3BU2A

Crystal structure of a trna-binding protein from staphylococcus saprophyticus subsp. saprophyticus. northeast structural genomics consortium target syr77
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
198
structure length
195
Chain Sequence
MNLFYNKEAVGDVAFLQINPTEGEYNYVTQGDVVEIQNDGEVVGYNIFNASNKATLTHIKLTETLVQAFQKAIEAAGFTYKLDADFTPKFVVGYVETKDKHPDADKLSVLSVDVATEKLQIVCGAPNVEAGQKVVVAKVGAVMPSGMVIKDAELRGVASSGMICSMKELGLPNAPQEKGIMVLSDDYTVGQSFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tRNA-binding protein
publication title Crystal structure of a tRNA-binding protein from Staphylococcus saprophyticus subsp. saprophyticus.
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
molecule tags Rna binding protein
total genus 32
structure length 195
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
A PF14794 DUF4479 Domain of unknown function (DUF4479)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3bu2A01
3.30.1940.10 Alpha Beta 2-Layer Sandwich Nucleic acid-binding protein fold YtpR-like 3bu2A02
1K3RA 1HR0L 3BJUA 3UDXA 2R7ZH 1TWHH 3U4ZA 3S1RH 3HKZG 1HZBA 1FGUA 4PZ8A 3KFUA 3BZKA 4LUVA 5IYCG 4GNXA 2JE6I 1GO3E 4A3FG 1TWFH 4LF4L 4QY7A 4BXXG 3CAMA 5IWAL 2L15A 1QVFA 3AYHB 2N8NA 3NENA 4HIDA 4LUOA 4NXNL 1HNZL 2VY3A 4HJ7A 4A3BH 2Y0SE 4KHPQ 3I4NG 1C0AA 1VQOA 2OTLA 2AWOA 4JI2L 4TVAB 1PH7A 4BBRG 4DV7L 1HZ9A 4DV4Q 1EOVA 4JV5L 1E22A 2BA0A 2IT1A 2Z6KA 2A8VA 1Y1VH 1K8GA 3OYYA 2K52A 4HJAA 4LF6Q 5M5XH 1VQJA 1VQMA 2WFWA 4IOCA 1S72A 2QGQA 3AFPA 1I3QH 4P75A 1KL9A 3GO5A 1Q7YC 1IBLL 2E5LL 3CCLA 2YTYA 4OONA 2NN6G 2JA6G 2JA8H 4GN4B 4A3LG 3S2HH 3HKZE 2I5MX 2OCEA 4R4TA 1LTLA 4A76A 5GADC 3B6YA 4YY3L 4GLAC 4DUYQ 4LFAQ 1Y1WH 3RLNA 1LYLA 1XPUA 3MEFA 5JEAG 4DV0Q 2RF4A 5GAEC 2IY5B 2V1CC 1Q81C 4JC0A 5IYDG 4DV6Q 3KDFB 2VL6A 5LMNW 1J5EL 1VQBA 4GNXB 1X3GA 4PZ7A 4JI7Q 1PFSA 1WI5A 4IJHA 3H3VH 1V1QA 3CXCA 3CCMA 2N78A 1CSQA 1VCIA 3A0JA 3M4QA 4IO9A 1HNWQ 4AQYL 4A3KH 1PYSB 1OXXK 1X65A 2NVYH 5DLQE 5ELNA 4HJ5A 1PH5A 4L5SA 4DR4L 4DR6Q 1PVOA 2YTXA 2BH8A 2QEXA 4JOIC 3L2PA 1FJGQ 3ERSX 4UPAA 2C35B 4JI8Q 4L5QA 1KC8C 1KHIA 3G6EA 1VQNA 3CC2A 1KRSA 3T1HL 4APVA 2ZM6Q 1AE3A 3UDGA 1K83H 4BBSH 3M4PA 1J6QA 1I94L 4OX9L 4JBJA 3HOVH 4A3DG 1RIPA 3F2DA 4DR2L 4DR3L 2JA7H 2VS1A 3K80C 2YYZA 2OWOA 2Q2HA 4LWCA 1WYDA 5GAHC 4K0KL 1I6HH 1X56A 1K73C 2ASBA 4UP9A 2MO1A 1EQRA 4X66Q 5IY0A 2UXDQ 2UXCQ 4DR1L 1IXRA 2A1AA 2JEAI 1AE2A 1GM5A 4AYBG 3TRZA 5K36G 4P71A 4JBKA 3KYHC 1Z9FA 4JI0L 4JOIA 4B3TQ 2PQAA 2CFMA 4PZ6A 4PMWA 4DR5Q 3A74A 1RL2A 1UWVA 1EIYB 3F2CA 3J7A5 5BR8Q 2ZJQA 2JA5G 4LNQA 3EN2A 1N8RC 1KXLA 5FLMH 5C0XG 4RMFA 3I55A 1VQIA 4JI1L 4LFCL 5C4JH 2VUMH 3KOJA 1PH9A 3H0GH 3I7FA 3K7UC 4LF9Q 1Q12A 3HOXG 1NMGA 3PGZA 2K4KA 4DPGA 1IBLQ 3U58A 3J80c 2ZTDA 3J81c 4C3IH 1Q8KA 1IBKL 5IP9G 4YHHL 4A3EH 4LF7Q 3M9BA 3Q8DA 1JJGA 3PCOB 4GKKL 4DV5Q 2HHHL 4BY7G 2NVQH 5IYBG 2AHOB 2PNHA 2F4VQ 1XMQL 3KLWA 1VQPA 5M5WH 2EIFA 1Q86C 2WAQG 1TWGH 2JA9A 5C44G 1VQDA 2D0PA 4A75A 1UE7A 1XPRA 2UU9L 4DV3L 4LFBL 4R4CA 4WJ3M 3KJPA 1TWAH 2XTIA 4X64L 3GD7A 4LF5Q 1N36L 3HOWH 2E2HH 1WOCA 1HNXL 3HOZG 2I0QA 2UUCQ 4A3MG 2Y0SG 5IP7G 4IPGA 4LW1A 3DM3A 3GTQH 2JEBI 3PUXA 2R93G 3PUVA 4A4IA 1PHJA 1XPOA 1U0LA 1WFQA 1N34L 3S15H 4BY1H 2OTJA 3PUYA 4JYAL 2GVAA 2FXQA 3JAMi 4C3HH 3T1YL 4JI4L 1YVCA 4XIGS 5C4XG 1L1OB 4OWXB 1CSPA 4A93H 3G48A 3SGIA 1XNRL 4POGA 4Y52H 1A63A 3EBEA 1IBMQ 1AH9A 4A3CG 2F3IA 2KENA 1PH3A 1R9TH 1PH8A 3GTMH 5IYCH 1XNQQ 1QVGA 1UE6A 4A3FH 3KDFA 4R4IA 2R92G 4DV2Q 2PI2E 4X62L 3GTPH 3I4MH 4JI6Q 3UDFA 2Q2IA 4JI5Q 1NJIC 4YCVA 4B3SQ 4UP8A 5HY6A 1N32Q 1NBWA 1E3PA 3HOYG 1W2BA 4BBRH 2BH2A 3RZOH 2R7DA 4A3GG 1BBUA 1NMFA 4YWKA 1QUQB 5JJKA 1SFOH 2VZAA 3K8AA 2JQOA 1HZAA 3GDEA 2VQFL 4GLXA 4R1JA 2MQHA 4GKJQ 4JG2A 1CKNB 5IT9c 3S1NH 4J15A 1E24A 1XTDA 1XMOL 5FJ8G 2MO0A 1JJCB 5ELOA 2JA6H 2R7ZG 3CW2C 4AIMA 3M3YH 1JB7A 2WB1E 4BA2I 1VQ4A 3S17H 3D0FA 1EUJA 1V9PA 4X65L 3PIPA 4NXMQ 4DR7Q 2GVBA 5C3EH 1YI2A 1E1OA 3L0OA 3GTOH 4IJLA 2HHHQ 2AWNA 4AH6A 3IRBA 1CKMA 4A3BG 3ICEA 5AJ3L 3ZJYC 1P16A 4DAMA 4HIKA 1QVCA 5LMNL 4GN5A 4NPSA 3GTGH 1Y1VG 4C2MH 2NZHA 4UY8C 5E7NA 1MJCA 1LUZA 3KF6B 2UUBQ 3CP0A 3RLFA 3S24A 3J7ZC 1N33Q 3CCSA 1YEZA 3GTKH 3MXNB 4QJFA 1VQ7A 2OQ0A 4JI3Q 1Z47A 4LF8Q 2VQEL 3AFQA 4IFDJ 1KAWA 2HQLA 3KJOA 1IL2A 1PH4A 1IZ6A 3CPFA 2UUAL 3OTOQ 3S14H 2UXBL 4A3DH 4JBWA 4Y7NH 2EXDA 2H5XA 1FL0A 1VS0A 3KF8B 4MNOA 4YCUA 1A8VA 3GTJH 4ME3A 1MIUA 1KQSA 4B3ML 1YITA 4HJ8A 4NB3A 4QQBX 3CQZH 3CCUA 5GROA 4IOAA 4A3IH 1HR0Q 2I5HA 1B8AA 1L1OC 3I56A 1SMXA 3CCQA 2CWPA 2Z0SA 5FJ8H 1HJPA 1VQHA 1X9NA 4LF4Q 2DGYA 2AMCB 1L2FA 5IWAQ 3CD6A 4XTCS 2YU9H 2PMZE 4X6AH 2OQKA 1HNZQ 3RN2A 2MFIA 1Q82C 4NXNQ 4GOPB 1TWCH 4BBSG 1X6OA 1YHBA 4JI2Q 4DV1L 4DV7Q 4DUZL 1PYBA 4B3RL 1NY4A 3FP9A 3CCJA 4JV5Q 2JA7G 1C9OA 2IHEA 1GD7A 5HGQA 3PO2H 3H3VI 3TREA 2K5NA 3HOXH 2B29A 1Q1BA 1O7IA 3CC7A 4WJ4A 3W1BA 1Y14B 5J3BA 1I50H 3PF5A 2E5LQ 1PH1A 3HOUG 3TEHB 3CCRA 1FVIA 4DKAC 3RLOA 5M3FG 1L1OA 1WCMH 4BY7H 4P74A 2ZTCA 2XGTA 2NVXH 2PI2A 4YY3Q 4KHPL 3CCVA 1M1KC 1OXTA 4OWWB 2QA4A 4YWMA 4DAYB 4OO1I 5C44H 2B3GA 1D8LA 2K5HA 3H15A 4DV4L 1J5EQ 2GN5A 1YJWA 1JJ2A 4LF6L 3NEMA 1YHAA 2YTVA 1H95A 5FLMG 1I5FA 2ATWA 1GKHA 4AQYQ 2ZJPA 2VUMG 3H0GG 3I2ZA 4DR4Q 1ASZA 3HOZH 3UE1A 2N3SA 2E2IH 1QUQA 3PO3G 5IP7H 5M3MH 3RNUA 4DUYL 1CKNA 4A3EG 4LFAL 2R93H 2B63G 4DV0L 4C3JH 1XJVA 5GQOA 3T1HQ 4RG1A 4DV6L 4JI7L 4UP7A 1I94Q 4OX9Q 1K0RA 1LM0A 3PIOA 4IFDI 1UEBA 2CCZA 4DR2Q 4DR3Q 3S1QH 3EIVA 1HNWL 3TQYA 3W5OA 4ALPA 4A3CH 1YHQA 4K0KQ 2WB1G 1G291 1VQ8A 5IE8A 1E1TA 3ULPA 4DR6L 2WP8J 1FJGL 4DR1Q 5JEAJ 3TS0A 2RHQB 4A3JG 3HOWG 4BXXH 3JAMc 1UE5A 4JI8L 1N9WA 1SE8A 1CKOA 1VQ5A 3NELA 3PV0A 2K75A 5GAGC 2IX1A 1L0WA 4JI0Q 1T9HA 3M7NA 2JJQA 3I4NH 3HOYH 2CWAA 3HKSA 3NBHB 2ZM6L 2E2JH 3STBC 4A3GH 3AQQA 3BU2A 3KF6A 1EQQA 4BY1G 2E8GA 3FKIG 2ID0A 3U50C 2VW9A 4R4QA 4L5TA 4R4OA 1HR0W 4HIOA 3U4VA 4GOPC 3WWVA 4JI1Q 1WJJA 3M85A 3HFZB 4X66L 3A5UA 4LFCQ 2KHJA 4EQ5A 2RHSB 3PSIA 4A93G 3HOUH 1VQLA 2UXCL 2UXDL 1G6PA 4A3LH 2EQSA 1A62A 3F1ZA 3VDYA 3CMAA 5LMUL 1QZGA 1EFWA 3I4MG 1IBKQ 4YCWA 4YHHQ 4GN3B 4B3TL 1K8AC 4DR5L 3STBD 4GKKQ 2K14A 2LSSA 1S40A 1VQ6A 5BR8L 5IYDH 2BA1A 4DK6C 5M5YH 4OWTB 1YJ9A 1XMQQ 1VQ9A 2JK8A 3D31A 1EWIA 1YZ6A 2N49A 3ER0A 3FHWA 1KRTA 4EX5A 2Q2UA 1CUKA 3K7AH 2HIVA 2UU9Q 2IX0A 3A5ZB 4DV3Q 3E0EA 4LF9L 2IHFA 1OXVA 3L7ZC 4LFBQ 4GOPA 3S1MH 4DK3C 4X64Q 1YNXA 1N36Q 1M90C 2KHIA 2JA8G 1HNXQ 3JC66 4LF7L 1MJEA 1SRUA 4DV5L 2KCTA 3I4OA 4GLVB 1Y1WG 1PV4A 1OXUA 5C3EG 1UE1A 4QIWE 1K9MC 2F4VL 1NTGA 5C0XJ 1YBYA 2RCNA 1N34Q 1ASYA 3F8TA 1VQKA 2HT1A 3E9HA 1OTCA 1B70B 1IYJB 4KHZA 4JYAQ 1V43A 3T1YQ 4JI4Q 2KBNA 1X55A 4GS3A 4YWLA 5H1SE 1NE3A 1KD1C 3CCEA 1XNRQ 1U5KA 1G51A 4IPHA 1QZHA 3S2DH 3F2BA 4A3KG 4LF5L 2HIXA 2R6GA 3K0XA 1PH2A 1SROA 1X3EA 2CKZB 1JT8A 3E9IA 2UUCL 2K5VA 1BKBA 2I5LX 2NN6I 1SLJA 4X62Q 1BVSA 2ZTEA 4DNIA 2K50A 3CPWA 1Q1EA 2NVTH 1JMCA 3DLLA 3S16H 4OO1G 3M4OH 4BA1I 2JA5H 2R7FA 4O0AA 2ES2A 3HOVG 3W1GA 2VQFQ 1DGSA 4MZ9A 4PG3A 1IBML 1XMOQ 3BZCA 3ULLA 2A19A 2F52A 5FLXc 3UE0A 4A3IG 1XNQL 2VNUD 2Q2TA 1TXYA 4DV2L 1B7YB 1Q46A 5IP9H 4JI6L 5M3FH 1SN8A 5LMUQ 4X65Q 4JI5L 4H02A 4LUZA 1D7QA 5IYBH 4B3SL 1SR3A 3PF4A 1N32L 1OXSC 5EAYA 4IPDA 1HZCA 3G4SA 1MKHA 4IPCA 4IFDG 1VQEA 4KLKA 5AJ3Q 3J80i 3J81i 4JBMA 3CF5A 3RN5A 4L5RC 4GKJL 4JCVE 1PA6A 5LMNQ 1JE5A 3PO2G 3PUWA 1HH2P 2YV5A 3K81C 1KIXA 1YIJA 2AKWB 3PO3H 4POFA 4HJ9A 1VQFA 1W3SA 4A3MH 2D62A 1EYGA 2D0OA 5JJLA 4NXML 2LXJA 3G71A 4KI0A 2VQEQ 1P8LA 4DR7L 2B63H 4P72A 5JJIA 1WCMG 4AYBE 4HIMA 4OXPA 2UUAQ 3J81j 1C7YA 4O2DA 2NZOA 2UXBQ 3CMEA 2MNAA 4QGUA 1PH6A 5C4XH 1VQCA 3OW2A 4QL5A 4B3MQ 4FDBA 3RR5A 3CC4A 1VQAA 2PQAB 5C0XI 3LGJA 3GTLH 4GNXC 1BBWA 2UUBL 4TQUS 4MTNA 3ULJA 2R92H 1N33L 4A3JH 4JI3L 4LF8L 1X54A 1YJNA 1X3FA 2DUDA 5M3MG 2ZJRA 2LXKA 3OTOL 1A0IA 2ALYB 1EIFA 3PUZA 3TS2A 2Z6KC 3RZDH 3FKIH 3UDIA 3AEVA 1GVPA 4DV1Q 4B3RQ 4DUZQ 1VQGA 2WAQE 1S3OA 4P73A 2KCMA 2CQOA 1E7ZA
chains in the Genus database with same CATH superfamily
4HTHA 1HR0L 1Q90A 3BJUA 3UDXA 1ET9A 1TWHH 1HZBA 3HOZB 4PZ8A 4LUVA 1GO3E 1TWFH 4LF4L 1I4XA 1TR5A 3WOEA 4HIDA 1LT6D 4C3JB 1HHVA 4A3BH 2Y0SE 1VQOA 4TVAB 1PH7A 1HZ9A 4DV4Q 3S1QB 2IT1A 2IWHA 2A8VA 2L9HA 3OYYA 1GUOA 4HJAA 4LF6Q 3GTLB 4FVMA 4JPBW 3SR1A 2R92B 4P75A 1KL9A 3CCLA 1T5EA 2YTYA 2NN6G 3FPPA 3HKZE 2Z9HA 1RKNA 2F3WA 5I4DA 3BDLA 3B6YA 4YY3L 4DUYQ 4ABNA 3RLNA 4N9PA 3MEFA 1HXYD 4DV0Q 1J8IA 5GAEC 2J0TD 2G9DA 2V1CC 5FKAC 1Q81C 4DV6Q 1J5EL 3KLRA 4TSSA 3DEOA 3NWTA 2F1MA 3H3VH 1V1QA 4CDCC 3CXCA 4ULLA 1I4PA 3M4QA 4IO9A 1PYSB 5DLQE 1PH5A 4L5SA 4DR6Q 4HMIA 1A3UA 1FJGQ 3L2PA 1ZEQX 4Q5VA 4JI8Q 4L5QA 1KC8C 3CC2A 3T1HL 5M5YB 2NYZD 1SYDA 2EY6A 1IKLA 2JA7H 3K57A 1HCZA 3K80C 2YYZA 2F0WA 5M9OA 1WYDA 5GAHC 4K0KL 1EQRA 3CKIB 4X66Q 5IY0A 1I3QB 1H9SB 4FXGC 2BE5D 1UUPA 2Z4HA 3SK4A 1SYFA 2XVSA 2A1AA 2GA4B 4CHTB 1AZQA 4JBKA 2HCIA 4UAIA 3T4AC 4B3TQ 4DR5Q 3A74A 3J7A5 2ZJQA 3EQLC 1SYBA 1TY2A 5FLMH 3GP7A 4RMFA 3I55A 1U9RA 1VQIA 5KNCA 3S2DB 2NVYB 1SJED 3I7FA 2HD3A 3U58A 3J80c 2ZTDA 2XIWA 1IBKL 5CV5A 4LF7Q 1JJGA 2IPKD 1MHWC 2WACA 3MFGA 1MGSA 1STEA 5IYBG 2RDFA 3KLWA 2EIFA 1S5CD 1TWGH 1KDAA 3J81E 3H94A 5JPNC 5EQ0A 3KJPA 3A8IE 3I90A 3HOWH 2A68D 4A3MG 2Y0SG 4IPGA 1QJOA 4LMQD 1E2WA 2R93G 3PUVA 1GUGA 1RTNA 1PHJA 1GHJA 3S15H 2EYHA 4ME5A 1YVCA 4OWXB 1CSPA 4A93H 4POGA 4Y52H 2XWBB 1ENCA 1PH3A 3PO3B 1HQRD 1UE6A 4A3FH 1K8OA 4X62L 3GTPH 2Q2IA 1LTSD 4YCVA 4B3SQ 4UP8A 5HY6A 