3D0FA

Structure of the big_1156.2 domain of putative penicillin-binding protein mrca from nitrosomonas europaea atcc 19718
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
NAYRGPEAFLKLPKDLKDREALQDIMQDIGNSDDILAAVVLSATPGAVEAFRKNGETIRITGDGLKAAHRFLSNDPKIGEKRIRPGALIRVKKTEKGSWQIVQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the BIG_1156.2 domain of putative penicillin-binding protein MrcA from Nitrosomonas europaea ATCC 19718.
rcsb
source organism Nitrosomonas europaea atcc 19718
molecule tags Transferase
molecule keywords Penicillin-binding 1 transmembrane protein MrcA
total genus 14
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.4.2.-:
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3d0fA01
3S14H 3HKZE 1LYLA 1R9TH 5EAYA 1A8VA 1CSQA 1P8LA 4LUVA 1EFWA 4LF5Q 2UXDL 1HR0Q 3S24A 1WFQA 2OQKA 4KHZA 4GKJQ 1VQNA 2PI2E 1D7QA 1KD1C 3RZDH 1VQ6A 2I5LX 2UXDQ 3KF6B 4UP8A 4YHHL 4OO1G 1WI5A 3HOXH 1W3SA 2R6GA 2Z6KC 3UE1A 1IBKL 1VQ7A 5J3BA 4AYBE 3BZKA 2Q2UA 2BA1A 3E9HA 3GO5A 1X9NA 3HOVH 4DV7Q 4R4QA 1PVOA 1C9OA 3CPFA 3EIVA 4GLAC 4GN5A 2V1CC 5GROA 3A5UA 1KC8C 1I94L 2IX1A 1L0WA 3GTPH 3S17H 3HKSA 3S1QH 5ELOA 4JI8Q 2DGYA 4DUYL 2JA7H 3KFUA 3I4MH 4IPDA 3EBEA 3K7AH 2AHOB 1J5EQ 4LF8Q 3NENA 3I56A 1VQEA 4DV7L 3J81j 3HOXG 4LF6Q 2JA9A 3J81i 3DM3A 5LMNW 1Q46A 2IX0A 2R7FA 4X65L 1X3EA 4JBWA 1XJVA 4OO1I 1PYBA 3K8AA 4A3EH 1NMFA 2VQEL 1PH2A 1IBMQ 2MNAA 2D62A 4DV3Q 5IYDH 1XMOL 4YHHQ 1QVFA 2R7ZH 1VQMA 4TQUS 1RIPA 5M3FG 4RMFA 4GS3A 4L5TA 3TQYA 4DR3L 4JG2A 1VQ8A 1QUQB 2ATWA 1Q81C 1V9PA 5M5YH 1E24A 4LF5L 4LF8L 1VQ9A 4BXXG 1JJCB 3CCMA 2OQ0A 3GTMH 4JI1Q 3S2HH 1L1OB 4IJLA 3PIOA 4BBRG 2A19A 1X3GA 4BBSG 1Y1WH 5M3MH 4DR4Q 1GD7A 1W2BA 1GKHA 4DR1L 4JI3Q 2WP8J 1TWAH 1OXTA 4AQYQ 3PUYA 2QA4A 2OTJA 4Y7NH 4A3JG 1FJGL 3CP0A 3GTJH 2B63H 4DR4L 1M90C 3F2BA 2K5VA 2I5HA 4YY3L 5IY0A 1PFSA 3D31A 4JOIC 4JI1L 4YCWA 5IP7H 2HT1A 3S16H 4DR6L 4H02A 4P75A 4R4CA 4B3TQ 1SRUA 2KBNA 3J7ZC 4A76A 3K0XA 1AE2A 1KRTA 3WWVA 4A3MG 4LF4L 4IFDI 1I5FA 4GKJL 3CQZH 4C2MH 4UP9A 3ZJYC 3CCSA 4JYAL 1PH6A 5HY6A 2YYZA 1NMGA 3ER0A 3KDFA 2VL6A 4DAYB 1FGUA 4A3JH 4DR7Q 1SROA 1N36L 4DV3L 1IXRA 3W5OA 2VQEQ 3FP9A 3DLLA 2UXBQ 1N33L 3PF4A 4DR5L 1X56A 4O0AA 4X65Q 2RHSB 2NZHA 3L2PA 1U0LA 4NXNQ 1N32Q 1B70B 4MTNA 3FKIG 4APVA 1MJCA 1NTGA 1TWHH 2RCNA 2MO1A 1J5EL 4X66L 1JE5A 4ALPA 1UE6A 4RG1A 2F3IA 4JI5L 4DUYQ 1ASYA 2JA8H 2UXBL 1K83H 3L7ZC 4JBKA 2R93G 1G6PA 1I94Q 1OXXK 2IHFA 4JCVE 1HZAA 3HFZB 4JYAQ 2VUMH 1HNXL 4IOAA 2K52A 3PUWA 1YIJA 5H1SE 3OW2A 4FDBA 2H5XA 1XNRL 4BY7H 1NJIC 3NELA 5C3EG 4GLVB 1KIXA 2WFWA 3PO3H 4GN3B 4A3FH 1TWFH 4GNXA 1QZGA 4B3ML 5M5XH 1VQOA 1WJJA 3UDFA 1PH5A 3TEHB 5GAHC 5AJ3Q 5IWAQ 4R4OA 4X6AH 2UUAQ 2KENA 3RZOH 1XNRQ 1EQQA 1OTCA 4ME3A 2CCZA 2B29A 5IYCG 2Q2IA 1KHIA 3HOVG 2VUMG 1EQRA 4PG3A 4KLKA 2EQSA 4A3CG 2AWOA 4OWWB 1XTDA 4LFBQ 1IZ6A 3CCUA 2HIXA 3KOJA 1E7ZA 1PH3A 4EX5A 2UUCQ 3S1MH 2Z6KA 1VQAA 1MIUA 4XTCS 4AIMA 4LF7Q 4DV2L 1KL9A 1S3OA 1VQFA 1V1QA 1QZHA 1XNQL 4DV1Q 4DR3Q 4PMWA 1VQKA 4NXNL 4L5SA 2Y0SE 4HIDA 2K5HA 1N33Q 3BU2A 1HH2P 5IYCH 3M9BA 2CQOA 5C0XJ 4A3EG 1UE5A 4DPGA 1XPOA 1OXSC 1N36Q 3I4NH 2MO0A 3CF5A 4DUZQ 3ERSX 4L5RC 2NVXH 3K80C 2JA5H 1MKHA 2E2HH 4IOCA 3I2ZA 3F2CA 4JI0Q 3HKZG 1VQPA 1UEBA 1HR0W 2JE6I 2R7DA 3NBHB 1KRSA 5GAEC 3CCRA 4QJFA 3CW2C 1X65A 3U4VA 1SN8A 4YY3Q 4HJ8A 3M85A 2R92G 2VS1A 1L1OC 2FXQA 4POFA 1EWIA 4P73A 4LW1A 1PH9A 2YV5A 3UDXA 2EXDA 4NPSA 3PIPA 4AQYL 4LFCQ 4A75A 2E8GA 5IP9H 3CXCA 5C44G 4A3LG 3PUZA 4POGA 3GD7A 4YWLA 3OTOQ 5FJ8G 2D0PA 3T1HL 1YITA 3PO2H 2VY3A 4QY7A 3I4OA 5BR8L 1YBYA 2I0QA 3IRBA 1VQLA 1P16A 4BXXH 4DV4L 2NN6I 2XGTA 3HOYG 1X55A 5LMNL 2ZM6Q 1HJPA 2EIFA 4IPGA 2WB1E 3G6EA 4DV0L 1C7YA 4A3MH 3TS2A 2ALYB 2AMCB 1G51A 5FLMG 2BA0A 4GOPB 1N32L 4DV0Q 2A8VA 1UE7A 2ZM6L 4HJ9A 1Z9FA 5LMUQ 3UDGA 1HZ9A 4DK6C 1NBWA 4C3HH 4OX9L 2KCTA 1XMOQ 3ULPA 1EYGA 3AQQA 4BY1G 4KHPL 3RR5A 5DLQE 1YHAA 2DUDA 2ZJRA 3M7NA 4DV6L 1S40A 3PO2G 3M4QA 3U4ZA 3JAMc 1EIFA 1PHJA 4Y52H 2K75A 3H3VH 5JEAJ 4MNOA 4IJHA 4PZ7A 3H0GH 3RLOA 1PH7A 3W1GA 4DR2Q 2MQHA 1O7IA 3LGJA 1A63A 3H3VI 4A93H 5C4JH 1SR3A 1VQGA 2PQAB 1DGSA 3M4OH 4DR2L 1Y1VG 1E1OA 5IYBG 1G291 4A3KH 4BY1H 3GTGH 2ZJPA 3T1YQ 3CCQA 2N49A 1GM5A 1IBKQ 2CWPA 1QUQA 1TXYA 2A1AA 4O2DA 2PI2A 2RF4A 4TVAB 5C3EH 3FKIH 3GTLH 4A3IG 1UE1A 2N3SA 4KHPQ 4JBJA 2UXCL 1JB7A 4A93G 5IE8A 4A3DG 1B8AA 5GAGC 1BBUA 2JA8G 3JAMi 3CCEA 2R93H 4JI2Q 4OWTB 1Y1VH 3STBC 3D0FA 3STBD 3PV0A 2Z0SA 3KJPA 3RNUA 2BH2A 4LF9Q 5JJIA 2AKWB 3F2DA 2IT1A 2L15A 2PMZE 1N34L 2YTVA 3T1HQ 1QVGA 1EIYB 4NXMQ 2JA6H 4B3RQ 2JA7G 1IBLQ 1VQDA 3ULLA 4A3CH 3PUXA 4UY8C 4AYBG 1BBWA 2ES2A 1X6OA 4LFAL 2ZTEA 2VZAA 3CCVA 3CC2A 2JQOA 3CMAA 3SGIA 4GLXA 4JI2L 1JJGA 3MEFA 1HNWL 2HHHQ 4IFDJ 1JMCA 2VQFQ 2KHIA 1N8RC 3KDFB 1CKNA 4JV5L 1GO3E 4B3MQ 1Q12A 3K7UC 3TRZA 3HOZH 4X64L 3B6YA 3KYHC 2JA5G 1SFOH 1VQCA 2YTYA 1I6HH 3KF8B 1OXUA 1K8AC 1B7YB 4GNXB 2YU9H 1XMQQ 2OTLA 2I5MX 4YWMA 3G48A 4JI6L 2IHEA 1BKBA 3CC4A 3PUVA 2GN5A 1M1KC 4P74A 4BBRH 1N9WA 4DNIA 2E5LQ 3HOUH 2C35B 4X62Q 4DV5Q 3RN2A 3HOWH 3JC66 3I55A 3MXNB 2LSSA 3S15H 2XTIA 4P71A 4X62L 4DV5L 4HIKA 1K8GA 1I50H 1KAWA 1IBLL 5IT9c 1VQ4A 3A0JA 2UUCL 4DR5Q 2B63G 5C44H 2E2JH 4LWCA 3I4MG 2WAQG 1K3RA 3M4PA 3BZCA 2CFMA 1N34Q 4JBMA 1PH4A 2MFIA 2QGQA 4DR7L 1HNZL 5LMUL 2B3GA 3PSIA 4GN4B 1E22A 3NEMA 2VW9A 4GOPC 5C0XG 2KCMA 2JJQA 5AJ3L 4LF4Q 2RHQB 1I3QH 1D8LA 3F1ZA 5IYDG 4OXPA 1NE3A 1BVSA 1Q82C 1Q86C 4XIGS 4B3TL 2R7ZG 5IP9G 1VQ5A 4GKKQ 3A74A 5FJ8H 2VQFL 3PCOB 2NVQH 1CKNB 2GVBA 4WJ4A 2K5NA 3J80c 1SE8A 1PYSB 1FL0A 4JI3L 4A4IA 1PV4A 2Y0SG 4B3SQ 2Q2HA 3H0GG 4NXML 4BA2I 3A5ZB 1FVIA 3U58A 1Y1WG 4LUZA 4JI7L 4B3RL 1H95A 3CMEA 4X66Q 3CPWA 5C0XI 4IPHA 2JEBI 4DK3C 1C0AA 4IO9A 3RN5A 4JI0L 1VQBA 4UP7A 3G4SA 4DV6Q 1Y14B 3GTOH 2D0OA 3TREA 3E9IA 2UU9Q 3PO3G 3UDIA 4YCUA 1CSPA 2F52A 4A3FG 1KQSA 1CUKA 4GOPA 2UU9L 2OWOA 2ZTDA 1YNXA 4A3BH 4IPCA 4K0KL 3GTKH 2CWAA 4GNXC 3S1RH 1WOCA 3CAMA 3K81C 4JOIA 1XNQQ 4HJAA 3T1YL 1UWVA 5IYBH 2NVYH 1L2FA 4A3KG 4JI4L 4A3GH 3M3YH 4DV4Q 4DR6Q 2WB1G 3CCLA 2K50A 4JV5Q 3W1BA 2JA6G 1NY4A 3GTQH 5C4XG 1HNWQ 1A0IA 2LXKA 1LTLA 4JC0A 1AE3A 3F8TA 3CD6A 4OONA 2HIVA 4LUOA 3VDYA 3AFQA 2PQAA 3U50C 1GVPA 2Q2TA 4R1JA 2NVTH 3J81c 4HJ5A 4J15A 5JJLA 1XPRA 4AH6A 4A3GG 1YZ6A 3ULJA 4OX9Q 4GKKL 1A62A 3I4NG 1QVCA 3HOZG 4JI4Q 1KXLA 4WJ3M 4C3JH 3OYYA 4HIOA 4BY7G 1U5KA 3H15A 3G71A 2GVAA 2NZOA 4QIWE 1HNXQ 2VNUD 5GQOA 3KF6A 1YI2A 1HR0L 4K0KQ 4DUZL 1HNZQ 1E1TA 1YJ9A 2ID0A 5BR8Q 1JJ2A 3AEVA 5M5WH 1HZCA 1J6QA 1WCMG 1IBML 1PA6A 3OTOL 5K36G 3J7A5 4KI0A 3HOUG 4LFCL 1Q8KA 2K14A 4PZ6A 3AFPA 4LF6L 4LF7L 2N8NA 1YJWA 3S2DH 5GADC 4LFBL 2E5LL 1YHQA 1SLJA 1T9HA 4DKAC 3KJOA 1ASZA 4JI7Q 4DAMA 4A3DH 5FLXc 1EUJA 3UE0A 4B3SL 5HGQA 1YVCA 2BH8A 3TS0A 1XMQL 1VQIA 1WCMH 2JEAI 2F4VL 1Z47A 1Q7YC 1IL2A 3E0EA 3FHWA 2QEXA 1WYDA 2UUAL 3GDEA 5FLMH 3CCJA 1PH1A 2NN6G 1X3FA 1Q1EA 1E3PA 1YEZA 1YJNA 3HOWG 5M3FH 4HIMA 2AWNA 4QL5A 4LNQA 3J80i 1K9MC 2HHHL 4DV1L 3S1NH 5E7NA 2N78A 1CKMA 1LM0A 3EN2A 2JK8A 4DV2Q 5LMNQ 2UUBQ 1FJGQ 4PZ8A 4C3IH 5IP7G 4LFAQ 4UPAA 5JJKA 3KLWA 4QQBX 2HQLA 1VQHA 3L0OA 4MZ9A 4JI5Q 1LUZA 4BBSH 2R92H 5M3MG 3AYHB 3I7FA 3Q8DA 4LF9L 1HZBA 1TWGH 1V43A 4BA1I 1PH8A 1MJEA 3RLNA 2UUBL 2ASBA 4OWXB 2KHJA 4L5QA 4A3LH 1K0RA 1S72A 5IWAL 4IFDG 1VQJA 2YTXA 2ZJQA 2LXJA 1CKOA 2CKZB 1JT8A 2UXCQ 1EOVA 3RLFA 1X54A 3ICEA 3HOYH 4JI6Q 4HJ7A 4A3IH 3PF5A 3PGZA 2PNHA 4YCVA 1VCIA 1XPUA 4A3BG 4YWKA 1Q1BA 4NB3A 3CC7A 2WAQE 1K73C 2OCEA 1VS0A 1IYJB 2F4VQ 1RL2A 1OXVA 5ELNA 4X64Q 5JEAG 4QGUA 4R4TA 4P72A 1YHBA 4R4IA 4JI8L 2E2IH 1TWCH 3BJUA 2IY5B 1L1OA 5C4XH 1AH9A 2ZTCA 2K4KA 4EQ5A 1SMXA 4DR1Q
chains in the Genus database with same CATH superfamily
2DN8A 1CZGA 4U68A 1LYLA 3OW7A 1R9TH 1CSQA 1P8LA 2NBFA 4LF5Q 2OQKA 2J7ZA 1MSHA 2M00A 3KF8A 1C4QA 4DNTB 5CBAE 1D5MC 3RZDH 2I5LX 4UP8A 4YHHL 4OO1G 3P1HA 5CR3A 1WI5A 1W3SA 2R6GA 5E4WC 2XNAC 2Q2UA 1JE4A 5DNFA 3GO5A 1UNSA 1PVOA 4B08A 1C9OA 3EIVA 5C6AA 4GLAC 5GROA 3VYTA 1L0WA 3S1QH 2DNCA 2WIIB 2JA7B 1J5EQ 2AHOB 1LACA 1HPCA 4OO1H 3I56A 1SBBB 4CKBA 4LF6Q 3M3YB 2IX0A 4X65L 3K8AA 1I3QB 4DV3Q 3Q24A 4HTHA 5IYDH 2R7ZH 4TQUS 2JYOA 4JG2A 1V9PA 2NTSA 4FVMA 2RA4A 3SXHA 4LF8L 1EIHA 1L1OB 1K83B 2A19A 1X3GA 3AU7A 4KK7A 4K6DA 1TS4A 1EZ8A 1GKHA 2K01A 2WP8J 1KNAA 3BS1A 2QA4A 4CJ0B 3TP7A 4RH6A 3D31A 3BVMA 3P75A 4B3TQ 5G3LD 5D14A 1KRTA 4LF4L 3VR3A 4F7XA 1I5FA 3ZJYC 2A6HC 3FKIB 2PMZB 1NCVA 1R9TB 4KV6A 2VQEQ 3LWUA 1X56A 2B2WC 2NZHA 3IFTA 2L5TA 4MTNA 4QUCA 2D9UA 2XIWA 1GUTA 1JE5A 1ENCA 4DUYQ 1ASYA 1EY5A 1K83H 3HOWB 1G6PA 5EPLA 1J8IA 1OXXK 1B9MA 1HZAA 3HFZB 5C5MA 2K52A 1YIJA 3OW2A 1HXYD 1XX8A 2SOBA 5D3DA 3TZUA 4X3TA 1TKWB 1U4RA 1QZGA 2R7ZB 1O7ZA 3MFYA 3TEHB 4X6AH 5IWAQ 4R4OA 2ICEC 1EQQA 3BYTB 1U9RA 2B29A 2VUMG 1B3QA 5JOBA 2A6ED 3OMCA 1H9JA 4N8X1 2AWOA 1S5BD 3KOJA 4EX5A 1VQAA 4XTCS 4AIMA 1SJED 4F88A 1S3OA 4ZUJA 1QZHA 4DR3Q 4K2KA 4NXNL 3E6ZX 1SSOA 3DWPA 4JW0A 5M5YB 3HOWG 1UE5A 1N36Q 5M5WB 4DUZQ 4L5RC 5DM63 2JA5B 2E2HH 3CQZB 4C2MB 4JI0Q 3GTOB 1HR0W 4DK0A 4O1NA 1ML0D 1G91A 5DAUA 3M7GA 3DEPA 1L1OC 1H9SB 2JP1A 4POFA 4KKSA 1H9KA 4AQYL 2E8GA 3CXCA 1TR5A 2WV6D 4POGA 3VA7A 3OTOQ 5FJ8G 3PO2H 4QY7A 1YBYA 3IRBA 1P16A 1RD9D 4DV4L 3HOYG 3JAML 1Q8IA 3TS2A 1AZQA 2QCPX 2FJ2A 1WD1A 2ZM6L 1Z9FA 2EYOA 5FLXL 1EY7A 4QMGA 5LMUQ 4KHPL 1XMOQ 1EYGA 4BY1G 5DLQE 2DUDA 3PO2G 1DXMA 4KN4C 4EGVA 2L0CA 3H0GH 3RLOA 3C3LA 3KLRA 1A63A 2F0DA 2O4XA 4BBRB 