3D0FA

Structure of the big_1156.2 domain of putative penicillin-binding protein mrca from nitrosomonas europaea atcc 19718
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
NAYRGPEAFLKLPKDLKDREALQDIMQDIGNSDDILAAVVLSATPGAVEAFRKNGETIRITGDGLKAAHRFLSNDPKIGEKRIRPGALIRVKKTEKGSWQIVQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Penicillin-binding 1 transmembrane protein MrcA
publication title Structure of the BIG_1156.2 domain of putative penicillin-binding protein MrcA from Nitrosomonas europaea ATCC 19718.
rcsb
source organism Nitrosomonas europaea atcc 19718
total genus 14
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.4.2.-:
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3d0fA01
1PH5A 1W3SA 5AJ3Q 4X66L 1PA6A 2RF4A 1S40A 5GAHC 5IWAL 3KDFA 3D31A 5M3MH 1YNXA 2IT1A 5BR8L 5GAEC 5M3FH 1QVGA 4A3CG 4IFDJ 3ULLA 4ME3A 4GLXA 2JEAI 1VQBA 4HJ9A 1E1TA 4KHZA 4C3IH 4R4CA 1L1OC 3RLFA 5IP9H 3CCRA 4LF6L 1WCMG 1VQ6A 4DR6L 1V1QA 5AJ3L 4JBWA 4DNIA 4DV1L 3TS0A 4Y52H 1L0WA 2ZTCA 3PV0A 2YTVA 4JI0Q 5JJKA 1EQRA 4GNXA 4IOCA 4BXXG 3GDEA 3CPFA 3ERSX 1SROA 4JI8L 5FLMG 3I4MH 4A3GG 5M5XH 4LFCQ 4XIGS 4IOAA 2RHSB 4IPCA 4JI0L 2UXCQ 4GN3B 1RIPA 1VCIA 4JI6Q 1YBYA 3CD6A 2ZJRA 2NVYH 1TWCH 2BH8A 1HJPA 4GOPB 3E9HA 3U4ZA 1VQNA 2UXCL 3GD7A 4LF7Q 1CKOA 5H1SE 4PZ6A 4RMFA 3HOXH 3S1RH 2JQOA 1XPRA 1VQLA 3F1ZA 1IBLL 3S16H 2CWPA 4YWLA 2K5NA 4BA1I 1XJVA 1VQIA 1NMGA 1S3OA 3K80C 4BY1G 4B3SQ 3M4OH 5HY6A 3I4NH 3E9IA 4LF7L 3KF8B 1QVCA 2MO1A 4QY7A 3K8AA 1I3QH 4DV0Q 1ASZA 4KHPQ 4OONA 4DV4L 3FP9A 5C4XH 1WJJA 2UUCQ 2YTXA 1YZ6A 5IYDH 2VQFQ 1PH1A 4DR4L 4KHPL 2AMCB 3CCVA 4IJLA 4LFAQ 4QQBX 2DGYA 2IY5B 2NN6G 2JA7H 5IYBG 1OXVA 3NEMA 1C0AA 1TWFH 4JYAL 4DR2Q 4DK3C 3G48A 4LF8Q 1XMQQ 3PUZA 4QIWE 2GVBA 2L15A 2VQFL 2Q2UA 3F2DA 1UE7A 1KL9A 1VQ9A 4LFAL 2JJQA 4AYBE 3M7NA 1SRUA 1G51A 1PFSA 3I56A 3NELA 2VW9A 2AHOB 3KDFB 4A3KG 4O0AA 1GM5A 2R7DA 2OQ0A 3RN2A 1VQPA 1JJ2A 2B63H 1Q12A 1Y14B 1VQ5A 3PUYA 5JJIA 4X62Q 1K8AC 2VUMG 3F2CA 4HIOA 4A4IA 1Q8KA 1X54A 3PCOB 4A3FG 1QVFA 4GNXB 3CF5A 1EOVA 2CWAA 3G6EA 1IL2A 1NJIC 1KRTA 4POFA 3PO2G 1X6OA 2JA9A 3CPWA 2N49A 4LF5Q 2K75A 4HIDA 1X3EA 1S72A 4A93H 3PO3H 4B3ML 1U5KA 4JI1L 4A3MH 1B70B 1O7IA 4GOPC 3HKZG 3S2HH 2IHFA 3M4PA 1PHJA 1JB7A 1VQHA 3AFPA 4LF5L 4YCWA 4PZ7A 3M9BA 3GTJH 4DUZL 4B3TL 2ZM6Q 1PVOA 2AWOA 2BA1A 3I2ZA 1GD7A 2CQOA 3A5ZB 3HKSA 4R4TA 2PNHA 2Y0SE 2EXDA 3FKIG 4A3IG 3HOVG 2JA5H 4MTNA 1PH3A 2QEXA 1K8GA 4WJ4A 3B6YA 3I7FA 4C2MH 5DLQE 4A3CH 1HZCA 4BBRH 1IBKQ 1PH7A 2H5XA 4DR5Q 3JAMc 2ZJPA 1WCMH 1JMCA 2K4KA 2Z0SA 1EWIA 4QL5A 1HNWL 2F52A 1M1KC 2UUAL 4IPGA 1G291 3H3VI 2NN6I 1HNZQ 5IYCG 3GTGH 4HJ7A 4A3DG 4OO1G 2MQHA 2NZHA 2PI2A 1IBML 3RLNA 2KBNA 1QZGA 4NXNL 4LF9L 3T1HQ 1CUKA 1FVIA 1HH2P 2Q2IA 2AWNA 4AQYQ 1N32Q 2B3GA 1JE5A 1X3FA 3HFZB 1JJCB 1HNXL 2IX1A 3KOJA 1VQ7A 1RL2A 2HHHL 4A3BH 5M5WH 1D8LA 3GTPH 1CKMA 2EIFA 3M4QA 4JI5Q 2WAQG 4AQYL 1N32L 3MEFA 1U0LA 3UDFA 1PYSB 4IFDG 3PUVA 2NZOA 2JK8A 2YV5A 4POGA 4P73A 4L5RC 1SR3A 5IP7G 2VL6A 4GNXC 1J6QA 2YU9H 4JI5L 4BY1H 4GKKQ 4FDBA 3ZJYC 4NPSA 2K50A 4EQ5A 3A0JA 1K83H 4ALPA 4DV2Q 1MJCA 1N34Q 3CCUA 4A3EG 4LW1A 1SE8A 3H0GH 4QJFA 4NB3A 4DV6Q 4A3LG 3UE1A 4R4IA 2PQAA 4B3RQ 1BBUA 4UPAA 4HJAA 4A76A 2N3SA 1H95A 1K0RA 3CXCA 4DV2L 1CSQA 1Q1BA 2R93H 2JA8G 1WYDA 5ELOA 3ULPA 2YYZA 1CSPA 2HQLA 1OXXK 3W1BA 5LMNW 5GROA 4LFCL 3PIOA 4JI7Q 4JI4Q 3WWVA 4X64Q 5C3EH 4K0KQ 2IX0A 5JEAG 4IJHA 4JI6L 3U50C 2R7ZH 2VZAA 3S2DH 1A8VA 5C44H 1KXLA 1EIFA 3G4SA 4R1JA 1GO3E 5JEAJ 3CCQA 4A3JH 4OO1I 4X64L 1QUQA 2ZTEA 3CCSA 1Q86C 1VQKA 1Z47A 1Y1VH 1VS0A 2A1AA 1E7ZA 4JCVE 1DGSA 5M5YH 3ER0A 3J7A5 5E7NA 2I5LX 1V43A 2HIXA 1XPOA 5C0XJ 3HOYG 4UP7A 3T1YQ 4B3SL 1IZ6A 4H02A 2NVQH 1IXRA 4J15A 1YHAA 3VDYA 2E2HH 1A0IA 3A5UA 4DV0L 3UDGA 2JA6H 4GLAC 4IFDI 1PH9A 3G71A 3OYYA 2VY3A 1FGUA 2N8NA 4XTCS 1OXUA 2B29A 4DR1Q 2UUCL 4YCVA 1VQCA 3L0OA 4LNQA 1GVPA 3KJOA 1L2FA 1ASYA 1I94Q 4LUVA 3I55A 5M3FG 1YITA 1EIYB 3FHWA 1YJNA 1KIXA 1NTGA 1Q7YC 3HOZH 1VQAA 1VQ4A 1HR0Q 2BH2A 2GN5A 4DR2L 3E0EA 4LF8L 1XMQL 1I94L 1Y1WG 4GN4B 4BBSG 4OX9Q 3S1QH 1HR0L 4L5SA 1KD1C 3GTMH 1PH8A 3TQYA 2PQAB 1HZAA 3KFUA 3EIVA 3J80c 4DV5Q 1N9WA 3MXNB 3GTLH 4JV5Q 4X62L 4OWTB 5K36G 1HZBA 4A75A 1CKNA 3OTOQ 3TRZA 2FXQA 1I50H 4GKJQ 3SGIA 4JBKA 1J5EQ 4DUYQ 3CCLA 1A63A 1JT8A 1BVSA 1K9MC 1YVCA 1HZ9A 2Z6KA 2V1CC 4DPGA 3BZCA 3HKZE 3K81C 4LWCA 4X65Q 3OTOL 3HOXG 4OWXB 3K0XA 2UXBQ 3CC2A 2CFMA 3I4OA 4DV7Q 3J81j 2RHQB 3BU2A 4JI2Q 4DUYL 3AEVA 3HOUH 3HOWG 5JJLA 1YJ9A 2QGQA 3I4NG 3TS2A 1SFOH 2AKWB 2N78A 4R4OA 1XNQQ 2ZM6L 1TWHH 2RCNA 4DR7Q 1QUQB 5LMNQ 3KF6A 2HIVA 4DV7L 1KAWA 2OWOA 4JI2L 5FLXc 5C4JH 5C4XG 1VQGA 2JE6I 1XMOQ 4DR3Q 4A3EH 3NBHB 3M85A 2KENA 1XNQL 1I5FA 4DR7L 4HJ5A 3S1NH 4BXXH 4DKAC 2Q2TA 1IBKL 1D7QA 5FLMH 3J7ZC 1VQOA 4DR5L 2JA7G 3AFQA 1WOCA 3S24A 1FL0A 2JA8H 3F8TA 2VQEQ 3K7AH 1EUJA 2WP8J 1SN8A 3CC7A 3U58A 2NVXH 1PYBA 1UE5A 4DAYB 1HNZL 4MNOA 1Z9FA 1JJGA 3S15H 1BKBA 1GKHA 1UWVA 3KJPA 4P71A 1AE3A 4IPHA 3S14H 2LXJA 3T1HL 2WFWA 3LGJA 3NENA 2UU9Q 4OXPA 1XNRQ 3RLOA 3A74A 1AE2A 2CCZA 2WAQE 1SLJA 2XTIA 2ALYB 4NXMQ 2HT1A 5IY0A 1AH9A 4GLVB 1PH6A 2LSSA 1T9HA 4YHHQ 1N33Q 4JOIA 3ICEA 1NE3A 1NBWA 4IPDA 4L5QA 4AIMA 1XNRL 3PO3G 4YWKA 1Q46A 4UP8A 4RG1A 2F4VQ 4NXML 2D0PA 3CCEA 4GKKL 2OTLA 1V9PA 1CKNB 2IHEA 2WB1G 3ULJA 3EBEA 5FJ8G 5GADC 4X66Q 4YHHL 1N33L 3CMEA 2GVAA 1X9NA 2R92G 5IWAQ 1KRSA 1N34L 4JC0A 1OXTA 4JBMA 2R6GA 5GAGC 4BA2I 5HGQA 4DV6L 1G6PA 2WB1E 3DM3A 2JA5G 4X6AH 4LF6Q 3H3VH 5IYBH 2ATWA 1A62A 1TXYA 4DR6Q 1VQEA 4B3RL 2ZTDA 2OCEA 4YCUA 4DV1Q 4DV3Q 4PG3A 1Q1EA 4TVAB 1QZHA 3J80i 3TREA 3RZDH 4BY7G 4PZ8A 4BBRG 4JI8Q 2CKZB 5LMUQ 3PIPA 3F2BA 3IRBA 4A3KH 2ASBA 1E24A 2MFIA 4DV3L 1XTDA 2LXKA 3KF6B 4O2DA 4C3JH 2MNAA 1Y1WH 2D62A 4BBSH 1VQFA 2VUMH 4MZ9A 4JI7L 4JI4L 4GN5A 2F3IA 5C0XG 5LMUL 2E2IH 4LFBQ 4HIKA 4EX5A 2A8VA 4K0KL 4KI0A 4A3FH 4LUZA 1PH4A 3CMAA 1L1OA 2E2JH 1KC8C 5J3BA 3W1GA 1K3RA 3KYHC 3Q8DA 2ZJQA 3PO2H 3GTQH 4A3GH 4LFBL 4A3BG 1LM0A 1IBLQ 3J81c 4DAMA 1FJGQ 3RR5A 1YEZA 3UE0A 2PI2E 3JAMi 2Q2HA 1KQSA 3T1YL 2YTYA 1IYJB 3PF5A 1E22A 1C9OA 3GO5A 3AYHB 4DV4Q 3CAMA 1YJWA 3FKIH 4A3IH 3HOVH 1FJGL 1WFQA 1X3GA 3HOWH 2K5HA 3W5OA 5M3MG 1W2BA 4LUOA 2JEBI 1X65A 2PMZE 1R9TH 4HIMA 4DR4Q 4DR1L 5IP9G 4JI3Q 2XGTA 1UE6A 3CQZH 3H0GG 3PUXA 1B7YB 4TQUS 3S1MH 2I5MX 4P74A 3CW2C 4DK6C 2KHJA 5IT9c 4JYAQ 3RN5A 2E5LQ 4JI3L 3I4MG 1C7YA 1E3PA 3TEHB 2R93G 5IYCH 2Z6KC 1UEBA 4UP9A 4A3DH 3U4VA 3EN2A 2ID0A 4AYBG 3DLLA 1YHQA 1OTCA 4OX9L 2E5LL 1MIUA 2K14A 2VS1A 2UUBQ 1P8LA 2A19A 1K73C 1EYGA 1EFWA 2OTJA 2KCMA 2UXDQ 2DUDA 5C3EG 2D0OA 4DV5L 3UDXA 4JV5L 3PGZA 1VQDA 3H15A 2KCTA 2R7ZG 3PSIA 2I0QA 3GTKH 5C44G 2UUBL 3UDIA 4GKJL 4Y7NH 2UXDL 5C0XI 5ELNA 4A3JG 5GQOA 1J5EL 4B3MQ 4JI1Q 1Y1VG 5IP7H 3KLWA 1SMXA 4X65L 2QA4A 5IE8A 2UXBL 3L7ZC 3JC66 1P16A 4B3TQ 4DUZQ 1UE1A 1LYLA 3L2PA 1I6HH 1L1OB 4C3HH 5IYDG 4A3LH 1Q82C 1X55A 3S17H 2JA6G 2Y0SG 3GTOH 2I5HA 5FJ8H 5LMNL 4LF4Q 4GS3A 4UY8C 2R92H 3K7UC 5EAYA 3PUWA 4P72A 2K5VA 4HJ8A 1NMFA 4DR3L 1XMOL 1YI2A 2BA0A 4YWMA 4OWWB 4GOPA 4LF4L 3HOZG 1TWAH 1MKHA 1HNWQ 1X56A 1TWGH 3BJUA 2UUAQ 1PV4A 2EQSA 1M90C 2ES2A 1N36Q 4BY7H 2VQEL 4JOIC 4JG2A 1VQMA 2B63G 2K52A 2MO0A 1YIJA 1IBMQ 3STBD 1OXSC 4APVA 2KHIA 4WJ3M 4LF9Q 2R7FA 4NXNQ 4YY3Q 1NY4A 3J81i 2OQKA 3CCMA 3STBC 4PMWA 1EQQA 1N36L 3RZOH 1VQJA 4KLKA 2NVTH 1E1OA 1HNXQ 4IO9A 3AQQA 1LUZA 1YHBA 4AH6A 1Q81C 2HHHQ 2UU9L 4A93G 2C35B 4R4QA 4YY3L 3OW2A 3D0FA 4A3MG 2VNUD 1LTLA 3HOYH 1PH2A 3CC4A 1VQ8A 3PF4A 1XPUA 1HR0W 1MJEA 3CP0A 3RNUA 1BBWA 3CCJA 4P75A 1B8AA 4L5TA 4QGUA 1KHIA 4JBJA 5BR8Q 3M3YH 1N8RC 2F4VL 2E8GA 3BZKA 3HOUG 1WI5A
chains in the Genus database with same CATH superfamily
3FPPA 1S40A 1YNXA 1E2ZA 5K5PA 3I91A 3ULLA 4ME3A 2EY2A 2JEAI 2ENBA 3F2UA 4KHZA 4HJ9A 4R4CA 1STYA 3D3RA 1B1ZA 5L37A 1QNUA 4JBWA 4DV1L 2ZTCA 1EQRA 1TR5A 3CPFA 1MHWC 1BR9A 1SNCA 2N55A 3SK4A 4KTAA 1I4XA 4X3SA 1K28A 2UXCQ 1UEAB 4GN3B 1VCIA 4JI6Q 4XXEA 2WINB 3CD6A 2BOSA 1TWCH 4GOPB 2IL8A 3MFGA 3U4ZA 1VQNA 2UXCL 1FYCA 4TSSA 4LF7Q 4R9WA 2L4NA 1V1PB 3KLSA 1Z6HA 3F1ZA 1IBLL 4BA1I 1UUPA 1LV9A 3I4NH 4LF7L 3KF8B 1LACA 4FYDA 2SDFA 4OONA 4DK1A 1EIGA 5C4XH 1EYCA 2DJFC 3MXUA 3H6MA 3DWQA 5J1ZA 3CCVA 3Q6SA 4QQBX 3QIAA 2L1BA 2NN6G 2Z9HA 1CFMA 1TWFH 2EYOA 2PMZB 4JYAL 4IUTA 4I65A 2GVBA 3DUZA 2Q2UA 1XX8A 3NQTA 1SXTA 4AYBE 3M7NA 1PFSA 1GM5A 5JJIA 1D2BA 1Y14B 3PUYA 3RMHA 2JXMB 1Y8PB 1QNKA 3MXPA 3RD4A 4X62Q 3AMUA 4HIOA 4KN4C 5C5LA 2NWGA 2B2WC 5EKKA 3K5LA 5BN4A 3O13A 2XVSA 3PO2G 1X6OA 2N49A 1RD9D 2K75A 4KD4A 3R2IA 1W6JA 4GOPC 1SJED 3I4LA 2CW0D 4XQQA 1PHJA 1JB7A 3AFPA 3SK8A 2CW0C 4PZ7A 4B3TL 3VYTA 4DUZL 2BA1A 1O7ZA 2RDHA 3DEPA 3I2ZA 4R4TA 3HOXB 4F87A 1SBBB 1K8GA 3DM1A 2CH4A 2CVRA 2K1BA 4BBRH 5KGUA 1IBKQ 3J7YW 3S1MB 3K5NA 4DR5Q 3D4RA 3JAMc 2ZJPA 2Z0SA 5A2QL 2F52A 4IPGA 2NN6I 3OWEB 4HJ7A 4A3DG 4OO1G 2AQ2B 4PQXA 1QZGA 4DFAA 1HH2P 2Q2IA 4AQYQ 1PRTF 3TZUA 2JN4A 3SE0A 1F9PA 2IX1A 3LWUA 4A3BH 1D8LA 1WTHA 1CKMA 2EIFA 1NR2A 1R4QB 2B2VA 2NUCA 2WAQG 4AQYL 2K5DA 1PYSB 3NUCA 1SE3A 2JK8A 2YV5A 4L5RC 2VL6A 2LFNA 2TMPA 1J6QA 3URYA 4BY1H 4FDBA 4EQ5A 1WD0A 1PZKD 1SJHD 1WD1A 2WACA 3H0GH 2H4OA 4A3LG 2FMCA 5HGTA 1BBUA 4HJAA 2N3SA 1K0RA 3TP7A 3CXCA 1CSQA 2G9DA 1Q1BA 4K8JA 1OXXK 4R8IA 5LMNW 4LFCL 4BY7B 3WWVA 4X64Q 1BDOA 5C3EH 1EU4A 5JEAG 1ESFA 2QF7A 2R7ZH 4QB4A 4F88A 1KXLA 3K59A 4OO1I 4X64L 1QUQA 1RTNA 2ZTEA 1Z47A 1Y1VH 4CDFC 2A1AA 3ER0A 3T51B 1QOHA 