1Y8OB

Crystal structure of the pdk3-l2 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
97
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8oB00
3GQBA 2AUJD 1E2ZA 2D62A 1ONLA 2DN8A 4DNRB 1LABA 1H9JA 2BDOA 1OXTA 2AUKA 2Q8IB 2BE5D 5KNCA 4DK1A 3MFYA 3N6RA 1GHKA 3I73A 2JE6I 3M85A 2A6HD 4KN4C 2EJFC 1IYVA 1I6VC 1CFMA 3OW7A 3FPPA 1Q12A 4TKOB 2E74C 1VCIA 1Q90A 3D4RA 1FYCA 1GJXA 3BG3A 2DNEA 4KN7C 4HR7B 4I7ZC 1BDOA 1B9NA 3OOCA 4DNTB 2D5DA 2A68D 3IKJA 2O5IC 3U9SA 3P20A 3VR6A 2PNRC 4XTCS 3ND8A 1E2WA 2YYZA 5K36G 4KKUA 5KNDA 2A6ED 5C0XG 3L7ZC 4KMUC 3CRKC 2DNCA 3VA7A 2R6GA 1B9MA 4G7HC 1O7LA 1H9SA 4G7ZC 3A7LA 5K36H 4IFDG 5C0XH 1OXXK 1T5EA 3OPOA 2EJGC 4OGQC 4OO1G 1GUSA 3H94A 2PPBC 2AWOA 3FMCA 4G7OC 4XIGS 4IFDH 1IW7C 2F1MA 2EJMA 1QJOA 4OO1H 1TU2B 3W3AA 2K33A 3PUVA 2KCCA 3VR4A 5A35A 1K8OA 3A8KE 1CTMA 1VF7A 2JEAI 1DCZA 2NN6I 3HGBA 3I72A 3T51B 4BA1I 4KHZA 4JBWA 5KNBA 4L8JA 3SDZA 2V4DA 1OXSC 3AB9A 2A69C 4H13C 1VDZA 3QJYA 4H0LC 5BN4A 2A68C 2EVBA 2B8FA 1Q1BA 1Z6HA 2IT1A 3MXUA 3VR3A 4DK0A 2L5TA 1YNJC 3PUZA 4JK1C 1EWHA 1K8MA 4KI0A 1IYUA 4PV1C 3RLFA 4LJZC 2B8GA 3QG1A 1VF5C 3BDOA 3LNNA 3ND9A 2BE5C 3T56B 2D2CC 5BN5A 2BA1A 2QF7A 1V43A 2E76C 1ZKOA 3CRLC 2JEBI 2A6HC 1OXUA 3A7AB 3IFTA 3QIAA 3EQLC 1PMRA 1GUNA 1CI3M 1DD2A 2ZT9C 1GUGA 3KLRA 3M4YA 3PUXA 4BA2I 1O78A 4KKSA 3A8IE 1DXMA 2K32A 2K7VA 2LMCB 1E2VA 1IW7D 2JXMB 2PCFB 1Y8PB 1Z7TA 1ZYRC 2E75C 1Q1EA 1HTPA 1V8QA 3M7NA 2CW0C 2KA7A 2NN6G 4TQUS 3T53B 3VR5A 5JEAG 5BN3A 3DXJC 1SMYC 1H9MA 3D31A 2A6EC 3NE5B 1H9KA 1Y8OB 4H44C 4RCNA 3SE0A 1OXVA 3LWUA 4GZYC 2NN6H 5JEAH 1YNNC 3A8JE 3PV0A 2A69D 1H9SB 1HCZA 1A6XA 1LACA 3VR2A 1GUTA 1Y8NB 2EDGA 4LK1C 2O5JC 3GD7A 3PUYA 2BA0A 3TZUA 3PUWA 1GHJA 1TKWB 1FR3A 1Y69U 1HPCA 1HQMC 1GUOA 4IQZA 3I4LA 4KKTA 3WDNA 1H9RA 1G291
chains in the Genus database with same CATH superfamily
1PH7A 4A3JH 5LMNW 1JCKB 4M1UB 3JAME 1NY4A 2JE6I 3R2IA 3M85A 3AMUA 3S1NH 2RVLA 5E1FA 4A3GB 3HZXA 4MZ9A 4C3HG 1RTOA 1FYCA 2EY5A 4R4QA 3F2UA 1HUMA 1C48A 4UY8C 4B3RL 1GD7A 1ZYRD 3P1HA 1EQQA 1STEA 1N9WA 2VQEQ 2K05A 3WOFA 1S5CD 4DV4Q 5K36G 4LF5Q 3S1QB 1AE3A 1PFSA 3CRKC 4HJAA 1ESRA 1NAPA 1XMOL 4B3TL 1RJTA 2FMCA 4IFDG 1F9SA 4IUUA 4K0KL 1KRTA 4PMBA 3I4MG 5COYA 3MTSA 2IPKD 3K7AB 1PZID 3CXCA 4L6TB 2WINB 4JBWA 5M3MH 2VQFQ 1JT8A 1IBLL 1EWIA 4JOIC 3TZDA 2Z6BA 1TWAH 4BBRG 4A93H 1HTLD 1JICA 1EIFA 1RF2D 5ELNA 1B4OA 1I3QB 3T4AC 1G91A 1UNSA 5CYUA 1IKLA 1CZWA 1LT3D 5EPJA 3JC66 2BA1A 3H3VC 5DAUA 4DK3C 1RD9D 1PFMA 1TWHB 1XNRQ 3PIPA 4O1NA 4DV7Q 4BA2I 2ZJRA 1N32Q 1XNQL 1G2SA 1DM0B 1WYDA 5C44G 1ILQA 1KHIA 1N33L 1EU4A 4IALA 1O7ZA 2ZM6Q 4BY1H 4TQUS 1TXYA 3D31A 1K0RA 2CWPA 5M3MB 2NN6H 2PI2E 3X3MA 2M00A 4JBMA 4A93B 2IHEA 3L2PA 2UXBL 3J7A5 5M5WH 1EQTA 1MSGA 2Q2HA 