3SK6A

Crystal structure of staphylococcal nuclease variant delta+nviagla v23k/l36e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTKKLMYKGQPMVFRELLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+NVIAGLA V23K/L36E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk6A00
4PMCA 2RDFA 3T13A 5CC4A 5HURA 3NQTA 3TMEA 2F0SA 1A3VA 1EY5A 4DF7A 4NDXA 4DU9A 4WORA 3SK6A 2F0DA 5E1FA 1AEXA 4K6DA 4F7XA 4F8MA 4IUNA 5I9PA 2PYKA 3HZXA 2EYHA 3OWFA 5DAUA 1STNA 3MEHA 4RKLA 5C3XA 5JAVA 2KHSA 5EGTA 4OL7A 4RKBA 1JOOA 3T16A 5KEEA 5KYIA 1EY4A 1SYBA 4ODGA 3S9WA 3EROA 4NP5A 2EXZA 2EYFA 4B9WA 2ENBA 1TQOA 2F0VA 4LAAA 4EQPA 3DMUA 3HEJA 2F0FA 1F2YA 2KQ3A 1SYFA 2EYPA 3D6CA 4IZ8A 5HGTA 3TP5A 3C1EA 5C5LA 2O4XA 3D8GA 4J1MA 4N9PA 5M9OA 3NXWA 4MIUA 1JOKA 4H7BA 1STAA 5JOBA 1EY0A 2EY1A 2F0QA 1ENCA 5J1ZA 1U9RA 3NK9A 3SK5A 2RKSA 2SOBA 1SNOA 2HQEA 4K5VA 5EKLA 4KY7A 5IGEA 3DHQA 4S3SA 4HTHA 2EYLA 3NUCA 5DEHA 2EY2A 3P1HA 2F0NA 1EZ8A 2M00A 5IGBA 4KHVA 3OSOA 2QDBA 4R8NA 3SHLA 5EKKA 3NHHA 1NSNS 2F0GA 3P75A 4PNYA 2WACA 4TRDA 4YIJA 3SK4A 3MXPA 4DGZA 5CGKA 4I65A 4EQOA 5CV6A 5KRUA 1EYAA 5K5PA 3NP8A 5KIXA 4KD4A 2F0EA 1KDAA 2F0MA 1EY6A 3TP7A 2OF1A 4EVOA 4QMGA 4HMIA 3SXHA 2F0UA 3BDLA 3U9OA 5IGDA 5CV8A 1A2UA 1A3UA 1STYA 4ID6A 4K2LA 5CR3A 2SNSA 1SYDA 1KDBA 4NKLA 4ZUIA 2F0LA 3QOLA 3ITPA 5C5MA 5KGUA 5ISRA 5J22A 4KD3A 4ZUJA 2F0JA 4ME5A 4NMZA 2EY5A 3PMFA 4HMJA 1EYDA 4KV6A 1IHZA 4ZQ3A 1SNDA 3MHBA 4K8IA 5CV9A 4DFAA 5CV4A 1SNMA 2F3WA 4WRDA 4B9XA 5I6YA 1A2TA 2NUCA 1KDCA 5I9OA 4G57A 5IIFA 3SR1A 1STBA 2OEOA 2OXPA 4E6IA 3LX0A 4K2KA 3R3OA 2PW5A 2PQEA 1TR5A 2F0TA 5NUCA 3MVVA 4KJOA 2PW7A 3TP8A 1SNCA 4QB4A 3EVQA 5F2DA 4KY5A 2EY6A 1KABA 4KY6A 3TP6A 5C4HA 2EYOA 3EJIA 2PZUA 3SK8A 3QOJA 5C6AA 2F3VA 2F0HA 2F0PA 4K5XA 3H6MA 5E3FA 4EQNA 2F0OA 1EYCA 2F0IA 4QF4A 5IOCA 4K5WA 2PZTA 2LKVA 3D4DA 1F2ZA 1EY7A 1ENAA 3C1FA 3OMCA 4IALA 4J6HA 3RUZA 5J39A 3ERQA 5C4ZA 2EYMA 5IODA 2PZWA 3BDCA 3MZ5A 5CV7A 3E5SA 1STGA 3V2TA 3OMGA 5KYLA 5I6WA 2RBMA 5IGFA 1EZ6A 3D4WA 3VA5A 2EYJA 1A3TA 1EY9A 5IGGA 1F2MA 1NUCA 1SYCA 1SNPA 4KTAA 5CV5A 4K14A 1JOQA 1EY8A 1RKNA 1II3A 2F0KA 3QB3A 1SYEA 2F0WA 4N9TA 5C3WA 1SYGA 2SNMA 1EQVA 5IGCA 4KJNA 1TT2A 4PMBA 4K8JA 1STHA 1SNQA 1JORA 1KAAA
chains in the Genus database with same CATH superfamily
1L1OA 1F9SA 1I6HH 2ICIA 2NVTB 4KN7C 5IT9L 4JPBW 4ZKCB 4GS3A 2F0DA 2AWNA 2CWAA 4CDCC 1KIXA 5IP7G 1D5XC 1AEXA 1LT4D 3RLOA 2HUGA 4NW2A 3F2DA 5IWAL 2K50A 2D62A 2CVRA 5IYDH 3STBC 1NJIC 4LF5L 5IP9G 2Q8TA 4DR3L 4DV0L 3D6WA 4ODGA 3S9WA 1PRTB 4L5SA 1A0IA 1DJRD 1FD7D 2TMPA 4ILWA 3I73A 3L2PA 5M5YH 4DV4Q 5EQ0A 2IT1A 5J1ZA 3GV3A 2ZJRA 1SNOA 5EKLA 1HFNA 1AP0A 4A3EG 4J15A 1VQ8A 3J7AF 4GOPC 1XMQQ 1CKNB 2PI2A 3HOXB 1GOZA 3PQIA 1EYAA 4ME3A 5JEAH 2KCCA 1LABA 1XPUA 3TDQA 2UUCL 2J0TD 1YJWA 4A3BB 1MSHA 4R4CA 3PO2G 3AFQA 3J81E 4LFAL 3CRLC 5IT9E 2CH4A 1HNWQ 2D0PA 4JI3Q 4A3DB 3EN2A 4KD3A 5J22A 5FLXL 5GQOA 3GD7A 1KAWA 1EYDA 3DWQA 1EEID 5FO7B 1X6OA 4B9XA 1HFGA 1QWYA 5IIFA 3SR1A 2OXPA 3QO2A 3HOYB 3S1QB 4YHHQ 3IFDA 4R9WA 3MC0B 4LUVA 3CKIB 4DK0A 1G2TA 1GKHA 1JE4A 2PZUA 1RHPA 2F0PA 3M7NA 2FJ2A 1EYCA 2XVSA 1VQAA 2AQ2B 1ENAA 3GDEA 2VY3A 2DJGC 3E9HA 4CHTB 4OIJA 2MJ8A 1YVCA 2LS01 4JI8L 3STBD 4C56C 5KNCA 3S1MH 5IWAQ 3T1YQ 3PO3B 2JSOA 2Y0SB 1PTOH 2QGQA 4JI2L 1O78A 1B2TA 1UEAB 3FP9A 4JI7L 1EY8A 2F0KA 4A75A 2VQFQ 4DR6L 4BBSH 2O2LD 2YU9H 1N33L 2EXDA 2MUYA 3KBXA 5JJIA 2ZM6Q 1UEBA 5KNDA 1X9NA 2B3GA 3F1ZA 4LF7L 4KI0A 4DXGA 1HQMC 3DEOA 3K7AB 4GN3B 2J4XA 5EGTA 4X65L 1ICWA 4A3KB 1EY4A 1J9OA 1VS0A 1STEA 3VR6A 3D6CA 4ZLTF 1RDPD 5EBDA 2O4XA 4TQUS 4LF6Q 1BBUA 4K5VA 5DEHA 4JK1C 1JWMD 3OSOA 2GVBA 1QVCA 2DNEA 4I65A 1N32L 2KCTA 3ND8A 1P8LA 2K1BA 1ET9A 1XX8A 4FXKC 4EVOA 1UNSA 2WV6D 4IPDA 1ICFB 2PPBC 2JA7B 4X66L 2IJ0A 4XQQA 2F0LA 4A3LH 3U50C 1PTOD 1W2BA 2NVXH 4HMJA 3T51B 1IL8A 3GTJB 2KCMA 2H5XA 1SNDA 1NR2A 4TKOB 2ZTEA 3R8BA 4A3MB 5I6YA 1LTBD 2NUCA 3IFTA 4IUVA 4G57A 4X64L 1SMYC 3LX0A 5DLQE 3PIPA 2LXKA 1R4PB 1SRUA 3D4RA 1SFOB 1SMXA 4UP8A 3VYSA 2JA8B 4G7HC 1TS3A 4KY6A 3PUYA 3TP6A 2HHHL 4Y52H 2DN8A 5C6AA 1Q8KA 3CQZB 1AFPA 5KNBA 4HCEA 2PI2E 4X3SA 4K5WA 4YY3Q 3I4MG 3RUZA 2VZAA 3C1FA 4J6HA 2N49A 4HJAA 3S2HH 3V2TA 1D1KA 3RZDH 2DNCA 1E1OA 1Y1WB 2I5HA 4DR5L 2JN4A 1A6XA 1EFID 2AUJD 4YY3L 4C3JH 1CZWA 3J7A5 2EDGA 1F9PA 1STHA 2K32A 1W6KA 4IJLA 5HY6A 4B3TQ 3ULPA 1TWCH 1CSQA 2LY7A 1L0WA 3HOVG 1A62A 2A6EC 2CQOA 3HKZG 2F52A 3I4NG 2E2JB 3J80c 1GHKA 3K81C 4LF5Q 1LM0A 1ZXTA 3G4SA 4DV7L 5FLMH 2L4NA 1WTVA 1H9SA 2EJFC 1TWGB 4Q0FA 3K5LA 4NP5A 4R4IA 3DLLA 4JV5L 1TKWB 1K9MC 2F0VA 1HA5A 1VQ7A 1Y1VB 2IHEA 1U4MA 5I2XA 4DV4L 1WTQA 1PRTC 1KTKA 3E6ZX 2A6HD 3TSSA 4JC0A 2KOLA 1ZKOA 2TSSA 4GOPB 2NTTA 3E9IA 3KYHC 3NK9A 2SOBA 2HQEA 1H95A 4S3SA 2KEDA 4JI2Q 1N36L 1KLGD 2F0NA 2M00A 1GXDC 3SHLA 3QWNA 1VQMA 1JJCB 2DY8A 2R7ZB 3CCSA 2QA4A 1TWAH 3W1BA 2JA9A 3MXGA 2ES2A 3P7JA 3A56A 2JXMB 1EIYB 3GTPH 1WTPA 1I50B 2QKIC 1B70B 1WCMH 2UUBQ 5C0XI 1D2BA 4YWLA 4NKLA 5KGUA 2QCPX 3UE0A 4P72A 4QUFA 3J81L 1PHJA 1HPCA 2F0JA 2E2HH 1S5ED 1U0LA 1JJGA 1SNMA 3RD4A 3VA7A 2NTSA 2FXQA 3ERSX 2WFWA 2HDLA 3R3OA 4DR6Q 3EFXD 3CPFA 3ULJA 1FJGL 2K5NA 1KRSA 2PW7A 4MTKA 4A3IB 1JJ2A 4J8QA 1KABA 2ATWA 2DUDA 2VUMG 1E3PA 1SBBB 5J39A 2K14A 3J81i 4DV3Q 3ERQA 5IODA 1RIPA 5JVG3 1O7LA 3D4WA 1PRTF 1L2FA 3AU7A 1AN8A 5BN5A 1CKMA 1S4ZA 2B2VA 3HOXH 4A3EH 1EQTA 5D65A 2L55A 3K5NA 1KC8C 1LTTD 1UE7A 1CI3M 5C3XA 3MEHA 3CPWA 2EPBA 1M8AA 1KXLA 4V0BA 4H02A 1TU2B 5FKAC 3NBHA 1VQIA 4UP9A 4LF9L 4WJ3M 1PH3A 1G51A 3Q23A 3AB9A 3CW2C 2R92G 1IZ6A 1XNRL 1IBKQ 5JOBA 2XGTA 2A69C 4BY7G 4L6TB 2A6HC 1N32Q 4PNYA 2WACA 4DGZA 1Z47A 1XMOL 1PH2A 5C4XB 1DONA 1A63A 1TXYA 4OO1G 5ELEA 2OTLA 5C3EH 5CV8A 1PFMA 3BVZA 1A3UA 3KUPA 4UHVA 1AW7A 1HCZA 3RR5A 5C0XH 3UDFA 4B3SL 1G6PA 1Y8NB 2V1CC 3GTGB 4FF4A 4HEDA 1PTOB 4LWCA 3BYYB 1WTHA 1VCIA 4A3GH 4BWGB 5I9OA 1K3RA 4IFDI 2IX3A 2ID0A 2JA5H 4QIWE 3HRZC 4BBRB 5C44B 2A1AA 3A8JE 5NUCA 3FDTA 4LUZA 5HGQA 4JI1L 2XWJB 3T1HL 5F2DA 4Y7NH 1LLRD 3M3YH 2NYZD 5C4HA 1QNUA 1QOHA 2E2DC 4JOIA 2LKVA 3D4DA 3NTHA 4G7OC 3BDCA 4MN3A 3OMGA 3T1YL 4RGMA 2UU9Q 3HOZH 4KLKA 2VUMB 1JR0D 4TVAB 2PMZE 1VQHA 2ALYB 2UXCQ 2EYJA 2K75A 2K6AA 1B1ZA 1JOQA 4K14A 2B2VC 1MGSA 1SMYD 5M3MH 2CW0D 2JA5G 2UU9L 4C3HH 4A93B 3T13A 1OXSC 2PCFB 5J3BA 1O7YA 4JI0Q 3I55A 3KOJA 5BN3A 4RH6A 1EQRA 3RLFA 2EZVA 4A3CG 1VQGA 4X65Q 4P75A 4HJ7A 5I9PA 1B9NA 3HOWG 4RKLA 3QJYA 3E0JA 2KHSA 5KYIA 1GUGA 5C3EG 2UUBL 1M4VA 5EPKA 5LHY1 2NVTH 2XSCA 4DK3C 2NVXB 1G291 1IXRA 3DMUA 2WKCA 4A3MH 1BCPC 1K8OA 2AWOA 1X32A 5EAYA 1WTOA 1YITA 1YZ6A 1SE3A 3PUWA 1WD0A 5JEAJ 1CUKA 1N36Q 1F77A 1X54A 4KY7A 4XYOA 2EYLA 1EFWA 2BH8A 2FMCA 3DWAA 1TS2A 3I4LA 3T53B 1HZBA 1Y8PB 2B63G 1I4XA 1JB3A 4MTNA 4ZYSA 1OXUA 3NTKA 2F0UA 2Z0SA 5CR3A 2SNSA 3I72A 1N34L 1KDBA 3FKIH 3HFZB 3OTOQ 1D7QA 4R1JA 1B3QA 1EYGA 2WINB 1AH9A 2WKDA 2AQ1B 4A3BH 1TVXA 4C3JB 4IPCA 2EJGC 2AQ3B 1V9PA 5IT9c 1U4PA 2C5CA 5JPMC 1P16A 2PW5A 4KKTA 2F4VQ 4QIWB 1XNQQ 4MNOA 3J7AV 3TP8A 4QB4A 1LYLA 4O2DA 1JE5A 4FF2A 1XMQL 1XTDA 4POGA 3SGIA 1O7ZA 2CQAA 3U58A 3JAML 2HDMA 1PZID 3S1QH 1VQLA 5JJKA 5JPNC 4HJ5A 1U4LA 3H91A 3CHBD 2G9DA 4L5QA 4NXNQ 3KLSA 4XQJA 1K73C 5IGFA 5A2QE 3I2ZA 3KDFB 2L1BA 2L0CA 1HTPA 3PSIA 5I2YA 5IP7H 1VQOA 1PH1A 3M4OH 3JAME 4OGQC 2F0WA 2GN5A 2UXBL 3A5ZB 5C3WA 1E2WA 3BDOA 2EVBA 5M3FB 1MJCA 2CW0C 2P5ZX 4R8IA 4OONA 4IUPA 4X3KA 3GTLB 1WYDA 3LWUA 2KHJA 3SK6A 1ET6A 1QNKA 1V1PA 1I94L 4RWSC 3KF6A 1VF5C 2F1MA 1WCMB 2VW9A 2IX1A 3A55A 1JQYD 1VMCA 2K5VA 2YU9B 3SVMA 2K5WA 1DCZA 1WCMG 4DR4Q 5EPJA 4GKJQ 1Q1BA 1CHPD 3EROA 1X3EA 3TEHB 1TQOA 3CRKC 1E24A 4WJ4A 2KQ3A 2UXDL 3K7AH 1Q3LA 5AJ3Q 4RCNA 4A3FH 1TS4A 2V4DA 2XTIA 3MXNB 4LJZC 3TBIB 3U4VA 4HIDA 2QDBA 4JI6L 3MXPA 4AIMA 2JA6G 4A3IG 1O7IA 4OX9L 4LF6L 2MO1A 3OHXC 4DKAC 2I5LX 4ID6A 4IOAA 1IBML 2VB2X 1PRTD 1WOCA 3RLNA 3MHBA 4K8IA 2B2YC 4X3UA 1QCBD 4BXXG 1J5EQ 1VQDA 4JOIC 2E76C 1D8LA 3H0GH 2Z4IA 2GVAA 3AMUA 3GTQH 1DOKA 3A8IE 1AZQA 2Z6BA 4AYBG 5DM73 5ELDA 3MVVA 1ASYA 2A6ED 2A69D 2NBFA 1SE2A 4B3RQ 1HR0Q 3SEBA 3T1HQ 3PIOA 3NTIA 3DUZA 2F0IA 2JJQA 1GUNA 4GZYC 5D3IB 2JA6H 1I4HA 4OWTB 2UXCL 1UWVA 3G7LA 4UDUC 3WOFA 4B3TL 2I46A 4LFAQ 3N52A 4YCWA 4HSPA 1SYCA 1SNPA 4KTAA 4A3FG 1IW7D 1PYBA 5IYCH 4AH6A 1JORA 2RF4A 1KAAA 1Y1WH 3G6JB 4K0KL 4GLAC 4LFBQ 4NPSA 1ESRA 2E2IH 2YTXA 4X6AH 4ULLA 4F8MA 4DR3Q 2C35B 1HJPA 3BG3A 1LT5D 3AQQA 5DAUA 4C1NI 1Q86C 1BCPB 2L5TA 1TWCB 2WIIB 3HKSA 2DJFC 4EQPA 4POFA 3HEJA 4ZCKA 4DV0Q 4IFDJ 5HGTA 1PTOC 5C4XG 2HHHQ 3C46A 1XPRA 3NXWA 1EOVA 4H7BA 1QZHA 1NAPA 4IN3A 3CXCA 3O13A 2NN6G 1TWGH 