3WOEA 3WDNA 4X3UA 1H9SA 2I5LX 2HIXA 4UP7A 1PDQA 3M7GA 3T4AC 1I4HA 3VDYA 1C48A 4K6LA 4DV0L 1PH9A 3G71A 2VY3A 1FGUA 2QILA 2EOTA 4XTCS 1OXUA 4DF7A 1EY5A 4F7XA 1GVPA 3KJOA 3J81E 4KHVA 3I55A 2CH4W 2YU9B 3J80L 1KIXA 1D1IA 1Q7YC 1JB3A 2DJGC 1VQ4A 2SNSA 4UAIA 5DM73 4LJZC 2NB0A 4KY6A 4LF8L 3D6CA 2KA7A 1XMQL 1RHPA 1CZWA 1LTBD 5E3FA 2F0WA 3VYUA 2F0EA 4KK7A 4NDXA 1FNUA 1HA5A 3KFUA 2WKCA 4GKJQ 1TWCB 4ZYSA 3SGIA 5C3WA 5FO9B 1BVSA 1EY4A 3P75A 4CKEA 1HZ9A 2EYLA 4DPGA 3HKZE 3HOXG 3OIQA 1DZ1A 3AEVA 5JJLA 2J0TD 1F2ZA 3QG1A 2F0QA 1V8QA 2Q8RE 2F4IA 2ZM6L 4DR7Q 1QUQB 4K14A 2HIVA 1KAWA 3CRKC 5C4JH 1XMOQ 4A3EH 1H9SB 3M85A 1I5FA 4RA8A 4DR7L 3C2PA 2Q2TA 5EKIA 3J7ZC 5ELCA 2B2VC 3AFQA 2WP8J 3C3LA 1SN8A 2NVXH 1SNPA 4NKLA 4PMCA 1Z9FA 2F0PA 3HEJA 2UU9Q 3RLOA 3A74A 1AE2A 3GTMB 2XTIA 4NXMQ 3TZDA 2A5HA 4YHHQ 1GUGA 4IPDA 2XRSD 2XWBB 4K2KA 3ONAB 2F4VQ 4NXML 2D0PA 1HHVA 4GKKL 2OTLA 3QOLA 1RODA 4ZUIA 2IHEA 3J7AF 3EBEA 4YHHL 2GVAA 5IWAQ 3SR1A 1KTKA 3VA7A 4DV6L 2WB1E 3DM3A 4UHVA 1DOMA 3HOUB 1A62A 1TXYA 3CU7A 4DR6Q 3NXWA 4YCUA 4DV3Q 4TVAB 3J80i 3TREA 4BY7G 4PZ8A 1DONA 3A7AB 4CKCA 4DAVA 3F2BA 2ASBA 4DV3L 4S3SA 5AFWA 1EFID 4Q0FA 1LLRD 4JI7L 4K0KL 1IW7D 4EX5A 2A8VA 3BYTB 4KI0A 2D2CC 1PH4A 3CMAA 1L1OA 1IW7C 1GUTA 2Z8LA 3W1GA 2GA4B 5BN3A 3PO2H 3GTQH 1HUNA 3ITPA 1IKMA 1DXMA 2MPMA 3J81c 1RF2D 3UE0A 4DXGA 3OSOA 2Q2HA 1KQSA 4DV4Q 3AYHB 2L11A 3CAMA 3H09A 1FNVA 1S5DD 1AW7A 4BY1B 1X65A 5DAUA 4DR4Q 1F9RA 1B7YB 3H0GB 2OEOA 3S9WA 1ZKOA 5EKLA 4CDCC 4OHJA 1UEBA 4A3DH 4OO1H 2X6GA 4OX9L 1O7LA 2VXWA 1E0BA 1K73C 2OTJA 2UXDQ 4JW0A 5C3EB 2QDBA 1NR4A 1VQDA 3PGZA 4JV5L 1O78A 2PZUA 4HCSA 3PSIA 2R7ZB 1SAPA 2UXDL 5LL6X 4OIKA 4A3JG 1DM0B 1QE6A 4X65L 1CZGA 2X69A 3TP5A 2QA4A 1K0SA 5E4XA 3K5OA 1BCPB 1LYLA 1UE1A 1L1OB 1SNMA 4A3LH 1PFNA 1WTPA 3I90A 2F0SA 5FJ8H 4RCOA 4GS3A 3BYYB 2KVMA 3PUWA 5FO7B 4YWMA 3FMCA 4RKLA 3VR5A 3HOZG 1HFNA 3BJUA 2UUAQ 5LHY1 2EQSA 1HQMC 3U9OA 4ULLA 4RHRA 5JEAH 2L0CA 4LF9Q 2R7FA 5E1FA 4NXNQ 4IQZA 5C0XH 1LUZA 1YHBA 1KAAA 2HHHQ 3D8GA 2C35B 3TP8A 4R4QA 1PZJD 5I6WA 3OW2A 2VNUD 1LTLA 1VQ8A 5D65A 1MJEA 3CP0A 2HUGA 1B8AA 1K8OA 4QGUA 3M3YH 5BR8Q 2E8GA 3BZKA 3HOUG 1WI5A 1F2MA 1BCPD 4X3TA 2PW5A 2NTTA 3D31A 5BR8L 2C9OA 1WTVA 1BCPC 1SYFA 3TP6A 4LF6L 1L1OC 5IP9H 1ESRA 1ONLA 1V1QA 4A3EB 1JOKA 1L0WA 3S17B 2YTVA 4IOCA 3GTOB 3GDEA 3CKIB 3ERSX 4JI8L 3MEHA 3TSSA 1O80A 1NUCA 2PPBC 4IOAA 3ZYYX 3FDTA 1A2UA 2EZVA 1YBYA 5CGKA 2NVXB 2NVYH 1HJPA 2K01A 2WIIB 2KEDA 4RAUC 2A6HD 4DXFA 1SNDA 3A8IE 1VMCA 4PZ6A 3HOXH 3S1RH 2JQOA 1VQLA 2K5NA 4BY1G 4RGMA 5C4ZA 1I3QH 1HXYD 3FP9A 4J1MA 2UUCQ 4HR7B 1CTMA 1YZ6A 1PH1A 1TY0A 2HCIA 4FXGC 2IY5B 1C0AA 2D5DA 3G48A 1Y8OB 2AUKA 3PUZA 3QWNA 1UE7A 2JJQA 4RCNA 1G51A 1E2WA 2EY5A 2HCCA 2VW9A 2KQ3A 4FF4A 2AUJD 2R7DA 2OQ0A 1D1KA 5EGTA 1KDBA 4QUFA 1X54A 1B4OA 4NW2A 1EOVA 2CWAA 3L3OC 4HMIA 2JA9A 4LF5Q 3PO2B 4A93H 1X3EA 4LMQD 3GTQB 1MSHA 4B3ML 1U5KA 1B70B 2EY6A 3Q0AA 4LF5L 1SYGA 3IFTA 4YCWA 3JAML 1PVOA 3M9BA 1GD7A 3A5ZB 3HP3A 5HURA 2F0DA 2EXDA 3HOVG 2Q8IB 1MBYA 3KLSX 1EZ8A 1PLFA 3SEBA 4O42A 4J8QA 4C2MH 5DLQE 4A3CH 1WTOA 2B8FA 1WCMH 1JMCA 2F0IA 2HQEA 5COYA 1EWIA 4QL5A 2L9HA 3I8ZA 3V96A 1HNWL 2F0FA 1G291 4Z9CB 1HNZQ 1SEBD 3GTGH 2BDOA 1DD2A 3JAME 1JOOA 4A3DB 1IBML 2PI2A 1IL8A 2KBNA 1Q8IA 3T1HQ 1CUKA 1N32Q 3E0JA 3T56B 1H9RA 3G6JB 2F0VA 2WAQB 1H9MA 1N32L 3MEFA 1U0LA 3UDFA 1TVXA 4POGA 2B2TA 4NP5A 5IIFA 5FKAC 2YU9H 3BVMA 2K50A 5G3LD 1B2TA 1K83H 4ILWA 4A3EG 4LW1A 5I4DA 4NB3A 4CDDC 5CBEE 2R61A 4K5WA 4YIJA 4A76A 1R4PB 4N8X1 2L55A 2BE5D 1S4ZA 1ILQA 3ULPA 2JA5B 2BE5C 1FGBD 3Q22A 2BCOA 4JI4Q 2ZXPA 1YNJD 4JI6L 2JYOA 4OGQC 4IUNA 5TSSA 3MC0B 1YNJC 2F3WA 3G4SA 4R1JA 4A3JH 5JEAJ 5EPKA 4DNTB 1Q86C 5M5YH 1E7ZA 2EY1A 4E6IA 1V43A 5C0XJ 3R93A 2B39A 3T1YQ 1IXRA 4J15A 2EYHA 3A5UA 3GTPB 4RHSA 3M3YB 1JWMD 3OWFA 4YCVA 1VQCA 3L0OA 2PZTA 3MXGA 3I70A 4G57A 4LUVA 1HTPA 4WORA 1EIYB 3HOZH 1VQAA 1HR0Q 2BH2A 2GN5A 3E0EA 4HN7A 1Q90A 1A3VA 2F3VA 4CDEC 1HR0L 4L5SA 4OEMB 3GTMH 1PH8A 1JOQA 2EYFA 4UDUC 2K03A 4OL7A 1TKWB 1F9QA 4X62L 4OWTB 3VA5A 4AYBB 5K36G 1HZBA 1CKNA 4HSVA 3OTOQ 3TRZA 1I50H 2NVYB 5ELDA 1GHKA 1J5EQ 3CCLA 1A63A 1WTQA 3MTSA 2FINB 4V190 3OTOL 3S1RB 1CM9A 3CC2A 1EYDA 1PTOB 3I4OA 3BU2A 4KMUC 3J81j 3HOUH 1YJ9A 2AKWB 1B50A 1O7YA 2TSSA 3H94A 4JPBW 2QDLA 1I3QB 2RCNA 1KNAA 5LMNQ 1I6VC 3KF6A 5FLXc 2FMMA 1I4GA 3NWTA 4DR3Q 1KDCA 1CQVA 3IL8A 3EROA 2B8GA 1GHJA 4DKAC 2OXPA 1S5ED 1IBKL 1U9RA 1VQOA 4DR5L 1FL0A 2A73B 2JA8H 3F8TA 3GV3A 3K7AH 1BF4A 2KOLA 2B2TC 1H9KA 4MNOA 3EFXD 2KHSA 2A68D 3KJPA 3LGJA 2A68C 4XYOA 5KYLA 1E2VA 1G91A 4MIUA 2CHBD 2LSSA 2RDGA 3W3AA 4JOIA 3VYRA 4A93B 3NBIA 3X3NA 4IN3A 4RWSC 3ULJA 1CKNB 5FJ8G 4X66Q 1PTOD 3CMEA 1X9NA 1KRSA 1ICFB 2EDGA 1MGSA 1PTOC 5HGQA 1G6PA 2JA5G 2ZTDA 1PYWD 4PG3A 1Q1EA 4EQNA 1B9MA 5FK9C 1CI3M 3LWEA 4C2MB 2Z4HA 3SXHA 5IGCA 5LMUQ 4H0LC 3PIPA 2O5IC 4B9XA 1X3QA 3SK6A 1WCMB 2MFIA 3KF6B 3J81L 1EQTA 2D62A 1I4RA 1VQFA 3N52A 4MZ9A 4GN5A 2F3IA 4RGTA 5C0XG 5LMUL 3GTGB 4LUZA 5J3BA 1BXTA 5CC4A 4C56C 3NE5B 1F77A 3K58A 3S15B 5FOBB 4DAMA 1FJGQ 3S14B 2JP1A 3P1HA 3HOVH 1FJGL 1X3GA 5DNFA 3HOWH 1W2BA 4LUOA 1GXDC 1K83B 5IP9G 4JI3Q 3PUXA 3MHBA 1C4QA 4P74A 5IT9c 2DY8A 3RN5A 2E5LQ 4K5VA 2FFKB 4JI3L 1C7YA 1TIID 4QIWB 1PFMA 2PYKA 4AYBG 3DLLA 1WVLA 2E5LL 2K14A 2UUBQ 1P8LA 2A19A 1EFWA 1SNOA 5CV7A 1M4VA 2DUDA 4KJOA 2D0OA 4H13C 2P5ZX 2UUBL 4GKJL 2IX3A 5C0XI 5ELNA 5E4WC 4A3JB 1KLUD 4JI1Q 1ENCA 5M5YB 2O4XA 3L7ZC 1X32A 4FF1A 2E2JB 4XT1B 1MI2A 1I6HH 1ZXTA 3HKZB 1JE4A 1BCPF 3S17H 3GTOH 1STBA 3K7UC 1DOLA 5EAYA 5F2DA 2E2DC 1XMOL 1NMFA 5D3DA 1YI2A 3FKIB 2IW3A 1GUOA 2E75C 4F8MA 1X3PA 1MKHA 3HOZB 1HCZA 2K32A 4WFN3 5IGGA 5ELEA 1N36Q 3CQZB 5C3XA 1EYAA 4JOIC 5D3IB 5JVG3 2MO0A 1STGA 4CJ1B 2KEEA 3J81i 4HEDA 1N36L 3RZOH 3P20A 1VQJA 4MHEA 3TN2A 1E1OA 1HNXQ 1JC7A 3AQQA 3QR8A 2UU9L 4A93G 3X3MA 5CBAE 1LT4D 4I7AA 1I50B 5CV5A 1XPUA 3RNUA 2K04A 1LT5D 1STEA 2BDNA 3VR4A 4OIJA 2F4VL 4Y7NB 2EVBA 1EU3A 1W3SA 5GAHC 5IWAL 3KDFA 5M3MH 4IFDJ 2IT1A 1QVGA 4A3CG 4GLXA 2N88A 4K2LA 3RLFA 4DR6L 4RH6A 1VQ6A 1WCMG 1ML0D 4GZYC 1QG7A 4Y52H 5JJKA 3PV0A 3SHLA 1JR0D 4GNXA 1SSOA 5FLMG 3I4MH 2IJ0A 4B08A 5M5XH 2RHSB 2WV6D 4IPCA 2JA8B 1RIPA 3K7AB 1LTID 1T5EA 5IGEA 5K36H 1TWAB 2F0HA 1TWGB 1SYCA 2BH8A 3DHQA 1U4RA 1A15A 3GD7A 1CKOA 2M9VA 4IALA 2Z4IA 4RMFA 1XPRA 2RCFA 3S16H 2CWPA 4YWLA 5KNBA 1XJVA 3M4OH 1VQIA 1NMGA 4B3SQ 5HY6A 3NSWA 2ICIA 3E9IA 4PV1C 1PFBA 2C5CA 4DU9A 1QVCA 5D14A 3K8AA 1ASZA 3NBHA 4KHPQ 1QWYA 4DV4L 1A3TA 4XDXA 1DOKA 3HOYB 1VF5C 1G2TA 2A6ED 2YTXA 3W2DA 2I07B 1WTWA 2CQAA 1A6XA 4IZ8A 2K6AA 2A6EC 4DR4L 4KHPL 2AMCB 4FXDA 4IJLA 3GP7A 2DGYA 1OXVA 1RCVD 4DAYA 4KD3A 4DK3C 4DR2Q 3F2DA 5M3FB 1VQ9A 3HGBA 4TKOB 5J39A 1SRUA 3ND8A 3I56A 4C3IB 3KDFB 4A3KG 1VDZA 1VQPA 2B63H 1Q12A 1K8AC 2VUMG 2B2YA 3Q23A 3F2CA 3NHHA 2F0MA 1QVFA 4GNXB 2RVLA 1IL2A 2G9HD 1B53A 3CPWA 2A69D 3LNNA 4HIDA 1S72A 2OT2A 5CV8A 1O7IA 2A69C 3VYSA 3HKZG 3M4PA 4K8IA 5EJWA 3OPOA 3GTJH 1B3QA 2K33A 2CQOA 4ZRZA 2Y0SE 3FKIG 2JA5H 3HOVB 2EJMA 5IGDA 1PH3A 4PNYA 3HOWB 4B9WA 1F2YA 1EQVA 2H5XA 1PH7A 3A54A 2VB3X 1CT1D 2K4KA 4KJNA 1M1KC 2UUAL 3FEWX 3H3VI 5IYCG 3QJYA 2JA7B 2MQHA 2NZHA 4LF9L 4NXNL 1GOZA 1NSNS 2X6LA 2B3GA 1JE5A 3I73A 1JJCB 1VQ7A 2HHHL 4V0BA 3GTPH 4JI5Q 3M4QA 1EWHA 4IFDG 3PUVA 1B9NA 2NTSA 2NZOA 3TDQA 1G8ZD 4U673 4GNXC 4JI5L 2L12A 4NPSA 3J7AV 3A0JA 4C1NI 2RQXA 4DV2Q 1N34Q 1I6HB 2SEBD 1SE8A 4QJFA 3UE1A 2PQAA 4XT3B 4B3RQ 3OMGA 1QB5D 4DV2L 3I72A 4M1UB 2JA8G 1WYDA 1G2SA 2F0NA 2ZT9C 1B3AA 1FNWA 2HQLA 3QOJA 1LO5D 4DAPA 1OO9B 5GROA 3PIOA 4CKBA 1U4LA 2A6HC 3U50C 1IYVA 2VZAA 3S2DH 4DGZA 2PZWA 1IYUA 3SVMA 1ET9A 1Y8NB 1PTOH 1SE4A 4N9PA 3CCQA 3RZOB 1VQKA 4JCVE 1DGSA 5E7NA 1C8CA 2F0OA 3HOYG 2K28A 4H02A 3DXJC 4FO2A 1SNQA 5M5WB 1A0IA 2QKIC 1GJXA 4Q5VA 3UDGA 4IFDI 3OYYA 2N8NA 4DR1Q 2UUCL 1IHZA 1L2FA 3K57A 1NCVA 2B2YC 2OF1A 1I94Q 5M3FG 1YJNA 5M3MB 1KLGD 1NTGA 2F0KA 4C3IG 2XWJB 1I94L 1F9SA 3H91A 3TQYA 2PQAB 3I4MB 5M5XB 2R93B 2LS01 3EIVA 4DV5Q 1N9WA 3E6ZX 5EPLA 2IPKD 4A75A 3T13A 3D4WA 5C6AA 1BUVT 5ISRA 3IAYA 4DUYQ 5FLXL 1JT8A 1K9MC 1CK1A 3MAQA 2V1CC 3BZCA 3K81C 2UXBQ 3U9SA 3EA6A 4OWXB 5C44B 2CFMA 2MHVA 4DV7Q 5CR3A 2RHQB 3HOWG 3S16B 4DUYL 3M4OB 2QGQA 5EPJA 3TS2A 4R4OA 5CORA 1XYIA 4RKBA 3R2TA 3PQIA 1LTGD 1TWHH 4DV7L 2OWOA 1TT2A 2QW7A 4EQPA 1VQGA 2NVQB 2PQEA 4I7ZC 1JQYD 4EQOA 1PMRA 3K5MA 1EY0A 1TY2A 2JA6B 3S1NH 1SYDA 5FLMH 5FLXE 2JA7G 3N6RA 1WOCA 1G6ZA 4C1NK 5DM63 3GQBA 5T1GA 2VQEQ 3CC7A 3U58A 1ZEQX 1PYBA 1ICWA 1UE5A 1HNZL 3S15H 1UWVA 4CGYB 4WRDA 3S14H 2LXJA 3T1HL 1QILA 2E74C 2WFWA 4ZKCB 2B63B 4OXPA 2O2LD 1KABA 3A8KE 1XNRQ 4QUCA 1U4PA 2WAQE 1SLJA 2ALYB 2HT1A 1W6KA 1QJOA 4DN4M 1AH9A 1T9HA 1NE3A 1NBWA 4L5QA 1XNRL 4KY5A 4G7HC 3PO3G 4YWKA 1FR3A 1Q46A 4RG1A 4XQJA 2F0TA 3CCEA 2EJGC 4CBVA 2VB2X 5GADC 2JSOA 4JC0A 3GTJB 1OXTA 2RDFA 2R6GA 5GAGC 4JBMA 4G4KA 4BA2I 2KCNA 2R3ZA 3H3VH 3NTHA 2ATWA 2OCEA 1SFOB 4DV1Q 1D5MC 1YNND 1TS5A 5JVH3 1QZHA 3RZDH 3AU7A 1YNNC 1AEXA 1IKLA 4A3KH 4KN7C 2MGSA 2M00A 1XTDA 1XWEA 4O2DA 3V2TA 1Y1WH 2HDMA 5T1IA 2EXZA 4BBSH 2VUMH 3C1FA 2PNRC 4JI4L 4HCEA 4ZUJA 4HIKA 1JCKB 1RKNA 4KY7A 2E2JH 1KC8C 3KYHC 4JVZA 3PIP3 1RJTA 1LM0A 1HPCA 1IBLQ 2FJ2A 3CHBD 2PI2E 3AB9A 1VF7A 5IT9L 3JAMi 3T1YL 3A8JE 1E22A 5IODA 1C9OA 3GO5A 1YJWA 5EQ0A 1CHQD 1BOSA 3FKIH 2NZ1D 1WFQA 3GV6A 3W5OA 5M3MG 2JEBI 4LAAA 2PMZE 1R9TH 4HIMA 2LY7A 3G7LA 3MA2B 3CQZH 1CHPD 4TQUS 2KHJA 4JYAQ 2SNMA 4L63B 4U68A 3I4MG 1E3PA 