1QG7A

Stroma cell-derived factor-1alpha (sdf-1alpha)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
SYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords STROMAL CELL-DERIVED FACTOR 1 ALPHA
publication title Crystal structure of recombinant native SDF-1alpha with additional mutagenesis studies: an attempt at a more comprehensive interpretation of accumulated structure-activity relationship data.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qg7A00
2EE1A 1QG7A 1SAPA 1TVXA 2NZ1D 5CMDA 1AP0A 2B2YA 1ZXTA 2N55A 4IUPA 2Q8RE 2X6LA 1SSOA 4RWSC 1PDQA 3KBXA 4MN3A 5E4XA 1G2SA 1IKMA 1DOKA 1A15A 3KUPA 2L4NA 2SDFA 1HFGA 2CVRA 4QUFA 1VMCA 2D9UA 4XT1B 1EIGA 3R93A 1PFBA 5E4WC 3F2UA 1WTWA 1RODA 3N52A 1EQTA 1HUNA 5EPJA 2KECA 1U4MA 1ESRA 3DEOA 2HDLA 4X3UA 2FHTA 4XT3B 2L12A 3MTSA 2RSNA 1RJTA 1WD0A 1B53A 3TN2A 1G91A 4O42A 2FMMA 1MSGA 4ZAIA 2H1EA 1XX8A 4OIKA 2N88A 1IL8A 2KEEA 2HUGA 2VXWA 4IUQA 1X32A 2B2VA 1NR2A 5CORA 1WTVA 3G7LA 4CJ2C 1NAPA 1CA6A 1WD1A 3MWYW 1BF4A 2M2LA 1PFMA 2RA4A 5EQ0A 4UAIA 1CM9A 2KUMA 1PLFA 3GV6A 1QNKA 3DM1A 2IL8A 4ZKCB 4U68A 2EPBA 1MGSA 2B2VC 3Q6SA 1AZQA 1O80A 4X3TA 1B2TA 4HSVA 1CA5A 1KNEA 1NCVA 2R3ZA 1HFNA 4R9WA 1G6ZA 3TZDA 5CBEE 5COYA 1PFNA 2K05A 4XDXA 2JP1A 5T1GA 1DOMA 4CJ1B 1Q3LA 1E0BA 1WTXA 3I3CA 4RAUC 1RTNA 1C8CA 4ZKBB 2B2WC 1O7ZA 1HA6A 4IURA 3H91A 1VMPA 1DZ1A 3I8ZA 1S4ZA 1X3PA 2K01A 3HP3A 5D65A 4IUUA 2B2UC 2K1BA 3I90A 4RA8A 1U4PA 1F9PA 4LMQD 4QUCA 1NR4A 3QO2A 1WTOA 4ZK9B 1BO0A 2RVLA 1ML0D 1HUMA 1B4OA 1F9QA 1MI2A 1ILQA 2BDNA 2HCIA 4R8IA 2XIWA 1J8IA 4OIJA 1EOTA 1JE4A 3LWEA 1WVLA 5AFWA 1MSHA 2NWGA 1QE6A 2RSOA 1F9RA 3IFDA 2MP1A 5T1IA 5EJWA 1U4RA 2L1BA 4IUTA 2B2WA 1RTOA 2KEDA 1WTQA 1HRJA 3FDTA 2B2TC 3IL8A 3SVMA 4HEDA 1ICWA 4MHEA 4X3KA 2B2UA 2L11A 2HCCA 2KOLA 5D14A 3UI2A 5JJZA 1B50A 2KVMA 4IUVA 1EL0A 2NYZD 4ZLTF 1B3AA 1F9SA 4HAEA 5EKIA 1O7YA 1WTRA 1LV9A 2FINB 1WTPA 2FJ2A 1RHPA 1G2TA 2JYOA 4NW2A 2K03A 1HHVA 4X3SA 2EOTA 2Q8TA 1XYIA 5DNFA 2MPMA 3D6WA 1JICA 2X69A 1IKLA 1DOLA 1F2LA 2B2TA 1J9OA 1M8AA 2B2YC 3ONAB 2DY8A 3I91A 1KNAA 1X3QA 2J7ZA 1U4LA 2HDMA 4DN4M 2X6GA 5CBAE 4CJ0B 4HCSA 2DY7A 1AZPA 2FFKB 5EPLA 2MGSA 2L9HA 1EIHA 2MJ8A 1BNZA 2K04A 3DEPA 5EPKA 1DONA 1SDFA 3GV3A 3P7JA 1GUWA 1ILPA 2K28A 1BBXC 3FPUB
chains in the Genus database with same CATH superfamily
3U4VA 3R2TA 1J6QA 1BBWA 4APVA 4DU9A 2JXMB 4P71A 2XN9C 1TU2B 1K0RA 4WJWA 3PSIA 1OO9B 4JOIC 5C3EG 2LS01 1WTWA 1ET6A 4A76A 3QIAA 1TS3A 4DK6C 5EPJA 2JJQA 2OEOA 5KYIA 1K83H 2WKDA 1FNWA 1UE5A 1C4QA 1YHBA 2OQ0A 3CKIB 4HJ7A 4DKAC 1KAAA 2KHIA 2HT1A 3A74A 5G3LD 3CHBD 5IT9E 3M4YA 1I4QA 2YTXA 5ELDA 1N36Q 1C9OA 5LHY1 5E3FA 4OGQC 1EU3A 5IE8A 3EN2A 1VQBA 5JPNC 1UE1A 2SNSA 1XPOA 1KNEA 3KBGA 4DA2A 5IYDG 1J5EQ 4NMZA 5C4XH 1C7YA 3HOYG 4DR7L 3D4DA 1WTXA 4JI6L 1C8CA 3S1NH 3T1YQ 1VMPA 5KNBA 4IPDA 1XNRQ 4IUUA 2K1BA 3I90A 1HJPA 2JEAI 2XWBB 2H5XA 3BYYB 1EY8A 1E7ZA 4ZK9B 2QF7A 2XGTA 1F9QA 2XVSA 3HOXG 1V1PB 2KJXA 1B70B 1PH8A 4ID6A 2ZXPA 1U4RA 1Z6HA 3R2IA 4C3JG 1Y8NB 4OX9L 4KD3A 1ESFA 3PV0A 4BXXH 5NUCA 1WFQA 4IOAA 4G4KA 4JI5Q 3OTOL 2LXKA 3HOVH 1KDBA 2RF4A 1Y1WH 2DY8A 2VS1A 4YY3Q 1WOCA 5IP7G 1SNDA 3U58A 4A3KH 1XJVA 4C3HB 1EQVA 4DNRB 3FRPB 1JCKB 4RHRA 1FGBD 2EDGA 1WCMB 2WAQE 3JAMi 2NB0A 2Q8RE 2A74C 2E8GA 4MN3A 1ZYRD 3BVGA 4GOPA 5JOBA 1VMCA 2D9UA 4JI2Q 2UXBL 3OWFA 3L9AX 5CV6A 3G6JB 5I4DA 3L7ZC 1F77A 3CF5A 3AU7A 3MTSA 4IFDJ 2OXPA 3H0GB 1KXLA 3DMUA 1CTMA 2H1EA 5K5PA 5KRUA 3PQIA 1KQSA 4UY8C 5CORA 3E3XA 3HOWH 2N3SA 4X6AH 3KJOA 2PQAA 1HH2P 2F0IA 4YHHL 1Y14B 2Z1CA 5I2YA 4A3BH 1N32L 1B2TA 5FLXc 1I4PA 1NCVA 1VQJA 3OW2A 1CHPD 4DV0L 1DJRD 1X3FA 4JPBW 3KLWA 2JP1A 2Y0SG 4HJ8A 1M90C 3GTJB 2RQXA 3HKZG 3S1QB 2VQFL 2EVBA 2NVQH 2B63H 1IYVA 3TS0A 4K8IA 3A55A 2L0CA 4C1NK 5EAYA 3IFDA 2AWNA 5CV4A 1OXXK 4QB4A 5EJWA 1CK1A 1RL2A 1UWVA 2PZTA 3I56A 5KIXA 2HCCA 2KVMA 1AEXA 4GNXB 1XPUA 2Q8IB 2YU9H 3S9WA 1SFOB 2IHEA 1HXYD 1GM5A 3S15H 1IKLA 1Z47A 2KCMA 3KLSA 4XQJA 1YEZA 2HDMA 2ICEC 3W1BA 5CBAE 4CJ0B 2F0WA 1NY4A 3DLLA 1LYLA 4L6TB 1PXUA 4C3HG 4A3FB 3LGJA 1DONA 1LT4D 2F4VQ 1WCMG 1STYA 4H0LC 4YWKA 2UXDL 2NVYB 3J7YW 5LMUL 1RIPA 3PO3B 3MXPA 4ME5A 2C5CA 3DWAA 2JK8A 4JYAL 2I0QA 1B7YB 3KBXA 1G2SA 1KL9A 1JR0D 2EY1A 1IBMQ 4DUZQ 1YNND 5EBDA 3QOJA 1FYCA 2R93H 4MNOA 4DAMA 2XRSD 4DAYB 4WRDA 2JA7H 3CC7A 4FF1A 2LMCB 1RF2D 4RG1A 4B3TL 2PZWA 4GZYC 4XYOA 5BR8L 2L5TA 1VQKA 1B9NA 2IX0A 3EBEA 3PIPA 2RA4A 2JA6H 4DGZA 5H1SE 4ULLA 4DV7L 1K9MC 1O7LA 3S2DH 2CQAA 4K6LA 5EBCA 1F2MA 2EYPA 3GDEA 1MGSA 4DR6L 2MHVA 4X3TA 4F7XA 1R4QB 3LNNA 4HJ5A 1PH6A 4R9WA 2HHHQ 4HCEA 3GTKH 3CCUA 5IYBG 4UP7A 3CD6A 3CPFA 2AMCB 2CH4W 4DNIA 4LF9L 1DZ1A 2ENBA 3UDFA 1F9PA 4WJ3M 1B3QA 1YNJC 2Z4IA 3D3RA 4H44C 3FMCA 1I3QB 4DXGA 5JJKA 1S5ED 1RTOA 4DV4L 3E9IA 2A1AA 2ZJQA 3AMUA 3RN5A 3SVMA 4H13C 2KCNA 2A68C 4A93B 2QW7A 1V1PA 1N33L 4HAEA 4K0KQ 4OONA 1Q86C 4POFA 3VYUA 1PZID 1RHPA 1T5XD 2PI2E 1PTOC 3OYYA 3NBIA 4JI8Q 2EYFA 1XYIA 3J81L 2O4XA 4G7HC 2ES2A 1U5KA 4JV5Q 4AYBB 1RD9D 3ONAB 1W6KA 1KNAA 3DM3A 3IFTA 1XMOQ 1KHIA 4AQYL 3KK7A 2PNRC 1QVCA 3GTPH 2L9HA 2UXCL 1X3GA 3S14B 1JJ2A 5KYLA 2QEJC 5EGTA 4DV5Q 2HD3A 4GS3A 3CW2C 2AQ3B 1PTOH 3JAME 2BA1A 4KI0A 1VF5C 2CW0D 2AHOB 3S17H 3EROA 1LTLA 1SSOA 4LFAQ 4BBRB 3S2HB 4MTKA 4KLKA 3PO2B 1PFBA 1MJCA 1WJJA 4GKKQ 1KLUD 2R7ZB 1SNQA 3OWEB 3VR5A 4JBKA 1K8GA 2FMCA 1H9JA 3EA6A 1TWFB 3BDCA 3VR2A 1F2YA 5DM63 4OIKA 5CR3A 1JT8A 2A6EC 4YCWA 3G7LA 1EY4A 1XTDA 1NSNS 3T51B 1L1OA 2GVBA 1XNQQ 2F0TA 2EPBA 1IW7C 4QJFA 2F3IA 4E6IA 3CCRA 4HN7A 1OXUA 4HSVA 3F8TA 3STBD 1SE3A 2BCOA 3OOCA 3C3LA 1G6ZA 4Y7NB 1GJXA 1H95A 3PUVA 3GTOH 2ZXRA 3VR3A 1DOMA 3I3CA 3NP8A 1TY0A 1VQCA 5FK9C 4ZYSA 3H91A 1Q90A 1TS5A 5D65A 3HP3A 5CV9A 2NUCA 4BY1B 3J7A5 1O7IA 4DK3C 3PUYA 4DK0A 2BOSA 4IZ8A 4BWGB 3CRLC 5ELCA 2K14A 2Q2HA 3NQTA 2KA7A 1HQRD 1YHAA 1Q1EA 4KN7C 3OIPA 1FVIA 4V0BA 3AFPA 2D0OA 2JA5H 2RDHA 1M4VA 1KTKA 1K83B 1TS2A 5ELNA 4A93G 1B3AA 1EFWA 4A3LH 4IJHA 4X66L 1EZ8A 1X65A 2JA8H 1A2UA 2JYOA 2K52A 1Q8KA 1FL0A 4AYBG 2Q2TA 4CDEC 4FVMA 5E1FA 2VNUD 4LFCL 2QKIC 2R61A 2E2HH 5M3MG 3S1RB 5I6YA 3GTQB 2R6GA 2CWPA 1KRTA 2NN6I 3ZYYX 3GV3A 1K3RA 1HTLD 5JEAG 2EE1A 1R9TH 1R4PB 1QG7A 2F0GA 2I5LX 2N55A 3UDXA 1EYGA 4DR7Q 3A5ZB 4JI6Q 1PDQA 4BBRG 5C3WA 1STGA 1SXTA 2F52A 5FO9B 3H15A 2R7ZG 3J80c 1S5FD 4X3UA 4JI7Q 3WOEA 1DCZA 3K7AH 1EQQA 1L2FA 2NVTH 2HIXA 3NXWA 1BVSA 3Q8DA 5F2DA 4WJ4A 2DJFC 3UE0A 3MFGA 1CKOA 2VB3X 2B3GA 2WP8J 1PZKD 2VXWA 4OX9Q 1X32A 3NQIA 3PF4A 3MXNB 3P20A 4DAYA 1BF4A 2PPBC 2M2LA 2E2JB 1HNWL 3EIVA 4A3GG 2KUMA 1TQOA 4RGMA 1EUJA 5HGTA 2EYLA 4MTNA 4LUZA 3OTOQ 2NN6H 3RZDH 3GTLH 3HOVB 4NKLA 1Y1WB 1HNXL 1TWCH 3E0EA 3PUZA 2CFMA 3FEWX 1IXRA 2EXDA 1JE5A 1A3VA 3TZDA 3OHXC 5C4ZA 5IP9G 1IYJB 4A3KB 1PYBA 1SYGA 3NBHB 1E22A 2KCCA 4BY1G 1I50H 3OMCA 5M3FG 3K5NA 1BO0A 3P1HA 1ILQA 5HGQA 1UE6A 1VQLA 2SOBA 1Y1VH 4GN5A 3T1HL 5T1IA 4X65L 2R7FA 3I4NH 3E5SA 2UXBQ 4A4IA 4DV2Q 2NZOA 3FDTA 2L11A 2WIIB 1QCBD 5C5MA 5M5XH 5IT9L 3RN2A 3HOZB 4UP8A 1G2TA 2I5HA 2OWOA 3C46A 2F0UA 3FP9A 2X69A 3K7UC 5C0XG 3HOWB 2MNAA 2AKWB 4V190 1O78A 2I5MX 1KC8C 2XSCA 4YHHQ 3M85A 1H9SB 2D2CC 1SMYC 2WKCA 1VQFA 3DEPA 4A3BB 2K5VA 2NVXH 1ICFB 1YJWA 5C4JH 4PMBA 4DFAA 1E24A 1FD7D 2WV6D 4RGOS 1EWCA 4TVAB 3VR4A 1DD2A 4IQZA 3I4MB 1II3A 1KD1C 4QUFA 1TKWB 2NVQB 2VQFQ 2B63B 3FKIB 1PYSB 3DUZA 4KJOA 3U9OA 3ZJYC 1LABA 4GLXA 4PMWA 3ERSX 3GTGB 1B53A 1HTPA 3J7ZC 1MSGA 3M3YH 2F0OA 2YU9B 3MWYW 1A3UA 1PTOF 1SYEA 2WFWA 4L5SA 1NUCA 3MVVA 5IOCA 4ZKCB 3HOVG 4X62L 2R92G 1E2VA 5CV5A 4CDFC 5BN5A 3A7LA 4N9PA 1LTAD 4I7ZC 1UNSA 4HMJA 5C4HA 4N8X1 2VUMB 2JA9A 3F2CA 1D1IA 3MXUA 3SK8A 4A3KG 1DYQA 1CFMA 4CJ1B 4QGUA 1PRTC 4BS9A 1VQPA 1QOHA 2TMPA 4R4IA 4XQNA 1KLGD 1S4ZA 2N78A 3RMHA 5KEEA 3KJPA 1PMRA 1SJHD 2UXDQ 4LMQD 1UUPA 5LMUQ 4FP5D 3QR8A 4YWLA 4KY6A 4JYAQ 1JE4A 1WVLA 3TEHB 1F9RA 4IO9A 2M9VA 4ABNA 1HNZL 4IUTA 1HRJA 1I4GA 3OW7A 4P73A 5LL6X 2R93B 4K5WA 4QIWB 2J4XA 4DV1L 1WTPA 3HOZG 4B9WA 1CHQD 4LF5L 2K03A 1JJGA 1D5XC 1N9WA 4B3TQ 2NBFA 1IHZA 1DOLA 5BR8Q 3SXHA 2B2TA 2M00A 5CV7A 3NPPA 1U4LA 4DN4M 4ALPA 2BH2A 5K36G 1TWGH 3S2DB 4DV7Q 5IYCH 2MGSA 4GOPC 4YIJA 2F0DA 3NSWA 4C3IB 5J39A 4DV6Q 4DR6Q 4B9XA 2WAQG 4CDCC 1SDFA 1GUWA 1CZWA 1LTTD 5IODA 4R4TA 4JOIA 4LW1A 1CQFA 3CPWA 1ZXTA 2K5NA 3SR1A 4LWCA 4A3EG 1PH5A 3I4MG 1ENFA 1NJIC 3CC4A 5A2QL 1IKMA 1L0XB 4LF9Q 1XMQQ 2B63G 3FKIG 3TQYA 3N52A 4RKBA 3IAYA 3J81j 2VL6A 3A0JA 4OELB 2KECA 1HR0L 1ESRA 3H94A 5J22A 3BVMA 2IJ0A 3KFUA 1HA5A 4QMGA 3BZCA 3K0YA 1EYAA 2I46A 3TMEA 4DV4Q 1XX8A 5KNDA 4UDUC 4DR3L 4A3CG 