3KDFB

X-ray crystal structure of the human replication protein a complex from wheat germ cell free expression
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
118
Chain Sequence
HIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 14 kDa subunit
publication title X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression
rcsb
source organism Homo sapiens
molecule tags Replication
total genus 25
structure length 118
sequence length 127
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kdfB00
3DM3A 3A0JA 3J81j 3RZDH 2ALYB 3K8AA 5LMNW 4UPAA 2OTLA 1VQPA 1YIJA 1Y1WH 3E9HA 1S72A 3F2CA 1IBKL 1EYGA 5IT9c 1YHBA 3T1HQ 1IXRA 2AKWB 4YCWA 2UXDL 5JJIA 1SFOH 3AEVA 4AH6A 4A76A 2VUMH 1LYLA 1XNRQ 3HOZG 5IYBG 5LMUL 2YU9H 3U4ZA 2ID0A 2BH8A 2JA7H 2R93H 4LF8L 2MQHA 2B63G 1XNQQ 3OTOQ 4BY1H 4NXNQ 1FJGL 4BA1I 2R6GA 3HOXH 3OYYA 4HIOA 4DV1Q 4A3KH 2NVTH 1VQGA 4A3IG 2RF4A 2N78A 1YJWA 2BA1A 4JI8L 1QZGA 3KFUA 4NB3A 1K8AC 1L2FA 1YITA 4YHHQ 3CC7A 3EBEA 3OW2A 4DV0Q 4JBJA 1TWHH 4AYBG 4DAYB 5IP9G 1IBMQ 4JI7Q 1HNWL 1HJPA 1K0RA 1W2BA 4YY3Q 2ES2A 4A3BG 2Z0SA 2MFIA 1GO3E 4LUVA 1JMCA 1VQKA 2QEXA 1VQBA 4GNXB 1MIUA 3TQYA 4DV5Q 4JI4Q 1SN8A 1I94Q 2PI2E 1CKNB 2VQFQ 2JEAI 1Y1WG 4OXPA 3PGZA 2R7ZG 2JA5H 3HFZB 5FJ8H 1YJ9A 4B3RL 4KHPL 2RHSB 3PUYA 4POGA 2JA8H 2KHJA 4DR3L 2ASBA 4GKJQ 3I4OA 3PIPA 1OXXK 2R7DA 3BZKA 1OTCA 4LW1A 4HJ5A 1EIYB 4UP8A 2WFWA 3HOWG 3KF8B 5J3BA 2E5LL 1TWGH 4A3DH 1SRUA 3PUXA 1KC8C 1N33Q 1G51A 2OQ0A 4LNQA 1N9WA 1WJJA 4GOPC 1V1QA 3S1NH 4GLAC 5IYDH 3M85A 2JK8A 1XMOL 4PZ7A 4J15A 1IBLQ 4L5TA 4B3TL 1PYBA 3GD7A 2ATWA 3S17H 1HR0Q 3AFQA 2OTJA 3F1ZA 1HNXL 3HOYG 3GTJH 4OO1I 4IO9A 2E2IH 1PH7A 1WI5A 3L2PA 1GKHA 4ME3A 4GN4B 3W5OA 3H3VI 4BBSG 2CFMA 2RHQB 4IOCA 1N34L 1CSPA 1OXVA 3JAMc 4BY7H 1Q1EA 3VDYA 2K50A 5IP7H 4JC0A 2UXDQ 3NENA 1XPOA 1JJCB 5GAEC 5ELNA 3CQZH 1X6OA 4UP7A 3J80c 2E2JH 2YTYA 5LMUQ 4RG1A 4A3DG 1ASZA 1VQOA 2ZJQA 4LF8Q 5DLQE 3ER0A 1FJGQ 1BBWA 1YVCA 3CC4A 2IT1A 1SR3A 4JI3L 3M4OH 1PH5A 3AQQA 5E7NA 3JAMi 4GNXA 1B7YB 1CKNA 3BJUA 5M5YH 1N32L 4HJ7A 5IYDG 4A3EH 1EOVA 1HNZL 4JI8Q 4LF4L 1K73C 2Q2TA 4X6AH 4LF9L 4B3ML 1P16A 2E8GA 4LFBL 2KHIA 4RMFA 3CPFA 3UDFA 4A3MH 2UUBL 5GROA 1HNWQ 1VS0A 4DK6C 2HHHL 3U58A 4HJ9A 1Q81C 2A8VA 5K36G 2VNUD 1OXTA 2LXJA 3RNUA 1YZ6A 2LXKA 4O0AA 4ALPA 4JI1L 1BBUA 2ZJPA 4BY7G 4B3RQ 5GAGC 3CW2C 3M7NA 5M5XH 5IP7G 4DR3Q 3S2HH 1LUZA 3HOVH 2PI2A 3GTQH 2ZTEA 4KI0A 2EIFA 4R4CA 1NJIC 2UUAL 3T1YL 4LF7L 1X54A 3TEHB 2HT1A 2E5LQ 3CF5A 1CUKA 4HJ8A 4OWTB 3KDFB 1EUJA 2NVXH 3KF6B 2YTXA 3J81c 3UE1A 1QVCA 3S1RH 1WOCA 3F2DA 1NMGA 2FXQA 4BBRG 4XIGS 4DV7L 4LF6Q 3PF5A 5ELOA 2EXDA 1PA6A 1KL9A 1FL0A 2XGTA 4YCUA 3GTGH 2OWOA 3S14H 4IPGA 2IX0A 4B3TQ 1VQDA 1XMOQ 1KQSA 1CKMA 3S1QH 5IE8A 4EQ5A 3ULPA 4A3MG 4BA2I 4GN5A 3PUWA 1Q82C 3J81i 3E0EA 4GKKL 4YWLA 2NN6G 1SLJA 2PQAA 3W1BA 3CAMA 1VQ5A 5C4XH 1LM0A 1HZCA 5LMNL 1HNXQ 1N36L 1TWFH 3BZCA 1KXLA 5C3EH 1N34Q 1AH9A 4DR6L 4IPDA 3I56A 1NTGA 5C44H 1TXYA 2Q2IA 5C4JH 1K8GA 4IJLA 4QGUA 4LWCA 1E3PA 3FKIG 5FLMG 4A3FG 3PUZA 4BXXH 2HIVA 2UXCL 4C3HH 4DV3L 5HGQA 4GOPB 2HQLA 3PO2H 2D62A 1G291 1E22A 3K7AH 3PF4A 2MO0A 2ZM6L 2YYZA 2YTVA 1PH9A 5IWAL 3EN2A 3HKZE 3TS0A 4JI3Q 4AQYL 4DUYL 1VQAA 1LTLA 1S3OA 2ZJRA 1VQFA 3CCRA 1N32Q 1HNZQ 4AIMA 4A4IA 4LF9Q 4B3MQ 3CCUA 4JYAL 4LFBQ 4O2DA 3STBC 2UUBQ 4A3LH 2A19A 2VUMG 2D0PA 2UU9L 1VQJA 2HHHQ 2JA7G 2R93G 1TWAH 4OONA 1L1OA 4L5SA 4DV2L 5C4XG 4JI7L 2ZTDA 4BY1G 3KOJA 3HOUH 3HOXG 4X65L 1PH2A 3I4MH 1B70B 2WB1E 4P75A 4A3KG 2AMCB 3G6EA 4H02A 2N8NA 4JI1Q 1Q12A 1MJEA 2AHOB 3PO3H 5C44G 2GN5A 2CWAA 5H1SE 3S24A 2JA6H 2WAQG 1EQRA 4Y52H 4BXXG 1I3QH 4TVAB 2B29A 1FGUA 1QUQB 1UE6A 3K0XA 4GLVB 4R1JA 3HKZG 1HZBA 5IY0A 4HIKA 2UUAQ 2Z6KC 3T1YQ 4LF7Q 3PO2G 4K0KQ 4DR7L 1R9TH 4LF5L 1KRSA 4X62L 1VQ6A 3I4NH 1I50H 3G4SA 3CCVA 1Q86C 1VQIA 3TRZA 1QZHA 4WJ3M 2DGYA 4DV7Q 1ASYA 2MO1A 4A3JH 2JA5G 1UE1A 5FJ8G 4LUZA 3I55A 5IYCH 1IBKQ 3CC2A 2JA8G 1NY4A 1D7QA 5M3FH 2YV5A 2B3GA 2C35B 4R4QA 3GO5A 4DKAC 4PZ6A 4X66L 2L15A 3A5ZB 1KHIA 1XTDA 3K81C 4DR5L 4JI2L 4UY8C 3GTLH 5JJKA 4GKKQ 3S15H 1XJVA 2WB1G 3K7UC 1BVSA 1PH6A 4TQUS 1KRTA 3A5UA 5LMNQ 1GVPA 3U4VA 1K9MC 2N49A 3HOUG 2UUCL 1N36Q 2N3SA 4QQBX 3I4MG 2IY5B 2NN6I 4JBMA 1NMFA 3I2ZA 4A3CH 4A3GH 5M3MH 2H5XA 2Y0SE 1XPRA 1X3GA 4DR6Q 5BR8L 2CCZA 3RN5A 4IFDG 4MNOA 3NELA 3ERSX 2JA6G 3J80i 4JOIC 3W1GA 4A93H 1PH1A 1PV4A 1YBYA 2ZTCA 2OQKA 1QVFA 2UXCQ 4IPCA 2KCTA 4DV3Q 4HIDA 4MTNA 2MNAA 1H95A 1PYSB 1YNXA 1VQ8A 1X55A 2LSSA 2IHFA 3MXNB 4DK3C 3J7ZC 2Q2UA 2ZM6Q 1PH8A 5IWAQ 1Q7YC 1E1OA 3H3VH 4DPGA 2HIXA 4P72A 4JV5L 4DUYQ 3ICEA 4KHZA 1W3SA 1Z9FA 3CCJA 1EFWA 1E7ZA 5IYCG 1V43A 4KHPQ 4DR2L 4JBKA 4OX9L 1Q1BA 2V1CC 4JYAQ 4DR4L 2CKZB 1M90C 1U5KA 1C7YA 2VQEL 1P8LA 1X65A 4GKJL 5AJ3L 3NBHB 3PSIA 2QA4A 2IX1A 1A8VA 2UU9Q 3RZOH 3ZJYC 4JBWA 1XMQL 2AWOA 2A1AA 5JEAG 3H15A 4DUZL 2Y0SG 4DV2Q 1JJ2A 3CMAA 1HR0W 4JI0L 3PIOA 3HOZH 4X65Q 4JCVE 3ULLA 2WP8J 1VCIA 4A3CG 4R4OA 4A3GG 5M3MG 1EIFA 4DNIA 3CXCA 1TWCH 1V9PA 4A3EG 1JB7A 1KD1C 1YI2A 4IFDJ 1YEZA 1B8AA 1CKOA 1VQLA 1KAWA 1OXUA 2E2HH 4LFAL 4A93G 3KLWA 3CMEA 3J7A5 1WCMH 1VQNA 3D31A 3G71A 4DR7Q 1MJCA 4LF5Q 4X62Q 1E24A 1SROA 4POFA 4A3BH 3I7FA 1GD7A 3H0GH 3PV0A 4JI5L 2Q2HA 3RLFA 2CQOA 5GADC 3M3YH 1OXSC 2F3IA 1U0LA 1SE8A 3CCSA 1I5FA 3LGJA 3UDIA 5JJLA 3WWVA 4IJHA 3AFPA 3S16H 2R7ZH 1K3RA 3B6YA 1VQCA 4MZ9A 4PMWA 3HOVG 4X66Q 3MEFA 2UXBL 4L5QA 3CD6A 2D0OA 4JI2Q 1Q8KA 4DR5Q 2I5LX 2K5HA 3D0FA 3A74A 3M4PA 4B3SL 2WAQE 2NZOA 1WYDA 1KIXA 2NVYH 5JEAJ 1GM5A 1YJNA 3FP9A 3PUVA 1YHQA 2UUCQ 3HOWH 4KLKA 5GQOA 2EQSA 5C0XG 3CCMA 3IRBA 1VQ9A 3RLOA 3CCLA 1VQEA 1O7IA 1UE5A 1CSQA 1PFSA 4OWXB 1PH4A 3EIVA 2K5NA 5BR8Q 3CP0A 3GTKH 4X64L 4LF4Q 2R92H 4DR1L 4C3JH 1L1OC 3GTPH 1RIPA 1A0IA 1VQHA 3TREA 1AE2A 1N8RC 4IFDI 1WCMG 3Q8DA 1I6HH 4FDBA 1J5EL 3NEMA 3KDFA 2R7FA 1S40A 3KF6A 4GLXA 4XTCS 2NZHA 3H0GG 4DV4L 4JV5Q 5C3EG 3FHWA 3HOYH 1X3FA 4LFCL 1M1KC 2KENA 1L0WA 3UDXA 3UDGA 4BBSH 4DR2Q 4JI6L 1Q46A 1UEBA 3F2BA 4NXML 4OX9Q 1JJGA 1JE5A 3S2DH 2F4VL 4DR4Q 1A62A 2PNHA 2VQEQ 2K14A 4C3IH 2BH2A 5AJ3Q 1HZAA 2VZAA 3F8TA 1PHJA 4DV6L 1E1TA 3L7ZC 2XTIA 2K4KA 1XMQQ 3E9IA 3RR5A 4DUZQ 2NVQH 1Z47A 4JI0Q 1AE3A 1HH2P 1NE3A 3KJPA 2JEBI 1IZ6A 3M4QA 5EAYA 4DAMA 2K5VA 1X56A 4NPSA 5C0XJ 1C0AA 4A75A 4YWKA 1WFQA 4PG3A 4LF6L 2R92G 3GTMH 4C2MH 4P71A 4GN3B 4PZ8A 3RLNA 3PCOB 4LFAQ 3T1HL 1VQ4A 1Y14B 4JG2A 4A3LG 1YHAA 4HJAA 3DLLA 4QIWE 3CCEA 4GNXC 1G6PA 2I5MX 4GOPA 3CCQA 2I5HA 3AYHB 2BA0A 3M9BA 4P73A 4APVA 1XNRL 1UWVA 1Y1VH 1XPUA 2GVAA 5FLXc 1XNQL 3OTOL 4NXNL 4JI5Q 4L5RC 3TS2A 3PO3G 1SMXA 2Z6KA 4DV1L 2K52A 1FVIA 1BKBA 4QJFA 1JT8A 1EQQA 1RL2A 3UE0A 5GAHC 3G48A 4R4TA 4GS3A 2UXBQ 2F52A 4YHHL 2GVBA 4IPHA 4DV0L 1DGSA 2VL6A 1T9HA 1IBML 2AWNA 4B3SQ 4IOAA 2PQAB 2CWPA 4R4IA 1C9OA 3I4NG 4QY7A 4EX5A 4YY3L 2VW9A 2VS1A 1IL2A 2OCEA 4AQYQ 4HIMA 4A3JG 1A63A 1J6QA 2JJQA 4DV5L 4JI4L 1I94L 4QL5A 2JA9A 2VQFL 5M3FG 4BBRH 1PH3A 4X64Q 2DUDA 3ULJA 5C0XI 3GTOH 3KYHC 4DR1Q 1HZ9A 4OWWB 3SGIA 1IYJB 2RCNA 3U50C 1QUQA 2IHEA 3JC66 3RN2A 4UP9A 2PMZE 3GDEA 4YCVA 2JE6I 4Y7NH 1X9NA 3KJOA 1J5EQ 2I0QA 1Y1VG 4JOIA 5IYBH 4WJ4A 4DV4Q 1UE7A 1N33L 2B63H 2KBNA 1PVOA 4LFCQ 3BU2A 1X3EA 3L0OA 4P74A 3STBD 3CPWA 4YWMA 2K75A 1EWIA 4JI6Q 4NXMQ 5M5WH 1MKHA 5HY6A 4A3IH 2F4VQ 1NBWA 1VQMA 3HKSA 1D8LA 1QVGA 1IBLL 4A3FH 3FKIH 5FLMH 1HR0L 3S1MH 4LUOA 4DV6Q 1VQ7A 5IP9H 4OO1G 2JQOA 3K80C 2VY3A 1L1OB 2KCMA 1K83H 4K0KL 2QGQA 4AYBE
chains in the Genus database with same CATH superfamily
3DM3A 3A0JA 3RZDH 4N9TA 5BN5A 1VQPA 1I4XA 5IOCA 1Y1WH 3E9HA 5LL6S 3VR6A 2ICIA 1JQYD 3I70A 4YCWA 5KGUA 2A69C 1LYLA 3HOZG 1LACA 2YU9H 2JA7H 2ID0A 2BH8A 1LV9A 3FDTA 3OTOQ 2DNCA 3WOEA 2Z4HA 3OYYA 4HIOA 1VF5C 4DV1Q 2E2HB 1B3AA 1RDPD 3P7JA 4A3IG 1WCMB 1ET6A 1QZGA 4NB3A 4PV1C 4A3BB 3OW2A 4DV0Q 4AYBG 1TWHH 3NBHA 1IBMQ 3M3YB 1BCPD 1W2BA 4YY3Q 3EA6A 5A2QL 2MFIA 5DEHA 1GO3E 1X32A 2R7ZB 3TQYA 1SN8A 2PI2E 3PIO3 1Y1WG 1SFOB 5FJ8H 1D5MC 1YJ9A 2RHSB 3PUYA 3A7LA 2ASBA 5D65A 1OXXK 2D2CC 2F4IA 4DAVA 1SDFA 1KNAA 5CGKA 2E5LL 1TWGH 4A3DH 1XX8A 1SRUA 3GP7A 3PUXA 1KC8C 2OQ0A 4LNQA 3H94A 4CHTB 1SMYD 3S1NH 1V1QA 3VR5A 1I6HB 5IYDH 5LL6X 1DZ1A 3M85A 4PZ7A 3O13A 1H9MA 5CR3A 3GD7A 3S17H 1HR0Q 5EPJA 1BO0A 1UEAB 3AFQA 3HOYB 1EU4A 1PXUA 3QJYA 5KEEA 1C4QA 4FF4A 3GTJH 1CZGA 4OO1I 3L2PA 3H3VI 5JVH3 4ME3A 4BBSG 3VR4A 2NYZD 5T1IA 1F2ZA 2K50A 1SYEA 5ELNA 5FKAC 5CBAE 3CQZH 5L37A 3KBGA 1LTSD 2SOBA 1KDAA 4A3DG 5JEAH 4PQXA 1PRTC 1BUVT 1YVCA 3U9SA 1I4PA 2IT1A 4JI3L 5IGGA 1CA5A 3M4OH 2KCNA 1KAAA 3JAMi 1B7YB 1D6EC 5M5YH 2PO4A 2F0FA 5IYDG 5JVG3 1K73C 4X6AH 4LF9L 3MFYA 1RODA 3MHBA 3UDFA 3E3XA 1QNKA 2EYLA 3JAML 4DK6C 2NN6H 4HJ9A 2A8VA 3P20A 3J7YW 4XQNA 5T1GA 3J80L 1NAPA 2B8GA 1DJRD 1GXDC 3S2HH 2WV6D 3TN2A 2ZTEA 2EIFA 2UUAL 1NJIC 2P5ZX 4KY5A 3T1YL 1EYDA 3TEHB 5CBEE 1J9OA 2E5LQ 3CF5A 2A6HC 4FF2A 5FO7B 1NMGA 4UHVA 4BBRG 4XIGS 3G7LA 1DCZA 1NSNS 1FL0A 2XGTA 2OWOA 1ESFA 5I2XA 5IE8A 4EQ5A 1FNUA 5CV6A 2EY5A 1BNZA 2H1EA 3PUWA 2EZVA 2NN6G 1SLJA 3CAMA 4N8FA 1H9RA 5C4XH 1LM0A 1HZCA 2IJ0A 1EWHA 2F0NA 3VA5A 1KXLA 1FNWA 2F0OA 3FKIB 1NTGA 5C44H 4LWCA 1E3PA 3PUZA 4BXXH 3QWNA 2UXCL 3RZDB 3PO2H 2D62A 1WD1A 2NBFA 2ZM6L 1Y1WB 1KLGD 1PH9A 4JI3Q 3CCRA 4V0BA 4XYOA 4LF9Q 2YU9B 2JA7B 4O2DA 3K5OA 1JWUD 4A3LH 5C5MA 1VQJA 4KTAA 2R93G 5C4XG 1TWAH 5I2YA 4DV2L 3OMCA 4BY1G 1IYVA 2B2UA 4X65L 1PH2A 2F0IA 4H02A 1CTMA 2N8NA 1Q12A 1MJEA 3PO3H 5C44G 2KOLA 