3D0FA

Structure of the big_1156.2 domain of putative penicillin-binding protein mrca from nitrosomonas europaea atcc 19718
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
NAYRGPEAFLKLPKDLKDREALQDIMQDIGNSDDILAAVVLSATPGAVEAFRKNGETIRITGDGLKAAHRFLSNDPKIGEKRIRPGALIRVKKTEKGSWQIVQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the BIG_1156.2 domain of putative penicillin-binding protein MrcA from Nitrosomonas europaea ATCC 19718.
rcsb
source organism Nitrosomonas europaea atcc 19718
molecule tags Transferase
molecule keywords Penicillin-binding 1 transmembrane protein MrcA
total genus 14
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 2.4.2.-:
pdb deposition date 2008-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3d0fA01
2BA0A 1VQHA 2L15A 4YHHL 3FKIG 5BR8L 4PZ8A 1Y1WG 4HJ7A 4DUYQ 1YHQA 4UPAA 4AYBE 1MJEA 1LTLA 1HZCA 4X65Q 2JK8A 3GTGH 4B3SQ 3I4MG 3NELA 4JI7L 5BR8Q 3GTJH 1CKOA 4RMFA 1YHBA 2NVXH 5IYCH 4GNXC 4JCVE 4YWMA 4C3HH 3TRZA 1Y1VH 4DR7L 4BY1H 4NB3A 4LFBQ 3E9HA 4DV4Q 3LGJA 1EQRA 1U5KA 2Y0SE 3S1NH 4A3IH 2WFWA 5IYBG 1N9WA 2JE6I 3MXNB 3HOYG 1Z9FA 1TWAH 4OWXB 2CWAA 1NBWA 3I4NG 4B3SL 1KIXA 1Q81C 1U0LA 1W2BA 5C3EH 1PVOA 4JG2A 4TVAB 2Z6KC 2VQFL 1EQQA 1PHJA 1CSQA 3CPWA 1VQ8A 4BY1G 4YHHQ 4DK3C 3I56A 1HNZL 1KRTA 2LXJA 3KFUA 1E24A 2JEAI 1I3QH 2ASBA 2NVTH 3OTOQ 1PYBA 2AKWB 4X66Q 2R92H 2KBNA 2QGQA 5M5WH 5IY0A 1VQNA 2F3IA 1X56A 5C0XJ 2RHQB 2UXDL 1MIUA 3RLOA 2JA5G 1XNQQ 1VQEA 4A3LH 1N32Q 3FKIH 2PI2E 1NY4A 2V1CC 1X3GA 1JJCB 1QUQB 4QGUA 4LFCL 4LF6L 4LWCA 4JI6Q 4JBMA 4DV3L 3PV0A 1R9TH 4L5TA 1CKNB 3T1YL 1XNRL 1VQDA 4K0KL 2D62A 4JI3L 1TWFH 5M5XH 1KHIA 1YJ9A 3CPFA 1S3OA 1FJGQ 1Y14B 4DR2L 2JA7H 1N8RC 4A93G 4YCVA 1N36L 3ER0A 2VL6A 4A3KH 1YJNA 4BA1I 5IE8A 2VZAA 1KD1C 3GTMH 4PZ6A 2Q2TA 1TXYA 3H15A 3CD6A 5GADC 3H0GH 4LF5Q 3KOJA 2ZM6Q 3UE1A 2PI2A 3E9IA 2JA8G 1XNRQ 3DLLA 3AQQA 2R92G 4MTNA 2XTIA 3DM3A 3PUWA 3HFZB 1JT8A 3U50C 1C9OA 1LUZA 1HZBA 3K7UC 1EFWA 3HKZE 1XTDA 4JI8Q 4BBSG 4BXXH 4A3GH 3GDEA 1N32L 1TWGH 3AFQA 1HJPA 1O7IA 2BA1A 3ULLA 5H1SE 3ZJYC 3FP9A 1SMXA 2I5MX 3L0OA 3UDFA 4HIOA 3J7A5 1Z47A 3J80c 5JJLA 3J81i 4IJLA 4JOIC 2E2IH 1XPRA 4DR7Q 4R4IA 4BY7H 2JA6H 4GKKL 1HZ9A 3M9BA 1XNQL 1VQIA 1G291 1YNXA 4GN4B 4JI4Q 2ZTCA 1I5FA 3K81C 4JV5L 3I7FA 3EIVA 4LUVA 2IHFA 3U4VA 4R4OA 3S1RH 3RNUA 1CSPA 3OTOL 1VQ5A 1NMGA 4PMWA 4DKAC 3CCJA 1C7YA 3M4QA 2ID0A 2ZTDA 1X55A 1WJJA 3A5UA 2HIXA 2R6GA 2R7FA 1IBMQ 4DAYB 5LMNQ 1IZ6A 4JBKA 2VNUD 4LF4Q 5IP7G 1J6QA 1PFSA 1QVCA 4DV6Q 1QVFA 1HNWL 2MO0A 1N33Q 4JBWA 3CCVA 3S1MH 4GNXB 1C0AA 3CXCA 3G4SA 2OTLA 3FHWA 4LNQA 4MNOA 1OTCA 4OO1G 2IY5B 3UDIA 1SLJA 3TS0A 1T9HA 1VQCA 4P74A 4JI7Q 4DV2L 4AQYQ 5IP9H 1AE3A 4IFDG 3RLFA 4DV6L 2MO1A 1PA6A 4A4IA 5AJ3L 4DUYL 3PO2H 4GKJQ 1MKHA 1UE7A 3CF5A 1VQFA 2I5HA 3PIPA 1HZAA 1TWHH 1RL2A 2MFIA 3KF8B 3HOUG 3TREA 1P8LA 5C4XG 3NENA 4A3BG 1SFOH 2Q2IA 3KLWA 1XPOA 4LF8L 4A3CG 1IBKL 1PH7A 3HOYH 5M3MG 2C35B 4QQBX 3RZOH 2BH8A 4OXPA 2A1AA 1OXTA 3F8TA 5IP7H 4JI4L 4QJFA 1XMQL 1EOVA 1I50H 4KLKA 3CCUA 1YITA 2AHOB 1N34Q 1IBLQ 3PO3G 2D0OA 4GN5A 3M4OH 5JJIA 4KHZA 2EXDA 4ME3A 4YWKA 3U58A 3PF4A 2GVBA 4JI1Q 2PNHA 3T1HL 4NXNQ 5E7NA 4QIWE 2Z0SA 4EX5A 3KJPA 1VQOA 4OO1I 2B3GA 2R7ZH 4DV1L 3G71A 5C0XG 2KCMA 1X3FA 1YBYA 1A62A 4EQ5A 4HJ9A 3HKSA 2UUAL 2VUMH 3JC66 4WJ4A 1Q8KA 2CQOA 3WWVA 4GN3B 2UXBL 2KENA 2UU9Q 2YTXA 4BBRH 2ATWA 3M4PA 4XTCS 4GNXA 4A3EG 1HNXQ 1W3SA 2ZM6L 2E2JH 1WCMG 5HGQA 3HOVH 2JJQA 3B6YA 1WOCA 3CMEA 4JI0Q 1BVSA 1E1OA 2UU9L 5IWAL 3F2DA 3M7NA 4OWTB 4QL5A 1X3EA 2CWPA 1HR0Q 3H3VI 3GTQH 4DR6L 5DLQE 1UE1A 1HH2P 2DUDA 2RF4A 4UY8C 4YY3Q 3KF6A 1NTGA 5EAYA 4BXXG 4BBRG 2HT1A 2IT1A 2E2HH 3I55A 1Y1VG 3KDFA 4L5RC 1BBUA 1WCMH 2YTYA 1K83H 1KQSA 4GS3A 5C0XI 4A3BH 2UUCL 2UXCQ 1CUKA 1SROA 1NE3A 2WB1E 1VQKA 4B3TQ 4LF8Q 4OONA 5C44G 1FVIA 4DAMA 4DR3Q 2WB1G 3A74A 1Q1EA 3E0EA 4P75A 2VQEL 4LF9L 3PO3H 5LMNW 4Y52H 4DUZL 4A3MG 1G6PA 1YZ6A 1YIJA 3HOWH 1K0RA 5GROA 3G48A 3L2PA 1EYGA 1KL9A 5FJ8H 1VQAA 5IYBH 1NJIC 2F4VL 1YI2A 1AH9A 2VQFQ 1J5EQ 1XMOL 2GN5A 1MJCA 2K4KA 3HOXG 3TS2A 1X6OA 4DV5Q 1V1QA 4HJ8A 4JYAQ 4A3MH 4IOCA 4DNIA 3F2BA 1M90C 4H02A 4GOPB 5IYDH 3CCRA 1E1TA 1YEZA 3M85A 3S2DH 4LFBL 1XMOQ 4IPHA 1J5EL 2PQAB 3EN2A 3PCOB 3PUVA 3I4NH 3AFPA 4P72A 1K8AC 2OCEA 1IYJB 1JE5A 2A19A 2VY3A 2XGTA 4NPSA 1B7YB 1CKMA 5JEAG 4A3DG 1EIYB 2OQ0A 4X65L 4NXMQ 1XPUA 4KHPQ 4IFDJ 1ASZA 1D8LA 4B3MQ 1KXLA 4LUOA 4OX9Q 5M3FH 1B70B 2YYZA 3TEHB 3CC4A 4LF7L 2K52A 2ZJRA 3UDGA 2HHHL 1WFQA 4IPGA 1H95A 3W1BA 5IYCG 1E7ZA 3D0FA 3TQYA 4DR3L 3CCQA 2R93H 2K5NA 4X62Q 1SN8A 2ZTEA 2VS1A 4DR1Q 1M1KC 3HOWG 4JYAL 4JI2L 3ULPA 1I94L 4B3RQ 3K7AH 3I2ZA 3BZKA 3UDXA 4GLXA 3HOUH 2NZOA 4YCUA 1E22A 2VUMG 1A0IA 4RG1A 1PH1A 3RR5A 2Y0SG 5FLMG 4HIKA 1JB7A 1L1OC 4R1JA 4X64Q 1KAWA 2E8GA 3Q8DA 4DK6C 4A3JH 1YJWA 2N78A 1K3RA 5M5YH 3SGIA 4YY3L 2UUBL 1N36Q 4A3GG 1EIFA 4POFA 1HR0L 2YU9H 3GD7A 1S72A 1GVPA 1PH6A 1PH8A 3EBEA 3RN2A 2BH2A 3STBC 4B3TL 4R4CA 4JI3Q 1Q86C 2JA8H 4YWLA 4ALPA 4PG3A 2RHSB 4GOPC 1ASYA 4X6AH 2UUCQ 4JI5Q 1GKHA 2NVYH 4XIGS 3U4ZA 3RLNA 3KDFB 4BBSH 2IHEA 3CW2C 1PH9A 3ERSX 2E5LL 2E5LQ 4LF6Q 3BJUA 4GLVB 4DR5L 3S16H 3S1QH 4DV0Q 4DR4Q 1PH2A 4JI5L 1TWCH 1S40A 1Q12A 3M3YH 1I94Q 1UWVA 3A5ZB 5ELOA 3W1GA 4A3FH 4DV0L 3W5OA 5FLXc 4IPDA 4DR1L 4DR4L 4DR5Q 4GLAC 1Q82C 3JAMc 3BZCA 3KYHC 2VW9A 2ZJQA 1UE5A 2DGYA 3VDYA 2Q2UA 4A93H 3PIOA 5K36G 1L0WA 3MEFA 2OWOA 2N49A 1VQ4A 2LXKA 4LF7Q 3CC7A 2R7DA 2PMZE 1VS0A 2AMCB 1WYDA 1GO3E 3STBD 1A63A 5HY6A 4JOIA 3J81j 3KJOA 4HJAA 4MZ9A 4UP7A 3CCSA 4B3ML 4X64L 1NMFA 3IRBA 4P73A 2KCTA 4A3CH 2OQKA 2UUAQ 1AE2A 1P16A 4AIMA 3CCEA 2CCZA 2Z6KA 4IFDI 3CC2A 2JA7G 1PH3A 4GKJL 1GD7A 4JI2Q 1JJ2A 5AJ3Q 2JA5H 4A3LG 3T1HQ 1OXVA 3NEMA 4X62L 2H5XA 3CP0A 4TQUS 4AQYL 1PV4A 1L1OB 3AYHB 1OXXK 1N33L 1HNWQ 1N34L 4JBJA 4LF4L 3HKZG 1XMQQ 4A3FG 5C4XH 3PGZA 1YHAA 2HHHQ 1K8GA 3GO5A 3H3VH 3F1ZA 2K50A 1WI5A 2MNAA 4OX9L 4DV5L 3OYYA 2KHIA 4UP8A 4DPGA 5GQOA 5LMUQ 1VCIA 2D0PA 3PO2G 2K75A 2NN6I 4QY7A 4LUZA 4IOAA 3HOZG 2JEBI 3PSIA 4A3EH 1V9PA 3JAMi 3CCMA 1Q46A 1IBML 2K5HA 4KI0A 1EUJA 3H0GG 2A8VA 1SE8A 2MQHA 3BU2A 3D31A 4L5QA 3F2CA 2R7ZG 4GKKQ 2N8NA 4NXML 5M3MH 4KHPL 4DV2Q 1IXRA 2WAQE 5LMUL 4LF9Q 4C3IH 1Q7YC 3AEVA 1OXSC 2JQOA 4JV5Q 1Q1BA 1QVGA 1HR0W 2EQSA 1X9NA 1QZHA 1UE6A 4HJ5A 1B8AA 3GTOH 4J15A 4C2MH 3G6EA 3HOVG 1KRSA 4UP9A 1VQBA 1PH5A 5FLMH 4LFAQ 1VQMA 2F4VQ 4BY7G 3L7ZC 5ELNA 5LMNL 4JI8L 4A3JG 2F52A 1RIPA 3CMAA 1K73C 2B63H 2I5LX 1UEBA 1OXUA 3CAMA 3HOZH 4JC0A 4O2DA 2HIVA 3PUXA 3PUZA 5C3EG 1VQLA 1E3PA 4DUZQ 4DV7Q 3CCLA 1IL2A 3KF6B 2R93G 1X65A 1X54A 2JA9A 2K5VA 1JJGA 4O0AA 4DR2Q 3NBHB 4LF5L 2WAQG 2I0QA 4A76A 1EWIA 1V43A 2HQLA 4AH6A 1L1OA 3A0JA 1BKBA 1LYLA 4K0KQ 4Y7NH 4FDBA 3J7ZC 1VQ6A 3K80C 1VQPA 1PH4A 1VQ7A 1VQ9A 1BBWA 2NZHA 4DV3Q 4R4QA 4IPCA 2VQEQ 1GM5A 4POGA 1FJGL 3ICEA 3UE0A 4A3KG 2FXQA 2LSSA 2QA4A 2ES2A 2IX1A 3GTPH 1G51A 2B29A 4PZ7A 1DGSA 1JMCA 2UXCL 1FGUA 3T1YQ 3J81c 3J80i 1QZGA 4JI1L 4NXNL 4X66L 4JI6L 4P71A 3S15H 4DR6Q 1CKNA 5IP9G 4OWWB 1KC8C 2B63G 1VQGA 4JI0L 5JEAJ 3K0XA 3S17H 4LW1A 2CKZB 4BA2I 2YV5A 3K8AA 5GAEC 1HNZQ 3PUYA 5GAGC 1PYSB 2CFMA 4DV7L 2OTJA 1D7QA 2IX0A 2Q2HA 5IWAQ 5IYDG 5C4JH 1VQJA 2UXBQ 4A3IG 3GTLH 4WJ3M 1SRUA 5FJ8G 2ALYB 3ULJA 2NVQH 1K9MC 2JA6G 2EIFA 2N3SA 2UUBQ 3I4MH 3S24A 1SR3A 3PF5A 1HNXL 1A8VA 3RN5A 4LFAL 2AWNA 3CQZH 4AYBG 1YVCA 3HOXH 5IT9c 2PQAA 5J3BA 3OW2A 2RCNA 4APVA 5JJKA 1XJVA 4LFCQ 3S14H 1FL0A 4IJHA 2WP8J 2ZJPA 1Y1WH 1I6HH 4IO9A 4A3DH 4L5SA 3GTKH 4HIDA 2UXDQ 5GAHC 4DV1Q 4R4TA 4B3RL 2KHJA 2K14A 4GOPA 5M3FG 4C3JH 4DV4L 1IBKQ 1L2FA 1LM0A 3RZDH 4YCWA 4HIMA 1IBLL 2AWOA 2GVAA 3S2HH 5C44H 1QUQA 2QEXA 2YTVA 4A75A 3I4OA 2NN6G
chains in the Genus database with same CATH superfamily
2PMZB 1VQHA 4YHHL 2NVTB 1MHWC 4FP5D 4HJ7A 3MEHA 4A93B 4BS9A 4C56C 3BDOA 3I4MG 3W2DA 3E0JA 2NVXH 5IYCH 2Z1CA 4YWMA 4TKOB 3S2DB 4DR7L 3E9HA 4DV4Q 2VB3X 2MHVA 3ITPA 4A3IH 2F0PA 2WFWA 3HOYG 4BBRB 3S14B 4OWXB 1NBWA 1JWMD 2J7ZA 4B3SL 4IUVA 1U0LA 3NBIA 1W2BA 2QILA 1EQQA 3PIO3 3RZDB 3TSSA 1KRTA 1J9OA 3KFUA 1E24A 4J1MA 3WOEA 3DEPA 4U68A 4X66Q 4XQQA 1JOKA 2YU9B 1BCPD 2KOLA 5M5WH 5IY0A 2F3IA 1X56A 3SK8A 4WRDA 2JA5G 1XNQQ 1N32Q 2E2IB 1X3GA 1JJCB 4QGUA 1PTOH 1MBYA 3OMGA 4JI6Q 4DV3L 5D3IB 1XNRL 4ZYSA 2KCNA 4K0KL 3QO2A 3CPFA 2E75C 1AEXA 4A93G 4YCVA 3ER0A 2VL6A 3KK7A 5IE8A 2VZAA 1KD1C 1H9KA 3H6MA 3OWEB 2Q2TA 1TXYA 3H15A 1G91A 2O2LD 5EKIA 1AP0A 2R3ZA 3E9IA 2R92G 2BCOA 3J7AV 4MTNA 1LTSD 1NR4A 1SMYC 3I90A 3L3OC 1LUZA 3HKZE 1XTDA 4Y7NB 1TWGH 1HJPA 4X3SA 3ZJYC 1LTRD 4K14A 2KA7A 5FO8B 4KKTA 5JJLA 3J80c 5C3EB 5IGGA 4DR7Q 4R4IA 2IX3A 3FRPB 3M9BA 1G291 1YNXA 2ZTCA 4JV5L 4K8JA 3U4VA 1EIHA 4UDUC 3OWFA 3SK4A 2NBFA 3CCJA 2ZTDA 3OHXC 2L4NA 1U4PA 4LF4Q 3VR2A 1HNWL 5E3FA 1LT4D 3TDQA 4FXKC 3CXCA 3NPPA 3D8GA 2QF7A 4B9WA 5IP9H 1AE3A 3GTOB 4ZUIA 5ELFA 3RLFA 3TP6A 1RHPA 1S5ED 4DUYL 2L9HA 2F4IA 3AB9A 1UE7A 5E1FA 1TWHH 1RL2A 1Q8IA 1P8LA 1SNQA 1FR3A 5C3WA 1KNEA 4RFBA 5M3MG 2C35B 4FNFA 5CV9A 2A1AA 5IP7H 2BE5D 3OIQA 1IBLQ 2KQ3A 2D0OA 2EXDA 1I4QA 1Q3LA 3VA5A 3T1HL 1JICA 4LK1C 2R7ZH 1X3FA 2EJFC 5KNCA 3IKJA 4WJ4A 4HMIA 2CQOA 3S1MB 1G8ZD 3WWVA 1KNAA 2KENA 2ATWA 1HNXQ 2E2JH 1CHPD 1ML0D 1WCMG 3C1FA 3CMEA 3RZOB 1E1OA 5IWAL 3M7NA 3H3VI 3H91A 5DLQE 2F0VA 4E6IA 2KJXA 2RF4A 2F0HA 2MGSA 4YY3Q 4UY8C 3O13A 1NTGA 3DEOA 2NVQB 4BXXG 2HT1A 3J81L 2R7ZB 2L11A 4TSSA 4L5RC 1AZPA 3IAYA 2DN8A 1BBUA 1SAPA 2NTTA 3I4LA 4GS3A 1B9NA 