3SK6A

Crystal structure of staphylococcal nuclease variant delta+nviagla v23k/l36e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTKKLMYKGQPMVFRELLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23K/L36E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk6A00
2EYPA 3SHLA 2EY5A 3NK9A 1STNA 2F0LA 1F2MA 4QMGA 5C5MA 1SYBA 3T13A 3VA5A 1EY0A 3E5SA 3TP7A 5C4HA 4K14A 1RKNA 1EYCA 3TMEA 3MZ5A 5CV7A 2F0FA 2F0EA 2PW5A 1EY6A 4K5WA 4B9WA 4OL7A 5EKLA 1NUCA 2KQ3A 2HQEA 5HGTA 5C3WA 4YIJA 3LX0A 5CC4A 4K2LA 1ENAA 3NQTA 4K2KA 1KDCA 3MVVA 1KDAA 5JOBA 4HMIA 3DHQA 1EY8A 4ME5A 5KRUA 1JOOA 2F0MA 2RKSA 3ERQA 1II3A 4HMJA 4EQPA 3QB3A 2PQEA 2QDBA 4KV6A 2EY1A 5IOCA 5ISRA 1AEXA 1STHA 1JOKA 2F0IA 3OSOA 4QB4A 1EY9A 5C6AA 1EY4A 1TT2A 5EGTA 1TQOA 3MEHA 3P75A 4DU9A 4KTAA 4KD3A 4J1MA 3NXWA 5IGEA 5C3XA 4S3SA 4WORA 5E3FA 1SNOA 3SK4A 1SNDA 3NP8A 5IODA 5K5PA 3EJIA 2EYHA 2PZWA 1STGA 4NMZA 1KDBA 1SYDA 3D6CA 4NKLA 3T16A 4IALA 1EQVA 1SYGA 4IZ8A 4RKLA 1STYA 4K8IA 5CV6A 5CR3A 2EYLA 5C5LA 2F0QA 1JORA 2EYFA 2F3VA 3RUZA 2F0KA 3S9WA 3OMGA 5I6WA 5I6YA 1SNMA 1SYFA 5J39A 4MIUA 4K8JA 1EZ8A 2SNSA 3ITPA 1EYAA 4TRDA 5CV9A 4F8MA 2EXZA 2LKVA 1SYCA 4PNYA 1EYDA 3TP5A 4DGZA 4KJOA 2EYOA 4WRDA 5F2DA 4EQOA 5I9PA 2ENBA 4PMCA 2RDFA 4KD4A 5J1ZA 2F0OA 3EROA 2SOBA 3SK5A 3QOLA 3MHBA 5IGGA 5KGUA 1A2TA 1KAAA 3R3OA 3QOJA 2F0PA 2F0VA 3NUCA 3SR1A 4E6IA 4NP5A 3TP8A 2EYJA 4KY7A 5KIXA 5KYLA 2OEOA 3C1EA 2F0HA 2PZUA 2F0NA 1NSNS 2NUCA 2PYKA 4ID6A 2F0UA 4HTHA 4I65A 2O4XA 4DF7A 4N9PA 5DAUA 3SK8A 2PZTA 2F0JA 1U9RA 5CV8A 3D4DA 4H7BA 3PMFA 4LAAA 2SNMA 1SNCA 2F0WA 3BDCA 1A2UA 4K5XA 4ODGA 2F0GA 5DEHA 5J22A 3HEJA 4RKBA 1KABA 5NUCA 2M00A 3SXHA 4EVOA 2OXPA 2EY6A 2F0SA 1EZ6A 2F3WA 4K5VA 4KY6A 4NDXA 4PMBA 2PW7A 3C1FA 3OWFA 4ZUJA 5M9OA 3D8GA 4EQNA 3SK6A 2RBMA 1ENCA 5IGBA 5IGFA 5JAVA 5C4ZA 5KEEA 2EY2A 4KJNA 2KHSA 1A3UA 2F0TA 5CGKA 3TP6A 4J6HA 1JOQA 1F2YA 1EY7A 3V2TA 3D4WA 1A3TA 4B9XA 4K6DA 4R8NA 3BDLA 1SYEA 5CV5A 3MXPA 4ZQ3A 1A3VA 4G57A 2F0DA 4N9TA 5EKKA 4DFAA 5IGDA 1IHZA 5CV4A 3EVQA 1F2ZA 1EY5A 2EYMA 2WACA 5E1FA 1STAA 1STBA 3DMUA 4KY5A 4ZUIA 4F7XA 5I9OA 3H6MA 5HURA 1SNQA 5IIFA 5IGCA 5KYIA 4QF4A 3P1HA 4IUNA 3U9OA 3NHHA 4KHVA 3OMCA 2OF1A 3HZXA 1TR5A 1SNPA
chains in the Genus database with same CATH superfamily
1YNJC 1X3EA 3HOXG 2F0LA 1EY0A 3TP7A 5JVH3 1F9PA 1Y14B 3DWAA 5C4JB 3K5LA 1BBXC 2L11A 3PUYA 3ND8A 1T5XD 3AQQA 5E7NA 1E1OA 1NUCA 1CSQA 1D6EC 1C48A 2HQEA 2OTJA 3GTOH 4OGQC 3CMAA 4GNXA 4L5QA 2D2CC 2FXQA 4QY7A 2LXJA 3MTSA 1PH5A 3TS2A 2RKSA 2K5HA 4HMJA 1JCKB 3JC66 2NB0A 3BYYB 1XTCD 3DWPA 2D9UA 1VQJA 4JI8L 2CH4W 2JXMB 2OQKA 4DUZL 2A5HA 2JA5H 1B9MA 2XSCA 5BN5A 1U4LA 5FKAC 1E3PA 1F9QA 2PMZB 1EL0A 2OQ0A 3HOXH 3PQIA 2XTIA 1MJEA 1G51A 2RDGA 2DY7A 4LFCL 2R92G 2WINB 4HJ7A 3SK5A 3NTHA 3BVZA 3J80i 4AYBB 4LF5L 4NP5A 5EPKA 1TWHH 1KRTA 3K5NA 3FKIG 3S16B 3PIPA 2NUCA 3CAMA 3ER0A 4ID6A 1DYQA 2F0UA 1TVXA 4C3HG 5LMUL 1H9RA 3CHBD 1N33Q 3SK8A 2J7ZA 5CV8A 1W6JA 2F4IA 1A2UA 4JC0A 1Q90A 2QGQA 1O78A 4HCSA 5LMNW 4ZRZA 2OXPA 4LWCA 5L37A 3QIAA 4LF4Q 2F3WA 1H95A 2ICIA 4AQYL 1VCIA 1LABA 4P71A 1D5MC 4DUYL 4BS9A 2X6LA 3OW7A 4IFDJ 5IP9G 3HGBA 1VMCA 2NYZD 2ZXPA 2K14A 2UXCL 1NJIC 1EFWA 4CBVA 4ZLTF 4F87A 4ZUIA 3F2UA 1QVCA 1YNNC 2Q8RE 2R92H 3GV3A 2E2DC 1KNEA 5T1GA 5IIFA 2R3ZA 2DJFC 5KYIA 1JE5A 1Q82C 3A54A 5C5MA 1F2MA 1B8AA 2E75C 5GQOA 4UP8A 3VA5A 1XMOQ 4C3HH 4XT1B 5C4HA 3OWEB 4PG3A 4B3SQ 4MNOA 1G2SA 3IFTA 1I94L 1GOZA 2L5TA 5EKLA 4DV3L 4JBMA 1LTAD 3BDOA 3QR8A 3J7ZC 1ILPA 1A63A 2ZXRA 3OW2A 1GHJA 3AFPA 3Q24A 2KEEA 5JVG3 1U5KA 4ME5A 2DUDA 3RR5A 5IT9c 1YJWA 1F9SA 3QB3A 4KV6A 1DGSA 1OXUA 3J80L 2KOLA 5C3XA 1SMYD 2A1AA 2KVMA 1U0LA 1GUSA 2AUKA 4ME3A 1HZ9A 3A55A 5FJ8G 2K05A 4DXGA 2WB1B 3U9SA 3HOVG 1VQAA 1XXGA 3NPPA 5C5LA 1PFNA 4CJ1B 3S9WA 4OO1G 1IKLA 3CRKC 4YWMA 2JA6B 3S1QB 1CKOA 1SYCA 4B3RQ 4LF8Q 4G7HC 3UDFA 1S40A 2CHBD 4R9WA 4IN3A 3J7A5 2LXKA 1P8LA 2PNRC 3C1EA 3I73A 4KK7A 2F0NA 2WKDA 2ZTDA 4HTHA 5C0XJ 4LF7L 1WTVA 2VUMG 3S15H 1KXLA 3I7FA 3GQBA 5FLXc 1X3GA 1LTID 1TU2B 3GTQH 1UNSA 2A69D 3PV0A 3T53B 4EQNA 2RBMA 1PLFA 1LO5D 1L0YB 2GN5A 3NEMA 4O2DA 5C4ZA 4A4IA 4YCVA 3EFXD 4DV7Q 5JJKA 1A3UA 4POGA 3PUZA 1FGUA 4OO1H 1EY7A 5C3EG 2IX1A 1HJPA 3CCRA 4BBSB 2ZM6Q 4DV2L 5E1FA 1Y8OB 2EYMA 4JI6L 1I6HB 4PQXA 3AU7A 4DAYB 2IHEA 1HNXQ 2VZAA 4A3JB 1STEA 3IRBA 1LTRD 2F4VL 1KIXA 4GN3B 4LFBQ 1SDFA 2BH8A 1QVFA 1E1TA 3I4MG 3MZ5A 1UE7A 1VQ8A 3S17H 4DN4M 1L1OC 1G291 2KHJA 4DR2L 4JOIA 3EBEA 4FXGC 1N36Q 1UEAB 3HOUG 1JB7A 1DD2A 1YHQA 1VS0A 2WFWA 3MVVA 2VL6A 4V0BA 1EY8A 1HR0L 1WOCA 1V43A 1K8GA 1R4PB 3K8AA 3PUVA 3H0GG 4C2MB 3I4NH 4FF1A 5K5PA 1BCPC 5EGTA 1D8LA 5EKIA 5C3EH 4DV4L 1GUNA 1A8VA 1MI2A 5D3IB 5BR8Q 1N32Q 1Q46A 3EN2A 1XPRA 3AB9A 1M90C 4XYQA 3A56A 1STGA 1CK1A 2MUYA 2UUAQ 1UWVA 3SDZA 4CKBA 5M3FB 2NVQB 1RIPA 1EQRA 3J80E 1HUNA 2RDHA 1LT5D 2KBNA 4NXMQ 1EZ8A 1Q1EA 3ITPA 4OX9Q 4A93H 2JN4A 2EXZA 3H3VI 1HFGA 3TP5A 2Z6KA 5G3LF 2YU9B 3HOUH 1XMQQ 1A2TA 1YNND 1F77A 4C3IB 2NVXB 4GN5A 1LT3D 3A5ZB 3UE1A 2VQEQ 5ELDA 3FEWX 2A68D 4C1NI 2UXBL 3NTKA 3H0GH 4RG1A 4A3FB 3CCSA 4H7BA 4A3BB 3BDCA 3KDFB 3W1GA 4DV0Q 2JEBI 1PH8A 2K33A 4GLXA 4B3ML 2AQ2B 2ATWA 3H94A 4K5VA 5C4JH 1PH2A 1O7IA 5ELNA 1YEZA 1QZGA 3PO3B 3VA7A 3A7AB 5IGFA 5M5XB 1Z7TA 1XNRL 1WTWA 2HCCA 1FVIA 4IUQA 4AYBG 1BXTA 1JWMD 2Q8TA 1IYVA 1XYIA 1VQIA 1I4HA 4PV1C 1F2LA 3UI2A 1BR9A 1CZGA 1X3FA 4DPGA 1DCZA 2X69A 1STAA 1MD2D 1JICA 4CJ2C 4X3KA 1HFNA 1BDOA 2EY5A 4U68A 1TKWB 5IYDG 1SYBA 3S14B 2NVTH 4JI2Q 1PHJA 4YCWA 5EBCA 3VYUA 2EQSA 4X64Q 2R6GA 2H5XA 2AWNA 1HZCA 1HPCA 3KOJA 1VQOA 5ELCA 2JA7B 3BYTB 4GZYC 1JB3A 2Z6BA 2C35B 1JOOA 3K57A 1T9HA 1NMFA 4EQPA 4JI7Q 4M1UB 1E2VA 2EY1A 1CTMA 1XWEA 3HKZB 4QIWE 1TT2A 4DR6L 3BVMA 3S16H 3OOCA 1HNZQ 1ET9A 1SNOA 4DAYA 2KA7A 4FDBA 1WTHA 3CMEA 4R1JA 2PZWA 1SLJA 1H9KA 1B9NA 1VQFA 4UP7A 3M4QA 3PCOB 3JAMi 1WTOA 2D62A 3RUZA 4MN3A 4DR5L 1GM5A 5I6WA 5IYDH 3E0EA 4OONA 2EJMA 3KF8B 2Z4IA 2IWHA 2LKVA 2B2VC 1PFMA 2NTTA 5KGUA 2Q8IB 4GLAC 2F3IA 1V9PA 3TP8A 2NZ1D 4JVZA 3J7AV 2B2WC 4FXKC 2QCPX 1K8MA 5JJZA 1KLGD 2WB1G 4DR1Q 4JI3Q 2N3SA 2F0GA 4CDCC 3HOWB 1EQTA 4RH6A 1RL2A 4UY8C 2JA6G 2PO4A 1HA6A 4A75A 4HIMA 1ENCA 5IGBA 1BKBA 4YHHQ 2L15A 1G2TA 4UDUC 2D0PA 3CU7A 3GTGH 3OIPA 1Q8KA 1WVLA 3RLNA 4JW0A 1HUMA 1O7ZA 2VB2X 2ES2A 3A74A 3M85A 1J6QA 1KAWA 3H6MA 5HURA 2Z4HA 3IKJA 4UHVA 4NXNQ 2CFMA 4IOAA 5J22A 4ZKCB 3KDFA 2R61A 3KLWA 4B08A 3N6RA 4IFDI 3ULPA 4PZ8A 3VR4A 1JJ2A 1LYLA 4OL7A 2K50A 4IPCA 1XNQL 1J8IA 4H02A 3I8ZA 2JA8B 3JAML 4DV6Q 2JA6H 4BBSG 3S1QH 1WJJA 3HFZB 2C9OA 1N33L 4IJHA 5IY0A 2NN6G 3S15B 2F0IA 1LUZA 2AMCB 4A3JG 3DLLA 2FINB 4GNXC 1Z47A 2IW3A 2WV6D 3CW2C 2E2HB 1K83H 5ELBA 3HKSA 1ICFB 4XQNA 1YIJA 4RHSA 3I72A 2IJ0A 4HCEA 1SN8A 1LACA 1SYGA 4LMQD 3TBIB 1YNXA 3D3RA 1JORA 3MXGA 1EIHA 1SYFA 1WI5A 2YYZA 1EYDA 1VQBA 2VS1A 3L9AX 2Q2UA 3EROA 3R2IA 1VQ6A 3QOJA 3NQIA 1XMOL 4CKCA 2PZUA 4TVAB 3RD4A 2OCEA 2B2VA 4I65A 4BWGB 2O4XA 4B3SL 3NWTA 4N9PA 1I6HH 1S5ED 4GKJL 1QB5D 3L7ZC 5M3FG 2PNHA 1SNCA 4A3JH 1NMGA 2F52A 2K28A 3BJUA 1KABA 2NZHA 1LTTD 3C2PA 4XQQA 2B2WA 2WAQB 1B3AA 4P73A 5AFWA 1DOMA 2UUBQ 1BBWA 4A3LG 1PZKD 2LSSA 4XXEA 4PZ6A 5E4WC 3KF8A 4C56C 2B3GA 3HG9A 1AE3A 4C3IG 1FGBD 3Q8DA 2E8GA 2Y0SG 1TIID 5D65A 1SJHD 2O5JC 1F2ZA 1GKHA 1YHBA 3GD7A 1SMYC 4A3FG 1STBA 1W3SA 4A3IH 4A3BG 1TXYA 2L12A 3NHHA 3CPFA 1CHQD 5BN3A 1VQDA 3CCEA 1Q86C 4R8IA 2MO1A 2QEJC 2RCFA 4A93B 4B3RL 1PV4A 5ELOA 3MC0B 3PO3G 1Y8PB 2F0EA 2DNEA 2PW5A 1L0WA 1EY6A 2NVQH 4JI4Q 1ZXTA 1PH4A 2LMCB 2XIWA 1ICWA 5IYCG 2HDLA 4RCNA 1IBKQ 3HOZB 4WFN3 1G91A 1X6OA 2N49A 3OTOQ 4A3KB 4A3LH 2YTVA 1E2ZA 3C46A 1A62A 1I4GA 3M7GA 2UXDL 1K3RA 1AEXA 1STHA 1DJRD 4C3IH 2NVXH 1PTOF 2R7ZH 4A3EB 1H9SB 1UE5A 4KTAA 3QWNA 3JAME 1WTPA 5DNFA 3GTKB 1ET6A 1PYSB 1X3PA 4NMZA 4A3FH 3A7LA 4A3BH 2A69C 4DV7L 3K0XA 2F0QA 3EQLC 1DXMA 5AJ3Q 2JA7G 1Q8IA 3PO3H 4DAMA 5M5XH 5F2DA 2VQFQ 2N55A 2ENBA 1B4OA 1S5FD 1ZKOA 1HNXL 5FO9B 3QOLA 4IPDA 3HKZG 5IYCH 3S1RB 2Y0SE 5LMNQ 1C4QA 3BZCA 4LFBL 2A73B 1B53A 2R7DA 2NVTB 2L9HA 5DAUA 3NE5B 1YHAA 1N36L 4DR3Q 4POFA 1X56A 4IPHA 3J81L 4DR4Q 1ESRA 1QWYA 4EVOA 3S14H 2EY6A 4BA1I 2Z9HA 3T1YQ 4EX5A 1NY4A 2L4NA 2HHHQ 2EJFC 1TS5A 1CM9A 3UDIA 1IL2A 3A8JE 2HT1A 2Z8LA 4DA2A 2UU9Q 3TP6A 1N32L 4A76A 2JA7H 3D4WA 1A3TA 3T56B 1WD0A 2J0TD 3CCMA 2O2LD 2JEAI 2F0DA 1PZJD 4DFAA 4ZK9B 4C1NK 5CV4A 2O5IC 3T51B 2UUAL 1XJVA 4HR7B 1Y1WH 1SFOB 4QL5A 4ZCKA 5FO8B 2PCFB 4IUNA 1SEBD 3HOWG 1Q12A 2K5DA 3HZXA 4DK0A 1YZ6A 4NXML 3NK9A 1I3QB 4YWKA 5IYBG 4OX9L 2XWBB 3TMEA 4MHEA 1XMQL 1IXRA 3AFQA 1RODA 2VQEL 4KN4C 1ENAA 