3SK6A

Crystal structure of staphylococcal nuclease variant delta+nviagla v23k/l36e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTKKLMYKGQPMVFRELLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23K/L36E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk6A00
1F2ZA 2F0GA 4HTHA 3QB3A 3H6MA 1SYGA 3NUCA 5E1FA 4H7BA 3SR1A 1AEXA 2SNMA 5EGTA 2EYLA 5HGTA 4KHVA 4MIUA 4KY6A 5I6YA 4ZQ3A 3D8GA 5IIFA 3SK4A 5IGEA 2PW5A 4KJNA 4B9XA 4EQOA 2QDBA 4RKBA 5IOCA 4DU9A 5C5MA 5KIXA 4K5VA 5CV8A 3S9WA 2F0HA 2F0DA 1SYFA 2EYPA 1NSNS 2F0IA 2F0EA 2RBMA 2PW7A 2EY6A 2WACA 3DHQA 3MEHA 4I65A 1F2MA 3NP8A 1ENAA 5CV7A 3U9OA 4K2LA 2EYFA 4NMZA 5KYIA 4KJOA 3EROA 5KRUA 4KD3A 5KYLA 3MXPA 5CV4A 4RKLA 5EKKA 1EY7A 4J1MA 4EQNA 4KV6A 4KD4A 5E3FA 2F0UA 1SNMA 2M00A 1SNCA 2F0LA 4B9WA 2EYJA 3EVQA 5CV6A 4K2KA 5IGGA 4QMGA 5IGCA 2EY5A 4PNYA 5NUCA 4DFAA 5DAUA 4G57A 2KHSA 4HMJA 5C4ZA 1SYBA 5CGKA 2F0QA 1KAAA 3P1HA 4IZ8A 5F2DA 3MHBA 1SYEA 4F7XA 3D6CA 2F3VA 5KEEA 1EY9A 2F0TA 4E6IA 4EVOA 1EY6A 5EKLA 2EYMA 2F0OA 3TP8A 4K6DA 4KY7A 2F0MA 4TRDA 1STNA 1U9RA 2F0KA 3D4DA 4R8NA 3SK5A 2PZTA 3ITPA 4ZUJA 1STHA 5C4HA 3OSOA 5CV9A 4EQPA 2EXZA 5M9OA 2EYOA 1STGA 5J1ZA 2SOBA 3RUZA 3E5SA 1TR5A 2NUCA 4DGZA 3BDLA 1SYCA 3OWFA 2EY1A 5CR3A 2F0FA 3OMGA 4WRDA 3VA5A 5CC4A 5I9OA 3TP7A 1TQOA 4WORA 5HURA 4PMCA 1SYDA 3EJIA 1JOQA 2F0SA 1EY0A 2F0PA 1EYCA 4ID6A 2LKVA 3NHHA 1SNOA 5J22A 1SNPA 4IALA 2PYKA 3C1FA 3P75A 4KTAA 5DEHA 1NUCA 5IGBA 4NKLA 4NP5A 4DF7A 5IODA 2RDFA 3V2TA 2KQ3A 3NQTA 3LX0A 3QOLA 3TMEA 1A3TA 1EY5A 3ERQA 3TP6A 1JOOA 4J6HA 4K14A 1KABA 1RKNA 2F0NA 1A3VA 2OXPA 2F0WA 3OMCA 4K8JA 4LAAA 3SXHA 2EYHA 4N9PA 4IUNA 2PQEA 3PMFA 1STYA 4YIJA 3HEJA 5K5PA 3SK6A 2O4XA 2PZWA 2SNSA 1A3UA 2EY2A 1JORA 4K8IA 4KY5A 5JAVA 2OEOA 4ZUIA 2OF1A 3QOJA 1TT2A 2F0VA 1KDBA 4OL7A 4QB4A 5C3XA 5I9PA 5ISRA 5JOBA 4HMIA 1EYDA 4QF4A 4ODGA 3MZ5A 1II3A 3C1EA 1SNQA 2ENBA 4NDXA 2RKSA 5KGUA 2HQEA 4S3SA 5C6AA 3T16A 1EZ8A 1F2YA 2F3WA 1SNDA 5C3WA 4N9TA 3T13A 5J39A 3SHLA 1A2UA 1EYAA 4K5WA 4ME5A 3DMUA 5I6WA 3BDCA 3TP5A 1JOKA 4K5XA 5IGDA 5IGFA 1STBA 3NXWA 1KDCA 5C5LA 3MVVA 1KDAA 3R3OA 1EY8A 5CV5A 1STAA 4F8MA 1EQVA 4PMBA 1EZ6A 1ENCA 3NK9A 2F0JA 3HZXA 1IHZA 3SK8A 3D4WA 2PZUA 1A2TA 1EY4A
chains in the Genus database with same CATH superfamily
2BCOA 4HSVA 5EGTA 4UP8A 2OTLA 4DV3L 1PH4A 1HXYD 2O2LD 1G6PA 1Y1WG 1DOKA 4YY3L 5KIXA 1ML0D 1UWVA 3VR2A 5IOCA 3FKIH 3K58A 3VYRA 4DV2Q 1HR0L 3CCLA 1N33L 3S16H 2L15A 4A3MB 3S1QB 3JAMc 4Q5VA 5E3FA 3CXCA 2ZJRA 2ICEC 3H0GB 3ER0A 3I7FA 4DNIA 3KLSX 2PI2E 2SEBD 4AQYQ 5NUCA 1R9TB 5CMDA 4X3KA 1Q12A 1Q82C 1KLUD 1OXUA 2F3VA 1TWGB 2B2YA 1EY6A 4JBMA 4CKCA 1L1OB 2WB1G 2AUKA 3S24A 3J80E 2RDGA 1IKLA 1BXTA 1JQYD 2R92H 3I73A 2A68C 1STGA 1TWHH 3HFZB 4WJ3M 4JI4Q 3J7AV 3STBD 4X65L 3P20A 3EJIA 1KXLA 1JR0D 3WWVA 1ONLA 4U673 1UEBA 1B70B 1SE2A 2UUCQ 2KJXA 3K5OA 3I56A 1SMXA 3PV0A 3GO5A 4DR4L 3CQZH 1PXUA 3EFXD 4JI0Q 4DV1L 4XQQA 3K5NA 4B3RQ 2K7VA 2C9OA 4A3IG 2UU9Q 3T53B 3GTMB 1X9NA 1ZYRD 1XXGA 3UE1A 1NR4A 4DV0L 1QE6A 2K05A 2K6AA 1IW7C 3RZDB 4FNFA 4ODGA 3AEVA 3J7AF 1JWMD 2FMMA 5IYDH 4C3IB 2ZM6Q 2I46A 5IWAL 5IYCH 1QWYA 4RH6A 2MQHA 1STBA 3NXWA 1KLGD 3IKJA 4IN3A 3GDEA 2JXMB 5CYUA 1IHZA 4DR6L 1SSOA 1TWCB 3E5SA 1CKMA 4DR2L 2RCFA 1A0IA 4I7ZC 4A3JB 5HGTA 1FNWA 1DCZA 1BCPB 3HOXG 3U9SA 3F2BA 3HOVB 4B9XA 1WFQA 2B2TA 3MFGA 3S9WA 3K6OA 3NWSA 4K5VA 4QQBX 1WD0A 5D65A 3NQIA 1F2MA 1SBBB 2XWJB 3CF5A 4A4IA 3JAMi 2OTJA 2M2LA 5J3BA 4KV6A 5JVH3 4OONA 2VUMH 4BY1B 3V96A 4LF5Q 2K28A 5CORA 1YHBA 2H1EA 5IGGA 1ASZA 4KKSA 4LF6L 3J81j 3HOUH 1YNXA 4L63B 1EWHA 4HMJA 1NCVA 2JA7B 3L0OA 4IUPA 4DV5Q 4HIOA 4JI5Q 3CD6A 3ND8A 1HNZQ 2AUJD 5ELDA 1Q86C 1PZKD 2F3IA 2UUBL 1KRSA 1BQQT 1LLRD 1Q90A 1SE3A 2J4XA 4GNXB 1WTHA 2EXZA 2KHIA 2JE6I 2SOBA 3DM3A 3FP9A 2E2JB 1STEA 3R8BA 4R4CA 1LV9A 4WRDA 5I9OA 5A2QE 3NBHB 3S1MB 4R4IA 4LWCA 2VUMG 1I6HH 2HT1A 1IBLQ 1PA6A 4WJ4A 4NXNL 5J22A 1WTOA 5M3FB 5D3DA 3RMHA 1HUMA 1L0XB 1TVXA 2NN6I 3S15B 2Z1CA 3NQTA 1UE1A 3S14B 2F0WA 1I4QA 3TZUA 3X3NA 3IFTA 3PO2H 1LTID 4KKTA 5IYBH 4A76A 3TS0A 1B9NA 3GV6A 1F9QA 1RTOA 2F0VA 4OELB 1XNRQ 2VY3A 1RTNA 2JA6H 3VYSA 3WOEA 3C1EA 4UP7A 2R7ZG 2F3WA 2B2YC 5FJ8H 4GN4B 4DK3C 1HNWL 1KQSA 2E5LQ 2HIVA 1GUNA 1AZPA 5CV5A 5IE8A 2G5DA 3M3YH 4RHRA 3SK8A 3CKIB 1GO3E 5M5XH 2IX1A 2KVMA 1I94L 4X6AH 4HJ8A 1EQQA 2Z6BA 1CSPA 1PH7A 4KHPQ 5ELCA 3G6EA 2CH4A 3A55A 4BBSB 1CA5A 3RN2A 4JI6L 3HKZB 1IL2A 2F0IA 4PG3A 2WACA 3DHQA 5C4XH 3J81i 3HKSA 2JA8H 2VQFQ 5KYIA 2JA5H 3G6JB 5DM63 2N8NA 4KD4A 4IUTA 1RF2D 2X69A 5M3MB 1CHQD 1N36L 1VQAA 3CC2A 5C4ZA 3J7ZC 4HIMA 3H3VC 1V1OA 4IZ8A 3MHBA 4DR1Q 2F03A 1RCVD 1KC8C 1IXRA 4JPBW 3BDOA 1GXDC 4DR5Q 4B3SQ 3PIPA 3BU2A 5COYA 3CC4A 2F0KA 1T5XD 1Y1WB 3H3VI 2I5LX 3M7GA 3I4OA 3K0XA 4JI3L 1VQBA 5IT9L 1PTOH 5J1ZA 4DGZA 1L2FA 4CGYB 1HZBA 4RHSA 2UXBL 2B29A 4BXXG 1ILQA 4UY8C 5JPNC 1SYDA 3ICEA 4R9WA 1VQLA 2B2TC 3BYYB 2IX0A 2PCFB 3PUYA 5T1IA 5LL6X 1VQFA 5KNDA 1K83B 2QF7A 2F52A 4BY7B 3TMEA 1A3TA 1B50A 1HH2P 2EYHA 1EEID 5FO7B 1R4QB 4IUNA 4QIWB 4FF2A 4KY5A 3A7AB 2OEOA 3J80i 4A3GG 1ESFA 4XYOA 1PRTF 3VA7A 3J81L 2BA1A 1RDPD 1ZXTA 3F2DA 2L55A 1VQDA 2J7ZA 3OTOL 1V1PB 1EIYB 2R93H 1NNXA 4P71A 1MSHA 2AHOB 4JYAL 4DV6L 3T1HL 1S5BD 4DUYQ 4KMUC 3PF4A 1HJPA 4QUCA 2KCTA 4HAEA 1ZEQX 1PRTD 2EYLA 2KOLA 4KHVA 3K5MA 4JBKA 5C44G 4NPSA 3KDFA 3SK4A 1K3BC 2E76C 5KNBA 4DAYB 5JEAG 4RKBA 4LF8L 1TWGH 1SYFA 2O5IC 5E4XA 2RBMA 2PW7A 2EY6A 4LMQD 2I0QA 1F2LA 3BVGA 5IP7H 1VQ9A 4B3TQ 1G2SA 5FOBB 4J1MA 1SAPA 4FYDA 2Z0SA 2M00A 1CUKA 1FL0A 2MUYA 4P72A 1XPUA 1B4OA 4DK1A 4DFAA 3L9AX 4JBJA 2D9UA 4K0KL 2OT2A 2R93G 1DD2A 2OWOA 2DY7A 3MFYA 1ET9A 1HQRD 4Y7NH 2BOSA 1Y1VH 2EYMA 2F0OA 4BBRG 4HJ9A 4IOCA 4A3LH 3S17H 4TRDA 1TS3A 3L3OC 1BNZA 4GN5A 3GQBA 3A0JA 3BG3A 2DJGC 1CQVA 2IHEA 2EYOA 5BN3A 4POGA 3Q0AA 3VYTA 3J80L 5CC4A 2VS1A 1H9JA 1RODA 4OWTB 3NENA 3CCUA 4C56C 4F87A 2BH8A 2ZT9C 1O7LA 2F0PA 2MPMA 1VQKA 1S5ED 1TY2A 4ZLTF 5LMNQ 3GTJB 4PZ6A 4KTAA 4YHHL 3M4YA 3KF8B 2Y0SG 5GAHC 4PZ7A 4DV7L 4UHVA 1KABA 3BJUA 4LAAA 2ZTCA 5D3IB 2QDLA 4AYBG 4HIDA 1Y1VG 1PH8A 3KOJA 1XPOA 1IKMA 4X62Q 3FEWX 3KJOA 1KDBA 4QB4A 5I9PA 4PMWA 3HOVH 2WINB 5FO8B 4DUZL 1E7ZA 4HMIA 4L5TA 5GQOA 1PV4A 1A15A 2RKSA 4ULLA 1IBKL 3VR3A 5J39A 4IFDJ 4ME5A 3X3MA 4EGVA 2DNCA 3CMAA 4HIKA 1K0SA 1EQRA 4X64L 4F88A 2I5HA 1QNKA 1ENCA 4I7AA 4G7ZC 2LXJA 1RD9D 1MSGA 1HHVA 2EXDA 1SE4A 4HTHA 3GTPB 5H1SE 3RLNA 4OX9Q 1Q8KA 4NW2A 2HHHQ 3FRPB 1GVPA 2EQSA 2QKIC 2LY7A 1PZJD 3UDIA 1VQOA 1GD7A 1TS4A 4M1UB 4GOPA 4I65A 3MEHA 2Z6KC 1V1QA 3U58A 1RIPA 3F8TA 1T5EA 5D14A 2R7ZB 5G3LF 2EYJA 3STBC 1WTWA 2E2JH 5E7NA 2K4KA 2L9HA 1XNQQ 1VQNA 2A6ED 2ICIA 1VS0A 2NYZD 5F2DA 4IJLA 3HOZH 1OO9B 1OXSC 1UNSA 5KEEA 3GTKH 3TSSA 4DR7Q 1E0BA 1CKNA 1HRJA 2VQEL 1HPCA 5G3LD 4A3CH 1ZYRC 4TSSA 1GOZA 4LF9Q 1QJOA 4GKJL 3H91A 3RR5A 3RUZA 4X66Q 1M1KC 1D7QA 2PO4A 3MXGA 4HJ5A 2DUDA 4LFCQ 4G7OC 2B2WA 2D5DA 4PQXA 1HNXL 1B8AA 1B9MA 2EIFA 2WIIB 1K73C 4CKBA 4GLAC 2IX3A 5IT9E 4YWMA 2N88A 3M4OB 1IBMQ 1Y8NB 4NP5A 4OHJA 3V2TA 4QL5A 5GAEC 2F0NA 3OMCA 4FXKC 4N9PA 2R7DA 3HKZE 1YHAA 3HEJA 4A93B 4CJ2C 1JT8A 1MJEA 1HFGA 3I4NG 1Q1EA 1PZID 4ZUIA 3HS0C 5I4DA 1IL8A 1VF7A 1G291 1BF4A 2UXCL 5C3XA 1D6EC 3PUVA 3NSWA 4A3BH 1NTGA 1LT5D 4YCUA 4BBSH 1C48A 2K32A 2WFWA 1WTQA 2MJ8A 3FDTA 4K5WA 1CA6A 1NR2A 5IGDA 1PFNA 1A63A 1YIJA 2ZXPA 4JI7Q 2B63G 1KNAA 4JI1Q 4KI0A 3ULPA 5M3MH 1BVSA 1EFWA 4TVAB 4JW0A 4XXEA 2AMCB 5IGEA 4KHZA 3RZOH 1PYSB 4C3HH 2VXWA 4A3GB 1DM0B 4DV4Q 2E75C 2JP1A 4JI4L 1HUNA 3TREA 3J7A5 1EWCA 5C0XJ 5EKKA 3KK7A 3VR5A 1LTGD 4C3JB 1X65A 4A3BG 1SNCA 2PQAA 1IYUA 1J5EL 4LF7L 1SXTA 3OOCA 4K6LA 4B3ML 2FXQA 2Z4IA 4GLXA 4IO9A 1CKOA 1VF5C 2EVBA 1N32L 4QIWE 2WB1E 5LHY1 3MXNB 3K57A 1YEZA 2F0MA 1HFNA 5FO9B 2YU9B 5C44B 2X6LA 4WFN3 2A19A 3ITPA 3LNNA 4BY7H 2F1MA 3OSOA 4CDEC 1XTDA 1PH2A 1FNVA 3NTIA 1QCBD 1KHIA 3F2CA 3OWFA 4RGOS 1FJGL 4TQUS 1Q8IA 5HURA 1I50B 3HOYG 3MTSA 1AZQA 3VDYA 3S2DH 2BE5D 4PZ8A 1SNPA 4IFDH 1QUQA 3N6RA 1BUVT 2PNRC 1YBYA 2RVLA 3C46A 4GOPC 1CK1A 3K0YA 4GKKQ 4GS3A 1S5FD 4A3DH 2DNEA 4BA1I 1U0LA 4JK1C 1MI2A 3FKIG 1GUGA 2WKCA 4BBRB 1PMRA 4RGMA 4Z9CB 3EN2A 2NB0A 4HCEA 5IP9H 1K28A 3L2PA 3DXJC 1II3A 2ENBA 4NDXA 1LM0A 3FMCA 3AB9A 3DUZA 4RAUC 4S3SA 5C6AA 1PH5A 3C3LA 4OWWB 1VQHA 5JJIA 4LF5L 1JOKA 2XRQD 5LL6S 1STAA 1E24A 3DWAA 5BR8Q 5DM73 5KNCA 5M5WB 1SFOB 5ELFA 1MGSA 4JI5L 2Y0SB 1X3GA 4DV5L 1AEXA 2B39A 1FVIA 3WDNA 2K04A 4A3FH 2B2WC 1HNZL 4KJNA 2R92G 4DV3Q 2F0HA 2XTIA 5JPMC 4IOAA 2K01A 2NVYB 3BVZA 1GUWA 4XIGS 1G51A 4C2MB 3DEOA 1Y8OB 5HGQA 1JWSD 5CV6A 3I3CA 4NXML 3PO3H 1I4RA 