4FVMA 4KHVA 2UUCL 1CUKA 1C4QA 4QMGA 1NE3A 2MUYA 4LF8Q 4OONA 3GTMB 3A74A 2VQEL 3E0EA 1ENAA 1LTBD 2HD3A 3SDZA 3AMUA 4C3JB 3HOVB 4DNTB 5LMNW 3GTLB 2Y0SB 1G6PA 3NBHA 5M3MB 1KLGD 1K0RA 5BN3A 4XYOA 1DXMA 1QJOA 4DF7A 2EE1A 1MJCA 2H1EA 2K4KA 5IT9L 1X32A 1V1QA 2WKDA 4JYAQ 4A3MH 4GOPB 5IYDH 5CR3A 3S2DH 1EFID 4LFBL 1XMOQ 4IPHA 1GUSA 4CGYB 1CT1D 3PCOB 3PUVA 3I4NH 5LL6X 5I4DA 2OCEA 5D65A 1TS5A 1B53A 2VXWA 2XGTA 2F0FA 1EIYB 4KHPQ 1NNXA 1ASZA 1D8LA 1S4ZA 4B3MQ 4OHJA 5ELBA 4BBSB 5M3FH 3TEHB 3FVQA 2K52A 4EQPA 2ZJRA 2HHHL 1ESFA 1U4LA 1I3QB 3W1BA 1SNMA 1E7ZA 1Y8PB 4P2CB 4CKBA 5K36H 4X62Q 1SN8A 5CV6A 1FYCA 1F2LA 4B3RQ 5IOCA 3K7AH 2O5JC 4ZLTF 2VB2X 2NZOA 4C3JG 1E22A 4RG1A 2Y0SG 1L1OC 1KAWA 2E8GA 4DK6C 2N78A 4K2LA 4FF1A 3SGIA 1BCPB 1ZYRC 2UUBL 1LABA 2HQEA 1PH6A 3HOXB 3EBEA 2BH2A 3X3MA 1Q86C 3QB3A 3FKIB 5DEHA 4DXFA 5CV4A 1AN8A 3KDFB 4BBSH 1ONLA 2IHEA 1HPCA 2E5LL 3FMCA 3TBIB 1PH2A 1I94Q 5ELOA 3W1GA 4A3FH 2K05A 5FLXc 4IPDA 1B3AA 4Q0FA 2Z4IA 4A3DB 1Q82C 3HOUB 3P7JA 2ZJQA 3VDYA 3UI2A 3DWQA 3OOCA 1R4QB 5K36G 1L0WA 2L1BA 2LXKA 4LF7Q 3CC7A 2R7DA 3NQTA 1GO3E 3GTJB 1A63A 3J81j 3KJOA 1OO9B 3HP3A 3HRZC 2F0LA 2OQKA 4A3CH 4AIMA 1XXGA 1LACA 1PH3A 4JI2Q 5AJ3Q 5COYA 5I6WA 2SEBD 3A54A 2LKVA 1RKNA 5I6YA 4H7BA 2EYPA 5L37A 2EY2A 4I7AA 1EL0A 4DPGA 2D0PA 1WTVA 2JEBI 4A3EH 3CCMA 4FF4A 1PTOD 1U9RA 2A8VA 2MQHA 2R7ZG 3D31A 2N8NA 2CHBD 4NXML 5EBDA 4C3IH 2JQOA 3EA6A 4KK7A 1QVGA 1HR0W 1D1KA 1PRTC 1FNVA 3MVVA 1VDZA 3AU7A 3G6EA 1KRSA 5JOBA 5CV5A 1EEID 1GOZA 4LFAQ 1VQMA 3L7ZC 2F4VQ 3I3CA 4BY7G 5LMNL 3U9OA 3E6ZX 1VQLA 2HIVA 4EQOA 1IYVA 1X65A 3FPPA 3MWYW 4ULLA 2JA7B 2KEDA 5KEEA 1RODA 3QJYA 4K0KQ 1YNJC 4FDBA 2BDOA 3K80C 2K6AA 1I4GA 1VQ9A 3R3OA 2L12A 2NZHA 4DV3Q 2LS01 4POGA 5LHY1 3GTKB 2K28A 2IX1A 2FXQA 5I9PA 1G51A 1D6EC 1DGSA 1FGUA 3J80i 3GQBA 1GUGA 5CYUA 2BE5C 3IFDA 4P71A 1CKNA 1DD2A 1R4PB 4FYDA 2L5TA 1HTPA 4LW1A 2KHSA 3C3LA 1IKMA 3L9AX 3K8AA 1WD1A 2OTJA 1DOLA 2EYJA 5IGDA 5IYDG 1SRUA 3HOWB 3URYA 2UUBQ 3V2TA 1SR3A 3RN5A 3P1HA 3HOXH 2MPMA 2RBMA 1H9SB 2PQAA 3D4WA 4XXEA 3OW2A 4APVA 2PPBC 4FXGC 2UXDQ 5GAHC 4DV1Q 4R4TA 4B3RL 1GUWA 1SEBD 5M3FG 3PO3B 1IBKQ 1LM0A 1B1ZA 1GHJA 1SNOA 2AWOA 4K5VA 3MTSA 3NWTA 3S2HH 2G9HD 1A15A 1NUCA 2EDGA 2L15A 4HR7B 1YNNC 4PZ8A 2B2WA 1Y1WG 3CRLC 1YHQA 1MJEA 4KY5A 2F0TA 3GV3A 4X65Q 2N88A 3GTGH 4WFN3 3C1EA 4JI7L 1EY0A 5BR8Q 3GTJH 4RMFA 2IPKD 1HUMA 4JCVE 5E4WC 4C3HH 3TRZA 2A6EC 1CQFA 1WTHA 3E5SA 4LFBQ 3HGBA 1U5KA 5IYBG 3MA2B 1JWSD 1PZKD 3NUCA 4XYQA 1PVOA 4G4KA 1D5XC 1VQ8A 4YHHQ 1M4VA 3D6CA 2B2YC 1HQMC 1STHA 5KYLA 3DMUA 1KLUD 5CBAE 5A2QE 1E2ZA 2K1BA 1PFBA 5C0XJ 2UXDL 2SNMA 4XDXA 2PI2E 4HN7A 3MZ5A 4LWCA 2JN4A 3HOZB 1BCPC 2D62A 3GTPB 3PMFA 4R8NA 1SYFA 3ND9A 1FJGQ 1Y14B 1N8RC 1WD0A 4DNRB 4ABNA 4X3UA 1RF2D 1YJNA 4BA1I 2JSOA 4PZ6A 5GADC 1O7ZA 4L8JA 3KOJA 2AQ3B 2PI2A 2JA8G 3DLLA 3AQQA 2B2TC 2EYMA 2XTIA 3HFZB 3EFXD 1HZBA 4BXXH 3GDEA 3AFQA 5M5WB 1O7IA 3I4NB 2TMPA 2F0MA 1F9QA 4KY6A 3FDTA 1SMXA 4ILWA 4HIOA 2B2WC 4JOIC 1VMCA 2LFNA 2JA6H 4KKSA 1XNQL 2G5DA 1VQIA 2EYOA 5C4JB 3DXJC 1I5FA 1Z7TA 2IHFA 5CGKA 2A68C 3S1RH 2VUMB 1CSPA 3R2IA 1T5EA 5CV7A 4IURA 4FXDA 1NMGA 5JPMC 2AUJD 3CKIB 1V1PA 2HIXA 2R6GA 1JC7A 1UAPA 2X6LA 4PMCA 1IZ6A 1TIID 2Q8IB 5LMNQ 1IBMQ 1JOQA 5EKLA 2PZWA 2NZ1D 4GNXB 3VYRA 3HG9A 3FHWA 3TP7A 2A6HD 1SYBA 1OTCA 4OO1G 3UDIA 3TS0A 1T9HA 4CKEA 4L6TB 4DV2L 4DK0A 4IFDG 4B08A 1PA6A 4A4IA 5AJ3L 3PO2H 1ET9A 5EQ0A 2JA6B 5G3LD 2KUMA 5C44B 3KF8B 4I7ZC 5C4XG 1EY4A 2Q2IA 4EGVA 3QG1A 3RZOH 2BH8A 1OXTA 1K83B 4PNYA 3M3YB 4KLKA 4M8AA 3PO3G 4J8QA 3N52A 1TWAB 4ZKCB 1LT6D 4CDFC 3PF4A 2PNHA 4CDDC 5E7NA 2F3VA 1VQOA 1B9MA 2PW5A 2KCMA 3H3VC 1A62A 5J1ZA 4HJ9A 3HKSA 3JC66 2YTXA 5BN4A 2HCIA 4A3FB 2PNRC 4XTCS 3PQIA 4GNXA 4R8IA 4ID6A 5EBCA 4MN3A 4JI0Q 3MAQA 2UU9L 3F2DA 3NK9A 1SYEA 3PO2B 1EYCA 2CWPA 4IALA 1A2TA 3NE5B 3JAME 1HH2P 1PTOB 4IUTA 2K5QA 1SNDA 3TZDA 2IT1A 2E2HH 3I55A 1K8OA 1SMYD 1JQYD 1WCMH 3NXWA 2C5CA 2J0TD 2NB0A 1SROA 3HS0C 1D5ZC 2WB1E 5C44G 4DR3Q 2WB1G 1WTPA 4P75A 3PO3H 2EXZA 4DUZL 4C3HG 4CHTB 5GROA 3MXGA 1EYGA 1KL9A 3H09A 1VQAA 2XWBB 5IYBH 1NJIC 2F4VL 1AH9A 4F87A 4KY7A 2GN5A 4DV5Q 4JVZA 5JEAH 4DNIA 2F0GA 1M90C 4H02A 2F03A 3T56B 2NVYB 5T1GA 1E1TA 4NMZA 3M85A 2PW7A 1J5EL 5CC4A 5EKKA 3AFPA 1CFMA 1K8AC 4DAPA 1J8IA 1JE5A 2A19A 1CKMA 2JA8B 1H9JA 2OQ0A 4X65L 1EOTA 4L63B 4LUOA 1WTOA 2NVXB 1B70B 2CW0C 2YYZA 3V05A 3UDGA 3M4YA 1EY5A 2K7VA 1WFQA 4CKCA 5KIXA 1H9MA 2XIWA 3S16B 3VR4A 4BWGB 4DR3L 4DR1Q 4JYAL 3I2ZA 3UDXA 4GLXA 1EY7A 3C46A 1I50B 2VUMG 2B2YA 1PH1A 3NP8A 4LAAA 4A3MB 2K04A 4R1JA 3MFGA 1JR0D 1O7LA 3Q8DA 5FOBB 5ELDA 3GP7A 5M5YH 2NTSA 1IL8A 3P20A 2B8GA 1EIFA 4KN4C 2YU9H 1S72A 1PH8A 3VR6A 1SJED 1TY0A 4RH6A 4JI3Q 3SE0A 1DONA 4YWLA 4ALPA 4GOPC 2RHSB 4RHSA 1I6HB 2UUCQ 2CVRA 5IGFA 1JCKB 2AQ1B 1LT5D 1G6ZA 2A73B 1EU3A 3ERSX 4QUCA 2EY6A 3BVMA 4GLVB 4DR5L 2E5LQ 4LF6Q 3I4MB 3S16H 3S1QH 4DR4Q 1EWCA 3M3YH 1LTTD 1IW7C 1Q12A 4N8FA 3S9WA 3A5ZB 4NW2A 5M9OA 4DR1L 3LX0A 3MFYA 3KUPA 1EEFD 1H9SA 4DA2A 2K5WA 3BVGA 5C4XB 3KYHC 3PIOA 2OWOA 1BNZA 4A3JB 2PMZE 3STBD 3K5MA 1VF7A 4MZ9A 4UP7A 5IGEA 3G7LA 1DOMA 3IRBA 4P73A 2KCTA 2AUKA 2CCZA 2Z6KA 3CC2A 2B2VA 2JA7G 1JJ2A 4A3LG 3T1HQ 1OXVA 2F0NA 3CP0A 1N33L 1U4MA 1TT2A 3HKZG 5C4XH 2HHHQ 5F2DA 2MNAA 3OYYA 4UP8A 2NN6I 1II3A 4QY7A 3ONAB 4IOAA 3HOZG 3K6OA 2B63B 4IUPA 1IBML 1EUJA 1VF5C 3H0GG 2Z9HA 1SE8A 1PXUA 5M3MH 3A7AB 4N8X1 4G7OC 1VMPA 1OXSC 3BDLA 1Q1BA 1HHVA 3V96A 1X9NA 1UE6A 2WB1B 4HJ5A 3GTOH 4UAIA 4C2MH 1O7YA 4UP9A 3RUZA 5ELNA 2PZTA 1PZID 2B63H 1K73C 2DNCA 1UEBA 4JC0A 1BQQT 4O2DA 1S5FD 3CCLA 1IL2A 4DUZQ 4H13C 4G57A 2R93G 2K5VA 3CQZB 2Z6BA 2WAQG 1KDAA 4OIKA 2I0QA 1V43A 2HQLA 1S5CD 1LYLA 3TMEA 4Y7NH 3QWNA 1VQ6A 1PH4A 3QOJA 5ELEA 1SE2A 1STYA 1XTCD 4IPCA 3HKZB 1I4PA 4IZ8A 4R4QA 5C6AA 1WTXA 1FJGL 2LSSA 5CMDA 5J39A 2QA4A 1GJXA 2B29A 2RCFA 2UXCL 2RSOA 2ZXOA 2JP1A 2F0OA 4DK1A 1BR9A 2HDLA 2SDFA 3IL8A 5EPLA 4OWWB 1NR2A 1KC8C 4JI0L 3K0XA 4LJZC 3WDNA 2CKZB 4HCEA 5GAEC 3LNNA 1B2TA 2QEJC 3PUYA 2CFMA 2AQ2B 5ELCA 1D7QA 2Q2HA 1W6JA 4WJ3M 2ALYB 2JA6G 4BY1B 1HUNA 3I4MH 3PF5A 1ESRA 3CQZH 4QB4A 1YVCA 3TP5A 5J3BA 2QDLA 5FLXL 2A69D 2EYHA 2K03A 4LFCQ 4A3BB 4IJHA 2WP8J 3NQIA 2ZJPA 1I6HH 2OT2A 1SNCA 4L5SA 3W3AA 3GTKH 4HIDA 1NCVA 2KHJA 2K14A 4KJNA 3NTHA 4C3JH 4DV4L 3RZDH 4HIMA 3VA7A 2WAQB 5I2YA 3K5OA 3S15B 5BR8L 1S5BD 2EYFA 3PIP3 4OO1H 2F0KA 4UPAA 4AYBE 1QCBD 4CJ1B 2JK8A 3TN2A 4B3SQ 1BDOA 3NELA 4A3KB 1HA5A 5DNFA 4GNXC 3MHBA 3IFTA 2RDGA 4PQXA 1Y1VH 4BY1H 2RQXA 3LGJA 1EQRA 5JVG3 5M5XB 4C3IB 4CJ0B 4RCNA 1N9WA 3MXNB 1Z9FA 3K57A 1KAAA 2CWAA 1DM0B 2MJ8A 2LMCB 1Q81C 5JPNC 4JG2A 1GUTA 2VQFL 3BZDB 3CPWA 1HNZL 1TVXA 1RTOA 4KTAA 2JEAI 4UHVA 2ASBA 2F0QA 2NVTH 1PYBA 4JK1C 2AKWB 3QOLA 2DJFC 5TSSA 2R92H 2KBNA 2QGQA 4RGMA 1VQNA 3S1NB 2NWGA 3CRKC 1NY4A 1E2VA 1QUQB 4LF6L 5I9OA 3PV0A 1RD9D 4L5TA 1PRTF 4N9PA 3LWEA 1TWGB 1VQDA 1MSHA 4JI3L 5M5XH 1KHIA 2D5DA 1PDQA 4DR2L 2JA7H 2RSNA 2WKCA 4A3KH 3A8KE 5C4ZA 1F9PA 3CD6A 5A35A 2ICEC 2KVMA 4LF5Q 1TS2A 2ZM6Q 2XRQD 3EQLC 1EYDA 1A3VA 1PFMA 1STGA 2F0WA 3U50C 3K7UC 1ENCA 5H1SE 3ULLA 2FMMA 3FP9A 3UDFA 2I5MX 3L0OA 5JJZA 3D4RA 3J7A5 1Z47A 1CK1A 3J81i 1PZJD 2E2IH 4GKKL 4BY7H 1HZ9A 2NUCA 5A2QL 3I7FA 3EIVA 4LUVA 4K6LA 4R4OA 2P5ZX 4KV6A 1M8AA 3RNUA 1I4RA 3OTOL 1VQ5A 4PMWA 4DKAC 1C8CA 1C7YA 3M4QA 1K28A 1IKLA 1WJJA 1O80A 2R7FA 2VNUD 3R2TA 1BCPF 4OIJA 2ICIA 1J6QA 1QVCA 2DNEA 3K7AB 4NKLA 5IP7G 1QVFA 3CCVA 1ILPA 1C0AA 4Z9CB 1SLJA 4JI7Q 2F0IA 1QNUA 4DV6L 4GZYC 2MO1A 4DU9A 2K5DA 3OMCA 4ZCKA 1MKHA 2EZVA 1HZAA 2MFIA 2HCCA 4C1NI 2DY8A 3TREA 2RDFA 4A3BG 1SFOH 1XPOA 4LF8L 3R93A 1IBKL 4S3SA 1PH7A 4TRDA 4OXPA 1PRTB 1XMQL 4K2KA 1HCZA 1EY8A 1N34Q 2AHOB 5JJIA 4R9WA 4WJWA 4ME3A 2GVBA 2E2DC 3KJPA 2Z0SA 4OO1I 1EYAA 3KBXA 1YBYA 2UUAL 2VUMH 1XYIA 2UXBL 1TS4A 2UU9Q 4BBRH 3M4PA 1BUVT 1W3SA 5HGQA 3HOVH 2FFKB 3B6YA 4FF3A 1B3QA 1A6XA 4OWTB 4QL5A 1X3EA 1ZEQX 2A5HA 1UE1A 1SNPA 3KF6A 2MP1A 5DM63 3KDFA 1O78A 1Y69U 1LTAD 4G7ZC 1KQSA 5C0XI 4A3BH 3K59A 2UXCQ 1BBXC 4B3TQ 4EQNA 1R9TB 3A55A 4RKBA 4Y52H 1WTWA 1YZ6A 3S2HB 3J7YW 1HQRD 3E3XA 4QF4A 3L2PA 2JA5B 5FJ8H 2F0UA 1TKWB 4A3GB 4PMBA 5KRUA 2RKSA 3TS2A 4HJ8A 3KLRA 2X6GA 3F2BA 3R8BA 1D5MC 5FK9C 1Q90A 4ZRZA 3CCRA 1YEZA 5JAVA 4QUFA 3EN2A 5EJWA 5BN5A 2GA4B 5C4HA 3G6JB 4P72A 4QCLA 1EU4A 1IYJB 2VY3A 4NPSA 1B7YB 5JEAG 4A3DG 3I72A 1KXLA 4LF7L 2F0JA 1HFNA 1H95A 5IYCG 4H44C 3D0FA 4FF2A 3HZXA 3CCQA 2R93H 3SEBA 2ZTEA 1W6KA 4YIJA 2K01A 3MC0B 3MXNA 4JI2L 1A2UA 4RHRA 3HOUH 4RKLA 2OXPA 1A0IA 1S5DD 2QKIC 2EYLA 3RR5A 4K6DA 4X64Q 3VYUA 1EQVA 1YJWA 4N9TA 1K3RA 4YY3L 1SFOB 1RJTA 3BS1A 1D2BA 2RDHA 1HR0L 4POFA 3GD7A 2QCPX 1L0XB 3STBC 3J80E 2JA8H 1JORA 4PG3A 4X6AH 4JI5Q 4OL7A 4XQJA 1PH9A 4DV0Q 3I91A 1TS3A 5T1IA 4DGZA 3J7AF 1STEA 3EJIA 1Y8OB 3CU7A 4DV0L 3W5OA 1STNA 4DR5Q 2FJ2A 3NTKA 1QB5D 4IFDH 1HTLD 1JWUD 3JAMc 3BZCA 2VW9A 1UE5A 4F8MA 2DGYA 2R61A 4IQZA 4A93H 3MEFA 2M9VA 2Z4HA 1VQ4A 1VS0A 1WYDA 3Q22A 5HY6A 4JOIA 1SJHD 3CHBD 4HJAA 1K0SA 1IHZA 3BG3A 1AE2A 1P16A 3CCEA 4IFDI 1GD7A 2JA5H 1AW7A 3NEMA 5J22A 3KLSA 4X62L 2H5XA 4TQUS 3J80L 1PV4A 3AYHB 1SSOA 2PO4A 4RCOA 5HURA 4JBJA 1SXTA 1XMQQ 4A3FG 3PGZA 2A69C 1D1IA 3S1QB 1K8GA 1BF4A 3F1ZA 3KF8A 2Q8TA 1WCMB 4OX9L 2EY5A 1IYUA 4DV5L 5LMUQ 1CQVA 1LO5D 1VCIA 3PO2G 2K75A 4LUZA 1SBBB 1TQOA 4G7HC 3TZUA 3JAMi 4EVOA 1Q46A 1I6VC 1HA6A 4NDXA 1F9RA 4L5QA 3H94A 4GKKQ 1Y1VB 5EPKA 1EZ8A 4ODGA 1U4RA 2WAQE 5LMUL 4A3IB 3AEVA 4JV5Q 4KN7C 2EQSA 