3SK6A

Crystal structure of staphylococcal nuclease variant delta+nviagla v23k/l36e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTKKLMYKGQPMVFRELLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23K/L36E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk6A00
5KYLA 4LAAA 4B9WA 2F0TA 4KY5A 3MEHA 4J6HA 1NSNS 2O4XA 2PW5A 4NDXA 1KDCA 2PZWA 1STNA 4DF7A 4EQPA 4TRDA 4ID6A 4K2KA 4YIJA 3QOJA 1ENAA 3DHQA 3SK5A 2PQEA 3D4DA 5C5LA 4IUNA 5CC4A 2LKVA 3NQTA 4EVOA 1F2MA 1KDBA 1JOKA 2F0EA 5IIFA 2EYOA 3HZXA 5IGDA 4G57A 1RKNA 2EY1A 4B9XA 4F8MA 2F0OA 3EROA 4ODGA 1A3UA 3NHHA 1EZ6A 4K5XA 1STYA 1NUCA 2EYPA 2OXPA 3D6CA 1SYGA 4NMZA 5C5MA 4HTHA 4ZUJA 1A3TA 2WACA 1U9RA 2RKSA 1JORA 5HURA 2F0WA 3HEJA 2F3WA 2F0KA 4RKLA 5IGGA 2M00A 2F0UA 2F0PA 4N9PA 2PZUA 1JOOA 1SYDA 5F2DA 3P1HA 3E5SA 5CGKA 5ISRA 2F0JA 3MVVA 5I6YA 5J39A 2RDFA 5CV9A 1EY9A 1SNQA 5NUCA 1JOQA 5I9PA 1II3A 4WRDA 4QF4A 4S3SA 4IALA 4K8IA 3S9WA 2EYHA 1STBA 4K5WA 4KJNA 5CV4A 1F2YA 4ZQ3A 5C3WA 5C6AA 3PMFA 3R3OA 5JAVA 3V2TA 3EVQA 3QB3A 3VA5A 1EZ8A 1ENCA 5IGEA 3SXHA 1A2TA 3TP6A 3TMEA 2EY6A 4OL7A 3T13A 4NKLA 5HGTA 3BDLA 4N9TA 3SK4A 4K14A 2EYMA 4PMCA 3LX0A 2EXZA 4HMIA 1TQOA 1SNMA 1KDAA 1EY5A 2SNSA 3MXPA 1SYEA 4RKBA 1STAA 5CV6A 4F7XA 1SNOA 4EQOA 2PW7A 4KJOA 1SYCA 3MZ5A 3EJIA 3SHLA 2F0HA 4PMBA 2HQEA 5J1ZA 5CV7A 5IODA 4DU9A 4KV6A 3QOLA 1EYCA 2QDBA 5KEEA 2F0SA 4KY6A 5IGBA 5KRUA 1A3VA 3SK6A 1KABA 2EYFA 2F3VA 3ITPA 4KTAA 1EQVA 4ZUIA 2EY5A 5JOBA 5K5PA 5KGUA 1A2UA 2F0NA 4KD4A 3OWFA 3NP8A 1TT2A 2F0VA 3P75A 4KHVA 3U9OA 5I6WA 5IGFA 5KYIA 2SNMA 5EGTA 1SNDA 3MHBA 4R8NA 5CV8A 4PNYA 2PYKA 2SOBA 3OMGA 4K5VA 4QB4A 3TP7A 4E6IA 1EY6A 5J22A 1EY4A 5E3FA 1F2ZA 2EY2A 1EY7A 2KHSA 2F0QA 3T16A 2F0FA 4J1MA 3OSOA 3H6MA 1STHA 5CV5A 5CR3A 3C1EA 3NK9A 4K2LA 4ME5A 5E1FA 3TP8A 1EYAA 2F0MA 4EQNA 4I65A 5KIXA 1EY0A 5EKKA 3DMUA 4QMGA 4IZ8A 2F0GA 1EYDA 3ERQA 3NUCA 5C4ZA 2EYJA 2PZTA 1KAAA 2F0IA 5C3XA 5I9OA 5IOCA 1AEXA 2NUCA 4WORA 4HMJA 4DFAA 1SYFA 2F0LA 2RBMA 5DEHA 3RUZA 3SR1A 2ENBA 1EY8A 1STGA 2OEOA 3BDCA 3C1FA 3NXWA 2KQ3A 4KY7A 4NP5A 3D8GA 3TP5A 4DGZA 2EYLA 5C4HA 1TR5A 1IHZA 1SYBA 5DAUA 2OF1A 5M9OA 1SNCA 3OMCA 3D4WA 5EKLA 3SK8A 5IGCA 1SNPA 4K8JA 2F0DA 4MIUA 4H7BA 4K6DA 4KD3A
chains in the Genus database with same CATH superfamily
1S72A 2EQSA 4LAAA 4H13C 4X3UA 3J80E 3RZOB 1MKHA 3DM3A 1K9MC 1SBBB 2K32A 4K2KA 3CCUA 5EKIA 2I46A 2HHHL 1T9HA 4A3DB 4UHVA 2UXBQ 5M5WB 1J6QA 3IFTA 3IKJA 2IX3A 1G2SA 1JOKA 5KNDA 3C2PA 1KL9A 1S4ZA 3FKIH 4B9XA 4K0KQ 3NHHA 1K28A 1HH2P 2JA6H 1HNWL 5C0XG 1Q82C 5C5MA 4HTHA 4YCVA 4AYBG 4IFDH 1M8AA 2D9UA 4BBSH 2B2UA 2B8GA 4DPGA 3GTPH 1VQLA 4G7OC 3R2TA 3S2HB 1R9TH 4DAVA 3KYHC 5M3MB 2F0JA 4PZ7A 2PI2A 4HN7A 3MXGA 2TSSA 1TS4A 3OYYA 2G9DA 4Y7NB 5M5YB 3BS1A 1IYJB 1F2YA 4XQJA 3PUXA 5JAVA 4OO1I 4JI6L 3FDTA 3G71A 3J80i 2K5DA 1EZ8A 2B2WA 3VYTA 2R7ZH 1R4PB 5IYDH 2K04A 3G4SA 4K14A 1IBLQ 5M3FB 3S17H 3TN2A 1TXYA 3LX0A 2VQFQ 4HMIA 2A73B 3CCLA 1SNOA 4EQOA 3OHXC 4FXDA 3BYTB 3RD4A 4A3JB 1C0AA 1WD0A 3W5OA 1P16A 5FLMH 5LMUQ 1CM9A 1FNUA 5JOBA 3HOYG 2NVQB 2K7VA 2RSNA 1ET6A 3CF5A 2B3GA 4LUZA 1BF4A 4YHHQ 3PCOB 1EL0A 2RDHA 1H9MA 2WINB 4C3IH 4H02A 2F0FA 2OT2A 3H6MA 4CDCC 1XWEA 4KKSA 4HCSA 3NENA 3LWUA 2FINB 2KECA 3R2IA 3F2CA 4KMUC 3NSWA 1PMRA 5EPJA 3I4NH 1UEAB 2JJQA 2NYZD 5IOCA 1IBKQ 3HKZG 5FLXL 2LFNA 4JOIA 5DEHA 1NMGA 1TWAH 1STGA 4M1UB 4JV5L 4DNTB 1AW7A 3UDXA 1IZ6A 2MHVA 3OOCA 4DK0A 2JA7G 4X65Q 5EPLA 4LUVA 5IWAL 1JC7A 3LWEA 1EIGA 3J81i 4GLVB 1H9JA 1K0RA 2OQ0A 5D3DA 4ALPA 2JA6B 1H95A 3VR5A 5ELFA 1ENAA 2J7ZA 1JE4A 3ND8A 1PH9A 4BBSB 2Q8IB 1ZKOA 3GTPB 1A15A 1Z7TA 1PZKD 4X66L 3DXJC 1XX8A 3EROA 1A3UA 1U4RA 1EZ6A 2L0CA 1RTOA 4RGOS 3MA2B 4PQXA 1JORA 1JB3A 3A55A 2HIVA 4LMQD 2R7ZB 3S2DH 1S3OA 3I8ZA 3S14H 4A3BB 3SDZA 3PF4A 3I90A 3S17B 1GUGA 1A0IA 4B3RL 4LFCL 5C3EH 1EQRA 2N3SA 3KF6A 3S15H 3EA6A 5C4XH 4DV7Q 5DM63 3KF6B 5AFWA 1XYIA 3T13A 3I91A 1YNXA 1N33L 1KAWA 1LTAD 2LY7A 2PQAA 4HIMA 3FEWX 1EUJA 1SYCA 2PQAB 3D6WA 1SAPA 1G51A 4K6LA 3SHLA 3CAMA 1VQJA 2K1BA 1XJVA 1MIUA 2RQXA 4JI1Q 5M5XH 2Q2HA 2G9HD 5KRUA 4C3IB 2WFWA 1WCMG 3MFYA 1E1TA 2HDMA 3U9OA 2QCPX 1RD9D 4K5VA 4P71A 1JB7A 3P7JA 1UAPA 3A8KE 4POGA 3TRZA 5EPKA 3K81C 4A3MG 2XGTA 1VQAA 2E2IH 2IX1A 2ZTCA 4IZ8A 1PYWD 3NWSA 3U9SA 4DFAA 3STBC 4OXPA 5J3BA 2ENBA 1D5MC 5G3LD 3SR1A 3TDQA 3D8GA 3MC0B 5JPMC 4DR6L 1HJPA 2QKIC 2EXDA 1ESRA 1WTVA 3TQYA 2L5TA 4LF4L 2K03A 1PV4A 3S1MH 1U4PA 2L4NA 2FXQA 4RCOA 4Q0FA 4XXEA 3BZDB 2Z4HA 3SK5A 5C5LA 4IUNA 2HIXA 4C3JG 4HSVA 4IJLA 3S2DB 1RKNA 1HXYD 3S14B 4IFDI 1OO9B 3G6EA 3VR3A 4JVZA 4BXXH 5T1IA 3CCQA 3CCEA 2K5NA 3VYUA 5C3EB 1Z9FA 3S15B 2UXDL 1XNRQ 5C4XB 1GHKA 3FPPA 1EEID 1MBYA 5D14A 4CDEC 2XN9C 2JEAI 1Z6HA 1S40A 3I4LA 1II3A 4WRDA 1JR0D 2Y0SB 3OIQA 4N8FA 1STBA 5DNFA 1VQHA 2K5WA 4RGTA 4HJ8A 2ALYB 4DR1L 2WIIB 1VMPA 4DK1A 3QB3A 4UDUC 1MSHA 1LM0A 5M5XB 1FYCA 1B8AA 1OXXK 1CQVA 2EY6A 4QIWB 3K5OA 5BR8Q 1R4QB 3DWAA 1Y8NB 2KUMA 2FMMA 1XMQQ 1X65A 1SMYD 1UE7A 1ESFA 3TSSA 3T1YQ 5J1ZA 4DV3Q 3ZJYC 3FP9A 1A3VA 2DY8A 4JI2Q 2A69C 3NTKA 4PZ8A 3C46A 1YJWA 4LFAL 5KYIA 3FHWA 1HFGA 1MJEA 2E2IB 2KCTA 4C3HH 5CORA 3IRBA 5ELEA 2I5LX 2VNUD 3TP7A 2XWBB 5E3FA 1L2FA 4R8IA 2IHFA 4DK3C 2KHJA 1I4QA 1JT8A 1EYGA 4A75A 2M2LA 2V4DA 4OX9Q 4QMGA 5GAEC 2IWHA 3ERQA 4LF9L 1Z47A 1GM5A 2ZXOA 3I70A 3S1MB 4ILWA 4MN3A 1FNWA 2L11A 1WTOA 1QCBD 3U4ZA 5IY0A 2LMCB 4DV2L 2NZOA 4GKKQ 1EU3A 2Z8LA 4J15A 5LL6S 4JBMA 2D0OA 1EOVA 1I4PA 2JQOA 4HJAA 4G4KA 2Z1CA 1NSNS 2AUJD 2E5LL 3D4RA 1B2TA 1N36Q 3QOJA 1C7YA 3VDYA 4LF8L 1VQDA 1LTTD 5EBCA 1JICA 2LKVA 3FRPB 3PIPA 1B70B 5IGDA 1I3QH 2VS1A 1C8CA 1JJGA 2RKSA 3K7AH 1VQ7A 3CXCA 3BG3A 3ICEA 1W3SA 2SDFA 3H0GH 4YWKA 5ISRA 1EQTA 4IUQA 1DD2A 1E2ZA 1VQCA 4LJZC 4YCWA 3CD6A 1D6EC 1B44D 1F9SA 4R4CA 4QF4A 4JI0L 5T1GA 4JBJA 3VR6A 5CV4A 5C3WA 3R3OA 1H9SA 1E22A 1ASZA 4RA8A 1EWIA 1HR0W 1V1QA 3V96A 2E2HH 1Y8OB 2UUCL 2NVTH 2XVSA 3D31A 2DNCA 3HOZG 1EY5A 2ICEC 1JCKB 2BH8A 3GTJH 4IUUA 5IP9G 2ZJRA 4C3HB 2QGQA 2VY3A 2ZXPA 1SE4A 1Y69U 3SK6A 2EYFA 1VQOA 5COYA 3HOVH 1W6JA 2V1CC 2I0QA 1KD1C 2EPBA 3TZUA 4DV6Q 3NP8A 4L6TB 3UDGA 3BZKA 1LTLA 2ZJPA 1U0LA 4PNYA 4OO1H 3OMGA 1EY4A 3AFQA 3CCVA 4TSSA 1LT4D 4F87A 3OSOA 2WB1G 1CSQA 3NEMA 3D0FA 1N32L 3W3AA 3F2BA 4HAEA 1BXTA 3HKSA 1GVPA 2F0GA 4TVAB 1PH4A 4A93H 3I56A 5C3XA 1CTMA 2G5DA 3OPOA 2RVLA 3UI2A 2H5XA 1V1PA 3Q6SA 2UUAQ 2JN4A 3DUZA 3GQBA 1VQ5A 2Q8RE 5EKLA 3OMCA 4IO9A 4BY1G 3MAQA 3BDOA 4JW0A 4XIGS 4DV0L 4KD3A 3M7NA 1I3QB 2XIWA 2F0TA 3BVGA 4NDXA 3SVMA 3STBD 2XSCA 3ERSX 5CYUA 1U4LA 3K7AB 1GJXA 2JA5H 1BCPB 3H0GB 3JAMc 4XDXA 1F9PA 3HFZB 2XTIA 3TZDA 1NBWA 3PF5A 3ER0A 1STYA 3TREA 4A3EG 3E0JA 3T51B 1W2BA 4IFDJ 3M7GA 5I2YA 3S16H 3QIAA 1QVFA 2F0WA 4FF2A 5IGGA 2F0UA 2JE6I 4IPGA 2CH4A 2BDNA 4N9PA 3H15A 2E2HB 2NVTB 1ET9A 5I9PA 1HNZQ 4MTNA 3PO3H 3GTJB 2OWOA 3EVQA 4LF6Q 1EU4A 2EE1A 1KC8C 1UWVA 4NKLA 1Q81C 2RCNA 1X54A 3HOVB 4X3TA 4F7XA 1SYEA 4NPSA 1EIHA 2YTVA 4QJFA 4GN3B 3QO2A 1M90C 2YV5A 4PMBA 2CFMA 2JA8B 4GZYC 3EN2A 1EYCA 1PTOF 4K0KL 5IGBA 3QWNA 3U4VA 2R92B 2NZ1D 3WOFA 1EOTA 4A3IH 2CWPA 1TWFH 1BVSA 1Q3LA 3KLSX 2EZVA 3ZYYX 4A93B 2MO1A 1WI5A 1LTID 1PRTF 1O7YA 1VF7A 2P5ZX 2Z6BA 1XTCD 1JWMD 2A69D 1TU2B 3RZDH 3HS0C 5M3MG 5C4ZA 4RG1A 1I6HH 1KAAA 2F0IA 2BA0A 4DV4Q 2NUCA 3JAML 1LYLA 2RBMA 4V0BA 1IBLL 1KRSA 2KQ3A 2VQFL 1I4GA 4FVMA 1YNJD 1IHZA 1CUKA 3URYA 3CC2A 2JA5B 3NELA 3I3CA 1LUZA 5KNBA 3J7AV 2NN6G 1H9KA 1DOMA 5M3FG 2VUMH 5LMUL 4IPCA 4TRDA 3S16B 1BCPC 1VMCA 4A3JG 2K4KA 4JYAQ 3DEOA 4YHHL 3L7ZC 1UEBA 2EY1A 4CGYB 1IBMQ 4ODGA 2WP8J 3FMCA 2CQAA 3K5NA 1CQFA 1PFNA 1HR0Q 3KBGA 3D6CA 3PO3B 3CKIB 1L0WA 1CSPA 2Z4IA 5GAGC 5K36G 1NCVA 4EGVA 2SEBD 1EEFD 1SE2A 1PTOD 2ICIA 3A7LA 4MNOA 5FJ8H 5HGQA 1IBKL 2UXCQ 5ELOA 2BDOA 1QZGA 4HEDA 2PMZE 1PFBA 3M9BA 3KJOA 2MGSA 5DLQE 1RODA 3TS2A 1TKWB 3GP7A 5FLXc 4X65L 2JSOA 4UP9A 3A8IE 1PRTD 4HIOA 1GUTA 1WFQA 3B6YA 1X3EA 1WTWA 1YHBA 3EBEA 1XXGA 1NAPA 1Q8IA 1TWFB 4C2MH 1JWSD 4P73A 4ULLA 1Y1VH 3HOXG 4R4OA 5C4JH 1BKBA 3PUVA 1J5EL 2JA6G 1YIJA 5IT9E 1MI2A 2VB2X 1SMYC 1BOSA 3OW7A 4DR5Q 4BBSG 4R4IA 2I5MX 3OWFA 3H94A 2JK8A 1PYBA 3RZDB 1BBWA 3IAYA 2YYZA 4AYBE 2A6ED 4OHJA 1I6HB 1KHIA 2MP1A 4GN5A 2A68D 2DN8A 4CKEA 2F0QA 2HCCA 3PV0A 1VS0A 4C56C 3K0YA 2EVBA 4KN4C 1TIID 1VQNA 1EYAA 4QQBX 5EKKA 3PIP3 3JC66 1WTXA 4DV7L 3PQIA 4A3BG 4R9WA 1K3RA 3UDIA 4TQUS 3PO2G 3J81E 3OW2A 1EWHA 3R8BA 2HDLA 2EYLA 2QA4A 1SYBA 5FLMG 3OTOQ 4DR2Q 2IHEA 3K58A 1CKOA 2KBNA 4L8JA 4JI1L 1LT6D 2O4XA 4YY3Q 1ILPA 1A62A 2J4XA 1TS5A 1Q1BA 1VQKA 2PQEA 3HOUG 5E7NA 5LMNW 2KCNA 4R4TA 3J80c 3NQTA 2JP1A 2R3ZA 