4C56C 1VQ9A 2ZJPA 4JI2Q 3UE0A 1D6EC 3U4VA 1PXUA 5EBDA 2QDLA 3S2DH 2XWJB 4EQNA 4DUZQ 1ICWA 5EKLA 5C6AA 4JI8L 2AKWB 3F2BA 2RBMA 3ERQA 3HOWH 1L0XB 4KN7C 4R1JA 1TQOA 2O5IC 4K8JA 1EQRA 1WTOA 1JQYD 5AFWA 5M5YH 2YYZA 5ISRA 4XQJA 2MNAA 4BY1B 1WCMH 4HIMA 4O2DA 2KOLA 1H9SA 4JI4Q 1SJHD 4MNOA 2IW3A 3HKZB 2EJGC 2WB1E 4KHPQ 4WFN3 1G8ZD 2AWNA 4QMGA 1J9OA 1MIUA 5CC4A 2LS01 1M90C 1HZAA 1K8AC 4NXNQ 1VQNA 3J7AV 3HOZG 1SAPA 1SNMA 2Q2IA 4CBVA 3F1ZA 2SOBA 1YVCA 2CFMA 5C3EH 5D14A 1DJRD 3S2DB 4GN4B 1WTXA 5IT9L 4DF7A 3S1MH 1JB7A 4GOPA 2GVAA 4FF2A 2WB1G 1SLJA 4JI1Q 4JK1C 4V190 3QG1A 4X62Q 5M5YB 4QIWB 4K5VA 2BE5C 3GTJH 2RHQB 1WCMB 1HZ9A 4JOIA 2A6HC 1OXUA 3S17B 3NBIA 5C4JH 4MIUA 4R8NA 2EYHA 3SHLA 1EU3A 1E2VA 2R92G 1B2TA 4I7AA 4IPCA 3L3OC 1AZPA 2CW0C 2R93H 5FOBB 2M2LA 5E4WC 1S40A 4OHJA 2D0PA 5CV9A 1NJIC 5ELCA 3DM3A 1RCVD 3HOUG 1VS0A 4N9PA 1B70B 1GUTA 3J81j 4MTKA 2O5JC 3T1YQ 1TKWB 3O13A 1LTID 4Q5VA 4K14A 1TS5A 1H9RA 4NXML 1ASYA 4HCEA 1X3QA 5C4HA 4OELB 3I56A 2AMCB 2KCTA 1Y1WG 1JB3A 2BE5D 3KLSA 1SYDA 4YCWA 1K83H 2A6HD 3J80L 1UEBA 1I6VC 3C2PA 4QCLA 1VCIA 5J3BA 4KV6A 1LTTD 5C4JB 4DR1Q 1B3QA 5I6YA 4K2LA 1FJGL 3C3LA 4DR1L 4C3HH 2A68D 3Q22A 3NQTA 3OWFA 1PH9A 1PTOH 2CW0D 1S5ED 2F0LA 3VR6A 1WVLA 2UUBL 2R93B 1QNKA 4KHVA 1SROA 3CF5A 1BOSA 2ALYB 5K36H 1MKHA 2EYJA 3T1HL 4ZAIA 1AP0A 3UE1A 1PA6A 1L1OC 4IFDH 3SK5A 1PFNA 1STHA 5DNFA 1BUVT 4LF7L 2Z8LA 4QGUA 3CCUA 3I4MH 1V1PB 3A74A 3NBHA 1G6ZA 1U4RA 2NN6I 3HGBA 4IURA 4OWXB 1YIJA 3GTKH 1L2FA 5GAEC 4DR2Q 5FK9C 4FXKC 1AW7A 5IGEA 2YTXA 1QWYA 2F0JA 2LY7A 3AFPA 2EVBA 2JYOA 2H1EA 4LNQA 2JA7G 5JOBA 5JAVA 3OTOQ 1KXLA 2F0IA 5I6WA 5IGCA 3QWNA 4PV1C 4BBRH 2UXDQ 1IYUA 1IBKQ 2WIIB 2EY1A 1PTOB 2NZOA 2EZVA 5KGUA 4YCVA 4BXXG 2UU9Q 4KY6A 2E76C 1EYDA 4OWWB 2DUDA 1W2BA 2F4IA 1PMRA 1Q86C 2JA5B 4LF9Q 3LGJA 1I6HH 1O78A 1IXRA 2IHFA 2VXWA 4H7BA 4X65Q 1O7IA 1C8CA 1Q1EA 4DV6Q 3I4MB 3BDLA 3OSOA 1V8QA 4RMFA 3KJPA 4DV0L 3JAMi 5C44H 4APVA 2MO0A 1IBMQ 2RCFA 5FO8B 4HSVA 2XN9C 4RH6A 3LWUA 2HUGA 3KFUA 5LMUQ 1HCZA 4X3SA 2E2JH 2G9HD 4A3GG 2OXPA 1AZQA 3H0GG 1MGSA 5LMUL 2BH8A 4JI3L 2Z4HA 3B6YA 4NKLA 1WFQA 1O7YA 1E2ZA 3NENA 2RDGA 1EZ8A 3AU7A 3HRZC 2HIXA 4P75A 3I73A 4FO2A 1KQSA 2ZXPA 3J80c 2NB0A 1KAWA 2K5VA 1EOVA 2JQOA 4GNXC 4A3MG 2YTYA 2K52A 2PNRC 2XRSD 2XNAC 4ZUJA 1ET9A 4AIMA 2K5NA 2KUMA 1T5EA 3OPOA 2RHSB 4V0BA 4UPAA 1CA6A 5IODA 3J80E 4X64Q 3Q23A 4DXGA 5A35A 4UP8A 2F0QA 1DGSA 3VDYA 2K5WA 3IL8A 4J15A 4RA8A 3V96A 2RSNA 4JPBW 2HQLA 3HOZH 3CMAA 1CHQD 4KJOA 1PYWD 3TEHB 1IYJB 3CCQA 4DFAA 2DY7A 1QE6A 3FHWA 4UP9A 4G57A 3J81L 3SGIA 5IYBG 5ELOA 2Q2UA 2H5XA 4LJZC 3RLFA 5EPKA 3S9WA 2EYLA 1SYCA 2AQ1B 4IUPA 5EAYA 5DM73 1WTVA 1EEID 3MXNB 4CDDC 2YV5A 2JEBI 2DY8A 4DR5L 3K81C 3STBD 4C3IG 1XWEA 3M7GA 4JBJA 4YHHL 4BBSG 