3KDFB

X-ray crystal structure of the human replication protein a complex from wheat germ cell free expression
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
118
Chain Sequence
HIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 14 kDa subunit
publication title X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression
rcsb
source organism Homo sapiens
molecule tags Replication
total genus 25
structure length 118
sequence length 127
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kdfB00
4X64L 4NB3A 5ELNA 4A3IH 2AHOB 1Q8KA 4PZ6A 4A4IA 1I5FA 2GN5A 3ER0A 4IPGA 1CKMA 3VDYA 2WP8J 3TS2A 4DUZL 3M7NA 1JB7A 2VUMH 4BY1H 4GKJQ 1SROA 1N36L 3KJPA 1R9TH 2HIXA 4DV0Q 4JI5Q 5GADC 2AWNA 2I5MX 2XTIA 5DLQE 4L5SA 1VQNA 2K52A 1GD7A 4IJHA 3TRZA 4LFAQ 1Q12A 4DK3C 1WCMG 4HJAA 1N33Q 1K0RA 2Q2HA 4R4QA 3FKIH 4GN4B 2L15A 3ZJYC 1EUJA 1KRTA 5LMNL 2IY5B 5BR8L 2ALYB 4JI2L 3RN2A 1XMQQ 2JA7G 1C9OA 3F2DA 2RF4A 5JEAJ 4R4CA 3HOWH 3J81j 1DGSA 3LGJA 2VQFQ 4IFDI 3KDFB 4QIWE 3Q8DA 1N34Q 4GOPC 1P8LA 1E3PA 4JYAL 4LF5Q 2V1CC 1FJGL 1UE1A 5HGQA 1N9WA 4Y52H 2K5VA 3CPWA 3ULJA 3DLLA 4DV6L 3HOVG 1U5KA 5C0XJ 4XIGS 4UY8C 1EOVA 3K0XA 4PMWA 3T1HL 3E9HA 2B63H 2E2HH 1N32L 4YHHL 4DR3L 4JI3L 5JJLA 2I0QA 5IWAL 1IL2A 4R4IA 1YHBA 4OX9Q 2CKZB 2NZHA 2R7ZH 4JV5L 5M3FH 1KRSA 3CCUA 2MO1A 2ZJRA 4GLXA 4AQYQ 2OWOA 1VQMA 1Z47A 1SRUA 5GROA 4P75A 4LFCL 2NVQH 4LF4L 4YWKA 3KLWA 1MJCA 1VCIA 4B3MQ 4LF6Q 3PUVA 2GVBA 4JI7L 5FJ8H 1SLJA 1HNWQ 3AEVA 1Q46A 4IPCA 3CMAA 1O7IA 2ZM6Q 2YU9H 2JA8H 2R7DA 5EAYA 1I94L 2UU9L 5E7NA 1EIYB 3CMEA 4JI4L 1X6OA 1YJWA 3S15H 3UDXA 5IP7H 2CCZA 2OQKA 4DV5L 2B29A 1PH6A 1JE5A 1PV4A 4BA2I 2OCEA 4DR2L 1TWGH 1NMFA 1Q1BA 2PMZE 4O0AA 3RLFA 3HKZG 1Q82C 4LUVA 3OW2A 4B3RL 3RN5A 5IY0A 2WB1G 4LUOA 4DR5L 4DKAC 3FP9A 3U4VA 2NZOA 5C4JH 5AJ3L 3PO2H 1PH5A 2UXCQ 1Q81C 4OO1G 4DV3Q 2BH2A 1A63A 2BA1A 2JQOA 3I4OA 1PYBA 1V1QA 1J5EL 1S3OA 2JA5G 2OQ0A 2CWAA 4X66Q 1A62A 1JJCB 1VQFA 1B70B 3L2PA 2HQLA 1CKNB 2JJQA 3KDFA 3PGZA 1UEBA 4A75A 1VQJA 3D0FA 1HJPA 5C0XI 4X6AH 4GN5A 5C44H 1PYSB 1PA6A 4HJ8A 2NN6G 3CCJA 4A3MH 4RG1A 1VQ8A 4HJ5A 2K50A 2I5HA 1EQQA 2E2JH 2OTJA 3BU2A 3I4MH 4JI1Q 1LUZA 3KOJA 4QGUA 2YYZA 4B3SL 1G51A 3S1QH 3GD7A 4APVA 3U58A 1V43A 4LF8L 3M4PA 2Q2TA 3HOXG 5IYDH 2NVYH 3I7FA 3L0OA 3MEFA 1X56A 1YEZA 2EQSA 1K8AC 1TWHH 4DR4L 4KHPQ 3K7UC 4TQUS 1XPOA 3HOUG 3G6EA 1SE8A 2UUCL 1UE6A 2PQAB 3RNUA 3U50C 3G4SA 4AYBE 1PH4A 3GDEA 1E22A 3K7AH 4YY3L 2MO0A 3UDGA 4BY7G 2AWOA 4DPGA 5IYBG 4DV4L 1PH1A 1IBML 1I3QH 2E2IH 1VQDA 2ZTDA 4P72A 3BZKA 3AFPA 1PHJA 3ULLA 2UUBQ 5FLMG 4PZ8A 1JJ2A 1I50H 4YY3Q 1Y1VH 4LFBQ 2VL6A 3CXCA 3KF6B 1HNZQ 1VQCA 3HOYG 3PIPA 4YWLA 2YTXA 5GQOA 1YHAA 4P71A 4C3HH 1M1KC 2RHQB 4UP7A 1Z9FA 4UPAA 1NJIC 4HJ7A 1D7QA 5FLXc 3EN2A 1HNXQ 5FLMH 3PO3G 4X64Q 3ULPA 4JOIA 1UE7A 3JC66 4A3LG 2GVAA 5LMUL 4DUZQ 4OWXB 4JBJA 1N36Q 4YCWA 3RZOH 4UP9A 2YV5A 4GNXB 1GM5A 3ERSX 4DUYL 2E5LL 3HKZE 2MNAA 1CKOA 3HOZG 1YNXA 4AH6A 1VQGA 3A5UA 4JBMA 4JI6L 1XNRL 1YJ9A 2ES2A 1PH8A 1G6PA 4JBKA 4WJ3M 4NXML 2IT1A 2PI2A 3I4NG 3S2DH 2JA6G 1KXLA 1SN8A 5LMNQ 1WCMH 1L0WA 5BR8Q 2CWPA 2XGTA 1GVPA 3H0GG 4JI2Q 4HIMA 1XNQL 2HT1A 4BBRG 3KJOA 3H3VI 2CQOA 2Y0SG 1BKBA 1QUQA 3HOZH 1GKHA 4X65L 2JA7H 3KFUA 1E1OA 1Q1EA 3E9IA 3RLOA 1C7YA 1H95A 2KCTA 1VQ5A 4JYAQ 2C35B 1FJGQ 2CFMA 1AE3A 2UXDL 2PQAA 4R4OA 1HR0L 2BH8A 4P73A 4DV6Q 3GTLH 3CCMA 4JOIC 1NBWA 5ELOA 2JE6I 3TQYA 3T1HQ 2E8GA 5M5WH 4L5QA 3S24A 3BZCA 1N32Q 4YHHQ 4DR3Q 3HOVH 2IHFA 4LUZA 1XPUA 1CSQA 4JI3Q 3A5ZB 3I2ZA 3CC2A 1KQSA 2R93G 1FGUA 5IWAQ 1OXSC 1E1TA 1X54A 2EIFA 4IOAA 4JV5Q 4K0KL 4DR1L 4LWCA 4LFCQ 4LF4Q 4OO1I 2KHJA 2I5LX 4R1JA 3UE1A 2NVTH 1YJNA 4JI7Q 1OXTA 2R7FA 3H3VH 2LXJA 4IJLA 4X62L 3S1NH 5C3EG 1B8AA 2DUDA 2LSSA 3UE0A 3CCQA 1I94Q 1X3GA 1KC8C 3STBC 4C3JH 3GTJH 4A3FG 1IBKL 1K83H 2VQEL 1XMOL 4JI4Q 4B3TL 1OTCA 2NN6I 3D31A 4DV5Q 4C2MH 3CD6A 1EQRA 2VZAA 5JJIA 2Z0SA 4DR2Q 4C3IH 4OONA 4B3RQ 5M5YH 4DR5Q 2UUAL 2ASBA 2PNHA 3F2BA 3RZDH 1XTDA 4MZ9A 5AJ3Q 1BBUA 4A3BG 4IPDA 4OWWB 4NXNL 4JC0A 3UDIA 3OTOL 1J5EQ 4BXXG 4A93G 1ASZA 1VS0A 1WJJA 3F8TA 2A1AA 4XTCS 5GAHC 1VQIA 4GOPB 1VQOA 2F4VL 1VQBA 1WOCA 5M3MG 2WAQG 1TXYA 1YHQA 2VNUD 1X3EA 4TVAB 2ZJPA 4DV2L 3PIOA 3AQQA 2KBNA 3PV0A 2JA5H 3S17H 2MQHA 1HH2P 5M5XH 3F2CA 1RL2A 2AMCB 4YCVA 3JAMi 4A3DG 2IX1A 3PUZA 2AKWB 5IYCG 4GKKL 1RIPA 4JI8L 5M3MH 3CQZH 4B3SQ 4DR6Q 2VW9A 4O2DA 4GNXC 4A3EG 3H15A 4LF8Q 4DV1L 1LTLA 1TWCH 1PVOA 3GTKH 3CCSA 4DR4Q 1VQHA 4A3DH 3CW2C 2Y0SE 1K9MC 1VQPA 3M9BA 3HOXH 1QZGA 3RLNA 4A3KG 4JI0L 3TEHB 4IO9A 1Q7YC 1E7ZA 2ID0A 3S1RH 5LMNW 4DV7L 5IP9G 2UUCQ 1X3FA 3CC4A 4LF7L 3HOUH 1IBLL 1M90C 3NENA 4HIDA 4FDBA 1L1OB 4L5TA 3T1YL 2R92G 1K73C 4DV4Q 1NTGA 1IBMQ 3A0JA 3CPFA 2H5XA 2JK8A 3CP0A 4A3CG 3PCOB 2A8VA 4A3KH 1VQ9A 1MIUA 2KCMA 4BY7H 4LF9L 2D0PA 5IYBH 2HHHL 4DR7L 1I6HH 2K14A 4A3JG 4L5RC 1YZ6A 1SMXA 4GS3A 2IHEA 4QL5A 1PH9A 3PUYA 3AFQA 3UDFA 2PI2E 1CKNA 1KD1C 2R92H 1OXUA 2UXBL 4BY1G 2YTVA 2Q2IA 4EX5A 3WWVA 2EXDA 5GAGC 3G48A 3HOYH 2WFWA 3OYYA 2K5NA 3W1BA 3IRBA 4OXPA 3S1MH 3J80i 1YIJA 5H1SE 5LMUQ 2JEAI 4GKJL 4A3JH 3HFZB 3EBEA 3PF5A 3GTPH 1AH9A 2RHSB 2WB1E 4JI5L 4DV0L 1X55A 4KI0A 1Y14B 2ATWA 3PO3H 4A3GG 1VQLA 2LXKA 2VS1A 1GO3E 3FKIG 3M4QA 4IPHA 4P74A 2BA0A 3TREA 1VQKA 4A3LH 1D8LA 1L2FA 1K3RA 1UE5A 4DUYQ 1EFWA 1W2BA 2E5LQ 2NVXH 4LFAL 3W1GA 1N33L 4KLKA 1VQ4A 4JI6Q 1IXRA 1XNRQ 2JA9A 4KHZA 3HOWG 4YCUA 3J81i 1PH3A 4NXMQ 1WFQA 3PUWA 2QGQA 2D62A 3I55A 1XMQL 1B7YB 1YBYA 1HZAA 4A3GH 3STBD 1XNQQ 4OWTB 3CF5A 1BVSA 3I4NH 2VQFL 1IZ6A 2FXQA 2JA6H 2DGYA 3GTQH 3JAMc 1VQAA 2WAQE 3H0GH 4UP8A 1N34L 1C0AA 4X65Q 1EWIA 4BBRH 1YI2A 1YITA 4DAMA 1PH7A 3RR5A 3CCEA 4LF5L 1FVIA 2IX0A 3DM3A 4MNOA 2B63G 2UXDQ 4NPSA 2F3IA 1X9NA 1SFOH 1HR0Q 4POGA 4DK6C 1JT8A 1L1OA 1HZBA 4HIOA 1NE3A 2R7ZG 5M3FG 1N8RC 1J6QA 2JEBI 3KF6A 4AYBG 4AIMA 3PSIA 3CCLA 3CC7A 3HKSA 4OX9L 1T9HA 3FHWA 1HZ9A 4AQYL 3TS0A 1CSPA 3U4ZA 2A19A 5FJ8G 4DR6L 4BBSG 3PUXA 2QEXA 4DR1Q 4K0KQ 2OTLA 2JA8G 4QJFA 1AE2A 3EIVA 4A76A 4IFDG 4B3ML 3S16H 2Z6KA 2R93H 4LF6L 4Y7NH 1W3SA 3K81C 1HNWL 1QVGA 2B3GA 5IP7G 1OXXK 2ZM6L 2YTYA 4X62Q 2ZJQA 4RMFA 3AYHB 1PFSA 3K80C 3NBHB 4GNXA 3L7ZC 1IBKQ 2K4KA 4GN3B 2VQEQ 1XMOQ 3GTMH 4B3TQ 2N49A 4BBSH 3CCRA 5HY6A 1WI5A 3NELA 4GLAC 3A74A 5C3EH 1S40A 1JMCA 3J7A5 1KL9A 2K75A 4DNIA 4A3FH 3PO2G 4JBWA 3M85A 4WJ4A 1VQEA 4QQBX 4ME3A 5J3BA 1BBWA 4JCVE 1L1OC 2UUAQ 1A0IA 1S72A 2UXCL 4DV3L 1FL0A 3ICEA 1EYGA 4GLVB 4NXNQ 3J80c 1KAWA 4MTNA 3OTOQ 5C44G 1ASYA 4X66L 2K5HA 3S2HH 4A3BH 4LW1A 2F4VQ 1EIFA 1HZCA 4A3MG 1Y1WG 1MKHA 1KHIA 2Z6KC 3CCVA 4A93H 4BXXH 3NEMA 4DV2Q 1KIXA 1Q86C 1NMGA 3I4MG 1VQ6A 4R4TA 3J81c 2N3SA 1QVFA 3J7ZC 1QVCA 4HJ9A 1E24A 2R6GA 3SGIA 5IYDG 3I56A 4HIKA 2ZTEA 4YWMA 4JI1L 4KHPL 4GKKQ 4JI8Q 5IT9c 1LM0A 1Y1WH 5JEAG 1K8GA 3S14H 1PH2A 3E0EA 1OXVA 4DV1Q 4IOCA 5IYCH 1CUKA 3MXNB 4LNQA 3GTOH 5K36G 5JJKA 4A3EH 2MFIA 3M3YH 1X65A 2KENA 1JJGA 2QA4A 1UWVA 3B6YA 5C0XG 2RCNA 4JI0Q 4DAYB 1XJVA 4IFDJ 1QUQB 1MJEA 4DV7Q 4LF7Q 2ZTCA 3GO5A 2D0OA 5IE8A 3BJUA 2HIVA 1QZHA 1IBLQ 2N78A 1IYJB 1G291 1P16A 1U0LA 1Y1VG 3T1YQ 1V9PA 5C4XG 3GTGH 1A8VA 5IP9H 4PG3A 1TWFH 4PZ7A 2Q2UA 2UUBL 2F52A 2UU9Q 4A3IG 4EQ5A 1SR3A 4J15A 4QY7A 2KHIA 4LFBL 1LYLA 3KF8B 4LF9Q 2N8NA 4H02A 4ALPA 1VQ7A 2VY3A 1HR0W 2HHHQ 1YVCA 4POFA 1HNZL 2VUMG 4DR7Q 4A3CH 3G71A 3W5OA 3CAMA 4JG2A 4GOPA 4BA1I 1XPRA 1NY4A 1TWAH 5GAEC 5C4XH 3PF4A 3K8AA 2UXBQ 1HNXL 3KYHC 1WYDA 3F1ZA 3M4OH
chains in the Genus database with same CATH superfamily
4PZ6A 1H9JA 3GTKB 1N36L 4A3DB 4L63B 1R9TH 2HIXA 5GADC 2I5MX 2IW3A 3HOXB 1VF7A 5JVH3 1Q12A 2RKSA 4RGMA 3K59A 4HJAA 3C3LA 1N33Q 5K36H 1C8CA 2IY5B 5BR8L 2ALYB 3RN2A 5C3WA 3F2DA 2PW5A 2RF4A 2Q8TA 3VR4A 1G2TA 4R4CA 2DNEA 3J81j 1DGSA 3C1FA 4QIWE 1N34Q 4GOPC 1Z6HA 3GTGB 1MBYA 1FJGL 1UE1A 4I65A 1N9WA 4Y52H 3CPWA 3MXPA 1U5KA 4XIGS 5IGFA 3NWTA 3K0XA 3ITPA 1DCZA 5CBAE 4NP5A 3HS0C 2B63H 2E2HH 3BG3A 1N32L 4YHHL 1KDBA 2EY5A 1BF4A 2LS01 4LAAA 4DK1A 1IL2A 3M4OB 2R7ZH 5M3FH 4GLXA 4RGNA 5KYIA 4LFCL 5GROA 3NTHA 4YWKA 3KLWA 4F8MA 2B2UA 1R9TB 5COYA 4HCEA 1Q46A 1O7IA 2YU9H 3P1HA 4IFDH 2HD3A 5E7NA 4F87A 3UDXA 1JR0D 4PV1C 3SK8A 5IP7H 2CCZA 1HFNA 1PV4A 5EPLA 4BA2I 2F1MA 1Q1BA 2PMZE 2QEJC 1LV9A 3RLFA 3UI2A 5ELFA 3OW2A 5IY0A 3IAYA 2WB1G 4DR5L 1EYCA 4LK1C 4RGOS 4OO1G 2DJGC 5BN4A 1A63A 2JQOA 2M00A 1EYAA 2NTSA 2HQLA 1CKNB 2JJQA 5IODA 1VQJA 5C0XI 1HJPA 5C44H 1D1KA 2RDFA 1KNAA 2NN6G 3BVZA 2F03A 2R7ZB 5M3FB 1VQ8A 1AFPA 4HJ5A 4CJ1B 2ICEC 3W2DA 1JWSD 3BU2A 3I4MH 3S1QH 2ZXRA 3GD7A 2WV6D 5CR3A 2IX3A 1SNOA 2E74C 2YU9B 2DJFC 4DR4L 2NWGA 2WACA 3K7UC 4JW0A 2P5ZX 1S5FD 4ILWA 1LTSD 3SK4A 5I2YA 2PQAB 4OIJA 1PH4A 4ZLTF 4BY7G 2AWOA 4DPGA 1STHA 1H9RA 1PXUA 2UUBQ 1I50H 4LFBQ 2VL6A 1SYEA 3HOYG 1I4PA 5C44B 1TY2A 2YTXA 3LWUA 4HR7B 4P71A 1GUSA 5GQOA 2RHQB 1RCVD 1PDQA 2IPKD 3DXJC 4G4KA 5FLXc 3PO3G 1HTLD 2ICIA 5LMUL 2Q8IB 3I4MB 4YCWA 3GTOB 1GJXA 4A3EB 2YV5A 2SNMA 1WD1A 1LTBD 2JP1A 2E5LL 3KLSA 2MNAA 1C4QA 1YNXA 4AH6A 4JBMA 2ES2A 3A55A 1SNMA 1SNQA 5LMNQ 3H0GG 2XGTA 3LWEA 4JI2Q 1XNQL 2CQAA 4KJOA 1CZWA 2Y0SG 3HOZH 1GKHA 1WTOA 1E1OA 3E9IA 2QKIC 1C7YA 2MHVA 1VQ5A 1EY9A 2CFMA 2JN4A 2UXDL 2FJ2A 1HR0L 2A73B 2JE6I 3TP7A 3T1HQ 2E8GA 1TVXA 2FMMA 4DR3Q 1XPUA 3A5ZB 3I2ZA 3KLRA 1KQSA 3P7JA 2KECA 5AFWA 4FF4A 2VUMB 1SNCA 2KVMA 3A8JE 4LWCA 4LF4Q 2KHJA 2I5LX 4R1JA 3EROA 3UE1A 2R7FA 3H3VH 5C3EG 1B8AA 2DUDA 2LSSA 3TDQA 1K3BC 3UE0A 3CCQA 1GHJA 