2EE1A 1IBLL 4G57A 1JMCA 1SYEA 2AWNA 2XWBB 1Q1BA 5DLQE 1EYGA 2A74C 3GTJH 4KY7A 5K36H 2X6GA 2Q2TA 3Q24A 1BBWA 2ALYB 4GLVB 2H5XA 2RHQB 3SGIA 3J81c 1WD1A 1H95A 4H02A 2KEEA 3LWUA 1TR5A 4ABNA 5IYDG 2D62A 1TWFB 4JG2A 5IYCG 1K8AC 3TDQA 4RWSC 4J15A 1DONA 2L0CA 2NVTH 2A8VA 2E5LL 3I55A 1WTVA 1FYCA 4NKLA 4DF7A 4LW1A 1PTOF 2XGTA 1TS5A 3LX0A 4RG1A 2KECA 2UXDQ 1JCKB 1RKNA 4K8JA 1A3VA 4UDUC 4A3KH 5GADC 4ZAIA 1PRTC 2O5JC 4DV1Q 4FDBA 4KHPL 1XTCD 2PZWA 3CPFA 2SNSA 3E3XA 3I4MB 1PVOA 4XDXA 2WV6D 1J6QA 3OWEB 1N9WA 3K5LA 1JJCB 2WP8J 4G7HC 4CBVA 3QIAA 1PTOD 3D4RA 2IWHA 4LF4L 3MEFA 3OIQA 1SNDA 3HOUG 2QILA 1F77A 2QW7A 5C0XH 5M5YH 5IWAQ 1VQ5A 1WTRA 4TKOB 3G71A 5A35A 1PDQA 2GA4B 1CZGA 3M7NA 3HOWH 3FHWA 1SYGA 4DR6Q 1YHQA 4DR3Q 2E2IH 4DR5L 4MNOA 3VYUA 4ME3A 4JOIA 1X32A 3J80c 2K5DA 2LFNA 3S1RH 1HCZA 5CV8A 3T1YQ 4L5SA 3I4NB 1JE4A 2XRSD 1TWAH 5CV7A 5KYLA 3PIO3 5AJ3Q 1HQMC 2B2VA 4V0BA 4JI2L 1TY0A 3RN5A 2F0UA 3FPPA 5GAGC 4MZ9A 2K75A 5C3EH 4FVMA 3KLRA 2NZ1D 3D31A 2C5CA 2B63B 5FKAC 1I3QH 2NVXB 1I4GA 3PO2G 1CZWA 4XTCS 3HOWG 5IYBG 3CMEA 2WAQG 3K7AB 3D4DA 3Q23A 1FGBD 1IYJB 2JA6G 3HGBA 1YNND 1E2WA 2NUCA 4IJHA 1U4LA 1E22A 5FJ8G 3KBGA 1RJTA 1TQOA 1GHKA 3PCOB 1JWUD 3LWEA 1ICWA 1GKHA 3H09A 1SNOA 2NTSA 2NVQB 5C3EG 2NWGA 2PYKA 4ZYSA 2L4NA 2A6HD 5BN5A 1HA5A 2FMCA 4A3EH 5JJZA 1AFPA 1WCMH 4NXNQ 1EL0A 4DUYL 1EY5A 1PH1A 2KCCA 5K5PA 4YIJA 1A3UA 5C4XG 2JA8G 2OF1A 3CAMA 2JA5G 2K5HA 1SMYD 4QF4A 3CRKC 4V190 4HN7A 1N8RC 3GTQB 2HQEA 2GVAA 3T16A 4B3TL 3T13A 2MO0A 1TIID 1Y14B 3HOYB 4RGTA 3TP5A 3ULLA 1SR3A 2E2HH 4R4OA 3URYA 1HNWQ 3S2HB 3TBIB 4C3JH 3HZXA 2A6EC 4X3SA 2CW0D 2WB1B 3QB3A 4UP9A 1XMOL 1QZHA 2SNMA 3K81C 3W5OA 4DNTB 3QR8A 1LACA 2TSSA 1I94Q 1HA6A 4LFAQ 3FKIB 1SEBD 1YI2A 4JV5Q 4L5QA 2K14A 1F9PA 1CTMA 2RF4A 3CW2C 3VA5A 3U9OA 4K2LA 2ASBA 4OWXB 2JN4A 4GZYC 2NTTA 1BCPD 4EQNA 4A3MH 3S1QH 3I8ZA 1W3SA 3H0GH 1U4MA 2R3ZA 3NEMA 4HCSA 3GTLB 2SDFA 2KA7A 1R9TH 4LFBQ 5CGKA 5LMNL 5ELOA 2HCIA 1Y8PB 4A3IB 4DA2A 3B6YA 1Z6HA 4EVOA 2RHSB 2MHVA 3D3RA 2MP1A 3RD4A 1K8MA 4ZKBB 5ELEA 2R92B 2UUAQ 4KK7A 1TWHB 2A69D 1XX8A 1LT6D 1J8IA 4X62L 1MJCA 2KBNA 1XJVA 2TMPA 1YVCA 1AE2A 3KFUA 3NWTA 2KCNA 4R4QA 4IFDI 3KF6A 2UXBQ 1PH3A 2CH4W 3A8IE 1B1ZA 1X3PA 2Y0SE 3P75A 2ZXRA 3M85A 1L0WA 2Q8TA 4O2DA 3CQZB 1H9KA 1OXXK 3HOXB 3SVMA 2E2DC 2K5VA 1KTKA 1VQIA 3ERQA 1G2TA 4AH6A 4AYBE 3ONAB 1LUZA 2PNHA 4APVA 2ATWA 4EQ5A 3NTHA 2XVSA 4JI8L 2WKDA 5M5WH 4OX9L 1STYA 3SK6A 4IPDA 3GTMH 1B7YB 4K8IA 5JAVA 1PH9A 5IP7G 2ID0A 2IT1A 2QEXA 3PUWA 1DYQA 3RZDH 4YCVA 5KGUA 3KUPA 3T56B 2BDNA 2E74C 2K33A 5FLMH 4IUQA 4C3IH 2F4VL 1MBYA 1EEFD 1EIGA 4KKUA 1JJGA 3OTOQ 1LTLA 5EPLA 3TP6A 3PF5A 1F2ZA 1TWCH 2VZAA 4A3LG 1VQ8A 3PSIA 3BS1A 4A3JH 4A75A 4DR7L 3UE0A 3DM1A 1VQ4A 1X3QA 4P74A 3CP0A 3R2IA 1H9SA 1I4PA 4FF1A 1KNEA 2ZTDA 1QILA 2Z4HA 3EQLC 2EYFA 1P16A 1EIHA 4X66L 2OQ0A 2VUMB 1GUTA 1SNMA 4LFCL 1BO0A 1CM9A 3EVQA 4BY1H 3NPPA 3HOUB 1V43A 1A8VA 1TWFH 1X55A 2BE5C 2L12A 4MHEA 2N55A 1KAAA 2JA7H 3TS2A 3D6CA 4H44C 4K0KQ 3G4SA 4CHTB 1IBML 2EZVA 2B8GA 4CKEA 1U5KA 1TS2A 2P5ZX 3CU7A 1LTRD 1U4RA 3M4PA 1VCIA 3HOVG 2NN6H 1Y69U 1LT4D 2LXKA 5CV9A 5M9OA 3FPUB 3OIPA 4FF3A 3I4LA 1B3AA 3JAME 1YJ9A 3S1MH 2HD3A 3I2ZA 5FLXL 4KLKA 2MGSA 3CCSA 3NHHA 1MKHA 4QJFA 2RCNA 4FP5D 2IW3A 5DEHA 1LO5D 5IGBA 1ENFA 5M3FH 5EPJA 5IODA 2RSOA 2DJFC 4JI1L 2JA7G 1KAWA 3S15H 1L1OA 3PO2B 3N52A 3SXHA 3S14H 3KDFB 2CFMA 3ZYYX 3KLWA 4KN4C 3AMUA 2JA6B 1JJ2A 1K3RA 5ELBA 2RQXA 5JOBA 1WVLA 5C0XI 4BA2I 3AYHB 4DV4L 3GP7A 3LGJA 1WOCA 4YWLA 3GTGB 1IBKQ 2YV5A 3M3YB 2IPKD 3HOZG 1KD1C 1K9MC 2EJFC 1CQFA 4XT1B 2PZUA 5M5XB 4J8QA 3C2PA 2F0GA 3NUCA 4IQZA 3SR1A 2K5NA 5E1FA 3MC0B 5I6YA 1BDOA 4HR7B 3D8GA 1YITA 2JK8A 4A3CG 1S5DD 2R61A 4DV2L 5EJWA 4R1JA 2CWAA 1LTAD 5C4XB 2JA8B 1E2ZA 1UUPA 2CQAA 4NMZA 4KJOA 4DAVA 2LMCB 2JYOA 4AQYL 3H3VH 2F0LA 2H4OA 2HDLA 3VR6A 3F1ZA 3IL8A 3JC66 1UE6A 2MFIA 4K2KA 4PNYA 1O7YA 2N78A 3I70A 5DAUA 2CQOA 1LTSD 3TRZA 4AIMA 3P1HA 1DZ1A 3BZCA 1UAPA 3CCEA 2NVQH 4DPGA 4EX5A 5EKLA 1NMGA 1E1OA 1EU3A 2EJGC 4DN4M 3GTOB 2CKZB 1U9RA 4IPCA 4R8NA 1XMQQ 1M4VA 1K0RA 4ZUJA 1Y1WH 1STHA 4JBWA 2VQEQ 1PTOB 1S72A 2EOTA 4G4KA 3IRBA 3J7YW 4BBSG 3K80C 4GKJQ 2YYZA 3OMGA 2L11A 4PMCA 2CHBD 1XWEA 1PTOC 1EY0A 1EYCA 3CRLC 2UUCL 1EUJA 2EPBA 2XNAC 2MO1A 3C1FA 5M3MG 4JI0L 2Q8RE 5BR8L 2KQ3A 4B3RL 4RMFA 1B53A 1K83H 2UU9L 1HTPA 2K5WA 4GN3B 1OXVA 2PQEA 1ET6A 4C3HG 1PLFA 4GNXA 3KYHC 2HQLA 1N34Q 1M90C 1D5XC 1OXTA 1H9RA 2AWOA 1TT2A 2B8FA 2N3SA 1M8AA 4OL7A 3CHBD 4GOPB 3NELA 2ZM6L 3UDFA 2UXCQ 3MZ5A 3NBHA 2KENA 1MHWC 5T1GA 1D1IA 2CVRA 3CPWA 2R93B 1EYAA 3DMUA 4P75A 2QA4A 3H15A 1HZCA 5LMUQ 4F8MA 1I5FA 2HUGA 1EY4A 2XN9C 5E4WC 3DEPA 3GTLH 4LUZA 1C0AA 4H7BA 1EOVA 4IURA 1AW7A 4MIUA 4KY6A 1S4ZA 5EAYA 4BY7G 2OQKA 1DOMA 1CKNB 1WJJA 2QDBA 4A3IH 3I72A 1S40A 1NSNS 3F2UA 4X3TA 3D0FA 1YNNC 3MXPA 3EA6A 4RKLA 1L1OC 1Z9FA 2RSNA 4B9WA 4IFDG 4R4TA 5IGCA 4L8JA 1J5EQ 4LF7Q 5BN4A 5IT9c 4A3DG 5L37A 1QVGA 4P73A 1AN8A 1JC7A 3I90A 2A6HC 4B3MQ 5EPKA 4Y7NB 4AYBB 1Y1VB 4FXGC 2V1CC 3S17B 4K6DA 5EQ0A 4YY3Q 2UXDL 4RFBA 1N32Q 1V8QA 1H9MA 3HOXH 1SDFA 4OIJA 1HR0Q 5IP9G 1N33Q 3S1NB 3O13A 1BKBA 4B08A 3AU7A 1SROA 5EKIA 1PFMA 1SMYC 3TP7A 1FJGQ 2JJQA 2LKVA 4IALA 5C4JB 2KCMA 1TU2B 1O7ZA 2RDFA 3QOLA 1R4PB 4A3FG 2Z8LA 2CW0C 4J6HA 2OXPA 4CJ0B 2D2CC 1LTBD 1DXMA 4DR3L 5JEAJ 4UPAA 5FLXE 1X56A 1Q46A 1VQMA 1EWIA 3TEHB 4JC0A 1XNRL 2VL6A 3T1YL 4UAIA 3QOJA 1YNJD 3RNUA 2RDHA 3UI2A 4ALPA 4X65Q 4OEMB 4LUOA 1ESRA 1SE8A 5AJ3L 4H0LC 1BCPC 1PRTB 3PO3G 4CJ1B 2PQAB 3A8JE 1EFID 1MD2D 1XPRA 1GM5A 1EIFA 3Q8DA 3A5ZB 2F0JA 4C1NK 3D4WA 4XQJA 4DR4Q 3R2TA 1UEAB 3QO2A 3ULJA 3H6MA 2PMZE 5K36G 2ZJPA 1LYLA 4O0AA 2Q2UA 3U4ZA 2F4IA 1CI3M 3GTPH 2NZOA 3E6ZX 2LSSA 3BZDB 4DKAC 4DXGA 2J0TD 5I2XA 4DU9A 4DV0Q 3HP3A 4U68A 2VQFL 4OO1H 3AQQA 1S5CD 4DK0A 1Q7YC 1PH6A 1NE3A 2AQ2B 2A69C 3EROA 1X3EA 3KLSA 2GN5A 3MA2B 4POFA 2PI2A 5CV4A 1IYVA 2B2UA 4Y52H 5JJLA 2R7FA 1U4PA 1V1PA 1X6OA 3A74A 2JEAI 2R7ZH 4QMGA 2DY8A 5ELNA 4KN7C 4DR1L 2FFKB 2QGQA 3PIOA 4GNXC 2QEJC 4NXMQ 2IJ0A 3HOZB 1C9OA 1Z47A 1QUQB 4F7XA 4DR2Q 4B3SL 2ZTEA 1D5MC 4CDCC 3DWPA 3GTKB 3E9IA 4A3KG 1JB7A 2WAQE 2JSOA 4WJWA 3TP8A 4DAYA 3OYYA 2D0PA 2V4DA 2AQ3B 4IUUA 1LTTD 5HY6A 5C4HA 4OIKA 3DWQA 1LABA 4N8X1 4OO1G 1SJHD 1VQGA 1SYCA 4CDDC 1VDZA 1Z7TA 4CDFC 3CC7A 4WORA 5C0XG 1B2TA 3CCJA 1A6XA 1JOQA 3DLLA 1O78A 2F0SA 4LF6Q 2EDGA 3G48A 3NTKA 1JB3A 5I2YA 1VMPA 1I4XA 1Q81C 3JAML 3GTGH 3GD7A 3PGZA 3M4OH 4YWKA 3ERSX 1WTPA 2UUBQ 2K52A 1PYBA 4MN3A 3IFDA 4LFAL 2O4XA 2AKWB 4A93H 3MXUA 2A68D 1JORA 1DOLA 4JV5L 2L5TA 2ZJQA 5ISRA 4A3BB 1DJRD 3T4AC 1W6KA 3FVQA 3E9HA 1QB5D 1EZ8A 3BZKA 1TXYA 4N9TA 5TSSA 4LF4Q 5I6WA 3BDCA 4K5XA 3U50C 1C7YA 1NMFA 4BXXH 3MVVA 5LMNW 1EY8A 1YZ6A 1EQVA 1KIXA 3NK9A 3KF8A 1A2TA 1Q3LA 1GHJA 4LFBL 1FD7D 3VR4A 1SRUA 4XT3B 3HRZC 5GROA 1YJWA 5JVG3 1WTXA 1NJIC 3RZOB 2YTVA 2PW5A 4MTKA 1BOSA 5C5MA 3QWNA 4X3UA 2CWPA 4C3HB 3MAQA 1RHPA 2EYPA 1NAPA 1QVFA 1IW7D 5FLXc 2UUAL 2F0EA 4A93G 2JA9A 3NP8A 1GUSA 3GTOH 4XQNA 1L0YB 4Q0FA 4A3GH 2B3GA 2N49A 4KD3A 2A5HA 3MWYW 3EIVA 2Q2IA 2VW9A 1W2BA 3SEBA 4IPGA 2G9HD 1QG7A 1X3FA 1X54A 1WI5A 1GUOA 3OW7A 4JI2Q 3PIP3 1BCPF 1NY4A 4A3EG 1O7IA 3A54A 1WCMG 4NB3A 4R8IA 2K03A 3ND9A 4LUVA 1NBWA 1D2BA 2Z6KA 3PUXA 1K8OA 3P7JA 2C35B 4DAMA 3S16B 2ES2A 1ASYA 2YU9H 5C44H 3SK5A 3UDXA 4JI6Q 2FJ2A 2HDMA 2BH2A 3AFPA 5JEAH 1PHJA 1F9SA 4EQPA 1CSQA 1DGSA 2G9DA 5CBAE 2YTYA 4O42A 1QZGA 2CCZA 1I50H 3S2DB 1N36Q 4ZKCB 4C3JG 4N8FA 4DNRB 2JQOA 4RA8A 4C1NI 1TKWB 2BA0A 4A3DB 2VNUD 1IZ6A 1JOOA 3QJYA 3IAYA 2I5MX 2NZHA 2QCPX 2B2UC 1VQEA 3PMFA 4HSPA 3TZDA 3H94A 4BBRH 4JI3Q 1QVCA 1FGUA 1T9HA 2EY2A 2OCEA 3W1BA 2NBFA 1I6VC 2Z9HA 4HJAA 4A3MG 3K7UC 3QG1A 4IUVA 4JOIC 1SNQA 1K8GA 3H0GG 2K50A 1ICFB 1C8CA 5IGFA 1AH9A 1KDCA 5C5LA 2BDOA 1KDAA 2HCCA 4QCLA 4BS9A 2B2VC 3A5UA 1AP0A 3M9BA 2HHHL 1SFOH 4A3FB 2E8GA 4OGQC 2D0OA 1XMOQ 1J9OA 1PFBA 5FK9C 2F0DA 4LK1C 4HEDA 5IY0A 4JVZA 1VQ7A 2NVYH 1ENAA 1B3QA 1E3PA 4C2MH 1EY7A 3SE0A 4FO2A 3NE5B 3S1NH 1XNQL 1G6ZA 1HZAA 3PO3B 3V05A 4FF4A 4JYAQ 2EY5A 1MIUA 3ZJYC 4DV6Q 3T1HQ 4YCWA 4JCVE 2KHSA 2MNAA 1BR9A 2I07B 1QNUA 3K8AA 3R93A 1WYDA 4HJ7A 4QY7A 2F0TA 3SDZA 1G8ZD 5C4JH 2PPBC 2FINB 2GVBA 4LF8Q 2AQ1B 4H13C 4LF9L 3E0JA 1CFMA 3EBEA 3BVMA 3BDLA 2ZXOA 5CR3A 2K1BA 1SN8A 5FLMG 2LS01 2XIWA 4C3IG 3TQYA 3T51B 2NVTB 4RCOA 3HG9A 4ID6A 3K59A 4DXFA 4ZRZA 1BBUA 3OHXC 4M8AA 3Q22A 2PMZB 3G7LA 3MXNA 4A3JG 2FHTA 1S3OA 4A3KB 1YJNA 2HIXA 1QOHA 3OW2A 1HZ9A 3TN2A 4QGUA 1V9PA 3A8KE 3AFQA 3UDGA 4RGNA 4JI8Q 3WOFA 1D5ZC 3I4MH 2L1BA 4LJZC 4RCNA 1I6HB 5EBDA 5CBEE 1RL2A 3A56A 1D8LA 1SJED 4BY1G 5EBCA 2IY5B 4ILWA 1UE7A 1D1KA 2IHFA 2RA4A 5M5YB 4JI7L 2A1AA 2VB2X 2XSCA 4OXPA 2F4VQ 1O80A 4L6TB 4YHHQ 4LNQA 1VQJA 3OPOA 3HOWB 2JEBI 4DV7Q 2WAQB 3KJPA 1ILPA 2KHJA 2E2IB 3I91A 4ZQ3A 5IIFA 4OO1I 3CCVA 4EQOA 3S1RB 2M9VA 2NN6G 4ZCKA 3W1GA 2A73B 1XMQL 1I4HA 1HTLD 2Q2HA 4XYQA 3Q6SA 4DUZQ 1TWAB 3W3AA 4DAPA 3I4NH 5JJKA 3I4MG 1FNUA 2R6GA 5KRUA 3CCMA 2VB3X 1KL9A 1CT1D 5DNFA 1JE5A 4MTNA 1FR3A 5C3EB 1XYIA 4X64Q 2EJMA 3U4VA 3KF6B 5M3FG 1EOTA 3RLFA 2DGYA 4IPHA 1GJXA 1KRTA 3BYTB 3KBXA 1SYBA 2F0QA 4FXDA 1I3QB 3GV3A 4ZK9B 3E0EA 2B63H 1E2VA 1EY9A 2KUMA 1C4QA 4E6IA 5A2QL 2NVXH 3PUZA 1F9RA 3K7AH 1STNA 3D6WA 4L5RC 2K5QA 2JA5B 2PZTA 3W2DA 1PYWD 1N34L 1OTCA 1VQ6A 1VQPA 3M4QA 1AE3A 1YNJC 3RLOA 2EY1A 1HR0W 1UE5A 2F0FA 3L7ZC 1EU4A 4P2CB 1W6JA 1G91A 4A3EB 1VQCA 3CCQA 5LMUL 1WCMB 4GKKL 1ZKOA 1NUCA 3PQIA 1B44D 2YTXA 2KEDA 4K14A 5AFWA 1BBXC 3CCRA 2IL8A 1P8LA 3A7LA 3HKZG 3J81E 1CHPD 2DN8A 4BWGB 1SLJA 1E1TA 1H9SB 1EQTA 3NBIA 2Q8IB 1EYDA 1VMCA 4O1NA 1PFSA 1HNXQ 1F2YA 3GTQH 5C3WA 3SHLA 1A2UA 1A62A 4PV1C 2E2HB 3HOYH 4DK6C 3R3OA 1LT3D 4PMBA 1EZ6A 3S2HH 4QUFA 1JICA
