3D0FA

Structure of the big_1156.2 domain of putative penicillin-binding protein mrca from nitrosomonas europaea atcc 19718
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
b'NAYRGPEAFLKLPKDLKDREALQDIMQDIGNSDDILAAVVLSATPGAVEAFRKNGETIRITGDGLKAAHRFLSNDPKIGEKRIRPGALIRVKKTEKGSWQIVQLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Penicillin-binding 1 transmembrane protein MrcA
molecule tags Transferase
source organism Nitrosomonas europaea atcc 19718
publication title Structure of the BIG_1156.2 domain of putative penicillin-binding protein MrcA from Nitrosomonas europaea ATCC 19718.
rcsb
total genus 14
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.4.2.-:
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3d0fA01
1XNQL 2Z6KA 2R93H 3CC2A 4GN3B 2CFMA 3HOUG 4LF4Q 2B3GA 1Q1BA 4JI8L 1PH2A 2N3SA 5C3EG 4B3RQ 2K14A 4DK3C 2AWNA 3OTOQ 3CXCA 4DR7L 5JJIA 3S14H 1KD1C 1K8GA 1K83H 1J6QA 1Q82C 1WCMH 1HZ9A 2E2JH 4YWMA 1JMCA 3Q8DA 3ULJA 2JA5G 1NY4A 1A0IA 5FJ8H 1K9MC 3CPWA 1BKBA 4DR2L 3PGZA 1IBML 1WCMG 4HIMA 4LFAL 4LF5Q 3S2DH 4B3ML 4L5SA 3S1MH 2UXBL 4LF6Q 1SFOH 1L1OC 4DV2L 2VQEL 1IBKQ 1N33Q 4IPCA 3FHWA 2LSSA 3UE0A 3RLOA 1VQAA 1P8LA 1PYSB 1SN8A 1BBWA 4DV6L 4GLVB 4P72A 3F2CA 4GNXA 1KC8C 3PO3G 5ELOA 3MXNB 4YCWA 3J80i 2GVAA 3GTLH 4IPHA 1HNZL 3CCJA 3PF5A 1LTLA 2JA9A 1KIXA 1HR0W 1YJWA 1U0LA 2HHHQ 4GKKL 4IPGA 1N34Q 4GNXC 1IBMQ 5IY0A 2UUBL 2R7ZG 1HH2P 4QIWE 4PMWA 2E2HH 4DV4L 4DV2Q 2IX0A 1PYBA 4LF9Q 5IP7H 2VW9A 1X9NA 3I4OA 5LMUQ 4IFDJ 4WJ4A 1A62A 3HOXH 3S1NH 2ZJQA 2AWOA 3W1BA 1HNWQ 4DR6Q 1WOCA 2XGTA 4HJ9A 3ZJYC 3T1HQ 2PI2E 2R6GA 4DR1Q 3S2HH 3HOWH 1WI5A 2JA8G 4GKKQ 1VQGA 1PH9A 4DR4L 1Q12A 1Y1VH 2WFWA 1HJPA 1UWVA 2Z0SA 1MJCA 2K75A 1MKHA 4JBJA 5DLQE 4JI4L 1IYJB 1DGSA 3CPFA 3A5UA 4DV4Q 1C7YA 2JA8H 3M4OH 2K50A 2F4VQ 4A3GG 3G48A 4XTCS 1WJJA 1NBWA 2Y0SE 1SROA 3J80c 1Q7YC 4LNQA 2QGQA 1UE1A 4GLAC 1EQRA 1J5EQ 3HOXG 3BZCA 1D8LA 3M4PA 1EWIA 2KHIA 3IRBA 3H0GH 1NMFA 5M3FG 5K36G 1CKNB 1RIPA 4BA1I 2CWPA 5GAEC 3J81i 3UDFA 4POGA 4IFDI 3GD7A 4X65Q 2PQAB 4LF5L 4JC0A 1QVFA 2VUMG 2Q2TA 4JI4Q 2YTVA 2VZAA 3JC66 3ULPA 1VQ6A 4IJHA 4X66L 4R1JA 1G6PA 2VNUD 5C44H 3S1QH 1PVOA 1B7YB 4GN4B 1B8AA 2OQKA 3J7ZC 3KDFA 4A3IH 4DUZQ 3PO3H 4A3DH 2IHFA 4B3SQ 3CCQA 5E7NA 3I4MG 4JYAL 4DAYB 1VQJA 2V1CC 1KL9A 3NBHB 1PH4A 4A3KG 1BBUA 3BJUA 3M9BA 1MJEA 1HNXQ 3GTGH 4BXXH 4DPGA 4J15A 1HZBA 2NZOA 2E2IH 2JEAI 1UEBA 3S17H 1VQ9A 1YHAA 4DKAC 1VQKA 4BY1H 4NXNQ 4OWWB 4X65L 3I4NH 2E5LQ 2B29A 3F2BA 4A3FH 3CF5A 3PIPA 3F8TA 2JA5H 4X66Q 3STBD 3K8AA 3L7ZC 3TEHB 4BA2I 1KXLA 1GM5A 1VQPA 4A3MG 5JEAG 4JI5Q 1OXUA 2FXQA 4DUZL 4NXMQ 1FJGQ 5C44G 3H15A 1TWAH 1JT8A 2BA0A 4WJ3M 3TRZA 2DGYA 2R93G 2IY5B 2AKWB 3JAMi 2JA7H 3M85A 3CMAA 1S40A 4LF7L 1FL0A 4ALPA 2N8NA 1OXSC 4A3BH 1EIFA 3D31A 3H0GG 1N32L 1OTCA 4A3IG 4JI2L 2D0OA 1V43A 2LXKA 3E9IA 5IE8A 4GOPB 2F4VL 4A75A 5IYDH 2Y0SG 4JG2A 3CCUA 1CKMA 2EXDA 1XNRQ 3KOJA 4C2MH 4DR5Q 2Q2IA 4JBWA 5M3MH 1PH7A 2CKZB 4KI0A 3CP0A 3FKIG 3G4SA 1IBLL 1I50H 4YWLA 1TWGH 1YIJA 4A93H 4BY7G 4PZ7A 1E7ZA 1OXTA 1E24A 3HFZB 2ZTDA 2PMZE 3PUXA 4DUYL 4OWTB 4JI7Q 4A76A 1W2BA 5C4JH 2ASBA 3PO2H 2KCMA 4A93G 3A5ZB 3HKZE 3G6EA 4BY7H 3CCLA 2IT1A 3FKIH 3KDFB 1XPUA 1SR3A 5C0XJ 3KJPA 1YJNA 2HIXA 1X3EA 2Z6KC 4JI6Q 2OTLA 2ZM6L 4DV5L 2I5LX 2VY3A 4YWKA 1QZGA 2A1AA 4HJ8A 2HT1A 1X54A 2K52A 3NELA 4LFCL 3TREA 4GLXA 1XMOQ 4Y52H 4QGUA 2PQAA 1C0AA 4RMFA 3PV0A 2KCTA 2NVYH 2BH2A 2F52A 1Y1VG 2PNHA 1PFSA 5IYBH 5HY6A 1X56A 1G51A 3A0JA 4NXNL 2ZTEA 1QVGA 4JOIA 1H95A 1E3PA 4PG3A 4JI7L 4OO1I 1TWFH 5M3MG 2VS1A 3M4QA 1YITA 1YHBA 1XPRA 1HZAA 1QVCA 3KFUA 2LXJA 3EIVA 1XTDA 1X55A 2HQLA 2I5MX 4JI6L 4MTNA 1NE3A 3E0EA 3EN2A 2BA1A 3U50C 4A3LH 2UXCL 3G71A 4EQ5A 4B3MQ 4JI5L 3S24A 1XMOL 3CC7A 3T1YQ 4NXML 1FJGL 2VQEQ 2UUCL 5M5WH 4A3BG 4P71A 2YTXA 4R4TA 4GKJL 4LF8L 2I0QA 4GOPC 4A3FG 5IWAQ 2R7ZH 2JA6G 4KHZA 4YY3L 3HKZG 1ASYA 4BY1G 3RR5A 1Q46A 4UPAA 1YI2A 4BBSG 1UE7A 3AQQA 1YEZA 4AYBG 3L2PA 5JJKA 3PUWA 4IOCA 1SLJA 2B63H 2EIFA 2IHEA 4A3MH 2JQOA 3GDEA 4HIOA 1YJ9A 4LW1A 3I4MH 4A3DG 2OTJA 3RZOH 3CCSA 3FP9A 1VQHA 2UUBQ 1KAWA 2UXCQ 4DV1L 4BBRH 2N78A 2UUCQ 4GKJQ 4H02A 4LF4L 2VUMH 4C3JH 3A74A 4YY3Q 4OXPA 3OTOL 5FLMG 1VS0A 4DR7Q 4UP9A 4QJFA 3I56A 1SRUA 4DR3Q 1E22A 1FVIA 1IL2A 1I94L 4JBKA 1OXVA 1XPOA 2CQOA 1HR0L 4B3TQ 2R92H 4DV3Q 1EUJA 3DM3A 4DR4Q 4OX9L 1Z47A 1RL2A 4P75A 3SGIA 1S3OA 3EBEA 1OXXK 4LF6L 4UY8C 3TQYA 3U4VA 1UE6A 2OCEA 3ERSX 4A3CG 3PO2G 3ER0A 3I2ZA 1UE5A 2OQ0A 4UP7A 4DV7L 3GTQH 1VCIA 4R4OA 3HOYG 3JAMc 3OW2A 4A4IA 1PH8A 5IYCH 1YHQA 4X62L 1TWCH 2D62A 5GQOA 3VDYA 1EQQA 5GAGC 1HNZQ 1I94Q 2HHHL 1Q1EA 4XIGS 4JCVE 1S72A 3CW2C 4JI1L 2K4KA 1CSQA 2AHOB 2JK8A 4POFA 3WWVA 1N8RC 4TQUS 2C35B 3RN2A 5IYCG 1M1KC 3AFPA 3L0OA 2WP8J 5AJ3Q 3I55A 4DV0Q 1KQSA 2UXDL 5HGQA 5IWAL 1GVPA 4GOPA 2QEXA 2JA7G 1C9OA 4OONA 1VQOA 2MFIA 5H1SE 4RG1A 1I6HH 1EYGA 2K5HA 2KENA 5LMNL 1VQEA 1SMXA 3STBC 3U58A 1PV4A 2JEBI 2BH8A 1GKHA 3S16H 3GTPH 3KF8B 4IJLA 2D0PA 1KHIA 1IBKL 1WFQA 1D7QA 4UP8A 4YHHQ 4OWXB 2RCNA 4DV6Q 4BBRG 2EQSA 3J81c 5C4XH 3PSIA 1VQ4A 4JOIC 1LM0A 3UDXA 4KLKA 2F3IA 2VQFL 4DR3L 2A8VA 1Q81C 1K73C 2ID0A 1TXYA 2WB1E 4DV3L 2HIVA 1AE2A 3B6YA 2ALYB 3CAMA 4FDBA 3CCVA 1VQIA 4EX5A 4JV5L 4OX9Q 1CSPA 3GTKH 1A8VA 1JJCB 1E1OA 4TVAB 1YZ6A 2YU9H 2RHQB 2WB1G 1Q8KA 3I4NG 3M3YH 2AMCB 3HOUH 1XNQQ 3KJOA 2E8GA 2JA6H 4BXXG 1QZHA 4L5QA 3NENA 2WAQG 3NEMA 4YHHL 4A3KH 5GADC 1VQ8A 1VQBA 2H5XA 2NZHA 1HNWL 1K0RA 5JJLA 2VQFQ 2MO0A 1Y1WG 1AH9A 1XMQQ 2ES2A 3ICEA 1CKNA 3E9HA 3UE1A 2IX1A 4JI0Q 3PF4A 4A3GH 2E5LL 3CD6A 1I5FA 2N49A 4APVA 5IP9G 4HJAA 4BBSH 4X64Q 1PH5A 4DV0L 3AYHB 4PZ6A 4QL5A 3TS2A 3K7AH 1MIUA 3GTMH 1TWHH 3HKSA 4QY7A 5EAYA 2ZM6Q 1G291 4AIMA 1IZ6A 4LFCQ 3I7FA 2L15A 1BVSA 3BZKA 2RF4A 4NB3A 1PH6A 1J5EL 1VQNA 3OYYA 3K81C 1X6OA 3K7UC 1N34L 3PCOB 2K5VA 4NPSA 3U4ZA 1N36Q 4LF7Q 3H3VI 3HOVH 2NN6G 3CC4A 3PUYA 1B70B 3RLFA 4GNXB 3LGJA 2WAQE 5GAHC 4DAMA 3UDGA 4A3EH 2JJQA 1LYLA 1N32Q 2YV5A 4JI2Q 4X64L 4LF9L 1W3SA 1VQDA 3RNUA 1X65A 5LMUL 1NJIC 1XNRL 4AYBE 5IT9c 4KHPQ 4IPDA 1Y14B 4Y7NH 4AH6A 4IOAA 2UU9L 4DR1L 3AFQA 1T9HA 4HJ5A 2NVTH 1JB7A 2NN6I 4A3CH 1L1OB 4MZ9A 1L1OA 4O0AA 5IP7G 1M90C 4YCUA 2ZTCA 5IYDG 3KF6A 1JJ2A 3S1RH 1K3RA 1EIYB 4AQYL 4GS3A 1VQ7A 3BU2A 4YCVA 1NMGA 3K0XA 1U5KA 2YTYA 1I3QH 2R92G 2YYZA 5LMNW 4LFBL 1P16A 2MO1A 4MNOA 4K0KL 1VQFA 4JBMA 4DV1Q 2Q2HA 5IP9H 1AE3A 1PA6A 1K8AC 2ATWA 1XMQL 3S15H 1VQ5A 1CUKA 5JEAJ 4DNIA 4LWCA 1X3GA 1VQMA 1SE8A 4JI0L 3GTOH 5C3EH 1A63A 2MNAA 4DK6C 5M5YH 4IO9A 1IXRA 1Q86C 3HOZG 4AQYQ 2GVBA 2A19A 1HR0Q 1PH1A 4B3TL 1WYDA 1R9TH 3CQZH 5FLXc 5FJ8G 5ELNA 4LFBQ 5M5XH 2B63G 5C4XG 3RLNA 1HZCA 2R7DA 4P73A 2UUAQ 4DR5L 4K0KQ 1N9WA 4R4CA 4B3SL 3HOZH 4JYAQ 1GD7A 1LUZA 5BR8L 4LF8Q 2R7FA 2ZJRA 2CWAA 1IBLQ 2RHSB 3KLWA 3J81j 1HNXL 4DV7Q 3DLLA 4B3RL 4LUOA 5J3BA 1N36L 1YNXA 4ME3A 2OWOA 4C3IH 4A3LG 3MEFA 1YVCA 4LUZA 4HIDA 1YBYA 4OO1G 1KRSA 4R4QA 5M3FH 4JI3L 1EFWA 1KRTA 4DV5Q 3D0FA 4KHPL 2UUAL 5IYBG 2UU9Q 4A3JH 5AJ3L 4X6AH 3CMEA 5BR8Q 1VQLA 3W1GA 2NVXH 2UXDQ 1EOVA 2DUDA 3ULLA 2ZJPA 3K80C 3W5OA 4P74A 1JE5A 2I5HA 4A3EG 2NVQH 3KF6B 1QUQA 3PUVA 1PH3A 2KBNA 2CCZA 5C0XG 1FGUA 3RN5A 4HJ7A 1V9PA 3RZDH 1VQCA 1XJVA 4LUVA 4QQBX 5LMNQ 1X3FA 1QUQB 3GTJH 4R4IA 1E1TA 3PIOA 1GO3E 2QA4A 3UDIA 2Q2UA 3HOWG 4C3HH 4JI3Q 3F2DA 3F1ZA 3HOYH 4HIKA 1ASZA 3KYHC 4GN5A 1V1QA 1O7IA 3T1YL 3PUZA 2K5NA 3HOVG 4JI8Q 3CCMA 3H3VH 3J7A5 4O2DA 2GN5A 2JE6I 5C0XI 3CCEA 3AEVA 1NTGA 4A3JG 4DR6L 4L5TA 2PI2A 4DUYQ 4IFDG 3T1HL 4X62Q 4PZ8A 5GROA 4L5RC 3M7NA 1CKOA 1Z9FA 1JJGA 1PHJA 2VL6A 2KHJA 1Y1WH 1L2FA 4JI1Q 4DR2Q 4JV5Q 1L0WA 4LFAQ 2MQHA 5FLMH 2UXBQ 1N33L 2XTIA 3CCRA 3GO5A 3TS0A
chains in the Genus database with same CATH superfamily
2VUMB 4GN3B 4B9XA 3HOUG 5I6WA 4YIJA 5C3EG 4B3RQ 1O78A 2AWNA 5JJIA 5JPNC 3PIO3 2E2JH 3I4MB 3I91A 3Q8DA 5M5XB 1A0IA 1B44D 5J1ZA 4DR2L 3PGZA 1PZKD 4LFAL 4F87A 3S1MH 1HUNA 4LF6Q 5TSSA 2VQEL 4OGQC 2J7ZA 3FHWA 2EYJA 4FP5D 2PQEA 1VQAA 4GNXA 2EXZA 1SN8A 1Y8OB 3F2CA 4P72A 1KC8C 4LMQD 1CZGA 3S16B 4L6TB 2EY2A 3GTLH 3CCJA 4CKBA 1LTLA 3P75A 1YJWA 4GKKL 1EY5A 3D8GA 3H09A 4GNXC 1F2LA 5IY0A 1G6ZA 1HH2P 4KD4A 1STBA 2K6AA 3GTPB 1X9NA 2AUKA 3HOXH 1SJED 1CI3M 2AWOA 4FF2A 4DR6Q 1WOCA 1PTOH 2R6GA 4DR1Q 4DXGA 5J22A 2EYMA 4BY7B 1QB5D 1QJOA 4DR4L 3U9OA 2MHVA 3J80E 1HJPA 2EJFC 1TS2A 1UWVA 2K75A 1MKHA 1TWGB 1NCVA 4DV4Q 1WD1A 1C7YA 2K50A 1E2WA 3W2DA 4LJZC 1NR4A 1QILA 3OMGA 3J80c 1WJJA 1Q7YC 2Y0SE 1SROA 4IZ8A 4LNQA 2EYFA 3HOXG 1D8LA 2XRSD 1NMFA 1RIPA 3DWPA 4C1NI 1D5XC 3J81i 1EU4A 3IL8A 4JC0A 3AMUA 2MJ8A 2VUMG 3QWNA 1VQ6A 2VNUD 1GOZA 3BYYB 3Q23A 1MBYA 1LT6D 3KDFA 1TIID 3I4MG 2AQ1B 1PH4A 3BZDB 1BBUA 3M9BA 4A3FB 1AZQA 4DPGA 2JA6B 1HZBA 2JEAI 2JXMB 4BBSB 4IUQA 3I4NH 2E5LQ 4A3FH 3F2BA 3CF5A 2YU9B 3PIPA 3F8TA 4X66Q 1AFPA 1ENCA 2O2LD 1BDOA 2A6HC 3VYTA 4A3MG 5JEAG 1GM5A 3SVMA 4XQJA 3K57A 4DUZL 4NXMQ 4CKEA 1TWAH 1IKLA 1U4LA 2DGYA 2JA7H 1S40A 2IWHA 1WTOA 4A3BH 2A5HA 1X32A 1Y8NB 3H0GG 4CDDC 1OTCA 4A3IG 4JI2L 1II3A 4A75A 1XNRQ 2EXDA 2Q2IA 1PH7A 3BG3A 4FF1A 4BY7G 1TWGH 2RKSA 2BE5D 3E6ZX 3HFZB 2AQ2B 3SR1A 4DF7A 1HRJA 2F0PA 4OWTB 1G2TA 2ASBA 3PO2H 2KCMA 1MHWC 3A5ZB 1WTWA 1D1IA 2IT1A 1XPUA 5FK9C 1RJTA 1X3EA 2OTLA 2EYHA 3BS1A 2VY3A 4L8JA 2HT1A 1TWCB 1X54A 1A3TA 4LFCL 3TREA 3J81E 3HOXB 4RMFA 2F52A 1Y1VG 3X3NA 2PNHA 1PFSA 5HY6A 2IW3A 3Q0AA 5ELBA 2ZTEA 4JOIA 3R8BA 4JI7L 5E3FA 3M4QA 1YITA 1YHBA 3KFUA 4DK1A 2PZTA 4A3LH 1NE3A 