3TEHB 2R93G 5IYCH 3K6OA 2E76C 5IT9E 2ID0A 1OTCA 2DY7A 1MIUA 2VS1A 1SYEA 1EYGA 3VR2A 5DEHA 1XXGA 2KUMA 3GTKH 5C44G 4C3JB 3UDIA 3S2DB 4Y7NH 4IFDH 1J9OA 3NP8A 1J5EL 3BDOA 2E2IB 3KLWA 1SMXA 4A3FB 5IE8A 4OELB 1F2LA 4A3GB 3JC66 1P16A 4B3TQ 4DUZQ 3HRZC 1X55A 2JA6G 2I5HA 2I46A 5LMNL 5LL6S 3K0YA 4UY8C 2R92H 1EEFD 4QF4A 4DR3L 4HJ8A 4DNRB 4A3IB 2LMCB 3C1EA 5C5MA 5JAVA 4FVMA 1S5CD 1TWAH 1NAPA 1TWGH 1PV4A 2ES2A 1M90C 2K5QA 2J4XA 4ZCKA 2B63G 5JPNC 3STBD 1OXSC 4WJ3M 2KHIA 4IUPA 1HUMA 1RDPD 2OQKA 3CCMA 3STBC 2NVTH 3BVZA 4ZK9B 4IO9A 3OMCA 3D4DA 2HD3A 3E3XA 3D0FA 3HOYH 1DJRD 1HR0W 2RKSA 1BBWA 1KNEA 4ZKBB 4IUUA 4XYQA 2PO4A 1KHIA 3QO2A 4BS9A 1N8RC 3OW7A 4CJ2C 1PH5A 5A2QE 5AJ3Q 4X66L 1PA6A 2RF4A 5M3FH 5GAEC 3KUPA 2PW7A 1JORA 1TWHB 4EVOA 1VQBA 1DCZA 1E1TA 1D6EC 4C3IH 3CCRA 2MUYA 1EL0A 5AJ3L 4C3HB 4DNIA 3TS0A 4JI0Q 1LTTD 4BXXG 3S1NB 1SROA 3WOFA 5CV9A 5IGBA 4LFCQ 4XIGS 4CHTB 1LTSD 4JI0L 5ELBA 2IWHA 3KLRA 4H44C 1LT6D 2ZJRA 3NTKA 1I4QA 5J22A 1TS4A 3E9HA 2RSNA 4ODGA 2RA4A 5H1SE 2ZXOA 4R8NA 1EZ6A 2A74C 1ZYRD 1S3OA 3K80C 1Z7TA 1LTAD 4QMGA 3P7JA 1ZYRC 2MO1A 4QY7A 3Q24A 2B2UA 4DV0Q 2J7ZA 1EWCA 1WJJA 2M2LA 3QB3A 1QCBD 4X3KA 3A56A 5IYDH 5KYIA 2VQFQ 1TU2B 5I9PA 4HMJA 4ME5A 4LFAQ 3EVQA 2JA7H 5IYBG 3NEMA 4LF8Q 1XMQQ 4QIWE 2VQFL 2L15A 1AFPA 3HZXA 1KL9A 4LFAL 5CV6A 3RZDB 4FF2A 1HRJA 2WKDA 3NWSA 3BS1A 3NELA 1EY7A 2AHOB 2F0LA 4O0AA 4A3KB 1UAPA 4C3JG 3RN2A 1K3BC 1JJ2A 1Y1WB 1VQ5A 4BBSB 2VUMB 3E5SA 4A4IA 4IURA 4XQNA 1Q8KA 3PCOB 3T53B 1J8IA 4A3FG 3CF5A 3G6EA 1AZQA 1NNXA 1KRTA 4POFA 1NJIC 4A3GG 1H9JA 3DEOA 1BQQT 5KIXA 3PO3H 1MD2D 3A7LA 4JI1L 4A3MH 2RBMA 3S2HH 3DWAA 2IHFA 5JJZA 3J80E 3OOCA 1VQHA 2EYJA 4DA2A 5A35A 1CA6A 2ZM6Q 2AWOA 3HKSA 2PNHA 3KK7A 2F1MA 4A3IG 4MTNA 4ZQ3A 2QEXA 3I4NB 2F0UA 3BDCA 3B6YA 4WJ4A 1LT3D 1R9TB 2PCFB 3I7FA 3SK5A 1D5ZC 1HZCA 2NYZD 2XRQD 4G7OC 5C4XB 2HDLA 3IKJA 2K7VA 4EGVA 3IFDA 3FVQA 2Z1CA 1ENFA 4QCLA 1L0YB 3H3VC 1PRTB 2DN8A 4N9TA 1TWFB 3RLNA 2ZXRA 1FVIA 2AWNA 1X3FA 2K05A 3HFZB 1HNXL 2QCPX 3KOJA 1RL2A 4IUVA 5M5WH 1KDAA 3GTKB 1GUSA 3CRLC 1D5XC 4KKTA 4P73A 1SR3A 1HTLD 4MTKA 5IP7G 1WTXA 4GKKQ 3ZJYC 4HTHA 1PZID 4ALPA 1MJCA 5FO8B 3CCUA 5I9OA 4C3HG 4DV6Q 4R4IA 1TS3A 2DNEA 2LKVA 4UPAA 1H95A 2WB1B 3MXNA 2F03A 2R92B 2R93H 5ELOA 2NN6H 1EOTA 2YYZA 3MFYA 1CSPA 1HA6A 1A3UA 2EE1A 3W1BA 5KNCA 4KKSA 1AP0A 4JI7Q 4G7ZC 5BN5A 1EY8A 4BBRB 2IX0A 3MWYW 2B2UC 1Y69U 4K0KQ 4IJHA 3C46A 1A8VA 2XIWA 3I3CA 1EIFA 5C44H 1PRTD 3DMUA 2V4DA 1GO3E 2NVTB 1VMPA 3CCSA 1PRTC 1VS0A 3J7A5 2SOBA 1XPOA 3PIO3 4J6HA 5EBDA 1IZ6A 3FPUB 1BBXC 4B3SL 2NVQH 1SMYD 1YHAA 2E2HH 4A3BB 3MVVA 2JA6H 1SMYC 2AQ1B 4GLAC 2B29A 1Q3LA 1RTOA 4LNQA 1CA5A 1ASYA 1ET6A 2D9UA 5KEEA 1M8AA 1YITA 3FHWA 4ZAIA 5M9OA 5CV4A 1HQRD 1STNA 3BDLA 3NK9A 2NBFA 4DR2L 1Y1WG 4HAEA 4GN4B 3HS0C 4FXKC 4BBSG 4OX9Q 3S1QH 2F0JA 1KD1C 2KECA 3A55A 1HZAA 1STAA 2RSOA 1BO0A 3J80c 3MXNB 3GTLH 4JV5Q 4DK0A 5CYUA 2FXQA 2KCCA 1I4PA 4H7BA 4JBKA 1MSGA 5G3LF 1XTCD 1YVCA 2Z6KA 4X65Q 3M4YA 4LWCA 3L9AX 3K0XA 4LK1C 2G5DA 1T5XD 4JI2Q 1BNZA 3I4NG 1SFOH 1Y1VB 2N78A 4KV6A 1XNQQ 3SDZA 1AZPA 1II3A 4RGNA 3ND9A 4JI2L 5C4XG 2JE6I 3NBHB 5ELFA 2KENA 1XNQL 4HJ5A 2Y0SB 4BXXH 1D7QA 1CQFA 4KKUA 4N8FA 1U4MA 3BVGA 3S24A 1EUJA 4JK1C 4DAYB 1JJGA 3PMFA 3R3OA 1BKBA 1GKHA 4P71A 1AE3A 4IPHA 4K5XA 2EYPA 3NENA 3MZ5A 2F0GA 3TBIB 1S5BD 2CCZA 5IY0A 2Z6BA 1EY6A 2MJ8A 4GLVB 2L5TA 4CJ0B 1PH6A 1N33Q 3ICEA 1A2TA 4AIMA 3PO3B 4UP8A 4A3MB 2MP1A 2KJXA 4L8JA 1B44D 3S2HB 1FD7D 1V9PA 2WB1G 1GUWA 5NUCA 1N33L 4FP5D 1AN8A 3D6WA 2R92G 4HSPA 1N34L 4IUQA 1L0XB 4X6AH 4LF6Q 5IYBH 4B3RL 1VQEA 4BBRG 2O5JC 4JI8Q 2CKZB 1JICA 5C4JB 3IRBA 3T16A 1E24A 2H1EA 2LXKA 4C3JH 2MNAA 2AQ3B 2E2IH 4LFBQ 1JWUD 4A3FH 4ID6A 4BWGB 4RGOS 1K3RA 3Q8DA 2ZJQA 4A3GH 1S5FD 4ABNA 1EY9A 1STHA 5IGFA 5JPMC 4LFBL 3VR3A 1SDFA 4A3BG 4O1NA 4L6TB 3RR5A 1YEZA 2XN9C 1PXUA 3NQIA 2YTYA 1IYJB 3PF5A 4A3IH 2K5HA 1LTRD 2K5WA 5IOCA 1LABA 4M8AA 4RFBA 4DR1L 1UNSA 2XGTA 1UE6A 1SE2A 3H0GG 4P2CB 1EIHA 3S1MH 2I5MX 3CW2C 3HG9A 4DK6C 1V1OA 5KRUA 5CMDA 3KBGA 1HFGA 2EJFC 1EEID 3ERQA 4WJWA 1WTRA 2Z6KC 2EPBA 4UP9A 3U4VA 3EN2A 3KBXA 1YHQA 2KCMA 3R8BA 5I6YA 3RUZA 5C3EG 4DV5L 3UDXA 1GUNA 4K6DA 2KCTA 3H15A 2R7ZG 2I0QA 4FF3A 1TQOA 3DWPA 5GQOA 3EJIA 5C4HA 4B3MQ 5KNDA 1Y1VG 5IP7H 1PTOF 1ILPA 4MN3A 2UXBL 1TS2A 4FNFA 3NTIA 3L2PA 4C3HH 5IYDG 1Q82C 2E2HB 2B2WA 4NMZA 4TRDA 2EYMA 3OHXC 2Y0SG 4LF4Q 3EQLC 3BZDB 4P72A 2K5VA 1K8MA 5EBCA 2Q8TA 2BA0A 2FHTA 4OWWB 4GOPA 1DYQA 1SYBA 4LF4L 5JOBA 3LX0A 1X56A 1HNWQ 4BY7H 1V1PA 2ICEC 2VQEL 1VQMA 4JG2A 2K52A 1YIJA 1IBMQ 2XNAC 4APVA 3S1QB 3BG3A 3OIPA 4YY3Q 1NY4A 3KF8A 1EQQA 4PMWA 4KLKA 4AH6A 1Q81C 4PMBA 3GTLB 4YY3L 4A3MG 4ZLTF 3NPPA 1ENAA 5I2YA 3V05A 1PH2A 3CC4A 1JWSD 3PF4A 2QEJC 2DNCA 3CCJA 4P75A 4L5TA 4JBJA 3VR6A 5I2XA 3TMEA 3FRPB 2XSCA 3UI2A
chains in the Genus database with same CATH topology
1PH5A 1W3SA 5AJ3Q 4X66L 1PA6A 2RF4A 1S40A 5GAHC 5IWAL 3KDFA 3D31A 5M3MH 1YNXA 2IT1A 5BR8L 5GAEC 5M3FH 1QVGA 4A3CG 4IFDJ 3ULLA 4ME3A 4GLXA 2JEAI 1VQBA 4HJ9A 1E1TA 4KHZA 4C3IH 4R4CA 1L1OC 3RLFA 5IP9H 3CCRA 4LF6L 1WCMG 1VQ6A 4DR6L 1V1QA 5AJ3L 4JBWA 4DNIA 4DV1L 3TS0A 4Y52H 1L0WA 2ZTCA 3PV0A 2YTVA 4JI0Q 5JJKA 1EQRA 4GNXA 4IOCA 4BXXG 3GDEA 3CPFA 3ERSX 1SROA 4JI8L 5FLMG 3I4MH 4A3GG 5M5XH 4LFCQ 4XIGS 4IOAA 2RHSB 4IPCA 4JI0L 2UXCQ 4GN3B 1RIPA 1VCIA 4JI6Q 1YBYA 3CD6A 2ZJRA 2NVYH 1TWCH 2BH8A 1HJPA 4GOPB 3E9HA 3U4ZA 1VQNA 2UXCL 3GD7A 4LF7Q 1CKOA 5H1SE 4PZ6A 4RMFA 3HOXH 3S1RH 2JQOA 1XPRA 1VQLA 3F1ZA 1IBLL 3S16H 2CWPA 4YWLA 2K5NA 4BA1I 1XJVA 1VQIA 1NMGA 1S3OA 3K80C 4BY1G 4B3SQ 3M4OH 5HY6A 3I4NH 3E9IA 4LF7L 3KF8B 1QVCA 2MO1A 4QY7A 3K8AA 1I3QH 4DV0Q 1ASZA 4KHPQ 4OONA 4DV4L 3FP9A 5C4XH 1WJJA 2UUCQ 2YTXA 1YZ6A 5IYDH 2VQFQ 1PH1A 4DR4L 4KHPL 2AMCB 3CCVA 4IJLA 4LFAQ 4QQBX 2DGYA 2IY5B 2NN6G 2JA7H 5IYBG 1OXVA 3NEMA 1C0AA 1TWFH 4JYAL 4DR2Q 4DK3C 3G48A 4LF8Q 1XMQQ 3PUZA 4QIWE 2GVBA 2L15A 2VQFL 2Q2UA 3F2DA 1UE7A 1KL9A 1VQ9A 4LFAL 2JJQA 4AYBE 3M7NA 1SRUA 1G51A 1PFSA 3I56A 3NELA 2VW9A 2AHOB 3KDFB 4A3KG 4O0AA 1GM5A 2R7DA 2OQ0A 3RN2A 1VQPA 1JJ2A 2B63H 1Q12A 1Y14B 1VQ5A 3PUYA 5JJIA 4X62Q 1K8AC 2VUMG 3F2CA 4HIOA 4A4IA 1Q8KA 1X54A 3PCOB 4A3FG 1QVFA 4GNXB 3CF5A 1EOVA 2CWAA 3G6EA 1IL2A 1NJIC 1KRTA 4POFA 3PO2G 1X6OA 2JA9A 3CPWA 2N49A 4LF5Q 2K75A 4HIDA 1X3EA 1S72A 4A93H 3PO3H 4B3ML 1U5KA 4JI1L 4A3MH 1B70B 1O7IA 4GOPC 3HKZG 3S2HH 2IHFA 3M4PA 1PHJA 1JB7A 1VQHA 3AFPA 4LF5L 4YCWA 4PZ7A 3M9BA 3GTJH 4DUZL 4B3TL 2ZM6Q 1PVOA 2AWOA 2BA1A 3I2ZA 1GD7A 2CQOA 3A5ZB 3HKSA 4R4TA 2PNHA 2Y0SE 2EXDA 3FKIG 4A3IG 3HOVG 2JA5H 4MTNA 1PH3A 2QEXA 1K8GA 4WJ4A 3B6YA 3I7FA 4C2MH 5DLQE 4A3CH 1HZCA 4BBRH 1IBKQ 1PH7A 2H5XA 4DR5Q 3JAMc 2ZJPA 1WCMH 1JMCA 2K4KA 2Z0SA 1EWIA 4QL5A 1HNWL 2F52A 1M1KC 2UUAL 4IPGA 1G291 3H3VI 2NN6I 1HNZQ 5IYCG 3GTGH 4HJ7A 4A3DG 4OO1G 2MQHA 2NZHA 2PI2A 1IBML 3RLNA 2KBNA 1QZGA 4NXNL 4LF9L 3T1HQ 1CUKA 1FVIA 1HH2P 2Q2IA 2AWNA 4AQYQ 1N32Q 2B3GA 1JE5A 1X3FA 3HFZB 1JJCB 1HNXL 2IX1A 3KOJA 1VQ7A 1RL2A 2HHHL 4A3BH 5M5WH 1D8LA 3GTPH 1CKMA 2EIFA 3M4QA 4JI5Q 2WAQG 4AQYL 1N32L 3MEFA 1U0LA 3UDFA 1PYSB 4IFDG 3PUVA 2NZOA 2JK8A 2YV5A 4POGA 4P73A 4L5RC 1SR3A 5IP7G 2VL6A 4GNXC 1J6QA 2YU9H 4JI5L 4BY1H 4GKKQ 4FDBA 3ZJYC 4NPSA 2K50A 4EQ5A 3A0JA 1K83H 4ALPA 4DV2Q 1MJCA 1N34Q 3CCUA 4A3EG 4LW1A 1SE8A 3H0GH 4QJFA 4NB3A 4DV6Q 4A3LG 3UE1A 4R4IA 2PQAA 4B3RQ 1BBUA 4UPAA 4HJAA 4A76A 2N3SA 1H95A 1K0RA 3CXCA 4DV2L 1CSQA 1Q1BA 2R93H 2JA8G 1WYDA 5ELOA 3ULPA 2YYZA 1CSPA 2HQLA 1OXXK 3W1BA 5LMNW 5GROA 4LFCL 3PIOA 4JI7Q 4JI4Q 3WWVA 4X64Q 5C3EH 4K0KQ 2IX0A 5JEAG 4IJHA 4JI6L 3U50C 2R7ZH 2VZAA 3S2DH 1A8VA 5C44H 1KXLA 1EIFA 3G4SA 4R1JA 1GO3E 5JEAJ 3CCQA 4A3JH 4OO1I 4X64L 1QUQA 2ZTEA 3CCSA 1Q86C 1VQKA 1Z47A 1Y1VH 1VS0A 2A1AA 1E7ZA 4JCVE 1DGSA 5M5YH 3ER0A 3J7A5 5E7NA 2I5LX 1V43A 2HIXA 1XPOA 5C0XJ 3HOYG 4UP7A 3T1YQ 4B3SL 1IZ6A 4H02A 2NVQH 1IXRA 4J15A 1YHAA 3VDYA 2E2HH 1A0IA 3A5UA 4DV0L 3UDGA 2JA6H 4GLAC 4IFDI 1PH9A 3G71A 3OYYA 2VY3A 1FGUA 2N8NA 4XTCS 1OXUA 2B29A 4DR1Q 2UUCL 4YCVA 1VQCA 3L0OA 4LNQA 1GVPA 3KJOA 1L2FA 1ASYA 1I94Q 4LUVA 3I55A 5M3FG 1YITA 1EIYB 3FHWA 1YJNA 1KIXA 1NTGA 1Q7YC 3HOZH 1VQAA 1VQ4A 1HR0Q 2BH2A 2GN5A 4DR2L 3E0EA 4LF8L 1XMQL 1I94L 1Y1WG 4GN4B 4BBSG 4OX9Q 3S1QH 1HR0L 4L5SA 1KD1C 3GTMH 1PH8A 3TQYA 2PQAB 1HZAA 3KFUA 3EIVA 3J80c 4DV5Q 1N9WA 3MXNB 3GTLH 4JV5Q 4X62L 4OWTB 5K36G 1HZBA 4A75A 1CKNA 3OTOQ 3TRZA 2FXQA 1I50H 4GKJQ 3SGIA 4JBKA 1J5EQ 4DUYQ 3CCLA 1A63A 1JT8A 1BVSA 1K9MC 1YVCA 1HZ9A 2Z6KA 2V1CC 4DPGA 3BZCA 3HKZE 3K81C 4LWCA 4X65Q 3OTOL 3HOXG 4OWXB 3K0XA 2UXBQ 3CC2A 2CFMA 3I4OA 4DV7Q 3J81j 2RHQB 3BU2A 4JI2Q 4DUYL 3AEVA 3HOUH 3HOWG 5JJLA 1YJ9A 2QGQA 3I4NG 3TS2A 1SFOH 2AKWB 2N78A 4R4OA 1XNQQ 2ZM6L 1TWHH 2RCNA 4DR7Q 1QUQB 5LMNQ 3KF6A 2HIVA 4DV7L 1KAWA 2OWOA 4JI2L 5FLXc 5C4JH 5C4XG 1VQGA 2JE6I 1XMOQ 4DR3Q 4A3EH 3NBHB 3M85A 2KENA 1XNQL 1I5FA 4DR7L 4HJ5A 3S1NH 4BXXH 4DKAC 2Q2TA 1IBKL 1D7QA 5FLMH 3J7ZC 1VQOA 4DR5L 2JA7G 3AFQA 1WOCA 3S24A 1FL0A 2JA8H 3F8TA 2VQEQ 3K7AH 1EUJA 2WP8J 1SN8A 3CC7A 3U58A 2NVXH 1PYBA 1UE5A 4DAYB 1HNZL 4MNOA 1Z9FA 1JJGA 3S15H 1BKBA 1GKHA 1UWVA 3KJPA 4P71A 1AE3A 4IPHA 3S14H 2LXJA 3T1HL 2WFWA 3LGJA 3NENA 2UU9Q 4OXPA 1XNRQ 3RLOA 3A74A 1AE2A 2CCZA 2WAQE 1SLJA 2XTIA 2ALYB 4NXMQ 2HT1A 5IY0A 1AH9A 4GLVB 1PH6A 2LSSA 1T9HA 4YHHQ 1N33Q 4JOIA 3ICEA 1NE3A 1NBWA 4IPDA 4L5QA 4AIMA 1XNRL 3PO3G 4YWKA 1Q46A 4UP8A 4RG1A 2F4VQ 4NXML 2D0PA 3CCEA 4GKKL 2OTLA 1V9PA 1CKNB 2IHEA 2WB1G 