chains in the Genus database with same CATH topology
2BCOA 4HSVA 5EGTA 1HXYD 2O2LD 1DOKA 5KIXA 1ML0D 3VR2A 5IOCA 3K58A 3VYRA 4A3MB 3S1QB 4Q5VA 5E3FA 2ICEC 3H0GB 3KLSX 2SEBD 5NUCA 1R9TB 5CMDA 4X3KA 1Q12A 1KLUD 1OXUA 2F3VA 1TWGB 2B2YA 1EY6A 4CKCA 2AUKA 3J80E 2RDGA 1IKLA 1BXTA 1JQYD 3I73A 2A68C 1STGA 3J7AV 3P20A 3EJIA 1JR0D 1ONLA 4U673 1SE2A 2KJXA 3K5OA 3PV0A 3GO5A 1PXUA 3EFXD 4XQQA 3K5NA 2K7VA 2C9OA 3T53B 3GTMB 1ZYRD 1XXGA 1NR4A 1QE6A 2K05A 2K6AA 1IW7C 3RZDB 4FNFA 4ODGA 3J7AF 1JWMD 2FMMA 4C3IB 2I46A 1QWYA 4RH6A 1STBA 3NXWA 1KLGD 3IKJA 4IN3A 2JXMB 5CYUA 1IHZA 1SSOA 1TWCB 3E5SA 4I7ZC 4A3JB 5HGTA 1FNWA 1DCZA 1BCPB 3U9SA 3HOVB 4B9XA 2B2TA 3MFGA 3S9WA 3K6OA 3NWSA 4K5VA 1WD0A 5D65A 1F2MA 1SBBB 2XWJB 3NQIA 2M2LA 4KV6A 5JVH3 4BY1B 3V96A 2K28A 5CORA 2H1EA 5IGGA 4KKSA 4L63B 1EWHA 4HMJA 1NCVA 2JA7B 4IUPA 3ND8A 2AUJD 5ELDA 1PZKD 1BQQT 1LLRD 1Q90A 1SE3A 2J4XA 2EXZA 2JE6I 2SOBA 2E2JB 1STEA 3R8BA 1LV9A 4WRDA 5I9OA 5A2QE 3S1MB 5J22A 1WTOA 5M3FB 5D3DA 3RMHA 1HUMA 1L0XB 1TVXA 2NN6I 3S15B 2Z1CA 3NQTA 3S14B 2F0WA 1I4QA 3TZUA 3X3NA 3IFTA 1LTID 4KKTA 1B9NA 3GV6A 1F9QA 1RTOA 2F0VA 1RTNA 3VYSA 3WOEA 3C1EA 2F3WA 2B2YC 1GUNA 1AZPA 5CV5A 4RHRA 3SK8A 3CKIB 2IX1A 2KVMA 5ELCA 3A55A 4BBSB 1CA5A 3HKZB 2F0IA 2WACA 3DHQA 5KYIA 3G6JB 5DM63 4KD4A 4IUTA 1RF2D 2X69A 5M3MB 1CHQD 5C4ZA 3H3VC 1V1OA 4IZ8A 3MHBA 2F03A 1RCVD 3BDOA 1GXDC 5COYA 2F0KA 1T5XD 1Y1WB 3M7GA 5IT9L 1PTOH 5J1ZA 4DGZA 4CGYB 4RHSA 1ILQA 5JPNC 1SYDA 4R9WA 2B2TC 3BYYB 2IX0A 2PCFB 3PUYA 5T1IA 5LL6X 5KNDA 1K83B 2QF7A 4BY7B 3TMEA 1A3TA 1B50A 2EYHA 1EEID 5FO7B 1R4QB 4IUNA 4QIWB 4FF2A 4KY5A 3A7AB 2OEOA 1ESFA 4XYOA 1PRTF 3VA7A 3J81L 2BA1A 1RDPD 1ZXTA 2L55A 2J7ZA 1V1PB 1MSHA 1S5BD 4KMUC 4QUCA 4HAEA 1ZEQX 1PRTD 2EYLA 2KOLA 4KHVA 3K5MA 3SK4A 2E76C 5KNBA 5JEAG 4RKBA 1SYFA 2O5IC 5E4XA 2RBMA 2PW7A 2EY6A 4LMQD 1F2LA 3BVGA 1G2SA 5FOBB 4J1MA 1SAPA 4FYDA 2M00A 2MUYA 1B4OA 4DK1A 4DFAA 3L9AX 1DD2A 2D9UA 2OT2A 2DY7A 3MFYA 1ET9A 1HQRD 2BOSA 2EYMA 2F0OA 4TRDA 1TS3A 3L3OC 1BNZA 3GQBA 3BG3A 1CQVA 2EYOA 5BN3A 3Q0AA 3VYTA 3J80L 5CC4A 1H9JA 1RODA 4C56C 4F87A 2ZT9C 1O7LA 2F0PA 2MPMA 1S5ED 1TY2A 4ZLTF 3GTJB 4KTAA 3M4YA 1KABA 4LAAA 5D3IB 1IKMA 3FEWX 1KDBA 4QB4A 5I9PA 4PMWA 2WINB 5FO8B 4HMIA 1A15A 2RKSA 4ULLA 3VR3A 5J39A 4IFDJ 4ME5A 3X3MA 4EGVA 2DNCA 4F88A 1QNKA 1ENCA 4G7ZC 1RD9D 1MSGA 1HHVA 1SE4A 4HTHA 3GTPB 4NW2A 3FRPB 2QKIC 2LY7A 1PZJD 1TS4A 4M1UB 4I65A 3MEHA 1T5EA 5D14A 2R7ZB 5G3LF 2EYJA 1WTWA 2L9HA 2A6ED 2ICIA 2NYZD 5F2DA 1OO9B 1OXSC 1UNSA 5KEEA 3TSSA 1E0BA 1HRJA 1HPCA 5G3LD 1ZYRC 4TSSA 1GOZA 1QJOA 3H91A 3RUZA 2PO4A 3MXGA 4G7OC 2B2WA 2D5DA 4PQXA 1B9MA 2WIIB 4CKBA 2IX3A 5IT9E 2N88A 3M4OB 1Y8NB 4NP5A 4OHJA 3V2TA 2F0NA 3OMCA 4FXKC 4N9PA 3HEJA 4A93B 4CJ2C 1HFGA 1Q1EA 1PZID 4ZUIA 3HS0C 5I4DA 1IL8A 1VF7A 1G291 1BF4A 5C3XA 1D6EC 3PUVA 3NSWA 1LT5D 1C48A 2K32A 1WTQA 2MJ8A 3FDTA 4K5WA 1CA6A 1NR2A 5IGDA 1PFNA 2ZXPA 1KNAA 4KI0A 4XXEA 5IGEA 4KHZA 2VXWA 4A3GB 1DM0B 2E75C 2JP1A 1HUNA 1EWCA 5C0XJ 5EKKA 3KK7A 3VR5A 1LTGD 4C3JB 1SNCA 1IYUA 1SXTA 3OOCA 4K6LA 2Z4IA 1VF5C 2EVBA 5LHY1 3K57A 2F0MA 1HFNA 5FO9B 2YU9B 5C44B 2X6LA 4WFN3 3ITPA 3LNNA 2F1MA 3OSOA 1FNVA 3NTIA 1QCBD 3OWFA 4RGOS 4TQUS 1Q8IA 5HURA 1I50B 3MTSA 1AZQA 2BE5D 1SNPA 4IFDH 3N6RA 1BUVT 2PNRC 2RVLA 3C46A 1CK1A 3K0YA 1S5FD 2DNEA 4BA1I 4JK1C 1MI2A 1GUGA 2WKCA 4BBRB 1PMRA 4RGMA 4Z9CB 2NB0A 4HCEA 3DXJC 1II3A 2ENBA 4NDXA 3FMCA 4S3SA 3AB9A 3DUZA 4RAUC 5C6AA 3C3LA 1JOKA 2XRQD 5LL6S 1STAA 3DWAA 5DM73 5KNCA 5M5WB 1SFOB 5ELFA 1MGSA 2Y0SB 1AEXA 2B39A 3WDNA 2K04A 2B2WC 4KJNA 2F0HA 5JPMC 2K01A 2NVYB 3BVZA 1GUWA 4XIGS 4C2MB 3DEOA 1Y8OB 1JWSD 5CV6A 3I3CA 1I4RA 2EE1A 4G57A 1SYEA 2AWNA 2XWBB 1Q1BA 2A74C 4KY7A 5K36H 2X6GA 3Q24A 1WD1A 2KEEA 3LWUA 1TR5A 4ABNA 2D62A 1TWFB 3TDQA 4RWSC 1DONA 2L0CA 1WTVA 1FYCA 4NKLA 4DF7A 1PTOF 1TS5A 3LX0A 2KECA 1JCKB 1RKNA 4K8JA 1A3VA 4UDUC 4ZAIA 1PRTC 2O5JC 1XTCD 2PZWA 3I4MB 2SNSA 4XDXA 2WV6D 3OWEB 3K5LA 2WP8J 4G7HC 4CBVA 3QIAA 1PTOD 3D4RA 2IWHA 3OIQA 1SNDA 2QILA 1F77A 5C0XH 1WTRA 4TKOB 5A35A 1PDQA 2GA4B 1CZGA 3M7NA 1SYGA 3VYUA 1X32A 2K5DA 2LFNA 1HCZA 5CV8A 3I4NB 1JE4A 2XRSD 5CV7A 5KYLA 3PIO3 1HQMC 2B2VA 4V0BA 1TY0A 2F0UA 3FPPA 4FVMA 3KLRA 2NZ1D 3D31A 2C5CA 2B63B 5FKAC 2NVXB 1I4GA 1CZWA 4XTCS 3K7AB 3D4DA 3Q23A 1FGBD 3HGBA 1YNND 1E2WA 2NUCA 1U4LA 3KBGA 1RJTA 1TQOA 1GHKA 1JWUD 3LWEA 1ICWA 3H09A 1SNOA 2NTSA 2NVQB 2NWGA 2PYKA 4ZYSA 2L4NA 2A6HD 5BN5A 1HA5A 2FMCA 1AFPA 5JJZA 1EL0A 1EY5A 2KCCA 5K5PA 4YIJA 1A3UA 2OF1A 1SMYD 4QF4A 3CRKC 4V190 4HN7A 3GTQB 2HQEA 3T16A 3T13A 1TIID 3HOYB 4RGTA 3TP5A 3URYA 3S2HB 3TBIB 3HZXA 2A6EC 4X3SA 2CW0D 2WB1B 3QB3A 2SNMA 4DNTB 1LACA 2TSSA 1HA6A 3FKIB 1SEBD 1F9PA 1CTMA 3VA5A 3U9OA 4K2LA 4GZYC 2NTTA 1BCPD 4EQNA 3I8ZA 1U4MA 2R3ZA 4HCSA 3GTLB 2SDFA 2KA7A 5CGKA 2HCIA 1Y8PB 4A3IB 4DA2A 1Z6HA 4EVOA 2MHVA 3D3RA 2MP1A 3RD4A 1K8MA 4ZKBB 5ELEA 2R92B 4KK7A 1TWHB 2A69D 1XX8A 1LT6D 1J8IA 2TMPA 3NWTA 2KCNA 4IFDI 3A8IE 1B1ZA 1X3PA 3P75A 2ZXRA 3M85A 2Q8TA 3CQZB 1H9KA 1OXXK 3HOXB 3SVMA 2E2DC 1KTKA 3ERQA 1G2TA 3ONAB 3NTHA 2XVSA 2WKDA 1STYA 3SK6A 4K8IA 5JAVA 2ID0A 2IT1A 3PUWA 1DYQA 5KGUA 3KUPA 3T56B 2BDNA 2E74C 2K33A 4IUQA 1MBYA 1EEFD 1EIGA 4KKUA 5EPLA 3TP6A 1F2ZA 3BS1A 3DM1A 1X3QA 3R2IA 1H9SA 1I4PA 4FF1A 1KNEA 1QILA 2Z4HA 3EQLC 2EYFA 1EIHA 2VUMB 1GUTA 1SNMA 1BO0A 1CM9A 3EVQA 3NPPA 3HOUB 1V43A 2BE5C 2L12A 4MHEA 2N55A 1KAAA 3D6CA 4H44C 4CHTB 2EZVA 2B8GA 4CKEA 1TS2A 3CU7A 1LTRD 1U4RA 1VCIA 2NN6H 1Y69U 1LT4D 5CV9A 5M9OA 3FPUB 3OIPA 4FF3A 3I4LA 1B3AA 3JAME 5FLXL 2MGSA 3NHHA 4FP5D 2IW3A 5DEHA 1LO5D 5IGBA 1ENFA 5EPJA 5IODA 2RSOA 3PO2B 3N52A 3SXHA 3ZYYX 4KN4C 3AMUA 2JA6B 5ELBA 2RQXA 5JOBA 1WVLA 5C0XI 4BA2I 3GP7A 3GTGB 3M3YB 2IPKD 2EJFC 1CQFA 4XT1B 2PZUA 5M5XB 4J8QA 3C2PA 2F0GA 3NUCA 4IQZA 3SR1A 5E1FA 3MC0B 5I6YA 1BDOA 4HR7B 3D8GA 1S5DD 2R61A 5EJWA 1LTAD 5C4XB 2JA8B 1E2ZA 1UUPA 2CQAA 4NMZA 4KJOA 4DAVA 2LMCB 2JYOA 2F0LA 2H4OA 2HDLA 3VR6A 3IL8A 4K2KA 4PNYA 1O7YA 3I70A 5DAUA 1LTSD 3P1HA 1DZ1A 1UAPA 5EKLA 1EU3A 2EJGC 4DN4M 3GTOB 4R8NA 1U9RA 1M4VA 4ZUJA 1STHA 4JBWA 1PTOB 2EOTA 4G4KA 3J7YW 2YYZA 3OMGA 2L11A 4PMCA 2CHBD 1XWEA 1PTOC 1EY0A 1EYCA 3CRLC 2EPBA 2XNAC 3C1FA 2Q8RE 2KQ3A 1B53A 1HTPA 2K5WA 1OXVA 2PQEA 1ET6A 4C3HG 1PLFA 1D5XC 1OXTA 1H9RA 2AWOA 1TT2A 2B8FA 1M8AA 4OL7A 3CHBD 3MZ5A 3NBHA 5T1GA 1D1IA 2CVRA 2R93B 1EYAA 3DMUA 4F8MA 2HUGA 1EY4A 2XN9C 5E4WC 3DEPA 4H7BA 4IURA 1AW7A 4MIUA 4KY6A 1S4ZA 1DOMA 2QDBA 3I72A 1NSNS 3F2UA 4X3TA 1YNNC 3MXPA 3EA6A 4RKLA 2RSNA 4B9WA 4IFDG 5IGCA 4L8JA 5BN4A 1AN8A 1JC7A 3I90A 2A6HC 5EPKA 4Y7NB 4AYBB 1Y1VB 4FXGC 3S17B 4K6DA 5EQ0A 4RFBA 1V8QA 1H9MA 1SDFA 4OIJA 3S1NB 3O13A 4B08A 3AU7A 5EKIA 1PFMA 1SMYC 3TP7A 2LKVA 4IALA 5C4JB 1TU2B 1O7ZA 2RDFA 3QOLA 1R4PB 2Z8LA 2CW0C 4J6HA 2OXPA 4CJ0B 2D2CC 1LTBD 1DXMA 5JEAJ 5FLXE 4UAIA 3QOJA 1YNJD 2RDHA 3UI2A 1ESRA 4H0LC 1BCPC 1PRTB 4CJ1B 3A8JE 1EFID 1MD2D 2F0JA 4C1NK 3D4WA 4XQJA 3R2TA 1UEAB 3QO2A 3H6MA 5K36G 2F4IA 1CI3M 3E6ZX 3BZDB 4DXGA 2J0TD 5I2XA 4DU9A 3HP3A 4U68A 4OO1H 1S5CD 4DK0A 2AQ2B 2A69C 3EROA 3KLSA 3MA2B 5CV4A 1IYVA 2B2UA 1U4PA 1V1PA 2JEAI 4QMGA 2DY8A 4KN7C 2FFKB 2QEJC 2IJ0A 3HOZB 1Z47A 4F7XA 1D5MC 3DWPA 3GTKB 2JSOA 4WJWA 3TP8A 4DAYA 2V4DA 2AQ3B 4IUUA 1LTTD 5C4HA 4OIKA 3DWQA 1LABA 4OO1G 1SJHD 1SYCA 1VDZA 1Z7TA 4WORA 5C0XG 1B2TA 1A6XA 1JOQA 1O78A 2F0SA 2EDGA 3NTKA 1JB3A 5I2YA 1VMPA 1I4XA 3JAML 3GD7A 1WTPA 4MN3A 3IFDA 2O4XA 