1K0SA 1NR2A 2K04A 4DR2L 4ME5A 3T1YQ 1WTXA 1F9PA 2B2TA 1BXTA 2QDLA 3I72A 1A3UA 3OPOA 3GTLH 1UE1A 4DNRB 1K3BC 5IE8A 1QOHA 4A93G 3L9AX 5C5LA 3D0FA 5JVH3 2Z0SA 4LF9Q 2AKWB 2PZWA 3S14B 5C4JB 2YTVA 1Z7TA 1IBLQ 4AYBG 5C4XB 1I4PA 2K32A 4P2CB 3MEFA 1EIGA 3X3MA 1V1PB 1X32A 2KHIA 4CDEC 4E6IA 2N55A 2Q8IB 2XWJB 3KDFB 1TT2A 4FF2A 5DM73 1Q12A 2CW0D 2CVRA 3KYHC 2MP1A 2JA5G 1VQCA 2YTYA 3BVZA 1D6EC 4ZYSA 4RAUC 1OXUA 1K8AC 1F2LA 2OTLA 3G48A 4JI6L 4WJWA 5CMDA 2A74C 1SE2A 1M1KC 3G6JB 5KYIA 3HKZB 1KTKA 4X62Q 1CQFA 4RFBA 4P71A 3H91A 2UUCL 1KAWA 1ENFA 4DR5Q 2E2JH 3SK6A 4OIJA 4HSVA 1PH4A 2MFIA 2QGQA 3QG1A 2B3GA 3PSIA 1E22A 4CJ2C 1STBA 4GOPC 5C0XG 4ABNA 1XYIA 4DN4M 1CA5A 2E2HB 1I3QH 1PMRA 1CM9A 3F1ZA 5IYDG 1Q86C 1NE3A 2R7ZG 2F0JA 5BN4A 5FOBB 3A8JE 4K6LA 3PCOB 2EYFA 2NVQH 2GVBA 1WVLA 2K5NA 3CU7A 4XYQA 4RKLA 1SE8A 2F0TA 2B39A 4B3SQ 5C44B 4NXML 1Y1WG 4B3RL 4LUZA 2CH4W 1LTTD 3GTMB 3W2DA 1RJTA 3GTOH 1Y14B 1SE3A 3UDIA 4YCUA 2F52A 4UAIA 1KNEA 1YNXA 1CI3M 3GTKH 4C3JB 4GNXC 3S1RH 2IL8A 1XNQQ 2FMCA 3X3NA 2HDMA 1L2FA 2A5HA 4A3GH 2WB1G 2ZXOA 2K50A 2WAQB 2R92B 3W3AA 3AB9A 5C3XA 2LXKA 1LTLA 1QE6A 2HIVA 2CW0C 2EY1A 2KQ3A 2RSNA 4LAAA 3AFQA 3GTQB 2Q2TA 4KHVA 4AH6A 4GKKL 5KIXA 2AUJD 2DNEA 3HOZG 1KXLA 1LT6D 4C1NK 2F0LA 1L0YB 4HIOA 1U5KA 3H15A 2FFKB 3G71A 1HRJA 2NZ1D 4K0KQ 1E1TA 3VR2A 2MGSA 5M5WH 1J6QA 1IL8A 5T1GA 1PA6A 1F2MA 4LFCL 2K14A 4LF7L 1LLRD 3S2DH 3R2TA 3TBIB 2E5LL 4DAMA 5EKLA 3QOLA 1O7YA 3UE0A 5E4XA 1XMQL 5D65A 2JEAI 1Z47A 1IL2A 3E0EA 2EVBA 3NBHA 5FLMH 3MHBA 1PH1A 1B44D 4GZYC 4K5WA 4HIMA 2AWNA 4LNQA 2HHHL 5E7NA 4I7ZC 2NB0A 1FJGQ 2JK8A 2WINB 4PZ8A 5JJKA 1I50B 2QDBA 3KLWA 4MZ9A 4BBSH 2AQ1B 4Q0FA 1LUZA 1HZBA 4BA1I 1PH8A 3FEWX 5COYA 2UUBL 2ASBA 2XRSD 2KHJA 1WTQA 1VQJA 2YTXA 5G3LF 2LXJA 4NKLA 2BE5C 2PNHA 4DF7A 4BY7B 5BN3A 4YWKA 2HCCA 2N88A 1VS0A 1IYJB 1LTID 5ELNA 1S4ZA 1Q90A 4TRDA 1G6ZA 5NUCA 5JEAG 5CYUA 4QGUA 4R4TA 4JI8L 1VDZA 1TWCH 2IY5B 1L1OA 5C4XH 3Q23A 5C4HA 3DHQA 2EY6A 2KVMA 1STYA 3C1EA 3S14H 1FD7D 1IKLA 1A8VA 2UXDL 1HR0Q 3FPUB 5JEAH 5M3FB 1WFQA 4M8AA 3D6CA 5ELBA 4FF4A 1D7QA 1SMYC 3GTLB 3OHXC 3KF6B 5KYLA 3ND8A 3OWFA 5EJWA 1LTRD 1KDBA 5J3BA 3BZKA 4ZKBB 1X9NA 3A5UA 1KC8C 2IX1A 1TQOA 4DUYL 3I4MH 3EBEA 3J7AV 3NENA 5KGUA 3SVMA 1VQEA 1D5XC 4DV7L 1FR3A 1Q46A 1SNQA 3R8BA 2R7FA 1X3EA 1XJVA 4A3EH 1PH2A 1NMFA 1XXGA 2CH4A 2VQEL 2MNAA 2EJFC 1RTOA 1QILA 1RIPA 5M3FG 5IODA 4RGMA 4L5TA 3TQYA 1VQ8A 2ATWA 3NPPA 5M5YH 3NUCA 5J1ZA 4NP5A 1HUNA 2OQ0A 3GTMH 3T4AC 3NP8A 1S5FD 3PIOA 4XYOA 1HTLD 1GD7A 1W2BA 4JI3Q 3CHBD 4RKBA 2EJGC 3GTJH 2B63H 3PIO3 3F2BA 2I5HA 4YY3L 4I7AA 1I6VC 1UEAB 4P75A 1SRUA 2NWGA 3KLSA 1AE2A 4A3MG 4IFDI 3D8GA 2F0EA 2B2VC 4FF1A 3CCSA 5C3EB 3PO3B 1NMGA 3KDFA 4DR7Q 1FGUA 1TS5A 3HEJA 1GHKA 4DV3L 3DLLA 1Y8NB 4KN7C 2UXBQ 3PF4A 1A3VA 4O0AA 4X65Q 3ND9A 4G57A 2VXWA 3FKIG 1KDCA 1NTGA 3I73A 1EU4A 1L0XB 2DY7A 2RCNA 2MO1A 1J5EL 1UE6A 2F3IA 4JI5L 2IJ0A 3L7ZC 1HHVA 4JBKA 3OMGA 2IHFA 1BDOA 1F2ZA 1JB3A 4JYAQ 2VUMH 4C3JG 2BDNA 1HNXL 4BY7H 3S1NB 2H5XA 1NJIC 2A6EC 3NELA 2RDFA 4PMCA 1GUGA 4B3ML 5M5XH 1PH5A 1KDAA 4J8QA 2KENA 2KCNA 2KJXA 2Q2IA 1KHIA 1NSNS 3P20A 1EQRA 4RCNA 4PG3A 1PTOC 4KLKA 1ZYRC 3EJIA 3RUZA 1E2WA 4K8JA 5IIFA 4OWWB 4LFBQ 2UUCQ 1E7ZA 1KABA 1DOMA 1KL9A 2E2DC 4O42A 1VQFA 4K5VA 4HEDA 1STNA 4PMWA 1VQKA 4PQXA 4DGZA 3QIAA 4CKEA 2CQOA 5C0XJ 1QB5D 5BN5A 1OXSC 1CFMA 1I4QA 4S3SA 1Y8PB 3SEBA 1G2TA 1EY0A 3K80C 1TS2A 1MKHA 4DFAA 3I2ZA 1VQPA 1UEBA 3I70A 1HUMA 5IGEA 4MHEA 1QWYA 1X65A 4M1UB 1EFID 3BDLA 4YY3Q 2FHTA 3M85A 2VS1A 5JJZA 1K8OA 4BWGB 4CHTB 2YV5A 5DEHA 2F0SA 4LFCQ 5C44G 4A3LG 4YWLA 2F3VA 2D0PA 1YITA 2VY3A 2R93B 5TSSA 1VQLA 4WFN3 1X55A 1HJPA 4DV0L 1G51A 2BA0A 4DV0Q 3ZYYX 4WORA 1HZ9A 4FNFA 1NBWA 2Y0SB 2BCOA 3AQQA 1K28A 3ULPA 1BCPD 1FNWA 3RR5A 5I2YA 2PO4A 4R9WA 3M7NA 1C48A 3M4QA 4XQJA 3JAMc 2K75A 3H3VH 3OWEB 2RBMA 1GUOA 2B8FA 1QNUA 2MQHA 4DR2Q 1SYCA 1TY2A 3S1QB 3H3VI 4A93H 5J39A 2PQAB 1GXDC 3D4WA 1MSGA 2KHSA 4A3KH 5IGGA 3RMHA 1GM5A 3K5OA 1QUQA 1TXYA 4FXGC 2PI2A 4OHJA 3Q22A 2RF4A 4TVAB 5C3EH 2F0QA 4KHPQ 3HOZB 4JBJA 2EYLA 5A2QE 1BBUA 3D4RA 3ERQA 4QB4A 3JAMi 1YNJC 2VB2X 5D3IB 3STBD 5JJIA 2RCFA 3NTHA 2JA6H 3M4OB 2F0VA 1N34L 1EIYB 1VF5C 4NXMQ 4B3RQ 3IKJA 1DONA 1NUCA 5A35A 2JA7G 4PMBA 4A3CH 1SYFA 4I65A 4LFAL 3HGBA 5CBEE 1T5EA 3CCVA 3CC2A 3SGIA 4JI2L 1RCVD 1N8RC 4R8NA 4B3MQ 3TRZA 1RF2D 4XQQA 2E74C 1I6HB 3QWNA 2YU9H 4A3EB 4YWMA 4CKCA 1SEBD 3CC4A 3PUVA 3GTJB 5CORA 2IX3A 4DNIA 5I6WA 3HOWH 1ET6A 3RN2A 3K58A 3JC66 3I55A 1EY6A 1I4RA 2XTIA 4X62L 3V05A 3IFDA 1VQ4A 3NK9A 3I4MG 1N34Q 3M4PA 2CFMA 2EYJA 2E2IB 3QB3A 4DR7L 1JICA 5E3FA 4XQNA 4A3JB 1DYQA 5EBDA 3T51B 2HQEA 2VW9A 5I9PA 2LS01 4HCEA 2RHQB 1D8LA 3U9SA 2X69A 1VQ5A 1E0BA 2TSSA 5FJ8H 1GJXA 4L6TB 2WKDA 3J80c 4DK1A 4JI3L 1SJHD 2E2JB 3KLSX 2A69C 2Z8LA 1H9MA 4K5XA 1LTBD 4IPHA 3VYSA 3RD4A 1AZPA 4IO9A 4UP7A 3G4SA 3J81L 1HQRD 2F4IA 2UU9Q 3IAYA 4ZQ3A 3PO3G 1WTRA 1CSPA 4A3FG 2UU9L 2OWOA 1CUKA 4K0KL 3V2TA 2ZTDA 4IPCA 2CWAA 2X6LA 3CAMA 3K81C 3T1YL 4A3KG 3MC0B 3M3YH 1WCMB 2RQXA 3HZXA 3W1BA 4Q5VA 1NY4A 1W6JA 2VB3X 4H7BA 1A0IA 4JC0A 1BUVT 3CD6A 4OONA 3R93A 4LUOA 2PQAA 4R1JA 4HJ5A 1DOLA 2NVYB 5KEEA 3ULJA 1A62A 1K8MA 1DCZA 3MA2B 3I4NG 2E76C 4BY7G 3IL8A 2NZOA 3KF6A 1YI2A 3J81E 1HR0L 1SDFA 1HZCA 2K7VA 3OTOL 1EU3A 1D1IA 3BDOA 4KI0A 1EY4A 4XT3B 4LF6L 3AFPA 1TWHB 1YJWA 5K5PA 4LFBL 1T9HA 4G7OC 4B3SL 2BH8A 5CV7A 1V1OA 1A2TA 1EEID 3HOXB 3DXJC 1PYWD 1B2TA 1Q7YC 1II3A 2L1BA 3GDEA 5IT9L 2NN6G 3H94A 1JWUD 1Q1EA 5HGTA 2K5QA 1YJNA 2KCCA 2MHVA 1SXTA 1IYUA 2N78A 1CKMA 1A6XA 1LM0A 3EN2A 2UUBQ 5LMNQ 4MIUA 2WACA 4LFAQ 4K8IA 3BG3A 1LO5D 4JI5Q 3NWTA 2M9VA 1MJEA 4H44C 4TKOB 3Q6SA 1AEXA 4OWXB 4L5QA 5IGFA 1S72A 5IWAL 3PQIA 2ZJQA 1JT8A 4C1NI 3T16A 1EOVA 1X54A 3EQLC 3HOYH 2QEJC 5EGTA 4JI6Q 4HJ7A 4A3IH 1SYBA 3R2IA 1X3PA 1K73C 3A55A 3U9OA 2OCEA 3K57A 1ZXTA 3SDZA 5FO7B 1ONLA 4R4IA 3BJUA 2A73B 3KBGA 2ZTCA 4EQ5A 1SMXA 2PNRC 2Z1CA 5EKIA 3MXNA 1VMCA 3WOFA 2JA6B 5HURA 4QUFA 1Y1VB 1EFWA 4LUVA 1JORA 3KBXA 1EL0A 2L55A 3S24A 3SK8A 4A3BB 3D3RA 2KEEA 2RDGA 1WD0A 2PI2E 1VQNA 1T5XD 1ESFA 3HOXH 4DA2A 3TZDA 5EPKA 1U4LA 4RCOA 3NQTA 3A54A 2BA1A 3E9HA 3HOVH 4DV7Q 5ELCA 3CPFA 2V1CC 3S17H 3HKSA 5ELOA 3QO2A 1RHPA 3C1FA 2H4OA 3KFUA 4LF8Q 3HOUB 3J81j 3HOXG 5FK9C 3DM3A 3AMUA 3GQBA 5LMNW 4JBWA 1PYBA 4RGNA 4NDXA 1IBMQ 2D62A 1XMOL 1QVFA 1TWFB 1VQMA 5FLXE 3EVQA 3S9WA 4N9TA 1BCPF 3MWYW 1JOKA 1QUQB 5E1FA 1Q81C 1HQMC 4CDFC 2F3WA 4BXXG 3K6OA 3S2HH 2B2YC 4BBSB 1B53A 1CT1D 5M3MH 4DR4Q 1OXTA 4AQYQ 3HOVB 2OTJA 4Y7NH 5ISRA 4A3JG 3H3VC 3CP0A 2K5VA 1B50A 2L12A 1EZ6A 1PRTF 5IY0A 4JOIC 4JI1L 4YCWA 4DR6L 2CQAA 2NYZD 4R4CA 2QILA 3J7ZC 4A76A 3K0XA 2KUMA 3HS0C 4KY5A 3WWVA 1IW7C 4LMQD 4JYAL 5CV9A 4A3JH 1N36L 1IXRA 3W5OA 2B2UA 2ICIA 4DR5L 1SNDA 4NXNQ 5KRUA 3S1MB 5CV5A 5CC4A 2FMMA 4X66L 2EXZA 4DXGA 4RG1A 2UXBL 5ELFA 4NW2A 2JA8H 2R93G 2LMCB 1I94Q 3H09A 5IGBA 1SAPA 1PZKD 1EWHA 4JCVE 1ENAA 3T13A 4KD3A 3PUWA 4IOAA 2O2LD 3JAME 4CBVA 1JOOA 3PO3H 4GN3B 3MXUA 3NSWA 1TWFH 2A69D 1B4OA 3UDFA 1Y8OB 5IYCG 2X6GA 2I07B 2B63B 1HA5A 2EQSA 2BOSA 1G2SA 1PTOH 1XTDA 3CCUA 1I4HA 2HIXA 1PH3A 2Z6KA 4LF7Q 4DV2L 1LT4D 4DV1Q 1MD2D 1HFNA 4L5SA 3S1RB 1HH2P 5IYCH 4DPGA 3I4NH 1ICWA 2MO0A 2NVXH 2JA5H 4IOCA 2XVSA 3HKZG 2JE6I 2R7DA 3NBHB 1KRSA 1OO9B 2AQ2B 5GAEC 3CCRA 3CW2C 4BY1B 3TSSA 4F8MA 5CV6A 1PXUA 1SN8A 2Z4IA 1TS3A 1W6KA 1DJRD 2R92G 2FXQA 1EWIA 1F2YA 2O5IC 2F0OA 1XTCD 3O13A 4NPSA 1EOTA 2R3ZA 3A56A 2WB1B 2HDLA 3PUZA 2EOTA 1MI2A 5BR8L 1QJOA 3TP5A 4BXXH 5KNDA 4KD4A 2ZM6Q 4IPGA 2EIFA 1C7YA 1EY8A 3BZDB 3NE5B 4HSPA 4A3MH 2ALYB 3DWQA 3J80E 5FLMG 2A8VA 2NN6H 1UE7A 5FO9B 1AFPA 3UDGA 4DK6C 4OX9L 2XRQD 2F03A 2ZJRA 1CTMA 4PNYA 1S40A 4RWSC 4Y52H 3HG9A 5JEAJ 1SNOA 1PH7A 3W1GA 1O7IA 3LGJA 1CK1A 1SR3A 5C4JH 5M3MB 1ESRA 2K5WA 2L4NA 2D5DA 1E1OA 5IYBG 1G291 3GTGH 2ZJPA 1CZWA 3CCQA 2N49A 4QF4A 4DXFA 3FKIH 1XWEA 2N3SA 3N6RA 1U4PA 1BR9A 2K03A 1TIID 2R93H 4JI2Q 4OWTB 3STBC 5AFWA 2SDFA 3CKIB 5F2DA 1YNJD 3TDQA 4EVOA 2BH2A 3RNUA 4WJ3M 3F2DA 2L15A 2EPBA 3T1HQ 1QVGA 4OL7A 2IPKD 4MTKA 1BBWA 1CHQD 1X6OA 2ES2A 2ZTEA 2VZAA 1WTPA 3GV3A 3CMAA 4GLXA 3S2HB 2I46A 3LNNA 2HHHQ 1HNWL 2FINB 2VQFQ 1EYAA 4DAYA 1CKNA 4JV5L 1GO3E 4HMIA 3B6YA 4A3FB 4ZAIA 1SFOH 3EROA 3KF8B 1B7YB 4EQNA 4CDDC 2RKSA 3VR5A 1XMQQ 4ZK9B 2IHEA 1BKBA 2K6AA 2G9DA 3J7AF 3BVGA 3K0YA 2GN5A 1LTGD 1JWSD 4BBRH 2E5LQ 3HOUH 2C35B 2F0UA 4DV5Q 4IUVA 1I4GA 1TWGB 2LSSA 1MBYA 3MFGA 5I4DA 5CV4A 1K8GA 4A3DG 1I50H 2K28A 1IBLL 3SE0A 1K3RA 3BZCA 4JBMA 1EQVA 4RGOS 4C3IG 4GN4B 3K5NA 4ZUIA 2JJQA 3T53B 5AJ3L 4LF4Q 4EQOA 1EQTA 1X3QA 2F0FA 4GKKQ 4B3TL 2VUMB 4DAVA 1B1ZA 2RSOA 3PO2B 1CKNB 4IFDH 2F0NA 4K14A 3QR8A 1O7LA 3H0GG 3NTIA 2C5CA 3R3OA 3A5ZB 3VR4A 5C4ZA 1ZKOA 3G7LA 1I4XA 1HTPA 5IOCA 4IUUA 1IHZA 1DOKA 1PRTB 1CA6A 1RODA 3TREA 3E9IA 1FGBD 4QCLA 3C2PA 4F87A 1J9OA 3K59A 1PZJD 4A3BH 3NTKA 2Q8TA 1D2BA 4JOIA 4HJAA 4XXEA 1UWVA 5IYBH 1F9SA 2RDHA 4DV4Q 1JOQA 1DD2A 2J0TD 2EYPA 3FMCA 4JV5Q 3MEHA 4A93B 1PTOB 4N8FA 2ZXRA 3GTQH 1STEA 1D5ZC 1Y1WB 2B2YA 4AYBB 5C4XG 1HNWQ 1S5ED 1BBXC 1AE3A 1GHJA 1BQQT 3A8KE 4ULLA 3U50C 1GVPA 3TMEA 1MGSA 4J15A 1S5CD 3E5SA 1YZ6A 4A3GB 1QVCA 4JI4Q 4C3JH 1F9QA 4IUTA 2KECA 4K2LA 1HNXQ 5GQOA 4KJNA 1HCZA 1ILQA 2NUCA 4DUZL 3LX0A 2PYKA 1YJ9A 1TY0A 4IALA 1JJ2A 3QJYA 3AEVA 3I4NB 2H1EA 1JC7A 3T56B 4HMJA 3L3OC 4G4KA 3J7A5 1Q8KA 4X3KA 4PZ6A 3DM1A 2OEOA 1YNNC 4R8IA 1IW7D 4RGTA 1SLJA 4JI7Q 3KJOA 2MUYA 1WTOA 1H9SA 1AP0A 2Z6BA 