5DM73 2BA1A 3TZUA 3G71A 1XMOL 2A6EC 2D5DA 1F9RA 4A3BG 4GKJL 1JORA 5EKKA 1I4HA 4LF8L 4GOPC 4A3FG 5IWAQ 2JA6G 4BBSG 1YEZA 3JAML 3L2PA 3PUWA 1CZWA 3DWAA 4IOCA 1SE2A 4Q0FA 1LTTD 4A3MH 1YJ9A 4LW1A 2JSOA 3CCSA 2B2UC 3MHBA 4A3MB 1KAWA 2O5JC 5LL6S 4WFN3 3OIQA 2Z9HA 4PQXA 1O7LA 3O13A 3D4DA 2VUMH 2RA4A 3GTGB 4YY3Q 4OXPA 1CQVA 3OTOL 5FLMG 3FEWX 1WTVA 3H0GB 3PIP3 1SNDA 4A3IB 1XPOA 1Y1WB 1HR0L 3GV3A 4DV3Q 3VR2A 2A6ED 3SGIA 4P75A 1FNUA 2K5DA 4LF6L 4UY8C 2OT2A 4J8QA 3S9WA 2OCEA 4C56C 1EIGA 3NXWA 1UE5A 2ZXRA 4DV7L 3GTQH 2K5QA 1JICA 3CRLC 1A6XA 4G7ZC 2RDGA 4A4IA 4C3HG 2QILA 1EQQA 1TWCH 5GQOA 1JWUD 3E5SA 1Q1EA 3QOJA 1CSQA 2AHOB 1RKNA 2JK8A 4G4KA 4TQUS 3EJIA 4ULLA 5ELCA 5IYCG 1KABA 1SXTA 2WP8J 3SK4A 3C1EA 2NVXB 4KN4C 1Y1VB 4GOPA 2QEXA 3S2HB 1VQOA 4ZUJA 4RG1A 1BF4A 4DK0A 2KENA 1PV4A 1CA5A 4ZLTF 2XVSA 3KF8B 4IJLA 3I90A 1KHIA 4A3BB 4PMBA 1FYCA 4OIJA 4U68A 1SYBA 2JP1A 5FO7B 4YHHQ 1L0YB 3LX0A 4OWXB 1TKWB 2EQSA 4OO1H 5C4XH 1VMCA 2VQFL 1LM0A 4RGMA 1RTOA 2K1BA 3B6YA 5JJKA 5BN3A 3CCVA 2VB2X 2KEDA 1CSPA 3OW7A 1O7YA 3V05A 1SFOB 3M3YH 3HOUH 2QF7A 1XNQQ 5NUCA 2E8GA 2ENBA 2JA6H 1QZHA 3VR5A 3KBGA 1HNWL 2NZHA 5CYUA 1O7ZA 5AFWA 1Y1WG 4BS9A 2CQAA 2ES2A 4FF3A 3ICEA 2IX1A 4R9WA 4JI0Q 2O5IC 4A3GH 2N88A 2HDLA 1EL0A 2E5LL 1CFMA 4HCSA 3SE0A 3AYHB 3PQIA 4PZ6A 4QL5A 5IIFA 1TWHH 5EAYA 3GTMH 2IPKD 3BDOA 4AIMA 1UNSA 1TS5A 2BE5C 4C3HB 4LFCQ 3I7FA 4NDXA 3BZKA 2RF4A 5CV5A 1PH6A 2C9OA 3D6CA 3OYYA 2A68D 3D4WA 2Q8TA 1N34L 3NWSA 4A3EB 3H3VI 1F77A 2NN6G 3PUYA 3NBIA 3RLFA 3UDGA 4G7HC 4JI2Q 4LF9L 2RSOA 1EZ8A 1X65A 1NJIC 4F8MA 4G7OC 5IT9c 4IPDA 4AH6A 4ZYSA 2LKVA 1K3BC 1RD9D 2EYLA 1JB7A 2A6HD 1L1OA 4CBVA 1M90C 2ZTCA 1HA6A 1JJ2A 1B2TA 3S1RH 1MSGA 1VQ7A 4YCVA 1NMGA 4TSSA 3FDTA 2R92G 4LFBL 3J7AV 3GTLB 2DY7A 4LK1C 3SK6A 4EGVA 4X3SA 2RDHA 5JEAJ 4RH6A 1GJXA 1TS3A 4IO9A 3F2UA 4AQYQ 2GVBA 1HR0Q 1PH1A 1LTAD 1K28A 3URYA 2F0WA 1R9TH 5KGUA 3K5MA 1HZCA 2AUJD 1WCMB 4K0KQ 4R4CA 3VA5A 4LF8Q 1EIHA 2ZJRA 4CDEC 3R93A 1UEAB 4ODGA 2EYPA 5KRUA 3J81j 2KOLA 1H9RA 4DV7Q 4LUOA 1N36L 2OWOA 4HIDA 4LUZA 2PNRC 3RD4A 2NVTB 5D3DA 1GUSA 1F9SA 2IL8A 4JI3L 3TSSA 1PFBA 3D0FA 1DOKA 1HTPA 2UUAL 1S4ZA 3CRKC 4X6AH 3CMEA 1JWMD 3GV6A 2NVXH 2UXDQ 4A3EG 1K8OA 5A2QL 5COYA 5EKLA 1PH3A 4DXFA 3RN5A 1VQCA 4PNYA 1X3QA 4DNTB 4H7BA 4R4IA 1GO3E 2Q2UA 4H0LC 3F1ZA 4HIKA 1ASZA 4GN5A 3T1YL 3IFTA 3PUZA 2K5NA 5T1GA 1C8CA 2F0NA 3CCEA 1D5MC 4LAAA 3AEVA 4L5TA 1IYVA 3T1HL 1LABA 1PHJA 1U4PA 1SYEA 2KHJA 2R92B 1DZ1A 4HCEA 5M3FB 3AB9A 1R4QB 4LFAQ 3TP5A 4JPBW 1TY0A 1XNQL 1EU3A 2Z6KA 2R93H 4LF4Q 3HEJA 2B3GA 1Q1BA 2N3SA 5CR3A 1EQVA 2TSSA 3PMFA 3OTOQ 1KD1C 3I8ZA 2EY6A 1Q82C 1WTPA 1HZ9A 2K7VA 3A8JE 3ULJA 2CH4W 5FJ8H 1K9MC 2QEJC 3OWFA 1WCMG 4LF5Q 3GQBA 4B3ML 4L5SA 4QIWB 5EJWA 1EY7A 4DGZA 1SFOH 1L1OC 4DV2L 2FHTA 2LSSA 2VB3X 1P8LA 1BBWA 1KDBA 1PTOC 3OOCA 5CV7A 5ELDA 2SDFA 4YCWA 1GUWA 2GVAA 2B8FA 5EGTA 1Z7TA 4IPHA 1HNZL 1VQLA 4ZK9B 2JA9A 2HHHQ 1N34Q 1MGSA 1IBMQ 1TR5A 1RCVD 4PMWA 4DV4L 3DXJC 4KD3A 2VW9A 1SNQA 3S1NH 1QNUA 2ZJQA 2Y0SB 1HNWQ 4UDUC 2XGTA 4HMJA 2X6LA 2PI2E 1BO0A 5JPMC 3SDZA 4HEDA 1QG7A 5IGGA 4OELB 1PH9A 4CHTB 2Z0SA 4WJWA 4A93B 3A5UA 4IN3A 2F4VQ 5CV9A 3R3OA 3G48A 4KKTA 1NNXA 5M3FG 1CKNB 4BA1I 2CWPA 2K04A 3K5LA 4X65Q 2XRQD 2B2TC 3RMHA 4JI4Q 5E4XA 2SOBA 3S1QH 1PVOA 1NUCA 1B7YB 2Z6BA 3J7ZC 3PO3H 4A3IH 5C6AA 5E7NA 5KEEA 1VQJA 3NBHB 2QDBA 1SYGA 3BJUA 3GTGH 4J15A 1JOKA 2NZOA 4C3JG 1PMRA 1UEBA 3CHBD 1VQ9A 4NXNQ 3S17H 4BBSH 5M5WB 3K8AA 3L7ZC 4JI5Q 1OXUA 2K05A 1JT8A 2BA0A 1TWFB 5IGBA 1C4QA 2IY5B 5CGKA 2AKWB 4LF7L 1FL0A 4ALPA 1EIFA 3D31A 2NZ1D 1J9OA 1N32L 2LXKA 1B9NA 2K5WA 4GOPB 4N8FA 4RWSC 2Y0SG 2F3WA 2F0HA 5M3MH 4YWLA 1QZGA 1WTRA 3E0JA 2NTSA 1V1OA 4JW0A 3PUXA 4DUYL 1HQMC 3MFGA 4A93G 2H1EA 5KYLA 4BY7H 3CCLA 5C0XJ 1ICWA 2Z6KC 4FXGC 3MZ5A 1AEXA 2A1AA 3OIPA 1XMOQ 4EQNA 2EY5A 2JN4A 3C2PA 4XXEA 3CU7A 4UHVA 5IGDA 2BH2A 2HUGA 3C46A 1WD0A 3JAME 2HD3A 2K32A 1X56A 2QKIC 3A0JA 2B2UA 2KA7A 3T16A 1TWFH 1SEBD 1HZAA 1PFMA 5EPKA 2HQLA 2J0TD 4JI6L 1ML0D 2J4XA 3E0EA 4MTNA 2XNAC 4B3MQ 3S24A 3CC7A 3T1YQ 4NXML 2B2VC 2VQEQ 5M5WH 2K28A 2B2TA 1LT4D 2KCNA 4YY3L 4C3JB 2N55A 1X3PA 3RR5A 1YI2A 4N8X1 4UPAA 3S1MB 4GZYC 2B63H 2EIFA 3TBIB 3Q24A 4HIOA 3I4MH 3BYTB 2E2JB 3D4RA 3PO3B 3DWQA 3RZOH 1XTCD 1Q8IA 1CQFA 3S14B 2UXCQ 2F0IA 4K6DA 2SEBD 3M4YA 4BBRH 4DN4M 2UUCQ 3VR6A 4LF4L 3S17B 1BXTA 2EDGA 4UP9A 4QJFA 3I56A 4DR3Q 3NSWA 1IL2A 2K01A 1I94L 3ZYYX 1EUJA 4DR4Q 4HN7A 4IURA 4OX9L 4IFDH 1RL2A 5FO8B 1OXXK 2L11A 1DONA 1UE6A 2PYKA 3ER0A 3I2ZA 2EOTA 3U9SA 1VCIA 4R4OA 3HOYG 3OW2A 2L4NA 4IUPA 3L9AX 1HNZQ 2HHHL 5M9OA 4XIGS 3CW2C 4CDCC 4XQNA 1LTGD 3WWVA 1SDFA 2F0EA 3AFPA 3I55A 5E1FA 1RTNA 3M7GA 1C9OA 4KK7A 4OONA 1A2UA 5H1SE 1I4PA 1EY9A 5CORA 1ONLA 4CJ2C 5LL6X 2K5HA 5LMNL 1KDAA 1SMXA 3U58A 5FOBB 1STHA 2JEBI 2BH8A 1GKHA 4B9WA 4F7XA 1QWYA 4KMUC 1IBKL 1B1ZA 1D7QA 5FLXE 3LNNA 2RCNA 3J81c 1VQ4A 2L0CA 3UDXA 1RHPA 5JEAH 1EEID 4ZKCB 1K73C 1KNEA 2WB1E 3PO3G 2HIVA 1AE2A 4FDBA 3OPOA 1IHZA 1VQIA 4EX5A 2C5CA 1E1OA 4TVAB 3VA7A 4XYOA 1BR9A 1Q8KA 2WB1G 2AMCB 2K03A 4K2KA 3KJOA 1YNND 2M00A 3V2TA 3SK8A 3QOLA 2F0QA 5CBAE 1VQBA 1YNJD 3NTIA 1B3QA 2MO0A 1AH9A 1CA6A 3E9HA 3UE1A 1PYWD 2F0TA 5EQ0A 2CW0C 1I5FA 1KDCA 4X64Q 1PH5A 5DNFA 4DV0L 3K7AH 1MIUA 3HOYB 1DYQA 4IUTA 3N6RA 2PPBC 4NB3A 1PRTB 3K81C 3HGBA 3PCOB 4LF7Q 3U4ZA 1FGBD 3T56B 3HOVH 1HXYD 2I07B 4GNXB 2OEOA 3LGJA 1LYLA 1DJRD 2ZT9C 3NTHA 4HSVA 5JOBA 1N32Q 1W3SA 1VQDA 3RNUA 3HOWB 3H6MA 4AYBE 3GTJB 4V190 4KHPQ 1E0BA 4EQOA 4KJNA 1JB3A 3KF6A 1F9QA 1K3RA 2E2HB 1B4OA 1U5KA 4F88A 2F03A 1I3QH 1EOTA 1CTMA 2YYZA 3MFYA 3NUCA 4MNOA 4K0KL 2A68C 1GUOA 2Q2HA 3K0YA 5C5MA 1XMQL 3S15H 1VQ5A 3WDNA 5KNCA 3A8IE 1X3GA 1A63A 4FXKC 2MNAA 2WB1B 3K59A 5M5YH 1IXRA 1Q86C 3MTSA 2K33A 2R61A 3ND8A 2RDFA 1WYDA 1F9PA 3T13A 3D3RA 3CQZH 2FFKB 5FJ8G 5FLXc 5ELNA 3NWTA 1F2MA 4P73A 2H4OA 3FPUB 4B3SL 3HOZH 4JYAQ 1STYA 5KYIA 2WINB 5BR8L 3A8KE 2PO4A 2CWAA 2RHSB 3EA6A 3KLWA 4B3RL 1ZEQX 1L0XB 4ME3A 1I4QA 2WKDA 5JVG3 1CHPD 1NAPA 2DJFC 2EVBA 4OO1G 1KRSA 4R4QA 1EFWA 1KRTA 1FNWA 3SEBA 1YNJC 5IYBG 3S1RB 2UU9Q 4A3JH 2KEEA 1KXLA 1PRTC 4P74A 1QUQA 1DCZA 3PUVA 2CCZA 1V9PA 4ZUIA 4QQBX 5LMNQ 1X3FA 1QUQB 3HOWG 5KIXA 1HA5A 3F2DA 3HOYH 3GTMB 1PDQA 4ABNA 3K7AB 2HQEA 4UAIA 3A7LA 3OSOA 1V8QA 2PW7A 5C0XI 2JE6I 1V1PA 5I2YA 4ZAIA 3I4LA 4IFDG 2DN8A 2A73B 4L5RC 3M7NA 1SBBB 1Z9FA 4QUCA 4JI1Q 4DR2Q 1L0WA 1PLFA 3MXUA 3VYSA 2NUCA 1GHKA 4I7ZC 1WTHA 4HSPA 2ZXOA 5EPJA 1PH2A 2K14A 3H3VC 2F0LA 4KKUA 1K8GA 4FNFA 2G5DA 4XT1B 1EQTA 1H9JA 4XQQA 1WVLA 3CPWA 3L3OC 2UXBL 3M3YB 1N33Q 1S5ED 1IBKQ 1STGA 3ONAB 3MA2B 2F4IA 3RLOA 1O80A 3C3LA 1XXGA 3MXNB 3J80i 5FO9B 2JYOA 3KK7A 1KIXA 2IJ0A 4EVOA 2A69D 1HUMA 4KY5A 3N52A 2CHBD 2NWGA 2UUBL 4QIWE 2E2HH 5K36H 1PYBA 2ICIA 1TT2A 5C3XA 2PW5A 4LF9Q 4KKSA 4WJ4A 4XYQA 3W1BA 1D6EC 4BWGB 3KF8A 3IKJA 2F0SA 3S2HH 3HOWH 1J8IA 1WI5A 2LFNA 2BOSA 4GKKQ 3TP8A 1Q12A 1Y1VH 1HPCA 1BUVT 4JBJA 1MJCA 1SYDA 1IYJB 2JA8H 5D14A 3M4OH 5G3LD 3NE5B 1BCPD 2HCCA 5CV6A 5CV8A 4XTCS 4C2MB 1UE1A 1EQRA 2KVMA 3BZCA 1EFID 1EWIA 3IAYA 4CDFC 2KHIA 3H0GH 4POGA 4IFDI 1AW7A 2Q2TA 1ZKOA 2YTVA 3JC66 3HS0C 3ULPA 2PCFB 3T4AC 4X66L 3TN2A 4R1JA 2F0VA 1CHQD 4GN4B 1B8AA 3TMEA 3QO2A 3QG1A 4DUZQ 4B3SQ 2DNCA 2DJGC 3CCQA 4A3DH 4JYAL 2V1CC 1KL9A 2L12A 3NHHA 1MJEA 1PZID 3K6OA 3R2TA 5BN4A 4BY1B 1YHAA 4BY1H 4OWWB 1NSNS 1SMYC 3GTKB 3X3MA 2RCFA 2JA5H 2B8GA 3STBD 2EYOA 4V0BA 2XWJB 1EY6A 1XYIA 1SNOA 2B2WA 2F0KA 2FXQA 4OEMB 1FJGQ 4WJ3M 3TRZA 4DAYA 4FXDA 4RHSA 3G7LA 1KNAA 1OXSC 4HAEA 3EFXD 5IE8A 3E9IA 4ILWA 3EROA 2CH4A 1BCPC 1VDZA 4JG2A 3CCUA 1BNZA 4C2MH 4XT3B 4JBWA 1I6HB 2CKZB 4KI0A 3CP0A 3G4SA 1YIJA 3PO2B 1B9MA 1E24A 2XIWA 3H94A 2NVYB 3MXNA 2PMZE 4WRDA 3NBHA 4JI7Q 4A76A 5C4JH 5C3WA 3HKZE 3G6EA 2CVRA 3FKIH 4ZRZA 1SR3A 2B2VA 1YJNA 4K6LA 2ZM6L 2F0GA 2I5LX 4L63B 4RCOA 4YWKA 5C0XH 4HJ8A 1Y69U 3NELA 2K52A 3QB3A 4QMGA 2KUMA 3KUPA 4GLXA 4P2CB 4Y52H 4K5VA 2F0UA 4QGUA 2RSNA 2PQAA 3PV0A 2KCTA 2PZUA 5IYBH 1JOOA 1E3PA 4PG3A 4CJ0B 2VS1A 3T53B 2LXJA 4ID6A 4KV6A 1A3VA 4EQ5A 2UUCL 4P71A 4R4TA 2I0QA 2R7ZH 2FJ2A 1JQYD 1ASYA 4BY1G 3AQQA 4AYBG 1U9RA 1TWAB 1SLJA 2KCCA 4K2LA 2IHEA 2JQOA 3I73A 1TQOA 2OTJA 1U4RA 4DAVA 3S1QB 4DNRB 4DV1L 1PTOD 5C4HA 2N78A 3I4NB 3C1FA 2WV6D 2XN9C 2WKCA 4DR7Q 1MI2A 1VS0A 4QB4A 1FVIA 1I6VC 4JBKA 1OXVA 3J7YW 1B3AA 1LTID 4IUNA 3EBEA 1LLRD 3TQYA 4QF4A 4A3CG 1KAAA 4RHRA 3PO2G 2EZVA 4FYDA 1ET9A 3QR8A 1IL8A 3JAMc 1GHJA 1MSHA 1PXUA 1YHQA 2D62A 4ZQ3A 4IALA 5GAGC 1ZYRD 1QNKA 4JCVE 1S72A 4JI1L 1EYAA 3RZDB 4POFA 1N8RC 1VMPA 2C35B 3RN2A 2E75C 3L0OA 2Q8IB 1EEFD 5AJ3Q 1CM9A 2R3ZA 3A7AB 4HR7B 2DY8A 3J81L 5HGQA 5IWAL 2X69A 2F1MA 1C48A 2M9VA 4RA8A 1EYGA 1PTOB 1I6HH 2RVLA 1VQEA 3I70A 1PRTF 3GTPH 3A54A 2F0MA 1B53A 1EWCA 5ELFA 1FD7D 1ESFA 3NTKA 1Q3LA 4UP8A 3OMCA 4AYBB 2ICEC 4DV6Q 4RKLA 3BVMA 5EBCA 4KLKA 2F3IA 4DR3L 1SE3A 5EKIA 2B2YC 2IX3A 3OWEB 1RDPD 1GUNA 3I72A 4DV3L 4JV5L 4OX9Q 3GTKH 1A8VA 1JJCB 4MN3A 4N9PA 2RHQB 1FNVA 3K5OA 3I4NG 3S15B 1TS4A 1WTQA 4MHEA 4BXXG 2M2LA 3NENA 3NEMA 4A3KH 1QOHA 2EJGC 1VQ8A 2H5XA 4M8AA 1RODA 4B08A 5JJLA 2QCPX 1I3QB 1HCZA 1CKNA 2NYZD 4JK1C 3KLSX 1HFNA 1VF7A 4X3KA 2RBMA 2KJXA 2N49A 5IP9G 4HJAA 4KTAA 4FF4A 3TS2A 3MWYW 1G291 3HP3A 3J7AF 2L15A 1EWHA 1J5EL 3MEHA 4OHJA 1VQNA 4TKOB 1QE6A 1BCPB 1X6OA 2F0FA 3M4OB 5D3IB 1STNA 1ENAA 2WAQE 4DAMA 2JJQA 2YV5A 4KHVA 3DEPA 3FPPA 5LMUL 1Y14B 4Y7NH 1SJHD 4IOAA 2FMMA 3AFQA 1T9HA 3WOFA 4HJ5A 2NVTH 4C3IB 