2PQEA 3EJIA 2VZAA 5C3EH 4YCUA 1N33Q 1WD1A 1SE2A 2Z8LA 1CM9A 4DR1L 2D62A 3DM1A 3CRKC 2B2VC 5CGKA 1XPRA 2VUMG 2K5QA 4YWMA 2BH8A 3MXNA 4JC0A 3S24A 4AQYQ 2HIVA 2EJFC 1PFNA 3HEJA 3A8KE 1NBWA 2QGQA 1A6XA 2UXCQ 3V05A 1EFID 1V9PA 1HA6A 1TWAH 2AWOA 1Y69U 3S16H 2AQ2B 5C44B 1G6PA 4OO1G 1EY0A 3ERQA 1SNMA 4QUCA 4QY7A 3F1ZA 1EYDA 1A0IA 1EWHA 2RVLA 4K2LA 3S17B 4KHPL 3Q22A 3HGBA 2BDOA 3HRZC 5AFWA 2RSOA 3NBHA 1CKNA 2MP1A 3CCSA 2E2IH 3HOYH 4KK7A 4B3RL 4C2MH 3QWNA 1K0SA 1A62A 2MQHA 4IUVA 3NTKA 4YCVA 5ELEA 1GHJA 4ZLTF 3CCVA 4RGTA 4A3IH 1VQ9A 2UUBL 2EY5A 4R4QA 4DUYL 1PV4A 4POGA 1LT5D 1JC7A 1K8MA 4P72A 3L2PA 4OWTB 3HOXH 3J7AV 3FVQA 5A2QE 3NWSA 4JCVE 1PHJA 2NTSA 5BN4A 1BUVT 1JQYD 1F2LA 5JAVA 3VYSA 3GQBA 3N6RA 4IALA 3ULPA 3BDOA 4C3JH 3QG1A 1PVOA 3CXCA 2F0KA 3RZOH 4C3IG 3RNUA 4PNYA 4O0AA 4FF4A 2XRQD 1MKHA 1GD7A 3FPUB 4X3KA 4QIWE 4NDXA 3GTOB 3MXGA 2ASBA 4IFDG 4XIGS 1DOKA 1E3PA 1ET9A 3KUPA 3K5LA 3CQZH 2CVRA 5IP7H 3GTMH 4PZ8A 1RODA 2EY6A 3MAQA 3DWPA 4KD4A 4EQPA 4FXGC 4DR4Q 3GD7A 4LF8Q 1OXSC 1MIUA 2B8GA 4BY7H 1RDPD 3X3MA 3CCEA 4FXKC 1WD0A 2JA5B 1MD2D 2PYKA 4HSPA 3BYTB 3BZDB 3C2PA 3G4SA 4IUQA 2VB2X 4JI3Q 2MUYA 3U9SA 3NTHA 2JA8B 3T56B 4X66Q 5IGFA 1K3BC 2K5HA 1TY2A 3GV6A 4CKEA 1CZGA 1TWHB 2K33A 2LSSA 1D7QA 4IUNA 2RDGA 1AZQA 4LFBL 3ITPA 5FLXL 4C1NI 4LUVA 4QL5A 4QCLA 2SNMA 1V43A 2GA4B 4DXFA 3UDGA 3TREA 4LFCQ 2E2HB 5CBEE 3PIOA 3H0GG 4GLVB 1EYCA 2OF1A 2G5DA 1O7ZA 2A69C 2QCPX 4IURA 3JAML 4J15A 5C44G 5AJ3L 3HOUB 4KHZA 3J81c 1R9TB 3CU7A 2V4DA 4JI0L 1SJED 4B3MQ 1A8VA 1HUMA 2BDNA 1QVFA 3LWEA 1S5DD 2F0MA 5FO8B 5A35A 2DJGC 1D5ZC 1CQVA 2BE5C 4A3DB 3DXJC 2QA4A 3T1YL 4J8QA 1L0YB 4NXMQ 3BDLA 4C56C 3K7AB 4RFBA 1O7YA 1AW7A 1LV9A 4XTCS 4A3MB 1G291 5GAHC 2NVTB 1B9MA 1HPCA 1UE7A 1I4RA 4B3SL 2Z0SA 5IGCA 4JK1C 3W5OA 2F0HA 3HS0C 1KAWA 4OWWB 2EJMA 3M9BA 1AZPA 1C0AA 2KENA 3J7AF 1PA6A 2MO1A 3R8BA 3H6MA 1TWCB 2K28A 5CV8A 5IGDA 1SN8A 2GN5A 1AP0A 3PIO3 2NZ1D 2A6HC 2B2YA 1PRTF 1STEA 4YY3L 5IY0A 4JI4L 3D0FA 5FO7B 4UHVA 2SDFA 3WOFA 2LKVA 4IPCA 1LM0A 3KOJA 3F2UA 4S3SA 2PNHA 3PIP3 4ME3A 1LTBD 5FLXE 1X55A 2CHBD 5C6AA 3BJUA 1L1OC 3HZXA 3T1HQ 4A3FG 3I4NB 3ER0A 1ENAA 2FMMA 2LFNA 1BOSA 3H09A 1TIID 1SR3A 2UUCL 3PO3G 4JI2L 1IBKQ 1CA6A 4LAAA 2OCEA 4LK1C 5M5XB 4A3JB 1XWEA 3R3OA 1PH9A 3SK6A 1QNUA 3T53B 1Q7YC 2EJGC 1AH9A 4BBSB 3M4PA 4FYDA 1B8AA 1VQ5A 3G6EA 2IPKD 5FJ8H 4IPHA 3E6ZX 1BCPC 4TKOB 3HOUG 5LMNQ 3C1EA 1U4PA 1Z7TA 2DNEA 3BZKA 2KQ3A 5GROA 3C1FA 1JB3A 2V1CC 2XIWA 4OHJA 2O2LD 4EX5A 3G71A 5ELBA 2E5LL 3ICEA 3NHHA 4A3DG 1BQQT 4DV3L 1Q1BA 1I6VC 1YIJA 2KHJA 4DPGA 3I2ZA 5D14A 2B2UA 2E76C 2KCTA 4A3MG 1CI3M 4HIOA 2G9DA 4NW2A 1UEBA 4O2DA 1AE3A 1AE2A 1GUNA 3D6WA 1GXDC 1JICA 3VA7A 4JG2A 5JEAJ 1X3QA 4BA2I 2PI2A 4CHTB 2RBMA 1VQOA 3NUCA 2DY7A 1YNJD 5EPLA 4X62Q 4FDBA 1QILA 1HZBA 1UEAB 3SK4A 1SFOH 1SAPA 1TVXA 2D0PA 2F0EA 4KY7A 4K5XA 4IUPA 2DN8A 3VR6A 4RWSC 2A68D 2DGYA 1AFPA 5M5YH 1OXTA 1PTOD 2K32A 4GNXA 3KYHC 3K81C 2H4OA 1CSQA 1QB5D 2QDLA 4OWXB 3I4NG 2K5WA 5FKAC 2F1MA 4M1UB 1HNZQ 3S1MH 3K5MA 2ZM6L 4ZAIA 1H9MA 1PRTB 5C4XB 1SE4A 1SNOA 1DM0B 2CQOA 1WTVA 4A3JG 1LACA 2YYZA 2CWAA 4DV1Q 1I4XA 3S1NB 4LF5Q 1F2ZA 1EY6A 3PO2G 1EWIA 2L55A 2F0JA 4HR7B 4BBSG 3X3NA 4O1NA 1GUOA 4K2KA 3VDYA 2E75C 2EYMA 3AFQA 5IT9c 4ZKBB 1K28A 4LJZC 1U0LA 3I8ZA 4RA8A 4NP5A 2A19A 5FLMG 1JORA 2JSOA 2DNCA 1VQNA 4N9TA 2UUAL 4HMIA 1YITA 1PFSA 4OIJA 4TSSA 5GAGC 2A6ED 1MSHA 2WB1B 3E9HA 2B2WA 1WTQA 5BN3A 1JJCB 1HR0Q 4IOCA 1EEFD 2Q2IA 2KOLA 2F0NA 1IW7D 5C0XJ 2MO0A 4LF6L 2F0FA 4ILWA 4KTAA 4ODGA 4PMCA 4IPGA 1X6OA 3AB9A 4DR3Q 3W3AA 1YI2A 2K6AA 2Z6KC 3K58A 1M1KC 4DR1Q 2RKSA 1EZ6A 1D5MC 1JOKA 3MC0B 4P2CB 3AEVA 1BNZA 1EY9A 2K04A 5FOBB 4G7ZC 1AN8A 3MHBA 1A3TA 3LWUA 1XMOL 1SMXA 1SLJA 3S16B 2L4NA 2ZTEA 4JI1L 3HG9A 5M3MH 4HTHA 1W6JA 3F2BA 1EQTA 4P74A 3URYA 4DV5L 4KHPQ 2FHTA 4GLAC 4F88A 1VQ6A 5JEAH 2L12A 3PF5A 3CC2A 1GHKA 3CCJA 3CP0A 1N32Q 1ENCA 1PH7A 3IRBA 4C2MB 4HIDA 5C4XG 4CDDC 4BBRH 4B3RQ 3S2HH 4DV0Q 4A3IB 1X56A 3NE5B 1NAPA 1JWSD 4GKKL 1Y8PB 2UUBQ 2ZXOA 5EQ0A 4F87A 3QB3A 4DUYQ 1GO3E 1PH3A 3A7AB 1LTSD 5DEHA 1C48A 3BVZA 5IGBA 1MBYA 3U50C 2QDBA 5ISRA 1I5FA 4FO2A 2QILA 4R8NA 2E74C 3MZ5A 2R3ZA 1FGUA 4EQOA 4KY5A 3CCMA 1HQMC 1CT1D 4UPAA 5COYA 1QVGA 3TP7A 3RZOB 3PGZA 5HURA 1E0BA 5D3DA 4OXPA 5L37A 4A3GH 1XNQL 2N8NA 3TP8A 1VQDA 3OPOA 4RHSA 2NZHA 1WTOA 5HY6A 4BXXG 2C9OA 1B4OA 5C0XI 4R8IA 1VCIA 4XXEA 3TDQA 1S40A 3S15B 2GVAA 3FPPA 5LMNW 1Y1WG 5IP9H 4L5TA 2AUJD 3QOLA 2B2TC 2JQOA 4MHEA 2I07B 3UI2A 5IIFA 5JJZA 2AUKA 1B50A 1ZYRC 4KKUA 5M3FH 4K8JA 4BY7B 1S5BD 2FINB 1EOVA 1XXGA 4X64L 4K6DA 1ASZA 2Q8TA 2MPMA 4H02A 3UE1A 3KLRA 3K59A 1ASYA 4L8JA 1SROA 1VQ4A 1VQEA 2Z4HA 3J80E 1KRSA 4RMFA 5IGEA 2B29A 1VDZA 3NELA 2WB1E 5KNCA 3NENA 1SYFA 1S5CD 2F03A 4PV1C 1Q46A 5EPKA 4LFBQ 3G48A 3HKSA 1ILPA 1OTCA 2JA7B 4Q0FA 1V1OA 3RLOA 2ZTDA 4K5VA 4DR5L 5C0XH 1BCPF 2X6LA 2PCFB 2IW3A 3TSSA 1V1QA 1PH2A 1JMCA 5AJ3Q 1QUQB 3S1RH 1VQMA 1K73C 1TR5A 1EIGA 3PUXA 4KKTA 5E4WC 1FJGL 3GTQH 3HOWG 1HUNA 4JI0Q 5I9PA 3M4OH 2JA6B 2XNAC 3ULLA 3RD4A 2O5IC 4WFN3 4FXDA 4ZUIA 3AYHB 2C35B 2SEBD 2RSNA 4A3BG 1KDCA 3TBIB 2OTLA 1N34L 3D6CA 2A5HA 2Y0SB 1TS4A 3SHLA 3HKZB 1SRUA 4R4CA 4A3IG 1SMYD 1WTHA 2F0VA 4CJ2C 3GTKB 1YNXA 3Q24A 4JI7L 4UAIA 1CSPA 1IL2A 1VQHA 2VQEL 3QJYA 4ZUJA 3NEMA 4B3SQ 2K50A 4IN3A 3A56A 3MEHA 1YJ9A 3CCQA 4NB3A 1JOOA 4RAUC 5TSSA 2RHSB 5KGUA 2E2JH 2K01A 3P75A 4DR2L 2EZVA 1BBUA 1UAPA 2R92H 2F3VA 1VQGA 4JI4Q 4PG3A 1EOTA 2NWGA 1W3SA 1KABA 1WYDA 3ND9A 4KHVA 2LXJA 4Q5VA 1HZ9A 2IT1A 4CKCA 3D8GA 4G57A 1EL0A 3WDNA 3PUWA 1F9SA 1N8RC 1GKHA 4NXNL 3GTPB 1H9RA 4BY7G 1YNNC 5J1ZA 1I94L 1I6HH 1PTOB 4TRDA 1STNA 5IWAL 4LF4L 1PRTD 2UUCQ 1HR0W 4DV2L 1GVPA 2J7ZA 2VW9A 4LF7L 5IYDH 2JEBI 2G9HD 3D31A 1L1OB 2R93G 3CMAA 3HOZH 4CGYB 3K5OA 2JA7G 5M5WH 3KF6B 5C3XA 3TRZA 1EQRA 4P75A 3WWVA 3L3OC 1SNCA 5K36H 1A15A 1HFGA 4Y52H 1KDAA 3R93A 3NK9A 1NE3A 3A5UA 2JA6G 5E7NA 1NMFA 1U4MA 3EQLC 2O5JC 3KF8B 2Z6BA 2ZT9C 2E5LQ 2EYOA 3TN2A 4DV3Q 1SYDA 4GKJL 3PMFA 4A3EH 3I4MH 3JAMc 2HQEA 2ZJPA 1IL8A 3I55A 1BCPB 2B2VA 1NR2A 3SDZA 1KIXA 4OO1I 3FKIH 4LUOA 2UU9L 1H9SA 3J81i 1PLFA 1A63A 5I6WA 4QF4A 3K0XA 3GTGH 1IBLL 3T16A 3TP5A 5G3LF 1D8LA 2PO4A 4A3CH 1TT2A 2B8FA 1RKNA 3AQQA 1D6EC 2EIFA 1Q82C 2K75A 2Q2UA 3MA2B 2PW7A 2Y0SE 4RGNA 3T4AC 5D3IB 1CUKA 3HKZE 2P5ZX 2PW5A 2ICIA 3OSOA 2JE6I 1ML0D 2HCIA 4HJAA 2VUMH 4KV6A 1Y8OB 1A2TA 2IY5B 4PQXA 2CCZA 2VY3A 5M5YB 1EY5A 2OQKA 5JVG3 3DWQA 1W2BA 4GN4B 2CW0C 1ZKOA 1QJOA 4HEDA 2F0LA 4KN4C 4JBMA 1TXYA 4DNTB 4OO1H 1N36L 2R7DA 3BS1A 3RLFA 5DLQE 3S1MB 1HZAA 2ZM6Q 2LY7A 2A73B 1E2WA 3RUZA 3F2DA 4MZ9A 1QZHA 4IFDI 3RLNA 4HIMA 2EXZA 1J9OA 1VS0A 2B2YC 3SGIA 1J5EL 2X6GA 4HCSA 4RH6A 3P7JA 1XNRL 1BBXC 1GUSA 1PYWD 1LTID 2F0QA 3K8AA 1T5EA 5FJ8G 4KKSA 3ULJA 3L0OA 1L0WA 3STBC 5I9OA 3A8JE 4ZQ3A 5J3BA 1X9NA 3SK5A 4XT1B 4CBVA 1BXTA 4DV6L 4C3IH 5GQOA 2UUAQ 2KHSA 1G51A 2EQSA 2FXQA 2L15A 3I7FA 1HNWQ 4BA1I 3GTLB 3RZDB 4KJNA 5DAUA 5C5LA 1QUQA 3U4ZA 5JJLA 4JI5L 1HNXQ 2ZTCA 4IFDH 1XMQL 2HUGA 4B08A 4LNQA 3PCOB 2ATWA 3BU2A 4GN3B 3E0JA 3KDFB 4LF6Q 1YHQA 2A8VA 1P8LA 1I50B 3OIQA 5JVH3 3M7GA 3Q6SA 3M7NA 4C3HH 2D5DA 1SBBB 2IHFA 1IZ6A 1Y1VB 1WCMH 2PMZB 4FNFA 4AH6A 2K05A 4X65Q 2JA5G 1XTCD 5CYUA 1LTGD 1EY7A 4NPSA 2JN4A 1U9RA 4DAPA 3FHWA 1X54A 5LL6S 1X3PA 2MFIA 4L5RC 2B2UC 4A3LG 2K7VA 2JA8G 4AIMA 1MI2A 1D2BA 2RCNA 1J8IA 4JBWA 5M3MB 2EYHA 4JI1Q 2WACA 4RCOA 3H0GH 2OT2A 2ZJRA 1VQ8A 1ICWA 4ZRZA 5C44H 3MEFA 1YBYA 5GAEC 2NYZD 1YJNA 1VQAA 4XYQA 2Z9HA 3RR5A 4FF3A 2NVXB 2EOTA 1I4HA 5C4JB 2K5DA 1BDOA 3JC66 3VYRA 1GOZA 5JPMC 2A69D 1HZCA 1P16A 3GO5A 3HFZB 2F3WA 2F0SA 4TQUS 1SEBD 2CKZB 1PH1A 3Q23A 5ELFA 1V8QA 5IYBH 3GTJH 1NMGA 4GNXC 5M9OA 1EIYB 3I72A 2IWHA 3S1QH 1DXMA 3TS2A 1LUZA 2BE5D 1VF7A 3VA5A 4UP9A 3SE0A 3H3VI 3LX0A 2NTTA 1QWYA 4A3GB 1E1OA 3M3YB 3W2DA 3IKJA 1T9HA 1VQIA 3I4LA 2YV5A 2HDLA 3KF6A 1Q81C 3KLSX 4XT3B 2EYJA 2NN6G 1PZJD 3J80i 4J6HA 3TZUA 1RJTA 4QQBX 2TSSA 4OEMB 1MHWC 3NTIA 3CMEA 1JOQA 3SEBA 3H3VC 1EIFA 1RCVD 2OTJA 3KF8A 5M3FB 3J81E 2IX1A 1FR3A 3A8IE 1PFMA 5DM73 4DR4L 4X64Q 1QNKA 2EY2A 4G7OC 4LF8L 4U68A 2A6HD 1BR9A 2AQ1B 1EU4A 4IJLA 1O80A 4A3FH 3OMGA 2F4VL 1CA5A 2CH4A 1Y1VG 5EKLA 1HFNA 3MFYA 2NVYH 1FNUA 1MJEA 4JI3L 3PO3H 4XDXA 3H3VH 1YZ6A 1Q3LA 4ZCKA 2B2WC 1STAA 1TWHH 2YTYA 1IBML 4J1MA 2K4KA 1HCZA 4DUZL 3QO2A 4JW0A 4KMUC 1STBA 4DR5Q 1JB7A 1EEID 1G8ZD 3EFXD 1ZEQX 1FJGQ 3M4OB 4U673 1D1KA 2QEXA 4JVZA 3A54A 3HOUH 1TWGB 1OXVA 3I4OA 2PMZE 5EKIA 1WTRA 2RHQB 2KBNA 4B3ML 5EKKA 1HHVA 1SNPA 1LO5D 4DAVA 1N34Q 5DNFA 1S3OA 1NNXA 4L5QA 5ELOA 1BCPD 1FNVA 1M8AA 1Q12A 4A3DH 3I91A 2E2DC 3T13A 4AYBE 4EQ5A 2F4IA 4NXML 2HHHL 2RDFA 3CCLA 1S72A 2VQEQ 1GUGA 2MJ8A 1EIHA 4A3MH 4Z9CB 4GOPB 2YTVA 5JJIA 3K80C 4HJ9A 1B44D 2XTIA 4CKBA 2DUDA 3W1GA 4XQQA 5CMDA 1YVCA 2HQLA 1WI5A 1LT6D 1I3QH 5E4XA 4M8AA 3NWTA 4DR2Q 5C3EB 1Z9FA 5IGGA 2R92B 1K8OA 3DEOA 2J0TD 3ND8A 3M4QA 4K0KL 4A93H 4F8MA 1SYBA 2B39A 4FF2A 1E2ZA 2PQAB 1G91A 4O42A 4JI8L 3K57A 1CKNB 2N88A 2KEEA 4PZ7A 3I70A 4JV5L 5GADC 3DHQA 4H7BA 4NXNQ 1SYCA 3O13A 1TWAB 3TP6A 4RCNA 1X3EA 2BA0A 1I6HB 1I94Q 2IL8A 3S14H 4LF4Q 5IWAQ 1PH4A 3J80L 2N49A 3K6OA 4MIUA 1VQ7A 3KDFA 4WORA 4LF7Q 1IBKL 1B1ZA 1NTGA 1ONLA 3VYTA 5T1GA 5I2XA 2IX3A 1CKMA 2E2IB 4EQNA 4A3JH 1LLRD 4LFAL 3HOYB 1RTNA 2WINB 2ALYB 1H9KA 1JWMD 4K14A 2PZUA 4HIKA 3B6YA 4JBJA 3PO2H 4I7AA 5M5WB 1NR4A 4BBSH 2R7ZH 1LTRD 3HOXB 1QE6A 5CC4A 4A75A 1GUTA 1TWFH 4R1JA 1BKBA 4R4OA 2L1BA 1JWUD 2KEDA 3IL8A 2WAQB 4C3JB 5LMNL 3CAMA 5IYCG 1STHA 3GP7A 1SE8A 3BG3A 5FLMH 3Q0AA 2FJ2A 4PZ6A 2Z6KA 4A3EB 4X3SA 3EVQA 1LT3D 2RCFA 4GKJQ 4RKLA 4EGVA 4N8FA 1QZGA 4EVOA 4DK1A 2F0PA 4I65A 2WB1G 2UU9Q 4L63B 2XWJB 1IYUA 3CQZB 4Y7NH 3UDIA 2FFKB 3D4RA 3GTMB 4DF7A 2ID0A 3V96A 1DGSA 1E1TA 1Q8IA 1IBLQ 1K8AC 3D4WA 3V2TA 4OL7A 4BY1H 3I73A