3BYYB 5FLXc 1EUJA 1YVCA 5ELDA 5EBCA 1WCMH 3A7AB 1M8AA 2AQ3B 3FHWA 4HCSA 1AN8A 5IT9E 4LK1C 1KLGD 1RDPD 1E3PA 2HD3A 1LT3D 1PFBA 2K33A 4IQZA 4C3HG 5M3FH 1ET9A 4QL5A 2A68C 2EYHA 3J80i 1CHPD 2EY2A 4C56C 4UDUC 3VR6A 5CV8A 5IP7G 4Y7NB 4ZLTF 5JPMC 2V4DA 1LV9A 4QQBX 4IUNA 3AYHB 4LF9L 3Q8DA 3K5LA 1TWGH 3LWEA 3RLNA 1LT5D 4A3LH 1K0RA 3TP8A 3DMUA 1CKOA 2CKZB 1KAAA 4FF3A 3ICEA 3PF5A 1SNPA 4YCVA 1XPUA 4H0LC 3E3XA 4NB3A 3OIQA 1M4VA 1PFMA 1V8QA 2WAQE 3CC7A 1EWCA 2F4VQ 2L9HA 1FNUA 1RL2A 1JR0D 4X64Q 2LKVA 4FYDA 1ZEQX 1DM0B 3MZ5A 3A7LA 4P72A 1YHBA 4FXDA 2E2IH 4CJ1B 3S2DB 3WOEA 2K4KA 2EZVA 1GUWA 1EEFD 2JN4A 1JCKB 2TMPA 2BE5D 3DEOA 3HKZE 2F0PA 5EAYA 3KUPA 1VF7A 2JXMB 1Q3LA 2B2VA 4KHZA 2G9HD 4DU9A 1WTVA 2PZTA 2YU9B 4GKJQ 1KD1C 4OEMB 1JWMD 4G7ZC 1VQ6A 2UXDQ 3MVVA 1RKNA 2K1BA 1LTAD 2F0HA 2Z6KC 3UE1A 3E0JA 1IBKL 4AYBE 1VQ7A 4PV1C 4R4QA 4GN5A 1I94L 3GTPH 4JI8Q 2DGYA 4G7HC 2JA7H 3K5MA 4IPDA 3K7AH 2L11A 2JA9A 3J81i 2B2WA 3J7YW 1PFNA 4U673 4OO1I 4FP5D 2K05A 1ZYRD 2EDGA 4YHHQ 4A3IB 1SNCA 4A3MB 4RMFA 4WRDA 4GS3A 4ZCKA 4DR3L 4XDXA 1SYDA 2RVLA 1E24A 4LF5L 2HCIA 1VQ9A 1JJCB 3CCMA 2OF1A 5ELEA 4JI1Q 4V190 4IJLA 4BBRG 1SMYD 4BBSG 1Y1WH 4Z9CB 2AUKA 3NQIA 4DR1L 1TWAH 3PUYA 4C3IB 1FJGL 2XWBB 4DR4L 1GUSA 1M90C 2G5DA 3CRLC 2NVQB 3DWAA 1PFSA 2HT1A 3S16H 5IP7H 4H02A 4B9WA 4MN3A 1PLFA 3WDNA 2KBNA 2F0KA 1F9RA 4GKJL 2OXPA 2NVXB 3CQZH 4C2MH 2IWHA 4UP9A 4TSSA 5A2QL 2QW7A 1PH6A 5HY6A 2YYZA 4DAYB 3ER0A 2VL6A 4KTAA 2EYMA 1HA6A 1SROA 3FP9A 1BNZA 1N33L 2RHSB 3L2PA 1U0LA 1O80A 1N32Q 2PW5A 2O5JC 1B70B 4APVA 1C8CA 1MJCA 1TWHH 2D2CC 4ALPA 3TN2A 4OIKA 4L8JA 1ILPA 4KJOA 4IURA 2F1MA 1EYDA 5M9OA 1XNRL 5H1SE 4FDBA 3MAQA 5C3EG 1A2UA 4GLVB 2WFWA 1KIXA 3HRZC 4A3FH 4GNXA 5FO8B 2LY7A 1VQOA 1WJJA 3FRPB 5GAHC 5AJ3Q 2UUAQ 2DJGC 3RZOH 1XNRQ 1OTCA 4ME3A 2CCZA 3M4YA 3HOVG 4QIWB 2A68D 1QG7A 1H9RA 3N52A 4A3CG 1A3TA 1IZ6A 3D6WA 3S1MH 3FDTA 1MIUA 1V1QA 1XNQL 1PRTD 1D1KA 2Y0SE 4HIDA 2K5HA 1N33Q 1BF4A 3BU2A 1XPOA 1VMPA 3M9BA 3RZOB 4A3EG 1SE4A 2B8GA 3CF5A 3ERSX 2ENBA 1YNND 3F2CA 2K5DA 1UUPA 3SK5A 5I9OA 1GUNA 4QJFA 3U4VA 1Z6HA 4HJ8A 2XSCA 4KKUA 1STHA 3EA6A 4P73A 4LW1A 1PH9A 3UDXA 2EXDA 4RHSA 3PIPA 4A75A 5IP9H 3H0GB 3GD7A 3SK4A 3T1HL 4J1MA 4KMUC 3I4OA 2I0QA 1QNKA 2NN6I 2XGTA 5LMNL 3G6EA 5M5XB 2WB1E 2PCFB 4FO2A 3I8ZA 2AMCB 4GOPB 5CGKA 3J80L 5EKKA 3V96A 4HJ9A 3URYA 4C3HH 2KCTA 4IUQA 3Q0AA 4X3SA 1FNVA 3A8IE 1YHAA 3PMFA 1NR4A 1R4QB 4DV6L 2KEDA 3U4ZA 1PHJA 1EIFA 2PQEA 2Z9HA 5EPJA 5IGCA 4MNOA 4IJHA 2Z4HA 4ILWA 4PZ7A 4N9PA 3S15B 5KNBA 3M4OH 1VQGA 1DGSA 3NHHA 2EY5A 1Y1VG 3I91A 4BY1H 4BS9A 3UI2A 1IBKQ 2CWPA 3GTKB 2Q8RE 2A1AA 4O2DA 3MXGA 3H6MA 5LL6S 4IN3A 2F0WA 1NNXA 1SYGA 4A3IG 3RZDB 5C3WA 5FKAC 2UXCL 1JB7A 2E75C 3D4DA 1B8AA 5GAGC 2JSOA 5IGDA 2JA8G 3CCEA 2GA4B 2EE1A 1SNMA 1Y1VH 4JVZA 4A3KB 4V0BA 4X3UA 3SHLA 2QF7A 3PV0A 3KJPA 2IT1A 2PMZE 1BCPC 2NTTA 1VQDA 3ULLA 4HAEA 3PUXA 4UY8C 1EY9A 2KOLA 2JQOA 3FVQA 4OELB 1JJGA 4IFDJ 5LHY1 1JMCA 1G8ZD 3K7UC 3HOZH 3KK7A 4X64L 3OIPA 4CGYB 1Y69U 4H13C 4KKTA 1I6HH 1V1PA 4GNXB 5I2XA 3S16B 4XT1B 2I5MX 1AW7A 1UAPA 3I90A 3QOJA 3MXPA 1S5DD 4IUPA 1BCPB 4P74A 3VYUA 2JA8B 1N9WA 1STGA 3MXNB 3S15H 4J6HA 4A3DB 4DV5L 4HIKA 2KA7A 5JPNC 3GTPB 2B63G 5IT9c 1N32L 3A0JA 5C44H 4LWCA 1TU2B 2WAQG 2CHBD 3C46A 1HNZL 5LMUL 1DZ1A 2OT2A 3NEMA 1QCBD 2KCMA 3OSOA 3TP6A 4OXPA 1Q82C 1BVSA 2R61A 2EJMA 4XIGS 5IP9G 1CQVA 1NAPA 1R4PB 3A74A 1PZID 1PDQA 2VQFL 1RTNA 4FXKC 4WJ4A 4JK1C 2MPMA 2HUGA 3PIP3 3K7AB 2J4XA 1PYSB 3DUZA 1WTHA 1FL0A 4A4IA 1PV4A 1IKMA 2Y0SG 4HR7B 2Q2HA 2NVTB 5C0XH 4BA2I 1JQYD 1FVIA 2DJFC 3U58A 4JI7L 1H95A 1TWCB 3CMEA 4X66Q 3CPWA 1SYEA 5C0XI 2B2UC 3NXWA 5J22A 2JEBI 2F0GA 4DK3C 3I3CA 2IW3A 1C0AA 3RN5A 4KY7A 4JI0L 1VQBA 4DV6Q 2D0OA 1EYCA 3I4LA 3ITPA 4C3HB 1KQSA 5I6YA 4GOPA 5T1IA 1STAA 3HP3A 2B2TC 1WOCA 4NMZA 2M2LA 1PTOF 3VA5A 3SR1A 2NVYH 2LFNA 4JI4L 5LL6X 2ZT9C 1B3AA 4DR6Q 1BOSA 2XN9C 3CCLA 2JA6G 4L63B 1HFGA 1TVXA 3F8TA 1U4MA 3VDYA 3S17B 5JVG3 2NVTH 3J81c 5JJLA 4ZKCB 1XPRA 5K36H 1O78A 4A3GG 4OX9Q 4CDCC 3GP7A 3OYYA 2GVAA 2VNUD 4QIWE 1SFOB 4KY6A 4RA8A 1HNZQ 2ID0A 5BR8Q 3FPPA 5KNCA 1WCMG 1IBML 2F0MA 4LJZC 5K36G 3HOUG 3GTGB 3NBIA 2N8NA 2A6HD 5GADC 1IYVA 4JPBW 1YHQA 1ASZA 4DKAC 4ODGA 4A3DH 2PPBC 1ICFB 1PRTC 5HGQA 3TS0A 1VQIA 2F4VL 2QEXA 2MJ8A 1WYDA 2UUAL 1B9NA 1KLUD 2BDOA 3EFXD 3CCJA 1X3FA 1YEZA 1WTWA 2QKIC 3HOYB 1PTOD 3F2UA 3VYRA 1K9MC 5EQ0A 4B9XA 4DV1L 3S1NH 2ZXPA 4DV2Q 4C3IH 4DAPA 1LABA 4RHRA 2SEBD 4UPAA 2SNSA 3ONAB 2HQLA 1VQHA 3L0OA 4IZ8A 1FYCA 2R92H 5M3MG 3CRKC 3I7FA 4HN7A 1V43A 3P7JA 1MHWC 3MTSA 1E2ZA 2PW7A 2P5ZX 4YIJA 4IFDG 2UXCQ 3RLFA 1E2VA 5JAVA 3PGZA 3BDCA 4EQPA 1VCIA 4A3BG 3GV6A 1Q1BA 3OOCA 1GOZA 2C9OA 2WKCA 1OXVA 1LTSD 1BO0A 2F0IA 3NWSA 4OGQC 3I4MB 2SNMA 4UHVA 4ID6A 1A15A 1AH9A 1F77A 4DR1Q 1TWAB 4ZRZA 2PZUA 2DY8A 5L37A
chains in the Genus database with same CATH topology
3S14H 3HKZE 1LYLA 1R9TH 5EAYA 1A8VA 1CSQA 1P8LA 4LUVA 1EFWA 4LF5Q 2UXDL 1HR0Q 3S24A 1WFQA 2OQKA 4KHZA 4GKJQ 1VQNA 2PI2E 1D7QA 1KD1C 3RZDH 1VQ6A 2I5LX 2UXDQ 3KF6B 4UP8A 4YHHL 4OO1G 1WI5A 3HOXH 1W3SA 2R6GA 2Z6KC 3UE1A 1IBKL 1VQ7A 5J3BA 4AYBE 3BZKA 2Q2UA 2BA1A 3E9HA 3GO5A 1X9NA 3HOVH 4DV7Q 4R4QA 1PVOA 1C9OA 3CPFA 3EIVA 4GLAC 4GN5A 2V1CC 5GROA 3A5UA 1KC8C 1I94L 2IX1A 1L0WA 3GTPH 3S17H 3HKSA 3S1QH 5ELOA 4JI8Q 2DGYA 4DUYL 2JA7H 3KFUA 3I4MH 4IPDA 3EBEA 3K7AH 2AHOB 1J5EQ 4LF8Q 3NENA 3I56A 1VQEA 4DV7L 3J81j 3HOXG 4LF6Q 2JA9A 3J81i 3DM3A 5LMNW 1Q46A 2IX0A 2R7FA 4X65L 1X3EA 4JBWA 1XJVA 4OO1I 1PYBA 3K8AA 4A3EH 1NMFA 2VQEL 1PH2A 1IBMQ 2MNAA 2D62A 4DV3Q 5IYDH 1XMOL 4YHHQ 1QVFA 2R7ZH 1VQMA 4TQUS 1RIPA 5M3FG 4RMFA 4GS3A 4L5TA 3TQYA 4DR3L 4JG2A 1VQ8A 1QUQB 2ATWA 1Q81C 1V9PA 5M5YH 1E24A 4LF5L 4LF8L 1VQ9A 4BXXG 1JJCB 3CCMA 2OQ0A 3GTMH 4JI1Q 3S2HH 1L1OB 4IJLA 3PIOA 4BBRG 2A19A 1X3GA 4BBSG 1Y1WH 5M3MH 4DR4Q 1GD7A 1W2BA 1GKHA 4DR1L 4JI3Q 2WP8J 1TWAH 1OXTA 4AQYQ 3PUYA 2QA4A 2OTJA 4Y7NH 4A3JG 1FJGL 3CP0A 3GTJH 2B63H 4DR4L 1M90C 3F2BA 2K5VA 2I5HA 4YY3L 5IY0A 1PFSA 3D31A 4JOIC 4JI1L 4YCWA 5IP7H 2HT1A 3S16H 4DR6L 4H02A 4P75A 4R4CA 4B3TQ 1SRUA 2KBNA 3J7ZC 4A76A 3K0XA 1AE2A 1KRTA 3WWVA 4A3MG 4LF4L 4IFDI 1I5FA 4GKJL 3CQZH 4C2MH 4UP9A 3ZJYC 3CCSA 4JYAL 1PH6A 5HY6A 2YYZA 1NMGA 3ER0A 3KDFA 2VL6A 4DAYB 1FGUA 4A3JH 4DR7Q 1SROA 1N36L 4DV3L 1IXRA 3W5OA 2VQEQ 3FP9A 3DLLA 2UXBQ 1N33L 3PF4A 4DR5L 1X56A 4O0AA 4X65Q 2RHSB 2NZHA 3L2PA 1U0LA 4NXNQ 1N32Q 1B70B 4MTNA 3FKIG 4APVA 1MJCA 1NTGA 1TWHH 2RCNA 2MO1A 1J5EL 4X66L 1JE5A 4ALPA 1UE6A 4RG1A 2F3IA 4JI5L 4DUYQ 1ASYA 2JA8H 2UXBL 1K83H 3L7ZC 4JBKA 2R93G 1G6PA 1I94Q 1OXXK 2IHFA 4JCVE 1HZAA 3HFZB 4JYAQ 2VUMH 1HNXL 4IOAA 2K52A 3PUWA 1YIJA 5H1SE 3OW2A 4FDBA 2H5XA 1XNRL 4BY7H 1NJIC 3NELA 5C3EG 4GLVB 1KIXA 2WFWA 3PO3H 4GN3B 4A3FH 1TWFH 4GNXA 1QZGA 4B3ML 5M5XH 1VQOA 1WJJA 3UDFA 1PH5A 3TEHB 5GAHC 5AJ3Q 5IWAQ 4R4OA 4X6AH 2UUAQ 2KENA 3RZOH 1XNRQ 1EQQA 1OTCA 4ME3A 2CCZA 2B29A 5IYCG 2Q2IA 1KHIA 3HOVG 2VUMG 1EQRA 4PG3A 4KLKA 2EQSA 4A3CG 2AWOA 4OWWB 1XTDA 4LFBQ 1IZ6A 3CCUA 2HIXA 3KOJA 1E7ZA 1PH3A 4EX5A 2UUCQ 3S1MH 2Z6KA 1VQAA 1MIUA 4XTCS 4AIMA 4LF7Q 4DV2L 1KL9A 1S3OA 1VQFA 1V1QA 1QZHA 1XNQL 4DV1Q 4DR3Q 4PMWA 1VQKA 4NXNL 4L5SA 2Y0SE 4HIDA 2K5HA 1N33Q 3BU2A 1HH2P 5IYCH 3M9BA 2CQOA 5C0XJ 4A3EG 1UE5A 4DPGA 1XPOA 1OXSC 1N36Q 3I4NH 2MO0A 3CF5A 4DUZQ 3ERSX 4L5RC 2NVXH 3K80C 2JA5H 1MKHA 2E2HH 4IOCA 3I2ZA 3F2CA 4JI0Q 3HKZG 1VQPA 1UEBA 1HR0W 2JE6I 2R7DA 3NBHB 1KRSA 5GAEC 3CCRA 4QJFA 3CW2C 1X65A 3U4VA 1SN8A 4YY3Q 4HJ8A 3M85A 2R92G 2VS1A 1L1OC 2FXQA 4POFA 1EWIA 4P73A 4LW1A 1PH9A 2YV5A 3UDXA 2EXDA 4NPSA 3PIPA 4AQYL 4LFCQ 4A75A 2E8GA 5IP9H 3CXCA 5C44G 4A3LG 3PUZA 4POGA 3GD7A 4YWLA 3OTOQ 5FJ8G 2D0PA 3T1HL 1YITA 3PO2H 2VY3A 4QY7A 3I4OA 5BR8L 1YBYA 2I0QA 3IRBA 1VQLA 1P16A 4BXXH 4DV4L 2NN6I 2XGTA 3HOYG 1X55A 5LMNL 2ZM6Q 1HJPA 2EIFA 4IPGA 2WB1E 3G6EA 4DV0L 1C7YA 4A3MH 3TS2A 2ALYB 2AMCB 1G51A 5FLMG 2BA0A 4GOPB 1N32L 4DV0Q 2A8VA 1UE7A 2ZM6L 4HJ9A 1Z9FA 5LMUQ 3UDGA 1HZ9A 4DK6C 1NBWA 4C3HH 4OX9L 2KCTA 1XMOQ 3ULPA 1EYGA 3AQQA 4BY1G 4KHPL 3RR5A 5DLQE 1YHAA 2DUDA 2ZJRA 3M7NA 4DV6L 1S40A 3PO2G 3M4QA 3U4ZA 3JAMc 1EIFA 1PHJA 4Y52H 2K75A 3H3VH 5JEAJ 4MNOA 4IJHA 4PZ7A 3H0GH 3RLOA 1PH7A 3W1GA 4DR2Q 2MQHA 1O7IA 3LGJA 1A63A 3H3VI 4A93H 5C4JH 1SR3A 1VQGA 2PQAB 1DGSA 3M4OH 4DR2L 1Y1VG 1E1OA 5IYBG 1G291 4A3KH 4BY1H 3GTGH 2ZJPA 3T1YQ 3CCQA 2N49A 1GM5A 1IBKQ 2CWPA 1QUQA 1TXYA 2A1AA 4O2DA 2PI2A 2RF4A 4TVAB 5C3EH 3FKIH 3GTLH 4A3IG 1UE1A 2N3SA 4KHPQ 4JBJA 2UXCL 1JB7A 4A93G 5IE8A 4A3DG 1B8AA 5GAGC 1BBUA 2JA8G 3JAMi 3CCEA 2R93H 4JI2Q 4OWTB 1Y1VH 3STBC 3D0FA 3STBD 3PV0A 2Z0SA 3KJPA 3RNUA 2BH2A 4LF9Q 5JJIA 2AKWB 3F2DA 2IT1A 2L15A 2PMZE 1N34L 2YTVA 3T1HQ 1QVGA 1EIYB 4NXMQ 2JA6H 4B3RQ 2JA7G 1IBLQ 1VQDA 3ULLA 4A3CH 3PUXA 4UY8C 4AYBG 1BBWA 2ES2A 1X6OA 4LFAL 2ZTEA 2VZAA 3CCVA 3CC2A 2JQOA 3CMAA 3SGIA 4GLXA 4JI2L 1JJGA 3MEFA 1HNWL 2HHHQ 4IFDJ 1JMCA 2VQFQ 2KHIA 1N8RC 3KDFB 1CKNA 4JV5L 1GO3E 4B3MQ 1Q12A 3K7UC 3TRZA 3HOZH 4X64L 3B6YA 3KYHC 2JA5G 1SFOH 1VQCA 2YTYA 1I6HH 3KF8B 1OXUA 1K8AC 1B7YB 4GNXB 2YU9H 1XMQQ 2OTLA 2I5MX 4YWMA 3G48A 4JI6L 2IHEA 1BKBA 3CC4A 3PUVA 2GN5A 1M1KC 4P74A 4BBRH 1N9WA 4DNIA 2E5LQ 3HOUH 2C35B 4X62Q 4DV5Q 3RN2A 3HOWH 3JC66 3I55A 3MXNB 2LSSA 3S15H 2XTIA 4P71A 4X62L 4DV5L 4HIKA 1K8GA 1I50H 1KAWA 1IBLL 5IT9c 1VQ4A 3A0JA 2UUCL 4DR5Q 2B63G 5C44H 2E2JH 4LWCA 3I4MG 2WAQG 1K3RA 3M4PA 3BZCA 2CFMA 1N34Q 4JBMA 1PH4A 2MFIA 2QGQA 4DR7L 1HNZL 5LMUL 2B3GA 