4ZKCB 4JI4Q 3IL8A 5FK9C 1SEBD 4A3FG 4B3TL 1EZ8A 1OTCA 1NR2A 4DV5Q 2X6LA 1VMPA 1I4RA 3A56A 2B2TC 2UUAL 2A6EC 2AUKA 3F2BA 1BUVT 4FF1A 1XTDA 1BBUA 4A3BG 2EJFC 2TSSA 1IKMA 3OTOL 1QWYA 1VS0A 1Y8NB 2KOLA 1VQIA 1VQBA 1EY0A 5EKKA 4DV2L 4G7OC 4R9WA 3JAMi 3I3CA 2IX1A 3PUZA 3AMUA 2O2LD 1RKNA 2NN6H 3K57A 5M3MH 4DR6Q 2A74C 3H15A 4DV1L 1LTLA 5A2QL 1PVOA 1KDCA 3OIPA 1XYIA 3VR3A 3CW2C 2EYPA 3M9BA 4WORA 4ZK9B 4A3KG 4JI0L 1E0BA 2UUCQ 3CC4A 3PO2B 3J81L 4IURA 1IBLL 3E0JA 3FVQA 4HIDA 4FDBA 5FOBB 4HMIA 3MXUA 1NTGA 4A3CG 3CPFA 2H5XA 3CP0A 2F0UA 2K01A 4BY7H 4LF9L 2HHHL 4L5RC 1IYUA 2I46A 1EY5A 1PRTF 4ZKBB 2B2VA 4HTHA 2R92H 1CKNA 1TKWB 1F9RA 3HOYH 1J9OA 3W1BA 3S1MH 3J80i 2K33A 4A3JH 3HFZB 2ATWA 1Y14B 2L4NA 3PO3H 4A3GG 2VS1A 1GO3E 4IPHA 3M4QA 3TREA 2BA0A 2NUCA 1D8LA 1L2FA 1UE5A 2NVXH 4M8AA 4EVOA 3EJIA 4RA8A 4JI6Q 1XNRQ 1WTXA 4UAIA 5G3LF 4C1NK 2E2IB 2A68D 1I3QB 2B39A 3VR5A 4G7HC 2CHBD 2WAQE 3H0GH 1RF2D 3L3OC 3CCEA 1ESFA 2F0GA 4NPSA 2F3IA 1GXDC 4BY7B 1DXMA 1JT8A 4KN7C 4FXKC 1WTVA 4XT1B 1TR5A 2PZTA 3NQTA 2LMCB 3KUPA 3CC7A 2XNAC 3HKSA 1T9HA 5C5LA 3LX0A 3HOYB 1HZ9A 3TS0A 3RZOB 5EJWA 5FJ8G 4BBSG 2QEXA 4DR1Q 2OTLA 3NE5B 4QJFA 3EIVA 4A76A 4B9XA 1LTGD 1O78A 2A68C 3K81C 2B3GA 1OXXK 3S2DB 2NVXB 2L9HA 3AYHB 1YNJD 5M9OA 2HQEA 3BVMA 3I4LA 3EFXD 3CCRA 1EL0A 4MIUA 3A74A 3D6CA 5C3EH 1S40A 3J7A5 2JA7B 1CI3M 4DNIA 4A3FH 1IL8A 1I4GA 4CKEA 4QQBX 2FMCA 2HCCA 5J3BA 3N52A 1A0IA 2EDGA 1D5MC 4DV3L 1V1PA 3ICEA 4NXNQ 1LT4D 2Y0SB 1U4MA 1ASYA 3HOVB 4A3BH 2X69A 2J4XA 1HZCA 1ESRA 4KKTA 4A3MG 4XXEA 1Q8IA 3NEMA 4OIKA 5C6AA 4R4TA 4KHVA 3J81c 1AZPA 2B8GA 2N3SA 3EQLC 3A7LA 2R6GA 4JPBW 3SGIA 2Z1CA 2ZTEA 1WTPA 1SBBB 4KHPL 4JI8Q 1Y1WH 4R8IA 3S14H 1PH2A 5CC4A 3NK9A 1AEXA 4C2MB 2F3WA 3U9SA 2F0PA 4DK0A 2MFIA 2DY7A 2WKCA 2KENA 1ICFB 2QA4A 3B6YA 5C3EB 3RZDB 2BDOA 2F0EA 4IUNA 4DV7Q 3T4AC 4A3FB 4LF7Q 2NYZD 1HXYD 2HIVA 1A6XA 1Y1VG 3T1YQ 2Q2UA 4U68A 2F52A 4DA2A 3QB3A 4J15A 2KHIA 2JA5B 4C3HG 4ABNA 3E6ZX 2VY3A 1HR0W 4A3CH 1RD9D 4GZYC 4K2KA 2BE5C 2HCIA 2UXBQ 1WYDA 1YNND 5EPJA 4X64L 1HQRD 5IGEA 1TIID 1I5FA 1K8OA 1CKMA 3VDYA 4DUZL 4X3TA 1JB7A 3M7NA 1AW7A 1XXGA 4DV0Q 3S14B 2PW7A 3I70A 2XTIA 1PTOH 4L5SA 1ET9A 4K2LA 1GD7A 4V0BA 3TRZA 2DY8A 1WCMG 2F0JA 1EU4A 3S1RB 2E75C 1B4OA 4GN4B 2L15A 3ZJYC 4KKUA 1G91A 1EUJA 2B2YA 4A3KB 3Q24A 2VQFQ 4IFDI 4FXGC 2XWBB 4LF5Q 2V1CC 1WD0A 2K5VA 1XWEA 1LACA 3ULJA 3BDLA 4UY8C 5EGTA 3TP8A 4PMWA 2VXWA 4OGQC 1QB5D 5JJLA 3QIAA 4DAVA 5CV4A 1X3QA 4OX9Q 2NZHA 1U9RA 2VB2X 3CCUA 4AQYQ 1DOMA 2NVQH 1Z47A 2D5DA 4DXFA 4ID6A 4B3MQ 2OF1A 5FJ8H 1BCPB 1SLJA 5JVG3 2FFKB 1HNWQ 3H6MA 1ZXTA 4IPCA 3I91A 2UU9L 5IGBA 4TKOB 3RD4A 4A3GB 3S15H 3MXGA 3I4NB 2OQKA 1JE5A 4DR2L 1NMFA 4O0AA 3HKZG 4KD4A 3T53B 1TS4A 5JAVA 4LUOA 2F0QA 3FPPA 4TRDA 4DKAC 1CK1A 3FP9A 1SFOB 1PRTC 2EJGC 5AJ3L 5BN5A 1DJRD 3A8KE 2BH2A 4RAUC 4KY6A 1JB3A 1J5EL 1PMRA 2OQ0A 1GUTA 2CWAA 1E2ZA 1A62A 3L2PA 3PGZA 2L5TA 2Z4IA 4X6AH 3RUZA 2AQ3B 3PIO3 4HJ8A 2ZXOA 4X3SA 4A3MH 2AQ1B 2NVQB 4JI1Q 1QNUA 4ULLA 3D6WA 3GTMB 4BBSB 1CZGA 2Q2TA 2BOSA 4UDUC 3MEFA 1V1OA 1X56A 1K8AC 1F9SA 1KLGD 5E4XA 5KGUA 3S15B 3HOUG 1CTMA 3G6EA 1VMCA 2EYLA 1CFMA 1UE6A 5I6WA 1JQYD 3RNUA 3CHBD 3G4SA 4AYBE 2PYKA 1S5BD 3K7AH 4IN3A 4L6TB 2MO0A 3BYYB 1PH1A 1IBML 2F0NA 2ZTDA 4P72A 4QUCA 1PHJA 3ULLA 4IQZA 2AQ2B 4CDDC 4XYQA 3S9WA 1JJ2A 3C1EA 1MSHA 1Y1VH 3KF6B 4CKBA 1JC7A 2FINB 1VQCA 3PIPA 1EIGA 4C3HH 1M1KC 3J7AV 1JWUD 1K0SA 1D7QA 1HNXQ 4PQXA 1B9NA 5FLMH 3U9OA 4C1NI 3J7YW 1UE7A 4ZUJA 2GVAA 4J8QA 5J22A 1N36Q 2B2WA 4GNXB 1GM5A 2CVRA 1STYA 3HOZG 2VB3X 3NTKA 1T5XD 2RVLA 5FLXL 1YJ9A 1PH8A 4JBKA 4NXML 2JA6G 1TT2A 1WCMH 1L0WA 5BR8Q 4PMCA 4BBRG 3KJOA 3H3VI 1JE4A 4K5VA 2N88A 1WTRA 5JPMC 2GA4B 4X65L 1H95A 2KCTA 4QMGA 2C35B 1FJGQ 2EYHA 1AE3A 2EJMA 1Y1VB 1JCKB 3GTLH 3CCMA 4JOIC 4NKLA 3TQYA 3TBIB 2LKVA 4L5QA 5KNBA 3BZCA 1N32Q 4YHHQ 1EQVA 4LUZA 2R93G 1X54A 2F4IA 2KJXA 3R2IA 4LFCQ 5IGCA 4OO1I 1Y8OB 1KDAA 1YJNA 2EOTA 2HDLA 3STBC 4C3JH 1MGSA 2NZ1D 1LTTD 1FD7D 1K83H 4S3SA 1XMOL 5FO7B 1LTID 2NN6I 3D31A 1RJTA 3CD6A 1WCMB 5JJIA 2Z0SA 5IT9E 4OONA 5M5YH 4OEMB 4DR5Q 4KV6A 4MZ9A 1HUNA 1HPCA 4OWWB 2B63B 4JC0A 4WRDA 2E2HB 4A93G 4BXXG 2RCFA 3AU7A 1WJJA 3F8TA 2EYJA 1BBXC 5GAHC 1NSNS 4GOPB 1VQOA 1WOCA 1ML0D 5M3MG 1YHQA 1X3EA 4TVAB 2KCNA 3AQQA 2MQHA 5M5XH 3F2CA 3OMCA 2AMCB 1QILA 5E1FA 5C5MA 3VA7A 3G6JB 3DM1A 4GKKL 1RIPA 3KLSX 4KY5A 4O2DA 4ME5A 4DNTB 5DEHA 1UAPA 4DR4Q 1K9MC 1VQPA 4ZQ3A 1H9SB 2MUYA 2H4OA 1Q7YC 2PQEA 1E7ZA 4J1MA 2LFNA 3HOUH 5M5YB 4L5TA 2R92G 5DM63 3HKZB 3A0JA 3E3XA 3PCOB 3A54A 4OELB 3BS1A 4O1NA 1R4QB 1CHQD 1VQ9A 3K5NA 1I6HH 4A3JG 1YZ6A 2QCPX 4GS3A 2K6AA 3PUYA 3AFQA 4NMZA 4RKBA 2YTVA 1PZID 4EX5A 3WWVA 5GAGC 3S1QB 3G48A 3HZXA 1B3AA 3OYYA 2F0WA 3IRBA 3IFTA 1YIJA 4GKJL 5H1SE 5LMUQ 4JI5L 2LXKA 2RSNA 4P74A 4FP5D 1W2BA 1B1ZA 2E5LQ 4LFAL 1VQ4A 1ENCA 2JA9A 4KHZA 2A5HA 1V1PB 2QGQA 1XMQL 1YBYA 1HZAA 3OMGA 4V190 1XNQQ 3CF5A 3SR1A 3HOUB 1IZ6A 2JA6H 1I50B 1W6KA 2DGYA 1EIHA 3GTQH 3OWEB 1VDZA 2RQXA 3E5SA 4BBRH 4ZYSA 1FVIA 5I2XA 1BDOA 2UXDQ 2A6ED 1HR0Q 1ICWA 1JOOA 1I6HB 1ZEQX 1FNWA 1L1OA 1HZBA 5D14A 1S5ED 1N8RC 3KF6A 1K28A 2Z6BA 4AYBG 2O4XA 3PSIA 3CCLA 1NCVA 4CJ0B 4I7AA 2WIIB 3FHWA 1CSPA 4IUTA 1HFGA 4N9PA 2RBMA 3TMEA 3MC0B 2JXMB 2R93H 4LF6L 5FKAC 4Y7NH 1W3SA 3OHXC 1QVGA 2ZM6L 1RHPA 2YTYA 2ZJQA 4RMFA 3X3MA 3K80C 3NBHB 4GNXA 1U4PA 1ENAA 2Z4HA 4B3TQ 2N49A 1BCPF 1SNPA 3V2TA 1PTOF 3HOZB 3SEBA 1KL9A 4JBWA 2QILA 2SDFA 1VQEA 2F0DA 2JA6B 2UUAQ 1PLFA 1QCBD 3GTQB 2UXCL 1SYDA 3T13A 1A2UA 3P75A 1SMYC 4MTNA 3OTOQ 4X66L 2K5HA 5DNFA 4MTKA 1EIFA 1Y1WG 1MKHA 1XTCD 2Z6KC 4A93H 4BXXH 4DV2Q 3VYTA 1KIXA 1CQVA 1OO9B 1Q86C 4KMUC 2OXPA 2F3VA 3H09A 3K5MA 1QVFA 3X3NA 3J7ZC 2JYOA 1LO5D 4HMJA 5IYDG 5CV5A 4HIKA 4YWMA 2EPBA 2XRQD 2R93B 5IT9c 4Y7NB 1ILQA 2RDGA 3E0EA 4DV1Q 1UNSA 3H91A 2EXZA 1CUKA 4LNQA 4K6DA 3M3YH 1XX8A 2C5CA 5KNDA 1NR4A 1UWVA 4JI0Q 2RCNA 3DMUA 5A35A 1NUCA 1QUQB 2ZTCA 2D0OA 2WB1B 3BJUA 1IBLQ 1QZHA 4FF3A 1G8ZD 1M8AA 1P16A 2KCCA 4ZRZA 3A8IE 1A8VA 2QF7A 1TWFH 4PZ7A 1EYDA 3LNNA 4K8JA 4H0LC 4HAEA 3TP5A 4HN7A 4QY7A 5C0XH 1UUPA 2G9HD 1LYLA 1LABA 3PQIA 4LF9Q 4H02A 2HHHQ 2EY2A 1VQ7A 1YVCA 1HNZL 1AP0A 1EWCA 3MHBA 1SYFA 1TS5A 3CAMA 4GOPA 1Y69U 3PF4A 1TWAH 5JOBA 5C4XH 3BVGA 5KRUA 5M3MB 1D1IA 5ELNA 4CBVA 4A3IH 1Q8KA 4A4IA 2GN5A 3TS2A 5TSSA 2WP8J 1RODA 4EQOA 1SROA 5CGKA 3KJPA 5D3IB 2AWNA 3NQIA 3QO2A 5DLQE 5NUCA 2K52A 4IJHA 2Q2HA 1EY4A 4R4QA 2L11A 1ENFA 1KRTA 2EYOA 1LT6D 1H9SA 1O7ZA 4KK7A 4DNRB 3LGJA 3MXNA 3Q8DA 2C9OA 1P8LA 1E3PA 1TWFB 4JYAL 2A69D 4DGZA 4DV6L 3DLLA 2O5IC 2R92B 3T16A 3GQBA 1TU2B 3C2PA 1DOLA 3S1MB 4JI3L 5I6YA 3L9AX 2I0QA 4A3JB 1I6VC 1SYCA 5IWAL 1YHBA 2CKZB 4JV5L 3PO3B 1KRSA 4DAPA 2MO1A 2ZJRA 2OWOA 4QUFA 1SRUA 4P75A 1PYWD 1MJCA 3URYA 1VCIA 3R3OA 5DAUA 4JI7L 2XN9C 2NTTA 2A6HD 2X6GA 5ELDA 3KBGA 2R7DA 3F2UA 5EAYA 1I94L 1CM9A 3CMEA 5CV6A 2A69C 2B29A 1BO0A 2OCEA 1B50A 3H0GB 4B3RL 3RN5A 3HEJA 1X32A 1FGBD 1HRJA 5C4JH 1PH5A 1GOZA 1Q81C 4DV3Q 4ODGA 2BA1A 3I4OA 1PYBA 3Q22A 5IIFA 4HSPA 1EEFD 5KIXA 1JJCB 1VQFA 5K5PA 3KDFA 2B2UC 3D0FA 4GN5A 1PYSB 2A6HC 1PA6A 2R61A 4N8FA 5LHY1 4AYBB 2EY1A 2I5HA 1EQTA 1EQQA 2BE5D 4HEDA 3I72A 4B3SL 3KOJA 4QGUA 4KHPQ 2YYZA 3SK5A 1G51A 4CHTB 4APVA 1KXLA 2K1BA 1V43A 4LF8L 1QG7A 3NSWA 3HOXG 5IYDH 2NVYH 3L0OA 3DWQA 1XPOA 4TQUS 3NBHA 1SE8A 1BOSA 3W3AA 1MHWC 3FRPB 4G7ZC 1WTQA 2L12A 1A15A 3U50C 1HQMC 3GDEA 4YY3L 2RSOA 3UDGA 5C4JB 4DV4L 4A3BB 5FLMG 4PZ8A 2KUMA 3MA2B 4YY3Q 5KEEA 2KQ3A 2SEBD 3CXCA 4PMBA 3NP8A 4RGTA 4YWLA 4UP7A 4UPAA 3JAME 1W6JA 3BZDB 4RWSC 3EN2A 4QIWB 1Y1WB 4X64Q 2K5WA 5LL6S 2MJ8A 4A3LG 4B9WA 4OWXB 4JBJA 4DUZQ 3MFGA 2F0FA 4UP9A 3ERSX 1NAPA 4DUYL 3T51B 3A5UA 4IALA 4WJ3M 2IT1A 2PI2A 1STBA 1SN8A 1KTKA 2CWPA 1GVPA 1B44D 2KEDA 2TMPA 5FO8B 4BWGB 1QUQA 3KFUA 1Q1EA 3RLOA 3MAQA 2HDMA 1SSOA 3MTSA 2CH4W 1PRTD 1Y8PB 5ELOA 1F2LA 2B2TA 4MN3A 3D4WA 2PMZB 3OIQA 2IHFA 2EZVA 1CSQA 4CKCA 3CC2A 2PPBC 1OXSC 1E1TA 1G2SA 5ELCA 4Q5VA 1EZ6A 2EIFA 4C3JG 1PTOB 4K0KL 3J80E 1DYQA 3ONAB 2NVTH 3QJYA 1SJHD 4C56C 2BCOA 4G57A 4IJLA 4X62L 1E2WA 3S1NH 1F2ZA 2UU9Q 1IBKL 2VQEL 1Z7TA 5E4WC 4B08A 2XWJB 3I73A 3R93A 1EQRA 4DR2Q 3NBIA 3QG1A 1MI2A 3G7LA 5EKLA 1NNXA 5EQ0A 2ASBA 2PNHA 2QDLA 4JK1C 5AJ3Q 3N6RA 4RFBA 1A3TA 2F0SA 1AN8A 2PCFB 1RDPD 1J5EQ 1ASZA 4TSSA 1ILPA 2F4VL 4L8JA 2WAQG 1TXYA 2VNUD 2F0TA 4OL7A 3PIOA 2KBNA 3PV0A 3S17H 3TN2A 5HURA 1HH2P 1SXTA 1CA5A 2KHSA 2AKWB 1A2TA 3VA5A 1H9KA 2F0LA 2E2DC 3MEHA 3CQZH 2VW9A 3CKIB 4GNXC 4A3EG 3I90A 1TWCH 2IL8A 2JSOA 3MFYA 3GTKH 3CCSA 4A3DH 1VQHA 2DNCA 3NTIA 4NDXA 2Y0SE 1GUWA 3HOXH 1QZGA 1BR9A 2K7VA 5ELBA 2MPMA 4RKLA 2SOBA 5IP9G 5EBCA 5DM73 4KKSA 5IGDA 2CW0C 3NENA 2EE1A 1L1OB 1LT5D 1WVLA 1II3A 1UEAB 1IBMQ 1DM0B 2KCMA 1F9PA 2D0PA 4DR7L 5CV8A 4A3MB 1O80A 4KD3A 4QL5A 2XIWA 1PH9A 3UDFA 3MWYW 5EBDA 2WKDA 1OXUA 2BDNA 4BY1G 2K5NA 4UHVA 3NHHA 2N55A 3PF5A 3EBEA 1AH9A 2RHSB 3CQZB 1X55A 3FKIG 4H7BA 1PFNA 4A3LH 1TWCB 1EFWA 1L0XB 3W1GA 1N33L 4KLKA 2F0VA 4RCNA 1IXRA 1F77A 3HOWG 4YCUA 3J81i 1PH3A 1WTWA 4NXMQ 3K7AB 3PUWA 3VYSA 3GV6A 3NWSA 3I55A 1B7YB 1T5EA 2K03A 3STBD 4OWTB 1A3VA 3IKJA 2B2VC 3JAMc 1N34L 4UP8A 4X65Q 1EWIA 1YI2A 1PH7A 4DAMA 2IWHA 3RR5A 3P20A 4MNOA 1QOHA 3GV3A 3IFDA 3SDZA 4C3HB 5ELEA 3FEWX 3TSSA 1NE3A 1J6QA 2JEBI 3D3RA 1Q90A 4AIMA 4H44C 1PZJD 2G5DA 3HG9A 3VYRA 3PMFA 2EVBA 4RHRA 3K5LA 1D6EC 2JA8G 4K5XA 4CGYB 3WOFA 1IHZA 4U673 2K04A 1PFSA 3L7ZC 3NXWA 4GN3B 1XMOQ 