3NBHB 1TY0A 1PH5A 4RHRA 2AUKA 4JG2A 4U68A 1NUCA 2OXPA 2R61A 3CU7A 4DUYQ 1I94Q 1VQBA 3OIPA 5JPNC 2QEJC 4RMFA 3AQQA 1CHQD 3FKIB 2F0PA 1LTRD 3RLOA 4P2CB 4APVA 1JJ2A 2JA7H 1X9NA 3E9HA 1EIFA 3HKZE 3RLNA 3DWPA 1OXSC 3CC7A 1R9TB 4C2MB 1A63A 1N8RC 1Y1VB 5C4JB 4QUFA 5HGTA 1HNXQ 5G3LF 1EQQA 2XNAC 1BCPF 1RHPA 2F0HA 1GOZA 1PH2A 1C9OA 1TVXA 4GN4B 2A5HA 3VYSA 4MTKA 4I7ZC 1AE3A 1PTOH 3U58A 1E1OA 4JC0A 4HIKA 1QVCA 1TT2A 2C35B 1QE6A 4NXMQ 4LFBQ 4B3SQ 1Y1WH 3Q22A 1NNXA 1XNRL 1QG7A 4KI0A 3A5UA 1YZ6A 3J81c 4MZ9A 2EY2A 1V8QA 4X64Q 5CR3A 4DNIA 4HJ7A 4DA2A 4IOCA 4BY7H 2F03A 3DMUA 1F77A 4DAYA 3J80L 5EBDA 4ABNA 4DAYB 2Y0SG 2YTYA 3RUZA 1NR4A 4UP7A 5C44G 4OIJA 1MHWC 1XMQL 1SNCA 2MJ8A 1LABA 3D4WA 3I4NB 1WTHA 2F0DA 1WCMH 3NE5B 3T1YL 2PO4A 4YWMA 1TWAB 4QY7A 1YBYA 1WJJA 1STNA 5EAYA 3HKZB 2PNHA 4JI2L 2B63G 3D4DA 2RDGA 3E0EA 4L5SA 5CBEE 5IIFA 4JI3Q 1IKMA 4G57A 3Q8DA 2JA7B 4DV1Q 1NR2A 4Q5VA 2EJMA 3LGJA 4NMZA 1SYGA 2QF7A 4ZKCB 1BCPD 1LT5D 1CFMA 2R93G 2F4VQ 4R1JA 4A3GG 1D8LA 1SYDA 4OX9L 1IL8A 1K3BC 1LTSD 1Q12A 2DUDA 4P74A 3MVVA 4FP5D 4HR7B 5FOBB 3KJPA 2AQ3B 4GKKL 4GLXA 5I4DA 3TP6A 4CKCA 2D62A 1PTOB 1VQ8A 1I4HA 2EJGC 1WTRA 4C3JH 5C0XI 2UU9L 1STEA 3J81L 3RN5A 3K8AA 4IJHA 1IYUA 1N36L 2KA7A 1Y1WB 5IYCH 1Y14B 2AMCB 2ZTDA 4BXXG 2Q8TA 1PRTB 4CKBA 4CBVA 2Z9HA 3CQZH 4BY7B 4X3KA 4R8NA 1IW7D 3EQLC 2PYKA 4E6IA 2QILA 4Y52H 1WVLA 4DR4Q 4JBKA 3T53B 3VYRA 4K2LA 1DM0B 1GXDC 2IT1A 3GO5A 3N6RA 1HZCA 1Q7YC 2Q2UA 1L0YB 1BUVT 4AH6A 5LMNQ 1WCMB 4PMWA 1G6ZA 1KLGD 3V05A 1EY8A 4A3LH 1B1ZA 2LS01 1HQMC 4AIMA 3AMUA 1RTNA 5IGCA 1FR3A 4K8JA 1S5FD 2XWJB 1CA6A 1X55A 4B9WA 2M9VA 3BJUA 1YNJC 2NVXH 2K14A 2L1BA 1O7IA 4ID6A 1FD7D 4OIKA 1Q46A 1BBXC 3I55A 4DV6L 4JI7L 4P72A 1KTKA 1SN8A 3T1HQ 4JI8Q 3CCRA 4RHSA 3NWTA 3IFDA 4QCLA 1PH6A 2ZJQA 4NXNQ 3GV3A 2Z0SA 3CW2C 1NTGA 2R7DA 2ATWA 1LACA 1HUMA 1XNQQ 1E7ZA 1BO0A 1PXUA 1AZQA 1YNNC 4C3JB 3TBIB 1PA6A 5JJKA 2A6HC 5IYBH 1MJCA 4K8IA 4JI4Q 3A5ZB 4K5WA 5C6AA 3F1ZA 1DYQA 3QR8A 3K5MA 1PTOC 4GNXC 1A2TA 3TMEA 1MSGA 1YHQA 3SEBA 4N9TA 2WAQG 4FF3A 1KDAA 3CQZB 1AE2A 2UUBQ 1PRTC 1SLJA 5ELDA 1FGUA 4LW1A 5CV7A 4DNRB 3F2DA 4IPHA 1YJNA 5TSSA 4KHZA 4ZUIA 1CKNB 1HFNA 2F0NA 3WDNA 3DWQA 3EIVA 2WKCA 5IP7H 4KHVA 1F9RA 4DR1Q 2WAQE 5A2QE 4JPBW 3M4OH 5IGFA 3FVQA 4BS9A 2X69A 5I2XA 5J22A 3M3YH 1EY6A 1XPRA 1BQQT 2K5VA 2R6GA 3VA7A 1F2ZA 4C1NI 5CV5A 3J7YW 1HNZL 3U50C 1G91A 1PYSB 2A6EC 1LO5D 2CVRA 3GTGH 5ELNA 2A68C 1QILA 1HZ9A 4UY8C 2N8NA 4LF6L 4XT3B 5IP9H 2NWGA 1SYFA 1SJHD 1JMCA 2F0LA 3M4QA 2AQ1B 2NVXB 2OEOA 1CK1A 5AJ3Q 4WJ4A 4HSPA 4LFAQ 2K5HA 1I4XA 2VZAA 3NQIA 2DJGC 4UPAA 2J0TD 3CCSA 3KK7A 1U4MA 5BN3A 2RSOA 1GKHA 1V43A 4KY5A 4JBWA 3CCMA 4AQYQ 3CC4A 1KDCA 1Q90A 1TS2A 3GD7A 3A56A 4JK1C 4YIJA 1B9MA 5H1SE 2JA8G 4NB3A 4GKJQ 4OO1G 1NE3A 4DXFA 2R92G 4KHPQ 3A7AB 3AFPA 4A76A 4OGQC 2QDLA 2MPMA 3NBIA 4DN4M 4JI5Q 2PNRC 2WB1E 5BN5A 4LNQA 2F3WA 1FVIA 1JOOA 1KRTA 3X3MA 2RDFA 1WYDA 4DV4L 2PCFB 4GLAC 1D2BA 1DXMA 2TMPA 3V2TA 3ONAB 1ENCA 1XPOA 1EFID 4X62Q 3I4OA 1RF2D 2EYMA 3MXNB 2L12A 4JCVE 1I4RA 1FJGQ 3HG9A 3A8JE 2E2JH 2D2CC 1YEZA 2E2DC 2JA5G 3M4OB 3MZ5A 3IL8A 4A3KH 1HHVA 3R93A 3G48A 1K0SA 3M3YB 4DAMA 3W1BA 3RNUA 1VQPA 1HR0L 3RMHA 3G6JB 1PHJA 1PZID 3GTGB 3KBXA 3MHBA 2CH4W 2FMCA 1EY7A 4BBRH 1SDFA 4XQQA 4A3FG 2RHSB 3NK9A 2VQEQ 2F0MA 4LF7Q 2UXBL 2RF4A 1TWCH 1K8AC 2JXMB 1ONLA 2YTXA 5I9OA 3RLFA 4N8X1 1FGBD 1XPUA 4L5QA 2LSSA 4FO2A 4A3DG 5GAHC 4DR3Q 1A8VA 1A6XA 2RHQB 1DOKA 1TY2A 1TR5A 3HOWH 4PV1C 1K73C 2WB1B 3UE1A 5LL6X 5LHY1 1UNSA 4MIUA 2OCEA 4IPDA 4KLKA 2GVAA 2K28A 3NTIA 4DF7A 3X3NA 1QNUA 4DR5L 1AP0A 1D7QA 3LNNA 2F1MA 2DNEA 4IUTA 3VR2A 4EVOA 1J8IA 4A3CH 3G7LA 2EYOA 1E2WA 4B3MQ 4CJ0B 4K5XA 3GTMH 3J7A5 3I4MH 1PH3A 1PH8A 2AKWB 5JEAH 1GUOA 4ZKBB 4X3SA 3L3OC 1IKLA 3AEVA 2PI2E 3S9WA 1OXTA 3MWYW 2C5CA 3BU2A 4A3KB 2F52A 3OTOL 4DR2L 1S5ED 4QGUA 1O7ZA 4ZCKA 2KJXA 5FKAC 1YNND 2MO0A 3UE0A 1AH9A 2A6HD 4YY3L 1STAA 1SE3A 4L5TA 4FXKC 1HA5A 2IL8A 1N34Q 2WKDA 3K7UC 4DK6C 2JYOA 5K36H 3QJYA 2DJFC 4C1NK 4BBRB 4DV5Q 1VQMA 1JWUD 3HRZC 4BWGB 5K5PA 2MUYA 4IN3A 1XMOQ 1A2UA 4U673 4G7ZC 4OELB 1N9WA 2N55A 4Z9CB 5I6WA 4DUYL 1QZHA 1I94L 1T5XD 2LXJA 2HQLA 2K75A 1D1IA 1L1OA 1JJCB 3MTSA 3L2PA 4IOAA 4A3IB 1J9OA 1RJTA 4DR7Q 4EQNA 1L1OB 5C0XH 1KNEA 3HOWB 1IW7C 3FKIG 1HQRD 3S1NH 1SROA 2MNAA 2O5IC 4IQZA 3J7ZC 2KEDA 4IFDG 3KLWA 1C48A 3HOXH 4DGZA 1HNXL 2HUGA 1ML0D 3I7FA 1S5DD 1QOHA 1W6KA 1Y1VG 3BZCA 1EIYB 2IPKD 1ZXTA 1TWHH 1E24A 1B3AA 1UE6A 3GTMB 2ID0A 2K01A 2R7ZG 2IX0A 1LLRD 3I4MB 5IYDG 3S1QH 3KOJA 2B2YC 3I2ZA 4LFBL 1Q8KA 4NXML 4B3SL 1KDBA 2Z6KC 1IXRA 2F0EA 2K6AA 4M8AA 4DUZQ 1Q86C 4FYDA 2VUMB 1KIXA 3KLRA 3HGBA 1DONA 2EYPA 4A3BH 4UAIA 1G2TA 2Q2IA 3HOYH 4X64L 2K50A 1PDQA 3PO2H 2B39A 4R4QA 1QNKA 2M00A 1RL2A 2NVYH 2VL6A 2ZM6Q 1S5CD 1JQYD 5I6YA 3KF8A 4L63B 4UP8A 1SXTA 4RFBA 2VW9A 3KF8B 2IJ0A 1I5FA 2CW0D 3NBHA 2PMZB 2BE5C 4A4IA 1KXLA 3VA5A 4C3IG 2E76C 3SXHA 3HOUH 1B50A 4BA1I 2JEBI 3BDLA 3SK4A 1UE1A 1D5XC 2NTSA 2B29A 2EXZA 4LF5Q 1SNMA 2SNSA 5CV6A 1XTDA 3Q23A 4B3TQ 1VQ6A 3I4NG 3GTLH 4KJOA 3PIOA 2ZT9C 2HQEA 4IUVA 3FPUB 4DU9A 2K5QA 5E4XA 3M85A 1CA5A 2CCZA 4XTCS 4JI3L 2IY5B 4KY6A 5JJLA 1SE8A 1VCIA 3H3VH 4DV1L 3ITPA 2EY5A 2HHHQ 4YWLA 1QUQA 1CI3M 1B3QA 2QEXA 4AYBB 5JVH3 3S1NB 1QUQB 5CV8A 5IT9c 2F4VL 4CJ1B 1B9NA 1HNWQ 1L1OC 1UE5A 1K8GA 3HOXB 3E6ZX 5JJIA 1O78A 4QL5A 2I5HA 4HIDA 5FO7B 5KIXA 5FO8B 2VB3X 4XT1B 4F88A 4WJ3M 3UDFA 1TWHB 1J5EQ 1ENFA 1AFPA 4XYQA 3GTQH 3NXWA 1X3QA 4JI6Q 1H9RA 1AN8A 4O42A 3RR5A 3S1QB 2OF1A 1C4QA 1IL2A 3M4PA 2B2UC 2FHTA 2B2VA 1VQ4A 2MFIA 5KYLA 5FO9B 3MEHA 4J6HA 4PZ6A 2BH2A 5C3EG 1HRJA 1L0XB 4O2DA 1DGSA 4ME3A 5C4XG 3HOYB 1Y1WG 1EFWA 5EQ0A 3PO2B 3CMAA 2DGYA 4GOPA 2ASBA 1E0BA 2WV6D 3MEFA 1F2MA 2NVYB 2B2WC 4GOPB 4OONA 4F8MA 1E2VA 4CDDC 1GUNA 1ZEQX 5BR8L 2OTJA 4DR4L 1F2LA 1WD1A 1M1KC 4BY7G 2E74C 2HT1A 3KFUA 3E9IA 5DM73 2X6GA 5HURA 3PSIA 5C44H 1X32A 2O5JC 2NN6I 2C9OA 1AZPA 5CGKA 4DV3L 4J8QA 3P1HA 3E5SA 5LMNL 3HOUB 3GV6A 1NJIC 5CV9A 1PLFA 1JOQA 2H4OA 3BYYB 2Q2TA 1Y8PB 1T5EA 2EOTA 4YCUA 2Y0SE 1I6VC 1X3FA 4TKOB 1X6OA 4ZQ3A 4BA2I 2JA9A 3GTLB 4A3MH 2O2LD 3ULLA 4KN7C 1RDPD 5E4WC 2B63H 1GHJA 5IT9L 4QIWE 4FXGC 3AYHB 4NW2A 4JV5Q 1TQOA 4RKBA 4OWWB 1VQFA 3CP0A 3GTKH 4KKTA 5IWAQ 1LV9A 3Q0AA 2R93H 4A3GH 3OWEB 3T1HL 1WTQA 4JI8L 4I7AA 4LWCA 4JOIC 4P75A 4HJ9A 4O1NA 4X66Q 1GO3E 1EWCA 4KKUA 5EGTA 4RWSC 4GNXA 4NXNL 3DM1A 2MQHA 4GNXB 4HCEA 1PVOA 1XNQL 5GQOA 4DAPA 3W2DA 2RCFA 2H1EA 3GTQB 5ELCA 4ME5A 2A74C 2ZXRA 2D5DA 4CHTB 4JI4L 3J81j 1EY0A 4CJ2C 3RN2A 2YU9H 5CBAE 3CMEA 1HCZA 2EYJA 3N52A 4ZRZA 1ASYA 4B3RQ 4LFCQ 4KK7A 1K83H 2L15A 3C1FA 4KY7A 5IYCG 4RGNA 5M9OA 3K0XA 3SK8A 1SNPA 2B2VC 2UUBL 4H7BA 2KENA 5D3IB 5HY6A 4POFA 3DEPA 1PH1A 1N33Q 1CZWA 3PUYA 3CPWA 2R7FA 1S5BD 1MGSA 1HTPA 1PZJD 4GOPC 5C44B 3F8TA 2GA4B 3ULJA 4PG3A 1K8OA 1NY4A 3KLSA 4XQNA 4OWTB 3T56B 1PH7A 1SFOH 4L5RC 4ZUJA 2WACA 1I50H 3I72A 1RCVD 3HP3A 4OEMB 2N88A 3MXUA 4DXGA 4CDFC 4A3MB 1X3PA 2NZHA 5F2DA 2B63B 1KQSA 4ZYSA 3WWVA 3L0OA 1SNQA 1SRUA 4A3LG 2N49A 3EFXD 4IALA 4C3HG 1ZYRC 3PMFA 2LXKA 3GTKB 1CT1D 3CRKC 5AJ3L 2EIFA 1CKMA 1X3GA 3CRLC 3H3VC 4X6AH 1KNAA 3DLLA 2R93B 1DZ1A 4B08A 4A3GB 3K5LA 2B8FA 1YI2A 2EJFC 4AQYL 4DR6Q 1OXVA 5EJWA 1M4VA 2PW7A 4EX5A 3H3VI 4QUCA 3D3RA 2BE5D 2BCOA 4FF1A 4GKJL 4LF4Q 1GD7A 2QDBA 1FNVA 5GADC 4KTAA 4KHPL 3Q24A 1D1KA 4IURA 4KD4A 4JI5L 2XRSD 2UUAL 2E75C 2RA4A 3GTOH 2ZTEA 4WJWA 1YITA 2A19A 5FK9C 2YU9B 4QB4A 1KLUD 1BBUA 5IYBG 1E3PA 2D0PA 2KHSA 2UU9Q 3F2UA 3KUPA 4ZK9B 1QWYA 1K83B 2KOLA 1GUWA 1WOCA 2CQOA 3TP8A 5A35A 2UXDQ 1PFSA 1YHAA 3NUCA 2A8VA 1CKNA 2PZTA 3P20A 4WORA 3H91A 4X62L 2CHBD 1VQGA 3KDFA 4IUPA 3TP5A 3H0GG 1FJGL 1JE5A 3KDFB 1ILQA 2NTTA 2K05A 2XRQD 3AU7A 3TS0A 1X56A 1CHPD 4HJ5A 2BA1A 1HTLD 3JAME 5IP7G 4EQPA 1SFOB 4V190 1I50B 3HOZH 1FL0A 1HUNA 1VQIA 1P8LA 4ZAIA 3HZXA 1PFMA 3A0JA 5JJZA 1H9SB 2A1AA 2PPBC 1TWGH 3BVZA 1Q1EA 1WTPA 1A3TA 4RAUC 1NMFA 1U9RA 3ND9A 4XYOA 3PIO3 3K57A 2VQEL 2AHOB 4LF7L 5JEAJ 4FDBA 1B53A 2CKZB 2PZUA 1QVGA 3HOVG 4FNFA 3MFGA 3VR4A 1EY9A 2E8GA 5NUCA 1DJRD 1SJED 4S3SA 4MHEA 3GDEA 2HD3A 4KJNA 4DR3L 4JI7Q 2QW7A 3O13A 5CMDA 4ZLTF 4LF9Q 2N78A 5IGEA 3JAMi 3PUWA 3SGIA 1IYVA 2JA8H 4OL7A 3J7AF 3L9AX 2CW0C 3PUZA 2NBFA 4WFN3 4DV2Q 3SE0A 2R92H 3AB9A 3T4AC 3GTOB 4A93G 1VQ9A 1YJ9A 3WOEA 4DKAC 1BR9A 2GN5A 1GUSA 5IODA 5BN4A 4KV6A 1QB5D 2KHIA 1BNZA 4BY1H 3TEHB 2E5LQ 4B3ML 1KABA 5KGUA 2KEEA 3QG1A 4LF8Q 1QJOA 2WAQB 2F0VA 3P75A 1BDOA 2NB0A 2OTLA 1OXUA 3MXNA 1V1PB 2SOBA 1D5ZC 4OWXB 1YVCA 2X6LA 4J1MA 1STHA 1RIPA 5C0XJ 3C1EA 4G7HC 2B2TA 4A3EH 1B7YB 4I65A 3A54A 2OQKA 5D65A 3H09A 4JYAL 1U5KA 1IBML 1AEXA 1DOLA 4RGMA 3CHBD 4HMJA 4JI0Q 1B4OA 2FJ2A 1SMXA 2F4IA 3A74A 2L9HA 3HOZB 4A3KG 1SEBD 3K59A 1G6PA 1G291 1VF5C 3W1GA 1N34L 3BVMA 3PO3G 2UUCQ 1SSOA 3S1RH 2UXCL 1LT3D 2PW5A 1TWGB 4DV5L 2K52A 2PZWA 1V9PA 1XMOL 3DHQA 4A3FH 5CC4A 5IE8A 5KNCA 3C3LA 5L37A 4BBRG 3NTHA 2FFKB 2F0OA 2EDGA 3RZOH 3S24A 1UUPA 2IW3A 4RH6A 4GS3A 2AQ2B 4A3DH 4H0LC 4RCNA 4DR7L 2VXWA 3HEJA 5M5WH 2F0KA 4RKLA 3M4YA 4EQ5A 4LK1C 5J39A 2AWNA 1HZBA 5FLXE 4A3IG 2CWAA 5JVG3 5GROA 1N32Q 3HOWG 1LTBD 1V1OA 1F9QA 2EYHA 3ULPA 2B2YA 3CPFA 2Z6KA 1G8ZD 1HPCA 3S2HH 5M3MH 4BY1B 3CCJA 2K33A 2F3IA 3NPPA 4PMCA 4Y7NH 2KVMA 3MXPA 5M5YH 5A2QL 4H44C 1SR3A 1TS3A 1ZYRD 3EJIA 3K80C 4A3CG 2DY7A 2KCMA 3E3XA 4O0AA 4DV0Q 2AWOA 1HZAA 4DUZL 3QOLA 5KEEA 2F0SA 2NN6H 5M3FH 2F3VA 4FF4A 1EQVA 2GVBA 2E2JB 3I73A 3I4MG 1MD2D 4A3EB 1ICFB 2VUMG 4A3JH 5JEAG 2SNMA 1SNDA 4LUOA 2ZM6L 1O80A 3T16A 2NVQH 1O7LA 1VQEA 2B2TC 1K8MA 2KCCA 5E1FA 1OTCA 2ES2A 3PGZA 1ICWA 2I07B 2BOSA 3K6OA 5ELBA 1EYDA 1LTGD 3S1RB 1CZGA 1DCZA 2L55A 3BDCA 2HCIA 1VDZA 4NP5A 5C4HA 4LF5L 4A3FB 1TWCB 5DAUA 4B3TL 5FJ8G 4K6DA 1HA6A