chains in the Genus database with same CATH topology
3R2TA 4DU9A 2JXMB 2XN9C 1TU2B 4WJWA 1OO9B 1WTWA 2LS01 1ET6A 3QIAA 1TS3A 5EPJA 2OEOA 5KYIA 2WKDA 1FNWA 1C4QA 3CKIB 1KAAA 5G3LD 3CHBD 5IT9E 3M4YA 1I4QA 5ELDA 5LHY1 5E3FA 4OGQC 1EU3A 5JPNC 2SNSA 1KNEA 3KBGA 4DA2A 4NMZA 3D4DA 1WTXA 1C8CA 1VMPA 5KNBA 4IUUA 2K1BA 3I90A 2JEAI 2XWBB 3BYYB 1EY8A 4ZK9B 2QF7A 1F9QA 2XVSA 1V1PB 2KJXA 4ID6A 2ZXPA 1U4RA 1Z6HA 3R2IA 4C3JG 1Y8NB 4KD3A 1ESFA 3PV0A 5NUCA 4G4KA 1KDBA 2DY8A 1SNDA 4C3HB 1EQVA 4DNRB 3FRPB 1JCKB 4RHRA 1FGBD 2EDGA 1WCMB 2NB0A 2Q8RE 2A74C 4MN3A 1ZYRD 3BVGA 5JOBA 1VMCA 2D9UA 3OWFA 3L9AX 5CV6A 3G6JB 5I4DA 3L7ZC 1F77A 3AU7A 3MTSA 4IFDJ 2OXPA 3H0GB 3DMUA 1CTMA 2H1EA 5K5PA 5KRUA 5CORA 2F0IA 2Z1CA 5I2YA 1B2TA 1I4PA 1NCVA 1CHPD 1DJRD 2JP1A 3GTJB 2RQXA 3S1QB 2EVBA 1IYVA 4K8IA 3A55A 2L0CA 4C1NK 3IFDA 2AWNA 5CV4A 1OXXK 4QB4A 5EJWA 1CK1A 2PZTA 5KIXA 2HCCA 2KVMA 1AEXA 2Q8IB 3S9WA 1SFOB 1HXYD 1IKLA 1Z47A 3KLSA 4XQJA 2HDMA 2ICEC 5CBAE 4CJ0B 2F0WA 4L6TB 1PXUA 4C3HG 4A3FB 1DONA 1LT4D 1STYA 4H0LC 2NVYB 3J7YW 3PO3B 3MXPA 4ME5A 2C5CA 3DWAA 3KBXA 1G2SA 1JR0D 2EY1A 1YNND 5EBDA 3QOJA 1FYCA 2XRSD 4WRDA 4FF1A 2LMCB 1RF2D 4GZYC 2PZWA 4XYOA 2L5TA 1B9NA 2IX0A 2RA4A 4DGZA 4ULLA 1O7LA 2CQAA 4K6LA 5EBCA 1F2MA 2EYPA 1MGSA 2MHVA 4X3TA 4F7XA 1R4QB 3LNNA 4R9WA 4HCEA 1DZ1A 2ENBA 1F9PA 1YNJC 2Z4IA 3D3RA 4H44C 3FMCA 1I3QB 4DXGA 1S5ED 1RTOA 3AMUA 3SVMA 4H13C 2KCNA 2A68C 4A93B 1V1PA 4HAEA 3VYUA 1PZID 1RHPA 1T5XD 1PTOC 3NBIA 2EYFA 1XYIA 3J81L 2O4XA 4G7HC 4AYBB 1RD9D 3ONAB 1W6KA 1KNAA 3IFTA 3KK7A 2PNRC 2L9HA 3S14B 5KYLA 2QEJC 5EGTA 2AQ3B 1PTOH 3JAME 2BA1A 4KI0A 1VF5C 2CW0D 3EROA 1SSOA 4BBRB 3S2HB 3PO2B 1PFBA 1KLUD 2R7ZB 1SNQA 3OWEB 3VR5A 2FMCA 1H9JA 3EA6A 1TWFB 3BDCA 3VR2A 1F2YA 5DM63 4OIKA 5CR3A 2A6EC 3G7LA 1EY4A 1NSNS 3T51B 2F0TA 2EPBA 1IW7C 4E6IA 4HN7A 1OXUA 4HSVA 1SE3A 2BCOA 3OOCA 3C3LA 1G6ZA 4Y7NB 1GJXA 3PUVA 2ZXRA 3VR3A 1DOMA 3I3CA 3NP8A 1TY0A 5FK9C 4ZYSA 3H91A 1Q90A 1TS5A 5D65A 3HP3A 5CV9A 2NUCA 4BY1B 3PUYA 4DK0A 2BOSA 4IZ8A 4BWGB 3CRLC 5ELCA 3NQTA 2KA7A 1HQRD 1Q1EA 4KN7C 3OIPA 4V0BA 2RDHA 1M4VA 1KTKA 1K83B 1TS2A 1B3AA 1EZ8A 1A2UA 2JYOA 4FVMA 5E1FA 2VNUD 2QKIC 2R61A 3S1RB 5I6YA 3GTQB 2R6GA 2NN6I 3ZYYX 3GV3A 1HTLD 5JEAG 2EE1A 1R4PB 1QG7A 2F0GA 2N55A 1PDQA 5C3WA 1STGA 1SXTA 5FO9B 1S5FD 4X3UA 3WOEA 1DCZA 3NXWA 5F2DA 3MFGA 2VB3X 2WP8J 1PZKD 2VXWA 1X32A 3NQIA 3P20A 4DAYA 1BF4A 2PPBC 2M2LA 2E2JB 2KUMA 1TQOA 4RGMA 5HGTA 2EYLA 3HOVB 2NN6H 4NKLA 1Y1WB 3PUZA 3FEWX 1A3VA 3TZDA 3OHXC 5C4ZA 4A3KB 1SYGA 2KCCA 3OMCA 3K5NA 1BO0A 3P1HA 1ILQA 2SOBA 5T1IA 3E5SA 3FDTA 2L11A 2WIIB 1QCBD 5C5MA 5IT9L 3HOZB 1G2TA 3C46A 2F0UA 2X69A 5C0XG 3HOWB 4V190 1O78A 2XSCA 3M85A 1H9SB 2D2CC 1SMYC 2WKCA 3DEPA 4A3BB 4PMBA 4DFAA 1FD7D 4RGOS 2WV6D 1EWCA 3VR4A 1DD2A 4IQZA 3I4MB 1II3A 4QUFA 1TKWB 2NVQB 2B63B 3FKIB 3DUZA 4KJOA 3U9OA 1LABA 4PMWA 3GTGB 1B53A 1HTPA 1MSGA 2F0OA 2YU9B 3MWYW 1A3UA 1PTOF 1SYEA 1NUCA 3MVVA 5IOCA 4ZKCB 1E2VA 5CV5A 5BN5A 3A7LA 4N9PA 1LTAD 4I7ZC 1UNSA 4HMJA 5C4HA 2VUMB 1D1IA 3MXUA 3SK8A 1DYQA 1CFMA 4CJ1B 1PRTC 4BS9A 1QOHA 2TMPA 4XQNA 1KLGD 1S4ZA 3RMHA 5KEEA 1PMRA 1SJHD 4LMQD 1UUPA 4FP5D 4KY6A 1JE4A 1WVLA 1F9RA 2M9VA 4ABNA 4IUTA 1HRJA 1I4GA 3OW7A 5LL6X 2R93B 4K5WA 4QIWB 2J4XA 1WTPA 4B9WA 1CHQD 2K03A 1D5XC 2NBFA 1IHZA 1DOLA 3SXHA 2B2TA 2M00A 5CV7A 3NPPA 1U4LA 4DN4M 5K36G 3S2DB 2MGSA 4YIJA 2F0DA 3NSWA 4C3IB 5J39A 4B9XA 1SDFA 1GUWA 1CZWA 1LTTD 5IODA 1CQFA 1ZXTA 3SR1A 1ENFA 5A2QL 1IKMA 1L0XB 3N52A 4RKBA 3IAYA 2KECA 1ESRA 3H94A 5J22A 3BVMA 2IJ0A 1HA5A 4QMGA 3K0YA 1EYAA 2I46A 3TMEA 1XX8A 5KNDA 4UDUC 2PQEA 3EJIA 1WD1A 1SE2A 2Z8LA 1CM9A 2D62A 3DM1A 3CRKC 2B2VC 5CGKA 2K5QA 3MXNA 2EJFC 1PFNA 3HEJA 3A8KE 1A6XA 3V05A 1EFID 1HA6A 1Y69U 2AWOA 2AQ2B 5C44B 4OO1G 1EY0A 3ERQA 1SNMA 4QUCA 1EYDA 1EWHA 2RVLA 4K2LA 3S17B 3Q22A 3HGBA 2BDOA 3HRZC 5AFWA 2RSOA 3NBHA 2MP1A 4KK7A 3QWNA 4IUVA 5ELEA 3NTKA 4ZLTF 4G7OC 1GHJA 4RGTA 2EY5A 1LT5D 1JC7A 1K8MA 3J7AV 3FVQA 5A2QE 3NWSA 2NTSA 5BN4A 1BUVT 1JQYD 1F2LA 5JAVA 3VYSA 3GQBA 3N6RA 4IALA 3BDOA 3QG1A 2F0KA 4C3IG 4PNYA 2XRQD 3FPUB 4X3KA 4NDXA 3GTOB 3MXGA 4IFDG 4XIGS 1DOKA 1ET9A 3KUPA 3K5LA 2CVRA 1RODA 2EY6A 3MAQA 3DWPA 4KD4A 4EQPA 4FXGC 3GD7A 1OXSC 2B8GA 1RDPD 3X3MA 4FXKC 1WD0A 2JA5B 1MD2D 2PYKA 4HSPA 3BYTB 3BZDB 3C2PA 4IUQA 2VB2X 2MUYA 3U9SA 3NTHA 2JA8B 3T56B 5IGFA 1TY2A 3GV6A 4CKEA 1CZGA 1TWHB 2K33A 4IUNA 2RDGA 1AZQA 3ITPA 5FLXL 4C1NI 4QCLA 2SNMA 1V43A 2GA4B 4DXFA 2E2HB 5CBEE 1EYCA 2OF1A 1O7ZA 2A69C 2QCPX 4IURA 3JAML 3HOUB 4KHZA 1R9TB 3CU7A 2V4DA 1SJED 1HUMA 2BDNA 3LWEA 1S5DD 2F0MA 5FO8B 5A35A 1D5ZC 1CQVA 2BE5C 4A3DB 3DXJC 4J8QA 1L0YB 3BDLA 4C56C 3K7AB 4RFBA 1O7YA 1AW7A 1LV9A 4XTCS 4A3MB 1G291 2NVTB 1B9MA 1HPCA 1I4RA 5IGCA 4JK1C 2F0HA 3HS0C 2EJMA 1AZPA 3J7AF 3R8BA 3H6MA 1TWCB 2K28A 5CV8A 5IGDA 1AP0A 3PIO3 2NZ1D 2A6HC 2B2YA 1PRTF 1STEA 5FO7B 2SDFA 3WOFA 2LKVA 3F2UA 4S3SA 3PIP3 1LTBD 5FLXE 2CHBD 5C6AA 3HZXA 3I4NB 1ENAA 2FMMA 2LFNA 1BOSA 3H09A 1TIID 1CA6A 4LAAA 4LK1C 5M5XB 4A3JB 1XWEA 3R3OA 3SK6A 1QNUA 3T53B 2EJGC 4BBSB 4FYDA 2IPKD 3E6ZX 1BCPC 4TKOB 3C1EA 1U4PA 1Z7TA 2DNEA 2KQ3A 3C1FA 1JB3A 2XIWA 4OHJA 2O2LD 5ELBA 3NHHA 1BQQT 1Q1BA 1I6VC 5D14A 2B2UA 2E76C 1CI3M 2G9DA 4NW2A 1GUNA 3D6WA 1GXDC 1JICA 3VA7A 5JEAJ 1X3QA 4BA2I 4CHTB 2RBMA 3NUCA 2DY7A 1YNJD 5EPLA 1QILA 1UEAB 3SK4A 1SAPA 1TVXA 2F0EA 4KY7A 4K5XA 4IUPA 2DN8A 3VR6A 4RWSC 2A68D 1AFPA 1OXTA 1PTOD 2K32A 2H4OA 1QB5D 2K5WA 5FKAC 2F1MA 4M1UB 3K5MA 4ZAIA 1H9MA 1PRTB 5C4XB 1SE4A 1SNOA 1DM0B 1WTVA 1LACA 2YYZA 1I4XA 3S1NB 1F2ZA 1EY6A 2L55A 2F0JA 4HR7B 3X3NA 4O1NA 1GUOA 4K2KA 2E75C 2EYMA 4ZKBB 4LJZC 3I8ZA 4RA8A 4NP5A 1JORA 2JSOA 2DNCA 4N9TA 4HMIA 4OIJA 4TSSA 2A6ED 1MSHA 2WB1B 2B2WA 1WTQA 5BN3A 1EEFD 2KOLA 2F0NA 1IW7D 5C0XJ 2F0FA 4ILWA 4KTAA 4ODGA 4PMCA 3AB9A 3W3AA 2K6AA 3K58A 2RKSA 1EZ6A 1D5MC 1JOKA 3MC0B 4P2CB 1BNZA 1EY9A 2K04A 5FOBB 4G7ZC 1AN8A 3MHBA 1A3TA 3LWUA 3S16B 2L4NA 3HG9A 4HTHA 1W6JA 1EQTA 3URYA 2FHTA 4F88A 5JEAH 2L12A 1GHKA 1ENCA 4C2MB 4A3IB 3NE5B 1NAPA 1JWSD 1Y8PB 2ZXOA 5EQ0A 4F87A 3QB3A 3A7AB 5DEHA 1LTSD 1C48A 3BVZA 5IGBA 1MBYA 2QDBA 5ISRA 4FO2A 2QILA 4R8NA 2E74C 3MZ5A 2R3ZA 4EQOA 4KY5A 1HQMC 1CT1D 5COYA 3TP7A 3RZOB 5HURA 1E0BA 5D3DA 3TP8A 3OPOA 4RHSA 1WTOA 2C9OA 1B4OA 5C0XI 4R8IA 1VCIA 4XXEA 3TDQA 3S15B 3FPPA 2AUJD 3QOLA 2B2TC 5IIFA 4MHEA 5JJZA 2I07B 3UI2A 2AUKA 1B50A 1ZYRC 4KKUA 4K8JA 4BY7B 1S5BD 2FINB 1XXGA 4K6DA 2Q8TA 2MPMA 3KLRA 3K59A 4L8JA 2Z4HA 3J80E 5IGEA 1VDZA 2F03A 5KNCA 1SYFA 1S5CD 4PV1C 5EPKA 1ILPA 2JA7B 4Q0FA 1V1OA 4K5VA 5C0XH 1BCPF 2X6LA 2PCFB 2IW3A 3TSSA 1TR5A 1EIGA 3PUXA 4KKTA 5E4WC 1HUNA 5I9PA 2JA6B 2XNAC 3RD4A 2O5IC 4WFN3 4FXDA 4ZUIA 2SEBD 2RSNA 1KDCA 3TBIB 3D6CA 2A5HA 2Y0SB 1TS4A 3SHLA 3HKZB 1SMYD 2F0VA 4CJ2C 3GTKB 3Q24A 4UAIA 3QJYA 4ZUJA 4IN3A 3A56A 3MEHA 1JOOA 4RAUC 5TSSA 5KGUA 2K01A 3P75A 2EZVA 1UAPA 2F3VA 1EOTA 2NWGA 1KABA 3ND9A 4KHVA 4Q5VA 2IT1A 4CKCA 3D8GA 4G57A 1EL0A 3WDNA 3PUWA 1F9SA 3GTPB 1H9RA 1YNNC 5J1ZA 1PTOB 4TRDA 1STNA 1PRTD 2J7ZA 2JEBI 2G9HD 3D31A 4CGYB 3K5OA 5C3XA 3L3OC 1SNCA 5K36H 1A15A 1HFGA 1KDAA 3R93A 3NK9A 1U4MA 3EQLC 2O5JC 2ZT9C 2EYOA 3TN2A 1SYDA 3PMFA 2HQEA 1IL8A 1BCPB 2B2VA 1NR2A 3SDZA 4OO1I 1H9SA 1PLFA 5I6WA 4QF4A 3T16A 3TP5A 5G3LF 2PO4A 1TT2A 2B8FA 1RKNA 1D6EC 3MA2B 2PW7A 4RGNA 