3KDFB

X-ray crystal structure of the human replication protein a complex from wheat germ cell free expression
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
118
Chain Sequence
HIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication protein A 14 kDa subunit
publication title X-ray Crystal Structure of the Human Replication Protein A Complex from Wheat Germ Cell Free Expression
rcsb
source organism Homo sapiens
total genus 25
structure length 118
sequence length 127
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kdfB00
3GTGH 1Y1WH 1HNZL 3S16H 3W5OA 1PVOA 2XTIA 4DR1L 1FJGL 4AQYQ 1KAWA 4R4QA 4R4IA 4TVAB 1PH4A 3GTPH 2R92H 1XPRA 4QJFA 1Y1WG 3H15A 3S1NH 1MJEA 1JJ2A 4HIMA 1HZBA 3I4MG 1D8LA 4DK3C 1QUQA 1K3RA 2R92G 1P16A 3HOZH 3T1HQ 3GTLH 2JA5H 5C0XG 1I50H 2H5XA 4AYBG 1GM5A 2HHHQ 2AWNA 5E7NA 3CCQA 3UE0A 4JYAQ 4DV6Q 4AQYL 1L0WA 4GNXA 2CWAA 2JA5G 4YHHL 4Y7NH 4JBMA 1E1OA 2CWPA 2D62A 2R93G 2HIVA 2YV5A 3PF5A 2DGYA 2KCTA 1GO3E 3T1HL 3I4MH 3W1GA 3UDIA 4UP8A 4FDBA 2HHHL 1VQJA 1I6HH 1VQNA 1UEBA 4DV6L 1JE5A 3KJPA 1K8GA 3GTJH 3ULPA 1VQ5A 4ME3A 2VY3A 4PG3A 5HGQA 2VUMH 4DR6Q 5M3FH 3S1MH 4DV1Q 1TXYA 4NXMQ 1GKHA 1B8AA 4A93H 5IYCG 1WI5A 5ELNA 4DAYB 3PUVA 5M3FG 3GDEA 4POGA 1OTCA 2N3SA 1OXTA 1H95A 1LYLA 2HQLA 2R6GA 2C35B 5EAYA 4A3EG 2K5HA 3CCUA 1HZ9A 5GAGC 2XGTA 4DK6C 2I0QA 5JEAJ 4DR6L 1YIJA 1EUJA 3FKIH 3CC2A 1DGSA 1B7YB 3RLNA 5C44H 4DV1L 4NXML 1X3FA 4DR7Q 1N8RC 1SROA 1A63A 1V9PA 1VQ8A 3FKIG 2JA8H 2OQKA 1JJCB 4P73A 3HOUH 4DV4Q 3UDGA 4A3FH 2I5HA 1KHIA 3CMAA 3HKZG 3CF5A 5GAHC 2JA8G 4BY1G 3ULLA 2PQAA 4A3FG 3NEMA 1UE7A 2VQFQ 3S1QH 2WB1G 3G48A 1U5KA 1RIPA 3JC66 5DLQE 2B63H 4LFBQ 2JE6I 4DV4L 3CD6A 3K7UC 1VQPA 3UE1A 2YTVA 4LFCQ 4P75A 1XTDA 1HJPA 3OW2A 3CCSA 5ELOA 4DUYQ 2VUMG 3M4PA 1G291 1VQIA 1X6OA 3M3YH 1LM0A 1TWCH 4HIDA 4EX5A 4LFBL 2K52A 5GADC 1PYSB 4K0KQ 3L2PA 4LF5L 2GVAA 3D31A 2Y0SE 4LFCL 3UDFA 4UY8C 3BU2A 1CSPA 3UDXA 2ZM6Q 3J80c 3L0OA 5AJ3Q 3HOWG 1PFSA 4DUYL 2Z0SA 2ZJRA 3HOYG 2E8GA 1TWHH 2WAQG 1X56A 4DUZQ 1T9HA 3G4SA 4YCWA 4DV0Q 3RLOA 4DR2Q 4K0KL 3CCRA 3J7A5 1IL2A 5C3EH 2YU9H 4YWKA 2HT1A 4J15A 2MNAA 3WWVA 1YHAA 5AJ3L 3HOXH 5C3EG 4DV7Q 4L5SA 2ZTEA 1V1QA 1WJJA 4P72A 4LFAQ 1KRTA 1JMCA 1J5EQ 1VQLA 2BH8A 4DUZL 1G51A 3HOXG 4DV0L 4LF6Q 4NXNQ 1Q1EA 2RHSB 2UUAQ 3E9IA 2FXQA 4NB3A 4DR2L 4JI8Q 2MFIA 2Q2IA 2MO0A 3STBD 5IYBG 1Y14B 4BBSG 1NJIC 2UUCL 2JA6H 1BBUA 1N34L 1HNWL 4DV7L 3K7AH 4LFAL 2JA6G 1J5EL 2HIXA 5LMNW 1SFOH 4X66L 4A3LH 4NXNL 4LF6L 4IO9A 2N78A 1OXSC 2ALYB 2UUAL 2YYZA 1EQRA 4JI8L 1VQGA 3M9BA 1XPOA 4A3LG 1U0LA 1VQBA 3AEVA 4A3BH 5IT9c 3SGIA 4YWLA 5FLXc 4DV3Q 3PO2G 4OONA 2IX1A 3S14H 1WCMH 4A3BG 4PZ6A 4DV2Q 4A93G 2OTJA 1SN8A 1E3PA 2NZHA 4MTNA 1FVIA 4JI7Q 4YCVA 2OTLA 3GTOH 1WCMG 5LMUQ 1O7IA 4QIWE 4JV5Q 2KHIA 1W2BA 4JI6Q 3DM3A 2ZTCA 1PV4A 1Z47A 2JJQA 3RN5A 3M4OH 1E1TA 3PUXA 4DV3L 1N33Q 1S40A 1CUKA 5FJ8H 3CCVA 1HZAA 4DV2L 3I7FA 2ES2A 5JJLA 3J80i 4JI7L 4IPCA 1IBKL 3AQQA 5FJ8G 5LMUL 4IJLA 3W1BA 1VQ6A 1CKOA 1FL0A 4JV5L 2AKWB 4JI6L 5K36G 4IOAA 4PZ8A 1C9OA 3CCEA 3HOZG 2WP8J 4QGUA 2VW9A 3CCJA 3S2HH 4LUVA 4GS3A 3PUWA 5H1SE 3KJOA 1VQKA 4WJ4A 5M5XH 3RZDH 4DNIA 5IP9H 4GKKQ 3K80C 3J81i 1IBMQ 5JEAG 1VQMA 1OXUA 1NBWA 2RF4A 4JYAL 5IP9G 1TWAH 2EQSA 4R4CA 4A3IH 4HJ7A 1QVCA 4LUZA 4HJAA 3RNUA 1PH8A 3I4NH 4A3IG 4XTCS 2KBNA 1L2FA 4GLVB 3I4NG 1IBML 2RHQB 3K81C 1V43A 3RZOH 4BXXH 1CKNB 1EYGA 4AYBE 1C0AA 1S3OA 4OWTB 3KF6B 3EBEA 4IFDJ 4BXXG 2NN6I 1RL2A 1MIUA 2AMCB 4R4TA 1R9TH 2UXDQ 3M7NA 1X65A 3KLWA 5IE8A 3TEHB 5C44G 4JC0A 3S1RH 5C0XJ 1SMXA 2PI2E 1BKBA 2WFWA 3L7ZC 4JBWA 1PH9A 4IFDI 4IOCA 3PIOA 2Q2HA 2IY5B 2JA7H 3CAMA 2KHJA 2UXBQ 2I5LX 3J81j 1HR0W 1A62A 3GTKH 3HOUG 1JT8A 2JEBI 5M3MH 2EXDA 2JA7G 2E2HH 1PA6A 5C0XI 4HIKA 1N36Q 3S2DH 1Q81C 4H02A 5GAEC 4O0AA 1Q1BA 1M1KC 4JBJA 1NY4A 5M3MG 3RN2A 1A0IA 1XMOQ 4A3CH 2F52A 2GVBA 3KDFB 3ZJYC 4DR5Q 1XNRQ 4OO1I 1PH6A 1VQAA 2B63G 2UXBL 4HJ9A 1KL9A 1L1OB 4B3SQ 3H3VI 2VQFL 4A3GH 2LXJA 1UE1A 5C4JH 1VQ4A 1N36L 4L5RC 3U50C 4LNQA 1IZ6A 2IHEA 4B3RQ 1XJVA 2OQ0A 2CFMA 4YY3Q 4JBKA 1XMOL 4JG2A 2L15A 4DR5L 4GN4B 4BA2I 3PV0A 1QVFA 4RG1A 5HY6A 1KXLA 1YVCA 3AYHB 1EFWA 3HKZE 4B3SL 3AFQA 1KIXA 1I94Q 5J3BA 3KOJA 2R7FA 2AHOB 1XPUA 3MEFA 3JAMc 1EIYB 3ER0A 1HNXQ 2BA1A 1ASZA 3GD7A 4LF7Q 1PYBA 3D0FA 3OYYA 2QEXA 1KC8C 3PGZA 1WYDA 3U4VA 2IT1A 2ZM6L 1QZHA 3GTMH 1I94L 4PZ7A 4GLXA 4UP7A 1QZGA 4A3DH 1Z9FA 2CKZB 3J7ZC 1HNXL 4LF7L 2NVQH 1VS0A 3TS2A 2CQOA 4LF4Q 4A3DG 1E22A 2Z6KC 3VDYA 1BBWA 1IYJB 2ZJPA 1Y1VH 1X54A 3A0JA 4JOIC 4C3JH 4ALPA 5IWAQ 1EQQA 1W3SA 2IHFA 4IPGA 3E0EA 2D0PA 4A4IA 1YJNA 1Y1VG 1X3EA 1UE6A 3DLLA 1VQOA 2VQEQ 1B70B 3HKSA 4DR3Q 4NPSA 2R7ZH 4LF4L 2WAQE 4GN5A 3B6YA 4A3JH 3F1ZA 4EQ5A 1GD7A 1YITA 5IWAL 4JI3Q 1Q7YC 3PSIA 3GTQH 2PNHA 1VQHA 3NELA 4A3JG 1YBYA 2K50A 5LMNQ 1E7ZA 2VQEL 2I5MX 4DR3L 3PO3H 2KENA 2VL6A 2K5VA 1CKNA 1NMFA 5BR8Q 1UE5A 4XIGS 4HJ8A 1L1OC 2Q2TA 4IPHA 3PO3G 3KF6A 1Q12A 3PCOB 2RCNA 4JI3L 3CMEA 2UXCQ 2ID0A 2JA9A 1HH2P 1PHJA 1KQSA 4LF8Q 4JI2Q 3F2CA 5LMNL 4JI1Q 4GLAC 4A75A 4HJ5A 4GNXC 3TREA 3JAMi 3G71A 2YTXA 3H0GH 2V1CC 4JI5Q 1FJGQ 2YTYA 2VZAA 4APVA 3G6EA 3AFPA 3BZKA 3S15H 2F4VQ 1D7QA 1N33L 1SR3A 4P71A 4AIMA 1VQDA 2UXCL 2QA4A 3H0GG 1I5FA 3HOVH 4JI2L 2NN6G 3CW2C 4JI1L 2E2JH 4JI4Q 4A3KH 4YCUA 2UU9Q 2D0OA 4IPDA 5JJKA 2Q2UA 3HOVG 1JB7A 1A8VA 4OWXB 3KDFA 1TWFH 3MXNB 1EOVA 3I4OA 4JI5L 5GQOA 4A3KG 1YHQA 2EIFA 2N8NA 4YHHQ 1LTLA 3K8AA 1K73C 1PH7A 4X65Q 1IBLQ 2BA0A 1YEZA 2VS1A 3GO5A 1L1OA 4GKJQ 3I55A 3BJUA 2B29A 3EIVA 4JI4L 4A3MH 3A74A 1PH3A 1OXXK 1GVPA 1HZCA 2UU9L 1N32Q 3IRBA 3CPFA 1YJ9A 1YZ6A 2QGQA 2R93H 1VCIA 4A3MG 2PMZE 3CPWA 2PI2A 3M85A 1IBLL 3H3VH 4DR7L 4OO1G 4GN3B 4X65L 3ERSX 3CXCA 4GKJL 4O2DA 2GN5A 1CSQA 5M5WH 1SLJA 1Q86C 1N32L 1K9MC 4OX9Q 1NTGA 4LUOA 2IX0A 2N49A 3CQZH 1VQ7A 2JEAI 4GOPB 2ZJQA 3EN2A 5IYCH 1MKHA 1AH9A 5M5YH 3HFZB 3CC7A 2JK8A 3TS0A 2MQHA 5JJIA 1P8LA 3PUYA 1FGUA 4A3EH 4OX9L 3F2BA 4P74A 2UXDL 3ICEA 2A1AA 4LWCA 2MO1A 4X6AH 1M90C 1K83H 4Y52H 4B3TQ 1XNQQ 3BZCA 5C4XH 1K8AC 3CP0A 4KLKA 3ULJA 4X64Q 1HR0Q 4MNOA 1X3GA 4TQUS 4A3CG 1LUZA 5C4XG 1QUQB 2Y0SG 4BY1H 4UPAA 1CKMA 1NE3A 2KCMA 2VNUD 4A3GG 4QL5A 3FHWA 1VQ9A 1WOCA 4DKAC 4B3TL 2AWOA 1XNQL 4B3MQ 4R4OA 4GNXB 1YI2A 1XNRL 5IYDH 4C2MH 3NENA 4X64L 4KHZA 1HR0L 1I3QH 2E2IH 2NVXH 3RR5A 5IYDG 3F2DA 1VQEA 4L5TA 2A8VA 3PUZA 1K0RA 2NVTH 4DR4Q 4LF5Q 1XMQQ 4L5QA 3CCLA 1SRUA 4DAMA 3KF8B 1TWGH 2K14A 3RLFA 4YY3L 2CCZA 2WB1E 3K0XA 4IFDG 3T1YQ 4B3ML 3A5UA 3CCMA 3LGJA 5FLMH 4BY7H 2ZTDA 1MJCA 5GROA 3I56A 2ASBA 2NZOA 2ATWA 2R7DA 3E9HA 4C3IH 5FLMG 1ASYA 4JCVE 4BY7G 4DR4L 3M4QA 1X9NA 1XMQL 3HOWH 1JJGA 4JI0L 2LXKA 3HOYH 4OWWB 3T1YL 1J6QA 1IXRA 1VQCA 1N9WA 1VQFA 4BBRH 4GOPC 1PH1A 3CC4A 3PF4A 4BBRG 2UUCQ 1HNWQ 1N34Q 1Q8KA 3PIPA 2A19A 5IY0A 2UUBQ 2R7ZG 3STBC 4DV5Q 1BVSA 3J81c 1YHBA 2PQAB 3U4ZA 3S24A 5IYBH 4X66Q 4A76A 4BBSH 1AE2A 4DPGA 2JQOA 3U58A 2BH2A 4KHPQ 4RMFA 4OXPA 4X62Q 3OTOQ 1YJWA 1EWIA 1OXVA 2K5NA 1AE3A 2NVYH 2DUDA 1PH2A 2E5LQ 4DV5L 2B3GA 3A5ZB 3KYHC 2UUBL 2Z6KA 4R1JA 1NMGA 1UWVA 4LW1A 4LF9Q 2LSSA 4MZ9A 4UP9A 4JOIA 4JI0Q 4B3RL 4PMWA 4KHPL 3PO2H 4POFA 1QVGA 2K75A 1C7YA 2OCEA 1YNXA 4QY7A 1WFQA 1SE8A 1KRSA 1X55A 5IP7H 4X62L 1EIFA 1Q46A 5BR8L 3OTOL 4GOPA 1Q82C 4KI0A 1KD1C 1HNZQ 3Q8DA 4DR1Q 3TQYA 2E5LL 1G6PA 3I2ZA 5IP7G 3KFUA 4YWMA 4HIOA 4LF9L 4C3HH 1PH5A 1E24A 4LF8L 3TRZA 3S17H 2F4VL 4QQBX 4WJ3M 1S72A 1IBKQ 2K4KA 4IJHA 2OWOA 4AH6A 3NBHB 3FP9A 2F3IA 4BA1I 4GKKL 3F8TA
chains in the Genus database with same CATH superfamily
1ZEQX 3IFDA 1HNZL 3W5OA 4H0LC 4DR1L 3D3RA 4AQYQ 3HOXB 4R4IA 4TVAB 1PH4A 3R93A 1GHKA 4A3DB 1MJEA 1JJ2A 1HZBA 3EA6A 5BN3A 5KNCA 4DK3C 3K58A 1YNJC 2R92G 1B53A 1P16A 5C0XG 2AWNA 3UE0A 5FK9C 2L4NA 4DV6Q 4GNXA 4AQYL 3K7AB 4K14A 4ZK9B 2QEJC 2R93G 1DOLA 1GO3E 3KK7A 1SJED 5KNBA 3W1GA 1B50A 1VQNA 1UEBA 4DV6L 3KJPA 1K8GA 3GTJH 4KN7C 1VQ5A 5HGQA 3NQIA 2ZXPA 1TXYA 1F2LA 1B8AA 3GTOB 5IYCG 5D65A 5ELNA 4DA2A 3GDEA 2OT2A 1OTCA 2N3SA 1OXTA 3E0JA 1LYLA 2R6GA 4A3EG 2I0QA 3VYTA 1EUJA 1DGSA 1AFPA 3ND9A 2WKDA 1N8RC 3P1HA 1SROA 2OQKA 3SHLA 4M1UB 3CMAA 1Z6HA 1CZWA 2XIWA 4KD4A 3J80E 3ULLA 2PQAA 4A3FG 2L9HA 1T5EA 2PNRC 5M5XB 3RZDB 3S1QH 3G48A 5DLQE 2JE6I 5FOBB 3CD6A 3K57A 1VQPA 5CV9A 4EQPA 4C1NI 1GHJA 2PW5A 1JWUD 3I4NB 1LM0A 1GUNA 3BDCA 2BOSA 5GADC 1PYSB 4KD3A 5J1ZA 3BU2A 2XRQD 4K8IA 1H9MA 3HOYG 2E8GA 1EEFD 2WAQG 1R9TB 3G4SA 3CCRA 3NTKA 2IJ0A 2EZVA 2YU9H 1JWSD 3I73A 2B2UA 3NWTA 3I4LA 1JMCA 1KLGD 2BH8A 4LF6Q 1J8IA 1HFGA 1RTOA 1V8QA 2RHSB 4NB3A 5C6AA 3I3CA 3VR4A 2MFIA 1C4QA 5IYBG 1Y14B 4C1NK 3BVGA 2UUCL 1N34L 1B3AA 2JA6G 3OWFA 5LMNW 4LF6L 2N78A 1D5ZC 4A3LG 1SNQA 1HQRD 2FMMA 1WCMH 1IKMA 1TY2A 4MTNA 4PMBA 5IT9L 4YCVA 2ZT9C 3P75A 4JI7Q 5LMUQ 3A54A 4JI6Q 3DM3A 1Z47A 3RN5A 2X69A 3M4OH 1SE2A 1CT1D 3CCVA 1CA5A 1HZAA 3A7AB 3J80i 3H3VC 1NCVA 2B8GA 4JI7L 2F0SA 5LMUL 5FJ8G 1YNNC 2CHBD 3QOJA 4CKEA 4JI6L 4PZ8A 3TN2A 2KJXA 1Y1VB 3E5SA 2K04A 1JOQA 2VW9A 5E4WC 3VYUA 5H1SE 3KJOA 3X3NA 4DNIA 2RQXA 3J81i 4A3JB 1BUVT 2WACA 3DWQA 1NBWA 2RF4A 1JICA 5ELBA 5IP9G 4JYAL 3GTQB 4A3IH 1B44D 3AB9A 2Q8RE 3RNUA 1KLUD 1PH8A 3OHXC 2KBNA 1Z7TA 2J0TD 2PW7A 1I4QA 1V1PA 3PIO3 5DM73 3EBEA 4BXXG 5CV8A 4K2KA 4DK0A 3MFYA 3VYRA 2AMCB 2UXDQ 1X65A 5BN4A 4DN4M 2WFWA 3S15B 2IY5B 4IOCA 3PIOA 2Q2HA 5IGCA 2KHJA 3HOUG 1PZJD 1HR0W 3GTKH 3HOVB 1D5XC 2K28A 2E2JB 3I70A 2RSOA 5C0XI 4HIKA 5CBAE 3JAME 3S2DH 1Q81C 4O0AA 4JBJA 