1D1IA 1EQRA 1ESRA 4BXXG 2C9OA 1UE6A 3K0XA 2B2YA 3LX0A 3PQIA 5IY0A 4HIKA 1GUNA 2UUAQ 3T1YQ 3PO2G 4K0KQ 1R9TH 4X62L 1VQ6A 4C56C 3I4NH 3G4SA 4HR7B 1Z6HA 4ILWA 1QZHA 3R2IA 4A3JH 1UE1A 4L63B 1IBKQ 5IYCH 2JA8G 1LTGD 2M9VA 4DKAC 4ZLTF 1TWGB 4X66L 1XTDA 3K81C 4JI2L 3GTLH 3I4MB 2HUGA 1ENFA 2ZXPA 3C1EA 1Q90A 4KY6A 4TQUS 5J39A 3S1NB 2MPMA 4DN4M 2PQEA 4RHRA 4JBMA 1NMFA 4A3CH 1TR5A 5M3MH 3S17B 5CYUA 1X3GA 5FK9C 2KJXA 3RN5A 3NELA 1GOZA 2OQKA 1EYCA 2UXCQ 3GTJB 4IUTA 3IFTA 1PYSB 4DNTB 1YNXA 1XYIA 3J7ZC 3VYSA 2Q2UA 2ZM6Q 1U4MA 3FEWX 4HAEA 2LMCB 5JPNC 1Z9FA 5IYCG 1V43A 4DR2L 2V1CC 1QNUA 1U5KA 1P8LA 1ICFB 1X65A 2K5WA 2OXPA 4GKJL 2Y0SB 1S5BD 1HPCA 3PSIA 2IX1A 3M4OB 3ZJYC 3M7NA 2AWOA 2A1AA 4DUZL 5I6WA 4DV2Q 5M5YB 3PIOA 4X65Q 2WP8J 4RHSA 4A3CG 2D9UA 3WOFA 4F7XA 4R4OA 4RAUC 5M3MG 3C2PA 1EIFA 1XTCD 3J81E 1JB7A 1A3VA 2JSOA 1LT4D 1PTOH 2K6AA 4X62Q 2F0SA 1WD0A 3NSWA 1GD7A 2K04A 3PV0A 3S2HB 1QB5D 1O80A 2Z9HA 1I5FA 3W3AA 1K3RA 4IUNA 4QCLA 3HOVG 2F03A 3ERQA 1JORA 4X66Q 2UXBL 2D0OA 4FYDA 4JI2Q 2FMCA 2JXMB 3D0FA 2WAQE 1B9MA 3HOWH 1JICA 1YHQA 4KLKA 3TP5A 1STNA 2EQSA 5C0XG 3CCMA 1FGBD 3BVZA 2K5NA 4X64L 3GTPH 4RA8A 1A0IA 1VDZA 2B2WA 3MFGA 2A73B 5C4XB 1OO9B 1AE2A 4IFDI 3Q8DA 5G3LD 3KF6A 2DJGC 4X3KA 1TQOA 4XTCS 1QE6A 1M1KC 1L0WA 3A8KE 3R93A 4DR2Q 1JJGA 1Q46A 3F2BA 2EPBA 1SNDA 2CH4W 2F4VL 1TS2A 2PNHA 1RCVD 2XWJB 1HZAA 1M4VA 2VZAA 3E5SA 4RGOS 1TU2B 4DUZQ 1EY9A 4ULLA 1AE3A 3CU7A 3M4QA 1H9SA 3T16A 5IIFA 1QG7A 4YWKA 4LF6L 4IQZA 3GTMH 3OIPA 4PZ8A 2SDFA 4GN3B 4FXDA 1BDOA 1TWAB 3NTKA 4WFN3 1D5XC 2R61A 1YHAA 3DLLA 4QIWE 1G6PA 4GOPA 1ILPA 4OEMB 3I73A 3AYHB 2BA0A 3PO3B 2PZUA 1Y1VH 5FLXc 1XNQL 4KY7A 4NXNL 1PZJD 4DFAA 1WTOA 3VA7A 1LABA 1FVIA 2LY7A 5FLXE 4KK7A 1RL2A 3OPOA 3G48A 1M8AA 1R9TB 2UXBQ 2NVQB 3I4NB 3QIAA 2GVBA 3R2TA 5FOBB 1DGSA 4A3JB 4QY7A 3DHQA 4LJZC 2O4XA 1SE2A 2G9HD 2A6EC 1ICWA 4C2MB 1J6QA 2X6GA 3X3NA 2JA9A 5CORA 5M3FG 3GTLB 4X64Q 3ULJA 3GTOH 1Q3LA 4H44C 5EBCA 1R4QB 3U50C 3JC66 4O42A 3NTHA 4UP9A 4YCVA 4CJ2C 3KJOA 3TBIB 1Y1VG 1EU3A 1IW7D 3Q22A 1PVOA 3BU2A 1CT1D 3STBD 3CPWA 4CGYB 4K5XA 5ELDA 1Z7TA 2F4VQ 2WACA 1D8LA 1IBLL 4A3FH 1GUTA 1HA5A 4OO1G 2RDGA 2VY3A 1L1OB 2L9HA 4XYQA 1S5CD 1CHQD 3F2CA 4RH6A 1PTOD 1TT2A 1YHBA 1HCZA 5JJIA 1SFOH 3NTIA 3AEVA 1SYCA 1STGA 3SXHA 5LMUL 1K28A 2F0KA 4IUUA 2F3VA 4G4KA 1XNQQ 4NXNQ 2B2VA 3HOXH 3A56A 1X3QA 2NVTH 4KJNA 2L0CA 1SYGA 5C5LA 1YJWA 2BA1A 3T51B 4F88A 4PMBA 1L2FA 1AFPA 1LTID 1RKNA 4JBJA 3IL8A 4DAYB 5HGTA 1HJPA 1SSOA 2ES2A 4A3BG 2Z0SA 4Z9CB 1U9RA 1JMCA 2QEXA 1VQBA 4GNXB 1MIUA 4KD4A 2L55A 1UAPA 3K5NA 2R7ZG 4B3RL 1AEXA 4LK1C 5G3LF 1A3UA 2KHJA 3HOWB 1PMRA 1T5EA 2R7DA 3LWEA 4H7BA 4LW1A 4HJ5A 2GA4B 5CV5A 3V2TA 3D4DA 1YNNC 1EY7A 5C6AA 1G51A 3K58A 3GTPB 3DWQA 1WJJA 2IX3A 1S5DD 1PLFA 4G7ZC 4GLAC 3Q24A 1IBLQ 1XMOL 2XVSA 3SK6A 2PPBC 3I8ZA 1PZKD 1HNXL 3HOYG 3TSSA 4RGTA 1RTOA 1GKHA 2AQ1B 1N34L 3W2DA 1JCKB 1G91A 1CSPA 1OXVA 3JAMc 1BR9A 1Q1EA 5IGEA 1W6JA 5IP7H 3SE0A 2D5DA 2EXZA 1XPOA 3I72A 4TRDA 1L0YB 3JAME 4UP7A 3J80c 5LMUQ 5CC4A 1B9NA 2ZJQA 3GTMB 3KLRA 2HDMA 3ER0A 1ZYRC 1SR3A 4GNXA 5I9OA 3BJUA 1N32L 1DYQA 4K2LA 2WINB 1BBXC 4LF4L 3D3RA 4RMFA 1Y1VB 2UUBL 5GROA 2KVMA 5I6YA 3PIP3 1HUMA 1WTHA 5K36G 2XRQD 2FFKB 2LXJA 2A68D 3NQIA 3RNUA 1HTLD 1YZ6A 2LXKA 1LTBD 1IYUA 2EY2A 2RSOA 3BDLA 4OELB 5GAGC 5JJZA 5JOBA 2ZJPA 4B3RQ 1DD2A 5IP7G 3ONAB 2SNSA 4DGZA 4R4CA 1JB3A 1X54A 2HCIA 1CUKA 4HJ8A 3KDFB 4X3SA 3GTOB 3S1RH 3I90A 1C48A 3K5LA 4KHVA 2EXDA 4M8AA 1KL9A 2KA7A 4IPGA 1U4LA 2TSSA 1VQDA 1XMOQ 1GUOA 3KLSX 1CI3M 4BA2I 1PZID 1SNCA 3W1BA 1HNXQ 2CW0C 3MC0B 1G2TA 1PTOF 3OHXC 1VMCA 3M7GA 5E1FA 3BZCA 1YNJD 1E2ZA 4A3FB 2CVRA 1N34Q 3MXUA 1EY6A 1K8GA 4IJLA 1RJTA 2L4NA 3FKIG 2XNAC 3SEBA 4G7HC 2HIVA 1RHPA 4ZUIA 5CV4A 5HGQA 3NP8A 3Q0AA 1JOQA 2G5DA 1G291 1E22A 1F9SA 3WDNA 3PF4A 2YYZA 1QCBD 2G9DA 3EN2A 5KYIA 4AQYL 2RBMA 3IFDA 4R8IA 1S3OA 4XT1B 3H3VC 1N32Q 3D6CA 5I9PA 4A4IA 5C3WA 4N9PA 2UUBQ 3DMUA 4UAIA 2A19A 1TWFB 2D0PA 3HOXB 2JA7G 4OONA 2NVTB 2X6LA 2E74C 3MZ5A 3I4MH 3NWSA 1KLUD 1WTXA 1PRTB 3OWEB 3S24A 4IFDH 2A5HA 1BQQT 2JA6H 1I3QH 3K7AB 1Y8PB 2SNMA 1HZBA 4LF5L 1SYDA 1QOHA 1QILA 3TRZA 4XDXA 3T13A 2FINB 2DGYA 3FPUB 3D6WA 4WJ3M 4ZKBB 3MXPA 2VXWA 5FJ8G 3SHLA 3CC2A 3NE5B 2B3GA 4R4QA 3P75A 2QILA 1F77A 4IUPA 2M00A 3SR1A 2EY6A 5JJKA 1E0BA 3S15H 2KECA 2KEEA 1PH6A 5BN3A 1PFNA 4ZCKA 1K9MC 4E6IA 2UUCL 3TZUA 3I4MG 4NDXA 1BCPC 4A3GH 1DM0B 3HS0C 2H5XA 2Y0SE 2QDBA 3NK9A 4PMCA 4IFDG 2XSCA 2JA6G 2CHBD 3J80i 4JOIC 3W1GA 3Q6SA 1L0XB 1PV4A 1YBYA 2ZTCA 1I50B 4MN3A 4HIDA 1CFMA 1IKMA 1PDQA 2IHFA 1E1OA 1B2TA 4P72A 3K57A 4X3TA 4JV5L 4DK1A 1EFWA 3MAQA 1EL0A 2PZWA 4JBKA 4OX9L 2VB2X 1EEID 3DXJC 5E4XA 2CKZB 2TMPA 1SMYC 5AJ3L 2ZXOA 3RZOH 5JEAG 2Y0SG 3CMAA 1HFGA 2FJ2A 4A3GG 1SXTA 5D3IB 4DNIA 3CXCA 1V9PA 2IW3A 3KBXA 1CA6A 1YEZA 1B8AA 1CKOA 1JR0D 1KAWA 1Y8OB 1ET9A 3J7A5 2DJFC 1VQNA 3G71A 4LF5Q 2BE5D 2FHTA 1BOSA 4JI5L 2CQOA 5GADC 3CCSA 1SE8A 3LGJA 5C3XA 1WTPA 3S16H 5EKIA 1VQCA 4MZ9A 2EY1A 3MEFA 3CD6A 1Q8KA 1SYBA 2K05A 2ZXRA 3OMGA 4QMGA 5J1ZA 1K8OA 3S1RB 1G2SA 1KIXA 2F3WA 1GM5A 2UUCQ 1TY2A 3ZYYX 2VB3X 4JVZA 1SBBB 2F0MA 1O7IA 1CSQA 3EFXD 2Q8IB 4CBVA 2V4DA 3CP0A 2JYOA 3NHHA 3I3CA 4C3JH 1VQHA 2B2UC 3TREA 1N8RC 3AU7A 4IALA 3K6OA 1F2YA 2A74C 1J5EL 2R7FA 2NZHA 4JV5Q 4LFCL 4U68A 2IWHA 2B2YC 1UUPA 2L1BA 4OX9Q 3RD4A 1A62A 1EWCA 2NVYB 5AJ3Q 4CDEC 3F8TA 5K5PA 1IHZA 1E1TA 4IUQA 2XTIA 1SE3A 2NVQH 4QUFA 1PYWD 3BVGA 1WTVA 5EAYA 4RKLA 4N8X1 3DEOA 2QEJC 3MVVA 5HURA 4C2MH 1IL8A 3RLNA 2K1BA 4A3LG 4H13C 1ZXTA 2I5HA 3M9BA 4P73A 1STHA 4QUCA 1F9PA 2GVAA 3S2DB 2JA6B 1B53A 3HRZC 4JI5Q 3PO3G 1I3QB 2K52A 3CKIB 1EQQA 2H4OA 2F52A 4YHHL 2EJMA 2VL6A 4K2KA 1HQRD 2PQAB 1C9OA 3I4NG 4EX5A 1S5FD 2F0EA 2OCEA 4HIMA 4A3JG 4V190 2I07B 4JI4L 4HTHA 4IZ8A 2VQFL 3IKJA 3S15B 1EEFD 3KYHC 4OWWB 1I4HA 2RCNA 1V1OA 2LFNA 2MGSA 4Y7NH 4ZAIA 1X9NA 4A3GB 1J5EQ 2I0QA 5IYBH 1LT3D 3D4RA 1N33L 2KBNA 4LFCQ 1X3EA 3OOCA 3L0OA 5D14A 1ILQA 1EWIA 1MKHA 2EJGC 2EYFA 4IUVA 2WIIB 2L12A 4LAAA 5I4DA 2XIWA 1VQMA 3HZXA 4U673 5FLMH 5KYLA 3SK4A 1SNOA 2JQOA 4MIUA 2KCMA 4DU9A 2QGQA 1DOKA 2HDLA 2ALYB 3K59A 5LMNW 4UPAA 1EIHA 5JPMC 3BS1A 3RZOB 1KNEA 3MA2B 1XWEA 3M4YA 1SYFA 2AKWB 1VMPA 1Y69U 3D4WA 1JC7A 2B63B 3URYA 2VUMH 1G8ZD 4R8NA 5IYBG 3U4ZA 4LF8L 2MQHA 1QWYA 2B2WC 1RF2D 1NNXA 3DWPA 3R8BA 2HD3A 4A3KH 1CHPD 2N78A 3KFUA 4HCEA 4JI8L 3K5MA 1YITA 4YHHQ 1EOTA 1HNWL 4J6HA 3U9OA 5IT9L 2J4XA 1WVLA 3S16B 4LUVA 4JI4Q 2K5DA 3SVMA 2VQFQ 2K28A 3PGZA 2JA5H 3K0YA 4KHPL 1F9QA 4ZYSA 4GKJQ 3I4OA 1OTCA 1EIYB 4XXEA 4UP8A 3HOWG 4FXKC 4J8QA 1B50A 4RKBA 1N33Q 4C3JB 1N9WA 4HMIA 1IKLA 2QDLA 4GOPC 1CZWA 2JK8A 4B3TL 2ATWA 5DNFA 1BF4A 2J0TD 5CV7A 3H6MA 3F1ZA 3R3OA 1GUSA 1EYAA 2E2IH 3W5OA 4IOCA 2O5JC 4BY7H 3VDYA 1FR3A 1JJCB 1LO5D 1FYCA 5IODA 4Q0FA 1ASZA 3I4LA 1VQOA 2DN8A 5DLQE 4H0LC 4LF8Q 1BBWA 3CC4A 1PH5A 5E7NA 4ID6A 4Q5VA 4HJ7A 2EYOA 4A3EH 1HNZL 4DNRB 4JI8Q 2Q2TA 1ENAA 3CRKC 1HTPA 4B3ML 4LFBL 2KHIA 2L5TA 4A3MH 1HNWQ 4L8JA 3KK7A 2F0HA 2HHHL 2JP1A 3U58A 2VNUD 1OXTA 4NW2A 4O0AA 1KDBA 1J8IA 1BBUA 4BY7G 4TKOB 4XT3B 2DNEA 3GTQH 4KI0A 4LF7L 2HT1A 2F1MA 4OWTB 1EUJA 3GV6A 1WTQA 1WOCA 2FXQA 4DV7L 1GHJA 4LF6Q 3A54A 5ELOA 2XRSD 4YCUA 4Y7NB 4B3TQ 1CKMA 4S3SA 3ULPA 4EQPA 4A3MG 1S4ZA 4GKKL 3J81i 5A2QE 2OF1A 5CV9A 1B3QA 5LMNL 1N36L 1KDCA 1TWFH 3EQLC 5C3EH 2E76C 4IPDA 3I56A 1TXYA 1Y8NB 1NR4A 2Q2IA 3J81L 4KN7C 4A3FG 2F0TA 2PYKA 1MSGA 4DV3L 2HQLA 2PNRC 1BXTA 3K7AH 2CQAA 2YTVA 2OEOA 4G57A 1VQAA 1LTLA 4DA2A 1EQTA 1SJHD 2ZJRA 1K8MA 5EJWA 3FMCA 1HNZQ 2WKCA 4AIMA 4B9WA 1IW7C 4B3MQ 3CCUA 4LFBQ 2VUMB 3STBC 5IGBA 2QKIC 2UU9L 2HHHQ 4A3KB 1L1OA 5IGCA 4JI7L 1D2BA 2ZTDA 4FP5D 3KOJA 4L6TB 3HOUH 4NP5A 2RQXA 3HOXG 1B70B 4P75A 3G6EA 2AHOB 2RDHA 3C46A 2GN5A 3QG1A 4C3HB 2CWAA 1O7ZA 1CM9A 5IGDA 5H1SE 1KTKA 2F0VA 1F9RA 1FGUA 1QUQB 4GLVB 4R9WA 2Z6KC 4LF7Q 1PTOC 1I4QA 2ENBA 2KEDA 2JA5B 1I50H 3E6ZX 3MEHA 3CCVA 1VQIA 2RA4A 4DV7Q 5C4HA 5D3DA 4BWGB 4LUZA 5COYA 1D7QA 2WB1B 4PZ6A 2L15A 5NUCA 4DR5L 4DAYA 4GKKQ 3K7UC 1BVSA 1MBYA 2BDNA 4CKCA 3A5UA 5LMNQ 2XWBB 1EFID 2N49A 3HOUG 4C1NI 3NQTA 1N36Q 4QQBX 4WORA 4EQNA 3J80E 2DY7A 3N52A 1I4GA 2Z6BA 4IN3A 2CCZA 2A69D 3ERSX 4NMZA 1PH1A 1AW7A 5DM63 2NUCA 4IPCA 1LTAD 2KCTA 4OL7A 4DV3Q 2NZ1D 4ODGA 3X3MA 2E2IB 1MGSA 1VQ8A 3MXNB 3G6JB 3OW7A 3AMUA 4DPGA 2HIXA 4KD3A 4BY7B 3ICEA 4KHZA 2EVBA 1E7ZA 4K6LA 3RUZA 1A6XA 2CH4A 2KUMA 5FLXL 2VQEL 3BZDB 4ABNA 3NBHB 4K8IA 2UU9Q 1MHWC 4PNYA 3H15A 4RGNA 1JJ2A 3QR8A 4JI7Q 3HOZH 5EQ0A 4A3EB 1PFMA 2K5QA 2F0JA 1E2WA 4A93B 1TWCH 4A3MB 1YI2A 4KJOA 3UI2A 1AZQA 1VQLA 1OXUA 3KLWA 3LNNA 3CMEA 1EY8A 2B2TA 3TMEA 3D31A 4ZKCB 3RMHA 4POFA 2I46A 2K33A 3H0GH 1VF7A 3RLFA 2Q2HA 1HFNA 1A3TA 1SEBD 2F3IA 2QW7A 3GTQB 3UDIA 3WWVA 4IJHA 3AFPA 4EGVA 4PMWA 1STAA 3TZDA 3BYYB 2AUKA 4DR5Q 2I5LX 3A74A 3M4PA 3TP6A 4B3SL 4IURA 2NVYH 3MXNA 4JK1C 3FP9A 3PUVA 2WKDA 3BDCA 5GQOA 3IRBA 1VQ9A 3RLOA 3CCLA 1KABA 1EY0A 1PH4A 1PFSA 2EJFC 4LF4Q 4KKSA 3DEPA 2EYMA 2A68C 1RIPA 3A7AB 3H09A 3QB3A 4B9XA 1PRTD 2RDFA 3T53B 5C3EB 4FDBA 4KV6A 3NEMA 3V96A 2EE1A 3KDFA 3ND9A 5DM73 1S40A 1Q8IA 5KRUA 3H0GG 1II3A 4DV4L 3FHWA 1F2MA 1T5XD 1GUWA 2KENA 3UDXA 3UDGA 4BBSH 3S2DH 4I7AA 3SK8A 2VQEQ 2K14A 1BCPB 4C3IH 3FRPB 5FO8B 1G6ZA 3VYRA 1PHJA 5KIXA 5JAVA 2K4KA 3NPPA 2PW7A 1WTRA 1Z47A 2NTSA 1HH2P 1NE3A 3GTKB 4K8JA 2F0QA 3F2UA 4RWSC 2R92B 1RTNA 4DAMA 5C0XJ 1X56A 4NPSA 1C0AA 4CDCC 4O1NA 3PCOB 3T1HL 1VQ4A 