2SOBA 2C9OA 2EJMA 1TWFB 3WOFA 1RDPD 4J15A 3HOVG 1MD2D 2B39A 3DWPA 4IUQA 1PH5A 5FLMH 1SE4A 5IGCA 1NSNS 5IT9E 4JI8L 4A3JG 5CORA 2RVLA 1LLRD 5IODA 1OXUA 3CAMA 1WVLA 1E3PA 4DV7Q 1YNJD 4HMJA 1X54A 2JA9A 1WTRA 4O0AA 4DR2Q 3NBHB 4A76A 4AH6A 3VR5A 1L1OA 3A0JA 2WV6D 1BKBA 3J7ZC 3SXHA 1LTID 1VQ7A 1CA6A 4A3KG 2D9UA 4J6HA 3GTPH 1KTKA 4PZ7A 1JMCA 3T1YQ 3J81c 1UUPA 3A7LA 1QZGA 2OF1A 4JI6L 4DR6Q 4MHEA 5IP9G 1EY6A 3SR1A 2F3WA 2KCCA 5NUCA 1GHKA 1B4OA 4BA2I 1HNZQ 1UEAB 3TP8A 5GAGC 1QWYA 2IX0A 4Q5VA 4OEMB 1VQJA 1PTOF 3OW7A 2IL8A 3ULJA 1K9MC 2EIFA 2IJ0A 2N3SA 1A8VA 1GUNA 4LFAL 2AWNA 4AYBG 1CZGA 3A8IE 4ZK9B 5JJKA 1XJVA 1IW7D 1FL0A 3M7GA 4KD3A 4A3DH 1F2YA 1E2WA 1F2ZA 3HEJA 2JYOA 5HGTA 1EZ6A 4YCWA 4K5XA 2GVAA 1QUQA 1SDFA 4KKUA 2NN6G 2BA0A 3FKIG 2NYZD 2B8FA 5LL6S 2HDMA 4DUYQ 1LTLA 1HZCA 1XX8A 2FINB 2N55A 4RGTA 1V1PB 3MXUA 1CKOA 4XQNA 1YHBA 3U9SA 3OSOA 3K0YA 2RA4A 5EPJA 3SVMA 1SYCA 3C2PA 3T13A 4DN4M 4NB3A 2R92B 4HTHA 2ZXRA 2Y0SE 3S1NH 4O42A 4K8IA 5IGBA 2JE6I 2F0DA 1TWAH 1BOSA 2X69A 3JAML 3I4NG 1KIXA 2JXMB 5C3EH 4TVAB 2Z6KC 2PZUA 3KBGA 1PHJA 1CSQA 4BY1G 3I56A 4DK3C 3Q24A 3GTQB 4V190 2LXJA 1I3QH 4OGQC 2SNSA 3M4OB 3K58A 3OTOQ 3A56A 2A68D 5IIFA 5EGTA 2RHQB 1MIUA 1F77A 5C5LA 3RLOA 1VQEA 3GTGB 4A3LH 2V1CC 3FKIH 1C48A 4DFAA 3ERQA 1FNWA 4LFCL 4JBMA 4KD4A 1CHQD 1R9TH 1CKNB 3T1YL 2E2HB 4CDCC 4DXGA 1TWFH 3I73A 1YJ9A 2QW7A 1S3OA 3ND8A 1LV9A 5C5MA 5G3LF 1N36L 1X3QA 3EVQA 3DWAA 3GTMH 2ENBA 4RA8A 1Y8NB 3S17B 1X3PA 3S1RB 2DJGC 3H0GH 3NWSA 3UE1A 2TSSA 1XNRQ 3DM3A 3PUWA 1JT8A 1C9OA 4BBSG 1EFWA 3VYSA 1GUOA 2KECA 4JI8Q 3HOYB 4A3GH 2XVSA 3T4AC 1N32L 2BA1A 1RTNA 4XT3B 1BXTA 4IJLA 4ZUJA 5CV8A 3X3NA 1XPRA 4LMQD 4GN4B 3K5NA 4JI4Q 3K81C 1B50A 2B2UC 1H9RA 1TU2B 4HCSA 1LT3D 5D14A 4B9XA 3MXPA 2ID0A 1QG7A 4RWSC 1X55A 3A5UA 4JBKA 4A3EB 2I07B 4DAYB 1HRJA 1PFSA 4DV6Q 2MO0A 3I70A 4JBWA 4KMUC 2EOTA 1HXYD 1N33Q 3S1MH 2HUGA 3G4SA 2OTLA 4LNQA 3SK5A 4MNOA 2IY5B 3BVZA 1VQCA 4KJOA 1ILQA 4P74A 4AQYQ 2A6ED 4DAVA 1UNSA 1ET6A 4GKJQ 3CF5A 1VQFA 2I5HA 3OIPA 3PIPA 2I46A 2BDNA 1CI3M 4CJ2C 3HOUG 3NENA 3A8JE 4C3HB 1KDBA 3KLWA 5AFWA 4QQBX 4A3CG 4M1UB 3HOYH 1TR5A 3F8TA 4JI4L 4QJFA 1MI2A 1TWCB 1EOVA 1I50H 3M4OH 3CCUA 1YITA 4GN5A 4KHZA 3U58A 4YWKA 4X3KA 3RD4A 4JI1Q 4ME5A 4NXNQ 4QIWE 4EX5A 3EROA 2FHTA 1SYDA 2B3GA 4DV1L 3G71A 3N6RA 5C0XG 1FGBD 2LY7A 4EQ5A 1NAPA 3VYTA 1Q8KA 1GXDC 1CA5A 2IWHA 4GN3B 5JVH3 1F2MA 3ZYYX 3DUZA 3DM1A 2B2VC 4A3EG 1B44D 4IN3A 4FO2A 3SK6A 2ZM6L 4F88A 2JJQA 1WOCA 1BVSA 1QNKA 1HR0Q 3GTQH 4DR6L 2F1MA 2DUDA 2OEOA 4C3IG 1A3TA 5EAYA 3BYYB 4BBRG 3BDCA 1CZWA 1Y1VG 2A6HC 2YTYA 1K83H 2CH4W 1PLFA 5D3DA 2KEEA 4HSVA 2PCFB 1TWHB 2CW0D 1VQKA 2PQEA 1FVIA 4DAMA 1Q1EA 4MTKA 4LF9L 2XWJB 4A3MG 1YIJA 3HOWH 3G48A 4X3TA 5C0XH 3T16A 3P75A 1YI2A 5FKAC 2VQFQ 1J5EQ 1XMOL 2R93B 3HOXG 3FPUB 1X6OA 3NHHA 1PFNA 3Q6SA 4CDEC 1G2TA 4IOCA 5ISRA 1DCZA 2BOSA 2H4OA 2PQAB 3DHQA 1PRTD 3D4DA 2QDBA 3F2UA 4RGNA 2G9DA 3D3RA 4OELB 4C2MB 1ICFB 2D2CC 1HFGA 4NXMQ 1XPUA 1PYWD 1ZKOA 4IFDJ 2WINB 5FLXE 1PTOC 4OX9Q 4NP5A 1K8MA 3CC4A 2M2LA 1BO0A 1SYGA 4IPGA 5KGUA 1L0YB 4ZAIA 3TQYA 2ZT9C 2K5NA 1FNUA 3HOWG 2VS1A 1M1KC 1G2SA 3ULPA 1I94L 3BZKA 1QOHA 2V4DA 4YCUA 1MSGA 5FLMG 4HIKA 1JB7A 4A3JH 2F0SA 1ICWA 1QE6A 2EY1A 3FEWX 1N36Q 4A3GG 2CQAA 1GVPA 4RAUC 1PMRA 1STAA 3RN2A 2Z8LA 4H0LC 4B3TL 4R4CA 5KNBA 1AZQA 2E2JB 5FO9B 1Y1WB 1ASYA 3H0GB 1GKHA 2K32A 2NVYH 4XIGS 3U4ZA 3RLNA 4HSPA 1RCVD 3CW2C 3BJUA 1DZ1A 3I8ZA 1A3UA 4ZQ3A 5E4XA 5I2XA 4JI5L 1TWCH 1S40A 2DY7A 1UWVA 2J4XA 4DR4L 1JE4A 1V8QA 4GLAC 1I4XA 4ZKBB 3Q23A 1ENFA 1STBA 2B2TA 2Q2UA 3D6WA 2EPBA 2A74C 4BY7B 2N49A 2E76C 2AMCB 5M5YB 3Q0AA 3CCSA 4B3ML 4X64L 1NMFA 2UUAQ 1ZYRD 1DOKA 4GKJL 3QR8A 2NN6H 4AQYL 1L1OB 1OXXK 1HNWQ 1N34L 3LWUA 1Z6HA 3OPOA 4LF4L 3SHLA 2WIIB 1YHAA 1EQTA 3GO5A 4MIUA 3H3VH 1I4HA 2K50A 1WI5A 1KDCA 4JPBW 2KHIA 5GQOA 1CTMA 4PV1C 5KYIA 5KNDA 1WTQA 3PSIA 1V9PA 2O4XA 4IUUA 4I65A 2K5HA 4KI0A 3BU2A 3NTIA 3F2CA 1LTGD 1CM9A 1ZXTA 5FO7B 4KHPL 2PYKA 4DV2Q 1IXRA 4LF9Q 3GV6A 2B2UA 1Q7YC 1QILA 1T5XD 1TY2A 4O1NA 4AYBB 1QZHA 4RGOS 1B8AA 1EY9A 5DAUA 2M00A 3K5LA 1VQBA 2FMCA 2F52A 1RIPA 3CMAA 2Q8RE 2XRSD 2I5LX 2XNAC 3HOZH 5M3FB 3PUXA 3PUZA 5C3EG 3KF6B 1FD7D 1JJGA 4WORA 4U673 1JB3A 4LF5L 1EWIA 3RMHA 4HAEA 3NSWA 4JW0A 1MGSA 5C3XA 1XWEA 2F0EA 1VQPA 1DJRD 1BBWA 2VQEQ 1GM5A 1JOOA 3ICEA 3UE0A 4C1NK 5K5PA 2ES2A 1EWHA 4V0BA 1SE3A 4HEDA 4JI1L 4NXNL 4X66L 2K33A 3S15H 2IW3A 4QIWB 2XN9C 5CBEE 2CH4A 2B63G 1VQGA 3S17H 5JEAJ 1DYQA 2YV5A 1PYSB 4DV7L 4F7XA 4XT1B 5IWAQ 5C4JH 2UXBQ 4A3IG 3GTLH 4IUNA 1F9SA 5DM73 5FJ8G 2NVQH 2ZXPA 3S24A 1K3BC 3J81E 1HNXL 2E74C 2O5IC 1AFPA 2EVBA 1E0BA 5IT9c 2RCNA 1KABA 3S14H 4K5WA 1Y1WH 4IO9A 4DAYA 1V1OA 3BYTB 2XSCA 2WACA 4GOPA 1EIGA 3VR3A 1L2FA 4CBVA 2EJGC 3T51B 1IBLL 3KLSX 5C44H 3QIAA 3T53B 2L0CA 2YTVA 2QEXA 4A75A 2L55A 3I4OA 1YNND
chains in the Genus database with same CATH topology
2BA0A 1VQHA 2L15A 4YHHL 3FKIG 5BR8L 4PZ8A 1Y1WG 4HJ7A 4DUYQ 1YHQA 4UPAA 4AYBE 1MJEA 1LTLA 1HZCA 4X65Q 2JK8A 3GTGH 4B3SQ 3I4MG 3NELA 4JI7L 5BR8Q 3GTJH 1CKOA 4RMFA 1YHBA 2NVXH 5IYCH 4GNXC 4JCVE 4YWMA 4C3HH 3TRZA 1Y1VH 4DR7L 4BY1H 4NB3A 4LFBQ 3E9HA 4DV4Q 3LGJA 1EQRA 1U5KA 2Y0SE 3S1NH 4A3IH 2WFWA 5IYBG 1N9WA 2JE6I 3MXNB 3HOYG 1Z9FA 1TWAH 4OWXB 2CWAA 1NBWA 3I4NG 4B3SL 1KIXA 1Q81C 1U0LA 1W2BA 5C3EH 1PVOA 4JG2A 4TVAB 2Z6KC 2VQFL 1EQQA 1PHJA 1CSQA 3CPWA 1VQ8A 4BY1G 4YHHQ 4DK3C 3I56A 1HNZL 1KRTA 2LXJA 3KFUA 1E24A 2JEAI 1I3QH 2ASBA 2NVTH 3OTOQ 1PYBA 2AKWB 4X66Q 2R92H 2KBNA 2QGQA 5M5WH 5IY0A 1VQNA 2F3IA 1X56A 5C0XJ 2RHQB 2UXDL 1MIUA 3RLOA 2JA5G 1XNQQ 1VQEA 4A3LH 1N32Q 3FKIH 2PI2E 1NY4A 2V1CC 1X3GA 1JJCB 1QUQB 4QGUA 4LFCL 4LF6L 4LWCA 4JI6Q 4JBMA 4DV3L 3PV0A 1R9TH 4L5TA 1CKNB 3T1YL 1XNRL 1VQDA 4K0KL 2D62A 4JI3L 1TWFH 5M5XH 1KHIA 1YJ9A 3CPFA 1S3OA 1FJGQ 1Y14B 4DR2L 2JA7H 1N8RC 4A93G 4YCVA 1N36L 3ER0A 2VL6A 4A3KH 1YJNA 4BA1I 5IE8A 2VZAA 1KD1C 3GTMH 4PZ6A 2Q2TA 1TXYA 3H15A 3CD6A 5GADC 3H0GH 4LF5Q 3KOJA 2ZM6Q 3UE1A 2PI2A 3E9IA 2JA8G 1XNRQ 3DLLA 3AQQA 2R92G 4MTNA 2XTIA 3DM3A 3PUWA 3HFZB 1JT8A 3U50C 1C9OA 1LUZA 1HZBA 3K7UC 1EFWA 3HKZE 1XTDA 4JI8Q 4BBSG 4BXXH 4A3GH 3GDEA 1N32L 1TWGH 3AFQA 1HJPA 1O7IA 2BA1A 3ULLA 5H1SE 3ZJYC 3FP9A 1SMXA 2I5MX 3L0OA 3UDFA 4HIOA 3J7A5 1Z47A 3J80c 5JJLA 3J81i 4IJLA 4JOIC 2E2IH 1XPRA 4DR7Q 4R4IA 4BY7H 2JA6H 4GKKL 1HZ9A 3M9BA 1XNQL 1VQIA 1G291 1YNXA 4GN4B 4JI4Q 2ZTCA 1I5FA 3K81C 4JV5L 3I7FA 3EIVA 4LUVA 2IHFA 3U4VA 4R4OA 3S1RH 3RNUA 1CSPA 3OTOL 1VQ5A 1NMGA 4PMWA 4DKAC 3CCJA 1C7YA 3M4QA 2ID0A 2ZTDA 1X55A 1WJJA 3A5UA 2HIXA 2R6GA 2R7FA 1IBMQ 4DAYB 5LMNQ 1IZ6A 4JBKA 2VNUD 4LF4Q 5IP7G 1J6QA 1PFSA 1QVCA 4DV6Q 1QVFA 1HNWL 2MO0A 1N33Q 4JBWA 3CCVA 3S1MH 4GNXB 1C0AA 3CXCA 3G4SA 2OTLA 3FHWA 4LNQA 4MNOA 1OTCA 4OO1G 2IY5B 3UDIA 1SLJA 3TS0A 1T9HA 1VQCA 4P74A 4JI7Q 4DV2L 4AQYQ 5IP9H 1AE3A 4IFDG 3RLFA 4DV6L 2MO1A 1PA6A 4A4IA 5AJ3L 4DUYL 3PO2H 4GKJQ 1MKHA 1UE7A 3CF5A 1VQFA 2I5HA 3PIPA 1HZAA 1TWHH 1RL2A 2MFIA 3KF8B 3HOUG 3TREA 1P8LA 5C4XG 3NENA 4A3BG 1SFOH 2Q2IA 3KLWA 1XPOA 4LF8L 4A3CG 1IBKL 1PH7A 3HOYH 5M3MG 2C35B 4QQBX 3RZOH 2BH8A 4OXPA 2A1AA 1OXTA 3F8TA 5IP7H 4JI4L 4QJFA 1XMQL 1EOVA 1I50H 4KLKA 3CCUA 1YITA 2AHOB 1N34Q 1IBLQ 3PO3G 2D0OA 4GN5A 3M4OH 5JJIA 4KHZA 2EXDA 4ME3A 4YWKA 3U58A 3PF4A 2GVBA 4JI1Q 2PNHA 3T1HL 4NXNQ 5E7NA 4QIWE 2Z0SA 4EX5A 3KJPA 1VQOA 4OO1I 2B3GA 2R7ZH 4DV1L 3G71A 5C0XG 2KCMA 1X3FA 1YBYA 1A62A 4EQ5A 4HJ9A 3HKSA 2UUAL 2VUMH 3JC66 4WJ4A 1Q8KA 2CQOA 3WWVA 4GN3B 2UXBL 2KENA 2UU9Q 2YTXA 4BBRH 2ATWA 3M4PA 4XTCS 4GNXA 4A3EG 1HNXQ 1W3SA 2ZM6L 2E2JH 1WCMG 5HGQA 3HOVH 2JJQA 3B6YA 1WOCA 3CMEA 4JI0Q 1BVSA 1E1OA 2UU9L 5IWAL 3F2DA 3M7NA 4OWTB 4QL5A 1X3EA 2CWPA 1HR0Q 3H3VI 3GTQH 4DR6L 5DLQE 1UE1A 1HH2P 2DUDA 2RF4A 4UY8C 4YY3Q 3KF6A 1NTGA 5EAYA 4BXXG 4BBRG 2HT1A 2IT1A 2E2HH 3I55A 1Y1VG 3KDFA 4L5RC 1BBUA 1WCMH 2YTYA 1K83H 1KQSA 4GS3A 5C0XI 4A3BH 2UUCL 2UXCQ 1CUKA 1SROA 1NE3A 2WB1E 1VQKA 4B3TQ 4LF8Q 4OONA 5C44G 1FVIA 4DAMA 4DR3Q 2WB1G 3A74A 1Q1EA 3E0EA 4P75A 2VQEL 4LF9L 3PO3H 5LMNW 4Y52H 4DUZL 4A3MG 1G6PA 1YZ6A 1YIJA 3HOWH 1K0RA 5GROA 3G48A 3L2PA 1EYGA 1KL9A 5FJ8H 1VQAA 5IYBH 1NJIC 2F4VL 1YI2A 1AH9A 2VQFQ 1J5EQ 1XMOL 2GN5A 1MJCA 2K4KA 3HOXG 3TS2A 1X6OA 4DV5Q 1V1QA 4HJ8A 4JYAQ 4A3MH 4IOCA 4DNIA 3F2BA 1M90C 4H02A 4GOPB 5IYDH 3CCRA 1E1TA 1YEZA 3M85A 3S2DH 4LFBL 1XMOQ 4IPHA 1J5EL 2PQAB 3EN2A 3PCOB 3PUVA 3I4NH 3AFPA 4P72A 1K8AC 2OCEA 1IYJB 1JE5A 2A19A 2VY3A 2XGTA 4NPSA 1B7YB 1CKMA 5JEAG 4A3DG 1EIYB 2OQ0A 4X65L 4NXMQ 1XPUA 4KHPQ 4IFDJ 1ASZA 1D8LA 4B3MQ 1KXLA 4LUOA 4OX9Q 5M3FH 1B70B 2YYZA 3TEHB 3CC4A 4LF7L 2K52A 2ZJRA 3UDGA 2HHHL 1WFQA 4IPGA 1H95A 3W1BA 5IYCG 1E7ZA 3D0FA 3TQYA 4DR3L 3CCQA 2R93H 2K5NA 4X62Q 1SN8A 2ZTEA 2VS1A 4DR1Q 1M1KC 3HOWG 4JYAL 4JI2L 3ULPA 1I94L 4B3RQ 3K7AH 3I2ZA 3BZKA 3UDXA 4GLXA 3HOUH 2NZOA 4YCUA 1E22A 2VUMG 1A0IA 4RG1A 1PH1A 3RR5A 2Y0SG 5FLMG 4HIKA 1JB7A 1L1OC 4R1JA 4X64Q 1KAWA 2E8GA 3Q8DA 4DK6C 4A3JH 1YJWA 2N78A 1K3RA 5M5YH 3SGIA 4YY3L 2UUBL 1N36Q 4A3GG 1EIFA 4POFA 1HR0L 2YU9H 3GD7A 1S72A 1GVPA 1PH6A 1PH8A 3EBEA 3RN2A 2BH2A 3STBC 4B3TL 4R4CA 4JI3Q 1Q86C 2JA8H 4YWLA 4ALPA 4PG3A 2RHSB 4GOPC 1ASYA 4X6AH 2UUCQ 4JI5Q 1GKHA 2NVYH 4XIGS 3U4ZA 3RLNA 3KDFB 4BBSH 2IHEA 3CW2C 1PH9A 3ERSX 2E5LL 2E5LQ 4LF6Q 3BJUA 4GLVB 4DR5L 3S16H 3S1QH 4DV0Q 4DR4Q 1PH2A 4JI5L 1TWCH 1S40A 1Q12A 3M3YH 1I94Q 1UWVA 3A5ZB 5ELOA 3W1GA 4A3FH 4DV0L 3W5OA 5FLXc 4IPDA 4DR1L 4DR4L 4DR5Q 4GLAC 1Q82C 3JAMc 3BZCA 