3ULJA 3EBEA 5FJ8G 5GADC 4X66Q 4YHHL 1N33L 3CMEA 2GVAA 1X9NA 2R92G 5IWAQ 1KRSA 1N34L 4JC0A 1OXTA 4JBMA 2R6GA 5GAGC 4BA2I 5HGQA 4DV6L 1G6PA 2WB1E 3DM3A 2JA5G 4X6AH 4LF6Q 3H3VH 5IYBH 2ATWA 1A62A 1TXYA 4DR6Q 1VQEA 4B3RL 2ZTDA 2OCEA 4YCUA 4DV1Q 4DV3Q 4PG3A 1Q1EA 4TVAB 1QZHA 3J80i 3TREA 3RZDH 4BY7G 4PZ8A 4BBRG 4JI8Q 2CKZB 5LMUQ 3PIPA 3F2BA 3IRBA 4A3KH 2ASBA 1E24A 2MFIA 4DV3L 1XTDA 2LXKA 3KF6B 4O2DA 4C3JH 2MNAA 1Y1WH 2D62A 4BBSH 1VQFA 2VUMH 4MZ9A 4JI7L 4JI4L 4GN5A 2F3IA 5C0XG 5LMUL 2E2IH 4LFBQ 4HIKA 4EX5A 2A8VA 4K0KL 4KI0A 4A3FH 4LUZA 1PH4A 3CMAA 1L1OA 2E2JH 1KC8C 5J3BA 3W1GA 1K3RA 3KYHC 3Q8DA 2ZJQA 3PO2H 3GTQH 4A3GH 4LFBL 4A3BG 1LM0A 1IBLQ 3J81c 4DAMA 1FJGQ 3RR5A 1YEZA 3UE0A 2PI2E 3JAMi 2Q2HA 1KQSA 3T1YL 2YTYA 1IYJB 3PF5A 1E22A 1C9OA 3GO5A 3AYHB 4DV4Q 3CAMA 1YJWA 3FKIH 4A3IH 3HOVH 1FJGL 1WFQA 1X3GA 3HOWH 2K5HA 3W5OA 5M3MG 1W2BA 4LUOA 2JEBI 1X65A 2PMZE 1R9TH 4HIMA 4DR4Q 4DR1L 5IP9G 4JI3Q 2XGTA 1UE6A 3CQZH 3H0GG 3PUXA 1B7YB 4TQUS 3S1MH 2I5MX 4P74A 3CW2C 4DK6C 2KHJA 5IT9c 4JYAQ 3RN5A 2E5LQ 4JI3L 3I4MG 1C7YA 1E3PA 3TEHB 2R93G 5IYCH 2Z6KC 1UEBA 4UP9A 4A3DH 3U4VA 3EN2A 2ID0A 4AYBG 3DLLA 1YHQA 1OTCA 4OX9L 2E5LL 1MIUA 2K14A 2VS1A 2UUBQ 1P8LA 2A19A 1K73C 1EYGA 1EFWA 2OTJA 2KCMA 2UXDQ 2DUDA 5C3EG 2D0OA 4DV5L 3UDXA 4JV5L 3PGZA 1VQDA 3H15A 2KCTA 2R7ZG 3PSIA 2I0QA 3GTKH 5C44G 2UUBL 3UDIA 4GKJL 4Y7NH 2UXDL 5C0XI 5ELNA 4A3JG 5GQOA 1J5EL 4B3MQ 4JI1Q 1Y1VG 5IP7H 3KLWA 1SMXA 4X65L 2QA4A 5IE8A 2UXBL 3L7ZC 3JC66 1P16A 4B3TQ 4DUZQ 1UE1A 1LYLA 3L2PA 1I6HH 1L1OB 4C3HH 5IYDG 4A3LH 1Q82C 1X55A 3S17H 2JA6G 2Y0SG 3GTOH 2I5HA 5FJ8H 5LMNL 4LF4Q 4GS3A 4UY8C 2R92H 3K7UC 5EAYA 3PUWA 4P72A 2K5VA 4HJ8A 1NMFA 4DR3L 1XMOL 1YI2A 2BA0A 4YWMA 4OWWB 4GOPA 4LF4L 3HOZG 1TWAH 1MKHA 1HNWQ 1X56A 1TWGH 3BJUA 2UUAQ 1PV4A 2EQSA 1M90C 2ES2A 1N36Q 4BY7H 2VQEL 4JOIC 4JG2A 1VQMA 2B63G 2K52A 2MO0A 1YIJA 1IBMQ 3STBD 1OXSC 4APVA 2KHIA 4WJ3M 4LF9Q 2R7FA 4NXNQ 4YY3Q 1NY4A 3J81i 2OQKA 3CCMA 3STBC 4PMWA 1EQQA 1N36L 3RZOH 1VQJA 4KLKA 2NVTH 1E1OA 1HNXQ 4IO9A 3AQQA 1LUZA 1YHBA 4AH6A 1Q81C 2HHHQ 2UU9L 4A93G 2C35B 4R4QA 4YY3L 3OW2A 3D0FA 4A3MG 2VNUD 1LTLA 3HOYH 1PH2A 3CC4A 1VQ8A 3PF4A 1XPUA 1HR0W 1MJEA 3CP0A 3RNUA 1BBWA 3CCJA 4P75A 1B8AA 4L5TA 4QGUA 1KHIA 4JBJA 5BR8Q 3M3YH 1N8RC 2F4VL 2E8GA 3BZKA 3HOUG 1WI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH5 A;  1W3S A;  5AJ3 Q;  4X66 L;  1PA6 A;  2RF4 A;  1S40 A;  5GAH C;  5IWA L;  3KDF A;  3D31 A;  5M3M H;  1YNX A;  2IT1 A;  5BR8 L;  5GAE C;  5M3F H;  1QVG A;  4A3C G;  4IFD J;  3ULL A;  4ME3 A;  4GLX A;  2JEA I;  1VQB A;  4HJ9 A;  1E1T A;  4KHZ A;  4C3I H;  4R4C A;  1L1O C;  3RLF A;  5IP9 H;  3CCR A;  4LF6 L;  1WCM G;  1VQ6 A;  4DR6 L;  1V1Q A;  5AJ3 L;  4JBW A;  4DNI A;  4DV1 L;  3TS0 A;  4Y52 H;  1L0W A;  2ZTC A;  3PV0 A;  2YTV A;  4JI0 Q;  5JJK A;  1EQR A;  4GNX A;  4IOC A;  4BXX G;  3GDE A;  3CPF A;  3ERS X;  1SRO A;  4JI8 L;  5FLM G;  3I4M H;  4A3G G;  5M5X H;  4LFC Q;  4XIG S;  4IOA A;  2RHS B;  4IPC A;  4JI0 L;  2UXC Q;  4GN3 B;  1RIP A;  1VCI A;  4JI6 Q;  1YBY A;  3CD6 A;  2ZJR A;  2NVY H;  1TWC H;  2BH8 A;  1HJP A;  4GOP B;  3E9H A;  3U4Z A;  1VQN A;  2UXC L;  3GD7 A;  4LF7 Q;  1CKO A;  5H1S E;  4PZ6 A;  4RMF A;  3HOX H;  3S1R H;  2JQO A;  1XPR A;  1VQL A;  3F1Z A;  1IBL L;  3S16 H;  2CWP A;  4YWL A;  2K5N A;  4BA1 I;  1XJV A;  1VQI A;  1NMG A;  1S3O A;  3K80 C;  4BY1 G;  4B3S Q;  3M4O H;  5HY6 A;  3I4N H;  3E9I A;  4LF7 L;  3KF8 B;  1QVC A;  2MO1 A;  4QY7 A;  3K8A A;  1I3Q H;  4DV0 Q;  1ASZ A;  4KHP Q;  4OON A;  4DV4 L;  3FP9 A;  5C4X H;  1WJJ A;  2UUC Q;  2YTX A;  1YZ6 A;  5IYD H;  2VQF Q;  1PH1 A;  4DR4 L;  4KHP L;  2AMC B;  3CCV A;  4IJL A;  4LFA Q;  4QQB X;  2DGY A;  2IY5 B;  2NN6 G;  2JA7 H;  5IYB G;  1OXV A;  3NEM A;  1C0A A;  1TWF H;  4JYA L;  4DR2 Q;  4DK3 C;  3G48 A;  4LF8 Q;  1XMQ Q;  3PUZ A;  4QIW E;  2GVB A;  2L15 A;  2VQF L;  2Q2U A;  3F2D A;  1UE7 A;  1KL9 A;  1VQ9 A;  4LFA L;  2JJQ A;  4AYB E;  3M7N A;  1SRU A;  1G51 A;  1PFS A;  3I56 A;  3NEL A;  2VW9 A;  2AHO B;  3KDF B;  4A3K G;  4O0A A;  1GM5 A;  2R7D A;  2OQ0 A;  3RN2 A;  1VQP A;  1JJ2 A;  2B63 H;  1Q12 A;  1Y14 B;  1VQ5 A;  3PUY A;  5JJI A;  4X62 Q;  1K8A C;  2VUM G;  3F2C A;  4HIO A;  4A4I A;  1Q8K A;  1X54 A;  3PCO B;  4A3F G;  1QVF A;  4GNX B;  3CF5 A;  1EOV A;  2CWA A;  3G6E A;  1IL2 A;  1NJI C;  1KRT A;  4POF A;  3PO2 G;  1X6O A;  2JA9 A;  3CPW A;  2N49 A;  4LF5 Q;  2K75 A;  4HID A;  1X3E A;  1S72 A;  4A93 H;  3PO3 H;  4B3M L;  1U5K A;  4JI1 L;  4A3M H;  1B70 B;  1O7I A;  4GOP C;  3HKZ G;  3S2H H;  2IHF A;  3M4P A;  1PHJ A;  1JB7 A;  1VQH A;  3AFP A;  4LF5 L;  4YCW A;  4PZ7 A;  3M9B A;  3GTJ H;  4DUZ L;  4B3T L;  2ZM6 Q;  1PVO A;  2AWO A;  2BA1 A;  3I2Z A;  1GD7 A;  2CQO A;  3A5Z B;  3HKS A;  4R4T A;  2PNH A;  2Y0S E;  2EXD A;  3FKI G;  4A3I G;  3HOV G;  2JA5 H;  4MTN A;  1PH3 A;  2QEX A;  1K8G A;  4WJ4 A;  3B6Y A;  3I7F A;  4C2M H;  5DLQ E;  4A3C H;  1HZC A;  4BBR H;  1IBK Q;  1PH7 A;  2H5X A;  4DR5 Q;  3JAM c;  2ZJP A;  1WCM H;  1JMC A;  2K4K A;  2Z0S A;  1EWI A;  4QL5 A;  1HNW L;  2F52 A;  1M1K C;  2UUA L;  4IPG A;  1G29 1;  3H3V I;  2NN6 I;  1HNZ Q;  5IYC G;  3GTG H;  4HJ7 A;  4A3D G;  4OO1 G;  2MQH A;  2NZH A;  2PI2 A;  1IBM L;  3RLN A;  2KBN A;  1QZG A;  4NXN L;  4LF9 L;  3T1H Q;  1CUK A;  1FVI A;  1HH2 P;  2Q2I A;  2AWN A;  4AQY Q;  1N32 Q;  2B3G A;  1JE5 A;  1X3F A;  3HFZ B;  1JJC B;  1HNX L;  2IX1 A;  3KOJ A;  1VQ7 A;  1RL2 A;  2HHH L;  4A3B H;  5M5W H;  1D8L A;  3GTP H;  1CKM A;  2EIF A;  3M4Q A;  4JI5 Q;  2WAQ G;  4AQY L;  1N32 L;  3MEF A;  1U0L A;  3UDF A;  1PYS B;  4IFD G;  3PUV A;  2NZO A;  2JK8 A;  2YV5 A;  4POG A;  4P73 A;  4L5R C;  1SR3 A;  5IP7 G;  2VL6 A;  4GNX C;  1J6Q A;  2YU9 H;  4JI5 L;  4BY1 H;  4GKK Q;  4FDB A;  3ZJY C;  4NPS A;  2K50 A;  4EQ5 A;  3A0J A;  1K83 H;  4ALP A;  4DV2 Q;  1MJC A;  1N34 Q;  3CCU A;  4A3E G;  4LW1 A;  1SE8 A;  3H0G H;  4QJF A;  4NB3 A;  4DV6 Q;  4A3L G;  3UE1 A;  4R4I A;  2PQA A;  4B3R Q;  1BBU A;  4UPA A;  4HJA A;  4A76 A;  2N3S A;  1H95 A;  1K0R A;  3CXC A;  4DV2 L;  1CSQ A;  1Q1B A;  2R93 H;  2JA8 G;  1WYD A;  5ELO A;  3ULP A;  2YYZ A;  1CSP A;  2HQL A;  1OXX K;  3W1B A;  5LMN W;  5GRO A;  4LFC L;  3PIO A;  4JI7 Q;  4JI4 Q;  3WWV A;  4X64 Q;  5C3E H;  4K0K Q;  2IX0 A;  5JEA G;  4IJH A;  4JI6 L;  3U50 C;  2R7Z H;  2VZA A;  3S2D H;  1A8V A;  5C44 H;  1KXL A;  1EIF A;  3G4S A;  4R1J A;  1GO3 E;  5JEA J;  3CCQ A;  4A3J H;  4OO1 I;  4X64 L;  1QUQ A;  2ZTE A;  3CCS A;  1Q86 C;  1VQK A;  1Z47 A;  1Y1V H;  1VS0 A;  2A1A A;  1E7Z A;  4JCV E;  1DGS A;  5M5Y H;  3ER0 A;  3J7A 5;  5E7N A;  2I5L X;  1V43 A;  2HIX A;  1XPO A;  5C0X J;  3HOY G;  4UP7 A;  3T1Y Q;  4B3S L;  1IZ6 A;  4H02 A;  2NVQ H;  1IXR A;  4J15 A;  1YHA A;  3VDY A;  2E2H H;  1A0I A;  3A5U A;  4DV0 L;  3UDG A;  2JA6 H;  4GLA C;  4IFD I;  1PH9 A;  3G71 A;  3OYY A;  2VY3 A;  1FGU A;  2N8N A;  4XTC S;  1OXU A;  2B29 A;  4DR1 Q;  2UUC L;  4YCV A;  1VQC A;  3L0O A;  4LNQ A;  1GVP A;  3KJO A;  1L2F A;  1ASY A;  1I94 Q;  4LUV A;  3I55 A;  5M3F G;  1YIT A;  1EIY B;  3FHW A;  1YJN A;  1KIX A;  1NTG A;  1Q7Y C;  3HOZ H;  1VQA A;  1VQ4 A;  1HR0 Q;  2BH2 A;  2GN5 A;  4DR2 L;  3E0E A;  4LF8 L;  1XMQ L;  1I94 L;  1Y1W G;  4GN4 B;  4BBS G;  4OX9 Q;  3S1Q H;  1HR0 L;  4L5S A;  1KD1 C;  3GTM H;  1PH8 A;  3TQY A;  2PQA B;  1HZA A;  3KFU A;  3EIV A;  3J80 c;  4DV5 Q;  1N9W A;  3MXN B;  3GTL H;  4JV5 Q;  4X62 L;  4OWT B;  5K36 G;  1HZB A;  4A75 A;  1CKN A;  3OTO Q;  3TRZ A;  2FXQ A;  1I50 H;  4GKJ Q;  3SGI A;  4JBK A;  1J5E Q;  4DUY Q;  3CCL A;  1A63 A;  1JT8 A;  1BVS A;  1K9M C;  1YVC A;  1HZ9 A;  2Z6K A;  2V1C C;  4DPG A;  3BZC A;  3HKZ E;  3K81 C;  4LWC A;  4X65 Q;  3OTO L;  3HOX G;  4OWX B;  3K0X A;  2UXB Q;  3CC2 A;  2CFM A;  3I4O A;  4DV7 Q;  3J81 j;  2RHQ B;  3BU2 A;  4JI2 Q;  4DUY L;  3AEV A;  3HOU H;  3HOW G;  5JJL A;  1YJ9 A;  2QGQ A;  3I4N G;  3TS2 A;  1SFO H;  2AKW B;  2N78 A;  4R4O A;  1XNQ Q;  2ZM6 L;  1TWH H;  2RCN A;  4DR7 Q;  1QUQ B;  5LMN Q;  3KF6 A;  2HIV A;  4DV7 L;  1KAW A;  2OWO A;  4JI2 L;  5FLX c;  5C4J H;  5C4X G;  1VQG A;  2JE6 I;  1XMO Q;  4DR3 Q;  4A3E H;  3NBH B;  3M85 A;  2KEN A;  1XNQ L;  1I5F A;  4DR7 L;  4HJ5 A;  3S1N H;  4BXX H;  4DKA C;  2Q2T A;  1IBK L;  1D7Q A;  5FLM H;  3J7Z C;  1VQO A;  4DR5 L;  2JA7 G;  3AFQ A;  1WOC A;  3S24 A;  1FL0 A;  2JA8 H;  3F8T A;  2VQE Q;  3K7A H;  1EUJ A;  2WP8 J;  1SN8 A;  3CC7 A;  3U58 A;  2NVX H;  1PYB A;  1UE5 A;  4DAY B;  1HNZ L;  4MNO A;  1Z9F A;  1JJG A;  3S15 H;  1BKB A;  1GKH A;  1UWV A;  3KJP A;  4P71 A;  1AE3 A;  4IPH A;  3S14 H;  2LXJ A;  3T1H L;  2WFW A;  3LGJ A;  3NEN A;  2UU9 Q;  4OXP A;  1XNR Q;  3RLO A;  3A74 A;  1AE2 A;  2CCZ A;  2WAQ E;  1SLJ A;  2XTI A;  2ALY B;  4NXM Q;  2HT1 A;  5IY0 A;  1AH9 A;  4GLV B;  1PH6 A;  2LSS A;  1T9H A;  4YHH Q;  1N33 Q;  4JOI A;  3ICE A;  1NE3 A;  1NBW A;  4IPD A;  4L5Q A;  4AIM A;  1XNR L;  3PO3 G;  4YWK A;  1Q46 A;  4UP8 A;  4RG1 A;  2F4V Q;  4NXM L;  2D0P A;  3CCE A;  4GKK L;  2OTL A;  1V9P A;  1CKN B;  2IHE A;  2WB1 G;  3ULJ A;  3EBE A;  5FJ8 G;  5GAD C;  4X66 Q;  4YHH L;  1N33 L;  3CME A;  2GVA A;  1X9N A;  2R92 G;  5IWA Q;  1KRS A;  1N34 L;  4JC0 A;  1OXT A;  4JBM A;  2R6G A;  5GAG C;  4BA2 I;  5HGQ A;  4DV6 L;  