1YNJC 2A6HD 1Y14B 4JG2A 3HOUB 4HJAA 3CCEA 1W6KA 3CCQA 1HXYD 2K01A 4ME5A 4BS9A 3S9WA 5J22A 1XNRL 1UWVA 1XPUA 3NUCA 3TS2A 1SMXA 1BKBA 1JT8A 2O2LD 4M1UB 3UE0A 5GAHC 1EY5A 2EYJA 4GS3A 4C3IG 1I4RA 1F2LA 1HUNA 4B3SQ 2IL8A 4IOAA 4R4IA 5KNDA 5E4WC 4DF7A 2VS1A 2VW9A 4AQYQ 3HG9A 2Q8RE 3L3OC 4DV5L 2RVLA 2KCCA 1I94L 4BBRH 1PH3A 2DUDA 4G7OC 4RGMA 3OIQA 1AN8A 2O5IC 3C3LA 3L9AX 2IHEA 3RN2A 3GDEA 1RD9D 2JE6I 5AFWA 4CJ0B 2BDOA 2AUJD 4JOIA 1ZEQX 2X69A 5KNCA 4DV4Q 1UE7A 2B63H 4KMUC 2Z1CA 4P74A 3NXWA 2K75A 4DXFA 5HY6A 2L11A 4FF1A 1XXGA 3J7AV 3HKSA 3FVQA 4LUOA 1VQ7A 5IP9H 4RCOA 1ENCA 1CQVA 1K83H 2NB0A 4K0KL 1MI2A 1PFBA 3J81j 2PMZB 3K8AA 2OTLA 3I91A 5LHY1 1GUGA 1V1PB 1MD2D 1YIJA 3NBIA 1S72A 1WTWA 1IBKL 1EYGA 5IT9c 1K0SA 3T1HQ 4ZUJA 1IXRA 2ZT9C 2UXDL 3HOZB 2LKVA 5IT9E 1SAPA 4AH6A 4A76A 1XNRQ 1TWCB 2R93H 5M5WB 2B63G 1FJGL 4BY1H 4BA1I 2R6GA 4C1NK 4A3IB 1EZ6A 2F0GA 1SNMA 1VQGA 3S1MB 4AYBB 2RF4A 5ELBA 1K8AC 5IGFA 3EBEA 3CC7A 1STBA 5IP9G 3H0GB 3N6RA 1K0RA 4I65A 4TSSA 1VQKA 2C5CA 4DV5Q 5ELFA 1I94Q 3D8GA 1CKNB 2JEAI 4OXPA 1PRTF 3ND8A 3HFZB 2JA8H 4POGA 1BCPF 4KKTA 4DR3L 3PIPA 3BZKA 2WFWA 4RCNA 1NR2A 3KF8B 4RFBA 5J3BA 1ML0D 2M2LA 5BN4A 2B39A 5F2DA 3GV3A 2BE5C 3CRLC 3QO2A 1V1PA 1TWHB 4C3JG 3EVQA 4J15A 4EVOA 4L5TA 2Z8LA 1FNVA 1PYBA 3EROA 5M9OA 4K5WA 3MTSA 1SE4A 2ICEC 2SEBD 4MTKA 5EBDA 4BBSB 2OTJA 4P2CB 4HSPA 4IO9A 1PH7A 1WI5A 4GN4B 4C3IB 1TY0A 2CFMA 2RHQB 1HQMC 3OWFA 2FMMA 1FD7D 1TS5A 2EDGA 2F0DA 4JC0A 3HEJA 3NENA 2UXDQ 5GAEC 4A3DB 1TIID 4OHJA 1X6OA 2E2JH 2YTYA 4GZYC 4WJWA 2K03A 4RG1A 3TP8A 1FJGQ 1E2VA 3AQQA 1LT6D 1U4RA 1CKNA 4B08A 1EOVA 1CK1A 1P16A 2E8GA 4OGQC 3CPFA 4CKBA 1I6VC 5FO9B 2MJ8A 1VS0A 2PW5A 3J7AF 2KQ3A 3KUPA 5EKLA 3KF8A 3T4AC 1Q81C 3AB9A 4HSVA 3LWUA 4ALPA 3MWYW 4JI1L 3CQZB 1SJED 1A15A 3CW2C 3QOLA 5M5XH 4DR3Q 1O78A 1LUZA 3HOVH 2PI2A 3PMFA 1ZKOA 1CQFA 4BBRB 2NVXH 2N55A 3KF6B 2YTXA 3J81c 3UE1A 1QVCA 3E0JA 1SNQA 3F2DA 5C0XH 4K5VA 3PF5A 2F0WA 1TS3A 2N88A 1PA6A 1HRJA 3GTGH 3S14H 2RSNA 2IX0A 3S1QH 1KQSA 2IPKD 5DAUA 4GN5A 1Q82C 2EYPA 3E0EA 4YWLA 2PQAA 1VQ5A 2E75C 1STEA 1H9SB 4JW0A 1AH9A 1A2UA 3DWAA 4DR6L 3BYTB 1LTRD 3DM1A 5C4JH 4QGUA 1K83B 5FLMG 4FNFA 4C3HH 4GOPB 2QF7A 2F0UA 3NWTA 4NKLA 5EPKA 1LTTD 2MO0A 3GQBA 5IWAL 3HKZE 3TS0A 5CV8A 4CKEA 4DUYL 2MUYA 4CDDC 1VQFA 1EIGA 1R4PB 4JYAL 2F0LA 2R93B 1DXMA 2A6ED 4BY1B 2VUMG 3C1FA 3TP7A 4L5SA 5C44B 1STYA 4DK0A 5TSSA 2WB1E 4LMQD 4A3KG 2AMCB 4DAPA 2HQEA 4JI1Q 1UNSA 3T56B 4JPBW 2WAQG 3PO2B 1AP0A 4Y52H 4TVAB 2B29A 4C3HG 4R1JA 3HKZG 3A8JE 4DR7L 1KRSA 3FPPA 1Q86C 2JA8B 1O7LA 1ASYA 2MO1A 2JA5G 4HN7A 3I55A 1NY4A 3HGBA 1TS4A 5M3FH 2YV5A 3H91A 2C35B 3GO5A 4CJ1B 3A5ZB 2OT2A 1KHIA 4ZQ3A 5A35A 4UY8C 3VYTA 3EJIA 2PZTA 1D5ZC 5ELCA 1XJVA 2WB1G 1JWMD 1KRTA 4F8MA 1GVPA 3U4VA 2N3SA 2IY5B 1MSHA 2NN6I 3I2ZA 4CDFC 1XPRA 4DR6Q 3SK5A 5BR8L 4MNOA 4YIJA 4K6DA 4A93H 1QVFA 4DXGA 2NWGA 4MTNA 5E3FA 2MNAA 1H95A 1X55A 2LSSA 1X3PA 4DK3C 4OO1H 5EKKA 1PH8A 4X3UA 5IWAQ 1Q7YC 3H3VH 1AZPA 2JN4A 4DUYQ 1W3SA 3CCJA 1LLRD 4XQJA 4KHPQ 2EOTA 3P1HA 1Q1BA 2HCCA 2E2JB 4JYAQ 4DR4L 1LT5D 2AQ3B 1H9KA 1M90C 1C7YA 2MP1A 1HA6A 3QOJA 1B1ZA 4XQQA 4KN4C 2QA4A 1A8VA 4JBWA 1XMQL 1ONLA 5M3MB 1D1KA 1HR0W 4JI0L 4WRDA 4UDUC 4JCVE 3ULLA 1VCIA 4A3EG 1C8CA 1KD1C 2J7ZA 2AQ2B 4IFDJ 2LS01 3VR3A 4OIJA 4A93G 4LFAL 2E2HH 4QB4A 1HHVA 1YNND 2B2VC 1K3BC 1WCMH 4HMJA 4DR7Q 1MJCA 1E24A 1SROA 3TDQA 4A3BH 4F87A 3I7FA 4HEDA 3MXGA 5ISRA 1JE4A 5M5XB 3M3YH 5CMDA 5EPLA 1OXSC 3HOVB 1U0LA 1V8QA 5JJLA 4OIKA 2R7ZH 1EQVA 3B6YA 3ITPA 3A55A 4L5QA 2NVXB 1B4OA 2K5HA 3SDZA 1JWSD 1TKWB 2NZOA 1WYDA 2NTTA 1DONA 1B44D 5JEAJ 5KNBA 1YJNA 3GTGB 3BVMA 3S14B 2EYHA 3S1QB 1PTOB 1VQEA 1UE5A 4OWXB 3GTKH 1GHKA 3EIVA 1JOKA 5BR8Q 2R92H 1U4PA 4MHEA 4DR1L 1L1OC 1ZYRD 1WCMG 2K7VA 4K14A 1I6HH 1QJOA 3VYUA 4I7ZC 4QF4A 3VR2A 1DOLA 4GLXA 2F0PA 5C4JB 5C3EG 4KKUA 3HOYH 1X3FA 2BCOA 2WAQB 2E2DC 4JI6L 4NXML 1UEBA 3HKZB 1JE5A 4DR4Q 3IAYA 1GJXA 2BH2A 2R3ZA 4DV6L 3L7ZC 1XMQQ 3E9IA 3RR5A 4JI0Q 3KJPA 2JEBI 1EZ8A 1IZ6A 2K5VA 4A75A 1NCVA 1WFQA 4PG3A 2R92G 4P71A 2QCPX 1S5ED 5EGTA 3Q23A 4LFAQ 3CHBD 4GNXC 2I5MX 3KLSA 1NUCA 2Z4IA 4FF3A 5K36H 3OTOL 2KHSA 4L5RC 4ZK9B 2Z6KA 4DV1L 1TVXA 4QJFA 3A8IE 4R4TA 2Q8TA 2CW0D 2DY8A 4IPHA 4DV0L 2BOSA 1T9HA 1IBML 2AWNA 4HCSA 1SNPA 2CWPA 4YY3L 1IL2A 2XN9C 5M3FB 4QIWB 1JOOA 1A63A 2JJQA 4QL5A 3BDOA 5C0XI 1O7YA 1H9JA 4DR1Q 1HZ9A 3SGIA 1IYJB 1QUQA 1DOMA 2PMZE 2RKSA 2RCFA 4FXGC 4WJ4A 2MHVA 3V05A 3OSOA 4YWMA 1A2TA 4FVMA 4JI6Q 4NXMQ 5M5WH 2B2TC 3DUZA 4A3IH 4EQOA 1NBWA 2K32A 1QVGA 4ZRZA 2PCFB 2B8FA 3FKIH 3HP3A 1HR0L 3BG3A 4FO2A 3S1MH 4DV6Q 5C4ZA 3K80C 5ELEA 4J1MA 4APVA 4AYBE 1EY4A
chains in the Genus database with same CATH topology
3DM3A 3A0JA 3J81j 3RZDH 2ALYB 3K8AA 5LMNW 4UPAA 2OTLA 1VQPA 1YIJA 1Y1WH 3E9HA 1S72A 3F2CA 1IBKL 1EYGA 5IT9c 1YHBA 3T1HQ 1IXRA 2AKWB 4YCWA 2UXDL 5JJIA 1SFOH 3AEVA 4AH6A 4A76A 2VUMH 1LYLA 1XNRQ 3HOZG 5IYBG 5LMUL 2YU9H 3U4ZA 2ID0A 2BH8A 2JA7H 2R93H 4LF8L 2MQHA 2B63G 1XNQQ 3OTOQ 4BY1H 4NXNQ 1FJGL 4BA1I 2R6GA 3HOXH 3OYYA 4HIOA 4DV1Q 4A3KH 2NVTH 1VQGA 4A3IG 2RF4A 2N78A 1YJWA 2BA1A 4JI8L 1QZGA 3KFUA 4NB3A 1K8AC 1L2FA 1YITA 4YHHQ 3CC7A 3EBEA 3OW2A 4DV0Q 4JBJA 1TWHH 4AYBG 4DAYB 5IP9G 1IBMQ 4JI7Q 1HNWL 1HJPA 1K0RA 1W2BA 4YY3Q 2ES2A 4A3BG 2Z0SA 2MFIA 1GO3E 4LUVA 1JMCA 1VQKA 2QEXA 1VQBA 4GNXB 1MIUA 3TQYA 4DV5Q 4JI4Q 1SN8A 1I94Q 2PI2E 1CKNB 2VQFQ 2JEAI 1Y1WG 4OXPA 3PGZA 2R7ZG 2JA5H 3HFZB 5FJ8H 1YJ9A 4B3RL 4KHPL 2RHSB 3PUYA 4POGA 2JA8H 2KHJA 4DR3L 2ASBA 4GKJQ 3I4OA 3PIPA 1OXXK 2R7DA 3BZKA 1OTCA 4LW1A 4HJ5A 1EIYB 4UP8A 2WFWA 3HOWG 3KF8B 5J3BA 2E5LL 1TWGH 4A3DH 1SRUA 3PUXA 1KC8C 1N33Q 1G51A 2OQ0A 4LNQA 1N9WA 1WJJA 4GOPC 1V1QA 3S1NH 4GLAC 5IYDH 3M85A 2JK8A 1XMOL 4PZ7A 4J15A 1IBLQ 4L5TA 4B3TL 1PYBA 3GD7A 2ATWA 3S17H 1HR0Q 3AFQA 2OTJA 3F1ZA 1HNXL 3HOYG 3GTJH 4OO1I 4IO9A 2E2IH 1PH7A 1WI5A 3L2PA 1GKHA 4ME3A 4GN4B 3W5OA 3H3VI 4BBSG 2CFMA 2RHQB 4IOCA 1N34L 1CSPA 1OXVA 3JAMc 4BY7H 1Q1EA 3VDYA 2K50A 5IP7H 4JC0A 2UXDQ 3NENA 1XPOA 1JJCB 5GAEC 5ELNA 3CQZH 1X6OA 4UP7A 3J80c 2E2JH 2YTYA 5LMUQ 4RG1A 4A3DG 1ASZA 1VQOA 2ZJQA 4LF8Q 5DLQE 3ER0A 1FJGQ 1BBWA 1YVCA 3CC4A 2IT1A 1SR3A 4JI3L 3M4OH 1PH5A 3AQQA 5E7NA 3JAMi 4GNXA 1B7YB 1CKNA 3BJUA 5M5YH 1N32L 4HJ7A 5IYDG 4A3EH 1EOVA 1HNZL 4JI8Q 4LF4L 1K73C 2Q2TA 4X6AH 4LF9L 4B3ML 1P16A 2E8GA 4LFBL 2KHIA 4RMFA 3CPFA 3UDFA 4A3MH 2UUBL 5GROA 1HNWQ 1VS0A 4DK6C 2HHHL 3U58A 4HJ9A 1Q81C 2A8VA 5K36G 2VNUD 1OXTA 2LXJA 3RNUA 1YZ6A 2LXKA 4O0AA 4ALPA 4JI1L 1BBUA 2ZJPA 4BY7G 4B3RQ 5GAGC 3CW2C 3M7NA 5M5XH 5IP7G 4DR3Q 3S2HH 1LUZA 3HOVH 2PI2A 3GTQH 2ZTEA 4KI0A 2EIFA 4R4CA 1NJIC 2UUAL 3T1YL 4LF7L 1X54A 3TEHB 2HT1A 2E5LQ 3CF5A 1CUKA 4HJ8A 4OWTB 3KDFB 1EUJA 2NVXH 3KF6B 2YTXA 3J81c 3UE1A 1QVCA 3S1RH 1WOCA 3F2DA 1NMGA 2FXQA 4BBRG 4XIGS 4DV7L 4LF6Q 3PF5A 5ELOA 2EXDA 1PA6A 1KL9A 1FL0A 2XGTA 4YCUA 3GTGH 2OWOA 3S14H 4IPGA 2IX0A 4B3TQ 1VQDA 1XMOQ 1KQSA 1CKMA 3S1QH 5IE8A 4EQ5A 3ULPA 4A3MG 4BA2I 4GN5A 3PUWA 1Q82C 3J81i 3E0EA 4GKKL 4YWLA 2NN6G 1SLJA 2PQAA 3W1BA 3CAMA 1VQ5A 5C4XH 1LM0A 1HZCA 5LMNL 1HNXQ 1N36L 1TWFH 3BZCA 1KXLA 5C3EH 1N34Q 1AH9A 4DR6L 4IPDA 3I56A 1NTGA 5C44H 1TXYA 2Q2IA 5C4JH 1K8GA 4IJLA 4QGUA 4LWCA 1E3PA 3FKIG 5FLMG 4A3FG 3PUZA 4BXXH 2HIVA 2UXCL 4C3HH 4DV3L 5HGQA 4GOPB 2HQLA 3PO2H 2D62A 1G291 1E22A 3K7AH 3PF4A 2MO0A 2ZM6L 2YYZA 2YTVA 1PH9A 5IWAL 3EN2A 3HKZE 3TS0A 4JI3Q 4AQYL 4DUYL 1VQAA 1LTLA 1S3OA 2ZJRA 1VQFA 3CCRA 1N32Q 1HNZQ 4AIMA 4A4IA 4LF9Q 4B3MQ 3CCUA 4JYAL 4LFBQ 4O2DA 3STBC 2UUBQ 4A3LH 2A19A 2VUMG 2D0PA 2UU9L 1VQJA 2HHHQ 2JA7G 2R93G 1TWAH 4OONA 1L1OA 4L5SA 4DV2L 5C4XG 4JI7L 2ZTDA 4BY1G 3KOJA 3HOUH 3HOXG 4X65L 1PH2A 3I4MH 1B70B 2WB1E 4P75A 4A3KG 2AMCB 3G6EA 4H02A 2N8NA 4JI1Q 1Q12A 1MJEA 2AHOB 3PO3H 5C44G 2GN5A 2CWAA 5H1SE 3S24A 2JA6H 2WAQG 1EQRA 4Y52H 4BXXG 1I3QH 4TVAB 2B29A 1FGUA 1QUQB 1UE6A 3K0XA 4GLVB 4R1JA 3HKZG 1HZBA 5IY0A 4HIKA 2UUAQ 2Z6KC 3T1YQ 4LF7Q 3PO2G 4K0KQ 4DR7L 1R9TH 4LF5L 1KRSA 4X62L 1VQ6A 3I4NH 1I50H 3G4SA 3CCVA 1Q86C 1VQIA 3TRZA 1QZHA 4WJ3M 2DGYA 4DV7Q 1ASYA 2MO1A 4A3JH 2JA5G 1UE1A 5FJ8G 4LUZA 3I55A 5IYCH 1IBKQ 3CC2A 2JA8G 1NY4A 1D7QA 5M3FH 2YV5A 2B3GA 2C35B 4R4QA 3GO5A 4DKAC 4PZ6A 4X66L 2L15A 3A5ZB 1KHIA 1XTDA 3K81C 4DR5L 4JI2L 4UY8C 3GTLH 5JJKA 4GKKQ 3S15H 1XJVA 2WB1G 3K7UC 1BVSA 1PH6A 4TQUS 1KRTA 3A5UA 5LMNQ 1GVPA 3U4VA 1K9MC 2N49A 3HOUG 2UUCL 1N36Q 2N3SA 4QQBX 3I4MG 2IY5B 2NN6I 4JBMA 1NMFA 3I2ZA 4A3CH 4A3GH 5M3MH 2H5XA 2Y0SE 1XPRA 1X3GA 4DR6Q 5BR8L 2CCZA 3RN5A 4IFDG 4MNOA 3NELA 3ERSX 2JA6G 3J80i 4JOIC 3W1GA 4A93H 1PH1A 1PV4A 1YBYA 2ZTCA 2OQKA 1QVFA 2UXCQ 4IPCA 2KCTA 4DV3Q 4HIDA 4MTNA 2MNAA 1H95A 1PYSB 1YNXA 1VQ8A 1X55A 2LSSA 2IHFA 3MXNB 4DK3C 3J7ZC 2Q2UA 2ZM6Q 1PH8A 5IWAQ 1Q7YC 1E1OA 3H3VH 4DPGA 2HIXA 4P72A 4JV5L 4DUYQ 3ICEA 4KHZA 1W3SA 1Z9FA 3CCJA 1EFWA 1E7ZA 5IYCG 1V43A 4KHPQ 4DR2L 4JBKA 4OX9L 1Q1BA 2V1CC 4JYAQ 4DR4L 2CKZB 1M90C 1U5KA 1C7YA 2VQEL 1P8LA 1X65A 4GKJL 5AJ3L 3NBHB 3PSIA 2QA4A 2IX1A 1A8VA 2UU9Q 3RZOH 3ZJYC 4JBWA 1XMQL 2AWOA 2A1AA 5JEAG 3H15A 4DUZL 2Y0SG 4DV2Q 1JJ2A 3CMAA 1HR0W 4JI0L 3PIOA 3HOZH 4X65Q 4JCVE 3ULLA 2WP8J 1VCIA 4A3CG 4R4OA 4A3GG 5M3MG 1EIFA 4DNIA 3CXCA 1TWCH 1V9PA 4A3EG 1JB7A 1KD1C 1YI2A 4IFDJ 1YEZA 1B8AA 1CKOA 1VQLA 1KAWA 1OXUA 2E2HH 4LFAL 4A93G 3KLWA 3CMEA 3J7A5 1WCMH 1VQNA 3D31A 3G71A 4DR7Q 1MJCA 4LF5Q 4X62Q 1E24A 1SROA 4POFA 4A3BH 3I7FA 1GD7A 3H0GH 3PV0A 4JI5L 2Q2HA 3RLFA 2CQOA 5GADC 