3BU2A

Crystal structure of a trna-binding protein from staphylococcus saprophyticus subsp. saprophyticus. northeast structural genomics consortium target syr77
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
198
structure length
195
Chain Sequence
MNLFYNKEAVGDVAFLQINPTEGEYNYVTQGDVVEIQNDGEVVGYNIFNASNKATLTHIKLTETLVQAFQKAIEAAGFTYKLDADFTPKFVVGYVETKDKHPDADKLSVLSVDVATEKLQIVCGAPNVEAGQKVVVAKVGAVMPSGMVIKDAELRGVASSGMICSMKELGLPNAPQEKGIMVLSDDYTVGQSFFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Putative tRNA-binding protein
publication title Crystal structure of a tRNA-binding protein from Staphylococcus saprophyticus subsp. saprophyticus.
rcsb
source organism Staphylococcus saprophyticus subsp. saprophyticus atcc 15305
total genus 32
structure length 195
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
A PF14794 DUF4479 Domain of unknown function (DUF4479)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3bu2A01
3.30.1940.10 Alpha Beta 2-Layer Sandwich Nucleic acid-binding protein fold YtpR-like 3bu2A02
3FHWA 3OTOQ 1VQOA 4LUOA 4QIWE 1Q8KA 4DV0Q 1HJPA 1Q86C 4A3BG 1N33Q 1I6HH 4RMFA 3HOWG 1QVFA 3RR5A 3KYHC 4C3IH 1UWVA 2ZJQA 3S15H 4DK6C 2Y0SE 2E2JH 1LM0A 1Q1EA 1HNZL 4DR3L 4BA1I 3CCSA 2YTYA 5IYBH 4POGA 4IJHA 1VQ5A 1MIUA 4HIOA 1CKNA 1V1QA 4X65L 1EFWA 1JT8A 1TWFH 3CP0A 1SRUA 5IYBG 5LMNL 4LF5L 1A8VA 1XMQL 4TQUS 2Z0SA 4GN5A 1XNQQ 4YWKA 4OONA 3KJPA 1R9TH 1XJVA 1CKMA 3HOUH 3I4MH 2ZM6Q 1XMOQ 4DR3Q 1OXXK 1KIXA 1YI2A 4GKJQ 1N36L 4DR2L 1EQRA 1YBYA 4YCVA 3I4MG 3HOXH 2A8VA 2IY5B 1VQDA 4J15A 4X65Q 3TREA 5LMNQ 1K9MC 3PO3H 3STBD 1OXVA 1PH8A 4LF8L 4LF5Q 1SN8A 3KJOA 1HZ9A 1W3SA 1XNRQ 4KLKA 3PO3G 3GTJH 2B3GA 4APVA 2NN6G 1L1OB 1N34Q 5C0XJ 1E3PA 2KHIA 2KHJA 2UXDL 1E7ZA 3HOYH 1JJ2A 3CCUA 3CC7A 2E8GA 3CW2C 3J81i 4DV6L 4DR4L 4DR2Q 2Q2TA 3HOYG 3PV0A 1KL9A 3S16H 4DR6L 2UXBQ 3L2PA 4BBRH 4HIKA 2VL6A 3EBEA 3F8TA 5C0XI 3H15A 4A3MH 3GTMH 1PH6A 1IBLQ 4UY8C 1D8LA 3B6YA 4GN4B 3H3VI 1AE3A 4L5SA 5K36G 2EQSA 1LUZA 4DNIA 5IP7H 5BR8L 1O7IA 2HHHL 1SLJA 2PQAB 3J7ZC 1PH7A 2EIFA 1BBWA 2N8NA 3CC2A 3CMAA 2R7ZH 3FP9A 3HOZG 4NXNL 4B3SQ 2HT1A 1OXSC 4JI8Q 5M5WH 4C3HH 4JI6Q 3UE0A 4DR6Q 4HJAA 2R93H 4IPGA 3PUXA 2KCTA 4DAYB 4A3EH 2DGYA 1YNXA 3MEFA 4PZ6A 3UDIA 3U4ZA 3RNUA 1VQFA 4AIMA 1KD1C 4JI2L 3RZOH 4BBSG 2R93G 3I4OA 4JI0L 4A3EG 1WFQA 4X64L 4LNQA 4JI7L 1PYSB 4DV5L 2Q2UA 1JJCB 3PUZA 2JQOA 1EIFA 2JA7H 4R4OA 1EYGA 1UEBA 5BR8Q 3T1YQ 1B8AA 2JA9A 2F4VL 2JA7G 4NXNQ 1KHIA 3G6EA 2N78A 2WAQG 4LFCL 1VQGA 1DGSA 1P8LA 4UP7A 1KRTA 4JI1L 3JC66 3J81c 2E5LQ 2RCNA 1N9WA 1YZ6A 5LMNW 2CQOA 4LUVA 1Q81C 4YY3L 2VUMH 1EQQA 1PH2A 1K83H 5IYDH 2IT1A 4XIGS 4JI2Q 4POFA 4YCWA 3UE1A 1B7YB 2VUMG 3GTLH 4ALPA 1JE5A 3HFZB 3GO5A 4A4IA 5IYDG 4YHHL 1PH9A 1HNXL 5FJ8H 4DV1L 1HNWQ 1C7YA 5FJ8G 2F4VQ 1H95A 3H0GH 1KQSA 4LFCQ 1Q12A 2AKWB 4JI1Q 2Z6KA 2HIVA 2PMZE 3IRBA 4DV3Q 1IL2A 2NN6I 1E22A 1KXLA 2MFIA 4AYBG 2F52A 5IT9c 3I56A 2OCEA 4NPSA 2AWNA 3TQYA 5IWAL 3CMEA 1PFSA 2KBNA 4LF7L 1Y1VH 4JV5Q 4R4TA 2CWPA 3AYHB 2RF4A 2JA6H 4DV1Q 4JI3L 4DKAC 4R4IA 2ES2A 3AQQA 3PSIA 4O0AA 2JA6G 5M3MH 4B3RL 2JJQA 4A3LG 4IO9A 3BU2A 4A75A 2ALYB 4H02A 4BXXH 1QZGA 1Y14B 2IX0A 3HKZG 3A0JA 3RLFA 3CPWA 4AQYL 4BY7H 1YJNA 3OYYA 3GDEA 1HH2P 4UPAA 4B3MQ 5DLQE 1WYDA 4BY7G 3GTPH 4OX9L 3S1MH 1GKHA 2MQHA 2YYZA 3TEHB 4DV2Q 4DR7Q 1YJWA 3AFQA 2YTXA 2LSSA 4GOPC 1J5EL 1MJCA 1G6PA 1NJIC 1IXRA 1X9NA 1WOCA 4PMWA 3CCRA 1UE6A 1U0LA 1X3GA 2EXDA 2DUDA 2OQKA 4GNXB 2Z6KC 1ASZA 4B3TL 2LXKA 3I2ZA 3M7NA 4A93H 5ELNA 4P74A 1ASYA 1SR3A 4IFDG 1V9PA 1XTDA 3D0FA 4A93G 1UE5A 1D7QA 5LMUL 5IP9H 4UP8A 3G71A 4LFAL 1V43A 1TWHH 4A3CH 1HNZQ 4RG1A 4JOIC 1BKBA 1AH9A 4Y52H 2A1AA 3J80i 3KF6B 3HOUG 5IY0A 3KLWA 4DUYL 1QZHA 3I4NH 2R92H 3FKIH 4UP9A 4P71A 4BA2I 4L5TA 1VQBA 2BH8A 1NBWA 3PCOB 3HOXG 1KAWA 2A19A 3FKIG 3ER0A 4K0KL 2VQFL 1XMQQ 5C4XH 4HIDA 3E9HA 4P75A 2OTLA 2I5HA 2NZHA 4BY1H 3J81j 2E2IH 3BZCA 4DR1L 3KF8B 5C4XG 1JMCA 1M90C 4GLVB 4IJLA 4QQBX 4L5QA 1FGUA 3I7FA 4BY1G 3ULPA 1N36Q 4A3KH 4DR5L 3UDFA 3F2DA 2ZJPA 2H5XA 4DUYQ 3S1NH 1X65A 3CC4A 4HJ5A 1CKOA 1EIYB 1BBUA 4A3KG 1OXUA 3AEVA 1VQKA 2N49A 1Z9FA 5J3BA 1N32L 4LF8Q 1IBKL 4IPHA 2CWAA 4BBRG 5M3FH 2JA8H 2UUAL 4JYAL 4GKKL 1J6QA 4K0KQ 1WJJA 1X6OA 1PH5A 4A3MG 1M1KC 4IOAA 5AJ3L 3S17H 1C9OA 4PZ7A 2VQEL 2UXDQ 3RLOA 1Z47A 4QY7A 2JK8A 3ULJA 4KHPL 2K14A 4DV6Q 1LYLA 3PGZA 5IP7G 4DR4Q 4DR5Q 3BJUA 2MNAA 4GNXA 3J80c 2MO0A 3PIOA 3CCMA 3L7ZC 1PA6A 3K7AH 3SGIA 5C4JH 4HIMA 1AE2A 1K8GA 4JYAQ 5JJLA 1I5FA 4QJFA 4OWXB 3D31A 3G4SA 3UDXA 4DAMA 4IFDJ 3CAMA 4LFBL 1FL0A 3KFUA 2HHHQ 1C0AA 2YU9H 2YTVA 3LGJA 1K3RA 1X3EA 3KF6A 2VW9A 4KHPQ 4DPGA 2K4KA 1VCIA 1I50H 1VQHA 3F2BA 4IFDI 4DUZL 2NZOA 3K0XA 1G291 3K8AA 3W1GA 2V1CC 2WB1G 3U58A 4JI0Q 2IHEA 4X64Q 1L1OA 1VQ8A 1IYJB 5HGQA 4DV5Q 4JI7Q 1YHQA 2ATWA 3S14H 2JEAI 4A3DH 1HR0L 4LF9L 3M3YH 4X62L 1GO3E 2OQ0A 2JEBI 3HKSA 4IOCA 1I94L 4PG3A 3L0OA 2ID0A 3S24A 4QGUA 2KENA 4JG2A 5GAGC 2R7FA 2YV5A 3M4PA 5GADC 5GAEC 3K80C 1P16A 1I3QH 1HZAA 4JI5L 4A3FH 4LF6L 4QL5A 4DK3C 1VQMA 1K8AC 2GN5A 2QGQA 4YY3Q 2UU9L 2BA1A 3H0GG 3CCQA 3RN2A 3PIPA 4A3FG 3GTOH 2N3SA 1KC8C 1JJGA 3PO2H 3CCEA 1GD7A 1XPUA 4JI4L 4AH6A 4YHHQ 1HNXQ 2PQAA 1LTLA 1I94Q 1K73C 2ZTEA 1SMXA 1YHBA 4DV7L 1Y1VG 2Q2IA 1WCMH 1EOVA 3NENA 1VQ7A 4OO1G 4X66L 5C44H 4GLXA 2WAQE 1VQ9A 5FLXc 4DV4L 3PF5A 1PV4A 3CCJA 1CUKA 1HZBA 1NY4A 1WCMG 4O2DA 1UE7A 4P72A 1GM5A 4LF6Q 3NBHB 1CSQA 5M3MG 3OTOL 3A5UA 2KCMA 1KRSA 3CXCA 4DV0L 4HJ9A 3T1HL 1OTCA 1QVCA 1NE3A 2WB1E 3EIVA 4MNOA 5IWAQ 3DLLA 3RZDH 2BH2A 4BXXG 3F2CA 4NXML 4X6AH 1K0RA 4LF7Q 3CD6A 5IYCH 2VY3A 1L1OC 4JI4Q 3S1QH 3NELA 1S72A 2I5MX 3M4OH 2GVAA 3S2DH 3Q8DA 4JI3Q 2BA0A 5IYCG 4DV7Q 4HJ7A 2NVTH 5GROA 4HJ8A 2D62A 1VQNA 1A63A 4DV4Q 2FXQA 4B3RQ 2RHQB 1PH3A 2F3IA 3G48A 5M5XH 3HOVH 1A0IA 4JCVE 1JB7A 4YWMA 1X54A 2OTJA 4AQYQ 1CSPA 4AYBE 1EUJA 4WJ3M 3T1HQ 2R7ZG 4YWLA 1FVIA 2UUCL 3HOVG 2JE6I 1IZ6A 1X3FA 1TWCH 5ELOA 2R7DA 4NXMQ 4JBMA 1XNQL 2K50A 3CF5A 4OX9Q 3E9IA 1PVOA 3EN2A 2ZM6L 1YVCA 5IP9G 1XMOL 3M9BA 4LWCA 1J5EQ 4GKJL 3RLNA 4A3CG 5JEAJ 1E24A 4EQ5A 2JA5H 4A3JH 3ZJYC 4OXPA 3U50C 1L0WA 4MZ9A 1VQEA 3I4NG 4B3TQ 3HKZE 2K5VA 4A3JG 1SROA 2JA5G 2R92G 4KHZA 3ULLA 1HZCA 1XNRL 5JJIA 2PI2A 5HY6A 2UUCQ 1WI5A 2PNHA 2LXJA 4NB3A 1HR0W 5LMUQ 4LFAQ 1N34L 3M4QA 2PI2E 3TS0A 1PH1A 4LW1A 3A5ZB 4TVAB 5M5YH 1VQJA 2ZJRA 1PH4A 1Y1WH 2UXBL 1BVSA 4XTCS 1NTGA 3K81C 2MO1A 2XTIA 3CQZH 1VQPA 2C35B 3WWVA 4GS3A 1Y1WG 4EX5A 2VQFQ 1E1OA 1IBLL 2B29A 1FJGL 5M3FG 2JA8G 4OO1I 3PUVA 1VQAA 1QUQB 5E7NA 1VQLA 3PF4A 4LUZA 4DR1Q 1Q7YC 4GN3B 2OWOA 5GQOA 4R4CA 1X55A 5FLMH 4GOPB 1Q82C 4LF4L 3W5OA 4B3SL 4JI8L 1S40A 4JI6L 2AHOB 5FLMG 1IBML 1N32Q 1RL2A 3JAMi 2ASBA 4A3GH 3A74A 1IBKQ 3ICEA 1S3OA 3ERSX 4JBWA 2UUAQ 3K7UC 4GKKQ 3KDFB 1PYBA 2E2HH 2CFMA 4A3GG 3PUWA 2AWOA 4IPDA 4P73A 4PZ8A 5AJ3Q 1FJGQ 1Q1BA 2IX1A 2ZTDA 3HOZH 2VQEQ 3M85A 3AFPA 3S1RH 2NVXH 1TXYA 2HQLA 2K5NA 4OWWB 3T1YL 1X56A 1B70B 1GVPA 1MJEA 1VQ6A 5IE8A 1VQCA 4Y7NH 2AMCB 2K52A 4LF4Q 4A76A 4OWTB 3STBC 2NVYH 2E5LL 2XGTA 3MXNB 4BBSH 2HIXA 1MKHA 3GTKH 1IBMQ 3VDYA 3GTQH 1YITA 1A62A 2IHFA 2R6GA 4YCUA 3W1BA 3KOJA 2QEXA 1T9HA 4JC0A 1YEZA 2D0OA 1EWIA 1VQIA 3CCLA 4LFBQ 2Q2HA 2UUBL 2UXCL 3S2HH 3F1ZA 4MTNA 3UDGA 2K75A 5JEAG 2B63H 4A3DG 1HNWL 4GLAC 3U4VA 1XPRA 1VQ4A 2CCZA 1YJ9A 2B63G 4IPCA 4DUZQ 1CKNB 2I5LX 4GNXC 2VNUD 1TWAH 1TWGH 1L2FA 4DV3L 2K5HA 2I0QA 3J7A5 5JJKA 3DM3A 3PUYA 3TS2A 1RIPA 1UE1A 4ME3A 1VS0A 1YIJA 3JAMc 1SFOH 1QUQA 1SE8A 1HR0Q 4LF9Q 2Y0SG 4X62Q 3PO2G 4JV5L 2NVQH 2UUBQ 2UXCQ 3CPFA 1N8RC 4KI0A 1OXTA 1PHJA 3TRZA 4GOPA 2QA4A 3E0EA 4R4QA 1NMFA 3RN5A 4WJ4A 3CCVA 2RHSB 4A3IH 4JI5Q 2WFWA 5C44G 2ZTCA 5EAYA 2UU9Q 4R1JA 1G51A 3NEMA 2GVBA 1XPOA 4A3IG 2VS1A 3KDFA 1NMGA 5H1SE 1W2BA 1U5KA 1N33L 1YHAA 4FDBA 5C0XG 4B3ML 4JBKA 3OW2A 4C2MH 3BZKA 1QVGA 3H3VH 4JOIA 4C3JH 4DV2L 4DR7L 4L5RC 1Q46A 1E1TA 5GAHC 5C3EH 4X66Q 4A3LH 2L15A 2CKZB 2D0PA 2VZAA 4A3BH 3I55A 3GD7A 3HOWH 5C3EG 2WP8J 4JBJA 3GTGH
chains in the Genus database with same CATH superfamily
3OTOQ 2B2TA 4ZKCB 4DV0Q 1Q86C 4RMFA 5EJWA 4Z9CB 3TZUA 3S15H 1Q1EA 1F77A 2YTYA 1EYCA 3MTSA 4POGA 1MIUA 1V1QA 4O42A 2QEJC 1BCPD 3CQZB 3PO3B 4LF5L 4N8FA 1XMQL 4TQUS 5J39A 4IN3A 3SK5A 1S5FD 3GV6A 3KJPA 2G9DA 1CKMA 2SOBA 2ZM6Q 4DR3Q 1CHPD 1VDZA 1VQDA 4J15A 4X65Q 5IGEA 1SYCA 4XDXA 3VR2A 1HZ9A 3PO3G 4JVZA 3IKJA 1L1OB 4KN7C 2KHIA 1LT5D 3SK8A 2E8GA 3L9AX 3CW2C 1RF2D 4P2CB 4IZ8A 4DR2Q 2PMZB 3F2UA 1LV9A 2UXBQ 3L2PA 2VL6A 4BBSB 1PTOF 3H15A 2R93B 3PQIA 4E6IA 4A3MH 1JWMD 5K36H 1CI3M 3MFGA 1M4VA 1AE3A 4L5SA 4DNIA 5IP7H 1O7IA 2EIFA 2RDFA 1LTAD 2PYKA 4JI8Q 4C3HH 4JI6Q 2IWHA 5CV6A 4QUFA 1RCVD 1STAA 4JI2L 3RZOH 1KD1C 4BBSG 2R93G 2EY6A 4DK0A 4LNQA 3MC0B 3PUZA 1SFOB 2K1BA 2ZXOA 5IIFA 1DJRD 1IKLA 1EIFA 4R4OA 1UEBA 5BR8Q 2Z9HA 2XRQD 4RKBA 4DNRB 3G6EA 1P8LA 3G6JB 3WOFA 1N9WA 2EJGC 1SYFA 4PQXA 1XXGA 3I70A 3NP8A 1JORA 1W6JA 2KQ3A 3VYUA 4POFA 1B7YB 4ALPA 5IYDG 1STGA 4YHHL 1FNWA 1PXUA 3KLSX 4CHTB 4C3JB 4DV1L 4QB4A 2JA6B 4QMGA 4LFCQ 1HXYD 1Q12A 2AKWB 1ZYRD 2L9HA 4JI1Q 3IRBA 3T56B 5KNBA 1E22A 1KXLA 2MFIA 3KUPA 2F52A 5IT9c 2OCEA 2AWNA 3D4RA 3OPOA 3TQYA 5KYLA 3CMEA 4DF7A 4C3IB 1BXTA 2CWPA 3AYHB 2E2JB 2F0SA 4DKAC 1K8OA 2ES2A 4O0AA 4C3JG 4RHSA 2JA6G 2RA4A 4EQPA 2JJQA 1FGBD 2BE5D 2ALYB 5IOCA 3S9WA 4K6DA 1WTRA 3TSSA 1YJNA 4B3MQ 3J81E 1LT4D 2B2YA 4OX9L 3S1MH 4U673 2PNRC 3HOUB 4C3IG 1YJWA 3AFQA 2YTXA 2L12A 4FXKC 4HN7A 2XWJB 1X9NA 2RKSA 1IL8A 3HOXB 3FKIB 2IW3A 