3PSIA 4GN4B 1E22A 3NEMA 2VW9A 4GOPC 5C0XG 2KCMA 2JJQA 5AJ3L 4LF4Q 2RHQB 1I3QH 1D8LA 3F1ZA 5IYDG 4OXPA 1NE3A 1BVSA 1Q82C 1Q86C 4XIGS 4B3TL 2R7ZG 5IP9G 1VQ5A 4GKKQ 3A74A 5FJ8H 2VQFL 3PCOB 2NVQH 1CKNB 2GVBA 4WJ4A 2K5NA 3J80c 1SE8A 1PYSB 1FL0A 4JI3L 4A4IA 1PV4A 2Y0SG 4B3SQ 2Q2HA 3H0GG 4NXML 4BA2I 3A5ZB 1FVIA 3U58A 1Y1WG 4LUZA 4JI7L 4B3RL 1H95A 3CMEA 4X66Q 3CPWA 5C0XI 4IPHA 2JEBI 4DK3C 1C0AA 4IO9A 3RN5A 4JI0L 1VQBA 4UP7A 3G4SA 4DV6Q 1Y14B 3GTOH 2D0OA 3TREA 3E9IA 2UU9Q 3PO3G 3UDIA 4YCUA 1CSPA 2F52A 4A3FG 1KQSA 1CUKA 4GOPA 2UU9L 2OWOA 2ZTDA 1YNXA 4A3BH 4IPCA 4K0KL 3GTKH 2CWAA 4GNXC 3S1RH 1WOCA 3CAMA 3K81C 4JOIA 1XNQQ 4HJAA 3T1YL 1UWVA 5IYBH 2NVYH 1L2FA 4A3KG 4JI4L 4A3GH 3M3YH 4DV4Q 4DR6Q 2WB1G 3CCLA 2K50A 4JV5Q 3W1BA 2JA6G 1NY4A 3GTQH 5C4XG 1HNWQ 1A0IA 2LXKA 1LTLA 4JC0A 1AE3A 3F8TA 3CD6A 4OONA 2HIVA 4LUOA 3VDYA 3AFQA 2PQAA 3U50C 1GVPA 2Q2TA 4R1JA 2NVTH 3J81c 4HJ5A 4J15A 5JJLA 1XPRA 4AH6A 4A3GG 1YZ6A 3ULJA 4OX9Q 4GKKL 1A62A 3I4NG 1QVCA 3HOZG 4JI4Q 1KXLA 4WJ3M 4C3JH 3OYYA 4HIOA 4BY7G 1U5KA 3H15A 3G71A 2GVAA 2NZOA 4QIWE 1HNXQ 2VNUD 5GQOA 3KF6A 1YI2A 1HR0L 4K0KQ 4DUZL 1HNZQ 1E1TA 1YJ9A 2ID0A 5BR8Q 1JJ2A 3AEVA 5M5WH 1HZCA 1J6QA 1WCMG 1IBML 1PA6A 3OTOL 5K36G 3J7A5 4KI0A 3HOUG 4LFCL 1Q8KA 2K14A 4PZ6A 3AFPA 4LF6L 4LF7L 2N8NA 1YJWA 3S2DH 5GADC 4LFBL 2E5LL 1YHQA 1SLJA 1T9HA 4DKAC 3KJOA 1ASZA 4JI7Q 4DAMA 4A3DH 5FLXc 1EUJA 3UE0A 4B3SL 5HGQA 1YVCA 2BH8A 3TS0A 1XMQL 1VQIA 1WCMH 2JEAI 2F4VL 1Z47A 1Q7YC 1IL2A 3E0EA 3FHWA 2QEXA 1WYDA 2UUAL 3GDEA 5FLMH 3CCJA 1PH1A 2NN6G 1X3FA 1Q1EA 1E3PA 1YEZA 1YJNA 3HOWG 5M3FH 4HIMA 2AWNA 4QL5A 4LNQA 3J80i 1K9MC 2HHHL 4DV1L 3S1NH 5E7NA 2N78A 1CKMA 1LM0A 3EN2A 2JK8A 4DV2Q 5LMNQ 2UUBQ 1FJGQ 4PZ8A 4C3IH 5IP7G 4LFAQ 4UPAA 5JJKA 3KLWA 4QQBX 2HQLA 1VQHA 3L0OA 4MZ9A 4JI5Q 1LUZA 4BBSH 2R92H 5M3MG 3AYHB 3I7FA 3Q8DA 4LF9L 1HZBA 1TWGH 1V43A 4BA1I 1PH8A 1MJEA 3RLNA 2UUBL 2ASBA 4OWXB 2KHJA 4L5QA 4A3LH 1K0RA 1S72A 5IWAL 4IFDG 1VQJA 2YTXA 2ZJQA 2LXJA 1CKOA 2CKZB 1JT8A 2UXCQ 1EOVA 3RLFA 1X54A 3ICEA 3HOYH 4JI6Q 4HJ7A 4A3IH 3PF5A 3PGZA 2PNHA 4YCVA 1VCIA 1XPUA 4A3BG 4YWKA 1Q1BA 4NB3A 3CC7A 2WAQE 1K73C 2OCEA 1VS0A 1IYJB 2F4VQ 1RL2A 1OXVA 5ELNA 4X64Q 5JEAG 4QGUA 4R4TA 4P72A 1YHBA 4R4IA 4JI8L 2E2IH 1TWCH 3BJUA 2IY5B 1L1OA 5C4XH 1AH9A 2ZTCA 2K4KA 4EQ5A 1SMXA 4DR1Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 H;  3HKZ E;  1LYL A;  1R9T H;  5EAY A;  1A8V A;  1CSQ A;  1P8L A;  4LUV A;  1EFW A;  4LF5 Q;  2UXD L;  1HR0 Q;  3S24 A;  1WFQ A;  2OQK A;  4KHZ A;  4GKJ Q;  1VQN A;  2PI2 E;  1D7Q A;  1KD1 C;  3RZD H;  1VQ6 A;  2I5L X;  2UXD Q;  3KF6 B;  4UP8 A;  4YHH L;  4OO1 G;  1WI5 A;  3HOX H;  1W3S A;  2R6G A;  2Z6K C;  3UE1 A;  1IBK L;  1VQ7 A;  5J3B A;  4AYB E;  3BZK A;  2Q2U A;  2BA1 A;  3E9H A;  3GO5 A;  1X9N A;  3HOV H;  4DV7 Q;  4R4Q A;  1PVO A;  1C9O A;  3CPF A;  3EIV A;  4GLA C;  4GN5 A;  2V1C C;  5GRO A;  3A5U A;  1KC8 C;  1I94 L;  2IX1 A;  1L0W A;  3GTP H;  3S17 H;  3HKS A;  3S1Q H;  5ELO A;  4JI8 Q;  2DGY A;  4DUY L;  2JA7 H;  3KFU A;  3I4M H;  4IPD A;  3EBE A;  3K7A H;  2AHO B;  1J5E Q;  4LF8 Q;  3NEN A;  3I56 A;  1VQE A;  4DV7 L;  3J81 j;  3HOX G;  4LF6 Q;  2JA9 A;  3J81 i;  3DM3 A;  5LMN W;  1Q46 A;  2IX0 A;  2R7F A;  4X65 L;  1X3E A;  4JBW A;  1XJV A;  4OO1 I;  1PYB A;  3K8A A;  4A3E H;  1NMF A;  2VQE L;  1PH2 A;  1IBM Q;  2MNA A;  2D62 A;  4DV3 Q;  5IYD H;  1XMO L;  4YHH Q;  1QVF A;  2R7Z H;  1VQM A;  4TQU S;  1RIP A;  5M3F G;  4RMF A;  4GS3 A;  4L5T A;  3TQY A;  4DR3 L;  4JG2 A;  1VQ8 A;  1QUQ B;  2ATW A;  1Q81 C;  1V9P A;  5M5Y H;  1E24 A;  4LF5 L;  4LF8 L;  1VQ9 A;  4BXX G;  1JJC B;  3CCM A;  2OQ0 A;  3GTM H;  4JI1 Q;  3S2H H;  1L1O B;  4IJL A;  3PIO A;  4BBR G;  2A19 A;  1X3G A;  4BBS G;  1Y1W H;  5M3M H;  4DR4 Q;  1GD7 A;  1W2B A;  1GKH A;  4DR1 L;  4JI3 Q;  2WP8 J;  1TWA H;  1OXT A;  4AQY Q;  3PUY A;  2QA4 A;  2OTJ A;  4Y7N H;  4A3J G;  1FJG L;  3CP0 A;  3GTJ H;  2B63 H;  4DR4 L;  1M90 C;  3F2B A;  2K5V A;  2I5H A;  4YY3 L;  5IY0 A;  1PFS A;  3D31 A;  4JOI C;  4JI1 L;  4YCW A;  5IP7 H;  2HT1 A;  3S16 H;  4DR6 L;  4H02 A;  4P75 A;  4R4C A;  4B3T Q;  1SRU A;  2KBN A;  3J7Z C;  4A76 A;  3K0X A;  1AE2 A;  1KRT A;  3WWV A;  4A3M G;  4LF4 L;  4IFD I;  1I5F A;  4GKJ L;  3CQZ H;  4C2M H;  4UP9 A;  3ZJY C;  3CCS A;  4JYA L;  1PH6 A;  5HY6 A;  2YYZ A;  1NMG A;  3ER0 A;  3KDF A;  2VL6 A;  4DAY B;  1FGU A;  4A3J H;  4DR7 Q;  1SRO A;  1N36 L;  4DV3 L;  1IXR A;  3W5O A;  2VQE Q;  3FP9 A;  3DLL A;  2UXB Q;  1N33 L;  3PF4 A;  4DR5 L;  1X56 A;  4O0A A;  4X65 Q;  2RHS B;  2NZH A;  3L2P A;  1U0L A;  4NXN Q;  1N32 Q;  1B70 B;  4MTN A;  3FKI G;  4APV A;  1MJC A;  1NTG A;  1TWH H;  2RCN A;  2MO1 A;  1J5E L;  4X66 L;  1JE5 A;  4ALP A;  1UE6 A;  4RG1 A;  2F3I A;  4JI5 L;  4DUY Q;  1ASY A;  2JA8 H;  2UXB L;  1K83 H;  3L7Z C;  4JBK A;  2R93 G;  1G6P A;  1I94 Q;  1OXX K;  2IHF A;  4JCV E;  1HZA A;  3HFZ B;  4JYA Q;  2VUM H;  1HNX L;  4IOA A;  2K52 A;  3PUW A;  1YIJ A;  5H1S E;  3OW2 A;  4FDB A;  2H5X A;  1XNR L;  4BY7 H;  1NJI C;  3NEL A;  5C3E G;  4GLV B;  1KIX A;  2WFW A;  3PO3 H;  4GN3 B;  4A3F H;  1TWF H;  4GNX A;  1QZG A;  4B3M L;  5M5X H;  1VQO A;  1WJJ A;  3UDF A;  1PH5 A;  3TEH B;  5GAH C;  5AJ3 Q;  5IWA Q;  4R4O A;  4X6A H;  2UUA Q;  2KEN A;  3RZO H;  1XNR Q;  1EQQ A;  1OTC A;  4ME3 A;  2CCZ A;  2B29 A;  5IYC G;  2Q2I A;  1KHI A;  3HOV G;  2VUM G;  1EQR A;  4PG3 A;  4KLK A;  2EQS A;  4A3C G;  2AWO A;  4OWW B;  1XTD A;  4LFB Q;  1IZ6 A;  3CCU A;  2HIX A;  3KOJ A;  1E7Z A;  1PH3 A;  4EX5 A;  2UUC Q;  3S1M H;  2Z6K A;  1VQA A;  1MIU A;  4XTC S;  4AIM A;  4LF7 Q;  4DV2 L;  1KL9 A;  1S3O A;  1VQF A;  1V1Q A;  1QZH A;  1XNQ L;  4DV1 Q;  4DR3 Q;  4PMW A;  1VQK A;  4NXN L;  4L5S A;  2Y0S E;  4HID A;  2K5H A;  1N33 Q;  3BU2 A;  1HH2 P;  5IYC H;  3M9B A;  2CQO A;  5C0X J;  4A3E G;  1UE5 A;  4DPG A;  1XPO A;  1OXS C;  1N36 Q;  3I4N H;  2MO0 A;  3CF5 A;  4DUZ Q;  3ERS X;  4L5R C;  2NVX H;  3K80 C;  2JA5 H;  1MKH A;  2E2H H;  4IOC A;  3I2Z A;  3F2C A;  4JI0 Q;  3HKZ G;  1VQP A;  1UEB A;  1HR0 W;  2JE6 I;  2R7D A;  3NBH B;  1KRS A;  5GAE C;  3CCR A;  4QJF A;  3CW2 C;  1X65 A;  3U4V A;  1SN8 A;  4YY3 Q;  4HJ8 A;  3M85 A;  2R92 G;  2VS1 A;  1L1O C;  2FXQ A;  4POF A;  1EWI A;  4P73 A;  4LW1 A;  1PH9 A;  2YV5 A;  3UDX A;  2EXD A;  4NPS A;  3PIP A;  4AQY L;  4LFC Q;  4A75 A;  2E8G A;  5IP9 H;  3CXC A;  5C44 G;  4A3L G;  3PUZ A;  4POG A;  3GD7 A;  4YWL A;  3OTO Q;  5FJ8 G;  2D0P A;  3T1H L;  1YIT A;  3PO2 H;  2VY3 A;  4QY7 A;  3I4O A;  5BR8 L;  1YBY A;  2I0Q A;  3IRB A;  1VQL A;  1P16 A;  4BXX H;  4DV4 L;  2NN6 I;  2XGT A;  3HOY G;  1X55 A;  5LMN L;  2ZM6 Q;  1HJP A;  2EIF A;  4IPG A;  2WB1 E;  3G6E A;  4DV0 L;  1C7Y A;  4A3M H;  3TS2 A;  2ALY B;  2AMC B;  1G51 A;  5FLM G;  2BA0 A;  4GOP B;  1N32 L;  4DV0 Q;  2A8V A;  1UE7 A;  2ZM6 L;  4HJ9 A;  1Z9F A;  5LMU Q;  3UDG A;  1HZ9 A;  4DK6 C;  1NBW A;  4C3H H;  4OX9 L;  2KCT A;  1XMO Q;  3ULP A;  1EYG A;  3AQQ A;  4BY1 G;  4KHP L;  3RR5 A;  5DLQ E;  1YHA A;  2DUD A;  2ZJR A;  3M7N A;  4DV6 L;  1S40 A;  3PO2 G;  3M4Q A;  3U4Z A;  3JAM c;  1EIF A;  1PHJ A;  4Y52 H;  2K75 A;  3H3V H;  5JEA J;  4MNO A;  4IJH A;  4PZ7 A;  3H0G H;  3RLO A;  1PH7 A;  3W1G A;  4DR2 Q;  2MQH A;  1O7I A;  3LGJ A;  1A63 A;  3H3V I;  4A93 H;  5C4J H;  1SR3 A;  1VQG A;  2PQA B;  1DGS A;  3M4O H;  4DR2 L;  1Y1V G;  1E1O A;  5IYB G;  1G29 1;  4A3K H;  4BY1 H;  3GTG H;  2ZJP A;  3T1Y Q;  3CCQ A;  2N49 A;  1GM5 A;  1IBK Q;  2CWP A;  1QUQ A;  1TXY A;  2A1A A;  4O2D A;  2PI2 A;  2RF4 A;  4TVA B;  5C3E H;  3FKI H;  3GTL H;  4A3I G;  1UE1 A;  2N3S A;  4KHP Q;  4JBJ A;  2UXC L;  1JB7 A;  4A93 G;  5IE8 A;  4A3D G;  1B8A A;  5GAG C;  1BBU A;  2JA8 G;  3JAM i;  3CCE A;  2R93 H;  4JI2 Q;  4OWT B;  1Y1V H;  3STB C;  3D0F A;  3STB D;  3PV0 A;  2Z0S A;  3KJP A;  3RNU A;  2BH2 A;  4LF9 Q;  5JJI A;  2AKW B;  3F2D A;  2IT1 A;  2L15 A;  2PMZ E;  1N34 L;  2YTV A;  3T1H Q;  1QVG A;  1EIY B;  4NXM Q;  2JA6 H;  4B3R Q;  2JA7 G;  1IBL Q;  1VQD A;  3ULL A;  4A3C H;  3PUX A;  4UY8 C;  4AYB G;  1BBW A;  2ES2 A;  1X6O A;  4LFA L;  2ZTE A;  2VZA A;  3CCV A;  3CC2 A;  2JQO A;  3CMA A;  3SGI A;  4GLX A;  4JI2 L;  1JJG A;  3MEF A;  1HNW L;  2HHH Q;  4IFD J;  1JMC A;  2VQF Q;  2KHI A;  1N8R C;  3KDF B;  1CKN A;  4JV5 L;  1GO3 E;  4B3M Q;  1Q12 A;  3K7U C;  3TRZ A;  3HOZ H;  4X64 L;  3B6Y A;  3KYH C;  2JA5 G;  1SFO H;  1VQC A;  2YTY A;  1I6H H;  3KF8 B;  1OXU A;  1K8A C;  1B7Y B;  4GNX B;  2YU9 H;  1XMQ Q;  2OTL A;  2I5M X;  4YWM A;  3G48 A;  4JI6 L;  2IHE A;  1BKB A;  3CC4 A;  3PUV A;  2GN5 A;  1M1K C;  4P74 A;  4BBR H;  1N9W A;  4DNI A;  2E5L Q;  3HOU H;  2C35 B;  4X62 Q;  4DV5 Q;  3RN2 A;  3HOW H;  3JC6 6;  3I55 A;  3MXN B;  2LSS A;  3S15 H;  2XTI A;  4P71 A;  4X62 L;  4DV5 L;  4HIK A;  1K8G A;  1I50 H;  1KAW A;  1IBL L;  5IT9 c;  1VQ4 A;  3A0J A;  2UUC L;  4DR5 Q;  2B63 G;  5C44 H;  2E2J H;  4LWC A;  3I4M G;  2WAQ G;  1K3R A;  3M4P A;  3BZC A;  2CFM A;  1N34 Q;  4JBM A;  1PH4 A;  2MFI A;  2QGQ A;  4DR7 L;  1HNZ L;  5LMU L;  2B3G A;  3PSI A;  4GN4 B;  1E22 A;  3NEM A;  2VW9 A;  4GOP C;  5C0X G;  2KCM A;  2JJQ A;  5AJ3 L;  4LF4 Q;  2RHQ B;  1I3Q H;  1D8L A;  3F1Z A;  5IYD G;  4OXP A;  1NE3 A;  1BVS A;  1Q82 C;  1Q86 C;  4XIG S;  4B3T L;  2R7Z