5ISRA

Crystal structure of staphylococcal nuclease variant delta+phs l38e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLEVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L38E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5isrA00
1JOKA 1STGA 5C4HA 1EYDA 5IGGA 4K2LA 4KY7A 5KGUA 3H6MA 3D6CA 5IGEA 5KYIA 4NDXA 1STAA 2O4XA 3NHHA 3NXWA 4EQNA 2F0UA 2F3WA 1II3A 1RKNA 2PYKA 4PMCA 3D4WA 1EY7A 3DHQA 2F0TA 5IODA 3MVVA 1KDCA 5K5PA 4N9TA 3R3OA 1KAAA 3HZXA 4K8JA 5C6AA 4IALA 4PNYA 3SXHA 5ISRA 5CR3A 2M00A 3ITPA 2WACA 5F2DA 3NQTA 4B9WA 3EVQA 4F7XA 2RDFA 4WRDA 1STBA 2QDBA 2EYMA 5CV9A 4KJOA 3C1EA 4K5XA 3TP8A 2EXZA 2F0HA 1EY9A 5IGBA 5C4ZA 5IOCA 2NUCA 4H7BA 3RUZA 1AEXA 1EZ6A 5CGKA 5J39A 5I6YA 1SYGA 4NKLA 3SHLA 3T16A 4DU9A 4EQOA 1ENAA 5HURA 5IIFA 2PQEA 3MZ5A 3SR1A 1SNOA 5CV8A 4ID6A 5JOBA 3NP8A 4ODGA 5IGFA 1EY6A 5I6WA 1SYEA 1KDBA 2LKVA 3SK6A 5M9OA 1TT2A 2EY5A 2PZUA 3NK9A 3NUCA 4HMJA 5HGTA 2EYPA 4NMZA 1STHA 2OXPA 3T13A 2EY6A 2PW7A 3MEHA 1NUCA 3ERQA 1NSNS 5EKLA 4KY5A 1KABA 4DFAA 5CC4A 3PMFA 4QMGA 1A3UA 2F0MA 4QB4A 2F0LA 5DAUA 5I9PA 5IGCA 3LX0A 4I65A 4IUNA 4DF7A 2RBMA 1SYBA 2ENBA 2F0GA 4KHVA 3TP5A 2EYLA 1U9RA 3SK5A 3TMEA 4YIJA 5CV5A 4QF4A 4G57A 4B9XA 4ZQ3A 2HQEA 3P1HA 4E6IA 3EROA 1SYDA 4ZUJA 4J1MA 1A3VA 1STNA 2KQ3A 2EY1A 5J1ZA 4HMIA 2F0VA 5E1FA 2F0JA 1JOOA 2PW5A 4MIUA 2OEOA 3DMUA 1SNDA 3BDLA 1F2ZA 4IZ8A 4HTHA 2F0PA 5E3FA 4ZUIA 2F0KA 5KIXA 2F0SA 4RKBA 5I9OA 5EKKA 4ME5A 4K6DA 4DGZA 2EYHA 3D8GA 4N9PA 5C5LA 2EY2A 4K8IA 4KD4A 3TP7A 4NP5A 1SNCA 2F0OA 1SYFA 5IGDA 1SNQA 2PZWA 5CV4A 4EQPA 2F0DA 4K14A 3OMGA 4KJNA 3V2TA 2EYFA 5JAVA 5KYLA 1A2TA 1EY0A 1SYCA 5C3XA 4PMBA 3HEJA 5CV7A 5KEEA 1EY4A 4KD3A 5EGTA 1TQOA 3BDCA 4KTAA 2F0NA 3U9OA 3SK8A 1F2MA 5C5MA 2F0QA 1SNPA 3OMCA 4R8NA 1EZ8A 3E5SA 4OL7A 2EYJA 2F0FA 1EYCA 1EYAA 1EY8A 3EJIA 1ENCA 3P75A 4F8MA 2SOBA 4EVOA 3QB3A 2RKSA 5DEHA 5CV6A 5NUCA 5KRUA 3TP6A 4WORA 2SNMA 1A2UA 2F0WA 3QOLA 1STYA 4KV6A 4KY6A 3OWFA 5C3WA 4TRDA 1EY5A 2F3VA 3C1FA 1SNMA 4K5WA 4S3SA 1IHZA 3MXPA 4J6HA 2PZTA 4LAAA 1EQVA 1KDAA 4K2KA 3QOJA 1A3TA 2F0IA 3D4DA 1F2YA 2EYOA 2F0EA 2OF1A 4RKLA 3SK4A 3OSOA 1TR5A 2KHSA 1JORA 3S9WA 2SNSA 3MHBA 3VA5A 5J22A 4K5VA 1JOQA
chains in the Genus database with same CATH superfamily
4AQYL 2CKZB 3S1QB 3OOCA 1DD2A 2VW9A 3CW2C 2YTVA 2FMMA 2EJFC 1RDPD 4RGMA 2KHJA 3K6OA 4HJ9A 4RWSC 1X6OA 4JI4Q 4N9TA 4IOCA 1KAAA 1TWCB 3VR2A 4C3IB 2K5HA 5ELDA 1YNJD 3GD7A 3CCEA 3LGJA 1XTDA 1MIUA 3AU7A 2K33A 1OO9B 5I6YA 2WB1E 2DGYA 1G2SA 3KLSX 3SEBA 2KEEA 2EXDA 4DUYL 2F4IA 4HCSA 4M8AA 2E2HB 3UDGA 4YWMA 5GAEC 1Q81C 5BR8Q 5JJKA 1MSHA 3CC7A 3K0YA 4DR5L 4KMUC 2PNRC 2UUAQ 2RBMA 1WOCA 2E2JH 2CH4A 1EWCA 3NBIA 3SK5A 2EPBA 2E74C 1E2WA 1NCVA 4G57A 1HUNA 1PYBA 3S24A 2QILA 5J1ZA 1FNVA 2UXDQ 4B3RL 2OEOA 3PF4A 1I4PA 1WTVA 3GTKB 1K83H 2B2TC 3S1RB 2QCPX 2F0KA 3MC0B 2JA6H 3I4MG 3K81C 3MXUA 2R92H 1JE4A 3RMHA 5DM63 1KAWA 1QG7A 1R4QB 2E2DC 4F88A 4DNRB 4X62L 2AWOA 1PVOA 3CCVA 2CQOA 3CC2A 1T9HA 1UE1A 3KYHC 4LF5Q 1L1OA 4GKJL 4WJ3M 1HFNA 1U4LA 1KLUD 1X3FA 4CGYB 5FOBB 3E0EA 4F87A 4CJ0B 4RFBA 3R2IA 2NTTA 4KKTA 4LUZA 4DK6C 1N8RC 4B3TQ 2XGTA 1K28A 2J7ZA 4L5SA 4WORA 2RCNA 2I5HA 2SNMA 2UXCQ 1GM5A 3CMEA 1PH5A 2IL8A 2J4XA 2DN8A 1A3TA 1S5BD 1RIPA 2VB2X 4XQQA 5C3EB 1E3PA 4P72A 1HA6A 1NAPA 1SMYD 2Z9HA 1YIJA 2BA0A 2RVLA 2BE5D 4UHVA 2F0UA 1V1OA 3K80C 4IPDA 3GTPB 1XNRL 4C2MH 3M3YH 5K5PA 4JI6Q 5FO7B 3NBHA 3JAMc 1NTGA 5FLXL 3GTJB 4X64Q 3ITPA 3OTOL 4B9WA 1N33Q 2R7ZB 1QNUA 2PO4A 5IGBA 4DR3Q 3I91A 1K3RA 4EQOA 2D0OA 4DV7L 4JG2A 2L11A 4IUQA 4C3JH 3CKIB 1RJTA 4ODGA 4JI2L 4BXXG 1PXUA 3E9HA 3NK9A 5HGTA 4YWKA 3EFXD 1QZGA 2R93B 2Q2HA 4FXDA 3T13A 2R7DA 2L1BA 3ERQA 1R9TB 1ILPA 4A93G 1IW7C 5CYUA 4GKKL 4A3KB 4DR7L 4QCLA 3H91A 1B8AA 4KHVA 1G291 3HOYB 2KENA 4JBJA 1XPOA 3MFYA 1AE3A 2QGQA 4G4KA 4ZUJA 3VR5A 5C0XH 2KQ3A 2N78A 3RN5A 4HIMA 3DMUA 4JYAL 2ZTCA 1F2ZA 3CRLC 1MI2A 1UUPA 4DV4Q 1SFOB 3NSWA 3L9AX 4CDEC 1G91A 4BBSB 1I3QH 2IX3A 5JJZA 3CC4A 5IGDA 4LF6L 4R8IA 2EYFA 5KNCA 1GVPA 1RTNA 1L0WA 5EAYA 1E2ZA 2Z6BA 4C3HH 4CHTB 4KD3A 1OXXK 4CJ1B 5GROA 1SJHD 4YHHL 3CCSA 4JI3Q 1EYCA 4OXPA 4AIMA 4A3FG 5DLQE 5IYCH 2EZVA 4EVOA 3MWYW 2NN6G 1ICFB 5D65A 1A2UA 2B2YA 4K5WA 1L1OB 2PZTA 3TS2A 1B3AA 2Z4HA 3CRKC 2B2WC 2EYOA 3BYYB 1VQOA 2SNSA 2CQAA 3VA5A 1HTLD 5LL6S 2IJ0A 3KDFA 1SRUA 1STEA 1MSGA 1QUQA 3T53B 1CQFA 1RD9D 2JE6I 1VQ5A 1VS0A 3MFGA 2OWOA 2WIIB 2X69A 4HIOA 3G71A 2HHHL 2WINB 3NTIA 1A63A 4GNXB 1TY0A 1CSPA 1N36L 3R3OA 4OO1I 3W2DA 4OIJA 1DOKA 4NPSA 4CDFC 1YZ6A 3I90A 4X3TA 1G6ZA 4H7BA 2B39A 1PYSB 2KCTA 4X66L 4A3CG 1TU2B 4BY1G 4DV2Q 2UUCQ 3NBHB 1ZEQX 5C0XJ 3ULJA 2K7VA 2LSSA 1EU3A 2D2CC 3URYA 4U673 3NUCA 4HR7B 4L5TA 1GD7A 1Q7YC 2EY6A 2PNHA 3HOVG 2CH4W 3R2TA 2B63G 1KL9A 2F0MA 5I9PA 5IT9c 3JC66 2F0GA 1LYLA 2VUMH 1VQ9A 2ZT9C 4DK3C 4ZK9B 2PMZE 3S15H 2BH2A 4UDUC 3I3CA 3U9SA 4LMQD 3PV0A 2WB1G 3TZUA 3FPUB 2K5QA 3T1YL 1JWUD 1S4ZA 3GTGB 2JA8H 1L2FA 4JK1C 3BZCA 1XPUA 4IUTA 1QZHA 5C5LA 3F8TA 3QO2A 1GUNA 1SE8A 4O1NA 2PZWA 2A6HC 1B7YB 3AYHB 1X3GA 2C5CA 5M5YB 1YNXA 5KEEA 3LWUA 3CP0A 2O2LD 3H09A 1W3SA 5C44H 4R8NA 5IYBH 1E24A 1UWVA 3DWPA 4OL7A 2JYOA 1VQMA 2Z6KC 2CW0D 3MXNA 3LWEA 4MHEA 2K5VA 2KOLA 1XXGA 5D3DA 3X3MA 3J80i 4X65L 2NVQH 4GLAC 3TQYA 1HNXL 3I70A 4A3IB 4NXNL 5HGQA 2K4KA 4PMWA 1Y1VG 1K73C 1HR0L 3HOXH 2XSCA 2KCCA 5J22A 4YCWA 3G6JB 3H0GB 1I50B 4IFDH 5IT9E 5KGUA 4JI8Q 2HCCA 2M2LA 1II3A 1RHPA 1WCMH 1ESFA 3HP3A 3I7FA 1BKBA 1QE6A 2KUMA 1XMQQ 2JEAI 1SEBD 3S2HB 3T51B 1WI5A 3IKJA 5CR3A 1YNND 1S5CD 1XMOQ 3HOWH 1SROA 2EOTA 4CKBA 4A3EB 2YU9H 2I5MX 1QUQB 4RHSA 3GV3A 4BBRB 4HSPA 1B53A 1CSQA 1GOZA 4R4TA 4QUCA 3Q6SA 5ELCA 2RA4A 2OTLA 2EYPA 3OW7A 3M7NA 1Q8IA 4C3IG 5LHY1 4CBVA 3J81L 4QMGA 3L7ZC 4KKUA 1RODA 5IGCA 2Y0SB 3EA6A 3F1ZA 1F9PA 2HQEA 1TKWB 1U0LA 3QIAA 1U5KA 4LF4L 1DONA 1J6QA 2B29A 3K57A 3PO2H 3TN2A 1A62A 1S40A 1JT8A 3RN2A 3I4MH 3Q0AA 1C9OA 4DUZQ 3H3VH 2FINB 1A0IA 3CPWA 1IZ6A 2K28A 1KNEA 3ULLA 3W5OA 3A5UA 4HCEA 4LFCL 3DM1A 3RZOB 3SVMA 1EL0A 4DUYQ 2J0TD 1B2TA 3BDCA 2HQLA 3IFDA 2BOSA 3AEVA 4IFDJ 4IPCA 1GO3E 3QB3A 2L0CA 4DR5Q 1J8IA 4LF7L 1AZQA 1Y1WB 3PCOB 4G7OC 1TVXA 4DV1Q 5K36G 1EY5A 4GLXA 5DM73 1IHZA 3J81c 2JA5H 3HRZC 4R4IA 4ALPA 3BG3A 1Y8OB 5M5XB 2L12A 1TR5A 1S72A 1XNQQ 1W6KA 5M5WH 3OHXC 4IUUA 1TWFB 3KLRA 3M4OH 1VQHA 3M9BA 1D1IA 1EY7A 1YJWA 3D31A 3UDFA 2JJQA 5FO9B 1FNUA 1X54A 2HIXA 5ELBA 1HCZA 5C3EG 4A3GH 4A3MH 4X62Q 2F0HA 4M1UB 4GKJQ 2F3IA 4DU9A 1X3PA 2B2VC 3S1MB 1F2LA 3UE0A 5IIFA 3GTQH 2RCFA 1SNOA 4XT1B 2A8VA 1CHPD 1CFMA 1LTTD 2V4DA 3NP8A 1PH1A 2RSNA 1TWGH 2NVXH 4L8JA 3A7LA 2Y0SE 3NE5B 3U4ZA 4JOIC 1O7LA 1NUCA 4N8X1 2F4VQ 2R7ZG 3PO3H 4BA2I 3VR4A 1X32A 4A93H 1BCPC 1U9RA 1VQGA 2MPMA 1TS2A 4KN7C 5M3MB 3KLSA 3STBD 3P1HA 1VQFA 1O7ZA 2QEJC 2MO0A 2RQXA 3KUPA 3I56A 5LL6X 1H9SA 1STNA 2N3SA 5FO8B 1IKLA 4HMIA 4XDXA 1KXLA 4O0AA 2R93G 2JN4A 1VMPA 3K5OA 1I94L 2N49A 4FO2A 4DAMA 3NWTA 2XWJB 4WJ4A 4GN4B 4A3KG 3G4SA 2MP1A 2IW3A 3IL8A 3D8GA 1RF2D 2B2UC 3HOYG 1CQVA 4B3ML 4NP5A 1EQTA 2RHSB 2L9HA 1LABA 1QVCA 2VB3X 3DXJC 1JE5A 4JI5L 2QW7A 4DV7Q 4PMBA 1EQRA 2A6EC 4OWTB 4JI2Q 4TKOB 3SK8A 2NZ1D 3TBIB 3ER0A 2C35B 3I2ZA 3EJIA 1ENCA 5CBAE 5IP9G 3AMUA 4BBSG 1NE3A 4CDCC 1NMGA 4DR7Q 1PDQA 4LF8L 1PFNA 3DEPA 2D5DA 2KA7A 2E2JB 3A8JE 1WTXA 5G3LF 5FLMH 1EFID 3N52A 1GUOA 1U4RA 3FP9A 4JYAQ 2EIFA 2EJMA 2IX1A 2K5NA 2HCIA 1A8VA 2L15A 1ASZA 2AHOB 1SN8A 5D3IB 3AFPA 4GOPC 1K83B 5BN4A 1ONLA 1EIFA 2AKWB 2JA6B 1ENFA 1PTOC 3HZXA 5ISRA 2ICIA 5C6AA 2G5DA 2R92B 1R4PB 4P75A 4NXML 4LW1A 1D5MC 4KJOA 4K5XA 3I4NH 2EXZA 3S16B 2K32A 5C4ZA 5IOCA 1IBML 5CGKA 1AN8A 2FJ2A 4XYQA 2IT1A 4PQXA 3D3RA 2IX0A 3KLWA 4C56C 1TT2A 2A6HD 2B3GA 1OXSC 4OELB 3HOVH 2P5ZX 5CC4A 2K01A 4FF3A 4A3BH 1CZWA 3LX0A 1S3OA 1IKMA 1LACA 4HIDA 3M7GA 2MNAA 3OPOA 4IQZA 5JEAG 4E6IA 1DM0B 4PZ7A 3FEWX 2EY1A 2HUGA 1EWHA 1PTOH 1JOOA 3WWVA 2HHHQ 1N36Q 1D2BA 1HZBA 4BY7H 2KJXA 2PI2A 4C2MB 3NTKA 1XWEA 3M3YB 2ZTEA 4JV5L 2EY2A 1H9SB 4I7AA 1SR3A 2HD3A 4ZYSA 5KNBA 3T4AC 1SBBB 4DR1L 2YTXA 5KYLA 4HIKA 1ET9A 1Z47A 2BDOA 4H44C 1X9NA 2EDGA 4YY3L 4DR6L 4C3JB 3K59A 4A3DH 2H5XA 3KOJA 3J7AF 4JC0A 2LXKA 1ZYRC 5NUCA 3F2CA 3KJOA 4S3SA 4B3SQ 3I8ZA 3KBXA 1GUTA 1KD1C 1GUGA 1V1PA 1YHBA 4MNOA 5EBDA 3PIPA 4KHPL 3N6RA 4V190 4FF4A 4EX5A 4RHRA 4PZ8A 5JPMC 1VQBA 2I0QA 1DGSA 2HIVA 1WD0A 4TVAB 4A75A 1PH7A 4DXGA 4C1NI 3DM3A 4PMCA 3D4WA 5IP7H 2UXBQ 5CMDA 1EEID 4A3IG 3TRZA 5D14A 5F2DA 4F7XA 3EVQA 1STBA 1JCKB 1I3QB 2EYMA 1GKHA 4L5QA 2ZXRA 3H0GG 2K50A 3C3LA 3FDTA 4LNQA 4NKLA 3SHLA 2EVBA 4C3HB 3NQIA 3J7YW 1BBWA 1VQ8A 1B70B 1EY6A 