1WI5A 4GLAC 4Z9CB 3PO2G 1S5CD 1SYGA 2J7ZA 3VR6A 4K8IA 4ME3A 4JCVE 3QOJA 2F0HA 3GTLB 1S72A 3SK6A 3HRZC 2F0IA 1EYGA 4XYOA 3J80c 1KAWA 1BNZA 3MZ5A 4LW1A 1FNUA 2ZT9C 1KHIA 3FMCA 4K5WA 4X3KA 2R3ZA 1VQ6A 4RCOA 3C46A 4CDCC 1RTNA 1EY7A 1E24A 3I56A 1STAA 4GKKQ 5JEAG 3RMHA 4C3JB 3ERQA 1K83B 1OXVA 4IOCA 2V4DA 1EFID 3HGBA 1R4PB 1DD2A 3MXNB 3GTOH 3OPOA 2OT2A 3R2TA 4A3EH 1X65A 1HA6A 1E2VA 3Q6SA 1JJGA 2SNSA 5C0XG 4M1UB 3DUZA 5IT9L 1MJEA 3Q0AA 1I4QA 1Q3LA 1ZKOA 1D5ZC 1SE3A 1U0LA 5C4XG 1F9QA 5IP9H 2I07B 4PG3A 2UUBL 4A3IG 2KEEA 5CV9A 4LFBL 1JOKA 3QOLA 5I9PA 1L0YB 2N8NA 4ALPA 5M5XB 1ET6A 3G71A 3W5OA 3BDOA 5GAEC 1U4LA 1KABA 5I9OA 3KYHC 3F1ZA 2WAQB 2PZWA 4F7XA 4NB3A 3CRKC 2AHOB 1IYVA 3ER0A 4IPGA 5I4DA 1MSGA 4GKJQ 2VUMH 4XQJA 4BY1H 2NBFA 4DN4M 4JI5Q 5CORA 1VQNA 3DWPA 3K5OA 4H13C 4LFAQ 4DK3C 1K0RA 3FKIH 4YIJA 5LMNL 4JI2L 1XMQQ 2JA7G 1C9OA 4I7ZC 5JEAJ 4RHSA 1KAAA 3HOWH 1JORA 3KDFB 1TS3A 2FHTA 2WINB 4DAYA 5HGQA 2J0TD 3HOVG 2KA7A 5C0XJ 4MHEA 1EOVA 4HCSA 3T1HL 1D2BA 3E9HA 4DR3L 1SMYD 1MD2D 3EA6A 3ND9A 2K05A 4R4IA 3AB9A 3KF8A 4KN4C 3QR8A 3H3VC 1VQMA 3I8ZA 4LF4L 4BY1B 5D3DA 5CYUA 5T1GA 4LF6Q 3PUVA 2GVBA 2CH4A 4P2CB 3AEVA 2B2YC 3CMAA 5A2QE 2ZM6Q 2JA8H 3O13A 1TY0A 1EIYB 4JI4L 1X6OA 1YJWA 2HUGA 3FKIB 4C3IG 3K0YA 4DV5L 1PH6A 2XVSA 1TWGH 1Q82C 4BBRB 4LUVA 1ONLA 3J81E 1BQQT 3HOWB 2D2CC 1BXTA 4DU9A 3V05A 3U4VA 4KY7A 2NZOA 3PO2H 2UXCQ 1GUNA 1V1QA 3VR2A 1S3OA 5FO9B 5C3XA 3T56B 4X66Q 1AZQA 2JA5G 2O5JC 1B70B 4DXGA 1UEBA 4A75A 4OO1H 3CCJA 2EY6A 4IUQA 4RG1A 1VF5C 5CV7A 2K50A 2E2JH 2OTJA 4DR6L 4Q0FA 1LUZA 5CBEE 1U4RA 3KK7A 3A7AB 3U58A 1HCZA 1LT3D 3M4PA 3OOCA 2JA8B 3D4DA 3I7FA 1YEZA 2EQSA 1TWHH 1JWMD 5JEAH 2M9VA 4K6LA 3ND8A 4IUPA 2UUCL 1TWGB 1GUOA 1SYBA 1E22A 1SE4A 4EGVA 5IYBG 2E2IH 2L1BA 5KNCA 1I3QH 1VQDA 3BZKA 3AFPA 2AUJD 4A93B 4XQQA 5LL6X 1GUGA 1HNZQ 3WDNA 1YHAA 4FO2A 1NJIC 1KLUD 1Z9FA 4HJ7A 3CU7A 3ULPA 4JOIA 1GHKA 3DEOA 3JC66 5CMDA 1J8IA 3OSOA 3VYUA 2E2JB 5F2DA 1TQOA 4EQNA 3RZOH 3M3YB 4FYDA 1LTAD 3HKZE 2F0KA 1CKOA 3HP3A 5J1ZA 1TWHB 1VQGA 4JI6L 1HA5A 3QWNA 1XNRL 2XRSD 1G6PA 3I4NG 3FDTA 3S2DH 2HT1A 2M2LA 4HIMA 2CQOA 1BKBA 2JA7H 4JYAQ 1I4HA 5L37A 2PQAA 4R4OA 1D5XC 1WTHA 2BH8A 4P73A 4DV6Q 1TWAB 5C4XB 1NBWA 4JVZA 1B3QA 1DZ1A 3SXHA 1LTRD 5M5WH 4A3IB 3S24A 2XSCA 3HOVH 2PO4A 2K5QA 2B2WC 4JI3Q 1FGUA 5IWAQ 2K32A 5D65A 3KBXA 4IOAA 4JV5Q 4DR1L 2D9UA 3EVQA 2NB0A 5EKIA 4JI7Q 1OXTA 3DWAA 1PFBA 2LXJA 1I94Q 1X3GA 1KC8C 3GTJH 2F0OA 1STGA 4C2MH 2VZAA 1PZKD 1K8MA 4C3IH 4B3RQ 3Q23A 3GP7A 3RZDH 4IUUA 4IPDA 5J39A 1M4VA 1HHVA 4NXNL 3UDIA 1HUMA 5T1IA 1A3UA 3D8GA 2A1AA 3OW7A 4XTCS 2PZUA 5M5WB 2ZJPA 1LLRD 2JA5H 1X3PA 1RL2A 3NPPA 4YCVA 5KYLA 4A3DG 3CRLC 2ENBA 4BS9A 1IW7D 4LJZC 5IYCG 4RH6A 1YNJC 4JI8L 3H94A 4B3SQ 4FNFA 1I4XA 1CQFA 4LF8Q 1FNVA 4LMQD 3R8BA 1BCPD 2PNRC 4HSVA 1EY6A 1PTOD 3GTJB 2EYMA 1SNDA 3RLNA 3TEHB 4IO9A 3BYTB 4EQPA 3BDCA 2ID0A 3S1RH 5LMNW 4DV7L 4LF7L 3J7AF 1X3FA 4C3IB 5E3FA 1M90C 3D4RA 3T1YL 5IOCA 3DEPA 1K73C 1O7YA 4DV4Q 1QJOA 1CHPD 2JK8A 4N9TA 2A8VA 4A3KH 1IW7C 1MIUA 4F88A 5IYBH 2QW7A 2L0CA 2IJ0A 2K14A 1SMXA 2IHEA 1JICA 1KD1C 4K14A 2PI2E 3NUCA 2UXBL 2EYFA 2Q2IA 1B53A 2EXDA 1BCPC 1S5DD 2WFWA 1PTOC 4OXPA 2NVYB 1PFMA 5EPKA 3WOEA 2JEAI 3GTPH 2WB1E 4DV0L 2ZXPA 4KI0A 4ZUIA 4XT3B 3SE0A 1VQLA 5K36G 1F2YA 1VQKA 1V8QA 1FYCA 1K3RA 4IZ8A 4NW2A 4DUYQ 4R8NA 4FVMA 2K28A 4ZAIA 1WFQA 2D62A 2F0MA 4DF7A 1QE6A 4A3GH 1BVSA 3I4NH 2VQFL 2FXQA 1HTPA 4CDFC 1VQAA 3M4YA 1C0AA 5HGTA 1YITA 4LF5L 1EU3A 2IX0A 2B63G 3DM3A 4IUVA 1EY8A 5C4HA 1X9NA 4CJ2C 2RDHA 1SFOH 2MP1A 4POGA 4DK6C 1B9MA 1CT1D 2E76C 1EEID 1YNNC 4HIOA 1KNEA 2R7ZG 2G9DA 5M3FG 2MGSA 4DFAA 1G6ZA 3JAML 2OEOA 4XQNA 1EWHA 4OX9L 4E6IA 4AQYL 3U4ZA 2A19A 3PUXA 1S4ZA 4K0KQ 1AE2A 3M7GA 4B3ML 3GTPB 2Z6KA 3S16H 4IFDG 3OWFA 1HNWL 4ZCKA 5G3LD 5IP7G 3ZYYX 4X62Q 4QB4A 4FXDA 1SE2A 4KJNA 1IBKQ 2K4KA 1QNKA 4N8X1 2VQEQ 3GTMH 1ZYRD 4BBSH 3MVVA 5HY6A 3NELA 1DONA 2Z8LA 1JMCA 2DN8A 2K75A 4WJ4A 3M85A 1BBWA 1CA6A 1L1OC 5C4ZA 3V96A 1H9MA 1FL0A 1SDFA 1SJED 4QCLA 1C48A 4J6HA 4GLVB 4WJWA 1STNA 2CW0D 5C44G 3TZDA 3SVMA 3S2HH 2H1EA 2F4VQ 3CCVA 3DHQA 2QDBA 1IKLA 2Z9HA 1O7LA 1NMGA 3I4MG 2NVTB 5JPNC 4FF2A 2Q8RE 3J80L 1JOQA 5BN3A 1QVCA 1ZYRC 4HJ9A 3S1NB 4JI1L 3S16B 5ISRA 1LM0A 1K8GA 4CDEC 1SAPA 5IYCH 5IGGA 1FR3A 5JJKA 5FLXE 4QF4A 2K5DA 4OHJA 4KTAA 3FPUB 4DAYB 1XJVA 4IFDJ 2B8FA 3K6OA 4O42A 4X3UA 3GO5A 5IE8A 2N78A 3SHLA 2L55A 1IYJB 1G291 3TP6A 1TS2A 1PRTB 1V9PA 3GTGH 1RTOA 5JJZA 1DOKA 4EQ5A 1SR3A 1STEA 1B2TA 4WFN3 3S17B 3KF8B 3S2HB 2VUMG 4DR7Q 4XDXA 4POFA 1EOTA 2LY7A 3TZUA 2RA4A 4JG2A 3PIP3 4BA1I 1XPRA 1NY4A 3K58A 1F2MA 3K8AA 4PNYA 1HNXL 3M4OH
chains in the Genus database with same CATH topology
4X64L 4NB3A 5ELNA 4A3IH 2AHOB 1Q8KA 4PZ6A 4A4IA 1I5FA 2GN5A 3ER0A 4IPGA 1CKMA 3VDYA 2WP8J 3TS2A 4DUZL 3M7NA 1JB7A 2VUMH 4BY1H 4GKJQ 1SROA 1N36L 3KJPA 1R9TH 2HIXA 4DV0Q 4JI5Q 5GADC 2AWNA 2I5MX 2XTIA 5DLQE 4L5SA 1VQNA 2K52A 1GD7A 4IJHA 3TRZA 4LFAQ 1Q12A 4DK3C 1WCMG 4HJAA 1N33Q 1K0RA 2Q2HA 4R4QA 3FKIH 4GN4B 2L15A 3ZJYC 1EUJA 1KRTA 5LMNL 2IY5B 5BR8L 2ALYB 4JI2L 3RN2A 1XMQQ 2JA7G 1C9OA 3F2DA 2RF4A 5JEAJ 4R4CA 3HOWH 3J81j 1DGSA 3LGJA 2VQFQ 4IFDI 3KDFB 4QIWE 3Q8DA 1N34Q 4GOPC 1P8LA 1E3PA 4JYAL 4LF5Q 2V1CC 1FJGL 1UE1A 5HGQA 1N9WA 4Y52H 2K5VA 3CPWA 3ULJA 3DLLA 4DV6L 3HOVG 1U5KA 5C0XJ 4XIGS 4UY8C 1EOVA 3K0XA 4PMWA 3T1HL 3E9HA 2B63H 2E2HH 1N32L 4YHHL 4DR3L 4JI3L 5JJLA 2I0QA 5IWAL 1IL2A 4R4IA 1YHBA 4OX9Q 2CKZB 2NZHA 2R7ZH 4JV5L 5M3FH 1KRSA 3CCUA 2MO1A 2ZJRA 4GLXA 4AQYQ 2OWOA 1VQMA 1Z47A 1SRUA 5GROA 4P75A 4LFCL 2NVQH 4LF4L 4YWKA 3KLWA 1MJCA 1VCIA 4B3MQ 4LF6Q 3PUVA 2GVBA 4JI7L 5FJ8H 1SLJA 1HNWQ 3AEVA 1Q46A 4IPCA 3CMAA 1O7IA 2ZM6Q 2YU9H 2JA8H 2R7DA 5EAYA 1I94L 2UU9L 5E7NA 1EIYB 3CMEA 4JI4L 1X6OA 1YJWA 3S15H 3UDXA 5IP7H 2CCZA 2OQKA 4DV5L 2B29A 1PH6A 1JE5A 1PV4A 4BA2I 2OCEA 4DR2L 1TWGH 1NMFA 1Q1BA 2PMZE 4O0AA 3RLFA 3HKZG 1Q82C 4LUVA 3OW2A 4B3RL 3RN5A 5IY0A 2WB1G 4LUOA 4DR5L 4DKAC 3FP9A 3U4VA 2NZOA 5C4JH 5AJ3L 3PO2H 1PH5A 2UXCQ 1Q81C 4OO1G 4DV3Q 2BH2A 1A63A 2BA1A 2JQOA 3I4OA 1PYBA 1V1QA 1J5EL 1S3OA 2JA5G 2OQ0A 2CWAA 4X66Q 1A62A 1JJCB 1VQFA 1B70B 3L2PA 2HQLA 1CKNB 2JJQA 3KDFA 3PGZA 1UEBA 4A75A 1VQJA 3D0FA 1HJPA 5C0XI 4X6AH 4GN5A 5C44H 1PYSB 1PA6A 4HJ8A 2NN6G 3CCJA 4A3MH 4RG1A 1VQ8A 4HJ5A 2K50A 2I5HA 1EQQA 2E2JH 2OTJA 3BU2A 3I4MH 4JI1Q 1LUZA 3KOJA 4QGUA 2YYZA 4B3SL 1G51A 3S1QH 3GD7A 4APVA 3U58A 1V43A 4LF8L 3M4PA 2Q2TA 3HOXG 5IYDH 2NVYH 3I7FA 3L0OA 3MEFA 1X56A 1YEZA 2EQSA 1K8AC 1TWHH 4DR4L 4KHPQ 3K7UC 4TQUS 1XPOA 3HOUG 3G6EA 1SE8A 2UUCL 1UE6A 2PQAB 3RNUA 3U50C 3G4SA 4AYBE 1PH4A 3GDEA 1E22A 3K7AH 4YY3L 2MO0A 3UDGA 4BY7G 2AWOA 4DPGA 5IYBG 4DV4L 1PH1A 1IBML 1I3QH 2E2IH 1VQDA 2ZTDA 4P72A 3BZKA 3AFPA 1PHJA 3ULLA 2UUBQ 5FLMG 4PZ8A 1JJ2A 1I50H 4YY3Q 1Y1VH 4LFBQ 2VL6A 3CXCA 3KF6B 1HNZQ 1VQCA 3HOYG 3PIPA 4YWLA 2YTXA 5GQOA 1YHAA 4P71A 4C3HH 1M1KC 2RHQB 4UP7A 1Z9FA 4UPAA 1NJIC 4HJ7A 1D7QA 5FLXc 3EN2A 1HNXQ 5FLMH 3PO3G 4X64Q 3ULPA 4JOIA 1UE7A 3JC66 4A3LG 2GVAA 5LMUL 4DUZQ 4OWXB 4JBJA 1N36Q 4YCWA 3RZOH 4UP9A 2YV5A 4GNXB 1GM5A 3ERSX 4DUYL 2E5LL 3HKZE 2MNAA 1CKOA 3HOZG 1YNXA 4AH6A 1VQGA 3A5UA 4JBMA 4JI6L 1XNRL 1YJ9A 2ES2A 1PH8A 1G6PA 4JBKA 4WJ3M 4NXML 2IT1A 2PI2A 3I4NG 3S2DH 2JA6G 1KXLA 1SN8A 5LMNQ 1WCMH 1L0WA 5BR8Q 2CWPA 2XGTA 1GVPA 3H0GG 4JI2Q 4HIMA 1XNQL 2HT1A 4BBRG 3KJOA 3H3VI 2CQOA 2Y0SG 1BKBA 1QUQA 3HOZH 1GKHA 4X65L 2JA7H 3KFUA 1E1OA 1Q1EA 3E9IA 3RLOA 1C7YA 1H95A 2KCTA 1VQ5A 4JYAQ 2C35B 1FJGQ 2CFMA 1AE3A 2UXDL 2PQAA 4R4OA 1HR0L 2BH8A 4P73A 4DV6Q 3GTLH 3CCMA 4JOIC 1NBWA 5ELOA 2JE6I 3TQYA 3T1HQ 2E8GA 5M5WH 4L5QA 3S24A 3BZCA 1N32Q 4YHHQ 4DR3Q 3HOVH 2IHFA 4LUZA 1XPUA 1CSQA 4JI3Q 3A5ZB 3I2ZA 3CC2A 1KQSA 2R93G 1FGUA 5IWAQ 1OXSC 1E1TA 1X54A 2EIFA 4IOAA 4JV5Q 4K0KL 4DR1L 4LWCA 4LFCQ 4LF4Q 4OO1I 2KHJA 2I5LX 4R1JA 3UE1A 2NVTH 1YJNA 4JI7Q 1OXTA 2R7FA 3H3VH 2LXJA 4IJLA 4X62L 3S1NH 5C3EG 1B8AA 2DUDA 2LSSA 3UE0A 3CCQA 1I94Q 1X3GA 1KC8C 3STBC 4C3JH 3GTJH 4A3FG 1IBKL 1K83H 2VQEL 1XMOL 4JI4Q 4B3TL 1OTCA 2NN6I 3D31A 4DV5Q 4C2MH 3CD6A 1EQRA 2VZAA 5JJIA 2Z0SA 4DR2Q 4C3IH 4OONA 4B3RQ 5M5YH 4DR5Q 2UUAL 2ASBA 2PNHA 3F2BA 3RZDH 1XTDA 4MZ9A 5AJ3Q 1BBUA 4A3BG 4IPDA 4OWWB 4NXNL 4JC0A 3UDIA 3OTOL 1J5EQ 4BXXG 4A93G 1ASZA 1VS0A 1WJJA 3F8TA 2A1AA 4XTCS 5GAHC 1VQIA 4GOPB 1VQOA 2F4VL 1VQBA 1WOCA 5M3MG 2WAQG 1TXYA 1YHQA 2VNUD 1X3EA 4TVAB 2ZJPA 4DV2L 3PIOA 3AQQA 2KBNA 3PV0A 2JA5H 3S17H 2MQHA 1HH2P 5M5XH 3F2CA 1RL2A 2AMCB 4YCVA 3JAMi 4A3DG 2IX1A 3PUZA 2AKWB 5IYCG 4GKKL 1RIPA 4JI8L 5M3MH 3CQZH 4B3SQ 4DR6Q 2VW9A 4O2DA 4GNXC 4A3EG 3H15A 4LF8Q 4DV1L 1LTLA 1TWCH 1PVOA 3GTKH 3CCSA 4DR4Q 1VQHA 4A3DH 3CW2C 2Y0SE 1K9MC 1VQPA 3M9BA 3HOXH 1QZGA 3RLNA 4A3KG 4JI0L 3TEHB 4IO9A 1Q7YC 1E7ZA 2ID0A 3S1RH 5LMNW 4DV7L 5IP9G 2UUCQ 1X3FA 3CC4A 4LF7L 3HOUH 1IBLL 1M90C 3NENA 4HIDA 4FDBA 1L1OB 4L5TA 3T1YL 2R92G 1K73C 4DV4Q 1NTGA 1IBMQ 3A0JA 3CPFA 2H5XA 2JK8A 3CP0A 4A3CG 3PCOB 2A8VA 4A3KH 1VQ9A 1MIUA 2KCMA 4BY7H 4LF9L 2D0PA 5IYBH 2HHHL 4DR7L 1I6HH 2K14A 4A3JG 4L5RC 1YZ6A 1SMXA 4GS3A 2IHEA 4QL5A 1PH9A 3PUYA 3AFQA 3UDFA 2PI2E 1CKNA 1KD1C 2R92H 1OXUA 2UXBL 4BY1G 2YTVA 2Q2IA 4EX5A 3WWVA 2EXDA 5GAGC 3G48A 3HOYH 2WFWA 3OYYA 2K5NA 3W1BA 3IRBA 4OXPA 3S1MH 3J80i 1YIJA 5H1SE 5LMUQ 2JEAI 4GKJL 4A3JH 3HFZB 3EBEA 3PF5A 3GTPH 1AH9A 2RHSB 2WB1E 4JI5L 4DV0L 1X55A 4KI0A 1Y14B 2ATWA 3PO3H 4A3GG 1VQLA 2LXKA 2VS1A 1GO3E 3FKIG 3M4QA 4IPHA 4P74A 