1QG7A

Stroma cell-derived factor-1alpha (sdf-1alpha)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
b'SYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMAL CELL-DERIVED FACTOR 1 ALPHA
publication title Crystal structure of recombinant native SDF-1alpha with additional mutagenesis studies: an attempt at a more comprehensive interpretation of accumulated structure-activity relationship data.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qg7A00
1KNAA 1PFNA 1RHPA 1M8AA 3LWEA 3MTSA 2L4NA 1F2LA 2K03A 2KVMA 2EE1A 3MWYW 4X3KA 1HUNA 2EOTA 2RVLA 1PDQA 2NZ1D 4X3UA 2BDNA 1AP0A 1PFMA 4RAUC 1VMCA 5AFWA 2B2UC 4MHEA 1IKLA 1BNZA 5CBAE 1C8CA 5DNFA 1PLFA 3DM1A 4IUQA 1G2TA 1EOTA 1G2SA 3DEPA 2KEDA 4IUUA 5EKIA 1U4MA 2B2WC 2RSNA 2K28A 1MGSA 2XIWA 3DEOA 5JJZA 4IURA 4IUVA 1JE4A 1GUWA 2FFKB 1O7YA 1BO0A 2NWGA 1DONA 1O7ZA 1DOLA 2B2TC 2CVRA 2JP1A 1G91A 1JICA 2K04A 3HP3A 1RTNA 3QO2A 2X6LA 4HCSA 1LV9A 1J9OA 5CORA 1RTOA 5T1IA 3SVMA 1EL0A 1F9QA 1CM9A 1SAPA 4U68A 4ZK9B 1O80A 2N88A 1HFNA 1QG7A 1MSGA 2KEEA 3TZDA 1IKMA 2MGSA 1HFGA 1KNEA 1DOKA 2HDMA 4QUFA 2B2VA 1NR2A 1J8IA 2N55A 3I91A 3GV3A 2NYZD 5EPKA 1DOMA 1EIGA 2FJ2A 1RJTA 1E0BA 4HSVA 2DY7A 5EJWA 2K01A 1HHVA 2L9HA 4HAEA 4XT1B 1BBXC 1F9SA 5D14A 2B2WA 1WTOA 1U4PA 1QE6A 3G7LA 2Q8RE 3IFDA 3R93A 3IL8A 2MJ8A 5E4XA 1WTWA 3F2UA 2MP1A 4CJ2C 1NR4A 4QUCA 5D65A 1PFBA 1B3AA 2MPMA 3KUPA 1XX8A 2KECA 5EQ0A 1DZ1A 1VMPA 4OIJA 2HCIA 1B53A 2R3ZA 2Q8TA 1S4ZA 1ESRA 3D6WA 1WTPA 1WTRA 1ILPA 1HA6A 5CMDA 1X32A 5EPJA 2FHTA 3Q6SA 1WTXA 1XYIA 4R9WA 5EPLA 1BF4A 3KBXA 2B2UA 2HCCA 2VXWA 5T1GA 3TN2A 4ZLTF 2K05A 1SDFA 1ZXTA 1WVLA 3GV6A 4NW2A 4RWSC 4DN4M 2HUGA 1A15A 1MSHA 3I3CA 2B2YC 3P7JA 1NCVA 1WD1A 2RA4A 4LMQD 1TVXA 1AZQA 1B50A 2DY8A 4IUPA 1F9RA 2D9UA 3H91A 4X3TA 1HRJA 1CA6A 4XDXA 4OIKA 4ZKCB 2K1BA 2M2LA 4ZKBB 4O42A 2B2TA 1U4LA 1Q3LA 3I90A 2SDFA 2KOLA 2L12A 1CA5A 2IL8A 2H1EA 1IL8A 1NAPA 2FINB 3N52A 4R8IA 4IUTA 4UAIA 4MN3A 2B2VC 1X3PA 5E4WC 5CBEE 4CJ1B 1B4OA 2JYOA 1HUMA 1U4RA 1RODA 2J7ZA 3FPUB 3FDTA 2L11A 1ML0D 1AZPA 2EPBA 4XT3B 1QNKA 1ICWA 2HDLA 4ZAIA 4CJ0B 1WTQA 1X3QA 3UI2A 1F9PA 2X69A 1B2TA 4RA8A 2B2YA 1G6ZA 1WD0A 4X3SA 2RSOA 1WTVA 1EIHA 1SSOA 2L1BA 1MI2A 2FMMA 5COYA 1ILQA 3ONAB 4HEDA 2KUMA 1EQTA 2X6GA 3I8ZA
chains in the Genus database with same CATH superfamily
1CKMA 1PH9A 1F2LA 3CU7A 3NENA 1GO3E 1PZJD 3ZJYC 3HOUH 4ZUJA 2UXDL 1EIYB 1PFMA 4DKAC 3PO2B 1M1KC 3GD7A 5FO9B 3B6YA 3PIO3 3T1HQ 1TS2A 4YIJA 4R4IA 4A3GH 3PCOB 2IT1A 1NE3A 3HOYH 1A2TA 4XIGS 1BBUA 1EU3A 5CV5A 4IURA 1R9TH 4A3MH 4A3IB 2FFKB 1ONLA 2QDBA 3C2PA 2F0SA 1DOLA 1JICA 1RTNA 4DK1A 3H0GH 4GS3A 2ID0A 2HQLA 1CM9A 2RCNA 1YNJD 2EY6A 4PZ7A 2ASBA 1PTOF 4PG3A 4C3IG 1V1PA 5C4JH 4DR3L 3M4OB 4FYDA 3I91A 3GV3A 4KY5A 2VUMB 4J6HA 3NTHA 1BBXC 3PIP3 3GTKH 3STBC 5K36G 4C2MB 1FNVA 2F0WA 2IHFA 4FP5D 4LUZA 1PFBA 3VYRA 4JI1Q 2A1AA 3QIAA 3SE0A 1NY4A 4HR7B 4JK1C 3H09A 5C4XB 1EYAA 4DNTB 1SXTA 1I3QH 2VZAA 4IQZA 4NB3A 1PYWD 1WTRA 4YHHQ 5EPLA 1STEA 3PO2H 2EVBA 1LABA 2B39A 2OQKA 4WJ3M 4HMJA 1VQ6A 1BOSA 1FVIA 5IGBA 4HIMA 3A8IE 5HGTA 2RA4A 1AZQA 1TVXA 2F0VA 3WDNA 1TWAB 4A75A 1CA6A 3VR6A 3I56A 2IHEA 3TBIB 1D7QA 3Q23A 4A3FG 4A3LG 2SOBA 2A69D 4UAIA 2BA1A 2JN4A 4DV0L 3M4OH 3GQBA 1PV4A 4IFDG 3HOWG 1JB3A 2VQEL 3I2ZA 3S14B 4DV3Q 1HNWQ 3TSSA 1UEAB 3HOVH 5IGGA 3NTKA 2JA6G 4KY6A 4C2MH 2D2CC 3A74A 3P20A 1M8AA 3ULLA 1FR3A 2KVMA 2LKVA 1PDQA 4DK3C 1F77A 3KFUA 3HGBA 2IX3A 4QY7A 3RD4A 2UUAQ 2D62A 1IKLA 1GUSA 3CP0A 1K0RA 4F88A 1S72A 1RL2A 4DV1L 5IP7G 3NP8A 4C3IB 2B2WC 3DEOA 1MGSA 3BDCA 2IX0A 3KBGA 5GROA 4CBVA 1KDAA 2EIFA 4UP8A 1JE4A 1KQSA 2F0MA 5D3DA 2B2TC 1Z47A 1QVCA 1B7YB 3CRKC 1RTOA 2GVAA 4HJ9A 1VQFA 2NVXH 1Y8PB 3S1NH 4PZ6A 2RQXA 5J22A 1DOMA 1N9WA 1GM5A 5EKLA 2Y0SG 4DR1Q 1SR3A 1GOZA 1X6OA 3S14H 3FPPA 4G57A 3AU7A 1HTLD 3EN2A 4QJFA 3NHHA 1GUGA 3K7AB 1B3AA 1B44D 3VR2A 5EQ0A 5LMUQ 1S5BD 3QB3A 5CV4A 5EPJA 2SEBD 4BS9A 3MEHA 3S24A 2HCCA 1WFQA 2K50A 3SXHA 4A3FB 4P74A 4ABNA 3W1GA 4DV2Q 4LF6Q 4OEMB 5JJLA 2EY2A 1EYCA 3CD6A 2NTTA 4LF8Q 3S1RB 3KK7A 2D9UA 1EEID 1ENFA 2YU9H 1EWHA 4TSSA 4N8FA 2NZHA 4K5XA 3GTLB 5K36H 4MN3A 1X3PA 2JA6B 3NE5B 4LUVA 1STGA 2K5NA 1YHBA 3PF5A 3J7ZC 1AZPA 1UEBA 4RG1A 1XPUA 1LTRD 2UUCQ 3K5LA 1Y8NB 2EJMA 1L0WA 2WKDA 1UE1A 2E2JH 3K7AH 5CV8A 2A19A 3LWEA 1T5EA 2EOTA 4JI8L 1CKNB 3HG9A 2PPBC 4A3FH 1X55A 2OF1A 1O78A 1CHQD 3E0EA 2PW7A 1PMRA 3NQTA 1HJPA 2KHIA 2Y0SB 3S1RH 1FNWA 3RLOA 2JA8H 2CVRA 3JAME 3HOWH 5T1IA 3SVMA 4DR1L 1LV9A 2NVYH 1K28A 3EBEA 5EKKA 1EY4A 3U4VA 2XWJB 1DYQA 1L0XB 3GTJB 2N49A 1PYBA 3OTOQ 2HDMA 4WFN3 4R1JA 4RCNA 5KRUA 3VR5A 2JA6H 4APVA 3BVMA 3NUCA 2ZTDA 4JV5L 4MTNA 2L15A 2RDGA 2KCNA 2B2WA 2QF7A 3TS2A 2HQEA 1A62A 3I55A 5IE8A 4JI4Q 3FRPB 3VR4A 1B9NA 4OO1I 1Y69U 5IP7H 1VMPA 4LF6L 1Q82C 4JG2A 4IJHA 1Q46A 5BN4A 4KTAA 3A7AB 2K5VA 3A8KE 3K8AA 2B2UA 2K05A 1STAA 3A8JE 4R4OA 3QOLA 3J81L 5FKAC 4HIKA 4DNRB 2F0GA 1STNA 4ZKCB 3KF8A 4OIKA 4KHZA 2L12A 2UUCL 5IOCA 4DXFA 1H9SB 1V1OA 3S9WA 4OWXB 4QL5A 4FF4A 5ELEA 4R4TA 5E4WC 5EBDA 3GTJH 1J5EQ 1MJEA 1LTID 1SNCA 2MQHA 4QIWE 3GTPB 1PTOD 1CFMA 4B3SQ 4RKLA 4O2DA 1B2TA 1I50B 1I4QA 1H9MA 1GHJA 1XNQL 3JAMc 3M7GA 2TMPA 1PZKD 3VYUA 1UAPA 3NWTA 3QR8A 3WWVA 3F2CA 1XPOA 4FO2A 2N8NA 2EYFA 1AP0A 2Q2UA 1LUZA 4HJAA 1A2UA 1VMCA 4AQYQ 1B8AA 4TRDA 1SYBA 3K80C 4PV1C 3RLFA 3NPPA 2EY1A 3HS0C 3DM1A 4C3JB 5IP9H 1PH8A 1QZGA 1TWHB 2F0OA 3H15A 1JWUD 3A0JA 5I2XA 2B3GA 2HIVA 5I6WA 4DUZL 1G91A 1K8GA 2F0FA 3QG1A 4X64L 5FOBB 3WOFA 2OWOA 1SEBD 1N33Q 3MXGA 1ZYRD 2MGSA 5J3BA 3IFTA 1OTCA 3S16B 1SE3A 2FJ2A 2LSSA 4DUYQ 1AN8A 1YITA 3I4MB 4GN5A 1LT5D 3GTPH 1JMCA 1F9SA 4Q5VA 3QWNA 5IGFA 2KQ3A 4HN7A 3NSWA 3BJUA 1QZHA 1I50H 3I4OA 2YTXA 2MP1A 2V4DA 1CSQA 3AQQA 2F03A 5I9OA 3SK4A 1FNUA 2QA4A 1XTCD 2KECA 2A6HD 4LFCQ 4JC0A 3SK5A 1TR5A 2RKSA 3D6WA 4KY7A 4DR2Q 1PTOH 4C3HG 1BF4A 4K6DA 3J80L 3TN2A 2MHVA 1SYDA 4KHPL 2F0IA 2OTJA 1CTMA 3J81j 1TWCB 1JT8A 1TWHH 4OHJA 5H1SE 4EQPA 1PXUA 4G7OC 1ASYA 4RFBA 4B3SL 3CCSA 4GN4B 2DN8A 1F2MA 3L7ZC 1IL8A 1NAPA 1TS5A 2F0KA 2FINB 4P75A 4L5QA 1EY9A 4DR5Q 3MHBA 1JWMD 4XXEA 1N34L 2OT2A 2EXZA 4TVAB 4IFDJ 3T53B 2E5LQ 2FMCA 2UUBL 1QOHA 5KEEA 4JI6Q 1AEXA 4GN3B 3HOUG 3J7AV 2OEOA 4IFDI 3F8TA 2Q8IB 3ONAB 4ULLA 3VYTA 1SMXA 3D6CA 3I8ZA 2E2HH 3GTGB 1TT2A 1YNND 2K03A 1YJNA 2IW3A 2NZ1D 2F4VQ 1YI2A 4ME3A 3BZDB 3D4RA 1VQIA 4JI0L 4B3MQ 2PNHA 1YBYA 2KEDA 3H0GG 2K4KA 3H3VH 4DNIA 3S17B 5JJZA 2VY3A 3ERSX 4QB4A 4JI3L 4X66Q 4V190 4JCVE 3MVVA 2K04A 1SAPA 4DXGA 5JVG3 3D0FA 1VF5C 1MSGA 3TZDA 5IT9L 4K8IA 5EBCA 1RJTA 3G71A 3PUWA 3Q0AA 1BVSA 3DXJC 4LF5L 4FF1A 4K2LA 3MXUA 1I6VC 2LXKA 4WRDA 5ISRA 5A2QE 1YVCA 3RLNA 4BA1I 1PRTF 1EQVA 3KUPA 3CCRA 1Q12A 2B63H 4B9WA 1C4QA 3GTGH 1NMGA 1PVOA 5FJ8G 2F0JA 4CGYB 3CC7A 1FJGL 4K2KA 4R9WA 4HJ7A 3ULPA 4GOPB 5ELDA 3K57A 2Q2TA 4NW2A 5C3EH 1JQYD 2PQEA 3D4DA 3PIOA 5LMNQ 1SNMA 1K3BC 4BBSG 3V2TA 1HRJA 1PTOC 3H91A 4X3TA 4DR3Q 2L5TA 3LX0A 3K5NA 3M3YB 4BXXG 2VB2X 3UE0A 1U4LA 5HY6A 4P71A 1A3UA 2C35B 3HOUB 3VR3A 1CQVA 3J7AF 1IXRA 5DLQE 3TP7A 1HUMA 5I4DA 1JOOA 1KDBA 2K5DA 2PW5A 4XT3B 3T1YL 3BU2A 1G6ZA 1B3QA 3PIPA 3L0OA 4C3HH 4Z9CB 1EY6A 3PF4A 3H0GB 4HEDA 2CW0D 2EE1A 1EWCA 1E2VA 3TQYA 2BDNA 5GAEC 3E6ZX 2C9OA 3ITPA 3FP9A 1HXYD 3CKIB 2PNRC 2JA7G 1PLFA 1ZYRC 5L37A 2ENBA 1XMOL 3GTMB 4H02A 3TMEA 4IUVA 3EVQA 2JEBI 4A3DG 2AWNA 3W3AA 4DV0Q 1O7ZA 2K5WA 4H44C 4X65L 4HCSA 3M3YH 1EQRA 3FEWX 2VQEQ 1I3QB 1K8OA 2F3WA 3D31A 4WJ4A 4A3CG 4HCEA 3T13A 2KA7A 2N55A 5M5XH 3E9HA 3EQLC 1E1OA 4J8QA 1H9KA 1MJCA 3T56B 1N32L 2JXMB 5LL6S 4P72A 3K7UC 1I4RA 2K75A 2Q8RE 4K0KQ 3ULJA 1LTTD 1HCZA 1NSNS 3DWQA 4L5TA 1ZEQX 4OWTB 1LTGD 5C4HA 2EQSA 3OPOA 2R7FA 1T5XD 4DV1Q 3MFGA 2I46A 2Q8TA 5LMNL 1SMYD 2TSSA 1I4HA 2RCFA 2WAQG 4Y52H 4KHVA 4XQQA 3MXNA 2SNMA 3G48A 4HJ5A 3E9IA 1FYCA 1KC8C 1D5XC 2E75C 1B50A 2DY8A 3KDFB 3GTMH 3RUZA 4RCOA 5C0XG 3E5SA 3K5OA 3OIPA 5NUCA 2E2IH 2V1CC 1FL0A 4ALPA 3NQIA 4IUTA 2F1MA 4I7ZC 1X3FA 4X62L 2J7ZA 2DJFC 2XSCA 3FDTA 3G6JB 1X3QA 4I65A 3CC2A 4RA8A 1NJIC 5FJ8H 4OX9L 1FGUA 4IPGA 1VQKA 1UE6A 4KD3A 2E2DC 2RHQB 2JA7B 2ZXRA 2IX1A 3J81E 1HQRD 3IAYA 1PFNA 2P5ZX 2L4NA 1FGBD 2NVXB 3S1NB 4LWCA 4R4QA 1Y14B 4A3EG 4BBSH 2CWPA 4A3DB 1CZGA 1U9RA 4FNFA 3NBIA 4C1NI 2BCOA 4BXXH 2JA8G 3AFPA 1EOTA 3S2DB 3TRZA 5CR3A 3HOZG 1KAAA 1JORA 2F0DA 1YIJA 1TY2A 3NBHB 1P8LA 1Y1VG 1XXGA 4LK1C 4GOPC 3BYYB 4ZK9B 4F7XA 2F4IA 2NN6G 1MBYA 3PO3G 5ELOA 3QJYA 4K0KL 2B2VA 2NB0A 4NXNL 1TQOA 2N78A 4IOAA 4O1NA 1E0BA 4CDFC 2Z0SA 3FHWA 2XVSA 1EFWA 4O0AA 2H5XA 2WAQB 2LY7A 4N9TA 3JC66 4JI8Q 3UDFA 