3D0FA

Structure of the big_1156.2 domain of putative penicillin-binding protein mrca from nitrosomonas europaea atcc 19718
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
NAYRGPEAFLKLPKDLKDREALQDIMQDIGNSDDILAAVVLSATPGAVEAFRKNGETIRITGDGLKAAHRFLSNDPKIGEKRIRPGALIRVKKTEKGSWQIVQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Penicillin-binding 1 transmembrane protein MrcA
publication title Structure of the BIG_1156.2 domain of putative penicillin-binding protein MrcA from Nitrosomonas europaea ATCC 19718.
rcsb
source organism Nitrosomonas europaea atcc 19718
molecule tags Transferase
total genus 14
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.4.2.-:
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3d0fA01
1SN8A 5GADC 4DR1Q 1SE8A 4YCVA 1LM0A 4ALPA 4GKKL 1UE7A 4O0AA 4LF7L 1NBWA 2JEBI 3HKZE 2K52A 1XPOA 4YY3Q 4L5QA 4DKAC 2JA9A 2OQKA 3H0GG 3CCSA 2Q2TA 4JBWA 3BJUA 2A1AA 3W1GA 1XNRQ 4DUYQ 4LF6Q 4LFCL 4BXXH 3K8AA 1YITA 1Z47A 5C0XI 5C4JH 2UXCQ 1VQFA 4A3KH 4BA1I 2VS1A 5C4XH 3JAMi 2IT1A 4HJ5A 4YCUA 1Q46A 1PVOA 1G51A 2B3GA 2KCTA 1L2FA 3FKIH 4DV0L 3KFUA 1UE6A 2LXKA 4DV3L 4C2MH 2OTLA 3HOYG 2HIXA 2MFIA 4LFCQ 1B8AA 5H1SE 4DV4L 2GVAA 1X54A 1NY4A 3ER0A 5GAGC 2ES2A 2VUMH 2AWNA 3CF5A 1N36L 2Y0SG 3I7FA 1W2BA 4XIGS 1ASZA 5IP7G 5JJKA 3S15H 1QUQB 4QL5A 3W5OA 3H0GH 3GDEA 4X65L 1Z9FA 1M90C 1CSQA 2F3IA 4JOIA 2E2IH 2CKZB 1P16A 4B3TL 1NE3A 4X66Q 1VQAA 4PZ6A 4DK3C 1PH5A 3PO3G 1QVGA 3CMAA 3E9HA 4R4QA 4YWMA 5J3BA 3UDGA 1HR0W 1VQBA 1N36Q 4GNXA 4PMWA 1B7YB 1K0RA 3NELA 4POFA 1HNXL 5LMNW 1IXRA 3CC4A 1Y1VH 1YHQA 3RLOA 1PH7A 1TWHH 1Q8KA 4X65Q 3H15A 4IJHA 3TS0A 2VQEL 1JJ2A 3HOYH 3TRZA 1OXSC 1D7QA 2ALYB 4MNOA 3PIPA 3GD7A 4UY8C 1VQOA 2ZJQA 3D0FA 3PIOA 3RNUA 3T1YQ 5IT9c 1XMOL 4A3CH 1GVPA 3NEMA 1A62A 1PYBA 5ELNA 2JA5G 5IP7H 2JEAI 1CKMA 4RMFA 3L7ZC 3J80c 3A0JA 4LNQA 1I6HH 4IPDA 2JE6I 4DAMA 3S1QH 4O2DA 2H5XA 5EAYA 3CQZH 3HOVG 1N33L 5HGQA 5IWAL 4LF4L 3OW2A 3PO3H 4JI1L 4HJ9A 1KD1C 3CC2A 3RLFA 2I5LX 1JJCB 4EX5A 2KBNA 3UDXA 1NMGA 1U0LA 3CP0A 2VNUD 3B6YA 1UE1A 1Q1BA 2JJQA 3AFQA 3NBHB 4QIWE 2ZJPA 2R92H 3M7NA 4DAYB 4LW1A 2OCEA 1OTCA 1N32L 3J81i 1IBLL 1E24A 2K4KA 1CUKA 1JMCA 2AKWB 2C35B 1CKNA 4HIKA 2UUCL 1G6PA 1W3SA 3CCJA 1Y1WG 1EOVA 4LF5Q 3PCOB 5M5YH 1HZBA 1A0IA 2KENA 4JI0Q 4DR5Q 3HOVH 1XMQL 4KHZA 2OWOA 2K75A 4A93G 2EXDA 4LFAQ 1EFWA 3M4PA 2ZTCA 1YJ9A 3UDFA 1UEBA 5HY6A 2PI2A 1N8RC 5C44H 4JI8Q 3L2PA 3S1MH 1X3FA 5IYDG 1M1KC 2B63H 4JG2A 3RN5A 5IP9G 3M85A 3PSIA 3S1RH 1VQMA 1Q12A 1XMQQ 3S2DH 4A3DG 2WAQG 1L0WA 4UP8A 3GTPH 4JI5L 5BR8L 2HHHL 2D0OA 1XNQL 3KF6B 5GQOA 4AQYL 2OTJA 3ULPA 5K36G 4OWTB 4A76A 1YI2A 1JJGA 4YWKA 4DV2L 2LSSA 4YWLA 1SROA 1NJIC 4DR6L 4LFAL 4PZ8A 1KL9A 3K81C 2JK8A 5M3MG 3TREA 2RCNA 4GLAC 4LWCA 4AQYQ 3J81j 4LFBL 2NVQH 1TXYA 2NVYH 2MO0A 1VQ4A 1IZ6A 4YY3L 1DGSA 1YZ6A 2K14A 4DV2Q 1X56A 3CCLA 4DR6Q 4DV1Q 4LF6L 2UXBQ 3BZKA 4X6AH 3CCVA 4R4IA 2UXCL 3MXNB 1VQGA 4BY1G 1VQCA 3HOZG 1K8AC 4LFBQ 2CFMA 3KJOA 3EIVA 1WCMG 2MO1A 2XGTA 3HOWG 3K80C 2R93G 2JA7G 1IYJB 3I4OA 1I50H 1WFQA 2E8GA 4C3HH 3CCRA 1YJWA 1X65A 1QVCA 3ERSX 1X55A 5M3MH 1PH2A 4Y52H 3H3VH 1JE5A 2K5NA 2I0QA 4KHPL 3F1ZA 5FLXc 4LF9Q 2E5LQ 5C3EG 3U4VA 1UWVA 3KDFA 1LUZA 5AJ3Q 5IY0A 3I2ZA 3ICEA 1X3EA 2L15A 4JCVE 5GAEC 3M4QA 3JAMc 1GM5A 2UUAL 4IPGA 4X66L 4HIMA 4XTCS 5ELOA 4GN4B 3I56A 3DLLA 4LUOA 4BY1H 4Y7NH 4X64Q 5IYBG 1C7YA 3HOZH 4KHPQ 1K73C 1KAWA 4K0KQ 4NB3A 1KC8C 4QQBX 4GNXB 4RG1A 3GTGH 1HZAA 1WCMH 3S2HH 3RLNA 3M4OH 3UE1A 4WJ3M 3K0XA 1JT8A 3I4NG 4JI7Q 4DPGA 3PUXA 4LF8L 3KJPA 2UUAQ 5JJIA 2VQFQ 4IFDI 4OO1I 4GLXA 2MNAA 1HR0L 4AYBG 3T1YL 1IBML 1E1TA 1PHJA 1QZGA 3U4ZA 3K7UC 1X9NA 2I5MX 3STBD 3KOJA 2UU9Q 1VS0A 4TQUS 5E7NA 5M5WH 1KIXA 4NXML 3J7ZC 1SMXA 3VDYA 1WYDA 4LF8Q 1KHIA 4ME3A 2CCZA 3UDIA 3DM3A 2Y0SE 1HR0Q 1IBMQ 3I4MG 2BA0A 1MJCA 1TWGH 5IYBH 1S40A 1G291 4H02A 4R4OA 5JJLA 3OYYA 5LMNQ 4JOIC 4YHHL 4IOAA 2AHOB 3S16H 2N78A 1GD7A 2N3SA 2R7DA 4NXMQ 3JC66 3I4NH 2Z6KC 1FJGQ 4BBSG 1S3OA 3PV0A 2RHQB 1K3RA 4GOPA 3CPWA 4GNXC 3E0EA 3PO2G 3PUYA 3CCMA 3TS2A 2LXJA 2YTVA 4C3JH 3S17H 4A3GG 3CXCA 2YYZA 2KCMA 1CKNB 4YHHQ 3Q8DA 4TVAB 4LF5L 1PFSA 2AWOA 4AH6A 2R7FA 2B29A 1OXTA 4JI0L 2IHFA 4DR5L 2IX1A 5FLMG 3GTLH 3CC7A 3AFPA 3L0OA 2Q2HA 3RR5A 4HJ8A 3S14H 3F2DA 4JI2Q 1SRUA 3I55A 4A3EG 2JA5H 1X3GA 4HJAA 2WB1G 2BA1A 4JBMA 4JI8L 1B70B 2DGYA 3NENA 1E7ZA 3J81c 2Q2UA 4A3BG 1EIFA 4P71A 4GN5A 1K9MC 1I94L 1VQ7A 4BBSH 2D0PA 4BBRG 4DK6C 3PO2H 4BY7G 1AH9A 1OXVA 2IHEA 1YIJA 1YEZA 1VQ9A 1I3QH 2KHIA 2GVBA 4MZ9A 2UXDL 4A3GH 1C0AA 4OWXB 4A3LG 3MEFA 1GO3E 2VY3A 4IO9A 1SFOH 3FP9A 1SR3A 1HJPA 1WJJA 2EQSA 2N8NA 4IPHA 1I94Q 1VQKA 3A5ZB 4OXPA 1YNXA 3G6EA 3CD6A 4JV5Q 1XPRA 4R1JA 1PH6A 4KLKA 4NPSA 5FLMH 2IY5B 3ULJA 4DR2Q 3F8TA 3F2CA 3T1HQ 4A3EH 3CCEA 4DV5Q 4P72A 2NN6G 2UXDQ 1TWCH 4DUZQ 2PI2E 4GN3B 1Y1WH 4DR7Q 1P8LA 1VQHA 2ZJRA 4DV1L 3PUWA 2PNHA 2UXBL 5C0XJ 4BBRH 1JB7A 1O7IA 4X62Q 4A3IG 1VQ6A 4A93H 3U50C 1Q1EA 3OTOQ 1A8VA 1J5EQ 2VL6A 1HZCA 4A3LH 1VQJA 1BKBA 3PUVA 1VQEA 1L1OA 5IYDH 3TQYA 5IYCG 1C9OA 5IP9H 3HKSA 3GTQH 3RZDH 1I5FA 4DV7Q 3TEHB 3PF5A 1T9HA 4A3DH 2VW9A 3H3VI 5JEAG 4HJ7A 2IX0A 3FHWA 4P75A 1BBUA 3HKZG 4JI3Q 5IE8A 4LF9L 3ZJYC 2K50A 4C3IH 2E5LL 3BZCA 1HH2P 1V9PA 4J15A 3PGZA 4LUZA 3KF6A 1YBYA 5AJ3L 2FXQA 4OONA 2DUDA 3KDFB 4R4TA 1HNWQ 4HIOA 3GTJH 4A3IH 1VQPA 4BA2I 2PQAA 5GROA 4X64L 4K0KL 1EQRA 2N49A 3KF8B 1FL0A 1KRSA 3AQQA 1K8GA 1QVFA 1OXUA 2HQLA 2XTIA 1LTLA 1EWIA 1X6OA 5IYCH 5C0XG 4IPCA 4OX9Q 1U5KA 4JI7L 2R6GA 2VUMG 1QZHA 5DLQE 4PZ7A 2CQOA 1WOCA 3E9IA 4L5TA 4DNIA 1V43A 2VQFL 3CCQA 2JA8G 1OXXK 2QA4A 3EBEA 4LUVA 4L5SA 2EIFA 4NXNQ 3HFZB 4EQ5A 4JYAL 3HOWH 1R9TH 2R93H 2JA7H 2UU9L 1HZ9A 3S1NH 4GKKQ 4LF7Q 4A3JG 1PH3A 4MTNA 5GAHC 1FGUA 2ZM6L 4UP7A 4DV6L 4JI6L 3K7AH 3AEVA 2K5VA 2E2JH 1Y1VG 5C3EH 3KYHC 1RIPA 1J6QA 3G4SA 1TWAH 1Q82C 4JYAQ 5LMNL 4B3RL 2CWPA 4A3FG 2GN5A 4IFDG 4OO1G 4P74A 1S72A 1FJGL 3F2BA 1AE2A 4A3CG 1PH9A 4JBJA 1EQQA 4A3MG 2JA8H 2ZM6Q 4GOPB 3M3YH 4DV6Q 1IBKL 4JI6Q 2WP8J 3EN2A 5M3FG 1N34L 4DV0Q 2CWAA 4DV3Q 3G71A 2UUBL 1YHBA 4DV4Q 4B3RQ 1XJVA 4YCWA 2Z6KA 2R7ZG 3CMEA 3RZOH 3CPFA 1MIUA 1NTGA 4AYBE 4A3JH 1VQIA 4QJFA 4JBKA 1TWFH 1QUQA 1PV4A 3W1BA 1IBKQ 1RL2A 1N34Q 4GLVB 4JI2L 3M9BA 2HT1A 2NZOA 1XPUA 2R92G 2UUBQ 2F4VQ 4DR3L 3J7A5 4FDBA 4B3TQ 4A3FH 3J80i 3STBC 3RN2A 1YVCA 5FJ8G 4R4CA 1YHAA 2ASBA 3GTKH 1A63A 1EUJA 4DUYL 2QGQA 4HIDA 3A74A 4A3MH 2VZAA 1HNXQ 1LYLA 3I4MH 4DR4L 4L5RC 1CKOA 5M3FH 1IL2A 2VQEQ 3HOUG 4GKJQ 4DR3Q 2KHJA 2YTYA 3PF4A 4A4IA 2QEXA 2R7ZH 4GOPC 2WFWA 2JA6G 2F52A 1XMOQ 2RHSB 4JV5L 2E2HH 1KQSA 2A8VA 3KLWA 1EYGA 4DR4Q 1GKHA 2ZTDA 4A75A 5JEAJ 5C44G 2BH8A 4DR2L 3T1HL 2RF4A 1BVSA 4DV5L 2B63G 4IOCA 1Y14B 3IRBA 4DUZL 1N33Q 4POGA 4UP9A 4DR7L 4LF4Q 5IWAQ 4JI1Q 5FJ8H 2PMZE 1H95A 1YJNA 1PA6A 2AMCB 2YV5A 5LMUL 2I5HA 2BH2A 4X62L 2YTXA 3S24A 1HNZL 2V1CC 3OTOL 4B3ML 1XTDA 4PG3A 1J5EL 2YU9H 2WB1E 1PH8A 3U58A 1KRTA 2OQ0A 4IJLA 2D62A 4APVA 3HOUH 4QGUA 2Z0SA 2K5HA 2JQOA 3CAMA 3CW2C 4A3BH 1Q86C 1ASYA 1IBLQ 1N32Q 1VCIA 2JA6H 1L1OB 2A19A 1VQ8A 5LMUQ 4DV7L 2NVTH 3A5UA 3SGIA 5M5XH 1Q7YC 4KI0A 1HNZQ 4BY7H 1FVIA 1WI5A 3HOXG 4JI3L 2UUCQ 4B3SL 1D8LA 1BBWA 1V1QA 4B3MQ 1PYSB 1SLJA 3AYHB 2NN6I 4JI4L 3PUZA 1VQDA 3GO5A 3LGJA 1E1OA 1K83H 1UE5A 2WAQE 1MKHA 4UPAA 1HNWL 1VQLA 3UE0A 2HIVA 1VQ5A 2NZHA 1EIYB 2NVXH 3GTOH 4B3SQ 3ULLA 4QY7A 2PQAB 4JI4Q 1MJEA 3WWVA 2F4VL 4BXXG 4GKJL 4DR1L 2MQHA 1CSPA 4OX9L 4JC0A 5BR8Q 2HHHQ 4JI5Q 1XNQQ 2ATWA 4IFDJ 1KXLA 1E3PA 4A3KG 3CCUA 1PH1A 4GS3A 3D31A 4AIMA 1VQNA 4OWWB 5C4XG 3GTMH 3HOXH 1N9WA 3G48A 4P73A 4WJ4A 3FKIG 2ZTEA 1E22A 3BU2A 4NXNL 1XNRL 1Q81C 1PH4A 1NMFA 2Q2IA 2ID0A 1L1OC 1AE3A
chains in the Genus database with same CATH superfamily
5M5WB 3FRPB 4YCVA 1SNOA 4FNFA 5AFWA 2FFKB 2F3WA 2K52A 1TWGB 1AW7A 1XPOA 1E0BA 1U9RA 3H0GG 3CCSA 2Q2TA 4JBWA 1XNRQ 2ZXPA 3E0JA 1EQTA 4LFCL 1YITA 1Z47A 3DEOA 4LAAA 3I4NB 5JOBA 2UXCQ 3ERQA 4ZLTF 3K0YA 2VS1A 5C4XH 2VB2X 2IT1A 1JOKA 3JAMi 4RFBA 1G51A 3J80L 1EU3A 1L2FA 4DV3L 4C2MH 2OTLA 2HIXA 2MFIA 5KNBA 1B8AA 4A3FB 4LFCQ 3C2PA 3F2UA 2J7ZA 3KF8A 5EPKA 2VUMH 2AWNA 1N36L 1W2BA 2ICIA 5M3FB 1SYDA 3OWEB 4QL5A 3GV3A 5EKKA 4WRDA 4CKEA 1CZGA 1P16A 4X66Q 4PZ6A 3FDTA 1PH5A 2ZXRA 5LL6S 4R4QA 1AN8A 1S5DD 5J3BA 1N36Q 3A56A 4C3JG 1B7YB 5IT9E 1HNXL 5CV8A 1JJ2A 1TWHH 3TS0A 3HOYH 1TKWB 3GP7A 1VQOA 1MHWC 2ZXOA 3QB3A 1H9MA 1PLFA 3NEMA 1LABA 5IP7H 1CKMA 1EWCA 3L7ZC 3MXUA 2PQEA 3NTIA 3J80c 1KNEA 1I6HH 5JJZA 2JE6I 3S1QH 4TSSA 4C1NK 1H9SA 4LF4L 4JI1L 3RLFA 2I5LX 2KBNA 5M5XB 1SDFA 1X3PA 2TSSA 5DAUA 2RDHA 2VNUD 1BCPD 4BS9A 4QIWE 2R92H 1CZWA 2FINB 3OWFA 1OTCA 2B2VC 5CC4A 3C1EA 2RSNA 5FK9C 3CCJA 3NK9A 4JI0Q 5G3LF 1HA6A 1XMQL 3TP6A 1GUNA 1KDBA 1UUPA 1XWEA 1UEBA 1F9SA 2PI2A 2CW0D 3PMFA 4JI8Q 1C8CA 1BR9A 2B63H 3S1RH 3PSIA 4J6HA 1O7ZA 1XMQQ 1Q12A 1OO9B 5ISRA 3GTPH 4JI5L 5BR8L 2HHHL 1QB5D 5GQOA 1FYCA 1BUVT 4CJ2C 3NBIA 1STHA 1JJGA 1EYDA 2ENBA 1EZ8A 3K81C 1TS2A 3JAML 1STAA 4OIJA 5M3MG 3TREA 2RCNA 4KKUA 5C4XB 4LFBL 2NVYH 4CGYB 2E2JB 4S3SA 1HQRD 5CGKA 1STEA 1JORA 1CHQD 3CCLA 1SYCA 2O2LD 3BZKA 2F0EA 3CCVA 2VUMB 4R4IA 4BY1G 1VQCA 4LFBQ 1K8AC 4DU9A 1WCMG 5CBEE 4R8IA 2E8GA 2XRQD 1RKNA 1X65A 2EY1A 1PH2A 2K03A 4U673 4KN7C 4KHPL 1EL0A 5C3EG 3U4VA 3G6JB 3S9WA 1UWVA 3VR5A 3HOYB 5CV7A 3TZDA 5EKLA 2AQ1B 1X3EA 3JAMc 4XTCS 5ELOA 3FPPA 3DLLA 4LUOA 3A7AB 3AMUA 4X64Q 1SNDA 5IOCA 5IYBG 1C7YA 3HOZH 5EPJA 1K73C 4B9XA 4KHPQ 1I6HB 3S1QB 