1JORA 3MXUA 2A68D 1DOLA 2L5TA 5ISRA 4A3BB 1DJRD 3T4AC 1W6KA 3FVQA 1QB5D 1EZ8A 5TSSA 4N9TA 5I6WA 3BDCA 4K5XA 3MVVA 1EY8A 1EQVA 3NK9A 3KF8A 1A2TA 1Q3LA 1GHJA 1FD7D 3VR4A 4XT3B 3HRZC 5JVG3 1WTXA 3RZOB 2PW5A 1BOSA 5C5MA 3QWNA 4X3UA 4C3HB 3MAQA 1RHPA 2EYPA 1NAPA 1IW7D 2F0EA 3NP8A 1GUSA 4XQNA 1L0YB 4Q0FA 4KD3A 2A5HA 3MWYW 3SEBA 2G9HD 1QG7A 1GUOA 3OW7A 3PIP3 1BCPF 3A54A 4R8IA 2K03A 3ND9A 1D2BA 3PUXA 1K8OA 3P7JA 3S16B 3SK5A 2FJ2A 2HDMA 5JEAH 1F9SA 4EQPA 2G9DA 5CBAE 4O42A 3S2DB 4ZKCB 4C3JG 4DNRB 4RA8A 4C1NI 1TKWB 2BA0A 4A3DB 2VNUD 1JOOA 3QJYA 3IAYA 2QCPX 2B2UC 3PMFA 4HSPA 3TZDA 3H94A 2EY2A 2NBFA 1I6VC 3QG1A 4IUVA 1SNQA 1C8CA 5IGFA 1KDCA 5C5LA 2BDOA 1KDAA 2HCCA 4QCLA 4BS9A 2B2VC 1AP0A 4A3FB 4OGQC 1J9OA 1PFBA 5FK9C 2F0DA 4LK1C 4HEDA 1ENAA 1EY7A 3SE0A 4FO2A 3NE5B 1G6ZA 3PO3B 3V05A 4FF4A 2EY5A 2KHSA 1BR9A 2I07B 1QNUA 3R93A 2F0TA 3SDZA 1G8ZD 2PPBC 2FINB 2AQ1B 4H13C 3E0JA 1CFMA 3BVMA 3BDLA 2ZXOA 5CR3A 2K1BA 2LS01 2XIWA 4C3IG 3T51B 2NVTB 4RCOA 3HG9A 4ID6A 3K59A 4DXFA 4ZRZA 3OHXC 4M8AA 3Q22A 2PMZB 3G7LA 3MXNA 2FHTA 4A3KB 1QOHA 3TN2A 3A8KE 4RGNA 3WOFA 1D5ZC 4LJZC 2L1BA 4RCNA 1I6HB 5EBDA 5CBEE 3A56A 1SJED 5EBCA 4ILWA 1D1KA 2RA4A 5M5YB 2VB2X 2XSCA 1O80A 4L6TB 3OPOA 3HOWB 2JEBI 2WAQB 1ILPA 2E2IB 3I91A 4ZQ3A 5IIFA 4OO1I 4EQOA 3S1RB 2M9VA 2NN6G 2A73B 1I4HA 1HTLD 4XYQA 3Q6SA 1TWAB 3W3AA 4DAPA 1FNUA 2R6GA 5KRUA 2VB3X 1CT1D 5DNFA 1FR3A 5C3EB 1XYIA 2EJMA 1EOTA 3RLFA 1GJXA 3BYTB 3KBXA 1SYBA 2F0QA 4FXDA 1I3QB 3GV3A 4ZK9B 1E2VA 1EY9A 2KUMA 1C4QA 4E6IA 5A2QL 3PUZA 1F9RA 1STNA 3D6WA 2K5QA 2JA5B 2PZTA 3W2DA 1PYWD 1YNJC 2EY1A 2F0FA 3L7ZC 1EU4A 4P2CB 1W6JA 1G91A 4A3EB 1WCMB 1ZKOA 1NUCA 1B44D 2KEDA 4K14A 5AFWA 1BBXC 2IL8A 3A7LA 3J81E 1CHPD 2DN8A 4BWGB 1H9SB 1EQTA 3NBIA 2Q8IB 1EYDA 1VMCA 4O1NA 1F2YA 5C3WA 3SHLA 1A2UA 4PV1C 2E2HB 3R3OA 1LT3D 4PMBA 1EZ6A 4QUFA 1JICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2Z A;  2F0G A;  4HTH A;  3QB3 A;  3H6M A;  1SYG A;  3NUC A;  5E1F A;  4H7B A;  3SR1 A;  1AEX A;  2SNM A;  5EGT A;  2EYL A;  5HGT A;  4KHV A;  4MIU A;  4KY6 A;  5I6Y A;  4ZQ3 A;  3D8G A;  5IIF A;  3SK4 A;  5IGE A;  2PW5 A;  4KJN A;  4B9X A;  4EQO A;  2QDB A;  4RKB A;  5IOC A;  4DU9 A;  5C5M A;  5KIX A;  4K5V A;  5CV8 A;  3S9W A;  2F0H A;  2F0D A;  1SYF A;  2EYP A;  1NSN S;  2F0I A;  2F0E A;  2RBM A;  2PW7 A;  2EY6 A;  2WAC A;  3DHQ A;  3MEH A;  4I65 A;  1F2M A;  3NP8 A;  1ENA A;  5CV7 A;  3U9O A;  4K2L A;  2EYF A;  4NMZ A;  5KYI A;  4KJO A;  3ERO A;  5KRU A;  4KD3 A;  5KYL A;  3MXP A;  5CV4 A;  4RKL A;  5EKK A;  1EY7 A;  4J1M A;  4EQN A;  4KV6 A;  4KD4 A;  5E3F A;  2F0U A;  1SNM A;  2M00 A;  1SNC A;  2F0L A;  4B9W A;  2EYJ A;  3EVQ A;  5CV6 A;  4K2K A;  5IGG A;  4QMG A;  5IGC A;  2EY5 A;  4PNY A;  5NUC A;  4DFA A;  5DAU A;  4G57 A;  2KHS A;  4HMJ A;  5C4Z A;  1SYB A;  5CGK A;  2F0Q A;  1KAA A;  3P1H A;  4IZ8 A;  5F2D A;  3MHB A;  1SYE A;  4F7X A;  3D6C A;  2F3V A;  5KEE A;  1EY9 A;  2F0T A;  4E6I A;  4EVO A;  1EY6 A;  5EKL A;  2EYM A;  2F0O A;  3TP8 A;  4K6D A;  4KY7 A;  2F0M A;  4TRD A;  1STN A;  1U9R A;  2F0K A;  3D4D A;  4R8N A;  3SK5 A;  2PZT A;  3ITP A;  4ZUJ A;  1STH A;  5C4H A;  3OSO A;  5CV9 A;  4EQP A;  2EXZ A;  5M9O A;  2EYO A;  1STG A;  5J1Z A;  2SOB A;  3RUZ A;  3E5S A;  1TR5 A;  2NUC A;  4DGZ A;  3BDL A;  1SYC A;  3OWF A;  2EY1 A;  5CR3 A;  2F0F A;  3OMG A;  4WRD A;  3VA5 A;  5CC4 A;  5I9O A;  3TP7 A;  1TQO A;  4WOR A;  5HUR A;  4PMC A;  1SYD A;  3EJI A;  1JOQ A;  2F0S A;  1EY0 A;  2F0P A;  1EYC A;  4ID6 A;  2LKV A;  3NHH A;  1SNO A;  5J22 A;  1SNP A;  4IAL A;  2PYK A;  3C1F A;  3P75 A;  4KTA A;  5DEH A;  1NUC A;  5IGB A;  4NKL A;  4NP5 A;  4DF7 A;  5IOD A;  2RDF A;  3V2T A;  2KQ3 A;  3NQT A;  3LX0 A;  3QOL A;  3TME A;  1A3T A;  1EY5 A;  3ERQ A;  3TP6 A;  1JOO A;  4J6H A;  4K14 A;  1KAB A;  1RKN A;  2F0N A;  1A3V A;  2OXP A;  2F0W A;  3OMC A;  4K8J A;  4LAA A;  3SXH A;  2EYH A;  4N9P A;  4IUN A;  2PQE A;  3PMF A;  1STY A;  4YIJ A;  3HEJ A;  5K5P A;  3SK6 A;  2O4X A;  2PZW A;  2SNS A;  1A3U A;  2EY2 A;  1JOR A;  4K8I A;  4KY5 A;  5JAV A;  2OEO A;  4ZUI A;  2OF1 A;  3QOJ A;  1TT2 A;  2F0V A;  1KDB A;  4OL7 A;  4QB4 A;  5C3X A;  5I9P A;  5ISR A;  5JOB A;  4HMI A;  1EYD A;  4QF4 A;  4ODG A;  3MZ5 A;  1II3 A;  3C1E A;  1SNQ A;  2ENB A;  4NDX A;  2RKS A;  5KGU A;  2HQE A;  4S3S A;  5C6A A;  3T16 A;  1EZ8 A;  1F2Y A;  2F3W A;  1SND A;  5C3W A;  4N9T A;  3T13 A;  5J39 A;  3SHL A;  1A2U A;  1EYA A;  4K5W A;  4ME5 A;  3DMU A;  5I6W A;  3BDC A;  3TP5 A;  1JOK A;  4K5X A;  5IGD A;  5IGF A;  1STB A;  3NXW A;  1KDC A;  5C5L A;  3MVV A;  1KDA A;  3R3O A;  1EY8 A;  5CV5 A;  1STA A;  4F8M A;  1EQV A;  4PMB A;  1EZ6 A;  1ENC A;  3NK9 A;  2F0J A;  3HZX A;  1IHZ A;  3SK8 A;  3D4W A;  2PZU A;  1A2T A;  1EY4 A; 
#chains in the Genus database with same CATH topology
 2BCO A;  4HSV A;  5EGT A;  4UP8 A;  2OTL A;  4DV3 L;  1PH4 A;  1HXY D;  2O2L D;  1G6P A;  1Y1W G;  1DOK A;  4YY3 L;  5KIX A;  1ML0 D;  1UWV A;  3VR2 A;  5IOC A;  3FKI H;  3K58 A;  3VYR A;  4DV2 Q;  1HR0 L;  3CCL A;  1N33 L;  3S16 H;  2L15 A;  4A3M B;  3S1Q B;  3JAM c;  4Q5V A;  5E3F A;  3CXC A;  2ZJR A;  2ICE C;  3H0G B;  3ER0 A;  3I7F A;  4DNI A;  3KLS X;  2PI2 E;  2SEB D;  4AQY Q;  5NUC A;  1R9T B;  5CMD A;  4X3K A;  1Q12 A;  1Q82 C;  1KLU D;  1OXU A;  2F3V A;  1TWG B;  2B2Y A;  1EY6 A;  4JBM A;  4CKC A;  1L1O B;  2WB1 G;  2AUK A;  3S24 A;  3J80 E;  2RDG A;  1IKL A;  1BXT A;  1JQY D;  2R92 H;  3I73 A;  2A68 C;  1STG A;  1TWH H;  3HFZ B;  4WJ3 M;  4JI4 Q;  3J7A V;  3STB D;  4X65 L;  3P20 A;  3EJI A;  1KXL A;  1JR0 D;  3WWV A;  1ONL A;  4U67 3;  1UEB A;  1B70 B;  1SE2 A;  2UUC Q;  2KJX A;  3K5O A;  3I56 A;  1SMX A;  3PV0 A;  3GO5 A;  4DR4 L;  3CQZ H;  1PXU A;  3EFX D;  4JI0 Q;  4DV1 L;  4XQQ A;  3K5N A;  4B3R Q;  2K7V A;  2C9O A;  4A3I G;  2UU9 Q;  3T53 B;  3GTM B;  1X9N A;  1ZYR D;  1XXG A;  3UE1 A;  1NR4 A;  4DV0 L;  1QE6 A;  2K05 A;  2K6A A;  1IW7 C;  3RZD B;  4FNF A;  4ODG A;  3AEV A;  3J7A F;  1JWM D;  2FMM A;  5IYD H;  4C3I B;  2ZM6 Q;  2I46 A;  5IWA L;  5IYC H;  1QWY A;  4RH6 A;  2MQH A;  1STB A;  3NXW A;  1KLG D;  3IKJ A;  4IN3 A;  3GDE A;  2JXM B;  5CYU A;  1IHZ A;  4DR6 L;  1SSO A;  1TWC B;  3E5S A;  1CKM A;  4DR2 L;  2RCF A;  1A0I A;  4I7Z C;  4A3J B;  5HGT A;  1FNW A;  1DCZ A;  1BCP B;  3HOX G;  3U9S A;  3F2B A;  3HOV B;  4B9X A;  1WFQ A;  2B2T A;  3MFG A;  3S9W A;  3K6O A;  3NWS A;  4K5V A;  4QQB X;  1WD0 A;  5D65 A;  3NQI A;  1F2M A;  1SBB B;  2XWJ B;  3CF5 A;  4A4I A;  3JAM i;  2OTJ A;  2M2L A;  5J3B A;  4KV6 A;  5JVH 3;  4OON A;  2VUM H;  4BY1 B;  3V96 A;  4LF5 Q;  2K28 A;  5COR A;  1YHB A;  2H1E A;  5IGG A;  1ASZ A;  4KKS A;  4LF6 L;  3J81 j;  3HOU H;  1YNX A;  4L63 B;  1EWH A;  4HMJ A;  1NCV A;  2JA7 B;  3L0O A;  4IUP A;  4DV5 Q;  4HIO A;  4JI5 Q;  3CD6 A;  3ND8 A;  1HNZ Q;  2AUJ D;  5ELD A;  1Q86 C;  1PZK D;  2F3I A;  2UUB L;  1KRS A;  1BQQ T;  1LLR D;  1Q90 A;  1SE3 A;  2J4X A;  4GNX B;  1WTH A;  2EXZ A;  2KHI A;  2JE6 I;  2SOB A;  3DM3 A;  3FP9 A;  2E2J B;  1STE A;  3R8B A;  4R4C A;  1LV9 A;  4WRD A;  5I9O A;  5A2Q E;  3NBH B;  3S1M B;  4R4I A;  4LWC A;  2VUM G;  1I6H H;  2HT1 A;  1IBL Q;  1PA6 A;  4WJ4 A;  4NXN L;  5J22 A;  1WTO A;  5M3F B;  5D3D A;  3RMH A;  1HUM A;  1L0X B;  1TVX A;  2NN6 I;  3S15 B;  2Z1C A;  3NQT A;  1UE1 A;  3S14 B;  2F0W A;  1I4Q A;  3TZU A;  3X3N A;  3IFT A;  3PO2 H;  1LTI D;  4KKT A;  5IYB H;  4A76 A;  3TS0 A;  1B9N A;  3GV6 A;  1F9Q A;  1RTO A;  2F0V A;  4OEL B;  1XNR Q;  2VY3 A;  1RTN A;  2JA6 H;  3VYS A;  3WOE A;  3C1E A;  4UP7 A;  2R7Z G;  2F3W A;  2B2Y C;  5FJ8 H;  4GN4 B;  4DK3 C;  1HNW L;  1KQS A;  2E5L Q;  2HIV A;  1GUN A;  1AZP A;  5CV5 A;  5IE8 A;  2G5D A;  3M3Y H;  4RHR A;  3SK8 A;  3CKI B;  1GO3 E;  5M5X H;  2IX1 A;  2KVM A;  1I94 L;  4X6A H;  4HJ8 A;  1EQQ A;  2Z6B A;  1CSP A;  1PH7 A;  4KHP Q;  5ELC A;  3G6E A;  2CH4 A;  3A55 A;  4BBS B;  1CA5 A;  3RN2 A;  4JI6 L;  3HKZ B;  1IL2 A;  2F0I A;  4PG3 A;  2WAC A;  3DHQ A;  5C4X H;  3J81 i;  3HKS A;  2JA8 H;  2VQF Q;  5KYI A;  2JA5 H;  3G6J B;  5DM6 3;  2N8N A;  4KD4 A;  4IUT A;  1RF2 D;  2X69 A;  5M3M B;  1CHQ D;  1N36 L;  1VQA A;  3CC2 A;  5C4Z A;  3J7Z C;  4HIM A;  3H3V C;  1V1O A;  4IZ8 A;  3MHB A;  4DR1 Q;  2F03 A;  1RCV D;  1KC8 C;  1IXR A;  4JPB W;  3BDO A;  1GXD C;  4DR5 Q;  4B3S Q;  3PIP A;  3BU2 A;  5COY A;  3CC4 A;  2F0K A;  1T5X D;  1Y1W B;  3H3V I;  2I5L