2ZTEA 1RCVD 2R7FA 1ASYA 1L0XB 4HEDA 4G7ZC 2KEDA 2A68C 1LTSD 1AZQA 4GKKQ 2B39A 2QDBA 4JOIC 5IOCA 2E2IB 3H15A 4X62L 1QZHA 3MXUA 4QCLA 1B3QA 1RD9D 4PZ7A 4DV1L 3NXWA 5E3FA 1VQ5A 3S24A 3EJIA 4P2CB 3K7AH 1RDPD 2AWOA 4JYAQ 1EQVA 4RKLA 3VYRA 3HOWH 4R4QA 3GTGB 4U673 3CCVA 2JA8G 3OMGA 4DV5L 5IYBH 4K8JA 1T5EA 2G5DA 1EOVA 4RHRA 1EIGA 2IT1A 1PRTB 2NTSA 5I9PA 5CBAE 4OXPA 2RDFA 1ILQA 1CSPA 4DAVA 3MWYW 3BZKA 3I4OA 1PH7A 2N8NA 1AFPA 1NSNS 4FVMA 1EWCA 4JI2L 1H9SA 2Z6KC 4X64L 1BBUA 4LAAA 3KLSX 3GDEA 4DXFA 1BF4A 1EIYB 2JSOA 2WP8J 2ICEC 3PUXA 4IOCA 2XRSD 1SJED 5M9OA 1K3BC 3ND9A 4NB3A 5I2XA 4JI7L 4DK6C 1NAPA 4C3JB 4RWSC 2MHVA 2KHSA 2PI2E 5TSSA 3J81E 2JA8H 5G3LD 1HNZL 4G4KA 1NR4A 3OHXC 3A5UA 1WTRA 1K83B 1C8CA 2D5DA 3BDLA 1A3VA 4G57A 4N9TA 5BN4A 2KJXA 1EY5A 1GUTA 3RLFA 1I4XA 3U4VA 2K5VA 4A3DB 3E9HA 1SNPA 2E2HH 2A6ED 2FJ2A 2WAQG 3N52A 4XTCS 4HJAA 3A0JA 4L63B 5C0XH 1EYCA 1SXTA 3K0YA 1PMRA 3PF4A 4K5WA 3I4NG 2KQ3A 2LY7A 1N8RC 1VQNA 4QJFA 1TWCB 1UE6A 3NQTA 1KDCA 1XTDA 1RJTA 4JI1Q 3I2ZA 1Y69U 1IL8A 2K75A 2AHOB 2QDLA 4KHPQ 1VQ9A 5EAYA 3TSSA 3RZOH 4JI3L 4DR1L 3BU2A 5EJWA 1R4QB 1J5EQ 1GUWA 1CUKA 3NWSA 3P75A 5C44B 3DUZA 3RLOA 1BNZA 4DR7Q 1UE1A 4A93G 4JBWA 4NKLA 1PFSA 4YHHL 1E24A 2LFNA 3G48A 4K8IA 2BA0A 2GA4B 2XNAC 3HOZG 5I6YA 5J39A 4A3KG 4CDDC 3RMHA 3TREA 5EQ0A 4DGZA 5JEAG 1OTCA 1X32A 4WRDA 2K01A 3ICEA 5IT9L 1JR0D 4A3IB 4XT3B 2H4OA 1PYWD 2ZJQA 2BDNA 2RHSB 4IUVA 4NXNL 4H0LC 4A3EG 2F0PA 3FP9A 1YI2A 4JPBW 1P16A 1PVOA 2IHFA 4LF6L 4F88A 1A6XA 5JJIA 1SE3A 3CKIB 3V05A 1DOLA 2MPMA 4DV6L 3G6JB 5JPMC 1EZ6A 4MTNA 1H9JA 4X3UA 5C4XB 2B2UA 2V1CC 3MAQA 4XIGS 1TWGB 5LMUQ 2EXDA 1I5FA 2R7ZB 3HOZH 4I7ZC 3KFUA 2KCMA 1CKNB 4Y7NH 4A3KH 3DXJC 4R4CA 3RZDB 3PSIA 4IQZA 4ZQ3A 1ML0D 5JEAH 3PO2B 1IYUA 1L2FA 3R2TA 3UDXA 4K6LA 2NN6I 2N78A 4PMWA 2ZJRA 1MJCA 2A8VA 1XX8A 1MSHA 3DMUA 5I9OA 2WIIB 4A3EH 5EPLA 3GTMH 1VDZA 1TS3A 5FLXL 1VQPA 3GTKH 1JQYD 1STNA 2CCZA 5IWAL 1JWUD 1V8QA 3MXNB 1EU3A 1I6VC 2GVAA 4OIKA 4R4TA 2K1BA 4HAEA 2VW9A 4YIJA 3R8BA 5CC4A 4K2LA 2FFKB 1E2WA 3SE0A 1VQMA 5KRUA 3K5OA 3F8TA 3S1RH 2CH4A 5M5WB 1X3QA 4Q0FA 4AH6A 3X3MA 4DV3Q 2JE6I 2UUBL 1BQQT 2EYHA 4RCOA 1PRTD 1GXDC 5IE8A 3I4LA 1SAPA 4X3SA 4MIUA 3NBIA 1HHVA 3VR5A 4HIKA 5CV9A 2EYOA 1Y1WB 3D31A 1D1IA 2QEXA 2F0VA 1AE2A 2IPKD 2OEOA 2K5QA 4O0AA 4YY3L 2PYKA 1K8OA 2PMZE 1D2BA 3T1HQ 4CHTB 1SFOH 4JI4L 1U9RA 3D4DA 2XVSA 2G9DA 1IBKL 4RKBA 2K6AA 3GP7A 1I3QH 1KD1C 2XWJB 2CVRA 3BZDB 4ZUJA 4AYBE 2F03A 1WFQA 4J15A 4ABNA 3U4ZA 3K59A 1YVCA 4LF7Q 5FO7B 4RAUC 4ULLA 1F2YA 4M8AA 2V4DA 2E74C 4L5RC 2BCOA 3K7AB 2L55A 5GAHC 2HIXA 4FF2A 2E2IH 2SEBD 1Q1BA 3M9BA 5HY6A 4OELB 2VY3A 1N34Q 4GOPB 3FPUB 2ASBA 4DNIA 2KHIA 3CQZB 3KF6B 3FKIB 1ASZA 1RKNA 2EDGA 2VQFL 1HZAA 4C3JG 1I4RA 4B9WA 3KJPA 3I56A 4JI0Q 5LMNL 5HGTA 1DZ1A 3CCQA 4B3TQ 3TEHB 4KKUA 4K2KA 2E2JB 3CP0A 5A35A 1CKNA 2CKZB 4YWLA 2AQ3B 2PQAB 4DR3L 4GOPC 4DR4L 4LF9Q 4DU9A 1EEFD 1PH6A 4A3DG 2BDOA 3I91A 3KBGA 3T1YL 3CC4A 4Y52H 3HRZC 1JJGA 2HHHL 3BVGA 2MO0A 2MGSA 1PZID 4DAPA 3AMUA 5J3BA 3I55A 1S5CD 4IZ8A 1M8AA 2UU9L 4I7AA 5CR3A 2KUMA 3MXNA 4A3GB 3NBHB 1SR3A 2K5WA 1M4VA 2M2LA 1MIUA 3M4PA 3W3AA 1GJXA 4C3JH 4FF3A 4X66Q 2HD3A 2HIVA 5J1ZA 4DNRB 2EOTA 4HJ8A 3CC7A 4LF4L 1X54A 5C44G 2WB1E 1OO9B 1EIFA 1N9WA 2LS01 4R4OA 2JJQA 4LJZC 3FHWA 3S2DB 1IW7D 4P75A 3DEOA 2SNMA 4K5XA 3HP3A 4A3DH 1VQLA 1QCBD 5GAEC 1W6KA 3F1ZA 4LUOA 1TWFB 2EJGC 1CA5A 3CCUA 2N88A 1CHPD 1V1OA 2J4XA 1SBBB 3KJOA 5D14A 2MFIA 1GD7A 4XYOA 4HSPA 4A3IG 3RZOB 1HR0W 1ZYRD 3ZYYX 2M9VA 2Z1CA 1IZ6A 1TWCH 1B1ZA 4GLVB 4LW1A 1CQVA 1U4RA 1SRUA 3HOVB 1BO0A 4K6DA 2BE5D 4BY1B 2DN8A 1K0RA 1K8AC 4JI5Q 4JYAL 1Y1VH 1JC7A 1TY2A 3I3CA 1PDQA 3S2HB 4RGMA 3H3VH 4X65Q 3DWQA 3M4OH 3OYYA 3P1HA 4QF4A 4UPAA 3U9OA 5C44H 1D5ZC 3A8IE 5FLMG 2EYPA 1PH1A 3GTJB 1C7YA 5DM63 3V96A 5C4XG 4UAIA 1WCMB 1JE4A 1C9OA 2RF4A 2F0FA 1H9MA 1KHIA 4KKTA 2VUMB 2R7ZG 1KL9A 5C3WA 5KNDA 1QUQB 3ZJYC 1WD1A 2VNUD 2HQLA 3PO2G 1KC8C 2IX0A 3QJYA 3ERQA 2RVLA 3J81i 5T1IA 4ZYSA 1LT4D 2EIFA 4X6AH 5KNCA 1JOKA 5C6AA 4QB4A 2QKIC 5JPNC 1BCPF 5KNBA 3TQYA 3L2PA 1FD7D 4WJ4A 4OWWB 4LF8L 3T16A 4GOPA 3BG3A 1S72A 3S1MB 1STYA 4OO1I 3KF6A 1F9RA 4CGYB 5FLMH 2KCNA 1V1PB 1JT8A 4Y7NB 4BA2I 1J9OA 5C4XH 1X9NA 3VYTA 4HSVA 1EYAA 2CW0D 1TWGH 4PNYA 2IL8A 4EQOA 3LGJA 3GV6A 4FP5D 1X65A 5IGGA 4JG2A 3GTMB 1GUOA 2EYJA 4KY7A 1FL0A 3RZDH 1FNUA 2PQAA 3PO2H 4O42A 3R93A 5EPJA 5LL6S 4DF7A 1S5BD 1SMXA 4OHJA 1U4MA 2A6EC 3SGIA 3RNUA 5DEHA 5M5YB 3Q22A 2L0CA 2ZM6L 1CZWA 5DM73 5LL6X 3AEVA 2F0SA 2XN9C 4PMBA 4JI1L 1S5DD 4LFAQ 3OWFA 3SK6A 1LV9A 3K81C 4KHPL 2B63B 3NBHA 1Z6HA 1IBLQ 5CYUA 4AIMA 1Y1WG 2UUCQ 1CKMA 2H1EA 5KEEA 3VR6A 4WJ3M 4HIDA 1S4ZA 1J5EL 2KCCA 2BH2A 1B50A 4DR7L 1TY0A 4B9XA 4RGTA 4R8NA 1ENFA 1SYEA 2E5LQ 5EKKA 1IHZA 2HDMA 2Q2HA 2IX3A 3VDYA 3U50C 4BBRB 2I07B 2K4KA 1Y8NB 2VB3X 4X3TA 1Z9FA 5M5WH 3NELA 1EEID 1R9TB 1IYJB 2OT2A 3J80c 4EGVA 4IUTA 3G71A 1SSOA 4QMGA 3E5SA 4QIWB 1G8ZD 5COYA 4V190 3Q6SA 3F2CA 5CBEE 4IFDG 5BR8L 2K52A 4BY7B 3G4SA 4HMIA 1YJNA 3EA6A 2F0MA 2ID0A 4RGOS 4XDXA 5GADC 2PQEA 5H1SE 4TQUS 3K7UC 1EY9A 2Z0SA 3DEPA 3MEHA 1XNQQ 5M3MB 4J1MA 5FK9C 4ZKBB 4WORA 3SK4A 2YTYA 3S1NB 1SNDA 1QVGA 1MHWC 1B44D 3D6CA 1SYDA 5CORA 2BOSA 3VYSA 2C5CA 5DLQE 3J7YW 5CV6A 4QQBX 3H91A 3J7AF 5FOBB 3HKZE 4ILWA 4UP9A 4TRDA 1PYBA 4DV0L 4IFDH 3EIVA 1QUQA 3WOFA 1PH3A 1TWAB 2SOBA 3MHBA 4R4IA 1ONLA 1KAAA 3F2DA 5JJLA 4P72A 4OEMB 4IUUA 4JK1C 4JV5Q 2RHQB 1YITA 2XRQD 2CQOA 4KKSA 1GUGA 1UEBA 4K0KQ 2K7VA 2F0JA 2PZTA 4GN4B 1EQQA 1NR2A 4A3GG 1QE6A 5NUCA 2M00A 1WYDA 1KRSA 2JA9A 3CQZH 3FKIH 1PXUA 2KENA 3M4YA 4Z9CB 1V1PA 1QNKA 3GTLB 4KJNA 4A3MB 4GKJQ 3OIQA 4HN7A 2EZVA 1WTXA 1UAPA 1E7ZA 1G6ZA 3URYA 2G9HD 3FPPA 2E2JH 2B2UC 2TMPA 5C0XG 2TSSA 1VF5C 3EVQA 3UDGA 3RN2A 3ULLA 4KY5A 2PPBC 1HTPA 1SNQA 1NNXA 1CFMA 5IP9H 1PRTC 5IGEA 2KECA 1TR5A 3K58A 2R93B 2B29A 3T4AC 2A6HD 5CV7A 1PH9A 4FXDA 4H13C 1NBWA 3E3XA 4OWTB 4A3GH 4DK3C 3G6EA 3VR3A 1HQRD 4N8FA 3STBD 4BY1G 3T1HL 2OWOA 3I70A 3DHQA 1HNWQ 3HOYB 4XQJA 2QA4A 2DY8A 4JBKA 3Q0AA 3X3NA 3F2BA 5ISRA 4IJLA 3TS0A 1EY4A 3CD6A 4P74A 4CDEC 2RA4A 4KD3A 4S3SA 4CDFC 4HJ5A 3S2DH 3FMCA 1PFBA 1FJGQ 1WCMG 2RSOA 1QNUA 3HS0C 4IALA 3PIO3 1YNJD 1IBMQ 5GAGC 2A19A 2UXDQ 3KYHC 1RF2D 1TWFH 2EYFA 2XGTA 3CCJA 4IO9A 2K5NA 3GTPB 1Y1VB 3M4OB 3TZUA 5FJ8H 3CF5A 4HIOA 3W5OA 1AP0A 3HOVH 1OXTA 1N34L 4ZAIA 5LHY1 3DM1A 4A3CG 1L1OB 4L6TB 4BY1H 3TZDA 1EWHA 3S2HH 4OIJA 2MJ8A 4KHZA 1EUJA 4JI0L 3PMFA 1Q7YC 4B3TL 3SXHA 3GTJH 3I90A 1JJCB 3TDQA 2ZXOA 1I50B 4KY6A 3H3VC 1WCMH 3C1FA 4JI8Q 1QILA 1FYCA 1BCPB 3ULJA 3Q23A 4DUZQ 4DNTB 2VUMH 1LM0A 2NZOA 4LF9L 1VQCA 2F0TA 1Q3LA 3M3YB 2YTXA 1JOQA 4BXXG 3CPWA 1E22A 2ZTCA 1B2TA 2D0OA 4MZ9A 1KQSA 1AZPA 4LFCQ 2EE1A 2WAQE 4RA8A 5IGCA 1JMCA 2NVYB 3OMCA 5IODA 1HA5A 2OF1A 2K04A 1PTOB 5CMDA 4FO2A 4LF5Q 4A3CH 3MEFA 1VQKA 1HH2P 4JBJA 3T13A 1AH9A 1K73C 4K14A 1DOKA 2B63G 3S1MH 4MTKA 4X66L 4IUPA 4L8JA 1OXSC 2FMMA 3LX0A 1OXXK 3P20A 3WOEA 3K6OA 1M1KC 1SE8A 5I4DA 2DJGC 1KTKA 3WDNA 5I2YA 3IL8A 2P5ZX 3I4MH 5JEAJ 4EQ5A 1II3A 4AQYQ 3M7NA 2B8GA 4BBRG 1PTOC 1HTLD 2I5MX 3CRLC 4DUYQ 3ONAB 4Q5VA 5ELFA 4G7OC 4BXXH 1IW7C 2UXCQ 2BA1A 1A15A 1DONA 2Y0SB 1W2BA 5M5YH 2A74C 1I4PA 4BY7G 2EVBA 1MGSA 3K5MA 1O7LA 4X62Q 3GTOB 1C0AA 1SE4A 1ZYRC 2SNSA 4DV1Q 1E0BA 2B63H 4JI5L 5D3DA 1LTBD 3CXCA 2DGYA 4DK1A 4X65L 4PMCA 1I94Q 2BE5C 4KD4A 1HCZA 1K0SA 3SR1A 3LWEA 3NUCA 5KIXA 1FR3A 5M3MG 2QF7A 2CWAA 1D1KA 1RTNA 1K9MC 4DV5Q 3IAYA 4BBRH 3W1BA 2IY5B 1NE3A 4J8QA 2F0WA 1R9TH 2JA5B 1D7QA 4L5TA 2KCTA 4GS3A 3HOXB 5E4XA 2B2TC 1VQHA 2GVBA 3D8GA 1HQMC 4RMFA 1D5XC 4BY7H 2EY2A 3E6ZX 1UUPA 5HGQA 1ZEQX 5CGKA 3L0OA 1GO3E 4J6HA 2AKWB 3JAMc 3DM3A 2L1BA 1TWHB 3KBXA 3QO2A 3CCLA 3MXPA 1LTLA 5IT9E 1XPOA 3IFDA 3QG1A 2WACA 3MFGA 1L1OA 4APVA 4KHVA 5M3MH 2JYOA 3OTOL 4O1NA 1XPUA 3SHLA 3S1NH 1OXVA 4CJ0B 2ALYB 4LUZA 2JP1A 1DM0B 1GVPA 1AW7A 5IP7G 1VQ7A 4QUFA 2EPBA 1K28A 4A3MG 3GO5A 2CW0C 1EFID 3A8KE 3O13A 4ALPA 3RN5A 4KMUC 4OWXB 3U58A 4H44C 4WJWA 5JOBA 3D0FA 2I0QA 3PIP3 5ELEA 1VQGA 1B7YB 4NW2A 2I5LX 2R92B 1TWAH 3E0JA 3SVMA 4HJ9A 5GROA 5AJ3L 5A2QL 1ESFA 2Q2TA 3LNNA 3E9IA 4LFAL 2ZJPA 2R93G 1LT6D 2FHTA 1IBLL 4C3HB 4DV2Q 2UUCL 1IKMA 2FMCA 4JI6Q 5FLXE 3OPOA 2EYLA 1NTGA 2F3VA 1LLRD 2F0KA 1V1QA 2F4VQ 4FF4A 2E5LL 1MSGA 1O7YA 1CQFA 4KLKA 3HOYG 4LUVA 3GTLH 5IP7H 4KN7C 2E76C 4A3MH 1RHPA 2F0OA 4DR2Q 1HRJA 4E6IA 5K36G 2HCIA 4CKEA 1PA6A 2MQHA 1BCPD 1HR0Q 4ODGA 4DKAC 3PGZA 1CI3M 4DV4Q 4NPSA 2R93H 2RCNA 1PRTF 1U4PA 1QG7A 2HUGA 2B2YC 2VXWA 3PIOA 1Y1VG 4GNXB 1EOTA 1VQEA 5JAVA 4LF6Q 2I46A 3WWVA 3TRZA 1HZBA 3V2TA 2B2TA 1PTOD 3MFYA 3K80C 1FNVA 3HOYH 2AQ1B 2CQAA 1NCVA 3L3OC 4N8X1 1MKHA 3PUWA 2WKCA 3SEBA 3D4RA 5K36H 1SE2A 4TKOB 1S3OA 1YJ9A 1VF7A 2Q2IA 1RTOA 1VQ4A 3GTQB 1X55A 3LWUA 4GKKL 1TS2A 4QUCA 2QILA 1CA6A 3UE0A 1MBYA 2UXBQ 1WTQA 1KNAA 4FNFA 3KK7A 1BVSA 4JV5L 2SDFA 3GTPH 3B6YA 4B3MQ 1KDAA 4TSSA 1VMPA 2JK8A 3H09A 5IWAQ 3W2DA 4K0KL 2NWGA 4JCVE 2OTLA 1EYGA 3ERSX 1GHKA 1XNRQ 3OSOA 1EWIA 3G7LA 1TQOA 4IURA 1FNWA 2B8FA 2K03A 1Q81C 5EBDA 4KI0A 3KLRA 2MNAA 4BBSH 1CT1D 1QJOA 2ZT9C 3NP8A 2MP1A 1G6PA 3NTIA 1KDBA 3TN2A 3FVQA 3FDTA 3S17B 2NN6H 4RFBA 1O80A 3NSWA 4QGUA 5A2QE 3J81c 3NENA 1I50H 1I4QA 1SNMA 4IPGA 2K32A 4F8MA 2JQOA 4KJOA 4LK1C 3AYHB 2QW7A 1AN8A 2I5HA 3M3YH 3R3OA 3I4NB 1LTGD 5KYLA 5C3EB 2F0HA 5C0XI 4YCUA 3C3LA 2F1MA 2NBFA 4C2MH 2NVYH 2AUJD 1EU4A 1YBYA 2A6HC 3HEJA 1PTOH 4L5SA 2RSNA 4DR6Q 2YV5A 1HXYD 4NDXA 1TS4A 2PW7A 1HNWL 3J81j 3PF5A 3VR2A 3I4MB 1QOHA 4YY3Q 4LNQA 3STBC 1BUVT 3FRPB 5M3FH 3MA2B 3HOUB 3D6WA 2CWPA 1BOSA 1SROA 2X6GA 4DR5Q 1B70B 4RGNA 1FJGL 3KUPA 2DNCA 5CV5A 2B2YA 5IGDA 4FYDA 1A0IA 3CC2A 3KLSA 1IBML 2YU9H 3H0GB 3P7JA 4F7XA 2JA5G 1KLUD 1JWSD 2RQXA 2PI2A 3BS1A