3UE1A 2EY6A 5I2YA 2EOTA 3T1YL 2F0TA 5KIXA 2B2YA 2R92B 4TQUS 4NXML 1SMXA 1GXDC 4K5XA 4ME3A 1EIGA 4HCSA 4HR7B 2Y0SE 1JQYD 1A2UA 1RTNA 4IOAA 4JOIC 5FKAC 1H9RA 2N78A 3S16H 4FF4A 4NXMQ 1FJGQ 3A8JE 4I65A 2R3ZA 4GOPA 4BWGB 2JA6B 2OEOA 3E0EA 4FYDA 3PUYA 1NSNS 2IWHA 1FNWA 4IALA 4C3JH 3S17H 2QKIC 1SYGA 1CKNB 2KCMA 2B63B 5C4HA 1MI2A 1ESFA 2B8GA 3S1RB 3IAYA 4TRDA 5G3LD 3RD4A 3GTPB 2NUCA 1HXYD 3GTLH 1K28A 3MTSA 2X6GA 3S14H 3F2DA 3I55A 4CBVA 4JBMA 3NENA 2Q2UA 1K9MC 4BBSH 3PO2H 4BY7G 1VQ9A 2NVYB 1G8ZD 1SYEA 2NYZD 3HOXB 1G91A 5DEHA 5E3FA 3MEFA 1IL2A 1HJPA 2EQSA 1VQKA 1TT2A 4OXPA 3G6EA 4JV5Q 1JWUD 1XPRA 4R1JA 4KLKA 1F2MA 1XX8A 4A3EH 4P72A 2NN6G 1TWCH 2EJGC 3CKIB 1P8LA 4C1NI 4DV1L 2UXBL 5C0XJ 4A3IG 2JN4A 4Q0FA 3KBGA 1L0XB 4A3LH 1RJTA 4CDEC 4G7OC 3PUVA 1VQEA 5IYCG 1F9RA 3HKSA 4HEDA 1I5FA 4DV7Q 1T9HA 3BVZA 2L55A 2Q8IB 5JEAG 4HJ7A 3HOZB 2IX0A 5IE8A 4LF9L 2K50A 5IGEA 3H0GB 1HH2P 1G6ZA 2Q8TA 3DUZA 4J15A 3OHXC 3PGZA 5AJ3L 3KF6A 2FXQA 2DUDA 1IW7D 2MHVA 5GROA 4K2LA 1EQRA 3RUZA 4OEMB 1F77A 2RSOA 5D3IB 1ET6A 2HQLA 2XTIA 1QVFA 1LT4D 2EYFA 1FGBD 2R6GA 1QZHA 5DLQE 1S5CD 3CCQA 3E9IA 4L5TA 1I4HA 1JOOA 1LLRD 2RCFA 1HZ9A 3PIO3 3DWPA 3S1NH 4DFAA 4A3JG 2SOBA 2ZM6L 4UP7A 4DV6L 4JI6L 4JVZA 4C3JB 2K5VA 1Y1VG 3S17B 5C3EH 3KYHC 1HUMA 2LS01 2BE5C 1RIPA 1J6QA 1Q82C 2QDBA 4IUUA 4B3RL 4A3FG 4X3SA 1D6EC 3F2BA 1AE2A 4A3CG 3GTLB 2AUKA 2JA8H 1LTSD 2ZM6Q 4MN3A 4DV6Q 1IBKL 4JI6Q 2WP8J 5M3FG 3KUPA 2A68C 2XWBB 1K8MA 4DV4Q 4B3RQ 2EYMA 1XJVA 4RHRA 3T16A 3PO2B 4GZYC 3BDCA 1IBKQ 3P75A 1RL2A 2HT1A 2NZOA 2EXZA 5JPMC 3STBC 3RN2A 4IFDH 5FJ8G 4R4CA 1A63A 2QGQA 2ICEC 3U9OA 3DWQA 2VZAA 1LYLA 1Q3LA 4A3EB 3E3XA 3KLSX 1L0YB 5D3DA 5J22A 4CJ0B 4A4IA 2R7ZH 3KLWA 1EYGA 5HURA 2ZTDA 4A75A 5C44G 3T1HL 3L9AX 4DV5L 4IOCA 1Y14B 3IRBA 4DUZL 1N33Q 5CBAE 4UP9A 5IWAQ 1RD9D 2PZTA 3LX0A 3VYUA 1H95A 1PA6A 4HAEA 3S24A 2XSCA 1KRTA 2OQ0A 3HOUH 2KCNA 1ASYA 1VMPA 1IBLQ 1VCIA 4BY7H 4KI0A 2N55A 4FXKC 1D8LA 1V1QA 3FEWX 1PYSB 3NTKA 1VQDA 2IW3A 2E2DC 1SBBB 4FXDA 2QDLA 1EIYB 2QCPX 3V2TA 1U4RA 1BNZA 2KOLA 2PQAB 1WCMB 3HS0C 1MJEA 4DR1L 3S1NB 3VR2A 2WINB 2F0NA 3CCUA 3C3LA 2QEJC 5C4XG 3DM1A 3MWYW 3NWSA 3GTMH 1N9WA 1SYBA 5C3EB 2RDFA 1E22A 2Q2IA 2ID0A 5A2QE 1L1OC 3M4OH 5GADC 4IURA 4DR1Q 4M1UB 4GKKL 5I6WA 4LF7L 2JA8B 3HKZE 4F8MA 1CTMA 2RA4A 4YY3Q 5JEAH 2EYLA 2OQKA 2M00A 3W1GA 1O7YA 3EROA 4BXXH 2CHBD 2F0DA 1E2WA 3VA5A 4HJ5A 2B2WC 4YCUA 1MBYA 2KCCA 4DV0L 4HMJA 1UE6A 3KFUA 1HRJA 1RCVD 2N88A 3HOYG 5H1SE 5ELCA 3R2IA 3R8BA 5GAGC 2ES2A 1GUTA 3CF5A 5JJKA 2M9VA 5IP7G 3DEPA 3S15H 4XT1B 2DY7A 3GV6A 1CSQA 2CKZB 4B3TL 4DK3C 5KNCA 1V1PA 1HR0W 4JW0A 4YWMA 4HSVA 4GNXA 3NELA 2EZVA 4KHVA 2K33A 3CC4A 1Y1VH 5CV6A 3RLOA 5FOBB 2VQEL 1EFID 4ABNA 3PIPA 4V190 1SFOB 2ZJQA 1I4XA 3D0FA 2NB0A 1ZKOA 2PMZB 4A3CH 1PYBA 2F0UA 2DNCA 1PTOH 4RCNA 4DAMA 2O5JC 2H5XA 3Q23A 5EAYA 1LTAD 4RGTA 3D8GA 1KD1C 3UDXA 4BY7B 1NMGA 4IN3A 3BVGA 1U0LA 1AEXA 1S5BD 2L0CA 3LNNA 3CP0A 2AQ2B 2JJQA 3NBHB 2ZJPA 4DAYB 4LW1A 5A35A 3SK8A 4QB4A 3J81i 4DF7A 1E24A 1JMCA 1CUKA 2AKWB 2C35B 2UUCL 1W3SA 2K04A 1Y1WG 1ILPA 1K0SA 1A0IA 1GUOA 4DR5Q 3HOVH 4KHZA 3D6WA 2K75A 3Q0AA 2EXDA 4A93G 4B9WA 3I90A 1YJ9A 3GTMB 1SYFA 2MP1A 5C44H 3M4OB 4JG2A 5IP9G 1VQMA 2RVLA 3H6MA 3S2DH 4A3DG 4UP8A 4AQYL 1AZQA 2OTJA 1JOQA 3DHQA 4OWTB 1YI2A 1H9JA 4YWKA 4DV2L 5IIFA 1FR3A 1SROA 1NJIC 4DR6L 4LFAL 4PZ8A 2JK8A 2QILA 1PRTD 1LTID 2AUJD 4IUQA 4AQYQ 1QWYA 1SNMA 4K8IA 1TXYA 2A6ED 1U4MA 4DK0A 1H9KA 1B1ZA 1YZ6A 4DV2Q 2FMCA 1EY5A 1PDQA 2B8FA 4DR6Q 4QCLA 3ND9A 4J1MA 1B53A 3SR1A 3BS1A 1FD7D 2UXCL 3MXNB 1VQGA 1EOTA 3HOZG 1HHVA 1SMYD 2CFMA 3S15B 3VR6A 1S5ED 2MO1A 1ONLA 3K80C 4N9PA 3I4OA 2SNSA 1WFQA 1SSOA 1D1KA 5BN4A 1GJXA 1QVCA 4A3JB 3H3VH 1PZJD 3F1ZA 2SDFA 3QWNA 5FLXc 2E5LQ 2DN8A 3X3MA 1Y1VB 2OXPA 1QG7A 5IY0A 3I2ZA 2O4XA 4H7BA 3M4QA 2HDMA 4X66L 4GN4B 3I56A 3T13A 2PNRC 2PZUA 1KC8C 4EVOA 3R3OA 3S2HH 3RLNA 4K5WA 2OF1A 1WTWA 4DPGA 1PTOD 3PUXA 4LF8L 3KJPA 3NPPA 4GLXA 4AYBG 3K7UC 1LT6D 3KOJA 2UU9Q 1XTCD 1HA5A 5E7NA 3J81L 2QF7A 3J7ZC 4LF8Q 2CCZA 3D3RA 1H9SB 2BA0A 1O80A 3J7YW 3W2DA 5LHY1 5LMNQ 3SXHA 4DK1A 3K5LA 1D5ZC 2F1MA 1ML0D 5D14A 3TN2A 4BBSG 1BCPB 1PXUA 3CPWA 3PO2G 1LTTD 3TS2A 2LXJA 3TBIB 5C44B 3CXCA 3Q8DA 1PFSA 2B29A 3S2DB 4JI0L 2IHFA 2PW7A 3Q6SA 3CC7A 4HJ8A 3NE5B 1ENCA 2C5CA 1GUGA 2EJFC 4A3EG 4I7AA 4HJAA 4JI8L 2Z6BA 3M7GA 4KJOA 1E7ZA 3J81c 1C4QA 4B08A 4F7XA 4ZUJA 1VQ7A 1I94L 1HQMC 4I7ZC 4KY5A 2IHEA 1YEZA 1NR2A 4A3GH 4OGQC 4A3LG 4UDUC 2F0OA 1SR3A 4CJ1B 1I94Q 1QNKA 3A5ZB 1YNXA 1QE6A 5KGUA 5FLMH 4XYQA 5LL6X 2EDGA 2IY5B 4DR2Q 1YNJD 1WD1A 3R93A 1Y1WH 4DR7Q 1VQHA 3PUWA 2D5DA 3J7AF 4A93H 1EY4A 1Q1EA 3OTOQ 1IKMA 1A8VA 1Z7TA 1J5EQ 3FPUB 4C2MB 2F4IA 3GTQH 1C9OA 5IP9H 4LMQD 4A3DH 3TEHB 4ODGA 2VW9A 3H3VI 4ZYSA 4JI3Q 1BBUA 4C3IH 3S2HB 4WFN3 1W6JA 3HEJA 3OSOA 1YBYA 4OONA 1WTRA 4R4TA 1HNWQ 1SJED 1Y69U 1BO0A 1JICA 1VQPA 4ZAIA 4XQQA 4RKLA 1HCZA 1EQVA 4X64L 2BOSA 4PQXA 1FL0A 1DYQA 1K8GA 1TWHB 5ELFA 2PO4A 4RGNA 1TQOA 1X6OA 1HTLD 1R4PB 4IPCA 1U5KA 4HCEA 4R9WA 2F0FA 2CQOA 4DNIA 1MD2D 2JA8G 2L4NA 2M2LA 2QA4A 4MTKA 4DA2A 4NXNQ 4EQ5A 1BF4A 2R61A 3A8KE 3MA2B 3VA7A 1TVXA 4FF2A 3TMEA 2L11A 4MTNA 1STNA 1FGUA 3WOEA 2CQAA 3K7AH 3SE0A 2XVSA 5I6YA 3AEVA 2L9HA 1BDOA 1I4RA 3G4SA 1TWAH 5FO7B 1TS3A 4IFDG 1JB3A 1FJGL 2CH4W 1EQQA 3M3YH 1Z6HA 4GOPB 4ZK9B 4PMCA 2CWAA 3G71A 1STYA 4TKOB 2UUBL 1YHBA 2MGSA 3OIPA 1B9MA 2R7ZG 1PYWD 1ZXTA 2KA7A 1MIUA 3P20A 1TWFH 1QUQA 4N9TA 3W1BA 1JE4A 2Z8LA 1NNXA 2UUBQ 4LK1C 3J7A5 4FDBA 2B2TC 2E76C 1HTPA 3A55A 3IFDA 1Q8IA 2ASBA 3GTKH 2B2VA 1EUJA 4HIDA 3NSWA 1G2TA 2K01A 2EY5A 4DR4L 2A69C 5IGGA 1RF2D 4N8FA 3HOUG 1Y1WB 2KHJA 2YTYA 2Z1CA 1SJHD 4DXFA 1EY0A 1BOSA 5E4XA 1XMOQ 5KNDA 4A93B 4JV5L 2E2HH 2A8VA 5J1ZA 2F0JA 4DR4Q 1F2YA 2BH8A 3OOCA 3RMHA 2RF4A 1BVSA 4H0LC 3GTQB 3NXWA 3P1HA 2PMZE 4LJZC 2F0IA 4A3DB 2YV5A 3BZDB 2I5HA 1DOLA 3BYYB 5E4WC 4C3IB 3I70A 1PH8A 4APVA 1V8QA 2A6HC 2Z0SA 3CAMA 1Q86C 5J39A 1N32Q 3FMCA 4KN4C 4O1NA 4DV7L 2NVTH 3A5UA 1WI5A 2J0TD 1WD0A 1XYIA 4RCOA 2MJ8A 5T1GA 1UE5A 2WAQE 1IYVA 1WTQA 3MFGA 3MFYA 4RGOS 3UE0A 4L63B 3GTOH 2XN9C 3MHBA 3WWVA 2F4VL 4BXXG 1XNQQ 1NCVA 1PH1A 1MSGA 2G9DA 3K7AB 1A3VA 3SK4A 4P2CB 4P73A 3W3AA 1TWAB 1CA6A 1PH4A 2EJMA 2F4VQ 1SN8A 3MZ5A 2XWJB 1JCKB 4ALPA 2A73B 4O0AA 2JEBI 2SNMA 2H1EA 5D65A 2F0HA 1Y8OB 2F0KA 4DN4M 4LF6Q 1LT3D 3S16B 2WKCA 4MIUA 5EJWA 5IT9L 1VQFA 4A3KH 4BA1I 3AB9A 1TWFB 4AYBB 1Q46A 2J4XA 1DD2A 1DM0B 3QIAA 1ZYRC 4DGZA 2GVAA 4DV4L 2F0MA 5IGDA 3A8IE 3GTKB 1NY4A 3ER0A 4DNRB 1KNAA 5KEEA 5DM73 2K5QA 3I7FA 3Q24A 4XIGS 1ASZA 3S14B 3GDEA 1Z9FA 1M90C 2I46A 4JOIA 1NAPA 1HPCA 1VQAA 4BBSB 3CMAA 3E9HA 3UDGA 1D5XC 1SE4A 2F3VA 2K6AA 2E2HB 1VQBA 2JXMB 1K0RA 3H91A 1SE3A 1I4PA 4U68A 1YHQA 1PH7A 1Q8KA 4QIWB 4IJHA 3TRZA 5BN5A 3J80E 2B2TA 2L12A 1OXSC 2ALYB 3GD7A 4UY8C 5M9OA 3PIOA 3RNUA 2D9UA 5IT9c 4KJNA 1KDAA 1TU2B 1J8IA 1A62A 4RWSC 4OIKA 4RMFA 3URYA 3A0JA 4LNQA 4IPDA 1TWCB 2E74C 3CQZH 3HOVG 1N33L 1WVLA 5IWAL 3PO3H 4HJ9A 1JJCB 3T56B 3FVQA 5CMDA 3J7AV 2PYKA 2KECA 3B6YA 4FXGC 3AFQA 3N52A 3M7NA 2O5IC 2OCEA 3BDOA 1K8OA 1CQFA 3OMGA 3K58A 1IBLL 2K4KA 3ONAB 2PW5A 3A54A 3LWUA 4HIKA 4LF5Q 4ZKBB 3PCOB 1A3UA 1HZBA 2KENA 5I9PA 5ELDA 2OWOA 3C1FA 2K1BA 2VB3X 4LFAQ 1EFWA 1STGA 3K5NA 1O78A 3OIQA 1N8RC 3L2PA 3S1MH 1X3FA 3T4AC 1ILQA 3RN5A 3M85A 1KLUD 2BDOA 1VMCA 4QMGA 2LSSA 2GA4B 1LTRD 1VF7A 2G9HD 3HZXA 2JP1A 4A3KB 2ZT9C 1B2TA 3DMUA 2F0GA 1VQ4A 4KY7A 1M8AA 4YY3L 1WTXA 2K14A 1EYAA 1X56A 1CFMA 4X6AH 4PNYA 3BVMA 1BBXC 5K36H 3U9SA 3EIVA 4XQJA 3QO2A 2LFNA 2XGTA 2JA7G 1IYJB 4IZ8A 4CDCC 1IKLA 1YNND 4C3HH 1UEAB 3CCRA 5K5PA 3CHBD 4UAIA 1B9NA 3JAME 1UAPA 4UHVA 2BE5D 2B39A 2L5TA 2FMMA 2HUGA 3EFXD 3KDFA 1LUZA 1DONA 3MC0B 2L15A 5GAEC 4IPGA 2LMCB 1A15A 3L3OC 2Y0SB 1V1PB 4K0KQ 2A68D 1KAWA 4NB3A 1PFBA 1ZEQX 4RG1A 4GNXB 3GTGH 2XNAC 3CQZB 5C3XA 4ZQ3A 1JT8A 4JI7Q 4KTAA 3PO3B 2R7ZB 5JJIA 2VQFQ 4IFDI 1IBML 1PHJA 4NKLA 3U4ZA 1X9NA 2I5MX 3STBD 1AZPA 5M5WH 1KIXA 3N6RA 1K3BC 3D6CA 3I73A 5DM63 1WYDA 4KKSA 3DM3A 3EQLC 1IBMQ 1ICWA 3I4MG 1MJCA 1TWGH 4CKCA 1S40A 3QG1A 5JJLA 1C48A 5EBCA 3HOUB 5C6AA 2N3SA 2R7DA 3I4NH 2Z6KC 1S3OA 1I4QA 3PV0A 3I72A 2F0SA 1JC7A 3NP8A 2YTVA 1PZKD 4A3GG 4RHSA 3A7LA 2DNEA 3S1MB 2E75C 1S5FD 2G5DA 2AWOA 2R7FA 4DR5L 3X3NA 5FLMG 1E2VA 2F03A 4PMBA 3TZUA 3AFPA 3GQBA 1A6XA 4JI2Q 3NHHA 2MUYA 5EGTA 2WB1G 3NQTA 1B70B 2DGYA 3SHLA 4A3BG 3E5SA 4JK1C 4GN5A 2D0PA 4DK6C 4J8QA 1DZ1A 5EBDA 1OXVA 3HRZC 1YIJA 2KHIA 2GVBA 4MZ9A 4FF1A 4KV6A 1C0AA 5L37A 4OWXB 1BCPC 4M8AA 1GO3E 2VY3A 1SNPA 4IO9A 1D2BA 4IPHA 3VR3A 1PH6A 2P5ZX 1BCPF 4L8JA 3ULJA 4DAYA 2X6LA 5FLXL 4C3IG 1CI3M 1PRTB 3CCEA 1G2SA 3SK5A 1I6VC 4IUPA 2VXWA 4BBRH 1JB7A 2KEEA 4X62Q 1VQ6A 3U50C 1RODA 1UNSA 4EGVA 3KLRA 3VYSA 2NBFA 1L1OA 1NUCA 2CW0C 3TQYA 3RZDH 1CT1D 3QOJA 1B3AA 2K5DA 3H09A 3GTGB 4IQZA 3ZJYC 2E5LL 3BZCA 1V9PA 1CM9A 1DCZA 4LUZA 4HIOA 1JWMD 4ZKCB 4BA2I 2B2WA 4K6DA 3KF8B 1KRSA 3QJYA 2EY2A 3G7LA 3H3VC 1LTLA 4OX9Q 4HTHA 3DXJC 4IUNA 1Y8NB 3HP3A 1WOCA 1JR0D 1V43A 2KQ3A 1OXXK 4LUVA 5I9OA 4L5SA 2EIFA 4K2KA 1PTOB 4NP5A 5TSSA 4JYAL 4YIJA 4E6IA 5IODA 5C3WA 2UU9L 2JA7H 3MXNA 1B3QA 1I4GA 1LTBD 2NTTA 1PH3A 1X32A 4KD4A 1SNQA 2IJ0A 2E2JH 1R4QB 4MHEA 4JYAQ 5LMNL 1A2TA 2CWPA 4OO1G 4IUTA 5C0XH 1F9QA 5ELBA 1PH9A 3K59A 4FVMA 4G7ZC 3PQIA 2EYOA 4DV3Q 4ULLA 5JVG3 1EU4A 2X69A 4L6TB 2Z6KA 3LWEA 4YCWA 3CMEA 1SNCA 5COYA 4IUVA 3RZOH 3HOVB 4AYBE 1VQIA 1TS5A 4QJFA 4JBKA 1PV4A 2B2YC 2CH4A 4X3KA 4GLVB 