2BA0A 3TREA 1VQKA 4A3LH 1D8LA 1L2FA 1K3RA 1UE5A 4DUYQ 1EFWA 1W2BA 2E5LQ 2NVXH 4LFAL 3W1GA 1N33L 4KLKA 1VQ4A 4JI6Q 1IXRA 1XNRQ 2JA9A 4KHZA 3HOWG 4YCUA 3J81i 1PH3A 4NXMQ 1WFQA 3PUWA 2QGQA 2D62A 3I55A 1XMQL 1B7YB 1YBYA 1HZAA 4A3GH 3STBD 1XNQQ 4OWTB 3CF5A 1BVSA 3I4NH 2VQFL 1IZ6A 2FXQA 2JA6H 2DGYA 3GTQH 3JAMc 1VQAA 2WAQE 3H0GH 4UP8A 1N34L 1C0AA 4X65Q 1EWIA 4BBRH 1YI2A 1YITA 4DAMA 1PH7A 3RR5A 3CCEA 4LF5L 1FVIA 2IX0A 3DM3A 4MNOA 2B63G 2UXDQ 4NPSA 2F3IA 1X9NA 1SFOH 1HR0Q 4POGA 4DK6C 1JT8A 1L1OA 1HZBA 4HIOA 1NE3A 2R7ZG 5M3FG 1N8RC 1J6QA 2JEBI 3KF6A 4AYBG 4AIMA 3PSIA 3CCLA 3CC7A 3HKSA 4OX9L 1T9HA 3FHWA 1HZ9A 4AQYL 3TS0A 1CSPA 3U4ZA 2A19A 5FJ8G 4DR6L 4BBSG 3PUXA 2QEXA 4DR1Q 4K0KQ 2OTLA 2JA8G 4QJFA 1AE2A 3EIVA 4A76A 4IFDG 4B3ML 3S16H 2Z6KA 2R93H 4LF6L 4Y7NH 1W3SA 3K81C 1HNWL 1QVGA 2B3GA 5IP7G 1OXXK 2ZM6L 2YTYA 4X62Q 2ZJQA 4RMFA 3AYHB 1PFSA 3K80C 3NBHB 4GNXA 3L7ZC 1IBKQ 2K4KA 4GN3B 2VQEQ 1XMOQ 3GTMH 4B3TQ 2N49A 4BBSH 3CCRA 5HY6A 1WI5A 3NELA 4GLAC 3A74A 5C3EH 1S40A 1JMCA 3J7A5 1KL9A 2K75A 4DNIA 4A3FH 3PO2G 4JBWA 3M85A 4WJ4A 1VQEA 4QQBX 4ME3A 5J3BA 1BBWA 4JCVE 1L1OC 2UUAQ 1A0IA 1S72A 2UXCL 4DV3L 1FL0A 3ICEA 1EYGA 4GLVB 4NXNQ 3J80c 1KAWA 4MTNA 3OTOQ 5C44G 1ASYA 4X66L 2K5HA 3S2HH 4A3BH 4LW1A 2F4VQ 1EIFA 1HZCA 4A3MG 1Y1WG 1MKHA 1KHIA 2Z6KC 3CCVA 4A93H 4BXXH 3NEMA 4DV2Q 1KIXA 1Q86C 1NMGA 3I4MG 1VQ6A 4R4TA 3J81c 2N3SA 1QVFA 3J7ZC 1QVCA 4HJ9A 1E24A 2R6GA 3SGIA 5IYDG 3I56A 4HIKA 2ZTEA 4YWMA 4JI1L 4KHPL 4GKKQ 4JI8Q 5IT9c 1LM0A 1Y1WH 5JEAG 1K8GA 3S14H 1PH2A 3E0EA 1OXVA 4DV1Q 4IOCA 5IYCH 1CUKA 3MXNB 4LNQA 3GTOH 5K36G 5JJKA 4A3EH 2MFIA 3M3YH 1X65A 2KENA 1JJGA 2QA4A 1UWVA 3B6YA 5C0XG 2RCNA 4JI0Q 4DAYB 1XJVA 4IFDJ 1QUQB 1MJEA 4DV7Q 4LF7Q 2ZTCA 3GO5A 2D0OA 5IE8A 3BJUA 2HIVA 1QZHA 1IBLQ 2N78A 1IYJB 1G291 1P16A 1U0LA 1Y1VG 3T1YQ 1V9PA 5C4XG 3GTGH 1A8VA 5IP9H 4PG3A 1TWFH 4PZ7A 2Q2UA 2UUBL 2F52A 2UU9Q 4A3IG 4EQ5A 1SR3A 4J15A 4QY7A 2KHIA 4LFBL 1LYLA 3KF8B 4LF9Q 2N8NA 4H02A 4ALPA 1VQ7A 2VY3A 1HR0W 2HHHQ 1YVCA 4POFA 1HNZL 2VUMG 4DR7Q 4A3CH 3G71A 3W5OA 3CAMA 4JG2A 4GOPA 4BA1I 1XPRA 1NY4A 1TWAH 5GAEC 5C4XH 3PF4A 3K8AA 2UXBQ 1HNXL 3KYHC 1WYDA 3F1ZA 3M4OH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 L;  4NB3 A;  5ELN A;  4A3I H;  2AHO B;  1Q8K A;  4PZ6 A;  4A4I A;  1I5F A;  2GN5 A;  3ER0 A;  4IPG A;  1CKM A;  3VDY A;  2WP8 J;  3TS2 A;  4DUZ L;  3M7N A;  1JB7 A;  2VUM H;  4BY1 H;  4GKJ Q;  1SRO A;  1N36 L;  3KJP A;  1R9T H;  2HIX A;  4DV0 Q;  4JI5 Q;  5GAD C;  2AWN A;  2I5M X;  2XTI A;  5DLQ E;  4L5S A;  1VQN A;  2K52 A;  1GD7 A;  4IJH A;  3TRZ A;  4LFA Q;  1Q12 A;  4DK3 C;  1WCM G;  4HJA A;  1N33 Q;  1K0R A;  2Q2H A;  4R4Q A;  3FKI H;  4GN4 B;  2L15 A;  3ZJY C;  1EUJ A;  1KRT A;  5LMN L;  2IY5 B;  5BR8 L;  2ALY B;  4JI2 L;  3RN2 A;  1XMQ Q;  2JA7 G;  1C9O A;  3F2D A;  2RF4 A;  5JEA J;  4R4C A;  3HOW H;  3J81 j;  1DGS A;  3LGJ A;  2VQF Q;  4IFD I;  3KDF B;  4QIW E;  3Q8D A;  1N34 Q;  4GOP C;  1P8L A;  1E3P A;  4JYA L;  4LF5 Q;  2V1C C;  1FJG L;  1UE1 A;  5HGQ A;  1N9W A;  4Y52 H;  2K5V A;  3CPW A;  3ULJ A;  3DLL A;  4DV6 L;  3HOV G;  1U5K A;  5C0X J;  4XIG S;  4UY8 C;  1EOV A;  3K0X A;  4PMW A;  3T1H L;  3E9H A;  2B63 H;  2E2H H;  1N32 L;  4YHH L;  4DR3 L;  4JI3 L;  5JJL A;  2I0Q A;  5IWA L;  1IL2 A;  4R4I A;  1YHB A;  4OX9 Q;  2CKZ B;  2NZH A;  2R7Z H;  4JV5 L;  5M3F H;  1KRS A;  3CCU A;  2MO1 A;  2ZJR A;  4GLX A;  4AQY Q;  2OWO A;  1VQM A;  1Z47 A;  1SRU A;  5GRO A;  4P75 A;  4LFC L;  2NVQ H;  4LF4 L;  4YWK A;  3KLW A;  1MJC A;  1VCI A;  4B3M Q;  4LF6 Q;  3PUV A;  2GVB A;  4JI7 L;  5FJ8 H;  1SLJ A;  1HNW Q;  3AEV A;  1Q46 A;  4IPC A;  3CMA A;  1O7I A;  2ZM6 Q;  2YU9 H;  2JA8 H;  2R7D A;  5EAY A;  1I94 L;  2UU9 L;  5E7N A;  1EIY B;  3CME A;  4JI4 L;  1X6O A;  1YJW A;  3S15 H;  3UDX A;  5IP7 H;  2CCZ A;  2OQK A;  4DV5 L;  2B29 A;  1PH6 A;  1JE5 A;  1PV4 A;  4BA2 I;  2OCE A;  4DR2 L;  1TWG H;  1NMF A;  1Q1B A;  2PMZ E;  4O0A A;  3RLF A;  3HKZ G;  1Q82 C;  4LUV A;  3OW2 A;  4B3R L;  3RN5 A;  5IY0 A;  2WB1 G;  4LUO A;  4DR5 L;  4DKA C;  3FP9 A;  3U4V A;  2NZO A;  5C4J H;  5AJ3 L;  3PO2 H;  1PH5 A;  2UXC Q;  1Q81 C;  4OO1 G;  4DV3 Q;  2BH2 A;  1A63 A;  2BA1 A;  2JQO A;  3I4O A;  1PYB A;  1V1Q A;  1J5E L;  1S3O A;  2JA5 G;  2OQ0 A;  2CWA A;  4X66 Q;  1A62 A;  1JJC B;  1VQF A;  1B70 B;  3L2P A;  2HQL A;  1CKN B;  2JJQ A;  3KDF A;  3PGZ A;  1UEB A;  4A75 A;  1VQJ A;  3D0F A;  1HJP A;  5C0X I;  4X6A H;  4GN5 A;  5C44 H;  1PYS B;  1PA6 A;  4HJ8 A;  2NN6 G;  3CCJ A;  4A3M H;  4RG1 A;  1VQ8 A;  4HJ5 A;  2K50 A;  2I5H A;  1EQQ A;  2E2J H;  2OTJ A;  3BU2 A;  3I4M H;  4JI1 Q;  1LUZ A;  3KOJ A;  4QGU A;  2YYZ A;  4B3S L;  1G51 A;  3S1Q H;  3GD7 A;  4APV A;  3U58 A;  1V43 A;  4LF8 L;  3M4P A;  2Q2T A;  3HOX G;  5IYD H;  2NVY H;  3I7F A;  3L0O A;  3MEF A;  1X56 A;  1YEZ A;  2EQS A;  1K8A C;  1TWH H;  4DR4 L;  4KHP Q;  3K7U C;  4TQU S;  1XPO A;  3HOU G;  3G6E A;  1SE8 A;  2UUC L;  1UE6 A;  2PQA B;  3RNU A;  3U50 C;  3G4S A;  4AYB E;  1PH4 A;  3GDE A;  1E22 A;  3K7A H;  4YY3 L;  2MO0 A;  3UDG A;  4BY7 G;  2AWO A;  4DPG A;  5IYB G;  4DV4 L;  1PH1 A;  1IBM L;  1I3Q H;  2E2I H;  1VQD A;  2ZTD A;  4P72 A;  3BZK A;  3AFP A;  1PHJ A;  3ULL A;  2UUB Q;  5FLM G;  4PZ8 A;  1JJ2 A;  1I50 H;  4YY3 Q;  1Y1V H;  4LFB Q;  2VL6 A;  3CXC A;  3KF6 B;  1HNZ Q;  1VQC A;  3HOY G;  3PIP A;  4YWL A;  2YTX A;  5GQO A;  1YHA A;  4P71 A;  4C3H H;  1M1K C;  2RHQ B;  4UP7 A;  1Z9F A;  4UPA A;  1NJI C;  4HJ7 A;  1D7Q A;  5FLX c;  3EN2 A;  1HNX Q;  5FLM H;  3PO3 G;  4X64 Q;  3ULP A;  4JOI A;  1UE7 A;  3JC6 6;  4A3L G;  2GVA A;  5LMU L;  4DUZ Q;  4OWX B;  4JBJ A;  1N36 Q;  4YCW A;  3RZO H;  4UP9 A;  2YV5 A;  4GNX B;  1GM5 A;  3ERS X;  4DUY L;  2E5L L;  3HKZ E;  2MNA A;  1CKO A;  3HOZ G;  1YNX A;  4AH6 A;  1VQG A;  3A5U A;  4JBM A;  4JI6 L;  1XNR L;  1YJ9 A;  2ES2 A;  1PH8 A;  1G6P A;  4JBK A;  4WJ3 M;  4NXM L;  2IT1 A;  2PI2 A;  3I4N G;  3S2D H;  2JA6 G;  1KXL A;  1SN8 A;  5LMN Q;  1WCM H;  1L0W A;  5BR8 Q;  2CWP A;  2XGT A;  1GVP A;  3H0G G;  4JI2 Q;  4HIM A;  1XNQ L;  2HT1 A;  4BBR G;  3KJO A;  3H3V I;  2CQO A;  2Y0S G;  1BKB A;  1QUQ A;  3HOZ H;  1GKH A;  4X65 L;  2JA7 H;  3KFU A;  1E1O A;  1Q1E A;  3E9I A;  3RLO A;  1C7Y A;  1H95 A;  2KCT A;  1VQ5 A;  4JYA Q;  2C35 B;  1FJG Q;  2CFM A;  1AE3 A;  2UXD L;  2PQA A;  4R4O A;  1HR0 L;  2BH8 A;  4P73 A;  4DV6 Q;  3GTL H;  3CCM A;  4JOI C;  1NBW A;  5ELO A;  2JE6 I;  3TQY A;  3T1H Q;  2E8G A;  5M5W H;  4L5Q A;  3S24 A;  3BZC A;  1N32 Q;  4YHH Q;  4DR3 Q;  3HOV H;  2IHF A;  4LUZ A;  1XPU A;  1CSQ A;  4JI3 Q;  3A5Z B;  3I2Z A;  3CC2 A;  1KQS A;  2R93 G;  1FGU A;  5IWA Q;  1OXS C;  1E1T A;  1X54 A;  2EIF A;  4IOA A;  4JV5 Q;  4K0K L;  4DR1 L;  4LWC A;  4LFC Q;  4LF4 Q;  4OO1 I;  2KHJ A;  2I5L X;  4R1J A;  3UE1 A;  2NVT H;  1YJN A;  4JI7 Q;  1OXT A;  2R7F A;  3H3V H;  2LXJ A;  4IJL A;  4X62 L;  3S1N H;  5C3E G;  1B8A A;  2DUD A;  2LSS A;  3UE0 A;  3CCQ A;  1I94 Q;  1X3G A;  1KC8 C;  3STB C;  4C3J H;  3GTJ H;  4A3F G;  1IBK L;  1K83 H;  2VQE L;  1XMO L;  4JI4 Q;  4B3T L;  1OTC A;  2NN6 I;  3D31 A;  4DV5 Q;  4C2M H;  3CD6 A;  1EQR A;  2VZA A;  5JJI A;  2Z0S A;  4DR2 Q;  4C3I H;  4OON A;  4B3R Q;  5M5Y H;  4DR5 Q;  2UUA L;  2ASB A;  2PNH A;  3F2B A;  3RZD H;  1XTD A;  4MZ9 A;  5AJ3 Q;  1BBU A;  4A3B G;  4IPD A;  4OWW B;  4NXN L;  4JC0 A;  3UDI A;  3OTO L;  1J5E Q;  4BXX G;  4A93 G;  1ASZ A;  1VS0 A;  1WJJ A;  3F8T A;  2A1A A;  4XTC S;  5GAH C;  1VQI A;  4GOP B;  1VQO A;  2F4V L;  1VQB A;  1WOC A;  5M3M G;  2WAQ G;  1TXY A;  1YHQ A;  2VNU D;  1X3E A;  4TVA B;  2ZJP A;  4DV2 L;  3PIO A;  3AQQ A;  2KBN A;  3PV0 A;  2JA5 H;  3S17 H;  2MQH A;  1HH2 P;  5M5X H;  3F2C A;  1RL2 A;  2AMC B;  4YCV A;  3JAM i;  4A3D G;  2IX1 A;  3PUZ A;  2AKW B;  5IYC G;  4GKK L;  1RIP A;  4JI8 L;  5M3M H;  3CQZ H;  4B3S Q;  4DR6 Q;  2VW9 A;  4O2D A;  4GNX C;  4A3E G;  3H15 A;  4LF8 Q;  4DV1 L;  1LTL A;  1TWC H;  1PVO A;  3GTK H;  3CCS A;  4DR4 Q;  1VQH A;  4A3D H;  3CW2 C;  2Y0S E;  1K9M C;  1VQP A;  3M9B A;  3HOX H;  1QZG A;  3RLN A;  4A3K G;  4JI0 L;  3TEH B;  4IO9 A;  1Q7Y C;  1E7Z A;  2ID0 A;  3S1R H;  5LMN W;  4DV7 L;  5IP9 G;  2UUC Q;  1X3F A;  3CC4 A;  4LF7 L;  3HOU H;  1IBL L;  1M90 C;  3NEN A;  4HID A;  4FDB A;  1L1O B;  4L5T A;  3T1Y L;  2R92 G;  1K73 C;  4DV4 Q;  1NTG A;  1IBM Q;  3A0J A;  3CPF A;  2H5X A;  2JK8 A;  3CP0 A;  4A3C G;  3PCO B;  2A8V A;  4A3K H;  1VQ9 A;  1MIU A;  2KCM A;  4BY7 H;  4LF9 L;  2D0P A;  5IYB H;  2HHH L;  4DR7 L;  1I6H H;  2K14 A;  4A3J G;  4L5R C;  1YZ6 A;  1SMX A;  4GS3 A;  2IHE A;  4QL5 A;  1PH9 A;  3PUY A;  3AFQ A;  3UDF A;  2PI2 E;  1CKN A;  1KD1 C;  2R92 H;  1OXU A;  2UXB L;  4BY1 G;  2YTV A;  2Q2I A;  4EX5 A;  3WWV A;  2EXD A;  5GAG C;  3G48 A;  3HOY H;  2WFW A;  3OYY A;  2K5N A;  3W1B A;  3IRB A;  4OXP A;  3S1M H;  3J80 i;  1YIJ A;  5H1S E;  5LMU Q;  2JEA I;  4GKJ L;  4A3J H;  3HFZ B;  3EBE A;  3PF5 A;  3GTP H;  1AH9 A;  2RHS B;  2WB1 E;  4JI5 L;  4DV0 L;  1X55 A;  4KI0 A;  1Y14 B;  2ATW A;  3PO3 H;  4A3G G;  1VQL A;  2LXK A;  2VS1 A;  1GO3 E;  3FKI G;  3M4Q A;  4IPH A;  4P74 A;  2BA0 A;  3TRE A;  1VQK A;  4A3L H;  1D8L A;  1L2F A;  1K3R A;  1UE5 A;  4DUY Q;  1EFW A;  1W2B A;  2E5L Q;  