1QG7A

Stroma cell-derived factor-1alpha (sdf-1alpha)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
SYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMAL CELL-DERIVED FACTOR 1 ALPHA
publication title Crystal structure of recombinant native SDF-1alpha with additional mutagenesis studies: an attempt at a more comprehensive interpretation of accumulated structure-activity relationship data.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 10
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qg7A00
2EOTA 3D6WA 3KUPA 5D14A 2RVLA 1GUWA 2HUGA 1B50A 5CBEE 1DZ1A 2DY7A 2Q8RE 3TZDA 1XYIA 5CORA 4CJ0B 2K04A 4HSVA 1TVXA 2FMMA 1ESRA 3DEPA 4O42A 5CBAE 2RSNA 1EL0A 3DM1A 1PFMA 1RJTA 2RSOA 2KUMA 4QUFA 1B53A 5E4XA 5EQ0A 2SDFA 1JICA 1KNAA 1F9PA 1O80A 5D65A 4CJ2C 1WTOA 5AFWA 1U4PA 1WTXA 1HFNA 1RTNA 2JP1A 2MPMA 3G7LA 1HHVA 5EKIA 1QNKA 1RTOA 1A15A 1SAPA 4XDXA 3R93A 4DN4M 1J8IA 1AZPA 3P7JA 1WD1A 2XIWA 2Q8TA 2EE1A 2MJ8A 2RA4A 1M8AA 1VMCA 2B2WA 1U4RA 1PFBA 1ZXTA 2KEDA 1G91A 3I3CA 5EPJA 4ZKBB 4U68A 2H1EA 1DOMA 1WTRA 3GV6A 1G2TA 1MSHA 2K1BA 4HEDA 1PFNA 1O7ZA 1QE6A 3I91A 3UI2A 2B2TA 1NCVA 1S4ZA 1EQTA 2K28A 2KECA 1F2LA 2FFKB 5CMDA 5EPKA 3IFDA 1DONA 1IL8A 3Q6SA 1RODA 2MP1A 2L1BA 3DEOA 1B3AA 1E0BA 5E4WC 3I8ZA 3QO2A 4CJ1B 1CA5A 1WTVA 1WTQA 2CVRA 3MWYW 2EPBA 2FINB 1J9OA 1ML0D 2B2VA 2B2YA 2B2UC 2FHTA 1KNEA 2NWGA 4HCSA 4XT1B 3ONAB 1ILQA 2R3ZA 4IUVA 3LWEA 4ZK9B 1ILPA 1ICWA 1WVLA 1DOKA 1F9RA 2VXWA 1U4MA 2J7ZA 1SDFA 4R9WA 4XT3B 3I90A 4OIJA 1X3PA 2HDLA 2X69A 4RWSC 5DNFA 1WD0A 1AZQA 1EIGA 4X3UA 2NZ1D 2K05A 4IUUA 1BF4A 1BNZA 4HAEA 3FPUB 1VMPA 2D9UA 3HP3A 4X3KA 1DOLA 4RA8A 1NR2A 1G2SA 1B2TA 1MGSA 1O7YA 2L9HA 2IL8A 2MGSA 1C8CA 4ZAIA 1HFGA 1HA6A 5T1GA 4IURA 3N52A 2HDMA 4IUTA 1WTPA 2HCIA 1HUNA 2KEEA 4RAUC 1NAPA 4IUPA 2N88A 2FJ2A 1WTWA 1BO0A 1IKLA 1HUMA 1X32A 3H91A 4NW2A 1QG7A 2KVMA 4QUCA 1EIHA 2JYOA 1F9SA 2L11A 2L12A 5COYA 2K03A 1XX8A 1IKMA 2B2WC 3KBXA 1NR4A 1LV9A 1X3QA 3GV3A 4IUQA 4X3TA 2KOLA 2N55A 3MTSA 1HRJA 1RHPA 2K01A 1CA6A 1G6ZA 5T1IA 5JJZA 1F9QA 1B4OA 2B2TC 3F2UA 5EPLA 2HCCA 4R8IA 1BBXC 3FDTA 1SSOA 1Q3LA 5EJWA 1JE4A 4X3SA 1PLFA 4MHEA 2NYZD 1MSGA 2L4NA 3TN2A 1EOTA 2X6GA 1PDQA 1CM9A 3SVMA 4ZLTF 1MI2A 2B2VC 1U4LA 4ZKCB 2B2YC 4LMQD 2M2LA 4MN3A 1AP0A 4UAIA 2B2UA 2DY8A 2X6LA 3IL8A 2BDNA 4OIKA
chains in the Genus database with same CATH superfamily
1KD1C 1WTHA 2EYPA 2Z9HA 3PUWA 4JI6L 1WCMG 4A3CG 1PH8A 5JJLA 1O7IA 3ULJA 4RHRA 2KHIA 2BA1A 3O13A 1ESRA 5CBAE 4DR1L 5K36H 2EY6A 2F0HA 5E7NA 3AEVA 4X6AH 1JJGA 2L55A 1Y14B 4KKUA 1WTXA 1JB7A 2AUKA 3CW2C 2F0VA 5EKIA 4XQNA 3OYYA 4BBRB 2F0GA 1VQOA 2OWOA 4S3SA 4CKEA 1DOMA 2OTJA 4ZCKA 1ET9A 3FEWX 2PNHA 2B2TA 4JI7Q 2E2IB 5BR8L 1PVOA 3DMUA 2V1CC 3D31A 4A3GB 1IL8A 3SHLA 4C3JH 3DEOA 2G9DA 3CCVA 3OTOQ 4DPGA 4LFBL 4LF5Q 2PYKA 3RR5A 4LAAA 4A3IB 2A6HC 2K14A 2K52A 4G7OC 2J7ZA 3KF8B 1T9HA 1E2ZA 4G7HC 3H09A 4RCNA 3LX0A 2A74C 2A19A 3UDGA 2QA4A 1G51A 3S1MB 3BYTB 1HFGA 4IURA 4IOCA 3RZOH 4BY1B 1IW7C 2YTXA 1VCIA 3NENA 3MZ5A 2EYOA 1HTLD 1BO0A 1IKLA 5FLXE 1XNQL 1SXTA 1TS5A 1XPUA 1K8OA 1SNMA 3DWPA 2BDOA 1JOQA 3A74A 5ELFA 2ID0A 1QILA 2Z6KA 2A6EC 3GTOB 2UUAQ 1E22A 3F2UA 4R8IA 1U0LA 1SNDA 1S5DD 1SNPA 4ODGA 2UUCL 4BXXH 5M5YB 3PO2B 3SK5A 5FLMG 3I55A 2EYHA 3HOZH 1OTCA 3D4RA 4B08A 4XIGS 2NZHA 5C4XH 4BBSH 3J81L 3SXHA 4OXPA 1AP0A 3G6EA 3UDXA 2D0PA 2KQ3A 4KY7A 2ZM6Q 5TSSA 1R9TH 1PTOH 4G7ZC 5NUCA 1DM0B 3E0JA 1IHZA 3QJYA 1B50A 4IOAA 4R4IA 1RL2A 1I4QA 2YU9B 1PMRA 4FDBA 4NP5A 1VQKA 4BY7G 2BH8A 4OEMB 3DM1A 2RSOA 2KUMA 4QUFA 4DV2L 4A3FB 5FJ8G 3HOWG 1HFNA 5HGQA 1I3QH 2F0IA 3HEJA 3L2PA 4WJWA 4IUNA 1FL0A 3I4NH 4CDDC 1TWFH 2HIXA 1VQDA 1E1TA 4YWKA 1E3PA 5KNBA 3I3CA 4U68A 4DK1A 1H9MA 3HKZG 3NTIA 1EQQA 1QE6A 3H94A 2B8GA 2JN4A 3K7AH 5GQOA 1EQTA 1N36Q 4KJNA 2K32A 2CKZB 1LT6D 3NWSA 5JJIA 2R6GA 5M3MG 2XVSA 3KJPA 4HJ5A 1KC8C 1HZCA 4DNTB 4DV6Q 1NTGA 3TBIB 5FK9C 2JA6H 4G57A 1JMCA 3NWTA 4APVA 3GTPH 3HKZE 4R9WA 3CPWA 3I90A 3RLOA 2X69A 1WD0A 3KLRA 1VQMA 3GTJH 3T1YL 1QVCA 5LHY1 4RA8A 3S2HB 1UAPA 1MGSA 3M4YA 5H1SE 2FXQA 1PH2A 4X65L 1ENFA 3GTGH 2GN5A 4KK7A 3E3XA 3KF6A 2K50A 1YZ6A 2KA7A 1S5CD 1HR0Q 2AQ1B 1XJVA 3DM3A 1F9SA 4DV5Q 2L11A 5IP7G 2EXDA 4UY8C 1H95A 2BA0A 1CA6A 1S5ED 5FO9B 1EUJA 5EPLA 3T53B 4Q5VA 3I4MH 3TP8A 2F0KA 2WINB 5I2XA 4ZRZA 2XWBB 2VW9A 3K81C 1PLFA 1SE4A 1EOTA 1BKBA 1WCMH 1AE3A 2PI2E 2CW0C 2RHQB 3MEHA 3HOUG 4FF3A 1LT3D 5J3BA 1VQ6A 5F2DA 3FKIG 2ASBA 1A6XA 2VL6A 4KY6A 3S1NH 3HOYG 3F2DA 3RUZA 4QL5A 4CJ0B 3KLSX 1CK1A 5FKAC 1Q7YC 1UEBA 1I94Q 1QVFA 4GKKL 2AUJD 4HJ9A 5EQ0A 4C3IG 1IYVA 5D65A 1Y8PB 3MFGA 3K6OA 4L5TA 3OWFA 2MPMA 5C3WA 3W1BA 2E2HH 1AZPA 2R93H 1VQCA 2F0WA 2JE6I 1W3SA 4MTKA 4Y7NH 4GOPB 1SYCA 1WI5A 3MXUA 4P75A 1VQ7A 4A3LH 3KDFA 1WTRA 4B9XA 5IT9E 2K1BA 1TWHH 2OF1A 1H9SA 1O7ZA 5C4ZA 2LFNA 5IYCG 3PSIA 3H6MA 4RGNA 3KFUA 2K4KA 5E4WC 4GNXC 4A3EG 3CRLC 3MWYW 3S16H 1D5ZC 1X54A 1J9OA 2WIIB 5L37A 4ZK9B 4JI7L 2HHHQ 1UE1A 2QGQA 4KJOA 5IYDG 5CGKA 4XT3B 2HDLA 3PF5A 5DNFA 4JI3Q 3CCMA 1A3VA 3PUVA 3QOLA 4HN7A 3J80c 2EJFC 3FMCA 3FPUB 5M5WH 3OTOL 5CYUA 3A7LA 4DR7Q 4LF5L 2NVYH 1F2MA 4DXFA 3FVQA 3C2PA 1HCZA 3MEFA 2QKIC 4A3DG 4RKLA 3N52A 2HCIA 1YITA 1LYLA 4B3RQ 2FJ2A 1A8VA 1BDOA 3BVZA 2EY2A 1Z9FA 2B3GA 2AMCB 1OXTA 2ICEC 1IYUA 1V1OA 2K03A 4PNYA 4DF7A 3CCQA 1EU4A 1YVCA 1G8ZD 5FLMH 1JOOA 2EJGC 4FNFA 3DLLA 2JA5H 1CSPA 3NXWA 3PF4A 2JQOA 1CZWA 4QY7A 4ABNA 1X3EA 3G48A 2WP8J 2UXBQ 2B63B 4A3BB 2NN6H 1LTID 4H44C 2JA9A 4IPGA 4ZLTF 3AQQA 1RIPA 4R4QA 1V1PA 3EN2A 3M4PA 2ZT9C 5ELDA 4P2CB 3AB9A 2I46A 3SDZA 2E2JH 2DJGC 2EOTA 3S1RH 4YCUA 4TKOB 1EOVA 2F1MA 1LM0A 3OW2A 2JSOA 1SFOB 5FJ8H 1VQAA 3T4AC 3U4VA 3G4SA 2QCPX 4XYQA 3HOWH 3FRPB 2EYFA 2CWPA 1QJOA 1SNQA 2ZM6L 4OHJA 4EQPA 3Q23A 2K75A 2JP1A 1LTRD 2YYZA 4A93G 2PPBC 3M3YB 2A73B 4DR1Q 1WD1A 1CQFA 5KNCA 3W3AA 3U50C 2K7VA 2C5CA 4IJHA 4YY3Q 3PQIA 1NBWA 3RD4A 4DR4Q 5M3MH 5G3LD 3I70A 1MBYA 3VDYA 5IGGA 3BU2A 3SK6A 3T13A 1R4QB 2N3SA 5ELNA 3J81E 4K6DA 3NUCA 5JAVA 1ML0D 2FHTA 3JC66 3CMAA 2NWGA 3Q24A 3EROA 4UP7A 5M3FB 3BJUA 4IUVA 2JA8G 1DGSA 5K36G 1WVLA 1N36L 3CC2A 1AFPA 4A3MG 2F0EA 3M4QA 1Q86C 4K5XA 4DV0Q 2WB1B 3J7YW 4DV6L 4QMGA 4JG2A 3JAML 2KEEA 1STBA 5I4DA 1QG7A 1Y1WG 5JVH3 4NXNQ 5C0XG 1CZGA 3CCJA 4XTCS 1SNCA 1OXUA 3U4ZA 4ILWA 5GAHC 5J22A 1EWIA 4C3JG 1YNND 4UDUC 4JCVE 1X3QA 4IN3A 3QIAA 1AE2A 3J81j 2ZTEA 1YJNA 1VQEA 1HR0L 4DV5L 4TRDA 1K8AC 5EGTA 3MFYA 4P71A 4GN5A 3FKIH 1I50B 4K8IA 2K5NA 3S14H 4GNXA 3HOYH 4UHVA 4KLKA 1L1OB 2EY1A 1Q82C 4GLXA 4UAIA 2R7FA 3AYHB 5I6WA 2A8VA 3NP8A 2F0LA 1PZID 1VQFA 2HUGA 1SYEA 2Q8RE 3SK4A 2UXDQ 2K04A 1TVXA 5EBCA 4PMCA 5EKLA 1RJTA 2DJFC 3M7NA 3NK9A 4RHSA 1FNUA 3F1ZA 4BXXG 4DN4M 1QNKA 4JPBW 1UE6A 3HOZG 3P7JA 1JWSD 1YIJA 4DV2Q 2RA4A 2KCMA 3UE1A 2KBNA 3MVVA 5IYCH 1I94L 1VQ4A 2H1EA 2ENBA 4DV1Q 4BBSG 1C4QA 2E8GA 3I7FA 1SYDA 2UU9Q 2DNCA 2CH4A 1IXRA 3V96A 3H15A 2AWNA 2NVTB 5CC4A 4TVAB 1Q46A 2H4OA 1K83B 2MNAA 3V05A 2CVRA 1WTQA 2EPBA 4JV5Q 4YHHL 2JJQA 1TKWB 2LXJA 4TQUS 3W2DA 3KOJA 1IZ6A 1CT1D 4A3DH 2PQAA 2RCFA 3P20A 4LF7L 3ZYYX 1BF4A 4RMFA 4L5SA 4DR2Q 3TMEA 4ID6A 2R92B 1D8LA 5LMNW 1R4PB 1Q1EA 1STGA 4WFN3 1K8MA 1PRTC 4XYOA 1X32A 4JI3L 4HR7B 2QDBA 1NMFA 4DR7L 2PMZB 2FMCA 4X65Q 4IUQA 1OXVA 1S5BD 1RHPA 3R2IA 4X62Q 4E6IA 5JJZA 4B3RL 1PH9A 1HA5A 2HIVA 4LF8Q 3UE0A 1Q3LA 4MNOA 4FXGC 3FP9A 4A3JB 5C4JH 1EYGA 1HNWQ 1MSGA 4AIMA 5FO7B 4DR6Q 3CCSA 3HG9A 4GN4B 3R3OA 4OO1I 2K5VA 4DA2A 4F8MA 1IBMQ 2UXBL 4B9WA 3VR2A 5D14A 3I2ZA 1TIID 1A62A 5LL6S 5I9OA 1CQVA 4JK1C 3HOXB 4IPCA 4O42A 1BXTA 4A93H 1CKNB 2M00A 1GXDC 2L5TA 5JJKA 2HT1A 3Q22A 1Y8OB 3I4MG 1EY4A 3ULPA 5FOBB 4PZ6A 3OOCA 1FR3A 2EYMA 2VQFQ 3NPPA 4GKKQ 2WAQB 3H0GH 3PO3B 3IRBA 5DM73 4A76A 1P16A 2KENA 4DV3Q 2VUMG 3HOVG 3S17B 1PFSA 1NCVA 1S4ZA 2KECA 5C44G 5C4XB 5IIFA 4O1NA 4DAPA 1PTOF 2MP1A 2JA8H 4FXDA 3I8ZA 1HQMC 1WYDA 4A3MH 4YY3L 3STBC 1R9TB 1PTOB 1SE8A 3I56A 1EIYB 4DR4L 1EY6A 1D5XC 1TXYA 4N8FA 1E2WA 4RGMA 2K05A 4YCWA 2F0NA 2F0UA 1VQGA 4X3KA 1DOLA 3WOEA 2R93G 1J5EQ 1Y1WH 3NBHA 5C0XH 2IL8A 3NTHA 3TRZA 4Q0FA 1I4GA 1HA6A 5T1GA 1IBLQ 1SYGA 3I4NB 4A3LG 1UWVA 1TWFB 4IUPA 1Y1VH 2N88A 5FO8B 4JBJA 4DV0L 1EWHA 1RCVD 2V4DA 1SJED 1LTTD 5E1FA 2NVQH 1DXMA 1SN8A 2J4XA 1D7QA 4KV6A 3GTKB 1JWUD 5T1IA 3RN2A 3S15B 1KDCA 3SK8A 5E3FA 4JI1Q 2DN8A 2Q2HA 4NXNL 1HZAA 4B3MQ 3EJIA 5C3EG 2RHSB 2L4NA 3KK7A 4HJAA 2IHFA 4PV1C 2JA6B 1I4PA 2Q2IA 1OXXK 1U4LA 4J15A 3CXCA 3GTPB 5IGFA 3VA5A 3RZDB 1TY2A 3GTJB 4Y52H 4QB4A 3EA6A 3WOFA 2A5HA 3S1QH 1IBKL 2EIFA 4CHTB 2OEOA 1FD7D 1D2BA 4HSVA 1GUOA 2FMMA 