chains in the Genus database with same CATH topology
4LAAA 4H13C 4X3UA 3J80E 3RZOB 1SBBB 2K32A 4K2KA 5EKIA 2I46A 4A3DB 5M5WB 3IFTA 3IKJA 2IX3A 1G2SA 1JOKA 5KNDA 3C2PA 1S4ZA 4B9XA 3NHHA 5C0XG 5C5MA 4HTHA 4IFDH 1M8AA 2D9UA 2B2UA 2B8GA 4G7OC 3R2TA 3S2HB 4DAVA 5M3MB 2F0JA 4HN7A 3MXGA 2TSSA 1TS4A 2G9DA 4Y7NB 5M5YB 3BS1A 1F2YA 4XQJA 3PUXA 5JAVA 4OO1I 3FDTA 2K5DA 1EZ8A 2B2WA 3VYTA 1R4PB 2K04A 4K14A 5M3FB 3TN2A 3LX0A 4HMIA 2A73B 1SNOA 4EQOA 3OHXC 4FXDA 3BYTB 3RD4A 4A3JB 1WD0A 1CM9A 1FNUA 5JOBA 2NVQB 2K7VA 2RSNA 1ET6A 1BF4A 1EL0A 2RDHA 1H9MA 2WINB 2F0FA 2OT2A 3H6MA 1XWEA 4KKSA 4HCSA 3LWUA 2FINB 2KECA 3R2IA 4KMUC 3NSWA 1PMRA 5EPJA 1UEAB 5IOCA 2NYZD 5FLXL 2LFNA 5DEHA 1STGA 4M1UB 4DNTB 1AW7A 2MHVA 3OOCA 4DK0A 5EPLA 1JC7A 3LWEA 1EIGA 1H9JA 5D3DA 2JA6B 3VR5A 5ELFA 1ENAA 2J7ZA 1JE4A 3ND8A 4BBSB 2Q8IB 1ZKOA 3GTPB 1A15A 1Z7TA 1PZKD 3DXJC 1XX8A 3EROA 1A3UA 1U4RA 1EZ6A 2L0CA 1RTOA 4RGOS 3MA2B 4PQXA 1JORA 1JB3A 3A55A 4LMQD 2R7ZB 3I8ZA 4A3BB 3SDZA 3I90A 3S17B 1GUGA 3EA6A 5DM63 5AFWA 1XYIA 3T13A 3I91A 1LTAD 2LY7A 3FEWX 1SYCA 3D6WA 4K6LA 1SAPA 3SHLA 2K1BA 2RQXA 2G9HD 5KRUA 4C3IB 3MFYA 2HDMA 3U9OA 2QCPX 1RD9D 4K5VA 3P7JA 1UAPA 3A8KE 5EPKA 2IX1A 4IZ8A 1PYWD 3NWSA 3U9SA 4DFAA 3SR1A 2ENBA 1D5MC 5G3LD 3TDQA 3D8GA 3MC0B 5JPMC 2QKIC 1ESRA 1WTVA 2L5TA 2K03A 1U4PA 2L4NA 4RCOA 4Q0FA 4XXEA 3BZDB 2Z4HA 3SK5A 5C5LA 4IUNA 4C3JG 4HSVA 3S2DB 1RKNA 1HXYD 3S14B 4IFDI 1OO9B 3VR3A 5T1IA 3VYUA 5C3EB 3S15B 5C4XB 1GHKA 3FPPA 1EEID 1MBYA 5D14A 2XN9C 2JEAI 1Z6HA 3I4LA 1II3A 4WRDA 1JR0D 2Y0SB 3OIQA 1STBA 5DNFA 2K5WA 4RGTA 2WIIB 1VMPA 4DK1A 3QB3A 4UDUC 1MSHA 5M5XB 1FYCA 1OXXK 2EY6A 1CQVA 4QIWB 3K5OA 1R4QB 3DWAA 1Y8NB 2KUMA 2FMMA 1SMYD 1ESFA 3TSSA 5J1ZA 1A3VA 2DY8A 2A69C 3NTKA 3C46A 5KYIA 2E2IB 1HFGA 5CORA 5ELEA 2VNUD 3TP7A 2XWBB 5E3FA 4R8IA 1I4QA 2M2LA 2V4DA 4QMGA 2IWHA 3ERQA 1Z47A 2ZXOA 3I70A 3S1MB 4ILWA 4MN3A 1FNWA 2L11A 1WTOA 1QCBD 2LMCB 1EU3A 2Z8LA 5LL6S 1I4PA 4G4KA 2Z1CA 1NSNS 2AUJD 3D4RA 1B2TA 3QOJA 1LTTD 5EBCA 1JICA 2LKVA 3FRPB 5IGDA 1C8CA 2RKSA 3BG3A 2SDFA 5ISRA 1EQTA 4IUQA 1DD2A 1E2ZA 4LJZC 1D6EC 1B44D 1F9SA 4QF4A 5T1GA 3VR6A 5CV4A 5C3WA 3R3OA 1H9SA 4RA8A 3V96A 1Y8OB 2XVSA 3D31A 2DNCA 1EY5A 2ICEC 1JCKB 4IUUA 4C3HB 2ZXPA 1SE4A 1Y69U 3SK6A 2EYFA 5COYA 1W6JA 2EPBA 3TZUA 3NP8A 4L6TB 4PNYA 4OO1H 3OMGA 1EY4A 4TSSA 1LT4D 4F87A 3OSOA 3W3AA 4HAEA 1BXTA 2F0GA 5C3XA 1CTMA 3OPOA 2RVLA 3UI2A 1V1PA 3Q6SA 3DUZA 3GQBA 2Q8RE 5EKLA 3OMCA 3MAQA 3BDOA 3M7NA 4XIGS 4KD3A 1I3QB 2XIWA 2F0TA 3BVGA 4NDXA 3SVMA 2XSCA 5CYUA 1U4LA 3K7AB 1GJXA 1BCPB 3H0GB 4XDXA 1F9PA 3TZDA 1STYA 3E0JA 3T51B 4IFDJ 3M7GA 5I2YA 3QIAA 2F0WA 4FF2A 5IGGA 2F0UA 2JE6I 4N9PA 2BDNA 2E2HB 2NVTB 1ET9A 5I9PA 3GTJB 3EVQA 1EU4A 2EE1A 4NKLA 3HOVB 4X3TA 4F7XA 1SYEA 1EIHA 3QO2A 4PMBA 2JA8B 4GZYC 1EYCA 1PTOF 5IGBA 3QWNA 2R92B 2NZ1D 3WOFA 1EOTA 1Q3LA 3KLSX 2EZVA 3ZYYX 4A93B 1LTID 1PRTF 1O7YA 1VF7A 1XTCD 1JWMD 2A69D 1TU2B 3HS0C 5C4ZA 1KAAA 2F0IA 2BA0A 2NUCA 3JAML 2RBMA 4V0BA 2KQ3A 1I4GA 4FVMA 1YNJD 1IHZA 3URYA 2JA5B 3I3CA 3J7AV 5KNBA 2NN6G 1H9KA 1DOMA 4TRDA 3S16B 1BCPC 1VMCA 3DEOA 3L7ZC 2EY1A 4CGYB 4ODGA 2WP8J 3FMCA 2CQAA 3K5NA 1CQFA 1PFNA 3KBGA 3D6CA 3PO3B 3CKIB 2Z4IA 5K36G 1NCVA 4EGVA 2SEBD 1EEFD 1SE2A 1PTOD 2ICIA 3A7LA 2BDOA 4HEDA 1PFBA 2MGSA 1RODA 1TKWB 3GP7A 2JSOA 3A8IE 1PRTD 1GUTA 1WTWA 1XXGA 1NAPA 1Q8IA 1TWFB 1JWSD 4ULLA 3PUVA 5IT9E 1MI2A 2VB2X 1SMYC 1BOSA 3OW7A 3H94A 3OWFA 3RZDB 3IAYA 2YYZA 2A6ED 4OHJA 1I6HB 2MP1A 2A68D 2DN8A 4CKEA 2F0QA 2HCCA 3PV0A 4C56C 3K0YA 2EVBA 4KN4C 1TIID 1EYAA 5EKKA 3PIP3 1WTXA 4R9WA 4TQUS 3J81E 1EWHA 3R8BA 2HDLA 2EYLA 1SYBA 3K58A 4L8JA 1LT6D 2O4XA 1ILPA 2J4XA 1TS5A 1Q1BA 2PQEA 2KCNA 3NQTA 2JP1A 2R3ZA 1TY0A 4RHRA 2AUKA 4U68A 1NUCA 2OXPA 2R61A 3CU7A 3OIPA 5JPNC 2QEJC 1CHQD 3FKIB 2F0PA 1LTRD 4P2CB 3DWPA 1OXSC 1R9TB 4C2MB 1Y1VB 5C4JB 4QUFA 5HGTA 5G3LF 2XNAC 1BCPF 1RHPA 2F0HA 1GOZA 1TVXA 2A5HA 3VYSA 4I7ZC 1PTOH 1TT2A 1QE6A 3Q22A 1QG7A 4KI0A 2EY2A 1V8QA 5CR3A 4DA2A 2F03A 3DMUA 1F77A 4DAYA 3J80L 5EBDA 4ABNA 3RUZA 1NR4A 4OIJA 1SNCA 2MJ8A 1LABA 3D4WA 3I4NB 2F0DA 3NE5B 2PO4A 1TWAB 1STNA 3HKZB 3D4DA 2RDGA 5CBEE 5IIFA 1IKMA 4G57A 2JA7B 1NR2A 4Q5VA 2EJMA 4NMZA 1SYGA 2QF7A 4ZKCB 1BCPD 1LT5D 1CFMA 1SYDA 1IL8A 1Q12A 1LTSD 3MVVA 4FP5D 4HR7B 5FOBB 2AQ3B 5I4DA 3TP6A 4CKCA 2D62A 1PTOB 1I4HA 2EJGC 1WTRA 5C0XI 1STEA 3J81L 1IYUA 2KA7A 1Y1WB 2Q8TA 1PRTB 4CKBA 4CBVA 4BY7B 4X3KA 4R8NA 1IW7D 3EQLC 2PYKA 4E6IA 2QILA 1WVLA 3T53B 3VYRA 4K2LA 1DM0B 1GXDC 2IT1A 3GO5A 3N6RA 1L0YB 1BUVT 1WCMB 4PMWA 1G6ZA 1KLGD 3V05A 1EY8A 1B1ZA 2LS01 1HQMC 3AMUA 1RTNA 5IGCA 1FR3A 4K8JA 1S5FD 2XWJB 1CA6A 4B9WA 2M9VA 1YNJC 2L1BA 4ID6A 1FD7D 4OIKA 1BBXC 1KTKA 4RHSA 3NWTA 3IFDA 4QCLA 3GV3A 1LACA 1HUMA 1BO0A 1PXUA 1AZQA 1YNNC 4C3JB 3TBIB 2A6HC 4K8IA 4K5WA 5C6AA 1DYQA 3K5MA 1PTOC 1A2TA 3TMEA 1MSGA 3SEBA 4N9TA 4FF3A 1KDAA 3CQZB 1PRTC 5ELDA 4DNRB 5CV7A 5TSSA 4KHZA 4ZUIA 1HFNA 2F0NA 3WDNA 3DWQA 2WKCA 4KHVA 1F9RA 5A2QE 5IGFA 3FVQA 4BS9A 2X69A 5I2XA 5J22A 1EY6A 1BQQT 2R6GA 3VA7A 1F2ZA 4C1NI 5CV5A 3J7YW 1G91A 2A6EC 1LO5D 2CVRA 2A68C 1QILA 4XT3B 2NWGA 1SYFA 1SJHD 2F0LA 2AQ1B 2NVXB 2OEOA 1CK1A 4HSPA 1I4XA 3NQIA 2J0TD 3KK7A 1U4MA 5BN3A 2RSOA 4KY5A 1V43A 4JBWA 1KDCA 1Q90A 1TS2A 3GD7A 3A56A 4JK1C 4YIJA 1B9MA 4OO1G 4DXFA 3A7AB 4OGQC 2MPMA 3NBIA 4DN4M 2PNRC 5BN5A 2F3WA 1JOOA 3X3MA 2RDFA 2PCFB 1D2BA 1DXMA 2TMPA 3V2TA 3ONAB 1ENCA 1EFID 1RF2D 2EYMA 2L12A 1I4RA 3HG9A 3A8JE 2D2CC 2E2DC 3M4OB 3MZ5A 3IL8A 1HHVA 3R93A 3M3YB 3RMHA 3G6JB 3GTGB 1PZID 3KBXA 3MHBA 2FMCA 1EY7A 1SDFA 4XQQA 3NK9A 2F0MA 2JXMB 1ONLA 5I9OA 3RLFA 1FGBD 4FO2A 1A6XA 1DOKA 1TY2A 1TR5A 4PV1C 2WB1B 5LL6X 5LHY1 1UNSA 4MIUA 2K28A 3NTIA 4DF7A 3X3NA 1QNUA 1AP0A 3LNNA 2F1MA 2DNEA 4IUTA 3VR2A 4EVOA 1J8IA 3G7LA 2EYOA 1E2WA 4CJ0B 4K5XA 5JEAH 1GUOA 4ZKBB 4X3SA 3L3OC 1IKLA 3S9WA 1OXTA 3MWYW 2C5CA 4A3KB 1S5ED 1O7ZA 2KJXA 5FKAC 1YNND 2A6HD 1STAA 1SE3A 4FXKC 1HA5A 2IL8A 2WKDA 2JYOA 5K36H 3QJYA 4C1NK 4BBRB 1JWUD 3HRZC 4BWGB 5K5PA 2MUYA 4IN3A 1A2UA 4U673 4G7ZC 2N55A 4Z9CB 5I6WA 1T5XD 1D1IA 3MTSA 4A3IB 1J9OA 1RJTA 4EQNA 5C0XH 3HOWB 1KNEA 1IW7C 1HQRD 2O5IC 4IQZA 2KEDA 4IFDG 1C48A 4DGZA 2HUGA 1ML0D 1S5DD 1QOHA 1W6KA 2IPKD 1ZXTA 1B3AA 3GTMB 2ID0A 2K01A 2IX0A 1LLRD 3I4MB 2B2YC 1KDBA 2F0EA 2K6AA 4M8AA 2VUMB 4FYDA 3KLRA 3HGBA 1DONA 2EYPA 4UAIA 1G2TA 1PDQA 2B39A 1QNKA 2M00A 1S5CD 1JQYD 5I6YA 3KF8A 4L63B 1SXTA 4RFBA 2IJ0A 2CW0D 3NBHA 2PMZB 2BE5C 3VA5A 4C3IG 2E76C 3SXHA 1B50A 4BA1I 2JEBI 3BDLA 3SK4A 1D5XC 2NTSA 2EXZA 1SNMA 2SNSA 5CV6A 3Q23A 4KJOA 2ZT9C 2HQEA 4IUVA 3FPUB 4DU9A 2K5QA 5E4XA 3M85A 1CA5A 4XTCS 4KY6A 1VCIA 3ITPA 2EY5A 1CI3M 4AYBB 5JVH3 3S1NB 5CV8A 4CJ1B 1B9NA 3HOXB 3E6ZX 1O78A 5FO7B 5KIXA 5FO8B 2VB3X 4XT1B 4F88A 1TWHB 1ENFA 1AFPA 4XYQA 3NXWA 1X3QA 1H9RA 1AN8A 4O42A 3S1QB 2OF1A 1C4QA 2B2UC 2FHTA 2B2VA 5KYLA 5FO9B 3MEHA 4J6HA 1HRJA 1L0XB 3HOYB 5EQ0A 3PO2B 1E0BA 2WV6D 1F2MA 2NVYB 2B2WC 4F8MA 1E2VA 1GUNA 1ZEQX 1F2LA 1WD1A 2E74C 5DM73 2X6GA 5HURA 2O5JC 1X32A 2NN6I 2C9OA 1AZPA 5CGKA 4J8QA 3P1HA 3E5SA 3HOUB 3GV6A 5CV9A 1PLFA 1JOQA 2H4OA 3BYYB 1Y8PB 1T5EA 2EOTA 1I6VC 4TKOB 4ZQ3A 4BA2I 3GTLB 2O2LD 4KN7C 1RDPD 5E4WC 1GHJA 5IT9L 4FXGC 4NW2A 1TQOA 4RKBA 4KKTA 1LV9A 3Q0AA 3OWEB 1WTQA 4O1NA 1EWCA 4KKUA 5EGTA 4RWSC 3DM1A 4HCEA 4DAPA 3W2DA 2H1EA 3GTQB 5ELCA 4ME5A 2A74C 2ZXRA 2D5DA 4CHTB 1EY0A 4CJ2C 5CBAE 1HCZA 2EYJA 3N52A 4ZRZA 4KK7A 3C1FA 4KY7A 4RGNA 