X;  3M7G A;  3I4O A;  3K0X A;  4JI3 L;  1VQB A;  5IT9 L;  1PTO H;  5J1Z A;  4DGZ A;  1L2F A;  4CGY B;  1HZB A;  4RHS A;  2UXB L;  2B29 A;  4BXX G;  1ILQ A;  4UY8 C;  5JPN C;  1SYD A;  3ICE A;  4R9W A;  1VQL A;  2B2T C;  3BYY B;  2IX0 A;  2PCF B;  3PUY A;  5T1I A;  5LL6 X;  1VQF A;  5KND A;  1K83 B;  2QF7 A;  2F52 A;  4BY7 B;  3TME A;  1A3T A;  1B50 A;  1HH2 P;  2EYH A;  1EEI D;  5FO7 B;  1R4Q B;  4IUN A;  4QIW B;  4FF2 A;  4KY5 A;  3A7A B;  2OEO A;  3J80 i;  4A3G G;  1ESF A;  4XYO A;  1PRT F;  3VA7 A;  3J81 L;  2BA1 A;  1RDP D;  1ZXT A;  3F2D A;  2L55 A;  1VQD A;  2J7Z A;  3OTO L;  1V1P B;  1EIY B;  2R93 H;  1NNX A;  4P71 A;  1MSH A;  2AHO B;  4JYA L;  4DV6 L;  3T1H L;  1S5B D;  4DUY Q;  4KMU C;  3PF4 A;  1HJP A;  4QUC A;  2KCT A;  4HAE A;  1ZEQ X;  1PRT D;  2EYL A;  2KOL A;  4KHV A;  3K5M A;  4JBK A;  5C44 G;  4NPS A;  3KDF A;  3SK4 A;  1K3B C;  2E76 C;  5KNB A;  4DAY B;  5JEA G;  4RKB A;  4LF8 L;  1TWG H;  1SYF A;  2O5I C;  5E4X A;  2RBM A;  2PW7 A;  2EY6 A;  4LMQ D;  2I0Q A;  1F2L A;  3BVG A;  5IP7 H;  1VQ9 A;  4B3T Q;  1G2S A;  5FOB B;  4J1M A;  1SAP A;  4FYD A;  2Z0S A;  2M00 A;  1CUK A;  1FL0 A;  2MUY A;  4P72 A;  1XPU A;  1B4O A;  4DK1 A;  4DFA A;  3L9A X;  4JBJ A;  2D9U A;  4K0K L;  2OT2 A;  2R93 G;  1DD2 A;  2OWO A;  2DY7 A;  3MFY A;  1ET9 A;  1HQR D;  4Y7N H;  2BOS A;  1Y1V H;  2EYM A;  2F0O A;  4BBR G;  4HJ9 A;  4IOC A;  4A3L H;  3S17 H;  4TRD A;  1TS3 A;  3L3O C;  1BNZ A;  4GN5 A;  3GQB A;  3A0J A;  3BG3 A;  2DJG C;  1CQV A;  2IHE A;  2EYO A;  5BN3 A;  4POG A;  3Q0A A;  3VYT A;  3J80 L;  5CC4 A;  2VS1 A;  1H9J A;  1ROD A;  4OWT B;  3NEN A;  3CCU A;  4C56 C;  4F87 A;  2BH8 A;  2ZT9 C;  1O7L A;  2F0P A;  2MPM A;  1VQK A;  1S5E D;  1TY2 A;  4ZLT F;  5LMN Q;  3GTJ B;  4PZ6 A;  4KTA A;  4YHH L;  3M4Y A;  3KF8 B;  2Y0S G;  5GAH C;  4PZ7 A;  4DV7 L;  4UHV A;  1KAB A;  3BJU A;  4LAA A;  2ZTC A;  5D3I B;  2QDL A;  4AYB G;  4HID A;  1Y1V G;  1PH8 A;  3KOJ A;  1XPO A;  1IKM A;  4X62 Q;  3FEW X;  3KJO A;  1KDB A;  4QB4 A;  5I9P A;  4PMW A;  3HOV H;  2WIN B;  5FO8 B;  4DUZ L;  1E7Z A;  4HMI A;  4L5T A;  5GQO A;  1PV4 A;  1A15 A;  2RKS A;  4ULL A;  1IBK L;  3VR3 A;  5J39 A;  4IFD J;  4ME5 A;  3X3M A;  4EGV A;  2DNC A;  3CMA A;  4HIK A;  1K0S A;  1EQR A;  4X64 L;  4F88 A;  2I5H A;  1QNK A;  1ENC A;  4I7A A;  4G7Z C;  2LXJ A;  1RD9 D;  1MSG A;  1HHV A;  2EXD A;  1SE4 A;  4HTH A;  3GTP B;  5H1S E;  3RLN A;  4OX9 Q;  1Q8K A;  4NW2 A;  2HHH Q;  3FRP B;  1GVP A;  2EQS A;  2QKI C;  2LY7 A;  1PZJ D;  3UDI A;  1VQO A;  1GD7 A;  1TS4 A;  4M1U B;  4GOP A;  4I65 A;  3MEH A;  2Z6K C;  1V1Q A;  3U58 A;  1RIP A;  3F8T A;  1T5E A;  5D14 A;  2R7Z B;  5G3L F;  2EYJ A;  3STB C;  1WTW A;  2E2J H;  5E7N A;  2K4K A;  2L9H A;  1XNQ Q;  1VQN A;  2A6E D;  2ICI A;  1VS0 A;  2NYZ D;  5F2D A;  4IJL A;  3HOZ H;  1OO9 B;  1OXS C;  1UNS A;  5KEE A;  3GTK H;  3TSS A;  4DR7 Q;  1E0B A;  1CKN A;  1HRJ A;  2VQE L;  1HPC A;  5G3L D;  4A3C H;  1ZYR C;  4TSS A;  1GOZ A;  4LF9 Q;  1QJO A;  4GKJ L;  3H91 A;  3RR5 A;  3RUZ A;  4X66 Q;  1M1K C;  1D7Q A;  2PO4 A;  3MXG A;  4HJ5 A;  2DUD A;  4LFC Q;  4G7O C;  2B2W A;  2D5D A;  4PQX A;  1HNX L;  1B8A A;  1B9M A;  2EIF A;  2WII B;  1K73 C;  4CKB A;  4GLA C;  2IX3 A;  5IT9 E;  4YWM A;  2N88 A;  3M4O B;  1IBM Q;  1Y8N B;  4NP5 A;  4OHJ A;  3V2T A;  4QL5 A;  5GAE C;  2F0N A;  3OMC A;  4FXK C;  4N9P A;  2R7D A;  3HKZ E;  1YHA A;  3HEJ A;  4A93 B;  4CJ2 C;  1JT8 A;  1MJE A;  1HFG A;  3I4N G;  1Q1E A;  1PZI D;  4ZUI A;  3HS0 C;  5I4D A;  1IL8 A;  1VF7 A;  1G29 1;  1BF4 A;  2UXC L;  5C3X A;  1D6E C;  3PUV A;  3NSW A;  4A3B H;  1NTG A;  1LT5 D;  4YCU A;  4BBS H;  1C48 A;  2K32 A;  2WFW A;  1WTQ A;  2MJ8 A;  3FDT A;  4K5W A;  1CA6 A;  1NR2 A;  5IGD A;  1PFN A;  1A63 A;  1YIJ A;  2ZXP A;  4JI7 Q;  2B63 G;  1KNA A;  4JI1 Q;  4KI0 A;  3ULP A;  5M3M H;  1BVS A;  1EFW A;  4TVA B;  4JW0 A;  4XXE A;  2AMC B;  5IGE A;  4KHZ A;  3RZO H;  1PYS B;  4C3H H;  2VXW A;  4A3G B;  1DM0 B;  4DV4 Q;  2E75 C;  2JP1 A;  4JI4 L;  1HUN A;  3TRE A;  3J7A 5;  1EWC A;  5C0X J;  5EKK A;  3KK7 A;  3VR5 A;  1LTG D;  4C3J B;  1X65 A;  4A3B G;  1SNC A;  2PQA A;  1IYU A;  1J5E L;  4LF7 L;  1SXT A;  3OOC A;  4K6L A;  4B3M L;  2FXQ A;  2Z4I A;  4GLX A;  4IO9 A;  1CKO A;  1VF5 C;  2EVB A;  1N32 L;  4QIW E;  2WB1 E;  5LHY 1;  3MXN B;  3K57 A;  1YEZ A;  2F0M A;  1HFN A;  5FO9 B;  2YU9 B;  5C44 B;  2X6L A;  4WFN 3;  2A19 A;  3ITP A;  3LNN A;  4BY7 H;  2F1M A;  3OSO A;  4CDE C;  1XTD A;  1PH2 A;  1FNV A;  3NTI A;  1QCB D;  1KHI A;  3F2C A;  3OWF A;  4RGO S;  1FJG L;  4TQU S;  1Q8I A;  5HUR A;  1I50 B;  3HOY G;  3MTS A;  1AZQ A;  3VDY A;  3S2D H;  2BE5 D;  4PZ8 A;  1SNP A;  4IFD H;  1QUQ A;  3N6R A;  1BUV T;  2PNR C;  1YBY A;  2RVL A;  3C46 A;  4GOP C;  1CK1 A;  3K0Y A;  4GKK Q;  4GS3 A;  1S5F D;  4A3D H;  2DNE A;  4BA1 I;  1U0L A;  4JK1 C;  1MI2 A;  3FKI G;  1GUG A;  2WKC A;  4BBR B;  1PMR A;  4RGM A;  4Z9C B;  3EN2 A;  2NB0 A;  4HCE A;  5IP9 H;  1K28 A;  3L2P A;  3DXJ C;  1II3 A;  2ENB A;  4NDX A;  1LM0 A;  3FMC A;  3AB9 A;  3DUZ A;  4RAU C;  4S3S A;  5C6A A;  1PH5 A;  3C3L A;  4OWW B;  1VQH A;  5JJI A;  4LF5 L;  1JOK A;  2XRQ D;  5LL6 S;  1STA A;  1E24 A;  3DWA A;  5BR8 Q;  5DM7 3;  5KNC A;  5M5W B;  1SFO B;  5ELF A;  1MGS A;  4JI5 L;  2Y0S B;  1X3G A;  4DV5 L;  1AEX A;  2B39 A;  1FVI A;  3WDN A;  2K04 A;  4A3F H;  2B2W C;  1HNZ L;  4KJN A;  2R92 G;  4DV3 Q;  2F0H A;  2XTI A;  5JPM C;  4IOA A;  2K01 A;  2NVY B;  3BVZ A;  1GUW A;  4XIG S;  1G51 A;  4C2M B;  3DEO A;  1Y8O B;  5HGQ A;  1JWS D;  5CV6 A;  3I3C A;  4NXM L;  3PO3 H;  1I4R A;  2EE1 A;  1IBL L;  4G57 A;  1JMC A;  1SYE A;  2AWN A;  2XWB B;  1Q1B A;  5DLQ E;  1EYG A;  2A74 C;  3GTJ H;  4KY7 A;  5K36 H;  2X6G A;  2Q2T A;  3Q24 A;  1BBW A;  2ALY B;  4GLV B;  2H5X A;  2RHQ B;  3SGI A;  3J81 c;  1WD1 A;  1H95 A;  4H02 A;  2KEE A;  3LWU A;  1TR5 A;  4ABN A;  5IYD G;  2D62 A;  1TWF B;  4JG2 A;  5IYC G;  1K8A C;  3TDQ A;  4RWS C;  4J15 A;  1DON A;  2L0C A;  2NVT H;  2A8V A;  2E5L L;  3I55 A;  1WTV A;  1FYC A;  4NKL A;  4DF7 A;  4LW1 A;  1PTO F;  2XGT A;  1TS5 A;  3LX0 A;  4RG1 A;  2KEC A;  2UXD Q;  1JCK B;  1RKN A;  4K8J A;  1A3V A;  4UDU C;  4A3K H;  5GAD C;  4ZAI A;  1PRT C;  2O5J C;  4DV1 Q;  4FDB A;  4KHP L;  1XTC D;  2PZW A;  3CPF A;  2SNS A;  3E3X A;  3I4M B;  1PVO A;  4XDX A;  2WV6 D;  1J6Q A;  3OWE B;  1N9W A;  3K5L A;  1JJC B;  2WP8 J;  4G7H C;  4CBV A;  3QIA A;  1PTO D;  3D4R A;  2IWH A;  4LF4 L;  3MEF A;  3OIQ A;  1SND A;  3HOU G;  2QIL A;  1F77 A;  2QW7 A;  5C0X H;  5M5Y H;  5IWA Q;  1VQ5 A;  1WTR A;  4TKO B;  3G71 A;  5A35 A;  1PDQ A;  2GA4 B;  1CZG A;  3M7N A;  3HOW H;  3FHW A;  1SYG A;  4DR6 Q;  1YHQ A;  4DR3 Q;  2E2I H;  4DR5 L;  4MNO A;  3VYU A;  4ME3 A;  4JOI A;  1X32 A;  3J80 c;  2K5D A;  2LFN A;  3S1R H;  1HCZ A;  5CV8 A;  3T1Y Q;  4L5S A;  3I4N B;  1JE4 A;  2XRS D;  1TWA H;  5CV7 A;  5KYL A;  3PIO 3;  5AJ3 Q;  1HQM C;  2B2V A;  4V0B A;  4JI2 L;  1TY0 A;  3RN5 A;  2F0U A;  3FPP A;  5GAG C;  4MZ9 A;  2K75 A;  5C3E H;  4FVM A;  3KLR A;  2NZ1 D;  3D31 A;  2C5C A;  2B63 B;  5FKA C;  1I3Q H;  2NVX B;  1I4G A;  3PO2 G;  1CZW A;  4XTC S;  3HOW G;  5IYB G;  3CME A;  2WAQ G;  3K7A B;  3D4D A;  3Q23 A;  1FGB D;  1IYJ B;  2JA6 G;  3HGB A;  1YNN D;  1E2W A;  2NUC A;  4IJH A;  1U4L A;  1E22 A;  5FJ8 G;  3KBG A;  1RJT A;  1TQO A;  1GHK A;  3PCO B;  1JWU D;  3LWE A;  1ICW A;  1GKH A;  3H09 A;  1SNO A;  2NTS A;  2NVQ B;  5C3E G;  2NWG A;  2PYK A;  4ZYS A;  2L4N A;  2A6H D;  5BN5 A;  1HA5 A;  2FMC A;  4A3E H;  5JJZ A;  1AFP A;  1WCM H;  4NXN Q;  1EL0 A;  4DUY L;  1EY5 A;  1PH1 A;  2KCC A;  5K5P A;  4YIJ A;  1A3U A;  5C4X G;  2JA8 G;  2OF1 A;  3CAM A;  2JA5 G;  2K5H A;  1SMY D;  4QF4 A;  3CRK C;  4V19 0;  4HN7 A;  1N8R C;  3GTQ B;  2HQE A;  2GVA A;  3T16 A;  4B3T L;  3T13 A;  2MO0 A;  1TII D;  1Y14 B;  3HOY B;  4RGT A;  3TP5 A;  3ULL A;  1SR3 A;  2E2H H;  4R4O A;  3URY A;  1HNW Q;  3S2H B;  3TBI B;  4C3J H;  3HZX A;  2A6E C;  4X3S A;  2CW0 D;  2WB1 B;  3QB3 A;  4UP9 A;  1XMO L;  1QZH A;  2SNM A;  3K81 C;  3W5O A;  4DNT B;  3QR8 A;  1LAC A;  2TSS A;  1I94 Q;  1HA6 A;  4LFA Q;  3FKI B;  1SEB D;  1YI2 A;  4JV5 Q;  4L5Q A;  2K14 A;  1F9P A;  1CTM A;  2RF4 A;  3CW2 C;  3VA5 A;  3U9O A;  4K2L A;  2ASB A;  4OWX B;  2JN4 A;  4GZY C;  2NTT A;  1BCP D;  4EQN A;  4A3M H;  3S1Q H;  3I8Z A;  1W3S A;  