1QG7A

Stroma cell-derived factor-1alpha (sdf-1alpha)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
SYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of recombinant native SDF-1alpha with additional mutagenesis studies: an attempt at a more comprehensive interpretation of accumulated structure-activity relationship data.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords STROMAL CELL-DERIVED FACTOR 1 ALPHA
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qg7A00
1XX8A 1B3AA 3MTSA 1ML0D 1C8CA 1HUMA 1U4RA 2JP1A 2RSNA 4O42A 5CBEE 5E4WC 4HEDA 1IL8A 1WTPA 1AZPA 2L11A 1MGSA 1A15A 5EQ0A 1O7YA 2K28A 1IKMA 2XIWA 2HDLA 2KUMA 1PLFA 1B53A 3KUPA 1PDQA 1BNZA 1F9SA 2NYZD 3G7LA 3H91A 1WTQA 1LV9A 1VMCA 3GV3A 3SVMA 4RWSC 4DN4M 2L12A 1SDFA 3I91A 4ZAIA 1EL0A 1NAPA 1RTNA 2RA4A 1CA5A 2N55A 2X69A 1O7ZA 1BBXC 3LWEA 1CA6A 1DOMA 1X3QA 2K01A 1WTXA 2B2VA 3D6WA 2EE1A 4QUFA 2K03A 1U4MA 2Q8RE 1EQTA 1HUNA 1NR4A 4NW2A 2HCCA 3ONAB 1E0BA 4X3KA 1HFNA 5E4XA 1RODA 4UAIA 1NR2A 2NZ1D 3GV6A 1WD1A 1AZQA 1QNKA 1G2SA 2EPBA 1WVLA 2MPMA 1ILQA 1JICA 1EOTA 2X6LA 3FDTA 3N52A 5T1IA 1WTVA 1WTWA 5EPJA 2B2YA 1J8IA 2RVLA 2K05A 4RA8A 2MP1A 4XT1B 3DEOA 4X3SA 1NCVA 1HHVA 3QO2A 1B50A 1DONA 1F9PA 2IL8A 1RJTA 1J9OA 2MGSA 1PFMA 4R9WA 2B2WC 2B2TA 3F2UA 1RTOA 2K04A 1MSHA 3HP3A 4LMQD 4OIKA 5D65A 2DY8A 1PFBA 1VMPA 1JE4A 2FHTA 2RSOA 3I8ZA 1KNAA 4IUPA 1F2LA 4CJ2C 4CJ0B 4R8IA 2HUGA 1S4ZA 2B2UC 2B2UA 2BDNA 2K1BA 5EKIA 2L9HA 1HRJA 5CBAE 2KEDA 5AFWA 1F9QA 2N88A 1X32A 4HAEA 1F9RA 1SAPA 2JYOA 2SDFA 4QUCA 1MI2A 4IUUA 1Q3LA 2B2TC 2B2WA 2X6GA 4X3UA 2HCIA 1MSGA 1HFGA 1U4LA 1IKLA 5COYA 5CORA 2FINB 3P7JA 1CM9A 4IURA 1HA6A 4MHEA 3TZDA 3UI2A 1QE6A 4ZKCB 5D14A 3FPUB 1EIGA 4RAUC 2B2YC 2J7ZA 3DM1A 3IFDA 4ZK9B 1G6ZA 4CJ1B 1B4OA 1PFNA 3I90A 2KVMA 3KBXA 2CVRA 1KNEA 4ZLTF 2KECA 2L1BA 1WTRA 4IUTA 1SSOA 4XT3B 1O80A 3IL8A 2FMMA 2HDMA 4MN3A 2DY7A 4U68A 3I3CA 4HSVA 1ZXTA 2D9UA 1DOLA 1X3PA 4ZKBB 2M2LA 4HCSA 1BO0A 1RHPA 5JJZA 2FFKB 5DNFA 1G91A 1AP0A 1QG7A 2B2VC 3DEPA 3TN2A 1WTOA 1GUWA 3MWYW 3R93A 1M8AA 1ESRA 1DOKA 1B2TA 2H1EA 4IUVA 4X3TA 1DZ1A 1XYIA 1U4PA 2R3ZA 1ICWA 5CMDA 4OIJA 5EPLA 2VXWA 5EJWA 2MJ8A 1BF4A 1G2TA 2KOLA 3Q6SA 1EIHA 5EPKA 4XDXA 2EOTA 5T1GA 2FJ2A 2L4NA 2NWGA 1WD0A 4IUQA 1ILPA 2Q8TA 1TVXA 2KEEA
chains in the Genus database with same CATH superfamily
1XX8A 3M3YH 3L7ZC 2Q2TA 1K8GA 4QL5A 4A3LG 4M8AA 5EQ0A 1TS3A 5C44G 1EY9A 1HZBA 3P75A 4OHJA 4DAMA 3H91A 1FYCA 4HTHA 4RH6A 2CWPA 1Z6HA 5BN3A 2L12A 5AJ3Q 4ZAIA 4ZUIA 4A3DB 2Z6BA 3SK5A 4KTAA 4RHRA 2CKZB 4JYAL 5CYUA 1CA6A 2B39A 2XRQD 2JA5H 4QUFA 4FF1A 4A3EB 2EYPA 1EY4A 1Y8OB 3JAMc 3U9SA 2Q8RE 3VA5A 2I0QA 2Q2IA 2NVTB 3LNNA 5EBDA 2K5QA 2EY5A 3NELA 3N52A 5T1IA 3E9HA 4ME5A 5BN4A 5HGTA 1EUJA 3S1NH 3S1QH 3HOXG 2YTXA 4X3SA 2EY6A 3MFGA 3SK4A 4IFDJ 1B8AA 1OXUA 2A1AA 3SEBA 5D3DA 2A69D 1S5CD 2ZJPA 3NK9A 2MQHA 1SFOH 1VQ7A 3HOVH 2F0LA 1G51A 2BDNA 2F3WA 2P5ZX 2PZUA 5C3XA 3HOYB 2F0DA 2OT2A 1EY8A 4KI0A 3FEWX 1CQVA 3NBIA 2MFIA 3M7GA 1DM0B 3A56A 3QIAA 3ULPA 3QB3A 4IJLA 4DV3Q 3GTOB 4R8NA 3WDNA 1VQDA 3GTOH 2PMZB 2UXBL 1PH1A 2KECA 1SNCA 4QMGA 3ER0A 5J1ZA 1YZ6A 4BBRH 2KHJA 3TRZA 5M5YB 3HOVG 1YITA 1A6XA 2CHBD 1K3RA 1G91A 2FFKB 5IT9E 1IW7C 3HOUB 3TN2A 1E2ZA 2B63H 3L9AX 3M9BA 1GUGA 1ONLA 5ISRA 4GZYC 2EYLA 1VQIA 1G2TA 3OIQA 1JE5A 2KHSA 2E5LQ 4GOPC 1I50H 4B08A 4P73A 4IPDA 1SR3A 1B7YB 4HEDA 3HGBA 1KL9A 1WTPA 2ASBA 1EYAA 1MJEA 3CCJA 1IKMA 2IW3A 5FJ8H 1SROA 2LXKA 2UUAQ 1SYEA 2XWJB 3RLNA 4P75A 4A75A 2BOSA 2R92G 1XPUA 3TMEA 5IGDA 2WAQB 3A7LA 1JR0D 3OIPA 3D8GA 4R1JA 2ID0A 2EIFA 1ZEQX 3DWQA 4AQYQ 1VQ9A 1DD2A 2DN8A 1CSQA 1BBWA 2NTTA 1STHA 1S72A 2E2HB 3EJIA 3K58A 2EXDA 2JA6G 1IBMQ 1TWHH 1WD1A 3PF5A 3D4WA 3RLOA 1Y1VB 3FDTA 1VF5C 4EGVA 4BBRB 2K5WA 4RA8A 1BQQT 5CC4A 2QCPX 4JVZA 3CC4A 2A69C 1IYUA 2JA5G 1QNUA 4OXPA 4JI7Q 1ASYA 3C46A 1EWIA 3I70A 1ZKOA 2ZM6Q 3S14B 1ET6A 5ELOA 2KCTA 5EKIA 2QKIC 1A2UA 2I5HA 2Z6KA 3ERSX 2F0IA 1Y8PB 4HAEA 3PGZA 3W1GA 3CQZB 2CCZA 1CHPD 1GUSA 3HFZB 1G6ZA 2J7ZA 4HIDA 1Y1VH 4NDXA 4OO1G 2BA0A 5ELFA 2KVMA 1TWAB 2L55A 4NXNL 3IL8A 5I2YA 1RL2A 1KAAA 3MHBA 1EU3A 2KCNA 2EJFC 2CW0D 4OONA 3UDFA 4NPSA 4PG3A 4RKBA 2Y0SB 3VYTA 4B3RL 1JOKA 3DUZA 3Q0AA 1M8AA 4RFBA 3I4MG 1HQRD 1NSNS 2DUDA 4JI2Q 3PF4A 4NP5A 3CCLA 3CU7A 4KKUA 4LF9Q 5E4WC 1VQCA 1YNND 4O42A 4CBVA 2EJMA 3E9IA 1WFQA 2ICEC 4R4IA 3U50C 2IX1A 4K0KQ 1B3QA 3N6RA 4TVAB 1IBML 1N34L 1STYA 1K8AC 1TWFH 3SVMA 4LF5Q 1SDFA 3PIO3 4A76A 3J7A5 3A7AB 3I4OA 1CKMA 4H44C 1UE5A 2VNUD 3MXUA 3CQZH 3HOZG 4DPGA 2PO4A 1KLGD 4RGNA 4ILWA 4QJFA 3TBIB 4JBJA 2WKCA 1UAPA 3U9OA 4XQJA 2EPBA 1XNQQ 5LMNQ 4N8X1 4C3HB 4YWKA 3GTMH 2K05A 4ME3A 2EVBA 5L37A 4LF8L 3BDLA 1RJTA 1PH6A 4LF7L 1QVFA 2Z0SA 3SK6A 3AYHB 4R4OA 1C48A 1CI3M 1WJJA 4JOIA 4CJ0B 1BUVT 3I4NB 3VR6A 4L5RC 3Q22A 1PRTB 3IAYA 1KHIA 5C6AA 3IKJA 1TWCH 3PO3G 1YHQA 1PH5A 3D6CA 2K14A 1MI2A 1W6KA 5C0XH 1ENFA 4MTNA 4CDCC 4B3SL 1NMFA 4LFAL 4DR3L 3R3OA 3AU7A 4A3MG 1T9HA 3D4RA 4RAUC 4TRDA 3KF8B 5HGQA 1Q8IA 1MIUA 3S2DB 1AN8A 4IUTA 2FMMA 4MIUA 1HZCA 1F77A 5DEHA 1A8VA 3FKIH 1Q46A 3A8JE 3OWFA 4YWLA 1HZ9A 3P20A 4O0AA 1HNWL 4XIGS 4A3IB 4WJWA 5GAEC 3F1ZA 1VQFA 4P74A 2F0OA 1Q7YC 3S15H 3S15B 2OCEA 1D5XC 1VF7A 4ZYSA 4KY7A 2Q8TA 2KHIA 1VQLA 3GTPB 1RIPA 4DFAA 1XTDA 2JA7H 1PYWD 4UP7A 3TP7A 3OTOQ 1AZPA 1VDZA 1QB5D 3D0FA 1LTBD 4N8FA 4GOPA 2HDLA 3CC2A 5C4JH 2BH2A 5M3FG 4A3KG 1UNSA 1C9OA 2NYZD 4C3HH 4XXEA 1F2YA 3J7YW 1TT2A 3UE1A 4DV6L 5IGBA 3FRPB 3I91A 1A3UA 1CSPA 1II3A 1IYJB 1AE2A 1KRSA 3S17H 1YIJA 3NTIA 1XTCD 2OTJA 4DK1A 1KDAA 1ILQA 4WRDA 3T1YL 4KD4A 3JC66 2EYHA 2AQ3B 1NE3A 1TQOA 3BG3A 5IIFA 2GN5A 3DEOA 3Q23A 2D0OA 3FPPA 3GTQH 2OWOA 1RF2D 2YTYA 1PFMA 5G3LF 1J5EL 3BZKA 3HRZC 1MSHA 1O78A 1JT8A 1BCPC 2Y0SE 2Z4IA 4IALA 1HPCA 1KNAA 1E1TA 2E74C 1WCMB 1BKBA 5JJLA 2R93H 1X32A 1SAPA 4QUCA 3M4QA 3L3OC 3J80E 4A3GH 4A3GB 2HHHL 2NZHA 1MSGA 3S1QB 5COYA 2EYOA 3TDQA 1KXLA 4YIJA 4NKLA 2F0NA 4LK1C 2NVTH 4O1NA 4JI4Q 3IRBA 1UE7A 1PRTC 3ND8A 1BVSA 2F03A 1Q8KA 5IP9H 2NN6H 2XSCA 3S1MH 1YNJD 2BCOA 3GTQB 3CCEA 2JA8B 1AP0A 3BVMA 4RHSA 3VR3A 1XYIA 5CV8A 1YHAA 5EPLA 5KNDA 4DNIA 1PHJA 2XN9C 5C4XB 3MEHA 2VQFL 1EIHA 4GN5A 4LAAA 3GTLB 4KLKA 5M3MH 2KEEA 2C35B 2R61A 1B70B 3ULJA 2JE6I 4GNXC 1D6EC 4N9PA 4GNXA 3HZXA 3HOUH 3DWAA 1M4VA 2F4VQ 1FGUA 2A74C 1B53A 4BXXH 3CCQA 3VDYA 3G7LA 5CV4A 4ZCKA 1SE2A 1H9JA 5ELNA 4C1NI 4IFDG 2QF7A 2L15A 4IFDH 4V190 3UDIA 1V9PA 3CKIB 1IL2A 1I94L 2K01A 3E5SA 1WTXA 1EOVA 4A93B 1PH4A 3PIPA 4X66L 2VZAA 1L0WA 2IHEA 3G48A 2OTLA 1W6JA 2WIIB 1BCPD 4O2DA 2KENA 2PPBC 4JI3L 1S5DD 2NBFA 5EPJA 1NUCA 4YY3L 3M3YB 2TMPA 4JCVE 2CWAA 4KV6A 1I4PA 3WWVA 1B50A 1L2FA 1FGBD 1C0AA 1SMYC 3HP3A 1X3FA 1HXYD 4AYBG 1VMPA 4KKSA 4CJ2C 1I4QA 3CCSA 2D5DA 2HUGA 2K1BA 2L9HA 1MBYA 2O5IC 2M00A 5FLXL 1WYDA 4HMIA 2PZWA 3KOJA 1SXTA 1HFGA 4FF3A 2DJFC 2IWHA 3GP7A 2F4VL 3GTKH 5NUCA 1HA6A 2RQXA 5DLQE 3J81c 5I6YA 2CVRA 4XYQA 1KNEA 4NB3A 5M3MB 3EVQA 2DJGC 3S14H 4MN3A 3C2PA 1LTRD 2KCCA 1KLUD 5CV9A 5JJZA 5IYCH 2QW7A 2RBMA 2B2VC 5LMUQ 2ZXPA 5I6WA 1K9MC 4EQ5A 2V4DA 2OQKA 4A3BB 4JBWA 2NN6G 2VL6A 5IWAQ 1BF4A 4GN4B 1N36L 1SYCA 4DU9A 5IYBG 4DV1Q 3GO5A 1W2BA 1HH2P 3H3VH 3KDFB 3HKZG 5TSSA 4Q0FA 3HG9A 4DUZQ 1TS5A 4A4IA 2K28A 4MNOA 2XIWA 4HSPA 2R7ZG 1RKNA 4NXNQ 1DCZA 3M4PA 3CCVA 1PXUA 5C4XG 1LV9A 1B9NA 1N32L 1K73C 3V96A 1EWCA 2IT1A 2VB2X 3T53B 4K6DA 1LTGD 4OWTB 1V8QA 3K5LA 4EQPA 4CKEA 4N9TA 4GOPB 1X3GA 5BN5A 1CK1A 4BA2I 3CD6A 1G2SA 2MPMA 1WTVA 5GROA 1V1PB 1QJOA 5LMNL 1LT6D 5LHY1 4X62Q 4DV2L 3G6EA 2WB1B 3QJYA 2IL8A 3HOZB 2EY1A 1FNWA 3D3RA 2MHVA 3PO2G 1HQMC 4BA1I 2FHTA 3H09A 4YCVA 2B2UC 1HZAA 3JAME 3I55A 1EY6A 4HR7B 5AFWA 2N88A 4JOIC 3PUVA 5C5MA 4PZ6A 2RDFA 4EVOA 5I4DA 3H3VC 2EJGC 4FXGC 2JA7G 2BE5C 1JC7A 4OGQC 5CORA 5IGCA 1M90C 1QE6A 4ZKCB 5J22A 4ID6A 5JAVA 4LUOA 4LWCA 4QIWB 4X64Q 4JV5L 4F87A 2XRSD 4DV2Q 3PO2H 1VQ8A 4K6LA 5ELCA 4HSVA 3F2DA 3GDEA 1TWFB 3UE0A 1N8RC 3TS2A 3O13A 1D7QA 1PFSA 2JEAI 3TEHB 4POFA 3DEPA 5C0XI 3E0EA 4KY6A 2ZJQA 2H1EA 3K6OA 3FKIG 5JOBA 4ALPA 4JK1C 2NB0A 1QILA 4RG1A 3CRLC 2NWGA 3A5ZB 4IUQA 2NUCA 1BCPB 3I72A 1X9NA 3ZJYC 4AQYL 5CBEE 1JORA 1EQRA 4HJ7A 1IL8A 4Y7NH 5KIXA 4KKTA 4KN4C 4DUZL 5EAYA 4JI0Q 1K8MA 2I07B 5FO7B 4HIKA 1WTQA 4JI8L 1LT4D 3EBEA 4RWSC 1EZ6A 4LUVA 3H6MA 4A3LH 1EL0A 2IY5B 2JA6B 4JW0A 1DGSA 4A3IG 1H9SA 2J0TD 3FMCA 2K03A 1VQJA 4L6TB 5A2QL 1EFID 2HCCA 4K0KL 3VA7A 4S3SA 4HIMA 4C56C 2K4KA 2VQFQ 4UAIA 2JA8G 4ULLA 3T1HQ 3RZDB 4UY8C 1Y1VG 1AW7A 1VQBA 2B2YA 2UUCL 3BU2A 3I2ZA 2EQSA 3NQTA 1I3QH 4A3DG 4DR2Q 2I46A 