4HSVA

Crystal structure of cxcl4l1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
GDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternative C-terminal helix orientation alters chemokine function: structure of the anti-angiogenic chemokine, CXCL4L1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antitumor protein
molecule keywords Platelet factor 4 variant
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hsvA00
5EPJA 1ESRA 2B2UC 3IL8A 4ZK9B 1WVLA 1QE6A 2B2YC 1WTWA 1CM9A 1RODA 1B3AA 4ZAIA 3SVMA 1HHVA 2K05A 4R9WA 5EPLA 2J7ZA 1BBXC 3I91A 3MWYW 1VMPA 2NZ1D 4RAUC 2FHTA 5E4WC 1O80A 2FMMA 3GV3A 5CORA 4HSVA 2FINB 1QG7A 2KUMA 3HP3A 1HUMA 2B2VA 2Q8RE 2L1BA 5COYA 1SDFA 1X32A 2EOTA 4IUTA 3DM1A 5EQ0A 3F2UA 1EIGA 4IUQA 2RA4A 1NCVA 1F9QA 2NYZD 2KOLA 1NR2A 1B53A 3TN2A 4OIJA 1WD0A 2K1BA 5CBAE 1B50A 4CJ2C 4UAIA 1AZPA 2HDMA 1PFBA 1KNAA 2HCIA 4U68A 2SDFA 1HUNA 1IKLA 4XT1B 1VMCA 1ILPA 4LMQD 1AP0A 3TZDA 2MPMA 5T1IA 1WTOA 5E4XA 5AFWA 2IL8A 1BNZA 1MSHA 2KECA 4X3TA 1SAPA 2FFKB 2HDLA 1ILQA 2R3ZA 2L4NA 5DNFA 1A15A 1U4LA 1J9OA 3P7JA 1AZQA 1NAPA 4MN3A 2L9HA 1G2SA 1WTPA 3KBXA 2B2WC 1DOKA 4RWSC 2EPBA 2RSNA 1PFNA 1EL0A 5EJWA 3I90A 1HRJA 2RSOA 2B2TA 1X3QA 2EE1A 3D6WA 1O7YA 2BDNA 1PDQA 2VXWA 4IUVA 1U4RA 1DOLA 4X3SA 4O42A 4ZLTF 1WTXA 5T1GA 2HUGA 2NWGA 5EKIA 1ZXTA 1RTNA 3IFDA 5D65A 2RVLA 1WTRA 2H1EA 2L12A 2X69A 5D14A 1B2TA 4X3KA 3Q6SA 2M2LA 3QO2A 4HCSA 1G91A 2B2VC 4OIKA 1WD1A 4X3UA 3KUPA 3I3CA 4XDXA 2K28A 2B2UA 4QUCA 2KEDA 1ICWA 4ZKCB 3R93A 1WTVA 2DY7A 2K03A 3DEOA 4QUFA 1F9SA 3ONAB 5CBEE 1DOMA 1JICA 2MP1A 2B2YA 1XX8A 1CA5A 2B2TC 2CVRA 1BO0A 2XIWA 1IKMA 1E0BA 1G6ZA 1U4MA 1TVXA 1HFGA 1MI2A 4IURA 1ML0D 1F2LA 5CMDA 1WTQA 2Q8TA 1IL8A 1BF4A 2HCCA 2N55A 1J8IA 4IUUA 1MSGA 2X6GA 3N52A 1CA6A 1DZ1A 2D9UA 2B2WA 1Q3LA 4CJ0B 1EIHA 2L11A 1GUWA 1O7ZA 1RTOA 1X3PA 1LV9A 3FPUB 4HAEA 1EQTA 1S4ZA 3FDTA 4DN4M 4CJ1B 3UI2A 1C8CA 3DEPA 1HA6A 4MHEA 1PLFA 1HFNA 2KVMA 4HEDA 1RHPA 1JE4A 4R8IA 2X6LA 1NR4A 2MJ8A 4IUPA 2FJ2A 4XT3B 1U4PA 1B4OA 2N88A 2K01A 3H91A 1M8AA 1MGSA 3LWEA 3MTSA 5EPKA 2MGSA 1G2TA 1PFMA 1F9RA 1RJTA 2JP1A 2JYOA 2KEEA 1F9PA 3GV6A 4NW2A 4RA8A 2DY8A 4ZKBB 1KNEA 1EOTA 1SSOA 2K04A 3G7LA 5JJZA 3I8ZA 1DONA 1XYIA 1QNKA
chains in the Genus database with same CATH superfamily
4NXNQ 1EU3A 3IL8A 4BA1I 3MWYW 1VQGA 2DNCA 3HOYG 4LFBQ 3A74A 1ZYRC 3UE1A 1LTRD 1TU2B 3S24A 4BY7H 2Y0SG 4LF4L 3F2UA 3PO3B 2A6HD 3K0XA 4A3BH 3PUYA 3TEHB 2AUJD 2R7ZG 4A3JH 3MFYA 2N8NA 2L5TA 4LNQA 3TN2A 2EQSA 4K14A 1O78A 4YWLA 3S1MH 3T1YL 4A3LG 2HDMA 4A3IB 4JV5Q 3NBHA 3VDYA 1AN8A 1C4QA 1IKLA 4K6LA 4XT1B 2F0UA 1KQSA 1YVCA 2B63G 4G4KA 2JQOA 3V96A 5CC4A 3BZKA 5FLXc 3GTJB 1W2BA 1BNZA 1GXDC 2OQKA 4BY1H 1SAPA 2R7FA 4JI8L 1XJVA 3D0FA 1EZ6A 1JJCB 2WP8J 1N8RC 1EY0A 4YWKA 4NMZA 2JA8G 5C4XG 2A69C 3CCUA 3EQLC 2MO1A 1C48A 1BOSA 4HR7B 5HY6A 1ET9A 5K36G 2F3IA 4GS3A 3MAQA 5A35A 3M3YB 3KLSX 4OWTB 5C44B 5C4HA 3TP5A 1WD1A 5IYDG 3STBD 3UE0A 3PO3G 4IPCA 1ONLA 1GUOA 1YNNC 5LMNL 5IY0A 1U0LA 3KF6A 1XNQL 1XX8A 1N36L 1ZEQX 2DGYA 1F2LA 3K5OA 3U9SA 2JXMB 3ERQA 1EEID 1CA6A 1EIHA 2B2WA 4JYAQ 1D5MC 3RN5A 3CP0A 1RTOA 1MBYA 5IGFA 3GTGB 1HFNA 4X62L 2HIXA 2SNMA 3RR5A 3QOJA 4C1NI 1B4OA 1ICFB 1PYBA 3WOEA 1GD7A 4LF7Q 1BBWA 4KKUA 4DAYA 1HTPA 1Q1BA 1SYCA 1SMYC 3A0JA 3NENA 4NW2A 4NPSA 3U4VA 5EAYA 1KRSA 4UP9A 2FMCA 4C3JB 2MQHA 1VQBA 4C2MB 3MXNB 3HOVG 2Z0SA 3H09A 1TXYA 3FVQA 2B63B 2NTTA 1HHVA 3ND8A 1AEXA 3X3MA 1BUVT 1K0RA 3HEJA 4KY7A 1V9PA 1YEZA 1A0IA 3PUVA 3M3YH 2OT2A 1SDFA 1D8LA 3AEVA 4QJFA 4QY7A 2NN6H 3A8KE 4IUQA 2VUMG 1YJ9A 2E8GA 1D5ZC 4GKKQ 5JEAG 4C56C 2K1BA 4HSPA 5FKAC 5AJ3Q 4DV3L 3K5MA 3CCVA 3HFZB 4JV5L 5FLXL 1SYGA 3CMAA 3NTHA 3AYHB 3JAML 2GA4B 1GKHA 1YI2A 2PW5A 4R4CA 1D1KA 2R3ZA 3P20A 4BWGB 4B3MQ 5JJLA 3V2TA 1LTSD 1PH4A 4GLVB 3PUXA 3UDFA 1G2SA 1I5FA 3SK6A 4A3GG 4RWSC 2JN4A 2RSNA 1YJWA 1SNPA 4B3TQ 3T1HL 1N32L 2BOSA 3OW2A 1NMGA 4AH6A 1DOLA 3PQIA 2Z9HA 4O0AA 2HUGA 2RVLA 4BA2I 2UXBL 4X3KA 2QILA 3TS0A 5FO7B 2JA6G 2QDLA 3FHWA 4C3JH 4BBSB 4A3GH 4WJWA 3I72A 3TRZA 4DR3L 1O7IA 1IBKL 1Q8IA 1CKNA 1JWMD 2BH8A 4DAMA 4DK0A 2WAQG 4IPDA 1TVXA 1B9NA 2UU9Q 3QJYA 4EQPA 5CV4A 2OTLA 4BBRB 1GUTA 2QKIC 1CI3M 2HT1A 1L0XB 3SK5A 4A3CG 1JB3A 1GUWA 2CW0C 2K32A 2F0QA 3E5SA 1LTGD 3VYSA 5D3DA 2JJQA 1QJOA 2QDBA 4JI1L 4DR1Q 1IYVA 2A74C 2RDHA 4YCVA 1S5CD 2F0SA 3RZDB 4X62Q 2HD3A 4MZ9A 3SHLA 3H91A 1M8AA 5IT9E 1LO5D 2F0IA 2JP1A 1LT4D 2ID0A 4LF6L 1XXGA 4ZKBB 1XMOL 4AIMA 1I6HH 3E9IA 5EPJA 3ICEA 3GQBA 3VYUA 5M3FB 2NZHA 1TWFB 1QB5D 1Q12A 5EKLA 1QUQA 2F3WA 5M5WH 2M00A 3Q0AA 3OYYA 2EJFC 3HP3A 4OWWB 4A3EH 2ZM6Q 4A3EB 3BJUA 4KTAA 1JT8A 4B08A 1A2UA 1B50A 1E24A 4CJ2C 4ZCKA 4OGQC 1QZGA 5FJ8H 1TS5A 3EN2A 1VMCA 1AP0A 4A3LH 4LF5L 3NQTA 4FYDA 2B8GA 1SFOB 2UUBQ 1CKNB 2EYLA 2E2JH 4IUNA 2L15A 4G7HC 3KF8A 1H9SA 1VQ4A 3HG9A 1NTGA 1WTPA 4P71A 3ITPA 2WB1G 3J81i 1WCMH 3K8AA 1SRUA 1R4PB 1K83H 3OMGA 4RFBA 1KDCA 1ZXTA 1RTNA 3IFDA 3ULJA 3S15H 3AQQA 2R61A 1TWHB 4JI7L 2EXDA 3QO2A 4X65Q 2EVBA 1WOCA 3A8JE 3HZXA 4P75A 4JI2L 4EX5A 1C7YA 4JOIA 5JOBA 3CHBD 3DEOA 1AE3A 1KDBA 1VF7A 4C3IG 2WV6D 1X3EA 4DR7L 3CC7A 4DR3Q 2O5JC 4KHZA 2JA5G 5M5WB 1VQHA 4JI0L 4KLKA 2R92H 3CMEA 1TKWB 2LY7A 2NUCA 2PQEA 1ENFA 4DR5Q 4DNIA 3S1QH 3MVVA 2HCCA 2VQFQ 2CCZA 1RIPA 4RGTA 3J81j 4WRDA 1PHJA 5IGDA 1PYSB 4KI0A 1KRTA 1S4ZA 4R8NA 4A3IH 1D1IA 3GTGH 1KLUD 5CV9A 4M1UB 1EWIA 3SDZA 1B44D 2K4KA 4JI1Q 3PUWA 3CCSA 3LNNA 4WJ4A 1AW7A 4P74A 1ENCA 3MTSA 3FKIH 4P72A 2IX1A 2JYOA 2F3VA 1Y8PB 3PIOA 5KIXA 4UHVA 2BH2A 4R4TA 4C3HG 1NBWA 1Z9FA 4RKLA 4LF6Q 2JEAI 1D2BA 3U4ZA 4NXMQ 1PH1A 2VZAA 5A2QE 1XPUA 2EYMA 2ZXPA 4R9WA 5EPLA 1K3RA 2TSSA 1CQVA 2VB2X 2FMMA 3CXCA 2D62A 5C44H 2ATWA 3LWUA 2DJGC 4R4OA 3OPOA 4YCUA 1NR2A 1JE5A 2DUDA 1DCZA 1B53A 4LUZA 2IX0A 4H02A 1JMCA 3HKZB 4KKSA 3M4PA 3C2PA 1KNAA 1KC8C 1WJJA 2TMPA 1HH2P 5C3EH 2MPMA 1E1TA 3SK8A 1BCPD 1N33L 1FGUA 3J7AV 2JA9A 3MXGA 2IL8A 3JAMc 3ULPA 2RCFA 1PRTC 1IXRA 3P7JA 2WKDA 4NKLA 1SE4A 3BZCA 2E74C 3DWAA 3BVMA 3VYTA 5M9OA 1O7YA 1TS2A 4N8X1 2AQ2B 1PH2A 3KLRA 3MEFA 2L12A 3GTQH 1G91A 2A19A 3NWSA 3W2DA 1Y1VB 4XDXA 4QUCA 2B2UA 1ICWA 3D4WA 1U9RA 4DV2Q 1G8ZD 3J81E 4JI2Q 2ICIA 1HNXQ 5CBEE 3TBIB 1DOMA 3ZYYX 4NDXA 4BY1G 4CBVA 1B9MA 2K5DA 1HFGA 3A56A 1YITA 2GVBA 1TY2A 1TWHH 5IODA 1BF4A 4JK1C 2N55A 1VQLA 1PTOH 4IUUA 4G7ZC 2IHEA 4CJ0B 4N9PA 5KRUA 3IFTA 4C3HB 3K7AH 3AFQA 4IFDG 4F7XA 2KVMA 3S14H 2HHHL 3UDXA 2F0HA 2UUCQ 5C0XG 1EIFA 1HR0L 4LFAQ 2EYFA 2QEXA 1PTOD 1NE3A 4C1NK 4GNXA 1F77A 3D3RA 3LX0A 3HOUH 4HIDA 5IYBG 1XYIA 2E5LL 5M3MH 2R93B 1CZWA 3NUCA 3I55A 1JOQA 3T16A 1BCPF 5C4JB 2KCMA 4CKEA 2AUKA 2D5DA 4QIWE 4IUTA 1HA5A 3S16H 1F9QA 5CBAE 2K7VA 5K5PA 3IKJA 1BR9A 1UAPA 3Q24A 1FNUA 2SDFA 1K8GA 1TWGB 4Q5VA 4A93B 2EYOA 2OEOA 4FF2A 2RF4A 4DV6L 1SR3A 5ELBA 3W1GA 5D3IB 4X66Q 2HDLA 1K8MA 4FF3A 4R4IA 2JEBI 4OEMB 4A3BB 2XRSD 3Q22A 2ZT9C 4DA2A 5KYLA 4QQBX 2AHOB 1EL0A 3KBGA 1LTTD 3HOWB 1D7QA 2B2TA 1FNWA 2I5LX 4HJ7A 4K0KQ 2JA7G 2F0OA 3A5ZB 1CSQA 3MXPA 4HCEA 2F0DA 3NBIA 3PF5A 3HOUG 3TREA 2ALYB 3I4OA 4JI5Q 2E2IH 2DJFC 3M7GA 4KHPL 3U9OA 1RCVD 5LL6X 1E2ZA 4C2MH 1BBUA 2F0TA 5CGKA 1A3UA 4JI4Q 1ASYA 4A3EG 1AH9A 4FXKC 2NVXB 3HGBA 3I2ZA 5G3LD 5CMDA 4O1NA 2J0TD 1X54A 4V0BA 1N36Q 4LFCL 3DWQA 5KNCA 5IWAL 2AQ3B 5KGUA 1DZ1A 1TQOA 4KKTA 1E1OA 5I6WA 4GKJQ 1UWVA 1X65A 1WYDA 2X6LA 1UEBA 3OMCA 3KLWA 5BN4A 3EA6A 1JORA 1EEFD 3GV6A 2G5DA 4AYBE 3MC0B 4A3MH 4UP8A 5DEHA 2RHSB 4PV1C 3ONAB 3GTKH 3K0YA 2KHJA 1A62A 2EJGC 2J7ZA 3QOLA 1VQCA 4F87A 2CH4A 1R9TH 4JBMA 5NUCA 2KHIA 5CORA 4B3SL 1HUMA 4CGYB 2C35B 5CV7A 3FEWX 1OXSC 5JVH3 5FLMG 3BYYB 5JEAJ 3MFGA 5FOBB 1SEBD 4A3CH 2UXCQ 1CT1D 1PFBA 2UXDQ 2I46A 1EYGA 2MO0A 1CKMA 1E22A 1C9OA 5AJ3L 1R4QB 2JA7H 4LUVA 2JA5B 4WORA 3CCRA 4KN7C 5IP7G 1EQRA 3L9AX 5IGEA 4DV4Q 1AZQA 5C0XJ 1X6OA 1EZ8A 4AQYQ 1STHA 2EPBA 2E2HH 2PZTA 1SNOA 3SXHA 2A68C 4GN5A 3I90A 5EJWA 1HRJA 2B3GA 3D6WA 4YWMA 5BN3A 3GTMB 4K6DA 3W3AA 3GTPB 2NWGA 2CH4W 3S2DH 1M1KC 3A7AB 3GTQB 5BR8L 1EIYB 4ME5A 1B2TA 4QB4A 1TIID 4DR4Q 2M2LA 4X64L 2EY1A 4DV0Q 1T5XD 1WI5A 2KEDA 1ESFA 5C4XH 1A3TA 3I70A 3S1RB 1UE7A 1RF2D 3MA2B 5I2YA 3OIPA 2Z4IA 3CC4A 3S2DB 2F0KA 2MP1A 1X56A 2B2YA 3D6CA 2PYKA 3NTKA 2Z6KA 2XIWA 4RKBA 3HKZE 1MI2A 2F0MA 1UNSA 1WTQA 3WWVA 5FO8B 4XXEA 1GOZA 4JBJA 5E3FA 4LFCQ 4A3KH 3NWTA 3S14B 2K5QA 4LF9L 1JE4A 4C3IH 3RZOH 1U4PA 1LT5D 1MD2D 1A8VA 1BQQT 1VQPA 2ZTDA 4DR1L 4DR6Q 1BCPB 3RUZA 4BBRH 4BY1B 4ALPA 3I56A 1VQ9A 4FXGC 4XQJA 1PFSA 1ESRA 3KYHC 1G291 4A4IA 1PXUA 4DR2L 1B3AA 1PYWD 1IBLQ 1CSPA 1KDAA 5C4XB 3TZUA 