3T13A 4A93H 3BDLA 4B3TL 3I2ZA 1ASYA 4IFDG 1EIHA 3GTJB 5C4XB 1EQTA 5IP9H 3G71A 2SDFA 1TWHH 2F0FA 1AH9A 2A1AA 3KF6B 4PMBA 3HOUG 4DUYL 2ZT9C 4P71A 1Q8IA 4I7AA 1KAWA 3HOXG 2B2TC 3FKIG 4C56C 2VQFL 1EZ8A 3N6RA 1XMQQ 1JC7A 2I5HA 1PFMA 3S17B 5C4XG 4IJLA 3I7FA 3MXGA 1JR0D 2H5XA 3S1NH 4HJ5A 4DA2A 3AEVA 1Z9FA 2K5DA 2JA8H 5M3FH 5KRUA 3K7AB 5EGTA 2UUAL 4K0KQ 1WJJA 4IOAA 3E3XA 1A3UA 1Z47A 2KEDA 3FPPA 2RBMA 1CZWA 4ILWA 1LYLA 4F88A 1TS4A 2KHSA 1SJHD 5E1FA 1PTOD 2HCIA 3J80L 1RKNA 2BDOA 3CCMA 5JJLA 1I5FA 4QJFA 1TKWB 3DXJC 3KFUA 1XTCD 3M3YB 3KF6A 1SBBB 1ENFA 2K4KA 3E6ZX 1VQHA 3F2BA 4IFDI 3H0GB 3HG9A 5JPMC 3K0XA 4S3SA 3V96A 5KNDA 3V05A 3W1GA 2IHEA 4OELB 3S14H 5HGQA 1YHQA 4A3DH 2JEAI 1I4XA 2A6EC 1X3PA 2JEBI 3HKSA 1LTBD 3S24A 2KENA 3DWQA 1SNMA 1ICWA 1WCMB 2QW7A 3QWNA 2A8VA 4FNFA 2GN5A 2BA1A 3H0GG 4G4KA 1JJGA 3PIPA 2N3SA 4RCOA 1ENAA 3VA5A 1LACA 4JI4L 4YHHQ 1SNQA 1SNCA 4DV7L 1Y1VG 3QO2A 3D6WA 3M4OB 1EOVA 4FF2A 5AFWA 2B2WC 4EGVA 3J7YW 1D2BA 4WFN3 3NSWA 1DM0B 1PV4A 1CUKA 1GM5A 1WCMG 4LF6Q 4P72A 1KNEA 5M3MG 1CSQA 4HJ9A 3A5UA 1Z7TA 2WB1E 4MNOA 3RZDH 4X6AH 1AFPA 1L1OC 2I5MX 2KVMA 5GROA 3A56A 2D62A 1A63A 4DV4Q 2R92B 2F3IA 3G48A 5M5XH 3HOVH 3P1HA 3BDOA 1PRTB 2RSOA 4WJ3M 1AW7A 2UUCL 1JWSD 2JE6I 5ELOA 4H0LC 4OX9Q 3E9IA 1CQFA 2F03A 1SYGA 4OGQC 4ME5A 5JEAJ 2A68C 2JA5H 3ZJYC 3BZDB 4ID6A 4B3TQ 3HKZE 2R92G 1G2TA 4MTKA 2NTTA 1XNRL 4NW2A 2EJFC 4K6LA 2LXJA 1HR0W 2CH4A 1S4ZA 2B2YC 1R4PB 4TVAB 2HDMA 2ZJRA 1Y1WH 4ZUIA 3K81C 5IGBA 1VQPA 1JCKB 3NQIA 2VQFQ 1V8QA 1WTXA 3BG3A 1FJGL 2E2HB 1CA5A 4GN3B 4PMCA 5EKLA 4LF4L 4HAEA 1IBML 2ASBA 2ICIA 5EKIA 2UUAQ 1S5DD 3HS0C 3KDFB 2RDHA 4DAVA 2ZTDA 1VF5C 3QB3A 2NVXH 2HQLA 2K5NA 4OWWB 3T1YL 5IE8A 1VQCA 5I9OA 4X3SA 3A55A 5BN3A 4A76A 2NVYH 1O78A 4QIWB 3MXNB 3GTKH 1NNXA 3GTQH 1TWAB 1TWGB 2RSNA 1A62A 1CM9A 2K03A 1KLGD 1S5ED 2NYZD 3DWPA 4KKTA 1LTGD 2FFKB 2UUBL 4KHVA 4IUNA 5JPNC 2FMMA 4MN3A 4MTNA 1TR5A 2K75A 1D1KA 2PW7A 5JEAG 4PNYA 4GLAC 1XPRA 1VQ4A 1GJXA 2VXWA 1YJ9A 2KA7A 3MVVA 2K5HA 3J7A5 2ICEC 3PUYA 1RTOA 1W6KA 5E3FA 2L11A 3MWYW 4JV5L 5JVG3 3S1QB 5EPKA 1I4GA 5ELCA 1EWHA 2NVTB 2F1MA 4R4QA 4WJ4A 5C44G 1DOKA 2GVBA 1XPOA 2VS1A 1CZGA 3KDFA 1W2BA 1X32A 2VB2X 4NP5A 5C0XG 4JBKA 3K5LA 1WTQA 3EROA 4ULLA 4DV2L 2IJ0A 5C6AA 5C3EH 4QUCA 3BVGA 3QG1A 3MXNA 1LTSD 3HOWH 2WP8J 2KEEA 3V2TA 1BCPF 3GTGH 2XSCA 4LUOA 1F2MA 1HJPA 1I6HH 1YNND 3ND8A 1JICA 5I6YA 1UWVA 4DK6C 3LWUA 1CFMA 4J6HA 3LNNA 4KJNA 1HNZL 3K5MA 4DR3L 3CCSA 5M5YB 1S5CD 4F8MA 5IYBH 2SNMA 2OXPA 3JAME 1JOQA 5KGUA 4HIOA 1G8ZD 4X65L 1EFWA 1JT8A 2F0DA 3CP0A 1EFID 2Z0SA 2DJFC 4GN5A 3NBIA 1F2ZA 4YWKA 5LHY1 1K0SA 1ONLA 4EQNA 2KJXA 3I4MH 1YI2A 1N36L 4DR2L 2XRSD 5L37A 1D1IA 3ND9A 2PCFB 2EY1A 3OMGA 4B08A 3T51B 5LMNQ 1OXVA 1B9MA 1SN8A 1XNRQ 1SE2A 1W3SA 1B1ZA 2B3GA 3NQTA 3H6MA 2WKCA 1E3PA 3S1RB 4YIJA 1H9MA 1JJ2A 2Q8RE 4DR4L 1G91A 1JQYD 3S16H 4C3HB 2EXZA 3EBEA 5C0XI 1A2TA 3I3CA 5M9OA 5NUCA 3RZOB 3PIP3 1DOMA 2F4IA 3FMCA 1BO0A 5K36G 2EQSA 2HHHL 2Q8TA 5BR8L 1Y69U 1SLJA 1BBWA 3HOZG 4IUUA 3FP9A 4IUPA 2HT1A 5I4DA 4DAPA 5C3WA 4DR6Q 4HEDA 1GHKA 4DAYB 4A3EH 2DGYA 2AQ3B 4C3HG 3MEFA 1VQFA 4AIMA 4ZUJA 4JI0L 3QJYA 4JI7L 4C1NI 2Q2UA 1JJCB 4CKBA 5CMDA 2JA7H 4R9WA 1EYGA 3T1YQ 3E0JA 4MIUA 5FK9C 1SNOA 2WINB 4NXNQ 1UAPA 1KRTA 2Z8LA 4LFCL 1VQGA 1DGSA 4JI1L 1QVFA 3JC66 5LMNW 1YZ6A 4AYBB 3J81L 1PH2A 1K83H 2AUKA 1ET9A 1GXDC 3UE1A 2WACA 1JE5A 2A6HD 4A4IA 1PH9A 1YNJC 1HNXL 5FJ8H 3T16A 2QCPX 4RKLA 2C9OA 1PTOC 1H95A 1KQSA 2PMZE 4K2KA 5CORA 4AYBG 5IWAL 3NWTA 1PFSA 2KBNA 4UHVA 1RJTA 3OIPA 4JV5Q 5D65A 1JWUD 4R4TA 3K58A 2RF4A 2ZXPA 5DM63 5CC4A 1NCVA 3PMFA 4PV1C 2JN4A 1F9PA 4DAYA 4A75A 4BXXH 1GUGA 3EVQA 1QZGA 4N9PA 1Y14B 2IX0A 4JPBW 4LK1C 4A93B 4BY7H 2Q8IB 3HEJA 3OYYA 1WTPA 1HH2P 4LJZC 1FR3A 1WYDA 4G7OC 5JAVA 2YYZA 2F0LA 3TEHB 3NTHA 4DV2Q 1TWHB 1ML0D 2K6AA 1AZQA 3MHBA 1G6PA 5ELBA 2KUMA 4PMWA 2OQKA 2Z6KC 1TIID 5ELNA 2K28A 4P74A 3I8ZA 4A93G 1UE5A 4ZKBB 1D7QA 1CA6A 1L0XB 1U4PA 2F0GA 3KLRA 2EE1A 4UP8A 4A3CH 5K5PA 1HNZQ 4RG1A 1BKBA 4KY5A 1J9OA 5CR3A 3IFTA 3KLWA 1IW7C 5ELFA 3I4NH 4UP9A 2DNEA 4L5TA 4BBRB 2A19A 4K0KL 5M3FB 4P75A 3NUCA 3NK9A 3J81j 2H4OA 1RDPD 2E2IH 3BZCA 4DR1L 1JMCA 4GLVB 4L5QA 1N36Q 2J0TD 1D6EC 4KD3A 1WTWA 5I2YA 5M5WB 2EY5A 3VR4A 3CC4A 3D8GA 1BBUA 1OXUA 4IQZA 4BBRG 1NR2A 5AJ3L 4RHRA 4ZRZA 4HTHA 3RLOA 3UI2A 2JK8A 1IHZA 1HA5A 3PGZA 4DR4Q 4KMUC 3J80c 2PW5A 3L7ZC 2EYMA 1IYVA 3D4DA 5C4JH 1AE2A 2Z4HA 4J1MA 1K8GA 4OWXB 1WTOA 3G4SA 3UDXA 4IFDJ 3CAMA 3S14B 5DAUA 4DGZA 4LFBL 2CW0D 2K05A 2HHHQ 3H91A 4R8IA 2YTVA 2B2WA 1K3RA 1X3EA 1VCIA 3AB9A 1LTTD 1A2UA 3K8AA 2V1CC 4H44C 4JI0Q 1L1OA 1VQ8A 4JI7Q 1HR0L 4X62L 4IOCA 4PG3A 4ODGA 2ID0A 4QGUA 3EA6A 4JG2A 5GAGC 1BDOA 1BCPB 3M4PA 4A3FH 4JI5L 1HZAA 4LF6L 4MHEA 3CCQA 4G57A 3RN2A 3GTOH 1CTMA 3PO2H 3CCEA 1GD7A 4M1UB 5COYA 1HNXQ 2CHBD 2NTSA 3NTKA 3DWAA 1YHBA 2Q2IA 1MI2A 1VQ7A 2J4XA 2WAQE 1VQ9A 4DV4L 3R2TA 4O2DA 2BCOA 2PPBC 3CRKC 2R7ZB 3NBHB 1C48A 1AEXA 3HOVB 2JP1A 3N52A 4GZYC 2M00A 5IWAQ 3DLLA 3NWSA 2BH2A 3F2CA 3CD6A 5IYCH 2VY3A 1QOHA 1STNA 2MP1A 1EY5A 4HJ7A 1LTRD 3DM1A 4X3UA 1ZXTA 2JA5B 1BBXC 4JCVE 1X54A 5J22A 1CSPA 3T1HQ 2R7ZG 1FVIA 3MZ5A 5CV7A 3HOVG 1IZ6A 1X3FA 3A8KE 1TWCH 1D5MC 2R7DA 4NXMQ 1SJED 3EN2A 4XT3B 2F0QA 5IODA 1YVCA 4GKJL 2F0MA 5I2XA 2FMCA 4OXPA 1Y1WB 1QNUA 4MZ9A 2JA5G 1SROA 4KHZA 1F2LA 1VMPA 4Q5VA 3PIO3 3C46A 5HY6A 1WI5A 2PNHA 5FLXE 3IL8A 3KBXA 1VF7A 1ILPA 1PH1A 3R3OA 2F0KA 3M4YA 1XYIA 4ZYSA 4XTCS 4JW0A 1NTGA 3GV3A 2XTIA 3NBHA 3CQZH 1YNNC 1Y1WG 3HP3A 1E1OA 5JVH3 1IBLL 1II3A 3PUVA 1VQAA 1A3TA 1VQLA 4DR1Q 2X6LA 5IGCA 5C4ZA 5GQOA 2OWOA 2YU9B 2NVXB 5FLMH 4GOPB 1Y8OB 1Q82C 1I50B 1RD9D 4A3GH 3GTQB 1S3OA 3ERSX 5HURA 2CH4W 2CFMA 2AWOA 4P73A 5AJ3Q 1Q1BA 5D3IB 3SK4A 1OO9B 2E75C 1GVPA 2KCNA 4Y7NH 4K2LA 2K52A 4OWTB 2E5LL 2XGTA 2K5QA 3OWEB 4CBVA 1E2ZA 1I3QB 4BBSH 4FP5D 2B2UA 2B8FA 2ENBA 1SMYC 5ELDA 4YCUA 1ZEQX 1DOLA 2Y0SB 4JC0A 2O4XA 3CCLA 4LFBQ 4CDCC 3F1ZA 3UDGA 4HSPA 2B63H 2QDLA 1QE6A 1ZKOA 4K8IA 5KNCA 4RGTA 5ISRA 1CKNB 2O2LD 1HTLD 4DV3L 1L2FA 4FXGC 4NKLA 1RIPA 4OIJA 1EYAA 3SK6A 4WRDA 1SFOH 3JAML 1HR0Q 1R4QB 2Y0SG 4X62Q 3K6OA 3CPFA 3S2DB 3FVQA 4GOPA 1D5ZC 1PLFA 5C3EB 3J7AF 3CCVA 2NBFA 4JI5Q 3AMUA 2ZTCA 3EQLC 3VR3A 3HOWB 1G51A 1EY4A 1NMGA 3A8JE 1U5KA 2A74C 1TT2A 3NHHA 4FDBA 1PZJD 2AUJD 4OEMB 3H3VH 4JOIA 4C3JH 3KBGA 4DR7L 4ZAIA 1GHJA 2RVLA 5LL6X 2F0TA 2VZAA 2B2VA 4A3BH 1LO5D 5C3EG 3FHWA 1VQOA 2OEOA 4QIWE 3HOWG 1FD7D 3KYHC 4C3IH 3E5SA 2E2JH 2WIIB 3BDCA 1LM0A 1V1OA 2F0JA 4BA1I 3I4MB 1PTOB 4IJHA 3ERQA 1CKNA 2A69D 1TWFH 5LMNL 5IYBG 1HA6A 4IFDH 1SDFA 2DY8A 3MXUA 5DNFA 3Q22A 1PDQA 1XX8A 2WV6D 3VR6A 1O7YA 2KCCA 4CDFC 1R9TH 3HOUH 2Z1CA 2D9UA 1OXXK 2EYHA 1KIXA 4GKJQ 3R93A 1WTVA 3HZXA 1YBYA 5J1ZA 3I4MG 3HOXH 2IY5B 2VB3X 1Q3LA 5C3XA 3TREA 1K9MC 3TBIB 4DU9A 1PFBA 2EYOA 2NN6H 3MA2B 3GTJH 2JSOA 4APVA 2L0CA 5C0XJ 3LX0A 2KHJA 4UAIA 1E7ZA 3HOYH 2UXDL 3WDNA 4KK7A 4DV6L 2D2CC 4G7ZC 1BCPC 1KNAA 4XYQA 3PV0A 4DR6L 1XWEA 4HIKA 2WKDA 3F8TA 2HQEA 3SEBA 3DEPA 4A3EB 3GTMH 1ENCA 2ZXRA 4CDDC 4TSSA 3A7LA 3OIQA 4H7BA 1AZPA 1IBLQ 2QDBA 4UY8C 5CBAE 4GN4B 1DD2A 3TP8A 2P5ZX 1LUZA 3S2HB 3RUZA 2JA7B 1B44D 3J7ZC 2PQAB 1PH7A 3CC2A 3CMAA 4NXNL 4I7ZC 3UE0A 1IYUA 2OT2A 3VYRA 3SVMA 4HMIA 1A6XA 4PZ6A 4RGMA 3BVZA 2EDGA 3M7GA 1D5XC 3I4OA 4A3EG 1WFQA 4X64L 1PYSB 4DV5L 1HQMC 3DUZA 1B8AA 5KYIA 2JA7G 5A35A 1KHIA 5LL6S 4CDEC 2E5LQ 2L4NA 3J81c 2RCNA 1QNKA 3VA7A 4LUVA 4TKOB 1Q81C 2K7VA 2VUMH 3NE5B 4QCLA 5IGDA 2LKVA 5D3DA 3GTLH 3HFZB 3GO5A 1V1PB 3KLSA 1ILQA 3EJIA 5FJ8G 2F4VQ 4KN4C 3H0GH 1EL0A 3HKZB 2Z6KA 2O5IC 4HR7B 4DV3Q 4JK1C 4L6TB 1J8IA 2B2UC 3BYTB 4QF4A 3I56A 4BY7B 3A54A 1IKMA 1KDCA 3U9SA 3HGBA 1O7LA 4LF7L 1Y1VH 3S15B 2F0VA 2MUYA 4JI3L 1B3AA 3AQQA 3PSIA 5M3MH 4B3RL 4A3LG 4H02A 3VYTA 3HKZG 3A0JA 4AQYL 3OHXC 3GDEA 1SXTA 2LS01 4BY7G 1EY8A 3GTPH 4DXFA 5KIXA 1KTKA 1SEBD 3L3OC 4DR7Q 5HGTA 1ZYRC 1G6ZA 4GOPC 2I07B 3I4LA 4XXEA 3X3NA 4HCEA 4RH6A 3CCRA 4GNXB 1U0LA 2EXDA 1MD2D 3M7NA 2K33A 1GUWA 1SR3A 3A7AB 1V9PA 3D0FA 3VYSA 1V1PA 3O13A 3I72A 4LFAL 1V43A 4JOIC 4KKUA 4Y52H 5IT9E 3J80i 2KOLA 3RD4A 2BE5C 2R92H 2B2VC 1VQBA 1SNPA 1NBWA 5I9PA 1FNVA 4B9XA 4A3MB 2EYPA 2RQXA 5E4WC 4HIDA 4RGOS 2OTLA 4BY1H 1EQVA 1B2TA 1FGUA 1B9NA 5DEHA 4A3KH 3F2DA 1SYDA 1BNZA 3URYA 4RWSC 1X65A 2IL8A 2R3ZA 3C2PA 3LWEA 5A2QE 5CV4A 1BUVT 2G9HD 1QB5D 1IBKL 2CWAA 1F9SA 4GKKL 1KLUD 5C4JB 1X6OA 2EVBA 4X3TA 4A3MG 4K5VA 3AU7A 1STBA 1C9OA 2UXDQ 1F9RA 3ULJA 2A6ED 2K14A 4DV6Q 5IP7G 1ET6A 2TMPA 4X3KA 4DR5Q 4GNXA 3PIOA 1NUCA 1PA6A 3ITPA 3SGIA 4HIMA 4JYAQ 4K5XA 1GUNA 5JOBA 1K3BC 2D5DA 1C0AA 5IGFA 4NMZA 4KHPQ 1JOKA 2RDGA 4DPGA 5C5LA 4WJWA 3G7LA 1K8MA 1ICFB 4DUZL 2NZOA 4V190 4A3FB 2F0EA 1NR4A 1A15A 1RTNA 1SSOA 2BDNA 1LABA 3U58A 4X64Q 4ZQ3A 4DV5Q 2NB0A 2ATWA 5JEAH 3FPUB 4LF9L 3QR8A 2OQ0A 3L0OA 4K5WA 2JXMB 2R7FA 3C1FA 1TS2A 1DXMA 2DN8A 5GADC 5GAEC 3DEOA 3K80C 2UU9L 2QGQA 4A3FG 2AQ2B 4IUQA 5E4XA 4AH6A 3IAYA 3W3AA 4H13C 4OO1H 1I94Q 1LTLA 3S1MB 1K73C 2HUGA 2ZTEA 4IALA 3NENA 4X66L 5C44H 4GLXA 1I4HA 3X3MA 1HZBA 1NY4A 5FLXL 3KK7A 2C5CA 5D14A 4ABNA 2KCMA 1KRSA 2F3VA 2QKIC 3CXCA 3T1HL 1OTCA 1EIGA 1NE3A 1QVCA 2E76C 1STYA 4NXML 4XQJA 1K0RA 4LF7Q 1TWCB 2KECA 3S1QH 1QG7A 1S72A 2MPMA 4JI3Q 2BA0A 2JYOA 5IYCG 3IFDA 2NVTH 1HCZA 4HJ8A 5FO9B 1T5XD 3ZYYX 2FXQA 4B3RQ 1H9JA 2RHQB 2F0HA 4YWMA 4AQYQ 3TMEA 1EUJA 1QILA 4YWLA 1XNQL 2MJ8A 4RAUC 1PVOA 2R61A 1TVXA 3U9OA 4B9WA 2HD3A 5EPLA 5IP9G 1RODA 1XMOL 4LWCA 3RLNA 1E24A 2XIWA 4OHJA 3HRZC 4EQ5A 4A3JH 