4HCEA 2RKSA 3MHBA 5ELBA 3JAME 1C48A 2VS1A 2JA5G 4JI2L 2PZUA 2BE5D 4HMIA 1MKHA 1EY5A 1I4HA 2SDFA 4NMZA 4LJZC 4A3KB 2AQ3B 2CFMA 2H5XA 4UPAA 5DEHA 5A35A 2NN6G 2LKVA 2UXDL 2MO0A 3L0OA 1X65A 4IALA 2O5JC 4M8AA 3MXNB 1ZXTA 1PFBA 1V43A 1B7YB 1MIUA 1JJ2A 3HKSA 3OSOA 3PIO3 1D1IA 1QUQA 1XMQQ 4FF2A 1WCMB 1F2ZA 5KYIA 1EFID 1HQRD 1E0BA 3QO2A 4DNIA 4QIWE 1VDZA 1WTVA 1DJRD 5CR3A 4HIKA 2FINB 4DV1L 3ND9A 1ONLA 1IL2A 1VF7A 2SNMA 2UU9L 2C35B 1ILQA 4MTNA 1ICWA 3TP7A 1Q1BA 1KRTA 3NE5B 4OIJA 3VR6A 4BBRH 1ASZA 1AW7A 4IUUA 1SRUA 4JV5L 5JEAJ 4IFDI 3A5UA 3A7AB 1Q90A 4CBVA 3IFTA 2E2IH 3CCUA 2E2HB 1GKHA 3QWNA 1KIXA 2XWJB 4GLAC 4Y7NB 1EY9A 1TWHB 4DR2L 1YNJD 1N33Q 2ZJRA 3KBGA 5DAUA 2Z4HA 3PCOB 4LUZA 2R7DA 2HCCA 1U9RA 2AKWB 2VZAA 3TS2A 4DUYQ 2NYZD 3TN2A 3MXPA 1BBUA 3L9AX 1C9OA 4AYBG 3S1MH 1CTMA 1EFWA 2PO4A 4X62L 5IGDA 3A8JE 1Z47A 3GD7A 4LMQD 5AJ3Q 1M1KC 2SNSA 5GADC 1WFQA 1SLJA 2OCEA 4P73A 4G4KA 4LF8L 2WKCA 2ZTDA 4OIKA 4H13C 4LUOA 4EX5A 5M5WB 4CDCC 1HNWL 3OMGA 2NVYB 3CRKC 4KY5A 1TWCH 3GP7A 1GUWA 4DR6L 4HSPA 5CBEE 3TZDA 5LMUQ 1E24A 1L2FA 4AYBE 2XNAC 3W5OA 1IBML 1K28A 4RGTA 1NJIC 4EQNA 2VY3A 1F9PA 1Q8KA 4PMBA 4JI5Q 3H3VI 3CD6A 4N9PA 2XTIA 2VUMH 3HOVH 1PH3A 2BE5C 2Q8TA 5C44H 5JVG3 2F4IA 1JWMD 4LW1A 1KLUD 1SBBB 1XTCD 3J80L 3A54A 2F52A 4K0KQ 3VYTA 4ZUIA 4NDXA 1QCBD 4IFDJ 2JEBI 3Q6SA 2VQFL 3DWAA 3NELA 4LFCL 1GUNA 5ELEA 1LTLA 5C4HA 4BY7B 3S1RB 1N32Q 4A3FH 4DV3L 1P8LA 3TREA 2XSCA 4EVOA 3HOWB 2F0TA 4FXKC 5IY0A 4YHHQ 2PW5A 3ER0A 1G2SA 1B2TA 3CPFA 1CKMA 1EIFA 4OL7A 3HKZB 4LF7Q 5CV9A 1G6PA 1JOKA 3CF5A 2C9OA 1TS4A 1TU2B 4I7ZC 5DLQE 1KTKA 4R4CA 3HRZC 1J5EL 4LF4Q 5M3MB 2VB3X 4DR3Q 4X3TA 2KOLA 5C3EH 1O78A 3L3OC 1IBLL 3K5NA 3PV0A 1SYFA 3M9BA 3GTMH 5LL6X 1QB5D 1YNJC 1SE3A 4NKLA 3CHBD 2QW7A 5M9OA 2ZTCA 2TMPA 4JW0A 4OGQC 5IP9G 4C2MH 2M2LA 4KHVA 1GUSA 4OWTB 4JI4Q 4JI1L 2NB0A 4JI0Q 3KF8A 4FF1A 1TS3A 4IJLA 4B3ML 3D6WA 1WOCA 1PH6A 4KHPQ 5D3IB 1MHWC 1LACA 5CV4A 1PYSB 1DZ1A 1TR5A 1I5FA 2NBFA 1XYIA 3DEPA 5KYLA 4R1JA 4C3HG 2F0JA 2G5DA 3P1HA 2IWHA 3BZCA 4CJ2C 1WTOA 1U4PA 4QGUA 4QQBX 4IO9A 2IHEA 3BS1A 3R93A 2AWOA 5J1ZA 1TY0A 2D5DA 3NBIA 4GOPC 5GROA 3KJOA 1M8AA 1G91A 3PIPA 3HOUB 4MIUA 1G2TA 1EZ8A 3AFQA 1STEA 1VQLA 2PCFB 4DAVA 3FKIB 2Z6BA 1HNZQ 3HOYB 3HZXA 3CQZB 1DONA 1RODA 4NXMQ 5HURA 3ICEA 3A8KE 4KKTA 1CA5A 3TZUA 2ICIA 1NE3A 3G6JB 2MUYA 2YTYA 4DAYB 2Q2TA 1JE5A 3FHWA 4C3IB 1DOKA 1XMQL 3GTQH 3SGIA 3RN5A 1X3PA 4DV4Q 1EIGA 1VMPA 4PQXA 4HTHA 5C6AA 2F4VQ 1NSNS 1STNA 3H0GG 4HIDA 2PNRC 1KQSA 2JA7G 3E5SA 2F0DA 1IYJB 3CMEA 4BA2I 1SYBA 1I4XA 4JBWA 1LT5D 3OPOA 4A3EB 4JYAQ 1B8AA 1S3OA 3J7AF 2XRQD 2CHBD 2K01A 4AQYQ 3J7A5 2OXPA 4RGOS 4CGYB 1GUGA 1QZGA 4K5VA 5BN4A 3UDIA 1EY8A 5A2QE 1AN8A 1PDQA 1CM9A 1N33L 4FF4A 1CUKA 5GAGC 3U58A 4A3DB 1I6HB 1VF5C 1ENAA 1LTBD 5IOCA 2DY8A 1F77A 1BCPF 3D4WA 3DWQA 1K3RA 4OONA 4PZ7A 1Y1VG 4DUYL 3CCLA 1BCPB 2N49A 3K5MA 5AJ3L 3KLWA 1FJGQ 3A56A 1EL0A 1V8QA 1XPRA 5BN3A 1IBKQ 2B63H 4XQQA 1H9JA 4U673 4RH6A 1O80A 4IFDH 1EQRA 4O2DA 1LUZA 1RTNA 3NQTA 1SAPA 5LMUL 4L8JA 2ZXPA 1EY7A 4DK0A 1XMOQ 4KKSA 2F0OA 2HQLA 1B70B 4JI2Q 4TSSA 1VMCA 3S2DH 5C4JB 3HS0C 1MSHA 2ATWA 3UI2A 4JI5L 3VYSA 2GA4B 1SFOH 2R7ZG 3K7UC 4ME3A 5EPKA 1EYDA 3S9WA 3H3VC 1VQBA 1PRTF 3Q0AA 1D6EC 2Y0SG 2I5MX 4F7XA 3QR8A 1RD9D 4BS9A 5FLXc 4K0KL 4WORA 1N34Q 1YBYA 3K5OA 2VXWA 3R2TA 1JR0D 1AZQA 3M3YH 1HH2P 4RWSC 4A93B 5DM63 4PZ8A 2CWAA 1A2UA 2D9UA 3BVMA 2NVXB 2JK8A 1N32L 3BVGA 2L9HA 2MFIA 2RDGA 1WTPA 2Y0SE 3OWEB 1SR3A 1NAPA 1YNXA 1ET6A 2R61A 4POFA 1Z7TA 4WJ3M 4FO2A 2IT1A 2SOBA 1IKMA 1V9PA 2B2WC 1NR4A 4GOPA 3H3VH 1VQJA 3J80E 3TDQA 3AFPA 5M3FH 3K57A 2EVBA 2RDHA 4A75A 2JA8B 5IP9H 1ASYA 2E75C 4V0BA 3K80C 4A3MB 2BOSA 4WRDA 1VQNA 4NPSA 4BBRG 4KD3A 4LF4L 1L1OC 4DR3L 4PG3A 4B3SQ 5I9PA 2B2YC 2K5WA 3K5LA 3F8TA 5IODA 1JJCB 1KAWA 1STHA 2X6LA 3IL8A 1HXYD 4KD4A 4C3HH 1HZ9A 3D4DA 5I6YA 1Y1WB 4A3GG 1PH4A 2B29A 1F2YA 4K8JA 4C3JB 5HY6A 2QF7A 4LFAQ 3L7ZC 1YNNC 4J6HA 4A3IG 3RLNA 1W6JA 4JI0L 4JI4L 2XGTA 2QILA 3NHHA 3GTLH 1B9MA 1KNAA 3T51B 4KHPL 1FGUA 3KF6B 3R8BA 1A15A 1DCZA 1I50H 3DHQA 3LNNA 5M5XH 3D6CA 4RFBA 4KTAA 2EY5A 2F0PA 4BA1I 5EPJA 1EEFD 3TEHB 4BY1G 1YHAA 1PTOD 1KHIA 2DGYA 5D3DA 1GHKA 3RZOB 4JVZA 3MA2B 2L1BA 2YTVA 1E7ZA 1VQIA 3E0EA 4OWXB 4GZYC 2RDFA 2A1AA 2B2UC 3S1QB 1QNUA 4HCSA 3ONAB 2UUBQ 3PO2G 1F9RA 1FNWA 1HNZL 3JAMi 3ND8A 4LFCQ 4KMUC 4NXML 2JA7H 4X3UA 5IGCA 2I07B 3HOZB 3PUYA 3Q8DA 2O5IC 1BOSA 2UXCQ 2F0MA 3OMCA 4P72A 4X64Q 4BBSB 5KIXA 2NVTH 2BH2A 4DV4L 3E6ZX 3H91A 1Y8NB 2LS01 1K83H 5COYA 4IZ8A 1QZHA 2F4VL 1VQ9A 4XXEA 1HZBA 1D5MC 4A3FG 3KDFB 1TWAH 1ZYRD 3FDTA 1YJ9A 1H9SB 1H9KA 4OO1G 1QWYA 1I3QB 4CKBA 1SE2A 3SVMA 1VQPA 4JYAL 1KXLA 2K6AA 1MI2A 4DUZQ 4J1MA 4RG1A 2R92H 1Y69U 4AQYL 4JI8Q 5GAEC 3M4OH 3BG3A 4MN3A 1HR0W 5KGUA 1VQ5A 1FNVA 3F2CA 4F87A 2EXZA 1MJCA 3K7AB 2NN6I 3C46A 2DY7A 4YCVA 1L0WA 2WV6D 5C5MA 4CDFC 2JEAI 5IT9c 1PH1A 1W2BA 4O0AA 1M90C 3CCEA 4HIMA 4OX9Q 2YV5A 1XXGA 5E4XA 1U5KA 4A3JH 2PW7A 1S72A 2PZTA 2TSSA 1TWGH 3ITPA 1GO3E 2ZJQA 1NNXA 1C7YA 1Q8IA 3EQLC 3NSWA 4K5WA 1STAA 2IW3A 1XWEA 2R7ZH 2KEDA 2B2WA 1FJGL 5IYBH 2PQEA 1CKOA 1B44D 4GS3A 4ZYSA 1STYA 2ALYB 3GTGB 1F2LA 5LMNQ 1YI2A 4UP9A 2FFKB 2D2CC 1HHVA 1XMOL 3GDEA 1B3QA 1PTOC 4K2LA 3EVQA 3HOXH 4OWWB 5HGTA 2CH4W 3CC7A 1L1OA 2QEJC 1KL9A 2B2YA 1TWCB 3OIQA 1S40A 1V1PB 3LWUA 1ILPA 1U4MA 4HMJA 1SDFA 2ZXRA 3I4MB 2NTSA 2ZJPA 1JB3A 1PYBA 4POGA 4DR5Q 1LTAD 1T5XD 1A3TA 3I4LA 1SEBD 1GHJA 3VR3A 3PO3H 1GVPA 3BDOA 3DXJC 2CW0D 3X3NA 2CCZA 2MGSA 1N34L 3S17H 3DUZA 2HDMA 4IUTA 1PHJA 2VUMB 3HOVB 4RAUC 2DNEA 2K5QA 1MD2D 5KRUA 5A2QL 5C44B 3MAQA 3S1NB 2AQ2B 3D3RA 1N8RC 3T56B 4CKCA 3QG1A 1V1QA 5C5LA 5JEAG 2KHSA 4C56C 1G6ZA 2CQAA 1DYQA 1F9QA 1BBXC 1L0YB 4KN7C 1YHBA 4A4IA 2I5LX 2EQSA 4JOIC 4ULLA 1BVSA 2Z4IA 4LF9Q 1X3GA 4X3SA 2IX0A 1A63A 1DD2A 2LMCB 4L5RC 3S24A 1ZYRC 2R93B 2F3IA 4IPHA 1SMYD 4A3GH 1KDBA 1O7LA 4RCOA 4DK3C 1QOHA 2B2UA 3NEMA 4L63B 3V2TA 1FYCA 2EJMA 4JBKA 2BCOA 1NUCA 4KI0A 4A3IH 3HFZB 3PUXA 2D0OA 3AU7A 1YJWA 2WACA 4B3SL 2EYJA 3A8IE 1HPCA 3GTKH 2M9VA 1GOZA 1S5FD 1TT2A 2SEBD 3S15H 2RSNA 3S16B 1B53A 3VR5A 2LY7A 2OT2A 3K0XA 3J81c 5C3EB 4GKJQ 3NQIA 4BY1H 2OTLA 3T1HQ 1LLRD 4LFAL 2XIWA 3QOJA 3GTMB 1N9WA 3CP0A 2EYLA 1U4RA 1ZEQX 3D8GA 2K5HA 3TP6A 3RZDH 1YEZA 2JXMB 3J7ZC 1UEAB 4HEDA 1NMGA 3RLFA 4HJ8A 1K0SA 4B3TQ 4MZ9A 3GTOH 1K73C 1EEID 5JPNC 1CSQA 4C2MB 5CMDA 5K5PA 3E9HA 1B9NA 5M5YH 1B3AA 3AMUA 3PO2H 4L6TB 4FP5D 1X6OA 4GNXB 1CHQD 4XT1B 1EQVA 4DNRB 3F2BA 2JA5B 4A3KH 2WFWA 5I2YA 3IAYA 2B63G 5JPMC 3CCRA 4A3BG 4IQZA 4IFDG 1HNXQ 4ZUJA 4WJ4A 1A2TA 4QIWB 4ME5A 2F3VA 2B39A 1A0IA 3W1GA 5ELOA 1CKNA 4YWMA 1NR2A 1E2VA 1JCKB 1BUVT 2RF4A 3BDLA 2UUBL 3K0YA 2YU9H 4C1NI 4A3CH 2KVMA 2E2JB 2VNUD 3WDNA 3KBXA 4OO1H 1FVIA 1HRJA 3T16A 2F0QA 2UXCL 4X64L 2J0TD 1EYAA 4LF6Q 1UNSA 2F03A 4FYDA 1PZJD 1SSOA 2HD3A 2VB2X 3OHXC 4MHEA 4PMWA 2A69D 1JORA 4LWCA 3GTQB 2O2LD 3BDCA 2BDNA 1AH9A 1PXUA 4HIOA 3KUPA 3SR1A 1C0AA 1SMYC 2A68D 1XTDA 4X66Q 4BWGB 5EBDA 4DUZL 2PQAB 3J81i 4JBMA 4JI8L 4H02A 3I72A 5IGBA 1PFMA 2IPKD 1X9NA 5M3FG 2XRSD 1JICA 3S2HH 5AFWA 2AHOB 1NY4A 4XDXA 1J8IA 4AYBB 2MQHA 2P5ZX 2WB1G 4DFAA 1GM5A 2RBMA 3ULLA 4OX9L 4YIJA 3A55A 3B6YA 3RMHA 1K0RA 2IY5B 2Z8LA 2IX3A 1LTSD 4JOIA 1ESFA 3IFDA 3EIVA 3M7GA 2NUCA 2WB1E 3VR4A 1T5EA 1KNEA 2NZOA 2VQEQ 2RCNA 1X3FA 1D1KA 4LUVA 1UE5A 2KCCA 5LMNL 5CV7A 2KCTA 1JT8A 3P75A 2DUDA 1BNZA 1LT4D 4ALPA 3HP3A 4I65A 3ERQA 4H0LC 4EGVA 1II3A 2E5LQ 3CC4A 1GJXA 3S14B 1GUTA 5IWAQ 4XQJA 1E1OA 1HUNA 2UUAL 1PYWD 3URYA 1WTWA 1CFMA 5JEAH 4NW2A 1EIHA 1SJHD 4DR5L 2MHVA 1UE7A 3J7AV 3MXNA 1JQYD 2WKDA 4DV7Q 3S2DB 1SMXA 4BY7H 1KRSA 2RQXA 2N8NA 2Z1CA 4J8QA 2QDLA 5C0XI 3WWVA 1XNRQ 5EJWA 1JE4A 1BQQT 1TQOA 4JI6Q 4DU9A 1BBWA 1SNOA 3K8AA 1KABA 5EAYA 3U9OA 5CV5A 1BCPD 2B2VC 4ZKCB 3X3MA 1KAAA 4KHZA 4QF4A 2OQKA 4GN3B 2IX1A 3G71A 2A69C 4LF9L 2RVLA 4P74A 4CDEC 1FGBD 3CKIB 5CORA 1RDPD 2A68C 1RF2D 2EZVA 3NBHB 2Q8IB 4FVMA 1LO5D 1Q12A 3J80i 3MXGA 2ES2A 4JC0A 1L0XB 4Z9CB 5IE8A 5BR8Q 1J6QA 3LGJA 5FLXL 4K2KA 2EE1A 1H9RA 3EBEA 2MJ8A 3A0JA 1BR9A 5ELCA 2G9HD 3IKJA 4ZKBB 4DXGA 4LFBQ 2R92G 4RKBA 3QB3A 3K58A 1PFNA 1PRTD 3I91A 3KLSA 1B1ZA 1OO9B 4GKJL 2LSSA 2GVBA 3T1HL 3EFXD 5IP7H 4EQOA 3K59A 5G3LF 1EU3A 5KNDA 4A3BH 4C3HB 2EDGA 4B3TL 2K33A 2R3ZA 3LWEA 5EKKA 5BN5A 1MJEA 2NTTA 5C0XJ 4KN4C 1G291 3VA7A 4A3JG 3C1FA 1XNQQ 2NZ1D 3OW7A 3PGZA 4HAEA 2Q2UA 1I4RA 1X55A 3GTLB 1EY0A 2PMZE 3HOUH 1C8CA 4ZAIA 2GVAA 5IYBG 1AEXA 3OIPA 2K5DA 2F3WA 2OQ0A 1M4VA 1PH5A 5M5XB 2UUCQ 1HNXL 1HUMA 3CQZH 4QUCA 1LTGD 3BZKA 1ENCA 3C1EA 1Z6HA 3D0FA 1EZ6A 2L12A 4LK1C 1PRTB 1K9MC 2D62A 3HGBA 1KLGD 3HOXG 1EWCA 3MTSA 3GO5A 4ZQ3A 4C3IH 2B2TC 4M1UB 2F0FA 5J39A 1KDAA 1PA6A 3E9IA 3MC0B 4IPDA 1QUQB 2I5HA 1VQHA 2PZWA 3JAMc 3UDFA 2F0SA 1X56A 2KHJA 2WAQG 4C1NK 3PO3G 4DAMA 3H0GB 3SE0A 4LF6L 1RKNA 3A5ZB 2QEXA 2JA7B 1CI3M 3PUZA 1K3BC 1SROA 3PMFA 1BCPC 2L15A 3RNUA 5C4XG 3TQYA 4F88A 1HTPA 2HQEA 4L5QA 1VS0A 4A3EH 3ERSX 1GD7A 3PIOA 3STBD 4N8X1 3N6RA 3TP5A 4EQ5A 2WAQE 1W6KA 1XPOA 5IYDH 4N9TA 3U9SA 5ISRA 2KJXA 1PV4A 2B8FA 5C3XA 3BZDB 4X66L 1A3UA 5CV8A 3KYHC 4QCLA 3G7LA 3TS0A 3C3LA 1RTOA 5KEEA 2MO1A 1ZKOA 2Z6KC 2IJ0A 1TWAB 1I6HH 4DK6C 2LXKA 4UP8A 1TS2A 1I6VC 3GV6A 3NTKA 4AH6A 3I4NG 4DKAC 2CQOA 1EYCA 1UUPA 2K28A 1Y1VB 2A6HD 2HHHL 3M4OB 2KCNA 3ZJYC 4LNQA 3T1YQ 4CJ1B 4QJFA 2I0QA 2E2DC 1VQ8A 2O4XA 3VYUA 2NVQB 2B2VA 1OXSC 3VYRA 1LABA 5CV6A 3SEBA 4R4TA 4V190 3PIP3 2PI2A 2XN9C 1IW7D 1HJPA 1PZKD 2JA6G 3M85A 3GQBA 4H7BA 1O7YA 1K8GA 2VQEL 2N78A 1TWGB 3I4OA 2A6ED 2R7ZB 2JYOA 3CAMA 2E74C 2Z0SA 1XX8A 1LV9A 4HJ7A 1ICFB 3GV3A 2E5LL 2N55A 5IWAL 2Y0SB 4DGZA 3CU7A 2L0CA 4OELB 2E76C 4YWLA 1B4OA 1YHQA 3FPPA 4R8NA 3I73A 3TSSA 1Q81C 4K14A 5IT9L 4A3KG 2ZXOA 4DV7L 1JC7A 2NVXH 2X6GA 4GLVB 1WJJA 1PH7A 4I7AA 1QVGA 4NB3A 4DAYA 5IGEA 3BYYB 4R4OA 1CHPD 1XNRL 5JOBA 4K6LA