4DXFA 3KLRA 1JB7A 3GTOH 1CM9A 4Y7NB 4YIJA 3GTMB 4CJ2C 1N9WA 4CDDC 2ZXOA 3LNNA 3GQBA 2B39A 3B6YA 3QR8A 4OX9Q 1AZPA 3KJPA 2SEBD 4XT3B 3Q8DA 1SAPA 5GAGC 4RG1A 4ME5A 2EY5A 1RODA 3GTPB 5CV9A 4QQBX 4WRDA 4JBWA 1CQVA 2IX0A 5M3MB 1D1IA 1Z7TA 4I7ZC 4A93H 4C3HB 1MBYA 4QCLA 2H1EA 2B2WC 4FF1A 4BA1I 1YJNA 2E2HB 2B8FA 2KA7A 2R7FA 1I4QA 4BY1G 1AE3A 4XDXA 4X62L 1NE3A 3D0FA 1S5FD 1BCPF 5M3FG 2WAQE 4Q5VA 3OMCA 1WFQA 4B3MQ 2B63H 5IP9H 3MZ5A 5G3LF 5KYLA 2Y0SE 5I6WA 1VQ4A 5FJ8H 1XPOA 2RBMA 2IWHA 2UXDQ 5EBCA 4JI8Q 2VQFL 1GJXA 3NELA 2ZTDA 3NWTA 2RSNA 3TRZA 4N9TA 2R93B 1QE6A 1EQVA 1WI5A 5IGCA 1RJTA 1R9TB 4B3SQ 1D6EC 1LTID 4JVZA 2R92B 1TWFH 1ESFA 3EQLC 2EOTA 2K05A 2XRQD 4DU9A 3W1GA 1CA6A 1GUTA 3DM1A 3K58A 2A19A 4LFBL 1TY2A 2X6LA 4R4TA 1M1KC 4EQ5A 1IBKL 1CSPA 2K04A 1DZ1A 3H09A 4JI5L 3FKIB 4AYBE 4A3EB 4YWMA 4B08A 2ENBA 2E8GA 1O80A 1VQBA 4C2MB 4XT1B 3UDXA 2EYPA 2VL6A 5C5LA 3ICEA 5C0XG 4UAIA 1HNZQ 1E1TA 2BCOA 4CKBA 1QVGA 3HOZG 5M5WB 1JMCA 1LV9A 1NCVA 3U9SA 4C3IH 4OWWB 4B3RL 1CZGA 1PH7A 1VQCA 3Q22A 3S17H 1PVOA 2NN6H 3WOEA 3A5UA 1XYIA 2QEJC 1STYA 2B2UA 2NWGA 4LF8Q 2EQSA 5C4XH 3PMFA 4DPGA 4BY1H 1YNNC 2E74C 2RVLA 5L37A 3M4OB 5ELFA 2QDLA 5C3EB 1PFNA 5M3FH 2MFIA 1IW7C 1OO9B 2OTJA 1YIJA 3GTGH 3GTLH 3WWVA 4LF9Q 1WD1A 1NMFA 3MTSA 4KJOA 2PNHA 1EU4A 4P74A 3EVQA 4ZK9B 1CKOA 4GLVB 4CDEC 2JA5B 1MKHA 2EJMA 3S1RB 5IYCG 2HQLA 4KK7A 3I90A 2R93G 4U673 3K5OA 1EY7A 2OQ0A 3NBIA 5C4ZA 3I3CA 5LL6S 4HIKA 2BE5C 1GHJA 2MGSA 3M3YB 2MPMA 2NZHA 1E2ZA 3PF5A 1SSOA 1E0BA 2BE5D 1J5EL 2ZXRA 4FF3A 1T5EA 2G5DA 2KBNA 3K8AA 3PV0A 3H3VI 1NNXA 1C9OA 2LFNA 5D3DA 2R7ZG 4PMBA 1YHQA 5IE8A 4K8JA 2NZOA 4RFBA 1WVLA 2RDFA 3HOZB 3FMCA 2VUMH 3HOUB 3CU7A 4ZRZA 5A35A 4WJWA 2RA4A 1VQKA 2YYZA 1H9JA 3JAMi 3OWFA 3IKJA 4RKBA 5KEEA 3HG9A 1VQNA 2QW7A 4QJFA 4IUUA 4AYBB 1IKMA 4MZ9A 5FK9C 2ASBA 5BR8L 5E4WC 2IPKD 3F8TA 3F2CA 5M9OA 2K01A 4IJHA 1STAA 3H0GB 1EY0A 1K83B 1JICA 3DEPA 2K5HA 2NVQH 1EIHA 1B44D 5FLXc 1NMGA 4C1NK 5EJWA 4TRDA 4IFDG 2I07B 1G2SA 4FXGC 3G71A 2NVYH 1C48A 2K4KA 3MWYW 2F0MA 1QZGA 3KDFA 5ELBA 1PH6A 4FXDA 2XN9C 4A3KG 4DAYA 1SYDA 4KHPL 1LTSD 4LF4Q 3QOLA 2CCZA 3I7FA 4JI7Q 1K8GA 3V05A 4ZQ3A 2KHIA 3HOVH 1KQSA 3VR5A 1BF4A 4GOPA 1JCKB 1Q12A 2K7VA 4JI6Q 2RCFA 5JJZA 1KL9A 4K2KA 4DR2L 5FLMG 2MQHA 1VDZA 1GO3E 4C3JG 2F0TA 2BA1A 2K33A 1DOMA 4HIOA 3RMHA 4KY5A 4GNXC 1KRTA 1B9MA 3K5MA 2B2WA 3QOJA 3PCOB 2Z6KA 1H9KA 5DM63 2PZTA 3R2TA 4HSVA 2UUCQ 5EPLA 4CBVA 2MHVA 4L5TA 1JWSD 2XWBB 3HOUG 5LMNL 3VR2A 2CFMA 1CK1A 2K52A 1E7ZA 1S5BD 1YBYA 3TS0A 1N34Q 1LTRD 1Y1VG 5IGGA 3Q0AA 2Q8RE 4AQYQ 4H13C 5CV5A 3MFYA 4UY8C 3VDYA 4C3IG 3LWEA 4DR7L 1HR0L 1IL2A 3GTMH 2RQXA 3Q24A 4JYAL 4QY7A 4YHHL 5E1FA 4AQYL 1QUQA 4KKUA 1PZKD 4NXMQ 3K57A 3H3VH 2MO0A 1FYCA 2NZ1D 3C3LA 4OL7A 4PZ7A 3D3RA 3M7GA 3PO2B 3C2PA 4BBSG 1CFMA 1XNQL 2K03A 2KVMA 4M8AA 4QUCA 5COYA 5C4JB 4EX5A 3TREA 1WJJA 2F0QA 1A8VA 5LMUL 4IURA 4O0AA 1W3SA 1C0AA 1DD2A 1B8AA 5EKKA 3S2DB 1I4PA 3SK4A 3PF4A 1GUSA 1QUQB 2JEBI 1N33Q 3J7YW 4A3FB 4DV6Q 4APVA 1EY6A 4K6LA 1TY0A 2DY7A 3NQIA 1G6ZA 3T56B 2RCNA 3ONAB 4ABNA 4K2LA 3BZKA 1DOLA 1LUZA 1LT3D 1I3QH 4ZUJA 4ZAIA 1F9RA 3GTKH 1EOTA 3RZOB 5CV4A 2N88A 2R93H 2K28A 1YHBA 3S1NB 1R9TH 2BH2A 3FPUB 4DNIA 4R4OA 1RF2D 1TWFB 3I4NB 1MHWC 3HKZB 1VQ6A 1L1OB 1SNCA 2B8GA 3VYRA 4A3LG 3I8ZA 5JEAG 2R3ZA 4OO1I 1Z6HA 1F9QA 1JWUD 3BYTB 4IPHA 1S5DD 4DV1Q 4GKKL 4B3ML 4QF4A 3GTQB 2E5LQ 1VMPA 4DNTB 4JYAQ 4FDBA 3M4QA 4RGTA 2PQAA 1Y14B 1X3GA 1BBWA 4GN4B 5BR8Q 4RMFA 1NUCA 2JYOA 2E5LL 4DV6L 4DN4M 3MXNA 2B29A 1EQQA 3J80i 2JA6B 2BDOA 5M5WH 1PFSA 5CC4A 3BJUA 1CA5A 3NQTA 2F0SA 2N78A 3TZDA 1C4QA 2YV5A 2F4VL 1KNAA 2OWOA 2PYKA 2Z9HA 3U4ZA 4NXML 4DR1Q 4A3CH 1EIFA 3OYYA 5E4XA 2HIVA 4BY1B 4DV2Q 2E2IB 4LAAA 5CBEE 3PUZA 2RDHA 3GO5A 4TSSA 3RNUA 1F2LA 4J1MA 5M3MG 2VS1A 1IBLL 2RHSB 1AE2A 1YEZA 4JV5Q 1NTGA 2OCEA 4JW0A 4PZ8A 2Q8IB 5AFWA 4N8X1 4DAYB 5K5PA 2K5DA 2AKWB 4N8FA 1WTRA 5GROA 4QMGA 3PGZA 3MXUA 3QG1A 3GTOB 2PNRC 5IYDG 4ZUIA 3CCMA 1Q90A 4JBKA 3J81j 1TIID 3LGJA 4DK6C 4NMZA 1K0SA 1ENFA 2VQEQ 1R4QB 3W5OA 3Q6SA 3OTOL 5CORA 1U5KA 1PH4A 4UP7A 3HOWB 1W6JA 4IUTA 4HJ9A 3X3MA 1C7YA 2A8VA 2VQEL 1EIGA 3A7AB 1NBWA 3J81c 1KNEA 4FVMA 4IUQA 1XNRQ 1HZ9A 4FO2A 4LK1C 3S16B 4K5XA 1SDFA 2F0OA 1YNXA 4CGYB 1C8CA 5T1IA 3IRBA 1FR3A 1HNZL 1EWIA 2HIXA 3HGBA 3S14B 3E5SA 1K28A 3WDNA 2N3SA 4RHRA 3J7ZC 2WB1G 1Q82C 1DGSA 3VA5A 1IKLA 4OO1H 4BY7H 4JI1Q 2PMZB 2ZT9C 3KF6B 5JVH3 5GAHC 1SYEA 1Q46A 3DWPA 4U68A 2NVQB 2B63B 2ZM6L 1M90C 1HZAA 4DK1A 2HT1A 1RTNA 1CTMA 2MP1A 2NVYB 5IYBH 5CBAE 3M85A 2SDFA 2HD3A 4F7XA 2NN6I 5C44G 3HZXA 2EYHA 4M1UB 1A15A 3TQYA 2VXWA 2R92H 1D5MC 3A74A 3PIP3 1CQFA 4B9WA 2M9VA 4O1NA 3UDGA 1SYFA 3TP5A 3C1EA 1B4OA 1BQQT 1MSGA 4X3TA 3S15H 3D8GA 4A3DG 1FGBD 5T1GA 2R7DA 1ENCA 1I4RA 2L11A 3CCVA 3H3VC 3SK5A 2A5HA 4BS9A 4C2MH 1G8ZD 5LMUQ 4PQXA 3HOXG 1K3BC 1L0YB 1L1OC 4LF7Q 2EIFA 1MJEA 5KIXA 1V43A 1HHVA 1VQEA 4FNFA 3TP7A 3ULLA 1K0RA 3G48A 3OIQA 1A2UA 1MIUA 1S3OA 5M5XB 2PQAB 2VNUD 2BDNA 3KF8B 2O5JC 4RGNA 2L12A 4C3IB 2BA0A 5CYUA 2FMMA 5FOBB 2UXBQ 1IHZA 2X69A 4RCOA 4OWXB 1YJ9A 3S17B 1LTGD 1A2TA 2KJXA 1OXTA 4P2CB 1VQ5A 2X6GA 4DAPA 1RTOA 3KBGA 3EA6A 4E6IA 3G6EA 4LF8L 1UAPA 1PLFA 1FNWA 1GM5A 2JP1A 4K0KQ 2J7ZA 2WB1B 4BBRG 1SR3A 3SK8A 4X62Q 2QEXA 2F0HA 1ONLA 1GVPA 2JQOA 3TN2A 1MI2A 2LSSA 3FKIG 1PFBA 3DM3A 3CCJA 5FLXE 1UE5A 2FINB 5C4JH 1HNXL 2A73B 1I6HB 3H15A 3S1RH 4GLXA 2XIWA 2XRSD 4DV5L 3CP0A 4LMQD 1EY9A 1X65A 5IYBG 5D14A 4XQNA 4DR5Q 1SYGA 1T5XD 3UE1A 1SE4A 4KJNA 1ILQA 2OT2A 1Y1WG 1EUJA 3OW2A 1XXGA 3S2DH 2XNAC 1A3VA 3URYA 1B53A 4NDXA 1UUPA 1BBXC 4P71A 4KHZA 5E7NA 2Q2TA 1RL2A 3NBHB 1S72A 4DV1L 4GKKQ 4GN5A 1STNA 5M5YB 4HN7A 4BA2I 4MHEA 3L7ZC 3NPPA 1IYUA 3A7LA 1SEBD 3HOUH 1HQRD 2ICEC 3AYHB 2EXZA 1EEFD 5LMNW 4UPAA 3GTKB 1VQFA 3JAMc 2Z4HA 4N9PA 3BS1A 3S1NH 1TWHH 1V8QA 3PIO3 3CCQA 3CCLA 2EY1A 1KLUD 2NB0A 3NENA 3K7UC 1VQJA 1U9RA 3I4NH 1QB5D 2FFKB 2Q2HA 1LTLA 3DHQA 4A4IA 3L3OC 1Q81C 1HA6A 2D2CC 2Y0SG 3P1HA 1L0XB 4PMWA 4KHPQ 2RHQB 3P75A 4A3DH 1OTCA 1Y69U 5KRUA 2BOSA 4YWKA 1CT1D 4BXXH 1PDQA 2KENA 1KDAA 1K83H 3NWSA 2KEEA 3GV6A 3SXHA 3CC4A 4DR1L 1YNJD 2A68D 4DAMA 3EBEA 4O42A 5C5MA 1FNVA 1YNJC 2A68C 3S24A 3HOYH 2ZJPA 4DUYQ 2WP8J 3I91A 1BOSA 4JBJA 2O5IC 3P20A 2Q2UA 1B3AA 4JI0L 4DFAA 1K8MA 4FYDA 4CKCA 1DXMA 1HNWL 2N55A 2A74C 2E75C 3W2DA 3MA2B 1TR5A 4I7AA 1ILPA 2I5MX 1Q1EA 3HOVB 5LL6X 1PA6A 2EY6A 1BCPD 3H6MA 5E3FA 1RCVD 2N8NA 3OPOA 1F2ZA 4A3BG 1JC7A 1X56A 1SXTA 4A3JB 1KHIA 5CV7A 1ZEQX 1IYVA 3CAMA 4DUZQ 2CH4W 3KLWA 4LUOA 1QG7A 2F4IA 1RKNA 3ER0A 3F2UA 3I4MB 3QB3A 2SNMA 3PO3G 2Z8LA 3TZUA 3PUVA 3CMAA 1T9HA 1BDOA 5GADC 1NR4A 4HCSA 3MEFA 4DAVA 4K6DA 4IUNA 3FHWA 4YCVA 5FJ8G 1H9SB 4QL5A 3HS0C 1BO0A 3K80C 3T16A 1SYBA 5ELNA 3UDIA 3BU2A 1WTXA 2Z6KC 3CD6A 1J8IA 1F2YA 1BXTA 4IZ8A 3VR3A 3CC2A 1IBLQ 1IYJB 2F3IA 3JC66 4NXNL 3HOWH 2JA7G 4DA2A 3PO2H 1U4RA 2RKSA 1GD7A 1K8AC 2AUKA 4DNRB 3SDZA 3CMEA 2JA7H 5IGBA 2ZTCA 1PZJD 4L8JA 5CGKA 3I4OA 2C9OA 3NP8A 4KD4A 5TSSA 5G3LD 3U9OA 1B7YB 1D5ZC 1PMRA 2I0QA 5IGDA 4IOCA 5ISRA 1LT6D 2WAQG 1GUOA 2R6GA 1UE1A 1XWEA 1SFOH 1EU3A 4XIGS 1S40A 2B2TC 2F3WA 2G9HD 4HIMA 3CQZH 1XJVA 1STBA 3K0XA 2Z1CA 1IBMQ 2JK8A 1I3QB 1Z9FA 4GNXB 2LMCB 1HUMA 5EKIA 3BVGA 3S2HB 3RZOH 3KJOA 3D31A 1UE6A 1V1OA 3HKZE 2JEAI 1CKNA 4LFCQ 4EQNA 4ZKBB 1CHQD 4CJ1B 2CWPA 4IPGA 4DV2L 4A3MG 4A3GG 4JCVE 3FVQA 2B2TA 1I94Q 2EYMA 2PZWA 1STGA 2KCNA 2D5DA 1YI2A 2D9UA 3V96A 1NY4A 1F2MA 3I56A 1FL0A 5DNFA 1ZYRC 2OQKA 1I5FA 4XYQA 3K59A 3OW7A 4A76A 4JBMA 3N6RA 1PYSB 4QGUA 4X66Q 2H4OA 2FHTA 4PMCA 1WTWA 4OIKA 2IHFA 4KN4C 4DF7A 2F03A 4WORA 1YNND 3KK7A 1Y1VH 3NE5B 1HH2P 3DXJC 4IQZA 3HOYG 5I4DA 3QIAA 5C0XJ 2JE6I 1EL0A 2QF7A 1KD1C 3T4AC 4EGVA 1JOOA 3H94A 4LFCL 3UI2A 4PG3A 3KLSX 1SROA 1Y8OB 1QJOA 1Q7YC 2EYFA 3E0EA 3J80E 3FRPB 1FVIA 3SE0A 3S1MB 2L15A 4DV5Q 1QILA 4CJ0B 2R7ZH 3MFGA 1TWAB 1JOKA 1J6QA 3PO3H 1HTLD 3VYUA 4A3JG 3ND9A 2IY5B 1GUWA 1I50H 1B50A 1X3QA 1ML0D 5IGEA 4HTHA 3M9BA 4BBSB 3BVMA 3H0GG 4OHJA 4JI4Q 4A93G 1PH9A 5K36G 1SE8A 4RGOS 4DR7Q 1ASZA 3M4PA 1BR9A 2OF1A 3OWEB 2AMCB 3BDLA 4JG2A 4L5RC 3K0YA 2UUAL 3F2BA 1EWHA 4A3KH 3NEMA 4P73A 5LMNQ 4HAEA 4KV6A 1SJHD 2HCIA 5IY0A 4DR4L 4GKJL 4A3IH 3MAQA 1V1PB 1HXYD 5GAEC 5CMDA 4IFDH 4DV7Q 3L0OA 4OELB 2OEOA 1VQ9A 4ALPA 3J80L 4X64Q 3BZCA 2R61A 2IW3A 3FPPA 1SN8A 3IL8A 1PH8A 3RN5A 4LNQA 1JT8A 1BVSA 2HCCA 2IL8A 2EYOA 4JI5Q 2EE1A 2F3VA 5ELCA 4Z9CB 4JI4L 4L63B 5IOCA 1OXVA 1PYWD 1E2VA 1H9RA 4XTCS 1V1QA 3VYTA 1X55A 1VF7A 1SJED 4WFN3 1VQPA 1YHAA 1I6VC 3HP3A 1HR0W 1EZ6A 3S16H 1TWHB 3GTJH 4DV3L 3CC7A 1FNUA 3TS2A 3S14H 5BN4A 1SNQA 2UUAQ 5HURA 3TMEA 1EY5A 4CKEA 2ZXPA 3A54A 2LXJA 2RDGA 5H1SE 4BY7B 1PH5A 1FJGQ 2JA8H 1FGUA 1XTCD 3GP7A 3BZDB 3VR4A 1H9MA 1BUVT 4G4KA 1HNXQ 4KMUC 1X3FA 2KUMA 5JAVA 2CKZB 2JA8G 3W3AA 3ZJYC 5A2QL 1DYQA 4PZ6A 4H44C 4R4QA 2F0FA 4F88A 3RZDB 4MIUA 3CCUA 2K5QA 2AHOB 1LTAD 3I70A 3CF5A 4HR7B 3IAYA 4RHSA 2QILA 3NUCA 1G91A 2EY2A 3FEWX 1EZ8A 3E3XA 2D0OA 4KHVA 4C3HG 4R8NA 3NHHA 1NSNS 1Q8IA 2F0GA 4CDFC 3S15B 4IO9A 5FO8B 1PXUA 3M4YA 1BNZA 4EQOA 3KF8A 5CV6A 2KECA 2M2LA 2F0EA 2PO4A 2E2JH 4A3GB 3X3NA 1BKBA 4HMIA 3A0JA 4A3JH 2B2UC 4DUZL 4DUYL 1I4GA 2YTYA 5JJLA 3AEVA 1S5CD 3ITPA 4BBRH 1XMOQ 3ZYYX 5C44H 1TS5A 2YTVA 4G7ZC 1HRJA 1PTOF 1EWCA 4OEMB 2CHBD 3I4MH 4DR2Q 1KDCA 3OOCA 4OXPA 1X3PA 1PV4A 2MNAA 4FP5D 5M5XH 3RN2A 3NSWA 1ZYRD 2PQEA 3KFUA 3AFPA 5ELOA 4GNXA 3CCRA 3R93A 1DM0B 4LF4L 2WAQB 3OIPA 4JI3L 3EJIA 4KKSA 1OXXK 3EIVA 1LO5D 1SLJA 1HUNA 2WB1E 4YCUA 2Q2IA 4RAUC 1HZCA 4IALA 1N8RC 3R2IA 1MD2D 3PUXA 2B2YA 2L9HA 4F87A 1E22A 4RA8A 2VB3X 5AJ3L 5K36H 1RD9D 3L9AX 4NB3A 3A8KE 4H0LC 3K6OA 4PV1C 2GA4B 4V190 4LW1A 1A3TA 1LACA 4XXEA 4HJ8A 2DGYA 1II3A 3CCEA 1QVFA 2ZJQA 1TT2A 2RSOA 5FO9B