2PZTA 3R93A 3F2UA 4JVZA 3CCMA 1JR0D 2YU9B 4DK6C 2MPMA 2JA7H 1XX8A 1QILA 4OONA 4JBWA 3M85A 2XWBB 3GP7A 3OSOA 1LO5D 1D5MC 2FHTA 2PMZE 4A3DH 3S2HH 1B1ZA 4JI7Q 1EYDA 2CWAA 1L1OB 2EDGA 1STYA 2I5HA 5LMNW 1UE7A 1ZXTA 4WJWA 3Q8DA 3PUYA 4A4IA 1MSHA 3CMAA 3AYHB 3SK6A 3KYHC 1AE3A 3S2DH 4A3CH 1SROA 2I07B 4IUPA 4JOIC 4UP9A 3J81c 3J7YW 3TP5A 3CPWA 2E2JB 2Z1CA 4H0LC 2A6EC 3I90A 4DK0A 4JV5Q 1GKHA 1EIFA 3OWFA 4OWWB 3E0JA 2MUYA 4YCUA 4EGVA 4G4KA 3G4SA 1ENAA 4UP7A 4A3EB 2Z9HA 3A55A 5C5MA 3EJIA 4LFAQ 5I9PA 3J80E 3UE1A 3PUVA 2NBFA 4LAAA 2JA8B 1W6KA 3OMGA 3TS0A 5IYBH 3NWSA 3HOWB 5M5WH 2NVYB 4HIOA 5JVH3 3BDOA 5IY0A 1VQ8A 5IP9G 1PRTD 2SNSA 4AIMA 2VS1A 3ND9A 1Y1VB 2YYZA 2XRSD 3TZUA 2WV6D 5C0XH 1WTHA 4KJNA 2CQOA 4F87A 4QMGA 3DEPA 2JK8A 1LTBD 3CQZH 1EZ8A 5IGCA 2AQ3B 2O5JC 2YTYA 3J81i 3HEJA 1IYJB 1JCKB 1PRTB 3HKZE 3QO2A 1E24A 4NMZA 2ICEC 2VB3X 1DGSA 1XMQL 2WB1G 3X3NA 1Z6HA 1RCVD 2ZTEA 2NYZD 4E6IA 3IRBA 5C3WA 1XNQQ 1HPCA 1Q8KA 1V8QA 2D0PA 4MNOA 1OXUA 4PNYA 3KOJA 1YNJC 3VA7A 5IWAL 2N3SA 4A3EH 1TU2B 1SJHD 4MZ9A 2O4XA 2QKIC 4JI7L 3C46A 2B29A 4GOPA 2E8GA 4OIJA 1W3SA 4ZUIA 3HOZH 1ESRA 5IIFA 2BA0A 1PH2A 5FO7B 1ILPA 2AKWB 4JPBW 1WTXA 3ND8A 4EQ5A 5T1GA 1Y1VH 2KBNA 3U58A 3EFXD 4DUZQ 5IT9E 3EIVA 4X64Q 3J80c 1AW7A 4GZYC 1NCVA 2NN6H 3PO3H 2DJGC 5M5YB 1HZBA 4DV4L 1F9RA 3DM3A 4XYQA 2BH8A 2KJXA 2B2TA 2OCEA 2HD3A 3EROA 1JWSD 3K81C 2IL8A 5FLXc 3CCQA 1SN8A 1VQBA 2R7DA 4LFAL 4JW0A 1JOQA 4CJ1B 2Q2IA 1LT4D 5E3FA 4UY8C 2Z8LA 1CQFA 5C44H 3CCEA 1F2YA 2A69C 5GQOA 5DM73 4PQXA 1HNZQ 1UE5A 3TDQA 3W1BA 4CDDC 4Q0FA 2UXCL 2R61A 4UDUC 5KNDA 2F0UA 4JOIA 1ILQA 1XWEA 1BR9A 1IZ6A 2KUMA 1EQTA 1TS4A 3SDZA 2RHSB 3URYA 1I5FA 4KHPQ 3CCVA 3CRLC 3MWYW 4R8NA 2F52A 4K5VA 4N9PA 1R4PB 5CC4A 5DEHA 1JE5A 2J0TD 2C5CA 5AJ3Q 3L2PA 2NUCA 2AUJD 1DJRD 4KMUC 2XIWA 2WB1B 3J80i 1SNQA 1YEZA 3BZCA 3TP6A 5M5YH 2LS01 3WOEA 1N34Q 1DONA 1GVPA 2HT1A 1R4QB 3HP3A 1DD2A 3DMUA 1L1OC 2UUBQ 1EEFD 1NNXA 1PTOB 4L6TB 3P75A 1J8IA 3ERQA 3C1FA 5IT9c 3S1QB 4YWMA 1SRUA 4YCVA 3NK9A 2B63G 1BCPF 2R93H 1AE2A 4LJZC 5ELNA 2EYOA 5E4XA 5DAUA 3BZKA 1K8MA 2EYHA 4JI0Q 2ZXOA 1LTAD 3F2DA 4KJOA 1ET6A 5C3EG 5C3XA 1L0YB 2YTVA 4DR4Q 4KKTA 1VQEA 4JI3Q 1W2BA 3AB9A 1IL2A 3OOCA 2BOSA 3GTQB 1HZ9A 1PH4A 1D6EC 4J1MA 2UXBL 2KCMA 3L3OC 1NMFA 1L2FA 4LFBL 5LL6X 2MO1A 1GUNA 3I4NG 1EY8A 2VQFL 3JAMi 2E2HB 1YHAA 4LF5Q 2XN9C 4L5RC 2JQOA 4ILWA 1HNZL 5FK9C 3U9OA 1QUQB 1B4OA 4ODGA 5EAYA 1EWIA 1A8VA 1A3VA 1EOVA 1B70B 3FPUB 2CQAA 4POGA 3TP8A 1PRTC 5C6AA 3S1QH 2X69A 4BY1H 1Q81C 1ZKOA 4JYAL 4DA2A 3MA2B 1WTVA 3R2TA 3I73A 1K73C 1FJGQ 4HSPA 5FLXL 2KCTA 3HRZC 1I94L 2QEJC 5AJ3L 5HGQA 1RIPA 1HUNA 2F0QA 3PMFA 2XGTA 2RVLA 4NDXA 4U673 3AMUA 4RAUC 1I4PA 3HOXG 3M4QA 3RMHA 1Q7YC 5BR8Q 1PH3A 1QWYA 3RN5A 3MZ5A 2EXDA 3NBHA 3GTQH 2Y0SE 4CDCC 2J4XA 2RSNA 4QGUA 2YV5A 2ZXPA 5GAGC 1IBKL 1K0SA 2R7ZG 1PA6A 4C1NK 2NWGA 2F0TA 1H95A 2QW7A 1CZWA 2K5HA 1B9MA 2B63B 4RH6A 4LF4L 1P16A 3T1YQ 2LXJA 3J7A5 3OYYA 4BBRG 1E7ZA 4QUFA 3STBD 4GLXA 1SBBB 5ELFA 4DAYB 1UWVA 5EJWA 2K01A 1GUOA 3C3LA 3H94A 5C3EB 4DV6L 1X65A 2XNAC 4ME5A 5TSSA 4DR4L 3LNNA 2MJ8A 1A0IA 1CK1A 4OELB 4S3SA 5M9OA 1SNOA 2BH2A 1GHKA 1L1OA 2IWHA 1EU4A 1XMOQ 3I4NB 2ES2A 1EZ6A 3HFZB 4V0BA 3R3OA 1M90C 3S1MB 4IN3A 1VQJA 2VXWA 1YHQA 2WFWA 4X65Q 1VCIA 3PUZA 2Z4IA 3M4YA 4A3KG 5I6YA 2F0LA 1VS0A 1O7IA 2K14A 2QEXA 1SFOH 4C3HB 2G5DA 4JI2Q 1V1QA 2VNUD 1N32Q 1H9RA 4IPCA 1DM0B 5CV6A 2K6AA 2IY5B 1I4XA 1RODA 4FXDA 1CSPA 3E3XA 3M7NA 4JI5L 1TS3A 1DCZA 4OL7A 5GADC 1WD0A 2ZJQA 5COYA 1HA5A 5BR8L 1AFPA 1VQHA 2EJGC 1KAWA 1HR0Q 1RD9D 3NXWA 1VQ7A 1RHPA 3MTSA 2ZJPA 2IPKD 3KJOA 4X6AH 4DR7L 5M5XB 3I4NH 1EUJA 1LTSD 2K7VA 5AFWA 5G3LD 1K9MC 3Q24A 2Z6KC 1BNZA 1H9JA 3S1MH 4JBJA 2R92G 4IUQA 1G2SA 4OO1G 1N36Q 3X3MA 1GJXA 1YZ6A 2GA4B 3HKZG 2MNAA 1OO9B 4X62Q 1CKNA 1UUPA 1S40A 2VUMG 2E76C 1EY7A 5CORA 1D1KA 4A76A 1O80A 1PH7A 1TIID 5KNCA 4OX9Q 1HFGA 5JJKA 4EVOA 1KL9A 1WCMG 3CMEA 2MFIA 4GKKQ 2F3IA 3VYSA 3KLRA 2L9HA 4UPAA 4I7AA 2PMZB 1EQQA 2DNEA 1PH6A 5BN5A 5C4XG 1HZCA 4BY7G 1QE6A 4LF9Q 5D3IB 1NBWA 4CKEA 2AMCB 3HOXH 1LM0A 2PCFB 2CFMA 1VQGA 3F1ZA 4DU9A 2WACA 1OXVA 1Q8IA 2HHHL 2CHBD 2E2IB 4QF4A 5IGDA 1S5CD 5KYLA 4KLKA 4DV5L 3H3VC 5ELBA 1G8ZD 4DV7L 2R7ZH 1HNXQ 4DF7A 4JI2L 1NTGA 2A6HC 4POFA 3OW2A 1WVLA 3OW7A 3I3CA 4BBRH 1RF2D 3D4WA 3K5MA 2L0CA 4YWLA 4NXNQ 1E2ZA 2OQ0A 4LW1A 3BS1A 2PYKA 1PHJA 2RF4A 1IBLL 1KD1C 2EYJA 5JEAG 4BBSB 2H1EA 1IYVA 2NVTB 3V05A 5E7NA 2AHOB 3ZYYX 1XNRL 4A3BG 2AQ1B 4FXGC 3A54A 3K0YA 4IALA 1HR0L 5IYBG 4BA2I 2B8FA 4YCWA 3PGZA 1X54A 3VDYA 4DAVA 1K83B 1OXTA 2OXPA 1H9SA 3CW2C 4FXKC 3CC4A 2R92B 1BCPD 2QILA 4KV6A 1KNAA 3KJPA 2LMCB 4A3KH 1N36L 3HKZB 3T51B 1WYDA 2NZOA 2F3VA 4B3RL 1U5KA 4MHEA 2GN5A 3H3VI 1YNNC 2WIIB 4RGMA 2VW9A 1SE8A 4IUUA 2CCZA 3BG3A 1U4MA 3SGIA 2K28A 4CKBA 1BCPB 3NEMA 3D3RA 2F0HA 3UDGA 1WCMB 2Z6BA 2JA9A 4DR6L 1Q1BA 1IBMQ 3KF6B 3EA6A 4GKKL 1BXTA 2ZM6L 2AUKA 2WKCA 3L9AX 4BY7B 1EL0A 1J9OA 3A7LA 4ID6A 5JOBA 1KRSA 1LLRD 1F9QA 2G9HD 4B3TL 2QCPX 1VQPA 4LF9L 3S2HB 1Z7TA 2NVTH 1EYGA 2Z6KA 3A5ZB 3DWAA 1C48A 1GD7A 5D14A 5J1ZA 1BQQT 1PYSB 1WTOA 3IFDA 1XTDA 1VQOA 3DWPA 1K83H 4AYBE 4CJ2C 3AEVA 1HNXL 4DFAA 2PI2A 5D65A 4A3IH 2O2LD 2R92H 1IYUA 5M3MG 1KLGD 2WP8J 2HCIA 4OO1H 3RN2A 1WTPA 1XYIA 3DHQA 1GUWA 3Q6SA 3CAMA 4KN4C 3MAQA 4PZ8A 2VUMH 2A8VA 4K14A 2RDFA 3RNUA 1E22A 4GNXB 4CHTB 1A15A 2DUDA 1WD1A 3D8GA 1KXLA 2M00A 4A3BB 2CKZB 1XMQQ 4M1UB 1S3OA 1WCMH 2BE5D 1QUQA 1PH1A 2K1BA 4G7ZC 5DM63 3T1HL 5M5WB 2M2LA 1K8AC 5KGUA 4P73A 5C44G 1YJ9A 1FD7D 2KOLA 5C4XH 1CA5A 5IWAQ 4BY7H 2JYOA 3PUXA 5A2QL 1KRTA 1BBWA 3DLLA 3MFYA 2L11A 1ML0D 2EPBA 2MO0A 4ZAIA 1YJWA 4KN7C 4NP5A 2AQ2B 4YY3Q 5ELCA 4QIWB 2PZUA 3CQZB 3K58A 1X9NA 2D5DA 3R2IA 1SNDA 1SSOA 1HR0W 1MI2A 2I5LX 3W5OA 3T16A 1STBA 1TWAH 2QGQA 2A5HA 3SHLA 2ALYB 4L63B 2OTLA 4F8MA 3CCJA 2CH4A 3OHXC 1BKBA 2JSOA 1CT1D 4A3JG 4DV4Q 5C5LA 3A5UA 1I4GA 5HURA 2B2UC 1IBML 4JI1L 2LFNA 2CW0C 2FXQA 3P1HA 3KLSX 3U4ZA 1KDCA 1QVGA 3KLWA 5JEAH 1JJCB 1VQ9A 4YHHL 4A3BH 1X3GA 4RGTA 2IJ0A 4DAYA 2JP1A 1S5FD 1G2TA 2X6LA 3GDEA 1NUCA 4U68A 3HOZB 1D1IA 1SYGA 1IKMA 2UXCQ 1DOKA 5FLXE 2R93G 1NR2A 1E3PA 1RKNA 5EPKA 4OXPA 5JPMC 5CGKA 5M3MB 1HQMC 1KABA 3CXCA 1O7LA 4DAPA 2H4OA 4HAEA 2PQAB 3PO3B 4C3IH 3UDIA 2DGYA 4LF7Q 2EY5A 3V96A 4JBMA 4MIUA 2QDLA 4QUCA 1VQNA 2ZJRA 1DZ1A 1B53A 1WOCA 4DGZA 2R3ZA 1XJVA 4DV3L 1LT3D 1HNWL 4A93G 4HJ8A 5JAVA 2RDHA 1Y1WG 3SK8A 5C44B 4ZLTF 4R4CA 2UU9Q 1W6JA 4RWSC 1LACA 2R6GA 1VQLA 1K3RA 1SMYC 1V43A 2B2YC 1TKWB 4LMQD 4GLVB 4AH6A 1F2ZA 4PMBA 2UUAL 1HZAA 3IKJA 2M9VA 4XDXA 2PZWA 2KENA 2A68D 4K8JA 1SYCA 1X56A 4RKBA 5G3LF 4YY3L 4BWGB 4BY1G 1IHZA 3GO5A 3NTIA 1BCPC 3AFQA 4ZQ3A 4K5WA 4L8JA 5M3MH 4A3LH 3KLSA 4A3JB 1F9PA 3GTOB 3I72A 2RSOA 5FLMG 3G6EA 4XYOA 3RZDB 4IFDH 1VDZA 2X6GA 2ICIA 1ESFA 4C3JG 1TWFB 5IYCG 2UXBQ 3GTLH 4LFBQ 4EQOA 1X3EA 4QQBX 1VQ4A 2VQFQ 5CBAE 1CI3M 1C8CA 1Q1EA 3CCUA 1J6QA 4FF2A 5LMUL 2D0OA 5F2DA 4KK7A 1JJGA 2R93B 4ZRZA 2JE6I 1D2BA 2B8GA 4Y7NB 1O7YA 1BO0A 3K0XA 2EYMA 4DV2L 3I4MG 1VQDA 3BVZA 2A74C 1VQCA 4GNXC 4LF8L 4FF3A 3M9BA 4JYAQ 4LF7L 1JB7A 5KNBA 2ZT9C 1ENCA 1Z9FA 1S5ED 2KCCA 3M4PA 4IPHA 2WAQE 2ATWA 3BYTB 1SJED 4XT1B 1I94Q 3CPFA 4A93B 1DXMA 1EFID 1V1PB 4A3JH 3MXNB 3GTOH 1OXXK 4CKCA 3IL8A 1Y1WB 4PMCA 1MIUA 1TXYA 2PO4A 3RZDH 2UU9L 3RZOB 2KHJA 1C7YA 2BE5C 1TWFH 4RHRA 4RMFA 1IBKQ 3KBXA 1AH9A 2F0EA 1SDFA 1G291 3GV6A 2VL6A 5J39A 2HUGA 4LF4Q 4BY1B 3MEFA 1QB5D 1MD2D 3LGJA 4UHVA 4HIDA 4Y7NH 4O42A 1TY0A 1Q3LA 4RGNA 2SDFA 4NXMQ 4FVMA 5JEAJ 4HTHA 2CH4W 4DV6Q 3N52A 1G51A 3PV0A 4HMIA 3W2DA 1GUTA 3KDFA 1SE2A 5EGTA 3FKIG 2HDLA 3UI2A 1I6HB 1LTLA 2B2YA 4C56C 3OTOL 3SR1A 4A93H 1WI5A 4X3SA 1EIHA 4IO9A 5A35A 3OIQA 2BDOA 1Y1WH 1SNPA 2JEAI 3ER0A 5C0XJ 5KYIA 5IYDG 1ET9A 4B08A 1PFSA 2NVQB 3MC0B 1A3TA 1QJOA 4PMWA 5C0XI 1IW7D 3RZOH 4JI4L 4RHSA 4XQNA 3KF6A 3Q22A 1YNXA 5DNFA 5E1FA 3QOJA 2DNCA 4RGOS 4XTCS 5EKIA 3LWUA 3DUZA 1QVFA 2NTSA 2AWOA 5IODA 3C1EA 4JI5Q 1Q86C 3N6RA 2K52A 3NELA 1HFNA 1E2WA 1QG7A 2KEEA 3O13A 1II3A 5FLMH 1KIXA 2JJQA 2KHSA 1SYFA 4HSVA 1SYEA 3S15B 4LNQA 3TEHB 4IOCA 2E74C 4C3JH 1E1TA 3OMCA 4KKSA 1U4PA 4AYBG 2JA5G 3G7LA 5IYCH 1SFOB 1I6HH 4EX5A 4QCLA 1WTWA 1J5EL 4DR7Q 4NKLA 1RDPD 4ZCKA 5JJIA 1KTKA 4OGQC 5CYUA 4H7BA 4L5SA 4KD4A 1CHPD 1MKHA 1QNUA 4FDBA 4GNXA 1S5DD 4H13C 4TKOB 2NVQH 5CV7A 2A73B 1HA6A 2I0QA 5M3FG 1ASZA 2A68C 3S16H 1MHWC 3HOVG 2NN6I 3I4MH 4EQNA 4NXML 3K6OA 4CDEC 2G9DA 3P7JA 5IGEA 1BDOA 3BVGA 1EY0A 4AQYL 3R8BA 3H6MA 1UNSA 3FKIB 2F0PA 4ZKBB 1JJ2A 1TWGB 4A3GG 3BDLA 3SEBA 4IJLA 4GLAC 2XRQD 3PSIA 4JBKA 3HOYG 2RBMA 4G7HC 1ICFB 5K5PA 4A3MG 3MXPA 2I5MX 3I7FA 3CCLA 1T9HA 4CJ0B 1QNKA 2HHHQ 1WTQA 3S15H 1VF7A 3HZXA 1SLJA 1D5ZC 3JAML 1N33L 1TWCH 4DV5Q 3FVQA 2HIXA 2L1BA 2FMMA 4DV7Q 4GKJQ 4DUYL 4TQUS 4ZYSA 1VQAA 5GAHC 4P2CB 3I70A 5C4ZA 4X3KA 4X3UA 1A63A 1SE4A 1PH5A 4K6LA 2WB1E 1M4VA 3OWEB 4B9XA 5FO8B 1Y8OB 4LFCL 4IZ8A 1IBLQ 1C9OA 2UXDQ 4DR2L 3HOXB 1D8LA 3I4LA 3UDXA 4YWKA 2EYPA 1XNRQ 1KHIA 3PO2G 2WINB 3FKIH 4AYBB 2K33A 2JA5B 1TWGH 2PQAA 2N88A 1A6XA 3U50C 2R7ZB 1BUVT 1KNEA 2GVBA 1EIGA 3CF5A 1G6PA 4NPSA 2EYLA 2DY7A 4N8X1 1PZID 4A3IG 5IYDH 1HHVA 1EY5A 1VQ5A 1Q90A 4MTKA 2F0NA 4BBRB 5M3FB 3S17H 1V9PA 4DR5L 1CUKA 4B3RQ 1NR4A 3HOVB 5LHY1 1U0LA 2EJFC 2E5LL 2PI2E 1LYLA 1WJJA 4DAMA 1S4ZA 4JI6L 3PQIA 3VA5A 2EZVA 2O5IC 2L55A 2XTIA 3K59A 1C0AA 5CMDA 1X32A 3RR5A 3T4AC 4DR6Q 1KLUD 2Q2HA 1CKOA 4A3GB 2ZM6Q 4DN4M 1GXDC 1XPRA 4IPDA 3HOYB 2A6ED 1R9TB 2F4VL 4A3MB 2Z4HA 4B3TQ 1JC7A 3CHBD 4XQJA 5JPNC 3ICEA 1OXSC 5BN3A 3HKSA 2ZTCA 1STHA 1LT6D 4B3ML 4M8AA 2K5QA 1QCBD 1VQMA 4A3KB 4IUNA 3F2BA 2JA5H 5C4JB 3FMCA 4R8IA 3TREA 2B2VC 5KIXA 3KF8B 5CBEE 5CV9A 4X66L 4GKJL 1HTPA 4KI0A 1U4RA 3GTKB 1ICWA 1IW7C 1JOKA 1N8RC 3U9SA 2K32A 1HH2P 4J15A 4DPGA 3A56A 5M3FH 5I2YA 4KKUA 4LUOA 4WORA