chains in the Genus database with same CATH topology
2EYPA 3PUWA 4RHRA 2BA1A 3O13A 1ESRA 5CBAE 5K36H 2EY6A 2F0HA 2L55A 4KKUA 1WTXA 2AUKA 2F0VA 5EKIA 4XQNA 4BBRB 2F0GA 4S3SA 4CKEA 1DOMA 1ET9A 3FEWX 2B2TA 2E2IB 3DMUA 3D31A 4A3GB 1IL8A 3SHLA 3DEOA 2G9DA 2PYKA 4LAAA 4A3IB 2A6HC 4G7OC 2J7ZA 1E2ZA 4G7HC 3H09A 4RCNA 3LX0A 2A74C 3S1MB 3BYTB 1HFGA 4IURA 4BY1B 1IW7C 1VCIA 3MZ5A 2EYOA 1HTLD 1BO0A 1IKLA 5FLXE 1SXTA 1TS5A 1K8OA 1SNMA 3DWPA 2BDOA 1JOQA 5ELFA 2ID0A 1QILA 3GTOB 2A6EC 3F2UA 4R8IA 5M5YB 1SNDA 1S5DD 1SNPA 4ODGA 3PO2B 3SK5A 2EYHA 3D4RA 4B08A 4XIGS 3J81L 3SXHA 1AP0A 2KQ3A 4KY7A 5TSSA 1PTOH 4G7ZC 5NUCA 1DM0B 3E0JA 1IHZA 3QJYA 1B50A 1I4QA 2YU9B 1PMRA 4NP5A 3DM1A 2RSOA 2KUMA 4QUFA 4A3FB 1HFNA 2F0IA 3HEJA 4WJWA 4IUNA 5KNBA 3I3CA 4U68A 4DK1A 1H9MA 3NTIA 1QE6A 3H94A 2B8GA 1EQTA 4KJNA 2K32A 1LT6D 3NWSA 2R6GA 2XVSA 4DNTB 3TBIB 5FK9C 4G57A 3NWTA 4R9WA 3I90A 2X69A 1WD0A 3KLRA 5LHY1 4RA8A 3S2HB 1UAPA 1MGSA 3M4YA 1ENFA 4KK7A 2KA7A 1S5CD 2AQ1B 1F9SA 2L11A 2BA0A 1CA6A 1S5ED 5FO9B 5EPLA 3T53B 4Q5VA 3TP8A 2F0KA 2WINB 5I2XA 4ZRZA 2XWBB 1PLFA 1SE4A 1EOTA 2CW0C 3MEHA 4FF3A 1LT3D 5F2DA 1A6XA 4KY6A 3RUZA 4CJ0B 3KLSX 1CK1A 5FKAC 2AUJD 5EQ0A 4C3IG 1IYVA 5D65A 1Y8PB 3MFGA 3K6OA 3OWFA 2MPMA 5C3WA 1AZPA 2F0WA 2JE6I 1SYCA 3MXUA 1WTRA 4B9XA 5IT9E 2K1BA 2OF1A 1H9SA 1O7ZA 5C4ZA 2LFNA 3H6MA 4RGNA 5E4WC 3CRLC 3MWYW 1D5ZC 1J9OA 2WIIB 4ZK9B 4KJOA 5CGKA 4XT3B 2HDLA 5DNFA 1A3VA 3PUVA 3QOLA 4HN7A 2EJFC 3FMCA 3FPUB 5CYUA 3A7LA 1F2MA 4DXFA 3FVQA 3C2PA 1HCZA 2QKIC 4RKLA 3N52A 2HCIA 2FJ2A 1BDOA 3BVZA 2EY2A 1OXTA 2ICEC 4DF7A 1IYUA 1V1OA 2K03A 4PNYA 1EU4A 1G8ZD 1JOOA 2EJGC 4FNFA 3NXWA 1CZWA 4ABNA 2WP8J 2B63B 4A3BB 2NN6H 1LTID 4H44C 4ZLTF 1V1PA 5ELDA 2ZT9C 4P2CB 3AB9A 2I46A 3SDZA 2EOTA 4TKOB 2F1MA 2JSOA 1SFOB 3T4AC 2QCPX 4XYQA 3FRPB 2EYFA 1QJOA 1SNQA 4OHJA 4EQPA 3Q23A 2JP1A 1LTRD 2YYZA 2PPBC 3M3YB 2A73B 1WD1A 1CQFA 5KNCA 3W3AA 2K7VA 2C5CA 3RD4A 5G3LD 3I70A 1MBYA 5IGGA 3SK6A 3T13A 1R4QB 3J81E 4K6DA 3NUCA 5JAVA 1ML0D 2FHTA 2NWGA 3Q24A 3EROA 5M3FB 4IUVA 5K36G 1WVLA 1AFPA 2F0EA 4K5XA 2WB1B 3J7YW 4QMGA 3JAML 2KEEA 1STBA 5I4DA 1QG7A 5JVH3 5C0XG 1CZGA 4XTCS 1SNCA 1OXUA 4ILWA 5J22A 4C3JG 1YNND 4UDUC 1X3QA 4IN3A 3QIAA 4TRDA 5EGTA 3MFYA 1I50B 4K8IA 2EY1A 4UAIA 5I6WA 3NP8A 2F0LA 1PZID 2HUGA 1SYEA 2Q8RE 3SK4A 2K04A 1TVXA 5EBCA 4PMCA 5EKLA 1RJTA 3M7NA 3NK9A 4RHSA 1FNUA 4DN4M 1QNKA 3P7JA 1JWSD 2RA4A 3MVVA 2H1EA 2ENBA 1C4QA 1SYDA 2DNCA 3V96A 2AWNA 2NVTB 5CC4A 2H4OA 1K83B 3V05A 2CVRA 1WTQA 2EPBA 1TKWB 4TQUS 3W2DA 1CT1D 3P20A 3ZYYX 1BF4A 3TMEA 4ID6A 2R92B 1R4PB 1Q1EA 1STGA 4WFN3 1K8MA 1PRTC 4XYOA 1X32A 4HR7B 2QDBA 2PMZB 2FMCA 4IUQA 1OXVA 1S5BD 1RHPA 3R2IA 4E6IA 5JJZA 1HA5A 1Q3LA 4FXGC 4A3JB 1MSGA 5FO7B 3HG9A 3R3OA 4OO1I 4DA2A 4F8MA 4B9WA 3VR2A 5D14A 1TIID 5LL6S 5I9OA 1CQVA 4JK1C 3HOXB 4O42A 1BXTA 2M00A 1GXDC 2L5TA 3Q22A 1Y8OB 1EY4A 5FOBB 3OOCA 1FR3A 2EYMA 3NPPA 2WAQB 3PO3B 5DM73 3S17B 1NCVA 1S4ZA 2KECA 5C4XB 5IIFA 4O1NA 4DAPA 1PTOF 2MP1A 4FXDA 3I8ZA 1HQMC 1R9TB 1PTOB 1EY6A 1D5XC 1E2WA 4RGMA 2K05A 2F0NA 2F0UA 4X3KA 1DOLA 3WOEA 3NBHA 5C0XH 2IL8A 3NTHA 4Q0FA 1I4GA 1HA6A 5T1GA 1SYGA 3I4NB 1TWFB 4IUPA 2N88A 5FO8B 1EWHA 1RCVD 2V4DA 1SJED 1LTTD 5E1FA 1DXMA 2J4XA 4KV6A 3GTKB 1JWUD 5T1IA 3S15B 1KDCA 3SK8A 5E3FA 2DN8A 3EJIA 2L4NA 3KK7A 4PV1C 2JA6B 1I4PA 1OXXK 1U4LA 3GTPB 5IGFA 3VA5A 3RZDB 1TY2A 3GTJB 4QB4A 3EA6A 3WOFA 2A5HA 4CHTB 2OEOA 1FD7D 1D2BA 4HSVA 1GUOA 2FMMA 4HCEA 2RKSA 3MHBA 5ELBA 3JAME 1C48A 2PZUA 2BE5D 4HMIA 1EY5A 1I4HA 2SDFA 4NMZA 4LJZC 4A3KB 2AQ3B 5DEHA 5A35A 2NN6G 2LKVA 4IALA 2O5JC 4M8AA 1ZXTA 1PFBA 1V43A 3OSOA 3PIO3 1D1IA 4FF2A 1WCMB 1F2ZA 5KYIA 1EFID 1HQRD 1E0BA 3QO2A 1VDZA 1WTVA 1DJRD 5CR3A 2FINB 3ND9A 1ONLA 1VF7A 2SNMA 1ILQA 1ICWA 3TP7A 1Q1BA 3NE5B 4OIJA 3VR6A 1AW7A 4IUUA 5JEAJ 4IFDI 3A7AB 1Q90A 4CBVA 3IFTA 2E2HB 3QWNA 2XWJB 4Y7NB 1EY9A 1TWHB 1YNJD 3KBGA 5DAUA 2Z4HA 2HCCA 1U9RA 2NYZD 3TN2A 3MXPA 3L9AX 1CTMA 2PO4A 5IGDA 3A8JE 1Z47A 3GD7A 4LMQD 2SNSA 4G4KA 2WKCA 4OIKA 5M5WB 4H13C 3OMGA 2NVYB 3CRKC 4KY5A 3GP7A 1GUWA 4HSPA 5CBEE 3TZDA 2XNAC 4RGTA 4EQNA 1F9PA 4PMBA 4N9PA 2BE5C 2Q8TA 5JVG3 2F4IA 1JWMD 1KLUD 1SBBB 1XTCD 3J80L 3A54A 3VYTA 4ZUIA 4NDXA 1QCBD 4IFDJ 2JEBI 3Q6SA 3DWAA 1GUNA 5ELEA 5C4HA 4BY7B 3S1RB 2XSCA 4EVOA 3HOWB 2F0TA 4FXKC 2PW5A 1G2SA 1B2TA 4OL7A 3HKZB 5CV9A 1JOKA 2C9OA 1TS4A 1TU2B 4I7ZC 1KTKA 3HRZC 5M3MB 2VB3X 4X3TA 2KOLA 1O78A 3L3OC 3K5NA 3PV0A 1SYFA 5LL6X 1QB5D 1YNJC 1SE3A 4NKLA 3CHBD 5M9OA 2TMPA 4OGQC 2M2LA 4KHVA 1GUSA 2NB0A 3KF8A 4FF1A 1TS3A 3D6WA 5D3IB 1LACA 5CV4A 1DZ1A 1TR5A 2NBFA 1XYIA 3DEPA 5KYLA 4C3HG 2F0JA 3P1HA 2IWHA 4CJ2C 1WTOA 1U4PA 3BS1A 3R93A 2AWOA 5J1ZA 1TY0A 2D5DA 3NBIA 1M8AA 1G91A 3HOUB 4MIUA 1G2TA 1EZ8A 1STEA 2PCFB 4DAVA 3FKIB 3HOYB 3HZXA 3CQZB 1DONA 1RODA 5HURA 3A8KE 4KKTA 1CA5A 3TZUA 2ICIA 3G6JB 2MUYA 4C3IB 1DOKA 1X3PA 1EIGA 1VMPA 4PQXA 4HTHA 5C6AA 1NSNS 1STNA 2PNRC 3E5SA 2F0DA 4BA2I 1SYBA 1I4XA 4JBWA 1LT5D 3OPOA 4A3EB 3J7AF 2XRQD 2CHBD 2K01A 2OXPA 4RGOS 4CGYB 1GUGA 4K5VA 5BN4A 1EY8A 5A2QE 1AN8A 1PDQA 1CM9A 4FF4A 4A3DB 1I6HB 1VF5C 1ENAA 1LTBD 5IOCA 2DY8A 1F77A 1BCPF 3D4WA 3DWQA 1BCPB 3K5MA 3A56A 1EL0A 1V8QA 5BN3A 4XQQA 1H9JA 4U673 4RH6A 1O80A 4IFDH 1RTNA 3NQTA 1SAPA 4L8JA 2ZXPA 1EY7A 4DK0A 4KKSA 2F0OA 4TSSA 1VMCA 5C4JB 3HS0C 1MSHA 3UI2A 3VYSA 2GA4B 5EPKA 1EYDA 3S9WA 3H3VC 1PRTF 3Q0AA 1D6EC 4F7XA 1RD9D 4BS9A 4WORA 3K5OA 2VXWA 3R2TA 1JR0D 1AZQA 4RWSC 4A93B 5DM63 1A2UA 2D9UA 3BVMA 2NVXB 3BVGA 2L9HA 2RDGA 1WTPA 3OWEB 1NAPA 1ET6A 2R61A 1Z7TA 4FO2A 2IT1A 2SOBA 1IKMA 2B2WC 1NR4A 3J80E 3TDQA 3K57A 2EVBA 2RDHA 2JA8B 2E75C 4V0BA 4A3MB 2BOSA 4WRDA 4KD3A 5I9PA 2B2YC 2K5WA 3K5LA 5IODA 1STHA 2X6LA 3IL8A 1HXYD 4KD4A 3D4DA 5I6YA 1Y1WB 1F2YA 4K8JA 4C3JB 2QF7A 3L7ZC 1YNNC 4J6HA 1W6JA 2QILA 3NHHA 1B9MA 3T51B 1KNAA 3R8BA 1A15A 1DCZA 3DHQA 3LNNA 3D6CA 4RFBA 4KTAA 2EY5A 2F0PA 4BA1I 5EPJA 1EEFD 1PTOD 5D3DA 1GHKA 3RZOB 3MA2B 2L1BA 4GZYC 2RDFA 3S1QB 2B2UC 1QNUA 4HCSA 3ONAB 1F9RA 1FNWA 3ND8A 4KMUC 4X3UA 5IGCA 2I07B 3HOZB 3PUYA 2O5IC 1BOSA 2F0MA 3OMCA 4BBSB 5KIXA 3E6ZX 3H91A 1Y8NB 2LS01 5COYA 4IZ8A 4XXEA 1D5MC 1ZYRD 3FDTA 1H9SB 1H9KA 4OO1G 1QWYA 1I3QB 4CKBA 1SE2A 3SVMA 2K6AA 1MI2A 4J1MA 1Y69U 3BG3A 4MN3A 5KGUA 1FNVA 4F87A 2EXZA 3K7AB 2NN6I 3C46A 2DY7A 2WV6D 5C5MA 2JEAI 1XXGA 5E4XA 2PW7A 2PZTA 2TSSA 3ITPA 1Q8IA 3EQLC 3NSWA 4K5WA 1STAA 2IW3A 1XWEA 2KEDA 2B2WA 2PQEA 1B44D 4ZYSA 1STYA 3GTGB 1F2LA 2FFKB 2D2CC 1HHVA 1PTOC 4K2LA 3EVQA 5HGTA 2QEJC 2B2YA 1TWCB 3OIQA 1V1PB 3LWUA 1ILPA 1U4MA 4HMJA 1SDFA 2ZXRA 3I4MB 2NTSA 1JB3A 1LTAD 1T5XD 1A3TA 3I4LA 1SEBD 1GHJA 3VR3A 3BDOA 3DXJC 2CW0D 3X3NA 2MGSA 3DUZA 2HDMA 4IUTA 2VUMB 3HOVB 4RAUC 2DNEA 2K5QA 1MD2D 5KRUA 5A2QL 5C44B 3MAQA 3S1NB 2AQ2B 3D3RA 3T56B 4CKCA 3QG1A 5C5LA 5JEAG 2KHSA 4C56C 1G6ZA 2CQAA 1DYQA 1F9QA 1BBXC 1L0YB 4KN7C 4ULLA 2Z4IA 4X3SA 2IX0A 1DD2A 2LMCB 1ZYRC 2R93B 1SMYD 1KDBA 1O7LA 4RCOA 1QOHA 2B2UA 4L63B 3V2TA 1FYCA 2EJMA 2BCOA 1NUCA 4KI0A 3PUXA 3AU7A 2WACA 2EYJA 3A8IE 1HPCA 2M9VA 1GOZA 1S5FD 1TT2A 2SEBD 2RSNA 3S16B 1B53A 3VR5A 2LY7A 2OT2A 5C3EB 3NQIA 1LLRD 2XIWA 3QOJA 3GTMB 2EYLA 1U4RA 1ZEQX 3D8GA 3TP6A 2JXMB 1UEAB 4HEDA 3RLFA 1EEID 5JPNC 4C2MB 5CMDA 5K5PA 1B9NA 1B3AA 3AMUA 4L6TB 4FP5D 1CHQD 4XT1B 1EQVA 