5M9OA 3SK8A 1SNPA 2B2VC 4H7BA 5D3IB 3DEPA 1CZWA 3PUYA 1S5BD 1MGSA 1HTPA 1PZJD 5C44B 2GA4B 1K8OA 3KLSA 4XQNA 3T56B 4ZUJA 2WACA 3I72A 1RCVD 3HP3A 2N88A 3MXUA 4DXGA 4A3MB 1X3PA 5F2DA 2B63B 4ZYSA 1SNQA 4IALA 3EFXD 4C3HG 1ZYRC 3PMFA 3GTKB 1CT1D 3CRKC 3CRLC 3H3VC 1KNAA 1DZ1A 2R93B 4B08A 4A3GB 3K5LA 2B8FA 2EJFC 1OXVA 5EJWA 1M4VA 2PW7A 4QUCA 3D3RA 2BE5D 2BCOA 4FF1A 2QDBA 1FNVA 4KTAA 3Q24A 1D1KA 4IURA 4KD4A 2XRSD 2E75C 2RA4A 4WJWA 5FK9C 2YU9B 4QB4A 1KLUD 2KHSA 3F2UA 3KUPA 4ZK9B 1QWYA 1K83B 2KOLA 1GUWA 5A35A 3TP8A 3NUCA 2PZTA 3P20A 4WORA 3H91A 2CHBD 4IUPA 3TP5A 1ILQA 2NTTA 2K05A 2XRQD 3AU7A 1CHPD 2BA1A 1HTLD 3JAME 4EQPA 1SFOB 4V190 1I50B 1HUNA 4ZAIA 3HZXA 1PFMA 5JJZA 1H9SB 2PPBC 3BVZA 1Q1EA 1WTPA 1A3TA 4RAUC 1U9RA 3ND9A 4XYOA 3PIO3 3K57A 5JEAJ 1B53A 2PZUA 4FNFA 3MFGA 3VR4A 1EY9A 5NUCA 1DJRD 1SJED 4S3SA 4MHEA 4KJNA 3O13A 5CMDA 4ZLTF 5IGEA 3PUWA 1IYVA 4OL7A 3J7AF 3L9AX 2CW0C 3PUZA 2NBFA 4WFN3 3SE0A 3AB9A 3T4AC 3GTOB 3WOEA 1BR9A 1GUSA 5IODA 5BN4A 4KV6A 1QB5D 1BNZA 1KABA 5KGUA 2KEEA 3QG1A 1QJOA 2WAQB 2F0VA 3P75A 1BDOA 2NB0A 1OXUA 3MXNA 1V1PB 2SOBA 1D5ZC 2X6LA 4J1MA 1STHA 5C0XJ 3C1EA 4G7HC 2B2TA 4I65A 3A54A 5D65A 3H09A 1AEXA 1DOLA 4RGMA 3CHBD 4HMJA 1B4OA 2FJ2A 2F4IA 2L9HA 3HOZB 1SEBD 3K59A 1G291 1VF5C 3BVMA 1SSOA 1LT3D 2PW5A 1TWGB 2PZWA 3DHQA 5CC4A 5KNCA 3C3LA 3NTHA 2FFKB 2F0OA 2EDGA 1UUPA 2IW3A 4RH6A 2AQ2B 4H0LC 4RCNA 2VXWA 3HEJA 2F0KA 4RKLA 3M4YA 4LK1C 5J39A 2AWNA 5FLXE 5JVG3 1LTBD 1V1OA 1F9QA 2EYHA 2B2YA 1G8ZD 1HPCA 4BY1B 2K33A 3NPPA 4PMCA 2KVMA 3MXPA 5A2QL 4H44C 1TS3A 1ZYRD 3EJIA 2DY7A 2AWOA 3QOLA 5KEEA 2F0SA 2NN6H 2F3VA 4FF4A 1EQVA 2E2JB 3I73A 1MD2D 4A3EB 5JEAG 2SNMA 1SNDA 1O80A 3T16A 1O7LA 2B2TC 1K8MA 2KCCA 5E1FA 1ICWA 2I07B 2BOSA 3K6OA 5ELBA 1EYDA 1LTGD 3S1RB 1CZGA 1DCZA 2L55A 3BDCA 2HCIA 1VDZA 4NP5A 5C4HA 4A3FB 1TWCB 5DAUA 4K6DA 1HA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KYL A;  4LAA A;  4B9W A;  2F0T A;  4KY5 A;  3MEH A;  4J6H A;  1NSN S;  2O4X A;  2PW5 A;  4NDX A;  1KDC A;  2PZW A;  1STN A;  4DF7 A;  4EQP A;  4TRD A;  4ID6 A;  4K2K A;  4YIJ A;  3QOJ A;  1ENA A;  3DHQ A;  3SK5 A;  2PQE A;  3D4D A;  5C5L A;  4IUN A;  5CC4 A;  2LKV A;  3NQT A;  4EVO A;  1F2M A;  1KDB A;  1JOK A;  2F0E A;  5IIF A;  2EYO A;  3HZX A;  5IGD A;  4G57 A;  1RKN A;  2EY1 A;  4B9X A;  4F8M A;  2F0O A;  3ERO A;  4ODG A;  1A3U A;  3NHH A;  1EZ6 A;  4K5X A;  1STY A;  1NUC A;  2EYP A;  2OXP A;  3D6C A;  1SYG A;  4NMZ A;  5C5M A;  4HTH A;  4ZUJ A;  1A3T A;  2WAC A;  1U9R A;  2RKS A;  1JOR A;  5HUR A;  2F0W A;  3HEJ A;  2F3W A;  2F0K A;  4RKL A;  5IGG A;  2M00 A;  2F0U A;  2F0P A;  4N9P A;  2PZU A;  1JOO A;  1SYD A;  5F2D A;  3P1H A;  3E5S A;  5CGK A;  5ISR A;  2F0J A;  3MVV A;  5I6Y A;  5J39 A;  2RDF A;  5CV9 A;  1EY9 A;  1SNQ A;  5NUC A;  1JOQ A;  5I9P A;  1II3 A;  4WRD A;  4QF4 A;  4S3S A;  4IAL A;  4K8I A;  3S9W A;  2EYH A;  1STB A;  4K5W A;  4KJN A;  5CV4 A;  1F2Y A;  4ZQ3 A;  5C3W A;  5C6A A;  3PMF A;  3R3O A;  5JAV A;  3V2T A;  3EVQ A;  3QB3 A;  3VA5 A;  1EZ8 A;  1ENC A;  5IGE A;  3SXH A;  1A2T A;  3TP6 A;  3TME A;  2EY6 A;  4OL7 A;  3T13 A;  4NKL A;  5HGT A;  3BDL A;  4N9T A;  3SK4 A;  4K14 A;  2EYM A;  4PMC A;  3LX0 A;  2EXZ A;  4HMI A;  1TQO A;  1SNM A;  1KDA A;  1EY5 A;  2SNS A;  3MXP A;  1SYE A;  4RKB A;  1STA A;  5CV6 A;  4F7X A;  1SNO A;  4EQO A;  2PW7 A;  4KJO A;  1SYC A;  3MZ5 A;  3EJI A;  3SHL A;  2F0H A;  4PMB A;  2HQE A;  5J1Z A;  5CV7 A;  5IOD A;  4DU9 A;  4KV6 A;  3QOL A;  1EYC A;  2QDB A;  5KEE A;  2F0S A;  4KY6 A;  5IGB A;  5KRU A;  1A3V A;  3SK6 A;  1KAB A;  2EYF A;  2F3V A;  3ITP A;  4KTA A;  1EQV A;  4ZUI A;  2EY5 A;  5JOB A;  5K5P A;  5KGU A;  1A2U A;  2F0N A;  4KD4 A;  3OWF A;  3NP8 A;  1TT2 A;  2F0V A;  3P75 A;  4KHV A;  3U9O A;  5I6W A;  5IGF A;  5KYI A;  2SNM A;  5EGT A;  1SND A;  3MHB A;  4R8N A;  5CV8 A;  4PNY A;  2PYK A;  2SOB A;  3OMG A;  4K5V A;  4QB4 A;  3TP7 A;  4E6I A;  1EY6 A;  5J22 A;  1EY4 A;  5E3F A;  1F2Z A;  2EY2 A;  1EY7 A;  2KHS A;  2F0Q A;  3T16 A;  2F0F A;  4J1M A;  3OSO A;  3H6M A;  1STH A;  5CV5 A;  5CR3 A;  3C1E A;  3NK9 A;  4K2L A;  4ME5 A;  5E1F A;  3TP8 A;  1EYA A;  2F0M A;  4EQN A;  4I65 A;  5KIX A;  1EY0 A;  5EKK A;  3DMU A;  4QMG A;  4IZ8 A;  2F0G A;  1EYD A;  3ERQ A;  3NUC A;  5C4Z A;  2EYJ A;  2PZT A;  1KAA A;  2F0I A;  5C3X A;  5I9O A;  5IOC A;  1AEX A;  2NUC A;  4WOR A;  4HMJ A;  4DFA A;  1SYF A;  2F0L A;  2RBM A;  5DEH A;  3RUZ A;  3SR1 A;  2ENB A;  1EY8 A;  1STG A;  2OEO A;  3BDC A;  3C1F A;  3NXW A;  2KQ3 A;  4KY7 A;  4NP5 A;  3D8G A;  3TP5 A;  4DGZ A;  2EYL A;  5C4H A;  1TR5 A;  1IHZ A;  1SYB A;  5DAU A;  2OF1 A;  5M9O A;  1SNC A;  3OMC A;  3D4W A;  5EKL A;  3SK8 A;  5IGC A;  1SNP A;  4K8J A;  2F0D A;  4MIU A;  4H7B A;  4K6D A;  4KD3 A; 
#chains in the Genus database with same CATH topology
 1S72 A;  2EQS A;  4LAA A;  4H13 C;  4X3U A;  3J80 E;  3RZO B;  1MKH A;  3DM3 A;  1K9M C;  1SBB B;  2K32 A;  4K2K A;  3CCU A;  5EKI A;  2I46 A;  2HHH L;  1T9H A;  4A3D B;  4UHV A;  2UXB Q;  5M5W B;  1J6Q A;  3IFT A;  3IKJ A;  2IX3 A;  1G2S A;  1JOK A;  5KND A;  3C2P A;  1KL9 A;  1S4Z A;  3FKI H;  4B9X A;  4K0K Q;  3NHH A;  1K28 A;  1HH2 P;  2JA6 H;  1HNW L;  5C0X G;  1Q82 C;  5C5M A;  4HTH A;  4YCV A;  4AYB G;  4IFD H;  1M8A A;  2D9U A;  4BBS H;  2B2U A;  2B8G A;  4DPG A;  3GTP H;  1VQL A;  4G7O C;  3R2T A;  3S2H B;  1R9T H;  4DAV A;  3KYH C;  5M3M B;  2F0J A;  4PZ7 A;  2PI2 A;  4HN7 A;  3MXG A;  2TSS A;  1TS4 A;  3OYY A;  2G9D A;  4Y7N B;  5M5Y B;  3BS1 A;  1IYJ B;  1F2Y A;  4XQJ A;  3PUX A;  5JAV A;  4OO1 I;  4JI6 L;  3FDT A;  3G71 A;  3J80 i;  2K5D A;  1EZ8 A;  2B2W A;  3VYT A;  2R7Z H;  1R4P B;  5IYD H;  2K04 A;  3G4S A;  4K14 A;  1IBL Q;  5M3F B;  3S17 H;  3TN2 A;  1TXY A;  3LX0 A;  2VQF Q;  4HMI A;  2A73 B;  3CCL A;  1SNO A;  4EQO A;  3OHX C;  4FXD A;  3BYT B;  3RD4 A;  4A3J B;  1C0A A;  1WD0 A;  3W5O A;  1P16 A;  5FLM H;  5LMU Q;  1CM9 A;  1FNU A;  5JOB A;  3HOY G;  2NVQ B;  2K7V A;  2RSN A;  1ET6 A;  3CF5 A;  2B3G A;  4LUZ A;  1BF4 A;  4YHH Q;  3PCO B;  1EL0 A;  2RDH A;  1H9M A;  2WIN B;  4C3I H;  4H02 A;  2F0F A;  2OT2 A;  3H6M A;  4CDC C;  1XWE A;  4KKS A;  4HCS A;  3NEN A;  3LWU A;  2FIN B;  2KEC A;  3R2I A;  3F2C A;  4KMU C;  3NSW A;  1PMR A;  5EPJ A;  3I4N H;  1UEA B;  2JJQ A;  2NYZ D;  5IOC A;  1IBK Q;  3HKZ G;  5FLX L;  2LFN A;  4JOI A;  5DEH A;  1NMG A;  1TWA H;  1STG A;  4M1U B;  4JV5 L;  4DNT B;  1AW7 A;  3UDX A;  1IZ6 A;  2MHV A;  3OOC A;  4DK0 A;  2JA7 G;  4X65 Q;  5EPL A;  4LUV A;  5IWA L;  1JC7 A;  3LWE A;  1EIG A;  3J81 i;  4GLV B;  1H9J A;  1K0R A;  2OQ0 A;  5D3D A;  4ALP A;  2JA6 B;  1H95 A;  3VR5 A;  5ELF A;  1ENA A;  2J7Z A;  1JE4 A;  3ND8 A;  1PH9 A;  4BBS B;  2Q8I B;  1ZKO A;  3GTP B;  1A15 A;  1Z7T A;  1PZK D;  4X66 L;  3DXJ C;  1XX8 A;  3ERO A;  1A3U A;  1U4R A;  1EZ6 A;  2L0C A;  1RTO A;  4RGO S;  3MA2 B;  4PQX A;  1JOR A;  1JB3 A;  3A55 A;  2HIV A;  4LMQ D;  2R7Z B;  3S2D H;  1S3O A;  3I8Z A;  3S14 H;  4A3B B;  3SDZ A;  3PF4 A;  3I90 A;  3S17 B;  1GUG A;  1A0I A;  4B3R L;  4LFC L;  5C3E H;  1EQR A;  2N3S A;  3KF6 A;  3S15 H;  3EA6 A;  5C4X H;  4DV7 Q;  5DM6 3;  3KF6 B;  5AFW A;  1XYI A;  3T13 A;  3I91 A;  1YNX A;  1N33 L;  1KAW A;  1LTA D;  2LY7 A;  2PQA A;  4HIM A;  3FEW X;  1EUJ A;  1SYC A;  2PQA B;  3D6W A;  1SAP A;  1G51 A;  4K6L A;  3SHL A;  3CAM A;  1VQJ A;  2K1B A;  1XJV A;  1MIU A;  2RQX A;  4JI1 Q;  5M5X H;  2Q2H A;  2G9H D;  5KRU A;  4C3I B;  2WFW A;  1WCM G;  3MFY A;  1E1T A;  2HDM A;  3U9O A;  2QCP X;  1RD9 D;  4K5V A;  4P71 A;  1JB7 A;  3P7J A;  1UAP A;  3A8K E;  4POG A;  3TRZ A;  5EPK A;  3K81 C;  4A3M G;  2XGT A;  1VQA A;  2E2I H;  2IX1 A;  2ZTC A;  4IZ8 A;  1PYW D;  3NWS A;  3U9S A;  4DFA A;  3STB C;  4OXP A;  5J3B A;  2ENB A;  1D5M C;  5G3L D;  3SR1 A;  3TDQ A;  3D8G A;  3MC0 B;  5JPM C;  4DR6 L;  1HJP A;  2QKI C;  2EXD A;  1ESR A;  1WTV A;  3TQY A;  2L5T A;  4LF4 L;  2K03 A;  1PV4 A;  3S1M H;  1U4P A;  2L4N A;  2FXQ A;  4RCO A;  4Q0F A;  4XXE A;  3BZD B;  2Z4H A;  3SK5 A;  5C5L A;  4IUN A;  2HIX A;  4C3J G;  4HSV A;  4IJL A;  3S2D B;  1RKN A;  1HXY D;  3S14 B;  4IFD I;  1OO9 B;  3G6E A;  3VR3 A;  4JVZ A;  4BXX H;  5T1I A;  3CCQ A;  3CCE A;  2K5N A;  3VYU A;  5C3E B;  1Z9F A;  3S15 B;  2UXD L;  1XNR Q;  5C4X B;  1GHK A;  3FPP A;  1EEI D;  1MBY A;  5D14 A;  4CDE C;  2XN9 C;  2JEA I;  1Z6H A;  1S40 A;  3I4L A;  1II3 A;  4WRD