4GKKL 1A2UA 1LYLA 1VQ8A 3CCVA 3M4OH 4R4CA 2R92H 2NZ1D 1H9MA 3NE5B 3HKZE 1A2TA 3VA5A 3DMUA 1NE3A 4IFDI 3CCSA 3GD7A 5J22A 1SBBB 3PUWA 4DK6C 5LMNQ 1NUCA 3HOUH 1ESFA 3PO3B 2ZJQA 2QCPX 2Q8IB 4GN5A 1G291 1FNUA 2N55A 1F9RA 1VMCA 3BZDB 5CGKA 2DN8A 3CCRA 4DNRB 5JJZA 4GKJQ 2B3GA 1JJCB 2ZXRA 1VQ6A 1F9QA 2WB1B 2KEDA 3IRBA 1UE1A 4CKEA 2D9UA 4F8MA 1QG7A 3V05A 1Y1WH 3ERSX 5FLXE 2F0KA 1E24A 3HKZG 2BH2A 4JV5Q 3D4RA 1VQEA 1QUQB 1JWSD 2B2TA 1K3RA 4DR3Q 2EIFA 4IOAA 4L63B 4WJ3M 2JSOA 3RZDH 1ENFA 3E9HA 1SNPA 2R7FA 4ME5A 4DAPA 2F52A 1YNXA 3K5OA 3M4PA 3MFGA 4ZKCB 2XTIA 1QZHA 1C7YA 1IZ6A 4A3CG 2NVXH 1ENAA 1K8GA 2OEOA 2A74C 3OIPA 1TU2B 1B53A 4J8QA 4M8AA 3KF6B 1A8VA 3K6OA 2JEAI 1S3OA 3J7AF 4KHZA 2YU9H 4L8JA 1SNDA 1VQAA 4R4IA 1CZGA 5AJ3L 4GNXB 1RIPA 1Y1WB 4IFDJ 5CORA 5BN4A 2G5DA 1KLGD 2H4OA 3J81c 1CT1D 4LF6L 1X3EA 3GDEA 2JA7H 2KHJA 1EYGA 1X9NA 1YHQA 4FXGC 2JN4A 1VQ5A 4MN3A 1BCPC 2EOTA 3TDQA 4ME3A 5CV5A 1E1OA 2E2HH 3EQLC 2R3ZA 1BQQT 3P75A 4CDEC 4BXXH 3PUXA 5I9OA 1CK1A 4KKSA 1X3GA 2NVXB 3HP3A 2ZTEA 5IP9G 4P73A 1PYSB 1E1TA 3KK7A 3PMFA 4YWLA 5KYIA 3J81E 5E7NA 3H15A 3I70A 3DHQA 2YU9B 1QVGA 2VUMG 1V1OA 3HOVB 2F0MA 1G51A 1EQVA 4IJLA 5M3FB 1EIYB 4A3GH 1QB5D 5D3IB 3GQBA 1FGBD 4RHSA 3H0GH 3ZJYC 2JA7B 1EY9A 1STAA 1TWFH 4X66Q 1HRJA 1QILA 3N6RA 3DWAA 1OTCA 1BKBA 4CJ0B 4DXFA 2UUCL 1CFMA 2NVTB 1HR0L 4DV2Q 2HCIA 3EFXD 4AQYL 4B3SQ 3EN2A 4ZRZA 4DV2L 2C5CA 4YWMA 1PH8A 1ML0D 5D3DA 3S15H 3K7AH 4KKUA 2SNMA 4A3MH 1UAPA 3NHHA 1VQGA 2JA9A 2UUAQ 2PYKA 2Z0SA 3SK6A 2UXCQ 4DA2A 2ICEC 5C5LA 4DAYA 1QCBD 2K6AA 4GN3B 2FHTA 2KCCA 3H0GB 3HS0C 2IX0A 5I2YA 5C4XB 4JI5Q 1MJCA 1TWFB 1BBXC 1I3QH 4JI5L 4A76A 2B29A 4A75A 4JW0A 3GV6A 1F2LA 2R61A 1PH6A 3K5LA 2VQEL 2JA5G 4A3BB 3CW2C 4DV4L 1RDPD 4OL7A 4LF5L 1TWHH 2RCNA 5DM63 3V2TA 2L5TA 1YNJC 1TT2A 3E3XA 4GOPC 1T5XD 4PNYA 5IYBH 2B8GA 2Q8TA 3S15B 4XQQA 3D8GA 1Y14B 4A3MB 3ER0A 1Q46A 4P74A 2XRQD 2M9VA 1GUNA 1EIGA 4NDXA 1GUGA 3CP0A 2NTSA 2F0EA 2MUYA 3FP9A 4RGMA 2VQFL 1D2BA 1J8IA 4C3IH 1NR2A 3KJOA 4HJ8A 2FXQA 2PO4A 1PZKD 2EXZA 3U58A 5JEAG 3EIVA 4BBSH 3N52A 1H9KA 3W1GA 1X55A 3PV0A 1LV9A 4ULLA 4ZQ3A 3NQIA 3HOYG 1Y69U 1MJEA 4F7XA 1II3A 2LFNA 4R4TA 1X32A 1YNJD 1SYGA 5JPNC 4Y52H 1HZBA 1XNRL 1VQ4A 4U68A 1EY7A 4PMCA 4DV7L 4HIOA 3K7UC 1N32L 1KDBA 3Q24A 2Y0SE 2ZTDA 1KDCA 5IYDG 3J80i 2CQAA 4IUTA 1L0WA 2ZM6L 1IL2A 3TP5A 3LWEA 3BJUA 4JBKA 4HR7B 1NMFA 1CQVA 3E0EA 3HEJA 4C3IB 4OIKA 1R4QB 1SE8A 5BR8Q 3ND8A 4QQBX 3CMEA 1M1KC 4BBSB 4G7HC 4X3TA 1WTQA 3NTHA 4EX5A 1AH9A 2Y0SG 3I7FA 4BWGB 3MA2B 4JI2L 4XIGS 3T13A 1PRTF 4A3LG 1EZ6A 4A3CH 3PUVA 4DUZL 4CDCC 3RN2A 1XMQQ 2Z4IA 4ABNA 5ELBA 4ODGA 1D7QA 1NNXA 4XYOA 1XYIA 2B8FA 1I4GA 3S17H 4JI4L 2K03A 2KHSA 1SE3A 5FO9B 4LF8Q 1IKMA 3A54A 4GS3A 4HJ7A 1PYBA 1I4RA 4KHPL 