2NVX H;  4LFA L;  3W1G A;  1N33 L;  4KLK A;  1VQ4 A;  4JI6 Q;  1IXR A;  1XNR Q;  2JA9 A;  4KHZ A;  3HOW G;  4YCU A;  3J81 i;  1PH3 A;  4NXM Q;  1WFQ A;  3PUW A;  2QGQ A;  2D62 A;  3I55 A;  1XMQ L;  1B7Y B;  1YBY A;  1HZA A;  4A3G H;  3STB D;  1XNQ Q;  4OWT B;  3CF5 A;  1BVS A;  3I4N H;  2VQF L;  1IZ6 A;  2FXQ A;  2JA6 H;  2DGY A;  3GTQ H;  3JAM c;  1VQA A;  2WAQ E;  3H0G H;  4UP8 A;  1N34 L;  1C0A A;  4X65 Q;  1EWI A;  4BBR H;  1YI2 A;  1YIT A;  4DAM A;  1PH7 A;  3RR5 A;  3CCE A;  4LF5 L;  1FVI A;  2IX0 A;  3DM3 A;  4MNO A;  2B63 G;  2UXD Q;  4NPS A;  2F3I A;  1X9N A;  1SFO H;  1HR0 Q;  4POG A;  4DK6 C;  1JT8 A;  1L1O A;  1HZB A;  4HIO A;  1NE3 A;  2R7Z G;  5M3F G;  1N8R C;  1J6Q A;  2JEB I;  3KF6 A;  4AYB G;  4AIM A;  3PSI A;  3CCL A;  3CC7 A;  3HKS A;  4OX9 L;  1T9H A;  3FHW A;  1HZ9 A;  4AQY L;  3TS0 A;  1CSP A;  3U4Z A;  2A19 A;  5FJ8 G;  4DR6 L;  4BBS G;  3PUX A;  2QEX A;  4DR1 Q;  4K0K Q;  2OTL A;  2JA8 G;  4QJF A;  1AE2 A;  3EIV A;  4A76 A;  4IFD G;  4B3M L;  3S16 H;  2Z6K A;  2R93 H;  4LF6 L;  4Y7N H;  1W3S A;  3K81 C;  1HNW L;  1QVG A;  2B3G A;  5IP7 G;  1OXX K;  2ZM6 L;  2YTY A;  4X62 Q;  2ZJQ A;  4RMF A;  3AYH B;  1PFS A;  3K80 C;  3NBH B;  4GNX A;  3L7Z C;  1IBK Q;  2K4K A;  4GN3 B;  2VQE Q;  1XMO Q;  3GTM H;  4B3T Q;  2N49 A;  4BBS H;  3CCR A;  5HY6 A;  1WI5 A;  3NEL A;  4GLA C;  3A74 A;  5C3E H;  1S40 A;  1JMC A;  3J7A 5;  1KL9 A;  2K75 A;  4DNI A;  4A3F H;  3PO2 G;  4JBW A;  3M85 A;  4WJ4 A;  1VQE A;  4QQB X;  4ME3 A;  5J3B A;  1BBW A;  4JCV E;  1L1O C;  2UUA Q;  1A0I A;  1S72 A;  2UXC L;  4DV3 L;  1FL0 A;  3ICE A;  1EYG A;  4GLV B;  4NXN Q;  3J80 c;  1KAW A;  4MTN A;  3OTO Q;  5C44 G;  1ASY A;  4X66 L;  2K5H A;  3S2H H;  4A3B H;  4LW1 A;  2F4V Q;  1EIF A;  1HZC A;  4A3M G;  1Y1W G;  1MKH A;  1KHI A;  2Z6K C;  3CCV A;  4A93 H;  4BXX H;  3NEM A;  4DV2 Q;  1KIX A;  1Q86 C;  1NMG A;  3I4M G;  1VQ6 A;  4R4T A;  3J81 c;  2N3S A;  1QVF A;  3J7Z C;  1QVC A;  4HJ9 A;  1E24 A;  2R6G A;  3SGI A;  5IYD G;  3I56 A;  4HIK A;  2ZTE A;  4YWM A;  4JI1 L;  4KHP L;  4GKK Q;  4JI8 Q;  5IT9 c;  1LM0 A;  1Y1W H;  5JEA G;  1K8G A;  3S14 H;  1PH2 A;  3E0E A;  1OXV A;  4DV1 Q;  4IOC A;  5IYC H;  1CUK A;  3MXN B;  4LNQ A;  3GTO H;  5K36 G;  5JJK A;  4A3E H;  2MFI A;  3M3Y H;  1X65 A;  2KEN A;  1JJG A;  2QA4 A;  1UWV A;  3B6Y A;  5C0X G;  2RCN A;  4JI0 Q;  4DAY B;  1XJV A;  4IFD J;  1QUQ B;  1MJE A;  4DV7 Q;  4LF7 Q;  2ZTC A;  3GO5 A;  2D0O A;  5IE8 A;  3BJU A;  2HIV A;  1QZH A;  1IBL Q;  2N78 A;  1IYJ B;  1G29 1;  1P16 A;  1U0L A;  1Y1V G;  3T1Y Q;  1V9P A;  5C4X G;  3GTG H;  1A8V A;  5IP9 H;  4PG3 A;  1TWF H;  4PZ7 A;  2Q2U A;  2UUB L;  2F52 A;  2UU9 Q;  4A3I G;  4EQ5 A;  1SR3 A;  4J15 A;  4QY7 A;  2KHI A;  4LFB L;  1LYL A;  3KF8 B;  4LF9 Q;  2N8N A;  4H02 A;  4ALP A;  1VQ7 A;  2VY3 A;  1HR0 W;  2HHH Q;  1YVC A;  4POF A;  1HNZ L;  2VUM G;  4DR7 Q;  4A3C H;  3G71 A;  3W5O A;  3CAM A;  4JG2 A;  4GOP A;  4BA1 I;  1XPR A;  1NY4 A;  1TWA H;  5GAE C;  5C4X H;  3PF4 A;  3K8A A;  2UXB Q;  1HNX L;  3KYH C;  1WYD A;  3F1Z A;  3M4O H; 
#chains in the Genus database with same CATH topology
 4PZ6 A;  1H9J A;  3GTK B;  1N36 L;  4A3D B;  4L63 B;  1R9T H;  2HIX A;  5GAD C;  2I5M X;  2IW3 A;  3HOX B;  1VF7 A;  5JVH 3;  1Q12 A;  2RKS A;  4RGM A;  3K59 A;  4HJA A;  3C3L A;  1N33 Q;  5K36 H;  1C8C A;  2IY5 B;  5BR8 L;  2ALY B;  3RN2 A;  5C3W A;  3F2D A;  2PW5 A;  2RF4 A;  2Q8T A;  3VR4 A;  1G2T A;  4R4C A;  2DNE A;  3J81 j;  1DGS A;  3C1F A;  4QIW E;  1N34 Q;  4GOP C;  1Z6H A;  3GTG B;  1MBY A;  1FJG L;  1UE1 A;  4I65 A;  1N9W A;  4Y52 H;  3CPW A;  3MXP A;  1U5K A;  4XIG S;  5IGF A;  3NWT A;  3K0X A;  3ITP A;  1DCZ A;  5CBA E;  4NP5 A;  3HS0 C;  2B63 H;  2E2H H;  3BG3 A;  1N32 L;  4YHH L;  1KDB A;  2EY5 A;  1BF4 A;  2LS0 1;  4LAA A;  4DK1 A;  1IL2 A;  3M4O B;  2R7Z H;  5M3F H;  4GLX A;  4RGN A;  5KYI A;  4LFC L;  5GRO A;  3NTH A;  4YWK A;  3KLW A;  4F8M A;  2B2U A;  1R9T B;  5COY A;  4HCE A;  1Q46 A;  1O7I A;  2YU9 H;  3P1H A;  4IFD H;  2HD3 A;  5E7N A;  4F87 A;  3UDX A;  1JR0 D;  4PV1 C;  3SK8 A;  5IP7 H;  2CCZ A;  1HFN A;  1PV4 A;  5EPL A;  4BA2 I;  2F1M A;  1Q1B A;  2PMZ E;  2QEJ C;  1LV9 A;  3RLF A;  3UI2 A;  5ELF A;  3OW2 A;  5IY0 A;  3IAY A;  2WB1 G;  4DR5 L;  1EYC A;  4LK1 C;  4RGO S;  4OO1 G;  2DJG C;  5BN4 A;  1A63 A;  2JQO A;  2M00 A;  1EYA A;  2NTS A;  2HQL A;  1CKN B;  2JJQ A;  5IOD A;  1VQJ A;  5C0X I;  1HJP A;  5C44 H;  1D1K A;  2RDF A;  1KNA A;  2NN6 G;  3BVZ A;  2F03 A;  2R7Z B;  5M3F B;  1VQ8 A;  1AFP A;  4HJ5 A;  4CJ1 B;  2ICE C;  3W2D A;  1JWS D;  3BU2 A;  3I4M H;  3S1Q H;  2ZXR A;  3GD7 A;  2WV6 D;  5CR3 A;  2IX3 A;  1SNO A;  2E74 C;  2YU9 B;  2DJF C;  4DR4 L;  2NWG A;  2WAC A;  3K7U C;  4JW0 A;  2P5Z X;  1S5F D;  4ILW A;  1LTS D;  3SK4 A;  5I2Y A;  2PQA B;  4OIJ A;  1PH4 A;  4ZLT F;  4BY7 G;  2AWO A;  4DPG A;  1STH A;  1H9R A;  1PXU A;  2UUB Q;  1I50 H;  4LFB Q;  2VL6 A;  1SYE A;  3HOY G;  1I4P A;  5C44 B;  1TY2 A;  2YTX A;  3LWU A;  4HR7 B;  4P71 A;  1GUS A;  5GQO A;  2RHQ B;  1RCV D;  1PDQ A;  2IPK D;  3DXJ C;  4G4K A;  5FLX c;  3PO3 G;  1HTL D;  2ICI A;  5LMU L;  2Q8I B;  3I4M B;  4YCW A;  3GTO B;  1GJX A;  4A3E B;  2YV5 A;  2SNM A;  1WD1 A;  1LTB D;  2JP1 A;  2E5L L;  3KLS A;  2MNA A;  1C4Q A;  1YNX A;  4AH6 A;  4JBM A;  2ES2 A;  3A55 A;  1SNM A;  1SNQ A;  5LMN Q;  3H0G G;  2XGT A;  3LWE A;  4JI2 Q;  1XNQ L;  2CQA A;  4KJO A;  1CZW A;  2Y0S G;  3HOZ H;  1GKH A;  1WTO A;  1E1O A;  3E9I A;  2QKI C;  1C7Y A;  2MHV A;  1VQ5 A;  1EY9 A;  2CFM A;  2JN4 A;  2UXD L;  2FJ2 A;  1HR0 L;  2A73 B;  2JE6 I;  3TP7 A;  3T1H Q;  2E8G A;  1TVX A;  2FMM A;  4DR3 Q;  1XPU A;  3A5Z B;  3I2Z A;  3KLR A;  1KQS A;  3P7J A;  2KEC A;  5AFW A;  4FF4 A;  2VUM B;  1SNC A;  2KVM A;  3A8J E;  4LWC A;  4LF4 Q;  2KHJ A;  2I5L X;  4R1J A;  3ERO A;  3UE1 A;  2R7F A;  3H3V H;  5C3E G;  1B8A A;  2DUD A;  2LSS A;  3TDQ A;  1K3B C;  3UE0 A;  3CCQ A;  1GHJ A;  4ZKC B;  4JI4 Q;  3IL8 A;  5FK9 C;  1SEB D;  4A3F G;  4B3T L;  1EZ8 A;  1OTC A;  1NR2 A;  4DV5 Q;  2X6L A;  1VMP A;  1I4R A;  3A56 A;  2B2T C;  2UUA L;  2A6E C;  2AUK A;  3F2B A;  1BUV T;  4FF1 A;  1XTD A;  1BBU A;  4A3B G;  2EJF C;  2TSS A;  1IKM A;  3OTO L;  1QWY A;  1VS0 A;  1Y8N B;  2KOL A;  1VQI A;  1VQB A;  1EY0 A;  5EKK A;  4DV2 L;  4G7O C;  4R9W A;  3JAM i;  3I3C A;  2IX1 A;  3PUZ A;  3AMU A;  2O2L D;  1RKN A;  2NN6 H;  3K57 A;  5M3M H;  4DR6 Q;  2A74 C;  3H15 A;  4DV1 L;  1LTL A;  5A2Q L;  1PVO A;  1KDC A;  3OIP A;  1XYI A;  3VR3 A;  3CW2 C;  2EYP A;  3M9B A;  4WOR A;  4ZK9 B;  4A3K G;  4JI0 L;  1E0B A;  2UUC Q;  3CC4 A;  3PO2 B;  3J81 L;  4IUR A;  1IBL L;  3E0J A;  3FVQ A;  4HID A;  4FDB A;  5FOB B;  4HMI A;  3MXU A;  1NTG A;  4A3C G;  3CPF A;  2H5X A;  3CP0 A;  2F0U A;  2K01 A;  4BY7 H;  4LF9 L;  2HHH L;  4L5R C;  1IYU A;  2I46 A;  1EY5 A;  1PRT F;  4ZKB B;  2B2V A;  4HTH A;  2R92 H;  1CKN A;  1TKW B;  1F9R A;  3HOY H;  1J9O A;  3W1B A;  3S1M H;  3J80 i;  2K33 A;  4A3J H;  3HFZ B;  2ATW A;  1Y14 B;  2L4N A;  3PO3 H;  4A3G G;  2VS1 A;  1GO3 E;  4IPH A;  3M4Q A;  3TRE A;  2BA0 A;  2NUC A;  1D8L A;  1L2F A;  1UE5 A;  2NVX H;  4M8A A;  4EVO A;  3EJI A;  4RA8 A;  4JI6 Q;  1XNR Q;  1WTX A;  4UAI A;  5G3L F;  4C1N K;  2E2I B;  2A68 D;  1I3Q B;  2B39 A;  3VR5 A;  4G7H C;  2CHB D;  2WAQ E;  3H0G H;  1RF2 D;  3L3O C;  3CCE A;  1ESF A;  2F0G A;  4NPS A;  2F3I A;  1GXD C;  4BY7 B;  1DXM A;  1JT8 A;  4KN7 C;  4FXK C;  1WTV A;  4XT1 B;  1TR5 A;  2PZT A;  3NQT A;  2LMC B;  3KUP A;  3CC7 A;  2XNA C;  3HKS A;  1T9H A;  5C5L A;  3LX0 A;  3HOY B;  1HZ9 A;  3TS0 A;  3RZO B;  5EJW A;  5FJ8 G;  4BBS G;  2QEX A;  4DR1 Q;  2OTL A;  3NE5 B;  4QJF A;  3EIV A;  4A76 A;  4B9X A;  1LTG D;  1O78 A;  2A68 C;  3K81 C;  2B3G A;  1OXX K;  3S2D B;  2NVX B;  2L9H A;  3AYH B;  1YNJ D;  5M9O A;  2HQE A;  3BVM A;  3I4L A;  3EFX D;  3CCR A;  1EL0 A;  4MIU A;  3A74 A;  3D6C A;  5C3E H;  1S40 A;  3J7A 5;  2JA7 B;  1CI3 M;  4DNI A;  4A3F H;  1IL8 A;  1I4G A;  4CKE A;  4QQB X;  2FMC A;  2HCC A;  5J3B A;  3N52 A;  1A0I A;  2EDG A;  1D5M C;  4DV3 L;  1V1P A;  3ICE A;  4NXN Q;  1LT4 D;  2Y0S B;  1U4M A;  1ASY A;  3HOV B;  4A3B H;  2X69 A;  2J4X A;  1HZC A;  1ESR A;  4KKT A;  4A3M G;  4XXE A;  1Q8I A;  3NEM A;  4OIK A;  5C6A A;  4R4T A;  4KHV A;  3J81 c;  1AZP A;  2B8G A;  2N3S A;  3EQL C;  3A7L A;  2R6G A;  4JPB W;  3SGI A;  2Z1C A;  2ZTE A;  1WTP A;  1SBB B;  4KHP L;  4JI8 Q;  1Y1W H;  4R8I A;  3S14 H;  1PH2 A;  5CC4 A;  3NK9 A;  1AEX A;  4C2M B;  2F3W A;  3U9S A;  2F0P A;  4DK0 A;  2MFI A;  2DY7 A;  2WKC A;  2KEN A;  1ICF B;  2QA4 A;  3B6Y A;  5C3E B;  3RZD B;  2BDO A;  2F0E A;  4IUN A;  4DV7 Q;  3T4A C;  4A3F B;  4LF7 Q;  2NYZ D;  1HXY D;  2HIV A;  1A6X A;  1Y1V G;  3T1Y Q;  2Q2U A;  4U68 A;  2F52 A;  4DA2 A;  3QB3 A;  4J15 A;  2KHI A;  2JA5 B;  4C3H G;  4ABN A;  3E6Z X;  2VY3 A;  1HR0 W;  4A3C H;  1RD9 D;  4GZY C;  4K2K A;  2BE5 C;  2HCI A;  2UXB Q;  1WYD A;  1YNN D;  5EPJ A;  4X64 L;  1HQR D;  5IGE A;  1TII D;  1I5F A;  1K8O A;  1CKM A;  3VDY A;  4DUZ L;  4X3T A;  1JB7 A;  3M7N A;  1AW7 A;  1XXG A;  4DV0 Q;  3S14 B;  2PW7 A;  3I70 A;  2XTI A;  1PTO H;  4L5S A;  1ET9 A;  4K2L A;  1GD7 