3M3YH 1OXSC 2F3IA 1U0LA 1SE8A 3CCSA 1I5FA 3LGJA 3UDIA 5JJLA 3WWVA 4IJHA 3AFPA 3S16H 2R7ZH 1K3RA 3B6YA 1VQCA 4MZ9A 4PMWA 3HOVG 4X66Q 3MEFA 2UXBL 4L5QA 3CD6A 2D0OA 4JI2Q 1Q8KA 4DR5Q 2I5LX 2K5HA 3D0FA 3A74A 3M4PA 4B3SL 2WAQE 2NZOA 1WYDA 1KIXA 2NVYH 5JEAJ 1GM5A 1YJNA 3FP9A 3PUVA 1YHQA 2UUCQ 3HOWH 4KLKA 5GQOA 2EQSA 5C0XG 3CCMA 3IRBA 1VQ9A 3RLOA 3CCLA 1VQEA 1O7IA 1UE5A 1CSQA 1PFSA 4OWXB 1PH4A 3EIVA 2K5NA 5BR8Q 3CP0A 3GTKH 4X64L 4LF4Q 2R92H 4DR1L 4C3JH 1L1OC 3GTPH 1RIPA 1A0IA 1VQHA 3TREA 1AE2A 1N8RC 4IFDI 1WCMG 3Q8DA 1I6HH 4FDBA 1J5EL 3NEMA 3KDFA 2R7FA 1S40A 3KF6A 4GLXA 4XTCS 2NZHA 3H0GG 4DV4L 4JV5Q 5C3EG 3FHWA 3HOYH 1X3FA 4LFCL 1M1KC 2KENA 1L0WA 3UDXA 3UDGA 4BBSH 4DR2Q 4JI6L 1Q46A 1UEBA 3F2BA 4NXML 4OX9Q 1JJGA 1JE5A 3S2DH 2F4VL 4DR4Q 1A62A 2PNHA 2VQEQ 2K14A 4C3IH 2BH2A 5AJ3Q 1HZAA 2VZAA 3F8TA 1PHJA 4DV6L 1E1TA 3L7ZC 2XTIA 2K4KA 1XMQQ 3E9IA 3RR5A 4DUZQ 2NVQH 1Z47A 4JI0Q 1AE3A 1HH2P 1NE3A 3KJPA 2JEBI 1IZ6A 3M4QA 5EAYA 4DAMA 2K5VA 1X56A 4NPSA 5C0XJ 1C0AA 4A75A 4YWKA 1WFQA 4PG3A 4LF6L 2R92G 3GTMH 4C2MH 4P71A 4GN3B 4PZ8A 3RLNA 3PCOB 4LFAQ 3T1HL 1VQ4A 1Y14B 4JG2A 4A3LG 1YHAA 4HJAA 3DLLA 4QIWE 3CCEA 4GNXC 1G6PA 2I5MX 4GOPA 3CCQA 2I5HA 3AYHB 2BA0A 3M9BA 4P73A 4APVA 1XNRL 1UWVA 1Y1VH 1XPUA 2GVAA 5FLXc 1XNQL 3OTOL 4NXNL 4JI5Q 4L5RC 3TS2A 3PO3G 1SMXA 2Z6KA 4DV1L 2K52A 1FVIA 1BKBA 4QJFA 1JT8A 1EQQA 1RL2A 3UE0A 5GAHC 3G48A 4R4TA 4GS3A 2UXBQ 2F52A 4YHHL 2GVBA 4IPHA 4DV0L 1DGSA 2VL6A 1T9HA 1IBML 2AWNA 4B3SQ 4IOAA 2PQAB 2CWPA 4R4IA 1C9OA 3I4NG 4QY7A 4EX5A 4YY3L 2VW9A 2VS1A 1IL2A 2OCEA 4AQYQ 4HIMA 4A3JG 1A63A 1J6QA 2JJQA 4DV5L 4JI4L 1I94L 4QL5A 2JA9A 2VQFL 5M3FG 4BBRH 1PH3A 4X64Q 2DUDA 3ULJA 5C0XI 3GTOH 3KYHC 4DR1Q 1HZ9A 4OWWB 3SGIA 1IYJB 2RCNA 3U50C 1QUQA 2IHEA 3JC66 3RN2A 4UP9A 2PMZE 3GDEA 4YCVA 2JE6I 4Y7NH 1X9NA 3KJOA 1J5EQ 2I0QA 1Y1VG 4JOIA 5IYBH 4WJ4A 4DV4Q 1UE7A 1N33L 2B63H 2KBNA 1PVOA 4LFCQ 3BU2A 1X3EA 3L0OA 4P74A 3STBD 3CPWA 4YWMA 2K75A 1EWIA 4JI6Q 4NXMQ 5M5WH 1MKHA 5HY6A 4A3IH 2F4VQ 1NBWA 1VQMA 3HKSA 1D8LA 1QVGA 1IBLL 4A3FH 3FKIH 5FLMH 1HR0L 3S1MH 4LUOA 4DV6Q 1VQ7A 5IP9H 4OO1G 2JQOA 3K80C 2VY3A 1L1OB 2KCMA 1K83H 4K0KL 2QGQA 4AYBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DM3 A;  3A0J A;  3J81 j;  3RZD H;  2ALY B;  3K8A A;  5LMN W;  4UPA A;  2OTL A;  1VQP A;  1YIJ A;  1Y1W H;  3E9H A;  1S72 A;  3F2C A;  1IBK L;  1EYG A;  5IT9 c;  1YHB A;  3T1H Q;  1IXR A;  2AKW B;  4YCW A;  2UXD L;  5JJI A;  1SFO H;  3AEV A;  4AH6 A;  4A76 A;  2VUM H;  1LYL A;  1XNR Q;  3HOZ G;  5IYB G;  5LMU L;  2YU9 H;  3U4Z A;  2ID0 A;  2BH8 A;  2JA7 H;  2R93 H;  4LF8 L;  2MQH A;  2B63 G;  1XNQ Q;  3OTO Q;  4BY1 H;  4NXN Q;  1FJG L;  4BA1 I;  2R6G A;  3HOX H;  3OYY A;  4HIO A;  4DV1 Q;  4A3K H;  2NVT H;  1VQG A;  4A3I G;  2RF4 A;  2N78 A;  1YJW A;  2BA1 A;  4JI8 L;  1QZG A;  3KFU A;  4NB3 A;  1K8A C;  1L2F A;  1YIT A;  4YHH Q;  3CC7 A;  3EBE A;  3OW2 A;  4DV0 Q;  4JBJ A;  1TWH H;  4AYB G;  4DAY B;  5IP9 G;  1IBM Q;  4JI7 Q;  1HNW L;  1HJP A;  1K0R A;  1W2B A;  4YY3 Q;  2ES2 A;  4A3B G;  2Z0S A;  2MFI A;  1GO3 E;  4LUV A;  1JMC A;  1VQK A;  2QEX A;  1VQB A;  4GNX B;  1MIU A;  3TQY A;  4DV5 Q;  4JI4 Q;  1SN8 A;  1I94 Q;  2PI2 E;  1CKN B;  2VQF Q;  2JEA I;  1Y1W G;  4OXP A;  3PGZ A;  2R7Z G;  2JA5 H;  3HFZ B;  5FJ8 H;  1YJ9 A;  4B3R L;  4KHP L;  2RHS B;  3PUY A;  4POG A;  2JA8 H;  2KHJ A;  4DR3 L;  2ASB A;  4GKJ Q;  3I4O A;  3PIP A;  1OXX K;  2R7D A;  3BZK A;  1OTC A;  4LW1 A;  4HJ5 A;  1EIY B;  4UP8 A;  2WFW A;  3HOW G;  3KF8 B;  5J3B A;  2E5L L;  1TWG H;  4A3D H;  1SRU A;  3PUX A;  1KC8 C;  1N33 Q;  1G51 A;  2OQ0 A;  4LNQ A;  1N9W A;  1WJJ A;  4GOP C;  1V1Q A;  3S1N H;  4GLA C;  5IYD H;  3M85 A;  2JK8 A;  1XMO L;  4PZ7 A;  4J15 A;  1IBL Q;  4L5T A;  4B3T L;  1PYB A;  3GD7 A;  2ATW A;  3S17 H;  1HR0 Q;  3AFQ A;  2OTJ A;  3F1Z A;  1HNX L;  3HOY G;  3GTJ H;  4OO1 I;  4IO9 A;  2E2I H;  1PH7 A;  1WI5 A;  3L2P A;  1GKH A;  4ME3 A;  4GN4 B;  3W5O A;  3H3V I;  4BBS G;  2CFM A;  2RHQ B;  4IOC A;  1N34 L;  1CSP A;  1OXV A;  3JAM c;  4BY7 H;  1Q1E A;  3VDY A;  2K50 A;  5IP7 H;  4JC0 A;  2UXD Q;  3NEN A;  1XPO A;  1JJC B;  5GAE C;  5ELN A;  3CQZ H;  1X6O A;  4UP7 A;  3J80 c;  2E2J H;  2YTY A;  5LMU Q;  4RG1 A;  4A3D G;  1ASZ A;  1VQO A;  2ZJQ A;  4LF8 Q;  5DLQ E;  3ER0 A;  1FJG Q;  1BBW A;  1YVC A;  3CC4 A;  2IT1 A;  1SR3 A;  4JI3 L;  3M4O H;  1PH5 A;  3AQQ A;  5E7N A;  3JAM i;  4GNX A;  1B7Y B;  1CKN A;  3BJU A;  5M5Y H;  1N32 L;  4HJ7 A;  5IYD G;  4A3E H;  1EOV A;  1HNZ L;  4JI8 Q;  4LF4 L;  1K73 C;  2Q2T A;  4X6A H;  4LF9 L;  4B3M L;  1P16 A;  2E8G A;  4LFB L;  2KHI A;  4RMF A;  3CPF A;  3UDF A;  4A3M H;  2UUB L;  5GRO A;  1HNW Q;  1VS0 A;  4DK6 C;  2HHH L;  3U58 A;  4HJ9 A;  1Q81 C;  2A8V A;  5K36 G;  2VNU D;  1OXT A;  2LXJ A;  3RNU A;  1YZ6 A;  2LXK A;  4O0A A;  4ALP A;  4JI1 L;  1BBU A;  2ZJP A;  4BY7 G;  4B3R Q;  5GAG C;  3CW2 C;  3M7N A;  5M5X H;  5IP7 G;  4DR3 Q;  3S2H H;  1LUZ A;  3HOV H;  2PI2 A;  3GTQ H;  2ZTE A;  4KI0 A;  2EIF A;  4R4C A;  1NJI C;  2UUA L;  3T1Y L;  4LF7 L;  1X54 A;  3TEH B;  2HT1 A;  2E5L Q;  3CF5 A;  1CUK A;  4HJ8 A;  4OWT B;  3KDF B;  1EUJ A;  2NVX H;  3KF6 B;  2YTX A;  3J81 c;  3UE1 A;  1QVC A;  3S1R H;  1WOC A;  3F2D A;  1NMG A;  2FXQ A;  4BBR G;  4XIG S;  4DV7 L;  4LF6 Q;  3PF5 A;  5ELO A;  2EXD A;  1PA6 A;  1KL9 A;  1FL0 A;  2XGT A;  4YCU A;  3GTG H;  2OWO A;  3S14 H;  4IPG A;  2IX0 A;  4B3T Q;  1VQD A;  1XMO Q;  1KQS A;  1CKM A;  3S1Q H;  5IE8 A;  4EQ5 A;  3ULP A;  4A3M G;  4BA2 I;  4GN5 A;  3PUW A;  1Q82 C;  3J81 i;  3E0E A;  4GKK L;  4YWL A;  2NN6 G;  1SLJ A;  2PQA A;  3W1B A;  3CAM A;  1VQ5 A;  5C4X H;  1LM0 A;  1HZC A;  5LMN L;  1HNX Q;  1N36 L;  1TWF H;  3BZC A;  1KXL A;  5C3E H;  1N34 Q;  1AH9 A;  4DR6 L;  4IPD A;  3I56 A;  1NTG A;  5C44 H;  1TXY A;  2Q2I A;  5C4J H;  1K8G A;  4IJL A;  4QGU A;  4LWC A;  1E3P A;  3FKI G;  5FLM G;  4A3F G;  3PUZ A;  4BXX H;  2HIV A;  2UXC L;  4C3H H;  4DV3 L;  5HGQ A;  4GOP B;  2HQL A;  3PO2 H;  2D62 A;  1G29 1;  1E22 A;  3K7A H;  3PF4 A;  2MO0 A;  2ZM6 L;  2YYZ A;  2YTV A;  1PH9 A;  5IWA L;  3EN2 A;  3HKZ E;  3TS0 A;  4JI3 Q;  4AQY L;  4DUY L;  1VQA A;  1LTL A;  1S3O A;  2ZJR A;  1VQF A;  3CCR A;  1N32 Q;  1HNZ Q;  4AIM A;  4A4I A;  4LF9 Q;  4B3M Q;  3CCU A;  4JYA L;  4LFB Q;  4O2D A;  3STB C;  2UUB Q;  4A3L H;  2A19 A;  2VUM G;  2D0P A;  2UU9 L;  1VQJ A;  2HHH Q;  2JA7 G;  2R93 G;  1TWA H;  4OON A;  1L1O A;  4L5S A;  4DV2 L;  5C4X G;  4JI7 L;  2ZTD A;  4BY1 G;  3KOJ A;  3HOU H;  3HOX G;  4X65 L;  1PH2 A;  3I4M H;  1B70 B;  2WB1 E;  4P75 A;  4A3K G;  2AMC B;  3G6E A;  4H02 A;  2N8N A;  4JI1 Q;  1Q12 A;  1MJE A;  2AHO B;  3PO3 H;  5C44 G;  2GN5 A;  2CWA A;  5H1S E;  3S24 A;  2JA6 H;  2WAQ G;  1EQR A;  4Y52 H;  4BXX G;  1I3Q H;  4TVA B;  2B29 A;  1FGU A;  1QUQ B;  1UE6 A;  3K0X A;  4GLV B;  4R1J A;  3HKZ G;  1HZB A;  5IY0 A;  4HIK A;  2UUA Q;  2Z6K C;  3T1Y Q;  4LF7 Q;  3PO2 G;  4K0K Q;  4DR7 L;  1R9T H;  4LF5 L;  1KRS A;  4X62 L;  1VQ6 A;  3I4N H;  1I50 H;  3G4S A;  3CCV A;  1Q86 C;  1VQI A;  3TRZ A;  1QZH A;  4WJ3 M;  2DGY A;  4DV7 Q;  1ASY A;  2MO1 A;  4A3J H;  2JA5 G;  1UE1 A;  5FJ8 G;  4LUZ A;  3I55 A;  5IYC H;  1IBK Q;  3CC2 A;  2JA8 G;  1NY4 A;  1D7Q A;  5M3F H;  2YV5 A;  2B3G A;  2C35 B;  4R4Q A;  3GO5 A;  4DKA C;  4PZ6 A;  4X66 L;  2L15 A;  3A5Z B;  1KHI A;  1XTD A;  3K81 C;  4DR5 L;  4JI2 L;  4UY8 C;  3GTL H;  5JJK A;  4GKK Q;  3S15 H;  1XJV A;  2WB1 G;  3K7U C;  1BVS A;  1PH6 A;  4TQU S;  1KRT A;  3A5U A;  5LMN Q;  1GVP A;  3U4V A;  1K9M C;  2N49 A;  3HOU G;  2UUC L;  1N36 Q;  2N3S A;  4QQB X;  3I4M G;  2IY5 B;  2NN6 I;  4JBM A;  1NMF A;  3I2Z A;  4A3C H;  4A3G H;  5M3M H;  2H5X A;  2Y0S E;  1XPR A;  1X3G A;  4DR6 Q;  5BR8 L;  2CCZ A;  3RN5 A;  4IFD G;  4MNO A;  3NEL A;  3ERS X;  2JA6 G;  3J80 i;  4JOI C;  3W1G A;  4A93 H;  1PH1 A;  1PV4 A;  1YBY A;  2ZTC A;  2OQK A;  1QVF A;  2UXC Q;  4IPC A;  2KCT A;  4DV3 Q;  4HID A;  4MTN A;  2MNA A;  1H95 A;  1PYS B;  1YNX A;  1VQ8 A;  1X55 A;  2LSS A;  2IHF A;  3MXN B;  4DK3 C;  3J7Z C;  2Q2U A;  2ZM6 Q;  1PH8 A;  5IWA Q;  1Q7Y C;  1E1O A;  3H3V H;  4DPG A;  2HIX A;  4P72 A;  4JV5 L;  4DUY Q;  3ICE A;  4KHZ A;  1W3S A;  1Z9F A;  3CCJ A;  1EFW A;  1E7Z A;  5IYC G;  1V43 A;  4KHP Q;  4DR2 L;  4JBK A;  4OX9 L;  1Q1B A;  2V1C C;  4JYA Q;  4DR4 L;  2CKZ B;  1M90 C;  1U5K A;  1C7Y A;  2VQE L;  1P8L A;  1X65 A;  4GKJ L;  5AJ3 L;  3NBH B;  3PSI A;  2QA4 A;  2IX1 A;  1A8V A;  2UU9 Q;  3RZO H;  3ZJY C;  4JBW A;  1XMQ L;  2AWO A;  2A1A A;  5JEA G;  3H15 A;  4DUZ L;  2Y0S G;  4DV2 Q;  1JJ2 A;  3CMA A;  1HR0 W;  4JI0 L;  3PIO A;  3HOZ H;  4X65 Q;  4JCV E;  3ULL A;  2WP8 J;  1VCI A;  4A3C G;  4R4O A;  4A3G G;  5M3M G;  1EIF A;  4DNI A;  3CXC A;  1TWC H;  1V9P A;  4A3E G;  1JB7 A;  1KD1 C;  1YI2 A;  4IFD J;  1YEZ A;  1B8A A;  1CKO A;  1VQL A;  1KAW A;  1OXU A;  2E2H H;  4LFA L;  4A93 G;  3KLW A;  3CME A;  3J7A 5;  1WCM H;  1VQN A;  3D31 A;  3G71 A;  4DR7 Q;  1MJC A;  4LF5 Q;  4X62 Q;  1E24 A;  1SRO A;  4POF A;  4A3B H;  3I7F A;  1GD7 A;  3H0G H;  3PV0 A;  4JI5 L;  2Q2H A;  3RLF A;  2CQO A;  5GAD C;  3M3Y H;  1OXS C;  2F3I A;  1U0L A;  1SE8 A;  3CCS A;  1I5F A;  3LGJ A;  3UDI A;  5JJL A;  3WWV A;  4IJH A;  