3GTLH 4EGVA 3S2HH 3S14B 1VQKA 2XVSA 1G2TA 4OO1I 2F0SA 1X65A 1YJ9A 1STGA 3BZCA 3IFTA 2N8NA 4NXNL 4I65A 1HNWQ 4R4OA 2IY5B 3RN5A 1FVIA 1XXGA 2FJ2A 2RQXA 3PO3G 3R93A 2K32A 1JMCA 4HN7A 1Y8PB 2D0OA 3G4SA 3AYHB 3H3VH 3A55A 4K2KA 5IP9H 3RUZA 1UE7A 3OW2A 3CPWA 2CVRA 2I5MX 1STNA 1K3BC 2PMZB 4YY3Q 1Q7YC 4JI1L 1NTGA 4LW1A 2OTJA 4DR6Q 4X62L 4A3KG 3E6ZX 3I4LA 2VUMH 4DR6L 4PQXA 3J7YW 4NP5A 3MEHA 3SEBA 3PF4A 1B44D 2F4VQ 4HJ9A 4QY7A 1SYFA 4ZK9B 3GTLB 3S2HB 1KL9A 2HHHQ 4JI6Q 2EPBA 1X56A 2CH4A 1W6JA 3HG9A 4TKOB 3BDCA 2JK8A 4EQPA 4X3KA 3G6EA 4ZKBB 5CV7A 1YJWA 3IKJA 1GM5A 2I5HA 3TN2A 3T1YL 4GLXA 1HQRD 2MP1A 5I9PA 1STBA 2A1AA 2ID0A 3ONAB 2ICIA 4A3FG 1BCPF 2VUMB 2EJMA 1S4ZA 4X3UA 1X54A 1JOOA 3A56A 1I4PA 3MEFA 2E8GA 1R9TH 2Z6KC 3EROA 1LTLA 3H6MA 1A3UA 4Q0FA 4HEDA 1D5XC 3MXGA 2JA5H 1XX8A 4FF4A 4L5RC 1MBYA 3LX0A 3PGZA 5C3XA 1A63A 3I2ZA 4LFCQ 1PHJA 1TWGB 1QOHA 4QL5A 2KBNA 3HOVG 3KOJA 5M3FG 4LFAQ 3MAQA 4DR7Q 4LUOA 2K5DA 1LLRD 1SR3A 3NBHB 5IT9c 3FKIG 4DR2L 3HKSA 4AYBE 2K14A 1SEBD 1QNUA 5A2QL 2CCZA 1R9TB 2Q8RE 3OTOL 1IL8A 4DV3Q 4DR4Q 4WJ4A 1B1ZA 5JEAH 1YNNC 1RODA 2UXDL 1IBKL 2Z1CA 3DWPA 2BA0A 4ZYSA 2VNUD 4DV5Q 4JCVE 3CAMA 4K5XA 1FNVA 4N9TA 3HOYH 2UU9L 4KLKA 4DGZA 4DV5L 2QW7A 4EVOA 2QEJC 2OWOA 4LF9L 4FDBA 5DEHA 5IT9E 4RG1A 3OYYA 1FGUA 4AYBG 3IAYA 4N8X1 3AQQA 4X65L 4C3JB 1KD1C 4DV6L 3FPPA 4BS9A 1IBML 2DNEA 4NW2A 4I7ZC 5IYDH 4RFBA 3M3YH 4OX9Q 1N36Q 3TQYA 1JWMD 2J0TD 5IYCG 5IIFA 5C4XG 2XIWA 1VQIA 3I91A 5KNDA 2B2TC 2DNCA 1YNND 1E3PA 2F0FA 1KLUD 5F2DA 4A3BG 4OO1G 4B9XA 1CKNA 3H94A 5FLMG 3QB3A 4P72A 3H3VI 3HOYB 3TMEA 3OWEB 2K1BA 1GKHA 2HIVA 5G3LF 1KNAA 4A3LH 2L12A 2F0UA 3EA6A 2VZAA 3RMHA 3CCEA 2EYPA 2GVBA 4HSPA 4A3IG 5JJKA 1OXSC 2K28A 2LXJA 5CMDA 2OQKA 2RA4A 4ILWA 1S72A 1EFWA 2B2YC 3K57A 3GTOH 3A5ZB 1SFOB 4POGA 3CU7A 2X69A 3M3YB 4PZ7A 3OMCA 3BYTB 1SN8A 2XGTA 4IPDA 1CSQA 3BDOA 5C4ZA 2DGYA 2NYZD 2Z6KA 1SYEA 4X64L 3A7AB 1EY6A 2K01A 2PW5A 4WRDA 1CUKA 2K7VA 3KDFA 2LMCB 2Y0SB 1Y1VG 2K4KA 3K0YA 2QGQA 3KYHC 3PO3H 1I4HA 4WORA 1N34Q 3AFQA 2TSSA 3SE0A 3K5MA 1N34L 3R2TA 3DLLA 1HZCA 5EQ0A 4R9WA 1PRTC 1L1OB 3D6CA 2VB2X 4ZLTF 1HPCA 3GTOB 4IJHA 1S5FD 2PI2A 2KENA 2L55A 4QF4A 4JYAQ 2D62A 4A3KH 2EXDA 2KCMA 2BDOA 3A5UA 1HXYD 4DK1A 3PIO3 3KF8A 5JVH3 2IJ0A 3S24A 2WFWA 3M9BA 3OW7A 1X3FA 1U4LA 1LT4D 2MJ8A 2PZWA 2EQSA 1K28A 3BG3A 3D0FA 3F8TA 5C0XJ 3OOCA 2L1BA 4F87A 2WP8J 4IZ8A 3RLOA 1A15A 4L5TA 2F3WA 2K50A 1SMXA 2SNSA 5EKKA 5LMNL 2PZTA 2BDNA 4IN3A 1B9MA 3BU2A 1D1KA 4O0AA 2F0NA 5H1SE 3TP6A 3WWVA 1PRTD 4XQNA 2F0OA 4OGQC 4RGOS 4GKJL 2N3SA 5LHY1 2AWOA 2VB3X 2IX1A 1QJOA 2WKDA 2K04A 5GAHC 4L5SA 2K33A 2F03A 4A3KB 4A3FH 2PMZE 1VF7A 4JV5L 3R8BA 3T51B 4BA1I 4HIKA 1BVSA 5D65A 2F0TA 4DR3L 3AB9A 2PNHA 1BBUA 1KRSA 3R3OA 4HMIA 1JORA 3JAML 