3T4AC 5D3IB 2PW5A 2ICIA 3OSOA 2JE6I 1ML0D 2HCIA 4KV6A 1Y8OB 1A2TA 4PQXA 5M5YB 1EY5A 5JVG3 3DWQA 2CW0C 1ZKOA 1QJOA 4HEDA 2F0LA 4KN4C 4OO1H 4DNTB 3BS1A 3RLFA 3S1MB 2LY7A 2A73B 1E2WA 3RUZA 4IFDI 2EXZA 1J9OA 2B2YC 2X6GA 4HCSA 4RH6A 3P7JA 1BBXC 1PYWD 1GUSA 1LTID 2F0QA 1T5EA 4KKSA 5I9OA 3A8JE 4ZQ3A 3SK5A 4XT1B 4CBVA 1BXTA 2KHSA 4BA1I 3GTLB 3RZDB 4KJNA 5DAUA 5C5LA 4IFDH 2HUGA 4B08A 3E0JA 1I50B 3OIQA 5JVH3 3M7GA 3Q6SA 3M7NA 2D5DA 1SBBB 1Y1VB 2PMZB 4FNFA 2K05A 1XTCD 5CYUA 1LTGD 1EY7A 1U9RA 4DAPA 5LL6S 1X3PA 2B2UC 2K7VA 1MI2A 1D2BA 1J8IA 4JBWA 5M3MB 2EYHA 2WACA 4RCOA 2OT2A 1ICWA 4ZRZA 2NYZD 4XYQA 4FF3A 2NVXB 2EOTA 1I4HA 5C4JB 2K5DA 1BDOA 3VYRA 1GOZA 5JPMC 2A69D 3GO5A 2F3WA 2F0SA 4TQUS 1SEBD 3Q23A 5ELFA 1V8QA 5M9OA 3I72A 2IWHA 1DXMA 2BE5D 1VF7A 3VA5A 3SE0A 3LX0A 2NTTA 1QWYA 4A3GB 3M3YB 3W2DA 3IKJA 3I4LA 2HDLA 3KLSX 4XT3B 2EYJA 2NN6G 1PZJD 4J6HA 3TZUA 1RJTA 2TSSA 3NTIA 1JOQA 3SEBA 3H3VC 1RCVD 3KF8A 5M3FB 3J81E 2IX1A 1FR3A 3A8IE 1PFMA 5DM73 1QNKA 2EY2A 4U68A 2A6HD 1BR9A 2AQ1B 1EU4A 1O80A 3OMGA 1CA5A 5EKLA 1HFNA 3MFYA 1FNUA 4XDXA 1Q3LA 2B2WC 1STAA 4J1MA 1HCZA 3QO2A 4KMUC 1STBA 1EEID 1G8ZD 3EFXD 1ZEQX 3M4OB 4U673 1D1KA 3A54A 1TWGB 1OXVA 5EKIA 1WTRA 5EKKA 1HHVA 1SNPA 1LO5D 4DAVA 5DNFA 1BCPD 1FNVA 1M8AA 1Q12A 3I91A 2E2DC 3T13A 2F4IA 2RDFA 1GUGA 2MJ8A 1EIHA 4Z9CB 1B44D 4CKBA 4XQQA 5CMDA 1LT6D 5E4XA 4M8AA 3NWTA 5C3EB 5IGGA 2R92B 1K8OA 3DEOA 2J0TD 3ND8A 4F8MA 1SYBA 2B39A 4FF2A 1E2ZA 1G91A 4O42A 3K57A 2N88A 2KEEA 3I70A 3DHQA 4H7BA 1SYCA 3O13A 1TWAB 3TP6A 4RCNA 2BA0A 1I6HB 2IL8A 3J80L 3K6OA 4MIUA 4WORA 1B1ZA 1ONLA 3VYTA 5T1GA 5I2XA 2IX3A 2E2IB 4EQNA 3HOYB 1LLRD 1RTNA 2WINB 1H9KA 1JWMD 4K14A 2PZUA 5M5WB 1NR4A 1LTRD 3HOXB 1QE6A 5CC4A 1GUTA 2L1BA 1JWUD 2KEDA 3IL8A 2WAQB 4C3JB 1STHA 3GP7A 3BG3A 3Q0AA 2FJ2A 4A3EB 4X3SA 3EVQA 1LT3D 4RKLA 4EGVA 4EVOA 4DK1A 2F0PA 4I65A 4L63B 2XWJB 1IYUA 3CQZB 2FFKB 3D4RA 3GTMB 4DF7A 2ID0A 3V96A 1Q8IA 3D4WA 3V2TA 4OL7A 4FF4A 3I73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EE1 A;  1QG7 A;  1SAP A;  1TVX A;  2NZ1 D;  5CMD A;  1AP0 A;  2B2Y A;  1ZXT A;  2N55 A;  4IUP A;  2Q8R E;  2X6L A;  1SSO A;  4RWS C;  1PDQ A;  3KBX A;  4MN3 A;  5E4X A;  1G2S A;  1IKM A;  1DOK A;  1A15 A;  3KUP A;  2L4N A;  2SDF A;  1HFG A;  2CVR A;  4QUF A;  1VMC A;  2D9U A;  4XT1 B;  1EIG A;  3R93 A;  1PFB A;  5E4W C;  3F2U A;  1WTW A;  1ROD A;  3N52 A;  1EQT A;  1HUN A;  5EPJ A;  2KEC A;  1U4M A;  1ESR A;  3DEO A;  2HDL A;  4X3U A;  2FHT A;  4XT3 B;  2L12 A;  3MTS A;  2RSN A;  1RJT A;  1WD0 A;  1B53 A;  3TN2 A;  1G91 A;  4O42 A;  2FMM A;  1MSG A;  4ZAI A;  2H1E A;  1XX8 A;  4OIK A;  2N88 A;  1IL8 A;  2KEE A;  2HUG A;  2VXW A;  4IUQ A;  1X32 A;  2B2V A;  1NR2 A;  5COR A;  1WTV A;  3G7L A;  4CJ2 C;  1NAP A;  1CA6 A;  1WD1 A;  3MWY W;  1BF4 A;  2M2L A;  1PFM A;  2RA4 A;  5EQ0 A;  4UAI A;  1CM9 A;  2KUM A;  1PLF A;  3GV6 A;  1QNK A;  3DM1 A;  2IL8 A;  4ZKC B;  4U68 A;  2EPB A;  1MGS A;  2B2V C;  3Q6S A;  1AZQ A;  1O80 A;  4X3T A;  1B2T A;  4HSV A;  1CA5 A;  1KNE A;  1NCV A;  2R3Z A;  1HFN A;  4R9W A;  1G6Z A;  3TZD A;  5CBE E;  5COY A;  1PFN A;  2K05 A;  4XDX A;  2JP1 A;  5T1G A;  1DOM A;  4CJ1 B;  1Q3L A;  1E0B A;  1WTX A;  3I3C A;  4RAU C;  1RTN A;  1C8C A;  4ZKB B;  2B2W C;  1O7Z A;  1HA6 A;  4IUR A;  3H91 A;  1VMP A;  1DZ1 A;  3I8Z A;  1S4Z A;  1X3P A;  2K01 A;  3HP3 A;  5D65 A;  4IUU A;  2B2U C;  2K1B A;  3I90 A;  4RA8 A;  1U4P A;  1F9P A;  4LMQ D;  4QUC A;  1NR4 A;  3QO2 A;  1WTO A;  4ZK9 B;  1BO0 A;  2RVL A;  1ML0 D;  1HUM A;  1B4O A;  1F9Q A;  1MI2 A;  1ILQ A;  2BDN A;  2HCI A;  4R8I A;  2XIW A;  1J8I A;  4OIJ A;  1EOT A;  1JE4 A;  3LWE A;  1WVL A;  5AFW A;  1MSH A;  2NWG A;  1QE6 A;  2RSO A;  1F9R A;  3IFD A;  2MP1 A;  5T1I A;  5EJW A;  1U4R A;  2L1B A;  4IUT A;  2B2W A;  1RTO A;  2KED A;  1WTQ A;  1HRJ A;  3FDT A;  2B2T C;  3IL8 A;  3SVM A;  4HED A;  1ICW A;  4MHE A;  4X3K A;  2B2U A;  2L11 A;  2HCC A;  2KOL A;  5D14 A;  3UI2 A;  5JJZ A;  1B50 A;  2KVM A;  4IUV A;  1EL0 A;  2NYZ D;  4ZLT F;  1B3A A;  1F9S A;  4HAE A;  5EKI A;  1O7Y A;  1WTR A;  1LV9 A;  2FIN B;  1WTP A;  2FJ2 A;  1RHP A;  1G2T A;  2JYO A;  4NW2 A;  2K03 A;  1HHV A;  4X3S A;  2EOT A;  2Q8T A;  1XYI A;  5DNF A;  2MPM A;  3D6W A;  1JIC A;  2X69 A;  1IKL A;  1DOL A;  1F2L A;  2B2T A;  1J9O A;  1M8A A;  2B2Y C;  3ONA B;  2DY8 A;  3I91 A;  1KNA A;  1X3Q A;  2J7Z A;  1U4L A;  2HDM A;  4DN4 M;  2X6G A;  5CBA E;  4CJ0 B;  4HCS A;  2DY7 A;  1AZP A;  2FFK B;  5EPL A;  2MGS A;  2L9H A;  1EIH A;  2MJ8 A;  1BNZ A;  2K04 A;  3DEP A;  5EPK A;  1DON A;  1SDF A;  3GV3 A;  3P7J A;  1GUW A;  1ILP A;  2K28 A;  1BBX C;  3FPU B; 
#chains in the Genus database with same CATH topology
 3U4V A;  3R2T A;  1J6Q A;  1BBW A;  4APV A;  4DU9 A;  2JXM B;  4P71 A;  2XN9 C;  1TU2 B;  1K0R A;  4WJW A;  3PSI A;  1OO9 B;  4JOI C;  5C3E G;  2LS0 1;  1WTW A;  1ET6 A;  4A76 A;  3QIA A;  1TS3 A;  4DK6 C;  5EPJ A;  2JJQ A;  2OEO A;  5KYI A;  1K83 H;  2WKD A;  1FNW A;  1UE5 A;  1C4Q A;  1YHB A;  2OQ0 A;  3CKI B;  4HJ7 A;  4DKA C;  1KAA A;  2KHI A;  2HT1 A;  3A74 A;  5G3L D;  3CHB D;  5IT9 E;  3M4Y A;  1I4Q A;  2YTX A;  5ELD A;  1N36 Q;  1C9O A;  5LHY 1;  5E3F A;  4OGQ C;  1EU3 A;  5IE8 A;  3EN2 A;  1VQB A;  5JPN C;  1UE1 A;  2SNS A;  1XPO A;  1KNE A;  3KBG A;  4DA2 A;  5IYD G;  1J5E Q;  4NMZ A;  5C4X H;  1C7Y A;  3HOY G;  4DR7 L;  3D4D A;  1WTX A;  4JI6 L;  1C8C A;  3S1N H;  3T1Y Q;  1VMP A;  5KNB A;  4IPD A;  1XNR Q;  4IUU A;  2K1B A;  3I90 A;  1HJP A;  2JEA I;  2XWB B;  2H5X A;  3BYY B;  1EY8 A;  1E7Z A;  4ZK9 B;  2QF7 A;  2XGT A;  1F9Q A;  2XVS A;  3HOX G;  1V1P B;  2KJX A;  1B70 B;  1PH8 A;  4ID6 A;  2ZXP A;  1U4R A;  1Z6H A;  3R2I A;  4C3J G;  1Y8N B;  4OX9 L;  4KD3 A;  1ESF A;  3PV0 A;  4BXX H;  5NUC A;  1WFQ A;  4IOA A;  4G4K A;  4JI5 Q;  3OTO L;  2LXK A;  3HOV H;  1KDB A;  2RF4 A;  1Y1W H;  2DY8 A;  2VS1 A;  4YY3 Q;  1WOC A;  5IP7 G;  1SND A;  3U58 A;  4A3K H;  1XJV A;  4C3H B;  1EQV A;  4DNR B;  3FRP B;  1JCK B;  4RHR A;  1FGB D;  2EDG A;  1WCM B;  2WAQ E;  3JAM i;  2NB0 A;  2Q8R E;  2A74 C;  2E8G A;  4MN3 A;  1ZYR D;  3BVG A;  4GOP A;  5JOB A;  1VMC A;  2D9U A;  4JI2 Q;  2UXB L;  3OWF A;  3L9A X;  5CV6 A;  3G6J B;  5I4D A;  3L7Z C;  1F77 A;  3CF5 A;  3AU7 A;  3MTS A;  4IFD J;  2OXP A;  3H0G B;  1KXL A;  3DMU A;  1CTM A;  2H1E A;  5K5P A;  5KRU A;  3PQI A;  1KQS A;  4UY8 C;  5COR A;  3E3X A;  3HOW H;  2N3S A;  4X6A H;  3KJO A;  2PQA A;  1HH2 P;  2F0I A;  4YHH L;  1Y14 B;  2Z1C A;  5I2Y A;  4A3B H;  1N32 L;  1B2T A;  5FLX c;  1I4P A;  1NCV A;  1VQJ A;  3OW2 A;  1CHP D;  4DV0 L;  1DJR D;  1X3F A;  4JPB W;  3KLW A;  2JP1 A;  2Y0S G;  4HJ8 A;  1M90 C;  3GTJ B;  2RQX A;  3HKZ G;  3S1Q B;  2VQF L;  2EVB A;  2NVQ H;  2B63 H;  1IYV A;  3TS0 A;  4K8I A;  3A55 A;  2L0C A;  4C1N K;  5EAY A;  3IFD A;  2AWN A;  5CV4 A;  1OXX K;  4QB4 A;  5EJW A;  1CK1 A;  1RL2 A;  1UWV A;  2PZT A;  3I56 A;  5KIX A;  2HCC A;  2KVM A;  1AEX A;  4GNX B;  1XPU A;  2Q8I B;  2YU9 H;  3S9W A;  1SFO B;  2IHE A;  1HXY D;  1GM5 A;  3S15 H;  1IKL A;  1Z47 A;  2KCM A;  3KLS A;  4XQJ A;  1YEZ A;  2HDM A;  2ICE C;  3W1B A;  5CBA E;  4CJ0 B;  2F0W A;  1NY4 A;  3DLL A;  1LYL A;  4L6T B;  1PXU A;  4C3H G;  4A3F B;  3LGJ A;  1DON A;  1LT4 D;  2F4V Q;  1WCM G;  1STY A;  4H0L C;  4YWK A;  2UXD L;  2NVY B;  3J7Y W;  5LMU L;  1RIP A;  3PO3 B;  3MXP A;  4ME5 A;  2C5C A;  3DWA A;  2JK8 A;  4JYA L;  2I0Q A;  1B7Y B;  3KBX A;  1G2S A;  1KL9 A;  1JR0 D;  2EY1 A;  1IBM Q;  4DUZ Q;  1YNN D;  5EBD A;  3QOJ A;  1FYC A;  2R93 H;  4MNO A;  4DAM A;  2XRS D;  4DAY B;  4WRD A;  2JA7 H;  3CC7 A;  4FF1 A;  2LMC B;  1RF2 D;  4RG1 A;  4B3T L;  2PZW A;  4GZY C;  4XYO A;  5BR8 L;  2L5T A;  1VQK A;  1B9N A;  2IX0 A;  3EBE A;  3PIP A;  2RA4 A;  2JA6 H;  4DGZ A;  5H1S E;  4ULL A;  4DV7 L;  1K9M C;  1O7L A;  3S2D H;  2CQA A;  4K6L A;  5EBC A;  1F2M A;  2EYP A;  3GDE A;  1MGS A;  4DR6 L;  2MHV A;  4X3T A;  4F7X A;  1R4Q B;  3LNN A;  4HJ5 A;  1PH6 A;  4R9W A;  2HHH Q;  4HCE A;  3GTK H;  3CCU A;  5IYB G;  4UP7 A;  3CD6 A;  3CPF A;  2AMC B;  2CH4 W;  4DNI A;  4LF9 L;  1DZ1 A;  2ENB A;  3UDF A;  1F9P A;  4WJ3 M;  1B3Q A;  1YNJ C;  2Z4I A;  3D3R A;  4H44 C;  3FMC A;  1I3Q B;  4DXG A;  5JJK A;  1S5E D;  1RTO A;  4DV4 L;  3E9I A;  2A1A A;  2ZJQ A;  3AMU A;  3RN5 A;  3SVM A;  4H13 C;  2KCN A;  2A68 C;  4A93 B;  2QW7 A;  1V1P A;  1N33 