2K05A 3M9BA 1FNUA 4RAUC 2FJ2A 1KABA 3EA6A 1CA5A 3NQIA 3TP5A 1GUSA 2QW7A 4RA8A 4A3MH 1HNXQ 1LACA 3I4MH 4L5RC 1QNUA 4HSPA 2PZWA 4G4KA 4GOPC 2WFWA 4BBRB 2DJGC 1AFPA 3BG3A 1KQSA 1TY0A 1GKHA 5JEAJ 4DR2L 2PCFB 4ILWA 2LKVA 2KVMA 2EPBA 4POGA 4LF4Q 4DR7L 2KUMA 1V1OA 4JI1Q 3RZDB 5CYUA 1YJNA 2F0VA 2AMCB 1STBA 5LMUL 5IGCA 1GOZA 1HNZL 3OTOL 4B3ML 4PG3A 1QOHA 1J5EL 2YU9H 4IJLA 3OPOA 4QGUA 2JQOA 2Z4IA 3CW2C 4A3BH 4K14A 2JA6H 2B2UC 1VQ8A 5LMUQ 4XQNA 1LV9A 3VR4A 1Q7YC 1HNZQ 2EYPA 3MXPA 3VYTA 4B3MQ 4JI3L 5A2QL 4CKBA 1BBWA 1SLJA 1A3TA 4JI4L 3PUZA 3GO5A 3LGJA 3EVQA 1VDZA 1DXMA 1K83H 1HNWL 4H13C 1VQLA 2HIVA 5I4DA 3KK7A 1VQ5A 2NZHA 3HKZB 3CRKC 5CORA 2NVXH 3D4DA 3CU7A 4ID6A 5C5MA 4QY7A 3ULLA 4Q5VA 5EPLA 4JI4Q 2JA7B 1EY9A 2KHSA 1DJRD 3WOFA 4GKJL 2MQHA 4JC0A 5BR8Q 2HHHQ 4JI5Q 4KMUC 2ATWA 3R2TA 4A3KG 3O13A 2DJFC 3NUCA 3HOXH 2ZTEA 3BU2A 4NXNL 4DUYL 2NZ1D 1AE3A 4GKJQ 1SE8A 1LM0A 1II3A 3MXGA 3QR8A 1UE7A 1NBWA 3SK6A 4L5QA 4DKAC 2JA9A 1KLGD 4CDDC 3BJUA 2A1AA 4DUYQ 3K8AA 3RZOB 4NW2A 5C0XI 5C4JH 1M4VA 5I2XA 1IW7C 1JWSD 1EIHA 1PVOA 2B3GA 2A74C 3D4WA 2F0QA 2KCTA 3FKIH 2LXKA 3K6OA 2WACA 3ZYYX 3NTHA 4K8JA 4EQNA 1E2ZA 1X54A 1EWHA 4A3MB 1BQQT 3AU7A 1EZ6A 2Y0SG 3I4MB 3I3CA 1QUQB 3W5OA 1D1IA 3H0GH 4X65L 3I91A 2F3IA 4G7HC 2E2IH 3BYTB 1NE3A 2PPBC 1PFMA 3M4YA 3PO3G 1QVGA 1TR5A 2Z4HA 1LT5D 2BDNA 4PMWA 1DOKA 4POFA 1T5EA 5LMNW 1IXRA 4A3GB 4X65Q 3H15A 4K5VA 1U4PA 1D7QA 4MNOA 4R8NA 4V0BA 4ZRZA 4OO1H 3EJIA 3T1YQ 5JAVA 1XMOL 2IL8A 3HGBA 2IX3A 1GVPA 3P7JA 2K28A 5ELNA 2JA5G 2YU9B 2JEAI 2WB1B 4O2DA 4A3BB 2XRSD 5HGQA 3OW2A 3CC2A 3E6ZX 4EX5A 2RDGA 4XT3B 4F87A 4OELB 1UE1A 1Q1BA 1B50A 5F2DA 4WORA 1K83B 1GUWA 4KD3A 1N32L 1SAPA 1X3QA 2NVXB 1Q90A 4XXEA 1G6PA 1CKNA 1ESRA 4O42A 3TP8A 1NR4A 3D4RA 1EOVA 5M5YH 1LTGD 3TDQA 1TY2A 2B2UA 2EYHA 3M4PA 5DNFA 2ZTCA 3UDFA 5HY6A 1CHPD 1T5XD 1F2ZA 1M1KC 5IYDG 5C5LA 2OT2A 4CDFC 2BCOA 2WAQG 1L0WA 2JSOA 2F0WA 1XNQL 2D0OA 3KF6B 4K6LA 3IKJA 3ULPA 4ZUIA 5K36G 4A76A 1QILA 1IL8A 1CQVA 1S4ZA 2V4DA 4YWLA 1KL9A 1U4LA 4G57A 4C3HG 2D2CC 4X3UA 1MGSA 3V96A 5C4JB 4GLAC 1ENFA 3ND8A 4LWCA 3J81j 2NVQH 2H4OA 2MO0A 1IZ6A 5KYLA 3FKIB 2DY8A 1DGSA 2JYOA 4QF4A 1EY7A 1VF5C 4NDXA 4DV1Q 4LF6L 2UXBQ 5E1FA 3C46A 1ENAA 1KAAA 3M3YB 1RDPD 3KJOA 5FLXE 3HOWG 1WTPA 1DOMA 1KDCA 2R93G 2E2IB 1I50H 5NUCA 1YJWA 3ERSX 1X55A 3K5OA 5M3MH 4Y52H 1B4OA 1JE5A 2K5NA 2I0QA 3WDNA 4LF9Q 5C4ZA 1HFNA 4N8X1 1Y8PB 5AJ3Q 2TMPA 3ICEA 4JCVE 5CV9A 1GM5A 2NTSA 2UUAL 3VYRA 4HIMA 4WJWA 4BY1H 4Y7NH 4QQBX 5KYIA 4FO2A 1HZAA 1WCMH 5JPNC 4KKTA 4WJ3M 3K0XA 4DXGA 1F9PA 3I4NG 2K5WA 2Q8RE 4HMIA 1YNNC 2UUAQ 4OO1I 1J9OA 2MNAA 1HR0L 1E1TA 1QZGA 4OL7A 3SDZA 4EQPA 4Z9CB 1VS0A 2NWGA 4NMZA 3VDYA 2SEBD 1FNVA 1KHIA 4OHJA 1WTVA 3UDIA 2RKSA 2A69D 1HR0Q 5IYBH 3UI2A 1G291 4H02A 4R4OA 5FO9B 1IHZA 5M5YB 3OYYA 4YHHL 3CRLC 2AHOB 2KJXA 1GD7A 4JPBW 3JC66 4FP5D 2RHQB 1K3RA 4GNXC 1SXTA 2HQEA 4ME5A 3CCMA 2NVTB 3I8ZA 2YYZA 4ZCKA 4YHHQ 4LF5L 4TVAB 3OW7A 4AH6A 3MEHA 4QUCA 1OXTA 3J81E 3H94A 2IX1A 1EEFD 2RBMA 3L0OA 2Q2HA 3RR5A 3GTOB 2C9OA 1SRUA 2A6HD 4RKBA 2JA5H 1X3GA 2BA1A 5KRUA 3OMCA 1EY8A 4KY6A 1EIFA 4P71A 4BBRG 1EEID 1CK1A 1QJOA 2NVQB 1AH9A 5EKIA 1I3QH 2UXDL 2LY7A 1W6KA 2K7VA 1SFOH 3FP9A 2WIIB 1WJJA 2N8NA 3SEBA 5IGFA 3CD6A 2XIWA 2F0PA 4NPSA 3F8TA 3F2CA 3T1HQ 2UXDQ 4DV5Q 4DUZQ 2A5HA 2PI2E 4GN3B 1I50B 3K57A 1IYUA 1WTHA 2ZJRA 2PNHA 5M3MB 1O7IA 5EQ0A 4KK7A 2VL6A 1HZCA 2Z9HA 1AP0A 1VQJA 1BKBA 5HGTA 5IYDH 1GHJA 4BY1B 3PF5A 4Y7NB 1PZID 3FHWA 4P75A 3HKZG 4RH6A 2NN6H 3SVMA 3I4LA 1KTKA 4X3TA 3KDFB 1SEBD 3GTJH 4A3IH 1PRTC 1QCBD 2PQAA 2K32A 4DNTB 4DAVA 1BXTA 1HUNA 4EQOA 1EY6A 4K0KL 2N49A 5CV4A 1ZYRD 1LO5D 3AQQA 2A6EC 1OXUA 1PRTF 1EWIA 5IYCH 5C0XG 3V05A 4F88A 4JI7L 2VUMG 3IL8A 4PZ7A 2VQFL 3BDLA 5JVH3 2IPKD 1PMRA 3EBEA 1O7LA 2KEDA 3HFZB 1B44D 1SMYC 5T1IA 3PIP3 3HOWH 1R9TH 2R93H 1RTOA 3Q22A 1ICFB 4GKKQ 4LF7Q 1F2LA 5GAHC 4DAPA 2HD3A 4XYOA 3KBXA 2GN5A 4P74A 1HFGA 4CHTB 3TSSA 1WTOA 1S72A 4JBJA 4A3MG 1EYCA 2RQXA 3HG9A 3IFTA 4C56C 3EN2A 1N34L 4DV0Q 2JA5B 4XDXA 2L1BA 1MSHA 4FF3A 3CPFA 1NTGA 1TIID 3K5MA 4A3JH 1PTOC 1D5MC 1I3QB 3DWAA 1N34Q 4JI2L 1XPUA 2R92G 3NWTA 5ELEA 1ET9A 4DR3L 1PTOF 4B3TQ 4A3FH 3J80i 1YVCA 1YHAA 3A74A 2WV6D 1CKOA 5M3FH 2VQEQ 2CVRA 2EVBA 4DR3Q 3PF4A 1RHPA 3KLSA 2QEXA 2JA6G 2F52A 2RHSB 2WKDA 2HCCA 5CR3A 2B63G 2HCIA 1SE2A 4QUFA 4H44C 5FJ8H 2EE1A 2AQ3B 5BN3A 2WAQB 2BH2A 4X62L 2YTXA 2F0LA 2V1CC 3NBHA 1XTDA 1XXGA 2WB1E 3QOLA 3U58A 2D62A 2K5HA 3ITPA 4C3HB 3GTJB 5IGBA 1L1OB 2A19A 4A3IB 2I07B 2EYJA 3SGIA 5CV5A 5M5XH 3MAQA 1FVIA 2UUCQ 3HOXG 4B3SL 3AYHB 2NN6I 4HN7A 2FHTA 1E1OA 1MKHA 4UPAA 1PFNA 3MVVA 4B3SQ 3HOWB 2MPMA 1R9TB 2R93B 1YNJC 4RGMA 4PV1C 1CSPA 3T53B 4OX9L 1KXLA 1GHKA 5FO8B 3TP7A 1TS4A 4IFDJ 1E3PA 4GS3A 3D31A 4AIMA 1VQNA 4OWWB 3T51B 2HDLA 3G48A 4WJ4A 3FKIG 1XNRL 1Q81C 1NMFA
chains in the Genus database with same CATH topology
1SN8A 5GADC 4DR1Q 1SE8A 4YCVA 1LM0A 4ALPA 4GKKL 1UE7A 4O0AA 4LF7L 1NBWA 2JEBI 3HKZE 2K52A 1XPOA 4YY3Q 4L5QA 4DKAC 2JA9A 2OQKA 3H0GG 3CCSA 2Q2TA 4JBWA 3BJUA 2A1AA 3W1GA 1XNRQ 4DUYQ 4LF6Q 4LFCL 4BXXH 3K8AA 1YITA 1Z47A 5C0XI 5C4JH 2UXCQ 1VQFA 4A3KH 4BA1I 2VS1A 5C4XH 3JAMi 2IT1A 4HJ5A 4YCUA 1Q46A 1PVOA 1G51A 2B3GA 2KCTA 1L2FA 3FKIH 4DV0L 3KFUA 1UE6A 2LXKA 4DV3L 4C2MH 2OTLA 3HOYG 2HIXA 2MFIA 4LFCQ 1B8AA 5H1SE 4DV4L 2GVAA 1X54A 1NY4A 3ER0A 5GAGC 2ES2A 2VUMH 2AWNA 3CF5A 1N36L 2Y0SG 3I7FA 1W2BA 4XIGS 1ASZA 5IP7G 5JJKA 3S15H 1QUQB 4QL5A 3W5OA 3H0GH 3GDEA 4X65L 1Z9FA 1M90C 1CSQA 2F3IA 4JOIA 2E2IH 2CKZB 1P16A 4B3TL 1NE3A 4X66Q 1VQAA 4PZ6A 4DK3C 1PH5A 3PO3G 1QVGA 3CMAA 3E9HA 4R4QA 4YWMA 5J3BA 3UDGA 1HR0W 1VQBA 1N36Q 4GNXA 4PMWA 1B7YB 1K0RA 3NELA 4POFA 1HNXL 5LMNW 1IXRA 3CC4A 1Y1VH 1YHQA 3RLOA 1PH7A 1TWHH 1Q8KA 4X65Q 3H15A 4IJHA 3TS0A 2VQEL 1JJ2A 3HOYH 3TRZA 1OXSC 1D7QA 2ALYB 4MNOA 3PIPA 3GD7A 4UY8C 1VQOA 2ZJQA 3D0FA 3PIOA 3RNUA 3T1YQ 5IT9c 1XMOL 4A3CH 1GVPA 3NEMA 1A62A 1PYBA 5ELNA 2JA5G 5IP7H 2JEAI 1CKMA 4RMFA 3L7ZC 3J80c 3A0JA 4LNQA 1I6HH 4IPDA 2JE6I 4DAMA 3S1QH 4O2DA 2H5XA 5EAYA 3CQZH 3HOVG 1N33L 5HGQA 5IWAL 4LF4L 3OW2A 3PO3H 4JI1L 4HJ9A 1KD1C 3CC2A 3RLFA 2I5LX 1JJCB 4EX5A 2KBNA 3UDXA 1NMGA 1U0LA 3CP0A 2VNUD 3B6YA 1UE1A 1Q1BA 2JJQA 3AFQA 3NBHB 4QIWE 2ZJPA 2R92H 3M7NA 4DAYB 4LW1A 2OCEA 1OTCA 1N32L 3J81i 1IBLL 1E24A 2K4KA 1CUKA 1JMCA 2AKWB 2C35B 1CKNA 4HIKA 2UUCL 1G6PA 1W3SA 3CCJA 1Y1WG 1EOVA 4LF5Q 3PCOB 5M5YH 1HZBA 1A0IA 2KENA 4JI0Q 4DR5Q 3HOVH 1XMQL 4KHZA 2OWOA 2K75A 4A93G 2EXDA 4LFAQ 1EFWA 3M4PA 2ZTCA 1YJ9A 3UDFA 1UEBA 5HY6A 2PI2A 1N8RC 5C44H 4JI8Q 3L2PA 3S1MH 1X3FA 5IYDG 1M1KC 2B63H 4JG2A 3RN5A 5IP9G 3M85A 3PSIA 3S1RH 1VQMA 1Q12A 1XMQQ 3S2DH 4A3DG 2WAQG 1L0WA 4UP8A 3GTPH 4JI5L 5BR8L 2HHHL 2D0OA 1XNQL 3KF6B 5GQOA 4AQYL 2OTJA 3ULPA 5K36G 4OWTB 4A76A 1YI2A 1JJGA 4YWKA 4DV2L 2LSSA 4YWLA 1SROA 1NJIC 4DR6L 4LFAL 4PZ8A 1KL9A 3K81C 2JK8A 5M3MG 3TREA 2RCNA 4GLAC 4LWCA 4AQYQ 3J81j 4LFBL 2NVQH 1TXYA 2NVYH 2MO0A 1VQ4A 1IZ6A 4YY3L 1DGSA 1YZ6A 2K14A 4DV2Q 1X56A 3CCLA 4DR6Q 4DV1Q 4LF6L 2UXBQ 3BZKA 4X6AH 3CCVA 4R4IA 2UXCL 3MXNB 1VQGA 4BY1G 1VQCA 3HOZG 1K8AC 4LFBQ 2CFMA 3KJOA 3EIVA 1WCMG 2MO1A 2XGTA 3HOWG 3K80C 2R93G 2JA7G 1IYJB 3I4OA 1I50H 1WFQA 2E8GA 4C3HH 3CCRA 1YJWA 1X65A 1QVCA 3ERSX 1X55A 5M3MH 1PH2A 4Y52H 3H3VH 1JE5A 2K5NA 2I0QA 4KHPL 3F1ZA 5FLXc 4LF9Q 2E5LQ 5C3EG 3U4VA 1UWVA 3KDFA 1LUZA 5AJ3Q 5IY0A 3I2ZA 3ICEA 1X3EA 2L15A 4JCVE 5GAEC 3M4QA 3JAMc 1GM5A 2UUAL 4IPGA 4X66L 4HIMA 4XTCS 5ELOA 4GN4B 3I56A 3DLLA 4LUOA 4BY1H 4Y7NH 4X64Q 5IYBG 1C7YA 3HOZH 4KHPQ 1K73C 1KAWA 4K0KQ 4NB3A 1KC8C 4QQBX 4GNXB 4RG1A 3GTGH 1HZAA 1WCMH 3S2HH 3RLNA 3M4OH 3UE1A 4WJ3M 3K0XA 1JT8A 3I4NG 4JI7Q 4DPGA 3PUXA 4LF8L 3KJPA 2UUAQ 5JJIA 2VQFQ 4IFDI 4OO1I 4GLXA 2MNAA 1HR0L 4AYBG 3T1YL 1IBML 1E1TA 1PHJA 1QZGA 3U4ZA 3K7UC 1X9NA 2I5MX 3STBD 3KOJA 2UU9Q 1VS0A 4TQUS 5E7NA 5M5WH 1KIXA 4NXML 3J7ZC 1SMXA 3VDYA 1WYDA 4LF8Q 1KHIA 4ME3A 2CCZA 3UDIA 3DM3A 2Y0SE 1HR0Q 1IBMQ 3I4MG 2BA0A 1MJCA 1TWGH 5IYBH 1S40A 1G291 4H02A 4R4OA 5JJLA 3OYYA 5LMNQ 4JOIC 4YHHL 4IOAA 2AHOB 3S16H 2N78A 1GD7A 2N3SA 2R7DA 4NXMQ 3JC66 3I4NH 2Z6KC 1FJGQ 4BBSG 1S3OA 3PV0A 2RHQB 1K3RA 4GOPA 3CPWA 4GNXC 3E0EA 3PO2G 3PUYA 3CCMA 3TS2A 2LXJA 2YTVA 4C3JH 3S17H 4A3GG 3CXCA 2YYZA 2KCMA 1CKNB 4YHHQ 3Q8DA 4TVAB 4LF5L 1PFSA 2AWOA 4AH6A 2R7FA 2B29A 1OXTA 4JI0L 2IHFA 4DR5L 2IX1A 5FLMG 3GTLH 3CC7A 3AFPA 3L0OA 2Q2HA 3RR5A 4HJ8A 3S14H 3F2DA 4JI2Q 1SRUA 3I55A 4A3EG 2JA5H 1X3GA 4HJAA 2WB1G 2BA1A 4JBMA 4JI8L 1B70B 2DGYA 3NENA 1E7ZA 3J81c 2Q2UA 4A3BG 1EIFA 4P71A 4GN5A 1K9MC 1I94L 1VQ7A 4BBSH 2D0PA 4BBRG 4DK6C 3PO2H 4BY7G 1AH9A 1OXVA 2IHEA 1YIJA 1YEZA 1VQ9A 1I3QH 2KHIA 2GVBA 4MZ9A 2UXDL 4A3GH 1C0AA 4OWXB 4A3LG 3MEFA 1GO3E 2VY3A 4IO9A 1SFOH 3FP9A 1SR3A 1HJPA 1WJJA 2EQSA 2N8NA 4IPHA 1I94Q 1VQKA 3A5ZB 4OXPA 1YNXA 3G6EA 3CD6A 4JV5Q 1XPRA 4R1JA 1PH6A 4KLKA 4NPSA 5FLMH 2IY5B 3ULJA 4DR2Q 3F8TA 3F2CA 3T1HQ 4A3EH 3CCEA 4DV5Q 4P72A 2NN6G 2UXDQ 1TWCH 4DUZQ 2PI2E 4GN3B 1Y1WH 4DR7Q 1P8LA 1VQHA 2ZJRA 4DV1L 3PUWA 2PNHA 2UXBL 5C0XJ 4BBRH 1JB7A 1O7IA 4X62Q 4A3IG 1VQ6A 4A93H 3U50C 1Q1EA 3OTOQ 1A8VA 1J5EQ 2VL6A 1HZCA 4A3LH 1VQJA 1BKBA 3PUVA 1VQEA 1L1OA 5IYDH 3TQYA 5IYCG 1C9OA 5IP9H 3HKSA 3GTQH 3RZDH 1I5FA 4DV7Q 3TEHB 3PF5A 1T9HA 4A3DH 2VW9A 3H3VI 5JEAG 4HJ7A 2IX0A 3FHWA 4P75A 1BBUA 3HKZG 4JI3Q 5IE8A 4LF9L 3ZJYC 2K50A 4C3IH 2E5LL 3BZCA 1HH2P 1V9PA 4J15A 3PGZA 4LUZA 3KF6A 1YBYA 5AJ3L 2FXQA 4OONA 2DUDA 3KDFB 4R4TA 1HNWQ 4HIOA 