1NY4A 5M3MG 4A3CH 3ZJYC 1XNRQ 5E4XA 1PH6A 2B63G 5IGBA 4CDEC 4Q5VA 4A3MB 4A3GH 4FF2A 2LXJA 1GUSA 4L5RC 1VQ4A 4CDDC 4I7ZC 2Q8TA 4GN4B 4NDXA 1QVFA 5HY6A 1BCPC 1YVCA 3AYHB 5J3BA 1RODA 3KOJA 3WOEA 1EZ6A 1XPUA 3MEFA 1QG7A 1GOZA 3GD7A 2F0IA 2K5DA 3CQZB 3I90A 1PYBA 3D0FA 2DY8A 1KC8C 5C3XA 1WYDA 1FGBD 2IL8A 4FXDA 5M5YB 1S5BD 3GTMH 4GLXA 1QZGA 1BR9A 1HCZA 1U4PA 2CKZB 2F0UA 1S4ZA 2NVQH 2ICIA 2CQOA 4LF4Q 4A3DG 1K83B 3EVQA 1BBWA 3DWPA 1V1OA 2AUKA 3E6ZX 2A5HA 3LWEA 4IPGA 3E0EA 3NTHA 4CKBA 1YJNA 1S5ED 2AUJD 3HKSA 2DJFC 1A2TA 4LF4L 2WAQE 3I8ZA 1SE3A 4I65A 1STYA 1Q90A 2QF7A 4JI3Q 3EQLC 1DOKA 3PO3H 2NVTB 3SEBA 2K5VA 3TP8A 3J81L 1CKNA 3DM1A 2L1BA 4NP5A 2EY2A 1O7YA 3KF6A 3PCOB 4JI3L 3CMEA 1PTOC 1PHJA 2JA9A 1HH2P 4ID6A 3F2CA 2F1MA 4JI1Q 3EJIA 4GLAC 1NR4A 4A75A 5I6WA 1M8AA 1CTMA 2F0GA 1CQVA 4KMUC 3R8BA 3JAMi 2V1CC 1FNVA 4JI5Q 3AFPA 2A6HD 2F4VQ 1SR3A 2F3VA 1Y8OB 2QA4A 3H0GG 1I5FA 3V2TA 4JI1L 4JI4Q 4BBRB 1WTVA 1E2WA 2D0OA 1ZYRC 4JI5L 3I4OA 4CDCC 1YHQA 4IFDG 1SNCA 2F4VL 4DR7Q 5C0XH 1PYWD 3I55A 2PZUA 1MSHA 3T4AC 2B29A 3BDLA 3EIVA 1IHZA 4JI4L 5JOBA 4BBSB 3NP8A 1QB5D 3QB3A 1YJ9A 2QGQA 2R93H 2PMZE 2A6ED 2PI2A 4DR7L 4GN3B 4OGQC 5COYA 2NZ1D 2GN5A 1CSQA 5M5WH 1Q86C 4XQNA 2N55A 4OX9Q 1NTGA 2N49A 4GOPB 3T16A 2ZJQA 5IYCH 1KNAA 2JK8A 4K8JA 3TS0A 5JJIA 3S17B 2BE5D 1P8LA 4PV1C 4A3EH 4OX9L 1EY5A 1I4PA 5KYIA 2A69C 4X6AH 3S16B 1M90C 4Y52H 2D9UA 2MUYA 2F0PA 1K8AC 2R92B 4KLKA 2K5QA 5LL6X 3S1NB 4OL7A 4X64Q 4TQUS 3HOZB 3GTLB 4RWSC 2Y0SG 2K33A 4UPAA 2VNUD 3Q0AA 3FHWA 1WOCA 4DKAC 4XYOA 1U9RA 4Y7NB 4GNXB 1YI2A 4C2MH 4X64L 2EE1A 5IYDG 4L5TA 1PRTB 1XX8A 4LF5Q 5IIFA 3RLFA 4YY3L 4RCOA 4L6TB 1GUTA 4O42A 5FLMH 3S1MB 5GROA 1IW7C 2KQ3A 3K5OA 1MSGA 3E9HA 1LTID 4C3IH 4HTHA 4KKSA 3R3OA 3HOYH 4OWWB 1F9SA 5C44B 1N9WA 3MA2B 4ZUIA 3OSOA 2B2WC 2B2TC 3MZ5A 4N8FA 4A3FB 5HGTA 2AQ2B 1Q8KA 1K8MA 3OMCA 5IY0A 1BVSA 2PQAB 4K2LA 5IYBH 4X66Q 4P2CB 1EYDA 4K6DA 2BH2A 3Q6SA 4X62Q 3A8IE 1PH2A 2E5LQ 3KYHC 3A5ZB 4IUUA 1DCZA 1BBXC 4TKOB 5IGFA 4JOIA 2K75A 2OCEA 4BS9A 1WTRA 4X62L 4GKKQ 4KI0A 2B39A 2WAQB 2E5LL 1H9SA 1PH5A 4KHVA 5I9PA 1TWHB 2RDFA 1BO0A 2IPKD 3TRZA 4WJ3M 3OW7A 2OWOA 1IBKQ 2K4KA 2CW0D 2F3IA 3BZDB 1PRTD 4BA1I 4GKKL 3F8TA 1Y1WH 1PVOA 1FJGL 1B2TA 1KAWA 3PMFA 2KOLA 4QJFA 1XPRA 1D8LA 1PFBA 2IW3A 1ILPA 3T1HQ 2P5ZX 4HEDA 3MVVA 1GM5A 2E76C 2JA6B 3CCQA 2JA5G 1LACA 1YNJD 4JBMA 2D62A 4FXGC 2JN4A 1SFOB 2X6LA 3BDOA 2KCTA 4R9WA 3T1HL 4HCEA 1DD2A 4UP8A 2NB0A 4FDBA 1VQJA 1JE5A 1XXGA 5D14A 4HMJA 2VY3A 4K5XA 3S14B 1PZID 5M3FH 4NXMQ 1HUMA 3PUVA 2LS01 3SK8A 1H95A 5IODA 1NNXA 1W6JA 3FVQA 3CCUA 4DK6C 2PMZB 1YIJA 3FKIH 4NXML 4ZUJA 4RKLA 1VQ8A 1D6EC 2JA8H 1JJCB 5DEHA 3HOUH 4QF4A 1PMRA 3J7AF 4HR7B 3RUZA 2MGSA 1STEA 3KBGA 2WB1G 1RIPA 3JC66 2B63H 4RGMA 3K7UC 2YTVA 4P75A 1TWAB 1HJPA 4RKBA 3FMCA 5ELOA 3M3YH 2K1BA 1VMPA 4G7HC 3NBIA 1TWCH 4HIDA 2KEEA 4K0KQ 3D31A 2Y0SE 3J80c 1TS2A 1V1PB 2HQEA 1AW7A 5A2QL 2WKCA 4JK1C 1X56A 2M2LA 1D1KA 3NBHA 4DUZQ 4DV0Q 4K0KL 1BXTA 3S1RB 2HT1A 2F0VA 4J15A 1O7LA 1SDFA 2VB2X 5C4HA 3HOXH 5C3EG 5FLXE 1V1QA 1WJJA 1KRTA 3VA5A 3D6CA 1SYDA 1J5EQ 5M3MB 2E2HB 4DUZL 1G51A 4DV0L 2NTSA 1EYCA 2RKSA 3NPPA 2MO0A 3STBD 3OMGA 4BBSG 4G7ZC 2HCIA 4LMQD 3K7AH 3QG1A 3C2PA 3T13A 1J5EL 4DF7A 1OXSC 1H9RA 1EQRA 1VQGA 3I72A 3OOCA 3K6OA 4KV6A 4YWLA 4DV3Q 4OONA 4A3BG 2OTJA 4EQOA 1SN8A 4DAYA 3GTOH 2OTLA 2AQ1B 2XWJB 4KKTA 5T1GA 4B9WA 5FO8B 4DV3L 1S40A 1SMYD 5ELFA 1TIID 3AU7A 5DAUA 4IPCA 2LFNA 3HZXA 1VQ6A 4IJLA 1CKOA 1EY6A 5K36G 1B9NA 1JB3A 3CCEA 4OHJA 4C3JB 3HOZG 3CCJA 1YNND 3MTSA 1AP0A 3BVZA 2EYFA 4WJ4A 1BCPB 5M5XH 3RZDH 2R7ZB 5E3FA 2EY1A 3K80C 2EJFC 1IBMQ 1VQMA 1NAPA 4QIWB 5A35A 4DU9A 1KAAA 1I4RA 3I4NH 4XTCS 4GLVB 1XYIA 1IBML 1QILA 1T5XD 2RHQB 3K81C 1V43A 3BYTB 1CKNB 1D2BA 1Y69U 1R4PB 3KF6B 4IFDJ 2V4DA 1U4RA 4R4TA 1R9TH 3M7NA 5C44G 3BYYB 4JC0A 3H0GB 3L7ZC 4RA8A 5J39A 4NW2A 3TZDA 2I5LX 1JQYD 3S9WA 2JA7G 4MIUA 4ILWA 2L55A 4H02A 3GQBA 5GAEC 4DFAA 3SDZA 2ENBA 4OO1I 2F52A 2EYHA 5JPMC 1MBYA 1VQAA 4AYBB 4HJ9A 4QMGA 4QUCA 1PTOB 3U50C 1STBA 4E6IA 1B4OA 1LT4D 1M4VA 1C8CA 4BA2I 3PV0A 2MJ8A 1EFWA 1I94Q 4CKCA 2R7FA 2AHOB 2FJ2A 4IUTA 5EBDA 3ER0A 3JAMc 2BA1A 1BCPD 3GTJB 2TSSA 3U4VA 2IT1A 4FP5D 1QZHA 1I94L 1EEID 4UP7A 1D1IA 3D4RA 1Z9FA 4OIKA 3ZYYX 3DHQA 1XTCD 1X3QA 4IUNA 1RD9D 1TS5A 1Y1VH 2EYLA 1X54A 3A0JA 1EQQA 4ALPA 5IWAQ 1TU2B 2Y0SB 2D0PA 5IOCA 5DNFA 1X3EA 3TMEA 1VQOA 2KVMA 5G3LF 1HXYD 4NPSA 4BY1B 4JPBW 4XDXA 3NXWA 4A3JH 1EYAA 1GD7A 1H9JA 5IWAL 1HA6A 3GTQH 1Q7YC 5TSSA 1LT3D 2E2IB 1CK1A 2I5MX 2C5CA 1TWGB 1ONLA 4HJ8A 1PXUA 1LTSD 4IPHA 1Q12A 2RCNA 2UXCQ 1SNDA 3TP7A 1KQSA 4LF8Q 2EYOA 3HOWB 1PTOD 3S15H 2VZAA 1HFNA 2G5DA 2UXCL 1VQDA 3HOVH 2NN6G 3HP3A 2E2JH 3F2UA 1X3PA 4FF1A 4RFBA 1EFID 5JJKA 4FF3A 1XWEA 2Z4HA 4MN3A 1A8VA 4A3KG 1K73C 2EIFA 4YHHQ 1IBLQ 2L11A 4J6HA 1SYFA 1YEZA 2BA0A 2XSCA 2PPBC 1ZYRD 4A3MH 1PH3A 1JORA 1N32Q 3VR5A 3CPFA 4DAVA 2RSNA 4OO1H 1YZ6A 2A74C 4KN4C 3CPWA 3M85A 1IBLL 2NVYB 4IALA 1GUOA 2OF1A 1QOHA 2Z1CA 1N32L 3PO2B 3HG9A 4HAEA 3CQZH 2RCFA 2LY7A 1PRTF 4ZKBB 3ERQA 1MKHA 5M5YH 3HFZB 3CC7A 4C3HB 3NWSA 1H9SB 3CRLC 2E2DC 4QCLA 5DM63 2L0CA 2UXDL 2A1AA 4LWCA 3GTGB 5EKIA 1K83H 3RMHA 2NWGA 5C5LA 4B3TQ 1TS3A 5C4XH 3GTPB 4CBVA 3ULJA 5CBEE 2B2VC 5CV7A 4GZYC 2DNEA 2JA5B 1I50B 3QWNA 1SNPA 4OELB 4XT3B 1VQ9A 4B3TL 1XNRL 4Z9CB 4KHZA 5IGDA 2L5TA 2JSOA 3F2DA 1VQEA 1K0RA 2NVTH 4NMZA 1I6HB 4DAMA 3K0XA 1WTHA 2VXWA 2NYZD 1HHVA 1IYUA 1FYCA 2A68C 2ZXRA 1JCKB 2NZOA 3KBXA 1LTBD 4BY7G 3D6WA 4JCVE 2B2VA 4WFN3 1X9NA 1RF2D 1J6QA 1VQCA 1W6KA 4KY5A 4BBRH 5ELDA 2GA4B 1LLRD 1ML0D 2DJGC 4C3JG 3J80L 3CC4A 4ZAIA 3MXNA 3PF4A 5CYUA 4QUFA 1HNWQ 5FKAC 4EQNA 1ENCA 2WB1B 4ABNA 2R7ZG 4DV5Q 1YHBA 4BBSH 5EKLA 1AE2A 1EY4A 3U58A 1B9MA 1DOMA 3OTOQ 1EWIA 2K5NA 3A8KE 1AE3A 3I91A 4DV5L 4G7OC 3TBIB 2KCNA 1NMGA 3G6JB 4LF9Q 4MZ9A 3VR6A 3DXJC 3A8JE 4POFA 3KLRA 1YNXA 3OTOL 2PQEA 1EIFA 1F2ZA 3KLSX 3G7LA 3CKIB 5IP7G 2AQ3B 4YWMA 4LF9L 4QQBX 4TRDA 3S17H 4FYDA 3NBHB 1EZ8A 2RBMA 5C3EB 3S16H 2F0LA 2R92H 4MHEA 3H15A 3S1NH 1I4XA 5EPLA 4HIMA 1A3UA 4KKUA 4DAPA 1QUQA 1K3RA 3HOZH 3K5NA 3GTLH 2H5XA 4AYBG 4NKLA 5E7NA 4IZ8A 4FO2A 2DY7A 1L0WA 2CWAA 3M7GA 1F2MA 3M4YA 4Y7NH 2HIVA 2YV5A 3NTIA 2DGYA 2RDHA 2BDNA 3SR1A 1RJTA 2J7ZA 4A3BB 5AFWA 3MXUA 1TR5A 4PG3A 1WTOA 3H91A 4DR6Q 4CGYB 3S1MH 4DV1Q 1GKHA 1WI5A 2XVSA 4DAYB 1CHPD 2HQLA 1MGSA 3EROA 4DNRB 1QWYA 2M9VA 2XGTA 4DR6L 5C44H 1B7YB 4X3UA 3RLNA 4DV1L 4KK7A 1PLFA 1ESRA 3GP7A 1B3QA 4A3FH 1KHIA 5GAHC 3S2HB 4BY1G 1QE6A 2SOBA 1UE7A 3NEMA 1PZKD 2VQFQ 1SNOA 5CORA 1KDAA 1U5KA 4RH6A 4LFBQ 3FPPA 1S5DD 1ICWA 4ZQ3A 4LFCQ 1PFMA 2X6GA 5K5PA 2SNSA 3OW2A 4MTKA 3CCSA 1DXMA 5D3IB 3OIPA 4DUYQ 1G291 1STAA 1VQIA 1X6OA 2K05A 3KLSA 3QOLA 2B2YC 4LFBL 2K52A 3L2PA 4LF5L 2GVAA 3RZOB 1K0SA 4LFCL 3W2DA 3LNNA 1CSPA 1SYBA 3UDXA 3HGBA 2ZM6Q 3L0OA 3HOWG 4DUYL 1FNWA 2Z0SA 2ZJRA 4IN3A 1BDOA 1TWHH 1T9HA 4C56C 3RLOA 4DR2Q 1TY0A 5KGUA 3WWVA 1G8ZD 5D3DA 3JAML 4R8NA 5HURA 2JA7B 3EFXD 2UUAQ 3E9IA 2FXQA 4DR2L 3WDNA 2Q2IA 1EIHA 2B2YA 1KTKA 1NJIC 2JA6H 1BBUA 4F88A 1ENAA 1CHQD 2A73B 4ZRZA 1SFOH 4A3LH 4X66L 3IFTA 5C4JB 2UUAL 2HDMA 2K01A 1U0LA 3AEVA 2B2WA 5IT9c 3SGIA 2B2TA 5FLXc 3PO2G 1E2ZA 2F0QA 1BNZA 3S14H 3IKJA 2JXMB 1E3PA 5CV4A 2NZHA 1WCMG 2F0EA 1O7IA 2EJMA 4QIWE 2JP1A 2KHIA 4C3HG 1AN8A 2ZTCA 1PV4A 2JJQA 4M8AA 1N33Q 1CUKA 5FJ8H 2ES2A 1DONA 1IBKL 3AQQA 5I9OA 3GV3A 2AKWB 1AZPA 2NN6H 1TS4A 2WP8J 3PQIA 4LUVA 2E74C 5FO9B 3A55A 1VQKA 1NUCA 3BS1A 5IP9H 4ULLA 2JYOA 5JEAG 1OXUA 2EVBA 3T56B 3H94A 4LJZC 1TWAH 4XQQA 3WOFA 2EQSA 1F9RA 4HJ7A 4BWGB 2A6EC 4LUZA 3VYSA 4A3IG 4S3SA 1F9QA 1L2FA 1BQQT 4CHTB 4BXXH 4AYBE 4OWTB 4F87A 1B1ZA 3OWEB 1MIUA 4UAIA 2F4IA 2BE5C 3S1RH 1WTPA 1SMXA 2PI2E 4IFDI 1PH9A 1STNA 1SAPA 3TP6A 5I2XA 1E2VA 2UXBQ 1JT8A 3J81j 4RHSA 2SDFA 2J4XA 4DK1A 1LT6D 5M3MH 4A3KB 5KEEA 1PA6A 2E2HH 2KECA 1FD7D 3DUZA 4R8IA 3RN2A 1KDBA 1TWFB 3MFGA 3I4MB 2KUMA 4DR5Q 3DWAA 2UXBL 3N6RA 1VF5C 1KL9A 4RGTA 1UE1A 4LNQA 3A56A 1A3VA 4B3RQ 1XJVA 2OQ0A 2CFMA 4JBKA 4JG2A 1EY7A 1TT2A 4X3KA 4DR5L 5JAVA 5IGGA 4ODGA 4IUVA 2LMCB 4UDUC 3OYYA 1LABA 3MXPA 3CU7A 5IT9E 2WINB 1OO9B 4PZ7A 2MHVA 2PZTA 1GJXA 4IURA 4A3DH 3J7ZC 5LHY1 5CMDA 4DXFA 1E22A 2Z6KC 3VDYA 1K8OA 4G4KA 1IYJB 4C3JH 1W3SA 3A7LA 4HSPA 2CVRA 3DLLA 1UE6A 2EDGA 3HKZB 3RD4A 1SNMA 1CQFA 3DEOA 1HRJA 2R7ZH 2K5WA 4GN5A 3IL8A 1FNUA 3SVMA 3B6YA 3F1ZA 4DGZA 4EQ5A 3MC0B 1YITA 1LO5D 1VQHA 1I3QB 2NVXB 1D5MC 1YBYA 5LMNQ 1E7ZA 4FF4A 2KENA 2VL6A 2VUMB 2XRSD 2QDLA 1NMFA 5BR8Q 5EJWA 3K59A 1I4HA 1L1OC 2Q2TA 3PO3G 4BY7B 3GV6A 4JI2Q 5LMNL 1CA6A 3H09A 4HN7A 4GNXC 3TREA 1ENFA 1L0XB 3H0GH 2CW0C 2YTYA 4APVA 3G6EA 3NQTA 1D7QA 1PRTC 4P71A 5EBCA 4JI2L 3CW2C 4K5VA 1GUWA 2EOTA 2WV6D 4YCUA 4WJWA 4IFDH 2Q2UA 1JB7A 3KDFA 3MXNB 5BN5A 5GQOA 1PH7A 2N8NA 1G6ZA 3K8AA 4CDFC 1L1OA 2F0KA 1NR2A 1HA5A 3A74A 3KUPA 2EYMA 1HZCA 1X32A 5JVG3 3IRBA 1PTOH 2F3WA 2EJGC 1VCIA 2Z9HA 2OEOA 3C1FA 5L37A 3ERSX 1CFMA 2IX0A 5IGEA 4A93B 1VMCA 2EYPA 5T1IA 4F8MA 1VQ7A 2DNCA 2JEAI 1SEBD 2MQHA 1E0BA 3L3OC 3QIAA 4WORA 1R4QB 1HTPA 1S5FD 4P74A 2CH4A 3ICEA 3MWYW 1EOTA 1SXTA 3CP0A 1ZXTA 2RA4A 1S5CD 1HR0Q 1L0YB 1WD0A 1QUQB 2Z6BA 4BY1H 1JE4A 1CKMA 1NE3A 1RCVD 2IWHA 4QL5A 2AWOA 4CJ2C 4B3MQ 4R4OA 3J7AV 5IYDH 5CR3A 1UEAB 3NENA 1SYGA 2CQAA 1HR0L 2E2IH 3RR5A 4XYQA 2B2UC 4DR4Q 3U9SA 1SRUA 2XN9C 3SK5A 1TWGH 1DZ1A 2RDGA 2WB1E 3U9OA 4B3ML 3A5UA 2WIIB 4FVMA 3CCMA 5KIXA 4RGNA 3MAQA 3I56A 3NHHA 