3NXWA 5E3FA 3VYTA 1E0BA 3QO2A 2WAQE 2VY3A 3CQZB 3D6WA 2A8VA 3MXUA 3VR3A 3CCMA 3PUZA 2QILA 5IWAQ 1KAAA 1VF5C 1EY4A 3ND9A 1LO5D 2B2UA 2V1CC 3T56B 4BY7B 3CRLC 1K73C 2K5QA 1KC8C 1DD2A 1MSHA 2B2YA 3KLRA 3NSWA 3ULPA 1SNQA 3CCLA 2O4XA 3NELA 4JC0A 4OIJA 1PH1A 4RKBA 3WOEA 2CHBD 3HOVH 5M3FH 1UE6A 2WAQG 4DKAC 4LAAA 4MHEA 4CKCA 3FKIH 2E5LQ 5BN3A 1W6KA 4A3FB 1SNCA 4RCNA 4X6AH 1OXVA 1QVCA 1B3AA 2KVMA 4QUCA 5ELDA 3VR2A 2EDGA 4LK1C 3UDGA 3RR5A 3C46A 1FR3A 3EBEA 2NVTH 3EJIA 4KKTA 3WDNA 3HOXB 2B2VA 1I50H 3GTPH 2VS1A 4A3EG 3GV3A 5JEAJ 2E2IH 4KY7A 1F2ZA 2IWHA 4GLAC 1WTRA 1A3VA 3MWYW 4KN4C 1XTCD 4XT3B 1IYVA 5EBCA 4RCOA 2C35B 3PF5A 1NR4A 3TP7A 3NWSA 1YI2A 4PG3A 3NEMA 3C1EA 3J7ZC 1BXTA 5IOCA 2R7DA 1VMPA 3P20A 1PRTB 2F0WA 4Z9CB 2B2WA 3FKIB 2RKSA 5C0XG 1DOLA 3MC0B 2R6GA 2PQAA 4CDFC 5IYCH 5C4XH 1XTDA 1OO9B 2RF4A 5J1ZA 1OXXK 4FVMA 1BCPD 1JWUD 1PV4A 3QR8A 4X66L 1PVOA 1IW7C 1GOZA 3U9OA 5HURA 4ZCKA 2NVQH 4A3BH 4OO1H 5C3WA 3MZ5A 1JOQA 5FLMH 4O42A 1I50B 3GTPB 5IGGA 1CTMA 3E5SA 2QA4A 4OONA 2JA6G 2E2IB 4HCSA 1AEXA 1MD2D 3UDFA 4OEMB 2QEXA 2LXKA 4B3SL 4AYBB 1AN8A 1G6PA 3Q8DA 4A3IH 1A3TA 1Q1BA 1Z6HA 1Q8KA 3ULJA 2UUAL 3UDIA 1Z9FA 3FPUB 1D8LA 1YJNA 1K9MC 4RAUC 4HJ5A 2UXCL 1VQJA 3HFZB 2F0HA 1I4QA 4NB3A 5BN5A 2JJQA 1SSOA 2QF7A 1LTGD 1CM9A 2LSSA 1CI3M 1L0YB 2G9DA 4ID6A 1DXMA 1IW7D 4A3DB 2MGSA 1LTBD 2GA4B 2NVQB 1Z7TA 1HUNA 1DYQA 3I4OA 2XSCA 3M7NA 4OXPA 3T53B 3GTGH 3BZKA 3NUCA 1LUZA 1SMYC 1ET6A 4H44C 2A6EC 4LUVA 1EOTA 1Y1VH 2F0PA 5IP7G 3W5OA 4B3RQ 1SJED 1KABA 1KNEA 4C3JG 1LACA 1Q8IA 3I4NG 3TZUA 1I4XA 1GHJA 4A3IB 1EY0A 3UDXA 2R7ZB 5NUCA 1XMOQ 4B3TQ 1UUPA 3RZOB 3W2DA 4UDUC 3G6JB 4K0KQ 1ILPA 1VQLA 1U5KA 1PH4A 4F88A 1YITA 4RWSC 2YTVA 4DV1Q 5C3EB 4P71A 1A62A 4DV1L 4E6IA 1M8AA 4A3JB 2FFKB 1IBLQ 1BDOA 2MHVA 2ENBA 1BCPB 2HD3A 1SMYD 3S1NB 3GTGB 2A6ED 2E2DC 1NMGA 1Y1VB 3E0JA 5GQOA 4ALPA 4K6LA 1XJVA 2PW7A 5G3LD 2ZXOA 4IPGA 4EQ5A 4FXDA 4N8FA 1KDAA 1DOKA 3MXPA 2F0DA 3G7LA 2B39A 1QVFA 1BBWA 5JJLA 2F0GA 1TS4A 1TR5A 2L4NA 5KYLA 3OHXC 3I72A 1RKNA 1XNQQ 2BOSA 5GROA 1F77A 4MTNA 2DJFC 3CC4A 2V4DA 1N33Q 4HMJA 1BR9A 1P8LA 1VQOA 2A69C 3S14H 1VDZA 4H0LC 5BR8L 1SE4A 1KTKA 3CKIB 1SDFA 3C1FA 4QB4A 1PLFA 2K5HA 5EKIA 3TS0A 5IE8A 1EY5A 3AEVA 2D2CC 1TWAB 2UXBQ 4QJFA 1U0LA 1JE5A 1T9HA 4XYQA 1NBWA 4PMWA 1BF4A 1F2MA 4DAMA 1XMQL 2HQEA 4CKBA 3OIQA 5GADC 1J5EQ 4EQOA 4K5WA 4JI8Q 1J5EL 4IO9A 1QZGA 1PH5A 3DXJC 2OF1A 4RHRA 2RDHA 1M4VA 1EFID 1JE4A 4RGNA 2A69D 1H9SB 3TREA 4LF8L 1EYAA 2NUCA 4DUYQ 1HR0W 1ICFB 1VQMA 1TY0A 2B63G 1HFNA 4DUYL 1N8RC 5IGDA 2N78A 3P7JA 4DNIA 1HNWL 1LABA 1H9JA 2AUKA 1U4PA 2MPMA 4KTAA 3DUZA 3MFYA 3E9IA 1HJPA 5K5PA 4JI7Q 1PTOC 1GHKA 4A3EH 1HHVA 2J7ZA 4U673 1E7ZA 4JI7L 4LFBQ 2SDFA 1Q12A 4YIJA 5I2XA 1Q90A 5HY6A 3CHBD 5M5WB 1TIID 