chains in the Genus database with same CATH topology
1F9SA 2ICIA 2NVTB 4KN7C 5IT9L 4ZKCB 2F0DA 2AWNA 1D5XC 1AEXA 1LT4D 2HUGA 4NW2A 2D62A 2CVRA 2Q8TA 3D6WA 4ODGA 3S9WA 1PRTB 1DJRD 1FD7D 2TMPA 4ILWA 3I73A 5EQ0A 2IT1A 5J1ZA 3GV3A 1SNOA 5EKLA 1HFNA 1AP0A 3J7AF 3HOXB 1GOZA 1EYAA 5JEAH 2KCCA 1LABA 3TDQA 2J0TD 4A3BB 1MSHA 3J81E 3CRLC 5IT9E 4A3DB 5J22A 4KD3A 5FLXL 3GD7A 1EYDA 3DWQA 1EEID 5FO7B 4B9XA 1HFGA 1QWYA 5IIFA 3SR1A 2OXPA 3QO2A 3HOYB 3S1QB 3IFDA 4R9WA 3MC0B 3CKIB 4DK0A 1G2TA 1JE4A 2PZUA 1RHPA 2F0PA 3M7NA 2FJ2A 1EYCA 2XVSA 2AQ2B 1ENAA 4CHTB 4OIJA 2MJ8A 2LS01 4C56C 5KNCA 3PO3B 2JSOA 2Y0SB 1PTOH 1O78A 1B2TA 1UEAB 1EY8A 2F0KA 2O2LD 2MUYA 3KBXA 5KNDA 4KI0A 4DXGA 1HQMC 3DEOA 3K7AB 2J4XA 5EGTA 1ICWA 4A3KB 1EY4A 1J9OA 1STEA 3VR6A 3D6CA 4ZLTF 1RDPD 5EBDA 2O4XA 4TQUS 4K5VA 5DEHA 4JK1C 1JWMD 3OSOA 2DNEA 4I65A 3ND8A 2K1BA 1ET9A 1XX8A 4FXKC 4EVOA 1UNSA 2WV6D 2PPBC 2JA7B 2IJ0A 4XQQA 2F0LA 1PTOD 4HMJA 3T51B 1IL8A 3GTJB 4TKOB 1SNDA 1NR2A 3R8BA 4A3MB 5I6YA 1LTBD 2NUCA 3IFTA 4IUVA 4G57A 1SMYC 3LX0A 1R4PB 3D4RA 1SFOB 3VYSA 2JA8B 4G7HC 1TS3A 4KY6A 3PUYA 3TP6A 2DN8A 5C6AA 3CQZB 1AFPA 5KNBA 4HCEA 4X3SA 4K5WA 3RUZA 3C1FA 4J6HA 3V2TA 1D1KA 2DNCA 1Y1WB 1A6XA 1EFID 2AUJD 1CZWA 2EDGA 1STHA 1F9PA 2K32A 1W6KA 2LY7A 2A6EC 2E2JB 1GHKA 1ZXTA 2L4NA 1WTVA 1H9SA 2EJFC 1TWGB 4Q0FA 3K5LA 4NP5A 1TKWB 2F0VA 1HA5A 1Y1VB 1U4MA 5I2XA 1WTQA 1PRTC 1KTKA 3E6ZX 2A6HD 3TSSA 2KOLA 1ZKOA 2TSSA 2NTTA 3NK9A 2SOBA 2HQEA 4S3SA 2KEDA 1KLGD 2F0NA 2M00A 1GXDC 3SHLA 3QWNA 2DY8A 2R7ZB 3MXGA 3P7JA 3A56A 2JXMB 1WTPA 1I50B 2QKIC 5C0XI 1D2BA 4NKLA 5KGUA 2QCPX 4QUFA 3J81L 1HPCA 2F0JA 1S5ED 1SNMA 3RD4A 3VA7A 2NTSA 2HDLA 3R3OA 3EFXD 2PW7A 4A3IB 4J8QA 1KABA 1SBBB 5J39A 3ERQA 5IODA 5JVG3 1O7LA 3D4WA 1PRTF 3AU7A 1AN8A 5BN5A 1S4ZA 2B2VA 1EQTA 3K5NA 2L55A 5D65A 1LTTD 1CI3M 5C3XA 3MEHA 2EPBA 1M8AA 4V0BA 1TU2B 5FKAC 3NBHA 3Q23A 3AB9A 5JOBA 2A69C 4L6TB 2A6HC 4DGZA 4PNYA 2WACA 1Z47A 5C4XB 1DONA 4OO1G 5ELEA 5CV8A 1PFMA 3BVZA 1A3UA 3KUPA 1AW7A 1HCZA 5C0XH 1Y8NB 3GTGB 4FF4A 4HEDA 1PTOB 3BYYB 1VCIA 4BWGB 5I9OA 4IFDI 2IX3A 2ID0A 3HRZC 4BBRB 5C44B 3A8JE 5NUCA 3FDTA 2XWJB 5F2DA 1LLRD 2NYZD 5C4HA 1QNUA 1QOHA 2E2DC 2LKVA 3D4DA 3NTHA 4G7OC 3BDCA 4MN3A 3OMGA 4RGMA 2VUMB 1JR0D 2EYJA 2K6AA 1B1ZA 1JOQA 4K14A 2B2VC 1MGSA 1SMYD 2CW0D 4A93B 3T13A 1OXSC 2PCFB 1O7YA 5BN3A 4RH6A 3RLFA 2EZVA 5I9PA 1B9NA 4RKLA 3QJYA 3E0JA 2KHSA 5KYIA 1GUGA 1M4VA 5EPKA 5LHY1 2XSCA 2NVXB 1G291 3DMUA 2WKCA 1BCPC 1K8OA 2AWOA 1X32A 1WTOA 1SE3A 3PUWA 1WD0A 5JEAJ 1F77A 4KY7A 4XYOA 2EYLA 3DWAA 2FMCA 1TS2A 3I4LA 3T53B 1Y8PB 1I4XA 1JB3A 4ZYSA 1OXUA 3NTKA 2F0UA 5CR3A 2SNSA 3I72A 1KDBA 2WINB 2WKDA 2AQ1B 1TVXA 4C3JB 2EJGC 2AQ3B 1U4PA 2C5CA 5JPMC 2PW5A 4KKTA 4QIWB 3J7AV 3TP8A 4QB4A 4FF2A 1O7ZA 2CQAA 3JAML 2HDMA 1PZID 5JPNC 1U4LA 3H91A 3CHBD 2G9DA 3KLSA 4XQJA 5IGFA 5A2QE 2L1BA 2L0CA 1HTPA 5I2YA 3JAME 4OGQC 2F0WA 5C3WA 1E2WA 3BDOA 2EVBA 5M3FB 2CW0C 4R8IA 4IUPA 4X3KA 3GTLB 3LWUA 3SK6A 1ET6A 1QNKA 1V1PA 4RWSC 1VF5C 2F1MA 1WCMB 2IX1A 3A55A 1JQYD 1VMCA 2YU9B 3SVMA 2K5WA 1DCZA 5EPJA 1Q1BA 1CHPD 3EROA 1TQOA 3CRKC 2KQ3A 1Q3LA 4RCNA 1TS4A 2V4DA 4LJZC 3TBIB 2QDBA 3MXPA 3OHXC 4ID6A 2VB2X 1PRTD 3MHBA 4K8IA 2B2YC 4X3UA 1QCBD 2E76C 2Z4IA 3AMUA 1DOKA 3A8IE 1AZQA 5DM73 5ELDA 3MVVA 2A6ED 2A69D 2NBFA 1SE2A 3SEBA 3NTIA 3DUZA 2F0IA 1GUNA 4GZYC 5D3IB 1I4HA 3G7LA 4UDUC 3WOFA 2I46A 3N52A 4HSPA 1SYCA 1SNPA 4KTAA 1IW7D 1JORA 1KAAA 3G6JB 1ESRA 4ULLA 4F8MA 3BG3A 4C1NI 1LT5D 5DAUA 1BCPB 2L5TA 1TWCB 2WIIB 4EQPA 3HEJA 4IFDJ 5HGTA 1PTOC 3C46A 3NXWA 4H7BA 1NAPA 4IN3A 3O13A 2NN6G 4DXFA 3KLRA 1CM9A 4Y7NB 4YIJA 3GTMB 4CJ2C 2ZXOA 3LNNA 3GQBA 2B39A 1AZPA 2SEBD 4XT3B 1SAPA 4ME5A 2EY5A 1RODA 3GTPB 5CV9A 4WRDA 4JBWA 1CQVA 2IX0A 5M3MB 1D1IA 1Z7TA 4I7ZC 4C3HB 1MBYA 4QCLA 2H1EA 2B2WC 4FF1A 4BA1I 2E2HB 2B8FA 2KA7A 1I4QA 4XDXA 1S5FD 1BCPF 4Q5VA 3OMCA 3MZ5A 5G3LF 5KYLA 5I6WA 2RBMA 2IWHA 5EBCA 1GJXA 3NWTA 2RSNA 4N9TA 2R93B 1QE6A 1EQVA 5IGCA 1RJTA 1R9TB 1D6EC 1LTID 2R92B 1ESFA 3EQLC 2EOTA 2K05A 2XRQD 4DU9A 1CA6A 1GUTA 3DM1A 3K58A 1TY2A 2X6LA 2K04A 1DZ1A 3H09A 3FKIB 4A3EB 4B08A 2ENBA 1O80A 4C2MB 4XT1B 2EYPA 5C5LA 5C0XG 4UAIA 2BCOA 4CKBA 5M5WB 1LV9A 1NCVA 3U9SA 1CZGA 3Q22A 2NN6H 3WOEA 1XYIA 1STYA 2B2UA 2NWGA 2QEJC 3PMFA 1YNNC 2E74C 2RVLA 3M4OB 5ELFA 5C3EB 1PFNA 1IW7C 1OO9B 1WD1A 3MTSA 4KJOA 1EU4A 3EVQA 4ZK9B 2JA5B 2EJMA 3S1RB 4KK7A 3I90A 4U673 3K5OA 1EY7A 3NBIA 5C4ZA 3I3CA 5LL6S 2BE5C 1GHJA 2MGSA 3M3YB 2MPMA 1E2ZA 1SSOA 1E0BA 2BE5D 2ZXRA 4FF3A 1T5EA 3PV0A 5D3DA 2LFNA 4PMBA 4K8JA 4RFBA 1WVLA 2RDFA 3HOZB 3FMCA 3HOUB 3CU7A 4ZRZA 5A35A 4WJWA 2RA4A 2YYZA 1H9JA 3OWFA 3IKJA 4RKBA 5KEEA 3HG9A 4IUUA 4AYBB 1IKMA 5FK9C 5E4WC 2IPKD 5M9OA 2K01A 1STAA 3H0GB 1EY0A 1K83B 1JICA 3DEPA 1EIHA 1B44D 4C1NK 5EJWA 4TRDA 4IFDG 2I07B 1G2SA 4FXGC 1C48A 3MWYW 2F0MA 5ELBA 4FXDA 2XN9C 4DAYA 1SYDA 1LTSD 3QOLA 3V05A 4ZQ3A 3VR5A 1BF4A 1JCKB 1Q12A 2K7VA 5JJZA 4K2KA 1VDZA 4C3JG 2F0TA 2BA1A 2K33A 1DOMA 3RMHA 4KY5A 1B9MA 3K5MA 2B2WA 3QOJA 1H9KA 5DM63 2PZTA 3R2TA 4HSVA 5EPLA 4CBVA 2MHVA 1JWSD 2XWBB 3VR2A 1CK1A 1S5BD 1LTRD 3Q0AA 5IGGA 2Q8RE 4H13C 5CV5A 3MFYA 4C3IG 3LWEA 2RQXA 3Q24A 5E1FA 4KKUA 1PZKD 3K57A 1FYCA 2NZ1D 3C3LA 4OL7A 3D3RA 3M7GA 3PO2B 3C2PA 1CFMA 2K03A 2KVMA 4M8AA 4QUCA 5COYA 5C4JB 2F0QA 4IURA 1DD2A 5EKKA 3S2DB 1I4PA 3SK4A 1GUSA 2JEBI 3J7YW 4A3FB 1EY6A 3NQIA 1TY0A 2DY7A 4K6LA 1G6ZA 3T56B 3ONAB 4ABNA 4K2LA 1DOLA 1LT3D 4ZUJA 4ZAIA 1F9RA 1EOTA 3RZOB 5CV4A 2N88A 2K28A 3S1NB 3FPUB 1RF2D 1TWFB 3I4NB 3HKZB 1SNCA 2B8GA 3VYRA 3I8ZA 5JEAG 2R3ZA 4OO1I 1Z6HA 1F9QA 1JWUD 3BYTB 1S5DD 4QF4A 3GTQB 1VMPA 4DNTB 4RGTA 1NUCA 2JYOA 4DN4M 3MXNA 2JA6B 2BDOA 5CC4A 1CA5A 3NQTA 2F0SA 3TZDA 1C4QA 1KNAA 2PYKA 5E4XA 4BY1B 2E2IB 4LAAA 5CBEE 3PUZA 2RDHA 3GO5A 4TSSA 1F2LA 4J1MA 2Q8IB 5AFWA 5K5PA 2K5DA 1WTRA 4QMGA 3MXUA 3QG1A 3GTOB 2PNRC 4ZUIA 1Q90A 1TIID 4NMZA 1ENFA 1R4QB 3Q6SA 5CORA 3HOWB 1W6JA 4IUTA 3X3MA 1EIGA 3A7AB 1KNEA 4FVMA 4IUQA 4FO2A 4LK1C 3S16B 4K5XA 1SDFA 2F0OA 4CGYB 1C8CA 5T1IA 1FR3A 3HGBA 3S14B 3E5SA 3WDNA 4RHRA 3VA5A 1IKLA 4OO1H 2PMZB 2ZT9C 5JVH3 1SYEA 4U68A 3DWPA 2NVQB 2B63B 4DK1A 1RTNA 1CTMA 2MP1A 2NVYB 5CBAE 3M85A 2SDFA 4F7XA 2NN6I 3HZXA 2EYHA 4M1UB 1A15A 2VXWA 1D5MC 3PIP3 1CQFA 4B9WA 2M9VA 4O1NA 1SYFA 3TP5A 3C1EA 1B4OA 1BQQT 1MSGA 4X3TA 3D8GA 1FGBD 5T1GA 1ENCA 1I4RA 2L11A 3H3VC 3SK5A 2A5HA 4BS9A 1G8ZD 4PQXA 1L0YB 5KIXA 1V43A 1HHVA 4FNFA 3TP7A 3OIQA 1A2UA 5M5XB 2VNUD 2BDNA 2O5JC 4RGNA 2L12A 4C3IB 2BA0A 5CYUA 2FMMA 5FOBB 1IHZA 2X69A 4RCOA 3S17B 1LTGD 1A2TA 2KJXA 1OXTA 4P2CB 2X6GA 4DAPA 1RTOA 3KBGA 3EA6A 4E6IA 1UAPA 1PLFA 1FNWA 2JP1A 2J7ZA 2WB1B 3SK8A 2F0HA 1ONLA 3TN2A 1MI2A 1PFBA 5FLXE 2FINB 2A73B 1I6HB 2XIWA 2XRSD 4LMQD 1EY9A 5D14A 4XQNA 1SYGA 1T5XD 1SE4A 4KJNA 1ILQA 2OT2A 1XXGA 2XNAC 1A3VA 3URYA 1B53A 4NDXA 1UUPA 1BBXC 4KHZA 1STNA 5M5YB 4HN7A 4BA2I 4MHEA 3L7ZC 3NPPA 1IYUA 3A7LA 1SEBD 1HQRD 2ICEC 2EXZA 1EEFD 3GTKB 2Z4HA 4N9PA 3BS1A 1V8QA 3PIO3 2EY1A 1KLUD 2NB0A 1U9RA 1QB5D 2FFKB 3DHQA 3L3OC 1HA6A 2D2CC 3P1HA 1L0XB 4PMWA 3P75A 1Y69U 5KRUA 2BOSA 1CT1D 1PDQA 1KDAA 3NWSA 2KEEA 3GV6A 3SXHA 1YNJD 2A68D 4O42A 5C5MA 1FNVA 1YNJC 2A68C 2WP8J 3I91A 1BOSA 2O5IC 3P20A 1B3AA 4DFAA 1K8MA 4FYDA 4CKCA 1DXMA 2N55A 2A74C 2E75C 3W2DA 3MA2B 1TR5A 1ILPA 1Q1EA 3HOVB 5LL6X 2EY6A 1BCPD 3H6MA 5E3FA 1RCVD 3OPOA 1F2ZA 1JC7A 4A3JB 1SXTA 5CV7A 1ZEQX 1IYVA 1QG7A 2F4IA 1RKNA 3I4MB 