chains in the Genus database with same CATH topology
1YNJC 2F0LA 1EY0A 3TP7A 5JVH3 1F9PA 5C4JB 3DWAA 3K5LA 1BBXC 2L11A 3PUYA 3ND8A 1T5XD 1NUCA 1D6EC 1C48A 2HQEA 4OGQC 2D2CC 3MTSA 2RKSA 4HMJA 1JCKB 2NB0A 3BYYB 1XTCD 3DWPA 2D9UA 2JXMB 2A5HA 1B9MA 2XSCA 5BN5A 1U4LA 5FKAC 1F9QA 2PMZB 1EL0A 2RDGA 2DY7A 2WINB 3SK5A 3NTHA 3BVZA 4AYBB 4NP5A 5EPKA 3K5NA 3S16B 2NUCA 4ID6A 1DYQA 2F0UA 1TVXA 4C3HG 1H9RA 3CHBD 3SK8A 2J7ZA 5CV8A 1W6JA 2F4IA 1A2UA 1Q90A 1O78A 4HCSA 4ZRZA 2OXPA 3QIAA 2F3WA 2ICIA 1VCIA 1LABA 1D5MC 4BS9A 2X6LA 3OW7A 4IFDJ 3HGBA 1VMCA 2NYZD 2ZXPA 4CBVA 4ZLTF 4F87A 4ZUIA 3F2UA 1YNNC 2Q8RE 3GV3A 2E2DC 1KNEA 5T1GA 5IIFA 2R3ZA 5KYIA 3A54A 5C5MA 1F2MA 2E75C 3VA5A 4XT1B 5C4HA 3OWEB 1G2SA 3IFTA 1GOZA 2L5TA 5EKLA 1LTAD 3BDOA 1ILPA 2ZXRA 1GHJA 3Q24A 2KEEA 5JVG3 4ME5A 1F9SA 3QB3A 4KV6A 1OXUA 3J80L 2KOLA 5C3XA 1SMYD 2KVMA 2AUKA 1GUSA 3A55A 2K05A 4DXGA 2WB1B 3U9SA 1XXGA 3NPPA 5C5LA 1PFNA 4CJ1B 3S9WA 4OO1G 1IKLA 3CRKC 2JA6B 3S1QB 1SYCA 4G7HC 2CHBD 4R9WA 4IN3A 2PNRC 3C1EA 3I73A 4KK7A 2F0NA 2WKDA 4HTHA 5C0XJ 1WTVA 3GQBA 1LTID 1TU2B 1UNSA 2A69D 3PV0A 3T53B 4EQNA 2RBMA 1PLFA 1LO5D 1L0YB 5C4ZA 3EFXD 1A3UA 3PUZA 4OO1H 1EY7A 2IX1A 4BBSB 5E1FA 1Y8OB 2EYMA 1I6HB 4PQXA 3AU7A 4A3JB 1STEA 1LTRD 1SDFA 3MZ5A 4DN4M 1G291 4FXGC 1UEAB 1DD2A 3MVVA 4V0BA 1EY8A 1V43A 1R4PB 3PUVA 4C2MB 4FF1A 5K5PA 1BCPC 5EGTA 5EKIA 1GUNA 1MI2A 5D3IB 3AB9A 4XYQA 3A56A 1STGA 1CK1A 2MUYA 4CKBA 3SDZA 5M3FB 2NVQB 3J80E 1HUNA 2RDHA 1LT5D 1EZ8A 1Q1EA 3ITPA 2EXZA 1HFGA 3TP5A 5G3LF 2YU9B 1A2TA 1YNND 1F77A 4C3IB 2NVXB 1LT3D 5ELDA 3FEWX 2A68D 4C1NI 3NTKA 4A3FB 4H7BA 4A3BB 3BDCA 2JEBI 2K33A 2AQ2B 3H94A 4K5VA 3PO3B 3VA7A 3A7AB 5IGFA 5M5XB 1Z7TA 1WTWA 2HCCA 4IUQA 1BXTA 1JWMD 2Q8TA 1IYVA 1XYIA 1I4HA 4PV1C 1F2LA 3UI2A 1BR9A 1CZGA 1DCZA 2X69A 1STAA 1MD2D 1JICA 4CJ2C 4X3KA 1HFNA 1BDOA 2EY5A 4U68A 1TKWB 1SYBA 3S14B 5EBCA 3VYUA 2R6GA 2AWNA 1HPCA 5ELCA 2JA7B 3BYTB 4GZYC 1JB3A 1JOOA 3K57A 4EQPA 4M1UB 1E2VA 2EY1A 1CTMA 1XWEA 3HKZB 1TT2A 3BVMA 3OOCA 1ET9A 1SNOA 4DAYA 2KA7A 2PZWA 1H9KA 1B9NA 1WTOA 2D62A 3RUZA 4MN3A 5I6WA 2EJMA 2Z4IA 2IWHA 2LKVA 2B2VC 1PFMA 2NTTA 5KGUA 2Q8IB 3TP8A 2NZ1D 3J7AV 2B2WC 4FXKC 2QCPX 1K8MA 5JJZA 1KLGD 2F0GA 3HOWB 1EQTA 4RH6A 2PO4A 1HA6A 1ENCA 5IGBA 1G2TA 4UDUC 3CU7A 3OIPA 1WVLA 1HUMA 1O7ZA 2VB2X 3M85A 5HURA 3H6MA 2Z4HA 3IKJA 5J22A 4ZKCB 4B08A 2R61A 3N6RA 4IFDI 3VR4A 4OL7A 1J8IA 3I8ZA 2JA8B 3JAML 2C9OA 2NN6G 3S15B 2F0IA 2FINB 1Z47A 2IW3A 2WV6D 2E2HB 5ELBA 4XQNA 4RHSA 3I72A 2IJ0A 4HCEA 1LACA 1SYGA 4LMQD 3TBIB 3D3RA 1JORA 3MXGA 1EIHA 1SYFA 2YYZA 1EYDA 3L9AX 3EROA 3R2IA 3QOJA 3NQIA 4CKCA 2PZUA 3RD4A 2B2VA 4I65A 4BWGB 2O4XA 3NWTA 4N9PA 1S5ED 1QB5D 3L7ZC 1SNCA 2K28A 1KABA 1LTTD 3C2PA 4XQQA 2B2WA 2WAQB 1B3AA 5AFWA 1DOMA 1PZKD 4XXEA 5E4WC 3KF8A 4C56C 3HG9A 4C3IG 1FGBD 1TIID 5D65A 1SJHD 2O5JC 1F2ZA 3GD7A 1SMYC 1STBA 2L12A 3NHHA 1CHQD 5BN3A 4R8IA 2QEJC 4A93B 3MC0B 1Y8PB 2F0EA 2DNEA 2PW5A 1EY6A 1ZXTA 2LMCB 2XIWA 1ICWA 2HDLA 4RCNA 3HOZB 4WFN3 1G91A 4A3KB 1E2ZA 3C46A 1I4GA 3M7GA 1AEXA 1STHA 1DJRD 1PTOF 4A3EB 1H9SB 4KTAA 3QWNA 3JAME 1WTPA 5DNFA 3GTKB 1ET6A 1X3PA 4NMZA 3A7LA 2A69C 2F0QA 3EQLC 1DXMA 1Q8IA 5F2DA 2N55A 2ENBA 1B4OA 1S5FD 1ZKOA 5FO9B 3QOLA 3S1RB 1C4QA 2A73B 1B53A 2NVTB 2L9HA 5DAUA 3NE5B 3J81L 1ESRA 1QWYA 4EVOA 2EY6A 4BA1I 2L4NA 2EJFC 1TS5A 1CM9A 3A8JE 2Z8LA 4DA2A 3TP6A 3D4WA 1A3TA 3T56B 1WD0A 2J0TD 2O2LD 2JEAI 2F0DA 1PZJD 4DFAA 4ZK9B 4C1NK 5CV4A 2O5IC 3T51B 4HR7B 1SFOB 5FO8B 2PCFB 4IUNA 1SEBD 1Q12A 2K5DA 3HZXA 4DK0A 3NK9A 1I3QB 2XWBB 3TMEA 4MHEA 1RODA 4KN4C 1ENAA 1RCVD 1L0XB 4HEDA 4G7ZC 2KEDA 2A68C 1LTSD 1AZQA 2B39A 2QDBA 5IOCA 2E2IB 3MXUA 4QCLA 1RD9D 3NXWA 5E3FA 3EJIA 4P2CB 1RDPD 2AWOA 1EQVA 4RKLA 3VYRA 3GTGB 4U673 3OMGA 4K8JA 1T5EA 4RHRA 1EIGA 2IT1A 1PRTB 2NTSA 5I9PA 5CBAE 2RDFA 1ILQA 4DAVA 3MWYW 1AFPA 1NSNS 4FVMA 1EWCA 1H9SA 4LAAA 3KLSX 4DXFA 1BF4A 2JSOA 2WP8J 2ICEC 3PUXA 2XRSD 1SJED 5M9OA 3ND9A 5I2XA 1NAPA 4C3JB 4RWSC 2MHVA 2KHSA 3J81E 5TSSA 5G3LD 4G4KA 1NR4A 3OHXC 1WTRA 1K83B 1C8CA 2D5DA 3BDLA 1A3VA 4G57A 4N9TA 5BN4A 2KJXA 1EY5A 1GUTA 3RLFA 1I4XA 4A3DB 1SNPA 2A6ED 2FJ2A 3N52A 4XTCS 4L63B 5C0XH 1EYCA 1SXTA 3K0YA 1PMRA 4K5WA 2KQ3A 2LY7A 1TWCB 3NQTA 1KDCA 1RJTA 1Y69U 1IL8A 3TSSA 5EJWA 1R4QB 1GUWA 3NWSA 3P75A 5C44B 3DUZA 1BNZA 4JBWA 4NKLA 2LFNA 4K8IA 2BA0A 2GA4B 2XNAC 5I6YA 5J39A 3RMHA 5EQ0A 4DGZA 5JEAG 1X32A 4WRDA 2K01A 5IT9L 1JR0D 4A3IB 4XT3B 2H4OA 1PYWD 2BDNA 4IUVA 4H0LC 2F0PA 4F88A 1A6XA 1SE3A 3CKIB 3V05A 1DOLA 2MPMA 3G6JB 5JPMC 1EZ6A 1H9JA 4X3UA 5C4XB 2B2UA 3MAQA 4XIGS 1TWGB 2R7ZB 4I7ZC 3DXJC 3RZDB 4IQZA 4ZQ3A 1ML0D 5JEAH 3PO2B 1IYUA 3R2TA 4K6LA 2NN6I 4PMWA 1XX8A 1MSHA 5I9OA 3DMUA 2WIIB 5EPLA 1VDZA 1TS3A 5FLXL 1JQYD 1STNA 1JWUD 1V8QA 1EU3A 1I6VC 4OIKA 2K1BA 4HAEA 4YIJA 3R8BA 5CC4A 4K2LA 2FFKB 1E2WA 3SE0A 5KRUA 3K5OA 5M5WB 1X3QA 4Q0FA 3X3MA 2JE6I 1BQQT 2EYHA 4RCOA 1PRTD 1GXDC 3I4LA 1SAPA 4X3SA 4MIUA 3NBIA 1HHVA 3VR5A 5CV9A 2EYOA 1Y1WB 3D31A 1D1IA 2F0VA 2IPKD 2OEOA 2K5QA 2PYKA 1K8OA 1D2BA 4CHTB 1U9RA 3D4DA 2XVSA 2G9DA 4RKBA 2K6AA 3GP7A 2XWJB 2CVRA 3BZDB 4ZUJA 2F03A 4ABNA 3K59A 5FO7B 4RAUC 4ULLA 1F2YA 4M8AA 2V4DA 2E74C 2BCOA 3K7AB 2L55A 4FF2A 2SEBD 1Q1BA 3FPUB 3CQZB 3FKIB 1RKNA 2EDGA 4C3JG 1I4RA 4B9WA 5HGTA 1DZ1A 4KKUA 4K2KA 2E2JB 5A35A 2AQ3B 4DU9A 1EEFD 2BDOA 3I91A 3KBGA 3HRZC 3BVGA 2MGSA 1PZID 4DAPA 3AMUA 1S5CD 4IZ8A 1M8AA 5CR3A 2KUMA 3MXNA 4A3GB 2K5WA 1M4VA 2M2LA 3W3AA 1GJXA 4FF3A 5J1ZA 4DNRB 2EOTA 1OO9B 2LS01 4LJZC 3S2DB 1IW7D 3DEOA 2SNMA 4K5XA 3HP3A 1QCBD 1W6KA 1TWFB 2EJGC 1CA5A 2N88A 1CHPD 1V1OA 2J4XA 1SBBB 5D14A 4XYOA 4HSPA 3RZOB 1ZYRD 3ZYYX 2M9VA 2Z1CA 1B1ZA 1CQVA 1U4RA 3HOVB 1BO0A 4K6DA 2BE5D 4BY1B 2DN8A 1JC7A 1TY2A 3I3CA 1PDQA 3S2HB 4RGMA 3DWQA 4QF4A 3P1HA 3U9OA 1D5ZC 3A8IE 2EYPA 3GTJB 5DM63 3V96A 4UAIA 1WCMB 1JE4A 2F0FA 1H9MA 4KKTA 2VUMB 5C3WA 5KNDA 1WD1A 2VNUD 2IX0A 3QJYA 3ERQA 2RVLA 5T1IA 4ZYSA 1LT4D 5KNCA 1JOKA 5C6AA 4QB4A 2QKIC 5JPNC 1BCPF 5KNBA 1FD7D 3T16A 3BG3A 3S1MB 1STYA 4OO1I 1F9RA 4CGYB 2KCNA 1V1PB 4Y7NB 4BA2I 1J9OA 3VYTA 4HSVA 1EYAA 2CW0D 4PNYA 2IL8A 4EQOA 3GV6A 4FP5D 5IGGA 3GTMB 1GUOA 2EYJA 4KY7A 1FNUA 4O42A 3R93A 5EPJA 5LL6S 4DF7A 1S5BD 4OHJA 1U4MA 2A6EC 5DEHA 5M5YB 3Q22A 2L0CA 1CZWA 5DM73 5LL6X 2F0SA 2XN9C 4PMBA 1S5DD 3OWFA 3SK6A 1LV9A 2B63B 3NBHA 1Z6HA 5CYUA 2H1EA 5KEEA 3VR6A 1S4ZA 2KCCA 1B50A 4B9XA 1TY0A 4RGTA 4R8NA 1ENFA 1SYEA 5EKKA 1IHZA 2HDMA 2IX3A 4BBRB 2I07B 1Y8NB 2VB3X 4X3TA 1EEID 1R9TB 2OT2A 4EGVA 4IUTA 1SSOA 4QMGA 3E5SA 4QIWB 1G8ZD 5COYA 4V190 3Q6SA 5CBEE 4IFDG 4BY7B 4HMIA 2ID0A 2F0MA 3EA6A 4RGOS 4XDXA 2PQEA 4TQUS 1EY9A 3DEPA 3MEHA 5M3MB 4J1MA 5FK9C 4ZKBB 4WORA 3SK4A 3S1NB 1SNDA 1B44D 3D6CA 1SYDA 5CORA 2BOSA 3VYSA 2C5CA 3J7YW 5CV6A 3H91A 3J7AF 5FOBB 4ILWA 4TRDA 4IFDH 3WOFA 1TWAB 2SOBA 3MHBA 1ONLA 1KAAA 4IUUA 4JK1C 2XRQD 4KKSA 1GUGA 2K7VA 2F0JA 2PZTA 1NR2A 1QE6A 5NUCA 2M00A 1PXUA 3M4YA 4Z9CB 1V1PA 1QNKA 3GTLB 4KJNA 4A3MB 3OIQA 4HN7A 2EZVA 1WTXA 1UAPA 1G6ZA 3URYA 2G9HD 3FPPA 2B2UC 2TMPA 5C0XG 2TSSA 1VF5C 3EVQA 4KY5A 2PPBC 1HTPA 1SNQA 1CFMA 1PRTC 5IGEA 2KECA 1TR5A 3K58A 2R93B 3T4AC 2A6HD 5CV7A 4FXDA 4H13C 3VR3A 1HQRD 3I70A 3DHQA 3HOYB 4XQJA 2DY8A 3Q0AA 3X3NA 5ISRA 1EY4A 2RA4A 4KD3A 4S3SA 3FMCA 1PFBA 2RSOA 1QNUA 3HS0C 4IALA 3PIO3 1YNJD 1RF2D 2EYFA 3GTPB 1Y1VB 3M4OB 3TZUA 1AP0A 1OXTA 4ZAIA 5LHY1 3DM1A 4L6TB 3TZDA 1EWHA 4OIJA 2MJ8A 4KHZA 3PMFA 3SXHA 3I90A 3TDQA 