4A3CH 1L1OB 1PRTD 4MZ9A 2NVQB 2F3VA 2QW7A 4YCUA 4MIUA 4MTKA 4AQYL 4GS3A 4Q5VA 3K0XA 1R4PB 1S5DD 1P16A 2MO1A 4EQPA 4X3TA 1VQFA 4JBMA 1ILPA 2E74C 1AE3A 5IP9H 1PA6A 1K8AC 2ATWA 1XWEA 4LWCA 3P1HA 1VQMA 1SE8A 4JI0L 3GTOB 1IW7C 3HOZG 2NBFA 2A19A 2F0OA 1EY4A 4DU9A 1GUGA 4LFBQ 3MC0B 2B63G 5C4XG 1UAPA 1HHVA 2UUAQ 5F2DA 1N9WA 1GD7A 1LUZA 1H9SB 1DXMA 5I9OA 2R7FA 1AP0A 1IBLQ 2WACA 1HNXL 4HMIA 1YNXA 5J39A 1YBYA 5HGTA 1SYFA 4KHPL 3K58A 5AJ3L 2NVQH 1JC7A 3KF6B 4HTHA 2KBNA 5C0XG 3RZDH 4HJ7A 4RGNA 5I4DA 4Y7NB 2QA4A 1G91A 3UDIA 1UUPA 4C3HH 3BVZA 4JI3Q 1K0SA 3KYHC 1V1QA 3ITPA 3SXHA 4C3IG 3HOVG 5ISRA 3J7A5 1I4RA 3KLSA 4A3GB 4DR6L 2PI2A 3SHLA 5IODA 4X62Q 3VR3A 4PZ8A 1JJGA 1CKOA 1V1PB 2VL6A 1L2FA 2MUYA 4R8IA 3BVGA 4JV5Q 2Z4HA 5L37A 1H9SA 2MQHA 5FLMH 4N9TA 2XTIA 3CCRA 3GO5A 3CC2A 2MP1A 2CFMA 3KLRA 4I65A 1SNPA 4JI8L 1IKMA 1I4GA 4DK3C 2RQXA 2GA4B 2SNMA 3H91A 3CXCA 4DR7L 3S14H 4DAPA 2L1BA 3HOZB 1K83H 3RZOB 1J6QA 1WCMH 1DOLA 4YWMA 1JMCA 2JA5G 1NY4A 4A3KB 1D5ZC 1R9TB 1BKBA 2B63B 1IBML 5C4XB 1YNNC 3ND9A 4HIMA 3S2DH 4NMZA 3R2IA 4IPCA 3NP8A 3UE0A 1VF5C 1PYSB 3MVVA 2Z4IA 2AQ3B 2LMCB 4GLVB 4H44C 4DV6L 1H9MA 5ELOA 1A15A 1TVXA 1EZ6A 1HR0W 3PF5A 1U0LA 4IPGA 2Z1CA 4M1UB 4FO2A 3TDQA 5CMDA 2R7ZG 1JOQA 3FMCA 3LWEA 2G9HD 4DV2Q 2IX0A 5KNBA 5IP7H 2NB0A 3I4OA 5LMUQ 4IFDJ 1A62A 4K5XA 2NTTA 4HJ9A 3ZJYC 3T1HQ 4FVMA 3FKIB 2JA8G 1VQGA 1LTRD 1ET6A 2WFWA 4R8NA 3GTQB 1T5EA 1EYDA 3GP7A 5DLQE 1K8MA 4JI4L 1T5XD 3OHXC 4Z9CB 1DGSA 3CPFA 3HOVB 1JWSD 2I46A 5D65A 3TP6A 4A3GG 5T1IA 1NBWA 2D9UA 2QGQA 4GLAC 1EY8A 4K14A 4CGYB 1HFGA 5BN5A 1J5EQ 3M4PA 2G9DA 3IRBA 3ERQA 5K36G 1STAA 2O4XA 1ENFA 5GAEC 3UDFA 3GD7A 4LF5L 2PQAB 2X6GA 3D6WA 4ME5A 2B2WC 1E2VA 1QVFA 5I2XA 2VZAA 4IJHA 4RCNA 4I7AA 4S3SA 1G6PA 5C44H 1KTKA 2FMCA 2OQKA 2LY7A 1QCBD 2IHFA 3J80L 3BDLA 4DAYB 2JA5B 4A3KG 3Q22A 3QJYA 1HNXQ 1D2BA 4BXXH 3HKZB 2E2IH 2FINB 5IT9E 1VQKA 4DKAC 3HRZC 4X65L 2B29A 1HTLD 4DFAA 3TEHB 2OF1A 4BA2I 4A3DB 1SSOA 1VQPA 5I6YA 2TMPA 5C44G 3H15A 4NP5A 1U4MA 4CJ1B 2R93G 3JAMi 2R7ZB 3M85A 1PTOF 3CMAA 4RFBA 2N8NA 1LT3D 1LTSD 1V43A 2D0OA 2F4VL 1CKMA 3KOJA 4DR5Q 3P7JA 4IQZA 3FKIG 1EY0A 1JE4A 1I50H 4DA2A 5K5PA 1IBLL 2JA8B 4A93H 2A69C 4PZ7A 1E7ZA 1OXTA 4X3UA 4O42A 2ZTDA 1PFNA 1W2BA 3Q6SA 4ZCKA 3KDFB 3KJPA 2VXWA 2XWBB 1GXDC 1SYCA 2HIXA 4JI6Q 1Q90A 4DV5L 3G6JB 2BDOA 3S1NB 2V4DA 5C4JB 1C0AA 1STEA 3HZXA 2NVYH 1SAPA 1I50B 1G51A 2JA7B 4NXNL 1QVGA 1H95A 1A2TA 2A74C 4WORA 1Z6HA 3DM1A 4OO1I 5M3MG 1XPRA 1QVCA 5C4ZA 1XTDA 3EIVA 1X55A 2I5MX 3EN2A 3U50C 1TY2A 2UXCL 3IFDA 3K5NA 3DHQA 4JI5L 1FJGL 2YTXA 3FVQA 4KY7A 2E76C 4KHZA 3HKZG 3T51B 1Q46A 1UE7A 2E2IB 1ZXTA 4BBRB 2EE1A 2F0JA 4RAUC 3GDEA 4U673 3EVQA 4A3DG 4PV1C 1EYCA 5CBEE 3FP9A 1VQHA 2UUBQ 3TZDA 5C44B 3LWUA 4CKCA 1HQRD 4GKJQ 4H02A 2R93B 4C3JH 3A74A 2EY1A 4JVZA 1ESRA 1SRUA 1E22A 1BOSA 1I4XA 5EPLA 2CQOA 4B3TQ 2R92H 2Z8LA 3DM3A 4QUFA 2Q8RE 1Z47A 1S3OA 1CK1A 1ICFB 4K5WA 2DNEA 3U4VA 2MGSA 3ERSX 3NQIA 1WTXA 3RUZA 1KLGD 4G57A 5IOCA 5DEHA 1LTBD 2OQ0A 4UP7A 2KECA 1PZJD 4RGTA 1AN8A 1DOMA 1PH8A 5IYCH 4X62L 4ZKBB 4OIKA 1LACA 3VDYA 1I94Q 4IUUA 3NK9A 1LV9A 2K4KA 2XSCA 2WIIB 4RKBA 1S5FD 1NR2A 2NN6H 1DM0B 1M1KC 1LT5D 4J1MA 4DV0Q 1MD2D 1KQSA 2UXDL 3BDCA 1GVPA 1D1KA 2QDLA 3A56A 3VYUA 5IGFA 2JA7G 2MFIA 4KJOA 3SK5A 5M3MB 1B50A 1A3UA 3STBC 1BCPF 5IGEA 4C1NK 2CW0D 3MAQA 3S16H 2D0PA 2HDMA 1M8AA 3DMUA 1ILQA 2BDNA 1WFQA 5E4WC 3I3CA 1BBXC 3S2DB 2EPBA 4BBRG 3PSIA 3EQLC 4JOIC 2A8VA 1Q81C 2ID0A 2P5ZX 3AU7A 1TXYA 5JAVA 1K83B 2ALYB 3CAMA 2YU9H 1YZ6A 5EBDA 4E6IA 5DAUA 4L5QA 2WAQG 5ELEA 4YHHL 5GADC 5JVH3 4NKLA 4RGOS 1K0RA 2VQFQ 1XMQQ 5CV4A 2HCIA 4PMCA 5I9PA 3PF4A 2B39A 3CD6A 4APVA 1CT1D 2OXPA 3HKSA 4QY7A 2ZM6Q 3A55A 1IZ6A 2LS01 1BVSA 1JR0D 3HG9A 3K7UC 2K5VA 4NPSA 1N36Q 1SE4A 2L5TA 5IGCA 1G8ZD 1B70B 3CC4A 4A3EH 5GAHC 2E2DC 4KN7C 5LHY1 4X64L 5FLXL 2B2YA 1XNRL 1H9KA 3MXGA 5DM63 1TWHB 2UU9L 4DR1L 1F2ZA 1TU2B 2NN6I 3UI2A 5IP7G 4O0AA 1S5CD 5JJZA 5IYDG 4A3JB 1EIYB 3VYRA 4H13C 5CC4A 3BU2A 2YTYA 3QIAA 5LMNW 4IUVA 1W6JA 4DV1Q 2PZWA 1SNMA 5IT9L 1OO9B 3NPPA 4K8IA 1CUKA 3HOUB 4DNIA 5C3EB 2MPMA 3GTOH 5C3EH 4DK6C 2KHSA 3W3AA 5KNDA 4B3TL 5FKAC 2WAQB 4J6HA 1DD2A 3CQZB 4OL7A 5M5XH 3RLNA 1S5BD 2R7DA 4DR5L 4XDXA 3WOEA 5M5YB 3P20A 1ZYRC 1JCKB 2ZXPA 1SNCA 2BCOA 3DLLA 5J3BA 2PMZB 2KQ3A 4C3IH 4A3LG 3MEFA 1YVCA 4NW2A 5M3FH 5G3LF 3VR4A 4DV5Q 4TRDA 1LO5D 4QCLA 2SNSA 3MXPA 5BR8Q 1SMYD 3W1GA 5IYDH 1BQQT 1EOVA 2DUDA 3ULLA 3NQTA 2D2CC 3K80C 3W5OA 1JE5A 2I5HA 3KBXA 2ZJPA 1FR3A 5A35A 1FGUA 1XJVA 4LUVA 1RF2D 1F2YA 1IW7D 3GTJH 1E1TA 3CKIB 3PIOA 3DEOA 3V96A 1IYUA 1XX8A 1E2ZA 1O7IA 3E3XA 3FRPB 1AZPA 4JI8Q 4K8JA 3CCMA 3H3VH 4O2DA 1KLUD 2GN5A 2EJMA 2L9HA 1NTGA 4A3JG 4DUYQ 1G2SA 5C5LA 2F0DA 5GROA 4O1NA 1Y1WH 1M4VA 5HURA 1W6KA 1Y8PB 4KY6A 3DUZA 1GUTA 2UXBQ 5A2QE 3TP7A 1N33L 2L55A 3TS0A
chains in the Genus database with same CATH topology
1XNQL 2Z6KA 2R93H 3CC2A 4GN3B 2CFMA 3HOUG 4LF4Q 2B3GA 1Q1BA 4JI8L 1PH2A 2N3SA 5C3EG 4B3RQ 2K14A 4DK3C 2AWNA 3OTOQ 3CXCA 4DR7L 5JJIA 3S14H 1KD1C 1K8GA 1K83H 1J6QA 1Q82C 1WCMH 1HZ9A 2E2JH 4YWMA 1JMCA 3Q8DA 3ULJA 2JA5G 1NY4A 1A0IA 5FJ8H 1K9MC 3CPWA 1BKBA 4DR2L 3PGZA 1IBML 1WCMG 4HIMA 4LFAL 4LF5Q 3S2DH 4B3ML 4L5SA 3S1MH 2UXBL 4LF6Q 1SFOH 1L1OC 4DV2L 2VQEL 1IBKQ 1N33Q 4IPCA 3FHWA 2LSSA 3UE0A 3RLOA 1VQAA 1P8LA 1PYSB 1SN8A 1BBWA 4DV6L 4GLVB 4P72A 3F2CA 4GNXA 1KC8C 3PO3G 5ELOA 3MXNB 4YCWA 3J80i 2GVAA 3GTLH 4IPHA 1HNZL 3CCJA 3PF5A 1LTLA 2JA9A 1KIXA 1HR0W 1YJWA 1U0LA 2HHHQ 4GKKL 4IPGA 1N34Q 4GNXC 1IBMQ 5IY0A 2UUBL 2R7ZG 1HH2P 4QIWE 4PMWA 2E2HH 4DV4L 4DV2Q 2IX0A 1PYBA 4LF9Q 5IP7H 2VW9A 1X9NA 3I4OA 5LMUQ 4IFDJ 4WJ4A 1A62A 3HOXH 3S1NH 2ZJQA 2AWOA 3W1BA 1HNWQ 4DR6Q 1WOCA 2XGTA 4HJ9A 3ZJYC 3T1HQ 2PI2E 2R6GA 4DR1Q 3S2HH 3HOWH 1WI5A 2JA8G 4GKKQ 1VQGA 1PH9A 4DR4L 1Q12A 1Y1VH 2WFWA 1HJPA 1UWVA 2Z0SA 1MJCA 2K75A 1MKHA 4JBJA 5DLQE 4JI4L 1IYJB 1DGSA 3CPFA 3A5UA 4DV4Q 1C7YA 2JA8H 3M4OH 2K50A 2F4VQ 4A3GG 3G48A 4XTCS 1WJJA 1NBWA 2Y0SE 1SROA 3J80c 1Q7YC 4LNQA 2QGQA 1UE1A 4GLAC 1EQRA 1J5EQ 3HOXG 3BZCA 1D8LA 3M4PA 1EWIA 2KHIA 3IRBA 3H0GH 1NMFA 5M3FG 5K36G 1CKNB 1RIPA 4BA1I 2CWPA 5GAEC 3J81i 3UDFA 4POGA 4IFDI 3GD7A 4X65Q 2PQAB 4LF5L 4JC0A 1QVFA 2VUMG 2Q2TA 4JI4Q 2YTVA 2VZAA 3JC66 3ULPA 1VQ6A 4IJHA 4X66L 4R1JA 1G6PA 2VNUD 5C44H 3S1QH 1PVOA 1B7YB 4GN4B 1B8AA 2OQKA 3J7ZC 3KDFA 4A3IH 4DUZQ 3PO3H 4A3DH 2IHFA 4B3SQ 3CCQA 5E7NA 3I4MG 4JYAL 4DAYB 1VQJA 2V1CC 1KL9A 3NBHB 1PH4A 4A3KG 1BBUA 3BJUA 3M9BA 1MJEA 1HNXQ 3GTGH 4BXXH 4DPGA 4J15A 1HZBA 2NZOA 2E2IH 2JEAI 1UEBA 3S17H 1VQ9A 1YHAA 4DKAC 1VQKA 4BY1H 4NXNQ 4OWWB 4X65L 3I4NH 2E5LQ 2B29A 3F2BA 4A3FH 3CF5A 3PIPA 3F8TA 2JA5H 4X66Q 3STBD 3K8AA 3L7ZC 3TEHB 4BA2I 1KXLA 1GM5A 1VQPA 4A3MG 5JEAG 4JI5Q 1OXUA 2FXQA 4DUZL 4NXMQ 1FJGQ 5C44G 3H15A 1TWAH 1JT8A 2BA0A 4WJ3M 3TRZA 2DGYA 2R93G 2IY5B 2AKWB 3JAMi 2JA7H 3M85A 3CMAA 1S40A 4LF7L 1FL0A 4ALPA 2N8NA 1OXSC 4A3BH 1EIFA 3D31A 3H0GG 1N32L 1OTCA 4A3IG 4JI2L 2D0OA 1V43A 2LXKA 3E9IA 5IE8A 4GOPB 2F4VL 4A75A 5IYDH 2Y0SG 4JG2A 3CCUA 1CKMA 2EXDA 1XNRQ 3KOJA 4C2MH 4DR5Q 2Q2IA 4JBWA 5M3MH 1PH7A 2CKZB 4KI0A 3CP0A 3FKIG 3G4SA 1IBLL 1I50H 4YWLA 1TWGH 1YIJA 4A93H 4BY7G 4PZ7A 1E7ZA 1OXTA 1E24A 3HFZB 2ZTDA 2PMZE 3PUXA 4DUYL 4OWTB 4JI7Q 4A76A 1W2BA 5C4JH 2ASBA 3PO2H 2KCMA 4A93G 3A5ZB 3HKZE 3G6EA 4BY7H 3CCLA 2IT1A 3FKIH 3KDFB 1XPUA 1SR3A 5C0XJ 3KJPA 1YJNA 2HIXA 1X3EA 2Z6KC 4JI6Q 2OTLA 2ZM6L 4DV5L 2I5LX 2VY3A 4YWKA 1QZGA 2A1AA 4HJ8A 2HT1A 1X54A 2K52A 3NELA 4LFCL 3TREA 4GLXA 1XMOQ 4Y52H 4QGUA 2PQAA 1C0AA 4RMFA 3PV0A 2KCTA 2NVYH 2BH2A 2F52A 1Y1VG 2PNHA 1PFSA 5IYBH 5HY6A 1X56A 1G51A 3A0JA 4NXNL 2ZTEA 1QVGA 4JOIA 1H95A 1E3PA 4PG3A 4JI7L 4OO1I 1TWFH 5M3MG 2VS1A 3M4QA 1YITA 1YHBA 1XPRA 1HZAA 1QVCA 3KFUA 2LXJA 3EIVA 1XTDA 1X55A 2HQLA 2I5MX 4JI6L 4MTNA 1NE3A 3E0EA 3EN2A 2BA1A 3U50C 4A3LH 2UXCL 3G71A 4EQ5A 4B3MQ 4JI5L 3S24A 1XMOL 3CC7A 3T1YQ 4NXML 1FJGL 2VQEQ 2UUCL 5M5WH 4A3BG 4P71A 2YTXA 4R4TA 4GKJL 4LF8L 2I0QA 4GOPC 4A3FG 5IWAQ 2R7ZH 2JA6G 4KHZA 4YY3L 3HKZG 1ASYA 4BY1G 3RR5A 1Q46A 4UPAA 1YI2A 4BBSG 1UE7A 3AQQA 1YEZA 4AYBG 3L2PA 5JJKA 3PUWA 4IOCA 1SLJA 2B63H 2EIFA 2IHEA 4A3MH 2JQOA 3GDEA 4HIOA 1YJ9A 4LW1A 3I4MH 4A3DG 2OTJA 3RZOH 3CCSA 3FP9A 1VQHA 2UUBQ 1KAWA 2UXCQ 4DV1L 4BBRH 2N78A 2UUCQ 4GKJQ 4H02A 4LF4L 2VUMH 4C3JH 3A74A 4YY3Q 4OXPA 3OTOL 5FLMG 1VS0A 4DR7Q 4UP9A 4QJFA 3I56A 1SRUA 4DR3Q 1E22A 1FVIA 1IL2A 1I94L 4JBKA 1OXVA 1XPOA 2CQOA 1HR0L 4B3TQ 2R92H 4DV3Q 1EUJA 3DM3A 4DR4Q 4OX9L 1Z47A 1RL2A 4P75A 3SGIA 1S3OA 3EBEA 1OXXK 4LF6L 4UY8C 3TQYA 3U4VA 1UE6A 2OCEA 3ERSX 4A3CG 3PO2G 3ER0A 3I2ZA 1UE5A 2OQ0A 4UP7A 4DV7L 3GTQH 1VCIA 4R4OA 3HOYG 3JAMc 3OW2A 4A4IA 1PH8A 5IYCH 1YHQA 4X62L 1TWCH 2D62A 5GQOA 3VDYA 1EQQA 5GAGC 1HNZQ 1I94Q 2HHHL 1Q1EA 4XIGS 4JCVE 1S72A 3CW2C 4JI1L 2K4KA 1CSQA 2AHOB 2JK8A 4POFA 3WWVA 1N8RC 4TQUS 2C35B 3RN2A 5IYCG 1M1KC 3AFPA 3L0OA 2WP8J 5AJ3Q 3I55A 4DV0Q 1KQSA 2UXDL 5HGQA 5IWAL 1GVPA 4GOPA 2QEXA 2JA7G 1C9OA 4OONA 1VQOA 2MFIA 5H1SE 4RG1A 1I6HH 1EYGA 2K5HA 2KENA 5LMNL 1VQEA 1SMXA 3STBC 3U58A 1PV4A 2JEBI 2BH8A 1GKHA 3S16H 3GTPH 3KF8B 4IJLA 2D0PA 1KHIA 1IBKL 1WFQA 1D7QA 4UP8A 4YHHQ 4OWXB 2RCNA 4DV6Q 4BBRG 2EQSA 3J81c 5C4XH 3PSIA 1VQ4A 4JOIC 1LM0A 3UDXA 4KLKA 2F3IA 2VQFL 4DR3L 2A8VA 1Q81C 1K73C 2ID0A 1TXYA 2WB1E 4DV3L 2HIVA 1AE2A 3B6YA 2ALYB 3CAMA 4FDBA 3CCVA 1VQIA 4EX5A 4JV5L 4OX9Q 1CSPA 3GTKH 1A8VA 1JJCB 1E1OA 4TVAB 1YZ6A 2YU9H 2RHQB 2WB1G 1Q8KA 3I4NG 3M3YH 