5ISRA

Crystal structure of staphylococcal nuclease variant delta+phs l38e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLEVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L38E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5isrA00
2RKSA 1ENCA 1A2UA 1STYA 3OMCA 3RUZA 5CC4A 2PZUA 5IIFA 1A2TA 3NUCA 2PW5A 3T13A 2F0MA 3EVQA 1EY8A 1TR5A 4ZUIA 2F0NA 3SHLA 2EY5A 5I9OA 3HEJA 2KHSA 2NUCA 3OWFA 1STHA 4KY5A 3S9WA 4R8NA 5CV8A 5E3FA 2F0QA 4ZQ3A 4HTHA 2ENBA 4KJNA 2EYPA 4TRDA 4E6IA 1KDAA 1SNOA 1SYFA 2QDBA 4QMGA 4K5XA 2F0OA 4F7XA 3SK5A 2F0LA 2EYLA 4PMBA 4B9WA 1KDBA 2OEOA 3ITPA 3PMFA 3NXWA 4ID6A 4KY6A 4KTAA 4ME5A 3BDCA 1SNPA 5C5MA 4EQPA 5KYLA 4DGZA 3C1FA 5JAVA 2EY6A 3BDLA 2RBMA 3MXPA 5M9OA 5I6YA 1SYCA 3NP8A 4H7BA 4K14A 1SNCA 3P75A 1EY6A 1EYAA 1F2YA 1STNA 2F0JA 1SNQA 4HMIA 4ODGA 1KABA 5IGCA 1EYCA 1II3A 1STAA 1F2ZA 1U9RA 2EYMA 3MEHA 1EZ8A 3OSOA 4KD3A 4PNYA 5CV5A 5CV6A 3TP5A 5J1ZA 5KEEA 5EKLA 1JORA 1NUCA 1EY4A 5C6AA 5E1FA 1KDCA 4IZ8A 4J6HA 2F0TA 4WORA 2F0FA 3SR1A 5IGEA 5F2DA 3OMGA 1SYGA 3SK6A 3V2TA 5KYIA 5IGGA 3E5SA 4K6DA 5CR3A 1NSNS 4NDXA 4IUNA 2EYOA 2F0DA 1EYDA 3NK9A 3VA5A 4S3SA 3H6MA 3P1HA 3HZXA 3D6CA 1A3TA 3NQTA 4NKLA 5C3WA 2F3VA 5NUCA 2F0EA 4N9TA 5CV9A 4IALA 4MIUA 2PZWA 1SYBA 4F8MA 5IOCA 2F0VA 3DHQA 2PQEA 4K5VA 5IGFA 2OF1A 5KIXA 1ENAA 3D4DA 3TP7A 4WRDA 4YIJA 3TP8A 3EROA 4N9PA 4KD4A 5HGTA 2RDFA 4B9XA 2PYKA 4KHVA 2EXZA 3QB3A 3SK4A 3SK8A 5DEHA 2F3WA 4KV6A 1STBA 5JOBA 1JOKA 5IGBA 5DAUA 4NP5A 4RKBA 5CV4A 3LX0A 2EYFA 2LKVA 2O4XA 4NMZA 4PMCA 1SYEA 3TMEA 2SNMA 4DF7A 5C5LA 1TQOA 2PZTA 1RKNA 2F0UA 5IGDA 5K5PA 1STGA 2EY1A 3DMUA 2EYHA 2SOBA 3C1EA 3QOLA 4LAAA 5KRUA 1SNDA 1A3UA 3ERQA 4EQNA 5CGKA 3EJIA 1SNMA 5KGUA 1EY9A 2SNSA 4K5WA 2EY2A 2OXPA 3U9OA 4EVOA 1TT2A 3SXHA 4QB4A 4DFAA 1SYDA 2F0IA 4K8IA 2EYJA 1EQVA 2M00A 4J1MA 3NHHA 5HURA 3R3OA 5C4ZA 2F0PA 3TP6A 3MHBA 3QOJA 5CV7A 2F0GA 5C3XA 3MVVA 4KJOA 5IODA 5C4HA 2F0HA 4KY7A 2F0WA 1JOOA 1A3VA 1F2MA 4RKLA 2PW7A 3D8GA 4I65A 5I9PA 4G57A 5ISRA 5J22A 4OL7A 3T16A 1JOQA 1EY0A 4EQOA 5I6WA 5EGTA 1EY5A 2HQEA 2WACA 4K8JA 4HMJA 4K2KA 2KQ3A 5J39A 1EZ6A 5EKKA 1EY7A 4ZUJA 4DU9A 3D4WA 4QF4A 2F0KA 2F0SA 1KAAA 1IHZA 4K2LA 3MZ5A 1AEXA
chains in the Genus database with same CATH superfamily
1A2UA 3SVMA 1CT1D 2LFNA 5C44H 2F0NA 3PUZA 5A2QE 1L0XB 1JB3A 1EWIA 4R8NA 4QQBX 3WOFA 4Q5VA 1XMQQ 2R61A 5ELOA 5EKIA 4BA2I 1E22A 1U4LA 3M4OH 3QO2A 4NXNL 3SK5A 1RIPA 1Q1EA 3S15H 1UE1A 1UAPA 4A93B 2F4VQ 4A75A 3PSIA 3RMHA 2ALYB 2KBNA 1AZPA 3IAYA 4CKEA 3GTLH 3EQLC 3P75A 1PTOF 1EY6A 2ASBA 2L9HA 1H9JA 1XPRA 2E75C 5KEEA 5EKLA 1EY4A 3OIQA 1TWCB 2F0TA 3BZDB 2OWOA 3L2PA 2Z6BA 3W2DA 5GAHC 2E74C 3I73A 2K1BA 1KL9A 1ILQA 1HA5A 1CQVA 1SE3A 2I5MX 2F3VA 4LF9Q 5ELFA 5I4DA 2XRSD 4MIUA 2PZWA 3TQYA 1YZ6A 4IPHA 1UE5A 3TP7A 4XQQA 1X65A 4JVZA 5JVH3 2AUKA 3A5ZB 4BBRH 3TN2A 2NVYB 2RF4A 3OW2A 3PIOA 3GTQB 2D62A 2CFMA 1XMOL 3MWYW 4XIGS 1LM0A 1NR4A 1STGA 4X64L 3I8ZA 3NEMA 2KJXA 3K8AA 1KNAA 2HIVA 2EQSA 1EU4A 4CDEC 1YNJD 2MHVA 3SXHA 2AQ1B 3K58A 1JJ2A 1MBYA 4DR6L 5KNDA 2WB1E 3HOWG 4ZLTF 1PDQA 2VQFL 4GLAC 1NMGA 3CCUA 1Q3LA 2B2WC 3T16A 4YY3L 4GN4B 4DAMA 1VQPA 3J80i 2WKDA 1CHQD 1D5XC 4PQXA 3V05A 1W2BA 2F0KA 2LXJA 4QCLA 1G291 3DEOA 3HRZC 2PPBC 2PW5A 3ERSX 1IBKQ 1DD2A 4FDBA 3PCOB 2I46A 2HHHQ 4IUTA 4A3KH 2ZXOA 5C0XI 2UU9L 1TS3A 2FMCA 1K73C 3KBGA 4B3MQ 1FYCA 2AHOB 4GNXC 2YU9B 1MSGA 2IJ0A 4PZ7A 3GQBA 1PH3A 1SNOA 1VF7A 1YHBA 3GV6A 3L7ZC 4U673 3SE0A 1XNQL 3PMFA 4ID6A 4P75A 1F2LA 1Q82C 1AP0A 4RAUC 3IL8A 1Y69U 4A3BG 4IUUA 4A3CG 1EQRA 2AQ3B 2KUMA 3FRPB 3NP8A 4X62L 1VQBA 1BBXC 2K33A 2F0JA 2CWAA 2HQLA 5HGQA 2A68C 3OSOA 4ZAIA 4YCVA 3W1BA 2QCPX 4IUVA 2WFWA 1SXTA 1PTOB 5JPNC 5IGGA 1V1PB 2JA5G 1WVLA 4QUFA 1B70B 2UUAQ 4DR4L 2CW0C 1TKWB 3HZXA 1WD0A 3I4NG 4Y7NH 3NQTA 4AQYQ 2UUBQ 2YYZA 1VQDA 2KHIA 2SEBD 2E2IH 1LACA 1SDFA 1CZGA 1NJIC 3PUXA 5CBEE 2MNAA 1JJCB 1NNXA 2Q8TA 3S15B 4C3IB 4UP9A 1TWGB 4DF7A 3KDFB 4KN7C 1RKNA 2B2YC 3IRBA 4FXKC 4HEDA 4HSPA 1V1QA 2VNUD 1SNMA 1EY9A 4K5WA 2JEBI 1Z9FA 4QB4A 5FJ8G 4JI8L 3J7AV 2IX0A 2F0IA 3L0OA 1K0SA 1EQVA 4HAEA 2DN8A 4LUZA 4A3MG 1TWHH 1SFOH 2GVBA 3C2PA 3AQQA 3NSWA 4YHHQ 4DR7Q 5K36G 1RL2A 3CKIB 2Z4HA 5J22A 4RKLA 4IPDA 2HCIA 1JOQA 4IFDG 2J4XA 1EWHA 5C0XG 2YTYA 1EWCA 1TY2A 4GNXA 3CRKC 4LF8L 4N8FA 2EVBA 3J7YW 1N9WA 1BOSA 1P16A 4JI4Q 1EY8A 1MGSA 4LFCL 4IFDJ 3M7NA 4BY7G 2BDNA 4JI1L 1ICFB 3R2IA 1LTTD 5E3FA 4BS9A 4DV5L 2LMCB 1B9NA 1CKNB 1ET6A 2E5LQ 3CCRA 1EQQA 2L15A 4GLXA 3Q23A 2B2UC 1MJEA 2QEXA 4YWMA 4KY6A 1BVSA 4H0LC 4KTAA 4RCOA 2KOLA 5KYLA 1HTPA 1N34Q 5AJ3L 4UP8A 1KHIA 1QZHA 3Q8DA 5I6YA 1XMQL 2NVTB 1K8OA 3L3OC 1GOZA 2NWGA 5FLMH 5IE8A 1CK1A 5M5WH 1SNQA 2MP1A 4KHZA 4NXNQ 1Y1WG 3BYTB 1GHKA 2R7ZG 4J6HA 4WORA 3CCVA 1NTGA 3HG9A 1M1KC 3KDFA 2SDFA 2KCMA 4AYBE 4R8IA 3DWQA 2PMZE 4RGOS 5AFWA 3KJPA 3MFYA 2F0DA 2C9OA 4FP5D 1BCPD 1SE4A 3AU7A 5BN5A 3H6MA 1OXVA 2H4OA 1MI2A 3BJUA 5IT9c 4NKLA 2D9UA 3AFPA 4DNIA 3CP0A 3B6YA 1MJCA 2A6EC 1GHJA 4FNFA 2BA0A 5G3LD 4APVA 5FO9B 2K14A 1PRTB 1EEID 4ZKCB 1H95A 4GKKQ 2R3ZA 1DOKA 2HCCA 1X56A 3MXUA 4OONA 3Q22A 1E1OA 1SYEA 2QDLA 3IFDA 2JE6I 1PYBA 3MXGA 2EOTA 1RJTA 4AYBG 1L0WA 2X6LA 3D31A 2KEDA 1YNNC 1LLRD 2SNSA 1HFGA 4UY8C 1I4PA 1QNKA 1LT6D 2LSSA 4A3DB 4JBMA 4J1MA 4X3KA 1KRTA 4F88A 2QKIC 3QOJA 2KEEA 4KJOA 2WB1B 1N32L 1PVOA 3I4NB 2IT1A 2QILA 4OL7A 2JEAI 2ICEC 1EY0A 5I6WA 2ZJQA 2A1AA 4DV2L 1IHZA 2JK8A 2RSOA 3MXNB 1KAWA 2DUDA 2E2JB 3NUCA 3FKIB 1HUMA 1AE2A 1KXLA 2LY7A 2ES2A 1HTLD 1VQ7A 1FJGQ 2R92H 2EYPA 3QIAA 3PIPA 4KMUC 4QMGA 1BQQT 2QDBA 1FGUA 1O80A 4GOPA 3ONAB 2EYLA 4JBWA 1B8AA 4OHJA 2HHHL 1SNPA 4FXDA 4DGZA 1UE7A 4LJZC 2GA4B 3JAMc 3CHBD 2XVSA 3FHWA 4C2MB 1HXYD 4IQZA 1SE8A 5FLXE 5F2DA 3SDZA 5LMNW 5FOBB 3GD7A 3VYSA 1BCPF 3E5SA 1NSNS 3GTJB 1X3QA 1WTOA 5FJ8H 3HS0C 1QCBD 3PQIA 1JT8A 4DR3L 5JVG3 1JWUD 4BBRG 1SMXA 1TIID 1BUVT 3U4VA 5M5WB 4YIJA 2N49A 3TP8A 4DV1L 5E7NA 1ET9A 4KN4C 2WINB 3BZKA 3WOEA 2GVAA 3N6RA 2NN6G 2Z1CA 2LXKA 2QA4A 3GTLB 4CJ0B 1TQOA 5DM63 3S1RH 2UUBL 1IBLQ 5A35A 2H1EA 1YI2A 1G2SA 2Y0SB 3EJIA 4RGTA 5EPKA 1MIUA 1F9QA 2IX3A 3K81C 3DUZA 4DA2A 2QF7A 1S3OA 4BBSB 2KCNA 4QJFA 1RCVD 1JC7A 4R4CA 2KCCA 5C3EG 4DUZL 2B2UA 4RCNA 3PIO3 1CTMA 1VQ9A 1PH2A 1WTVA 1WTRA 3HOWB 4K8JA 3CCEA 1R9TH 1ZKOA 4BY1B 1TR5A 3I55A 4C2MH 3DXJC 3M9BA 1RD9D 4HIMA 4HTHA 1WTPA 1VQEA 5EBCA 4E6IA 3NWSA 4YCUA 4K5XA 1HUNA 2R92G 1VF5C 1BCPC 3BDCA 3CPFA 4BA1I 2PNHA 1GVPA 3HOUG 4ZRZA 4DV5Q 1SYCA 3I70A 3J81j 2E5LL 3NWTA 2IY5B 4DR5Q 5IP7G 1EYCA 4A3GB 4G7ZC 1T5EA 3GO5A 3UDIA 5JPMC 4ZK9B 1CSQA 4ILWA 5IYBG 4A3JH 4KLKA 5KYIA 4A3IB 1XX8A 1VQ8A 3KF8A 2M2LA 1S5CD 1EYDA 3P1HA 3KF6A 1BO0A 2Q2HA 1Q12A 4C1NK 4JBKA 4DNRB 1UWVA 4RWSC 1I4RA 4DK1A 1E7ZA 3I7FA 1XTCD 4IN3A 3D3RA 3VA7A 1STBA 3U9SA 2HIXA 2R93G 4PMCA 1MKHA 1QVGA 3S1NB 2CWPA 2VUMH 1JR0D 2KENA 2SOBA 4JI5Q 1B1ZA 3FEWX 4KI0A 2JA5B 3LWUA 5CGKA 4QY7A 4POGA 4LF6Q 2ATWA 3KLWA 4CKCA 1SYDA 5JEAG 2EJFC 2M00A 2JA6G 1F77A 1EFID 4XT1B 5C4HA 4C3JG 4EX5A 2G5DA 3CAMA 4JI0L 2CCZA 1F2MA 3D8GA 3TDQA 1LTSD 1YBYA 1OXTA 1VQAA 4O42A 2K5HA 3M4PA 4KKTA 1XPUA 3D4WA 5C4JB 2JN4A 2NUCA 4R4IA 4K2LA 3M3YH 3OMCA 3RUZA 1EUJA 5M3MH 4DR1Q 3HOUH 3T13A 4DPGA 3TS2A 1C7YA 1NE3A 3M7GA 1ESFA 1ICWA 2NVTH 3KFUA 1GUNA 2XWBB 2OTLA 4OEMB 1BDOA 2WKCA 2XN9C 4POFA 2CHBD 1QNUA 1HR0W 1D6EC 2OCEA 3KF8B 1HNXL 1E2VA 4N8X1 4AH6A 3TBIB 2K01A 1PFNA 5IGCA 2EYMA 4X64Q 4IUPA 1K0RA 4QL5A 2K32A 5JJIA 1IYUA 4QUCA 1T5XD 2B2TA 1MSHA 3MFGA 5IGEA 2MPMA 3OMGA 2B8GA 2JYOA 1WTQA 4DR6Q 2VQFQ 5EPJA 4GS3A 4NPSA 5FLMG 1SJED 1VMCA 2NN6I 1KLUD 3EFXD 3J81L 5I2YA 4X65Q 1ENAA 5LMNQ 1Y8NB 2JXMB 4JI6L 2PYKA 4B3SQ 5T1GA 5ELCA 4LUOA 3HOVH 4ME3A 2DJFC 4IJHA 3NE5B 1GUOA 2XGTA 1H9SA 2M9VA 2WAQG 3K0XA 3QOLA 4JYAQ 2E2HB 4EQNA 2RDHA 4DV1Q 1VMPA 4EVOA 1J5EQ 2Q8IB 1WD1A 3C3LA 2AUJD 2NVXB 2FMMA 1RF2D 1A6XA 3UI2A 3GTMB 3RR5A 3HKSA 2RVLA 1HR0L 3OHXC 3ICEA 4MNOA 4X62Q 3HOZB 2FXQA 3PIP3 4DV6L 1V8QA 1U0LA 2WACA 4Y7NB 3S2DB 3I3CA 4XTCS 4QGUA 4B3RL 4OO1I 1WFQA 3HP3A 3AYHB 2K6AA 4QIWB 4X66L 5IP7H 4JV5Q 5EPLA 1HNZQ 2ZTEA 2DY7A 2UUAL 4KKUA 4P2CB 4DR4Q 1STHA 4HJ5A 3Q24A 5DLQE 3JAML 1GO3E 4OO1G 5CORA 2LS01 4M1UB 1I3QB 5GADC 4FF3A 4HCSA 5IP9G 1CZWA 1G91A 3MXNA 1UEAB 1K8AC 1J9OA 1FR3A 1KLGD 4DV3Q 2B2WA 1W6JA 4GLVB 1UEBA 4DK6C 1E3PA 1YVCA 3H94A 1WCMH 2IL8A 2PQAB 2NYZD 4ABNA 4GOPB 3TP5A 5CV6A 2L11A 3AB9A 3M85A 3Q6SA 1U4RA 1HFNA 2F1MA 4IPGA 3T56B 1O7LA 2EIFA 3BU2A 3GP7A 1FNWA 2ZTDA 3HKZE 3S14H 2WAQB 5L37A 2EPBA 4DR7L 3NK9A 4O2DA 4S3SA 2BE5C 4B3TQ 2PQAA 1A3TA 1LTGD 2I5LX 5C4JH 2F0EA 3OIPA 2CKZB 1K8MA 1E2ZA 