chains in the Genus database with same CATH topology
1F2LA 3CU7A 1PZJD 4ZUJA 1PFMA 3PO2B 3GD7A 5FO9B 3PIO3 1TS2A 4YIJA 2IT1A 1A2TA 4XIGS 5CV5A 1EU3A 4IURA 4A3IB 2FFKB 1ONLA 2QDBA 3C2PA 2F0SA 1DOLA 1JICA 1RTNA 4DK1A 2ID0A 1CM9A 1YNJD 2EY6A 1PTOF 4C3IG 1V1PA 3M4OB 4FYDA 3I91A 3GV3A 4KY5A 2VUMB 4J6HA 3NTHA 1BBXC 3PIP3 5K36G 4C2MB 1FNVA 2F0WA 4FP5D 1PFBA 3VYRA 3QIAA 3SE0A 4HR7B 4JK1C 3H09A 5C4XB 1EYAA 4DNTB 1SXTA 4IQZA 1PYWD 1WTRA 5EPLA 1STEA 2EVBA 1LABA 2B39A 4HMJA 1BOSA 5IGBA 3A8IE 5HGTA 2RA4A 1AZQA 1TVXA 2F0VA 3WDNA 1TWAB 1CA6A 3VR6A 3TBIB 3Q23A 2SOBA 2A69D 4UAIA 2BA1A 3GQBA 4IFDG 1JB3A 3S14B 3TSSA 1UEAB 5IGGA 3NTKA 4KY6A 2D2CC 3P20A 1M8AA 1FR3A 2KVMA 2LKVA 1PDQA 1F77A 3HGBA 2IX3A 3RD4A 2D62A 1IKLA 1GUSA 4F88A 3NP8A 4C3IB 2B2WC 3DEOA 1MGSA 3BDCA 2IX0A 3KBGA 4CBVA 1KDAA 1JE4A 2F0MA 5D3DA 2B2TC 1Z47A 3CRKC 1RTOA 1Y8PB 2RQXA 5J22A 1DOMA 5EKLA 1GOZA 3FPPA 4G57A 3AU7A 1HTLD 3NHHA 1GUGA 3K7AB 1B3AA 1B44D 3VR2A 5EQ0A 1S5BD 3QB3A 5CV4A 5EPJA 2SEBD 4BS9A 3MEHA 2HCCA 3SXHA 4A3FB 4ABNA 2EY2A 1EYCA 2NTTA 3S1RB 3KK7A 2D9UA 1EEID 1ENFA 1EWHA 4TSSA 3GTLB 4K5XA 5K36H 4MN3A 1X3PA 2JA6B 3NE5B 1STGA 1AZPA 1LTRD 3K5LA 1Y8NB 2EJMA 2WKDA 5CV8A 3LWEA 1T5EA 2EOTA 3HG9A 2PPBC 2OF1A 1O78A 1CHQD 2PW7A 1PMRA 3NQTA 2Y0SB 1FNWA 2CVRA 3JAME 5T1IA 3SVMA 1LV9A 5EKKA 1EY4A 2XWJB 1DYQA 1L0XB 3GTJB 2HDMA 4WFN3 4RCNA 5KRUA 3VR5A 3BVMA 3NUCA 2RDGA 2KCNA 2B2WA 2QF7A 2HQEA 3FRPB 3VR4A 1B9NA 4OO1I 1Y69U 1VMPA 5BN4A 4KTAA 3A7AB 3A8KE 2B2UA 2K05A 1STAA 3A8JE 3QOLA 3J81L 5FKAC 4DNRB 2F0GA 1STNA 4ZKCB 3KF8A 4OIKA 4KHZA 2L12A 5IOCA 4DXFA 1H9SB 1V1OA 3S9WA 4FF4A 5ELEA 5E4WC 5EBDA 1LTID 1SNCA 3GTPB 1PTOD 1CFMA 4RKLA 1B2TA 1I50B 1I4QA 1H9MA 1GHJA 3M7GA 2TMPA 1PZKD 3VYUA 1UAPA 3NWTA 4FO2A 2EYFA 1AP0A 1A2UA 1VMCA 4TRDA 1SYBA 4PV1C 3RLFA 3NPPA 2EY1A 3HS0C 3DM1A 4C3JB 1TWHB 2F0OA 1JWUD 5I2XA 5I6WA 1G91A 2F0FA 3QG1A 5FOBB 3WOFA 1SEBD 3MXGA 1ZYRD 2MGSA 3IFTA 3S16B 1SE3A 2FJ2A 1AN8A 3I4MB 1LT5D 1F9SA 4Q5VA 3QWNA 5IGFA 2KQ3A 4HN7A 3NSWA 2MP1A 2V4DA 2F03A 5I9OA 3SK4A 1FNUA 1XTCD 2KECA 2A6HD 3SK5A 1TR5A 2RKSA 3D6WA 4KY7A 1PTOH 4C3HG 1BF4A 4K6DA 3J80L 3TN2A 2MHVA 1SYDA 2F0IA 1CTMA 1TWCB 4OHJA 4EQPA 1PXUA 4G7OC 4RFBA 2DN8A 1F2MA 3L7ZC 1IL8A 1NAPA 1TS5A 2F0KA 2FINB 1EY9A 3MHBA 1JWMD 4XXEA 2OT2A 2EXZA 4IFDJ 3T53B 2FMCA 1QOHA 5KEEA 1AEXA 3J7AV 2OEOA 4IFDI 2Q8IB 3ONAB 4ULLA 3VYTA 3D6CA 3I8ZA 3GTGB 1TT2A 1YNND 2K03A 2IW3A 2NZ1D 3BZDB 3D4RA 2KEDA 3S17B 5JJZA 4QB4A 4V190 3MVVA 2K04A 1SAPA 4DXGA 5JVG3 1VF5C 1MSGA 3TZDA 5IT9L 4K8IA 5EBCA 1RJTA 3Q0AA 3PUWA 3DXJC 4FF1A 4K2LA 3MXUA 1I6VC 5ISRA 4WRDA 5A2QE 4BA1I 1PRTF 1EQVA 3KUPA 1Q12A 4B9WA 1C4QA 2F0JA 4CGYB 4K2KA 4R9WA 5ELDA 3K57A 4NW2A 1JQYD 2PQEA 3D4DA 1SNMA 3V2TA 1HRJA 1PTOC 3H91A 4X3TA 2L5TA 3LX0A 3K5NA 3M3YB 2VB2X 1U4LA 1A3UA 3HOUB 3VR3A 1CQVA 3J7AF 3TP7A 1HUMA 5I4DA 1JOOA 1KDBA 2K5DA 2PW5A 4XT3B 1G6ZA 4Z9CB 1EY6A 3H0GB 4HEDA 2CW0D 2EE1A 1EWCA 1E2VA 2BDNA 3E6ZX 2C9OA 3ITPA 1HXYD 3CKIB 2PNRC 1PLFA 1ZYRC 2ENBA 3GTMB 3TMEA 4IUVA 3EVQA 2JEBI 2AWNA 3W3AA 1O7ZA 2K5WA 4H44C 4HCSA 3FEWX 1I3QB 1K8OA 2F3WA 3D31A 4HCEA 3T13A 2KA7A 2N55A 3EQLC 4J8QA 1H9KA 3T56B 2JXMB 5LL6S 1I4RA 2Q8RE 1LTTD 1HCZA 1NSNS 3DWQA 1ZEQX 1LTGD 5C4HA 3OPOA 1T5XD 3MFGA 2I46A 2Q8TA 1SMYD 2TSSA 1I4HA 4KHVA 4XQQA 3MXNA 2SNMA 1FYCA 1D5XC 2E75C 1B50A 2DY8A 3RUZA 4RCOA 5C0XG 3E5SA 3K5OA 3OIPA 5NUCA 3NQIA 4IUTA 2F1MA 4I7ZC 2J7ZA 2XSCA 3FDTA 3G6JB 1X3QA 4I65A 4RA8A 4KD3A 2E2DC 2JA7B 2ZXRA 2IX1A 3J81E 1HQRD 3IAYA 1PFNA 2L4NA 1FGBD 2NVXB 3S1NB 4A3DB 1CZGA 1U9RA 4FNFA 3NBIA 4C1NI 2BCOA 1EOTA 3S2DB 5CR3A 1KAAA 1JORA 2F0DA 1TY2A 1XXGA 4LK1C 3BYYB 4ZK9B 4F7XA 2F4IA 2NN6G 1MBYA 3QJYA 2B2VA 2NB0A 1TQOA 4O1NA 1E0BA 2XVSA 2WAQB 2LY7A 4N9TA 2PZTA 3R93A 3F2UA 1JR0D 2YU9B 2MPMA 1XX8A 1QILA 3M85A 4JBWA 2XWBB 3GP7A 3OSOA 1LO5D 1D5MC 2FHTA 1B1ZA 1EYDA 2EDGA 1STYA 1ZXTA 4WJWA 3PUYA 1MSHA 3SK6A 2I07B 4IUPA 3J7YW 3TP5A 2E2JB 2Z1CA 4H0LC 2A6EC 3I90A 4DK0A 3OWFA 3E0JA 2MUYA 4EGVA 4G4KA 1ENAA 4A3EB 3A55A 5C5MA 3EJIA 5I9PA 3J80E 3PUVA 2NBFA 4LAAA 2JA8B 1W6KA 3OMGA 3HOWB 3NWSA 2NVYB 5JVH3 3BDOA 1PRTD 2SNSA 3ND9A 1Y1VB 2YYZA 2XRSD 3TZUA 2WV6D 5C0XH 4KJNA 4F87A 4QMGA 3DEPA 1LTBD 1EZ8A 5IGCA 2AQ3B 2O5JC 3HEJA 1JCKB 1PRTB 3QO2A 4NMZA 2ICEC 2VB3X 3X3NA 1Z6HA 1RCVD 2NYZD 4E6IA 5C3WA 1HPCA 1V8QA 1OXUA 4PNYA 3VA7A 1YNJC 1TU2B 1SJHD 2O4XA 2QKIC 3C46A 4OIJA 4ZUIA 1ESRA 5IIFA 2BA0A 5FO7B 1ILPA 1WTXA 3ND8A 5T1GA 3EFXD 5IT9E 1AW7A 4GZYC 1NCVA 2NN6H 5M5YB 1F9RA 4XYQA 2KJXA 2B2TA 3EROA 1JWSD 2IL8A 1JOQA 4CJ1B 1LT4D 5E3FA 2Z8LA 1CQFA 1F2YA 2A69C 5DM73 4PQXA 3TDQA 4Q0FA 2R61A 4UDUC 5KNDA 2F0UA 1ILQA 1XWEA 1BR9A 2KUMA 1EQTA 1TS4A 3SDZA 3URYA 3CRLC 3MWYW 4R8NA 4K5VA 4N9PA 1R4PB 5CC4A 5DEHA 2J0TD 2C5CA 2NUCA 2AUJD 1DJRD 4KMUC 2XIWA 2WB1B 1SNQA 3TP6A 2LS01 3WOEA 1DONA 1R4QB 3HP3A 1DD2A 3DMUA 1EEFD 1PTOB 4L6TB 1J8IA 3P75A 3ERQA 3C1FA 3S1QB 3NK9A 1BCPF 4LJZC 2EYOA 5E4XA 5DAUA 1K8MA 2EYHA 2ZXOA 1LTAD 4KJOA 1ET6A 5C3XA 1L0YB 4KKTA 3AB9A 3OOCA 2BOSA 3GTQB 1D6EC 4J1MA 3L3OC 5LL6X 1GUNA 1EY8A 2E2HB 2XN9C 4ILWA 5FK9C 3U9OA 1B4OA 4ODGA 1A3VA 3FPUB 2CQAA 3TP8A 1PRTC 5C6AA 2X69A 1ZKOA 4DA2A 3MA2B 1WTVA 3R2TA 3I73A 4HSPA 5FLXL 3HRZC 2QEJC 1HUNA 2F0QA 3PMFA 2RVLA 4NDXA 4U673 3AMUA 4RAUC 1I4PA 3RMHA 1QWYA 3MZ5A 3NBHA 2J4XA 2RSNA 2ZXPA 4C1NK 2NWGA 2F0TA 1CZWA 1B9MA 2B63B 4RH6A 4QUFA 1SBBB 5ELFA 5EJWA 2K01A 1GUOA 3C3LA 3H94A 5C3EB 2XNAC 5TSSA 4ME5A 3LNNA 2MJ8A 1CK1A 4S3SA 5M9OA 1SNOA 1GHKA 2IWHA 1EU4A 3I4NB 1EZ6A 4V0BA 3R3OA 3S1MB 4IN3A 2VXWA 1VCIA 3PUZA 2Z4IA 3M4YA 5I6YA 2F0LA 4C3HB 2VNUD 1H9RA 1DM0B 5CV6A 2K6AA 1I4XA 1RODA 4FXDA 3M7NA 1TS3A 1DCZA 4OL7A 1WD0A 5COYA 1HA5A 1AFPA 2EJGC 1RD9D 3NXWA 1RHPA 3MTSA 2IPKD 5M5XB 5G3LD 1LTSD 2K7VA 5AFWA 3Q24A 1BNZA 1H9JA 4IUQA 1G2SA 4OO1G 3X3MA 1GJXA 2GA4B 1OO9B 1UUPA 2E76C 1EY7A 5CORA 1D1KA 1O80A 1TIID 5KNCA 1HFGA 4EVOA 3VYSA 3KLRA 2L9HA 2PMZB 2DNEA 5BN5A 1QE6A 5D3IB 4CKEA 2PCFB 4DU9A 2WACA 1OXVA 1Q8IA 2CHBD 2E2IB 4QF4A 5IGDA 1S5CD 5KYLA 3H3VC 5ELBA 1G8ZD 4DF7A 2A6HC 1WVLA 3OW7A 3I3CA 1RF2D 3D4WA 3K5MA 2L0CA 1E2ZA 3BS1A 2PYKA 2EYJA 5JEAG 4BBSB 2H1EA 1IYVA 2NVTB 3V05A 3ZYYX 2AQ1B 4FXGC 3A54A 3K0YA 4IALA 4BA2I 2B8FA 4DAVA 1K83B 1OXTA 2OXPA 1H9SA 4FXKC 2R92B 1BCPD 2QILA 4KV6A 1KNAA 2LMCB 3HKZB 3T51B 2F3VA 4MHEA 1YNNC 2WIIB 4RGMA 4IUUA 3BG3A 1U4MA 2K28A 4CKBA 1BCPB 3D3RA 2F0HA 1WCMB 1Q1BA 3EA6A 1BXTA 2AUKA 2WKCA 3L9AX 4BY7B 1EL0A 1J9OA 5JOBA 3A7LA 4ID6A 1LLRD 1F9QA 2G9HD 2QCPX 3S2HB 1Z7TA 3DWAA 1C48A 5D14A 5J1ZA 1BQQT 1WTOA 3IFDA 3DWPA 4CJ2C 4DFAA 5D65A 2O2LD 1IYUA 1KLGD 2WP8J 2HCIA 4OO1H 1WTPA 1XYIA 3DHQA 1GUWA 3Q6SA 4KN4C 3MAQA 4K14A 2RDFA 4CHTB 1A15A 1WD1A 3D8GA 2M00A 4A3BB 4M1UB 2BE5D 2K1BA 4G7ZC 5DM63 5M5WB 2M2LA 5KGUA 1FD7D 2KOLA 1CA5A 2JYOA 3PUXA 5A2QL 3MFYA 2L11A 1ML0D 2EPBA 4ZAIA 4KN7C 4NP5A 2AQ2B 5ELCA 4QIWB 2PZUA 3CQZB 3K58A 2D5DA 3R2IA 1SNDA 1SSOA 1MI2A 3T16A 1STBA 2A5HA 3SHLA 4L63B 4F8MA 3OHXC 2JSOA 1CT1D 5C5LA 1I4GA 5HURA 2B2UC 2LFNA 2CW0C 3P1HA 3KLSX 1KDCA 5JEAH 4RGTA 2IJ0A 4DAYA 2JP1A 1S5FD 1G2TA 2X6LA 1NUCA 4U68A 3HOZB 1D1IA 1SYGA 1IKMA 1DOKA 5FLXE 1NR2A 1RKNA 5EPKA 5JPMC 5CGKA 5M3MB 1HQMC 1KABA 1O7LA 4DAPA 2H4OA 4HAEA 3PO3B 2EY5A 3V96A 4MIUA 4QUCA 1DZ1A 1B53A 4DGZA 2R3ZA 1LT3D 5JAVA 2RDHA 3SK8A 5C44B 