3J81E 2ATWA 1RKNA 2H1EA 2MP1A 5FLMG 1JJGA 4DR4L 2A68D 3FPUB 3M4QA 3HOWH 4CJ0B 2FINB 1HTLD 4C3IG 4IUPA 1ET6A 4KY7A 3PIP3 1EU3A 2BCOA 4K5WA 1EWHA 2NUCA 5EPJA 2K03A 2UUCQ 1N34Q 3PIPA 3CHBD 1STGA 1PFNA 3STBC 3IAYA 3LWUA 3U4ZA 3S24A 4A76A 3S1QB 4DPGA 4H44C 4KHPQ 1Y8PB 1DYQA 4FXKC 4JVZA 1YJWA 4RCNA 1SYCA 2NVYH 2DUDA 3MHBA 2B3GA 1G2TA 1EY0A 1UWVA 4LW1A 3OPOA 4UP9A 3V96A 4PMWA 4KHPL 3PO2H 3FDTA 1C7YA 1WFQA 1X55A 3LX0A 4F7XA 1G6PA 1K28A 3I2ZA 2QKIC 5F2DA 4C3HH 4LF8L 1S72A 2EY6A 1SMYC 3URYA 5FLXL 2O5JC 1SBBB 4ME5A 2YU9B 3GTGH 1DJRD 2XTIA 5M9OA 3D8GA 4R4QA 3GTPH 5CV6A 5CV5A 1Y1WG 3I4MG 1MHWC 1QCBD 4OEMB 2JA5H 3BG3A 1I50H 2HHHQ 2G9HD 1F2YA 4JYAQ 2M00A 4YHHL 2XWBB 1E1OA 2CWPA 1A15A 4KTAA 1EWCA 2VB3X 5C3WA 3HEJA 5JEAH 4RGOS 3PF5A 4XQJA 3C46A 3KF8A 3UDIA 2HHHL 1I6HH 5KRUA 1LTGD 1UUPA 3ULPA 2BDOA 4ME3A 1MD2D 1Q8IA 1WCMB 3MXGA 1I6VC 2F0OA 3H6MA 4POGA 5M3FG 2QW7A 1AEXA 4LK1C 2C35B 5EAYA 3M4OB 2K5HA 1HZ9A 5GAGC 3Q22A 5JEAJ 5E1FA 2OXPA 3CC2A 2A69D 1X3FA 5FO7B 3K5MA 1A63A 2I46A 1V9PA 3FKIG 1Y8NB 4P73A 4DV4Q 3UDGA 2DN8A 2I5HA 3HKZG 3CF5A 2JA8G 5KYLA 2F0DA 1EIGA 3N52A 2Z4IA 3NUCA 4J1MA 1UNSA 4Q0FA 4UHVA 2H4OA 1O7ZA 4DV4L 3UE1A 3ONAB 2KA7A 1XTDA 4A3IB 1CM9A 2VUMG 2PCFB 3OIQA 2SEBD 3M4PA 1WTWA 1UAPA 1ET9A 4EX5A 1PDQA 3UDFA 4UY8C 1IW7D 5AJ3Q 1PFSA 2N88A 4YCWA 4U673 5JJZA 1EQVA 3J7A5 4KJOA 1IL2A 5C3EH 4YWKA 3R2TA 2MNAA 1YHAA 2F0NA 2C9OA 5AJ3L 4DV7Q 4L5SA 2ZTEA 4LFAQ 3GTKB 4P72A 5CGKA 4O1NA 1EQTA 3D4WA 2IX3A 2F0WA 1A2UA 1VQLA 3HOXG 4NXNQ 1Q1EA 3S2DB 3BVMA 4JI8Q 1TKWB 5C4XB 2LKVA 2HDLA 1HNWL 2FFKB 4DV7L 4LFAL 5EQ0A 4DNTB 5KNDA 2HIXA 1HPCA 4A3GB 4NXNL 4IO9A 2ALYB 2YYZA 4JI8L 3M9BA 1XPOA 2FHTA 1VQBA 4L8JA 4A3BH 2K32A 4HSVA 1H9KA 3K0YA 1SYEA 2EXZA 2SNMA 2G9DA 3J7YW 2IX1A 2EPBA 4A93G 4PZ6A 4DV2Q 1FVIA 2RVLA 1F77A 1WTQA 4JV5Q 1K3BC 1W2BA 1E1TA 1G2SA 3PUXA 3GTMB 4DV2L 3T53B 3I7FA 4EGVA 5I2YA 5JJLA 5K36H 4HMIA 1IL8A 2NVQB 3W1BA 3NK9A 4EVOA 1FL0A 4JV5L 5I4DA 4IOAA 1C9OA 3K5LA 1A6XA 1EL0A 4QGUA 1I4GA 3S2HH 4GS3A 3PUWA 5LL6S 1TVXA 1FR3A 5CC4A 4N9PA 5JPNC 2TMPA 1II3A 3Q24A 4H13C 5EKKA 4V190 4R4CA 2O2LD 1QVCA 2F0JA 5EGTA 5EPKA 4HJAA 3PO3B 3FRPB 3I4NG 5JVH3 3R2IA 3V05A 3RZOH 1EYGA 1LT5D 5J22A 3SE0A 1S3OA 1C0AA 2NN6I 1RL2A 3TDQA 2F0TA 3FEWX 3KLWA 5IE8A 5A2QE 3TEHB 1G91A 1JOKA 5C0XJ 1BKBA 1U4LA 4JBWA 1KDCA 4CJ1B 3AMUA 2JA7H 1SSOA 3CAMA 1A62A 4KJNA 2HUGA 2JEBI 2EXDA 2QDBA 3SK6A 1N36Q 2EYJA 3D4DA 1Q1BA 5C5MA 4JW0A 1M1KC 5NUCA 2Q8IB 1A0IA 1XMOQ 3KDFB 2GVBA 1SE4A 1NSNS 1F9PA 2K6AA 1L1OB 4B3SQ 3H3VI 2VQFL 4B08A 3SK4A 5C4JH 1N36L 1IZ6A 2IHEA 1WTXA 4RAUC 2R93B 2PZWA 2F0HA 3QR8A 1O80A 4YY3Q 1XMOL 5ELEA 2L15A 2PO4A 1KXLA 4RG1A 1QNKA 1SJHD 3HKZE 5G3LD 3AFQA 1KIXA 4B3SL 1J9OA 1LTTD 1Q3LA 4HCSA 5M5WB 1EIYB 1HNXQ 3P7JA 1ASZA 4LF7Q 4IQZA 2QEXA 3PGZA 1CI3M 2ZM6L 4A3EB 3C3LA 1HNXL 3O13A 3VR2A 4LF7L 1VS0A 3TS2A 1HUNA 2K7VA 1ESFA 2ZJPA 4ZCKA 4JOIC 4G57A 4H7BA 2IHFA 1STHA 4IUQA 4PMCA 4A4IA 4ZYSA 1Y1VG 2VQEQ 1B70B 2ICEC 2B8FA 4DR3Q 2MPMA 4X3TA 2O4XA 1BCPF 4C2MB 3PSIA 2PNHA 3NELA 1RTNA 4A3JG 2K50A 2HD3A 2NTTA 2VQEL 2F03A 1VDZA 4B9XA 4DR3L 2QILA 1A3TA 1UE5A 4XIGS 1EU4A 1O78A 2ID0A 1CZGA 4TSSA 4PQXA 2A6HC 4C3IB 4HJ5A 2D5DA 3HOYB 1JWMD 2YTXA 3G71A 2R61A 1FJGQ 3BZKA 1DM0B 1RDPD 4AIMA 1N33L 2FMCA 4A3KH 2UU9Q 4IPDA 3HOVG 3HS0C 4OIJA 4OWXB 3I4MH 1TWFH 1EOVA 5I6YA 1LTLA 1BF4A 1EY8A 1JR0D 4X65Q 4GKJQ 2VS1A 3GO5A 3ITPA 3BJUA 3VR3A 1OXXK 1GVPA 2UU9L 1EY9A 3TSSA 4XT1B 4A3MG 1MI2A 1GXDC 3H3VH 4OO1G 1PTOF 4X65L 3CXCA 4GKJL 4X3SA 2D2CC 4L63B 4O2DA 4N8X1 1C48A 2ZXOA 1SLJA 1K9MC 1IYVA 4LUOA 3UI2A 1VF7A 3C1EA 2KCCA 3EN2A 1AH9A 1KABA 3NE5B 4PNYA 4KY6A 3HRZC 3PUYA 1FGUA 3QO2A 1HQMC 3F2BA 3X3MA 1QJOA 3NSWA 2KHSA 2MO1A 1Y1WB 2NBFA 2HCCA 1XNQQ 3BZCA 3DEPA 1JC7A 3E3XA 5ELCA 1QNUA 4MNOA 1X3GA 4A3CG 1LUZA 5C4XG 3SXHA 1ZKOA 2KCMA 4A3GG 4U68A 1XNQL 4N9TA 1I3QH 2NVXH 2O5IC 2A8VA 2E75C 3PUZA 4ZLTF 3TZUA 1LTAD 1IKLA 4L5QA 1XMQQ 3CCLA 4JI0Q 3KF8B 2K14A 3W3AA 2CCZA 2VUMH 4B3RL 4J8QA 3T1YQ 2XNAC 3LGJA 4BY7H 5M3FB 2ZTDA 1MJCA 4V0BA 2Z8LA 2ASBA 2F0MA 2I07B 2R7DA 1ASYA 1KNEA 1LV9A 1XMQL 4YIJA 4JI0L 3L9AX 3Q23A 3QJYA 2LXKA 3T1YL 2L12A 2F0FA 2CH4W 2PYKA 1ICFB 1IXRA 3FKIB 1VQFA 3P20A 4XXEA 5C4ZA 4GOPC 1PH1A 2JA8B 3HOUB 1TQOA 4DXGA 1WD1A 4RHRA 4BBRG 3ND8A 4ZKCB 2A19A 2UUBQ 2R3ZA 1RHPA 3J81c 4QB4A 4WRDA 1WVLA 2JQOA 2B63B 4RMFA 2EY5A 4OXPA 1ILQA 1OXVA 4K6LA 2UUBL 2QCPX 3VA7A 1JOOA 2Z6KA 4R1JA 1GUGA 3M3YB 1U4MA 2LSSA 4I7AA 1TWCB 4LAAA 1QVGA 4QY7A 3TP5A 5IP7H 1SE8A 1KRSA 1AZQA 4GOPA 4A93H 1Q46A 1BOSA 3CRKC 5BR8L 1Q82C 1KD1C 1HNZQ 3Q8DA 2KEDA 3TQYA 3DMUA 4DR1Q 4FNFA 5ISRA 3KFUA 3MEHA 4HIOA 1E24A 1LTRD 4IJHA 4AH6A 3T51B 3FP9A
chains in the Genus database with same CATH topology
3GTGH 1Y1WH 1HNZL 3S16H 3W5OA 1PVOA 2XTIA 4DR1L 1FJGL 4AQYQ 1KAWA 4R4QA 4R4IA 4TVAB 1PH4A 3GTPH 2R92H 1XPRA 4QJFA 1Y1WG 3H15A 3S1NH 1MJEA 1JJ2A 4HIMA 1HZBA 3I4MG 1D8LA 4DK3C 1QUQA 1K3RA 2R92G 1P16A 3HOZH 3T1HQ 3GTLH 2JA5H 5C0XG 1I50H 2H5XA 4AYBG 1GM5A 2HHHQ 2AWNA 5E7NA 3CCQA 3UE0A 4JYAQ 4DV6Q 4AQYL 1L0WA 4GNXA 2CWAA 2JA5G 4YHHL 4Y7NH 4JBMA 1E1OA 2CWPA 2D62A 2R93G 2HIVA 2YV5A 3PF5A 2DGYA 2KCTA 1GO3E 3T1HL 3I4MH 3W1GA 3UDIA 4UP8A 4FDBA 2HHHL 1VQJA 1I6HH 1VQNA 1UEBA 4DV6L 1JE5A 3KJPA 1K8GA 3GTJH 3ULPA 1VQ5A 4ME3A 2VY3A 4PG3A 5HGQA 2VUMH 4DR6Q 5M3FH 3S1MH 4DV1Q 1TXYA 4NXMQ 1GKHA 1B8AA 4A93H 5IYCG 1WI5A 5ELNA 4DAYB 3PUVA 5M3FG 3GDEA 4POGA 1OTCA 2N3SA 1OXTA 1H95A 1LYLA 2HQLA 2R6GA 2C35B 5EAYA 4A3EG 2K5HA 3CCUA 1HZ9A 5GAGC 2XGTA 4DK6C 2I0QA 5JEAJ 4DR6L 1YIJA 1EUJA 3FKIH 3CC2A 1DGSA 1B7YB 3RLNA 5C44H 4DV1L 4NXML 1X3FA 4DR7Q 1N8RC 1SROA 1A63A 1V9PA 1VQ8A 3FKIG 2JA8H 2OQKA 1JJCB 4P73A 3HOUH 4DV4Q 3UDGA 4A3FH 2I5HA 1KHIA 3CMAA 3HKZG 3CF5A 5GAHC 2JA8G 4BY1G 3ULLA 2PQAA 4A3FG 3NEMA 1UE7A 2VQFQ 3S1QH 2WB1G 3G48A 1U5KA 1RIPA 3JC66 5DLQE 2B63H 4LFBQ 2JE6I 4DV4L 3CD6A 3K7UC 1VQPA 3UE1A 2YTVA 4LFCQ 4P75A 1XTDA 1HJPA 3OW2A 3CCSA 5ELOA 4DUYQ 2VUMG 3M4PA 1G291 1VQIA 1X6OA 3M3YH 1LM0A 1TWCH 4HIDA 4EX5A 4LFBL 2K52A 5GADC 1PYSB 4K0KQ 3L2PA 4LF5L 2GVAA 3D31A 2Y0SE 4LFCL 3UDFA 4UY8C 3BU2A 1CSPA 3UDXA 2ZM6Q 3J80c 3L0OA 5AJ3Q 3HOWG 1PFSA 4DUYL 2Z0SA 2ZJRA 3HOYG 2E8GA 1TWHH 2WAQG 1X56A 4DUZQ 1T9HA 3G4SA 4YCWA 4DV0Q 3RLOA 4DR2Q 4K0KL 3CCRA 3J7A5 1IL2A 5C3EH 2YU9H 4YWKA 2HT1A 4J15A 2MNAA 3WWVA 1YHAA 5AJ3L 3HOXH 5C3EG 4DV7Q 4L5SA 2ZTEA 1V1QA 1WJJA 4P72A 4LFAQ 1KRTA 1JMCA 1J5EQ 1VQLA 2BH8A 4DUZL 1G51A 3HOXG 4DV0L 4LF6Q 4NXNQ 1Q1EA 2RHSB 2UUAQ 3E9IA 2FXQA 4NB3A 4DR2L 4JI8Q 2MFIA 2Q2IA 2MO0A 3STBD 5IYBG 1Y14B 4BBSG 1NJIC 2UUCL 2JA6H 1BBUA 1N34L 1HNWL 4DV7L 3K7AH 4LFAL 2JA6G 1J5EL 2HIXA 5LMNW 1SFOH 4X66L 4A3LH 4NXNL 4LF6L 4IO9A 2N78A 1OXSC 2ALYB 2UUAL 2YYZA 1EQRA 4JI8L 1VQGA 3M9BA 1XPOA 4A3LG 1U0LA 1VQBA 3AEVA 4A3BH 5IT9c 3SGIA 4YWLA 5FLXc 4DV3Q 3PO2G 4OONA 2IX1A 3S14H 1WCMH 4A3BG 4PZ6A 4DV2Q 4A93G 2OTJA 1SN8A 1E3PA 2NZHA 4MTNA 1FVIA 4JI7Q 4YCVA 2OTLA 3GTOH 1WCMG 5LMUQ 1O7IA 4QIWE 4JV5Q 2KHIA 1W2BA 4JI6Q 3DM3A 2ZTCA 1PV4A 1Z47A 2JJQA 3RN5A 3M4OH 1E1TA 3PUXA 4DV3L 1N33Q 1S40A 1CUKA 5FJ8H 3CCVA 1HZAA 4DV2L 3I7FA 2ES2A 5JJLA 3J80i 4JI7L 4IPCA 1IBKL 3AQQA 5FJ8G 5LMUL 4IJLA 3W1BA 1VQ6A 1CKOA 1FL0A 4JV5L 2AKWB 4JI6L 5K36G 4IOAA 4PZ8A 1C9OA 3CCEA 3HOZG 2WP8J 4QGUA 2VW9A 3CCJA 3S2HH 4LUVA 4GS3A 3PUWA 5H1SE 3KJOA 1VQKA 4WJ4A 5M5XH 3RZDH 4DNIA 5IP9H 4GKKQ 3K80C 3J81i 1IBMQ 5JEAG 1VQMA 1OXUA 1NBWA 2RF4A 4JYAL 5IP9G 1TWAH 2EQSA 4R4CA 4A3IH 4HJ7A 1QVCA 4LUZA 4HJAA 3RNUA 1PH8A 3I4NH 4A3IG 4XTCS 2KBNA 1L2FA 4GLVB 3I4NG 1IBML 2RHQB 3K81C 1V43A 3RZOH 4BXXH 1CKNB 1EYGA 4AYBE 1C0AA 1S3OA 4OWTB 3KF6B 3EBEA 4IFDJ 4BXXG 2NN6I 1RL2A 1MIUA 2AMCB 4R4TA 1R9TH 2UXDQ 3M7NA 1X65A 3KLWA 5IE8A 3TEHB 5C44G 4JC0A 3S1RH 5C0XJ 1SMXA 2PI2E 1BKBA 2WFWA 3L7ZC 4JBWA 1PH9A 4IFDI 4IOCA 3PIOA 2Q2HA 2IY5B 2JA7H 3CAMA 2KHJA 2UXBQ 2I5LX 3J81j 1HR0W 1A62A 3GTKH 3HOUG 1JT8A 2JEBI 5M3MH 2EXDA 2JA7G 2E2HH 1PA6A 5C0XI 4HIKA 1N36Q 3S2DH 1Q81C 4H02A 5GAEC 4O0AA 1Q1BA 1M1KC 4JBJA 1NY4A 5M3MG 3RN2A 1A0IA 1XMOQ 4A3CH 2F52A 2GVBA 3KDFB 3ZJYC 4DR5Q 1XNRQ 4OO1I 1PH6A 1VQAA 2B63G 2UXBL 4HJ9A 1KL9A 1L1OB 4B3SQ 3H3VI 2VQFL 4A3GH 2LXJA 1UE1A 5C4JH 1VQ4A 1N36L 4L5RC 3U50C 4LNQA 1IZ6A 2IHEA 4B3RQ 1XJVA 2OQ0A 2CFMA 4YY3Q 4JBKA 1XMOL 4JG2A 2L15A 4DR5L 4GN4B 4BA2I 3PV0A 1QVFA 4RG1A 5HY6A 1KXLA 1YVCA 3AYHB 1EFWA 3HKZE 4B3SL 3AFQA 1KIXA 1I94Q 5J3BA 3KOJA 2R7FA 2AHOB 1XPUA 3MEFA 3JAMc 1EIYB 3ER0A 1HNXQ 2BA1A 1ASZA 3GD7A 4LF7Q 1PYBA 3D0FA 3OYYA 2QEXA 1KC8C 3PGZA 1WYDA 3U4VA 2IT1A 2ZM6L 1QZHA 3GTMH 1I94L 4PZ7A 4GLXA 4UP7A 1QZGA 4A3DH 1Z9FA 2CKZB 3J7ZC 1HNXL 4LF7L 2NVQH 1VS0A 3TS2A 2CQOA 4LF4Q 4A3DG 1E22A 2Z6KC 3VDYA 1BBWA 1IYJB 2ZJPA 1Y1VH 1X54A 3A0JA 4JOIC 4C3JH 4ALPA 5IWAQ 1EQQA 1W3SA 2IHFA 4IPGA 3E0EA 2D0PA 4A4IA 1YJNA 1Y1VG 1X3EA 1UE6A 3DLLA 1VQOA 2VQEQ 1B70B 3HKSA 4DR3Q 4NPSA 2R7ZH 4LF4L 2WAQE 4GN5A 3B6YA 4A3JH 3F1ZA 4EQ5A 1GD7A 1YITA 5IWAL 4JI3Q 1Q7YC 3PSIA 3GTQH 2PNHA 1VQHA 3NELA 4A3JG 1YBYA 2K50A 5LMNQ 1E7ZA 2VQEL 2I5MX 4DR3L 3PO3H 2KENA 2VL6A 2K5VA 1CKNA 1NMFA 5BR8Q 1UE5A 4XIGS 4HJ8A 1L1OC 2Q2TA 4IPHA 3PO3G 3KF6A 1Q12A 3PCOB 2RCNA 4JI3L 3CMEA 2UXCQ 2ID0A 2JA9A 1HH2P 1PHJA 1KQSA 4LF8Q 4JI2Q 3F2CA 5LMNL 4JI1Q 4GLAC 4A75A 4HJ5A 4GNXC 3TREA 3JAMi 3G71A 2YTXA 3H0GH 2V1CC 4JI5Q 1FJGQ 2YTYA 2VZAA 4APVA 3G6EA 3AFPA 3BZKA 3S15H 2F4VQ 1D7QA 1N33L 1SR3A 4P71A 4AIMA 1VQDA 2UXCL 2QA4A 3H0GG 1I5FA 3HOVH 4JI2L 2NN6G 3CW2C 