4JPBW 4OGQC 1B9NA 1U4MA 1AP0A 4X65Q 1TWCH 4C3IH 1V9PA 1HNXQ 3MXGA 1KABA 4A3EG 3PMFA 3IRBA 4NXNQ 1HR0Q 5JVH3 3CXCA 4BBRG 4RCOA 2XIWA 2UU9L 1K9MC 1VQCA 3EROA 5C4XB 3QR8A 4RA8A 5JPNC 4JI1Q 2Q2TA 3RD4A 1KRTA 3KFUA 3NELA 1WVLA 4JI0L 1PFBA 3SE0A 1YITA 1JJCB 3NWSA 4HTHA 3G6EA 5EQ0A 1PH2A 4RGNA 4XQNA 4A3JH 2ZXOA 2Z6KA 1YVCA 4JW0A 2Y0SG 1PZKD 4K8IA 4KD4A 4ZKCB 3JAMi 5I4DA 2KBNA 3OMGA 1B50A 2JEBI 3QJYA 4EQ5A 1NR2A 4KLKA 4RG1A 4FXGC 1CHQD 2LY7A 5E7NA 1F2MA 4ME3A 1NMFA 1QB5D 1DYQA 1N9WA 1EYAA 1VQAA 2QKIC 1VDZA 3E9IA 1C4QA 3CCLA 1ESRA 4A4IA 4J6HA 3CQZH 2RDHA 1BCPF 4Y7NH 2D62A 5FLXc 3A54A 2DNCA 1KQSA 4R9WA 2VUMB 4LF4Q 4X6AH 3RNUA 1VQIA 3S15B 4RH6A 4O42A 3JAME 2ZM6L 1STAA 2XN9C 3BS1A 1Y1WG 3NEMA 3P7JA 4FF1A 1V1PB 3VR3A 3PIP3 4OO1H 2JA8B 3VYSA 3BYTB 2CFMA 4A3LH 1VF5C 4LFCQ 1WTPA 1VQ6A 3HOZB 2A69C 4UPAA 2AQ3B 5ELEA 1ENAA 2NWGA 2VXWA 4JBKA 1JMCA 1J5EQ 2JA7B 5C44B 1PRTB 2LKVA 3SK6A 1CA6A 4LF7Q 4OEMB 1STHA 1E0BA 3A56A 1CKMA 3FKIB 3UDIA 3HOUH 1GHJA 3H94A 5T1IA 1E2VA 1LUZA 2R6GA 3S1NB 2A6ED 1TWAH 2DUDA 3QWNA 3U4VA 2NVQB 1BOSA 3CCMA 2LMCB 4LK1C 1A15A 2FFKB 2NB0A 1I6HH 5A2QL 3X3NA 2A74C 3HOXB 4J1MA 1WTRA 3J80L 4LF9L 4OWWB 1GJXA 1JC7A 1ILQA 2K5WA 5FLXE 3DUZA 3WOFA 3RZDH 1WCMB 1LT3D 1M8AA 1SXTA 1PTOF 2MHVA 5M3MG 4Q0FA 4POFA 1PYWD 1IBKQ 1YBYA 2UUAL 2ZJRA 3HOWB 2YU9B 2R7FA 1L1OC 5I2XA 1EY0A 5FJ8H 3FVQA 1TWHH 4IJLA 1LT6D 5AJ3L 1PTOD 4KTAA 1IYUA 3OMCA 2L55A 3E5SA 1UE7A 2YV5A 1M4VA 1LT5D 2KEDA 4F8MA 3PIOA 4TSSA 4G7ZC 2BCOA 2CCZA 1RL2A 4P73A 3M85A 1VQPA 2F3VA 1CKOA 4XYOA 4GNXC 1EQVA 4BS9A 1HNZQ 2UUBL 3DWAA 4IURA 3I55A 1Q1EA 2O5JC 3V05A 1WD1A 1DOMA 1JOQA 5A35A 5C4HA 3UE1A 3CD6A 1UAPA 3PUWA 2NYZD 3NHHA 1D7QA 3PO2B 1FR3A 1JB3A 4B3TL 4J15A 2F0TA 2KCNA 4DA2A 4DK1A 4HJ5A 3UDXA 4DXFA 2UXCL 4YWLA 1K0SA 4JI5Q 2K1BA 2FXQA 2V1CC 3CCRA 1GXDC 2NVTH 3CPFA 3TP8A 1Q90A 1NJIC 1DXMA 2K6AA 3VYRA 1AEXA 2QDLA 3EN2A 5J39A 2TMPA 3S2DB 2SEBD 3VA7A 2VNUD 3M4PA 3MZ5A 1AW7A 5KNDA 1YNJC 1PH6A 2VL6A 3MA2B 2EY5A 2YYZA 3F2DA 4FDBA 2JA6G 3WDNA 1EU4A 4LF8Q 2CHBD 4AH6A 4DV5Q 2R92G 1JICA 4DV6L 1A3UA 3AB9A 2Z8LA 3KDFB 1SYBA 5BN3A 2B2UA 5EJWA 3SDZA 2VQEL 2JA5B 1BF4A 4DR3L 2E5LL 1EOVA 3VYUA 3GV6A 3BDLA 4DV3L 2RF4A 3KF8A 3M4OB 3GTLH 4NB3A 5I9OA 1OXVA 4C1NK 1IYJB 3TDQA 3GTMH 4ZAIA 4KJNA 1HZCA 4A3GB 4A3MB 5LMUL 1SYCA 4R4OA 4AQYQ 1EY4A 3GO5A 2Q8TA 1YI2A 3CF5A 2HDMA 2OT2A 3U9OA 2F0NA 3FRPB 4AYBB 1O7IA 2E2IB 1C48A 3GTQB 4KN4C 3TZDA 1EY8A 3GTOH 3K5MA 1TWGB 2NVXB 5DEHA 2MFIA 1N34L 2PQAA 3J81j 4DR4L 1YJNA 4DV4L 4O2DA 3U58A 4EGVA 3PO3B 1LTID 5M5YH 1QVFA 1TS3A 2KVMA 1UEAB 3KF6A 4LFAL 4LUVA 1G2TA 2NTSA 3PIO3 4GZYC 1CKNA 2RSOA 4C3JG 4QGUA 1AE2A 5EPLA 4HJ8A 4ZCKA 2A1AA 1HH2P 3RLNA 1H95A 4JBWA 4R1JA 2QEXA 4JV5Q 3MVVA 3EIVA 5GADC 1Q82C 4DR1Q 1HA5A 3VYTA 1B1ZA 4HEDA 3K7AH 5AFWA 2DY8A 3H0GH 2XNAC 4YY3Q 5C0XG 3MXNB 4DR6Q 3CAMA 4B3RQ 3OWEB 4XXEA 2F03A 1HZAA 4PZ6A 1HR0W 2FHTA 1L0YB 1IW7D 2AQ1B 2ATWA 4LFBL 4IPHA 1ZKOA 4IUPA 4DKAC 1H9MA 4G7HC 2WKDA 3RR5A 3HGBA 1KRSA 5ELOA 4QJFA 4DF7A 1FL0A 2N55A 2ENBA 3D0FA 3T56B 4XT3B 2DJFC 3I4OA 1CZGA 1JWMD 1KNAA 4C3HG 3J81i 3ERSX 3MTSA 4XTCS 1BDOA 5J3BA 1BQQT 2DJGC 2PW5A 1EYGA 2WKCA 2Q8IB 5IYCG 4BXXH 3S17H 1PA6A 1PHJA 1HQMC 1EUJA 4DAVA 3A74A 4JVZA 2B2TA 3BVMA 4DPGA 1WTQA 3NENA 1JB7A 2ZTDA 1EFWA 3TP7A 1KTKA 2F0OA 4RMFA 1Q46A 1SNQA 4P2CB 5C4XG 3I4NB 3S14H 3KF8B 1MKHA 5EGTA 4OX9L 1K0RA 5M3FB 2PCFB 1Q3LA 5C5MA 1E22A 1XJVA 3K8AA 1XNRQ 3J81E 4KK7A 2SOBA 1V43A 1IL2A 2ZJPA 4WJWA 3PUZA 2LXJA 1DJRD 4FP5D 4KY6A 3OIPA 3OTOQ 4TRDA 3MXPA 2K52A 4A3BB 1HXYD 2F0IA 1SE4A 2K14A 1LM0A 3M4YA 2JK8A 5E4XA 1F9RA 5DNFA 1L0XB 2PQAB 3TREA 1DZ1A 3AQQA 4JI0Q 4KY7A 4B08A 3K5NA 1PTOB 1C0AA 1HHVA 4R4QA 4XQJA 4A3FH 1YJ9A 1SAPA 3DHQA 2NN6H 4BY7B 4DV0L 4GKKQ 4DN4M 1CKNB 1BVSA 4FNFA 2WACA 3R8BA 2ES2A 3E6ZX 2VUMG 4GS3A 1M1KC 2BA1A 3RUZA 3CHBD 3EBEA 1SYGA 3T16A 3KK7A 1B9MA 2ID0A 2VZAA 1KDBA 3A8KE 4A3DB 2JA8G 3G48A 5G3LD 3K0XA 4QIWB 5IYDG 5EKLA 4KY5A 1LT4D 1N32L 4LF6Q 3HOZG 3L3OC 1PLFA 4DR2L 1UNSA 1H9RA 4CJ2C 1WTWA 2ZM6Q 5LMNL 2JA7G 5C44G 1D5ZC 5IYBG 4YHHQ 4A3CH 5L37A 1SMXA 4BY1H 4KKSA 1LTAD 3FKIG 1Z6HA 2F0PA 2XRSD 2YTYA 1VQNA 4Y52H 4ME5A 3WOEA 3U50C 2I46A 2B63H 1SNCA 1SYFA 4H0LC 3V2TA 2VY3A 3HOXG 2VQFL 5IY0A 1KHIA 1GHKA 1TIID 5C3XA 5IWAL 5CV7A 4YCUA 3G7LA 3ND9A 4IO9A 4IFDG 3A55A 1SNPA 2EE1A 4X3KA 1TY2A 1WCMG 2F0FA 3P75A 1ICWA 1O78A 1Z7TA 4QY7A 4UP7A 5TSSA 1VCIA 1K8GA 3KJPA 1I6VC 2RHQB 3TEHB 5KRUA 4OWXB 4DUZL 1D5XC 3HOWG 3GDEA 1MD2D 3L2PA 3HKSA 2CW0C 1FJGL 4Q5VA 5C4JH 3W1GA 4X66Q 3S9WA 2F52A 4LF9Q 2B2WA 3PQIA 4DNTB 1SDFA 1STGA 2I5LX 4K2LA 4IUVA 4JI7L 2M9VA 1MGSA 3Q8DA 1PH4A 1D8LA 3L0OA 4N8FA 5IODA 1C7YA 4K0KL 4A3JB 4PNYA 3BJUA 2NBFA 2M00A 4DV1L 2RDFA 2K04A 2NVYH 5AJ3Q 1Y1VH 1HZ9A 3TSSA 3J7AV 1YNNC 1A6XA 1XNQL 3PO2G 4QIWE 1LTSD 5IGFA 3T1YQ 5M9OA 4CKCA 3BZKA 1MHWC 3JAML 3BVGA 4NMZA 3CCJA 1KIXA 2BDNA 3VDYA 5EBCA 1EEFD 1Z9FA 1MJEA 2Z0SA 2UUBQ 5DAUA 3S16H 3BVZA 3CQZB 2R3ZA 1IBLL 2MQHA 3TMEA 1I4XA 1I5FA 4Y7NB 1H9JA 4QF4A 4B9XA 1VQ7A 3C46A 1K3BC 3DWQA 2JXMB 1SYDA 3S1QH 3FMCA 5E1FA 4HAEA 4MZ9A 4CDDC 5LMNW 2DNEA 1OXTA 2K75A 3ONAB 5ELNA 1FVIA 4MTNA 4HSVA 2WAQB 1QCBD 4QL5A 1XX8A 2F0SA 3PUVA 1Q1BA 1X65A 5EKKA 4K6DA 2F4VL 4CKEA 4PG3A 2JA5G 1EWIA 3GQBA 5CV4A 4EQPA 4V0BA 2F0DA 4K14A 4GNXA 1MJCA 1OXUA 1BBUA 3F2UA 4ABNA 3BDOA 1BO0A 3A5ZB 2E2HH 3OIQA 2B8FA 2I07B 1GUWA 4DV6Q 1F9QA 1PH8A 3HOUB 2F0WA 2GVBA 1I4RA 1TWAB 2VQEQ 4A3GG 1P8LA 2RDGA 4A3MG 2G9HD 1KDAA 2KECA 4K2KA 3QOJA 3P20A 3D4DA 1F2YA 1SJED 1JJGA 1WTHA 2KHSA 2E5LQ 4AYBG 1JR0D 1I6HB 2L5TA 1EYDA 1XYIA 3MEFA 4L5RC 3GTKH 3H6MA 4DV3Q 1LLRD 5KYIA 2GA4B 2O4XA 3S1RH 3NXWA 2AMCB 4RCNA 4EQNA 4ZLTF 2CVRA 1PH3A 3W3AA 2ZXPA 3RZDB 1KLGD 1X3EA 3PO3G 1IL8A 3E3XA 1QNKA 3K58A 3Q23A 5K36H 4WRDA 3H15A 1CTMA 2Q2UA 1B4OA 3MAQA 5LMUQ 1ML0D 2PPBC 3T1HL 3Q22A 3BZDB 3AFQA 1MBYA 4GLVB 1PMRA 1TWHB 2H1EA 2KHIA 2MUYA 5CV8A 1BCPD 2PMZB 1G8ZD 1RCVD 1N34Q 4DR4Q 4UAIA 3NTHA 4X3UA 3MEHA 4XIGS 3PSIA 1NSNS 4KI0A 3SGIA 4KHZA 1OTCA 1CI3M 4IUNA 3VR6A 1VQEA 4LFAQ 1AZPA 5C3EH 3HS0C 2GN5A 1HNWL 3HKZB 2WAQE 1K8MA 4DAPA 2KCMA 5C0XI 2ALYB 2IHEA 5ELFA 3GTPH 4IZ8A 1JWSD 3STBC 1ZXTA 4QQBX 5IT9L 4Z9CB 4H02A 1HUMA 3GTJH 1S5ED 4JI4L 2A5HA 2R7ZH 3O13A 3R93A 1VQKA 3D4RA 1BR9A 2G9DA 2IY5B 5JAVA 1LTRD 5FLMG 2NVTB 5C4XH 1NY4A 2L4NA 3HEJA 1J9OA 1TQOA 1E1OA 4LFBQ 2B8GA 1EZ8A 1M90C 2R93H 1VQJA 1WYDA 2HT1A 5E4WC 1R9TH 1X3QA 1P16A 2Q8RE 2X6LA 2MJ8A 5I6WA 5BR8L 2A68C 3OW2A 4A3KH 3CCUA 2A19A 3HOYH 3I4NG 2PI2E 1LV9A 2OF1A 3I4LA 4DK0A 4JBMA 5M3FG 1JORA 2CWPA 2E76C 2E75C 1F9SA 1G6PA 1Q8KA 4BWGB 1I4QA 1V8QA 2UXDL 3A8IE 1AFPA 1AH9A 4UY8C 2WFWA 2EJGC 1PRTC 1TS4A 3K7UC 1SFOH 5IP9H 3GTLB 4BBSH 4A3BG 4APVA 5CV9A 1B3QA 2JA9A 4B3SL 3GTMB 1EY9A 3J7A5 4OX9Q 2NUCA 4GN3B 1BXTA 1O7YA 1GUSA 3SR1A 2K5DA 3CMAA 1I94Q 1RTOA 2ZJQA 4LF5L 2B2VA 3OYYA 1D6EC 3J80c 3GTOB 4BY7G 1WJJA 2OXPA 2PW7A 4L6TB 1G51A 2UXBL 1S5DD 5IYDH 3QG1A 3W1BA 3HKZE 4DFAA 4B3MQ 3I4MB 4PV1C 4QB4A 4JOIA 3PUXA 4I65A 3TP5A 3HOZH 2EYLA 1LO5D 3IFTA 5CV5A 3Q24A 4FVMA 1DCZA 2H4OA 1VMCA 2LS01 2OTJA 2IHFA 3FPPA 2JA7H 2F0VA 2JQOA 2F0JA 4A3DG 2QF7A 4IPGA 1Y8PB 3FKIH 1SNDA 4K6LA 3S1NH 4DV0Q 5KIXA 4RKBA 1T5XD 1TXYA 4DGZA 1QWYA 2EYHA 1HQRD 5CBEE 5JVG3 4JI6L 3V96A 3KBGA 1IXRA 4U68A 1TS5A 4X64L 1CT1D 2E8GA 2MGSA 1N33L 5EPJA 1UE5A 3K7AB 1ZYRD 1PZJD 5JEAH 3IAYA 1Y8NB 3TS0A 1E1TA 4JI1L 5M5WB 1W6JA 2EYJA 1H9KA 5IP7G 2QA4A 5EKIA 2JP1A 2RKSA 5CV6A 4IOAA 1N32Q 4H13C 3CCQA 1SE3A 1T5EA 1JJ2A 4A76A 4NXMQ 4DR2Q 1B44D 5A2QE 4LAAA 5FK9C 3H3VC 1EIYB 2TSSA 1XPRA 4P74A 4IN3A 4RKLA 1IBMQ 3LNNA 3J80E 3HG9A 1NBWA 5LMNQ 1JQYD 1HRJA 3D6WA 3MHBA 1QJOA 1BBXC 4K5VA 2Z1CA 3A7AB 4IFDI 4NDXA 2OQKA 1EQQA 5H1SE 2F3WA 3GTGH 1RKNA 2R61A 4ZRZA 2PYKA 3S17B 4QUFA 2B2YC 3B6YA 2GVAA 1QVGA 1KDCA 3EQLC 4RGOS 3ZYYX 4K8JA 1V1QA 2LFNA 4IALA 4GOPA 1ASYA 1UE6A 1HJPA 2EQSA 3ND8A 5GQOA 2VQFQ 1FNWA 1SSOA 4A93B 3C1EA 5IWAQ 4JCVE 1FGUA 4RGTA 1VF7A 5HURA 3S14B 2PQEA 1PV4A 4DNIA 4ID6A 4YCVA 5T1GA 5JOBA 2XWBB 1SYEA 2PZUA 3GP7A 1ET6A 4A3JG 4JI3L 3ULPA 1BUVT 1LTLA 1SE2A 2HDLA 4NW2A 4DAYA 1D1KA 1SMYC 3C2PA 4A3IH 2F0LA 1FJGQ 3CU7A 1QILA 1PFSA 2BE5C 4ILWA 2AUKA 3UI2A 1YHQA 2A73B 3S2DH 4GN5A 5JJLA 3I73A 2WP8J 3DEOA 1I50H 4JI7Q 4I7ZC 5JEAJ 1K8AC 3PGZA 4MIUA 1Y14B 4OHJA 1WTOA 1J5EL 2NZOA 4WFN3 2IWHA 1CK1A 1EIHA 4K0KQ 4LWCA 4ZUIA 1BNZA 1UEBA 3S2HH 4A3FB 1BCPB 4P71A 4BA1I 3H3VI 1C8CA 4MTKA 1K8OA 4A3EH 2XRQD 4J8QA 4POGA 5CORA 5GAGC 4KHPQ 1CUKA 4FYDA 2XTIA 4BBRH 1YEZA 1LTGD 5I2YA 2FMCA 1PZID 2WAQG 2F1MA 3RLOA 4DV2L 2UUCL 4FXKC 2ASBA 4OO1G 1CA5A 1E7ZA 4A3LG 3QOLA 3M4QA 1STYA 3OWFA 1SNMA 1IBLQ 1PH9A 1EIGA 1Q12A 4AYBE 4HJAA 1QOHA 1IBKL 1O80A 4OIKA 1NR4A 3A0JA 2E2IH 2VS1A 1YHAA 1JOKA 4X3SA 5IGGA 2BH8A 3DLLA 2AQ2B 1FGBD 4OONA 1HFGA 1EOTA 3D6CA 5IGEA 4BY1B 3RLFA 4HN7A 3HOUG 3PUYA 3FHWA 2Z4IA 5HY6A 2AWNA 2A69D 2O5IC 1I4HA 3SXHA 3K5LA 2AUJD 2CWAA 3NQTA 3HOVB 2QDBA 2B63B 1F77A 4UP8A 2UU9Q 1HNZL 3RZOH 1Q86C 1EZ6A 2NZHA 1DOLA 4LUOA 3E0JA 3NPPA 1HTPA 4GOPB 1VQ4A 4HMJA 2WB1B 1Y1WH 3ZJYC 3KF6B 1VQDA 3ICEA 5COYA 5FKAC 2DY7A 2Q2IA 1Y69U 1CM9A 5M5XH 1XTCD 2C9OA 5EPKA 5FJ8G 3HFZB 4YIJA 4ZQ3A 2X6GA 5C4JB 4DAYB 2OQ0A 1A3VA 4ZKBB 2A68D 4UP9A 4HJ7A 1SLJA 1TWFH 4JI8L 5E3FA 1VQLA 5GAHC 1KC8C 4LJZC 1LTBD 2MO1A 2N8NA 1PRTF 2D0PA 1HPCA 2OCEA 2K05A 4MN3A 4DV5L 4N9PA 1XMQL 4R4CA 4TQUS 1I4GA 1U4PA 1X55A 3T1HQ 2K03A 2WV6D 3HKZG 5IE8A 4RAUC 1XMOL 1WFQA 3BU2A 2D9UA 2ICEC 2SDFA 1A2TA 5BN5A 3S1MH 2IPKD 2NVYB 1Y1VB 1PRTD 5JJIA 2F0QA 1FYCA 1PFMA 1S5FD 3I72A 4ULLA 4L63B 3F2BA 4FF2A 2XVSA 1FD7D 3TP6A 2NN6I 1IYVA 2N88A 4KV6A 5C3WA 3C1FA 3J7ZC 2JSOA 5M3MH 3PF5A 1HNWQ 1NNXA 1X56A 2F0EA 3SK4A 3OSOA 1W2BA 5M3FH 4IJHA