4DNRB 2JA5B 5I2YA 3IAYA 5JPMC 4IFDG 4IQZA 4ZUJA 1A2TA 4QIWB 4ME5A 2F3VA 2B39A 1NR2A 1E2VA 1JCKB 1BUVT 3BDLA 3K0YA 4C1NI 2KVMA 2E2JB 2VNUD 3WDNA 3KBXA 4OO1H 1HRJA 3T16A 2F0QA 2J0TD 1EYAA 1UNSA 2F03A 4FYDA 1PZJD 1SSOA 2VB2X 3OHXC 4MHEA 4PMWA 2A69D 1JORA 3GTQB 2O2LD 3BDCA 2BDNA 1PXUA 3KUPA 3SR1A 1SMYC 2A68D 4BWGB 5EBDA 5IGBA 3I72A 1PFMA 2IPKD 2XRSD 1JICA 5AFWA 4XDXA 1J8IA 4AYBB 4DFAA 2RBMA 4YIJA 3A55A 3RMHA 2Z8LA 2IX3A 1LTSD 1ESFA 3IFDA 3M7GA 2NUCA 3VR4A 1T5EA 1KNEA 1D1KA 2KCCA 5CV7A 3P75A 1BNZA 1LT4D 3HP3A 4I65A 3ERQA 4H0LC 4EGVA 1II3A 1GJXA 3S14B 1GUTA 4XQJA 1HUNA 1PYWD 3URYA 1WTWA 1CFMA 5JEAH 4NW2A 1EIHA 1SJHD 2MHVA 3J7AV 3MXNA 1JQYD 2WKDA 3S2DB 2RQXA 2Z1CA 4J8QA 5C0XI 5EJWA 1JE4A 1BQQT 1TQOA 4DU9A 1SNOA 1KABA 3U9OA 5CV5A 1BCPD 2B2VC 4ZKCB 3X3MA 1KAAA 4KHZA 4QF4A 2IX1A 2A69C 2RVLA 1FGBD 3CKIB 5CORA 1RDPD 2A68C 1RF2D 2EZVA 2Q8IB 4FVMA 1LO5D 1Q12A 3MXGA 1L0XB 4Z9CB 5FLXL 4K2KA 2EE1A 1H9RA 2MJ8A 1BR9A 5ELCA 2G9HD 3IKJA 4ZKBB 4DXGA 4RKBA 3QB3A 3K58A 1PFNA 1PRTD 3I91A 3KLSA 1B1ZA 1OO9B 3EFXD 4EQOA 3K59A 5G3LF 1EU3A 5KNDA 4C3HB 2EDGA 2K33A 2R3ZA 3LWEA 5EKKA 5BN5A 2NTTA 5C0XJ 4KN4C 1G291 3VA7A 3C1FA 2NZ1D 3OW7A 4HAEA 1I4RA 3GTLB 1EY0A 1C8CA 4ZAIA 1AEXA 3OIPA 2K5DA 2F3WA 1M4VA 5M5XB 1HUMA 4QUCA 1LTGD 1ENCA 3C1EA 1Z6HA 1EZ6A 2L12A 4LK1C 1PRTB 2D62A 3HGBA 1KLGD 1EWCA 3MTSA 3GO5A 4ZQ3A 2B2TC 4M1UB 2F0FA 5J39A 1KDAA 3MC0B 2PZWA 2F0SA 4C1NK 3H0GB 3SE0A 1RKNA 2JA7B 1CI3M 3PUZA 3PMFA 1BCPC 4F88A 1HTPA 2HQEA 3N6RA 3TP5A 1W6KA 4N9TA 3U9SA 5ISRA 2KJXA 2B8FA 5C3XA 3BZDB 1A3UA 5CV8A 4QCLA 3G7LA 3C3LA 1RTOA 5KEEA 1ZKOA 2IJ0A 1TWAB 1TS2A 1I6VC 3GV6A 3NTKA 1EYCA 1UUPA 2K28A 1Y1VB 2A6HD 3M4OB 2KCNA 4CJ1B 2E2DC 2O4XA 3VYUA 2NVQB 2B2VA 1OXSC 3VYRA 1LABA 5CV6A 3SEBA 4V190 3PIP3 2XN9C 1IW7D 1PZKD 3M85A 3GQBA 4H7BA 1O7YA 1TWGB 2A6ED 2R7ZB 2JYOA 2E74C 1XX8A 1LV9A 3GV3A 2N55A 2Y0SB 4DGZA 3CU7A 2L0CA 2E76C 1B4OA 3FPPA 4R8NA 3I73A 3TSSA 4K14A 5IT9L 2ZXOA 1JC7A 2X6GA 4DAYA 5IGEA 3BYYB 1CHPD 5JOBA 4K6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOT A;  3D6W A;  3KUP A;  5D14 A;  2RVL A;  1GUW A;  2HUG A;  1B50 A;  5CBE E;  1DZ1 A;  2DY7 A;  2Q8R E;  3TZD A;  1XYI A;  5COR A;  4CJ0 B;  2K04 A;  4HSV A;  1TVX A;  2FMM A;  1ESR A;  3DEP A;  4O42 A;  5CBA E;  2RSN A;  1EL0 A;  3DM1 A;  1PFM A;  1RJT A;  2RSO A;  2KUM A;  4QUF A;  1B53 A;  5E4X A;  5EQ0 A;  2SDF A;  1JIC A;  1KNA A;  1F9P A;  1O80 A;  5D65 A;  4CJ2 C;  1WTO A;  5AFW A;  1U4P A;  1WTX A;  1HFN A;  1RTN A;  2JP1 A;  2MPM A;  3G7L A;  1HHV A;  5EKI A;  1QNK A;  1RTO A;  1A15 A;  1SAP A;  4XDX A;  3R93 A;  4DN4 M;  1J8I A;  1AZP A;  3P7J A;  1WD1 A;  2XIW A;  2Q8T A;  2EE1 A;  2MJ8 A;  2RA4 A;  1M8A A;  1VMC A;  2B2W A;  1U4R A;  1PFB A;  1ZXT A;  2KED A;  1G91 A;  3I3C A;  5EPJ A;  4ZKB B;  4U68 A;  2H1E A;  1DOM A;  1WTR A;  3GV6 A;  1G2T A;  1MSH A;  2K1B A;  4HED A;  1PFN A;  1O7Z A;  1QE6 A;  3I91 A;  3UI2 A;  2B2T A;  1NCV A;  1S4Z A;  1EQT A;  2K28 A;  2KEC A;  1F2L A;  2FFK B;  5CMD A;  5EPK A;  3IFD A;  1DON A;  1IL8 A;  3Q6S A;  1ROD A;  2MP1 A;  2L1B A;  3DEO A;  1B3A A;  1E0B A;  5E4W C;  3I8Z A;  3QO2 A;  4CJ1 B;  1CA5 A;  1WTV A;  1WTQ A;  2CVR A;  3MWY W;  2EPB A;  2FIN B;  1J9O A;  1ML0 D;  2B2V A;  2B2Y A;  2B2U C;  2FHT A;  1KNE A;  2NWG A;  4HCS A;  4XT1 B;  3ONA B;  1ILQ A;  2R3Z A;  4IUV A;  3LWE A;  4ZK9 B;  1ILP A;  1ICW A;  1WVL A;  1DOK A;  1F9R A;  2VXW A;  1U4M A;  2J7Z A;  1SDF A;  4R9W A;  4XT3 B;  3I90 A;  4OIJ A;  1X3P A;  2HDL A;  2X69 A;  4RWS C;  5DNF A;  1WD0 A;  1AZQ A;  1EIG A;  4X3U A;  2NZ1 D;  2K05 A;  4IUU A;  1BF4 A;  1BNZ A;  4HAE A;  3FPU B;  1VMP A;  2D9U A;  3HP3 A;  4X3K A;  1DOL A;  4RA8 A;  1NR2 A;  1G2S A;  1B2T A;  1MGS A;  1O7Y A;  2L9H A;  2IL8 A;  2MGS A;  1C8C A;  4ZAI A;  1HFG A;  1HA6 A;  5T1G A;  4IUR A;  3N52 A;  2HDM A;  4IUT A;  1WTP A;  2HCI A;  1HUN A;  2KEE A;  4RAU C;  1NAP A;  4IUP A;  2N88 A;  2FJ2 A;  1WTW A;  1BO0 A;  1IKL A;  1HUM A;  1X32 A;  3H91 A;  4NW2 A;  1QG7 A;  2KVM A;  4QUC A;  1EIH A;  2JYO A;  1F9S A;  2L11 A;  2L12 A;  5COY A;  2K03 A;  1XX8 A;  1IKM A;  2B2W C;  3KBX A;  1NR4 A;  1LV9 A;  1X3Q A;  3GV3 A;  4IUQ A;  4X3T A;  2KOL A;  2N55 A;  3MTS A;  1HRJ A;  1RHP A;  2K01 A;  1CA6 A;  1G6Z A;  5T1I A;  5JJZ A;  1F9Q A;  1B4O A;  2B2T C;  3F2U A;  5EPL A;  2HCC A;  4R8I A;  1BBX C;  3FDT A;  1SSO A;  1Q3L A;  5EJW A;  1JE4 A;  4X3S A;  1PLF A;  4MHE A;  2NYZ D;  1MSG A;  2L4N A;  3TN2 A;  1EOT A;  2X6G A;  1PDQ A;  1CM9 A;  3SVM A;  4ZLT F;  1MI2 A;  2B2V C;  1U4L A;  4ZKC B;  2B2Y C;  4LMQ D;  2M2L A;  4MN3 A;  1AP0 A;  4UAI A;  2B2U A;  2DY8 A;  2X6L A;  3IL8 A;  2BDN A;  4OIK A; 
#chains in the Genus database with same CATH topology
 1KD1 C;  1WTH A;  2EYP A;  2Z9H A;  3PUW A;  4JI6 L;  1WCM G;  4A3C G;  1PH8 A;  5JJL A;  1O7I A;  3ULJ A;  4RHR A;  2KHI A;  2BA1 A;  3O13 A;  1ESR A;  5CBA E;  4DR1 L;  5K36 H;  2EY6 A;  2F0H A;  5E7N A;  3AEV A;  4X6A H;  1JJG A;  2L55 A;  1Y14 B;  4KKU A;  1WTX A;  1JB7 A;  2AUK A;  3CW2 C;  2F0V A;  5EKI A;  4XQN A;  3OYY A;  4BBR B;  2F0G A;  1VQO A;  2OWO A;  4S3S A;  4CKE A;  1DOM A;  2OTJ A;  4ZCK A;  1ET9 A;  3FEW X;  2PNH A;  2B2T A;  4JI7 Q;  2E2I B;  5BR8 L;  1PVO A;  3DMU A;  2V1C C;  3D31 A;  4A3G B;  1IL8 A;  3SHL A;  4C3J H;  3DEO A;  2G9D A;  3CCV A;  3OTO Q;  4DPG A;  4LFB L;  4LF5 Q;  2PYK A;  3RR5 A;  4LAA A;  4A3I B;  2A6H C;  2K14 A;  2K52 A;  4G7O C;  2J7Z A;  3KF8 B;  1T9H A;  1E2Z A;  4G7H C;  3H09 A;  4RCN A;  3LX0 A;  2A74 C;  2A19 A;  3UDG A;  2QA4 A;  1G51 A;  3S1M B;  3BYT B;  1HFG A;  4IUR A;  4IOC A;  3RZO H;  4BY1 B;  1IW7 C;  2YTX A;  1VCI A;  3NEN A;  3MZ5 A;  2EYO A;  1HTL D;  1BO0 A;  1IKL A;  5FLX E;  1XNQ L;  1SXT A;  1TS5 A;  1XPU A;  1K8O A;  1SNM A;  3DWP A;  2BDO A;  1JOQ A;  3A74 A;  5ELF A;  2ID0 A;  1QIL A;  2Z6K A;  2A6E C;  3GTO B;  2UUA Q;  1E22 A;  3F2U A;  4R8I A;  1U0L A;  1SND A;  1S5D D;  1SNP A;  4ODG A;  2UUC L;  4BXX H;  5M5Y B;  3PO2 B;  3SK5 A;  5FLM G;  3I55 A;  2EYH A;  3HOZ H;  1OTC A;  3D4R A;  4B08 A;  4XIG S;  2NZH A;  5C4X H;  4BBS H;  3J81 L;  3SXH A;  4OXP A;  1AP0 A;  3G6E A;  3UDX A;  2D0P A;  2KQ3 A;  4KY7 A;  2ZM6 Q;  5TSS A;  1R9T H;  1PTO H;  4G7Z C;  5NUC A;  1DM0 B;  3E0J A;  1IHZ A;  3QJY A;  1B50 A;  4IOA A;  4R4I A;  1RL2 A;  1I4Q A;  2YU9 B;  1PMR A;  4FDB A;  4NP5 A;  1VQK A;  4BY7 G;  2BH8 A;  4OEM B;  3DM1 A;  2RSO A;  2KUM A;  4QUF A;  4DV2 L;  4A3F B;  5FJ8 G;  3HOW G;  1HFN A;  5HGQ A;  1I3Q H;  2F0I A;  3HEJ A;  3L2P A;  4WJW A;  4IUN A;  1FL0 A;  3I4N H;  4CDD C;  1TWF H;  2HIX A;  1VQD A;  1E1T A;  4YWK A;  1E3P A;  5KNB A;  3I3C A;  4U68 A;  4DK1 A;  1H9M A;  3HKZ G;  3NTI A;  1EQQ A;  1QE6 A;  3H94 A;  2B8G A;  2JN4 A;  3K7A H;  5GQO A;  1EQT A;  1N36 Q;  4KJN A;  2K32 A;  2CKZ B;  1LT6 D;  3NWS A;  5JJI A;  2R6G A;  5M3M G;  2XVS A;  3KJP A;  4HJ5 A;  1KC8 C;  1HZC A;  4DNT B;  4DV6 Q;  1NTG A;  3TBI B;  5FK9 C;  2JA6 H;  4G57 A;  1JMC A;  3NWT A;  4APV A;  3GTP H;  3HKZ E;  4R9W A;  3CPW A;  3I90 A;  3RLO A;  2X69 A;  1WD0 A;  3KLR A;  1VQM A;  3GTJ H;  3T1Y L;  1QVC A;  5LHY 1;  4RA8 A;  3S2H B;  1UAP A;  1MGS A;  3M4Y A;  5H1S E;  2FXQ A;  1PH2 A;  4X65 L;  1ENF A;  3GTG H;  2GN5 A;  4KK7 A;  3E3X A;  3KF6 A;  2K50 A;  1YZ6 A;  2KA7 A;  1S5C D;  1HR0 Q;  2AQ1 B;  1XJV A;  3DM3 A;  1F9S A;  4DV5 Q;  2L11 A;  5IP7 G;  2EXD A;  4UY8 C;  1H95 A;  2BA0 A;  1CA6 A;  1S5E D;  5FO9 B;  1EUJ A;  5EPL A;  3T53 B;  4Q5V A;  3I4M H;  3TP8 A;  2F0K A;  2WIN B;  5I2X A;  4ZRZ A;  2XWB B;  2VW9 A;  3K81 C;  1PLF A;  1SE4 A;  1EOT A;  1BKB A;  1WCM H;  1AE3 A;  2PI2 E;  2CW0 C;  2RHQ B;  3MEH A;  3HOU G;  4FF3 A;  1LT3 D;  5J3B A;  1VQ6 A;  5F2D A;  3FKI G;  2ASB A;  1A6X A;  2VL6 A;  4KY6 A;  3S1N H;  3HOY G;  3F2D A;  3RUZ A;  4QL5 A;  4CJ0 B;  3KLS X;  1CK1 A;  5FKA C;  1Q7Y C;  1UEB A;  1I94 Q;  1QVF A;  4GKK L;  2AUJ D;  4HJ9 A;  5EQ0 A;  4C3I G;  1IYV A;  5D65 A;  1Y8P B;  3MFG A;  3K6O A;  4L5T A;  3OWF A;  2MPM A;  5C3W A;  3W1B A;  2E2H H;  1AZP A;  2R93 H;  1VQC A;  2F0W A;  2JE6 I;  1W3S A;  4MTK A;  4Y7N H;  4GOP B;  1SYC A;  1WI5 A;  3MXU A;  4P75 A;  1VQ7 A;  4A3L H;  3KDF A;  1WTR A;  4B9X A;  5IT9 E;  2K1B A;  1TWH H;  2OF1 A;  1H9S A;  1O7Z A;  5C4Z A;  2LFN A;  5IYC G;  3PSI A;  3H6M A;  4RGN A;  3KFU A;  2K4K A;  5E4W C;  4GNX C;  4A3E G;  