3H0G H;  1U4M A;  2R3Z A;  3NEM A;  4HCS A;  3GTL B;  2SDF A;  2KA7 A;  1R9T H;  4LFB Q;  5CGK A;  5LMN L;  5ELO A;  2HCI A;  1Y8P B;  4A3I B;  4DA2 A;  3B6Y A;  1Z6H A;  4EVO A;  2RHS B;  2MHV A;  3D3R A;  2MP1 A;  3RD4 A;  1K8M A;  4ZKB B;  5ELE A;  2R92 B;  2UUA Q;  4KK7 A;  1TWH B;  2A69 D;  1XX8 A;  1LT6 D;  1J8I A;  4X62 L;  1MJC A;  2KBN A;  1XJV A;  2TMP A;  1YVC A;  1AE2 A;  3KFU A;  3NWT A;  2KCN A;  4R4Q A;  4IFD I;  3KF6 A;  2UXB Q;  1PH3 A;  2CH4 W;  3A8I E;  1B1Z A;  1X3P A;  2Y0S E;  3P75 A;  2ZXR A;  3M85 A;  1L0W A;  2Q8T A;  4O2D A;  3CQZ B;  1H9K A;  1OXX K;  3HOX B;  3SVM A;  2E2D C;  2K5V A;  1KTK A;  1VQI A;  3ERQ A;  1G2T A;  4AH6 A;  4AYB E;  3ONA B;  1LUZ A;  2PNH A;  4APV A;  2ATW A;  4EQ5 A;  3NTH A;  2XVS A;  4JI8 L;  2WKD A;  5M5W H;  4OX9 L;  1STY A;  3SK6 A;  4IPD A;  3GTM H;  1B7Y B;  4K8I A;  5JAV A;  1PH9 A;  5IP7 G;  2ID0 A;  2IT1 A;  2QEX A;  3PUW A;  1DYQ A;  3RZD H;  4YCV A;  5KGU A;  3KUP A;  3T56 B;  2BDN A;  2E74 C;  2K33 A;  5FLM H;  4IUQ A;  4C3I H;  2F4V L;  1MBY A;  1EEF D;  1EIG A;  4KKU A;  1JJG A;  3OTO Q;  1LTL A;  5EPL A;  3TP6 A;  3PF5 A;  1F2Z A;  1TWC H;  2VZA A;  4A3L G;  1VQ8 A;  3PSI A;  3BS1 A;  4A3J H;  4A75 A;  4DR7 L;  3UE0 A;  3DM1 A;  1VQ4 A;  1X3Q A;  4P74 A;  3CP0 A;  3R2I A;  1H9S A;  1I4P A;  4FF1 A;  1KNE A;  2ZTD A;  1QIL A;  2Z4H A;  3EQL C;  2EYF A;  1P16 A;  1EIH A;  4X66 L;  2OQ0 A;  2VUM B;  1GUT A;  1SNM A;  4LFC L;  1BO0 A;  1CM9 A;  3EVQ A;  4BY1 H;  3NPP A;  3HOU B;  1V43 A;  1A8V A;  1TWF H;  1X55 A;  2BE5 C;  2L12 A;  4MHE A;  2N55 A;  1KAA A;  2JA7 H;  3TS2 A;  3D6C A;  4H44 C;  4K0K Q;  3G4S A;  4CHT B;  1IBM L;  2EZV A;  2B8G A;  4CKE A;  1U5K A;  1TS2 A;  2P5Z X;  3CU7 A;  1LTR D;  1U4R A;  3M4P A;  1VCI A;  3HOV G;  2NN6 H;  1Y69 U;  1LT4 D;  2LXK A;  5CV9 A;  5M9O A;  3FPU B;  3OIP A;  4FF3 A;  3I4L A;  1B3A A;  3JAM E;  1YJ9 A;  3S1M H;  2HD3 A;  3I2Z A;  5FLX L;  4KLK A;  2MGS A;  3CCS A;  3NHH A;  1MKH A;  4QJF A;  2RCN A;  4FP5 D;  2IW3 A;  5DEH A;  1LO5 D;  5IGB A;  1ENF A;  5M3F H;  5EPJ A;  5IOD A;  2RSO A;  2DJF C;  4JI1 L;  2JA7 G;  1KAW A;  3S15 H;  1L1O A;  3PO2 B;  3N52 A;  3SXH A;  3S14 H;  3KDF B;  2CFM A;  3ZYY X;  3KLW A;  4KN4 C;  3AMU A;  2JA6 B;  1JJ2 A;  1K3R A;  5ELB A;  2RQX A;  5JOB A;  1WVL A;  5C0X I;  4BA2 I;  3AYH B;  4DV4 L;  3GP7 A;  3LGJ A;  1WOC A;  4YWL A;  3GTG B;  1IBK Q;  2YV5 A;  3M3Y B;  2IPK D;  3HOZ G;  1KD1 C;  1K9M C;  2EJF C;  1CQF A;  4XT1 B;  2PZU A;  5M5X B;  4J8Q A;  3C2P A;  2F0G A;  3NUC A;  4IQZ A;  3SR1 A;  2K5N A;  5E1F A;  3MC0 B;  5I6Y A;  1BDO A;  4HR7 B;  3D8G A;  1YIT A;  2JK8 A;  4A3C G;  1S5D D;  2R61 A;  4DV2 L;  5EJW A;  4R1J A;  2CWA A;  1LTA D;  5C4X B;  2JA8 B;  1E2Z A;  1UUP A;  2CQA A;  4NMZ A;  4KJO A;  4DAV A;  2LMC B;  2JYO A;  4AQY L;  3H3V H;  2F0L A;  2H4O A;  2HDL A;  3VR6 A;  3F1Z A;  3IL8 A;  3JC6 6;  1UE6 A;  2MFI A;  4K2K A;  4PNY A;  1O7Y A;  2N78 A;  3I70 A;  5DAU A;  2CQO A;  1LTS D;  3TRZ A;  4AIM A;  3P1H A;  1DZ1 A;  3BZC A;  1UAP A;  3CCE A;  2NVQ H;  4DPG A;  4EX5 A;  5EKL A;  1NMG A;  1E1O A;  1EU3 A;  2EJG C;  4DN4 M;  3GTO B;  2CKZ B;  1U9R A;  4IPC A;  4R8N A;  1XMQ Q;  1M4V A;  1K0R A;  4ZUJ A;  1Y1W H;  1STH A;  4JBW A;  2VQE Q;  1PTO B;  1S72 A;  2EOT A;  4G4K A;  3IRB A;  3J7Y W;  4BBS G;  3K80 C;  4GKJ Q;  2YYZ A;  3OMG A;  2L11 A;  4PMC A;  2CHB D;  1XWE A;  1PTO C;  1EY0 A;  1EYC A;  3CRL C;  2UUC L;  1EUJ A;  2EPB A;  2XNA C;  2MO1 A;  3C1F A;  5M3M G;  4JI0 L;  2Q8R E;  5BR8 L;  2KQ3 A;  4B3R L;  4RMF A;  1B53 A;  1K83 H;  2UU9 L;  1HTP A;  2K5W A;  4GN3 B;  1OXV A;  2PQE A;  1ET6 A;  4C3H G;  1PLF A;  4GNX A;  3KYH C;  2HQL A;  1N34 Q;  1M90 C;  1D5X C;  1OXT A;  1H9R A;  2AWO A;  1TT2 A;  2B8F A;  2N3S A;  1M8A A;  4OL7 A;  3CHB D;  4GOP B;  3NEL A;  2ZM6 L;  3UDF A;  2UXC Q;  3MZ5 A;  3NBH A;  2KEN A;  1MHW C;  5T1G A;  1D1I A;  2CVR A;  3CPW A;  2R93 B;  1EYA A;  3DMU A;  4P75 A;  2QA4 A;  3H15 A;  1HZC A;  5LMU Q;  4F8M A;  1I5F A;  2HUG A;  1EY4 A;  2XN9 C;  5E4W C;  3DEP A;  3GTL H;  4LUZ A;  1C0A A;  4H7B A;  1EOV A;  4IUR A;  1AW7 A;  4MIU A;  4KY6 A;  1S4Z A;  5EAY A;  4BY7 G;  2OQK A;  1DOM A;  1CKN B;  1WJJ A;  2QDB A;  4A3I H;  3I72 A;  1S40 A;  1NSN S;  3F2U A;  4X3T A;  3D0F A;  1YNN C;  3MXP A;  3EA6 A;  4RKL A;  1L1O C;  1Z9F A;  2RSN A;  4B9W A;  4IFD G;  4R4T A;  5IGC A;  4L8J A;  1J5E Q;  4LF7 Q;  5BN4 A;  5IT9 c;  4A3D G;  5L37 A;  1QVG A;  4P73 A;  1AN8 A;  1JC7 A;  3I90 A;  2A6H C;  4B3M Q;  5EPK A;  4Y7N B;  4AYB B;  1Y1V B;  4FXG C;  2V1C C;  3S17 B;  4K6D A;  5EQ0 A;  4YY3 Q;  2UXD L;  4RFB A;  1N32 Q;  1V8Q A;  1H9M A;  3HOX H;  1SDF A;  4OIJ A;  1HR0 Q;  5IP9 G;  1N33 Q;  3S1N B;  3O13 A;  1BKB A;  4B08 A;  3AU7 A;  1SRO A;  5EKI A;  1PFM A;  1SMY C;  3TP7 A;  1FJG Q;  2JJQ A;  2LKV A;  4IAL A;  5C4J B;  2KCM A;  1TU2 B;  1O7Z A;  2RDF A;  3QOL A;  1R4P B;  4A3F G;  2Z8L A;  2CW0 C;  4J6H A;  2OXP A;  4CJ0 B;  2D2C C;  1LTB D;  1DXM A;  4DR3 L;  5JEA J;  4UPA A;  5FLX E;  1X56 A;  1Q46 A;  1VQM A;  1EWI A;  3TEH B;  4JC0 A;  1XNR L;  2VL6 A;  3T1Y L;  4UAI A;  3QOJ A;  1YNJ D;  3RNU A;  2RDH A;  3UI2 A;  4ALP A;  4X65 Q;  4OEM B;  4LUO A;  1ESR A;  1SE8 A;  5AJ3 L;  4H0L C;  1BCP C;  1PRT B;  3PO3 G;  4CJ1 B;  2PQA B;  3A8J E;  1EFI D;  1MD2 D;  1XPR A;  1GM5 A;  1EIF A;  3Q8D A;  3A5Z B;  2F0J A;  4C1N K;  3D4W A;  4XQJ A;  4DR4 Q;  3R2T A;  1UEA B;  3QO2 A;  3ULJ A;  3H6M A;  2PMZ E;  5K36 G;  2ZJP A;  1LYL A;  4O0A A;  2Q2U A;  3U4Z A;  2F4I A;  1CI3 M;  3GTP H;  2NZO A;  3E6Z X;  2LSS A;  3BZD B;  4DKA C;  4DXG A;  2J0T D;  5I2X A;  4DU9 A;  4DV0 Q;  3HP3 A;  4U68 A;  2VQF L;  4OO1 H;  3AQQ A;  1S5C D;  4DK0 A;  1Q7Y C;  1PH6 A;  1NE3 A;  2AQ2 B;  2A69 C;  3ERO A;  1X3E A;  3KLS A;  2GN5 A;  3MA2 B;  4POF A;  2PI2 A;  5CV4 A;  1IYV A;  2B2U A;  4Y52 H;  5JJL A;  2R7F A;  1U4P A;  1V1P A;  1X6O A;  3A74 A;  2JEA I;  2R7Z H;  4QMG A;  2DY8 A;  5ELN A;  4KN7 C;  4DR1 L;  2FFK B;  2QGQ A;  3PIO A;  4GNX C;  2QEJ C;  4NXM Q;  2IJ0 A;  3HOZ B;  1C9O A;  1Z47 A;  1QUQ B;  4F7X A;  4DR2 Q;  4B3S L;  2ZTE A;  1D5M C;  4CDC C;  3DWP A;  3GTK B;  3E9I A;  4A3K G;  1JB7 A;  2WAQ E;  2JSO A;  4WJW A;  3TP8 A;  4DAY A;  3OYY A;  2D0P A;  2V4D A;  2AQ3 B;  4IUU A;  1LTT D;  5HY6 A;  5C4H A;  4OIK A;  3DWQ A;  1LAB A;  4N8X 1;  4OO1 G;  1SJH D;  1VQG A;  1SYC A;  4CDD C;  1VDZ A;  1Z7T A;  4CDF C;  3CC7 A;  4WOR A;  5C0X G;  1B2T A;  3CCJ A;  1A6X A;  1JOQ A;  3DLL A;  1O78 A;  2F0S A;  4LF6 Q;  2EDG A;  3G48 A;  3NTK A;  1JB3 A;  5I2Y A;  1VMP A;  1I4X A;  1Q81 C;  3JAM L;  3GTG H;  3GD7 A;  3PGZ A;  3M4O H;  4YWK A;  3ERS X;  1WTP A;  2UUB Q;  2K52 A;  1PYB A;  4MN3 A;  3IFD A;  4LFA L;  2O4X A;  2AKW B;  4A93 H;  3MXU A;  2A68 D;  1JOR A;  1DOL A;  4JV5 L;  2L5T A;  2ZJQ A;  5ISR A;  4A3B B;  1DJR D;  3T4A C;  1W6K A;  3FVQ A;  3E9H A;  1QB5 D;  1EZ8 A;  3BZK A;  1TXY A;  4N9T A;  5TSS A;  4LF4 Q;  5I6W A;  3BDC A;  4K5X A;  3U50 C;  1C7Y A;  1NMF A;  4BXX H;  3MVV A;  5LMN W;  1EY8 A;  1YZ6 A;  1EQV A;  1KIX A;  3NK9 A;  3KF8 A;  1A2T A;  1Q3L A;  1GHJ A;  4LFB L;  1FD7 D;  3VR4 A;  1SRU A;  4XT3 B;  3HRZ C;  5GRO A;  1YJW A;  5JVG 3;  1WTX A;  1NJI C;  3RZO B;  2YTV A;  2PW5 A;  4MTK A;  1BOS A;  5C5M A;  3QWN A;  4X3U A;  2CWP A;  4C3H B;  3MAQ A;  1RHP A;  2EYP A;  1NAP A;  1QVF A;  1IW7 D;  5FLX c;  2UUA L;  2F0E A;  4A93 G;  2JA9 A;  3NP8 A;  1GUS A;  3GTO H;  4XQN A;  1L0Y B;  4Q0F A;  4A3G H;  2B3G A;  2N49 A;  4KD3 A;  2A5H A;  3MWY W;  3EIV A;  2Q2I A;  2VW9 A;  1W2B A;  3SEB A;  4IPG A;  2G9H D;  1QG7 A;  1X3F A;  1X54 A;  1WI5 A;  1GUO A;  3OW7 A;  4JI2 Q;  3PIP 3;  1BCP F;  1NY4 A;  4A3E G;  1O7I A;  3A54 A;  1WCM G;  4NB3 A;  4R8I A;  2K03 A;  3ND9 A;  4LUV A;  1NBW A;  1D2B A;  2Z6K A;  3PUX A;  1K8O A;  3P7J A;  2C35 B;  4DAM A;  3S16 B;  2ES2 A;  1ASY A;  2YU9 H;  5C44 H;  3SK5 A;  3UDX A;  4JI6 Q;  2FJ2 A;  2HDM A;  2BH2 A;  3AFP A;  5JEA H;  1PHJ A;  1F9S A;  4EQP A;  1CSQ A;  1DGS A;  2G9D A;  5CBA E;  2YTY A;  4O42 A;  1QZG A;  2CCZ A;  1I50 H;  3S2D B;  1N36 Q;  4ZKC B;  4C3J G;  4N8F A;  4DNR B;  2JQO A;  4RA8 A;  4C1N I;  1TKW B;  2BA0 A;  4A3D B;  2VNU D;  1IZ6 A;  1JOO A;  3QJY A;  3IAY A;  2I5M X;  2NZH A;  2QCP X;  2B2U C;  1VQE A;  3PMF A;  4HSP A;  3TZD A;  3H94 A;  