4JI1L 2E2JH 4JI4Q 4A3KH 4YCUA 2UU9Q 2D0OA 4IPDA 5JJKA 2Q2UA 3HOVG 1JB7A 1A8VA 4OWXB 3KDFA 1TWFH 3MXNB 1EOVA 3I4OA 4JI5L 5GQOA 4A3KG 1YHQA 2EIFA 2N8NA 4YHHQ 1LTLA 3K8AA 1K73C 1PH7A 4X65Q 1IBLQ 2BA0A 1YEZA 2VS1A 3GO5A 1L1OA 4GKJQ 3I55A 3BJUA 2B29A 3EIVA 4JI4L 4A3MH 3A74A 1PH3A 1OXXK 1GVPA 1HZCA 2UU9L 1N32Q 3IRBA 3CPFA 1YJ9A 1YZ6A 2QGQA 2R93H 1VCIA 4A3MG 2PMZE 3CPWA 2PI2A 3M85A 1IBLL 3H3VH 4DR7L 4OO1G 4GN3B 4X65L 3ERSX 3CXCA 4GKJL 4O2DA 2GN5A 1CSQA 5M5WH 1SLJA 1Q86C 1N32L 1K9MC 4OX9Q 1NTGA 4LUOA 2IX0A 2N49A 3CQZH 1VQ7A 2JEAI 4GOPB 2ZJQA 3EN2A 5IYCH 1MKHA 1AH9A 5M5YH 3HFZB 3CC7A 2JK8A 3TS0A 2MQHA 5JJIA 1P8LA 3PUYA 1FGUA 4A3EH 4OX9L 3F2BA 4P74A 2UXDL 3ICEA 2A1AA 4LWCA 2MO1A 4X6AH 1M90C 1K83H 4Y52H 4B3TQ 1XNQQ 3BZCA 5C4XH 1K8AC 3CP0A 4KLKA 3ULJA 4X64Q 1HR0Q 4MNOA 1X3GA 4TQUS 4A3CG 1LUZA 5C4XG 1QUQB 2Y0SG 4BY1H 4UPAA 1CKMA 1NE3A 2KCMA 2VNUD 4A3GG 4QL5A 3FHWA 1VQ9A 1WOCA 4DKAC 4B3TL 2AWOA 1XNQL 4B3MQ 4R4OA 4GNXB 1YI2A 1XNRL 5IYDH 4C2MH 3NENA 4X64L 4KHZA 1HR0L 1I3QH 2E2IH 2NVXH 3RR5A 5IYDG 3F2DA 1VQEA 4L5TA 2A8VA 3PUZA 1K0RA 2NVTH 4DR4Q 4LF5Q 1XMQQ 4L5QA 3CCLA 1SRUA 4DAMA 3KF8B 1TWGH 2K14A 3RLFA 4YY3L 2CCZA 2WB1E 3K0XA 4IFDG 3T1YQ 4B3ML 3A5UA 3CCMA 3LGJA 5FLMH 4BY7H 2ZTDA 1MJCA 5GROA 3I56A 2ASBA 2NZOA 2ATWA 2R7DA 3E9HA 4C3IH 5FLMG 1ASYA 4JCVE 4BY7G 4DR4L 3M4QA 1X9NA 1XMQL 3HOWH 1JJGA 4JI0L 2LXKA 3HOYH 4OWWB 3T1YL 1J6QA 1IXRA 1VQCA 1N9WA 1VQFA 4BBRH 4GOPC 1PH1A 3CC4A 3PF4A 4BBRG 2UUCQ 1HNWQ 1N34Q 1Q8KA 3PIPA 2A19A 5IY0A 2UUBQ 2R7ZG 3STBC 4DV5Q 1BVSA 3J81c 1YHBA 2PQAB 3U4ZA 3S24A 5IYBH 4X66Q 4A76A 4BBSH 1AE2A 4DPGA 2JQOA 3U58A 2BH2A 4KHPQ 4RMFA 4OXPA 4X62Q 3OTOQ 1YJWA 1EWIA 1OXVA 2K5NA 1AE3A 2NVYH 2DUDA 1PH2A 2E5LQ 4DV5L 2B3GA 3A5ZB 3KYHC 2UUBL 2Z6KA 4R1JA 1NMGA 1UWVA 4LW1A 4LF9Q 2LSSA 4MZ9A 4UP9A 4JOIA 4JI0Q 4B3RL 4PMWA 4KHPL 3PO2H 4POFA 1QVGA 2K75A 1C7YA 2OCEA 1YNXA 4QY7A 1WFQA 1SE8A 1KRSA 1X55A 5IP7H 4X62L 1EIFA 1Q46A 5BR8L 3OTOL 4GOPA 1Q82C 4KI0A 1KD1C 1HNZQ 3Q8DA 4DR1Q 3TQYA 2E5LL 1G6PA 3I2ZA 5IP7G 3KFUA 4YWMA 4HIOA 4LF9L 4C3HH 1PH5A 1E24A 4LF8L 3TRZA 3S17H 2F4VL 4QQBX 4WJ3M 1S72A 1IBKQ 2K4KA 4IJHA 2OWOA 4AH6A 3NBHB 3FP9A 2F3IA 4BA1I 4GKKL 3F8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG H;  1Y1W H;  1HNZ L;  3S16 H;  3W5O A;  1PVO A;  2XTI A;  4DR1 L;  1FJG L;  4AQY Q;  1KAW A;  4R4Q A;  4R4I A;  4TVA B;  1PH4 A;  3GTP H;  2R92 H;  1XPR A;  4QJF A;  1Y1W G;  3H15 A;  3S1N H;  1MJE A;  1JJ2 A;  4HIM A;  1HZB A;  3I4M G;  1D8L A;  4DK3 C;  1QUQ A;  1K3R A;  2R92 G;  1P16 A;  3HOZ H;  3T1H Q;  3GTL H;  2JA5 H;  5C0X G;  1I50 H;  2H5X A;  4AYB G;  1GM5 A;  2HHH Q;  2AWN A;  5E7N A;  3CCQ A;  3UE0 A;  4JYA Q;  4DV6 Q;  4AQY L;  1L0W A;  4GNX A;  2CWA A;  2JA5 G;  4YHH L;  4Y7N H;  4JBM A;  1E1O A;  2CWP A;  2D62 A;  2R93 G;  2HIV A;  2YV5 A;  3PF5 A;  2DGY A;  2KCT A;  1GO3 E;  3T1H L;  3I4M H;  3W1G A;  3UDI A;  4UP8 A;  4FDB A;  2HHH L;  1VQJ A;  1I6H H;  1VQN A;  1UEB A;  4DV6 L;  1JE5 A;  3KJP A;  1K8G A;  3GTJ H;  3ULP A;  1VQ5 A;  4ME3 A;  2VY3 A;  4PG3 A;  5HGQ A;  2VUM H;  4DR6 Q;  5M3F H;  3S1M H;  4DV1 Q;  1TXY A;  4NXM Q;  1GKH A;  1B8A A;  4A93 H;  5IYC G;  1WI5 A;  5ELN A;  4DAY B;  3PUV A;  5M3F G;  3GDE A;  4POG A;  1OTC A;  2N3S A;  1OXT A;  1H95 A;  1LYL A;  2HQL A;  2R6G A;  2C35 B;  5EAY A;  4A3E G;  2K5H A;  3CCU A;  1HZ9 A;  5GAG C;  2XGT A;  4DK6 C;  2I0Q A;  5JEA J;  4DR6 L;  1YIJ A;  1EUJ A;  3FKI H;  3CC2 A;  1DGS A;  1B7Y B;  3RLN A;  5C44 H;  4DV1 L;  4NXM L;  1X3F A;  4DR7 Q;  1N8R C;  1SRO A;  1A63 A;  1V9P A;  1VQ8 A;  3FKI G;  2JA8 H;  2OQK A;  1JJC B;  4P73 A;  3HOU H;  4DV4 Q;  3UDG A;  4A3F H;  2I5H A;  1KHI A;  3CMA A;  3HKZ G;  3CF5 A;  5GAH C;  2JA8 G;  4BY1 G;  3ULL A;  2PQA A;  4A3F G;  3NEM A;  1UE7 A;  2VQF Q;  3S1Q H;  2WB1 G;  3G48 A;  1U5K A;  1RIP A;  3JC6 6;  5DLQ E;  2B63 H;  4LFB Q;  2JE6 I;  4DV4 L;  3CD6 A;  3K7U C;  1VQP A;  3UE1 A;  2YTV A;  4LFC Q;  4P75 A;  1XTD A;  1HJP A;  3OW2 A;  3CCS A;  5ELO A;  4DUY Q;  2VUM G;  3M4P A;  1G29 1;  1VQI A;  1X6O A;  3M3Y H;  1LM0 A;  1TWC H;  4HID A;  4EX5 A;  4LFB L;  2K52 A;  5GAD C;  1PYS B;  4K0K Q;  3L2P A;  4LF5 L;  2GVA A;  3D31 A;  2Y0S E;  4LFC L;  3UDF A;  4UY8 C;  3BU2 A;  1CSP A;  3UDX A;  2ZM6 Q;  3J80 c;  3L0O A;  5AJ3 Q;  3HOW G;  1PFS A;  4DUY L;  2Z0S A;  2ZJR A;  3HOY G;  2E8G A;  1TWH H;  2WAQ G;  1X56 A;  4DUZ Q;  1T9H A;  3G4S A;  4YCW A;  4DV0 Q;  3RLO A;  4DR2 Q;  4K0K L;  3CCR A;  3J7A 5;  1IL2 A;  5C3E H;  2YU9 H;  4YWK A;  2HT1 A;  4J15 A;  2MNA A;  3WWV A;  1YHA A;  5AJ3 L;  3HOX H;  5C3E G;  4DV7 Q;  4L5S A;  2ZTE A;  1V1Q A;  1WJJ A;  4P72 A;  4LFA Q;  1KRT A;  1JMC A;  1J5E Q;  1VQL A;  2BH8 A;  4DUZ L;  1G51 A;  3HOX G;  4DV0 L;  4LF6 Q;  4NXN Q;  1Q1E A;  2RHS B;  2UUA Q;  3E9I A;  2FXQ A;  4NB3 A;  4DR2 L;  4JI8 Q;  2MFI A;  2Q2I A;  2MO0 A;  3STB D;  5IYB G;  1Y14 B;  4BBS G;  1NJI C;  2UUC L;  2JA6 H;  1BBU A;  1N34 L;  1HNW L;  4DV7 L;  3K7A H;  4LFA L;  2JA6 G;  1J5E L;  2HIX A;  5LMN W;  1SFO H;  4X66 L;  4A3L H;  4NXN L;  4LF6 L;  4IO9 A;  2N78 A;  1OXS C;  2ALY B;  2UUA L;  2YYZ A;  1EQR A;  4JI8 L;  1VQG A;  3M9B A;  1XPO A;  4A3L G;  1U0L A;  1VQB A;  3AEV A;  4A3B H;  5IT9 c;  3SGI A;  4YWL A;  5FLX c;  4DV3 Q;  3PO2 G;  4OON A;  2IX1 A;  3S14 H;  1WCM H;  4A3B G;  4PZ6 A;  4DV2 Q;  4A93 G;  2OTJ A;  1SN8 A;  1E3P A;  2NZH A;  4MTN A;  1FVI A;  4JI7 Q;  4YCV A;  2OTL A;  3GTO H;  1WCM G;  5LMU Q;  1O7I A;  4QIW E;  4JV5 Q;  2KHI A;  1W2B A;  4JI6 Q;  3DM3 A;  2ZTC A;  1PV4 A;  1Z47 A;  2JJQ A;  3RN5 A;  3M4O H;  1E1T A;  3PUX A;  4DV3 L;  1N33 Q;  1S40 A;  1CUK A;  5FJ8 H;  3CCV A;  1HZA A;  4DV2 L;  3I7F A;  2ES2 A;  5JJL A;  3J80 i;  4JI7 L;  4IPC A;  1IBK L;  3AQQ A;  5FJ8 G;  5LMU L;  4IJL A;  3W1B A;  1VQ6 A;  1CKO A;  1FL0 A;  4JV5 L;  2AKW B;  4JI6 L;  5K36 G;  4IOA A;  4PZ8 A;  1C9O A;  3CCE A;  3HOZ G;  2WP8 J;  4QGU A;  2VW9 A;  3CCJ A;  3S2H H;  4LUV A;  4GS3 A;  3PUW A;  5H1S E;  3KJO A;  1VQK A;  4WJ4 A;  5M5X H;  3RZD H;  4DNI A;  5IP9 H;  4GKK Q;  3K80 C;  3J81 i;  1IBM Q;  5JEA G;  1VQM A;  1OXU A;  1NBW A;  2RF4 A;  4JYA L;  5IP9 G;  1TWA H;  2EQS A;  4R4C A;  4A3I H;  4HJ7 A;  1QVC A;  4LUZ A;  4HJA A;  3RNU A;  1PH8 A;  3I4N H;  4A3I G;  4XTC S;  2KBN A;  1L2F A;  4GLV B;  3I4N G;  1IBM L;  2RHQ B;  3K81 C;  1V43 A;  3RZO H;  4BXX H;  1CKN B;  1EYG A;  4AYB E;  1C0A A;  1S3O A;  4OWT B;  3KF6 B;  3EBE A;  4IFD J;  4BXX G;  2NN6 I;  1RL2 A;  1MIU A;  2AMC B;  4R4T A;  1R9T H;  2UXD Q;  3M7N A;  1X65 A;  3KLW A;  5IE8 A;  3TEH B;  5C44 G;  4JC0 A;  3S1R H;  5C0X J;  1SMX A;  2PI2 E;  1BKB A;  2WFW A;  3L7Z C;  4JBW A;  1PH9 A;  4IFD I;  4IOC A;  3PIO A;  2Q2H A;  2IY5 B;  2JA7 H;  3CAM A;  2KHJ A;  2UXB Q;  2I5L X;  3J81 j;  1HR0 W;  1A62 A;  3GTK H;  3HOU G;  1JT8 A;  2JEB I;  5M3M H;  2EXD A;  2JA7 G;  2E2H H;  1PA6 A;  5C0X I;  4HIK A;  1N36 Q;  3S2D H;  1Q81 C;  4H02 A;  5GAE C;  4O0A A;  1Q1B A;  1M1K C;  4JBJ A;  1NY4 A;  5M3M G;  3RN2 A;  1A0I A;  1XMO Q;  4A3C H;  2F52 A;  2GVB A;  3KDF B;  3ZJY C;  4DR5 Q;  1XNR Q;  4OO1 I;  1PH6 A;  1VQA A;  2B63 G;  2UXB L;  4HJ9 A;  1KL9 A;  1L1O B;  4B3S Q;  3H3V I;  2VQF L;  4A3G H;  2LXJ A;  1UE1 A;  5C4J H;  1VQ4 A;  1N36 L;  4L5R C;  3U50 C;  4LNQ A;  1IZ6 A;  2IHE A;  4B3R Q;  1XJV A;  2OQ0 A;  2CFM A;  4YY3 Q;  4JBK A;  1XMO L;  4JG2 A;  2L15 A;  4DR5 L;  4GN4 B;  4BA2 I;  3PV0 A;  1QVF A;  4RG1 A;  5HY6 A;  1KXL A;  1YVC A;  3AYH B;  1EFW A;  3HKZ E;  4B3S L;  3AFQ A;  1KIX A;  1I94 Q;  5J3B A;  3KOJ A;  2R7F A;  2AHO B;  1XPU A;  3MEF A;  3JAM c;  1EIY B;  3ER0 A;  1HNX Q;  2BA1 A;  1ASZ A;  3GD7 A;  4LF7 Q;  1PYB A;  3D0F A;  3OYY A;  2QEX A;  1KC8 C;  3PGZ A;  1WYD A;  3U4V A;  2IT1 A;  2ZM6 L;  1QZH A;  3GTM H;  1I94 L;  4PZ7 A;  4GLX A;  4UP7 A;  1QZG A;  4A3D H;  1Z9F A;  2CKZ B;  3J7Z C;  1HNX L;  4LF7 L;  2NVQ H;  1VS0 A;  3TS2 A;  2CQO A;  4LF4 Q;  4A3D G;  1E22 A;  2Z6K C;  3VDY A;  1BBW A;  1IYJ B;  2ZJP A;  1Y1V H;  1X54 A;  3A0J A;  4JOI C;  4C3J H;  4ALP A;  5IWA Q;  1EQQ A;  1W3S A;  2IHF A;  4IPG A;  3E0E A;  2D0P A;  4A4I A;  1YJN A;  1Y1V G;  1X3E A;  1UE6 A;  3DLL A;  1VQO A;  2VQE Q;  1B70 B;  3HKS A;  4DR3 Q;  4NPS A;  2R7Z H;  4LF4 L;  2WAQ E;  4GN5 A;  3B6Y A;  4A3J H;  3F1Z A;  4EQ5 A;  1GD7 A;  1YIT A;  5IWA L;  4JI3 Q;  1Q7Y C;  3PSI A;  3GTQ H;  2PNH A;  1VQH A;  3NEL A;  4A3J G;  1YBY A;  2K50 A;  5LMN Q;  1E7Z A;  2VQE L;  2I5M X;  4DR3 L;  3PO3 H;  2KEN A;  2VL6 A;  2K5V A;  1CKN A;  1NMF A;  5BR8 Q;  1UE5 A;  4XIG S;  4HJ8 A;  1L1O C;  2Q2T A;  4IPH A;  3PO3 G;  3KF6 A;  1Q12 A;  3PCO B;  2RCN A;  4JI3 L;  3CME A;  2UXC Q;  2ID0 A;  2JA9 A;  1HH2 P;  1PHJ A;  1KQS A;  4LF8 Q;  4JI2 Q;  3F2C A;  5LMN L;  4JI1 Q;  4GLA C;  4A75 A;  4HJ5 A;  4GNX C;  3TRE A;  3JAM i;  3G71 A;  2YTX A;  3H0G H;  2V1C C;  4JI5 Q;  1FJG Q;  2YTY A;  2VZA A;  4APV A;  3G6E A;  3AFP A;  3BZK A;  3S15 H;  2F4V Q;  1D7Q A;  1N33 L;  1SR3 A;  4P71 A;  4AIM A;  1VQD A;  2UXC L;  2QA4 A;  3H0G G;  1I5F A;  3HOV H;  4JI2 L;  2NN6 G;  3CW2 C;  4JI1 L;  2E2J H;  4JI4 Q;  4A3K H;  4YCU A;  2UU9 Q;  2D0O A;  4IPD A;  5JJK A;  2Q2U A;  3HOV G;  1JB7 A;  1A8V A;  4OWX B;  