DXF A;  3T1Y L;  3K8A A;  2BA1 A;  3RZO H;  1RL2 A;  3PO2 H;  1EY6 A;  1YEZ A;  2ENB A;  2Z4H A;  2WII B;  1EWH A;  4DR4 Q;  3EBE A;  1FYC A;  1NCV A;  4C3J H;  3HKZ G;  1X3E A;  2PCF B;  2MQH A;  5M3F B;  3H3V C;  2ZJR A;  2NVQ B;  1EWC A;  1TQO A;  3T1Y Q;  1JJ2 A;  4J15 A;  4PZ8 A;  2H4O A;  2WV6 D;  4OGQ C;  4IPG A;  4IUP A;  4FF3 A;  2RCN A;  1HRJ A;  4IFD J;  1FGB D;  5TSS A;  1XX8 A;  3FPP A;  1WCM G;  4H44 C;  2ZTE A;  3S14 B;  1EEI D;  3NPP A;  4HMI A;  2NYZ D;  1U5K A;  3L7Z C;  3IRB A;  1BDO A;  4ZUI A;  2RF4 A;  4C3H H;  5DEH A;  1PTO D;  3T13 A;  3IL8 A;  3K5N A;  4IFD H;  4R4C A;  4JV5 L;  3PMF A;  1S5B D;  1UE5 A;  3P20 A;  4O42 A;  1P8L A;  2AMC B;  4JBJ A;  2OQ0 A;  1CT1 D;  3CRL C;  1TWG H;  1BUV T;  1EYD A;  4CJ1 B;  4X66 L;  2NTS A;  1TWA B;  4AQY L;  1DCZ A;  3LNN A;  5T1G A;  3Q8D A;  2WAQ E;  4YCV A;  3PO2 B;  4B08 A;  3IFT A;  1SMX A;  5I2X A;  4JV5 Q;  4A93 G;  2F0M A;  2M9V A;  2B2Y A;  3HOW G;  5CC4 A;  4J8Q A;  3BYT B;  3S2D H;  1SN8 A;  1HJP A;  1VDZ A;  2E76 C;  5DAU A;  4ZQ3 A;  4DV7 L;  2J7Z A;  1K0R A;  1PH7 A;  3J7Y W;  4AQY Q;  5LMN L;  1P16 A;  1SMY D;  2G9H D;  3D3R A;  1PVO A;  2Q2I A;  1HA6 A;  1VQL A;  4X3T A;  2F3W A;  2MUY A;  4IUV A;  2ZXR A;  2N55 A;  3FKI H;  1G91 A;  1E2Z A;  3JAM L;  1STA A;  4PMB A;  2DNC A;  3I4M B;  5F2D A;  1F9R A;  4DV7 Q;  4EQN A;  3T4A C;  1DOK A;  2WAQ G;  1JT8 A;  4LFC Q;  1Y1V H;  5KNB A;  4LF7 L;  3RN5 A;  1MI2 A;  4CKB A;  4RMF A;  2FHT A;  3U9O A;  3FVQ A;  3K7A H;  3S16 H;  1SYB A;  3M3Y H;  4G7O C;  5CV7 A;  5D14 A;  2JN4 A;  5M5W H;  2UUB L;  1NAP A;  2A19 A;  1QG7 A;  4G4K A;  5C5M A;  5CV9 A;  1OXS C;  2ZXO A;  1BNZ A;  4LF7 Q;  2K14 A;  1YNX A;  4XIG S;  5CV6 A;  1II3 A;  4X62 Q;  3TRZ A;  4KN7 C;  2KUM A;  4QF4 A;  1FNU A;  3MXN A;  3J81 L;  4A3K B;  1SYF A;  2JA7 G;  1JWM D;  4TSS A;  1VQG A;  1CFM A;  2PI2 E;  5C4X H;  1AZQ A;  2UUB Q;  2F0W A;  4XYO A;  1DZ1 A;  4LF4 L;  4R1J A;  3JC6 6;  1ML0 D;  4YCW A;  4ZK9 B;  1EY7 A;  4L5Q A;  5IGD A;  4F88 A;  2DJG C;  3S1N H;  1EU3 A;  4DAY A;  1Y1W B;  3S24 A;  1A63 A;  2XVS A;  1FR3 A;  3CQZ H;  1LT6 D;  2HUG A;  1IBM L;  1B7Y B;  4YWL A;  4A75 A;  2CW0 D;  1STG A;  4R4T A;  1D1I A;  4DKA C;  4LF4 Q;  1LV9 A;  2VB3 X;  4A3F B;  2ZXP A;  1KDB A;  3G4S A;  4KY6 A;  3S9W A;  4P71 A;  2YTV A;  1TS5 A;  1S5F D;  3PO2 G;  2EZV A;  3PUW A;  5GAD C;  2YU9 B;  1IBM Q;  2R6G A;  2MO0 A;  2K7V A;  4C3J G;  2LKV A;  1LT3 D;  3MVV A;  1TWC B;  2D2C C;  5M5W B;  2K05 A;  2NVT B;  4QIW E;  2KBN A;  1KNA A;  4DUY L;  4G7H C;  3CW2 C;  2HIV A;  4A3C G;  3QG1 A;  1SE2 A;  1IKL A;  2L5T A;  3UDX A;  4C3I H;  4O1N A;  2PPB C;  3J80 i;  1EY9 A;  1F2Z A;  4HJ9 A;  1PHJ A;  1MD2 D;  3PO3 H;  1N36 L;  4DA2 A;  4HJ8 A;  1KL9 A;  5C4X B;  3KDF B;  2F4V L;  2JXM B;  3I7F A;  3PUX A;  2F0U A;  2IWH A;  2XWB B;  2V1C C;  1HR0 L;  2NVY H;  1A2T A;  4KK7 A;  4MIU A;  4DK1 A;  5K36 H;  1IKM A;  3DHQ A;  1TWH H;  3UDG A;  1YBY A;  4FDB A;  2QEJ C;  3ND9 A;  1H9J A;  3E0J A;  4CHT B;  1N33 L;  4JVZ A;  1TS4 A;  5DM6 3;  4DAV A;  3RZD H;  1MJE A;  3Q23 A;  1HR0 Q;  3S1M B;  2MHV A;  3OOC A;  5FK9 C;  1K8O A;  4NP5 A;  2A68 D;  3H6M A;  4A3K G;  4BBS H;  4K14 A;  1ESR A;  1UEA B;  1EZ6 A;  1WJJ A;  1MKH A;  4JI0 L;  1MGS A;  1JB3 A;  1ICW A;  1EZ8 A;  5CBE E;  3HG9 A;  1N33 Q;  1YJN A;  3S2H H;  4LJZ C;  3I73 A;  4L5T A;  1SR3 A;  1SE4 A;  5HGT