2ZXOA 1I50B 4KY6A 3H3VC 3C1FA 1QILA 1FYCA 1BCPB 3Q23A 4DNTB 2F0TA 1Q3LA 3M3YB 1JOQA 1B2TA 1AZPA 2EE1A 4RA8A 5IGCA 2NVYB 3OMCA 5IODA 1HA5A 2OF1A 2K04A 1PTOB 5CMDA 4FO2A 3T13A 4K14A 1DOKA 4IUPA 4L8JA 1OXSC 2FMMA 3LX0A 1OXXK 3P20A 3WOEA 3K6OA 5I4DA 1KTKA 3WDNA 5I2YA 3IL8A 5JEAJ 1II3A 3M7NA 2B8GA 1PTOC 1HTLD 3CRLC 3ONAB 4Q5VA 5ELFA 4G7OC 1IW7C 2BA1A 1A15A 1DONA 2Y0SB 2A74C 1I4PA 2EVBA 1MGSA 3K5MA 1O7LA 3GTOB 1SE4A 1ZYRC 2SNSA 1E0BA 5D3DA 1LTBD 4DK1A 4PMCA 2BE5C 4KD4A 1HCZA 3SR1A 3LWEA 3NUCA 5KIXA 1FR3A 2QF7A 1D1KA 1RTNA 3IAYA 4J8QA 2F0WA 2JA5B 3HOXB 5E4XA 2B2TC 3D8GA 1HQMC 1D5XC 2EY2A 3E6ZX 1UUPA 1ZEQX 5CGKA 4J6HA 2L1BA 1TWHB 3KBXA 3QO2A 3MXPA 5IT9E 3IFDA 3QG1A 2WACA 3MFGA 4KHVA 2JYOA 4O1NA 3SHLA 1OXVA 4CJ0B 2JP1A 1DM0B 1AW7A 4QUFA 2EPBA 3GO5A 2CW0C 1EFID 3A8KE 3O13A 4KMUC 4H44C 4WJWA 5JOBA 3PIP3 5ELEA 4NW2A 2R92B 3E0JA 3SVMA 5A2QL 1ESFA 3LNNA 1LT6D 2FHTA 4C3HB 1IKMA 2FMCA 5FLXE 3OPOA 2EYLA 2F3VA 1LLRD 2F0KA 4FF4A 1MSGA 1O7YA 1CQFA 4KN7C 2E76C 1RHPA 2F0OA 1HRJA 4E6IA 5K36G 2HCIA 4CKEA 1BCPD 4ODGA 1CI3M 1PRTF 1U4PA 1QG7A 2HUGA 2B2YC 2VXWA 1EOTA 5JAVA 2I46A 3V2TA 2B2TA 1PTOD 3MFYA 1FNVA 2AQ1B 2CQAA 1NCVA 3L3OC 3PUWA 2WKCA 3SEBA 3D4RA 5K36H 1SE2A 4TKOB 1VF7A 1RTOA 3GTQB 3LWUA 1TS2A 4QUCA 2QILA 1CA6A 1MBYA 1WTQA 1KNAA 4FNFA 3KK7A 2SDFA 1KDAA 4TSSA 1VMPA 3H09A 3W2DA 2NWGA 1GHKA 3OSOA 3G7LA 1TQOA 4IURA 1FNWA 2B8FA 2K03A 5EBDA 4KI0A 3KLRA 1CT1D 1QJOA 2ZT9C 3NP8A 2MP1A 3NTIA 1KDBA 3TN2A 3FVQA 3FDTA 3S17B 2NN6H 4RFBA 1O80A 3NSWA 5A2QE 1I4QA 1SNMA 2K32A 4F8MA 4KJOA 4LK1C 1AN8A 3R3OA 3I4NB 1LTGD 5KYLA 5C3EB 2F0HA 5C0XI 3C3LA 2F1MA 2NBFA 2AUJD 1EU4A 2A6HC 3HEJA 1PTOH 2RSNA 1HXYD 4NDXA 1TS4A 2PW7A 3VR2A 3I4MB 1QOHA 1BUVT 3FRPB 3MA2B 3HOUB 3D6WA 1BOSA 2X6GA 4RGNA 5CV5A 3KUPA 2DNCA 5IGDA 2B2YA 4FYDA 3KLSA 3H0GB 3P7JA 4F7XA 1KLUD 1JWSD 2RQXA 3BS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYP A;  3SHL A;  2EY5 A;  3NK9 A;  1STN A;  2F0L A;  1F2M A;  4QMG A;  5C5M A;  1SYB A;  3T13 A;  3VA5 A;  1EY0 A;  3E5S A;  3TP7 A;  5C4H A;  4K14 A;  1RKN A;  1EYC A;  3TME A;  3MZ5 A;  5CV7 A;  2F0F A;  2F0E A;  2PW5 A;  1EY6 A;  4K5W A;  4B9W A;  4OL7 A;  5EKL A;  1NUC A;  2KQ3 A;  2HQE A;  5HGT A;  5C3W A;  4YIJ A;  3LX0 A;  5CC4 A;  4K2L A;  1ENA A;  3NQT A;  4K2K A;  1KDC A;  3MVV A;  1KDA A;  5JOB A;  4HMI A;  3DHQ A;  1EY8 A;  4ME5 A;  5KRU A;  1JOO A;  2F0M A;  2RKS A;  3ERQ A;  1II3 A;  4HMJ A;  4EQP A;  3QB3 A;  2PQE A;  2QDB A;  4KV6 A;  2EY1 A;  5IOC A;  5ISR A;  1AEX A;  1STH A;  1JOK A;  2F0I A;  3OSO A;  4QB4 A;  1EY9 A;  5C6A A;  1EY4 A;  1TT2 A;  5EGT A;  1TQO A;  3MEH A;  3P75 A;  4DU9 A;  4KTA A;  4KD3 A;  4J1M A;  3NXW A;  5IGE A;  5C3X A;  4S3S A;  4WOR A;  5E3F A;  1SNO A;  3SK4 A;  1SND A;  3NP8 A;  5IOD A;  5K5P A;  3EJI A;  2EYH A;  2PZW A;  1STG A;  4NMZ A;  1KDB A;  1SYD A;  3D6C A;  4NKL A;  3T16 A;  4IAL A;  1EQV A;  1SYG A;  4IZ8 A;  4RKL A;  1STY A;  4K8I A;  5CV6 A;  5CR3 A;  2EYL A;  5C5L A;  2F0Q A;  1JOR A;  2EYF A;  2F3V A;  3RUZ A;  2F0K A;  3S9W A;  3OMG A;  5I6W A;  5I6Y A;  1SNM A;  1SYF A;  5J39 A;  4MIU A;  4K8J A;  1EZ8 A;  2SNS A;  3ITP A;  1EYA A;  4TRD A;  5CV9 A;  4F8M A;  2EXZ A;  2LKV A;  1SYC A;  4PNY A;  1EYD A;  3TP5 A;  4DGZ A;  4KJO A;  2EYO A;  4WRD A;  5F2D A;  4EQO A;  5I9P A;  2ENB A;  4PMC A;  2RDF A;  4KD4 A;  5J1Z A;  2F0O A;  3ERO A;  2SOB A;  3SK5 A;  3QOL A;  3MHB A;  5IGG A;  5KGU A;  1A2T A;  1KAA A;  3R3O A;  3QOJ A;  2F0P A;  2F0V A;  3NUC A;  3SR1 A;  4E6I A;  4NP5 A;  3TP8 A;  2EYJ A;  4KY7 A;  5KIX A;  5KYL A;  2OEO A;  3C1E A;  2F0H A;  2PZU A;  2F0N A;  1NSN S;  2NUC A;  2PYK A;  4ID6 A;  2F0U A;  4HTH A;  4I65 A;  2O4X A;  4DF7 A;  4N9P A;  5DAU A;  3SK8 A;  2PZT A;  2F0J A;  1U9R A;  5CV8 A;  3D4D A;  4H7B A;  3PMF A;  4LAA A;  2SNM A;  1SNC A;  2F0W A;  3BDC A;  1A2U A;  4K5X A;  4ODG A;  2F0G A;  5DEH A;  5J22 A;  3HEJ A;  4RKB A;  1KAB A;  5NUC A;  2M00 A;  3SXH A;  4EVO A;  2OXP A;  2EY6 A;  2F0S A;  1EZ6 A;  2F3W A;  4K5V A;  4KY6 A;  4NDX A;  4PMB A;  2PW7 A;  3C1F A;  3OWF A;  4ZUJ A;  5M9O A;  3D8G A;  4EQN A;  3SK6 A;  2RBM A;  1ENC A;  5IGB A;  5IGF A;  5JAV A;  5C4Z A;  5KEE A;  2EY2 A;  4KJN A;  2KHS A;  1A3U A;  2F0T A;  5CGK A;  3TP6 A;  4J6H A;  1JOQ A;  1F2Y A;  1EY7 A;  3V2T A;  3D4W A;  1A3T A;  4B9X A;  4K6D A;  4R8N A;  3BDL A;  1SYE A;  5CV5 A;  3MXP A;  4ZQ3 A;  1A3V A;  4G57 A;  2F0D A;  4N9T A;  5EKK A;  4DFA A;  5IGD A;  1IHZ A;  5CV4 A;  3EVQ A;  1F2Z A;  1EY5 A;  2EYM A;  2WAC A;  5E1F A;  1STA A;  1STB A;  3DMU A;  4KY5 A;  4ZUI A;  4F7X A;  5I9O A;  3H6M A;  5HUR A;  1SNQ A;  5IIF A;  5IGC A;  5KYI A;  4QF4 A;  3P1H A;  4IUN A;  3U9O A;  3NHH A;  4KHV A;  3OMC A;  2OF1 A;  3HZX A;  1TR5 A;  1SNP A; 
#chains in the Genus database with same CATH topology
 1YNJ C;  1X3E A;  3HOX G;  2F0L A;  1EY0 A;  3TP7 A;  5JVH 3;  1F9P A;  1Y14 B;  3DWA A;  5C4J B;  3K5L A;  1BBX C;  2L11 A;  3PUY A;  3ND8 A;  1T5X D;  3AQQ A;  5E7N A;  1E1O A;  1NUC A;  1CSQ A;  1D6E C;  1C48 A;  2HQE A;  2OTJ A;  3GTO H;  4OGQ C;  3CMA A;  4GNX A;  4L5Q A;  2D2C C;  2FXQ A;  4QY7 A;  2LXJ A;  3MTS A;  1PH5 A;  3TS2 A;  2RKS A;  2K5H A;  4HMJ A;  1JCK B;  3JC6 6;  2NB0 A;  3BYY B;  1XTC D;  3DWP A;  2D9U A;  1VQJ A;  4JI8 L;  2CH4 W;  2JXM B;  2OQK A;  4DUZ L;  2A5H A;  2JA5 H;  1B9M A;  2XSC A;  5BN5 A;  1U4L A;  5FKA C;  1E3P A;  1F9Q A;  2PMZ B;  1EL0 A;  2OQ0 A;  3HOX H;  3PQI A;  2XTI A;  1MJE A;  1G51 A;  2RDG A;  2DY7 A;  4LFC L;  2R92 G;  2WIN B;  4HJ7 A;  3SK5 A;  3NTH A;  3BVZ A;  3J80 i;  4AYB B;  4LF5 L;  4NP5 A;  5EPK A;  1TWH H;  1KRT A;  3K5N A;  3FKI G;  3S16 B;  3PIP A;  2NUC A;  3CAM A;  3ER0 A;  4ID6 A;  1DYQ A;  2F0U A;  1TVX A;  4C3H G;  5LMU L;  1H9R A;  3CHB D;  1N33 Q;  3SK8 A;  2J7Z A;  5CV8 A;  1W6J A;  2F4I A;  1A2U A;  4JC0 A;  1Q90 A;  2QGQ A;  1O78 A;  4HCS A;  5LMN W;  4ZRZ A;  2OXP A;  4LWC A;  5L37 A;  3QIA A;  4LF4 Q;  2F3W A;  1H95 A;  2ICI A;  4AQY L;  1VCI A;  1LAB A;  4P71 A;  1D5M C;  4DUY L;  4BS9 A;  2X6L A;  3OW7 A;  4IFD J;  5IP9 G;  3HGB A;  1VMC A;  2NYZ D;  2ZXP A;  2K14 A;  2UXC L;  1NJI C;  1EFW A;  4CBV A;  4ZLT F;  4F87 A;  4ZUI A;  3F2U A;  1QVC A;  1YNN C;  2Q8R E;  2R92 H;  3GV3 A;  2E2D C;  1KNE A;  5T1G A;  5IIF A;  2R3Z A;  2DJF C;  5KYI A;  1JE5 A;  1Q82 C;  3A54 A;  5C5M A;  1F2M A;  1B8A A;  2E75 C;  5GQO A;  4UP8 A;  3VA5 A;  1XMO Q;  4C3H H;  4XT1 B;  5C4H A;  3OWE B;  4PG3 A;  4B3S Q;  4MNO A;  1G2S A;  3IFT A;  1I94 L;  1GOZ A;  2L5T A;  5EKL A;  4DV3 L;  4JBM A;  1LTA D;  3BDO A;  3QR8 A;  3J7Z C;  1ILP A;  1A63 A;  2ZXR A;  3OW2 A;  1GHJ A;  3AFP A;  3Q24 A;  2KEE A;  5JVG 3;  1U5K A;  4ME5 A;  2DUD A;  3RR5 A;  5IT9 c;  1YJW A;  1F9S A;  3QB3 A;  4KV6 A;  1DGS A;  1OXU A;  3J80 L;  2KOL A;  5C3X A;  1SMY D;  2A1A A;  2KVM A;  1U0L A;  1GUS A;  2AUK A;  4ME3 A;  1HZ9 A;  3A55 A;  5FJ8 G;  2K05 A;  4DXG A;  2WB1 B;  3U9S A;  3HOV G;  1VQA A;  1XXG A;  3NPP A;  5C5L A;  1PFN A;  4CJ1 B;  3S9W A;  4OO1 G;  1IKL A;  3CRK C;  4YWM A;  2JA6 B;  3S1Q B;  1CKO A;  1SYC A;  4B3R Q;  4LF8 Q;  4G7H C;  3UDF A;  1S40 A;  2CHB D;  4R9W A;  4IN3 A;  3J7A 5;  2LXK A;  1P8L A;  2PNR C;  3C1E A;  3I73 A;  4KK7 A;  2F0N A;  2WKD A;  2ZTD A;  4HTH A;  5C0X J;  4LF7 L;  1WTV A;  2VUM G;  3S15 H;  1KXL A;  3I7F A;  3GQB A;  5FLX c;  1X3G A;  1LTI D;  1TU2 B;  3GTQ H;  1UNS A;  2A69 D;  3PV0 A;  3T53 B;  4EQN A;  2RBM A;  1PLF A;  1LO5 D;  1L0Y B;  2GN5 A;  3NEM A;  4O2D A;  5C4Z A;  4A4I A;  4YCV A;  3EFX D;  4DV7 Q;  5JJK A;  1A3U A;  4POG A;  3PUZ A;  1FGU A;  4OO1 H;  1EY7 A;  5C3E G;  2IX1 A;  1HJP A;  3CCR A;  4BBS B;  2ZM6 Q;  4DV2 L;  5E1F A;  1Y8O B;  2EYM A;  4JI6 L;  1I6H B;  4PQX A;  3AU7 A;  4DAY B;  2IHE A;  1HNX Q;  2VZA A;  4A3J B;  1STE A;  3IRB A;  1LTR D;  2F4V L;  1KIX A;  4GN3 B;  4LFB Q;  1SDF A;  2BH8 A;  1QVF A;  1E1T A;  3I4M G;  3MZ5 A;  1UE7 A;  1VQ8 A;  3S17 H;  4DN4 M;  1L1O C;  1G29 1;  2KHJ A;  4DR2 L;  4JOI A;  3EBE A;  4FXG C;  1N36 Q;  1UEA B;  3HOU G;  1JB7 A;  1DD2 A;  1YHQ A;  1VS0 A;  2WFW A;  3MVV A;  2VL6 A;  4V0B A;  1EY8 A;  1HR0 L;  1WOC A;  1V43 A;  1K8G A;  1R4P B;  3K8A A;  3PUV A;  3H0G G;  4C2M B;  3I4N H;  4FF1 A;  5K5P A;  1BCP C;  5EGT A;  1D8L A;  5EKI A;  5C3E H;  4DV4 L;  1GUN A;  1A8V A;  1MI2 A;  5D3I B;  5BR8 Q;  1N32 Q;  1Q46 A;  3EN2 A;  1XPR A;  3AB9 