3G6EA 2HT1A 4LF8Q 3EROA 2K4KA 2ID0A 3BZCA 4B08A 4RKBA 4LFCQ 3HOYH 2EJGC 2A73B 2B2VC 4C3IH 1K3BC 4JI1Q 2JQOA 3HOXB 3S2HB 4PG3A 4IFDH 3DMUA 3C1EA 4A93G 5FKAC 1A3UA 3H3VH 4LK1C 2VXWA 1VDZA 4DAYA 2K03A 4DFAA 3I4MG 1AN8A 5M3MB 1L0YB 4CDFC 4IJLA 1I50H 3TP6A 1X3GA 3SEBA 5CV7A 1VQJA 5TSSA 4FF2A 2WV6D 4I65A 5LMUL 2E2DC 5I9PA 1FL0A 4LFAQ 1DM0B 2Q2TA 2HQEA 3NENA 1G8ZD 4LF6L 3TREA 4DAYB 1FVIA 5DNFA 2Z6KC 3K59A 1LT3D 2KQ3A 1I6HH 2R93H 1JE4A 1RHPA 1N33L 1FNUA 3I4MB 4HIDA 3T1YQ 4JI0Q 1R9TB 2RHQB 4O0AA 3PO3G 4KY5A 2NZ1D 3X3NA 3VDYA 3MTSA 4L63B 4KK7A 1Y1VB 2C5CA 3IKJA 1VQLA 2IW3A 1XTDA 1LABA 2HDLA 4PMBA 1C8CA 2JA9A 2Z6KA 3C1FA 2NVYH 1X3PA 2EY6A 3BDLA 1Y1VG 1VQHA 5JJLA 2RBMA 1EL0A 1O78A 4DK3C 4H7BA 3S1NH 4ZCKA 1STNA 4TVAB 4R1JA 5BR8Q 2A6ED 2A69D 3OWEB 4KD3A 3T53B 3N52A 2Z0SA 4L5RC 1KDCA 3NTHA 2XNAC 3V2TA 1Q7YC 4YWKA 2TSSA 1CSPA 4RMFA 4YWLA 1DONA 5HY6A 3UDXA 3I4OA 3K5LA 3ULPA 1N32Q 1C4QA 4L5QA 5C3WA 5NUCA 1EFWA 4A3DH 2DNCA 1QVCA 3OOCA 2B63G 3W5OA 3V96A 1IL2A 4X3SA 1O7IA 1WYDA 2RDGA 3D4DA 4NXMQ 4DV2Q 1I5FA 2BA1A 2RDFA 4KHVA 1M90C 4QIWE 1CHPD 2F3WA 2R7FA 3AFQA 5IGBA 1DJRD 3J81c 5DAUA 3DLLA 3P7JA 4IFDI 2LKVA 2QGQA 2SNMA 1SLJA 2K50A 2PCFB 3LWEA 3VR6A 4X65L 3OTOQ 1JWMD 3BVMA 3U9OA 4JI6Q 4B3SL 2G9DA 4EQ5A 2Y0SG 1S40A 1MHWC 4HCEA 5M3FB 3R3OA 3OW7A 2X6GA 3GV3A 4A3BH 1PMRA 1SAPA 4HJ9A 1CKOA 1EOTA 1AZQA 2J0TD 1SBBB 2YTVA 1G51A 1L1OB 1J5EL 1JWSD 1EIHA 1GXDC 2MO1A 1EY7A 1HZCA 4ZUJA 4DV0Q 3EN2A 2RKSA 1ENCA 4A3KG 1HR0Q 2FHTA 2AWNA 4I7ZC 3OPOA 3CCLA 2JSOA 4DV6Q 2C35B 2P5ZX 3ZJYC 3P20A 1DGSA 3GDEA 1D8LA 4DV4L 1D2BA 3CQZH 3ITPA 4X66Q 2CH4A 4OWTB 2BE5D 4L8JA 3URYA 5JAVA 4GNXB 1BCPB 1PLFA 1AE3A 2BH2A 2AKWB 4OWXB 2D5DA 1VQ6A 1TY0A 1IBLL 1A8VA 1II3A 1K83B 1U9RA 1PV4A 1BBUA 1UNSA 5J1ZA 1VQOA 2R7DA 2X69A 3A8KE 4A76A 1SRUA 1SEBD 3IFTA 5KNCA 3J80c 3BYYB 4NDXA 1PTOH 5IP9H 4C3HB 3CF5A 3I4MH 4H44C 2I07B 5K36H 2ZJPA 2E2JH 2DJGC 1SFOB 1BR9A 4CBVA 2DGYA 1S72A 3RZDB 2YTXA 4UHVA 4XQJA 1FD7D 2F52A 3VYUA 1GUTA 5HGTA 4B9XA 3TZDA 2K5VA 3JC66 5DEHA 1AW7A 1V43A 1N36Q 1Y1WH 4OX9L 2Z8LA 3PUVA 3CPWA 2ZJRA 1QVFA 3TZUA 1EQTA 3T1HL 4BWGB 1WI5A 4A3MB 5KGUA 4A3KB 2O5IC 4OXPA 1F9PA 1GUGA 1Q8KA 1TS4A 1X55A 2EYJA 4IURA 1Y1WB 3F1ZA 3STBD 2L12A 3MVVA 4DNTB 3HOZG 2CH4W 4LFBQ 3NPPA 2O2LD 4HIKA 4BY1G 1STEA 4DR5L 3FMCA 3KBXA 5CYUA 3RN5A 1CA5A 1XWEA 4K2KA 3DM3A 5J39A 1FNVA 4J15A 2VQEQ 1KIXA 1YEZA 1KAAA 4NW2A 4EQPA 3PUWA 2JA7H 2NBFA 4HJAA 1G6ZA 1ESRA 1J8IA 4C3HH 2BCOA 3A54A 1TVXA 5LMUQ 3SHLA 4LFAL 2KHJA 3HEJA 4A3CH 2NVQB 2V4DA 3MEFA 1SJHD 2Z4IA 4A3EH 1HQMC 1LYLA 2HD3A 4ZQ3A 3H91A 1WTWA 2EXDA 2XTIA 3PGZA 3S16H 1LT5D 4IOAA 2EJMA 1ML0D 4TRDA 1A0IA 2L4NA 4HR7B 4WJ3M 1AFPA 5E4XA 5LL6X 4B9WA 1KDBA 4ULLA 1PZJD 3H0GB 1IYVA 1QB5D 4X3UA 5ELBA 1ENFA 1IKMA 1EIYB 1X32A 4K14A 3CMEA 1F2YA 4V190 3FDTA 3KF6B 1KABA 3GTPB 1TWGH 1TWAB 4JI5L 1PH9A 3KK7A 2UUCQ 1JICA 3TS0A 3R93A 1D7QA 4BXXH 4R4OA 4LF4L 3CMAA 1L1OC 2CQAA 2OQ0A 2PNRC 4TSSA 4DR2Q 5BR8L 4FXGC 4OGQC 1IW7D 2BDOA 4M8AA 3JAME 3Q0AA 1H9SB 5IOCA 2F0VA 5IGFA 5FLXL 2XIWA 5CBAE 1K8GA 1VQNA 5JJKA 4A93H 4DR1L 2JA8H 1Y8PB 4Z9CB 2UXDL 4NP5A 2V1CC 2NVXH 1BXTA 4A3FH 2AMCB 2F0UA 3K7UC 5K5PA 1A63A 3VR5A 3E0EA 1K9MC 4NXML 4RH6A 1WOCA 4RGNA 1D5MC 3S1RB 1GM5A 4ALPA 4A3LH 3H0GH 5D65A 2K28A 4G4KA 4RG1A 5HURA 2B63H 1I4HA 1PYWD 1HNXQ 3S16B 1XYIA 3S14B 1A3VA 4JI7Q 4DKAC 1L2FA 3UDGA 5ISRA 4GN3B 5EGTA 4H13C 1CKNA 2N55A 3K7AH 5T1IA 1C48A 4NB3A 4OO1H 4QF4A 4A3IG 4XT3B 1AEXA 1IKLA 2B63B 1W6KA 5IWAQ 4XYQA 3VYRA 1VQGA 1TWFB 2B2YA 1OXSC 3F2BA 3W3AA 2N88A 1PTOD 2F0QA 4F87A 1QUQA 1TWHB 4KJNA 2D0OA 1ASZA 1FGBD 1KDAA 1V1PA 4F7XA 1RODA 1YJWA 5LMNL 2RHSB 4XDXA 3D0FA 4A3MH 1ZEQX 1YHQA 2VB2X 3AMUA 1EOVA 5IYCH 2F3IA 2CQOA 2MO0A 1ZYRC 4FVMA 3PO3H 1YJNA 4JG2A 1U4MA 1ONLA 3T51B 3CCSA 4DV4Q 2OTJA 1HQRD 3BVGA 1STAA 4JYAL 4PNYA 3PO2B 2JA6B 5C6AA 1LTLA 1PH8A 3HKZG 2F0FA 3HKZB 3SR1A 1RTOA 2Q2UA 1SYGA 3SK6A 1UE6A 4CHTB 2ZXRA 2L1BA 3VA5A 1HA6A 2WIIB 1SE2A 3HOYG 2WAQE 3GTPH 1NMFA 4C3IG 2NB0A 3GTJH 3GTGH 5C4XH 5J3BA 1HCZA 4F8MA 2VW9A 3I4NH 4WRDA 3CXCA 3STBC 4B3RQ 1RTNA 4JPBW 2ZM6L 4KV6A 5JOBA 3R8BA 1JOKA 1QG7A 3KYHC 4JV5L 1HNZL 3K0YA 3H3VI 1GUWA 2JA7G 5IYCG 3R2TA 1I4QA 1SNDA 1LV9A 4OIJA 3DEPA 2N78A 5D3DA 2VUMB 1CI3M 5IT9L 2E76C 5M5YB 1TT2A 1PH7A 3U50C 2VY3A 3NHHA 1WJJA 1G6PA 1H9MA 3CCMA 4DK0A 4DV3L 4A3EB 3GTQH 4KHPL 2O5JC 2NVQH 4BBRB 4WJWA 2F0WA 1IBML 4GZYC 1VQ4A 3PV0A 1J6QA 2PW7A 1D1KA 3FP9A 1XJVA 4G57A 1TWFH 2PI2A 1NBWA 3SGIA 1X9NA 1EZ6A 3RZDH 1PYSB 3K5NA 1STYA 4PMWA 4R4TA 2XWJB 1QJOA 2XRQD 4LFBL 1KD1C 3G7LA 2A8VA 2KHSA 3DM1A 4LF5Q 2JA6H 5CV8A 1YJ9A 3J81i 4B3TL 2VQEL 1PA6A 3KOJA 5I2XA 1KRSA 3RN2A 5EQ0A 4JBJA 4RHSA 1VQ5A 1C0AA 2UXCL 5M5YH 3GTKH 3PO2G 1IZ6A 2CW0D 2FFKB 4MZ9A 2I0QA 4EGVA 1HZBA 1S5DD 1SMYC 4DV7L 5M5XB 1SNCA 1E1TA 1IL8A 4HN7A 3MEHA 1F2ZA 1DXMA 1EZ8A 2JA8G 3I4LA 4CJ2C 5C3EH 3S2DH 1BNZA 2E2IB 3A0JA 3HOWH 3WWVA 4A3LG 4BY7H 2K5QA 2EYOA 1Y14B 3GTOB 3HOZH 4P73A 3CC4A 4AIMA 2FINB 4CJ1B 1K28A 4JCVE 1O7ZA 2EZVA 4N9TA 2MUYA 1AH9A 3M4QA 3RD4A 4RFBA 4LW1A 4LF4Q 1JQYD 3C46A 1TWCH 3CC2A 4IUQA 4C1NI 1N33Q 2F4VL 1B44D 2IHEA 3KUPA 3T1YL 4DR2L 4PV1C 1PFSA 1R4QB 2EYFA 5KRUA 3KLSX 3NBHB 3NQIA 5EBDA 1R4PB 4JW0A 3HOXG 4A3EG 2L0CA 1SSOA 1DOMA 3RZOH 1Q86C 2HDMA 3J81E 1TXYA 2EY2A 2OXPA 2BH8A 4P74A 3WDNA 1B2TA 2UXDQ 1HJPA 5C4ZA 2XSCA 1Q46A 3PF4A 3MHBA 2F0GA 5C3XA 3VYTA 5ELNA 2F0HA 4K6LA 3A5UA 2B2TC 3GTOH 5ELEA 1RDPD 3PO2H 1EY5A 3ND8A 3E9IA 1B50A 5IYBH 3E0JA 2UXBL 1LTID 2F0SA 3MZ5A 5CC4A 4A4IA 3S24A 1XNRL 2F0MA 1JB7A 5IYDH 1KC8C 1XMOQ 1TS2A 2PI2E 4GKJQ 4C3JH 4IO9A 4C56C 5M5XH 4GOPC 2WP8J 2ENBA 2MQHA 1Z6HA 2F4IA 2F0OA 3UDFA 4DUYL 4DAPA 3I2ZA 3A74A 2OEOA 4ME5A 1M8AA 2MGSA 4GN5A 5C5MA 1LUZA 5H1SE 3LNNA 5C44G 4FF1A 4J8QA 1B3AA 1X54A 3F8TA 4RGMA 5BN3A 2BOSA 3H15A 2QEJC 1OO9B 1HNWQ 2N8NA 4DXGA 3KLRA 2B8FA 5JEAH 3OTOL 1HPCA 2Q8RE 5E1FA 2A69C 1LO5D 2ZTCA 3HGBA 1XPOA 3D4RA 4FF4A 3FKIH 3CC7A 3M4YA 3G71A 1IBKL 4JOIA 3JAMi 3A55A 5C0XJ 5EJWA 4AYBB 2L5TA 3TRZA 1X3FA 1B9MA 2AWOA 4H02A 2UU9Q 1A15A 4KKSA 2PMZB 2EDGA 4X3TA 5BN4A 4G7HC 1LTAD 1Q8IA 3D6CA 4IALA 1S5BD 3A7AB 3J7AF 1I6HB 1B4OA 2A68D 4FO2A 3ULLA 1M4VA 3U58A 1X6OA 1H9KA 3D6WA 1JMCA 3FPUB 2DNEA 4DV0L 4A3FG 3H3VC 3NBIA 2ICIA 3H09A 4O1NA 5CV4A 1WCMB 1F9SA 2R7ZH 2NTSA 2PZTA 1DCZA 1Q90A 2EY1A 2EYHA 2Q2IA 1JJGA 3BVZA 4P71A 3G48A 2R92B 4V0BA 1Q81C 2YU9H 2OQKA 3KLSA 1HH2P 1X3EA 2MJ8A 2R7ZB 1KTKA 1LTBD 1Q1BA 4LUVA 3X3MA 3TSSA 1VQKA 4OWWB 2A6HC 2R93B 2KA7A 3DWAA 4YCWA 5JJZA 1VCIA 2H5XA 4AQYL 4OELB 3A8JE 2WB1G 5C3EB 2A5HA 1SR3A 5FK9C 3J7ZC 1IXRA 1JE5A 4A3JB 3MAQA 4K0KL 1E0BA 1QE6A 5GROA 3FVQA 3RLOA 2RSNA 3QR8A 1WTXA 4HIOA 1E24A 2RCNA 1I94Q 2HUGA 3OWFA 3CD6A 1DZ1A 4BBSG 3K57A 3FPPA 2K5WA 1K83H 2G9HD 2B39A 1YHAA 2KCTA 1SYFA 1K3RA 3E3XA 3NXWA 3S1MB 1QWYA 4I7AA 1SN8A 5GAGC 4LF5L 2VB3X 5M9OA 3PF5A 1N36L 1YNXA 4OX9Q 3K5MA 1LTRD 4UPAA 3HOUB 5JEAJ 4IOCA 4ODGA 4HMIA 2UXCQ 3T1HQ 2B29A 1CUKA 3H0GG 2Z9HA 4BY1H 5IY0A 1NUCA 4U68A 1PH5A 4IZ8A 1D1IA 3DWPA 1PFMA 4DV7Q 4JI4L 3BS1A 2IWHA 4IUNA 4MTNA 3FKIG 2KECA 3J80E 2A19A 3A56A 1GKHA 1SYBA 3DHQA 1NR2A 1U5KA 3E6ZX 4R4QA 4TKOB 3G6JB 4KD4A 1N34L 3AEVA 5AJ3Q 2EXZA 2K7VA 3QB3A 3SK4A 4RA8A 1H9RA 1B53A 1CFMA 2N3SA 4LF7L 4CDDC 2O4XA 4NMZA 3TMEA 3CQZB 4IPCA 3A8IE 5FO7B 5ELDA 1XXGA 1KNEA 3UE1A 1VQCA 2E2HH 1T9HA 4Y52H 3S1QH 3NTIA 4JI2Q 1D5ZC 1I3QH 4JI3Q 5COYA 3QG1A 2JA8B 1OXXK 4WFN3 1B7YB 4CDCC 5IODA 4DAVA 1IYJB 5A2QL 2AQ2B 1ASYA 1BBWA 1Z7TA 2ZXPA 1QILA 1VQMA 1IW7C 1PH4A 3NELA 2UUCL 3MC0B 1A62A 3S17H 2B2VA 2KVMA 4GKKL 2D0PA 3KJOA 2PZUA 3I56A 1CA6A 3G4SA 3MA2B 1I6VC 2GN5A 1PH1A 2EY5A 1PFBA 5C4XG 2YV5A 4JC0A 5GQOA 1TU2B 4C3HG 2R6GA 1PRTD 1TWAH 2UXBQ 3CCQA 1MD2D 1HZ9A 1LT4D 2F0LA 3S1QB 5LHY1 4A3FB 1XNRQ 4WJ4A 1S5FD 3HOVB 1L1OA 4L5SA 2NZOA 4GKJL 5D3IB 1S5ED 3NTKA 2EE1A 4LNQA 1E2WA 4HSVA 1EYAA 4PZ6A 4FYDA 1QUQB 3GTKB 2JP1A 5IYDG 4DUYQ 2VS1A 5CV5A 2ZT9C 1PXUA 5G3LF 2B3GA 2K52A 1BF4A 3EIVA 4LF9L 5IT9E 3K7AB 4PZ8A 3K6OA 5FO8B 4HJ8A 3RNUA 5CR3A 2RCFA 1G2TA 1KQSA 2JA7B 1NCVA 2NTTA 1SMYD 3F2CA 1HNWL 1WCMG 1PH6A 1PZKD 2FJ2A 3E9HA 4JI7L 4BBSH 2JJQA 1FJGL 5CV9A 5GAEC 2PQEA 1PTOC 4K5VA 2J7ZA 3BG3A 3A7LA 5DM73 5KIXA 5FLXc 4X6AH 4XYOA 2NN6H 2OT2A 1W3SA 1I4XA 1SROA 3CW2C 3ER0A 1NAPA 4XQNA 5IWAL 1EIGA 1VQFA 1ILPA 3W1GA 3CCJA 3HOVG 3ERQA 4A3DG 1DYQA 4YY3Q 1GD7A 3UE0A 1VQIA 4K8IA 1OTCA 1Y1VH 1B3QA 4OIKA 5LL6S 4MN3A 3M3YB 5C4XB 3CU7A 3ULJA 2I5HA 3NBHA 4BY7B 2D2CC 4LMQD 4DR3Q 1YIJA 4MHEA 1S4ZA 4C3JB 1VS0A 4B3ML 1GJXA 2K75A 2F03A 3EBEA 5EKKA 1N8RC 2QW7A 5IIFA 1A2TA 1BKBA 3PUYA 2VUMG 1XNQQ 5C0XH 2MFIA 4L6TB 3EVQA 1YNJC 1UUPA 1EYGA 4BXXG 4ZUIA 4HJ7A 4G7OC 1ZYRD 4JK1C 4DN4M 1PRTF 2NZHA 3QJYA 5I9OA 4A3IH 3PO3B 1YITA 3S9WA 3HFZB 2JA5H 3F2DA 1NY4A 1I50B 1OXUA 3VR2A 3RLNA 3RLFA 1PZID 4K0KQ 3OYYA 3GTMH 1F9RA 1V1OA 2DY8A 1I4GA 4R9WA 1I94L 5D14A 2ZM6Q 1HRJA 2VZAA 1GUSA 4DUZQ 3MXPA 3BDOA 4RHRA 3HOXH 4MTKA 1EU3A 4P72A 2IX1A 3S2HH 1WTHA 3O13A 3HOYB 2IHFA 4UP7A 4DXFA 3RZOB 4UAIA 3GTGB 5C44B 1P8LA 2PO4A 4L5TA 5M3MG 3QWNA 1JORA 4CKBA 2L55A 1CM9A 3I72A 4A3GG 1EEFD 3K5OA 1HHVA 3ND9A 2TMPA 3EA6A 4KHPQ 1JCKB 3S17B 4ZKBB 1Z47A 2RQXA 2A74C 1IBMQ 1EIFA 1YNND 3I91A 4A3BB 5M3FH 3LGJA 2OF1A 3T4AC 2E8GA 4Q0FA 3VR3A 4N9PA 1C9OA 3CRLC 2RA4A 2K05A 3SK8A 4A3GH 3TEHB 4JI8Q 1O7YA 1QOHA 2VL6A 5EAYA 3LX0A 5C5LA 4YHHL 5IGDA 1U4PA 1V9PA 2CVRA 4LAAA 1QZGA 1CKMA 2K04A 5M3FG 3J80L 5E4WC 3M4OB 4JOIC 2K5NA 1CQFA 1TS5A 4CGYB 3F2UA 4TQUS 1DOLA 1ZXTA 5CMDA 2Y0SE 3I90A 5KNBA 3S1MH 4LF7Q 2F0PA 3J7A5 2A6HD 1PRTC 3VR4A 3L9AX 4KY7A 1JOOA 2IPKD 3K80C 2K5DA 3U4ZA 4EQOA 1HZAA 4HMJA 4JI2L 3ZYYX 4XXEA 4A3JG 4JI3L 4DU9A 1PHJA 4K6DA 4ZYSA 4LWCA 1Y8OB 4UDUC