A;  1JR0 D;  2Y0S B;  3OIQ A;  4N8F A;  1STB A;  5DNF A;  1VQH A;  2K5W A;  4RGT A;  4HJ8 A;  2ALY B;  4DR1 L;  2WII B;  1VMP A;  4DK1 A;  3QB3 A;  4UDU C;  1MSH A;  1LM0 A;  5M5X B;  1FYC A;  1B8A A;  1OXX K;  1CQV A;  2EY6 A;  4QIW B;  3K5O A;  5BR8 Q;  1R4Q B;  3DWA A;  1Y8N B;  2KUM A;  2FMM A;  1XMQ Q;  1X65 A;  1SMY D;  1UE7 A;  1ESF A;  3TSS A;  3T1Y Q;  5J1Z A;  4DV3 Q;  3ZJY C;  3FP9 A;  1A3V A;  2DY8 A;  4JI2 Q;  2A69 C;  3NTK A;  4PZ8 A;  3C46 A;  1YJW A;  4LFA L;  5KYI A;  3FHW A;  1HFG A;  1MJE A;  2E2I B;  2KCT A;  4C3H H;  5COR A;  3IRB A;  5ELE A;  2I5L X;  2VNU D;  3TP7 A;  2XWB B;  5E3F A;  1L2F A;  4R8I A;  2IHF A;  4DK3 C;  2KHJ A;  1I4Q A;  1JT8 A;  1EYG A;  4A75 A;  2M2L A;  2V4D A;  4OX9 Q;  4QMG A;  5GAE C;  2IWH A;  3ERQ A;  4LF9 L;  1Z47 A;  1GM5 A;  2ZXO A;  3I70 A;  3S1M B;  4ILW A;  4MN3 A;  1FNW A;  2L11 A;  1WTO A;  1QCB D;  3U4Z A;  5IY0 A;  2LMC B;  4DV2 L;  2NZO A;  4GKK Q;  1EU3 A;  2Z8L A;  4J15 A;  5LL6 S;  4JBM A;  2D0O A;  1EOV A;  1I4P A;  2JQO A;  4HJA A;  4G4K A;  2Z1C A;  1NSN S;  2AUJ D;  2E5L L;  3D4R A;  1B2T A;  1N36 Q;  3QOJ A;  1C7Y A;  3VDY A;  4LF8 L;  1VQD A;  1LTT D;  5EBC A;  1JIC A;  2LKV A;  3FRP B;  3PIP A;  1B70 B;  5IGD A;  1I3Q H;  2VS1 A;  1C8C A;  1JJG A;  2RKS A;  3K7A H;  1VQ7 A;  3CXC A;  3BG3 A;  3ICE A;  1W3S A;  2SDF A;  3H0G H;  4YWK A;  5ISR A;  1EQT A;  4IUQ A;  1DD2 A;  1E2Z A;  1VQC A;  4LJZ C;  4YCW A;  3CD6 A;  1D6E C;  1B44 D;  1F9S A;  4R4C A;  4QF4 A;  4JI0 L;  5T1G A;  4JBJ A;  3VR6 A;  5CV4 A;  5C3W A;  3R3O A;  1H9S A;  1E22 A;  1ASZ A;  4RA8 A;  1EWI A;  1HR0 W;  1V1Q A;  3V96 A;  2E2H H;  1Y8O B;  2UUC L;  2NVT H;  2XVS A;  3D31 A;  2DNC A;  3HOZ G;  1EY5 A;  2ICE C;  1JCK B;  2BH8 A;  3GTJ H;  4IUU A;  5IP9 G;  2ZJR A;  4C3H B;  2QGQ A;  2VY3 A;  2ZXP A;  1SE4 A;  1Y69 U;  3SK6 A;  2EYF A;  1VQO A;  5COY A;  3HOV H;  1W6J A;  2V1C C;  2I0Q A;  1KD1 C;  2EPB A;  3TZU A;  4DV6 Q;  3NP8 A;  4L6T B;  3UDG A;  3BZK A;  1LTL A;  2ZJP A;  1U0L A;  4PNY A;  4OO1 H;  3OMG A;  1EY4 A;  3AFQ A;  3CCV A;  4TSS A;  1LT4 D;  4F87 A;  3OSO A;  2WB1 G;  1CSQ A;  3NEM A;  3D0F A;  1N32 L;  3W3A A;  3F2B A;  4HAE A;  1BXT A;  3HKS A;  1GVP A;  2F0G A;  4TVA B;  1PH4 A;  4A93 H;  3I56 A;  5C3X A;  1CTM A;  2G5D A;  3OPO A;  2RVL A;  3UI2 A;  2H5X A;  1V1P A;  3Q6S A;  2UUA Q;  2JN4 A;  3DUZ A;  3GQB A;  1VQ5 A;  2Q8R E;  5EKL A;  3OMC A;  4IO9 A;  4BY1 G;  3MAQ A;  3BDO A;  4JW0 A;  4XIG S;  4DV0 L;  4KD3 A;  3M7N A;  1I3Q B;  2XIW A;  2F0T A;  3BVG A;  4NDX A;  3SVM A;  3STB D;  2XSC A;  3ERS X;  5CYU A;  1U4L A;  3K7A B;  1GJX A;  2JA5 H;  1BCP B;  3H0G B;  3JAM c;  4XDX A;  1F9P A;  3HFZ B;  2XTI A;  3TZD A;  1NBW A;  3PF5 A;  3ER0 A;  1STY A;  3TRE A;  4A3E G;  3E0J A;  3T51 B;  1W2B A;  4IFD J;  3M7G A;  5I2Y A;  3S16 H;  3QIA A;  1QVF A;  2F0W A;  4FF2 A;  5IGG A;  2F0U A;  2JE6 I;  4IPG A;  2CH4 A;  2BDN A;  4N9P A;  3H15 A;  2E2H B;  2NVT B;  1ET9 A;  5I9P A;  1HNZ Q;  4MTN A;  3PO3 H;  3GTJ B;  2OWO A;  3EVQ A;  4LF6 Q;  1EU4 A;  2EE1 A;  1KC8 C;  1UWV A;  4NKL A;  1Q81 C;  2RCN A;  1X54 A;  3HOV B;  4X3T A;  4F7X A;  1SYE A;  4NPS A;  1EIH A;  2YTV A;  4QJF A;  4GN3 B;  3QO2 A;  1M90 C;  2YV5 A;  4PMB A;  2CFM A;  2JA8 B;  4GZY C;  3EN2 A;  1EYC A;  1PTO F;  4K0K L;  5IGB A;  3QWN A;  3U4V A;  2R92 B;  2NZ1 D;  3WOF A;  1EOT A;  4A3I H;  2CWP A;  1TWF H;  1BVS A;  1Q3L A;  3KLS X;  2EZV A;  3ZYY X;  4A93 B;  2MO1 A;  1WI5 A;  1LTI D;  1PRT F;  1O7Y A;  1VF7 A;  2P5Z X;  2Z6B A;  1XTC D;  1JWM D;  2A69 D;  1TU2 B;  3RZD H;  3HS0 C;  5M3M G;  5C4Z A;  4RG1 A;  1I6H H;  1KAA A;  2F0I A;  2BA0 A;  4DV4 Q;  2NUC A;  3JAM L;  1LYL A;  2RBM A;  4V0B A;  1IBL L;  1KRS A;  2KQ3 A;  2VQF L;  1I4G A;  4FVM A;  1YNJ D;  1IHZ A;  1CUK A;  3URY A;  3CC2 A;  2JA5 B;  3NEL A;  3I3C A;  1LUZ A;  5KNB A;  3J7A V;  2NN6 G;  1H9K A;  1DOM A;  5M3F G;  2VUM H;  5LMU L;  4IPC A;  4TRD A;  3S16 B;  1BCP C;  1VMC A;  4A3J G;  2K4K A;  4JYA Q;  3DEO A;  4YHH L;  3L7Z C;  1UEB A;  2EY1 A;  4CGY B;  1IBM Q;  4ODG A;  2WP8 J;  3FMC A;  2CQA A;  3K5N A;  1CQF A;  1PFN A;  1HR0 Q;  3KBG A;  3D6C A;  3PO3 B;  3CKI B;  1L0W A;  1CSP A;  2Z4I A;  5GAG C;  5K36 G;  1NCV A;  4EGV A;  2SEB D;  1EEF D;  1SE2 A;  1PTO D;  2ICI A;  3A7L A;  4MNO A;  5FJ8 H;  5HGQ A;  1IBK L;  2UXC Q;  5ELO A;  2BDO A;  1QZG A;  4HED A;  2PMZ E;  1PFB A;  3M9B A;  3KJO A;  2MGS A;  5DLQ E;  1ROD A;  3TS2 A;  1TKW B;  3GP7 A;  5FLX c;  4X65 L;  2JSO A;  4UP9 A;  3A8I E;  1PRT D;  4HIO A;  1GUT A;  1WFQ A;  3B6Y A;  1X3E A;  1WTW A;  1YHB A;  3EBE A;  1XXG A;  1NAP A;  1Q8I A;  1TWF B;  4C2M H;  1JWS D;  4P73 A;  4ULL A;  1Y1V H;  3HOX G;  4R4O A;  5C4J H;  1BKB A;  3PUV A;  1J5E L;  2JA6 G;  1YIJ A;  5IT9 E;  1MI2 A;  2VB2 X;  1SMY C;  1BOS A;  3OW7 A;  4DR5 Q;  4BBS G;  4R4I A;  2I5M X;  3OWF A;  3H94 A;  2JK8 A;  1PYB A;  3RZD B;  1BBW A;  3IAY A;  2YYZ A;  4AYB E;  2A6E D;  4OHJ A;  1I6H B;  1KHI A;  2MP1 A;  4GN5 A;  2A68 D;  2DN8 A;  4CKE A;  2F0Q A;  2HCC A;  3PV0 A;  1VS0 A;  4C56 C;  3K0Y A;  2EVB A;  4KN4 C;  1TII D;  1VQN A;  1EYA A;  4QQB X;  5EKK A;  3PIP 3;  3JC6 6;  1WTX A;  4DV7 L;  3PQI A;  4A3B G;  4R9W A;  1K3R A;  3UDI A;  4TQU S;  3PO2 G;  3J81 E;  3OW2 A;  1EWH A;  3R8B A;  2HDL A;  2EYL A;  2QA4 A;  1SYB A;  5FLM G;  3OTO Q;  4DR2 Q;  2IHE A;  3K58 A;  1CKO A;  2KBN A;  4L8J A;  4JI1 L;  1LT6 D;  2O4X A;  4YY3 Q;  1ILP A;  1A62 A;  2J4X A;  1TS5 A;  1Q1B A;  1VQK A;  2PQE A;  3HOU G;  5E7N A;  5LMN W;  2KCN A;  4R4T A;  3J80 c;  3NQT A;  2JP1 A;  2R3Z A;  3NBH B;  1TY0 A;  1PH5 A;  4RHR A;  2AUK A;  4JG2 A;  4U68 A;  1NUC A;  2OXP A;  2R61 A;  3CU7 A;  4DUY Q;  1I94 Q;  1VQB A;  3OIP A;  5JPN C;  2QEJ C;  4RMF A;  3AQQ A;  1CHQ D;  3FKI B;  2F0P A;  1LTR D;  3RLO A;  4P2C B;  4APV A;  1JJ2 A;  2JA7 H;  1X9N A;  3E9H A;  1EIF A;  3HKZ E;  3RLN A;  3DWP A;  1OXS C;  3CC7 A;  1R9T B;  4C2M B;  1A63 A;  1N8R C;  1Y1V B;  5C4J B;  4QUF A;  5HGT A;  1HNX Q;  5G3L F;  1EQQ A;  2XNA C;  1BCP F;  1RHP A;  2F0H A;  1GOZ A;  1PH2 A;  1C9O A;  1TVX A;  4GN4 B;  2A5H A;  3VYS A;  4MTK A;  4I7Z C;  1AE3 A;  1PTO H;  3U58 A;  1E1O A;  4JC0 A;  4HIK A;  1QVC A;  1TT2 A;  2C35 B;  1QE6 A;  4NXM Q;  4LFB Q;  4B3S Q;  1Y1W H;  3Q22 A;  1NNX A;  1XNR L;  1QG7 A;  4KI0 A;  3A5U A;  1YZ6 A;  3J81 c;  4MZ9 A;  2EY2 A;  1V8Q A;  4X64 Q;  5CR3 A;  4DNI A;  4HJ7 A;  4DA2 A;  4IOC A;  4BY7 H;  2F03 A;  3DMU A;  1F77 A;  4DAY A;  3J80 L;  5EBD A;  4ABN A;  4DAY B;  2Y0S G;  2YTY A;  3RUZ A;  1NR4 A;  4UP7 A;  5C44 G;  4OIJ A;  1MHW C;  1XMQ L;  1SNC A;  2MJ8 A;  1LAB A;  3D4W A;  3I4N B;  1WTH A;  2F0D A;  1WCM H;  3NE5 B;  3T1Y L;  2PO4 A;  4YWM A;  1TWA B;  4QY7 A;  1YBY A;  1WJJ A;  1STN A;  5EAY A;  3HKZ B;  2PNH A;  4JI2 L;  2B63 G;  3D4D A;  2RDG A;  3E0E A;  4L5S A;  5CBE E;  5IIF A;  4JI3 Q;  1IKM A;  4G57 A;  3Q8D A;  2JA7 B;  4DV1 Q;  1NR2 A;  4Q5V A;  2EJM A;  3LGJ A;  4NMZ A;  1SYG A;  2QF7 A;  4ZKC B;  1BCP D;  1LT5 D;  1CFM A;  2R93 G;  2F4V Q;  4R1J A;  4A3G G;  1D8L A;  1SYD A;  4OX9 L;  1IL8 A;  1K3B C;  1LTS D;  1Q12 A;  2DUD A;  4P74 A;  3MVV A;  4FP5 D;  4HR7 B;  5FOB B;  3KJP A;  2AQ3 B;  4GKK L;  4GLX A;  5I4D A;  3TP6 A;  4CKC A;  2D62 A;  1PTO B;  1VQ8 A;  1I4H A;  2EJG C;  1WTR A;  4C3J H;  5C0X I;  2UU9 L;  1STE A;  3J81 L;  3RN5 A;  3K8A A;  4IJH A;  1IYU A;  1N36 L;  2KA7 A;  1Y1W B;  5IYC H;  1Y14 B;  2AMC B;  2ZTD A;  4BXX G;  2Q8T A;  1PRT B;  4CKB A;  4CBV A;  2Z9H A;  3CQZ H;  4BY7 B;  4X3K A;  4R8N A;  1IW7 D;  3EQL C;  2PYK A;  4E6I A;  2QIL A;  4Y52 H;  1WVL A;  4DR4 Q;  4JBK A;  3T53 B;  3VYR A;  4K2L A;  1DM0 B;  1GXD C;  2IT1 A;  3GO5 A;  3N6R A;  1HZC A;  1Q7Y C;  2Q2U A;  1L0Y B;  1BUV T;  4AH6 A;  5LMN Q;  1WCM B;  4PMW A;  1G6Z A;  1KLG D;  3V05 A;  1EY8 A;  4A3L H;  1B1Z A;  2LS0 1;  1HQM C;  4AIM A;  3AMU A;  1RTN A;  5IGC A;  1FR3 A;  4K8J A;  1S5F D;  2XWJ B;  1CA6 A;  1X55 A;  4B9W A;  2M9V A;  3BJU A;  1YNJ C;  2NVX H;  2K14 A;  2L1B A;  1O7I A;  4ID6 A;  1FD7 D;  4OIK A;  1Q46 A;  1BBX C;  3I55 A;  4DV6 L;  4JI7 L;  4P72 A;  1KTK A;  1SN8 A;  3T1H Q;  4JI8 Q;  3CCR A;  4RHS A;  3NWT A;  3IFD A;  4QCL A;  1PH6 A;  2ZJQ A;  4NXN Q;  3GV3 A;  2Z0S A;  3CW2 C;  1NTG A;  2R7D A;  2ATW A;  1LAC A;  1HUM A;  1XNQ Q;  1E7Z A;  1BO0 A;  1PXU A;  