4EVOA 1VCIA 1I4XA 5E4WC 3J7YW 1O80A 2F03A 5IP9H 4G7OC 4CKCA 3PF4A 3UDIA 1VQMA 3I73A 1XMQL 1SE8A 4GNXC 1VQ6A 4OX9L 4IOCA 1I6HB 1PRTF 3QWNA 2RCNA 3MZ5A 1UUPA 1B8AA 5IP9G 2N3SA 1J5EQ 1JC7A 2C5CA 1S72A 1TWAH 3CCLA 3HOZH 3H6MA 4A93H 1FYCA 1KABA 3M4QA 5IT9c 4EQ5A 3BS1A 4LF5Q 1CQFA 2KECA 3T56B 3H15A 3SR1A 2L4NA 5DNFA 3PGZA 1A15A 2AWOA 2R93G 2R7DA 4B9WA 4DKAC 1G51A 2O5IC 4LWCA 5ISRA 2MFIA 4S3SA 3E0JA 1GUNA 3STBC 3I4NH 1L1OB 2VXWA 4IUVA 3JC66 5EKKA 1YNND 2KJXA 3HKSA 1S5ED 3JAMi 2VQEL 4BXXG 2XGTA 3Q6SA 1XNRQ 2KENA 1SNCA 1IYUA 4M8AA 4R1JA 1SYBA 1EQVA 3OOCA 4DR4L 3S16B 3K7UC 4DK1A 3I4LA 1XNQQ 5H1SE 4F8MA 1PH7A 3RNUA 5IE8A 1PH3A 1BO0A 1V1QA 1TS4A 1BCPC 3NK9A 1I94Q 1MSGA 1QVFA 2YU9H 2D9UA 3ERSX 1CTMA 4P73A 1LV9A 1KTKA 3P1HA 1SMYD 4JI3L 2A73B 2EDGA 1YNJD 1VQIA 4XIGS 3L7ZC 4KV6A 2PW7A 3BDOA 2OCEA 1CFMA 2YU9B 1Q86C 1STEA 3LGJA 4DR6L 1CHPD 4RG1A 3I8ZA 1HCZA 4JBKA 1A6XA 2SOBA 1WVLA 2JA6B 3K5LA 1CM9A 1RODA 1OXXK 1HNWQ 1U5KA 1VMPA 1GHJA 3OTOL 3R3OA 1K73C 4BBRG 4XQQA 2PNHA 3T4AC 3HOUB 2ES2A 4LFBL 1VQKA 2WINB 2EIFA 1EIGA 1HQRD 3R2TA 5M3MB 1Y1VH 5IGCA 1EFWA 4XQNA 1VDZA 4OX9Q 4LUOA 3TSSA 4BBSG 1VQDA 2K5VA 1EFID 3HRZC 4JBWA 5IT9L 3T51B 4JI6L 3GD7A 4GLXA 4K8JA 5T1IA 1KD1C 3RD4A 1EYDA 3KDFB 4FNFA 3AU7A 1JOOA 1N34Q 3RLNA 2LXJA 3NBHB 1FL0A 4MN3A 4B3TL 2L9HA 1TWGH 1N32Q 3E0EA 2Z6KC 4ZUIA 5C0XH 1EY4A 2LFNA 4YHHQ 2EY6A 4CDDC 4FXDA 1V8QA 4IJHA 2F0WA 1VQ8A 1PZKD 3S1NB 2YYZA 2G9HD 3VYRA 4X3UA 3DXJC 1VQNA 2XWJB 4L5SA 1SNQA 1WTVA 2K03A 5M3FH 5EBCA 3NE5B 1JICA 2UU9L 2D0OA 1CA5A 2BA0A 2VW9A 4A3FB 2PMZE 1HNXL 2ZTEA 5CR3A 1DYQA 1IYJB 1UE5A 4PZ7A 1EYCA 5JAVA 2YTXA 2F0EA 1SYFA 2L55A 1XWEA 3FPUB 4IFDI 1K8OA 1EY7A 4JYAL 3DEPA 1KLGD 3KJPA 4HEDA 5C4ZA 4XT3B 1NUCA 1B7YB 3VR3A 4QIWB 3K6OA 2HHHQ 5I2XA 5M5YH 2UUCL 1K0SA 1RL2A 2I5HA 3KK7A 5KEEA 4WJ3M 3KFUA 3EIVA 1PRTB 3CQZH 4XTCS 3CC2A 2RHQB 1SYEA 1Q82C 2NN6I 3DUZA 2ENBA 3SVMA 2DNEA 2KCCA 3J7A5 5C3EG 3S1RH 2A6EC 3FPPA 4RAUC 4LK1C 1XPRA 2B29A 1QZHA 4IPGA 5FO9B 3OTOQ 2Q8RE 2L1BA 4P2CB 2EYHA 2I07B 1TWCB 1E2VA 1NCVA 4KK7A 2OTJA 4UY8C 4BY7G 2F4IA 3C1EA 2N78A 5GADC 2PQAB 4C3JG 1LT6D 4GKKL 1SJHD 1Y1WB 3I4MH 4K5XA 2UUBL 4DV5L 3PSIA 1F2YA 4I7AA 4C3IB 4RMFA 4DV3Q 2N49A 5G3LF 3RLOA 4JI6Q 2PMZB 2JA7B 4A3KB 1T5EA 1CK1A 1Q46A 3C46A 3J80L 2PI2A 2Z1CA 4KD3A 4B3RL 2EE1A 2BDNA 4ZRZA 4OXPA 1IBML 2XVSA 3F2BA 4O42A 4IFDH 3QIAA 2KHSA 4YHHL 4QF4A 4K0KL 5D14A 4POFA 3F2CA 4PZ6A 2B2VC 3FKIG 3J81L 2O2LD 4PZ8A 1TWCH 3CCMA 3L0OA 1HPCA 4YY3Q 3AFPA 4A3MB 1JQYD 4A3DH 4H7BA 1ML0D 3PIO3 4DXFA 1SNMA 1I3QB 1STNA 2JK8A 2RBMA 4U673 2X6GA 4KY6A 1DD2A 2HQEA 1JR0D 1HR0W 4QL5A 1X3PA 3BU2A 4KJNA 3D8GA 4QCLA 2A68D 5IYCG 2WAQB 2F0FA 5C3EB 4GOPA 2OF1A 3M85A 1G2TA 1RDPD 3HOYH 1NY4A 4DNTB 4A3GB 1ASZA 1CHQD 1SBBB 2Q2TA 5M5XB 4NXML 1MJEA 1RKNA 2V1CC 4ZK9B 3NHHA 1QE6A 4K5WA 1ZYRD 1FR3A 1HJPA 2FHTA 2WKCA 4OO1I 5C4JH 4YCWA 4HSVA 4LF4Q 1GUSA 1STGA 4CDCC 4HIKA 2ZXOA 1V1OA 3CQZB 5DLQE 3K5NA 1L2FA 5KNBA 4DAPA 1AZPA 1WCMB 3CCQA 5ELOA 4U68A 2IT1A 2NVTB 4GOPB 2F0JA 4PMCA 3VR6A 2NVTH 3D4RA 3OW7A 4IJLA 3KF8B 5C5MA 3ER0A 2FFKB 1PMRA 5JPNC 4L5TA 1OXVA 1LT3D 1SN8A 5L37A 3H3VC 2XWBB 3S1QB 4DV4L 2PZUA 1Q81C 2E75C 1I4HA 3S1MB 1KIXA 1PDQA 2K75A 1WTXA 1A63A 3CW2C 3SEBA 2MHVA 2X69A 2E2DC 4OONA 4K2KA 3HOZG 5CV8A 1EWCA 3F8TA 5ELDA 1STYA 1VQAA 4HCSA 4DF7A 3PIPA 4DV2L 4OIKA 5BR8Q 3D31A 5LMNQ 2VY3A 2JSOA 2XNAC 4X64Q 2DY7A 1I4PA 5C3XA 2R93H 4QUFA 1QWYA 2IY5B 4JW0A 3CKIB 2QW7A 3H3VI 1HZBA 1Q1EA 1Q90A 4IURA 4YY3L 5EBDA 4A93G 1LTLA 3M4OH 3HOVB 1MHWC 1SE2A 2RDGA 4KN4C 1NMFA 4IOAA 2L11A 1F2ZA 1NSNS 1O7ZA 1EQTA 4IFDJ 2PPBC 2VNUD 1HZAA 4C3HH 3HOXH 5ELCA 2IX3A 1YIJA 1YJNA 2N88A 4LF9Q 5EPKA 4LAAA 1E3PA 4POGA 1VQEA 5HURA 2E5LQ 4RA8A 4ULLA 5DM73 4GN3B 3Q23A 2FXQA 1Y8OB 4HIOA 1KHIA 4A3FG 4NXNL 3I4MG 1D5XC 5FJ8G 4F88A 3GV3A 2XSCA 1H9JA 2R92G 3MXNA 4IALA 4KHVA 3C1FA 5EQ0A 5J39A 3KDFA 2E2IB 4ZUJA 4HTHA 1YNXA 4X6AH 1Z7TA 4H0LC 4UAIA 3J80i 1K8AC 3GO5A 3PUZA 3S17H 4A3DG 3S9WA 2F0LA 5ELNA 3W5OA 4X66L 5E4XA 4FO2A 1QOHA 2JA5H 4GZYC 2BE5D 4RCOA 3J7AF 3GTOB 1ILQA 1N33Q 1CUKA 4RGMA 3DM3A 1PRTD 2EY5A 2Z8LA 3EROA 2BCOA 3J80c 5BN5A 2ICEC 3NQIA 3EVQA 3K7AB 1X3QA 2KCTA 1MJCA 1QCBD 4J6HA 5IGGA 3HKZG 2UXBQ 1YZ6A 3OHXC 5EKIA 4JC0A 5C0XI 3DHQA 4HN7A 5JJIA 4L8JA 4HMIA 2AWNA 3RLFA 3CCEA 4MIUA 3OIQA 1Q7YC 4ZKCB 1FVIA 2CQAA 4AYBG 1IBKQ 1K3BC 1ZKOA 4JI4L 1Z47A 4CKBA 4FP5D 3H0GG 1E0BA 1LUZA 1T9HA 4HMJA 4L63B 4O2DA 3R8BA 3BDCA 1Y14B 2GN5A 2CW0D 5DAUA 2EZVA 1Q3LA 4DN4M 5I6YA 2WFWA 3I4MB 2LKVA 4MTNA 5LHY1 2NVYH 1FJGQ 2MJ8A 4IUPA 5M3FG 3VR5A 1VQ5A 1Y1WG 2F0PA 1LTBD 5IYDH 1QNUA 2MGSA 1PFMA 1VF5C 4L6TB 1NJIC 5FLXE 1H9SB 4LFAL 4LF7L 2JA8B 1M4VA 1EOTA 1PTOC 3RN2A 3K57A 5C3WA 1MKHA 1QNKA 2JE6I 2IWHA 2B2UC 3WOFA 5I4DA 3MXUA 3I91A 2EYPA 2NZ1D 2ZM6L 2B39A 2IW3A 2K14A 1UEAB 2EJMA 3S15B 5IYCH 1VQFA 2ASBA 1LLRD 4N8FA 4CDEC 2WB1B 4XYOA 2NYZD 2KOLA 3RZDH 5C44G 2HQLA 5JPMC 3HOWH 3S1NH 1B1ZA 2UXDL 3BYTB 1OXTA 5FK9C 4LF8Q 5F2DA 4QGUA 3X3NA 2XN9C 4EQNA 3OSOA 1DM0B 1PA6A 1W6KA 1J6QA 3SE0A 3KJOA 3GTJH 4J1MA 1MSHA 2YTYA 4DPGA 3F1ZA 3WDNA 2NTSA 4DGZA 1HNZQ 3KBXA 2B2WC 1N34L 1KAAA 4TRDA 2OQ0A 3HS0C 3M9BA 4AYBB 3BDLA 4E6IA 5CV6A 4HIMA 1KL9A 4DV0L 3KOJA 5C5LA 4Z9CB 2NVQH 5M5XH 3VR2A 4G57A 4RCNA 1X3GA 2M9VA 2RKSA 2UUAQ 2A5HA 1Q8KA 3HOWG 1X55A 4OWXB 1GJXA 3NTIA 2E2HB 4LW1A 2OXPA 1B70B 1I4GA 4ODGA 5IOCA 4KHPQ 3U50C 4ZQ3A 4DR5L 3GP7A 4V190 1S5DD 3EJIA 4I7ZC 5J1ZA 3VA5A 2ZTCA 3PO2H 1SLJA 5IWAQ 4Y7NH 4CJ1B 1PLFA 2A69D 1RHPA 1OTCA 2EYJA 1BKBA 5LL6S 1A2TA 5GAGC 2K50A 5TSSA 1W6JA 3K58A 2F0VA 5GQOA 2RQXA 5EGTA 1FJGL 4YIJA 2AQ1B 4DNRB 1F9PA 1KNEA 3G7LA 2F0NA 1LTID 3A55A 4DK6C 1I50H 1XMOQ 2R7ZB 1WTWA 2B2YC 1LM0A 2B63H 4PMBA 1BBXC 3G4SA 5ELEA 3ULLA 3A54A 1QG7A 2IJ0A 2P5ZX 1W3SA 4JVZA 5COYA 2EOTA 2KBNA 2R7ZH 1UE6A 4ZYSA 1SXTA 2RA4A 1EWHA 3NEMA 4UP7A 3H3VH 5E1FA 2AKWB 1IW7C 2QF7A 1HUNA 1B3QA 2K5NA 3TZDA 2GVAA 3PV0A 3DMUA 1PZJD 1WTOA 1EY9A 3HOXB 2NZOA 1K83B 2R6GA 3ND9A 2DN8A 1YHAA 3B6YA 4IQZA 3PO3H 1DOKA 4L5QA 1PFNA 2WAQE 2A1AA 3G48A 1I4QA 1U4RA 1CZGA 2NBFA 4B3RQ 4FDBA 4A3KG 1PTOB 3DLLA 1ENAA 1IBMQ 1WTRA 2I0QA 2H1EA 1Y8NB 2BA1A 2B8FA 2D2CC 4HJ8A 4NB3A 3AB9A 4X65L 3FMCA 1PH9A 3CPFA 4DFAA 1F9SA 3CPWA 2A6ED 1H9RA 2UUAL 4FF4A 2Q2HA 2Z4HA 2Q2IA 4CDFC 5LMUL 3EFXD 5JJKA 3L3OC 4DR7Q 3E6ZX 3M7NA 2F1MA 1A3VA 2IPKD 3CD6A 1SFOH 2MNAA 2LSSA 3FKIB 3K59A 2F0GA 3A5UA 1P8LA 1FNVA 1TY0A 4I65A 4HAEA 3HOVH 3FDTA 5M3MG 3UI2A 3TS2A 2NVYB 4A3BG 1HR0Q 4R8IA 1HXYD 3D4DA 4IO9A 1VQJA 3E9HA 4LJZC 1H9MA 1TWAB 3F2DA 1EU4A 1F9RA 1RJTA 2KEEA 3I7FA 4A3DB 1HQMC 2HIVA 1P16A 3P75A 3TQYA 1EY6A 1I4RA 3AMUA 1HNWL 1L1OC 1QVCA 1JJGA 1GVPA 1DXMA 1N9WA 3E3XA 2H5XA 4RHRA 3NP8A 4DR2Q 4L5RC 3H94A 1SROA 2PNRC 2KUMA 2ZJRA 1STBA 1X32A 1QVGA 5GAHC 4GOPC 2BDOA 1XMQQ 2QA4A 4Y52H 5A2QL 4OIJA 3CCJA 3I4NB 4DU9A 1TS3A 2HCIA 2IHFA 4OL7A 4IN3A 1ILPA 1LABA 4DV6Q 3CF5A 2K5WA 1J5EL 4PQXA 1O7LA 4B3ML 4TSSA 1D6EC 5FLMH 1IL2A 5IYBH 1SNDA 3JAME 1K28A 4H13C 1U4LA 4KJOA 2CKZB 2LMCB 3T1HQ 5HGQA 1WTHA 3CU7A 5ELFA 1MIUA 2RSOA 3A8IE 1S5BD 4X3SA 5T1GA 1LYLA 2VL6A 3M4YA 2C9OA 4BY7B 2L0CA 3DWPA 1PH6A 4JOIC 2Y0SB 3I3CA 3NSWA 1XNRL 4PG3A 3S2HH 4J15A 3J81c 1WFQA 3QR8A 2F4VQ 1PZID 2CVRA 2QEJC 1RD9D 3SK4A 5KNDA 3U58A 1BDOA 3TP7A 5LMUQ 2Q8TA 5IIFA 1J8IA 5E7NA 2JA6H 1QILA 4APVA 2J4XA 1I94L 4K8IA 3GTKB 3KLSA 4JCVE 3PCOB 1G6PA 1GUGA 2I5MX 4NP5A 1C8CA 4DUYQ 4TQUS 4JI3Q 2VS1A 4K5VA 4EGVA 1YNJC 3S17B 2K01A 4WFN3 4MNOA 1C0AA 1X9NA 4GN4B 1MGSA 1V1PA 1JCKB 2CHBD 1IHZA 3M4OB 3QB3A 1SSOA 4BXXH 2K04A 4XYQA 3TDQA 3BVZA 5J3BA 4EQOA 1GM5A 5GAEC 3URYA 2K05A 5KYIA 4RH6A 3I4NG 3PO2G 4A3MG 2NVXH 3S2HB 3EBEA 4PNYA 3W1BA 4ABNA 2RDFA 3GDEA 1II3A 4PMWA 2NVQB 2JA8H 2B2VA 4IPHA 2WB1E 1FD7D 1Y1VG 5I9OA 1CKOA 3DM1A 2K52A 4FF1A 3RMHA 1VQ7A 4CHTB 2LXKA 3T13A 2A8VA 1S5FD 1WD0A 2UXCL 4FVMA 1VS0A 5M5YB 4A75A 2CWAA 4ILWA 1BXTA 4KY5A 1JWUD 4QMGA 2Q2UA 3MHBA 1PTOF 3N6RA 1V43A 2O4XA 4Y7NB 1K9MC 4ME3A 3UDGA 2CWPA 1EUJA 1XPOA 1J9OA 1NAPA 4DAYB 1PV4A 2Q8IB 1UE1A 2Y0SE 1LACA 4DV7Q 3NXWA 1E7ZA 3NELA 4A3FH 3FRPB 1YBYA 4ZLTF 5LMNW 4JI7Q 1AFPA 2VB3X 2WACA 1OXUA 4RGNA 3H0GB 4DUZL 2VUMB 4A76A 1DJRD 1I6VC 2Z6BA 3IRBA 5DM63 3KUPA 1LTAD 2V4DA 4DK3C 2K28A 3O13A 3V05A 4OO1H 2PI2E 1BVSA 4IZ8A 4JI5L 1H9KA 3HOXG 5IP7H 2NN6G 4JI0Q 5GROA 2VUMH 1PVOA 2PO4A 2A6HC 3ZJYC 4TVAB 1IKMA 3FP9A 3T53B 2PZWA 2F4VL 2VQFL 2KQ3A 1PH8A 1IL8A 4HJ5A 2K5HA 4DV1L 1KXLA 3GTPH 1X3FA 4KD4A 2LS01 3MEHA 3SGIA 1M90C 3OWEB 3PO2B 2CQOA 2G9DA 4MHEA 2AMCB 1GHKA 4HJ9A 4GKJL 1NR4A 1JB7A 1XTDA 3VA7A 1WCMG 1HZCA 4DUYL 1L0YB 3HOZB 2CFMA 3BZDB 2BE5C 3Q8DA 1Y1WH 2H4OA 3R2IA 1I3QH 1VQOA 1Y69U 1JJ2A 1EQQA 4HJAA 2QCPX 1F2MA 1STAA 1GO3E 4A3JB 1IBLL 3CRLC 4KMUC 4GLAC 1TWFH 3G6EA 4ZAIA 3K80C 3OWFA 4R4QA 3IAYA 2EY2A 4K2LA 2F52A 3CRKC 2FINB 3H0GH 2PCFB 4BS9A 2YTVA 3J7ZC 4B3SQ 3KF6B 1EOVA 1HTLD 1YHBA 4Q0FA 3T1YQ 1Z6HA 3PIP3 3C3LA 4UPAA 3K81C 3A7LA 1L1OA 3G71A 3L2PA 2ZJQA 1OO9B 1IZ6A 2OWOA 4H44C 4LMQD 3GTMH 5C6AA 1EYAA 1S3OA 4LF8L 2XTIA 3GTLH 4JI8Q 4J8QA 1DGSA 2E2JB 4DV5Q 5AFWA 3TP6A 3GTOH 4X3TA 1HZ9A 5K36H 2K33A 2XRQD 1SE3A 1KAWA 5JVG3 1SJED 4OELB 1ET6A 4ID6A 4AQYL 1SMXA 1HNZL 1FGBD 1JOKA 2KA7A 2KCNA 1R9TB 2VQEQ 4A3IG 4DV7L 4DXGA 4RGOS 5D65A 3CAMA 1SYDA 1QUQB 2QGQA 3BVGA 4DUZQ 1EY8A 1XTCD 2K6AA 2R92B 1YHQA 4BBSH 3TP8A 3R93A 5JEAH 4B9XA 3HOYB 2MUYA 2YV5A 1I50B 1IW7D 4OHJA 4JPBW 1TR5A 4RHSA 2B2TC 1G6ZA 5J22A 4GNXB 1U4MA 1V1PB 4OO1G 3QG1A 3PMFA 2EXZA 3N52A 2E76C 2ZJPA 1TT2A 4JG2A 2WIIB 5HGTA 4DAVA 1EY5A 4DV1Q 1L0WA 5CYUA 3J80E 1NNXA 3BG3A 3NPPA 4UDUC 1PH5A 3RZOB 4A3JG 1HA6A 1AE2A 1H95A 3G6JB 2SEBD 1JWSD 2NB0A 4N9TA 5IGBA 2ZXRA 2FJ2A 4MTKA 3GTLB 4TKOB 3LWEA 3VR4A 2D0PA 1S40A 1E2WA 2DY8A 2PQAA 2SNSA 5JJZA 5CV5A 3TMEA 5I9PA 1DONA