4FXDA 3S1NB 3TDQA 3U50C 1L0WA 1VQEA 1EY0A 3NXWA 4O1NA 1I4PA 2JA8B 1HZCA 3K5OA 5JJIA 2PI2A 1UUPA 1HFNA 1U4LA 2E2DC 4LFAQ 1N34L 1ESRA 4LW1A 4ZCKA 5M5YH 1SNDA 4CJ0B 2PZWA 3I90A 1BVSA 1TY2A 4G7HC 1WTHA 2MO1A 1CQVA 2C35B 3WWVA 4EX5A 4A3GB 3I73A 4ZK9B 2AQ1B 1PRTF 2B29A 5M3FG 2JA8G 3R2IA 5E7NA 1QUQB 4HCSA 3PF4A 2J7ZA 1Q7YC 1TS3A 4FYDA 1B3QA 2A69C 3W5OA 4B3SL 4RA8A 1HRJA 1S40A 4Y7NB 4KV6A 1FYCA 2LMCB 4XQQA 4J8QA 5FLMG 2EOTA 1IBKQ 3TP7A 4GKKQ 1PYBA 4A3GG 3OW7A 3PUWA 5DM73 1F2YA 4A3DB 1SYEA 3HOZH 3S1RH 1TXYA 3CHBD 1B70B 1MJEA 2B63B 2M2LA 1DCZA 4HMJA 1WD0A 1GOZA 1MKHA 2HIXA 3VDYA 4FF3A 2SNSA 1A3VA 1EY7A 3W1BA 3KOJA 2QEXA 1EWCA 3EFXD 3TN2A 4OIKA 1BQQT 1TQOA 2LFNA 3D6CA 5FO7B 4A3DG 3K0YA 1HNWL 3SE0A 4KKSA 2B63G 4DUZQ 3Q24A 2I5LX 1UNSA 4GNXC 2VNUD 2HCCA 1EEID 2A5HA 4V0BA 3DM3A 1B53A 2G5DA 1UE1A 2PZUA 4ME3A 1YIJA 3JAMc 3RZDB 1LT3D 5CGKA 1QUQA 1SE8A 4LF9Q 3CRLC 2NVQH 2UXCQ 1N8RC 1KDAA 5CBEE 4KI0A 1PHJA 4BWGB 1C8CA 1LLRD 2L55A 1CT1D 1NMFA 2RHSB 4A3IH 1LTID 2K32A 2WFWA 4A3BB 2EJMA 3H94A 5M5XB 2UU9Q 1LT6D 1HUNA 2B39A 4WORA 5EBDA 3OMCA 4DK1A 3OW2A 4C2MH 3BZKA 1HUMA 2DJGC 1Q46A 1PYWD 3ONAB 1E1TA 4X66Q 2D0PA 4NDXA 3I55A 2F0IA 1U4RA 1B50A 4JBJA 1TWFB 1BR9A 1Q8KA 4A3BG 2K01A 2EYFA 1X3QA 1N33Q 1SE4A 3RR5A 3DHQA 5EBCA 2ZJQA 1SYBA 1H9RA 2Y0SE 1I4RA 3FRPB 1R9TB 2V4DA 2N88A 2QF7A 4DFAA 1VQ5A 1UEAB 1SRUA 1A8VA 4FF1A 1XNQQ 2O5JC 4OONA 4HSVA 1XJVA 1JOOA 1XMOQ 3HOYB 3BVMA 2Z4IA 1PMRA 1EQRA 4YCVA 2E74C 4IUTA 3PO3H 3STBD 1PH8A 1TS5A 4LF8L 4LF5Q 3KJOA 3GTMB 2LY7A 1HFGA 4KLKA 2HDLA 2CVRA 2NN6G 1N34Q 3VR5A 1E2VA 3CCUA 3CC7A 1H9SB 1MHWC 3J81i 2Q2TA 3HOYG 1KL9A 2NVYB 4BBRH 2L5TA 4XT1B 3GTKB 2A73B 5FKAC 1PH6A 1STHA 2X69A 1PRTD 1D8LA 3B6YA 3K57A 1HHVA 3H3VI 5CV8A 1VMCA 1YNJD 2N8NA 2WAQB 4F7XA 4B3SQ 1OXSC 5M5WH 4HJAA 2R93H 4IPGA 3PUXA 2KCTA 1YNXA 1JE4A 3UDIA 1EY9A 3U4ZA 5I6WA 3RNUA 2VUMB 4IUVA 3NPPA 5CV5A 2JQOA 3GTLB 1U4MA 4N8X1 4I65A 2N55A 1QJOA 2JA9A 2F4VL 4RFBA 2N78A 2WAQG 4UP7A 5JJZA 2CQOA 4YY3L 1EQQA 3OOCA 4L8JA 5IYDH 1PFNA 2IT1A 4DXGA 4XIGS 4JI2Q 1KABA 4YCWA 2IX3A 1K28A 2VUMG 1Y1VB 2CQAA 1NSNS 1I6VC 1H9SA 2NWGA 4CKCA 4KY7A 2F0OA 1HNWQ 1C7YA 1G2SA 1Y8PB 1T5EA 5M3MB 2HIVA 2XWBB 1IL2A 2F0UA 2NN6I 4BS9A 3GTGB 1I6HB 1KAAA 4NPSA 5IT9L 2H1EA 5EPJA 5BN4A 3FDTA 3MFYA 3GTPB 2JA6H 4DV1Q 1SE3A 4R4IA 1Z6HA 4KJOA 3H09A 2OF1A 5C4HA 4IO9A 3BU2A 2TSSA 1MSHA 4OL7A 1IW7D 3CPWA 5EKKA 3RLFA 1BOSA 2A6HC 3FEWX 2I46A 2MHVA 4UPAA 2RCFA 5DLQE 1GKHA 2MQHA 5TSSA 5A2QL 2LSSA 3P7JA 1J5EL 1F9QA 1MJCA 1MBYA 1NJIC 4C1NK 1IXRA 1WOCA 2FINB 3MXPA 1UE6A 2R7ZH 1X3GA 1ASZA 2DUDA 3QOLA 2LXKA 4DNTB 1XTDA 5LMUL 2PQEA 3C1EA 3P75A 4BY1B 1E2WA 1WD1A 5IY0A 4A3KB 1QZHA 3FKIH 4BA2I 3S16B 2BH8A 3PCOB 1GUOA 1H9KA 1GUSA 3ER0A 5C4XH 1C4QA 3E9HA 1U9RA 2NZHA 1EZ6A 1NAPA 3KF8B 1M90C 2L1BA 4QQBX 1QWYA 3ULPA 4BY1G 5CYUA 3GP7A 4DR5L 3UDFA 2ZJPA 4DUYQ 1CKOA 1EIYB 4A3KG 1N32L 1VQKA 2N49A 5J3BA 3K5NA 4LF8Q 4IPHA 4JYAL 1J6QA 1O7ZA 3WOEA 1PH5A 1M1KC 2EYJA 3TP5A 3S17H 4PZ7A 2VQEL 4Q0FA 4IURA 4QY7A 3H3VC 4KHPL 3BJUA 2MNAA 1STEA 2FJ2A 2MO0A 1EOTA 2WB1B 1DYQA 3K7AH 1K83B 2EY2A 3C3LA 3D31A 4DAMA 2XN9C 1FL0A 2K04A 2YU9H 3LGJA 2VW9A 4LMQD 5ELEA 1I50H 3OWFA 3K59A 3J7AV 3DMUA 1G291 2WB1G 4U68A 1IYJB 2F0NA 3M3YH 5G3LF 3KF8A 1GO3E 2BOSA 2F0WA 3R8BA 2Z6BA 1I94L 3CKIB 2PZTA 2YV5A 1WVLA 5C44B 2B8GA 1P16A 1I3QH 3P20A 2F3WA 4QL5A 4DK3C 1VQMA 1K8AC 4YY3Q 1HQRD 3Q0AA 1KC8C 2CW0C 1XPUA 3J80E 2PQAA 2IPKD 1SMXA 1M8AA 1E0BA 5C5MA 3W2DA 1WCMH 4OO1G 4FO2A 5FLXc 3PF5A 3CCJA 1UE7A 3D4WA 1SAPA 4CJ2C 3OTOL 2QILA 4DV0L 1CK1A 2F0PA 3EIVA 4BXXG 4JI4Q 2SEBD 3NELA 5FOBB 3M4OH 2GVAA 3S2DH 3Q8DA 4DV7Q 2PO4A 1VQNA 3I4NB 1EYDA 1PH3A 4A3JB 4KY6A 3TP6A 1A0IA 1RHPA 3MAQA 1JB7A 2OTJA 2FHTA 4AYBE 3BS1A 1DZ1A 3T53B 4JBMA 2K50A 3CF5A 1TY0A 2E2IB 5EQ0A 5T1GA 4F87A 2ZM6L 1EEFD 1EU4A 3M9BA 1PZKD 1J5EQ 4DN4M 4A3CG 4ZLTF 2EZVA 4XQNA 3BYYB 3I4NG 2K5VA 4A3JG 3ULLA 3SDZA 2UUCQ 1PZID 3SXHA 4NB3A 5LMUQ 3M4QA 2PI2E 3TS0A 3NTIA 3A5ZB 2X6GA 4KTAA 1PTOH 1VQJA 1PH4A 1QCBD 2NZ1D 1MSGA 2UXBL 1HTPA 3QOJA 4M8AA 4GS3A 4L63B 4K14A 2XNAC 3T4AC 2EPBA 1SMYD 4OO1I 3MEHA 1EY6A 4LUZA 5FO8B 3HOZB 4UDUC 4R4CA 1X55A 1AN8A 3Q6SA 4JI8L 4JI6L 2AHOB 1N32Q 1RL2A 1TU2B 3JAMi 3A74A 3ICEA 4JBWA 3K7UC 3CU7A 1CHQD 3D3RA 2E2HH 5T1IA 4IPDA 2IX1A 1FNUA 4PZ8A 1FJGQ 2VQEQ 3M85A 3AFPA 3OSOA 1AP0A 1X56A 1VQ6A 4K8JA 2AMCB 4LF4Q 1HPCA 1EU3A 1Q90A 3STBC 3RMHA 2DY7A 2MGSA 1IBMQ 1YITA 2EYLA 4LAAA 1DONA 2IHFA 2R6GA 5CV9A 3GTOB 2K5WA 1T9HA 3PO2B 4EQOA 1YEZA 2D0OA 1EWIA 1VQIA 5KEEA 1BF4A 2DNCA 2Q2HA 2UXCL 3QIAA 4RGNA 5IGGA 3S2HH 2NVQB 4EVOA 5F2DA 1L0YB 3U4VA 5BN5A 2CCZA 4IPCA 3GQBA 4A3IB 1TWAH 1TWGH 2I0QA 1ESFA 3Q23A 2M9VA 4FVMA 5JJKA 1PRTC 3TS2A 1VS0A 4TRDA 4R8NA 2GA4B 4CJ1B 5G3LD 3PO2G 1KDBA 2UUBQ 4C2MB 4N9TA 1OXTA 1O80A 4RCNA 1JB3A 3TRZA 2QA4A 3E0EA 3RN5A 2XVSA 2A68D 1B4OA 2NUCA 1MGSA 4R1JA 5EAYA 1I4QA 3NEMA 4CKEA 3SR1A 3TZDA 5C0XH 1N33L 4A3IG 5H1SE 1YHAA 4B3ML 3A8IE 4XYOA 1Y8NB 1S5BD 1QVGA 4L5RC 3SHLA 4FF4A 5GAHC 4A3LH 1GUTA 3I91A 2L15A 2CKZB 4KD4A 3GD7A 4CGYB
chains in the Genus database with same CATH topology
3FHWA 3OTOQ 1VQOA 4LUOA 4QIWE 1Q8KA 4DV0Q 1HJPA 1Q86C 4A3BG 1N33Q 1I6HH 4RMFA 3HOWG 1QVFA 3RR5A 3KYHC 4C3IH 1UWVA 2ZJQA 3S15H 4DK6C 2Y0SE 2E2JH 1LM0A 1Q1EA 1HNZL 4DR3L 4BA1I 3CCSA 2YTYA 5IYBH 4POGA 4IJHA 1VQ5A 1MIUA 4HIOA 1CKNA 1V1QA 4X65L 1EFWA 1JT8A 1TWFH 3CP0A 1SRUA 5IYBG 5LMNL 4LF5L 1A8VA 1XMQL 4TQUS 2Z0SA 4GN5A 1XNQQ 4YWKA 4OONA 3KJPA 1R9TH 1XJVA 1CKMA 3HOUH 3I4MH 2ZM6Q 1XMOQ 4DR3Q 1OXXK 1KIXA 1YI2A 4GKJQ 1N36L 4DR2L 1EQRA 1YBYA 4YCVA 3I4MG 3HOXH 2A8VA 2IY5B 1VQDA 4J15A 4X65Q 3TREA 5LMNQ 1K9MC 3PO3H 3STBD 1OXVA 1PH8A 4LF8L 4LF5Q 1SN8A 3KJOA 1HZ9A 1W3SA 1XNRQ 4KLKA 3PO3G 3GTJH 2B3GA 4APVA 2NN6G 1L1OB 1N34Q 5C0XJ 1E3PA 2KHIA 2KHJA 2UXDL 1E7ZA 3HOYH 1JJ2A 3CCUA 3CC7A 2E8GA 3CW2C 3J81i 4DV6L 4DR4L 4DR2Q 2Q2TA 3HOYG 3PV0A 1KL9A 3S16H 4DR6L 2UXBQ 3L2PA 4BBRH 4HIKA 2VL6A 3EBEA 3F8TA 5C0XI 3H15A 4A3MH 3GTMH 1PH6A 1IBLQ 4UY8C 1D8LA 3B6YA 4GN4B 3H3VI 1AE3A 4L5SA 5K36G 2EQSA 1LUZA 4DNIA 5IP7H 5BR8L 1O7IA 2HHHL 1SLJA 2PQAB 3J7ZC 1PH7A 2EIFA 1BBWA 2N8NA 3CC2A 3CMAA 2R7ZH 3FP9A 3HOZG 4NXNL 4B3SQ 2HT1A 1OXSC 4JI8Q 5M5WH 4C3HH 4JI6Q 3UE0A 4DR6Q 4HJAA 2R93H 4IPGA 3PUXA 2KCTA 4DAYB 4A3EH 2DGYA 1YNXA 3MEFA 4PZ6A 3UDIA 3U4ZA 3RNUA 1VQFA 4AIMA 1KD1C 4JI2L 3RZOH 4BBSG 2R93G 3I4OA 4JI0L 4A3EG 1WFQA 4X64L 4LNQA 4JI7L 1PYSB 4DV5L 2Q2UA 1JJCB 3PUZA 2JQOA 1EIFA 2JA7H 4R4OA 1EYGA 1UEBA 5BR8Q 3T1YQ 1B8AA 2JA9A 2F4VL 2JA7G 4NXNQ 1KHIA 3G6EA 2N78A 2WAQG 4LFCL 1VQGA 1DGSA 1P8LA 4UP7A 1KRTA 4JI1L 3JC66 3J81c 2E5LQ 2RCNA 1N9WA 1YZ6A 5LMNW 2CQOA 4LUVA 1Q81C 4YY3L 2VUMH 1EQQA 1PH2A 1K83H 5IYDH 2IT1A 4XIGS 4JI2Q 4POFA 4YCWA 3UE1A 1B7YB 2VUMG 3GTLH 4ALPA 1JE5A 3HFZB 3GO5A 4A4IA 5IYDG 4YHHL 1PH9A 1HNXL 5FJ8H 4DV1L 1HNWQ 1C7YA 5FJ8G 2F4VQ 1H95A 3H0GH 1KQSA 4LFCQ 1Q12A 2AKWB 4JI1Q 2Z6KA 2HIVA 2PMZE 3IRBA 4DV3Q 1IL2A 2NN6I 1E22A 1KXLA 2MFIA 4AYBG 2F52A 5IT9c 3I56A 2OCEA 4NPSA 2AWNA 3TQYA 5IWAL 3CMEA 1PFSA 2KBNA 4LF7L 1Y1VH 4JV5Q 4R4TA 2CWPA 3AYHB 2RF4A 2JA6H 4DV1Q 4JI3L 4DKAC 4R4IA 2ES2A 3AQQA 3PSIA 4O0AA 2JA6G 5M3MH 4B3RL 2JJQA 4A3LG 4IO9A 3BU2A 4A75A 2ALYB 4H02A 4BXXH 1QZGA 1Y14B 2IX0A 3HKZG 3A0JA 3RLFA 3CPWA 4AQYL 4BY7H 1YJNA 3OYYA 3GDEA 1HH2P 4UPAA 4B3MQ 5DLQE 1WYDA 4BY7G 3GTPH 4OX9L 3S1MH 1GKHA 2MQHA 2YYZA 3TEHB 4DV2Q 4DR7Q 1YJWA 3AFQA 2YTXA 2LSSA 4GOPC 1J5EL 1MJCA 1G6PA 1NJIC 1IXRA 1X9NA 1WOCA 4PMWA 3CCRA 1UE6A 1U0LA 1X3GA 2EXDA 2DUDA 2OQKA 4GNXB 2Z6KC 1ASZA 4B3TL 2LXKA 3I2ZA 3M7NA 4A93H 5ELNA 4P74A 1ASYA 1SR3A 4IFDG 1V9PA 1XTDA 3D0FA 4A93G 1UE5A 1D7QA 5LMUL 5IP9H 4UP8A 3G71A 4LFAL 1V43A 1TWHH 4A3CH 1HNZQ 4RG1A 4JOIC 1BKBA 1AH9A 4Y52H 2A1AA 3J80i 3KF6B 3HOUG 5IY0A 3KLWA 4DUYL 1QZHA 3I4NH 2R92H 3FKIH 4UP9A 4P71A 4BA2I 4L5TA 1VQBA 2BH8A 1NBWA 3PCOB 3HOXG 1KAWA 2A19A 3FKIG 3ER0A 4K0KL 2VQFL 1XMQQ 5C4XH 4HIDA 3E9HA 4P75A 2OTLA 2I5HA 2NZHA 4BY1H 3J81j 2E2IH 3BZCA 4DR1L 3KF8B 5C4XG 1JMCA 1M90C 4GLVB 4IJLA 4QQBX 4L5QA 1FGUA 3I7FA 4BY1G 3ULPA 1N36Q 4A3KH 4DR5L 3UDFA 3F2DA 2ZJPA 2H5XA 4DUYQ 3S1NH 1X65A 3CC4A 4HJ5A 1CKOA 1EIYB 1BBUA 4A3KG 1OXUA 3AEVA 1VQKA 2N49A 1Z9FA 5J3BA 1N32L 4LF8Q 1IBKL 4IPHA 2CWAA 4BBRG 5M3FH 2JA8H 2UUAL 4JYAL 4GKKL 1J6QA 4K0KQ 1WJJA 1X6OA 1PH5A 4A3MG 1M1KC 4IOAA 5AJ3L 3S17H 1C9OA 4PZ7A 2VQEL 2UXDQ 3RLOA 1Z47A 4QY7A 2JK8A 3ULJA 4KHPL 2K14A 4DV6Q 1LYLA 3PGZA 5IP7G 4DR4Q 4DR5Q 3BJUA 2MNAA 4GNXA 3J80c 2MO0A 3PIOA 3CCMA 3L7ZC 1PA6A 3K7AH 3SGIA 5C4JH 4HIMA 1AE2A 1K8GA 4JYAQ 5JJLA 1I5FA 4QJFA 4OWXB 3D31A 3G4SA 3UDXA 4DAMA 4IFDJ 3CAMA 4LFBL 1FL0A 3KFUA 2HHHQ 1C0AA 2YU9H 2YTVA 3LGJA 1K3RA 1X3EA 3KF6A 2VW9A 4KHPQ 4DPGA 2K4KA 1VCIA 1I50H 1VQHA 3F2BA 4IFDI 4DUZL 2NZOA 3K0XA 1G291 3K8AA 3W1GA 2V1CC 2WB1G 3U58A 4JI0Q 2IHEA 4X64Q 1L1OA 1VQ8A 1IYJB 5HGQA 4DV5Q 4JI7Q 1YHQA 2ATWA 3S14H 2JEAI 4A3DH 1HR0L 4LF9L 3M3YH 4X62L 1GO3E 2OQ0A 2JEBI 3HKSA 4IOCA 1I94L 4PG3A 3L0OA 2ID0A 3S24A 4QGUA 2KENA 4JG2A 5GAGC 2R7FA 2YV5A 3M4PA 5GADC 5GAEC 3K80C 1P16A 1I3QH 1HZAA 4JI5L 4A3FH 4LF6L 4QL5A 4DK3C 1VQMA 1K8AC 2GN5A 2QGQA 4YY3Q 2UU9L 2BA1A 3H0GG 3CCQA 3RN2A 3PIPA 4A3FG 3GTOH 2N3SA 1KC8C 1JJGA 3PO2H 3CCEA 1GD7A 1XPUA 4JI4L 4AH6A 4YHHQ 1HNXQ 2PQAA 1LTLA 1I94Q 1K73C 2ZTEA 1SMXA 1YHBA 4DV7L 1Y1VG 2Q2IA 1WCMH 1EOVA 3NENA 1VQ7A 4OO1G 4X66L 5C44H 4GLXA 2WAQE 1VQ9A 5FLXc 4DV4L 3PF5A 1PV4A 3CCJA 1CUKA 1HZBA 1NY4A 1WCMG 4O2DA 1UE7A 4P72A 1GM5A 4LF6Q 3NBHB 1CSQA 5M3MG 3OTOL 3A5UA 2KCMA 1KRSA 3CXCA 4DV0L 4HJ9A 3T1HL 1OTCA 1QVCA 1NE3A 2WB1E 3EIVA 4MNOA 5IWAQ 3DLLA 3RZDH 2BH2A 4BXXG 3F2CA 4NXML 4X6AH 1K0RA 4LF7Q 3CD6A 5IYCH 2VY3A 1L1OC 4JI4Q 3S1QH 3NELA 1S72A 2I5MX 3M4OH 2GVAA 3S2DH 3Q8DA 4JI3Q 2BA0A 5IYCG 4DV7Q 4HJ7A 2NVTH 5GROA 4HJ8A 2D62A 1VQNA 1A63A 4DV4Q 2FXQA 4B3RQ 2RHQB 1PH3A 2F3IA 3G48A 5M5XH 3HOVH 1A0IA 4JCVE 1JB7A 4YWMA 1X54A 2OTJA 4AQYQ 1CSPA 4AYBE 1EUJA 4WJ3M 3T1HQ 2R7ZG 4YWLA 1FVIA 2UUCL 3HOVG 2JE6I 1IZ6A 1X3FA 1TWCH 5ELOA 2R7DA 4NXMQ 4JBMA 1XNQL 2K50A 3CF5A 4OX9Q 3E9IA 1PVOA 3EN2A 2ZM6L 1YVCA 5IP9G 1XMOL 3M9BA 4LWCA 1J5EQ 4GKJL 3RLNA 4A3CG 5JEAJ 1E24A 4EQ5A 2JA5H 4A3JH 3ZJYC 4OXPA 3U50C 1L0WA 4MZ9A 1VQEA 3I4NG 4B3TQ 3HKZE 2K5VA 4A3JG 1SROA 2JA5G 2R92G 4KHZA 3ULLA 1HZCA 1XNRL 5JJIA 2PI2A 5HY6A 2UUCQ 1WI5A 2PNHA 2LXJA 4NB3A 1HR0W 5LMUQ 4LFAQ 1N34L 3M4QA 2PI2E 3TS0A 1PH1A 4LW1A 3A5ZB 4TVAB 5M5YH 1VQJA 2ZJRA 1PH4A 1Y1WH 2UXBL 1BVSA 4XTCS 1NTGA 3K81C 2MO1A 2XTIA 3CQZH 1VQPA 2C35B 3WWVA 4GS3A 1Y1WG 4EX5A 2VQFQ 1E1OA 1IBLL 2B29A 1FJGL 5M3FG 2JA8G 4OO1I 3PUVA 1VQAA 1QUQB 5E7NA 1VQLA 3PF4A 4LUZA 4DR1Q 1Q7YC 4GN3B 2OWOA 5GQOA 4R4CA 1X55A 5FLMH 4GOPB 1Q82C 4LF4L 3W5OA 4B3SL 4JI8L 1S40A 4JI6L 2AHOB 5FLMG 1IBML 1N32Q 1RL2A 3JAMi 2ASBA 4A3GH 3A74A 1IBKQ 3ICEA 1S3OA 3ERSX 4JBWA 2UUAQ 3K7UC 4GKKQ 3KDFB 1PYBA 2E2HH 2CFMA 4A3GG 3PUWA 2AWOA 4IPDA 4P73A 4PZ8A 5AJ3Q 1FJGQ 1Q1BA 2IX1A 2ZTDA 3HOZH 2VQEQ 3M85A 3AFPA 3S1RH 2NVXH 1TXYA 2HQLA 2K5NA 4OWWB 3T1YL 1X56A 1B70B 1GVPA 1MJEA 1VQ6A 5IE8A 1VQCA 4Y7NH 2AMCB 2K52A 4LF4Q 4A76A 4OWTB 3STBC 2NVYH 2E5LL 2XGTA 3MXNB 4BBSH 2HIXA 1MKHA 3GTKH 1IBMQ 3VDYA 3GTQH 1YITA 1A62A 2IHFA 2R6GA 4YCUA 3W1BA 3KOJA 2QEXA 1T9HA 4JC0A 1YEZA 2D0OA 1EWIA 1VQIA 3CCLA 4LFBQ 2Q2HA 2UUBL 2UXCL 3S2HH 3F1ZA 4MTNA 3UDGA 2K75A 5JEAG 2B63H 4A3DG 1HNWL 4GLAC 3U4VA 1XPRA 1VQ4A 2CCZA 1YJ9A 2B63G 4IPCA 4DUZQ 1CKNB 2I5LX 4GNXC 2VNUD 1TWAH 1TWGH 1L2FA 4DV3L 2K5HA 2I0QA 3J7A5 5JJKA 3DM3A 3PUYA 3TS2A 1RIPA 1UE1A 4ME3A 1VS0A 1YIJA 3JAMc 1SFOH 1QUQA 1SE8A 1HR0Q 4LF9Q 2Y0SG 4X62Q 3PO2G 4JV5L 2NVQH 2UUBQ 2UXCQ 3CPFA 1N8RC 4KI0A 1OXTA 1PHJA 3TRZA 4GOPA 2QA4A 3E0EA 4R4QA 1NMFA 3RN5A 4WJ4A 3CCVA 2RHSB 4A3IH 4JI5Q 2WFWA 5C44G 2ZTCA 5EAYA 2UU9Q 4R1JA 1G51A 3NEMA 2GVBA 1XPOA 4A3IG 2VS1A 3KDFA 1NMGA 5H1SE 1W2BA 1U5KA 1N33L 1YHAA 4FDBA 5C0XG 4B3ML 4JBKA 3OW2A 4C2MH 3BZKA 1QVGA 3H3VH 4JOIA 4C3JH 4DV2L 4DR7L 4L5RC 1Q46A 1E1TA 5GAHC 5C3EH 4X66Q 4A3LH 2L15A 2CKZB 2D0PA 2VZAA 4A3BH 3I55A 3GD7A 3HOWH 5C3EG 2WP8J 4JBJA 3GTGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHW A;  3OTO Q;  1VQO A;  4LUO A;  4QIW E;  1Q8K A;  4DV0 Q;  1HJP A;  1Q86 C;  4A3B G;  1N33 Q;  1I6H H;  4RMF A;  3HOW G;  1QVF A;  3RR5 A;  3KYH C;  4C3I H;  1UWV A;  2ZJQ A;  3S15 H;  4DK6 C;  2Y0S E;  2E2J H;  1LM0 A;  1Q1E A;  1HNZ L;  4DR3 L;  4BA1 I;  3CCS A;  2YTY A;  5IYB H;  4POG A;  4IJH A;  1VQ5 A;  1MIU A;  4HIO A;  1CKN A;  1V1Q A;  4X65 L;  1EFW A;  1JT8 A;  1TWF H;  3CP0 A;  1SRU A;  5IYB G;  5LMN L;  4LF5 L;  1A8V A;  1XMQ L;  4TQU S;  2Z0S A;  4GN5 A;  1XNQ Q;  4YWK A;  4OON A;  3KJP A;  1R9T H;  1XJV A;  1CKM A;  3HOU H;  3I4M H;  2ZM6 Q;  1XMO Q;  4DR3 Q;  1OXX K;  1KIX A;  1YI2 A;  4GKJ Q;  1N36 L;  4DR2 L;  1EQR A;  1YBY A;  4YCV A;  3I4M G;  3HOX H;  2A8V A;  2IY5 B;  1VQD A;  4J15 A;  4X65 Q;  3TRE A;  5LMN Q;  1K9M C;  3PO3 H;  3STB D;  1OXV A;  1PH8 A;  4LF8 L;  4LF5 Q;  1SN8 A;  3KJO A;  1HZ9 A;  1W3S A;  1XNR Q;  4KLK A;  3PO3 G;  3GTJ H;  2B3G A;  4APV A;  2NN6 G;  1L1O B;  1N34 Q;  5C0X J;  1E3P A;  2KHI A;  2KHJ A;  2UXD L;  1E7Z A;  3HOY H;  1JJ2 A;  3CCU A;  3CC7 A;  2E8G A;  3CW2 C;  3J81 i;  4DV6 L;  4DR4 L;  4DR2 Q;  2Q2T A;  3HOY G;  3PV0 A;  1KL9 A;  3S16 H;  4DR6 L;  2UXB Q;  3L2P A;  4BBR H;  4HIK A;  2VL6 A;  3EBE A;  3F8T A;  5C0X I;  3H15 A;  4A3M H;  3GTM H;  1PH6 A;  1IBL Q;  4UY8 C;  1D8L A;  3B6Y A;  4GN4 B;  3H3V I;  1AE3 A;  4L5S A;  5K36 G;  2EQS A;  1LUZ A;  4DNI A;  5IP7 H;  5BR8 L;  1O7I A;  2HHH L;  1SLJ A;  2PQA B;  3J7Z C;  1PH7 A;  2EIF A;  1BBW A;  2N8N A;  3CC2 A;  3CMA A;  2R7Z H;  3FP9 A;  3HOZ G;  4NXN L;  4B3S Q;  2HT1 A;  1OXS C;  4JI8 Q;  5M5W H;  4C3H H;  4JI6 Q;  3UE0 A;  4DR6 Q;  4HJA A;  2R93 H;  4IPG A;  3PUX A;  2KCT A;  4DAY B;  4A3E H;  2DGY A;  1YNX A;  3MEF A;  4PZ6 A;  3UDI A;  3U4Z A;  3RNU A;  1VQF A;  4AIM A;  1KD1 C;  4JI2 L;  3RZO H;  4BBS G;  2R93 G;  3I4O A;  4JI0 L;  4A3E G;  1WFQ A;  4X64 L;  4LNQ A;  4JI7 L;  1PYS B;  4DV5 L;  2Q2U A;  1JJC B;  3PUZ A;  2JQO A;  1EIF A;  2JA7 H;  4R4O A;  1EYG A;  1UEB A;  5BR8 Q;  3T1Y Q;  1B8A A;  2JA9 A;  2F4V L;  2JA7 G;  4NXN Q;  1KHI A;  3G6E A;  2N78 A;  2WAQ G;  4LFC L;  1VQG A;  1DGS A;  1P8L A;  4UP7 A;  1KRT A;  4JI1 L;  3JC6 6;  3J81 c;  2E5L Q;  2RCN A;  1N9W A;  1YZ6 A;  5LMN W;  2CQO A;  4LUV A;  1Q81 C;  4YY3 L;  2VUM H;  1EQQ A;  1PH2 A;  1K83 H;  5IYD H;  2IT1 A;  4XIG S;  4JI2 Q;  4POF A;  4YCW A;  3UE1 A;  1B7Y B;  2VUM G;  3GTL H;  4ALP A;  1JE5 A;  3HFZ B;  3GO5 A;  4A4I A;  5IYD G;  4YHH L;  1PH9 A;  1HNX L;  5FJ8 H;  4DV1 L;  1HNW Q;  1C7Y A;  5FJ8 G;  2F4V Q;  1H95 A;  3H0G H;  1KQS A;  4LFC Q;  1Q12 A;  2AKW B;  4JI1 Q;  2Z6K A;  2HIV A;  2PMZ E;  3IRB A;  4DV3 Q;  1IL2 A;  2NN6 I;  1E22 A;  1KXL A;  2MFI A;  4AYB G;  2F52 A;  5IT9 c;  3I56 A;  2OCE A;  4NPS A;  2AWN A;  3TQY A;  5IWA L;  3CME A;  1PFS A;  2KBN A;  4LF7 L;  1Y1V H;  4JV5 Q;  4R4T A;  2CWP A;  3AYH B;  2RF4 A;  2JA6 H;  4DV1 Q;  4JI3 L;  4DKA C;  4R4I A;  2ES2 A;  3AQQ A;  3PSI A;  4O0A A;  2JA6 G;  5M3M H;  4B3R L;  2JJQ A;  4A3L G;  4IO9 A;  3BU2 A;  4A75 A;  2ALY B;  4H02 A;  4BXX H;  1QZG A;  1Y14 B;  2IX0 A;  3HKZ G;  3A0J A;  3RLF A;  3CPW A;  4AQY L;  4BY7 H;  1YJN A;  3OYY A;  3GDE A;  1HH2 P;  4UPA A;  4B3M Q;  5DLQ E;  1WYD A;  4BY7 G;  3GTP H;  4OX9 L;  3S1M H;  1GKH A;  2MQH A;  2YYZ A;  3TEH B;  4DV2 Q;  4DR7 Q;  1YJW A;  3AFQ A;  2YTX A;  2LSS A;  4GOP C;  1J5E L;  1MJC A;  1G6P A;  1NJI C;  1IXR A;  1X9N A;  1WOC A;  4PMW A;  3CCR A;  1UE6 A;  1U0L A;  1X3G A;  2EXD A;  2DUD A;  2OQK A;  4GNX B;  2Z6K C;  1ASZ A;  4B3T L;  2LXK A;  3I2Z A;  3M7N A;  4A93 H;  5ELN A;  4P74 A;  1ASY A;  1SR3 A;  4IFD G;  1V9P A;  1XTD A;  3D0F A;  4A93 G;  1UE5 A;  1D7Q A;  5LMU L;  5IP9 H;  4UP8 A;  3G71 A;  4LFA L;  1V43 A;  1TWH H;  4A3C H;  1HNZ Q;  4RG1 A;  4JOI C;  1BKB A;  1AH9 A;  4Y52 H;  2A1A A;  3J80 i;  3KF6 B;  3HOU G;  5IY0 A;  3KLW A;  4DUY L;  1QZH A;  3I4N H;  2R92 H;  3FKI H;  4UP9 A;  4P71 A;  4BA2 I;  4L5T A;  1VQB A;  2BH8 A;  1NBW A;  3PCO B;  3HOX G;  1KAW A;  2A19 A;  3FKI G;  3ER0 A;  4K0K L;  2VQF L;  1XMQ Q;  5C4X H;  4HID A;  3E9H A;  4P75 A;  2OTL A;  2I5H A;  2NZH A;  4BY1 H;  3J81 j;  2E2I H;  3BZC A;  4DR1 L;  3KF8 B;  5C4X G;  1JMC A;  1M90 C;  4GLV B;  4IJL A;  4QQB X;  4L5Q A;  1FGU A;  3I7F A;  4BY1 G;  3ULP A;  1N36 Q;  4A3K H;  4DR5 L;  3UDF A;  3F2D A;  2ZJP A;  2H5X A;  4DUY Q;  3S1N H;  1X65 A;  3CC4 A;  4HJ5 A;  1CKO A;  1EIY B;  1BBU A;  4A3K G;  1OXU A;  3AEV A;  1VQK A;  2N49 A;  1Z9F A;  5J3B A;  1N32 L;  4LF8 Q;  1IBK L;  4IPH A;  2CWA A;  4BBR G;  5M3F H;  2JA8 H;  2UUA L;  4JYA L;  4GKK L;  1J6Q A;  4K0K Q;  1WJJ A;  1X6O A;  1PH5 A;  4A3M G;  1M1K C;  4IOA A;  5AJ3 L;  3S17 H;  1C9O A;  4PZ7 A;  2VQE L;  2UXD Q;  3RLO A;  1Z47 A;  4QY7 A;  2JK8 A;  3ULJ A;  4KHP L;  2K14 A;  4DV6 Q;  1LYL A;  3PGZ A;  5IP7 G;  4DR4 Q;  4DR5 Q;  3BJU A;  2MNA A;  4GNX A;  3J80 c;  2MO0 A;  3PIO A;  3CCM A;  3L7Z C;  1PA6 A;  3K7A H;  3SGI A;  5C4J H;  4HIM A;  1AE2 A;  1K8G A;  4JYA Q;  5JJL A;  1I5F A;  4QJF A;  4OWX B;  3D31 A;  3G4S A;  3UDX A;  4DAM A;  4IFD J;  3CAM A;  4LFB L;  1FL0 A;  3KFU A;  2HHH Q;  1C0A A;  2YU9 H;  2YTV A;  3LGJ A;  1K3R A;  1X3E A;  3KF6 A;  2VW9 A;  4KHP Q;  4DPG A;  2K4K A;  1VCI A;  1I50 H;  1VQH A;  3F2B A;  4IFD I;  4DUZ L;  2NZO A;  3K0X A;  1G29 1;  3K8A A;  3W1G A;  2V1C C;  2WB1 G;  3U58 A;  4JI0 Q;  2IHE A;  4X64 Q;  1L1O A;  1VQ8 A;  1IYJ B;  5HGQ A;  4DV5 Q;  4JI7 Q;  1YHQ A;  2ATW A;  3S14 H;  2JEA I;  4A3D H;  1HR0 L;  4LF9 L;  3M3Y H;  4X62 L;  1GO3 E;  2OQ0 A;  2JEB I;  3HKS A;  4IOC A;  1I94 L;  4PG3 A;  3L0O A;  2ID0 A;  3S24 A;  4QGU A;  2KEN A;  4JG2 A;  5GAG C;  2R7F A;  2YV5 A;  3M4P A;  5GAD C;  5GAE C;  3K80 C;  1P16 A;  1I3Q H;  1HZA A;  4JI5 L;  4A3F H;  4LF6 L;  4QL5 A;  4DK3 C;  1VQM A;  1K8A C;  2GN5 A;  2QGQ A;  4YY3 Q;  2UU9 L;  2BA1 A;  3H0G G;  3CCQ A;  3RN2 A;  3PIP A;  4A3F G;  3GTO H;  2N3S A;  1KC8 C;  1JJG A;  3PO2 H;  3CCE A;  1GD7 A;  1XPU A;  4JI4 L;  4AH6 A;  4YHH Q;  1HNX Q;  2PQA A;  1LTL A;  1I94 Q;  1K73 C;  2ZTE A;  1SMX A;  1YHB A;  4DV7 L;  1Y1V G;  2Q2I A;  1WCM H;  1EOV A;  3NEN A;  1VQ7 A;  4OO1 G;  4X66 L;  5C44 H;  4GLX A;  2WAQ E;  1VQ9 A;  5FLX c;  4DV4 L;  3PF5 A;  1PV4 A;  3CCJ A;  1CUK A;  1HZB A;  1NY4 A;  1WCM G;  4O2D A;  1UE7 A;  4P72 A;  1GM5 A;  4LF6 Q;  3NBH B;  1CSQ A;  5M3M G;  3OTO L;  3A5U A;  2KCM A;  1KRS A;  3CXC A;  4DV0 L;  4HJ9 A;  3T1H L;  1OTC A;  1QVC A;  1NE3 A;  2WB1 E;  3EIV A;  4MNO A;  5IWA Q;  3DLL A;  3RZD H;  2BH2 A;  4BXX G;  3F2C A;  4NXM L;  4X6A H;  1K0R A;  4LF7 Q;  3CD6 A;  5IYC H;  2VY3 A;  1L1O C;  4JI4 Q;  3S1Q H;  3NEL A;  1S72 A;  2I5M X;  3M4O H;  2GVA A;  3S2D H;  3Q8D A;  4JI3 Q;  