chains in the Genus database with same CATH topology
3S1QB 3OOCA 1DD2A 2FMMA 2EJFC 1RDPD 4RGMA 3K6OA 4RWSC 4N9TA 1KAAA 1TWCB 3VR2A 4C3IB 5ELDA 1YNJD 3GD7A 3AU7A 2K33A 1OO9B 5I6YA 1G2SA 3KLSX 3SEBA 2KEEA 2F4IA 4HCSA 4M8AA 2E2HB 1MSHA 3K0YA 4KMUC 2PNRC 2RBMA 1EWCA 3NBIA 3SK5A 2EPBA 2E74C 1E2WA 1NCVA 4G57A 1HUNA 2QILA 5J1ZA 1FNVA 2OEOA 1I4PA 1WTVA 3GTKB 2B2TC 3S1RB 2QCPX 2F0KA 3MC0B 3MXUA 1JE4A 3RMHA 5DM63 1QG7A 1R4QB 2E2DC 4F88A 4DNRB 2AWOA 1HFNA 1U4LA 1KLUD 4CGYB 5FOBB 4F87A 4CJ0B 4RFBA 3R2IA 2NTTA 4KKTA 2J7ZA 4WORA 2SNMA 2IL8A 2J4XA 2DN8A 1A3TA 1S5BD 2VB2X 4XQQA 5C3EB 1HA6A 1NAPA 1SMYD 2BA0A 2RVLA 2BE5D 2F0UA 1V1OA 3GTPB 5K5PA 5FO7B 3NBHA 5FLXL 3GTJB 3ITPA 4B9WA 2R7ZB 1QNUA 2PO4A 5IGBA 3I91A 4EQOA 2L11A 4IUQA 3CKIB 1RJTA 4ODGA 1PXUA 3NK9A 5HGTA 3EFXD 2R93B 4FXDA 3T13A 2L1BA 3ERQA 1R9TB 1ILPA 1IW7C 5CYUA 4A3KB 4QCLA 3H91A 4KHVA 1G291 3HOYB 3MFYA 4ZUJA 4G4KA 3VR5A 5C0XH 2KQ3A 3DMUA 1F2ZA 3CRLC 1MI2A 1UUPA 1SFOB 3NSWA 3L9AX 1G91A 4BBSB 2IX3A 5JJZA 5IGDA 4R8IA 2EYFA 5KNCA 1RTNA 4CHTB 4CJ1B 1E2ZA 4KD3A 1OXXK 1SJHD 1EYCA 2EZVA 4EVOA 3MWYW 2NN6G 5D65A 1A2UA 2B2YA 4K5WA 2PZTA 1B3AA 2Z4HA 3CRKC 2B2WC 2EYOA 3BYYB 2SNSA 2CQAA 3VA5A 1HTLD 5LL6S 2IJ0A 1STEA 1MSGA 3T53B 1CQFA 1RD9D 2JE6I 3MFGA 2WIIB 2X69A 2WINB 3NTIA 1TY0A 3R3OA 4OO1I 3W2DA 4OIJA 1DOKA 3I90A 4X3TA 1G6ZA 4H7BA 2B39A 1TU2B 1ZEQX 5C0XJ 2K7VA 1EU3A 2D2CC 3URYA 4U673 3NUCA 4HR7B 2EY6A 3R2TA 2F0MA 5I9PA 2F0GA 2ZT9C 4ZK9B 4UDUC 3I3CA 3U9SA 4LMQD 3PV0A 3TZUA 3FPUB 2K5QA 1JWUD 1S4ZA 3GTGB 4JK1C 4IUTA 5C5LA 3QO2A 1GUNA 4O1NA 2PZWA 2A6HC 5M5YB 2C5CA 5KEEA 3LWUA 2O2LD 3H09A 4R8NA 3DWPA 4OL7A 2JYOA 2CW0D 3MXNA 3LWEA 4MHEA 2KOLA 1XXGA 5D3DA 3X3MA 3I70A 4A3IB 4PMWA 2XSCA 2KCCA 5J22A 3G6JB 3H0GB 1I50B 4IFDH 5IT9E 5KGUA 2HCCA 2M2LA 1II3A 1RHPA 1ESFA 3HP3A 1QE6A 2KUMA 2JEAI 1SEBD 3S2HB 3T51B 3IKJA 5CR3A 1YNND 1S5CD 2EOTA 4CKBA 4A3EB 4RHSA 3GV3A 4BBRB 4HSPA 1B53A 1GOZA 4QUCA 3Q6SA 5ELCA 2RA4A 2EYPA 3OW7A 3M7NA 1Q8IA 4C3IG 5LHY1 4CBVA 3J81L 4QMGA 3L7ZC 4KKUA 1RODA 5IGCA 2Y0SB 3EA6A 1F9PA 2HQEA 1TKWB 3QIAA 1DONA 3K57A 3TN2A 3Q0AA 2FINB 2K28A 1KNEA 4HCEA 3DM1A 3RZOB 3SVMA 1EL0A 2J0TD 1B2TA 3BDCA 3IFDA 2BOSA 4IFDJ 3QB3A 2L0CA 1J8IA 1AZQA 1Y1WB 4G7OC 1TVXA 5K36G 1EY5A 5DM73 1IHZA 3HRZC 3BG3A 1Y8OB 5M5XB 2L12A 1TR5A 1W6KA 3OHXC 4IUUA 1TWFB 3KLRA 1D1IA 1EY7A 3D31A 5FO9B 1FNUA 5ELBA 1HCZA 2F0HA 4M1UB 4DU9A 1X3PA 2B2VC 3S1MB 1F2LA 5IIFA 1SNOA 4XT1B 1CHPD 1CFMA 1LTTD 2V4DA 3NP8A 2RSNA 4L8JA 3A7LA 3NE5B 1O7LA 1NUCA 4BA2I 3VR4A 1X32A 1BCPC 1U9RA 2MPMA 4KN7C 1TS2A 5M3MB 3KLSA 3P1HA 3KUPA 1O7ZA 2QEJC 2RQXA 5LL6X 1H9SA 1STNA 5FO8B 1IKLA 4HMIA 4XDXA 1VMPA 3K5OA 4FO2A 3NWTA 2XWJB 2MP1A 2IW3A 3IL8A 3D8GA 1RF2D 2B2UC 1CQVA 4NP5A 1EQTA 2L9HA 1LABA 2VB3X 3DXJC 4PMBA 2A6EC 4TKOB 3SK8A 2NZ1D 3TBIB 3EJIA 1ENCA 5CBAE 3AMUA 1PDQA 1PFNA 3DEPA 2D5DA 2KA7A 2E2JB 3A8JE 1WTXA 5G3LF 1EFID 3N52A 1GUOA 1U4RA 2IX1A 2EJMA 2HCIA 5D3IB 1K83B 5BN4A 1ONLA 2JA6B 1ENFA 1PTOC 3HZXA 5ISRA 2ICIA 5C6AA 2R92B 1R4PB 1D5MC 4KJOA 4K5XA 2EXZA 3S16B 2K32A 5C4ZA 5IOCA 5CGKA 1AN8A 2FJ2A 4XYQA 2IT1A 4PQXA 3D3RA 2IX0A 4C56C 1TT2A 2A6HD 1OXSC 5CC4A 2K01A 4FF3A 1CZWA 3LX0A 1IKMA 1LACA 3M7GA 3OPOA 4IQZA 5JEAG 4E6IA 1DM0B 3FEWX 2EY1A 2HUGA 1EWHA 1PTOH 1JOOA 1D2BA 2KJXA 4C2MB 3NTKA 1XWEA 3M3YB 2EY2A 1H9SB 4ZYSA 5KNBA 3T4AC 1SBBB 5KYLA 1ET9A 1Z47A 2BDOA 4H44C 2EDGA 4C3JB 3K59A 3J7AF 1ZYRC 5NUCA 4S3SA 3I8ZA 3KBXA 1GUTA 1GUGA 1V1PA 5EBDA 3N6RA 4V190 4FF4A 4RHRA 5JPMC 1WD0A 4DXGA 4C1NI 4PMCA 3D4WA 5CMDA 1EEID 5D14A 5F2DA 4F7XA 3EVQA 1STBA 1JCKB 1I3QB 2EYMA 2ZXRA 3C3LA 3FDTA 4NKLA 3SHLA 2EVBA 4C3HB 3NQIA 3J7YW 1EY6A 4OGQC 1B9NA 1U4MA 1AP0A 3MXGA 1KABA 3PMFA 5JVH3 4RCOA 2XIWA 3EROA 5C4XB 4RA8A 5JPNC 3RD4A 1WVLA 1PFBA 3SE0A 3NWSA 4HTHA 5EQ0A 4RGNA 4XQNA 2ZXOA 1PZKD 4K8IA 4KD4A 4ZKCB 5I4DA 3OMGA 1B50A 2JEBI 3QJYA 1NR2A 4FXGC 1CHQD 2LY7A 1F2MA 1QB5D 1DYQA 1EYAA 2QKIC 1VDZA 1C4QA 1ESRA 4J6HA 2RDHA 1BCPF 2D62A 3A54A 2DNCA 4R9WA 2VUMB 3S15B 4RH6A 4O42A 3JAME 1STAA 2XN9C 3BS1A 3P7JA 4FF1A 1V1PB 3VR3A 3PIP3 4OO1H 2JA8B 3VYSA 3BYTB 1VF5C 1WTPA 3HOZB 2A69C 5ELEA 2AQ3B 1ENAA 2NWGA 2VXWA 2JA7B 5C44B 1PRTB 2LKVA 3SK6A 1CA6A 1STHA 1E0BA 3A56A 3FKIB 1GHJA 3H94A 5T1IA 1E2VA 2R6GA 3S1NB 2A6ED 3QWNA 2NVQB 1BOSA 2LMCB 4LK1C 1A15A 2FFKB 2NB0A 5A2QL 3X3NA 2A74C 3HOXB 4J1MA 1WTRA 3J80L 1GJXA 1JC7A 1ILQA 2K5WA 5FLXE 3DUZA 3WOFA 1WCMB 1LT3D 1M8AA 1SXTA 1PTOF 2MHVA 4Q0FA 1PYWD 3HOWB 2YU9B 5I2XA 1EY0A 3FVQA 1LT6D 1PTOD 4KTAA 1IYUA 3OMCA 2L55A 3E5SA 1M4VA 1LT5D 2KEDA 4F8MA 4G7ZC 4TSSA 2BCOA 3M85A 2F3VA 4XYOA 1EQVA 4BS9A 3DWAA 4IURA 1Q1EA 2O5JC 3V05A 1WD1A 1DOMA 1JOQA 5A35A 5C4HA 1UAPA 3PUWA 2NYZD 3NHHA 3PO2B 1FR3A 1JB3A 2F0TA 2KCNA 4DA2A 4DK1A 4DXFA 2K1BA 1GXDC 3TP8A 1Q90A 1DXMA 2K6AA 3VYRA 1AEXA 5J39A 3S2DB 2TMPA 2SEBD 3VA7A 2VNUD 3MZ5A 1AW7A 5KNDA 1YNJC 3MA2B 2EY5A 2YYZA 3WDNA 1EU4A 2CHBD 1JICA 1A3UA 3AB9A 2Z8LA 1SYBA 5BN3A 2B2UA 5EJWA 3SDZA 2JA5B 1BF4A 3VYUA 3GV6A 3BDLA 3KF8A 3M4OB 5I9OA 1OXVA 4C1NK 3TDQA 4ZAIA 4KJNA 4A3GB 4A3MB 1SYCA 1EY4A 3GO5A 2Q8TA 2HDMA 2OT2A 3U9OA 2F0NA 3FRPB 4AYBB 2E2IB 1C48A 3GTQB 4KN4C 3TZDA 1EY8A 3K5MA 1TWGB 2NVXB 5DEHA 4EGVA 3PO3B 1LTID 1TS3A 2KVMA 1UEAB 1G2TA 2NTSA 3PIO3 4GZYC 2RSOA 4C3JG 5EPLA 4JBWA 3MVVA 1HA5A 3VYTA 1B1ZA 4HEDA 5AFWA 2DY8A 2XNAC 5C0XG 3OWEB 4XXEA 2F03A 2FHTA 1L0YB 1IW7D 2AQ1B 1ZKOA 4IUPA 1H9MA 4G7HC 2WKDA 3HGBA 4DF7A 2N55A 2ENBA 3T56B 4XT3B 1CZGA 1JWMD 1KNAA 4C3HG 3MTSA 4XTCS 1BDOA 1BQQT 2PW5A 2WKCA 2Q8IB 1HQMC 4DAVA 2B2TA 3BVMA 1WTQA 3TP7A 1KTKA 2F0OA 1SNQA 4P2CB 3I4NB 5EGTA 5M3FB 2PCFB 1Q3LA 5C5MA 3J81E 4KK7A 2SOBA 1V43A 4WJWA 3PUZA 1DJRD 4FP5D 4KY6A 3OIPA 4TRDA 3MXPA 4A3BB 1HXYD 2F0IA 1SE4A 3M4YA 5E4XA 1F9RA 5DNFA 1L0XB 1DZ1A 4KY7A 4B08A 3K5NA 1PTOB 1HHVA 4XQJA 1SAPA 3DHQA 2NN6H 4BY7B 4DN4M 4FNFA 2WACA 3R8BA 3E6ZX 2BA1A 3RUZA 3CHBD 1SYGA 3T16A 3KK7A 1B9MA 2ID0A 1KDBA 3A8KE 4A3DB 5G3LD 4QIWB 5EKLA 4KY5A 1LT4D 3L3OC 1PLFA 1UNSA 1H9RA 4CJ2C 1WTWA 1D5ZC 4KKSA 1LTAD 1Z6HA 2F0PA 2XRSD 4ME5A 3WOEA 2I46A 1SNCA 1SYFA 4H0LC 3V2TA 1GHKA 1TIID 5C3XA 5CV7A 3G7LA 3ND9A 4IFDG 3A55A 1SNPA 2EE1A 4X3KA 1TY2A 2F0FA 3P75A 1ICWA 1O78A 1Z7TA 5TSSA 1VCIA 1I6VC 5KRUA 1D5XC 1MD2D 2CW0C 4Q5VA 3S9WA 2B2WA 4DNTB 1SDFA 1STGA 4K2LA 4IUVA 2M9VA 1MGSA 5IODA 4A3JB 4PNYA 2NBFA 2M00A 2RDFA 2K04A 3TSSA 3J7AV 1YNNC 1A6XA 1LTSD 5IGFA 5M9OA 4CKCA 3JAML 3BVGA 4NMZA 2BDNA 5EBCA 1EEFD 5DAUA 3BVZA 3CQZB 2R3ZA 3TMEA 1I4XA 4Y7NB 1H9JA 4QF4A 4B9XA 3C46A 3DWQA 2JXMB 1SYDA 3FMCA 5E1FA 4HAEA 2DNEA 1OXTA 3ONAB 4HSVA 2WAQB 1QCBD 1XX8A 2F0SA 3PUVA 1Q1BA 5EKKA 4K6DA 4CKEA 3GQBA 5CV4A 4EQPA 4V0BA 2F0DA 4K14A 1OXUA 3F2UA 4ABNA 3BDOA 1BO0A 3OIQA 2B8FA 2I07B 1GUWA 1F9QA 3HOUB 2F0WA 1I4RA 1TWAB 2RDGA 2G9HD 1KDAA 2KECA 4K2KA 3QOJA 3P20A 3D4DA 1F2YA 1SJED 2KHSA 1JR0D 1I6HB 2L5TA 1EYDA 1XYIA 3H6MA 1LLRD 5KYIA 2GA4B 2O4XA 3NXWA 4RCNA 4EQNA 4ZLTF 2CVRA 3W3AA 2ZXPA 3RZDB 1KLGD 1IL8A 1QNKA 3K58A 3Q23A 5K36H 4WRDA 1CTMA 1B4OA 3MAQA 1ML0D 2PPBC 3Q22A 3BZDB 1MBYA 1PMRA 1TWHB 2H1EA 2MUYA 5CV8A 1BCPD 2PMZB 1G8ZD 1RCVD 4UAIA 3NTHA 4X3UA 3MEHA 4XIGS 1NSNS 4KI0A 4KHZA 1CI3M 4IUNA 3VR6A 1AZPA 3HS0C 3HKZB 1K8MA 4DAPA 5C0XI 5ELFA 4IZ8A 1JWSD 1ZXTA 5IT9L 4Z9CB 1HUMA 1S5ED 2A5HA 3O13A 3R93A 3D4RA 1BR9A 2G9DA 5JAVA 1LTRD 2NVTB 2L4NA 3HEJA 1J9OA 1TQOA 2B8GA 1EZ8A 5E4WC 1X3QA 2Q8RE 2X6LA 2MJ8A 5I6WA 2A68C 1LV9A 2OF1A 3I4LA 4DK0A 1JORA 2E76C 