4ZLTF 1W6JA 4RWSC 1LACA 2R6GA 1SMYC 1V43A 2B2YC 1TKWB 4LMQD 1F2ZA 4PMBA 3IKJA 2M9VA 4XDXA 2PZWA 2A68D 4K8JA 1SYCA 4RKBA 5G3LF 4BWGB 1IHZA 3GO5A 3NTIA 1BCPC 4ZQ3A 4K5WA 4L8JA 3KLSA 4A3JB 1F9PA 3GTOB 3I72A 2RSOA 4XYOA 3RZDB 4IFDH 1VDZA 2X6GA 2ICIA 1ESFA 4C3JG 1TWFB 4EQOA 5CBAE 1CI3M 1C8CA 1Q1EA 4FF2A 5F2DA 4KK7A 2R93B 4ZRZA 2JE6I 1D2BA 2B8GA 4Y7NB 1O7YA 1BO0A 2EYMA 3BVZA 2A74C 4FF3A 5KNBA 2ZT9C 1ENCA 1S5ED 2KCCA 3BYTB 1SJED 4XT1B 4A93B 1DXMA 1EFID 1V1PB 1OXXK 4CKCA 3IL8A 1Y1WB 4PMCA 2PO4A 3RZOB 2BE5C 4RHRA 3KBXA 2F0EA 1SDFA 1G291 3GV6A 5J39A 2HUGA 4BY1B 1QB5D 1MD2D 4O42A 1TY0A 1Q3LA 4RGNA 2SDFA 4FVMA 5JEAJ 4HTHA 3N52A 3PV0A 4HMIA 3W2DA 1GUTA 1SE2A 5EGTA 2HDLA 3UI2A 1I6HB 2B2YA 4C56C 3SR1A 4X3SA 1EIHA 5A35A 3OIQA 2BDOA 1SNPA 2JEAI 5C0XJ 5KYIA 1ET9A 4B08A 2NVQB 3MC0B 1A3TA 1QJOA 4PMWA 5C0XI 1IW7D 4RHSA 4XQNA 3Q22A 5DNFA 5E1FA 3QOJA 2DNCA 4RGOS 4XTCS 5EKIA 3LWUA 3DUZA 2NTSA 2AWOA 5IODA 3C1EA 3N6RA 1HFNA 1E2WA 1QG7A 2KEEA 3O13A 1II3A 2KHSA 1SYFA 4HSVA 1SYEA 3S15B 2E74C 3OMCA 4KKSA 1U4PA 3G7LA 1SFOB 4QCLA 1WTWA 4NKLA 1RDPD 1KTKA 4OGQC 5CYUA 4H7BA 4KD4A 1CHPD 1QNUA 1S5DD 4H13C 4TKOB 5CV7A 2A73B 1HA6A 2A68C 2NN6I 4EQNA 3K6OA 2G9DA 3P7JA 5IGEA 1BDOA 3BVGA 1EY0A 3R8BA 3H6MA 1UNSA 3FKIB 2F0PA 4ZKBB 1TWGB 3BDLA 3SEBA 2XRQD 2RBMA 4G7HC 5K5PA 3MXPA 4CJ0B 1QNKA 1WTQA 1VF7A 3HZXA 1D5ZC 3JAML 3FVQA 2L1BA 2FMMA 4ZYSA 4TQUS 4P2CB 3I70A 5C4ZA 4X3KA 4X3UA 1SE4A 4K6LA 3OWEB 1M4VA 4B9XA 5FO8B 1Y8OB 4IZ8A 3HOXB 3I4LA 2EYPA 2WINB 4AYBB 2K33A 2JA5B 2N88A 1A6XA 2R7ZB 1BUVT 1KNEA 1EIGA 2EYLA 2DY7A 1HHVA 1PZID 1EY5A 1Q90A 2F0NA 4BBRB 5M3FB 1NR4A 3HOVB 5LHY1 2EJFC 1S4ZA 3VA5A 2EZVA 2O5IC 2L55A 3K59A 5CMDA 1X32A 3T4AC 1KLUD 4A3GB 4DN4M 1GXDC 3HOYB 2A6ED 1R9TB 4A3MB 2Z4HA 1JC7A 3CHBD 4XQJA 5JPNC 1OXSC 5BN3A 1STHA 1LT6D 4M8AA 2K5QA 1QCBD 4A3KB 4IUNA 5C4JB 3FMCA 4R8IA 2B2VC 5KIXA 5CBEE 5CV9A 1HTPA 4KI0A 1U4RA 3GTKB 1ICWA 1IW7C 1JOKA 3U9SA 2K32A 3A56A 5I2YA 4KKUA 4WORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNA A;  1PFN A;  1RHP A;  1M8A A;  3LWE A;  3MTS A;  2L4N A;  1F2L A;  2K03 A;  2KVM A;  2EE1 A;  3MWY W;  4X3K A;  1HUN A;  2EOT A;  2RVL A;  1PDQ A;  2NZ1 D;  4X3U A;  2BDN A;  1AP0 A;  1PFM A;  4RAU C;  1VMC A;  5AFW A;  2B2U C;  4MHE A;  1IKL A;  1BNZ A;  5CBA E;  1C8C A;  5DNF A;  1PLF A;  3DM1 A;  4IUQ A;  1G2T A;  1EOT A;  1G2S A;  3DEP A;  2KED A;  4IUU A;  5EKI A;  1U4M A;  2B2W C;  2RSN A;  2K28 A;  1MGS A;  2XIW A;  3DEO A;  5JJZ A;  4IUR A;  4IUV A;  1JE4 A;  1GUW A;  2FFK B;  1O7Y A;  1BO0 A;  2NWG A;  1DON A;  1O7Z A;  1DOL A;  2B2T C;  2CVR A;  2JP1 A;  1G91 A;  1JIC A;  2K04 A;  3HP3 A;  1RTN A;  3QO2 A;  2X6L A;  4HCS A;  1LV9 A;  1J9O A;  5COR A;  1RTO A;  5T1I A;  3SVM A;  1EL0 A;  1F9Q A;  1CM9 A;  1SAP A;  4U68 A;  4ZK9 B;  1O80 A;  2N88 A;  1HFN A;  1QG7 A;  1MSG A;  2KEE A;  3TZD A;  1IKM A;  2MGS A;  1HFG A;  1KNE A;  1DOK A;  2HDM A;  4QUF A;  2B2V A;  1NR2 A;  1J8I A;  2N55 A;  3I91 A;  3GV3 A;  2NYZ D;  5EPK A;  1DOM A;  1EIG A;  2FJ2 A;  1RJT A;  1E0B A;  4HSV A;  2DY7 A;  5EJW A;  2K01 A;  1HHV A;  2L9H A;  4HAE A;  4XT1 B;  1BBX C;  1F9S A;  5D14 A;  2B2W A;  1WTO A;  1U4P A;  1QE6 A;  3G7L A;  2Q8R E;  3IFD A;  3R93 A;  3IL8 A;  2MJ8 A;  5E4X A;  1WTW A;  3F2U A;  2MP1 A;  4CJ2 C;  1NR4 A;  4QUC A;  5D65 A;  1PFB A;  1B3A A;  2MPM A;  3KUP A;  1XX8 A;  2KEC A;  5EQ0 A;  1DZ1 A;  1VMP A;  4OIJ A;  2HCI A;  1B53 A;  2R3Z A;  2Q8T A;  1S4Z A;  1ESR A;  3D6W A;  1WTP A;  1WTR A;  1ILP A;  1HA6 A;  5CMD A;  1X32 A;  5EPJ A;  2FHT A;  3Q6S A;  1WTX A;  1XYI A;  4R9W A;  5EPL A;  1BF4 A;  3KBX A;  2B2U A;  2HCC A;  2VXW A;  5T1G A;  3TN2 A;  4ZLT F;  2K05 A;  1SDF A;  1ZXT A;  1WVL A;  3GV6 A;  4NW2 A;  4RWS C;  4DN4 M;  2HUG A;  1A15 A;  1MSH A;  3I3C A;  2B2Y C;  3P7J A;  1NCV A;  1WD1 A;  2RA4 A;  4LMQ D;  1TVX A;  1AZQ A;  1B50 A;  2DY8 A;  4IUP A;  1F9R A;  2D9U A;  3H91 A;  4X3T A;  1HRJ A;  1CA6 A;  4XDX A;  4OIK A;  4ZKC B;  2K1B A;  2M2L A;  4ZKB B;  4O42 A;  2B2T A;  1U4L A;  1Q3L A;  3I90 A;  2SDF A;  2KOL A;  2L12 A;  1CA5 A;  2IL8 A;  2H1E A;  1IL8 A;  1NAP A;  2FIN B;  3N52 A;  4R8I A;  4IUT A;  4UAI A;  4MN3 A;  2B2V C;  1X3P A;  5E4W C;  5CBE E;  4CJ1 B;  1B4O A;  2JYO A;  1HUM A;  1U4R A;  1ROD A;  2J7Z A;  3FPU B;  3FDT A;  2L11 A;  1ML0 D;  1AZP A;  2EPB A;  4XT3 B;  1QNK A;  1ICW A;  2HDL A;  4ZAI A;  4CJ0 B;  1WTQ A;  1X3Q A;  3UI2 A;  1F9P A;  2X69 A;  1B2T A;  4RA8 A;  2B2Y A;  1G6Z A;  1WD0 A;  4X3S A;  2RSO A;  1WTV A;  1EIH A;  1SSO A;  2L1B A;  1MI2 A;  2FMM A;  5COY A;  1ILQ A;  3ONA B;  4HED A;  2KUM A;  1EQT A;  2X6G A;  3I8Z A; 
#chains in the Genus database with same CATH topology
 1CKM A;  1PH9 A;  1F2L A;  3CU7 A;  3NEN A;  1GO3 E;  1PZJ D;  3ZJY C;  3HOU H;  4ZUJ A;  2UXD L;  1EIY B;  1PFM A;  4DKA C;  3PO2 B;  1M1K C;  3GD7 A;  5FO9 B;  3B6Y A;  3PIO 3;  3T1H Q;  1TS2 A;  4YIJ A;  4R4I A;  4A3G H;  3PCO B;  2IT1 A;  1NE3 A;  3HOY H;  1A2T A;  4XIG S;  1BBU A;  1EU3 A;  5CV5 A;  4IUR A;  1R9T H;  4A3M H;  4A3I B;  2FFK B;  1ONL A;  2QDB A;  3C2P A;  2F0S A;  1DOL A;  1JIC A;  1RTN A;  4DK1 A;  3H0G H;  4GS3 A;  2ID0 A;  2HQL A;  1CM9 A;  2RCN A;  1YNJ D;  2EY6 A;  4PZ7 A;  2ASB A;  1PTO F;  4PG3 A;  4C3I G;  1V1P A;  5C4J H;  4DR3 L;  3M4O B;  4FYD A;  3I91 A;  3GV3 A;  4KY5 A;  2VUM B;  4J6H A;  3NTH A;  1BBX C;  3PIP 3;  3GTK H;  3STB C;  5K36 G;  4C2M B;  1FNV A;  2F0W A;  2IHF A;  4FP5 D;  4LUZ A;  1PFB A;  3VYR A;  4JI1 Q;  2A1A A;  3QIA A;  3SE0 A;  1NY4 A;  4HR7 B;  4JK1 C;  3H09 A;  5C4X B;  1EYA A;  4DNT B;  1SXT A;  1I3Q H;  2VZA A;  4IQZ A;  4NB3 A;  1PYW D;  1WTR A;  4YHH Q;  5EPL A;  1STE A;  3PO2 H;  2EVB A;  1LAB A;  2B39 A;  2OQK A;  4WJ3 M;  4HMJ A;  1VQ6 A;  1BOS A;  1FVI A;  5IGB A;  4HIM A;  3A8I E;  5HGT A;  2RA4 A;  1AZQ A;  1TVX A;  2F0V A;  3WDN A;  1TWA B;  4A75 A;  1CA6 A;  3VR6 A;  3I56 A;  2IHE A;  3TBI B;  1D7Q A;  3Q23 A;  4A3F G;  4A3L G;  2SOB A;  2A69 D;  4UAI A;  2BA1 A;  2JN4 A;  4DV0 L;  3M4O H;  3GQB A;  1PV4 A;  4IFD G;  3HOW G;  1JB3 A;  2VQE L;  3I2Z A;  3S14 B;  4DV3 Q;  1HNW Q;  3TSS A;  1UEA B;  3HOV H;  5IGG A;  3NTK A;  2JA6 G;  4KY6 A;  4C2M H;  2D2C C;  3A74 A;  3P20 A;  1M8A A;  3ULL A;  1FR3 A;  2KVM A;  2LKV A;  1PDQ A;  4DK3 C;  1F77 A;  3KFU A;  3HGB A;  2IX3 A;  4QY7 A;  3RD4 A;  2UUA Q;  2D62 A;  1IKL A;  1GUS A;  3CP0 A;  1K0R A;  4F88 A;  1S72 A;  1RL2 A;  4DV1 L;  5IP7 G;  3NP8 A;  4C3I B;  2B2W C;  3DEO A;  1MGS A;  3BDC A;  2IX0 A;  3KBG A;  5GRO A;  4CBV A;  1KDA A;  2EIF A;  4UP8 A;  1JE4 A;  1KQS A;  2F0M A;  5D3D A;  2B2T C;  1Z47 A;  1QVC A;  1B7Y B;  3CRK C;  1RTO A;  2GVA A;  4HJ9 A;  1VQF A;  2NVX H;  1Y8P B;  3S1N H;  4PZ6 A;  2RQX A;  5J22 A;  1DOM A;  1N9W A;  1GM5 A;  5EKL A;  2Y0S G;  4DR1 Q;  1SR3 A;  1GOZ A;  1X6O A;  3S14 H;  3FPP A;  4G57 A;  3AU7 A;  1HTL D;  3EN2 A;  4QJF A;  3NHH A;  1GUG A;  3K7A B;  1B3A A;  1B44 D;  3VR2 A;  5EQ0 A;  5LMU Q;  1S5B D;  3QB3 A;  5CV4 A;  5EPJ A;  2SEB D;  4BS9 A;  3MEH A;  3S24 A;  2HCC A;  1WFQ A;  2K50 A;  3SXH A;  4A3F B;  4P74 A;  4ABN A;  3W1G A;  4DV2 Q;  4LF6 Q;  4OEM B;  5JJL A;  2EY2 A;  1EYC A;  3CD6 A;  2NTT A;  4LF8 Q;  3S1R B;  3KK7 A;  2D9U A;  1EEI D;  1ENF A;  2YU9 H;  1EWH A;  4TSS A;  4N8F A;  2NZH A;  4K5X A;  3GTL B;  5K36 H;  4MN3 A;  1X3P A;  2JA6 B;  3NE5 B;  4LUV A;  1STG A;  2K5N A;  1YHB A;  3PF5 A;  3J7Z C;  1AZP A;  1UEB A;  4RG1 A;  1XPU A;  1LTR D;  2UUC Q;  3K5L A;  1Y8N B;  2EJM A;  1L0W A;  2WKD A;  1UE1 A;  2E2J H;  3K7A H;  5CV8 A;  2A19 A;  3LWE A;  1T5E A;  2EOT A;  4JI8 L;  1CKN B;  3HG9 A;  2PPB C;  4A3F H;  1X55 A;  2OF1 A;  1O78 A;  1CHQ D;  3E0E A;  2PW7 A;  1PMR A;  3NQT A;  1HJP A;  2KHI A;  2Y0S B;  3S1R H;  1FNW A;  3RLO A;  2JA8 H;  2CVR A;  3JAM E;  3HOW H;  5T1I A;  3SVM A;  4DR1 L;  1LV9 A;  2NVY H;  1K28 A;  3EBE A;  5EKK A;  1EY4 A;  3U4V A;  2XWJ B;  1DYQ A;  1L0X B;  3GTJ B;  2N49 A;  1PYB A;  3OTO Q;  2HDM A;  4WFN 3;  4R1J A;  4RCN A;  5KRU A;  3VR5 A;  2JA6 H;  4APV A;  3BVM A;  3NUC A;  2ZTD A;  4JV5 L;  4MTN A;  2L15 A;  2RDG A;  2KCN A;  2B2W A;  2QF7 A;  3TS2 A;  2HQE A;  1A62 A;  3I55 A;  5IE8 A;  4JI4 Q;  3FRP B;  3VR4 A;  1B9N A;  4OO1 I;  1Y69 U;  5IP7 H;  1VMP A;  4LF6 L;  1Q82 C;  4JG2 A;  4IJH A;  1Q46 A;  5BN4 A;  4KTA A;  3A7A B;  2K5V A;  3A8K E;  3K8A A;  