A;  4V0B A;  3TRZ A;  2DY8 A;  1WCM G;  2F0J A;  1EU4 A;  3S1R B;  2E75 C;  1B4O A;  4GN4 B;  2L15 A;  3ZJY C;  4KKU A;  1G91 A;  1EUJ A;  2B2Y A;  4A3K B;  3Q24 A;  2VQF Q;  4IFD I;  4FXG C;  2XWB B;  4LF5 Q;  2V1C C;  1WD0 A;  2K5V A;  1XWE A;  1LAC A;  3ULJ A;  3BDL A;  4UY8 C;  5EGT A;  3TP8 A;  4PMW A;  2VXW A;  4OGQ C;  1QB5 D;  5JJL A;  3QIA A;  4DAV A;  5CV4 A;  1X3Q A;  4OX9 Q;  2NZH A;  1U9R A;  2VB2 X;  3CCU A;  4AQY Q;  1DOM A;  2NVQ H;  1Z47 A;  2D5D A;  4DXF A;  4ID6 A;  4B3M Q;  2OF1 A;  5FJ8 H;  1BCP B;  1SLJ A;  5JVG 3;  2FFK B;  1HNW Q;  3H6M A;  1ZXT A;  4IPC A;  3I91 A;  2UU9 L;  5IGB A;  4TKO B;  3RD4 A;  4A3G B;  3S15 H;  3MXG A;  3I4N B;  2OQK A;  1JE5 A;  4DR2 L;  1NMF A;  4O0A A;  3HKZ G;  4KD4 A;  3T53 B;  1TS4 A;  5JAV A;  4LUO A;  2F0Q A;  3FPP A;  4TRD A;  4DKA C;  1CK1 A;  3FP9 A;  1SFO B;  1PRT C;  2EJG C;  5AJ3 L;  5BN5 A;  1DJR D;  3A8K E;  2BH2 A;  4RAU C;  4KY6 A;  1JB3 A;  1J5E L;  1PMR A;  2OQ0 A;  1GUT A;  2CWA A;  1E2Z A;  1A62 A;  3L2P A;  3PGZ A;  2L5T A;  2Z4I A;  4X6A H;  3RUZ A;  2AQ3 B;  3PIO 3;  4HJ8 A;  2ZXO A;  4X3S A;  4A3M H;  2AQ1 B;  2NVQ B;  4JI1 Q;  1QNU A;  4ULL A;  3D6W A;  3GTM B;  4BBS B;  1CZG A;  2Q2T A;  2BOS A;  4UDU C;  3MEF A;  1V1O A;  1X56 A;  1K8A C;  1F9S A;  1KLG D;  5E4X A;  5KGU A;  3S15 B;  3HOU G;  1CTM A;  3G6E A;  1VMC A;  2EYL A;  1CFM A;  1UE6 A;  5I6W A;  1JQY D;  3RNU A;  3CHB D;  3G4S A;  4AYB E;  2PYK A;  1S5B D;  3K7A H;  4IN3 A;  4L6T B;  2MO0 A;  3BYY B;  1PH1 A;  1IBM L;  2F0N A;  2ZTD A;  4P72 A;  4QUC A;  1PHJ A;  3ULL A;  4IQZ A;  2AQ2 B;  4CDD C;  4XYQ A;  3S9W A;  1JJ2 A;  3C1E A;  1MSH A;  1Y1V H;  3KF6 B;  4CKB A;  1JC7 A;  2FIN B;  1VQC A;  3PIP A;  1EIG A;  4C3H H;  1M1K C;  3J7A V;  1JWU D;  1K0S A;  1D7Q A;  1HNX Q;  4PQX A;  1B9N A;  5FLM H;  3U9O A;  4C1N I;  3J7Y W;  1UE7 A;  4ZUJ A;  2GVA A;  4J8Q A;  5J22 A;  1N36 Q;  2B2W A;  4GNX B;  1GM5 A;  2CVR A;  1STY A;  3HOZ G;  2VB3 X;  3NTK A;  1T5X D;  2RVL A;  5FLX L;  1YJ9 A;  1PH8 A;  4JBK A;  4NXM L;  2JA6 G;  1TT2 A;  1WCM H;  1L0W A;  5BR8 Q;  4PMC A;  4BBR G;  3KJO A;  3H3V I;  1JE4 A;  4K5V A;  2N88 A;  1WTR A;  5JPM C;  2GA4 B;  4X65 L;  1H95 A;  2KCT A;  4QMG A;  2C35 B;  1FJG Q;  2EYH A;  1AE3 A;  2EJM A;  1Y1V B;  1JCK B;  3GTL H;  3CCM A;  4JOI C;  4NKL A;  3TQY A;  3TBI B;  2LKV A;  4L5Q A;  5KNB A;  3BZC A;  1N32 Q;  4YHH Q;  1EQV A;  4LUZ A;  2R93 G;  1X54 A;  2F4I A;  2KJX A;  3R2I A;  4LFC Q;  5IGC A;  4OO1 I;  1Y8O B;  1KDA A;  1YJN A;  2EOT A;  2HDL A;  3STB C;  4C3J H;  1MGS A;  2NZ1 D;  1LTT D;  1FD7 D;  1K83 H;  4S3S A;  1XMO L;  5FO7 B;  1LTI D;  2NN6 I;  3D31 A;  1RJT A;  3CD6 A;  1WCM B;  5JJI A;  2Z0S A;  5IT9 E;  4OON A;  5M5Y H;  4OEM B;  4DR5 Q;  4KV6 A;  4MZ9 A;  1HUN A;  1HPC A;  4OWW B;  2B63 B;  4JC0 A;  4WRD A;  2E2H B;  4A93 G;  4BXX G;  2RCF A;  3AU7 A;  1WJJ A;  3F8T A;  2EYJ A;  1BBX C;  5GAH C;  1NSN S;  4GOP B;  1VQO A;  1WOC A;  1ML0 D;  5M3M G;  1YHQ A;  1X3E A;  4TVA B;  2KCN A;  3AQQ A;  2MQH A;  5M5X H;  3F2C A;  3OMC A;  2AMC B;  1QIL A;  5E1F A;  5C5M A;  3VA7 A;  3G6J B;  3DM1 A;  4GKK L;  1RIP A;  3KLS X;  4KY5 A;  4O2D A;  4ME5 A;  4DNT B;  5DEH A;  1UAP A;  4DR4 Q;  1K9M C;  1VQP A;  4ZQ3 A;  1H9S B;  2MUY A;  2H4O A;  1Q7Y C;  2PQE A;  1E7Z A;  4J1M A;  2LFN A;  3HOU H;  5M5Y B;  4L5T A;  2R92 G;  5DM6 3;  3HKZ B;  3A0J A;  3E3X A;  3PCO B;  3A54 A;  4OEL B;  3BS1 A;  4O1N A;  1R4Q B;  1CHQ D;  1VQ9 A;  3K5N A;  1I6H H;  4A3J G;  1YZ6 A;  2QCP X;  4GS3 A;  2K6A A;  3PUY A;  3AFQ A;  4NMZ A;  4RKB A;  2YTV A;  1PZI D;  4EX5 A;  3WWV A;  5GAG C;  3S1Q B;  3G48 A;  3HZX A;  1B3A A;  3OYY A;  2F0W A;  3IRB A;  3IFT A;  1YIJ A;  4GKJ L;  5H1S E;  5LMU Q;  4JI5 L;  2LXK A;  2RSN A;  4P74 A;  4FP5 D;  1W2B A;  1B1Z A;  2E5L Q;  4LFA L;  1VQ4 A;  1ENC A;  2JA9 A;  4KHZ A;  2A5H A;  1V1P B;  2QGQ A;  1XMQ L;  1YBY A;  1HZA A;  3OMG A;  4V19 0;  1XNQ Q;  3CF5 A;  3SR1 A;  3HOU B;  1IZ6 A;  2JA6 H;  1I50 B;  1W6K A;  2DGY A;  1EIH A;  3GTQ H;  3OWE B;  1VDZ A;  2RQX A;  3E5S A;  4BBR H;  4ZYS A;  1FVI A;  5I2X A;  1BDO A;  2UXD Q;  2A6E D;  1HR0 Q;  1ICW A;  1JOO A;  1I6H B;  1ZEQ X;  1FNW A;  1L1O A;  1HZB A;  5D14 A;  1S5E D;  1N8R C;  3KF6 A;  1K28 A;  2Z6B A;  4AYB G;  2O4X A;  3PSI A;  3CCL A;  1NCV A;  4CJ0 B;  4I7A A;  2WII B;  3FHW A;  1CSP A;  4IUT A;  1HFG A;  4N9P A;  2RBM A;  3TME A;  3MC0 B;  2JXM B;  2R93 H;  4LF6 L;  5FKA C;  4Y7N H;  1W3S A;  3OHX C;  1QVG A;  2ZM6 L;  1RHP A;  2YTY A;  2ZJQ A;  4RMF A;  3X3M A;  3K80 C;  3NBH B;  4GNX A;  1U4P A;  1ENA A;  2Z4H A;  4B3T Q;  2N49 A;  1BCP F;  1SNP A;  3V2T A;  1PTO F;  3HOZ B;  3SEB A;  1KL9 A;  4JBW A;  2QIL A;  2SDF A;  1VQE A;  2F0D A;  2JA6 B;  2UUA Q;  1PLF A;  1QCB D;  3GTQ B;  2UXC L;  1SYD A;  3T13 A;  1A2U A;  3P75 A;  1SMY C;  4MTN A;  3OTO Q;  4X66 L;  2K5H A;  5DNF A;  4MTK A;  1EIF A;  1Y1W G;  1MKH A;  1XTC D;  2Z6K C;  4A93 H;  4BXX H;  4DV2 Q;  3VYT A;  1KIX A;  1CQV A;  1OO9 B;  1Q86 C;  4KMU C;  2OXP A;  2F3V A;  3H09 A;  3K5M A;  1QVF A;  3X3N A;  3J7Z C;  2JYO A;  1LO5 D;  4HMJ A;  5IYD G;  5CV5 A;  4HIK A;  4YWM A;  2EPB A;  2XRQ D;  2R93 B;  5IT9 c;  4Y7N B;  1ILQ A;  2RDG A;  3E0E A;  4DV1 Q;  1UNS A;  3H91 A;  2EXZ A;  1CUK A;  4LNQ A;  4K6D A;  3M3Y H;  1XX8 A;  2C5C A;  5KND A;  1NR4 A;  1UWV A;  4JI0 Q;  2RCN A;  3DMU A;  5A35 A;  1NUC A;  1QUQ B;  2ZTC A;  2D0O A;  2WB1 B;  3BJU A;  1IBL Q;  1QZH A;  4FF3 A;  1G8Z D;  1M8A A;  1P16 A;  2KCC A;  4ZRZ A;  3A8I E;  1A8V A;  2QF7 A;  1TWF H;  4PZ7 A;  1EYD A;  3LNN A;  4K8J A;  4H0L C;  4HAE A;  3TP5 A;  4HN7 A;  4QY7 A;  5C0X H;  1UUP A;  2G9H D;  1LYL A;  1LAB A;  3PQI A;  4LF9 Q;  4H02 A;  2HHH Q;  2EY2 A;  1VQ7 A;  1YVC A;  1HNZ L;  1AP0 A;  1EWC A;  3MHB A;  1SYF A;  1TS5 A;  3CAM A;  4GOP A;  1Y69 U;  3PF4 A;  1TWA H;  5JOB A;  5C4X H;  3BVG A;  5KRU A;  5M3M B;  1D1I A;  5ELN A;  4CBV A;  4A3I H;  1Q8K A;  4A4I A;  2GN5 A;  3TS2 A;  5TSS A;  2WP8 J;  1ROD A;  4EQO A;  1SRO A;  5CGK A;  3KJP A;  5D3I B;  2AWN A;  3NQI A;  3QO2 A;  5DLQ E;  5NUC A;  2K52 A;  4IJH A;  2Q2H A;  1EY4 A;  4R4Q A;  2L11 A;  1ENF A;  1KRT A;  2EYO A;  1LT6 D;  1H9S A;  1O7Z A;  4KK7 A;  4DNR B;  3LGJ A;  3MXN A;  3Q8D A;  2C9O A;  1P8L A;  1E3P A;  1TWF B;  4JYA L;  2A69 D;  4DGZ A;  4DV6 L;  3DLL A;  2O5I C;  2R92 B;  3T16 A;  3GQB A;  1TU2 B;  3C2P A;  1DOL A;  3S1M B;  4JI3 L;  5I6Y A;  3L9A X;  2I0Q A;  4A3J B;  1I6V C;  1SYC A;  5IWA L;  1YHB A;  2CKZ B;  4JV5 L;  3PO3 B;  1KRS A;  4DAP A;  2MO1 A;  2ZJR A;  2OWO A;  4QUF A;  1SRU A;  4P75 A;  1PYW D;  1MJC A;  3URY A;  1VCI A;  3R3O A;  5DAU A;  4JI7 L;  2XN9 C;  2NTT A;  2A6H D;  2X6G A;  5ELD A;  3KBG A;  2R7D A;  3F2U A;  5EAY A;  1I94 L;  1CM9 A;  3CME A;  5CV6 A;  2A69 C;  2B29 A;  1BO0 A;  2OCE A;  1B50 A;  3H0G B;  4B3R L;  3RN5 A;  3HEJ A;  1X32 A;  1FGB D;  1HRJ A;  5C4J H;  1PH5 A;  1GOZ A;  1Q81 C;  4DV3 Q;  4ODG A;  2BA1 A;  3I4O A;  1PYB A;  3Q22 A;  5IIF A;  4HSP A;  1EEF D;  5KIX A;  1JJC B;  1VQF A;  5K5P A;  3KDF A;  2B2U C;  3D0F A;  4GN5 A;  1PYS B;  2A6H C;  1PA6 A;  2R61 A;  4N8F A;  5LHY 1;  4AYB B;  2EY1 A;  2I5H A;  1EQT A;  1EQQ A;  2BE5 D;  4HED A;  3I72 A;  4B3S L;  3KOJ A;  4QGU A;  4KHP Q;  2YYZ A;  3SK5 A;  1G51 A;  4CHT B;  4APV A;  1KXL A;  2K1B A;  1V43 A;  4LF8 L;  1QG7 A;  3NSW A;  3HOX G;  5IYD H;  2NVY H;  3L0O A;  3DWQ A;  1XPO A;  4TQU S;  3NBH A;  1SE8 A;  1BOS A;  3W3A A;  1MHW C;  3FRP B;  4G7Z C;  1WTQ A;  2L12 A;  1A15 A;  3U50 C;  1HQM C;  3GDE A;  4YY3 L;  2RSO A;  3UDG A;  5C4J B;  4DV4 L;  4A3B B;  5FLM G;  4PZ8 A;  2KUM A;  3MA2 B;  4YY3 Q;  5KEE A;  2KQ3 A;  2SEB D;  3CXC A;  4PMB A;  3NP8 A;  4RGT A;  4YWL A;  4UP7 A;  4UPA A;  3JAM E;  1W6J A;  3BZD B;  4RWS C;  3EN2 A;  4QIW B;  1Y1W B;  4X64 Q;  2K5W A;  5LL6 S;  2MJ8 A;  4A3L G;  4B9W A;  4OWX B;  4JBJ A;  4DUZ Q;  3MFG A;  2F0F A;  4UP9 A;  3ERS X;  1NAP A;  4DUY L;  3T51 B;  3A5U A;  4IAL A;  4WJ3 M;  2IT1 A;  2PI2 A;  1STB A;  1SN8 A;  1KTK A;  2CWP A;  1GVP A;  1B44 D;  2KED A;  2TMP A;  5FO8 B;  4BWG B;  1QUQ A;  3KFU A;  1Q1E A;  3RLO A;  3MAQ A;  2HDM A;  1SSO A;  3MTS A;  2CH4 W;  1PRT D;  1Y8P B;  5ELO A;  1F2L A;  2B2T A;  4MN3 A;  3D4W A;  2PMZ B;  3OIQ A;  2IHF A;  2EZV A;  1CSQ A;  4CKC A;  3CC2 A;  2PPB C;  1OXS C;  1E1T A;  1G2S A;  5ELC A;  4Q5V A;  1EZ6 A;  2EIF A;  4C3J G;  1PTO B;  4K0K L;  3J80 E;  1DYQ A;  3ONA B;  2NVT H;  3QJY A;  1SJH D;  4C56 C;  2BCO A;  4G57 A;  4IJL A;  4X62 L;  1E2W A;  3S1N H;  1F2Z A;  2UU9 Q;  1IBK L;  2VQE L;  1Z7T A;  5E4W C;  4B08 A;  2XWJ B;  3I73 A;  3R93 A;  1EQR A;  4DR2 Q;  3NBI A;  3QG1 A;  1MI2 A;  3G7L A;  5EKL A;  1NNX A;  5EQ0 A;  2ASB A;  2PNH A;  2QDL A;  4JK1 C;  5AJ3 Q;  3N6R A;  4RFB A;  1A3T A;  2F0S A;  1AN8 A;  2PCF B;  1RDP D;  1J5E Q;  1ASZ A;  4TSS A;  1ILP A;  2F4V L;  4L8J A;  2WAQ G;  1TXY A;  2VNU D;  2F0T A;  4OL7 A;  3PIO A;  2KBN A;  3PV0 A;  3S17 H;  3TN2 A;  5HUR A;  1HH2 P;  1SXT A;  1CA5 A;  2KHS A;  2AKW B;  1A2T A;  3VA5 A;  1H9K A;  2F0L A;  2E2D C;  3MEH A;  3CQZ H;  2VW9 A;  3CKI B;  4GNX C;  4A3E G;  3I90 A;  1TWC