1G6P A;  2WB1 E;  3DM3 A;  2JA5 G;  4X6A H;  4LF6 Q;  3H3V H;  5IYB H;  2ATW A;  1A62 A;  1TXY A;  4DR6 Q;  1VQE A;  4B3R L;  2ZTD A;  2OCE A;  4YCU A;  4DV1 Q;  4DV3 Q;  4PG3 A;  1Q1E A;  4TVA B;  1QZH A;  3J80 i;  3TRE A;  3RZD H;  4BY7 G;  4PZ8 A;  4BBR G;  4JI8 Q;  2CKZ B;  5LMU Q;  3PIP A;  3F2B A;  3IRB A;  4A3K H;  2ASB A;  1E24 A;  2MFI A;  4DV3 L;  1XTD A;  2LXK A;  3KF6 B;  4O2D A;  4C3J H;  2MNA A;  1Y1W H;  2D62 A;  4BBS H;  1VQF A;  2VUM H;  4MZ9 A;  4JI7 L;  4JI4 L;  4GN5 A;  2F3I A;  5C0X G;  5LMU L;  2E2I H;  4LFB Q;  4HIK A;  4EX5 A;  2A8V A;  4K0K L;  4KI0 A;  4A3F H;  4LUZ A;  1PH4 A;  3CMA A;  1L1O A;  2E2J H;  1KC8 C;  5J3B A;  3W1G A;  1K3R A;  3KYH C;  3Q8D A;  2ZJQ A;  3PO2 H;  3GTQ H;  4A3G H;  4LFB L;  4A3B G;  1LM0 A;  1IBL Q;  3J81 c;  4DAM A;  1FJG Q;  3RR5 A;  1YEZ A;  3UE0 A;  2PI2 E;  3JAM i;  2Q2H A;  1KQS A;  3T1Y L;  2YTY A;  1IYJ B;  3PF5 A;  1E22 A;  1C9O A;  3GO5 A;  3AYH B;  4DV4 Q;  3CAM A;  1YJW A;  3FKI H;  4A3I H;  3HOV H;  1FJG L;  1WFQ A;  1X3G A;  3HOW H;  2K5H A;  3W5O A;  5M3M G;  1W2B A;  4LUO A;  2JEB I;  1X65 A;  2PMZ E;  1R9T H;  4HIM A;  4DR4 Q;  4DR1 L;  5IP9 G;  4JI3 Q;  2XGT A;  1UE6 A;  3CQZ H;  3H0G G;  3PUX A;  1B7Y B;  4TQU S;  3S1M H;  2I5M X;  4P74 A;  3CW2 C;  4DK6 C;  2KHJ A;  5IT9 c;  4JYA Q;  3RN5 A;  2E5L Q;  4JI3 L;  3I4M G;  1C7Y A;  1E3P A;  3TEH B;  2R93 G;  5IYC H;  2Z6K C;  1UEB A;  4UP9 A;  4A3D H;  3U4V A;  3EN2 A;  2ID0 A;  4AYB G;  3DLL A;  1YHQ A;  1OTC A;  4OX9 L;  2E5L L;  1MIU A;  2K14 A;  2VS1 A;  2UUB Q;  1P8L A;  2A19 A;  1K73 C;  1EYG A;  1EFW A;  2OTJ A;  2KCM A;  2UXD Q;  2DUD A;  5C3E G;  2D0O A;  4DV5 L;  3UDX A;  4JV5 L;  3PGZ A;  1VQD A;  3H15 A;  2KCT A;  2R7Z G;  3PSI A;  2I0Q A;  3GTK H;  5C44 G;  2UUB L;  3UDI A;  4GKJ L;  4Y7N H;  2UXD L;  5C0X I;  5ELN A;  4A3J G;  5GQO A;  1J5E L;  4B3M Q;  4JI1 Q;  1Y1V G;  5IP7 H;  3KLW A;  1SMX A;  4X65 L;  2QA4 A;  5IE8 A;  2UXB L;  3L7Z C;  3JC6 6;  1P16 A;  4B3T Q;  4DUZ Q;  1UE1 A;  1LYL A;  3L2P A;  1I6H H;  1L1O B;  4C3H H;  5IYD G;  4A3L H;  1Q82 C;  1X55 A;  3S17 H;  2JA6 G;  2Y0S G;  3GTO H;  2I5H A;  5FJ8 H;  5LMN L;  4LF4 Q;  4GS3 A;  4UY8 C;  2R92 H;  3K7U C;  5EAY A;  3PUW A;  4P72 A;  2K5V A;  4HJ8 A;  1NMF A;  4DR3 L;  1XMO L;  1YI2 A;  2BA0 A;  4YWM A;  4OWW B;  4GOP A;  4LF4 L;  3HOZ G;  1TWA H;  1MKH A;  1HNW Q;  1X56 A;  1TWG H;  3BJU A;  2UUA Q;  1PV4 A;  2EQS A;  1M90 C;  2ES2 A;  1N36 Q;  4BY7 H;  2VQE L;  4JOI C;  4JG2 A;  1VQM A;  2B63 G;  2K52 A;  2MO0 A;  1YIJ A;  1IBM Q;  3STB D;  1OXS C;  4APV A;  2KHI A;  4WJ3 M;  4LF9 Q;  2R7F A;  4NXN Q;  4YY3 Q;  1NY4 A;  3J81 i;  2OQK A;  3CCM A;  3STB C;  4PMW A;  1EQQ A;  1N36 L;  3RZO H;  1VQJ A;  4KLK A;  2NVT H;  1E1O A;  1HNX Q;  4IO9 A;  3AQQ A;  1LUZ A;  1YHB A;  4AH6 A;  1Q81 C;  2HHH Q;  2UU9 L;  4A93 G;  2C35 B;  4R4Q A;  4YY3 L;  3OW2 A;  3D0F A;  4A3M G;  2VNU D;  1LTL A;  3HOY H;  1PH2 A;  3CC4 A;  1VQ8 A;  3PF4 A;  1XPU A;  1HR0 W;  1MJE A;  3CP0 A;  3RNU A;  1BBW A;  3CCJ A;  4P75 A;  1B8A A;  4L5T A;  4QGU A;  1KHI A;  4JBJ A;  5BR8 Q;  3M3Y H;  1N8R C;  2F4V L;  2E8G A;  3BZK A;  3HOU G;  1WI5 A; 
#chains in the Genus database with same CATH topology
 3FPP A;  1S40 A;  1YNX A;  1E2Z A;  5K5P A;  3I91 A;  3ULL A;  4ME3 A;  2EY2 A;  2JEA I;  2ENB A;  3F2U A;  4KHZ A;  4HJ9 A;  4R4C A;  1STY A;  3D3R A;  1B1Z A;  5L37 A;  1QNU A;  4JBW A;  4DV1 L;  2ZTC A;  1EQR A;  1TR5 A;  3CPF A;  1MHW C;  1BR9 A;  1SNC A;  2N55 A;  3SK4 A;  4KTA A;  1I4X A;  4X3S A;  1K28 A;  2UXC Q;  1UEA B;  4GN3 B;  1VCI A;  4JI6 Q;  4XXE A;  2WIN B;  3CD6 A;  2BOS A;  1TWC H;  4GOP B;  2IL8 A;  3MFG A;  3U4Z A;  1VQN A;  2UXC L;  1FYC A;  4TSS A;  4LF7 Q;  4R9W A;  2L4N A;  1V1P B;  3KLS A;  1Z6H A;  3F1Z A;  1IBL L;  4BA1 I;  1UUP A;  1LV9 A;  3I4N H;  4LF7 L;  3KF8 B;  1LAC A;  4FYD A;  2SDF A;  4OON A;  4DK1 A;  1EIG A;  5C4X H;  1EYC A;  2DJF C;  3MXU A;  3H6M A;  3DWQ A;  5J1Z A;  3CCV A;  3Q6S A;  4QQB X;  3QIA A;  2L1B A;  2NN6 G;  2Z9H A;  1CFM A;  1TWF H;  2EYO A;  2PMZ B;  4JYA L;  4IUT A;  4I65 A;  2GVB A;  3DUZ A;  2Q2U A;  1XX8 A;  3NQT A;  1SXT A;  4AYB E;  3M7N A;  1PFS A;  1GM5 A;  5JJI A;  1D2B A;  1Y14 B;  3PUY A;  3RMH A;  2JXM B;  1Y8P B;  1QNK A;  3MXP A;  3RD4 A;  4X62 Q;  3AMU A;  4HIO A;  4KN4 C;  5C5L A;  2NWG A;  2B2W C;  5EKK A;  3K5L A;  5BN4 A;  3O13 A;  2XVS A;  3PO2 G;  1X6O A;  2N49 A;  1RD9 D;  2K75 A;  4KD4 A;  3R2I A;  1W6J A;  4GOP C;  1SJE D;  3I4L A;  2CW0 D;  4XQQ A;  1PHJ A;  1JB7 A;  3AFP A;  3SK8 A;  2CW0 C;  4PZ7 A;  4B3T L;  3VYT A;  4DUZ L;  2BA1 A;  1O7Z A;  2RDH A;  3DEP A;  3I2Z A;  4R4T A;  3HOX B;  4F87 A;  1SBB B;  1K8G A;  3DM1 A;  2CH4 A;  2CVR A;  2K1B A;  4BBR H;  5KGU A;  1IBK Q;  3J7Y W;  3S1M B;  3K5N A;  4DR5 Q;  3D4R A;  3JAM c;  2ZJP A;  2Z0S A;  5A2Q L;  2F52 A;  4IPG A;  2NN6 I;  3OWE B;  4HJ7 A;  4A3D G;  4OO1 G;  2AQ2 B;  4PQX A;  1QZG A;  4DFA A;  1HH2 P;  2Q2I A;  4AQY Q;  1PRT F;  3TZU A;  2JN4 A;  3SE0 A;  1F9P A;  2IX1 A;  3LWU A;  4A3B H;  1D8L A;  1WTH A;  1CKM A;  2EIF A;  1NR2 A;  1R4Q B;  2B2V A;  2NUC A;  2WAQ G;  4AQY L;  2K5D A;  1PYS B;  3NUC A;  1SE3 A;  2JK8 A;  2YV5 A;  4L5R C;  2VL6 A;  2LFN A;  2TMP A;  1J6Q A;  3URY A;  4BY1 H;  4FDB A;  4EQ5 A;  1WD0 A;  1PZK D;  1SJH D;  1WD1 A;  2WAC A;  3H0G H;  2H4O A;  4A3L G;  2FMC A;  5HGT A;  1BBU A;  4HJA A;  2N3S A;  1K0R A;  3TP7 A;  3CXC A;  1CSQ A;  2G9D A;  1Q1B A;  4K8J A;  1OXX K;  4R8I A;  5LMN W;  4LFC L;  4BY7 B;  3WWV A;  4X64 Q;  1BDO A;  5C3E H;  1EU4 A;  5JEA G;  1ESF A;  2QF7 A;  2R7Z H;  4QB4 A;  4F88 A;  1KXL A;  3K59 A;  4OO1 I;  4X64 L;  1QUQ A;  1RTN A;  2ZTE A;  1Z47 A;  1Y1V H;  4CDF C;  2A1A A;  3ER0 A;  3T51 B;  1QOH A;  3WOE A;  3WDN A;  4X3U A;  1H9S A;  2I5L X;  2HIX A;  4UP7 A;  1PDQ A;  3M7G A;  3T4A C;  1I4H A;  3VDY A;  1C48 A;  4K6L A;  4DV0 L;  1PH9 A;  3G71 A;  2VY3 A;  1FGU A;  2QIL A;  2EOT A;  4XTC S;  1OXU A;  4DF7 A;  1EY5 A;  4F7X A;  1GVP A;  3KJO A;  3J81 E;  4KHV A;  3I55 A;  2CH4 W;  2YU9 B;  3J80 L;  1KIX A;  1D1I A;  1Q7Y C;  1JB3 A;  2DJG C;  1VQ4 A;  2SNS A;  4UAI A;  5DM7 3;  4LJZ C;  2NB0 A;  4KY6 A;  4LF8 L;  3D6C A;  2KA7 A;  1XMQ L;  1RHP A;  1CZW A;  1LTB D;  5E3F A;  2F0W A;  3VYU A;  2F0E A;  4KK7 A;  4NDX A;  1FNU A;  1HA5 A;  3KFU A;  2WKC A;  4GKJ Q;  1TWC B;  4ZYS A;  3SGI A;  5C3W A;  5FO9 B;  1BVS A;  1EY4 A;  3P75 A;  4CKE A;  1HZ9 A;  2EYL A;  4DPG A;  3HKZ E;  3HOX G;  3OIQ A;  1DZ1 A;  3AEV A;  5JJL A;  2J0T D;  1F2Z A;  3QG1 A;  2F0Q A;  1V8Q A;  2Q8R E;  2F4I A;  2ZM6 L;  4DR7 Q;  1QUQ B;  4K14 A;  2HIV A;  1KAW A;  3CRK C;  5C4J H;  1XMO Q;  4A3E H;  1H9S B;  3M85 A;  1I5F A;  4RA8 A;  4DR7 L;  3C2P A;  2Q2T A;  5EKI A;  3J7Z C;  5ELC A;  2B2V C;  3AFQ A;  2WP8 J;  3C3L A;  1SN8 A;  2NVX H;  1SNP A;  4NKL A;  4PMC A;  1Z9F A;  2F0P A;  3HEJ A;  2UU9 Q;  3RLO A;  3A74 A;  1AE2 A;  3GTM B;  2XTI A;  4NXM Q;  3TZD A;  2A5H A;  4YHH Q;  1GUG A;  4IPD A;  2XRS D;  2XWB B;  4K2K A;  3ONA B;  2F4V Q;  4NXM L;  2D0P A;  1HHV A;  4GKK L;  2OTL A;  3QOL A;  1ROD A;  4ZUI A;  2IHE A;  3J7A F;  3EBE A;  4YHH L;  2GVA A;  5IWA Q;  3SR1 A;  1KTK A;  3VA7 A;  4DV6 L;  2WB1 E;  3DM3 A;  4UHV A;  1DOM A;  3HOU B;  1A62 A;  1TXY A;  3CU7 A;  4DR6 Q;  3NXW A;  4YCU A;  4DV3 Q;  4TVA B;  3J80 i;  3TRE A;  4BY7 G;  4PZ8 A;  1DON A;  3A7A B;  4CKC A;  4DAV A;  3F2B A;  2ASB A;  4DV3 L;  4S3S A;  5AFW A;  1EFI D;  4Q0F A;  1LLR D;  4JI7 L;  4K0K L;  1IW7 D;  4EX5 A;  2A8V A;  3BYT B;  4KI0 A;  2D2C C;  1PH4 A;  3CMA A;  1L1O A;  1IW7 C;  1GUT A;  2Z8L A;  3W1G A;  2GA4 B;  5BN3 A;  3PO2 H;  3GTQ H;  1HUN A;  3ITP A;  1IKM A;  1DXM A;  2MPM A;  3J81 c;  1RF2 D;  3UE0 A;  4DXG A;  3OSO A;  2Q2H A;  1KQS A;  4DV4 Q;  3AYH B;  2L11 A;  3CAM A;  3H09 A;  1FNV A;  1S5D D;  1AW7 A;  4BY1 B;  1X65 A;  5DAU A;  4DR4 Q;  1F9R A;  1B7Y B;  3H0G B;  2OEO A;  3S9W A;  1ZKO A;  5EKL A;  4CDC C;  4OHJ A;  1UEB A;  4A3D H;  4OO1 H;  2X6G A;  4OX9 L;  1O7L A;  2VXW A;  1E0B A;  1K73 C;  2OTJ A;  2UXD Q;  4JW0 A;  5C3E B;  2QDB A;  1NR4 A;  1VQD A;  3PGZ A;  4JV5 L;  1O78 A;  2PZU A;  4HCS A;  3PSI A;  2R7Z B;  1SAP A;  2UXD L;  5LL6 X;  4OIK A;  4A3J G;  1DM0 B;  1QE6 A;  4X65 L;  1CZG A;  2X69 A;  3TP5 A;  2QA4 A;  1K0S A;  5E4X A;  3K5O A;  1BCP B;  1LYL A;  1UE1 A;  1L1O B;  1SNM A;  4A3L H;  1PFN A;  1WTP A;  3I90 A;  2F0S A;  5FJ8 H;  4RCO A;  4GS3 A;  3BYY B;  2KVM A;  3PUW A;  5FO7 B;  4YWM A;  3FMC A;  4RKL A;  3VR5 A;  3HOZ G;  1HFN A;  3BJU A;  2UUA Q;  5LHY 1;  2EQS A;  1HQM C;  3U9O A;  4ULL A;  4RHR A;  5JEA H;  2L0C A;  4LF9 Q;  2R7F A;  5E1F A;  4NXN Q;  4IQZ A;  5C0X H;  1LUZ A;  1YHB A;  1KAA A;  2HHH Q;  3D8G A;  2C35 B;  3TP8 A;  4R4Q A;  1PZJ D;  5I6W A;  3OW2 A;  2VNU D;  1LTL A;  1VQ8 A;  5D65 A;  1MJE A;  3CP0 A;  2HUG A;  1B8A A;  1K8O A;  4QGU A;  3M3Y H;  5BR8 Q;  2E8G A;  3BZK A;  3HOU G;  1WI5 A;  1F2M A;  1BCP D;  4X3T A;  2PW5 A;  2NTT A;  3D31 A;  5BR8 L;  2C9O A;  1WTV A;  1BCP C;  1SYF A;  3TP6 A;  4LF6 L;  1L1O C;  5IP9 H;  1ESR A;  1ONL A;  1V1Q A;  4A3E B;  1JOK A;  1L0W A;  3S17 B;  2YTV A;  4IOC A;  3GTO B;  3GDE