chains in the Genus database with same CATH topology
1EU3A 3IL8A 4BA1I 3MWYW 2DNCA 1ZYRC 1LTRD 1TU2B 3F2UA 3PO3B 2A6HD 3PUYA 2AUJD 3MFYA 2L5TA 3TN2A 4K14A 1O78A 2HDMA 4A3IB 3NBHA 1AN8A 1C4QA 1IKLA 4K6LA 4XT1B 2F0UA 4G4KA 3V96A 5CC4A 3GTJB 1BNZA 1GXDC 1SAPA 1EZ6A 2WP8J 1EY0A 4NMZA 2A69C 3EQLC 1C48A 1BOSA 4HR7B 1ET9A 5K36G 3MAQA 5A35A 3M3YB 3KLSX 5C44B 5C4HA 3TP5A 1WD1A 1ONLA 1GUOA 1YNNC 1XX8A 1ZEQX 1F2LA 3U9SA 3K5OA 2JXMB 3ERQA 1EEID 1CA6A 1EIHA 2B2WA 1D5MC 1RTOA 1MBYA 5IGFA 3GTGB 1HFNA 2SNMA 3QOJA 4C1NI 1B4OA 3WOEA 4KKUA 4DAYA 1HTPA 1SYCA 1Q1BA 1SMYC 4NW2A 4C3JB 2FMCA 4C2MB 3H09A 3FVQA 2B63B 2NTTA 1HHVA 3ND8A 1AEXA 3X3MA 1BUVT 3HEJA 4KY7A 3PUVA 2OT2A 1SDFA 2NN6H 3A8KE 4IUQA 1D5ZC 5JEAG 4C56C 2K1BA 4HSPA 5FKAC 3K5MA 5FLXL 1SYGA 3NTHA 3JAML 2GA4B 2PW5A 1D1KA 2R3ZA 3P20A 4BWGB 3V2TA 1LTSD 3PUXA 1G2SA 3SK6A 4RWSC 2RSNA 1SNPA 2BOSA 1DOLA 2HUGA 2RVLA 4BA2I 4X3KA 2QILA 5FO7B 4BBSB 4WJWA 3I72A 1Q8IA 1JWMD 4DK0A 1TVXA 1B9NA 3QJYA 4EQPA 5CV4A 4BBRB 1GUTA 2QKIC 1CI3M 1L0XB 3SK5A 1JB3A 1GUWA 2CW0C 2K32A 2F0QA 3E5SA 1LTGD 3VYSA 5D3DA 1QJOA 2QDBA 1IYVA 2A74C 2RDHA 1S5CD 2F0SA 3RZDB 3SHLA 3H91A 1M8AA 5IT9E 1LO5D 2F0IA 2JP1A 1LT4D 2ID0A 1XXGA 4ZKBB 5EPJA 3GQBA 3VYUA 5M3FB 1TWFB 1QB5D 1Q12A 5EKLA 2F3WA 2M00A 3Q0AA 2EJFC 3HP3A 4A3EB 4KTAA 4B08A 1A2UA 1B50A 4CJ2C 4OGQC 1TS5A 1VMCA 1AP0A 3NQTA 4FYDA 2B8GA 1SFOB 2EYLA 4IUNA 4G7HC 3KF8A 1H9SA 3HG9A 1WTPA 3ITPA 1R4PB 3OMGA 4RFBA 1KDCA 1ZXTA 1RTNA 3IFDA 2R61A 1TWHB 3QO2A 2EVBA 3A8JE 3HZXA 5JOBA 3CHBD 3DEOA 1KDBA 1VF7A 4C3IG 2WV6D 2O5JC 4KHZA 5M5WB 1TKWB 2LY7A 2NUCA 2PQEA 1ENFA 3MVVA 2HCCA 4RGTA 4WRDA 5IGDA 4KI0A 1S4ZA 4R8NA 1D1IA 1KLUD 5CV9A 4M1UB 3SDZA 1B44D 3PUWA 3LNNA 1AW7A 1ENCA 3MTSA 2IX1A 2JYOA 2F3VA 1Y8PB 5KIXA 4C3HG 4RKLA 2JEAI 1D2BA 5A2QE 2EYMA 2ZXPA 4R9WA 5EPLA 2TSSA 1CQVA 2VB2X 2FMMA 2D62A 3LWUA 3OPOA 1NR2A 1DCZA 1B53A 2IX0A 3HKZB 4KKSA 3C2PA 1KNAA 2TMPA 2MPMA 3SK8A 1BCPD 3J7AV 3MXGA 2IL8A 1PRTC 3P7JA 2WKDA 4NKLA 1SE4A 2E74C 3DWAA 3BVMA 3VYTA 5M9OA 1O7YA 1TS2A 2AQ2B 3KLRA 2L12A 1G91A 3NWSA 3W2DA 1Y1VB 4XDXA 4QUCA 2B2UA 1ICWA 3D4WA 1U9RA 1G8ZD 3J81E 2ICIA 5CBEE 3TBIB 1DOMA 3ZYYX 4NDXA 4CBVA 1B9MA 2K5DA 1HFGA 3A56A 1TY2A 5IODA 1BF4A 4JK1C 2N55A 1PTOH 4IUUA 4G7ZC 4CJ0B 4N9PA 5KRUA 3IFTA 4C3HB 4IFDG 4F7XA 2KVMA 2F0HA 5C0XG 2EYFA 1PTOD 4C1NK 1F77A 3D3RA 3LX0A 1XYIA 2R93B 1CZWA 3NUCA 1JOQA 3T16A 1BCPF 5C4JB 4CKEA 2AUKA 2D5DA 4IUTA 1HA5A 1F9QA 5CBAE 2K7VA 5K5PA 3IKJA 1BR9A 1UAPA 3Q24A 1FNUA 2SDFA 1TWGB 4Q5VA 4A93B 2EYOA 2OEOA 4FF2A 5ELBA 5D3IB 2HDLA 1K8MA 4FF3A 2JEBI 4A3BB 2XRSD 3Q22A 2ZT9C 4DA2A 5KYLA 1EL0A 3KBGA 1LTTD 3HOWB 2B2TA 1FNWA 2F0OA 3MXPA 4HCEA 2F0DA 3NBIA 3M7GA 3U9OA 1RCVD 5LL6X 1E2ZA 2F0TA 5CGKA 1A3UA 4FXKC 2NVXB 3HGBA 5G3LD 5CMDA 4O1NA 2J0TD 4V0BA 3DWQA 5KNCA 2AQ3B 5KGUA 1DZ1A 1TQOA 4KKTA 5I6WA 2X6LA 3OMCA 5BN4A 3EA6A 1JORA 1EEFD 3GV6A 3MC0B 5DEHA 4PV1C 3ONAB 3K0YA 2EJGC 2J7ZA 3QOLA 4F87A 5NUCA 5CORA 1HUMA 4CGYB 5CV7A 3FEWX 1OXSC 5JVH3 3BYYB 5JEAJ 3MFGA 5FOBB 1SEBD 1CT1D 1PFBA 2I46A 1R4QB 2JA5B 4WORA 4KN7C 3L9AX 5IGEA 1AZQA 5C0XJ 1EZ8A 1STHA 2EPBA 2PZTA 1SNOA 3SXHA 2A68C 5EJWA 3I90A 1HRJA 3D6WA 5BN3A 3GTMB 4K6DA 3W3AA 3GTPB 2NWGA 3A7AB 3GTQB 1B2TA 4ME5A 4QB4A 1TIID 2M2LA 2EY1A 1T5XD 2KEDA 1ESFA 1A3TA 3I70A 3S1RB 1RF2D 3MA2B 5I2YA 3OIPA 2Z4IA 3S2DB 2F0KA 2MP1A 2B2YA 2PYKA 3D6CA 3NTKA 2XIWA 4RKBA 1MI2A 2F0MA 1UNSA 1WTQA 5FO8B 4XXEA 1GOZA 5E3FA 3NWTA 3S14B 2K5QA 1JE4A 1U4PA 1LT5D 1MD2D 1BQQT 1BCPB 3RUZA 4BY1B 4FXGC 4XQJA 1ESRA 1G291 1PXUA 1B3AA 1PYWD 1KDAA 5C4XB 3TZUA 4EVOA 1VCIA 1I4XA 5E4WC 3J7YW 1O80A 2F03A 4G7OC 4CKCA 3I73A 1I6HB 1PRTF 3QWNA 3MZ5A 1UUPA 1JC7A 2C5CA 3H6MA 1FYCA 1KABA 3BS1A 1CQFA 2KECA 3T56B 3SR1A 2L4NA 5DNFA 1A15A 2AWOA 4B9WA 2O5IC 5ISRA 4S3SA 3E0JA 1GUNA 2VXWA 4IUVA 5EKKA 1YNND 2KJXA 1S5ED 3Q6SA 1SNCA 1IYUA 4M8AA 1SYBA 1EQVA 3OOCA 3S16B 4DK1A 3I4LA 4F8MA 1BO0A 1TS4A 1BCPC 3NK9A 1MSGA 2D9UA 1CTMA 1LV9A 1KTKA 3P1HA 1SMYD 2A73B 2EDGA 1YNJD 4XIGS 3L7ZC 4KV6A 2PW7A 3BDOA 1CFMA 2YU9B 1STEA 1CHPD 3I8ZA 1HCZA 1A6XA 2SOBA 1WVLA 2JA6B 3K5LA 1CM9A 1RODA 1OXXK 1VMPA 1GHJA 3R3OA 4XQQA 3T4AC 3HOUB 2WINB 1EIGA 1HQRD 3R2TA 5M3MB 5IGCA 4XQNA 1VDZA 3TSSA 1EFID 3HRZC 4JBWA 5IT9L 3T51B 3GD7A 4K8JA 5T1IA 3RD4A 1EYDA 4FNFA 3AU7A 1JOOA 4MN3A 2L9HA 4ZUIA 5C0XH 1EY4A 2LFNA 2EY6A 4FXDA 1V8QA 2F0WA 1PZKD 3S1NB 2YYZA 2G9HD 3VYRA 4X3UA 3DXJC 2XWJB 1SNQA 1WTVA 2K03A 5EBCA 3NE5B 1JICA 1CA5A 2BA0A 4A3FB 5CR3A 1DYQA 1EYCA 5JAVA 2F0EA 1SYFA 2L55A 1XWEA 3FPUB 4IFDI 1K8OA 1EY7A 3DEPA 1KLGD 4HEDA 5C4ZA 4XT3B 1NUCA 3VR3A 4QIWB 3K6OA 5I2XA 3KK7A 5KEEA 4XTCS 1PRTB 1SYEA 2NN6I 3DUZA 2ENBA 3SVMA 2DNEA 2KCCA 2A6EC 3FPPA 4RAUC 4LK1C 5FO9B 2Q8RE 2L1BA 4P2CB 2EYHA 2I07B 1TWCB 1E2VA 1NCVA 4KK7A 2F4IA 3C1EA 4C3JG 1LT6D 1SJHD 1Y1WB 4K5XA 1F2YA 4C3IB 5G3LF 2PMZB 2JA7B 4A3KB 1T5EA 1CK1A 3C46A 3J80L 2Z1CA 4KD3A 2EE1A 2BDNA 4ZRZA 2XVSA 4O42A 4IFDH 3QIAA 2KHSA 4QF4A 5D14A 2B2VC 3J81L 2O2LD 1HPCA 4A3MB 1JQYD 4H7BA 1ML0D 3PIO3 4DXFA 1SNMA 1I3QB 1STNA 2RBMA 4U673 2X6GA 4KY6A 1DD2A 2HQEA 1JR0D 1X3PA 4KJNA 3D8GA 4QCLA 2A68D 2WAQB 2F0FA 5C3EB 2OF1A 3M85A 1G2TA 1RDPD 4DNTB 4A3GB 1SBBB 1CHQD 5M5XB 1RKNA 4ZK9B 3NHHA 1QE6A 4K5WA 1ZYRD 1FR3A 2FHTA 2WKCA 4OO1I 4HSVA 1GUSA 1STGA 2ZXOA 1V1OA 3CQZB 3K5NA 5KNBA 4DAPA 1AZPA 1WCMB 4U68A 2IT1A 2NVTB 2F0JA 4PMCA 3VR6A 3D4RA 3OW7A 5C5MA 2FFKB 1PMRA 5JPNC 1OXVA 1LT3D 3H3VC 2XWBB 3S1QB 2PZUA 2E75C 1I4HA 3S1MB 1PDQA 1WTXA 3SEBA 2MHVA 2X69A 2E2DC 4K2KA 5CV8A 1EWCA 5ELDA 1STYA 4HCSA 4DF7A 4OIKA 3D31A 2JSOA 2XNAC 2DY7A 1I4PA 5C3XA 4QUFA 1QWYA 3CKIB 1Q1EA 1Q90A 4IURA 5EBDA 3HOVB 1SE2A 2RDGA 4KN4C 2L11A 1F2ZA 1NSNS 1O7ZA 1EQTA 4IFDJ 2PPBC 2VNUD 5ELCA 2IX3A 2N88A 5EPKA 4LAAA 5HURA 4RA8A 4ULLA 5DM73 3Q23A 1Y8OB 1D5XC 4F88A 3GV3A 2XSCA 1H9JA 3MXNA 4IALA 4KHVA 3C1FA 5EQ0A 5J39A 2E2IB 4ZUJA 4HTHA 1Z7TA 4H0LC 4UAIA 3GO5A 3PUZA 3S9WA 2F0LA 5E4XA 4FO2A 1QOHA 4GZYC 2BE5D 3GTOB 3J7AF 4RCOA 1ILQA 4RGMA 1PRTD 2EY5A 2Z8LA 3EROA 2BCOA 5BN5A 2ICEC 3NQIA 3EVQA 3K7AB 1X3QA 1QCBD 4J6HA 5IGGA 3OHXC 5C0XI 5EKIA 3DHQA 4HN7A 4L8JA 4HMIA 2AWNA 3RLFA 4MIUA 3OIQA 4ZKCB 2CQAA 1ZKOA 1Z47A 4CKBA 4FP5D 1E0BA 4HMJA 4L63B 3R8BA 3BDCA 2CW0D 5DAUA 2EZVA 1Q3LA 4DN4M 5I6YA 3I4MB 2LKVA 5LHY1 2MJ8A 4IUPA 3VR5A 2F0PA 1LTBD 1QNUA 2MGSA 1PFMA 1VF5C 4L6TB 5FLXE 1H9SB 2JA8B 1M4VA 1EOTA 1PTOC 3K57A 5C3WA 1QNKA 2JE6I 2IWHA 2B2UC 3WOFA 5I4DA 3MXUA 3I91A 2EYPA 2NZ1D 2B39A 2IW3A 1UEAB 2EJMA 3S15B 1LLRD 2WB1B 4XYOA 2NYZD 2KOLA 5JPMC 1B1ZA 3BYTB 1OXTA 5FK9C 5F2DA 3X3NA 2XN9C 4EQNA 3OSOA 1DM0B 1W6KA 3SE0A 4J1MA 1MSHA 3WDNA 2NTSA 4DGZA 3KBXA 2B2WC 1KAAA 4TRDA 3HS0C 4AYBB 3BDLA 4E6IA 5CV6A 5C5LA 4Z9CB 3VR2A 4G57A 4RCNA 2M9VA 2RKSA 2A5HA 1GJXA 3NTIA 2E2HB 2OXPA 1I4GA 5IOCA 4ODGA 4ZQ3A 3GP7A 4V190 1S5DD 3EJIA 4I7ZC 5J1ZA 3VA5A 4CJ1B 1PLFA 2A69D 1RHPA 2EYJA 5LL6S 1A2TA 5TSSA 1W6JA 3K58A 2F0VA 2RQXA 5EGTA 4YIJA 2AQ1B 4DNRB 1F9PA 1KNEA 3G7LA 2F0NA 1LTID 3A55A 2R7ZB 1WTWA 2B2YC 4PMBA 1BBXC 5ELEA 3A54A 1QG7A 2IJ0A 5COYA 2EOTA 4ZYSA 1SXTA 2RA4A 1EWHA 5E1FA 1IW7C 2QF7A 1HUNA 3TZDA 3PV0A 3DMUA 1PZJD 1WTOA 1EY9A 3HOXB 1K83B 2R6GA 3ND9A 2DN8A 4IQZA 1DOKA 1PFNA 1I4QA 1U4RA 1CZGA 2NBFA 1PTOB 1ENAA 1WTRA 2H1EA 1Y8NB 2BA1A 2B8FA 2D2CC 3AB9A 3FMCA 4DFAA 1F9SA 2A6ED 1H9RA 4FF4A 2Z4HA 3EFXD 