4FF4A 2N78A 3SDZA 4QGUA 1GKHA 4LFBQ 2K04A 1STEA 4BY7H 2O5JC 1BOSA 1F2LA 4A3GG 4JG2A 3K7AH 3K7AB 1HR0L 1QUQA 2UXDL 5KNCA 2QILA 1SE8A 1AE3A 3VR2A 1YI2A 4X65Q 5E1FA 5M3FH 4A3KH 1PH8A 4MTKA 2UXCQ 4X3UA 3A0JA 3A74A 3WOFA 2HT1A 2JA7B 2FINB 2A8VA 5D3IB 4EQOA 4YCUA 1EFWA 3U4ZA 3EA6A 4IJHA 3KBXA 3C3LA 4PZ7A 1WTRA 4LJZC 3CCUA 2E5LL 3UDGA 3I3CA 3I4MH 1XJVA 1XXGA 1LACA 2F1MA 4DNTB 3RN2A 3HOZH 4Y52H 4HJ9A 3QWNA 5BR8L 2ZM6L 3J81E 2VQEL 4IUVA 1SNQA 4QF4A 2F3IA 3C1EA 4FXKC 4G7HC 5C4HA 2IHFA 4K2KA 4DR1L 5M5XB 4CKCA 4A3JB 2JJQA 4CDFC 3KK7A 4DV0L 4OO1H 2IJ0A 1LUZA 1N32Q 4DF7A 2VUMG 1TVXA 1GUTA 1L1OB 5GADC 2NVQB 5FLXc 5M5WB 4UP8A 3KF6B 4DKAC 4K5VA 4DA2A 3J81i 4JBMA 4LW1A 1SYFA 1DXMA 1EIYB 1ET9A 3K8AA 5C4JB 2UXDQ 1PDQA 4BY1H 5CV7A 1FNVA 2WKDA 1U0LA 5A2QE 2R92H 3I73A 3HOYH 2UUBL 4A3CG 3R2TA 4JPBW 2Z9HA 1X3QA 1T5EA 2Y0SG 4A3EG 3SXHA 1V1OA 1NR4A 1Y1WG 3J81j 3ONAB 2NZ1D 3T1HL 1HA5A 1LT5D 4XQNA 1R9TB 3KLSX 4NXML 1NMGA 1TXYA 5A35A 5FK9C 5CV5A 4JI6Q 2AMCB 4JBKA 4ABNA 1IHZA 4WFN3 3L0OA 2RCNA 4FYDA 1J9OA 2EYFA 3H15A 3DHQA 3RR5A 4OIKA 3L2PA 3W2DA 3M7NA 1EU4A 4KHZA 5CR3A 2K33A 5CBAE 4DR4L 4DR1Q 2RF4A 1N9WA 2EXZA 1SEBD 2ZXRA 3EIVA 3T13A 2K75A 4FNFA 1JOOA 1VQOA 2J4XA 4DAYB 1TWGB 5IOCA 1G6PA 3TZDA 5D14A 3FPUB 3BDCA 1LABA 5GAGC 4DR2L 3QOLA 2E75C 3GTLH 4WJ4A 2V1CC 1NTGA 3OMGA 3GTPH 1YEZA 1X3PA 4LUZA 3H3VI 5KGUA 4C1NK 1BO0A 2PNRC 5DNFA 1OXSC 2CQOA 1I4HA 1V43A 3X3MA 2ES2A 2WV6D 1EEID 3OOCA 2AWNA 4R4QA 2PQAB 4PZ8A 4C3JG 1E7ZA 4X6AH 2R92B 1KTKA 1GUOA 1TWHB 1L0YB 4A3CH 1F2MA 1JB7A 1WI5A 1QUQB 4AYBE 2DGYA 2EOTA 1JJ2A 4KHPL 3TS0A 4BWGB 2PYKA 1FNUA 2F0MA 3ICEA 4DV1L 4A3FH 1EYGA 1D1IA 1H9RA 1TWGH 1C8CA 2JP1A 2NVYB 1K0SA 1MGSA 3T56B 1A15A 3J81L 5IYBH 1LYLA 1K3BC 3RNUA 2PQEA 3PV0A 1QCBD 5BR8Q 1K8OA 3KYHC 4GLVB 4YHHL 3CMEA 3G6JB 1D8LA 1JWUD 1LTAD 2B8FA 3CC7A 2CW0C 1OXXK 4B3TQ 1LTTD 3HOUG 1I50B 3K81C 3R2IA 4IN3A 4LF7Q 5HURA 2HIVA 1XPOA 3PMFA 1HNWQ 5K36H 1E0BA 4H0LC 1TIID 4F88A 1I6VC 2MUYA 1QNKA 4JI8Q 3CW2C 4QQBX 3JAMi 1O7LA 4DR5L 3HEJA 3PO2B 4XT1B 1H95A 1Y1WH 4M1UB 2NVYH 3LX0A 3I56A 1PYSB 1F9PA 2A68D 2UUBQ 1E2WA 1D5ZC 4R9WA 2F3VA 1BR9A 1PZKD 5C3WA 1L1OC 4IUPA 2RSOA 1PTOH 4PMCA 4RCNA 2JN4A 3AEVA 4A3BH 2B3GA 2I5LX 5AJ3L 2R93B 1Q81C 1Z47A 2XTIA 2R7ZB 3ZYYX 2B2TC 2JSOA 1GOZA 3S1RB 4L5SA 3KLWA 3RMHA 3HKZB 4HMJA 1Z9FA 1PH3A 3UI2A 3F2CA 3PCOB 4LNQA 1IBLQ 1G291 3SE0A 2EZVA 4DV4Q 4XT3B 2AUKA 4Q5VA 3MXGA 2DY7A 4J1MA 4G7ZC 3KJOA 4DXGA 1PA6A 3VYUA 4A3BG 4ZKBB 1L1OA 2YV5A 4OX9L 4UDUC 3WOEA 5JPMC 3BS1A 3KF6A 1I4GA 3MWYW 4P2CB 3W1BA 1NBWA 2A6HD 4X3TA 4XTCS 5DM73 3JAML 5CMDA 5CV6A 4JI4L 4J8QA 3NHHA 3STBC 3CPFA 5IYDG 3PIOA 4FP5D 4YCWA 2RKSA 1P8LA 1Q12A 1I5FA 1Y14B 4A93H 5FLMH 1B3AA 5EGTA 4LF6Q 3A8IE 3RD4A 1GJXA 5M5YH 5K36G 2RDHA 4Y7NB 4BBSG 1S5FD 3EROA 3MFYA 2K5HA 4BBSH 2D62A 1HR0Q 2G9DA 3KUPA 1EQVA 2BA1A 3K5OA 4K8IA 4JI1L 1Y1WB 5GQOA 2DNCA 3STBD 1KAWA 1RTNA 2N55A 3LWEA 5HY6A 2Q2HA 2MO1A 2NTSA 3D6WA 4C3IH 2O2LD 1GUNA 4B3MQ 3NEMA 1SMYD 1K83H 1WVLA 3PQIA 3TSSA 3SR1A 4AYBB 2A73B 2MO0A 5KNBA 1GD7A 1YNJC 2QEJC 1SLJA 1FR3A 1GM5A 3KLRA 4DGZA 4KMUC 2B2WC 1XMOL 3OMCA 4J15A 4ZRZA 5D65A 3DLLA 1LLRD 1M1KC 2GA4B 3AB9A 3CP0A 1CZGA 2L5TA 5C3EG 1TKWB 2KEDA 5IWAL 5FO8B 2DNEA 2I5MX 4G4KA 2UUCQ 4IUUA 2EDGA 2B63G 1VQGA 1SN8A 4TKOB 2VB3X 5LMUL 4JI7L 4B3TL 3NPPA 1R4PB 5GAHC 1JWSD 2SNMA 4CKBA 5IYCG 3V2TA 4WJ3M 2LSSA 1B4OA 3I90A 1WOCA 2L1BA 4YY3Q 5E3FA 3D4DA 3I4NH 4IQZA 3K5MA 3OPOA 4U68A 1ZXTA 3OW2A 3H0GH 2E2IH 2YU9H 1PTOD 4IZ8A 4GNXB 4BBSB 1C4QA 3NWTA 3R93A 4DAYA 1ESRA 3S9WA 5FLXE 1PRTF 4LF4L 1TS4A 4PMBA 4H7BA 2JQOA 4OO1I 1U4PA 2F4IA 2LS01 2PZTA 5E7NA 1B9MA 3T16A 5IP9G 5M9OA 2VW9A 2IX3A 3NXWA 2A19A 4DR4Q 4UPAA 5T1GA 3TZUA 4F7XA 4POGA 4C3IG 4X3KA 2LMCB 4GS3A 1CKNA 2RDGA 5IT9c 3HOWB 2L11A 4K5XA 1JJGA 1Y69U 5IP7G 1TY0A 3ITPA 2F0FA 2OXPA 3S24A 4HJAA 2LFNA 1K28A 2K5VA 1I3QB 1N36Q 4KJOA 1CZWA 4XQQA 1A63A 1FJGL 1S3OA 1E22A 1Q82C 1CKOA 5FLMG 1LT3D 2EE1A 1KIXA 2AUJD 1EQTA 3LWUA 3KBGA 1HFNA 2KCMA 2H5XA 2F0TA 4QIWE 3CHBD 2F0PA 3NQIA 2LKVA 5LL6S 2ZJRA 4GKKQ 4LF6L 3VYSA 4FDBA 5ELDA 3Q8DA 3SK8A 3I4MB 1RD9D 2Q8IB 4I65A 1GXDC 2A5HA 2QEXA 5KYIA 5JPNC 1Z7TA 4IFDI 4UP9A 1U9RA 1HJPA 2K50A 3MXNB 4A93G 4R4CA 3H0GG 3S2HB 4C2MB 3E3XA 2IPKD 1GHKA 3B6YA 3W5OA 1UWVA 3NUCA 4IPHA 4X62L 1IKLA 3RZOB 1DYQA 4L8JA 1S5BD 1SYBA 4HN7A 4IURA 3GTGH 4MHEA 1HNZL 3HOYG 1EIGA 1CKNB 1IBKQ 2SEBD 2ENBA 1CHQD 1CT1D 5C0XJ 4X64L 4JV5Q 5IGFA 2E76C 4KY5A 4FO2A 1PTOF 1EQQA 1E24A 4DK3C 5C5LA 5IGGA 1K0RA 5FOBB 1SMXA 1GUWA 3GQBA 3RUZA 3T4AC 2HHHQ 1E3PA 5EKLA 3DWPA 4LFCQ 4OIJA 5J3BA 4KN7C 1YBYA 4L5TA 2O4XA 1KDCA 3KLSA 5FJ8G 2QDBA 4ZQ3A 4RCOA 2AQ1B 3TREA 1D1KA 2F0GA 2ZTDA 1X6OA 1PVOA 2UU9Q 3GTJB 3J80L 3PUWA 5I9PA 2R6GA 3OWEB 2OF1A 1BNZA 5C44B 3SGIA 1X56A 2KJXA 3GV3A 5C4XH 4A3MB 2AQ2B 1WTHA 3MAQA 2F0WA 5JVH3 1JB3A 1HTPA 4LF8Q 2R7ZH 2M9VA 1OTCA 4BY7B 3KDFA 1U4MA 2HIXA 3M85A 1SYDA 5E4XA 2HQLA 4DR7Q 1AZQA 1GHJA 1RDPD 4X65L 1MHWC 4I7ZC 3AFPA 4APVA 3TP5A 3TP6A 2UXCL 1WTWA 4BY7G 3W3AA 2N49A 5FO9B 3GTJH 1A2TA 1I94Q 3MEFA 1DONA 2XGTA 2HD3A 2N3SA 2MGSA 2B2TA 4G7OC 4DV3L 2VUMB 4IUNA 4A3FG 3I8ZA 1N34Q 1LTID 1IBKL 4A3JG 1WCMH 4OELB 1D5MC 2Q2UA 4R4TA 1HCZA 2PW5A 4UHVA 4GLXA 5FKAC 2HCIA 3J7ZC 1U4LA 3RZOH 2F0VA 1DJRD 1H9SB 5LL6X 4E6IA 3DM1A 2CQAA 1R9TH 3MXPA 2K32A 1SSOA 1UEBA 1O80A 3S1NB 5K5PA 4DV5Q 4C3JH 1EY0A 4DV7Q 3CPWA 1JCKB 1DOLA 1MJCA 2YTVA 3X3NA 5IODA 1VQKA 4HCSA 4DAVA 3NSWA 4OL7A 2UU9L 1EEFD 4H13C 3K0XA 2FXQA 4B3SQ 1IW7D 1HTLD 1T5XD 2CH4W 2TSSA 1Q86C 1BBUA 1PTOB 3OYYA 2UUAL 2F0UA 2JXMB 4IPCA 3DM3A 2MJ8A 2GVAA 1CUKA 2E2DC 4DV5L 1Y8NB 2FJ2A 1E1OA 4DV6Q 4A3FB 4KK7A 1HUMA 3K59A 2A6HC 2JEBI 4H02A 4DK0A 2K7VA 3Q24A 4P71A 3K0YA 1Q1BA 3CAMA 1SNMA 1JQYD 1MD2D 4BY1B 2NN6I 2WFWA 1D2BA 3NE5B 3CF5A 3P1HA 3RLFA 1XNQL 3PIP3 3I7FA 4A3MH 4OWWB 3PO3B 3CXCA 2ZT9C 1P16A 4K8JA 2NVXH 4FF2A 2VUMH 3M4OB 1XNRQ 4NW2A 4DR3Q 3J7AV 5JJIA 3ND9A 1H9MA 4IOAA 2BH8A 1V1PA 1QVCA 1A3VA 4OEMB 4LFCL 2LXJA 1SNOA 1X54A 5C4ZA 1NNXA 4KD3A 1QWYA 4P72A 1YJWA 4C3HG 2RVLA 3BJUA 1A62A 2F52A 4HJ8A 4A3DH 1KC8C 4JC0A 3A55A 3F2UA 4RGOS 5LMNW 1I6HH 1X3EA 4B3ML 4LFAQ 3CMAA 1AH9A 1JE4A 4K14A 3LGJA 4R8IA 1VQMA 4RKLA 1S4ZA 3NTKA 2HQEA 4IPGA 2Z1CA 1YHBA 1VQAA 4BXXG 2JYOA 3NWSA 4FVMA 4L5QA 1OXVA 1SE4A 1B44D 4C3IB 4GKJQ 1STGA 3KFUA 1CQFA 4Z9CB 5KRUA 1QVGA 1V1QA 1OO9B 3HKZE 4ZK9B 4CJ1B 1PRTD 4AIMA 1ASZA 4ZLTF 4FXDA 4L63B 2F0HA 3PUZA 1TY2A 4EQNA 2HDMA 4YHHQ 1WCMG 1PZID 2E2JH 1QZHA 4QCLA 1UEAB 3VR5A 1VCIA 3VR4A 5I9OA 2BE5D 1N33Q 1QG7A 2Z8LA 1F2ZA 3S1RH 1YVCA 3HOVB 3GTKB 2R3ZA 2EY2A 2F0EA 1EIFA 1KDBA 1EWHA 5DM63 1ESFA 3ERQA 5EPKA 3ULLA 1Q1EA 4IO9A 4DV7L 1KQSA 4PMWA 3U4VA 1ILPA 2NVXB 3PSIA 2EYJA 4DR5Q 1HR0W 1ML0D 3D31A 4KHVA 1U4RA 3EFXD 3K57A 1NJIC 1O7YA 1CTMA 1EYDA 4J6HA 3NBHA 3BYYB 3NENA 2N8NA 5JEAH 1AEXA 1HNXQ 4LF9L 3S1MB 3BDOA 4U673 1UE1A 4C2MH 2PW7A 2D2CC 1Q90A 2RA4A 2X69A 1O7ZA 5JEAJ 2IX0A 2QA4A 1DOMA 5M3FB 4A3KB 3MA2B 3FHWA 3QR8A 1PZJD 4YWMA 3BYTB 2QDLA 4JI5Q 1RODA 4OWXB 3GV6A 1IYVA 1K83B 4K2LA 4JI0L 3RN5A 2WACA 1EOTA 3K5NA 4GKKL 1L0XB 4BBRG 2PNHA 1XMQQ 3E6ZX 2E2JB 1E2VA 1NCVA 1SBBB 2K5NA 2AHOB 2L0CA 3HOXH 1VQEA 3HOXB 1SFOB 3GD7A 2WP8J 2F0JA 1YJNA 2K5DA 4WORA 1HRJA 1MKHA 5CGKA 3AMUA 2YU9B 2WAQG 4PV1C 1F9RA 2SDFA 1PTOC 2F0QA 2AWOA 4OX9Q 1PH7A 1S40A 4GKJL 2MNAA 2E2HH 4MZ9A 2B29A 1J6QA 1CM9A 1W3SA 1A3TA 4DUYL 2B2YC 1HNZQ 1VQ5A 3CCMA 1PFNA 1YJ9A 2WINB 3S2DH 3S16B 1XMQL 1UE6A 1KD1C 1EY7A 4LF5L 3U58A 3CRKC 1SRUA 3BVZA 5ELEA 1WTOA 4TQUS 1EZ8A 2KBNA 2B63B 4V0BA 1B2TA 2JA9A 1NY4A 1PMRA 3QOJA 4CGYB 4DR6Q 3I4NG 2LY7A 2KOLA 4XDXA 2WAQE 2R7FA 1WD0A 1HNXL 5IE8A 4QY7A 4HIOA 1SYGA 1STBA 1KABA 3BZDB 1TR5A 3MTSA 5JVG3 1ENCA 2A68C 1LO5D 3NP8A 2ZTEA 4K5WA 2KUMA 1YNXA 2R7DA 2PQAA 2QGQA 5F2DA 1F9SA 5C44H 1BXTA 5C3EH 4ZUJA 3BZCA 5C3EB 5M3MG 1IBLL 2E2IB 3R8BA 1PH9A 2ATWA 4AH6A 3HKSA 1C7YA 4CDDC 2JA6H 1JOQA 3VYRA 1LTLA 2EYMA 2PI2A 1XMOQ 3HS0C 4F8MA 3S17B 3HOWH 3MVVA 1ZYRC 2SOBA 1NR2A 3MZ5A 5DAUA 1SE3A 1FD7D 1JICA 2X6LA 3DXJC 4ODGA 2C9OA 4JI6L 5JEAG 1EY5A 2BDOA 1G8ZD 2JK8A 4NXMQ 1J8IA 2MP1A 3URYA 4G57A 1HHVA 2CH4A 3I4LA 3QO2A 5KEEA 3A8KE 3GTGB 2PMZE 1J5EQ 3J7AF 1QZGA 4HJ5A 1RTOA 4LMQD 1KRTA 4DUYQ 1IZ6A 4B9XA 5JJKA 1PFBA 4DK6C 1CFMA 2VQEQ 1LTSD 3PUXA 3IFTA 1UUPA 2B2UA 3H0GB 3S2HH 2YYZA 3OW7A 1F9QA 2E8GA 4JI1Q 3RZDH 1Q3LA 3T1YQ 2B2WA 2Z4HA 1TU2B 2WB1E 2OEOA 4EX5A 5M5WH 2KQ3A 1I4XA 3TP8A 1PYBA 3IFDA 2RHQB 3J80c 3OSOA 1TWAH 4DR6L 3S16H 2ICIA 4CDEC 1I4RA 2B8GA 2ZXOA 1VQNA 1U5KA 2K52A 3G4SA 3K80C 4DV0Q 3V05A 3MC0B 4I7AA 3CCRA 1VQ4A 2G9HD 2M2LA 1BDOA 1TWCB 3J80i 3E0JA 1H9KA 5H1SE 1PV4A 3OTOL 1DOKA 2XNAC 3M4YA 1BCPF 2JA5B 2A6ED 4LF4Q 3F8TA 1DZ1A 4PQXA 1R4QB 1B1ZA 1VQHA 1QOHA 5EJWA 5M5XH 1X55A 4DR7L 2R93G 1JWMD 3Q6SA 4JYAQ 1X65A 4B9WA 5IP7H 2L4NA 3T51B 2D0PA 1STAA 3DMUA 1YNNC 4GLAC 4HCEA 3K7UC 1FJGQ 2RSNA 1LM0A 4DXFA 5IY0A 3HOWG 2GVBA 1PH2A 1PLFA 1ENAA 2A6EC 2PI2E 1I6HB 1VQPA 5IYDH 5IT9L 5J39A 4JI3Q 4BY1G 4IOCA 2ALYB 3FP9A 2XWBB 3FKIB 1VMCA 3TQYA 5EKKA 3MXNA 4DN4M 2VY3A 1JMCA 1NAPA 1CA5A 1XPRA 1BBXC 4DAPA 4PNYA 1O7IA 1IXRA 2B2VA 3KJPA 1GO3E 4A3EH 2NVQH 1AFPA 1HUNA 4LFBL 2UXBQ 1XWEA 2F0SA 2K6AA 3NBHB 2CFMA 3A5UA 1VQ6A 1STNA 1EYCA 2ZTCA 4XYOA 3EQLC 2F0KA 4RGTA 2RHSB 1OXTA 3KF8A 4GN3B 2FMCA 3A54A 4QB4A 3PUYA 4A3IH 3EN2A 2DY8A 2OQ0A 5G3LD 2NZOA 5C0XG 3NTHA 1SNPA 4RGMA 2SNSA 3OHXC 3BVGA 2RCFA 4JI2L 3C1FA 3H94A 1S5ED 1RCVD 2C5CA 5ELBA 2X6GA 4X66Q 3G71A 2H4OA 2WB1G 3UDXA 2G5DA 1FL0A 4B3RQ 3P7JA 4BS9A 3AQQA 1VS0A 4JI5L 4A3JH 4DNRB 2AKWB 3F2BA 1TS2A 2XVSA 2Z6KC 1FVIA 3GTMB 5KYLA 1A0IA 4KHPQ 2D9UA 4C3JB 2PCFB 2VS1A 1JJCB 1GVPA 3QG1A 1N33L 2JA8H 1RHPA 5I2XA 1SJHD 4NMZA 4CHTB 4KJNA 4TSSA 2KA7A 3M4OH 1ZYRD 1XNRL 3AFQA 1ICWA 2VXWA 3FVQA 1SNDA 3PO3H 1ICFB 5IGEA 3SHLA 4RMFA 1SJED 5EBCA 4DV4L