3KDF A;  1TWF H;  3MXN B;  1EOV A;  3I4O A;  4JI5 L;  5GQO A;  4A3K G;  1YHQ A;  2EIF A;  2N8N A;  4YHH Q;  1LTL A;  3K8A A;  1K73 C;  1PH7 A;  4X65 Q;  1IBL Q;  2BA0 A;  1YEZ A;  2VS1 A;  3GO5 A;  1L1O A;  4GKJ Q;  3I55 A;  3BJU A;  2B29 A;  3EIV A;  4JI4 L;  4A3M H;  3A74 A;  1PH3 A;  1OXX K;  1GVP A;  1HZC A;  2UU9 L;  1N32 Q;  3IRB A;  3CPF A;  1YJ9 A;  1YZ6 A;  2QGQ A;  2R93 H;  1VCI A;  4A3M G;  2PMZ E;  3CPW A;  2PI2 A;  3M85 A;  1IBL L;  3H3V H;  4DR7 L;  4OO1 G;  4GN3 B;  4X65 L;  3ERS X;  3CXC A;  4GKJ L;  4O2D A;  2GN5 A;  1CSQ A;  5M5W H;  1SLJ A;  1Q86 C;  1N32 L;  1K9M C;  4OX9 Q;  1NTG A;  4LUO A;  2IX0 A;  2N49 A;  3CQZ H;  1VQ7 A;  2JEA I;  4GOP B;  2ZJQ A;  3EN2 A;  5IYC H;  1MKH A;  1AH9 A;  5M5Y H;  3HFZ B;  3CC7 A;  2JK8 A;  3TS0 A;  2MQH A;  5JJI A;  1P8L A;  3PUY A;  1FGU A;  4A3E H;  4OX9 L;  3F2B A;  4P74 A;  2UXD L;  3ICE A;  2A1A A;  4LWC A;  2MO1 A;  4X6A H;  1M90 C;  1K83 H;  4Y52 H;  4B3T Q;  1XNQ Q;  3BZC A;  5C4X H;  1K8A C;  3CP0 A;  4KLK A;  3ULJ A;  4X64 Q;  1HR0 Q;  4MNO A;  1X3G A;  4TQU S;  4A3C G;  1LUZ A;  5C4X G;  1QUQ B;  2Y0S G;  4BY1 H;  4UPA A;  1CKM A;  1NE3 A;  2KCM A;  2VNU D;  4A3G G;  4QL5 A;  3FHW A;  1VQ9 A;  1WOC A;  4DKA C;  4B3T L;  2AWO A;  1XNQ L;  4B3M Q;  4R4O A;  4GNX B;  1YI2 A;  1XNR L;  5IYD H;  4C2M H;  3NEN A;  4X64 L;  4KHZ A;  1HR0 L;  1I3Q H;  2E2I H;  2NVX H;  3RR5 A;  5IYD G;  3F2D A;  1VQE A;  4L5T A;  2A8V A;  3PUZ A;  1K0R A;  2NVT H;  4DR4 Q;  4LF5 Q;  1XMQ Q;  4L5Q A;  3CCL A;  1SRU A;  4DAM A;  3KF8 B;  1TWG H;  2K14 A;  3RLF A;  4YY3 L;  2CCZ A;  2WB1 E;  3K0X A;  4IFD G;  3T1Y Q;  4B3M L;  3A5U A;  3CCM A;  3LGJ A;  5FLM H;  4BY7 H;  2ZTD A;  1MJC A;  5GRO A;  3I56 A;  2ASB A;  2NZO A;  2ATW A;  2R7D A;  3E9H A;  4C3I H;  5FLM G;  1ASY A;  4JCV E;  4BY7 G;  4DR4 L;  3M4Q A;  1X9N A;  1XMQ L;  3HOW H;  1JJG A;  4JI0 L;  2LXK A;  3HOY H;  4OWW B;  3T1Y L;  1J6Q A;  1IXR A;  1VQC A;  1N9W A;  1VQF A;  4BBR H;  4GOP C;  1PH1 A;  3CC4 A;  3PF4 A;  4BBR G;  2UUC Q;  1HNW Q;  1N34 Q;  1Q8K A;  3PIP A;  2A19 A;  5IY0 A;  2UUB Q;  2R7Z G;  3STB C;  4DV5 Q;  1BVS A;  3J81 c;  1YHB A;  2PQA B;  3U4Z A;  3S24 A;  5IYB H;  4X66 Q;  4A76 A;  4BBS H;  1AE2 A;  4DPG A;  2JQO A;  3U58 A;  2BH2 A;  4KHP Q;  4RMF A;  4OXP A;  4X62 Q;  3OTO Q;  1YJW A;  1EWI A;  1OXV A;  2K5N A;  1AE3 A;  2NVY H;  2DUD A;  1PH2 A;  2E5L Q;  4DV5 L;  2B3G A;  3A5Z B;  3KYH C;  2UUB L;  2Z6K A;  4R1J A;  1NMG A;  1UWV A;  4LW1 A;  4LF9 Q;  2LSS A;  4MZ9 A;  4UP9 A;  4JOI A;  4JI0 Q;  4B3R L;  4PMW A;  4KHP L;  3PO2 H;  4POF A;  1QVG A;  2K75 A;  1C7Y A;  2OCE A;  1YNX A;  4QY7 A;  1WFQ A;  1SE8 A;  1KRS A;  1X55 A;  5IP7 H;  4X62 L;  1EIF A;  1Q46 A;  5BR8 L;  3OTO L;  4GOP A;  1Q82 C;  4KI0 A;  1KD1 C;  1HNZ Q;  3Q8D A;  4DR1 Q;  3TQY A;  2E5L L;  1G6P A;  3I2Z A;  5IP7 G;  3KFU A;  4YWM A;  4HIO A;  4LF9 L;  4C3H H;  1PH5 A;  1E24 A;  4LF8 L;  3TRZ A;  3S17 H;  2F4V L;  4QQB X;  4WJ3 M;  1S72 A;  1IBK Q;  2K4K A;  4IJH A;  2OWO A;  4AH6 A;  3NBH B;  3FP9 A;  2F3I A;  4BA1 I;  4GKK L;  3F8T A; 
#chains in the Genus database with same CATH topology
 1ZEQ X;  3IFD A;  1HNZ L;  3W5O A;  4H0L C;  4DR1 L;  3D3R A;  4AQY Q;  3HOX B;  4R4I A;  4TVA B;  1PH4 A;  3R93 A;  1GHK A;  4A3D B;  1MJE A;  1JJ2 A;  1HZB A;  3EA6 A;  5BN3 A;  5KNC A;  4DK3 C;  3K58 A;  1YNJ C;  2R92 G;  1B53 A;  1P16 A;  5C0X G;  2AWN A;  3UE0 A;  5FK9 C;  2L4N A;  4DV6 Q;  4GNX A;  4AQY L;  3K7A B;  4K14 A;  4ZK9 B;  2QEJ C;  2R93 G;  1DOL A;  1GO3 E;  3KK7 A;  1SJE D;  5KNB A;  3W1G A;  1B50 A;  1VQN A;  1UEB A;  4DV6 L;  3KJP A;  1K8G A;  3GTJ H;  4KN7 C;  1VQ5 A;  5HGQ A;  3NQI A;  2ZXP A;  1TXY A;  1F2L A;  1B8A A;  3GTO B;  5IYC G;  5D65 A;  5ELN A;  4DA2 A;  3GDE A;  2OT2 A;  1OTC A;  2N3S A;  1OXT A;  3E0J A;  1LYL A;  2R6G A;  4A3E G;  2I0Q A;  3VYT A;  1EUJ A;  1DGS A;  1AFP A;  3ND9 A;  2WKD A;  1N8R C;  3P1H A;  1SRO A;  2OQK A;  3SHL A;  4M1U B;  3CMA A;  1Z6H A;  1CZW A;  2XIW A;  4KD4 A;  3J80 E;  3ULL A;  2PQA A;  4A3F G;  2L9H A;  1T5E A;  2PNR C;  5M5X B;  3RZD B;  3S1Q H;  3G48 A;  5DLQ E;  2JE6 I;  5FOB B;  3CD6 A;  3K57 A;  1VQP A;  5CV9 A;  4EQP A;  4C1N I;  1GHJ A;  2PW5 A;  1JWU D;  3I4N B;  1LM0 A;  1GUN A;  3BDC A;  2BOS A;  5GAD C;  1PYS B;  4KD3 A;  5J1Z A;  3BU2 A;  2XRQ D;  4K8I A;  1H9M A;  3HOY G;  2E8G A;  1EEF D;  2WAQ G;  1R9T B;  3G4S A;  3CCR A;  3NTK A;  2IJ0 A;  2EZV A;  2YU9 H;  1JWS D;  3I73 A;  2B2U A;  3NWT A;  3I4L A;  1JMC A;  1KLG D;  2BH8 A;  4LF6 Q;  1J8I A;  1HFG A;  1RTO A;  1V8Q A;  2RHS B;  4NB3 A;  5C6A A;  3I3C A;  3VR4 A;  2MFI A;  1C4Q A;  5IYB G;  1Y14 B;  4C1N K;  3BVG A;  2UUC L;  1N34 L;  1B3A A;  2JA6 G;  3OWF A;  5LMN W;  4LF6 L;  2N78 A;  1D5Z C;  4A3L G;  1SNQ A;  1HQR D;  2FMM A;  1WCM H;  1IKM A;  1TY2 A;  4MTN A;  4PMB A;  5IT9 L;  4YCV A;  2ZT9 C;  3P75 A;  4JI7 Q;  5LMU Q;  3A54 A;  4JI6 Q;  3DM3 A;  1Z47 A;  3RN5 A;  2X69 A;  3M4O H;  1SE2 A;  1CT1 D;  3CCV A;  1CA5 A;  1HZA A;  3A7A B;  3J80 i;  3H3V C;  1NCV A;  2B8G A;  4JI7 L;  2F0S A;  5LMU L;  5FJ8 G;  1YNN C;  2CHB D;  3QOJ A;  4CKE A;  4JI6 L;  4PZ8 A;  3TN2 A;  2KJX A;  1Y1V B;  3E5S A;  2K04 A;  1JOQ A;  2VW9 A;  5E4W C;  3VYU A;  5H1S E;  3KJO A;  3X3N A;  4DNI A;  2RQX A;  3J81 i;  4A3J B;  1BUV T;  2WAC A;  3DWQ A;  1NBW A;  2RF4 A;  1JIC A;  5ELB A;  5IP9 G;  4JYA L;  3GTQ B;  4A3I H;  1B44 D;  3AB9 A;  2Q8R E;  3RNU A;  1KLU D;  1PH8 A;  3OHX C;  2KBN A;  1Z7T A;  2J0T D;  2PW7 A;  1I4Q A;  1V1P A;  3PIO 3;  5DM7 3;  3EBE A;  4BXX G;  5CV8 A;  4K2K A;  4DK0 A;  3MFY A;  3VYR A;  2AMC B;  2UXD Q;  1X65 A;  5BN4 A;  4DN4 M;  2WFW A;  3S15 B;  2IY5 B;  4IOC A;  3PIO A;  2Q2H A;  5IGC A;  2KHJ A;  3HOU G;  1PZJ D;  1HR0 W;  3GTK H;  3HOV B;  1D5X C;  2K28 A;  2E2J B;  3I70 A;  2RSO A;  5C0X I;  4HIK A;  5CBA E;  3JAM E;  3S2D H;  1Q81 C;  4O0A A;  4JBJ A;  1NY4 A;  5M3M G;  4A3C H;  3ZJY C;  1XNR Q;  5E4X A;  1PH6 A;  2B63 G;  5IGB A;  4CDE C;  4Q5V A;  4A3M B;  4A3G H;  4FF2 A;  2LXJ A;  1GUS A;  4L5R C;  1VQ4 A;  4CDD C;  4I7Z C;  2Q8T A;  4GN4 B;  4NDX A;  1QVF A;  5HY6 A;  1BCP C;  1YVC A;  3AYH B;  5J3B A;  1ROD A;  3KOJ A;  3WOE A;  1EZ6 A;  1XPU A;  3MEF A;  1QG7 A;  1GOZ A;  3GD7 A;  2F0I A;  2K5D A;  3CQZ B;  3I90 A;  1PYB A;  3D0F A;  2DY8 A;  1KC8 C;  5C3X A;  1WYD A;  1FGB D;  2IL8 A;  4FXD A;  5M5Y B;  1S5B D;  3GTM H;  4GLX A;  1QZG A;  1BR9 A;  1HCZ A;  1U4P A;  2CKZ B;  2F0U A;  1S4Z A;  2NVQ H;  2ICI A;  2CQO A;  4LF4 Q;  4A3D G;  1K83 B;  3EVQ A;  1BBW A;  3DWP A;  1V1O A;  2AUK A;  3E6Z X;  2A5H A;  3LWE A;  4IPG A;  3E0E A;  3NTH A;  4CKB A;  1YJN A;  1S5E D;  2AUJ D;  3HKS A;  2DJF C;  1A2T A;  4LF4 L;  2WAQ E;  3I8Z A;  1SE3 A;  4I65 A;  1STY A;  1Q90 A;  2QF7 A;  4JI3 Q;  3EQL C;  1DOK A;  3PO3 H;  2NVT B;  3SEB A;  2K5V A;  3TP8 A;  3J81 L;  1CKN A;  3DM1 A;  2L1B A;  4NP5 A;  2EY2 A;  1O7Y A;  3KF6 A;  3PCO B;  4JI3 L;  3CME A;  1PTO C;  1PHJ A;  2JA9 A;  1HH2 P;  4ID6 A;  3F2C A;  2F1M A;  4JI1 Q;  3EJI A;  4GLA C;  1NR4 A;  4A75 A;  5I6W A;  1M8A A;  1CTM A;  2F0G A;  1CQV A;  4KMU C;  3R8B A;  3JAM i;  2V1C C;  1FNV A;  4JI5 Q;  3AFP A;  2A6H D;  2F4V Q;  1SR3 A;  2F3V A;  1Y8O B;  2QA4 A;  3H0G G;  1I5F A;  3V2T A;  4JI1 L;  4JI4 Q;  4BBR B;  1WTV A;  1E2W A;  2D0O A;  1ZYR C;  4JI5 L;  3I4O A;  4CDC C;  1YHQ A;  4IFD G;  1SNC A;  2F4V L;  4DR7 Q;  5C0X H;  1PYW D;  3I55 A;  2PZU A;  1MSH A;  3T4A C;  2B29 A;  3BDL A;  3EIV A;  1IHZ A;  4JI4 L;  5JOB A;  4BBS B;  3NP8 A;  1QB5 D;  3QB3 A;  1YJ9 A;  2QGQ A;  2R93 H;  2PMZ E;  2A6E D;  2PI2 A;  4DR7 L;  4GN3 B;  4OGQ C;  5COY A;  2NZ1 D;  2GN5 A;  1CSQ A;  5M5W H;  1Q86 C;  4XQN A;  2N55 A;  4OX9 Q;  1NTG A;  2N49 A;  4GOP B;  3T16 A;  2ZJQ A;  5IYC H;  1KNA A;  2JK8 A;  4K8J A;  3TS0 A;  5JJI A;  3S17 B;  2BE5 D;  1P8L A;  4PV1 C;  4A3E H;  4OX9 L;  1EY5 A;  1I4P A;  5KYI A;  2A69 C;  4X6A H;  3S16 B;  1M90 C;  4Y52 H;  2D9U A;  2MUY A;  2F0P A;  1K8A C;  2R92 B;  4KLK A;  2K5Q A;  5LL6 X;  3S1N B;  4OL7 A;  4X64 Q;  4TQU S;  3HOZ B;  3GTL B;  4RWS C;  2Y0S G;  2K33 A;  4UPA A;  2VNU D;  3Q0A A;  3FHW A;  1WOC A;  4DKA C;  4XYO A;  1U9R A;  4Y7N B;  4GNX B;  1YI2 A;  4C2M H;  4X64 L;  2EE1 A;  5IYD G;  4L5T A;  1PRT B;  1XX8 A;  4LF5 Q;  5IIF A;  3RLF A;  4YY3 L;  4RCO A;  4L6T B;  1GUT A;  4O42 A;  5FLM H;  3S1M B;  5GRO A;  1IW7 C;  2KQ3 A;  3K5O A;  1MSG A;  3E9H A;  1LTI D;  4C3I H;  4HTH A;  4KKS A;  3R3O A;  3HOY H;  4OWW B;  1F9S A;  5C44 B;  1N9W A;  3MA2 B;  4ZUI A;  3OSO A;  2B2W C;  2B2T C;  3MZ5 A;  4N8F A;  4A3F B;  5HGT A;  2AQ2 B;  1Q8K A;  1K8M A;  3OMC A;  5IY0 A;  1BVS A;  2PQA B;  4K2L A;  5IYB H;  4X66 Q;  4P2C B;  1EYD A;  4K6D A;  2BH2 A;  3Q6S A;  4X62 Q;  3A8I E;  1PH2 A;  2E5L Q;  3KYH C;  3A5Z B;  4IUU A;  1DCZ A;  1BBX C;  4TKO B;  5IGF A;  4JOI A;  2K75 A;  2OCE A;  4BS9 A;  1WTR A;  4X62 L;  4GKK Q;  4KI0 A;  2B39 A;  2WAQ B;  2E5L L;  1H9S A;  1PH5 A;  4KHV A;  5I9P A;  1TWH B;  2RDF A;  1BO0 A;  2IPK D;  3TRZ A;  4WJ3 M;  3OW7 A;  2OWO A;  1IBK Q;  2K4K A;  2CW0 D;  2F3I A;  3BZD B;  1PRT D;  4BA1 I;  4GKK L;  3F8T A;  1Y1W H;  