A;  2MGS A;  1QVF A;  3A8I E;  1QVG A;  3K81 C;  1C7Y A;  2WIN B;  4CKC A;  4DV5 L;  4UY8 C;  1VQH A;  2AHO B;  3QR8 A;  1J9O A;  4A76 A;  4C3I B;  4JI0 Q;  4EGV A;  4A3F G;  1STE A;  4OL7 A;  3V2T A;  3TP7 A;  1B1Z A;  3BVG A;  2QW7 A;  1SFO H;  1KAB A;  3D4W A;  1E7Z A;  1Y1V G;  3CCU A;  1CSP A;  4DV5 Q;  1CHP D;  2HDM A;  4IOC A;  2NVY B;  5KIX A;  1RIP A;  1GJX A;  2IJ0 A;  1WTP A;  2QGQ A;  3KDF A;  4AYB G;  1VQB A;  5ISR A;  1GUN A;  1RCV D;  2C35 B;  3VYR A;  4HIO A;  2YTX A;  3R8B A;  3H91 A;  3BS1 A;  3CCS A;  1WTW A;  5IT9 L;  1N32 L;  3KLW A;  2B2T A;  2B29 A;  2K5W A;  4K6L A;  1NE3 A;  3SEB A;  3AB9 A;  5LMN W;  2PQA A;  5C4J H;  4IFD I;  3M4O B;  5I6Y A;  2PZW A;  2OTL A;  3W3A A;  1MHW C;  2A6E D;  3L3O C;  1B9N A;  1PH5 A;  5C4X G;  1GUS A;  2F0S A;  3MHB A;  2K28 A;  1UWV A;  2K04 A;  2QKI C;  1DOL A;  2SNS A;  4POF A;  2D62 A;  1N32 Q;  2MNA A;  3GTJ B;  2A5H A;  4B3M L;  5LHY 1;  3HOY B;  2G9D A;  3NEL A;  1LTG D;  3GTO B;  3GTQ H;  2E2I B;  4H0L C;  3T16 A;  4LFA L;  2SOB A;  5CV8 A;  2EIF A;  1CM9 A;  1QOH A;  2PMZ B;  1XPU A;  1GVP A;  2PNH A;  3RLF A;  3SE0 A;  5ELC A;  3VR3 A;  2ZTD A;  1A62 A;  5C3E H;  4B3M Q;  4KHP L;  1LTT D;  3DEO A;  2DY8 A;  1XPO A;  2PZU A;  3JAM i;  5EKK A;  2Q8R E;  1VQ9 A;  2A8V A;  3OYY A;  5KYI A;  3TRE A;  4LFA Q;  4A3B B;  2WB1 B;  3NBH A;  1BCP C;  2OXP A;  4XXE A;  5BN3 A;  4GNX C;  1CKN B;  1FNW A;  3QWN A;  1O7Z A;  4TQU S;  3UI2 A;  4IUU A;  3DMU A;  4A3L H;  1BO0 A;  1KXL A;  4KHP Q;  2RKS A;  3HOZ H;  1YVC A;  3STB C;  4NXN L;  1EOV A;  3Q6S A;  5D3D A;  4BWG B;  4R4O A;  3OW2 A;  4EQP A;  4X3U A;  1HPC A;  4C3I G;  4KI0 A;  1QIL A;  5DLQ E;  3PO3 G;  1VQC A;  1JJG A;  2A6H D;  4NDX A;  1MIU A;  3SHL A;  1HA5 A;  3J81 i;  1K3R A;  3QJY A;  4LK1 C;  4NXN Q;  2R93 B;  1QNU A;  2KCM A;  2Z4I A;  2KEE A;  2GN5 A;  2OQK A;  1XMQ L;  5K36 G;  3GTQ B;  2R92 B;  2VXW A;  3WOE A;  2KVM A;  1IW7 D;  3NTK A;  3PF4 A;  5EAY A;  1EWI A;  3D8G A;  1VQP A;  1X3G A;  4RGO S;  2FXQ A;  2KED A;  1WTQ A;  5K5P A;  4GS3 A;  1V43 A;  4BA2 I;  4MHE A;  2XNA C;  3A8K E;  3FMC A;  2BE5 C;  1GM5 A;  5EJW A;  1XMQ Q;  2D9U A;  2D5D A;  4JI4 L;  1E2W A;  3HS0 C;  1VQK A;  4PZ6 A;  4A3M H;  3GTG H;  4RGT A;  1SJE D;  3KBX A;  1VQ6 A;  3HOY G;  2OTJ A;  2AWN A;  1NR4 A;  1M90 C;  1HR0 W;  4DK0 A;  4GN3 B;  1WI5 A;  4KJO A;  2UXC L;  1BXT A;  3A7L A;  4F87 A;  3I4N B;  2K1B A;  5M3M H;  4DV0 L;  1E3P A;  3T51 B;  4UP9 A;  1XMO L;  3MWY W;  2IX0 A;  3J80 E;  1ZYR D;  3NUC A;  1UAP A;  2P5Z X;  1AN8 A;  1X3Q A;  1XYI A;  2EXZ A;  3NWT A;  1G6Z A;  1KTK A;  1KRS A;  5ELB A;  2UXC Q;  1F9P A;  1S40 A;  4KY7 A;  5IGB A;  4DV0 Q;  3F2B A;  1HZC A;  1VCI A;  5JPM C;  1S5D D;  1E0B A;  2K03 A;  1Q3L A;  4FO2 A;  1I4X A;  4ZRZ A;  4ALP A;  1D5M C;  2JYO A;  3U58 A;  4LFB L;  3AMU A;  2F52 A;  2AWO A;  4RGM A;  1BF4 A;  2E8G A;  4DAP A;  1ROD A;  3RUZ A;  4H7B A;  2NB0 A;  4OIJ A;  4C1N I;  5C0X J;  2CQO A;  3F8T A;  1CA5 A;  3BYY B;  1GD7 A;  3TZU A;  3EIV A;  2ICI A;  1I4R A;  4BY7 H;  1NSN S;  5COR A;  5JVH 3;  4YWM A;  2R93 G;  4LFB Q;  3GD7 A;  4YCU A;  3SK5 A;  2R7F A;  2PW7 A;  3I8Z A;  3F1Z A;  1F2L A;  4X3S A;  4WRD A;  4I65 A;  5IP9 H;  1CUK A;  1LAB A;  3SXH A;  4K5W A;  5C0X H;  1OTC A;  4IO9 A;  4GLX A;  2LMC B;  2EYH A;  5EPK A;  1GHJ A;  4DAM A;  5C3E G;  1JWU D;  5IGF A;  1QJO A;  1ONL A;  2DUD A;  