2E75C 1F9SA 4BWGB 1I4QA 1V8QA 3A8IE 1AFPA 2EJGC 1PRTC 1TS4A 3GTLB 5CV9A 3GTMB 1EY9A 2NUCA 1BXTA 1O7YA 1GUSA 3SR1A 2K5DA 1RTOA 2B2VA 1D6EC 3GTOB 2OXPA 2PW7A 4L6TB 1S5DD 3QG1A 3I4MB 4DFAA 4PV1C 4QB4A 3PUXA 4I65A 3TP5A 2EYLA 1LO5D 3IFTA 5CV5A 3Q24A 4FVMA 1DCZA 2H4OA 1VMCA 2LS01 3FPPA 2F0VA 2F0JA 2QF7A 1Y8PB 1SNDA 4K6LA 5KIXA 4RKBA 1T5XD 4DGZA 1QWYA 2EYHA 1HQRD 5CBEE 5JVG3 3V96A 3KBGA 4U68A 1TS5A 1CT1D 2MGSA 5EPJA 3K7AB 1ZYRD 1PZJD 5JEAH 3IAYA 1Y8NB 5M5WB 1W6JA 2EYJA 1H9KA 5EKIA 2JP1A 2RKSA 5CV6A 4H13C 1SE3A 1T5EA 1B44D 5A2QE 4LAAA 5FK9C 3H3VC 2TSSA 4IN3A 4RKLA 3LNNA 3J80E 3HG9A 1JQYD 1HRJA 3D6WA 3MHBA 1QJOA 1BBXC 4K5VA 2Z1CA 3A7AB 4IFDI 4NDXA 2F3WA 1RKNA 2R61A 4ZRZA 2PYKA 3S17B 4QUFA 2B2YC 1KDCA 3EQLC 4RGOS 3ZYYX 4K8JA 2LFNA 4IALA 3ND8A 1FNWA 1SSOA 4A93B 3C1EA 4RGTA 1VF7A 5HURA 3S14B 2PQEA 4ID6A 5T1GA 5JOBA 2XWBB 1SYEA 2PZUA 3GP7A 1ET6A 1BUVT 4NW2A 1SE2A 2HDLA 4DAYA 1D1KA 1SMYC 3C2PA 2F0LA 3CU7A 1QILA 2BE5C 4ILWA 2AUKA 3UI2A 2A73B 3I73A 2WP8J 3DEOA 4I7ZC 5JEAJ 4MIUA 4OHJA 1WTOA 4WFN3 2IWHA 1CK1A 1EIHA 4ZUIA 1BNZA 4A3FB 1BCPB 4BA1I 1C8CA 1K8OA 2XRQD 4J8QA 5CORA 4FYDA 1LTGD 5I2YA 2FMCA 1PZID 2F1MA 4FXKC 4OO1G 1CA5A 3QOLA 1STYA 3OWFA 1SNMA 1EIGA 1Q12A 1QOHA 1O80A 4OIKA 1NR4A 1JOKA 4X3SA 5IGGA 2AQ2B 1FGBD 1HFGA 1EOTA 3D6CA 5IGEA 4BY1B 3RLFA 4HN7A 3PUYA 2Z4IA 2AWNA 2A69D 2O5IC 1I4HA 3SXHA 3K5LA 2AUJD 3NQTA 3HOVB 2QDBA 2B63B 1F77A 1EZ6A 1DOLA 3E0JA 3NPPA 1HTPA 4HMJA 2WB1B 5COYA 5FKAC 2DY7A 1Y69U 1CM9A 1XTCD 2C9OA 5EPKA 4YIJA 4ZQ3A 2X6GA 5C4JB 1A3VA 4ZKBB 2A68D 5E3FA 4LJZC 1LTBD 1PRTF 1HPCA 2K05A 4MN3A 4N9PA 4TQUS 1I4GA 1U4PA 2K03A 2WV6D 4RAUC 2D9UA 2ICEC 2SDFA 1A2TA 5BN5A 2IPKD 2NVYB 1Y1VB 1PRTD 2F0QA 1FYCA 1PFMA 1S5FD 3I72A 4ULLA 4L63B 4FF2A 2XVSA 1FD7D 3TP6A 2NN6I 1IYVA 2N88A 4KV6A 5C3WA 3C1FA 2JSOA 2F0EA 3SK4A 3OSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOK A;  1STG A;  5C4H A;  1EYD A;  5IGG A;  4K2L A;  4KY7 A;  5KGU A;  3H6M A;  3D6C A;  5IGE A;  5KYI A;  4NDX A;  1STA A;  2O4X A;  3NHH A;  3NXW A;  4EQN A;  2F0U A;  2F3W A;  1II3 A;  1RKN A;  2PYK A;  4PMC A;  3D4W A;  1EY7 A;  3DHQ A;  2F0T A;  5IOD A;  3MVV A;  1KDC A;  5K5P A;  4N9T A;  3R3O A;  1KAA A;  3HZX A;  4K8J A;  5C6A A;  4IAL A;  4PNY A;  3SXH A;  5ISR A;  5CR3 A;  2M00 A;  3ITP A;  2WAC A;  5F2D A;  3NQT A;  4B9W A;  3EVQ A;  4F7X A;  2RDF A;  4WRD A;  1STB A;  2QDB A;  2EYM A;  5CV9 A;  4KJO A;  3C1E A;  4K5X A;  3TP8 A;  2EXZ A;  2F0H A;  1EY9 A;  5IGB A;  5C4Z A;  5IOC A;  2NUC A;  4H7B A;  3RUZ A;  1AEX A;  1EZ6 A;  5CGK A;  5J39 A;  5I6Y A;  1SYG A;  4NKL A;  3SHL A;  3T16 A;  4DU9 A;  4EQO A;  1ENA A;  5HUR A;  5IIF A;  2PQE A;  3MZ5 A;  3SR1 A;  1SNO A;  5CV8 A;  4ID6 A;  5JOB A;  3NP8 A;  4ODG A;  5IGF A;  1EY6 A;  5I6W A;  1SYE A;  1KDB A;  2LKV A;  3SK6 A;  5M9O A;  1TT2 A;  2EY5 A;  2PZU A;  3NK9 A;  3NUC A;  4HMJ A;  5HGT A;  2EYP A;  4NMZ A;  1STH A;  2OXP A;  3T13 A;  2EY6 A;  2PW7 A;  3MEH A;  1NUC A;  3ERQ A;  1NSN S;  5EKL A;  4KY5 A;  1KAB A;  4DFA A;  5CC4 A;  3PMF A;  4QMG A;  1A3U A;  2F0M A;  4QB4 A;  2F0L A;  5DAU A;  5I9P A;  5IGC A;  3LX0 A;  4I65 A;  4IUN A;  4DF7 A;  2RBM A;  1SYB A;  2ENB A;  2F0G A;  4KHV A;  3TP5 A;  2EYL A;  1U9R A;  3SK5 A;  3TME A;  4YIJ A;  5CV5 A;  4QF4 A;  4G57 A;  4B9X A;  4ZQ3 A;  2HQE A;  3P1H A;  4E6I A;  3ERO A;  1SYD A;  4ZUJ A;  4J1M A;  1A3V A;  1STN A;  2KQ3 A;  2EY1 A;  5J1Z A;  4HMI A;  2F0V A;  5E1F A;  2F0J A;  1JOO A;  2PW5 A;  4MIU A;  2OEO A;  3DMU A;  1SND A;  3BDL A;  1F2Z A;  4IZ8 A;  4HTH A;  2F0P A;  5E3F A;  4ZUI A;  2F0K A;  5KIX A;  2F0S A;  4RKB A;  5I9O A;  5EKK A;  4ME5 A;  4K6D A;  4DGZ A;  2EYH A;  3D8G A;  4N9P A;  5C5L A;  2EY2 A;  4K8I A;  4KD4 A;  3TP7 A;  4NP5 A;  1SNC A;  2F0O A;  1SYF A;  5IGD A;  1SNQ A;  2PZW A;  5CV4 A;  4EQP A;  2F0D A;  4K14 A;  3OMG A;  4KJN A;  3V2T A;  2EYF A;  5JAV A;  5KYL A;  1A2T A;  1EY0 A;  1SYC A;  5C3X A;  4PMB A;  3HEJ A;  5CV7 A;  5KEE A;  1EY4 A;  4KD3 A;  5EGT A;  1TQO A;  3BDC A;  4KTA A;  2F0N A;  3U9O A;  3SK8 A;  1F2M A;  5C5M A;  2F0Q A;  1SNP A;  3OMC A;  4R8N A;  1EZ8 A;  3E5S A;  4OL7 A;  2EYJ A;  2F0F A;  1EYC A;  1EYA A;  1EY8 A;  3EJI A;  1ENC A;  3P75 A;  4F8M A;  2SOB A;  4EVO A;  3QB3 A;  2RKS A;  5DEH A;  5CV6 A;  5NUC A;  5KRU A;  3TP6 A;  4WOR A;  2SNM A;  1A2U A;  2F0W A;  3QOL A;  1STY A;  4KV6 A;  4KY6 A;  3OWF A;  5C3W A;  4TRD A;  1EY5 A;  2F3V A;  3C1F A;  1SNM A;  4K5W A;  4S3S A;  1IHZ A;  3MXP A;  4J6H A;  2PZT A;  4LAA A;  1EQV A;  1KDA A;  4K2K A;  3QOJ A;  1A3T A;  2F0I A;  3D4D A;  1F2Y A;  2EYO A;  2F0E A;  2OF1 A;  4RKL A;  3SK4 A;  3OSO A;  1TR5 A;  2KHS A;  1JOR A;  3S9W A;  2SNS A;  3MHB A;  3VA5 A;  5J22 A;  4K5V A;  1JOQ A; 
#chains in the Genus database with same CATH topology
 4AQY L;  2CKZ B;  3S1Q B;  3OOC A;  1DD2 A;  2VW9 A;  3CW2 C;  2YTV A;  2FMM A;  2EJF C;  1RDP D;  4RGM A;  2KHJ A;  3K6O A;  4HJ9 A;  4RWS C;  1X6O A;  4JI4 Q;  4N9T A;  4IOC A;  1KAA A;  1TWC B;  3VR2 A;  4C3I B;  2K5H A;  5ELD A;  1YNJ D;  3GD7 A;  3CCE A;  3LGJ A;  1XTD A;  1MIU A;  3AU7 A;  2K33 A;  1OO9 B;  5I6Y A;  2WB1 E;  2DGY A;  1G2S A;  3KLS X;  3SEB A;  2KEE A;  2EXD A;  4DUY L;  2F4I A;  4HCS A;  4M8A A;  2E2H B;  3UDG A;  4YWM A;  5GAE C;  1Q81 C;  5BR8 Q;  5JJK A;  1MSH A;  3CC7 A;  3K0Y A;  4DR5 L;  4KMU C;  2PNR C;  2UUA Q;  2RBM A;  1WOC A;  2E2J H;  2CH4 A;  1EWC A;  3NBI A;  3SK5 A;  2EPB A;  2E74 C;  1E2W A;  1NCV A;  4G57 A;  1HUN A;  1PYB A;  3S24 A;  2QIL A;  5J1Z A;  1FNV A;  2UXD Q;  4B3R L;  2OEO A;  3PF4 A;  1I4P A;  1WTV A;  3GTK B;  1K83 H;  2B2T C;  3S1R B;  2QCP X;  2F0K A;  3MC0 B;  2JA6 H;  3I4M G;  3K81 C;  3MXU A;  2R92 H;  1JE4 A;  3RMH A;  5DM6 3;  1KAW A;  1QG7 A;  1R4Q B;  2E2D C;  4F88 A;  4DNR B;  4X62 L;  2AWO A;  1PVO A;  3CCV A;  2CQO A;  3CC2 A;  1T9H A;  1UE1 A;  3KYH C;  4LF5 Q;  1L1O A;  4GKJ L;  4WJ3 M;  1HFN A;  1U4L A;  1KLU D;  1X3F A;  4CGY B;  5FOB B;  3E0E A;  4F87 A;  4CJ0 B;  4RFB A;  3R2I A;  2NTT A;  4KKT A;  4LUZ A;  4DK6 C;  1N8R C;  4B3T Q;  2XGT A;  1K28 A;  2J7Z A;  4L5S A;  4WOR A;  2RCN A;  2I5H A;  2SNM A;  2UXC Q;  1GM5 A;  3CME A;  1PH5 A;  2IL8 A;  2J4X A;  2DN8 A;  1A3T A;  1S5B D;  1RIP A;  2VB2 X;  4XQQ A;  5C3E B;  1E3P A;  4P72 A;  1HA6 A;  1NAP A;  1SMY D;  2Z9H A;  1YIJ A;  2BA0 A;  2RVL A;  2BE5 D;  4UHV A;  2F0U A;  1V1O A;  3K80 C;  4IPD A;  3GTP B;  1XNR L;  4C2M H;  3M3Y H;  5K5P A;  4JI6 Q;  5FO7 B;  3NBH A;  3JAM c;  1NTG A;  5FLX L;  3GTJ B;  4X64 Q;  3ITP A;  3OTO L;  4B9W A;  1N33 Q;  2R7Z B;  1QNU A;  2PO4 A;  5IGB A;  4DR3 Q;  3I91 A;  1K3R A;  4EQO A;  2D0O A;  4DV7 L;  4JG2 A;  2L11 A;  4IUQ A;  4C3J H;  3CKI B;  1RJT A;  4ODG A;  4JI2 L;  4BXX G;  1PXU A;  3E9H A;  3NK9 A;  5HGT A;  4YWK A;  3EFX D;  1QZG A;  2R93 B;  2Q2H A;  4FXD A;  3T13 A;  2R7D A;  2L1B A;  3ERQ A;  1R9T B;  1ILP A;  4A93 G;  1IW7 C;  5CYU A;  4GKK L;  4A3K B;  4DR7 L;  4QCL A;  3H91 A;  1B8A A;  4KHV A;  1G29 1;  3HOY B;  2KEN A;  4JBJ A;  1XPO A;  3MFY A;  1AE3 A;  2QGQ A;  4G4K A;  4ZUJ A;  3VR5 A;  5C0X H;  2KQ3 A;  2N78 A;  3RN5 A;  4HIM A;  3DMU A;  4JYA L;  2ZTC A;  1F2Z A;  3CRL C;  1MI2 A;  1UUP A;  4DV4 Q;  1SFO B;  3NSW A;  3L9A X;  4CDE C;  1G91 A;  4BBS B;  1I3Q H;  2IX3 A;  5JJZ A;  3CC4 A;  5IGD A;  4LF6 L;  4R8I A;  2EYF A;  5KNC A;  1GVP A;  1RTN A;  1L0W A;  5EAY A;  1E2Z A;  2Z6B A;  4C3H H;  4CHT B;  4KD3 A;  1OXX K;  4CJ1 B;  5GRO A;  1SJH D;  4YHH L;  3CCS A;  4JI3 Q;  1EYC A;  4OXP A;  4AIM A;  4A3F G;  5DLQ E;  5IYC H;  2EZV A;  4EVO A;  3MWY W;  2NN6 G;  1ICF B;  5D65 A;  1A2U A;  2B2Y A;  4K5W A;  1L1O B;  2PZT A;  3TS2 A;  1B3A A;  2Z4H A;  3CRK C;  2B2W C;  2EYO A;  3BYY B;  1VQO A;  2SNS A;  2CQA A;  3VA5 A;  1HTL D;  5LL6 S;  2IJ0 A;  3KDF A;  1SRU A;  1STE A;  1MSG A;  1QUQ A;  3T53 B;  1CQF A;  1RD9 D;  2JE6 I;  1VQ5 A;  1VS0 A;  3MFG A;  2OWO A;  2WII B;  2X69 A;  4HIO A;  3G71 A;  2HHH L;  2WIN B;  3NTI A;  1A63 A;  4GNX B;  1TY0 A;  1CSP A;  1N36 L;  3R3O A;  4OO1 I;  3W2D A;  4OIJ A;  1DOK A;  4NPS A;  4CDF C;  1YZ6 A;  3I90 A;  4X3T A;  1G6Z A;  4H7B A;  2B39 A;  1PYS B;  2KCT A;  4X66 L;  4A3C G;  1TU2 B;  4BY1 G;  4DV2 Q;  2UUC Q;  3NBH B;  1ZEQ X;  5C0X J;  3ULJ A;  2K7V A;  2LSS A;  1EU3 A;  2D2C C;  3URY A;  4U67 3;  3NUC A;  4HR7 B;  4L5T A;  1GD7 A;  1Q7Y C;  2EY6 A;  2PNH A;  