L;  4HAE A;  4K0K Q;  4OON A;  1Q86 C;  4POF A;  3VYU A;  1PZI D;  1RHP A;  1T5X D;  2PI2 E;  1PTO C;  3OYY A;  3NBI A;  4JI8 Q;  2EYF A;  1XYI A;  3J81 L;  2O4X A;  4G7H C;  2ES2 A;  1U5K A;  4JV5 Q;  4AYB B;  1RD9 D;  3ONA B;  1W6K A;  1KNA A;  3DM3 A;  3IFT A;  1XMO Q;  1KHI A;  4AQY L;  3KK7 A;  2PNR C;  1QVC A;  3GTP H;  2L9H A;  2UXC L;  1X3G A;  3S14 B;  1JJ2 A;  5KYL A;  2QEJ C;  5EGT A;  4DV5 Q;  2HD3 A;  4GS3 A;  3CW2 C;  2AQ3 B;  1PTO H;  3JAM E;  2BA1 A;  4KI0 A;  1VF5 C;  2CW0 D;  2AHO B;  3S17 H;  3ERO A;  1LTL A;  1SSO A;  4LFA Q;  4BBR B;  3S2H B;  4MTK A;  4KLK A;  3PO2 B;  1PFB A;  1MJC A;  1WJJ A;  4GKK Q;  1KLU D;  2R7Z B;  1SNQ A;  3OWE B;  3VR5 A;  4JBK A;  1K8G A;  2FMC A;  1H9J A;  3EA6 A;  1TWF B;  3BDC A;  3VR2 A;  1F2Y A;  5DM6 3;  4OIK A;  5CR3 A;  1JT8 A;  2A6E C;  4YCW A;  3G7L A;  1EY4 A;  1XTD A;  1NSN S;  3T51 B;  1L1O A;  2GVB A;  1XNQ Q;  2F0T A;  2EPB A;  1IW7 C;  4QJF A;  2F3I A;  4E6I A;  3CCR A;  4HN7 A;  1OXU A;  4HSV A;  3F8T A;  3STB D;  1SE3 A;  2BCO A;  3OOC A;  3C3L A;  1G6Z A;  4Y7N B;  1GJX A;  1H95 A;  3PUV A;  3GTO H;  2ZXR A;  3VR3 A;  1DOM A;  3I3C A;  3NP8 A;  1TY0 A;  1VQC A;  5FK9 C;  4ZYS A;  3H91 A;  1Q90 A;  1TS5 A;  5D65 A;  3HP3 A;  5CV9 A;  2NUC A;  4BY1 B;  3J7A 5;  1O7I A;  4DK3 C;  3PUY A;  4DK0 A;  2BOS A;  4IZ8 A;  4BWG B;  3CRL C;  5ELC A;  2K14 A;  2Q2H A;  3NQT A;  2KA7 A;  1HQR D;  1YHA A;  1Q1E A;  4KN7 C;  3OIP A;  1FVI A;  4V0B A;  3AFP A;  2D0O A;  2JA5 H;  2RDH A;  1M4V A;  1KTK A;  1K83 B;  1TS2 A;  5ELN A;  4A93 G;  1B3A A;  1EFW A;  4A3L H;  4IJH A;  4X66 L;  1EZ8 A;  1X65 A;  2JA8 H;  1A2U A;  2JYO A;  2K52 A;  1Q8K A;  1FL0 A;  4AYB G;  2Q2T A;  4CDE C;  4FVM A;  5E1F A;  2VNU D;  4LFC L;  2QKI C;  2R61 A;  2E2H H;  5M3M G;  3S1R B;  5I6Y A;  3GTQ B;  2R6G A;  2CWP A;  1KRT A;  2NN6 I;  3ZYY X;  3GV3 A;  1K3R A;  1HTL D;  5JEA G;  2EE1 A;  1R9T H;  1R4P B;  1QG7 A;  2F0G A;  2I5L X;  2N55 A;  3UDX A;  1EYG A;  4DR7 Q;  3A5Z B;  4JI6 Q;  1PDQ A;  4BBR G;  5C3W A;  1STG A;  1SXT A;  2F52 A;  5FO9 B;  3H15 A;  2R7Z G;  3J80 c;  1S5F D;  4X3U A;  4JI7 Q;  3WOE A;  1DCZ A;  3K7A H;  1EQQ A;  1L2F A;  2NVT H;  2HIX A;  3NXW A;  1BVS A;  3Q8D A;  5F2D A;  4WJ4 A;  2DJF C;  3UE0 A;  3MFG A;  1CKO A;  2VB3 X;  2B3G A;  2WP8 J;  1PZK D;  2VXW A;  4OX9 Q;  1X32 A;  3NQI A;  3PF4 A;  3MXN B;  3P20 A;  4DAY A;  1BF4 A;  2PPB C;  2M2L A;  2E2J B;  1HNW L;  3EIV A;  4A3G G;  2KUM A;  1TQO A;  4RGM A;  1EUJ A;  5HGT A;  2EYL A;  4MTN A;  4LUZ A;  3OTO Q;  2NN6 H;  3RZD H;  3GTL H;  3HOV B;  4NKL A;  1Y1W B;  1HNX L;  1TWC H;  3E0E A;  3PUZ A;  2CFM A;  3FEW X;  1IXR A;  2EXD A;  1JE5 A;  1A3V A;  3TZD A;  3OHX C;  5C4Z A;  5IP9 G;  1IYJ B;  4A3K B;  1PYB A;  1SYG A;  3NBH B;  1E22 A;  2KCC A;  4BY1 G;  1I50 H;  3OMC A;  5M3F G;  3K5N A;  1BO0 A;  3P1H A;  1ILQ A;  5HGQ A;  1UE6 A;  1VQL A;  2SOB A;  1Y1V H;  4GN5 A;  3T1H L;  5T1I A;  4X65 L;  2R7F A;  3I4N H;  3E5S A;  2UXB Q;  4A4I A;  4DV2 Q;  2NZO A;  3FDT A;  2L11 A;  2WII B;  1QCB D;  5C5M A;  5M5X H;  5IT9 L;  3RN2 A;  3HOZ B;  4UP8 A;  1G2T A;  2I5H A;  2OWO A;  3C46 A;  2F0U A;  3FP9 A;  2X69 A;  3K7U C;  5C0X G;  3HOW B;  2MNA A;  2AKW B;  4V19 0;  1O78 A;  2I5M X;  1KC8 C;  2XSC A;  4YHH Q;  3M85 A;  1H9S B;  2D2C C;  1SMY C;  2WKC A;  1VQF A;  3DEP A;  4A3B B;  2K5V A;  2NVX H;  1ICF B;  1YJW A;  5C4J H;  4PMB A;  4DFA A;  1E24 A;  1FD7 D;  2WV6 D;  4RGO S;  1EWC A;  4TVA B;  3VR4 A;  1DD2 A;  4IQZ A;  3I4M B;  1II3 A;  1KD1 C;  4QUF A;  1TKW B;  2NVQ B;  2VQF Q;  2B63 B;  3FKI B;  1PYS B;  3DUZ A;  4KJO A;  3U9O A;  3ZJY C;  1LAB A;  4GLX A;  4PMW A;  3ERS X;  3GTG B;  1B53 A;  1HTP A;  3J7Z C;  1MSG A;  3M3Y H;  2F0O A;  2YU9 B;  3MWY W;  1A3U A;  1PTO F;  1SYE A;  2WFW A;  4L5S A;  1NUC A;  3MVV A;  5IOC A;  4ZKC B;  3HOV G;  4X62 L;  2R92 G;  1E2V A;  5CV5 A;  4CDF C;  5BN5 A;  3A7L A;  4N9P A;  1LTA D;  4I7Z C;  1UNS A;  4HMJ A;  5C4H A;  4N8X 1;  2VUM B;  2JA9 A;  3F2C A;  1D1I A;  3MXU A;  3SK8 A;  4A3K G;  1DYQ A;  1CFM A;  4CJ1 B;  4QGU A;  1PRT C;  4BS9 A;  1VQP A;  1QOH A;  2TMP A;  4R4I A;  4XQN A;  1KLG D;  1S4Z A;  2N78 A;  3RMH A;  5KEE A;  3KJP A;  1PMR A;  1SJH D;  2UXD Q;  4LMQ D;  1UUP A;  5LMU Q;  4FP5 D;  3QR8 A;  4YWL A;  4KY6 A;  4JYA Q;  1JE4 A;  1WVL A;  3TEH B;  1F9R A;  4IO9 A;  2M9V A;  4ABN A;  1HNZ L;  4IUT A;  1HRJ A;  1I4G A;  3OW7 A;  4P73 A;  5LL6 X;  2R93 B;  4K5W A;  4QIW B;  2J4X A;  4DV1 L;  1WTP A;  3HOZ G;  4B9W A;  1CHQ D;  4LF5 L;  2K03 A;  1JJG A;  1D5X C;  1N9W A;  4B3T Q;  2NBF A;  1IHZ A;  1DOL A;  5BR8 Q;  3SXH A;  2B2T A;  2M00 A;  5CV7 A;  3NPP A;  1U4L A;  4DN4 M;  4ALP A;  2BH2 A;  5K36 G;  1TWG H;  3S2D B;  4DV7 Q;  5IYC H;  2MGS A;  4GOP C;  4YIJ A;  2F0D A;  3NSW A;  4C3I B;  5J39 A;  4DV6 Q;  4DR6 Q;  4B9X A;  2WAQ G;  4CDC C;  1SDF A;  1GUW A;  1CZW A;  1LTT D;  5IOD A;  4R4T A;  4JOI A;  4LW1 A;  1CQF A;  3CPW A;  1ZXT A;  2K5N A;  3SR1 A;  4LWC A;  4A3E G;  1PH5 A;  3I4M G;  1ENF A;  1NJI C;  3CC4 A;  5A2Q L;  1IKM A;  1L0X B;  4LF9 Q;  1XMQ Q;  2B63 G;  3FKI G;  3TQY A;  3N52 A;  4RKB A;  3IAY A;  3J81 j;  2VL6 A;  3A0J A;  4OEL B;  2KEC A;  1HR0 L;  1ESR A;  3H94 A;  5J22 A;  3BVM A;  2IJ0 A;  3KFU A;  1HA5 A;  4QMG A;  3BZC A;  3K0Y A;  1EYA A;  2I46 A;  3TME A;  4DV4 Q;  1XX8 A;  5KND A;  4UDU C;  4DR3 L;  4A3C G;  2PQE A;  3EJI A;  2VZA A;  5C3E H;  4YCU A;  1N33 Q;  1WD1 A;  1SE2 A;  2Z8L A;  1CM9 A;  4DR1 L;  2D62 A;  3DM1 A;  3CRK C;  2B2V C;  5CGK A;  1XPR A;  2VUM G;  2K5Q A;  4YWM A;  2BH8 A;  3MXN A;  4JC0 A;  3S24 A;  4AQY Q;  2HIV A;  2EJF C;  1PFN A;  3HEJ A;  3A8K E;  1NBW A;  2QGQ A;  1A6X A;  2UXC Q;  3V05 A;  1EFI D;  1V9P A;  1HA6 A;  1TWA H;  2AWO A;  1Y69 U;  3S16 H;  2AQ2 B;  5C44 B;  1G6P A;  4OO1 G;  1EY0 A;  3ERQ A;  1SNM A;  4QUC A;  4QY7 A;  3F1Z A;  1EYD A;  1A0I A;  1EWH A;  2RVL A;  4K2L A;  3S17 B;  4KHP L;  3Q22 A;  3HGB A;  2BDO A;  3HRZ C;  5AFW A;  2RSO A;  3NBH A;  1CKN A;  2MP1 A;  3CCS A;  2E2I H;  3HOY H;  4KK7 A;  4B3R L;  4C2M H;  3QWN A;  1K0S A;  1A62 A;  2MQH A;  4IUV A;  3NTK A;  4YCV A;  5ELE A;  1GHJ A;  4ZLT F;  3CCV A;  4RGT A;  4A3I H;  1VQ9 A;  2UUB L;  2EY5 A;  4R4Q A;  4DUY L;  1PV4 A;  4POG A;  1LT5 D;  1JC7 A;  1K8M A;  4P72 A;  3L2P A;  4OWT B;  3HOX H;  3J7A V;  3FVQ A;  5A2Q E;  3NWS A;  4JCV E;  1PHJ A;  2NTS A;  5BN4 A;  1BUV T;  1JQY D;  1F2L A;  5JAV A;  3VYS A;  3GQB A;  3N6R A;  4IAL A;  3ULP A;  3BDO A;  4C3J H;  3QG1 A;  1PVO A;  3CXC A;  2F0K A;  3RZO H;  4C3I G;  3RNU A;  4PNY A;  4O0A A;  4FF4 A;  2XRQ D;  1MKH A;  1GD7 A;  3FPU B;  4X3K A;  4QIW E;  4NDX A;  3GTO B;  3MXG A;  2ASB A;  4IFD G;  4XIG S;  1DOK A;  1E3P A;  1ET9 A;  3KUP A;  3K5L A;  3CQZ H;  2CVR A;  5IP7 H;  3GTM H;  4PZ8 A;  1ROD A;  2EY6 A;  3MAQ A;  3DWP A;  4KD4 A;  4EQP A;  4FXG C;  4DR4 Q;  3GD7 A;  4LF8 Q;  1OXS C;  1MIU A;  2B8G A;  4BY7 H;  1RDP D;  3X3M A;  3CCE A;  4FXK C;  1WD0 A;  2JA5 B;  1MD2 D;  2PYK A;  4HSP A;  3BYT B;  3BZD B;  3C2P A;  3G4S A;  4IUQ A;  2VB2 X;  4JI3 Q;  2MUY A;  3U9S A;  3NTH A;  2JA8 B;  3T56 B;  4X66 Q;  5IGF A;  1K3B C;  2K5H A;  1TY2 A;  3GV6 A;  4CKE A;  1CZG A;  1TWH B;  2K33 A;  2LSS A;  1D7Q A;  4IUN A;  2RDG A;  1AZQ A;  4LFB L;  3ITP A;  5FLX L;  4C1N I;  4LUV A;  4QL5 A;  4QCL A;  2SNM A;  1V43 A;  2GA4 B;  4DXF A;  3UDG A;  3TRE A;  4LFC Q;  2E2H B;  5CBE E;  3PIO A;  3H0G G;  4GLV B;  1EYC A;  2OF1 A;  2G5D A;  1O7Z A;  2A69 C;  2QCP X;  4IUR A;  3JAM L;  4J15 A;  5C44 G;  5AJ3 L;  3HOU B;  4KHZ A;  3J81 c;  1R9T B;  3CU7 A;  2V4D A;  4JI0 L;  1SJE D;  4B3M Q;  1A8V A;  1HUM A;  2BDN A;  1QVF A;  3LWE A;  1S5D D;  2F0M A;  5FO8 B;  5A35 A;  2DJG C;  1D5Z C;  1CQV A;  2BE5 C;  4A3D B;  3DXJ C;  2QA4 A;  3T1Y L;  4J8Q A;  1L0Y B;  4NXM Q;  3BDL A;  4C56 C;  3K7A B;  4RFB A;  1O7Y A;  1AW7 A;  1LV9 A;  4XTC S;  4A3M B;  1G29 1;  5GAH C;  2NVT B;  1B9M A;  1HPC A;  1UE7 A;  1I4R A;  4B3S L;  2Z0S A;  5IGC A;  4JK1 C;  3W5O A;  2F0H A;  3HS0 C;  1KAW A;  4OWW B;  2EJM A;  3M9B A;  1AZP A;  1C0A A;  2KEN A;  3J7A F;  1PA6 A;  2MO1 A;  3R8B A;  3H6M A;  1TWC B;  2K28 A;  5CV8 A;  5IGD A;  1SN8 A;  2GN5 A;  1AP0 A;  3PIO 3;  2NZ1 D;  2A6H C;  2B2Y A;  1PRT F;  1STE A;  4YY3 L;  5IY0 A;  4JI4 L;  3D0F A;  5FO7 B;  4UHV