2B2U A;  2K05 A;  1STA A;  3A8J E;  4R4O A;  3QOL A;  3J81 L;  5FKA C;  4HIK A;  4DNR B;  2F0G A;  1STN A;  4ZKC B;  3KF8 A;  4OIK A;  4KHZ A;  2L12 A;  2UUC L;  5IOC A;  4DXF A;  1H9S B;  1V1O A;  3S9W A;  4OWX B;  4QL5 A;  4FF4 A;  5ELE A;  4R4T A;  5E4W C;  5EBD A;  3GTJ H;  1J5E Q;  1MJE A;  1LTI D;  1SNC A;  2MQH A;  4QIW E;  3GTP B;  1PTO D;  1CFM A;  4B3S Q;  4RKL A;  4O2D A;  1B2T A;  1I50 B;  1I4Q A;  1H9M A;  1GHJ A;  1XNQ L;  3JAM c;  3M7G A;  2TMP A;  1PZK D;  3VYU A;  1UAP A;  3NWT A;  3QR8 A;  3WWV A;  3F2C A;  1XPO A;  4FO2 A;  2N8N A;  2EYF A;  1AP0 A;  2Q2U A;  1LUZ A;  4HJA A;  1A2U A;  1VMC A;  4AQY Q;  1B8A A;  4TRD A;  1SYB A;  3K80 C;  4PV1 C;  3RLF A;  3NPP A;  2EY1 A;  3HS0 C;  3DM1 A;  4C3J B;  5IP9 H;  1PH8 A;  1QZG A;  1TWH B;  2F0O A;  3H15 A;  1JWU D;  3A0J A;  5I2X A;  2B3G A;  2HIV A;  5I6W A;  4DUZ L;  1G91 A;  1K8G A;  2F0F A;  3QG1 A;  4X64 L;  5FOB B;  3WOF A;  2OWO A;  1SEB D;  1N33 Q;  3MXG A;  1ZYR D;  2MGS A;  5J3B A;  3IFT A;  1OTC A;  3S16 B;  1SE3 A;  2FJ2 A;  2LSS A;  4DUY Q;  1AN8 A;  1YIT A;  3I4M B;  4GN5 A;  1LT5 D;  3GTP H;  1JMC A;  1F9S A;  4Q5V A;  3QWN A;  5IGF A;  2KQ3 A;  4HN7 A;  3NSW A;  3BJU A;  1QZH A;  1I50 H;  3I4O A;  2YTX A;  2MP1 A;  2V4D A;  1CSQ A;  3AQQ A;  2F03 A;  5I9O A;  3SK4 A;  1FNU A;  2QA4 A;  1XTC D;  2KEC A;  2A6H D;  4LFC Q;  4JC0 A;  3SK5 A;  1TR5 A;  2RKS A;  3D6W A;  4KY7 A;  4DR2 Q;  1PTO H;  4C3H G;  1BF4 A;  4K6D A;  3J80 L;  3TN2 A;  2MHV A;  1SYD A;  4KHP L;  2F0I A;  2OTJ A;  1CTM A;  3J81 j;  1TWC B;  1JT8 A;  1TWH H;  4OHJ A;  5H1S E;  4EQP A;  1PXU A;  4G7O C;  1ASY A;  4RFB A;  4B3S L;  3CCS A;  4GN4 B;  2DN8 A;  1F2M A;  3L7Z C;  1IL8 A;  1NAP A;  1TS5 A;  2F0K A;  2FIN B;  4P75 A;  4L5Q A;  1EY9 A;  4DR5 Q;  3MHB A;  1JWM D;  4XXE A;  1N34 L;  2OT2 A;  2EXZ A;  4TVA B;  4IFD J;  3T53 B;  2E5L Q;  2FMC A;  2UUB L;  1QOH A;  5KEE A;  4JI6 Q;  1AEX A;  4GN3 B;  3HOU G;  3J7A V;  2OEO A;  4IFD I;  3F8T A;  2Q8I B;  3ONA B;  4ULL A;  3VYT A;  1SMX A;  3D6C A;  3I8Z A;  2E2H H;  3GTG B;  1TT2 A;  1YNN D;  2K03 A;  1YJN A;  2IW3 A;  2NZ1 D;  2F4V Q;  1YI2 A;  4ME3 A;  3BZD B;  3D4R A;  1VQI A;  4JI0 L;  4B3M Q;  2PNH A;  1YBY A;  2KED A;  3H0G G;  2K4K A;  3H3V H;  4DNI A;  3S17 B;  5JJZ A;  2VY3 A;  3ERS X;  4QB4 A;  4JI3 L;  4X66 Q;  4V19 0;  4JCV E;  3MVV A;  2K04 A;  1SAP A;  4DXG A;  5JVG 3;  3D0F A;  1VF5 C;  1MSG A;  3TZD A;  5IT9 L;  4K8I A;  5EBC A;  1RJT A;  3G71 A;  3PUW A;  3Q0A A;  1BVS A;  3DXJ C;  4LF5 L;  4FF1 A;  4K2L A;  3MXU A;  1I6V C;  2LXK A;  4WRD A;  5ISR A;  5A2Q E;  1YVC A;  3RLN A;  4BA1 I;  1PRT F;  1EQV A;  3KUP A;  3CCR A;  1Q12 A;  2B63 H;  4B9W A;  1C4Q A;  3GTG H;  1NMG A;  1PVO A;  5FJ8 G;  2F0J A;  4CGY B;  3CC7 A;  1FJG L;  4K2K A;  4R9W A;  4HJ7 A;  3ULP A;  4GOP B;  5ELD A;  3K57 A;  2Q2T A;  4NW2 A;  5C3E H;  1JQY D;  2PQE A;  3D4D A;  3PIO A;  5LMN Q;  1SNM A;  1K3B C;  4BBS G;  3V2T A;  1HRJ A;  1PTO C;  3H91 A;  4X3T A;  4DR3 Q;  2L5T A;  3LX0 A;  3K5N A;  3M3Y B;  4BXX G;  2VB2 X;  3UE0 A;  1U4L A;  5HY6 A;  4P71 A;  1A3U A;  2C35 B;  3HOU B;  3VR3 A;  1CQV A;  3J7A F;  1IXR A;  5DLQ E;  3TP7 A;  1HUM A;  5I4D A;  1JOO A;  1KDB A;  2K5D A;  2PW5 A;  4XT3 B;  3T1Y L;  3BU2 A;  1G6Z A;  1B3Q A;  3PIP A;  3L0O A;  4C3H H;  4Z9C B;  1EY6 A;  3PF4 A;  3H0G B;  4HED A;  2CW0 D;  2EE1 A;  1EWC A;  1E2V A;  3TQY A;  2BDN A;  5GAE C;  3E6Z X;  2C9O A;  3ITP A;  3FP9 A;  1HXY D;  3CKI B;  2PNR C;  2JA7 G;  1PLF A;  1ZYR C;  5L37 A;  2ENB A;  1XMO L;  3GTM B;  4H02 A;  3TME A;  4IUV A;  3EVQ A;  2JEB I;  4A3D G;  2AWN A;  3W3A A;  4DV0 Q;  1O7Z A;  2K5W A;  4H44 C;  4X65 L;  4HCS A;  3M3Y H;  1EQR A;  3FEW X;  2VQE Q;  1I3Q B;  1K8O A;  2F3W A;  3D31 A;  4WJ4 A;  4A3C G;  4HCE A;  3T13 A;  2KA7 A;  2N55 A;  5M5X H;  3E9H A;  3EQL C;  1E1O A;  4J8Q A;  1H9K A;  1MJC A;  3T56 B;  1N32 L;  2JXM B;  5LL6 S;  4P72 A;  3K7U C;  1I4R A;  2K75 A;  2Q8R E;  4K0K Q;  3ULJ A;  1LTT D;  1HCZ A;  1NSN S;  3DWQ A;  4L5T A;  1ZEQ X;  4OWT B;  1LTG D;  5C4H A;  2EQS A;  3OPO A;  2R7F A;  1T5X D;  4DV1 Q;  3MFG A;  2I46 A;  2Q8T A;  5LMN L;  1SMY D;  2TSS A;  1I4H A;  2RCF A;  2WAQ G;  4Y52 H;  4KHV A;  4XQQ A;  3MXN A;  2SNM A;  3G48 A;  4HJ5 A;  3E9I A;  1FYC A;  1KC8 C;  1D5X C;  2E75 C;  1B50 A;  2DY8 A;  3KDF B;  3GTM H;  3RUZ A;  4RCO A;  5C0X G;  3E5S A;  3K5O A;  3OIP A;  5NUC A;  2E2I H;  2V1C C;  1FL0 A;  4ALP A;  3NQI A;  4IUT A;  2F1M A;  4I7Z C;  1X3F A;  4X62 L;  2J7Z A;  2DJF C;  2XSC A;  3FDT A;  3G6J B;  1X3Q A;  4I65 A;  3CC2 A;  4RA8 A;  1NJI C;  5FJ8 H;  4OX9 L;  1FGU A;  4IPG A;  1VQK A;  1UE6 A;  4KD3 A;  2E2D C;  2RHQ B;  2JA7 B;  2ZXR A;  2IX1 A;  3J81 E;  1HQR D;  3IAY A;  1PFN A;  2P5Z X;  2L4N A;  1FGB D;  2NVX B;  3S1N B;  4LWC A;  4R4Q A;  1Y14 B;  4A3E G;  4BBS H;  2CWP A;  4A3D B;  1CZG A;  1U9R A;  4FNF A;  3NBI A;  4C1N I;  2BCO A;  4BXX H;  2JA8 G;  3AFP A;  1EOT A;  3S2D B;  3TRZ A;  5CR3 A;  3HOZ G;  1KAA A;  1JOR A;  2F0D A;  1YIJ A;  1TY2 A;  3NBH B;  1P8L A;  1Y1V G;  1XXG A;  4LK1 C;  4GOP C;  3BYY B;  4ZK9 B;  4F7X A;  2F4I A;  2NN6 G;  1MBY A;  3PO3 G;  5ELO A;  3QJY A;  4K0K L;  2B2V A;  2NB0 A;  4NXN L;  1TQO A;  2N78 A;  4IOA A;  4O1N A;  1E0B A;  4CDF C;  2Z0S A;  3FHW A;  2XVS A;  1EFW A;  4O0A A;  2H5X A;  2WAQ B;  2LY7 A;  4N9T A;  3JC6 6;  4JI8 Q;  3UDF A;  2PZT A;  3R93 A;  3F2U A;  4JVZ A;  3CCM A;  1JR0 D;  2YU9 B;  4DK6 C;  2MPM A;  2JA7 H;  1XX8 A;  1QIL A;  4OON A;  4JBW A;  3M85 A;  2XWB B;  3GP7 A;  3OSO A;  1LO5 D;  1D5M C;  2FHT A;  2PMZ E;  4A3D H;  3S2H H;  1B1Z A;  4JI7 Q;  1EYD A;  2CWA A;  1L1O B;  2EDG A;  1STY A;  2I5H A;  5LMN W;  1UE7 A;  1ZXT A;  4WJW A;  3Q8D A;  3PUY A;  4A4I A;  1MSH A;  3CMA A;  3AYH B;  3SK6 A;  3KYH C;  1AE3 A;  3S2D H;  4A3C H;  1SRO A;  2I07 B;  4IUP A;  4JOI C;  4UP9 A;  3J81 c;  3J7Y W;  3TP5 A;  3CPW A;  2E2J B;  2Z1C A;  4H0L C;  2A6E C;  3I90 A;  4DK0 A;  4JV5 Q;  1GKH A;  1EIF A;  3OWF A;  4OWW B;  3E0J A;  2MUY A;  4YCU A;  4EGV A;  4G4K A;  3G4S A;  1ENA A;  4UP7 A;  4A3E B;  2Z9H A;  3A55 A;  5C5M A;  3EJI A;  4LFA Q;  5I9P A;  3J80 E;  3UE1 A;  3PUV A;  2NBF A;  4LAA A;  2JA8 B;  1W6K A;  3OMG A;  3TS0 A;  5IYB H;  3NWS A;  3HOW B;  5M5W H;  2NVY B;  4HIO A;  5JVH 3;  3BDO A;  5IY0 A;  1VQ8 A;  5IP9 G;  1PRT D;  2SNS A;  4AIM A;  2VS1 A;  3ND9 A;  1Y1V B;  2YYZ A;  2XRS D;  3TZU A;  2WV6 D;  5C0X H;  1WTH A;  4KJN A;  2CQO A;  4F87 A;  4QMG A;  3DEP A;  2JK8 A;  1LTB D;  3CQZ H;  1EZ8 A;  5IGC A;  2AQ3 B;  2O5J C;  2YTY A;  3J81 i;  3HEJ A;  1IYJ B;  1JCK B;  1PRT B;  3HKZ E;  3QO2 A;  1E24 A;  4NMZ A;  2ICE C;  2VB3 X;  1DGS A;  1XMQ L;  2WB1 G;  3X3N A;  1Z6H A;  1RCV D;  2ZTE A;  2NYZ D;  4E6I A;  3IRB A;  5C3W A;  1XNQ Q;  1HPC A;  1Q8K A;  1V8Q A;  2D0P A;  4MNO A;  1OXU A;  4PNY A;  3KOJ A;  1YNJ C;  3VA7 A;  5IWA L;  2N3S A;  4A3E H;  1TU2 B;  1SJH D;  4MZ9 A;  2O4X A;  2QKI C;  4JI7 L;  3C46 A;  2B29 A;  4GOP A;  2E8G A;  4OIJ A;  1W3S A;  4ZUI A;  3HOZ H;  1ESR A;  5IIF A;  2BA0 A;  1PH2 A;  5FO7 B;  1ILP A;  2AKW B;  4JPB W;  1WTX A;  3ND8 A;  4EQ5 A;  5T1G A;  1Y1V H;  2KBN A;  3U58 A;  3EFX D;  4DUZ Q;  5IT9 E;  3EIV A;  4X64 Q;  3J80 c;  1AW7 A;  4GZY C;  1NCV A;  2NN6 H;  3PO3 H;  2DJG C;  5M5Y B;  1HZB A;  4DV4 L;  1F9R A;  3DM3 A;  4XYQ A;  2BH8 A;  2KJX A;  2B2T A;  2OCE A;  2HD3 A;  3ERO A;  1JWS D;  3K81 C;  2IL8 A;  5FLX c;  3CCQ A;  1SN8 A;  1VQB A;  2R7D A;  4LFA L;  4JW0 A;  1JOQ A;  4CJ1 B;  2Q2I A;  1LT4 D;  5E3F A;  4UY8 C;  2Z8L A;  1CQF A;  5C44 H;  3CCE A;  1F2Y A;  2A69 C;  5GQO A;  5DM7 3;  4PQX A;  1HNZ Q;  1UE5 A;  3TDQ A;  3W1B A;  4CDD C;  4Q0F A;  2UXC L;  2R61 A;  4UDU C;  5KND A;  2F0U A;  4JOI A;  1ILQ A;  1XWE A;  1BR9 A;  1IZ6 A;  2KUM A;  1EQT A;  1TS4 A;  3SDZ A;  2RHS B;  3URY A;  1I5F A;  4KHP Q;  3CCV A;  3CRL C;  3MWY W;  4R8N A;  2F52 A;  4K5V A;  4N9P A;  1R4P B;  5CC4 A;  5DEH A;  1JE5 A;  2J0T D;  2C5C A;  5AJ3 Q;  3L2P A;  2NUC A;  2AUJ D;  1DJR D;  4KMU C;  2XIW A;  2WB1 B;  3J80 i;  1SNQ A;  1YEZ A;  3BZC A;  3TP6 A;  5M5Y H;  2LS0 1;  3WOE A;  1N34 Q;  1DON A;  1GVP A;  2HT1 A;  1R4Q B;  3HP3 A;  1DD2 A;  3DMU A;  1L1O C;  2UUB Q;  1EEF D;  1NNX A;  1PTO B;  4L6T B;  3P75 A;  1J8I A;  3ERQ A;  3C1F A;  5IT9 c;  3S1Q