3HOYG 5KGUA 5E4WC 1LABA 1SFOH 3I70A 1CKNB 3TP7A 3C3LA 4J15A 3ZYYX 5ELOA 4A3JB 2JA6H 1VQ4A 4X65L 1V9PA 2EY5A 3PIPA 2GVBA 5C3EH 4K2KA 3GTOH 2AWNA 1STAA 3IRBA 3D4RA 3A55A 3OW7A 3FKIB 5AJ3L 2QEJC 2KCCA 4NW2A 2DY8A 4NPSA 1Y1VG 2NZHA 3OMGA 4LAAA 3S1RB 3IFDA 4WRDA 1LUZA 1D1KA 3KF6B 3MWYW 3GTKH 4V0BA 3Q24A 1KAWA 1IL2A 1PH4A 1U4PA 2UUAL 2CH4A 1MI2A 1X3QA 3OTOQ 2UXBL 4A3DH 4NP5A 4JBWA 3GTJH 2SNMA 1AZPA 1MIUA 1CI3M 3CQZH 4EQOA 4RH6A 1GHKA 4YIJA 3I3CA 1SMXA 3S17B 1LTID 1D5MC 1X9NA 3V2TA 3S9WA 1L2FA 4X6AH 3R8BA 1HNZQ 3RN2A 2E76C 2EE1A 4FXKC 3IL8A 5CBAE 4IFDH 1TU2B 1X6OA 4JI2Q 4DV7Q 5IGGA 3FP9A 1JE4A 4OELB 3H3VI 4N9TA 5JPMC 1Q1BA 3K6OA 3W1BA 1XX8A 1QCBD 1EOTA 2RCFA 2E5LQ 1AW7A 3CCRA 5I6YA 3VYSA 4DKAC 3RLOA 1WCMH 1YNJC 2B2YA 4PNYA 3KLSX 1OXTA 1ENFA 4ZRZA 2K5HA 2KVMA 1HA5A 2G9HD 5C3WA 4RCNA 1I6HB 1I5FA 2FJ2A 2ZJPA 2VUMG 3K5NA 3F2UA 5DEHA 4DR4Q 3HOZH 1QUQA 5IP7H 3EVQA 4PMBA 1NR2A 3TN2A 3VA7A 4O42A 4C3JH 2A6HC 5D65A 5HURA 1I94Q 2ICEC 4RCOA 2CCZA 3S1QH 4DR3Q 2J4XA 3PO2B 5IGEA 2F0UA 1EEFD 1FNUA 4DR1Q 3TS0A 2RHQB 1B53A 3JAMc 1CKOA 4KN4C 2IW3A 3PV0A 5GAGC 3DXJC 5EBCA 2X6LA 1PYWD 1A6XA 3NQIA 1QG7A 3MXNA 1BQQT 2ID0A 2VW9A 3UI2A 5KRUA 1LACA 2B39A 4JI1Q 3M85A 3A5UA 2UXDL 3PSIA 1VQLA 2NN6H 2E2HB 4IURA 4IUNA 5LMUL 3P1HA 5E3FA 2F03A 3GTQB 2L12A 1K8AC 2NTTA 2Z4IA 2K14A 4GKKQ 1VQ6A 1PTOB 1QNUA 5M5YH 4F8MA 1XMQQ 5CV6A 1VQ9A 3P7JA 3PIP3 2N49A 2RQXA 1KRTA 1CUKA 1MBYA 5TSSA 2CW0C 1WTWA 3Q6SA 2IHFA 3URYA 2DY7A 4GOPA 1JOOA 3KLSA 1HNXQ 2Q8IB 5DM63 4OIJA 2EDGA 2FFKB 1OXUA 4RA8A 1PV4A 1Z7TA 1K9MC 4BBRB 1N34Q 1ASYA 3AB9A 4KKSA 2HT1A 4KHZA 4JI4Q 1EY6A 2KBNA 4YWLA 1DONA 3NUCA 4HN7A 1U5KA 1G51A 2E2DC 4IPHA 3S2DH 2K32A 1PH2A 2R6GA 1LT5D 3E9IA 3QB3A 4OHJA 2I5LX 4DNIA 5CR3A 4DXGA 1L0YB 3W1GA 2E74C 3GTGB 4PG3A 1XMOQ 1Y69U 3OWFA 5FLXc 2VNUD 2DJFC 4LJZC 1A3TA 3HZXA 5F2DA 2Q2TA 4PMCA 4JI6L 5LMUQ 1F9SA 1WTHA 3EFXD 4LUZA 5JAVA 5IYBH 1N32L 1TS2A 3KK7A 1EZ8A 1EY0A 1PLFA 3G4SA 1VQEA 4MIUA 3J80i 3QR8A 3SEBA 1EY7A 1JE5A 1FNVA 1HH2P 2BOSA 3MZ5A 4K8JA 4FNFA 1YIJA 2AKWB 4HCEA 5CV4A 1JWSD 1TY0A 1UAPA 4AYBB 4POFA 1EY5A 3PO3H 1W3SA 4A3MH 2D0OA 5JJLA 4HSPA 4DR7L 1P8LA 1G8ZD 5JJIA 2FMCA 4H0LC 3S16B 3NE5B 4DAVA 3CMEA 1PH6A 2I07B 3OHXC 1F2LA 4I7ZC 3RR5A 3CC4A 2R3ZA 2PQAB 3HOXB 2EYMA 2A69C 5EPKA 3ULJA 4MTNA 4A3JH 1I4HA 3LX0A 1YJNA 1X3FA 3TSSA 1CK1A 4KD3A 2WIIB 3U9SA 2A6HD 1PFNA 1EIFA 2NWGA 3BDOA 3PUZA 3FKIH 3HG9A 4B3RQ 1VQGA 3TP6A 2WAQE 4JW0A 5CV7A 3NTHA 4CGYB 3S1RH 5G3LD 4H7BA 4CKBA 1FGUA 5J22A 3KFUA 3D4WA 1CFMA 4A3FG 4K14A 1QVFA 3AYHB 2SDFA 4NXNL 2M00A 4HJ7A 5C4XB 1CZGA 5CYUA 3ONAB 1STNA 1Y1VH 2WV6D 2EPBA 5M5XH 3T51B 1VQJA 1S72A 4IOCA 3AMUA 4E6IA 2JA6G 4GN4B 1SDFA 3DMUA 1Q3LA 2I5MX 4K5XA 2OCEA 1LTLA 1E2ZA 4LFAQ 1XPUA 1BNZA 5JEAG 4A3GB 2EOTA 5LMNW 1VQBA 1X3GA 2EYLA 1PFSA 2CW0D 4DGZA 3CCMA 5ELNA 4HJ5A 2RSOA 4NDXA 3TMEA 3ERSX 2B8FA 1K0SA 2RA4A 1VQNA 3D6WA 2XRQD 4ID6A 1II3A 1LT3D 4G4KA 1KRSA 5T1IA 2ZM6Q 3UDGA 1TQOA 2B2WA 1KDBA 1J6QA 4OX9L 4A3DG 1RIPA 2VS1A 2IJ0A 3VYRA 2Q2HA 4LWCA 5BN4A 1I6HH 1X56A 3OPOA 4OL7A 2F3VA 2LFNA 3TZDA 3S2HB 3TRZA 1M8AA 1Z9FA 4JOIA 2KQ3A 2KJXA 4CKEA 5A35A 4PMWA 1BCPD 1UWVA 1EIYB 1B4OA 3F2CA 5BR8Q 2BDOA 5FLXE 1CQFA 4GZYC 5T1GA 1JR0D 4OIKA 2JA5G 2F0EA 4LNQA 4EQNA 1KXLA 2AQ2B 1WD1A 4LFCL 2VUMH 4LF9Q 3K7UC 3NTKA 1NMGA 4DPGA 3J81c 2XNAC 1CTMA 1TS3A 5KEEA 5D3IB 3PCOB 4TKOB 4K5VA 5NUCA 4BBSB 3MXUA 2F4VQ 2WAQG 2E75C 1SBBB 1FYCA 3ERQA 4A75A 1UE7A 2EJFC 4KJNA 1XPRA 4R4CA 4IUUA 2V4DA 4ZYSA 3VYUA 4X64L 4LK1C 1N36L 2E2HH 1WOCA 5M3FB 3HOZG 2I0QA 1VF5C 2K5DA 4J8QA 5IP7G 4LW1A 3DM3A 3GTQH 2WAQB 4M8AA 1PXUA 4C3JG 1WFQA 4G7ZC 2KUMA 1PTOH 5EPJA 2OTJA 1O80A 2MP1A 3Q23A 4JYAL 2GVAA 3JAMi 3T1YL 3BS1A 4XIGS 3NSWA 5IGBA 2A69D 1XNRL 1AH9A 3H0GB 1IBMQ 3H6MA 1PH8A 3GTMH 5IYCH 2R92G 1NSNS 4DK1A 3I8ZA 2F0DA 1NUCA 5KNDA 4JI5Q 4C1NK 1E3PA 2AQ3B 1W2BA 1KLGD 4BBRH 2BH2A 1S4ZA 3RZOH 1NMFA 4YWKA 5JJKA 2VZAA 1NAPA 3K8AA 3GDEA 4NMZA 2VQFL 4GLXA 2MQHA 2KHSA 1XTDA 2XWJB 1K28A 1JJCB 5EKLA 1EY9A 3KF8A 3NP8A 1JB7A 2A5HA 3BVGA 2OXPA 1EUJA 2J7ZA 3L0OA 1EQTA 4AH6A 1KABA 1H9SA 2ZXOA 3ICEA 2CHBD 2B2VA 4KJOA 1NR4A 4C3HB 1P16A 3KBGA 4HIKA 5ISRA 2RKSA 3J7AV 5E1FA 4UHVA 5LMNL 5G3LF 3GTGH 4C2MH 2K01A 4CJ2C 4UY8C 1OO9B 5E7NA 2UUBQ 3CP0A 1KTKA 3S24A 3BYYB 3SDZA 4B08A 4JI3Q 3I4MB 3SK6A 3KJOA 3CPFA 5LL6S 1PZKD 1Y8NB 3P75A 2PW5A 2H5XA 3KF8B 1VS0A 2F4IA 1A8VA 4ME3A 1KQSA 1YITA 4NB3A 4QQBX 2WKDA 3CCUA 2IL8A 1HR0Q 5D3DA 4X3SA 3H09A 1L1OC 3I56A 5K36H 2G5DA 4QUFA 4LF4Q 1Y1WB 2DGYA 3OIQA 3CD6A 1W6JA 2OQKA 1Q82C 5C4HA 2EJGC 3GV3A 5KNBA 1IW7C 3O13A 4J1MA 2IHEA 3NBIA 4BS9A 5HGQA 2OF1A 4EVOA 2K5NA 1HUNA 1TIID 3HOXH 5A2QL 4WJ4A 1Y14B 2B2UA 1ICWA 4K6DA 3TEHB 1R4PB 4YY3Q 4KHPL 3CCVA 4OWWB 2EZVA 2QA4A 4YWMA 4DAYB 2NTSA 3SVMA 3H15A 1J5EQ 3SK8A 1JJ2A 1H95A 1I4QA 2Q8RE 2ATWA 1H9MA 5CC4A 1VDZA 4PV1C 2N3SA 1BCPF 3PO3G 3W3AA 3RUZA 3E6ZX 5DAUA 1WVLA 1CKNA 3V05A 3Q22A 2YU9B 4RAUC 4KKTA 1XJVA 3CU7A 3T1HQ 2A74C 4XYQA 4EGVA 4JI7L 1A15A 1LV9A 4ZCKA 1HNWL 5C4JB 4A3CH 4K0KQ 5EKIA 1G291 4HCSA 1E1TA 3ULPA 1I50B 1PRTC 4A3JG 4QUCA 1UE5A 4WFN3 1N9WA 1SE8A 5JVH3 2A6ED 1VQ5A 2F0OA 2O2LD 1L0WA 3FMCA 5A2QE 3C1EA 2JJQA 1G2SA 1JOQA 4QMGA 2CWAA 5IGCA 1MD2D 3NBHB 2E2JH 4A3GH 3BU2A 3KF6A 2JP1A 2ZXRA 5IIFA 1LLRD 4BY1G 2O5JC 3FKIG 3U50C 4L5TA 3WWVA 4IZ8A 2EYOA 1WJJA 1TWAB 4EQ5A 2UXCL 1IL8A 4XQQA 2EQSA 1G6PA 1A62A 2PNRC 3MXGA 1EFWA 1IBKQ 4GN3B 1E2VA 5C5LA 5JEAH 1EY8A 1B1ZA 2BA1A 4DK6C 4BY1B 2QKIC 1LTRD 3D31A 2QF7A 3ER0A 4EX5A 2Q2UA 1XWEA 2IX0A 3A5ZB 3L7ZC 1R9TB 2C5CA 1RCVD 1SNMA 4I7AA 3FDTA 1MJEA 1SRUA 4I65A 4DV5L 4GLVB 1DM0B 4QIWE 3VR2A 1I4GA 5C0XJ 3F8TA 1VQKA 1Q8IA 1SJHD 1OTCA 4GS3A 2D9UA 2L0CA 5H1SE 2QDBA 3HOUB 4LF5L 2HIXA 3K0XA 2QCPX 3M3YB 2CKZB 2UUCL 2K5VA 4X62Q 1BVSA 3KUPA 1G91A 3I91A 1O7LA 3I72A 3G6JB 2OT2A 2L11A 2JA5H 3K5OA 2K04A 4DXFA 1A2TA 2NZ1D 1LTTD 5ELDA 3ND8A 3UE0A 4A3IG 1XNQL 1EFID 1TXYA 4DV2L 1V1PB 1Q46A 2HCCA 3OMCA 5M3FH 4X65Q 1SSOA 1WTRA 3PF4A 1OXSC 3S14B 3QG1A 1LO5D 4IPDA 4Y7NB 1MKHA 3ND9A 5AJ3Q 1IW7D 3J81i 4JBMA 3CF5A 3RN5A 4GKJL 1PFMA 4KMUC 4RKLA 1GUWA 1PA6A 3PO2G 4A3IB 2EJMA 2YV5A 3K81C 5CORA 3TBIB 1KIXA 3SE0A 1EYGA 5EJWA 4NXML 3G71A 2WKCA 4KI0A 3C46A 4AYBE 2UUAQ 3J81j 1C7YA 4O2DA 2NZOA 2UXBQ 2MNAA 5L37A 1VQAA 4F87A 4O1NA 3GTLH 3PQIA 1BBWA 4TQUS 2R92H 1N33L 4LF8L 1X54A 2DUDA 4BY7B 3QWNA 5IOCA 5M3MG 2ZJRA 1RJTA 1A0IA 3TS2A 5C44B 1GUTA 1SNDA 5KYLA 3UDIA 2NUCA 3HP3A 2KCMA 2CQOA 4ZUIA 1K3RA 2Z6BA 3HEJA 3T16A 3U4ZA 1PRTD 1SEBD 1NNXA 3MFYA 5IYCG 4GNXA 2JE6I 4ZKBB 5M3MB 4QY7A 3CAMA 5IWAL 4FF1A 2L15A 1EIGA 1F9PA 3NENA 1HUMA 4LUOA 3U9OA 2P5ZX 2OTLA 2AWOA 4BBRG 5JVG3 4JV5L 1EOVA 1E22A 2Z6KA 1K8GA 2K1BA 1ET6A 2K52A 1XTCD 2F0GA 2QGQA 3AFPA 1I3QH 1SXTA 3GO5A 4OEMB 4QIWB 4OONA 3RD4A 2HDMA 2B8GA 1JB3A 4A76A 1Y1WH 3QOLA 4GLAC 2RF4A 2IY5B 5IYDG 4KD4A 3KDFB 2VL6A 4GNXB 4PZ7A 1WI5A 2VB2X 3NHHA 2RBMA 4AQYL 1TS5A 1OXXK 1X65A 2NVYH 1D1IA 1TWFB 3SK5A 2C35B 4XYOA 2DNCA 5FO9B 1HPCA 4A3BB 1EIHA 3VYTA 1S5ED 3CHBD 3BDCA 4APVA 1ESRA 4FO2A 1BCPC 2AUJD 3M4PA 4DR2L 3VR3A 2OWOA 1DOMA 1X32A 4ODGA 4UP9A 4IUVA 2MO1A 4HSVA 2UXDQ 1FNWA 1AE2A 3MAQA 4AYBG 1GM5A 5K36G 3LNNA 4JI0L 2PQAA 2CFMA 4PZ6A 1JOKA 3R93A 1IYUA 4C56C 1CT1D 2L1BA 1KDCA 3MTSA 1BDOA 3TDQA 5C4JH 1Y8OB 1PH9A 1Q12A 3HOXG 4NKLA 2SOBA 4DN4M 3G7LA 1I6VC 1Q8KA 4YHHL 4ZQ3A 1QE6A 3Q8DA 3JAML 3VA5A 2PNHA 1VQPA 3A54A 4DU9A 1VMCA 3IFTA 2JA9A 2JA7B 1VQDA 2K6AA 1DJRD 2D0PA 2UU9L 1TVXA 4Z9CB 4DV3L 4LFBL 2KEDA 1C8CA 1TWAH 5IT9L 2FINB 3GD7A 3FRPB 1CZWA 4L6TB 3I4LA 2K28A 1KLUD 4WJWA 2JEBI 3IAYA 3OOCA 2FMMA 4A4IA 1XPOA 4BY1H 5C4XG 1L1OB 5E4XA 1U4RA 1XXGA 1GJXA 2Z8LA 3OIPA 2HDLA 3G48A 1A63A 3T13A 2EVBA 2F3IA 4A3CG 2KENA 1GXDC 1R9TH 3DHQA 1QVGA 1BXTA 2MJ8A 2QDLA 1W6KA 4JI6Q 3UDFA 2B63B 1NJIC 1CHQD 5CV9A 1N32Q 1NBWA 3BG3A 3C2PA 5EBDA 2F0PA 1TWGB 2F0JA 2R7DA 4A3GG 1BBUA 2LS01 1S5FD 4R1JA 3D8GA 4JG2A 2XRSD 1E24A 4IUPA 5DNFA 1WTPA 5JOBA 3TP8A 5LL6X 1JWUD 3ITPA 2R7ZG 2K03A 3CW2C 3NTIA 3M3YH 3S17H 3D0FA 4DR7Q 1YI2A 2TSSA 1BUVT 3A7AB 1AEXA 1CKMA 3S15B 3RZDB 1UNSA 4DNTB 1B9NA 1QVCA 1PRTF 1EU3A 4GN5A 2K7VA 4A93B 2F0MA 1GUSA 2R7ZB 2JSOA 1EU4A 3RLFA 3DWQA 2OQ0A 1Z47A 3NWSA 2VQEL 4IFDJ 1IZ6A 2L4NA 4QB4A 3S14H 1C4QA 1R4QB 4Y7NH 1FL0A 4B3ML 2CH4W 1RTOA 3KBXA 3OWEB 2AQ1B 1PRTB 1SE3A 4A3IH 2JA8B 2PMZB 2B2YC 4KY7A 2Z0SA 1HJPA 3MA2B 2X69A 5C3EB 4RKBA 4XXEA 2MHVA 4NXNQ 4KV6A 2EXZA 1JWMD 4FXDA 3J7AF 3X3MA 3MHBA 4BBSG 1AFPA 1YHBA 4DV1L 4DUZL 1NY4A 2KA7A 3CCJA 3QIAA 1GD7A 1PFBA 3PO2H 5J1ZA 3TREA 4A3KB 2PW7A 1HA6A 1CA6A 5J3BA 3GTKB 1DZ1A 4OGQC 1ONLA 2BCOA 5M3FG 2JXMB 4BY7H 4P74A 2ZTCA 4CKCA 2XGTA 1A3VA 2F0NA 2SNSA 2K33A 1K83B 4BWGB 4OO1I 5IGDA 3HOVB 5C44H 2B3GA 4DV4L 1TKWB 3Q0AA 2XN9C 1YJWA 4LF6L 3CQZB 1LTGD 1YHAA 2YTVA 1D6EC 3H0GG 1EY4A 1ASZA 3A7LA 4KK7A 1B50A 5M3MH 3RNUA 4DUYL 4A3EG 4DA2A 2A6EC 4DV0L 1SYGA 5GQOA 4DV6L 5ELEA 4UP7A 4OX9Q 1K0RA 1LM0A 1UEBA 4KY5A 1GOZA 3TQYA 3HRZC 1D5XC 3W5OA 5FOBB 2X6GA 1YHQA 4FYDA 1EWCA 1VQ8A 5IE8A 4TRDA 4DR6L 2WP8J 1FJGL 4C3IB 2H4OA 4JI8L 4A3EB 2KECA 1WCMB 5EKKA 2NVQB 1ESFA 5M5WB 3N52A 3AQQA 1QOHA 1EQQA 4C3HG 4GOPC 4LFCQ 4X66L 2KHJA 2RHSB 3H3VC 3VDYA 3CMAA 1HFGA 1QZGA 3I4MG 2KCNA 5EPLA 4B3TL 4DR5L 3STBD 2LSSA 5IYDH 4OWTB 1YJ9A 1WD0A 4DK0A 4DF7A 1F2MA 3FHWA 4R8IA 2WINB 1PZID 1PZJD 1BBXC 1SNQA 4X64Q 1YNXA 1N36Q 2KHIA 1KAAA 3QO2A 4LF7L 3NK9A 3N6RA 1Y1WG 1UE1A 4CDFC 1YBYA 4F7XA 1F2ZA 1RHPA 3E9HA 1TS4A 1B70B 1IYJB 2F0IA 4JYAQ 3T1YQ 1BO0A 