3KYHC 2VW9A 2ZJQA 1UE5A 2DGYA 3VDYA 2Q2UA 4A93H 3PIOA 5K36G 1L0WA 3MEFA 2OWOA 2N49A 1VQ4A 2LXKA 4LF7Q 3CC7A 2R7DA 2PMZE 1VS0A 2AMCB 1WYDA 1GO3E 3STBD 1A63A 5HY6A 4JOIA 3J81j 3KJOA 4HJAA 4MZ9A 4UP7A 3CCSA 4B3ML 4X64L 1NMFA 3IRBA 4P73A 2KCTA 4A3CH 2OQKA 2UUAQ 1AE2A 1P16A 4AIMA 3CCEA 2CCZA 2Z6KA 4IFDI 3CC2A 2JA7G 1PH3A 4GKJL 1GD7A 4JI2Q 1JJ2A 5AJ3Q 2JA5H 4A3LG 3T1HQ 1OXVA 3NEMA 4X62L 2H5XA 3CP0A 4TQUS 4AQYL 1PV4A 1L1OB 3AYHB 1OXXK 1N33L 1HNWQ 1N34L 4JBJA 4LF4L 3HKZG 1XMQQ 4A3FG 5C4XH 3PGZA 1YHAA 2HHHQ 1K8GA 3GO5A 3H3VH 3F1ZA 2K50A 1WI5A 2MNAA 4OX9L 4DV5L 3OYYA 2KHIA 4UP8A 4DPGA 5GQOA 5LMUQ 1VCIA 2D0PA 3PO2G 2K75A 2NN6I 4QY7A 4LUZA 4IOAA 3HOZG 2JEBI 3PSIA 4A3EH 1V9PA 3JAMi 3CCMA 1Q46A 1IBML 2K5HA 4KI0A 1EUJA 3H0GG 2A8VA 1SE8A 2MQHA 3BU2A 3D31A 4L5QA 3F2CA 2R7ZG 4GKKQ 2N8NA 4NXML 5M3MH 4KHPL 4DV2Q 1IXRA 2WAQE 5LMUL 4LF9Q 4C3IH 1Q7YC 3AEVA 1OXSC 2JQOA 4JV5Q 1Q1BA 1QVGA 1HR0W 2EQSA 1X9NA 1QZHA 1UE6A 4HJ5A 1B8AA 3GTOH 4J15A 4C2MH 3G6EA 3HOVG 1KRSA 4UP9A 1VQBA 1PH5A 5FLMH 4LFAQ 1VQMA 2F4VQ 4BY7G 3L7ZC 5ELNA 5LMNL 4JI8L 4A3JG 2F52A 1RIPA 3CMAA 1K73C 2B63H 2I5LX 1UEBA 1OXUA 3CAMA 3HOZH 4JC0A 4O2DA 2HIVA 3PUXA 3PUZA 5C3EG 1VQLA 1E3PA 4DUZQ 4DV7Q 3CCLA 1IL2A 3KF6B 2R93G 1X65A 1X54A 2JA9A 2K5VA 1JJGA 4O0AA 4DR2Q 3NBHB 4LF5L 2WAQG 2I0QA 4A76A 1EWIA 1V43A 2HQLA 4AH6A 1L1OA 3A0JA 1BKBA 1LYLA 4K0KQ 4Y7NH 4FDBA 3J7ZC 1VQ6A 3K80C 1VQPA 1PH4A 1VQ7A 1VQ9A 1BBWA 2NZHA 4DV3Q 4R4QA 4IPCA 2VQEQ 1GM5A 4POGA 1FJGL 3ICEA 3UE0A 4A3KG 2FXQA 2LSSA 2QA4A 2ES2A 2IX1A 3GTPH 1G51A 2B29A 4PZ7A 1DGSA 1JMCA 2UXCL 1FGUA 3T1YQ 3J81c 3J80i 1QZGA 4JI1L 4NXNL 4X66L 4JI6L 4P71A 3S15H 4DR6Q 1CKNA 5IP9G 4OWWB 1KC8C 2B63G 1VQGA 4JI0L 5JEAJ 3K0XA 3S17H 4LW1A 2CKZB 4BA2I 2YV5A 3K8AA 5GAEC 1HNZQ 3PUYA 5GAGC 1PYSB 2CFMA 4DV7L 2OTJA 1D7QA 2IX0A 2Q2HA 5IWAQ 5IYDG 5C4JH 1VQJA 2UXBQ 4A3IG 3GTLH 4WJ3M 1SRUA 5FJ8G 2ALYB 3ULJA 2NVQH 1K9MC 2JA6G 2EIFA 2N3SA 2UUBQ 3I4MH 3S24A 1SR3A 3PF5A 1HNXL 1A8VA 3RN5A 4LFAL 2AWNA 3CQZH 4AYBG 1YVCA 3HOXH 5IT9c 2PQAA 5J3BA 3OW2A 2RCNA 4APVA 5JJKA 1XJVA 4LFCQ 3S14H 1FL0A 4IJHA 2WP8J 2ZJPA 1Y1WH 1I6HH 4IO9A 4A3DH 4L5SA 3GTKH 4HIDA 2UXDQ 5GAHC 4DV1Q 4R4TA 4B3RL 2KHJA 2K14A 4GOPA 5M3FG 4C3JH 4DV4L 1IBKQ 1L2FA 1LM0A 3RZDH 4YCWA 4HIMA 1IBLL 2AWOA 2GVAA 3S2HH 5C44H 1QUQA 2QEXA 2YTVA 4A75A 3I4OA 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 A;  1VQH A;  2L15 A;  4YHH L;  3FKI G;  5BR8 L;  4PZ8 A;  1Y1W G;  4HJ7 A;  4DUY Q;  1YHQ A;  4UPA A;  4AYB E;  1MJE A;  1LTL A;  1HZC A;  4X65 Q;  2JK8 A;  3GTG H;  4B3S Q;  3I4M G;  3NEL A;  4JI7 L;  5BR8 Q;  3GTJ H;  1CKO A;  4RMF A;  1YHB A;  2NVX H;  5IYC H;  4GNX C;  4JCV E;  4YWM A;  4C3H H;  3TRZ A;  1Y1V H;  4DR7 L;  4BY1 H;  4NB3 A;  4LFB Q;  3E9H A;  4DV4 Q;  3LGJ A;  1EQR A;  1U5K A;  2Y0S E;  3S1N H;  4A3I H;  2WFW A;  5IYB G;  1N9W A;  2JE6 I;  3MXN B;  3HOY G;  1Z9F A;  1TWA H;  4OWX B;  2CWA A;  1NBW A;  3I4N G;  4B3S L;  1KIX A;  1Q81 C;  1U0L A;  1W2B A;  5C3E H;  1PVO A;  4JG2 A;  4TVA B;  2Z6K C;  2VQF L;  1EQQ A;  1PHJ A;  1CSQ A;  3CPW A;  1VQ8 A;  4BY1 G;  4YHH Q;  4DK3 C;  3I56 A;  1HNZ L;  1KRT A;  2LXJ A;  3KFU A;  1E24 A;  2JEA I;  1I3Q H;  2ASB A;  2NVT H;  3OTO Q;  1PYB A;  2AKW B;  4X66 Q;  2R92 H;  2KBN A;  2QGQ A;  5M5W H;  5IY0 A;  1VQN A;  2F3I A;  1X56 A;  5C0X J;  2RHQ B;  2UXD L;  1MIU A;  3RLO A;  2JA5 G;  1XNQ Q;  1VQE A;  4A3L H;  1N32 Q;  3FKI H;  2PI2 E;  1NY4 A;  2V1C C;  1X3G A;  1JJC B;  1QUQ B;  4QGU A;  4LFC L;  4LF6 L;  4LWC A;  4JI6 Q;  4JBM A;  4DV3 L;  3PV0 A;  1R9T H;  4L5T A;  1CKN B;  3T1Y L;  1XNR L;  1VQD A;  4K0K L;  2D62 A;  4JI3 L;  1TWF H;  5M5X H;  1KHI A;  1YJ9 A;  3CPF A;  1S3O A;  1FJG Q;  1Y14 B;  4DR2 L;  2JA7 H;  1N8R C;  4A93 G;  4YCV A;  1N36 L;  3ER0 A;  2VL6 A;  4A3K H;  1YJN A;  4BA1 I;  5IE8 A;  2VZA A;  1KD1 C;  3GTM H;  4PZ6 A;  2Q2T A;  1TXY A;  3H15 A;  3CD6 A;  5GAD C;  3H0G H;  4LF5 Q;  3KOJ A;  2ZM6 Q;  3UE1 A;  2PI2 A;  3E9I A;  2JA8 G;  1XNR Q;  3DLL A;  3AQQ A;  2R92 G;  4MTN A;  2XTI A;  3DM3 A;  3PUW A;  3HFZ B;  1JT8 A;  3U50 C;  1C9O A;  1LUZ A;  1HZB A;  3K7U C;  1EFW A;  3HKZ E;  1XTD A;  4JI8 Q;  4BBS G;  4BXX H;  4A3G H;  3GDE A;  1N32 L;  1TWG H;  3AFQ A;  1HJP A;  1O7I A;  2BA1 A;  3ULL A;  5H1S E;  3ZJY C;  3FP9 A;  1SMX A;  2I5M X;  3L0O A;  3UDF A;  4HIO A;  3J7A 5;  1Z47 A;  3J80 c;  5JJL A;  3J81 i;  4IJL A;  4JOI C;  2E2I H;  1XPR A;  4DR7 Q;  4R4I A;  4BY7 H;  2JA6 H;  4GKK L;  1HZ9 A;  3M9B A;  1XNQ L;  1VQI A;  1G29 1;  1YNX A;  4GN4 B;  4JI4 Q;  2ZTC A;  1I5F A;  3K81 C;  4JV5 L;  3I7F A;  3EIV A;  4LUV A;  2IHF A;  3U4V A;  4R4O A;  3S1R H;  3RNU A;  1CSP A;  3OTO L;  1VQ5 A;  1NMG A;  4PMW A;  4DKA C;  3CCJ A;  1C7Y A;  3M4Q A;  2ID0 A;  2ZTD A;  1X55 A;  1WJJ A;  3A5U A;  2HIX A;  2R6G A;  2R7F A;  1IBM Q;  4DAY B;  5LMN Q;  1IZ6 A;  4JBK A;  2VNU D;  4LF4 Q;  5IP7 G;  1J6Q A;  1PFS A;  1QVC A;  4DV6 Q;  1QVF A;  1HNW L;  2MO0 A;  1N33 Q;  4JBW A;  3CCV A;  3S1M H;  4GNX B;  1C0A A;  3CXC A;  3G4S A;  2OTL A;  3FHW A;  4LNQ A;  4MNO A;  1OTC A;  4OO1 G;  2IY5 B;  3UDI A;  1SLJ A;  3TS0 A;  1T9H A;  1VQC A;  4P74 A;  4JI7 Q;  4DV2 L;  4AQY Q;  5IP9 H;  1AE3 A;  4IFD G;  3RLF A;  4DV6 L;  2MO1 A;  1PA6 A;  4A4I A;  5AJ3 L;  4DUY L;  3PO2 H;  4GKJ Q;  1MKH A;  1UE7 A;  3CF5 A;  1VQF A;  2I5H A;  3PIP A;  1HZA A;  1TWH H;  1RL2 A;  2MFI A;  3KF8 B;  3HOU G;  3TRE A;  1P8L A;  5C4X G;  3NEN A;  4A3B G;  1SFO H;  2Q2I A;  3KLW A;  1XPO A;  4LF8 L;  4A3C G;  1IBK L;  1PH7 A;  3HOY H;  5M3M G;  2C35 B;  4QQB X;  3RZO H;  2BH8 A;  4OXP A;  2A1A A;  1OXT A;  3F8T A;  5IP7 H;  4JI4 L;  4QJF A;  1XMQ L;  1EOV A;  1I50 H;  4KLK A;  3CCU A;  1YIT A;  2AHO B;  1N34 Q;  1IBL Q;  3PO3 G;  2D0O A;  4GN5 A;  3M4O H;  5JJI A;  4KHZ A;  2EXD A;  4ME3 A;  4YWK A;  3U58 A;  3PF4 A;  2GVB A;  4JI1 Q;  2PNH A;  3T1H L;  4NXN Q;  5E7N A;  4QIW E;  2Z0S A;  4EX5 A;  3KJP A;  1VQO A;  4OO1 I;  2B3G A;  2R7Z H;  4DV1 L;  3G71 A;  5C0X G;  2KCM A;  1X3F A;  1YBY A;  1A62 A;  4EQ5 A;  4HJ9 A;  3HKS A;  2UUA L;  2VUM H;  3JC6 6;  4WJ4 A;  1Q8K A;  2CQO A;  3WWV A;  4GN3 B;  2UXB L;  2KEN A;  2UU9 Q;  2YTX A;  4BBR H;  2ATW A;  3M4P A;  4XTC S;  4GNX A;  4A3E G;  1HNX Q;  1W3S A;  2ZM6 L;  2E2J H;  1WCM G;  5HGQ A;  3HOV H;  2JJQ A;  3B6Y A;  1WOC A;  3CME A;  4JI0 Q;  1BVS A;  1E1O A;  2UU9 L;  5IWA L;  3F2D A;  3M7N A;  4OWT B;  4QL5 A;  1X3E A;  2CWP A;  1HR0 Q;  3H3V I;  3GTQ H;  4DR6 L;  5DLQ E;  1UE1 A;  1HH2 P;  2DUD A;  2RF4 A;  4UY8 C;  4YY3 Q;  3KF6 A;  1NTG A;  5EAY A;  4BXX G;  4BBR G;  2HT1 A;  2IT1 A;  2E2H H;  3I55 A;  1Y1V G;  3KDF A;  4L5R C;  1BBU A;  1WCM H;  2YTY A;  1K83 H;  1KQS A;  4GS3 A;  5C0X I;  4A3B H;  2UUC L;  2UXC Q;  1CUK A;  1SRO A;  1NE3 A;  2WB1 E;  1VQK A;  4B3T Q;  4LF8 Q;  4OON A;  5C44 G;  1FVI A;  4DAM A;  4DR3 Q;  2WB1 G;  3A74 A;  1Q1E A;  3E0E A;  4P75 A;  2VQE L;  4LF9 L;  3PO3 H;  5LMN W;  4Y52 H;  4DUZ L;  4A3M G;  1G6P A;  1YZ6 A;  1YIJ A;  3HOW H;  1K0R A;  5GRO A;  3G48 A;  3L2P A;  1EYG A;  1KL9 A;  5FJ8 H;  1VQA A;  5IYB H;  1NJI C;  2F4V L;  1YI2 A;  1AH9 A;  2VQF Q;  1J5E Q;  1XMO L;  2GN5 A;  1MJC A;  2K4K A;  3HOX G;  3TS2 A;  1X6O A;  4DV5 Q;  1V1Q A;  4HJ8 A;  4JYA Q;  4A3M H;  4IOC A;  4DNI A;  3F2B A;  1M90 C;  4H02 A;  4GOP B;  5IYD H;  3CCR A;  1E1T A;  1YEZ A;  3M85 A;  3S2D H;  4LFB L;  1XMO Q;  4IPH A;  1J5E L;  2PQA B;  3EN2 A;  3PCO B;  3PUV A;  3I4N H;  3AFP A;  4P72 A;  1K8A C;  2OCE A;  1IYJ B;  1JE5 A;  2A19 A;  2VY3 A;  2XGT A;  4NPS A;  1B7Y B;  1CKM A;  5JEA G;  4A3D G;  1EIY B;  2OQ0 A;  4X65 L;  4NXM Q;  1XPU A;  4KHP Q;  4IFD J;  1ASZ A;  1D8L A;  4B3M Q;  1KXL A;  4LUO A;  4OX9 Q;  5M3F H;  1B70 B;  2YYZ A;  3TEH B;  3CC4 A;  4LF7 L;  2K52 A;  2ZJR A;  3UDG A;  2HHH L;  1WFQ A;  4IPG A;  1H95 A;  3W1B A;  5IYC G;  1E7Z A;  3D0F A;  3TQY A;  4DR3 L;  3CCQ A;  2R93 H;  2K5N A;  4X62 Q;  1SN8 A;  2ZTE A;  2VS1 A;  4DR1 Q;  1M1K C;  3HOW G;  4JYA L;  4JI2 L;  3ULP A;  1I94 L;  4B3R Q;  3K7A H;  3I2Z A;  3BZK A;  3UDX A;  4GLX A;  3HOU H;  2NZO A;  4YCU A;  1E22 A;  2VUM G;  1A0I A;  4RG1 A;  1PH1 A;  3RR5 A;  2Y0S G;  5FLM G;  4HIK A;  1JB7 A;  1L1O C;  4R1J A;  4X64 Q;  1KAW A;  2E8G A;  3Q8D A;  4DK6 C;  4A3J H;  1YJW A;  2N78 A;  1K3R A;  5M5Y H;  3SGI A;  4YY3 L;  2UUB L;  1N36 Q;  4A3G G;  1EIF A;  4POF A;  1HR0 L;  2YU9 H;  3GD7 A;  1S72 A;  1GVP A;  1PH6 A;  1PH8 A;  3EBE A;  3RN2 A;  2BH2 A;  3STB C;  4B3T L;  4R4C A;  4JI3 Q;  1Q86 C;  2JA8 H;  4YWL A;  4ALP A;  4PG3 A;  2RHS B;  4GOP C;  1ASY A;  4X6A H;  2UUC Q;  4JI5 Q;  1GKH A;  2NVY H;  4XIG S;  3U4Z A;  3RLN A;  3KDF B;  4BBS H;  2IHE A;  3CW2 C;  1PH9 A;  3ERS X;  2E5L L;  2E5L Q;  4LF6 Q;  3BJU A;  4GLV B;  4DR5 L;  3S16 H;  3S1Q H;  4DV0 Q;  4DR4 Q;  1PH2 A;  4JI5 L;  1TWC H;  1S40 A;  1Q12 A;  3M3Y H;  1I94 Q;  1UWV A;  3A5Z B;  5ELO A;  3W1G A;  4A3F H;  4DV0 L;  3W5O A;  5FLX c;  4IPD A;  4DR1 L;  4DR4 L;  4DR5 Q;  4GLA C;  1Q82 C;  3JAM c;  3BZC A;  3KYH C;  2VW9 A;  2ZJQ A;  1UE5 A;  2DGY A;  3VDY A;  2Q2U A;  4A93 H;  3PIO A;  5K36 G;  1L0W A;  3MEF A;  2OWO A;  2N49 A;  1VQ4 A;  2LXK A;  4LF7 Q;  3CC7 A;  2R7D A;  2PMZ E;  1VS0 A;  2AMC B;  1WYD A;  1GO3 E;  3STB