A;  3CKI B;  3ERS X;  4JI8 L;  3MEH A;  3TSS A;  1O80 A;  1NUC A;  2PPB C;  4IOA A;  3ZYY X;  3FDT A;  1A2U A;  2EZV A;  1YBY A;  5CGK A;  2NVX B;  2NVY H;  1HJP A;  2K01 A;  2WII B;  2KED A;  4RAU C;  2A6H D;  4DXF A;  1SND A;  3A8I E;  1VMC A;  4PZ6 A;  3HOX H;  3S1R H;  2JQO A;  1VQL A;  2K5N A;  4BY1 G;  4RGM A;  5C4Z A;  1I3Q H;  1HXY D;  3FP9 A;  4J1M A;  2UUC Q;  4HR7 B;  1CTM A;  1YZ6 A;  1PH1 A;  1TY0 A;  2HCI A;  4FXG C;  2IY5 B;  1C0A A;  2D5D A;  3G48 A;  1Y8O B;  2AUK A;  3PUZ A;  3QWN A;  1UE7 A;  2JJQ A;  4RCN A;  1G51 A;  1E2W A;  2EY5 A;  2HCC A;  2VW9 A;  2KQ3 A;  4FF4 A;  2AUJ D;  2R7D A;  2OQ0 A;  1D1K A;  5EGT A;  1KDB A;  4QUF A;  1X54 A;  1B4O A;  4NW2 A;  1EOV A;  2CWA A;  3L3O C;  4HMI A;  2JA9 A;  4LF5 Q;  3PO2 B;  4A93 H;  1X3E A;  4LMQ D;  3GTQ B;  1MSH A;  4B3M L;  1U5K A;  1B70 B;  2EY6 A;  3Q0A A;  4LF5 L;  1SYG A;  3IFT A;  4YCW A;  3JAM L;  1PVO A;  3M9B A;  1GD7 A;  3A5Z B;  3HP3 A;  5HUR A;  2F0D A;  2EXD A;  3HOV G;  2Q8I B;  1MBY A;  3KLS X;  1EZ8 A;  1PLF A;  3SEB A;  4O42 A;  4J8Q A;  4C2M H;  5DLQ E;  4A3C H;  1WTO A;  2B8F A;  1WCM H;  1JMC A;  2F0I A;  2HQE A;  5COY A;  1EWI A;  4QL5 A;  2L9H A;  3I8Z A;  3V96 A;  1HNW L;  2F0F A;  1G29 1;  4Z9C B;  1HNZ Q;  1SEB D;  3GTG H;  2BDO A;  1DD2 A;  3JAM E;  1JOO A;  4A3D B;  1IBM L;  2PI2 A;  1IL8 A;  2KBN A;  1Q8I A;  3T1H Q;  1CUK A;  1N32 Q;  3E0J A;  3T56 B;  1H9R A;  3G6J B;  2F0V A;  2WAQ B;  1H9M A;  1N32 L;  3MEF A;  1U0L A;  3UDF A;  1TVX A;  4POG A;  2B2T A;  4NP5 A;  5IIF A;  5FKA C;  2YU9 H;  3BVM A;  2K50 A;  5G3L D;  1B2T A;  1K83 H;  4ILW A;  4A3E G;  4LW1 A;  5I4D A;  4NB3 A;  4CDD C;  5CBE E;  2R61 A;  4K5W A;  4YIJ A;  4A76 A;  1R4P B;  4N8X 1;  2L55 A;  2BE5 D;  1S4Z A;  1ILQ A;  3ULP A;  2JA5 B;  2BE5 C;  1FGB D;  3Q22 A;  2BCO A;  4JI4 Q;  2ZXP A;  1YNJ D;  4JI6 L;  2JYO A;  4OGQ C;  4IUN A;  5TSS A;  3MC0 B;  1YNJ C;  2F3W A;  3G4S A;  4R1J A;  4A3J H;  5JEA J;  5EPK A;  4DNT B;  1Q86 C;  5M5Y H;  1E7Z A;  2EY1 A;  4E6I A;  1V43 A;  5C0X J;  3R93 A;  2B39 A;  3T1Y Q;  1IXR A;  4J15 A;  2EYH A;  3A5U A;  3GTP B;  4RHS A;  3M3Y B;  1JWM D;  3OWF A;  4YCV A;  1VQC A;  3L0O A;  2PZT A;  3MXG A;  3I70 A;  4G57 A;  4LUV A;  1HTP A;  4WOR A;  1EIY B;  3HOZ H;  1VQA A;  1HR0 Q;  2BH2 A;  2GN5 A;  3E0E A;  4HN7 A;  1Q90 A;  1A3V A;  2F3V A;  4CDE C;  1HR0 L;  4L5S A;  4OEM B;  3GTM H;  1PH8 A;  1JOQ A;  2EYF A;  4UDU C;  2K03 A;  4OL7 A;  1TKW B;  1F9Q A;  4X62 L;  4OWT B;  3VA5 A;  4AYB B;  5K36 G;  1HZB A;  1CKN A;  4HSV A;  3OTO Q;  3TRZ A;  1I50 H;  2NVY B;  5ELD A;  1GHK A;  1J5E Q;  3CCL A;  1A63 A;  1WTQ A;  3MTS A;  2FIN B;  4V19 0;  3OTO L;  3S1R B;  1CM9 A;  3CC2 A;  1EYD A;  1PTO B;  3I4O A;  3BU2 A;  4KMU C;  3J81 j;  3HOU H;  1YJ9 A;  2AKW B;  1B50 A;  1O7Y A;  2TSS A;  3H94 A;  4JPB W;  2QDL A;  1I3Q B;  2RCN A;  1KNA A;  5LMN Q;  1I6V C;  3KF6 A;  5FLX c;  2FMM A;  1I4G A;  3NWT A;  4DR3 Q;  1KDC A;  1CQV A;  3IL8 A;  3ERO A;  2B8G A;  1GHJ A;  4DKA C;  2OXP A;  1S5E D;  1IBK L;  1U9R A;  1VQO A;  4DR5 L;  1FL0 A;  2A73 B;  2JA8 H;  3F8T A;  3GV3 A;  3K7A H;  1BF4 A;  2KOL A;  2B2T C;  1H9K A;  4MNO A;  3EFX D;  2KHS A;  2A68 D;  3KJP A;  3LGJ A;  2A68 C;  4XYO A;  5KYL A;  1E2V A;  1G91 A;  4MIU A;  2CHB D;  2LSS A;  2RDG A;  3W3A A;  4JOI A;  3VYR A;  4A93 B;  3NBI A;  3X3N A;  4IN3 A;  4RWS C;  3ULJ A;  1CKN B;  5FJ8 G;  4X66 Q;  1PTO D;  3CME A;  1X9N A;  1KRS A;  1ICF B;  2EDG A;  1MGS A;  1PTO C;  5HGQ A;  1G6P A;  2JA5 G;  2ZTD A;  1PYW D;  4PG3 A;  1Q1E A;  4EQN A;  1B9M A;  5FK9 C;  1CI3 M;  3LWE A;  4C2M B;  2Z4H A;  3SXH A;  5IGC A;  5LMU Q;  4H0L C;  3PIP A;  2O5I C;  4B9X A;  1X3Q A;  3SK6 A;  1WCM B;  2MFI A;  3KF6 B;  3J81 L;  1EQT A;  2D62 A;  1I4R A;  1VQF A;  3N52 A;  4MZ9 A;  4GN5 A;  2F3I A;  4RGT A;  5C0X G;  5LMU L;  3GTG B;  4LUZ A;  5J3B A;  1BXT A;  5CC4 A;  4C56 C;  3NE5 B;  1F77 A;  3K58 A;  3S15 B;  5FOB B;  4DAM A;  1FJG Q;  3S14 B;  2JP1 A;  3P1H A;  3HOV H;  1FJG L;  1X3G A;  5DNF A;  3HOW H;  1W2B A;  4LUO A;  1GXD C;  1K83 B;  5IP9 G;  4JI3 Q;  3PUX A;  3MHB A;  1C4Q A;  4P74 A;  5IT9 c;  2DY8 A;  3RN5 A;  2E5L Q;  4K5V A;  2FFK B;  4JI3 L;  1C7Y A;  1TII D;  4QIW B;  1PFM A;  2PYK A;  4AYB G;  3DLL A;  1WVL A;  2E5L L;  2K14 A;  2UUB Q;  1P8L A;  2A19 A;  1EFW A;  1SNO A;  5CV7 A;  1M4V A;  2DUD A;  4KJO A;  2D0O A;  4H13 C;  2P5Z X;  2UUB L;  4GKJ L;  2IX3 A;  5C0X I;  5ELN A;  5E4W C;  4A3J B;  1KLU D;  4JI1 Q;  1ENC A;  5M5Y B;  2O4X A;  3L7Z C;  1X32 A;  4FF1 A;  2E2J B;  4XT1 B;  1MI2 A;  1I6H H;  1ZXT A;  3HKZ B;  1JE4 A;  1BCP F;  3S17 H;  3GTO H;  1STB A;  3K7U C;  1DOL A;  5EAY A;  5F2D A;  2E2D C;  1XMO L;  1NMF A;  5D3D A;  1YI2 A;  3FKI B;  2IW3 A;  1GUO A;  2E75 C;  4F8M A;  1X3P A;  1MKH A;  3HOZ B;  1HCZ A;  2K32 A;  4WFN 3;  5IGG A;  5ELE A;  1N36 Q;  3CQZ B;  5C3X A;  1EYA A;  4JOI C;  5D3I B;  5JVG 3;  2MO0 A;  1STG A;  4CJ1 B;  2KEE A;  3J81 i;  4HED A;  1N36 L;  3RZO H;  3P20 A;  1VQJ A;  4MHE A;  3TN2 A;  1E1O A;  1HNX Q;  1JC7 A;  3AQQ A;  3QR8 A;  2UU9 L;  4A93 G;  3X3M A;  5CBA E;  1LT4 D;  4I7A A;  1I50 B;  5CV5 A;  1XPU A;  3RNU A;  2K04 A;  1LT5 D;  1STE A;  2BDN A;  3VR4 A;  4OIJ A;  2F4V L;  4Y7N B;  2EVB A;  1EU3 A;  1W3S A;  5GAH C;  5IWA L;  3KDF A;  5M3M H;  4IFD J;  2IT1 A;  1QVG A;  4A3C G;  4GLX A;  2N88 A;  4K2L A;  3RLF A;  4DR6 L;  4RH6 A;  1VQ6 A;  1WCM G;  1ML0 D;  4GZY C;  1QG7 A;  4Y52 H;  5JJK A;  3PV0 A;  3SHL A;  1JR0 D;  4GNX A;  1SSO A;  5FLM G;  3I4M H;  2IJ0 A;  4B08 A;  5M5X H;  2RHS B;  2WV6 D;  4IPC A;  2JA8 B;  1RIP A;  3K7A B;  1LTI D;  1T5E A;  5IGE A;  5K36 H;  1TWA B;  2F0H A;  1TWG B;  1SYC A;  2BH8 A;  3DHQ A;  1U4R A;  1A15 A;  3GD7 A;  1CKO A;  2M9V A;  4IAL A;  2Z4I A;  4RMF A;  1XPR A;  2RCF A;  3S16 H;  2CWP A;  4YWL A;  5KNB A;  1XJV A;  3M4O H;  1VQI A;  1NMG A;  4B3S Q;  5HY6 A;  3NSW A;  2ICI A;  3E9I A;  4PV1 C;  1PFB A;  2C5C A;  4DU9 A;  1QVC A;  5D14 A;  3K8A A;  1ASZ A;  3NBH A;  4KHP Q;  1QWY A;  4DV4 L;  1A3T A;  4XDX A;  1DOK A;  3HOY B;  1VF5 C;  1G2T A;  2A6E D;  2YTX A;  3W2D A;  2I07 B;  1WTW A;  2CQA A;  1A6X A;  4IZ8 A;  2K6A A;  2A6E C;  4DR4 L;  4KHP L;  2AMC B;  4FXD A;  4IJL A;  3GP7 A;  2DGY A;  1OXV A;  1RCV D;  4DAY A;  4KD3 A;  4DK3 C;  4DR2 Q;  3F2D A;  5M3F B;  1VQ9 A;  3HGB A;  4TKO B;  5J39 A;  1SRU A;  3ND8 A;  3I56 A;  4C3I B;  3KDF B;  4A3K G;  1VDZ A;  1VQP A;  2B63 H;  1Q12 A;  1K8A C;  2VUM G;  2B2Y A;  3Q23 A;  3F2C A;  3NHH A;  2F0M A;  1QVF A;  4GNX B;  2RVL A;  1IL2 A;  2G9H D;  1B53 A;  3CPW A;  2A69 D;  3LNN A;  4HID A;  1S72 A;  2OT2 A;  5CV8 A;  1O7I A;  2A69 C;  3VYS A;  3HKZ G;  3M4P A;  4K8I A;  5EJW A;  3OPO A;  3GTJ H;  1B3Q A;  2K33 A;  2CQO A;  4ZRZ A;  2Y0S E;  3FKI G;  2JA5 H;  3HOV B;  2EJM A;  5IGD A;  1PH3 A;  4PNY A;  3HOW B;  4B9W A;  1F2Y A;  1EQV A;  2H5X A;  1PH7 A;  3A54 A;  2VB3 X;  1CT1 D;  2K4K A;  4KJN A;  1M1K C;  2UUA L;  3FEW X;  3H3V I;  5IYC G;  3QJY A;  2JA7 B;  2MQH A;  2NZH A;  4LF9 L;  4NXN L;  1GOZ A;  1NSN S;  2X6L A;  2B3G A;  1JE5 A;  3I73 A;  1JJC B;  1VQ7 A;  2HHH L;  4V0B A;  3GTP H;  4JI5 Q;  3M4Q A;  1EWH A;  4IFD G;  3PUV A;  1B9N A;  2NTS A;  2NZO A;  3TDQ A;  1G8Z D;  4U67 3;  4GNX C;  4JI5 L;  2L12 A;  4NPS A;  3J7A V;  3A0J A;  4C1N I;  2RQX A;  4DV2 Q;  1N34 Q;  1I6H B;  2SEB D;  1SE8 A;  4QJF A;  3UE1 A;  2PQA A;  4XT3 B;  4B3R Q;  3OMG A;  1QB5 D;  4DV2 L;  3I72 A;  4M1U B;  2JA8 G;  1WYD A;  1G2S A;  2F0N A;  2ZT9 C;  1B3A A;  1FNW A;  2HQL A;  3QOJ A;  1LO5 D;  4DAP A;  1OO9 B;  5GRO A;  3PIO A;  4CKB A;  1U4L A;  2A6H C;  3U50 C;  1IYV A;  2VZA A;  3S2D H;  4DGZ A;  2PZW A;  1IYU A;  3SVM A;  1ET9 A;  1Y8N B;  1PTO H;  1SE4 A;  4N9P A;  3CCQ A;  3RZO B;  1VQK A;  4JCV E;  1DGS A;  5E7N A;  1C8C A;  2F0O A;  3HOY G;  2K28 A;  4H02 A;  3DXJ C;  4FO2 A;  1SNQ A;  5M5W B;  1A0I A;  2QKI C;  1GJX A;  4Q5V A;  3UDG A;  4IFD I;  3OYY A;  2N8N A;  4DR1 Q;  2UUC L;  1IHZ A;  1L2F A;  3K57 A;  1NCV A;  2B2Y C;  2OF1 A;  1I94 Q;  5M3F G;  1YJN A;  5M3M B;  1KLG D;  1NTG A;  2F0K A;  4C3I G;  2XWJ B;  1I94 L;  1F9S A;  3H91 A;  3TQY A;  2PQA B;  3I4M B;  5M5X B;  2R93 B;  2LS0 1;  3EIV A;  4DV5 Q;  1N9W A;  3E6Z X;  5EPL A;  2IPK D;  4A75 A;  3T13 A;  3D4W A;  5C6A A;  1BUV T;  5ISR A;  3IAY A;  4DUY Q;  5FLX L;  1JT8 A;  1K9M C;  1CK1 A;  3MAQ A;  2V1C C;  3BZC A;  3K81 C;  2UXB Q;  3U9S A;  3EA6 A;  4OWX B;  5C44 B;  2CFM A;  2MHV A;  4DV7 Q;  5CR3 A;  2RHQ B;  3HOW G;  3S16 B;  4DUY L;  3M4O B;  2QGQ A;  5EPJ A;  3TS2 A;  4R4O A;  5COR A;  1XYI A;  4RKB A;  3R2T A;  3PQI A;  1LTG D;  1TWH H;  4DV7 L;  2OWO A;  1TT2 A;  2QW7 A;  4EQP A;  1VQG A;  2NVQ B;  2PQE A;  4I7Z C;  1JQY D;  4EQO A;  1PMR A;  3K5M A;  1EY0 A;  1TY2 A;  2JA6 B;  3S1N H;  1SYD A;  5FLM H;  5FLX E;  2JA7 G;  3N6R A;  1WOC A;  1G6Z A;  4C1N K;  5DM6 3;  3GQB A;  5T1G A;  2VQE Q;  3CC7 A;  3U58 A;  1ZEQ X;  1PYB A;  1ICW A;  1UE5 A;  1HNZ L;  3S15 H;  1UWV A;  4CGY B;  4WRD A;  3S14 H;  2LXJ A;  3T1H L;  1QIL A;  2E74 C;  2WFW A;  4ZKC B;  2B63 B;  4OXP A;  2O2L D;  1KAB A;  3A8K E;  1XNR Q;  4QUC A;  1U4P A;  2WAQ E;  1SLJ A;  2ALY B;  2HT1 A;  1W6K A;  1QJO A;  4DN4 M;  1AH9 A;  1T9H A;  1NE3 A;  1NBW A;  4L5Q A;  1XNR L;  4KY5 A;  4G7H C;  3PO3 G;  4YWK A;  1FR3 A;  1Q46 A;  4RG1 A;  4XQJ A;  2F0T A;  3CCE A;  2EJG C;  4CBV A;  2VB2 X;  5GAD C;  2JSO A;  4JC0 A;  3GTJ B;  1OXT A;  2RDF A;  2R6G A;  5GAG C;  4JBM A;  4G4K A;  4BA2 I;  2KCN A;  2R3Z A;  3H3V H;  3NTH A;  2ATW A;  2OCE A;  1SFO B;  4DV1 Q;  1D5M C;  1YNN D;  1TS5 A;  5JVH 3;  1QZH A;  3RZD H;  3AU7 A;  1YNN C;  1AEX A;  1IKL A;  4A3K H;  4KN7 C;  2MGS A;  2M00 A;  1XTD A;  1XWE A;  4O2D A;  3V2T A;  1Y1W H;  2HDM A;  5T1I A;  2EXZ A;  4BBS H;  2VUM H;  3C1F A;  2PNR C;  4JI4 L;  4HCE A;  4ZUJ A;  4HIK A;  1JCK B;  1RKN A;  4KY7 A;  2E2J H;  1KC8 C;  3KYH C;  4JVZ A;  3PIP 3;  1RJT A;  1LM0 A;  1HPC A;  1IBL Q;  2FJ2 A;  3CHB D;  2PI2 E;  3AB9 A;  1VF7 A;  5IT9 L;  3JAM i;  3T1Y L;  3A8J E;  1E22 A;  5IOD A;  1C9O A;  3GO5 A;  1YJW A;  5EQ0 A;  1CHQ D;  1BOS A;  3FKI H;  2NZ1 D;  1WFQ A;  3GV6 A;  3W5O A;  5M3M G;  2JEB I;  4LAA A;  2PMZ E;  1R9T H;  4HIM A;  2LY7 A;  3G7L A;  3MA2 B;  3CQZ H;  1CHP D;  4TQU S;  2KHJ A;  4JYA Q;  2SNM A;  4L63 B;  4U68 A;  3I4M G;  1E3P A;  3TEH B;  2R93 G;  5IYC H;  3K6O A;  2E76 C;  5IT9 E;  2ID0 A;  1OTC A;  2DY7 A;  1MIU A;  2VS1 A;  1SYE A;  1EYG A;  3VR2 A;  5DEH A;  1XXG A;  2KUM A;  3GTK H;  5C44 G;  4C3J B;  3UDI A;  3S2D B;  4Y7N H;  4IFD H;  1J9O A;  3NP8 A;  1J5E L;  3BDO A;  2E2I B;  3KLW A;  1SMX A;  4A3F B;  5IE8 A;  4OEL B;  1F2L A;  4A3G B;  3JC6 6;  1P16 A;  4B3T Q;  4DUZ Q;  3HRZ C;  1X55 A;  2JA6 G;  2I5H A;  2I46 A;  5LMN L;  5LL6 S;  3K0Y A;  4UY8 C;  2R92 H;  1EEF D;  4QF4 A;  4DR3 L;  4HJ8 A;  4DNR B;  4A3I B;  2LMC B;  3C1E A;  5C5M A;  5JAV A;  4FVM A;  1S5C D;  1TWA H;  1NAP A;  1TWG H;  1PV4 A;  2ES2 A;  1M90 C;  2K5Q A;  2J4X A;  4ZCK A;  2B63 G;  5JPN C;  3STB D;  1OXS C;  4WJ3 M;  2KHI A;  4IUP A;  1HUM A;  1RDP D;  2OQK A;  3CCM A;  3STB C;  2NVT H;  3BVZ A;  4ZK9 B;  4IO9 A;  3OMC A;  3D4D A;  2HD3 A;  3E3X A;  3D0F A;  3HOY H;  1DJR D;  1HR0 W;  2RKS A;  1BBW A;  1KNE A;  4ZKB B;  4IUU A;  4XYQ A;  2PO4 A;  1KHI A;  3QO2 A;  4BS9 A;  1N8R C;  3OW7 A;  4CJ2 C;  1PH5 A;  5A2Q E;  5AJ3 Q;  4X66 L;  1PA6 A;  2RF4 A;  5M3F H;  5GAE C;  3KUP A;  2PW7 A;  1JOR A;  1TWH B;  4EVO A;  1VQB A;  1DCZ A;  1E1T A;  1D6E C;  4C3I H;  3CCR A;  2MUY A;  1EL0 A;  5AJ3 L;  4C3H B;  4DNI A;  3TS0 A;  4JI0 Q;  1LTT D;  4BXX G;  3S1N B;  1SRO A;  3WOF A;  5CV9 A;  5IGB A;  4LFC Q;  4XIG S;  4CHT B;  1LTS D;  4JI0 L;  5ELB A;  2IWH A;  3KLR A;  4H44 C;  1LT6 D;  2ZJR A;  3NTK A;  1I4Q A;  5J22 A;  1TS4 A;  3E9H A;  2RSN A;  4ODG A;  2RA4 A;  5H1S E;  2ZXO A;  4R8N A;  1EZ6 A;  2A74 C;  1ZYR D;  1S3O A;  3K80 C;  1Z7T A;  1LTA D;  4QMG A;  3P7J A;  1ZYR C;  2MO1 A;  4QY7 A;  3Q24 A;  2B2U A;  4DV0 Q;  2J7Z A;  1EWC A;  1WJJ A;  2M2L A;  3QB3 A;  1QCB D;  4X3K A;  3A56 A;  5IYD H;  5KYI A;  2VQF Q;  1TU2 B;  5I9P A;  4HMJ A;  4ME5 A;  4LFA Q;  3EVQ A;  2JA7 H;  5IYB G;  3NEM A;  4LF8 Q;  1XMQ Q;  4QIW E;  2VQF L;  2L15 A;  1AFP A;  3HZX A;  1KL9 A;  4LFA L;  5CV6 A;  3RZD B;  4FF2 A;  1HRJ A;  2WKD A;  3NWS A;  3BS1 A;  3NEL A;  1EY7 A;  2AHO B;  2F0L A;  4O0A A;  4A3K B;  1UAP A;  4C3J G;  3RN2 A;  1K3B C;  1JJ2 A;  1Y1W B;  1VQ5 A;  4BBS B;  2VUM B;  3E5S A;  4A4I A;  4IUR A;  4XQN A;  1Q8K A;  3PCO B;  3T53 B;  1J8I A;  4A3F G;  3CF5 A;  3G6E A;  1AZQ A;  1NNX A;  1KRT A;  4POF A;  1NJI C;  4A3G G;  1H9J A;  3DEO A;  1BQQ T;  5KIX A;  3PO3 H;  1MD2 D;  3A7L A;  4JI1 L;  4A3M H;  2RBM A;  3S2H H;  3DWA A;  2IHF A;  5JJZ A;  3J80 E;  3OOC A;  1VQH A;  2EYJ A;  4DA2 A;  5A35 A;  1CA6 A;  2ZM6 Q;  2AWO A;  3HKS A;  2PNH A;  3KK7 A;  2F1M A;  4A3I G;  4MTN A;  4ZQ3 A;  2QEX A;  3I4N B;  2F0U A;  3BDC A;  3B6Y A;  4WJ4 A;  1LT3 D;  1R9T B;  2PCF B;  3I7F A;  3SK5 A;  1D5Z C;  1HZC A;  2NYZ D;  2XRQ D;  4G7O C;  5C4X B;  2HDL A;  3IKJ A;  2K7V A;  4EGV A;  3IFD A;  3FVQ A;  2Z1C A;  1ENF A;  4QCL A;  1L0Y B;  3H3V C;  1PRT B;  2DN8 A;  4N9T A;  1TWF B;  3RLN A;  2ZXR A;  1FVI A;  2AWN A;  1X3F A;  2K05 A;  3HFZ B;  1HNX L;  2QCP X;  3KOJ A;  1RL2 A;  4IUV A;  5M5W H;  1KDA A;  3GTK B;  1GUS A;  3CRL C;  1D5X C;  4KKT A;  4P73 A;  1SR3 A;  1HTL D;  4MTK A;  5IP7 G;  1WTX A;  4GKK Q;  3ZJY C;  4HTH A;  1PZI D;  4ALP A;  1MJC A;  5FO8 B;  3CCU A;  5I9O A;  4C3H G;  4DV6 Q;  4R4I A;  1TS3 A;  2DNE A;  2LKV A;  4UPA A;  1H95 A;  2WB1 B;  3MXN A;  2F03 A;  2R92 B;  2R93 H;  5ELO A;  2NN6 H;  1EOT A;  2YYZ A;  3MFY A;  1CSP A;  1HA6 A;  1A3U A;  2EE1 A;  3W1B A;  5KNC A;  4KKS A;  1AP0 A;  4JI7 Q;  4G7Z C;  5BN5 A;  1EY8 A;  4BBR B;  2IX0 A;  3MWY W;  2B2U C;  1Y69 U;  4K0K Q;  4IJH A;  3C46 A;  1A8V A;  2XIW A;  3I3C A;  1EIF A;  5C44 H;  1PRT D;  3DMU A;  2V4D A;  1GO3 E;  2NVT B;  1VMP A;  3CCS A;  1PRT C;  1VS0 A;  3J7A 5;  2SOB A;  1XPO A;  3PIO 3;  4J6H A;  5EBD A;  1IZ6 A;  3FPU B;  1BBX C;  4B3S L;  2NVQ H;  1SMY D;  1YHA A;  2E2H H;  4A3B B;  3MVV A;  2JA6 H;  1SMY C;  2AQ1 B;  4GLA C;  2B29 A;  1Q3L A;  1RTO A;  4LNQ A;  1CA5 A;  1ASY A;  1ET6 A;  2D9U A;  5KEE A;  1M8A A;  1YIT A;  3FHW A;  4ZAI A;  5M9O A;  5CV4 A;  1HQR D;  1STN A;  3BDL A;  3NK9 A;  2NBF A;  4DR2 L;  1Y1W G;  4HAE A;  4GN4 B;  3HS0 C;  4FXK C;  4BBS G;  4OX9 Q;  3S1Q H;  2F0J A;  1KD1 C;  2KEC A;  3A55 A;  1HZA A;  1STA A;  2RSO A;  1BO0 A;  3J80 c;  3MXN B;  3GTL H;  4JV5 Q;  4DK0 A;  5CYU A;  2FXQ A;  2KCC A;  1I4P A;  4H7B A;  4JBK A;  1MSG A;  5G3L F;  1XTC D;  1YVC A;  2Z6K A;  4X65 Q;  3M4Y A;  4LWC A;  3L9A X;  3K0X A;  4LK1 C;  2G5D A;  1T5X D;  4JI2 Q;  1BNZ A;  3I4N G;  1SFO H;  1Y1V B;  2N78 A;  4KV6 A;  1XNQ Q;  3SDZ A;  1AZP A;  1II3 A;  4RGN A;  3ND9 A;  4JI2 L;  5C4X G;  2JE6 I;  3NBH B;  5ELF A;  2KEN A;  1XNQ L;  4HJ5 A;  2Y0S B;  4BXX H;  1D7Q A;  1CQF A;  4KKU A;  4N8F A;  1U4M A;  3BVG A;  3S24 A;  1EUJ A;  4JK1 C;  4DAY B;  1JJG A;  3PMF A;  3R3O A;  1BKB A;  1GKH A;  4P71 A;  1AE3 A;  4IPH A;  4K5X A;  2EYP A;  3NEN A;  3MZ5 A;  2F0G A;  3TBI B;  1S5B D;  2CCZ A;  5IY0 A;  2Z6B A;  1EY6 A;  2MJ8 A;  4GLV B;  2L5T A;  4CJ0 B;  1PH6 A;  1N33 Q;  3ICE A;  1A2T A;  4AIM A;  3PO3 B;  4UP8 A;  4A3M B;  2MP1 A;  2KJX A;  4L8J A;  1B44 D;  3S2H B;  1FD7 D;  1V9P A;  2WB1 G;  1GUW A;  5NUC A;  1N33 L;  4FP5 D;  1AN8 A;  3D6W A;  2R92 G;  4HSP A;  1N34 L;  4IUQ A;  1L0X B;  4X6A H;  4LF6 Q;  5IYB H;  4B3R L;  1VQE A;  4BBR G;  2O5J C;  4JI8 Q;  2CKZ B;  1JIC A;  5C4J B;  3IRB A;  3T16 A;  1E24 A;  2H1E A;  2LXK A;  4C3J H;  2MNA A;  2AQ3 B;  2E2I H;  4LFB Q;  1JWU D;  4A3F H;  4ID6 A;  4BWG B;  4RGO S;  1K3R A;  3Q8D A;  2ZJQ A;  4A3G H;  1S5F D;  4ABN A;  1EY9 A;  1STH A;  5IGF A;  5JPM C;  4LFB L;  3VR3 A;  1SDF A;  4A3B G;  4O1N A;  4L6T B;  3RR5 A;  1YEZ A;  2XN9 C;  1PXU A;  3NQI A;  2YTY A;  1IYJ B;  3PF5 A;  4A3I H;  2K5H A;  1LTR D;  2K5W A;  5IOC A;  1LAB A;  4M8A A;  4RFB A;  4DR1 L;  1UNS A;  2XGT A;  1UE6 A;  1SE2 A;  3H0G G;  4P2C B;  1EIH A;  3S1M H;  2I5M X;  3CW2 C;  3HG9 A;  4DK6 C;  1V1O A;  5KRU A;  5CMD A;  3KBG A;  1HFG A;  2EJF C;  1EEI D;  3ERQ A;  4WJW A;  1WTR A;  2Z6K C;  2EPB A;  4UP9 A;  3U4V A;  3EN2 A;  3KBX A;  1YHQ A;  2KCM A;  3R8B A;  5I6Y A;  3RUZ A;  5C3E G;  4DV5 L;  3UDX A;  1GUN A;  4K6D A;  2KCT A;  3H15 A;  2R7Z G;  2I0Q A;  4FF3 A;  1TQO A;  3DWP A;  5GQO A;  3EJI A;  5C4H A;  4B3M Q;  5KND A;  1Y1V G;  5IP7 H;  1PTO F;  1ILP A;  4MN3 A;  2UXB L;  1TS2 A;  4FNF A;  3NTI A;  3L2P A;  4C3H H;  5IYD G;  1Q82 C;  2E2H B;  2B2W A;  4NMZ A;  4TRD A;  2EYM A;  3OHX C;  2Y0S G;  4LF4 Q;  3EQL C;  3BZD B;  4P72 A;  2K5V A;  1K8M A;  5EBC A;  2Q8T A;  2BA0 A;  2FHT A;  4OWW B;  4GOP A;  1DYQ A;  1SYB A;  4LF4 L;  5JOB A;  3LX0 A;  1X56 A;  1HNW Q;  4BY7 H;  1V1P A;  2ICE C;  2VQE L;  1VQM A;  4JG2 A;  2K52 A;  1YIJ A;  1IBM Q;  2XNA C;  4APV A;  3S1Q B;  3BG3 A;  3OIP A;  4YY3 Q;  1NY4 A;  3KF8 A;  1EQQ A;  4PMW A;  4KLK A;  4AH6 A;  1Q81 C;  4PMB A;  3GTL B;  4YY3 L;  4A3M G;  4ZLT F;  3NPP A;  1ENA A;  5I2Y A;  3V05 A;  1PH2 A;  3CC4 A;  1JWS D;  3PF4 A;  2QEJ C;  2DNC A;  3CCJ A;  4P75 A;  4L5T A;  4JBJ A;  3VR6 A;  5I2X A;  3TME A;  3FRP B;  2XSC A;  3UI2 A; 
#chains in the Genus database with same CATH homology