2BA0 A;  5IYC G;  4DV7 Q;  4HJ7 A;  2NVT H;  5GRO A;  4HJ8 A;  2D62 A;  1VQN A;  1A63 A;  4DV4 Q;  2FXQ A;  4B3R Q;  2RHQ B;  1PH3 A;  2F3I A;  3G48 A;  5M5X H;  3HOV H;  1A0I A;  4JCV E;  1JB7 A;  4YWM A;  1X54 A;  2OTJ A;  4AQY Q;  1CSP A;  4AYB E;  1EUJ A;  4WJ3 M;  3T1H Q;  2R7Z G;  4YWL A;  1FVI A;  2UUC L;  3HOV G;  2JE6 I;  1IZ6 A;  1X3F A;  1TWC H;  5ELO A;  2R7D A;  4NXM Q;  4JBM A;  1XNQ L;  2K50 A;  3CF5 A;  4OX9 Q;  3E9I A;  1PVO A;  3EN2 A;  2ZM6 L;  1YVC A;  5IP9 G;  1XMO L;  3M9B A;  4LWC A;  1J5E Q;  4GKJ L;  3RLN A;  4A3C G;  5JEA J;  1E24 A;  4EQ5 A;  2JA5 H;  4A3J H;  3ZJY C;  4OXP A;  3U50 C;  1L0W A;  4MZ9 A;  1VQE A;  3I4N G;  4B3T Q;  3HKZ E;  2K5V A;  4A3J G;  1SRO A;  2JA5 G;  2R92 G;  4KHZ A;  3ULL A;  1HZC A;  1XNR L;  5JJI A;  2PI2 A;  5HY6 A;  2UUC Q;  1WI5 A;  2PNH A;  2LXJ A;  4NB3 A;  1HR0 W;  5LMU Q;  4LFA Q;  1N34 L;  3M4Q A;  2PI2 E;  3TS0 A;  1PH1 A;  4LW1 A;  3A5Z B;  4TVA B;  5M5Y H;  1VQJ A;  2ZJR A;  1PH4 A;  1Y1W H;  2UXB L;  1BVS A;  4XTC S;  1NTG A;  3K81 C;  2MO1 A;  2XTI A;  3CQZ H;  1VQP A;  2C35 B;  3WWV A;  4GS3 A;  1Y1W G;  4EX5 A;  2VQF Q;  1E1O A;  1IBL L;  2B29 A;  1FJG L;  5M3F G;  2JA8 G;  4OO1 I;  3PUV A;  1VQA A;  1QUQ B;  5E7N A;  1VQL A;  3PF4 A;  4LUZ A;  4DR1 Q;  1Q7Y C;  4GN3 B;  2OWO A;  5GQO A;  4R4C A;  1X55 A;  5FLM H;  4GOP B;  1Q82 C;  4LF4 L;  3W5O A;  4B3S L;  4JI8 L;  1S40 A;  4JI6 L;  2AHO B;  5FLM G;  1IBM L;  1N32 Q;  1RL2 A;  3JAM i;  2ASB A;  4A3G H;  3A74 A;  1IBK Q;  3ICE A;  1S3O A;  3ERS X;  4JBW A;  2UUA Q;  3K7U C;  4GKK Q;  3KDF B;  1PYB A;  2E2H H;  2CFM A;  4A3G G;  3PUW A;  2AWO A;  4IPD A;  4P73 A;  4PZ8 A;  5AJ3 Q;  1FJG Q;  1Q1B A;  2IX1 A;  2ZTD A;  3HOZ H;  2VQE Q;  3M85 A;  3AFP A;  3S1R H;  2NVX H;  1TXY A;  2HQL A;  2K5N A;  4OWW B;  3T1Y L;  1X56 A;  1B70 B;  1GVP A;  1MJE A;  1VQ6 A;  5IE8 A;  1VQC A;  4Y7N H;  2AMC B;  2K52 A;  4LF4 Q;  4A76 A;  4OWT B;  3STB C;  2NVY H;  2E5L L;  2XGT A;  3MXN B;  4BBS H;  2HIX A;  1MKH A;  3GTK H;  1IBM Q;  3VDY A;  3GTQ H;  1YIT A;  1A62 A;  2IHF A;  2R6G A;  4YCU A;  3W1B A;  3KOJ A;  2QEX A;  1T9H A;  4JC0 A;  1YEZ A;  2D0O A;  1EWI A;  1VQI A;  3CCL A;  4LFB Q;  2Q2H A;  2UUB L;  2UXC L;  3S2H H;  3F1Z A;  4MTN A;  3UDG A;  2K75 A;  5JEA G;  2B63 H;  4A3D G;  1HNW L;  4GLA C;  3U4V A;  1XPR A;  1VQ4 A;  2CCZ A;  1YJ9 A;  2B63 G;  4IPC A;  4DUZ Q;  1CKN B;  2I5L X;  4GNX C;  2VNU D;  1TWA H;  1TWG H;  1L2F A;  4DV3 L;  2K5H A;  2I0Q A;  3J7A 5;  5JJK A;  3DM3 A;  3PUY A;  3TS2 A;  1RIP A;  1UE1 A;  4ME3 A;  1VS0 A;  1YIJ A;  3JAM c;  1SFO H;  1QUQ A;  1SE8 A;  1HR0 Q;  4LF9 Q;  2Y0S G;  4X62 Q;  3PO2 G;  4JV5 L;  2NVQ H;  2UUB Q;  2UXC Q;  3CPF A;  1N8R C;  4KI0 A;  1OXT A;  1PHJ A;  3TRZ A;  4GOP A;  2QA4 A;  3E0E A;  4R4Q A;  1NMF A;  3RN5 A;  4WJ4 A;  3CCV A;  2RHS B;  4A3I H;  4JI5 Q;  2WFW A;  5C44 G;  2ZTC A;  5EAY A;  2UU9 Q;  4R1J A;  1G51 A;  3NEM A;  2GVB A;  1XPO A;  4A3I G;  2VS1 A;  3KDF A;  1NMG A;  5H1S E;  1W2B A;  1U5K A;  1N33 L;  1YHA A;  4FDB A;  5C0X G;  4B3M L;  4JBK A;  3OW2 A;  4C2M H;  3BZK A;  1QVG A;  3H3V H;  4JOI A;  4C3J H;  4DV2 L;  4DR7 L;  4L5R C;  1Q46 A;  1E1T A;  5GAH C;  5C3E H;  4X66 Q;  4A3L H;  2L15 A;  2CKZ B;  2D0P A;  2VZA A;  4A3B H;  3I55 A;  3GD7 A;  3HOW H;  5C3E G;  2WP8 J;  4JBJ A;  3GTG H; 
#chains in the Genus database with same CATH topology
 3OTO Q;  2B2T A;  4ZKC B;  4DV0 Q;  1Q86 C;  4RMF A;  5EJW A;  4Z9C B;  3TZU A;  3S15 H;  1Q1E A;  1F77 A;  2YTY A;  1EYC A;  3MTS A;  4POG A;  1MIU A;  1V1Q A;  4O42 A;  2QEJ C;  1BCP D;  3CQZ B;  3PO3 B;  4LF5 L;  4N8F A;  1XMQ L;  4TQU S;  5J39 A;  4IN3 A;  3SK5 A;  1S5F D;  3GV6 A;  3KJP A;  2G9D A;  1CKM A;  2SOB A;  2ZM6 Q;  4DR3 Q;  1CHP D;  1VDZ A;  1VQD A;  4J15 A;  4X65 Q;  5IGE A;  1SYC A;  4XDX A;  3VR2 A;  1HZ9 A;  3PO3 G;  4JVZ A;  3IKJ A;  1L1O B;  4KN7 C;  2KHI A;  1LT5 D;  3SK8 A;  2E8G A;  3L9A X;  3CW2 C;  1RF2 D;  4P2C B;  4IZ8 A;  4DR2 Q;  2PMZ B;  3F2U A;  1LV9 A;  2UXB Q;  3L2P A;  2VL6 A;  4BBS B;  1PTO F;  3H15 A;  2R93 B;  3PQI A;  4E6I A;  4A3M H;  1JWM D;  5K36 H;  1CI3 M;  3MFG A;  1M4V A;  1AE3 A;  4L5S A;  4DNI A;  5IP7 H;  1O7I A;  2EIF A;  2RDF A;  1LTA D;  2PYK A;  4JI8 Q;  4C3H H;  4JI6 Q;  2IWH A;  5CV6 A;  4QUF A;  1RCV D;  1STA A;  4JI2 L;  3RZO H;  1KD1 C;  4BBS G;  2R93 G;  2EY6 A;  4DK0 A;  4LNQ A;  3MC0 B;  3PUZ A;  1SFO B;  2K1B A;  2ZXO A;  5IIF A;  1DJR D;  1IKL A;  1EIF A;  4R4O A;  1UEB A;  5BR8 Q;  2Z9H A;  2XRQ D;  4RKB A;  4DNR B;  3G6E A;  1P8L A;  3G6J B;  3WOF A;  1N9W A;  2EJG C;  1SYF A;  4PQX A;  1XXG A;  3I70 A;  3NP8 A;  1JOR A;  1W6J A;  2KQ3 A;  3VYU A;  4POF A;  1B7Y B;  4ALP A;  5IYD G;  1STG A;  4YHH L;  1FNW A;  1PXU A;  3KLS X;  4CHT B;  4C3J B;  4DV1 L;  4QB4 A;  2JA6 B;  4QMG A;  4LFC Q;  1HXY D;  1Q12 A;  2AKW B;  1ZYR D;  2L9H A;  4JI1 Q;  3IRB A;  3T56 B;  5KNB A;  1E22 A;  1KXL A;  2MFI A;  3KUP A;  2F52 A;  5IT9 c;  2OCE A;  2AWN A;  3D4R A;  3OPO A;  3TQY A;  5KYL A;  3CME A;  4DF7 A;  4C3I B;  1BXT A;  2CWP A;  3AYH B;  2E2J B;  2F0S A;  4DKA C;  1K8O A;  2ES2 A;  4O0A A;  4C3J G;  4RHS A;  2JA6 G;  2RA4 A;  4EQP A;  2JJQ A;  1FGB D;  2BE5 D;  2ALY B;  5IOC A;  3S9W A;  4K6D A;  1WTR A;  3TSS A;  1YJN A;  4B3M Q;  3J81 E;  1LT4 D;  2B2Y A;  4OX9 L;  3S1M H;  4U67 3;  2PNR C;  3HOU B;  4C3I G;  1YJW A;  3AFQ A;  2YTX A;  2L12 A;  4FXK C;  4HN7 A;  2XWJ B;  1X9N A;  2RKS A;  1IL8 A;  3HOX B;  3FKI B;  2IW3 A;  3T13 A;  4A93 H;  3BDL A;  4B3T L;  3I2Z A;  1ASY A;  4IFD G;  1EIH A;  3GTJ B;  5C4X B;  1EQT A;  5IP9 H;  3G71 A;  2SDF A;  1TWH H;  2F0F A;  1AH9 A;  2A1A A;  3KF6 B;  4PMB A;  3HOU G;  4DUY L;  2ZT9 C;  4P71 A;  1Q8I A;  4I7A A;  1KAW A;  3HOX G;  2B2T C;  3FKI G;  4C56 C;  2VQF L;  1EZ8 A;  3N6R A;  1XMQ Q;  1JC7 A;  2I5H A;  1PFM A;  3S17 B;  5C4X G;  4IJL A;  3I7F A;  3MXG A;  1JR0 D;  2H5X A;  3S1N H;  4HJ5 A;  4DA2 A;  3AEV A;  1Z9F A;  2K5D A;  2JA8 H;  5M3F H;  5KRU A;  3K7A B;  5EGT A;  2UUA L;  4K0K Q;  1WJJ A;  4IOA A;  3E3X A;  1A3U A;  1Z47 A;  2KED A;  3FPP A;  2RBM A;  1CZW A;  4ILW A;  1LYL A;  4F88 A;  1TS4 A;  2KHS A;  1SJH D;  5E1F A;  1PTO D;  2HCI A;  3J80 L;  1RKN A;  2BDO A;  3CCM A;  5JJL A;  1I5F A;  4QJF A;  1TKW B;  3DXJ C;  3KFU A;  1XTC D;  3M3Y B;  3KF6 A;  1SBB B;  1ENF A;  2K4K A;  3E6Z X;  1VQH A;  3F2B A;  4IFD I;  3H0G B;  3HG9 A;  5JPM C;  3K0X A;  4S3S A;  3V96 A;  5KND A;  3V05 A;  3W1G A;  2IHE A;  4OEL B;  3S14 H;  5HGQ A;  1YHQ A;  4A3D H;  2JEA I;  1I4X A;  2A6E C;  1X3P A;  2JEB I;  3HKS A;  1LTB D;  3S24 A;  2KEN A;  3DWQ A;  1SNM A;  1ICW A;  1WCM B;  2QW7 A;  3QWN A;  2A8V A;  4FNF A;  2GN5 A;  2BA1 A;  3H0G G;  4G4K A;  1JJG A;  3PIP A;  2N3S A;  4RCO A;  1ENA A;  3VA5 A;  1LAC A;  4JI4 L;  4YHH Q;  1SNQ A;  1SNC A;  4DV7 L;  1Y1V G;  3QO2 A;  3D6W A;  3M4O B;  1EOV A;  4FF2 A;  5AFW A;  2B2W C;  4EGV A;  3J7Y W;  1D2B A;  4WFN 3;  3NSW A;  1DM0 B;  1PV4 A;  1CUK A;  1GM5 A;  1WCM G;  4LF6 Q;  4P72 A;  1KNE A;  5M3M G;  1CSQ A;  4HJ9 A;  3A5U A;  1Z7T A;  2WB1 E;  4MNO A;  3RZD H;  4X6A H;  1AFP A;  1L1O C;  2I5M X;  2KVM A;  5GRO A;  3A56 A;  2D62 A;  1A63 A;  4DV4 Q;  2R92 B;  2F3I A;  3G48 A;  5M5X H;  3HOV H;  3P1H A;  3BDO A;  1PRT B;  2RSO A;  4WJ3 M;  1AW7 A;  2UUC L;  1JWS D;  2JE6 I;  5ELO A;  4H0L C;  4OX9 Q;  3E9I A;  1CQF A;  2F03 A;  1SYG A;  4OGQ C;  4ME5 A;  5JEA J;  2A68 C;  2JA5 H;  3ZJY C;  3BZD B;  4ID6 A;  4B3T Q;  3HKZ E;  2R92 G;  1G2T A;  4MTK A;  2NTT A;  1XNR L;  4NW2 A;  2EJF C;  4K6L A;  2LXJ A;  1HR0 W;  2CH4 A;  1S4Z A;  2B2Y C;  1R4P B;  4TVA B;  2HDM A;  2ZJR A;  1Y1W H;  4ZUI A;  3K81 C;  5IGB A;  1VQP A;  1JCK B;  3NQI A;  2VQF Q;  1V8Q A;  1WTX A;  3BG3 A;  1FJG L;  2E2H B;  1CA5 A;  4GN3 B;  4PMC A;  5EKL A;  4LF4 L;  4HAE A;  1IBM L;  2ASB A;  2ICI A;  5EKI A;  2UUA Q;  1S5D D;  3HS0 C;  3KDF B;  2RDH A;  4DAV A;  2ZTD A;  1VF5 C;  3QB3 A;  2NVX H;  2HQL A;  2K5N A;  4OWW B;  3T1Y L;  5IE8 A;  1VQC A;  5I9O A;  4X3S A;  3A55 A;  5BN3 A;  4A76 A;  2NVY H;  1O78 A;  4QIW B;  3MXN B;  3GTK H;  1NNX A;  3GTQ H;  1TWA B;  1TWG B;  2RSN A;  1A62 A;  1CM9 A;  2K03 A;  1KLG D;  1S5E D;  2NYZ D;  3DWP A;  4KKT A;  1LTG D;  2FFK B;  2UUB L;  4KHV A;  4IUN A;  5JPN C;  2FMM A;  4MN3 A;  4MTN A;  1TR5 A;  2K75 A;  1D1K A;  2PW7 A;  5JEA G;  4PNY A;  4GLA C;  1XPR A;  1VQ4 A;  1GJX A;  2VXW A;  1YJ9 A;  2KA7 A;  3MVV A;  2K5H A;  3J7A 5;  2ICE C;  3PUY A;  1RTO A;  1W6K A;  5E3F A;  2L11 A;  3MWY W;  4JV5 L;  5JVG 3;  3S1Q B;  5EPK A;  1I4G A;  5ELC A;  1EWH A;  2NVT B;  2F1M A;  4R4Q A;  4WJ4 A;  5C44 G;  1DOK A;  2GVB A;  1XPO A;  2VS1 A;  1CZG A;  3KDF A;  1W2B A;  1X32 A;  2VB2 X;  4NP5 A;  5C0X G;  4JBK A;  3K5L A;  1WTQ A;  3ERO A;  4ULL A;  4DV2 L;  2IJ0 A;  5C6A A;  5C3E H;  4QUC A;  3BVG A;  3QG1 A;  3MXN A;  1LTS D;  3HOW H;  2WP8 J;  2KEE A;  3V2T A;  1BCP F;  3GTG H;  2XSC A;  4LUO A;  1F2M A;  1HJP A;  1I6H H;  1YNN D;  3ND8 A;  1JIC A;  5I6Y A;  1UWV A;  4DK6 C;  3LWU A;  1CFM A;  4J6H A;  3LNN A;  4KJN A;  1HNZ L;  3K5M A;  4DR3 L;  3CCS A;  5M5Y B;  1S5C D;  4F8M A;  5IYB H;  2SNM A;  2OXP A;  3JAM E;  1JOQ A;  5KGU A;  4HIO A;  1G8Z D;  4X65 L;  