3L3OC 3E6ZX 3M7NA 2F1MA 1A3VA 2IPKD 3FKIB 3K59A 2F0GA 1FNVA 1TY0A 4I65A 4HAEA 3FDTA 3UI2A 2NVYB 4R8IA 1HXYD 3D4DA 4LJZC 1H9MA 1TWAB 1EU4A 1F9RA 1RJTA 2KEEA 4A3DB 1HQMC 3P75A 1EY6A 1I4RA 3AMUA 1DXMA 4RHRA 3NP8A 3H94A 2PNRC 2KUMA 1STBA 1X32A 2BDOA 5A2QL 4OIJA 3I4NB 4DU9A 1TS3A 2HCIA 4OL7A 4IN3A 1ILPA 1LABA 2K5WA 4PQXA 1O7LA 4TSSA 1D6EC 3JAME 1SNDA 4H13C 1U4LA 4KJOA 2LMCB 3CU7A 5ELFA 2RSOA 3A8IE 1S5BD 4X3SA 5T1GA 3M4YA 2C9OA 4BY7B 2L0CA 3DWPA 2Y0SB 3I3CA 3NSWA 1PZID 2CVRA 2QEJC 1RD9D 3SK4A 5KNDA 1BDOA 3TP7A 2Q8TA 5IIFA 1J8IA 1QILA 2J4XA 3GTKB 4K8IA 3KLSA 1GUGA 4NP5A 1C8CA 4TQUS 4K5VA 4EGVA 1YNJC 3S17B 2K01A 4WFN3 1MGSA 1V1PA 1JCKB 2CHBD 1IHZA 3M4OB 3QB3A 1SSOA 2K04A 4XYQA 3TDQA 3BVZA 4EQOA 3URYA 2K05A 5KYIA 4RH6A 3S2HB 4PNYA 4ABNA 2RDFA 1II3A 4PMWA 2NVQB 2B2VA 1FD7D 5I9OA 3DM1A 4FF1A 3RMHA 4CHTB 3T13A 1S5FD 1WD0A 4FVMA 5M5YB 4ILWA 1BXTA 4KY5A 1JWUD 4QMGA 3MHBA 1PTOF 3N6RA 1V43A 2O4XA 4Y7NB 1J9OA 1NAPA 2Q8IB 1LACA 3NXWA 3FRPB 4ZLTF 1AFPA 2VB3X 2WACA 1OXUA 4RGNA 3H0GB 2VUMB 1DJRD 1I6VC 5DM63 3KUPA 1LTAD 2V4DA 2K28A 3O13A 3V05A 4OO1H 4IZ8A 1H9KA 2NN6G 2PO4A 2A6HC 1IKMA 3T53B 2PZWA 2KQ3A 1IL8A 4KD4A 2LS01 3MEHA 3OWEB 3PO2B 2G9DA 4MHEA 1GHKA 1NR4A 3VA7A 1L0YB 3HOZB 3BZDB 2BE5C 2H4OA 3R2IA 1Y69U 2QCPX 1F2MA 1STAA 4A3JB 3CRLC 4KMUC 4ZAIA 3OWFA 3IAYA 2EY2A 4K2LA 3CRKC 2FINB 2PCFB 4BS9A 1HTLD 4Q0FA 3C3LA 1Z6HA 3PIP3 3A7LA 1OO9B 4H44C 4LMQD 5C6AA 1EYAA 4J8QA 2E2JB 5AFWA 3TP6A 4X3TA 5K36H 2K33A 2XRQD 1SE3A 5JVG3 1SJED 1ET6A 4ID6A 1FGBD 1JOKA 2KA7A 2KCNA 1R9TB 4DXGA 4RGOS 5D65A 1SYDA 3BVGA 2R92B 1EY8A 1XTCD 2K6AA 3TP8A 3R93A 5JEAH 4B9XA 3HOYB 2MUYA 1I50B 1IW7D 4OHJA 4RHSA 1TR5A 2B2TC 1G6ZA 5J22A 1U4MA 1V1PB 4OO1G 3QG1A 3PMFA 2EXZA 3N52A 2E76C 1TT2A 2WIIB 4DAVA 5HGTA 1EY5A 3J80E 5CYUA 4UDUC 3BG3A 3NPPA 3RZOB 1HA6A 3G6JB 2SEBD 1JWSD 2NB0A 4N9TA 5IGBA 2ZXRA 2FJ2A 3GTLB 4TKOB 3LWEA 3VR4A 1E2WA 2DY8A 2SNSA 5JJZA 5CV5A 3TMEA 5I9PA 1DONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPJ A;  1ESR A;  2B2U C;  3IL8 A;  4ZK9 B;  1WVL A;  1QE6 A;  2B2Y C;  1WTW A;  1CM9 A;  1ROD A;  1B3A A;  4ZAI A;  3SVM A;  1HHV A;  2K05 A;  4R9W A;  5EPL A;  2J7Z A;  1BBX C;  3I91 A;  3MWY W;  1VMP A;  2NZ1 D;  4RAU C;  2FHT A;  5E4W C;  1O80 A;  2FMM A;  3GV3 A;  5COR A;  4HSV A;  2FIN B;  1QG7 A;  2KUM A;  3HP3 A;  1HUM A;  2B2V A;  2Q8R E;  2L1B A;  5COY A;  1SDF A;  1X32 A;  2EOT A;  4IUT A;  3DM1 A;  5EQ0 A;  3F2U A;  1EIG A;  4IUQ A;  2RA4 A;  1NCV A;  1F9Q A;  2NYZ D;  2KOL A;  1NR2 A;  1B53 A;  3TN2 A;  4OIJ A;  1WD0 A;  2K1B A;  5CBA E;  1B50 A;  4CJ2 C;  4UAI A;  1AZP A;  2HDM A;  1PFB A;  1KNA A;  2HCI A;  4U68 A;  2SDF A;  1HUN A;  1IKL A;  4XT1 B;  1VMC A;  1ILP A;  4LMQ D;  1AP0 A;  3TZD A;  2MPM A;  5T1I A;  1WTO A;  5E4X A;  5AFW A;  2IL8 A;  1BNZ A;  1MSH A;  2KEC A;  4X3T A;  1SAP A;  2FFK B;  2HDL A;  1ILQ A;  2R3Z A;  2L4N A;  5DNF A;  1A15 A;  1U4L A;  1J9O A;  3P7J A;  1AZQ A;  1NAP A;  4MN3 A;  2L9H A;  1G2S A;  1WTP A;  3KBX A;  2B2W C;  1DOK A;  4RWS C;  2EPB A;  2RSN A;  1PFN A;  1EL0 A;  5EJW A;  3I90 A;  1HRJ A;  2RSO A;  2B2T A;  1X3Q A;  2EE1 A;  3D6W A;  1O7Y A;  2BDN A;  1PDQ A;  2VXW A;  4IUV A;  1U4R A;  1DOL A;  4X3S A;  4O42 A;  4ZLT F;  1WTX A;  5T1G A;  2HUG A;  2NWG A;  5EKI A;  1ZXT A;  1RTN A;  3IFD A;  5D65 A;  2RVL A;  1WTR A;  2H1E A;  2L12 A;  2X69 A;  5D14 A;  1B2T A;  4X3K A;  3Q6S A;  2M2L A;  3QO2 A;  4HCS A;  1G91 A;  2B2V C;  4OIK A;  1WD1 A;  4X3U A;  3KUP A;  3I3C A;  4XDX A;  2K28 A;  2B2U A;  4QUC A;  2KED A;  1ICW A;  4ZKC B;  3R93 A;  1WTV A;  2DY7 A;  2K03 A;  3DEO A;  4QUF A;  1F9S A;  3ONA B;  5CBE E;  1DOM A;  1JIC A;  2MP1 A;  2B2Y A;  1XX8 A;  1CA5 A;  2B2T C;  2CVR A;  1BO0 A;  2XIW A;  1IKM A;  1E0B A;  1G6Z A;  1U4M A;  1TVX A;  1HFG A;  1MI2 A;  4IUR A;  1ML0 D;  1F2L A;  5CMD A;  1WTQ A;  2Q8T A;  1IL8 A;  1BF4 A;  2HCC A;  2N55 A;  1J8I A;  4IUU A;  1MSG A;  2X6G A;  3N52 A;  1CA6 A;  1DZ1 A;  2D9U A;  2B2W A;  1Q3L A;  4CJ0 B;  1EIH A;  2L11 A;  1GUW A;  1O7Z A;  1RTO A;  1X3P A;  1LV9 A;  3FPU B;  4HAE A;  1EQT A;  1S4Z A;  3FDT A;  4DN4 M;  4CJ1 B;  3UI2 A;  1C8C A;  3DEP A;  1HA6 A;  4MHE A;  1PLF A;  1HFN A;  2KVM A;  4HED A;  1RHP A;  1JE4 A;  4R8I A;  2X6L A;  1NR4 A;  2MJ8 A;  4IUP A;  2FJ2 A;  4XT3 B;  1U4P A;  1B4O A;  2N88 A;  2K01 A;  3H91 A;  1M8A A;  1MGS A;  3LWE A;  3MTS A;  5EPK A;  2MGS A;  1G2T A;  1PFM A;  1F9R A;  1RJT A;  2JP1 A;  2JYO A;  2KEE A;  1F9P A;  3GV6 A;  4NW2 A;  4RA8 A;  2DY8 A;  4ZKB B;  1KNE A;  1EOT A;  1SSO A;  2K04 A;  3G7L A;  5JJZ A;  3I8Z A;  1DON A;  1XYI A;  1QNK A; 
#chains in the Genus database with same CATH topology
 4NXN Q;  1EU3 A;  3IL8 A;  4BA1 I;  3MWY W;  1VQG A;  2DNC A;  3HOY G;  4LFB Q;  3A74 A;  1ZYR C;  3UE1 A;  1LTR D;  1TU2 B;  3S24 A;  4BY7 H;  2Y0S G;  4LF4 L;  3F2U A;  3PO3 B;  2A6H D;  3K0X A;  4A3B H;  3PUY A;  3TEH B;  2AUJ D;  2R7Z G;  4A3J H;  3MFY A;  2N8N A;  2L5T A;  4LNQ A;  3TN2 A;  2EQS A;  4K14 A;  1O78 A;  4YWL A;  3S1M H;  3T1Y L;  4A3L G;  2HDM A;  4A3I B;  4JV5 Q;  3NBH A;  3VDY A;  1AN8 A;  1C4Q A;  1IKL A;  4K6L A;  4XT1 B;  2F0U A;  1KQS A;  1YVC A;  2B63 G;  4G4K A;  2JQO A;  3V96 A;  5CC4 A;  3BZK A;  5FLX c;  3GTJ B;  1W2B A;  1BNZ A;  1GXD C;  2OQK A;  4BY1 H;  1SAP A;  2R7F A;  4JI8 L;  1XJV A;  3D0F A;  1EZ6 A;  1JJC B;  2WP8 J;  1N8R C;  1EY0 A;  4YWK A;  4NMZ A;  2JA8 G;  5C4X G;  2A69 C;  3CCU A;  3EQL C;  2MO1 A;  1C48 A;  1BOS A;  4HR7 B;  5HY6 A;  1ET9 A;  5K36 G;  2F3I A;  4GS3 A;  3MAQ A;  5A35 A;  3M3Y B;  3KLS X;  4OWT B;  5C44 B;  5C4H A;  3TP5 A;  1WD1 A;  5IYD G;  3STB D;  3UE0 A;  3PO3 G;  4IPC A;  1ONL A;  1GUO A;  1YNN C;  5LMN L;  5IY0 A;  1U0L A;  3KF6 A;  1XNQ L;  1XX8 A;  1N36 L;  1ZEQ X;  2DGY A;  1F2L A;  3K5O A;  3U9S A;  2JXM B;  3ERQ A;  1EEI D;  1CA6 A;  1EIH A;  2B2W A;  4JYA Q;  1D5M C;  3RN5 A;  3CP0 A;  1RTO A;  1MBY A;  5IGF A;  3GTG B;  1HFN A;  4X62 L;  2HIX A;  2SNM A;  3RR5 A;  3QOJ A;  4C1N I;  1B4O A;  1ICF B;  1PYB A;  3WOE A;  1GD7 A;  4LF7 Q;  1BBW A;  4KKU A;  4DAY A;  1HTP A;  1Q1B A;  1SYC A;  1SMY C;  3A0J A;  3NEN A;  4NW2 A;  4NPS A;  3U4V A;  5EAY A;  1KRS A;  4UP9 A;  2FMC A;  4C3J B;  2MQH A;  1VQB A;  4C2M B;  3MXN B;  3HOV G;  2Z0S A;  3H09 A;  1TXY A;  3FVQ A;  2B63 B;  2NTT A;  1HHV A;  3ND8 A;  1AEX A;  3X3M A;  1BUV T;  1K0R A;  3HEJ A;  4KY7 A;  1V9P A;  1YEZ A;  1A0I A;  3PUV A;  3M3Y H;  2OT2 A;  1SDF A;  1D8L A;  3AEV A;  4QJF A;  4QY7 A;  2NN6 H;  3A8K E;  4IUQ A;  2VUM G;  1YJ9 A;  2E8G A;  1D5Z C;  4GKK Q;  5JEA G;  4C56 C;  2K1B A;  4HSP A;  5FKA C;  5AJ3 Q;  4DV3 L;  3K5M A;  3CCV A;  3HFZ B;  4JV5 L;  5FLX L;  1SYG A;  3CMA A;  3NTH A;  3AYH B;  3JAM L;  2GA4 B;  1GKH A;  1YI2 A;  2PW5 A;  4R4C A;  1D1K A;  2R3Z A;  3P20 A;  4BWG B;  4B3M Q;  5JJL A;  3V2T A;  1LTS D;  1PH4 A;  4GLV B;  3PUX A;  3UDF A;  1G2S A;  1I5F A;  3SK6 A;  4A3G G;  4RWS C;  2JN4 A;  2RSN A;  1YJW A;  1SNP A;  4B3T Q;  3T1H L;  1N32 L;  2BOS A;  3OW2 A;  1NMG A;  4AH6 A;  1DOL A;  3PQI A;  2Z9H A;  4O0A A;  2HUG A;  2RVL A;  4BA2 I;  2UXB L;  4X3K A;  2QIL A;  3TS0 A;  5FO7 B;  2JA6 G;  2QDL A;  3FHW A;  4C3J H;  4BBS B;  4A3G H;  4WJW A;  3I72 A;  3TRZ A;  4DR3 L;  1O7I A;  1IBK L;  1Q8I A;  1CKN A;  1JWM D;  2BH8 A;  4DAM A;  4DK0 A;  2WAQ G;  4IPD A;  1TVX A;  1B9N A;  2UU9 Q;  3QJY A;  4EQP A;  5CV4 A;  2OTL A;  4BBR B;  1GUT A;  2QKI C;  1CI3 M;  2HT1 A;  1L0X B;  3SK5 A;  4A3C G;  1JB3 A;  1GUW A;  2CW0 C;  2K32 A;  2F0Q A;  3E5S A;  1LTG D;  3VYS A;  5D3D A;  2JJQ A;  1QJO A;  2QDB A;  4JI1 L;  4DR1 Q;  1IYV A;  2A74 C;  2RDH A;  4YCV A;  1S5C D;  2F0S A;  3RZD B;  4X62 Q;  2HD3 A;  4MZ9 A;  3SHL A;  3H91 A;  1M8A A;  5IT9 E;  1LO5 D;  2F0I A;  2JP1 A;  1LT4 D;  2ID0 A;  4LF6 L;  1XXG A;  4ZKB B;  1XMO L;  4AIM A;  1I6H H;  3E9I A;  5EPJ A;  3ICE A;  3GQB A;  3VYU A;  5M3F B;  2NZH A;  1TWF B;  1QB5 D;  1Q12 A;  5EKL A;  1QUQ A;  2F3W A;  5M5W H;  2M00 A;  3Q0A A;  3OYY A;  2EJF C;  3HP3 A;  4OWW B;  4A3E H;  2ZM6 Q;  4A3E B;  3BJU A;  4KTA A;  1JT8 A;  4B08 A;  1A2U A;  1B50 A;  1E24 A;  4CJ2 C;  4ZCK A;  4OGQ C;  1QZG A;  5FJ8 H;  1TS5 A;  3EN2 A;  1VMC A;  1AP0 A;  4A3L H;  4LF5 L;  3NQT A;  4FYD A;  2B8G A;  1SFO B;  2UUB Q;  1CKN B;  2EYL A;  2E2J H;  4IUN A;  2L15 A;  4G7H C;  3KF8 A;  1H9S A;  1VQ4 