3S1NB 2F0FA 5CGKA 1BF4A 2PO4A 1KD1C 1XNRQ 2DN8A 3F2BA 4DAYA 3R2TA 1DOLA 1JT8A 2ZT9C 4MN3A 1BKBA 3J81L 4ZUJA 1MSGA 1O7YA 1Q1EA 1JMCA 1FGBD 3DLLA 5KYIA 3S16H 4OO1G 3EA6A 4HMJA 4O0AA 1SAPA 4ILWA 3L3OC 4MZ9A 2PZWA 2VQFQ 4V190 3P20A 4RHRA 3ULLA 2A19A 2F52A 2HQEA 1AN8A 2MGSA 4ZLTF 3VR6A 5C3XA 1X3PA 5AFWA 4H02A 4EQPA 1D7QA 4B3SL 1SR3A 1RD9D 5IGFA 1ILQA 2EYPA 1GUNA 4IPCA 4K6LA 4L5RC 5LMNQ 3DM1A 3NBHA 1O7ZA 3D3RA 1RODA 2D62A 3A8JE 2FHTA 1ENAA 2LXJA 1JQYD 2B63H 2F0SA 4P72A 5FK9C 4HIMA 1U4MA 4KY6A 4OXPA 4RGNA 1TWCB 1B2TA 4QGUA 4P2CB 2R61A 5C4XH 1PTOD 3OW2A 4QL5A 2N88A 4XT3B 2DNEA 4RHSA 5C0XI 3A56A 4XT1B 4CJ1B 3LGJA 4XQJA 1HTPA 1BCPB 2NVXB 2A73B 5FO7B 3OTOL 2ICIA 4K2LA 3RZDH 3K5MA 2OEOA 3AEVA 1GVPA 1LTAD 1STBA 2NBFA 1SNPA 5C6AA 1E7ZA 4IUQA 5D14A 1M4VA 4G7OC 2R7ZH 3HKZG 4KHVA 3K0YA 4A3MB 2E2IB 3BZKA 4N8X1 2Y0SB 1F9RA 4JVZA 4BXXG 2ENBA 2R93B 2B2TA 2N8NA 1EYAA 5IODA 1HNZL 2VY3A 1C0AA 4KHPQ 3I4NG 4JI2L 4DV7L 2BA0A 4C1NI 3AU7A 2VB3X 1MSHA 1S5DD 1B44D 1FD7D 3HKZB 2I46A 2WFWA 2QW7A 1VQMA 4L63B 1IBLL 2E5LL 1Q7YC 3QJYA 3HOUG 2JA8H 4A3LG 2TMPA 1LTBD 1WTOA 3S2HH 4RFBA 4RWSC 4R4TA 5GADC 2B2WC 3I4NB 3HOYB 3HGBA 1LYLA 1IYVA 4JC0A 4N8FA 2F0LA 2LKVA 1V1PA 4JI7Q 1EYDA 1SE4A 2NB0A 3R2IA 1STHA 4IJHA 4U68A 1BR9A 2N78A 1CSQA 1VCIA 2LMCB 3A0JA 1HNWQ 4A3KH 1B9MA 1STGA 1EQVA 4DR4L 1PVOA 2YTXA 2BH8A 3I73A 1SE2A 4JOIC 2QEXA 4UPAA 5BN3A 5ELFA 5COYA 1KHIA 2M9VA 3J80L 3G6EA 1LT4D 1A2UA 4J6HA 3D4DA 4FF2A 4BBSH 1AE3A 1K83H 2XSCA 1I94L 3HOVH 4JBJA 1EZ6A 3F2DA 4DR3L 2ZXPA 1Y1VB 3K7AB 5M5XB 3OSOA 1K73C 2ASBA 4XDXA 3MEHA 1QB5D 3S1MB 3C1FA 3WOFA 4DR1L 1IXRA 5FO8B 2UXCQ 1E0BA 2JEAI 1I4RA 3CRKC 4P71A 1CQVA 3KYHC 1RL2A 3GV6A 1H9JA 3EN2A 1N8RC 1O78A 3W2DA 5C0XG 2PZTA 4JI1L 2EY2A 5CV8A 3KOJA 2RSNA 3H0GH 4JK1C 1BOSA 3PGZA 1NCVA 2K4KA 1IBLQ 1YNNC 4C3IH 2VXWA 5IP9G 4A3EH 3M9BA 1SYEA 2PQEA 3L9AX 4DV5Q 2HHHL 4BY7G 4GKKL 2NVTB 2NVQH 2AHOB 1XMQL 3E5SA 5M5WH 1Q86C 1JORA 2F0VA 3M4OB 5BN5A 2K05A 3M4YA 1SNCA 5C44G 1L0XB 5C4ZA 3J80E 1WTQA 2F0KA 1T5XD 2K5QA 4WORA 4WJ3M 3EJIA 4IQZA 2XTIA 4K8IA 4LF5Q 1HNXL 2UUCQ 4CBVA 3BVMA 4KTAA 4FF4A 3PUXA 1TT2A 3LWEA 4R8NA 4FP5D 1U0LA 1N34L 3PUYA 5LHY1 2FXQA 4JI4L 4C3HH 2EYFA 5JJZA 3SGIA 2VUMB 4H13C 3EBEA 2PZUA 1CHPD 2Q8TA 1XNQQ 3KDFA 4IALA 4R4IA 4DV2Q 1ZYRC 2PI2E 3I4MH 4XQNA 1PTOF 2B2VC 1QWYA 5ELBA 1QUQB 5I9OA 2JQOA 1HZAA 3DWPA 1ZKOA 2N55A 2D5DA 4GKJQ 5I2YA 1UEAB 5IT9c 3S1NH 1XMOL 5FJ8G 2MO0A 2JN4A 1EEID 5I6WA 4AIMA 3X3NA 4BA2I 2WB1E 3M7GA 2O4XA 1U4LA 3TP5A 2RDGA 4NXMQ 4X3UA 1VMPA 4UDUC 1E1OA 2QILA 3FEWX 4IJLA 2HHHQ 4A3BG 5EGTA 3ZJYC 2K5WA 4DAMA 3BZDB 2C9OA 5KIXA 3BYTB 4QCLA 3NXWA 2HUGA 1TWHB 1MJCA 3GTMB 1DOKA 5I2XA 1JC7A 1F77A 3J7ZC 1N33Q 3CCSA 1YEZA 3MXNB 4QJFA 1VQ7A 1EWHA 4LF8Q 1V1OA 1G2TA 3AFQA 2HQLA 4OO1H 3T53B 3RZOB 2Z1CA 2EXDA 4K5WA 4MNOA 4YCUA 2AUKA 4HJ8A 3CRLC 5GROA 1HQMC 4IOAA 2B2UC 2I5HA 3MC0B 1B8AA 3R3OA 3CCQA 1F2YA 2CWPA 1DCZA 1VQHA 2AMCB 5IWAQ 4XTCS 2YU9H 2PMZE 2MFIA 1SMYC 1AP0A 4GOPB 1TWCH 2SEBD 4S3SA 3FPUB 1PMRA 4B3RL 1H9RA 1PYBA 4JV5Q 2JA7G 1C9OA 3NQTA 1KNAA 2L5TA 4C2MB 1HRJA 2B29A 1O7IA 3CC7A 1H9KA 1D5ZC 1I50H 4L8JA 3PF5A 1PH1A 1QILA 4DNRB 1FVIA 1L1OA 2NVXH 2PI2A 1M1KC 3FVQA 4ZK9B 1D8LA 2RVLA 2GN5A 3NEMA 2CQAA 2RDHA 5FLMG 5CMDA 3DUZA 1GKHA 3SXHA 4AQYQ 5HGTA 1YNND 1FR3A 3I2ZA 1WTVA 3WDNA 3UE1A 2E2IH 1B3AA 1Z6HA 1S5BD 2EYJA 1YNJD 2KEEA 1C48A 5J39A 1IKMA 1IHZA 4PQXA 4LFAL 2R93H 3VR5A 2B63G 4HAEA 1SYCA 3K59A 1HTLD 1DXMA 4RG1A 3SHLA 4CDDC 3PMFA 4F88A 1WTXA 3LWUA 1JCKB 3PIOA 4IFDI 3K58A 4DR2Q 4B9XA 4HEDA 4R9WA 2PPBC 1K3BC 3EIVA 1CA5A 2MPMA 4ALPA 1PDQA 2WB1G 1JICA 2B2TC 5JEAJ 4B9WA 3HOWG 5I9PA 4BXXH 4IUTA 3NELA 3QOJA 2K75A 2IX1A 4DAPA 4JI0Q 1Y8PB 1T9HA 3M7NA 3I4NH 3MVVA 3HOYH 3HKSA 1STYA 2ZM6L 1K8MA 3STBC 2JYOA 4QF4A 3RMHA 2E8GA 1B3QA 4R4QA 4G57A 4R4OA 3JAME 1HR0W 4HIOA 3U4VA 1DYQA 2WB1B 3E0JA 4A93G 3HFZB 4U673 1EYCA 1ZYRD 2DJGC 3HOUH 3HOWB 4A3LH 3F1ZA 1QNKA 3EROA 4YCWA 4YHHQ 5IT9E 1J9OA 4MHEA 4X3KA 1S40A 3DWAA 5BR8L 4Q0FA 4IN3A 3HS0C 1XYIA 2JK8A 1EWIA 1YZ6A 3MXPA 4X3TA 2PYKA 3K7AH 2HIVA 3E3XA 2UU9Q 3NPPA 1VF7A 4DV3Q 3E0EA 4LF9L 4LFBQ 1OXVA 5CBEE 3S1MH 4DK3C 4A3FB 4HR7B 3D6CA 1M90C 3GTPB 2JA8G 3BVZA 5FLXL 3JC66 2H1EA 2MUYA 2KCTA 3I4OA 1D2BA 5C5MA 5C3EG 2F4VL 2E2JB 1NTGA 2KOLA 4KKUA 2RCNA 5DM73 2LY7A 1SFOB 3T56B 1RF2D 1V43A 1X55A 1NE3A 3CCEA 1QZHA 2JA6B 4A3KG 1SROA 1X3EA 2NN6I 2BE5C 4KN7C 1SLJA 1HFNA 3GTOB 2ZTEA 2K50A 3CPWA 2NVTH 1CM9A 2F0TA 3M4OH 4BA1I 2R7FA 2F0QA 2ES2A 3HOVG 4MTKA 5C0XH 1DGSA 1V8QA 1IBML 3BZCA 3GQBA 5ELCA 3J7YW 1B7YB 1SNOA 5IP9H 1SN8A 4ZAIA 4JI5L 2PCFB 5K5PA 1SMYD 2F0HA 3TZUA 5EAYA 4A3DB 3GTJB 1HZCA 4IFDG 4KLKA 2L55A 4RGTA 1ML0D 4FF3A 1EL0A 4JCVE 1PTOC 3PUWA 2D2CC 3H91A 4HJ9A 2IX3A 1VQFA 2EY1A 4RGOS 4RGMA 3K5LA 3V96A 2VQEQ 4C3IG 1G6ZA 2A68C 1WCMG 2BDNA 2O5IC 2JA5B 4M1UB 1F9QA 1VQCA 4CDEC 1ICFB 4H44C 4G7HC 4B3MQ 4FDBA 1RDPD 1ILPA 2CVRA 4GNXC 2UUBL 4JI3L 4ZKCB 4CJ0B 3PIO3 1ZXTA 1DD2A 2LXKA 2M2LA 2ALYB 3IKJA 1KNEA 2Z6KC 3VR4A 3DEPA 4DV1Q 4DFAA 3A8KE 4DUZQ 1S3OA 4P73A 5FJ8H
chains in the Genus database with same CATH topology
1K3RA 1HR0L 3BJUA 3UDXA 2R7ZH 1TWHH 3U4ZA 3S1RH 3HKZG 1HZBA 1FGUA 4PZ8A 3KFUA 3BZKA 4LUVA 5IYCG 4GNXA 2JE6I 1GO3E 4A3FG 1TWFH 4LF4L 4QY7A 4BXXG 3CAMA 5IWAL 2L15A 1QVFA 3AYHB 2N8NA 3NENA 4HIDA 4LUOA 4NXNL 1HNZL 2VY3A 4HJ7A 4A3BH 2Y0SE 4KHPQ 3I4NG 1C0AA 1VQOA 2OTLA 2AWOA 4JI2L 4TVAB 1PH7A 4BBRG 4DV7L 1HZ9A 4DV4Q 1EOVA 4JV5L 1E22A 2BA0A 2IT1A 2Z6KA 2A8VA 1Y1VH 1K8GA 3OYYA 2K52A 4HJAA 4LF6Q 5M5XH 1VQJA 1VQMA 2WFWA 4IOCA 1S72A 2QGQA 3AFPA 1I3QH 4P75A 1KL9A 3GO5A 1Q7YC 1IBLL 2E5LL 3CCLA 2YTYA 4OONA 2NN6G 2JA6G 2JA8H 4GN4B 4A3LG 3S2HH 3HKZE 2I5MX 2OCEA 4R4TA 1LTLA 4A76A 5GADC 3B6YA 4YY3L 4GLAC 4DUYQ 4LFAQ 1Y1WH 3RLNA 1LYLA 1XPUA 3MEFA 5JEAG 4DV0Q 2RF4A 5GAEC 2IY5B 2V1CC 1Q81C 4JC0A 5IYDG 4DV6Q 3KDFB 2VL6A 5LMNW 1J5EL 1VQBA 4GNXB 1X3GA 4PZ7A 4JI7Q 1PFSA 1WI5A 4IJHA 3H3VH 1V1QA 3CXCA 3CCMA 2N78A 1CSQA 1VCIA 3A0JA 3M4QA 4IO9A 1HNWQ 4AQYL 4A3KH 1PYSB 1OXXK 1X65A 2NVYH 5DLQE 5ELNA 4HJ5A 1PH5A 4L5SA 4DR4L 4DR6Q 1PVOA 2YTXA 2BH8A 2QEXA 4JOIC 3L2PA 1FJGQ 3ERSX 4UPAA 2C35B 4JI8Q 4L5QA 1KC8C 1KHIA 3G6EA 1VQNA 3CC2A 1KRSA 3T1HL 4APVA 2ZM6Q 1AE3A 3UDGA 1K83H 4BBSH 3M4PA 1J6QA 1I94L 4OX9L 4JBJA 3HOVH 4A3DG 1RIPA 3F2DA 4DR2L 4DR3L 2JA7H 2VS1A 3K80C 2YYZA 2OWOA 2Q2HA 4LWCA 1WYDA 5GAHC 4K0KL 1I6HH 1X56A 1K73C 2ASBA 4UP9A 2MO1A 1EQRA 4X66Q 5IY0A 2UXDQ 2UXCQ 4DR1L 1IXRA 2A1AA 2JEAI 1AE2A 1GM5A 4AYBG 3TRZA 5K36G 4P71A 4JBKA 3KYHC 1Z9FA 4JI0L 4JOIA 4B3TQ 2PQAA 2CFMA 4PZ6A 4PMWA 4DR5Q 3A74A 1RL2A 1UWVA 1EIYB 3F2CA 3J7A5 5BR8Q 2ZJQA 2JA5G 4LNQA 3EN2A 1N8RC 1KXLA 5FLMH 5C0XG 4RMFA 3I55A 1VQIA 4JI1L 4LFCL 5C4JH 2VUMH 3KOJA 1PH9A 3H0GH 3I7FA 3K7UC 4LF9Q 1Q12A 3HOXG 1NMGA 3PGZA 2K4KA 4DPGA 1IBLQ 3U58A 3J80c 2ZTDA 3J81c 4C3IH 1Q8KA 1IBKL 5IP9G 4YHHL 4A3EH 4LF7Q 3M9BA 3Q8DA 1JJGA 3PCOB 4GKKL 4DV5Q 2HHHL 4BY7G 2NVQH 5IYBG 2AHOB 2PNHA 2F4VQ 1XMQL 3KLWA 1VQPA 5M5WH 2EIFA 1Q86C 2WAQG 1TWGH 2JA9A 5C44G 1VQDA 2D0PA 4A75A 1UE7A 1XPRA 2UU9L 4DV3L 4LFBL 4R4CA 4WJ3M 3KJPA 1TWAH 2XTIA 4X64L 3GD7A 4LF5Q 1N36L 3HOWH 2E2HH 1WOCA 1HNXL 3HOZG 2I0QA 2UUCQ 4A3MG 2Y0SG 5IP7G 4IPGA 4LW1A 3DM3A 3GTQH 2JEBI 3PUXA 2R93G 3PUVA 4A4IA 1PHJA 1XPOA 1U0LA 1WFQA 1N34L 3S15H 4BY1H 2OTJA 3PUYA 4JYAL 2GVAA 2FXQA 3JAMi 4C3HH 3T1YL 4JI4L 1YVCA 4XIGS 5C4XG 1L1OB 4OWXB 1CSPA 4A93H 3G48A 3SGIA 1XNRL 4POGA 4Y52H 1A63A 3EBEA 1IBMQ 1AH9A 4A3CG 2F3IA 2KENA 1PH3A 1R9TH 1PH8A 3GTMH 5IYCH 1XNQQ 1QVGA 1UE6A 4A3FH 3KDFA 4R4IA 2R92G 4DV2Q 2PI2E 4X62L 3GTPH 3I4MH 4JI6Q 3UDFA 2Q2IA 4JI5Q 1NJIC 4YCVA 4B3SQ 4UP8A 5HY6A 1N32Q 1NBWA 1E3PA 3HOYG 1W2BA 4BBRH 2BH2A 3RZOH 2R7DA 4A3GG 1BBUA 1NMFA 4YWKA 1QUQB 5JJKA 1SFOH 2VZAA 3K8AA 2JQOA 1HZAA 3GDEA 2VQFL 4GLXA 4R1JA 2MQHA 4GKJQ 4JG2A 1CKNB 5IT9c 3S1NH 4J15A 1E24A 1XTDA 1XMOL 5FJ8G 2MO0A 1JJCB 5ELOA 2JA6H 2R7ZG 3CW2C 4AIMA 3M3YH 1JB7A 2WB1E 4BA2I 1VQ4A 3S17H 3D0FA 1EUJA 1V9PA 4X65L 3PIPA 4NXMQ 4DR7Q 2GVBA 5C3EH 1YI2A 1E1OA 3L0OA 3GTOH 4IJLA 2HHHQ 2AWNA 4AH6A 3IRBA 1CKMA 4A3BG 3ICEA 5AJ3L 3ZJYC 1P16A 4DAMA 4HIKA 1QVCA 5LMNL 4GN5A 4NPSA 3GTGH 1Y1VG 4C2MH 2NZHA 4UY8C 5E7NA 1MJCA 1LUZA 3KF6B 2UUBQ 3CP0A 3RLFA 3S24A 3J7ZC 1N33Q 3CCSA 1YEZA 3GTKH 3MXNB 4QJFA 1VQ7A 2OQ0A 4JI3Q 1Z47A 4LF8Q 2VQEL 3AFQA 4IFDJ 1KAWA 2HQLA 3KJOA 1IL2A 1PH4A 1IZ6A 3CPFA 2UUAL 3OTOQ 3S14H 2UXBL 4A3DH 4JBWA 4Y7NH 2EXDA 2H5XA 1FL0A 1VS0A 3KF8B 4MNOA 4YCUA 1A8VA 3GTJH 4ME3A 1MIUA 1KQSA 4B3ML 1YITA 4HJ8A 4NB3A 4QQBX 3CQZH 3CCUA 5GROA 4IOAA 4A3IH 1HR0Q 2I5HA 1B8AA 1L1OC 3I56A 1SMXA 3CCQA 2CWPA 2Z0SA 5FJ8H 1HJPA 1VQHA 1X9NA 4LF4Q 2DGYA 2AMCB 1L2FA 5IWAQ 3CD6A 4XTCS 2YU9H 2PMZE 4X6AH 2OQKA 1HNZQ 3RN2A 2MFIA 1Q82C 4NXNQ 4GOPB 1TWCH 4BBSG 1X6OA 1YHBA 4JI2Q 4DV1L 4DV7Q 4DUZL 1PYBA 4B3RL 1NY4A 3FP9A 3CCJA 4JV5Q 2JA7G 1C9OA 2IHEA 1GD7A 5HGQA 3PO2H 3H3VI 3TREA 2K5NA 3HOXH 2B29A 1Q1BA 1O7IA 3CC7A 4WJ4A 3W1BA 1Y14B 5J3BA 1I50H 3PF5A 2E5LQ 1PH1A 3HOUG 3TEHB 3CCRA 1FVIA 4DKAC 3RLOA 5M3FG 1L1OA 1WCMH 4BY7H 4P74A 2ZTCA 2XGTA 2NVXH 2PI2A 4YY3Q 4KHPL 3CCVA 1M1KC 1OXTA 4OWWB 2QA4A 4YWMA 4DAYB 4OO1I 5C44H 2B3GA 1D8LA 2K5HA 3H15A 4DV4L 1J5EQ 2GN5A 1YJWA 1JJ2A 4LF6L 3NEMA 1YHAA 2YTVA 1H95A 5FLMG 1I5FA 2ATWA 1GKHA 4AQYQ 2ZJPA 2VUMG 3H0GG 3I2ZA 4DR4Q 1ASZA 3HOZH 3UE1A 2N3SA 2E2IH 1QUQA 3PO3G 5IP7H 5M3MH 3RNUA 4DUYL 1CKNA 4A3EG 4LFAL 2R93H 2B63G 4DV0L 4C3JH 1XJVA 5GQOA 3T1HQ 4RG1A 4DV6L 4JI7L 4UP7A 1I94Q 4OX9Q 1K0RA 