3G6E A;  4B9W A;  2NBF A;  4JK1 C;  2EY2 A;  1QNK A;  5C4H A;  2EY5 A;  5EBC A;  4JOI C;  1DM0 B;  2HHH L;  2F0K A;  4FXK C;  2CH4 W;  5IWA L;  2JQO A;  1VS0 A;  4R4Q A;  3CCE A;  4DV6 L;  3BDC A;  1KNE A;  1VQI A;  1G2T A;  3HOZ G;  4HIM A;  2IY5 B;  2DY7 A;  4UP7 A;  3DWQ A;  1HZB A;  3C46 A;  1CSQ A;  4PG3 A;  4UPA A;  3QIA A;  5FJ8 H;  3QOJ A;  3PUV A;  3F2U A;  3K5L A;  3P7J A;  4U68 A;  4KKS A;  3KJP A;  2B39 A;  1QCB D;  2HHH Q;  2TMP A;  3F2D A;  2N78 A;  3MAQ A;  3S1Q B;  5IWA Q;  2F0N A;  3E5S A;  4QMG A;  4DV6 Q;  2EVB A;  5FOB B;  5M5Y B;  5GRO A;  3VYT A;  1MSG A;  1VF7 A;  5M3F H;  1YI2 A;  3OMG A;  1R4Q B;  3ERQ A;  3I2Z A;  2XRQ D;  4X3K A;  2NVQ H;  4KKU A;  1PH8 A;  3HGB A;  3RD4 A;  1CQV A;  1EOT A;  5LMU L;  4LUV A;  1R9T B;  2HCC A;  1L1O B;  5C44 B;  1PTO C;  4OHJ A;  1PYW D;  4FF1 A;  4P72 A;  4FYD A;  2ES2 A;  1SLJ A;  5IT9 c;  1CKM A;  1N34 L;  2KJX A;  2RA4 A;  4G57 A;  4DR2 L;  3D6C A;  1S5E D;  1L0X B;  2YYZ A;  3MEH A;  2EYO A;  3ULJ A;  2Z6B A;  3S14 H;  3D6W A;  5GAG C;  1Q86 C;  4WFN 3;  5LMU Q;  1HQM C;  3VDY A;  3ERS X;  3GO5 A;  3HKZ E;  3GTL B;  4BS9 A;  4ODG A;  4GOP B;  3JAM E;  4A3M G;  2G5D A;  1TII D;  3QOL A;  1N34 Q;  1FNV A;  1SND A;  3NE5 B;  4Q5V A;  3RNU A;  4DR2 Q;  1IYU A;  1KLG D;  4DV2 Q;  3PQI A;  5ELN A;  1I4P A;  2SEB D;  2UUA L;  4HCS A;  4JW0 A;  1TWA H;  3AFQ A;  1SMY C;  1LTB D;  1KRT A;  1D8L A;  3NEM A;  3KLS X;  3RMH A;  3KF8 B;  2B2U A;  4HN7 A;  2EDG A;  3HOU B;  4V19 0;  2VQE L;  4A3I B;  3CHB D;  4NB3 A;  4DV4 L;  4PNY A;  3QO2 A;  4K0K L;  4XQQ A;  4MTK A;  4IUR A;  1HZA A;  2UUA Q;  1IZ6 A;  4Q0F A;  2QEX A;  1I3Q B;  3P75 A;  5FKA C;  3UE0 A;  3J81 E;  3MFG A;  4EVO A;  1DGS A;  4IZ8 A;  4DK6 C;  4B3S L;  4A3C H;  1IL8 A;  2VQE Q;  1EQV A;  1YIJ A;  4LNQ A;  1C48 A;  1DON A;  4QJF A;  1BQQ T;  2JK8 A;  4UDU C;  4XTC S;  3GTK B;  2XSC A;  3SK4 A;  1U4L A;  3I4M H;  4K0K Q;  1L1O A;  4RFB A;  5CBA E;  4N9T A;  2BCO A;  1I4Q A;  4EQ5 A;  4B3S Q;  2WFW A;  3A54 A;  2DJF C;  2R7Z B;  1PH6 A;  2H1E A;  1PRT B;  5IGE A;  2OF1 A;  4BY7 G;  2B2T C;  1YNJ D;  5FLX L;  4MN3 A;  3MFY A;  2MP1 A;  1CQF A;  4NXM L;  2CKZ B;  1GUT A;  3I72 A;  5NUC A;  4GN5 A;  1ZEQ X;  1SNP A;  5IP9 G;  5I2Y A;  2E2H B;  4JBM A;  3NWS A;  1NBW A;  5C0X G;  1XXG A;  4A3K H;  2EJM A;  2CW0 C;  2F0I A;  4A3D B;  1V1P A;  1DD2 A;  4NXM Q;  1KDA A;  4P73 A;  2KEC A;  5CMD A;  3KF8 A;  4X66 Q;  2FJ2 A;  3BDL A;  1JQY D;  2EYF A;  2KCT A;  3ER0 A;  2QDL A;  1Y1W H;  3DM3 A;  1RHP A;  4YIJ A;  1B53 A;  1IHZ A;  4KKT A;  2JA8 H;  5C5L A;  5GAE C;  2OCE A;  4A3F H;  1EYC A;  3FP9 A;  2KHI A;  2ZM6 L;  2L15 A;  5FJ8 G;  2B2W A;  3K80 C;  2A73 B;  2F0T A;  4RWS C;  5IIF A;  5LMN Q;  5C3X A;  5IOD A;  1K3B C;  1ENA A;  2YU9 H;  1HNZ L;  1DOM A;  3Q22 A;  3TME A;  3VYS A;  2E2D C;  1TWC H;  5M3F G;  5G3L D;  2D0O A;  2Q2U A;  2NVT H;  1SAP A;  5GQO A;  1NMG A;  1LTL A;  3M4Q A;  1BVS A;  4GLV B;  1WD1 A;  4NMZ A;  1K8A C;  3SVM A;  3ZJY C;  4KMU C;  4BBR B;  1O80 A;  2EPB A;  1B3Q A;  1PDQ A;  4A3E H;  1NY4 A;  1OXV A;  3HKS A;  4JBK A;  5L37 A;  4OO1 G;  2RDF A;  4HSP A;  3MXP A;  4O2D A;  5C3W A;  1E1T A;  4CDF C;  5C0X I;  4QIW B;  2I5L X;  2F0Q A;  1PTO B;  4JI8 L;  1FL0 A;  1ZKO A;  2A68 C;  4RKL A;  4LAA A;  3KUP A;  4DK3 C;  4RGN A;  2PYK A;  2JA8 B;  4A3G H;  4F7X A;  3G7L A;  4LF6 L;  4OON A;  3V05 A;  4IUQ A;  2L11 A;  2BOS A;  3H94 A;  3S1M H;  5A35 A;  2JA5 H;  2UXD L;  2F0G A;  3Q24 A;  3K0Y A;  4OEL B;  2F0L A;  1EUJ A;  1CZW A;  2B2V C;  4WJ4 A;  4DNR B;  1A8V A;  2F0O A;  3EVQ A;  4XDX A;  2NTT A;  4LF6 Q;  1WTO A;  4QB4 A;  2K5V A;  1UEB A;  4H13 C;  2HT1 A;  3I4O A;  1XNQ L;  1TXY A;  2VZA A;  3W2D A;  1A0I A;  1Q8I A;  2PO4 A;  2MPM A;  2N3S A;  3EJI A;  4OXP A;  2PZT A;  4ZYS A;  1F77 A;  1B8A A;  3BZD B;  1M1K C;  1U0L A;  4L63 B;  1TY2 A;  3A8J E;  4A3E B;  1SBB B;  1HZ9 A;  3I4M G;  2CH4 A;  4FF2 A;  1JOQ A;  2MO1 A;  4J6H A;  1ASY A;  4DFA A;  1EEF D;  1YIT A;  1KHI A;  5E4X A;  2Q2H A;  4DUY Q;  5CYU A;  1QZG A;  1O7Y A;  2HDL A;  4J1M A;  5E4W C;  2H5X A;  2A6E C;  3D4D A;  3NK9 A;  4M8A A;  3S17 B;  1N36 Q;  2JA6 B;  2F4V Q;  4A3G B;  2CWA A;  3OWE B;  1Z47 A;  5IGG A;  1XTC D;  1OO9 B;  3U50 C;  3M4O H;  2JA5 B;  1SNC A;  1VMC A;  2F0J A;  4C1N K;  4HJ7 A;  3I91 A;  3RN2 A;  1AP0 A;  1HCZ A;  1PLF A;  4XQN A;  4K6D A;  4A3J H;  4KD4 A;  3HOX B;  5JVG 3;  4UAI A;  4AYB E;  3X3M A;  3GTJ H;  2GVB A;  3EFX D;  3LGJ A;  3HOY H;  1S5C D;  3AU7 A;  2Z6K C;  1WYD A;  3OW7 A;  1Y1W G;  1WD0 A;  3GTO H;  2E2I H;  3S1R B;  1JWS D;  1A15 A;  3K58 A;  2N8N A;  1LLR D;  1VQJ A;  2JA8 G;  3KOJ A;  3AQQ A;  1VQN A;  1I4G A;  1X56 A;  1CKO A;  4FVM A;  4ILW A;  1X55 A;  2F1M A;  3OIP A;  3CXC A;  2BDO A;  1BKB A;  1HHV A;  1IBL L;  4DUZ L;  2VB2 X;  3PGZ A;  4ZKB B;  2HCI A;  4HTH A;  4A3B H;  3CP0 A;  1B3A A;  3CF5 A;  3CCQ A;  3J81 j;  4RCN A;  2KHS A;  4YY3 L;  4G7Z C;  2RQX A;  3GTP B;  2IX3 A;  1CZG A;  4IPD A;  1IBL Q;  4DUZ Q;  3R2T A;  2IPK D;  1G51 A;  4HSV A;  1I5F A;  4C2M B;  3CCV A;  1EFI D;  3RLN A;  1I6V C;  4YY3 Q;  3C3L A;  4A3E G;  5IGC A;  3J7A F;  2RDG A;  4I7Z C;  1U4P A;  1GOZ A;  4A3J B;  5JJL A;  1ASZ A;  3K6O A;  3KJO A;  5KEE A;  2CWP A;  1XWE A;  2OEO A;  3ITP A;  2R93 H;  1ZXT A;  1J8I A;  1PZK D;  2E2J B;  3OTO L;  4OIK A;  5FLX c;  2R92 H;  2I46 A;  4HJ5 A;  2JA6 G;  2QCP X;  1GO3 E;  1ILP A;  4A3G G;  2B63 B;  4DR5 L;  1K73 C;  1V8Q A;  5A2Q E;  4CDD C;  1HUM A;  2B3G A;  1C4Q A;  3VR5 A;  2JA5 G;  4ZAI A;  3E6Z X;  3BU2 A;  1I6H B;  3OTO Q;  4IPH A;  1L0Y B;  4PZ7 A;  2AUJ D;  3C1F A;  4DR5 Q;  1L2F A;  2ZT9 C;  3FEW X;  3N52 A;  4N9P A;  4HIK A;  2VY3 A;  2HQL A;  3PF5 A;  3A74 A;  3M4Y A;  3K7U C;  4FXD A;  1V1O A;  3FPU B;  1EQR A;  1VQE A;  3I4N H;  1SDF A;  4MZ9 A;  1EQQ A;  3GV3 A;  4FXG C;  3R93 A;  1EIY B;  2ASB A;  1GKH A;  3ND8 A;  2F03 A;  1YNN C;  3J7Z C;  4RAU C;  3KK7 A;  3O13 A;  4JG2 A;  1X9N A;  1Z7T A;  1JOR A;  1B50 A;  1ET6 A;  4CKE A;  3DXJ C;  1ILQ A;  2BH2 A;  5KGU A;  4LF5 L;  5JPN C;  3H15 A;  3C2P A;  2VUM B;  2XWJ B;  2Z1C A;  3VR6 A;  1X32 A;  4R8N A;  4RHS A;  4DF7 A;  2NVX B;  1QZH A;  3HOV B;  4IJL A;  3NSW A;  3SDZ A;  4MNO A;  1LTA D;  3GTM B;  1EIF A;  2V4D A;  4ZLT F;  1WTV A;  1X3P A;  1AZP A;  3UDI A;  5IP7 G;  4OX9 L;  3TP6 A;  4LF5 Q;  5IY0 A;  1PFB A;  5IOC A;  2Z0S A;  1H9M A;  2KCC A;  2K5N A;  4TRD A;  5BN4 A;  4X6A H;  1AH9 A;  1A3U A;  4I7A A;  2AQ1 B;  4A3J G;  3SGI A;  1EU4 A;  2YTY A;  3RLO A;  2NN6 H;  1FVI A;  1XNR L;  1KDC A;  1M4V A;  3T1H L;  2X69 A;  1HQR D;  2FMM A;  1CA6 A;  4JI4 Q;  3DWP A;  3CC7 A;  1KAA A;  4DN4 M;  4OX9 Q;  3CRK C;  2RHQ B;  1CKN A;  2B2Y C;  3CPW A;  2B63 G;  3I4L A;  4BY1 B;  3TSS A;  3PV0 A;  3KLS A;  1NJI C;  4GLA C;  1ET9 A;  4ME3 A;  3T1H Q;  2IT1 A;  1CI3 M;  4LW1 A;  2GA4 B;  1W6K A;  5EPL A; 