A;  3HG9 A;  1NTG A;  1WTP A;  4P71 A;  3ITP A;  2WB1 G;  3J81 i;  1WCM H;  3K8A A;  1SRU A;  1R4P B;  1K83 H;  3OMG A;  4RFB A;  1KDC A;  1ZXT A;  1RTN A;  3IFD A;  3ULJ A;  3S15 H;  3AQQ A;  2R61 A;  1TWH B;  4JI7 L;  2EXD A;  3QO2 A;  4X65 Q;  2EVB A;  1WOC A;  3A8J E;  3HZX A;  4P75 A;  4JI2 L;  4EX5 A;  1C7Y A;  4JOI A;  5JOB A;  3CHB D;  3DEO A;  1AE3 A;  1KDB A;  1VF7 A;  4C3I G;  2WV6 D;  1X3E A;  4DR7 L;  3CC7 A;  4DR3 Q;  2O5J C;  4KHZ A;  2JA5 G;  5M5W B;  1VQH A;  4JI0 L;  4KLK A;  2R92 H;  3CME A;  1TKW B;  2LY7 A;  2NUC A;  2PQE A;  1ENF A;  4DR5 Q;  4DNI A;  3S1Q H;  3MVV A;  2HCC A;  2VQF Q;  2CCZ A;  1RIP A;  4RGT A;  3J81 j;  4WRD A;  1PHJ A;  5IGD A;  1PYS B;  4KI0 A;  1KRT A;  1S4Z A;  4R8N A;  4A3I H;  1D1I A;  3GTG H;  1KLU D;  5CV9 A;  4M1U B;  1EWI A;  3SDZ A;  1B44 D;  2K4K A;  4JI1 Q;  3PUW A;  3CCS A;  3LNN A;  4WJ4 A;  1AW7 A;  4P74 A;  1ENC A;  3MTS A;  3FKI H;  4P72 A;  2IX1 A;  2JYO A;  2F3V A;  1Y8P B;  3PIO A;  5KIX A;  4UHV A;  2BH2 A;  4R4T A;  4C3H G;  1NBW A;  1Z9F A;  4RKL A;  4LF6 Q;  2JEA I;  1D2B A;  3U4Z A;  4NXM Q;  1PH1 A;  2VZA A;  5A2Q E;  1XPU A;  2EYM A;  2ZXP A;  4R9W A;  5EPL A;  1K3R A;  2TSS A;  1CQV A;  2VB2 X;  2FMM A;  3CXC A;  2D62 A;  5C44 H;  2ATW A;  3LWU A;  2DJG C;  4R4O A;  3OPO A;  4YCU A;  1NR2 A;  1JE5 A;  2DUD A;  1DCZ A;  1B53 A;  4LUZ A;  2IX0 A;  4H02 A;  1JMC A;  3HKZ B;  4KKS A;  3M4P A;  3C2P A;  1KNA A;  1KC8 C;  1WJJ A;  2TMP A;  1HH2 P;  5C3E H;  2MPM A;  1E1T A;  3SK8 A;  1BCP D;  1N33 L;  1FGU A;  3J7A V;  2JA9 A;  3MXG A;  2IL8 A;  3JAM c;  3ULP A;  2RCF A;  1PRT C;  1IXR A;  3P7J A;  2WKD A;  4NKL A;  1SE4 A;  3BZC A;  2E74 C;  3DWA A;  3BVM A;  3VYT A;  5M9O A;  1O7Y A;  1TS2 A;  4N8X 1;  2AQ2 B;  1PH2 A;  3KLR A;  3MEF A;  2L12 A;  3GTQ H;  1G91 A;  2A19 A;  3NWS A;  3W2D A;  1Y1V B;  4XDX A;  4QUC A;  2B2U A;  1ICW A;  3D4W A;  1U9R A;  4DV2 Q;  1G8Z D;  3J81 E;  4JI2 Q;  2ICI A;  1HNX Q;  5CBE E;  3TBI B;  1DOM A;  3ZYY X;  4NDX A;  4BY1 G;  4CBV A;  1B9M A;  2K5D A;  1HFG A;  3A56 A;  1YIT A;  2GVB A;  1TY2 A;  1TWH H;  5IOD A;  1BF4 A;  4JK1 C;  2N55 A;  1VQL A;  1PTO H;  4IUU A;  4G7Z C;  2IHE A;  4CJ0 B;  4N9P A;  5KRU A;  3IFT A;  4C3H B;  3K7A H;  3AFQ A;  4IFD G;  4F7X A;  2KVM A;  3S14 H;  2HHH L;  3UDX A;  2F0H A;  2UUC Q;  5C0X G;  1EIF A;  1HR0 L;  4LFA Q;  2EYF A;  2QEX A;  1PTO D;  1NE3 A;  4C1N K;  4GNX A;  1F77 A;  3D3R A;  3LX0 A;  3HOU H;  4HID A;  5IYB G;  1XYI A;  2E5L L;  5M3M H;  2R93 B;  1CZW A;  3NUC A;  3I55 A;  1JOQ A;  3T16 A;  1BCP F;  5C4J B;  2KCM A;  4CKE A;  2AUK A;  2D5D A;  4QIW E;  4IUT A;  1HA5 A;  3S16 H;  1F9Q A;  5CBA E;  2K7V A;  5K5P A;  3IKJ A;  1BR9 A;  1UAP A;  3Q24 A;  1FNU A;  2SDF A;  1K8G A;  1TWG B;  4Q5V A;  4A93 B;  2EYO A;  2OEO A;  4FF2 A;  2RF4 A;  4DV6 L;  1SR3 A;  5ELB A;  3W1G A;  5D3I B;  4X66 Q;  2HDL A;  1K8M A;  4FF3 A;  4R4I A;  2JEB I;  4OEM B;  4A3B B;  2XRS D;  3Q22 A;  2ZT9 C;  4DA2 A;  5KYL A;  4QQB X;  2AHO B;  1EL0 A;  3KBG A;  1LTT D;  3HOW B;  1D7Q A;  2B2T A;  1FNW A;  2I5L X;  4HJ7 A;  4K0K Q;  2JA7 G;  2F0O A;  3A5Z B;  1CSQ A;  3MXP A;  4HCE A;  2F0D A;  3NBI A;  3PF5 A;  3HOU G;  3TRE A;  2ALY B;  3I4O A;  4JI5 Q;  2E2I H;  2DJF C;  3M7G A;  4KHP L;  3U9O A;  1RCV D;  5LL6 X;  1E2Z A;  4C2M H;  1BBU A;  2F0T A;  5CGK A;  1A3U A;  4JI4 Q;  1ASY A;  4A3E G;  1AH9 A;  4FXK C;  2NVX B;  3HGB A;  3I2Z A;  5G3L D;  5CMD A;  4O1N A;  2J0T D;  1X54 A;  4V0B A;  1N36 Q;  4LFC L;  3DWQ A;  5KNC A;  5IWA L;  2AQ3 B;  5KGU A;  1DZ1 A;  1TQO A;  4KKT A;  1E1O A;  5I6W A;  4GKJ Q;  1UWV A;  1X65 A;  1WYD A;  2X6L A;  1UEB A;  3OMC A;  3KLW A;  5BN4 A;  3EA6 A;  1JOR A;  1EEF D;  3GV6 A;  2G5D A;  4AYB E;  3MC0 B;  4A3M H;  4UP8 A;  5DEH A;  2RHS B;  4PV1 C;  3ONA B;  3GTK H;  3K0Y A;  2KHJ A;  1A62 A;  2EJG C;  2J7Z A;  3QOL A;  1VQC A;  4F87 A;  2CH4 A;  1R9T H;  4JBM A;  5NUC A;  2KHI A;  5COR A;  4B3S L;  1HUM A;  4CGY B;  2C35 B;  5CV7 A;  3FEW X;  1OXS C;  5JVH 3;  5FLM G;  3BYY B;  5JEA J;  3MFG A;  5FOB B;  1SEB D;  4A3C H;  2UXC Q;  1CT1 D;  1PFB A;  2UXD Q;  2I46 A;  1EYG A;  2MO0 A;  1CKM A;  1E22 A;  1C9O A;  5AJ3 L;  1R4Q B;  2JA7 H;  4LUV A;  2JA5 B;  4WOR A;  3CCR A;  4KN7 C;  5IP7 G;  1EQR A;  3L9A X;  5IGE A;  4DV4 Q;  1AZQ A;  5C0X J;  1X6O A;  1EZ8 A;  4AQY Q;  1STH A;  2EPB A;  2E2H H;  2PZT A;  1SNO A;  3SXH A;  2A68 C;  4GN5 A;  3I90 A;  5EJW A;  1HRJ A;  2B3G A;  3D6W A;  4YWM A;  5BN3 A;  3GTM B;  4K6D A;  3W3A A;  3GTP B;  2NWG A;  2CH4 W;  3S2D H;  1M1K C;  3A7A B;  3GTQ B;  5BR8 L;  1EIY B;  4ME5 A;  1B2T A;  4QB4 A;  1TII D;  4DR4 Q;  2M2L A;  4X64 L;  2EY1 A;  4DV0 Q;  1T5X D;  1WI5 A;  2KED A;  1ESF A;  5C4X H;  1A3T A;  3I70 A;  3S1R B;  1UE7 A;  1RF2 D;  3MA2 B;  5I2Y A;  3OIP A;  2Z4I A;  3CC4 A;  3S2D B;  2F0K A;  2MP1 A;  1X56 A;  2B2Y A;  3D6C A;  2PYK A;  3NTK A;  2Z6K A;  2XIW A;  4RKB A;  3HKZ E;  1MI2 A;  2F0M A;  1UNS A;  1WTQ A;  3WWV A;  5FO8 B;  4XXE A;  1GOZ A;  4JBJ A;  5E3F A;  4LFC Q;  4A3K H;  3NWT A;  3S14 B;  2K5Q A;  4LF9 L;  1JE4 A;  4C3I H;  3RZO H;  1U4P A;  1LT5 D;  1MD2 D;  1A8V A;  1BQQ T;  1VQP A;  2ZTD A;  4DR1 L;  4DR6 Q;  1BCP B;  3RUZ A;  4BBR H;  4BY1 B;  4ALP A;  3I56 A;  1VQ9 A;  4FXG C;  4XQJ A;  1PFS A;  1ESR A;  3KYH C;  1G29 1;  4A4I A;  1PXU A;  4DR2 L;  1B3A A;  1PYW D;  1IBL Q;  1CSP A;  1KDA A;  5C4X B;  3TZU A;  4EVO A;  1VCI A;  1I4X A;  5E4W C;  3J7Y W;  1O80 A;  2F03 A;  5IP9 H;  4G7O C;  4CKC A;  3PF4 A;  3UDI A;  1VQM A;  3I73 A;  1XMQ L;  1SE8 A;  4GNX C;  1VQ6 A;  4OX9 L;  4IOC A;  1I6H B;  1PRT F;  3QWN A;  2RCN A;  3MZ5 A;  1UUP A;  1B8A A;  5IP9 G;  2N3S A;  1J5E Q;  1JC7 A;  2C5C A;  1S72 A;  1TWA H;  3CCL A;  3HOZ H;  3H6M A;  4A93 H;  1FYC A;  1KAB A;  3M4Q A;  5IT9 c;  4EQ5 A;  3BS1 A;  4LF5 Q;  1CQF A;  2KEC A;  3T56 B;  3H15 A;  3SR1 A;  2L4N A;  5DNF A;  3PGZ A;  1A15 A;  2AWO A;  2R93 G;  2R7D A;  4B9W A;  4DKA C;  1G51 A;  2O5I C;  4LWC A;  5ISR A;  2MFI A;  4S3S A;  3E0J A;  1GUN A;  3STB C;  3I4N H;  1L1O B;  2VXW A;  4IUV A;  3JC6 6;  5EKK A;  1YNN D;  2KJX A;  3HKS A;  1S5E D;  3JAM i;  2VQE L;  4BXX G;  2XGT A;  3Q6S A;  1XNR Q;  2KEN A;  1SNC A;  1IYU A;  4M8A A;  4R1J A;  1SYB A;  1EQV A;  3OOC A;  4DR4 L;  3S16 B;  3K7U C;  4DK1 A;  3I4L A;  1XNQ Q;  5H1S E;  4F8M A;  1PH7 A;  3RNU A;  5IE8 A;  1PH3 A;  1BO0 A;  1V1Q A;  1TS4 A;  1BCP C;  3NK9 A;  1I94 Q;  1MSG A;  1QVF A;  2YU9 H;  2D9U A;  3ERS X;  1CTM A;  4P73 A;  1LV9 A;  1KTK A;  3P1H A;  1SMY D;  4JI3 L;  2A73 B;  2EDG A;  1YNJ D;  1VQI A;  4XIG S;  3L7Z C;  4KV6 A;  2PW7 A;  3BDO A;  2OCE A;  1CFM A;  2YU9 B;  1Q86 C;  1STE A;  3LGJ A;  4DR6 L;  1CHP D;  4RG1 A;  3I8Z A;  1HCZ A;  4JBK A;  1A6X A;  2SOB A;  1WVL A;  2JA6 B;  3K5L A;  1CM9 A;  1ROD A;  1OXX K;  1HNW Q;  1U5K A;  1VMP A;  1GHJ A;  3OTO L;  3R3O A;  1K73 C;  4BBR G;  4XQQ A;  2PNH A;  3T4A C;  3HOU B;  2ES2 A;  4LFB L;  1VQK A;  2WIN B;  2EIF A;  1EIG A;  1HQR D;  3R2T A;  5M3M B;  1Y1V H;  5IGC A;  1EFW A;  4XQN A;  1VDZ A;  4OX9 Q;  4LUO A;  3TSS A;  4BBS G;  1VQD A;  2K5V A;  1EFI D;  3HRZ C;  4JBW A;  5IT9 L;  3T51 B;  4JI6 L;  3GD7 A;  4GLX A;  4K8J A;  5T1I A;  1KD1 C;  3RD4 A;  1EYD A;  3KDF B;  4FNF A;  3AU7 A;  1JOO A;  1N34 Q;  3RLN A;  2LXJ A;  3NBH B;  1FL0 A;  4MN3 A;  4B3T L;  2L9H A;  1TWG H;  1N32 Q;  3E0E A;  2Z6K C;  4ZUI A;  5C0X H;  1EY4 A;  2LFN A;  4YHH Q;  2EY6 A;  4CDD C;  4FXD A;  1V8Q A;  4IJH A;  2F0W A;  1VQ8 A;  1PZK D;  3S1N B;  2YYZ A;  2G9H D;  3VYR A;  4X3U A;  3DXJ C;  1VQN A;  2XWJ B;  4L5S A;  1SNQ A;  1WTV A;  2K03 A;  5M3F H;  5EBC A;  3NE5 B;  1JIC A;  2UU9 L;  2D0O A;  1CA5 A;  2BA0 A;  2VW9 A;  4A3F B;  2PMZ E;  1HNX L;  2ZTE A;  5CR3 A;  1DYQ A;  1IYJ B;  1UE5 A;  4PZ7 A;  1EYC A;  5JAV A;  2YTX A;  2F0E A;  1SYF A;  2L55 A;  1XWE A;  3FPU B;  4IFD I;  1K8O A;  1EY7 A;  4JYA L;  3DEP A;  1KLG D;  3KJP A;  4HED A;  5C4Z A;  4XT3 B;  1NUC A;  1B7Y B;  3VR3 A;  4QIW B;  3K6O A;  2HHH Q;  5I2X A;  5M5Y H;  2UUC L;  1K0S A;  1RL2 A;  2I5H A;  3KK7 A;  5KEE A;  4WJ3 M;  3KFU A;  3EIV A;  1PRT B;  3CQZ H;  4XTC S;  3CC2 A;  2RHQ B;  1SYE A;  1Q82 C;  2NN6 I;  3DUZ A;  2ENB A;  3SVM A;  2DNE A;  2KCC A;  3J7A 5;  5C3E G;  3S1R H;  2A6E C;  3FPP A;  4RAU C;  4LK1 C;  1XPR A;  