chains in the Genus database with same CATH topology
1XX8A 3L7ZC 4M8AA 5EQ0A 1TS3A 1EY9A 3P75A 4OHJA 3H91A 1FYCA 4HTHA 4RH6A 1Z6HA 5BN3A 2L12A 4ZAIA 4ZUIA 4A3DB 3SK5A 4KTAA 4RHRA 5CYUA 1CA6A 2B39A 2XRQD 4QUFA 4FF1A 4A3EB 2EYPA 1EY4A 1Y8OB 3U9SA 2Q8RE 3VA5A 2NVTB 3LNNA 5EBDA 2K5QA 2EY5A 3N52A 5T1IA 4ME5A 5BN4A 5HGTA 4X3SA 2EY6A 3MFGA 3SK4A 4IFDJ 1OXUA 3SEBA 5D3DA 2A69D 1S5CD 3NK9A 2F0LA 2BDNA 2F3WA 2PZUA 5C3XA 3HOYB 2F0DA 2OT2A 1EY8A 4KI0A 3FEWX 1CQVA 3NBIA 3M7GA 1DM0B 3A56A 3QIAA 3QB3A 3GTOB 4R8NA 3WDNA 2PMZB 2KECA 1SNCA 4QMGA 5J1ZA 5M5YB 1A6XA 2CHBD 1G91A 2FFKB 5IT9E 1IW7C 3HOUB 3TN2A 1E2ZA 3L9AX 1GUGA 1ONLA 5ISRA 4GZYC 2EYLA 1G2TA 3OIQA 2KHSA 4B08A 4HEDA 3HGBA 1WTPA 1EYAA 1IKMA 2IW3A 1SYEA 2XWJB 2BOSA 3TMEA 5IGDA 2WAQB 3A7LA 1JR0D 3OIPA 3D8GA 2ID0A 1ZEQX 3DWQA 1DD2A 2DN8A 2NTTA 1STHA 2E2HB 3EJIA 3K58A 1WD1A 3D4WA 1Y1VB 3FDTA 1VF5C 4EGVA 4BBRB 2K5WA 4RA8A 1BQQT 5CC4A 2QCPX 2A69C 1IYUA 1QNUA 3C46A 3I70A 1ZKOA 3S14B 1ET6A 5EKIA 2QKIC 1A2UA 2F0IA 1Y8PB 4HAEA 3CQZB 1CHPD 1GUSA 1G6ZA 2J7ZA 4NDXA 4OO1G 2BA0A 5ELFA 2KVMA 1TWAB 2L55A 3IL8A 5I2YA 1KAAA 3MHBA 1EU3A 2KCNA 2EJFC 2CW0D 4RKBA 3VYTA 2Y0SB 1JOKA 3DUZA 3Q0AA 1M8AA 4RFBA 1HQRD 1NSNS 4NP5A 3CU7A 4KKUA 5E4WC 1YNND 4O42A 4CBVA 2EJMA 2ICEC 2IX1A 3N6RA 1STYA 3SVMA 1SDFA 3PIO3 3A7AB 4H44C 2VNUD 3MXUA 2PO4A 1KLGD 4RGNA 4ILWA 3TBIB 3U9OA 2WKCA 1UAPA 4XQJA 2EPBA 4C3HB 2K05A 2EVBA 3BDLA 1RJTA 3SK6A 1C48A 1CI3M 4CJ0B 1BUVT 3I4NB 3VR6A 3Q22A 1PRTB 3IAYA 5C6AA 3IKJA 3D6CA 1MI2A 1W6KA 5C0XH 1ENFA 3R3OA 3AU7A 3D4RA 4RAUC 4TRDA 1Q8IA 3S2DB 1AN8A 4IUTA 2FMMA 4MIUA 1F77A 5DEHA 3A8JE 3OWFA 3P20A 4XIGS 4A3IB 4WJWA 2F0OA 3S15B 1D5XC 1VF7A 4ZYSA 4KY7A 2Q8TA 3GTPB 4DFAA 1PYWD 3TP7A 1AZPA 1VDZA 1QB5D 1LTBD 2HDLA 1UNSA 2NYZD 4XXEA 1F2YA 3J7YW 1TT2A 5IGBA 3FRPB 3I91A 1A3UA 1II3A 3NTIA 1XTCD 4DK1A 1KDAA 1ILQA 4WRDA 4KD4A 2EYHA 2AQ3B 1TQOA 3BG3A 5IIFA 3DEOA 3Q23A 3FPPA 1RF2D 1PFMA 5G3LF 3HRZC 1MSHA 1O78A 1BCPC 2Z4IA 4IALA 1HPCA 1KNAA 2E74C 1WCMB 1X32A 1SAPA 4QUCA 3L3OC 3J80E 4A3GB 3S1QB 1MSGA 5COYA 2EYOA 3TDQA 4YIJA 4NKLA 2F0NA 4LK1C 4O1NA 1PRTC 3ND8A 2F03A 2NN6H 2XSCA 1YNJD 2BCOA 3GTQB 2JA8B 1AP0A 3BVMA 4RHSA 3VR3A 1XYIA 5CV8A 5EPLA 5KNDA 2XN9C 5C4XB 3MEHA 1EIHA 4LAAA 3GTLB 2KEEA 2R61A 2JE6I 1D6EC 4N9PA 3HZXA 3DWAA 1M4VA 2A74C 1B53A 3G7LA 5CV4A 1SE2A 1H9JA 4C1NI 4IFDG 2QF7A 4IFDH 4V190 3CKIB 2K01A 3E5SA 1WTXA 4A93B 1W6JA 2WIIB 1BCPD 2PPBC 1S5DD 2NBFA 5EPJA 1NUCA 3M3YB 2TMPA 4KV6A 1I4PA 1B50A 1FGBD 1SMYC 3HP3A 1HXYD 1VMPA 4KKSA 4CJ2C 1I4QA 2D5DA 2HUGA 2K1BA 2L9HA 1MBYA 2O5IC 2M00A 5FLXL 4HMIA 2PZWA 1SXTA 1HFGA 4FF3A 2IWHA 3GP7A 5NUCA 1HA6A 2RQXA 5I6YA 2CVRA 4XYQA 1KNEA 5M3MB 3EVQA 4MN3A 3C2PA 1LTRD 2KCCA 1KLUD 5JJZA 5CV9A 2RBMA 2B2VC 2ZXPA 5I6WA 2V4DA 4A3BB 4JBWA 2NN6G 1BF4A 1SYCA 4DU9A 3GO5A 5TSSA 4Q0FA 3HG9A 1TS5A 2K28A 2XIWA 4HSPA 1RKNA 1DCZA 1PXUA 1LV9A 1B9NA 3V96A 1EWCA 2IT1A 2VB2X 3T53B 4K6DA 1LTGD 1V8QA 3K5LA 4EQPA 4CKEA 4N9TA 5BN5A 4BA2I 1CK1A 1G2SA 2MPMA 1WTVA 1V1PB 1QJOA 1LT6D 5LHY1 2WB1B 3QJYA 2IL8A 3HOZB 2EY1A 1FNWA 3D3RA 2MHVA 1HQMC 4BA1I 2FHTA 3H09A 2B2UC 3JAME 1EY6A 4HR7B 5AFWA 2N88A 3PUVA 5C5MA 2RDFA 4EVOA 5I4DA 3H3VC 2EJGC 4FXGC 2BE5C 1JC7A 4OGQC 5CORA 5IGCA 1QE6A 4ZKCB 5J22A 4ID6A 5JAVA 4QIWB 4F87A 2XRSD 4K6LA 5ELCA 4HSVA 1TWFB 3O13A 2JEAI 3DEPA 5C0XI 4KY6A 2H1EA 3K6OA 5JOBA 4JK1C 2NB0A 1QILA 3CRLC 2NWGA 4IUQA 2NUCA 1BCPB 3I72A 5CBEE 1JORA 1IL8A 5KIXA 4KKTA 4KN4C 1K8MA 2I07B 5FO7B 1WTQA 1LT4D 4RWSC 1EZ6A 3H6MA 1EL0A 2JA6B 1H9SA 2J0TD 3FMCA 2K03A 5A2QL 4L6TB 1EFID 2HCCA 3VA7A 4S3SA 4C56C 4UAIA 4ULLA 3RZDB 1AW7A 2B2YA 3NQTA 2I46A 4FF4A 3SDZA 2K04A 1STEA 2O5JC 1BOSA 1F2LA 3K7AB 5KNCA 2QILA 3VR2A 5E1FA 4X3UA 3WOFA 2JA7B 2FINB 5D3IB 4EQOA 3EA6A 3C3LA 3KBXA 1WTRA 4LJZC 3I3CA 1XXGA 1LACA 2F1MA 4DNTB 3QWNA 3J81E 4IUVA 1SNQA 4QF4A 3C1EA 4FXKC 4G7HC 5C4HA 4K2KA 5M5XB 4CKCA 4A3JB 3KK7A 4OO1H 2IJ0A 4DF7A 1TVXA 1GUTA 2NVQB 5M5WB 4K5VA 4DA2A 1SYFA 1DXMA 1ET9A 5C4JB 1PDQA 5CV7A 1FNVA 2WKDA 5A2QE 3I73A 3R2TA 1X3QA 1T5EA 3SXHA 1V1OA 1NR4A 3ONAB 2NZ1D 1HA5A 1LT5D 4XQNA 1R9TB 3KLSX 5A35A 5FK9C 5CV5A 4ABNA 1IHZA 4WFN3 4FYDA 1J9OA 2EYFA 3DHQA 4OIKA 3W2DA 3M7NA 1EU4A 4KHZA 5CR3A 2K33A 5CBAE 2EXZA 1SEBD 2ZXRA 3T13A 4FNFA 1JOOA 2J4XA 1TWGB 5IOCA 3TZDA 5D14A 3FPUB 3BDCA 1LABA 3QOLA 2E75C 3OMGA 1X3PA 5KGUA 4C1NK 1BO0A 2PNRC 5DNFA 1OXSC 1V43A 3X3MA 1I4HA 2WV6D 1EEID 3OOCA 2AWNA 4C3JG 2R92B 1KTKA 1GUOA 1TWHB 1L0YB 1F2MA 2EOTA 4BWGB 2PYKA 1FNUA 2F0MA 1D1IA 1H9RA 1C8CA 2JP1A 2NVYB 1MGSA 3T56B 1A15A 3J81L 2PQEA 3PV0A 1QCBD 1K8OA 3G6JB 1JWUD 1LTAD 2B8FA 2CW0C 1OXXK 1LTTD 1I50B 3R2IA 4IN3A 5HURA 3PMFA 5K36H 1E0BA 4H0LC 1TIID 4F88A 1I6VC 2MUYA 1QNKA 1O7LA 3HEJA 3PO2B 4XT1B 4M1UB 3LX0A 1F9PA 2A68D 1E2WA 1D5ZC 4R9WA 2F3VA 1BR9A 1PZKD 5C3WA 4IUPA 2RSOA 1PTOH 4PMCA 4RCNA 2R93B 1Z47A 2R7ZB 3ZYYX 2B2TC 2JSOA 1GOZA 3S1RB 3RMHA 3HKZB 4HMJA 3UI2A 1G291 3SE0A 2EZVA 4XT3B 2AUKA 4Q5VA 3MXGA 2DY7A 4J1MA 4G7ZC 4DXGA 3VYUA 4ZKBB 4UDUC 3WOEA 5JPMC 3BS1A 1I4GA 3MWYW 4P2CB 2A6HD 4X3TA 4XTCS 5DM73 3JAML 5CMDA 5CV6A 4J8QA 3NHHA 4FP5D 2RKSA 1Q12A 1B3AA 5EGTA 3A8IE 3RD4A 1GJXA 5K36G 2RDHA 4Y7NB 1S5FD 3EROA 3MFYA 2D62A 2G9DA 3KUPA 1EQVA 2BA1A 3K5OA 4K8IA 1Y1WB 2DNCA 1RTNA 2N55A 3LWEA 2NTSA 3D6WA 2O2LD 1GUNA 1SMYD 1WVLA 3TSSA 3SR1A 4AYBB 2A73B 5KNBA 1YNJC 2QEJC 1FR3A 3KLRA 4DGZA 4KMUC 2B2WC 3OMCA 4ZRZA 5D65A 1LLRD 2GA4B 3AB9A 1CZGA 2L5TA 1TKWB 2KEDA 5FO8B 2DNEA 4G4KA 4IUUA 2EDGA 4TKOB 2VB3X 3NPPA 1R4PB 1JWSD 2SNMA 4CKBA 3V2TA 1B4OA 3I90A 2L1BA 5E3FA 3D4DA 4IQZA 3K5MA 3OPOA 4U68A 1ZXTA 1PTOD 4IZ8A 4BBSB 1C4QA 3NWTA 3R93A 4DAYA 1ESRA 3S9WA 5FLXE 1PRTF 1TS4A 4PMBA 4H7BA 4OO1I 1U4PA 2F4IA 2LS01 2PZTA 1B9MA 3T16A 5M9OA 2IX3A 3NXWA 5T1GA 3TZUA 4F7XA 4C3IG 4X3KA 2LMCB 2RDGA 3HOWB 2L11A 4K5XA 1Y69U 1TY0A 3ITPA 2F0FA 2OXPA 2LFNA 1I3QB 4KJOA 1CZWA 4XQQA 1LT3D 2EE1A 2AUJD 1EQTA 3LWUA 3KBGA 1HFNA 2F0TA 3CHBD 2F0PA 3NQIA 2LKVA 5LL6S 3VYSA 5ELDA 3SK8A 3I4MB 1RD9D 2Q8IB 4I65A 1GXDC 2A5HA 5KYIA 5JPNC 1Z7TA 4IFDI 1U9RA 3S2HB 4C2MB 2IPKD 1GHKA 3NUCA 1IKLA 3RZOB 1DYQA 4L8JA 1S5BD 1SYBA 4HN7A 4IURA 4MHEA 1EIGA 2SEBD 2ENBA 1CHQD 1CT1D 5C0XJ 5IGFA 2E76C 4KY5A 4FO2A 1PTOF 5C5LA 5IGGA 5FOBB 1GUWA 3GQBA 3RUZA 3T4AC 5EKLA 3DWPA 4OIJA 4KN7C 2O4XA 1KDCA 3KLSA 2QDBA 4ZQ3A 4RCOA 2AQ1B 1D1KA 2F0GA 3GTJB 3J80L 3PUWA 5I9PA 2R6GA 3OWEB 2OF1A 1BNZA 5C44B 2KJXA 3GV3A 4A3MB 2AQ2B 3MAQA 2F0WA 5JVH3 1JB3A 1HTPA 2M9VA 4BY7B 1U4MA 3M85A 1SYDA 5E4XA 1AZQA 1GHJA 1RDPD 4I7ZC 3TP5A 3TP6A 1WTWA 3W3AA 5FO9B 1A2TA 1DONA 2MGSA 2B2TA 4G7OC 2VUMB 4IUNA 3I8ZA 1LTID 1D5MC 1HCZA 2PW5A 5FKAC 2HCIA 1U4LA 2F0VA 1DJRD 1H9SB 5LL6X 4E6IA 3DM1A 2CQAA 3MXPA 2K32A 1SSOA 1O80A 3S1NB 5K5PA 1EY0A 1JCKB 1DOLA 5IODA 3X3NA 4HCSA 4DAVA 3NSWA 4OL7A 1EEFD 4H13C 1IW7D 1HTLD 1T5XD 2TSSA 1PTOB 2F0UA 2JXMB 2MJ8A 2E2DC 1Y8NB 2FJ2A 4A3FB 4KK7A 1HUMA 3K59A 2A6HC 2JEBI 4DK0A 2K7VA 3Q24A 3K0YA 1Q1BA 1SNMA 1JQYD 1MD2D 4BY1B 2NN6I 1D2BA 3NE5B 3P1HA 3RLFA 3PIP3 3PO3B 2ZT9C 4K8JA 4FF2A 3M4OB 4NW2A 3J7AV 3ND9A 1H9MA 1V1PA 1A3VA 1SNOA 5C4ZA 4KD3A 1QWYA 4C3HG 2RVLA 3A55A 3F2UA 4RGOS 1JE4A 4K14A 4R8IA 4RKLA 1S4ZA 3NTKA 2HQEA 2Z1CA 2JYOA 3NWSA 4FVMA 1OXVA 1SE4A 1B44D 4C3IB 1STGA 1CQFA 4Z9CB 5KRUA 1OO9B 4ZK9B 4CJ1B 1PRTD 4ZLTF 