A;  1M90 C;  4XYQ A;  3A56 A;  1STG A;  1CK1 A;  2MUY A;  2UUA Q;  1UWV A;  3SDZ A;  4CKB A;  5M3F B;  2NVQ B;  1RIP A;  1EQR A;  3J80 E;  1HUN A;  2RDH A;  1LT5 D;  2KBN A;  4NXM Q;  1EZ8 A;  1Q1E A;  3ITP A;  4OX9 Q;  4A93 H;  2JN4 A;  2EXZ A;  3H3V I;  1HFG A;  3TP5 A;  2Z6K A;  5G3L F;  2YU9 B;  3HOU H;  1XMQ Q;  1A2T A;  1YNN D;  1F77 A;  4C3I B;  2NVX B;  4GN5 A;  1LT3 D;  3A5Z B;  3UE1 A;  2VQE Q;  5ELD A;  3FEW X;  2A68 D;  4C1N I;  2UXB L;  3NTK A;  3H0G H;  4RG1 A;  4A3F B;  3CCS A;  4H7B A;  4A3B B;  3BDC A;  3KDF B;  3W1G A;  4DV0 Q;  2JEB I;  1PH8 A;  2K33 A;  4GLX A;  4B3M L;  2AQ2 B;  2ATW A;  3H94 A;  4K5V A;  5C4J H;  1PH2 A;  1O7I A;  5ELN A;  1YEZ A;  1QZG A;  3PO3 B;  3VA7 A;  3A7A B;  5IGF A;  5M5X B;  1Z7T A;  1XNR L;  1WTW A;  2HCC A;  1FVI A;  4IUQ A;  4AYB G;  1BXT A;  1JWM D;  2Q8T A;  1IYV A;  1XYI A;  1VQI A;  1I4H A;  4PV1 C;  1F2L A;  3UI2 A;  1BR9 A;  1CZG A;  1X3F A;  4DPG A;  1DCZ A;  2X69 A;  1STA A;  1MD2 D;  1JIC A;  4CJ2 C;  4X3K A;  1HFN A;  1BDO A;  2EY5 A;  4U68 A;  1TKW B;  5IYD G;  1SYB A;  3S14 B;  2NVT H;  4JI2 Q;  1PHJ A;  4YCW A;  5EBC A;  3VYU A;  2EQS A;  4X64 Q;  2R6G A;  2H5X A;  2AWN A;  1HZC A;  1HPC A;  3KOJ A;  1VQO A;  5ELC A;  2JA7 B;  3BYT B;  4GZY C;  1JB3 A;  2Z6B A;  2C35 B;  1JOO A;  3K57 A;  1T9H A;  1NMF A;  4EQP A;  4JI7 Q;  4M1U B;  1E2V A;  2EY1 A;  1CTM A;  1XWE A;  3HKZ B;  4QIW E;  1TT2 A;  4DR6 L;  3BVM A;  3S16 H;  3OOC A;  1HNZ Q;  1ET9 A;  1SNO A;  4DAY A;  2KA7 A;  4FDB A;  1WTH A;  3CME A;  4R1J A;  2PZW A;  1SLJ A;  1H9K A;  1B9N A;  1VQF A;  4UP7 A;  3M4Q A;  3PCO B;  3JAM i;  1WTO A;  2D62 A;  3RUZ A;  4MN3 A;  4DR5 L;  1GM5 A;  5I6W A;  5IYD H;  3E0E A;  4OON A;  2EJM A;  3KF8 B;  2Z4I A;  2IWH A;  2LKV A;  2B2V C;  1PFM A;  2NTT A;  5KGU A;  2Q8I B;  4GLA C;  2F3I A;  1V9P A;  3TP8 A;  2NZ1 D;  4JVZ A;  3J7A V;  2B2W C;  4FXK C;  2QCP X;  1K8M A;  5JJZ A;  1KLG D;  2WB1 G;  4DR1 Q;  4JI3 Q;  2N3S A;  2F0G A;  4CDC C;  3HOW B;  1EQT A;  4RH6 A;  1RL2 A;  4UY8 C;  2JA6 G;  2PO4 A;  1HA6 A;  4A75 A;  4HIM A;  1ENC A;  5IGB A;  1BKB A;  4YHH Q;  2L15 A;  1G2T A;  4UDU C;  2D0P A;  3CU7 A;  3GTG H;  3OIP A;  1Q8K A;  1WVL A;  3RLN A;  4JW0 A;  1HUM A;  1O7Z A;  2VB2 X;  2ES2 A;  3A74 A;  3M85 A;  1J6Q A;  1KAW A;  3H6M A;  5HUR A;  2Z4H A;  3IKJ A;  4UHV A;  4NXN Q;  2CFM A;  4IOA A;  5J22 A;  4ZKC B;  3KDF A;  2R61 A;  3KLW A;  4B08 A;  3N6R A;  4IFD I;  3ULP A;  4PZ8 A;  3VR4 A;  1JJ2 A;  1LYL A;  4OL7 A;  2K50 A;  4IPC A;  1XNQ L;  1J8I A;  4H02 A;  3I8Z A;  2JA8 B;  3JAM L;  4DV6 Q;  2JA6 H;  4BBS G;  3S1Q H;  1WJJ A;  3HFZ B;  2C9O A;  1N33 L;  4IJH A;  5IY0 A;  2NN6 G;  3S15 B;  2F0I A;  1LUZ A;  2AMC B;  4A3J G;  3DLL A;  2FIN B;  4GNX C;  1Z47 A;  2IW3 A;  2WV6 D;  3CW2 C;  2E2H B;  1K83 H;  5ELB A;  3HKS A;  1ICF B;  4XQN A;  1YIJ A;  4RHS A;  3I72 A;  2IJ0 A;  4HCE A;  1SN8 A;  1LAC A;  1SYG A;  4LMQ D;  3TBI B;  1YNX A;  3D3R A;  1JOR A;  3MXG A;  1EIH A;  1SYF A;  1WI5 A;  2YYZ A;  1EYD A;  1VQB A;  2VS1 A;  3L9A X;  2Q2U A;  3ERO A;  3R2I A;  1VQ6 A;  3QOJ A;  3NQI A;  1XMO L;  4CKC A;  2PZU A;  4TVA B;  3RD4 A;  2OCE A;  2B2V A;  4I65 A;  4BWG B;  2O4X A;  4B3S L;  3NWT A;  4N9P A;  1I6H H;  1S5E D;  4GKJ L;  1QB5 D;  3L7Z C;  5M3F G;  2PNH A;  1SNC A;  4A3J H;  1NMG A;  2F52 A;  2K28 A;  3BJU A;  1KAB A;  2NZH A;  1LTT D;  3C2P A;  4XQQ A;  2B2W A;  2WAQ B;  1B3A A;  4P73 A;  5AFW A;  1DOM A;  2UUB Q;  1BBW A;  4A3L G;  1PZK D;  2LSS A;  4XXE A;  4PZ6 A;  5E4W C;  3KF8 A;  4C56 C;  2B3G A;  3HG9 A;  1AE3 A;  4C3I G;  1FGB D;  3Q8D A;  2E8G A;  2Y0S G;  1TII D;  5D65 A;  1SJH D;  2O5J C;  1F2Z A;  1GKH A;  1YHB A;  3GD7 A;  1SMY C;  4A3F G;  1STB A;  1W3S A;  4A3I H;  4A3B G;  1TXY A;  2L12 A;  3NHH A;  3CPF A;  1CHQ D;  5BN3 A;  1VQD A;  3CCE A;  1Q86 C;  4R8I A;  2MO1 A;  2QEJ C;  2RCF A;  4A93 B;  4B3R L;  1PV4 A;  5ELO A;  3MC0 B;  3PO3 G;  1Y8P B;  2F0E A;  2DNE A;  2PW5 A;  1L0W A;  1EY6 A;  2NVQ H;  4JI4 Q;  1ZXT A;  1PH4 A;  2LMC B;  2XIW A;  1ICW A;  5IYC G;  2HDL A;  4RCN A;  1IBK Q;  3HOZ B;  4WFN 3;  1G91 A;  1X6O A;  2N49 A;  3OTO Q;  4A3K B;  4A3L H;  2YTV A;  1E2Z A;  3C46 A;  1A62 A;  1I4G A;  3M7G A;  2UXD L;  1K3R A;  1AEX A;  1STH A;  1DJR D;  4C3I H;  2NVX H;  1PTO F;  2R7Z H;  4A3E B;  1H9S B;  1UE5 A;  4KTA A;  3QWN A;  3JAM E;  1WTP A;  5DNF A;  3GTK B;  1ET6 A;  1PYS B;  1X3P A;  4NMZ A;  4A3F H;  3A7L A;  4A3B H;  2A69 C;  4DV7 L;  3K0X A;  2F0Q A;  3EQL C;  1DXM A;  5AJ3 Q;  2JA7 G;  1Q8I A;  3PO3 H;  4DAM A;  5M5X H;  5F2D A;  2VQF Q;  2N55 A;  2ENB A;  1B4O A;  1S5F D;  1ZKO A;  1HNX L;  5FO9 B;  3QOL A;  4IPD A;  3HKZ G;  5IYC H;  3S1R B;  2Y0S E;  5LMN Q;  1C4Q A;  3BZC A;  4LFB L;  2A73 B;  1B53 A;  2R7D A;  2NVT B;  2L9H A;  5DAU A;  3NE5 B;  1YHA A;  1N36 L;  4DR3 Q;  4POF A;  1X56 A;  4IPH A;  3J81 L;  4DR4 Q;  1ESR A;  1QWY A;  4EVO A;  3S14 H;  2EY6 A;  4BA1 I;  2Z9H A;  3T1Y Q;  4EX5 A;  1NY4 A;  2L4N A;  2HHH Q;  2EJF C;  1TS5 A;  1CM9 A;  3UDI A;  1IL2 A;  3A8J E;  2HT1 A;  2Z8L A;  4DA2 A;  2UU9 Q;  3TP6 A;  1N32 L;  4A76 A;  2JA7 H;  3D4W A;  1A3T A;  3T56 B;  1WD0 A;  2J0T D;  3CCM A;  2O2L D;  2JEA I;  2F0D A;  1PZJ D;  4DFA A;  4ZK9 B;  4C1N K;  5CV4 A;  2O5I C;  3T51 B;  2UUA L;  1XJV A;  4HR7 B;  1Y1W H;  1SFO B;  4QL5 A;  4ZCK A;  5FO8 B;  2PCF B;  4IUN A;  1SEB D;  3HOW G;  1Q12 A;  2K5D A;  3HZX A;  4DK0 A;  1YZ6 A;  4NXM L;  3NK9 A;  1I3Q B;  4YWK A;  5IYB G;  4OX9 L;  2XWB B;  3TME A;  4MHE A;  1XMQ L;  1IXR A;  3AFQ A;  1ROD A;  2VQE L;  4KN4 C;  1ENA A;  2ZTE A;  1RCV D;  2R7F A;  1ASY A;  1L0X B;  4HED A;  4G7Z C;  2KED A;  2A68 C;  1LTS D;  1AZQ A;  4GKK Q;  2B39 A;  2QDB A;  4JOI C;  5IOC A;  2E2I B;  3H15 A;  4X62 L;  1QZH A;  3MXU A;  4QCL A;  1B3Q A;  1RD9 D;  4PZ7 A;  4DV1 L;  3NXW A;  5E3F A;  1VQ5 A;  3S24 A;  3EJI A;  4P2C B;  3K7A H;  1RDP D;  2AWO A;  4JYA Q;  1EQV A;  4RKL A;  3VYR A;  3HOW H;  4R4Q A;  3GTG B;  4U67 3;  3CCV A;  2JA8 G;  3OMG A;  4DV5 L;  5IYB H;  4K8J A;  1T5E A;  2G5D A;  1EOV A;  4RHR A;  1EIG A;  2IT1 A;  1PRT B;  2NTS A;  5I9P A;  5CBA E;  4OXP A;  2RDF A;  1ILQ A;  1CSP A;  4DAV A;  3MWY W;  3BZK A;  3I4O A;  1PH7 A;  2N8N A;  1AFP A;  1NSN S;  4FVM A;  1EWC A;  4JI2 L;  1H9S A;  2Z6K C;  4X64 L;  1BBU A;  4LAA A;  3KLS X;  3GDE A;  4DXF A;  1BF4 A;  1EIY B;  2JSO A;  2WP8 J;  2ICE C;  3PUX A;  4IOC A;  2XRS D;  1SJE D;  5M9O A;  1K3B C;  3ND9 A;  4NB3 A;  5I2X A;  4JI7 L;  4DK6 C;  1NAP A;  4C3J B;  4RWS C;  2MHV A;  2KHS A;  2PI2 E;  5TSS A;  3J81 E;  2JA8 H;  5G3L D;  1HNZ L;  4G4K A;  1NR4 A;  3OHX C;  3A5U A;  1WTR A;  1K83 B;  1C8C A;  2D5D A;  3BDL A;  1A3V A;  4G57 A;  4N9T A;  5BN4 A;  2KJX A;  1EY5 A;  1GUT A;  3RLF A;  1I4X A;  3U4V A;  2K5V A;  4A3D B;  3E9H A;  1SNP A;  2E2H H;  2A6E D;  2FJ2 A;  2WAQ G;  3N52 A;  4XTC S;  4HJA A;  3A0J A;  4L63 B;  5C0X H;  1EYC A;  1SXT A;  3K0Y A;  1PMR A;  3PF4 A;  4K5W A;  3I4N G;  2KQ3 A;  2LY7 A;  1N8R C;  1VQN A;  4QJF A;  1TWC B;  1UE6 A;  3NQT A;  1KDC A;  1XTD A;  1RJT A;  4JI1 Q;  3I2Z A;  1Y69 U;  1IL8 A;  2K75 A;  2AHO B;  2QDL A;  4KHP Q;  1VQ9 A;  5EAY A;  3TSS A;  3RZO H;  4JI3 L;  4DR1 L;  3BU2 A;  5EJW A;  1R4Q B;  1J5E Q;  1GUW A;  1CUK A;  3NWS A;  3P75 A;  5C44 B;  3DUZ A;  3RLO A;  1BNZ A;  4DR7 Q;  1UE1 A;  4A93 G;  4JBW A;  4NKL A;  1PFS A;  4YHH L;  1E24 A;  2LFN A;  3G48 A;  4K8I A;  2BA0 A;  2GA4 B;  2XNA C;  3HOZ G;  5I6Y A;  5J39 A;  4A3K G;  4CDD C;  3RMH A;  3TRE A;  5EQ0 A;  4DGZ A;  5JEA G;  1OTC A;  1X32 A;  4WRD A;  2K01 A;  3ICE A;  5IT9 L;  1JR0 D;  4A3I B;  4XT3 B;  2H4O A;  1PYW D;  2ZJQ A;  2BDN A;  2RHS B;  4IUV A;  4NXN L;  4H0L C;  4A3E G;  2F0P A;  3FP9 A;  1YI2 A;  4JPB W;  1P16 A;  1PVO A;  2IHF A;  4LF6 L;  4F88 A;  1A6X A;  5JJI A;  1SE3 A;  3CKI B;  3V05 A;  1DOL A;  2MPM A;  4DV6 L;  3G6J B;  5JPM C;  1EZ6 A;  4MTN A;  1H9J A;  4X3U A;  5C4X B;  2B2U A;  2V1C C;  3MAQ A;  4XIG S;  1TWG B;  5LMU Q;  2EXD A;  1I5F A;  2R7Z B;  3HOZ H;  4I7Z C;  3KFU A;  2KCM A;  1CKN B;  4Y7N H;  4A3K H;  3DXJ C;  4R4C A;  3RZD B;  3PSI A;  4IQZ A;  4ZQ3 A;  1ML0 D;  5JEA H;  3PO2 B;  1IYU A;  1L2F A;  3R2T A;  3UDX A;  4K6L A;  2NN6 I;  2N78 A;  4PMW A;  2ZJR A;  1MJC A;  2A8V A;  1XX8 A;  1MSH A;  3DMU A;  5I9O A;  2WII B;  4A3E H;  5EPL A;  