3AFP A;  3S16 H;  2R7Z H;  1K3R A;  3B6Y A;  1VQC A;  4MZ9 A;  4PMW A;  3HOV G;  4X66 Q;  3MEF A;  2UXB L;  4L5Q A;  3CD6 A;  2D0O A;  4JI2 Q;  1Q8K A;  4DR5 Q;  2I5L X;  2K5H A;  3D0F A;  3A74 A;  3M4P A;  4B3S L;  2WAQ E;  2NZO A;  1WYD A;  1KIX A;  2NVY H;  5JEA J;  1GM5 A;  1YJN A;  3FP9 A;  3PUV A;  1YHQ A;  2UUC Q;  3HOW H;  4KLK A;  5GQO A;  2EQS A;  5C0X G;  3CCM A;  3IRB A;  1VQ9 A;  3RLO A;  3CCL A;  1VQE A;  1O7I A;  1UE5 A;  1CSQ A;  1PFS A;  4OWX B;  1PH4 A;  3EIV A;  2K5N A;  5BR8 Q;  3CP0 A;  3GTK H;  4X64 L;  4LF4 Q;  2R92 H;  4DR1 L;  4C3J H;  1L1O C;  3GTP H;  1RIP A;  1A0I A;  1VQH A;  3TRE A;  1AE2 A;  1N8R C;  4IFD I;  1WCM G;  3Q8D A;  1I6H H;  4FDB A;  1J5E L;  3NEM A;  3KDF A;  2R7F A;  1S40 A;  3KF6 A;  4GLX A;  4XTC S;  2NZH A;  3H0G G;  4DV4 L;  4JV5 Q;  5C3E G;  3FHW A;  3HOY H;  1X3F A;  4LFC L;  1M1K C;  2KEN A;  1L0W A;  3UDX A;  3UDG A;  4BBS H;  4DR2 Q;  4JI6 L;  1Q46 A;  1UEB A;  3F2B A;  4NXM L;  4OX9 Q;  1JJG A;  1JE5 A;  3S2D H;  2F4V L;  4DR4 Q;  1A62 A;  2PNH A;  2VQE Q;  2K14 A;  4C3I H;  2BH2 A;  5AJ3 Q;  1HZA A;  2VZA A;  3F8T A;  1PHJ A;  4DV6 L;  1E1T A;  3L7Z C;  2XTI A;  2K4K A;  1XMQ Q;  3E9I A;  3RR5 A;  4DUZ Q;  2NVQ H;  1Z47 A;  4JI0 Q;  1AE3 A;  1HH2 P;  1NE3 A;  3KJP A;  2JEB I;  1IZ6 A;  3M4Q A;  5EAY A;  4DAM A;  2K5V A;  1X56 A;  4NPS A;  5C0X J;  1C0A A;  4A75 A;  4YWK A;  1WFQ A;  4PG3 A;  4LF6 L;  2R92 G;  3GTM H;  4C2M H;  4P71 A;  4GN3 B;  4PZ8 A;  3RLN A;  3PCO B;  4LFA Q;  3T1H L;  1VQ4 A;  1Y14 B;  4JG2 A;  4A3L G;  1YHA A;  4HJA A;  3DLL A;  4QIW E;  3CCE A;  4GNX C;  1G6P A;  2I5M X;  4GOP A;  3CCQ A;  2I5H A;  3AYH B;  2BA0 A;  3M9B A;  4P73 A;  4APV A;  1XNR L;  1UWV A;  1Y1V H;  1XPU A;  2GVA A;  5FLX c;  1XNQ L;  3OTO L;  4NXN L;  4JI5 Q;  4L5R C;  3TS2 A;  3PO3 G;  1SMX A;  2Z6K A;  4DV1 L;  2K52 A;  1FVI A;  1BKB A;  4QJF A;  1JT8 A;  1EQQ A;  1RL2 A;  3UE0 A;  5GAH C;  3G48 A;  4R4T A;  4GS3 A;  2UXB Q;  2F52 A;  4YHH L;  2GVB A;  4IPH A;  4DV0 L;  1DGS A;  2VL6 A;  1T9H A;  1IBM L;  2AWN A;  4B3S Q;  4IOA A;  2PQA B;  2CWP A;  4R4I A;  1C9O A;  3I4N G;  4QY7 A;  4EX5 A;  4YY3 L;  2VW9 A;  2VS1 A;  1IL2 A;  2OCE A;  4AQY Q;  4HIM A;  4A3J G;  1A63 A;  1J6Q A;  2JJQ A;  4DV5 L;  4JI4 L;  1I94 L;  4QL5 A;  2JA9 A;  2VQF L;  5M3F G;  4BBR H;  1PH3 A;  4X64 Q;  2DUD A;  3ULJ A;  5C0X I;  3GTO H;  3KYH C;  4DR1 Q;  1HZ9 A;  4OWW B;  3SGI A;  1IYJ B;  2RCN A;  3U50 C;  1QUQ A;  2IHE A;  3JC6 6;  3RN2 A;  4UP9 A;  2PMZ E;  3GDE A;  4YCV A;  2JE6 I;  4Y7N H;  1X9N A;  3KJO A;  1J5E Q;  2I0Q A;  1Y1V G;  4JOI A;  5IYB H;  4WJ4 A;  4DV4 Q;  1UE7 A;  1N33 L;  2B63 H;  2KBN A;  1PVO A;  4LFC Q;  3BU2 A;  1X3E A;  3L0O A;  4P74 A;  3STB D;  3CPW A;  4YWM A;  2K75 A;  1EWI A;  4JI6 Q;  4NXM Q;  5M5W H;  1MKH A;  5HY6 A;  4A3I H;  2F4V Q;  1NBW A;  1VQM A;  3HKS A;  1D8L A;  1QVG A;  1IBL L;  4A3F H;  3FKI H;  5FLM H;  1HR0 L;  3S1M H;  4LUO A;  4DV6 Q;  1VQ7 A;  5IP9 H;  4OO1 G;  2JQO A;  3K80 C;  2VY3 A;  1L1O B;  2KCM A;  1K83 H;  4K0K L;  2QGQ A;  4AYB E; 
#chains in the Genus database with same CATH topology
 3DM3 A;  3A0J A;  3RZD H;  4N9T A;  5BN5 A;  1VQP A;  1I4X A;  5IOC A;  1Y1W H;  3E9H A;  5LL6 S;  3VR6 A;  2ICI A;  1JQY D;  3I70 A;  4YCW A;  5KGU A;  2A69 C;  1LYL A;  3HOZ G;  1LAC A;  2YU9 H;  2JA7 H;  2ID0 A;  2BH8 A;  1LV9 A;  3FDT A;  3OTO Q;  2DNC A;  3WOE A;  2Z4H A;  3OYY A;  4HIO A;  1VF5 C;  4DV1 Q;  2E2H B;  1B3A A;  1RDP D;  3P7J A;  4A3I G;  1WCM B;  1ET6 A;  1QZG A;  4NB3 A;  4PV1 C;  4A3B B;  3OW2 A;  4DV0 Q;  4AYB G;  1TWH H;  3NBH A;  1IBM Q;  3M3Y B;  1BCP D;  1W2B A;  4YY3 Q;  3EA6 A;  5A2Q L;  2MFI A;  5DEH A;  1GO3 E;  1X32 A;  2R7Z B;  3TQY A;  1SN8 A;  2PI2 E;  3PIO 3;  1Y1W G;  1SFO B;  5FJ8 H;  1D5M C;  1YJ9 A;  2RHS B;  3PUY A;  3A7L A;  2ASB A;  5D65 A;  1OXX K;  2D2C C;  2F4I A;  4DAV A;  1SDF A;  1KNA A;  5CGK A;  2E5L L;  1TWG H;  4A3D H;  1XX8 A;  1SRU A;  3GP7 A;  3PUX A;  1KC8 C;  2OQ0 A;  4LNQ A;  3H94 A;  4CHT B;  1SMY D;  3S1N H;  1V1Q A;  3VR5 A;  1I6H B;  5IYD H;  5LL6 X;  1DZ1 A;  3M85 A;  4PZ7 A;  3O13 A;  1H9M A;  5CR3 A;  3GD7 A;  3S17 H;  1HR0 Q;  5EPJ A;  1BO0 A;  1UEA B;  3AFQ A;  3HOY B;  1EU4 A;  1PXU A;  3QJY A;  5KEE A;  1C4Q A;  4FF4 A;  3GTJ H;  1CZG A;  4OO1 I;  3L2P A;  3H3V I;  5JVH 3;  4ME3 A;  4BBS G;  3VR4 A;  2NYZ D;  5T1I A;  1F2Z A;  2K50 A;  1SYE A;  5ELN A;  5FKA C;  5CBA E;  3CQZ H;  5L37 A;  3KBG A;  1LTS D;  2SOB A;  1KDA A;  4A3D G;  5JEA H;  4PQX A;  1PRT C;  1BUV T;  1YVC A;  3U9S A;  1I4P A;  2IT1 A;  4JI3 L;  5IGG A;  1CA5 A;  3M4O H;  2KCN A;  1KAA A;  3JAM i;  1B7Y B;  1D6E C;  5M5Y H;  2PO4 A;  2F0F A;  5IYD G;  5JVG 3;  1K73 C;  4X6A H;  4LF9 L;  3MFY A;  1ROD A;  3MHB A;  3UDF A;  3E3X A;  1QNK A;  2EYL A;  3JAM L;  4DK6 C;  2NN6 H;  4HJ9 A;  2A8V A;  3P20 A;  3J7Y W;  4XQN A;  5T1G A;  3J80 L;  1NAP A;  2B8G A;  1DJR D;  1GXD C;  3S2H H;  2WV6 D;  3TN2 A;  2ZTE A;  2EIF A;  2UUA L;  1NJI C;  2P5Z X;  4KY5 A;  3T1Y L;  1EYD A;  3TEH B;  5CBE E;  1J9O A;  2E5L Q;  3CF5 A;  2A6H C;  4FF2 A;  5FO7 B;  1NMG A;  4UHV A;  4BBR G;  4XIG S;  3G7L A;  1DCZ A;  1NSN S;  1FL0 A;  2XGT A;  2OWO A;  1ESF A;  5I2X A;  5IE8 A;  4EQ5 A;  1FNU A;  5CV6 A;  2EY5 A;  1BNZ A;  2H1E A;  3PUW A;  2EZV A;  2NN6 G;  1SLJ A;  3CAM A;  4N8F A;  1H9R A;  5C4X H;  1LM0 A;  1HZC A;  2IJ0 A;  1EWH A;  2F0N A;  3VA5 A;  1KXL A;  1FNW A;  2F0O A;  3FKI B;  1NTG A;  5C44 H;  4LWC A;  1E3P A;  3PUZ A;  4BXX H;  3QWN A;  2UXC L;  3RZD B;  3PO2 H;  2D62 A;  1WD1 A;  2NBF A;  2ZM6 L;  1Y1W B;  1KLG D;  1PH9 A;  4JI3 Q;  3CCR A;  4V0B A;  4XYO A;  4LF9 Q;  2YU9 B;  2JA7 B;  4O2D A;  3K5O A;  1JWU D;  4A3L H;  5C5M A;  1VQJ A;  4KTA A;  2R93 G;  5C4X G;  1TWA H;  5I2Y A;  4DV2 L;  3OMC A;  4BY1 G;  1IYV A;  2B2U A;  4X65 L;  1PH2 A;  2F0I A;  4H02 A;  1CTM A;  2N8N A;  1Q12 A;  1MJE A;  3PO3 H;  5C44 G;  2KOL A;  1D1I A;  1EQR A;  1ESR A;  4BXX G;  2C9O A;  1UE6 A;  3K0X A;  2B2Y A;  3LX0 A;  3PQI A;  5IY0 A;  4HIK A;  1GUN A;  2UUA Q;  3T1Y Q;  3PO2 G;  4K0K Q;  1R9T H;  4X62 L;  1VQ6 A;  4C56 C;  3I4N H;  3G4S A;  4HR7 B;  1Z6H A;  4ILW A;  1QZH A;  3R2I A;  4A3J H;  1UE1 A;  4L63 B;  1IBK Q;  5IYC H;  2JA8 G;  1LTG D;  2M9V A;  4DKA C;  4ZLT F;  1TWG B;  4X66 L;  1XTD A;  3K81 C;  4JI2 L;  3GTL H;  3I4M B;  2HUG A;  1ENF A;  2ZXP A;  3C1E A;  1Q90 A;  4KY6 A;  4TQU S;  5J39 A;  3S1N B;  2MPM A;  4DN4 M;  2PQE A;  4RHR A;  4JBM A;  1NMF A;  4A3C H;  1TR5 A;  5M3M H;  3S17 B;  5CYU A;  1X3G A;  5FK9 C;  2KJX A;  3RN5 A;  3NEL A;  1GOZ A;  2OQK A;  1EYC A;  2UXC Q;  3GTJ B;  4IUT A;  3IFT A;  1PYS B;  4DNT B;  1YNX A;  1XYI A;  3J7Z C;  3VYS A;  2Q2U A;  2ZM6 Q;  1U4M A;  3FEW X;  4HAE A;  2LMC B;  5JPN C;  1Z9F A;  5IYC G;  1V43 A;  4DR2 L;  2V1C C;  1QNU A;  1U5K A;  1P8L A;  1ICF B;  1X65 A;  2K5W A;  2OXP A;  4GKJ L;  2Y0S B;  1S5B D;  1HPC A;  3PSI A;  2IX1 A;  3M4O B;  3ZJY C;  3M7N A;  2AWO A;  2A1A A;  4DUZ L;  5I6W A;  4DV2 Q;  5M5Y B;  3PIO A;  4X65 Q;  2WP8 J;  4RHS A;  4A3C G;  2D9U A;  3WOF A;  4F7X A;  4R4O A;  4RAU C;  5M3M G;  3C2P A;  1EIF A;  1XTC D;  3J81 E;  1JB7 A;  1A3V A;  2JSO A;  1LT4 D;  1PTO H;  2K6A A;  4X62 Q;  2F0S A;  1WD0 A;  3NSW A;  1GD7 A;  2K04 A;  3PV0 A;  3S2H B;  1QB5 D;  1O80 A;  2Z9H A;  1I5F A;  3W3A A;  1K3R A;  4IUN A;  4QCL A;  3HOV G;  2F03 A;  3ERQ A;  1JOR A;  4X66 Q;  2UXB L;  2D0O A;  4FYD A;  4JI2 Q;  2FMC A;  2JXM B;  3D0F A;  2WAQ E;  1B9M A;  3HOW H;  1JIC A;  1YHQ A;  4KLK A;  3TP5 A;  1STN A;  2EQS A;  5C0X G;  3CCM A;  1FGB D;  3BVZ A;  2K5N A;  4X64 L;  3GTP H;  4RA8 A;  1A0I A;  1VDZ A;  2B2W A;  3MFG A;  2A73 B;  5C4X B;  1OO9 B;  1AE2 A;  4IFD I;  3Q8D A;  5G3L D;  3KF6 A;  2DJG C;  4X3K A;  1TQO A;  4XTC S;  1QE6 A;  1M1K C;  1L0W A;  3A8K E;  3R93 A;  4DR2 Q;  1JJG A;  1Q46 A;  3F2B A;  2EPB A;  1SND A;  2CH4 W;  2F4V L;  1TS2 A;  2PNH A;  1RCV D;  2XWJ B;  1HZA A;  1M4V A;  2VZA A;  3E5S A;  4RGO S;  1TU2 B;  4DUZ Q;  1EY9 A;  4ULL A;  1AE3 A;  3CU7 A;  3M4Q A;  1H9S A;  3T16 A;  5IIF A;  1QG7 A;  4YWK A;  4LF6 L;  4IQZ A;  3GTM H;  3OIP A;  4PZ8 A;  2SDF A;  4GN3 B;  4FXD A;  1BDO A;  1TWA B;  3NTK A;  4WFN 3;  1D5X C;  2R61 A;  1YHA A;  3DLL A;  4QIW E;  1G6P A;  4GOP A;  1ILP A;  4OEM B;  3I73 A;  3AYH B;  2BA0 A;  3PO3 B;  2PZU A;  1Y1V H;  5FLX c;  1XNQ L;  4KY7 A;  4NXN L;  1PZJ D;  4DFA A;  1WTO A;  3VA7 A;  1LAB A;  1FVI A;  2LY7 A;  5FLX E;  4KK7 A;  1RL2 A;  3OPO A;  3G48 A;  1M8A A;  1R9T B;  2UXB Q;  2NVQ B;  3I4N B;  3QIA A;  2GVB A;  3R2T A;  5FOB B;  1DGS A;  4A3J B;  4QY7 A;  3DHQ A;  4LJZ C;  2O4X A;  1SE2 A;  2G9H D;  2A6E C;  1ICW A;  4C2M B;  1J6Q A;  2X6G A;  3X3N A;  2JA9 A;  5COR A;  5M3F G;  3GTL B;  4X64 Q;  3ULJ A;  3GTO H;  1Q3L A;  4H44 C;  5EBC A;  1R4Q B;  3U50 C;  3JC6 6;  4O42 A;  3NTH A;  4UP9 A;  4YCV A;  4CJ2 C;  3KJO A;  3TBI B;  1Y1V G;  1EU3 A;  1IW7 D;  3Q22 A;  1PVO A;  3BU2 A;  1CT1 D;  3STB D;  3CPW A;  4CGY B;  4K5X A;  5ELD A;  1Z7T A;  2F4V Q;  2WAC A;  1D8L A;  1IBL L;  4A3F H;  1GUT A;  1HA5 A;  4OO1 G;  2RDG A;  2VY3 A;  1L1O B;  2L9H A;  4XYQ A;  1S5C