D;  1A63 A;  5HY6 A;  4JOI A;  3J81 j;  3KJO A;  4HJA A;  4MZ9 A;  4UP7 A;  3CCS A;  4B3M L;  4X64 L;  1NMF A;  3IRB A;  4P73 A;  2KCT A;  4A3C H;  2OQK A;  2UUA Q;  1AE2 A;  1P16 A;  4AIM A;  3CCE A;  2CCZ A;  2Z6K A;  4IFD I;  3CC2 A;  2JA7 G;  1PH3 A;  4GKJ L;  1GD7 A;  4JI2 Q;  1JJ2 A;  5AJ3 Q;  2JA5 H;  4A3L G;  3T1H Q;  1OXV A;  3NEM A;  4X62 L;  2H5X A;  3CP0 A;  4TQU S;  4AQY L;  1PV4 A;  1L1O B;  3AYH B;  1OXX K;  1N33 L;  1HNW Q;  1N34 L;  4JBJ A;  4LF4 L;  3HKZ G;  1XMQ Q;  4A3F G;  5C4X H;  3PGZ A;  1YHA A;  2HHH Q;  1K8G A;  3GO5 A;  3H3V H;  3F1Z A;  2K50 A;  1WI5 A;  2MNA A;  4OX9 L;  4DV5 L;  3OYY A;  2KHI A;  4UP8 A;  4DPG A;  5GQO A;  5LMU Q;  1VCI A;  2D0P A;  3PO2 G;  2K75 A;  2NN6 I;  4QY7 A;  4LUZ A;  4IOA A;  3HOZ G;  2JEB I;  3PSI A;  4A3E H;  1V9P A;  3JAM i;  3CCM A;  1Q46 A;  1IBM L;  2K5H A;  4KI0 A;  1EUJ A;  3H0G G;  2A8V A;  1SE8 A;  2MQH A;  3BU2 A;  3D31 A;  4L5Q A;  3F2C A;  2R7Z G;  4GKK Q;  2N8N A;  4NXM L;  5M3M H;  4KHP L;  4DV2 Q;  1IXR A;  2WAQ E;  5LMU L;  4LF9 Q;  4C3I H;  1Q7Y C;  3AEV A;  1OXS C;  2JQO A;  4JV5 Q;  1Q1B A;  1QVG A;  1HR0 W;  2EQS A;  1X9N A;  1QZH A;  1UE6 A;  4HJ5 A;  1B8A A;  3GTO H;  4J15 A;  4C2M H;  3G6E A;  3HOV G;  1KRS A;  4UP9 A;  1VQB A;  1PH5 A;  5FLM H;  4LFA Q;  1VQM A;  2F4V Q;  4BY7 G;  3L7Z C;  5ELN A;  5LMN L;  4JI8 L;  4A3J G;  2F52 A;  1RIP A;  3CMA A;  1K73 C;  2B63 H;  2I5L X;  1UEB A;  1OXU A;  3CAM A;  3HOZ H;  4JC0 A;  4O2D A;  2HIV A;  3PUX A;  3PUZ A;  5C3E G;  1VQL A;  1E3P A;  4DUZ Q;  4DV7 Q;  3CCL A;  1IL2 A;  3KF6 B;  2R93 G;  1X65 A;  1X54 A;  2JA9 A;  2K5V A;  1JJG A;  4O0A A;  4DR2 Q;  3NBH B;  4LF5 L;  2WAQ G;  2I0Q A;  4A76 A;  1EWI A;  1V43 A;  2HQL A;  4AH6 A;  1L1O A;  3A0J A;  1BKB A;  1LYL A;  4K0K Q;  4Y7N H;  4FDB A;  3J7Z C;  1VQ6 A;  3K80 C;  1VQP A;  1PH4 A;  1VQ7 A;  1VQ9 A;  1BBW A;  2NZH A;  4DV3 Q;  4R4Q A;  4IPC A;  2VQE Q;  1GM5 A;  4POG A;  1FJG L;  3ICE A;  3UE0 A;  4A3K G;  2FXQ A;  2LSS A;  2QA4 A;  2ES2 A;  2IX1 A;  3GTP H;  1G51 A;  2B29 A;  4PZ7 A;  1DGS A;  1JMC A;  2UXC L;  1FGU A;  3T1Y Q;  3J81 c;  3J80 i;  1QZG A;  4JI1 L;  4NXN L;  4X66 L;  4JI6 L;  4P71 A;  3S15 H;  4DR6 Q;  1CKN A;  5IP9 G;  4OWW B;  1KC8 C;  2B63 G;  1VQG A;  4JI0 L;  5JEA J;  3K0X A;  3S17 H;  4LW1 A;  2CKZ B;  4BA2 I;  2YV5 A;  3K8A A;  5GAE C;  1HNZ Q;  3PUY A;  5GAG C;  1PYS B;  2CFM A;  4DV7 L;  2OTJ A;  1D7Q A;  2IX0 A;  2Q2H A;  5IWA Q;  5IYD G;  5C4J H;  1VQJ A;  2UXB Q;  4A3I G;  3GTL H;  4WJ3 M;  1SRU A;  5FJ8 G;  2ALY B;  3ULJ A;  2NVQ H;  1K9M C;  2JA6 G;  2EIF A;  2N3S A;  2UUB Q;  3I4M H;  3S24 A;  1SR3 A;  3PF5 A;  1HNX L;  1A8V A;  3RN5 A;  4LFA L;  2AWN A;  3CQZ H;  4AYB G;  1YVC A;  3HOX H;  5IT9 c;  2PQA A;  5J3B A;  3OW2 A;  2RCN A;  4APV A;  5JJK A;  1XJV A;  4LFC Q;  3S14 H;  1FL0 A;  4IJH A;  2WP8 J;  2ZJP A;  1Y1W H;  1I6H H;  4IO9 A;  4A3D H;  4L5S A;  3GTK H;  4HID A;  2UXD Q;  5GAH C;  4DV1 Q;  4R4T A;  4B3R L;  2KHJ A;  2K14 A;  4GOP A;  5M3F G;  4C3J H;  4DV4 L;  1IBK Q;  1L2F A;  1LM0 A;  3RZD H;  4YCW A;  4HIM A;  1IBL L;  2AWO A;  2GVA A;  3S2H H;  5C44 H;  1QUQ A;  2QEX A;  2YTV A;  4A75 A;  3I4O A;  2NN6 G; 
#chains in the Genus database with same CATH topology
 2PMZ B;  1VQH A;  4YHH L;  2NVT B;  1MHW C;  4FP5 D;  4HJ7 A;  3MEH A;  4A93 B;  4BS9 A;  4C56 C;  3BDO A;  3I4M G;  3W2D A;  3E0J A;  2NVX H;  5IYC H;  2Z1C A;  4YWM A;  4TKO B;  3S2D B;  4DR7 L;  3E9H A;  4DV4 Q;  2VB3 X;  2MHV A;  3ITP A;  4A3I H;  2F0P A;  2WFW A;  3HOY G;  4BBR B;  3S14 B;  4OWX B;  1NBW A;  1JWM D;  2J7Z A;  4B3S L;  4IUV A;  1U0L A;  3NBI A;  1W2B A;  2QIL A;  1EQQ A;  3PIO 3;  3RZD B;  3TSS A;  1KRT A;  1J9O A;  3KFU A;  1E24 A;  4J1M A;  3WOE A;  3DEP A;  4U68 A;  4X66 Q;  4XQQ A;  1JOK A;  2YU9 B;  1BCP D;  2KOL A;  5M5W H;  5IY0 A;  2F3I A;  1X56 A;  3SK8 A;  4WRD A;  2JA5 G;  1XNQ Q;  1N32 Q;  2E2I B;  1X3G A;  1JJC B;  4QGU A;  1PTO H;  1MBY A;  3OMG A;  4JI6 Q;  4DV3 L;  5D3I B;  1XNR L;  4ZYS A;  2KCN A;  4K0K L;  3QO2 A;  3CPF A;  2E75 C;  1AEX A;  4A93 G;  4YCV A;  3ER0 A;  2VL6 A;  3KK7 A;  5IE8 A;  2VZA A;  1KD1 C;  1H9K A;  3H6M A;  3OWE B;  2Q2T A;  1TXY A;  3H15 A;  1G91 A;  2O2L D;  5EKI A;  1AP0 A;  2R3Z A;  3E9I A;  2R92 G;  2BCO A;  3J7A V;  4MTN A;  1LTS D;  1NR4 A;  1SMY C;  3I90 A;  3L3O C;  1LUZ A;  3HKZ E;  1XTD A;  4Y7N B;  1TWG H;  1HJP A;  4X3S A;  3ZJY C;  1LTR D;  4K14 A;  2KA7 A;  5FO8 B;  4KKT A;  5JJL A;  3J80 c;  5C3E B;  5IGG A;  4DR7 Q;  4R4I A;  2IX3 A;  3FRP B;  3M9B A;  1G29 1;  1YNX A;  2ZTC A;  4JV5 L;  4K8J A;  3U4V A;  1EIH A;  4UDU C;  3OWF A;  3SK4 A;  2NBF A;  3CCJ A;  2ZTD A;  3OHX C;  2L4N A;  1U4P A;  4LF4 Q;  3VR2 A;  1HNW L;  5E3F A;  1LT4 D;  3TDQ A;  4FXK C;  3CXC A;  3NPP A;  3D8G A;  2QF7 A;  4B9W A;  5IP9 H;  1AE3 A;  3GTO B;  4ZUI A;  5ELF A;  3RLF A;  3TP6 A;  1RHP A;  1S5E D;  4DUY L;  2L9H A;  2F4I A;  3AB9 A;  1UE7 A;  5E1F A;  1TWH H;  1RL2 A;  1Q8I A;  1P8L A;  1SNQ A;  1FR3 A;  5C3W A;  1KNE A;  4RFB A;  5M3M G;  2C35 B;  4FNF A;  5CV9 A;  2A1A A;  5IP7 H;  2BE5 D;  3OIQ A;  1IBL Q;  2KQ3 A;  2D0O A;  2EXD A;  1I4Q A;  1Q3L A;  3VA5 A;  3T1H L;  1JIC A;  4LK1 C;  2R7Z H;  1X3F A;  2EJF C;  5KNC A;  3IKJ A;  4WJ4 A;  4HMI A;  2CQO A;  3S1M B;  1G8Z D;  3WWV A;  1KNA A;  2KEN A;  2ATW A;  1HNX Q;  2E2J H;  1CHP D;  1ML0 D;  1WCM G;  3C1F A;  3CME A;  3RZO B;  1E1O A;  5IWA L;  3M7N A;  3H3V I;  3H91 A;  5DLQ E;  2F0V A;  4E6I A;  2KJX A;  2RF4 A;  2F0H A;  2MGS A;  4YY3 Q;  4UY8 C;  3O13 A;  1NTG A;  3DEO A;  2NVQ B;  4BXX G;  2HT1 A;  3J81 L;  2R7Z B;  2L11 A;  4TSS A;  4L5R C;  1AZP A;  3IAY A;  2DN8 A;  1BBU A;  1SAP A;  2NTT A;  3I4L A;  4GS3 A;  1B9N A;  4FVM A;  4KHV A;  2UUC L;  1CUK A;  1C4Q A;  4QMG A;  1NE3 A;  2MUY A;  4LF8 Q;  4OON A;  3GTM B;  3A74 A;  2VQE L;  3E0E A;  1ENA A;  1LTB D;  2HD3 A;  3SDZ A;  3AMU A;  4C3J B;  3HOV B;  4DNT B;  5LMN W;  3GTL B;  2Y0S B;  1G6P A;  3NBH A;  5M3M B;  1KLG D;  1K0R A;  5BN3 A;  4XYO A;  1DXM A;  1QJO A;  4DF7 A;  2EE1 A;  1MJC A;  2H1E A;  2K4K A;  5IT9 L;  1X32 A;  1V1Q A;  2WKD A;  4JYA Q;  4A3M H;  4GOP B;  5IYD H;  5CR3 A;  3S2D H;  1EFI D;  4LFB L;  1XMO Q;  4IPH A;  1GUS A;  4CGY B;  1CT1 D;  3PCO B;  3PUV A;  3I4N H;  5LL6 X;  5I4D A;  2OCE A;  5D65 A;  1TS5 A;  1B53 A;  2VXW A;  2XGT A;  2F0F A;  1EIY B;  4KHP Q;  1NNX A;  1ASZ A;  1D8L A;  1S4Z A;  4B3M Q;  4OHJ A;  5ELB A;  4BBS B;  5M3F H;  3TEH B;  3FVQ A;  2K52 A;  4EQP A;  2ZJR A;  2HHH L;  1ESF A;  1U4L A;  1I3Q B;  3W1B A;  1SNM A;  1E7Z A;  1Y8P B;  4P2C B;  4CKB A;  5K36 H;  4X62 Q;  1SN8 A;  5CV6 A;  1FYC A;  1F2L A;  4B3R Q;  5IOC A;  3K7A H;  2O5J C;  4ZLT F;  2VB2 X;  2NZO A;  4C3J G;  1E22 A;  4RG1 A;  2Y0S G;  1L1O C;  1KAW A;  2E8G A;  4DK6 C;  2N78 A;  4K2L A;  4FF1 A;  3SGI A;  1BCP B;  1ZYR C;  2UUB L;  1LAB A;  2HQE A;  1PH6 A;  3HOX B;  3EBE A;  2BH2 A;  3X3M A;  1Q86 C;  3QB3 A;  3FKI B;  5DEH A;  4DXF A;  5CV4 A;  1AN8 A;  3KDF B;  4BBS H;  1ONL A;  2IHE A;  1HPC A;  2E5L L;  3FMC A;  3TBI B;  1PH2 A;  1I94 Q;  5ELO A;  3W1G A;  4A3F H;  2K05 A;  5FLX c;  4IPD A;  1B3A A;  4Q0F A;  2Z4I A;  4A3D B;  1Q82 C;  3HOU B;  3P7J A;  2ZJQ A;  3VDY A;  3UI2 A;  3DWQ A;  3OOC A;  1R4Q B;  5K36 G;  1L0W A;  2L1B A;  2LXK A;  4LF7 Q;  3CC7 A;  2R7D A;  3NQT A;  1GO3 E;  3GTJ B;  1A63 A;  3J81 j;  3KJO A;  1OO9 B;  3HP3 A;  3HRZ C;  2F0L A;  2OQK A;  4A3C H;  4AIM A;  1XXG A;  1LAC A;  1PH3 A;  4JI2 Q;  5AJ3 Q;  5COY A;  5I6W A;  2SEB D;  3A54 A;  2LKV A;  1RKN A;  5I6Y A;  4H7B A;  2EYP A;  5L37 A;  2EY2 A;  4I7A A;  1EL0 A;  4DPG A;  2D0P A;  1WTV A;  2JEB I;  4A3E H;  3CCM A;  4FF4 A;  1PTO D;  1U9R A;  2A8V A;  2MQH A;  2R7Z G;  3D31 A;  2N8N A;  2CHB D;  4NXM L;  5EBD A;  4C3I H;  2JQO A;  3EA6 A;  4KK7 A;  1QVG A;  1HR0 W;  1D1K A;  1PRT C;  1FNV A;  3MVV A;  1VDZ A;  3AU7 A;  3G6E A;  1KRS A;  5JOB A;  5CV5 A;  1EEI D;  1GOZ A;  4LFA Q;  1VQM A;  3L7Z C;  2F4V Q;  3I3C A;  4BY7 G;  5LMN L;  3U9O A;  3E6Z X;  1VQL A;  2HIV A;  4EQO A;  1IYV A;  1X65 A;  3FPP A;  3MWY W;  4ULL A;  2JA7 B;  2KED A;  5KEE A;  1ROD A;  3QJY A;  4K0K Q;  1YNJ C;  4FDB A;  2BDO A;  3K80 C;  2K6A A;  1I4G A;  1VQ9 A;  3R3O A;  2L12 A;  2NZH A;  4DV3 Q;  2LS0 1;  4POG A;  5LHY 1;  3GTK B;  2K28 A;  2IX1 A;  2FXQ A;  5I9P A;  1G51 A;  1D6E C;  1DGS A;  1FGU A;  3J80 i;  3GQB A;  1GUG A;  5CYU A;  2BE5 C;  3IFD A;  4P71 A;  1CKN A;  1DD2 A;  1R4P B;  4FYD A;  2L5T A;  1HTP A;  4LW1 A;  2KHS A;  3C3L A;  1IKM A;  3L9A X;  3K8A A;  1WD1 A;  2OTJ A;  1DOL A;  2EYJ A;  5IGD A;  5IYD G;  1SRU A;  3HOW B;  3URY A;  2UUB Q;  3V2T A;  1SR3 A;  3RN5 A;  3P1H A;  3HOX H;  2MPM A;  2RBM A;  1H9S B;  2PQA A;  3D4W A;  4XXE A;  3OW2 A;  4APV A;  2PPB C;  4FXG C;  2UXD Q;  5GAH C;  4DV1 Q;  4R4T A;  4B3R L;  1GUW A;  1SEB D;  5M3F G;  3PO3 B;  1IBK Q;  1LM0 A;  1B1Z A;  1GHJ A;  1SNO A;  2AWO A;  4K5V A;  3MTS A;  3NWT A;  3S2H H;  2G9H D;  1A15 A;  1NUC A;  2EDG A;  2L15 A;  4HR7 B;  1YNN C;  4PZ8 A;  2B2W A;  1Y1W G;  3CRL C;  1YHQ A;  1MJE A;  4KY5 A;  2F0T A;  3GV3 A;  4X65 Q;  2N88 A;  3GTG H;  4WFN 3;  3C1E A;  4JI7 L;  1EY0 A;  5BR8 