3GTM H;  1VDZ A;  1TS3 A;  5FLX L;  1VQP A;  3GTK H;  1JQY D;  1STN A;  2CCZ A;  5IWA L;  1JWU D;  1V8Q A;  3MXN B;  1EU3 A;  1I6V C;  2GVA A;  4OIK A;  4R4T A;  2K1B A;  4HAE A;  2VW9 A;  4YIJ A;  3R8B A;  5CC4 A;  4K2L A;  2FFK B;  1E2W A;  3SE0 A;  1VQM A;  5KRU A;  3K5O A;  3F8T A;  3S1R H;  2CH4 A;  5M5W B;  1X3Q A;  4Q0F A;  4AH6 A;  3X3M A;  4DV3 Q;  2JE6 I;  2UUB L;  1BQQ T;  2EYH A;  4RCO A;  1PRT D;  1GXD C;  5IE8 A;  3I4L A;  1SAP A;  4X3S A;  4MIU A;  3NBI A;  1HHV A;  3VR5 A;  4HIK A;  5CV9 A;  2EYO A;  1Y1W B;  3D31 A;  1D1I A;  2QEX A;  2F0V A;  1AE2 A;  2IPK D;  2OEO A;  2K5Q A;  4O0A A;  4YY3 L;  2PYK A;  1K8O A;  2PMZ E;  1D2B A;  3T1H Q;  4CHT B;  1SFO H;  4JI4 L;  1U9R A;  3D4D A;  2XVS A;  2G9D A;  1IBK L;  4RKB A;  2K6A A;  3GP7 A;  1I3Q H;  1KD1 C;  2XWJ B;  2CVR A;  3BZD B;  4ZUJ A;  4AYB E;  2F03 A;  1WFQ A;  4J15 A;  4ABN A;  3U4Z A;  3K59 A;  1YVC A;  4LF7 Q;  5FO7 B;  4RAU C;  4ULL A;  1F2Y A;  4M8A A;  2V4D A;  2E74 C;  4L5R C;  2BCO A;  3K7A B;  2L55 A;  5GAH C;  2HIX A;  4FF2 A;  2E2I H;  2SEB D;  1Q1B A;  3M9B A;  5HY6 A;  4OEL B;  2VY3 A;  1N34 Q;  4GOP B;  3FPU B;  2ASB A;  4DNI A;  2KHI A;  3CQZ B;  3KF6 B;  3FKI B;  1ASZ A;  1RKN A;  2EDG A;  2VQF L;  1HZA A;  4C3J G;  1I4R A;  4B9W A;  3KJP A;  3I56 A;  4JI0 Q;  5LMN L;  5HGT A;  1DZ1 A;  3CCQ A;  4B3T Q;  3TEH B;  4KKU A;  4K2K A;  2E2J B;  3CP0 A;  5A35 A;  1CKN A;  2CKZ B;  4YWL A;  2AQ3 B;  2PQA B;  4DR3 L;  4GOP C;  4DR4 L;  4LF9 Q;  4DU9 A;  1EEF D;  1PH6 A;  4A3D G;  2BDO A;  3I91 A;  3KBG A;  3T1Y L;  3CC4 A;  4Y52 H;  3HRZ C;  1JJG A;  2HHH L;  3BVG A;  2MO0 A;  2MGS A;  1PZI D;  4DAP A;  3AMU A;  5J3B A;  3I55 A;  1S5C D;  4IZ8 A;  1M8A A;  2UU9 L;  4I7A A;  5CR3 A;  2KUM A;  3MXN A;  4A3G B;  3NBH B;  1SR3 A;  2K5W A;  1M4V A;  2M2L A;  1MIU A;  3M4P A;  3W3A A;  1GJX A;  4C3J H;  4FF3 A;  4X66 Q;  2HD3 A;  2HIV A;  5J1Z A;  4DNR B;  2EOT A;  4HJ8 A;  3CC7 A;  4LF4 L;  1X54 A;  5C44 G;  2WB1 E;  1OO9 B;  1EIF A;  1N9W A;  2LS0 1;  4R4O A;  2JJQ A;  4LJZ C;  3FHW A;  3S2D B;  1IW7 D;  4P75 A;  3DEO A;  2SNM A;  4K5X A;  3HP3 A;  4A3D H;  1VQL A;  1QCB D;  5GAE C;  1W6K A;  3F1Z A;  4LUO A;  1TWF B;  2EJG C;  1CA5 A;  3CCU A;  2N88 A;  1CHP D;  1V1O A;  2J4X A;  1SBB B;  3KJO A;  5D14 A;  2MFI A;  1GD7 A;  4XYO A;  4HSP A;  4A3I G;  3RZO B;  1HR0 W;  1ZYR D;  3ZYY X;  2M9V A;  2Z1C A;  1IZ6 A;  1TWC H;  1B1Z A;  4GLV B;  4LW1 A;  1CQV A;  1U4R A;  1SRU A;  3HOV B;  1BO0 A;  4K6D A;  2BE5 D;  4BY1 B;  2DN8 A;  1K0R A;  1K8A C;  4JI5 Q;  4JYA L;  1Y1V H;  1JC7 A;  1TY2 A;  3I3C A;  1PDQ A;  3S2H B;  4RGM A;  3H3V H;  4X65 Q;  3DWQ A;  3M4O H;  3OYY A;  3P1H A;  4QF4 A;  4UPA A;  3U9O A;  5C44 H;  1D5Z C;  3A8I E;  5FLM G;  2EYP A;  1PH1 A;  3GTJ B;  1C7Y A;  5DM6 3;  3V96 A;  5C4X G;  4UAI A;  1WCM B;  1JE4 A;  1C9O A;  2RF4 A;  2F0F A;  1H9M A;  1KHI A;  4KKT A;  2VUM B;  2R7Z G;  1KL9 A;  5C3W A;  5KND A;  1QUQ B;  3ZJY C;  1WD1 A;  2VNU D;  2HQL A;  3PO2 G;  1KC8 C;  2IX0 A;  3QJY A;  3ERQ A;  2RVL A;  3J81 i;  5T1I A;  4ZYS A;  1LT4 D;  2EIF A;  4X6A H;  5KNC A;  1JOK A;  5C6A A;  4QB4 A;  2QKI C;  5JPN C;  1BCP F;  5KNB A;  3TQY A;  3L2P A;  1FD7 D;  4WJ4 A;  4OWW B;  4LF8 L;  3T16 A;  4GOP A;  3BG3 A;  1S72 A;  3S1M B;  1STY A;  4OO1 I;  3KF6 A;  1F9R A;  4CGY B;  5FLM H;  2KCN A;  1V1P B;  1JT8 A;  4Y7N B;  4BA2 I;  1J9O A;  5C4X H;  1X9N A;  3VYT A;  4HSV A;  1EYA A;  2CW0 D;  1TWG H;  4PNY A;  2IL8 A;  4EQO A;  3LGJ A;  3GV6 A;  4FP5 D;  1X65 A;  5IGG A;  4JG2 A;  3GTM B;  1GUO A;  2EYJ A;  4KY7 A;  1FL0 A;  3RZD H;  1FNU A;  2PQA A;  3PO2 H;  4O42 A;  3R93 A;  5EPJ A;  5LL6 S;  4DF7 A;  1S5B D;  1SMX A;  4OHJ A;  1U4M A;  2A6E C;  3SGI A;  3RNU A;  5DEH A;  5M5Y B;  3Q22 A;  2L0C A;  2ZM6 L;  1CZW A;  5DM7 3;  5LL6 X;  3AEV A;  2F0S A;  2XN9 C;  4PMB A;  4JI1 L;  1S5D D;  4LFA Q;  3OWF A;  3SK6 A;  1LV9 A;  3K81 C;  4KHP L;  2B63 B;  3NBH A;  1Z6H A;  1IBL Q;  5CYU A;  4AIM A;  1Y1W G;  2UUC Q;  1CKM A;  2H1E A;  5KEE A;  3VR6 A;  4WJ3 M;  4HID A;  1S4Z A;  1J5E L;  2KCC A;  2BH2 A;  1B50 A;  4DR7 L;  1TY0 A;  4B9X A;  4RGT A;  4R8N A;  1ENF A;  1SYE A;  2E5L Q;  5EKK A;  1IHZ A;  2HDM A;  2Q2H A;  2IX3 A;  3VDY A;  3U50 C;  4BBR B;  2I07 B;  2K4K A;  1Y8N B;  2VB3 X;  4X3T A;  1Z9F A;  5M5W H;  3NEL A;  1EEI D;  1R9T B;  1IYJ B;  2OT2 A;  3J80 c;  4EGV A;  4IUT A;  3G71 A;  1SSO A;  4QMG A;  3E5S A;  4QIW B;  1G8Z D;  5COY A;  4V19 0;  3Q6S A;  3F2C A;  5CBE E;  4IFD G;  5BR8 L;  2K52 A;  4BY7 B;  3G4S A;  4HMI A;  1YJN A;  3EA6 A;  2F0M A;  2ID0 A;  4RGO S;  4XDX A;  5GAD C;  2PQE A;  5H1S E;  4TQU S;  3K7U C;  1EY9 A;  2Z0S A;  3DEP A;  3MEH A;  1XNQ Q;  5M3M B;  4J1M A;  5FK9 C;  4ZKB B;  4WOR A;  3SK4 A;  2YTY A;  3S1N B;  1SND A;  1QVG A;  1MHW C;  1B44 D;  3D6C A;  1SYD A;  5COR A;  2BOS A;  3VYS A;  2C5C A;  5DLQ E;  3J7Y W;  5CV6 A;  4QQB X;  3H91 A;  3J7A F;  5FOB B;  3HKZ E;  4ILW A;  4UP9 A;  4TRD A;  1PYB A;  4DV0 L;  4IFD H;  3EIV A;  1QUQ A;  3WOF A;  1PH3 A;  1TWA B;  2SOB A;  3MHB A;  4R4I A;  1ONL A;  1KAA A;  3F2D A;  5JJL A;  4P72 A;  4OEM B;  4IUU A;  4JK1 C;  4JV5 Q;  2RHQ B;  1YIT A;  2XRQ D;  2CQO A;  4KKS A;  1GUG A;  1UEB A;  4K0K Q;  2K7V A;  2F0J A;  2PZT A;  4GN4 B;  1EQQ A;  1NR2 A;  4A3G G;  1QE6 A;  5NUC A;  2M00 A;  1WYD A;  1KRS A;  2JA9 A;  3CQZ H;  3FKI H;  1PXU A;  2KEN A;  3M4Y A;  4Z9C B;  1V1P A;  1QNK A;  3GTL B;  4KJN A;  4A3M B;  4GKJ Q;  3OIQ A;  4HN7 A;  2EZV A;  1WTX A;  1UAP A;  1E7Z A;  1G6Z A;  3URY A;  2G9H D;  3FPP A;  2E2J H;  2B2U C;  2TMP A;  5C0X G;  2TSS A;  1VF5 C;  3EVQ A;  3UDG A;  3RN2 A;  3ULL A;  4KY5 A;  2PPB C;  1HTP A;  1SNQ A;  1NNX A;  1CFM A;  5IP9 H;  1PRT C;  5IGE A;  2KEC A;  1TR5 A;  3K58 A;  2R93 B;  2B29 A;  3T4A C;  2A6H D;  5CV7 A;  1PH9 A;  4FXD A;  4H13 C;  1NBW A;  3E3X A;  4OWT B;  4A3G H;  4DK3 C;  3G6E A;  3VR3 A;  1HQR D;  4N8F A;  3STB D;  4BY1 G;  3T1H L;  2OWO A;  3I70 A;  3DHQ A;  1HNW Q;  3HOY B;  4XQJ A;  2QA4 A;  2DY8 A;  4JBK A;  3Q0A A;  3X3N A;  3F2B A;  5ISR A;  4IJL A;  3TS0 A;  1EY4 A;  3CD6 A;  4P74 A;  4CDE C;  2RA4 A;  4KD3 A;  4S3S A;  4CDF C;  4HJ5 A;  3S2D H;  3FMC A;  1PFB A;  1FJG Q;  1WCM G;  2RSO A;  1QNU A;  3HS0 C;  4IAL A;  3PIO 3;  1YNJ D;  1IBM Q;  5GAG C;  2A19 A;  2UXD Q;  3KYH C;  1RF2 D;  1TWF H;  2EYF A;  2XGT A;  3CCJ A;  4IO9 A;  2K5N A;  3GTP B;  1Y1V B;  3M4O B;  3TZU A;  5FJ8 H;  3CF5 A;  4HIO A;  3W5O A;  1AP0 A;  3HOV H;  1OXT A;  1N34 L;  4ZAI A;  5LHY 1;  3DM1 A;  4A3C G;  1L1O B;  4L6T B;  4BY1 H;  3TZD A;  1EWH A;  3S2H H;  4OIJ A;  2MJ8 A;  4KHZ A;  1EUJ A;  4JI0 L;  3PMF A;  1Q7Y C;  4B3T L;  3SXH A;  3GTJ H;  3I90 A;  1JJC B;  3TDQ A;  2ZXO A;  1I50 B;  4KY6 A;  3H3V C;  1WCM H;  3C1F A;  4JI8 Q;  1QIL A;  1FYC A;  1BCP B;  3ULJ A;  3Q23 A;  4DUZ Q;  4DNT B;  2VUM H;  1LM0 A;  2NZO A;  4LF9 L;  1VQC A;  2F0T A;  1Q3L A;  3M3Y B;  2YTX A;  1JOQ A;  4BXX G;  3CPW A;  1E22 A;  2ZTC A;  1B2T A;  2D0O A;  4MZ9 A;  1KQS A;  1AZP A;  4LFC Q;  2EE1 A;  2WAQ E;  4RA8 A;  5IGC A;  1JMC A;  2NVY B;  3OMC A;  5IOD A;  1HA5 A;  2OF1 A;  2K04 A;  1PTO B;  5CMD A;  4FO2 A;  4LF5 Q;  4A3C H;  3MEF A;  1VQK A;  1HH2 P;  4JBJ A;  3T13 A;  1AH9 A;  1K73 C;  4K14 A;  1DOK A;  2B63 G;  3S1M H;  4MTK A;  4X66 L;  4IUP A;  4L8J A;  1OXS C;  2FMM A;  3LX0 A;  1OXX K;  3P20 A;  3WOE A;  3K6O A;  1M1K C;  1SE8 A;  5I4D A;  2DJG C;  1KTK A;  3WDN A;  5I2Y A;  3IL8 A;  2P5Z X;  3I4M H;  5JEA J;  4EQ5 A;  1II3 A;  4AQY Q;  3M7N A;  2B8G A;  4BBR G;  1PTO C;  1HTL D;  2I5M X;  3CRL C;  4DUY Q;  3ONA B;  4Q5V A;  5ELF A;  4G7O C;  4BXX H;  1IW7 C;  2UXC Q;  2BA1 A;  1A15 A;  1DON A;  2Y0S B;  1W2B A;  5M5Y H;  2A74 C;  1I4P A;  4BY7 G;  2EVB A;  1MGS A;  3K5M A;  1O7L A;  4X62 Q;  3GTO B;  1C0A A;  1SE4 A;  1ZYR C;  2SNS A;  4DV1 Q;  1E0B A;  2B63 H;  4JI5 L;  5D3D A;  1LTB D;  3CXC A;  2DGY A;  4DK1 A;  4X65 L;  4PMC A;  1I94 Q;  2BE5 C;  4KD4 A;  1HCZ A;  1K0S A;  3SR1 A;  3LWE A;  3NUC A;  5KIX A;  1FR3 A;  5M3M G;  2QF7 A;  2CWA A;  1D1K A;  1RTN A;  1K9M C;  4DV5 Q;  3IAY A;  4BBR H;  3W1B A;  2IY5 B;  1NE3 A;  4J8Q A;  2F0W A;  1R9T H;  2JA5 B;  1D7Q A;  4L5T A;  2KCT A;  4GS3 A;  3HOX B;  5E4X A;  2B2T C;  1VQH A;  2GVB A;  3D8G A;  1HQM C;  4RMF A;  1D5X C;  4BY7 H;  2EY2 A;  3E6Z X;  