A;  2SDF A;  3WOF A;  2LKV A;  4IPC A;  1LM0 A;  3KOJ A;  3F2U A;  4S3S A;  2PNH A;  3PIP 3;  4ME3 A;  1LTB D;  5FLX E;  1X55 A;  2CHB D;  5C6A A;  3BJU A;  1L1O C;  3HZX A;  3T1H Q;  4A3F G;  3I4N B;  3ER0 A;  1ENA A;  2FMM A;  2LFN A;  1BOS A;  3H09 A;  1TII D;  1SR3 A;  2UUC L;  3PO3 G;  4JI2 L;  1IBK Q;  1CA6 A;  4LAA A;  2OCE A;  4LK1 C;  5M5X B;  4A3J B;  1XWE A;  3R3O A;  1PH9 A;  3SK6 A;  1QNU A;  3T53 B;  1Q7Y C;  2EJG C;  1AH9 A;  4BBS B;  3M4P A;  4FYD A;  1B8A A;  1VQ5 A;  3G6E A;  2IPK D;  5FJ8 H;  4IPH A;  3E6Z X;  1BCP C;  4TKO B;  3HOU G;  5LMN Q;  3C1E A;  1U4P A;  1Z7T A;  2DNE A;  3BZK A;  2KQ3 A;  5GRO A;  3C1F A;  1JB3 A;  2V1C C;  2XIW A;  4OHJ A;  2O2L D;  4EX5 A;  3G71 A;  5ELB A;  2E5L L;  3ICE A;  3NHH A;  4A3D G;  1BQQ T;  4DV3 L;  1Q1B A;  1I6V C;  1YIJ A;  2KHJ A;  4DPG A;  3I2Z A;  5D14 A;  2B2U A;  2E76 C;  2KCT A;  4A3M G;  1CI3 M;  4HIO A;  2G9D A;  4NW2 A;  1UEB A;  4O2D A;  1AE3 A;  1AE2 A;  1GUN A;  3D6W A;  1GXD C;  1JIC A;  3VA7 A;  4JG2 A;  5JEA J;  1X3Q A;  4BA2 I;  2PI2 A;  4CHT B;  2RBM A;  1VQO A;  3NUC A;  2DY7 A;  1YNJ D;  5EPL A;  4X62 Q;  4FDB A;  1QIL A;  1HZB A;  1UEA B;  3SK4 A;  1SFO H;  1SAP A;  1TVX A;  2D0P A;  2F0E A;  4KY7 A;  4K5X A;  4IUP A;  2DN8 A;  3VR6 A;  4RWS C;  2A68 D;  2DGY A;  1AFP A;  5M5Y H;  1OXT A;  1PTO D;  2K32 A;  4GNX A;  3KYH C;  3K81 C;  2H4O A;  1CSQ A;  1QB5 D;  2QDL A;  4OWX B;  3I4N G;  2K5W A;  5FKA C;  2F1M A;  4M1U B;  1HNZ Q;  3S1M H;  3K5M A;  2ZM6 L;  4ZAI A;  1H9M A;  1PRT B;  5C4X B;  1SE4 A;  1SNO A;  1DM0 B;  2CQO A;  1WTV A;  4A3J G;  1LAC A;  2YYZ A;  2CWA A;  4DV1 Q;  1I4X A;  3S1N B;  4LF5 Q;  1F2Z A;  1EY6 A;  3PO2 G;  1EWI A;  2L55 A;  2F0J A;  4HR7 B;  4BBS G;  3X3N A;  4O1N A;  1GUO A;  4K2K A;  3VDY A;  2E75 C;  2EYM A;  3AFQ A;  5IT9 c;  4ZKB B;  1K28 A;  4LJZ C;  1U0L A;  3I8Z A;  4RA8 A;  4NP5 A;  2A19 A;  5FLM G;  1JOR A;  2JSO A;  2DNC A;  1VQN A;  4N9T A;  2UUA L;  4HMI A;  1YIT A;  1PFS A;  4OIJ A;  4TSS A;  5GAG C;  2A6E D;  1MSH A;  2WB1 B;  3E9H A;  2B2W A;  1WTQ A;  5BN3 A;  1JJC B;  1HR0 Q;  4IOC A;  1EEF D;  2Q2I A;  2KOL A;  2F0N A;  1IW7 D;  5C0X J;  2MO0 A;  4LF6 L;  2F0F A;  4ILW A;  4KTA A;  4ODG A;  4PMC A;  4IPG A;  1X6O A;  3AB9 A;  4DR3 Q;  3W3A A;  1YI2 A;  2K6A A;  2Z6K C;  3K58 A;  1M1K C;  4DR1 Q;  2RKS A;  1EZ6 A;  1D5M C;  1JOK A;  3MC0 B;  4P2C B;  3AEV A;  1BNZ A;  1EY9 A;  2K04 A;  5FOB B;  4G7Z C;  1AN8 A;  3MHB A;  1A3T A;  3LWU A;  1XMO L;  1SMX A;  1SLJ A;  3S16 B;  2L4N A;  2ZTE A;  4JI1 L;  3HG9 A;  5M3M H;  4HTH A;  1W6J A;  3F2B A;  1EQT A;  4P74 A;  3URY A;  4DV5 L;  4KHP Q;  2FHT A;  4GLA C;  4F88 A;  1VQ6 A;  5JEA H;  2L12 A;  3PF5 A;  3CC2 A;  1GHK A;  3CCJ A;  3CP0 A;  1N32 Q;  1ENC A;  1PH7 A;  3IRB A;  4C2M B;  4HID A;  5C4X G;  4CDD C;  4BBR H;  4B3R Q;  3S2H H;  4DV0 Q;  4A3I B;  1X56 A;  3NE5 B;  1NAP A;  1JWS D;  4GKK L;  1Y8P B;  2UUB Q;  2ZXO A;  5EQ0 A;  4F87 A;  3QB3 A;  4DUY Q;  1GO3 E;  1PH3 A;  3A7A B;  1LTS D;  5DEH A;  1C48 A;  3BVZ A;  5IGB A;  1MBY A;  3U50 C;  2QDB A;  5ISR A;  1I5F A;  4FO2 A;  2QIL A;  4R8N A;  2E74 C;  3MZ5 A;  2R3Z A;  1FGU A;  4EQO A;  4KY5 A;  3CCM A;  1HQM C;  1CT1 D;  4UPA A;  5COY A;  1QVG A;  3TP7 A;  3RZO B;  3PGZ A;  5HUR A;  1E0B A;  5D3D A;  4OXP A;  5L37 A;  4A3G H;  1XNQ L;  2N8N A;  3TP8 A;  1VQD A;  3OPO A;  4RHS A;  2NZH A;  1WTO A;  5HY6 A;  4BXX G;  2C9O A;  1B4O A;  5C0X I;  4R8I A;  1VCI A;  4XXE A;  3TDQ A;  1S40 A;  3S15 B;  2GVA A;  3FPP A;  5LMN W;  1Y1W G;  5IP9 H;  4L5T A;  2AUJ D;  3QOL A;  2B2T C;  2JQO A;  4MHE A;  2I07 B;  3UI2 A;  5IIF A;  5JJZ A;  2AUK A;  1B50 A;  1ZYR C;  4KKU A;  5M3F H;  4K8J A;  4BY7 B;  1S5B D;  2FIN B;  1EOV A;  1XXG A;  4X64 L;  4K6D A;  1ASZ A;  2Q8T A;  2MPM A;  4H02 A;  3UE1 A;  3KLR A;  3K59 A;  1ASY A;  4L8J A;  1SRO A;  1VQ4 A;  1VQE A;  2Z4H A;  3J80 E;  1KRS A;  4RMF A;  5IGE A;  2B29 A;  1VDZ A;  3NEL A;  2WB1 E;  5KNC A;  3NEN A;  1SYF A;  1S5C D;  2F03 A;  4PV1 C;  1Q46 A;  5EPK A;  4LFB Q;  3G48 A;  3HKS A;  1ILP A;  1OTC A;  2JA7 B;  4Q0F A;  1V1O A;  3RLO A;  2ZTD A;  4K5V A;  4DR5 L;  5C0X H;  1BCP F;  2X6L A;  2PCF B;  2IW3 A;  3TSS A;  1V1Q A;  1PH2 A;  1JMC A;  5AJ3 Q;  1QUQ B;  3S1R H;  1VQM A;  1K73 C;  1TR5 A;  1EIG A;  3PUX A;  4KKT A;  5E4W C;  1FJG L;  3GTQ H;  3HOW G;  1HUN A;  4JI0 Q;  5I9P A;  3M4O H;  2JA6 B;  2XNA C;  3ULL A;  3RD4 A;  2O5I C;  4WFN 3;  4FXD A;  4ZUI A;  3AYH B;  2C35 B;  2SEB D;  2RSN A;  4A3B G;  1KDC A;  3TBI B;  2OTL A;  1N34 L;  3D6C A;  2A5H A;  2Y0S B;  1TS4 A;  3SHL A;  3HKZ B;  1SRU A;  4R4C A;  4A3I G;  1SMY D;  1WTH A;  2F0V A;  4CJ2 C;  3GTK B;  1YNX A;  3Q24 A;  4JI7 L;  4UAI A;  1CSP A;  1IL2 A;  1VQH A;  2VQE L;  3QJY A;  4ZUJ A;  3NEM A;  4B3S Q;  2K50 A;  4IN3 A;  3A56 A;  3MEH A;  1YJ9 A;  3CCQ A;  4NB3 A;  1JOO A;  4RAU C;  5TSS A;  2RHS B;  5KGU A;  2E2J H;  2K01 A;  3P75 A;  4DR2 L;  2EZV A;  1BBU A;  1UAP A;  2R92 H;  2F3V A;  1VQG A;  4JI4 Q;  4PG3 A;  1EOT A;  2NWG A;  1W3S A;  1KAB A;  1WYD A;  3ND9 A;  4KHV A;  2LXJ A;  4Q5V A;  1HZ9 A;  2IT1 A;  4CKC A;  3D8G A;  4G57 A;  1EL0 A;  3WDN A;  3PUW A;  1F9S A;  1N8R C;  1GKH A;  4NXN L;  3GTP B;  1H9R A;  4BY7 G;  1YNN C;  5J1Z A;  1I94 L;  1I6H H;  1PTO B;  4TRD A;  1STN A;  5IWA L;  4LF4 L;  1PRT D;  2UUC Q;  1HR0 W;  4DV2 L;  1GVP A;  2J7Z A;  2VW9 A;  4LF7 L;  5IYD H;  2JEB I;  2G9H D;  3D31 A;  1L1O B;  2R93 G;  3CMA A;  3HOZ H;  4CGY B;  3K5O A;  2JA7 G;  5M5W H;  3KF6 B;  5C3X A;  3TRZ A;  1EQR A;  4P75 A;  3WWV A;  3L3O C;  1SNC A;  5K36 H;  1A15 A;  1HFG A;  4Y52 H;  1KDA A;  3R93 A;  3NK9 A;  1NE3 A;  3A5U A;  2JA6 G;  5E7N A;  1NMF A;  1U4M A;  3EQL C;  2O5J C;  3KF8 B;  2Z6B A;  2ZT9 C;  2E5L Q;  2EYO A;  3TN2 A;  4DV3 Q;  1SYD A;  4GKJ L;  3PMF A;  4A3E H;  3I4M H;  3JAM c;  2HQE A;  2ZJP A;  1IL8 A;  3I55 A;  1BCP B;  2B2V A;  1NR2 A;  3SDZ A;  1KIX A;  4OO1 I;  3FKI H;  4LUO A;  2UU9 L;  1H9S A;  3J81 i;  1PLF A;  1A63 A;  5I6W A;  4QF4 A;  3K0X A;  3GTG H;  1IBL L;  3T16 A;  3TP5 A;  5G3L F;  1D8L A;  2PO4 A;  4A3C H;  1TT2 A;  2B8F A;  1RKN A;  3AQQ A;  1D6E C;  2EIF A;  1Q82 C;  2K75 A;  2Q2U A;  3MA2 B;  2PW7 A;  2Y0S E;  4RGN A;  3T4A C;  5D3I B;  1CUK A;  3HKZ E;  2P5Z X;  2PW5 A;  2ICI A;  3OSO A;  2JE6 I;  1ML0 D;  2HCI A;  4HJA A;  2VUM H;  4KV6 A;  1Y8O B;  1A2T A;  2IY5 B;  4PQX A;  2CCZ A;  2VY3 A;  5M5Y B;  1EY5 A;  2OQK A;  5JVG 3;  3DWQ A;  1W2B A;  4GN4 B;  2CW0 C;  1ZKO A;  1QJO A;  4HED A;  2F0L A;  4KN4 C;  4JBM A;  1TXY A;  4DNT B;  4OO1 H;  1N36 L;  2R7D A;  3BS1 A;  3RLF A;  5DLQ E;  3S1M B;  1HZA A;  2ZM6 Q;  2LY7 A;  2A73 B;  1E2W A;  3RUZ A;  3F2D A;  4MZ9 A;  1QZH A;  4IFD I;  3RLN A;  4HIM A;  2EXZ A;  1J9O A;  1VS0 A;  2B2Y C;  3SGI A;  1J5E L;  2X6G A;  4HCS A;  4RH6 A;  3P7J A;  1XNR L;  1BBX C;  1GUS A;  1PYW D;  1LTI D;  2F0Q A;  3K8A A;  1T5E A;  5FJ8 G;  4KKS A;  3ULJ A;  3L0O A;  1L0W A;  3STB C;  5I9O A;  3A8J E;  4ZQ3 A;  5J3B A;  1X9N A;  3SK5 A;  4XT1 B;  4CBV A;  1BXT A;  4DV6 L;  4C3I H;  5GQO A;  2UUA Q;  2KHS A;  1G51 A;  2EQS A;  2FXQ A;  2L15 A;  3I7F A;  1HNW Q;  4BA1 I;  3GTL B;  3RZD B;  4KJN A;  5DAU A;  5C5L A;  1QUQ A;  3U4Z A;  5JJL A;  4JI5 L;  1HNX Q;  2ZTC A;  4IFD H;  1XMQ L;  2HUG A;  4B08 A;  4LNQ A;  3PCO B;  2ATW A;  3BU2 A;  4GN3 B;  3E0J A;  3KDF B;  4LF6 Q;  1YHQ A;  2A8V A;  1P8L A;  1I50 B;  3OIQ A;  5JVH 3;  3M7G A;  3Q6S A;  3M7N A;  4C3H H;  2D5D A;  1SBB B;  2IHF A;  1IZ6 A;  1Y1V B;  1WCM H;  2PMZ B;  4FNF A;  4AH6 A;  2K05 A;  4X65 Q;  2JA5 G;  1XTC D;  5CYU A;  1LTG D;  1EY7 A;  4NPS A;  2JN4 A;  1U9R A;  4DAP A;  3FHW A;  1X54 A;  5LL6 S;  1X3P A;  2MFI A;  4L5R C;  2B2U C;  4A3L G;  2K7V A;  2JA8 G;  4AIM A;  1MI2 A;  1D2B A;  2RCN A;  1J8I A;  4JBW A;  5M3M B;  2EYH A;  4JI1 Q;  2WAC A;  4RCO A;  3H0G H;  2OT2 A;  2ZJR A;  1VQ8 A;  1ICW A;  4ZRZ A;  5C44 H;  3MEF A;  1YBY A;  5GAE C;  2NYZ D;  1YJN A;  1VQA A;  4XYQ A;  2Z9H A;  3RR5 A;  4FF3 A;  2NVX B;  2EOT A;  1I4H A;  5C4J B;  2K5D A;  1BDO A;  3JC6 6;  3VYR A;  1GOZ A;  5JPM C;  2A69 D;  1HZC A;  1P16 A;  3GO5 A;  3HFZ B;  2F3W A;  2F0S A;  4TQU S;  1SEB D;  2CKZ B;  1PH1 A;  3Q23 A;  5ELF A;  1V8Q A;  5IYB H;  3GTJ H;  1NMG A;  4GNX C;  5M9O A;  1EIY B;  3I72 A;  2IWH A;  