3F2UA 3QB3A 2SNMA 2Z8LA 3TZUA 3PUVA 1BDOA 1NR4A 4HCSA 4DAVA 4K6DA 4IUNA 1H9SB 3HS0C 1BO0A 3T16A 1SYBA 1WTXA 1J8IA 1F2YA 1BXTA 4IZ8A 3VR3A 4DA2A 1U4RA 2RKSA 2AUKA 4DNRB 3SDZA 5IGBA 1PZJD 4L8JA 5CGKA 2C9OA 3NP8A 4KD4A 5TSSA 5G3LD 3U9OA 1PMRA 1D5ZC 5IGDA 5ISRA 1LT6D 1GUOA 2R6GA 1XWEA 1EU3A 4XIGS 2B2TC 2F3WA 2G9HD 1STBA 2Z1CA 1I3QB 2LMCB 1HUMA 5EKIA 3BVGA 3S2HB 3D31A 1V1OA 2JEAI 4EQNA 4ZKBB 1CHQD 4CJ1B 3FVQA 2B2TA 2EYMA 2PZWA 1STGA 2KCNA 2D5DA 2D9UA 3V96A 1F2MA 5DNFA 1ZYRC 4XYQA 3K59A 3OW7A 3N6RA 2H4OA 2FHTA 4PMCA 1WTWA 4OIKA 4KN4C 4DF7A 2F03A 4WORA 1YNND 3KK7A 3NE5B 3DXJC 4IQZA 5I4DA 3QIAA 5C0XJ 2JE6I 1EL0A 2QF7A 3T4AC 4EGVA 1JOOA 3H94A 3UI2A 3KLSX 1Y8OB 1QJOA 2EYFA 3J80E 3FRPB 3SE0A 3S1MB 1QILA 4CJ0B 3MFGA 1TWAB 1JOKA 1HTLD 3VYUA 3ND9A 1GUWA 1B50A 1X3QA 1ML0D 5IGEA 4HTHA 4BBSB 3BVMA 4OHJA 5K36G 4RGOS 1BR9A 2OF1A 3OWEB 3BDLA 3K0YA 1EWHA 4HAEA 4KV6A 1SJHD 2HCIA 3MAQA 1V1PB 1HXYD 5CMDA 4IFDH 2OEOA 3J80L 2R61A 2IW3A 3FPPA 3IL8A 2HCCA 2IL8A 2EYOA 2EE1A 2F3VA 5ELCA 4Z9CB 4L63B 5IOCA 1OXVA 1PYWD 1E2VA 1H9RA 4XTCS 3VYTA 1VF7A 1SJED 4WFN3 1I6VC 3HP3A 1EZ6A 1TWHB 1FNUA 5BN4A 1SNQA 5HURA 3TMEA 1EY5A 4CKEA 2ZXPA 3A54A 2RDGA 4BY7B 1XTCD 3GP7A 3BZDB 3VR4A 1H9MA 1BUVT 4G4KA 4KMUC 2KUMA 5JAVA 3W3AA 5A2QL 1DYQA 4H44C 2F0FA 4F88A 3RZDB 4MIUA 2K5QA 1LTAD 3I70A 4HR7B 3IAYA 4RHSA 2QILA 3NUCA 1G91A 2EY2A 3FEWX 1EZ8A 4KHVA 4C3HG 4R8NA 3NHHA 1NSNS 1Q8IA 2F0GA 3S15B 1BNZA 5FO8B 1PXUA 3M4YA 4EQOA 3KF8A 5CV6A 2KECA 2M2LA 2F0EA 2PO4A 4A3GB 3X3NA 4HMIA 2B2UC 1I4GA 1S5CD 3ITPA 3ZYYX 1TS5A 4G7ZC 1HRJA 1PTOF 1EWCA 2CHBD 1KDCA 3OOCA 1X3PA 4FP5D 3NSWA 1ZYRD 2PQEA 3R93A 1DM0B 2WAQB 3OIPA 3EJIA 4KKSA 1OXXK 1LO5D 1HUNA 4RAUC 4IALA 3R2IA 1MD2D 3PUXA 2B2YA 2L9HA 4F87A 4RA8A 2VB3X 5K36H 1RD9D 3L9AX 3A8KE 4H0LC 3K6OA 4PV1C 2GA4B 4V190 1A3TA 1LACA 4XXEA 1II3A 1TT2A 2RSOA 5FO9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMC A;  2RDF A;  3T13 A;  5CC4 A;  5HUR A;  3NQT A;  3TME A;  2F0S A;  1A3V A;  1EY5 A;  4DF7 A;  4NDX A;  4DU9 A;  4WOR A;  3SK6 A;  2F0D A;  5E1F A;  1AEX A;  4K6D A;  4F7X A;  4F8M A;  4IUN A;  5I9P A;  2PYK A;  3HZX A;  2EYH A;  3OWF A;  5DAU A;  1STN A;  3MEH A;  4RKL A;  5C3X A;  5JAV A;  2KHS A;  5EGT A;  4OL7 A;  4RKB A;  1JOO A;  3T16 A;  5KEE A;  5KYI A;  1EY4 A;  1SYB A;  4ODG A;  3S9W A;  3ERO A;  4NP5 A;  2EXZ A;  2EYF A;  4B9W A;  2ENB A;  1TQO A;  2F0V A;  4LAA A;  4EQP A;  3DMU A;  3HEJ A;  2F0F A;  1F2Y A;  2KQ3 A;  1SYF A;  2EYP A;  3D6C A;  4IZ8 A;  5HGT A;  3TP5 A;  3C1E A;  5C5L A;  2O4X A;  3D8G A;  4J1M A;  4N9P A;  5M9O A;  3NXW A;  4MIU A;  1JOK A;  4H7B A;  1STA A;  5JOB A;  1EY0 A;  2EY1 A;  2F0Q A;  1ENC A;  5J1Z A;  1U9R A;  3NK9 A;  3SK5 A;  2RKS A;  2SOB A;  1SNO A;  2HQE A;  4K5V A;  5EKL A;  4KY7 A;  5IGE A;  3DHQ A;  4S3S A;  4HTH A;  2EYL A;  3NUC A;  5DEH A;  2EY2 A;  3P1H A;  2F0N A;  1EZ8 A;  2M00 A;  5IGB A;  4KHV A;  3OSO A;  2QDB A;  4R8N A;  3SHL A;  5EKK A;  3NHH A;  1NSN S;  2F0G A;  3P75 A;  4PNY A;  2WAC A;  4TRD A;  4YIJ A;  3SK4 A;  3MXP A;  4DGZ A;  5CGK A;  4I65 A;  4EQO A;  5CV6 A;  5KRU A;  1EYA A;  5K5P A;  3NP8 A;  5KIX A;  4KD4 A;  2F0E A;  1KDA A;  2F0M A;  1EY6 A;  3TP7 A;  2OF1 A;  4EVO A;  4QMG A;  4HMI A;  3SXH A;  2F0U A;  3BDL A;  3U9O A;  5IGD A;  5CV8 A;  1A2U A;  1A3U A;  1STY A;  4ID6 A;  4K2L A;  5CR3 A;  2SNS A;  1SYD A;  1KDB A;  4NKL A;  4ZUI A;  2F0L A;  3QOL A;  3ITP A;  5C5M A;  5KGU A;  5ISR A;  5J22 A;  4KD3 A;  4ZUJ A;  2F0J A;  4ME5 A;  4NMZ A;  2EY5 A;  3PMF A;  4HMJ A;  1EYD A;  4KV6 A;  1IHZ A;  4ZQ3 A;  1SND A;  3MHB A;  4K8I A;  5CV9 A;  4DFA A;  5CV4 A;  1SNM A;  2F3W A;  4WRD A;  4B9X A;  5I6Y A;  1A2T A;  2NUC A;  1KDC A;  5I9O A;  4G57 A;  5IIF A;  3SR1 A;  1STB A;  2OEO A;  2OXP A;  4E6I A;  3LX0 A;  4K2K A;  3R3O A;  2PW5 A;  2PQE A;  1TR5 A;  2F0T A;  5NUC A;  3MVV A;  4KJO A;  2PW7 A;  3TP8 A;  1SNC A;  4QB4 A;  3EVQ A;  5F2D A;  4KY5 A;  2EY6 A;  1KAB A;  4KY6 A;  3TP6 A;  5C4H A;  2EYO A;  3EJI A;  2PZU A;  3SK8 A;  3QOJ A;  5C6A A;  2F3V A;  2F0H A;  2F0P A;  4K5X A;  3H6M A;  5E3F A;  4EQN A;  2F0O A;  1EYC A;  2F0I A;  4QF4 A;  5IOC A;  4K5W A;  2PZT A;  2LKV A;  3D4D A;  1F2Z A;  1EY7 A;  1ENA A;  3C1F A;  3OMC A;  4IAL A;  4J6H A;  3RUZ A;  5J39 A;  3ERQ A;  5C4Z A;  2EYM A;  5IOD A;  2PZW A;  3BDC A;  3MZ5 A;  5CV7 A;  3E5S A;  1STG A;  3V2T A;  3OMG A;  5KYL A;  5I6W A;  2RBM A;  5IGF A;  1EZ6 A;  3D4W A;  3VA5 A;  2EYJ A;  1A3T A;  1EY9 A;  5IGG A;  1F2M A;  1NUC A;  1SYC A;  1SNP A;  4KTA A;  5CV5 A;  4K14 A;  1JOQ A;  1EY8 A;  1RKN A;  1II3 A;  2F0K A;  3QB3 A;  1SYE A;  2F0W A;  4N9T A;  5C3W A;  1SYG A;  2SNM A;  1EQV A;  5IGC A;  4KJN A;  1TT2 A;  4PMB A;  4K8J A;  1STH A;  1SNQ A;  1JOR A;  1KAA A; 
#chains in the Genus database with same CATH topology
 1L1O A;  1F9S A;  1I6H H;  2ICI A;  2NVT B;  4KN7 C;  5IT9 L;  4JPB W;  4ZKC B;  4GS3 A;  2F0D A;  2AWN A;  2CWA A;  4CDC C;  1KIX A;  5IP7 G;  1D5X C;  1AEX A;  1LT4 D;  3RLO A;  2HUG A;  4NW2 A;  3F2D A;  5IWA L;  2K50 A;  2D62 A;  2CVR A;  5IYD H;  3STB C;  1NJI C;  4LF5 L;  5IP9 G;  2Q8T A;  4DR3 L;  4DV0 L;  3D6W A;  4ODG A;  3S9W A;  1PRT B;  4L5S A;  1A0I A;  1DJR D;  1FD7 D;  2TMP A;  4ILW A;  3I73 A;  3L2P A;  5M5Y H;  4DV4 Q;  5EQ0 A;  2IT1 A;  5J1Z A;  3GV3 A;  2ZJR A;  1SNO A;  5EKL A;  1HFN A;  1AP0 A;  4A3E G;  4J15 A;  1VQ8 A;  3J7A F;  4GOP C;  1XMQ Q;  1CKN B;  2PI2 A;  3HOX B;  1GOZ A;  3PQI A;  1EYA A;  4ME3 A;  5JEA H;  2KCC A;  1LAB A;  1XPU A;  3TDQ A;  2UUC L;  2J0T D;  1YJW A;  4A3B B;  1MSH A;  4R4C A;  3PO2 G;  3AFQ A;  3J81 E;  4LFA L;  3CRL C;  5IT9 E;  2CH4 A;  1HNW Q;  2D0P A;  4JI3 Q;  4A3D B;  3EN2 A;  4KD3 A;  5J22 A;  5FLX L;  5GQO A;  3GD7 A;  1KAW A;  1EYD A;  3DWQ A;  1EEI D;  5FO7 B;  1X6O A;  4B9X A;  1HFG A;  1QWY A;  5IIF A;  3SR1 A;  2OXP A;  3QO2 A;  3HOY B;  3S1Q B;  4YHH Q;  3IFD A;  4R9W A;  3MC0 B;  4LUV A;  3CKI B;  4DK0 A;  1G2T A;  1GKH A;  1JE4 A;  2PZU A;  1RHP A;  2F0P A;  3M7N A;  2FJ2 A;  1EYC A;  2XVS A;  1VQA A;  2AQ2 B;  1ENA A;  3GDE A;  2VY3 A;  2DJG C;  3E9H A;  4CHT B;  4OIJ A;  2MJ8 A;  1YVC A;  2LS0 1;  4JI8 L;  3STB D;  4C56 C;  5KNC A;  3S1M H;  5IWA Q;  3T1Y Q;  3PO3 B;  2JSO A;  2Y0S B;  1PTO H;  2QGQ A;  4JI2 L;  1O78 A;  1B2T A;  1UEA B;  3FP9 A;  4JI7 L;  1EY8 A;  2F0K A;  4A75 A;  2VQF Q;  4DR6 L;  4BBS H;  2O2L D;  2YU9 H;  1N33 L;  2EXD A;  2MUY A;  3KBX A;  5JJI A;  2ZM6 Q;  1UEB A;  5KND A;  1X9N A;  2B3G A;  3F1Z A;  4LF7 L;  4KI0 A;  4DXG A;  1HQM C;  3DEO A;  3K7A B;  4GN3 B;  2J4X A;  5EGT A;  4X65 L;  1ICW A;  4A3K B;  1EY4 A;  1J9O A;  1VS0 A;  1STE A;  3VR6 A;  3D6C A;  4ZLT F;  1RDP D;  5EBD A;  2O4X A;  4TQU S;  4LF6 Q;  1BBU A;  4K5V A;  5DEH A;  4JK1 C;  1JWM D;  3OSO A;  2GVB A;  1QVC A;  2DNE A;  4I65 A;  1N32 L;  2KCT A;  3ND8 A;  1P8L A;  2K1B A;  1ET9 A;  1XX8 A;  4FXK C;  4EVO A;  1UNS A;  2WV6 D;  4IPD A;  1ICF B;  2PPB C;  2JA7 B;  4X66 L;  2IJ0 A;  4XQQ A;  2F0L A;  4A3L H;  3U50 C;  1PTO D;  1W2B A;  2NVX H;  4HMJ A;  3T51 B;  1IL8 A;  3GTJ B;  2KCM A;  2H5X A;  1SND A;  1NR2 A;  4TKO B;  2ZTE A;  3R8B A;  4A3M B;  5I6Y A;  1LTB D;  2NUC A;  3IFT A;  4IUV A;  4G57 A;  4X64 L;  1SMY C;  3LX0 A;  5DLQ E;  3PIP A;  2LXK A;  1R4P B;  1SRU A;  3D4R A;  1SFO B;  1SMX A;  4UP8 A;  3VYS A;  2JA8 B;  4G7H C;  1TS3 A;  4KY6 A;  3PUY A;  3TP6 A;  2HHH L;  4Y52 H;  2DN8 A;  5C6A A;  1Q8K A;  3CQZ B;  1AFP A;  5KNB A;  4HCE A;  2PI2 E;  4X3S A;  4K5W A;  4YY3 Q;  3I4M G;  3RUZ A;  2VZA A;  3C1F A;  4J6H A;  2N49 A;  4HJA A;  3S2H H;  3V2T A;  1D1K A;  3RZD H;  2DNC A;  1E1O A;  1Y1W B;  2I5H A;  4DR5 L;  2JN4 A;  1A6X A;  1EFI D;  2AUJ D;  4YY3 L;  4C3J H;  1CZW A;  3J7A 5;  2EDG A;  1F9P A;  1STH A;  2K32 A;  1W6K A;  4IJL A;  5HY6 A;  4B3T Q;  3ULP A;  1TWC H;  1CSQ A;  2LY7 A;  1L0W A;  3HOV G;  1A62 A;  2A6E C;  2CQO A;  3HKZ G;  2F52 A;  3I4N G;  2E2J B;  3J80 c;  1GHK A;  3K81 C;  4LF5 Q;  1LM0 A;  1ZXT A;  3G4S A;  4DV7 L;  5FLM H;  2L4N A;  1WTV A;  1H9S A;  2EJF C;  1TWG B;  4Q0F A;  3K5L A;  4NP5 A;  4R4I A;  3DLL A;  4JV5 L;  1TKW B;  1K9M C;  2F0V A;  1HA5 A;  1VQ7 A;  1Y1V B;  2IHE A;  1U4M A;  5I2X A;  4DV4 L;  1WTQ A;  1PRT C;  1KTK A;  3E6Z X;  2A6H D;  3TSS A;  4JC0 A;  2KOL A;  1ZKO A;  2TSS A;  4GOP B;  2NTT A;  3E9I A;  3KYH C;  3NK9 A;  2SOB A;  2HQE A;  1H95 A;  