3HOV G;  2CH4 W;  3R2T A;  2B63 G;  1KL9 A;  2F0M A;  5I9P A;  5IT9 c;  3JC6 6;  2F0G A;  1LYL A;  2VUM H;  1VQ9 A;  2ZT9 C;  4DK3 C;  4ZK9 B;  2PMZ E;  3S15 H;  2BH2 A;  4UDU C;  3I3C A;  3U9S A;  4LMQ D;  3PV0 A;  2WB1 G;  3TZU A;  3FPU B;  2K5Q A;  3T1Y L;  1JWU D;  1S4Z A;  3GTG B;  2JA8 H;  1L2F A;  4JK1 C;  3BZC A;  1XPU A;  4IUT A;  1QZH A;  5C5L A;  3F8T A;  3QO2 A;  1GUN A;  1SE8 A;  4O1N A;  2PZW A;  2A6H C;  1B7Y B;  3AYH B;  1X3G A;  2C5C A;  5M5Y B;  1YNX A;  5KEE A;  3LWU A;  3CP0 A;  2O2L D;  3H09 A;  1W3S A;  5C44 H;  4R8N A;  5IYB H;  1E24 A;  1UWV A;  3DWP A;  4OL7 A;  2JYO A;  1VQM A;  2Z6K C;  2CW0 D;  3MXN A;  3LWE A;  4MHE A;  2K5V A;  2KOL A;  1XXG A;  5D3D A;  3X3M A;  3J80 i;  4X65 L;  2NVQ H;  4GLA C;  3TQY A;  1HNX L;  3I70 A;  4A3I B;  4NXN L;  5HGQ A;  2K4K A;  4PMW A;  1Y1V G;  1K73 C;  1HR0 L;  3HOX H;  2XSC A;  2KCC A;  5J22 A;  4YCW A;  3G6J B;  3H0G B;  1I50 B;  4IFD H;  5IT9 E;  5KGU A;  4JI8 Q;  2HCC A;  2M2L A;  1II3 A;  1RHP A;  1WCM H;  1ESF A;  3HP3 A;  3I7F A;  1BKB A;  1QE6 A;  2KUM A;  1XMQ Q;  2JEA I;  1SEB D;  3S2H B;  3T51 B;  1WI5 A;  3IKJ A;  5CR3 A;  1YNN D;  1S5C D;  1XMO Q;  3HOW H;  1SRO A;  2EOT A;  4CKB A;  4A3E B;  2YU9 H;  2I5M X;  1QUQ B;  4RHS A;  3GV3 A;  4BBR B;  4HSP A;  1B53 A;  1CSQ A;  1GOZ A;  4R4T A;  4QUC A;  3Q6S A;  5ELC A;  2RA4 A;  2OTL A;  2EYP A;  3OW7 A;  3M7N A;  1Q8I A;  4C3I G;  5LHY 1;  4CBV A;  3J81 L;  4QMG A;  3L7Z C;  4KKU A;  1ROD A;  5IGC A;  2Y0S B;  3EA6 A;  3F1Z A;  1F9P A;  2HQE A;  1TKW B;  1U0L A;  3QIA A;  1U5K A;  4LF4 L;  1DON A;  1J6Q A;  2B29 A;  3K57 A;  3PO2 H;  3TN2 A;  1A62 A;  1S40 A;  1JT8 A;  3RN2 A;  3I4M H;  3Q0A A;  1C9O A;  4DUZ Q;  3H3V H;  2FIN B;  1A0I A;  3CPW A;  1IZ6 A;  2K28 A;  1KNE A;  3ULL A;  3W5O A;  3A5U A;  4HCE A;  4LFC L;  3DM1 A;  3RZO B;  3SVM A;  1EL0 A;  4DUY Q;  2J0T D;  1B2T A;  3BDC A;  2HQL A;  3IFD A;  2BOS A;  3AEV A;  4IFD J;  4IPC A;  1GO3 E;  3QB3 A;  2L0C A;  4DR5 Q;  1J8I A;  4LF7 L;  1AZQ A;  1Y1W B;  3PCO B;  4G7O C;  1TVX A;  4DV1 Q;  5K36 G;  1EY5 A;  4GLX A;  5DM7 3;  1IHZ A;  3J81 c;  2JA5 H;  3HRZ C;  4R4I A;  4ALP A;  3BG3 A;  1Y8O B;  5M5X B;  2L12 A;  1TR5 A;  1S72 A;  1XNQ Q;  1W6K A;  5M5W H;  3OHX C;  4IUU A;  1TWF B;  3KLR A;  3M4O H;  1VQH A;  3M9B A;  1D1I A;  1EY7 A;  1YJW A;  3D31 A;  3UDF A;  2JJQ A;  5FO9 B;  1FNU A;  1X54 A;  2HIX A;  5ELB A;  1HCZ A;  5C3E G;  4A3G H;  4A3M H;  4X62 Q;  2F0H A;  4M1U B;  4GKJ Q;  2F3I A;  4DU9 A;  1X3P A;  2B2V C;  3S1M B;  1F2L A;  3UE0 A;  5IIF A;  3GTQ H;  2RCF A;  1SNO A;  4XT1 B;  2A8V A;  1CHP D;  1CFM A;  1LTT D;  2V4D A;  3NP8 A;  1PH1 A;  2RSN A;  1TWG H;  2NVX H;  4L8J A;  3A7L A;  2Y0S E;  3NE5 B;  3U4Z A;  4JOI C;  1O7L A;  1NUC A;  4N8X 1;  2F4V Q;  2R7Z G;  3PO3 H;  4BA2 I;  3VR4 A;  1X32 A;  4A93 H;  1BCP C;  1U9R A;  1VQG A;  2MPM A;  1TS2 A;  4KN7 C;  5M3M B;  3KLS A;  3STB D;  3P1H A;  1VQF A;  1O7Z A;  2QEJ C;  2MO0 A;  2RQX A;  3KUP A;  3I56 A;  5LL6 X;  1H9S A;  1STN A;  2N3S A;  5FO8 B;  1IKL A;  4HMI A;  4XDX A;  1KXL A;  4O0A A;  2R93 G;  2JN4 A;  1VMP A;  3K5O A;  1I94 L;  2N49 A;  4FO2 A;  4DAM A;  3NWT A;  2XWJ B;  4WJ4 A;  4GN4 B;  4A3K G;  3G4S A;  2MP1 A;  2IW3 A;  3IL8 A;  3D8G A;  1RF2 D;  2B2U C;  3HOY G;  1CQV A;  4B3M L;  4NP5 A;  1EQT A;  2RHS B;  2L9H A;  1LAB A;  1QVC A;  2VB3 X;  3DXJ C;  1JE5 A;  4JI5 L;  2QW7 A;  4DV7 Q;  4PMB A;  1EQR A;  2A6E C;  4OWT B;  4JI2 Q;  4TKO B;  3SK8 A;  2NZ1 D;  3TBI B;  3ER0 A;  2C35 B;  3I2Z A;  3EJI A;  1ENC A;  5CBA E;  5IP9 G;  3AMU A;  4BBS G;  1NE3 A;  4CDC C;  1NMG A;  4DR7 Q;  1PDQ A;  4LF8 L;  1PFN A;  3DEP A;  2D5D A;  2KA7 A;  2E2J B;  3A8J E;  1WTX A;  5G3L F;  5FLM H;  1EFI D;  3N52 A;  1GUO A;  1U4R A;  3FP9 A;  4JYA Q;  2EIF A;  2EJM A;  2IX1 A;  2K5N A;  2HCI A;  1A8V A;  2L15 A;  1ASZ A;  2AHO B;  1SN8 A;  5D3I B;  3AFP A;  4GOP C;  1K83 B;  5BN4 A;  1ONL A;  1EIF A;  2AKW B;  2JA6 B;  1ENF A;  1PTO C;  3HZX A;  5ISR A;  2ICI A;  5C6A A;  2G5D A;  2R92 B;  1R4P B;  4P75 A;  4NXM L;  4LW1 A;  1D5M C;  4KJO A;  4K5X A;  3I4N H;  2EXZ A;  3S16 B;  2K32 A;  5C4Z A;  5IOC A;  1IBM L;  5CGK A;  1AN8 A;  2FJ2 A;  4XYQ A;  2IT1 A;  4PQX A;  3D3R A;  2IX0 A;  3KLW A;  4C56 C;  1TT2 A;  2A6H D;  2B3G A;  1OXS C;  4OEL B;  3HOV H;  2P5Z X;  5CC4 A;  2K01 A;  4FF3 A;  4A3B H;  1CZW A;  3LX0 A;  1S3O A;  1IKM A;  1LAC A;  4HID A;  3M7G A;  2MNA A;  3OPO A;  4IQZ A;  5JEA G;  4E6I A;  1DM0 B;  4PZ7 A;  3FEW X;  2EY1 A;  2HUG A;  1EWH A;  1PTO H;  1JOO A;  3WWV A;  2HHH Q;  1N36 Q;  1D2B A;  1HZB A;  4BY7 H;  2KJX A;  2PI2 A;  4C2M B;  3NTK A;  1XWE A;  3M3Y B;  2ZTE A;  4JV5 L;  2EY2 A;  1H9S B;  4I7A A;  1SR3 A;  2HD3 A;  4ZYS A;  5KNB A;  3T4A C;  1SBB B;  4DR1 L;  2YTX A;  5KYL A;  4HIK A;  1ET9 A;  1Z47 A;  2BDO A;  4H44 C;  1X9N A;  2EDG A;  4YY3 L;  4DR6 L;  4C3J B;  3K59 A;  4A3D H;  2H5X A;  3KOJ A;  3J7A F;  4JC0 A;  2LXK A;  1ZYR C;  5NUC A;  3F2C A;  3KJO A;  4S3S A;  4B3S Q;  3I8Z A;  3KBX A;  1GUT A;  1KD1 C;  1GUG A;  1V1P A;  1YHB A;  4MNO A;  5EBD A;  3PIP A;  4KHP L;  3N6R A;  4V19 0;  4FF4 A;  4EX5 A;  4RHR A;  4PZ8 A;  5JPM C;  1VQB A;  2I0Q A;  1DGS A;  2HIV A;  1WD0 A;  4TVA B;  4A75 A;  1PH7 A;  4DXG A;  4C1N I;  3DM3 A;  4PMC A;  3D4W A;  5IP7 H;  2UXB Q;  5CMD A;  1EEI D;  4A3I G;  3TRZ A;  5D14 A;  5F2D A;  4F7X A;  3EVQ A;  1STB A;  1JCK B;  1I3Q B;  2EYM A;  1GKH A;  4L5Q A;  2ZXR A;  3H0G G;  2K50 A;  3C3L A;  3FDT A;  4LNQ A;  4NKL A;  3SHL A;  2EVB A;  4C3H B;  3NQI A;  3J7Y W;  1BBW A;  1VQ8 A;  1B70 B;  1EY6 A;  4JPB W;  4OGQ C;  1B9N A;  1U4M A;  1AP0 A;  4X65 Q;  1TWC H;  4C3I H;  1V9P A;  1HNX Q;  3MXG A;  1KAB A;  4A3E G;  3PMF A;  3IRB A;  4NXN Q;  1HR0 Q;  5JVH 3;  3CXC A;  4BBR G;  4RCO A;  2XIW A;  2UU9 L;  1K9M C;  1VQC A;  3ERO A;  5C4X B;  3QR8 A;  4RA8 A;  5JPN C;  4JI1 Q;  2Q2T A;  3RD4 A;  1KRT A;  3KFU A;  3NEL A;  1WVL A;  4JI0 L;  1PFB A;  3SE0 A;  1YIT A;  1JJC B;  3NWS A;  4HTH A;  3G6E A;  5EQ0 A;  1PH2 A;  4RGN A;  4XQN A;  4A3J H;  2ZXO A;  2Z6K A;  1YVC A;  4JW0 A;  2Y0S G;  1PZK D;  4K8I A;  4KD4 A;  4ZKC B;  3JAM i;  5I4D A;  2KBN A;  3OMG A;  1B50 A;  2JEB I;  3QJY A;  4EQ5 A;  1NR2 A;  4KLK A;  4RG1 A;  4FXG C;  1CHQ D;  2LY7 A;  5E7N A;  1F2M A;  4ME3 A;  1NMF A;  1QB5 D;  1DYQ A;  1N9W A;  1EYA A;  1VQA A;  2QKI C;  1VDZ A;  3E9I A;  1C4Q A;  3CCL A;  1ESR A;  4A4I A;  4J6H A;  3CQZ H;  2RDH A;  1BCP F;  4Y7N H;  2D62 A;  5FLX c;  3A54 A;  2DNC A;  1KQS A;  4R9W A;  2VUM B;  4LF4 Q;  4X6A H;  3RNU A;  1VQI A;  3S15 B;  4RH6 A;  4O42 A;  3JAM E;  2ZM6 L;  1STA A;  2XN9 C;  3BS1 A;  1Y1W G;  3NEM A;  3P7J A;  4FF1 A;  1V1P B;  3VR3 A;  3PIP 3;  4OO1 H;  2JA8 B;  3VYS A;  3BYT B;  2CFM A;  4A3L H;  1VF5 C;  4LFC Q;  1WTP A;  1VQ6 A;  3HOZ B;  2A69 C;  4UPA A;  2AQ3 B;  5ELE A;  1ENA A;  2NWG A;  2VXW A;  4JBK A;  1JMC A;  1J5E Q;  2JA7 B;  5C44 B;  1PRT B;  2LKV A;  3SK6 A;  1CA6 A;  4LF7 Q;  4OEM B;  1STH A;  1E0B A;  3A56 A;  1CKM A;  3FKI B;  3UDI A;  3HOU H;  1GHJ A;  3H94 A;  5T1I A;  1E2V A;  1LUZ A;  2R6G A;  3S1N B;  2A6E D;  1TWA H;  2DUD A;  3QWN A;  3U4V A;  2NVQ B;  1BOS A;  3CCM A;  2LMC B;  4LK1 C;  1A15 A;  2FFK B;  2NB0 A;  1I6H H;  5A2Q L;  3X3N A;  2A74 C;  3HOX B;  4J1M A;  1WTR A;  3J80 L;  4LF9 L;  4OWW B;  1GJX A;  1JC7 A;  1ILQ A;  2K5W A;  5FLX E;  3DUZ A;  3WOF A;  3RZD H;  1WCM B;  1LT3 D;  1M8A A;  1SXT A;  1PTO F;  2MHV A;  5M3M G;  4Q0F A;  4POF A;  1PYW D;  1IBK Q;  1YBY A;  2UUA L;  2ZJR A;  3HOW B;  2YU9 B;  2R7F A;  1L1O C;  5I2X A;  1EY0 A;  5FJ8 H;  3FVQ A;  1TWH H;  4IJL A;  1LT6 D;  5AJ3 L;  1PTO D;  4KTA A;  1IYU A;  3OMC A;  2L55 A;  3E5S A;  1UE7 A;  2YV5 A;  1M4V A;  1LT5 D;  2KED A;  4F8M A;  3PIO A;  4TSS A;  4G7Z C;  2BCO A;  2CCZ A;  1RL2 A;  4P73 A;  3M85 A;  1VQP A;  2F3V A;  1CKO A;  4XYO A;  4GNX C;  1EQV A;  4BS9 A;  1HNZ Q;  2UUB L;  3DWA A;  4IUR A;  3I55 A;  1Q1E A;  2O5J C;  3V05 A;  1WD1 A;  1DOM A;  1JOQ A;  5A35 A;  5C4H A;  3UE1 A;  3CD6 A;  1UAP A;  3PUW A;  2NYZ D;  3NHH A;  1D7Q A;  3PO2 B;  1FR3 A;  1JB3 A;  4B3T L;  4J15 A;  2F0T A;  2KCN A;  4DA2 A;  4DK1 A;  4HJ5 A;  3UDX A;  4DXF A;  2UXC L;  4YWL A;  1K0S A;  4JI5 Q;  2K1B A;  2FXQ A;  2V1C C;  3CCR A;  1GXD C;  2NVT H;  3CPF A;  3TP8 A;  1Q90 A;  1NJI C;  