3GTJH 4A3IH 1VQPA 4BA2I 2PQAA 5GROA 4X64L 4K0KL 1EQRA 2N49A 3KF8B 1FL0A 1KRSA 3AQQA 1K8GA 1QVFA 1OXUA 2HQLA 2XTIA 1LTLA 1EWIA 1X6OA 5IYCH 5C0XG 4IPCA 4OX9Q 1U5KA 4JI7L 2R6GA 2VUMG 1QZHA 5DLQE 4PZ7A 2CQOA 1WOCA 3E9IA 4L5TA 4DNIA 1V43A 2VQFL 3CCQA 2JA8G 1OXXK 2QA4A 3EBEA 4LUVA 4L5SA 2EIFA 4NXNQ 3HFZB 4EQ5A 4JYAL 3HOWH 1R9TH 2R93H 2JA7H 2UU9L 1HZ9A 3S1NH 4GKKQ 4LF7Q 4A3JG 1PH3A 4MTNA 5GAHC 1FGUA 2ZM6L 4UP7A 4DV6L 4JI6L 3K7AH 3AEVA 2K5VA 2E2JH 1Y1VG 5C3EH 3KYHC 1RIPA 1J6QA 3G4SA 1TWAH 1Q82C 4JYAQ 5LMNL 4B3RL 2CWPA 4A3FG 2GN5A 4IFDG 4OO1G 4P74A 1S72A 1FJGL 3F2BA 1AE2A 4A3CG 1PH9A 4JBJA 1EQQA 4A3MG 2JA8H 2ZM6Q 4GOPB 3M3YH 4DV6Q 1IBKL 4JI6Q 2WP8J 3EN2A 5M3FG 1N34L 4DV0Q 2CWAA 4DV3Q 3G71A 2UUBL 1YHBA 4DV4Q 4B3RQ 1XJVA 4YCWA 2Z6KA 2R7ZG 3CMEA 3RZOH 3CPFA 1MIUA 1NTGA 4AYBE 4A3JH 1VQIA 4QJFA 4JBKA 1TWFH 1QUQA 1PV4A 3W1BA 1IBKQ 1RL2A 1N34Q 4GLVB 4JI2L 3M9BA 2HT1A 2NZOA 1XPUA 2R92G 2UUBQ 2F4VQ 4DR3L 3J7A5 4FDBA 4B3TQ 4A3FH 3J80i 3STBC 3RN2A 1YVCA 5FJ8G 4R4CA 1YHAA 2ASBA 3GTKH 1A63A 1EUJA 4DUYL 2QGQA 4HIDA 3A74A 4A3MH 2VZAA 1HNXQ 1LYLA 3I4MH 4DR4L 4L5RC 1CKOA 5M3FH 1IL2A 2VQEQ 3HOUG 4GKJQ 4DR3Q 2KHJA 2YTYA 3PF4A 4A4IA 2QEXA 2R7ZH 4GOPC 2WFWA 2JA6G 2F52A 1XMOQ 2RHSB 4JV5L 2E2HH 1KQSA 2A8VA 3KLWA 1EYGA 4DR4Q 1GKHA 2ZTDA 4A75A 5JEAJ 5C44G 2BH8A 4DR2L 3T1HL 2RF4A 1BVSA 4DV5L 2B63G 4IOCA 1Y14B 3IRBA 4DUZL 1N33Q 4POGA 4UP9A 4DR7L 4LF4Q 5IWAQ 4JI1Q 5FJ8H 2PMZE 1H95A 1YJNA 1PA6A 2AMCB 2YV5A 5LMUL 2I5HA 2BH2A 4X62L 2YTXA 3S24A 1HNZL 2V1CC 3OTOL 4B3ML 1XTDA 4PG3A 1J5EL 2YU9H 2WB1E 1PH8A 3U58A 1KRTA 2OQ0A 4IJLA 2D62A 4APVA 3HOUH 4QGUA 2Z0SA 2K5HA 2JQOA 3CAMA 3CW2C 4A3BH 1Q86C 1ASYA 1IBLQ 1N32Q 1VCIA 2JA6H 1L1OB 2A19A 1VQ8A 5LMUQ 4DV7L 2NVTH 3A5UA 3SGIA 5M5XH 1Q7YC 4KI0A 1HNZQ 4BY7H 1FVIA 1WI5A 3HOXG 4JI3L 2UUCQ 4B3SL 1D8LA 1BBWA 1V1QA 4B3MQ 1PYSB 1SLJA 3AYHB 2NN6I 4JI4L 3PUZA 1VQDA 3GO5A 3LGJA 1E1OA 1K83H 1UE5A 2WAQE 1MKHA 4UPAA 1HNWL 1VQLA 3UE0A 2HIVA 1VQ5A 2NZHA 1EIYB 2NVXH 3GTOH 4B3SQ 3ULLA 4QY7A 2PQAB 4JI4Q 1MJEA 3WWVA 2F4VL 4BXXG 4GKJL 4DR1L 2MQHA 1CSPA 4OX9L 4JC0A 5BR8Q 2HHHQ 4JI5Q 1XNQQ 2ATWA 4IFDJ 1KXLA 1E3PA 4A3KG 3CCUA 1PH1A 4GS3A 3D31A 4AIMA 1VQNA 4OWWB 5C4XG 3GTMH 3HOXH 1N9WA 3G48A 4P73A 4WJ4A 3FKIG 2ZTEA 1E22A 3BU2A 4NXNL 1XNRL 1Q81C 1PH4A 1NMFA 2Q2IA 2ID0A 1L1OC 1AE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SN8 A;  5GAD C;  4DR1 Q;  1SE8 A;  4YCV A;  1LM0 A;  4ALP A;  4GKK L;  1UE7 A;  4O0A A;  4LF7 L;  1NBW A;  2JEB I;  3HKZ E;  2K52 A;  1XPO A;  4YY3 Q;  4L5Q A;  4DKA C;  2JA9 A;  2OQK A;  3H0G G;  3CCS A;  2Q2T A;  4JBW A;  3BJU A;  2A1A A;  3W1G A;  1XNR Q;  4DUY Q;  4LF6 Q;  4LFC L;  4BXX H;  3K8A A;  1YIT A;  1Z47 A;  5C0X I;  5C4J H;  2UXC Q;  1VQF A;  4A3K H;  4BA1 I;  2VS1 A;  5C4X H;  3JAM i;  2IT1 A;  4HJ5 A;  4YCU A;  1Q46 A;  1PVO A;  1G51 A;  2B3G A;  2KCT A;  1L2F A;  3FKI H;  4DV0 L;  3KFU A;  1UE6 A;  2LXK A;  4DV3 L;  4C2M H;  2OTL A;  3HOY G;  2HIX A;  2MFI A;  4LFC Q;  1B8A A;  5H1S E;  4DV4 L;  2GVA A;  1X54 A;  1NY4 A;  3ER0 A;  5GAG C;  2ES2 A;  2VUM H;  2AWN A;  3CF5 A;  1N36 L;  2Y0S G;  3I7F A;  1W2B A;  4XIG S;  1ASZ A;  5IP7 G;  5JJK A;  3S15 H;  1QUQ B;  4QL5 A;  3W5O A;  3H0G H;  3GDE A;  4X65 L;  1Z9F A;  1M90 C;  1CSQ A;  2F3I A;  4JOI A;  2E2I H;  2CKZ B;  1P16 A;  4B3T L;  1NE3 A;  4X66 Q;  1VQA A;  4PZ6 A;  4DK3 C;  1PH5 A;  3PO3 G;  1QVG A;  3CMA A;  3E9H A;  4R4Q A;  4YWM A;  5J3B A;  3UDG A;  1HR0 W;  1VQB A;  1N36 Q;  4GNX A;  4PMW A;  1B7Y B;  1K0R A;  3NEL A;  4POF A;  1HNX L;  5LMN W;  1IXR A;  3CC4 A;  1Y1V H;  1YHQ A;  3RLO A;  1PH7 A;  1TWH H;  1Q8K A;  4X65 Q;  3H15 A;  4IJH A;  3TS0 A;  2VQE L;  1JJ2 A;  3HOY H;  3TRZ A;  1OXS C;  1D7Q A;  2ALY B;  4MNO A;  3PIP A;  3GD7 A;  4UY8 C;  1VQO A;  2ZJQ A;  3D0F A;  3PIO A;  3RNU A;  3T1Y Q;  5IT9 c;  1XMO L;  4A3C H;  1GVP A;  3NEM A;  1A62 A;  1PYB A;  5ELN A;  2JA5 G;  5IP7 H;  2JEA I;  1CKM A;  4RMF A;  3L7Z C;  3J80 c;  3A0J A;  4LNQ A;  1I6H H;  4IPD A;  2JE6 I;  4DAM A;  3S1Q H;  4O2D A;  2H5X A;  5EAY A;  3CQZ H;  3HOV G;  1N33 L;  5HGQ A;  5IWA L;  4LF4 L;  3OW2 A;  3PO3 H;  4JI1 L;  4HJ9 A;  1KD1 C;  3CC2 A;  3RLF A;  2I5L X;  1JJC B;  4EX5 A;  2KBN A;  3UDX A;  1NMG A;  1U0L A;  3CP0 A;  2VNU D;  3B6Y A;  1UE1 A;  1Q1B A;  2JJQ A;  3AFQ A;  3NBH B;  4QIW E;  2ZJP A;  2R92 H;  3M7N A;  4DAY B;  4LW1 A;  2OCE A;  1OTC A;  1N32 L;  3J81 i;  1IBL L;  1E24 A;  2K4K A;  1CUK A;  1JMC A;  2AKW B;  2C35 B;  1CKN A;  4HIK A;  2UUC L;  1G6P A;  1W3S A;  3CCJ A;  1Y1W G;  1EOV A;  4LF5 Q;  3PCO B;  5M5Y H;  1HZB A;  1A0I A;  2KEN A;  4JI0 Q;  4DR5 Q;  3HOV H;  1XMQ L;  4KHZ A;  2OWO A;  2K75 A;  4A93 G;  2EXD A;  4LFA Q;  1EFW A;  3M4P A;  2ZTC A;  1YJ9 A;  3UDF A;  1UEB A;  5HY6 A;  2PI2 A;  1N8R C;  5C44 H;  4JI8 Q;  3L2P A;  3S1M H;  1X3F A;  5IYD G;  1M1K C;  2B63 H;  4JG2 A;  3RN5 A;  5IP9 G;  3M85 A;  3PSI A;  3S1R H;  1VQM A;  1Q12 A;  1XMQ Q;  3S2D H;  4A3D G;  2WAQ G;  1L0W A;  4UP8 A;  3GTP H;  4JI5 L;  5BR8 L;  2HHH L;  2D0O A;  1XNQ L;  3KF6 B;  5GQO A;  4AQY L;  2OTJ A;  3ULP A;  5K36 G;  4OWT B;  4A76 A;  1YI2 A;  1JJG A;  4YWK A;  4DV2 L;  2LSS A;  4YWL A;  1SRO A;  1NJI C;  4DR6 L;  4LFA L;  4PZ8 A;  1KL9 A;  3K81 C;  2JK8 A;  5M3M G;  3TRE A;  2RCN A;  4GLA C;  4LWC A;  4AQY Q;  3J81 j;  4LFB L;  2NVQ H;  1TXY A;  2NVY H;  2MO0 A;  1VQ4 A;  1IZ6 A;  4YY3 L;  1DGS A;  1YZ6 A;  2K14 A;  4DV2 Q;  1X56 A;  3CCL A;  4DR6 Q;  4DV1 Q;  4LF6 L;  2UXB Q;  3BZK A;  4X6A H;  3CCV A;  4R4I A;  2UXC L;  3MXN B;  1VQG A;  4BY1 G;  1VQC A;  3HOZ G;  1K8A C;  4LFB Q;  2CFM A;  3KJO A;  3EIV A;  1WCM G;  2MO1 A;  2XGT A;  3HOW G;  3K80 C;  2R93 G;  2JA7 G;  1IYJ B;  3I4O A;  1I50 H;  1WFQ A;  2E8G A;  4C3H H;  3CCR A;  1YJW A;  1X65 A;  1QVC A;  3ERS X;  1X55 A;  5M3M H;  1PH2 A;  4Y52 H;  3H3V H;  1JE5 A;  2K5N A;  2I0Q A;  4KHP L;  3F1Z A;  5FLX c;  4LF9 Q;  2E5L Q;  5C3E G;  3U4V A;  1UWV A;  3KDF A;  1LUZ A;  5AJ3 Q;  5IY0 A;  3I2Z A;  3ICE A;  1X3E A;  2L15 A;  4JCV E;  5GAE C;  3M4Q A;  3JAM c;  1GM5 A;  2UUA L;  4IPG A;  4X66 L;  4HIM A;  4XTC S;  5ELO A;  4GN4 B;  3I56 A;  3DLL A;  4LUO A;  4BY1 H;  4Y7N H;  4X64 Q;  5IYB G;  1C7Y A;  3HOZ H;  4KHP Q;  1K73 C;  1KAW A;  4K0K Q;  4NB3 A;  1KC8 C;  4QQB X;  4GNX B;  4RG1 A;  3GTG H;  1HZA A;  1WCM H;  3S2H H;  3RLN A;  3M4O H;  3UE1 A;  4WJ3 M;  3K0X A;  1JT8 A;  3I4N G;  4JI7 Q;  4DPG A;  3PUX A;  4LF8 L;  3KJP A;  2UUA Q;  5JJI A;  2VQF Q;  4IFD I;  4OO1 I;  4GLX A;  2MNA A;  1HR0 L;  4AYB G;  3T1Y L;  1IBM L;  1E1T A;  1PHJ A;  1QZG A;  3U4Z A;  3K7U C;  1X9N A;  2I5M X;  3STB D;  3KOJ A;  2UU9 Q;  1VS0 A;  4TQU S;  5E7N A;  5M5W H;  1KIX A;  4NXM L;  3J7Z C;  1SMX A;  3VDY A;  1WYD A;  4LF8 Q;  1KHI A;  4ME3 A;  2CCZ A;  3UDI A;  3DM3 A;  2Y0S E;  1HR0 Q;  1IBM Q;  3I4M G;  2BA0 A;  1MJC A;  1TWG H;  5IYB H;  1S40 A;  1G29 1;  4H02 A;  4R4O A;  5JJL A;  3OYY A;  5LMN Q;  4JOI C;  4YHH L;  4IOA A;  2AHO B;  3S16 H;  2N78 A;  1GD7 A;  2N3S A;  2R7D A;  4NXM Q;  3JC6 6;  3I4N H;  2Z6K C;  1FJG Q;  4BBS G;  1S3O A;  3PV0 A;  2RHQ B;  1K3R A;  4GOP A;  3CPW A;  4GNX C;  3E0E A;  3PO2 G;  3PUY A;  3CCM A;  3TS2 A;  2LXJ A;  2YTV A;  4C3J H;  3S17 H;  4A3G G;  3CXC A;  2YYZ A;  2KCM A;  1CKN B;  4YHH Q;  3Q8D A;  4TVA B;  4LF5 L;  1PFS A;  2AWO A;  4AH6 A;  2R7F A;  2B29 A;  1OXT A;  4JI0 L;  2IHF A;  4DR5 L;  2IX1 A;  5FLM G;  3GTL H;  3CC7 A;  3AFP A;  3L0O A;  2Q2H A;  3RR5 A;  4HJ8 A;  3S14 H;  3F2D A;  4JI2 Q;  1SRU A;  3I55 A;  4A3E G;  2JA5 H;  1X3G A;  4HJA A;  2WB1 G;  2BA1 A;  4JBM A;  4JI8 L;  1B70 B;  2DGY A;  3NEN A;  1E7Z A;  3J81 c;  2Q2U A;  4A3B G;  1EIF A;  4P71 A;  4GN5 A;  1K9M C;  1I94 L;  1VQ7 A;  4BBS H;  2D0P A;  4BBR G;  4DK6 C;  3PO2 H;  4BY7 G;  1AH9 A;  1OXV A;  2IHE A;  1YIJ A;  1YEZ A;  1VQ9 A;  1I3Q H;  2KHI A;  2GVB A;  4MZ9 A;  2UXD L;  4A3G H;  1C0A A;  4OWX B;  4A3L G;  3MEF A;  1GO3 E;  2VY3 A;  4IO9 A;  1SFO H;  3FP9 A;  1SR3 A;  1HJP A;  1WJJ A;  2EQS A;  2N8N A;  4IPH A;  1I94 Q;  1VQK A;  3A5Z B;  4OXP A;  1YNX A;  3G6E A;  3CD6 A;  4JV5 Q;  1XPR A;  4R1J A;  1PH6 A;  4KLK A;  4NPS A;  5FLM H;  2IY5 B;  3ULJ A;  4DR2 Q;  3F8T A;  3F2C A;  3T1H Q;  4A3E H;  3CCE A;  4DV5 Q;  4P72 A;  2NN6 G;  2UXD Q;  1TWC H;  4DUZ Q;  2PI2 E;  4GN3 B;  1Y1W H;  4DR7 Q;  1P8L A;  1VQH A;  2ZJR A;  4DV1 L;  3PUW A;  2PNH A;  2UXB L;  5C0X J;  4BBR H;  1JB7 A;  1O7I A;  4X62 Q;  4A3I G;  1VQ6 A;  4A93 H;  3U50 C;  1Q1E A;  3OTO Q;  1A8V A;  1J5E Q;  2VL6 A;  1HZC A;  4A3L H;  1VQJ A;  1BKB A;  3PUV A;  1VQE A;  1L1O A;  5IYD H;  3TQY A;  5IYC G;  1C9O A;  5IP9 H;  3HKS A;  3GTQ H;  3RZD H;  1I5F A;  4DV7 Q;  3TEH B;  3PF5 A;  1T9H A;  4A3D H;  2VW9 A;  3H3V I;  5JEA G;  4HJ7 A;  2IX0 A;  3FHW A;  4P75 A;  1BBU A;  3HKZ G;  4JI3 Q;  5IE8 A;  4LF9 L;  3ZJY C;  2K50 A;  4C3I H;  2E5L L;  3BZC A;  1HH2 P;  1V9P A;  4J15 A;  3PGZ A;  4LUZ A;  3KF6 A;  1YBY A;  5AJ3 L;  2FXQ A;  4OON A;  2DUD A;  3KDF B;  4R4T A;  1HNW Q;  4HIO A;  3GTJ H;  4A3I H;  1VQP A;  4BA2 I;  2PQA A;  5GRO A;  4X64 L;  4K0K L;  1EQR A;  2N49 A;  3KF8 B;  1FL0 A;  1KRS A;  3AQQ A;  1K8G A;  1QVF A;  1OXU A;  2HQL A;  2XTI A;  1LTL A;  1EWI A;  1X6O A;  5IYC H;  5C0X