B;  4YWM A;  1SRU A;  4YCV A;  3NK9 A;  2B63 G;  1BCP F;  2R93 H;  1AE2 A;  4LJZ C;  5ELN A;  2EYO A;  5E4X A;  5DAU A;  3BZK A;  1K8M A;  2EYH A;  4JI0 Q;  2ZXO A;  1LTA D;  3F2D A;  4KJO A;  1ET6 A;  5C3E G;  5C3X A;  1L0Y B;  2YTV A;  4DR4 Q;  4KKT A;  1VQE A;  4JI3 Q;  1W2B A;  3AB9 A;  1IL2 A;  3OOC A;  2BOS A;  3GTQ B;  1HZ9 A;  1PH4 A;  1D6E C;  4J1M A;  2UXB L;  2KCM A;  3L3O C;  1NMF A;  1L2F A;  4LFB L;  5LL6 X;  2MO1 A;  1GUN A;  3I4N G;  1EY8 A;  2VQF L;  3JAM i;  2E2H B;  1YHA A;  4LF5 Q;  2XN9 C;  4L5R C;  2JQO A;  4ILW A;  1HNZ L;  5FK9 C;  3U9O A;  1QUQ B;  1B4O A;  4ODG A;  5EAY A;  1EWI A;  1A8V A;  1A3V A;  1EOV A;  1B70 B;  3FPU B;  2CQA A;  4POG A;  3TP8 A;  1PRT C;  5C6A A;  3S1Q H;  2X69 A;  4BY1 H;  1Q81 C;  1ZKO A;  4JYA L;  4DA2 A;  3MA2 B;  1WTV A;  3R2T A;  3I73 A;  1K73 C;  1FJG Q;  4HSP A;  5FLX L;  2KCT A;  3HRZ C;  1I94 L;  2QEJ C;  5AJ3 L;  5HGQ A;  1RIP A;  1HUN A;  2F0Q A;  3PMF A;  2XGT A;  2RVL A;  4NDX A;  4U67 3;  3AMU A;  4RAU C;  1I4P A;  3HOX G;  3M4Q A;  3RMH A;  1Q7Y C;  5BR8 Q;  1PH3 A;  1QWY A;  3RN5 A;  3MZ5 A;  2EXD A;  3NBH A;  3GTQ H;  2Y0S E;  4CDC C;  2J4X A;  2RSN A;  4QGU A;  2YV5 A;  2ZXP A;  5GAG C;  1IBK L;  1K0S A;  2R7Z G;  1PA6 A;  4C1N K;  2NWG A;  2F0T A;  1H95 A;  2QW7 A;  1CZW A;  2K5H A;  1B9M A;  2B63 B;  4RH6 A;  4LF4 L;  1P16 A;  3T1Y Q;  2LXJ A;  3J7A 5;  3OYY A;  4BBR G;  1E7Z A;  4QUF A;  3STB D;  4GLX A;  1SBB B;  5ELF A;  4DAY B;  1UWV A;  5EJW A;  2K01 A;  1GUO A;  3C3L A;  3H94 A;  5C3E B;  4DV6 L;  1X65 A;  2XNA C;  4ME5 A;  5TSS A;  4DR4 L;  3LNN A;  2MJ8 A;  1A0I A;  1CK1 A;  4OEL B;  4S3S A;  5M9O A;  1SNO A;  2BH2 A;  1GHK A;  1L1O A;  2IWH A;  1EU4 A;  1XMO Q;  3I4N B;  2ES2 A;  1EZ6 A;  3HFZ B;  4V0B A;  3R3O A;  1M90 C;  3S1M B;  4IN3 A;  1VQJ A;  2VXW A;  1YHQ A;  2WFW A;  4X65 Q;  1VCI A;  3PUZ A;  2Z4I A;  3M4Y A;  4A3K G;  5I6Y A;  2F0L A;  1VS0 A;  1O7I A;  2K14 A;  2QEX A;  1SFO H;  4C3H B;  2G5D A;  4JI2 Q;  1V1Q A;  2VNU D;  1N32 Q;  1H9R A;  4IPC A;  1DM0 B;  5CV6 A;  2K6A A;  2IY5 B;  1I4X A;  1ROD A;  4FXD A;  1CSP A;  3E3X A;  3M7N A;  4JI5 L;  1TS3 A;  1DCZ A;  4OL7 A;  5GAD C;  1WD0 A;  2ZJQ A;  5COY A;  1HA5 A;  5BR8 L;  1AFP A;  1VQH A;  2EJG C;  1KAW A;  1HR0 Q;  1RD9 D;  3NXW A;  1VQ7 A;  1RHP A;  3MTS A;  2ZJP A;  2IPK D;  3KJO A;  4X6A H;  4DR7 L;  5M5X B;  3I4N H;  1EUJ A;  1LTS D;  2K7V A;  5AFW A;  5G3L D;  1K9M C;  3Q24 A;  2Z6K C;  1BNZ A;  1H9J A;  3S1M H;  4JBJ A;  2R92 G;  4IUQ A;  1G2S A;  4OO1 G;  1N36 Q;  3X3M A;  1GJX A;  1YZ6 A;  2GA4 B;  3HKZ G;  2MNA A;  1OO9 B;  4X62 Q;  1CKN A;  1UUP A;  1S40 A;  2VUM G;  2E76 C;  1EY7 A;  5COR A;  1D1K A;  4A76 A;  1O80 A;  1PH7 A;  1TII D;  5KNC A;  4OX9 Q;  1HFG A;  5JJK A;  4EVO A;  1KL9 A;  1WCM G;  3CME A;  2MFI A;  4GKK Q;  2F3I A;  3VYS A;  3KLR A;  2L9H A;  4UPA A;  4I7A A;  2PMZ B;  1EQQ A;  2DNE A;  1PH6 A;  5BN5 A;  5C4X G;  1HZC A;  4BY7 G;  1QE6 A;  4LF9 Q;  5D3I B;  1NBW A;  4CKE A;  2AMC B;  3HOX H;  1LM0 A;  2PCF B;  2CFM A;  1VQG A;  3F1Z A;  4DU9 A;  2WAC A;  1OXV A;  1Q8I A;  2HHH L;  2CHB D;  2E2I B;  4QF4 A;  5IGD A;  1S5C D;  5KYL A;  4KLK A;  4DV5 L;  3H3V C;  5ELB A;  1G8Z D;  4DV7 L;  2R7Z H;  1HNX Q;  4DF7 A;  4JI2 L;  1NTG A;  2A6H C;  4POF A;  3OW2 A;  1WVL A;  3OW7 A;  3I3C A;  4BBR H;  1RF2 D;  3D4W A;  3K5M A;  2L0C A;  4YWL A;  4NXN Q;  1E2Z A;  2OQ0 A;  4LW1 A;  3BS1 A;  2PYK A;  1PHJ A;  2RF4 A;  1IBL L;  1KD1 C;  2EYJ A;  5JEA G;  4BBS B;  2H1E A;  1IYV A;  2NVT B;  3V05 A;  5E7N A;  2AHO B;  3ZYY X;  1XNR L;  4A3B G;  2AQ1 B;  4FXG C;  3A54 A;  3K0Y A;  4IAL A;  1HR0 L;  5IYB G;  4BA2 I;  2B8F A;  4YCW A;  3PGZ A;  1X54 A;  3VDY A;  4DAV A;  1K83 B;  1OXT A;  2OXP A;  1H9S A;  3CW2 C;  4FXK C;  3CC4 A;  2R92 B;  1BCP D;  2QIL A;  4KV6 A;  1KNA A;  3KJP A;  2LMC B;  4A3K H;  1N36 L;  3HKZ B;  3T51 B;  1WYD A;  2NZO A;  2F3V A;  4B3R L;  1U5K A;  4MHE A;  2GN5 A;  3H3V I;  1YNN C;  2WII B;  4RGM A;  2VW9 A;  1SE8 A;  4IUU A;  2CCZ A;  3BG3 A;  1U4M A;  3SGI A;  2K28 A;  4CKB A;  1BCP B;  3NEM A;  3D3R A;  2F0H A;  3UDG A;  1WCM B;  2Z6B A;  2JA9 A;  4DR6 L;  1Q1B A;  1IBM Q;  3KF6 B;  3EA6 A;  4GKK L;  1BXT A;  2ZM6 L;  2AUK A;  2WKC A;  3L9A X;  4BY7 B;  1EL0 A;  1J9O A;  3A7L A;  4ID6 A;  5JOB A;  1KRS A;  1LLR D;  1F9Q A;  2G9H D;  4B3T L;  2QCP X;  1VQP A;  4LF9 L;  3S2H B;  1Z7T A;  2NVT H;  1EYG A;  2Z6K A;  3A5Z B;  3DWA A;  1C48 A;  1GD7 A;  5D14 A;  5J1Z A;  1BQQ T;  1PYS B;  1WTO A;  3IFD A;  1XTD A;  1VQO A;  3DWP A;  1K83 H;  4AYB E;  4CJ2 C;  3AEV A;  1HNX L;  4DFA A;  2PI2 A;  5D65 A;  4A3I H;  2O2L D;  2R92 H;  1IYU A;  5M3M G;  1KLG D;  2WP8 J;  2HCI A;  4OO1 H;  3RN2 A;  1WTP A;  1XYI A;  3DHQ A;  1GUW A;  3Q6S A;  3CAM A;  4KN4 C;  3MAQ A;  4PZ8 A;  2VUM H;  2A8V A;  4K14 A;  2RDF A;  3RNU A;  1E22 A;  4GNX B;  4CHT B;  1A15 A;  2DUD A;  1WD1 A;  3D8G A;  1KXL A;  2M00 A;  4A3B B;  2CKZ B;  1XMQ Q;  4M1U B;  1S3O A;  1WCM H;  2BE5 D;  1QUQ A;  1PH1 A;  2K1B A;  4G7Z C;  5DM6 3;  3T1H L;  5M5W B;  2M2L A;  1K8A C;  5KGU A;  4P73 A;  5C44 G;  1YJ9 A;  1FD7 D;  2KOL A;  5C4X H;  1CA5 A;  5IWA Q;  4BY7 H;  2JYO A;  3PUX A;  5A2Q L;  1KRT A;  1BBW A;  3DLL A;  3MFY A;  2L11 A;  1ML0 D;  2EPB A;  2MO0 A;  4ZAI A;  1YJW A;  4KN7 C;  4NP5 A;  2AQ2 B;  4YY3 Q;  5ELC A;  4QIW B;  2PZU A;  3CQZ B;  3K58 A;  1X9N A;  2D5D A;  3R2I A;  1SND A;  1SSO A;  1HR0 W;  1MI2 A;  2I5L X;  3W5O A;  3T16 A;  1STB A;  1TWA H;  2QGQ A;  2A5H A;  3SHL A;  2ALY B;  4L63 B;  2OTL A;  4F8M A;  3CCJ A;  2CH4 A;  3OHX C;  1BKB A;  2JSO A;  1CT1 D;  4A3J G;  4DV4 Q;  5C5L A;  3A5U A;  1I4G A;  5HUR A;  2B2U C;  1IBM L;  4JI1 L;  2LFN A;  2CW0 C;  2FXQ A;  3P1H A;  3KLS X;  3U4Z A;  1KDC A;  1QVG A;  3KLW A;  5JEA H;  1JJC B;  1VQ9 A;  4YHH L;  4A3B H;  1X3G A;  4RGT A;  2IJ0 A;  4DAY A;  2JP1 A;  1S5F D;  1G2T A;  2X6L A;  3GDE A;  1NUC A;  4U68 A;  3HOZ B;  1D1I A;  1SYG A;  1IKM A;  2UXC Q;  1DOK A;  5FLX E;  2R93 G;  1NR2 A;  1E3P A;  1RKN A;  5EPK A;  4OXP A;  5JPM C;  5CGK A;  5M3M B;  1HQM C;  1KAB A;  3CXC A;  1O7L A;  4DAP A;  2H4O A;  4HAE A;  2PQA B;  3PO3 B;  4C3I H;  3UDI A;  2DGY A;  4LF7 Q;  2EY5 A;  3V96 A;  4JBM A;  4MIU A;  2QDL A;  4QUC A;  1VQN A;  2ZJR A;  1DZ1 A;  1B53 A;  1WOC A;  4DGZ A;  2R3Z A;  1XJV A;  4DV3 L;  1LT3 D;  1HNW L;  4A93 G;  4HJ8 A;  5JAV A;  2RDH A;  1Y1W G;  3SK8 A;  5C44 B;  4ZLT F;  4R4C A;  2UU9 Q;  1W6J A;  4RWS C;  1LAC A;  2R6G A;  1VQL A;  1K3R A;  1SMY C;  1V43 A;  2B2Y C;  1TKW B;  4LMQ D;  4GLV B;  4AH6 A;  1F2Z A;  4PMB A;  2UUA L;  1HZA A;  3IKJ A;  2M9V A;  4XDX A;  2PZW A;  2KEN A;  2A68 D;  4K8J A;  1SYC A;  1X56 A;  4RKB A;  5G3L F;  4YY3 L;  4BWG B;  4BY1 G;  1IHZ A;  3GO5 A;  3NTI A;  1BCP C;  3AFQ A;  4ZQ3 A;  4K5W A;  4L8J A;  5M3M H;  4A3L H;  3KLS A;  4A3J B;  1F9P A;  3GTO B;  3I72 A;  2RSO A;  5FLM G;  3G6E A;  4XYO A;  3RZD B;  4IFD H;  1VDZ A;  2X6G A;  2ICI A;  1ESF A;  4C3J G;  1TWF B;  5IYC G;  2UXB Q;  3GTL H;  4LFB Q;  4EQO A;  1X3E A;  4QQB X;  1VQ4 A;  2VQF Q;  5CBA E;  1CI3 M;  1C8C A;  1Q1E A;  3CCU A;  1J6Q A;  4FF2 A;  5LMU L;  2D0O A;  5F2D A;  4KK7 A;  1JJG A;  2R93 B;  4ZRZ A;  2JE6 I;  1D2B A;  2B8G A;  4Y7N B;  1O7Y A;  1BO0 A;  3K0X A;  2EYM A;  4DV2 L;  3I4M G;  1VQD A;  3BVZ A;  2A74 C;  1VQC A;  4GNX C;  4LF8 L;  4FF3 A;  3M9B A;  4JYA Q;  4LF7 L;  1JB7 A;  5KNB A;  2ZT9 C;  1ENC A;  1Z9F A;  1S5E D;  2KCC A;  3M4P A;  4IPH A;  2WAQ E;  2ATW A;  3BYT B;  1SJE D;  4XT1 B;  1I94 Q;  3CPF A;  4A93 B;  1DXM A;  1EFI D;  1V1P B;  4A3J H;  3MXN B;  3GTO H;  1OXX K;  4CKC A;  3IL8 A;  1Y1W B;  4PMC A;  1MIU A;  1TXY A;  2PO4 A;  3RZD H;  2UU9 L;  3RZO B;  2KHJ A;  1C7Y A;  2BE5 C;  1TWF H;  4RHR A;  4RMF A;  1IBK Q;  3KBX A;  1AH9 A;  2F0E A;  1SDF A;  1G29 1;  3GV6 A;  2VL6 A;  5J39 A;  2HUG A;  4LF4 Q;  4BY1 B;  3MEF A;  1QB5 D;  1MD2 D;  3LGJ A;  4UHV A;  4HID A;  4Y7N H;  4O42 A;  1TY0 A;  1Q3L A;  4RGN A;  2SDF A;  4NXM Q;  4FVM A;  5JEA J;  4HTH A;  2CH4 W;  4DV6 Q;  3N52 A;  1G51 A;  3PV0 A;  4HMI A;  3W2D A;  1GUT A;  3KDF A;  1SE2 A;  5EGT A;  3FKI G;  2HDL A;  3UI2 A;  1I6H B;  1LTL A;  2B2Y A;  4C56 C;  3OTO L;  3SR1 A;  4A93 H;  1WI5 A;  4X3S A;  1EIH A;  4IO9 A;  5A35 A;  3OIQ A;  2BDO A;  1Y1W H;  1SNP A;  