3S1Q H;  1DXM A;  3TS2 A;  1LUZ A;  2BE5 D;  1VF7 A;  3VA5 A;  4UP9 A;  3SE0 A;  3H3V I;  3LX0 A;  2NTT A;  1QWY A;  4A3G B;  1E1O A;  3M3Y B;  3W2D A;  3IKJ A;  1T9H A;  1VQI A;  3I4L A;  2YV5 A;  2HDL A;  3KF6 A;  1Q81 C;  3KLS X;  4XT3 B;  2EYJ A;  2NN6 G;  1PZJ D;  3J80 i;  4J6H A;  3TZU A;  1RJT A;  4QQB X;  2TSS A;  4OEM B;  1MHW C;  3NTI A;  3CME A;  1JOQ A;  3SEB A;  3H3V C;  1EIF A;  1RCV D;  2OTJ A;  3KF8 A;  5M3F B;  3J81 E;  2IX1 A;  1FR3 A;  3A8I E;  1PFM A;  5DM7 3;  4DR4 L;  4X64 Q;  1QNK A;  2EY2 A;  4G7O C;  4LF8 L;  4U68 A;  2A6H D;  1BR9 A;  2AQ1 B;  1EU4 A;  4IJL A;  1O80 A;  4A3F H;  3OMG A;  2F4V L;  1CA5 A;  2CH4 A;  1Y1V G;  5EKL A;  1HFN A;  3MFY A;  2NVY H;  1FNU A;  1MJE A;  4JI3 L;  3PO3 H;  4XDX A;  3H3V H;  1YZ6 A;  1Q3L A;  4ZCK A;  2B2W C;  1STA A;  1TWH H;  2YTY A;  1IBM L;  4J1M A;  2K4K A;  1HCZ A;  4DUZ L;  3QO2 A;  4JW0 A;  4KMU C;  1STB A;  4DR5 Q;  1JB7 A;  1EEI D;  1G8Z D;  3EFX D;  1ZEQ X;  1FJG Q;  3M4O B;  4U67 3;  1D1K A;  2QEX A;  4JVZ A;  3A54 A;  3HOU H;  1TWG B;  1OXV A;  3I4O A;  2PMZ E;  5EKI A;  1WTR A;  2RHQ B;  2KBN A;  4B3M L;  5EKK A;  1HHV A;  1SNP A;  1LO5 D;  4DAV A;  1N34 Q;  5DNF A;  1S3O A;  1NNX A;  4L5Q A;  5ELO A;  1BCP D;  1FNV A;  1M8A A;  1Q12 A;  4A3D H;  3I91 A;  2E2D C;  3T13 A;  4AYB E;  4EQ5 A;  2F4I A;  4NXM L;  2HHH L;  2RDF A;  3CCL A;  1S72 A;  2VQE Q;  1GUG A;  2MJ8 A;  1EIH A;  4A3M H;  4Z9C B;  4GOP B;  2YTV A;  5JJI A;  3K80 C;  4HJ9 A;  1B44 D;  2XTI A;  4CKB A;  2DUD A;  3W1G A;  4XQQ A;  5CMD A;  1YVC A;  2HQL A;  1WI5 A;  1LT6 D;  1I3Q H;  5E4X A;  4M8A A;  3NWT A;  4DR2 Q;  5C3E B;  1Z9F A;  5IGG A;  2R92 B;  1K8O A;  3DEO A;  2J0T D;  3ND8 A;  3M4Q A;  4K0K L;  4A93 H;  4F8M A;  1SYB A;  2B39 A;  4FF2 A;  1E2Z A;  2PQA B;  1G91 A;  4O42 A;  4JI8 L;  3K57 A;  1CKN B;  2N88 A;  2KEE A;  4PZ7 A;  3I70 A;  4JV5 L;  5GAD C;  3DHQ A;  4H7B A;  4NXN Q;  1SYC A;  3O13 A;  1TWA B;  3TP6 A;  4RCN A;  1X3E A;  2BA0 A;  1I6H B;  1I94 Q;  2IL8 A;  3S14 H;  4LF4 Q;  5IWA Q;  1PH4 A;  3J80 L;  2N49 A;  3K6O A;  4MIU A;  1VQ7 A;  3KDF A;  4WOR A;  4LF7 Q;  1IBK L;  1B1Z A;  1NTG A;  1ONL A;  3VYT A;  5T1G A;  5I2X A;  2IX3 A;  1CKM A;  2E2I B;  4EQN A;  4A3J H;  1LLR D;  4LFA L;  3HOY B;  1RTN A;  2WIN B;  2ALY B;  1H9K A;  1JWM D;  4K14 A;  2PZU A;  4HIK A;  3B6Y A;  4JBJ A;  3PO2 H;  4I7A A;  5M5W B;  1NR4 A;  4BBS H;  2R7Z H;  1LTR D;  3HOX B;  1QE6 A;  5CC4 A;  4A75 A;  1GUT A;  1TWF H;  4R1J A;  1BKB A;  4R4O A;  2L1B A;  1JWU D;  2KED A;  3IL8 A;  2WAQ B;  4C3J B;  5LMN L;  3CAM A;  5IYC G;  1STH A;  3GP7 A;  1SE8 A;  3BG3 A;  5FLM H;  3Q0A A;  2FJ2 A;  4PZ6 A;  2Z6K A;  4A3E B;  4X3S A;  3EVQ A;  1LT3 D;  2RCF A;  4GKJ Q;  4RKL A;  4EGV A;  4N8F A;  1QZG A;  4EVO A;  4DK1 A;  2F0P A;  4I65 A;  2WB1 G;  2UU9 Q;  4L63 B;  2XWJ B;  1IYU A;  3CQZ B;  4Y7N H;  3UDI A;  2FFK B;  3D4R A;  3GTM B;  4DF7 A;  2ID0 A;  3V96 A;  1DGS A;  1E1T A;  1Q8I A;  1IBL Q;  1K8A C;  3D4W A;  3V2T A;  4OL7 A;  4BY1 H;  3I73 A; 
#chains in the Genus database with same CATH homology
 3R2T A;  4DU9 A;  2JXM B;  2XN9 C;  1TU2 B;  4WJW A;  1OO9 B;  1WTW A;  2LS0 1;  1ET6 A;  3QIA A;  1TS3 A;  5EPJ A;  2OEO A;  5KYI A;  2WKD A;  1FNW A;  1C4Q A;  3CKI B;  1KAA A;  5G3L D;  3CHB D;  5IT9 E;  3M4Y A;  1I4Q A;  5ELD A;  5LHY 1;  5E3F A;  4OGQ C;  1EU3 A;  5JPN C;  2SNS A;  1KNE A;  3KBG A;  4DA2 A;  4NMZ A;  3D4D A;  1WTX A;  1C8C A;  1VMP A;  5KNB A;  4IUU A;  2K1B A;  3I90 A;  2JEA I;  2XWB B;  3BYY B;  1EY8 A;  4ZK9 B;  2QF7 A;  1F9Q A;  2XVS A;  1V1P B;  2KJX A;  4ID6 A;  2ZXP A;  1U4R A;  1Z6H A;  3R2I A;  4C3J G;  1Y8N B;  4KD3 A;  1ESF A;  3PV0 A;  5NUC A;  4G4K A;  1KDB A;  2DY8 A;  1SND A;  4C3H B;  1EQV A;  4DNR B;  3FRP B;  1JCK B;  4RHR A;  1FGB D;  2EDG A;  1WCM B;  2NB0 A;  2Q8R E;  2A74 C;  4MN3 A;  1ZYR D;  3BVG A;  5JOB A;  1VMC A;  2D9U A;  3OWF A;  3L9A X;  5CV6 A;  3G6J B;  5I4D A;  3L7Z C;  1F77 A;  3AU7 A;  3MTS A;  4IFD J;  2OXP A;  3H0G B;  3DMU A;  1CTM A;  2H1E A;  5K5P A;  5KRU A;  5COR A;  2F0I A;  2Z1C A;  5I2Y A;  1B2T A;  1I4P A;  1NCV A;  1CHP D;  1DJR D;  2JP1 A;  3GTJ B;  2RQX A;  3S1Q B;  2EVB A;  1IYV A;  4K8I A;  3A55 A;  2L0C A;  4C1N K;  3IFD A;  2AWN A;  5CV4 A;  1OXX K;  4QB4 A;  5EJW A;  1CK1 A;  2PZT A;  5KIX A;  2HCC A;  2KVM A;  1AEX A;  2Q8I B;  3S9W A;  1SFO B;  1HXY D;  1IKL A;  1Z47 A;  3KLS A;  4XQJ A;  2HDM A;  2ICE C;  5CBA E;  4CJ0 B;  2F0W A;  4L6T B;  1PXU A;  4C3H G;  4A3F B;  1DON A;  1LT4 D;  1STY A;  4H0L C;  2NVY B;  3J7Y W;  3PO3 B;  3MXP A;  4ME5 A;  2C5C A;  3DWA A;  3KBX A;  1G2S A;  1JR0 D;  2EY1 A;  1YNN D;  5EBD A;  3QOJ A;  1FYC A;  2XRS D;  4WRD A;  4FF1 A;  2LMC B;  1RF2 D;  4GZY C;  2PZW A;  4XYO A;  2L5T A;  1B9N A;  2IX0 A;  2RA4 A;  4DGZ A;  4ULL A;  1O7L A;  2CQA A;  4K6L A;  5EBC A;  1F2M A;  2EYP A;  1MGS A;  2MHV A;  4X3T A;  4F7X A;  1R4Q B;  3LNN A;  4R9W A;  4HCE A;  1DZ1 A;  2ENB A;  1F9P A;  1YNJ C;  2Z4I A;  3D3R A;  4H44 C;  3FMC A;  1I3Q B;  4DXG A;  1S5E D;  1RTO A;  3AMU A;  3SVM A;  4H13 C;  2KCN A;  2A68 C;  4A93 B;  1V1P A;  4HAE A;  3VYU A;  1PZI D;  1RHP A;  1T5X D;  1PTO C;  3NBI A;  2EYF A;  1XYI A;  3J81 L;  2O4X A;  4G7H C;  4AYB B;  1RD9 D;  3ONA B;  1W6K A;  1KNA A;  3IFT A;  3KK7 A;  2PNR C;  2L9H A;  3S14 B;  5KYL A;  2QEJ C;  5EGT A;  2AQ3 B;  1PTO H;  3JAM E;  2BA1 A;  4KI0 A;  1VF5 C;  2CW0 D;  3ERO A;  1SSO A;  4BBR B;  3S2H B;  3PO2 B;  1PFB A;  1KLU D;  2R7Z B;  1SNQ A;  3OWE B;  3VR5 A;  2FMC A;  1H9J A;  3EA6 A;  1TWF B;  3BDC A;  3VR2 A;  1F2Y A;  5DM6 3;  4OIK A;  5CR3 A;  2A6E C;  3G7L A;  1EY4 A;  1NSN S;  3T51 B;  2F0T A;  2EPB A;  1IW7 C;  4E6I A;  4HN7 A;  1OXU A;  4HSV A;  1SE3 A;  2BCO A;  3OOC A;  3C3L A;  1G6Z A;  4Y7N B;  1GJX A;  3PUV A;  2ZXR A;  3VR3 A;  1DOM A;  3I3C A;  3NP8 A;  1TY0 A;  5FK9 C;  4ZYS A;  3H91 A;  1Q90 A;  1TS5 A;  5D65 A;  3HP3 A;  5CV9 A;  2NUC A;  4BY1 B;  3PUY A;  4DK0 A;  2BOS A;  4IZ8 A;  4BWG B;  3CRL C;  5ELC A;  3NQT A;  2KA7 A;  1HQR D;  1Q1E A;  4KN7 C;  3OIP A;  4V0B A;  2RDH A;  1M4V A;  1KTK A;  1K83 B;  1TS2 A;  1B3A A;  1EZ8 A;  1A2U A;  2JYO A;  4FVM A;  5E1F A;  2VNU D;  2QKI C;  2R61 A;  3S1R B;  5I6Y A;  3GTQ B;  2R6G A;  2NN6 I;  3ZYY X;  3GV3 A;  1HTL D;  5JEA G;  2EE1 A;  1R4P B;  1QG7 A;  2F0G A;  2N55 A;  1PDQ A;  5C3W A;  1STG A;  1SXT A;  5FO9 B;  1S5F D;  4X3U A;  3WOE A;  1DCZ A;  3NXW A;  5F2D A;  3MFG A;  2VB3 X;  2WP8 J;  1PZK D;  2VXW A;  1X32 A;  3NQI A;  3P20 A;  4DAY A;  1BF4 A;  2PPB C;  2M2L A;  2E2J B;  2KUM A;  1TQO A;  4RGM A;  5HGT A;  2EYL A;  3HOV B;  2NN6 H;  4NKL A;  1Y1W B;  3PUZ A;  3FEW X;  1A3V A;  3TZD A;  3OHX C;  5C4Z A;  4A3K B;  1SYG A;  2KCC A;  3OMC A;  3K5N A;  1BO0 A;  3P1H A;  1ILQ A;  2SOB A;  5T1I A;  3E5S A;  3FDT A;  2L11 A;  2WII B;  1QCB D;  5C5M A;  5IT9 L;  3HOZ B;  1G2T A;  3C46 A;  2F0U A;  2X69 A;  5C0X G;  3HOW B;  4V19 0;  1O78 A;  2XSC A;  3M85 A;  1H9S B;  2D2C C;  1SMY C;  2WKC A;  3DEP A;  4A3B B;  4PMB A;  4DFA A;  1FD7 D;  4RGO S;  2WV6 D;  1EWC A;  3VR4 A;  1DD2 A;  4IQZ A;  3I4M B;  1II3 A;  4QUF A;  1TKW B;  2NVQ B;  2B63 B;  3FKI B;  3DUZ A;  4KJO A;  3U9O A;  1LAB A;  4PMW A;  3GTG B;  1B53 A;  1HTP A;  1MSG A;  2F0O A;  2YU9 B;  3MWY W;  1A3U A;  1PTO F;  1SYE A;  1NUC A;  3MVV A;  5IOC A;  4ZKC B;  1E2V A;  5CV5 A;  5BN5 A;  3A7L A;  4N9P A;  1LTA D;  4I7Z C;  1UNS A;  4HMJ A;  5C4H A;  2VUM B;  1D1I A;  3MXU A;  3SK8 A;  1DYQ A;  1CFM A;  4CJ1 B;  1PRT C;  4BS9 A;  1QOH A;  2TMP A;  4XQN A;  1KLG D;  1S4Z A;  3RMH A;  5KEE A;  1PMR A;  1SJH D;  4LMQ D;  1UUP A;  4FP5 D;  4KY6 A;  1JE4 A;  1WVL A;  1F9R A;  2M9V A;  4ABN A;  4IUT A;  1HRJ A;  1I4G A;  3OW7 A;  5LL6 X;  2R93 B;  4K5W A;  4QIW B;  2J4X A;  1WTP A;  4B9W A;  1CHQ D;  2K03 A;  1D5X C;  2NBF A;  1IHZ A;  1DOL A;  3SXH A;  2B2T A;  2M00 A;  5CV7 A;  3NPP A;  1U4L A;  4DN4 M;  5K36 G;  3S2D B;  2MGS A;  4YIJ A;  2F0D A;  3NSW A;  4C3I B;  5J39 A;  4B9X A;  1SDF A;  1GUW A;  1CZW A;  1LTT D;  5IOD A;  1CQF A;  1ZXT A;  3SR1 A;  1ENF A;  5A2Q L;  1IKM A;  1L0X B;  3N52 A;  4RKB A;  3IAY A;  2KEC A;  1ESR A;  3H94 A;  5J22 A;  3BVM A;  2IJ0 A;  1HA5 A;  4QMG A;  3K0Y A;  1EYA A;  2I46 A;  3TME A;  1XX8 A;  5KND A;  4UDU C;  2PQE A;  3EJI A;  1WD1 A;  