1DXM A;  2K6A A;  3VYR A;  1AEX A;  2QDL A;  3EN2 A;  5J39 A;  2TMP A;  3S2D B;  2SEB D;  3VA7 A;  2VNU D;  3M4P A;  3MZ5 A;  1AW7 A;  5KND A;  1YNJ C;  1PH6 A;  2VL6 A;  3MA2 B;  2EY5 A;  2YYZ A;  3F2D A;  4FDB A;  2JA6 G;  3WDN A;  1EU4 A;  4LF8 Q;  2CHB D;  4AH6 A;  4DV5 Q;  2R92 G;  1JIC A;  4DV6 L;  1A3U A;  3AB9 A;  2Z8L A;  3KDF B;  1SYB A;  5BN3 A;  2B2U A;  5EJW A;  3SDZ A;  2VQE L;  2JA5 B;  1BF4 A;  4DR3 L;  2E5L L;  1EOV A;  3VYU A;  3GV6 A;  3BDL A;  4DV3 L;  2RF4 A;  3KF8 A;  3M4O B;  3GTL H;  4NB3 A;  5I9O A;  1OXV A;  4C1N K;  1IYJ B;  3TDQ A;  3GTM H;  4ZAI A;  4KJN A;  1HZC A;  4A3G B;  4A3M B;  5LMU L;  1SYC A;  4R4O A;  4AQY Q;  1EY4 A;  3GO5 A;  2Q8T A;  1YI2 A;  3CF5 A;  2HDM A;  2OT2 A;  3U9O A;  2F0N A;  3FRP B;  4AYB B;  1O7I A;  2E2I B;  1C48 A;  3GTQ B;  4KN4 C;  3TZD A;  1EY8 A;  3GTO H;  3K5M A;  1TWG B;  2NVX B;  5DEH A;  2MFI A;  1N34 L;  2PQA A;  3J81 j;  4DR4 L;  1YJN A;  4DV4 L;  4O2D A;  3U58 A;  4EGV A;  3PO3 B;  1LTI D;  5M5Y H;  1QVF A;  1TS3 A;  2KVM A;  1UEA B;  3KF6 A;  4LFA L;  4LUV A;  1G2T A;  2NTS A;  3PIO 3;  4GZY C;  1CKN A;  2RSO A;  4C3J G;  4QGU A;  1AE2 A;  5EPL A;  4HJ8 A;  4ZCK A;  2A1A A;  1HH2 P;  3RLN A;  1H95 A;  4JBW A;  4R1J A;  2QEX A;  4JV5 Q;  3MVV A;  3EIV A;  5GAD C;  1Q82 C;  4DR1 Q;  1HA5 A;  3VYT A;  1B1Z A;  4HED A;  3K7A H;  5AFW A;  2DY8 A;  3H0G H;  2XNA C;  4YY3 Q;  5C0X G;  3MXN B;  4DR6 Q;  3CAM A;  4B3R Q;  3OWE B;  4XXE A;  2F03 A;  1HZA A;  4PZ6 A;  1HR0 W;  2FHT A;  1L0Y B;  1IW7 D;  2AQ1 B;  2ATW A;  4LFB L;  4IPH A;  1ZKO A;  4IUP A;  4DKA C;  1H9M A;  4G7H C;  2WKD A;  3RR5 A;  3HGB A;  1KRS A;  5ELO A;  4QJF A;  4DF7 A;  1FL0 A;  2N55 A;  2ENB A;  3D0F A;  3T56 B;  4XT3 B;  2DJF C;  3I4O A;  1CZG A;  1JWM D;  1KNA A;  4C3H G;  3J81 i;  3ERS X;  3MTS A;  4XTC S;  1BDO A;  5J3B A;  1BQQ T;  2DJG C;  2PW5 A;  1EYG A;  2WKC A;  2Q8I B;  5IYC G;  4BXX H;  3S17 H;  1PA6 A;  1PHJ A;  1HQM C;  1EUJ A;  4DAV A;  3A74 A;  4JVZ A;  2B2T A;  3BVM A;  4DPG A;  1WTQ A;  3NEN A;  1JB7 A;  2ZTD A;  1EFW A;  3TP7 A;  1KTK A;  2F0O A;  4RMF A;  1Q46 A;  1SNQ A;  4P2C B;  5C4X G;  3I4N B;  3S14 H;  3KF8 B;  1MKH A;  5EGT A;  4OX9 L;  1K0R A;  5M3F B;  2PCF B;  1Q3L A;  5C5M A;  1E22 A;  1XJV A;  3K8A A;  1XNR Q;  3J81 E;  4KK7 A;  2SOB A;  1V43 A;  1IL2 A;  2ZJP A;  4WJW A;  3PUZ A;  2LXJ A;  1DJR D;  4FP5 D;  4KY6 A;  3OIP A;  3OTO Q;  4TRD A;  3MXP A;  2K52 A;  4A3B B;  1HXY D;  2F0I A;  1SE4 A;  2K14 A;  1LM0 A;  3M4Y A;  2JK8 A;  5E4X A;  1F9R A;  5DNF A;  1L0X B;  2PQA B;  3TRE A;  1DZ1 A;  3AQQ A;  4JI0 Q;  4KY7 A;  4B08 A;  3K5N A;  1PTO B;  1C0A A;  1HHV A;  4R4Q A;  4XQJ A;  4A3F H;  1YJ9 A;  1SAP A;  3DHQ A;  2NN6 H;  4BY7 B;  4DV0 L;  4GKK Q;  4DN4 M;  1CKN B;  1BVS A;  4FNF A;  2WAC A;  3R8B A;  2ES2 A;  3E6Z X;  2VUM G;  4GS3 A;  1M1K C;  2BA1 A;  3RUZ A;  3CHB D;  3EBE A;  1SYG A;  3T16 A;  3KK7 A;  1B9M A;  2ID0 A;  2VZA A;  1KDB A;  3A8K E;  4A3D B;  2JA8 G;  3G48 A;  5G3L D;  3K0X A;  4QIW B;  5IYD G;  5EKL A;  4KY5 A;  1LT4 D;  1N32 L;  4LF6 Q;  3HOZ G;  3L3O C;  1PLF A;  4DR2 L;  1UNS A;  1H9R A;  4CJ2 C;  1WTW A;  2ZM6 Q;  5LMN L;  2JA7 G;  5C44 G;  1D5Z C;  5IYB G;  4YHH Q;  4A3C H;  5L37 A;  1SMX A;  4BY1 H;  4KKS A;  1LTA D;  3FKI G;  1Z6H A;  2F0P A;  2XRS D;  2YTY A;  1VQN A;  4Y52 H;  4ME5 A;  3WOE A;  3U50 C;  2I46 A;  2B63 H;  1SNC A;  1SYF A;  4H0L C;  3V2T A;  2VY3 A;  3HOX G;  2VQF L;  5IY0 A;  1KHI A;  1GHK A;  1TII D;  5C3X A;  5IWA L;  5CV7 A;  4YCU A;  3G7L A;  3ND9 A;  4IO9 A;  4IFD G;  3A55 A;  1SNP A;  2EE1 A;  4X3K A;  1TY2 A;  1WCM G;  2F0F A;  3P75 A;  1ICW A;  1O78 A;  1Z7T A;  4QY7 A;  4UP7 A;  5TSS A;  1VCI A;  1K8G A;  3KJP A;  1I6V C;  2RHQ B;  3TEH B;  5KRU A;  4OWX B;  4DUZ L;  1D5X C;  3HOW G;  3GDE A;  1MD2 D;  3L2P A;  3HKS A;  2CW0 C;  1FJG L;  4Q5V A;  5C4J H;  3W1G A;  4X66 Q;  3S9W A;  2F52 A;  4LF9 Q;  2B2W A;  3PQI A;  4DNT B;  1SDF A;  1STG A;  2I5L X;  4K2L A;  4IUV A;  4JI7 L;  2M9V A;  1MGS A;  3Q8D A;  1PH4 A;  1D8L A;  3L0O A;  4N8F A;  5IOD A;  1C7Y A;  4K0K L;  4A3J B;  4PNY A;  3BJU A;  2NBF A;  2M00 A;  4DV1 L;  2RDF A;  2K04 A;  2NVY H;  5AJ3 Q;  1Y1V H;  1HZ9 A;  3TSS A;  3J7A V;  1YNN C;  1A6X A;  1XNQ L;  3PO2 G;  4QIW E;  1LTS D;  5IGF A;  3T1Y Q;  5M9O A;  4CKC A;  3BZK A;  1MHW C;  3JAM L;  3BVG A;  4NMZ A;  3CCJ A;  1KIX A;  2BDN A;  3VDY A;  5EBC A;  1EEF D;  1Z9F A;  1MJE A;  2Z0S A;  2UUB Q;  5DAU A;  3S16 H;  3BVZ A;  3CQZ B;  2R3Z A;  1IBL L;  2MQH A;  3TME A;  1I4X A;  1I5F A;  4Y7N B;  1H9J A;  4QF4 A;  4B9X A;  1VQ7 A;  3C46 A;  1K3B C;  3DWQ A;  2JXM B;  1SYD A;  3S1Q H;  3FMC A;  5E1F A;  4HAE A;  4MZ9 A;  4CDD C;  5LMN W;  2DNE A;  1OXT A;  2K75 A;  3ONA B;  5ELN A;  1FVI A;  4MTN A;  4HSV A;  2WAQ B;  1QCB D;  4QL5 A;  1XX8 A;  2F0S A;  3PUV A;  1Q1B A;  1X65 A;  5EKK A;  4K6D A;  2F4V L;  4CKE A;  4PG3 A;  2JA5 G;  1EWI A;  3GQB A;  5CV4 A;  4EQP A;  4V0B A;  2F0D A;  4K14 A;  4GNX A;  1MJC A;  1OXU A;  1BBU A;  3F2U A;  4ABN A;  3BDO A;  1BO0 A;  3A5Z B;  2E2H H;  3OIQ A;  2B8F A;  2I07 B;  1GUW A;  4DV6 Q;  1F9Q A;  1PH8 A;  3HOU B;  2F0W A;  2GVB A;  1I4R A;  1TWA B;  2VQE Q;  4A3G G;  1P8L A;  2RDG A;  4A3M G;  2G9H D;  1KDA A;  2KEC A;  4K2K A;  3QOJ A;  3P20 A;  3D4D A;  1F2Y A;  1SJE D;  1JJG A;  1WTH A;  2KHS A;  2E5L Q;  4AYB G;  1JR0 D;  1I6H B;  2L5T A;  1EYD A;  1XYI A;  3MEF A;  4L5R C;  3GTK H;  3H6M A;  4DV3 Q;  1LLR D;  5KYI A;  2GA4 B;  2O4X A;  3S1R H;  3NXW A;  2AMC B;  4RCN A;  4EQN A;  4ZLT F;  2CVR A;  1PH3 A;  3W3A A;  2ZXP A;  3RZD B;  1KLG D;  1X3E A;  3PO3 G;  1IL8 A;  3E3X A;  1QNK A;  3K58 A;  3Q23 A;  5K36 H;  4WRD A;  3H15 A;  1CTM A;  2Q2U A;  1B4O A;  3MAQ A;  5LMU Q;  1ML0 D;  2PPB C;  3T1H L;  3Q22 A;  3BZD B;  3AFQ A;  1MBY A;  4GLV B;  1PMR A;  1TWH B;  2H1E A;  2KHI A;  2MUY A;  5CV8 A;  1BCP D;  2PMZ B;  1G8Z D;  1RCV D;  1N34 Q;  4DR4 Q;  4UAI A;  3NTH A;  4X3U A;  3MEH A;  4XIG S;  3PSI A;  1NSN S;  4KI0 A;  3SGI A;  4KHZ A;  1OTC A;  1CI3 M;  4IUN A;  3VR6 A;  1VQE A;  4LFA Q;  1AZP A;  5C3E H;  3HS0 C;  2GN5 A;  1HNW L;  3HKZ B;  2WAQ E;  1K8M A;  4DAP A;  2KCM A;  5C0X I;  2ALY B;  2IHE A;  5ELF A;  3GTP H;  4IZ8 A;  1JWS D;  3STB C;  1ZXT A;  4QQB X;  5IT9 L;  4Z9C B;  4H02 A;  1HUM A;  3GTJ H;  1S5E D;  4JI4 L;  2A5H A;  2R7Z H;  3O13 A;  3R93 A;  1VQK A;  3D4R A;  1BR9 A;  2G9D A;  2IY5 B;  5JAV A;  1LTR D;  5FLM G;  2NVT B;  5C4X H;  1NY4 A;  2L4N A;  3HEJ A;  1J9O A;  1TQO A;  1E1O A;  4LFB Q;  2B8G A;  1EZ8 A;  1M90 C;  2R93 H;  1VQJ A;  1WYD A;  2HT1 A;  5E4W C;  1R9T H;  1X3Q A;  1P16 A;  2Q8R E;  2X6L A;  2MJ8 A;  5I6W A;  5BR8 L;  2A68 C;  3OW2 A;  4A3K H;  3CCU A;  2A19 A;  3HOY H;  3I4N G;  2PI2 E;  1LV9 A;  2OF1 A;  3I4L A;  4DK0 A;  4JBM A;  5M3F G;  1JOR A;  2CWP A;  2E76 C;  2E75 C;  1F9S A;  1G6P A;  1Q8K A;  4BWG B;  1I4Q A;  1V8Q A;  2UXD L;  3A8I E;  1AFP A;  1AH9 A;  4UY8 C;  2WFW A;  2EJG C;  1PRT C;  1TS4 A;  3K7U C;  1SFO H;  5IP9 H;  3GTL B;  4BBS H;  4A3B G;  4APV A;  5CV9 A;  1B3Q A;  2JA9 A;  4B3S L;  3GTM B;  1EY9 A;  3J7A 5;  4OX9 Q;  2NUC A;  4GN3 B;  1BXT A;  1O7Y A;  1GUS A;  3SR1 A;  2K5D A;  3CMA A;  1I94 Q;  1RTO A;  2ZJQ A;  4LF5 L;  2B2V A;  3OYY A;  1D6E C;  3J80 c;  3GTO B;  4BY7 G;  1WJJ A;  2OXP A;  2PW7 A;  4L6T B;  1G51 A;  2UXB L;  1S5D D;  5IYD H;  3QG1 A;  3W1B A;  3HKZ E;  4DFA A;  4B3M Q;  3I4M B;  4PV1 C;  4QB4 A;  4JOI A;  3PUX A;  4I65 A;  3TP5 A;  3HOZ H;  2EYL A;  1LO5 D;  3IFT A;  5CV5 A;  3Q24 A;  4FVM A;  1DCZ A;  2H4O A;  1VMC A;  2LS0 1;  2OTJ A;  2IHF A;  3FPP A;  2JA7 H;  2F0V A;  2JQO A;  2F0J A;  4A3D G;  2QF7 A;  4IPG A;  1Y8P B;  3FKI H;  1SND A;  4K6L A;  3S1N H;  4DV0 Q;  5KIX A;  4RKB A;  1T5X D;  1TXY A;  4DGZ A;  1QWY A;  2EYH A;  1HQR D;  5CBE E;  5JVG 3;  4JI6 L;  3V96 A;  3KBG A;  1IXR A;  4U68 A;  1TS5 A;  4X64 L;  1CT1 D;  2E8G A;  2MGS A;  1N33 L;  5EPJ A;  1UE5 A;  3K7A B;  1ZYR D;  1PZJ D;  5JEA H;  3IAY A;  1Y8N B;  3TS0 A;  1E1T A;  4JI1 L;  5M5W B;  1W6J A;  2EYJ A;  1H9K A;  5IP7 G;  2QA4 A;  5EKI A;  2JP1 A;  2RKS A;  5CV6 A;  4IOA A;  1N32 Q;  4H13 C;  3CCQ A;  1SE3 A;  1T5E A;  1JJ2 A;  4A76 A;  4NXM Q;  4DR2 Q;  1B44 D;  5A2Q E;  4LAA A;  5FK9 C;  3H3V C;  1EIY B;  2TSS A;  1XPR A;  4P74 A;  4IN3 A;  4RKL A;  1IBM Q;  