4FXDA 4L63B 2F0HA 3PUZA 1TY2A 4EQNA 2HDMA 1PZID 4QCLA 1UEAB 3VR5A 1VCIA 3VR4A 5I9OA 2BE5D 1QG7A 2Z8LA 1F2ZA 3HOVB 3GTKB 2R3ZA 2EY2A 2F0EA 1KDBA 1EWHA 5DM63 1ESFA 3ERQA 5EPKA 1Q1EA 4PMWA 1ILPA 2NVXB 2EYJA 1ML0D 3D31A 4KHVA 1U4RA 3EFXD 3K57A 1O7YA 1CTMA 1EYDA 4J6HA 3NBHA 3BYYB 5JEAH 1AEXA 3S1MB 3BDOA 4U673 2PW7A 2D2CC 1Q90A 2RA4A 2X69A 1O7ZA 5JEAJ 2IX0A 1DOMA 5M3FB 4A3KB 3MA2B 1PZJD 3BYTB 1RODA 1IYVA 3GV6A 1K83B 4K2LA 2WACA 1EOTA 3K5NA 1L0XB 3E6ZX 2E2JB 1E2VA 1NCVA 1SBBB 2L0CA 3HOXB 1SFOB 3GD7A 2WP8J 2F0JA 2K5DA 4WORA 1HRJA 5CGKA 3AMUA 2YU9B 4PV1C 1F9RA 2SDFA 1PTOC 2F0QA 2AWOA 1CM9A 1A3TA 2B2YC 1PFNA 2WINB 3S16B 1EY7A 3CRKC 3BVZA 5ELEA 1WTOA 4TQUS 1EZ8A 2B63B 4V0BA 1B2TA 1PMRA 3QOJA 4CGYB 2LY7A 2KOLA 4XDXA 1WD0A 1SYGA 1STBA 1KABA 3BZDB 1TR5A 3MTSA 5JVG3 1ENCA 2A68C 1LO5D 3NP8A 4K5WA 2KUMA 5F2DA 1F9SA 1BXTA 4ZUJA 5C3EB 2E2IB 3R8BA 1JOQA 3VYRA 2EYMA 3HS0C 4F8MA 3S17B 3MVVA 1ZYRC 2SOBA 1NR2A 3MZ5A 5DAUA 1SE3A 1FD7D 1JICA 2X6LA 3DXJC 4ODGA 2C9OA 5JEAG 1EY5A 2BDOA 1G8ZD 1J8IA 2MP1A 3URYA 4G57A 1HHVA 5KEEA 3I4LA 3QO2A 3A8KE 3GTGB 3J7AF 1RTOA 4LMQD 4B9XA 1PFBA 1CFMA 1LTSD 3PUXA 3IFTA 1UUPA 2B2UA 3H0GB 2YYZA 3OW7A 1F9QA 1Q3LA 2B2WA 2Z4HA 1TU2B 2OEOA 2KQ3A 1I4XA 3TP8A 3IFDA 3OSOA 2ICIA 1I4RA 2B8GA 2ZXOA 3V05A 3MC0B 2G9HD 2M2LA 1BDOA 1TWCB 3E0JA 1H9KA 1DOKA 2XNAC 3M4YA 1BCPF 2JA5B 2A6ED 1DZ1A 4PQXA 1R4QB 1B1ZA 1QOHA 5EJWA 1JWMD 3Q6SA 4B9WA 2L4NA 3T51B 1STAA 3DMUA 1YNNC 4HCEA 2RSNA 4DXFA 1PLFA 1ENAA 2A6EC 1I6HB 5IT9L 5J39A 2XWBB 3FKIB 1VMCA 5EKKA 3MXNA 4DN4M 1NAPA 1CA5A 1BBXC 4DAPA 4PNYA 2B2VA 1AFPA 1HUNA 1XWEA 2F0SA 2K6AA 1STNA 1EYCA 4XYOA 3EQLC 2F0KA 4RGTA 3KF8A 1OXTA 2FMCA 3A54A 4QB4A 3PUYA 2DY8A 5G3LD 5C0XG 3NTHA 1SNPA 4RGMA 2SNSA 3OHXC 3BVGA 3C1FA 3H94A 1S5ED 1RCVD 2C5CA 5ELBA 2X6GA 2H4OA 3P7JA 4BS9A 4DNRB 1TS2A 2XVSA 3GTMB 5KYLA 2D9UA 4C3JB 2PCFB 3QG1A 1RHPA 5I2XA 1SJHD 4NMZA 4CHTB 4KJNA 4TSSA 2KA7A 1ZYRD 1ICWA 2VXWA 3FVQA 1SNDA 5IGEA 3SHLA 1SJED 5EBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XX8 A;  1B3A A;  3MTS A;  1ML0 D;  1C8C A;  1HUM A;  1U4R A;  2JP1 A;  2RSN A;  4O42 A;  5CBE E;  5E4W C;  4HED A;  1IL8 A;  1WTP A;  1AZP A;  2L11 A;  1MGS A;  1A15 A;  5EQ0 A;  1O7Y A;  2K28 A;  1IKM A;  2XIW A;  2HDL A;  2KUM A;  1PLF A;  1B53 A;  3KUP A;  1PDQ A;  1BNZ A;  1F9S A;  2NYZ D;  3G7L A;  3H91 A;  1WTQ A;  1LV9 A;  1VMC A;  3GV3 A;  3SVM A;  4RWS C;  4DN4 M;  2L12 A;  1SDF A;  3I91 A;  4ZAI A;  1EL0 A;  1NAP A;  1RTN A;  2RA4 A;  1CA5 A;  2N55 A;  2X69 A;  1O7Z A;  1BBX C;  3LWE A;  1CA6 A;  1DOM A;  1X3Q A;  2K01 A;  1WTX A;  2B2V A;  3D6W A;  2EE1 A;  4QUF A;  2K03 A;  1U4M A;  2Q8R E;  1EQT A;  1HUN A;  1NR4 A;  4NW2 A;  2HCC A;  3ONA B;  1E0B A;  4X3K A;  1HFN A;  5E4X A;  1ROD A;  4UAI A;  1NR2 A;  2NZ1 D;  3GV6 A;  1WD1 A;  1AZQ A;  1QNK A;  1G2S A;  2EPB A;  1WVL A;  2MPM A;  1ILQ A;  1JIC A;  1EOT A;  2X6L A;  3FDT A;  3N52 A;  5T1I A;  1WTV A;  1WTW A;  5EPJ A;  2B2Y A;  1J8I A;  2RVL A;  2K05 A;  4RA8 A;  2MP1 A;  4XT1 B;  3DEO A;  4X3S A;  1NCV A;  1HHV A;  3QO2 A;  1B50 A;  1DON A;  1F9P A;  2IL8 A;  1RJT A;  1J9O A;  2MGS A;  1PFM A;  4R9W A;  2B2W C;  2B2T A;  3F2U A;  1RTO A;  2K04 A;  1MSH A;  3HP3 A;  4LMQ D;  4OIK A;  5D65 A;  2DY8 A;  1PFB A;  1VMP A;  1JE4 A;  2FHT A;  2RSO A;  3I8Z A;  1KNA A;  4IUP A;  1F2L A;  4CJ2 C;  4CJ0 B;  4R8I A;  2HUG A;  1S4Z A;  2B2U C;  2B2U A;  2BDN A;  2K1B A;  5EKI A;  2L9H A;  1HRJ A;  5CBA E;  2KED A;  5AFW A;  1F9Q A;  2N88 A;  1X32 A;  4HAE A;  1F9R A;  1SAP A;  2JYO A;  2SDF A;  4QUC A;  1MI2 A;  4IUU A;  1Q3L A;  2B2T C;  2B2W A;  2X6G A;  4X3U A;  2HCI A;  1MSG A;  1HFG A;  1U4L A;  1IKL A;  5COY A;  5COR A;  2FIN B;  3P7J A;  1CM9 A;  4IUR A;  1HA6 A;  4MHE A;  3TZD A;  3UI2 A;  1QE6 A;  4ZKC B;  5D14 A;  3FPU B;  1EIG A;  4RAU C;  2B2Y C;  2J7Z A;  3DM1 A;  3IFD A;  4ZK9 B;  1G6Z A;  4CJ1 B;  1B4O A;  1PFN A;  3I90 A;  2KVM A;  3KBX A;  2CVR A;  1KNE A;  4ZLT F;  2KEC A;  2L1B A;  1WTR A;  4IUT A;  1SSO A;  4XT3 B;  1O80 A;  3IL8 A;  2FMM A;  2HDM A;  4MN3 A;  2DY7 A;  4U68 A;  3I3C A;  4HSV A;  1ZXT A;  2D9U A;  1DOL A;  1X3P A;  4ZKB B;  2M2L A;  4HCS A;  1BO0 A;  1RHP A;  5JJZ A;  2FFK B;  5DNF A;  1G91 A;  1AP0 A;  1QG7 A;  2B2V C;  3DEP A;  3TN2 A;  1WTO A;  1GUW A;  3MWY W;  3R93 A;  1M8A A;  1ESR A;  1DOK A;  1B2T A;  2H1E A;  4IUV A;  4X3T A;  1DZ1 A;  1XYI A;  1U4P A;  2R3Z A;  1ICW A;  5CMD A;  4OIJ A;  5EPL A;  2VXW A;  5EJW A;  2MJ8 A;  1BF4 A;  1G2T A;  2KOL A;  3Q6S A;  1EIH A;  5EPK A;  4XDX A;  2EOT A;  5T1G A;  2FJ2 A;  2L4N A;  2NWG A;  1WD0 A;  4IUQ A;  1ILP A;  2Q8T A;  1TVX A;  2KEE A; 
#chains in the Genus database with same CATH topology
 1XX8 A;  3M3Y H;  3L7Z C;  2Q2T A;  1K8G A;  4QL5 A;  4A3L G;  4M8A A;  5EQ0 A;  1TS3 A;  5C44 G;  1EY9 A;  1HZB A;  3P75 A;  4OHJ A;  4DAM A;  3H91 A;  1FYC A;  4HTH A;  4RH6 A;  2CWP A;  1Z6H A;  5BN3 A;  2L12 A;  5AJ3 Q;  4ZAI A;  4ZUI A;  4A3D B;  2Z6B A;  3SK5 A;  4KTA A;  4RHR A;  2CKZ B;  4JYA L;  5CYU A;  1CA6 A;  2B39 A;  2XRQ D;  2JA5 H;  4QUF A;  4FF1 A;  4A3E B;  2EYP A;  1EY4 A;  1Y8O B;  3JAM c;  3U9S A;  2Q8R E;  3VA5 A;  2I0Q A;  2Q2I A;  2NVT B;  3LNN A;  5EBD A;  2K5Q A;  2EY5 A;  3NEL A;  3N52 A;  5T1I A;  3E9H A;  4ME5 A;  5BN4 A;  5HGT A;  1EUJ A;  3S1N H;  3S1Q H;  3HOX G;  2YTX A;  4X3S A;  2EY6 A;  3MFG A;  3SK4 A;  4IFD J;  1B8A A;  1OXU A;  2A1A A;  3SEB A;  5D3D A;  2A69 D;  1S5C D;  2ZJP A;  3NK9 A;  2MQH A;  1SFO H;  1VQ7 A;  3HOV H;  2F0L A;  1G51 A;  2BDN A;  2F3W A;  2P5Z X;  2PZU A;  5C3X A;  3HOY B;  2F0D A;  2OT2 A;  1EY8 A;  4KI0 A;  3FEW X;  1CQV A;  3NBI A;  2MFI A;  3M7G A;  1DM0 B;  3A56 A;  3QIA A;  3ULP A;  3QB3 A;  4IJL A;  4DV3 Q;  3GTO B;  4R8N A;  3WDN A;  1VQD A;  3GTO H;  2PMZ B;  2UXB L;  1PH1 A;  2KEC A;  1SNC A;  4QMG A;  3ER0 A;  5J1Z A;  1YZ6 A;  4BBR H;  2KHJ A;  3TRZ A;  5M5Y B;  3HOV G;  1YIT A;  1A6X A;  2CHB D;  1K3R A;  1G91 A;  2FFK B;  5IT9 E;  1IW7 C;  3HOU B;  3TN2 A;  1E2Z A;  2B63 H;  3L9A X;  3M9B A;  1GUG A;  1ONL A;  5ISR A;  4GZY C;  2EYL A;  1VQI A;  1G2T A;  3OIQ A;  1JE5 A;  2KHS A;  2E5L Q;  4GOP C;  1I50 H;  4B08 A;  4P73 A;  4IPD A;  1SR3 A;  1B7Y B;  4HED A;  3HGB A;  1KL9 A;  1WTP A;  2ASB A;  1EYA A;  1MJE A;  3CCJ A;  1IKM A;  2IW3 A;  5FJ8 H;  1SRO A;  2LXK A;  2UUA Q;  1SYE A;  2XWJ B;  3RLN A;  4P75 A;  4A75 A;  2BOS A;  2R92 G;  1XPU A;  3TME A;  5IGD A;  2WAQ B;  3A7L A;  1JR0 D;  3OIP A;  3D8G A;  4R1J A;  2ID0 A;  2EIF A;  1ZEQ X;  3DWQ A;  4AQY Q;  1VQ9 A;  1DD2 A;  2DN8 A;  1CSQ A;  1BBW A;  2NTT A;  1STH A;  1S72 A;  2E2H B;  3EJI A;  3K58 A;  2EXD A;  2JA6 G;  1IBM Q;  1TWH H;  1WD1 A;  3PF5 A;  3D4W A;  3RLO A;  1Y1V B;  3FDT A;  1VF5 C;  4EGV A;  4BBR B;  2K5W A;  4RA8 A;  1BQQ T;  5CC4 A;  2QCP X;  4JVZ A;  3CC4 A;  2A69 C;  1IYU A;  2JA5 G;  1QNU A;  4OXP A;  4JI7 Q;  1ASY A;  3C46 A;  1EWI A;  3I70 A;  1ZKO A;  2ZM6 Q;  3S14 B;  1ET6 A;  5ELO A;  2KCT A;  5EKI A;  2QKI C;  1A2U A;  2I5H A;  2Z6K A;  3ERS X;  2F0I A;  1Y8P B;  4HAE A;  3PGZ A;  3W1G A;  3CQZ B;  2CCZ A;  1CHP D;  1GUS A;  3HFZ B;  1G6Z A;  2J7Z A;  4HID A;  1Y1V H;  4NDX A;  4OO1 G;  2BA0 A;  5ELF A;  2KVM A;  1TWA B;  2L55 A;  4NXN L;  3IL8 A;  5I2Y A;  1RL2 A;  1KAA A;  3MHB A;  1EU3 A;  2KCN A;  2EJF C;  2CW0 D;  4OON A;  3UDF A;  4NPS A;  4PG3 A;  4RKB A;  2Y0S B;  3VYT A;  4B3R L;  1JOK A;  3DUZ A;  3Q0A A;  1M8A A;  4RFB A;  3I4M G;  1HQR D;  1NSN S;  2DUD A;  4JI2 Q;  3PF4 A;  4NP5 A;  3CCL A;  3CU7 A;  4KKU A;  4LF9 Q;  5E4W C;  1VQC A;  1YNN D;  4O42 A;  4CBV A;  2EJM A;  3E9I A;  1WFQ A;  2ICE C;  4R4I A;  3U50 C;  2IX1 A;  4K0K Q;  1B3Q A;  3N6R A;  4TVA B;  1IBM L;  1N34 L;  1STY A;  1K8A C;  1TWF H;  3SVM A;  4LF5 Q;  1SDF A;  3PIO 3;  4A76 A;  3J7A 5;  3A7A B;  3I4O A;  1CKM A;  4H44 C;  1UE5 A;  2VNU D;  3MXU A;  3CQZ H;  3HOZ G;  4DPG A;  2PO4 A;  1KLG D;  4RGN A;  4ILW A;  4QJF A;  3TBI B;  4JBJ A;  2WKC A;  1UAP A;  3U9O A;  4XQJ A;  2EPB A;  1XNQ Q;  5LMN Q;  4N8X 1;  4C3H B;  4YWK A;  3GTM H;  2K05 A;  4ME3 A;  2EVB A;  5L37 A;  4LF8 L;  3BDL A;  1RJT A;  1PH6 A;  4LF7 L;  1QVF A;  2Z0S A;  3SK6 A;  3AYH B;  4R4O A;  1C48 A;  1CI3 M;  1WJJ A;  4JOI A;  4CJ0 B;  1BUV T;  3I4N B;  3VR6 A;  4L5R C;  3Q22 A;  1PRT B;  3IAY A;  1KHI A;  5C6A A;  3IKJ A;  1TWC H;  3PO3 G;  1YHQ A;  1PH5 A;  3D6C A;  2K14 A;  1MI2 A;  1W6K A;  5C0X H;  1ENF A;  4MTN A;  4CDC C;  4B3S L;  1NMF A;  4LFA L;  4DR3 L;  3R3O A;  3AU7 A;  4A3M G;  1T9H A;  3D4R A;  4RAU C;  4TRD A;  3KF8 B;  5HGQ A;  1Q8I A;  1MIU A;  3S2D B;  1AN8 A;  4IUT A;  2FMM A;  4MIU A;  1HZC A;  1F77 A;  5DEH A;  1A8V A;  3FKI H;  1Q46 A;  3A8J E;  3OWF A;  4YWL A;  1HZ9 A;  3P20 A;  4O0A A;  1HNW L;  4XIG S;  4A3I B;  4WJW A;  5GAE C;  3F1Z A;  1VQF A;  4P74 A;  2F0O A;  1Q7Y C;  3S15 H;  3S15 B;  2OCE A;  1D5X C;  1VF7 A;  4ZYS A;  4KY7 A;  2Q8T A;  2KHI A;  1VQL A;  3GTP B;  1RIP A;  4DFA A;  1XTD A;  2JA7 H;  1PYW D;  4UP7 A;  3TP7 A;  3OTO Q;  1AZP A;  1VDZ A;  1QB5 D;  3D0F A;  1LTB D;  4N8F A;  4GOP A;  2HDL A;  3CC2 A;  5C4J H;  2BH2 A;  5M3F G;  4A3K G;  1UNS A;  1C9O A;  2NYZ D;  4C3H H;  4XXE A;  1F2Y A;  3J7Y W;  1TT2 A;  3UE1 A;  4DV6 L;  5IGB A;  3FRP B;  3I91 A;  1A3U A;  1CSP A;  1II3 A;  1IYJ B;  1AE2 A;  1KRS A;  3S17 H;  1YIJ A;  3NTI A;  1XTC D;  2OTJ A;  4DK1 A;  1KDA A;  1ILQ A;  4WRD A;  3T1Y L;  4KD4 A;  3JC6 6;  2EYH A;  2AQ3 B;  1NE3 A;  1TQO A;  3BG3 A;  5IIF A;  2GN5 A;  3DEO A;  3Q23 A;  2D0O A;  3FPP A;  3GTQ H;  2OWO A;  1RF2 D;  2YTY A;  1PFM A;  5G3L F;  1J5E L;  3BZK A;  3HRZ C;  1MSH A;  1O78 A;  1JT8 A;  1BCP C;  2Y0S E;  2Z4I A;  4IAL A;  1HPC A;  1KNA A;  1E1T A;  2E74 C;  1WCM B;  1BKB A;  5JJL A;  2R93 H;  1X32 A;  1SAP A;  4QUC A;  3M4Q A;  3L3O C;  3J80 E;  4A3G H;  4A3G B;  2HHH L;  2NZH A;  1MSG A;  3S1Q B;  5COY A;  2EYO A;  3TDQ A;  1KXL A;  4YIJ A;  4NKL A;  2F0N A;  4LK1 C;  2NVT H;  4O1N A;  4JI4 Q;  3IRB A;  1UE7 A;  1PRT C;  3ND8 A;  1BVS A;  2F03 A;  1Q8K A;  5IP9 H;  2NN6 H;  2XSC A;  3S1M H;  1YNJ D;  2BCO A;  3GTQ B;  3CCE A;  2JA8 B;  1AP0 A;  3BVM A;  4RHS A;  3VR3 A;  1XYI A;  5CV8 A;  1YHA A;  5EPL A;  5KND A;  4DNI A;  1PHJ A;  2XN9 C;  5C4X B;  3MEH A;  2VQF L;  1EIH A;  4GN5 A;  4LAA A;  3GTL B;  4KLK A;  5M3M H;  2KEE A;  2C35 B;  2R61 A;  1B70 B;  3ULJ A;  2JE6 I;  4GNX C;  1D6E C;  4N9P A;  4GNX A;  3HZX A;  3HOU H;  3DWA A;  1M4V A;  2F4V Q;  1FGU A;  2A74 C;  1B53 A;  4BXX H;  3CCQ A;  3VDY A;  3G7L A;  5CV4 A;  4ZCK A;  1SE2 A;  1H9J A;  5ELN A;  4C1N I;  4IFD G;  2QF7 A;  2L15 A;  4IFD H;  4V19 0;  3UDI A;  1V9P A;  3CKI B;  1IL2 A;  1I94 L;  2K01 A;  3E5S A;  1WTX A;  1EOV A;  4A93 B;  1PH4 A;  3PIP A;  4X66 L;  2VZA A;  1L0W A;  2IHE A;  3G48 A;  2OTL A;  1W6J A;  2WII B;  1BCP D;  4O2D A;  2KEN A;  2PPB C;  4JI3 L;  1S5D D;  2NBF A;  5EPJ A;  1NUC A;  4YY3 L;  3M3Y B;  2TMP A;  4JCV E;  2CWA A;  4KV6 A;  1I4P A;  3WWV A;  1B50 A;  1L2F A;  1FGB D;  1C0A A;  1SMY C;  3HP3 A;  1X3F A;  1HXY D;  4AYB G;  1VMP A;  4KKS A;  4CJ2 C;  1I4Q A;  3CCS A;  2D5D A;  2HUG A;  2K1B A;  2L9H A;  1MBY A;  2O5I C;  2M00 A;  5FLX L;  1WYD A;  4HMI A;  2PZW A;  3KOJ A;  1SXT A;  1HFG A;  4FF3 A;  2DJF C;  2IWH A;  3GP7 A;  2F4V L;  3GTK H;  5NUC A;  1HA6 A;  2RQX A;  5DLQ E;  3J81 c;  5I6Y A;  2CVR A;  4XYQ A;  1KNE A;  4NB3 A;  5M3M B;  3EVQ A;  2DJG C;  3S14 H;  4MN3 A;  3C2P A;  1LTR D;  2KCC A;  1KLU D;  5CV9 A;  5JJZ A;  5IYC H;  2QW7 A;  2RBM A;  2B2V C;  5LMU Q;  2ZXP A;  5I6W A;  1K9M C;  4EQ5 A;  2V4D A;  2OQK A;  4A3B B;  4JBW A;  2NN6 G;  2VL6 A;  5IWA Q;  1BF4 A;  4GN4 B;  1N36 L;  1SYC A;  4DU9 A;  5IYB G;  4DV1 Q;  3GO5 A;  1W2B A;  1HH2 P;  3H3V H;  3KDF B;  3HKZ G;  5TSS A;  4Q0F A;  3HG9 A;  4DUZ Q;  1TS5 A;  4A4I A;  2K28 A;  4MNO A;  2XIW A;  4HSP A;  2R7Z G;  1RKN A;  4NXN Q;  1DCZ A;  3M4P A;  3CCV A;  1PXU A;  5C4X G;  1LV9 A;  1B9N A;  1N32 L;  1K73 C;  3V96 A;  1EWC A;  2IT1 A;  2VB2 X;  3T53 B;  4K6D A;  1LTG D;  4OWT B;  1V8Q A;  3K5L A;  4EQP A;  4CKE A;  4N9T A;  4GOP B;  1X3G A;  5BN5 A;  1CK1 A;  4BA2 I;  3CD6 A;  1G2S A;  2MPM A;  1WTV A;  5GRO A;  1V1P B;  1QJO A;  5LMN L;  1LT6 D;  5LHY 1;  4X62 Q;  4DV2 L;  3G6E A;  2WB1 B;  3QJY A;  2IL8 A;  3HOZ B;  2EY1 A;  1FNW A;  3D3R A;  2MHV A;  3PO2 G;  1HQM C;  4BA1 I;  2FHT A;  3H09 A;  4YCV A;  2B2U C;  1HZA A;  3JAM E;  3I55 A;  1EY6 A;  4HR7 B;  5AFW A;  2N88 A;  4JOI C;  3PUV A;  5C5M A;  4PZ6 A;  2RDF A;  4EVO A;  5I4D A;  3H3V C;  2EJG C;  4FXG C;  2JA7 G;  2BE5 C;  1JC7 A;  4OGQ C;  5COR A;  5IGC A;  1M90 C;  1QE6 A;  4ZKC B;  5J22 A;  4ID6 A;  5JAV A;  4LUO A;  4LWC A;  4QIW B;  4X64 Q;  4JV5 L;  4F87 A;  2XRS D;  4DV2 Q;  3PO2 H;  1VQ8 A;  4K6L A;  5ELC A;  4HSV A;  3F2D A;  3GDE A;  1TWF B;  3UE0 A;  1N8R C;  3TS2 A;  3O13 A;  1D7Q A;  1PFS A;  2JEA I;  3TEH B;  4POF A;  3DEP A;  5C0X I;  3E0E A;  4KY6 A;  2ZJQ A;  2H1E A;  3K6O A;  3FKI G;  5JOB A;  4ALP A;  4JK1 C;  2NB0 A;  1QIL A;  4RG1 A;  3CRL C;  2NWG A;  3A5Z B;  4IUQ A;  2NUC A;  1BCP B;  3I72 A;  1X9N A;  3ZJY C;  4AQY L;  5CBE E;  1JOR A;  1EQR A;  4HJ7 A;  1IL8 A;  4Y7N H;  5KIX A;  4KKT A;  4KN4 C;  4DUZ L;  5EAY A;  4JI0 Q;  1K8M A;  2I07 B;  5FO7 B;  4HIK A;  1WTQ A;  4JI8 L;  1LT4 D;  3EBE A;  4RWS C;  1EZ6 A;  4LUV A;  3H6M A;  4A3L H;  1EL0 A;  2IY5 B;  2JA6 B;  4JW0 A;  1DGS A;  4A3I G;  1H9S A;  2J0T D;  3FMC A;  2K03 A;  1VQJ A;  4L6T B;  5A2Q L;  1EFI D;  2HCC A;  4K0K L;  3VA7 A;  4S3S A;  4HIM A;  4C56 C;  2K4K A;  2VQF Q;  4UAI A;  2JA8 G;  4ULL A;  3T1H Q;  3RZD B;  4UY8 C;  1Y1V G;  1AW7 A;  1VQB A;  2B2Y A;  2UUC L;  3BU2 A;  3I2Z A;  2EQS A;  3NQT A;  1I3Q H;  4A3D G;  4DR2 Q;  2I46 A;  4FF4 A;  2N78 A;  3SDZ A;  4QGU A;  1GKH A;  4LFB Q;  2K04 A;  1STE A;  4BY7 H;  2O5J C;  1BOS A;  1F2L A;  4A3G G;  4JG2 A;  3K7A H;  3K7A B;  1HR0 L;  1QUQ A;  2UXD L;  5KNC A;  2QIL A;  1SE8 A;  1AE3 A;  3VR2 A;  1YI2 A;  4X65 Q;  5E1F A;  5M3F H;  4A3K H;  1PH8 A;  4MTK A;  2UXC Q;  4X3U A;  3A0J A;  3A74 A;  3WOF A;  2HT1 A;  2JA7 B;  2FIN B;  2A8V A;  5D3I B;  4EQO A;  4YCU A;  1EFW A;  3U4Z A;  3EA6 A;  4IJH A;  3KBX A;  3C3L A;  4PZ7 A;  1WTR A;  4LJZ C;  3CCU A;  2E5L L;  3UDG A;  3I3C A;  3I4M H;  1XJV A;  1XXG A;  1LAC A;  2F1M A;  4DNT B;  3RN2 A;  3HOZ H;  4Y52 H;  4HJ9 A;  3QWN A;  5BR8 L;  2ZM6 L;  3J81 E;  2VQE L;  4IUV A;  1SNQ A;  4QF4 A;  2F3I A;  3C1E A;  4FXK C;  4G7H C;  5C4H A;  2IHF A;  4K2K A;  4DR1 L;  5M5X B;  4CKC A;  4A3J B;  2JJQ A;  4CDF C;  3KK7 A;  4DV0 L;  4OO1 H;  2IJ0 A;  1LUZ A;  1N32 Q;  4DF7 A;  2VUM G;  1TVX A;  1GUT A;  1L1O B;  5GAD C;  2NVQ B;  5FLX c;  5M5W B;  4UP8 A;  3KF6 B;  4DKA C;  4K5V A;  4DA2 A;  3J81 i;  4JBM A;  4LW1 A;  1SYF A;  1DXM A;  1EIY B;  1ET9 A;  3K8A A;  5C4J B;  2UXD Q;  1PDQ A;  4BY1 H;  5CV7 A;  1FNV A;  2WKD A;  1U0L A;  5A2Q E;  2R92 H;  3I73 A;  3HOY H;  2UUB L;  4A3C G;  3R2T A;  4JPB W;  2Z9H A;  1X3Q A;  1T5E A;  2Y0S G;  4A3E G;  3SXH A;  1V1O A;  1NR4 A;  1Y1W G;  3J81 j;  3ONA B;  2NZ1 D;  3T1H L;  1HA5 A;  1LT5 D;  4XQN A;  1R9T B;  3KLS X;  4NXM L;  1NMG A;  1TXY A;  5A35 A;  5FK9 C;  5CV5 A;  4JI6 Q;  2AMC B;  4JBK A;  4ABN A;  1IHZ A;  4WFN 3;  3L0O A;  2RCN A;  4FYD A;  1J9O A;  2EYF A;  3H15 A;  3DHQ A;  3RR5 A;  4OIK A;  3L2P A;  3W2D A;  3M7N A;  1EU4 A;  4KHZ A;  5CR3 A;  2K33 A;  5CBA E;  4DR4 L;  4DR1 Q;  2RF4 A;  1N9W A;  2EXZ A;  1SEB D;  2ZXR A;  3EIV A;  3T13 A;  2K75 A;  4FNF A;  1JOO A;  1VQO A;  2J4X A;  4DAY B;  1TWG B;  5IOC A;  1G6P A;  3TZD A;  5D14 A;  3FPU B;  3BDC A;  1LAB A;  5GAG C;  4DR2 L;  3QOL A;  2E75 C;  3GTL H;  4WJ4 A;  2V1C C;  1NTG A;  3OMG A;  3GTP H;  1YEZ A;  1X3P A;  4LUZ A;  3H3V I;  5KGU A;  4C1N K;  1BO0 A;  2PNR C;  5DNF A;  1OXS C;  2CQO A;  1I4H A;  1V43 A;  3X3M A;  2ES2 A;  2WV6 D;  1EEI D;  3OOC A;  2AWN A;  4R4Q A;  2PQA B;  4PZ8 A;  4C3J G;  1E7Z A;  4X6A H;  2R92 B;  1KTK A;  1GUO A;  1TWH B;  1L0Y B;  4A3C H;  1F2M A;  1JB7 A;  1WI5 A;  1QUQ B;  4AYB E;  2DGY A;  2EOT A;  1JJ2 A;  4KHP L;  3TS0 A;  4BWG B;  2PYK A;  1FNU A;  2F0M A;  3ICE A;  4DV1 L;  4A3F H;  1EYG A;  1D1I A;  1H9R A;  1TWG H;  1C8C A;  2JP1 A;  2NVY B;  1K0S A;  1MGS A;  3T56 B;  1A15 A;  3J81 L;  5IYB H;  1LYL A;  1K3B C;  3RNU A;  2PQE A;  3PV0 A;  1QCB D;  5BR8 Q;  1K8O A;  3KYH C;  4GLV B;  4YHH L;  3CME A;  3G6J B;  1D8L A;  1JWU D;  1LTA D;  2B8F A;  3CC7 A;  2CW0 C;  1OXX K;  4B3T Q;  1LTT D;  3HOU G;  1I50 B;  3K81 C;  3R2I A;  4IN3 A;  4LF7 Q;  5HUR A;  2HIV A;  1XPO A;  3PMF A;  1HNW Q;  5K36 H;  1E0B A;  4H0L C;  1TII D;  4F88 A;  1I6V C;  2MUY A;  1QNK A;  4JI8 Q;  3CW2 C;  4QQB X;  3JAM