1LM0A 3PIOA 4IFDI 1UEBA 2CCZA 4DR2Q 4DR3Q 3S1QH 3EIVA 1HNWL 3TQYA 3W5OA 4ALPA 4A3CH 1YHQA 4K0KQ 2WB1G 1G291 1VQ8A 5IE8A 1E1TA 3ULPA 4DR6L 2WP8J 1FJGL 4DR1Q 5JEAJ 3TS0A 2RHQB 4A3JG 3HOWG 4BXXH 3JAMc 1UE5A 4JI8L 1N9WA 1SE8A 1CKOA 1VQ5A 3NELA 3PV0A 2K75A 5GAGC 2IX1A 1L0WA 4JI0Q 1T9HA 3M7NA 2JJQA 3I4NH 3HOYH 2CWAA 3HKSA 3NBHB 2ZM6L 2E2JH 3STBC 4A3GH 3AQQA 3BU2A 3KF6A 1EQQA 4BY1G 2E8GA 3FKIG 2ID0A 3U50C 2VW9A 4R4QA 4L5TA 4R4OA 1HR0W 4HIOA 3U4VA 4GOPC 3WWVA 4JI1Q 1WJJA 3M85A 3HFZB 4X66L 3A5UA 4LFCQ 2KHJA 4EQ5A 2RHSB 3PSIA 4A93G 3HOUH 1VQLA 2UXCL 2UXDL 1G6PA 4A3LH 2EQSA 1A62A 3F1ZA 3VDYA 3CMAA 5LMUL 1QZGA 1EFWA 3I4MG 1IBKQ 4YCWA 4YHHQ 4GN3B 4B3TL 1K8AC 4DR5L 3STBD 4GKKQ 2K14A 2LSSA 1S40A 1VQ6A 5BR8L 5IYDH 2BA1A 4DK6C 5M5YH 4OWTB 1YJ9A 1XMQQ 1VQ9A 2JK8A 3D31A 1EWIA 1YZ6A 2N49A 3ER0A 3FHWA 1KRTA 4EX5A 2Q2UA 1CUKA 3K7AH 2HIVA 2UU9Q 2IX0A 3A5ZB 4DV3Q 3E0EA 4LF9L 2IHFA 1OXVA 3L7ZC 4LFBQ 4GOPA 3S1MH 4DK3C 4X64Q 1YNXA 1N36Q 1M90C 2KHIA 2JA8G 1HNXQ 3JC66 4LF7L 1MJEA 1SRUA 4DV5L 2KCTA 3I4OA 4GLVB 1Y1WG 1PV4A 1OXUA 5C3EG 1UE1A 4QIWE 1K9MC 2F4VL 1NTGA 5C0XJ 1YBYA 2RCNA 1N34Q 1ASYA 3F8TA 1VQKA 2HT1A 3E9HA 1OTCA 1B70B 1IYJB 4KHZA 4JYAQ 1V43A 3T1YQ 4JI4Q 2KBNA 1X55A 4GS3A 4YWLA 5H1SE 1NE3A 1KD1C 3CCEA 1XNRQ 1U5KA 1G51A 4IPHA 1QZHA 3S2DH 3F2BA 4A3KG 4LF5L 2HIXA 2R6GA 3K0XA 1PH2A 1SROA 1X3EA 2CKZB 1JT8A 3E9IA 2UUCL 2K5VA 1BKBA 2I5LX 2NN6I 1SLJA 4X62Q 1BVSA 2ZTEA 4DNIA 2K50A 3CPWA 1Q1EA 2NVTH 1JMCA 3DLLA 3S16H 4OO1G 3M4OH 4BA1I 2JA5H 2R7FA 4O0AA 2ES2A 3HOVG 3W1GA 2VQFQ 1DGSA 4MZ9A 4PG3A 1IBML 1XMOQ 3BZCA 3ULLA 2A19A 2F52A 5FLXc 3UE0A 4A3IG 1XNQL 2VNUD 2Q2TA 1TXYA 4DV2L 1B7YB 1Q46A 5IP9H 4JI6L 5M3FH 1SN8A 5LMUQ 4X65Q 4JI5L 4H02A 4LUZA 1D7QA 5IYBH 4B3SL 1SR3A 3PF4A 1N32L 1OXSC 5EAYA 4IPDA 1HZCA 3G4SA 1MKHA 4IPCA 4IFDG 1VQEA 4KLKA 5AJ3Q 3J80i 3J81i 4JBMA 3CF5A 3RN5A 4L5RC 4GKJL 4JCVE 1PA6A 5LMNQ 1JE5A 3PO2G 3PUWA 1HH2P 2YV5A 3K81C 1KIXA 1YIJA 2AKWB 3PO3H 4POFA 4HJ9A 1VQFA 1W3SA 4A3MH 2D62A 1EYGA 2D0OA 5JJLA 4NXML 2LXJA 3G71A 4KI0A 2VQEQ 1P8LA 4DR7L 2B63H 4P72A 5JJIA 1WCMG 4AYBE 4HIMA 4OXPA 2UUAQ 3J81j 1C7YA 4O2DA 2NZOA 2UXBQ 3CMEA 2MNAA 4QGUA 1PH6A 5C4XH 1VQCA 3OW2A 4QL5A 4B3MQ 4FDBA 3RR5A 3CC4A 1VQAA 2PQAB 5C0XI 3LGJA 3GTLH 4GNXC 1BBWA 2UUBL 4TQUS 4MTNA 3ULJA 2R92H 1N33L 4A3JH 4JI3L 4LF8L 1X54A 1YJNA 1X3FA 2DUDA 5M3MG 2ZJRA 2LXKA 3OTOL 1A0IA 2ALYB 1EIFA 3PUZA 3TS2A 2Z6KC 3RZDH 3FKIH 3UDIA 3AEVA 1GVPA 4DV1Q 4B3RQ 4DUZQ 1VQGA 2WAQE 1S3OA 4P73A 2KCMA 2CQOA 1E7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3R A;  1HR0 L;  3BJU A;  3UDX A;  2R7Z H;  1TWH H;  3U4Z A;  3S1R H;  3HKZ G;  1HZB A;  1FGU A;  4PZ8 A;  3KFU A;  3BZK A;  4LUV A;  5IYC G;  4GNX A;  2JE6 I;  1GO3 E;  4A3F G;  1TWF H;  4LF4 L;  4QY7 A;  4BXX G;  3CAM A;  5IWA L;  2L15 A;  1QVF A;  3AYH B;  2N8N A;  3NEN A;  4HID A;  4LUO A;  4NXN L;  1HNZ L;  2VY3 A;  4HJ7 A;  4A3B H;  2Y0S E;  4KHP Q;  3I4N G;  1C0A A;  1VQO A;  2OTL A;  2AWO A;  4JI2 L;  4TVA B;  1PH7 A;  4BBR G;  4DV7 L;  1HZ9 A;  4DV4 Q;  1EOV A;  4JV5 L;  1E22 A;  2BA0 A;  2IT1 A;  2Z6K A;  2A8V A;  1Y1V H;  1K8G A;  3OYY A;  2K52 A;  4HJA A;  4LF6 Q;  5M5X H;  1VQJ A;  1VQM A;  2WFW A;  4IOC A;  1S72 A;  2QGQ A;  3AFP A;  1I3Q H;  4P75 A;  1KL9 A;  3GO5 A;  1Q7Y C;  1IBL L;  2E5L L;  3CCL A;  2YTY A;  4OON A;  2NN6 G;  2JA6 G;  2JA8 H;  4GN4 B;  4A3L G;  3S2H H;  3HKZ E;  2I5M X;  2OCE A;  4R4T A;  1LTL A;  4A76 A;  5GAD C;  3B6Y A;  4YY3 L;  4GLA C;  4DUY Q;  4LFA Q;  1Y1W H;  3RLN A;  1LYL A;  1XPU A;  3MEF A;  5JEA G;  4DV0 Q;  2RF4 A;  5GAE C;  2IY5 B;  2V1C C;  1Q81 C;  4JC0 A;  5IYD G;  4DV6 Q;  3KDF B;  2VL6 A;  5LMN W;  1J5E L;  1VQB A;  4GNX B;  1X3G A;  4PZ7 A;  4JI7 Q;  1PFS A;  1WI5 A;  4IJH A;  3H3V H;  1V1Q A;  3CXC A;  3CCM A;  2N78 A;  1CSQ A;  1VCI A;  3A0J A;  3M4Q A;  4IO9 A;  1HNW Q;  4AQY L;  4A3K H;  1PYS B;  1OXX K;  1X65 A;  2NVY H;  5DLQ E;  5ELN A;  4HJ5 A;  1PH5 A;  4L5S A;  4DR4 L;  4DR6 Q;  1PVO A;  2YTX A;  2BH8 A;  2QEX A;  4JOI C;  3L2P A;  1FJG Q;  3ERS X;  4UPA A;  2C35 B;  4JI8 Q;  4L5Q A;  1KC8 C;  1KHI A;  3G6E A;  1VQN A;  3CC2 A;  1KRS A;  3T1H L;  4APV A;  2ZM6 Q;  1AE3 A;  3UDG A;  1K83 H;  4BBS H;  3M4P A;  1J6Q A;  1I94 L;  4OX9 L;  4JBJ A;  3HOV H;  4A3D G;  1RIP A;  3F2D A;  4DR2 L;  4DR3 L;  2JA7 H;  2VS1 A;  3K80 C;  2YYZ A;  2OWO A;  2Q2H A;  4LWC A;  1WYD A;  5GAH C;  4K0K L;  1I6H H;  1X56 A;  1K73 C;  2ASB A;  4UP9 A;  2MO1 A;  1EQR A;  4X66 Q;  5IY0 A;  2UXD Q;  2UXC Q;  4DR1 L;  1IXR A;  2A1A A;  2JEA I;  1AE2 A;  1GM5 A;  4AYB G;  3TRZ A;  5K36 G;  4P71 A;  4JBK A;  3KYH C;  1Z9F A;  4JI0 L;  4JOI A;  4B3T Q;  2PQA A;  2CFM A;  4PZ6 A;  4PMW A;  4DR5 Q;  3A74 A;  1RL2 A;  1UWV A;  1EIY B;  3F2C A;  3J7A 5;  5BR8 Q;  2ZJQ A;  2JA5 G;  4LNQ A;  3EN2 A;  1N8R C;  1KXL A;  5FLM H;  5C0X G;  4RMF A;  3I55 A;  1VQI A;  4JI1 L;  4LFC L;  5C4J H;  2VUM H;  3KOJ A;  1PH9 A;  3H0G H;  3I7F A;  3K7U C;  4LF9 Q;  1Q12 A;  3HOX G;  1NMG A;  3PGZ A;  2K4K A;  4DPG A;  1IBL Q;  3U58 A;  3J80 c;  2ZTD A;  3J81 c;  4C3I H;  1Q8K A;  1IBK L;  5IP9 G;  4YHH L;  4A3E H;  4LF7 Q;  3M9B A;  3Q8D A;  1JJG A;  3PCO B;  4GKK L;  4DV5 Q;  2HHH L;  4BY7 G;  2NVQ H;  5IYB G;  2AHO B;  2PNH A;  2F4V Q;  1XMQ L;  3KLW A;  1VQP A;  5M5W H;  2EIF A;  1Q86 C;  2WAQ G;  1TWG H;  2JA9 A;  5C44 G;  1VQD A;  2D0P A;  4A75 A;  1UE7 A;  1XPR A;  2UU9 L;  4DV3 L;  4LFB L;  4R4C A;  4WJ3 M;  3KJP A;  1TWA H;  2XTI A;  4X64 L;  3GD7 A;  4LF5 Q;  1N36 L;  3HOW H;  2E2H H;  1WOC A;  1HNX L;  3HOZ G;  2I0Q A;  2UUC Q;  4A3M G;  2Y0S G;  5IP7 G;  4IPG A;  4LW1 A;  3DM3 A;  3GTQ H;  2JEB I;  3PUX A;  2R93 G;  3PUV A;  4A4I A;  1PHJ A;  1XPO A;  1U0L A;  1WFQ A;  1N34 L;  3S15 H;  4BY1 H;  2OTJ A;  3PUY A;  4JYA L;  2GVA A;  2FXQ A;  3JAM i;  4C3H H;  3T1Y L;  4JI4 L;  1YVC A;  4XIG S;  5C4X G;  1L1O B;  4OWX B;  1CSP A;  4A93 H;  3G48 A;  3SGI A;  1XNR L;  4POG A;  4Y52 H;  1A63 A;  3EBE A;  1IBM Q;  1AH9 A;  4A3C G;  2F3I A;  2KEN A;  1PH3 A;  1R9T H;  1PH8 A;  3GTM H;  5IYC H;  1XNQ Q;  1QVG A;  1UE6 A;  4A3F H;  3KDF A;  4R4I A;  2R92 G;  4DV2 Q;  2PI2 E;  4X62 L;  3GTP H;  3I4M H;  4JI6 Q;  3UDF A;  2Q2I A;  4JI5 Q;  1NJI C;  4YCV A;  4B3S Q;  4UP8 A;  5HY6 A;  1N32 Q;  1NBW A;  1E3P A;  3HOY G;  1W2B A;  4BBR H;  2BH2 A;  3RZO H;  2R7D A;  4A3G G;  1BBU A;  1NMF A;  4YWK A;  1QUQ B;  5JJK A;  1SFO H;  2VZA A;  3K8A A;  2JQO A;  1HZA A;  3GDE A;  2VQF L;  4GLX A;  4R1J A;  2MQH A;  4GKJ Q;  4JG2 A;  1CKN B;  5IT9 c;  3S1N H;  4J15 A;  1E24 A;  1XTD A;  1XMO L;  5FJ8 G;  2MO0 A;  1JJC B;  5ELO A;  2JA6 H;  2R7Z G;  3CW2 C;  4AIM A;  3M3Y H;  1JB7 A;  2WB1 E;  4BA2 I;  1VQ4 A;  3S17 H;  3D0F A;  1EUJ A;  1V9P A;  4X65 L;  3PIP A;  4NXM Q;  4DR7 Q;  2GVB A;  5C3E H;  1YI2 A;  1E1O A;  3L0O A;  3GTO H;  4IJL A;  2HHH Q;  2AWN A;  4AH6 A;  3IRB A;  1CKM A;  4A3B G;  3ICE A;  5AJ3 L;  3ZJY C;  1P16 A;  4DAM A;  4HIK A;  1QVC A;  5LMN L;  4GN5 A;  4NPS A;  3GTG H;  1Y1V G;  4C2M H;  2NZH A;  4UY8 C;  5E7N A;  1MJC A;  1LUZ A;  3KF6 B;  2UUB Q;  3CP0 A;  3RLF A;  3S24 A;  3J7Z C;  1N33 Q;  3CCS A;  1YEZ A;  3GTK H;  3MXN B;  4QJF A;  1VQ7 A;  2OQ0 A;  4JI3 Q;  1Z47 A;  4LF8 Q;  2VQE L;  3AFQ A;  4IFD J;  1KAW A;  2HQL A;  3KJO A;  1IL2 A;  1PH4 A;  1IZ6 A;  3CPF A;  2UUA L;  3OTO Q;  3S14 H;  2UXB L;  4A3D H;  4JBW A;  4Y7N H;  2EXD A;  2H5X A;  1FL0 A;  1VS0 A;  3KF8 B;  4MNO A;  4YCU A;  1A8V A;  3GTJ H;  4ME3 A;  1MIU A;  1KQS A;  4B3M L;  1YIT A;  4HJ8 A;  4NB3 A;  4QQB X;  3CQZ H;  3CCU A;  5GRO A;  4IOA A;  4A3I H;  1HR0 Q;  2I5H A;  1B8A A;  1L1O C;  3I56 A;  1SMX A;  3CCQ A;  2CWP A;  2Z0S A;  5FJ8 H;  1HJP A;  1VQH A;  1X9N A;  4LF4 Q;  2DGY A;  2AMC B;  1L2F A;  5IWA Q;  3CD6 A;  4XTC S;  2YU9 H;  2PMZ E;  4X6A H;  2OQK A;  1HNZ Q;  3RN2 A;  2MFI A;  1Q82 C;  4NXN Q;  4GOP B;  1TWC H;  4BBS G;  1X6O A;  1YHB A;  4JI2 Q;  4DV1 L;  4DV7 Q;  4DUZ L;  1PYB A;  4B3R L;  1NY4 A;  3FP9 A;  3CCJ A;  4JV5 Q;  2JA7 G;  1C9O A;  2IHE A;  1GD7 A;  5HGQ A;  3PO2 H;  3H3V I;  3TRE A;  2K5N A;  3HOX H;  2B29 A;  1Q1B A;  1O7I A;  3CC7 A;  4WJ4 A;  3W1B A;  1Y14 B;  5J3B A;  1I50 H;  3PF5 A;  2E5L Q;  1PH1 A;  3HOU G;  3TEH B;  3CCR A;  1FVI A;  4DKA C;  3RLO A;  5M3F G;  1L1O A;  1WCM H;  4BY7 H;  4P74 A;  2ZTC A;  2XGT A;  2NVX H;  2PI2 A;  4YY3 Q;  4KHP L;  3CCV A;  1M1K C;  1OXT A;  4OWW B;  2QA4 A;  4YWM A;  4DAY B;  4OO1 I;  5C44 H;  2B3G A;  1D8L A;  2K5H A;  3H15 A;  4DV4 L;  1J5E Q;  2GN5 A;  1YJW A;  1JJ2 A;  4LF6 L;  3NEM A;  1YHA A;  2YTV A;  1H95 A;  5FLM G;  1I5F A;  2ATW A;  1GKH A;  4AQY Q;  2ZJP A;  2VUM G;  3H0G G;  3I2Z A;  4DR4 Q;  1ASZ A;  3HOZ H;  3UE1 A;  2N3S A;  2E2I H;  1QUQ A;  3PO3 G;  5IP7 H;  5M3M H;  3RNU A;  4DUY L;  1CKN A;  4A3E G;  4LFA L;  2R93 H;  2B63 G;  4DV0 L;  4C3J H;  1XJV A;  5GQO A;  3T1H Q;  4RG1 A;  4DV6 L;  4JI7 L;  4UP7 A;  1I94 Q;  4OX9 Q;  1K0R A;  1LM0 A;  3PIO A;  4IFD I;  1UEB A;  2CCZ A;  4DR2 Q;  4DR3 Q;  3S1Q H;  3EIV A;  1HNW L;  3TQY A;  3W5O A;  4ALP A;  4A3C H;  1YHQ A;  4K0K Q;  2WB1 G;  1G29 1;  1VQ8 A;  5IE8 A;  1E1T A;  3ULP A;  4DR6 L;  2WP8 J;  1FJG L;  4DR1 Q;  5JEA J;  3TS0 A;  2RHQ B;  4A3J G;  3HOW G;  4BXX H;  3JAM c;  1UE5 A;  4JI8 L;  1N9W A;  1SE8 A;  1CKO