3LNN A;  3J80 E;  3HG9 A;  1NBW A;  5LMN Q;  1JQY D;  1HRJ A;  3D6W A;  3MHB A;  1QJO A;  1BBX C;  4K5V A;  2Z1C A;  3A7A B;  4IFD I;  4NDX A;  2OQK A;  1EQQ A;  5H1S E;  2F3W A;  3GTG H;  1RKN A;  2R61 A;  4ZRZ A;  2PYK A;  3S17 B;  4QUF A;  2B2Y C;  3B6Y A;  2GVA A;  1QVG A;  1KDC A;  3EQL C;  4RGO S;  3ZYY X;  4K8J A;  1V1Q A;  2LFN A;  4IAL A;  4GOP A;  1ASY A;  1UE6 A;  1HJP A;  2EQS A;  3ND8 A;  5GQO A;  2VQF Q;  1FNW A;  1SSO A;  4A93 B;  3C1E A;  5IWA Q;  4JCV E;  1FGU A;  4RGT A;  1VF7 A;  5HUR A;  3S14 B;  2PQE A;  1PV4 A;  4DNI A;  4ID6 A;  4YCV A;  5T1G A;  5JOB A;  2XWB B;  1SYE A;  2PZU A;  3GP7 A;  1ET6 A;  4A3J G;  4JI3 L;  3ULP A;  1BUV T;  1LTL A;  1SE2 A;  2HDL A;  4NW2 A;  4DAY A;  1D1K A;  1SMY C;  3C2P A;  4A3I H;  2F0L A;  1FJG Q;  3CU7 A;  1QIL A;  1PFS A;  2BE5 C;  4ILW A;  2AUK A;  3UI2 A;  1YHQ A;  2A73 B;  3S2D H;  4GN5 A;  5JJL A;  3I73 A;  2WP8 J;  3DEO A;  1I50 H;  4JI7 Q;  4I7Z C;  5JEA J;  1K8A C;  3PGZ A;  4MIU A;  1Y14 B;  4OHJ A;  1WTO A;  1J5E L;  2NZO A;  4WFN 3;  2IWH A;  1CK1 A;  1EIH A;  4K0K Q;  4LWC A;  4ZUI A;  1BNZ A;  1UEB A;  3S2H H;  4A3F B;  1BCP B;  4P71 A;  4BA1 I;  3H3V I;  1C8C A;  4MTK A;  1K8O A;  4A3E H;  2XRQ D;  4J8Q A;  4POG A;  5COR A;  5GAG C;  4KHP Q;  1CUK A;  4FYD A;  2XTI A;  4BBR H;  1YEZ A;  1LTG D;  5I2Y A;  2FMC A;  1PZI D;  2WAQ G;  2F1M A;  3RLO A;  4DV2 L;  2UUC L;  4FXK C;  2ASB A;  4OO1 G;  1CA5 A;  1E7Z A;  4A3L G;  3QOL A;  3M4Q A;  1STY A;  3OWF A;  1SNM A;  1IBL Q;  1PH9 A;  1EIG A;  1Q12 A;  4AYB E;  4HJA A;  1QOH A;  1IBK L;  1O80 A;  4OIK A;  1NR4 A;  3A0J A;  2E2I H;  2VS1 A;  1YHA A;  1JOK A;  4X3S A;  5IGG A;  2BH8 A;  3DLL A;  2AQ2 B;  1FGB D;  4OON A;  1HFG A;  1EOT A;  3D6C A;  5IGE A;  4BY1 B;  3RLF A;  4HN7 A;  3HOU G;  3PUY A;  3FHW A;  2Z4I A;  5HY6 A;  2AWN A;  2A69 D;  2O5I C;  1I4H A;  3SXH A;  3K5L A;  2AUJ D;  2CWA A;  3NQT A;  3HOV B;  2QDB A;  2B63 B;  1F77 A;  4UP8 A;  2UU9 Q;  1HNZ L;  3RZO H;  1Q86 C;  1EZ6 A;  2NZH A;  1DOL A;  4LUO A;  3E0J A;  3NPP A;  1HTP A;  4GOP B;  1VQ4 A;  4HMJ A;  2WB1 B;  1Y1W H;  3ZJY C;  3KF6 B;  1VQD A;  3ICE A;  5COY A;  5FKA C;  2DY7 A;  2Q2I A;  1Y69 U;  1CM9 A;  5M5X H;  1XTC D;  2C9O A;  5EPK A;  5FJ8 G;  3HFZ B;  4YIJ A;  4ZQ3 A;  2X6G A;  5C4J B;  4DAY B;  2OQ0 A;  1A3V A;  4ZKB B;  2A68 D;  4UP9 A;  4HJ7 A;  1SLJ A;  1TWF H;  4JI8 L;  5E3F A;  1VQL A;  5GAH C;  1KC8 C;  4LJZ C;  1LTB D;  2MO1 A;  2N8N A;  1PRT F;  2D0P A;  1HPC A;  2OCE A;  2K05 A;  4MN3 A;  4DV5 L;  4N9P A;  1XMQ L;  4R4C A;  4TQU S;  1I4G A;  1U4P A;  1X55 A;  3T1H Q;  2K03 A;  2WV6 D;  3HKZ G;  5IE8 A;  4RAU C;  1XMO L;  1WFQ A;  3BU2 A;  2D9U A;  2ICE C;  2SDF A;  1A2T A;  5BN5 A;  3S1M H;  2IPK D;  2NVY B;  1Y1V B;  1PRT D;  5JJI A;  2F0Q A;  1FYC A;  1PFM A;  1S5F D;  3I72 A;  4ULL A;  4L63 B;  3F2B A;  4FF2 A;  2XVS A;  1FD7 D;  3TP6 A;  2NN6 I;  1IYV A;  2N88 A;  4KV6 A;  5C3W A;  3C1F A;  3J7Z C;  2JSO A;  5M3M H;  3PF5 A;  1HNW Q;  1NNX A;  1X56 A;  2F0E A;  3SK4 A;  3OSO A;  1W2B A;  5M3F H;  4IJH A; 
#chains in the Genus database with same CATH homology
 3S1Q B;  3OOC A;  1DD2 A;  2FMM A;  2EJF C;  1RDP D;  4RGM A;  3K6O A;  4RWS C;  4N9T A;  1KAA A;  1TWC B;  3VR2 A;  4C3I B;  5ELD A;  1YNJ D;  3GD7 A;  3AU7 A;  2K33 A;  1OO9 B;  5I6Y A;  1G2S A;  3KLS X;  3SEB A;  2KEE A;  2F4I A;  4HCS A;  4M8A A;  2E2H B;  1MSH A;  3K0Y A;  4KMU C;  2PNR C;  2RBM A;  1EWC A;  3NBI A;  3SK5 A;  2EPB A;  2E74 C;  1E2W A;  1NCV A;  4G57 A;  1HUN A;  2QIL A;  5J1Z A;  1FNV A;  2OEO A;  1I4P A;  1WTV A;  3GTK B;  2B2T C;  3S1R B;  2QCP X;  2F0K A;  3MC0 B;  3MXU A;  1JE4 A;  3RMH A;  5DM6 3;  1QG7 A;  1R4Q B;  2E2D C;  4F88 A;  4DNR B;  2AWO A;  1HFN A;  1U4L A;  1KLU D;  4CGY B;  5FOB B;  4F87 A;  4CJ0 B;  4RFB A;  3R2I A;  2NTT A;  4KKT A;  2J7Z A;  4WOR A;  2SNM A;  2IL8 A;  2J4X A;  2DN8 A;  1A3T A;  1S5B D;  2VB2 X;  4XQQ A;  5C3E B;  1HA6 A;  1NAP A;  1SMY D;  2BA0 A;  2RVL A;  2BE5 D;  2F0U A;  1V1O A;  3GTP B;  5K5P A;  5FO7 B;  3NBH A;  5FLX L;  3GTJ B;  3ITP A;  4B9W A;  2R7Z B;  1QNU A;  2PO4 A;  5IGB A;  3I91 A;  4EQO A;  2L11 A;  4IUQ A;  3CKI B;  1RJT A;  4ODG A;  1PXU A;  3NK9 A;  5HGT A;  3EFX D;  2R93 B;  4FXD A;  3T13 A;  2L1B A;  3ERQ A;  1R9T B;  1ILP A;  1IW7 C;  5CYU A;  4A3K B;  4QCL A;  3H91 A;  4KHV A;  1G29 1;  3HOY B;  3MFY A;  4ZUJ A;  4G4K A;  3VR5 A;  5C0X H;  2KQ3 A;  3DMU A;  1F2Z A;  3CRL C;  1MI2 A;  1UUP A;  1SFO B;  3NSW A;  3L9A X;  1G91 A;  4BBS B;  2IX3 A;  5JJZ A;  5IGD A;  4R8I A;  2EYF A;  5KNC A;  1RTN A;  4CHT B;  4CJ1 B;  1E2Z A;  4KD3 A;  1OXX K;  1SJH D;  1EYC A;  2EZV A;  4EVO A;  3MWY W;  2NN6 G;  5D65 A;  1A2U A;  2B2Y A;  4K5W A;  2PZT A;  1B3A A;  2Z4H A;  3CRK C;  2B2W C;  2EYO A;  3BYY B;  2SNS A;  2CQA A;  3VA5 A;  1HTL D;  5LL6 S;  2IJ0 A;  1STE A;  1MSG A;  3T53 B;  1CQF A;  1RD9 D;  2JE6 I;  3MFG A;  2WII B;  2X69 A;  2WIN B;  3NTI A;  1TY0 A;  3R3O A;  4OO1 I;  3W2D A;  4OIJ A;  1DOK A;  3I90 A;  4X3T A;  1G6Z A;  4H7B A;  2B39 A;  1TU2 B;  1ZEQ X;  5C0X J;  2K7V A;  1EU3 A;  2D2C C;  3URY A;  4U67 3;  3NUC A;  4HR7 B;  2EY6 A;  3R2T A;  2F0M A;  5I9P A;  2F0G A;  2ZT9 C;  4ZK9 B;  4UDU C;  3I3C A;  3U9S A;  4LMQ D;  3PV0 A;  3TZU A;  3FPU B;  2K5Q A;  1JWU D;  1S4Z A;  3GTG B;  4JK1 C;  4IUT A;  5C5L A;  3QO2 A;  1GUN A;  4O1N A;  2PZW A;  2A6H C;  5M5Y B;  2C5C A;  5KEE A;  3LWU A;  2O2L D;  3H09 A;  4R8N A;  3DWP A;  4OL7 A;  2JYO A;  2CW0 D;  3MXN A;  3LWE A;  4MHE A;  2KOL A;  1XXG A;  5D3D A;  3X3M A;  3I70 A;  4A3I B;  4PMW A;  2XSC A;  2KCC A;  5J22 A;  3G6J B;  3H0G B;  1I50 B;  4IFD H;  5IT9 E;  5KGU A;  2HCC A;  2M2L A;  1II3 A;  1RHP A;  1ESF A;  3HP3 A;  1QE6 A;  2KUM A;  2JEA I;  1SEB D;  3S2H B;  3T51 B;  3IKJ A;  5CR3 A;  1YNN D;  1S5C D;  2EOT A;  4CKB A;  4A3E B;  4RHS A;  3GV3 A;  4BBR B;  4HSP A;  1B53 A;  1GOZ A;  4QUC A;  3Q6S A;  5ELC A;  2RA4 A;  2EYP A;  3OW7 A;  3M7N A;  1Q8I A;  4C3I G;  5LHY 1;  4CBV A;  3J81 L;  4QMG A;  3L7Z C;  4KKU A;  1ROD A;  5IGC A;  2Y0S B;  3EA6 A;  1F9P A;  2HQE A;  1TKW B;  3QIA A;  1DON A;  3K57 A;  3TN2 A;  3Q0A A;  2FIN B;  2K28 A;  1KNE A;  4HCE A;  3DM1 A;  3RZO B;  3SVM A;  1EL0 A;  2J0T D;  1B2T A;  3BDC A;  3IFD A;  2BOS A;  4IFD J;  3QB3 A;  2L0C A;  1J8I A;  1AZQ A;  1Y1W B;  4G7O C;  1TVX A;  5K36 G;  1EY5 A;  5DM7 3;  1IHZ A;  3HRZ C;  3BG3 A;  1Y8O B;  5M5X B;  2L12 A;  1TR5 A;  1W6K A;  3OHX C;  4IUU A;  1TWF B;  3KLR A;  1D1I A;  1EY7 A;  3D31 A;  5FO9 B;  1FNU A;  5ELB A;  1HCZ A;  2F0H A;  4M1U B;  4DU9 A;  1X3P A;  2B2V C;  3S1M B;  1F2L A;  5IIF A;  1SNO A;  4XT1 B;  1CHP D;  1CFM A;  1LTT D;  2V4D A;  3NP8 A;  2RSN A;  4L8J A;  3A7L A;  3NE5 B;  1O7L A;  1NUC A;  4BA2 I;  3VR4 A;  1X32 A;  1BCP C;  1U9R A;  2MPM A;  4KN7 C;  1TS2 A;  5M3M B;  3KLS A;  3P1H A;  3KUP A;  1O7Z A;  2QEJ C;  2RQX A;  5LL6 X;  1H9S A;  1STN A;  5FO8 B;  1IKL A;  4HMI A;  4XDX A;  1VMP A;  3K5O A;  4FO2 A;  3NWT A;  2XWJ B;  2MP1 A;  2IW3 A;  3IL8 A;  3D8G A;  1RF2 D;  2B2U C;  1CQV A;  4NP5 A;  1EQT A;  2L9H A;  1LAB A;  2VB3 X;  3DXJ C;  4PMB A;  2A6E C;  4TKO B;  3SK8 A;  2NZ1 D;  3TBI B;  3EJI A;  1ENC A;  5CBA E;  3AMU A;  1PDQ A;  1PFN A;  3DEP A;  2D5D A;  2KA7 A;  2E2J B;  3A8J E;  1WTX A;  5G3L F;  1EFI D;  3N52 A;  1GUO A;  1U4R A;  2IX1 A;  2EJM A;  2HCI A;  5D3I B;  1K83 B;  5BN4 A;  1ONL A;  2JA6 B;  1ENF A;  1PTO C;  3HZX A;  5ISR A;  2ICI A;  5C6A A;  2R92 B;  1R4P B;  1D5M C;  4KJO A;  4K5X A;  2EXZ A;  3S16 B;  2K32 A;  5C4Z A;  5IOC A;  5CGK A;  1AN8 A;  2FJ2 A;  4XYQ A;  2IT1 A;  4PQX A;  3D3R A;  2IX0 A;  4C56 C;  1TT2 A;  2A6H D;  1OXS C;  5CC4 A;  2K01 A;  4FF3 A;  1CZW A;  3LX0 A;  1IKM A;  1LAC A;  3M7G A;  3OPO A;  4IQZ A;  5JEA G;  4E6I A;  1DM0 B;  3FEW X;  2EY1 A;  2HUG A;  1EWH A;  1PTO H;  1JOO A;  1D2B A;  2KJX A;  4C2M B;  3NTK A;  1XWE A;  3M3Y B;  2EY2 A;  1H9S B;  4ZYS A;  5KNB A;  3T4A C;  1SBB B;  5KYL A;  1ET9 A;  1Z47 A;  2BDO A;  4H44 C;  2EDG A;  4C3J B;  3K59 A;  3J7A F;  1ZYR C;  5NUC A;  4S3S A;  3I8Z A;  3KBX A;  1GUT A;  1GUG A;  1V1P A;  5EBD A;  3N6R A;  4V19 0;  4FF4 A;  4RHR A;  5JPM C;  1WD0 A;  4DXG A;  4C1N I;  4PMC A;  3D4W A;  5CMD A;  1EEI D;  5D14 A;  5F2D A;  4F7X A;  3EVQ A;  1STB A;  1JCK B;  1I3Q B;  2EYM A;  2ZXR A;  3C3L