G;  4IPC A;  4OX9 Q;  1U5K A;  4JI7 L;  2R6G A;  2VUM G;  1QZH A;  5DLQ E;  4PZ7 A;  2CQO A;  1WOC A;  3E9I A;  4L5T A;  4DNI A;  1V43 A;  2VQF L;  3CCQ A;  2JA8 G;  1OXX K;  2QA4 A;  3EBE A;  4LUV A;  4L5S A;  2EIF A;  4NXN Q;  3HFZ B;  4EQ5 A;  4JYA L;  3HOW H;  1R9T H;  2R93 H;  2JA7 H;  2UU9 L;  1HZ9 A;  3S1N H;  4GKK Q;  4LF7 Q;  4A3J G;  1PH3 A;  4MTN A;  5GAH C;  1FGU A;  2ZM6 L;  4UP7 A;  4DV6 L;  4JI6 L;  3K7A H;  3AEV A;  2K5V A;  2E2J H;  1Y1V G;  5C3E H;  3KYH C;  1RIP A;  1J6Q A;  3G4S A;  1TWA H;  1Q82 C;  4JYA Q;  5LMN L;  4B3R L;  2CWP A;  4A3F G;  2GN5 A;  4IFD G;  4OO1 G;  4P74 A;  1S72 A;  1FJG L;  3F2B A;  1AE2 A;  4A3C G;  1PH9 A;  4JBJ A;  1EQQ A;  4A3M G;  2JA8 H;  2ZM6 Q;  4GOP B;  3M3Y H;  4DV6 Q;  1IBK L;  4JI6 Q;  2WP8 J;  3EN2 A;  5M3F G;  1N34 L;  4DV0 Q;  2CWA A;  4DV3 Q;  3G71 A;  2UUB L;  1YHB A;  4DV4 Q;  4B3R Q;  1XJV A;  4YCW A;  2Z6K A;  2R7Z G;  3CME A;  3RZO H;  3CPF A;  1MIU A;  1NTG A;  4AYB E;  4A3J H;  1VQI A;  4QJF A;  4JBK A;  1TWF H;  1QUQ A;  1PV4 A;  3W1B A;  1IBK Q;  1RL2 A;  1N34 Q;  4GLV B;  4JI2 L;  3M9B A;  2HT1 A;  2NZO A;  1XPU A;  2R92 G;  2UUB Q;  2F4V Q;  4DR3 L;  3J7A 5;  4FDB A;  4B3T Q;  4A3F H;  3J80 i;  3STB C;  3RN2 A;  1YVC A;  5FJ8 G;  4R4C A;  1YHA A;  2ASB A;  3GTK H;  1A63 A;  1EUJ A;  4DUY L;  2QGQ A;  4HID A;  3A74 A;  4A3M H;  2VZA A;  1HNX Q;  1LYL A;  3I4M H;  4DR4 L;  4L5R C;  1CKO A;  5M3F H;  1IL2 A;  2VQE Q;  3HOU G;  4GKJ Q;  4DR3 Q;  2KHJ A;  2YTY A;  3PF4 A;  4A4I A;  2QEX A;  2R7Z H;  4GOP C;  2WFW A;  2JA6 G;  2F52 A;  1XMO Q;  2RHS B;  4JV5 L;  2E2H H;  1KQS A;  2A8V A;  3KLW A;  1EYG A;  4DR4 Q;  1GKH A;  2ZTD A;  4A75 A;  5JEA J;  5C44 G;  2BH8 A;  4DR2 L;  3T1H L;  2RF4 A;  1BVS A;  4DV5 L;  2B63 G;  4IOC A;  1Y14 B;  3IRB A;  4DUZ L;  1N33 Q;  4POG A;  4UP9 A;  4DR7 L;  4LF4 Q;  5IWA Q;  4JI1 Q;  5FJ8 H;  2PMZ E;  1H95 A;  1YJN A;  1PA6 A;  2AMC B;  2YV5 A;  5LMU L;  2I5H A;  2BH2 A;  4X62 L;  2YTX A;  3S24 A;  1HNZ L;  2V1C C;  3OTO L;  4B3M L;  1XTD A;  4PG3 A;  1J5E L;  2YU9 H;  2WB1 E;  1PH8 A;  3U58 A;  1KRT A;  2OQ0 A;  4IJL A;  2D62 A;  4APV A;  3HOU H;  4QGU A;  2Z0S A;  2K5H A;  2JQO A;  3CAM A;  3CW2 C;  4A3B H;  1Q86 C;  1ASY A;  1IBL Q;  1N32 Q;  1VCI A;  2JA6 H;  1L1O B;  2A19 A;  1VQ8 A;  5LMU Q;  4DV7 L;  2NVT H;  3A5U A;  3SGI A;  5M5X H;  1Q7Y C;  4KI0 A;  1HNZ Q;  4BY7 H;  1FVI A;  1WI5 A;  3HOX G;  4JI3 L;  2UUC Q;  4B3S L;  1D8L A;  1BBW A;  1V1Q A;  4B3M Q;  1PYS B;  1SLJ A;  3AYH B;  2NN6 I;  4JI4 L;  3PUZ A;  1VQD A;  3GO5 A;  3LGJ A;  1E1O A;  1K83 H;  1UE5 A;  2WAQ E;  1MKH A;  4UPA A;  1HNW L;  1VQL A;  3UE0 A;  2HIV A;  1VQ5 A;  2NZH A;  1EIY B;  2NVX H;  3GTO H;  4B3S Q;  3ULL A;  4QY7 A;  2PQA B;  4JI4 Q;  1MJE A;  3WWV A;  2F4V L;  4BXX G;  4GKJ L;  4DR1 L;  2MQH A;  1CSP A;  4OX9 L;  4JC0 A;  5BR8 Q;  2HHH Q;  4JI5 Q;  1XNQ Q;  2ATW A;  4IFD J;  1KXL A;  1E3P A;  4A3K G;  3CCU A;  1PH1 A;  4GS3 A;  3D31 A;  4AIM A;  1VQN A;  4OWW B;  5C4X G;  3GTM H;  3HOX H;  1N9W A;  3G48 A;  4P73 A;  4WJ4 A;  3FKI G;  2ZTE A;  1E22 A;  3BU2 A;  4NXN L;  1XNR L;  1Q81 C;  1PH4 A;  1NMF A;  2Q2I A;  2ID0 A;  1L1O C;  1AE3 A; 
#chains in the Genus database with same CATH topology
 5M5W B;  3FRP B;  4YCV A;  1SNO A;  4FNF A;  5AFW A;  2FFK B;  2F3W A;  2K52 A;  1TWG B;  1AW7 A;  1XPO A;  1E0B A;  1U9R A;  3H0G G;  3CCS A;  2Q2T A;  4JBW A;  1XNR Q;  2ZXP A;  3E0J A;  1EQT A;  4LFC L;  1YIT A;  1Z47 A;  3DEO A;  4LAA A;  3I4N B;  5JOB A;  2UXC Q;  3ERQ A;  4ZLT F;  3K0Y A;  2VS1 A;  5C4X H;  2VB2 X;  2IT1 A;  1JOK A;  3JAM i;  4RFB A;  1G51 A;  3J80 L;  1EU3 A;  1L2F A;  4DV3 L;  4C2M H;  2OTL A;  2HIX A;  2MFI A;  5KNB A;  1B8A A;  4A3F B;  4LFC Q;  3C2P A;  3F2U A;  2J7Z A;  3KF8 A;  5EPK A;  2VUM H;  2AWN A;  1N36 L;  1W2B A;  2ICI A;  5M3F B;  1SYD A;  3OWE B;  4QL5 A;  3GV3 A;  5EKK A;  4WRD A;  4CKE A;  1CZG A;  1P16 A;  4X66 Q;  4PZ6 A;  3FDT A;  1PH5 A;  2ZXR A;  5LL6 S;  4R4Q A;  1AN8 A;  1S5D D;  5J3B A;  1N36 Q;  3A56 A;  4C3J G;  1B7Y B;  5IT9 E;  1HNX L;  5CV8 A;  1JJ2 A;  1TWH H;  3TS0 A;  3HOY H;  1TKW B;  3GP7 A;  1VQO A;  1MHW C;  2ZXO A;  3QB3 A;  1H9M A;  1PLF A;  3NEM A;  1LAB A;  5IP7 H;  1CKM A;  1EWC A;  3L7Z C;  3MXU A;  2PQE A;  3NTI A;  3J80 c;  1KNE A;  1I6H H;  5JJZ A;  2JE6 I;  3S1Q H;  4TSS A;  4C1N K;  1H9S A;  4LF4 L;  4JI1 L;  3RLF A;  2I5L X;  2KBN A;  5M5X B;  1SDF A;  1X3P A;  2TSS A;  5DAU A;  2RDH A;  2VNU D;  1BCP D;  4BS9 A;  4QIW E;  2R92 H;  1CZW A;  2FIN B;  3OWF A;  1OTC A;  2B2V C;  5CC4 A;  3C1E A;  2RSN A;  5FK9 C;  3CCJ A;  3NK9 A;  4JI0 Q;  5G3L F;  1HA6 A;  1XMQ L;  3TP6 A;  1GUN A;  1KDB A;  1UUP A;  1XWE A;  1UEB A;  1F9S A;  2PI2 A;  2CW0 D;  3PMF A;  4JI8 Q;  1C8C A;  1BR9 A;  2B63 H;  3S1R H;  3PSI A;  4J6H A;  1O7Z A;  1XMQ Q;  1Q12 A;  1OO9 B;  5ISR A;  3GTP H;  4JI5 L;  5BR8 L;  2HHH L;  1QB5 D;  5GQO A;  1FYC A;  1BUV T;  4CJ2 C;  3NBI A;  1STH A;  1JJG A;  1EYD A;  2ENB A;  1EZ8 A;  3K81 C;  1TS2 A;  3JAM L;  1STA A;  4OIJ A;  5M3M G;  3TRE A;  2RCN A;  4KKU A;  5C4X B;  4LFB L;  2NVY H;  4CGY B;  2E2J B;  4S3S A;  1HQR D;  5CGK A;  1STE A;  1JOR A;  1CHQ D;  3CCL A;  1SYC A;  2O2L D;  3BZK A;  2F0E A;  3CCV A;  2VUM B;  4R4I A;  4BY1 G;  1VQC A;  4LFB Q;  1K8A C;  4DU9 A;  1WCM G;  5CBE E;  4R8I A;  2E8G A;  2XRQ D;  1RKN A;  1X65 A;  2EY1 A;  1PH2 A;  2K03 A;  4U67 3;  4KN7 C;  4KHP L;  1EL0 A;  5C3E G;  3U4V A;  3G6J B;  3S9W A;  1UWV A;  3VR5 A;  3HOY B;  5CV7 A;  3TZD A;  5EKL A;  2AQ1 B;  1X3E A;  3JAM c;  4XTC S;  5ELO A;  3FPP A;  3DLL A;  4LUO A;  3A7A B;  3AMU A;  4X64 Q;  1SND A;  5IOC A;  5IYB G;  1C7Y A;  3HOZ H;  5EPJ A;  1K73 C;  4B9X A;  4KHP Q;  1I6H B;  3S1Q B;  3UE1 A;  2EY6 A;  5I2Y A;  2EOT A;  3T1Y L;  2F0T A;  5KIX A;  2B2Y A;  2R92 B;  4TQU S;  4NXM L;  1SMX A;  1GXD C;  4K5X A;  4ME3 A;  1EIG A;  4HCS A;  4HR7 B;  2Y0S E;  1JQY D;  1A2U A;  1RTN A;  4IOA A;  4JOI C;  5FKA C;  1H9R A;  2N78 A;  3S16 H;  4FF4 A;  4NXM Q;  1FJG Q;  3A8J E;  4I65 A;  2R3Z A;  4GOP A;  4BWG B;  2JA6 B;  2OEO A;  3E0E A;  4FYD A;  3PUY A;  1NSN S;  2IWH A;  1FNW A;  4IAL A;  4C3J H;  3S17 H;  2QKI C;  1SYG A;  1CKN B;  2KCM A;  2B63 B;  5C4H A;  1MI2 A;  1ESF A;  2B8G A;  3S1R B;  3IAY A;  4TRD A;  5G3L D;  3RD4 A;  3GTP B;  2NUC A;  1HXY D;  3GTL H;  1K28 A;  3MTS A;  2X6G A;  3S14 H;  3F2D A;  3I55 A;  4CBV A;  4JBM A;  3NEN A;  2Q2U A;  1K9M C;  4BBS H;  3PO2 H;  4BY7 G;  1VQ9 A;  2NVY B;  1G8Z D;  1SYE A;  2NYZ D;  3HOX B;  1G91 A;  5DEH A;  5E3F A;  3MEF A;  1IL2 A;  1HJP A;  2EQS A;  1VQK A;  1TT2 A;  4OXP A;  3G6E A;  4JV5 Q;  1JWU D;  1XPR A;  4R1J A;  4KLK A;  1F2M A;  1XX8 A;  4A3E H;  4P72 A;  2NN6 G;  1TWC H;  2EJG C;  3CKI B;  1P8L A;  4C1N I;  4DV1 L;  2UXB L;  5C0X J;  4A3I G;  2JN4 A;  4Q0F A;  3KBG A;  1L0X B;  4A3L H;  1RJT A;  4CDE C;  4G7O C;  3PUV A;  1VQE A;  5IYC G;  1F9R A;  3HKS A;  4HED A;  1I5F A;  4DV7 Q;  1T9H A;  3BVZ A;  2L55 A;  2Q8I B;  5JEA G;  4HJ7 A;  3HOZ B;  2IX0 A;  5IE8 A;  4LF9 L;  2K50 A;  5IGE A;  3H0G B;  1HH2 P;  1G6Z A;  2Q8T A;  3DUZ A;  4J15 A;  3OHX C;  3PGZ A;  5AJ3 L;  3KF6 A;  2FXQ A;  2DUD A;  1IW7 D;  2MHV A;  5GRO A;  4K2L A;  1EQR A;  3RUZ A;  4OEM B;  1F77 A;  2RSO A;  5D3I B;  1ET6 A;  2HQL A;  2XTI A;  1QVF A;  1LT4 D;  2EYF A;  1FGB D;  2R6G A;  1QZH A;  5DLQ E;  1S5C D;  3CCQ A;  3E9I A;  4L5T A;  1I4H A;  1JOO A;  1LLR D;  2RCF A;  1HZ9 A;  3PIO 3;  3DWP A;  3S1N H;  4DFA A;  4A3J G;  2SOB A;  2ZM6 L;  4UP7 A;  4DV6 L;  4JI6 L;  4JVZ A;  4C3J B;  2K5V A;  1Y1V G;  3S17 B;  5C3E H;  3KYH C;  1HUM A;  2LS0 1;  2BE5 C;  1RIP A;  1J6Q A;  1Q82 C;  2QDB A;  4IUU A;  4B3R L;  4A3F G;  4X3S A;  1D6E C;  3F2B A;  1AE2 A;  4A3C G;  3GTL B;  2AUK A;  2JA8 H;  1LTS D;  2ZM6 Q;  4MN3 A;  4DV6 Q;  1IBK L;  4JI6 Q;  2WP8 J;  5M3F G;  3KUP A;  2A68 C;  2XWB B;  1K8M A;  4DV4 Q;  4B3R Q;  2EYM A;  1XJV A;  4RHR A;  3T16 A;  3PO2 B;  4GZY C;  3BDC A;  1IBK Q;  3P75 A;  1RL2 A;  2HT1 A;  2NZO A;  2EXZ A;  5JPM C;  3STB C;  3RN2 A;  4IFD H;  5FJ8 G;  4R4C A;  1A63 A;  2QGQ A;  2ICE C;  3U9O A;  3DWQ A;  2VZA A;  1LYL A;  1Q3L A;  4A3E B;  3E3X A;  3KLS X;  1L0Y B;  5D3D A;  5J22 A;  4CJ0 B;  4A4I A;  2R7Z H;  3KLW A;  1EYG A;  5HUR A;  2ZTD A;  4A75 A;  5C44 G;  3T1H L;  3L9A X;  4DV5 L;  4IOC A;  1Y14 B;  3IRB A;  4DUZ L;  1N33 Q;  5CBA E;  4UP9 A;  5IWA Q;  1RD9 D;  2PZT A;  3LX0 A;  3VYU A;  1H95 A;  1PA6 A;  4HAE A;  3S24 A;  2XSC A;  1KRT A;  2OQ0 A;  3HOU H;  2KCN A;  1ASY A;  1VMP A;  1IBL Q;  1VCI A;  4BY7 H;  4KI0 A;  2N55 A;  4FXK C;  1D8L A;  1V1Q A;  3FEW X;  1PYS B;  3NTK A;  1VQD A;  2IW3 A;  2E2D C;  1SBB B;  4FXD A;  2QDL A;  1EIY B;  2QCP X;  3V2T A;  1U4R A;  1BNZ A;  2KOL A;  2PQA B;  1WCM B;  3HS0 C;  1MJE A;  4DR1 L;  3S1N B;  3VR2 A;  2WIN B;  2F0N A;  3CCU A;  3C3L A;  2QEJ C;  5C4X G;  3DM1 A;  3MWY W;  3NWS A;  3GTM H;  1N9W A;  1SYB A;  5C3E B;  2RDF A;  1E22 A;  2Q2I A;  2ID0 A;  5A2Q E;  1L1O C;  3M4O H;  5GAD C;  4IUR A;  4DR1 Q;  4M1U B;  4GKK L;  5I6W A;  4LF7 L;  2JA8 B;  3HKZ E;  4F8M A;  1CTM A;  2RA4 A;  4YY3 Q;  5JEA H;  2EYL A;  2OQK A;  2M00 A;  3W1G A;  