1AZQ A;  1YNN C;  4C3J B;  3TBI B;  1PA6 A;  5JJK A;  2A6H C;  5IYB H;  1MJC A;  4K8I A;  4JI4 Q;  3A5Z B;  4K5W A;  5C6A A;  3F1Z A;  1DYQ A;  3QR8 A;  3K5M A;  1PTO C;  4GNX C;  1A2T A;  3TME A;  1MSG A;  1YHQ A;  3SEB A;  4N9T A;  2WAQ G;  4FF3 A;  1KDA A;  3CQZ B;  1AE2 A;  2UUB Q;  1PRT C;  1SLJ A;  5ELD A;  1FGU A;  4LW1 A;  5CV7 A;  4DNR B;  3F2D A;  4IPH A;  1YJN A;  5TSS A;  4KHZ A;  4ZUI A;  1CKN B;  1HFN A;  2F0N A;  3WDN A;  3DWQ A;  3EIV A;  2WKC A;  5IP7 H;  4KHV A;  1F9R A;  4DR1 Q;  2WAQ E;  5A2Q E;  4JPB W;  3M4O H;  5IGF A;  3FVQ A;  4BS9 A;  2X69 A;  5I2X A;  5J22 A;  3M3Y H;  1EY6 A;  1XPR A;  1BQQ T;  2K5V A;  2R6G A;  3VA7 A;  1F2Z A;  4C1N I;  5CV5 A;  3J7Y W;  1HNZ L;  3U50 C;  1G91 A;  1PYS B;  2A6E C;  1LO5 D;  2CVR A;  3GTG H;  5ELN A;  2A68 C;  1QIL A;  1HZ9 A;  4UY8 C;  2N8N A;  4LF6 L;  4XT3 B;  5IP9 H;  2NWG A;  1SYF A;  1SJH D;  1JMC A;  2F0L A;  3M4Q A;  2AQ1 B;  2NVX B;  2OEO A;  1CK1 A;  5AJ3 Q;  4WJ4 A;  4HSP A;  4LFA Q;  2K5H A;  1I4X A;  2VZA A;  3NQI A;  2DJG C;  4UPA A;  2J0T D;  3CCS A;  3KK7 A;  1U4M A;  5BN3 A;  2RSO A;  1GKH A;  1V43 A;  4KY5 A;  4JBW A;  3CCM A;  4AQY Q;  3CC4 A;  1KDC A;  1Q90 A;  1TS2 A;  3GD7 A;  3A56 A;  4JK1 C;  4YIJ A;  1B9M A;  5H1S E;  2JA8 G;  4NB3 A;  4GKJ Q;  4OO1 G;  1NE3 A;  4DXF A;  2R92 G;  4KHP Q;  3A7A B;  3AFP A;  4A76 A;  4OGQ C;  2QDL A;  2MPM A;  3NBI A;  4DN4 M;  4JI5 Q;  2PNR C;  2WB1 E;  5BN5 A;  4LNQ A;  2F3W A;  1FVI A;  1JOO A;  1KRT A;  3X3M A;  2RDF A;  1WYD A;  4DV4 L;  2PCF B;  4GLA C;  1D2B A;  1DXM A;  2TMP A;  3V2T A;  3ONA B;  1ENC A;  1XPO A;  1EFI D;  4X62 Q;  3I4O A;  1RF2 D;  2EYM A;  3MXN B;  2L12 A;  4JCV E;  1I4R A;  1FJG Q;  3HG9 A;  3A8J E;  2E2J H;  2D2C C;  1YEZ A;  2E2D C;  2JA5 G;  3M4O B;  3MZ5 A;  3IL8 A;  4A3K H;  1HHV A;  3R93 A;  3G48 A;  1K0S A;  3M3Y B;  4DAM A;  3W1B A;  3RNU A;  1VQP A;  1HR0 L;  3RMH A;  3G6J B;  1PHJ A;  1PZI D;  3GTG B;  3KBX A;  3MHB A;  2CH4 W;  2FMC A;  1EY7 A;  4BBR H;  1SDF A;  4XQQ A;  4A3F G;  2RHS B;  3NK9 A;  2VQE Q;  2F0M A;  4LF7 Q;  2UXB L;  2RF4 A;  1TWC H;  1K8A C;  2JXM B;  1ONL A;  2YTX A;  5I9O A;  3RLF A;  4N8X 1;  1FGB D;  1XPU A;  4L5Q A;  2LSS A;  4FO2 A;  4A3D G;  5GAH C;  4DR3 Q;  1A8V A;  1A6X A;  2RHQ B;  1DOK A;  1TY2 A;  1TR5 A;  3HOW H;  4PV1 C;  1K73 C;  2WB1 B;  3UE1 A;  5LL6 X;  5LHY 1;  1UNS A;  4MIU A;  2OCE A;  4IPD A;  4KLK A;  2GVA A;  2K28 A;  3NTI A;  4DF7 A;  3X3N A;  1QNU A;  4DR5 L;  1AP0 A;  1D7Q A;  3LNN A;  2F1M A;  2DNE A;  4IUT A;  3VR2 A;  4EVO A;  1J8I A;  4A3C H;  3G7L A;  2EYO A;  1E2W A;  4B3M Q;  4CJ0 B;  4K5X A;  3GTM H;  3J7A 5;  3I4M H;  1PH3 A;  1PH8 A;  2AKW B;  5JEA H;  1GUO A;  4ZKB B;  4X3S A;  3L3O C;  1IKL A;  3AEV A;  2PI2 E;  3S9W A;  1OXT A;  3MWY W;  2C5C A;  3BU2 A;  4A3K B;  2F52 A;  3OTO L;  4DR2 L;  1S5E D;  4QGU A;  1O7Z A;  4ZCK A;  2KJX A;  5FKA C;  1YNN D;  2MO0 A;  3UE0 A;  1AH9 A;  2A6H D;  4YY3 L;  1STA A;  1SE3 A;  4L5T A;  4FXK C;  1HA5 A;  2IL8 A;  1N34 Q;  2WKD A;  3K7U C;  4DK6 C;  2JYO A;  5K36 H;  3QJY A;  2DJF C;  4C1N K;  4BBR B;  4DV5 Q;  1VQM A;  1JWU D;  3HRZ C;  4BWG B;  5K5P A;  2MUY A;  4IN3 A;  1XMO Q;  1A2U A;  4U67 3;  4G7Z C;  4OEL B;  1N9W A;  2N55 A;  4Z9C B;  5I6W A;  4DUY L;  1QZH A;  1I94 L;  1T5X D;  2LXJ A;  2HQL A;  2K75 A;  1D1I A;  1L1O A;  1JJC B;  3MTS A;  3L2P A;  4IOA A;  4A3I B;  1J9O A;  1RJT A;  4DR7 Q;  4EQN A;  1L1O B;  5C0X H;  1KNE A;  3HOW B;  1IW7 C;  3FKI G;  1HQR D;  3S1N H;  1SRO A;  2MNA A;  2O5I C;  4IQZ A;  3J7Z C;  2KED A;  4IFD G;  3KLW A;  1C48 A;  3HOX H;  4DGZ A;  1HNX L;  2HUG A;  1ML0 D;  3I7F A;  1S5D D;  1QOH A;  1W6K A;  1Y1V G;  3BZC A;  1EIY B;  2IPK D;  1ZXT A;  1TWH H;  1E24 A;  1B3A A;  1UE6 A;  3GTM B;  2ID0 A;  2K01 A;  2R7Z G;  2IX0 A;  1LLR D;  3I4M B;  5IYD G;  3S1Q H;  3KOJ A;  2B2Y C;  3I2Z A;  4LFB L;  1Q8K A;  4NXM L;  4B3S L;  1KDB A;  2Z6K C;  1IXR A;  2F0E A;  2K6A A;  4M8A A;  4DUZ Q;  1Q86 C;  4FYD A;  2VUM B;  1KIX A;  3KLR A;  3HGB A;  1DON A;  2EYP A;  4A3B H;  4UAI A;  1G2T A;  2Q2I A;  3HOY H;  4X64 L;  2K50 A;  1PDQ A;  3PO2 H;  2B39 A;  4R4Q A;  1QNK A;  2M00 A;  1RL2 A;  2NVY H;  2VL6 A;  2ZM6 Q;  1S5C D;  1JQY D;  5I6Y A;  3KF8 A;  4L63 B;  4UP8 A;  1SXT A;  4RFB A;  2VW9 A;  3KF8 B;  2IJ0 A;  1I5F A;  2CW0 D;  3NBH A;  2PMZ B;  2BE5 C;  4A4I A;  1KXL A;  3VA5 A;  4C3I G;  2E76 C;  3SXH A;  3HOU H;  1B50 A;  4BA1 I;  2JEB I;  3BDL A;  3SK4 A;  1UE1 A;  1D5X C;  2NTS A;  2B29 A;  2EXZ A;  4LF5 Q;  1SNM A;  2SNS A;  5CV6 A;  1XTD A;  3Q23 A;  4B3T Q;  1VQ6 A;  3I4N G;  3GTL H;  4KJO A;  3PIO A;  2ZT9 C;  2HQE A;  4IUV A;  3FPU B;  4DU9 A;  2K5Q A;  5E4X A;  3M85 A;  1CA5 A;  2CCZ A;  4XTC S;  4JI3 L;  2IY5 B;  4KY6 A;  5JJL A;  1SE8 A;  1VCI A;  3H3V H;  4DV1 L;  3ITP A;  2EY5 A;  2HHH Q;  4YWL A;  1QUQ A;  1CI3 M;  1B3Q A;  2QEX A;  4AYB B;  5JVH 3;  3S1N B;  1QUQ B;  5CV8 A;  5IT9 c;  2F4V L;  4CJ1 B;  1B9N A;  1HNW Q;  1L1O C;  1UE5 A;  1K8G A;  3HOX B;  3E6Z X;  5JJI A;  1O78 A;  4QL5 A;  2I5H A;  4HID A;  5FO7 B;  5KIX A;  5FO8 B;  2VB3 X;  4XT1 B;  4F88 A;  4WJ3 M;  3UDF A;  1TWH B;  1J5E Q;  1ENF A;  1AFP A;  4XYQ A;  3GTQ H;  3NXW A;  1X3Q A;  4JI6 Q;  1H9R A;  1AN8 A;  4O42 A;  3RR5 A;  3S1Q B;  2OF1 A;  1C4Q A;  1IL2 A;  3M4P A;  2B2U C;  2FHT A;  2B2V A;  1VQ4 A;  2MFI A;  5KYL A;  5FO9 B;  3MEH A;  4J6H A;  4PZ6 A;  2BH2 A;  5C3E G;  1HRJ A;  1L0X B;  4O2D A;  1DGS A;  4ME3 A;  5C4X G;  3HOY B;  1Y1W G;  1EFW A;  5EQ0 A;  3PO2 B;  3CMA A;  2DGY A;  4GOP A;  2ASB A;  1E0B A;  2WV6 D;  3MEF A;  1F2M A;  2NVY B;  2B2W C;  4GOP B;  4OON A;  4F8M A;  1E2V A;  4CDD C;  1GUN A;  1ZEQ X;  5BR8 L;  2OTJ A;  4DR4 L;  1F2L A;  1WD1 A;  1M1K C;  4BY7 G;  2E74 C;  2HT1 A;  3KFU A;  3E9I A;  5DM7 3;  2X6G A;  5HUR A;  3PSI A;  5C44 H;  1X32 A;  2O5J C;  2NN6 I;  2C9O A;  1AZP A;  5CGK A;  4DV3 L;  4J8Q A;  3P1H A;  3E5S A;  5LMN L;  3HOU B;  3GV6 A;  1NJI C;  5CV9 A;  1PLF A;  1JOQ A;  2H4O A;  3BYY B;  2Q2T A;  1Y8P B;  1T5E A;  2EOT A;  4YCU A;  2Y0S E;  1I6V C;  1X3F A;  4TKO B;  1X6O A;  4ZQ3 A;  4BA2 I;  2JA9 A;  3GTL B;  4A3M H;  2O2L D;  3ULL A;  4KN7 C;  1RDP D;  5E4W C;  2B63 H;  1GHJ A;  5IT9 L;  4QIW E;  4FXG C;  3AYH B;  4NW2 A;  4JV5 Q;  1TQO A;  4RKB A;  4OWW B;  1VQF A;  3CP0 A;  3GTK H;  4KKT A;  5IWA Q;  1LV9 A;  3Q0A A;  2R93 H;  4A3G H;  3OWE B;  3T1H L;  1WTQ A;  4JI8 L;  4I7A A;  4LWC A;  4JOI C;  4P75 A;  4HJ9 A;  4O1N A;  4X66 Q;  1GO3 E;  1EWC A;  4KKU A;  5EGT A;  4RWS C;  4GNX A;  4NXN L;  3DM1 A;  2MQH A;  4GNX B;  4HCE A;  1PVO A;  1XNQ L;  5GQO A;  4DAP A;  3W2D A;  2RCF A;  2H1E A;  3GTQ B;  5ELC A;  4ME5 A;  2A74 C;  2ZXR A;  2D5D A;  4CHT B;  4JI4 L;  3J81 j;  1EY0 A;  4CJ2 C;  3RN2 A;  2YU9 H;  5CBA E;  3CME A;  1HCZ A;  2EYJ A;  3N52 A;  4ZRZ A;  1ASY A;  4B3R Q;  4LFC Q;  4KK7 A;  1K83 H;  2L15 A;  3C1F A;  4KY7 A;  5IYC G;  4RGN A;  5M9O A;  3K0X A;  3SK8 A;  1SNP A;  2B2V C;  2UUB L;  4H7B A;  2KEN A;  5D3I B;  5HY6 A;  4POF A;  3DEP A;  1PH1 A;  1N33 Q;  1CZW A;  3PUY A;  3CPW A;  2R7F A;  1S5B D;  1MGS A;  1HTP A;  1PZJ D;  4GOP C;  5C44 B;  3F8T A;  2GA4 B;  3ULJ A;  4PG3 A;  1K8O A;  1NY4 A;  3KLS A;  4XQN A;  4OWT B;  3T56 B;  1PH7 A;  1SFO H;  4L5R C;  4ZUJ A;  2WAC A;  1I50 H;  3I72 A;  1RCV D;  3HP3 A;  4OEM B;  2N88 A;  3MXU A;  4DXG A;  4CDF C;  4A3M B;  1X3P A;  2NZH A;  5F2D A;  2B63 B;  1KQS A;  4ZYS A;  3WWV A;  3L0O A;  1SNQ A;  1SRU A;  4A3L G;  2N49 A;  3EFX D;  4IAL A;  4C3H G;  1ZYR C;  3PMF A;  2LXK A;  3GTK B;  1CT1 D;  3CRK C;  5AJ3 L;  2EIF A;  1CKM A;  1X3G A;  3CRL C;  3H3V C;  4X6A H;  1KNA A;  3DLL A;  2R93 B;  1DZ1 A;  4B08 A;  4A3G B;  3K5L A;  2B8F A;  1YI2 A;  2EJF C;  4AQY L;  4DR6 Q;  1OXV A;  5EJW A;  1M4V A;  2PW7 A;  4EX5 A;  3H3V I;  4QUC A;  3D3R A;  2BE5 D;  2BCO A;  4FF1 A;  4GKJ L;  4LF4 Q;  1GD7 A;  2QDB A;  1FNV A;  5GAD C;  4KTA A;  4KHP L;  3Q24 A;  1D1K A;  4IUR A;  4KD4 A;  4JI5 L;  2XRS D;  2UUA L;  2E75 C;  2RA4 A;  3GTO H;  2ZTE A;  4WJW A;  1YIT A;  2A19 A;  5FK9 C;  2YU9 B;  4QB4 A;  1KLU D;  1BBU A;  5IYB G;  1E3P A;  2D0P A;  2KHS A;  2UU9 Q;  3F2U A;  3KUP A;  4ZK9 B;  1QWY A;  1K83 B;  2KOL A;  1GUW A;  1WOC A;  2CQO A;  3TP8 A;  5A35 A;  2UXD Q;  1PFS A;  1YHA A;  3NUC A;  2A8V A;  1CKN A;  2PZT A;  3P20 A;  