1EFW A;  1JT8 A;  2F0D A;  3CP0 A;  1EFI D;  2Z0S A;  2DJF C;  4GN5 A;  3NBI A;  1F2Z A;  4YWK A;  5LHY 1;  1K0S A;  1ONL A;  4EQN A;  2KJX A;  3I4M H;  1YI2 A;  1N36 L;  4DR2 L;  2XRS D;  5L37 A;  1D1I A;  3ND9 A;  2PCF B;  2EY1 A;  3OMG A;  4B08 A;  3T51 B;  5LMN Q;  1OXV A;  1B9M A;  1SN8 A;  1XNR Q;  1SE2 A;  1W3S A;  1B1Z A;  2B3G A;  3NQT A;  3H6M A;  2WKC A;  1E3P A;  3S1R B;  4YIJ A;  1H9M A;  1JJ2 A;  2Q8R E;  4DR4 L;  1G91 A;  1JQY D;  3S16 H;  4C3H B;  2EXZ A;  3EBE A;  5C0X I;  1A2T A;  3I3C A;  5M9O A;  5NUC A;  3RZO B;  3PIP 3;  1DOM A;  2F4I A;  3FMC A;  1BO0 A;  5K36 G;  2EQS A;  2HHH L;  2Q8T A;  5BR8 L;  1Y69 U;  1SLJ A;  1BBW A;  3HOZ G;  4IUU A;  3FP9 A;  4IUP A;  2HT1 A;  5I4D A;  4DAP A;  5C3W A;  4DR6 Q;  4HED A;  1GHK A;  4DAY B;  4A3E H;  2DGY A;  2AQ3 B;  4C3H G;  3MEF A;  1VQF A;  4AIM A;  4ZUJ A;  4JI0 L;  3QJY A;  4JI7 L;  4C1N I;  2Q2U A;  1JJC B;  4CKB A;  5CMD A;  2JA7 H;  4R9W A;  1EYG A;  3T1Y Q;  3E0J A;  4MIU A;  5FK9 C;  1SNO A;  2WIN B;  4NXN Q;  1UAP A;  1KRT A;  2Z8L A;  4LFC L;  1VQG A;  1DGS A;  4JI1 L;  1QVF A;  3JC6 6;  5LMN W;  1YZ6 A;  4AYB B;  3J81 L;  1PH2 A;  1K83 H;  2AUK A;  1ET9 A;  1GXD C;  3UE1 A;  2WAC A;  1JE5 A;  2A6H D;  4A4I A;  1PH9 A;  1YNJ C;  1HNX L;  5FJ8 H;  3T16 A;  2QCP X;  4RKL A;  2C9O A;  1PTO C;  1H95 A;  1KQS A;  2PMZ E;  4K2K A;  5COR A;  4AYB G;  5IWA L;  3NWT A;  1PFS A;  2KBN A;  4UHV A;  1RJT A;  3OIP A;  4JV5 Q;  5D65 A;  1JWU D;  4R4T A;  3K58 A;  2RF4 A;  2ZXP A;  5DM6 3;  5CC4 A;  1NCV A;  3PMF A;  4PV1 C;  2JN4 A;  1F9P A;  4DAY A;  4A75 A;  4BXX H;  1GUG A;  3EVQ A;  1QZG A;  4N9P A;  1Y14 B;  2IX0 A;  4JPB W;  4LK1 C;  4A93 B;  4BY7 H;  2Q8I B;  3HEJ A;  3OYY A;  1WTP A;  1HH2 P;  4LJZ C;  1FR3 A;  1WYD A;  4G7O C;  5JAV A;  2YYZ A;  2F0L A;  3TEH B;  3NTH A;  4DV2 Q;  1TWH B;  1ML0 D;  2K6A A;  1AZQ A;  3MHB A;  1G6P A;  5ELB A;  2KUM A;  4PMW A;  2OQK A;  2Z6K C;  1TII D;  5ELN A;  2K28 A;  4P74 A;  3I8Z A;  4A93 G;  1UE5 A;  4ZKB B;  1D7Q A;  1CA6 A;  1L0X B;  1U4P A;  2F0G A;  3KLR A;  2EE1 A;  4UP8 A;  4A3C H;  5K5P A;  1HNZ Q;  4RG1 A;  1BKB A;  4KY5 A;  1J9O A;  5CR3 A;  3IFT A;  3KLW A;  1IW7 C;  5ELF A;  3I4N H;  4UP9 A;  2DNE A;  4L5T A;  4BBR B;  2A19 A;  4K0K L;  5M3F B;  4P75 A;  3NUC A;  3NK9 A;  3J81 j;  2H4O A;  1RDP D;  2E2I H;  3BZC A;  4DR1 L;  1JMC A;  4GLV B;  4L5Q A;  1N36 Q;  2J0T D;  1D6E C;  4KD3 A;  1WTW A;  5I2Y A;  5M5W B;  2EY5 A;  3VR4 A;  3CC4 A;  3D8G A;  1BBU A;  1OXU A;  4IQZ A;  4BBR G;  1NR2 A;  5AJ3 L;  4RHR A;  4ZRZ A;  4HTH A;  3RLO A;  3UI2 A;  2JK8 A;  1IHZ A;  1HA5 A;  3PGZ A;  4DR4 Q;  4KMU C;  3J80 c;  2PW5 A;  3L7Z C;  2EYM A;  1IYV A;  3D4D A;  5C4J H;  1AE2 A;  2Z4H A;  4J1M A;  1K8G A;  4OWX B;  1WTO A;  3G4S A;  3UDX A;  4IFD J;  3CAM A;  3S14 B;  5DAU A;  4DGZ A;  4LFB L;  2CW0 D;  2K05 A;  2HHH Q;  3H91 A;  4R8I A;  2YTV A;  2B2W A;  1K3R A;  1X3E A;  1VCI A;  3AB9 A;  1LTT D;  1A2U A;  3K8A A;  2V1C C;  4H44 C;  4JI0 Q;  1L1O A;  1VQ8 A;  4JI7 Q;  1HR0 L;  4X62 L;  4IOC A;  4PG3 A;  4ODG A;  2ID0 A;  4QGU A;  3EA6 A;  4JG2 A;  5GAG C;  1BDO A;  1BCP B;  3M4P A;  4A3F H;  4JI5 L;  1HZA A;  4LF6 L;  4MHE A;  3CCQ A;  4G57 A;  3RN2 A;  3GTO H;  1CTM A;  3PO2 H;  3CCE A;  1GD7 A;  4M1U B;  5COY A;  1HNX Q;  2CHB D;  2NTS A;  3NTK A;  3DWA A;  1YHB A;  2Q2I A;  1MI2 A;  1VQ7 A;  2J4X A;  2WAQ E;  1VQ9 A;  4DV4 L;  3R2T A;  4O2D A;  2BCO A;  2PPB C;  3CRK C;  2R7Z B;  3NBH B;  1C48 A;  1AEX A;  3HOV B;  2JP1 A;  3N52 A;  4GZY C;  2M00 A;  5IWA Q;  3DLL A;  3NWS A;  2BH2 A;  3F2C A;  3CD6 A;  5IYC H;  2VY3 A;  1QOH A;  1STN A;  2MP1 A;  1EY5 A;  4HJ7 A;  1LTR D;  3DM1 A;  4X3U A;  1ZXT A;  2JA5 B;  1BBX C;  4JCV E;  1X54 A;  5J22 A;  1CSP A;  3T1H Q;  2R7Z G;  1FVI A;  3MZ5 A;  5CV7 A;  3HOV G;  1IZ6 A;  1X3F A;  3A8K E;  1TWC H;  1D5M C;  2R7D A;  4NXM Q;  1SJE D;  3EN2 A;  4XT3 B;  2F0Q A;  5IOD A;  1YVC A;  4GKJ L;  2F0M A;  5I2X A;  2FMC A;  4OXP A;  1Y1W B;  1QNU A;  4MZ9 A;  2JA5 G;  1SRO A;  4KHZ A;  1F2L A;  1VMP A;  4Q5V A;  3PIO 3;  3C46 A;  5HY6 A;  1WI5 A;  2PNH A;  5FLX E;  3IL8 A;  3KBX A;  1VF7 A;  1ILP A;  1PH1 A;  3R3O A;  2F0K A;  3M4Y A;  1XYI A;  4ZYS A;  4XTC S;  4JW0 A;  1NTG A;  3GV3 A;  2XTI A;  3NBH A;  3CQZ H;  1YNN C;  1Y1W G;  3HP3 A;  1E1O A;  5JVH 3;  1IBL L;  1II3 A;  3PUV A;  1VQA A;  1A3T A;  1VQL A;  4DR1 Q;  2X6L A;  5IGC A;  5C4Z A;  5GQO A;  2OWO A;  2YU9 B;  2NVX B;  5FLM H;  4GOP B;  1Y8O B;  1Q82 C;  1I50 B;  1RD9 D;  4A3G H;  3GTQ B;  1S3O A;  3ERS X;  5HUR A;  2CH4 W;  2CFM A;  2AWO A;  4P73 A;  5AJ3 Q;  1Q1B A;  5D3I B;  3SK4 A;  1OO9 B;  2E75 C;  1GVP A;  2KCN A;  4Y7N H;  4K2L A;  2K52 A;  4OWT B;  2E5L L;  2XGT A;  2K5Q A;  3OWE B;  4CBV A;  1E2Z A;  1I3Q B;  4BBS H;  4FP5 D;  2B2U A;  2B8F A;  2ENB A;  1SMY C;  5ELD A;  4YCU A;  1ZEQ X;  1DOL A;  2Y0S B;  4JC0 A;  2O4X A;  3CCL A;  4LFB Q;  4CDC C;  3F1Z A;  3UDG A;  4HSP A;  2B63 H;  2QDL A;  1QE6 A;  1ZKO A;  4K8I A;  5KNC A;  4RGT A;  5ISR A;  1CKN B;  2O2L D;  1HTL D;  4DV3 L;  1L2F A;  4FXG C;  4NKL A;  1RIP A;  4OIJ A;  1EYA A;  3SK6 A;  4WRD A;  1SFO H;  3JAM L;  1HR0 Q;  1R4Q B;  2Y0S G;  4X62 Q;  3K6O A;  3CPF A;  3S2D B;  3FVQ A;  4GOP A;  1D5Z C;  1PLF A;  5C3E B;  3J7A F;  3CCV A;  2NBF A;  4JI5 Q;  3AMU A;  2ZTC A;  3EQL C;  3VR3 A;  3HOW B;  1G51 A;  1EY4 A;  1NMG A;  3A8J E;  1U5K A;  2A74 C;  1TT2 A;  3NHH A;  4FDB A;  1PZJ D;  2AUJ D;  4OEM B;  3H3V H;  4JOI A;  4C3J H;  3KBG A;  4DR7 L;  4ZAI A;  1GHJ A;  2RVL A;  5LL6 X;  2F0T A;  2VZA A;  2B2V A;  4A3B H;  1LO5 D;  5C3E G;  3FHW A;  1VQO A;  2OEO A;  4QIW E;  3HOW G;  1FD7 D;  3KYH C;  4C3I H;  3E5S A;  2E2J H;  2WII B;  3BDC A;  1LM0 A;  1V1O A;  2F0J A;  4BA1 I;  3I4M B;  1PTO B;  4IJH A;  3ERQ A;  1CKN A;  2A69 D;  1TWF H;  5LMN L;  5IYB G;  1HA6 A;  4IFD H;  1SDF A;  2DY8 A;  3MXU A;  5DNF A;  3Q22 A;  1PDQ A;  1XX8 A;  2WV6 D;  3VR6 A;  1O7Y A;  2KCC A;  4CDF C;  1R9T H;  3HOU H;  2Z1C A;  2D9U A;  1OXX K;  2EYH A;  1KIX A;  4GKJ Q;  3R93 A;  1WTV A;  3HZX A;  1YBY A;  5J1Z A;  3I4M G;  3HOX H;  2IY5 B;  2VB3 X;  1Q3L A;  5C3X A;  3TRE A;  1K9M C;  3TBI B;  4DU9 A;  1PFB A;  2EYO A;  2NN6 H;  3MA2 B;  3GTJ H;  2JSO A;  4APV A;  2L0C A;  5C0X J;  3LX0 A;  2KHJ A;  4UAI A;  1E7Z A;  3HOY H;  2UXD L;  3WDN A;  4KK7 A;  4DV6 L;  2D2C C;  4G7Z C;  1BCP C;  1KNA A;  4XYQ A;  3PV0 A;  4DR6 L;  1XWE A;  4HIK A;  2WKD A;  3F8T A;  2HQE A;  3SEB A;  3DEP A;  4A3E B;  3GTM H;  1ENC A;  2ZXR A;  4CDD C;  4TSS A;  3A7L A;  3OIQ A;  4H7B A;  1AZP A;  1IBL Q;  2QDB A;  4UY8 C;  5CBA E;  4GN4 B;  1DD2 A;  3TP8 A;  2P5Z X;  1LUZ A;  3S2H B;  3RUZ A;  2JA7 B;  1B44 D;  3J7Z C;  2PQA B;  1PH7 A;  3CC2 A;  3CMA A;  4NXN L;  4I7Z C;  3UE0 A;  1IYU A;  2OT2 A;  3VYR A;  3SVM A;  4HMI A;  1A6X A;  4PZ6 A;  4RGM A;  3BVZ A;  2EDG A;  3M7G A;  1D5X C;  3I4O A;  4A3E G;  1WFQ A;  4X64 L;  1PYS B;  4DV5 L;  1HQM C;  3DUZ A;  1B8A A;  5KYI A;  2JA7 G;  5A35 A;  1KHI A;  5LL6 S;  4CDE C;  2E5L Q;  2L4N A;  3J81 c;  2RCN A;  1QNK A;  3VA7 A;  4LUV A;  4TKO B;  1Q81 C;  2K7V A;  2VUM H;  3NE5 B;  4QCL A;  5IGD A;  2LKV A;  5D3D A;  3GTL H;  3HFZ B;  3GO5 A;  1V1P B;  3KLS A;  1ILQ A;  3EJI A;  5FJ8 G;  2F4V Q;  4KN4 C;  3H0G H;  1EL0 A;  3HKZ B;  2Z6K A;  2O5I C;  4HR7 B;  4DV3 Q;  4JK1 C;  4L6T B;  1J8I A;  2B2U C;  3BYT B;  4QF4 A;  3I56 A;  4BY7 B;  3A54 A;  1IKM A;  1KDC A;  3U9S A;  3HGB A;  1O7L A;  4LF7 L;  1Y1V H;  3S15 B;  2F0V A;  2MUY A;  4JI3 L;  1B3A A;  3AQQ A;  3PSI A;  5M3M H;  4B3R L;  4A3L G;  4H02 A;  3VYT A;  3HKZ G;  3A0J A;  4AQY L;  3OHX C;  3GDE A;  1SXT A;  2LS0 1;  4BY7 G;  1EY8 A;  3GTP H;  4DXF A;  5KIX A;  1KTK A;  1SEB D;  3L3O C;  4DR7 Q;  5HGT A;  1ZYR C;  1G6Z A;  4GOP C;  2I07 B;  3I4L A;  4XXE A;  3X3N A;  4HCE A;  4RH6 A;  3CCR A;  4GNX B;  1U0L A;  2EXD A;  1MD2 D;  3M7N A;  2K33 A;  1GUW A;  1SR3 A;  3A7A B;  1V9P A;  3D0F A;  3VYS A;  1V1P A;  3O13 A;  3I72 A;  4LFA L;  1V43 A;  4JOI C;  4KKU A;  4Y52 H;  5IT9 E;  3J80 i;  2KOL A;  3RD4 A;  2BE5 C;  2R92 H;  2B2V C;  1VQB A;  1SNP A;  1NBW A;  5I9P A;  1FNV A;  4B9X A;  4A3M B;  2EYP A;  2RQX A;  5E4W C;  4HID A;  4RGO S;  2OTL A;  4BY1 H;  1EQV A;  1B2T A;  1FGU A;  1B9N A;  5DEH A;  4A3K H;  3F2D A;  1SYD A;  1BNZ A;  3URY A;  4RWS C;  1X65 A;  2IL8 A;  2R3Z A;  3C2P A;  3LWE A;  5A2Q E;  5CV4 A;  1BUV T;  2G9H D;  1QB5 D;  1IBK L;  2CWA A;  1F9S A;  4GKK L;  1KLU D;  5C4J B;  1X6O A;  2EVB A;  4X3T A;  4A3M G;  4K5V A;  3AU7 A;  1STB A;  1C9O A;  2UXD Q;  1F9R A;  3ULJ A;  2A6E D;  2K14 A;  4DV6 Q;  5IP7 G;  1ET6 A;  2TMP A;  4X3K A;  4DR5 Q;  4GNX A;  3PIO A;  1NUC A;  1PA6 A;  3ITP A;  3SGI A;  4HIM A;  4JYA Q;  4K5X A;  1GUN A;  5JOB A;  1K3B C;  2D5D A;  1C0A A;  5IGF A;  4NMZ A;  4KHP Q;  1JOK A;  2RDG A;  4DPG A;  5C5L A;  4WJW A;  3G7L A;  1K8M A;  1ICF B;  4DUZ L;  2NZO A;  4V19 0;  4A3F B;  2F0E A;  1NR4 A;  1A15 A;  1RTN A;  1SSO A;  2BDN A;  1LAB A;  3U58 A;  4X64 Q;  4ZQ3 A;  4DV5 Q;  2NB0 A;  2ATW A;  5JEA H;  3FPU B;  4LF9 L;  3QR8 A;  2OQ0 A;  3L0O A;  4K5W A;  2JXM B;  2R7F A;  3C1F A;  1TS2 A;  1DXM A;  2DN8 A;  5GAD C;  5GAE C;  3DEO A;  3K80 C;  2UU9 L;  