4BBR H;  4JI3 Q;  1QVC A;  1FGU A;  1T9H A;  2EY2 A;  2OCE A;  3W1B A;  2NBF A;  1I6V C;  2Z9H A;  4HJA A;  4A3M G;  3K7U C;  3QG1 A;  4IUV A;  4JOI C;  1SNQ A;  1K8G A;  3H0G G;  2K50 A;  1ICF B;  1C8C A;  5IGF A;  1AH9 A;  1KDC A;  5C5L A;  2BDO A;  1KDA A;  2HCC A;  4QCL A;  4BS9 A;  2B2V C;  3A5U A;  1AP0 A;  3M9B A;  2HHH L;  1SFO H;  4A3F B;  2E8G A;  4OGQ C;  2D0O A;  1XMO Q;  1J9O A;  1PFB A;  5FK9 C;  2F0D A;  4LK1 C;  4HED A;  5IY0 A;  4JVZ A;  1VQ7 A;  2NVY H;  1ENA A;  1B3Q A;  1E3P A;  4C2M H;  1EY7 A;  3SE0 A;  4FO2 A;  3NE5 B;  3S1N H;  1XNQ L;  1G6Z A;  1HZA A;  3PO3 B;  3V05 A;  4FF4 A;  4JYA Q;  2EY5 A;  1MIU A;  3ZJY C;  4DV6 Q;  3T1H Q;  4YCW A;  4JCV E;  2KHS A;  2MNA A;  1BR9 A;  2I07 B;  1QNU A;  3K8A A;  3R93 A;  1WYD A;  4HJ7 A;  4QY7 A;  2F0T A;  3SDZ A;  1G8Z D;  5C4J H;  2PPB C;  2FIN B;  2GVB A;  4LF8 Q;  2AQ1 B;  4H13 C;  4LF9 L;  3E0J A;  1CFM A;  3EBE A;  3BVM A;  3BDL A;  2ZXO A;  5CR3 A;  2K1B A;  1SN8 A;  5FLM G;  2LS0 1;  2XIW A;  4C3I G;  3TQY A;  3T51 B;  2NVT B;  4RCO A;  3HG9 A;  4ID6 A;  3K59 A;  4DXF A;  4ZRZ A;  1BBU A;  3OHX C;  4M8A A;  3Q22 A;  2PMZ B;  3G7L A;  3MXN A;  4A3J G;  2FHT A;  1S3O A;  4A3K B;  1YJN A;  2HIX A;  1QOH A;  3OW2 A;  1HZ9 A;  3TN2 A;  4QGU A;  1V9P A;  3A8K E;  3AFQ A;  3UDG A;  4RGN A;  4JI8 Q;  3WOF A;  1D5Z C;  3I4M H;  2L1B A;  4LJZ C;  4RCN A;  1I6H B;  5EBD A;  5CBE E;  1RL2 A;  3A56 A;  1D8L A;  1SJE D;  4BY1 G;  5EBC A;  2IY5 B;  4ILW A;  1UE7 A;  1D1K A;  2IHF A;  2RA4 A;  5M5Y B;  4JI7 L;  2A1A A;  2VB2 X;  2XSC A;  4OXP A;  2F4V Q;  1O80 A;  4L6T B;  4YHH Q;  4LNQ A;  1VQJ A;  3OPO A;  3HOW B;  2JEB I;  4DV7 Q;  2WAQ B;  3KJP A;  1ILP A;  2KHJ A;  2E2I B;  3I91 A;  4ZQ3 A;  5IIF A;  4OO1 I;  3CCV A;  4EQO A;  3S1R B;  2M9V A;  2NN6 G;  4ZCK A;  3W1G A;  2A73 B;  1XMQ L;  1I4H A;  1HTL D;  2Q2H A;  4XYQ A;  3Q6S A;  4DUZ Q;  1TWA B;  3W3A A;  4DAP A;  3I4N H;  5JJK A;  3I4M G;  1FNU A;  2R6G A;  5KRU A;  3CCM A;  2VB3 X;  1KL9 A;  1CT1 D;  5DNF A;  1JE5 A;  4MTN A;  1FR3 A;  5C3E B;  1XYI A;  4X64 Q;  2EJM A;  3U4V A;  3KF6 B;  5M3F G;  1EOT A;  3RLF A;  2DGY A;  4IPH A;  1GJX A;  1KRT A;  3BYT B;  3KBX A;  1SYB A;  2F0Q A;  4FXD A;  1I3Q B;  3GV3 A;  4ZK9 B;  3E0E A;  2B63 H;  1E2V A;  1EY9 A;  2KUM A;  1C4Q A;  4E6I A;  5A2Q L;  2NVX H;  3PUZ A;  1F9R A;  3K7A H;  1STN A;  3D6W A;  4L5R C;  2K5Q A;  2JA5 B;  2PZT A;  3W2D A;  1PYW D;  1N34 L;  1OTC A;  1VQ6 A;  1VQP A;  3M4Q A;  1AE3 A;  1YNJ C;  3RLO A;  2EY1 A;  1HR0 W;  1UE5 A;  2F0F A;  3L7Z C;  1EU4 A;  4P2C B;  1W6J A;  1G91 A;  4A3E B;  1VQC A;  3CCQ A;  5LMU L;  1WCM B;  4GKK L;  1ZKO A;  1NUC A;  3PQI A;  1B44 D;  2YTX A;  2KED A;  4K14 A;  5AFW A;  1BBX C;  3CCR A;  2IL8 A;  1P8L A;  3A7L A;  3HKZ G;  3J81 E;  1CHP D;  2DN8 A;  4BWG B;  1SLJ A;  1E1T A;  1H9S B;  1EQT A;  3NBI A;  2Q8I B;  1EYD A;  1VMC A;  4O1N A;  1PFS A;  1HNX Q;  1F2Y A;  3GTQ H;  5C3W A;  3SHL A;  1A2U A;  1A62 A;  4PV1 C;  2E2H B;  3HOY H;  4DK6 C;  3R3O A;  1LT3 D;  4PMB A;  1EZ6 A;  3S2H H;  4QUF A;  1JIC A; 
#chains in the Genus database with same CATH homology
 2BCO A;  4HSV A;  5EGT A;  1HXY D;  2O2L D;  1DOK A;  5KIX A;  1ML0 D;  3VR2 A;  5IOC A;  3K58 A;  3VYR A;  4A3M B;  3S1Q B;  4Q5V A;  5E3F A;  2ICE C;  3H0G B;  3KLS X;  2SEB D;  5NUC A;  1R9T B;  5CMD A;  4X3K A;  1Q12 A;  1KLU D;  1OXU A;  2F3V A;  1TWG B;  2B2Y A;  1EY6 A;  4CKC A;  2AUK A;  3J80 E;  2RDG A;  1IKL A;  1BXT A;  1JQY D;  3I73 A;  2A68 C;  1STG A;  3J7A V;  3P20 A;  3EJI A;  1JR0 D;  1ONL A;  4U67 3;  1SE2 A;  2KJX A;  3K5O A;  3PV0 A;  3GO5 A;  1PXU A;  3EFX D;  4XQQ A;  3K5N A;  2K7V A;  2C9O A;  3T53 B;  3GTM B;  1ZYR D;  1XXG A;  1NR4 A;  1QE6 A;  2K05 A;  2K6A A;  1IW7 C;  3RZD B;  4FNF A;  4ODG A;  3J7A F;  1JWM D;  2FMM A;  4C3I B;  2I46 A;  1QWY A;  4RH6 A;  1STB A;  3NXW A;  1KLG D;  3IKJ A;  4IN3 A;  2JXM B;  5CYU A;  1IHZ A;  1SSO A;  1TWC B;  3E5S A;  4I7Z C;  4A3J B;  5HGT A;  1FNW A;  1DCZ A;  1BCP B;  3U9S A;  3HOV B;  4B9X A;  2B2T A;  3MFG A;  3S9W A;  3K6O A;  3NWS A;  4K5V A;  1WD0 A;  5D65 A;  1F2M A;  1SBB B;  2XWJ B;  3NQI A;  2M2L A;  4KV6 A;  5JVH 3;  4BY1 B;  3V96 A;  2K28 A;  5COR A;  2H1E A;  5IGG A;  4KKS A;  4L63 B;  1EWH A;  4HMJ A;  1NCV A;  2JA7 B;  4IUP A;  3ND8 A;  2AUJ D;  5ELD A;  1PZK D;  1BQQ T;  1LLR D;  1Q90 A;  1SE3 A;  2J4X A;  2EXZ A;  2JE6 I;  2SOB A;  2E2J B;  1STE A;  3R8B A;  1LV9 A;  4WRD A;  5I9O A;  5A2Q E;  3S1M B;  5J22 A;  1WTO A;  5M3F B;  5D3D A;  3RMH A;  1HUM A;  1L0X B;  1TVX A;  2NN6 I;  3S15 B;  2Z1C A;  3NQT A;  3S14 B;  2F0W A;  1I4Q A;  3TZU A;  3X3N A;  3IFT A;  1LTI D;  4KKT A;  1B9N A;  3GV6 A;  1F9Q A;  1RTO A;  2F0V A;  1RTN A;  3VYS A;  3WOE A;  3C1E A;  2F3W A;  2B2Y C;  1GUN A;  1AZP A;  5CV5 A;  4RHR A;  3SK8 A;  3CKI B;  2IX1 A;  2KVM A;  5ELC A;  3A55 A;  4BBS B;  1CA5 A;  3HKZ B;  2F0I A;  2WAC A;  3DHQ A;  5KYI A;  3G6J B;  5DM6 3;  4KD4 A;  4IUT A;  1RF2 D;  2X69 A;  5M3M B;  1CHQ D;  5C4Z A;  3H3V C;  1V1O A;  4IZ8 A;  3MHB A;  2F03 A;  1RCV D;  3BDO A;  1GXD C;  5COY A;  2F0K A;  1T5X D;  1Y1W B;  3M7G A;  5IT9 L;  1PTO H;  5J1Z A;  4DGZ A;  4CGY B;  4RHS A;  1ILQ A;  5JPN C;  1SYD A;  4R9W A;  2B2T C;  3BYY B;  2IX0 A;  2PCF B;  3PUY A;  5T1I A;  5LL6 X;  5KND A;  1K83 B;  2QF7 A;  4BY7 B;  3TME A;  1A3T A;  1B50 A;  2EYH A;  1EEI D;  5FO7 B;  1R4Q B;  4IUN A;  4QIW B;  4FF2 A;  4KY5 A;  3A7A B;  2OEO A;  1ESF A;  4XYO A;  1PRT F;  3VA7 A;  3J81 L;  2BA1 A;  1RDP D;  1ZXT A;  2L55 A;  2J7Z A;  1V1P B;  1MSH A;  1S5B D;  4KMU C;  4QUC A;  4HAE A;  1ZEQ X;  1PRT D;  2EYL A;  2KOL A;  4KHV A;  3K5M A;  3SK4 A;  2E76 C;  5KNB A;  5JEA G;  4RKB A;  1SYF A;  2O5I C;  5E4X A;  2RBM A;  2PW7 A;  2EY6 A;  4LMQ D;  1F2L A;  3BVG A;  1G2S A;  5FOB B;  4J1M A;  1SAP A;  4FYD A;  2M00 A;  2MUY A;  1B4O A;  4DK1 A;  4DFA A;  3L9A X;  1DD2 A;  2D9U A;  2OT2 A;  2DY7 A;  3MFY A;  1ET9 A;  1HQR D;  2BOS A;  2EYM A;  2F0O A;  4TRD A;  1TS3 A;  3L3O C;  1BNZ A;  3GQB A;  3BG3 A;  1CQV A;  2EYO A;  5BN3 A;  3Q0A A;  3VYT A;  3J80 L;  5CC4 A;  1H9J A;  1ROD A;  4C56 C;  4F87 A;  2ZT9 C;  1O7L A;  2F0P A;  2MPM A;  1S5E D;  1TY2 A;  4ZLT F;  3GTJ B;  4KTA A;  3M4Y A;  1KAB A;  4LAA A;  5D3I B;  1IKM A;  3FEW X;  1KDB A;  4QB4 A;  5I9P A;  4PMW A;  2WIN B;  5FO8 B;  4HMI A;  1A15 A;  2RKS A;  4ULL A;  3VR3 A;  5J39 A;  4IFD J;  4ME5 A;  3X3M A;  4EGV A;  2DNC A;  4F88 A;  1QNK A;  1ENC A;  4G7Z C;  1RD9 D;  1MSG A;  1HHV A;  1SE4 A;  4HTH A;  3GTP B;  4NW2 A;  3FRP B;  2QKI C;  2LY7 A;  1PZJ D;  1TS4 A;  4M1U B;  4I65 A;  3MEH A;  1T5E A;  5D14 A;  2R7Z B;  5G3L F;  2EYJ A;  1WTW A;  2L9H A;  2A6E D;  2ICI A;  2NYZ D;  5F2D A;  1OO9 B;  1OXS C;  1UNS A;  5KEE A;  3TSS A;  1E0B A;  1HRJ A;  1HPC A;  5G3L D;  1ZYR C;  4TSS A;  1GOZ A;  1QJO A;  3H91 A;  3RUZ A;  2PO4 A;  3MXG A;  4G7O C;  2B2W A;  2D5D A;  4PQX A;  1B9M A;  2WII B;  4CKB A;  2IX3 A;  5IT9 E;  2N88 A;  3M4O B;  1Y8N B;  4NP5 A;  4OHJ A;  3V2T A;  2F0N A;  3OMC A;  4FXK C;  4N9P A;  3HEJ A;  4A93 B;  4CJ2 C;  1HFG A;  1Q1E A;  1PZI D;  4ZUI A;  3HS0 C;  5I4D A;  1IL8 A;  1VF7 A;  1G29 1;  1BF4 A;  5C3X A;  1D6E C;  3PUV A;  3NSW A;  1LT5 D;  1C48 A;  2K32 A;  1WTQ A;  2MJ8 A;  3FDT A;  4K5W A;  1CA6 A;  1NR2 A;  5IGD A;  1PFN A;  2ZXP A;  1KNA A;  4KI0 A;  4XXE A;  5IGE A;  4KHZ A;  2VXW A;  4A3G B;  1DM0 B;  2E75 C;  2JP1 A;  1HUN A;  1EWC A;  5C0X J;  5EKK A;  3KK7 A;  3VR5 A;  1LTG D;  4C3J B;  1SNC A;  1IYU A;  1SXT A;  3OOC A;  4K6L A;  2Z4I A;  1VF5 C;  2EVB A;  5LHY 1;  3K57 A;  2F0M A;  1HFN A;  5FO9 B;  2YU9 B;  5C44 B;  2X6L A;  4WFN 3;  3ITP A;  3LNN A;  2F1M A;  3OSO A;  1FNV A;  3NTI A;  1QCB D;  3OWF A;  4RGO S;  4TQU S;  1Q8I A;  5HUR A;  1I50 B;  3MTS A;  1AZQ A;  2BE5 D;  1SNP A;  4IFD H;  3N6R A;  1BUV T;  2PNR C;  2RVL A;  3C46 A;  1CK1 A;  3K0Y A;  1S5F D;  2DNE A;  4BA1 I;  4JK1 C;  1MI2 A;  1GUG A;  2WKC A;  4BBR B;  1PMR A;  4RGM A;  4Z9C B;  2NB0 A;  4HCE A;  3DXJ C;  1II3 A;  2ENB A;  4NDX A;  3FMC A;  4S3S A;  3AB9 A;  3DUZ A;  4RAU C;  5C6A A;  3C3L A;  1JOK A;  2XRQ D;  5LL6 S;  1STA A;  3DWA A;  5DM7 3;  5KNC A;  5M5W B;  1SFO B;  5ELF A;  1MGS A;  2Y0S B;  1AEX A;  2B39 A;  3WDN A;  2K04 A;  2B2W C;  4KJN A;  2F0H A;  5JPM C;  2K01 A;  2NVY B;  3BVZ A;  1GUW