4S3S A;  2KED A;  4JI2 Q;  1N36 L;  1KLG D;  2F0N A;  2M00 A;  1GXD C;  3SHL A;  3QWN A;  1VQM A;  1JJC B;  2DY8 A;  2R7Z B;  3CCS A;  2QA4 A;  1TWA H;  3W1B A;  2JA9 A;  3MXG A;  2ES2 A;  3P7J A;  3A56 A;  2JXM B;  1EIY B;  3GTP H;  1WTP A;  1I50 B;  2QKI C;  1B70 B;  1WCM H;  2UUB Q;  5C0X I;  1D2B A;  4YWL A;  4NKL A;  5KGU A;  2QCP X;  3UE0 A;  4P72 A;  4QUF A;  3J81 L;  1PHJ A;  1HPC A;  2F0J A;  2E2H H;  1S5E D;  1U0L A;  1JJG A;  1SNM A;  3RD4 A;  3VA7 A;  2NTS A;  2FXQ A;  3ERS X;  2WFW A;  2HDL A;  3R3O A;  4DR6 Q;  3EFX D;  3CPF A;  3ULJ A;  1FJG L;  2K5N A;  1KRS A;  2PW7 A;  4MTK A;  4A3I B;  1JJ2 A;  4J8Q A;  1KAB A;  2ATW A;  2DUD A;  2VUM G;  1E3P A;  1SBB B;  5J39 A;  2K14 A;  3J81 i;  4DV3 Q;  3ERQ A;  5IOD A;  1RIP A;  5JVG 3;  1O7L A;  3D4W A;  1PRT F;  1L2F A;  3AU7 A;  1AN8 A;  5BN5 A;  1CKM A;  1S4Z A;  2B2V A;  3HOX H;  4A3E H;  1EQT A;  5D65 A;  2L55 A;  3K5N A;  1KC8 C;  1LTT D;  1UE7 A;  1CI3 M;  5C3X A;  3MEH A;  3CPW A;  2EPB A;  1M8A A;  1KXL A;  4V0B A;  4H02 A;  1TU2 B;  5FKA C;  3NBH A;  1VQI A;  4UP9 A;  4LF9 L;  4WJ3 M;  1PH3 A;  1G51 A;  3Q23 A;  3AB9 A;  3CW2 C;  2R92 G;  1IZ6 A;  1XNR L;  1IBK Q;  5JOB A;  2XGT A;  2A69 C;  4BY7 G;  4L6T B;  2A6H C;  1N32 Q;  4PNY A;  2WAC A;  4DGZ A;  1Z47 A;  1XMO L;  1PH2 A;  5C4X B;  1DON A;  1A63 A;  1TXY A;  4OO1 G;  5ELE A;  2OTL A;  5C3E H;  5CV8 A;  1PFM A;  3BVZ A;  1A3U A;  3KUP A;  4UHV A;  1AW7 A;  1HCZ A;  3RR5 A;  5C0X H;  3UDF A;  4B3S L;  1G6P A;  1Y8N B;  2V1C C;  3GTG B;  4FF4 A;  4HED A;  1PTO B;  4LWC A;  3BYY B;  1WTH A;  1VCI A;  4A3G H;  4BWG B;  5I9O A;  1K3R A;  4IFD I;  2IX3 A;  2ID0 A;  2JA5 H;  4QIW E;  3HRZ C;  4BBR B;  5C44 B;  2A1A A;  3A8J E;  5NUC A;  3FDT A;  4LUZ A;  5HGQ A;  4JI1 L;  2XWJ B;  3T1H L;  5F2D A;  4Y7N H;  1LLR D;  3M3Y H;  2NYZ D;  5C4H A;  1QNU A;  1QOH A;  2E2D C;  4JOI A;  2LKV A;  3D4D A;  3NTH A;  4G7O C;  3BDC A;  4MN3 A;  3OMG A;  3T1Y L;  4RGM A;  2UU9 Q;  3HOZ H;  4KLK A;  2VUM B;  1JR0 D;  4TVA B;  2PMZ E;  1VQH A;  2ALY B;  2UXC Q;  2EYJ A;  2K75 A;  2K6A A;  1B1Z A;  1JOQ A;  4K14 A;  2B2V C;  1MGS A;  1SMY D;  5M3M H;  2CW0 D;  2JA5 G;  2UU9 L;  4C3H H;  4A93 B;  3T13 A;  1OXS C;  2PCF B;  5J3B A;  1O7Y A;  4JI0 Q;  3I55 A;  3KOJ A;  5BN3 A;  4RH6 A;  1EQR A;  3RLF A;  2EZV A;  4A3C G;  1VQG A;  4X65 Q;  4P75 A;  4HJ7 A;  5I9P A;  1B9N A;  3HOW G;  4RKL A;  3QJY A;  3E0J A;  2KHS A;  5KYI A;  1GUG A;  5C3E G;  2UUB L;  1M4V A;  5EPK A;  5LHY 1;  2NVT H;  2XSC A;  4DK3 C;  2NVX B;  1G29 1;  1IXR A;  3DMU A;  2WKC A;  4A3M H;  1BCP C;  1K8O A;  2AWO A;  1X32 A;  5EAY A;  1WTO A;  1YIT A;  1YZ6 A;  1SE3 A;  3PUW A;  1WD0 A;  5JEA J;  1CUK A;  1N36 Q;  1F77 A;  1X54 A;  4KY7 A;  4XYO A;  2EYL A;  1EFW A;  2BH8 A;  2FMC A;  3DWA A;  1TS2 A;  3I4L A;  3T53 B;  1HZB A;  1Y8P B;  2B63 G;  1I4X A;  1JB3 A;  4MTN A;  4ZYS A;  1OXU A;  3NTK A;  2F0U A;  2Z0S A;  5CR3 A;  2SNS A;  3I72 A;  1N34 L;  1KDB A;  3FKI H;  3HFZ B;  3OTO Q;  1D7Q A;  4R1J A;  1B3Q A;  1EYG A;  2WIN B;  1AH9 A;  2WKD A;  2AQ1 B;  4A3B H;  1TVX A;  4C3J B;  4IPC A;  2EJG C;  2AQ3 B;  1V9P A;  5IT9 c;  1U4P A;  2C5C A;  5JPM C;  1P16 A;  2PW5 A;  4KKT A;  2F4V Q;  4QIW B;  1XNQ Q;  4MNO A;  3J7A V;  3TP8 A;  4QB4 A;  1LYL A;  4O2D A;  1JE5 A;  4FF2 A;  1XMQ L;  1XTD A;  4POG A;  3SGI A;  1O7Z A;  2CQA A;  3U58 A;  3JAM L;  2HDM A;  1PZI D;  3S1Q H;  1VQL A;  5JJK A;  5JPN C;  4HJ5 A;  1U4L A;  3H91 A;  3CHB D;  2G9D A;  4L5Q A;  4NXN Q;  3KLS A;  4XQJ A;  1K73 C;  5IGF A;  5A2Q E;  3I2Z A;  3KDF B;  2L1B A;  2L0C A;  1HTP A;  3PSI A;  5I2Y A;  5IP7 H;  1VQO A;  1PH1 A;  3M4O H;  3JAM E;  4OGQ C;  2F0W A;  2GN5 A;  2UXB L;  3A5Z B;  5C3W A;  1E2W A;  3BDO A;  2EVB A;  5M3F B;  1MJC A;  2CW0 C;  2P5Z X;  4R8I A;  4OON A;  4IUP A;  4X3K A;  3GTL B;  1WYD A;  3LWU A;  2KHJ A;  3SK6 A;  1ET6 A;  1QNK A;  1V1P A;  1I94 L;  4RWS C;  3KF6 A;  1VF5 C;  2F1M A;  1WCM B;  2VW9 A;  2IX1 A;  3A55 A;  1JQY D;  1VMC A;  2K5V A;  2YU9 B;  3SVM A;  2K5W A;  1DCZ A;  1WCM G;  4DR4 Q;  5EPJ A;  4GKJ Q;  1Q1B A;  1CHP D;  3ERO A;  1X3E A;  3TEH B;  1TQO A;  3CRK C;  1E24 A;  4WJ4 A;  2KQ3 A;  2UXD L;  3K7A H;  1Q3L A;  5AJ3 Q;  4RCN A;  4A3F H;  1TS4 A;  2V4D A;  2XTI A;  3MXN B;  4LJZ C;  3TBI B;  3U4V A;  4HID A;  2QDB A;  4JI6 L;  3MXP A;  4AIM A;  2JA6 G;  4A3I G;  1O7I A;  4OX9 L;  4LF6 L;  2MO1 A;  3OHX C;  4DKA C;  2I5L X;  4ID6 A;  4IOA A;  1IBM L;  2VB2 X;  1PRT D;  1WOC A;  3RLN A;  3MHB A;  4K8I A;  2B2Y C;  4X3U A;  1QCB D;  4BXX G;  1J5E Q;  1VQD A;  4JOI C;  2E76 C;  1D8L A;  3H0G H;  2Z4I A;  2GVA A;  3AMU A;  3GTQ H;  1DOK A;  3A8I E;  1AZQ A;  2Z6B A;  4AYB G;  5DM7 3;  5ELD A;  3MVV A;  1ASY A;  2A6E D;  2A69 D;  2NBF A;  1SE2 A;  4B3R Q;  1HR0 Q;  3SEB A;  3T1H Q;  3PIO A;  3NTI A;  3DUZ A;  2F0I A;  2JJQ A;  1GUN A;  4GZY C;  5D3I B;  2JA6 H;  1I4H A;  4OWT B;  2UXC L;  1UWV A;  3G7L A;  4UDU C;  3WOF A;  4B3T L;  2I46 A;  4LFA Q;  3N52 A;  4YCW A;  4HSP A;  1SYC A;  1SNP A;  4KTA A;  4A3F G;  1IW7 D;  1PYB A;  5IYC H;  4AH6 A;  1JOR A;  2RF4 A;  1KAA A;  1Y1W H;  3G6J B;  4K0K L;  4GLA C;  4LFB Q;  4NPS A;  1ESR A;  2E2I H;  2YTX A;  4X6A H;  4ULL A;  4F8M A;  4DR3 Q;  2C35 B;  1HJP A;  3BG3 A;  1LT5 D;  3AQQ A;  5DAU A;  4C1N I;  1Q86 C;  1BCP B;  2L5T A;  1TWC B;  2WII B;  3HKS A;  2DJF C;  4EQP A;  4POF A;  3HEJ A;  4ZCK A;  4DV0 Q;  4IFD J;  5HGT A;  1PTO C;  5C4X G;  2HHH Q;  3C46 A;  1XPR A;  3NXW A;  1EOV A;  4H7B A;  1QZH A;  1NAP A;  4IN3 A;  3CXC A;  3O13 A;  2NN6 G;  1TWG H;  4DXF A;  3KLR A;  1JB7 A;  3GTO H;  1CM9 A;  4Y7N B;  4YIJ A;  3GTM B;  4CJ2 C;  1N9W A;  4CDD C;  2ZXO A;  3LNN A;  3GQB A;  2B39 A;  3B6Y A;  3QR8 A;  4OX9 Q;  1AZP A;  3KJP A;  2SEB D;  4XT3 B;  3Q8D A;  1SAP A;  5GAG C;  4RG1 A;  4ME5 A;  2EY5 A;  1ROD A;  3GTP B;  5CV9 A;  4QQB X;  4WRD A;  4JBW A;  1CQV A;  2IX0 A;  5M3M B;  1D1I A;  1Z7T A;  4I7Z C;  4A93 H;  4C3H B;  1MBY A;  4QCL A;  2H1E A;  2B2W C;  4FF1 A;  4BA1 I;  1YJN A;  2E2H B;  2B8F A;  2KA7 A;  2R7F A;  1I4Q A;  4BY1 G;  1AE3 A;  4XDX A;  4X62 L;  1NE3 A;  3D0F A;  1S5F D;  1BCP F;  5M3F G;  2WAQ E;  4Q5V A;  3OMC A;  1WFQ A;  4B3M Q;  2B63 H;  5IP9 H;  3MZ5 A;  5G3L F;  5KYL A;  2Y0S E;  5I6W A;  1VQ4 A;  5FJ8 H;  1XPO A;  2RBM A;  2IWH A;  2UXD Q;  5EBC A;  4JI8 Q;  2VQF L;  1GJX A;  3NEL A;  2ZTD A;  3NWT A;  2RSN A;  3TRZ A;  4N9T A;  2R93 B;  1QE6 A;  1EQV A;  1WI5 A;  5IGC A;  1RJT A;  1R9T B;  4B3S Q;  1D6E C;  1LTI D;  4JVZ A;  2R92 B;  1TWF H;  1ESF A;  3EQL C;  2EOT A;  2K05 A;  2XRQ D;  4DU9 A;  3W1G A;  1CA6 A;  1GUT A;  3DM1 A;  3K58 A;  2A19 A;  4LFB L;  1TY2 A;  2X6L A;  4R4T A;  1M1K C;  4EQ5 A;  1IBK L;  1CSP A;  2K04 A;  1DZ1 A;  3H09 A;  4JI5 L;  3FKI B;  4AYB E;  4A3E B;  4YWM A;  4B08 A;  2ENB A;  2E8G A;  1O80 A;  1VQB A;  4C2M B;  4XT1 B;  3UDX A;  2EYP A;  2VL6 A;  5C5L A;  3ICE A;  5C0X G;  4UAI A;  1HNZ Q;  1E1T A;  2BCO A;  4CKB A;  1QVG A;  3HOZ G;  5M5W B;  1JMC A;  1LV9 A;  1NCV A;  3U9S A;  4C3I H;  4OWW B;  4B3R L;  1CZG A;  1PH7 A;  1VQC A;  3Q22 A;  3S17 H;  1PVO A;  2NN6 H;  3WOE A;  3A5U A;  1XYI A;  2QEJ C;  1STY A;  2B2U A;  2NWG A;  4LF8 Q;  2EQS A;  5C4X H;  3PMF A;  4DPG A;  4BY1 H;  1YNN C;  2E74 C;  2RVL A;  5L37 A;  3M4O B;  5ELF A;  2QDL A;  5C3E B;  1PFN A;  5M3F H;  2MFI A;  1IW7 C;  1OO9 B;  2OTJ A;  1YIJ A;  3GTG H;  3GTL H;  3WWV A;  4LF9 Q;  1WD1 A;  1NMF A;  3MTS A;  4KJO A;  2PNH A;  1EU4 A;  4P74 A;  3EVQ A;  4ZK9 B;  1CKO A;  4GLV B;  4CDE C;  2JA5 B;  1MKH A;  2EJM A;  3S1R B;  5IYC G;  2HQL A;  4KK7 A;  3I90 A;  2R93 G;  4U67 3;  3K5O A;  1EY7 A;  2OQ0 A;  3NBI A;  5C4Z A;  3I3C A;  5LL6 S;  4HIK A;  2BE5 C;  1GHJ A;  2MGS A;  3M3Y B;  2MPM A;  2NZH A;  1E2Z A;  3PF5 A;  1SSO A;  1E0B A;  2BE5 D;  1J5E L;  2ZXR A;  4FF3 A;  1T5E A;  2G5D A;  2KBN A;  3K8A A;  3PV0 A;  3H3V I;  1NNX A;  1C9O A;  2LFN A;  5D3D A;  2R7Z G;  4PMB A;  1YHQ A;  5IE8 A;  4K8J A;  2NZO A;  4RFB A;  1WVL A;  2RDF A;  3HOZ B;  3FMC A;  2VUM H;  3HOU B;  3CU7 A;  4ZRZ A;  5A35 A;  4WJW A;  2RA4 A;  1VQK A;  2YYZ A;  1H9J A;  3JAM i;  3OWF A;  3IKJ A;  4RKB A;  5KEE A;  3HG9 A;  1VQN A;  2QW7 A;  4QJF A;  4IUU A;  4AYB B;  1IKM A;  4MZ9 A;  5FK9 C;  2ASB A;  5BR8 L;  5E4W C;  2IPK D;  3F8T A;  3F2C A;  5M9O A;  2K01 A;  4IJH