G;  5IP9 G;  1VQ5 A;  4GKK Q;  3A74 A;  5FJ8 H;  2VQF L;  3PCO B;  2NVQ H;  1CKN B;  2GVB A;  4WJ4 A;  2K5N A;  3J80 c;  1SE8 A;  1PYS B;  1FL0 A;  4JI3 L;  4A4I A;  1PV4 A;  2Y0S G;  4B3S Q;  2Q2H A;  3H0G G;  4NXM L;  4BA2 I;  3A5Z B;  1FVI A;  3U58 A;  1Y1W G;  4LUZ A;  4JI7 L;  4B3R L;  1H95 A;  3CME A;  4X66 Q;  3CPW A;  5C0X I;  4IPH A;  2JEB I;  4DK3 C;  1C0A A;  4IO9 A;  3RN5 A;  4JI0 L;  1VQB A;  4UP7 A;  3G4S A;  4DV6 Q;  1Y14 B;  3GTO H;  2D0O A;  3TRE A;  3E9I A;  2UU9 Q;  3PO3 G;  3UDI A;  4YCU A;  1CSP A;  2F52 A;  4A3F G;  1KQS A;  1CUK A;  4GOP A;  2UU9 L;  2OWO A;  2ZTD A;  1YNX A;  4A3B H;  4IPC A;  4K0K L;  3GTK H;  2CWA A;  4GNX C;  3S1R H;  1WOC A;  3CAM A;  3K81 C;  4JOI A;  1XNQ Q;  4HJA A;  3T1Y L;  1UWV A;  5IYB H;  2NVY H;  1L2F A;  4A3K G;  4JI4 L;  4A3G H;  3M3Y H;  4DV4 Q;  4DR6 Q;  2WB1 G;  3CCL A;  2K50 A;  4JV5 Q;  3W1B A;  2JA6 G;  1NY4 A;  3GTQ H;  5C4X G;  1HNW Q;  1A0I A;  2LXK A;  1LTL A;  4JC0 A;  1AE3 A;  3F8T A;  3CD6 A;  4OON A;  2HIV A;  4LUO A;  3VDY A;  3AFQ A;  2PQA A;  3U50 C;  1GVP A;  2Q2T A;  4R1J A;  2NVT H;  3J81 c;  4HJ5 A;  4J15 A;  5JJL A;  1XPR A;  4AH6 A;  4A3G G;  1YZ6 A;  3ULJ A;  4OX9 Q;  4GKK L;  1A62 A;  3I4N G;  1QVC A;  3HOZ G;  4JI4 Q;  1KXL A;  4WJ3 M;  4C3J H;  3OYY A;  4HIO A;  4BY7 G;  1U5K A;  3H15 A;  3G71 A;  2GVA A;  2NZO A;  4QIW E;  1HNX Q;  2VNU D;  5GQO A;  3KF6 A;  1YI2 A;  1HR0 L;  4K0K Q;  4DUZ L;  1HNZ Q;  1E1T A;  1YJ9 A;  2ID0 A;  5BR8 Q;  1JJ2 A;  3AEV A;  5M5W H;  1HZC A;  1J6Q A;  1WCM G;  1IBM L;  1PA6 A;  3OTO L;  5K36 G;  3J7A 5;  4KI0 A;  3HOU G;  4LFC L;  1Q8K A;  2K14 A;  4PZ6 A;  3AFP A;  4LF6 L;  4LF7 L;  2N8N A;  1YJW A;  3S2D H;  5GAD C;  4LFB L;  2E5L L;  1YHQ A;  1SLJ A;  1T9H A;  4DKA C;  3KJO A;  1ASZ A;  4JI7 Q;  4DAM A;  4A3D H;  5FLX c;  1EUJ A;  3UE0 A;  4B3S L;  5HGQ A;  1YVC A;  2BH8 A;  3TS0 A;  1XMQ L;  1VQI A;  1WCM H;  2JEA I;  2F4V L;  1Z47 A;  1Q7Y C;  1IL2 A;  3E0E A;  3FHW A;  2QEX A;  1WYD A;  2UUA L;  3GDE A;  5FLM H;  3CCJ A;  1PH1 A;  2NN6 G;  1X3F A;  1Q1E A;  1E3P A;  1YEZ A;  1YJN A;  3HOW G;  5M3F H;  4HIM A;  2AWN A;  4QL5 A;  4LNQ A;  3J80 i;  1K9M C;  2HHH L;  4DV1 L;  3S1N H;  5E7N A;  2N78 A;  1CKM A;  1LM0 A;  3EN2 A;  2JK8 A;  4DV2 Q;  5LMN Q;  2UUB Q;  1FJG Q;  4PZ8 A;  4C3I H;  5IP7 G;  4LFA Q;  4UPA A;  5JJK A;  3KLW A;  4QQB X;  2HQL A;  1VQH A;  3L0O A;  4MZ9 A;  4JI5 Q;  1LUZ A;  4BBS H;  2R92 H;  5M3M G;  3AYH B;  3I7F A;  3Q8D A;  4LF9 L;  1HZB A;  1TWG H;  1V43 A;  4BA1 I;  1PH8 A;  1MJE A;  3RLN A;  2UUB L;  2ASB A;  4OWX B;  2KHJ A;  4L5Q A;  4A3L H;  1K0R A;  1S72 A;  5IWA L;  4IFD G;  1VQJ A;  2YTX A;  2ZJQ A;  2LXJ A;  1CKO A;  2CKZ B;  1JT8 A;  2UXC Q;  1EOV A;  3RLF A;  1X54 A;  3ICE A;  3HOY H;  4JI6 Q;  4HJ7 A;  4A3I H;  3PF5 A;  3PGZ A;  2PNH A;  4YCV A;  1VCI A;  1XPU A;  4A3B G;  4YWK A;  1Q1B A;  4NB3 A;  3CC7 A;  2WAQ E;  1K73 C;  2OCE A;  1VS0 A;  1IYJ B;  2F4V Q;  1RL2 A;  1OXV A;  5ELN A;  4X64 Q;  5JEA G;  4QGU A;  4R4T A;  4P72 A;  1YHB A;  4R4I A;  4JI8 L;  2E2I H;  1TWC H;  3BJU A;  2IY5 B;  1L1O A;  5C4X H;  1AH9 A;  2ZTC A;  2K4K A;  4EQ5 A;  1SMX A;  4DR1 Q; 
#chains in the Genus database with same CATH topology
 2DN8 A;  1CZG A;  4U68 A;  1LYL A;  3OW7 A;  1R9T H;  1CSQ A;  1P8L A;  2NBF A;  4LF5 Q;  2OQK A;  2J7Z A;  1MSH A;  2M00 A;  3KF8 A;  1C4Q A;  4DNT B;  5CBA E;  1D5M C;  3RZD H;  2I5L X;  4UP8 A;  4YHH L;  4OO1 G;  3P1H A;  5CR3 A;  1WI5 A;  1W3S A;  2R6G A;  5E4W C;  2XNA C;  2Q2U A;  1JE4 A;  5DNF A;  3GO5 A;  1UNS A;  1PVO A;  4B08 A;  1C9O A;  3EIV A;  5C6A A;  4GLA C;  5GRO A;  3VYT A;  1L0W A;  3S1Q H;  2DNC A;  2WII B;  2JA7 B;  1J5E Q;  2AHO B;  1LAC A;  1HPC A;  4OO1 H;  3I56 A;  1SBB B;  4CKB A;  4LF6 Q;  3M3Y B;  2IX0 A;  4X65 L;  3K8A A;  1I3Q B;  4DV3 Q;  3Q24 A;  4HTH A;  5IYD H;  2R7Z H;  4TQU S;  2JYO A;  4JG2 A;  1V9P A;  2NTS A;  4FVM A;  2RA4 A;  3SXH A;  4LF8 L;  1EIH A;  1L1O B;  1K83 B;  2A19 A;  1X3G A;  3AU7 A;  4KK7 A;  4K6D A;  1TS4 A;  1EZ8 A;  1GKH A;  2K01 A;  2WP8 J;  1KNA A;  3BS1 A;  2QA4 A;  4CJ0 B;  3TP7 A;  4RH6 A;  3D31 A;  3BVM A;  3P75 A;  4B3T Q;  5G3L D;  5D14 A;  1KRT A;  4LF4 L;  3VR3 A;  4F7X A;  1I5F A;  3ZJY C;  2A6H C;  3FKI B;  2PMZ B;  1NCV A;  1R9T B;  4KV6 A;  2VQE Q;  3LWU A;  1X56 A;  2B2W C;  2NZH A;  3IFT A;  2L5T A;  4MTN A;  4QUC A;  2D9U A;  2XIW A;  1GUT A;  1JE5 A;  1ENC A;  4DUY Q;  1ASY A;  1EY5 A;  1K83 H;  3HOW B;  1G6P A;  5EPL A;  1J8I A;  1OXX K;  1B9M A;  1HZA A;  3HFZ B;  5C5M A;  2K52 A;  1YIJ A;  3OW2 A;  1HXY D;  1XX8 A;  2SOB A;  5D3D A;  3TZU A;  4X3T A;  1TKW B;  1U4R A;  1QZG A;  2R7Z B;  1O7Z A;  3MFY A;  3TEH B;  4X6A H;  5IWA Q;  4R4O A;  2ICE C;  1EQQ A;  3BYT B;  1U9R A;  2B29 A;  2VUM G;  1B3Q A;  5JOB A;  2A6E D;  3OMC A;  1H9J A;  4N8X 1;  2AWO A;  1S5B D;  3KOJ A;  4EX5 A;  1VQA A;  4XTC S;  4AIM A;  1SJE D;  4F88 A;  1S3O A;  4ZUJ A;  1QZH A;  4DR3 Q;  4K2K A;  4NXN L;  3E6Z X;  1SSO A;  3DWP A;  4JW0 A;  5M5Y B;  3HOW G;  1UE5 A;  1N36 Q;  5M5W B;  4DUZ Q;  4L5R C;  5DM6 3;  2JA5 B;  2E2H H;  3CQZ B;  4C2M B;  4JI0 Q;  3GTO B;  1HR0 W;  4DK0 A;  4O1N A;  1ML0 D;  1G91 A;  5DAU A;  3M7G A;  3DEP A;  1L1O C;  1H9S B;  2JP1 A;  4POF A;  4KKS A;  1H9K A;  4AQY L;  2E8G A;  3CXC A;  1TR5 A;  2WV6 D;  4POG A;  3VA7 A;  3OTO Q;  5FJ8 G;  3PO2 H;  4QY7 A;  1YBY A;  3IRB A;  1P16 A;  1RD9 D;  4DV4 L;  3HOY G;  3JAM L;  1Q8I A;  3TS2 A;  1AZQ A;  2QCP X;  2FJ2 A;  1WD1 A;  2ZM6 L;  1Z9F A;  2EYO A;  5FLX L;  1EY7 A;  4QMG A;  5LMU Q;  4KHP L;  1XMO Q;  1EYG A;  4BY1 G;  5DLQ E;  2DUD A;  3PO2 G;  1DXM A;  4KN4 C;  4EGV A;  2L0C A;  3H0G H;  3RLO A;  3C3L A;  3KLR A;  1A63 A;  2F0D A;  2O4X A;  4BBR B;  1K0S A;  1NR2 A;  2K04 A;  4DR2 L;  4ME5 A;  3T1Y Q;  1WTX A;  1F9P A;  2B2T A;  1BXT A;  2QDL A;  3I72 A;  1A3U A;  3OPO A;  3GTL H;  1UE1 A;  4DNR B;  1K3B C;  5IE8 A;  1QOH A;  4A93 G;  3L9A X;  5C5L A;  3D0F A;  5JVH 3;  2Z0S A;  4LF9 Q;  2AKW B;  2PZW A;  3S14 B;  5C4J B;  2YTV A;  1Z7T A;  1IBL Q;  4AYB G;  5C4X B;  1I4P A;  2K32 A;  4P2C B;  3MEF A;  1EIG A;  3X3M A;  1V1P B;  1X32 A;  2KHI A;  4CDE C;  4E6I A;  2N55 A;  2Q8I B;  2XWJ B;  3KDF B;  1TT2 A;  4FF2 A;  5DM7 3;  1Q12 A;  2CW0 D;  2CVR A;  3KYH C;  2MP1 A;  2JA5 G;  1VQC A;  2YTY A;  3BVZ A;  1D6E C;  4ZYS A;  4RAU C;  1OXU A;  1K8A C;  1F2L A;  2OTL A;  3G48 A;  4JI6 L;  4WJW A;  5CMD A;  2A74 C;  1SE2 A;  1M1K C;  3G6J B;  5KYI A;  3HKZ B;  1KTK A;  4X62 Q;  1CQF A;  4RFB A;  4P71 A;  3H91 A;  2UUC L;  1KAW A;  1ENF A;  4DR5 Q;  2E2J H;  3SK6 A;  4OIJ A;  4HSV A;  1PH4 A;  2MFI A;  2QGQ A;  3QG1 A;  2B3G A;  3PSI A;  1E22 A;  4CJ2 C;  1STB A;  4GOP C;  5C0X G;  4ABN A;  1XYI A;  4DN4 M;  1CA5 A;  2E2H B;  1I3Q H;  1PMR A;  1CM9 A;  3F1Z A;  5IYD G;  1Q86 C;  1NE3 A;  2R7Z G;  2F0J A;  5BN4 A;  5FOB B;  3A8J E;  4K6L A;  3PCO B;  2EYF A;  2NVQ H;  2GVB A;  1WVL A;  2K5N A;  3CU7 A;  4XYQ A;  4RKL A;  1SE8 A;  2F0T A;  2B39 A;  4B3S Q;  5C44 B;  4NXM L;  1Y1W G;  4B3R L;  4LUZ A;  2CH4 W;  1LTT D;  3GTM B;  3W2D A;  1RJT A;  3GTO H;  1Y14 B;  1SE3 A;  3UDI A;  4YCU A;  2F52 A;  4UAI A;  1KNE A;  1YNX A;  1CI3 M;  3GTK H;  4C3J B;  4GNX C;  3S1R H;  2IL8 A;  1XNQ Q;  2FMC A;  3X3N A;  2HDM A;  1L2F A;  2A5H A;  4A3G H;  2WB1 G;  2ZXO A;  2K50 A;  2WAQ B;  2R92 B;  3W3A A;  3AB9 A;  5C3X A;  2LXK A;  1LTL A;  1QE6 A;  2HIV A;  2CW0 C;  2EY1 A;  2KQ3 A;  2RSN A;  4LAA A;  3AFQ A;  3GTQ B;  2Q2T A;  4KHV A;  4AH6 A;  4GKK L;  5KIX A;  2AUJ D;  2DNE A;  3HOZ G;  1KXL A;  1LT6 D;  4C1N K;  2F0L A;  1L0Y B;  4HIO A;  1U5K A;  3H15 A;  2FFK B;  3G71 A;  1HRJ A;  2NZ1 D;  4K0K Q;  1E1T A;  3VR2 A;  2MGS A;  5M5W H;  1J6Q A;  1IL8 A;  5T1G A;  1PA6 A;  1F2M A;  4LFC L;  2K14 A;  4LF7 L;  1LLR D;  3S2D H;  3R2T A;  3TBI B;  2E5L L;  4DAM A;  5EKL A;  3QOL A;  1O7Y A;  3UE0 A;  5E4X A;  1XMQ L;  5D65 A;  2JEA I;  1Z47 A;  1IL2 A;  3E0E A;  2EVB A;  3NBH A;  5FLM H;  3MHB A;  1PH1 A;  1B44 D;  4GZY C;  4K5W A;  4HIM A;  2AWN A;  4LNQ A;  2HHH L;  5E7N A;  4I7Z C;  2NB0 A;  1FJG Q;  2JK8 A;  2WIN B;  4PZ8 A;  5JJK A;  1I50 B;  2QDB A;  3KLW A;  4MZ9 A;  4BBS H;  2AQ1 B;  4Q0F A;  1LUZ A;  1HZB A;  4BA1 I;  1PH8 A;  3FEW X;  5COY A;  2UUB L;  2ASB A;  2XRS D;  2KHJ A;  1WTQ A;  1VQJ A;  2YTX A;  5G3L F;  2LXJ A;  4NKL A;  2BE5 C;  2PNH A;  4DF7 A;  4BY7 B;  5BN3 A;  4YWK A;  2HCC A;  2N88 A;  1VS0 A;  1IYJ B;  1LTI D;  5ELN A;  1S4Z A;  1Q90 A;  4TRD A;  1G6Z A;  5NUC A;  5JEA G;  5CYU A;  4QGU A;  4R4T A;  4JI8 L;  1VDZ A;  1TWC H;  2IY5 B;  1L1O A;  5C4X H;  3Q23 A;  5C4H A;  3DHQ A;  2EY6 A;  2KVM A;  1STY A;  3C1E A;  3S14 H;  1FD7 D;  1IKL A;  1A8V A;  2UXD L;  1HR0 Q;  3FPU B;  5JEA H;  5M3F B;  1WFQ A;  4M8A A;  3D6C A;  5ELB A;  4FF4 A;  1D7Q A;  1SMY C;  3GTL B;  3OHX C;  3KF6 B;  5KYL A;  3ND8 A;  3OWF A;  5EJW A;  1LTR D;  1KDB A;  5J3B A;  3BZK A;  4ZKB B;  1X9N A;  3A5U A;  1KC8 C;  2IX1 A;  1TQO A;  4DUY L;  3I4M H;  3EBE A;  3J7A V;  3NEN A;  5KGU A;  3SVM A;  1VQE A;  1D5X C;  4DV7 L;  1FR3 A;  1Q46 A;  1SNQ A;  3R8B A;  2R7F A;  1X3E A;  1XJV A;  4A3E H;  1PH2 A;  1NMF A;  1XXG A;  