1O7Y A;  3ERO A;  4BXX H;  2CHB D;  2F0D A;  1E2W A;  3VA5 A;  4HJ5 A;  2B2W C;  4YCU A;  1MBY A;  2KCC A;  4DV0 L;  4HMJ A;  1UE6 A;  3KFU A;  1HRJ A;  1RCV D;  2N88 A;  3HOY G;  5H1S E;  5ELC A;  3R2I A;  3R8B A;  5GAG C;  2ES2 A;  1GUT A;  3CF5 A;  5JJK A;  2M9V A;  5IP7 G;  3DEP A;  3S15 H;  4XT1 B;  2DY7 A;  3GV6 A;  1CSQ A;  2CKZ B;  4B3T L;  4DK3 C;  5KNC A;  1V1P A;  1HR0 W;  4JW0 A;  4YWM A;  4HSV A;  4GNX A;  3NEL A;  2EZV A;  4KHV A;  2K33 A;  3CC4 A;  1Y1V H;  5CV6 A;  3RLO A;  5FOB B;  2VQE L;  1EFI D;  4ABN A;  3PIP A;  4V19 0;  1SFO B;  2ZJQ A;  1I4X A;  3D0F A;  2NB0 A;  1ZKO A;  2PMZ B;  4A3C H;  1PYB A;  2F0U A;  2DNC A;  1PTO H;  4RCN A;  4DAM A;  2O5J C;  2H5X A;  3Q23 A;  5EAY A;  1LTA D;  4RGT A;  3D8G A;  1KD1 C;  3UDX A;  4BY7 B;  1NMG A;  4IN3 A;  3BVG A;  1U0L A;  1AEX A;  1S5B D;  2L0C A;  3LNN A;  3CP0 A;  2AQ2 B;  2JJQ A;  3NBH B;  2ZJP A;  4DAY B;  4LW1 A;  5A35 A;  3SK8 A;  4QB4 A;  3J81 i;  4DF7 A;  1E24 A;  1JMC A;  1CUK A;  2AKW B;  2C35 B;  2UUC L;  1W3S A;  2K04 A;  1Y1W G;  1ILP A;  1K0S A;  1A0I A;  1GUO A;  4DR5 Q;  3HOV H;  4KHZ A;  3D6W A;  2K75 A;  3Q0A A;  2EXD A;  4A93 G;  4B9W A;  3I90 A;  1YJ9 A;  3GTM B;  1SYF A;  2MP1 A;  5C44 H;  3M4O B;  4JG2 A;  5IP9 G;  1VQM A;  2RVL A;  3H6M A;  3S2D H;  4A3D G;  4UP8 A;  4AQY L;  1AZQ A;  2OTJ A;  1JOQ A;  3DHQ A;  4OWT B;  1YI2 A;  1H9J A;  4YWK A;  4DV2 L;  5IIF A;  1FR3 A;  1SRO A;  1NJI C;  4DR6 L;  4LFA L;  4PZ8 A;  2JK8 A;  2QIL A;  1PRT D;  1LTI D;  2AUJ D;  4IUQ A;  4AQY Q;  1QWY A;  1SNM A;  4K8I A;  1TXY A;  2A6E D;  1U4M A;  4DK0 A;  1H9K A;  1B1Z A;  1YZ6 A;  4DV2 Q;  2FMC A;  1EY5 A;  1PDQ A;  2B8F A;  4DR6 Q;  4QCL A;  3ND9 A;  4J1M A;  1B53 A;  3SR1 A;  3BS1 A;  1FD7 D;  2UXC L;  3MXN B;  1VQG A;  1EOT A;  3HOZ G;  1HHV A;  1SMY D;  2CFM A;  3S15 B;  3VR6 A;  1S5E D;  2MO1 A;  1ONL A;  3K80 C;  4N9P A;  3I4O A;  2SNS A;  1WFQ A;  1SSO A;  1D1K A;  5BN4 A;  1GJX A;  1QVC A;  4A3J B;  3H3V H;  1PZJ D;  3F1Z A;  2SDF A;  3QWN A;  5FLX c;  2E5L Q;  2DN8 A;  3X3M A;  1Y1V B;  2OXP A;  1QG7 A;  5IY0 A;  3I2Z A;  2O4X A;  4H7B A;  3M4Q A;  2HDM A;  4X66 L;  4GN4 B;  3I56 A;  3T13 A;  2PNR C;  2PZU A;  1KC8 C;  4EVO A;  3R3O A;  3S2H H;  3RLN A;  4K5W A;  2OF1 A;  1WTW A;  4DPG A;  1PTO D;  3PUX A;  4LF8 L;  3KJP A;  3NPP A;  4GLX A;  4AYB G;  3K7U C;  1LT6 D;  3KOJ A;  2UU9 Q;  1XTC D;  1HA5 A;  5E7N A;  3J81 L;  2QF7 A;  3J7Z C;  4LF8 Q;  2CCZ A;  3D3R A;  1H9S B;  2BA0 A;  1O80 A;  3J7Y W;  3W2D A;  5LHY 1;  5LMN Q;  3SXH A;  4DK1 A;  3K5L A;  1D5Z C;  2F1M A;  1ML0 D;  5D14 A;  3TN2 A;  4BBS G;  1BCP B;  1PXU A;  3CPW A;  3PO2 G;  1LTT D;  3TS2 A;  2LXJ A;  3TBI B;  5C44 B;  3CXC A;  3Q8D A;  1PFS A;  2B29 A;  3S2D B;  4JI0 L;  2IHF A;  2PW7 A;  3Q6S A;  3CC7 A;  4HJ8 A;  3NE5 B;  1ENC A;  2C5C A;  1GUG A;  2EJF C;  4A3E G;  4I7A A;  4HJA A;  4JI8 L;  2Z6B A;  3M7G A;  4KJO A;  1E7Z A;  3J81 c;  1C4Q A;  4B08 A;  4F7X A;  4ZUJ A;  1VQ7 A;  1I94 L;  1HQM C;  4I7Z C;  4KY5 A;  2IHE A;  1YEZ A;  1NR2 A;  4A3G H;  4OGQ C;  4A3L G;  4UDU C;  2F0O A;  1SR3 A;  4CJ1 B;  1I94 Q;  1QNK A;  3A5Z B;  1YNX A;  1QE6 A;  5KGU A;  5FLM H;  4XYQ A;  5LL6 X;  2EDG A;  2IY5 B;  4DR2 Q;  1YNJ D;  1WD1 A;  3R93 A;  1Y1W H;  4DR7 Q;  1VQH A;  3PUW A;  2D5D A;  3J7A F;  4A93 H;  1EY4 A;  1Q1E A;  3OTO Q;  1IKM A;  1A8V A;  1Z7T A;  1J5E Q;  3FPU B;  4C2M B;  2F4I A;  3GTQ H;  1C9O A;  5IP9 H;  4LMQ D;  4A3D H;  3TEH B;  4ODG A;  2VW9 A;  3H3V I;  4ZYS A;  4JI3 Q;  1BBU A;  4C3I H;  3S2H B;  4WFN 3;  1W6J A;  3HEJ A;  3OSO A;  1YBY A;  4OON A;  1WTR A;  4R4T A;  1HNW Q;  1SJE D;  1Y69 U;  1BO0 A;  1JIC A;  1VQP A;  4ZAI A;  4XQQ A;  4RKL A;  1HCZ A;  1EQV A;  4X64 L;  2BOS A;  4PQX A;  1FL0 A;  1DYQ A;  1K8G A;  1TWH B;  5ELF A;  2PO4 A;  4RGN A;  1TQO A;  1X6O A;  1HTL D;  1R4P B;  4IPC A;  1U5K A;  4HCE A;  4R9W A;  2F0F A;  2CQO A;  4DNI A;  1MD2 D;  2JA8 G;  2L4N A;  2M2L A;  2QA4 A;  4MTK A;  4DA2 A;  4NXN Q;  4EQ5 A;  1BF4 A;  2R61 A;  3A8K E;  3MA2 B;  3VA7 A;  1TVX A;  4FF2 A;  3TME A;  2L11 A;  4MTN A;  1STN A;  1FGU A;  3WOE A;  2CQA A;  3K7A H;  3SE0 A;  2XVS A;  5I6Y A;  3AEV A;  2L9H A;  1BDO A;  1I4R A;  3G4S A;  1TWA H;  5FO7 B;  1TS3 A;  4IFD G;  1JB3 A;  1FJG L;  2CH4 W;  1EQQ A;  3M3Y H;  1Z6H A;  4GOP B;  4ZK9 B;  4PMC A;  2CWA A;  3G71 A;  1STY A;  4TKO B;  2UUB L;  1YHB A;  2MGS A;  3OIP A;  1B9M A;  2R7Z G;  1PYW D;  1ZXT A;  2KA7 A;  1MIU A;  3P20 A;  1TWF H;  1QUQ A;  4N9T A;  3W1B A;  1JE4 A;  2Z8L A;  1NNX A;  2UUB Q;  4LK1 C;  3J7A 5;  4FDB A;  2B2T C;  2E76 C;  1HTP A;  3A55 A;  3IFD A;  1Q8I A;  2ASB A;  3GTK H;  2B2V A;  1EUJ A;  4HID A;  3NSW A;  1G2T A;  2K01 A;  2EY5 A;  4DR4 L;  2A69 C;  5IGG A;  1RF2 D;  4N8F A;  3HOU G;  1Y1W B;  2KHJ A;  2YTY A;  2Z1C A;  1SJH D;  4DXF A;  1EY0 A;  1BOS A;  5E4X A;  1XMO Q;  5KND A;  4A93 B;  4JV5 L;  2E2H H;  2A8V A;  5J1Z A;  2F0J A;  4DR4 Q;  1F2Y A;  2BH8 A;  3OOC A;  3RMH A;  2RF4 A;  1BVS A;  4H0L C;  3GTQ B;  3NXW A;  3P1H A;  2PMZ E;  4LJZ C;  2F0I A;  4A3D B;  2YV5 A;  3BZD B;  2I5H A;  1DOL A;  3BYY B;  5E4W C;  4C3I B;  3I70 A;  1PH8 A;  4APV A;  1V8Q A;  2A6H C;  2Z0S A;  3CAM A;  1Q86 C;  5J39 A;  1N32 Q;  3FMC A;  4KN4 C;  4O1N A;  4DV7 L;  2NVT H;  3A5U A;  1WI5 A;  2J0T D;  1WD0 A;  1XYI A;  4RCO A;  2MJ8 A;  5T1G A;  1UE5 A;  2WAQ E;  1IYV A;  1WTQ A;  3MFG A;  3MFY A;  4RGO S;  3UE0 A;  4L63 B;  3GTO H;  2XN9 C;  3MHB A;  3WWV A;  2F4V L;  4BXX G;  1XNQ Q;  1NCV A;  1PH1 A;  1MSG A;  2G9D A;  3K7A B;  1A3V A;  3SK4 A;  4P2C B;  4P73 A;  3W3A A;  1TWA B;  1CA6 A;  1PH4 A;  2EJM A;  2F4V Q;  1SN8 A;  3MZ5 A;  2XWJ B;  1JCK B;  4ALP A;  2A73 B;  4O0A A;  2JEB I;  2SNM A;  2H1E A;  5D65 A;  2F0H A;  1Y8O B;  2F0K A;  4DN4 M;  4LF6 Q;  1LT3 D;  3S16 B;  2WKC A;  4MIU A;  5EJW A;  5IT9 L;  1VQF A;  4A3K H;  4BA1 I;  3AB9 A;  1TWF B;  4AYB B;  1Q46 A;  2J4X A;  1DD2 A;  1DM0 B;  3QIA A;  1ZYR C;  4DGZ A;  2GVA A;  4DV4 L;  2F0M A;  5IGD A;  3A8I E;  3GTK B;  1NY4 A;  3ER0 A;  4DNR B;  1KNA A;  5KEE A;  5DM7 3;  2K5Q A;  3I7F A;  3Q24 A;  4XIG S;  1ASZ A;  3S14 B;  3GDE A;  1Z9F A;  1M90 C;  2I46 A;  4JOI A;  1NAP A;  1HPC A;  1VQA A;  4BBS B;  3CMA A;  3E9H A;  3UDG A;  1D5X C;  1SE4 A;  2F3V A;  2K6A A;  2E2H B;  1VQB A;  2JXM B;  1K0R A;  3H91 A;  1SE3 A;  1I4P A;  4U68 A;  1YHQ A;  1PH7 A;  1Q8K A;  4QIW B;  4IJH A;  3TRZ A;  5BN5 A;  3J80 E;  2B2T A;  2L12 A;  1OXS C;  2ALY B;  3GD7 A;  4UY8 C;  5M9O A;  3PIO A;  3RNU A;  2D9U A;  5IT9 c;  4KJN A;  1KDA A;  1TU2 B;  1J8I A;  1A62 A;  4RWS C;  4OIK A;  4RMF A;  3URY A;  3A0J A;  4LNQ A;  4IPD A;  1TWC B;  2E74 C;  3CQZ H;  3HOV G;  1N33 L;  1WVL A;  5IWA L;  3PO3 H;  4HJ9 A;  1JJC B;  3T56 B;  3FVQ A;  5CMD A;  3J7A V;  2PYK A;  2KEC A;  3B6Y A;  4FXG C;  3AFQ A;  3N52 A;  3M7N A;  2O5I C;  2OCE A;  3BDO A;  1K8O A;  1CQF A;  3OMG A;  3K58 A;  1IBL L;  2K4K A;  3ONA B;  2PW5 A;  3A54 A;  3LWU A;  4HIK A;  4LF5 Q;  4ZKB B;  3PCO B;  1A3U A;  1HZB A;  2KEN A;  5I9P A;  5ELD A;  2OWO A;  3C1F A;  2K1B A;  2VB3 X;  4LFA Q;  1EFW A;  1STG A;  3K5N A;  1O78 A;  3OIQ A;  1N8R C;  3L2P A;  3S1M H;  1X3F A;  3T4A C;  1ILQ A;  3RN5 A;  3M85 A;  1KLU D;  2BDO A;  1VMC A;  4QMG A;  2LSS A;  2GA4 B;  1LTR D;  1VF7 A;  2G9H D;  3HZX A;  2JP1 A;  4A3K B;  2ZT9 C;  1B2T A;  3DMU A;  2F0G A;  1VQ4 A;  4KY7 A;  1M8A A;  4YY3 L;  1WTX A;  2K14 A;  1EYA A;  1X56 A;  1CFM A;  4X6A H;  4PNY A;  3BVM A;  1BBX C;  5K36 H;  3U9S A;  3EIV A;  4XQJ A;  3QO2 A;  2LFN A;  2XGT A;  2JA7 G;  1IYJ B;  4IZ8 A;  4CDC C;  1IKL A;  1YNN D;  4C3H H;  1UEA B;  3CCR A;  5K5P A;  3CHB D;  4UAI A;  1B9N A;  3JAM E;  1UAP A;  4UHV A;  2BE5 D;  2B39 A;  2L5T A;  2FMM A;  2HUG A;  3EFX D;  3KDF A;  1LUZ A;  1DON A;  3MC0 B;  2L15 A;  5GAE C;  4IPG A;  2LMC B;  1A15 A;  3L3O C;  2Y0S B;  1V1P B;  4K0K Q;  2A68 D;  1KAW A;  4NB3 A;  1PFB A;  1ZEQ X;  4RG1 A;  4GNX B;  3GTG H;  2XNA C;  3CQZ B;  5C3X A;  4ZQ3 A;  1JT8 A;  4JI7 Q;  4KTA A;  3PO3 B;  2R7Z B;  5JJI A;  2VQF Q;  4IFD I;  1IBM L;  1PHJ A;  4NKL A;  3U4Z A;  1X9N A;  2I5M X;  3STB D;  1AZP A;  5M5W H;  1KIX A;  3N6R A;  1K3B C;  3D6C A;  3I73 A;  5DM6 3;  1WYD A;  4KKS A;  3DM3 A;  3EQL C;  1IBM Q;  1ICW A;  3I4M G;  1MJC A;  1TWG H;  4CKC A;  1S40 A;  3QG1 A;  5JJL A;  1C48 A;  5EBC A;  3HOU B;  5C6A A;  2N3S A;  2R7D A;  3I4N H;  2Z6K C;  1S3O A;  1I4Q A;  3PV0 A;  3I72 A;  2F0S A;  1JC7 A;  3NP8 A;  2YTV A;  1PZK D;  4A3G G;  4RHS A;  3A7L A;  2DNE A;  3S1M B;  2E75 C;  1S5F D;  2G5D A;  2AWO A;  2R7F A;  4DR5 L;  3X3N A;  5FLM G;  1E2V A;  2F03 A;  4PMB A;  3TZU A;  3AFP A;  3GQB A;  1A6X A;  4JI2 Q;  3NHH A;  2MUY A;  5EGT A;  2WB1 G;  3NQT A;  1B70 B;  2DGY A;  3SHL A;  4A3B G;  3E5S A;  4JK1 C;  4GN5 A;  2D0P A;  4DK6 C;  4J8Q A;  1DZ1 A;  5EBD A;  1OXV A;  3HRZ C;  1YIJ A;  2KHI A;  2GVB A;  4MZ9 A;  4FF1 A;  4KV6 A;  1C0A A;  5L37 A;  4OWX B;  1BCP C;  4M8A A;  1GO3 E;  2VY3 A;  1SNP A;  4IO9 A;  1D2B A;  4IPH A;  3VR3 A;  1PH6 A;  2P5Z X;  1BCP F;  4L8J A;  3ULJ A;  4DAY A;  2X6L A;  5FLX L;  4C3I G;  1CI3 M;  1PRT B;  3CCE A;  1G2S A;  3SK5 A;  1I6V C;  4IUP A;  