chains in the Genus database with same CATH topology
1A2UA 3SVMA 1CT1D 2LFNA 2F0NA 3PUZA 5A2QE 1L0XB 1JB3A 4R8NA 3WOFA 4Q5VA 2R61A 5EKIA 4BA2I 1U4LA 3QO2A 3SK5A 1Q1EA 1UAPA 4A93B 3RMHA 1AZPA 3IAYA 4CKEA 3EQLC 3P75A 1PTOF 1EY6A 2L9HA 1H9JA 2E75C 5KEEA 5EKLA 1EY4A 3OIQA 1TWCB 2F0TA 3BZDB 3W2DA 2E74C 3I73A 2K1BA 1ILQA 1HA5A 1CQVA 1SE3A 2F3VA 5ELFA 5I4DA 2XRSD 4MIUA 2PZWA 3TP7A 4XQQA 5JVH3 2AUKA 3TN2A 2NVYB 3GTQB 2D62A 3MWYW 4XIGS 1NR4A 1STGA 3I8ZA 2KJXA 1KNAA 1EU4A 1YNJD 2MHVA 3SXHA 2AQ1B 3K58A 1MBYA 5KNDA 4ZLTF 1PDQA 1Q3LA 2B2WC 3T16A 2WKDA 1CHQD 1D5XC 4PQXA 3V05A 2F0KA 4QCLA 1G291 3DEOA 3HRZC 2PPBC 2PW5A 1DD2A 2I46A 4IUTA 2ZXOA 5C0XI 1TS3A 2FMCA 2YU9B 3KBGA 1FYCA 1MSGA 2IJ0A 3GQBA 1SNOA 1VF7A 3GV6A 3L7ZC 4U673 3SE0A 3PMFA 4ID6A 1F2LA 1AP0A 4RAUC 3IL8A 1Y69U 4IUUA 2AQ3B 2KUMA 3FRPB 3NP8A 1BBXC 2K33A 2F0JA 2A68C 3OSOA 4ZAIA 2QCPX 4IUVA 1SXTA 1PTOB 5JPNC 5IGGA 1V1PB 1WVLA 4QUFA 2CW0C 1TKWB 3HZXA 1WD0A 3NQTA 2YYZA 2SEBD 1LACA 1SDFA 1CZGA 3PUXA 5CBEE 3S15B 2Q8TA 4C3IB 1TWGB 4DF7A 4KN7C 1RKNA 2B2YC 4HEDA 4FXKC 4HSPA 2VNUD 1SNMA 1EY9A 4K5WA 2JEBI 4QB4A 3J7AV 2IX0A 2F0IA 1EQVA 4HAEA 2DN8A 3C2PA 3NSWA 5K36G 3CKIB 2Z4HA 5J22A 4RKLA 2HCIA 1JOQA 4IFDG 2J4XA 1EWHA 5C0XG 1EWCA 1TY2A 3CRKC 2EVBA 3J7YW 1BOSA 1EY8A 1MGSA 4IFDJ 3M7NA 2BDNA 3R2IA 1LTTD 5E3FA 4BS9A 2LMCB 1B9NA 1ET6A 3Q23A 2B2UC 4KY6A 4H0LC 4KTAA 4RCOA 2KOLA 5KYLA 1HTPA 5I6YA 2NVTB 1K8OA 3L3OC 1GOZA 2NWGA 1CK1A 1SNQA 2MP1A 4KHZA 3BYTB 1GHKA 4J6HA 4WORA 3HG9A 4R8IA 2SDFA 3DWQA 5AFWA 4RGOS 3MFYA 2F0DA 2C9OA 4FP5D 1BCPD 1SE4A 3AU7A 5BN5A 3H6MA 1OXVA 2H4OA 1MI2A 4NKLA 2D9UA 2A6EC 1GHJA 4FNFA 5FO9B 2BA0A 5G3LD 1PRTB 1EEID 4ZKCB 2R3ZA 1DOKA 2HCCA 3MXUA 3Q22A 1SYEA 3IFDA 2JE6I 3MXGA 2EOTA 1RJTA 2X6LA 3D31A 2KEDA 1YNNC 1LLRD 2SNSA 1HFGA 1I4PA 1QNKA 1LT6D 4A3DB 4J1MA 4X3KA 4F88A 2QKIC 3QOJA 2KEEA 4KJOA 2WB1B 3I4NB 2IT1A 2QILA 2JEAI 4OL7A 2ICEC 1EY0A 5I6WA 1IHZA 2RSOA 2E2JB 3NUCA 3FKIB 1HUMA 2LY7A 1HTLD 2EYPA 3QIAA 4KMUC 4QMGA 1BQQT 2QDBA 1O80A 3ONAB 2EYLA 4JBWA 4OHJA 1SNPA 4FXDA 4DGZA 4LJZC 2GA4B 3CHBD 2XVSA 4C2MB 1HXYD 4IQZA 5FLXE 5F2DA 3SDZA 5FOBB 3GD7A 3VYSA 1BCPF 3E5SA 1NSNS 3GTJB 1X3QA 1WTOA 3HS0C 1QCBD 5JVG3 1JWUD 1TIID 1BUVT 5M5WB 4YIJA 3TP8A 1ET9A 2WINB 4KN4C 3WOEA 3N6RA 2NN6G 2Z1CA 3GTLB 4CJ0B 1TQOA 5DM63 5A35A 2H1EA 1G2SA 2Y0SB 3EJIA 4RGTA 5EPKA 1F9QA 2IX3A 3DUZA 4DA2A 2QF7A 4BBSB 2KCNA 1RCVD 1JC7A 2KCCA 2B2UA 4RCNA 3PIO3 1CTMA 1WTVA 1WTRA 3HOWB 4K8JA 1ZKOA 4BY1B 1TR5A 3DXJC 1RD9D 4HTHA 1WTPA 5EBCA 4E6IA 3NWSA 4K5XA 1HUNA 1VF5C 1BCPC 3BDCA 4BA1I 4ZRZA 1SYCA 3I70A 3NWTA 1EYCA 4A3GB 4G7ZC 1T5EA 3GO5A 5JPMC 4ZK9B 4ILWA 5KYIA 4A3IB 1XX8A 3KF8A 2M2LA 1S5CD 1EYDA 3P1HA 1BO0A 1Q12A 4C1NK 4DNRB 4RWSC 1I4RA 4DK1A 1XTCD 4IN3A 3D3RA 3VA7A 1STBA 3U9SA 4PMCA 3S1NB 1JR0D 2SOBA 1B1ZA 3FEWX 4KI0A 2JA5B 3LWUA 5CGKA 4CKCA 1SYDA 5JEAG 2EJFC 2M00A 1F77A 1EFID 4XT1B 5C4HA 4C3JG 1F2MA 3D8GA 3TDQA 1LTSD 1OXTA 4O42A 4KKTA 3D4WA 5C4JB 2NUCA 4K2LA 3OMCA 3RUZA 3T13A 3M7GA 1ESFA 1ICWA 1GUNA 2XWBB 1BDOA 2WKCA 2XN9C 2CHBD 1QNUA 1D6EC 1E2VA 3TBIB 2K01A 1PFNA 5IGCA 2EYMA 4IUPA 2K32A 1IYUA 4QUCA 1T5XD 2B2TA 1MSHA 3MFGA 5IGEA 2MPMA 3OMGA 2B8GA 2JYOA 1WTQA 5EPJA 1SJED 1VMCA 2NN6I 1KLUD 3EFXD 3J81L 5I2YA 1ENAA 1Y8NB 2JXMB 2PYKA 5T1GA 5ELCA 3NE5B 1GUOA 1H9SA 2M9VA 3QOLA 2E2HB 4EQNA 2RDHA 1VMPA 4EVOA 2Q8IB 1WD1A 3C3LA 2AUJD 2NVXB 2FMMA 1RF2D 1A6XA 3UI2A 3GTMB 2RVLA 3OHXC 3HOZB 3PIP3 1V8QA 2WACA 4Y7NB 3S2DB 3I3CA 4XTCS 4OO1I 3HP3A 2K6AA 4QIWB 5EPLA 2DY7A 4KKUA 4P2CB 1STHA 3Q24A 3JAML 4OO1G 5CORA 2LS01 4M1UB 1I3QB 4FF3A 4HCSA 1CZWA 1G91A 3MXNA 1UEAB 1J9OA 1FR3A 1KLGD 2B2WA 1W6JA 3H94A 2IL8A 4ABNA 2NYZD 3TP5A 5CV6A 2L11A 3AB9A 3M85A 3Q6SA 1U4RA 1HFNA 2F1MA 3T56B 1O7LA 3GP7A 1FNWA 2WAQB 2EPBA 3NK9A 4S3SA 2BE5C 1A3TA 1LTGD 2F0EA 3OIPA 1K8MA 1E2ZA 3EROA 2ID0A 4B08A 4RKBA 2EJGC 2A73B 2B2VC 3HOXB 3S2HB 4IFDH 3DMUA 3C1EA 5FKAC 1A3UA 4LK1C 2VXWA 1VDZA 4DAYA 2K03A 4DFAA 1AN8A 5M3MB 1L0YB 3TP6A 3SEBA 5CV7A 5TSSA 4FF2A 2WV6D 4I65A 5I9PA 2E2DC 1DM0B 2HQEA 1G8ZD 5DNFA 3K59A 1LT3D 2KQ3A 1JE4A 1RHPA 1FNUA 3I4MB 1R9TB 4KY5A 2NZ1D 3X3NA 3MTSA 4L63B 4KK7A 1Y1VB 2C5CA 3IKJA 2IW3A 1LABA 2HDLA 4PMBA 1C8CA 3C1FA 1X3PA 2EY6A 3BDLA 2RBMA 1EL0A 1O78A 4H7BA 1STNA 2A6ED 2A69D 3OWEB 4KD3A 3T53B 3N52A 1KDCA 3NTHA 2XNAC 3V2TA 2TSSA 1DONA 3K5LA 1C4QA 5C3WA 5NUCA 2DNCA 3OOCA 3V96A 4X3SA 2RDGA 3D4DA 2BA1A 2RDFA 4KHVA 1CHPD 2F3WA 5IGBA 1DJRD 5DAUA 3P7JA 4IFDI 2LKVA 2SNMA 2PCFB 3LWEA 3VR6A 1JWMD 3BVMA 3U9OA 2G9DA 4HCEA 5M3FB 3R3OA 3OW7A 2X6GA 3GV3A 1PMRA 1SAPA 1EOTA 1AZQA 2J0TD 1SBBB 1JWSD 1EIHA 1GXDC 1EY7A 4ZUJA 2RKSA 1ENCA 2FHTA 2AWNA 4I7ZC 3OPOA 2JSOA 3P20A 1D2BA 3ITPA 2BE5D 4L8JA 3URYA 5JAVA 1BCPB 1PLFA 2D5DA 1TY0A 1II3A 1K83B 1U9RA 1UNSA 5J1ZA 2X69A 3A8KE 1SEBD 3IFTA 5KNCA 3BYYB 4NDXA 1PTOH 4C3HB 4H44C 2I07B 5K36H 1SFOB 1BR9A 4CBVA 3RZDB 4XQJA 1FD7D 3VYUA 1GUTA 5HGTA 4B9XA 3TZDA 5DEHA 1AW7A 1V43A 2Z8LA 3PUVA 3TZUA 1EQTA 4BWGB 4A3MB 5KGUA 4A3KB 2O5IC 1F9PA 1GUGA 1TS4A 2EYJA 4IURA 1Y1WB 2L12A 3MVVA 4DNTB 3NPPA 2O2LD 1STEA 3FMCA 3KBXA 5CYUA 1CA5A 1XWEA 4K2KA 5J39A 1FNVA 1KAAA 4NW2A 4EQPA 3PUWA 2NBFA 1G6ZA 1ESRA 1J8IA 2BCOA 3A54A 1TVXA 3SHLA 3HEJA 2NVQB 2V4DA 1SJHD 2Z4IA 1HQMC 4ZQ3A 3H91A 1WTWA 1LT5D 2EJMA 1ML0D 4TRDA 2L4NA 4HR7B 1AFPA 5E4XA 5LL6X 4B9WA 1KDBA 4ULLA 1PZJD 3H0GB 1IYVA 1QB5D 4X3UA 5ELBA 1ENFA 1IKMA 1X32A 4K14A 1F2YA 4V190 3FDTA 1KABA 3GTPB 1TWAB 3KK7A 1JICA 3R93A 2CQAA 2PNRC 4TSSA 4FXGC 4OGQC 1IW7D 2BDOA 4M8AA 3JAME 3Q0AA 1H9SB 5IOCA 2F0VA 5IGFA 5FLXL 2XIWA 5CBAE 1Y8PB 4Z9CB 4NP5A 1BXTA 2F0UA 5K5PA 3VR5A 4RH6A 4RGNA 1D5MC 3S1RB 5D65A 2K28A 4G4KA 5HURA 1I4HA 1PYWD 3S16B 1XYIA 3S14B 1A3VA 5ISRA 5EGTA 4H13C 2N55A 5T1IA 1C48A 4OO1H 4QF4A 4XT3B 1AEXA 1IKLA 2B63B 1W6KA 4XYQA 3VYRA 1TWFB 2B2YA 1OXSC 3W3AA 2N88A 1PTOD 2F0QA 4F87A 1TWHB 4KJNA 1FGBD 1V1PA 1KDAA 4F7XA 1RODA 4XDXA 1ZEQX 3AMUA 2VB2X 1ZYRC 4FVMA 1U4MA 1ONLA 3T51B 1HQRD 3BVGA 1STAA 4PNYA 3PO2B 2JA6B 5C6AA 2F0FA 3HKZB 3SR1A 1RTOA 1SYGA 3SK6A 4CHTB 2ZXRA 2L1BA 3VA5A 1HA6A 2WIIB 1SE2A 4C3IG 2NB0A 1HCZA 4F8MA 4WRDA 1RTNA 4KV6A 5JOBA 3R8BA 1JOKA 1QG7A 3K0YA 1GUWA 3R2TA 1I4QA 1SNDA 1LV9A 4OIJA 3DEPA 5D3DA 2VUMB 1CI3M 5IT9L 2E76C 5M5YB 1TT2A 3NHHA 1H9MA 4DK0A 4A3EB 2O5JC 4BBRB 4WJWA 2F0WA 4GZYC 3PV0A 2PW7A 1D1KA 4G57A 1EZ6A 3K5NA 1STYA 4PMWA 2XWJB 1QJOA 2XRQD 3G7LA 2KHSA 3DM1A 5CV8A 5I2XA 5EQ0A 4RHSA 2CW0D 2FFKB 4EGVA 1S5DD 1SMYC 5M5XB 1SNCA 1IL8A 4HN7A 3MEHA 1F2ZA 1DXMA 1EZ8A 3I4LA 4CJ2C 1BNZA 2E2IB 2K5QA 2EYOA 3GTOB 2FINB 4CJ1B 1O7ZA 2EZVA 4N9TA 2MUYA 3RD4A 4RFBA 1JQYD 3C46A 4IUQA 4C1NI 1B44D 3KUPA 4PV1C 1R4QB 2EYFA 5KRUA 3KLSX 3NQIA 5EBDA 1R4PB 2L0CA 1SSOA 1DOMA 2HDMA 3J81E 2EY2A 2OXPA 3WDNA 1B2TA 5C4ZA 2XSCA 3MHBA 2F0GA 5C3XA 3VYTA 2F0HA 4K6LA 2B2TC 5ELEA 1RDPD 1EY5A 3ND8A 1B50A 3E0JA 1LTID 2F0SA 3MZ5A 5CC4A 2F0MA 1TS2A 4C56C 2WP8J 2ENBA 1Z6HA 2F4IA 2F0OA 4DAPA 2OEOA 4ME5A 1M8AA 2MGSA 5C5MA 4FF1A 3LNNA 4J8QA 1B3AA 4RGMA 5BN3A 2BOSA 2QEJC 1OO9B 4DXGA 3KLRA 2B8FA 5JEAH 1HPCA 2Q8RE 5E1FA 2A69C 1LO5D 3HGBA 4FF4A 3D4RA 3M4YA 3A55A 5C0XJ 5EJWA 4AYBB 2L5TA 1B9MA 2AWOA 1A15A 4KKSA 2PMZB 2EDGA 4X3TA 5BN4A 4G7HC 1LTAD 1Q8IA 3D6CA 4IALA 1S5BD 3A7AB 3J7AF 1I6HB 1B4OA 2A68D 4FO2A 1M4VA 1H9KA 3D6WA 3FPUB 2DNEA 3H3VC 3NBIA 2ICIA 3H09A 4O1NA 5CV4A 1WCMB 1F9SA 2NTSA 2PZTA 1DCZA 1Q90A 2EY1A 2EYHA 3BVZA 2R92B 4V0BA 3KLSA 2MJ8A 2R7ZB 1KTKA 