2CH4 A;  2VQE L;  2MNA A;  2EJF C;  1RTO A;  1QIL A;  1RIP A;  5M3F G;  5IOD A;  4RGM A;  4L5T A;  3TQY A;  1VQ8 A;  2ATW A;  3NPP A;  5M5Y H;  3NUC A;  5J1Z A;  4NP5 A;  1HUN A;  2OQ0 A;  3GTM H;  3T4A C;  3NP8 A;  1S5F D;  3PIO A;  4XYO A;  1HTL D;  1GD7 A;  1W2B A;  4JI3 Q;  3CHB D;  4RKB A;  2EJG C;  3GTJ H;  2B63 H;  3PIO 3;  3F2B A;  2I5H A;  4YY3 L;  4I7A A;  1I6V C;  1UEA B;  4P75 A;  1SRU A;  2NWG A;  3KLS A;  1AE2 A;  4A3M G;  4IFD I;  3D8G A;  2F0E A;  2B2V C;  4FF1 A;  3CCS A;  5C3E B;  3PO3 B;  1NMG A;  3KDF A;  4DR7 Q;  1FGU A;  1TS5 A;  3HEJ A;  1GHK A;  4DV3 L;  3DLL A;  1Y8N B;  4KN7 C;  2UXB Q;  3PF4 A;  1A3V A;  4O0A A;  4X65 Q;  3ND9 A;  4G57 A;  2VXW A;  3FKI G;  1KDC A;  1NTG A;  3I73 A;  1EU4 A;  1L0X B;  2DY7 A;  2RCN A;  2MO1 A;  1J5E L;  1UE6 A;  2F3I A;  4JI5 L;  2IJ0 A;  3L7Z C;  1HHV A;  4JBK A;  3OMG A;  2IHF A;  1BDO A;  1F2Z A;  1JB3 A;  4JYA Q;  2VUM H;  4C3J G;  2BDN A;  1HNX L;  4BY7 H;  3S1N B;  2H5X A;  1NJI C;  2A6E C;  3NEL A;  2RDF A;  4PMC A;  1GUG A;  4B3M L;  5M5X H;  1PH5 A;  1KDA A;  4J8Q A;  2KEN A;  2KCN A;  2KJX A;  2Q2I A;  1KHI A;  1NSN S;  3P20 A;  1EQR A;  4RCN A;  4PG3 A;  1PTO C;  4KLK A;  1ZYR C;  3EJI A;  3RUZ A;  1E2W A;  4K8J A;  5IIF A;  4OWW B;  4LFB Q;  2UUC Q;  1E7Z A;  1KAB A;  1DOM A;  1KL9 A;  2E2D C;  4O42 A;  1VQF A;  4K5V A;  4HED A;  1STN A;  4PMW A;  1VQK A;  4PQX A;  4DGZ A;  3QIA A;  4CKE A;  2CQO A;  5C0X J;  1QB5 D;  5BN5 A;  1OXS C;  1CFM A;  1I4Q A;  4S3S A;  1Y8P B;  3SEB A;  1G2T A;  1EY0 A;  3K80 C;  1TS2 A;  1MKH A;  4DFA A;  3I2Z A;  1VQP A;  1UEB A;  3I70 A;  1HUM A;  5IGE A;  4MHE A;  1QWY A;  1X65 A;  4M1U B;  1EFI D;  3BDL A;  4YY3 Q;  2FHT A;  3M85 A;  2VS1 A;  5JJZ A;  1K8O A;  4BWG B;  4CHT B;  2YV5 A;  5DEH A;  2F0S A;  4LFC Q;  5C44 G;  4A3L G;  4YWL A;  2F3V A;  2D0P A;  1YIT A;  2VY3 A;  2R93 B;  5TSS A;  1VQL A;  4WFN 3;  1X55 A;  1HJP A;  4DV0 L;  1G51 A;  2BA0 A;  4DV0 Q;  3ZYY X;  4WOR A;  1HZ9 A;  4FNF A;  1NBW A;  2Y0S B;  2BCO A;  3AQQ A;  1K28 A;  3ULP A;  1BCP D;  1FNW A;  3RR5 A;  5I2Y A;  2PO4 A;  4R9W A;  3M7N A;  1C48 A;  3M4Q A;  4XQJ A;  3JAM c;  2K75 A;  3H3V H;  3OWE B;  2RBM A;  1GUO A;  2B8F A;  1QNU A;  2MQH A;  4DR2 Q;  1SYC A;  1TY2 A;  3S1Q B;  3H3V I;  4A93 H;  5J39 A;  2PQA B;  1GXD C;  3D4W A;  1MSG A;  2KHS A;  4A3K H;  5IGG A;  3RMH A;  1GM5 A;  3K5O A;  1QUQ A;  1TXY A;  4FXG C;  2PI2 A;  4OHJ A;  3Q22 A;  2RF4 A;  4TVA B;  5C3E H;  2F0Q A;  4KHP Q;  3HOZ B;  4JBJ A;  2EYL A;  5A2Q E;  1BBU A;  3D4R A;  3ERQ A;  4QB4 A;  3JAM i;  1YNJ C;  2VB2 X;  5D3I B;  3STB D;  5JJI A;  2RCF A;  3NTH A;  2JA6 H;  3M4O B;  2F0V A;  1N34 L;  1EIY B;  1VF5 C;  4NXM Q;  4B3R Q;  3IKJ A;  1DON A;  1NUC A;  5A35 A;  2JA7 G;  4PMB A;  4A3C H;  1SYF A;  4I65 A;  4LFA L;  3HGB A;  5CBE E;  1T5E A;  3CCV A;  3CC2 A;  3SGI A;  4JI2 L;  1RCV D;  1N8R C;  4R8N A;  4B3M Q;  3TRZ A;  1RF2 D;  4XQQ A;  2E74 C;  1I6H B;  3QWN A;  2YU9 H;  4A3E B;  4YWM A;  4CKC A;  1SEB D;  3CC4 A;  3PUV A;  3GTJ B;  5COR A;  2IX3 A;  4DNI A;  5I6W A;  3HOW H;  1ET6 A;  3RN2 A;  3K58 A;  3JC6 6;  3I55 A;  1EY6 A;  1I4R A;  2XTI A;  4X62 L;  3V05 A;  3IFD A;  1VQ4 A;  3NK9 A;  3I4M G;  1N34 Q;  3M4P A;  2CFM A;  2EYJ A;  2E2I B;  3QB3 A;  4DR7 L;  1JIC A;  5E3F A;  4XQN A;  4A3J B;  1DYQ A;  5EBD A;  3T51 B;  2HQE A;  2VW9 A;  5I9P A;  2LS0 1;  4HCE A;  2RHQ B;  1D8L A;  3U9S A;  2X69 A;  1VQ5 A;  1E0B A;  2TSS A;  5FJ8 H;  1GJX A;  4L6T B;  2WKD A;  3J80 c;  4DK1 A;  4JI3 L;  1SJH D;  2E2J B;  3KLS X;  2A69 C;  2Z8L A;  1H9M A;  4K5X A;  1LTB D;  4IPH A;  3VYS A;  3RD4 A;  1AZP A;  4IO9 A;  4UP7 A;  3G4S A;  3J81 L;  1HQR D;  2F4I A;  2UU9 Q;  3IAY A;  4ZQ3 A;  3PO3 G;  1WTR A;  1CSP A;  4A3F G;  2UU9 L;  2OWO A;  1CUK A;  4K0K L;  3V2T A;  2ZTD A;  4IPC A;  2CWA A;  2X6L A;  3CAM A;  3K81 C;  3T1Y L;  4A3K G;  3MC0 B;  3M3Y H;  1WCM B;  2RQX A;  3HZX A;  3W1B A;  4Q5V A;  1NY4 A;  1W6J A;  2VB3 X;  4H7B A;  1A0I A;  4JC0 A;  1BUV T;  3CD6 A;  4OON A;  3R93 A;  4LUO A;  2PQA A;  4R1J A;  4HJ5 A;  1DOL A;  2NVY B;  5KEE A;  3ULJ A;  1A62 A;  1K8M A;  1DCZ A;  3MA2 B;  3I4N G;  2E76 C;  4BY7 G;  3IL8 A;  2NZO A;  3KF6 A;  1YI2 A;  3J81 E;  1HR0 L;  1SDF A;  1HZC A;  2K7V A;  3OTO L;  1EU3 A;  1D1I A;  3BDO A;  4KI0 A;  1EY4 A;  4XT3 B;  4LF6 L;  3AFP A;  1TWH B;  1YJW A;  5K5P A;  4LFB L;  1T9H A;  4G7O C;  4B3S L;  2BH8 A;  5CV7 A;  1V1O A;  1A2T A;  1EEI D;  3HOX B;  3DXJ C;  1PYW D;  1B2T A;  1Q7Y C;  1II3 A;  2L1B A;  3GDE A;  5IT9 L;  2NN6 G;  3H94 A;  1JWU D;  1Q1E A;  5HGT A;  2K5Q A;  1YJN A;  2KCC A;  2MHV A;  1SXT A;  1IYU A;  2N78 A;  1CKM A;  1A6X A;  1LM0 A;  3EN2 A;  2UUB Q;  5LMN Q;  4MIU A;  2WAC A;  4LFA Q;  4K8I A;  3BG3 A;  1LO5 D;  4JI5 Q;  3NWT A;  2M9V A;  1MJE A;  4H44 C;  4TKO B;  3Q6S A;  1AEX A;  4OWX B;  4L5Q A;  5IGF A;  1S72 A;  5IWA L;  3PQI A;  2ZJQ A;  1JT8 A;  4C1N I;  3T16 A;  1EOV A;  1X54 A;  3EQL C;  3HOY H;  2QEJ C;  5EGT A;  4JI6 Q;  4HJ7 A;  4A3I H;  1SYB A;  3R2I A;  1X3P A;  1K73 C;  3A55 A;  3U9O A;  2OCE A;  3K57 A;  1ZXT A;  3SDZ A;  5FO7 B;  1ONL A;  4R4I A;  3BJU A;  2A73 B;  3KBG A;  2ZTC A;  4EQ5 A;  1SMX A;  2PNR C;  2Z1C A;  5EKI A;  3MXN A;  1VMC A;  3WOF A;  2JA6 B;  5HUR A;  4QUF A;  1Y1V B;  1EFW A;  4LUV A;  1JOR A;  3KBX A;  1EL0 A;  2L55 A;  3S24 A;  3SK8 A;  4A3B B;  3D3R A;  2KEE A;  2RDG A;  1WD0 A;  2PI2 E;  1VQN A;  1T5X D;  1ESF A;  3HOX H;  4DA2 A;  3TZD A;  5EPK A;  1U4L A;  4RCO A;  3NQT A;  3A54 A;  2BA1 A;  3E9H A;  3HOV H;  4DV7 Q;  5ELC A;  3CPF A;  2V1C C;  3S17 H;  3HKS A;  5ELO A;  3QO2 A;  1RHP A;  3C1F A;  2H4O A;  3KFU A;  4LF8 Q;  3HOU B;  3J81 j;  3HOX G;  5FK9 C;  3DM3 A;  3AMU A;  3GQB A;  5LMN W;  4JBW A;  1PYB A;  4RGN A;  4NDX A;  1IBM Q;  2D62 A;  1XMO L;  1QVF A;  1TWF B;  1VQM A;  5FLX E;  3EVQ A;  3S9W A;  4N9T A;  1BCP F;  3MWY W;  1JOK A;  1QUQ B;  5E1F A;  1Q81 C;  1HQM C;  4CDF C;  2F3W A;  4BXX G;  3K6O A;  3S2H H;  2B2Y C;  4BBS B;  1B53 A;  1CT1 D;  5M3M H;  4DR4 Q;  1OXT A;  4AQY Q;  3HOV B;  2OTJ A;  4Y7N H;  5ISR A;  4A3J G;  3H3V C;  3CP0 A;  2K5V A;  1B50 A;  2L12 A;  1EZ6 A;  1PRT F;  5IY0 A;  4JOI C;  4JI1 L;  4YCW A;  4DR6 L;  2CQA A;  2NYZ D;  4R4C A;  2QIL A;  3J7Z C;  4A76 A;  3K0X A;  2KUM A;  3HS0 C;  4KY5 A;  3WWV A;  1IW7 C;  4LMQ D;  4JYA L;  5CV9 A;  4A3J H;  1N36 L;  1IXR A;  3W5O A;  2B2U A;  2ICI A;  4DR5 L;  1SND A;  4NXN Q;  5KRU A;  3S1M B;  5CV5 A;  5CC4 A;  2FMM A;  4X66 L;  2EXZ A;  4DXG A;  4RG1 A;  2UXB L;  5ELF A;  4NW2 A;  2JA8 H;  2R93 G;  2LMC B;  1I94 Q;  3H09 A;  5IGB A;  1SAP A;  1PZK D;  1EWH A;  4JCV E;  1ENA A;  3T13 A;  4KD3 A;  3PUW A;  4IOA A;  2O2L D;  3JAM E;  4CBV A;  1JOO A;  3PO3 H;  4GN3 B;  3MXU A;  3NSW A;  1TWF H;  2A69 D;  1B4O A;  3UDF A;  1Y8O B;  5IYC G;  2X6G A;  2I07 B;  2B63 B;  1HA5 A;  2EQS A;  2BOS A;  1G2S A;  1PTO H;  1XTD A;  3CCU A;  1I4H A;  2HIX A;  1PH3 A;  2Z6K A;  4LF7 Q;  4DV2 L;  1LT4 D;  4DV1 Q;  1MD2 D;  1HFN A;  4L5S A;  3S1R B;  1HH2 P;  5IYC H;  4DPG A;  3I4N H;  1ICW A;  2MO0 A;  2NVX H;  2JA5 H;  4IOC A;  2XVS A;  3HKZ G;  2JE6 I;  2R7D A;  3NBH B;  1KRS A;  1OO9 B;  2AQ2 B;  5GAE C;  3CCR A;  3CW2 C;  4BY1 B;  3TSS A;  4F8M A;  5CV6 A;  1PXU A;  1SN8 A;  2Z4I A;  1TS3 A;  1W6K A;  1DJR D;  2R92 G;  2FXQ A;  1EWI A;  1F2Y A;  2O5I C;  2F0O A;  1XTC D;  3O13 A;  4NPS A;  1EOT A;  2R3Z A;  3A56 A;  2WB1 B;  2HDL A;  3PUZ A;  2EOT A;  1MI2 A;  5BR8 L;  1QJO A;  3TP5 A;  4BXX H;  5KND A;  4KD4 A;  2ZM6 Q;  4IPG A;  2EIF A;  1C7Y A;  1EY8 A;  3BZD B;  3NE5 B;  4HSP A;  4A3M H;  2ALY B;  3DWQ A;  3J80 E;  5FLM G;  2A8V A;  2NN6 H;  1UE7 A;  5FO9 B;  1AFP A;  3UDG A;  4DK6 C;  4OX9 L;  2XRQ D;  2F03 A;  2ZJR A;  1CTM A;  4PNY A;  1S40 A;  4RWS C;  4Y52 H;  3HG9 A;  5JEA J;  1SNO A;  1PH7 A;  3W1G A;  1O7I A;  3LGJ A;  1CK1 A;  1SR3 A;  5C4J H;  5M3M B;  1ESR A;  2K5W A;  2L4N A;  2D5D A;  1E1O A;  5IYB G;  1G29 1;  3GTG H;  2ZJP A;  1CZW A;  3CCQ A;  2N49 A;  4QF4 A;  4DXF A;  3FKI H;  1XWE A;  2N3S A;  3N6R A;  1U4P A;  1BR9 A;  2K03 A;  1TII D;  2R93 H;  4JI2 Q;  4OWT B;  3STB C;  5AFW A;  2SDF A;  3CKI B;  5F2D A;  1YNJ D;  3TDQ A;  4EVO A;  2BH2 A;  3RNU A;  4WJ3 M;  3F2D A;  2L15 A;  2EPB A;  3T1H Q;  1QVG A;  4OL7 A;  2IPK D;  4MTK A;  1BBW A;  1CHQ D;  1X6O A;  2ES2 A;  2ZTE A;  2VZA A;  1WTP A;  3GV3 A;  3CMA A;  4GLX A;  3S2H B;  2I46 A;  3LNN A;  2HHH Q;  1HNW L;  2FIN B;  2VQF Q;  1EYA A;  4DAY A;  1CKN A;  4JV5 L;  1GO3 E;  4HMI A;  3B6Y A;  4A3F B;  4ZAI A;  1SFO H;  3ERO A;  3KF8 B;  1B7Y B;  4EQN A;  4CDD C;  2RKS A;  3VR5 A;  1XMQ Q;  4ZK9 B;  2IHE A;  1BKB A;  2K6A A;  2G9D A;  3J7A F;  3BVG A;  3K0Y A;  2GN5 A;  1LTG D;  1JWS D;  4BBR H;  2E5L Q;  3HOU H;  2C35 B;  2F0U A;  4DV5 Q;  4IUV A;  1I4G A;  1TWG B;  2LSS A;  1MBY A;  3MFG A;  5I4D A;  5CV4 A;  1K8G A;  4A3D G;  1I50 H;  2K28 A;  1IBL L;  3SE0 A;  1K3R A;  3BZC A;  4JBM A;  1EQV A;  4RGO S;  4C3I G;  4GN4 B;  3K5N A;  4ZUI A;  2JJQ A;  3T53 B;  5AJ3 L;  4LF4 Q;  4EQO A;  1EQT A;  1X3Q A;  2F0F A;  4GKK Q;  4B3T L;  2VUM B;  4DAV A;  1B1Z A;  2RSO A;  3PO2 B;  1CKN B;  4IFD H;  2F0N