2AMCB 3HOUH 1XNQQ 3KJOA 2E8GA 2JA6H 4BXXG 1QZHA 4L5QA 3NENA 2WAQG 3NEMA 4YHHL 4A3KH 5GADC 1VQ8A 1VQBA 2H5XA 2NZHA 1HNWL 1K0RA 5JJLA 2VQFQ 2MO0A 1Y1WG 1AH9A 1XMQQ 2ES2A 3ICEA 1CKNA 3E9HA 3UE1A 2IX1A 4JI0Q 3PF4A 4A3GH 2E5LL 3CD6A 1I5FA 2N49A 4APVA 5IP9G 4HJAA 4BBSH 4X64Q 1PH5A 4DV0L 3AYHB 4PZ6A 4QL5A 3TS2A 3K7AH 1MIUA 3GTMH 1TWHH 3HKSA 4QY7A 5EAYA 2ZM6Q 1G291 4AIMA 1IZ6A 4LFCQ 3I7FA 2L15A 1BVSA 3BZKA 2RF4A 4NB3A 1PH6A 1J5EL 1VQNA 3OYYA 3K81C 1X6OA 3K7UC 1N34L 3PCOB 2K5VA 4NPSA 3U4ZA 1N36Q 4LF7Q 3H3VI 3HOVH 2NN6G 3CC4A 3PUYA 1B70B 3RLFA 4GNXB 3LGJA 2WAQE 5GAHC 4DAMA 3UDGA 4A3EH 2JJQA 1LYLA 1N32Q 2YV5A 4JI2Q 4X64L 4LF9L 1W3SA 1VQDA 3RNUA 1X65A 5LMUL 1NJIC 1XNRL 4AYBE 5IT9c 4KHPQ 4IPDA 1Y14B 4Y7NH 4AH6A 4IOAA 2UU9L 4DR1L 3AFQA 1T9HA 4HJ5A 2NVTH 1JB7A 2NN6I 4A3CH 1L1OB 4MZ9A 1L1OA 4O0AA 5IP7G 1M90C 4YCUA 2ZTCA 5IYDG 3KF6A 1JJ2A 3S1RH 1K3RA 1EIYB 4AQYL 4GS3A 1VQ7A 3BU2A 4YCVA 1NMGA 3K0XA 1U5KA 2YTYA 1I3QH 2R92G 2YYZA 5LMNW 4LFBL 1P16A 2MO1A 4MNOA 4K0KL 1VQFA 4JBMA 4DV1Q 2Q2HA 5IP9H 1AE3A 1PA6A 1K8AC 2ATWA 1XMQL 3S15H 1VQ5A 1CUKA 5JEAJ 4DNIA 4LWCA 1X3GA 1VQMA 1SE8A 4JI0L 3GTOH 5C3EH 1A63A 2MNAA 4DK6C 5M5YH 4IO9A 1IXRA 1Q86C 3HOZG 4AQYQ 2GVBA 2A19A 1HR0Q 1PH1A 4B3TL 1WYDA 1R9TH 3CQZH 5FLXc 5FJ8G 5ELNA 4LFBQ 5M5XH 2B63G 5C4XG 3RLNA 1HZCA 2R7DA 4P73A 2UUAQ 4DR5L 4K0KQ 1N9WA 4R4CA 4B3SL 3HOZH 4JYAQ 1GD7A 1LUZA 5BR8L 4LF8Q 2R7FA 2ZJRA 2CWAA 1IBLQ 2RHSB 3KLWA 3J81j 1HNXL 4DV7Q 3DLLA 4B3RL 4LUOA 5J3BA 1N36L 1YNXA 4ME3A 2OWOA 4C3IH 4A3LG 3MEFA 1YVCA 4LUZA 4HIDA 1YBYA 4OO1G 1KRSA 4R4QA 5M3FH 4JI3L 1EFWA 1KRTA 4DV5Q 3D0FA 4KHPL 2UUAL 5IYBG 2UU9Q 4A3JH 5AJ3L 4X6AH 3CMEA 5BR8Q 1VQLA 3W1GA 2NVXH 2UXDQ 1EOVA 2DUDA 3ULLA 2ZJPA 3K80C 3W5OA 4P74A 1JE5A 2I5HA 4A3EG 2NVQH 3KF6B 1QUQA 3PUVA 1PH3A 2KBNA 2CCZA 5C0XG 1FGUA 3RN5A 4HJ7A 1V9PA 3RZDH 1VQCA 1XJVA 4LUVA 4QQBX 5LMNQ 1X3FA 1QUQB 3GTJH 4R4IA 1E1TA 3PIOA 1GO3E 2QA4A 3UDIA 2Q2UA 3HOWG 4C3HH 4JI3Q 3F2DA 3F1ZA 3HOYH 4HIKA 1ASZA 3KYHC 4GN5A 1V1QA 1O7IA 3T1YL 3PUZA 2K5NA 3HOVG 4JI8Q 3CCMA 3H3VH 3J7A5 4O2DA 2GN5A 2JE6I 5C0XI 3CCEA 3AEVA 1NTGA 4A3JG 4DR6L 4L5TA 2PI2A 4DUYQ 4IFDG 3T1HL 4X62Q 4PZ8A 5GROA 4L5RC 3M7NA 1CKOA 1Z9FA 1JJGA 1PHJA 2VL6A 2KHJA 1Y1WH 1L2FA 4JI1Q 4DR2Q 4JV5Q 1L0WA 4LFAQ 2MQHA 5FLMH 2UXBQ 1N33L 2XTIA 3CCRA 3GO5A 3TS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ L;  2Z6K A;  2R93 H;  3CC2 A;  4GN3 B;  2CFM A;  3HOU G;  4LF4 Q;  2B3G A;  1Q1B A;  4JI8 L;  1PH2 A;  2N3S A;  5C3E G;  4B3R Q;  2K14 A;  4DK3 C;  2AWN A;  3OTO Q;  3CXC A;  4DR7 L;  5JJI A;  3S14 H;  1KD1 C;  1K8G A;  1K83 H;  1J6Q A;  1Q82 C;  1WCM H;  1HZ9 A;  2E2J H;  4YWM A;  1JMC A;  3Q8D A;  3ULJ A;  2JA5 G;  1NY4 A;  1A0I A;  5FJ8 H;  1K9M C;  3CPW A;  1BKB A;  4DR2 L;  3PGZ A;  1IBM L;  1WCM G;  4HIM A;  4LFA L;  4LF5 Q;  3S2D H;  4B3M L;  4L5S A;  3S1M H;  2UXB L;  4LF6 Q;  1SFO H;  1L1O C;  4DV2 L;  2VQE L;  1IBK Q;  1N33 Q;  4IPC A;  3FHW A;  2LSS A;  3UE0 A;  3RLO A;  1VQA A;  1P8L A;  1PYS B;  1SN8 A;  1BBW A;  4DV6 L;  4GLV B;  4P72 A;  3F2C A;  4GNX A;  1KC8 C;  3PO3 G;  5ELO A;  3MXN B;  4YCW A;  3J80 i;  2GVA A;  3GTL H;  4IPH A;  1HNZ L;  3CCJ A;  3PF5 A;  1LTL A;  2JA9 A;  1KIX A;  1HR0 W;  1YJW A;  1U0L A;  2HHH Q;  4GKK L;  4IPG A;  1N34 Q;  4GNX C;  1IBM Q;  5IY0 A;  2UUB L;  2R7Z G;  1HH2 P;  4QIW E;  4PMW A;  2E2H H;  4DV4 L;  4DV2 Q;  2IX0 A;  1PYB A;  4LF9 Q;  5IP7 H;  2VW9 A;  1X9N A;  3I4O A;  5LMU Q;  4IFD J;  4WJ4 A;  1A62 A;  3HOX H;  3S1N H;  2ZJQ A;  2AWO A;  3W1B A;  1HNW Q;  4DR6 Q;  1WOC A;  2XGT A;  4HJ9 A;  3ZJY C;  3T1H Q;  2PI2 E;  2R6G A;  4DR1 Q;  3S2H H;  3HOW H;  1WI5 A;  2JA8 G;  4GKK Q;  1VQG A;  1PH9 A;  4DR4 L;  1Q12 A;  1Y1V H;  2WFW A;  1HJP A;  1UWV A;  2Z0S A;  1MJC A;  2K75 A;  1MKH A;  4JBJ A;  5DLQ E;  4JI4 L;  1IYJ B;  1DGS A;  3CPF A;  3A5U A;  4DV4 Q;  1C7Y A;  2JA8 H;  3M4O H;  2K50 A;  2F4V Q;  4A3G G;  3G48 A;  4XTC S;  1WJJ A;  1NBW A;  2Y0S E;  1SRO A;  3J80 c;  1Q7Y C;  4LNQ A;  2QGQ A;  1UE1 A;  4GLA C;  1EQR A;  1J5E Q;  3HOX G;  3BZC A;  1D8L A;  3M4P A;  1EWI A;  2KHI A;  3IRB A;  3H0G H;  1NMF A;  5M3F G;  5K36 G;  1CKN B;  1RIP A;  4BA1 I;  2CWP A;  5GAE C;  3J81 i;  3UDF A;  4POG A;  4IFD I;  3GD7 A;  4X65 Q;  2PQA B;  4LF5 L;  4JC0 A;  1QVF A;  2VUM G;  2Q2T A;  4JI4 Q;  2YTV A;  2VZA A;  3JC6 6;  3ULP A;  1VQ6 A;  4IJH A;  4X66 L;  4R1J A;  1G6P A;  2VNU D;  5C44 H;  3S1Q H;  1PVO A;  1B7Y B;  4GN4 B;  1B8A A;  2OQK A;  3J7Z C;  3KDF A;  4A3I H;  4DUZ Q;  3PO3 H;  4A3D H;  2IHF A;  4B3S Q;  3CCQ A;  5E7N A;  3I4M G;  4JYA L;  4DAY B;  1VQJ A;  2V1C C;  1KL9 A;  3NBH B;  1PH4 A;  4A3K G;  1BBU A;  3BJU A;  3M9B A;  1MJE A;  1HNX Q;  3GTG H;  4BXX H;  4DPG A;  4J15 A;  1HZB A;  2NZO A;  2E2I H;  2JEA I;  1UEB A;  3S17 H;  1VQ9 A;  1YHA A;  4DKA C;  1VQK A;  4BY1 H;  4NXN Q;  4OWW B;  4X65 L;  3I4N H;  2E5L Q;  2B29 A;  3F2B A;  4A3F H;  3CF5 A;  3PIP A;  3F8T A;  2JA5 H;  4X66 Q;  3STB D;  3K8A A;  3L7Z C;  3TEH B;  4BA2 I;  1KXL A;  1GM5 A;  1VQP A;  4A3M G;  5JEA G;  4JI5 Q;  1OXU A;  2FXQ A;  4DUZ L;  4NXM Q;  1FJG Q;  5C44 G;  3H15 A;  1TWA H;  1JT8 A;  2BA0 A;  4WJ3 M;  3TRZ A;  2DGY A;  2R93 G;  2IY5 B;  2AKW B;  3JAM i;  2JA7 H;  3M85 A;  3CMA A;  1S40 A;  4LF7 L;  1FL0 A;  4ALP A;  2N8N A;  1OXS C;  4A3B H;  1EIF A;  3D31 A;  3H0G G;  1N32 L;  1OTC A;  4A3I G;  4JI2 L;  2D0O A;  1V43 A;  2LXK A;  3E9I A;  5IE8 A;  4GOP B;  2F4V L;  4A75 A;  5IYD H;  2Y0S G;  4JG2 A;  3CCU A;  1CKM A;  2EXD A;  1XNR Q;  3KOJ A;  4C2M H;  4DR5 Q;  2Q2I A;  4JBW A;  5M3M H;  1PH7 A;  2CKZ B;  4KI0 A;  3CP0 A;  3FKI G;  3G4S A;  1IBL L;  1I50 H;  4YWL A;  1TWG H;  1YIJ A;  4A93 H;  4BY7 G;  4PZ7 A;  1E7Z A;  1OXT A;  1E24 A;  3HFZ B;  2ZTD A;  2PMZ E;  3PUX A;  4DUY L;  4OWT B;  4JI7 Q;  4A76 A;  1W2B A;  5C4J H;  2ASB A;  3PO2 H;  2KCM A;  4A93 G;  3A5Z B;  3HKZ E;  3G6E A;  4BY7 H;  3CCL A;  2IT1 A;  3FKI H;  3KDF B;  1XPU A;  1SR3 A;  5C0X J;  3KJP A;  1YJN A;  2HIX A;  1X3E A;  2Z6K C;  4JI6 Q;  2OTL A;  2ZM6 L;  4DV5 L;  2I5L X;  2VY3 A;  4YWK A;  1QZG A;  2A1A A;  4HJ8 A;  2HT1 A;  1X54 A;  2K52 A;  3NEL A;  4LFC L;  3TRE A;  4GLX A;  1XMO Q;  4Y52 H;  4QGU A;  2PQA A;  1C0A A;  4RMF A;  3PV0 A;  2KCT A;  2NVY H;  2BH2 A;  2F52 A;  1Y1V G;  2PNH A;  1PFS A;  5IYB H;  5HY6 A;  1X56 A;  1G51 A;  3A0J A;  4NXN L;  2ZTE A;  1QVG A;  4JOI A;  1H95 A;  1E3P A;  4PG3 A;  4JI7 L;  4OO1 I;  1TWF H;  5M3M G;  2VS1 A;  3M4Q A;  1YIT A;  1YHB A;  1XPR A;  1HZA A;  1QVC A;  3KFU A;  2LXJ A;  3EIV A;  1XTD A;  1X55 A;  2HQL A;  2I5M X;  4JI6 L;  4MTN A;  1NE3 A;  3E0E A;  3EN2 A;  2BA1 A;  3U50 C;  4A3L H;  2UXC L;  3G71 A;  4EQ5 A;  4B3M Q;  4JI5 L;  3S24 A;  1XMO L;  3CC7 A;  3T1Y Q;  4NXM L;  1FJG L;  2VQE Q;  2UUC L;  5M5W H;  4A3B G;  4P71 A;  2YTX A;  4R4T A;  4GKJ L;  4LF8 L;  2I0Q A;  4GOP C;  4A3F G;  5IWA Q;  2R7Z H;  2JA6 G;  4KHZ A;  4YY3 L;  3HKZ G;  1ASY A;  4BY1 G;  3RR5 A;  1Q46 A;  4UPA A;  1YI2 A;  4BBS G;  1UE7 A;  3AQQ A;  1YEZ A;  4AYB G;  3L2P A;  5JJK A;  3PUW A;  4IOC A;  1SLJ A;  2B63 H;  2EIF A;  2IHE A;  4A3M H;  2JQO A;  3GDE A;  4HIO A;  1YJ9 A;  4LW1 A;  3I4M H;  4A3D G;  2OTJ A;  3RZO H;  3CCS A;  3FP9 A;  1VQH A;  2UUB Q;  1KAW A;  2UXC Q;  4DV1 L;  4BBR H;  2N78 A;  2UUC Q;  4GKJ Q;  4H02 A;  4LF4 L;  2VUM H;  4C3J H;  3A74 A;  4YY3 Q;  4OXP A;  3OTO L;  5FLM G;  1VS0 A;  4DR7 Q;  4UP9 A;  4QJF A;  3I56 A;  1SRU A;  4DR3 Q;  1E22 A;  1FVI A;  1IL2 A;  1I94 L;  4JBK A;  1OXV A;  1XPO A;  2CQO A;  1HR0 L;  4B3T Q;  2R92 H;  4DV3 Q;  1EUJ A;  3DM3 A;  4DR4 Q;  4OX9 L;  1Z47 A;  1RL2 A;  4P75 A;  3SGI A;  1S3O A;  3EBE A;  1OXX K;  4LF6 L;  4UY8 C;  3TQY A;  3U4V A;  1UE6 A;  2OCE A;  3ERS X;  4A3C G;  3PO2 G;  3ER0 A;  3I2Z A;  1UE5 A;  2OQ0 A;  4UP7 A;  4DV7 L;  3GTQ H;  1VCI A;  4R4O A;  3HOY G;  3JAM c;  3OW2 A;  4A4I A;  1PH8 A;  5IYC H;  1YHQ A;  4X62 L;  1TWC H;  2D62 A;  5GQO A;  3VDY A;  1EQQ A;  5GAG C;  1HNZ Q;  1I94 Q;  2HHH L;  1Q1E A;  4XIG S;  4JCV E;  1S72 A;  3CW2 C;  4JI1 L;  2K4K A;  1CSQ A;  2AHO B;  2JK8 A;  4POF A;  3WWV A;  1N8R C;  4TQU S;  2C35 B;  3RN2 A;  5IYC G;  1M1K C;  3AFP A;  3L0O A;  2WP8 J;  5AJ3 Q;  3I55 A;  4DV0 Q;  1KQS A;  2UXD L;  5HGQ A;  5IWA L;  1GVP A;  4GOP A;  2QEX A;  2JA7 G;  1C9O A;  4OON A;  1VQO A;  2MFI A;  5H1S E;  4RG1 A;  1I6H H;  1EYG A;  2K5H A;  2KEN A;  5LMN L;  1VQE A;  1SMX A;  3STB C;  3U58 A;  1PV4 A;  2JEB I;  2BH8 A;  1GKH A;  3S16 H;  3GTP H;  3KF8 B;  4IJL A;  2D0P A;  1KHI A;  1IBK L;  1WFQ A;  1D7Q A;  4UP8 A;  4YHH Q;  4OWX B;  2RCN A;  4DV6 Q;  4BBR G;  2EQS A;  3J81 c;  5C4X H;  3PSI A;  1VQ4 A;  4JOI C;  1LM0 A;  3UDX A;  4KLK A;  2F3I A;  2VQF L;  4DR3 L;  2A8V A;  1Q81 C;  1K73 C;  2ID0 A;  1TXY A;  2WB1 E;  4DV3 L;  2HIV A;  1AE2 A;  3B6Y A;  2ALY B;  3CAM A;  4FDB A;  3CCV A;  1VQI A;  4EX5 A;  4JV5 L;  4OX9 Q;  1CSP A;  3GTK H;  1A8V A;  1JJC B;  1E1O A;  4TVA B;  1YZ6 A;  2YU9 H;  2RHQ B;  2WB1 G;  1Q8K A;  3I4N G;  3M3Y H;  2AMC B;  3HOU H;  1XNQ Q;  3KJO A;  2E8G A;  2JA6 H;  4BXX G;  1QZH A;  4L5Q A;  3NEN A;  2WAQ G;  3NEM A;  4YHH L;  4A3K H;  5GAD C;  1VQ8 A;  1VQB A;  2H5X A;  2NZH A;  1HNW L;  1K0R A;  5JJL A;  2VQF Q;  2MO0 