1LTBD 1Q1BA 3X3MA 3TSSA 2A6HC 2R93B 2KA7A 3DWAA 5JJZA 1VCIA 3A8JE 5C3EB 2A5HA 5FK9C 4A3JB 3MAQA 1E0BA 1QE6A 3FVQA 2RSNA 1WTXA 2HUGA 3OWFA 1DZ1A 3K57A 3FPPA 2K5WA 2G9HD 2B39A 1SYFA 3S1MB 3NXWA 1QWYA 2VB3X 5M9OA 3K5MA 1LTRD 3HOUB 5JEAJ 4HMIA 4ODGA 1NUCA 4U68A 4IZ8A 1D1IA 3DWPA 1PFMA 3BS1A 2IWHA 4IUNA 2KECA 3J80E 3A56A 1SYBA 3DHQA 1NR2A 3E6ZX 4TKOB 3G6JB 4KD4A 2EXZA 2K7VA 3QB3A 3SK4A 4RA8A 1H9RA 1B53A 1CFMA 2O4XA 4NMZA 3TMEA 3CQZB 3A8IE 5FO7B 5ELDA 1XXGA 1KNEA 3NTIA 1D5ZC 5COYA 3QG1A 2JA8B 1OXXK 4WFN3 5IODA 4DAVA 5A2QL 2AQ2B 1Z7TA 2ZXPA 1QILA 1IW7C 3MC0B 2B2VA 2KVMA 2PZUA 1CA6A 3MA2B 1I6VC 2EY5A 1PFBA 1TU2B 4C3HG 2R6GA 1PRTD 1MD2D 1LT4D 2F0LA 3S1QB 5LHY1 4A3FB 1S5FD 3HOVB 5D3IB 1S5ED 3NTKA 2EE1A 1E2WA 4HSVA 1EYAA 4FYDA 3GTKB 2JP1A 5CV5A 2ZT9C 1PXUA 5G3LF 1BF4A 5IT9E 3K7AB 3K6OA 5FO8B 5CR3A 1G2TA 2JA7B 1NCVA 2NTTA 1SMYD 1PZKD 2FJ2A 5CV9A 2PQEA 1PTOC 4K5VA 2J7ZA 3BG3A 3A7LA 5DM73 5KIXA 4XYOA 2NN6H 2OT2A 1I4XA 4XQNA 1NAPA 1EIGA 1ILPA 3ERQA 1DYQA 4K8IA 4OIKA 5LL6S 4MN3A 3M3YB 5C4XB 3CU7A 3NBHA 4BY7B 2D2CC 4LMQD 4MHEA 1S4ZA 4C3JB 1GJXA 2F03A 5EKKA 5IIFA 1A2TA 3PUYA 5C0XH 4L6TB 3EVQA 1YNJC 1UUPA 4ZUIA 4G7OC 1ZYRD 4JK1C 4DN4M 1PRTF 3QJYA 5I9OA 3PO3B 3S9WA 1I50B 1OXUA 3VR2A 3RLFA 1PZID 1F9RA 1V1OA 2DY8A 1I4GA 4R9WA 5D14A 1HRJA 1GUSA 3MXPA 3BDOA 4RHRA 2IX1A 1EU3A 3O13A 3HOYB 3RZOB 4DXFA 4UAIA 3GTGB 5C44B 2PO4A 1JORA 3QWNA 4CKBA 2L55A 1CM9A 3I72A 1EEFD 3K5OA 1HHVA 3ND9A 2TMPA 3EA6A 1JCKB 3S17B 4ZKBB 1Z47A 2RQXA 2A74C 1YNND 3I91A 4A3BB 2OF1A 3T4AC 4Q0FA 3VR3A 4N9PA 3CRLC 2RA4A 2K05A 3SK8A 1O7YA 1QOHA 3LX0A 5C5LA 5IGDA 1U4PA 4LAAA 2CVRA 3M4OB 2K04A 3J80L 5E4WC 4CGYB 1CQFA 1TS5A 3F2UA 4TQUS 1DOLA 1ZXTA 5CMDA 3I90A 5KNBA 2F0PA 2A6HD 1PRTC 3VR4A 3L9AX 4KY7A 1JOOA 2IPKD 2K5DA 4EQOA 4HMJA 3ZYYX 4XXEA 4DU9A 4K6DA 4ZYSA 1Y8OB 4UDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKS A;  1ENC A;  1A2U A;  1STY A;  3OMC A;  3RUZ A;  5CC4 A;  2PZU A;  5IIF A;  1A2T A;  3NUC A;  2PW5 A;  3T13 A;  2F0M A;  3EVQ A;  1EY8 A;  1TR5 A;  4ZUI A;  2F0N A;  3SHL A;  2EY5 A;  5I9O A;  3HEJ A;  2KHS A;  2NUC A;  3OWF A;  1STH A;  4KY5 A;  3S9W A;  4R8N A;  5CV8 A;  5E3F A;  2F0Q A;  4ZQ3 A;  4HTH A;  2ENB A;  4KJN A;  2EYP A;  4TRD A;  4E6I A;  1KDA A;  1SNO A;  1SYF A;  2QDB A;  4QMG A;  4K5X A;  2F0O A;  4F7X A;  3SK5 A;  2F0L A;  2EYL A;  4PMB A;  4B9W A;  1KDB A;  2OEO A;  3ITP A;  3PMF A;  3NXW A;  4ID6 A;  4KY6 A;  4KTA A;  4ME5 A;  3BDC A;  1SNP A;  5C5M A;  4EQP A;  5KYL A;  4DGZ A;  3C1F A;  5JAV A;  2EY6 A;  3BDL A;  2RBM A;  3MXP A;  5M9O A;  5I6Y A;  1SYC A;  3NP8 A;  4H7B A;  4K14 A;  1SNC A;  3P75 A;  1EY6 A;  1EYA A;  1F2Y A;  1STN A;  2F0J A;  1SNQ A;  4HMI A;  4ODG A;  1KAB A;  5IGC A;  1EYC A;  1II3 A;  1STA A;  1F2Z A;  1U9R A;  2EYM A;  3MEH A;  1EZ8 A;  3OSO A;  4KD3 A;  4PNY A;  5CV5 A;  5CV6 A;  3TP5 A;  5J1Z A;  5KEE A;  5EKL A;  1JOR A;  1NUC A;  1EY4 A;  5C6A A;  5E1F A;  1KDC A;  4IZ8 A;  4J6H A;  2F0T A;  4WOR A;  2F0F A;  3SR1 A;  5IGE A;  5F2D A;  3OMG A;  1SYG A;  3SK6 A;  3V2T A;  5KYI A;  5IGG A;  3E5S A;  4K6D A;  5CR3 A;  1NSN S;  4NDX A;  4IUN A;  2EYO A;  2F0D A;  1EYD A;  3NK9 A;  3VA5 A;  4S3S A;  3H6M A;  3P1H A;  3HZX A;  3D6C A;  1A3T A;  3NQT A;  4NKL A;  5C3W A;  2F3V A;  5NUC A;  2F0E A;  4N9T A;  5CV9 A;  4IAL A;  4MIU A;  2PZW A;  1SYB A;  4F8M A;  5IOC A;  2F0V A;  3DHQ A;  2PQE A;  4K5V A;  5IGF A;  2OF1 A;  5KIX A;  1ENA A;  3D4D A;  3TP7 A;  4WRD A;  4YIJ A;  3TP8 A;  3ERO A;  4N9P A;  4KD4 A;  5HGT A;  2RDF A;  4B9X A;  2PYK A;  4KHV A;  2EXZ A;  3QB3 A;  3SK4 A;  3SK8 A;  5DEH A;  2F3W A;  4KV6 A;  1STB A;  5JOB A;  1JOK A;  5IGB A;  5DAU A;  4NP5 A;  4RKB A;  5CV4 A;  3LX0 A;  2EYF A;  2LKV A;  2O4X A;  4NMZ A;  4PMC A;  1SYE A;  3TME A;  2SNM A;  4DF7 A;  5C5L A;  1TQO A;  2PZT A;  1RKN A;  2F0U A;  5IGD A;  5K5P A;  1STG A;  2EY1 A;  3DMU A;  2EYH A;  2SOB A;  3C1E A;  3QOL A;  4LAA A;  5KRU A;  1SND A;  1A3U A;  3ERQ A;  4EQN A;  5CGK A;  3EJI A;  1SNM A;  5KGU A;  1EY9 A;  2SNS A;  4K5W A;  2EY2 A;  2OXP A;  3U9O A;  4EVO A;  1TT2 A;  3SXH A;  4QB4 A;  4DFA A;  1SYD A;  2F0I A;  4K8I A;  2EYJ A;  1EQV A;  2M00 A;  4J1M A;  3NHH A;  5HUR A;  3R3O A;  5C4Z A;  2F0P A;  3TP6 A;  3MHB A;  3QOJ A;  5CV7 A;  2F0G A;  5C3X A;  3MVV A;  4KJO A;  5IOD A;  5C4H A;  2F0H A;  4KY7 A;  2F0W A;  1JOO A;  1A3V A;  1F2M A;  4RKL A;  2PW7 A;  3D8G A;  4I65 A;  5I9P A;  4G57 A;  5ISR A;  5J22 A;  4OL7 A;  3T16 A;  1JOQ A;  1EY0 A;  4EQO A;  5I6W A;  5EGT A;  1EY5 A;  2HQE A;  2WAC A;  4K8J A;  4HMJ A;  4K2K A;  2KQ3 A;  5J39 A;  1EZ6 A;  5EKK A;  1EY7 A;  4ZUJ A;  4DU9 A;  3D4W A;  4QF4 A;  2F0K A;  2F0S A;  1KAA A;  1IHZ A;  4K2L A;  3MZ5 A;  1AEX A; 
#chains in the Genus database with same CATH topology
 1A2U A;  3SVM A;  1CT1 D;  2LFN A;  5C44 H;  2F0N A;  3PUZ A;  5A2Q E;  1L0X B;  1JB3 A;  1EWI A;  4R8N A;  4QQB X;  3WOF A;  4Q5V A;  1XMQ Q;  2R61 A;  5ELO A;  5EKI A;  4BA2 I;  1E22 A;  1U4L A;  3M4O H;  3QO2 A;  4NXN L;  3SK5 A;  1RIP A;  1Q1E A;  3S15 H;  1UE1 A;  1UAP A;  4A93 B;  2F4V Q;  4A75 A;  3PSI A;  3RMH A;  2ALY B;  2KBN A;  1AZP A;  3IAY A;  4CKE A;  3GTL H;  3EQL C;  3P75 A;  1PTO F;  1EY6 A;  2ASB A;  2L9H A;  1H9J A;  1XPR A;  2E75 C;  5KEE A;  5EKL A;  1EY4 A;  3OIQ A;  1TWC B;  2F0T A;  3BZD B;  2OWO A;  3L2P A;  2Z6B A;  3W2D A;  5GAH C;  2E74 C;  3I73 A;  2K1B A;  1KL9 A;  1ILQ A;  1HA5 A;  1CQV A;  1SE3 A;  2I5M X;  2F3V A;  4LF9 Q;  5ELF A;  5I4D A;  2XRS D;  4MIU A;  2PZW A;  3TQY A;  1YZ6 A;  4IPH A;  1UE5 A;  3TP7 A;  4XQQ A;  1X65 A;  4JVZ A;  5JVH 3;  2AUK A;  3A5Z B;  4BBR H;  3TN2 A;  2NVY B;  2RF4 A;  3OW2 A;  3PIO A;  3GTQ B;  2D62 A;  2CFM A;  1XMO L;  3MWY W;  4XIG S;  1LM0 A;  1NR4 A;  1STG A;  4X64 L;  3I8Z A;  3NEM A;  2KJX A;  3K8A A;  1KNA A;  2HIV A;  2EQS A;  1EU4 A;  4CDE C;  1YNJ D;  2MHV A;  3SXH A;  2AQ1 B;  3K58 A;  1JJ2 A;  1MBY A;  4DR6 L;  5KND A;  2WB1 E;  3HOW G;  4ZLT F;  1PDQ A;  2VQF L;  4GLA C;  1NMG A;  3CCU A;  1Q3L A;  2B2W C;  3T16 A;  4YY3 L;  4GN4 B;  4DAM A;  1VQP A;  3J80 i;  2WKD A;  1CHQ D;  1D5X C;  4PQX A;  3V05 A;  1W2B A;  2F0K A;  2LXJ A;  4QCL A;  1G29 1;  3DEO A;  3HRZ C;  2PPB C;  2PW5 A;  3ERS X;  1IBK Q;  1DD2 A;  4FDB A;  3PCO B;  2I46 A;  2HHH Q;  4IUT A;  4A3K H;  2ZXO A;  5C0X I;  2UU9 L;  1TS3 A;  2FMC A;  1K73 C;  3KBG A;  4B3M Q;  1FYC A;  2AHO B;  4GNX C;  2YU9 B;  1MSG A;  2IJ0 A;  4PZ7 A;  3GQB A;  1PH3 A;  1SNO A;  1VF7 A;  1YHB A;  3GV6 A;  3L7Z C;  4U67 3;  3SE0 A;  1XNQ L;  3PMF A;  4ID6 A;  4P75 A;  1F2L A;  1Q82 C;  1AP0 A;  4RAU C;  3IL8 A;  1Y69 U;  4A3B G;  4IUU A;  4A3C G;  1EQR A;  2AQ3 B;  2KUM A;  3FRP B;  3NP8 A;  4X62 L;  1VQB A;  1BBX C;  2K33 A;  2F0J A;  2CWA A;  2HQL A;  5HGQ A;  2A68 C;  3OSO A;  4ZAI A;  4YCV A;  3W1B A;  2QCP X;  4IUV A;  2WFW A;  1SXT A;  1PTO B;  5JPN C;  5IGG A;  1V1P B;  2JA5 G;  1WVL A;  4QUF A;  1B70 B;  2UUA Q;  4DR4 L;  2CW0 C;  1TKW B;  3HZX A;  1WD0 A;  3I4N G;  4Y7N H;  3NQT A;  4AQY Q;  2UUB Q;  2YYZ A;  1VQD A;  2KHI A;  2SEB D;  2E2I H;  1LAC A;  1SDF A;  1CZG A;  1NJI C;  3PUX A;  5CBE E;  2MNA A;  1JJC B;  1NNX A;  2Q8T A;  3S15 B;  4C3I B;  4UP9 A;  1TWG B;  4DF7 A;  3KDF B;  4KN7 C;  1RKN A;  2B2Y C;  3IRB A;  4FXK C;  4HED A;  4HSP A;  1V1Q A;  2VNU D;  1SNM A;  1EY9 A;  4K5W A;  2JEB I;  1Z9F A;  4QB4 A;  5FJ8 G;  4JI8 L;  3J7A V;  2IX0 A;  2F0I A;  3L0O A;  1K0S A;  1EQV A;  4HAE A;  2DN8 A;  4LUZ A;  4A3M G;  1TWH H;  1SFO H;  2GVB A;  3C2P A;  3AQQ A;  3NSW A;  4YHH Q;  4DR7 Q;  5K36 G;  1RL2 A;  3CKI B;  2Z4H A;  5J22 A;  4RKL A;  4IPD A;  2HCI A;  1JOQ A;  4IFD G;  2J4X A;  1EWH A;  5C0X G;  2YTY A;  1EWC A;  1TY2 A;  4GNX A;  3CRK C;  4LF8 L;  4N8F A;  2EVB A;  3J7Y W;  1N9W A;  1BOS A;  1P16 A;  4JI4 Q;  1EY8 A;  1MGS A;  4LFC L;  4IFD J;  3M7N A;  4BY7 G;  2BDN A;  4JI1 L;  1ICF B;  3R2I A;  1LTT D;  5E3F A;  4BS9 A;  4DV5 L;  2LMC B;  1B9N A;  1CKN B;  1ET6 A;  2E5L Q;  3CCR A;  1EQQ A;  2L15 A;  4GLX A;  3Q23 A;  2B2U C;  1MJE A;  2QEX A;  4YWM A;  4KY6 A;  1BVS A;  4H0L C;  4KTA A;  4RCO A;  2KOL A;  5KYL A;  1HTP A;  1N34 Q;  5AJ3 L;  4UP8 A;  1KHI A;  1QZH A;  3Q8D A;  5I6Y A;  1XMQ L;  2NVT B;  1K8O A;  3L3O C;  1GOZ A;  2NWG A;  5FLM H;  5IE8 A;  1CK1 A;  5M5W H;  1SNQ A;  2MP1 A;  4KHZ A;  4NXN Q;  1Y1W G;  3BYT B;  1GHK A;  2R7Z G;  4J6H A;  4WOR A;  3CCV A;  1NTG A;  3HG9 A;  1M1K C;  3KDF A;  2SDF A;  2KCM A;  4AYB E;  4R8I A;  3DWQ A;  2PMZ E;  4RGO S;  5AFW A;  3KJP A;  3MFY A;  2F0D A;  2C9O A;  4FP5 D;  1BCP D;  1SE4 A;  3AU7 A;  5BN5 A;  3H6M A;  1OXV A;  2H4O A;  1MI2 A;  3BJU A;  5IT9 c;  4NKL A;  2D9U A;  3AFP A;  4DNI A;  3CP0 A;  3B6Y A;  1MJC A;  2A6E C;  1GHJ A;  4FNF A;  2BA0 A;  5G3L D;  4APV A;  5FO9 B;  2K14 A;  1PRT B;  1EEI D;  4ZKC B;  1H95 A;  4GKK Q;  2R3Z A;  1DOK A;  2HCC A;  1X56 A;  3MXU A;  4OON A;  3Q22 A;  1E1O A;  1SYE A;  2QDL A;  3IFD A;  2JE6 I;  1PYB A;  3MXG A;  2EOT A;  1RJT A;  4AYB G;  1L0W A;  2X6L A;  3D31 A;  2KED A;  1YNN C;  1LLR D;  2SNS A;  1HFG A;  4UY8 C;  1I4P A;  1QNK A;  1LT6 D;  2LSS A;  4A3D B;  4JBM A;  4J1M A;  4X3K A;  1KRT A;  4F88 A;  2QKI C;  3QOJ A;  2KEE A;  4KJO A;  2WB1 B;  1N32 L;  1PVO A;  3I4N B;  2IT1 A;  2QIL A;  4OL7 A;  2JEA I;  2ICE C;  1EY0 A;  5I6W A;  2ZJQ A;  2A1A A;  4DV2 L;  1IHZ A;  2JK8 A;  2RSO A;  3MXN B;  1KAW A;  2DUD A;  2E2J B;  3NUC A;  3FKI B;  1HUM A;  1AE2 A;  1KXL A;  2LY7 A;  2ES2 A;  1HTL D;  1VQ7 A;  1FJG Q;  2R92 H;  2EYP A;  3QIA A;  3PIP A;  4KMU C;  4QMG A;  1BQQ T;  2QDB A;  1FGU A;  1O80 A;  4GOP A;  3ONA B;  2EYL A;  4JBW A;  1B8A A;  4OHJ A;  2HHH L;  1SNP A;  4FXD A;  4DGZ A;  1UE7 A;  4LJZ C;  2GA4 B;  3JAM c;  3CHB D;  2XVS A;  3FHW A;  4C2M B;  1HXY D;  4IQZ A;  1SE8 A;  5FLX E;  5F2D A;  3SDZ A;  5LMN W;  5FOB B;  3GD7 A;  3VYS A;  1BCP F;  3E5S A;  1NSN S;  3GTJ B;  1X3Q A;  1WTO A;  5FJ8 H;  3HS0 C;  1QCB D;  3PQI A;  1JT8 A;  4DR3 L;  5JVG 3;  1JWU D;  4BBR G;  1SMX A;  1TII D;  1BUV T;  3U4V A;  5M5W B;  4YIJ A;  2N49 A;  3TP8 A;  4DV1 L;  5E7N A;  1ET9 A;  4KN4 C;  2WIN B;  3BZK A;  3WOE A;  2GVA A;  3N6R A;  2NN6 G;  2Z1C A;  2LXK A;  2QA4 A;  3GTL B;  4CJ0 B;  1TQO A;  5DM6 3;  3S1R H;  2UUB L;  1IBL Q;  5A35 A;  2H1E A;  1YI2 A;  1G2S A;  2Y0S B;  3EJI A;  4RGT A;  5EPK A;  1MIU A;  1F9Q A;  2IX3 A;  3K81 C;  3DUZ A;  4DA2 A;  2QF7 A;  1S3O A;  4BBS B;  2KCN A;  4QJF A;  1RCV D;  1JC7 A;  4R4C A;  2KCC A;  5C3E G;  4DUZ L;  2B2U A;  4RCN A;  3PIO 3;  1CTM A;  1VQ9 A;  1PH2 A;  1WTV A;  1WTR A;  3HOW B;  4K8J A;  3CCE A;  1R9T H;  1ZKO A;  4BY1 B;  1TR5 A;  3I55 A;  4C2M H;  3DXJ C;  3M9B A;  1RD9 D;  4HIM A;  4HTH A;  1WTP A;  1VQE A;  5EBC A;  4E6I A;  3NWS A;  4YCU A;  4K5X A;  1HUN A;  2R92 G;  1VF5 C;  1BCP C;  3BDC A;  3CPF A;  4BA1 I;  2PNH A;  1GVP A;  3HOU G;  4ZRZ A;  4DV5 Q;  1SYC A;  3I70 A;  3J81 j;  2E5L L;  3NWT A;  2IY5 B;  4DR5 Q;  5IP7 G;  1EYC A;  4A3G B;  4G7Z C;  1T5E A;  3GO5 A;  3UDI A;  5JPM C;  4ZK9 B;  1CSQ A;  4ILW A;  5IYB G;  4A3J H;  4KLK A;  5KYI A;  4A3I B;  1XX8 A;  1VQ8 A;  3KF8 A;  2M2L A;  1S5C D;  1EYD A;  3P1H A;  3KF6 A;  1BO0 A;  2Q2H A;  1Q12 A;  4C1N K;  4JBK A;  4DNR B;  1UWV A;  4RWS C;  1I4R A;  4DK1 A;  1E7Z A;  3I7F A;  1XTC D;  4IN3 A;  3D3R A;  3VA7 A;  1STB A;  3U9S A;  2HIX A;  2R93 G;  4PMC A;  1MKH A;  1QVG A;  3S1N B;  2CWP A;  2VUM H;  1JR0 D;  2KEN A;  2SOB A;  4JI5 Q;  1B1Z A;  3FEW X;  4KI0 A;  2JA5 B;  3LWU A;  5CGK A;  4QY7 A;  4POG A;  4LF6 Q;  2ATW A;  3KLW A;  4CKC A;  1SYD A;  5JEA G;  2EJF C;  2M00 A;  2JA6 G;  1F77 A;  1EFI D;  4XT1 B;  5C4H A;  4C3J G;  4EX5 A;  2G5D A;  3CAM A;  4JI0 L;  2CCZ A;  1F2M A;  3D8G A;  3TDQ A;  1LTS D;  1YBY A;  1OXT A;  1VQA A;  4O42 A;  2K5H A;  3M4P A;  4KKT A;  1XPU A;  3D4W A;  5C4J B;  2JN4 A;  2NUC A;  4R4I A;  4K2L A;  3M3Y H;  3OMC A;  3RUZ A;  1EUJ A;  5M3M H;  4DR1 Q;  3HOU H;  3T13 A;  4DPG A;  3TS2 A;  1C7Y A;  1NE3 A;  3M7G A;  1ESF A;  1ICW A;  2NVT H;  3KFU A;  1GUN A;  2XWB B;  2OTL A;  4OEM B;  1BDO A;  2WKC A;  2XN9 C;  4POF A;  2CHB D;  1QNU A;  1HR0 W;  1D6E C;  2OCE A;  3KF8 B;  1HNX L;  1E2V A;  4N8X 1;  4AH6 A;  3TBI B;  2K01 A;  1PFN A;  5IGC A;  2EYM A;  4X64 Q;  4IUP A;  1K0R A;  4QL5 A;  2K32 A;  5JJI A;  1IYU A;  4QUC A;  1T5X D;  2B2T A;  1MSH A;  3MFG A;  5IGE A;  2MPM A;  3OMG A;  2B8G A;  2JYO A;  1WTQ A;  4DR6 Q;  2VQF Q;  5EPJ A;  4GS3 A;  4NPS A;  5FLM G;  1SJE D;  1VMC A;  2NN6 I;  1KLU D;  3EFX D;  3J81 L;  5I2Y A;  4X65 Q;  1ENA A;  5LMN Q;  1Y8N B;  2JXM B;  4JI6 L;  2PYK A;  4B3S Q;  5T1G A;  5ELC A;  4LUO A;  3HOV H;  4ME3 A;  2DJF C;  4IJH A;  3NE5 B;  1GUO A;  2XGT A;  1H9S A;  2M9V A;  2WAQ G;  3K0X A;  3QOL A;  4JYA Q;  2E2H B;  4EQN A;  2RDH A;  4DV1 Q;  1VMP A;  4EVO A;  1J5E Q;  2Q8I B;  1WD1 A;  3C3L A;  2AUJ D;  2NVX B;  2FMM A;  1RF2 D;  1A6X A;  3UI2 A;  3GTM B;  3RR5 A;  3HKS A;  2RVL A;  1HR0 L;  3OHX C;  3ICE A;  4MNO A;  4X62 Q;  3HOZ B;  2FXQ A;  3PIP 3;  4DV6 L;  1V8Q A;  1U0L A;  2WAC A;  4Y7N B;  3S2D B;  3I3C A;  4XTC S;  4QGU A;  4B3R L;  4OO1 I;  1WFQ A;  3HP3 A;  3AYH B;  2K6A A;  4QIW B;  4X66 L;  5IP7 H;  4JV5 Q;  5EPL A;  1HNZ Q;  2ZTE A;  2DY7 A;  2UUA L;  4KKU A;  4P2C B;  4DR4 Q;  1STH A;  4HJ5 A;  3Q24 A;  5DLQ E;  3JAM L;  1GO3 E;  4OO1 G;  5COR A;  2LS0 1;  4M1U B;  1I3Q B;  5GAD C;  4FF3 A;  4HCS A;  5IP9 G;  1CZW A;  1G91 A;  3MXN A;  1UEA B;  1K8A C;  1J9O A;  1FR3 A;  1KLG D;  4DV3 Q;  2B2W A;  1W6J A;  4GLV B;  1UEB A;  4DK6 C;  1E3P A;  1YVC A;  3H94 A;  1WCM H;  2IL8 A;  2PQA B;  2NYZ D;  4ABN A;  4GOP B;  3TP5 A;  5CV6 A;  2L11 A;  3AB9 A;  3M85 A;  3Q6S A;  1U4R A;  1HFN A;  2F1M A;  4IPG A;  3T56 B;  1O7L A;  2EIF A;  3BU2 A;  3GP7 A;  1FNW A;  2ZTD A;  3HKZ E;  3S14 H;  2WAQ B;  5L37 A;  2EPB A;  4DR7 L;  3NK9 A;  4O2D A;  4S3S A;  2BE5 C;  4B3T Q;  2PQA A;  1A3T A;  1LTG D;  2I5L X;  5C4J H;  2F0E A;  3OIP A;  2CKZ B;  1K8M A;  1E2Z A;  3G6E A;  2HT1 A;  4LF8 Q;  3ERO A;  2K4K A;  2ID0 A;  3BZC A;  4B08 A;  4RKB A;  4LFC Q;  3HOY H;  2EJG C;  2A73 B;  2B2V C;  4C3I H;  1K3B C;  4JI1 Q;  2JQO A;  3HOX B;  3S2H B;  4PG3 A;  4IFD H;  3DMU A;  3C1E A;  4A93 G;  5FKA C;  1A3U A;  3H3V H;  4LK1 C;  2VXW A;  1VDZ A;  4DAY A;  2K03 A;  4DFA A;  3I4M G;  1AN8 A;  5M3M B;  1L0Y B;  4CDF C;  4IJL A;  1I50 H;  3TP6 A;  1X3G A;  3SEB A;  5CV7 A;  1VQJ A;  5TSS A;  4FF2 A;  2WV6 D;  4I65 A;  5LMU L;  2E2D C;  5I9P A;  1FL0 A;  4LFA Q;  1DM0 B;  2Q2T A;  2HQE A;  3NEN A;  1G8Z D;  4LF6 L;  3TRE A;  4DAY B;  1FVI A;  5DNF A;  2Z6K C;  3K59 A;  1LT3 D;  2KQ3 A;  1I6H H;  2R93 H;  1JE4 A;  1RHP A;  1N33 L;  1FNU A;  3I4M B;  4HID A;  3T1Y Q;  4JI0 Q;  1R9T B;  2RHQ B;  4O0A A;  3PO3 G;  4KY5 A;  2NZ1 D;  3X3N A;  3VDY A;  3MTS A;  4L63 B;  4KK7 A;  1Y1V B;  2C5C A;  3IKJ A;  1VQL A;  2IW3 A;  1XTD A;  1LAB A;  2HDL A;  4PMB A;  1C8C A;  2JA9 A;  2Z6K A;  3C1F A;  2NVY H;  1X3P A;  2EY6 A;  3BDL A;  1Y1V G;  1VQH A;  5JJL A;  2RBM A;  1EL0 A;  1O78 A;  4DK3 C;  4H7B A;  3S1N H;  4ZCK A;  1STN A;  4TVA B;  4R1J A;  5BR8 Q;  2A6E D;  2A69 D;  3OWE B;  4KD3 A;  3T53 B;  3N52 A;  2Z0S A;  4L5R C;  1KDC A;  3NTH A;  2XNA C;  3V2T A;  1Q7Y C;  4YWK A;  2TSS A;  1CSP A;  4RMF A;  4YWL A;  1DON A;  5HY6 A;  3UDX A;  3I4O A;  3K5L A;  3ULP A;  1N32 Q;  1C4Q A;  4L5Q A;  5C3W A;  5NUC A;  1EFW A;  4A3D H;  2DNC A;  1QVC A;  3OOC A;  2B63 G;  3W5O A;  3V96 A;  1IL2 A;  4X3S A;  1O7I A;  1WYD A;  2RDG A;  3D4D A;  4NXM Q;  4DV2 Q;  1I5F A;  2BA1 A;  2RDF A;  4KHV A;  1M90 C;  4QIW E;  1CHP D;  2F3W A;  2R7F A;  3AFQ A;  5IGB A;  1DJR D;  3J81 c;  5DAU A;  3DLL A;  3P7J A;  4IFD I;  2LKV A;  2QGQ A;  2SNM A;  1SLJ A;  2K50 A;  2PCF B;  3LWE A;  3VR6 A;  4X65 L;  3OTO Q;  1JWM D;  3BVM A;  3U9O A;  4JI6 Q;  4B3S L;  2G9D A;  4EQ5 A;  2Y0S G;  1S40 A;  1MHW C;  4HCE A;  5M3F B;  3R3O A;  3OW7 A;  2X6G A;  3GV3 A;  4A3B H;  1PMR A;  1SAP A;  4HJ9 A;  1CKO A;  1EOT A;  1AZQ A;  2J0T D;  1SBB B;  2YTV A;  1G51 A;  1L1O B;  1J5E L;  1JWS D;  1EIH A;  1GXD C;  2MO1 A;  1EY7 A;  1HZC A;  4ZUJ A;  4DV0 Q;  3EN2 A;  2RKS A;  1ENC A;  4A3K G;  1HR0 Q;  2FHT A;  2AWN A;  4I7Z C;  3OPO A;  3CCL A;  2JSO A;  4DV6 Q;  2C35 B;  2P5Z X;  3ZJY C;  3P20 A;  1DGS A;  3GDE A;  1D8L A;  4DV4 L;  1D2B A;  3CQZ H;  3ITP A;  4X66 Q;  2CH4 A;  4OWT B;  2BE5 D;  4L8J A;  3URY A;  5JAV A;  4GNX B;  1BCP B;  1PLF A;  1AE3 A;  2BH2 A;  2AKW B;  4OWX B;  2D5D A;  1VQ6 A;  1TY0 A;  1IBL L;  1A8V A;  1II3 A;  1K83 B;  1U9R A;  1PV4 A;  1BBU A;  1UNS A;  5J1Z A;  1VQO A;  2R7D A;  2X69 A;  3A8K E;  4A76 A;  1SRU A;  1SEB D;  3IFT A;  5KNC A;  3J80 c;  3BYY B;  4NDX A;  1PTO H;  5IP9 H;  4C3H B;  3CF5 A;  3I4M H;  4H44 C;  2I07 B;  5K36 H;  2ZJP A;  2E2J H;  2DJG C;  1SFO B;  1BR9 A;  4CBV A;  2DGY A;  1S72 A;  3RZD B;  2YTX A;  4UHV A;  4XQJ A;  1FD7 D;  2F52 A;  3VYU A;  1GUT A;  5HGT A;  4B9X A;  3TZD A;  2K5V A;  3JC6 6;  5DEH A;  1AW7 A;  1V43 A;  1N36 Q;  1Y1W H;  4OX9 L;  2Z8L A;  3PUV A;  3CPW A;  2ZJR A;  1QVF A;  3TZU A;  1EQT A;  3T1H L;  4BWG B;  1WI5 A;  4A3M B;  5KGU A;  4A3K B;  2O5I C;  4OXP A;  1F9P A;  1GUG A;  1Q8K A;  1TS4 A;  1X55 A;  2EYJ A;  4IUR A;  1Y1W B;  3F1Z A;  3STB D;  2L12 A;  3MVV A;  4DNT B;  3HOZ G;  2CH4 W;  4LFB Q;  3NPP A;  2O2L D;  4HIK A;  4BY1 G;  1STE A;  4DR5 L;  3FMC A;  3KBX A;  5CYU A;  3RN5 A;  1CA5 A;  1XWE A;  4K2K A;  3DM3 A;  5J39 A;  1FNV A;  4J15 A;  2VQE Q;  1KIX A;  1YEZ A;  1KAA A;  4NW2 A;  4EQP A;  3PUW A;  2JA7 H;  2NBF A;  4HJA A;  1G6Z A;  1ESR A;  1J8I A;  4C3H H;  2BCO A;  3A54 A;  1TVX A;  5LMU Q;  3SHL A;  4LFA L;  2KHJ A;  3HEJ A;  4A3C H;  2NVQ B;  2V4D A;  3MEF A;  1SJH D;  2Z4I A;  4A3E H;  1HQM C;  1LYL A;  2HD3 A;  4ZQ3 A;  3H91 A;  1WTW A;  2EXD A;  2XTI A;  3PGZ A;  3S16 H;  1LT5 D;  4IOA A;  2EJM A;  1ML0 D;  4TRD A;  1A0I A;  2L4N A;  4HR7 B;  4WJ3 M;  1AFP A;  5E4X A;  5LL6 X;  4B9W A;  1KDB A;  4ULL A;  1PZJ D;  3H0G B;  1IYV A;  1QB5 D;  4X3U A;  5ELB A;  1ENF A;  1IKM A;  1EIY B;  1X32 A;  4K14 A;  3CME A;  1F2Y A;  4V19 0;  3FDT A;  3KF6 B;  1KAB A;  3GTP B;  1TWG H;  1TWA B;  4JI5 L;  1PH9 A;  3KK7 A;  2UUC Q;  1JIC A;  3TS0 A;  3R93 A;  1D7Q A;  4BXX H;  4R4O A;  4LF4 L;  3CMA A;  1L1O C;  2CQA A;  2OQ0 A;  2PNR C;  4TSS A;  4DR2 Q;  5BR8 L;  4FXG C;  4OGQ C;  1IW7 D;  2BDO A;  4M8A A;  3JAM E;  3Q0A A;  1H9S B;  5IOC A;  2F0V A;  5IGF A;  5FLX L;  2XIW A;  5CBA E;  1K8G A;  1VQN A;  5JJK A;  4A93 H;  4DR1 L;  2JA8 H;  1Y8P B;  4Z9C B;  2UXD L;  4NP5 A;  2V1C C;  2NVX H;  1BXT A;  4A3F H;  2AMC B;  2F0U A;  3K7U C;  5K5P A;  1A63 A;  3VR5 A;  3E0E A;  1K9M C;  4NXM L;  4RH6 A;  1WOC A;  4RGN A;  1D5M C;  3S1R B;  1GM5 A;  4ALP A;  4A3L H;  3H0G H;  5D65 A;  2K28 A;  4G4K A;  4RG1 A;  5HUR A;  2B63 H;  1I4H A;  1PYW D;  1HNX Q;  3S16 B;  1XYI A;  3S14 B;  1A3V A;  4JI7 Q;  4DKA C;  1L2F A;  3UDG A;  5ISR A;  4GN3 B;  5EGT A;  4H13 C;  1CKN A;  2N55 A;  3K7A H;  5T1I A;  1C48 A;  4NB3 A;  4OO1 H;  4QF4 A;  4A3I G;  4XT3 B;  1AEX A;  1IKL A;  2B63 B;  1W6K A;  5IWA Q;  4XYQ A;  3VYR A;  1VQG A;  1TWF B;  2B2Y A;  1OXS C;  3F2B A;  3W3A A;  2N88 A;  1PTO D;  2F0Q A;  4F87 A;  1QUQ A;  1TWH B;  4KJN A;  2D0O A;  1ASZ A;  1FGB D;  1KDA A;  1V1P A;  4F7X A;  1ROD A;  1YJW A;  5LMN L;  2RHS B;  4XDX A;  3D0F A;  4A3M H;  1ZEQ X;  1YHQ A;  2VB2 X;  3AMU A;  1EOV A;  5IYC H;  2F3I A;  2CQO A;  2MO0 A;  1ZYR C;  4FVM A;  3PO3 H;  1YJN A;  4JG2 A;  1U4M A;  1ONL A;  3T51 B;  3CCS A;  4DV4 Q;  2OTJ A;  1HQR D;  3BVG A;  1STA A;  4JYA L;  4PNY A;  3PO2 B;  2JA6 B;  5C6A A;  1LTL A;  1PH8 A;  3HKZ G;  2F0F A;  3HKZ B;  3SR1 A;  1RTO A;  2Q2U A;  1SYG A;  3SK6 A;  1UE6 A;  4CHT B;  2ZXR A;  2L1B A;  3VA5 A;  1HA6 A;  2WII B;  1SE2 A;  3HOY G;  2WAQ E;  3GTP H;  1NMF A;  4C3I G;  2NB0 A;  3GTJ H;  3GTG H;  5C4X H;  5J3B A;  1HCZ A;  4F8M A;  2VW9 A;  3I4N H;  4WRD A;  3CXC A;  3STB C;  4B3R Q;  1RTN A;  4JPB W;  2ZM6 L;  4KV6 A;  5JOB A;  3R8B A;  1JOK A;  1QG7 A;  3KYH C;  4JV5 L;  1HNZ L;  3K0Y A;  3H3V I;  1GUW A;  2JA7 G;  5IYC G;  3R2T A;  1I4Q A;  1SND A;  1LV9 A;  4OIJ A;  3DEP A;  2N78 A;  5D3D A;  2VUM B;  1CI3 M;  5IT9 L;  2E76 C;  5M5Y B;  1TT2 A;  1PH7 A;  3U50 C;  2VY3 A;  3NHH A;  1WJJ A;  1G6P A;  1H9M A;  3CCM A;  4DK0 A;  4DV3 L;  4A3E B;  3GTQ H;  4KHP L;  2O5J C;  2NVQ H;  4BBR B;  4WJW A;  2F0W A;  1IBM L;  4GZY C;  1VQ4 A;  3PV0 A;  1J6Q A;  2PW7 A;  1D1K A;  3FP9 A;  1XJV A;  4G57 A;  1TWF H;  2PI2 A;  1NBW A;  3SGI A;  1X9N A;  1EZ6 A;  3RZD H;  1PYS B;  3K5N A;  1STY A;  4PMW A;  4R4T A;  2XWJ B;  1QJO A;  2XRQ D;  4LFB L;  1KD1 C;  3G7L A;  2A8V A;  2KHS A;  3DM1 A;  4LF5 Q;  2JA6 H;  5CV8 A;  1YJ9 A;  3J81 i;  4B3T L;  2VQE L;  1PA6 A;  3KOJ A;  5I2X A;  1KRS A;  3RN2 A;  5EQ0 A;  4JBJ A;  4RHS A;  1VQ5 A;  1C0A A;  2UXC L;  5M5Y H;  3GTK H;  3PO2 G;  1IZ6 A;  2CW0 D;  2FFK B;  4MZ9 A;  2I0Q A;  4EGV A;  1HZB A;  1S5D D;  1SMY C;  4DV7 L;  5M5X B;  1SNC A;  1E1T A;  1IL8 A;  4HN7 A;  3MEH A;  1F2Z A;  1DXM A;  1EZ8 A;  2JA8 G;  3I4L A;  4CJ2 C;  5C3E H;  3S2D H;  1BNZ A;  2E2I B;  3A0J A;  3HOW H;  3WWV A;  4A3L G;  4BY7 H;  2K5Q A;  2EYO A;  1Y14 B;  3GTO B;  3HOZ H;  4P73 A;  3CC4 A;  4AIM A;  2FIN B;  4CJ1 B;  1K28 A;  4JCV E;  1O7Z A;  2EZV A;  4N9T A;  2MUY A;  1AH9 A;  3M4Q A;  3RD4 A;  4RFB A;  4LW1 A;  4LF4 Q;  1JQY D;  3C46 A;  1TWC H;  3CC2 A;  4IUQ A;  4C1N I;  1N33 Q;  2F4V L;  1B44 D;  2IHE A;  3KUP A;  3T1Y L;  4DR2 L;  4PV1 C;  1PFS A;  1R4Q B;  2EYF A;  5KRU A;  3KLS X;  3NBH B;  3NQI A;  5EBD A;  1R4P B;  4JW0 A;  3HOX G;  4A3E G;  2L0C A;  1SSO A;  1DOM A;  3RZO H;  1Q86 C;  2HDM A;  3J81 E;  1TXY A;  2EY2 A;  2OXP A;  2BH8 A;  4P74 A;  3WDN A;  1B2T A;  2UXD Q;  1HJP A;  5C4Z A;  2XSC A;  1Q46 A;  3PF4 A;  3MHB A;  2F0G A;  5C3X A;  3VYT A;  5ELN A;  2F0H A;  4K6L A;  3A5U A;  2B2T C;  3GTO H;  5ELE A;  1RDP D;  3PO2 H;  1EY5 A;  3ND8 A;  3E9I A;  1B50 A;  5IYB H;  3E0J A;  2UXB L;  1LTI D;  2F0S A;  3MZ5 A;  5CC4 A;  4A4I A;  3S24 A;  1XNR L;  2F0M A;  1JB7 A;  5IYD H;  1KC8 C;  1XMO Q;  1TS2 A;  2PI2 E;  4GKJ Q;  4C3J H;  4IO9 A;  4C56 C;  5M5X H;  4GOP C;  2WP8 J;  2ENB A;  2MQH A;  1Z6H A;  2F4I A;  2F0O A;  3UDF A;  4DUY L;  4DAP A;  3I2Z A;  3A74 A;  2OEO A;  4ME5 A;  1M8A A;  2MGS A;  4GN5 A;  5C5M A;  1LUZ A;  5H1S E;  3LNN A;  5C44 G;  4FF1 A;  4J8Q A;  1B3A A;  1X54 A;  3F8T A;  4RGM A;  5BN3 A;  2BOS A;  3H15 A;  2QEJ C;  1OO9 B;  1HNW Q;  2N8N A;  4DXG A;  3KLR A;  2B8F A;  5JEA H;  3OTO L;  1HPC A;  2Q8R E;  5E1F A;  2A69 C;  1LO5 D;  2ZTC A;  3HGB A;  1XPO A;  3D4R A;  4FF4 A;  3FKI H;  3CC7 A;  3M4Y A;  3G71 A;  1IBK L;  4JOI A;  3JAM i;  3A55 A;  5C0X J;  5EJW A;  4AYB B;  2L5T A;  3TRZ A;  1X3F A;  1B9M A;  2AWO A;  4H02 A;  2UU9 Q;  1A15 A;  4KKS A;  2PMZ B;  2EDG A;  4X3T A;  5BN4 A;  4G7H C;  1LTA D;  1Q8I A;  3D6C A;  4IAL A;  1S5B D;  3A7A B;  3J7A F;  1I6H B;  1B4O A;  2A68 D;  4FO2 A;  3ULL A;  1M4V A;  3U58 A;  1X6O A;  1H9K A;  3D6W A;  1JMC A;  3FPU B;  2DNE A;  4DV0 L;  4A3F G;  3H3V C;  3NBI A;  2ICI A;  3H09 A;  4O1N A;  5CV4 A;  1WCM B;  1F9S A;  2R7Z H;  2NTS A;  2PZT A;  1DCZ A;  1Q90 A;  2EY1 A;  2EYH A;  2Q2I A;  1JJG A;  3BVZ A;  4P71 A;  3G48 A;  2R92 B;  4V0B A;  1Q81 C;  2YU9 H;  2OQK A;  3KLS A;  1HH2 P;  1X3E A;  2MJ8 A;  2R7Z B;  1KTK A;  1LTB D;  1Q1B A;  4LUV A;  3X3M A;  3TSS A;  1VQK A;  4OWW B;  2A6H C;  2R93 B;  2KA7 A;  3DWA A;  4YCW A;  5JJZ A;  1VCI A;  2H5X A;  4AQY L;  4OEL B;  3A8J E;  2WB1 G;  5C3E B;  2A5H A;  1SR3 A;  5FK9 C;  3J7Z C;  1IXR A;  1JE5 A;  4A3J B;  3MAQ A;  4K0K L;  1E0B A;  1QE6 A;  5GRO A;  3FVQ A;  3RLO A;  2RSN A;  3QR8 A;  1WTX A;  4HIO A;  1E24 A;  2RCN A;  1I94 Q;  2HUG A;  3OWF A;  3CD6 A;  1DZ1 A;  4BBS G;  3K57 A;  3FPP A;  2K5W A;  1K83 H;  2G9H D;  2B39 A;  1YHA A;  2KCT A;  1SYF A;  1K3R A;  3E3X A;  3NXW A;  3S1M B;  1QWY A;  4I7A A;  1SN8 A;  5GAG C;  4LF5 L;  2VB3 X;  5M9O A;  3PF5 A;  1N36 L;  1YNX A;  4OX9 Q;  3K5M A;  1LTR D;  4UPA A;  3HOU B;  5JEA J;  4IOC A;  4ODG A;  4HMI A;  2UXC Q;  3T1H Q;  2B29 A;  1CUK A;  3H0G G;  2Z9H A;  4BY1 H;  5IY0 A;  1NUC A;  4U68 A;  1PH5 A;  4IZ8 A;  1D1I A;  3DWP A;  1PFM A;  4DV7 Q;  4JI4 L;  3BS1 A;  2IWH A;  4IUN A;  4MTN A;  3FKI G;  2KEC A;  3J80 E;  2A19 A;  3A56 A;  1GKH A;  1SYB A;  3DHQ A;  1NR2 A;  1U5K A;  3E6Z X;  4R4Q A;  4TKO B;  3G6J B;  4KD4 A;  1N34 L;  3AEV A;  5AJ3 Q;  2EXZ A;  2K7V A;  3QB3 A;  3SK4 A;  4RA8 A;  1H9R A;  1B53 A;  1CFM A;  2N3S A;  4LF7 L;  4CDD C;  2O4X A;  4NMZ A;  3TME A;  3CQZ B;  4IPC A;  3A8I E;  5FO7 B;  5ELD A;  1XXG A;  1KNE A;  3UE1 A;  1VQC A;  2E2H H;  1T9H A;  4Y52 H;  3S1Q H;  3NTI A;  4JI2 Q;  1D5Z C;  1I3Q H;  4JI3 Q;  5COY A;  3QG1 A;  2JA8 B;  1OXX K;  4WFN 3;  1B7Y B;  4CDC C;  5IOD A;  4DAV A;  1IYJ B;  5A2Q L;  2AQ2 B;  1ASY A;  1BBW A;  1Z7T A;  2ZXP A;  1QIL A;  1VQM A;  1IW7 C;  1PH4 A;  3NEL A;  2UUC L;  3MC0 B;  1A62 A;  3S17 H;  2B2V A;  2KVM A;  4GKK L;  2D0P A;  3KJO A;  2PZU A;  