1JR0D 2MQHA 2NVYH 4LFBL 3ITPA 3K59A 2PQEA 4GOPB 2HCCA 4DNTB 4YY3L 2D5DA 3U9SA 4XTCS 1UEAB 1E2WA 4KY5A 3PSIA 1VQCA 4UAIA 2P5ZX 2WAQB 4FF1A 3HOWB 1FD7D 5FKAC 2WACA 5C0XH 1DONA 2F4VL 3U50C 1GUSA 4IUNA 3CCJA 2IL8A 3QOLA 1HA5A 3CC7A 3EVQA 1U4MA 1HNZQ 4TSSA 5CV6A 3GTMH 1A0IA 1BO0A 2HHHL 4JI6L 5J39A 5HGQA 2CQOA 1Z47A 1HNZL 4NPSA 1X6OA 4LWCA 1WI5A 4BY7G 1PTOD 2KECA 2J4XA 3CC2A 4A3EB 1B8AA 2JA6H 3PO2G 2RDFA 2EYMA 2X6GA 3PIOA 1TWGH 5JJIA 3D4DA 2A68C 2AQ2B 3DEPA 2JP1A 2NVYB 1Q81C 4B08A 2OTLA 5IGFA 4GLVB 5FO7B 4OWTB 1EWHA 1K8MA 1KIXA 4HTHA 1SYBA 3G71A 3MHBA 1WOCA 3H09A 2I46A 3LNNA 2ATWA 3S1MB 1GVPA 2L9HA 4NXMQ 3URYA 2MO1A 1R4PB 1SRUA 1XPOA 1U9RA 3BVZA 4KD3A 4FNFA 4IUVA 3UI2A 3ICEA 3PQIA 3FRPB 3HOXG 5I4DA 4DU9A 3GTMB 1EIHA 5LL6S 3GTJB 5M5XH 1HTPA 1CA5A 2KA7A 1STYA 5E4XA 3RLNA 3J81i 2ES2A 1PFBA 1FJGQ 5CR3A 4GZYC 3BS1A 2JA6B 1YHBA 1A6XA 2UUBQ 2QDBA 2I5LX 5IP7H 1Q3LA 3K8AA 4WJWA 1B7YB 4L5QA 4C3JH 1EYCA 5LL6X 4IUQA 4LFCL 3D4WA 3I4NH 2VL6A 1LTSD 2AUJD 2L11A 1RTNA 3T1HQ 3GTQH 4NMZA 1V1PA 2K75A 2QKIC 2XWBB 1E22A 4LFAL 4DR7L 1HFGA 1EEFD 4LF7Q 2EJFC 4CHTB 5C5MA 3I8ZA 2EYFA 1PH3A 2N49A 2F3VA 5EJWA 3G48A 3BVMA 3CPFA 4DV3L 4DR4L 1VQBA 1GO3E 1K83B 5M5XB 1GUWA 2EY6A 1XPRA 5KRUA 1VQ7A 4LMQD 2N88A 3PIP3 4A4IA 1O7LA 2JA8G 1V1QA 1LTRD 3RNUA 4KD4A 3TSSA 1CHPD 3QOJA 3RD4A 4C3HB 3S16H 1I94Q 3FMCA 4G7OC 2HDLA 1WD0A 4C2MH 2F1MA 3FVQA 1YEZA 2HT1A 5FJ8G 1I94L 3I4NB 3F2CA 1SFOH 5HGTA 1K8OA 4JVZA 3A8KE 1DCZA 4TRDA 3GTQB 1WTHA 3L9AX 2KCNA 1PDQA 5KNBA 4IOCA 4FYDA 3K0XA 4OX9L 1LT6D 3H91A 5ELEA 4DV0Q 1N36L 3QJYA 1EL0A 1F2YA 2L0CA 4POFA 3I55A 1ASZA 5FLXL 2L15A 4A3DG 1D5ZC 5TSSA 3OMGA 4DK0A 1VQDA 1DOMA 4PZ8A 5KIXA 3GTKB 1SXTA 3NTIA 1WJJA 2HDMA 5M9OA 4JI3Q 3MVVA 4RKLA 1VQFA 2FINB 2Z9HA 1TS2A 4XDXA 1CSPA 1ZKOA 1CKNB 3NWTA 1SE2A 2B2UC 5DLQE 4K8IA 3NTKA 2GN5A 4BBRB 3S16B 3W1BA 2KEEA 2R7ZG 1D5MC 2NZHA 3TS2A 4C2MB 2JXMB 2PCFB 1TWCH 4YWKA 2MFIA 4HAEA 5JVG3 2KQ3A 5CBEE 1Y8OB 5C0XI 3L0OA 3Q0AA 1X3PA 1I6HB 3A8JE 4DAVA 4JI0Q 4B9WA 5EPLA 5C3EG 2AHOB 2BCOA 5GAGC 3PUYA 3X3NA 4JI0L 2F3IA 4KJNA 1HQMC 4IQZA 4A3JG 3M4QA 4C1NK 2EE1A 1YBYA 1MHWC 5C44B 3TRZA 1LM0A 5CV8A 4XXEA 2B63H 2B2VC 2X6LA 2E2JB 3STBC 3DEOA 2AQ3B 3D3RA 4FP5D 4C1NI 2IX3A 1HNXQ 3GP7A 5T1GA 5JPMC 4AH6A 3KDFB 1RHPA 1HNXL 3I3CA 1BNZA 1B9NA 4H02A 2KJXA 1TWCB 4CJ2C 4R8IA 2C9OA 1VQPA 3BYYB 3L7ZC 4KMUC 3VA7A 2TMPA 1FNWA 4G7ZC 2WKCA 3MXNA 4CJ1B 1L1OA 4JYAL 3KLSX 2B2WC 3I90A 2ZTCA 3SK4A 3K80C 1PH2A 1SNOA 3TP8A 3KBXA 5A2QE 4DR5Q 2I0QA 3CQZH 3W3AA 1B50A 5M3MG 3KF8B 2B63B 4YHHQ 2DJGC 4GKKQ 1O80A 4A93G 1Q82C 4BY7H 1TVXA 4H13C 1P16A 3FDTA 4J1MA 5FLXc 3PO2H 1ENCA 1UE5A 3IFDA 3KUPA 1D1IA 3PCOB 4KI0A 4ZUIA 3HOZB 1H95A 4PZ6A 4JG2A 2OQ0A 3ULLA 4IPHA 3QIAA 2NBFA 1W3SA 2ZT9C 