1UUP A;  5HGQ A;  1ZEQ X;  5CGK A;  3L0O A;  1GO3 E;  4J6H A;  2AKW B;  3JAM c;  3DM3 A;  2L1B A;  1TWH B;  3KBX A;  3QO2 A;  3CCL A;  3MXP A;  1LTL A;  5IT9 E;  1XPO A;  3IFD A;  3QG1 A;  2WAC A;  3MFG A;  1L1O A;  4APV A;  4KHV A;  5M3M H;  2JYO A;  3OTO L;  4O1N A;  1XPU A;  3SHL A;  3S1N H;  1OXV A;  4CJ0 B;  2ALY B;  4LUZ A;  2JP1 A;  1DM0 B;  1GVP A;  1AW7 A;  5IP7 G;  1VQ7 A;  4QUF A;  2EPB A;  1K28 A;  4A3M G;  3GO5 A;  2CW0 C;  1EFI D;  3A8K E;  3O13 A;  4ALP A;  3RN5 A;  4KMU C;  4OWX B;  3U58 A;  4H44 C;  4WJW A;  5JOB A;  3D0F A;  2I0Q A;  3PIP 3;  5ELE A;  1VQG A;  1B7Y B;  4NW2 A;  2I5L X;  2R92 B;  1TWA H;  3E0J A;  3SVM A;  4HJ9 A;  5GRO A;  5AJ3 L;  5A2Q L;  1ESF A;  2Q2T A;  3LNN A;  3E9I A;  4LFA L;  2ZJP A;  2R93 G;  1LT6 D;  2FHT A;  1IBL L;  4C3H B;  4DV2 Q;  2UUC L;  1IKM A;  2FMC A;  4JI6 Q;  5FLX E;  3OPO A;  2EYL A;  1NTG A;  2F3V A;  1LLR D;  2F0K A;  1V1Q A;  2F4V Q;  4FF4 A;  2E5L L;  1MSG A;  1O7Y A;  1CQF A;  4KLK A;  3HOY G;  4LUV A;  3GTL H;  5IP7 H;  4KN7 C;  2E76 C;  4A3M H;  1RHP A;  2F0O A;  4DR2 Q;  1HRJ A;  4E6I A;  5K36 G;  2HCI A;  4CKE A;  1PA6 A;  2MQH A;  1BCP D;  1HR0 Q;  4ODG A;  4DKA C;  3PGZ A;  1CI3 M;  4DV4 Q;  4NPS A;  2R93 H;  2RCN A;  1PRT F;  1U4P A;  1QG7 A;  2HUG A;  2B2Y C;  2VXW A;  3PIO A;  1Y1V G;  4GNX B;  1EOT A;  1VQE A;  5JAV A;  4LF6 Q;  2I46 A;  3WWV A;  3TRZ A;  1HZB A;  3V2T A;  2B2T A;  1PTO D;  3MFY A;  3K80 C;  1FNV A;  3HOY H;  2AQ1 B;  2CQA A;  1NCV A;  3L3O C;  4N8X 1;  1MKH A;  3PUW A;  2WKC A;  3SEB A;  3D4R A;  5K36 H;  1SE2 A;  4TKO B;  1S3O A;  1YJ9 A;  1VF7 A;  2Q2I A;  1RTO A;  1VQ4 A;  3GTQ B;  1X55 A;  3LWU A;  4GKK L;  1TS2 A;  4QUC A;  2QIL A;  1CA6 A;  3UE0 A;  1MBY A;  2UXB Q;  1WTQ A;  1KNA A;  4FNF A;  3KK7 A;  1BVS A;  4JV5 L;  2SDF A;  3GTP H;  3B6Y A;  4B3M Q;  1KDA A;  4TSS A;  1VMP A;  2JK8 A;  3H09 A;  5IWA Q;  3W2D A;  4K0K L;  2NWG A;  4JCV E;  2OTL A;  1EYG A;  3ERS X;  1GHK A;  1XNR Q;  3OSO A;  1EWI A;  3G7L A;  1TQO A;  4IUR A;  1FNW A;  2B8F A;  2K03 A;  1Q81 C;  5EBD A;  4KI0 A;  3KLR A;  2MNA A;  4BBS H;  1CT1 D;  1QJO A;  2ZT9 C;  3NP8 A;  2MP1 A;  1G6P A;  3NTI A;  1KDB A;  3TN2 A;  3FVQ A;  3FDT A;  3S17 B;  2NN6 H;  4RFB A;  1O80 A;  3NSW A;  4QGU A;  5A2Q E;  3J81 c;  3NEN A;  1I50 H;  1I4Q A;  1SNM A;  4IPG A;  2K32 A;  4F8M A;  2JQO A;  4KJO A;  4LK1 C;  3AYH B;  2QW7 A;  1AN8 A;  2I5H A;  3M3Y H;  3R3O A;  3I4N B;  1LTG D;  5KYL A;  5C3E B;  2F0H A;  5C0X I;  4YCU A;  3C3L A;  2F1M A;  2NBF A;  4C2M H;  2NVY H;  2AUJ D;  1EU4 A;  1YBY A;  2A6H C;  3HEJ A;  1PTO H;  4L5S A;  2RSN A;  4DR6 Q;  2YV5 A;  1HXY D;  4NDX A;  1TS4 A;  2PW7 A;  1HNW L;  3J81 j;  3PF5 A;  3VR2 A;  3I4M B;  1QOH A;  4YY3 Q;  4LNQ A;  3STB C;  1BUV T;  3FRP B;  5M3F H;  3MA2 B;  3HOU B;  3D6W A;  2CWP A;  1BOS A;  1SRO A;  2X6G A;  4DR5 Q;  1B70 B;  4RGN A;  1FJG L;  3KUP A;  2DNC A;  5CV5 A;  2B2Y A;  5IGD A;  4FYD A;  1A0I A;  3CC2 A;  3KLS A;  1IBM L;  2YU9 H;  3H0G B;  3P7J A;  4F7X A;  2JA5 G;  1KLU D;  1JWS D;  2RQX A;  2PI2 A;  3BS1 A; 
#chains in the Genus database with same CATH homology
 1YNJ C;  2F0L A;  1EY0 A;  3TP7 A;  5JVH 3;  1F9P A;  5C4J B;  3DWA A;  3K5L A;  1BBX C;  2L11 A;  3PUY A;  3ND8 A;  1T5X D;  1NUC A;  1D6E C;  1C48 A;  2HQE A;  4OGQ C;  2D2C C;  3MTS A;  2RKS A;  4HMJ A;  1JCK B;  2NB0 A;  3BYY B;  1XTC D;  3DWP A;  2D9U A;  2JXM B;  2A5H A;  1B9M A;  2XSC A;  5BN5 A;  1U4L A;  5FKA C;  1F9Q A;  2PMZ B;  1EL0 A;  2RDG A;  2DY7 A;  2WIN B;  3SK5 A;  3NTH A;  3BVZ A;  4AYB B;  4NP5 A;  5EPK A;  3K5N A;  3S16 B;  2NUC A;  4ID6 A;  1DYQ A;  2F0U A;  1TVX A;  4C3H G;  1H9R A;  3CHB D;  3SK8 A;  2J7Z A;  5CV8 A;  1W6J A;  2F4I A;  1A2U A;  1Q90 A;  1O78 A;  4HCS A;  4ZRZ A;  2OXP A;  3QIA A;  2F3W A;  2ICI A;  1VCI A;  1LAB A;  1D5M C;  4BS9 A;  2X6L A;  3OW7 A;  4IFD J;  3HGB A;  1VMC A;  2NYZ D;  2ZXP A;  4CBV A;  4ZLT F;  4F87 A;  4ZUI A;  3F2U A;  1YNN C;  2Q8R E;  3GV3 A;  2E2D C;  1KNE A;  5T1G A;  5IIF A;  2R3Z A;  5KYI A;  3A54 A;  5C5M A;  1F2M A;  2E75 C;  3VA5 A;  4XT1 B;  5C4H A;  3OWE B;  1G2S A;  3IFT A;  1GOZ A;  2L5T A;  5EKL A;  1LTA D;  3BDO A;  1ILP A;  2ZXR A;  1GHJ A;  3Q24 A;  2KEE A;  5JVG 3;  4ME5 A;  1F9S A;  3QB3 A;  4KV6 A;  1OXU A;  3J80 L;  2KOL A;  5C3X A;  1SMY D;  2KVM A;  2AUK A;  1GUS A;  3A55 A;  2K05 A;  4DXG A;  2WB1 B;  3U9S A;  1XXG A;  3NPP A;  5C5L A;  1PFN A;  4CJ1 B;  3S9W A;  4OO1 G;  1IKL A;  3CRK C;  2JA6 B;  3S1Q B;  1SYC A;  4G7H C;  2CHB D;  4R9W A;  4IN3 A;  2PNR C;  3C1E A;  3I73 A;  4KK7 A;  2F0N A;  2WKD A;  4HTH A;  5C0X J;  1WTV A;  3GQB A;  1LTI D;  1TU2 B;  1UNS A;  2A69 D;  3PV0 A;  3T53 B;  4EQN A;  2RBM A;  1PLF A;  1LO5 D;  1L0Y B;  5C4Z A;  3EFX D;  1A3U A;  3PUZ A;  4OO1 H;  1EY7 A;  2IX1 A;  4BBS B;  5E1F A;  1Y8O B;  2EYM A;  1I6H B;  4PQX A;  3AU7 A;  4A3J B;  1STE A;  1LTR D;  1SDF A;  3MZ5 A;  4DN4 M;  1G29 1;  4FXG C;  1UEA B;  1DD2 A;  3MVV A;  4V0B A;  1EY8 A;  1V43 A;  1R4P B;  3PUV A;  4C2M B;  4FF1 A;  5K5P A;  1BCP C;  5EGT A;  5EKI A;  1GUN A;  1MI2 A;  5D3I B;  3AB9 A;  4XYQ A;  3A56 A;  1STG A;  1CK1 A;  2MUY A;  4CKB A;  3SDZ A;  5M3F B;  2NVQ B;  3J80 E;  1HUN A;  2RDH A;  1LT5 D;  1EZ8 A;  1Q1E A;  3ITP A;  2EXZ A;  1HFG A;  3TP5 A;  5G3L F;  2YU9 B;  1A2T A;  1YNN D;  1F77 A;  4C3I B;  2NVX B;  1LT3 D;  5ELD A;  3FEW X;  2A68 D;  4C1N I;  3NTK A;  4A3F B;  4H7B A;  4A3B B;  3BDC A;  2JEB I;  2K33 A;  2AQ2 B;  3H94 A;  4K5V A;  3PO3 B;  3VA7 A;  3A7A B;  5IGF A;  5M5X B;  1Z7T A;  1WTW A;  2HCC A;  4IUQ A;  1BXT A;  1JWM D;  2Q8T A;  1IYV A;  1XYI A;  1I4H A;  4PV1 C;  1F2L A;  3UI2 A;  1BR9 A;  1CZG A;  1DCZ A;  2X69 A;  1STA A;  1MD2 D;  1JIC A;  4CJ2 C;  4X3K A;  1HFN A;  1BDO A;  2EY5 A;  4U68 A;  1TKW B;  1SYB A;  3S14 B;  5EBC A;  3VYU A;  2R6G A;  2AWN A;  1HPC A;  5ELC A;  2JA7 B;  3BYT B;  4GZY C;  1JB3 A;  1JOO A;  3K57 A;  4EQP A;  4M1U B;  1E2V A;  2EY1 A;  1CTM A;  1XWE A;  3HKZ B;  1TT2 A;  3BVM A;  3OOC A;  1ET9 A;  1SNO A;  4DAY A;  2KA7 A;  2PZW A;  1H9K A;  1B9N A;  1WTO A;  2D62 A;  3RUZ A;  4MN3 A;  5I6W A;  2EJM A;  2Z4I A;  2IWH A;  2LKV A;  2B2V C;  1PFM A;  2NTT A;  5KGU A;  2Q8I B;  3TP8 A;  2NZ1 D;  3J7A V;  2B2W C;  4FXK C;  2QCP X;  1K8M A;  5JJZ A;  1KLG D;  2F0G A;  3HOW B;  1EQT A;  4RH6 A;  2PO4 A;  1HA6 A;  1ENC A;  5IGB A;  1G2T A;  4UDU C;  3CU7 A;  3OIP A;  1WVL A;  1HUM A;  1O7Z A;  2VB2 X;  3M85 A;  5HUR A;  3H6M A;  2Z4H A;  3IKJ A;  5J22 A;  4ZKC B;  4B08 A;  2R61 A;  3N6R A;  4IFD I;  3VR4 A;  4OL7 A;  1J8I A;  3I8Z A;  2JA8 B;  3JAM L;  2C9O A;  2NN6 G;  3S15 B;  2F0I A;  2FIN B;  1Z47 A;  2IW3 A;  2WV6 D;  2E2H B;  5ELB A;  4XQN A;  4RHS A;  3I72 A;  2IJ0 A;  4HCE A;  1LAC A;  1SYG A;  4LMQ D;  3TBI B;  3D3R A;  1JOR A;  3MXG A;  1EIH A;  1SYF A;  2YYZ A;  1EYD A;  3L9A X;  3ERO A;  3R2I A;  3QOJ A;  3NQI A;  4CKC A;  2PZU A;  3RD4 A;  2B2V A;  4I65 A;  4BWG B;  2O4X A;  3NWT A;  4N9P A;  1S5E D;  1QB5 D;  3L7Z C;  1SNC A;  2K28 A;  1KAB A;  1LTT D;  3C2P A;  4XQQ A;  2B2W A;  2WAQ B;  1B3A A;  5AFW A;  1DOM A;  1PZK D;  4XXE A;  5E4W C;  3KF8 A;  4C56 C;  3HG9 A;  4C3I G;  1FGB D;  1TII D;  5D65 A;  1SJH D;  2O5J C;  1F2Z A;  3GD7 A;  1SMY C;  1STB A;  2L12 A;  3NHH A;  1CHQ D;  5BN3 A;  4R8I A;  2QEJ C;  4A93 B;  3MC0 B;  1Y8P B;  2F0E A;  2DNE A;  2PW5 A;  1EY6 A;  1ZXT A;  2LMC B;  2XIW A;  1ICW A;  2HDL A;  4RCN A;  3HOZ B;  4WFN 3;  1G91 A;  4A3K B;  1E2Z A;  3C46 A;  1I4G A;  3M7G A;  1AEX A;  1STH A;  1DJR D;  1PTO F;  4A3E B;  1H9S B;  4KTA A;  3QWN A;  3JAM E;  1WTP A;  5DNF A;  3GTK B;  1ET6 A;  1X3P A;  4NMZ A;  3A7L A;  2A69 C;  2F0Q A;  3EQL C;  1DXM A;  1Q8I A;  5F2D A;  2N55 A;  2ENB A;  1B4O A;  1S5F D;  1ZKO A;  5FO9 B;  3QOL A;  3S1R B;  1C4Q A;  2A73 B;  1B53 A;  2NVT B;  2L9H A;  5DAU A;  3NE5 B;  3J81 L;  1ESR A;  1QWY A;  4EVO A;  2EY6 A;  4BA1 I;  2L4N A;  2EJF C;  1TS5 A;  1CM9 A;  3A8J E;  2Z8L A;  4DA2 A;  3TP6 A;  3D4W A;  1A3T A;  3T56 B;  1WD0 A;  2J0T D;  2O2L D;  2JEA I;  2F0D A;  1PZJ D;  4DFA A;  4ZK9 B;  4C1N K;  5CV4 A;  2O5I C;  3T51 B;  4HR7 B;  1SFO B;  5FO8 B;  2PCF B;  4IUN A;  1SEB D;  1Q12 A;  2K5D A;  3HZX A;  4DK0 A;  3NK9 A;  1I3Q B;  2XWB B;  3TME A;  4MHE A;  1ROD A;  4KN4 C;  1ENA A;  1RCV D;  1L0X B;  4HED A;  4G7Z C;  2KED