A;  4XIG S;  4C2M B;  3DEO A;  1Y8O B;  1JWS D;  5CV6 A;  3I3C A;  1I4R A;  2EE1 A;  4G57 A;  1SYE A;  2AWN A;  2XWB B;  1Q1B A;  2A74 C;  4KY7 A;  5K36 H;  2X6G A;  3Q24 A;  1WD1 A;  2KEE A;  3LWU A;  1TR5 A;  4ABN A;  2D62 A;  1TWF B;  3TDQ A;  4RWS C;  1DON A;  2L0C A;  1WTV A;  1FYC A;  4NKL A;  4DF7 A;  1PTO F;  1TS5 A;  3LX0 A;  2KEC A;  1JCK B;  1RKN A;  4K8J A;  1A3V A;  4UDU C;  4ZAI A;  1PRT C;  2O5J C;  1XTC D;  2PZW A;  3I4M B;  2SNS A;  4XDX A;  2WV6 D;  3OWE B;  3K5L A;  2WP8 J;  4G7H C;  4CBV A;  3QIA A;  1PTO D;  3D4R A;  2IWH A;  3OIQ A;  1SND A;  2QIL A;  1F77 A;  5C0X H;  1WTR A;  4TKO B;  5A35 A;  1PDQ A;  2GA4 B;  1CZG A;  3M7N A;  1SYG A;  3VYU A;  1X32 A;  2K5D A;  2LFN A;  1HCZ A;  5CV8 A;  3I4N B;  1JE4 A;  2XRS D;  5CV7 A;  5KYL A;  3PIO 3;  1HQM C;  2B2V A;  4V0B A;  1TY0 A;  2F0U A;  3FPP A;  4FVM A;  3KLR A;  2NZ1 D;  3D31 A;  2C5C A;  2B63 B;  5FKA C;  2NVX B;  1I4G A;  1CZW A;  4XTC S;  3K7A B;  3D4D A;  3Q23 A;  1FGB D;  3HGB A;  1YNN D;  1E2W A;  2NUC A;  1U4L A;  3KBG A;  1RJT A;  1TQO A;  1GHK A;  1JWU D;  3LWE A;  1ICW A;  3H09 A;  1SNO A;  2NTS A;  2NVQ B;  2NWG A;  2PYK A;  4ZYS A;  2L4N A;  2A6H D;  5BN5 A;  1HA5 A;  2FMC A;  1AFP A;  5JJZ A;  1EL0 A;  1EY5 A;  2KCC A;  5K5P A;  4YIJ A;  1A3U A;  2OF1 A;  1SMY D;  4QF4 A;  3CRK C;  4V19 0;  4HN7 A;  3GTQ B;  2HQE A;  3T16 A;  3T13 A;  1TII D;  3HOY B;  4RGT A;  3TP5 A;  3URY A;  3S2H B;  3TBI B;  3HZX A;  2A6E C;  4X3S A;  2CW0 D;  2WB1 B;  3QB3 A;  2SNM A;  4DNT B;  1LAC A;  2TSS A;  1HA6 A;  3FKI B;  1SEB D;  1F9P A;  1CTM A;  3VA5 A;  3U9O A;  4K2L A;  4GZY C;  2NTT A;  1BCP D;  4EQN A;  3I8Z A;  1U4M A;  2R3Z A;  4HCS A;  3GTL B;  2SDF A;  2KA7 A;  5CGK A;  2HCI A;  1Y8P B;  4A3I B;  4DA2 A;  1Z6H A;  4EVO A;  2MHV A;  3D3R A;  2MP1 A;  3RD4 A;  1K8M A;  4ZKB B;  5ELE A;  2R92 B;  4KK7 A;  1TWH B;  2A69 D;  1XX8 A;  1LT6 D;  1J8I A;  2TMP A;  3NWT A;  2KCN A;  4IFD I;  3A8I E;  1B1Z A;  1X3P A;  3P75 A;  2ZXR A;  3M85 A;  2Q8T A;  3CQZ B;  1H9K A;  1OXX K;  3HOX B;  3SVM A;  2E2D C;  1KTK A;  3ERQ A;  1G2T A;  3ONA B;  3NTH A;  2XVS A;  2WKD A;  1STY A;  3SK6 A;  4K8I A;  5JAV A;  2ID0 A;  2IT1 A;  3PUW A;  1DYQ A;  5KGU A;  3KUP A;  3T56 B;  2BDN A;  2E74 C;  2K33 A;  4IUQ A;  1MBY A;  1EEF D;  1EIG A;  4KKU A;  5EPL A;  3TP6 A;  1F2Z A;  3BS1 A;  3DM1 A;  1X3Q A;  3R2I A;  1H9S A;  1I4P A;  4FF1 A;  1KNE A;  1QIL A;  2Z4H A;  3EQL C;  2EYF A;  1EIH A;  2VUM B;  1GUT A;  1SNM A;  1BO0 A;  1CM9 A;  3EVQ A;  3NPP A;  3HOU B;  1V43 A;  2BE5 C;  2L12 A;  4MHE A;  2N55 A;  1KAA A;  3D6C A;  4H44 C;  4CHT B;  2EZV A;  2B8G A;  4CKE A;  1TS2 A;  3CU7 A;  1LTR D;  1U4R A;  1VCI A;  2NN6 H;  1Y69 U;  1LT4 D;  5CV9 A;  5M9O A;  3FPU B;  3OIP A;  4FF3 A;  3I4L A;  1B3A A;  3JAM E;  5FLX L;  2MGS A;  3NHH A;  4FP5 D;  2IW3 A;  5DEH A;  1LO5 D;  5IGB A;  1ENF A;  5EPJ A;  5IOD A;  2RSO A;  3PO2 B;  3N52 A;  3SXH A;  3ZYY X;  4KN4 C;  3AMU A;  2JA6 B;  5ELB A;  2RQX A;  5JOB A;  1WVL A;  5C0X I;  4BA2 I;  3GP7 A;  3GTG B;  3M3Y B;  2IPK D;  2EJF C;  1CQF A;  4XT1 B;  2PZU A;  5M5X B;  4J8Q A;  3C2P A;  2F0G A;  3NUC A;  4IQZ A;  3SR1 A;  5E1F A;  3MC0 B;  5I6Y A;  1BDO A;  4HR7 B;  3D8G A;  1S5D D;  2R61 A;  5EJW A;  1LTA D;  5C4X B;  2JA8 B;  1E2Z A;  1UUP A;  2CQA A;  4NMZ A;  4KJO A;  4DAV A;  2LMC B;  2JYO A;  2F0L A;  2H4O A;  2HDL A;  3VR6 A;  3IL8 A;  4K2K A;  4PNY A;  1O7Y A;  3I70 A;  5DAU A;  1LTS D;  3P1H A;  1DZ1 A;  1UAP A;  5EKL A;  1EU3 A;  2EJG C;  4DN4 M;  3GTO B;  4R8N A;  1U9R A;  1M4V A;  4ZUJ A;  1STH A;  4JBW A;  1PTO B;  2EOT A;  4G4K A;  3J7Y W;  2YYZ A;  3OMG A;  2L11 A;  4PMC A;  2CHB D;  1XWE A;  1PTO C;  1EY0 A;  1EYC A;  3CRL C;  2EPB A;  2XNA C;  3C1F A;  2Q8R E;  2KQ3 A;  1B53 A;  1HTP A;  2K5W A;  1OXV A;  2PQE A;  1ET6 A;  4C3H G;  1PLF A;  1D5X C;  1OXT A;  1H9R A;  2AWO A;  1TT2 A;  2B8F A;  1M8A A;  4OL7 A;  3CHB D;  3MZ5 A;  3NBH A;  5T1G A;  1D1I A;  2CVR A;  2R93 B;  1EYA A;  3DMU A;  4F8M A;  2HUG A;  1EY4 A;  2XN9 C;  5E4W C;  3DEP A;  4H7B A;  4IUR A;  1AW7 A;  4MIU A;  4KY6 A;  1S4Z A;  1DOM A;  2QDB A;  3I72 A;  1NSN S;  3F2U A;  4X3T A;  1YNN C;  3MXP A;  3EA6 A;  4RKL A;  2RSN A;  4B9W A;  4IFD G;  5IGC A;  4L8J A;  5BN4 A;  1AN8 A;  1JC7 A;  3I90 A;  2A6H C;  5EPK A;  4Y7N B;  4AYB B;  1Y1V B;  4FXG C;  3S17 B;  4K6D A;  5EQ0 A;  4RFB A;  1V8Q A;  1H9M A;  1SDF A;  4OIJ A;  3S1N B;  3O13 A;  4B08 A;  3AU7 A;  5EKI A;  1PFM A;  1SMY C;  3TP7 A;  2LKV A;  4IAL A;  5C4J B;  1TU2 B;  1O7Z A;  2RDF A;  3QOL A;  1R4P B;  2Z8L A;  2CW0 C;  4J6H A;  2OXP A;  4CJ0 B;  2D2C C;  1LTB D;  1DXM A;  5JEA J;  5FLX E;  4UAI A;  3QOJ A;  1YNJ D;  2RDH A;  3UI2 A;  1ESR A;  4H0L C;  1BCP C;  1PRT B;  4CJ1 B;  3A8J E;  1EFI D;  1MD2 D;  2F0J A;  4C1N K;  3D4W A;  4XQJ A;  3R2T A;  1UEA B;  3QO2 A;  3H6M A;  5K36 G;  2F4I A;  1CI3 M;  3E6Z X;  3BZD B;  4DXG A;  2J0T D;  5I2X A;  4DU9 A;  3HP3 A;  4U68 A;  4OO1 H;  1S5C D;  4DK0 A;  2AQ2 B;  2A69 C;  3ERO A;  3KLS A;  3MA2 B;  5CV4 A;  1IYV A;  2B2U A;  1U4P A;  1V1P A;  2JEA I;  4QMG A;  2DY8 A;  4KN7 C;  2FFK B;  2QEJ C;  2IJ0 A;  3HOZ B;  1Z47 A;  4F7X A;  1D5M C;  3DWP A;  3GTK B;  2JSO A;  4WJW A;  3TP8 A;  4DAY A;  2V4D A;  2AQ3 B;  4IUU A;  1LTT D;  5C4H A;  4OIK A;  3DWQ A;  1LAB A;  4OO1 G;  1SJH D;  1SYC A;  1VDZ A;  1Z7T A;  4WOR A;  5C0X G;  1B2T A;  1A6X A;  1JOQ A;  1O78 A;  2F0S A;  2EDG A;  3NTK A;  1JB3 A;  5I2Y A;  1VMP A;  1I4X A;  3JAM L;  3GD7 A;  1WTP A;  4MN3 A;  3IFD A;  2O4X A;  1JOR A;  3MXU A;  2A68 D;  1DOL A;  2L5T A;  5ISR A;  4A3B B;  1DJR D;  3T4A C;  1W6K A;  3FVQ A;  1QB5 D;  1EZ8 A;  5TSS A;  4N9T A;  5I6W A;  3BDC A;  4K5X A;  3MVV A;  1EY8 A;  1EQV A;  3NK9 A;  3KF8 A;  1A2T A;  1Q3L A;  1GHJ A;  1FD7 D;  3VR4 A;  4XT3 B;  3HRZ C;  5JVG 3;  1WTX A;  3RZO B;  2PW5 A;  1BOS A;  5C5M A;  3QWN A;  4X3U A;  4C3H B;  3MAQ A;  1RHP A;  2EYP A;  1NAP A;  1IW7 D;  2F0E A;  3NP8 A;  1GUS A;  4XQN A;  1L0Y B;  4Q0F A;  4KD3 A;  2A5H A;  3MWY W;  3SEB A;  2G9H D;  1QG7 A;  1GUO A;  3OW7 A;  3PIP 3;  1BCP F;  3A54 A;  4R8I A;  2K03 A;  3ND9 A;  1D2B A;  3PUX A;  1K8O A;  3P7J A;  3S16 B;  3SK5 A;  2FJ2 A;  2HDM A;  5JEA H;  1F9S A;  4EQP A;  2G9D A;  5CBA E;  4O42 A;  3S2D B;  4ZKC B;  4C3J G;  4DNR B;  4RA8 A;  4C1N I;  1TKW B;  2BA0 A;  4A3D B;  2VNU D;  1JOO A;  3QJY A;  3IAY A;  2QCP X;  2B2U C;  3PMF A;  4HSP A;  3TZD A;  3H94 A;  2EY2 A;  2NBF A;  1I6V C;  3QG1 A;  4IUV A;  1SNQ A;  1C8C A;  5IGF A;  1KDC A;  5C5L A;  2BDO A;  1KDA A;  2HCC A;  4QCL A;  4BS9 A;  2B2V C;  1AP0 A;  4A3F B;  4OGQ C;  1J9O A;  1PFB A;  5FK9 C;  2F0D A;  4LK1 C;  4HED A;  1ENA A;  1EY7 A;  3SE0 A;  4FO2 A;  3NE5 B;  1G6Z A;  3PO3 B;  3V05 A;  4FF4 A;  2EY5 A;  2KHS A;  1BR9 A;  2I07 B;  1QNU A;  3R93 A;  2F0T A;  3SDZ A;  1G8Z D;  2PPB C;  2FIN B;  2AQ1 B;  4H13 C;  3E0J A;  1CFM A;  3BVM A;  3BDL A;  2ZXO A;  5CR3 A;  2K1B A;  2LS0 1;  2XIW A;  4C3I G;  3T51 B;  2NVT B;  4RCO A;  3HG9 A;  4ID6 A;  3K59 A;  4DXF A;  4ZRZ A;  3OHX C;  4M8A A;  3Q22 A;  2PMZ B;  3G7L A;  3MXN A;  2FHT A;  4A3K B;  1QOH A;  3TN2 A;  3A8K E;  4RGN A;  3WOF A;  1D5Z C;  4LJZ C;  2L1B A;  4RCN A;  1I6H B;  5EBD A;  5CBE E;  3A56 A;  1SJE D;  5EBC A;  4ILW A;  1D1K A;  2RA4 A;  5M5Y B;  2VB2 X;  2XSC A;  1O80 A;  4L6T B;  3OPO A;  3HOW B;  2JEB I;  2WAQ B;  1ILP A;  2E2I B;  3I91 A;  4ZQ3 A;  5IIF A;  4OO1 I;  4EQO A;  3S1R B;  2M9V A;  2NN6 G;  2A73 B;  1I4H A;  1HTL D;  4XYQ A;  3Q6S A;  1TWA B;  3W3A A;  4DAP A;  1FNU A;  2R6G A;  5KRU A;  2VB3 X;  1CT1 D;  5DNF A;  1FR3 A;  5C3E B;  1XYI A;  2EJM A;  1EOT A;  3RLF A;  1GJX A;  3BYT B;  3KBX A;  1SYB A;  2F0Q A;  4FXD A;  1I3Q B;  3GV3 A;  4ZK9 B;  1E2V A;  1EY9 A;  2KUM A;  1C4Q A;  4E6I A;  5A2Q L;  3PUZ A;  1F9R A;  1STN A;  3D6W A;  2K5Q A;  2JA5 B;  2PZT A;  3W2D A;  1PYW D;  1YNJ C;  2EY1 A;  2F0F A;  3L7Z C;  1EU4 A;  4P2C B;  1W6J A;  1G91 A;  4A3E B;  1WCM B;  1ZKO A;  1NUC A;  1B44 D;  2KED A;  4K14 A;  5AFW A;  1BBX C;  2IL8 A;  3A7L A;  3J81 E;  1CHP D;  2DN8 A;  4BWG B;  1H9S B;  1EQT A;  3NBI A;  2Q8I B;  1EYD A;  1VMC A;  4O1N A;  1F2Y A;  5C3W A;  3SHL A;  1A2U A;  4PV1 C;  2E2H B;  3R3O A;  1LT3 D;  4PMB A;  1EZ6 A;  4QUF A;  1JIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...