2VXW A;  4BBR H;  1JB7 A;  2KEE A;  4X62 Q;  1VQ6 A;  3U50 C;  1ROD A;  1UNS A;  4EGV A;  3KLR A;  3VYS A;  2NBF A;  1L1O A;  1NUC A;  2CW0 C;  3TQY A;  3RZD H;  1CT1 D;  3QOJ A;  1B3A A;  2K5D A;  3H09 A;  3GTG B;  4IQZ A;  3ZJY C;  2E5L L;  3BZC A;  1V9P A;  1CM9 A;  1DCZ A;  4LUZ A;  4HIO A;  1JWM D;  4ZKC B;  4BA2 I;  2B2W A;  4K6D A;  3KF8 B;  1KRS A;  3QJY A;  2EY2 A;  3G7L A;  3H3V C;  1LTL A;  4OX9 Q;  4HTH A;  3DXJ C;  4IUN A;  1Y8N B;  3HP3 A;  1WOC A;  1JR0 D;  1V43 A;  2KQ3 A;  1OXX K;  4LUV A;  5I9O A;  4L5S A;  2EIF A;  4K2K A;  1PTO B;  4NP5 A;  5TSS A;  4JYA L;  4YIJ A;  4E6I A;  5IOD A;  5C3W A;  2UU9 L;  2JA7 H;  3MXN A;  1B3Q A;  1I4G A;  1LTB D;  2NTT A;  1PH3 A;  1X32 A;  4KD4 A;  1SNQ A;  2IJ0 A;  2E2J H;  1R4Q B;  4MHE A;  4JYA Q;  5LMN L;  1A2T A;  2CWP A;  4OO1 G;  4IUT A;  5C0X H;  1F9Q A;  5ELB A;  1PH9 A;  3K59 A;  4FVM A;  4G7Z C;  3PQI A;  2EYO A;  4DV3 Q;  4ULL A;  5JVG 3;  1EU4 A;  2X69 A;  4L6T B;  2Z6K A;  3LWE A;  4YCW A;  3CME A;  1SNC A;  5COY A;  4IUV A;  3RZO H;  3HOV B;  4AYB E;  1VQI A;  1TS5 A;  4QJF A;  4JBK A;  1PV4 A;  2B2Y C;  2CH4 A;  4X3K A;  4GLV B;  2K05 A;  3M9B A;  1FNU A;  4RAU C;  2FJ2 A;  1KAB A;  3EA6 A;  1CA5 A;  3NQI A;  3TP5 A;  1GUS A;  2QW7 A;  4RA8 A;  4A3M H;  1HNX Q;  1LAC A;  3I4M H;  4L5R C;  1QNU A;  4HSP A;  2PZW A;  4G4K A;  4GOP C;  2WFW A;  4BBR B;  2DJG C;  1AFP A;  3BG3 A;  1KQS A;  1TY0 A;  1GKH A;  5JEA J;  4DR2 L;  2PCF B;  4ILW A;  2LKV A;  2KVM A;  2EPB A;  4POG A;  4LF4 Q;  4DR7 L;  2KUM A;  1V1O A;  4JI1 Q;  3RZD B;  5CYU A;  1YJN A;  2F0V A;  2AMC B;  1STB A;  5LMU L;  5IGC A;  1GOZ A;  1HNZ L;  3OTO L;  4B3M L;  4PG3 A;  1QOH A;  1J5E L;  2YU9 H;  4IJL A;  3OPO A;  4QGU A;  2JQO A;  2Z4I A;  3CW2 C;  4A3B H;  4K14 A;  2JA6 H;  2B2U C;  1VQ8 A;  5LMU Q;  4XQN A;  1LV9 A;  3VR4 A;  1Q7Y C;  1HNZ Q;  2EYP A;  3MXP A;  3VYT A;  4B3M Q;  4JI3 L;  5A2Q L;  4CKB A;  1BBW A;  1SLJ A;  1A3T A;  4JI4 L;  3PUZ A;  3GO5 A;  3LGJ A;  3EVQ A;  1VDZ A;  1DXM A;  1K83 H;  1HNW L;  4H13 C;  1VQL A;  2HIV A;  5I4D A;  3KK7 A;  1VQ5 A;  2NZH A;  3HKZ B;  3CRK C;  5COR A;  2NVX H;  3D4D A;  3CU7 A;  4ID6 A;  5C5M A;  4QY7 A;  3ULL A;  4Q5V A;  5EPL A;  4JI4 Q;  2JA7 B;  1EY9 A;  2KHS A;  1DJR D;  3WOF A;  4GKJ L;  2MQH A;  4JC0 A;  5BR8 Q;  2HHH Q;  4JI5 Q;  4KMU C;  2ATW A;  3R2T A;  4A3K G;  3O13 A;  2DJF C;  3NUC A;  3HOX H;  2ZTE A;  3BU2 A;  4NXN L;  4DUY L;  2NZ1 D;  1AE3 A;  4GKJ Q;  1SE8 A;  1LM0 A;  1II3 A;  3MXG A;  3QR8 A;  1UE7 A;  1NBW A;  3SK6 A;  4L5Q A;  4DKA C;  2JA9 A;  1KLG D;  4CDD C;  3BJU A;  2A1A A;  4DUY Q;  3K8A A;  3RZO B;  4NW2 A;  5C0X I;  5C4J H;  1M4V A;  5I2X A;  1IW7 C;  1JWS D;  1EIH A;  1PVO A;  2B3G A;  2A74 C;  3D4W A;  2F0Q A;  2KCT A;  3FKI H;  2LXK A;  3K6O A;  2WAC A;  3ZYY X;  3NTH A;  4K8J A;  4EQN A;  1E2Z A;  1X54 A;  1EWH A;  4A3M B;  1BQQ T;  3AU7 A;  1EZ6 A;  2Y0S G;  3I4M B;  3I3C A;  1QUQ B;  3W5O A;  1D1I A;  3H0G H;  4X65 L;  3I91 A;  2F3I A;  4G7H C;  2E2I H;  3BYT B;  1NE3 A;  2PPB C;  1PFM A;  3M4Y A;  3PO3 G;  1QVG A;  1TR5 A;  2Z4H A;  1LT5 D;  2BDN A;  4PMW A;  1DOK A;  4POF A;  1T5E A;  5LMN W;  1IXR A;  4A3G B;  4X65 Q;  3H15 A;  4K5V A;  1U4P A;  1D7Q A;  4MNO A;  4R8N A;  4V0B A;  4ZRZ A;  4OO1 H;  3EJI A;  3T1Y Q;  5JAV A;  1XMO L;  2IL8 A;  3HGB A;  2IX3 A;  1GVP A;  3P7J A;  2K28 A;  5ELN A;  2JA5 G;  2YU9 B;  2JEA I;  2WB1 B;  4O2D A;  4A3B B;  2XRS D;  5HGQ A;  3OW2 A;  3CC2 A;  3E6Z X;  4EX5 A;  2RDG A;  4XT3 B;  4F87 A;  4OEL B;  1UE1 A;  1Q1B A;  1B50 A;  5F2D A;  4WOR A;  1K83 B;  1GUW A;  4KD3 A;  1N32 L;  1SAP A;  1X3Q A;  2NVX B;  1Q90 A;  4XXE A;  1G6P A;  1CKN A;  1ESR A;  4O42 A;  3TP8 A;  1NR4 A;  3D4R A;  1EOV A;  5M5Y H;  1LTG D;  3TDQ A;  1TY2 A;  2B2U A;  2EYH A;  3M4P A;  5DNF A;  2ZTC A;  3UDF A;  5HY6 A;  1CHP D;  1T5X D;  1F2Z A;  1M1K C;  5IYD G;  5C5L A;  2OT2 A;  4CDF C;  2BCO A;  2WAQ G;  1L0W A;  2JSO A;  2F0W A;  1XNQ L;  2D0O A;  3KF6 B;  4K6L A;  3IKJ A;  3ULP A;  4ZUI A;  5K36 G;  4A76 A;  1QIL A;  1IL8 A;  1CQV A;  1S4Z A;  2V4D A;  4YWL A;  1KL9 A;  1U4L A;  4G57 A;  4C3H G;  2D2C C;  4X3U A;  1MGS A;  3V96 A;  5C4J B;  4GLA C;  1ENF A;  3ND8 A;  4LWC A;  3J81 j;  2NVQ H;  2H4O A;  2MO0 A;  1IZ6 A;  5KYL A;  3FKI B;  2DY8 A;  1DGS A;  2JYO A;  4QF4 A;  1EY7 A;  1VF5 C;  4NDX A;  4DV1 Q;  4LF6 L;  2UXB Q;  5E1F A;  3C46 A;  1ENA A;  1KAA A;  3M3Y B;  1RDP D;  3KJO A;  5FLX E;  3HOW G;  1WTP A;  1DOM A;  1KDC A;  2R93 G;  2E2I B;  1I50 H;  5NUC A;  1YJW A;  3ERS X;  1X55 A;  3K5O A;  5M3M H;  4Y52 H;  1B4O A;  1JE5 A;  2K5N A;  2I0Q A;  3WDN A;  4LF9 Q;  5C4Z A;  1HFN A;  4N8X 1;  1Y8P B;  5AJ3 Q;  2TMP A;  3ICE A;  4JCV E;  5CV9 A;  1GM5 A;  2NTS A;  2UUA L;  3VYR A;  4HIM A;  4WJW A;  4BY1 H;  4Y7N H;  4QQB X;  5KYI A;  4FO2 A;  1HZA A;  1WCM H;  5JPN C;  4KKT A;  4WJ3 M;  3K0X A;  4DXG A;  1F9P A;  3I4N G;  2K5W A;  2Q8R E;  4HMI A;  1YNN C;  2UUA Q;  4OO1 I;  1J9O A;  2MNA A;  1HR0 L;  1E1T A;  1QZG A;  4OL7 A;  3SDZ A;  4EQP A;  4Z9C B;  1VS0 A;  2NWG A;  4NMZ A;  3VDY A;  2SEB D;  1FNV A;  1KHI A;  4OHJ A;  1WTV A;  3UDI A;  2RKS A;  2A69 D;  1HR0 Q;  5IYB H;  3UI2 A;  1G29 1;  4H02 A;  4R4O A;  5FO9 B;  1IHZ A;  5M5Y B;  3OYY A;  4YHH L;  3CRL C;  2AHO B;  2KJX A;  1GD7 A;  4JPB W;  3JC6 6;  4FP5 D;  2RHQ B;  1K3R A;  4GNX C;  1SXT A;  2HQE A;  4ME5 A;  3CCM A;  2NVT B;  3I8Z A;  2YYZ A;  4ZCK A;  4YHH Q;  4LF5 L;  4TVA B;  3OW7 A;  4AH6 A;  3MEH A;  4QUC A;  1OXT A;  3J81 E;  3H94 A;  2IX1 A;  1EEF D;  2RBM A;  3L0O A;  2Q2H A;  3RR5 A;  3GTO B;  2C9O A;  1SRU A;  2A6H D;  4RKB A;  2JA5 H;  1X3G A;  2BA1 A;  5KRU A;  3OMC A;  1EY8 A;  4KY6 A;  1EIF A;  4P71 A;  4BBR G;  1EEI D;  1CK1 A;  1QJO A;  2NVQ B;  1AH9 A;  5EKI A;  1I3Q H;  2UXD L;  2LY7 A;  1W6K A;  2K7V A;  1SFO H;  3FP9 A;  2WII B;  1WJJ A;  2N8N A;  3SEB A;  5IGF A;  3CD6 A;  2XIW A;  2F0P A;  4NPS A;  3F8T A;  3F2C A;  3T1H Q;  2UXD Q;  4DV5 Q;  4DUZ Q;  2A5H A;  2PI2 E;  4GN3 B;  1I50 B;  3K57 A;  1IYU A;  1WTH A;  2ZJR A;  2PNH A;  5M3M B;  1O7I A;  5EQ0 A;  4KK7 A;  2VL6 A;  1HZC A;  2Z9H A;  1AP0 A;  1VQJ A;  1BKB A;  5HGT A;  5IYD H;  1GHJ A;  4BY1 B;  3PF5 A;  4Y7N B;  1PZI D;  3FHW A;  4P75 A;  3HKZ G;  4RH6 A;  2NN6 H;  3SVM A;  3I4L A;  1KTK A;  4X3T A;  3KDF B;  1SEB D;  3GTJ H;  4A3I H;  1PRT C;  1QCB D;  2PQA A;  2K32 A;  4DNT B;  4DAV A;  1BXT A;  1HUN A;  4EQO A;  1EY6 A;  4K0K L;  2N49 A;  5CV4 A;  1ZYR D;  1LO5 D;  3AQQ A;  2A6E C;  1OXU A;  1PRT F;  1EWI A;  5IYC H;  5C0X G;  3V05 A;  4F88 A;  4JI7 L;  2VUM G;  3IL8 A;  4PZ7 A;  2VQF L;  3BDL A;  5JVH 3;  2IPK D;  1PMR A;  3EBE A;  1O7L A;  2KED A;  3HFZ B;  1B44 D;  1SMY C;  5T1I A;  3PIP 3;  3HOW H;  1R9T H;  2R93 H;  1RTO A;  3Q22 A;  1ICF B;  4GKK Q;  4LF7 Q;  1F2L A;  5GAH C;  4DAP A;  2HD3 A;  4XYO A;  3KBX A;  2GN5 A;  4P74 A;  1HFG A;  4CHT B;  3TSS A;  1WTO A;  1S72 A;  4JBJ A;  4A3M G;  1EYC A;  2RQX A;  3HG9 A;  3IFT A;  4C56 C;  3EN2 A;  1N34 L;  4DV0 Q;  2JA5 B;  4XDX A;  2L1B A;  1MSH A;  4FF3 A;  3CPF A;  1NTG A;  1TII D;  3K5M A;  4A3J H;  1PTO C;  1D5M C;  1I3Q B;  3DWA A;  1N34 Q;  4JI2 L;  1XPU A;  2R92 G;  3NWT A;  5ELE A;  1ET9 A;  4DR3 L;  1PTO F;  4B3T Q;  4A3F H;  3J80 i;  1YVC A;  1YHA A;  3A74 A;  2WV6 D;  1CKO A;  5M3F H;  2VQE Q;  2CVR A;  2EVB A;  4DR3 Q;  3PF4 A;  1RHP A;  3KLS A;  2QEX A;  2JA6 G;  2F52 A;  2RHS B;  2WKD A;  2HCC A;  5CR3 A;  2B63 G;  2HCI A;  1SE2 A;  4QUF A;  4H44 C;  5FJ8 H;  2EE1 A;  2AQ3 B;  5BN3 A;  2WAQ B;  2BH2 A;  4X62 L;  2YTX A;  2F0L A;  2V1C C;  3NBH A;  1XTD A;  1XXG A;  2WB1 E;  3QOL A;  3U58 A;  2D62 A;  2K5H A;  3ITP A;  4C3H B;  3GTJ B;  5IGB A;  1L1O B;  2A19 A;  4A3I B;  2I07 B;  2EYJ A;  3SGI A;  5CV5 A;  5M5X H;  3MAQ A;  1FVI A;  2UUC Q;  3HOX G;  4B3S L;  3AYH B;  2NN6 I;  4HN7 A;  2FHT A;  1E1O A;  1MKH A;  4UPA A;  1PFN A;  3MVV A;  4B3S Q;  3HOW B;  2MPM A;  1R9T B;  2R93 B;  1YNJ C;  4RGM A;  4PV1 C;  1CSP A;  3T53 B;  4OX9 L;  1KXL A;  1GHK A;  5FO8 B;  3TP7 A;  1TS4 A;  4IFD J;  1E3P A;  4GS3 A;  3D31 A;  4AIM A;  1VQN A;  4OWW B;  3T51 B;  2HDL A;  3G48 A;  4WJ4 A;  3FKI G;  1XNR L;  1Q81 C;  1NMF A; 
#chains in the Genus database with same CATH homology