3I56 A;  1CA6 A;  3G4S A;  3MA2 B;  1I6V C;  2GN5 A;  1PH1 A;  2EY5 A;  1PFB A;  5C4X G;  2YV5 A;  4JC0 A;  5GQO A;  1TU2 B;  4C3H G;  2R6G A;  1PRT D;  1TWA H;  2UXB Q;  3CCQ A;  1MD2 D;  1HZ9 A;  1LT4 D;  2F0L A;  3S1Q B;  5LHY 1;  4A3F B;  1XNR Q;  4WJ4 A;  1S5F D;  3HOV B;  1L1O A;  4L5S A;  2NZO A;  4GKJ L;  5D3I B;  1S5E D;  3NTK A;  2EE1 A;  4LNQ A;  1E2W A;  4HSV A;  1EYA A;  4PZ6 A;  4FYD A;  1QUQ B;  3GTK B;  2JP1 A;  5IYD G;  4DUY Q;  2VS1 A;  5CV5 A;  2ZT9 C;  1PXU A;  5G3L F;  2B3G A;  2K52 A;  1BF4 A;  3EIV A;  4LF9 L;  5IT9 E;  3K7A B;  4PZ8 A;  3K6O A;  5FO8 B;  4HJ8 A;  3RNU A;  5CR3 A;  2RCF A;  1G2T A;  1KQS A;  2JA7 B;  1NCV A;  2NTT A;  1SMY D;  3F2C A;  1HNW L;  1WCM G;  1PH6 A;  1PZK D;  2FJ2 A;  3E9H A;  4JI7 L;  4BBS H;  2JJQ A;  1FJG L;  5CV9 A;  5GAE C;  2PQE A;  1PTO C;  4K5V A;  2J7Z A;  3BG3 A;  3A7L A;  5DM7 3;  5KIX A;  5FLX c;  4X6A H;  4XYO A;  2NN6 H;  2OT2 A;  1W3S A;  1I4X A;  1SRO A;  3CW2 C;  3ER0 A;  1NAP A;  4XQN A;  5IWA L;  1EIG A;  1VQF A;  1ILP A;  3W1G A;  3CCJ A;  3HOV G;  3ERQ A;  4A3D G;  1DYQ A;  4YY3 Q;  1GD7 A;  3UE0 A;  1VQI A;  4K8I A;  1OTC A;  1Y1V H;  1B3Q A;  4OIK A;  5LL6 S;  4MN3 A;  3M3Y B;  5C4X B;  3CU7 A;  3ULJ A;  2I5H A;  3NBH A;  4BY7 B;  2D2C C;  4LMQ D;  4DR3 Q;  1YIJ A;  4MHE A;  1S4Z A;  4C3J B;  1VS0 A;  4B3M L;  1GJX A;  2K75 A;  2F03 A;  3EBE A;  5EKK A;  1N8R C;  2QW7 A;  5IIF A;  1A2T A;  1BKB A;  3PUY A;  2VUM G;  1XNQ Q;  5C0X H;  2MFI A;  4L6T B;  3EVQ A;  1YNJ C;  1UUP A;  1EYG A;  4BXX G;  4ZUI A;  4HJ7 A;  4G7O C;  1ZYR D;  4JK1 C;  4DN4 M;  1PRT F;  2NZH A;  3QJY A;  5I9O A;  4A3I H;  3PO3 B;  1YIT A;  3S9W A;  3HFZ B;  2JA5 H;  3F2D A;  1NY4 A;  1I50 B;  1OXU A;  3VR2 A;  3RLN A;  3RLF A;  1PZI D;  4K0K Q;  3OYY A;  3GTM H;  1F9R A;  1V1O A;  2DY8 A;  1I4G A;  4R9W A;  1I94 L;  5D14 A;  2ZM6 Q;  1HRJ A;  2VZA A;  1GUS A;  4DUZ Q;  3MXP A;  3BDO A;  4RHR A;  3HOX H;  4MTK A;  1EU3 A;  4P72 A;  2IX1 A;  3S2H H;  1WTH A;  3O13 A;  3HOY B;  2IHF A;  4UP7 A;  4DXF A;  3RZO B;  4UAI A;  3GTG B;  5C44 B;  1P8L A;  2PO4 A;  4L5T A;  5M3M G;  3QWN A;  1JOR A;  4CKB A;  2L55 A;  1CM9 A;  3I72 A;  4A3G G;  1EEF D;  3K5O A;  1HHV A;  3ND9 A;  2TMP A;  3EA6 A;  4KHP Q;  1JCK B;  3S17 B;  4ZKB B;  1Z47 A;  2RQX A;  2A74 C;  1IBM Q;  1EIF A;  1YNN D;  3I91 A;  4A3B B;  5M3F H;  3LGJ A;  2OF1 A;  3T4A C;  2E8G A;  4Q0F A;  3VR3 A;  4N9P A;  1C9O A;  3CRL C;  2RA4 A;  2K05 A;  3SK8 A;  4A3G H;  3TEH B;  4JI8 Q;  1O7Y A;  1QOH A;  2VL6 A;  5EAY A;  3LX0 A;  5C5L A;  4YHH L;  5IGD A;  1U4P A;  1V9P A;  2CVR A;  4LAA A;  1QZG A;  1CKM A;  2K04 A;  5M3F G;  3J80 L;  5E4W C;  3M4O B;  4JOI C;  2K5N A;  1CQF A;  1TS5 A;  4CGY B;  3F2U A;  4TQU S;  1DOL A;  1ZXT A;  5CMD A;  2Y0S E;  3I90 A;  5KNB A;  3S1M H;  4LF7 Q;  2F0P A;  3J7A 5;  2A6H D;  1PRT C;  3VR4 A;  3L9A X;  4KY7 A;  1JOO A;  2IPK D;  3K80 C;  2K5D A;  3U4Z A;  4EQO A;  1HZA A;  4HMJ A;  4JI2 L;  3ZYY X;  4XXE A;  4A3J G;  4JI3 L;  4DU9 A;  1PHJ A;  4K6D A;  4ZYS A;  4LWC A;  1Y8O B;  4UDU C; 
#chains in the Genus database with same CATH homology
 1A2U A;  3SVM A;  1CT1 D;  2LFN A;  2F0N A;  3PUZ A;  5A2Q E;  1L0X B;  1JB3 A;  4R8N A;  3WOF A;  4Q5V A;  2R61 A;  5EKI A;  4BA2 I;  1U4L A;  3QO2 A;  3SK5 A;  1Q1E A;  1UAP A;  4A93 B;  3RMH A;  1AZP A;  3IAY A;  4CKE A;  3EQL C;  3P75 A;  1PTO F;  1EY6 A;  2L9H A;  1H9J A;  2E75 C;  5KEE A;  5EKL A;  1EY4 A;  3OIQ A;  1TWC B;  2F0T A;  3BZD B;  3W2D A;  2E74 C;  3I73 A;  2K1B A;  1ILQ A;  1HA5 A;  1CQV A;  1SE3 A;  2F3V A;  5ELF A;  5I4D A;  2XRS D;  4MIU A;  2PZW A;  3TP7 A;  4XQQ A;  5JVH 3;  2AUK A;  3TN2 A;  2NVY B;  3GTQ B;  2D62 A;  3MWY W;  4XIG S;  1NR4 A;  1STG A;  3I8Z A;  2KJX A;  1KNA A;  1EU4 A;  1YNJ D;  2MHV A;  3SXH A;  2AQ1 B;  3K58 A;  1MBY A;  5KND A;  4ZLT F;  1PDQ A;  1Q3L A;  2B2W C;  3T16 A;  2WKD A;  1CHQ D;  1D5X C;  4PQX A;  3V05 A;  2F0K A;  4QCL A;  1G29 1;  3DEO A;  3HRZ C;  2PPB C;  2PW5 A;  1DD2 A;  2I46 A;  4IUT A;  2ZXO A;  5C0X I;  1TS3 A;  2FMC A;  2YU9 B;  3KBG A;  1FYC A;  1MSG A;  2IJ0 A;  3GQB A;  1SNO A;  1VF7 A;  3GV6 A;  3L7Z C;  4U67 3;  3SE0 A;  3PMF A;  4ID6 A;  1F2L A;  1AP0 A;  4RAU C;  3IL8 A;  1Y69 U;  4IUU A;  2AQ3 B;  2KUM A;  3FRP B;  3NP8 A;  1BBX C;  2K33 A;  2F0J A;  2A68 C;  3OSO A;  4ZAI A;  2QCP X;  4IUV A;  1SXT A;  1PTO B;  5JPN C;  5IGG A;  1V1P B;  1WVL A;  4QUF A;  2CW0 C;  1TKW B;  3HZX A;  1WD0 A;  3NQT A;  2YYZ A;  2SEB D;  1LAC A;  1SDF A;  1CZG A;  3PUX A;  5CBE E;  3S15 B;  2Q8T A;  4C3I B;  1TWG B;  4DF7 A;  4KN7 C;  1RKN A;  2B2Y C;  4HED A;  4FXK C;  4HSP A;  2VNU D;  1SNM A;  1EY9 A;  4K5W A;  2JEB I;  4QB4 A;  3J7A V;  2IX0 A;  2F0I A;  1EQV A;  4HAE A;  2DN8 A;  3C2P A;  3NSW A;  5K36 G;  3CKI B;  2Z4H A;  5J22 A;  4RKL A;  2HCI A;  1JOQ A;  4IFD G;  2J4X A;  1EWH A;  5C0X G;  1EWC A;  1TY2 A;  3CRK C;  2EVB A;  3J7Y W;  1BOS A;  1EY8 A;  1MGS A;  4IFD J;  3M7N A;  2BDN A;  3R2I A;  1LTT D;  5E3F A;  4BS9 A;  2LMC B;  1B9N A;  1ET6 A;  3Q23 A;  2B2U C;  4KY6 A;  4H0L C;  4KTA A;  4RCO A;  2KOL A;  5KYL A;  1HTP A;  5I6Y A;  2NVT B;  1K8O A;  3L3O C;  1GOZ A;  2NWG A;  1CK1 A;  1SNQ A;  2MP1 A;  4KHZ A;  3BYT B;  1GHK A;  4J6H A;  4WOR A;  3HG9 A;  4R8I A;  2SDF A;  3DWQ A;  5AFW A;  4RGO S;  3MFY A;  2F0D A;  2C9O A;  4FP5 D;  1BCP D;  1SE4 A;  3AU7 A;  5BN5 A;  3H6M A;  1OXV A;  2H4O A;  1MI2 A;  4NKL A;  2D9U A;  2A6E C;  1GHJ A;  4FNF A;  5FO9 B;  2BA0 A;  5G3L D;  1PRT B;  1EEI D;  4ZKC B;  2R3Z A;  1DOK A;  2HCC A;  3MXU A;  3Q22 A;  1SYE A;  3IFD A;  2JE6 I;  3MXG A;  2EOT A;  1RJT A;  2X6L A;  3D31 A;  2KED A;  1YNN C;  1LLR D;  2SNS A;  1HFG A;  1I4P A;  1QNK A;  1LT6 D;  4A3D B;  4J1M A;  4X3K A;  4F88 A;  2QKI C;  3QOJ A;  2KEE A;  4KJO A;  2WB1 B;  3I4N B;  2IT1 A;  2QIL A;  2JEA I;  4OL7 A;  2ICE C;  1EY0 A;  5I6W A;  1IHZ A;  2RSO A;  2E2J B;  3NUC A;  3FKI B;  1HUM A;  2LY7 A;  1HTL D;  2EYP A;  3QIA A;  4KMU C;  4QMG A;  1BQQ T;  2QDB A;  1O80 A;  3ONA B;  2EYL A;  4JBW A;  4OHJ A;  1SNP A;  4FXD A;  4DGZ A;  4LJZ C;  2GA4 B;  3CHB D;  2XVS A;  4C2M B;  1HXY D;  4IQZ A;  5FLX E;  5F2D A;  3SDZ A;  5FOB B;  3GD7 A;  3VYS A;  1BCP F;  3E5S A;  1NSN S;  3GTJ B;  1X3Q A;  1WTO A;  3HS0 C;  1QCB D;  5JVG 3;  1JWU D;  1TII D;  1BUV T;  5M5W B;  4YIJ A;  3TP8 A;  1ET9 A;  2WIN B;  4KN4 C;  3WOE A;  3N6R A;  2NN6 G;  2Z1C A;  3GTL B;  4CJ0 B;  1TQO A;  5DM6 3;  5A35 A;  2H1E A;  1G2S A;  2Y0S B;  3EJI A;  4RGT A;  5EPK A;  1F9Q A;  2IX3 A;  3DUZ A;  4DA2 A;  2QF7 A;  4BBS B;  2KCN A;  1RCV D;  1JC7 A;  2KCC A;  2B2U A;  4RCN A;  3PIO 3;  1CTM A;  1WTV A;  1WTR A;  3HOW B;  4K8J A;  1ZKO A;  4BY1 B;  1TR5 A;  3DXJ C;  1RD9 D;  4HTH A;  1WTP A;  5EBC A;  4E6I A;  3NWS A;  4K5X A;  1HUN A;  1VF5 C;  1BCP C;  3BDC A;  4BA1 I;  4ZRZ A;  1SYC A;  3I70 A;  3NWT A;  1EYC A;  4A3G B;  4G7Z C;  1T5E A;  3GO5 A;  5JPM C;  4ZK9 B;  4ILW A;  5KYI A;  4A3I B;  1XX8 A;  3KF8 A;  2M2L A;  1S5C D;  1EYD A;  3P1H A;  1BO0 A;  1Q12 A;  4C1N K;  4DNR B;  4RWS C;  1I4R A;  4DK1 A;  1XTC D;  4IN3 A;  3D3R A;  3VA7 A;  1STB A;  3U9S A;  4PMC A;  3S1N B;  1JR0 D;  2SOB A;  1B1Z A;  3FEW X;  4KI0 A;  2JA5 B;  3LWU A;  5CGK A;  4CKC A;  1SYD A;  5JEA G;  2EJF C;  2M00 A;  1F77 A;  1EFI D;  4XT1 B;  5C4H A;  4C3J G;  1F2M A;  3D8G A;  3TDQ A;  1LTS D;  1OXT A;  4O42 A;  4KKT A;  3D4W A;  5C4J B;  2NUC A;  4K2L A;  3OMC A;  3RUZ A;  3T13 A;  3M7G A;  1ESF A;  1ICW A;  1GUN A;  2XWB B;  1BDO A;  2WKC A;  2XN9 C;  2CHB D;  1QNU A;  1D6E C;  1E2V A;  3TBI B;  2K01 A;  1PFN A;  5IGC A;  2EYM A;  4IUP A;  2K32 A;  1IYU A;  4QUC A;  1T5X D;  2B2T A;  1MSH A;  3MFG A;  5IGE A;  2MPM A;  3OMG A;  2B8G A;  2JYO A;  1WTQ A;  5EPJ A;  1SJE D;  1VMC A;  2NN6 I;  1KLU D;  3EFX D;  3J81 L;  5I2Y A;  1ENA A;  1Y8N B;  2JXM B;  2PYK A;  5T1G A;  5ELC A;  3NE5 B;  1GUO A;  1H9S A;  2M9V A;  3QOL A;  2E2H B;  4EQN A;  2RDH A;  1VMP A;  4EVO A;  2Q8I B;  1WD1 A;  3C3L A;  2AUJ D;  2NVX B;  2FMM A;  1RF2 D;  1A6X A;  3UI2 A;  3GTM B;  2RVL A;  3OHX C;  3HOZ B;  3PIP 3;  1V8Q A;  2WAC A;  4Y7N B;  3S2D B;  3I3C A;  4XTC S;  4OO1 I;  3HP3 A;  2K6A A;  4QIW B;  5EPL A;  2DY7 A;  4KKU A;  4P2C B;  1STH A;  3Q24 A;  3JAM L;  4OO1 G;  5COR A;  2LS0 1;  4M1U B;  1I3Q B;  4FF3 A;  4HCS A;  1CZW