A;  1Y1W G;  1AH9 A;  1XMQ Q;  2ES2 A;  3ICE A;  1CKN A;  3E9H A;  3UE1 A;  2IX1 A;  4JI0 Q;  3PF4 A;  4A3G H;  2E5L L;  3CD6 A;  1I5F A;  2N49 A;  4APV A;  5IP9 G;  4HJA A;  4BBS H;  4X64 Q;  1PH5 A;  4DV0 L;  3AYH B;  4PZ6 A;  4QL5 A;  3TS2 A;  3K7A H;  1MIU A;  3GTM H;  1TWH H;  3HKS A;  4QY7 A;  5EAY A;  2ZM6 Q;  1G29 1;  4AIM A;  1IZ6 A;  4LFC Q;  3I7F A;  2L15 A;  1BVS A;  3BZK A;  2RF4 A;  4NB3 A;  1PH6 A;  1J5E L;  1VQN A;  3OYY A;  3K81 C;  1X6O A;  3K7U C;  1N34 L;  3PCO B;  2K5V A;  4NPS A;  3U4Z A;  1N36 Q;  4LF7 Q;  3H3V I;  3HOV H;  2NN6 G;  3CC4 A;  3PUY A;  1B70 B;  3RLF A;  4GNX B;  3LGJ A;  2WAQ E;  5GAH C;  4DAM A;  3UDG A;  4A3E H;  2JJQ A;  1LYL A;  1N32 Q;  2YV5 A;  4JI2 Q;  4X64 L;  4LF9 L;  1W3S A;  1VQD A;  3RNU A;  1X65 A;  5LMU L;  1NJI C;  1XNR L;  4AYB E;  5IT9 c;  4KHP Q;  4IPD A;  1Y14 B;  4Y7N H;  4AH6 A;  4IOA A;  2UU9 L;  4DR1 L;  3AFQ A;  1T9H A;  4HJ5 A;  2NVT H;  1JB7 A;  2NN6 I;  4A3C H;  1L1O B;  4MZ9 A;  1L1O A;  4O0A A;  5IP7 G;  1M90 C;  4YCU A;  2ZTC A;  5IYD G;  3KF6 A;  1JJ2 A;  3S1R H;  1K3R A;  1EIY B;  4AQY L;  4GS3 A;  1VQ7 A;  3BU2 A;  4YCV A;  1NMG A;  3K0X A;  1U5K A;  2YTY A;  1I3Q H;  2R92 G;  2YYZ A;  5LMN W;  4LFB L;  1P16 A;  2MO1 A;  4MNO A;  4K0K L;  1VQF A;  4JBM A;  4DV1 Q;  2Q2H A;  5IP9 H;  1AE3 A;  1PA6 A;  1K8A C;  2ATW A;  1XMQ L;  3S15 H;  1VQ5 A;  1CUK A;  5JEA J;  4DNI A;  4LWC A;  1X3G A;  1VQM A;  1SE8 A;  4JI0 L;  3GTO H;  5C3E H;  1A63 A;  2MNA A;  4DK6 C;  5M5Y H;  4IO9 A;  1IXR A;  1Q86 C;  3HOZ G;  4AQY Q;  2GVB A;  2A19 A;  1HR0 Q;  1PH1 A;  4B3T L;  1WYD A;  1R9T H;  3CQZ H;  5FLX c;  5FJ8 G;  5ELN A;  4LFB Q;  5M5X H;  2B63 G;  5C4X G;  3RLN A;  1HZC A;  2R7D A;  4P73 A;  2UUA Q;  4DR5 L;  4K0K Q;  1N9W A;  4R4C A;  4B3S L;  3HOZ H;  4JYA Q;  1GD7 A;  1LUZ A;  5BR8 L;  4LF8 Q;  2R7F A;  2ZJR A;  2CWA A;  1IBL Q;  2RHS B;  3KLW A;  3J81 j;  1HNX L;  4DV7 Q;  3DLL A;  4B3R L;  4LUO A;  5J3B A;  1N36 L;  1YNX A;  4ME3 A;  2OWO A;  4C3I H;  4A3L G;  3MEF A;  1YVC A;  4LUZ A;  4HID A;  1YBY A;  4OO1 G;  1KRS A;  4R4Q A;  5M3F H;  4JI3 L;  1EFW A;  1KRT A;  4DV5 Q;  3D0F A;  4KHP L;  2UUA L;  5IYB G;  2UU9 Q;  4A3J H;  5AJ3 L;  4X6A H;  3CME A;  5BR8 Q;  1VQL A;  3W1G A;  2NVX H;  2UXD Q;  1EOV A;  2DUD A;  3ULL A;  2ZJP A;  3K80 C;  3W5O A;  4P74 A;  1JE5 A;  2I5H A;  4A3E G;  2NVQ H;  3KF6 B;  1QUQ A;  3PUV A;  1PH3 A;  2KBN A;  2CCZ A;  5C0X G;  1FGU A;  3RN5 A;  4HJ7 A;  1V9P A;  3RZD H;  1VQC A;  1XJV A;  4LUV A;  4QQB X;  5LMN Q;  1X3F A;  1QUQ B;  3GTJ H;  4R4I A;  1E1T A;  3PIO A;  1GO3 E;  2QA4 A;  3UDI A;  2Q2U A;  3HOW G;  4C3H H;  4JI3 Q;  3F2D A;  3F1Z A;  3HOY H;  4HIK A;  1ASZ A;  3KYH C;  4GN5 A;  1V1Q A;  1O7I A;  3T1Y L;  3PUZ A;  2K5N A;  3HOV G;  4JI8 Q;  3CCM A;  3H3V H;  3J7A 5;  4O2D A;  2GN5 A;  2JE6 I;  5C0X I;  3CCE A;  3AEV A;  1NTG A;  4A3J G;  4DR6 L;  4L5T A;  2PI2 A;  4DUY Q;  4IFD G;  3T1H L;  4X62 Q;  4PZ8 A;  5GRO A;  4L5R C;  3M7N A;  1CKO A;  1Z9F A;  1JJG A;  1PHJ A;  2VL6 A;  2KHJ A;  1Y1W H;  1L2F A;  4JI1 Q;  4DR2 Q;  4JV5 Q;  1L0W A;  4LFA Q;  2MQH A;  5FLM H;  2UXB Q;  1N33 L;  2XTI A;  3CCR A;  3GO5 A;  3TS0 A; 
#chains in the Genus database with same CATH topology
 2VUM B;  4GN3 B;  4B9X A;  3HOU G;  5I6W A;  4YIJ A;  5C3E G;  4B3R Q;  1O78 A;  2AWN A;  5JJI A;  5JPN C;  3PIO 3;  2E2J H;  3I4M B;  3I91 A;  3Q8D A;  5M5X B;  1A0I A;  1B44 D;  5J1Z A;  4DR2 L;  3PGZ A;  1PZK D;  4LFA L;  4F87 A;  3S1M H;  1HUN A;  4LF6 Q;  5TSS A;  2VQE L;  4OGQ C;  2J7Z A;  3FHW A;  2EYJ A;  4FP5 D;  2PQE A;  1VQA A;  4GNX A;  2EXZ A;  1SN8 A;  1Y8O B;  3F2C A;  4P72 A;  1KC8 C;  4LMQ D;  1CZG A;  3S16 B;  4L6T B;  2EY2 A;  3GTL H;  3CCJ A;  4CKB A;  1LTL A;  3P75 A;  1YJW A;  4GKK L;  1EY5 A;  3D8G A;  3H09 A;  4GNX C;  1F2L A;  5IY0 A;  1G6Z A;  1HH2 P;  4KD4 A;  1STB A;  2K6A A;  3GTP B;  1X9N A;  2AUK A;  3HOX H;  1SJE D;  1CI3 M;  2AWO A;  4FF2 A;  4DR6 Q;  1WOC A;  1PTO H;  2R6G A;  4DR1 Q;  4DXG A;  5J22 A;  2EYM A;  4BY7 B;  1QB5 D;  1QJO A;  4DR4 L;  3U9O A;  2MHV A;  3J80 E;  1HJP A;  2EJF C;  1TS2 A;  1UWV A;  2K75 A;  1MKH A;  1TWG B;  1NCV A;  4DV4 Q;  1WD1 A;  1C7Y A;  2K50 A;  1E2W A;  3W2D A;  4LJZ C;  1NR4 A;  1QIL A;  3OMG A;  3J80 c;  1WJJ A;  1Q7Y C;  2Y0S E;  1SRO A;  4IZ8 A;  4LNQ A;  2EYF A;  3HOX G;  1D8L A;  2XRS D;  1NMF A;  1RIP A;  3DWP A;  4C1N I;  1D5X C;  3J81 i;  1EU4 A;  3IL8 A;  4JC0 A;  3AMU A;  2MJ8 A;  2VUM G;  3QWN A;  1VQ6 A;  2VNU D;  1GOZ A;  3BYY B;  3Q23 A;  1MBY A;  1LT6 D;  3KDF A;  1TII D;  3I4M G;  2AQ1 B;  1PH4 A;  3BZD B;  1BBU A;  3M9B A;  4A3F B;  1AZQ A;  4DPG A;  2JA6 B;  1HZB A;  2JEA I;  2JXM B;  4BBS B;  4IUQ A;  3I4N H;  2E5L Q;  4A3F H;  3F2B A;  3CF5 A;  2YU9 B;  3PIP A;  3F8T A;  4X66 Q;  1AFP A;  1ENC A;  2O2L D;  1BDO A;  2A6H C;  3VYT A;  4A3M G;  5JEA G;  1GM5 A;  3SVM A;  4XQJ A;  3K57 A;  4DUZ L;  4NXM Q;  4CKE A;  1TWA H;  1IKL A;  1U4L A;  2DGY A;  2JA7 H;  1S40 A;  2IWH A;  1WTO A;  4A3B H;  2A5H A;  1X32 A;  1Y8N B;  3H0G G;  4CDD C;  1OTC A;  4A3I G;  4JI2 L;  1II3 A;  4A75 A;  1XNR Q;  2EXD A;  2Q2I A;  1PH7 A;  3BG3 A;  4FF1 A;  4BY7 G;  1TWG H;  2RKS A;  2BE5 D;  3E6Z X;  3HFZ B;  2AQ2 B;  3SR1 A;  4DF7 A;  1HRJ A;  2F0P A;  4OWT B;  1G2T A;  2ASB A;  3PO2 H;  2KCM A;  1MHW C;  3A5Z B;  1WTW A;  1D1I A;  2IT1 A;  1XPU A;  5FK9 C;  1RJT A;  1X3E A;  2OTL A;  2EYH A;  3BS1 A;  2VY3 A;  4L8J A;  2HT1 A;  1TWC B;  1X54 A;  1A3T A;  4LFC L;  3TRE A;  3J81 E;  3HOX B;  4RMF A;  2F52 A;  1Y1V G;  3X3N A;  2PNH A;  1PFS A;  5HY6 A;  2IW3 A;  3Q0A A;  5ELB A;  2ZTE A;  4JOI A;  3R8B A;  4JI7 L;  5E3F A;  3M4Q A;  1YIT A;  1YHB A;  3KFU A;  4DK1 A;  2PZT A;  4A3L H;  1NE3 A;  5DM7 3;  2BA1 A;  3TZU A;  3G71 A;  1XMO L;  2A6E C;  2D5D A;  1F9R A;  4A3B G;  4GKJ L;  1JOR A;  5EKK A;  1I4H A;  4LF8 L;  4GOP C;  4A3F G;  5IWA Q;  2JA6 G;  4BBS G;  1YEZ A;  3JAM L;  3L2P A;  3PUW A;  1CZW A;  3DWA A;  4IOC A;  1SE2 A;  4Q0F A;  1LTT D;  4A3M H;  1YJ9 A;  4LW1 A;  2JSO A;  3CCS A;  2B2U C;  3MHB A;  4A3M B;  1KAW A;  2O5J C;  5LL6 S;  4WFN 3;  3OIQ A;  2Z9H A;  4PQX A;  1O7L A;  3O13 A;  3D4D A;  2VUM H;  2RA4 A;  3GTG B;  4YY3 Q;  4OXP A;  1CQV A;  3OTO L;  5FLM G;  3FEW X;  1WTV A;  3H0G B;  3PIP 3;  1SND A;  4A3I B;  1XPO A;  1Y1W B;  1HR0 L;  3GV3 A;  4DV3 Q;  3VR2 A;  2A6E D;  3SGI A;  4P75 A;  1FNU A;  2K5D A;  4LF6 L;  4UY8 C;  2OT2 A;  4J8Q A;  3S9W A;  2OCE A;  4C56 C;  1EIG A;  3NXW A;  1UE5 A;  2ZXR A;  4DV7 L;  3GTQ H;  2K5Q A;  1JIC A;  3CRL C;  1A6X A;  4G7Z C;  2RDG A;  4A4I A;  4C3H G;  2QIL A;  1EQQ A;  1TWC H;  5GQO A;  1JWU D;  3E5S A;  1Q1E A;  3QOJ A;  1CSQ A;  2AHO B;  1RKN A;  2JK8 A;  4G4K A;  4TQU S;  3EJI A;  4ULL A;  5ELC A;  5IYC G;  1KAB A;  1SXT A;  2WP8 J;  3SK4 A;  3C1E A;  2NVX B;  4KN4 C;  1Y1V B;  4GOP A;  2QEX A;  3S2H B;  1VQO A;  4ZUJ A;  4RG1 A;  1BF4 A;  4DK0 A;  2KEN A;  1PV4 A;  1CA5 A;  4ZLT F;  2XVS A;  3KF8 B;  4IJL A;  3I90 A;  1KHI A;  4A3B B;  4PMB A;  1FYC A;  4OIJ A;  4U68 A;  1SYB A;  2JP1 A;  5FO7 B;  4YHH Q;  1L0Y B;  3LX0 A;  4OWX B;  1TKW B;  2EQS A;  4OO1 H;  5C4X H;  1VMC A;  2VQF L;  1LM0 A;  4RGM A;  1RTO A;  2K1B A;  3B6Y A;  5JJK A;  5BN3 A;  3CCV A;  2VB2 X;  2KED A;  1CSP A;  3OW7 A;  1O7Y A;  3V05 A;  1SFO B;  3M3Y H;  3HOU H;  2QF7 A;  1XNQ Q;  5NUC A;  2E8G A;  2ENB A;  2JA6 H;  1QZH A;  3VR5 A;  3KBG A;  1HNW L;  2NZH A;  5CYU A;  1O7Z A;  5AFW A;  1Y1W G;  4BS9 A;  2CQA A;  2ES2 A;  4FF3 A;  3ICE A;  2IX1 A;  4R9W A;  4JI0 Q;  2O5I C;  4A3G H;  2N88 A;  2HDL A;  1EL0 A;  2E5L L;  1CFM A;  4HCS A;  3SE0 A;  3AYH B;  3PQI A;  4PZ6 A;  4QL5 A;  5IIF A;  1TWH H;  5EAY A;  3GTM H;  2IPK D;  3BDO A;  4AIM A;  1UNS A;  1TS5 A;  2BE5 C;  4C3H B;  4LFC Q;  3I7F A;  4NDX A;  3BZK A;  2RF4 A;  5CV5 A;  1PH6 A;  2C9O A;  3D6C A;  3OYY A;  2A68 D;  3D4W A;  2Q8T A;  1N34 L;  3NWS A;  4A3E B;  3H3V I;  1F77 A;  2NN6 G;  3PUY A;  3NBI A;  3RLF A;  3UDG A;  4G7H C;  4JI2 Q;  4LF9 L;  2RSO A;  1EZ8 A;  1X65 A;  1NJI C;  4F8M A;  4G7O C;  5IT9 c;  4IPD A;  4AH6 A;  4ZYS A;  2LKV A;  1K3B C;  1RD9 D;  2EYL A;  1JB7 A;  2A6H D;  1L1O A;  4CBV A;  1M90 C;  2ZTC A;  1HA6 A;  1JJ2 A;  1B2T A;  3S1R H;  1MSG A;  1VQ7 A;  4YCV A;  1NMG A;  4TSS A;  3FDT A;  2R92 G;  4LFB L;  3J7A V;  3GTL B;  2DY7 A;  4LK1 C;  3SK6 A;  4EGV A;  4X3S A;  2RDH A;  5JEA J;  4RH6 A;  1GJX A;  1TS3 A;  4IO9 A;  3F2U A;  4AQY Q;  2GVB A;  1HR0 Q;  1PH1 A;  1LTA D;  1K28 A;  3URY A;  2F0W A;  1R9T H;  5KGU A;  3K5M A;  1HZC A;  2AUJ D;  1WCM B;  4K0K Q;  4R4C A;  3VA5 A;  4LF8 Q;  1EIH A;  2ZJR A;  4CDE C;  3R93 A;  1UEA B;  4ODG A;  2EYP A;  5KRU A;  3J81 j;  2KOL A;  1H9R A;  4DV7 Q;  4LUO A;  1N36 L;  2OWO A;  4HID A;  4LUZ A;  2PNR C;  3RD4 A;  2NVT B;  5D3D A;  1GUS A;  1F9S A;  2IL8 A;  4JI3 L;  3TSS A;  1PFB A;  3D0F A;  1DOK A;  1HTP A;  2UUA L;  1S4Z A;  3CRK C;  4X6A H;  3CME A;  1JWM D;  3GV6 A;  2NVX H;  2UXD Q;  4A3E G;  1K8O A;  5A2Q L;  5COY A;  5EKL A;  1PH3 A;  4DXF A;  3RN5 A;  1VQC A;  4PNY A;  1X3Q A;  4DNT B;  4H7B A;  4R4I A;  1GO3 E;  2Q2U A;  4H0L C;  3F1Z A;  4HIK A;  1ASZ A;  4GN5 A;  3T1Y L;  