#chains in the Genus database with same CATH homology
 2WKC A;  4KHZ A;  2KA7 A;  3NXW A;  4ME5 A;  3K57 A;  4RCO A;  5CGK A;  1PRT F;  3HZX A;  4ID6 A;  2F0P A;  1A2U A;  5ELD A;  1B9M A;  1SNQ A;  4F8M A;  2RSO A;  3OIQ A;  3J7A V;  3EA6 A;  4IQZ A;  5CV4 A;  1LO5 D;  1CK1 A;  2AQ3 B;  3L9A X;  1WTX A;  3NBI A;  5C6A A;  3A56 A;  5AFW A;  1TVX A;  5C4Z A;  5KND A;  3DWA A;  1OXU A;  3H09 A;  5JOB A;  2BA0 A;  3GV6 A;  2MJ8 A;  3LWU A;  3FDT A;  4HAE A;  1TWF B;  5J39 A;  2A69 C;  3V96 A;  5M5X B;  4E6I A;  2EYJ A;  3K59 A;  2KCN A;  1TS3 A;  2R3Z A;  1EY5 A;  2K32 A;  1SJH D;  2K5D A;  5D3I B;  3QB3 A;  2PNR C;  1BCP B;  2A74 C;  4ZUJ A;  2HQE A;  4Z9C B;  2Z8L A;  1HTP A;  2Y0S B;  3DM1 A;  2I07 B;  2EYP A;  1LT5 D;  2SNM A;  2EYM A;  3SK8 A;  3I70 A;  1WCM B;  1JIC A;  2FFK B;  2NUC A;  1NR2 A;  2M2L A;  1YNJ C;  2EJG C;  4OO1 H;  1PRT D;  2R61 A;  1JE4 A;  4P2C B;  3H0G B;  1K83 B;  4HED A;  1B4O A;  2L1B A;  1HFG A;  3J80 L;  1RF2 D;  1PZJ D;  2RSN A;  2K6A A;  1W6J A;  1JCK B;  2NN6 G;  5KRU A;  1F2Y A;  3MXG A;  4KTA A;  4A93 B;  5HUR A;  4PQX A;  4IAL A;  3HOW B;  2F0F A;  1RD9 D;  4KHV A;  4XT3 B;  1JOK A;  5G3L F;  4GZY C;  1MSH A;  1Q90 A;  1RTN A;  2L4N A;  4PMW A;  3HEJ A;  2WAQ B;  3R3O A;  1M8A A;  1VMP A;  3R2I A;  3I3C A;  2NZ1 D;  2WAC A;  1I50 B;  2IX1 A;  2Q8T A;  1IYV A;  1BBX C;  4DGZ A;  1D1K A;  4HR7 B;  1SYC A;  1A6X A;  2K01 A;  5KYL A;  2LFN A;  4PV1 C;  2JA7 B;  1GHK A;  1GUG A;  2NN6 I;  2PQE A;  1C8C A;  1LT4 D;  2DN8 A;  4KN4 C;  3TDQ A;  4IUT A;  2K5Q A;  1AEX A;  2QDB A;  5E3F A;  5J22 A;  3KBG A;  1DXM A;  1PTO H;  1JR0 D;  4PMC A;  3VR4 A;  1EIH A;  1TU2 B;  5EKI A;  2C5C A;  3IFD A;  1HUN A;  2FMC A;  3VA5 A;  3RZO B;  4JBW A;  4IUN A;  3WOF A;  1KLU D;  3T53 B;  1D5X C;  5COY A;  3URY A;  4C3J B;  3OMC A;  1Q1B A;  1ESF A;  4Y7N B;  5FO7 B;  1PZI D;  1EYA A;  2E74 C;  3K5M A;  1HTL D;  2J0T D;  2OT2 A;  3NP8 A;  1G2S A;  1Y8N B;  1Q12 A;  3PIP 3;  2DNE A;  1RTO A;  3CU7 A;  2QF7 A;  2E75 C;  5KNC A;  4EQO A;  5ELF A;  1O78 A;  4C3H B;  2B8F A;  2EY1 A;  2JEB I;  3SK6 A;  5J1Z A;  4QCL A;  2F0E A;  1TWG B;  1G8Z D;  3K5O A;  2KQ3 A;  1SXT A;  3HRZ C;  5D65 A;  2RVL A;  5I9P A;  1TKW B;  4QUC A;  4HCE A;  3S2D B;  3PUY A;  1ENF A;  1U9R A;  5IT9 E;  4LMQ D;  2K33 A;  3TN2 A;  3FKI B;  2O5J C;  3NTH A;  3M85 A;  3ONA B;  2L12 A;  2B8G A;  4S3S A;  3MA2 B;  2SDF A;  1RKN A;  1Y1V B;  1EY8 A;  3N6R A;  1A3T A;  3K7A B;  3S16 B;  1SE3 A;  4L8J A;  4IN3 A;  5LL6 S;  3M3Y B;  5ELE A;  2O4X A;  4AYB B;  1I4H A;  4DNT B;  4V0B A;  1FD7 D;  2N88 A;  2WP8 J;  4OO1 I;  3U9S A;  2CHB D;  4KY5 A;  2LY7 A;  3TP8 A;  4XQJ A;  3BDO A;  1EQT A;  1S4Z A;  3IKJ A;  3EQL C;  2X6G A;  5EGT A;  1RJT A;  5JEA J;  4C56 C;  3FRP B;  2NWG A;  3S1N B;  5I9O A;  4C3H G;  3P1H A;  2EY6 A;  3CQZ B;  4WJW A;  1F9S A;  4IFD G;  1SNM A;  1EIG A;  2Q8I B;  4CJ2 C;  5JEA H;  2TSS A;  4K2L A;  3A7A B;  4R9W A;  4K5V A;  3MXU A;  3VYU A;  3NTI A;  1STH A;  1H9R A;  3TZD A;  3ZYY X;  3TBI B;  5T1I A;  1Z6H A;  3OWF A;  1EY4 A;  2QIL A;  1A3V A;  2AQ2 B;  2F4I A;  1GUO A;  3NQI A;  1AFP A;  4CBV A;  2A6H C;  3OPO A;  1VF5 C;  3PO3 B;  1Y69 U;  3NQT A;  4K5X A;  3VR2 A;  1TS2 A;  1GXD C;  2J4X A;  1RDP D;  4B9X A;  1SYE A;  1UUP A;  5DNF A;  1IW7 C;  2CQA A;  1D6E C;  