A;  1G91 A;  3MXN A;  1UEA B;  1J9O A;  1FR3 A;  1KLG D;  2B2W A;  1W6J A;  3H94 A;  2IL8 A;  4ABN A;  2NYZ D;  3TP5 A;  5CV6 A;  2L11 A;  3AB9 A;  3M85 A;  3Q6S A;  1U4R A;  1HFN A;  2F1M A;  3T56 B;  1O7L A;  3GP7 A;  1FNW A;  2WAQ B;  2EPB A;  3NK9 A;  4S3S A;  2BE5 C;  1A3T A;  1LTG D;  2F0E A;  3OIP A;  1K8M A;  1E2Z A;  3ERO A;  2ID0 A;  4B08 A;  4RKB A;  2EJG C;  2A73 B;  2B2V C;  3HOX B;  3S2H B;  4IFD H;  3DMU A;  3C1E A;  5FKA C;  1A3U A;  4LK1 C;  2VXW A;  1VDZ A;  4DAY A;  2K03 A;  4DFA A;  1AN8 A;  5M3M B;  1L0Y B;  3TP6 A;  3SEB A;  5CV7 A;  5TSS A;  4FF2 A;  2WV6 D;  4I65 A;  5I9P A;  2E2D C;  1DM0 B;  2HQE A;  1G8Z D;  5DNF A;  3K59 A;  1LT3 D;  2KQ3 A;  1JE4 A;  1RHP A;  1FNU A;  3I4M B;  1R9T B;  4KY5 A;  2NZ1 D;  3X3N A;  3MTS A;  4L63 B;  4KK7 A;  1Y1V B;  2C5C A;  3IKJ A;  2IW3 A;  1LAB A;  2HDL A;  4PMB A;  1C8C A;  3C1F A;  1X3P A;  2EY6 A;  3BDL A;  2RBM A;  1EL0 A;  1O78 A;  4H7B A;  1STN A;  2A6E D;  2A69 D;  3OWE B;  4KD3 A;  3T53 B;  3N52 A;  1KDC A;  3NTH A;  2XNA C;  3V2T A;  2TSS A;  1DON A;  3K5L A;  1C4Q A;  5C3W A;  5NUC A;  2DNC A;  3OOC A;  3V96 A;  4X3S A;  2RDG A;  3D4D A;  2BA1 A;  2RDF A;  4KHV A;  1CHP D;  2F3W A;  5IGB A;  1DJR D;  5DAU A;  3P7J A;  4IFD I;  2LKV A;  2SNM A;  2PCF B;  3LWE A;  3VR6 A;  1JWM D;  3BVM A;  3U9O A;  2G9D A;  4HCE A;  5M3F B;  3R3O A;  3OW7 A;  2X6G A;  3GV3 A;  1PMR A;  1SAP A;  1EOT A;  1AZQ A;  2J0T D;  1SBB B;  1JWS D;  1EIH A;  1GXD C;  1EY7 A;  4ZUJ A;  2RKS A;  1ENC A;  2FHT A;  2AWN A;  4I7Z C;  3OPO A;  2JSO A;  3P20 A;  1D2B A;  3ITP A;  2BE5 D;  4L8J A;  3URY A;  5JAV A;  1BCP B;  1PLF A;  2D5D A;  1TY0 A;  1II3 A;  1K83 B;  1U9R A;  1UNS A;  5J1Z A;  2X69 A;  3A8K E;  1SEB D;  3IFT A;  5KNC A;  3BYY B;  4NDX A;  1PTO H;  4C3H B;  4H44 C;  2I07 B;  5K36 H;  1SFO B;  1BR9 A;  4CBV A;  3RZD B;  4XQJ A;  1FD7 D;  3VYU A;  1GUT A;  5HGT A;  4B9X A;  3TZD A;  5DEH A;  1AW7 A;  1V43 A;  2Z8L A;  3PUV A;  3TZU A;  1EQT A;  4BWG B;  4A3M B;  5KGU A;  4A3K B;  2O5I C;  1F9P A;  1GUG A;  1TS4 A;  2EYJ A;  4IUR A;  1Y1W B;  2L12 A;  3MVV A;  4DNT B;  3NPP A;  2O2L D;  1STE A;  3FMC A;  3KBX A;  5CYU A;  1CA5 A;  1XWE A;  4K2K A;  5J39 A;  1FNV A;  1KAA A;  4NW2 A;  4EQP A;  3PUW A;  2NBF A;  1G6Z A;  1ESR A;  1J8I A;  2BCO A;  3A54 A;  1TVX A;  3SHL A;  3HEJ A;  2NVQ B;  2V4D A;  1SJH D;  2Z4I A;  1HQM C;  4ZQ3 A;  3H91 A;  1WTW A;  1LT5 D;  2EJM A;  1ML0 D;  4TRD A;  2L4N A;  4HR7 B;  1AFP A;  5E4X A;  5LL6 X;  4B9W A;  1KDB A;  4ULL A;  1PZJ D;  3H0G B;  1IYV A;  1QB5 D;  4X3U A;  5ELB A;  1ENF A;  1IKM A;  1X32 A;  4K14 A;  1F2Y A;  4V19 0;  3FDT A;  1KAB A;  3GTP B;  1TWA B;  3KK7 A;  1JIC A;  3R93 A;  2CQA A;  2PNR C;  4TSS A;  4FXG C;  4OGQ C;  1IW7 D;  2BDO A;  4M8A A;  3JAM E;  3Q0A A;  1H9S B;  5IOC A;  2F0V A;  5IGF A;  5FLX L;  2XIW A;  5CBA E;  1Y8P B;  4Z9C B;  4NP5 A;  1BXT A;  2F0U A;  5K5P A;  3VR5 A;  4RH6 A;  4RGN A;  1D5M C;  3S1R B;  5D65 A;  2K28 A;  4G4K A;  5HUR A;  1I4H A;  1PYW D;  3S16 B;  1XYI A;  3S14 B;  1A3V A;  5ISR A;  5EGT A;  4H13 C;  2N55 A;  5T1I A;  1C48 A;  4OO1 H;  4QF4 A;  4XT3 B;  1AEX A;  1IKL A;  2B63 B;  1W6K A;  4XYQ A;  3VYR A;  1TWF B;  2B2Y A;  1OXS C;  3W3A A;  2N88 A;  1PTO D;  2F0Q A;  4F87 A;  1TWH B;  4KJN A;  1FGB D;  1V1P A;  1KDA A;  4F7X A;  1ROD A;  4XDX A;  1ZEQ X;  3AMU A;  2VB2 X;  1ZYR C;  4FVM A;  1U4M A;  1ONL A;  3T51 B;  1HQR D;  3BVG A;  1STA A;  4PNY A;  3PO2 B;  2JA6 B;  5C6A A;  2F0F A;  3HKZ B;  3SR1 A;  1RTO A;  1SYG A;  3SK6 A;  4CHT B;  2ZXR A;  2L1B A;  3VA5 A;  1HA6 A;  2WII B;  1SE2 A;  4C3I G;  2NB0 A;  1HCZ A;  4F8M A;  4WRD A;  1RTN A;  4KV6 A;  5JOB A;  3R8B A;  1JOK A;  1QG7 A;  3K0Y A;  1GUW A;  3R2T A;  1I4Q A;  1SND A;  1LV9 A;  4OIJ A;  3DEP A;  5D3D A;  2VUM B;  1CI3 M;  5IT9 L;  2E76 C;  5M5Y B;  1TT2 A;  3NHH A;  1H9M A;  4DK0 A;  4A3E B;  2O5J C;  4BBR B;  4WJW A;  2F0W A;  4GZY C;  3PV0 A;  2PW7 A;  1D1K A;  4G57 A;  1EZ6 A;  3K5N A;  1STY A;  4PMW A;  2XWJ B;  1QJO A;  2XRQ D;  3G7L A;  2KHS A;  3DM1 A;  5CV8 A;  5I2X A;  5EQ0 A;  4RHS A;  2CW0 D;  2FFK B;  4EGV A;  1S5D D;  1SMY C;  5M5X B;  1SNC A;  1IL8 A;  4HN7 A;  3MEH A;  1F2Z A;  1DXM A;  1EZ8 A;  3I4L A;  4CJ2 C;  1BNZ A;  2E2I B;  2K5Q A;  2EYO A;  3GTO B;  2FIN B;  4CJ1 B;  1O7Z A;  2EZV A;  4N9T A;  2MUY A;  3RD4 A;  4RFB A;  1JQY D;  3C46 A;  4IUQ A;  4C1N I;  1B44 D;  3KUP A;  4PV1 C;  1R4Q B;  2EYF A;  5KRU A;  3KLS X;  3NQI A;  5EBD A;  1R4P B;  2L0C A;  1SSO A;  1DOM A;  2HDM A;  3J81 E;  2EY2 A;  2OXP A;  3WDN A;  1B2T A;  5C4Z A;  2XSC A;  3MHB A;  2F0G A;  5C3X A;  3VYT A;  2F0H A;  4K6L A;  2B2T C;  5ELE A;  1RDP D;  1EY5 A;  3ND8 A;  1B50 A;  3E0J A;  1LTI D;  2F0S A;  3MZ5 A;  5CC4 A;  2F0M A;  1TS2 A;  4C56 C;  2WP8 J;  2ENB A;  1Z6H A;  2F4I A;  2F0O A;  4DAP A;  2OEO A;  4ME5 A;  1M8A A;  2MGS A;  5C5M A;  4FF1 A;  3LNN A;  4J8Q A;  1B3A A;  4RGM A;  5BN3 A;  2BOS A;  2QEJ C;  1OO9 B;  4DXG A;  3KLR A;  2B8F A;  5JEA H;  1HPC A;  2Q8R E;  5E1F A;  2A69 C;  1LO5 D;  3HGB A;  4FF4 A;  3D4R A;  3M4Y A;  3A55 A;  5C0X J;  5EJW A;  4AYB B;  2L5T A;  1B9M A;  2AWO A;  1A15 A;  4KKS A;  2PMZ B;  2EDG A;  4X3T A;  5BN4 A;  4G7H C;  1LTA D;  1Q8I A;  3D6C A;  4IAL A;  1S5B D;  3A7A B;  3J7A F;  1I6H B;  1B4O A;  2A68 D;  4FO2 A;  1M4V A;  1H9K A;  3D6W A;  3FPU B;  2DNE A;  3H3V C;  3NBI A;  2ICI A;  3H09 A;  4O1N A;  5CV4 A;  1WCM B;  1F9S A;  2NTS A;  2PZT A;  1DCZ A;  1Q90 A;  2EY1 A;  2EYH A;  3BVZ A;  2R92 B;  4V0B A;  3KLS A;  2MJ8 A;  2R7Z B;  1KTK A;  1LTB D;  1Q1B A;  3X3M A;  3TSS A;  2A6H C;  2R93 B;  2KA7 A;  3DWA A;  5JJZ A;  1VCI A;  3A8J E;  5C3E B;  2A5H A;  5FK9 C;  4A3J B;  3MAQ A;  1E0B A;  1QE6 A;  3FVQ A;  2RSN A;  1WTX A;  2HUG A;  3OWF A;  1DZ1 A;  3K57 A;  3FPP A;  2K5W A;  2G9H D;  2B39 A;  1SYF A;  3S1M B;  3NXW A;  1QWY A;  2VB3 X;  5M9O A;  3K5M A;  1LTR D;  3HOU B;  5JEA J;  4HMI A;  4ODG A;  1NUC A;  4U68 A;  4IZ8 A;  1D1I A;  3DWP A;  1PFM A;  3BS1 A;  2IWH A;  4IUN A;  2KEC A;  3J80 E;  3A56 A;  1SYB A;  3DHQ A;  1NR2 A;  3E6Z X;  4TKO B;  3G6J B;  4KD4 A;  2EXZ A;  2K7V A;  3QB3 A;  3SK4 A;  4RA8 A;  1H9R A;  1B53 A;  1CFM A;  2O4X A;  4NMZ A;  3TME A;  3CQZ B;  3A8I E;  5FO7 B;  5ELD A;  1XXG A;  1KNE A;  3NTI A;  1D5Z C;  5COY A;  3QG1 A;  2JA8 B;  1OXX K;  4WFN 3;  5IOD A;  4DAV A;  5A2Q L;  2AQ2 B;  1Z7T A;  2ZXP A;  1QIL A;  1IW7 C;  3MC0 B;  2B2V A;  2KVM A;  2PZU A;  1CA6 A;  3MA2 B;  1I6V C;  2EY5 A;  1PFB A;  1TU2 B;  4C3H G;  2R6G A;  1PRT D;  1MD2 D;  1LT4 D;  2F0L A;  3S1Q B;  5LHY 1;  4A3F B;  1S5F D;  3HOV B;  5D3I B;  1S5E D;  3NTK A;  2EE1 A;  1E2W A;  4HSV A;  1EYA A;  4FYD A;  3GTK B;  2JP1 A;  5CV5 A;  2ZT9 C;  1PXU A;  5G3L F;  1BF4 A;  5IT9 E;  3K7A B;  3K6O A;  5FO8 B;  5CR3 A;  1G2T A;  2JA7 B;  1NCV A;  2NTT A;  1SMY D;  1PZK D;  2FJ2 A;  5CV9 A;  2PQE A;  1PTO C;  4K5V A;  2J7Z A;  3BG3 A;  3A7L A;  5DM7 3;  5KIX A;  4XYO A;  2NN6 H;  2OT2 A;  1I4X A;  4XQN A;  1NAP A;  1EIG A;  1ILP A;  3ERQ A;  1DYQ A;  4K8I A;  4OIK A;  5LL6 S;  4MN3 A;  3M3Y B;  5C4X B;  3CU7 A;  3NBH A;  4BY7 B;  2D2C C;  4LMQ D;  4MHE A;  1S4Z A;  4C3J B;  1GJX A;  2F03 A;  5EKK A;  5IIF A;  1A2T A;  3PUY A;  5C0X H;  4L6T B;  3EVQ A;  1YNJ C;  1UUP A;  4ZUI A;  4G7O C;  1ZYR D;  4JK1 C;  4DN4 M;  1PRT F;  3QJY A;  5I9O A;  3PO3 B;  3S9W A;  1I50 B;  1OXU A;  3VR2 A;  3RLF A;  1PZI D;  1F9R A;  1V1O A;  2DY8 A;  1I4G A;  4R9W A;  5D14 A;  1HRJ A;  1GUS A;  3MXP A;  3BDO A;  4RHR A;  2IX1 A;  1EU3 A;  3O13 A;  3HOY B;  3RZO B;  4DXF A;  4UAI A;  3GTG B;  5C44 B;  2PO4 A;  1JOR A;  3QWN A;  4CKB A;  2L55 A;  1CM9 A;  3I72 A;  1EEF D;  3K5O A;  1HHV A;  3ND9 A;  2TMP A;  3EA6 A;  1JCK B;  3S17 B;  4ZKB B;  1Z47 A;  2RQX A;  2A74 C;  1YNN D;  3I91 A;  4A3B B;  2OF1 A;  3T4A C;  4Q0F A;  3VR3 A;  4N9P A;  3CRL C;  2RA4 A;  2K05 A;  3SK8 A;  1O7Y A;  1QOH A;  3LX0 A;  5C5L A;  5IGD A;  1U4P A;  4LAA A;  2CVR A;  3M4O B;  2K04 A;  3J80 L;  5E4W C;  4CGY B;  1CQF A;  1TS5 A;  3F2U A;  4TQU S;  1DOL A;  1ZXT A;  5CMD A;  3I90 A;  5KNB A;  2F0P A;  2A6H D;  1PRT C;  3VR4 A;  3L9A X;  4KY7 A;  1JOO A;  2IPK D;  2K5D A;  4EQO A;  4HMJ A;  3ZYY X;  4XXE A;  4DU9 A;  4K6D A;  4ZYS A;  1Y8O B;  4UDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...