A;  1VQ5 A;  3NEL A;  3PV0 A;  2K75 A;  5GAG C;  2IX1 A;  1L0W A;  4JI0 Q;  1T9H A;  3M7N A;  2JJQ A;  3I4N H;  3HOY H;  2CWA A;  3HKS A;  3NBH B;  2ZM6 L;  2E2J H;  3STB C;  4A3G H;  3AQQ A;  3BU2 A;  3KF6 A;  1EQQ A;  4BY1 G;  2E8G A;  3FKI G;  2ID0 A;  3U50 C;  2VW9 A;  4R4Q A;  4L5T A;  4R4O A;  1HR0 W;  4HIO A;  3U4V A;  4GOP C;  3WWV A;  4JI1 Q;  1WJJ A;  3M85 A;  3HFZ B;  4X66 L;  3A5U A;  4LFC Q;  2KHJ A;  4EQ5 A;  2RHS B;  3PSI A;  4A93 G;  3HOU H;  1VQL A;  2UXC L;  2UXD L;  1G6P A;  4A3L H;  2EQS A;  1A62 A;  3F1Z A;  3VDY A;  3CMA A;  5LMU L;  1QZG A;  1EFW A;  3I4M G;  1IBK Q;  4YCW A;  4YHH Q;  4GN3 B;  4B3T L;  1K8A C;  4DR5 L;  3STB D;  4GKK Q;  2K14 A;  2LSS A;  1S40 A;  1VQ6 A;  5BR8 L;  5IYD H;  2BA1 A;  4DK6 C;  5M5Y H;  4OWT B;  1YJ9 A;  1XMQ Q;  1VQ9 A;  2JK8 A;  3D31 A;  1EWI A;  1YZ6 A;  2N49 A;  3ER0 A;  3FHW A;  1KRT A;  4EX5 A;  2Q2U A;  1CUK A;  3K7A H;  2HIV A;  2UU9 Q;  2IX0 A;  3A5Z B;  4DV3 Q;  3E0E A;  4LF9 L;  2IHF A;  1OXV A;  3L7Z C;  4LFB Q;  4GOP A;  3S1M H;  4DK3 C;  4X64 Q;  1YNX A;  1N36 Q;  1M90 C;  2KHI A;  2JA8 G;  1HNX Q;  3JC6 6;  4LF7 L;  1MJE A;  1SRU A;  4DV5 L;  2KCT A;  3I4O A;  4GLV B;  1Y1W G;  1PV4 A;  1OXU A;  5C3E G;  1UE1 A;  4QIW E;  1K9M C;  2F4V L;  1NTG A;  5C0X J;  1YBY A;  2RCN A;  1N34 Q;  1ASY A;  3F8T A;  1VQK A;  2HT1 A;  3E9H A;  1OTC A;  1B70 B;  1IYJ B;  4KHZ A;  4JYA Q;  1V43 A;  3T1Y Q;  4JI4 Q;  2KBN A;  1X55 A;  4GS3 A;  4YWL A;  5H1S E;  1NE3 A;  1KD1 C;  3CCE A;  1XNR Q;  1U5K A;  1G51 A;  4IPH A;  1QZH A;  3S2D H;  3F2B A;  4A3K G;  4LF5 L;  2HIX A;  2R6G A;  3K0X A;  1PH2 A;  1SRO A;  1X3E A;  2CKZ B;  1JT8 A;  3E9I A;  2UUC L;  2K5V A;  1BKB A;  2I5L X;  2NN6 I;  1SLJ A;  4X62 Q;  1BVS A;  2ZTE A;  4DNI A;  2K50 A;  3CPW A;  1Q1E A;  2NVT H;  1JMC A;  3DLL A;  3S16 H;  4OO1 G;  3M4O H;  4BA1 I;  2JA5 H;  2R7F A;  4O0A A;  2ES2 A;  3HOV G;  3W1G A;  2VQF Q;  1DGS A;  4MZ9 A;  4PG3 A;  1IBM L;  1XMO Q;  3BZC A;  3ULL A;  2A19 A;  2F52 A;  5FLX c;  3UE0 A;  4A3I G;  1XNQ L;  2VNU D;  2Q2T A;  1TXY A;  4DV2 L;  1B7Y B;  1Q46 A;  5IP9 H;  4JI6 L;  5M3F H;  1SN8 A;  5LMU Q;  4X65 Q;  4JI5 L;  4H02 A;  4LUZ A;  1D7Q A;  5IYB H;  4B3S L;  1SR3 A;  3PF4 A;  1N32 L;  1OXS C;  5EAY A;  4IPD A;  1HZC A;  3G4S A;  1MKH A;  4IPC A;  4IFD G;  1VQE A;  4KLK A;  5AJ3 Q;  3J80 i;  3J81 i;  4JBM A;  3CF5 A;  3RN5 A;  4L5R C;  4GKJ L;  4JCV E;  1PA6 A;  5LMN Q;  1JE5 A;  3PO2 G;  3PUW A;  1HH2 P;  2YV5 A;  3K81 C;  1KIX A;  1YIJ A;  2AKW B;  3PO3 H;  4POF A;  4HJ9 A;  1VQF A;  1W3S A;  4A3M H;  2D62 A;  1EYG A;  2D0O A;  5JJL A;  4NXM L;  2LXJ A;  3G71 A;  4KI0 A;  2VQE Q;  1P8L A;  4DR7 L;  2B63 H;  4P72 A;  5JJI A;  1WCM G;  4AYB E;  4HIM A;  4OXP A;  2UUA Q;  3J81 j;  1C7Y A;  4O2D A;  2NZO A;  2UXB Q;  3CME A;  2MNA A;  4QGU A;  1PH6 A;  5C4X H;  1VQC A;  3OW2 A;  4QL5 A;  4B3M Q;  4FDB A;  3RR5 A;  3CC4 A;  1VQA A;  2PQA B;  5C0X I;  3LGJ A;  3GTL H;  4GNX C;  1BBW A;  2UUB L;  4TQU S;  4MTN A;  3ULJ A;  2R92 H;  1N33 L;  4A3J H;  4JI3 L;  4LF8 L;  1X54 A;  1YJN A;  1X3F A;  2DUD A;  5M3M G;  2ZJR A;  2LXK A;  3OTO L;  1A0I A;  2ALY B;  1EIF A;  3PUZ A;  3TS2 A;  2Z6K C;  3RZD H;  3FKI H;  3UDI A;  3AEV A;  1GVP A;  4DV1 Q;  4B3R Q;  4DUZ Q;  1VQG A;  2WAQ E;  1S3O A;  4P73 A;  2KCM A;  2CQO A;  1E7Z A; 
#chains in the Genus database with same CATH topology
 4HTH A;  1HR0 L;  1Q90 A;  3BJU A;  3UDX A;  1ET9 A;  1TWH H;  1HZB A;  3HOZ B;  4PZ8 A;  4LUV A;  1GO3 E;  1TWF H;  4LF4 L;  1I4X A;  1TR5 A;  3WOE A;  4HID A;  1LT6 D;  4C3J B;  1HHV A;  4A3B H;  2Y0S E;  1VQO A;  4TVA B;  1PH7 A;  1HZ9 A;  4DV4 Q;  3S1Q B;  2IT1 A;  2IWH A;  2A8V A;  2L9H A;  3OYY A;  1GUO A;  4HJA A;  4LF6 Q;  3GTL B;  4FVM A;  4JPB W;  3SR1 A;  2R92 B;  4P75 A;  1KL9 A;  3CCL A;  1T5E A;  2YTY A;  2NN6 G;  3FPP A;  3HKZ E;  2Z9H A;  1RKN A;  2F3W A;  5I4D A;  3BDL A;  3B6Y A;  4YY3 L;  4DUY Q;  4ABN A;  3RLN A;  4N9P A;  3MEF A;  1HXY D;  4DV0 Q;  1J8I A;  5GAE C;  2J0T D;  2G9D A;  2V1C C;  5FKA C;  1Q81 C;  4DV6 Q;  1J5E L;  3KLR A;  4TSS A;  3DEO A;  3NWT A;  2F1M A;  3H3V H;  1V1Q A;  4CDC C;  3CXC A;  4ULL A;  1I4P A;  3M4Q A;  4IO9 A;  1PYS B;  5DLQ E;  1PH5 A;  4L5S A;  4DR6 Q;  4HMI A;  1A3U A;  1FJG Q;  3L2P A;  1ZEQ X;  4Q5V A;  4JI8 Q;  4L5Q A;  1KC8 C;  3CC2 A;  3T1H L;  5M5Y B;  2NYZ D;  1SYD A;  2EY6 A;  1IKL A;  2JA7 H;  3K57 A;  1HCZ A;  3K80 C;  2YYZ A;  2F0W A;  5M9O A;  1WYD A;  5GAH C;  4K0K L;  1EQR A;  3CKI B;  4X66 Q;  5IY0 A;  1I3Q B;  1H9S B;  4FXG C;  2BE5 D;  1UUP A;  2Z4H A;  3SK4 A;  1SYF A;  2XVS A;  2A1A A;  2GA4 B;  4CHT B;  1AZQ A;  4JBK A;  2HCI A;  4UAI A;  3T4A C;  4B3T Q;  4DR5 Q;  3A74 A;  3J7A 5;  2ZJQ A;  3EQL C;  1SYB A;  1TY2 A;  5FLM H;  3GP7 A;  4RMF A;  3I55 A;  1U9R A;  1VQI A;  5KNC A;  3S2D B;  2NVY B;  1SJE D;  3I7F A;  2HD3 A;  3U58 A;  3J80 c;  2ZTD A;  2XIW A;  1IBK L;  5CV5 A;  4LF7 Q;  1JJG A;  2IPK D;  1MHW C;  2WAC A;  3MFG A;  1MGS A;  1STE A;  5IYB G;  2RDF A;  3KLW A;  2EIF A;  1S5C D;  1TWG H;  1KDA A;  3J81 E;  3H94 A;  5JPN C;  5EQ0 A;  3KJP A;  3A8I E;  3I90 A;  3HOW H;  2A68 D;  4A3M G;  2Y0S G;  4IPG A;  1QJO A;  4LMQ D;  1E2W A;  2R93 G;  3PUV A;  1GUG A;  1RTN A;  1PHJ A;  1GHJ A;  3S15 H;  2EYH A;  4ME5 A;  1YVC A;  4OWX B;  1CSP A;  4A93 H;  4POG A;  4Y52 H;  2XWB B;  1ENC A;  1PH3 A;  3PO3 B;  1HQR D;  1UE6 A;  4A3F H;  1K8O A;  4X62 L;  3GTP H;  2Q2I A;  1LTS D;  4YCV A;  4B3S Q;  4UP8 A;  5HY6 A;  3HOY G;  5KGU A;  5E4W C;  1LAB A;  1SFO H;  3I70 A;  1CKN B;  3TP7 A;  3C3L A;  4J15 A;  3ZYY X;  5ELO A;  4A3J B;  2JA6 H;  1VQ4 A;  4X65 L;  1V9P A;  2EY5 A;  3PIP A;  2GVB A;  5C3E H;  4K2K A;  3GTO H;  2AWN A;  1STA A;  3IRB A;  3D4R A;  3A55 A;  3OW7 A;  3FKI B;  5AJ3 L;  2QEJ C;  2KCC A;  4NW2 A;  2DY8 A;  4NPS A;  1Y1V G;  2NZH A;  3OMG A;  4LAA A;  3S1R B;  3IFD A;  4WRD A;  1LUZ A;  1D1K A;  3KF6 B;  3MWY W;  3GTK H;  4V0B A;  3Q24 A;  1KAW A;  1IL2 A;  1PH4 A;  1U4P A;  2UUA L;  2CH4 A;  1MI2 A;  1X3Q A;  3OTO Q;  2UXB L;  4A3D H;  4NP5 A;  4JBW A;  3GTJ H;  2SNM A;  1AZP A;  1MIU A;  1CI3 M;  3CQZ H;  4EQO A;  4RH6 A;  1GHK A;  4YIJ A;  3I3C A;  1SMX A;  3S17 B;  1LTI D;  1D5M C;  1X9N A;  3V2T A;  3S9W A;  1L2F A;  4X6A H;  3R8B A;  1HNZ Q;  3RN2 A;  2E76 C;  2EE1 A;  4FXK C;  3IL8 A;  5CBA E;  4IFD H;  1TU2 B;  1X6O A;  4JI2 Q;  4DV7 Q;  5IGG A;  3FP9 A;  1JE4 A;  4OEL B;  3H3V I;  4N9T A;  5JPM C;  1Q1B A;  3K6O A;  3W1B A;  1XX8 A;  1QCB D;  1EOT A;  2RCF A;  2E5L Q;  1AW7 A;  3CCR A;  5I6Y A;  3VYS A;  4DKA C;  3RLO A;  1WCM H;  1YNJ C;  2B2Y A;  4PNY A;  3KLS X;  1OXT A;  1ENF A;  4ZRZ A;  2K5H A;  2KVM A;  1HA5 A;  2G9H D;  5C3W A;  4RCN A;  1I6H B;  1I5F A;  2FJ2 A;  2ZJP A;  2VUM G;  3K5N A;  3F2U A;  5DEH A;  4DR4 Q;  3HOZ H;  1QUQ A;  5IP7 H;  3EVQ A;  4PMB A;  1NR2 A;  3TN2 A;  3VA7 A;  4O42 A;  4C3J H;  2A6H C;  5D65 A;  5HUR A;  1I94 Q;  2ICE C;  4RCO A;  2CCZ A;  3S1Q H;  4DR3 Q;  2J4X A;  3PO2 B;  5IGE A;  2F0U A;  1EEF D;  1FNU A;  4DR1 Q;  3TS0 A;  2RHQ B;  1B53 A;  3JAM c;  1CKO A;  4KN4 C;  2IW3 A;  3PV0 A;  5GAG C;  3DXJ C;  5EBC A;  2X6L A;  1PYW D;  1A6X A;  3NQI A;  1QG7 A;  3MXN A;  1BQQ T;  2ID0 A;  2VW9 A;  3UI2 A;  5KRU A;  1LAC A;  2B39 A;  4JI1 Q;  3M85 A;  3A5U A;  2UXD L;  3PSI A;  1VQL A;  2NN6 H;  2E2H B;  4IUR A;  4IUN A;  5LMU L;  3P1H A;  5E3F A;  2F03 A;  3GTQ B;  2L12 A;  1K8A C;  2NTT A;  2Z4I A;  2K14 A;  4GKK Q;  1VQ6 A;  1PTO B;  1QNU A;  5M5Y H;  4F8M A;  1XMQ Q;  5CV6 A;  1VQ9 A;  3P7J A;  3PIP 3;  2N49 A;  2RQX A;  1KRT A;  1CUK A;  1MBY A;  5TSS A;  2CW0 C;  1WTW A;  3Q6S A;  2IHF A;  3URY A;  2DY7 A;  4GOP A;  1JOO A;  3KLS A;  1HNX Q;  2Q8I B;  5DM6 3;  4OIJ A;  2EDG A;  2FFK B;  1OXU A;  4RA8 A;  1PV4 A;  1Z7T A;  1K9M C;  4BBR B;  1N34 Q;  1ASY A;  3AB9 A;  4KKS A;  2HT1 A;  4KHZ A;  4JI4 Q;  1EY6 A;  2KBN A;  4YWL A;  1DON A;  3NUC A;  4HN7 A;  1U5K A;  1G51 A;  2E2D C;  4IPH A;  3S2D H;  2K32 A;  1PH2 A;  2R6G A;  1LT5 D;  3E9I A;  3QB3 A;  4OHJ A;  2I5L X;  4DNI A;  5CR3 A;  4DXG A;  1L0Y B;  3W1G A;  2E74 C;  3GTG B;  4PG3 A;  1XMO Q;  1Y69 U;  3OWF A;  5FLX c;  2VNU D;  2DJF C;  4LJZ C;  1A3T A;  3HZX A;  5F2D A;  2Q2T A;  4PMC A;  4JI6 L;  5LMU Q;  1F9S A;  1WTH A;  3EFX D;  4LUZ A;  5JAV A;  5IYB H;  1N32 L;  1TS2 A;  3KK7 A;  1EZ8 A;  1EY0 A;  1PLF A;  3G4S A;  1VQE A;  4MIU A;  3J80 i;  3QR8 A;  3SEB A;  1EY7 A;  1JE5 A;  1FNV A;  1HH2 P;  2BOS A;  3MZ5 A;  4K8J A;  4FNF A;  1YIJ A;  2AKW B;  4HCE A;  5CV4 A;  1JWS D;  1TY0 A;  1UAP A;  4AYB B;  4POF A;  1EY5 A;  3PO3 H;  1W3S A;  4A3M H;  2D0O A;  5JJL A;  4HSP A;  4DR7 L;  1P8L A;  1G8Z D;  5JJI A;  2FMC A;  4H0L C;  3S16 B;  3NE5 B;  4DAV A;  3CME A;  1PH6 A;  2I07 B;  3OHX C;  1F2L A;  4I7Z C;  3RR5 A;  3CC4 A;  2R3Z A;  2PQA B;  3HOX B;  2EYM A;  2A69 C;  5EPK A;  3ULJ A;  4MTN A;  4A3J H;  1I4H A;  3LX0 A;  1YJN A;  1X3F A;  3TSS A;  1CK1 A;  4KD3 A;  2WII B;  3U9S A;  2A6H D;  1PFN A;  1EIF A;  2NWG A;  3BDO A;  3PUZ A;  3FKI H;  3HG9 A;  4B3R Q;  1VQG A;  3TP6 A;  2WAQ E;  4JW0 A;  5CV7 A;  3NTH A;  4CGY B;  3S1R H;  5G3L D;  4H7B A;  4CKB A;  1FGU A;  5J22 A;  3KFU A;  3D4W A;  1CFM A;  4A3F G;  