2EE1 A;  3OHX C;  4ABN A;  3T56 B;  1TWH B;  1NUC A;  4WOR A;  2EOT A;  4K2K A;  4ULL A;  5EPJ A;  2F3V A;  3RZD B;  1F9Q A;  2VNU D;  1HXY D;  4RKB A;  1JOO A;  1B44 D;  4BBS B;  1GUW A;  3IAY A;  5I4D A;  5EKL A;  1OXT A;  4KJN A;  1BR9 A;  3S2H B;  3X3N A;  1H9K A;  2ICE C;  1D5Z C;  3CKI B;  1BCP F;  1JC7 A;  2IL8 A;  1ZYR C;  3Q0A A;  5EBD A;  2B2U C;  1QB5 D;  1SFO B;  1F2M A;  1U4M A;  2F0D A;  3VA7 A;  1SNO A;  3D4R A;  4FF4 A;  2X6L A;  3ERO A;  3I90 A;  3PUZ A;  4RHR A;  1BOS A;  2EJF C;  3G6J B;  2BDN A;  1EY0 A;  1PXU A;  2PW5 A;  5C4J B;  1STY A;  1QWY A;  3D31 A;  1DYQ A;  1TY0 A;  2RDH A;  3PIO 3;  1MBY A;  1U4R A;  1TT2 A;  5M9O A;  1PFN A;  3MTS A;  5FO8 B;  1K8M A;  3S15 B;  1SYG A;  5E1F A;  3BVZ A;  4KD3 A;  1LTR D;  1PFM A;  3TP5 A;  1Q1E A;  2JP1 A;  4DU9 A;  1E2V A;  5JEA G;  1R4P B;  1CTM A;  3NHH A;  4CJ0 B;  5C3E B;  5FO9 B;  1STN A;  5DM7 3;  4M1U B;  5BN5 A;  2IW3 A;  2XIW A;  5CR3 A;  2JE6 I;  4K8I A;  4FP5 D;  5EQ0 A;  2F0H A;  2M00 A;  2B2V A;  3HOZ B;  2C9O A;  1UNS A;  1SEB D;  4TKO B;  2F0V A;  3BVM A;  4DXG A;  4RH6 A;  2B2W C;  5I6W A;  4RA8 A;  4QUF A;  1BCP D;  1WTR A;  2AUK A;  1T5X D;  5A2Q L;  4R8I A;  1Y8P B;  3M7G A;  5JAV A;  2O2L D;  1CHQ D;  3MZ5 A;  1YNN D;  1PRT C;  2EYL A;  1TR5 A;  1H9S B;  1G29 1;  4K8J A;  4U67 3;  3GP7 A;  4A3M B;  3GTG B;  2O5I C;  2RBM A;  2BE5 D;  1LTI D;  1PMR A;  1EL0 A;  1AW7 A;  2KOL A;  5M3M B;  4XT1 B;  1SSO A;  2CVR A;  1ENC A;  3BG3 A;  5CV5 A;  3HKZ B;  4FNF A;  2WKD A;  1Y8O B;  5FLX E;  3DEP A;  4CGY B;  1D2B A;  2XN9 C;  3SR1 A;  2L0C A;  1T5E A;  1LTS D;  2L9H A;  3MC0 B;  4ZKC B;  4XYQ A;  1QE6 A;  4HMJ A;  1PTO F;  3OSO A;  1OXX K;  3DUZ A;  2ID0 A;  5JJZ A;  4BA1 I;  4BY7 B;  2XRS D;  3LX0 A;  1H9S A;  1SYD A;  3WDN A;  1WVL A;  1LAC A;  3KLR A;  1B2T A;  3GQB A;  1DJR D;  3M7N A;  3C1E A;  2LS0 1;  2L55 A;  4L6T B;  2FIN B;  1O7L A;  1HFN A;  1STB A;  4KV6 A;  2JEA I;  3A55 A;  2JSO A;  3HP3 A;  4NKL A;  4NW2 A;  1V1P B;  3LWE A;  5LL6 X;  2A69 D;  4DXF A;  2BA1 A;  1EY6 A;  2ENB A;  2Z4H A;  2WII B;  1EWH A;  1FYC A;  1NCV A;  2PCF B;  5M3F B;  3H3V C;  2NVQ B;  1EWC A;  1TQO A;  2H4O A;  2WV6 D;  4OGQ C;  4IUP A;  4FF3 A;  1HRJ A;  4IFD J;  1FGB D;  5TSS A;  1XX8 A;  3FPP A;  4H44 C;  3S14 B;  1EEI D;  3NPP A;  4HMI A;  2NYZ D;  3L7Z C;  1BDO A;  4ZUI A;  5DEH A;  1PTO D;  3T13 A;  3IL8 A;  3K5N A;  4IFD H;  3PMF A;  1S5B D;  3P20 A;  4O42 A;  1CT1 D;  3CRL C;  1BUV T;  1EYD A;  4CJ1 B;  2NTS A;  1TWA B;  1DCZ A;  3LNN A;  5T1G A;  3PO2 B;  4B08 A;  3IFT A;  5I2X A;  2F0M A;  2M9V A;  2B2Y A;  5CC4 A;  4J8Q A;  3BYT B;  5DAU A;  1VDZ A;  4ZQ3 A;  2E76 C;  2J7Z A;  3J7Y W;  1SMY D;  2G9H D;  3D3R A;  1HA6 A;  4X3T A;  2F3W A;  2MUY A;  4IUV A;  2ZXR A;  2N55 A;  1G91 A;  1E2Z A;  3JAM L;  1STA A;  4PMB A;  2DNC A;  3I4M B;  5F2D A;  1F9R A;  4EQN A;  3T4A C;  1DOK A;  5KNB A;  1MI2 A;  4CKB A;  2FHT A;  3U9O A;  3FVQ A;  1SYB A;  4G7O C;  5CV7 A;  5D14 A;  1NAP A;  5C5M A;  1QG7 A;  4G4K A;  5CV9 A;  1OXS C;  2ZXO A;  1BNZ A;  4XIG S;  5CV6 A;  1II3 A;  4KN7 C;  2KUM A;  4QF4 A;  1FNU A;  3MXN A;  3J81 L;  4A3K B;  1SYF A;  1JWM D;  4TSS A;  1CFM A;  1AZQ A;  2F0W A;  4XYO A;  1DZ1 A;  1ML0 D;  4ZK9 B;  1EY7 A;  5IGD A;  4F88 A;  1EU3 A;  4DAY A;  1Y1W B;  2XVS A;  1FR3 A;  1LT6 D;  2HUG A;  2CW0 D;  1STG A;  1D1I A;  1LV9 A;  2VB3 X;  4A3F B;  2ZXP