1PVO A;  1FJG L;  1B2T A;  1KAW A;  3PMF A;  2KOL A;  4QJF A;  1XPR A;  1D8L A;  1PFB A;  2IW3 A;  1ILP A;  3T1H Q;  2P5Z X;  4HED A;  3MVV A;  1GM5 A;  2E76 C;  2JA6 B;  3CCQ A;  2JA5 G;  1LAC A;  1YNJ D;  4JBM A;  2D62 A;  4FXG C;  2JN4 A;  1SFO B;  2X6L A;  3BDO A;  2KCT A;  4R9W A;  3T1H L;  4HCE A;  1DD2 A;  4UP8 A;  2NB0 A;  4FDB A;  1VQJ A;  1JE5 A;  1XXG A;  5D14 A;  4HMJ A;  2VY3 A;  4K5X A;  3S14 B;  1PZI D;  5M3F H;  4NXM Q;  1HUM A;  3PUV A;  2LS0 1;  3SK8 A;  1H95 A;  5IOD A;  1NNX A;  1W6J A;  3FVQ A;  3CCU A;  4DK6 C;  2PMZ B;  1YIJ A;  3FKI H;  4NXM L;  4ZUJ A;  4RKL A;  1VQ8 A;  1D6E C;  2JA8 H;  1JJC B;  5DEH A;  3HOU H;  4QF4 A;  1PMR A;  3J7A F;  4HR7 B;  3RUZ A;  2MGS A;  1STE A;  3KBG A;  2WB1 G;  1RIP A;  3JC6 6;  2B63 H;  4RGM A;  3K7U C;  2YTV A;  4P75 A;  1TWA B;  1HJP A;  4RKB A;  3FMC A;  5ELO A;  3M3Y H;  2K1B A;  1VMP A;  4G7H C;  3NBI A;  1TWC H;  4HID A;  2KEE A;  4K0K Q;  3D31 A;  2Y0S E;  3J80 c;  1TS2 A;  1V1P B;  2HQE A;  1AW7 A;  5A2Q L;  2WKC A;  4JK1 C;  1X56 A;  2M2L A;  1D1K A;  3NBH A;  4DUZ Q;  4DV0 Q;  4K0K L;  1BXT A;  3S1R B;  2HT1 A;  2F0V A;  4J15 A;  1O7L A;  1SDF A;  2VB2 X;  5C4H A;  3HOX H;  5C3E G;  5FLX E;  1V1Q A;  1WJJ A;  1KRT A;  3VA5 A;  3D6C A;  1SYD A;  1J5E Q;  5M3M B;  2E2H B;  4DUZ L;  1G51 A;  4DV0 L;  2NTS A;  1EYC A;  2RKS A;  3NPP A;  2MO0 A;  3STB D;  3OMG A;  4BBS G;  4G7Z C;  2HCI A;  4LMQ D;  3K7A H;  3QG1 A;  3C2P A;  3T13 A;  1J5E L;  4DF7 A;  1OXS C;  1H9R A;  1EQR A;  1VQG A;  3I72 A;  3OOC A;  3K6O A;  4KV6 A;  4YWL A;  4DV3 Q;  4OON A;  4A3B G;  2OTJ A;  4EQO A;  1SN8 A;  4DAY A;  3GTO H;  2OTL A;  2AQ1 B;  2XWJ B;  4KKT A;  5T1G A;  4B9W A;  5FO8 B;  4DV3 L;  1S40 A;  1SMY D;  5ELF A;  1TII D;  3AU7 A;  5DAU A;  4IPC A;  2LFN A;  3HZX A;  1VQ6 A;  4IJL A;  1CKO A;  1EY6 A;  5K36 G;  1B9N A;  1JB3 A;  3CCE A;  4OHJ A;  4C3J B;  3HOZ G;  3CCJ A;  1YNN D;  3MTS A;  1AP0 A;  3BVZ A;  2EYF A;  4WJ4 A;  1BCP B;  5M5X H;  3RZD H;  2R7Z B;  5E3F A;  2EY1 A;  3K80 C;  2EJF C;  1IBM Q;  1VQM A;  1NAP A;  4QIW B;  5A35 A;  4DU9 A;  1KAA A;  1I4R A;  3I4N H;  4XTC S;  4GLV B;  1XYI A;  1IBM L;  1QIL A;  1T5X D;  2RHQ B;  3K81 C;  1V43 A;  3BYT B;  1CKN B;  1D2B A;  1Y69 U;  1R4P B;  3KF6 B;  4IFD J;  2V4D A;  1U4R A;  4R4T A;  1R9T H;  3M7N A;  5C44 G;  3BYY B;  4JC0 A;  3H0G B;  3L7Z C;  4RA8 A;  5J39 A;  4NW2 A;  3TZD A;  2I5L X;  1JQY D;  3S9W A;  2JA7 G;  4MIU A;  4ILW A;  2L55 A;  4H02 A;  3GQB A;  5GAE C;  4DFA A;  3SDZ A;  2ENB A;  4OO1 I;  2F52 A;  2EYH A;  5JPM C;  1MBY A;  1VQA A;  4AYB B;  4HJ9 A;  4QMG A;  4QUC A;  1PTO B;  3U50 C;  1STB A;  4E6I A;  1B4O A;  1LT4 D;  1M4V A;  1C8C A;  4BA2 I;  3PV0 A;  2MJ8 A;  1EFW A;  1I94 Q;  4CKC A;  2R7F A;  2AHO B;  2FJ2 A;  4IUT A;  5EBD A;  3ER0 A;  3JAM c;  2BA1 A;  1BCP D;  3GTJ B;  2TSS A;  3U4V A;  2IT1 A;  4FP5 D;  1QZH A;  1I94 L;  1EEI D;  4UP7 A;  1D1I A;  3D4R A;  1Z9F A;  4OIK A;  3ZYY X;  3DHQ A;  1XTC D;  1X3Q A;  4IUN A;  1RD9 D;  1TS5 A;  1Y1V H;  2EYL A;  1X54 A;  3A0J A;  1EQQ A;  4ALP A;  5IWA Q;  1TU2 B;  2Y0S B;  2D0P A;  5IOC A;  5DNF A;  1X3E A;  3TME A;  1VQO A;  2KVM A;  5G3L F;  1HXY D;  4NPS A;  4BY1 B;  4JPB W;  4XDX A;  3NXW A;  4A3J H;  1EYA A;  1GD7 A;  1H9J A;  5IWA L;  1HA6 A;  3GTQ H;  1Q7Y C;  5TSS A;  1LT3 D;  2E2I B;  1CK1 A;  2I5M X;  2C5C A;  1TWG B;  1ONL A;  4HJ8 A;  1PXU A;  1LTS D;  4IPH A;  1Q12 A;  2RCN A;  2UXC Q;  1SND A;  3TP7 A;  1KQS A;  4LF8 Q;  2EYO A;  3HOW B;  1PTO D;  3S15 H;  2VZA A;  1HFN A;  2G5D A;  2UXC L;  1VQD A;  3HOV H;  2NN6 G;  3HP3 A;  2E2J H;  3F2U A;  1X3P A;  4FF1 A;  4RFB A;  1EFI D;  5JJK A;  4FF3 A;  1XWE A;  2Z4H A;  4MN3 A;  1A8V A;  4A3K G;  1K73 C;  2EIF A;  4YHH Q;  1IBL Q;  2L11 A;  4J6H A;  1SYF A;  1YEZ A;  2BA0 A;  2XSC A;  2PPB C;  1ZYR D;  4A3M H;  1PH3 A;  1JOR A;  1N32 Q;  3VR5 A;  3CPF A;  4DAV A;  2RSN A;  4OO1 H;  1YZ6 A;  2A74 C;  4KN4 C;  3CPW A;  3M85 A;  1IBL L;  2NVY B;  4IAL A;  1GUO A;  2OF1 A;  1QOH A;  2Z1C A;  1N32 L;  3PO2 B;  3HG9 A;  4HAE A;  3CQZ H;  2RCF A;  2LY7 A;  1PRT F;  4ZKB B;  3ERQ A;  1MKH A;  5M5Y H;  3HFZ B;  3CC7 A;  4C3H B;  3NWS A;  1H9S B;  3CRL C;  2E2D C;  4QCL A;  5DM6 3;  2L0C A;  2UXD L;  2A1A A;  4LWC A;  3GTG B;  5EKI A;  1K83 H;  3RMH A;  2NWG A;  5C5L A;  4B3T Q;  1TS3 A;  5C4X H;  3GTP B;  4CBV A;  3ULJ A;  5CBE E;  2B2V C;  5CV7 A;  4GZY C;  2DNE A;  2JA5 B;  1I50 B;  3QWN A;  1SNP A;  4OEL B;  4XT3 B;  1VQ9 A;  4B3T L;  1XNR L;  4Z9C B;  4KHZ A;  5IGD A;  2L5T A;  2JSO A;  3F2D A;  1VQE A;  1K0R A;  2NVT H;  4NMZ A;  1I6H B;  4DAM A;  3K0X A;  1WTH A;  2VXW A;  2NYZ D;  1HHV A;  1IYU A;  1FYC A;  2A68 C;  2ZXR A;  1JCK B;  2NZO A;  3KBX A;  1LTB D;  4BY7 G;  3D6W A;  4JCV E;  2B2V A;  4WFN 3;  1X9N A;  1RF2 D;  1J6Q A;  1VQC A;  1W6K A;  4KY5 A;  4BBR H;  5ELD A;  2GA4 B;  1LLR D;  1ML0 D;  2DJG C;  4C3J G;  3J80 L;  3CC4 A;  4ZAI A;  3MXN A;  3PF4 A;  5CYU A;  4QUF A;  1HNW Q;  5FKA C;  4EQN A;  1ENC A;  2WB1 B;  4ABN A;  2R7Z G;  4DV5 Q;  1YHB A;  4BBS H;  5EKL A;  1AE2 A;  1EY4 A;  3U58 A;  1B9M A;  1DOM A;  3OTO Q;  1EWI A;  2K5N A;  3A8K E;  1AE3 A;  3I91 A;  4DV5 L;  4G7O C;  3TBI B;  2KCN A;  1NMG A;  3G6J B;  4LF9 Q;  4MZ9 A;  3VR6 A;  3DXJ C;  3A8J E;  4POF A;  3KLR A;  1YNX A;  3OTO L;  2PQE A;  1EIF A;  1F2Z A;  3KLS X;  3G7L A;  3CKI B;  5IP7 G;  2AQ3 B;  4YWM A;  4LF9 L;  4QQB X;  4TRD A;  3S17 H;  4FYD A;  3NBH B;  1EZ8 A;  2RBM A;  5C3E B;  3S16 H;  2F0L A;  2R92 H;  4MHE A;  3H15 A;  3S1N H;  1I4X A;  5EPL A;  4HIM A;  1A3U A;  4KKU A;  4DAP A;  1QUQ A;  1K3R A;  3HOZ H;  3K5N A;  3GTL H;  2H5X A;  4AYB G;  4NKL A;  5E7N A;  4IZ8 A;  4FO2 A;  2DY7 A;  1L0W A;  2CWA A;  3M7G A;  1F2M A;  3M4Y A;  4Y7N H;  2HIV A;  2YV5 A;  3NTI A;  2DGY A;  2RDH A;  2BDN A;  3SR1 A;  1RJT A;  2J7Z A;  4A3B B;  5AFW A;  3MXU A;  1TR5 A;  4PG3 A;  1WTO A;  3H91 A;  4DR6 Q;  4CGY B;  3S1M H;  4DV1 Q;  1GKH A;  1WI5 A;  2XVS A;  4DAY B;  1CHP D;  2HQL A;  1MGS A;  3ERO A;  4DNR B;  1QWY A;  2M9V A;  2XGT A;  4DR6 L;  5C44 H;  1B7Y B;  4X3U A;  3RLN A;  4DV1 L;  4KK7 A;  1PLF A;  1ESR A;  3GP7 A;  1B3Q A;  4A3F H;  1KHI A;  5GAH C;  3S2H B;  4BY1 G;  1QE6 A;  2SOB A;  1UE7 A;  3NEM A;  1PZK D;  2VQF Q;  1SNO A;  5COR A;  1KDA A;  1U5K A;  4RH6 A;  4LFB Q;  3FPP A;  1S5D D;  1ICW A;  4ZQ3 A;  4LFC Q;  1PFM A;  2X6G A;  5K5P A;  2SNS A;  3OW2 A;  4MTK A;  3CCS A;  1DXM A;  5D3I B;  3OIP A;  4DUY Q;  1G29 1;  1STA A;  1VQI A;  1X6O A;  2K05 A;  3KLS A;  3QOL A;  2B2Y C;  4LFB L;  2K52 A;  3L2P A;  4LF5 L;  2GVA A;  3RZO B;  1K0S A;  4LFC L;  3W2D A;  3LNN A;  1CSP A;  1SYB A;  3UDX A;  3HGB A;  2ZM6 Q;  3L0O A;  3HOW G;  4DUY L;  1FNW A;  2Z0S A;  2ZJR A;  4IN3 A;  1BDO A;  1TWH H;  1T9H A;  4C56 C;  3RLO A;  4DR2 Q;  1TY0 A;  5KGU A;  3WWV A;  1G8Z D;  5D3D A;  3JAM L;  4R8N A;  5HUR A;  2JA7 B;  3EFX D;  2UUA Q;  3E9I A;  2FXQ A;  4DR2 L;  3WDN A;  2Q2I A;  1EIH A;  2B2Y A;  1KTK A;  1NJI C;  2JA6 H;  1BBU A;  4F88 A;  1ENA A;  1CHQ D;  2A73 B;  4ZRZ A;  1SFO H;  4A3L H;  4X66 L;  3IFT A;  5C4J B;  2UUA L;  2HDM A;  2K01 A;  1U0L A;  3AEV A;  2B2W A;  5IT9 c;  3SGI A;  2B2T A;  5FLX c;  3PO2 G;  1E2Z A;  2F0Q A;  1BNZ A;  3S14 H;  3IKJ A;  2JXM B;  1E3P A;  5CV4 A;  2NZH A;  1WCM G;  2F0E A;  1O7I A;  2EJM A;  4QIW E;  2JP1 A;  2KHI A;  4C3H G;  1AN8 A;  2ZTC A;  1PV4 A;  2JJQ A;  4M8A A;  1N33 Q;  1CUK A;  5FJ8 H;  2ES2 A;  1DON A;  1IBK L;  3AQQ A;  5I9O A;  3GV3 A;  2AKW B;  1AZP A;  2NN6 H;  1TS4 A;  2WP8 J;  3PQI A;  4LUV A;  2E74 C;  5FO9 B;  3A55 A;  1VQK A;  1NUC A;  3BS1 A;  5IP9 H;  4ULL A;  2JYO A;  5JEA G;  1OXU A;  2EVB A;  3T56 B;  3H94 A;  4LJZ C;  1TWA H;  4XQQ A;  3WOF A;  2EQS A;  1F9R A;  4HJ7 A;  4BWG B;  2A6E C;  4LUZ A;  3VYS A;  4A3I G;  4S3S A;  1F9Q A;  1L2F A;  1BQQ T;  4CHT B;  4BXX H;  4AYB E;  4OWT B;  4F87 A;  1B1Z A;  3OWE B;  1MIU A;  4UAI A;  2F4I A;  2BE5 C;  3S1R H;  1WTP A;  1SMX A;  2PI2 E;  4IFD I;  1PH9 A;  1STN A;  1SAP A;  3TP6 A;  5I2X A;  1E2V A;  2UXB Q;  1JT8 A;  3J81 j;  4RHS A;  2SDF A;  2J4X A;  4DK1 A;  1LT6 D;  5M3M H;  4A3K B;  5KEE A;  1PA6 A;  2E2H H;  2KEC A;  1FD7 D;  3DUZ A;  4R8I A;  3RN2 A;  1KDB A;  1TWF B;  3MFG A;  3I4M B;  2KUM A;  4DR5 Q;  3DWA A;  2UXB L;  3N6R A;  1VF5 C;  1KL9 A;  4RGT A;  1UE1 A;  4LNQ A;  3A56 A;  1A3V A;  4B3R Q;  1XJV A;  2OQ0 A;  2CFM A;  4JBK A;  4JG2 A;  1EY7 A;  1TT2 A;  4X3K A;  4DR5 L;  5JAV A;  5IGG A;  4ODG A;  4IUV A;  2LMC B;  4UDU C;  3OYY A;  1LAB A;  3MXP A;  3CU7 A;  5IT9 E;  2WIN B;  1OO9 B;  4PZ7 A;  2MHV A;  2PZT A;  1GJX A;  4IUR A;  4A3D H;  3J7Z C;  5LHY 1;  5CMD A;  4DXF A;  1E22 A;  2Z6K C;  3VDY A;  1K8O A;  4G4K A;  1IYJ B;  4C3J H;  1W3S A;  3A7L A;  4HSP A;  2CVR A;  3DLL A;  1UE6 A;  2EDG A;  3HKZ B;  3RD4 A;  1SNM A;  1CQF A;  3DEO A;  1HRJ A;  2R7Z H;  2K5W A;  4GN5 A;  3IL8 A;  1FNU A;  3SVM A;  3B6Y A;  3F1Z A;  4DGZ A;  4EQ5 A;  3MC0 B;  1YIT A;  1LO5 D;  1VQH A;  1I3Q B;  2NVX B;  1D5M C;  1YBY A;  5LMN Q;  1E7Z A;  4FF4 A;  2KEN A;  2VL6 A;  2VUM B;  2XRS D;  2QDL A;  1NMF A;  5BR8 Q;  5EJW A;  3K59 A;  1I4H A;  1L1O