3CRL C;  3MWY W;  3S16 H;  1D5Z C;  1X54 A;  1J9O A;  2WII B;  5L37 A;  4ZK9 B;  4JI7 L;  2HHH Q;  1UE1 A;  2QGQ A;  4KJO A;  5IYD G;  5CGK A;  4XT3 B;  2HDL A;  3PF5 A;  5DNF A;  4JI3 Q;  3CCM A;  1A3V A;  3PUV A;  3QOL A;  4HN7 A;  3J80 c;  2EJF C;  3FMC A;  3FPU B;  5M5W H;  3OTO L;  5CYU A;  3A7L A;  4DR7 Q;  4LF5 L;  2NVY H;  1F2M A;  4DXF A;  3FVQ A;  3C2P A;  1HCZ A;  3MEF A;  2QKI C;  4A3D G;  4RKL A;  3N52 A;  2HCI A;  1YIT A;  1LYL A;  4B3R Q;  2FJ2 A;  1A8V A;  1BDO A;  3BVZ A;  2EY2 A;  1Z9F A;  2B3G A;  2AMC B;  1OXT A;  2ICE C;  1IYU A;  1V1O A;  2K03 A;  4PNY A;  4DF7 A;  3CCQ A;  1EU4 A;  1YVC A;  1G8Z D;  5FLM H;  1JOO A;  2EJG C;  4FNF A;  3DLL A;  2JA5 H;  1CSP A;  3NXW A;  3PF4 A;  2JQO A;  1CZW A;  4QY7 A;  4ABN A;  1X3E A;  3G48 A;  2WP8 J;  2UXB Q;  2B63 B;  4A3B B;  2NN6 H;  1LTI D;  4H44 C;  2JA9 A;  4IPG A;  4ZLT F;  3AQQ A;  1RIP A;  4R4Q A;  1V1P A;  3EN2 A;  3M4P A;  2ZT9 C;  5ELD A;  4P2C B;  3AB9 A;  2I46 A;  3SDZ A;  2E2J H;  2DJG C;  2EOT A;  3S1R H;  4YCU A;  4TKO B;  1EOV A;  2F1M A;  1LM0 A;  3OW2 A;  2JSO A;  1SFO B;  5FJ8 H;  1VQA A;  3T4A C;  3U4V A;  3G4S A;  2QCP X;  4XYQ A;  3HOW H;  3FRP B;  2EYF A;  2CWP A;  1QJO A;  1SNQ A;  2ZM6 L;  4OHJ A;  4EQP A;  3Q23 A;  2K75 A;  2JP1 A;  1LTR D;  2YYZ A;  4A93 G;  2PPB C;  3M3Y B;  2A73 B;  4DR1 Q;  1WD1 A;  1CQF A;  5KNC A;  3W3A A;  3U50 C;  2K7V A;  2C5C A;  4IJH A;  4YY3 Q;  3PQI A;  1NBW A;  3RD4 A;  4DR4 Q;  5M3M H;  5G3L D;  3I70 A;  1MBY A;  3VDY A;  5IGG A;  3BU2 A;  3SK6 A;  3T13 A;  1R4Q B;  2N3S A;  5ELN A;  3J81 E;  4K6D A;  3NUC A;  5JAV A;  1ML0 D;  2FHT A;  3JC6 6;  3CMA A;  2NWG A;  3Q24 A;  3ERO A;  4UP7 A;  5M3F B;  3BJU A;  4IUV A;  2JA8 G;  1DGS A;  5K36 G;  1WVL A;  1N36 L;  3CC2 A;  1AFP A;  4A3M G;  2F0E A;  3M4Q A;  1Q86 C;  4K5X A;  4DV0 Q;  2WB1 B;  3J7Y W;  4DV6 L;  4QMG A;  4JG2 A;  3JAM L;  2KEE A;  1STB A;  5I4D A;  1QG7 A;  1Y1W G;  5JVH 3;  4NXN Q;  5C0X G;  1CZG A;  3CCJ A;  4XTC S;  1SNC A;  1OXU A;  3U4Z A;  4ILW A;  5GAH C;  5J22 A;  1EWI A;  4C3J G;  1YNN D;  4UDU C;  4JCV E;  1X3Q A;  4IN3 A;  3QIA A;  1AE2 A;  3J81 j;  2ZTE A;  1YJN A;  1VQE A;  1HR0 L;  4DV5 L;  4TRD A;  1K8A C;  5EGT A;  3MFY A;  4P71 A;  4GN5 A;  3FKI H;  1I50 B;  4K8I A;  2K5N A;  3S14 H;  4GNX A;  3HOY H;  4UHV A;  4KLK A;  1L1O B;  2EY1 A;  1Q82 C;  4GLX A;  4UAI A;  2R7F A;  3AYH B;  5I6W A;  2A8V A;  3NP8 A;  2F0L A;  1PZI D;  1VQF A;  2HUG A;  1SYE A;  2Q8R E;  3SK4 A;  2UXD Q;  2K04 A;  1TVX A;  5EBC A;  4PMC A;  5EKL A;  1RJT A;  2DJF C;  3M7N A;  3NK9 A;  4RHS A;  1FNU A;  3F1Z A;  4BXX G;  4DN4 M;  1QNK A;  4JPB W;  1UE6 A;  3HOZ G;  3P7J A;  1JWS D;  1YIJ A;  4DV2 Q;  2RA4 A;  2KCM A;  3UE1 A;  2KBN A;  3MVV A;  5IYC H;  1I94 L;  1VQ4 A;  2H1E A;  2ENB A;  4DV1 Q;  4BBS G;  1C4Q A;  2E8G A;  3I7F A;  1SYD A;  2UU9 Q;  2DNC A;  2CH4 A;  1IXR A;  3V96 A;  3H15 A;  2AWN A;  2NVT B;  5CC4 A;  4TVA B;  1Q46 A;  2H4O A;  1K83 B;  2MNA A;  3V05 A;  2CVR A;  1WTQ A;  2EPB A;  4JV5 Q;  4YHH L;  2JJQ A;  1TKW B;  2LXJ A;  4TQU S;  3W2D A;  3KOJ A;  1IZ6 A;  1CT1 D;  4A3D H;  2PQA A;  2RCF A;  3P20 A;  4LF7 L;  3ZYY X;  1BF4 A;  4RMF A;  4L5S A;  4DR2 Q;  3TME A;  4ID6 A;  2R92 B;  1D8L A;  5LMN W;  1R4P B;  1Q1E A;  1STG A;  4WFN 3;  1K8M A;  1PRT C;  4XYO A;  1X32 A;  4JI3 L;  4HR7 B;  2QDB A;  1NMF A;  4DR7 L;  2PMZ B;  2FMC A;  4X65 Q;  4IUQ A;  1OXV A;  1S5B D;  1RHP A;  3R2I A;  4X62 Q;  4E6I A;  5JJZ A;  4B3R L;  1PH9 A;  1HA5 A;  2HIV A;  4LF8 Q;  3UE0 A;  1Q3L A;  4MNO A;  4FXG C;  3FP9 A;  4A3J B;  5C4J H;  1EYG A;  1HNW Q;  1MSG A;  4AIM A;  5FO7 B;  4DR6 Q;  3CCS A;  3HG9 A;  4GN4 B;  3R3O A;  4OO1 I;  2K5V A;  4DA2 A;  4F8M A;  1IBM Q;  2UXB L;  4B9W A;  3VR2 A;  5D14 A;  3I2Z A;  1TII D;  1A62 A;  5LL6 S;  5I9O A;  1CQV A;  4JK1 C;  3HOX B;  4IPC A;  4O42 A;  1BXT A;  4A93 H;  1CKN B;  2M00 A;  1GXD C;  2L5T A;  5JJK A;  2HT1 A;  3Q22 A;  1Y8O B;  3I4M G;  1EY4 A;  3ULP A;  5FOB B;  4PZ6 A;  3OOC A;  1FR3 A;  2EYM A;  2VQF Q;  3NPP A;  4GKK Q;  2WAQ B;  3H0G H;  3PO3 B;  3IRB A;  5DM7 3;  4A76 A;  1P16 A;  2KEN A;  4DV3 Q;  2VUM G;  3HOV G;  3S17 B;  1PFS A;  1NCV A;  1S4Z A;  2KEC A;  5C44 G;  5C4X B;  5IIF A;  4O1N A;  4DAP A;  1PTO F;  2MP1 A;  2JA8 H;  4FXD A;  3I8Z A;  1HQM C;  1WYD A;  4A3M H;  4YY3 L;  3STB C;  1R9T B;  1PTO B;  1SE8 A;  3I56 A;  1EIY B;  4DR4 L;  1EY6 A;  1D5X C;  1TXY A;  4N8F A;  1E2W A;  4RGM A;  2K05 A;  4YCW A;  2F0N A;  2F0U A;  1VQG A;  4X3K A;  1DOL A;  3WOE A;  2R93 G;  1J5E Q;  1Y1W H;  3NBH A;  5C0X H;  2IL8 A;  3NTH A;  3TRZ A;  4Q0F A;  1I4G A;  1HA6 A;  5T1G A;  1IBL Q;  1SYG A;  3I4N B;  4A3L G;  1UWV A;  1TWF B;  4IUP A;  1Y1V H;  2N88 A;  5FO8 B;  4JBJ A;  4DV0 L;  1EWH A;  1RCV D;  2V4D A;  1SJE D;  1LTT D;  5E1F A;  2NVQ H;  1DXM A;  1SN8 A;  2J4X A;  1D7Q A;  4KV6 A;  3GTK B;  1JWU D;  5T1I A;  3RN2 A;  3S15 B;  1KDC A;  3SK8 A;  5E3F A;  4JI1 Q;  2DN8 A;  2Q2H A;  4NXN L;  1HZA A;  4B3M Q;  3EJI A;  5C3E G;  2RHS B;  2L4N A;  3KK7 A;  4HJA A;  2IHF A;  4PV1 C;  2JA6 B;  1I4P A;  2Q2I A;  1OXX K;  1U4L A;  4J15 A;  3CXC A;  3GTP B;  5IGF A;  3VA5 A;  3RZD B;  1TY2 A;  3GTJ B;  4Y52 H;  4QB4 A;  3EA6 A;  3WOF A;  2A5H A;  3S1Q H;  1IBK L;  2EIF A;  4CHT B;  2OEO A;  1FD7 D;  1D2B A;  4HSV A;  1GUO A;  2FMM A;  4HCE A;  2RKS A;  3MHB A;  5ELB A;  3JAM E;  1C48 A;  2VS1 A;  2JA5 G;  4JI2 L;  2PZU A;  2BE5 D;  4HMI A;  1MKH A;  1EY5 A;  1I4H A;  2SDF A;  4NMZ A;  4LJZ C;  4A3K B;  2AQ3 B;  2CFM A;  2H5X A;  4UPA A;  5DEH A;  5A35 A;  2NN6 G;  2LKV A;  2UXD L;  2MO0 A;  3L0O A;  1X65 A;  4IAL A;  2O5J C;  4M8A A;  3MXN B;  1ZXT A;  1PFB A;  1V43 A;  1B7Y B;  1MIU A;  1JJ2 A;  3HKS A;  3OSO A;  3PIO 3;  1D1I A;  1QUQ A;  1XMQ Q;  4FF2 A;  1WCM B;  1F2Z A;  5KYI A;  1EFI D;  1HQR D;  1E0B A;  3QO2 A;  4DNI A;  4QIW E;  1VDZ A;  1WTV A;  1DJR D;  5CR3 A;  4HIK A;  2FIN B;  4DV1 L;  3ND9 A;  1ONL A;  1IL2 A;  1VF7 A;  2SNM A;  2UU9 L;  2C35 B;  1ILQ A;  4MTN A;  1ICW A;  3TP7 A;  1Q1B A;  1KRT A;  3NE5 B;  4OIJ A;  3VR6 A;  4BBR H;  1ASZ A;  1AW7 A;  4IUU A;  1SRU A;  4JV5 L;  5JEA J;  4IFD I;  3A5U A;  3A7A B;  1Q90 A;  4CBV A;  3IFT A;  2E2I H;  3CCU A;  2E2H B;  1GKH A;  3QWN A;  1KIX A;  2XWJ B;  4GLA C;  4Y7N B;  1EY9 A;  1TWH B;  4DR2 L;  1YNJ D;  1N33 Q;  2ZJR A;  3KBG A;  5DAU A;  2Z4H A;  3PCO B;  4LUZ A;  2R7D A;  2HCC A;  1U9R A;  2AKW B;  2VZA A;  3TS2 A;  4DUY Q;  2NYZ D;  3TN2 A;  3MXP A;  1BBU A;  3L9A X;  1C9O A;  4AYB G;  3S1M H;  1CTM A;  1EFW A;  2PO4 A;  4X62 L;  5IGD A;  3A8J E;  1Z47 A;  3GD7 A;  4LMQ D;  5AJ3 Q;  1M1K C;  2SNS A;  5GAD C;  1WFQ A;  1SLJ A;  2OCE A;  4P73 A;  4G4K A;  4LF8 L;  2WKC A;  2ZTD A;  4OIK A;  4H13 C;  4LUO A;  4EX5 A;  5M5W B;  4CDC C;  1HNW L;  3OMG A;  2NVY B;  3CRK C;  4KY5 A;  1TWC H;  3GP7 A;  1GUW A;  4DR6 L;  4HSP A;  5CBE E;  3TZD A;  5LMU Q;  1E24 A;  1L2F A;  4AYB E;  2XNA C;  3W5O A;  1IBM L;  1K28 A;  4RGT A;  1NJI C;  4EQN A;  2VY3 A;  1F9P A;  1Q8K A;  4PMB A;  4JI5 Q;  3H3V I;  3CD6 A;  4N9P A;  2XTI A;  2VUM H;  3HOV H;  1PH3 A;  2BE5 C;  2Q8T A;  5C44 H;  5JVG 3;  2F4I A;  1JWM D;  4LW1 A;  1KLU D;  1SBB B;  1XTC D;  3J80 L;  3A54 A;  2F52 A;  4K0K Q;  3VYT A;  4ZUI A;  4NDX A;  1QCB D;  4IFD J;  2JEB I;  3Q6S A;  2VQF L;  3DWA A;  3NEL A;  4LFC L;  1GUN A;  5ELE A;  1LTL A;  5C4H A;  4BY7 B;  3S1R B;  1N32 Q;  4A3F H;  4DV3 L;  1P8L A;  3TRE A;  2XSC A;  4EVO A;  3HOW B;  2F0T A;  4FXK C;  5IY0 A;  4YHH Q;  2PW5 A;  3ER0 A;  1G2S A;  1B2T A;  3CPF A;  1CKM A;  1EIF A;  4OL7 A;  3HKZ B;  4LF7 Q;  5CV9 A;  1G6P A;  1JOK A;  3CF5 A;  2C9O A;  1TS4 A;  1TU2 B;  4I7Z C;  5DLQ E;  1KTK A;  4R4C A;  3HRZ C;  1J5E L;  4LF4 Q;  5M3M B;  2VB3 X;  4DR3 Q;  4X3T A;  2KOL A;  5C3E H;  1O78 A;  3L3O C;  1IBL L;  3K5N A;  3PV0 A;  1SYF A;  3M9B A;  3GTM H;  5LL6 X;  1QB5 D;  1YNJ C;  1SE3 A;  4NKL A;  3CHB D;  2QW7 A;  5M9O A;  2ZTC A;  2TMP A;  4JW0 A;  4OGQ C;  5IP9 G;  4C2M H;  2M2L A;  4KHV A;  1GUS A;  4OWT B;  4JI4 Q;  4JI1 L;  2NB0 A;  4JI0 Q;  3KF8 A;  4FF1 A;  1TS3 A;  4IJL A;  4B3M L;  3D6W A;  1WOC A;  1PH6 A;  4KHP Q;  5D3I B;  1MHW C;  1LAC A;  5CV4 A;  1PYS B;  1DZ1 A;  1TR5 A;  1I5F A;  2NBF A;  1XYI A;  3DEP A;  5KYL A;  4R1J A;  4C3H G;  2F0J A;  2G5D A;  3P1H A;  2IWH