A;  1STA A;  3H0G B;  1EY0 A;  1K83 B;  1JIC A;  3DEP A;  2K5H A;  2NVQ H;  1EIH A;  1B44 D;  5FLX c;  1NMG A;  4C1N K;  5EJW A;  4TRD A;  4IFD G;  2I07 B;  1G2S A;  4FXG C;  3G71 A;  2NVY H;  1C48 A;  2K4K A;  3MWY W;  2F0M A;  1QZG A;  3KDF A;  5ELB A;  1PH6 A;  4FXD A;  2XN9 C;  4A3K G;  4DAY A;  1SYD A;  4KHP L;  1LTS D;  4LF4 Q;  3QOL A;  2CCZ A;  3I7F A;  4JI7 Q;  1K8G A;  3V05 A;  4ZQ3 A;  2KHI A;  3HOV H;  1KQS A;  3VR5 A;  1BF4 A;  4GOP A;  1JCK B;  1Q12 A;  2K7V A;  4JI6 Q;  2RCF A;  5JJZ A;  1KL9 A;  4K2K A;  4DR2 L;  5FLM G;  2MQH A;  1VDZ A;  1GO3 E;  4C3J G;  2F0T A;  2BA1 A;  2K33 A;  1DOM A;  4HIO A;  3RMH A;  4KY5 A;  4GNX C;  1KRT A;  1B9M A;  3K5M A;  2B2W A;  3QOJ A;  3PCO B;  2Z6K A;  1H9K A;  5DM6 3;  2PZT A;  3R2T A;  4HSV A;  2UUC Q;  5EPL A;  4CBV A;  2MHV A;  4L5T A;  1JWS D;  2XWB B;  3HOU G;  5LMN L;  3VR2 A;  2CFM A;  1CK1 A;  2K52 A;  1E7Z A;  1S5B D;  1YBY A;  3TS0 A;  1N34 Q;  1LTR D;  1Y1V G;  5IGG A;  3Q0A A;  2Q8R E;  4AQY Q;  4H13 C;  5CV5 A;  3MFY A;  4UY8 C;  3VDY A;  4C3I G;  3LWE A;  4DR7 L;  1HR0 L;  1IL2 A;  3GTM H;  2RQX A;  3Q24 A;  4JYA L;  4QY7 A;  4YHH L;  5E1F A;  4AQY L;  1QUQ A;  4KKU A;  1PZK D;  4NXM Q;  3K57 A;  3H3V H;  2MO0 A;  1FYC A;  2NZ1 D;  3C3L A;  4OL7 A;  4PZ7 A;  3D3R A;  3M7G A;  3PO2 B;  3C2P A;  4BBS G;  1CFM A;  1XNQ L;  2K03 A;  2KVM A;  4M8A A;  4QUC A;  5COY A;  5C4J B;  4EX5 A;  3TRE A;  1WJJ A;  2F0Q A;  1A8V A;  5LMU L;  4IUR A;  4O0A A;  1W3S A;  1C0A A;  1DD2 A;  1B8A A;  5EKK A;  3S2D B;  1I4P A;  3SK4 A;  3PF4 A;  1GUS A;  1QUQ B;  2JEB I;  1N33 Q;  3J7Y W;  4A3F B;  4DV6 Q;  4APV A;  1EY6 A;  4K6L A;  1TY0 A;  2DY7 A;  3NQI A;  1G6Z A;  3T56 B;  2RCN A;  3ONA B;  4ABN A;  4K2L A;  3BZK A;  1DOL A;  1LUZ A;  1LT3 D;  1I3Q H;  4ZUJ A;  4ZAI A;  1F9R A;  3GTK H;  1EOT A;  3RZO B;  5CV4 A;  2N88 A;  2R93 H;  2K28 A;  1YHB A;  3S1N B;  1R9T H;  2BH2 A;  3FPU B;  4DNI A;  4R4O A;  1RF2 D;  1TWF B;  3I4N B;  1MHW C;  3HKZ B;  1VQ6 A;  1L1O B;  1SNC A;  2B8G A;  3VYR A;  4A3L G;  3I8Z A;  5JEA G;  2R3Z A;  4OO1 I;  1Z6H A;  1F9Q A;  1JWU D;  3BYT B;  4IPH A;  1S5D D;  4DV1 Q;  4GKK L;  4B3M L;  4QF4 A;  3GTQ B;  2E5L Q;  1VMP A;  4DNT B;  4JYA Q;  4FDB A;  3M4Q A;  4RGT A;  2PQA A;  1Y14 B;  1X3G A;  1BBW A;  4GN4 B;  5BR8 Q;  4RMF A;  1NUC A;  2JYO A;  2E5L L;  4DV6 L;  4DN4 M;  3MXN A;  2B29 A;  1EQQ A;  3J80 i;  2JA6 B;  2BDO A;  5M5W H;  1PFS A;  5CC4 A;  3BJU A;  1CA5 A;  3NQT A;  2F0S A;  2N78 A;  3TZD A;  1C4Q A;  2YV5 A;  2F4V L;  1KNA A;  2OWO A;  2PYK A;  2Z9H A;  3U4Z A;  4NXM L;  4DR1 Q;  4A3C H;  1EIF A;  3OYY A;  5E4X A;  2HIV A;  4BY1 B;  4DV2 Q;  2E2I B;  4LAA A;  5CBE E;  3PUZ A;  2RDH A;  3GO5 A;  4TSS A;  3RNU A;  1F2L A;  4J1M A;  5M3M G;  2VS1 A;  1IBL L;  2RHS B;  1AE2 A;  1YEZ A;  4JV5 Q;  1NTG A;  2OCE A;  4JW0 A;  4PZ8 A;  2Q8I B;  5AFW A;  4N8X 1;  4DAY B;  5K5P A;  2K5D A;  2AKW B;  4N8F A;  1WTR A;  5GRO A;  4QMG A;  3PGZ A;  3MXU A;  3QG1 A;  3GTO B;  2PNR C;  5IYD G;  4ZUI A;  3CCM A;  1Q90 A;  4JBK A;  3J81 j;  1TII D;  3LGJ A;  4DK6 C;  4NMZ A;  1K0S A;  1ENF A;  2VQE Q;  1R4Q B;  3W5O A;  3Q6S A;  3OTO L;  5COR A;  1U5K A;  1PH4 A;  4UP7 A;  3HOW B;  1W6J A;  4IUT A;  4HJ9 A;  3X3M A;  1C7Y A;  2A8V A;  2VQE L;  1EIG A;  3A7A B;  1NBW A;  3J81 c;  1KNE A;  4FVM A;  4IUQ A;  1XNR Q;  1HZ9 A;  4FO2 A;  4LK1 C;  3S16 B;  4K5X A;  1SDF A;  2F0O A;  1YNX A;  4CGY B;  1C8C A;  5T1I A;  3IRB A;  1FR3 A;  1HNZ L;  1EWI A;  2HIX A;  3HGB A;  3S14 B;  3E5S A;  1K28 A;  3WDN A;  2N3S A;  4RHR A;  3J7Z C;  2WB1 G;  1Q82 C;  1DGS A;  3VA5 A;  1IKL A;  4OO1 H;  4BY7 H;  4JI1 Q;  2PMZ B;  2ZT9 C;  3KF6 B;  5JVH 3;  5GAH C;  1SYE A;  1Q46 A;  3DWP A;  4U68 A;  2NVQ B;  2B63 B;  2ZM6 L;  1M90 C;  1HZA A;  4DK1 A;  2HT1 A;  1RTN A;  1CTM A;  2MP1 A;  2NVY B;  5IYB H;  5CBA E;  3M85 A;  2SDF A;  2HD3 A;  4F7X A;  2NN6 I;  5C44 G;  3HZX A;  2EYH A;  4M1U B;  1A15 A;  3TQY A;  2VXW A;  2R92 H;  1D5M C;  3A74 A;  3PIP 3;  1CQF A;  4B9W A;  2M9V A;  4O1N A;  3UDG A;  1SYF A;  3TP5 A;  3C1E A;  1B4O A;  1BQQ T;  1MSG A;  4X3T A;  3S15 H;  3D8G A;  4A3D G;  1FGB D;  5T1G A;  2R7D A;  1ENC A;  1I4R A;  2L11 A;  3CCV A;  3H3V C;  3SK5 A;  2A5H A;  4BS9 A;  4C2M H;  1G8Z D;  5LMU Q;  4PQX A;  3HOX G;  1K3B C;  1L0Y B;  1L1O C;  4LF7 Q;  2EIF A;  1MJE A;  5KIX A;  1V43 A;  1HHV A;  1VQE A;  4FNF A;  3TP7 A;  3ULL A;  1K0R A;  3G48 A;  3OIQ A;  1A2U A;  1MIU A;  1S3O A;  5M5X B;  2PQA B;  2VNU D;  2BDN A;  3KF8 B;  2O5J C;  4RGN A;  2L12 A;  4C3I B;  2BA0 A;  5CYU A;  2FMM A;  5FOB B;  2UXB Q;  1IHZ A;  2X69 A;  4RCO A;  4OWX B;  1YJ9 A;  3S17 B;  1LTG D;  1A2T A;  2KJX A;  1OXT A;  4P2C B;  1VQ5 A;  2X6G A;  4DAP A;  1RTO A;  3KBG A;  3EA6 A;  4E6I A;  3G6E A;  4LF8 L;  1UAP A;  1PLF A;  1FNW A;  1GM5 A;  2JP1 A;  4K0K Q;  2J7Z A;  2WB1 B;  4BBR G;  1SR3 A;  3SK8 A;  4X62 Q;  2QEX A;  2F0H A;  1ONL A;  1GVP A;  2JQO A;  3TN2 A;  1MI2 A;  2LSS A;  3FKI G;  1PFB A;  3DM3 A;  3CCJ A;  5FLX E;  1UE5 A;  2FIN B;  5C4J H;  1HNX L;  2A73 B;  1I6H B;  3H15 A;  3S1R H;  4GLX A;  2XIW A;  2XRS D;  4DV5 L;  3CP0 A;  4LMQ D;  1EY9 A;  1X65 A;  5IYB G;  5D14 A;  4XQN A;  4DR5 Q;  1SYG A;  1T5X D;  3UE1 A;  1SE4 A;  4KJN A;  1ILQ A;  2OT2 A;  1Y1W G;  1EUJ A;  3OW2 A;  1XXG A;  3S2D H;  2XNA C;  1A3V A;  3URY A;  1B53 A;  4NDX A;  1UUP A;  1BBX C;  4P71 A;  4KHZ A;  5E7N A;  2Q2T A;  1RL2 A;  3NBH B;  1S72 A;  4DV1 L;  4GKK Q;  4GN5 A;  1STN A;  5M5Y B;  4HN7 A;  4BA2 I;  4MHE A;  3L7Z C;  3NPP A;  1IYU A;  3A7L A;  1SEB D;  3HOU H;  1HQR D;  2ICE C;  3AYH B;  2EXZ A;  1EEF D;  5LMN W;  4UPA A;  3GTK B;  1VQF A;  3JAM c;  2Z4H A;  4N9P A;  3BS1 A;  3S1N H;  1TWH H;  1V8Q A;  3PIO 3;  3CCQ A;  3CCL A;  2EY1 A;  1KLU D;  2NB0 A;  3NEN A;  3K7U C;  1VQJ A;  1U9R A;  3I4N H;  1QB5 D;  2FFK B;  2Q2H A;  1LTL A;  3DHQ A;  4A4I A;  3L3O C;  1Q81 C;  1HA6 A;  2D2C C;  2Y0S G;  3P1H A;  1L0X B;  4PMW A;  4KHP Q;  2RHQ B;  3P75 A;  4A3D H;  1OTC A;  1Y69 U;  5KRU A;  2BOS A;  4YWK A;  1CT1 D;  4BXX H;  1PDQ A;  2KEN A;  1KDA A;  1K83 H;  3NWS A;  2KEE A;  3GV6 A;  3SXH A;  3CC4 A;  4DR1 L;  1YNJ D;  2A68 D;  4DAM A;  3EBE A;  4O42 A;  5C5M A;  1FNV A;  1YNJ C;  2A68 C;  3S24 A;  3HOY H;  2ZJP A;  4DUY Q;  2WP8 J;  3I91 A;  1BOS A;  4JBJ A;  2O5I C;  3P20 A;  2Q2U A;  1B3A A;  4JI0 L;  4DFA A;  1K8M A;  4FYD A;  4CKC A;  1DXM A;  1HNW L;  2N55 A;  2A74 C;  2E75 C;  3W2D A;  3MA2 B;  1TR5 A;  4I7A A;  1ILP A;  2I5M X;  1Q1E A;  3HOV B;  5LL6 X;  1PA6 A;  2EY6 A;  1BCP D;  3H6M A;  5E3F A;  1RCV D;  2N8N A;  3OPO A;  1F2Z A;  4A3B G;  1JC7 A;  1X56 A;  1SXT A;  4A3J B;  1KHI A;  5CV7 A;  1ZEQ X;  1IYV A;  3CAM A;  4DUZ Q;  2CH4 W;  3KLW A;  4LUO A;  1QG7 A;  2F4I A;  1RKN A;  3ER0 A;  3F2U A;  3I4M B;  3QB3 A;  2SNM A;  3PO3 G;  2Z8L A;  3TZU A;  3PUV A;  3CMA A;  1T9H A;  1BDO A;  5GAD C;  1NR4 A;  4HCS A;  3MEF A;  4DAV A;  4K6D A;  4IUN A;  3FHW A;  4YCV A;  5FJ8 G;  1H9S B;  4QL5 A;  3HS0 C;  1BO0 A;  3K80 C;  3T16 A;  1SYB A;  5ELN A;  3UDI A;  3BU2 A;  1WTX A;  2Z6K C;  3CD6 A;  1J8I A;  1F2Y A;  1BXT A;  4IZ8 A;  3VR3 A;  3CC2 A;  1IBL Q;  1IYJ B;  2F3I A;  3JC6 6;  4NXN L;  3HOW H;  2JA7 G;  4DA2 A;  3PO2 H;  1U4R A;  2RKS A;  1GD7 A;  1K8A C;  2AUK A;  4DNR B;  3SDZ A;  3CME A;  2JA7 H;  5IGB A;  2ZTC A;  1PZJ D;  4L8J A;  5CGK A;  3I4O A;  2C9O A;  3NP8 A;  4KD4 A;  5TSS A;  5G3L D;  3U9O A;  1B7Y B;  1D5Z C;  1PMR A;  2I0Q A;  5IGD A;  4IOC A;  5ISR A;  1LT6 D;  2WAQ G;  1GUO A;  2R6G A;  1UE1 A;  1XWE A;  1SFO H;  1EU3 A;  4XIG S;  1S40 A;  2B2T C;  2F3W A;  2G9H D;  4HIM A;  3CQZ H;  1XJV A;  1STB A;  3K0X A;  2Z1C A;  1IBM Q;  2JK8 A;  1I3Q B;  1Z9F A;  4GNX B;  2LMC B;  1HUM A;  5EKI A;  3BVG A;  3S2H B;  3RZO H;  3KJO A;  3D31 A;  1UE6 A;  1V1O A;  3HKZ E;  2JEA I;  1CKN A;  4LFC Q;  4EQN A;  4ZKB B;  1CHQ D;  4CJ1 B;  2CWP A;  4IPG A;  4DV2 L;  4A3M G;  4A3G G;  4JCV E;  3FVQ A;  2B2T A;  1I94 Q;  2EYM A;  2PZW A;  1STG A;  2KCN A;  2D5D A;  1YI2 A;  2D9U A;  3V96 A;  1NY4 A;  1F2M A;  3I56 A;  1FL0 A;  5DNF A;  1ZYR C;  2OQK A;  1I5F A;  4XYQ A;  3K59 A;  3OW7 A;  4A76 A;  4JBM A;  3N6R A;  1PYS B;  4QGU A;  4X66 Q;  2H4O A;  2FHT A;  4PMC A;  1WTW A;  4OIK A;  2IHF A;  4KN4 C;  4DF7 A;  2F03 A;  4WOR A;  1YNN D;  3KK7 A;  1Y1V H;  