A;  1KDB A;  4KY6 A;  3S9W A;  1TS5 A;  1S5F D;  2EZV A;  3PUW A;  2YU9 B;  2R6G A;  2K7V A;  4C3J G;  2LKV A;  1LT3 D;  3MVV A;  1TWC B;  2D2C C;  5M5W B;  2K05 A;  2NVT B;  1KNA A;  4G7H C;  3QG1 A;  1SE2 A;  1IKL A;  2L5T A;  4O1N A;  2PPB C;  1EY9 A;  1F2Z A;  1MD2 D;  4DA2 A;  5C4X B;  2JXM B;  3PUX A;  2F0U A;  2IWH A;  2XWB B;  1A2T A;  4KK7 A;  4MIU A;  4DK1 A;  5K36 H;  1IKM A;  3DHQ A;  2QEJ C;  3ND9 A;  1H9J A;  3E0J A;  4CHT B;  1TS4 A;  5DM6 3;  4DAV A;  3Q23 A;  3S1M B;  2MHV A;  3OOC A;  5FK9 C;  1K8O A;  4NP5 A;  2A68 D;  3H6M A;  4K14 A;  1ESR A;  1UEA B;  1EZ6 A;  1MGS A;  1JB3 A;  1ICW A;  1EZ8 A;  5CBE E;  3HG9 A;  4LJZ C;  3I73 A;  1SE4 A;  5HGT A;  2MGS A;  3A8I E;  2WIN B;  4CKC A;  1J9O A;  4C3I B;  4EGV A;  1STE A;  4OL7 A;  3V2T A;  3TP7 A;  1B1Z A;  3BVG A;  1KAB A;  3D4W A;  1CHP D;  2HDM A;  2NVY B;  5KIX A;  1GJX A;  2IJ0 A;  1WTP A;  5ISR A;  1GUN A;  1RCV D;  3VYR A;  3R8B A;  3H91 A;  3BS1 A;  1WTW A;  5IT9 L;  2B2T A;  2K5W A;  4K6L A;  3SEB A;  3AB9 A;  4IFD I;  3M4O B;  5I6Y A;  2PZW A;  3W3A A;  2A6E D;  3L3O C;  1B9N A;  1GUS A;  2F0S A;  3MHB A;  2K28 A;  2K04 A;  2QKI C;  1DOL A;  2SNS A;  2D62 A;  3GTJ B;  2A5H A;  5LHY 1;  3HOY B;  2G9D A;  1LTG D;  3GTO B;  2E2I B;  4H0L C;  3T16 A;  2SOB A;  5CV8 A;  2PMZ B;  1CM9 A;  1QOH A;  3RLF A;  3SE0 A;  5ELC A;  3VR3 A;  1LTT D;  3DEO A;  2DY8 A;  2PZU A;  5EKK A;  2Q8R E;  5KYI A;  4A3B B;  2WB1 B;  3NBH A;  1BCP C;  2OXP A;  4XXE A;  5BN3 A;  1FNW A;  3QWN A;  1O7Z A;  4TQU S;  3UI2 A;  4IUU A;  3DMU A;  1BO0 A;  2RKS A;  3Q6S A;  5D3D A;  4BWG B;  4EQP A;  4X3U A;  1HPC A;  4C3I G;  4KI0 A;  1QIL A;  2A6H D;  4NDX A;  3SHL A;  1HA5 A;  3QJY A;  4LK1 C;  2R93 B;  1QNU A;  2Z4I A;  2KEE A;  5K36 G;  3GTQ B;  2R92 B;  2VXW A;  3WOE A;  2KVM A;  1IW7 D;  3NTK A;  3D8G A;  4RGO S;  2KED A;  1WTQ A;  5K5P A;  1V43 A;  4BA2 I;  4MHE A;  2XNA C;  3A8K E;  3FMC A;  2BE5 C;  5EJW A;  2D9U A;  2D5D A;  1E2W A;  3HS0 C;  4RGT A;  1SJE D;  3KBX A;  2AWN A;  1NR4 A;  4DK0 A;  4KJO A;  1BXT A;  3A7L A;  4F87 A;  3I4N B;  2K1B A;  3T51 B;  3MWY W;  2IX0 A;  3J80 E;  1ZYR D;  1UAP A;  3NUC A;  1XYI A;  1AN8 A;  1X3Q A;  2EXZ A;  3NWT A;  1G6Z A;  1KTK A;  5ELB A;  1F9P A;  4KY7 A;  5IGB A;  1VCI A;  5JPM C;  1S5D D;  1E0B A;  2K03 A;  1Q3L A;  4FO2 A;  1I4X A;  4ZRZ A;  1D5M C;  2JYO A;  3AMU A;  2AWO A;  4RGM A;  1BF4 A;  4DAP A;  1ROD A;  3RUZ A;  4H7B A;  2NB0 A;  4OIJ A;  4C1N I;  5C0X J;  1CA5 A;  3BYY B;  3TZU A;  2ICI A;  1I4R A;  1NSN S;  5COR A;  5JVH 3;  3GD7 A;  3SK5 A;  2PW7 A;  3I8Z A;  1F2L A;  4X3S A;  4WRD A;  4I65 A;  1LAB A;  3SXH A;  4K5W A;  5C0X H;  2LMC B;  2EYH A;  5EPK A;  1GHJ A;  1JWU D;  5IGF A;  1QJO A;  1ONL A;  4B9W A;  2NBF A;  4JK1 C;  2EY2 A;  1QNK A;  5C4H A;  2EY5 A;  5EBC A;  1DM0 B;  2F0K A;  4FXK C;  3BDC A;  1KNE A;  1G2T A;  2DY7 A;  3C46 A;  3DWQ A;  3QIA A;  3QOJ A;  3PUV A;  3F2U A;  3K5L A;  3P7J A;  4U68 A;  4KKS A;  2B39 A;  1QCB D;  2TMP A;  3MAQ A;  3S1Q B;  2F0N A;  3E5S A;  4QMG A;  2EVB A;  5FOB B;  5M5Y B;  3VYT A;  1MSG A;  1VF7 A;  3OMG A;  1R4Q B;  3ERQ A;  2XRQ D;  4X3K A;  4KKU A;  3HGB A;  3RD4 A;  1CQV A;  1EOT A;  1R9T B;  2HCC A;  5C44 B;  1PTO C;  4OHJ A;  1PYW D;  4FF1 A;  4FYD A;  2KJX A;  2RA4 A;  4G57 A;  3D6C A;  1S5E D;  1L0X B;  2YYZ A;  3MEH A;  2EYO A;  3D6W A;  4WFN 3;  1HQM C;  3GO5 A;  3GTL B;  