4K14 A;  1QVF A;  3AYH B;  2SDF A;  4NXN L;  2M00 A;  4HJ7 A;  5C4X B;  1CZG A;  5CYU A;  3ONA B;  1STN A;  1Y1V H;  2WV6 D;  2EPB A;  5M5X H;  3T51 B;  1VQJ A;  1S72 A;  4IOC A;  3AMU A;  4E6I A;  2JA6 G;  4GN4 B;  1SDF A;  3DMU A;  1Q3L A;  2I5M X;  4K5X A;  2OCE A;  1LTL A;  1E2Z A;  4LFA Q;  1XPU A;  1BNZ A;  5JEA G;  4A3G B;  2EOT A;  5LMN W;  1VQB A;  1X3G A;  2EYL A;  1PFS A;  2CW0 D;  4DGZ A;  3CCM A;  5ELN A;  4HJ5 A;  2RSO A;  4NDX A;  3TME A;  3ERS X;  2B8F A;  1K0S A;  2RA4 A;  1VQN A;  3D6W A;  2XRQ D;  4ID6 A;  1II3 A;  1LT3 D;  4G4K A;  1KRS A;  5T1I A;  2ZM6 Q;  3UDG A;  1TQO A;  2B2W A;  1KDB A;  1J6Q A;  4OX9 L;  4A3D G;  1RIP A;  2VS1 A;  2IJ0 A;  3VYR A;  2Q2H A;  4LWC A;  5BN4 A;  1I6H H;  1X56 A;  3OPO A;  4OL7 A;  2F3V A;  2LFN A;  3TZD A;  3S2H B;  3TRZ A;  1M8A A;  1Z9F A;  4JOI A;  2KQ3 A;  2KJX A;  4CKE A;  5A35 A;  4PMW A;  1BCP D;  1UWV A;  1EIY B;  1B4O A;  3F2C A;  5BR8 Q;  2BDO A;  5FLX E;  1CQF A;  4GZY C;  5T1G A;  1JR0 D;  4OIK A;  2JA5 G;  2F0E A;  4LNQ A;  4EQN A;  1KXL A;  2AQ2 B;  1WD1 A;  4LFC L;  2VUM H;  4LF9 Q;  3K7U C;  3NTK A;  1NMG A;  4DPG A;  3J81 c;  2XNA C;  1CTM A;  1TS3 A;  5KEE A;  5D3I B;  3PCO B;  4TKO B;  4K5V A;  5NUC A;  4BBS B;  3MXU A;  2F4V Q;  2WAQ G;  2E75 C;  1SBB B;  1FYC A;  3ERQ A;  4A75 A;  1UE7 A;  2EJF C;  4KJN A;  1XPR A;  4R4C A;  4IUU A;  2V4D A;  4ZYS A;  3VYU A;  4X64 L;  4LK1 C;  1N36 L;  2E2H H;  1WOC A;  5M3F B;  3HOZ G;  2I0Q A;  1VF5 C;  2K5D A;  4J8Q A;  5IP7 G;  4LW1 A;  3DM3 A;  3GTQ H;  2WAQ B;  4M8A A;  1PXU A;  4C3J G;  1WFQ A;  4G7Z C;  2KUM A;  1PTO H;  5EPJ A;  2OTJ A;  1O80 A;  2MP1 A;  3Q23 A;  4JYA L;  2GVA A;  3JAM i;  3T1Y L;  3BS1 A;  4XIG S;  3NSW A;  5IGB A;  2A69 D;  1XNR L;  1AH9 A;  3H0G B;  1IBM Q;  3H6M A;  1PH8 A;  3GTM H;  5IYC H;  2R92 G;  1NSN S;  4DK1 A;  3I8Z A;  2F0D A;  1NUC A;  5KND A;  4JI5 Q;  4C1N K;  1E3P A;  2AQ3 B;  1W2B A;  1KLG D;  4BBR H;  2BH2 A;  1S4Z A;  3RZO H;  1NMF A;  4YWK A;  5JJK A;  2VZA A;  1NAP A;  3K8A A;  3GDE A;  4NMZ A;  2VQF L;  4GLX A;  2MQH A;  2KHS A;  1XTD A;  2XWJ B;  1K28 A;  1JJC B;  5EKL A;  1EY9 A;  3KF8 A;  3NP8 A;  1JB7 A;  2A5H A;  3BVG A;  2OXP A;  1EUJ A;  2J7Z A;  3L0O A;  1EQT A;  4AH6 A;  1KAB A;  1H9S A;  2ZXO A;  3ICE A;  2CHB D;  2B2V A;  4KJO A;  1NR4 A;  4C3H B;  1P16 A;  3KBG A;  4HIK A;  5ISR A;  2RKS A;  3J7A V;  5E1F A;  4UHV A;  5LMN L;  5G3L F;  3GTG H;  4C2M H;  2K01 A;  4CJ2 C;  4UY8 C;  1OO9 B;  5E7N A;  2UUB Q;  3CP0 A;  1KTK A;  3S24 A;  3BYY B;  3SDZ A;  4B08 A;  4JI3 Q;  3I4M B;  3SK6 A;  3KJO A;  3CPF A;  5LL6 S;  1PZK D;  1Y8N B;  3P75 A;  2PW5 A;  2H5X A;  3KF8 B;  1VS0 A;  2F4I A;  1A8V A;  4ME3 A;  1KQS A;  1YIT A;  4NB3 A;  4QQB X;  2WKD A;  3CCU A;  2IL8 A;  1HR0 Q;  5D3D A;  4X3S A;  3H09 A;  1L1O C;  3I56 A;  5K36 H;  2G5D A;  4QUF A;  4LF4 Q;  1Y1W B;  2DGY A;  3OIQ A;  3CD6 A;  1W6J A;  2OQK A;  1Q82 C;  5C4H A;  2EJG C;  3GV3 A;  5KNB A;  1IW7 C;  3O13 A;  4J1M A;  2IHE A;  3NBI A;  4BS9 A;  5HGQ A;  2OF1 A;  4EVO A;  2K5N A;  1HUN A;  1TII D;  3HOX H;  5A2Q L;  4WJ4 A;  1Y14 B;  2B2U A;  1ICW A;  4K6D A;  3TEH B;  1R4P B;  4YY3 Q;  4KHP L;  3CCV A;  4OWW B;  2EZV A;  2QA4 A;  4YWM A;  4DAY B;  2NTS A;  3SVM A;  3H15 A;  1J5E Q;  3SK8 A;  1JJ2 A;  1H95 A;  1I4Q A;  2Q8R E;  2ATW A;  1H9M A;  5CC4 A;  1VDZ A;  4PV1 C;  2N3S A;  1BCP F;  3PO3 G;  3W3A A;  3RUZ A;  3E6Z X;  5DAU A;  1WVL A;  1CKN A;  3V05 A;  3Q22 A;  2YU9 B;  4RAU C;  4KKT A;  1XJV A;  3CU7 A;  3T1H Q;  2A74 C;  4XYQ A;  4EGV A;  4JI7 L;  1A15 A;  1LV9 A;  4ZCK A;  1HNW L;  5C4J B;  4A3C H;  4K0K Q;  5EKI A;  1G29 1;  4HCS A;  1E1T A;  3ULP A;  1I50 B;  1PRT C;  4A3J G;  4QUC A;  1UE5 A;  4WFN 3;  1N9W A;  1SE8 A;  5JVH 3;  2A6E D;  1VQ5 A;  2F0O A;  2O2L D;  1L0W A;  3FMC A;  5A2Q E;  3C1E A;  2JJQ A;  1G2S A;  1JOQ A;  4QMG A;  2CWA A;  5IGC A;  1MD2 D;  3NBH B;  2E2J H;  4A3G H;  3BU2 A;  3KF6 A;  2JP1 A;  2ZXR A;  5IIF A;  1LLR D;  4BY1 G;  2O5J C;  3FKI G;  3U50 C;  4L5T A;  3WWV A;  4IZ8 A;  2EYO A;  1WJJ A;  1TWA B;  4EQ5 A;  2UXC L;  1IL8 A;  4XQQ A;  2EQS A;  1G6P A;  1A62 A;  2PNR C;  3MXG A;  1EFW A;  1IBK Q;  4GN3 B;  1E2V A;  5C5L A;  5JEA H;  1EY8 A;  1B1Z A;  2BA1 A;  4DK6 C;  4BY1 B;  2QKI C;  1LTR D;  3D31 A;  2QF7 A;  3ER0 A;  4EX5 A;  2Q2U A;  1XWE A;  2IX0 A;  3A5Z B;  3L7Z C;  1R9T B;  2C5C A;  1RCV D;  1SNM A;  4I7A A;  3FDT A;  1MJE A;  1SRU A;  4I65 A;  4DV5 L;  4GLV B;  1DM0 B;  4QIW E;  3VR2 A;  1I4G A;  5C0X J;  3F8T A;  1VQK A;  1Q8I A;  1SJH D;  1OTC A;  4GS3 A;  2D9U A;  2L0C A;  5H1S E;  2QDB A;  3HOU B;  4LF5 L;  2HIX A;  3K0X A;  2QCP X;  3M3Y B;  2CKZ B;  2UUC L;  2K5V A;  4X62 Q;  1BVS A;  3KUP A;  1G91 A;  3I91 A;  1O7L A;  3I72 A;  3G6J B;  2OT2 A;  2L11 A;  2JA5 H;  3K5O A;  2K04 A;  4DXF A;  1A2T A;  2NZ1 D;  1LTT D;  5ELD A;  3ND8 A;  3UE0 A;  4A3I G;  1XNQ L;  1EFI D;  1TXY A;  4DV2 L;  1V1P B;  1Q46 A;  2HCC A;  3OMC A;  5M3F H;  4X65 Q;  1SSO A;  1WTR A;  3PF4 A;  1OXS C;  3S14 B;  3QG1 A;  1LO5 D;  4IPD A;  4Y7N B;  1MKH A;  3ND9 A;  5AJ3 Q;  1IW7 D;  3J81 i;  4JBM A;  3CF5 A;  3RN5 A;  4GKJ L;  1PFM A;  4KMU C;  4RKL A;  1GUW A;  1PA6 A;  3PO2 G;  4A3I B;  2EJM A;  2YV5 A;  3K81 C;  5COR A;  3TBI B;  1KIX A;  3SE0 A;  1EYG A;  5EJW A;  4NXM L;  3G71 A;  2WKC A;  4KI0 A;  3C46 A;  4AYB E;  2UUA Q;  3J81 j;  1C7Y A;  4O2D A;  2NZO A;  2UXB Q;  2MNA A;  5L37 A;  1VQA A;  4F87 A;  4O1N A;  3GTL H;  3PQI A;  1BBW A;  4TQU S;  2R92 H;  1N33 L;  4LF8 L;  1X54 A;  2DUD A;  4BY7 B;  3QWN A;  5IOC A;  5M3M G;  2ZJR A;  1RJT A;  1A0I A;  3TS2 A;  5C44 B;  1GUT A;  1SND A;  5KYL A;  3UDI A;  2NUC A;  3HP3 A;  2KCM A;  2CQO A;  4ZUI A;  1K3R A;  2Z6B A;  3HEJ A;  3T16 A;  3U4Z A;  1PRT D;  1SEB D;  1NNX A;  3MFY A;  5IYC G;  4GNX A;  2JE6 I;  4ZKB B;  5M3M B;  4QY7 A;  3CAM A;  5IWA L;  4FF1 A;  2L15 A;  1EIG A;  1F9P A;  3NEN A;  1HUM A;  4LUO A;  3U9O A;  2P5Z X;  2OTL A;  2AWO A;  4BBR G;  5JVG 3;  4JV5 L;  1EOV A;  1E22 A;  2Z6K A;  1K8G A;  2K1B A;  1ET6 A;  2K52 A;  1XTC D;  2F0G A;  2QGQ A;  3AFP A;  1I3Q H;  1SXT A;  3GO5 A;  4OEM B;  4QIW B;  4OON A;  3RD4 A;  2HDM A;  2B8G A;  1JB3 A;  4A76 A;  1Y1W H;  3QOL A;  4GLA C;  2RF4 A;  2IY5 B;  5IYD G;  4KD4 A;  3KDF B;  2VL6 A;  4GNX B;  4PZ7 A;  1WI5 A;  2VB2 X;  3NHH A;  2RBM A;  4AQY L;  1TS5 A;  1OXX K;  1X65 A;  2NVY H;  1D1I A;  1TWF B;  3SK5 A;  2C35 B;  4XYO A;  2DNC A;  5FO9 B;  1HPC A;  4A3B B;  1EIH A;  3VYT A;  1S5E D;  3CHB D;  3BDC A;  4APV A;  1ESR A;  4FO2 A;  1BCP C;  2AUJ D;  3M4P A;  4DR2 L;  3VR3 A;  2OWO A;  1DOM A;  1X32 A;  4ODG A;  4UP9 A;  4IUV A;  2MO1 A;  4HSV A;  2UXD Q;  1FNW A;  1AE2 A;  3MAQ A;  4AYB G;  1GM5 A;  5K36 G;  3LNN A;  4JI0 L;  2PQA A;  2CFM A;  4PZ6 A;  1JOK A;  3R93 A;  1IYU A;  4C56 C;  1CT1 D;  2L1B A;  1KDC A;  3MTS A;  1BDO A;  3TDQ A;  5C4J H;  1Y8O B;  1PH9 A;  1Q12 A;  3HOX G;  4NKL A;  2SOB A;  4DN4 M;  3G7L A;  1I6V C;  1Q8K A;  4YHH L;  4ZQ3 A;  1QE6 A;  3Q8D A;  3JAM L;  3VA5 A;  2PNH A;  1VQP A;  3A54 A;  4DU9 A;  1VMC A;  3IFT A;  2JA9 A;  2JA7 B;  1VQD A;  2K6A A;  1DJR D;  2D0P A;  2UU9 L;  1TVX A;  4Z9C B;  4DV3 L;  4LFB L;  2KED A;  1C8C A;  1TWA H;  5IT9 L;  2FIN B;  3GD7 A;  3FRP B;  1CZW A;  4L6T B;  3I4L A;  2K28 A;  1KLU D;  4WJW A;  2JEB I;  3IAY A;  3OOC A;  2FMM A;  4A4I A;  1XPO A;  4BY1 H;  5C4X G;  1L1O B;  5E4X A;  1U4R A;  1XXG A;  1GJX A;  2Z8L A;  3OIP A;  2HDL A;  3G48 A;  1A63 A;  3T13 A;  2EVB A;  2F3I A;  4A3C G;  2KEN A;  1GXD C;  1R9T H;  3DHQ A;  1QVG A;  1BXT A;  2MJ8 A;  2QDL A;  1W6K A;  4JI6 Q;  3UDF A;  2B63 B;  1NJI C;  1CHQ D;  5CV9 A;  1N32 Q;  1NBW A;  3BG3 A;  3C2P A;  5EBD A;  2F0P A;  1TWG B;  2F0J A;  2R7D A;  4A3G G;  1BBU A;  2LS0 1;  1S5F D;  4R1J A;  3D8G A;  4JG2 A;  2XRS D;  1E24 A;  4IUP A;  5DNF A;  1WTP A;  5JOB A;  3TP8 A;  5LL6 X;  1JWU D;  3ITP A;  2R7Z G;  2K03 A;  3CW2 C;  3NTI A;  3M3Y H;  3S17 H;  3D0F A;  4DR7 Q;  1YI2 A;  2TSS A;  1BUV T;  3A7A B;  1AEX A;  1CKM A;  3S15 B;  3RZD B;  1UNS A;  4DNT B;  1B9N A;  1QVC A;  1PRT F;  1EU3 A;  4GN5 A;  2K7V A;  4A93 B;  2F0M A;  1GUS A;  2R7Z B;  2JSO A;  1EU4 A;  3RLF A;  3DWQ A;  2OQ0 A;  1Z47 A;  3NWS A;  2VQE L;  4IFD J;  1IZ6 A;  2L4N A;  4QB4 A;  3S14 H;  1C4Q A;  1R4Q B;  4Y7N H;  1FL0 A;  4B3M L;  2CH4 W;  1RTO A;  3KBX A;  3OWE B;  2AQ1 B;  1PRT B;  1SE3 A;  4A3I H;  2JA8 B;  2PMZ B;  2B2Y C;  4KY7 A;  2Z0S A;  1HJP A;  3MA2 B;  2X69 A;  5C3E B;  4RKB A;  4XXE A;  2MHV A;  4NXN Q;  4KV6 A;  2EXZ A;  1JWM D;  4FXD A;  3J7A F;  3X3M A;  3MHB A;  4BBS G;  1AFP A;  1YHB A;  4DV1 L;  4DUZ L;  1NY4 A;  2KA7 A;  3CCJ A;  3QIA A;  1GD7 A;  1PFB A;  3PO2 H;  5J1Z A;  3TRE A;  4A3K B;  2PW7 A;  1HA6 A;  1CA6 A;  5J3B A;  3GTK B;  1DZ1 A;  4OGQ C;  1ONL A;  2BCO A;  5M3F G;  2JXM B;  4BY7 H;  4P74 A;  2ZTC A;  4CKC A;  2XGT A;  1A3V A;  2F0N A;  2SNS A;  2K33 A;  1K83 B;  4BWG B;  4OO1 I;  5IGD A;  3HOV B;  5C44 H;  2B3G A;  4DV4 L;  1TKW B;  3Q0A A;  2XN9 C;  1YJW A;  4LF6 L;  3CQZ B;  1LTG D;  1YHA A;  2YTV A;  1D6E C;  3H0G G;  1EY4 A;  1ASZ A;  3A7L A;  4KK7 A;  1B50 A;  5M3M H;  3RNU A;  4DUY L;  4A3E G;  4DA2 A;  2A6E C;  4DV0 L;  1SYG A;  