3NE5 B;  1HH2 P;  3DXJ C;  4IQZ A;  3HOY G;  5I4D A;  3QIA A;  5C0X J;  2JE6 I;  1EL0 A;  2QF7 A;  1KD1 C;  3T4A C;  4EGV A;  1JOO A;  3H94 A;  4LFC L;  3UI2 A;  4PG3 A;  3KLS X;  1SRO A;  1Y8O B;  1QJO A;  1Q7Y C;  2EYF A;  3E0E A;  3J80 E;  3FRP B;  1FVI A;  3SE0 A;  3S1M B;  2L15 A;  4DV5 Q;  1QIL A;  4CJ0 B;  2R7Z H;  3MFG A;  1TWA B;  1JOK A;  1J6Q A;  3PO3 H;  1HTL D;  3VYU A;  4A3J G;  3ND9 A;  2IY5 B;  1GUW A;  1I50 H;  1B50 A;  1X3Q A;  1ML0 D;  5IGE A;  4HTH A;  3M9B A;  4BBS B;  3BVM A;  3H0G G;  4OHJ A;  4JI4 Q;  4A93 G;  1PH9 A;  5K36 G;  1SE8 A;  4RGO S;  4DR7 Q;  1ASZ A;  3M4P A;  1BR9 A;  2OF1 A;  3OWE B;  2AMC B;  3BDL A;  4JG2 A;  4L5R C;  3K0Y A;  2UUA L;  3F2B A;  1EWH A;  4A3K H;  3NEM A;  4P73 A;  5LMN Q;  4HAE A;  4KV6 A;  1SJH D;  2HCI A;  5IY0 A;  4DR4 L;  4GKJ L;  4A3I H;  3MAQ A;  1V1P B;  1HXY D;  5GAE C;  5CMD A;  4IFD H;  4DV7 Q;  3L0O A;  4OEL B;  2OEO A;  1VQ9 A;  4ALP A;  3J80 L;  4X64 Q;  3BZC A;  2R61 A;  2IW3 A;  3FPP A;  1SN8 A;  3IL8 A;  1PH8 A;  3RN5 A;  4LNQ A;  1JT8 A;  1BVS A;  2HCC A;  2IL8 A;  2EYO A;  4JI5 Q;  2EE1 A;  2F3V A;  5ELC A;  4Z9C B;  4JI4 L;  4L63 B;  5IOC A;  1OXV A;  1PYW D;  1E2V A;  1H9R A;  4XTC S;  1V1Q A;  3VYT A;  1X55 A;  1VF7 A;  1SJE D;  4WFN 3;  1VQP A;  1YHA A;  1I6V C;  3HP3 A;  1HR0 W;  1EZ6 A;  3S16 H;  1TWH B;  3GTJ H;  4DV3 L;  3CC7 A;  1FNU A;  3TS2 A;  3S14 H;  5BN4 A;  1SNQ A;  2UUA Q;  5HUR A;  3TME A;  1EY5 A;  4CKE A;  2ZXP A;  3A54 A;  2LXJ A;  2RDG A;  5H1S E;  4BY7 B;  1PH5 A;  1FJG Q;  2JA8 H;  1FGU A;  1XTC D;  3GP7 A;  3BZD B;  3VR4 A;  1H9M A;  1BUV T;  4G4K A;  1HNX Q;  4KMU C;  1X3F A;  2KUM A;  5JAV A;  2CKZ B;  2JA8 G;  3W3A A;  3ZJY C;  5A2Q L;  1DYQ A;  4PZ6 A;  4H44 C;  4R4Q A;  2F0F A;  4F88 A;  3RZD B;  4MIU A;  3CCU A;  2K5Q A;  2AHO B;  1LTA D;  3I70 A;  3CF5 A;  4HR7 B;  3IAY A;  4RHS A;  2QIL A;  3NUC A;  1G91 A;  2EY2 A;  3FEW X;  1EZ8 A;  3E3X A;  2D0O A;  4KHV A;  4C3H G;  4R8N A;  3NHH A;  1NSN S;  1Q8I A;  2F0G A;  4CDF C;  3S15 B;  4IO9 A;  5FO8 B;  1PXU A;  3M4Y A;  1BNZ A;  4EQO A;  3KF8 A;  5CV6 A;  2KEC A;  2M2L A;  2F0E A;  2PO4 A;  2E2J H;  4A3G B;  3X3N A;  1BKB A;  4HMI A;  3A0J A;  4A3J H;  2B2U C;  4DUZ L;  4DUY L;  1I4G A;  2YTY A;  5JJL A;  3AEV A;  1S5C D;  3ITP A;  4BBR H;  1XMO Q;  3ZYY X;  5C44 H;  1TS5 A;  2YTV A;  4G7Z C;  1HRJ A;  1PTO F;  1EWC A;  4OEM B;  2CHB D;  3I4M H;  4DR2 Q;  1KDC A;  3OOC A;  4OXP A;  1X3P A;  1PV4 A;  2MNA A;  4FP5 D;  5M5X H;  3RN2 A;  3NSW A;  1ZYR D;  2PQE A;  3KFU A;  3AFP A;  5ELO A;  4GNX A;  3CCR A;  3R93 A;  1DM0 B;  4LF4 L;  2WAQ B;  3OIP A;  4JI3 L;  3EJI A;  4KKS A;  1OXX K;  3EIV A;  1LO5 D;  1SLJ A;  1HUN A;  2WB1 E;  4YCU A;  2Q2I A;  4RAU C;  1HZC A;  4IAL A;  1N8R C;  3R2I A;  1MD2 D;  3PUX A;  2B2Y A;  2L9H A;  4F87 A;  1E22 A;  4RA8 A;  2VB3 X;  5AJ3 L;  5K36 H;  1RD9 D;  3L9A X;  4NB3 A;  3A8K E;  4H0L C;  3K6O A;  4PV1 C;  2GA4 B;  4V19 0;  4LW1 A;  1A3T A;  1LAC A;  4XXE A;  4HJ8 A;  2DGY A;  1II3 A;  3CCE A;  1QVF A;  2ZJQ A;  1TT2 A;  2RSO A;  5FO9 B; 
#chains in the Genus database with same CATH homology
 1F9S A;  2ICI A;  2NVT B;  4KN7 C;  5IT9 L;  4ZKC B;  2F0D A;  2AWN A;  1D5X C;  1AEX A;  1LT4 D;  2HUG A;  4NW2 A;  2D62 A;  2CVR A;  2Q8T A;  3D6W A;  4ODG A;  3S9W A;  1PRT B;  1DJR D;  1FD7 D;  2TMP A;  4ILW A;  3I73 A;  5EQ0 A;  2IT1 A;  5J1Z A;  3GV3 A;  1SNO A;  5EKL A;  1HFN A;  1AP0 A;  3J7A F;  3HOX B;  1GOZ A;  1EYA A;  5JEA H;  2KCC A;  1LAB A;  3TDQ A;  2J0T D;  4A3B B;  1MSH A;  3J81 E;  3CRL C;  5IT9 E;  4A3D B;  5J22 A;  4KD3 A;  5FLX L;  3GD7 A;  1EYD A;  3DWQ A;  1EEI D;  5FO7 B;  4B9X A;  1HFG A;  1QWY A;  5IIF A;  3SR1 A;  2OXP A;  3QO2 A;  3HOY B;  3S1Q B;  3IFD A;  4R9W A;  3MC0 B;  3CKI B;  4DK0 A;  1G2T A;  1JE4 A;  2PZU A;  1RHP A;  2F0P A;  3M7N A;  2FJ2 A;  1EYC A;  2XVS A;  2AQ2 B;  1ENA A;  4CHT B;  4OIJ A;  2MJ8 A;  2LS0 1;  4C56 C;  5KNC A;  3PO3 B;  2JSO A;  2Y0S B;  1PTO H;  1O78 A;  1B2T A;  1UEA B;  1EY8 A;  2F0K A;  2O2L D;  2MUY A;  3KBX A;  5KND A;  4KI0 A;  4DXG A;  1HQM C;  3DEO A;  3K7A B;  2J4X A;  5EGT A;  1ICW A;  4A3K B;  1EY4 A;  1J9O A;  1STE A;  3VR6 A;  3D6C A;  4ZLT F;  1RDP D;  5EBD A;  2O4X A;  4TQU S;  4K5V A;  5DEH A;  4JK1 C;  1JWM D;  3OSO A;  2DNE A;  4I65 A;  3ND8 A;  2K1B A;  1ET9 A;  1XX8 A;  4FXK C;  4EVO A;  1UNS A;  2WV6 D;  2PPB C;  2JA7 B;  2IJ0 A;  4XQQ A;  2F0L A;  1PTO D;  4HMJ A;  3T51 B;  1IL8 A;  3GTJ B;  4TKO B;  1SND A;  1NR2 A;  3R8B A;  4A3M B;  5I6Y A;  1LTB D;  2NUC A;  3IFT A;  4IUV A;  4G57 A;  1SMY C;  3LX0 A;  1R4P B;  3D4R A;  1SFO B;  3VYS A;  2JA8 B;  4G7H C;  1TS3 A;  4KY6 A;  3PUY A;  3TP6 A;  2DN8 A;  5C6A A;  3CQZ B;  1AFP A;  5KNB A;  4HCE A;  4X3S A;  4K5W A;  3RUZ A;  3C1F A;  4J6H A;  3V2T A;  1D1K A;  2DNC A;  1Y1W B;  1A6X A;  1EFI D;  2AUJ D;  1CZW A;  2EDG A;  1STH A;  1F9P A;  2K32 A;  1W6K A;  2LY7 A;  2A6E C;  2E2J B;  1GHK A;  1ZXT A;  2L4N A;  1WTV A;  1H9S A;  2EJF C;  1TWG B;  4Q0F A;  3K5L A;  4NP5 A;  1TKW B;  2F0V A;  1HA5 A;  1Y1V B;  1U4M A;  5I2X A;  1WTQ A;  1PRT C;  1KTK A;  3E6Z X;  2A6H D;  3TSS A;  2KOL A;  1ZKO A;  2TSS A;  2NTT A;  3NK9 A;  2SOB A;  2HQE A;  4S3S A;  2KED A;  1KLG D;  2F0N A;  2M00 A;  1GXD C;  3SHL A;  3QWN A;  2DY8 A;  2R7Z B;  3MXG A;  3P7J A;  3A56 A;  2JXM B;  1WTP A;  1I50 B;  2QKI C;  5C0X I;  1D2B A;  4NKL A;  5KGU A;  2QCP X;  4QUF A;  3J81 L;  1HPC A;  2F0J A;  1S5E D;  1SNM A;  3RD4 A;  3VA7 A;  2NTS A;  2HDL A;  3R3O A;  3EFX D;  2PW7 A;  4A3I B;  4J8Q A;  1KAB A;  1SBB B;  5J39 A;  3ERQ A;  5IOD A;  5JVG 3;  1O7L A;  3D4W A;  1PRT F;  3AU7 A;  1AN8 A;  5BN5 A;  1S4Z A;  2B2V A;  1EQT A;  3K5N A;  2L55 A;  5D65 A;  1LTT D;  1CI3 M;  5C3X A;  3MEH A;  2EPB A;  1M8A A;  4V0B A;  1TU2 B;  5FKA C;  3NBH A;  3Q23 A;  3AB9 A;  5JOB A;  2A69 C;  4L6T B;  2A6H C;  4DGZ A;  4PNY A;  2WAC A;  1Z47 A;  5C4X B;  1DON A;  4OO1 G;  5ELE A;  5CV8 A;  1PFM A;  3BVZ A;  1A3U A;  3KUP A;  1AW7 A;  1HCZ A;  5C0X H;  1Y8N B;  3GTG B;  4FF4 A;  4HED A;  1PTO B;  3BYY B;  1VCI A;  4BWG B;  5I9O A;  4IFD I;  2IX3 A;  2ID0 A;  3HRZ C;  4BBR B;  5C44 B;  3A8J E;  5NUC A;  3FDT A;  2XWJ B;  5F2D A;  1LLR D;  2NYZ D;  5C4H A;  1QNU A;  1QOH A;  2E2D C;  2LKV A;  3D4D A;  3NTH A;  4G7O C;  3BDC A;  4MN3 A;  3OMG A;  4RGM A;  2VUM B;  1JR0 D;  2EYJ A;  2K6A A;  1B1Z A;  1JOQ A;  4K14 A;  2B2V C;  1MGS A;  1SMY D;  2CW0 D;  4A93 B;  3T13 A;  1OXS C;  2PCF B;  1O7Y A;  5BN3 A;  4RH6 A;  3RLF A;  2EZV A;  5I9P A;  1B9N A;  4RKL A;  3QJY A;  3E0J A;  2KHS A;  5KYI A;  1GUG A;  1M4V A;  5EPK A;  5LHY 1;  2XSC A;  2NVX B;  1G29 1;  3DMU A;  2WKC A;  1BCP C;  1K8O A;  2AWO A;  1X32 A;  1WTO A;  1SE3 A;  3PUW A;  1WD0 A;  5JEA J;  1F77 A;  4KY7 A;  4XYO A;  2EYL A;  3DWA A;  2FMC A;  1TS2 A;  3I4L A;  3T53 B;  1Y8P B;  1I4X A;  1JB3 A;  4ZYS A;  1OXU A;  3NTK A;  2F0U A;  5CR3 A;  2SNS A;  3I72 A;  1KDB A;  2WIN B;  2WKD A;  2AQ1 B;  1TVX A;  4C3J B;  2EJG C;  2AQ3 B;  1U4P A;  2C5C A;  5JPM C;  2PW5 A;  4KKT A;  4QIW B;  3J7A V;  3TP8 A;  4QB4 A;  4FF2 A;  1O7Z A;  2CQA A;  3JAM L;  2HDM A;  1PZI D;  5JPN C;  1U4L A;  3H91 A;  3CHB D;  2G9D A;  3KLS A;  4XQJ A;  5IGF A;  5A2Q E;  2L1B A;  2L0C A;  1HTP A;  5I2Y A;  3JAM E;  4OGQ C;  2F0W A;  5C3W A;  1E2W A;  3BDO A;  2EVB A;  5M3F B;  2CW0 C;  4R8I A;  4IUP A;  4X3K A;  3GTL B;  3LWU A;  3SK6 A;  1ET6 A;  1QNK A;  1V1P A;  4RWS C;  1VF5 C;  2F1M A;  1WCM B;  2IX1 A;  3A55 A;  1JQY D;  1VMC A;  2YU9 B;  3SVM A;  2K5W A;  1DCZ A;  5EPJ A;  1Q1B A;  1CHP D;  3ERO A;  1TQO A;  3CRK C;  2KQ3 A;  1Q3L A;  4RCN A;  1TS4 A;  2V4D A;  4LJZ C;  3TBI B;  2QDB A;  3MXP A;  3OHX C;  4ID6 A;  2VB2 X;  1PRT D;  3MHB A;  4K8I A;  2B2Y C;  4X3U A;  1QCB D;  2E76 C;  2Z4I A;  3AMU A;  1DOK A;  3A8I E;  1AZQ A;  5DM7 3;  5ELD A;  3MVV A;  2A6E D;  2A69 D;  2NBF A;  1SE2 A;  3SEB A;  3NTI A;  3DUZ A;  2F0I A;  1GUN A;  4GZY C;  5D3I B;  1I4H A;  3G7L A;  4UDU C;  3WOF A;  2I46 A;  3N52 A;  4HSP A;  1SYC A;  1SNP A;  4KTA A;  1IW7 D;  1JOR A;  1KAA A;  3G6J B;  1ESR A;  4ULL A;  4F8M A;  3BG3 A;  4C1N I;  1LT5 D;  5DAU A;  1BCP B;  2L5T A;  1TWC B;  2WII B;  4EQP A;  3HEJ A;  4IFD J;  5HGT A;  1PTO C;  3C46 A;  3NXW A;  4H7B A;  1NAP A;  4IN3 A;  3O13 A;  2NN6 G;  4DXF A;  3KLR A;  