4QUFA 3M4YA 3VYRA 3A8IE 4BY1G 1YZ6A 1PTOF 1JC7A 1QUQA 2E75C 1LTAD 4LUZA 4LF4Q 4J6HA 2NN6G 3HOXH 1DZ1A 1CKMA 4LF4L 3TBIB 1UWVA 2I07B 3KLWA 4QIWE 5IWAL 2OT2A 2LKVA 1MI2A 3M4OB 3U4ZA 3PO2B 2SEBD 4HIDA 5T1IA 2R92B 4UP7A 1F9PA 1C0AA 3NP8A 3S1RH 1ONLA 4DN4M 2O2LD 2EYOA 1XPUA 1OXTA 1PZJD 1EY8A 3KF6A 4S3SA 5CBAE 5KNCA 1V9PA 1WTWA 3HOWG 1EUJA 1YHAA 3HOUB 3FEWX 2E74C 4GNXA 2Q2TA 3K58A 2E5LL 1S5BD 4FF3A 1AFPA 3BVGA 1GJXA 1EWCA 1C4QA 3ZYYX 5EGTA 5AJ3Q 2NTTA 1WCMG 3SR1A 4CGYB 1HA6A 3A0JA 2EY2A 4LF6Q 1ZXTA 1CQFA 2CH4W 3A7LA 5CV4A 4RGTA 2NWGA 3Q6SA 1WTPA 3DWQA 2JA8H 2PPBC 3RZDB 5ELFA 5IGBA 1AE2A 3DM1A 3S1RB 3VR4A 5L37A 1TY2A 4UHVA 3NPPA 4KK7A 5FJ8H 2CKZB 3VYUA 1NSNS 3SDZA 3NK9A 3T16A 4Y7NH 1CKOA 3KBGA 1S5DD 2CWAA 2WV6D 2IT1A 3K5NA 1ZEQX 2RSOA 2VW9A 4TVAB 4P2CB 3SK8A 3SVMA 4A3DH 1LT5D 5KEEA 2PQAB 2F0VA 4B3MQ 1NCVA 1J6QA 5IY0A 1V43A 1GXDC 4B3ML 2A19A 1TS3A 4K6DA 2A5HA 1RL2A 1JJGA 4G4KA 3SXHA 2JA8B 2A73B 1HH2P 2FMMA 2PZUA 2R93G 1VQHA 4XT1B 1ZYRC 2UUCQ 3JAMc 1WD1A 1FL0A 2R7ZH 1JOKA 1C9OA 1HR0Q 1IHZA 3VR5A 3RZOH 3S1QH 2E2HB 2OCEA 4AQYQ 1JJ2A 3CD6A 2ASBA 3GO5A 4Y7NB 3VYSA 2KHIA 1Y8NB 4DPGA 1I5FA 1K0SA 1GUOA 4YCUA 4DAYB 3F2DA
chains in the Genus database with same CATH topology
1JCKB 4M1UB 3JAME 2JE6I 3R2IA 3M85A 3AMUA 2RVLA 5E1FA 4A3GB 3HZXA 4C3HG 1RTOA 1FYCA 2EY5A 3F2UA 1HUMA 1C48A 1ZYRD 3P1HA 1STEA 2K05A 3WOFA 1S5CD 5K36G 3S1QB 3CRKC 1ESRA 1NAPA 1RJTA 2FMCA 4IFDG 1F9SA 4IUUA 4PMBA 5COYA 3MTSA 2IPKD 3K7AB 1PZID 4L6TB 2WINB 4JBWA 3TZDA 1HTLD 1JICA 1RF2D 1B4OA 1I3QB 3T4AC 1G91A 1UNSA 5CYUA 1IKLA 1CZWA 1LT3D 5EPJA 2BA1A 3H3VC 5DAUA 1RD9D 1PFMA 1TWHB 4O1NA 4BA2I 1G2SA 1DM0B 1ILQA 1EU4A 4IALA 1O7ZA 4TQUS 3D31A 5M3MB 2NN6H 3X3MA 2M00A 4A93B 1EQTA 1MSGA 4C56C 1D6EC 1PXUA 5EBDA 2XWJB 4EQNA 1ICWA 5EKLA 5C6AA 2RBMA 3ERQA 1L0XB 4KN7C 1TQOA 2O5IC 4K8JA 1WTOA 1JQYD 5AFWA 4XQJA 2YYZA 5ISRA 4BY1B 2KOLA 1H9SA 1SJHD 2IW3A 3HKZB 2EJGC 4WFN3 1G8ZD 2AWNA 4QMGA 1J9OA 5CC4A 2LS01 3J7AV 1SAPA 1SNMA 4CBVA 2SOBA 5D14A 1DJRD 3S2DB 1WTXA 5IT9L 4DF7A 4FF2A 4V190 4JK1C 3QG1A 5M5YB 4QIWB 4K5VA 2BE5C 1WCMB 2A6HC 1OXUA 3S17B 3NBIA 4MIUA 4R8NA 2EYHA 3SHLA 1EU3A 1E2VA 1B2TA 3L3OC 1AZPA 2CW0C 5FOBB 2M2LA 5E4WC 4OHJA 5CV9A 5ELCA 1RCVD 4N9PA 1GUTA 2O5JC 1TKWB 3O13A 1LTID 4Q5VA 4K14A 1TS5A 1H9RA 4HCEA 1X3QA 5C4HA 1JB3A 2BE5D 3KLSA 1SYDA 2A6HD 3J80L 1I6VC 3C2PA 4QCLA 1VCIA 4KV6A 1LTTD 5C4JB 5I6YA 4K2LA 3C3LA 2A68D 3Q22A 3NQTA 3OWFA 1PTOH 2CW0D 1S5ED 2F0LA 3VR6A 1WVLA 2R93B 1QNKA 4KHVA 1BOSA 5K36H 2EYJA 4ZAIA 1AP0A 4IFDH 3SK5A 1PFNA 1STHA 5DNFA 1BUVT 2Z8LA 1V1PB 3NBHA 1G6ZA 1U4RA 2NN6I 3HGBA 4IURA 5FK9C 4FXKC 1AW7A 5IGEA 1QWYA 2F0JA 2LY7A 2EVBA 2JYOA 2H1EA 5JOBA 5JAVA 2F0IA 5I6WA 5IGCA 3QWNA 4PV1C 1IYUA 2WIIB 2EY1A 1PTOB 