D;  1CHQ D;  3F2C A;  4RH6 A;  1PTO D;  1TT2 A;  1YHB A;  1HCZ A;  5JJI A;  1SFO H;  3NTI A;  3AEV A;  1SYC A;  1STG A;  3SXH A;  5LMU L;  1K28 A;  2F0K A;  4IUU A;  2F3V A;  4G4K A;  1XNQ Q;  4NXN Q;  2B2V A;  3HOX H;  3A56 A;  1X3Q A;  2NVT H;  4KJN A;  2L0C A;  1SYG A;  5C5L A;  1YJW A;  2BA1 A;  3T51 B;  4F88 A;  4PMB A;  1L2F A;  1AFP A;  1LTI D;  1RKN A;  4JBJ A;  3IL8 A;  4DAY B;  5HGT A;  1HJP A;  1SSO A;  2ES2 A;  4A3B G;  2Z0S A;  4Z9C B;  1U9R A;  1JMC A;  2QEX A;  1VQB A;  4GNX B;  1MIU A;  4KD4 A;  2L55 A;  1UAP A;  3K5N A;  2R7Z G;  4B3R L;  1AEX A;  4LK1 C;  5G3L F;  1A3U A;  2KHJ A;  3HOW B;  1PMR A;  1T5E A;  2R7D A;  3LWE A;  4H7B A;  4LW1 A;  4HJ5 A;  2GA4 B;  5CV5 A;  3V2T A;  3D4D A;  1YNN C;  1EY7 A;  5C6A A;  1G51 A;  3K58 A;  3GTP B;  3DWQ A;  1WJJ A;  2IX3 A;  1S5D D;  1PLF A;  4G7Z C;  4GLA C;  3Q24 A;  1IBL Q;  1XMO L;  2XVS A;  3SK6 A;  2PPB C;  3I8Z A;  1PZK D;  1HNX L;  3HOY G;  3TSS A;  4RGT A;  1RTO A;  1GKH A;  2AQ1 B;  1N34 L;  3W2D A;  1JCK B;  1G91 A;  1CSP A;  1OXV A;  3JAM c;  1BR9 A;  1Q1E A;  5IGE A;  1W6J A;  5IP7 H;  3SE0 A;  2D5D A;  2EXZ A;  1XPO A;  3I72 A;  4TRD A;  1L0Y B;  3JAM E;  4UP7 A;  3J80 c;  5LMU Q;  5CC4 A;  1B9N A;  2ZJQ A;  3GTM B;  3KLR A;  2HDM A;  3ER0 A;  1ZYR C;  1SR3 A;  4GNX A;  5I9O A;  3BJU A;  1N32 L;  1DYQ A;  4K2L A;  2WIN B;  1BBX C;  4LF4 L;  3D3R A;  4RMF A;  1Y1V B;  2UUB L;  5GRO A;  2KVM A;  5I6Y A;  3PIP 3;  1HUM A;  1WTH A;  5K36 G;  2XRQ D;  2FFK B;  2LXJ A;  2A68 D;  3NQI A;  3RNU A;  1HTL D;  1YZ6 A;  2LXK A;  1LTB D;  1IYU A;  2EY2 A;  2RSO A;  3BDL A;  4OEL B;  5GAG C;  5JJZ A;  5JOB A;  2ZJP A;  4B3R Q;  1DD2 A;  5IP7 G;  3ONA B;  2SNS A;  4DGZ A;  4R4C A;  1JB3 A;  1X54 A;  2HCI A;  1CUK A;  4HJ8 A;  3KDF B;  4X3S A;  3GTO B;  3S1R H;  3I90 A;  1C48 A;  3K5L A;  4KHV A;  2EXD A;  4M8A A;  1KL9 A;  2KA7 A;  4IPG A;  1U4L A;  2TSS A;  1VQD A;  1XMO Q;  1GUO A;  3KLS X;  1CI3 M;  4BA2 I;  1PZI D;  1SNC A;  3W1B A;  1HNX Q;  2CW0 C;  3MC0 B;  1G2T A;  1PTO F;  3OHX C;  1VMC A;  3M7G A;  5E1F A;  3BZC A;  1YNJ D;  1E2Z A;  4A3F B;  2CVR A;  1N34 Q;  3MXU A;  1EY6 A;  1K8G A;  4IJL A;  1RJT A;  2L4N A;  3FKI G;  2XNA C;  3SEB A;  4G7H C;  2HIV A;  1RHP A;  4ZUI A;  5CV4 A;  5HGQ A;  3NP8 A;  3Q0A A;  1JOQ A;  2G5D A;  1G29 1;  1E22 A;  1F9S A;  3WDN A;  3PF4 A;  2YYZ A;  1QCB D;  2G9D A;  3EN2 A;  5KYI A;  4AQY L;  2RBM A;  3IFD A;  4R8I A;  1S3O A;  4XT1 B;  3H3V C;  1N32 Q;  3D6C A;  5I9P A;  4A4I A;  5C3W A;  4N9P A;  2UUB Q;  3DMU A;  4UAI A;  2A19 A;  1TWF B;  2D0P A;  3HOX B;  2JA7 G;  4OON A;  2NVT B;  2X6L A;  2E74 C;  3MZ5 A;  3I4M H;  3NWS A;  1KLU D;  1WTX A;  1PRT B;  3OWE B;  3S24 A;  4IFD H;  2A5H A;  1BQQ T;  2JA6 H;  1I3Q H;  3K7A B;  1Y8P B;  2SNM A;  1HZB A;  4LF5 L;  1SYD A;  1QOH A;  1QIL A;  3TRZ A;  4XDX A;  3T13 A;  2FIN B;  2DGY A;  3FPU B;  3D6W A;  4WJ3 M;  4ZKB B;  3MXP A;  2VXW A;  5FJ8 G;  3SHL A;  3CC2 A;  3NE5 B;  2B3G A;  4R4Q A;  3P75 A;  2QIL A;  1F77 A;  4IUP A;  2M00 A;  3SR1 A;  2EY6 A;  5JJK A;  1E0B A;  3S15 H;  2KEC A;  2KEE A;  1PH6 A;  5BN3 A;  1PFN A;  4ZCK A;  1K9M C;  4E6I A;  2UUC L;  3TZU A;  3I4M G;  4NDX A;  1BCP C;  4A3G H;  1DM0 B;  3HS0 C;  2H5X A;  2Y0S E;  2QDB A;  3NK9 A;  4PMC A;  4IFD G;  2XSC A;  2JA6 G;  2CHB D;  3J80 i;  4JOI C;  3W1G A;  3Q6S A;  1L0X B;  1PV4 A;  1YBY A;  2ZTC A;  1I50 B;  4MN3 A;  4HID A;  1CFM A;  1IKM A;  1PDQ A;  2IHF A;  1E1O A;  1B2T A;  4P72 A;  3K57 A;  4X3T A;  4JV5 L;  4DK1 A;  1EFW A;  3MAQ A;  1EL0 A;  2PZW A;  4JBK A;  4OX9 L;  2VB2 X;  1EEI D;  3DXJ C;  5E4X A;  2CKZ B;  2TMP A;  1SMY C;  5AJ3 L;  2ZXO A;  3RZO H;  5JEA G;  2Y0S G;  3CMA A;  1HFG A;  2FJ2 A;  4A3G G;  1SXT A;  5D3I B;  4DNI A;  3CXC A;  1V9P A;  2IW3 A;  3KBX A;  1CA6 A;  1YEZ A;  1B8A A;  1CKO A;  1JR0 D;  1KAW A;  1Y8O B;  1ET9 A;  3J7A 5;  2DJF C;  1VQN A;  3G71 A;  4LF5 Q;  2BE5 D;  2FHT A;  1BOS A;  4JI5 L;  2CQO A;  5GAD C;  3CCS A;  1SE8 A;  3LGJ A;  5C3X A;  1WTP A;  3S16 H;  5EKI A;  1VQC A;  4MZ9 A;  2EY1 A;  3MEF A;  3CD6 A;  1Q8K A;  1SYB A;  2K05 A;  2ZXR A;  3OMG A;  4QMG A;  5J1Z A;  1K8O A;  3S1R B;  1G2S A;  1KIX A;  2F3W A;  1GM5 A;  2UUC Q;  1TY2 A;  3ZYY X;  2VB3 X;  4JVZ A;  1SBB B;  2F0M A;  1O7I A;  1CSQ A;  3EFX D;  2Q8I B;  4CBV A;  2V4D A;  3CP0 A;  2JYO A;  3NHH A;  3I3C A;  4C3J H;  1VQH A;  2B2U C;  3TRE A;  1N8R C;  3AU7 A;  4IAL A;  3K6O A;  1F2Y A;  2A74 C;  1J5E L;  2R7F A;  2NZH A;  4JV5 Q;  4LFC L;  4U68 A;  2IWH A;  2B2Y C;  1UUP A;  2L1B A;  4OX9 Q;  3RD4 A;  1A62 A;  1EWC A;  2NVY B;  5AJ3 Q;  4CDE C;  3F8T A;  5K5P A;  1IHZ A;  1E1T A;  4IUQ A;  2XTI A;  1SE3 A;  2NVQ H;  4QUF A;  1PYW D;  3BVG A;  1WTV A;  5EAY A;  4RKL A;  4N8X 1;  3DEO A;  2QEJ C;  3MVV A;  5HUR A;  4C2M H;  1IL8 A;  3RLN A;  2K1B A;  4A3L G;  4H13 C;  1ZXT A;  2I5H A;  3M9B A;  4P73 A;  1STH A;  4QUC A;  1F9P A;  2GVA A;  3S2D B;  2JA6 B;  1B53 A;  3HRZ C;  4JI5 Q;  3PO3 G;  1I3Q B;  2K52 A;  3CKI B;  1EQQ A;  2H4O A;  2F52 A;  4YHH L;  2EJM A;  2VL6 A;  4K2K A;  1HQR D;  2PQA B;  1C9O A;  3I4N G;  4EX5 A;  1S5F D;  2F0E A;  2OCE A;  4HIM A;  4A3J G;  4V19 0;  2I07 B;  4JI4 L;  4HTH A;  4IZ8 A;  2VQF L;  3IKJ A;  3S15 B;  1EEF D;  3KYH C;  4OWW B;  1I4H A;  2RCN A;  1V1O A;  2LFN A;  2MGS A;  4Y7N H;  4ZAI A;  1X9N A;  4A3G B;  1J5E Q;  2I0Q A;  5IYB H;  1LT3 D;  3D4R A;  1N33 L;  2KBN A;  4LFC Q;  1X3E A;  3OOC A;  3L0O A;  5D14 A;  1ILQ A;  1EWI A;  1MKH A;  2EJG C;  2EYF A;  4IUV A;  2WII B;  2L12 A;  4LAA A;  5I4D A;  2XIW A;  1VQM A;  3HZX A;  4U67 3;  5FLM H;  5KYL A;  3SK4 A;  1SNO A;  2JQO A;  4MIU A;  2KCM A;  4DU9 A;  2QGQ A;  1DOK A;  2HDL A;  2ALY B;  3K59 A;  5LMN W;  4UPA A;  1EIH A;  5JPM C;  3BS1 A;  3RZO B;  1KNE A;  3MA2 B;  1XWE A;  3M4Y A;  1SYF A;  2AKW B;  1VMP A;  1Y69 U;  3D4W A;  1JC7 A;  2B63 B;  3URY A;  2VUM H;  1G8Z D;  4R8N A;  5IYB G;  3U4Z A;  4LF8 L;  2MQH A;  1QWY A;  2B2W C;  1RF2 D;  1NNX A;  3DWP A;  3R8B A;  2HD3 A;  4A3K H;  1CHP D;  2N78 A;  3KFU A;  4HCE A;  4JI8 L;  3K5M A;  1YIT A;  4YHH Q;  1EOT A;  1HNW L;  4J6H A;  3U9O A;  5IT9 L;  2J4X A;  1WVL A;  3S16 B;  4LUV A;  4JI4 Q;  2K5D A;  3SVM A;  2VQF Q;  2K28 A;  3PGZ A;  2JA5 H;  3K0Y A;  4KHP L;  1F9Q A;  4ZYS A;  4GKJ Q;  3I4O A;  1OTC A;  1EIY B;  4XXE A;  4UP8 A;  3HOW G;  4FXK C;  4J8Q A;  1B50 A;  4RKB A;  1N33 Q;  4C3J B;  1N9W A;  4HMI A;  1IKL A;  2QDL A;  4GOP C;  1CZW A;  2JK8 A;  4B3T L;  2ATW A;  5DNF A;  1BF4 A;  2J0T D;  5CV7 A;  3H6M A;  3F1Z A;  3R3O A;  1GUS A;  1EYA A;  2E2I H;  3W5O A;  4IOC A;  2O5J C;  4BY7 H;  3VDY A;  1FR3 A;  1JJC B;  1LO5 D;  1FYC A;  5IOD A;  4Q0F A;  1ASZ A;  3I4L A;  1VQO A;  2DN8 A;  5DLQ E;  4H0L C;  4LF8 Q;  1BBW A;  3CC4 A;  1PH5 A;  5E7N A;  4ID6 A;  4Q5V A;  4HJ7 A;  2EYO A;  4A3E H;  1HNZ L;  4DNR B;  4JI8 Q;  2Q2T A;  1ENA A;  3CRK C;  1HTP A;  4B3M L;  4LFB L;  2KHI A;  2L5T A;  4A3M H;  1HNW Q;  4L8J A;  3KK7 A;  2F0H A;  2HHH L;  2JP1 A;  3U58 A;  2VNU D;  1OXT A;  4NW2 A;  4O0A A;  1KDB A;  1J8I A;  1BBU A;  4BY7 G;  4TKO B;  4XT3 B;  2DNE A;  3GTQ H;  4KI0 A;  4LF7 L;  2HT1 A;  2F1M A;  4OWT B;  1EUJ A;  3GV6 A;  1WTQ A;  1WOC A;  2FXQ A;  4DV7 L;  1GHJ A;  4LF6 Q;  3A54 A;  5ELO A;  2XRS D;  4YCU A;  4Y7N B;  4B3T Q;  1CKM A;  4S3S A;  3ULP A;  4EQP A;  4A3M G;  1S4Z A;  4GKK L;  3J81 i;  5A2Q E;  2OF1 A;  5CV9 A;  1B3Q A;  5LMN L;  1N36 L;  1KDC A;  1TWF H;  3EQL C;  5C3E H;  2E76 C;  4IPD A;  3I56 A;  1TXY A;  1Y8N B;  1NR4 A;  2Q2I A;  3J81 L;  4KN7 C;  4A3F G;  2F0T A;  2PYK A;  1MSG A;  4DV3 L;  2HQL A;  2PNR C;  1BXT A;  3K7A H;  2CQA A;  2YTV A;  2OEO A;  4G57 A;  1VQA A;  1LTL A;  4DA2 A;  1EQT A;  1SJH D;  2ZJR A;  1K8M A;  5EJW A;  3FMC A;  1HNZ Q;  2WKC A;  4AIM A;  4B9W A;  1IW7 C;  4B3M Q;  3CCU A;  4LFB Q;  2VUM B;  3STB C;  5IGB A;  2QKI C;  2UU9 L;  2HHH Q;  4A3K B;  1L1O A;  5IGC A;  4JI7 L;  1D2B A;  2ZTD A;  4FP5 D;  3KOJ A;  4L6T B;  3HOU H;  4NP5 A;  2RQX A;  3HOX G;  1B70 B;  4P75 A;  3G6E A;  2AHO B;  2RDH A;  3C46 A;  2GN5 A;  3QG1 A;  4C3H B;  2CWA A;  1O7Z A;  1CM9 A;  5IGD A;  5H1S E;  1KTK A;  2F0V A;  1F9R A;  1FGU A;  1QUQ B;  4GLV B;  4R9W A;  2Z6K C;  4LF7 Q;  1PTO C;  1I4Q A;  2ENB A;  2KED A;  2JA5 B;  1I50 H;  3E6Z X;  3MEH A;  3CCV A;  1VQI A;  2RA4 A;  4DV7 Q;  5C4H A;  5D3D A;  4BWG B;  4LUZ A;  5COY A;  1D7Q A;  2WB1 B;  4PZ6 A;  2L15 A;  5NUC A;  4DR5 L;  4DAY A;  4GKK Q;  3K7U C;  1BVS A;  1MBY A;  2BDN A;  4CKC A;  3A5U A;  5LMN Q;  2XWB B;  1EFI D;  2N49 A;  3HOU G;  4C1N I;  3NQT A;  1N36 Q;  4QQB X;  4WOR A;  4EQN A;  3J80 E;  2DY7 A;  3N52 A;  1I4G A;  2Z6B A;  4IN3 A;  2CCZ A;  2A69 D;  3ERS X;  4NMZ A;  1PH1 A;  1AW7 A;  5DM6 3;  2NUC A;  4IPC A;  1LTA D;  2KCT A;  4OL7 A;  4DV3 Q;  2NZ1 D;  4ODG A;  3X3M A;  2E2I B;  1MGS A;  1VQ8 A;  3MXN B;  3G6J B;  3OW7 A;  3AMU A;  4DPG A;  2HIX A;  4KD3 A;  4BY7 B;  3ICE A;  4KHZ A;  2EVB A;  1E7Z A;  4K6L A;  3RUZ A;  1A6X A;  2CH4 A;  2KUM A;  5FLX L;  2VQE L;  3BZD B;  4ABN A;  3NBH B;  4K8I A;  2UU9 Q;  1MHW C;  4PNY A;  3H15 A;  4RGN A;  1JJ2 A;  3QR8 A;  4JI7 Q;  3HOZ H;  