H;  2IL8 A;  2JSO A;  3MFY A;  3GTK H;  3CCS A;  4A3D H;  1VQH A;  2DNC A;  3NTI A;  4NDX A;  2Y0S E;  1GUW A;  3HOX H;  1QZG A;  1BR9 A;  2K7V A;  5ELB A;  2MPM A;  4RKL A;  2SOB A;  5IP9 G;  5EBC A;  5DM7 3;  4KKS A;  5IGD A;  2CW0 C;  3NEN A;  2EE1 A;  1L1O B;  1LT5 D;  1WVL A;  1II3 A;  1UEA B;  1IBM Q;  1DM0 B;  2KCM A;  1F9P A;  2D0P A;  4DR7 L;  5CV8 A;  4A3M B;  1O80 A;  4KD3 A;  4QL5 A;  2XIW A;  1PH9 A;  3UDF A;  3MWY W;  5EBD A;  2WKD A;  1OXU A;  2BDN A;  4BY1 G;  2K5N A;  4UHV A;  3NHH A;  2N55 A;  3PF5 A;  3EBE A;  1AH9 A;  2RHS B;  3CQZ B;  1X55 A;  3FKI G;  4H7B A;  1PFN A;  4A3L H;  1TWC B;  1EFW A;  1L0X B;  3W1G A;  1N33 L;  4KLK A;  2F0V A;  4RCN A;  1IXR A;  1F77 A;  3HOW G;  4YCU A;  3J81 i;  1PH3 A;  1WTW A;  4NXM Q;  3K7A B;  3PUW A;  3VYS A;  3GV6 A;  3NWS A;  3I55 A;  1B7Y B;  1T5E A;  2K03 A;  3STB D;  4OWT B;  1A3V A;  3IKJ A;  2B2V C;  3JAM c;  1N34 L;  4UP8 A;  4X65 Q;  1EWI A;  1YI2 A;  1PH7 A;  4DAM A;  2IWH A;  3RR5 A;  3P20 A;  4MNO A;  1QOH A;  3GV3 A;  3IFD A;  3SDZ A;  4C3H B;  5ELE A;  3FEW X;  3TSS A;  1NE3 A;  1J6Q A;  2JEB I;  3D3R A;  1Q90 A;  4AIM A;  4H44 C;  1PZJ D;  2G5D A;  3HG9 A;  3VYR A;  3PMF A;  2EVB A;  4RHR A;  3K5L A;  1D6E C;  2JA8 G;  4K5X A;  4CGY B;  3WOF A;  1IHZ A;  4U67 3;  2K04 A;  1PFS A;  3L7Z C;  3NXW A;  4GN3 B;  1XMO Q;  1WI5 A;  4GLA C;  4Z9C B;  3PO2 G;  1S5C D;  1SYG A;  2J7Z A;  3VR6 A;  4K8I A;  4ME3 A;  4JCV E;  3QOJ A;  2F0H A;  3GTL B;  1S72 A;  3SK6 A;  3HRZ C;  2F0I A;  1EYG A;  4XYO A;  3J80 c;  1KAW A;  1BNZ A;  3MZ5 A;  4LW1 A;  1FNU A;  2ZT9 C;  1KHI A;  3FMC A;  4K5W A;  4X3K A;  2R3Z A;  1VQ6 A;  4RCO A;  3C46 A;  4CDC C;  1RTN A;  1EY7 A;  1E24 A;  3I56 A;  1STA A;  4GKK Q;  5JEA G;  3RMH A;  4C3J B;  3ERQ A;  1K83 B;  1OXV A;  4IOC A;  2V4D A;  1EFI D;  3HGB A;  1R4P B;  1DD2 A;  3MXN B;  3GTO H;  3OPO A;  2OT2 A;  3R2T A;  4A3E H;  1X65 A;  1HA6 A;  1E2V A;  3Q6S A;  1JJG A;  2SNS A;  5C0X G;  4M1U B;  3DUZ A;  5IT9 L;  1MJE A;  3Q0A A;  1I4Q A;  1Q3L A;  1ZKO A;  1D5Z C;  1SE3 A;  1U0L A;  5C4X G;  1F9Q A;  5IP9 H;  2I07 B;  4PG3 A;  2UUB L;  4A3I G;  2KEE A;  5CV9 A;  4LFB L;  1JOK A;  3QOL A;  5I9P A;  1L0Y B;  2N8N A;  4ALP A;  5M5X B;  1ET6 A;  3G71 A;  3W5O A;  3BDO A;  5GAE C;  1U4L A;  1KAB A;  5I9O A;  3KYH C;  3F1Z A;  2WAQ B;  2PZW A;  4F7X A;  4NB3 A;  3CRK C;  2AHO B;  1IYV A;  3ER0 A;  4IPG A;  5I4D A;  1MSG A;  4GKJ Q;  2VUM H;  4XQJ A;  4BY1 H;  2NBF A;  4DN4 M;  4JI5 Q;  5COR A;  1VQN A;  3DWP A;  3K5O A;  4H13 C;  4LFA Q;  4DK3 C;  1K0R A;  3FKI H;  4YIJ A;  5LMN L;  4JI2 L;  1XMQ Q;  2JA7 G;  1C9O A;  4I7Z C;  5JEA J;  4RHS A;  1KAA A;  3HOW H;  1JOR A;  3KDF B;  1TS3 A;  2FHT A;  2WIN B;  4DAY A;  5HGQ A;  2J0T D;  3HOV G;  2KA7 A;  5C0X J;  4MHE A;  1EOV A;  4HCS A;  3T1H L;  1D2B A;  3E9H A;  4DR3 L;  1SMY D;  1MD2 D;  3EA6 A;  3ND9 A;  2K05 A;  4R4I A;  3AB9 A;  3KF8 A;  4KN4 C;  3QR8 A;  3H3V C;  1VQM A;  3I8Z A;  4LF4 L;  4BY1 B;  5D3D A;  5CYU A;  5T1G A;  4LF6 Q;  3PUV A;  2GVB A;  2CH4 A;  4P2C B;  3AEV A;  2B2Y C;  3CMA A;  5A2Q E;  2ZM6 Q;  2JA8 H;  3O13 A;  1TY0 A;  1EIY B;  4JI4 L;  1X6O A;  1YJW A;  2HUG A;  3FKI B;  4C3I G;  3K0Y A;  4DV5 L;  1PH6 A;  2XVS A;  1TWG H;  1Q82 C;  4BBR B;  4LUV A;  1ONL A;  3J81 E;  1BQQ T;  3HOW B;  2D2C C;  1BXT A;  4DU9 A;  3V05 A;  3U4V A;  4KY7 A;  2NZO A;  3PO2 H;  2UXC Q;  1GUN A;  1V1Q A;  3VR2 A;  1S3O A;  5FO9 B;  5C3X A;  3T56 B;  4X66 Q;  1AZQ A;  2JA5 G;  2O5J C;  1B70 B;  4DXG A;  1UEB A;  4A75 A;  4OO1 H;  3CCJ A;  2EY6 A;  4IUQ A;  4RG1 A;  1VF5 C;  5CV7 A;  2K50 A;  2E2J H;  2OTJ A;  4DR6 L;  4Q0F A;  1LUZ A;  5CBE E;  1U4R A;  3KK7 A;  3A7A B;  3U58 A;  1HCZ A;  1LT3 D;  3M4P A;  3OOC A;  2JA8 B;  3D4D A;  3I7F A;  1YEZ A;  2EQS A;  1TWH H;  1JWM D;  5JEA H;  2M9V A;  4K6L A;  3ND8 A;  4IUP A;  2UUC L;  1TWG B;  1GUO A;  1SYB A;  1E22 A;  1SE4 A;  4EGV A;  5IYB G;  2E2I H;  2L1B A;  5KNC A;  1I3Q H;  1VQD A;  3BZK A;  3AFP A;  2AUJ D;  4A93 B;  4XQQ A;  5LL6 X;  1GUG A;  1HNZ Q;  3WDN A;  1YHA A;  4FO2 A;  1NJI C;  1KLU D;  1Z9F A;  4HJ7 A;  3CU7 A;  3ULP A;  4JOI A;  1GHK A;  3DEO A;  3JC6 6;  5CMD A;  1J8I A;  3OSO A;  3VYU A;  2E2J B;  5F2D A;  1TQO A;  4EQN A;  3RZO H;  3M3Y B;  4FYD A;  1LTA D;  3HKZ E;  2F0K A;  1CKO A;  3HP3 A;  5J1Z A;  1TWH B;  1VQG A;  4JI6 L;  1HA5 A;  3QWN A;  1XNR L;  2XRS D;  1G6P A;  3I4N G;  3FDT A;  3S2D H;  2HT1 A;  2M2L A;  4HIM A;  2CQO A;  1BKB A;  2JA7 H;  4JYA Q;  1I4H A;  5L37 A;  2PQA A;  4R4O A;  1D5X C;  1WTH A;  2BH8 A;  4P73 A;  4DV6 Q;  1TWA B;  5C4X B;  1NBW A;  4JVZ A;  1B3Q A;  1DZ1 A;  3SXH A;  1LTR D;  5M5W H;  4A3I B;  3S24 A;  2XSC A;  3HOV H;  2PO4 A;  2K5Q A;  2B2W C;  4JI3 Q;  1FGU A;  5IWA Q;  2K32 A;  5D65 A;  3KBX A;  4IOA A;  4JV5 Q;  4DR1 L;  2D9U A;  3EVQ A;  2NB0 A;  5EKI A;  4JI7 Q;  1OXT A;  3DWA A;  1PFB A;  2LXJ A;  1I94 Q;  1X3G A;  1KC8 C;  3GTJ H;  2F0O A;  1STG A;  4C2M H;  2VZA A;  1PZK D;  1K8M A;  4C3I H;  4B3R Q;  3Q23 A;  3GP7 A;  3RZD H;  4IUU A;  4IPD A;  5J39 A;  1M4V A;  1HHV A;  4NXN L;  3UDI A;  1HUM A;  5T1I A;  1A3U A;  3D8G A;  2A1A A;  3OW7 A;  4XTC S;  2PZU A;  5M5W B;  2ZJP A;  1LLR D;  2JA5 H;  1X3P A;  1RL2 A;  3NPP A;  4YCV A;  5KYL A;  4A3D G;  3CRL C;  2ENB A;  4BS9 A;  1IW7 D;  4LJZ C;  5IYC G;  4RH6 A;  1YNJ C;  4JI8 L;  3H94 A;  4B3S Q;  4FNF A;  1I4X A;  1CQF A;  4LF8 Q;  1FNV A;  4LMQ D;  3R8B A;  1BCP D;  2PNR C;  4HSV A;  1EY6 A;  1PTO D;  3GTJ B;  2EYM A;  1SND A;  3RLN A;  3TEH B;  4IO9 A;  3BYT B;  4EQP A;  3BDC A;  2ID0 A;  3S1R H;  5LMN W;  4DV7 L;  4LF7 L;  3J7A F;  1X3F A;  4C3I B;  5E3F A;  1M90 C;  3D4R A;  3T1Y L;  5IOC A;  3DEP A;  1K73 C;  1O7Y A;  4DV4 Q;  1QJO A;  1CHP D;  2JK8 A;  4N9T A;  2A8V A;  4A3K H;  1IW7 C;  1MIU A;  4F88 A;  5IYB H;  2QW7 A;  2L0C A;  2IJ0 A;  2K14 A;  1SMX A;  2IHE A;  1JIC A;  1KD1 C;  4K14 A;  2PI2 E;  3NUC A;  2UXB L;  2EYF A;  2Q2I A;  1B53 A;  2EXD A;  1BCP C;  1S5D D;  2WFW A;  1PTO C;  4OXP A;  2NVY B;  1PFM A;  5EPK A;  3WOE A;  2JEA I;  3GTP H;  2WB1 E;  4DV0 L;  2ZXP A;  4KI0 A;  4ZUI A;  4XT3 B;  3SE0 A;  1VQL A;  5K36 G;  1F2Y A;  1VQK A;  1V8Q A;  1FYC A;  1K3R A;  4IZ8 A;  4NW2 A;  4DUY Q;  4R8N A;  4FVM A;  2K28 A;  4ZAI A;  1WFQ A;  2D62 A;  2F0M A;  4DF7 A;  1QE6 A;  4A3G H;  1BVS A;  3I4N H;  2VQF L;  2FXQ A;  1HTP A;  4CDF C;  1VQA A;  3M4Y A;  1C0A A;  5HGT A;  1YIT A;  4LF5 L;  1EU3 A;  2IX0 A;  2B63 G;  3DM3 A;  4IUV A;  1EY8 A;  5C4H A;  1X9N A;  4CJ2 C;  2RDH A;  1SFO H;  2MP1 A;  4POG A;  4DK6 C;  1B9M A;  1CT1 D;  2E76 C;  1EEI D;  1YNN C;  4HIO A;  1KNE A;  2R7Z G;  2G9D A;  5M3F G;  2MGS A;  4DFA A;  1G6Z A;  3JAM L;  2OEO A;  4XQN A;  1EWH A;  4OX9 L;  4E6I A;  4AQY L;  3U4Z A;  2A19 A;  3PUX A;  1S4Z A;  4K0K Q;  1AE2 A;  3M7G A;  4B3M L;  3GTP B;  2Z6K A;  3S16 H;  4IFD G;  3OWF A;  1HNW L;  4ZCK A;  5G3L D;  5IP7 G;  3ZYY X;  4X62 Q;  4QB4 A;  4FXD A;  1SE2 A;  4KJN A;  1IBK Q;  2K4K A;  1QNK A;  4N8X 1;  2VQE Q;  3GTM H;  1ZYR D;  4BBS H;  3MVV A;  5HY6 A;  3NEL A;  1DON A;  2Z8L A;  1JMC A;  2DN8 A;  2K75 A;  4WJ4 A;  3M85 A;  1BBW A;  1CA6 A;  1L1O C;  5C4Z A;  3V96 A;  1H9M A;  1FL0 A;  1SDF A;  1SJE D;  4QCL A;  1C48 A;  4J6H A;  4GLV B;  4WJW A;  1STN A;  2CW0 D;  5C44 G;  3TZD A;  3SVM A;  3S2H H;  2H1E A;  2F4V Q;  3CCV A;  3DHQ A;  2QDB A;  1IKL A;  2Z9H A;  1O7L A;  1NMG A;  3I4M G;  2NVT B;  5JPN C;  4FF2 A;  2Q8R E;  3J80 L;  1JOQ A;  5BN3 A;  1QVC A;  1ZYR C;  4HJ9 A;  3S1N B;  4JI1 L;  3S16 B;  5ISR A;  1LM0 A;  1K8G A;  4CDE C;  1SAP A;  5IYC H;  5IGG A;  1FR3 A;  5JJK A;  5FLX E;  4QF4 A;  2K5D A;  4OHJ A;  4KTA A;  3FPU B;  4DAY B;  1XJV A;  4IFD J;  2B8F A;  3K6O A;  4O42 A;  4X3U A;  3GO5 A;  5IE8 A;  2N78 A;  3SHL A;  2L55 A;  1IYJ B;  1G29 1;  3TP6 A;  1TS2 A;  1PRT B;  1V9P A;  3GTG H;  1RTO A;  5JJZ A;  1DOK A;  4EQ5 A;  1SR3 A;  1STE A;  1B2T A;  4WFN 3;  3S17 B;  3KF8 B;  3S2H B;  2VUM G;  4DR7 Q;  4XDX A;  4POF A;  1EOT A;  2LY7 A;  3TZU A;  2RA4 A;  4JG2 A;  3PIP 3;  4BA1 I;  1XPR A;  1NY4 A;  3K58 A;  1F2M A;  3K8A A;  4PNY A;  1HNX L;  3M4O H; 
#chains in the Genus database with same CATH homology