A;  3BZC A;  4CJ2 C;  1WTO A;  1U4P A;  4QGU A;  4QQB X;  4IO9 A;  2IHE A;  3BS1 A;  3R93 A;  2AWO A;  5J1Z A;  1TY0 A;  2D5D A;  3NBI A;  4GOP C;  5GRO A;  3KJO A;  1M8A A;  1G91 A;  3PIP A;  3HOU B;  4MIU A;  1G2T A;  1EZ8 A;  3AFQ A;  1STE A;  1VQL A;  2PCF B;  4DAV A;  3FKI B;  2Z6B A;  1HNZ Q;  3HOY B;  3HZX A;  3CQZ B;  1DON A;  1ROD A;  4NXM Q;  5HUR A;  3ICE A;  3A8K E;  4KKT A;  1CA5 A;  3TZU A;  2ICI A;  1NE3 A;  3G6J B;  2MUY A;  2YTY A;  4DAY B;  2Q2T A;  1JE5 A;  3FHW A;  4C3I B;  1DOK A;  1XMQ L;  3GTQ H;  3SGI A;  3RN5 A;  1X3P A;  4DV4 Q;  1EIG A;  1VMP A;  4PQX A;  4HTH A;  5C6A A;  2F4V Q;  1NSN S;  1STN A;  3H0G G;  4HID A;  2PNR C;  1KQS A;  2JA7 G;  3E5S A;  2F0D A;  1IYJ B;  3CME A;  4BA2 I;  1SYB A;  1I4X A;  4JBW A;  1LT5 D;  3OPO A;  4A3E B;  4JYA Q;  1B8A A;  1S3O A;  3J7A F;  2XRQ D;  2CHB D;  2K01 A;  4AQY Q;  3J7A 5;  2OXP A;  4RGO S;  4CGY B;  1GUG A;  1QZG A;  4K5V A;  5BN4 A;  3UDI A;  1EY8 A;  5A2Q E;  1AN8 A;  1PDQ A;  1CM9 A;  1N33 L;  4FF4 A;  1CUK A;  5GAG C;  3U58 A;  4A3D B;  1I6H B;  1VF5 C;  1ENA A;  1LTB D;  5IOC A;  2DY8 A;  1F77 A;  1BCP F;  3D4W A;  3DWQ A;  1K3R A;  4OON A;  4PZ7 A;  1Y1V G;  4DUY L;  3CCL A;  1BCP B;  2N49 A;  3K5M A;  5AJ3 L;  3KLW A;  1FJG Q;  3A56 A;  1EL0 A;  1V8Q A;  1XPR A;  5BN3 A;  1IBK Q;  2B63 H;  4XQQ A;  1H9J A;  4U67 3;  4RH6 A;  1O80 A;  4IFD H;  1EQR A;  4O2D A;  1LUZ A;  1RTN A;  3NQT A;  1SAP A;  5LMU L;  4L8J A;  2ZXP A;  1EY7 A;  4DK0 A;  1XMO Q;  4KKS A;  2F0O A;  2HQL A;  1B70 B;  4JI2 Q;  4TSS A;  1VMC A;  3S2D H;  5C4J B;  3HS0 C;  1MSH A;  2ATW A;  3UI2 A;  4JI5 L;  3VYS A;  2GA4 B;  1SFO H;  2R7Z G;  3K7U C;  4ME3 A;  5EPK A;  1EYD A;  3S9W A;  3H3V C;  1VQB A;  1PRT F;  3Q0A A;  1D6E C;  2Y0S G;  2I5M X;  4F7X A;  3QR8 A;  1RD9 D;  4BS9 A;  5FLX c;  4K0K L;  4WOR A;  1N34 Q;  1YBY A;  3K5O A;  2VXW A;  3R2T A;  1JR0 D;  1AZQ A;  3M3Y H;  1HH2 P;  4RWS C;  4A93 B;  5DM6 3;  4PZ8 A;  2CWA A;  1A2U A;  2D9U A;  3BVM A;  2NVX B;  2JK8 A;  1N32 L;  3BVG A;  2L9H A;  2MFI A;  2RDG A;  1WTP A;  2Y0S E;  3OWE B;  1SR3 A;  1NAP A;  1YNX A;  1ET6 A;  2R61 A;  4POF A;  1Z7T A;  4WJ3 M;  4FO2 A;  2IT1 A;  2SOB A;  1IKM A;  1V9P A;  2B2W C;  1NR4 A;  4GOP A;  3H3V H;  1VQJ A;  3J80 E;  3TDQ A;  3AFP A;  5M3F H;  3K57 A;  2EVB A;  2RDH A;  4A75 A;  2JA8 B;  5IP9 H;  1ASY A;  2E75 C;  4V0B A;  3K80 C;  4A3M B;  2BOS A;  4WRD A;  1VQN A;  4NPS A;  4BBR G;  4KD3 A;  4LF4 L;  1L1O C;  4DR3 L;  4PG3 A;  4B3S Q;  5I9P A;  2B2Y C;  2K5W A;  3K5L A;  3F8T A;  5IOD A;  1JJC B;  1KAW A;  1STH A;  2X6L A;  3IL8 A;  1HXY D;  4KD4 A;  4C3H H;  1HZ9 A;  3D4D A;  5I6Y A;  1Y1W B;  4A3G G;  1PH4 A;  2B29 A;  1F2Y A;  4K8J A;  4C3J B;  5HY6 A;  2QF7 A;  4LFA Q;  3L7Z C;  1YNN C;  4J6H A;  4A3I G;  3RLN A;  1W6J A;  4JI0 L;  4JI4 L;  2XGT A;  2QIL A;  3NHH A;  3GTL H;  1B9M A;  1KNA A;  3T51 B;  4KHP L;  1FGU A;  3KF6 B;  3R8B A;  1A15 A;  1DCZ A;  1I50 H;  3DHQ A;  3LNN A;  5M5X H;  3D6C A;  4RFB A;  4KTA A;  2EY5 A;  2F0P A;  4BA1 I;  5EPJ A;  1EEF D;  3TEH B;  4BY1 G;  1YHA A;  1PTO D;  1KHI A;  2DGY A;  5D3D A;  1GHK A;  3RZO B;  4JVZ A;  3MA2 B;  2L1B A;  2YTV A;  1E7Z A;  1VQI A;  3E0E A;  4OWX B;  4GZY C;  2RDF A;  2A1A A;  2B2U C;  3S1Q B;  1QNU A;  4HCS A;  3ONA B;  2UUB Q;  3PO2 G;  1F9R A;  1FNW A;  1HNZ L;  3JAM i;  3ND8 A;  4LFC Q;  4KMU C;  4NXM L;  2JA7 H;  4X3U A;  5IGC A;  2I07 B;  3HOZ B;  3PUY A;  3Q8D A;  2O5I C;  1BOS A;  2UXC Q;  2F0M A;  3OMC A;  4P72 A;  4X64 Q;  4BBS B;  5KIX A;  2NVT H;  2BH2 A;  4DV4 L;  3E6Z X;  3H91 A;  1Y8N B;  2LS0 1;  1K83 H;  5COY A;  4IZ8 A;  1QZH A;  2F4V L;  1VQ9 A;  4XXE A;  1HZB A;  1D5M C;  4A3F G;  3KDF B;  1TWA H;  1ZYR D;  3FDT A;  1YJ9 A;  1H9S B;  1H9K A;  4OO1 G;  1QWY A;  1I3Q B;  4CKB A;  1SE2 A;  3SVM A;  1VQP A;  4JYA L;  1KXL A;  2K6A A;  1MI2 A;  4DUZ Q;  4J1M A;  4RG1 A;  2R92 H;  1Y69 U;  4AQY L;  4JI8 Q;  5GAE C;  3M4O H;  3BG3 A;  4MN3 A;  1HR0 W;  5KGU A;  1VQ5 A;  1FNV A;  3F2C A;  4F87 A;  2EXZ A;  1MJC A;  3K7A B;  2NN6 I;  3C46 A;  2DY7 A;  4YCV A;  1L0W A;  2WV6 D;  5C5M A;  4CDF C;  2JEA I;  5IT9 c;  1PH1 A;  1W2B A;  4O0A A;  1M90 C;  3CCE A;  4HIM A;  4OX9 Q;  2YV5 A;  1XXG A;  5E4X A;  1U5K A;  4A3J H;  2PW7 A;  1S72 A;  2PZT A;  2TSS A;  1TWG H;  3ITP A;  1GO3 E;  2ZJQ A;  1NNX A;  1C7Y A;  1Q8I A;  3EQL C;  3NSW A;  4K5W A;  1STA A;  2IW3 A;  1XWE A;  2R7Z H;  2KED A;  2B2W A;  1FJG L;  5IYB H;  2PQE A;  1CKO A;  1B44 D;  4GS3 A;  4ZYS A;  1STY A;  2ALY B;  3GTG B;  1F2L A;  5LMN Q;  1YI2 A;  4UP9 A;  2FFK B;  2D2C C;  1HHV A;  1XMO L;  3GDE A;  1B3Q A;  1PTO C;  4K2L A;  3EVQ A;  3HOX H;  4OWW B;  5HGT A;  2CH4 W;  3CC7 A;  1L1O A;  2QEJ C;  1KL9 A;  2B2Y A;  1TWC B;  3OIQ A;  1S40 A;  1V1P B;  3LWU A;  1ILP A;  1U4M A;  4HMJ A;  1SDF A;  2ZXR A;  3I4M B;  2NTS A;  2ZJP A;  1JB3 A;  1PYB A;  4POG A;  4DR5 Q;  1LTA D;  1T5X D;  1A3T A;  3I4L A;  1SEB D;  1GHJ A;  3VR3 A;  3PO3 H;  1GVP A;  3BDO A;  3DXJ C;  2CW0 D;  3X3N A;  2CCZ A;  2MGS A;  1N34 L;  3S17 H;  3DUZ A;  2HDM A;  4IUT A;  1PHJ A;  2VUM B;  3HOV B;  4RAU C;  2DNE A;  2K5Q A;  1MD2 D;  5KRU A;  5A2Q L;  5C44 B;  3MAQ A;  3S1N B;  2AQ2 B;  3D3R A;  1N8R C;  3T56 B;  4CKC A;  3QG1 A;  1V1Q A;  5C5L A;  5JEA G;  2KHS A;  4C56 C;  1G6Z A;  2CQA A;  1DYQ A;  1F9Q A;  1BBX C;  1L0Y B;  4KN7 C;  1YHB A;  4A4I A;  2I5L X;  2EQS A;  4JOI C;  4ULL A;  1BVS A;  2Z4I A;  4LF9 Q;  1X3G A;  4X3S A;  2IX0 A;  1A63 A;  1DD2 A;  2LMC B;  4L5R C;  3S24 A;  1ZYR C;  2R93 B;  2F3I A;  4IPH A;  1SMY D;  4A3G H;  1KDB A;  1O7L A;  4RCO A;  4DK3 C;  1QOH A;  2B2U A;  3NEM A;  4L63 B;  3V2T A;  1FYC A;  2EJM A;  4JBK A;  2BCO A;  1NUC A;  4KI0 A;  4A3I H;  3HFZ B;  3PUX A;  2D0O A;  3AU7 A;  1YJW A;  2WAC A;  4B3S L;  2EYJ A;  3A8I E;  1HPC A;  3GTK H;  2M9V A;  1GOZ A;  1S5F D;  1TT2 A;  2SEB D;  3S15 H;  2RSN A;  3S16 B;  1B53 A;  3VR5 A;  2LY7 A;  2OT2 A;  3K0X A;  3J81 c;  5C3E B;  4GKJ Q;  3NQI A;  4BY1 H;  2OTL A;  3T1H Q;  1LLR D;  4LFA L;  2XIW A;  3QOJ A;  3GTM B;  1N9W A;  3CP0 A;  2EYL A;  1U4R A;  1ZEQ X;  3D8G A;  2K5H A;  3TP6 A;  3RZD H;  1YEZ A;  2JXM B;  3J7Z C;  1UEA B;  4HED A;  1NMG A;  3RLF A;  4HJ8 A;  1K0S A;  4B3T Q;  4MZ9 A;  3GTO H;  1K73 C;  1EEI D;  5JPN C;  1CSQ A;  4C2M B;  5CMD A;  5K5P A;  3E9H A;  1B9N A;  5M5Y H;  1B3A A;  3AMU A;  3PO2 H;  4L6T B;  4FP5 D;  1X6O A;  4GNX B;  1CHQ D;  4XT1 B;  1EQV A;  4DNR B;  3F2B A;  2JA5 B;  4A3K H;  2WFW A;  5I2Y A;  3IAY A;  2B63 G;  5JPM C;  3CCR A;  4A3B G;  4IQZ A;  4IFD G;  1HNX Q;  4ZUJ A;  4WJ4 A;  1A2T A;  4QIW B;  4ME5 A;  2F3V A;  2B39 A;  1A0I A;  3W1G A;  5ELO A;  1CKN A;  4YWM A;  1NR2 A;  1E2V A;  1JCK B;  1BUV T;  2RF4 A;  3BDL A;  2UUB L;  3K0Y A;  2YU9 H;  4C1N I;  4A3C H;  2KVM A;  2E2J B;  2VNU D;  3WDN A;  3KBX A;  4OO1 H;  1FVI A;  1HRJ A;  3T16 A;  2F0Q A;  2UXC L;  4X64 L;  2J0T D;  1EYA A;  4LF6 Q;  1UNS A;  2F03 A;  4FYD A;  1PZJ D;  1SSO A;  2HD3 A;  2VB2 X;  3OHX C;  4MHE A;  4PMW A;  2A69 D;  1JOR A;  4LWC A;  3GTQ B;  2O2L D;  3BDC A;  2BDN A;  1AH9 A;  1PXU A;  4HIO A;  3KUP A;  3SR1 A;  1C0A A;  1SMY C;  2A68 D;  1XTD A;  4X66 Q;  4BWG B;  5EBD A;  4DUZ L;  2PQA B;  3J81 i;  4JBM A;  4JI8 L;  4H02 A;  3I72 A;  5IGB A;  1PFM A;  2IPK D;  1X9N A;  5M3F G;  2XRS D;  1JIC A;  3S2H H;  5AFW A;  2AHO B;  1NY4 A;  4XDX A;  1J8I A;  4AYB B;  2MQH A;  2P5Z X;  2WB1 G;  4DFA A;  1GM5 A;  2RBM A;  3ULL A;  4OX9 L;  4YIJ A;  3A55 A;  3B6Y A;  3RMH A;  1K0R A;  2IY5 B;  2Z8L A;  2IX3 A;  1LTS D;  4JOI A;  1ESF A;  3IFD A;  3EIV A;  3M7G A;  2NUC A;  2WB1 E;  3VR4 A;  1T5E A;  1KNE A;  2NZO A;  2VQE Q;  2RCN A;  1X3F A;  1D1K A;  4LUV A;  1UE5 A;  2KCC A;  5LMN L;  5CV7 A;  2KCT A;  1JT8 A;  3P75 A;  2DUD A;  1BNZ A;  1LT4 D;  4ALP A;  3HP3 A;  4I65 A;  3ERQ A;  4H0L C;  4EGV A;  1II3 A;  2E5L Q;  3CC4 A;  1GJX A;  3S14 B;  1GUT A;  5IWA Q;  4XQJ A;  1E1O A;  1HUN A;  2UUA L;  1PYW D;  3URY A;  1WTW A;  1CFM A;  5JEA H;  4NW2 A;  1EIH A;  1SJH D;  4DR5 L;  2MHV A;  1UE7 A;  3J7A V;  3MXN A;  1JQY D;  2WKD A;  4DV7 Q;  3S2D B;  1SMX A;  4BY7 H;  1KRS A;  2RQX A;  2N8N A;  2Z1C A;  4J8Q A;  2QDL A;  5C0X I;  3WWV A;  1XNR Q;  5EJW A;  1JE4 A;  1BQQ T;  1TQO A;  4JI6 Q;  4DU9 A;  1BBW A;  1SNO A;  3K8A A;  1KAB