4WOR A;  3H91 A;  4X62 L;  2CHB D;  1VQG A;  3KDF A;  4IUP A;  3TP5 A;  3H0G G;  1FJG L;  1JE5 A;  3KDF B;  1ILQ A;  2NTT A;  2K05 A;  2XRQ D;  3AU7 A;  3TS0 A;  1X56 A;  1CHP D;  4HJ5 A;  2BA1 A;  1HTL D;  3JAM E;  5IP7 G;  4EQP A;  1SFO B;  4V19 0;  1I50 B;  3HOZ H;  1FL0 A;  1HUN A;  1VQI A;  1P8L A;  4ZAI A;  3HZX A;  1PFM A;  3A0J A;  5JJZ A;  1H9S B;  2A1A A;  2PPB C;  1TWG H;  3BVZ A;  1Q1E A;  1WTP A;  1A3T A;  4RAU C;  1NMF A;  1U9R A;  3ND9 A;  4XYO A;  3PIO 3;  3K57 A;  2VQE L;  2AHO B;  4LF7 L;  5JEA J;  4FDB A;  1B53 A;  2CKZ B;  2PZU A;  1QVG A;  3HOV G;  4FNF A;  3MFG A;  3VR4 A;  1EY9 A;  2E8G A;  5NUC A;  1DJR D;  1SJE D;  4S3S A;  4MHE A;  3GDE A;  2HD3 A;  4KJN A;  4DR3 L;  4JI7 Q;  2QW7 A;  3O13 A;  5CMD A;  4ZLT F;  4LF9 Q;  2N78 A;  5IGE A;  3JAM i;  3PUW A;  3SGI A;  1IYV A;  2JA8 H;  4OL7 A;  3J7A F;  3L9A X;  2CW0 C;  3PUZ A;  2NBF A;  4WFN 3;  4DV2 Q;  3SE0 A;  2R92 H;  3AB9 A;  3T4A C;  3GTO B;  4A93 G;  1VQ9 A;  1YJ9 A;  3WOE A;  4DKA C;  1BR9 A;  2GN5 A;  1GUS A;  5IOD A;  5BN4 A;  4KV6 A;  1QB5 D;  2KHI A;  1BNZ A;  4BY1 H;  3TEH B;  2E5L Q;  4B3M L;  1KAB A;  5KGU A;  2KEE A;  3QG1 A;  4LF8 Q;  1QJO A;  2WAQ B;  2F0V A;  3P75 A;  1BDO A;  2NB0 A;  2OTL A;  1OXU A;  3MXN A;  1V1P B;  2SOB A;  1D5Z C;  4OWX B;  1YVC A;  2X6L A;  4J1M A;  1STH A;  1RIP A;  5C0X J;  3C1E A;  4G7H C;  2B2T A;  4A3E H;  1B7Y B;  4I65 A;  3A54 A;  2OQK A;  5D65 A;  3H09 A;  4JYA L;  1U5K A;  1IBM L;  1AEX A;  1DOL A;  4RGM A;  3CHB D;  4HMJ A;  4JI0 Q;  1B4O A;  2FJ2 A;  1SMX A;  2F4I A;  3A74 A;  2L9H A;  3HOZ B;  4A3K G;  1SEB D;  3K59 A;  1G6P A;  1G29 1;  1VF5 C;  3W1G A;  1N34 L;  3BVM A;  3PO3 G;  2UUC Q;  1SSO A;  3S1R H;  2UXC L;  1LT3 D;  2PW5 A;  1TWG B;  4DV5 L;  2K52 A;  2PZW A;  1V9P A;  1XMO L;  3DHQ A;  4A3F H;  5CC4 A;  5IE8 A;  5KNC A;  3C3L A;  5L37 A;  4BBR G;  3NTH A;  2FFK B;  2F0O A;  2EDG A;  3RZO H;  3S24 A;  1UUP A;  2IW3 A;  4RH6 A;  4GS3 A;  2AQ2 B;  4A3D H;  4H0L C;  4RCN A;  4DR7 L;  2VXW A;  3HEJ A;  5M5W H;  2F0K A;  4RKL A;  3M4Y A;  4EQ5 A;  4LK1 C;  5J39 A;  2AWN A;  1HZB A;  5FLX E;  4A3I G;  2CWA A;  5JVG 3;  5GRO A;  1N32 Q;  3HOW G;  1LTB D;  1V1O A;  1F9Q A;  2EYH A;  3ULP A;  2B2Y A;  3CPF A;  2Z6K A;  1G8Z D;  1HPC A;  3S2H H;  5M3M H;  4BY1 B;  3CCJ A;  2K33 A;  2F3I A;  3NPP A;  4PMC A;  4Y7N H;  2KVM A;  3MXP A;  5M5Y H;  5A2Q L;  4H44 C;  1SR3 A;  1TS3 A;  1ZYR D;  3EJI A;  3K80 C;  4A3C G;  2DY7 A;  2KCM A;  3E3X A;  4O0A A;  4DV0 Q;  2AWO A;  1HZA A;  4DUZ L;  3QOL A;  5KEE A;  2F0S A;  2NN6 H;  5M3F H;  2F3V A;  4FF4 A;  1EQV A;  2GVB A;  2E2J B;  3I73 A;  3I4M G;  1MD2 D;  4A3E B;  1ICF B;  2VUM G;  4A3J H;  5JEA G;  2SNM A;  1SND A;  4LUO A;  2ZM6 L;  1O80 A;  3T16 A;  2NVQ H;  1O7L A;  1VQE A;  2B2T C;  1K8M A;  2KCC A;  5E1F A;  1OTC A;  2ES2 A;  3PGZ A;  1ICW A;  2I07 B;  2BOS A;  3K6O A;  5ELB A;  1EYD A;  1LTG D;  3S1R B;  1CZG A;  1DCZ A;  2L55 A;  3BDC A;  2HCI A;  1VDZ A;  4NP5 A;  5C4H A;  4LF5 L;  4A3F B;  1TWC B;  5DAU A;  4B3T L;  5FJ8 G;  4K6D A;  1HA6 A; 
#chains in the Genus database with same CATH homology
 4LAA A;  4H13 C;  4X3U A;  3J80 E;  3RZO B;  1SBB B;  2K32 A;  4K2K A;  5EKI A;  2I46 A;  4A3D B;  5M5W B;  3IFT A;  3IKJ A;  2IX3 A;  1G2S A;  1JOK A;  5KND A;  3C2P A;  1S4Z A;  4B9X A;  3NHH A;  5C0X G;  5C5M A;  4HTH A;  4IFD H;  1M8A A;  2D9U A;  2B2U A;  2B8G A;  4G7O C;  3R2T A;  3S2H B;  4DAV A;  5M3M B;  2F0J A;  4HN7 A;  3MXG A;  2TSS A;  1TS4 A;  2G9D A;  4Y7N B;  5M5Y B;  3BS1 A;  1F2Y A;  4XQJ A;  3PUX A;  5JAV A;  4OO1 I;  3FDT A;  2K5D A;  1EZ8 A;  2B2W A;  3VYT A;  1R4P B;  2K04 A;  4K14 A;  5M3F B;  3TN2 A;  3LX0 A;  4HMI A;  2A73 B;  1SNO A;  4EQO A;  3OHX C;  4FXD A;  3BYT B;  3RD4 A;  4A3J B;  1WD0 A;  1CM9 A;  1FNU A;  5JOB A;  2NVQ B;  2K7V A;  2RSN A;  1ET6 A;  1BF4 A;  1EL0 A;  2RDH A;  1H9M A;  2WIN B;  2F0F A;  2OT2 A;  3H6M A;  1XWE A;  4KKS A;  4HCS A;  3LWU A;  2FIN B;  2KEC A;  3R2I A;  4KMU C;  3NSW A;  1PMR A;  5EPJ A;  1UEA B;  5IOC A;  2NYZ D;  5FLX L;  2LFN A;  5DEH A;  1STG A;  4M1U B;  4DNT B;  1AW7 A;  2MHV A;  3OOC A;  4DK0 A;  5EPL A;  1JC7 A;  3LWE A;  1EIG A;  1H9J A;  5D3D A;  2JA6 B;  3VR5 A;  5ELF A;  1ENA A;  2J7Z A;  1JE4 A;  3ND8 A;  4BBS B;  2Q8I B;  1ZKO A;  3GTP B;  1A15 A;  1Z7T A;  1PZK D;  3DXJ C;  1XX8 A;  3ERO A;  1A3U A;  1U4R A;  1EZ6 A;  2L0C A;  1RTO A;  4RGO S;  3MA2 B;  4PQX A;  1JOR A;  1JB3 A;  3A55 A;  4LMQ D;  2R7Z B;  3I8Z A;  4A3B B;  3SDZ A;  3I90 A;  3S17 B;  1GUG A;  3EA6 A;  5DM6 3;  5AFW A;  1XYI A;  3T13 A;  3I91 A;  1LTA D;  2LY7 A;  3FEW X;  1SYC A;  3D6W A;  4K6L A;  1SAP A;  3SHL A;  2K1B A;  2RQX A;  2G9H D;  5KRU A;  4C3I B;  3MFY A;  2HDM A;  3U9O A;  2QCP X;  1RD9 D;  4K5V A;  3P7J A;  1UAP A;  3A8K E;  5EPK A;  2IX1 A;  4IZ8 A;  1PYW D;  3NWS A;  3U9S A;  4DFA A;  3SR1 A;  2ENB A;  1D5M C;  5G3L D;  3TDQ A;  3D8G A;  3MC0 B;  5JPM C;  2QKI C;  1ESR A;  1WTV A;  2L5T A;  2K03 A;  1U4P A;  2L4N A;  4RCO A;  4Q0F A;  4XXE A;  3BZD B;  2Z4H A;  3SK5 A;  5C5L A;  4IUN A;  4C3J G;  4HSV A;  3S2D B;  1RKN A;  1HXY D;  3S14 B;  4IFD I;  1OO9 B;  3VR3 A;  5T1I A;  3VYU A;  5C3E B;  3S15 B;  5C4X B;  1GHK A;  3FPP A;  1EEI D;  1MBY A;  5D14 A;  2XN9 C;  2JEA I;  1Z6H A;  3I4L A;  1II3 A;  4WRD A;  1JR0 D;  2Y0S B;  3OIQ A;  1STB A;  5DNF A;  2K5W A;  4RGT A;  2WII B;  1VMP A;  4DK1 A;  3QB3 A;  4UDU C;  1MSH A;  5M5X B;  1FYC A;  1OXX K;  2EY6 A;  1CQV A;  4QIW B;  3K5O A;  1R4Q B;  3DWA A;  1Y8N B;  2KUM A;  2FMM A;  1SMY D;  1ESF A;  3TSS A;  5J1Z A;  1A3V A;  2DY8 A;  2A69 C;  3NTK A;  3C46 A;  5KYI A;  2E2I B;  1HFG A;  5COR A;  5ELE A;  2VNU D;  3TP7 A;  2XWB B;  5E3F A;  4R8I A;  1I4Q A;  2M2L A;  2V4D A;  4QMG A;  2IWH A;  3ERQ A;  1Z47 A;  2ZXO A;  3I70 A;  3S1M B;  4ILW A;  4MN3 A;  1FNW A;  2L11 A;  1WTO A;  1QCB D;  2LMC B;  1EU3 A;  2Z8L A;  5LL6 S;  1I4P A;  4G4K A;  2Z1C A;  1NSN S;  2AUJ D;  3D4R A;  1B2T A;  3QOJ A;  1LTT D;  5EBC A;  1JIC A;  2LKV A;  3FRP B;  5IGD A;  1C8C A;  2RKS A;  3BG3 A;  2SDF A;  5ISR A;  1EQT A;  4IUQ A;  1DD2 A;  1E2Z A;  4LJZ C;  1D6E C;  1B44 D;  1F9S A;  4QF4 A;  5T1G A;  3VR6 A;  5CV4 A;  5C3W A;  3R3O A;  1H9S A;  4RA8 A;  3V96 A;  1Y8O B;  2XVS A;  3D31 A;  2DNC A;  1EY5 A;  2ICE C;  1JCK B;  4IUU A;  4C3H B;  2ZXP A;  1SE4 A;  1Y69 U;  3SK6 A;  2EYF A;  5COY A;  1W6J A;  2EPB A;  3TZU A;  3NP8 A;  4L6T B;  4PNY A;  4OO1 H;  3OMG A;  1EY4 A;  4TSS A;  1LT4 D;  4F87 A;  3OSO A;  3W3A A;  4HAE A;  1BXT A;  2F0G A;  5C3X A;  1CTM A;  3OPO A;  2RVL A;  3UI2 A;  1V1P A;  3Q6S A;  3DUZ A;  3GQB A;  2Q8R E;  5EKL A;  3OMC A;  3MAQ A;  3BDO A;  3M7N A;  4XIG S;  4KD3 A;  1I3Q B;  2XIW A;  2F0T A;  3BVG A;  4NDX A;  3SVM A;  2XSC A;  5CYU A;  1U4L A;  3K7A B;  1GJX A;  1BCP B;  3H0G B;  4XDX A;  1F9P A;  3TZD A;  1STY A;  3E0J A;  3T51 B;  4IFD J;  3M7G A;  5I2Y A;  3QIA A;  2F0W A;  4FF2 A;  5IGG A;  2F0U A;  2JE6 I;  4N9P A;  2BDN A;  2E2H B;  2NVT B;  1ET9 A;  5I9P A;  3GTJ B;  3EVQ A;  1EU4 A;  2EE1 A;  4NKL A;  3HOV B;  4X3T A;  4F7X A;  1SYE A;  1EIH A;  3QO2 A;  4PMB A;  2JA8 B;  4GZY C;  1EYC A;  1PTO F;  5IGB A;  3QWN A;  2R92 B;  2NZ1 D;  3WOF A;  1EOT A;  1Q3L A;  3KLS X;  2EZV A;  3ZYY X;  4A93 B;  1LTI D;  1PRT F;  1O7Y A;  1VF7 A;  1XTC D;  1JWM D;  2A69 D;  1TU2 B;  3HS0 C;  5C4Z A;  1KAA A;  2F0I A;  2BA0 A;  2NUC A;  3JAM L;  2RBM A;  4V0B A;  2KQ3 A;  1I4G A;  4FVM A;  1YNJ D;  1IHZ A;  3URY A;  2JA5 B;  3I3C A;  3J7A V;  5KNB A;  2NN6 G;  1H9K A;  1DOM A;  4TRD A;  3S16 B;  1BCP C;  1VMC A;  3DEO A;  3L7Z C;  2EY1 A;  4CGY B;  4ODG A;  2WP8 J;  3FMC A;  2CQA A;  3K5N A;  1CQF A;  1PFN A;  3KBG A;  3D6C A;  3PO3 B;  3CKI B;  2Z4I A;  5K36 G;  1NCV A;  4EGV A;  2SEB D;  1EEF D;  1SE2 A;  1PTO D;  2ICI A;  3A7L A;  2BDO A;  4HED A;  1PFB A;  2MGS A;  1ROD A;  1TKW B;  3GP7 A;  2JSO A;  3A8I E;  1PRT D;  1GUT A;  1WTW A;  1XXG A;  1NAP A;  1Q8I A;  1TWF B;  1JWS D;  4ULL A;  3PUV A;  5IT9 E;  1MI2 A;  2VB2 X;  1SMY C;  1BOS A;  3OW7 A;  3H94 A;  3OWF A;  3RZD B;  3IAY A;  2YYZ A;  2A6E D;  4OHJ A;  1I6H B;  2MP1 A;  2A68 D;  2DN8 A;  4CKE A;  2F0Q A;  2HCC A;  3PV0 A;  4C56 C;  3K0Y A;  2EVB A;  4KN4 C;  1TII D;  1EYA A;  5EKK A;  3PIP 3;  1WTX A;  4R9W A;  4TQU S;  3J81 E;  1EWH A;  3R8B A;  2HDL