5EQ0 A;  4A3E B;  1PFM A;  2K5Q A;  2F0J A;  1E2W A;  4A93 B;  1TWC H;  4A3M B;  1YI2 A;  4KJO A;  3UI2 A;  1AZQ A;  1VQL A;  1OXU A;  3KLW A;  3LNN A;  3CME A;  1EY8 A;  2B2T A;  3TME A;  3D31 A;  4ZKC B;  3RMH A;  4POF A;  2I46 A;  2K33 A;  3H0G H;  1VF7 A;  3RLF A;  2Q2H A;  1HFN A;  1A3T A;  1SEB D;  2F3I A;  2QW7 A;  3GTQ B;  3UDI A;  3WWV A;  4IJH A;  3AFP A;  4EGV A;  4PMW A;  1STA A;  3TZD A;  3BYY B;  2AUK A;  4DR5 Q;  2I5L X;  3A74 A;  3M4P A;  3TP6 A;  4B3S L;  4IUR A;  2NVY H;  3MXN A;  4JK1 C;  3FP9 A;  3PUV A;  2WKD A;  3BDC A;  5GQO A;  3IRB A;  1VQ9 A;  3RLO A;  3CCL A;  1KAB A;  1EY0 A;  1PH4 A;  1PFS A;  2EJF C;  4LF4 Q;  4KKS A;  3DEP A;  2EYM A;  2A68 C;  1RIP A;  3A7A B;  3H09 A;  3QB3 A;  4B9X A;  1PRT D;  2RDF A;  3T53 B;  5C3E B;  4FDB A;  4KV6 A;  3NEM A;  3V96 A;  2EE1 A;  3KDF A;  3ND9 A;  5DM7 3;  1S40 A;  1Q8I A;  5KRU A;  3H0G G;  1II3 A;  4DV4 L;  3FHW A;  1F2M A;  1T5X D;  1GUW A;  2KEN A;  3UDX A;  3UDG A;  4BBS H;  3S2D H;  4I7A A;  3SK8 A;  2VQE Q;  2K14 A;  1BCP B;  4C3I H;  3FRP B;  5FO8 B;  1G6Z A;  3VYR A;  1PHJ A;  5KIX A;  5JAV A;  2K4K A;  3NPP A;  2PW7 A;  1WTR A;  1Z47 A;  2NTS A;  1HH2 P;  1NE3 A;  3GTK B;  4K8J A;  2F0Q A;  3F2U A;  4RWS C;  2R92 B;  1RTN A;  4DAM A;  5C0X J;  1X56 A;  4NPS A;  1C0A A;  4CDC C;  4O1N A;  3PCO B;  3T1H L;  1VQ4 A;  1YNJ C;  2A6H D;  1Y14 B;  4JG2 A;  3HOU B;  4HJA A;  3CCE A;  1W6K A;  3CCQ A;  1HXY D;  2K01 A;  4ME5 A;  4BS9 A;  3S9W A;  5J22 A;  1XNR L;  1UWV A;  1XPU A;  3NUC A;  3TS2 A;  1SMX A;  1BKB A;  1JT8 A;  2O2L D;  4M1U B;  3UE0 A;  5GAH C;  1EY5 A;  2EYJ A;  4GS3 A;  4C3I G;  1I4R A;  1F2L A;  1HUN A;  4B3S Q;  2IL8 A;  4IOA A;  4R4I A;  5KND A;  5E4W C;  4DF7 A;  2VS1 A;  2VW9 A;  4AQY Q;  3HG9 A;  2Q8R E;  3L3O C;  4DV5 L;  2RVL A;  2KCC A;  1I94 L;  4BBR H;  1PH3 A;  2DUD A;  4G7O C;  4RGM A;  3OIQ A;  1AN8 A;  2O5I C;  3C3L A;  3L9A X;  2IHE A;  3RN2 A;  3GDE A;  1RD9 D;  2JE6 I;  5AFW A;  4CJ0 B;  2BDO A;  2AUJ D;  4JOI A;  1ZEQ X;  2X69 A;  5KNC A;  4DV4 Q;  1UE7 A;  2B63 H;  4KMU C;  2Z1C A;  4P74 A;  3NXW A;  2K75 A;  4DXF A;  5HY6 A;  2L11 A;  4FF1 A;  1XXG A;  3J7A V;  3HKS A;  3FVQ A;  4LUO A;  1VQ7 A;  5IP9 H;  4RCO A;  1ENC A;  1CQV A;  1K83 H;  2NB0 A;  4K0K L;  1MI2 A;  1PFB A;  3J81 j;  2PMZ B;  3K8A A;  2OTL A;  3I91 A;  5LHY 1;  1GUG A;  1V1P B;  1MD2 D;  1YIJ A;  3NBI A;  1S72 A;  1WTW A;  1IBK L;  1EYG A;  5IT9 c;  1K0S A;  3T1H Q;  4ZUJ A;  1IXR A;  2ZT9 C;  2UXD L;  3HOZ B;  2LKV A;  5IT9 E;  1SAP A;  4AH6 A;  4A76 A;  1XNR Q;  1TWC B;  2R93 H;  5M5W B;  2B63 G;  1FJG L;  4BY1 H;  4BA1 I;  2R6G A;  4C1N K;  4A3I B;  1EZ6 A;  2F0G A;  1SNM A;  1VQG A;  3S1M B;  4AYB B;  2RF4 A;  5ELB A;  1K8A C;  5IGF A;  3EBE A;  3CC7 A;  1STB A;  5IP9 G;  3H0G B;  3N6R A;  1K0R A;  4I65 A;  4TSS A;  1VQK A;  2C5C A;  4DV5 Q;  5ELF A;  1I94 Q;  3D8G A;  1CKN B;  2JEA I;  4OXP A;  1PRT F;  3ND8 A;  3HFZ B;  2JA8 H;  4POG A;  1BCP F;  4KKT A;  4DR3 L;  3PIP A;  3BZK A;  2WFW A;  4RCN A;  1NR2 A;  3KF8 B;  4RFB A;  5J3B A;  1ML0 D;  2M2L A;  5BN4 A;  2B39 A;  5F2D A;  3GV3 A;  2BE5 C;  3CRL C;  3QO2 A;  1V1P A;  1TWH B;  4C3J G;  3EVQ A;  4J15 A;  4EVO A;  4L5T A;  2Z8L A;  1FNV A;  1PYB A;  3ERO A;  5M9O A;  4K5W A;  3MTS A;  1SE4 A;  2ICE C;  2SEB D;  4MTK A;  5EBD A;  4BBS B;  2OTJ A;  4P2C B;  4HSP A;  4IO9 A;  1PH7 A;  1WI5 A;  4GN4 B;  4C3I B;  1TY0 A;  2CFM A;  2RHQ B;  1HQM C;  3OWF A;  2FMM A;  1FD7 D;  1TS5 A;  2EDG A;  2F0D A;  4JC0 A;  3HEJ A;  3NEN A;  2UXD Q;  5GAE C;  4A3D B;  1TII D;  4OHJ A;  1X6O A;  2E2J H;  2YTY A;  4GZY C;  4WJW A;  2K03 A;  4RG1 A;  3TP8 A;  1FJG Q;  1E2V A;  3AQQ A;  1LT6 D;  1U4R A;  1CKN A;  4B08 A;  1EOV A;  1CK1 A;  1P16 A;  2E8G A;  4OGQ C;  3CPF A;  4CKB A;  1I6V C;  5FO9 B;  2MJ8 A;  1VS0 A;  2PW5 A;  3J7A F;  2KQ3 A;  3KUP A;  5EKL A;  3KF8 A;  3T4A C;  1Q81 C;  3AB9 A;  4HSV A;  3LWU A;  4ALP A;  3MWY W;  4JI1 L;  3CQZ B;  1SJE D;  1A15 A;  3CW2 C;  3QOL A;  5M5X H;  4DR3 Q;  1O78 A;  1LUZ A;  3HOV H;  2PI2 A;  3PMF A;  1ZKO A;  1CQF A;  4BBR B;  2NVX H;  2N55 A;  3KF6 B;  2YTX A;  3J81 c;  3UE1 A;  1QVC A;  3E0J A;  1SNQ A;  3F2D A;  5C0X H;  4K5V A;  3PF5 A;  2F0W A;  1TS3 A;  2N88 A;  1PA6 A;  1HRJ A;  3GTG H;  3S14 H;  2RSN A;  2IX0 A;  3S1Q H;  1KQS A;  2IPK D;  5DAU A;  4GN5 A;  1Q82 C;  2EYP A;  3E0E A;  4YWL A;  2PQA A;  1VQ5 A;  2E75 C;  1STE A;  1H9S B;  4JW0 A;  1AH9 A;  1A2U A;  3DWA A;  4DR6 L;  3BYT B;  1LTR D;  3DM1 A;  5C4J H;  4QGU A;  1K83 B;  5FLM G;  4FNF A;  4C3H H;  4GOP B;  2QF7 A;  2F0U A;  3NWT A;  4NKL A;  5EPK A;  1LTT D;  2MO0 A;  3GQB A;  5IWA L;  3HKZ E;  3TS0 A;  5CV8 A;  4CKE A;  4DUY L;  2MUY A;  4CDD C;  1VQF A;  1EIG A;  1R4P B;  4JYA L;  2F0L A;  2R93 B;  1DXM A;  2A6E D;  4BY1 B;  2VUM G;  3C1F A;  3TP7 A;  4L5S A;  5C44 B;  1STY A;  4DK0 A;  5TSS A;  2WB1 E;  4LMQ D;  4A3K G;  2AMC B;  4DAP A;  2HQE A;  4JI1 Q;  1UNS A;  3T56 B;  4JPB W;  2WAQ G;  3PO2 B;  1AP0 A;  4Y52 H;  4TVA B;  2B29 A;  4C3H G;  4R1J A;  3HKZ G;  3A8J E;  4DR7 L;  1KRS A;  3FPP A;  1Q86 C;  2JA8 B;  1O7L A;  1ASY A;  2MO1 A;  2JA5 G;  4HN7 A;  3I55 A;  1NY4 A;  3HGB A;  1TS4 A;  5M3F H;  2YV5 A;  3H91 A;  2C35 B;  3GO5 A;  4CJ1 B;  3A5Z B;  2OT2 A;  1KHI A;  4ZQ3 A;  5A35 A;  4UY8 C;  3VYT A;  3EJI A;  2PZT A;  1D5Z C;  5ELC A;  1XJV A;  2WB1 G;  1JWM D;  1KRT A;  4F8M A;  1GVP A;  3U4V A;  2N3S A;  2IY5 B;  1MSH A;  2NN6 I;  3I2Z A;  4CDF C;  1XPR A;  4DR6 Q;  3SK5 A;  5BR8 L;  4MNO A;  4YIJ A;  4K6D A;  4A93 H;  1QVF A;  4DXG A;  2NWG A;  4MTN A;  5E3F A;  2MNA A;  1H95 A;  1X55 A;  2LSS A;  1X3P A;  4DK3 C;  4OO1 H;  5EKK A;  1PH8 A;  4X3U A;  5IWA Q;  1Q7Y C;  3H3V H;  1AZP A;  2JN4 A;  4DUY Q;  1W3S A;  3CCJ A;  1LLR D;  4XQJ A;  4KHP Q;  2EOT A;  3P1H A;  1Q1B A;  2HCC A;  2E2J B;  4JYA Q;  4DR4 L;  1LT5 D;  2AQ3 B;  1H9K A;  1M90 C;  1C7Y A;  2MP1 A;  1HA6 A;  3QOJ A;  1B1Z A;  4XQQ A;  4KN4 C;  2QA4 A;  1A8V A;  4JBW A;  1XMQ L;  1ONL A;  5M3M B;  1D1K A;  1HR0 W;  4JI0 L;  4WRD A;  4UDU C;  4JCV E;  3ULL A;  1VCI A;  4A3E G;  1C8C A;  1KD1 C;  2J7Z A;  2AQ2 B;  4IFD J;  2LS0 1;  3VR3 A;  4OIJ A;  4A93 G;  4LFA L;  2E2H H;  4QB4 A;  1HHV A;  1YNN D;  2B2V C;  1K3B C;  1WCM H;  4HMJ A;  4DR7 Q;  1MJC A;  1E24 A;  1SRO A;  3TDQ A;  4A3B H;  4F87 A;  3I7F A;  4HED A;  3MXG A;  5ISR A;  1JE4 A;  5M5X B;  3M3Y H;  5CMD A;  5EPL A;  1OXS C;  3HOV B;  1U0L A;  1V8Q A;  5JJL A;  4OIK A;  2R7Z H;  1EQV A;  3B6Y A;  3ITP A;  3A55 A;  4L5Q A;  2NVX B;  1B4O A;  2K5H A;  3SDZ A;  1JWS D;  1TKW B;  2NZO A;  1WYD A;  2NTT A;  1DON A;  1B44 D;  5JEA J;  5KNB A;  1YJN A;  3GTG B;  3BVM A;  3S14 B;  2EYH A;  3S1Q B;  1PTO B;  1VQE A;  1UE5 A;  4OWX B;  3GTK H;  1GHK A;  3EIV A;  1JOK A;  5BR8 Q;  2R92 H;  1U4P A;  4MHE A;  4DR1 L;  1L1O C;  1ZYR D;  1WCM G;  2K7V A;  4K14 A;  1I6H H;  1QJO A;  3VYU A;  4I7Z C;  4QF4 A;  3VR2 A;  1DOL A;  4GLX A;  2F0P A;  5C4J B;  5C3E G;  4KKU A;  3HOY H;  1X3F A;  2BCO A;  2WAQ B;  2E2D C;  4JI6 L;  4NXM L;  1UEB A;  3HKZ B;  1JE5 A;  4DR4 Q;  3IAY A;  1GJX A;  2BH2 A;  2R3Z A;  4DV6 L;  3L7Z C;  1XMQ Q;  3E9I A;  3RR5 A;  4JI0 Q;  3KJP A;  2JEB I;  1EZ8 A;  1IZ6 A;  2K5V A;  4A75 A;  1NCV A;  1WFQ A;  4PG3 A;  2R92 G;  4P71 A;  2QCP X;  1S5E D;  5EGT A;  3Q23 A;  4LFA Q;  3CHB D;  4GNX C;  2I5M X;  3KLS A;  1NUC A;  2Z4I A;  4FF3 A;  5K36 H;  3OTO L;  2KHS A;  4L5R C;  4ZK9 B;  2Z6K A;  4DV1 L;  1TVX A;  4QJF A;  3A8I E;  4R4T A;  2Q8T A;  2CW0 D;  2DY8 A;  4IPH A;  4DV0 L;  2BOS A;  1T9H A;  1IBM L;  2AWN A;  4HCS A;  1SNP A;  2CWP A;  4YY3 L;  1IL2 A;  2XN9 C;  5M3F B;  4QIW B;  1JOO A;  1A63 A;  2JJQ A;  4QL5 A;  3BDO A;  5C0X I;  1O7Y A;  1H9J A;  4DR1 Q;  1HZ9 A;  3SGI A;  1IYJ B;  1QUQ A;  1DOM A;  2PMZ E;  2RKS A;  2RCF A;  4FXG C;  4WJ4 A;  2MHV A;  3V05 A;  3OSO A;  4YWM A;  1A2T A;  4FVM A;  4JI6 Q;  4NXM Q;  5M5W H;  2B2T C;  3DUZ A;  4A3I H;  4EQO A;  1NBW A;  2K32 A;  1QVG A;  4ZRZ A;  2PCF B;  2B8F A;  3FKI H;  3HP3 A;  1HR0 L;  3BG3 A;  4FO2 A;  3S1M H;  4DV6 Q;  5C4Z A;  3K80 C;  5ELE A;  4J1M A;  4APV A;  4AYB E;  1EY4 A; 
#chains in the Genus database with same CATH homology