4BS9 A;  4ODG A;  3JAM E;  1TII D;  3QOL A;  1FNV A;  1SND A;  3NE5 B;  4Q5V A;  1IYU A;  1KLG D;  1I4P A;  2SEB D;  4HCS A;  1SMY C;  1LTB D;  3KLS X;  3RMH A;  2B2U A;  4HN7 A;  2EDG A;  3HOU B;  4V19 0;  4A3I B;  3CHB D;  4PNY A;  3QO2 A;  4XQQ A;  4IUR A;  4Q0F A;  1I3Q B;  3P75 A;  5FKA C;  3J81 E;  3MFG A;  4EVO A;  4IZ8 A;  1IL8 A;  1EQV A;  1C48 A;  1DON A;  1BQQ T;  4UDU C;  4XTC S;  3GTK B;  2XSC A;  3SK4 A;  1U4L A;  4RFB A;  5CBA E;  4N9T A;  2BCO A;  1I4Q A;  3A54 A;  2R7Z B;  2H1E A;  1PRT B;  5IGE A;  2OF1 A;  2B2T C;  1YNJ D;  5FLX L;  4MN3 A;  3MFY A;  2MP1 A;  1CQF A;  1GUT A;  3I72 A;  5NUC A;  1ZEQ X;  1SNP A;  2E2H B;  5I2Y A;  3NWS A;  5C0X G;  1XXG A;  2EJM A;  2CW0 C;  2F0I A;  4A3D B;  1V1P A;  1DD2 A;  1KDA A;  2KEC A;  5CMD A;  3KF8 A;  2FJ2 A;  3BDL A;  1JQY D;  2EYF A;  1RHP A;  4YIJ A;  1B53 A;  1IHZ A;  4KKT A;  5C5L A;  1EYC A;  2B2W A;  2A73 B;  2F0T A;  4RWS C;  5IIF A;  5C3X A;  5IOD A;  1ENA A;  1DOM A;  3Q22 A;  3TME A;  3VYS A;  2E2D C;  5G3L D;  1SAP A;  1WD1 A;  4NMZ A;  3SVM A;  4KMU C;  4BBR B;  1O80 A;  2EPB A;  1PDQ A;  1OXV A;  4OO1 G;  2RDF A;  4HSP A;  3MXP A;  5C3W A;  5C0X I;  4QIW B;  2F0Q A;  1PTO B;  1ZKO A;  2A68 C;  4RKL A;  4LAA A;  3KUP A;  4RGN A;  2PYK A;  2JA8 B;  4F7X A;  3G7L A;  3V05 A;  4IUQ A;  2L11 A;  2BOS A;  3H94 A;  5A35 A;  2F0G A;  3Q24 A;  3K0Y A;  2F0L A;  1CZW A;  2B2V C;  4DNR B;  2F0O A;  3EVQ A;  4XDX A;  2NTT A;  1WTO A;  4QB4 A;  4H13 C;  3W2D A;  1Q8I A;  2PO4 A;  2MPM A;  3EJI A;  2PZT A;  4ZYS A;  1F77 A;  3BZD B;  4L63 B;  1TY2 A;  3A8J E;  4A3E B;  1SBB B;  4FF2 A;  1JOQ A;  4J6H A;  4DFA A;  1EEF D;  5E4X A;  5CYU A;  1O7Y A;  2HDL A;  4J1M A;  5E4W C;  2A6E C;  3D4D A;  3NK9 A;  4M8A A;  3S17 B;  2JA6 B;  4A3G B;  3OWE B;  1Z47 A;  5IGG A;  1XTC D;  1OO9 B;  2JA5 B;  1SNC A;  1VMC A;  2F0J A;  4C1N K;  3I91 A;  1AP0 A;  1HCZ A;  1PLF A;  4XQN A;  4K6D A;  4KD4 A;  3HOX B;  5JVG 3;  4UAI A;  3X3M A;  3EFX D;  1S5C D;  3AU7 A;  3OW7 A;  1WD0 A;  3S1R B;  1JWS D;  1A15 A;  3K58 A;  1LLR D;  1I4G A;  4FVM A;  4ILW A;  2F1M A;  3OIP A;  2BDO A;  1HHV A;  2VB2 X;  4ZKB B;  2HCI A;  4HTH A;  1B3A A;  4RCN A;  2KHS A;  4G7Z C;  2RQX A;  3GTP B;  2IX3 A;  1CZG A;  3R2T A;  2IPK D;  4HSV A;  4C2M B;  1EFI D;  1I6V C;  3C3L A;  5IGC A;  3J7A F;  2RDG A;  4I7Z C;  1U4P A;  1GOZ A;  4A3J B;  3K6O A;  5KEE A;  2OEO A;  1XWE A;  3ITP A;  1ZXT A;  1J8I A;  1PZK D;  2E2J B;  4OIK A;  2I46 A;  2QCP X;  1ILP A;  2B63 B;  1V8Q A;  5A2Q E;  1HUM A;  1C4Q A;  3VR5 A;  4ZAI A;  3E6Z X;  1I6H B;  1L0Y B;  2AUJ D;  3C1F A;  2ZT9 C;  3FEW X;  3N52 A;  4N9P A;  3M4Y A;  4FXD A;  1V1O A;  3FPU B;  1SDF A;  3GV3 A;  4FXG C;  3R93 A;  3ND8 A;  2F03 A;  1YNN C;  4RAU C;  3KK7 A;  3O13 A;  1Z7T A;  1JOR A;  1B50 A;  1ET6 A;  4CKE A;  3DXJ C;  1ILQ A;  5KGU A;  5JPN C;  3C2P A;  2VUM B;  2XWJ B;  2Z1C A;  3VR6 A;  1X32 A;  4R8N A;  4RHS A;  4DF7 A;  2NVX B;  3HOV B;  3NSW A;  3SDZ A;  1LTA D;  3GTM B;  2V4D A;  4ZLT F;  1WTV A;  1X3P A;  1AZP A;  3TP6 A;  5IOC A;  1PFB A;  1H9M A;  2KCC A;  4TRD A;  5BN4 A;  1A3U A;  2AQ1 B;  1EU4 A;  2NN6 H;  1KDC A;  1M4V A;  2X69 A;  1HQR D;  2FMM A;  1CA6 A;  3DWP A;  1KAA A;  4DN4 M;  3CRK C;  2B2Y C;  3I4L A;  4BY1 B;  3TSS A;  3PV0 A;  3KLS A;  1ET9 A;  2IT1 A;  1CI3 M;  2GA4 B;  1W6K A;  5EPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...