A;  4K14 A;  3QR8 A;  1O7L A;  3H0G G;  3NTI A;  2C5C A;  3R3O A;  3A5Z B;  3VR4 A;  5C4Z A;  1ZKO A;  3G7L A;  1I4X A;  1HTP A;  5IOC A;  4IUU A;  1IHZ A;  1DOK A;  1PRT B;  1CA6 A;  1ROD A;  3TRE A;  3E9I A;  1FGB D;  4QCL A;  3C2P A;  4F87 A;  1J9O A;  3K59 A;  1PZJ D;  4A3B H;  3NTK A;  2Q8T A;  1D2B A;  4JOI A;  4HJA A;  4XXE A;  1UWV A;  5IYB H;  1F9S A;  2RDH A;  4DV4 Q;  1JOQ A;  1DD2 A;  2J0T D;  2EYP A;  3FMC A;  4JV5 Q;  3MEH A;  4A93 B;  1PTO B;  4N8F A;  2ZXR A;  3GTQ H;  1STE A;  1D5Z C;  1Y1W B;  2B2Y A;  4AYB B;  5C4X G;  1HNW Q;  1S5E D;  1BBX C;  1AE3 A;  1GHJ A;  1BQQ T;  3A8K E;  4ULL A;  3U50 C;  1GVP A;  3TME A;  1MGS A;  4J15 A;  1S5C D;  3E5S A;  1YZ6 A;  4A3G B;  1QVC A;  4JI4 Q;  4C3J H;  1F9Q A;  4IUT A;  2KEC A;  4K2L A;  1HNX Q;  5GQO A;  4KJN A;  1HCZ A;  1ILQ A;  2NUC A;  4DUZ L;  3LX0 A;  2PYK A;  1YJ9 A;  1TY0 A;  4IAL A;  1JJ2 A;  3QJY A;  3AEV A;  3I4N B;  2H1E A;  1JC7 A;  3T56 B;  4HMJ A;  3L3O C;  4G4K A;  3J7A 5;  1Q8K A;  4X3K A;  4PZ6 A;  3DM1 A;  2OEO A;  1YNN C;  4R8I A;  1IW7 D;  4RGT A;  1SLJ A;  4JI7 Q;  3KJO A;  2MUY A;  1WTO A;  1H9S A;  1AP0 A;  2Z6B A;  3BYY B;  5FLX c;  1EUJ A;  1YVC A;  5ELD A;  5EBC A;  1WCM H;  3A7A B;  1M8A A;  2AQ3 B;  3FHW A;  4HCS A;  1AN8 A;  5IT9 E;  4LK1 C;  1KLG D;  1RDP D;  1E3P A;  2HD3 A;  1LT3 D;  1PFB A;  2K33 A;  4IQZ A;  4C3H G;  5M3F H;  1ET9 A;  4QL5 A;  2A68 C;  2EYH A;  3J80 i;  1CHP D;  2EY2 A;  4C56 C;  4UDU C;  3VR6 A;  5CV8 A;  5IP7 G;  4Y7N B;  4ZLT F;  5JPM C;  2V4D A;  1LV9 A;  4QQB X;  4IUN A;  3AYH B;  4LF9 L;  3Q8D A;  3K5L A;  1TWG H;  3LWE A;  3RLN A;  1LT5 D;  4A3L H;  1K0R A;  3TP8 A;  3DMU A;  1CKO A;  2CKZ B;  1KAA A;  4FF3 A;  3ICE A;  3PF5 A;  1SNP A;  4YCV A;  1XPU A;  4H0L C;  3E3X A;  4NB3 A;  3OIQ A;  1M4V A;  1PFM A;  1V8Q A;  2WAQ E;  3CC7 A;  1EWC A;  2F4V Q;  2L9H A;  1FNU A;  1RL2 A;  1JR0 D;  4X64 Q;  2LKV A;  4FYD A;  1ZEQ X;  1DM0 B;  3MZ5 A;  3A7L A;  4P72 A;  1YHB A;  4FXD A;  2E2I H;  4CJ1 B;  3S2D B;  3WOE A;  2K4K A;  2EZV A;  1GUW A;  1EEF D;  2JN4 A;  1JCK B;  2TMP A;  2BE5 D;  3DEO A;  3HKZ E;  2F0P A;  5EAY A;  3KUP A;  1VF7 A;  2JXM B;  1Q3L A;  2B2V A;  4KHZ A;  2G9H D;  4DU9 A;  1WTV A;  2PZT A;  2YU9 B;  4GKJ Q;  1KD1 C;  4OEM B;  1JWM D;  4G7Z C;  1VQ6 A;  2UXD Q;  3MVV A;  1RKN A;  2K1B A;  1LTA D;  2F0H A;  2Z6K C;  3UE1 A;  3E0J A;  1IBK L;  4AYB E;  1VQ7 A;  4PV1 C;  4R4Q A;  4GN5 A;  1I94 L;  3GTP H;  4JI8 Q;  2DGY A;  4G7H C;  2JA7 H;  3K5M A;  4IPD A;  3K7A H;  2L11 A;  2JA9 A;  3J81 i;  2B2W A;  3J7Y W;  1PFN A;  4U67 3;  4OO1 I;  4FP5 D;  2K05 A;  1ZYR D;  2EDG A;  4YHH Q;  4A3I B;  1SNC A;  4A3M B;  4RMF A;  4WRD A;  4GS3 A;  4ZCK A;  4DR3 L;  4XDX A;  1SYD A;  2RVL A;  1E24 A;  4LF5 L;  2HCI A;  1VQ9 A;  1JJC B;  3CCM A;  2OF1 A;  5ELE A;  4JI1 Q;  4V19 0;  4IJL A;  4BBR G;  1SMY D;  4BBS G;  1Y1W H;  4Z9C B;  2AUK A;  3NQI A;  4DR1 L;  1TWA H;  3PUY A;  4C3I B;  1FJG L;  2XWB B;  4DR4 L;  1GUS A;  1M90 C;  2G5D A;  3CRL C;  2NVQ B;  3DWA A;  1PFS A;  2HT1 A;  3S16 H;  5IP7 H;  4H02 A;  4B9W A;  4MN3 A;  1PLF A;  3WDN A;  2KBN A;  2F0K A;  1F9R A;  4GKJ L;  2OXP A;  2NVX B;  3CQZ H;  4C2M H;  2IWH A;  4UP9 A;  4TSS A;  5A2Q L;  2QW7 A;  1PH6 A;  5HY6 A;  2YYZ A;  4DAY B;  3ER0 A;  2VL6 A;  4KTA A;  2EYM A;  1HA6 A;  1SRO A;  3FP9 A;  1BNZ A;  1N33 L;  2RHS B;  3L2P A;  1U0L A;  1O80 A;  1N32 Q;  2PW5 A;  2O5J C;  1B70 B;  4APV A;  1C8C A;  1MJC A;  1TWH H;  2D2C C;  4ALP A;  3TN2 A;  4OIK A;  4L8J A;  1ILP A;  4KJO A;  4IUR A;  2F1M A;  1EYD A;  5M9O A;  1XNR L;  5H1S E;  4FDB A;  3MAQ A;  5C3E G;  1A2U A;  4GLV B;  2WFW A;  1KIX A;  3HRZ C;  4A3F H;  4GNX A;  5FO8 B;  2LY7 A;  1VQO A;  1WJJ A;  3FRP B;  5GAH C;  5AJ3 Q;  2UUA Q;  2DJG C;  3RZO H;  1XNR Q;  1OTC A;  4ME3 A;  2CCZ A;  3M4Y A;  3HOV G;  4QIW B;  2A68 D;  1QG7 A;  1H9R A;  3N52 A;  4A3C G;  1A3T A;  1IZ6 A;  3D6W A;  3S1M H;  3FDT A;  1MIU A;  1V1Q A;  1XNQ L;  1PRT D;  1D1K A;  2Y0S E;  4HID A;  2K5H A;  1N33 Q;  1BF4 A;  3BU2 A;  1XPO A;  1VMP A;  3M9B A;  3RZO B;  4A3E G;  1SE4 A;  2B8G A;  3CF5 A;  3ERS X;  2ENB A;  1YNN D;  3F2C A;  2K5D A;  1UUP A;  3SK5 A;  5I9O A;  1GUN A;  4QJF A;  3U4V A;  1Z6H A;  4HJ8 A;  2XSC A;  4KKU A;  1STH A;  3EA6 A;  4P73 A;  4LW1 A;  1PH9 A;  3UDX A;  2EXD A;  4RHS A;  3PIP A;  4A75 A;  5IP9 H;  3H0G B;  3GD7 A;  3SK4 A;  3T1H L;  4J1M A;  4KMU C;  3I4O A;  2I0Q A;  1QNK A;  2NN6 I;  2XGT A;  5LMN L;  3G6E A;  5M5X B;  2WB1 E;  2PCF B;  4FO2 A;  3I8Z A;  2AMC B;  4GOP B;  5CGK A;  3J80 L;  5EKK A;  3V96 A;  4HJ9 A;  3URY A;  4C3H H;  2KCT A;  4IUQ A;  3Q0A A;  4X3S A;  1FNV A;  3A8I E;  1YHA A;  3PMF A;  1NR4 A;  1R4Q B;  4DV6 L;  2KED A;  3U4Z A;  1PHJ A;  1EIF A;  2PQE A;  2Z9H A;  5EPJ A;  5IGC A;  4MNO A;  4IJH A;  2Z4H A;  4ILW A;  4PZ7 A;  4N9P A;  3S15 B;  5KNB A;  3M4O H;  1VQG A;  1DGS A;  3NHH A;  2EY5 A;  1Y1V G;  3I91 A;  4BY1 H;  4BS9 A;  3UI2 A;  1IBK Q;  2CWP A;  3GTK B;  2Q8R E;  2A1A A;  4O2D A;  3MXG A;  3H6M A;  5LL6 S;  4IN3 A;  2F0W A;  1NNX A;  1SYG A;  4A3I G;  3RZD B;  5C3W A;  5FKA C;  2UXC L;  1JB7 A;  2E75 C;  3D4D A;  1B8A A;  5GAG C;  2JSO A;  5IGD A;  2JA8 G;  3CCE A;  2GA4 B;  2EE1 A;  1SNM A;  1Y1V H;  4JVZ A;  4A3K B;  4V0B A;  4X3U A;  3SHL A;  2QF7 A;  3PV0 A;  3KJP A;  2IT1 A;  2PMZ E;  1BCP C;  2NTT A;  1VQD A;  3ULL A;  4HAE A;  3PUX A;  4UY8 C;  1EY9 A;  2KOL A;  2JQO A;  3FVQ A;  4OEL B;  1JJG A;  4IFD J;  5LHY 1;  1JMC A;  1G8Z D;  3K7U C;  3HOZ H;  3KK7 A;  4X64 L;  3OIP A;  4CGY B;  1Y69 U;  4H13 C;  4KKT A;  1I6H H;  1V1P A;  4GNX B;  5I2X A;  3S16 B;  4XT1 B;  2I5M X;  1AW7 A;  1UAP A;  3I90 A;  3QOJ A;  3MXP A;  1S5D D;  4IUP A;  1BCP B;  4P74 A;  3VYU A;  2JA8 B;  1N9W A;  1STG A;  3MXN B;  3S15 H;  4J6H A;  4A3D B;  4DV5 L;  4HIK A;  2KA7 A;  5JPN C;  3GTP B;  2B63 G;  5IT9 c;  1N32 L;  3A0J A;  5C44 H;  4LWC A;  1TU2 B;  2WAQ G;  2CHB D;  3C46 A;  1HNZ L;  5LMU L;  1DZ1 A;  2OT2 A;  3NEM A;  1QCB D;  2KCM A;  3OSO A;  3TP6 A;  4OXP A;  1Q82 C;  1BVS A;  2R61 A;  2EJM A;  4XIG S;  5IP9 G;  1CQV A;  1NAP A;  1R4P B;  3A74 A;  1PZI D;  1PDQ A;  2VQF L;  1RTN A;  4FXK C;  4WJ4 A;  4JK1 C;  2MPM A;  2HUG A;  3PIP 3;  3K7A B;  2J4X A;  1PYS B;  3DUZ A;  1WTH A;  1FL0 A;  4A4I A;  1PV4 A;  1IKM A;  2Y0S G;  4HR7 B;  2Q2H A;  2NVT B;  5C0X H;  4BA2 I;  1JQY D;  1FVI A;  2DJF C;  3U58 A;  4JI7 L;  1H95 A;  1TWC B;  3CME A;  4X66 Q;  3CPW A;  1SYE A;  5C0X I;  2B2U C;  3NXW A;  5J22 A;  2JEB I;  2F0G A;  4DK3 C;  3I3C A;  2IW3 A;  1C0A A;  3RN5 A;  4KY7 A;  4JI0 L;  1VQB A;  4DV6 Q;  2D0O A;  1EYC A;  3I4L A;  3ITP A;  4C3H B;  1KQS A;  5I6Y A;  4GOP A;  5T1I A;  1STA A;  3HP3 A;  2B2T C;  1WOC A;  4NMZ A;  2M2L A;  1PTO F;  3VA5 A;  3SR1 A;  2NVY H;  2LFN A;  4JI4 L;  5LL6 X;  2ZT9 C;  1B3A A;  4DR6 Q;  1BOS A;  2XN9 C;  3CCL A;  2JA6 G;  4L63 B;  1HFG A;  1TVX A;  3F8T A;  1U4M A;  3VDY A;  3S17 B;  5JVG 3;  2NVT H;  3J81 c;  5JJL A;  4ZKC B;  1XPR A;  5K36 H;  1O78 A;  4A3G G;  4OX9 Q;  4CDC C;  3GP7 A;  3OYY A;  2GVA A;  2VNU D;  4QIW E;  1SFO B;  4KY6 A;  4RA8 A;  1HNZ Q;  2ID0 A;  5BR8 Q;  3FPP A;  5KNC A;  1WCM G;  1IBM L;  2F0M A;  4LJZ C;  5K36 G;  3HOU G;  3GTG B;  3NBI A;  2N8N A;  2A6H D;  5GAD C;  1IYV A;  4JPB W;  1YHQ A;  1ASZ A;  4DKA C;  4ODG A;  4A3D H;  2PPB C;  1ICF B;  1PRT C;  5HGQ A;  3TS0 A;  1VQI A;  2F4V L;  2QEX A;  2MJ8 A;  1WYD A;  2UUA L;  1B9N A;  1KLU D;  2BDO A;  3EFX D;  3CCJ A;  1X3F A;  1YEZ A;  1WTW A;  2QKI C;  3HOY B;  1PTO D;  3F2U A;  3VYR A;  1K9M C;  5EQ0 A;  4B9X A;  4DV1 L;  3S1N H;  2ZXP A;  4DV2 Q;  4C3I H;  4DAP A;  1LAB A;  4RHR A;  2SEB D;  4UPA A;  2SNS A;  3ONA B;  2HQL A;  1VQH A;  3L0O A;  4IZ8 A;  1FYC A;  2R92 H;  5M3M G;  3CRK C;  3I7F A;  4HN7 A;  1V43 A;  3P7J A;  1MHW C;  3MTS A;  1E2Z A;  2PW7 A;  2P5Z X;  4YIJ A;  4IFD G;  2UXC Q;  3RLF A;  1E2V A;  5JAV A;  3PGZ A;  3BDC A;  4EQP A;  1VCI A;  4A3B G;  3GV6 A;  1Q1B A;  3OOC A;  1GOZ A;  2C9O A;  2WKC A;  1OXV A;  1LTS D;  1BO0 A;  2F0I A;  3NWS A;  4OGQ C;  3I4M B;  2SNM A;  4UHV A;  4ID6 A;  1A15 A;  1AH9 A;  1F77 A;  4DR1 Q;  1TWA B;  4ZRZ A;  2PZU A;  2DY8 A;  5L37 A; 
#chains in the Genus database with same CATH homology