 4X64 L;  4NB3 A;  5ELN A;  4A3I H;  2AHO B;  1Q8K A;  4PZ6 A;  4A4I A;  1I5F A;  2GN5 A;  3ER0 A;  4IPG A;  1CKM A;  3VDY A;  2WP8 J;  3TS2 A;  4DUZ L;  3M7N A;  1JB7 A;  2VUM H;  4BY1 H;  4GKJ Q;  1SRO A;  1N36 L;  3KJP A;  1R9T H;  2HIX A;  4DV0 Q;  4JI5 Q;  5GAD C;  2AWN A;  2I5M X;  2XTI A;  5DLQ E;  4L5S A;  1VQN A;  2K52 A;  1GD7 A;  4IJH A;  3TRZ A;  4LFA Q;  1Q12 A;  4DK3 C;  1WCM G;  4HJA A;  1N33 Q;  1K0R A;  2Q2H A;  4R4Q A;  3FKI H;  4GN4 B;  2L15 A;  3ZJY C;  1EUJ A;  1KRT A;  5LMN L;  2IY5 B;  5BR8 L;  2ALY B;  4JI2 L;  3RN2 A;  1XMQ Q;  2JA7 G;  1C9O A;  3F2D A;  2RF4 A;  5JEA J;  4R4C A;  3HOW H;  3J81 j;  1DGS A;  3LGJ A;  2VQF Q;  4IFD I;  3KDF B;  4QIW E;  3Q8D A;  1N34 Q;  4GOP C;  1P8L A;  1E3P A;  4JYA L;  4LF5 Q;  2V1C C;  1FJG L;  1UE1 A;  5HGQ A;  1N9W A;  4Y52 H;  2K5V A;  3CPW A;  3ULJ A;  3DLL A;  4DV6 L;  3HOV G;  1U5K A;  5C0X J;  4XIG S;  4UY8 C;  1EOV A;  3K0X A;  4PMW A;  3T1H L;  3E9H A;  2B63 H;  2E2H H;  1N32 L;  4YHH L;  4DR3 L;  4JI3 L;  5JJL A;  2I0Q A;  5IWA L;  1IL2 A;  4R4I A;  1YHB A;  4OX9 Q;  2CKZ B;  2NZH A;  2R7Z H;  4JV5 L;  5M3F H;  1KRS A;  3CCU A;  2MO1 A;  2ZJR A;  4GLX A;  4AQY Q;  2OWO A;  1VQM A;  1Z47 A;  1SRU A;  5GRO A;  4P75 A;  4LFC L;  2NVQ H;  4LF4 L;  4YWK A;  3KLW A;  1MJC A;  1VCI A;  4B3M Q;  4LF6 Q;  3PUV A;  2GVB A;  4JI7 L;  5FJ8 H;  1SLJ A;  1HNW Q;  3AEV A;  1Q46 A;  4IPC A;  3CMA A;  1O7I A;  2ZM6 Q;  2YU9 H;  2JA8 H;  2R7D A;  5EAY A;  1I94 L;  2UU9 L;  5E7N A;  1EIY B;  3CME A;  4JI4 L;  1X6O A;  1YJW A;  3S15 H;  3UDX A;  5IP7 H;  2CCZ A;  2OQK A;  4DV5 L;  2B29 A;  1PH6 A;  1JE5 A;  1PV4 A;  4BA2 I;  2OCE A;  4DR2 L;  1TWG H;  1NMF A;  1Q1B A;  2PMZ E;  4O0A A;  3RLF A;  3HKZ G;  1Q82 C;  4LUV A;  3OW2 A;  4B3R L;  3RN5 A;  5IY0 A;  2WB1 G;  4LUO A;  4DR5 L;  4DKA C;  3FP9 A;  3U4V A;  2NZO A;  5C4J H;  5AJ3 L;  3PO2 H;  1PH5 A;  2UXC Q;  1Q81 C;  4OO1 G;  4DV3 Q;  2BH2 A;  1A63 A;  2BA1 A;  2JQO A;  3I4O A;  1PYB A;  1V1Q A;  1J5E L;  1S3O A;  2JA5 G;  2OQ0 A;  2CWA A;  4X66 Q;  1A62 A;  1JJC B;  1VQF A;  1B70 B;  3L2P A;  2HQL A;  1CKN B;  2JJQ A;  3KDF A;  3PGZ A;  1UEB A;  4A75 A;  1VQJ A;  3D0F A;  1HJP A;  5C0X I;  4X6A H;  4GN5 A;  5C44 H;  1PYS B;  1PA6 A;  4HJ8 A;  2NN6 G;  3CCJ A;  4A3M H;  4RG1 A;  1VQ8 A;  4HJ5 A;  2K50 A;  2I5H A;  1EQQ A;  2E2J H;  2OTJ A;  3BU2 A;  3I4M H;  4JI1 Q;  1LUZ A;  3KOJ A;  4QGU A;  2YYZ A;  4B3S L;  1G51 A;  3S1Q H;  3GD7 A;  4APV A;  3U58 A;  1V43 A;  4LF8 L;  3M4P A;  2Q2T A;  3HOX G;  5IYD H;  2NVY H;  3I7F A;  3L0O A;  3MEF A;  1X56 A;  1YEZ A;  2EQS A;  1K8A C;  1TWH H;  4DR4 L;  4KHP Q;  3K7U C;  4TQU S;  1XPO A;  3HOU G;  3G6E A;  1SE8 A;  2UUC L;  1UE6 A;  2PQA B;  3RNU A;  3U50 C;  3G4S A;  4AYB E;  1PH4 A;  3GDE A;  1E22 A;  3K7A H;  4YY3 L;  2MO0 A;  3UDG A;  4BY7 G;  2AWO A;  4DPG A;  5IYB G;  4DV4 L;  1PH1 A;  1IBM L;  1I3Q H;  2E2I H;  1VQD A;  2ZTD A;  4P72 A;  3BZK A;  3AFP A;  1PHJ A;  3ULL A;  2UUB Q;  5FLM G;  4PZ8 A;  1JJ2 A;  1I50 H;  4YY3 Q;  1Y1V H;  4LFB Q;  2VL6 A;  3CXC A;  3KF6 B;  1HNZ Q;  1VQC A;  3HOY G;  3PIP A;  4YWL A;  2YTX A;  5GQO A;  1YHA A;  4P71 A;  4C3H H;  1M1K C;  2RHQ B;  4UP7 A;  1Z9F A;  4UPA A;  1NJI C;  4HJ7 A;  1D7Q A;  5FLX c;  3EN2 A;  1HNX Q;  5FLM H;  3PO3 G;  4X64 Q;  3ULP A;  4JOI A;  1UE7 A;  3JC6 6;  4A3L G;  2GVA A;  5LMU L;  4DUZ Q;  4OWX B;  4JBJ A;  1N36 Q;  4YCW A;  3RZO H;  4UP9 A;  2YV5 A;  4GNX B;  1GM5 A;  3ERS X;  4DUY L;  2E5L L;  3HKZ E;  2MNA A;  1CKO A;  3HOZ G;  1YNX A;  4AH6 A;  1VQG A;  3A5U A;  4JBM A;  4JI6 L;  1XNR L;  1YJ9 A;  2ES2 A;  1PH8 A;  1G6P A;  4JBK A;  4WJ3 M;  4NXM L;  2IT1 A;  2PI2 A;  3I4N G;  3S2D H;  2JA6 G;  1KXL A;  1SN8 A;  5LMN Q;  1WCM H;  1L0W A;  5BR8 Q;  2CWP A;  2XGT A;  1GVP A;  3H0G G;  4JI2 Q;  4HIM A;  1XNQ L;  2HT1 A;  4BBR G;  3KJO A;  3H3V I;  2CQO A;  2Y0S G;  1BKB A;  1QUQ A;  3HOZ H;  1GKH A;  4X65 L;  2JA7 H;  3KFU A;  1E1O A;  1Q1E A;  3E9I A;  3RLO A;  1C7Y A;  1H95 A;  2KCT A;  1VQ5 A;  4JYA Q;  2C35 B;  1FJG Q;  2CFM A;  1AE3 A;  2UXD L;  2PQA A;  4R4O A;  1HR0 L;  2BH8 A;  4P73 A;  4DV6 Q;  3GTL H;  3CCM A;  4JOI C;  1NBW A;  5ELO A;  2JE6 I;  3TQY A;  3T1H Q;  2E8G A;  5M5W H;  4L5Q A;  3S24 A;  3BZC A;  1N32 Q;  4YHH Q;  4DR3 Q;  3HOV H;  2IHF A;  4LUZ A;  1XPU A;  1CSQ A;  4JI3 Q;  3A5Z B;  3I2Z A;  3CC2 A;  1KQS A;  2R93 G;  1FGU A;  5IWA Q;  1OXS C;  1E1T A;  1X54 A;  2EIF A;  4IOA A;  4JV5 Q;  4K0K L;  4DR1 L;  4LWC A;  4LFC Q;  4LF4 Q;  4OO1 I;  2KHJ A;  2I5L X;  4R1J A;  3UE1 A;  2NVT H;  1YJN A;  4JI7 Q;  1OXT A;  2R7F A;  3H3V H;  2LXJ A;  4IJL A;  4X62 L;  3S1N H;  5C3E G;  1B8A A;  2DUD A;  2LSS A;  3UE0 A;  3CCQ A;  1I94 Q;  1X3G A;  1KC8 C;  3STB C;  4C3J H;  3GTJ H;  4A3F G;  1IBK L;  1K83 H;  2VQE L;  1XMO L;  4JI4 Q;  4B3T L;  1OTC A;  2NN6 I;  3D31 A;  4DV5 Q;  4C2M H;  3CD6 A;  1EQR A;  2VZA A;  5JJI A;  2Z0S A;  4DR2 Q;  4C3I H;  4OON A;  4B3R Q;  5M5Y H;  4DR5 Q;  2UUA L;  2ASB A;  2PNH A;  3F2B A;  3RZD H;  1XTD A;  4MZ9 A;  5AJ3 Q;  1BBU A;  4A3B G;  4IPD A;  4OWW B;  4NXN L;  4JC0 A;  3UDI A;  3OTO L;  1J5E Q;  4BXX G;  4A93 G;  1ASZ A;  1VS0 A;  1WJJ A;  3F8T A;  2A1A A;  4XTC S;  5GAH C;  1VQI A;  4GOP B;  1VQO A;  2F4V L;  1VQB A;  1WOC A;  5M3M G;  2WAQ G;  1TXY A;  1YHQ A;  2VNU D;  1X3E A;  4TVA B;  2ZJP A;  4DV2 L;  3PIO A;  3AQQ A;  2KBN A;  3PV0 A;  2JA5 H;  3S17 H;  2MQH A;  1HH2 P;  5M5X H;  3F2C A;  1RL2 A;  2AMC B;  4YCV A;  3JAM i;  4A3D G;  2IX1 A;  3PUZ A;  2AKW B;  5IYC G;  4GKK L;  1RIP A;  4JI8 L;  5M3M H;  3CQZ H;  4B3S Q;  4DR6 Q;  2VW9 A;  4O2D A;  4GNX C;  4A3E G;  3H15 A;  4LF8 Q;  4DV1 L;  1LTL A;  1TWC H;  1PVO A;  3GTK H;  3CCS A;  4DR4 Q;  1VQH A;  4A3D H;  3CW2 C;  2Y0S E;  1K9M C;  1VQP A;  3M9B A;  3HOX H;  1QZG A;  3RLN A;  4A3K G;  4JI0 L;  3TEH B;  4IO9 A;  1Q7Y C;  1E7Z A;  2ID0 A;  3S1R H;  5LMN W;  4DV7 L;  5IP9 G;  2UUC Q;  1X3F A;  3CC4 A;  4LF7 L;  3HOU H;  1IBL L;  1M90 C;  3NEN A;  4HID A;  4FDB A;  1L1O B;  4L5T A;  3T1Y L;  2R92 G;  1K73 C;  4DV4 Q;  1NTG A;  1IBM Q;  3A0J A;  3CPF A;  2H5X A;  2JK8 A;  3CP0 A;  4A3C G;  3PCO B;  2A8V A;  4A3K H;  1VQ9 A;  1MIU A;  2KCM A;  4BY7 H;  4LF9 L;  2D0P A;  5IYB H;  2HHH L;  4DR7 L;  1I6H H;  2K14 A;  4A3J G;  4L5R C;  1YZ6 A;  1SMX A;  4GS3 A;  2IHE A;  4QL5 A;  1PH9 A;  3PUY A;  3AFQ A;  3UDF A;  2PI2 E;  1CKN A;  1KD1 C;  2R92 H;  1OXU A;  2UXB L;  4BY1 G;  2YTV A;  2Q2I A;  4EX5 A;  3WWV A;  2EXD A;  5GAG C;  3G48 A;  3HOY H;  2WFW A;  3OYY A;  2K5N A;  3W1B A;  3IRB A;  4OXP A;  3S1M H;  3J80 i;  1YIJ A;  5H1S E;  5LMU Q;  2JEA I;  4GKJ L;  4A3J H;  3HFZ B;  3EBE A;  3PF5 A;  3GTP H;  1AH9 A;  2RHS B;  2WB1 E;  4JI5 L;  4DV0 L;  1X55 A;  4KI0 A;  1Y14 B;  2ATW A;  3PO3 H;  4A3G G;  1VQL A;  2LXK A;  2VS1 A;  1GO3 E;  3FKI G;  3M4Q A;  4IPH A;  4P74 A;  2BA0 A;  3TRE A;  1VQK A;  4A3L H;  1D8L A;  1L2F A;  1K3R A;  1UE5 A;  4DUY Q;  1EFW A;  1W2B A;  2E5L Q;  2NVX H;  4LFA L;  3W1G A;  1N33 L;  4KLK A;  1VQ4 A;  4JI6 Q;  1IXR A;  1XNR Q;  2JA9 A;  4KHZ A;  3HOW G;  4YCU A;  3J81 i;  1PH3 A;  4NXM Q;  1WFQ A;  3PUW A;  2QGQ A;  2D62 A;  3I55 A;  1XMQ L;  1B7Y B;  1YBY A;  1HZA A;  4A3G H;  3STB D;  1XNQ Q;  4OWT B;  3CF5 A;  1BVS A;  3I4N H;  2VQF L;  1IZ6 A;  2FXQ A;  2JA6 H;  2DGY A;  3GTQ H;  3JAM c;  1VQA A;  2WAQ E;  3H0G H;  4UP8 A;  1N34 L;  1C0A A;  4X65 Q;  1EWI A;  4BBR H;  1YI2 A;  1YIT A;  4DAM A;  1PH7 A;  3RR5 A;  3CCE A;  4LF5 L;  1FVI A;  2IX0 A;  3DM3 A;  4MNO A;  2B63 G;  2UXD Q;  4NPS A;  2F3I A;  1X9N A;  1SFO H;  1HR0 Q;  4POG A;  4DK6 C;  1JT8 A;  1L1O A;  1HZB A;  4HIO A;  1NE3 A;  2R7Z G;  5M3F G;  1N8R C;  1J6Q A;  2JEB I;  3KF6 A;  4AYB G;  4AIM A;  3PSI A;  3CCL A;  3CC7 A;  3HKS A;  4OX9 L;  1T9H A;  3FHW A;  1HZ9 A;  4AQY L;  3TS0 A;  1CSP A;  3U4Z A;  2A19 A;  5FJ8 G;  4DR6 L;  4BBS G;  3PUX A;  2QEX A;  4DR1 Q;  4K0K Q;  2OTL A;  2JA8 G;  4QJF A;  1AE2 A;  3EIV A;  4A76 A;  4IFD G;  4B3M L;  3S16 H;  2Z6K A;  2R93 H;  4LF6 L;  4Y7N H;  1W3S A;  3K81 C;  1HNW L;  1QVG A;  2B3G A;  5IP7 G;  1OXX K;  2ZM6 L;  2YTY A;  4X62 Q;  2ZJQ A;  4RMF A;  3AYH B;  1PFS A;  3K80 C;  3NBH B;  4GNX A;  3L7Z C;  1IBK Q;  2K4K A;  4GN3 B;  2VQE Q;  1XMO Q;  3GTM H;  4B3T Q;  2N49 A;  4BBS H;  3CCR A;  5HY6 A;  1WI5 A;  3NEL A;  4GLA C;  3A74 A;  5C3E H;  1S40 A;  1JMC A;  3J7A 5;  1KL9 A;  2K75 A;  4DNI A;  4A3F H;  3PO2 G;  4JBW A;  3M85 A;  4WJ4 A;  1VQE A;  4QQB X;  4ME3 A;  5J3B A;  1BBW A;  4JCV E;  1L1O C;  2UUA Q;  1A0I A;  1S72 A;  2UXC L;  4DV3 L;  1FL0 A;  3ICE A;  1EYG A;  4GLV B;  4NXN Q;  3J80 c;  1KAW A;  4MTN A;  3OTO Q;  5C44 G;  1ASY A;  4X66 L;  2K5H A;  3S2H H;  4A3B H;  4LW1 A;  2F4V Q;  1EIF A;  1HZC A;  4A3M G;  1Y1W G;  1MKH A;  1KHI A;  2Z6K C;  3CCV A;  4A93 H;  4BXX H;  3NEM A;  4DV2 Q;  1KIX A;  1Q86 C;  1NMG A;  3I4M G;  1VQ6 A;  4R4T A;  3J81 c;  2N3S A;  1QVF A;  3J7Z C;  1QVC A;  4HJ9 A;  1E24 A;  2R6G A;  3SGI A;  5IYD G;  3I56 A;  4HIK A;  2ZTE A;  4YWM A;  4JI1 L;  4KHP L;  4GKK Q;  4JI8 Q;  5IT9 c;  1LM0 A;  1Y1W H;  5JEA G;  1K8G A;  3S14 H;  1PH2 A;  3E0E A;  1OXV A;  4DV1 Q;  4IOC A;  5IYC H;  1CUK A;  3MXN B;  4LNQ A;  3GTO H;  5K36 G;  5JJK A;  4A3E H;  2MFI A;  3M3Y H;  1X65 A;  2KEN A;  1JJG A;  2QA4 A;  1UWV A;  3B6Y A;  5C0X G;  2RCN A;  4JI0 Q;  4DAY B;  1XJV A;  4IFD J;  1QUQ B;  1MJE A;  4DV7 Q;  4LF7 Q;  2ZTC A;  3GO5 A;  2D0O A;  5IE8 A;  3BJU A;  2HIV A;  1QZH A;  1IBL Q;  2N78 A;  1IYJ B;  1G29 1;  1P16 A;  1U0L A;  1Y1V G;  3T1Y Q;  1V9P A;  5C4X G;  3GTG H;  1A8V A;  5IP9 H;  4PG3 A;  1TWF H;  4PZ7 A;  2Q2U A;  2UUB L;  2F52 A;  2UU9 Q;  4A3I G;  4EQ5 A;  1SR3 A;  4J15 A;  4QY7 A;  2KHI A;  4LFB L;  1LYL A;  3KF8 B;  4LF9 Q;  2N8N A;  4H02 A;  4ALP A;  1VQ7 A;  2VY3 A;  1HR0 W;  2HHH Q;  1YVC A;  4POF A;  1HNZ L;  2VUM G;  4DR7 Q;  4A3C H;  3G71 A;  3W5O A;  3CAM A;  4JG2 A;  4GOP A;  4BA1 I;  1XPR A;  1NY4 A;  1TWA H;  5GAE C;  5C4X H;  3PF4 A;  3K8A A;  2UXB Q;  1HNX L;  3KYH C;  1WYD A;  3F1Z A;  3M4O H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...