 1PH5 A;  1W3S A;  5AJ3 Q;  4X66 L;  1PA6 A;  2RF4 A;  1S40 A;  5GAH C;  5IWA L;  3KDF A;  3D31 A;  5M3M H;  1YNX A;  2IT1 A;  5BR8 L;  5GAE C;  5M3F H;  1QVG A;  4A3C G;  4IFD J;  3ULL A;  4ME3 A;  4GLX A;  2JEA I;  1VQB A;  4HJ9 A;  1E1T A;  4KHZ A;  4C3I H;  4R4C A;  1L1O C;  3RLF A;  5IP9 H;  3CCR A;  4LF6 L;  1WCM G;  1VQ6 A;  4DR6 L;  1V1Q A;  5AJ3 L;  4JBW A;  4DNI A;  4DV1 L;  3TS0 A;  4Y52 H;  1L0W A;  2ZTC A;  3PV0 A;  2YTV A;  4JI0 Q;  5JJK A;  1EQR A;  4GNX A;  4IOC A;  4BXX G;  3GDE A;  3CPF A;  3ERS X;  1SRO A;  4JI8 L;  5FLM G;  3I4M H;  4A3G G;  5M5X H;  4LFC Q;  4XIG S;  4IOA A;  2RHS B;  4IPC A;  4JI0 L;  2UXC Q;  4GN3 B;  1RIP A;  1VCI A;  4JI6 Q;  1YBY A;  3CD6 A;  2ZJR A;  2NVY H;  1TWC H;  2BH8 A;  1HJP A;  4GOP B;  3E9H A;  3U4Z A;  1VQN A;  2UXC L;  3GD7 A;  4LF7 Q;  1CKO A;  5H1S E;  4PZ6 A;  4RMF A;  3HOX H;  3S1R H;  2JQO A;  1XPR A;  1VQL A;  3F1Z A;  1IBL L;  3S16 H;  2CWP A;  4YWL A;  2K5N A;  4BA1 I;  1XJV A;  1VQI A;  1NMG A;  1S3O A;  3K80 C;  4BY1 G;  4B3S Q;  3M4O H;  5HY6 A;  3I4N H;  3E9I A;  4LF7 L;  3KF8 B;  1QVC A;  2MO1 A;  4QY7 A;  3K8A A;  1I3Q H;  4DV0 Q;  1ASZ A;  4KHP Q;  4OON A;  4DV4 L;  3FP9 A;  5C4X H;  1WJJ A;  2UUC Q;  2YTX A;  1YZ6 A;  5IYD H;  2VQF Q;  1PH1 A;  4DR4 L;  4KHP L;  2AMC B;  3CCV A;  4IJL A;  4LFA Q;  4QQB X;  2DGY A;  2IY5 B;  2NN6 G;  2JA7 H;  5IYB G;  1OXV A;  3NEM A;  1C0A A;  1TWF H;  4JYA L;  4DR2 Q;  4DK3 C;  3G48 A;  4LF8 Q;  1XMQ Q;  3PUZ A;  4QIW E;  2GVB A;  2L15 A;  2VQF L;  2Q2U A;  3F2D A;  1UE7 A;  1KL9 A;  1VQ9 A;  4LFA L;  2JJQ A;  4AYB E;  3M7N A;  1SRU A;  1G51 A;  1PFS A;  3I56 A;  3NEL A;  2VW9 A;  2AHO B;  3KDF B;  4A3K G;  4O0A A;  1GM5 A;  2R7D A;  2OQ0 A;  3RN2 A;  1VQP A;  1JJ2 A;  2B63 H;  1Q12 A;  1Y14 B;  1VQ5 A;  3PUY A;  5JJI A;  4X62 Q;  1K8A C;  2VUM G;  3F2C A;  4HIO A;  4A4I A;  1Q8K A;  1X54 A;  3PCO B;  4A3F G;  1QVF A;  4GNX B;  3CF5 A;  1EOV A;  2CWA A;  3G6E A;  1IL2 A;  1NJI C;  1KRT A;  4POF A;  3PO2 G;  1X6O A;  2JA9 A;  3CPW A;  2N49 A;  4LF5 Q;  2K75 A;  4HID A;  1X3E A;  1S72 A;  4A93 H;  3PO3 H;  4B3M L;  1U5K A;  4JI1 L;  4A3M H;  1B70 B;  1O7I A;  4GOP C;  3HKZ G;  3S2H H;  2IHF A;  3M4P A;  1PHJ A;  1JB7 A;  1VQH A;  3AFP A;  4LF5 L;  4YCW A;  4PZ7 A;  3M9B A;  3GTJ H;  4DUZ L;  4B3T L;  2ZM6 Q;  1PVO A;  2AWO A;  2BA1 A;  3I2Z A;  1GD7 A;  2CQO A;  3A5Z B;  3HKS A;  4R4T A;  2PNH A;  2Y0S E;  2EXD A;  3FKI G;  4A3I G;  3HOV G;  2JA5 H;  4MTN A;  1PH3 A;  2QEX A;  1K8G A;  4WJ4 A;  3B6Y A;  3I7F A;  4C2M H;  5DLQ E;  4A3C H;  1HZC A;  4BBR H;  1IBK Q;  1PH7 A;  2H5X A;  4DR5 Q;  3JAM c;  2ZJP A;  1WCM H;  1JMC A;  2K4K A;  2Z0S A;  1EWI A;  4QL5 A;  1HNW L;  2F52 A;  1M1K C;  2UUA L;  4IPG A;  1G29 1;  3H3V I;  2NN6 I;  1HNZ Q;  5IYC G;  3GTG H;  4HJ7 A;  4A3D G;  4OO1 G;  2MQH A;  2NZH A;  2PI2 A;  1IBM L;  3RLN A;  2KBN A;  1QZG A;  4NXN L;  4LF9 L;  3T1H Q;  1CUK A;  1FVI A;  1HH2 P;  2Q2I A;  2AWN A;  4AQY Q;  1N32 Q;  2B3G A;  1JE5 A;  1X3F A;  3HFZ B;  1JJC B;  1HNX L;  2IX1 A;  3KOJ A;  1VQ7 A;  1RL2 A;  2HHH L;  4A3B H;  5M5W H;  1D8L A;  3GTP H;  1CKM A;  2EIF A;  3M4Q A;  4JI5 Q;  2WAQ G;  4AQY L;  1N32 L;  3MEF A;  1U0L A;  3UDF A;  1PYS B;  4IFD G;  3PUV A;  2NZO A;  2JK8 A;  2YV5 A;  4POG A;  4P73 A;  4L5R C;  1SR3 A;  5IP7 G;  2VL6 A;  4GNX C;  1J6Q A;  2YU9 H;  4JI5 L;  4BY1 H;  4GKK Q;  4FDB A;  3ZJY C;  4NPS A;  2K50 A;  4EQ5 A;  3A0J A;  1K83 H;  4ALP A;  4DV2 Q;  1MJC A;  1N34 Q;  3CCU A;  4A3E G;  4LW1 A;  1SE8 A;  3H0G H;  4QJF A;  4NB3 A;  4DV6 Q;  4A3L G;  3UE1 A;  4R4I A;  2PQA A;  4B3R Q;  1BBU A;  4UPA A;  4HJA A;  4A76 A;  2N3S A;  1H95 A;  1K0R A;  3CXC A;  4DV2 L;  1CSQ A;  1Q1B A;  2R93 H;  2JA8 G;  1WYD A;  5ELO A;  3ULP A;  2YYZ A;  1CSP A;  2HQL A;  1OXX K;  3W1B A;  5LMN W;  5GRO A;  4LFC L;  3PIO A;  4JI7 Q;  4JI4 Q;  3WWV A;  4X64 Q;  5C3E H;  4K0K Q;  2IX0 A;  5JEA G;  4IJH A;  4JI6 L;  3U50 C;  2R7Z H;  2VZA A;  3S2D H;  1A8V A;  5C44 H;  1KXL A;  1EIF A;  3G4S A;  4R1J A;  1GO3 E;  5JEA J;  3CCQ A;  4A3J H;  4OO1 I;  4X64 L;  1QUQ A;  2ZTE A;  3CCS A;  1Q86 C;  1VQK A;  1Z47 A;  1Y1V H;  1VS0 A;  2A1A A;  1E7Z A;  4JCV E;  1DGS A;  5M5Y H;  3ER0 A;  3J7A 5;  5E7N A;  2I5L X;  1V43 A;  2HIX A;  1XPO A;  5C0X J;  3HOY G;  4UP7 A;  3T1Y Q;  4B3S L;  1IZ6 A;  4H02 A;  2NVQ H;  1IXR A;  4J15 A;  1YHA A;  3VDY A;  2E2H H;  1A0I A;  3A5U A;  4DV0 L;  3UDG A;  2JA6 H;  4GLA C;  4IFD I;  1PH9 A;  3G71 A;  3OYY A;  2VY3 A;  1FGU A;  2N8N A;  4XTC S;  1OXU A;  2B29 A;  4DR1 Q;  2UUC L;  4YCV A;  1VQC A;  3L0O A;  4LNQ A;  1GVP A;  3KJO A;  1L2F A;  1ASY A;  1I94 Q;  4LUV A;  3I55 A;  5M3F G;  1YIT A;  1EIY B;  3FHW A;  1YJN A;  1KIX A;  1NTG A;  1Q7Y C;  3HOZ H;  1VQA A;  1VQ4 A;  1HR0 Q;  2BH2 A;  2GN5 A;  4DR2 L;  3E0E A;  4LF8 L;  1XMQ L;  1I94 L;  1Y1W G;  4GN4 B;  4BBS G;  4OX9 Q;  3S1Q H;  1HR0 L;  4L5S A;  1KD1 C;  3GTM H;  1PH8 A;  3TQY A;  2PQA B;  1HZA A;  3KFU A;  3EIV A;  3J80 c;  4DV5 Q;  1N9W A;  3MXN B;  3GTL H;  4JV5 Q;  4X62 L;  4OWT B;  5K36 G;  1HZB A;  4A75 A;  1CKN A;  3OTO Q;  3TRZ A;  2FXQ A;  1I50 H;  4GKJ Q;  3SGI A;  4JBK A;  1J5E Q;  4DUY Q;  3CCL A;  1A63 A;  1JT8 A;  1BVS A;  1K9M C;  1YVC A;  1HZ9 A;  2Z6K A;  2V1C C;  4DPG A;  3BZC A;  3HKZ E;  3K81 C;  4LWC A;  4X65 Q;  3OTO L;  3HOX G;  4OWX B;  3K0X A;  2UXB Q;  3CC2 A;  2CFM A;  3I4O A;  4DV7 Q;  3J81 j;  2RHQ B;  3BU2 A;  4JI2 Q;  4DUY L;  3AEV A;  3HOU H;  3HOW G;  5JJL A;  1YJ9 A;  2QGQ A;  3I4N G;  3TS2 A;  1SFO H;  2AKW B;  2N78 A;  4R4O A;  1XNQ Q;  2ZM6 L;  1TWH H;  2RCN A;  4DR7 Q;  1QUQ B;  5LMN Q;  3KF6 A;  2HIV A;  4DV7 L;  1KAW A;  2OWO A;  4JI2 L;  5FLX c;  5C4J H;  5C4X G;  1VQG A;  2JE6 I;  1XMO Q;  4DR3 Q;  4A3E H;  3NBH B;  3M85 A;  2KEN A;  1XNQ L;  1I5F A;  4DR7 L;  4HJ5 A;  3S1N H;  4BXX H;  4DKA C;  2Q2T A;  1IBK L;  1D7Q A;  5FLM H;  3J7Z C;  1VQO A;  4DR5 L;  2JA7 G;  3AFQ A;  1WOC A;  3S24 A;  1FL0 A;  2JA8 H;  3F8T A;  2VQE Q;  3K7A H;  1EUJ A;  2WP8 J;  1SN8 A;  3CC7 A;  3U58 A;  2NVX H;  1PYB A;  1UE5 A;  4DAY B;  1HNZ L;  4MNO A;  1Z9F A;  1JJG A;  3S15 H;  1BKB A;  1GKH A;  1UWV A;  3KJP A;  4P71 A;  1AE3 A;  4IPH A;  3S14 H;  2LXJ A;  3T1H L;  2WFW A;  3LGJ A;  3NEN A;  2UU9 Q;  4OXP A;  1XNR Q;  3RLO A;  3A74 A;  1AE2 A;  2CCZ A;  2WAQ E;  1SLJ A;  2XTI A;  2ALY B;  4NXM Q;  2HT1 A;  5IY0 A;  1AH9 A;  4GLV B;  1PH6 A;  2LSS A;  1T9H A;  4YHH Q;  1N33 Q;  4JOI A;  3ICE A;  1NE3 A;  1NBW A;  4IPD A;  4L5Q A;  4AIM A;  1XNR L;  3PO3 G;  4YWK A;  1Q46 A;  4UP8 A;  4RG1 A;  2F4V Q;  4NXM L;  2D0P A;  3CCE A;  4GKK L;  2OTL A;  1V9P A;  1CKN B;  2IHE A;  2WB1 G;  3ULJ A;  3EBE A;  5FJ8 G;  5GAD C;  4X66 Q;  4YHH L;  1N33 L;  3CME A;  2GVA A;  1X9N A;  2R92 G;  5IWA Q;  1KRS A;  1N34 L;  4JC0 A;  1OXT A;  4JBM A;  2R6G A;  5GAG C;  4BA2 I;  5HGQ A;  4DV6 L;  1G6P A;  2WB1 E;  3DM3 A;  2JA5 G;  4X6A H;  4LF6 Q;  3H3V H;  5IYB H;  2ATW A;  1A62 A;  1TXY A;  4DR6 Q;  1VQE A;  4B3R L;  2ZTD A;  2OCE A;  4YCU A;  4DV1 Q;  4DV3 Q;  4PG3 A;  1Q1E A;  4TVA B;  1QZH A;  3J80 i;  3TRE A;  3RZD H;  4BY7 G;  4PZ8 A;  4BBR G;  4JI8 Q;  2CKZ B;  5LMU Q;  3PIP A;  3F2B A;  3IRB A;  4A3K H;  2ASB A;  1E24 A;  2MFI A;  4DV3 L;  1XTD A;  2LXK A;  3KF6 B;  4O2D A;  4C3J H;  2MNA A;  1Y1W H;  2D62 A;  4BBS H;  1VQF A;  2VUM H;  4MZ9 A;  4JI7 L;  4JI4 L;  4GN5 A;  2F3I A;  5C0X G;  5LMU L;  2E2I H;  4LFB Q;  4HIK A;  4EX5 A;  2A8V A;  4K0K L;  4KI0 A;  4A3F H;  4LUZ A;  1PH4 A;  3CMA A;  1L1O A;  2E2J H;  1KC8 C;  5J3B A;  3W1G A;  1K3R A;  3KYH C;  3Q8D A;  2ZJQ A;  3PO2 H;  3GTQ H;  4A3G H;  4LFB L;  4A3B G;  1LM0 A;  1IBL Q;  3J81 c;  4DAM A;  1FJG Q;  3RR5 A;  1YEZ A;  3UE0 A;  2PI2 E;  3JAM i;  2Q2H A;  1KQS A;  3T1Y L;  2YTY A;  1IYJ B;  3PF5 A;  1E22 A;  1C9O A;  3GO5 A;  3AYH B;  4DV4 Q;  3CAM A;  1YJW A;  3FKI H;  4A3I H;  3HOV H;  1FJG L;  1WFQ A;  1X3G A;  3HOW H;  2K5H A;  3W5O A;  5M3M G;  1W2B A;  4LUO A;  2JEB I;  1X65 A;  2PMZ E;  1R9T H;  4HIM A;  4DR4 Q;  4DR1 L;  5IP9 G;  4JI3 Q;  2XGT A;  1UE6 A;  3CQZ H;  3H0G G;  3PUX A;  1B7Y B;  4TQU S;  3S1M H;  2I5M X;  4P74 A;  3CW2 C;  4DK6 C;  2KHJ A;  5IT9 c;  4JYA Q;  3RN5 A;  2E5L Q;  4JI3 L;  3I4M G;  1C7Y A;  1E3P A;  3TEH B;  2R93 G;  5IYC H;  2Z6K C;  1UEB A;  4UP9 A;  4A3D H;  3U4V A;  3EN2 A;  2ID0 A;  4AYB G;  3DLL A;  1YHQ A;  1OTC A;  4OX9 L;  2E5L L;  1MIU A;  2K14 A;  2VS1 A;  2UUB Q;  1P8L A;  2A19 A;  1K73 C;  1EYG A;  1EFW A;  2OTJ A;  2KCM A;  2UXD Q;  2DUD A;  5C3E G;  2D0O A;  4DV5 L;  3UDX A;  4JV5 L;  3PGZ A;  1VQD A;  3H15 A;  2KCT A;  2R7Z G;  3PSI A;  2I0Q A;  3GTK H;  5C44 G;  2UUB L;  3UDI A;  4GKJ L;  4Y7N H;  2UXD L;  5C0X I;  5ELN A;  4A3J G;  5GQO A;  1J5E L;  4B3M Q;  4JI1 Q;  1Y1V G;  5IP7 H;  3KLW A;  1SMX A;  4X65 L;  2QA4 A;  5IE8 A;  2UXB L;  3L7Z C;  3JC6 6;  1P16 A;  4B3T Q;  4DUZ Q;  1UE1 A;  1LYL A;  3L2P A;  1I6H H;  1L1O B;  4C3H H;  5IYD G;  4A3L H;  1Q82 C;  1X55 A;  3S17 H;  2JA6 G;  2Y0S G;  3GTO H;  2I5H A;  5FJ8 H;  5LMN L;  4LF4 Q;  4GS3 A;  4UY8 C;  2R92 H;  3K7U C;  5EAY A;  3PUW A;  4P72 A;  2K5V A;  4HJ8 A;  1NMF A;  4DR3 L;  1XMO L;  1YI2 A;  2BA0 A;  4YWM A;  4OWW B;  4GOP A;  4LF4 L;  3HOZ G;  1TWA H;  1MKH A;  1HNW Q;  1X56 A;  1TWG H;  3BJU A;  2UUA Q;  1PV4 A;  2EQS A;  1M90 C;  2ES2 A;  1N36 Q;  4BY7 H;  2VQE L;  4JOI C;  4JG2 A;  1VQM A;  2B63 G;  2K52 A;  2MO0 A;  1YIJ A;  1IBM Q;  3STB D;  1OXS C;  4APV A;  2KHI A;  4WJ3 M;  4LF9 Q;  2R7F A;  4NXN Q;  4YY3 Q;  1NY4 A;  3J81 i;  2OQK A;  3CCM A;  3STB C;  4PMW A;  1EQQ A;  1N36 L;  3RZO H;  1VQJ A;  4KLK A;  2NVT H;  1E1O A;  1HNX Q;  4IO9 A;  3AQQ A;  1LUZ A;  1YHB A;  4AH6 A;  1Q81 C;  2HHH Q;  2UU9 L;  4A93 G;  2C35 B;  4R4Q A;  4YY3 L;  3OW2 A;  3D0F A;  4A3M G;  2VNU D;  1LTL A;  3HOY H;  1PH2 A;  3CC4 A;  1VQ8 A;  3PF4 A;  1XPU A;  1HR0 W;  1MJE A;  3CP0 A;  3RNU A;  1BBW A;  3CCJ A;  4P75 A;  1B8A A;  4L5T A;  4QGU A;  1KHI A;  4JBJ A;  5BR8 Q;  3M3Y H;  1N8R C;  2F4V L;  2E8G A;  3BZK A;  3HOU G;  1WI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...