2JEA I;  3ER0 A;  5C0X J;  5KYI A;  5IYD G;  1ET9 A;  4B08 A;  1PFS A;  2NVQ B;  3MC0 B;  1A3T A;  1QJO A;  4PMW A;  5C0X I;  1IW7 D;  3RZO H;  4JI4 L;  4RHS A;  4XQN A;  3KF6 A;  3Q22 A;  1YNX A;  5DNF A;  5E1F A;  3QOJ A;  2DNC A;  4RGO S;  4XTC S;  5EKI A;  3LWU A;  3DUZ A;  1QVF A;  2NTS A;  2AWO A;  5IOD A;  3C1E A;  4JI5 Q;  1Q86 C;  3N6R A;  2K52 A;  3NEL A;  1HFN A;  1E2W A;  1QG7 A;  2KEE A;  3O13 A;  1II3 A;  5FLM H;  1KIX A;  2JJQ A;  2KHS A;  1SYF A;  4HSV A;  1SYE A;  3S15 B;  4LNQ A;  3TEH B;  4IOC A;  2E74 C;  4C3J H;  1E1T A;  3OMC A;  4KKS A;  1U4P A;  4AYB G;  2JA5 G;  3G7L A;  5IYC H;  1SFO B;  1I6H H;  4EX5 A;  4QCL A;  1WTW A;  1J5E L;  4DR7 Q;  4NKL A;  1RDP D;  4ZCK A;  5JJI A;  1KTK A;  4OGQ C;  5CYU A;  4H7B A;  4L5S A;  4KD4 A;  1CHP D;  1MKH A;  1QNU A;  4FDB A;  4GNX A;  1S5D D;  4H13 C;  4TKO B;  2NVQ H;  5CV7 A;  2A73 B;  1HA6 A;  2I0Q A;  5M3F G;  1ASZ A;  2A68 C;  3S16 H;  1MHW C;  3HOV G;  2NN6 I;  3I4M H;  4EQN A;  4NXM L;  3K6O A;  4CDE C;  2G9D A;  3P7J A;  5IGE A;  1BDO A;  3BVG A;  1EY0 A;  4AQY L;  3R8B A;  3H6M A;  1UNS A;  3FKI B;  2F0P A;  4ZKB B;  1JJ2 A;  1TWG B;  4A3G G;  3BDL A;  3SEB A;  4IJL A;  4GLA C;  2XRQ D;  3PSI A;  4JBK A;  3HOY G;  2RBM A;  4G7H C;  1ICF B;  5K5P A;  4A3M G;  3MXP A;  2I5M X;  3I7F A;  3CCL A;  1T9H A;  4CJ0 B;  1QNK A;  2HHH Q;  1WTQ A;  3S15 H;  1VF7 A;  3HZX A;  1SLJ A;  1D5Z C;  3JAM L;  1N33 L;  1TWC H;  4DV5 Q;  3FVQ A;  2HIX A;  2L1B A;  2FMM A;  4DV7 Q;  4GKJ Q;  4DUY L;  4TQU S;  4ZYS A;  1VQA A;  5GAH C;  4P2C B;  3I70 A;  5C4Z A;  4X3K A;  4X3U A;  1A63 A;  1SE4 A;  1PH5 A;  4K6L A;  2WB1 E;  1M4V A;  3OWE B;  4B9X A;  5FO8 B;  1Y8O B;  4LFC L;  4IZ8 A;  1IBL Q;  1C9O A;  2UXD Q;  4DR2 L;  3HOX B;  1D8L A;  3I4L A;  3UDX A;  4YWK A;  2EYP A;  1XNR Q;  1KHI A;  3PO2 G;  2WIN B;  3FKI H;  4AYB B;  2K33 A;  2JA5 B;  1TWG H;  2PQA A;  2N88 A;  1A6X A;  3U50 C;  2R7Z B;  1BUV T;  1KNE A;  2GVB A;  1EIG A;  3CF5 A;  1G6P A;  4NPS A;  2EYL A;  2DY7 A;  4N8X 1;  1PZI D;  4A3I G;  5IYD H;  1HHV A;  1EY5 A;  1VQ5 A;  1Q90 A;  4MTK A;  2F0N A;  4BBR B;  5M3F B;  3S17 H;  1V9P A;  4DR5 L;  1CUK A;  4B3R Q;  1NR4 A;  3HOV B;  5LHY 1;  1U0L A;  2EJF C;  2E5L L;  2PI2 E;  1LYL A;  1WJJ A;  4DAM A;  1S4Z A;  4JI6 L;  3PQI A;  3VA5 A;  2EZV A;  2O5I C;  2L55 A;  2XTI A;  3K59 A;  1C0A A;  5CMD A;  1X32 A;  3RR5 A;  3T4A C;  4DR6 Q;  1KLU D;  2Q2H A;  1CKO A;  4A3G B;  2ZM6 Q;  4DN4 M;  1GXD C;  1XPR A;  4IPD A;  3HOY B;  2A6E D;  1R9T B;  2F4V L;  4A3M B;  2Z4H A;  4B3T Q;  1JC7 A;  3CHB D;  4XQJ A;  5JPN C;  3ICE A;  1OXS C;  5BN3 A;  3HKS A;  2ZTC A;  1STH A;  1LT6 D;  4B3M L;  4M8A A;  2K5Q A;  1QCB D;  1VQM A;  4A3K B;  4IUN A;  3F2B A;  2JA5 H;  5C4J B;  3FMC A;  4R8I A;  3TRE A;  2B2V C;  5KIX A;  3KF8 B;  5CBE E;  5CV9 A;  4X66 L;  4GKJ L;  1HTP A;  4KI0 A;  1U4R A;  3GTK B;  1ICW A;  1IW7 C;  1JOK A;  1N8R C;  3U9S A;  2K32 A;  1HH2 P;  4J15 A;  4DPG A;  3A56 A;  5M3F H;  5I2Y A;  4KKU A;  4LUO A;  4WOR A; 
#chains in the Genus database with same CATH homology
 1F2L A;  3CU7 A;  1PZJ D;  4ZUJ A;  1PFM A;  3PO2 B;  3GD7 A;  5FO9 B;  3PIO 3;  1TS2 A;  4YIJ A;  2IT1 A;  1A2T A;  4XIG S;  5CV5 A;  1EU3 A;  4IUR A;  4A3I B;  2FFK B;  1ONL A;  2QDB A;  3C2P A;  2F0S A;  1DOL A;  1JIC A;  1RTN A;  4DK1 A;  2ID0 A;  1CM9 A;  1YNJ D;  2EY6 A;  1PTO F;  4C3I G;  1V1P A;  3M4O B;  4FYD A;  3I91 A;  3GV3 A;  4KY5 A;  2VUM B;  4J6H A;  3NTH A;  1BBX C;  3PIP 3;  5K36 G;  4C2M B;  1FNV A;  2F0W A;  4FP5 D;  1PFB A;  3VYR A;  3QIA A;  3SE0 A;  4HR7 B;  4JK1 C;  3H09 A;  5C4X B;  1EYA A;  4DNT B;  1SXT A;  4IQZ A;  1PYW D;  1WTR A;  5EPL A;  1STE A;  2EVB A;  1LAB A;  2B39 A;  4HMJ A;  1BOS A;  5IGB A;  3A8I E;  5HGT A;  2RA4 A;  1AZQ A;  1TVX A;  2F0V A;  3WDN A;  1TWA B;  1CA6 A;  3VR6 A;  3TBI B;  3Q23 A;  2SOB A;  2A69 D;  4UAI A;  2BA1 A;  3GQB A;  4IFD G;  1JB3 A;  3S14 B;  3TSS A;  1UEA B;  5IGG A;  3NTK A;  4KY6 A;  2D2C C;  3P20 A;  1M8A A;  1FR3 A;  2KVM A;  2LKV A;  1PDQ A;  1F77 A;  3HGB A;  2IX3 A;  3RD4 A;  2D62 A;  1IKL A;  1GUS A;  4F88 A;  3NP8 A;  4C3I B;  2B2W C;  3DEO A;  1MGS A;  3BDC A;  2IX0 A;  3KBG A;  4CBV A;  1KDA A;  1JE4 A;  2F0M A;  5D3D A;  2B2T C;  1Z47 A;  3CRK C;  1RTO A;  1Y8P B;  2RQX A;  5J22 A;  1DOM A;  5EKL A;  1GOZ A;  3FPP A;  4G57 A;  3AU7 A;  1HTL D;  3NHH A;  1GUG A;  3K7A B;  1B3A A;  1B44 D;  3VR2 A;  5EQ0 A;  1S5B D;  3QB3 A;  5CV4 A;  5EPJ A;  2SEB D;  4BS9 A;  3MEH A;  2HCC A;  3SXH A;  4A3F B;  4ABN A;  2EY2 A;  1EYC A;  2NTT A;  3S1R B;  3KK7 A;  2D9U A;  1EEI D;  1ENF A;  1EWH A;  4TSS A;  3GTL B;  4K5X A;  5K36 H;  4MN3 A;  1X3P A;  2JA6 B;  3NE5 B;  1STG A;  1AZP A;  1LTR D;  3K5L A;  1Y8N B;  2EJM A;  2WKD A;  5CV8 A;  3LWE A;  1T5E A;  2EOT A;  3HG9 A;  2PPB C;  2OF1 A;  1O78 A;  1CHQ D;  2PW7 A;  1PMR A;  3NQT A;  2Y0S B;  1FNW A;  2CVR A;  3JAM E;  5T1I A;  3SVM A;  1LV9 A;  5EKK A;  1EY4 A;  2XWJ B;  1DYQ A;  1L0X B;  3GTJ B;  2HDM A;  4WFN 3;  4RCN A;  5KRU A;  3VR5 A;  3BVM A;  3NUC A;  2RDG A;  2KCN A;  2B2W A;  2QF7 A;  2HQE A;  3FRP B;  3VR4 A;  1B9N A;  4OO1 I;  1Y69 U;  1VMP A;  5BN4 A;  4KTA A;  3A7A B;  3A8K E;  2B2U A;  2K05 A;  1STA A;  3A8J E;  3QOL A;  3J81 L;  5FKA C;  4DNR B;  2F0G A;  1STN A;  4ZKC B;  3KF8 A;  4OIK A;  4KHZ A;  2L12 A;  5IOC A;  4DXF A;  1H9S B;  1V1O A;  3S9W A;  4FF4 A;  5ELE A;  5E4W C;  5EBD A;  1LTI D;  1SNC A;  3GTP B;  1PTO D;  1CFM A;  4RKL A;  1B2T A;  1I50 B;  1I4Q A;  1H9M A;  1GHJ A;  3M7G A;  2TMP A;  1PZK D;  3VYU A;  1UAP A;  3NWT A;  4FO2 A;  2EYF A;  1AP0 A;  1A2U A;  1VMC A;  4TRD A;  1SYB A;  4PV1 C;  3RLF A;  3NPP A;  2EY1 A;  3HS0 C;  3DM1 A;  4C3J B;  1TWH B;  2F0O A;  1JWU D;  5I2X A;  5I6W A;  1G91 A;  2F0F A;  3QG1 A;  5FOB B;  3WOF A;  1SEB D;  3MXG A;  1ZYR D;  2MGS A;  3IFT A;  3S16 B;  1SE3 A;  2FJ2 A;  1AN8 A;  3I4M B;  1LT5 D;  1F9S A;  4Q5V A;  3QWN A;  5IGF A;  2KQ3 A;  4HN7 A;  3NSW A;  2MP1 A;  2V4D A;  2F03 A;  5I9O A;  3SK4 A;  1FNU A;  1XTC D;  2KEC A;  2A6H D;  3SK5 A;  1TR5 A;  2RKS A;  3D6W A;  4KY7 A;  1PTO H;  4C3H G;  1BF4 A;  4K6D A;  3J80 L;  3TN2 A;  2MHV A;  1SYD A;  2F0I A;  1CTM A;  1TWC B;  4OHJ A;  4EQP A;  1PXU A;  4G7O C;  4RFB A;  2DN8 A;  1F2M A;  3L7Z C;  1IL8 A;  1NAP A;  1TS5 A;  2F0K A;  2FIN B;  1EY9 A;  3MHB A;  1JWM D;  4XXE A;  2OT2 A;  2EXZ A;  4IFD J;  3T53 B;  2FMC A;  1QOH A;  5KEE A;  1AEX A;  3J7A V;  2OEO A;  4IFD I;  2Q8I B;  3ONA B;  4ULL A;  3VYT A;  3D6C A;  3I8Z A;  3GTG B;  1TT2 A;  1YNN D;  2K03 A;  2IW3 A;  2NZ1 D;  3BZD B;  3D4R A;  2KED A;  3S17 B;  5JJZ A;  4QB4 A;  4V19 0;  3MVV A;  2K04 A;  1SAP A;  4DXG A;  5JVG 3;  1VF5 C;  1MSG A;  3TZD A;  5IT9 L;  4K8I A;  5EBC A;  1RJT A;  3Q0A A;  3PUW A;  3DXJ C;  4FF1 A;  4K2L A;  3MXU A;  1I6V C;  5ISR A;  4WRD A;  5A2Q E;  4BA1 I;  1PRT F;  1EQV A;  3KUP A;  1Q12 A;  4B9W A;  1C4Q A;  2F0J A;  4CGY B;  4K2K A;  4R9W A;  5ELD A;  3K57 A;  4NW2 A;  1JQY D;  2PQE A;  3D4D A;  1SNM A;  3V2T A;  1HRJ A;  1PTO C;  3H91 A;  4X3T A;  2L5T A;  3LX0 A;  3K5N A;  3M3Y B;  2VB2 X;  1U4L A;  1A3U A;  3HOU B;  3VR3 A;  1CQV A;  3J7A F;  3TP7 A;  1HUM A;  5I4D A;  1JOO A;  1KDB A;  2K5D A;  2PW5 A;  4XT3 B;  1G6Z A;  4Z9C B;  1EY6 A;  3H0G B;  4HED A;  2CW0 D;  2EE1 A;  1EWC A;  1E2V A;  2BDN A;  3E6Z X;  2C9O A;  3ITP A;  1HXY D;  3CKI B;  2PNR C;  1PLF A;  1ZYR C;  2ENB A;  3GTM B;  3TME A;  4IUV A;  3EVQ A;  2JEB I;  2AWN A;  3W3A A;  1O7Z A;  2K5W A;  4H44 C;  4HCS A;  3FEW X;  1I3Q B;  1K8O A;  2F3W A;  3D31 A;  4HCE A;  3T13 A;  2KA7 A;  2N55 A;  3EQL C;  4J8Q A;  1H9K A;  3T56 B;  2JXM B;  5LL6 S;  1I4R A;  2Q8R E;  1LTT D;  1HCZ A;  1NSN S;  3DWQ A;  1ZEQ X;  1LTG D;  5C4H A;  3OPO A;  1T5X D;  3MFG A;  2I46 A;  2Q8T A;  1SMY D;  2TSS A;  1I4H A;  4KHV A;  4XQQ A;  3MXN A;  2SNM A;  1FYC A;  1D5X C;  2E75 C;  1B50 A;  2DY8 A;  3RUZ A;  4RCO A;  5C0X G;  3E5S A;  3K5O A;  3OIP A;  5NUC A;  3NQI A;  4IUT A;  2F1M A;  4I7Z C;  2J7Z A;  2XSC A;  3FDT A;  3G6J B;  1X3Q A;  4I65 A;  4RA8 A;  4KD3 A;  2E2D C;  2JA7 B;  2ZXR A;  2IX1 A;  3J81 E;  1HQR D;  3IAY A;  1PFN A;  2L4N A;  1FGB D;  2NVX B;  3S1N B;  4A3D B;  1CZG A;  1U9R A;  4FNF A;  3NBI A;  4C1N I;  2BCO A;  1EOT A;  3S2D B;  5CR3 A;  1KAA A;  1JOR A;  