A;  3FDT A;  4NKL A;  3SHL A;  2EVB A;  4C3H B;  3NQI A;  3J7Y W;  1EY6 A;  4OGQ C;  1B9N A;  1U4M A;  1AP0 A;  3MXG A;  1KAB A;  3PMF A;  5JVH 3;  4RCO A;  2XIW A;  3ERO A;  5C4X B;  4RA8 A;  5JPN C;  3RD4 A;  1WVL A;  1PFB A;  3SE0 A;  3NWS A;  4HTH A;  5EQ0 A;  4RGN A;  4XQN A;  2ZXO A;  1PZK D;  4K8I A;  4KD4 A;  4ZKC B;  5I4D A;  3OMG A;  1B50 A;  2JEB I;  3QJY A;  1NR2 A;  4FXG C;  1CHQ D;  2LY7 A;  1F2M A;  1QB5 D;  1DYQ A;  1EYA A;  2QKI C;  1VDZ A;  1C4Q A;  1ESR A;  4J6H A;  2RDH A;  1BCP F;  2D62 A;  3A54 A;  2DNC A;  4R9W A;  2VUM B;  3S15 B;  4RH6 A;  4O42 A;  3JAM E;  1STA A;  2XN9 C;  3BS1 A;  3P7J A;  4FF1 A;  1V1P B;  3VR3 A;  3PIP 3;  4OO1 H;  2JA8 B;  3VYS A;  3BYT B;  1VF5 C;  1WTP A;  3HOZ B;  2A69 C;  5ELE A;  2AQ3 B;  1ENA A;  2NWG A;  2VXW A;  2JA7 B;  5C44 B;  1PRT B;  2LKV A;  3SK6 A;  1CA6 A;  1STH A;  1E0B A;  3A56 A;  3FKI B;  1GHJ A;  3H94 A;  5T1I A;  1E2V A;  2R6G A;  3S1N B;  2A6E D;  3QWN A;  2NVQ B;  1BOS A;  2LMC B;  4LK1 C;  1A15 A;  2FFK B;  2NB0 A;  5A2Q L;  3X3N A;  2A74 C;  3HOX B;  4J1M A;  1WTR A;  3J80 L;  1GJX A;  1JC7 A;  1ILQ A;  2K5W A;  5FLX E;  3DUZ A;  3WOF A;  1WCM B;  1LT3 D;  1M8A A;  1SXT A;  1PTO F;  2MHV A;  4Q0F A;  1PYW D;  3HOW B;  2YU9 B;  5I2X A;  1EY0 A;  3FVQ A;  1LT6 D;  1PTO D;  4KTA A;  1IYU A;  3OMC A;  2L55 A;  3E5S A;  1M4V A;  1LT5 D;  2KED A;  4F8M A;  4G7Z C;  4TSS A;  2BCO A;  3M85 A;  2F3V A;  4XYO A;  1EQV A;  4BS9 A;  3DWA A;  4IUR A;  1Q1E A;  2O5J C;  3V05 A;  1WD1 A;  1DOM A;  1JOQ A;  5A35 A;  5C4H A;  1UAP A;  3PUW A;  2NYZ D;  3NHH A;  3PO2 B;  1FR3 A;  1JB3 A;  2F0T A;  2KCN A;  4DA2 A;  4DK1 A;  4DXF A;  2K1B A;  1GXD C;  3TP8 A;  1Q90 A;  1DXM A;  2K6A A;  3VYR A;  1AEX A;  5J39 A;  3S2D B;  2TMP A;  2SEB D;  3VA7 A;  2VNU D;  3MZ5 A;  1AW7 A;  5KND A;  1YNJ C;  3MA2 B;  2EY5 A;  2YYZ A;  3WDN A;  1EU4 A;  2CHB D;  1JIC A;  1A3U A;  3AB9 A;  2Z8L A;  1SYB A;  5BN3 A;  2B2U A;  5EJW A;  3SDZ A;  2JA5 B;  1BF4 A;  3VYU A;  3GV6 A;  3BDL A;  3KF8 A;  3M4O B;  5I9O A;  1OXV A;  4C1N K;  3TDQ A;  4ZAI A;  4KJN A;  4A3G B;  4A3M B;  1SYC A;  1EY4 A;  3GO5 A;  2Q8T A;  2HDM A;  2OT2 A;  3U9O A;  2F0N A;  3FRP B;  4AYB B;  2E2I B;  1C48 A;  3GTQ B;  4KN4 C;  3TZD A;  1EY8 A;  3K5M A;  1TWG B;  2NVX B;  5DEH A;  4EGV A;  3PO3 B;  1LTI D;  1TS3 A;  2KVM A;  1UEA B;  1G2T A;  2NTS A;  3PIO 3;  4GZY C;  2RSO A;  4C3J G;  5EPL A;  4JBW A;  3MVV A;  1HA5 A;  3VYT A;  1B1Z A;  4HED A;  5AFW A;  2DY8 A;  2XNA C;  5C0X G;  3OWE B;  4XXE A;  2F03 A;  2FHT A;  1L0Y B;  1IW7 D;  2AQ1 B;  1ZKO A;  4IUP A;  1H9M A;  4G7H C;  2WKD A;  3HGB A;  4DF7 A;  2N55 A;  2ENB A;  3T56 B;  4XT3 B;  1CZG A;  1JWM D;  1KNA A;  4C3H G;  3MTS A;  4XTC S;  1BDO A;  1BQQ T;  2PW5 A;  2WKC A;  2Q8I B;  1HQM C;  4DAV A;  2B2T A;  3BVM A;  1WTQ A;  3TP7 A;  1KTK A;  2F0O A;  1SNQ A;  4P2C B;  3I4N B;  5EGT A;  5M3F B;  2PCF B;  1Q3L A;  5C5M A;  3J81 E;  4KK7 A;  2SOB A;  1V43 A;  4WJW A;  3PUZ A;  1DJR D;  4FP5 D;  4KY6 A;  3OIP A;  4TRD A;  3MXP A;  4A3B B;  1HXY D;  2F0I A;  1SE4 A;  3M4Y A;  5E4X A;  1F9R A;  5DNF A;  1L0X B;  1DZ1 A;  4KY7 A;  4B08 A;  3K5N A;  1PTO B;  1HHV A;  4XQJ A;  1SAP A;  3DHQ A;  2NN6 H;  4BY7 B;  4DN4 M;  4FNF A;  2WAC A;  3R8B A;  3E6Z X;  2BA1 A;  3RUZ A;  3CHB D;  1SYG A;  3T16 A;  3KK7 A;  1B9M A;  2ID0 A;  1KDB A;  3A8K E;  4A3D B;  5G3L D;  4QIW B;  5EKL A;  4KY5 A;  1LT4 D;  3L3O C;  1PLF A;  1UNS A;  1H9R A;  4CJ2 C;  1WTW A;  1D5Z C;  4KKS A;  1LTA D;  1Z6H A;  2F0P A;  2XRS D;  4ME5 A;  3WOE A;  2I46 A;  1SNC A;  1SYF A;  4H0L C;  3V2T A;  1GHK A;  1TII D;  5C3X A;  5CV7 A;  3G7L A;  3ND9 A;  4IFD G;  3A55 A;  1SNP A;  2EE1 A;  4X3K A;  1TY2 A;  2F0F A;  3P75 A;  1ICW A;  1O78 A;  1Z7T A;  5TSS A;  1VCI A;  1I6V C;  5KRU A;  1D5X C;  1MD2 D;  2CW0 C;  4Q5V A;  3S9W A;  2B2W A;  4DNT B;  1SDF A;  1STG A;  4K2L A;  4IUV A;  2M9V A;  1MGS A;  5IOD A;  4A3J B;  4PNY A;  2NBF A;  2M00 A;  2RDF A;  2K04 A;  3TSS A;  3J7A V;  1YNN C;  1A6X A;  1LTS D;  5IGF A;  5M9O A;  4CKC A;  3JAM L;  3BVG A;  4NMZ A;  2BDN A;  5EBC A;  1EEF D;  5DAU A;  3BVZ A;  3CQZ B;  2R3Z A;  3TME A;  1I4X A;  4Y7N B;  1H9J A;  4QF4 A;  4B9X A;  3C46 A;  3DWQ A;  2JXM B;  1SYD A;  3FMC A;  5E1F A;  4HAE A;  2DNE A;  1OXT A;  3ONA B;  4HSV A;  2WAQ B;  1QCB D;  1XX8 A;  2F0S A;  3PUV A;  1Q1B A;  5EKK A;  4K6D A;  4CKE A;  3GQB A;  5CV4 A;  4EQP A;  4V0B A;  2F0D A;  4K14 A;  1OXU A;  3F2U A;  4ABN A;  3BDO A;  1BO0 A;  3OIQ A;  2B8F A;  2I07 B;  1GUW A;  1F9Q A;  3HOU B;  2F0W A;  1I4R A;  1TWA B;  2RDG A;  2G9H D;  1KDA A;  2KEC A;  4K2K A;  3QOJ A;  3P20 A;  3D4D A;  1F2Y A;  1SJE D;  2KHS A;  1JR0 D;  1I6H B;  2L5T A;  1EYD A;  1XYI A;  3H6M A;  1LLR D;  5KYI A;  2GA4 B;  2O4X A;  3NXW A;  4RCN A;  4EQN A;  4ZLT F;  2CVR A;  3W3A A;  2ZXP A;  3RZD B;  1KLG D;  1IL8 A;  1QNK A;  3K58 A;  3Q23 A;  5K36 H;  4WRD A;  1CTM A;  1B4O A;  3MAQ A;  1ML0 D;  2PPB C;  3Q22 A;  3BZD B;  1MBY A;  1PMR A;  1TWH B;  2H1E A;  2MUY A;  5CV8 A;  1BCP D;  2PMZ B;  1G8Z D;  1RCV D;  4UAI A;  3NTH A;  4X3U A;  3MEH A;  4XIG S;  1NSN S;  4KI0 A;  4KHZ A;  1CI3 M;  4IUN A;  3VR6 A;  1AZP A;  3HS0 C;  3HKZ B;  1K8M A;  4DAP A;  5C0X I;  5ELF A;  4IZ8 A;  1JWS D;  1ZXT A;  5IT9 L;  4Z9C B;  1HUM A;  1S5E D;  2A5H A;  3O13 A;  3R93 A;  3D4R A;  1BR9 A;  2G9D A;  5JAV A;  1LTR D;  2NVT B;  2L4N A;  3HEJ A;  1J9O A;  1TQO A;  2B8G A;  1EZ8 A;  5E4W C;  1X3Q A;  2Q8R E;  2X6L A;  2MJ8 A;  5I6W A;  2A68 C;  1LV9 A;  2OF1 A;  3I4L A;  4DK0 A;  1JOR A;  2E76 C;  2E75 C;  1F9S A;  4BWG B;  1I4Q A;  1V8Q A;  3A8I E;  1AFP A;  2EJG C;  1PRT C;  1TS4 A;  3GTL B;  5CV9 A;  3GTM B;  1EY9 A;  2NUC A;  1BXT A;  1O7Y A;  1GUS A;  3SR1 A;  2K5D A;  1RTO A;  2B2V A;  1D6E C;  3GTO B;  2OXP A;  2PW7 A;  4L6T B;  1S5D D;  3QG1 A;  3I4M B;  4DFA A;  4PV1 C;  4QB4 A;  3PUX A;  4I65 A;  3TP5 A;  2EYL A;  1LO5 D;  3IFT A;  5CV5 A;  3Q24 A;  4FVM A;  1DCZ A;  2H4O A;  1VMC A;  2LS0 1;  3FPP A;  2F0V A;  2F0J A;  2QF7 A;  1Y8P B;  1SND A;  4K6L A;  5KIX A;  4RKB A;  1T5X D;  4DGZ A;  1QWY A;  2EYH A;  1HQR D;  5CBE E;  5JVG 3;  3V96 A;  3KBG A;  4U68 A;  1TS5 A;  1CT1 D;  2MGS A;  5EPJ A;  3K7A B;  1ZYR D;  1PZJ D;  5JEA H;  3IAY A;  1Y8N B;  5M5W B;  1W6J A;  2EYJ A;  1H9K A;  5EKI A;  2JP1 A;  2RKS A;  5CV6 A;  4H13 C;  1SE3 A;  1T5E A;  1B44 D;  5A2Q E;  4LAA A;  5FK9 C;  3H3V C;  2TSS A;  4IN3 A;  4RKL A;  3LNN A;  3J80 E;  3HG9 A;  1JQY D;  1HRJ A;  3D6W A;  3MHB A;  1QJO A;  1BBX C;  4K5V A;  2Z1C A;  3A7A B;  4IFD I;  4NDX A;  2F3W A;  1RKN A;  2R61 A;  4ZRZ A;  2PYK A;  3S17 B;  4QUF A;  2B2Y C;  1KDC A;  3EQL C;  4RGO S;  3ZYY X;  4K8J A;  2LFN A;  4IAL A;  3ND8 A;  1FNW A;  1SSO A;  4A93 B;  3C1E A;  4RGT A;  1VF7 A;  5HUR A;  3S14 B;  2PQE A;  4ID6 A;  5T1G A;  5JOB A;  2XWB B;  1SYE A;  2PZU A;  3GP7 A;  1ET6 A;  1BUV T;  4NW2 A;  1SE2 A;  2HDL A;  4DAY A;  1D1K A;  1SMY C;  3C2P A;  2F0L A;  3CU7 A;  1QIL A;  2BE5 C;  4ILW A;  2AUK A;  3UI2 A;  2A73 B;  3I73 A;  2WP8 J;  3DEO A;  4I7Z C;  5JEA J;  4MIU A;  4OHJ A;  1WTO A;  4WFN 3;  2IWH A;  1CK1 A;  1EIH A;  4ZUI A;  1BNZ A;  4A3F B;  1BCP B;  4BA1 I;  1C8C A;  1K8O A;  2XRQ D;  4J8Q A;  5COR A;  4FYD A;  1LTG D;  5I2Y A;  2FMC A;  1PZI D;  2F1M A;  4FXK C;  4OO1 G;  1CA5 A;  3QOL A;  1STY A;  3OWF A;  1SNM A;  1EIG A;  1Q12 A;  1QOH A;  1O80 A;  4OIK A;  1NR4 A;  1JOK A;  4X3S A;  5IGG A;  2AQ2 B;  1FGB D;  1HFG A;  1EOT A;  3D6C A;  5IGE A;  4BY1 B;  3RLF A;  4HN7 A;  3PUY A;  2Z4I A;  2AWN A;  2A69 D;  2O5I C;  1I4H A;  3SXH A;  3K5L A;  2AUJ D;  3NQT A;  3HOV B;  2QDB A;  2B63 B;  1F77 A;  1EZ6 A;  1DOL A;  3E0J A;  3NPP A;  1HTP A;  4HMJ A;  2WB1 B;  5COY A;  5FKA C;  2DY7 A;  1Y69 U;  1CM9 A;  1XTC D;  2C9O A;  5EPK A;  4YIJ A;  4ZQ3 A;  2X6G A;  5C4J B;  1A3V A;  4ZKB B;  2A68 D;  5E3F A;  4LJZ C;  1LTB D;  1PRT F;  1HPC A;  2K05 A;  4MN3 A;  4N9P A;  4TQU S;  1I4G A;  1U4P A;  2K03 A;  2WV6 D;  4RAU C;  2D9U A;  2ICE C;  2SDF A;  1A2T A;  5BN5 A;  2IPK D;  2NVY B;  1Y1V B;  1PRT D;  2F0Q A;  1FYC A;  1PFM A;  1S5F D;  3I72 A;  4ULL A;  4L63 B;  4FF2 A;  2XVS A;  1FD7 D;  3TP6 A;  2NN6 I;  1IYV A;  2N88 A;  4KV6 A;  5C3W A;  3C1F A;  2JSO A;  2F0E A;  3SK4 A;  3OSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...