A;  2EYL A;  1SYB A;  3K58 A;  4L8J A;  1LT6 D;  2O4X A;  1ILP A;  2J4X A;  1TS5 A;  1Q1B A;  2PQE A;  2KCN A;  3NQT A;  2JP1 A;  2R3Z A;  1TY0 A;  4RHR A;  2AUK A;  4U68 A;  1NUC A;  2OXP A;  2R61 A;  3CU7 A;  3OIP A;  5JPN C;  2QEJ C;  1CHQ D;  3FKI B;  2F0P A;  1LTR D;  4P2C B;  3DWP A;  1OXS C;  1R9T B;  4C2M B;  1Y1V B;  5C4J B;  4QUF A;  5HGT A;  5G3L F;  2XNA C;  1BCP F;  1RHP A;  2F0H A;  1GOZ A;  1TVX A;  2A5H A;  3VYS A;  4I7Z C;  1PTO H;  1TT2 A;  1QE6 A;  3Q22 A;  1QG7 A;  4KI0 A;  2EY2 A;  1V8Q A;  5CR3 A;  4DA2 A;  2F03 A;  3DMU A;  1F77 A;  4DAY A;  3J80 L;  5EBD A;  4ABN A;  3RUZ A;  1NR4 A;  4OIJ A;  1SNC A;  2MJ8 A;  1LAB A;  3D4W A;  3I4N B;  2F0D A;  3NE5 B;  2PO4 A;  1TWA B;  1STN A;  3HKZ B;  3D4D A;  2RDG A;  5CBE E;  5IIF A;  1IKM A;  4G57 A;  2JA7 B;  1NR2 A;  4Q5V A;  2EJM A;  4NMZ A;  1SYG A;  2QF7 A;  4ZKC B;  1BCP D;  1LT5 D;  1CFM A;  1SYD A;  1IL8 A;  1Q12 A;  1LTS D;  3MVV A;  4FP5 D;  4HR7 B;  5FOB B;  2AQ3 B;  5I4D A;  3TP6 A;  4CKC A;  2D62 A;  1PTO B;  1I4H A;  2EJG C;  1WTR A;  5C0X I;  1STE A;  3J81 L;  1IYU A;  2KA7 A;  1Y1W B;  2Q8T A;  1PRT B;  4CKB A;  4CBV A;  4BY7 B;  4X3K A;  4R8N A;  1IW7 D;  3EQL C;  2PYK A;  4E6I A;  2QIL A;  1WVL A;  3T53 B;  3VYR A;  4K2L A;  1DM0 B;  1GXD C;  2IT1 A;  3GO5 A;  3N6R A;  1L0Y B;  1BUV T;  1WCM B;  4PMW A;  1G6Z A;  1KLG D;  3V05 A;  1EY8 A;  1B1Z A;  2LS0 1;  1HQM C;  3AMU A;  1RTN A;  5IGC A;  1FR3 A;  4K8J A;  1S5F D;  2XWJ B;  1CA6 A;  4B9W A;  2M9V A;  1YNJ C;  2L1B A;  4ID6 A;  1FD7 D;  4OIK A;  1BBX C;  1KTK A;  4RHS A;  3NWT A;  3IFD A;  4QCL A;  3GV3 A;  1LAC A;  1HUM A;  1BO0 A;  1PXU A;  1AZQ A;  1YNN C;  4C3J B;  3TBI B;  2A6H C;  4K8I A;  4K5W A;  5C6A A;  1DYQ A;  3K5M A;  1PTO C;  1A2T A;  3TME A;  1MSG A;  3SEB A;  4N9T A;  4FF3 A;  1KDA A;  3CQZ B;  1PRT C;  5ELD A;  4DNR B;  5CV7 A;  5TSS A;  4KHZ A;  4ZUI A;  1HFN A;  2F0N A;  3WDN A;  3DWQ A;  2WKC A;  4KHV A;  1F9R A;  5A2Q E;  5IGF A;  3FVQ A;  4BS9 A;  2X69 A;  5I2X A;  5J22 A;  1EY6 A;  1BQQ T;  2R6G A;  3VA7 A;  1F2Z A;  4C1N I;  5CV5 A;  3J7Y W;  1G91 A;  2A6E C;  1LO5 D;  2CVR A;  2A68 C;  1QIL A;  4XT3 B;  2NWG A;  1SYF A;  1SJH D;  2F0L A;  2AQ1 B;  2NVX B;  2OEO A;  1CK1 A;  4HSP A;  1I4X A;  3NQI A;  2J0T D;  3KK7 A;  1U4M A;  5BN3 A;  2RSO A;  4KY5 A;  1V43 A;  4JBW A;  1KDC A;  1Q90 A;  1TS2 A;  3GD7 A;  3A56 A;  4JK1 C;  4YIJ A;  1B9M A;  4OO1 G;  4DXF A;  3A7A B;  4OGQ C;  2MPM A;  3NBI A;  4DN4 M;  2PNR C;  5BN5 A;  2F3W A;  1JOO A;  3X3M A;  2RDF A;  2PCF B;  1D2B A;  1DXM A;  2TMP A;  3V2T A;  3ONA B;  1ENC A;  1EFI D;  1RF2 D;  2EYM A;  2L12 A;  1I4R A;  3HG9 A;  3A8J E;  2D2C C;  2E2D C;  3M4O B;  3MZ5 A;  3IL8 A;  1HHV A;  3R93 A;  3M3Y B;  3RMH A;  3G6J B;  3GTG B;  1PZI D;  3KBX A;  3MHB A;  2FMC A;  1EY7 A;  1SDF A;  4XQQ A;  3NK9 A;  2F0M A;  2JXM B;  1ONL A;  5I9O A;  3RLF A;  1FGB D;  4FO2 A;  1A6X A;  1DOK A;  1TY2 A;  1TR5 A;  4PV1 C;  2WB1 B;  5LL6 X;  5LHY 1;  1UNS A;  4MIU A;  2K28 A;  3NTI A;  4DF7 A;  3X3N A;  1QNU A;  1AP0 A;  3LNN A;  2F1M A;  2DNE A;  4IUT A;  3VR2 A;  4EVO A;  1J8I A;  3G7L A;  2EYO A;  1E2W A;  4CJ0 B;  4K5X A;  5JEA H;  1GUO A;  4ZKB B;  4X3S A;  3L3O C;  1IKL A;  3S9W A;  1OXT A;  3MWY W;  2C5C A;  4A3K B;  1S5E D;  1O7Z A;  2KJX A;  5FKA C;  1YNN D;  2A6H D;  1STA A;  1SE3 A;  4FXK C;  1HA5 A;  2IL8 A;  2WKD A;  2JYO A;  5K36 H;  3QJY A;  4C1N K;  4BBR B;  1JWU D;  3HRZ C;  4BWG B;  5K5P A;  2MUY A;  4IN3 A;  1A2U A;  4U67 3;  4G7Z C;  2N55 A;  4Z9C B;  5I6W A;  1T5X D;  1D1I A;  3MTS A;  4A3I B;  1J9O A;  1RJT A;  4EQN A;  5C0X H;  3HOW B;  1KNE A;  1IW7 C;  1HQR D;  2O5I C;  4IQZ A;  2KED A;  4IFD G;  1C48 A;  4DGZ A;  2HUG A;  1ML0 D;  1S5D D;  1QOH A;  1W6K A;  2IPK D;  1ZXT A;  1B3A A;  3GTM B;  2ID0 A;  2K01 A;  2IX0 A;  1LLR D;  3I4M B;  2B2Y C;  1KDB A;  2F0E A;  2K6A A;  4M8A A;  2VUM B;  4FYD A;  3KLR A;  3HGB A;  1DON A;  2EYP A;  4UAI A;  1G2T A;  1PDQ A;  2B39 A;  1QNK A;  2M00 A;  1S5C D;  1JQY D;  5I6Y A;  3KF8 A;  4L63 B;  1SXT A;  4RFB A;  2IJ0 A;  2CW0 D;  3NBH A;  2PMZ B;  2BE5 C;  3VA5 A;  4C3I G;  2E76 C;  3SXH A;  1B50 A;  4BA1 I;  2JEB I;  3BDL A;  3SK4 A;  1D5X C;  2NTS A;  2EXZ A;  1SNM A;  2SNS A;  5CV6 A;  3Q23 A;  4KJO A;  2ZT9 C;  2HQE A;  4IUV A;  3FPU B;  4DU9 A;  2K5Q A;  5E4X A;  3M85 A;  1CA5 A;  4XTC S;  4KY6 A;  1VCI A;  3ITP A;  2EY5 A;  1CI3 M;  4AYB B;  5JVH 3;  3S1N B;  5CV8 A;  4CJ1 B;  1B9N A;  3HOX B;  3E6Z X;  1O78 A;  5FO7 B;  5KIX A;  5FO8 B;  2VB3 X;  4XT1 B;  4F88 A;  1TWH B;  1ENF A;  1AFP A;  4XYQ A;  3NXW A;  1X3Q A;  1H9R A;  1AN8 A;  4O42 A;  3S1Q B;  2OF1 A;  1C4Q A;  2B2U C;  2FHT A;  2B2V A;  5KYL A;  5FO9 B;  3MEH A;  4J6H A;  1HRJ A;  1L0X B;  3HOY B;  5EQ0 A;  3PO2 B;  1E0B A;  2WV6 D;  1F2M A;  2NVY B;  2B2W C;  4F8M A;  1E2V A;  1GUN A;  1ZEQ X;  1F2L A;  1WD1 A;  2E74 C;  5DM7 3;  2X6G A;  5HUR A;  2O5J C;  1X32 A;  2NN6 I;  2C9O A;  1AZP A;  5CGK A;  4J8Q A;  3P1H A;  3E5S A;  3HOU B;  3GV6 A;  5CV9 A;  1PLF A;  1JOQ A;  2H4O A;  3BYY B;  1Y8P B;  1T5E A;  2EOT A;  1I6V C;  4TKO B;  4ZQ3 A;  4BA2 I;  3GTL B;  2O2L D;  4KN7 C;  1RDP D;  5E4W C;  1GHJ A;  5IT9 L;  4FXG C;  4NW2 A;  1TQO A;  4RKB A;  4KKT A;  1LV9 A;  3Q0A A;  3OWE B;  1WTQ A;  4O1N A;  1EWC A;  4KKU A;  5EGT A;  4RWS C;  3DM1 A;  4HCE A;  4DAP A;  3W2D A;  2H1E A;  3GTQ B;  5ELC A;  4ME5 A;  2A74 C;  2ZXR A;  2D5D A;  4CHT B;  1EY0 A;  4CJ2 C;  5CBA E;  1HCZ A;  2EYJ A;  3N52 A;  4ZRZ A;  4KK7 A;  3C1F A;  4KY7 A;  4RGN A;  5M9O A;  3SK8 A;  1SNP A;  2B2V C;  4H7B A;  5D3I B;  3DEP A;  1CZW A;  3PUY A;  1S5B D;  1MGS A;  1HTP A;  1PZJ D;  5C44 B;  2GA4 B;  1K8O A;  3KLS A;  4XQN A;  3T56 B;  4ZUJ A;  2WAC A;  3I72 A;  1RCV D;  3HP3 A;  2N88 A;  3MXU A;  4DXG A;  4A3M B;  1X3P A;  5F2D A;  2B63 B;  4ZYS A;  1SNQ A;  4IAL A;  3EFX D;  4C3H G;  1ZYR C;  3PMF A;  3GTK B;  1CT1 D;  3CRK C;  3CRL C;  3H3V C;  1KNA A;  1DZ1 A;  2R93 B;  4B08 A;  4A3G B;  3K5L A;  2B8F A;  2EJF C;  1OXV A;  5EJW A;  1M4V A;  2PW7 A;  4QUC A;  3D3R A;  2BE5 D;  2BCO A;  4FF1 A;  2QDB A;  1FNV A;  4KTA A;  3Q24 A;  1D1K A;  4IUR A;  4KD4 A;  2XRS D;  2E75 C;  2RA4 A;  4WJW A;  5FK9 C;  2YU9 B;  4QB4 A;  1KLU D;  2KHS A;  3F2U A;  3KUP A;  4ZK9 B;  1QWY A;  1K83 B;  2KOL A;  1GUW A;  5A35 A;  3TP8 A;  3NUC A;  2PZT A;  3P20 A;  4WOR A;  3H91 A;  2CHB D;  4IUP A;  3TP5 A;  1ILQ A;  2NTT A;  2K05 A;  2XRQ D;  3AU7 A;  1CHP D;  2BA1 A;  1HTL D;  3JAM E;  4EQP A;  1SFO B;  4V19 0;  1I50 B;  1HUN A;  4ZAI A;  3HZX A;  1PFM A;  5JJZ A;  1H9S B;  2PPB C;  3BVZ A;  1Q1E A;  1WTP A;  1A3T A;  4RAU C;  1U9R A;  3ND9 A;  4XYO A;  3PIO 3;  3K57 A;  5JEA J;  1B53 A;  2PZU A;  4FNF A;  3MFG A;  3VR4 A;  1EY9 A;  5NUC A;  1DJR D;  1SJE D;  4S3S A;  4MHE A;  4KJN A;  3O13 A;  5CMD A;  4ZLT F;  5IGE A;  3PUW A;  1IYV A;  4OL7 A;  3J7A F;  3L9A X;  2CW0 C;  3PUZ A;  2NBF A;  4WFN 3;  3SE0 A;  3AB9 A;  3T4A C;  3GTO B;  3WOE A;  1BR9 A;  1GUS A;  5IOD A;  5BN4 A;  4KV6 A;  1QB5 D;  1BNZ A;  1KAB A;  5KGU A;  2KEE A;  3QG1 A;  1QJO A;  2WAQ B;  2F0V A;  3P75 A;  1BDO A;  2NB0 A;  1OXU A;  3MXN A;  1V1P B;  2SOB A;  1D5Z C;  2X6L A;  4J1M A;  1STH A;  5C0X J;  3C1E A;  4G7H C;  2B2T A;  4I65 A;  3A54 A;  5D65 A;  3H09 A;  1AEX A;  1DOL A;  4RGM A;  3CHB D;  4HMJ A;  1B4O A;  2FJ2 A;  2F4I A;  2L9H A;  3HOZ B;  1SEB D;  3K59 A;  1G29 1;  1VF5 C;  3BVM A;  1SSO A;  1LT3 D;  2PW5 A;  1TWG B;  2PZW A;  3DHQ A;  5CC4 A;  5KNC A;  3C3L A;  3NTH A;  2FFK B;  2F0O A;  2EDG A;  1UUP A;  2IW3 A;  4RH6 A;  2AQ2 B;  4H0L C;  4RCN A;  2VXW A;  3HEJ A;  2F0K A;  4RKL A;  3M4Y A;  4LK1 C;  5J39 A;  2AWN A;  5FLX E;  5JVG 3;  1LTB D;  1V1O A;  1F9Q A;  2EYH A;  2B2Y A;  1G8Z D;  1HPC A;  4BY1 B;  2K33 A;  3NPP A;  4PMC A;  2KVM A;  3MXP A;  5A2Q L;  4H44 C;  1TS3 A;  1ZYR D;  3EJI A;  2DY7 A;  2AWO A;  3QOL A;  5KEE A;  2F0S A;  2NN6 H;  2F3V A;  4FF4 A;  1EQV A;  2E2J B;  3I73 A;  1MD2 D;  4A3E B;  5JEA G;  2SNM A;  1SND A;  1O80 A;  3T16 A;  1O7L A;  2B2T C;  1K8M A;  2KCC A;  5E1F A;  1ICW A;  2I07 B;  2BOS A;  3K6O A;  5ELB A;  1EYD A;  1LTG D;  3S1R B;  1CZG A;  1DCZ A;  2L55 A;  3BDC A;  2HCI A;  1VDZ A;  4NP5 A;  5C4H A;  4A3F B;  1TWC B;  5DAU A;  4K6D A;  1HA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...