i;  1O7L A;  4DR5 L;  3HEJ A;  3PO2 B;  4XT1 B;  1H95 A;  1Y1W H;  4M1U B;  2NVY H;  3LX0 A;  3I56 A;  1PYS B;  1F9P A;  2A68 D;  2UUB Q;  1E2W A;  1D5Z C;  4R9W A;  2F3V A;  1BR9 A;  1PZK D;  5C3W A;  1L1O C;  4IUP A;  2RSO A;  1PTO H;  4PMC A;  4RCN A;  2JN4 A;  3AEV A;  4A3B H;  2B3G A;  2I5L X;  5AJ3 L;  2R93 B;  1Q81 C;  1Z47 A;  2XTI A;  2R7Z B;  3ZYY X;  2B2T C;  2JSO A;  1GOZ A;  3S1R B;  4L5S A;  3KLW A;  3RMH A;  3HKZ B;  4HMJ A;  1Z9F A;  1PH3 A;  3UI2 A;  3F2C A;  3PCO B;  4LNQ A;  1IBL Q;  1G29 1;  3SE0 A;  2EZV A;  4DV4 Q;  4XT3 B;  2AUK A;  4Q5V A;  3MXG A;  2DY7 A;  4J1M A;  4G7Z C;  3KJO A;  4DXG A;  1PA6 A;  3VYU A;  4A3B G;  4ZKB B;  1L1O A;  2YV5 A;  4OX9 L;  4UDU C;  3WOE A;  5JPM C;  3BS1 A;  3KF6 A;  1I4G A;  3MWY W;  4P2C B;  3W1B A;  1NBW A;  2A6H D;  4X3T A;  4XTC S;  5DM7 3;  3JAM L;  5CMD A;  5CV6 A;  4JI4 L;  4J8Q A;  3NHH A;  3STB C;  3CPF A;  5IYD G;  3PIO A;  4FP5 D;  4YCW A;  2RKS A;  1P8L A;  1Q12 A;  1I5F A;  1Y14 B;  4A93 H;  5FLM H;  1B3A A;  5EGT A;  4LF6 Q;  3A8I E;  3RD4 A;  1GJX A;  5M5Y H;  5K36 G;  2RDH A;  4Y7N B;  4BBS G;  1S5F D;  3ERO A;  3MFY A;  2K5H A;  4BBS H;  2D62 A;  1HR0 Q;  2G9D A;  3KUP A;  1EQV A;  2BA1 A;  3K5O A;  4K8I A;  4JI1 L;  1Y1W B;  5GQO A;  2DNC A;  3STB D;  1KAW A;  1RTN A;  2N55 A;  3LWE A;  5HY6 A;  2Q2H A;  2MO1 A;  2NTS A;  3D6W A;  4C3I H;  2O2L D;  1GUN A;  4B3M Q;  3NEM A;  1SMY D;  1K83 H;  1WVL A;  3PQI A;  3TSS A;  3SR1 A;  4AYB B;  2A73 B;  2MO0 A;  5KNB A;  1GD7 A;  1YNJ C;  2QEJ C;  1SLJ A;  1FR3 A;  1GM5 A;  3KLR A;  4DGZ A;  4KMU C;  2B2W C;  1XMO L;  3OMC A;  4J15 A;  4ZRZ A;  5D65 A;  3DLL A;  1LLR D;  1M1K C;  2GA4 B;  3AB9 A;  3CP0 A;  1CZG A;  2L5T A;  5C3E G;  1TKW B;  2KED A;  5IWA L;  5FO8 B;  2DNE A;  2I5M X;  4G4K A;  2UUC Q;  4IUU A;  2EDG A;  2B63 G;  1VQG A;  1SN8 A;  4TKO B;  2VB3 X;  5LMU L;  4JI7 L;  4B3T L;  3NPP A;  1R4P B;  5GAH C;  1JWS D;  2SNM A;  4CKB A;  5IYC G;  3V2T A;  4WJ3 M;  2LSS A;  1B4O A;  3I90 A;  1WOC A;  2L1B A;  4YY3 Q;  5E3F A;  3D4D A;  3I4N H;  4IQZ A;  3K5M A;  3OPO A;  4U68 A;  1ZXT A;  3OW2 A;  3H0G H;  2E2I H;  2YU9 H;  1PTO D;  4IZ8 A;  4GNX B;  4BBS B;  1C4Q A;  3NWT A;  3R93 A;  4DAY A;  1ESR A;  3S9W A;  5FLX E;  1PRT F;  4LF4 L;  1TS4 A;  4PMB A;  4H7B A;  2JQO A;  4OO1 I;  1U4P A;  2F4I A;  2LS0 1;  2PZT A;  5E7N A;  1B9M A;  3T16 A;  5IP9 G;  5M9O A;  2VW9 A;  2IX3 A;  3NXW A;  2A19 A;  4DR4 Q;  4UPA A;  5T1G A;  3TZU A;  4F7X A;  4POG A;  4C3I G;  4X3K A;  2LMC B;  4GS3 A;  1CKN A;  2RDG A;  5IT9 c;  3HOW B;  2L11 A;  4K5X A;  1JJG A;  1Y69 U;  5IP7 G;  1TY0 A;  3ITP A;  2F0F A;  2OXP A;  3S24 A;  4HJA A;  2LFN A;  1K28 A;  2K5V A;  1I3Q B;  1N36 Q;  4KJO A;  1CZW A;  4XQQ A;  1A63 A;  1FJG L;  1S3O A;  1E22 A;  1Q82 C;  1CKO A;  5FLM G;  1LT3 D;  2EE1 A;  1KIX A;  2AUJ D;  1EQT A;  3LWU A;  3KBG A;  1HFN A;  2KCM A;  2H5X A;  2F0T A;  4QIW E;  3CHB D;  2F0P A;  3NQI A;  2LKV A;  5LL6 S;  2ZJR A;  4GKK Q;  4LF6 L;  3VYS A;  4FDB A;  5ELD A;  3Q8D A;  3SK8 A;  3I4M B;  1RD9 D;  2Q8I B;  4I65 A;  1GXD C;  2A5H A;  2QEX A;  5KYI A;  5JPN C;  1Z7T A;  4IFD I;  4UP9 A;  1U9R A;  1HJP A;  2K50 A;  3MXN B;  4A93 G;  4R4C A;  3H0G G;  3S2H B;  4C2M B;  3E3X A;  2IPK D;  1GHK A;  3B6Y A;  3W5O A;  1UWV A;  3NUC A;  4IPH A;  4X62 L;  1IKL A;  3RZO B;  1DYQ A;  4L8J A;  1S5B D;  1SYB A;  4HN7 A;  4IUR A;  3GTG H;  4MHE A;  1HNZ L;  3HOY G;  1EIG A;  1CKN B;  1IBK Q;  2SEB D;  2ENB A;  1CHQ D;  1CT1 D;  5C0X J;  4X64 L;  4JV5 Q;  5IGF A;  2E76 C;  4KY5 A;  4FO2 A;  1PTO F;  1EQQ A;  1E24 A;  4DK3 C;  5C5L A;  5IGG A;  1K0R A;  5FOB B;  1SMX A;  1GUW A;  3GQB A;  3RUZ A;  3T4A C;  2HHH Q;  1E3P A;  5EKL A;  3DWP A;  4LFC Q;  4OIJ A;  5J3B A;  4KN7 C;  1YBY A;  4L5T A;  2O4X A;  1KDC A;  3KLS A;  5FJ8 G;  2QDB A;  4ZQ3 A;  4RCO A;  2AQ1 B;  3TRE A;  1D1K A;  2F0G A;  2ZTD A;  1X6O A;  1PVO A;  2UU9 Q;  3GTJ B;  3J80 L;  3PUW A;  5I9P A;  2R6G A;  3OWE B;  2OF1 A;  1BNZ A;  5C44 B;  3SGI A;  1X56 A;  2KJX A;  3GV3 A;  5C4X H;  4A3M B;  2AQ2 B;  1WTH A;  3MAQ A;  2F0W A;  5JVH 3;  1JB3 A;  1HTP A;  4LF8 Q;  2R7Z H;  2M9V A;  1OTC A;  4BY7 B;  3KDF A;  1U4M A;  2HIX A;  3M85 A;  1SYD A;  5E4X A;  2HQL A;  4DR7 Q;  1AZQ A;  1GHJ A;  1RDP D;  4X65 L;  1MHW C;  4I7Z C;  3AFP A;  4APV A;  3TP5 A;  3TP6 A;  2UXC L;  1WTW A;  4BY7 G;  3W3A A;  2N49 A;  5FO9 B;  3GTJ H;  1A2T A;  1I94 Q;  3MEF A;  1DON A;  2XGT A;  2HD3 A;  2N3S A;  2MGS A;  2B2T A;  4G7O C;  4DV3 L;  2VUM B;  4IUN A;  4A3F G;  3I8Z A;  1N34 Q;  1LTI D;  1IBK L;  4A3J G;  1WCM H;  4OEL B;  1D5M C;  2Q2U A;  4R4T A;  1HCZ A;  2PW5 A;  4UHV A;  4GLX A;  5FKA C;  2HCI A;  3J7Z C;  1U4L A;  3RZO H;  2F0V A;  1DJR D;  1H9S B;  5LL6 X;  4E6I A;  3DM1 A;  2CQA A;  1R9T H;  3MXP A;  2K32 A;  1SSO A;  1UEB A;  1O80 A;  3S1N B;  5K5P A;  4DV5 Q;  4C3J H;  1EY0 A;  4DV7 Q;  3CPW A;  1JCK B;  1DOL A;  1MJC A;  2YTV A;  3X3N A;  5IOD A;  1VQK A;  4HCS A;  4DAV A;  3NSW A;  4OL7 A;  2UU9 L;  1EEF D;  4H13 C;  3K0X A;  2FXQ A;  4B3S Q;  1IW7 D;  1HTL D;  1T5X D;  2CH4 W;  2TSS A;  1Q86 C;  1BBU A;  1PTO B;  3OYY A;  2UUA L;  2F0U A;  2JXM B;  4IPC A;  3DM3 A;  2MJ8 A;  2GVA A;  1CUK A;  2E2D C;  4DV5 L;  1Y8N B;  2FJ2 A;  1E1O A;  4DV6 Q;  4A3F B;  4KK7 A;  1HUM A;  3K59 A;  2A6H C;  2JEB I;  4H02 A;  4DK0 A;  2K7V A;  3Q24 A;  4P71 A;  3K0Y A;  1Q1B A;  3CAM A;  1SNM A;  1JQY D;  1MD2 D;  4BY1 B;  2NN6 I;  2WFW A;  1D2B A;  3NE5 B;  3CF5 A;  3P1H A;  3RLF A;  1XNQ L;  3PIP 3;  3I7F A;  4A3M H;  4OWW B;  3PO3 B;  3CXC A;  2ZT9 C;  1P16 A;  4K8J A;  2NVX H;  4FF2 A;  2VUM H;  3M4O B;  1XNR Q;  4NW2 A;  4DR3 Q;  3J7A V;  5JJI A;  3ND9 A;  1H9M A;  4IOA A;  2BH8 A;  1V1P A;  1QVC A;  1A3V A;  4OEM B;  4LFC L;  2LXJ A;  1SNO A;  1X54 A;  5C4Z A;  1NNX A;  4KD3 A;  1QWY A;  4P72 A;  1YJW A;  4C3H G;  2RVL A;  3BJU A;  1A62 A;  2F52 A;  4HJ8 A;  4A3D H;  1KC8 C;  4JC0 A;  3A55 A;  3F2U A;  4RGO S;  5LMN W;  1I6H H;  1X3E A;  4B3M L;  4LFA Q;  3CMA A;  1AH9 A;  1JE4 A;  4K14 A;  3LGJ A;  4R8I A;  1VQM A;  4RKL A;  1S4Z A;  3NTK A;  2HQE A;  4IPG A;  2Z1C A;  1YHB A;  1VQA A;  4BXX G;  2JYO A;  3NWS A;  4FVM A;  4L5Q A;  1OXV A;  1SE4 A;  1B44 D;  4C3I B;  4GKJ Q;  1STG A;  3KFU A;  1CQF A;  4Z9C B;  5KRU A;  1QVG A;  1V1Q A;  1OO9 B;  3HKZ E;  4ZK9 B;  4CJ1 B;  1PRT D;  4AIM A;  1ASZ A;  4ZLT F;  4FXD A;  4L63 B;  2F0H A;  3PUZ A;  1TY2 A;  4EQN A;  2HDM A;  4YHH Q;  1WCM G;  1PZI D;  2E2J H;  1QZH A;  4QCL A;  1UEA B;  3VR5 A;  1VCI A;  3VR4 A;  5I9O A;  2BE5 D;  1N33 Q;  1QG7 A;  2Z8L A;  1F2Z A;  3S1R H;  1YVC A;  3HOV B;  3GTK B;  2R3Z A;  2EY2 A;  2F0E A;  1EIF A;  1KDB A;  1EWH A;  5DM6 3;  1ESF A;  3ERQ A;  5EPK A;  3ULL A;  1Q1E A;  4IO9 A;  4DV7 L;  1KQS A;  4PMW A;  3U4V A;  1ILP A;  2NVX B;  3PSI A;  2EYJ A;  4DR5 Q;  1HR0 W;  1ML0 D;  3D31 A;  4KHV A;  1U4R A;  3EFX D;  3K57 A;  1NJI C;  1O7Y A;  1CTM A;  1EYD A;  4J6H A;  3NBH A;  3BYY B;  3NEN A;  2N8N A;  5JEA H;  1AEX A;  1HNX Q;  4LF9 L;  3S1M B;  3BDO A;  4U67 3;  1UE1 A;  4C2M H;  2PW7 A;  2D2C C;  1Q90 A;  2RA4 A;  2X69 A;  1O7Z A;  5JEA J;  2IX0 A;  2QA4 A;  1DOM A;  5M3F B;  4A3K B;  3MA2 B;  3FHW A;  3QR8 A;  1PZJ D;  4YWM A;  3BYT B;  2QDL A;  4JI5 Q;  1ROD A;  4OWX B;  3GV6 A;  1IYV A;  1K83 B;  4K2L A;  4JI0 L;  3RN5 A;  2WAC A;  1EOT A;  3K5N A;  4GKK L;  1L0X B;  4BBR G;  2PNH A;  1XMQ Q;  3E6Z X;  2E2J B;  1E2V A;  1NCV A;  1SBB B;  2K5N A;  2AHO B;  2L0C A;  3HOX H;  1VQE A;  3HOX B;  1SFO B;  3GD7 A;  2WP8 J;  2F0J A;  1YJN A;  2K5D A;  4WOR A;  1HRJ A;  1MKH A;  5CGK A;  3AMU A;  2YU9 B;  2WAQ G;  4PV1 C;  1F9R A;  2SDF A;  1PTO C;  2F0Q A;  2AWO A;  4OX9 Q;  1PH7 A;  1S40 A;  4GKJ L;  2MNA A;  2E2H H;  4MZ9 A;  2B29 A;  1J6Q A;  1CM9 A;  1W3S A;  1A3T A;  4DUY L;  2B2Y C;  1HNZ Q;  1VQ5 A;  3CCM A;  1PFN A;  1YJ9 A;  2WIN B;  3S2D H;  3S16 B;  1XMQ L;  1UE6 A;  1KD1 C;  1EY7 A;  4LF5 L;  3U58 A;  3CRK C;  1SRU A;  3BVZ A;  5ELE A;  1WTO A;  4TQU S;  1EZ8 A;  2KBN A;  2B63 B;  4V0B A;  1B2T A;  2JA9 A;  1NY4 A;  1PMR A;  3QOJ A;  4CGY B;  4DR6 Q;  3I4N G;  2LY7 A;  2KOL A;  4XDX A;  2WAQ E;  2R7F A;  1WD0 A;  1HNX L;  5IE8 A;  4QY7 A;  4HIO A;  1SYG A;  1STB A;  1KAB A;  3BZD B;  1TR5 A;  3MTS A;  5JVG 3;  1ENC A;  2A68 C;  1LO5 D;  3NP8 