5GQO A;  4DV6 L;  5ELE A;  4UP7 A;  4OX9 Q;  1K0R A;  1LM0 A;  1UEB A;  4KY5 A;  1GOZ A;  3TQY A;  3HRZ C;  1D5X C;  3W5O A;  5FOB B;  2X6G A;  1YHQ A;  4FYD A;  1EWC A;  1VQ8 A;  5IE8 A;  4TRD A;  4DR6 L;  2WP8 J;  1FJG L;  4C3I B;  2H4O A;  4JI8 L;  4A3E B;  2KEC A;  1WCM B;  5EKK A;  2NVQ B;  1ESF A;  5M5W B;  3N52 A;  3AQQ A;  1QOH A;  1EQQ A;  4C3H G;  4GOP C;  4LFC Q;  4X66 L;  2KHJ A;  2RHS B;  3H3V C;  3VDY A;  3CMA A;  1HFG A;  1QZG A;  3I4M G;  2KCN A;  5EPL A;  4B3T L;  4DR5 L;  3STB D;  2LSS A;  5IYD H;  4OWT B;  1YJ9 A;  1WD0 A;  4DK0 A;  4DF7 A;  1F2M A;  3FHW A;  4R8I A;  2WIN B;  1PZI D;  1PZJ D;  1BBX C;  1SNQ A;  4X64 Q;  1YNX A;  1N36 Q;  2KHI A;  1KAA A;  3QO2 A;  4LF7 L;  3NK9 A;  3N6R A;  1Y1W G;  1UE1 A;  4CDF C;  1YBY A;  4F7X A;  1F2Z A;  1RHP A;  3E9H A;  1TS4 A;  1B70 B;  1IYJ B;  2F0I A;  4JYA Q;  3T1Y Q;  1BO0 A;  3S1N B;  2F0F A;  5CGK A;  1BF4 A;  2PO4 A;  1KD1 C;  1XNR Q;  2DN8 A;  3F2B A;  4DAY A;  3R2T A;  1DOL A;  1JT8 A;  2ZT9 C;  4MN3 A;  1BKB A;  3J81 L;  4ZUJ A;  1MSG A;  1O7Y A;  1Q1E A;  1JMC A;  1FGB D;  3DLL A;  5KYI A;  3S16 H;  4OO1 G;  3EA6 A;  4HMJ A;  4O0A A;  1SAP A;  4ILW A;  3L3O C;  4MZ9 A;  2PZW A;  2VQF Q;  4V19 0;  3P20 A;  4RHR A;  3ULL A;  2A19 A;  2F52 A;  2HQE A;  1AN8 A;  2MGS A;  4ZLT F;  3VR6 A;  5C3X A;  1X3P A;  5AFW A;  4H02 A;  4EQP A;  1D7Q A;  4B3S L;  1SR3 A;  1RD9 D;  5IGF A;  1ILQ A;  2EYP A;  1GUN A;  4IPC A;  4K6L A;  4L5R C;  5LMN Q;  3DM1 A;  3NBH A;  1O7Z A;  3D3R A;  1ROD A;  2D62 A;  3A8J E;  2FHT A;  1ENA A;  2LXJ A;  1JQY D;  2B63 H;  2F0S A;  4P72 A;  5FK9 C;  4HIM A;  1U4M A;  4KY6 A;  4OXP A;  4RGN A;  1TWC B;  1B2T A;  4QGU A;  4P2C B;  2R61 A;  5C4X H;  1PTO D;  3OW2 A;  4QL5 A;  2N88 A;  4XT3 B;  2DNE A;  4RHS A;  5C0X I;  3A56 A;  4XT1 B;  4CJ1 B;  3LGJ A;  4XQJ A;  1HTP A;  1BCP B;  2NVX B;  2A73 B;  5FO7 B;  3OTO L;  2ICI A;  4K2L A;  3RZD H;  3K5M A;  2OEO A;  3AEV A;  1GVP A;  1LTA D;  1STB A;  2NBF A;  1SNP A;  5C6A A;  1E7Z A;  4IUQ A;  5D14 A;  1M4V A;  4G7O C;  2R7Z H;  3HKZ G;  4KHV A;  3K0Y A;  4A3M B;  2E2I B;  3BZK A;  4N8X 1;  2Y0S B;  1F9R A;  4JVZ A;  4BXX G;  2ENB A;  2R93 B;  2B2T A;  2N8N A;  1EYA A;  5IOD A;  1HNZ L;  2VY3 A;  1C0A A;  4KHP Q;  3I4N G;  4JI2 L;  4DV7 L;  2BA0 A;  4C1N I;  3AU7 A;  2VB3 X;  1MSH A;  1S5D D;  1B44 D;  1FD7 D;  3HKZ B;  2I46 A;  2WFW A;  2QW7 A;  1VQM A;  4L63 B;  1IBL L;  2E5L L;  1Q7Y C;  3QJY A;  3HOU G;  2JA8 H;  4A3L G;  2TMP A;  1LTB D;  1WTO A;  3S2H H;  4RFB A;  4RWS C;  4R4T A;  5GAD C;  2B2W C;  3I4N B;  3HOY B;  3HGB A;  1LYL A;  1IYV A;  4JC0 A;  4N8F A;  2F0L A;  2LKV A;  1V1P A;  4JI7 Q;  1EYD A;  1SE4 A;  2NB0 A;  3R2I A;  1STH A;  4IJH A;  4U68 A;  1BR9 A;  2N78 A;  1CSQ A;  1VCI A;  2LMC B;  3A0J A;  1HNW Q;  4A3K H;  1B9M A;  1STG A;  1EQV A;  4DR4 L;  1PVO A;  2YTX A;  2BH8 A;  3I73 A;  1SE2 A;  4JOI C;  2QEX A;  4UPA A;  5BN3 A;  5ELF A;  5COY A;  1KHI A;  2M9V A;  3J80 L;  3G6E A;  1LT4 D;  1A2U A;  4J6H A;  3D4D A;  4FF2 A;  4BBS H;  1AE3 A;  1K83 H;  2XSC A;  1I94 L;  3HOV H;  4JBJ A;  1EZ6 A;  3F2D A;  4DR3 L;  2ZXP A;  1Y1V B;  3K7A B;  5M5X B;  3OSO A;  1K73 C;  2ASB A;  4XDX A;  3MEH A;  1QB5 D;  3S1M B;  3C1F A;  3WOF A;  4DR1 L;  1IXR A;  5FO8 B;  2UXC Q;  1E0B A;  2JEA I;  1I4R A;  3CRK C;  4P71 A;  1CQV A;  3KYH C;  1RL2 A;  3GV6 A;  1H9J A;  3EN2 A;  1N8R C;  1O78 A;  3W2D A;  5C0X G;  2PZT A;  4JI1 L;  2EY2 A;  5CV8 A;  3KOJ A;  2RSN A;  3H0G H;  4JK1 C;  1BOS A;  3PGZ A;  1NCV A;  2K4K A;  1IBL Q;  1YNN C;  4C3I H;  2VXW A;  5IP9 G;  4A3E H;  3M9B A;  1SYE A;  2PQE A;  3L9A X;  4DV5 Q;  2HHH L;  4BY7 G;  4GKK L;  2NVT B;  2NVQ H;  2AHO B;  1XMQ L;  3E5S A;  5M5W H;  1Q86 C;  1JOR A;  2F0V A;  3M4O B;  5BN5 A;  2K05 A;  3M4Y A;  1SNC A;  5C44 G;  1L0X B;  5C4Z A;  3J80 E;  1WTQ A;  2F0K A;  1T5X D;  2K5Q A;  4WOR A;  4WJ3 M;  3EJI A;  4IQZ A;  2XTI A;  4K8I A;  4LF5 Q;  1HNX L;  2UUC Q;  4CBV A;  3BVM A;  4KTA A;  4FF4 A;  3PUX A;  1TT2 A;  3LWE A;  4R8N A;  4FP5 D;  1U0L A;  1N34 L;  3PUY A;  5LHY 1;  2FXQ A;  4JI4 L;  4C3H H;  2EYF A;  5JJZ A;  3SGI A;  2VUM B;  4H13 C;  3EBE A;  2PZU A;  1CHP D;  2Q8T A;  1XNQ Q;  3KDF A;  4IAL A;  4R4I A;  4DV2 Q;  1ZYR C;  2PI2 E;  3I4M H;  4XQN A;  1PTO F;  2B2V C;  1QWY A;  5ELB A;  1QUQ B;  5I9O A;  2JQO A;  1HZA A;  3DWP A;  1ZKO A;  2N55 A;  2D5D A;  4GKJ Q;  5I2Y A;  1UEA B;  5IT9 c;  3S1N H;  1XMO L;  5FJ8 G;  2MO0 A;  2JN4 A;  1EEI D;  5I6W A;  4AIM A;  3X3N A;  4BA2 I;  2WB1 E;  3M7G A;  2O4X A;  1U4L A;  3TP5 A;  2RDG A;  4NXM Q;  4X3U A;  1VMP A;  4UDU C;  1E1O A;  2QIL A;  3FEW X;  4IJL A;  2HHH Q;  4A3B G;  5EGT A;  3ZJY C;  2K5W A;  4DAM A;  3BZD B;  2C9O A;  5KIX A;  3BYT B;  4QCL A;  3NXW A;  2HUG A;  1TWH B;  1MJC A;  3GTM B;  1DOK A;  5I2X A;  1JC7 A;  1F77 A;  3J7Z C;  1N33 Q;  3CCS A;  1YEZ A;  3MXN B;  4QJF A;  1VQ7 A;  1EWH A;  4LF8 Q;  1V1O A;  1G2T A;  3AFQ A;  2HQL A;  4OO1 H;  3T53 B;  3RZO B;  2Z1C A;  2EXD A;  4K5W A;  4MNO A;  4YCU A;  2AUK A;  4HJ8 A;  3CRL C;  5GRO A;  1HQM C;  4IOA A;  2B2U C;  2I5H A;  3MC0 B;  1B8A A;  3R3O A;  3CCQ A;  1F2Y A;  2CWP A;  1DCZ A;  1VQH A;  2AMC B;  5IWA Q;  4XTC S;  2YU9 H;  2PMZ E;  2MFI A;  1SMY C;  1AP0 A;  4GOP B;  1TWC H;  2SEB D;  4S3S A;  3FPU B;  1PMR A;  4B3R L;  1H9R A;  1PYB A;  4JV5 Q;  2JA7 G;  1C9O A;  3NQT A;  1KNA A;  2L5T A;  4C2M B;  1HRJ A;  2B29 A;  1O7I A;  3CC7 A;  1H9K A;  1D5Z C;  1I50 H;  4L8J A;  3PF5 A;  1PH1 A;  1QIL A;  4DNR B;  1FVI A;  1L1O A;  2NVX H;  2PI2 A;  1M1K C;  3FVQ A;  4ZK9 B;  1D8L A;  2RVL A;  2GN5 A;  3NEM A;  2CQA A;  2RDH A;  5FLM G;  5CMD A;  3DUZ A;  1GKH A;  3SXH A;  4AQY Q;  5HGT A;  1YNN D;  1FR3 A;  3I2Z A;  1WTV A;  3WDN A;  3UE1 A;  2E2I H;  1B3A A;  1Z6H A;  1S5B D;  2EYJ A;  1YNJ D;  2KEE A;  1C48 A;  5J39 A;  1IKM A;  1IHZ A;  4PQX A;  4LFA L;  2R93 H;  3VR5 A;  2B63 G;  4HAE A;  1SYC A;  3K59 A;  1HTL D;  1DXM A;  4RG1 A;  3SHL A;  4CDD C;  3PMF A;  4F88 A;  1WTX A;  3LWU A;  1JCK B;  3PIO A;  4IFD I;  3K58 A;  4DR2 Q;  4B9X A;  4HED A;  4R9W A;  2PPB C;  1K3B C;  3EIV A;  1CA5 A;  2MPM A;  4ALP A;  1PDQ A;  2WB1 G;  1JIC A;  2B2T C;  5JEA J;  4B9W A;  3HOW G;  5I9P A;  4BXX H;  4IUT A;  3NEL A;  3QOJ A;  2K75 A;  2IX1 A;  4DAP A;  4JI0 Q;  1Y8P B;  1T9H A;  3M7N A;  3I4N H;  3MVV A;  3HOY H;  3HKS A;  1STY A;  2ZM6 L;  1K8M A;  3STB C;  2JYO A;  4QF4 A;  3RMH A;  2E8G A;  1B3Q A;  4R4Q A;  4G57 A;  4R4O A;  3JAM E;  1HR0 W;  4HIO A;  3U4V A;  1DYQ A;  2WB1 B;  3E0J A;  4A93 G;  3HFZ B;  4U67 3;  1EYC A;  1ZYR D;  2DJG C;  3HOU H;  3HOW B;  4A3L H;  3F1Z A;  1QNK A;  3ERO A;  4YCW A;  4YHH Q;  5IT9 E;  1J9O A;  4MHE A;  4X3K A;  1S40 A;  3DWA A;  5BR8 L;  4Q0F A;  4IN3 A;  3HS0 C;  1XYI A;  2JK8 A;  1EWI A;  1YZ6 A;  3MXP A;  4X3T A;  2PYK A;  3K7A H;  2HIV A;  3E3X A;  2UU9 Q;  3NPP A;  1VF7 A;  4DV3 Q;  3E0E A;  4LF9 L;  4LFB Q;  1OXV A;  5CBE E;  3S1M H;  4DK3 C;  4A3F B;  4HR7 B;  3D6C A;  1M90 C;  3GTP B;  2JA8 G;  3BVZ A;  5FLX L;  3JC6 6;  2H1E A;  2MUY A;  2KCT A;  3I4O A;  1D2B A;  5C5M A;  5C3E G;  2F4V L;  2E2J B;  1NTG A;  2KOL A;  4KKU A;  2RCN A;  5DM7 3;  2LY7 A;  1SFO B;  3T56 B;  1RF2 D;  1V43 A;  1X55 A;  1NE3 A;  3CCE A;  1QZH A;  2JA6 B;  4A3K G;  1SRO A;  1X3E A;  2NN6 I;  2BE5 C;  4KN7 C;  1SLJ A;  1HFN A;  3GTO B;  2ZTE A;  2K50 A;  3CPW A;  2NVT H;  1CM9 A;  2F0T A;  3M4O H;  4BA1 I;  2R7F A;  2F0Q A;  2ES2 A;  3HOV G;  4MTK A;  5C0X H;  1DGS A;  1V8Q A;  1IBM L;  3BZC A;  3GQB A;  5ELC A;  3J7Y W;  1B7Y B;  1SNO A;  5IP9 H;  1SN8 A;  4ZAI A;  4JI5 L;  2PCF B;  5K5P A;  1SMY D;  2F0H A;  3TZU A;  5EAY A;  4A3D B;  3GTJ B;  1HZC A;  4IFD G;  4KLK A;  2L55 A;  4RGT A;  1ML0 D;  4FF3 A;  1EL0 A;  4JCV E;  1PTO C;  3PUW A;  2D2C C;  3H91 A;  4HJ9 A;  2IX3 A;  1VQF A;  2EY1 A;  4RGO S;  4RGM A;  3K5L A;  3V96 A;  2VQE Q;  4C3I G;  1G6Z A;  2A68 C;  1WCM G;  2BDN A;  2O5I C;  2JA5 B;  4M1U B;  1F9Q A;  1VQC A;  4CDE C;  1ICF B;  4H44 C;  4G7H C;  4B3M Q;  4FDB A;  1RDP D;  1ILP A;  2CVR A;  4GNX C;  2UUB L;  4JI3 L;  4ZKC B;  4CJ0 B;  3PIO 3;  1ZXT A;  1DD2 A;  2LXK A;  2M2L A;  2ALY B;  3IKJ A;  1KNE A;  2Z6K C;  3VR4 A;  3DEP A;  4DV1 Q;  4DFA A;  3A8K E;  4DUZ Q;  1S3O A;  4P73 A;  5FJ8 H; 
#chains in the Genus database with same CATH homology