2QGQ A;  4A3F G;  2AQ2 B;  4IUQ A;  5E4X A;  4AH6 A;  3IAY A;  3W3A A;  4H13 C;  4OO1 H;  1I94 Q;  1LTL A;  3S1M B;  1K73 C;  2HUG A;  2ZTE A;  4IAL A;  3NEN A;  4X66 L;  5C44 H;  4GLX A;  1I4H A;  3X3M A;  1HZB A;  1NY4 A;  5FLX L;  3KK7 A;  2C5C A;  5D14 A;  4ABN A;  2KCM A;  1KRS A;  2F3V A;  2QKI C;  3CXC A;  3T1H L;  1OTC A;  1EIG A;  1NE3 A;  1QVC A;  2E76 C;  1STY A;  4NXM L;  4XQJ A;  1K0R A;  4LF7 Q;  1TWC B;  2KEC A;  3S1Q H;  1QG7 A;  1S72 A;  2MPM A;  4JI3 Q;  2BA0 A;  2JYO A;  5IYC G;  3IFD A;  2NVT H;  1HCZ A;  4HJ8 A;  5FO9 B;  1T5X D;  3ZYY X;  2FXQ A;  4B3R Q;  1H9J A;  2RHQ B;  2F0H A;  4YWM A;  4AQY Q;  3TME A;  1EUJ A;  1QIL A;  4YWL A;  1XNQ L;  2MJ8 A;  4RAU C;  1PVO A;  2R61 A;  1TVX A;  3U9O A;  4B9W A;  2HD3 A;  5EPL A;  5IP9 G;  1ROD A;  1XMO L;  4LWC A;  3RLN A;  1E24 A;  2XIW A;  4OHJ A;  3HRZ C;  4EQ5 A;  4A3J H;  4FXD A;  3S1N B;  3TDQ A;  3U50 C;  1L0W A;  1VQE A;  1EY0 A;  3NXW A;  4O1N A;  1I4P A;  2JA8 B;  1HZC A;  3K5O A;  5JJI A;  2PI2 A;  1UUP A;  1HFN A;  1U4L A;  2E2D C;  4LFA Q;  1N34 L;  1ESR A;  4LW1 A;  4ZCK A;  5M5Y H;  1SND A;  4CJ0 B;  2PZW A;  3I90 A;  1BVS A;  1TY2 A;  4G7H C;  1WTH A;  2MO1 A;  1CQV A;  2C35 B;  3WWV A;  4EX5 A;  4A3G B;  3I73 A;  4ZK9 B;  2AQ1 B;  1PRT F;  2B29 A;  5M3F G;  2JA8 G;  3R2I A;  5E7N A;  1QUQ B;  4HCS A;  3PF4 A;  2J7Z A;  1Q7Y C;  1TS3 A;  4FYD A;  1B3Q A;  2A69 C;  3W5O A;  4B3S L;  4RA8 A;  1HRJ A;  1S40 A;  4Y7N B;  4KV6 A;  1FYC A;  2LMC B;  4XQQ A;  4J8Q A;  5FLM G;  2EOT A;  1IBK Q;  3TP7 A;  4GKK Q;  1PYB A;  4A3G G;  3OW7 A;  3PUW A;  5DM7 3;  1F2Y A;  4A3D B;  1SYE A;  3HOZ H;  3S1R H;  1TXY A;  3CHB D;  1B70 B;  1MJE A;  2B63 B;  2M2L A;  1DCZ A;  4HMJ A;  1WD0 A;  1GOZ A;  1MKH A;  2HIX A;  3VDY A;  4FF3 A;  2SNS A;  1A3V A;  1EY7 A;  3W1B A;  3KOJ A;  2QEX A;  1EWC A;  3EFX D;  3TN2 A;  4OIK A;  1BQQ T;  1TQO A;  2LFN A;  3D6C A;  5FO7 B;  4A3D G;  3K0Y A;  1HNW L;  3SE0 A;  4KKS A;  2B63 G;  4DUZ Q;  3Q24 A;  2I5L X;  1UNS A;  4GNX C;  2VNU D;  2HCC A;  1EEI D;  2A5H A;  4V0B A;  3DM3 A;  1B53 A;  2G5D A;  1UE1 A;  2PZU A;  4ME3 A;  1YIJ A;  3JAM c;  3RZD B;  1LT3 D;  5CGK A;  1QUQ A;  1SE8 A;  4LF9 Q;  3CRL C;  2NVQ H;  2UXC Q;  1N8R C;  1KDA A;  5CBE E;  4KI0 A;  1PHJ A;  4BWG B;  1C8C A;  1LLR D;  2L55 A;  1CT1 D;  1NMF A;  2RHS B;  4A3I H;  1LTI D;  2K32 A;  2WFW A;  4A3B B;  2EJM A;  3H94 A;  5M5X B;  2UU9 Q;  1LT6 D;  1HUN A;  2B39 A;  4WOR A;  5EBD A;  3OMC A;  4DK1 A;  3OW2 A;  4C2M H;  3BZK A;  1HUM A;  2DJG C;  1Q46 A;  1PYW D;  3ONA B;  1E1T A;  4X66 Q;  2D0P A;  4NDX A;  3I55 A;  2F0I A;  1U4R A;  1B50 A;  4JBJ A;  1TWF B;  1BR9 A;  1Q8K A;  4A3B G;  2K01 A;  2EYF A;  1X3Q A;  1N33 Q;  1SE4 A;  3RR5 A;  3DHQ A;  5EBC A;  2ZJQ A;  1SYB A;  1H9R A;  2Y0S E;  1I4R A;  3FRP B;  1R9T B;  2V4D A;  2N88 A;  2QF7 A;  4DFA A;  1VQ5 A;  1UEA B;  1SRU A;  1A8V A;  4FF1 A;  1XNQ Q;  2O5J C;  4OON A;  4HSV A;  1XJV A;  1JOO A;  1XMO Q;  3HOY B;  3BVM A;  2Z4I A;  1PMR A;  1EQR A;  4YCV A;  2E74 C;  4IUT A;  3PO3 H;  3STB D;  1PH8 A;  1TS5 A;  4LF8 L;  4LF5 Q;  3KJO A;  3GTM B;  2LY7 A;  1HFG A;  4KLK A;  2HDL A;  2CVR A;  2NN6 G;  1N34 Q;  3VR5 A;  1E2V A;  3CCU A;  3CC7 A;  1H9S B;  1MHW C;  3J81 i;  2Q2T A;  3HOY G;  1KL9 A;  2NVY B;  4BBR H;  2L5T A;  4XT1 B;  3GTK B;  2A73 B;  5FKA C;  1PH6 A;  1STH A;  2X69 A;  1PRT D;  1D8L A;  3B6Y A;  3K57 A;  1HHV A;  3H3V I;  5CV8 A;  1VMC A;  1YNJ D;  2N8N A;  2WAQ B;  4F7X A;  4B3S Q;  1OXS C;  5M5W H;  4HJA A;  2R93 H;  4IPG A;  3PUX A;  2KCT A;  1YNX A;  1JE4 A;  3UDI A;  1EY9 A;  3U4Z A;  5I6W A;  3RNU A;  2VUM B;  4IUV A;  3NPP A;  5CV5 A;  2JQO A;  3GTL B;  1U4M A;  4N8X 1;  4I65 A;  2N55 A;  1QJO A;  2JA9 A;  2F4V L;  4RFB A;  2N78 A;  2WAQ G;  4UP7 A;  5JJZ A;  2CQO A;  4YY3 L;  1EQQ A;  3OOC A;  4L8J A;  5IYD H;  1PFN A;  2IT1 A;  4DXG A;  4XIG S;  4JI2 Q;  1KAB A;  4YCW A;  2IX3 A;  1K28 A;  2VUM G;  1Y1V B;  2CQA A;  1NSN S;  1I6V C;  1H9S A;  2NWG A;  4CKC A;  4KY7 A;  2F0O A;  1HNW Q;  1C7Y A;  1G2S A;  1Y8P B;  1T5E A;  5M3M B;  2HIV A;  2XWB B;  1IL2 A;  2F0U A;  2NN6 I;  4BS9 A;  3GTG B;  1I6H B;  1KAA A;  4NPS A;  5IT9 L;  2H1E A;  5EPJ A;  5BN4 A;  3FDT A;  3MFY A;  3GTP B;  2JA6 H;  4DV1 Q;  1SE3 A;  4R4I A;  1Z6H A;  4KJO A;  3H09 A;  2OF1 A;  5C4H A;  4IO9 A;  3BU2 A;  2TSS A;  1MSH A;  4OL7 A;  1IW7 D;  3CPW A;  5EKK A;  3RLF A;  1BOS A;  2A6H C;  3FEW X;  2I46 A;  2MHV A;  4UPA A;  2RCF A;  5DLQ E;  1GKH A;  2MQH A;  5TSS A;  5A2Q L;  2LSS A;  3P7J A;  1J5E L;  1F9Q A;  1MJC A;  1MBY A;  1NJI C;  4C1N K;  1IXR A;  1WOC A;  2FIN B;  3MXP A;  1UE6 A;  2R7Z H;  1X3G A;  1ASZ A;  2DUD A;  3QOL A;  2LXK A;  4DNT B;  1XTD A;  5LMU L;  2PQE A;  3C1E A;  3P75 A;  4BY1 B;  1E2W A;  1WD1 A;  5IY0 A;  4A3K B;  1QZH A;  3FKI H;  4BA2 I;  3S16 B;  2BH8 A;  3PCO B;  1GUO A;  1H9K A;  1GUS A;  3ER0 A;  5C4X H;  1C4Q A;  3E9H A;  1U9R A;  2NZH A;  1EZ6 A;  1NAP A;  3KF8 B;  1M90 C;  2L1B A;  4QQB X;  1QWY A;  3ULP A;  4BY1 G;  5CYU A;  3GP7 A;  4DR5 L;  3UDF A;  2ZJP A;  4DUY Q;  1CKO A;  1EIY B;  4A3K G;  1N32 L;  1VQK A;  2N49 A;  5J3B A;  3K5N A;  4LF8 Q;  4IPH A;  4JYA L;  1J6Q A;  1O7Z A;  3WOE A;  1PH5 A;  1M1K C;  2EYJ A;  3TP5 A;  3S17 H;  4PZ7 A;  2VQE L;  4Q0F A;  4IUR A;  4QY7 A;  3H3V C;  4KHP L;  3BJU A;  2MNA A;  1STE A;  2FJ2 A;  2MO0 A;  1EOT A;  2WB1 B;  1DYQ A;  3K7A H;  1K83 B;  2EY2 A;  3C3L A;  3D31 A;  4DAM A;  2XN9 C;  1FL0 A;  2K04 A;  2YU9 H;  3LGJ A;  2VW9 A;  4LMQ D;  5ELE A;  1I50 H;  3OWF A;  3K59 A;  3J7A V;  3DMU A;  1G29 1;  2WB1 G;  4U68 A;  1IYJ B;  2F0N A;  3M3Y H;  5G3L F;  3KF8 A;  1GO3 E;  2BOS A;  2F0W A;  3R8B A;  2Z6B A;  1I94 L;  3CKI B;  2PZT A;  2YV5 A;  1WVL A;  5C44 B;  2B8G A;  1P16 A;  1I3Q H;  3P20 A;  2F3W A;  4QL5 A;  4DK3 C;  1VQM A;  1K8A C;  4YY3 Q;  1HQR D;  3Q0A A;  1KC8 C;  2CW0 C;  1XPU A;  3J80 E;  2PQA A;  2IPK D;  1SMX A;  1M8A A;  1E0B A;  5C5M A;  3W2D A;  1WCM H;  4OO1 G;  4FO2 A;  5FLX c;  3PF5 A;  3CCJ A;  1UE7 A;  3D4W A;  1SAP A;  4CJ2 C;  3OTO L;  2QIL A;  4DV0 L;  1CK1 A;  2F0P A;  3EIV A;  4BXX G;  4JI4 Q;  2SEB D;  3NEL A;  5FOB B;  3M4O H;  2GVA A;  3S2D H;  3Q8D A;  4DV7 Q;  2PO4 A;  1VQN A;  3I4N B;  1EYD A;  1PH3 A;  4A3J B;  4KY6 A;  3TP6 A;  1A0I A;  1RHP A;  3MAQ A;  1JB7 A;  2OTJ A;  2FHT A;  4AYB E;  3BS1 A;  1DZ1 A;  3T53 B;  4JBM A;  2K50 A;  3CF5 A;  1TY0 A;  2E2I B;  5EQ0 A;  5T1G A;  4F87 A;  2ZM6 L;  1EEF D;  1EU4 A;  3M9B A;  1PZK D;  1J5E Q;  4DN4 M;  4A3C G;  4ZLT F;  2EZV A;  4XQN A;  3BYY B;  3I4N G;  2K5V A;  4A3J G;  3ULL A;  3SDZ A;  2UUC Q;  1PZI D;  3SXH A;  4NB3 A;  5LMU Q;  3M4Q A;  2PI2 E;  3TS0 A;  3NTI A;  3A5Z B;  2X6G A;  4KTA A;  1PTO H;  1VQJ A;  1PH4 A;  1QCB D;  2NZ1 D;  1MSG A;  2UXB L;  1HTP A;  3QOJ A;  4M8A A;  4GS3 A;  4L63 B;  4K14 A;  2XNA C;  3T4A C;  2EPB A;  1SMY D;  4OO1 I;  3MEH A;  1EY6 A;  4LUZ A;  5FO8 B;  3HOZ B;  4UDU C;  4R4C A;  1X55 A;  1AN8 A;  3Q6S A;  4JI8 L;  4JI6 L;  2AHO B;  1N32 Q;  1RL2 A;  1TU2 B;  3JAM i;  3A74 A;  3ICE A;  4JBW A;  3K7U C;  3CU7 A;  1CHQ D;  3D3R A;  2E2H H;  5T1I A;  4IPD A;  2IX1 A;  1FNU A;  4PZ8 A;  1FJG Q;  2VQE Q;  3M85 A;  3AFP A;  3OSO A;  1AP0 A;  1X56 A;  1VQ6 A;  4K8J A;  2AMC B;  4LF4 Q;  1HPC A;  1EU3 A;  1Q90 A;  3STB C;  3RMH A;  2DY7 A;  2MGS A;  1IBM Q;  1YIT A;  2EYL A;  4LAA A;  1DON A;  2IHF A;  2R6G A;  5CV9 A;  3GTO B;  2K5W A;  1T9H A;  3PO2 B;  4EQO A;  1YEZ A;  2D0O A;  1EWI A;  1VQI A;  5KEE A;  1BF4 A;  2DNC A;  2Q2H A;  2UXC L;  3QIA A;  4RGN A;  5IGG A;  3S2H H;  2NVQ B;  4EVO A;  5F2D A;  1L0Y B;  3U4V A;  5BN5 A;  2CCZ A;  4IPC A;  3GQB A;  4A3I B;  1TWA H;  1TWG H;  2I0Q A;  1ESF A;  3Q23 A;  2M9V A;  4FVM A;  5JJK A;  1PRT C;  3TS2 A;  1VS0 A;  4TRD A;  4R8N A;  2GA4 B;  4CJ1 B;  5G3L D;  3PO2 G;  1KDB A;  2UUB Q;  4C2M B;  4N9T A;  1OXT A;  1O80 A;  4RCN A;  1JB3 A;  3TRZ A;  2QA4 A;  3E0E A;  3RN5 A;  2XVS A;  2A68 D;  1B4O A;  2NUC A;  1MGS A;  4R1J A;  5EAY A;  1I4Q A;  3NEM A;  4CKE A;  3SR1 A;  3TZD A;  5C0X H;  1N33 L;  4A3I G;  5H1S E;  1YHA A;  4B3M L;  3A8I E;  4XYO A;  1Y8N B;  1S5B D;  1QVG A;  4L5R C;  3SHL A;  4FF4 A;  5GAH C;  4A3L H;  1GUT A;  3I91 A;  2L15 A;  2CKZ B;  4KD4 A;  3GD7 A;  4CGY B; 
#chains in the Genus database with same CATH homology