2F0D A;  1TY2 A;  1XXG A;  4LK1 C;  3BYY B;  4ZK9 B;  4F7X A;  2F4I A;  2NN6 G;  1MBY A;  3QJY A;  2B2V A;  2NB0 A;  1TQO A;  4O1N A;  1E0B A;  2XVS A;  2WAQ B;  2LY7 A;  4N9T A;  2PZT A;  3R93 A;  3F2U A;  1JR0 D;  2YU9 B;  2MPM A;  1XX8 A;  1QIL A;  3M85 A;  4JBW A;  2XWB B;  3GP7 A;  3OSO A;  1LO5 D;  1D5M C;  2FHT A;  1B1Z A;  1EYD A;  2EDG A;  1STY A;  1ZXT A;  4WJW A;  3PUY A;  1MSH A;  3SK6 A;  2I07 B;  4IUP A;  3J7Y W;  3TP5 A;  2E2J B;  2Z1C A;  4H0L C;  2A6E C;  3I90 A;  4DK0 A;  3OWF A;  3E0J A;  2MUY A;  4EGV A;  4G4K A;  1ENA A;  4A3E B;  3A55 A;  5C5M A;  3EJI A;  5I9P A;  3J80 E;  3PUV A;  2NBF A;  4LAA A;  2JA8 B;  1W6K A;  3OMG A;  3HOW B;  3NWS A;  2NVY B;  5JVH 3;  3BDO A;  1PRT D;  2SNS A;  3ND9 A;  1Y1V B;  2YYZ A;  2XRS D;  3TZU A;  2WV6 D;  5C0X H;  4KJN A;  4F87 A;  4QMG A;  3DEP A;  1LTB D;  1EZ8 A;  5IGC A;  2AQ3 B;  2O5J C;  3HEJ A;  1JCK B;  1PRT B;  3QO2 A;  4NMZ A;  2ICE C;  2VB3 X;  3X3N A;  1Z6H A;  1RCV D;  2NYZ D;  4E6I A;  5C3W A;  1HPC A;  1V8Q A;  1OXU A;  4PNY A;  3VA7 A;  1YNJ C;  1TU2 B;  1SJH D;  2O4X A;  2QKI C;  3C46 A;  4OIJ A;  4ZUI A;  1ESR A;  5IIF A;  2BA0 A;  5FO7 B;  1ILP A;  1WTX A;  3ND8 A;  5T1G A;  3EFX D;  5IT9 E;  1AW7 A;  4GZY C;  1NCV A;  2NN6 H;  5M5Y B;  1F9R A;  4XYQ A;  2KJX A;  2B2T A;  3ERO A;  1JWS D;  2IL8 A;  1JOQ A;  4CJ1 B;  1LT4 D;  5E3F A;  2Z8L A;  1CQF A;  1F2Y A;  2A69 C;  5DM7 3;  4PQX A;  3TDQ A;  4Q0F A;  2R61 A;  4UDU C;  5KND A;  2F0U A;  1ILQ A;  1XWE A;  1BR9 A;  2KUM A;  1EQT A;  1TS4 A;  3SDZ A;  3URY A;  3CRL C;  3MWY W;  4R8N A;  4K5V A;  4N9P A;  1R4P B;  5CC4 A;  5DEH A;  2J0T D;  2C5C A;  2NUC A;  2AUJ D;  1DJR D;  4KMU C;  2XIW A;  2WB1 B;  1SNQ A;  3TP6 A;  2LS0 1;  3WOE A;  1DON A;  1R4Q B;  3HP3 A;  1DD2 A;  3DMU A;  1EEF D;  1PTO B;  4L6T B;  1J8I A;  3P75 A;  3ERQ A;  3C1F A;  3S1Q B;  3NK9 A;  1BCP F;  4LJZ C;  2EYO A;  5E4X A;  5DAU A;  1K8M A;  2EYH A;  2ZXO A;  1LTA D;  4KJO A;  1ET6 A;  5C3X A;  1L0Y B;  4KKT A;  3AB9 A;  3OOC A;  2BOS A;  3GTQ B;  1D6E C;  4J1M A;  3L3O C;  5LL6 X;  1GUN A;  1EY8 A;  2E2H B;  2XN9 C;  4ILW A;  5FK9 C;  3U9O A;  1B4O A;  4ODG A;  1A3V A;  3FPU B;  2CQA A;  3TP8 A;  1PRT C;  5C6A A;  2X69 A;  1ZKO A;  4DA2 A;  3MA2 B;  1WTV A;  3R2T A;  3I73 A;  4HSP A;  5FLX L;  3HRZ C;  2QEJ C;  1HUN A;  2F0Q A;  3PMF A;  2RVL A;  4NDX A;  4U67 3;  3AMU A;  4RAU C;  1I4P A;  3RMH A;  1QWY A;  3MZ5 A;  3NBH A;  2J4X A;  2RSN A;  2ZXP A;  4C1N K;  2NWG A;  2F0T A;  1CZW A;  1B9M A;  2B63 B;  4RH6 A;  4QUF A;  1SBB B;  5ELF A;  5EJW A;  2K01 A;  1GUO A;  3C3L A;  3H94 A;  5C3E B;  2XNA C;  5TSS A;  4ME5 A;  3LNN A;  2MJ8 A;  1CK1 A;  4S3S A;  5M9O A;  1SNO A;  1GHK A;  2IWH A;  1EU4 A;  3I4N B;  1EZ6 A;  4V0B A;  3R3O A;  3S1M B;  4IN3 A;  2VXW A;  1VCI A;  3PUZ A;  2Z4I A;  3M4Y A;  5I6Y A;  2F0L A;  4C3H B;  2VNU D;  1H9R A;  1DM0 B;  5CV6 A;  2K6A A;  1I4X A;  1ROD A;  4FXD A;  3M7N A;  1TS3 A;  1DCZ A;  4OL7 A;  1WD0 A;  5COY A;  1HA5 A;  1AFP A;  2EJG C;  1RD9 D;  3NXW A;  1RHP A;  3MTS A;  2IPK D;  5M5X B;  5G3L D;  1LTS D;  2K7V A;  5AFW A;  3Q24 A;  1BNZ A;  1H9J A;  4IUQ A;  1G2S A;  4OO1 G;  3X3M A;  1GJX A;  2GA4 B;  1OO9 B;  1UUP A;  2E76 C;  1EY7 A;  5COR A;  1D1K A;  1O80 A;  1TII D;  5KNC A;  1HFG A;  4EVO A;  3VYS A;  3KLR A;  2L9H A;  2PMZ B;  2DNE A;  5BN5 A;  1QE6 A;  5D3I B;  4CKE A;  2PCF B;  4DU9 A;  2WAC A;  1OXV A;  1Q8I A;  2CHB D;  2E2I B;  4QF4 A;  5IGD A;  1S5C D;  5KYL A;  3H3V C;  5ELB A;  1G8Z D;  4DF7 A;  2A6H C;  1WVL A;  3OW7 A;  3I3C A;  1RF2 D;  3D4W A;  3K5M A;  2L0C A;  1E2Z A;  3BS1 A;  2PYK A;  2EYJ A;  5JEA G;  4BBS B;  2H1E A;  1IYV A;  2NVT B;  3V05 A;  3ZYY X;  2AQ1 B;  4FXG C;  3A54 A;  3K0Y A;  4IAL A;  4BA2 I;  2B8F A;  4DAV A;  1K83 B;  1OXT A;  2OXP A;  1H9S A;  4FXK C;  2R92 B;  1BCP D;  2QIL A;  4KV6 A;  1KNA A;  2LMC B;  3HKZ B;  3T51 B;  2F3V A;  4MHE A;  1YNN C;  2WII B;  4RGM A;  4IUU A;  3BG3 A;  1U4M A;  2K28 A;  4CKB A;  1BCP B;  3D3R A;  2F0H A;  1WCM B;  1Q1B A;  3EA6 A;  1BXT A;  2AUK A;  2WKC A;  3L9A X;  4BY7 B;  1EL0 A;  1J9O A;  5JOB A;  3A7L A;  4ID6 A;  1LLR D;  1F9Q A;  2G9H D;  2QCP X;  3S2H B;  1Z7T A;  3DWA A;  1C48 A;  5D14 A;  5J1Z A;  1BQQ T;  1WTO A;  3IFD A;  3DWP A;  4CJ2 C;  4DFA A;  5D65 A;  2O2L D;  1IYU A;  1KLG D;  2WP8 J;  2HCI A;  4OO1 H;  1WTP A;  1XYI A;  3DHQ A;  1GUW A;  3Q6S A;  4KN4 C;  3MAQ A;  4K14 A;  2RDF A;  4CHT B;  1A15 A;  1WD1 A;  3D8G A;  2M00 A;  4A3B B;  4M1U B;  2BE5 D;  2K1B A;  4G7Z C;  5DM6 3;  5M5W B;  2M2L A;  5KGU A;  1FD7 D;  2KOL A;  1CA5 A;  2JYO A;  3PUX A;  5A2Q L;  3MFY A;  2L11 A;  1ML0 D;  2EPB A;  4ZAI A;  4KN7 C;  4NP5 A;  2AQ2 B;  5ELC A;  4QIW B;  2PZU A;  3CQZ B;  3K58 A;  2D5D A;  3R2I A;  1SND A;  1SSO A;  1MI2 A;  3T16 A;  1STB A;  2A5H A;  3SHL A;  4L63 B;  4F8M A;  3OHX C;  2JSO A;  1CT1 D;  5C5L A;  1I4G A;  5HUR A;  2B2U C;  2LFN A;  2CW0 C;  3P1H A;  3KLS X;  1KDC A;  5JEA H;  4RGT A;  2IJ0 A;  4DAY A;  2JP1 A;  1S5F D;  1G2T A;  2X6L A;  1NUC A;  4U68 A;  3HOZ B;  1D1I A;  1SYG A;  1IKM A;  1DOK A;  5FLX E;  1NR2 A;  1RKN A;  5EPK A;  5JPM C;  5CGK A;  5M3M B;  1HQM C;  1KAB A;  1O7L A;  4DAP A;  2H4O A;  4HAE A;  3PO3 B;  2EY5 A;  3V96 A;  4MIU A;  4QUC A;  1DZ1 A;  1B53 A;  4DGZ A;  2R3Z A;  1LT3 D;  5JAV A;  2RDH A;  3SK8 A;  5C44 B;  4ZLT F;  1W6J A;  4RWS C;  1LAC A;  2R6G A;  1SMY C;  1V43 A;  2B2Y C;  1TKW B;  4LMQ D;  1F2Z A;  4PMB A;  3IKJ A;  2M9V A;  4XDX A;  2PZW A;  2A68 D;  4K8J A;  1SYC A;  4RKB A;  5G3L F;  4BWG B;  1IHZ A;  3GO5 A;  3NTI A;  1BCP C;  4ZQ3 A;  4K5W A;  4L8J A;  3KLS A;  4A3J B;  1F9P A;  3GTO B;  3I72 A;  2RSO A;  4XYO A;  3RZD B;  4IFD H;  1VDZ A;  2X6G A;  2ICI A;  1ESF A;  4C3J G;  1TWF B;  4EQO A;  5CBA E;  1CI3 M;  1C8C A;  1Q1E A;  4FF2 A;  5F2D A;  4KK7 A;  2R93 B;  4ZRZ A;  2JE6 I;  1D2B A;  2B8G A;  4Y7N B;  1O7Y A;  1BO0 A;  2EYM A;  3BVZ A;  2A74 C;  4FF3 A;  5KNB A;  2ZT9 C;  1ENC A;  1S5E D;  2KCC A;  3BYT B;  1SJE D;  4XT1 B;  4A93 B;  1DXM A;  1EFI D;  1V1P B;  1OXX K;  4CKC A;  3IL8 A;  1Y1W B;  4PMC A;  2PO4 A;  3RZO B;  2BE5 C;  4RHR A;  3KBX A;  2F0E A;  1SDF A;  1G29 1;  3GV6 A;  5J39 A;  2HUG A;  4BY1 B;  1QB5 D;  1MD2 D;  4O42 A;  1TY0 A;  1Q3L A;  4RGN A;  2SDF A;  4FVM A;  5JEA J;  4HTH A;  3N52 A;  3PV0 A;  4HMI A;  3W2D A;  1GUT A;  1SE2 A;  5EGT A;  2HDL A;  3UI2 A;  1I6H B;  2B2Y A;  4C56 C;  3SR1 A;  4X3S A;  1EIH A;  5A35 A;  3OIQ A;  2BDO A;  1SNP A;  2JEA I;  5C0X J;  5KYI A;  1ET9 A;  4B08 A;  2NVQ B;  3MC0 B;  1A3T A;  1QJO A;  4PMW A;  5C0X I;  1IW7 D;  4RHS A;  4XQN A;  3Q22 A;  5DNF A;  5E1F A;  3QOJ A;  2DNC A;  4RGO S;  4XTC S;  5EKI A;  3LWU A;  3DUZ A;  2NTS A;  2AWO A;  5IOD A;  3C1E A;  3N6R A;  1HFN A;  1E2W A;  1QG7 A;  2KEE A;  3O13 A;  1II3 A;  2KHS A;  1SYF A;  4HSV A;  1SYE A;  3S15 B;  2E74 C;  3OMC A;  4KKS A;  1U4P A;  3G7L A;  1SFO B;  4QCL A;  1WTW A;  4NKL A;  1RDP D;  1KTK A;  4OGQ C;  5CYU A;  4H7B A;  4KD4 A;  1CHP D;  1QNU A;  1S5D D;  4H13 C;  4TKO B;  5CV7 A;  2A73 B;  1HA6 A;  2A68 C;  2NN6 I;  4EQN A;  3K6O A;  2G9D A;  3P7J A;  5IGE A;  1BDO A;  3BVG A;  1EY0 A;  3R8B A;  3H6M A;  1UNS A;  3FKI B;  2F0P A;  4ZKB B;  1TWG B;  3BDL A;  3SEB A;  2XRQ D;  2RBM A;  4G7H C;  5K5P A;  3MXP A;  4CJ0 B;  1QNK A;  1WTQ A;  1VF7 A;  3HZX A;  1D5Z C;  3JAM L;  3FVQ A;  2L1B A;  2FMM A;  4ZYS A;  4TQU S;  4P2C B;  3I70 A;  5C4Z A;  4X3K A;  4X3U A;  1SE4 A;  4K6L A;  3OWE B;  1M4V A;  4B9X A;  5FO8 B;  1Y8O B;  4IZ8 A;  3HOX B;  3I4L A;  2EYP A;  2WIN B;  4AYB B;  2K33 A;  2JA5 B;  2N88 A;  1A6X A;  2R7Z B;  1BUV T;  1KNE A;  1EIG A;  2EYL A;  2DY7 A;  1HHV A;  1PZI D;  1EY5 A;  1Q90 A;  2F0N A;  4BBR B;  5M3F B;  1NR4 A;  3HOV B;  5LHY 1;  2EJF C;  1S4Z A;  3VA5 A;  2EZV A;  2O5I C;  2L55 A;  3K59 A;  5CMD A;  1X32 A;  3T4A C;  1KLU D;  4A3G B;  4DN4 M;  1GXD C;  3HOY B;  2A6E D;  1R9T B;  4A3M B;  2Z4H A;  1JC7 A;  3CHB D;  4XQJ A;  5JPN C;  1OXS C;  5BN3 A;  1STH A;  1LT6 D;  4M8A A;  2K5Q A;  1QCB D;  4A3K B;  4IUN A;  5C4J B;  3FMC A;  4R8I A;  2B2V C;  5KIX A;  5CBE E;  5CV9 A;  1HTP A;  4KI0 A;  1U4R A;  3GTK B;  1ICW A;  1IW7 C;  1JOK A;  3U9S A;  2K32 A;  3A56 A;  5I2Y A;  4KKU A;  4WOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...