C;  2Q2T A;  3PO3 G;  4BY7 B;  3GV6 A;  4JI2 Q;  5LMN L;  1CA6 A;  3H09 A;  4HN7 A;  4GNX C;  3TRE A;  1ENF A;  1L0X B;  3H0G H;  2CW0 C;  2YTY A;  4APV A;  3G6E A;  3NQT A;  1D7Q A;  1PRT C;  4P71 A;  5EBC A;  4JI2 L;  3CW2 C;  4K5V A;  1GUW A;  2EOT A;  2WV6 D;  4YCU A;  4WJW A;  4IFD H;  2Q2U A;  1JB7 A;  3KDF A;  3MXN B;  5BN5 A;  5GQO A;  1PH7 A;  2N8N A;  1G6Z A;  3K8A A;  4CDF C;  1L1O A;  2F0K A;  1NR2 A;  1HA5 A;  3A74 A;  3KUP A;  2EYM A;  1HZC A;  1X32 A;  5JVG 3;  3IRB A;  1PTO H;  2F3W A;  2EJG C;  1VCI A;  2Z9H A;  2OEO A;  3C1F A;  5L37 A;  3ERS X;  1CFM A;  2IX0 A;  5IGE A;  4A93 B;  1VMC A;  2EYP A;  5T1I A;  4F8M A;  1VQ7 A;  2DNC A;  2JEA I;  1SEB D;  2MQH A;  1E0B A;  3L3O C;  3QIA A;  4WOR A;  1R4Q B;  1HTP A;  1S5F D;  4P74 A;  2CH4 A;  3ICE A;  3MWY W;  1EOT A;  1SXT A;  3CP0 A;  1ZXT A;  2RA4 A;  1S5C D;  1HR0 Q;  1L0Y B;  1WD0 A;  1QUQ B;  2Z6B A;  4BY1 H;  1JE4 A;  1CKM A;  1NE3 A;  1RCV D;  2IWH A;  4QL5 A;  2AWO A;  4CJ2 C;  4B3M Q;  4R4O A;  3J7A V;  5IYD H;  5CR3 A;  1UEA B;  3NEN A;  1SYG A;  2CQA A;  1HR0 L;  2E2I H;  3RR5 A;  4XYQ A;  2B2U C;  4DR4 Q;  3U9S A;  1SRU A;  2XN9 C;  3SK5 A;  1TWG H;  1DZ1 A;  2RDG A;  2WB1 E;  3U9O A;  4B3M L;  3A5U A;  2WII B;  4FVM A;  3CCM A;  5KIX A;  4RGN A;  3MAQ A;  3I56 A;  3NHH A;  3J81 E;  2ATW A;  1RKN A;  2H1E A;  2MP1 A;  5FLM G;  1JJG A;  4DR4 L;  2A68 D;  3FPU B;  3M4Q A;  3HOW H;  4CJ0 B;  2FIN B;  1HTL D;  4C3I G;  4IUP A;  1ET6 A;  4KY7 A;  3PIP 3;  1EU3 A;  2BCO A;  4K5W A;  1EWH A;  2NUC A;  5EPJ A;  2K03 A;  2UUC Q;  1N34 Q;  3PIP A;  3CHB D;  1STG A;  1PFN A;  3STB C;  3IAY A;  3LWU A;  3U4Z A;  3S24 A;  4A76 A;  3S1Q B;  4DPG A;  4H44 C;  4KHP Q;  1Y8P B;  1DYQ A;  4FXK C;  4JVZ A;  1YJW A;  4RCN A;  1SYC A;  2NVY H;  2DUD A;  3MHB A;  2B3G A;  1G2T A;  1EY0 A;  1UWV A;  4LW1 A;  3OPO A;  4UP9 A;  3V96 A;  4PMW A;  4KHP L;  3PO2 H;  3FDT A;  1C7Y A;  1WFQ A;  1X55 A;  3LX0 A;  4F7X A;  1G6P A;  1K28 A;  3I2Z A;  2QKI C;  5F2D A;  4C3H H;  4LF8 L;  1S72 A;  2EY6 A;  1SMY C;  3URY A;  5FLX L;  2O5J C;  1SBB B;  4ME5 A;  2YU9 B;  3GTG H;  1DJR D;  2XTI A;  5M9O A;  3D8G A;  4R4Q A;  3GTP H;  5CV6 A;  5CV5 A;  1Y1W G;  3I4M G;  1MHW C;  1QCB D;  4OEM B;  2JA5 H;  3BG3 A;  1I50 H;  2HHH Q;  2G9H D;  1F2Y A;  4JYA Q;  2M00 A;  4YHH L;  2XWB B;  1E1O A;  2CWP A;  1A15 A;  4KTA A;  1EWC A;  2VB3 X;  5C3W A;  3HEJ A;  5JEA H;  4RGO S;  3PF5 A;  4XQJ A;  3C46 A;  3KF8 A;  3UDI A;  2HHH L;  1I6H H;  5KRU A;  1LTG D;  1UUP A;  3ULP A;  2BDO A;  4ME3 A;  1MD2 D;  1Q8I A;  1WCM B;  3MXG A;  1I6V C;  2F0O A;  3H6M A;  4POG A;  5M3F G;  2QW7 A;  1AEX A;  4LK1 C;  2C35 B;  5EAY A;  3M4O B;  2K5H A;  1HZ9 A;  5GAG C;  3Q22 A;  5JEA J;  5E1F A;  2OXP A;  3CC2 A;  2A69 D;  1X3F A;  5FO7 B;  3K5M A;  1A63 A;  2I46 A;  1V9P A;  3FKI G;  1Y8N B;  4P73 A;  4DV4 Q;  3UDG A;  2DN8 A;  2I5H A;  3HKZ G;  3CF5 A;  2JA8 G;  5KYL A;  2F0D A;  1EIG A;  3N52 A;  2Z4I A;  3NUC A;  4J1M A;  1UNS A;  4Q0F A;  4UHV A;  2H4O A;  1O7Z A;  4DV4 L;  3UE1 A;  3ONA B;  2KA7 A;  1XTD A;  4A3I B;  1CM9 A;  2VUM G;  2PCF B;  3OIQ A;  2SEB D;  3M4P A;  1WTW A;  1UAP A;  1ET9 A;  4EX5 A;  1PDQ A;  3UDF A;  4UY8 C;  1IW7 D;  5AJ3 Q;  1PFS A;  2N88 A;  4YCW A;  4U67 3;  5JJZ A;  1EQV A;  3J7A 5;  4KJO A;  1IL2 A;  5C3E H;  4YWK A;  3R2T A;  2MNA A;  1YHA A;  2F0N A;  2C9O A;  5AJ3 L;  4DV7 Q;  4L5S A;  2ZTE A;  4LFA Q;  3GTK B;  4P72 A;  5CGK A;  4O1N A;  1EQT A;  3D4W A;  2IX3 A;  2F0W A;  1A2U A;  1VQL A;  3HOX G;  4NXN Q;  1Q1E A;  3S2D B;  3BVM A;  4JI8 Q;  1TKW B;  5C4X B;  2LKV A;  2HDL A;  1HNW L;  2FFK B;  4DV7 L;  4LFA L;  5EQ0 A;  4DNT B;  5KND A;  2HIX A;  1HPC A;  4A3G B;  4NXN L;  4IO9 A;  2ALY B;  2YYZ A;  4JI8 L;  3M9B A;  1XPO A;  2FHT A;  1VQB A;  4L8J A;  4A3B H;  2K32 A;  4HSV A;  1H9K A;  3K0Y A;  1SYE A;  2EXZ A;  2SNM A;  2G9D A;  3J7Y W;  2IX1 A;  2EPB A;  4A93 G;  4PZ6 A;  4DV2 Q;  1FVI A;  2RVL A;  1F77 A;  1WTQ A;  4JV5 Q;  1K3B C;  1W2B A;  1E1T A;  1G2S A;  3PUX A;  3GTM B;  4DV2 L;  3T53 B;  3I7F A;  4EGV A;  5I2Y A;  5JJL A;  5K36 H;  4HMI A;  1IL8 A;  2NVQ B;  3W1B A;  3NK9 A;  4EVO A;  1FL0 A;  4JV5 L;  5I4D A;  4IOA A;  1C9O A;  3K5L A;  1A6X A;  1EL0 A;  4QGU A;  1I4G A;  3S2H H;  4GS3 A;  3PUW A;  5LL6 S;  1TVX A;  1FR3 A;  5CC4 A;  4N9P A;  5JPN C;  2TMP A;  1II3 A;  3Q24 A;  4H13 C;  5EKK A;  4V19 0;  4R4C A;  2O2L D;  1QVC A;  2F0J A;  5EGT A;  5EPK A;  4HJA A;  3PO3 B;  3FRP B;  3I4N G;  5JVH 3;  3R2I A;  3V05 A;  3RZO H;  1EYG A;  1LT5 D;  5J22 A;  3SE0 A;  1S3O A;  1C0A A;  2NN6 I;  1RL2 A;  3TDQ A;  2F0T A;  3FEW X;  3KLW A;  5IE8 A;  5A2Q E;  3TEH B;  1G91 A;  1JOK A;  5C0X J;  1BKB A;  1U4L A;  4JBW A;  1KDC A;  4CJ1 B;  3AMU A;  2JA7 H;  1SSO A;  3CAM A;  1A62 A;  4KJN A;  2HUG A;  2JEB I;  2EXD A;  2QDB A;  3SK6 A;  1N36 Q;  2EYJ A;  3D4D A;  1Q1B A;  5C5M A;  4JW0 A;  1M1K C;  5NUC A;  2Q8I B;  1A0I A;  1XMO Q;  3KDF B;  2GVB A;  1SE4 A;  1NSN S;  1F9P A;  2K6A A;  1L1O B;  4B3S Q;  3H3V I;  2VQF L;  4B08 A;  3SK4 A;  5C4J H;  1N36 L;  1IZ6 A;  2IHE A;  1WTX A;  4RAU C;  2R93 B;  2PZW A;  2F0H A;  3QR8 A;  1O80 A;  4YY3 Q;  1XMO L;  5ELE A;  2L15 A;  2PO4 A;  1KXL A;  4RG1 A;  1QNK A;  1SJH D;  3HKZ E;  5G3L D;  3AFQ A;  1KIX A;  4B3S L;  1J9O A;  1LTT D;  1Q3L A;  4HCS A;  5M5W B;  1EIY B;  1HNX Q;  3P7J A;  1ASZ A;  4LF7 Q;  4IQZ A;  2QEX A;  3PGZ A;  1CI3 M;  2ZM6 L;  4A3E B;  3C3L A;  1HNX L;  3O13 A;  3VR2 A;  4LF7 L;  1VS0 A;  3TS2 A;  1HUN A;  2K7V A;  1ESF A;  2ZJP A;  4ZCK A;  4JOI C;  4G57 A;  4H7B A;  2IHF A;  1STH A;  4IUQ A;  4PMC A;  4A4I A;  4ZYS A;  1Y1V G;  2VQE Q;  1B70 B;  2ICE C;  2B8F A;  4DR3 Q;  2MPM A;  4X3T A;  2O4X A;  1BCP F;  4C2M B;  3PSI A;  2PNH A;  3NEL A;  1RTN A;  4A3J G;  2K50 A;  2HD3 A;  2NTT A;  2VQE L;  2F03 A;  1VDZ A;  4B9X A;  4DR3 L;  2QIL A;  1A3T A;  1UE5 A;  4XIG S;  1EU4 A;  1O78 A;  2ID0 A;  1CZG A;  4TSS A;  4PQX A;  2A6H C;  4C3I B;  4HJ5 A;  2D5D A;  3HOY B;  1JWM D;  2YTX A;  3G71 A;  2R61 A;  1FJG Q;  3BZK A;  1DM0 B;  1RDP D;  4AIM A;  1N33 L;  2FMC A;  4A3K H;  2UU9 Q;  4IPD A;  3HOV G;  3HS0 C;  4OIJ A;  4OWX B;  3I4M H;  1TWF H;  1EOV A;  5I6Y A;  1LTL A;  1BF4 A;  1EY8 A;  1JR0 D;  4X65 Q;  4GKJ Q;  2VS1 A;  3GO5 A;  3ITP A;  3BJU A;  3VR3 A;  1OXX K;  1GVP A;  2UU9 L;  1EY9 A;  3TSS A;  4XT1 B;  4A3M G;  1MI2 A;  1GXD C;  3H3V H;  4OO1 G;  1PTO F;  4X65 L;  3CXC A;  4GKJ L;  4X3S A;  2D2C C;  4L63 B;  4O2D A;  4N8X 1;  1C48 A;  2ZXO A;  1SLJ A;  1K9M C;  1IYV A;  4LUO A;  3UI2 A;  1VF7 A;  3C1E A;  2KCC A;  3EN2 A;  1AH9 A;  1KAB A;  3NE5 B;  4PNY A;  4KY6 A;  3HRZ C;  3PUY A;  1FGU A;  3QO2 A;  1HQM C;  3F2B A;  3X3M A;  1QJO A;  3NSW A;  2KHS A;  2MO1 A;  1Y1W B;  2NBF A;  2HCC A;  1XNQ Q;  3BZC A;  3DEP A;  1JC7 A;  3E3X A;  5ELC A;  1QNU A;  4MNO A;  1X3G A;  4A3C G;  1LUZ A;  5C4X G;  3SXH A;  1ZKO A;  2KCM A;  4A3G G;  4U68 A;  1XNQ L;  4N9T A;  1I3Q H;  2NVX H;  2O5I C;  2A8V A;  2E75 C;  3PUZ A;  4ZLT F;  3TZU A;  1LTA D;  1IKL A;  4L5Q A;  1XMQ Q;  3CCL A;  4JI0 Q;  3KF8 B;  2K14 A;  3W3A A;  2CCZ A;  2VUM H;  4B3R L;  4J8Q A;  3T1Y Q;  2XNA C;  3LGJ A;  4BY7 H;  5M3F B;  2ZTD A;  1MJC A;  4V0B A;  2Z8L A;  2ASB A;  2F0M A;  2I07 B;  2R7D A;  1ASY A;  1KNE A;  1LV9 A;  1XMQ L;  4YIJ A;  4JI0 L;  3L9A X;  3Q23 A;  3QJY A;  2LXK A;  3T1Y L;  2L12 A;  2F0F A;  2CH4 W;  2PYK A;  1ICF B;  1IXR A;  3FKI B;  1VQF A;  3P20 A;  4XXE A;  5C4Z A;  4GOP C;  1PH1 A;  2JA8 B;  3HOU B;  1TQO A;  4DXG A;  1WD1 A;  4RHR A;  4BBR G;  3ND8 A;  4ZKC B;  2A19 A;  2UUB Q;  2R3Z A;  1RHP A;  3J81 c;  4QB4 A;  4WRD A;  1WVL A;  2JQO A;  2B63 B;  4RMF A;  2EY5 A;  4OXP A;  1ILQ A;  1OXV A;  4K6L A;  2UUB L;  2QCP X;  3VA7 A;  1JOO A;  2Z6K A;  4R1J A;  1GUG A;  3M3Y B;  1U4M A;  2LSS A;  4I7A A;  1TWC B;  4LAA A;  1QVG A;  4QY7 A;  3TP5 A;  5IP7 H;  1SE8 A;  1KRS A;  1AZQ A;  4GOP A;  4A93 H;  1Q46 A;  1BOS A;  3CRK C;  5BR8 L;  1Q82 C;  1KD1 C;  1HNZ Q;  3Q8D A;  2KED A;  3TQY A;  3DMU A;  4DR1 Q;  4FNF A;  5ISR A;  3KFU A;  3MEH A;  4HIO A;  1E24 A;  1LTR D;  4IJH A;  4AH6 A;  3T51 B;  3FP9 A; 
#chains in the Genus database with same CATH homology