A;  2ZTE A;  4K5W A;  2KUM A;  1YNX A;  2R7D A;  2PQA A;  2QGQ A;  5F2D A;  1F9S A;  5C44 H;  1BXT A;  5C3E H;  4ZUJ A;  3BZC A;  5C3E B;  5M3M G;  1IBL L;  2E2I B;  3R8B A;  1PH9 A;  2ATW A;  4AH6 A;  3HKS A;  1C7Y A;  4CDD C;  2JA6 H;  1JOQ A;  3VYR A;  1LTL A;  2EYM A;  2PI2 A;  1XMO Q;  3HS0 C;  4F8M A;  3S17 B;  3HOW H;  3MVV A;  1ZYR C;  2SOB A;  1NR2 A;  3MZ5 A;  5DAU A;  1SE3 A;  1FD7 D;  1JIC A;  2X6L A;  3DXJ C;  4ODG A;  2C9O A;  4JI6 L;  5JEA G;  1EY5 A;  2BDO A;  1G8Z D;  2JK8 A;  4NXM Q;  1J8I A;  2MP1 A;  3URY A;  4G57 A;  1HHV A;  2CH4 A;  3I4L A;  3QO2 A;  5KEE A;  3A8K E;  3GTG B;  2PMZ E;  1J5E Q;  3J7A F;  1QZG A;  4HJ5 A;  1RTO A;  4LMQ D;  1KRT A;  4DUY Q;  1IZ6 A;  4B9X A;  5JJK A;  1PFB A;  4DK6 C;  1CFM A;  2VQE Q;  1LTS D;  3PUX A;  3IFT A;  1UUP A;  2B2U A;  3H0G B;  3S2H H;  2YYZ A;  3OW7 A;  1F9Q A;  2E8G A;  4JI1 Q;  3RZD H;  1Q3L A;  3T1Y Q;  2B2W A;  2Z4H A;  1TU2 B;  2WB1 E;  2OEO A;  4EX5 A;  5M5W H;  2KQ3 A;  1I4X A;  3TP8 A;  1PYB A;  3IFD A;  2RHQ B;  3J80 c;  3OSO A;  1TWA H;  4DR6 L;  3S16 H;  2ICI A;  4CDE C;  1I4R A;  2B8G A;  2ZXO A;  1VQN A;  1U5K A;  2K52 A;  3G4S A;  3K80 C;  4DV0 Q;  3V05 A;  3MC0 B;  4I7A A;  3CCR A;  1VQ4 A;  2G9H D;  2M2L A;  1BDO A;  1TWC B;  3J80 i;  3E0J A;  1H9K A;  5H1S E;  1PV4 A;  3OTO L;  1DOK A;  2XNA C;  3M4Y A;  1BCP F;  2JA5 B;  2A6E D;  4LF4 Q;  3F8T A;  1DZ1 A;  4PQX A;  1R4Q B;  1B1Z A;  1VQH A;  1QOH A;  5EJW A;  5M5X H;  1X55 A;  4DR7 L;  2R93 G;  1JWM D;  3Q6S A;  4JYA Q;  1X65 A;  4B9W A;  5IP7 H;  2L4N A;  3T51 B;  2D0P A;  1STA A;  3DMU A;  1YNN C;  4GLA C;  4HCE A;  3K7U C;  1FJG Q;  2RSN A;  1LM0 A;  4DXF A;  5IY0 A;  3HOW G;  2GVB A;  1PH2 A;  1PLF A;  1ENA A;  2A6E C;  2PI2 E;  1I6H B;  1VQP A;  5IYD H;  5IT9 L;  5J39 A;  4JI3 Q;  4BY1 G;  4IOC A;  2ALY B;  3FP9 A;  2XWB B;  3FKI B;  1VMC A;  3TQY A;  5EKK A;  3MXN A;  4DN4 M;  2VY3 A;  1JMC A;  1NAP A;  1CA5 A;  1XPR A;  1BBX C;  4DAP A;  4PNY A;  1O7I A;  1IXR A;  2B2V A;  3KJP A;  1GO3 E;  4A3E H;  2NVQ H;  1AFP A;  1HUN A;  4LFB L;  2UXB Q;  1XWE A;  2F0S A;  2K6A A;  3NBH B;  2CFM A;  3A5U A;  1VQ6 A;  1STN A;  1EYC A;  2ZTC A;  4XYO A;  3EQL C;  2F0K A;  4RGT A;  2RHS B;  1OXT A;  3KF8 A;  4GN3 B;  2FMC A;  3A54 A;  4QB4 A;  3PUY A;  4A3I H;  3EN2 A;  2DY8 A;  2OQ0 A;  5G3L D;  2NZO A;  5C0X G;  3NTH A;  1SNP A;  4RGM A;  2SNS A;  3OHX C;  3BVG A;  2RCF A;  4JI2 L;  3C1F A;  3H94 A;  1S5E D;  1RCV D;  2C5C A;  5ELB A;  2X6G A;  4X66 Q;  3G71 A;  2H4O A;  2WB1 G;  3UDX A;  2G5D A;  1FL0 A;  4B3R Q;  3P7J A;  4BS9 A;  3AQQ A;  1VS0 A;  4JI5 L;  4A3J H;  4DNR B;  2AKW B;  3F2B A;  1TS2 A;  2XVS A;  2Z6K C;  1FVI A;  3GTM B;  5KYL A;  1A0I A;  4KHP Q;  2D9U A;  4C3J B;  2PCF B;  2VS1 A;  1JJC B;  1GVP A;  3QG1 A;  1N33 L;  2JA8 H;  1RHP A;  5I2X A;  1SJH D;  4NMZ A;  4CHT B;  4KJN A;  4TSS A;  2KA7 A;  3M4O H;  1ZYR D;  1XNR L;  3AFQ A;  1ICW A;  2VXW A;  3FVQ A;  1SND A;  3PO3 H;  1ICF B;  5IGE A;  3SHL A;  4RMF A;  1SJE D;  5EBC A;  4DV4 L; 
#chains in the Genus database with same CATH homology
 1XX8 A;  3L7Z C;  4M8A A;  5EQ0 A;  1TS3 A;  1EY9 A;  3P75 A;  4OHJ A;  3H91 A;  1FYC A;  4HTH A;  4RH6 A;  1Z6H A;  5BN3 A;  2L12 A;  4ZAI A;  4ZUI A;  4A3D B;  3SK5 A;  4KTA A;  4RHR A;  5CYU A;  1CA6 A;  2B39 A;  2XRQ D;  4QUF A;  4FF1 A;  4A3E B;  2EYP A;  1EY4 A;  1Y8O B;  3U9S A;  2Q8R E;  3VA5 A;  2NVT B;  3LNN A;  5EBD A;  2K5Q A;  2EY5 A;  3N52 A;  5T1I A;  4ME5 A;  5BN4 A;  5HGT A;  4X3S A;  2EY6 A;  3MFG A;  3SK4 A;  4IFD J;  1OXU A;  3SEB A;  5D3D A;  2A69 D;  1S5C D;  3NK9 A;  2F0L A;  2BDN A;  2F3W A;  2PZU A;  5C3X A;  3HOY B;  2F0D A;  2OT2 A;  1EY8 A;  4KI0 A;  3FEW X;  1CQV A;  3NBI A;  3M7G A;  1DM0 B;  3A56 A;  3QIA A;  3QB3 A;  3GTO B;  4R8N A;  3WDN A;  2PMZ B;  2KEC A;  1SNC A;  4QMG A;  5J1Z A;  5M5Y B;  1A6X A;  2CHB D;  1G91 A;  2FFK B;  5IT9 E;  1IW7 C;  3HOU B;  3TN2 A;  1E2Z A;  3L9A X;  1GUG A;  1ONL A;  5ISR A;  4GZY C;  2EYL A;  1G2T A;  3OIQ A;  2KHS A;  4B08 A;  4HED A;  3HGB A;  1WTP A;  1EYA A;  1IKM A;  2IW3 A;  1SYE A;  2XWJ B;  2BOS A;  3TME A;  5IGD A;  2WAQ B;  3A7L A;  1JR0 D;  3OIP A;  3D8G A;  2ID0 A;  1ZEQ X;  3DWQ A;  1DD2 A;  2DN8 A;  2NTT A;  1STH A;  2E2H B;  3EJI A;  3K58 A;  1WD1 A;  3D4W A;  1Y1V B;  3FDT A;  1VF5 C;  4EGV A;  4BBR B;  2K5W A;  4RA8 A;  1BQQ T;  5CC4 A;  2QCP X;  2A69 C;  1IYU A;  1QNU A;  3C46 A;  3I70 A;  1ZKO A;  3S14 B;  1ET6 A;  5EKI A;  2QKI C;  1A2U A;  2F0I A;  1Y8P B;  4HAE A;  3CQZ B;  1CHP D;  1GUS A;  1G6Z A;  2J7Z A;  4NDX A;  4OO1 G;  2BA0 A;  5ELF A;  2KVM A;  1TWA B;  2L55 A;  3IL8 A;  5I2Y A;  1KAA A;  3MHB A;  1EU3 A;  2KCN A;  2EJF C;  2CW0 D;  4RKB A;  3VYT A;  2Y0S B;  1JOK A;  3DUZ A;  3Q0A A;  1M8A A;  4RFB A;  1HQR D;  1NSN S;  4NP5 A;  3CU7 A;  4KKU A;  5E4W C;  1YNN D;  4O42 A;  4CBV A;  2EJM A;  2ICE C;  2IX1 A;  3N6R A;  1STY A;  3SVM A;  1SDF A;  3PIO 3;  3A7A B;  4H44 C;  2VNU D;  3MXU A;  2PO4 A;  1KLG D;  4RGN A;  4ILW A;  3TBI B;  3U9O A;  2WKC A;  1UAP A;  4XQJ A;  2EPB A;  4C3H B;  2K05 A;  2EVB A;  3BDL A;  1RJT A;  3SK6 A;  1C48 A;  1CI3 M;  4CJ0 B;  1BUV T;  3I4N B;  3VR6 A;  3Q22 A;  1PRT B;  3IAY A;  5C6A A;  3IKJ A;  3D6C A;  1MI2 A;  1W6K A;  5C0X H;  1ENF A;  3R3O A;  3AU7 A;  3D4R A;  4RAU C;  4TRD A;  1Q8I A;  3S2D B;  1AN8 A;  4IUT A;  2FMM A;  4MIU A;  1F77 A;  5DEH A;  3A8J E;  3OWF A;  3P20 A;  4XIG S;  4A3I B;  4WJW A;  2F0O A;  3S15 B;  1D5X C;  1VF7 A;  4ZYS A;  4KY7 A;  2Q8T A;  3GTP B;  4DFA A;  1PYW D;  3TP7 A;  1AZP A;  1VDZ A;  1QB5 D;  1LTB D;  2HDL A;  1UNS A;  2NYZ D;  4XXE A;  1F2Y A;  3J7Y W;  1TT2 A;  5IGB A;  3FRP B;  3I91 A;  1A3U A;  1II3 A;  3NTI A;  1XTC D;  4DK1 A;  1KDA A;  1ILQ A;  4WRD A;  4KD4 A;  2EYH A;  2AQ3 B;  1TQO A;  3BG3 A;  5IIF A;  3DEO A;  3Q23 A;  3FPP A;  1RF2 D;  1PFM A;  5G3L F;  3HRZ C;  1MSH A;  1O78 A;  1BCP C;  2Z4I A;  4IAL A;  1HPC A;  1KNA A;  2E74 C;  1WCM B;  1X32 A;  1SAP A;  4QUC A;  3L3O C;  3J80 E;  4A3G B;  3S1Q B;  1MSG A;  5COY A;  2EYO A;  3TDQ A;  4YIJ A;  4NKL A;  2F0N A;  4LK1 C;  4O1N A;  1PRT C;  3ND8 A;  2F03 A;  2NN6 H;  2XSC A;  1YNJ D;  2BCO A;  3GTQ B;  2JA8 B;  1AP0 A;  3BVM A;  4RHS A;  3VR3 A;  1XYI A;  5CV8 A;  5EPL A;  5KND A;  2XN9 C;  5C4X B;  3MEH A;  1EIH A;  4LAA A;  3GTL B;  2KEE A;  2R61 A;  2JE6 I;  1D6E C;  4N9P A;  3HZX A;  3DWA A;  1M4V A;  2A74 C;  1B53 A;  3G7L A;  5CV4 A;  1SE2 A;  1H9J A;  4C1N I;  4IFD G;  2QF7 A;  4IFD H;  4V19 0;  3CKI B;  2K01 A;  3E5S A;  1WTX A;  4A93 B;  1W6J A;  2WII B;  1BCP D;  2PPB C;  1S5D D;  2NBF A;  5EPJ A;  1NUC A;  3M3Y B;  2TMP A;  4KV6 A;  1I4P A;  1B50 A;  1FGB D;  1SMY C;  3HP3 A;  1HXY D;  1VMP A;  4KKS A;  4CJ2 C;  1I4Q A;  2D5D A;  2HUG A;  2K1B A;  2L9H A;  1MBY A;  2O5I C;  2M00 A;  5FLX L;  4HMI A;  2PZW A;  1SXT A;  1HFG A;  4FF3 A;  2IWH A;  3GP7 A;  5NUC A;  1HA6 A;  2RQX A;  5I6Y A;  2CVR A;  4XYQ A;  1KNE A;  5M3M B;  3EVQ A;  4MN3 A;  3C2P A;  1LTR D;  2KCC A;  1KLU D;  5JJZ A;  5CV9 A;  2RBM A;  2B2V C;  2ZXP A;  5I6W A;  2V4D A;  4A3B B;  4JBW A;  2NN6 G;  1BF4 A;  1SYC A;  4DU9 A;  3GO5 A;  5TSS A;  4Q0F A;  3HG9 A;  1TS5 A;  2K28 A;  2XIW A;  4HSP A;  1RKN A;  1DCZ A;  1PXU A;  1LV9 A;  1B9N A;  3V96 A;  1EWC A;  2IT1 A;  2VB2 X;  3T53 B;  4K6D A;  1LTG D;  1V8Q A;  3K5L A;  4EQP A;  4CKE A;  4N9T A;  5BN5 A;  4BA2 I;  1CK1 A;  1G2S A;  2MPM A;  1WTV A;  1V1P B;  1QJO A;  1LT6 D;  5LHY 1;  2WB1 B;  3QJY A;  2IL8 A;  3HOZ B;  2EY1 A;  1FNW A;  3D3R A;  2MHV A;  1HQM C;  4BA1 I;  2FHT A;  3H09 A;  2B2U C;  3JAM E;  1EY6 A;  4HR7 B;  5AFW A;  2N88 A;  3PUV A;  5C5M A;  2RDF A;  4EVO A;  5I4D A;  3H3V C;  2EJG C;  4FXG C;  2BE5 C;  1JC7 A;  4OGQ C;  5COR A;  5IGC A;  1QE6 A;  4ZKC B;  5J22 A;  4ID6 A;  5JAV A;  4QIW B;  4F87 A;  2XRS D;  4K6L A;  5ELC A;  4HSV A;  1TWF B;  3O13 A;  2JEA I;  3DEP A;  5C0X I;  4KY6 A;  2H1E A;  3K6O A;  5JOB A;  4JK1 C;  2NB0 A;  1QIL A;  3CRL C;  2NWG A;  4IUQ A;  2NUC A;  1BCP B;  3I72 A;  5CBE E;  1JOR A;  1IL8 A;  5KIX A;  4KKT A;  4KN4 C;  1K8M A;  2I07 B;  5FO7 B;  1WTQ A;  1LT4 D;  4RWS C;  1EZ6 A;  3H6M A;  1EL0 A;  2JA6 B;  1H9S A;  2J0T D;  3FMC A;  2K03 A;  5A2Q L;  4L6T B;  1EFI D;  2HCC A;  3VA7 A;  4S3S A;  4C56 C;  4UAI A;  4ULL A;  3RZD B;  1AW7 