2B29 A;  1QZH A;  4IPG A;  5FO9 B;  3OTO Q;  2Q8R E;  2L1B A;  4P2C B;  2EYH A;  2I07 B;  1TWC B;  1E2V A;  1NCV A;  4KK7 A;  2OTJ A;  4UY8 C;  4BY7 G;  2F4I A;  3C1E A;  2N78 A;  5GAD C;  2PQA B;  4C3J G;  1LT6 D;  4GKK L;  1SJH D;  1Y1W B;  3I4M H;  4K5X A;  2UUB L;  4DV5 L;  3PSI A;  1F2Y A;  4I7A A;  4C3I B;  4RMF A;  4DV3 Q;  2N49 A;  5G3L F;  3RLO A;  4JI6 Q;  2PMZ B;  2JA7 B;  4A3K B;  1T5E A;  1CK1 A;  1Q46 A;  3C46 A;  3J80 L;  2PI2 A;  2Z1C A;  4KD3 A;  4B3R L;  2EE1 A;  2BDN A;  4ZRZ A;  4OXP A;  1IBM L;  2XVS A;  3F2B A;  4O42 A;  4IFD H;  3QIA A;  2KHS A;  4YHH L;  4QF4 A;  4K0K L;  5D14 A;  4POF A;  3F2C A;  4PZ6 A;  2B2V C;  3FKI G;  3J81 L;  2O2L D;  4PZ8 A;  1TWC H;  3CCM A;  3L0O A;  1HPC A;  4YY3 Q;  3AFP A;  4A3M B;  1JQY D;  4A3D H;  4H7B A;  1ML0 D;  3PIO 3;  4DXF A;  1SNM A;  1I3Q B;  1STN A;  2JK8 A;  2RBM A;  4U67 3;  2X6G A;  4KY6 A;  1DD2 A;  2HQE A;  1JR0 D;  1HR0 W;  4QL5 A;  1X3P A;  3BU2 A;  4KJN A;  3D8G A;  4QCL A;  2A68 D;  5IYC G;  2WAQ B;  2F0F A;  5C3E B;  4GOP A;  2OF1 A;  3M85 A;  1G2T A;  1RDP D;  3HOY H;  1NY4 A;  4DNT B;  4A3G B;  1ASZ A;  1CHQ D;  1SBB B;  2Q2T A;  5M5X B;  4NXM L;  1MJE A;  1RKN A;  2V1C C;  4ZK9 B;  3NHH A;  1QE6 A;  4K5W A;  1ZYR D;  1FR3 A;  1HJP A;  2FHT A;  2WKC A;  4OO1 I;  5C4J H;  4YCW A;  4HSV A;  4LF4 Q;  1GUS A;  1STG A;  4CDC C;  4HIK A;  2ZXO A;  1V1O A;  3CQZ B;  5DLQ E;  3K5N A;  1L2F A;  5KNB A;  4DAP A;  1AZP A;  1WCM B;  3CCQ A;  5ELO A;  4U68 A;  2IT1 A;  2NVT B;  4GOP B;  2F0J A;  4PMC A;  3VR6 A;  2NVT H;  3D4R A;  3OW7 A;  4IJL A;  3KF8 B;  5C5M A;  3ER0 A;  2FFK B;  1PMR A;  5JPN C;  4L5T A;  1OXV A;  1LT3 D;  1SN8 A;  5L37 A;  3H3V C;  2XWB B;  3S1Q B;  4DV4 L;  2PZU A;  1Q81 C;  2E75 C;  1I4H A;  3S1M B;  1KIX A;  1PDQ A;  2K75 A;  1WTX A;  1A63 A;  3CW2 C;  3SEB A;  2MHV A;  2X69 A;  2E2D C;  4OON A;  4K2K A;  3HOZ G;  5CV8 A;  1EWC A;  3F8T A;  5ELD A;  1STY A;  1VQA A;  4HCS A;  4DF7 A;  3PIP A;  4DV2 L;  4OIK A;  5BR8 Q;  3D31 A;  5LMN Q;  2VY3 A;  2JSO A;  2XNA C;  4X64 Q;  2DY7 A;  1I4P A;  5C3X A;  2R93 H;  4QUF A;  1QWY A;  2IY5 B;  4JW0 A;  3CKI B;  2QW7 A;  3H3V I;  1HZB A;  1Q1E A;  1Q90 A;  4IUR A;  4YY3 L;  5EBD A;  4A93 G;  1LTL A;  3M4O H;  3HOV B;  1MHW C;  1SE2 A;  2RDG A;  4KN4 C;  1NMF A;  4IOA A;  2L11 A;  1F2Z A;  1NSN S;  1O7Z A;  1EQT A;  4IFD J;  2PPB C;  2VNU D;  1HZA A;  4C3H H;  3HOX H;  5ELC A;  2IX3 A;  1YIJ A;  1YJN A;  2N88 A;  4LF9 Q;  5EPK A;  4LAA A;  1E3P A;  4POG A;  1VQE A;  5HUR A;  2E5L Q;  4RA8 A;  4ULL A;  5DM7 3;  4GN3 B;  3Q23 A;  2FXQ A;  1Y8O B;  4HIO A;  1KHI A;  4A3F G;  4NXN L;  3I4M G;  1D5X C;  5FJ8 G;  4F88 A;  3GV3 A;  2XSC A;  1H9J A;  2R92 G;  3MXN A;  4IAL A;  4KHV A;  3C1F A;  5EQ0 A;  5J39 A;  3KDF A;  2E2I B;  4ZUJ A;  4HTH A;  1YNX A;  4X6A H;  1Z7T A;  4H0L C;  4UAI A;  3J80 i;  1K8A C;  3GO5 A;  3PUZ A;  3S17 H;  4A3D G;  3S9W A;  2F0L A;  5ELN A;  3W5O A;  4X66 L;  5E4X A;  4FO2 A;  1QOH A;  2JA5 H;  4GZY C;  2BE5 D;  4RCO A;  3J7A F;  3GTO B;  1ILQ A;  1N33 Q;  1CUK A;  4RGM A;  3DM3 A;  1PRT D;  2EY5 A;  2Z8L A;  3ERO A;  2BCO A;  3J80 c;  5BN5 A;  2ICE C;  3NQI A;  3EVQ A;  3K7A B;  1X3Q A;  2KCT A;  1MJC A;  1QCB D;  4J6H A;  5IGG A;  3HKZ G;  2UXB Q;  1YZ6 A;  3OHX C;  5EKI A;  4JC0 A;  5C0X I;  3DHQ A;  4HN7 A;  5JJI A;  4L8J A;  4HMI A;  2AWN A;  3RLF A;  3CCE A;  4MIU A;  3OIQ A;  1Q7Y C;  4ZKC B;  1FVI A;  2CQA A;  4AYB G;  1IBK Q;  1K3B C;  1ZKO A;  4JI4 L;  1Z47 A;  4CKB A;  4FP5 D;  3H0G G;  1E0B A;  1LUZ A;  1T9H A;  4HMJ A;  4L63 B;  4O2D A;  3R8B A;  3BDC A;  1Y14 B;  2GN5 A;  2CW0 D;  5DAU A;  2EZV A;  1Q3L A;  4DN4 M;  5I6Y A;  2WFW A;  3I4M B;  2LKV A;  4MTN A;  5LHY 1;  2NVY H;  1FJG Q;  2MJ8 A;  4IUP A;  5M3F G;  3VR5 A;  1VQ5 A;  1Y1W G;  2F0P A;  1LTB D;  5IYD H;  1QNU A;  2MGS A;  1PFM A;  1VF5 C;  4L6T B;  1NJI C;  5FLX E;  1H9S B;  4LFA L;  4LF7 L;  2JA8 B;  1M4V A;  1EOT A;  1PTO C;  3RN2 A;  3K57 A;  5C3W A;  1MKH A;  1QNK A;  2JE6 I;  2IWH A;  2B2U C;  3WOF A;  5I4D A;  3MXU A;  3I91 A;  2EYP A;  2NZ1 D;  2ZM6 L;  2B39 A;  2IW3 A;  2K14 A;  1UEA B;  2EJM A;  3S15 B;  5IYC H;  1VQF A;  2ASB A;  1LLR D;  4N8F A;  4CDE C;  2WB1 B;  4XYO A;  2NYZ D;  2KOL A;  3RZD H;  5C44 G;  2HQL A;  5JPM C;  3HOW H;  3S1N H;  1B1Z A;  2UXD L;  3BYT B;  1OXT A;  5FK9 C;  4LF8 Q;  5F2D A;  4QGU A;  3X3N A;  2XN9 C;  4EQN A;  3OSO A;  1DM0 B;  1PA6 A;  1W6K A;  1J6Q A;  3SE0 A;  3KJO A;  3GTJ H;  4J1M A;  1MSH A;  2YTY A;  4DPG A;  3F1Z A;  3WDN A;  2NTS A;  4DGZ A;  1HNZ Q;  3KBX A;  2B2W C;  1N34 L;  1KAA A;  4TRD A;  2OQ0 A;  3HS0 C;  3M9B A;  4AYB B;  3BDL A;  4E6I A;  5CV6 A;  4HIM A;  1KL9 A;  4DV0 L;  3KOJ A;  5C5L A;  4Z9C B;  2NVQ H;  5M5X H;  3VR2 A;  4G57 A;  4RCN A;  1X3G A;  2M9V A;  2RKS A;  2UUA Q;  2A5H A;  1Q8K A;  3HOW G;  1X55 A;  4OWX B;  1GJX A;  3NTI A;  2E2H B;  4LW1 A;  2OXP A;  1B70 B;  1I4G A;  4ODG A;  5IOC A;  4KHP Q;  3U50 C;  4ZQ3 A;  4DR5 L;  3GP7 A;  4V19 0;  1S5D D;  3EJI A;  4I7Z C;  5J1Z A;  3VA5 A;  2ZTC A;  3PO2 H;  1SLJ A;  5IWA Q;  4Y7N H;  4CJ1 B;  1PLF A;  2A69 D;  1RHP A;  1OTC A;  2EYJ A;  1BKB A;  5LL6 S;  1A2T A;  5GAG C;  2K50 A;  5TSS A;  1W6J A;  3K58 A;  2F0V A;  5GQO A;  2RQX A;  5EGT A;  1FJG L;  4YIJ A;  2AQ1 B;  4DNR B;  1F9P A;  1KNE A;  3G7L A;  2F0N A;  1LTI D;  3A55 A;  4DK6 C;  1I50 H;  1XMO Q;  2R7Z B;  1WTW A;  2B2Y C;  1LM0 A;  2B63 H;  4PMB A;  1BBX C;  3G4S A;  5ELE A;  3ULL A;  3A54 A;  1QG7 A;  2IJ0 A;  2P5Z X;  1W3S A;  4JVZ A;  5COY A;  2EOT A;  2KBN A;  2R7Z H;  1UE6 A;  4ZYS A;  1SXT A;  2RA4 A;  1EWH A;  3NEM A;  4UP7 A;  3H3V H;  5E1F A;  2AKW B;  1IW7 C;  2QF7 A;  1HUN A;  1B3Q A;  2K5N A;  3TZD A;  2GVA A;  3PV0 A;  3DMU A;  1PZJ D;  1WTO A;  1EY9 A;  3HOX B;  2NZO A;  1K83 B;  2R6G A;  3ND9 A;  2DN8 A;  1YHA A;  3B6Y A;  4IQZ A;  3PO3 H;  1DOK A;  4L5Q A;  1PFN A;  2WAQ E;  2A1A A;  3G48 A;  1I4Q A;  1U4R A;  1CZG A;  2NBF A;  4B3R Q;  4FDB A;  4A3K G;  1PTO B;  3DLL A;  1ENA A;  1IBM Q;  1WTR A;  2I0Q A;  2H1E A;  1Y8N B;  2BA1 A;  2B8F A;  2D2C C;  4HJ8 A;  4NB3 A;  3AB9 A;  4X65 L;  3FMC A;  1PH9 A;  3CPF A;  4DFA A;  1F9S A;  3CPW A;  2A6E D;  1H9R A;  2UUA L;  4FF4 A;  2Q2H A;  2Z4H A;  2Q2I A;  4CDF C;  5LMU L;  3EFX D;  5JJK A;  3L3O C;  4DR7 Q;  3E6Z X;  3M7N A;  2F1M A;  1A3V A;  2IPK D;  3CD6 A;  1SFO H;  2MNA A;  2LSS A;  3FKI B;  3K59 A;  2F0G A;  3A5U A;  1P8L A;  1FNV A;  1TY0 A;  4I65 A;  4HAE A;  3HOV H;  3FDT A;  5M3M G;  3UI2 A;  3TS2 A;  2NVY B;  4A3B G;  1HR0 Q;  4R8I A;  1HXY D;  3D4D A;  4IO9 A;  1VQJ A;  3E9H A;  4LJZ C;  1H9M A;  1TWA B;  3F2D A;  1EU4 A;  1F9R A;  1RJT A;  2KEE A;  3I7F A;  4A3D B;  1HQM C;  2HIV A;  1P16 A;  3P75 A;  3TQY A;  1EY6 A;  1I4R A;  3AMU A;  1HNW L;  1L1O C;  1QVC A;  1JJG A;  1GVP A;  1DXM A;  1N9W A;  3E3X A;  2H5X A;  4RHR A;  3NP8 A;  4DR2 Q;  4L5R C;  3H94 A;  1SRO A;  2PNR C;  2KUM A;  2ZJR A;  1STB A;  1X32 A;  1QVG A;  5GAH C;  4GOP C;  2BDO A;  1XMQ Q;  2QA4 A;  4Y52 H;  5A2Q L;  4OIJ A;  3CCJ A;  3I4N B;  4DU9 A;  1TS3 A;  2HCI A;  2IHF A;  4OL7 A;  4IN3 A;  1ILP A;  1LAB A;  4DV6 Q;  3CF5 A;  2K5W A;  1J5E L;  4PQX A;  1O7L A;  4B3M L;  4TSS A;  1D6E C;  5FLM H;  1IL2 A;  5IYB H;  1SND A;  3JAM E;  1K28 A;  4H13 C;  1U4L A;  4KJO A;  2CKZ B;  2LMC B;  3T1H Q;  5HGQ A;  1WTH A;  3CU7 A;  5ELF A;  1MIU A;  2RSO A;  3A8I E;  1S5B D;  4X3S A;  5T1G A;  1LYL A;  2VL6 A;  3M4Y A;  2C9O A;  4BY7 B;  2L0C A;  3DWP A;  1PH6 A;  4JOI C;  2Y0S B;  3I3C A;  3NSW A;  1XNR L;  4PG3 A;  3S2H H;  4J15 A;  3J81 c;  1WFQ A;  3QR8 A;  2F4V Q;  1PZI D;  2CVR A;  2QEJ C;  1RD9 D;  3SK4 A;  5KND A;  3U58 A;  1BDO A;  3TP7 A;  5LMU Q;  2Q8T A;  5IIF A;  1J8I A;  5E7N A;  2JA6 H;  1QIL A;  4APV A;  2J4X A;  1I94 L;  4K8I A;  3GTK B;  3KLS A;  4JCV E;  3PCO B;  1G6P A;  1GUG A;  2I5M X;  4NP5 A;  1C8C A;  4DUY Q;  4TQU S;  4JI3 Q;  2VS1 A;  4K5V A;  4EGV A;  1YNJ C;  3S17 B;  2K01 A;  4WFN 3;  4MNO A;  1C0A A;  1X9N A;  4GN4 B;  1MGS A;  1V1P A;  1JCK B;  2CHB D;  1IHZ A;  3M4O B;  3QB3 A;  1SSO A;  4BXX H;  2K04 A;  4XYQ A;  3TDQ A;  3BVZ A;  5J3B A;  4EQO A;  1GM5 A;  5GAE C;  3URY A;  2K05 A;  5KYI A;  4RH6 A;  3I4N G;  3PO2 G;  4A3M G;  2NVX H;  3S2H B;  3EBE A;  4PNY A;  3W1B A;  4ABN A;  2RDF A;  