 3FHW A;  3OTO Q;  1VQO A;  4LUO A;  4QIW E;  1Q8K A;  4DV0 Q;  1HJP A;  1Q86 C;  4A3B G;  1N33 Q;  1I6H H;  4RMF A;  3HOW G;  1QVF A;  3RR5 A;  3KYH C;  4C3I H;  1UWV A;  2ZJQ A;  3S15 H;  4DK6 C;  2Y0S E;  2E2J H;  1LM0 A;  1Q1E A;  1HNZ L;  4DR3 L;  4BA1 I;  3CCS A;  2YTY A;  5IYB H;  4POG A;  4IJH A;  1VQ5 A;  1MIU A;  4HIO A;  1CKN A;  1V1Q A;  4X65 L;  1EFW A;  1JT8 A;  1TWF H;  3CP0 A;  1SRU A;  5IYB G;  5LMN L;  4LF5 L;  1A8V A;  1XMQ L;  4TQU S;  2Z0S A;  4GN5 A;  1XNQ Q;  4YWK A;  4OON A;  3KJP A;  1R9T H;  1XJV A;  1CKM A;  3HOU H;  3I4M H;  2ZM6 Q;  1XMO Q;  4DR3 Q;  1OXX K;  1KIX A;  1YI2 A;  4GKJ Q;  1N36 L;  4DR2 L;  1EQR A;  1YBY A;  4YCV A;  3I4M G;  3HOX H;  2A8V A;  2IY5 B;  1VQD A;  4J15 A;  4X65 Q;  3TRE A;  5LMN Q;  1K9M C;  3PO3 H;  3STB D;  1OXV A;  1PH8 A;  4LF8 L;  4LF5 Q;  1SN8 A;  3KJO A;  1HZ9 A;  1W3S A;  1XNR Q;  4KLK A;  3PO3 G;  3GTJ H;  2B3G A;  4APV A;  2NN6 G;  1L1O B;  1N34 Q;  5C0X J;  1E3P A;  2KHI A;  2KHJ A;  2UXD L;  1E7Z A;  3HOY H;  1JJ2 A;  3CCU A;  3CC7 A;  2E8G A;  3CW2 C;  3J81 i;  4DV6 L;  4DR4 L;  4DR2 Q;  2Q2T A;  3HOY G;  3PV0 A;  1KL9 A;  3S16 H;  4DR6 L;  2UXB Q;  3L2P A;  4BBR H;  4HIK A;  2VL6 A;  3EBE A;  3F8T A;  5C0X I;  3H15 A;  4A3M H;  3GTM H;  1PH6 A;  1IBL Q;  4UY8 C;  1D8L A;  3B6Y A;  4GN4 B;  3H3V I;  1AE3 A;  4L5S A;  5K36 G;  2EQS A;  1LUZ A;  4DNI A;  5IP7 H;  5BR8 L;  1O7I A;  2HHH L;  1SLJ A;  2PQA B;  3J7Z C;  1PH7 A;  2EIF A;  1BBW A;  2N8N A;  3CC2 A;  3CMA A;  2R7Z H;  3FP9 A;  3HOZ G;  4NXN L;  4B3S Q;  2HT1 A;  1OXS C;  4JI8 Q;  5M5W H;  4C3H H;  4JI6 Q;  3UE0 A;  4DR6 Q;  4HJA A;  2R93 H;  4IPG A;  3PUX A;  2KCT A;  4DAY B;  4A3E H;  2DGY A;  1YNX A;  3MEF A;  4PZ6 A;  3UDI A;  3U4Z A;  3RNU A;  1VQF A;  4AIM A;  1KD1 C;  4JI2 L;  3RZO H;  4BBS G;  2R93 G;  3I4O A;  4JI0 L;  4A3E G;  1WFQ A;  4X64 L;  4LNQ A;  4JI7 L;  1PYS B;  4DV5 L;  2Q2U A;  1JJC B;  3PUZ A;  2JQO A;  1EIF A;  2JA7 H;  4R4O A;  1EYG A;  1UEB A;  5BR8 Q;  3T1Y Q;  1B8A A;  2JA9 A;  2F4V L;  2JA7 G;  4NXN Q;  1KHI A;  3G6E A;  2N78 A;  2WAQ G;  4LFC L;  1VQG A;  1DGS A;  1P8L A;  4UP7 A;  1KRT A;  4JI1 L;  3JC6 6;  3J81 c;  2E5L Q;  2RCN A;  1N9W A;  1YZ6 A;  5LMN W;  2CQO A;  4LUV A;  1Q81 C;  4YY3 L;  2VUM H;  1EQQ A;  1PH2 A;  1K83 H;  5IYD H;  2IT1 A;  4XIG S;  4JI2 Q;  4POF A;  4YCW A;  3UE1 A;  1B7Y B;  2VUM G;  3GTL H;  4ALP A;  1JE5 A;  3HFZ B;  3GO5 A;  4A4I A;  5IYD G;  4YHH L;  1PH9 A;  1HNX L;  5FJ8 H;  4DV1 L;  1HNW Q;  1C7Y A;  5FJ8 G;  2F4V Q;  1H95 A;  3H0G H;  1KQS A;  4LFC Q;  1Q12 A;  2AKW B;  4JI1 Q;  2Z6K A;  2HIV A;  2PMZ E;  3IRB A;  4DV3 Q;  1IL2 A;  2NN6 I;  1E22 A;  1KXL A;  2MFI A;  4AYB G;  2F52 A;  5IT9 c;  3I56 A;  2OCE A;  4NPS A;  2AWN A;  3TQY A;  5IWA L;  3CME A;  1PFS A;  2KBN A;  4LF7 L;  1Y1V H;  4JV5 Q;  4R4T A;  2CWP A;  3AYH B;  2RF4 A;  2JA6 H;  4DV1 Q;  4JI3 L;  4DKA C;  4R4I A;  2ES2 A;  3AQQ A;  3PSI A;  4O0A A;  2JA6 G;  5M3M H;  4B3R L;  2JJQ A;  4A3L G;  4IO9 A;  3BU2 A;  4A75 A;  2ALY B;  4H02 A;  4BXX H;  1QZG A;  1Y14 B;  2IX0 A;  3HKZ G;  3A0J A;  3RLF A;  3CPW A;  4AQY L;  4BY7 H;  1YJN A;  3OYY A;  3GDE A;  1HH2 P;  4UPA A;  4B3M Q;  5DLQ E;  1WYD A;  4BY7 G;  3GTP H;  4OX9 L;  3S1M H;  1GKH A;  2MQH A;  2YYZ A;  3TEH B;  4DV2 Q;  4DR7 Q;  1YJW A;  3AFQ A;  2YTX A;  2LSS A;  4GOP C;  1J5E L;  1MJC A;  1G6P A;  1NJI C;  1IXR A;  1X9N A;  1WOC A;  4PMW A;  3CCR A;  1UE6 A;  1U0L A;  1X3G A;  2EXD A;  2DUD A;  2OQK A;  4GNX B;  2Z6K C;  1ASZ A;  4B3T L;  2LXK A;  3I2Z A;  3M7N A;  4A93 H;  5ELN A;  4P74 A;  1ASY A;  1SR3 A;  4IFD G;  1V9P A;  1XTD A;  3D0F A;  4A93 G;  1UE5 A;  1D7Q A;  5LMU L;  5IP9 H;  4UP8 A;  3G71 A;  4LFA L;  1V43 A;  1TWH H;  4A3C H;  1HNZ Q;  4RG1 A;  4JOI C;  1BKB A;  1AH9 A;  4Y52 H;  2A1A A;  3J80 i;  3KF6 B;  3HOU G;  5IY0 A;  3KLW A;  4DUY L;  1QZH A;  3I4N H;  2R92 H;  3FKI H;  4UP9 A;  4P71 A;  4BA2 I;  4L5T A;  1VQB A;  2BH8 A;  1NBW A;  3PCO B;  3HOX G;  1KAW A;  2A19 A;  3FKI G;  3ER0 A;  4K0K L;  2VQF L;  1XMQ Q;  5C4X H;  4HID A;  3E9H A;  4P75 A;  2OTL A;  2I5H A;  2NZH A;  4BY1 H;  3J81 j;  2E2I H;  3BZC A;  4DR1 L;  3KF8 B;  5C4X G;  1JMC A;  1M90 C;  4GLV B;  4IJL A;  4QQB X;  4L5Q A;  1FGU A;  3I7F A;  4BY1 G;  3ULP A;  1N36 Q;  4A3K H;  4DR5 L;  3UDF A;  3F2D A;  2ZJP A;  2H5X A;  4DUY Q;  3S1N H;  1X65 A;  3CC4 A;  4HJ5 A;  1CKO A;  1EIY B;  1BBU A;  4A3K G;  1OXU A;  3AEV A;  1VQK A;  2N49 A;  1Z9F A;  5J3B A;  1N32 L;  4LF8 Q;  1IBK L;  4IPH A;  2CWA A;  4BBR G;  5M3F H;  2JA8 H;  2UUA L;  4JYA L;  4GKK L;  1J6Q A;  4K0K Q;  1WJJ A;  1X6O A;  1PH5 A;  4A3M G;  1M1K C;  4IOA A;  5AJ3 L;  3S17 H;  1C9O A;  4PZ7 A;  2VQE L;  2UXD Q;  3RLO A;  1Z47 A;  4QY7 A;  2JK8 A;  3ULJ A;  4KHP L;  2K14 A;  4DV6 Q;  1LYL A;  3PGZ A;  5IP7 G;  4DR4 Q;  4DR5 Q;  3BJU A;  2MNA A;  4GNX A;  3J80 c;  2MO0 A;  3PIO A;  3CCM A;  3L7Z C;  1PA6 A;  3K7A H;  3SGI A;  5C4J H;  4HIM A;  1AE2 A;  1K8G A;  4JYA Q;  5JJL A;  1I5F A;  4QJF A;  4OWX B;  3D31 A;  3G4S A;  3UDX A;  4DAM A;  4IFD J;  3CAM A;  4LFB L;  1FL0 A;  3KFU A;  2HHH Q;  1C0A A;  2YU9 H;  2YTV A;  3LGJ A;  1K3R A;  1X3E A;  3KF6 A;  2VW9 A;  4KHP Q;  4DPG A;  2K4K A;  1VCI A;  1I50 H;  1VQH A;  3F2B A;  4IFD I;  4DUZ L;  2NZO A;  3K0X A;  1G29 1;  3K8A A;  3W1G A;  2V1C C;  2WB1 G;  3U58 A;  4JI0 Q;  2IHE A;  4X64 Q;  1L1O A;  1VQ8 A;  1IYJ B;  5HGQ A;  4DV5 Q;  4JI7 Q;  1YHQ A;  2ATW A;  3S14 H;  2JEA I;  4A3D H;  1HR0 L;  4LF9 L;  3M3Y H;  4X62 L;  1GO3 E;  2OQ0 A;  2JEB I;  3HKS A;  4IOC A;  1I94 L;  4PG3 A;  3L0O A;  2ID0 A;  3S24 A;  4QGU A;  2KEN A;  4JG2 A;  5GAG C;  2R7F A;  2YV5 A;  3M4P A;  5GAD C;  5GAE C;  3K80 C;  1P16 A;  1I3Q H;  1HZA A;  4JI5 L;  4A3F H;  4LF6 L;  4QL5 A;  4DK3 C;  1VQM A;  1K8A C;  2GN5 A;  2QGQ A;  4YY3 Q;  2UU9 L;  2BA1 A;  3H0G G;  3CCQ A;  3RN2 A;  3PIP A;  4A3F G;  3GTO H;  2N3S A;  1KC8 C;  1JJG A;  3PO2 H;  3CCE A;  1GD7 A;  1XPU A;  4JI4 L;  4AH6 A;  4YHH Q;  1HNX Q;  2PQA A;  1LTL A;  1I94 Q;  1K73 C;  2ZTE A;  1SMX A;  1YHB A;  4DV7 L;  1Y1V G;  2Q2I A;  1WCM H;  1EOV A;  3NEN A;  1VQ7 A;  4OO1 G;  4X66 L;  5C44 H;  4GLX A;  2WAQ E;  1VQ9 A;  5FLX c;  4DV4 L;  3PF5 A;  1PV4 A;  3CCJ A;  1CUK A;  1HZB A;  1NY4 A;  1WCM G;  4O2D A;  1UE7 A;  4P72 A;  1GM5 A;  4LF6 Q;  3NBH B;  1CSQ A;  5M3M G;  3OTO L;  3A5U A;  2KCM A;  1KRS A;  3CXC A;  4DV0 L;  4HJ9 A;  3T1H L;  1OTC A;  1QVC A;  1NE3 A;  2WB1 E;  3EIV A;  4MNO A;  5IWA Q;  3DLL A;  3RZD H;  2BH2 A;  4BXX G;  3F2C A;  4NXM L;  4X6A H;  1K0R A;  4LF7 Q;  3CD6 A;  5IYC H;  2VY3 A;  1L1O C;  4JI4 Q;  3S1Q H;  3NEL A;  1S72 A;  2I5M X;  3M4O H;  2GVA A;  3S2D H;  3Q8D A;  4JI3 Q;  2BA0 A;  5IYC G;  4DV7 Q;  4HJ7 A;  2NVT H;  5GRO A;  4HJ8 A;  2D62 A;  1VQN A;  1A63 A;  4DV4 Q;  2FXQ A;  4B3R Q;  2RHQ B;  1PH3 A;  2F3I A;  3G48 A;  5M5X H;  3HOV H;  1A0I A;  4JCV E;  1JB7 A;  4YWM A;  1X54 A;  2OTJ A;  4AQY Q;  1CSP A;  4AYB E;  1EUJ A;  4WJ3 M;  3T1H Q;  2R7Z G;  4YWL A;  1FVI A;  2UUC L;  3HOV G;  2JE6 I;  1IZ6 A;  1X3F A;  1TWC H;  5ELO A;  2R7D A;  4NXM Q;  4JBM A;  1XNQ L;  2K50 A;  3CF5 A;  4OX9 Q;  3E9I A;  1PVO A;  3EN2 A;  2ZM6 L;  1YVC A;  5IP9 G;  1XMO L;  3M9B A;  4LWC A;  1J5E Q;  4GKJ L;  3RLN A;  4A3C G;  5JEA J;  1E24 A;  4EQ5 A;  2JA5 H;  4A3J H;  3ZJY C;  4OXP A;  3U50 C;  1L0W A;  4MZ9 A;  1VQE A;  3I4N G;  4B3T Q;  3HKZ E;  2K5V A;  4A3J G;  1SRO A;  2JA5 G;  2R92 G;  4KHZ A;  3ULL A;  1HZC A;  1XNR L;  5JJI A;  2PI2 A;  5HY6 A;  2UUC Q;  1WI5 A;  2PNH A;  2LXJ A;  4NB3 A;  1HR0 W;  5LMU Q;  4LFA Q;  1N34 L;  3M4Q A;  2PI2 E;  3TS0 A;  1PH1 A;  4LW1 A;  3A5Z B;  4TVA B;  5M5Y H;  1VQJ A;  2ZJR A;  1PH4 A;  1Y1W H;  2UXB L;  1BVS A;  4XTC S;  1NTG A;  3K81 C;  2MO1 A;  2XTI A;  3CQZ H;  1VQP A;  2C35 B;  3WWV A;  4GS3 A;  1Y1W G;  4EX5 A;  2VQF Q;  1E1O A;  1IBL L;  2B29 A;  1FJG L;  5M3F G;  2JA8 G;  4OO1 I;  3PUV A;  1VQA A;  1QUQ B;  5E7N A;  1VQL A;  3PF4 A;  4LUZ A;  4DR1 Q;  1Q7Y C;  4GN3 B;  2OWO A;  5GQO A;  4R4C A;  1X55 A;  5FLM H;  4GOP B;  1Q82 C;  4LF4 L;  3W5O A;  4B3S L;  4JI8 L;  1S40 A;  4JI6 L;  2AHO B;  5FLM G;  1IBM L;  1N32 Q;  1RL2 A;  3JAM i;  2ASB A;  4A3G H;  3A74 A;  1IBK Q;  3ICE A;  1S3O A;  3ERS X;  4JBW A;  2UUA Q;  3K7U C;  4GKK Q;  3KDF B;  1PYB A;  2E2H H;  2CFM A;  4A3G G;  3PUW A;  2AWO A;  4IPD A;  4P73 A;  4PZ8 A;  5AJ3 Q;  1FJG Q;  1Q1B A;  2IX1 A;  2ZTD A;  3HOZ H;  2VQE Q;  3M85 A;  3AFP A;  3S1R H;  2NVX H;  1TXY A;  2HQL A;  2K5N A;  4OWW B;  3T1Y L;  1X56 A;  1B70 B;  1GVP A;  1MJE A;  1VQ6 A;  5IE8 A;  1VQC A;  4Y7N H;  2AMC B;  2K52 A;  4LF4 Q;  4A76 A;  4OWT B;  3STB C;  2NVY H;  2E5L L;  2XGT A;  3MXN B;  4BBS H;  2HIX A;  1MKH A;  3GTK H;  1IBM Q;  3VDY A;  3GTQ H;  1YIT A;  1A62 A;  2IHF A;  2R6G A;  4YCU A;  3W1B A;  3KOJ A;  2QEX A;  1T9H A;  4JC0 A;  1YEZ A;  2D0O A;  1EWI A;  1VQI A;  3CCL A;  4LFB Q;  2Q2H A;  2UUB L;  2UXC L;  3S2H H;  3F1Z A;  4MTN A;  3UDG A;  2K75 A;  5JEA G;  2B63 H;  4A3D G;  1HNW L;  4GLA C;  3U4V A;  1XPR A;  1VQ4 A;  2CCZ A;  1YJ9 A;  2B63 G;  4IPC A;  4DUZ Q;  1CKN B;  2I5L X;  4GNX C;  2VNU D;  1TWA H;  1TWG H;  1L2F A;  4DV3 L;  2K5H A;  2I0Q A;  3J7A 5;  5JJK A;  3DM3 A;  3PUY A;  3TS2 A;  1RIP A;  1UE1 A;  4ME3 A;  1VS0 A;  1YIJ A;  3JAM c;  1SFO H;  1QUQ A;  1SE8 A;  1HR0 Q;  4LF9 Q;  2Y0S G;  4X62 Q;  3PO2 G;  4JV5 L;  2NVQ H;  2UUB Q;  2UXC Q;  3CPF A;  1N8R C;  4KI0 A;  1OXT A;  1PHJ A;  3TRZ A;  4GOP A;  2QA4 A;  3E0E A;  4R4Q A;  1NMF A;  3RN5 A;  4WJ4 A;  3CCV A;  2RHS B;  4A3I H;  4JI5 Q;  2WFW A;  5C44 G;  2ZTC A;  5EAY A;  2UU9 Q;  4R1J A;  1G51 A;  3NEM A;  2GVB A;  1XPO A;  4A3I G;  2VS1 A;  3KDF A;  1NMG A;  5H1S E;  1W2B A;  1U5K A;  1N33 L;  1YHA A;  4FDB A;  5C0X G;  4B3M L;  4JBK A;  3OW2 A;  4C2M H;  3BZK A;  1QVG A;  3H3V H;  4JOI A;  4C3J H;  4DV2 L;  4DR7 L;  4L5R C;  1Q46 A;  1E1T A;  5GAH C;  5C3E H;  4X66 Q;  4A3L H;  2L15 A;  2CKZ B;  2D0P A;  2VZA A;  4A3B H;  3I55 A;  3GD7 A;  3HOW H;  5C3E G;  2WP8 J;  4JBJ A;  3GTG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...