3IFT A;  3PUZ A;  2K5N A;  5T1G A;  1C8C A;  2F0N A;  3CCE A;  1D5M C;  4LAA A;  3AEV A;  4L5T A;  1IYV A;  3T1H L;  1LAB A;  1PHJ A;  1U4P A;  1SYE A;  2KHJ A;  2R92 B;  1DZ1 A;  4HCE A;  5M3F B;  3AB9 A;  1R4Q B;  4LFA Q;  3TP5 A;  4JPB W;  1TY0 A;  1XNQ L;  1EU3 A;  2Z6K A;  2R93 H;  4LF4 Q;  3HEJ A;  2B3G A;  1Q1B A;  2N3S A;  5CR3 A;  1EQV A;  2TSS A;  3PMF A;  3OTO Q;  1KD1 C;  3I8Z A;  2EY6 A;  1Q82 C;  1WTP A;  1HZ9 A;  2K7V A;  3A8J E;  3ULJ A;  2CH4 W;  5FJ8 H;  1K9M C;  2QEJ C;  3OWF A;  1WCM G;  4LF5 Q;  3GQB A;  4B3M L;  4L5S A;  4QIW B;  5EJW A;  1EY7 A;  4DGZ A;  1SFO H;  1L1O C;  4DV2 L;  2FHT A;  2LSS A;  2VB3 X;  1P8L A;  1BBW A;  1KDB A;  1PTO C;  3OOC A;  5CV7 A;  5ELD A;  2SDF A;  4YCW A;  1GUW A;  2GVA A;  2B8F A;  5EGT A;  1Z7T A;  4IPH A;  1HNZ L;  1VQL A;  4ZK9 B;  2JA9 A;  2HHH Q;  1N34 Q;  1MGS A;  1IBM Q;  1TR5 A;  1RCV D;  4PMW A;  4DV4 L;  3DXJ C;  4KD3 A;  2VW9 A;  1SNQ A;  3S1N H;  1QNU A;  2ZJQ A;  2Y0S B;  1HNW Q;  4UDU C;  2XGT A;  4HMJ A;  2X6L A;  2PI2 E;  1BO0 A;  5JPM C;  3SDZ A;  4HED A;  1QG7 A;  5IGG A;  4OEL B;  1PH9 A;  4CHT B;  2Z0S A;  4WJW A;  4A93 B;  3A5U A;  4IN3 A;  2F4V Q;  5CV9 A;  3R3O A;  3G48 A;  4KKT A;  1NNX A;  5M3F G;  1CKN B;  4BA1 I;  2CWP A;  2K04 A;  3K5L A;  4X65 Q;  2XRQ D;  2B2T C;  3RMH A;  4JI4 Q;  5E4X A;  2SOB A;  3S1Q H;  1PVO A;  1NUC A;  1B7Y B;  2Z6B A;  3J7Z C;  3PO3 H;  4A3I H;  5C6A A;  5E7N A;  5KEE A;  1VQJ A;  3NBH B;  2QDB A;  1SYG A;  3BJU A;  3GTG H;  4J15 A;  1JOK A;  2NZO A;  4C3J G;  1PMR A;  1UEB A;  3CHB D;  1VQ9 A;  4NXN Q;  3S17 H;  4BBS H;  5M5W B;  3K8A A;  3L7Z C;  4JI5 Q;  1OXU A;  2K05 A;  1JT8 A;  2BA0 A;  1TWF B;  5IGB A;  1C4Q A;  2IY5 B;  5CGK A;  2AKW B;  4LF7 L;  1FL0 A;  4ALP A;  1EIF A;  3D31 A;  2NZ1 D;  1J9O A;  1N32 L;  2LXK A;  1B9N A;  2K5W A;  4GOP B;  4N8F A;  4RWS C;  2Y0S G;  2F3W A;  2F0H A;  5M3M H;  4YWL A;  1QZG A;  1WTR A;  3E0J A;  2NTS A;  1V1O A;  4JW0 A;  3PUX A;  4DUY L;  1HQM C;  3MFG A;  4A93 G;  2H1E A;  5KYL A;  4BY7 H;  3CCL A;  5C0X J;  1ICW A;  2Z6K C;  4FXG C;  3MZ5 A;  1AEX A;  2A1A A;  3OIP A;  1XMO Q;  4EQN A;  2EY5 A;  2JN4 A;  3C2P A;  4XXE A;  3CU7 A;  4UHV A;  5IGD A;  2BH2 A;  2HUG A;  3C46 A;  1WD0 A;  3JAM E;  2HD3 A;  2K32 A;  1X56 A;  2QKI C;  3A0J A;  2B2U A;  2KA7 A;  3T16 A;  1TWF H;  1SEB D;  1HZA A;  1PFM A;  5EPK A;  2HQL A;  2J0T D;  4JI6 L;  1ML0 D;  2J4X A;  3E0E A;  4MTN A;  2XNA C;  4B3M Q;  3S24 A;  3CC7 A;  3T1Y Q;  4NXM L;  2B2V C;  2VQE Q;  5M5W H;  2K28 A;  2B2T A;  1LT4 D;  2KCN A;  4YY3 L;  4C3J B;  2N55 A;  1X3P A;  3RR5 A;  1YI2 A;  4N8X 1;  4UPA A;  3S1M B;  4GZY C;  2B63 H;  2EIF A;  3TBI B;  3Q24 A;  4HIO A;  3I4M H;  3BYT B;  2E2J B;  3D4R A;  3PO3 B;  3DWQ A;  3RZO H;  1XTC D;  1Q8I A;  1CQF A;  3S14 B;  2UXC Q;  2F0I A;  4K6D A;  2SEB D;  3M4Y A;  4BBR H;  4DN4 M;  2UUC Q;  3VR6 A;  4LF4 L;  3S17 B;  1BXT A;  2EDG A;  4UP9 A;  4QJF A;  3I56 A;  4DR3 Q;  3NSW A;  1IL2 A;  2K01 A;  1I94 L;  3ZYY X;  1EUJ A;  4DR4 Q;  4HN7 A;  4IUR A;  4OX9 L;  4IFD H;  1RL2 A;  5FO8 B;  1OXX K;  2L11 A;  1DON A;  1UE6 A;  2PYK A;  3ER0 A;  3I2Z A;  2EOT A;  3U9S A;  1VCI A;  4R4O A;  3HOY G;  3OW2 A;  2L4N A;  4IUP A;  3L9A X;  1HNZ Q;  2HHH L;  5M9O A;  4XIG S;  3CW2 C;  4CDC C;  4XQN A;  1LTG D;  3WWV A;  1SDF A;  2F0E A;  3AFP A;  3I55 A;  5E1F A;  1RTN A;  3M7G A;  1C9O A;  4KK7 A;  4OON A;  1A2U A;  5H1S E;  1I4P A;  1EY9 A;  5COR A;  1ONL A;  4CJ2 C;  5LL6 X;  2K5H A;  5LMN L;  1KDA A;  1SMX A;  3U58 A;  5FOB B;  1STH A;  2JEB I;  2BH8 A;  1GKH A;  4B9W A;  4F7X A;  1QWY A;  4KMU C;  1IBK L;  1B1Z A;  1D7Q A;  5FLX E;  3LNN A;  2RCN A;  3J81 c;  1VQ4 A;  2L0C A;  3UDX A;  1RHP A;  5JEA H;  1EEI D;  4ZKC B;  1K73 C;  1KNE A;  2WB1 E;  3PO3 G;  2HIV A;  1AE2 A;  4FDB A;  3OPO A;  1IHZ A;  1VQI A;  4EX5 A;  2C5C A;  1E1O A;  4TVA B;  3VA7 A;  4XYO A;  1BR9 A;  1Q8K A;  2WB1 G;  2AMC B;  2K03 A;  4K2K A;  3KJO A;  1YNN D;  2M00 A;  3V2T A;  3SK8 A;  3QOL A;  2F0Q A;  5CBA E;  1VQB A;  1YNJ D;  3NTI A;  1B3Q A;  2MO0 A;  1AH9 A;  1CA6 A;  3E9H A;  3UE1 A;  1PYW D;  2F0T A;  5EQ0 A;  2CW0 C;  1I5F A;  1KDC A;  4X64 Q;  1PH5 A;  5DNF A;  4DV0 L;  3K7A H;  1MIU A;  3HOY B;  1DYQ A;  4IUT A;  3N6R A;  2PPB C;  4NB3 A;  1PRT B;  3K81 C;  3HGB A;  3PCO B;  4LF7 Q;  3U4Z A;  1FGB D;  3T56 B;  3HOV H;  1HXY D;  2I07 B;  4GNX B;  2OEO A;  3LGJ A;  1LYL A;  1DJR D;  2ZT9 C;  3NTH A;  4HSV A;  5JOB A;  1N32 Q;  1W3S A;  1VQD A;  3RNU A;  3HOW B;  3H6M A;  4AYB E;  3GTJ B;  4V19 0;  4KHP Q;  1E0B A;  4EQO A;  4KJN A;  1JB3 A;  3KF6 A;  1F9Q A;  1K3R A;  2E2H B;  1B4O A;  1U5K A;  4F88 A;  2F03 A;  1I3Q H;  1EOT A;  1CTM A;  2YYZ A;  3MFY A;  3NUC A;  4MNO A;  4K0K L;  2A68 C;  1GUO A;  2Q2H A;  3K0Y A;  5C5M A;  1XMQ L;  3S15 H;  1VQ5 A;  3WDN A;  5KNC A;  3A8I E;  1X3G A;  1A63 A;  4FXK C;  2MNA A;  2WB1 B;  3K59 A;  5M5Y H;  1IXR A;  1Q86 C;  3MTS A;  2K33 A;  2R61 A;  3ND8 A;  2RDF A;  1WYD A;  1F9P A;  3T13 A;  3D3R A;  3CQZ H;  2FFK B;  5FJ8 G;  5FLX c;  5ELN A;  3NWT A;  1F2M A;  4P73 A;  2H4O A;  3FPU B;  4B3S L;  3HOZ H;  4JYA Q;  1STY A;  5KYI A;  2WIN B;  5BR8 L;  3A8K E;  2PO4 A;  2CWA A;  2RHS B;  3EA6 A;  3KLW A;  4B3R L;  1ZEQ X;  1L0X B;  4ME3 A;  1I4Q A;  2WKD A;  5JVG 3;  1CHP D;  1NAP A;  2DJF C;  2EVB A;  4OO1 G;  1KRS A;  4R4Q A;  1EFW A;  1KRT A;  1FNW A;  3SEB A;  1YNJ C;  5IYB G;  3S1R B;  2UU9 Q;  4A3J H;  2KEE A;  1KXL A;  1PRT C;  4P74 A;  1QUQ A;  1DCZ A;  3PUV A;  2CCZ A;  1V9P A;  4ZUI A;  4QQB X;  5LMN Q;  1X3F A;  1QUQ B;  3HOW G;  5KIX A;  1HA5 A;  3F2D A;  3HOY H;  3GTM B;  1PDQ A;  4ABN A;  3K7A B;  2HQE A;  4UAI A;  3A7L A;  3OSO A;  1V8Q A;  2PW7 A;  5C0X I;  2JE6 I;  1V1P A;  5I2Y A;  4ZAI A;  3I4L A;  4IFD G;  2DN8 A;  2A73 B;  4L5R C;  3M7N A;  1SBB B;  1Z9F A;  4QUC A;  4JI1 Q;  4DR2 Q;  1L0W A;  1PLF A;  3MXU A;  3VYS A;  2NUC A;  1GHK A;  4I7Z C;  1WTH A;  4HSP A;  2ZXO A;  5EPJ A;  1PH2 A;  2K14 A;  3H3V C;  2F0L A;  4KKU A;  1K8G A;  4FNF A;  2G5D A;  4XT1 B;  1EQT A;  1H9J A;  4XQQ A;  1WVL A;  3CPW A;  3L3O C;  2UXB L;  3M3Y B;  1N33 Q;  1S5E D;  1IBK Q;  1STG A;  3ONA B;  3MA2 B;  2F4I A;  3RLO A;  1O80 A;  3C3L A;  1XXG A;  3MXN B;  3J80 i;  5FO9 B;  2JYO A;  3KK7 A;  1KIX A;  2IJ0 A;  4EVO A;  2A69 D;  1HUM A;  4KY5 A;  3N52 A;  2CHB D;  2NWG A;  2UUB L;  4QIW E;  2E2H H;  5K36 H;  1PYB A;  2ICI A;  1TT2 A;  5C3X A;  2PW5 A;  4LF9 Q;  4KKS A;  4WJ4 A;  4XYQ A;  3W1B A;  1D6E C;  4BWG B;  3KF8 A;  3IKJ A;  2F0S A;  3S2H H;  3HOW H;  1J8I A;  1WI5 A;  2LFN A;  2BOS A;  4GKK Q;  3TP8 A;  1Q12 A;  1Y1V H;  1HPC A;  1BUV T;  4JBJ A;  1MJC A;  1SYD A;  1IYJ B;  2JA8 H;  5D14 A;  3M4O H;  5G3L D;  3NE5 B;  1BCP D;  2HCC A;  5CV6 A;  5CV8 A;  4XTC S;  4C2M B;  1UE1 A;  1EQR A;  2KVM A;  3BZC A;  1EFI D;  1EWI A;  3IAY A;  4CDF C;  2KHI A;  3H0G H;  4POG A;  4IFD I;  1AW7 A;  2Q2T A;  1ZKO A;  2YTV A;  3JC6 6;  3HS0 C;  3ULP A;  2PCF B;  3T4A C;  4X66 L;  3TN2 A;  4R1J A;  2F0V A;  1CHQ D;  4GN4 B;  1B8A A;  3TME A;  3QO2 A;  3QG1 A;  4DUZ Q;  4B3S Q;  2DNC A;  2DJG C;  3CCQ A;  4A3D H;  4JYA L;  2V1C C;  1KL9 A;  2L12 A;  3NHH A;  1MJE A;  1PZI D;  3K6O A;  3R2T A;  5BN4 A;  4BY1 B;  1YHA A;  4BY1 H;  4OWW B;  1NSN S;  1SMY C;  3GTK B;  3X3M A;  2RCF A;  2JA5 H;  2B8G A;  3STB D;  2EYO A;  4V0B A;  2XWJ B;  1EY6 A;  1XYI A;  1SNO A;  2B2W A;  2F0K A;  2FXQ A;  4OEM B;  1FJG Q;  4WJ3 M;  3TRZ A;  4DAY A;  4FXD A;  4RHS A;  3G7L A;  1KNA A;  1OXS C;  4HAE A;  3EFX D;  5IE8 A;  3E9I A;  4ILW A;  3ERO A;  2CH4 A;  1BCP C;  1VDZ A;  4JG2 A;  3CCU A;  1BNZ A;  4C2M H;  4XT3 B;  4JBW A;  1I6H B;  2CKZ B;  4KI0 A;  3CP0 A;  3G4S A;  1YIJ A;  3PO2 B;  1B9M A;  1E24 A;  2XIW A;  3H94 A;  2NVY B;  3MXN A;  2PMZ E;  4WRD A;  3NBH A;  4JI7 Q;  4A76 A;  5C4J H;  5C3W A;  3HKZ E;  3G6E A;  2CVR A;  3FKI H;  4ZRZ A;  1SR3 A;  2B2V A;  1YJN A;  4K6L A;  2ZM6 L;  2F0G A;  2I5L X;  4L63 B;  4RCO A;  4YWK A;  5C0X H;  4HJ8 A;  1Y69 U;  3NEL A;  2K52 A;  3QB3 A;  4QMG A;  2KUM A;  3KUP A;  4GLX A;  4P2C B;  4Y52 H;  4K5V A;  2F0U A;  4QGU A;  2RSN A;  2PQA A;  3PV0 A;  2KCT A;  2PZU A;  5IYB H;  1JOO A;  1E3P A;  4PG3 A;  4CJ0 B;  2VS1 A;  3T53 B;  2LXJ A;  4ID6 A;  4KV6 A;  1A3V A;  4EQ5 A;  2UUC L;  4P71 A;  4R4T A;  2I0Q A;  2R7Z H;  2FJ2 A;  1JQY D;  1ASY A;  4BY1 G;  3AQQ A;  4AYB G;  1U9R A;  1TWA B;  1SLJ A;  2KCC A;  4K2L A;  2IHE A;  2JQO A;  3I73 A;  1TQO A;  2OTJ A;  1U4R A;  4DAV A;  3S1Q B;  4DNR B;  4DV1 L;  1PTO D;  5C4H A;  2N78 A;  3I4N B;  3C1F A;  2WV6 D;  2XN9 C;  2WKC A;  4DR7 Q;  1MI2 A;  1VS0 A;  4QB4 A;  1FVI A;  1I6V C;  4JBK A;  1OXV A;  3J7Y W;  1B3A A;  1LTI D;  4IUN A;  3EBE A;  1LLR D;  3TQY A;  4QF4 A;  4A3C G;  1KAA A;  4RHR A;  3PO2 G;  2EZV A;  4FYD A;  1ET9 A;  3QR8 A;  1IL8 A;  3JAM c;  1GHJ A;  1MSH A;  1PXU A;  1YHQ A;  2D62 A;  4ZQ3 A;  4IAL A;  5GAG C;  1ZYR D;  1QNK A;  4JCV E;  1S72 A;  4JI1 L;  1EYA A;  3RZD B;  4POF A;  1N8R C;  1VMP A;  2C35 B;  3RN2 A;  2E75 C;  3L0O A;  2Q8I B;  1EEF D;  5AJ3 Q;  1CM9 A;  2R3Z A;  3A7A B;  4HR7 B;  2DY8 A;  3J81 L;  5HGQ A;  5IWA L;  2X69 A;  2F1M A;  1C48 A;  