 1K3R A;  1HR0 L;  3BJU A;  3UDX A;  2R7Z H;  1TWH H;  3U4Z A;  3S1R H;  3HKZ G;  1HZB A;  1FGU A;  4PZ8 A;  3KFU A;  3BZK A;  4LUV A;  5IYC G;  4GNX A;  2JE6 I;  1GO3 E;  4A3F G;  1TWF H;  4LF4 L;  4QY7 A;  4BXX G;  3CAM A;  5IWA L;  2L15 A;  1QVF A;  3AYH B;  2N8N A;  3NEN A;  4HID A;  4LUO A;  4NXN L;  1HNZ L;  2VY3 A;  4HJ7 A;  4A3B H;  2Y0S E;  4KHP Q;  3I4N G;  1C0A A;  1VQO A;  2OTL A;  2AWO A;  4JI2 L;  4TVA B;  1PH7 A;  4BBR G;  4DV7 L;  1HZ9 A;  4DV4 Q;  1EOV A;  4JV5 L;  1E22 A;  2BA0 A;  2IT1 A;  2Z6K A;  2A8V A;  1Y1V H;  1K8G A;  3OYY A;  2K52 A;  4HJA A;  4LF6 Q;  5M5X H;  1VQJ A;  1VQM A;  2WFW A;  4IOC A;  1S72 A;  2QGQ A;  3AFP A;  1I3Q H;  4P75 A;  1KL9 A;  3GO5 A;  1Q7Y C;  1IBL L;  2E5L L;  3CCL A;  2YTY A;  4OON A;  2NN6 G;  2JA6 G;  2JA8 H;  4GN4 B;  4A3L G;  3S2H H;  3HKZ E;  2I5M X;  2OCE A;  4R4T A;  1LTL A;  4A76 A;  5GAD C;  3B6Y A;  4YY3 L;  4GLA C;  4DUY Q;  4LFA Q;  1Y1W H;  3RLN A;  1LYL A;  1XPU A;  3MEF A;  5JEA G;  4DV0 Q;  2RF4 A;  5GAE C;  2IY5 B;  2V1C C;  1Q81 C;  4JC0 A;  5IYD G;  4DV6 Q;  3KDF B;  2VL6 A;  5LMN W;  1J5E L;  1VQB A;  4GNX B;  1X3G A;  4PZ7 A;  4JI7 Q;  1PFS A;  1WI5 A;  4IJH A;  3H3V H;  1V1Q A;  3CXC A;  3CCM A;  2N78 A;  1CSQ A;  1VCI A;  3A0J A;  3M4Q A;  4IO9 A;  1HNW Q;  4AQY L;  4A3K H;  1PYS B;  1OXX K;  1X65 A;  2NVY H;  5DLQ E;  5ELN A;  4HJ5 A;  1PH5 A;  4L5S A;  4DR4 L;  4DR6 Q;  1PVO A;  2YTX A;  2BH8 A;  2QEX A;  4JOI C;  3L2P A;  1FJG Q;  3ERS X;  4UPA A;  2C35 B;  4JI8 Q;  4L5Q A;  1KC8 C;  1KHI A;  3G6E A;  1VQN A;  3CC2 A;  1KRS A;  3T1H L;  4APV A;  2ZM6 Q;  1AE3 A;  3UDG A;  1K83 H;  4BBS H;  3M4P A;  1J6Q A;  1I94 L;  4OX9 L;  4JBJ A;  3HOV H;  4A3D G;  1RIP A;  3F2D A;  4DR2 L;  4DR3 L;  2JA7 H;  2VS1 A;  3K80 C;  2YYZ A;  2OWO A;  2Q2H A;  4LWC A;  1WYD A;  5GAH C;  4K0K L;  1I6H H;  1X56 A;  1K73 C;  2ASB A;  4UP9 A;  2MO1 A;  1EQR A;  4X66 Q;  5IY0 A;  2UXD Q;  2UXC Q;  4DR1 L;  1IXR A;  2A1A A;  2JEA I;  1AE2 A;  1GM5 A;  4AYB G;  3TRZ A;  5K36 G;  4P71 A;  4JBK A;  3KYH C;  1Z9F A;  4JI0 L;  4JOI A;  4B3T Q;  2PQA A;  2CFM A;  4PZ6 A;  4PMW A;  4DR5 Q;  3A74 A;  1RL2 A;  1UWV A;  1EIY B;  3F2C A;  3J7A 5;  5BR8 Q;  2ZJQ A;  2JA5 G;  4LNQ A;  3EN2 A;  1N8R C;  1KXL A;  5FLM H;  5C0X G;  4RMF A;  3I55 A;  1VQI A;  4JI1 L;  4LFC L;  5C4J H;  2VUM H;  3KOJ A;  1PH9 A;  3H0G H;  3I7F A;  3K7U C;  4LF9 Q;  1Q12 A;  3HOX G;  1NMG A;  3PGZ A;  2K4K A;  4DPG A;  1IBL Q;  3U58 A;  3J80 c;  2ZTD A;  3J81 c;  4C3I H;  1Q8K A;  1IBK L;  5IP9 G;  4YHH L;  4A3E H;  4LF7 Q;  3M9B A;  3Q8D A;  1JJG A;  3PCO B;  4GKK L;  4DV5 Q;  2HHH L;  4BY7 G;  2NVQ H;  5IYB G;  2AHO B;  2PNH A;  2F4V Q;  1XMQ L;  3KLW A;  1VQP A;  5M5W H;  2EIF A;  1Q86 C;  2WAQ G;  1TWG H;  2JA9 A;  5C44 G;  1VQD A;  2D0P A;  4A75 A;  1UE7 A;  1XPR A;  2UU9 L;  4DV3 L;  4LFB L;  4R4C A;  4WJ3 M;  3KJP A;  1TWA H;  2XTI A;  4X64 L;  3GD7 A;  4LF5 Q;  1N36 L;  3HOW H;  2E2H H;  1WOC A;  1HNX L;  3HOZ G;  2I0Q A;  2UUC Q;  4A3M G;  2Y0S G;  5IP7 G;  4IPG A;  4LW1 A;  3DM3 A;  3GTQ H;  2JEB I;  3PUX A;  2R93 G;  3PUV A;  4A4I A;  1PHJ A;  1XPO A;  1U0L A;  1WFQ A;  1N34 L;  3S15 H;  4BY1 H;  2OTJ A;  3PUY A;  4JYA L;  2GVA A;  2FXQ A;  3JAM i;  4C3H H;  3T1Y L;  4JI4 L;  1YVC A;  4XIG S;  5C4X G;  1L1O B;  4OWX B;  1CSP A;  4A93 H;  3G48 A;  3SGI A;  1XNR L;  4POG A;  4Y52 H;  1A63 A;  3EBE A;  1IBM Q;  1AH9 A;  4A3C G;  2F3I A;  2KEN A;  1PH3 A;  1R9T H;  1PH8 A;  3GTM H;  5IYC H;  1XNQ Q;  1QVG A;  1UE6 A;  4A3F H;  3KDF A;  4R4I A;  2R92 G;  4DV2 Q;  2PI2 E;  4X62 L;  3GTP H;  3I4M H;  4JI6 Q;  3UDF A;  2Q2I A;  4JI5 Q;  1NJI C;  4YCV A;  4B3S Q;  4UP8 A;  5HY6 A;  1N32 Q;  1NBW A;  1E3P A;  3HOY G;  1W2B A;  4BBR H;  2BH2 A;  3RZO H;  2R7D A;  4A3G G;  1BBU A;  1NMF A;  4YWK A;  1QUQ B;  5JJK A;  1SFO H;  2VZA A;  3K8A A;  2JQO A;  1HZA A;  3GDE A;  2VQF L;  4GLX A;  4R1J A;  2MQH A;  4GKJ Q;  4JG2 A;  1CKN B;  5IT9 c;  3S1N H;  4J15 A;  1E24 A;  1XTD A;  1XMO L;  5FJ8 G;  2MO0 A;  1JJC B;  5ELO A;  2JA6 H;  2R7Z G;  3CW2 C;  4AIM A;  3M3Y H;  1JB7 A;  2WB1 E;  4BA2 I;  1VQ4 A;  3S17 H;  3D0F A;  1EUJ A;  1V9P A;  4X65 L;  3PIP A;  4NXM Q;  4DR7 Q;  2GVB A;  5C3E H;  1YI2 A;  1E1O A;  3L0O A;  3GTO H;  4IJL A;  2HHH Q;  2AWN A;  4AH6 A;  3IRB A;  1CKM A;  4A3B G;  3ICE A;  5AJ3 L;  3ZJY C;  1P16 A;  4DAM A;  4HIK A;  1QVC A;  5LMN L;  4GN5 A;  4NPS A;  3GTG H;  1Y1V G;  4C2M H;  2NZH A;  4UY8 C;  5E7N A;  1MJC A;  1LUZ A;  3KF6 B;  2UUB Q;  3CP0 A;  3RLF A;  3S24 A;  3J7Z C;  1N33 Q;  3CCS A;  1YEZ A;  3GTK H;  3MXN B;  4QJF A;  1VQ7 A;  2OQ0 A;  4JI3 Q;  1Z47 A;  4LF8 Q;  2VQE L;  3AFQ A;  4IFD J;  1KAW A;  2HQL A;  3KJO A;  1IL2 A;  1PH4 A;  1IZ6 A;  3CPF A;  2UUA L;  3OTO Q;  3S14 H;  2UXB L;  4A3D H;  4JBW A;  4Y7N H;  2EXD A;  2H5X A;  1FL0 A;  1VS0 A;  3KF8 B;  4MNO A;  4YCU A;  1A8V A;  3GTJ H;  4ME3 A;  1MIU A;  1KQS A;  4B3M L;  1YIT A;  4HJ8 A;  4NB3 A;  4QQB X;  3CQZ H;  3CCU A;  5GRO A;  4IOA A;  4A3I H;  1HR0 Q;  2I5H A;  1B8A A;  1L1O C;  3I56 A;  1SMX A;  3CCQ A;  2CWP A;  2Z0S A;  5FJ8 H;  1HJP A;  1VQH A;  1X9N A;  4LF4 Q;  2DGY A;  2AMC B;  1L2F A;  5IWA Q;  3CD6 A;  4XTC S;  2YU9 H;  2PMZ E;  4X6A H;  2OQK A;  1HNZ Q;  3RN2 A;  2MFI A;  1Q82 C;  4NXN Q;  4GOP B;  1TWC H;  4BBS G;  1X6O A;  1YHB A;  4JI2 Q;  4DV1 L;  4DV7 Q;  4DUZ L;  1PYB A;  4B3R L;  1NY4 A;  3FP9 A;  3CCJ A;  4JV5 Q;  2JA7 G;  1C9O A;  2IHE A;  1GD7 A;  5HGQ A;  3PO2 H;  3H3V I;  3TRE A;  2K5N A;  3HOX H;  2B29 A;  1Q1B A;  1O7I A;  3CC7 A;  4WJ4 A;  3W1B A;  1Y14 B;  5J3B A;  1I50 H;  3PF5 A;  2E5L Q;  1PH1 A;  3HOU G;  3TEH B;  3CCR A;  1FVI A;  4DKA C;  3RLO A;  5M3F G;  1L1O A;  1WCM H;  4BY7 H;  4P74 A;  2ZTC A;  2XGT A;  2NVX H;  2PI2 A;  4YY3 Q;  4KHP L;  3CCV A;  1M1K C;  1OXT A;  4OWW B;  2QA4 A;  4YWM A;  4DAY B;  4OO1 I;  5C44 H;  2B3G A;  1D8L A;  2K5H A;  3H15 A;  4DV4 L;  1J5E Q;  2GN5 A;  1YJW A;  1JJ2 A;  4LF6 L;  3NEM A;  1YHA A;  2YTV A;  1H95 A;  5FLM G;  1I5F A;  2ATW A;  1GKH A;  4AQY Q;  2ZJP A;  2VUM G;  3H0G G;  3I2Z A;  4DR4 Q;  1ASZ A;  3HOZ H;  3UE1 A;  2N3S A;  2E2I H;  1QUQ A;  3PO3 G;  5IP7 H;  5M3M H;  3RNU A;  4DUY L;  1CKN A;  4A3E G;  4LFA L;  2R93 H;  2B63 G;  4DV0 L;  4C3J H;  1XJV A;  5GQO A;  3T1H Q;  4RG1 A;  4DV6 L;  4JI7 L;  4UP7 A;  1I94 Q;  4OX9 Q;  1K0R A;  1LM0 A;  3PIO A;  4IFD I;  1UEB A;  2CCZ A;  4DR2 Q;  4DR3 Q;  3S1Q H;  3EIV A;  1HNW L;  3TQY A;  3W5O A;  4ALP A;  4A3C H;  1YHQ A;  4K0K Q;  2WB1 G;  1G29 1;  1VQ8 A;  5IE8 A;  1E1T A;  3ULP A;  4DR6 L;  2WP8 J;  1FJG L;  4DR1 Q;  5JEA J;  3TS0 A;  2RHQ B;  4A3J G;  3HOW G;  4BXX H;  3JAM c;  1UE5 A;  4JI8 L;  1N9W A;  1SE8 A;  1CKO A;  1VQ5 A;  3NEL A;  3PV0 A;  2K75 A;  5GAG C;  2IX1 A;  1L0W A;  4JI0 Q;  1T9H A;  3M7N A;  2JJQ A;  3I4N H;  3HOY H;  2CWA A;  3HKS A;  3NBH B;  2ZM6 L;  2E2J H;  3STB C;  4A3G H;  3AQQ A;  3BU2 A;  3KF6 A;  1EQQ A;  4BY1 G;  2E8G A;  3FKI G;  2ID0 A;  3U50 C;  2VW9 A;  4R4Q A;  4L5T A;  4R4O A;  1HR0 W;  4HIO A;  3U4V A;  4GOP C;  3WWV A;  4JI1 Q;  1WJJ A;  3M85 A;  3HFZ B;  4X66 L;  3A5U A;  4LFC Q;  2KHJ A;  4EQ5 A;  2RHS B;  3PSI A;  4A93 G;  3HOU H;  1VQL A;  2UXC L;  2UXD L;  1G6P A;  4A3L H;  2EQS A;  1A62 A;  3F1Z A;  3VDY A;  3CMA A;  5LMU L;  1QZG A;  1EFW A;  3I4M G;  1IBK Q;  4YCW A;  4YHH Q;  4GN3 B;  4B3T L;  1K8A C;  4DR5 L;  3STB D;  4GKK Q;  2K14 A;  2LSS A;  1S40 A;  1VQ6 A;  5BR8 L;  5IYD H;  2BA1 A;  4DK6 C;  5M5Y H;  4OWT B;  1YJ9 A;  1XMQ Q;  1VQ9 A;  2JK8 A;  3D31 A;  1EWI A;  1YZ6 A;  2N49 A;  3ER0 A;  3FHW A;  1KRT A;  4EX5 A;  2Q2U A;  1CUK A;  3K7A H;  2HIV A;  2UU9 Q;  2IX0 A;  3A5Z B;  4DV3 Q;  3E0E A;  4LF9 L;  2IHF A;  1OXV A;  3L7Z C;  4LFB Q;  4GOP A;  3S1M H;  4DK3 C;  4X64 Q;  1YNX A;  1N36 Q;  1M90 C;  2KHI A;  2JA8 G;  1HNX Q;  3JC6 6;  4LF7 L;  1MJE A;  1SRU A;  4DV5 L;  2KCT A;  3I4O A;  4GLV B;  1Y1W G;  1PV4 A;  1OXU A;  5C3E G;  1UE1 A;  4QIW E;  1K9M C;  2F4V L;  1NTG A;  5C0X J;  1YBY A;  2RCN A;  1N34 Q;  1ASY A;  3F8T A;  1VQK A;  2HT1 A;  3E9H A;  1OTC A;  1B70 B;  1IYJ B;  4KHZ A;  4JYA Q;  1V43 A;  3T1Y Q;  4JI4 Q;  2KBN A;  1X55 A;  4GS3 A;  4YWL A;  5H1S E;  1NE3 A;  1KD1 C;  3CCE A;  1XNR Q;  1U5K A;  1G51 A;  4IPH A;  1QZH A;  3S2D H;  3F2B A;  4A3K G;  4LF5 L;  2HIX A;  2R6G A;  3K0X A;  1PH2 A;  1SRO A;  1X3E A;  2CKZ B;  1JT8 A;  3E9I A;  2UUC L;  2K5V A;  1BKB A;  2I5L X;  2NN6 I;  1SLJ A;  4X62 Q;  1BVS A;  2ZTE A;  4DNI A;  2K50 A;  3CPW A;  1Q1E A;  2NVT H;  1JMC A;  3DLL A;  3S16 H;  4OO1 G;  3M4O H;  4BA1 I;  2JA5 H;  2R7F A;  4O0A A;  2ES2 A;  3HOV G;  3W1G A;  2VQF Q;  1DGS A;  4MZ9 A;  4PG3 A;  1IBM L;  1XMO Q;  3BZC A;  3ULL A;  2A19 A;  2F52 A;  5FLX c;  3UE0 A;  4A3I G;  1XNQ L;  2VNU D;  2Q2T A;  1TXY A;  4DV2 L;  1B7Y B;  1Q46 A;  5IP9 H;  4JI6 L;  5M3F H;  1SN8 A;  5LMU Q;  4X65 Q;  4JI5 L;  4H02 A;  4LUZ A;  1D7Q A;  5IYB H;  4B3S L;  1SR3 A;  3PF4 A;  1N32 L;  1OXS C;  5EAY A;  4IPD A;  1HZC A;  3G4S A;  1MKH A;  4IPC A;  4IFD G;  1VQE A;  4KLK A;  5AJ3 Q;  3J80 i;  3J81 i;  4JBM A;  3CF5 A;  3RN5 A;  4L5R C;  4GKJ L;  4JCV E;  1PA6 A;  5LMN Q;  1JE5 A;  3PO2 G;  3PUW A;  1HH2 P;  2YV5 A;  3K81 C;  1KIX A;  1YIJ A;  2AKW B;  3PO3 H;  4POF A;  4HJ9 A;  1VQF A;  1W3S A;  4A3M H;  2D62 A;  1EYG A;  2D0O A;  5JJL A;  4NXM L;  2LXJ A;  3G71 A;  4KI0 A;  2VQE Q;  1P8L A;  4DR7 L;  2B63 H;  4P72 A;  5JJI A;  1WCM G;  4AYB E;  4HIM A;  4OXP A;  2UUA Q;  3J81 j;  1C7Y A;  4O2D A;  2NZO A;  2UXB Q;  3CME A;  2MNA A;  4QGU A;  1PH6 A;  5C4X H;  1VQC A;  3OW2 A;  4QL5 A;  4B3M Q;  4FDB A;  3RR5 A;  3CC4 A;  1VQA A;  2PQA B;  5C0X I;  3LGJ A;  3GTL H;  4GNX C;  1BBW A;  2UUB L;  4TQU S;  4MTN A;  3ULJ A;  2R92 H;  1N33 L;  4A3J H;  4JI3 L;  4LF8 L;  1X54 A;  1YJN A;  1X3F A;  2DUD A;  5M3M G;  2ZJR A;  2LXK A;  3OTO L;  1A0I A;  2ALY B;  1EIF A;  3PUZ A;  3TS2 A;  2Z6K C;  3RZD H;  3FKI H;  3UDI A;  3AEV A;  1GVP A;  4DV1 Q;  4B3R Q;  4DUZ Q;  1VQG A;  2WAQ E;  1S3O A;  4P73 A;  2KCM A;  2CQO A;  1E7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...