3GDE A;  1II3 A;  4PMW A;  2NVQ B;  2JA8 H;  2B2V A;  4IPH A;  2WB1 E;  1FD7 D;  1Y1V G;  5I9O A;  1CKO A;  3DM1 A;  2K52 A;  4FF1 A;  3RMH A;  1VQ7 A;  4CHT B;  2LXK A;  3T13 A;  2A8V A;  1S5F D;  1WD0 A;  2UXC L;  4FVM A;  1VS0 A;  5M5Y B;  4A75 A;  2CWA A;  4ILW A;  1BXT A;  4KY5 A;  1JWU D;  4QMG A;  2Q2U A;  3MHB A;  1PTO F;  3N6R A;  1V43 A;  2O4X A;  4Y7N B;  1K9M C;  4ME3 A;  3UDG A;  2CWP A;  1EUJ A;  1XPO A;  1J9O A;  1NAP A;  4DAY B;  1PV4 A;  2Q8I B;  1UE1 A;  2Y0S E;  1LAC A;  4DV7 Q;  3NXW A;  1E7Z A;  3NEL A;  4A3F H;  3FRP B;  1YBY A;  4ZLT F;  5LMN W;  4JI7 Q;  1AFP A;  2VB3 X;  2WAC A;  1OXU A;  4RGN A;  3H0G B;  4DUZ L;  2VUM B;  4A76 A;  1DJR D;  1I6V C;  2Z6B A;  3IRB A;  5DM6 3;  3KUP A;  1LTA D;  2V4D A;  4DK3 C;  2K28 A;  3O13 A;  3V05 A;  4OO1 H;  2PI2 E;  1BVS A;  4IZ8 A;  4JI5 L;  1H9K A;  3HOX G;  5IP7 H;  2NN6 G;  4JI0 Q;  5GRO A;  2VUM H;  1PVO A;  2PO4 A;  2A6H C;  3ZJY C;  4TVA B;  1IKM A;  3FP9 A;  3T53 B;  2PZW A;  2F4V L;  2VQF L;  2KQ3 A;  1PH8 A;  1IL8 A;  4HJ5 A;  2K5H A;  4DV1 L;  1KXL A;  3GTP H;  1X3F A;  4KD4 A;  2LS0 1;  3MEH A;  3SGI A;  1M90 C;  3OWE B;  3PO2 B;  2CQO A;  2G9D A;  4MHE A;  2AMC B;  1GHK A;  4HJ9 A;  4GKJ L;  1NR4 A;  1JB7 A;  1XTD A;  3VA7 A;  1WCM G;  1HZC A;  4DUY L;  1L0Y B;  3HOZ B;  2CFM A;  3BZD B;  2BE5 C;  3Q8D A;  1Y1W H;  2H4O A;  3R2I A;  1I3Q H;  1VQO A;  1Y69 U;  1JJ2 A;  1EQQ A;  4HJA A;  2QCP X;  1F2M A;  1STA A;  1GO3 E;  4A3J B;  1IBL L;  3CRL C;  4KMU C;  4GLA C;  1TWF H;  3G6E A;  4ZAI A;  3K80 C;  3OWF A;  4R4Q A;  3IAY A;  2EY2 A;  4K2L A;  2F52 A;  3CRK C;  2FIN B;  3H0G H;  2PCF B;  4BS9 A;  2YTV A;  3J7Z C;  4B3S Q;  3KF6 B;  1EOV A;  1HTL D;  1YHB A;  4Q0F A;  3T1Y Q;  1Z6H A;  3PIP 3;  3C3L A;  4UPA A;  3K81 C;  3A7L A;  1L1O A;  3G71 A;  3L2P A;  2ZJQ A;  1OO9 B;  1IZ6 A;  2OWO A;  4H44 C;  4LMQ D;  3GTM H;  5C6A A;  1EYA A;  1S3O A;  4LF8 L;  2XTI A;  3GTL H;  4JI8 Q;  4J8Q A;  1DGS A;  2E2J B;  4DV5 Q;  5AFW A;  3TP6 A;  3GTO H;  4X3T A;  1HZ9 A;  5K36 H;  2K33 A;  2XRQ D;  1SE3 A;  1KAW A;  5JVG 3;  1SJE D;  4OEL B;  1ET6 A;  4ID6 A;  4AQY L;  1SMX A;  1HNZ L;  1FGB D;  1JOK A;  2KA7 A;  2KCN A;  1R9T B;  2VQE Q;  4A3I G;  4DV7 L;  4DXG A;  4RGO S;  5D65 A;  3CAM A;  1SYD A;  1QUQ B;  2QGQ A;  3BVG A;  4DUZ Q;  1EY8 A;  1XTC D;  2K6A A;  2R92 B;  1YHQ A;  4BBS H;  3TP8 A;  3R93 A;  5JEA H;  4B9X A;  3HOY B;  2MUY A;  2YV5 A;  1I50 B;  1IW7 D;  4OHJ A;  4JPB W;  1TR5 A;  4RHS A;  2B2T C;  1G6Z A;  5J22 A;  4GNX B;  1U4M A;  1V1P B;  4OO1 G;  3QG1 A;  3PMF A;  2EXZ A;  3N52 A;  2E76 C;  2ZJP A;  1TT2 A;  4JG2 A;  2WII B;  5HGT A;  4DAV A;  1EY5 A;  4DV1 Q;  1L0W A;  5CYU A;  3J80 E;  1NNX A;  3BG3 A;  3NPP A;  4UDU C;  1PH5 A;  3RZO B;  4A3J G;  1HA6 A;  1AE2 A;  1H95 A;  3G6J B;  2SEB D;  1JWS D;  2NB0 A;  4N9T A;  5IGB A;  2ZXR A;  2FJ2 A;  4MTK A;  3GTL B;  4TKO B;  3LWE A;  3VR4 A;  2D0P A;  1S40 A;  1E2W A;  2DY8 A;  2PQA A;  2SNS A;  5JJZ A;  5CV5 A;  3TME A;  5I9P A;  1DON A; 
#chains in the Genus database with same CATH homology
 1EU3 A;  3IL8 A;  4BA1 I;  3MWY W;  2DNC A;  1ZYR C;  1LTR D;  1TU2 B;  3F2U A;  3PO3 B;  2A6H D;  3PUY A;  2AUJ D;  3MFY A;  2L5T A;  3TN2 A;  4K14 A;  1O78 A;  2HDM A;  4A3I B;  3NBH A;  1AN8 A;  1C4Q A;  1IKL A;  4K6L A;  4XT1 B;  2F0U A;  4G4K A;  3V96 A;  5CC4 A;  3GTJ B;  1BNZ A;  1GXD C;  1SAP A;  1EZ6 A;  2WP8 J;  1EY0 A;  4NMZ A;  2A69 C;  3EQL C;  1C48 A;  1BOS A;  4HR7 B;  1ET9 A;  5K36 G;  3MAQ A;  5A35 A;  3M3Y B;  3KLS X;  5C44 B;  5C4H A;  3TP5 A;  1WD1 A;  1ONL A;  1GUO A;  1YNN C;  1XX8 A;  1ZEQ X;  1F2L A;  3U9S A;  3K5O A;  2JXM B;  3ERQ A;  1EEI D;  1CA6 A;  1EIH A;  2B2W A;  1D5M C;  1RTO A;  1MBY A;  5IGF A;  3GTG B;  1HFN A;  2SNM A;  3QOJ A;  4C1N I;  1B4O A;  3WOE A;  4KKU A;  4DAY A;  1HTP A;  1SYC A;  1Q1B A;  1SMY C;  4NW2 A;  4C3J B;  2FMC A;  4C2M B;  3H09 A;  3FVQ A;  2B63 B;  2NTT A;  1HHV A;  3ND8 A;  1AEX A;  3X3M A;  1BUV T;  3HEJ A;  4KY7 A;  3PUV A;  2OT2 A;  1SDF A;  2NN6 H;  3A8K E;  4IUQ A;  1D5Z C;  5JEA G;  4C56 C;  2K1B A;  4HSP A;  5FKA C;  3K5M A;  5FLX L;  1SYG A;  3NTH A;  3JAM L;  2GA4 B;  2PW5 A;  1D1K A;  2R3Z A;  3P20 A;  4BWG B;  3V2T A;  1LTS D;  3PUX A;  1G2S A;  3SK6 A;  4RWS C;  2RSN A;  1SNP A;  2BOS A;  1DOL A;  2HUG A;  2RVL A;  4BA2 I;  4X3K A;  2QIL A;  5FO7 B;  4BBS B;  4WJW A;  3I72 A;  1Q8I A;  1JWM D;  4DK0 A;  1TVX A;  1B9N A;  3QJY A;  4EQP A;  5CV4 A;  4BBR B;  1GUT A;  2QKI C;  1CI3 M;  1L0X B;  3SK5 A;  1JB3 A;  1GUW A;  2CW0 C;  2K32 A;  2F0Q A;  3E5S A;  1LTG D;  3VYS A;  5D3D A;  1QJO A;  2QDB A;  1IYV A;  2A74 C;  2RDH A;  1S5C D;  2F0S A;  3RZD B;  3SHL A;  3H91 A;  1M8A A;  5IT9 E;  1LO5 D;  2F0I A;  2JP1 A;  1LT4 D;  2ID0 A;  1XXG A;  4ZKB B;  5EPJ A;  3GQB A;  3VYU A;  5M3F B;  1TWF B;  1QB5 D;  1Q12 A;  5EKL A;  2F3W A;  2M00 A;  3Q0A A;  2EJF C;  3HP3 A;  4A3E B;  4KTA A;  4B08 A;  1A2U A;  1B50 A;  4CJ2 C;  4OGQ C;  1TS5 A;  1VMC A;  1AP0 A;  3NQT A;  4FYD A;  2B8G A;  1SFO B;  2EYL A;  4IUN A;  4G7H C;  3KF8 A;  1H9S A;  3HG9 A;  1WTP A;  3ITP A;  1R4P B;  3OMG A;  4RFB A;  1KDC A;  1ZXT A;  1RTN A;  3IFD A;  2R61 A;  1TWH B;  3QO2 A;  2EVB A;  3A8J E;  3HZX A;  5JOB A;  3CHB D;  3DEO A;  1KDB A;  1VF7 A;  4C3I G;  2WV6 D;  2O5J C;  4KHZ A;  5M5W B;  1TKW B;  2LY7 A;  2NUC A;  2PQE A;  1ENF A;  3MVV A;  2HCC A;  4RGT A;  4WRD A;  5IGD A;  4KI0 A;  1S4Z A;  4R8N A;  1D1I A;  1KLU D;  5CV9 A;  4M1U B;  3SDZ A;  1B44 D;  3PUW A;  3LNN A;  1AW7 A;  1ENC A;  3MTS A;  2IX1 A;  2JYO A;  2F3V A;  1Y8P B;  5KIX A;  4C3H G;  4RKL A;  2JEA I;  1D2B A;  5A2Q E;  2EYM A;  2ZXP A;  4R9W A;  5EPL A;  2TSS A;  1CQV A;  2VB2 X;  2FMM A;  2D62 A;  3LWU A;  3OPO A;  1NR2 A;  1DCZ A;  1B53 A;  2IX0 A;  3HKZ B;  4KKS A;  3C2P A;  1KNA A;  2TMP A;  2MPM A;  3SK8 A;  1BCP D;  3J7A V;  3MXG A;  2IL8 A;  1PRT C;  3P7J A;  2WKD A;  4NKL A;  1SE4 A;  2E74 C;  3DWA A;  3BVM A;  3VYT A;  5M9O A;  1O7Y A;  1TS2 A;  2AQ2 B;  3KLR A;  2L12 A;  1G91 A;  3NWS A;  3W2D A;  1Y1V B;  4XDX A;  4QUC A;  2B2U A;  1ICW A;  3D4W A;  1U9R A;  1G8Z D;  3J81 E;  2ICI A;  5CBE E;  3TBI B;  1DOM A;  3ZYY X;  4NDX A;  4CBV A;  1B9M A;  2K5D A;  1HFG A;  3A56 A;  1TY2 A;  5IOD A;  1BF4 A;  4JK1 C;  2N55 A;  1PTO H;  4IUU A;  4G7Z C;  4CJ0 B;  4N9P A;  5KRU A;  3IFT A;  4C3H B;  4IFD G;  4F7X A;  2KVM A;  2F0H A;  5C0X G;  2EYF A;  1PTO D;  4C1N K;  1F77 A;  3D3R A;  3LX0 A;  1XYI A;  2R93 B;  1CZW A;  3NUC A;  1JOQ A;  3T16 A;  1BCP F;  5C4J B;  4CKE A;  2AUK A;  2D5D A;  4IUT A;  1HA5 A;  1F9Q A;  5CBA E;  2K7V A;  5K5P A;  3IKJ A;  1BR9 A;  1UAP A;  3Q24 A;  1FNU A;  2SDF A;  1TWG B;  4Q5V A;  4A93 B;  2EYO A;  2OEO A;  4FF2 A;  5ELB A;  5D3I B;  2HDL A;  1K8M A;  4FF3 A;  2JEB I;  4A3B B;  2XRS D;  3Q22 A;  2ZT9 C;  4DA2 A;  5KYL A;  1EL0 A;  3KBG A;  1LTT D;  3HOW B;  2B2T A;  1FNW A;  2F0O A;  3MXP A;  4HCE A;  2F0D A;  3NBI A;  3M7G A;  3U9O A;  1RCV D;  5LL6 X;  1E2Z A;  2F0T A;  5CGK A;  1A3U A;  4FXK C;  2NVX B;  3HGB A;  5G3L D;  5CMD A;  4O1N A;  2J0T D;  4V0B A;  3DWQ A;  5KNC A;  2AQ3 B;  5KGU A;  1DZ1 A;  1TQO A;  4KKT A;  5I6W A;  2X6L A;  3OMC A;  5BN4 A;  3EA6 A;  1JOR A;  1EEF D;  3GV6 A;  3MC0 B;  5DEH A;  4PV1 C;  3ONA B;  3K0Y A;  2EJG C;  2J7Z A;  3QOL A;  4F87 A;  5NUC A;  5COR A;  1HUM A;  4CGY B;  5CV7 A;  3FEW X;  1OXS C;  5JVH 3;  3BYY B;  5JEA J;  3MFG A;  5FOB B;  1SEB D;  1CT1 D;  1PFB A;  2I46 A;  1R4Q B;  2JA5 B;  4WOR A;  4KN7 C;  3L9A X;  5IGE A;  1AZQ A;  5C0X J;  1EZ8 A;  1STH A;  2EPB A;  2PZT A;  1SNO A;  3SXH A;  2A68 C;  5EJW A;  3I90 A;  1HRJ A;  3D6W A;  5BN3 A;  3GTM B;  4K6D A;  3W3A A;  3GTP B;  2NWG A;  3A7A B;  3GTQ B;  1B2T A;  4ME5 A;  4QB4 A;  1TII D;  2M2L A;  2EY1 A;  1T5X D;  2KED A;  1ESF A;  1A3T A;  3I70 A;  3S1R B;  1RF2 D;  3MA2 B;  5I2Y A;  3OIP A;  2Z4I A;  3S2D B;  2F0K A;  2MP1 A;  2B2Y A;  2PYK A;  3D6C A;  3NTK A;  2XIW A;  4RKB A;  1MI2 A;  2F0M A;  1UNS A;  1WTQ A;  5FO8 B;  4XXE A;  1GOZ A;  5E3F A;  3NWT A;  3S14 B;  2K5Q A;  1JE4 A;  1U4P A;  1LT5 D;  1MD2 D;  1BQQ T;  1BCP B;  3RUZ A;  4BY1 B;  4FXG C;  4XQJ A;  1ESR A;  1G29 1;  1PXU A;  1B3A A;  1PYW D;  1KDA A;  5C4X B;  3TZU A;  4EVO A;  1VCI A;  1I4X A;  5E4W C;  3J7Y W;  1O80 A;  2F03 A;  4G7O