A;  2B2Y A;  3NQT A;  2I46 A;  4FF4 A;  3SDZ A;  2K04 A;  1STE A;  2O5J C;  1BOS A;  1F2L A;  3K7A B;  5KNC A;  2QIL A;  3VR2 A;  5E1F A;  4X3U A;  3WOF A;  2JA7 B;  2FIN B;  5D3I B;  4EQO A;  3EA6 A;  3C3L A;  3KBX A;  1WTR A;  4LJZ C;  3I3C A;  1XXG A;  1LAC A;  2F1M A;  4DNT B;  3QWN A;  3J81 E;  4IUV A;  1SNQ A;  4QF4 A;  3C1E A;  4FXK C;  4G7H C;  5C4H A;  4K2K A;  5M5X B;  4CKC A;  4A3J B;  3KK7 A;  4OO1 H;  2IJ0 A;  4DF7 A;  1TVX A;  1GUT A;  2NVQ B;  5M5W B;  4K5V A;  4DA2 A;  1SYF A;  1DXM A;  1ET9 A;  5C4J B;  1PDQ A;  5CV7 A;  1FNV A;  2WKD A;  5A2Q E;  3I73 A;  3R2T A;  1X3Q A;  1T5E A;  3SXH A;  1V1O A;  1NR4 A;  3ONA B;  2NZ1 D;  1HA5 A;  1LT5 D;  4XQN A;  1R9T B;  3KLS X;  5A35 A;  5FK9 C;  5CV5 A;  4ABN A;  1IHZ A;  4WFN 3;  4FYD A;  1J9O A;  2EYF A;  3DHQ A;  4OIK A;  3W2D A;  3M7N A;  1EU4 A;  4KHZ A;  5CR3 A;  2K33 A;  5CBA E;  2EXZ A;  1SEB D;  2ZXR A;  3T13 A;  4FNF A;  1JOO A;  2J4X A;  1TWG B;  5IOC A;  3TZD A;  5D14 A;  3FPU B;  3BDC A;  1LAB A;  3QOL A;  2E75 C;  3OMG A;  1X3P A;  5KGU A;  4C1N K;  1BO0 A;  2PNR C;  5DNF A;  1OXS C;  1V43 A;  3X3M A;  1I4H A;  2WV6 D;  1EEI D;  3OOC A;  2AWN A;  4C3J G;  2R92 B;  1KTK A;  1GUO A;  1TWH B;  1L0Y B;  1F2M A;  2EOT A;  4BWG B;  2PYK A;  1FNU A;  2F0M A;  1D1I A;  1H9R A;  1C8C A;  2JP1 A;  2NVY B;  1MGS A;  3T56 B;  1A15 A;  3J81 L;  2PQE A;  3PV0 A;  1QCB D;  1K8O A;  3G6J B;  1JWU D;  1LTA D;  2B8F A;  2CW0 C;  1OXX K;  1LTT D;  1I50 B;  3R2I A;  4IN3 A;  5HUR A;  3PMF A;  5K36 H;  1E0B A;  4H0L C;  1TII D;  4F88 A;  1I6V C;  2MUY A;  1QNK A;  1O7L A;  3HEJ A;  3PO2 B;  4XT1 B;  4M1U B;  3LX0 A;  1F9P A;  2A68 D;  1E2W A;  1D5Z C;  4R9W A;  2F3V A;  1BR9 A;  1PZK D;  5C3W A;  4IUP A;  2RSO A;  1PTO H;  4PMC A;  4RCN A;  2R93 B;  1Z47 A;  2R7Z B;  3ZYY X;  2B2T C;  2JSO A;  1GOZ A;  3S1R B;  3RMH A;  3HKZ B;  4HMJ A;  3UI2 A;  1G29 1;  3SE0 A;  2EZV A;  4XT3 B;  2AUK A;  4Q5V A;  3MXG A;  2DY7 A;  4J1M A;  4G7Z C;  4DXG A;  3VYU A;  4ZKB B;  4UDU C;  3WOE A;  5JPM C;  3BS1 A;  1I4G A;  3MWY W;  4P2C B;  2A6H D;  4X3T A;  4XTC S;  5DM7 3;  3JAM L;  5CMD A;  5CV6 A;  4J8Q A;  3NHH A;  4FP5 D;  2RKS A;  1Q12 A;  1B3A A;  5EGT A;  3A8I E;  3RD4 A;  1GJX A;  5K36 G;  2RDH A;  4Y7N B;  1S5F D;  3ERO A;  3MFY A;  2D62 A;  2G9D A;  3KUP A;  1EQV A;  2BA1 A;  3K5O A;  4K8I A;  1Y1W B;  2DNC A;  1RTN A;  2N55 A;  3LWE A;  2NTS A;  3D6W A;  2O2L D;  1GUN A;  1SMY D;  1WVL A;  3TSS A;  3SR1 A;  4AYB B;  2A73 B;  5KNB A;  1YNJ C;  2QEJ C;  1FR3 A;  3KLR A;  4DGZ A;  4KMU C;  2B2W C;  3OMC A;  4ZRZ A;  5D65 A;  1LLR D;  2GA4 B;  3AB9 A;  1CZG A;  2L5T A;  1TKW B;  2KED A;  5FO8 B;  2DNE A;  4G4K A;  4IUU A;  2EDG A;  4TKO B;  2VB3 X;  3NPP A;  1R4P B;  1JWS D;  2SNM A;  4CKB A;  3V2T A;  1B4O A;  3I90 A;  2L1B A;  5E3F A;  3D4D A;  4IQZ A;  3K5M A;  3OPO A;  4U68 A;  1ZXT A;  1PTO D;  4IZ8 A;  4BBS B;  1C4Q A;  3NWT A;  3R93 A;  4DAY A;  1ESR A;  3S9W A;  5FLX E;  1PRT F;  1TS4 A;  4PMB A;  4H7B A;  4OO1 I;  1U4P A;  2F4I A;  2LS0 1;  2PZT A;  1B9M A;  3T16 A;  5M9O A;  2IX3 A;  3NXW A;  5T1G A;  3TZU A;  4F7X A;  4C3I G;  4X3K A;  2LMC B;  2RDG A;  3HOW B;  2L11 A;  4K5X A;  1Y69 U;  1TY0 A;  3ITP A;  2F0F A;  2OXP A;  2LFN A;  1I3Q B;  4KJO A;  1CZW A;  4XQQ A;  1LT3 D;  2EE1 A;  2AUJ D;  1EQT A;  3LWU A;  3KBG A;  1HFN A;  2F0T A;  3CHB D;  2F0P A;  3NQI A;  2LKV A;  5LL6 S;  3VYS A;  5ELD A;  3SK8 A;  3I4M B;  1RD9 D;  2Q8I B;  4I65 A;  1GXD C;  2A5H A;  5KYI A;  5JPN C;  1Z7T A;  4IFD I;  1U9R A;  3S2H B;  4C2M B;  2IPK D;  1GHK A;  3NUC A;  1IKL A;  3RZO B;  1DYQ A;  4L8J A;  1S5B D;  1SYB A;  4HN7 A;  4IUR A;  4MHE A;  1EIG A;  2SEB D;  2ENB A;  1CHQ D;  1CT1 D;  5C0X J;  5IGF A;  2E76 C;  4KY5 A;  4FO2 A;  1PTO F;  5C5L A;  5IGG A;  5FOB B;  1GUW A;  3GQB A;  3RUZ A;  3T4A C;  5EKL A;  3DWP A;  4OIJ A;  4KN7 C;  2O4X A;  1KDC A;  3KLS A;  2QDB A;  4ZQ3 A;  4RCO A;  2AQ1 B;  1D1K A;  2F0G A;  3GTJ B;  3J80 L;  3PUW A;  5I9P A;  2R6G A;  3OWE B;  2OF1 A;  1BNZ A;  5C44 B;  2KJX A;  3GV3 A;  4A3M B;  2AQ2 B;  3MAQ A;  2F0W A;  5JVH 3;  1JB3 A;  1HTP A;  2M9V A;  4BY7 B;  1U4M A;  3M85 A;  1SYD A;  5E4X A;  1AZQ A;  1GHJ A;  1RDP D;  4I7Z C;  3TP5 A;  3TP6 A;  1WTW A;  3W3A A;  5FO9 B;  1A2T A;  1DON A;  2MGS A;  2B2T A;  4G7O C;  2VUM B;  4IUN A;  3I8Z A;  1LTI D;  1D5M C;  1HCZ A;  2PW5 A;  5FKA C;  2HCI A;  1U4L A;  2F0V A;  1DJR D;  1H9S B;  5LL6 X;  4E6I A;  3DM1 A;  2CQA A;  3MXP A;  2K32 A;  1SSO A;  1O80 A;  3S1N B;  5K5P A;  1EY0 A;  1JCK B;  1DOL A;  5IOD A;  3X3N A;  4HCS A;  4DAV A;  3NSW A;  4OL7 A;  1EEF D;  4H13 C;  1IW7 D;  1HTL D;  1T5X D;  2TSS A;  1PTO B;  2F0U A;  2JXM B;  2MJ8 A;  2E2D C;  1Y8N B;  2FJ2 A;  4A3F B;  4KK7 A;  1HUM A;  3K59 A;  2A6H C;  2JEB I;  4DK0 A;  2K7V A;  3Q24 A;  3K0Y A;  1Q1B A;  1SNM A;  1JQY D;  1MD2 D;  4BY1 B;  2NN6 I;  1D2B A;  3NE5 B;  3P1H A;  3RLF A;  3PIP 3;  3PO3 B;  2ZT9 C;  4K8J A;  4FF2 A;  3M4O B;  4NW2 A;  3J7A V;  3ND9 A;  1H9M A;  1V1P A;  1A3V A;  1SNO A;  5C4Z A;  4KD3 A;  1QWY A;  4C3H G;  2RVL A;  3A55 A;  3F2U A;  4RGO S;  1JE4 A;  4K14 A;  4R8I A;  4RKL A;  1S4Z A;  3NTK A;  2HQE A;  2Z1C A;  2JYO A;  3NWS A;  4FVM A;  1OXV A;  1SE4 A;  1B44 D;  4C3I B;  1STG A;  1CQF A;  4Z9C B;  5KRU A;  1OO9 B;  4ZK9 B;  4CJ1 B;  1PRT D;  4ZLT F;  4FXD A;  4L63 B;  2F0H A;  3PUZ A;  1TY2 A;  4EQN A;  2HDM A;  1PZI D;  4QCL A;  1UEA B;  3VR5 A;  1VCI A;  3VR4 A;  5I9O A;  2BE5 D;  1QG7 A;  2Z8L A;  1F2Z A;  3HOV B;  3GTK B;  2R3Z A;  2EY2 A;  2F0E A;  1KDB A;  1EWH A;  5DM6 3;  1ESF A;  3ERQ A;  5EPK A;  1Q1E A;  4PMW A;  1ILP A;  2NVX B;  2EYJ A;  1ML0 D;  3D31 A;  4KHV A;  1U4R A;  3EFX D;  3K57 A;  1O7Y A;  1CTM A;  1EYD A;  4J6H A;  3NBH A;  3BYY B;  5JEA H;  1AEX A;  3S1M B;  3BDO A;  4U67 3;  2PW7 A;  2D2C C;  1Q90 A;  2RA4 A;  2X69 A;  1O7Z A;  5JEA J;  2IX0 A;  1DOM A;  5M3F B;  4A3K B;  3MA2 B;  1PZJ D;  3BYT B;  1ROD A;  1IYV A;  3GV6 A;  1K83 B;  4K2L A;  2WAC A;  1EOT A;  3K5N A;  1L0X B;  3E6Z X;  2E2J B;  1E2V A;  1NCV A;  1SBB B;  2L0C A;  3HOX B;  1SFO B;  3GD7 A;  2WP8 J;  2F0J A;  2K5D A;  4WOR A;  1HRJ A;  5CGK A;  3AMU A;  2YU9 B;  4PV1 C;  1F9R A;  2SDF A;  1PTO C;  2F0Q A;  2AWO A;  1CM9 A;  1A3T A;  2B2Y C;  1PFN A;  2WIN B;  3S16 B;  1EY7 A;  3CRK C;  3BVZ A;  5ELE A;  1WTO A;  4TQU S;  1EZ8 A;  2B63 B;  4V0B A;  1B2T A;  1PMR A;  3QOJ A;  4CGY B;  2LY7 A;  2KOL A;  4XDX A;  1WD0 A;  1SYG A;  1STB A;  1KAB A;  3BZD B;  1TR5 A;  3MTS A;  5JVG 3;  1ENC A;  2A68 C;  1LO5 D;  3NP8 A;  4K5W A;  2KUM A;  5F2D A;  1F9S A;  1BXT A;  4ZUJ A;  5C3E B;  2E2I B;  3R8B A;  1JOQ A;  3VYR A;  2EYM A;  3HS0 C;  4F8M A;  3S17 B;  3MVV A;  1ZYR C;  2SOB A;  1NR2 A;  3MZ5 A;  5DAU A;  1SE3 A;  1FD7 D;  1JIC A;  2X6L A;  3DXJ C;  4ODG A;  2C9O A;  5JEA G;  1EY5 A;  2BDO A;  1G8Z D;  1J8I A;  2MP1 A;  3URY A;  4G57 A;  1HHV A;  5KEE A;  3I4L A;  3QO2 A;  3A8K E;  3GTG B;  3J7A F;  1RTO A;  4LMQ D;  4B9X A;  1PFB A;  1CFM A;  1LTS D;  3PUX A;  3IFT A;  1UUP A;  2B2U A;  3H0G B;  2YYZ A;  3OW7 A;  1F9Q A;  1Q3L A;  2B2W A;  2Z4H A;  1TU2 B;  2OEO A;  2KQ3 A;  1I4X A;  3TP8 A;  3IFD A;  3OSO A;  2ICI A;  1I4R A;  2B8G A;  2ZXO A;  3V05 A;  3MC0 B;  2G9H D;  2M2L A;  1BDO A;  1TWC B;  3E0J A;  1H9K A;  1DOK A;  2XNA C;  3M4Y A;  1BCP F;  2JA5 B;  2A6E D;  1DZ1 A;  4PQX A;  1R4Q B;  1B1Z A;  1QOH A;  5EJW A;  1JWM D;  3Q6S A;  4B9W A;  2L4N A;  3T51 B;  1STA A;  3DMU A;  1YNN C;  4HCE A;  2RSN A;  4DXF A;  1PLF A;  1ENA A;  2A6E C;  1I6H B;  5IT9 L;  5J39 A;  2XWB B;  3FKI B;  1VMC A;  5EKK A;  3MXN A;  4DN4 M;  1NAP A;  1CA5 A;  1BBX C;  4DAP A;  4PNY A;  2B2V A;  1AFP A;  1HUN A;  1XWE A;  2F0S A;  2K6A A;  1STN A;  1EYC A;  4XYO A;  3EQL C;  2F0K A;  4RGT A;  3KF8 A;  1OXT A;  2FMC A;  3A54 A;  4QB4 A;  3PUY A;  2DY8 A;  5G3L D;  5C0X G;  3NTH A;  1SNP A;  4RGM A;  2SNS A;  3OHX C;  3BVG A;  3C1F A;  3H94 A;  1S5E D;  1RCV D;  2C5C A;  5ELB A;  2X6G A;  2H4O A;  3P7J A;  4BS9 A;  4DNR B;  1TS2 A;  2XVS A;  3GTM B;  5KYL A;  2D9U A;  4C3J B;  2PCF B;  3QG1 A;  1RHP A;  5I2X A;  1SJH D;  4NMZ A;  4CHT B;  4KJN A;  4TSS A;  2KA7 A;  1ZYR D;  1ICW A;  2VXW A;  3FVQ A;  1SND A;  5IGE A;  3SHL A;  1SJE D;  5EBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...