 1SN8 A;  5GAD C;  4DR1 Q;  1SE8 A;  4YCV A;  1LM0 A;  4ALP A;  4GKK L;  1UE7 A;  4O0A A;  4LF7 L;  1NBW A;  2JEB I;  3HKZ E;  2K52 A;  1XPO A;  4YY3 Q;  4L5Q A;  4DKA C;  2JA9 A;  2OQK A;  3H0G G;  3CCS A;  2Q2T A;  4JBW A;  3BJU A;  2A1A A;  3W1G A;  1XNR Q;  4DUY Q;  4LF6 Q;  4LFC L;  4BXX H;  3K8A A;  1YIT A;  1Z47 A;  5C0X I;  5C4J H;  2UXC Q;  1VQF A;  4A3K H;  4BA1 I;  2VS1 A;  5C4X H;  3JAM i;  2IT1 A;  4HJ5 A;  4YCU A;  1Q46 A;  1PVO A;  1G51 A;  2B3G A;  2KCT A;  1L2F A;  3FKI H;  4DV0 L;  3KFU A;  1UE6 A;  2LXK A;  4DV3 L;  4C2M H;  2OTL A;  3HOY G;  2HIX A;  2MFI A;  4LFC Q;  1B8A A;  5H1S E;  4DV4 L;  2GVA A;  1X54 A;  1NY4 A;  3ER0 A;  5GAG C;  2ES2 A;  2VUM H;  2AWN A;  3CF5 A;  1N36 L;  2Y0S G;  3I7F A;  1W2B A;  4XIG S;  1ASZ A;  5IP7 G;  5JJK A;  3S15 H;  1QUQ B;  4QL5 A;  3W5O A;  3H0G H;  3GDE A;  4X65 L;  1Z9F A;  1M90 C;  1CSQ A;  2F3I A;  4JOI A;  2E2I H;  2CKZ B;  1P16 A;  4B3T L;  1NE3 A;  4X66 Q;  1VQA A;  4PZ6 A;  4DK3 C;  1PH5 A;  3PO3 G;  1QVG A;  3CMA A;  3E9H A;  4R4Q A;  4YWM A;  5J3B A;  3UDG A;  1HR0 W;  1VQB A;  1N36 Q;  4GNX A;  4PMW A;  1B7Y B;  1K0R A;  3NEL A;  4POF A;  1HNX L;  5LMN W;  1IXR A;  3CC4 A;  1Y1V H;  1YHQ A;  3RLO A;  1PH7 A;  1TWH H;  1Q8K A;  4X65 Q;  3H15 A;  4IJH A;  3TS0 A;  2VQE L;  1JJ2 A;  3HOY H;  3TRZ A;  1OXS C;  1D7Q A;  2ALY B;  4MNO A;  3PIP A;  3GD7 A;  4UY8 C;  1VQO A;  2ZJQ A;  3D0F A;  3PIO A;  3RNU A;  3T1Y Q;  5IT9 c;  1XMO L;  4A3C H;  1GVP A;  3NEM A;  1A62 A;  1PYB A;  5ELN A;  2JA5 G;  5IP7 H;  2JEA I;  1CKM A;  4RMF A;  3L7Z C;  3J80 c;  3A0J A;  4LNQ A;  1I6H H;  4IPD A;  2JE6 I;  4DAM A;  3S1Q H;  4O2D A;  2H5X A;  5EAY A;  3CQZ H;  3HOV G;  1N33 L;  5HGQ A;  5IWA L;  4LF4 L;  3OW2 A;  3PO3 H;  4JI1 L;  4HJ9 A;  1KD1 C;  3CC2 A;  3RLF A;  2I5L X;  1JJC B;  4EX5 A;  2KBN A;  3UDX A;  1NMG A;  1U0L A;  3CP0 A;  2VNU D;  3B6Y A;  1UE1 A;  1Q1B A;  2JJQ A;  3AFQ A;  3NBH B;  4QIW E;  2ZJP A;  2R92 H;  3M7N A;  4DAY B;  4LW1 A;  2OCE A;  1OTC A;  1N32 L;  3J81 i;  1IBL L;  1E24 A;  2K4K A;  1CUK A;  1JMC A;  2AKW B;  2C35 B;  1CKN A;  4HIK A;  2UUC L;  1G6P A;  1W3S A;  3CCJ A;  1Y1W G;  1EOV A;  4LF5 Q;  3PCO B;  5M5Y H;  1HZB A;  1A0I A;  2KEN A;  4JI0 Q;  4DR5 Q;  3HOV H;  1XMQ L;  4KHZ A;  2OWO A;  2K75 A;  4A93 G;  2EXD A;  4LFA Q;  1EFW A;  3M4P A;  2ZTC A;  1YJ9 A;  3UDF A;  1UEB A;  5HY6 A;  2PI2 A;  1N8R C;  5C44 H;  4JI8 Q;  3L2P A;  3S1M H;  1X3F A;  5IYD G;  1M1K C;  2B63 H;  4JG2 A;  3RN5 A;  5IP9 G;  3M85 A;  3PSI A;  3S1R H;  1VQM A;  1Q12 A;  1XMQ Q;  3S2D H;  4A3D G;  2WAQ G;  1L0W A;  4UP8 A;  3GTP H;  4JI5 L;  5BR8 L;  2HHH L;  2D0O A;  1XNQ L;  3KF6 B;  5GQO A;  4AQY L;  2OTJ A;  3ULP A;  5K36 G;  4OWT B;  4A76 A;  1YI2 A;  1JJG A;  4YWK A;  4DV2 L;  2LSS A;  4YWL A;  1SRO A;  1NJI C;  4DR6 L;  4LFA L;  4PZ8 A;  1KL9 A;  3K81 C;  2JK8 A;  5M3M G;  3TRE A;  2RCN A;  4GLA C;  4LWC A;  4AQY Q;  3J81 j;  4LFB L;  2NVQ H;  1TXY A;  2NVY H;  2MO0 A;  1VQ4 A;  1IZ6 A;  4YY3 L;  1DGS A;  1YZ6 A;  2K14 A;  4DV2 Q;  1X56 A;  3CCL A;  4DR6 Q;  4DV1 Q;  4LF6 L;  2UXB Q;  3BZK A;  4X6A H;  3CCV A;  4R4I A;  2UXC L;  3MXN B;  1VQG A;  4BY1 G;  1VQC A;  3HOZ G;  1K8A C;  4LFB Q;  2CFM A;  3KJO A;  3EIV A;  1WCM G;  2MO1 A;  2XGT A;  3HOW G;  3K80 C;  2R93 G;  2JA7 G;  1IYJ B;  3I4O A;  1I50 H;  1WFQ A;  2E8G A;  4C3H H;  3CCR A;  1YJW A;  1X65 A;  1QVC A;  3ERS X;  1X55 A;  5M3M H;  1PH2 A;  4Y52 H;  3H3V H;  1JE5 A;  2K5N A;  2I0Q A;  4KHP L;  3F1Z A;  5FLX c;  4LF9 Q;  2E5L Q;  5C3E G;  3U4V A;  1UWV A;  3KDF A;  1LUZ A;  5AJ3 Q;  5IY0 A;  3I2Z A;  3ICE A;  1X3E A;  2L15 A;  4JCV E;  5GAE C;  3M4Q A;  3JAM c;  1GM5 A;  2UUA L;  4IPG A;  4X66 L;  4HIM A;  4XTC S;  5ELO A;  4GN4 B;  3I56 A;  3DLL A;  4LUO A;  4BY1 H;  4Y7N H;  4X64 Q;  5IYB G;  1C7Y A;  3HOZ H;  4KHP Q;  1K73 C;  1KAW A;  4K0K Q;  4NB3 A;  1KC8 C;  4QQB X;  4GNX B;  4RG1 A;  3GTG H;  1HZA A;  1WCM H;  3S2H H;  3RLN A;  3M4O H;  3UE1 A;  4WJ3 M;  3K0X A;  1JT8 A;  3I4N G;  4JI7 Q;  4DPG A;  3PUX A;  4LF8 L;  3KJP A;  2UUA Q;  5JJI A;  2VQF Q;  4IFD I;  4OO1 I;  4GLX A;  2MNA A;  1HR0 L;  4AYB G;  3T1Y L;  1IBM L;  1E1T A;  1PHJ A;  1QZG A;  3U4Z A;  3K7U C;  1X9N A;  2I5M X;  3STB D;  3KOJ A;  2UU9 Q;  1VS0 A;  4TQU S;  5E7N A;  5M5W H;  1KIX A;  4NXM L;  3J7Z C;  1SMX A;  3VDY A;  1WYD A;  4LF8 Q;  1KHI A;  4ME3 A;  2CCZ A;  3UDI A;  3DM3 A;  2Y0S E;  1HR0 Q;  1IBM Q;  3I4M G;  2BA0 A;  1MJC A;  1TWG H;  5IYB H;  1S40 A;  1G29 1;  4H02 A;  4R4O A;  5JJL A;  3OYY A;  5LMN Q;  4JOI C;  4YHH L;  4IOA A;  2AHO B;  3S16 H;  2N78 A;  1GD7 A;  2N3S A;  2R7D A;  4NXM Q;  3JC6 6;  3I4N H;  2Z6K C;  1FJG Q;  4BBS G;  1S3O A;  3PV0 A;  2RHQ B;  1K3R A;  4GOP A;  3CPW A;  4GNX C;  3E0E A;  3PO2 G;  3PUY A;  3CCM A;  3TS2 A;  2LXJ A;  2YTV A;  4C3J H;  3S17 H;  4A3G G;  3CXC A;  2YYZ A;  2KCM A;  1CKN B;  4YHH Q;  3Q8D A;  4TVA B;  4LF5 L;  1PFS A;  2AWO A;  4AH6 A;  2R7F A;  2B29 A;  1OXT A;  4JI0 L;  2IHF A;  4DR5 L;  2IX1 A;  5FLM G;  3GTL H;  3CC7 A;  3AFP A;  3L0O A;  2Q2H A;  3RR5 A;  4HJ8 A;  3S14 H;  3F2D A;  4JI2 Q;  1SRU A;  3I55 A;  4A3E G;  2JA5 H;  1X3G A;  4HJA A;  2WB1 G;  2BA1 A;  4JBM A;  4JI8 L;  1B70 B;  2DGY A;  3NEN A;  1E7Z A;  3J81 c;  2Q2U A;  4A3B G;  1EIF A;  4P71 A;  4GN5 A;  1K9M C;  1I94 L;  1VQ7 A;  4BBS H;  2D0P A;  4BBR G;  4DK6 C;  3PO2 H;  4BY7 G;  1AH9 A;  1OXV A;  2IHE A;  1YIJ A;  1YEZ A;  1VQ9 A;  1I3Q H;  2KHI A;  2GVB A;  4MZ9 A;  2UXD L;  4A3G H;  1C0A A;  4OWX B;  4A3L G;  3MEF A;  1GO3 E;  2VY3 A;  4IO9 A;  1SFO H;  3FP9 A;  1SR3 A;  1HJP A;  1WJJ A;  2EQS A;  2N8N A;  4IPH A;  1I94 Q;  1VQK A;  3A5Z B;  4OXP A;  1YNX A;  3G6E A;  3CD6 A;  4JV5 Q;  1XPR A;  4R1J A;  1PH6 A;  4KLK A;  4NPS A;  5FLM H;  2IY5 B;  3ULJ A;  4DR2 Q;  3F8T A;  3F2C A;  3T1H Q;  4A3E H;  3CCE A;  4DV5 Q;  4P72 A;  2NN6 G;  2UXD Q;  1TWC H;  4DUZ Q;  2PI2 E;  4GN3 B;  1Y1W H;  4DR7 Q;  1P8L A;  1VQH A;  2ZJR A;  4DV1 L;  3PUW A;  2PNH A;  2UXB L;  5C0X J;  4BBR H;  1JB7 A;  1O7I A;  4X62 Q;  4A3I G;  1VQ6 A;  4A93 H;  3U50 C;  1Q1E A;  3OTO Q;  1A8V A;  1J5E Q;  2VL6 A;  1HZC A;  4A3L H;  1VQJ A;  1BKB A;  3PUV A;  1VQE A;  1L1O A;  5IYD H;  3TQY A;  5IYC G;  1C9O A;  5IP9 H;  3HKS A;  3GTQ H;  3RZD H;  1I5F A;  4DV7 Q;  3TEH B;  3PF5 A;  1T9H A;  4A3D H;  2VW9 A;  3H3V I;  5JEA G;  4HJ7 A;  2IX0 A;  3FHW A;  4P75 A;  1BBU A;  3HKZ G;  4JI3 Q;  5IE8 A;  4LF9 L;  3ZJY C;  2K50 A;  4C3I H;  2E5L L;  3BZC A;  1HH2 P;  1V9P A;  4J15 A;  3PGZ A;  4LUZ A;  3KF6 A;  1YBY A;  5AJ3 L;  2FXQ A;  4OON A;  2DUD A;  3KDF B;  4R4T A;  1HNW Q;  4HIO A;  3GTJ H;  4A3I H;  1VQP A;  4BA2 I;  2PQA A;  5GRO A;  4X64 L;  4K0K L;  1EQR A;  2N49 A;  3KF8 B;  1FL0 A;  1KRS A;  3AQQ A;  1K8G A;  1QVF A;  1OXU A;  2HQL A;  2XTI A;  1LTL A;  1EWI A;  1X6O A;  5IYC H;  5C0X G;  4IPC A;  4OX9 Q;  1U5K A;  4JI7 L;  2R6G A;  2VUM G;  1QZH A;  5DLQ E;  4PZ7 A;  2CQO A;  1WOC A;  3E9I A;  4L5T A;  4DNI A;  1V43 A;  2VQF L;  3CCQ A;  2JA8 G;  1OXX K;  2QA4 A;  3EBE A;  4LUV A;  4L5S A;  2EIF A;  4NXN Q;  3HFZ B;  4EQ5 A;  4JYA L;  3HOW H;  1R9T H;  2R93 H;  2JA7 H;  2UU9 L;  1HZ9 A;  3S1N H;  4GKK Q;  4LF7 Q;  4A3J G;  1PH3 A;  4MTN A;  5GAH C;  1FGU A;  2ZM6 L;  4UP7 A;  4DV6 L;  4JI6 L;  3K7A H;  3AEV A;  2K5V A;  2E2J H;  1Y1V G;  5C3E H;  3KYH C;  1RIP A;  1J6Q A;  3G4S A;  1TWA H;  1Q82 C;  4JYA Q;  5LMN L;  4B3R L;  2CWP A;  4A3F G;  2GN5 A;  4IFD G;  4OO1 G;  4P74 A;  1S72 A;  1FJG L;  3F2B A;  1AE2 A;  4A3C G;  1PH9 A;  4JBJ A;  1EQQ A;  4A3M G;  2JA8 H;  2ZM6 Q;  4GOP B;  3M3Y H;  4DV6 Q;  1IBK L;  4JI6 Q;  2WP8 J;  3EN2 A;  5M3F G;  1N34 L;  4DV0 Q;  2CWA A;  4DV3 Q;  3G71 A;  2UUB L;  1YHB A;  4DV4 Q;  4B3R Q;  1XJV A;  4YCW A;  2Z6K A;  2R7Z G;  3CME A;  3RZO H;  3CPF A;  1MIU A;  1NTG A;  4AYB E;  4A3J H;  1VQI A;  4QJF A;  4JBK A;  1TWF H;  1QUQ A;  1PV4 A;  3W1B A;  1IBK Q;  1RL2 A;  1N34 Q;  4GLV B;  4JI2 L;  3M9B A;  2HT1 A;  2NZO A;  1XPU A;  2R92 G;  2UUB Q;  2F4V Q;  4DR3 L;  3J7A 5;  4FDB A;  4B3T Q;  4A3F H;  3J80 i;  3STB C;  3RN2 A;  1YVC A;  5FJ8 G;  4R4C A;  1YHA A;  2ASB A;  3GTK H;  1A63 A;  1EUJ A;  4DUY L;  2QGQ A;  4HID A;  3A74 A;  4A3M H;  2VZA A;  1HNX Q;  1LYL A;  3I4M H;  4DR4 L;  4L5R C;  1CKO A;  5M3F H;  1IL2 A;  2VQE Q;  3HOU G;  4GKJ Q;  4DR3 Q;  2KHJ A;  2YTY A;  3PF4 A;  4A4I A;  2QEX A;  2R7Z H;  4GOP C;  2WFW A;  2JA6 G;  2F52 A;  1XMO Q;  2RHS B;  4JV5 L;  2E2H H;  1KQS A;  2A8V A;  3KLW A;  1EYG A;  4DR4 Q;  1GKH A;  2ZTD A;  4A75 A;  5JEA J;  5C44 G;  2BH8 A;  4DR2 L;  3T1H L;  2RF4 A;  1BVS A;  4DV5 L;  2B63 G;  4IOC A;  1Y14 B;  3IRB A;  4DUZ L;  1N33 Q;  4POG A;  4UP9 A;  4DR7 L;  4LF4 Q;  5IWA Q;  4JI1 Q;  5FJ8 H;  2PMZ E;  1H95 A;  1YJN A;  1PA6 A;  2AMC B;  2YV5 A;  5LMU L;  2I5H A;  2BH2 A;  4X62 L;  2YTX A;  3S24 A;  1HNZ L;  2V1C C;  3OTO L;  4B3M L;  1XTD A;  4PG3 A;  1J5E L;  2YU9 H;  2WB1 E;  1PH8 A;  3U58 A;  1KRT A;  2OQ0 A;  4IJL A;  2D62 A;  4APV A;  3HOU H;  4QGU A;  2Z0S A;  2K5H A;  2JQO A;  3CAM A;  3CW2 C;  4A3B H;  1Q86 C;  1ASY A;  1IBL Q;  1N32 Q;  1VCI A;  2JA6 H;  1L1O B;  2A19 A;  1VQ8 A;  5LMU Q;  4DV7 L;  2NVT H;  3A5U A;  3SGI A;  5M5X H;  1Q7Y C;  4KI0 A;  1HNZ Q;  4BY7 H;  1FVI A;  1WI5 A;  3HOX G;  4JI3 L;  2UUC Q;  4B3S L;  1D8L A;  1BBW A;  1V1Q A;  4B3M Q;  1PYS B;  1SLJ A;  3AYH B;  2NN6 I;  4JI4 L;  3PUZ A;  1VQD A;  3GO5 A;  3LGJ A;  1E1O A;  1K83 H;  1UE5 A;  2WAQ E;  1MKH A;  4UPA A;  1HNW L;  1VQL A;  3UE0 A;  2HIV A;  1VQ5 A;  2NZH A;  1EIY B;  2NVX H;  3GTO H;  4B3S Q;  3ULL A;  4QY7 A;  2PQA B;  4JI4 Q;  1MJE A;  3WWV A;  2F4V L;  4BXX G;  4GKJ L;  4DR1 L;  2MQH A;  1CSP A;  4OX9 L;  4JC0 A;  5BR8 Q;  2HHH Q;  4JI5 Q;  1XNQ Q;  2ATW A;  4IFD J;  1KXL A;  1E3P A;  4A3K G;  3CCU A;  1PH1 A;  4GS3 A;  3D31 A;  4AIM A;  1VQN A;  4OWW B;  5C4X G;  3GTM H;  3HOX H;  1N9W A;  3G48 A;  4P73 A;  4WJ4 A;  3FKI G;  2ZTE A;  1E22 A;  3BU2 A;  4NXN L;  1XNR L;  1Q81 C;  1PH4 A;  1NMF A;  2Q2I A;  2ID0 A;  1L1O C;  1AE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...