C;  4CKC A;  3I73 A;  1I6H B;  1PRT F;  3QWN A;  3MZ5 A;  1UUP A;  1JC7 A;  2C5C A;  3H6M A;  1FYC A;  1KAB A;  3BS1 A;  1CQF A;  2KEC A;  3T56 B;  3SR1 A;  2L4N A;  5DNF A;  1A15 A;  2AWO A;  4B9W A;  2O5I C;  5ISR A;  4S3S A;  3E0J A;  1GUN A;  2VXW A;  4IUV A;  5EKK A;  1YNN D;  2KJX A;  1S5E D;  3Q6S A;  1SNC A;  1IYU A;  4M8A A;  1SYB A;  1EQV A;  3OOC A;  3S16 B;  4DK1 A;  3I4L A;  4F8M A;  1BO0 A;  1TS4 A;  1BCP C;  3NK9 A;  1MSG A;  2D9U A;  1CTM A;  1LV9 A;  1KTK A;  3P1H A;  1SMY D;  2A73 B;  2EDG A;  1YNJ D;  4XIG S;  3L7Z C;  4KV6 A;  2PW7 A;  3BDO A;  1CFM A;  2YU9 B;  1STE A;  1CHP D;  3I8Z A;  1HCZ A;  1A6X A;  2SOB A;  1WVL A;  2JA6 B;  3K5L A;  1CM9 A;  1ROD A;  1OXX K;  1VMP A;  1GHJ A;  3R3O A;  4XQQ A;  3T4A C;  3HOU B;  2WIN B;  1EIG A;  1HQR D;  3R2T A;  5M3M B;  5IGC A;  4XQN A;  1VDZ A;  3TSS A;  1EFI D;  3HRZ C;  4JBW A;  5IT9 L;  3T51 B;  3GD7 A;  4K8J A;  5T1I A;  3RD4 A;  1EYD A;  4FNF A;  3AU7 A;  1JOO A;  4MN3 A;  2L9H A;  4ZUI A;  5C0X H;  1EY4 A;  2LFN A;  2EY6 A;  4FXD A;  1V8Q A;  2F0W A;  1PZK D;  3S1N B;  2YYZ A;  2G9H D;  3VYR A;  4X3U A;  3DXJ C;  2XWJ B;  1SNQ A;  1WTV A;  2K03 A;  5EBC A;  3NE5 B;  1JIC A;  1CA5 A;  2BA0 A;  4A3F B;  5CR3 A;  1DYQ A;  1EYC A;  5JAV A;  2F0E A;  1SYF A;  2L55 A;  1XWE A;  3FPU B;  4IFD I;  1K8O A;  1EY7 A;  3DEP A;  1KLG D;  4HED A;  5C4Z A;  4XT3 B;  1NUC A;  3VR3 A;  4QIW B;  3K6O A;  5I2X A;  3KK7 A;  5KEE A;  4XTC S;  1PRT B;  1SYE A;  2NN6 I;  3DUZ A;  2ENB A;  3SVM A;  2DNE A;  2KCC A;  2A6E C;  3FPP A;  4RAU C;  4LK1 C;  5FO9 B;  2Q8R E;  2L1B A;  4P2C B;  2EYH A;  2I07 B;  1TWC B;  1E2V A;  1NCV A;  4KK7 A;  2F4I A;  3C1E A;  4C3J G;  1LT6 D;  1SJH D;  1Y1W B;  4K5X A;  1F2Y A;  4C3I B;  5G3L F;  2PMZ B;  2JA7 B;  4A3K B;  1T5E A;  1CK1 A;  3C46 A;  3J80 L;  2Z1C A;  4KD3 A;  2EE1 A;  2BDN A;  4ZRZ A;  2XVS A;  4O42 A;  4IFD H;  3QIA A;  2KHS A;  4QF4 A;  5D14 A;  2B2V C;  3J81 L;  2O2L D;  1HPC A;  4A3M B;  1JQY D;  4H7B A;  1ML0 D;  3PIO 3;  4DXF A;  1SNM A;  1I3Q B;  1STN A;  2RBM A;  4U67 3;  2X6G A;  4KY6 A;  1DD2 A;  2HQE A;  1JR0 D;  1X3P A;  4KJN A;  3D8G A;  4QCL A;  2A68 D;  2WAQ B;  2F0F A;  5C3E B;  2OF1 A;  3M85 A;  1G2T A;  1RDP D;  4DNT B;  4A3G B;  1SBB B;  1CHQ D;  5M5X B;  1RKN A;  4ZK9 B;  3NHH A;  1QE6 A;  4K5W A;  1ZYR D;  1FR3 A;  2FHT A;  2WKC A;  4OO1 I;  4HSV A;  1GUS A;  1STG A;  2ZXO A;  1V1O A;  3CQZ B;  3K5N A;  5KNB A;  4DAP A;  1AZP A;  1WCM B;  4U68 A;  2IT1 A;  2NVT B;  2F0J A;  4PMC A;  3VR6 A;  3D4R A;  3OW7 A;  5C5M A;  2FFK B;  1PMR A;  5JPN C;  1OXV A;  1LT3 D;  3H3V C;  2XWB B;  3S1Q B;  2PZU A;  2E75 C;  1I4H A;  3S1M B;  1PDQ A;  1WTX A;  3SEB A;  2MHV A;  2X69 A;  2E2D C;  4K2K A;  5CV8 A;  1EWC A;  5ELD A;  1STY A;  4HCS A;  4DF7 A;  4OIK A;  3D31 A;  2JSO A;  2XNA C;  2DY7 A;  1I4P A;  5C3X A;  4QUF A;  1QWY A;  3CKI B;  1Q1E A;  1Q90 A;  4IUR A;  5EBD A;  3HOV B;  1SE2 A;  2RDG A;  4KN4 C;  2L11 A;  1F2Z A;  1NSN S;  1O7Z A;  1EQT A;  4IFD J;  2PPB C;  2VNU D;  5ELC A;  2IX3 A;  2N88 A;  5EPK A;  4LAA A;  5HUR A;  4RA8 A;  4ULL A;  5DM7 3;  3Q23 A;  1Y8O B;  1D5X C;  4F88 A;  3GV3 A;  2XSC A;  1H9J A;  3MXN A;  4IAL A;  4KHV A;  3C1F A;  5EQ0 A;  5J39 A;  2E2I B;  4ZUJ A;  4HTH A;  1Z7T A;  4H0L C;  4UAI A;  3GO5 A;  3PUZ A;  3S9W A;  2F0L A;  5E4X A;  4FO2 A;  1QOH A;  4GZY C;  2BE5 D;  3GTO B;  3J7A F;  4RCO A;  1ILQ A;  4RGM A;  1PRT D;  2EY5 A;  2Z8L A;  3ERO A;  2BCO A;  5BN5 A;  2ICE C;  3NQI A;  3EVQ A;  3K7A B;  1X3Q A;  1QCB D;  4J6H A;  5IGG A;  3OHX C;  5C0X I;  5EKI A;  3DHQ A;  4HN7 A;  4L8J A;  4HMI A;  2AWN A;  3RLF A;  4MIU A;  3OIQ A;  4ZKC B;  2CQA A;  1ZKO A;  1Z47 A;  4CKB A;  4FP5 D;  1E0B A;  4HMJ A;  4L63 B;  3R8B A;  3BDC A;  2CW0 D;  5DAU A;  2EZV A;  1Q3L A;  4DN4 M;  5I6Y A;  3I4M B;  2LKV A;  5LHY 1;  2MJ8 A;  4IUP A;  3VR5 A;  2F0P A;  1LTB D;  1QNU A;  2MGS A;  1PFM A;  1VF5 C;  4L6T B;  5FLX E;  1H9S B;  2JA8 B;  1M4V A;  1EOT A;  1PTO C;  3K57 A;  5C3W A;  1QNK A;  2JE6 I;  2IWH A;  2B2U C;  3WOF A;  5I4D A;  3MXU A;  3I91 A;  2EYP A;  2NZ1 D;  2B39 A;  2IW3 A;  1UEA B;  2EJM A;  3S15 B;  1LLR D;  2WB1 B;  4XYO A;  2NYZ D;  2KOL A;  5JPM C;  1B1Z A;  3BYT B;  1OXT A;  5FK9 C;  5F2D A;  3X3N A;  2XN9 C;  4EQN A;  3OSO A;  1DM0 B;  1W6K A;  3SE0 A;  4J1M A;  1MSH A;  3WDN A;  2NTS A;  4DGZ A;  3KBX A;  2B2W C;  1KAA A;  4TRD A;  3HS0 C;  4AYB B;  3BDL A;  4E6I A;  5CV6 A;  5C5L A;  4Z9C B;  3VR2 A;  4G57 A;  4RCN A;  2M9V A;  2RKS A;  2A5H A;  1GJX A;  3NTI A;  2E2H B;  2OXP A;  1I4G A;  5IOC A;  4ODG A;  4ZQ3 A;  3GP7 A;  4V19 0;  1S5D D;  3EJI A;  4I7Z C;  5J1Z A;  3VA5 A;  4CJ1 B;  1PLF A;  2A69 D;  1RHP A;  2EYJ A;  5LL6 S;  1A2T A;  5TSS A;  1W6J A;  3K58 A;  2F0V A;  2RQX A;  5EGT A;  4YIJ A;  2AQ1 B;  4DNR B;  1F9P A;  1KNE A;  3G7L A;  2F0N A;  1LTI D;  3A55 A;  2R7Z B;  1WTW A;  2B2Y C;  4PMB A;  1BBX C;  5ELE A;  3A54 A;  1QG7 A;  2IJ0 A;  5COY A;  2EOT A;  4ZYS A;  1SXT A;  2RA4 A;  1EWH A;  5E1F A;  1IW7 C;  2QF7 A;  1HUN A;  3TZD A;  3PV0 A;  3DMU A;  1PZJ D;  1WTO A;  1EY9 A;  3HOX B;  1K83 B;  2R6G A;  3ND9 A;  2DN8 A;  4IQZ A;  1DOK A;  1PFN A;  1I4Q A;  1U4R A;  1CZG A;  2NBF A;  1PTO B;  1ENA A;  1WTR A;  2H1E A;  1Y8N B;  2BA1 A;  2B8F A;  2D2C C;  3AB9 A;  3FMC A;  4DFA A;  1F9S A;  2A6E D;  1H9R A;  4FF4 A;  2Z4H A;  3EFX D;  3L3O C;  3E6Z X;  3M7N A;  2F1M A;  1A3V A;  2IPK D;  3FKI B;  3K59 A;  2F0G A;  1FNV A;  1TY0 A;  4I65 A;  4HAE A;  3FDT A;  3UI2 A;  2NVY B;  4R8I A;  1HXY D;  3D4D A;  4LJZ C;  1H9M A;  1TWA B;  1EU4 A;  1F9R A;  1RJT A;  2KEE A;  4A3D B;  1HQM C;  3P75 A;  1EY6 A;  1I4R A;  3AMU A;  1DXM A;  4RHR A;  3NP8 A;  3H94 A;  2PNR C;  2KUM A;  1STB A;  1X32 A;  2BDO A;  5A2Q L;  4OIJ A;  3I4N B;  4DU9 A;  1TS3 A;  2HCI A;  4OL7 A;  4IN3 A;  1ILP A;  1LAB A;  2K5W A;  4PQX A;  1O7L A;  4TSS A;  1D6E C;  3JAM E;  1SND A;  4H13 C;  1U4L A;  4KJO A;  2LMC B;  3CU7 A;  5ELF A;  2RSO A;  3A8I E;  1S5B D;  4X3S A;  5T1G A;  3M4Y A;  2C9O A;  4BY7 B;  2L0C A;  3DWP A;  2Y0S B;  3I3C A;  3NSW A;  1PZI D;  2CVR A;  2QEJ C;  1RD9 D;  3SK4 A;  5KND A;  1BDO A;  3TP7 A;  2Q8T A;  5IIF A;  1J8I A;  1QIL A;  2J4X A;  3GTK B;  4K8I A;  3KLS A;  1GUG A;  4NP5 A;  1C8C A;  4TQU S;  4K5V A;  4EGV A;  1YNJ C;  3S17 B;  2K01 A;  4WFN 3;  1MGS A;  1V1P A;  1JCK B;  2CHB D;  1IHZ A;  3M4O B;  3QB3 A;  1SSO A;  2K04 A;  4XYQ A;  3TDQ A;  3BVZ A;  4EQO A;  3URY A;  2K05 A;  5KYI A;  4RH6 A;  3S2H B;  4PNY A;  4ABN A;  2RDF A;  1II3 A;  4PMW A;  2NVQ B;  2B2V A;  1FD7 D;  5I9O A;  3DM1 A;  4FF1 A;  3RMH A;  4CHT B;  3T13 A;  1S5F D;  1WD0 A;  4FVM A;  5M5Y B;  4ILW A;  1BXT A;  4KY5 A;  1JWU D;  4QMG A;  3MHB A;  1PTO F;  3N6R A;  1V43 A;  2O4X A;  4Y7N B;  1J9O A;  1NAP A;  2Q8I B;  1LAC A;  3NXW A;  3FRP B;  4ZLT F;  1AFP A;  2VB3 X;  2WAC A;  1OXU A;  4RGN A;  3H0G B;  2VUM B;  1DJR D;  1I6V C;  5DM6 3;  3KUP A;  1LTA D;  2V4D A;  2K28 A;  3O13 A;  3V05 A;  4OO1 H;  4IZ8 A;  1H9K A;  2NN6 G;  2PO4 A;  2A6H C;  1IKM A;  3T53 B;  2PZW A;  2KQ3 A;  1IL8 A;  4KD4 A;  2LS0 1;  3MEH A;  3OWE B;  3PO2 B;  2G9D A;  4MHE A;  1GHK A;  1NR4 A;  3VA7 A;  1L0Y B;  3HOZ B;  3BZD B;  2BE5 C;  2H4O A;  3R2I A;  1Y69 U;  2QCP X;  1F2M A;  1STA A;  4A3J B;  3CRL C;  4KMU C;  4ZAI A;  3OWF A;  3IAY A;  2EY2 A;  4K2L A;  3CRK C;  2FIN B;  2PCF B;  4BS9 A;  1HTL D;  4Q0F A;  3C3L A;  1Z6H A;  3PIP 3;  3A7L A;  1OO9 B;  4H44 C;  4LMQ D;  5C6A A;  1EYA A;  4J8Q A;  2E2J B;  5AFW A;  3TP6 A;  4X3T A;  5K36 H;  2K33 A;  2XRQ D;  1SE3 A;  5JVG 3;  1SJE D;  1ET6 A;  4ID6 A;  1FGB D;  1JOK A;  2KA7 A;  2KCN A;  1R9T B;  4DXG A;  4RGO S;  5D65 A;  1SYD A;  3BVG A;  2R92 B;  1EY8 A;  1XTC D;  2K6A A;  3TP8 A;  3R93 A;  5JEA H;  4B9X A;  3HOY B;  2MUY A;  1I50 B;  1IW7 D;  4OHJ A;  4RHS A;  1TR5 A;  2B2T C;  1G6Z A;  5J22 A;  1U4M A;  1V1P B;  4OO1 G;  3QG1 A;  3PMF A;  2EXZ A;  3N52 A;  2E76 C;  1TT2 A;  2WII B;  4DAV A;  5HGT A;  1EY5 A;  3J80 E;  5CYU A;  4UDU C;  3BG3 A;  3NPP A;  3RZO B;  1HA6 A;  3G6J B;  2SEB D;  1JWS D;  2NB0 A;  4N9T A;  5IGB A;  2ZXR A;  2FJ2 A;  3GTL B;  4TKO B;  3LWE A;  3VR4 A;  1E2W A;  2DY8 A;  2SNS A;  5JJZ A;  5CV5 A;  3TME A;  5I9P A;  1DON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...