Q;  3GTJ H;  4RMF A;  2IPK D;  1HUM A;  4JCV E;  5E4W C;  4C3H H;  3TRZ A;  2A6E C;  1CQF A;  1WTH A;  3E5S A;  4LFB Q;  3HGB A;  1U5K A;  5IYB G;  3MA2 B;  1JWS D;  1PZK D;  3NUC A;  4XYQ A;  1PVO A;  4G4K A;  1D5X C;  1VQ8 A;  4YHH Q;  1M4V A;  3D6C A;  2B2Y C;  1HQM C;  1STH A;  5KYL A;  3DMU A;  1KLU D;  5CBA E;  5A2Q E;  1E2Z A;  2K1B A;  1PFB A;  5C0X J;  2UXD L;  2SNM A;  4XDX A;  2PI2 E;  4HN7 A;  3MZ5 A;  4LWC A;  2JN4 A;  3HOZ B;  1BCP C;  2D62 A;  3GTP B;  3PMF A;  4R8N A;  1SYF A;  3ND9 A;  1FJG Q;  1Y14 B;  1N8R C;  1WD0 A;  4DNR B;  4ABN A;  4X3U A;  1RF2 D;  1YJN A;  4BA1 I;  2JSO A;  4PZ6 A;  5GAD C;  1O7Z A;  4L8J A;  3KOJ A;  2AQ3 B;  2PI2 A;  2JA8 G;  3DLL A;  3AQQ A;  2B2T C;  2EYM A;  2XTI A;  3HFZ B;  3EFX D;  1HZB A;  4BXX H;  3GDE A;  3AFQ A;  5M5W B;  1O7I A;  3I4N B;  2TMP A;  2F0M A;  1F9Q A;  4KY6 A;  3FDT A;  1SMX A;  4ILW A;  4HIO A;  2B2W C;  4JOI C;  1VMC A;  2LFN A;  2JA6 H;  4KKS A;  1XNQ L;  2G5D A;  1VQI A;  2EYO A;  5C4J B;  3DXJ C;  1I5F A;  1Z7T A;  2IHF A;  5CGK A;  2A68 C;  3S1R H;  2VUM B;  1CSP A;  3R2I A;  1T5E A;  5CV7 A;  4IUR A;  4FXD A;  1NMG A;  5JPM C;  2AUJ D;  3CKI B;  1V1P A;  2HIX A;  2R6G A;  1JC7 A;  1UAP A;  2X6L A;  4PMC A;  1IZ6 A;  1TII D;  2Q8I B;  5LMN Q;  1IBM Q;  1JOQ A;  5EKL A;  2PZW A;  2NZ1 D;  4GNX B;  3VYR A;  3HG9 A;  3FHW A;  3TP7 A;  2A6H D;  1SYB A;  1OTC A;  4OO1 G;  3UDI A;  3TS0 A;  1T9H A;  4CKE A;  4L6T B;  4DV2 L;  4DK0 A;  4IFD G;  4B08 A;  1PA6 A;  4A4I A;  5AJ3 L;  3PO2 H;  1ET9 A;  5EQ0 A;  2JA6 B;  5G3L D;  2KUM A;  5C44 B;  3KF8 B;  4I7Z C;  5C4X G;  1EY4 A;  2Q2I A;  4EGV A;  3QG1 A;  3RZO H;  2BH8 A;  1OXT A;  1K83 B;  4PNY A;  3M3Y B;  4KLK A;  4M8A A;  3PO3 G;  4J8Q A;  3N52 A;  1TWA B;  4ZKC B;  1LT6 D;  4CDF C;  3PF4 A;  2PNH A;  4CDD C;  5E7N A;  2F3V A;  1VQO A;  1B9M A;  2PW5 A;  2KCM A;  3H3V C;  1A62 A;  5J1Z A;  4HJ9 A;  3HKS A;  3JC6 6;  2YTX A;  5BN4 A;  2HCI A;  4A3F B;  2PNR C;  4XTC S;  3PQI A;  4GNX A;  4R8I A;  4ID6 A;  5EBC A;  4MN3 A;  4JI0 Q;  3MAQ A;  2UU9 L;  3F2D A;  3NK9 A;  1SYE A;  3PO2 B;  1EYC A;  2CWP A;  4IAL A;  1A2T A;  3NE5 B;  3JAM E;  1HH2 P;  1PTO B;  4IUT A;  2K5Q A;  1SND A;  3TZD A;  2IT1 A;  2E2H H;  3I55 A;  1K8O A;  1SMY D;  1JQY D;  1WCM H;  3NXW A;  2C5C A;  2J0T D;  2NB0 A;  1SRO A;  3HS0 C;  1D5Z C;  2WB1 E;  5C44 G;  4DR3 Q;  2WB1 G;  1WTP A;  4P75 A;  3PO3 H;  2EXZ A;  4DUZ L;  4C3H G;  4CHT B;  5GRO A;  3MXG A;  1EYG A;  1KL9 A;  3H09 A;  1VQA A;  2XWB B;  5IYB H;  1NJI C;  2F4V L;  1AH9 A;  4F87 A;  4KY7 A;  2GN5 A;  4DV5 Q;  4JVZ A;  5JEA H;  4DNI A;  2F0G A;  1M90 C;  4H02 A;  2F03 A;  3T56 B;  2NVY B;  5T1G A;  1E1T A;  4NMZ A;  3M85 A;  2PW7 A;  1J5E L;  5CC4 A;  5EKK A;  3AFP A;  1CFM A;  1K8A C;  4DAP A;  1J8I A;  1JE5 A;  2A19 A;  1CKM A;  2JA8 B;  1H9J A;  2OQ0 A;  4X65 L;  1EOT A;  4L63 B;  4LUO A;  1WTO A;  2NVX B;  1B70 B;  2CW0 C;  2YYZ A;  3V05 A;  3UDG A;  3M4Y A;  1EY5 A;  2K7V A;  1WFQ A;  4CKC A;  5KIX A;  1H9M A;  2XIW A;  3S16 B;  3VR4 A;  4BWG B;  4DR3 L;  4DR1 Q;  4JYA L;  3I2Z A;  3UDX A;  4GLX A;  1EY7 A;  3C46 A;  1I50 B;  2VUM G;  2B2Y A;  1PH1 A;  3NP8 A;  4LAA A;  4A3M B;  2K04 A;  4R1J A;  3MFG A;  1JR0 D;  1O7L A;  3Q8D A;  5FOB B;  5ELD A;  3GP7 A;  5M5Y H;  2NTS A;  1IL8 A;  3P20 A;  2B8G A;  1EIF A;  4KN4 C;  2YU9 H;  1S72 A;  1PH8 A;  3VR6 A;  1SJE D;  1TY0 A;  4RH6 A;  4JI3 Q;  3SE0 A;  1DON A;  4YWL A;  4ALP A;  4GOP C;  2RHS B;  4RHS A;  1I6H B;  2UUC Q;  2CVR A;  5IGF A;  1JCK B;  2AQ1 B;  1LT5 D;  1G6Z A;  2A73 B;  1EU3 A;  3ERS X;  4QUC A;  2EY6 A;  3BVM A;  4GLV B;  4DR5 L;  2E5L Q;  4LF6 Q;  3I4M B;  3S16 H;  3S1Q H;  4DR4 Q;  1EWC A;  3M3Y H;  1LTT D;  1IW7 C;  1Q12 A;  4N8F A;  3S9W A;  3A5Z B;  4NW2 A;  5M9O A;  4DR1 L;  3LX0 A;  3MFY A;  3KUP A;  1EEF D;  1H9S A;  4DA2 A;  2K5W A;  3BVG A;  5C4X B;  3KYH C;  3PIO A;  2OWO A;  1BNZ A;  4A3J B;  2PMZ E;  3STB D;  3K5M A;  1VF7 A;  4MZ9 A;  4UP7 A;  5IGE A;  3G7L A;  1DOM A;  3IRB A;  4P73 A;  2KCT A;  2AUK A;  2CCZ A;  2Z6K A;  3CC2 A;  2B2V A;  2JA7 G;  1JJ2 A;  4A3L G;  3T1H Q;  1OXV A;  2F0N A;  3CP0 A;  1N33 L;  1U4M A;  1TT2 A;  3HKZ G;  5C4X H;  2HHH Q;  5F2D A;  2MNA A;  3OYY A;  4UP8 A;  2NN6 I;  1II3 A;  4QY7 A;  3ONA B;  4IOA A;  3HOZ G;  3K6O A;  2B63 B;  4IUP A;  1IBM L;  1EUJ A;  1VF5 C;  3H0G G;  2Z9H A;  1SE8 A;  1PXU A;  5M3M H;  3A7A B;  4N8X 1;  4G7O C;  1VMP A;  1OXS C;  3BDL A;  1Q1B A;  1HHV A;  3V96 A;  1X9N A;  1UE6 A;  2WB1 B;  4HJ5 A;  3GTO H;  4UAI A;  4C2M H;  1O7Y A;  4UP9 A;  3RUZ A;  5ELN A;  2PZT A;  1PZI D;  2B63 H;  1K73 C;  2DNC A;  1UEB A;  4JC0 A;  1BQQ T;  4O2D A;  1S5F D;  3CCL A;  1IL2 A;  4DUZ Q;  4H13 C;  4G57 A;  2R93 G;  2K5V A;  3CQZ B;  2Z6B A;  2WAQ G;  1KDA A;  4OIK A;  2I0Q A;  1V43 A;  2HQL A;  1S5C D;  1LYL A;  3TME A;  4Y7N H;  3QWN A;  1VQ6 A;  1PH4 A;  3QOJ A;  5ELE A;  1SE2 A;  1STY A;  1XTC D;  4IPC A;  3HKZ B;  1I4P A;  4IZ8 A;  4R4Q A;  5C6A A;  1WTX A;  1FJG L;  2LSS A;  5CMD A;  5J39 A;  2QA4 A;  1GJX A;  2B29 A;  2RCF A;  2UXC L;  2RSO A;  2ZXO A;  2JP1 A;  2F0O A;  4DK1 A;  1BR9 A;  2HDL A;  2SDF A;  3IL8 A;  5EPL A;  4OWW B;  1NR2 A;  1KC8 C;  4JI0 L;  3K0X A;  4LJZ C;  3WDN A;  2CKZ B;  4HCE A;  5GAE C;  3LNN A;  1B2T A;  2QEJ C;  3PUY A;  2CFM A;  2AQ2 B;  5ELC A;  1D7Q A;  2Q2H A;  1W6J A;  4WJ3 M;  2ALY B;  2JA6 G;  4BY1 B;  1HUN A;  3I4M H;  3PF5 A;  1ESR A;  3CQZ H;  4QB4 A;  1YVC A;  3TP5 A;  5J3B A;  2QDL A;  5FLX L;  2A69 D;  2EYH A;  2K03 A;  4LFC Q;  4A3B B;  4IJH A;  2WP8 J;  3NQI A;  2ZJP A;  1I6H H;  2OT2 A;  1SNC A;  4L5S A;  3W3A A;  3GTK H;  4HID A;  1NCV A;  2KHJ A;  2K14 A;  4KJN A;  3NTH A;  4C3J H;  4DV4 L;  3RZD H;  4HIM A;  3VA7 A;  2WAQ B;  5I2Y A;  3K5O A;  3S15 B;  5BR8 L;  1S5B D;  2EYF A;  3PIP 3;  4OO1 H;  2F0K A;  4UPA A;  4AYB E;  1QCB D;  4CJ1 B;  2JK8 A;  3TN2 A;  4B3S Q;  1BDO A;  3NEL A;  4A3K B;  1HA5 A;  5DNF A;  4GNX C;  3MHB A;  3IFT A;  2RDG A;  4PQX A;  1Y1V H;  4BY1 H;  2RQX A;  3LGJ A;  1EQR A;  5JVG 3;  5M5X B;  4C3I B;  4CJ0 B;  4RCN A;  1N9W A;  3MXN B;  1Z9F A;  3K57 A;  1KAA A;  2CWA A;  1DM0 B;  2MJ8 A;  2LMC B;  1Q81 C;  5JPN C;  4JG2 A;  1GUT A;  2VQF L;  3BZD B;  3CPW A;  1HNZ L;  1TVX A;  1RTO A;  4KTA A;  2JEA I;  4UHV A;  2ASB A;  2F0Q A;  2NVT H;  1PYB A;  4JK1 C;  2AKW B;  3QOL A;  2DJF C;  5TSS A;  2R92 H;  2KBN A;  2QGQ A;  4RGM A;  1VQN A;  3S1N B;  2NWG A;  3CRK C;  1NY4 A;  1E2V A;  1QUQ B;  4LF6 L;  5I9O A;  3PV0 A;  1RD9 D;  4L5T A;  1PRT F;  4N9P A;  3LWE A;  1TWG B;  1VQD A;  1MSH A;  4JI3 L;  5M5X H;  1KHI A;  2D5D A;  1PDQ A;  4DR2 L;  2JA7 H;  2RSN A;  2WKC A;  4A3K H;  3A8K E;  5C4Z A;  1F9P A;  3CD6 A;  5A35 A;  2ICE C;  2KVM A;  4LF5 Q;  1TS2 A;  2ZM6 Q;  2XRQ D;  3EQL C;  1EYD A;  1A3V A;  1PFM A;  1STG A;  2F0W A;  3U50 C;  3K7U C;  1ENC A;  5H1S E;  3ULL A;  2FMM A;  3FP9 A;  3UDF A;  2I5M X;  3L0O A;  5JJZ A;  3D4R A;  3J7A 5;  1Z47 A;  1CK1 A;  3J81 i;  1PZJ D;  2E2I H;  4GKK L;  4BY7 H;  1HZ9 A;  2NUC A;  5A2Q L;  3I7F A;  3EIV A;  4LUV A;  4K6L A;  4R4O A;  2P5Z X;  4KV6 A;  1M8A A;  3RNU A;  1I4R A;  3OTO L;  1VQ5 A;  4PMW A;  4DKA C;  1C8C A;  1C7Y A;  3M4Q A;  1K28 A;  1IKL A;  1WJJ A;  1O80 A;  2R7F A;  2VNU D;  3R2T A;  1BCP F;  4OIJ A;  2ICI A;  1J6Q A;  1QVC A;  2DNE A;  3K7A B;  4NKL A;  5IP7 G;  1QVF A;  3CCV A;  1ILP A;  1C0A A;  4Z9C B;  1SLJ A;  4JI7 Q;  2F0I A;  1QNU A;  4DV6 L;  4GZY C;  2MO1 A;  4DU9 A;  2K5D A;  3OMC A;  4ZCK A;  1MKH A;  2EZV A;  1HZA A;  2MFI A;  2HCC A;  4C1N I;  2DY8 A;  3TRE A;  2RDF A;  4A3B G;  1SFO H;  1XPO A;  4LF8 L;  3R93 A;  1IBK L;  4S3S A;  1PH7 A;  4TRD A;  4OXP A;  1PRT B;  1XMQ L;  4K2K A;  1HCZ A;  1EY8 A;  1N34 Q;  2AHO B;  5JJI A;  4R9W A;  4WJW A;  4ME3 A;  2GVB A;  2E2D C;  3KJP A;  2Z0S A;  4OO1 I;  1EYA A;  3KBX A;  1YBY A;  2UUA L;  2VUM H;  1XYI A;  2UXB L;  1TS4 A;  2UU9 Q;  4BBR H;  3M4P A;  1BUV T;  1W3S A;  5HGQ A;  3HOV H;  2FFK B;  3B6Y A;  4FF3 A;  1B3Q A;  1A6X A;  4OWT B;  4QL5 A;  1X3E A;  1ZEQ X;  2A5H A;  1UE1 A;  1SNP A;  3KF6 A;  2MP1 A;  5DM6 3;  3KDF A;  1O78 A;  1Y69 U;  1LTA D;  4G7Z C;  1KQS A;  5C0X I;  4A3B H;  3K59 A;  2UXC Q;  1BBX C;  4B3T Q;  4EQN A;  1R9T B;  3A55 A;  4RKB A;  4Y52 H;  1WTW A;  1YZ6 A;  3S2H B;  3J7Y W;  1HQR D;  3E3X A;  4QF4 A;  3L2P A;  2JA5 B;  5FJ8 H;  2F0U A;  1TKW B;  4A3G B;  4PMB A;  5KRU A;  2RKS A;  3TS2 A;  4HJ8 A;  3KLR A;  2X6G A;  3F2B A;  3R8B A;  1D5M C;  5FK9 C;  1Q90 A;  4ZRZ A;  3CCR A;  1YEZ A;  5JAV A;  4QUF A;  3EN2 A;  5EJW A;  5BN5 A;  2GA4 B;  5C4H A;  3G6J B;  4P72 A;  4QCL A;  1EU4 A;  1IYJ B;  2VY3 A;  4NPS A;  1B7Y B;  5JEA G;  4A3D G;  3I72 A;  1KXL A;  4LF7 L;  2F0J A;  1HFN A;  1H95 A;  5IYC G;  4H44 C;  3D0F A;  4FF2 A;  3HZX A;  3CCQ A;  2R93 H;  3SEB A;  2ZTE A;  1W6K A;  4YIJ A;  2K01 A;  3MC0 B;  3MXN A;  4JI2 L;  1A2U A;  4RHR A;  3HOU H;  4RKL A;  2OXP A;  1A0I A;  1S5D D;  2QKI C;  2EYL A;  3RR5 A;  4K6D A;  4X64 Q;  3VYU A;  1EQV A;  1YJW A;  4N9T A;  1K3R A;  4YY3 L;  1SFO B;  1RJT A;  3BS1 A;  1D2B A;  2RDH A;  1HR0 L;  4POF A;  3GD7 A;  2QCP X;  1L0X B;  3STB C;  3J80 E;  2JA8 H;  1JOR