 3DM3 A;  3A0J A;  3J81 j;  3RZD H;  2ALY B;  3K8A A;  5LMN W;  4UPA A;  2OTL A;  1VQP A;  1YIJ A;  1Y1W H;  3E9H A;  1S72 A;  3F2C A;  1IBK L;  1EYG A;  5IT9 c;  1YHB A;  3T1H Q;  1IXR A;  2AKW B;  4YCW A;  2UXD L;  5JJI A;  1SFO H;  3AEV A;  4AH6 A;  4A76 A;  2VUM H;  1LYL A;  1XNR Q;  3HOZ G;  5IYB G;  5LMU L;  2YU9 H;  3U4Z A;  2ID0 A;  2BH8 A;  2JA7 H;  2R93 H;  4LF8 L;  2MQH A;  2B63 G;  1XNQ Q;  3OTO Q;  4BY1 H;  4NXN Q;  1FJG L;  4BA1 I;  2R6G A;  3HOX H;  3OYY A;  4HIO A;  4DV1 Q;  4A3K H;  2NVT H;  1VQG A;  4A3I G;  2RF4 A;  2N78 A;  1YJW A;  2BA1 A;  4JI8 L;  1QZG A;  3KFU A;  4NB3 A;  1K8A C;  1L2F A;  1YIT A;  4YHH Q;  3CC7 A;  3EBE A;  3OW2 A;  4DV0 Q;  4JBJ A;  1TWH H;  4AYB G;  4DAY B;  5IP9 G;  1IBM Q;  4JI7 Q;  1HNW L;  1HJP A;  1K0R A;  1W2B A;  4YY3 Q;  2ES2 A;  4A3B G;  2Z0S A;  2MFI A;  1GO3 E;  4LUV A;  1JMC A;  1VQK A;  2QEX A;  1VQB A;  4GNX B;  1MIU A;  3TQY A;  4DV5 Q;  4JI4 Q;  1SN8 A;  1I94 Q;  2PI2 E;  1CKN B;  2VQF Q;  2JEA I;  1Y1W G;  4OXP A;  3PGZ A;  2R7Z G;  2JA5 H;  3HFZ B;  5FJ8 H;  1YJ9 A;  4B3R L;  4KHP L;  2RHS B;  3PUY A;  4POG A;  2JA8 H;  2KHJ A;  4DR3 L;  2ASB A;  4GKJ Q;  3I4O A;  3PIP A;  1OXX K;  2R7D A;  3BZK A;  1OTC A;  4LW1 A;  4HJ5 A;  1EIY B;  4UP8 A;  2WFW A;  3HOW G;  3KF8 B;  5J3B A;  2E5L L;  1TWG H;  4A3D H;  1SRU A;  3PUX A;  1KC8 C;  1N33 Q;  1G51 A;  2OQ0 A;  4LNQ A;  1N9W A;  1WJJ A;  4GOP C;  1V1Q A;  3S1N H;  4GLA C;  5IYD H;  3M85 A;  2JK8 A;  1XMO L;  4PZ7 A;  4J15 A;  1IBL Q;  4L5T A;  4B3T L;  1PYB A;  3GD7 A;  2ATW A;  3S17 H;  1HR0 Q;  3AFQ A;  2OTJ A;  3F1Z A;  1HNX L;  3HOY G;  3GTJ H;  4OO1 I;  4IO9 A;  2E2I H;  1PH7 A;  1WI5 A;  3L2P A;  1GKH A;  4ME3 A;  4GN4 B;  3W5O A;  3H3V I;  4BBS G;  2CFM A;  2RHQ B;  4IOC A;  1N34 L;  1CSP A;  1OXV A;  3JAM c;  4BY7 H;  1Q1E A;  3VDY A;  2K50 A;  5IP7 H;  4JC0 A;  2UXD Q;  3NEN A;  1XPO A;  1JJC B;  5GAE C;  5ELN A;  3CQZ H;  1X6O A;  4UP7 A;  3J80 c;  2E2J H;  2YTY A;  5LMU Q;  4RG1 A;  4A3D G;  1ASZ A;  1VQO A;  2ZJQ A;  4LF8 Q;  5DLQ E;  3ER0 A;  1FJG Q;  1BBW A;  1YVC A;  3CC4 A;  2IT1 A;  1SR3 A;  4JI3 L;  3M4O H;  1PH5 A;  3AQQ A;  5E7N A;  3JAM i;  4GNX A;  1B7Y B;  1CKN A;  3BJU A;  5M5Y H;  1N32 L;  4HJ7 A;  5IYD G;  4A3E H;  1EOV A;  1HNZ L;  4JI8 Q;  4LF4 L;  1K73 C;  2Q2T A;  4X6A H;  4LF9 L;  4B3M L;  1P16 A;  2E8G A;  4LFB L;  2KHI A;  4RMF A;  3CPF A;  3UDF A;  4A3M H;  2UUB L;  5GRO A;  1HNW Q;  1VS0 A;  4DK6 C;  2HHH L;  3U58 A;  4HJ9 A;  1Q81 C;  2A8V A;  5K36 G;  2VNU D;  1OXT A;  2LXJ A;  3RNU A;  1YZ6 A;  2LXK A;  4O0A A;  4ALP A;  4JI1 L;  1BBU A;  2ZJP A;  4BY7 G;  4B3R Q;  5GAG C;  3CW2 C;  3M7N A;  5M5X H;  5IP7 G;  4DR3 Q;  3S2H H;  1LUZ A;  3HOV H;  2PI2 A;  3GTQ H;  2ZTE A;  4KI0 A;  2EIF A;  4R4C A;  1NJI C;  2UUA L;  3T1Y L;  4LF7 L;  1X54 A;  3TEH B;  2HT1 A;  2E5L Q;  3CF5 A;  1CUK A;  4HJ8 A;  4OWT B;  3KDF B;  1EUJ A;  2NVX H;  3KF6 B;  2YTX A;  3J81 c;  3UE1 A;  1QVC A;  3S1R H;  1WOC A;  3F2D A;  1NMG A;  2FXQ A;  4BBR G;  4XIG S;  4DV7 L;  4LF6 Q;  3PF5 A;  5ELO A;  2EXD A;  1PA6 A;  1KL9 A;  1FL0 A;  2XGT A;  4YCU A;  3GTG H;  2OWO A;  3S14 H;  4IPG A;  2IX0 A;  4B3T Q;  1VQD A;  1XMO Q;  1KQS A;  1CKM A;  3S1Q H;  5IE8 A;  4EQ5 A;  3ULP A;  4A3M G;  4BA2 I;  4GN5 A;  3PUW A;  1Q82 C;  3J81 i;  3E0E A;  4GKK L;  4YWL A;  2NN6 G;  1SLJ A;  2PQA A;  3W1B A;  3CAM A;  1VQ5 A;  5C4X H;  1LM0 A;  1HZC A;  5LMN L;  1HNX Q;  1N36 L;  1TWF H;  3BZC A;  1KXL A;  5C3E H;  1N34 Q;  1AH9 A;  4DR6 L;  4IPD A;  3I56 A;  1NTG A;  5C44 H;  1TXY A;  2Q2I A;  5C4J H;  1K8G A;  4IJL A;  4QGU A;  4LWC A;  1E3P A;  3FKI G;  5FLM G;  4A3F G;  3PUZ A;  4BXX H;  2HIV A;  2UXC L;  4C3H H;  4DV3 L;  5HGQ A;  4GOP B;  2HQL A;  3PO2 H;  2D62 A;  1G29 1;  1E22 A;  3K7A H;  3PF4 A;  2MO0 A;  2ZM6 L;  2YYZ A;  2YTV A;  1PH9 A;  5IWA L;  3EN2 A;  3HKZ E;  3TS0 A;  4JI3 Q;  4AQY L;  4DUY L;  1VQA A;  1LTL A;  1S3O A;  2ZJR A;  1VQF A;  3CCR A;  1N32 Q;  1HNZ Q;  4AIM A;  4A4I A;  4LF9 Q;  4B3M Q;  3CCU A;  4JYA L;  4LFB Q;  4O2D A;  3STB C;  2UUB Q;  4A3L H;  2A19 A;  2VUM G;  2D0P A;  2UU9 L;  1VQJ A;  2HHH Q;  2JA7 G;  2R93 G;  1TWA H;  4OON A;  1L1O A;  4L5S A;  4DV2 L;  5C4X G;  4JI7 L;  2ZTD A;  4BY1 G;  3KOJ A;  3HOU H;  3HOX G;  4X65 L;  1PH2 A;  3I4M H;  1B70 B;  2WB1 E;  4P75 A;  4A3K G;  2AMC B;  3G6E A;  4H02 A;  2N8N A;  4JI1 Q;  1Q12 A;  1MJE A;  2AHO B;  3PO3 H;  5C44 G;  2GN5 A;  2CWA A;  5H1S E;  3S24 A;  2JA6 H;  2WAQ G;  1EQR A;  4Y52 H;  4BXX G;  1I3Q H;  4TVA B;  2B29 A;  1FGU A;  1QUQ B;  1UE6 A;  3K0X A;  4GLV B;  4R1J A;  3HKZ G;  1HZB A;  5IY0 A;  4HIK A;  2UUA Q;  2Z6K C;  3T1Y Q;  4LF7 Q;  3PO2 G;  4K0K Q;  4DR7 L;  1R9T H;  4LF5 L;  1KRS A;  4X62 L;  1VQ6 A;  3I4N H;  1I50 H;  3G4S A;  3CCV A;  1Q86 C;  1VQI A;  3TRZ A;  1QZH A;  4WJ3 M;  2DGY A;  4DV7 Q;  1ASY A;  2MO1 A;  4A3J H;  2JA5 G;  1UE1 A;  5FJ8 G;  4LUZ A;  3I55 A;  5IYC H;  1IBK Q;  3CC2 A;  2JA8 G;  1NY4 A;  1D7Q A;  5M3F H;  2YV5 A;  2B3G A;  2C35 B;  4R4Q A;  3GO5 A;  4DKA C;  4PZ6 A;  4X66 L;  2L15 A;  3A5Z B;  1KHI A;  1XTD A;  3K81 C;  4DR5 L;  4JI2 L;  4UY8 C;  3GTL H;  5JJK A;  4GKK Q;  3S15 H;  1XJV A;  2WB1 G;  3K7U C;  1BVS A;  1PH6 A;  4TQU S;  1KRT A;  3A5U A;  5LMN Q;  1GVP A;  3U4V A;  1K9M C;  2N49 A;  3HOU G;  2UUC L;  1N36 Q;  2N3S A;  4QQB X;  3I4M G;  2IY5 B;  2NN6 I;  4JBM A;  1NMF A;  3I2Z A;  4A3C H;  4A3G H;  5M3M H;  2H5X A;  2Y0S E;  1XPR A;  1X3G A;  4DR6 Q;  5BR8 L;  2CCZ A;  3RN5 A;  4IFD G;  4MNO A;  3NEL A;  3ERS X;  2JA6 G;  3J80 i;  4JOI C;  3W1G A;  4A93 H;  1PH1 A;  1PV4 A;  1YBY A;  2ZTC A;  2OQK A;  1QVF A;  2UXC Q;  4IPC A;  2KCT A;  4DV3 Q;  4HID A;  4MTN A;  2MNA A;  1H95 A;  1PYS B;  1YNX A;  1VQ8 A;  1X55 A;  2LSS A;  2IHF A;  3MXN B;  4DK3 C;  3J7Z C;  2Q2U A;  2ZM6 Q;  1PH8 A;  5IWA Q;  1Q7Y C;  1E1O A;  3H3V H;  4DPG A;  2HIX A;  4P72 A;  4JV5 L;  4DUY Q;  3ICE A;  4KHZ A;  1W3S A;  1Z9F A;  3CCJ A;  1EFW A;  1E7Z A;  5IYC G;  1V43 A;  4KHP Q;  4DR2 L;  4JBK A;  4OX9 L;  1Q1B A;  2V1C C;  4JYA Q;  4DR4 L;  2CKZ B;  1M90 C;  1U5K A;  1C7Y A;  2VQE L;  1P8L A;  1X65 A;  4GKJ L;  5AJ3 L;  3NBH B;  3PSI A;  2QA4 A;  2IX1 A;  1A8V A;  2UU9 Q;  3RZO H;  3ZJY C;  4JBW A;  1XMQ L;  2AWO A;  2A1A A;  5JEA G;  3H15 A;  4DUZ L;  2Y0S G;  4DV2 Q;  1JJ2 A;  3CMA A;  1HR0 W;  4JI0 L;  3PIO A;  3HOZ H;  4X65 Q;  4JCV E;  3ULL A;  2WP8 J;  1VCI A;  4A3C G;  4R4O A;  4A3G G;  5M3M G;  1EIF A;  4DNI A;  3CXC A;  1TWC H;  1V9P A;  4A3E G;  1JB7 A;  1KD1 C;  1YI2 A;  4IFD J;  1YEZ A;  1B8A A;  1CKO A;  1VQL A;  1KAW A;  1OXU A;  2E2H H;  4LFA L;  4A93 G;  3KLW A;  3CME A;  3J7A 5;  1WCM H;  1VQN A;  3D31 A;  3G71 A;  4DR7 Q;  1MJC A;  4LF5 Q;  4X62 Q;  1E24 A;  1SRO A;  4POF A;  4A3B H;  3I7F A;  1GD7 A;  3H0G H;  3PV0 A;  4JI5 L;  2Q2H A;  3RLF A;  2CQO A;  5GAD C;  3M3Y H;  1OXS C;  2F3I A;  1U0L A;  1SE8 A;  3CCS A;  1I5F A;  3LGJ A;  3UDI A;  5JJL A;  3WWV A;  4IJH A;  3AFP A;  3S16 H;  2R7Z H;  1K3R A;  3B6Y A;  1VQC A;  4MZ9 A;  4PMW A;  3HOV G;  4X66 Q;  3MEF A;  2UXB L;  4L5Q A;  3CD6 A;  2D0O A;  4JI2 Q;  1Q8K A;  4DR5 Q;  2I5L X;  2K5H A;  3D0F A;  3A74 A;  3M4P A;  4B3S L;  2WAQ E;  2NZO A;  1WYD A;  1KIX A;  2NVY H;  5JEA J;  1GM5 A;  1YJN A;  3FP9 A;  3PUV A;  1YHQ A;  2UUC Q;  3HOW H;  4KLK A;  5GQO A;  2EQS A;  5C0X G;  3CCM A;  3IRB A;  1VQ9 A;  3RLO A;  3CCL A;  1VQE A;  1O7I A;  1UE5 A;  1CSQ A;  1PFS A;  4OWX B;  1PH4 A;  3EIV A;  2K5N A;  5BR8 Q;  3CP0 A;  3GTK H;  4X64 L;  4LF4 Q;  2R92 H;  4DR1 L;  4C3J H;  1L1O C;  3GTP H;  1RIP A;  1A0I A;  1VQH A;  3TRE A;  1AE2 A;  1N8R C;  4IFD I;  1WCM G;  3Q8D A;  1I6H H;  4FDB A;  1J5E L;  3NEM A;  3KDF A;  2R7F A;  1S40 A;  3KF6 A;  4GLX A;  4XTC S;  2NZH A;  3H0G G;  4DV4 L;  4JV5 Q;  5C3E G;  3FHW A;  3HOY H;  1X3F A;  4LFC L;  1M1K C;  2KEN A;  1L0W A;  3UDX A;  3UDG A;  4BBS H;  4DR2 Q;  4JI6 L;  1Q46 A;  1UEB A;  3F2B A;  4NXM L;  4OX9 Q;  1JJG A;  1JE5 A;  3S2D H;  2F4V L;  4DR4 Q;  1A62 A;  2PNH A;  2VQE Q;  2K14 A;  4C3I H;  2BH2 A;  5AJ3 Q;  1HZA A;  2VZA A;  3F8T A;  1PHJ A;  4DV6 L;  1E1T A;  3L7Z C;  2XTI A;  2K4K A;  1XMQ Q;  3E9I A;  3RR5 A;  4DUZ Q;  2NVQ H;  1Z47 A;  4JI0 Q;  1AE3 A;  1HH2 P;  1NE3 A;  3KJP A;  2JEB I;  1IZ6 A;  3M4Q A;  5EAY A;  4DAM A;  2K5V A;  1X56 A;  4NPS A;  5C0X J;  1C0A A;  4A75 A;  4YWK A;  1WFQ A;  4PG3 A;  4LF6 L;  2R92 G;  3GTM H;  4C2M H;  4P71 A;  4GN3 B;  4PZ8 A;  3RLN A;  3PCO B;  4LFA Q;  3T1H L;  1VQ4 A;  1Y14 B;  4JG2 A;  4A3L G;  1YHA A;  4HJA A;  3DLL A;  4QIW E;  3CCE A;  4GNX C;  1G6P A;  2I5M X;  4GOP A;  3CCQ A;  2I5H A;  3AYH B;  2BA0 A;  3M9B A;  4P73 A;  4APV A;  1XNR L;  1UWV A;  1Y1V H;  1XPU A;  2GVA A;  5FLX c;  1XNQ L;  3OTO L;  4NXN L;  4JI5 Q;  4L5R C;  3TS2 A;  3PO3 G;  1SMX A;  2Z6K A;  4DV1 L;  2K52 A;  1FVI A;  1BKB A;  4QJF A;  1JT8 A;  1EQQ A;  1RL2 A;  3UE0 A;  5GAH C;  3G48 A;  4R4T A;  4GS3 A;  2UXB Q;  2F52 A;  4YHH L;  2GVB A;  4IPH A;  4DV0 L;  1DGS A;  2VL6 A;  1T9H A;  1IBM L;  2AWN A;  4B3S Q;  4IOA A;  2PQA B;  2CWP A;  4R4I A;  1C9O A;  3I4N G;  4QY7 A;  4EX5 A;  4YY3 L;  2VW9 A;  2VS1 A;  1IL2 A;  2OCE A;  4AQY Q;  4HIM A;  4A3J G;  1A63 A;  1J6Q A;  2JJQ A;  4DV5 L;  4JI4 L;  1I94 L;  4QL5 A;  2JA9 A;  2VQF L;  5M3F G;  4BBR H;  1PH3 A;  4X64 Q;  2DUD A;  3ULJ A;  5C0X I;  3GTO H;  3KYH C;  4DR1 Q;  1HZ9 A;  4OWW B;  3SGI A;  1IYJ B;  2RCN A;  3U50 C;  1QUQ A;  2IHE A;  3JC6 6;  3RN2 A;  4UP9 A;  2PMZ E;  3GDE A;  4YCV A;  2JE6 I;  4Y7N H;  1X9N A;  3KJO A;  1J5E Q;  2I0Q A;  1Y1V G;  4JOI A;  5IYB H;  4WJ4 A;  4DV4 Q;  1UE7 A;  1N33 L;  2B63 H;  2KBN A;  1PVO A;  4LFC Q;  3BU2 A;  1X3E A;  3L0O A;  4P74 A;  3STB D;  3CPW A;  4YWM A;  2K75 A;  1EWI A;  4JI6 Q;  4NXM Q;  5M5W H;  1MKH A;  5HY6 A;  4A3I H;  2F4V Q;  1NBW A;  1VQM A;  3HKS A;  1D8L A;  1QVG A;  1IBL L;  4A3F H;  3FKI H;  5FLM H;  1HR0 L;  3S1M H;  4LUO A;  4DV6 Q;  1VQ7 A;  5IP9 H;  4OO1 G;  2JQO A;  3K80 C;  2VY3 A;  1L1O B;  2KCM A;  1K83 H;  4K0K L;  2QGQ A;  4AYB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...