1CM9 A;  4Y7N B;  4YIJ A;  3GTM B;  4CJ2 C;  2ZXO A;  3LNN A;  3GQB A;  2B39 A;  1AZP A;  2SEB D;  4XT3 B;  1SAP A;  4ME5 A;  2EY5 A;  1ROD A;  3GTP B;  5CV9 A;  4WRD A;  4JBW A;  1CQV A;  2IX0 A;  5M3M B;  1D1I A;  1Z7T A;  4I7Z C;  4C3H B;  1MBY A;  4QCL A;  2H1E A;  2B2W C;  4FF1 A;  4BA1 I;  2E2H B;  2B8F A;  2KA7 A;  1I4Q A;  4XDX A;  1S5F D;  1BCP F;  4Q5V A;  3OMC A;  3MZ5 A;  5G3L F;  5KYL A;  5I6W A;  2RBM A;  2IWH A;  5EBC A;  1GJX A;  3NWT A;  2RSN A;  4N9T A;  2R93 B;  1QE6 A;  1EQV A;  5IGC A;  1RJT A;  1R9T B;  1D6E C;  1LTI D;  2R92 B;  1ESF A;  3EQL C;  2EOT A;  2K05 A;  2XRQ D;  4DU9 A;  1CA6 A;  1GUT A;  3DM1 A;  3K58 A;  1TY2 A;  2X6L A;  2K04 A;  1DZ1 A;  3H09 A;  3FKI B;  4A3E B;  4B08 A;  2ENB A;  1O80 A;  4C2M B;  4XT1 B;  2EYP A;  5C5L A;  5C0X G;  4UAI A;  2BCO A;  4CKB A;  5M5W B;  1LV9 A;  1NCV A;  3U9S A;  1CZG A;  3Q22 A;  2NN6 H;  3WOE A;  1XYI A;  1STY A;  2B2U A;  2NWG A;  2QEJ C;  3PMF A;  1YNN C;  2E74 C;  2RVL A;  3M4O B;  5ELF A;  5C3E B;  1PFN A;  1IW7 C;  1OO9 B;  1WD1 A;  3MTS A;  4KJO A;  1EU4 A;  3EVQ A;  4ZK9 B;  2JA5 B;  2EJM A;  3S1R B;  4KK7 A;  3I90 A;  4U67 3;  3K5O A;  1EY7 A;  3NBI A;  5C4Z A;  3I3C A;  5LL6 S;  2BE5 C;  1GHJ A;  2MGS A;  3M3Y B;  2MPM A;  1E2Z A;  1SSO A;  1E0B A;  2BE5 D;  2ZXR A;  4FF3 A;  1T5E A;  3PV0 A;  5D3D A;  2LFN A;  4PMB A;  4K8J A;  4RFB A;  1WVL A;  2RDF A;  3HOZ B;  3FMC A;  3HOU B;  3CU7 A;  4ZRZ A;  5A35 A;  4WJW A;  2RA4 A;  2YYZ A;  1H9J A;  3OWF A;  3IKJ A;  4RKB A;  5KEE A;  3HG9 A;  4IUU A;  4AYB B;  1IKM A;  5FK9 C;  5E4W C;  2IPK D;  5M9O A;  2K01 A;  1STA A;  3H0G B;  1EY0 A;  1K83 B;  1JIC A;  3DEP A;  1EIH A;  1B44 D;  4C1N K;  5EJW A;  4TRD A;  4IFD G;  2I07 B;  1G2S A;  4FXG C;  1C48 A;  3MWY W;  2F0M A;  5ELB A;  4FXD A;  2XN9 C;  4DAY A;  1SYD A;  1LTS D;  3QOL A;  3V05 A;  4ZQ3 A;  3VR5 A;  1BF4 A;  1JCK B;  1Q12 A;  2K7V A;  5JJZ A;  4K2K A;  1VDZ A;  4C3J G;  2F0T A;  2BA1 A;  2K33 A;  1DOM A;  3RMH A;  4KY5 A;  1B9M A;  3K5M A;  2B2W A;  3QOJ A;  1H9K A;  5DM6 3;  2PZT A;  3R2T A;  4HSV A;  5EPL A;  4CBV A;  2MHV A;  1JWS D;  2XWB B;  3VR2 A;  1CK1 A;  1S5B D;  1LTR D;  3Q0A A;  5IGG A;  2Q8R E;  4H13 C;  5CV5 A;  3MFY A;  4C3I G;  3LWE A;  2RQX A;  3Q24 A;  5E1F A;  4KKU A;  1PZK D;  3K57 A;  1FYC A;  2NZ1 D;  3C3L A;  4OL7 A;  3D3R A;  3M7G A;  3PO2 B;  3C2P A;  1CFM A;  2K03 A;  2KVM A;  4M8A A;  4QUC A;  5COY A;  5C4J B;  2F0Q A;  4IUR A;  1DD2 A;  5EKK A;  3S2D B;  1I4P A;  3SK4 A;  1GUS A;  2JEB I;  3J7Y W;  4A3F B;  1EY6 A;  3NQI A;  1TY0 A;  2DY7 A;  4K6L A;  1G6Z A;  3T56 B;  3ONA B;  4ABN A;  4K2L A;  1DOL A;  1LT3 D;  4ZUJ A;  4ZAI A;  1F9R A;  1EOT A;  3RZO B;  5CV4 A;  2N88 A;  2K28 A;  3S1N B;  3FPU B;  1RF2 D;  1TWF B;  3I4N B;  3HKZ B;  1SNC A;  2B8G A;  3VYR A;  3I8Z A;  5JEA G;  2R3Z A;  4OO1 I;  1Z6H A;  1F9Q A;  1JWU D;  3BYT B;  1S5D D;  4QF4 A;  3GTQ B;  1VMP A;  4DNT B;  4RGT A;  1NUC A;  2JYO A;  4DN4 M;  3MXN A;  2JA6 B;  2BDO A;  5CC4 A;  1CA5 A;  3NQT A;  2F0S A;  3TZD A;  1C4Q A;  1KNA A;  2PYK A;  5E4X A;  4BY1 B;  2E2I B;  4LAA A;  5CBE E;  3PUZ A;  2RDH A;  3GO5 A;  4TSS A;  1F2L A;  4J1M A;  2Q8I B;  5AFW A;  5K5P A;  2K5D A;  1WTR A;  4QMG A;  3MXU A;  3QG1 A;  3GTO B;  2PNR C;  4ZUI A;  1Q90 A;  1TII D;  4NMZ A;  1ENF A;  1R4Q B;  3Q6S A;  5COR A;  3HOW B;  1W6J A;  4IUT A;  3X3M A;  1EIG A;  3A7A B;  1KNE A;  4FVM A;  4IUQ A;  4FO2 A;  4LK1 C;  3S16 B;  4K5X A;  1SDF A;  2F0O A;  4CGY B;  1C8C A;  5T1I A;  1FR3 A;  3HGB A;  3S14 B;  3E5S A;  3WDN A;  4RHR A;  3VA5 A;  1IKL A;  4OO1 H;  2PMZ B;  2ZT9 C;  5JVH 3;  1SYE A;  4U68 A;  3DWP A;  2NVQ B;  2B63 B;  4DK1 A;  1RTN A;  1CTM A;  2MP1 A;  2NVY B;  5CBA E;  3M85 A;  2SDF A;  4F7X A;  2NN6 I;  3HZX A;  2EYH A;  4M1U B;  1A15 A;  2VXW A;  1D5M C;  3PIP 3;  1CQF A;  4B9W A;  2M9V A;  4O1N A;  1SYF A;  3TP5 A;  3C1E A;  1B4O A;  1BQQ T;  1MSG A;  4X3T A;  3D8G A;  1FGB D;  5T1G A;  1ENC A;  1I4R A;  2L11 A;  3H3V C;  3SK5 A;  2A5H A;  4BS9 A;  1G8Z D;  4PQX A;  1L0Y B;  5KIX A;  1V43 A;  1HHV A;  4FNF A;  3TP7 A;  3OIQ A;  1A2U A;  5M5X B;  2VNU D;  2BDN A;  2O5J C;  4RGN A;  2L12 A;  4C3I B;  2BA0 A;  5CYU A;  2FMM A;  5FOB B;  1IHZ A;  2X69 A;  4RCO A;  3S17 B;  1LTG D;  1A2T A;  2KJX A;  1OXT A;  4P2C B;  2X6G A;  4DAP A;  1RTO A;  3KBG A;  3EA6 A;  4E6I A;  1UAP A;  1PLF A;  1FNW A;  2JP1 A;  2J7Z A;  2WB1 B;  3SK8 A;  2F0H A;  1ONL A;  3TN2 A;  1MI2 A;  1PFB A;  5FLX E;  2FIN B;  2A73 B;  1I6H B;  2XIW A;  2XRS D;  4LMQ D;  1EY9 A;  5D14 A;  4XQN A;  1SYG A;  1T5X D;  1SE4 A;  4KJN A;  1ILQ A;  2OT2 A;  1XXG A;  2XNA C;  1A3V A;  3URY A;  1B53 A;  4NDX A;  1UUP A;  1BBX C;  4KHZ A;  1STN A;  5M5Y B;  4HN7 A;  4BA2 I;  4MHE A;  3L7Z C;  3NPP A;  1IYU A;  3A7L A;  1SEB D;  1HQR D;  2ICE C;  2EXZ A;  1EEF D;  3GTK B;  2Z4H A;  4N9P A;  3BS1 A;  1V8Q A;  3PIO 3;  2EY1 A;  1KLU D;  2NB0 A;  1U9R A;  1QB5 D;  2FFK B;  3DHQ A;  3L3O C;  1HA6 A;  2D2C C;  3P1H A;  1L0X B;  4PMW A;  3P75 A;  1Y69 U;  5KRU A;  2BOS A;  1CT1 D;  1PDQ A;  1KDA A;  3NWS A;  2KEE A;  3GV6 A;  3SXH A;  1YNJ D;  2A68 D;  4O42 A;  5C5M A;  1FNV A;  1YNJ C;  2A68 C;  2WP8 J;  3I91 A;  1BOS A;  2O5I C;  3P20 A;  1B3A A;  4DFA A;  1K8M A;  4FYD A;  4CKC A;  1DXM A;  2N55 A;  2A74 C;  2E75 C;  3W2D A;  3MA2 B;  1TR5 A;  1ILP A;  1Q1E A;  3HOV B;  5LL6 X;  2EY6 A;  1BCP D;  3H6M A;  5E3F A;  1RCV D;  3OPO A;  1F2Z A;  1JC7 A;  4A3J B;  1SXT A;  5CV7 A;  1ZEQ X;  1IYV A;  1QG7 A;  2F4I A;  1RKN A;  3I4M B;  3F2U A;  3QB3 A;  2SNM A;  2Z8L A;  3TZU A;  3PUV A;  1BDO A;  1NR4 A;  4HCS A;  4DAV A;  4K6D A;  4IUN A;  1H9S B;  3HS0 C;  1BO0 A;  3T16 A;  1SYB A;  1WTX A;  1J8I A;  1F2Y A;  1BXT A;  4IZ8 A;  3VR3 A;  4DA2 A;  1U4R A;  2RKS A;  2AUK A;  4DNR B;  3SDZ A;  5IGB A;  1PZJ D;  4L8J A;  5CGK A;  2C9O A;  3NP8 A;  4KD4 A;  5TSS A;  5G3L D;  3U9O A;  1PMR A;  1D5Z C;  5IGD A;  5ISR A;  1LT6 D;  1GUO A;  2R6G A;  1XWE A;  1EU3 A;  4XIG S;  2B2T C;  2F3W A;  2G9H D;  1STB A;  2Z1C A;  1I3Q B;  2LMC B;  1HUM A;  5EKI A;  3BVG A;  3S2H B;  3D31 A;  1V1O A;  2JEA I;  4EQN A;  4ZKB B;  1CHQ D;  4CJ1 B;  3FVQ A;  2B2T A;  2EYM A;  2PZW A;  1STG A;  2KCN A;  2D5D A;  2D9U A;  3V96 A;  1F2M A;  5DNF A;  1ZYR C;  4XYQ A;  3K59 A;  3OW7 A;  3N6R A;  2H4O A;  2FHT A;  4PMC A;  1WTW A;  4OIK A;  4KN4 C;  4DF7 A;  2F03 A;  4WOR A;  1YNN D;  3KK7 A;  3NE5 B;  3DXJ C;  4IQZ A;  5I4D A;  3QIA A;  5C0X J;  2JE6 I;  1EL0 A;  2QF7 A;  3T4A C;  4EGV A;  1JOO A;  3H94 A;  3UI2 A;  3KLS X;  1Y8O B;  1QJO A;  2EYF A;  3J80 E;  3FRP B;  3SE0 A;  3S1M B;  1QIL A;  4CJ0 B;  3MFG A;  1TWA B;  1JOK A;  1HTL D;  3VYU A;  3ND9 A;  1GUW A;  1B50 A;  1X3Q A;  1ML0 D;  5IGE A;  4HTH A;  4BBS B;  3BVM A;  4OHJ A;  5K36 G;  4RGO S;  1BR9 A;  2OF1 A;  3OWE B;  3BDL A;  3K0Y A;  1EWH A;  4HAE A;  4KV6 A;  1SJH D;  2HCI A;  3MAQ A;  1V1P B;  1HXY D;  5CMD A;  4IFD H;  2OEO A;  3J80 L;  2R61 A;  2IW3 A;  3FPP A;  3IL8 A;  2HCC A;  2IL8 A;  2EYO A;  2EE1 A;  2F3V A;  5ELC A;  4Z9C B;  4L63 B;  5IOC A;  1OXV A;  1PYW D;  1E2V A;  1H9R A;  4XTC S;  3VYT A;  1VF7 A;  1SJE D;  4WFN 3;  1I6V C;  3HP3 A;  1EZ6 A;  1TWH B;  1FNU A;  5BN4 A;  1SNQ A;  5HUR A;  3TME A;  1EY5 A;  4CKE A;  2ZXP A;  3A54 A;  2RDG A;  4BY7 B;  1XTC D;  3GP7 A;  3BZD B;  3VR4 A;  1H9M A;  1BUV T;  4G4K A;  4KMU C;  2KUM A;  5JAV A;  3W3A A;  5A2Q L;  1DYQ A;  4H44 C;  2F0F A;  4F88 A;  3RZD B;  4MIU A;  2K5Q A;  1LTA D;  3I70 A;  4HR7 B;  3IAY A;  4RHS A;  2QIL A;  3NUC A;  1G91 A;  2EY2 A;  3FEW X;  1EZ8 A;  4KHV A;  4C3H G;  4R8N A;  3NHH A;  1NSN S;  1Q8I A;  2F0G A;  3S15 B;  1BNZ A;  5FO8 B;  1PXU A;  3M4Y A;  4EQO A;  3KF8 A;  5CV6 A;  2KEC A;  2M2L A;  2F0E A;  2PO4 A;  4A3G B;  3X3N A;  4HMI A;  2B2U C;  1I4G A;  1S5C D;  3ITP A;  3ZYY X;  1TS5 A;  4G7Z C;  1HRJ A;  1PTO F;  1EWC A;  2CHB D;  1KDC A;  3OOC A;  1X3P A;  4FP5 D;  3NSW A;  1ZYR D;  2PQE A;  3R93 A;  1DM0 B;  2WAQ B;  3OIP A;  3EJI A;  4KKS A;  1OXX K;  1LO5 D;  1HUN A;  4RAU C;  4IAL A;  3R2I A;  1MD2 D;  3PUX A;  2B2Y A;  2L9H A;  4F87 A;  4RA8 A;  2VB3 X;  5K36 H;  1RD9 D;  3L9A X;  3A8K E;  4H0L C;  3K6O A;  4PV1 C;  2GA4 B;  4V19 0;  1A3T A;  1LAC A;  4XXE A;  1II3 A;  1TT2 A;  2RSO A;  5FO9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...