A;  4PG3 A;  4X6A H;  4JI5 Q;  4OL7 A;  4XQJ A;  1PH9 A;  4DV0 Q;  3I91 A;  1TS3 A;  5T1I A;  4DGZ A;  3J7A F;  1STE A;  3EJI A;  1Y8O B;  3CU7 A;  4DV0 L;  3W5O A;  1STN A;  4DR5 Q;  2FJ2 A;  3NTK A;  1QB5 D;  4IFD H;  1HTL D;  1JWU D;  3JAM c;  3BZC A;  2VW9 A;  1UE5 A;  4F8M A;  2DGY A;  2R61 A;  4IQZ A;  4A93 H;  3MEF A;  2M9V A;  2Z4H A;  1VQ4 A;  1VS0 A;  1WYD A;  3Q22 A;  5HY6 A;  4JOI A;  1SJH D;  3CHB D;  4HJA A;  1K0S A;  1IHZ A;  3BG3 A;  1AE2 A;  1P16 A;  3CCE A;  4IFD I;  1GD7 A;  2JA5 H;  1AW7 A;  3NEM A;  5J22 A;  3KLS A;  4X62 L;  2H5X A;  4TQU S;  3J80 L;  1PV4 A;  3AYH B;  1SSO A;  2PO4 A;  4RCO A;  5HUR A;  4JBJ A;  1SXT A;  1XMQ Q;  4A3F G;  3PGZ A;  2A69 C;  1D1I A;  3S1Q B;  1K8G A;  1BF4 A;  3F1Z A;  3KF8 A;  2Q8T A;  1WCM B;  4OX9 L;  2EY5 A;  1IYU A;  4DV5 L;  5LMU Q;  1CQV A;  1LO5 D;  1VCI A;  3PO2 G;  2K75 A;  4LUZ A;  1SBB B;  1TQO A;  4G7H C;  3TZU A;  3JAM i;  4EVO A;  1Q46 A;  1I6V C;  1HA6 A;  4NDX A;  1F9R A;  4L5Q A;  3H94 A;  4GKK Q;  1Y1V B;  5EPK A;  1EZ8 A;  4ODG A;  1U4R A;  2WAQ E;  5LMU L;  4A3I B;  3AEV A;  4JV5 Q;  4KN7 C;  2EQS A;  2SOB A;  2C9O A;  2EJM A;  1TWF B;  3WOF A;  1RDP D;  4J15 A;  3HOV G;  1MD2 D;  2B39 A;  3DWP A;  4IUQ A;  1PH5 A;  5FLM H;  1SE4 A;  5IGC A;  1NSN S;  5IT9 E;  4JI8 L;  4A3J G;  5COR A;  2RVL A;  1LLR D;  5IOD A;  1OXU A;  3CAM A;  1WVL A;  1E3P A;  4DV7 Q;  1YNJ D;  4HMJ A;  1X54 A;  2JA9 A;  1WTR A;  4O0A A;  4DR2 Q;  3NBH B;  4A76 A;  4AH6 A;  3VR5 A;  1L1O A;  3A0J A;  2WV6 D;  1BKB A;  3J7Z C;  3SXH A;  1LTI D;  1VQ7 A;  1CA6 A;  4A3K G;  2D9U A;  4J6H A;  3GTP H;  1KTK A;  4PZ7 A;  1JMC A;  3T1Y Q;  3J81 c;  1UUP A;  3A7L A;  1QZG A;  2OF1 A;  4JI6 L;  4DR6 Q;  4MHE A;  5IP9 G;  1EY6 A;  3SR1 A;  2F3W A;  2KCC A;  5NUC A;  1GHK A;  1B4O A;  4BA2 I;  1HNZ Q;  1UEA B;  3TP8 A;  5GAG C;  1QWY A;  2IX0 A;  4Q5V A;  4OEM B;  1VQJ A;  1PTO F;  3OW7 A;  2IL8 A;  3ULJ A;  1K9M C;  2EIF A;  2IJ0 A;  2N3S A;  1A8V A;  1GUN A;  4LFA L;  2AWN A;  4AYB G;  1CZG A;  3A8I E;  4ZK9 B;  5JJK A;  1XJV A;  1IW7 D;  1FL0 A;  3M7G A;  4KD3 A;  4A3D H;  1F2Y A;  1E2W A;  1F2Z A;  3HEJ A;  2JYO A;  5HGT A;  1EZ6 A;  4YCW A;  4K5X A;  2GVA A;  1QUQ A;  1SDF A;  4KKU A;  2NN6 G;  2BA0 A;  3FKI G;  2NYZ D;  2B8F A;  5LL6 S;  2HDM A;  4DUY Q;  1LTL A;  1HZC A;  1XX8 A;  2FIN B;  2N55 A;  4RGT A;  1V1P B;  3MXU A;  1CKO A;  4XQN A;  1YHB A;  3U9S A;  3OSO A;  3K0Y A;  2RA4 A;  5EPJ A;  3SVM A;  1SYC A;  3C2P A;  3T13 A;  4DN4 M;  4NB3 A;  2R92 B;  4HTH A;  2ZXR A;  2Y0S E;  3S1N H;  4O42 A;  4K8I A;  5IGB A;  2JE6 I;  2F0D A;  1TWA H;  1BOS A;  2X69 A;  3JAM L;  3I4N G;  1KIX A;  2JXM B;  5C3E H;  4TVA B;  2Z6K C;  2PZU A;  3KBG A;  1PHJ A;  1CSQ A;  4BY1 G;  3I56 A;  4DK3 C;  3Q24 A;  3GTQ B;  4V19 0;  2LXJ A;  1I3Q H;  4OGQ C;  2SNS A;  3M4O B;  3K58 A;  3OTO Q;  3A56 A;  2A68 D;  5IIF A;  5EGT A;  2RHQ B;  1MIU A;  1F77 A;  5C5L A;  3RLO A;  1VQE A;  3GTG B;  4A3L H;  2V1C C;  3FKI H;  1C48 A;  4DFA A;  3ERQ A;  1FNW A;  4LFC L;  4JBM A;  4KD4 A;  1CHQ D;  1R9T H;  1CKN B;  3T1Y L;  2E2H B;  4CDC C;  4DXG A;  1TWF H;  3I73 A;  1YJ9 A;  2QW7 A;  1S3O A;  3ND8 A;  1LV9 A;  5C5M A;  5G3L F;  1N36 L;  1X3Q A;  3EVQ A;  3DWA A;  3GTM H;  2ENB A;  4RA8 A;  1Y8N B;  3S17 B;  1X3P A;  3S1R B;  2DJG C;  3H0G H;  3NWS A;  3UE1 A;  2TSS A;  1XNR Q;  3DM3 A;  3PUW A;  1JT8 A;  1C9O A;  4BBS G;  1EFW A;  3VYS A;  1GUO A;  2KEC A;  4JI8 Q;  3HOY B;  4A3G H;  2XVS A;  3T4A C;  1N32 L;  2BA1 A;  1RTN A;  4XT3 B;  1BXT A;  4IJL A;  4ZUJ A;  5CV8 A;  3X3N A;  1XPR A;  4LMQ D;  4GN4 B;  3K5N A;  4JI4 Q;  3K81 C;  1B50 A;  2B2U C;  1H9R A;  1TU2 B;  4HCS A;  1LT3 D;  5D14 A;  4B9X A;  3MXP A;  2ID0 A;  1QG7 A;  4RWS C;  1X55 A;  3A5U A;  4JBK A;  4A3E B;  2I07 B;  4DAY B;  1HRJ A;  1PFS A;  4DV6 Q;  2MO0 A;  3I70 A;  4JBW A;  4KMU C;  2EOT A;  1HXY D;  1N33 Q;  3S1M H;  2HUG A;  3G4S A;  2OTL A;  4LNQ A;  3SK5 A;  4MNO A;  2IY5 B;  3BVZ A;  1VQC A;  4KJO A;  1ILQ A;  4P74 A;  4AQY Q;  2A6E D;  4DAV A;  1UNS A;  1ET6 A;  4GKJ Q;  3CF5 A;  1VQF A;  2I5H A;  3OIP A;  3PIP A;  2I46 A;  2BDN A;  1CI3 M;  4CJ2 C;  3HOU G;  3NEN A;  3A8J E;  4C3H B;  1KDB A;  3KLW A;  5AFW A;  4QQB X;  4A3C G;  4M1U B;  3HOY H;  1TR5 A;  3F8T A;  4JI4 L;  4QJF A;  1MI2 A;  1TWC B;  1EOV A;  1I50 H;  3M4O H;  3CCU A;  1YIT A;  4GN5 A;  4KHZ A;  3U58 A;  4YWK A;  4X3K A;  3RD4 A;  4JI1 Q;  4ME5 A;  4NXN Q;  4QIW E;  4EX5 A;  3ERO A;  2FHT A;  1SYD A;  2B3G A;  4DV1 L;  3G71 A;  3N6R A;  5C0X G;  1FGB D;  2LY7 A;  4EQ5 A;  1NAP A;  3VYT A;  1Q8K A;  1GXD C;  1CA5 A;  2IWH A;  4GN3 B;  5JVH 3;  1F2M A;  3ZYY X;  3DUZ A;  3DM1 A;  2B2V C;  4A3E G;  1B44 D;  4IN3 A;  4FO2 A;  3SK6 A;  2ZM6 L;  4F88 A;  2JJQ A;  1WOC A;  1BVS A;  1QNK A;  1HR0 Q;  3GTQ H;  4DR6 L;  2F1M A;  2DUD A;  2OEO A;  4C3I G;  1A3T A;  5EAY A;  3BYY B;  4BBR G;  3BDC A;  1CZW A;  1Y1V G;  2A6H C;  2YTY A;  1K83 H;  2CH4 W;  1PLF A;  5D3D A;  2KEE A;  4HSV A;  2PCF B;  1TWH B;  2CW0 D;  1VQK A;  2PQE A;  1FVI A;  4DAM A;  1Q1E A;  4MTK A;  4LF9 L;  2XWJ B;  4A3M G;  1YIJ A;  3HOW H;  3G48 A;  4X3T A;  5C0X H;  3T16 A;  3P75 A;  1YI2 A;  5FKA C;  2VQF Q;  1J5E Q;  1XMO L;  2R93 B;  3HOX G;  3FPU B;  1X6O A;  3NHH A;  1PFN A;  3Q6S A;  4CDE C;  1G2T A;  4IOC A;  5ISR A;  1DCZ A;  2BOS A;  2H4O A;  2PQA B;  3DHQ A;  1PRT D;  3D4D A;  2QDB A;  3F2U A;  4RGN A;  2G9D A;  3D3R A;  4OEL B;  4C2M B;  1ICF B;  2D2C C;  1HFG A;  4NXM Q;  1XPU A;  1PYW D;  1ZKO A;  4IFD J;  2WIN B;  5FLX E;  1PTO C;  4OX9 Q;  4NP5 A;  1K8M A;  3CC4 A;  2M2L A;  1BO0 A;  1SYG A;  4IPG A;  5KGU A;  1L0Y B;  4ZAI A;  3TQY A;  2ZT9 C;  2K5N A;  1FNU A;  3HOW G;  2VS1 A;  1M1K C;  1G2S A;  3ULP A;  1I94 L;  3BZK A;  1QOH A;  2V4D A;  4YCU A;  1MSG A;  5FLM G;  4HIK A;  1JB7 A;  4A3J H;  2F0S A;  1ICW A;  1QE6 A;  2EY1 A;  3FEW X;  1N36 Q;  4A3G G;  2CQA A;  1GVP A;  4RAU C;  1PMR A;  1STA A;  3RN2 A;  2Z8L A;  4H0L C;  4B3T L;  4R4C A;  5KNB A;  1AZQ A;  2E2J B;  5FO9 B;  1Y1W B;  1ASY A;  3H0G B;  1GKH A;  2K32 A;  2NVY H;  4XIG S;  3U4Z A;  3RLN A;  4HSP A;  1RCV D;  3CW2 C;  3BJU A;  1DZ1 A;  3I8Z A;  1A3U A;  4ZQ3 A;  5E4X A;  5I2X A;  4JI5 L;  1TWC H;  1S40 A;  2DY7 A;  1UWV A;  2J4X A;  4DR4 L;  1JE4 A;  1V8Q A;  4GLA C;  1I4X A;  4ZKB B;  3Q23 A;  1ENF A;  1STB A;  2B2T A;  2Q2U A;  3D6W A;  2EPB A;  2A74 C;  4BY7 B;  2N49 A;  2E76 C;  2AMC B;  5M5Y B;  3Q0A A;  3CCS A;  4B3M L;  4X64 L;  1NMF A;  2UUA Q;  1ZYR D;  1DOK A;  4GKJ L;  3QR8 A;  2NN6 H;  4AQY L;  1L1O B;  1OXX K;  1HNW Q;  1N34 L;  3LWU A;  1Z6H A;  3OPO A;  4LF4 L;  3SHL A;  2WII B;  1YHA A;  1EQT A;  3GO5 A;  4MIU A;  3H3V H;  1I4H A;  2K50 A;  1WI5 A;  1KDC A;  4JPB W;  2KHI A;  5GQO A;  1CTM A;  4PV1 C;  5KYI A;  5KND A;  1WTQ A;  3PSI A;  1V9P A;  2O4X A;  4IUU A;  4I65 A;  2K5H A;  4KI0 A;  3BU2 A;  3NTI A;  3F2C A;  1LTG D;  1CM9 A;  1ZXT A;  5FO7 B;  4KHP L;  2PYK A;  4DV2 Q;  1IXR A;  4LF9 Q;  3GV6 A;  2B2U A;  1Q7Y C;  1QIL A;  1T5X D;  1TY2 A;  4O1N A;  4AYB B;  1QZH A;  4RGO S;  1B8A A;  1EY9 A;  5DAU A;  2M00 A;  3K5L A;  1VQB A;  2FMC A;  2F52 A;  1RIP A;  3CMA A;  2Q8R E;  2XRS D;  2I5L X;  2XNA C;  3HOZ H;  5M3F B;  3PUX A;  3PUZ A;  5C3E G;  3KF6 B;  1FD7 D;  1JJG A;  4WOR A;  4U67 3;  1JB3 A;  4LF5 L;  1EWI A;  3RMH A;  4HAE A;  3NSW A;  4JW0 A;  1MGS A;  5C3X A;  1XWE A;  2F0E A;  1VQP A;  1DJR D;  1BBW A;  2VQE Q;  1GM5 A;  1JOO A;  3ICE A;  3UE0 A;  4C1N K;  5K5P A;  2ES2 A;  1EWH A;  4V0B A;  1SE3 A;  4HED A;  4JI1 L;  4NXN L;  4X66 L;  2K33 A;  3S15 H;  2IW3 A;  4QIW B;  2XN9 C;  5CBE E;  2CH4 A;  2B63 G;  1VQG A;  3S17 H;  5JEA J;  1DYQ A;  2YV5 A;  1PYS B;  4DV7 L;  4F7X A;  4XT1 B;  5IWA Q;  5C4J H;  2UXB Q;  4A3I G;  3GTL H;  4IUN A;  1F9S A;  5DM7 3;  5FJ8 G;  2NVQ H;  2ZXP A;  3S24 A;  1K3B C;  3J81 E;  1HNX L;  2E74 C;  2O5I C;  1AFP A;  2EVB A;  1E0B A;  5IT9 c;  2RCN A;  1KAB A;  3S14 H;  4K5W A;  1Y1W H;  4IO9 A;  4DAY A;  1V1O A;  3BYT B;  2XSC A;  2WAC A;  4GOP A;  1EIG A;  3VR3 A;  1L2F A;  4CBV A;  2EJG C;  3T51 B;  1IBL L;  3KLS X;  5C44 H;  3QIA A;  3T53 B;  2L0C A;  2YTV A;  2QEX A;  4A75 A;  2L55 A;  3I4O A;  1YNN D; 
#chains in the Genus database with same CATH homology