2M9V A;  4RA8 A;  1EYG A;  1PTO B;  1I6H H;  2RVL A;  1VQE A;  3I70 A;  1PRT F;  3GTP H;  3A54 A;  2F0M A;  1B53 A;  1EWC A;  5ELF A;  1FD7 D;  1ESF A;  3NTK A;  1Q3L A;  4UP8 A;  3OMC A;  4AYB B;  2ICE C;  4DV6 Q;  4RKL A;  3BVM A;  5EBC A;  4KLK A;  2F3I A;  4DR3 L;  1SE3 A;  5EKI A;  2B2Y C;  2IX3 A;  3OWE B;  1RDP D;  1GUN A;  3I72 A;  4DV3 L;  4JV5 L;  4OX9 Q;  3GTK H;  1A8V A;  1JJC B;  4MN3 A;  4N9P A;  2RHQ B;  1FNV A;  3K5O A;  3I4N G;  3S15 B;  1TS4 A;  1WTQ A;  4MHE A;  4BXX G;  2M2L A;  3NEN A;  3NEM A;  4A3K H;  1QOH A;  2EJG C;  1VQ8 A;  2H5X A;  4M8A A;  1ROD A;  4B08 A;  5JJL A;  2QCP X;  1I3Q B;  1HCZ A;  1CKN A;  2NYZ D;  4JK1 C;  3KLS X;  1HFN A;  1VF7 A;  4X3K A;  2RBM A;  2KJX A;  2N49 A;  5IP9 G;  4HJA A;  4KTA A;  4FF4 A;  3TS2 A;  3MWY W;  1G29 1;  3HP3 A;  3J7A F;  2L15 A;  1EWH A;  1J5E L;  3MEH A;  4OHJ A;  1VQN A;  4TKO B;  1QE6 A;  1BCP B;  1X6O A;  2F0F A;  3M4O B;  5D3I B;  1STN A;  1ENA A;  2WAQ E;  4DAM A;  2JJQ A;  2YV5 A;  4KHV A;  3DEP A;  3FPP A;  5LMU L;  1Y14 B;  4Y7N H;  1SJH D;  4IOA A;  2FMM A;  3AFQ A;  1T9H A;  3WOF A;  4HJ5 A;  2NVT H;  4C3I B;  4A3C H;  1L1O B;  1PRT D;  4MZ9 A;  2NVQ B;  2F3V A;  2QW7 A;  4YCU A;  4MIU A;  4MTK A;  4AQY L;  4GS3 A;  4Q5V A;  3K0X A;  1R4P B;  1S5D D;  1P16 A;  2MO1 A;  4EQP A;  4X3T A;  1VQF A;  4JBM A;  1ILP A;  2E74 C;  1AE3 A;  5IP9 H;  1PA6 A;  1K8A C;  2ATW A;  1XWE A;  4LWC A;  3P1H A;  1VQM A;  1SE8 A;  4JI0 L;  3GTO B;  1IW7 C;  3HOZ G;  2NBF A;  2A19 A;  2F0O A;  1EY4 A;  4DU9 A;  1GUG A;  4LFB Q;  3MC0 B;  2B63 G;  5C4X G;  1UAP A;  1HHV A;  2UUA Q;  5F2D A;  1N9W A;  1GD7 A;  1LUZ A;  1H9S B;  1DXM A;  5I9O A;  2R7F A;  1AP0 A;  1IBL Q;  2WAC A;  1HNX L;  4HMI A;  1YNX A;  5J39 A;  1YBY A;  5HGT A;  1SYF A;  4KHP L;  3K58 A;  5AJ3 L;  2NVQ H;  1JC7 A;  3KF6 B;  4HTH A;  2KBN A;  5C0X G;  3RZD H;  4HJ7 A;  4RGN A;  5I4D A;  4Y7N B;  2QA4 A;  1G91 A;  3UDI A;  1UUP A;  4C3H H;  3BVZ A;  4JI3 Q;  1K0S A;  3KYH C;  1V1Q A;  3ITP A;  3SXH A;  4C3I G;  3HOV G;  5ISR A;  3J7A 5;  1I4R A;  3KLS A;  4A3G B;  4DR6 L;  2PI2 A;  3SHL A;  5IOD A;  4X62 Q;  3VR3 A;  4PZ8 A;  1JJG A;  1CKO A;  1V1P B;  2VL6 A;  1L2F A;  2MUY A;  4R8I A;  3BVG A;  4JV5 Q;  2Z4H A;  5L37 A;  1H9S A;  2MQH A;  5FLM H;  4N9T A;  2XTI A;  3CCR A;  3GO5 A;  3CC2 A;  2MP1 A;  2CFM A;  3KLR A;  4I65 A;  1SNP A;  4JI8 L;  1IKM A;  1I4G A;  4DK3 C;  2RQX A;  2GA4 B;  2SNM A;  3H91 A;  3CXC A;  4DR7 L;  3S14 H;  4DAP A;  2L1B A;  3HOZ B;  1K83 H;  3RZO B;  1J6Q A;  1WCM H;  1DOL A;  4YWM A;  1JMC A;  2JA5 G;  1NY4 A;  4A3K B;  1D5Z C;  1R9T B;  1BKB A;  2B63 B;  1IBM L;  5C4X B;  1YNN C;  3ND9 A;  4HIM A;  3S2D H;  4NMZ A;  3R2I A;  4IPC A;  3NP8 A;  3UE0 A;  1VF5 C;  1PYS B;  3MVV A;  2Z4I A;  2AQ3 B;  2LMC B;  4GLV B;  4H44 C;  4DV6 L;  1H9M A;  5ELO A;  1A15 A;  1TVX A;  1EZ6 A;  1HR0 W;  3PF5 A;  1U0L A;  4IPG A;  2Z1C A;  4M1U B;  4FO2 A;  3TDQ A;  5CMD A;  2R7Z G;  1JOQ A;  3FMC A;  3LWE A;  2G9H D;  4DV2 Q;  2IX0 A;  5KNB A;  5IP7 H;  2NB0 A;  3I4O A;  5LMU Q;  4IFD J;  1A62 A;  4K5X A;  2NTT A;  4HJ9 A;  3ZJY C;  3T1H Q;  4FVM A;  3FKI B;  2JA8 G;  1VQG A;  1LTR D;  1ET6 A;  2WFW A;  4R8N A;  3GTQ B;  1T5E A;  1EYD A;  3GP7 A;  5DLQ E;  1K8M A;  4JI4 L;  1T5X D;  3OHX C;  4Z9C B;  1DGS A;  3CPF A;  3HOV B;  1JWS D;  2I46 A;  5D65 A;  3TP6 A;  4A3G G;  5T1I A;  1NBW A;  2D9U A;  2QGQ A;  4GLA C;  1EY8 A;  4K14 A;  4CGY B;  1HFG A;  5BN5 A;  1J5E Q;  3M4P A;  2G9D A;  3IRB A;  3ERQ A;  5K36 G;  1STA A;  2O4X A;  1ENF A;  5GAE C;  3UDF A;  3GD7 A;  4LF5 L;  2PQA B;  2X6G A;  3D6W A;  4ME5 A;  2B2W C;  1E2V A;  1QVF A;  5I2X A;  2VZA A;  4IJH A;  4RCN A;  4I7A A;  4S3S A;  1G6P A;  5C44 H;  1KTK A;  2FMC A;  2OQK A;  2LY7 A;  1QCB D;  2IHF A;  3J80 L;  3BDL A;  4DAY B;  2JA5 B;  4A3K G;  3Q22 A;  3QJY A;  1HNX Q;  1D2B A;  4BXX H;  3HKZ B;  2E2I H;  2FIN B;  5IT9 E;  1VQK A;  4DKA C;  3HRZ C;  4X65 L;  2B29 A;  1HTL D;  4DFA A;  3TEH B;  2OF1 A;  4BA2 I;  4A3D B;  1SSO A;  1VQP A;  5I6Y A;  2TMP A;  5C44 G;  3H15 A;  4NP5 A;  1U4M A;  4CJ1 B;  2R93 G;  3JAM i;  2R7Z B;  3M85 A;  1PTO F;  3CMA A;  4RFB A;  2N8N A;  1LT3 D;  1LTS D;  1V43 A;  2D0O A;  2F4V L;  1CKM A;  3KOJ A;  4DR5 Q;  3P7J A;  4IQZ A;  3FKI G;  1EY0 A;  1JE4 A;  1I50 H;  4DA2 A;  5K5P A;  1IBL L;  2JA8 B;  4A93 H;  2A69 C;  4PZ7 A;  1E7Z A;  1OXT A;  4X3U A;  4O42 A;  2ZTD A;  1PFN A;  1W2B A;  3Q6S A;  4ZCK A;  3KDF B;  3KJP A;  2VXW A;  2XWB B;  1GXD C;  1SYC A;  2HIX A;  4JI6 Q;  1Q90 A;  4DV5 L;  3G6J B;  2BDO A;  3S1N B;  2V4D A;  5C4J B;  1C0A A;  1STE A;  3HZX A;  2NVY H;  1SAP A;  1I50 B;  1G51 A;  2JA7 B;  4NXN L;  1QVG A;  1H95 A;  1A2T A;  2A74 C;  4WOR A;  1Z6H A;  3DM1 A;  4OO1 I;  5M3M G;  1XPR A;  1QVC A;  5C4Z A;  1XTD A;  3EIV A;  1X55 A;  2I5M X;  3EN2 A;  3U50 C;  1TY2 A;  2UXC L;  3IFD A;  3K5N A;  3DHQ A;  4JI5 L;  1FJG L;  2YTX A;  3FVQ A;  4KY7 A;  2E76 C;  4KHZ A;  3HKZ G;  3T51 B;  1Q46 A;  1UE7 A;  2E2I B;  1ZXT A;  4BBR B;  2EE1 A;  2F0J A;  4RAU C;  3GDE A;  4U67 3;  3EVQ A;  4A3D G;  4PV1 C;  1EYC A;  5CBE E;  3FP9 A;  1VQH A;  2UUB Q;  3TZD A;  5C44 B;  3LWU A;  4CKC A;  1HQR D;  4GKJ Q;  4H02 A;  2R93 B;  4C3J H;  3A74 A;  2EY1 A;  4JVZ A;  1ESR A;  1SRU A;  1E22 A;  1BOS A;  1I4X A;  5EPL A;  2CQO A;  4B3T Q;  2R92 H;  2Z8L A;  3DM3 A;  4QUF A;  2Q8R E;  1Z47 A;  1S3O A;  1CK1 A;  1ICF B;  4K5W A;  2DNE A;  3U4V A;  2MGS A;  3ERS X;  3NQI A;  1WTX A;  3RUZ A;  1KLG D;  4G57 A;  5IOC A;  5DEH A;  1LTB D;  2OQ0 A;  4UP7 A;  2KEC A;  1PZJ D;  4RGT A;  1AN8 A;  1DOM A;  1PH8 A;  5IYC H;  4X62 L;  4ZKB B;  4OIK A;  1LAC A;  3VDY A;  1I94 Q;  4IUU A;  3NK9 A;  1LV9 A;  2K4K A;  2XSC A;  2WII B;  4RKB A;  1S5F D;  1NR2 A;  2NN6 H;  1DM0 B;  1M1K C;  1LT5 D;  4J1M A;  4DV0 Q;  1MD2 D;  1KQS A;  2UXD L;  3BDC A;  1GVP A;  1D1K A;  2QDL A;  3A56 A;  3VYU A;  5IGF A;  2JA7 G;  2MFI A;  4KJO A;  3SK5 A;  5M3M B;  1B50 A;  1A3U A;  3STB C;  1BCP F;  5IGE A;  4C1N K;  2CW0 D;  3MAQ A;  3S16 H;  2D0P A;  2HDM A;  1M8A A;  3DMU A;  1ILQ A;  2BDN A;  1WFQ A;  5E4W C;  3I3C A;  1BBX C;  3S2D B;  2EPB A;  4BBR G;  3PSI A;  3EQL C;  4JOI C;  2A8V A;  1Q81 C;  2ID0 A;  2P5Z X;  3AU7 A;  1TXY A;  5JAV A;  1K83 B;  2ALY B;  3CAM A;  2YU9 H;  1YZ6 A;  5EBD A;  4E6I A;  5DAU A;  4L5Q A;  2WAQ G;  5ELE A;  4YHH L;  5GAD C;  5JVH 3;  4NKL A;  4RGO S;  1K0R A;  2VQF Q;  1XMQ Q;  5CV4 A;  2HCI A;  4PMC A;  5I9P A;  3PF4 A;  2B39 A;  3CD6 A;  4APV A;  1CT1 D;  2OXP A;  3HKS A;  4QY7 A;  2ZM6 Q;  3A55 A;  1IZ6 A;  2LS0 1;  1BVS A;  1JR0 D;  3HG9 A;  3K7U C;  2K5V A;  4NPS A;  1N36 Q;  1SE4 A;  2L5T A;  5IGC A;  1G8Z D;  1B70 B;  3CC4 A;  4A3E H;  5GAH C;  2E2D C;  4KN7 C;  5LHY 1;  4X64 L;  5FLX L;  2B2Y A;  1XNR L;  1H9K A;  3MXG A;  5DM6 3;  1TWH B;  2UU9 L;  4DR1 L;  1F2Z A;  1TU2 B;  2NN6 I;  3UI2 A;  5IP7 G;  4O0A A;  1S5C D;  5JJZ A;  5IYD G;  4A3J B;  1EIY B;  3VYR A;  4H13 C;  5CC4 A;  3BU2 A;  2YTY A;  3QIA A;  5LMN W;  4IUV A;  1W6J A;  4DV1 Q;  2PZW A;  1SNM A;  5IT9 L;  1OO9 B;  3NPP A;  4K8I A;  1CUK A;  3HOU B;  4DNI A;  5C3E B;  2MPM A;  3GTO H;  5C3E H;  4DK6 C;  2KHS A;  3W3A A;  5KND A;  4B3T L;  5FKA C;  2WAQ B;  4J6H A;  1DD2 A;  3CQZ B;  4OL7 A;  5M5X H;  3RLN A;  1S5B D;  2R7D A;  4DR5 L;  4XDX A;  3WOE A;  5M5Y B;  3P20 A;  1ZYR C;  1JCK B;  2ZXP A;  1SNC A;  2BCO A;  3DLL A;  5J3B A;  2PMZ B;  2KQ3 A;  4C3I H;  4A3L G;  3MEF A;  1YVC A;  4NW2 A;  5M3F H;  5G3L F;  3VR4 A;  4DV5 Q;  4TRD A;  1LO5 D;  4QCL A;  2SNS A;  3MXP A;  5BR8 Q;  1SMY D;  3W1G A;  5IYD H;  1BQQ T;  1EOV A;  2DUD A;  3ULL A;  3NQT A;  2D2C C;  3K80 C;  3W5O A;  1JE5 A;  2I5H A;  3KBX A;  2ZJP A;  1FR3 A;  5A35 A;  1FGU A;  1XJV A;  4LUV A;  1RF2 D;  1F2Y A;  1IW7 D;  3GTJ H;  1E1T A;  3CKI B;  3PIO A;  3DEO A;  3V96 A;  1IYU A;  1XX8 A;  1E2Z A;  1O7I A;  3E3X A;  3FRP B;  1AZP A;  4JI8 Q;  4K8J A;  3CCM A;  3H3V H;  4O2D A;  1KLU D;  2GN5 A;  2EJM A;  2L9H A;  1NTG A;  4A3J G;  4DUY Q;  1G2S A;  5C5L A;  2F0D A;  5GRO A;  4O1N A;  1Y1W H;  1M4V A;  5HUR A;  1W6K A;  1Y8P B;  4KY6 A;  3DUZ A;  1GUT A;  2UXB Q;  5A2Q E;  3TP7 A;  1N33 L;  2L55 A;  3TS0 A; 
#chains in the Genus database with same CATH homology