A;  5EAY A;  3U9O A;  5CV5 A;  1BCP D;  2B2V C;  4ZKC B;  3X3M A;  1KAA A;  4KHZ A;  4QF4 A;  2OQK A;  4GN3 B;  2IX1 A;  3G71 A;  2A69 C;  4LF9 L;  2RVL A;  4P74 A;  4CDE C;  1FGB D;  3CKI B;  5COR A;  1RDP D;  2A68 C;  1RF2 D;  2EZV A;  3NBH B;  2Q8I B;  4FVM A;  1LO5 D;  1Q12 A;  3J80 i;  3MXG A;  2ES2 A;  4JC0 A;  1L0X B;  4Z9C B;  5IE8 A;  5BR8 Q;  1J6Q A;  3LGJ A;  5FLX L;  4K2K A;  2EE1 A;  1H9R A;  3EBE A;  2MJ8 A;  3A0J A;  1BR9 A;  5ELC A;  2G9H D;  3IKJ A;  4ZKB B;  4DXG A;  4LFB Q;  2R92 G;  4RKB A;  3QB3 A;  3K58 A;  1PFN A;  1PRT D;  3I91 A;  3KLS A;  1B1Z A;  1OO9 B;  4GKJ L;  2LSS A;  2GVB A;  3T1H L;  3EFX D;  5IP7 H;  4EQO A;  3K59 A;  5G3L F;  1EU3 A;  5KND A;  4A3B H;  4C3H B;  2EDG A;  4B3T L;  2K33 A;  2R3Z A;  3LWE A;  5EKK A;  5BN5 A;  1MJE A;  2NTT A;  5C0X J;  4KN4 C;  1G29 1;  3VA7 A;  4A3J G;  3C1F A;  1XNQ Q;  2NZ1 D;  3OW7 A;  3PGZ A;  4HAE A;  2Q2U A;  1I4R A;  1X55 A;  3GTL B;  1EY0 A;  2PMZ E;  3HOU H;  1C8C A;  4ZAI A;  2GVA A;  5IYB G;  1AEX A;  3OIP A;  2K5D A;  2F3W A;  2OQ0 A;  1M4V A;  1PH5 A;  5M5X B;  2UUC Q;  1HNX L;  1HUM A;  3CQZ H;  4QUC A;  1LTG D;  3BZK A;  1ENC A;  3C1E A;  1Z6H A;  3D0F A;  1EZ6 A;  2L12 A;  4LK1 C;  1PRT B;  1K9M C;  2D62 A;  3HGB A;  1KLG D;  3HOX G;  1EWC A;  3MTS A;  3GO5 A;  4ZQ3 A;  4C3I H;  2B2T C;  4M1U B;  2F0F A;  5J39 A;  1KDA A;  1PA6 A;  3E9I A;  3MC0 B;  4IPD A;  1QUQ B;  2I5H A;  1VQH A;  2PZW A;  3JAM c;  3UDF A;  2F0S A;  1X56 A;  2KHJ A;  2WAQ G;  4C1N K;  3PO3 G;  4DAM A;  3H0G B;  3SE0 A;  4LF6 L;  1RKN A;  3A5Z B;  2QEX A;  2JA7 B;  1CI3 M;  3PUZ A;  1K3B C;  1SRO A;  3PMF A;  1BCP C;  2L15 A;  3RNU A;  5C4X G;  3TQY A;  4F88 A;  1HTP A;  2HQE A;  4L5Q A;  1VS0 A;  4A3E H;  3ERS X;  1GD7 A;  3PIO A;  3STB D;  4N8X 1;  3N6R A;  3TP5 A;  4EQ5 A;  2WAQ E;  1W6K A;  1XPO A;  5IYD H;  4N9T A;  3U9S A;  5ISR A;  2KJX A;  1PV4 A;  2B8F A;  5C3X A;  3BZD B;  4X66 L;  1A3U A;  5CV8 A;  3KYH C;  4QCL A;  3G7L A;  3TS0 A;  3C3L A;  1RTO A;  5KEE A;  2MO1 A;  1ZKO A;  2Z6K C;  2IJ0 A;  1TWA B;  1I6H H;  4DK6 C;  2LXK A;  4UP8 A;  1TS2 A;  1I6V C;  3GV6 A;  3NTK A;  4AH6 A;  3I4N G;  4DKA C;  2CQO A;  1EYC A;  1UUP A;  2K28 A;  1Y1V B;  2A6H D;  2HHH L;  3M4O B;  2KCN A;  3ZJY C;  4LNQ A;  3T1Y Q;  4CJ1 B;  4QJF A;  2I0Q A;  2E2D C;  1VQ8 A;  2O4X A;  3VYU A;  2NVQ B;  2B2V A;  1OXS C;  3VYR A;  1LAB A;  5CV6 A;  3SEB A;  4R4T A;  4V19 0;  3PIP 3;  2PI2 A;  2XN9 C;  1IW7 D;  1HJP A;  1PZK D;  2JA6 G;  3M85 A;  3GQB A;  4H7B A;  1O7Y A;  1K8G A;  2VQE L;  2N78 A;  1TWG B;  3I4O A;  2A6E D;  2R7Z B;  2JYO A;  3CAM A;  2E74 C;  2Z0S A;  1XX8 A;  1LV9 A;  4HJ7 A;  1ICF B;  3GV3 A;  2E5L L;  2N55 A;  5IWA L;  2Y0S B;  4DGZ A;  3CU7 A;  2L0C A;  4OEL B;  2E76 C;  4YWL A;  1B4O A;  1YHQ A;  3FPP A;  4R8N A;  3I73 A;  3TSS A;  1Q81 C;  4K14 A;  5IT9 L;  4A3K G;  2ZXO A;  4DV7 L;  1JC7 A;  2NVX H;  2X6G A;  4GLV B;  1WJJ A;  1PH7 A;  4I7A A;  1QVG A;  4NB3 A;  4DAY A;  5IGE A;  3BYY B;  4R4O A;  1CHP D;  1XNR L;  5JOB A;  4K6L A; 
#chains in the Genus database with same CATH homology
 2EYP A;  3PUW A;  4RHR A;  2BA1 A;  3O13 A;  1ESR A;  5CBA E;  5K36 H;  2EY6 A;  2F0H A;  2L55 A;  4KKU A;  1WTX A;  2AUK A;  2F0V A;  5EKI A;  4XQN A;  4BBR B;  2F0G A;  4S3S A;  4CKE A;  1DOM A;  1ET9 A;  3FEW X;  2B2T A;  2E2I B;  3DMU A;  3D31 A;  4A3G B;  1IL8 A;  3SHL A;  3DEO A;  2G9D A;  2PYK A;  4LAA A;  4A3I B;  2A6H C;  4G7O C;  2J7Z A;  1E2Z A;  4G7H C;  3H09 A;  4RCN A;  3LX0 A;  2A74 C;  3S1M B;  3BYT B;  1HFG A;  4IUR A;  4BY1 B;  1IW7 C;  1VCI A;  3MZ5 A;  2EYO A;  1HTL D;  1BO0 A;  1IKL A;  5FLX E;  1SXT A;  1TS5 A;  1K8O A;  1SNM A;  3DWP A;  2BDO A;  1JOQ A;  5ELF A;  2ID0 A;  1QIL A;  3GTO B;  2A6E C;  3F2U A;  4R8I A;  5M5Y B;  1SND A;  1S5D D;  1SNP A;  4ODG A;  3PO2 B;  3SK5 A;  2EYH A;  3D4R A;  4B08 A;  4XIG S;  3J81 L;  3SXH A;  1AP0 A;  2KQ3 A;  4KY7 A;  5TSS A;  1PTO H;  4G7Z C;  5NUC A;  1DM0 B;  3E0J A;  1IHZ A;  3QJY A;  1B50 A;  1I4Q A;  2YU9 B;  1PMR A;  4NP5 A;  3DM1 A;  2RSO A;  2KUM A;  4QUF A;  4A3F B;  1HFN A;  2F0I A;  3HEJ A;  4WJW A;  4IUN A;  5KNB A;  3I3C A;  4U68 A;  4DK1 A;  1H9M A;  3NTI A;  1QE6 A;  3H94 A;  2B8G A;  1EQT A;  4KJN A;  2K32 A;  1LT6 D;  3NWS A;  2R6G A;  2XVS A;  4DNT B;  3TBI B;  5FK9 C;  4G57 A;  3NWT A;  4R9W A;  3I90 A;  2X69 A;  1WD0 A;  3KLR A;  5LHY 1;  4RA8 A;  3S2H B;  1UAP A;  1MGS A;  3M4Y A;  1ENF A;  4KK7 A;  2KA7 A;  1S5C D;  2AQ1 B;  1F9S A;  2L11 A;  2BA0 A;  1CA6 A;  1S5E D;  5FO9 B;  5EPL A;  3T53 B;  4Q5V A;  3TP8 A;  2F0K A;  2WIN B;  5I2X A;  4ZRZ A;  2XWB B;  1PLF A;  1SE4 A;  1EOT A;  2CW0 C;  3MEH A;  4FF3 A;  1LT3 D;  5F2D A;  1A6X A;  4KY6 A;  3RUZ A;  4CJ0 B;  3KLS X;  1CK1 A;  5FKA C;  2AUJ D;  5EQ0 A;  4C3I G;  1IYV A;  5D65 A;  1Y8P B;  3MFG A;  3K6O A;  3OWF A;  2MPM A;  5C3W A;  1AZP A;  2F0W A;  2JE6 I;  1SYC A;  3MXU A;  1WTR A;  4B9X A;  5IT9 E;  2K1B A;  2OF1 A;  1H9S A;  1O7Z A;  5C4Z A;  2LFN A;  3H6M A;  4RGN A;  5E4W C;  3CRL C;  3MWY W;  1D5Z C;  1J9O A;  2WII B;  4ZK9 B;  4KJO A;  5CGK A;  4XT3 B;  2HDL A;  5DNF A;  1A3V A;  3PUV A;  3QOL A;  4HN7 A;  2EJF C;  3FMC A;  3FPU B;  5CYU A;  3A7L A;  1F2M A;  4DXF A;  3FVQ A;  3C2P A;  1HCZ A;  2QKI C;  4RKL A;  3N52 A;  2HCI A;  2FJ2 A;  1BDO A;  3BVZ A;  2EY2 A;  1OXT A;  2ICE C;  4DF7 A;  1IYU A;  1V1O A;  2K03 A;  4PNY A;  1EU4 A;  1G8Z D;  1JOO A;  2EJG C;  4FNF A;  3NXW A;  1CZW A;  4ABN A;  2WP8 J;  2B63 B;  4A3B B;  2NN6 H;  1LTI D;  4H44 C;  4ZLT F;  1V1P A;  5ELD A;  2ZT9 C;  4P2C B;  3AB9 A;  2I46 A;  3SDZ A;  2EOT A;  4TKO B;  2F1M A;  2JSO A;  1SFO B;  3T4A C;  2QCP X;  4XYQ A;  3FRP B;  2EYF A;  1QJO A;  1SNQ A;  4OHJ A;  4EQP A;  3Q23 A;  2JP1 A;  1LTR D;  2YYZ A;  2PPB C;  3M3Y B;  2A73 B;  1WD1 A;  1CQF A;  5KNC A;  3W3A A;  2K7V A;  2C5C A;  3RD4 A;  5G3L D;  3I70 A;  1MBY A;  5IGG A;  3SK6 A;  3T13 A;  1R4Q B;  3J81 E;  4K6D A;  3NUC A;  5JAV A;  1ML0 D;  2FHT A;  2NWG A;  3Q24 A;  3ERO A;  5M3F B;  4IUV A;  5K36 G;  1WVL A;  1AFP A;  2F0E A;  4K5X A;  2WB1 B;  3J7Y W;  4QMG A;  3JAM L;  2KEE A;  1STB A;  5I4D A;  1QG7 A;  5JVH 3;  5C0X G;  1CZG A;  4XTC S;  1SNC A;  1OXU A;  4ILW A;  5J22 A;  4C3J G;  1YNN D;  4UDU C;  1X3Q A;  4IN3 A;  3QIA A;  4TRD A;  5EGT A;  3MFY A;  1I50 B;  4K8I A;  2EY1 A;  4UAI A;  5I6W A;  3NP8 A;  2F0L A;  1PZI D;  2HUG A;  1SYE A;  2Q8R E;  3SK4 A;  2K04 A;  1TVX A;  5EBC A;  4PMC A;  5EKL A;  1RJT A;  3M7N A;  3NK9 A;  4RHS A;  1FNU A;  4DN4 M;  1QNK A;  3P7J A;  1JWS D;  2RA4 A;  3MVV A;  2H1E A;  2ENB A;  1C4Q A;  1SYD A;  2DNC A;  3V96 A;  2AWN A;  2NVT B;  5CC4 A;  2H4O A;  1K83 B;  3V05 A;  2CVR A;  1WTQ A;  2EPB A;  1TKW B;  4TQU S;  3W2D A;  1CT1 D;  3P20 A;  3ZYY X;  1BF4 A;  3TME A;  4ID6 A;  2R92 B;  1R4P B;  1Q1E A;  1STG A;  4WFN 3;  1K8M A;  1PRT C;  4XYO A;  1X32 A;  4HR7 B;  2QDB A;  2PMZ B;  2FMC A;  4IUQ A;  1OXV A;  1S5B D;  1RHP A;  3R2I A;  4E6I A;  5JJZ A;  1HA5 A;  1Q3L A;  4FXG C;  4A3J B;  1MSG A;  5FO7 B;  3HG9 A;  3R3O A;  4OO1 I;  4DA2 A;  4F8M A;  4B9W A;  3VR2 A;  5D14 A;  1TII D;  5LL6 S;  5I9O A;  1CQV A;  4JK1 C;  3HOX B;  4O42 A;  1BXT A;  2M00 A;  1GXD C;  2L5T A;  3Q22 A;  1Y8O B;  1EY4 A;  5FOB B;  3OOC A;  1FR3 A;  2EYM A;  3NPP A;  2WAQ B;  3PO3 B;  5DM7 3;  3S17 B;  1NCV A;  1S4Z A;  2KEC A;  5C4X B;  5IIF A;  4O1N A;  4DAP A;  1PTO F;  2MP1 A;  4FXD A;  3I8Z A;  1HQM C;  1R9T B;  1PTO B;  1EY6 A;  1D5X C;  1E2W A;  4RGM A;  2K05 A;  2F0N A;  2F0U A;  4X3K A;  1DOL A;  3WOE A;  3NBH A;  5C0X H;  2IL8 A;  3NTH A;  4Q0F A;  1I4G A;  1HA6 A;  5T1G A;  1SYG A;  3I4N B;  1TWF B;  4IUP A;  2N88 A;  5FO8 B;  1EWH A;  1RCV D;  2V4D A;  1SJE D;  1LTT D;  5E1F A;  1DXM A;  2J4X A;  4KV6 A;  3GTK B;  1JWU D;  5T1I A;  3S15 B;  1KDC A;  3SK8 A;  5E3F A;  2DN8 A;  3EJI A;  2L4N A;  3KK7 A;  4PV1 C;  2JA6 B;  1I4P A;  1OXX K;  1U4L A;  3GTP B;  5IGF A;  3VA5 A;  3RZD B;  1TY2 A;  3GTJ B;  4QB4 A;  3EA6 A;  3WOF A;  2A5H A;  4CHT B;  2OEO A;  1FD7 D;  1D2B A;  4HSV A;  1GUO A;  2FMM A;  4HCE A;  2RKS A;  3MHB A;  5ELB A;  3JAM E;  1C48 A;  2PZU A;  2BE5 D;  4HMI A;  1EY5 A;  1I4H A;  2SDF A;  4NMZ A;  4LJZ C;  4A3K B;  2AQ3 B;  5DEH A;  5A35 A;  2NN6 G;  2LKV A;  4IAL A;  2O5J C;  4M8A A;  1ZXT A;  1PFB A;  1V43 A;  