 2BA0 A;  1VQH A;  2L15 A;  4YHH L;  3FKI G;  5BR8 L;  4PZ8 A;  1Y1W G;  4HJ7 A;  4DUY Q;  1YHQ A;  4UPA A;  4AYB E;  1MJE A;  1LTL A;  1HZC A;  4X65 Q;  2JK8 A;  3GTG H;  4B3S Q;  3I4M G;  3NEL A;  4JI7 L;  5BR8 Q;  3GTJ H;  1CKO A;  4RMF A;  1YHB A;  2NVX H;  5IYC H;  4GNX C;  4JCV E;  4YWM A;  4C3H H;  3TRZ A;  1Y1V H;  4DR7 L;  4BY1 H;  4NB3 A;  4LFB Q;  3E9H A;  4DV4 Q;  3LGJ A;  1EQR A;  1U5K A;  2Y0S E;  3S1N H;  4A3I H;  2WFW A;  5IYB G;  1N9W A;  2JE6 I;  3MXN B;  3HOY G;  1Z9F A;  1TWA H;  4OWX B;  2CWA A;  1NBW A;  3I4N G;  4B3S L;  1KIX A;  1Q81 C;  1U0L A;  1W2B A;  5C3E H;  1PVO A;  4JG2 A;  4TVA B;  2Z6K C;  2VQF L;  1EQQ A;  1PHJ A;  1CSQ A;  3CPW A;  1VQ8 A;  4BY1 G;  4YHH Q;  4DK3 C;  3I56 A;  1HNZ L;  1KRT A;  2LXJ A;  3KFU A;  1E24 A;  2JEA I;  1I3Q H;  2ASB A;  2NVT H;  3OTO Q;  1PYB A;  2AKW B;  4X66 Q;  2R92 H;  2KBN A;  2QGQ A;  5M5W H;  5IY0 A;  1VQN A;  2F3I A;  1X56 A;  5C0X J;  2RHQ B;  2UXD L;  1MIU A;  3RLO A;  2JA5 G;  1XNQ Q;  1VQE A;  4A3L H;  1N32 Q;  3FKI H;  2PI2 E;  1NY4 A;  2V1C C;  1X3G A;  1JJC B;  1QUQ B;  4QGU A;  4LFC L;  4LF6 L;  4LWC A;  4JI6 Q;  4JBM A;  4DV3 L;  3PV0 A;  1R9T H;  4L5T A;  1CKN B;  3T1Y L;  1XNR L;  1VQD A;  4K0K L;  2D62 A;  4JI3 L;  1TWF H;  5M5X H;  1KHI A;  1YJ9 A;  3CPF A;  1S3O A;  1FJG Q;  1Y14 B;  4DR2 L;  2JA7 H;  1N8R C;  4A93 G;  4YCV A;  1N36 L;  3ER0 A;  2VL6 A;  4A3K H;  1YJN A;  4BA1 I;  5IE8 A;  2VZA A;  1KD1 C;  3GTM H;  4PZ6 A;  2Q2T A;  1TXY A;  3H15 A;  3CD6 A;  5GAD C;  3H0G H;  4LF5 Q;  3KOJ A;  2ZM6 Q;  3UE1 A;  2PI2 A;  3E9I A;  2JA8 G;  1XNR Q;  3DLL A;  3AQQ A;  2R92 G;  4MTN A;  2XTI A;  3DM3 A;  3PUW A;  3HFZ B;  1JT8 A;  3U50 C;  1C9O A;  1LUZ A;  1HZB A;  3K7U C;  1EFW A;  3HKZ E;  1XTD A;  4JI8 Q;  4BBS G;  4BXX H;  4A3G H;  3GDE A;  1N32 L;  1TWG H;  3AFQ A;  1HJP A;  1O7I A;  2BA1 A;  3ULL A;  5H1S E;  3ZJY C;  3FP9 A;  1SMX A;  2I5M X;  3L0O A;  3UDF A;  4HIO A;  3J7A 5;  1Z47 A;  3J80 c;  5JJL A;  3J81 i;  4IJL A;  4JOI C;  2E2I H;  1XPR A;  4DR7 Q;  4R4I A;  4BY7 H;  2JA6 H;  4GKK L;  1HZ9 A;  3M9B A;  1XNQ L;  1VQI A;  1G29 1;  1YNX A;  4GN4 B;  4JI4 Q;  2ZTC A;  1I5F A;  3K81 C;  4JV5 L;  3I7F A;  3EIV A;  4LUV A;  2IHF A;  3U4V A;  4R4O A;  3S1R H;  3RNU A;  1CSP A;  3OTO L;  1VQ5 A;  1NMG A;  4PMW A;  4DKA C;  3CCJ A;  1C7Y A;  3M4Q A;  2ID0 A;  2ZTD A;  1X55 A;  1WJJ A;  3A5U A;  2HIX A;  2R6G A;  2R7F A;  1IBM Q;  4DAY B;  5LMN Q;  1IZ6 A;  4JBK A;  2VNU D;  4LF4 Q;  5IP7 G;  1J6Q A;  1PFS A;  1QVC A;  4DV6 Q;  1QVF A;  1HNW L;  2MO0 A;  1N33 Q;  4JBW A;  3CCV A;  3S1M H;  4GNX B;  1C0A A;  3CXC A;  3G4S A;  2OTL A;  3FHW A;  4LNQ A;  4MNO A;  1OTC A;  4OO1 G;  2IY5 B;  3UDI A;  1SLJ A;  3TS0 A;  1T9H A;  1VQC A;  4P74 A;  4JI7 Q;  4DV2 L;  4AQY Q;  5IP9 H;  1AE3 A;  4IFD G;  3RLF A;  4DV6 L;  2MO1 A;  1PA6 A;  4A4I A;  5AJ3 L;  4DUY L;  3PO2 H;  4GKJ Q;  1MKH A;  1UE7 A;  3CF5 A;  1VQF A;  2I5H A;  3PIP A;  1HZA A;  1TWH H;  1RL2 A;  2MFI A;  3KF8 B;  3HOU G;  3TRE A;  1P8L A;  5C4X G;  3NEN A;  4A3B G;  1SFO H;  2Q2I A;  3KLW A;  1XPO A;  4LF8 L;  4A3C G;  1IBK L;  1PH7 A;  3HOY H;  5M3M G;  2C35 B;  4QQB X;  3RZO H;  2BH8 A;  4OXP A;  2A1A A;  1OXT A;  3F8T A;  5IP7 H;  4JI4 L;  4QJF A;  1XMQ L;  1EOV A;  1I50 H;  4KLK A;  3CCU A;  1YIT A;  2AHO B;  1N34 Q;  1IBL Q;  3PO3 G;  2D0O A;  4GN5 A;  3M4O H;  5JJI A;  4KHZ A;  2EXD A;  4ME3 A;  4YWK A;  3U58 A;  3PF4 A;  2GVB A;  4JI1 Q;  2PNH A;  3T1H L;  4NXN Q;  5E7N A;  4QIW E;  2Z0S A;  4EX5 A;  3KJP A;  1VQO A;  4OO1 I;  2B3G A;  2R7Z H;  4DV1 L;  3G71 A;  5C0X G;  2KCM A;  1X3F A;  1YBY A;  1A62 A;  4EQ5 A;  4HJ9 A;  3HKS A;  2UUA L;  2VUM H;  3JC6 6;  4WJ4 A;  1Q8K A;  2CQO A;  3WWV A;  4GN3 B;  2UXB L;  2KEN A;  2UU9 Q;  2YTX A;  4BBR H;  2ATW A;  3M4P A;  4XTC S;  4GNX A;  4A3E G;  1HNX Q;  1W3S A;  2ZM6 L;  2E2J H;  1WCM G;  5HGQ A;  3HOV H;  2JJQ A;  3B6Y A;  1WOC A;  3CME A;  4JI0 Q;  1BVS A;  1E1O A;  2UU9 L;  5IWA L;  3F2D A;  3M7N A;  4OWT B;  4QL5 A;  1X3E A;  2CWP A;  1HR0 Q;  3H3V I;  3GTQ H;  4DR6 L;  5DLQ E;  1UE1 A;  1HH2 P;  2DUD A;  2RF4 A;  4UY8 C;  4YY3 Q;  3KF6 A;  1NTG A;  5EAY A;  4BXX G;  4BBR G;  2HT1 A;  2IT1 A;  2E2H H;  3I55 A;  1Y1V G;  3KDF A;  4L5R C;  1BBU A;  1WCM H;  2YTY A;  1K83 H;  1KQS A;  4GS3 A;  5C0X I;  4A3B H;  2UUC L;  2UXC Q;  1CUK A;  1SRO A;  1NE3 A;  2WB1 E;  1VQK A;  4B3T Q;  4LF8 Q;  4OON A;  5C44 G;  1FVI A;  4DAM A;  4DR3 Q;  2WB1 G;  3A74 A;  1Q1E A;  3E0E A;  4P75 A;  2VQE L;  4LF9 L;  3PO3 H;  5LMN W;  4Y52 H;  4DUZ L;  4A3M G;  1G6P A;  1YZ6 A;  1YIJ A;  3HOW H;  1K0R A;  5GRO A;  3G48 A;  3L2P A;  1EYG A;  1KL9 A;  5FJ8 H;  1VQA A;  5IYB H;  1NJI C;  2F4V L;  1YI2 A;  1AH9 A;  2VQF Q;  1J5E Q;  1XMO L;  2GN5 A;  1MJC A;  2K4K A;  3HOX G;  3TS2 A;  1X6O A;  4DV5 Q;  1V1Q A;  4HJ8 A;  4JYA Q;  4A3M H;  4IOC A;  4DNI A;  3F2B A;  1M90 C;  4H02 A;  4GOP B;  5IYD H;  3CCR A;  1E1T A;  1YEZ A;  3M85 A;  3S2D H;  4LFB L;  1XMO Q;  4IPH A;  1J5E L;  2PQA B;  3EN2 A;  3PCO B;  3PUV A;  3I4N H;  3AFP A;  4P72 A;  1K8A C;  2OCE A;  1IYJ B;  1JE5 A;  2A19 A;  2VY3 A;  2XGT A;  4NPS A;  1B7Y B;  1CKM A;  5JEA G;  4A3D G;  1EIY B;  2OQ0 A;  4X65 L;  4NXM Q;  1XPU A;  4KHP Q;  4IFD J;  1ASZ A;  1D8L A;  4B3M Q;  1KXL A;  4LUO A;  4OX9 Q;  5M3F H;  1B70 B;  2YYZ A;  3TEH B;  3CC4 A;  4LF7 L;  2K52 A;  2ZJR A;  3UDG A;  2HHH L;  1WFQ A;  4IPG A;  1H95 A;  3W1B A;  5IYC G;  1E7Z A;  3D0F A;  3TQY A;  4DR3 L;  3CCQ A;  2R93 H;  2K5N A;  4X62 Q;  1SN8 A;  2ZTE A;  2VS1 A;  4DR1 Q;  1M1K C;  3HOW G;  4JYA L;  4JI2 L;  3ULP A;  1I94 L;  4B3R Q;  3K7A H;  3I2Z A;  3BZK A;  3UDX A;  4GLX A;  3HOU H;  2NZO A;  4YCU A;  1E22 A;  2VUM G;  1A0I A;  4RG1 A;  1PH1 A;  3RR5 A;  2Y0S G;  5FLM G;  4HIK A;  1JB7 A;  1L1O C;  4R1J A;  4X64 Q;  1KAW A;  2E8G A;  3Q8D A;  4DK6 C;  4A3J H;  1YJW A;  2N78 A;  1K3R A;  5M5Y H;  3SGI A;  4YY3 L;  2UUB L;  1N36 Q;  4A3G G;  1EIF A;  4POF A;  1HR0 L;  2YU9 H;  3GD7 A;  1S72 A;  1GVP A;  1PH6 A;  1PH8 A;  3EBE A;  3RN2 A;  2BH2 A;  3STB C;  4B3T L;  4R4C A;  4JI3 Q;  1Q86 C;  2JA8 H;  4YWL A;  4ALP A;  4PG3 A;  2RHS B;  4GOP C;  1ASY A;  4X6A H;  2UUC Q;  4JI5 Q;  1GKH A;  2NVY H;  4XIG S;  3U4Z A;  3RLN A;  3KDF B;  4BBS H;  2IHE A;  3CW2 C;  1PH9 A;  3ERS X;  2E5L L;  2E5L Q;  4LF6 Q;  3BJU A;  4GLV B;  4DR5 L;  3S16 H;  3S1Q H;  4DV0 Q;  4DR4 Q;  1PH2 A;  4JI5 L;  1TWC H;  1S40 A;  1Q12 A;  3M3Y H;  1I94 Q;  1UWV A;  3A5Z B;  5ELO A;  3W1G A;  4A3F H;  4DV0 L;  3W5O A;  5FLX c;  4IPD A;  4DR1 L;  4DR4 L;  4DR5 Q;  4GLA C;  1Q82 C;  3JAM c;  3BZC A;  3KYH C;  2VW9 A;  2ZJQ A;  1UE5 A;  2DGY A;  3VDY A;  2Q2U A;  4A93 H;  3PIO A;  5K36 G;  1L0W A;  3MEF A;  2OWO A;  2N49 A;  1VQ4 A;  2LXK A;  4LF7 Q;  3CC7 A;  2R7D A;  2PMZ E;  1VS0 A;  2AMC B;  1WYD A;  1GO3 E;  3STB D;  1A63 A;  5HY6 A;  4JOI A;  3J81 j;  3KJO A;  4HJA A;  4MZ9 A;  4UP7 A;  3CCS A;  4B3M L;  4X64 L;  1NMF A;  3IRB A;  4P73 A;  2KCT A;  4A3C H;  2OQK A;  2UUA Q;  1AE2 A;  1P16 A;  4AIM A;  3CCE A;  2CCZ A;  2Z6K A;  4IFD I;  3CC2 A;  2JA7 G;  1PH3 A;  4GKJ L;  1GD7 A;  4JI2 Q;  1JJ2 A;  5AJ3 Q;  2JA5 H;  4A3L G;  3T1H Q;  1OXV A;  3NEM A;  4X62 L;  2H5X A;  3CP0 A;  4TQU S;  4AQY L;  1PV4 A;  1L1O B;  3AYH B;  1OXX K;  1N33 L;  1HNW Q;  1N34 L;  4JBJ A;  4LF4 L;  3HKZ G;  1XMQ Q;  4A3F G;  5C4X H;  3PGZ A;  1YHA A;  2HHH Q;  1K8G A;  3GO5 A;  3H3V H;  3F1Z A;  2K50 A;  1WI5 A;  2MNA A;  4OX9 L;  4DV5 L;  3OYY A;  2KHI A;  4UP8 A;  4DPG A;  5GQO A;  5LMU Q;  1VCI A;  2D0P A;  3PO2 G;  2K75 A;  2NN6 I;  4QY7 A;  4LUZ A;  4IOA A;  3HOZ G;  2JEB I;  3PSI A;  4A3E H;  1V9P A;  3JAM i;  3CCM A;  1Q46 A;  1IBM L;  2K5H A;  4KI0 A;  1EUJ A;  3H0G G;  2A8V A;  1SE8 A;  2MQH A;  3BU2 A;  3D31 A;  4L5Q A;  3F2C A;  2R7Z G;  4GKK Q;  2N8N A;  4NXM L;  5M3M H;  4KHP L;  4DV2 Q;  1IXR A;  2WAQ E;  5LMU L;  4LF9 Q;  4C3I H;  1Q7Y C;  3AEV A;  1OXS C;  2JQO A;  4JV5 Q;  1Q1B A;  1QVG A;  1HR0 W;  2EQS A;  1X9N A;  1QZH A;  1UE6 A;  4HJ5 A;  1B8A A;  3GTO H;  4J15 A;  4C2M H;  3G6E A;  3HOV G;  1KRS A;  4UP9 A;  1VQB A;  1PH5 A;  5FLM H;  4LFA Q;  1VQM A;  2F4V Q;  4BY7 G;  3L7Z C;  5ELN A;  5LMN L;  4JI8 L;  4A3J G;  2F52 A;  1RIP A;  3CMA A;  1K73 C;  2B63 H;  2I5L X;  1UEB A;  1OXU A;  3CAM A;  3HOZ H;  4JC0 A;  4O2D A;  2HIV A;  3PUX A;  3PUZ A;  5C3E G;  1VQL A;  1E3P A;  4DUZ Q;  4DV7 Q;  3CCL A;  1IL2 A;  3KF6 B;  2R93 G;  1X65 A;  1X54 A;  2JA9 A;  2K5V A;  1JJG A;  4O0A A;  4DR2 Q;  3NBH B;  4LF5 L;  2WAQ G;  2I0Q A;  4A76 A;  1EWI A;  1V43 A;  2HQL A;  4AH6 A;  1L1O A;  3A0J A;  1BKB A;  1LYL A;  4K0K Q;  4Y7N H;  4FDB A;  3J7Z C;  1VQ6 A;  3K80 C;  1VQP A;  1PH4 A;  1VQ7 A;  1VQ9 A;  1BBW A;  2NZH A;  4DV3 Q;  4R4Q A;  4IPC A;  2VQE Q;  1GM5 A;  4POG A;  1FJG L;  3ICE A;  3UE0 A;  4A3K G;  2FXQ A;  2LSS A;  2QA4 A;  2ES2 A;  2IX1 A;  3GTP H;  1G51 A;  2B29 A;  4PZ7 A;  1DGS A;  1JMC A;  2UXC L;  1FGU A;  3T1Y Q;  3J81 c;  3J80 i;  1QZG A;  4JI1 L;  4NXN L;  4X66 L;  4JI6 L;  4P71 A;  3S15 H;  4DR6 Q;  1CKN A;  5IP9 G;  4OWW B;  1KC8 C;  2B63 G;  1VQG A;  4JI0 L;  5JEA J;  3K0X A;  3S17 H;  4LW1 A;  2CKZ B;  4BA2 I;  2YV5 A;  3K8A A;  5GAE C;  1HNZ Q;  3PUY A;  5GAG C;  1PYS B;  2CFM A;  4DV7 L;  2OTJ A;  1D7Q A;  2IX0 A;  2Q2H A;  5IWA Q;  5IYD G;  5C4J H;  1VQJ A;  2UXB Q;  4A3I G;  3GTL H;  4WJ3 M;  1SRU A;  5FJ8 G;  2ALY B;  3ULJ A;  2NVQ H;  1K9M C;  2JA6 G;  2EIF A;  2N3S A;  2UUB Q;  3I4M H;  3S24 A;  1SR3 A;  3PF5 A;  1HNX L;  1A8V A;  3RN5 A;  4LFA L;  2AWN A;  3CQZ H;  4AYB G;  1YVC A;  3HOX H;  5IT9 c;  2PQA A;  5J3B A;  3OW2 A;  2RCN A;  4APV A;  5JJK A;  1XJV A;  4LFC Q;  3S14 H;  1FL0 A;  4IJH A;  2WP8 J;  2ZJP A;  1Y1W H;  1I6H H;  4IO9 A;  4A3D H;  4L5S A;  3GTK H;  4HID A;  2UXD Q;  5GAH C;  4DV1 Q;  4R4T A;  4B3R L;  2KHJ A;  2K14 A;  4GOP A;  5M3F G;  4C3J H;  4DV4 L;  1IBK Q;  1L2F A;  1LM0 A;  3RZD H;  4YCW A;  4HIM A;  1IBL L;  2AWO A;  2GVA A;  3S2H H;  5C44 H;  1QUQ A;  2QEX A;  2YTV A;  4A75 A;  3I4O A;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...