1SE2 A;  2Z8L A;  1CM9 A;  2D62 A;  3DM1 A;  3CRK C;  2B2V C;  5CGK A;  2K5Q A;  3MXN A;  2EJF C;  1PFN A;  3HEJ A;  3A8K E;  1A6X A;  3V05 A;  1EFI D;  1HA6 A;  1Y69 U;  2AWO A;  2AQ2 B;  5C44 B;  4OO1 G;  1EY0 A;  3ERQ A;  1SNM A;  4QUC A;  1EYD A;  1EWH A;  2RVL A;  4K2L A;  3S17 B;  3Q22 A;  3HGB A;  2BDO A;  3HRZ C;  5AFW A;  2RSO A;  3NBH A;  2MP1 A;  4KK7 A;  3QWN A;  4IUV A;  5ELE A;  3NTK A;  4ZLT F;  4G7O C;  1GHJ A;  4RGT A;  2EY5 A;  1LT5 D;  1JC7 A;  1K8M A;  3J7A V;  3FVQ A;  5A2Q E;  3NWS A;  2NTS A;  5BN4 A;  1BUV T;  1JQY D;  1F2L A;  5JAV A;  3VYS A;  3GQB A;  3N6R A;  4IAL A;  3BDO A;  3QG1 A;  2F0K A;  4C3I G;  4PNY A;  2XRQ D;  3FPU B;  4X3K A;  4NDX A;  3GTO B;  3MXG A;  4IFD G;  4XIG S;  1DOK A;  1ET9 A;  3KUP A;  3K5L A;  2CVR A;  1ROD A;  2EY6 A;  3MAQ A;  3DWP A;  4KD4 A;  4EQP A;  4FXG C;  3GD7 A;  1OXS C;  2B8G A;  1RDP D;  3X3M A;  4FXK C;  1WD0 A;  2JA5 B;  1MD2 D;  2PYK A;  4HSP A;  3BYT B;  3BZD B;  3C2P A;  4IUQ A;  2VB2 X;  2MUY A;  3U9S A;  3NTH A;  2JA8 B;  3T56 B;  5IGF A;  1TY2 A;  3GV6 A;  4CKE A;  1CZG A;  1TWH B;  2K33 A;  4IUN A;  2RDG A;  1AZQ A;  3ITP A;  5FLX L;  4C1N I;  4QCL A;  2SNM A;  1V43 A;  2GA4 B;  4DXF A;  2E2H B;  5CBE E;  1EYC A;  2OF1 A;  1O7Z A;  2A69 C;  2QCP X;  4IUR A;  3JAM L;  3HOU B;  4KHZ A;  1R9T B;  3CU7 A;  2V4D A;  1SJE D;  1HUM A;  2BDN A;  3LWE A;  1S5D D;  2F0M A;  5FO8 B;  5A35 A;  1D5Z C;  1CQV A;  2BE5 C;  4A3D B;  3DXJ C;  4J8Q A;  1L0Y B;  3BDL A;  4C56 C;  3K7A B;  4RFB A;  1O7Y A;  1AW7 A;  1LV9 A;  4XTC S;  4A3M B;  1G29 1;  2NVT B;  1B9M A;  1HPC A;  1I4R A;  5IGC A;  4JK1 C;  2F0H A;  3HS0 C;  2EJM A;  1AZP A;  3J7A F;  3R8B A;  3H6M A;  1TWC B;  2K28 A;  5CV8 A;  5IGD A;  1AP0 A;  3PIO 3;  2NZ1 D;  2A6H C;  2B2Y A;  1PRT F;  1STE A;  5FO7 B;  2SDF A;  3WOF A;  2LKV A;  3F2U A;  4S3S A;  3PIP 3;  1LTB D;  5FLX E;  2CHB D;  5C6A A;  3HZX A;  3I4N B;  1ENA A;  2FMM A;  2LFN A;  1BOS A;  3H09 A;  1TII D;  1CA6 A;  4LAA A;  4LK1 C;  5M5X B;  4A3J B;  1XWE A;  3R3O A;  3SK6 A;  1QNU A;  3T53 B;  2EJG C;  4BBS B;  4FYD A;  2IPK D;  3E6Z X;  1BCP C;  4TKO B;  3C1E A;  1U4P A;  1Z7T A;  2DNE A;  2KQ3 A;  3C1F A;  1JB3 A;  2XIW A;  4OHJ A;  2O2L D;  5ELB A;  3NHH A;  1BQQ T;  1Q1B A;  1I6V C;  5D14 A;  2B2U A;  2E76 C;  1CI3 M;  2G9D A;  4NW2 A;  1GUN A;  3D6W A;  1GXD C;  1JIC A;  3VA7 A;  5JEA J;  1X3Q A;  4BA2 I;  4CHT B;  2RBM A;  3NUC A;  2DY7 A;  1YNJ D;  5EPL A;  1QIL A;  1UEA B;  3SK4 A;  1SAP A;  1TVX A;  2F0E A;  4KY7 A;  4K5X A;  4IUP A;  2DN8 A;  3VR6 A;  4RWS C;  2A68 D;  1AFP A;  1OXT A;  1PTO D;  2K32 A;  2H4O A;  1QB5 D;  2K5W A;  5FKA C;  2F1M A;  4M1U B;  3K5M A;  4ZAI A;  1H9M A;  1PRT B;  5C4X B;  1SE4 A;  1SNO A;  1DM0 B;  1WTV A;  1LAC A;  2YYZ A;  1I4X A;  3S1N B;  1F2Z A;  1EY6 A;  2L55 A;  2F0J A;  4HR7 B;  3X3N A;  4O1N A;  1GUO A;  4K2K A;  2E75 C;  2EYM A;  4ZKB B;  4LJZ C;  3I8Z A;  4RA8 A;  4NP5 A;  1JOR A;  2JSO A;  2DNC A;  4N9T A;  4HMI A;  4OIJ A;  4TSS A;  2A6E D;  1MSH A;  2WB1 B;  2B2W A;  1WTQ A;  5BN3 A;  1EEF D;  2KOL A;  2F0N A;  1IW7 D;  5C0X J;  2F0F A;  4ILW A;  4KTA A;  4ODG A;  4PMC A;  3AB9 A;  3W3A A;  2K6A A;  3K58 A;  2RKS A;  1EZ6 A;  1D5M C;  1JOK A;  3MC0 B;  4P2C B;  1BNZ A;  1EY9 A;  2K04 A;  5FOB B;  4G7Z C;  1AN8 A;  3MHB A;  1A3T A;  3LWU A;  3S16 B;  2L4N A;  3HG9 A;  4HTH A;  1W6J A;  1EQT A;  3URY A;  2FHT A;  4F88 A;  5JEA H;  2L12 A;  1GHK A;  1ENC A;  4C2M B;  4A3I B;  3NE5 B;  1NAP A;  1JWS D;  1Y8P B;  2ZXO A;  5EQ0 A;  4F87 A;  3QB3 A;  3A7A B;  5DEH A;  1LTS D;  1C48 A;  3BVZ A;  5IGB A;  1MBY A;  2QDB A;  5ISR A;  4FO2 A;  2QIL A;  4R8N A;  2E74 C;  3MZ5 A;  2R3Z A;  4EQO A;  4KY5 A;  1HQM C;  1CT1 D;  5COY A;  3TP7 A;  3RZO B;  5HUR A;  1E0B A;  5D3D A;  3TP8 A;  3OPO A;  4RHS A;  1WTO A;  2C9O A;  1B4O A;  5C0X I;  4R8I A;  1VCI A;  4XXE A;  3TDQ A;  3S15 B;  3FPP A;  2AUJ D;  3QOL A;  2B2T C;  5IIF A;  4MHE A;  5JJZ A;  2I07 B;  3UI2 A;  2AUK A;  1B50 A;  1ZYR C;  4KKU A;  4K8J A;  4BY7 B;  1S5B D;  2FIN B;  1XXG A;  4K6D A;  2Q8T A;  2MPM A;  3KLR A;  3K59 A;  4L8J A;  2Z4H A;  3J80 E;  5IGE A;  1VDZ A;  2F03 A;  5KNC A;  1SYF A;  1S5C D;  4PV1 C;  5EPK A;  1ILP A;  2JA7 B;  4Q0F A;  1V1O A;  4K5V A;  5C0X H;  1BCP F;  2X6L A;  2PCF B;  2IW3 A;  3TSS A;  1TR5 A;  1EIG A;  3PUX A;  4KKT A;  5E4W C;  1HUN A;  5I9P A;  2JA6 B;  2XNA C;  3RD4 A;  2O5I C;  4WFN 3;  4FXD A;  4ZUI A;  2SEB D;  2RSN A;  1KDC A;  3TBI B;  3D6C A;  2A5H A;  2Y0S B;  1TS4 A;  3SHL A;  3HKZ B;  1SMY D;  2F0V A;  4CJ2 C;  3GTK B;  3Q24 A;  4UAI A;  3QJY A;  4ZUJ A;  4IN3 A;  3A56 A;  3MEH A;  1JOO A;  4RAU C;  5TSS A;  5KGU A;  2K01 A;  3P75 A;  2EZV A;  1UAP A;  2F3V A;  1EOT A;  2NWG A;  1KAB A;  3ND9 A;  4KHV A;  4Q5V A;  2IT1 A;  4CKC A;  3D8G A;  4G57 A;  1EL0 A;  3WDN A;  3PUW A;  1F9S A;  3GTP B;  1H9R A;  1YNN C;  5J1Z A;  1PTO B;  4TRD A;  1STN A;  1PRT D;  2J7Z A;  2JEB I;  2G9H D;  3D31 A;  4CGY B;  3K5O A;  5C3X A;  3L3O C;  1SNC A;  5K36 H;  1A15 A;  1HFG A;  1KDA A;  3R93 A;  3NK9 A;  1U4M A;  3EQL C;  2O5J C;  2ZT9 C;  2EYO A;  3TN2 A;  1SYD A;  3PMF A;  2HQE A;  1IL8 A;  1BCP B;  2B2V A;  1NR2 A;  3SDZ A;  4OO1 I;  1H9S A;  1PLF A;  5I6W A;  4QF4 A;  3T16 A;  3TP5 A;  5G3L F;  2PO4 A;  1TT2 A;  2B8F A;  1RKN A;  1D6E C;  3MA2 B;  2PW7 A;  4RGN A;  3T4A C;  5D3I B;  2PW5 A;  2ICI A;  3OSO A;  2JE6 I;  1ML0 D;  2HCI A;  4KV6 A;  1Y8O B;  1A2T A;  4PQX A;  5M5Y B;  1EY5 A;  5JVG 3;  3DWQ A;  2CW0 C;  1ZKO A;  1QJO A;  4HED A;  2F0L A;  4KN4 C;  4OO1 H;  4DNT B;  3BS1 A;  3RLF A;  3S1M B;  2LY7 A;  2A73 B;  1E2W A;  3RUZ A;  4IFD I;  2EXZ A;  1J9O A;  2B2Y C;  2X6G A;  4HCS A;  4RH6 A;  3P7J A;  1BBX C;  1PYW D;  1GUS A;  1LTI D;  2F0Q A;  1T5E A;  4KKS A;  5I9O A;  3A8J E;  4ZQ3 A;  3SK5 A;  4XT1 B;  4CBV A;  1BXT A;  2KHS A;  4BA1 I;  3GTL B;  3RZD B;  4KJN A;  5DAU A;  5C5L A;  4IFD H;  2HUG A;  4B08 A;  3E0J A;  1I50 B;  3OIQ A;  5JVH 3;  3M7G A;  3Q6S A;  3M7N A;  2D5D A;  1SBB B;  1Y1V B;  2PMZ B;  4FNF A;  2K05 A;  1XTC D;  5CYU A;  1LTG D;  1EY7 A;  1U9R A;  4DAP A;  5LL6 S;  1X3P A;  2B2U C;  2K7V A;  1MI2 A;  1D2B A;  1J8I A;  4JBW A;  5M3M B;  2EYH A;  2WAC A;  4RCO A;  2OT2 A;  1ICW A;  4ZRZ A;  2NYZ D;  4XYQ A;  4FF3 A;  2NVX B;  2EOT A;  1I4H A;  5C4J B;  2K5D A;  1BDO A;  3VYR A;  1GOZ A;  5JPM C;  2A69 D;  3GO5 A;  2F3W A;  2F0S A;  4TQU S;  1SEB D;  3Q23 A;  5ELF A;  1V8Q A;  5M9O A;  3I72 A;  2IWH A;  1DXM A;  2BE5 D;  1VF7 A;  3VA5 A;  3SE0 A;  3LX0 A;  2NTT A;  1QWY A;  4A3G B;  3M3Y B;  3W2D A;  3IKJ A;  3I4L A;  2HDL A;  3KLS X;  4XT3 B;  2EYJ A;  2NN6 G;  1PZJ D;  4J6H A;  3TZU A;  1RJT A;  2TSS A;  3NTI A;  1JOQ A;  3SEB A;  3H3V C;  1RCV D;  3KF8 A;  5M3F B;  3J81 E;  2IX1 A;  1FR3 A;  3A8I E;  1PFM A;  5DM7 3;  1QNK A;  2EY2 A;  4U68 A;  2A6H D;  1BR9 A;  2AQ1 B;  1EU4 A;  1O80 A;  3OMG A;  1CA5 A;  5EKL A;  1HFN A;  3MFY A;  1FNU A;  4XDX A;  1Q3L A;  2B2W C;  1STA A;  4J1M A;  1HCZ A;  3QO2 A;  4KMU C;  1STB A;  1EEI D;  1G8Z D;  3EFX D;  1ZEQ X;  3M4O B;  4U67 3;  1D1K A;  3A54 A;  1TWG B;  1OXV A;  5EKI A;  1WTR A;  5EKK A;  1HHV A;  1SNP A;  1LO5 D;  4DAV A;  5DNF A;  1BCP D;  1FNV A;  1M8A A;  1Q12 A;  3I91 A;  2E2D C;  3T13 A;  2F4I A;  2RDF A;  1GUG A;  2MJ8 A;  1EIH A;  4Z9C B;  1B44 D;  4CKB A;  4XQQ A;  5CMD A;  1LT6 D;  5E4X A;  4M8A A;  3NWT A;  5C3E B;  5IGG A;  2R92 B;  1K8O A;  3DEO A;  2J0T D;  3ND8 A;  4F8M A;  1SYB A;  2B39 A;  4FF2 A;  1E2Z A;  1G91 A;  4O42 A;  3K57 A;  2N88 A;  2KEE A;  3I70 A;  3DHQ A;  4H7B A;  1SYC A;  3O13 A;  1TWA B;  3TP6 A;  4RCN A;  2BA0 A;  1I6H B;  2IL8 A;  3J80 L;  3K6O A;  4MIU A;  4WOR A;  1B1Z A;  1ONL A;  3VYT A;  5T1G A;  5I2X A;  2IX3 A;  2E2I B;  4EQN A;  3HOY B;  1LLR D;  1RTN A;  2WIN B;  1H9K A;  1JWM D;  4K14 A;  2PZU A;  5M5W B;  1NR4 A;  1LTR D;  3HOX B;  1QE6 A;  5CC4 A;  1GUT A;  2L1B A;  1JWU D;  2KED A;  3IL8 A;  2WAQ B;  4C3J B;  1STH A;  3GP7 A;  3BG3 A;  3Q0A A;  2FJ2 A;  4A3E B;  4X3S A;  3EVQ A;  1LT3 D;  4RKL A;  4EGV A;  4EVO A;  4DK1 A;  2F0P A;  4I65 A;  4L63 B;  2XWJ B;  1IYU A;  3CQZ B;  2FFK B;  3D4R A;  3GTM B;  4DF7 A;  2ID0 A;  3V96 A;  1Q8I A;  3D4W A;  3V2T A;  4OL7 A;  4FF4 A;  3I73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...