 3GTG H;  1Y1W H;  1HNZ L;  3S16 H;  3W5O A;  1PVO A;  2XTI A;  4DR1 L;  1FJG L;  4AQY Q;  1KAW A;  4R4Q A;  4R4I A;  4TVA B;  1PH4 A;  3GTP H;  2R92 H;  1XPR A;  4QJF A;  1Y1W G;  3H15 A;  3S1N H;  1MJE A;  1JJ2 A;  4HIM A;  1HZB A;  3I4M G;  1D8L A;  4DK3 C;  1QUQ A;  1K3R A;  2R92 G;  1P16 A;  3HOZ H;  3T1H Q;  3GTL H;  2JA5 H;  5C0X G;  1I50 H;  2H5X A;  4AYB G;  1GM5 A;  2HHH Q;  2AWN A;  5E7N A;  3CCQ A;  3UE0 A;  4JYA Q;  4DV6 Q;  4AQY L;  1L0W A;  4GNX A;  2CWA A;  2JA5 G;  4YHH L;  4Y7N H;  4JBM A;  1E1O A;  2CWP A;  2D62 A;  2R93 G;  2HIV A;  2YV5 A;  3PF5 A;  2DGY A;  2KCT A;  1GO3 E;  3T1H L;  3I4M H;  3W1G A;  3UDI A;  4UP8 A;  4FDB A;  2HHH L;  1VQJ A;  1I6H H;  1VQN A;  1UEB A;  4DV6 L;  1JE5 A;  3KJP A;  1K8G A;  3GTJ H;  3ULP A;  1VQ5 A;  4ME3 A;  2VY3 A;  4PG3 A;  5HGQ A;  2VUM H;  4DR6 Q;  5M3F H;  3S1M H;  4DV1 Q;  1TXY A;  4NXM Q;  1GKH A;  1B8A A;  4A93 H;  5IYC G;  1WI5 A;  5ELN A;  4DAY B;  3PUV A;  5M3F G;  3GDE A;  4POG A;  1OTC A;  2N3S A;  1OXT A;  1H95 A;  1LYL A;  2HQL A;  2R6G A;  2C35 B;  5EAY A;  4A3E G;  2K5H A;  3CCU A;  1HZ9 A;  5GAG C;  2XGT A;  4DK6 C;  2I0Q A;  5JEA J;  4DR6 L;  1YIJ A;  1EUJ A;  3FKI H;  3CC2 A;  1DGS A;  1B7Y B;  3RLN A;  5C44 H;  4DV1 L;  4NXM L;  1X3F A;  4DR7 Q;  1N8R C;  1SRO A;  1A63 A;  1V9P A;  1VQ8 A;  3FKI G;  2JA8 H;  2OQK A;  1JJC B;  4P73 A;  3HOU H;  4DV4 Q;  3UDG A;  4A3F H;  2I5H A;  1KHI A;  3CMA A;  3HKZ G;  3CF5 A;  5GAH C;  2JA8 G;  4BY1 G;  3ULL A;  2PQA A;  4A3F G;  3NEM A;  1UE7 A;  2VQF Q;  3S1Q H;  2WB1 G;  3G48 A;  1U5K A;  1RIP A;  3JC6 6;  5DLQ E;  2B63 H;  4LFB Q;  2JE6 I;  4DV4 L;  3CD6 A;  3K7U C;  1VQP A;  3UE1 A;  2YTV A;  4LFC Q;  4P75 A;  1XTD A;  1HJP A;  3OW2 A;  3CCS A;  5ELO A;  4DUY Q;  2VUM G;  3M4P A;  1G29 1;  1VQI A;  1X6O A;  3M3Y H;  1LM0 A;  1TWC H;  4HID A;  4EX5 A;  4LFB L;  2K52 A;  5GAD C;  1PYS B;  4K0K Q;  3L2P A;  4LF5 L;  2GVA A;  3D31 A;  2Y0S E;  4LFC L;  3UDF A;  4UY8 C;  3BU2 A;  1CSP A;  3UDX A;  2ZM6 Q;  3J80 c;  3L0O A;  5AJ3 Q;  3HOW G;  1PFS A;  4DUY L;  2Z0S A;  2ZJR A;  3HOY G;  2E8G A;  1TWH H;  2WAQ G;  1X56 A;  4DUZ Q;  1T9H A;  3G4S A;  4YCW A;  4DV0 Q;  3RLO A;  4DR2 Q;  4K0K L;  3CCR A;  3J7A 5;  1IL2 A;  5C3E H;  2YU9 H;  4YWK A;  2HT1 A;  4J15 A;  2MNA A;  3WWV A;  1YHA A;  5AJ3 L;  3HOX H;  5C3E G;  4DV7 Q;  4L5S A;  2ZTE A;  1V1Q A;  1WJJ A;  4P72 A;  4LFA Q;  1KRT A;  1JMC A;  1J5E Q;  1VQL A;  2BH8 A;  4DUZ L;  1G51 A;  3HOX G;  4DV0 L;  4LF6 Q;  4NXN Q;  1Q1E A;  2RHS B;  2UUA Q;  3E9I A;  2FXQ A;  4NB3 A;  4DR2 L;  4JI8 Q;  2MFI A;  2Q2I A;  2MO0 A;  3STB D;  5IYB G;  1Y14 B;  4BBS G;  1NJI C;  2UUC L;  2JA6 H;  1BBU A;  1N34 L;  1HNW L;  4DV7 L;  3K7A H;  4LFA L;  2JA6 G;  1J5E L;  2HIX A;  5LMN W;  1SFO H;  4X66 L;  4A3L H;  4NXN L;  4LF6 L;  4IO9 A;  2N78 A;  1OXS C;  2ALY B;  2UUA L;  2YYZ A;  1EQR A;  4JI8 L;  1VQG A;  3M9B A;  1XPO A;  4A3L G;  1U0L A;  1VQB A;  3AEV A;  4A3B H;  5IT9 c;  3SGI A;  4YWL A;  5FLX c;  4DV3 Q;  3PO2 G;  4OON A;  2IX1 A;  3S14 H;  1WCM H;  4A3B G;  4PZ6 A;  4DV2 Q;  4A93 G;  2OTJ A;  1SN8 A;  1E3P A;  2NZH A;  4MTN A;  1FVI A;  4JI7 Q;  4YCV A;  2OTL A;  3GTO H;  1WCM G;  5LMU Q;  1O7I A;  4QIW E;  4JV5 Q;  2KHI A;  1W2B A;  4JI6 Q;  3DM3 A;  2ZTC A;  1PV4 A;  1Z47 A;  2JJQ A;  3RN5 A;  3M4O H;  1E1T A;  3PUX A;  4DV3 L;  1N33 Q;  1S40 A;  1CUK A;  5FJ8 H;  3CCV A;  1HZA A;  4DV2 L;  3I7F A;  2ES2 A;  5JJL A;  3J80 i;  4JI7 L;  4IPC A;  1IBK L;  3AQQ A;  5FJ8 G;  5LMU L;  4IJL A;  3W1B A;  1VQ6 A;  1CKO A;  1FL0 A;  4JV5 L;  2AKW B;  4JI6 L;  5K36 G;  4IOA A;  4PZ8 A;  1C9O A;  3CCE A;  3HOZ G;  2WP8 J;  4QGU A;  2VW9 A;  3CCJ A;  3S2H H;  4LUV A;  4GS3 A;  3PUW A;  5H1S E;  3KJO A;  1VQK A;  4WJ4 A;  5M5X H;  3RZD H;  4DNI A;  5IP9 H;  4GKK Q;  3K80 C;  3J81 i;  1IBM Q;  5JEA G;  1VQM A;  1OXU A;  1NBW A;  2RF4 A;  4JYA L;  5IP9 G;  1TWA H;  2EQS A;  4R4C A;  4A3I H;  4HJ7 A;  1QVC A;  4LUZ A;  4HJA A;  3RNU A;  1PH8 A;  3I4N H;  4A3I G;  4XTC S;  2KBN A;  1L2F A;  4GLV B;  3I4N G;  1IBM L;  2RHQ B;  3K81 C;  1V43 A;  3RZO H;  4BXX H;  1CKN B;  1EYG A;  4AYB E;  1C0A A;  1S3O A;  4OWT B;  3KF6 B;  3EBE A;  4IFD J;  4BXX G;  2NN6 I;  1RL2 A;  1MIU A;  2AMC B;  4R4T A;  1R9T H;  2UXD Q;  3M7N A;  1X65 A;  3KLW A;  5IE8 A;  3TEH B;  5C44 G;  4JC0 A;  3S1R H;  5C0X J;  1SMX A;  2PI2 E;  1BKB A;  2WFW A;  3L7Z C;  4JBW A;  1PH9 A;  4IFD I;  4IOC A;  3PIO A;  2Q2H A;  2IY5 B;  2JA7 H;  3CAM A;  2KHJ A;  2UXB Q;  2I5L X;  3J81 j;  1HR0 W;  1A62 A;  3GTK H;  3HOU G;  1JT8 A;  2JEB I;  5M3M H;  2EXD A;  2JA7 G;  2E2H H;  1PA6 A;  5C0X I;  4HIK A;  1N36 Q;  3S2D H;  1Q81 C;  4H02 A;  5GAE C;  4O0A A;  1Q1B A;  1M1K C;  4JBJ A;  1NY4 A;  5M3M G;  3RN2 A;  1A0I A;  1XMO Q;  4A3C H;  2F52 A;  2GVB A;  3KDF B;  3ZJY C;  4DR5 Q;  1XNR Q;  4OO1 I;  1PH6 A;  1VQA A;  2B63 G;  2UXB L;  4HJ9 A;  1KL9 A;  1L1O B;  4B3S Q;  3H3V I;  2VQF L;  4A3G H;  2LXJ A;  1UE1 A;  5C4J H;  1VQ4 A;  1N36 L;  4L5R C;  3U50 C;  4LNQ A;  1IZ6 A;  2IHE A;  4B3R Q;  1XJV A;  2OQ0 A;  2CFM A;  4YY3 Q;  4JBK A;  1XMO L;  4JG2 A;  2L15 A;  4DR5 L;  4GN4 B;  4BA2 I;  3PV0 A;  1QVF A;  4RG1 A;  5HY6 A;  1KXL A;  1YVC A;  3AYH B;  1EFW A;  3HKZ E;  4B3S L;  3AFQ A;  1KIX A;  1I94 Q;  5J3B A;  3KOJ A;  2R7F A;  2AHO B;  1XPU A;  3MEF A;  3JAM c;  1EIY B;  3ER0 A;  1HNX Q;  2BA1 A;  1ASZ A;  3GD7 A;  4LF7 Q;  1PYB A;  3D0F A;  3OYY A;  2QEX A;  1KC8 C;  3PGZ A;  1WYD A;  3U4V A;  2IT1 A;  2ZM6 L;  1QZH A;  3GTM H;  1I94 L;  4PZ7 A;  4GLX A;  4UP7 A;  1QZG A;  4A3D H;  1Z9F A;  2CKZ B;  3J7Z C;  1HNX L;  4LF7 L;  2NVQ H;  1VS0 A;  3TS2 A;  2CQO A;  4LF4 Q;  4A3D G;  1E22 A;  2Z6K C;  3VDY A;  1BBW A;  1IYJ B;  2ZJP A;  1Y1V H;  1X54 A;  3A0J A;  4JOI C;  4C3J H;  4ALP A;  5IWA Q;  1EQQ A;  1W3S A;  2IHF A;  4IPG A;  3E0E A;  2D0P A;  4A4I A;  1YJN A;  1Y1V G;  1X3E A;  1UE6 A;  3DLL A;  1VQO A;  2VQE Q;  1B70 B;  3HKS A;  4DR3 Q;  4NPS A;  2R7Z H;  4LF4 L;  2WAQ E;  4GN5 A;  3B6Y A;  4A3J H;  3F1Z A;  4EQ5 A;  1GD7 A;  1YIT A;  5IWA L;  4JI3 Q;  1Q7Y C;  3PSI A;  3GTQ H;  2PNH A;  1VQH A;  3NEL A;  4A3J G;  1YBY A;  2K50 A;  5LMN Q;  1E7Z A;  2VQE L;  2I5M X;  4DR3 L;  3PO3 H;  2KEN A;  2VL6 A;  2K5V A;  1CKN A;  1NMF A;  5BR8 Q;  1UE5 A;  4XIG S;  4HJ8 A;  1L1O C;  2Q2T A;  4IPH A;  3PO3 G;  3KF6 A;  1Q12 A;  3PCO B;  2RCN A;  4JI3 L;  3CME A;  2UXC Q;  2ID0 A;  2JA9 A;  1HH2 P;  1PHJ A;  1KQS A;  4LF8 Q;  4JI2 Q;  3F2C A;  5LMN L;  4JI1 Q;  4GLA C;  4A75 A;  4HJ5 A;  4GNX C;  3TRE A;  3JAM i;  3G71 A;  2YTX A;  3H0G H;  2V1C C;  4JI5 Q;  1FJG Q;  2YTY A;  2VZA A;  4APV A;  3G6E A;  3AFP A;  3BZK A;  3S15 H;  2F4V Q;  1D7Q A;  1N33 L;  1SR3 A;  4P71 A;  4AIM A;  1VQD A;  2UXC L;  2QA4 A;  3H0G G;  1I5F A;  3HOV H;  4JI2 L;  2NN6 G;  3CW2 C;  4JI1 L;  2E2J H;  4JI4 Q;  4A3K H;  4YCU A;  2UU9 Q;  2D0O A;  4IPD A;  5JJK A;  2Q2U A;  3HOV G;  1JB7 A;  1A8V A;  4OWX B;  3KDF A;  1TWF H;  3MXN B;  1EOV A;  3I4O A;  4JI5 L;  5GQO A;  4A3K G;  1YHQ A;  2EIF A;  2N8N A;  4YHH Q;  1LTL A;  3K8A A;  1K73 C;  1PH7 A;  4X65 Q;  1IBL Q;  2BA0 A;  1YEZ A;  2VS1 A;  3GO5 A;  1L1O A;  4GKJ Q;  3I55 A;  3BJU A;  2B29 A;  3EIV A;  4JI4 L;  4A3M H;  3A74 A;  1PH3 A;  1OXX K;  1GVP A;  1HZC A;  2UU9 L;  1N32 Q;  3IRB A;  3CPF A;  1YJ9 A;  1YZ6 A;  2QGQ A;  2R93 H;  1VCI A;  4A3M G;  2PMZ E;  3CPW A;  2PI2 A;  3M85 A;  1IBL L;  3H3V H;  4DR7 L;  4OO1 G;  4GN3 B;  4X65 L;  3ERS X;  3CXC A;  4GKJ L;  4O2D A;  2GN5 A;  1CSQ A;  5M5W H;  1SLJ A;  1Q86 C;  1N32 L;  1K9M C;  4OX9 Q;  1NTG A;  4LUO A;  2IX0 A;  2N49 A;  3CQZ H;  1VQ7 A;  2JEA I;  4GOP B;  2ZJQ A;  3EN2 A;  5IYC H;  1MKH A;  1AH9 A;  5M5Y H;  3HFZ B;  3CC7 A;  2JK8 A;  3TS0 A;  2MQH A;  5JJI A;  1P8L A;  3PUY A;  1FGU A;  4A3E H;  4OX9 L;  3F2B A;  4P74 A;  2UXD L;  3ICE A;  2A1A A;  4LWC A;  2MO1 A;  4X6A H;  1M90 C;  1K83 H;  4Y52 H;  4B3T Q;  1XNQ Q;  3BZC A;  5C4X H;  1K8A C;  3CP0 A;  4KLK A;  3ULJ A;  4X64 Q;  1HR0 Q;  4MNO A;  1X3G A;  4TQU S;  4A3C G;  1LUZ A;  5C4X G;  1QUQ B;  2Y0S G;  4BY1 H;  4UPA A;  1CKM A;  1NE3 A;  2KCM A;  2VNU D;  4A3G G;  4QL5 A;  3FHW A;  1VQ9 A;  1WOC A;  4DKA C;  4B3T L;  2AWO A;  1XNQ L;  4B3M Q;  4R4O A;  4GNX B;  1YI2 A;  1XNR L;  5IYD H;  4C2M H;  3NEN A;  4X64 L;  4KHZ A;  1HR0 L;  1I3Q H;  2E2I H;  2NVX H;  3RR5 A;  5IYD G;  3F2D A;  1VQE A;  4L5T A;  2A8V A;  3PUZ A;  1K0R A;  2NVT H;  4DR4 Q;  4LF5 Q;  1XMQ Q;  4L5Q A;  3CCL A;  1SRU A;  4DAM A;  3KF8 B;  1TWG H;  2K14 A;  3RLF A;  4YY3 L;  2CCZ A;  2WB1 E;  3K0X A;  4IFD G;  3T1Y Q;  4B3M L;  3A5U A;  3CCM A;  3LGJ A;  5FLM H;  4BY7 H;  2ZTD A;  1MJC A;  5GRO A;  3I56 A;  2ASB A;  2NZO A;  2ATW A;  2R7D A;  3E9H A;  4C3I H;  5FLM G;  1ASY A;  4JCV E;  4BY7 G;  4DR4 L;  3M4Q A;  1X9N A;  1XMQ L;  3HOW H;  1JJG A;  4JI0 L;  2LXK A;  3HOY H;  4OWW B;  3T1Y L;  1J6Q A;  1IXR A;  1VQC A;  1N9W A;  1VQF A;  4BBR H;  4GOP C;  1PH1 A;  3CC4 A;  3PF4 A;  4BBR G;  2UUC Q;  1HNW Q;  1N34 Q;  1Q8K A;  3PIP A;  2A19 A;  5IY0 A;  2UUB Q;  2R7Z G;  3STB C;  4DV5 Q;  1BVS A;  3J81 c;  1YHB A;  2PQA B;  3U4Z A;  3S24 A;  5IYB H;  4X66 Q;  4A76 A;  4BBS H;  1AE2 A;  4DPG A;  2JQO A;  3U58 A;  2BH2 A;  4KHP Q;  4RMF A;  4OXP A;  4X62 Q;  3OTO Q;  1YJW A;  1EWI A;  1OXV A;  2K5N A;  1AE3 A;  2NVY H;  2DUD A;  1PH2 A;  2E5L Q;  4DV5 L;  2B3G A;  3A5Z B;  3KYH C;  2UUB L;  2Z6K A;  4R1J A;  1NMG A;  1UWV A;  4LW1 A;  4LF9 Q;  2LSS A;  4MZ9 A;  4UP9 A;  4JOI A;  4JI0 Q;  4B3R L;  4PMW A;  4KHP L;  3PO2 H;  4POF A;  1QVG A;  2K75 A;  1C7Y A;  2OCE A;  1YNX A;  4QY7 A;  1WFQ A;  1SE8 A;  1KRS A;  1X55 A;  5IP7 H;  4X62 L;  1EIF A;  1Q46 A;  5BR8 L;  3OTO L;  4GOP A;  1Q82 C;  4KI0 A;  1KD1 C;  1HNZ Q;  3Q8D A;  4DR1 Q;  3TQY A;  2E5L L;  1G6P A;  3I2Z A;  5IP7 G;  3KFU A;  4YWM A;  4HIO A;  4LF9 L;  4C3H H;  1PH5 A;  1E24 A;  4LF8 L;  3TRZ A;  3S17 H;  2F4V L;  4QQB X;  4WJ3 M;  1S72 A;  1IBK Q;  2K4K A;  4IJH A;  2OWO A;  4AH6 A;  3NBH B;  3FP9 A;  2F3I A;  4BA1 I;  4GKK L;  3F8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...