 1XNQ L;  2Z6K A;  2R93 H;  3CC2 A;  4GN3 B;  2CFM A;  3HOU G;  4LF4 Q;  2B3G A;  1Q1B A;  4JI8 L;  1PH2 A;  2N3S A;  5C3E G;  4B3R Q;  2K14 A;  4DK3 C;  2AWN A;  3OTO Q;  3CXC A;  4DR7 L;  5JJI A;  3S14 H;  1KD1 C;  1K8G A;  1K83 H;  1J6Q A;  1Q82 C;  1WCM H;  1HZ9 A;  2E2J H;  4YWM A;  1JMC A;  3Q8D A;  3ULJ A;  2JA5 G;  1NY4 A;  1A0I A;  5FJ8 H;  1K9M C;  3CPW A;  1BKB A;  4DR2 L;  3PGZ A;  1IBM L;  1WCM G;  4HIM A;  4LFA L;  4LF5 Q;  3S2D H;  4B3M L;  4L5S A;  3S1M H;  2UXB L;  4LF6 Q;  1SFO H;  1L1O C;  4DV2 L;  2VQE L;  1IBK Q;  1N33 Q;  4IPC A;  3FHW A;  2LSS A;  3UE0 A;  3RLO A;  1VQA A;  1P8L A;  1PYS B;  1SN8 A;  1BBW A;  4DV6 L;  4GLV B;  4P72 A;  3F2C A;  4GNX A;  1KC8 C;  3PO3 G;  5ELO A;  3MXN B;  4YCW A;  3J80 i;  2GVA A;  3GTL H;  4IPH A;  1HNZ L;  3CCJ A;  3PF5 A;  1LTL A;  2JA9 A;  1KIX A;  1HR0 W;  1YJW A;  1U0L A;  2HHH Q;  4GKK L;  4IPG A;  1N34 Q;  4GNX C;  1IBM Q;  5IY0 A;  2UUB L;  2R7Z G;  1HH2 P;  4QIW E;  4PMW A;  2E2H H;  4DV4 L;  4DV2 Q;  2IX0 A;  1PYB A;  4LF9 Q;  5IP7 H;  2VW9 A;  1X9N A;  3I4O A;  5LMU Q;  4IFD J;  4WJ4 A;  1A62 A;  3HOX H;  3S1N H;  2ZJQ A;  2AWO A;  3W1B A;  1HNW Q;  4DR6 Q;  1WOC A;  2XGT A;  4HJ9 A;  3ZJY C;  3T1H Q;  2PI2 E;  2R6G A;  4DR1 Q;  3S2H H;  3HOW H;  1WI5 A;  2JA8 G;  4GKK Q;  1VQG A;  1PH9 A;  4DR4 L;  1Q12 A;  1Y1V H;  2WFW A;  1HJP A;  1UWV A;  2Z0S A;  1MJC A;  2K75 A;  1MKH A;  4JBJ A;  5DLQ E;  4JI4 L;  1IYJ B;  1DGS A;  3CPF A;  3A5U A;  4DV4 Q;  1C7Y A;  2JA8 H;  3M4O H;  2K50 A;  2F4V Q;  4A3G G;  3G48 A;  4XTC S;  1WJJ A;  1NBW A;  2Y0S E;  1SRO A;  3J80 c;  1Q7Y C;  4LNQ A;  2QGQ A;  1UE1 A;  4GLA C;  1EQR A;  1J5E Q;  3HOX G;  3BZC A;  1D8L A;  3M4P A;  1EWI A;  2KHI A;  3IRB A;  3H0G H;  1NMF A;  5M3F G;  5K36 G;  1CKN B;  1RIP A;  4BA1 I;  2CWP A;  5GAE C;  3J81 i;  3UDF A;  4POG A;  4IFD I;  3GD7 A;  4X65 Q;  2PQA B;  4LF5 L;  4JC0 A;  1QVF A;  2VUM G;  2Q2T A;  4JI4 Q;  2YTV A;  2VZA A;  3JC6 6;  3ULP A;  1VQ6 A;  4IJH A;  4X66 L;  4R1J A;  1G6P A;  2VNU D;  5C44 H;  3S1Q H;  1PVO A;  1B7Y B;  4GN4 B;  1B8A A;  2OQK A;  3J7Z C;  3KDF A;  4A3I H;  4DUZ Q;  3PO3 H;  4A3D H;  2IHF A;  4B3S Q;  3CCQ A;  5E7N A;  3I4M G;  4JYA L;  4DAY B;  1VQJ A;  2V1C C;  1KL9 A;  3NBH B;  1PH4 A;  4A3K G;  1BBU A;  3BJU A;  3M9B A;  1MJE A;  1HNX Q;  3GTG H;  4BXX H;  4DPG A;  4J15 A;  1HZB A;  2NZO A;  2E2I H;  2JEA I;  1UEB A;  3S17 H;  1VQ9 A;  1YHA A;  4DKA C;  1VQK A;  4BY1 H;  4NXN Q;  4OWW B;  4X65 L;  3I4N H;  2E5L Q;  2B29 A;  3F2B A;  4A3F H;  3CF5 A;  3PIP A;  3F8T A;  2JA5 H;  4X66 Q;  3STB D;  3K8A A;  3L7Z C;  3TEH B;  4BA2 I;  1KXL A;  1GM5 A;  1VQP A;  4A3M G;  5JEA G;  4JI5 Q;  1OXU A;  2FXQ A;  4DUZ L;  4NXM Q;  1FJG Q;  5C44 G;  3H15 A;  1TWA H;  1JT8 A;  2BA0 A;  4WJ3 M;  3TRZ A;  2DGY A;  2R93 G;  2IY5 B;  2AKW B;  3JAM i;  2JA7 H;  3M85 A;  3CMA A;  1S40 A;  4LF7 L;  1FL0 A;  4ALP A;  2N8N A;  1OXS C;  4A3B H;  1EIF A;  3D31 A;  3H0G G;  1N32 L;  1OTC A;  4A3I G;  4JI2 L;  2D0O A;  1V43 A;  2LXK A;  3E9I A;  5IE8 A;  4GOP B;  2F4V L;  4A75 A;  5IYD H;  2Y0S G;  4JG2 A;  3CCU A;  1CKM A;  2EXD A;  1XNR Q;  3KOJ A;  4C2M H;  4DR5 Q;  2Q2I A;  4JBW A;  5M3M H;  1PH7 A;  2CKZ B;  4KI0 A;  3CP0 A;  3FKI G;  3G4S A;  1IBL L;  1I50 H;  4YWL A;  1TWG H;  1YIJ A;  4A93 H;  4BY7 G;  4PZ7 A;  1E7Z A;  1OXT A;  1E24 A;  3HFZ B;  2ZTD A;  2PMZ E;  3PUX A;  4DUY L;  4OWT B;  4JI7 Q;  4A76 A;  1W2B A;  5C4J H;  2ASB A;  3PO2 H;  2KCM A;  4A93 G;  3A5Z B;  3HKZ E;  3G6E A;  4BY7 H;  3CCL A;  2IT1 A;  3FKI H;  3KDF B;  1XPU A;  1SR3 A;  5C0X J;  3KJP A;  1YJN A;  2HIX A;  1X3E A;  2Z6K C;  4JI6 Q;  2OTL A;  2ZM6 L;  4DV5 L;  2I5L X;  2VY3 A;  4YWK A;  1QZG A;  2A1A A;  4HJ8 A;  2HT1 A;  1X54 A;  2K52 A;  3NEL A;  4LFC L;  3TRE A;  4GLX A;  1XMO Q;  4Y52 H;  4QGU A;  2PQA A;  1C0A A;  4RMF A;  3PV0 A;  2KCT A;  2NVY H;  2BH2 A;  2F52 A;  1Y1V G;  2PNH A;  1PFS A;  5IYB H;  5HY6 A;  1X56 A;  1G51 A;  3A0J A;  4NXN L;  2ZTE A;  1QVG A;  4JOI A;  1H95 A;  1E3P A;  4PG3 A;  4JI7 L;  4OO1 I;  1TWF H;  5M3M G;  2VS1 A;  3M4Q A;  1YIT A;  1YHB A;  1XPR A;  1HZA A;  1QVC A;  3KFU A;  2LXJ A;  3EIV A;  1XTD A;  1X55 A;  2HQL A;  2I5M X;  4JI6 L;  4MTN A;  1NE3 A;  3E0E A;  3EN2 A;  2BA1 A;  3U50 C;  4A3L H;  2UXC L;  3G71 A;  4EQ5 A;  4B3M Q;  4JI5 L;  3S24 A;  1XMO L;  3CC7 A;  3T1Y Q;  4NXM L;  1FJG L;  2VQE Q;  2UUC L;  5M5W H;  4A3B G;  4P71 A;  2YTX A;  4R4T A;  4GKJ L;  4LF8 L;  2I0Q A;  4GOP C;  4A3F G;  5IWA Q;  2R7Z H;  2JA6 G;  4KHZ A;  4YY3 L;  3HKZ G;  1ASY A;  4BY1 G;  3RR5 A;  1Q46 A;  4UPA A;  1YI2 A;  4BBS G;  1UE7 A;  3AQQ A;  1YEZ A;  4AYB G;  3L2P A;  5JJK A;  3PUW A;  4IOC A;  1SLJ A;  2B63 H;  2EIF A;  2IHE A;  4A3M H;  2JQO A;  3GDE A;  4HIO A;  1YJ9 A;  4LW1 A;  3I4M H;  4A3D G;  2OTJ A;  3RZO H;  3CCS A;  3FP9 A;  1VQH A;  2UUB Q;  1KAW A;  2UXC Q;  4DV1 L;  4BBR H;  2N78 A;  2UUC Q;  4GKJ Q;  4H02 A;  4LF4 L;  2VUM H;  4C3J H;  3A74 A;  4YY3 Q;  4OXP A;  3OTO L;  5FLM G;  1VS0 A;  4DR7 Q;  4UP9 A;  4QJF A;  3I56 A;  1SRU A;  4DR3 Q;  1E22 A;  1FVI A;  1IL2 A;  1I94 L;  4JBK A;  1OXV A;  1XPO A;  2CQO A;  1HR0 L;  4B3T Q;  2R92 H;  4DV3 Q;  1EUJ A;  3DM3 A;  4DR4 Q;  4OX9 L;  1Z47 A;  1RL2 A;  4P75 A;  3SGI A;  1S3O A;  3EBE A;  1OXX K;  4LF6 L;  4UY8 C;  3TQY A;  3U4V A;  1UE6 A;  2OCE A;  3ERS X;  4A3C G;  3PO2 G;  3ER0 A;  3I2Z A;  1UE5 A;  2OQ0 A;  4UP7 A;  4DV7 L;  3GTQ H;  1VCI A;  4R4O A;  3HOY G;  3JAM c;  3OW2 A;  4A4I A;  1PH8 A;  5IYC H;  1YHQ A;  4X62 L;  1TWC H;  2D62 A;  5GQO A;  3VDY A;  1EQQ A;  5GAG C;  1HNZ Q;  1I94 Q;  2HHH L;  1Q1E A;  4XIG S;  4JCV E;  1S72 A;  3CW2 C;  4JI1 L;  2K4K A;  1CSQ A;  2AHO B;  2JK8 A;  4POF A;  3WWV A;  1N8R C;  4TQU S;  2C35 B;  3RN2 A;  5IYC G;  1M1K C;  3AFP A;  3L0O A;  2WP8 J;  5AJ3 Q;  3I55 A;  4DV0 Q;  1KQS A;  2UXD L;  5HGQ A;  5IWA L;  1GVP A;  4GOP A;  2QEX A;  2JA7 G;  1C9O A;  4OON A;  1VQO A;  2MFI A;  5H1S E;  4RG1 A;  1I6H H;  1EYG A;  2K5H A;  2KEN A;  5LMN L;  1VQE A;  1SMX A;  3STB C;  3U58 A;  1PV4 A;  2JEB I;  2BH8 A;  1GKH A;  3S16 H;  3GTP H;  3KF8 B;  4IJL A;  2D0P A;  1KHI A;  1IBK L;  1WFQ A;  1D7Q A;  4UP8 A;  4YHH Q;  4OWX B;  2RCN A;  4DV6 Q;  4BBR G;  2EQS A;  3J81 c;  5C4X H;  3PSI A;  1VQ4 A;  4JOI C;  1LM0 A;  3UDX A;  4KLK A;  2F3I A;  2VQF L;  4DR3 L;  2A8V A;  1Q81 C;  1K73 C;  2ID0 A;  1TXY A;  2WB1 E;  4DV3 L;  2HIV A;  1AE2 A;  3B6Y A;  2ALY B;  3CAM A;  4FDB A;  3CCV A;  1VQI A;  4EX5 A;  4JV5 L;  4OX9 Q;  1CSP A;  3GTK H;  1A8V A;  1JJC B;  1E1O A;  4TVA B;  1YZ6 A;  2YU9 H;  2RHQ B;  2WB1 G;  1Q8K A;  3I4N G;  3M3Y H;  2AMC B;  3HOU H;  1XNQ Q;  3KJO A;  2E8G A;  2JA6 H;  4BXX G;  1QZH A;  4L5Q A;  3NEN A;  2WAQ G;  3NEM A;  4YHH L;  4A3K H;  5GAD C;  1VQ8 A;  1VQB A;  2H5X A;  2NZH A;  1HNW L;  1K0R A;  5JJL A;  2VQF Q;  2MO0 A;  1Y1W G;  1AH9 A;  1XMQ Q;  2ES2 A;  3ICE A;  1CKN A;  3E9H A;  3UE1 A;  2IX1 A;  4JI0 Q;  3PF4 A;  4A3G H;  2E5L L;  3CD6 A;  1I5F A;  2N49 A;  4APV A;  5IP9 G;  4HJA A;  4BBS H;  4X64 Q;  1PH5 A;  4DV0 L;  3AYH B;  4PZ6 A;  4QL5 A;  3TS2 A;  3K7A H;  1MIU A;  3GTM H;  1TWH H;  3HKS A;  4QY7 A;  5EAY A;  2ZM6 Q;  1G29 1;  4AIM A;  1IZ6 A;  4LFC Q;  3I7F A;  2L15 A;  1BVS A;  3BZK A;  2RF4 A;  4NB3 A;  1PH6 A;  1J5E L;  1VQN A;  3OYY A;  3K81 C;  1X6O A;  3K7U C;  1N34 L;  3PCO B;  2K5V A;  4NPS A;  3U4Z A;  1N36 Q;  4LF7 Q;  3H3V I;  3HOV H;  2NN6 G;  3CC4 A;  3PUY A;  1B70 B;  3RLF A;  4GNX B;  3LGJ A;  2WAQ E;  5GAH C;  4DAM A;  3UDG A;  4A3E H;  2JJQ A;  1LYL A;  1N32 Q;  2YV5 A;  4JI2 Q;  4X64 L;  4LF9 L;  1W3S A;  1VQD A;  3RNU A;  1X65 A;  5LMU L;  1NJI C;  1XNR L;  4AYB E;  5IT9 c;  4KHP Q;  4IPD A;  1Y14 B;  4Y7N H;  4AH6 A;  4IOA A;  2UU9 L;  4DR1 L;  3AFQ A;  1T9H A;  4HJ5 A;  2NVT H;  1JB7 A;  2NN6 I;  4A3C H;  1L1O B;  4MZ9 A;  1L1O A;  4O0A A;  5IP7 G;  1M90 C;  4YCU A;  2ZTC A;  5IYD G;  3KF6 A;  1JJ2 A;  3S1R H;  1K3R A;  1EIY B;  4AQY L;  4GS3 A;  1VQ7 A;  3BU2 A;  4YCV A;  1NMG A;  3K0X A;  1U5K A;  2YTY A;  1I3Q H;  2R92 G;  2YYZ A;  5LMN W;  4LFB L;  1P16 A;  2MO1 A;  4MNO A;  4K0K L;  1VQF A;  4JBM A;  4DV1 Q;  2Q2H A;  5IP9 H;  1AE3 A;  1PA6 A;  1K8A C;  2ATW A;  1XMQ L;  3S15 H;  1VQ5 A;  1CUK A;  5JEA J;  4DNI A;  4LWC A;  1X3G A;  1VQM A;  1SE8 A;  4JI0 L;  3GTO H;  5C3E H;  1A63 A;  2MNA A;  4DK6 C;  5M5Y H;  4IO9 A;  1IXR A;  1Q86 C;  3HOZ G;  4AQY Q;  2GVB A;  2A19 A;  1HR0 Q;  1PH1 A;  4B3T L;  1WYD A;  1R9T H;  3CQZ H;  5FLX c;  5FJ8 G;  5ELN A;  4LFB Q;  5M5X H;  2B63 G;  5C4X G;  3RLN A;  1HZC A;  2R7D A;  4P73 A;  2UUA Q;  4DR5 L;  4K0K Q;  1N9W A;  4R4C A;  4B3S L;  3HOZ H;  4JYA Q;  1GD7 A;  1LUZ A;  5BR8 L;  4LF8 Q;  2R7F A;  2ZJR A;  2CWA A;  1IBL Q;  2RHS B;  3KLW A;  3J81 j;  1HNX L;  4DV7 Q;  3DLL A;  4B3R L;  4LUO A;  5J3B A;  1N36 L;  1YNX A;  4ME3 A;  2OWO A;  4C3I H;  4A3L G;  3MEF A;  1YVC A;  4LUZ A;  4HID A;  1YBY A;  4OO1 G;  1KRS A;  4R4Q A;  5M3F H;  4JI3 L;  1EFW A;  1KRT A;  4DV5 Q;  3D0F A;  4KHP L;  2UUA L;  5IYB G;  2UU9 Q;  4A3J H;  5AJ3 L;  4X6A H;  3CME A;  5BR8 Q;  1VQL A;  3W1G A;  2NVX H;  2UXD Q;  1EOV A;  2DUD A;  3ULL A;  2ZJP A;  3K80 C;  3W5O A;  4P74 A;  1JE5 A;  2I5H A;  4A3E G;  2NVQ H;  3KF6 B;  1QUQ A;  3PUV A;  1PH3 A;  2KBN A;  2CCZ A;  5C0X G;  1FGU A;  3RN5 A;  4HJ7 A;  1V9P A;  3RZD H;  1VQC A;  1XJV A;  4LUV A;  4QQB X;  5LMN Q;  1X3F A;  1QUQ B;  3GTJ H;  4R4I A;  1E1T A;  3PIO A;  1GO3 E;  2QA4 A;  3UDI A;  2Q2U A;  3HOW G;  4C3H H;  4JI3 Q;  3F2D A;  3F1Z A;  3HOY H;  4HIK A;  1ASZ A;  3KYH C;  4GN5 A;  1V1Q A;  1O7I A;  3T1Y L;  3PUZ A;  2K5N A;  3HOV G;  4JI8 Q;  3CCM A;  3H3V H;  3J7A 5;  4O2D A;  2GN5 A;  2JE6 I;  5C0X I;  3CCE A;  3AEV A;  1NTG A;  4A3J G;  4DR6 L;  4L5T A;  2PI2 A;  4DUY Q;  4IFD G;  3T1H L;  4X62 Q;  4PZ8 A;  5GRO A;  4L5R C;  3M7N A;  1CKO A;  1Z9F A;  1JJG A;  1PHJ A;  2VL6 A;  2KHJ A;  1Y1W H;  1L2F A;  4JI1 Q;  4DR2 Q;  4JV5 Q;  1L0W A;  4LFA Q;  2MQH A;  5FLM H;  2UXB Q;  1N33 L;  2XTI A;  3CCR A;  3GO5 A;  3TS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...