A;  2A68 C;  1LTS D;  1AZQ A;  2B39 A;  2QDB A;  5IOC A;  2E2I B;  3MXU A;  4QCL A;  1RD9 D;  3NXW A;  5E3F A;  3EJI A;  4P2C B;  1RDP D;  2AWO A;  1EQV A;  4RKL A;  3VYR A;  3GTG B;  4U67 3;  3OMG A;  4K8J A;  1T5E A;  4RHR A;  1EIG A;  2IT1 A;  1PRT B;  2NTS A;  5I9P A;  5CBA E;  2RDF A;  1ILQ A;  4DAV A;  3MWY W;  1AFP A;  1NSN S;  4FVM A;  1EWC A;  1H9S A;  4LAA A;  3KLS X;  4DXF A;  1BF4 A;  2JSO A;  2WP8 J;  2ICE C;  3PUX A;  2XRS D;  1SJE D;  5M9O A;  3ND9 A;  5I2X A;  1NAP A;  4C3J B;  4RWS C;  2MHV A;  2KHS A;  3J81 E;  5TSS A;  5G3L D;  4G4K A;  1NR4 A;  3OHX C;  1WTR A;  1K83 B;  1C8C A;  2D5D A;  3BDL A;  1A3V A;  4G57 A;  4N9T A;  5BN4 A;  2KJX A;  1EY5 A;  1GUT A;  3RLF A;  1I4X A;  4A3D B;  1SNP A;  2A6E D;  2FJ2 A;  3N52 A;  4XTC S;  4L63 B;  5C0X H;  1EYC A;  1SXT A;  3K0Y A;  1PMR A;  4K5W A;  2KQ3 A;  2LY7 A;  1TWC B;  3NQT A;  1KDC A;  1RJT A;  1Y69 U;  1IL8 A;  3TSS A;  5EJW A;  1R4Q B;  1GUW A;  3NWS A;  3P75 A;  5C44 B;  3DUZ A;  1BNZ A;  4JBW A;  4NKL A;  2LFN A;  4K8I A;  2BA0 A;  2GA4 B;  2XNA C;  5I6Y A;  5J39 A;  3RMH A;  5EQ0 A;  4DGZ A;  5JEA G;  1X32 A;  4WRD A;  2K01 A;  5IT9 L;  1JR0 D;  4A3I B;  4XT3 B;  2H4O A;  1PYW D;  2BDN A;  4IUV A;  4H0L C;  2F0P A;  4F88 A;  1A6X A;  1SE3 A;  3CKI B;  3V05 A;  1DOL A;  2MPM A;  3G6J B;  5JPM C;  1EZ6 A;  1H9J A;  4X3U A;  5C4X B;  2B2U A;  3MAQ A;  4XIG S;  1TWG B;  2R7Z B;  4I7Z C;  3DXJ C;  3RZD B;  4IQZ A;  4ZQ3 A;  1ML0 D;  5JEA H;  3PO2 B;  1IYU A;  3R2T A;  4K6L A;  2NN6 I;  4PMW A;  1XX8 A;  1MSH A;  5I9O A;  3DMU A;  2WII B;  5EPL A;  1VDZ A;  1TS3 A;  5FLX L;  1JQY D;  1STN A;  1JWU D;  1V8Q A;  1EU3 A;  1I6V C;  4OIK A;  2K1B A;  4HAE A;  4YIJ A;  3R8B A;  5CC4 A;  4K2L A;  2FFK B;  1E2W A;  3SE0 A;  5KRU A;  3K5O A;  5M5W B;  1X3Q A;  4Q0F A;  3X3M A;  2JE6 I;  1BQQ T;  2EYH A;  4RCO A;  1PRT D;  1GXD C;  3I4L A;  1SAP A;  4X3S A;  4MIU A;  3NBI A;  1HHV A;  3VR5 A;  5CV9 A;  2EYO A;  1Y1W B;  3D31 A;  1D1I A;  2F0V A;  2IPK D;  2OEO A;  2K5Q A;  2PYK A;  1K8O A;  1D2B A;  4CHT B;  1U9R A;  3D4D A;  2XVS A;  2G9D A;  4RKB A;  2K6A A;  3GP7 A;  2XWJ B;  2CVR A;  3BZD B;  4ZUJ A;  2F03 A;  4ABN A;  3K59 A;  5FO7 B;  4RAU C;  4ULL A;  1F2Y A;  4M8A A;  2V4D A;  2E74 C;  2BCO A;  3K7A B;  2L55 A;  4FF2 A;  2SEB D;  1Q1B A;  3FPU B;  3CQZ B;  3FKI B;  1RKN A;  2EDG A;  4C3J G;  1I4R A;  4B9W A;  5HGT A;  1DZ1 A;  4KKU A;  4K2K A;  2E2J B;  5A35 A;  2AQ3 B;  4DU9 A;  1EEF D;  2BDO A;  3I91 A;  3KBG A;  3HRZ C;  3BVG A;  2MGS A;  1PZI D;  4DAP A;  3AMU A;  1S5C D;  4IZ8 A;  1M8A A;  5CR3 A;  2KUM A;  3MXN A;  4A3G B;  2K5W A;  1M4V A;  2M2L A;  3W3A A;  1GJX A;  4FF3 A;  5J1Z A;  4DNR B;  2EOT A;  1OO9 B;  2LS0 1;  4LJZ C;  3S2D B;  1IW7 D;  3DEO A;  2SNM A;  4K5X A;  3HP3 A;  1QCB D;  1W6K A;  1TWF B;  2EJG C;  1CA5 A;  2N88 A;  1CHP D;  1V1O A;  2J4X A;  1SBB B;  5D14 A;  4XYO A;  4HSP A;  3RZO B;  1ZYR D;  3ZYY X;  2M9V A;  2Z1C A;  1B1Z A;  1CQV A;  1U4R A;  3HOV B;  1BO0 A;  4K6D A;  2BE5 D;  4BY1 B;  2DN8 A;  1JC7 A;  1TY2 A;  3I3C A;  1PDQ A;  3S2H B;  4RGM A;  3DWQ A;  4QF4 A;  3P1H A;  3U9O A;  1D5Z C;  3A8I E;  2EYP A;  3GTJ B;  5DM6 3;  3V96 A;  4UAI A;  1WCM B;  1JE4 A;  2F0F A;  1H9M A;  4KKT A;  2VUM B;  5C3W A;  5KND A;  1WD1 A;  2VNU D;  2IX0 A;  3QJY A;  3ERQ A;  2RVL A;  5T1I A;  4ZYS A;  1LT4 D;  5KNC A;  1JOK A;  5C6A A;  4QB4 A;  2QKI C;  5JPN C;  1BCP F;  5KNB A;  1FD7 D;  3T16 A;  3BG3 A;  3S1M B;  1STY A;  4OO1 I;  1F9R A;  4CGY B;  2KCN A;  1V1P B;  4Y7N B;  4BA2 I;  1J9O A;  3VYT A;  4HSV A;  1EYA A;  2CW0 D;  4PNY A;  2IL8 A;  4EQO A;  3GV6 A;  4FP5 D;  5IGG A;  3GTM B;  1GUO A;  2EYJ A;  4KY7 A;  1FNU A;  4O42 A;  3R93 A;  5EPJ A;  5LL6 S;  4DF7 A;  1S5B D;  4OHJ A;  1U4M A;  2A6E C;  5DEH A;  5M5Y B;  3Q22 A;  2L0C A;  1CZW A;  5DM7 3;  5LL6 X;  2F0S A;  2XN9 C;  4PMB A;  1S5D D;  3OWF A;  3SK6 A;  1LV9 A;  2B63 B;  3NBH A;  1Z6H A;  5CYU A;  2H1E A;  5KEE A;  3VR6 A;  1S4Z A;  2KCC A;  1B50 A;  4B9X A;  1TY0 A;  4RGT A;  4R8N A;  1ENF A;  1SYE A;  5EKK A;  1IHZ A;  2HDM A;  2IX3 A;  4BBR B;  2I07 B;  1Y8N B;  2VB3 X;  4X3T A;  1EEI D;  1R9T B;  2OT2 A;  4EGV A;  4IUT A;  1SSO A;  4QMG A;  3E5S A;  4QIW B;  1G8Z D;  5COY A;  4V19 0;  3Q6S A;  5CBE E;  4IFD G;  4BY7 B;  4HMI A;  2ID0 A;  2F0M A;  3EA6 A;  4RGO S;  4XDX A;  2PQE A;  4TQU S;  1EY9 A;  3DEP A;  3MEH A;  5M3M B;  4J1M A;  5FK9 C;  4ZKB B;  4WOR A;  3SK4 A;  3S1N B;  1SND A;  1B44 D;  3D6C A;  1SYD A;  5COR A;  2BOS A;  3VYS A;  2C5C A;  3J7Y W;  5CV6 A;  3H91 A;  3J7A F;  5FOB B;  4ILW A;  4TRD A;  4IFD H;  3WOF A;  1TWA B;  2SOB A;  3MHB A;  1ONL A;  1KAA A;  4IUU A;  4JK1 C;  2XRQ D;  4KKS A;  1GUG A;  2K7V A;  2F0J A;  2PZT A;  1NR2 A;  1QE6 A;  5NUC A;  2M00 A;  1PXU A;  3M4Y A;  4Z9C B;  1V1P A;  1QNK A;  3GTL B;  4KJN A;  4A3M B;  3OIQ A;  4HN7 A;  2EZV A;  1WTX A;  1UAP A;  1G6Z A;  3URY A;  2G9H D;  3FPP A;  2B2U C;  2TMP A;  5C0X G;  2TSS A;  1VF5 C;  3EVQ A;  4KY5 A;  2PPB C;  1HTP A;  1SNQ A;  1CFM A;  1PRT C;  5IGE A;  2KEC A;  1TR5 A;  3K58 A;  2R93 B;  3T4A C;  2A6H D;  5CV7 A;  4FXD A;  4H13 C;  3VR3 A;  1HQR D;  3I70 A;  3DHQ A;  3HOY B;  4XQJ A;  2DY8 A;  3Q0A A;  3X3N A;  5ISR A;  1EY4 A;  2RA4 A;  4KD3 A;  4S3S A;  3FMC A;  1PFB A;  2RSO A;  1QNU A;  3HS0 C;  4IAL A;  3PIO 3;  1YNJ D;  1RF2 D;  2EYF A;  3GTP B;  1Y1V B;  3M4O B;  3TZU A;  1AP0 A;  1OXT A;  4ZAI A;  5LHY 1;  3DM1 A;  4L6T B;  3TZD A;  1EWH A;  4OIJ A;  2MJ8 A;  4KHZ A;  3PMF A;  3SXH A;  3I90 A;  3TDQ A;  2ZXO A;  1I50 B;  4KY6 A;  3H3V C;  3C1F A;  1QIL A;  1FYC A;  1BCP B;  3Q23 A;  4DNT B;  2F0T A;  1Q3L A;  3M3Y B;  1JOQ A;  1B2T A;  1AZP A;  2EE1 A;  4RA8 A;  5IGC A;  2NVY B;  3OMC A;  5IOD A;  1HA5 A;  2OF1 A;  2K04 A;  1PTO B;  5CMD A;  4FO2 A;  3T13 A;  4K14 A;  1DOK A;  4IUP A;  4L8J A;  1OXS C;  2FMM A;  3LX0 A;  1OXX K;  3P20 A;  3WOE A;  3K6O A;  5I4D A;  1KTK A;  3WDN A;  5I2Y A;  3IL8 A;  5JEA J;  1II3 A;  3M7N A;  2B8G A;  1PTO C;  1HTL D;  3CRL C;  3ONA B;  4Q5V A;  5ELF A;  4G7O C;  1IW7 C;  2BA1 A;  1A15 A;  1DON A;  2Y0S B;  2A74 C;  1I4P A;  2EVB A;  1MGS A;  3K5M A;  1O7L A;  3GTO B;  1SE4 A;  1ZYR C;  2SNS A;  1E0B A;  5D3D A;  1LTB D;  4DK1 A;  4PMC A;  2BE5 C;  4KD4 A;  1HCZ A;  3SR1 A;  3LWE A;  3NUC A;  5KIX A;  1FR3 A;  2QF7 A;  1D1K A;  1RTN A;  3IAY A;  4J8Q A;  2F0W A;  2JA5 B;  3HOX B;  5E4X A;  2B2T C;  3D8G A;  1HQM C;  1D5X C;  2EY2 A;  3E6Z X;  1UUP A;  1ZEQ X;  5CGK A;  4J6H A;  2L1B A;  1TWH B;  3KBX A;  3QO2 A;  3MXP A;  5IT9 E;  3IFD A;  3QG1 A;  2WAC A;  3MFG A;  4KHV A;  2JYO A;  4O1N A;  3SHL A;  1OXV A;  4CJ0 B;  2JP1 A;  1DM0 B;  1AW7 A;  4QUF A;  2EPB A;  3GO5 A;  2CW0 C;  1EFI D;  3A8K E;  3O13 A;  4KMU C;  4H44 C;  4WJW A;  5JOB A;  3PIP 3;  5ELE A;  4NW2 A;  2R92 B;  3E0J A;  3SVM A;  5A2Q L;  1ESF A;  3LNN A;  1LT6 D;  2FHT A;  4C3H B;  1IKM A;  2FMC A;  5FLX E;  3OPO A;  2EYL A;  2F3V A;  1LLR D;  2F0K A;  4FF4 A;  1MSG A;  1O7Y A;  1CQF A;  4KN7 C;  2E76 C;  1RHP A;  2F0O A;  1HRJ A;  4E6I A;  5K36 G;  2HCI A;  4CKE A;  1BCP D;  4ODG A;  1CI3 M;  1PRT F;  1U4P A;  1QG7 A;  2HUG A;  2B2Y C;  2VXW A;  1EOT A;  5JAV A;  2I46 A;  3V2T A;  2B2T A;  1PTO D;  3MFY A;  1FNV A;  2AQ1 B;  2CQA A;  1NCV A;  3L3O C;  3PUW A;  2WKC A;  3SEB A;  3D4R A;  5K36 H;  1SE2 A;  4TKO B;  1VF7 A;  1RTO A;  3GTQ B;  3LWU A;  1TS2 A;  4QUC A;  2QIL A;  1CA6 A;  1MBY A;  1WTQ A;  1KNA A;  4FNF A;  3KK7 A;  2SDF A;  1KDA A;  4TSS A;  1VMP A;  3H09 A;  3W2D A;  2NWG A;  1GHK A;  3OSO A;  3G7L A;  1TQO A;  4IUR A;  1FNW A;  2B8F A;  2K03 A;  5EBD A;  4KI0 A;  3KLR A;  1CT1 D;  1QJO A;  2ZT9 C;  3NP8 A;  2MP1 A;  3NTI A;  1KDB A;  3TN2 A;  3FVQ A;  3FDT A;  3S17 B;  2NN6 H;  4RFB A;  1O80 A;  3NSW A;  5A2Q E;  1I4Q A;  1SNM A;  2K32 A;  4F8M A;  4KJO A;  4LK1 C;  1AN8 A;  3R3O A;  3I4N B;  1LTG D;  5KYL A;  5C3E B;  2F0H A;  5C0X I;  3C3L A;  2F1M A;  2NBF A;  2AUJ D;  1EU4 A;  2A6H C;  3HEJ A;  1PTO H;  2RSN A;  1HXY D;  4NDX A;  1TS4 A;  2PW7 A;  3VR2 A;  3I4M B;  1QOH A;  1BUV T;  3FRP B;  3MA2 B;  3HOU B;  3D6W A;  1BOS A;  2X6G A;  4RGN A;  5CV5 A;  3KUP A;  2DNC A;  5IGD A;  2B2Y A;  4FYD A;  3KLS A;  3H0G B;  3P7J A;  4F7X A;  1KLU D;  1JWS D;  2RQX A;  3BS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...