 3S14 H;  3HKZ E;  1LYL A;  1R9T H;  5EAY A;  1A8V A;  1CSQ A;  1P8L A;  4LUV A;  1EFW A;  4LF5 Q;  2UXD L;  1HR0 Q;  3S24 A;  1WFQ A;  2OQK A;  4KHZ A;  4GKJ Q;  1VQN A;  2PI2 E;  1D7Q A;  1KD1 C;  3RZD H;  1VQ6 A;  2I5L X;  2UXD Q;  3KF6 B;  4UP8 A;  4YHH L;  4OO1 G;  1WI5 A;  3HOX H;  1W3S A;  2R6G A;  2Z6K C;  3UE1 A;  1IBK L;  1VQ7 A;  5J3B A;  4AYB E;  3BZK A;  2Q2U A;  2BA1 A;  3E9H A;  3GO5 A;  1X9N A;  3HOV H;  4DV7 Q;  4R4Q A;  1PVO A;  1C9O A;  3CPF A;  3EIV A;  4GLA C;  4GN5 A;  2V1C C;  5GRO A;  3A5U A;  1KC8 C;  1I94 L;  2IX1 A;  1L0W A;  3GTP H;  3S17 H;  3HKS A;  3S1Q H;  5ELO A;  4JI8 Q;  2DGY A;  4DUY L;  2JA7 H;  3KFU A;  3I4M H;  4IPD A;  3EBE A;  3K7A H;  2AHO B;  1J5E Q;  4LF8 Q;  3NEN A;  3I56 A;  1VQE A;  4DV7 L;  3J81 j;  3HOX G;  4LF6 Q;  2JA9 A;  3J81 i;  3DM3 A;  5LMN W;  1Q46 A;  2IX0 A;  2R7F A;  4X65 L;  1X3E A;  4JBW A;  1XJV A;  4OO1 I;  1PYB A;  3K8A A;  4A3E H;  1NMF A;  2VQE L;  1PH2 A;  1IBM Q;  2MNA A;  2D62 A;  4DV3 Q;  5IYD H;  1XMO L;  4YHH Q;  1QVF A;  2R7Z H;  1VQM A;  4TQU S;  1RIP A;  5M3F G;  4RMF A;  4GS3 A;  4L5T A;  3TQY A;  4DR3 L;  4JG2 A;  1VQ8 A;  1QUQ B;  2ATW A;  1Q81 C;  1V9P A;  5M5Y H;  1E24 A;  4LF5 L;  4LF8 L;  1VQ9 A;  4BXX G;  1JJC B;  3CCM A;  2OQ0 A;  3GTM H;  4JI1 Q;  3S2H H;  1L1O B;  4IJL A;  3PIO A;  4BBR G;  2A19 A;  1X3G A;  4BBS G;  1Y1W H;  5M3M H;  4DR4 Q;  1GD7 A;  1W2B A;  1GKH A;  4DR1 L;  4JI3 Q;  2WP8 J;  1TWA H;  1OXT A;  4AQY Q;  3PUY A;  2QA4 A;  2OTJ A;  4Y7N H;  4A3J G;  1FJG L;  3CP0 A;  3GTJ H;  2B63 H;  4DR4 L;  1M90 C;  3F2B A;  2K5V A;  2I5H A;  4YY3 L;  5IY0 A;  1PFS A;  3D31 A;  4JOI C;  4JI1 L;  4YCW A;  5IP7 H;  2HT1 A;  3S16 H;  4DR6 L;  4H02 A;  4P75 A;  4R4C A;  4B3T Q;  1SRU A;  2KBN A;  3J7Z C;  4A76 A;  3K0X A;  1AE2 A;  1KRT A;  3WWV A;  4A3M G;  4LF4 L;  4IFD I;  1I5F A;  4GKJ L;  3CQZ H;  4C2M H;  4UP9 A;  3ZJY C;  3CCS A;  4JYA L;  1PH6 A;  5HY6 A;  2YYZ A;  1NMG A;  3ER0 A;  3KDF A;  2VL6 A;  4DAY B;  1FGU A;  4A3J H;  4DR7 Q;  1SRO A;  1N36 L;  4DV3 L;  1IXR A;  3W5O A;  2VQE Q;  3FP9 A;  3DLL A;  2UXB Q;  1N33 L;  3PF4 A;  4DR5 L;  1X56 A;  4O0A A;  4X65 Q;  2RHS B;  2NZH A;  3L2P A;  1U0L A;  4NXN Q;  1N32 Q;  1B70 B;  4MTN A;  3FKI G;  4APV A;  1MJC A;  1NTG A;  1TWH H;  2RCN A;  2MO1 A;  1J5E L;  4X66 L;  1JE5 A;  4ALP A;  1UE6 A;  4RG1 A;  2F3I A;  4JI5 L;  4DUY Q;  1ASY A;  2JA8 H;  2UXB L;  1K83 H;  3L7Z C;  4JBK A;  2R93 G;  1G6P A;  1I94 Q;  1OXX K;  2IHF A;  4JCV E;  1HZA A;  3HFZ B;  4JYA Q;  2VUM H;  1HNX L;  4IOA A;  2K52 A;  3PUW A;  1YIJ A;  5H1S E;  3OW2 A;  4FDB A;  2H5X A;  1XNR L;  4BY7 H;  1NJI C;  3NEL A;  5C3E G;  4GLV B;  1KIX A;  2WFW A;  3PO3 H;  4GN3 B;  4A3F H;  1TWF H;  4GNX A;  1QZG A;  4B3M L;  5M5X H;  1VQO A;  1WJJ A;  3UDF A;  1PH5 A;  3TEH B;  5GAH C;  5AJ3 Q;  5IWA Q;  4R4O A;  4X6A H;  2UUA Q;  2KEN A;  3RZO H;  1XNR Q;  1EQQ A;  1OTC A;  4ME3 A;  2CCZ A;  2B29 A;  5IYC G;  2Q2I A;  1KHI A;  3HOV G;  2VUM G;  1EQR A;  4PG3 A;  4KLK A;  2EQS A;  4A3C G;  2AWO A;  4OWW B;  1XTD A;  4LFB Q;  1IZ6 A;  3CCU A;  2HIX A;  3KOJ A;  1E7Z A;  1PH3 A;  4EX5 A;  2UUC Q;  3S1M H;  2Z6K A;  1VQA A;  1MIU A;  4XTC S;  4AIM A;  4LF7 Q;  4DV2 L;  1KL9 A;  1S3O A;  1VQF A;  1V1Q A;  1QZH A;  1XNQ L;  4DV1 Q;  4DR3 Q;  4PMW A;  1VQK A;  4NXN L;  4L5S A;  2Y0S E;  4HID A;  2K5H A;  1N33 Q;  3BU2 A;  1HH2 P;  5IYC H;  3M9B A;  2CQO A;  5C0X J;  4A3E G;  1UE5 A;  4DPG A;  1XPO A;  1OXS C;  1N36 Q;  3I4N H;  2MO0 A;  3CF5 A;  4DUZ Q;  3ERS X;  4L5R C;  2NVX H;  3K80 C;  2JA5 H;  1MKH A;  2E2H H;  4IOC A;  3I2Z A;  3F2C A;  4JI0 Q;  3HKZ G;  1VQP A;  1UEB A;  1HR0 W;  2JE6 I;  2R7D A;  3NBH B;  1KRS A;  5GAE C;  3CCR A;  4QJF A;  3CW2 C;  1X65 A;  3U4V A;  1SN8 A;  4YY3 Q;  4HJ8 A;  3M85 A;  2R92 G;  2VS1 A;  1L1O C;  2FXQ A;  4POF A;  1EWI A;  4P73 A;  4LW1 A;  1PH9 A;  2YV5 A;  3UDX A;  2EXD A;  4NPS A;  3PIP A;  4AQY L;  4LFC Q;  4A75 A;  2E8G A;  5IP9 H;  3CXC A;  5C44 G;  4A3L G;  3PUZ A;  4POG A;  3GD7 A;  4YWL A;  3OTO Q;  5FJ8 G;  2D0P A;  3T1H L;  1YIT A;  3PO2 H;  2VY3 A;  4QY7 A;  3I4O A;  5BR8 L;  1YBY A;  2I0Q A;  3IRB A;  1VQL A;  1P16 A;  4BXX H;  4DV4 L;  2NN6 I;  2XGT A;  3HOY G;  1X55 A;  5LMN L;  2ZM6 Q;  1HJP A;  2EIF A;  4IPG A;  2WB1 E;  3G6E A;  4DV0 L;  1C7Y A;  4A3M H;  3TS2 A;  2ALY B;  2AMC B;  1G51 A;  5FLM G;  2BA0 A;  4GOP B;  1N32 L;  4DV0 Q;  2A8V A;  1UE7 A;  2ZM6 L;  4HJ9 A;  1Z9F A;  5LMU Q;  3UDG A;  1HZ9 A;  4DK6 C;  1NBW A;  4C3H H;  4OX9 L;  2KCT A;  1XMO Q;  3ULP A;  1EYG A;  3AQQ A;  4BY1 G;  4KHP L;  3RR5 A;  5DLQ E;  1YHA A;  2DUD A;  2ZJR A;  3M7N A;  4DV6 L;  1S40 A;  3PO2 G;  3M4Q A;  3U4Z A;  3JAM c;  1EIF A;  1PHJ A;  4Y52 H;  2K75 A;  3H3V H;  5JEA J;  4MNO A;  4IJH A;  4PZ7 A;  3H0G H;  3RLO A;  1PH7 A;  3W1G A;  4DR2 Q;  2MQH A;  1O7I A;  3LGJ A;  1A63 A;  3H3V I;  4A93 H;  5C4J H;  1SR3 A;  1VQG A;  2PQA B;  1DGS A;  3M4O H;  4DR2 L;  1Y1V G;  1E1O A;  5IYB G;  1G29 1;  4A3K H;  4BY1 H;  3GTG H;  2ZJP A;  3T1Y Q;  3CCQ A;  2N49 A;  1GM5 A;  1IBK Q;  2CWP A;  1QUQ A;  1TXY A;  2A1A A;  4O2D A;  2PI2 A;  2RF4 A;  4TVA B;  5C3E H;  3FKI H;  3GTL H;  4A3I G;  1UE1 A;  2N3S A;  4KHP Q;  4JBJ A;  2UXC L;  1JB7 A;  4A93 G;  5IE8 A;  4A3D G;  1B8A A;  5GAG C;  1BBU A;  2JA8 G;  3JAM i;  3CCE A;  2R93 H;  4JI2 Q;  4OWT B;  1Y1V H;  3STB C;  3D0F A;  3STB D;  3PV0 A;  2Z0S A;  3KJP A;  3RNU A;  2BH2 A;  4LF9 Q;  5JJI A;  2AKW B;  3F2D A;  2IT1 A;  2L15 A;  2PMZ E;  1N34 L;  2YTV A;  3T1H Q;  1QVG A;  1EIY B;  4NXM Q;  2JA6 H;  4B3R Q;  2JA7 G;  1IBL Q;  1VQD A;  3ULL A;  4A3C H;  3PUX A;  4UY8 C;  4AYB G;  1BBW A;  2ES2 A;  1X6O A;  4LFA L;  2ZTE A;  2VZA A;  3CCV A;  3CC2 A;  2JQO A;  3CMA A;  3SGI A;  4GLX A;  4JI2 L;  1JJG A;  3MEF A;  1HNW L;  2HHH Q;  4IFD J;  1JMC A;  2VQF Q;  2KHI A;  1N8R C;  3KDF B;  1CKN A;  4JV5 L;  1GO3 E;  4B3M Q;  1Q12 A;  3K7U C;  3TRZ A;  3HOZ H;  4X64 L;  3B6Y A;  3KYH C;  2JA5 G;  1SFO H;  1VQC A;  2YTY A;  1I6H H;  3KF8 B;  1OXU A;  1K8A C;  1B7Y B;  4GNX B;  2YU9 H;  1XMQ Q;  2OTL A;  2I5M X;  4YWM A;  3G48 A;  4JI6 L;  2IHE A;  1BKB A;  3CC4 A;  3PUV A;  2GN5 A;  1M1K C;  4P74 A;  4BBR H;  1N9W A;  4DNI A;  2E5L Q;  3HOU H;  2C35 B;  4X62 Q;  4DV5 Q;  3RN2 A;  3HOW H;  3JC6 6;  3I55 A;  3MXN B;  2LSS A;  3S15 H;  2XTI A;  4P71 A;  4X62 L;  4DV5 L;  4HIK A;  1K8G A;  1I50 H;  1KAW A;  1IBL L;  5IT9 c;  1VQ4 A;  3A0J A;  2UUC L;  4DR5 Q;  2B63 G;  5C44 H;  2E2J H;  4LWC A;  3I4M G;  2WAQ G;  1K3R A;  3M4P A;  3BZC A;  2CFM A;  1N34 Q;  4JBM A;  1PH4 A;  2MFI A;  2QGQ A;  4DR7 L;  1HNZ L;  5LMU L;  2B3G A;  3PSI A;  4GN4 B;  1E22 A;  3NEM A;  2VW9 A;  4GOP C;  5C0X G;  2KCM A;  2JJQ A;  5AJ3 L;  4LF4 Q;  2RHQ B;  1I3Q H;  1D8L A;  3F1Z A;  5IYD G;  4OXP A;  1NE3 A;  1BVS A;  1Q82 C;  1Q86 C;  4XIG S;  4B3T L;  2R7Z G;  5IP9 G;  1VQ5 A;  4GKK Q;  3A74 A;  5FJ8 H;  2VQF L;  3PCO B;  2NVQ H;  1CKN B;  2GVB A;  4WJ4 A;  2K5N A;  3J80 c;  1SE8 A;  1PYS B;  1FL0 A;  4JI3 L;  4A4I A;  1PV4 A;  2Y0S G;  4B3S Q;  2Q2H A;  3H0G G;  4NXM L;  4BA2 I;  3A5Z B;  1FVI A;  3U58 A;  1Y1W G;  4LUZ A;  4JI7 L;  4B3R L;  1H95 A;  3CME A;  4X66 Q;  3CPW A;  5C0X I;  4IPH A;  2JEB I;  4DK3 C;  1C0A A;  4IO9 A;  3RN5 A;  4JI0 L;  1VQB A;  4UP7 A;  3G4S A;  4DV6 Q;  1Y14 B;  3GTO H;  2D0O A;  3TRE A;  3E9I A;  2UU9 Q;  3PO3 G;  3UDI A;  4YCU A;  1CSP A;  2F52 A;  4A3F G;  1KQS A;  1CUK A;  4GOP A;  2UU9 L;  2OWO A;  2ZTD A;  1YNX A;  4A3B H;  4IPC A;  4K0K L;  3GTK H;  2CWA A;  4GNX C;  3S1R H;  1WOC A;  3CAM A;  3K81 C;  4JOI A;  1XNQ Q;  4HJA A;  3T1Y L;  1UWV A;  5IYB H;  2NVY H;  1L2F A;  4A3K G;  4JI4 L;  4A3G H;  3M3Y H;  4DV4 Q;  4DR6 Q;  2WB1 G;  3CCL A;  2K50 A;  4JV5 Q;  3W1B A;  2JA6 G;  1NY4 A;  3GTQ H;  5C4X G;  1HNW Q;  1A0I A;  2LXK A;  1LTL A;  4JC0 A;  1AE3 A;  3F8T A;  3CD6 A;  4OON A;  2HIV A;  4LUO A;  3VDY A;  3AFQ A;  2PQA A;  3U50 C;  1GVP A;  2Q2T A;  4R1J A;  2NVT H;  3J81 c;  4HJ5 A;  4J15 A;  5JJL A;  1XPR A;  4AH6 A;  4A3G G;  1YZ6 A;  3ULJ A;  4OX9 Q;  4GKK L;  1A62 A;  3I4N G;  1QVC A;  3HOZ G;  4JI4 Q;  1KXL A;  4WJ3 M;  4C3J H;  3OYY A;  4HIO A;  4BY7 G;  1U5K A;  3H15 A;  3G71 A;  2GVA A;  2NZO A;  4QIW E;  1HNX Q;  2VNU D;  5GQO A;  3KF6 A;  1YI2 A;  1HR0 L;  4K0K Q;  4DUZ L;  1HNZ Q;  1E1T A;  1YJ9 A;  2ID0 A;  5BR8 Q;  1JJ2 A;  3AEV A;  5M5W H;  1HZC A;  1J6Q A;  1WCM G;  1IBM L;  1PA6 A;  3OTO L;  5K36 G;  3J7A 5;  4KI0 A;  3HOU G;  4LFC L;  1Q8K A;  2K14 A;  4PZ6 A;  3AFP A;  4LF6 L;  4LF7 L;  2N8N A;  1YJW A;  3S2D H;  5GAD C;  4LFB L;  2E5L L;  1YHQ A;  1SLJ A;  1T9H A;  4DKA C;  3KJO A;  1ASZ A;  4JI7 Q;  4DAM A;  4A3D H;  5FLX c;  1EUJ A;  3UE0 A;  4B3S L;  5HGQ A;  1YVC A;  2BH8 A;  3TS0 A;  1XMQ L;  1VQI A;  1WCM H;  2JEA I;  2F4V L;  1Z47 A;  1Q7Y C;  1IL2 A;  3E0E A;  3FHW A;  2QEX A;  1WYD A;  2UUA L;  3GDE A;  5FLM H;  3CCJ A;  1PH1 A;  2NN6 G;  1X3F A;  1Q1E A;  1E3P A;  1YEZ A;  1YJN A;  3HOW G;  5M3F H;  4HIM A;  2AWN A;  4QL5 A;  4LNQ A;  3J80 i;  1K9M C;  2HHH L;  4DV1 L;  3S1N H;  5E7N A;  2N78 A;  1CKM A;  1LM0 A;  3EN2 A;  2JK8 A;  4DV2 Q;  5LMN Q;  2UUB Q;  1FJG Q;  4PZ8 A;  4C3I H;  5IP7 G;  4LFA Q;  4UPA A;  5JJK A;  3KLW A;  4QQB X;  2HQL A;  1VQH A;  3L0O A;  4MZ9 A;  4JI5 Q;  1LUZ A;  4BBS H;  2R92 H;  5M3M G;  3AYH B;  3I7F A;  3Q8D A;  4LF9 L;  1HZB A;  1TWG H;  1V43 A;  4BA1 I;  1PH8 A;  1MJE A;  3RLN A;  2UUB L;  2ASB A;  4OWX B;  2KHJ A;  4L5Q A;  4A3L H;  1K0R A;  1S72 A;  5IWA L;  4IFD G;  1VQJ A;  2YTX A;  2ZJQ A;  2LXJ A;  1CKO A;  2CKZ B;  1JT8 A;  2UXC Q;  1EOV A;  3RLF A;  1X54 A;  3ICE A;  3HOY H;  4JI6 Q;  4HJ7 A;  4A3I H;  3PF5 A;  3PGZ A;  2PNH A;  4YCV A;  1VCI A;  1XPU A;  4A3B G;  4YWK A;  1Q1B A;  4NB3 A;  3CC7 A;  2WAQ E;  1K73 C;  2OCE A;  1VS0 A;  1IYJ B;  2F4V Q;  1RL2 A;  1OXV A;  5ELN A;  4X64 Q;  5JEA G;  4QGU A;  4R4T A;  4P72 A;  1YHB A;  4R4I A;  4JI8 L;  2E2I H;  1TWC H;  3BJU A;  2IY5 B;  1L1O A;  5C4X H;  1AH9 A;  2ZTC A;  2K4K A;  4EQ5 A;  1SMX A;  4DR1 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...