3OSO A;  3PIO 3;  1D1I A;  4FF2 A;  1WCM B;  1F2Z A;  5KYI A;  1EFI D;  1HQR D;  1E0B A;  3QO2 A;  1VDZ A;  1WTV A;  1DJR D;  5CR3 A;  2FIN B;  3ND9 A;  1ONL A;  1VF7 A;  2SNM A;  1ILQ A;  1ICW A;  3TP7 A;  1Q1B A;  3NE5 B;  4OIJ A;  3VR6 A;  1AW7 A;  4IUU A;  5JEA J;  4IFD I;  3A7A B;  1Q90 A;  4CBV A;  3IFT A;  2E2H B;  3QWN A;  2XWJ B;  4Y7N B;  1EY9 A;  1TWH B;  1YNJ D;  3KBG A;  5DAU A;  2Z4H A;  2HCC A;  1U9R A;  2NYZ D;  3TN2 A;  3MXP A;  3L9A X;  1CTM A;  2PO4 A;  5IGD A;  3A8J E;  1Z47 A;  3GD7 A;  4LMQ D;  2SNS A;  4G4K A;  2WKC A;  4OIK A;  5M5W B;  4H13 C;  3OMG A;  2NVY B;  3CRK C;  4KY5 A;  3GP7 A;  1GUW A;  4HSP A;  5CBE E;  3TZD A;  2XNA C;  4RGT A;  4EQN A;  1F9P A;  4PMB A;  4N9P A;  2BE5 C;  2Q8T A;  5JVG 3;  2F4I A;  1JWM D;  1KLU D;  1SBB B;  1XTC D;  3J80 L;  3A54 A;  3VYT A;  4ZUI A;  4NDX A;  1QCB D;  4IFD J;  2JEB I;  3Q6S A;  3DWA A;  1GUN A;  5ELE A;  5C4H A;  4BY7 B;  3S1R B;  2XSC A;  4EVO A;  3HOW B;  2F0T A;  4FXK C;  2PW5 A;  1G2S A;  1B2T A;  4OL7 A;  3HKZ B;  5CV9 A;  1JOK A;  2C9O A;  1TS4 A;  1TU2 B;  4I7Z C;  1KTK A;  3HRZ C;  5M3M B;  2VB3 X;  4X3T A;  2KOL A;  1O78 A;  3L3O C;  3K5N A;  3PV0 A;  1SYF A;  5LL6 X;  1QB5 D;  1YNJ C;  1SE3 A;  4NKL A;  3CHB D;  5M9O A;  2TMP A;  4OGQ C;  2M2L A;  4KHV A;  1GUS A;  2NB0 A;  3KF8 A;  4FF1 A;  1TS3 A;  3D6W A;  5D3I B;  1LAC A;  5CV4 A;  1DZ1 A;  1TR5 A;  2NBF A;  1XYI A;  3DEP A;  5KYL A;  4C3H G;  2F0J A;  3P1H A;  2IWH A;  4CJ2 C;  1WTO A;  1U4P A;  3BS1 A;  3R93 A;  2AWO A;  5J1Z A;  1TY0 A;  2D5D A;  3NBI A;  1M8A A;  1G91 A;  3HOU B;  4MIU A;  1G2T A;  1EZ8 A;  1STE A;  2PCF B;  4DAV A;  3FKI B;  3HOY B;  3HZX A;  3CQZ B;  1DON A;  1ROD A;  5HUR A;  3A8K E;  4KKT A;  1CA5 A;  3TZU A;  2ICI A;  3G6J B;  2MUY A;  4C3I B;  1DOK A;  1X3P A;  1EIG A;  1VMP A;  4PQX A;  4HTH A;  5C6A A;  1NSN S;  1STN A;  2PNR C;  3E5S A;  2F0D A;  4BA2 I;  1SYB A;  1I4X A;  4JBW A;  1LT5 D;  3OPO A;  4A3E B;  3J7A F;  2XRQ D;  2CHB D;  2K01 A;  2OXP A;  4RGO S;  4CGY B;  1GUG A;  4K5V A;  5BN4 A;  1EY8 A;  5A2Q E;  1AN8 A;  1PDQ A;  1CM9 A;  4FF4 A;  4A3D B;  1I6H B;  1VF5 C;  1ENA A;  1LTB D;  5IOC A;  2DY8 A;  1F77 A;  1BCP F;  3D4W A;  3DWQ A;  1BCP B;  3K5M A;  3A56 A;  1EL0 A;  1V8Q A;  5BN3 A;  4XQQ A;  1H9J A;  4U67 3;  4RH6 A;  1O80 A;  4IFD H;  1RTN A;  3NQT A;  1SAP A;  4L8J A;  2ZXP A;  1EY7 A;  4DK0 A;  4KKS A;  2F0O A;  4TSS A;  1VMC A;  5C4J B;  3HS0 C;  1MSH A;  3UI2 A;  3VYS A;  2GA4 B;  5EPK A;  1EYD A;  3S9W A;  3H3V C;  1PRT F;  3Q0A A;  1D6E C;  4F7X A;  1RD9 D;  4BS9 A;  4WOR A;  3K5O A;  2VXW A;  3R2T A;  1JR0 D;  1AZQ A;  4RWS C;  4A93 B;  5DM6 3;  1A2U A;  2D9U A;  3BVM A;  2NVX B;  3BVG A;  2L9H A;  2RDG A;  1WTP A;  3OWE B;  1NAP A;  1ET6 A;  2R61 A;  1Z7T A;  4FO2 A;  2IT1 A;  2SOB A;  1IKM A;  2B2W C;  1NR4 A;  3J80 E;  3TDQ A;  3K57 A;  2EVB A;  2RDH A;  2JA8 B;  2E75 C;  4V0B A;  4A3M B;  2BOS A;  4WRD A;  4KD3 A;  5I9P A;  2B2Y C;  2K5W A;  3K5L A;  5IOD A;  1STH A;  2X6L A;  3IL8 A;  1HXY D;  4KD4 A;  3D4D A;  5I6Y A;  1Y1W B;  1F2Y A;  4K8J A;  4C3J B;  2QF7 A;  3L7Z C;  1YNN C;  4J6H A;  1W6J A;  2QIL A;  3NHH A;  1B9M A;  3T51 B;  1KNA A;  3R8B A;  1A15 A;  1DCZ A;  3DHQ A;  3LNN A;  3D6C A;  4RFB A;  4KTA A;  2EY5 A;  2F0P A;  4BA1 I;  5EPJ A;  1EEF D;  1PTO D;  5D3D A;  1GHK A;  3RZO B;  3MA2 B;  2L1B A;  4GZY C;  2RDF A;  3S1Q B;  2B2U C;  1QNU A;  4HCS A;  3ONA B;  1F9R A;  1FNW A;  3ND8 A;  4KMU C;  4X3U A;  5IGC A;  2I07 B;  3HOZ B;  3PUY A;  2O5I C;  1BOS A;  2F0M A;  3OMC A;  4BBS B;  5KIX A;  3E6Z X;  3H91 A;  1Y8N B;  2LS0 1;  5COY A;  4IZ8 A;  4XXE A;  1D5M C;  1ZYR D;  3FDT A;  1H9S B;  1H9K A;  4OO1 G;  1QWY A;  1I3Q B;  4CKB A;  1SE2 A;  3SVM A;  2K6A A;  1MI2 A;  4J1M A;  1Y69 U;  3BG3 A;  4MN3 A;  5KGU A;  1FNV A;  4F87 A;  2EXZ A;  3K7A B;  2NN6 I;  3C46 A;  2DY7 A;  2WV6 D;  5C5M A;  2JEA I;  1XXG A;  5E4X A;  2PW7 A;  2PZT A;  2TSS A;  3ITP A;  1Q8I A;  3EQL C;  3NSW A;  4K5W A;  1STA A;  2IW3 A;  1XWE A;  2KED A;  2B2W A;  2PQE A;  1B44 D;  4ZYS A;  1STY A;  3GTG B;  1F2L A;  2FFK B;  2D2C C;  1HHV A;  1PTO C;  4K2L A;  3EVQ A;  5HGT A;  2QEJ C;  2B2Y A;  1TWC B;  3OIQ A;  1V1P B;  3LWU A;  1ILP A;  1U4M A;  4HMJ A;  1SDF A;  2ZXR A;  3I4M B;  2NTS A;  1JB3 A;  1LTA D;  1T5X D;  1A3T A;  3I4L A;  1SEB D;  1GHJ A;  3VR3 A;  3BDO A;  3DXJ C;  2CW0 D;  3X3N A;  2MGS A;  3DUZ A;  2HDM A;  4IUT A;  2VUM B;  3HOV B;  4RAU C;  2DNE A;  2K5Q A;  1MD2 D;  5KRU A;  5A2Q L;  5C44 B;  3MAQ A;  3S1N B;  2AQ2 B;  3D3R A;  3T56 B;  4CKC A;  3QG1 A;  5C5L A;  5JEA G;  2KHS A;  4C56 C;  1G6Z A;  2CQA A;  1DYQ A;  1F9Q A;  1BBX C;  1L0Y B;  4KN7 C;  4ULL A;  2Z4I A;  4X3S A;  2IX0 A;  1DD2 A;  2LMC B;  1ZYR C;  2R93 B;  1SMY D;  1KDB A;  1O7L A;  4RCO A;  1QOH A;  2B2U A;  4L63 B;  3V2T A;  1FYC A;  2EJM A;  2BCO A;  1NUC A;  4KI0 A;  3PUX A;  3AU7 A;  2WAC A;  2EYJ A;  3A8I E;  1HPC A;  2M9V A;  1GOZ A;  1S5F D;  1TT2 A;  2SEB D;  2RSN A;  3S16 B;  1B53 A;  3VR5 A;  2LY7 A;  2OT2 A;  5C3E B;  3NQI A;  1LLR D;  2XIW A;  3QOJ A;  3GTM B;  2EYL A;  1U4R A;  1ZEQ X;  3D8G A;  3TP6 A;  2JXM B;  1UEA B;  4HED A;  3RLF A;  1EEI D;  5JPN C;  4C2M B;  5CMD A;  5K5P A;  1B9N A;  1B3A A;  3AMU A;  4L6T B;  4FP5 D;  1CHQ D;  4XT1 B;  1EQV A;  4DNR B;  2JA5 B;  5I2Y A;  3IAY A;  5JPM C;  4IFD G;  4IQZ A;  4ZUJ A;  1A2T A;  4QIW B;  4ME5 A;  2F3V A;  2B39 A;  1NR2 A;  1E2V A;  1JCK B;  1BUV T;  3BDL A;  3K0Y A;  4C1N I;  2KVM A;  2E2J B;  2VNU D;  3WDN A;  3KBX A;  4OO1 H;  1HRJ A;  3T16 A;  2F0Q A;  2J0T D;  1EYA A;  1UNS A;  2F03 A;  4FYD A;  1PZJ D;  1SSO A;  2VB2 X;  3OHX C;  4MHE A;  4PMW A;  2A69 D;  1JOR A;  3GTQ B;  2O2L D;  3BDC A;  2BDN A;  1PXU A;  3KUP A;  3SR1 A;  1SMY C;  2A68 D;  4BWG B;  5EBD A;  5IGB A;  3I72 A;  1PFM A;  2IPK D;  2XRS D;  1JIC A;  5AFW A;  4XDX A;  1J8I A;  4AYB B;  4DFA A;  2RBM A;  4YIJ A;  3A55 A;  3RMH A;  2Z8L A;  2IX3 A;  1LTS D;  1ESF A;  3IFD A;  3M7G A;  2NUC A;  3VR4 A;  1T5E A;  1KNE A;  1D1K A;  2KCC A;  5CV7 A;  3P75 A;  1BNZ A;  1LT4 D;  3HP3 A;  4I65 A;  3ERQ A;  4H0L C;  4EGV A;  1II3 A;  1GJX A;  3S14 B;  1GUT A;  4XQJ A;  1HUN A;  1PYW D;  3URY A;  1WTW A;  1CFM A;  5JEA H;  4NW2 A;  1EIH A;  1SJH D;  2MHV A;  3J7A V;  3MXN A;  1JQY D;  2WKD A;  3S2D B;  2RQX A;  2Z1C A;  4J8Q A;  5C0X I;  5EJW A;  1JE4 A;  1BQQ T;  1TQO A;  4DU9 A;  1SNO A;  1KAB A;  3U9O A;  5CV5 A;  1BCP D;  2B2V C;  4ZKC B;  3X3M A;  1KAA A;  4KHZ A;  4QF4 A;  2IX1 A;  2A69 C;  2RVL A;  1FGB D;  3CKI B;  5COR A;  1RDP D;  2A68 C;  1RF2 D;  2EZV A;  2Q8I B;  4FVM A;  1LO5 D;  1Q12 A;  3MXG A;  1L0X B;  4Z9C B;  5FLX L;  4K2K A;  2EE1 A;  1H9R A;  2MJ8 A;  1BR9 A;  5ELC A;  2G9H D;  3IKJ A;  4ZKB B;  4DXG A;  4RKB A;  3QB3 A;  3K58 A;  1PFN A;  1PRT D;  3I91 A;  3KLS A;  1B1Z A;  1OO9 B;  3EFX D;  4EQO A;  3K59 A;  5G3L F;  1EU3 A;  5KND A;  4C3H B;  2EDG A;  2K33 A;  2R3Z A;  3LWE A;  5EKK A;  5BN5 A;  2NTT A;  5C0X J;  4KN4 C;  1G29 1;  3VA7 A;  3C1F A;  2NZ1 D;  3OW7 A;  4HAE A;  1I4R A;  3GTL B;  1EY0 A;  1C8C A;  4ZAI A;  1AEX A;  3OIP A;  2K5D A;  2F3W A;  1M4V A;  5M5X B;  1HUM A;  4QUC A;  1LTG D;  1ENC A;  3C1E A;  1Z6H A;  1EZ6 A;  2L12 A;  4LK1 C;  1PRT B;  2D62 A;  3HGB A;  1KLG D;  1EWC A;  3MTS A;  3GO5 A;  4ZQ3 A;  2B2T C;  4M1U B;  2F0F A;  5J39 A;  1KDA A;  3MC0 B;  2PZW A;  2F0S A;  4C1N K;  3H0G B;  3SE0 A;  1RKN A;  2JA7 B;  1CI3 M;  3PUZ A;  3PMF A;  1BCP C;  4F88 A;  1HTP A;  2HQE A;  3N6R A;  3TP5 A;  1W6K A;  4N9T A;  3U9S A;  5ISR A;  2KJX A;  2B8F A;  5C3X A;  3BZD B;  1A3U A;  5CV8 A;  4QCL A;  3G7L A;  3C3L A;  1RTO A;  5KEE A;  1ZKO A;  2IJ0 A;  1TWA B;  1TS2 A;  1I6V C;  3GV6 A;  3NTK A;  1EYC A;  1UUP A;  2K28 A;  1Y1V B;  2A6H D;  3M4O B;  2KCN A;  4CJ1 B;  2E2D C;  2O4X A;  3VYU A;  2NVQ B;  2B2V A;  1OXS C;  3VYR A;  1LAB A;  5CV6 A;  3SEB A;  4V19 0;  3PIP 3;  2XN9 C;  1IW7 D;  1PZK D;  3M85 A;  3GQB A;  4H7B A;  1O7Y A;  1TWG B;  2A6E D;  2R7Z B;  2JYO A;  2E74 C;  1XX8 A;  1LV9 A;  3GV3 A;  2N55 A;  2Y0S B;  4DGZ A;  3CU7 A;  2L0C A;  2E76 C;  1B4O A;  3FPP A;  4R8N A;  3I73 A;  3TSS A;  4K14 A;  5IT9 L;  2ZXO A;  1JC7 A;  2X6G A;  4DAY A;  5IGE A;  3BYY B;  1CHP D;  5JOB A;  4K6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...