2EZVA 5KGUA 4KY6A 2E76C 1EYDA 2F4IA 1PMRA 2JA5B 1O78A 2VXWA 4H7BA 1C8CA 1Q1EA 3I4MB 3BDLA 3OSOA 1V8QA 5FO8B 4HSVA 2XN9C 4RH6A 3LWUA 2HUGA 1HCZA 4X3SA 2G9HD 2OXPA 1AZQA 1MGSA 2Z4HA 4NKLA 1O7YA 1E2ZA 2RDGA 1EZ8A 3AU7A 3HRZC 3I73A 4FO2A 2ZXPA 2NB0A 2PNRC 2XRSD 2XNAC 4ZUJA 1ET9A 2KUMA 1T5EA 3OPOA 4V0BA 1CA6A 5IODA 3J80E 3Q23A 4DXGA 5A35A 2F0QA 2K5WA 3IL8A 4RA8A 3V96A 2RSNA 1CHQD 4KJOA 1PYWD 4DFAA 2DY7A 1QE6A 4G57A 3J81L 3RLFA 4LJZC 5EPKA 3S9WA 2EYLA 1SYCA 2AQ1B 4IUPA 5DM73 1WTVA 1EEID 2JEBI 2DY8A 4C3IG 1XWEA 3M7GA 1A2UA 2NZ1D 1H9MA 3NE5B 1A2TA 3VA5A 3DMUA 4IFDI 3GD7A 5J22A 1SBBB 3PUWA 1NUCA 3PO3B 1ESFA 2Q8IB 2QCPX 1G291 1FNUA 2N55A 1F9RA 1VMCA 3BZDB 5CGKA 2DN8A 4DNRB 5JJZA 2ZXRA 1F9QA 2WB1B 2KEDA 4CKEA 2D9UA 4F8MA 1QG7A 3V05A 5FLXE 2F0KA 3D4RA 1JWSD 2B2TA 4L63B 2JSOA 1ENFA 1SNPA 4ME5A 4DAPA 3K5OA 3MFGA 4ZKCB 1ENAA 2OEOA 2A74C 3OIPA 1TU2B 1B53A 4J8QA 4M8AA 3K6OA 2JEAI 3J7AF 4KHZA 4L8JA 1SNDA 1CZGA 4IFDJ 1Y1WB 5CORA 5BN4A 1KLGD 2H4OA 1CT1D 4FXGC 4MN3A 1BCPC 2EOTA 3TDQA 5CV5A 3EQLC 2R3ZA 1BQQT 3P75A 3PUXA 5I9OA 1CK1A 4KKSA 2NVXB 3HP3A 3KK7A 3PMFA 5KYIA 3J81E 3I70A 3DHQA 2YU9B 1V1OA 3HOVB 2F0MA 5M3FB 1EQVA 1QB5D 5D3IB 3GQBA 1FGBD 4RHSA 2JA7B 1EY9A 1STAA 1HRJA 1QILA 3N6RA 3DWAA 4CJ0B 4DXFA 1CFMA 2NVTB 2HCIA 3EFXD 4ZRZA 2C5CA 1ML0D 5D3DA 4KKUA 2SNMA 1UAPA 3NHHA 2PYKA 3SK6A 4DA2A 2ICEC 5C5LA 4DAYA 1QCBD 2K6AA 2FHTA 2KCCA 3H0GB 3HS0C 2IX0A 5I2YA 5C4XB 1TWFB 1BBXC 3GV6A 1F2LA 2R61A 3K5LA 4A3BB 1RDPD 4OL7A 5DM63 3V2TA 2L5TA 1YNJC 1TT2A 1T5XD 4PNYA 2B8GA 2Q8TA 3S15B 4XQQA 3D8GA 4A3MB 2XRQD 2M9VA 1GUNA 1EIGA 4NDXA 1GUGA 2NTSA 2F0EA 2MUYA 4RGMA 1D2BA 1J8IA 1NR2A 2PO4A 1PZKD 2EXZA 5JEAG 3N52A 1H9KA 3PV0A 1LV9A 4ULLA 4ZQ3A 3NQIA 1Y69U 4F7XA 1II3A 2LFNA 1X32A 1YNJD 1SYGA 5JPNC 4U68A 1EY7A 4PMCA 1KDBA 3Q24A 1KDCA 2CQAA 4IUTA 3TP5A 3LWEA 4HR7B 1CQVA 3HEJA 4C3IB 4OIKA 1R4QB 3ND8A 4BBSB 4G7HC 4X3TA 1WTQA 3NTHA 4BWGB 3MA2B 4XIGS 3T13A 1PRTF 1EZ6A 3PUVA 2Z4IA 4ABNA 5ELBA 4ODGA 4XYOA 1XYIA 2B8FA 1I4GA 2K03A 2KHSA 1SE3A 5FO9B 1IKMA 3A54A 1I4RA 4EGVA 3S14B 2XVSA 1G2TA 4OO1I 2F0SA 1STGA 3IFTA 4I65A 1XXGA 2FJ2A 2RQXA 3R93A 2K32A 4HN7A 1Y8PB 3A55A 4K2KA 3RUZA 2CVRA 1STNA 2PMZB 3E6ZX 3I4LA 4PQXA 3J7YW 4NP5A 3MEHA 3SEBA 1B44D 1SYFA 4ZK9B 3GTLB 3S2HB 2EPBA 1W6JA 3HG9A 4TKOB 3BDCA 4EQPA 4X3KA 4ZKBB 5CV7A 3IKJA 3TN2A 1HQRD 2MP1A 5I9PA 1STBA 2ID0A 3ONAB 2ICIA 1BCPF 2VUMB 2EJMA 1S4ZA 4X3UA 1JOOA 3A56A 1I4PA 3EROA 3H6MA 1A3UA 4Q0FA 4HEDA 1D5XC 3MXGA 1XX8A 4FF4A 1MBYA 3LX0A 5C3XA 1TWGB 1QOHA 3MAQA 2K5DA 1LLRD 1SEBD 1QNUA 5A2QL 1R9TB 2Q8RE 1IL8A 1B1ZA 5JEAH 1YNNC 1RODA 2Z1CA 3DWPA 2BA0A 4ZYSA 2VNUD 4K5XA 4N9TA 1FNVA 4DGZA 4EVOA 2QEJC 5DEHA 5IT9E 3IAYA 4C3JB 3FPPA 4BS9A 2DNEA 4NW2A 4I7ZC 4RFBA 1JWMD 2J0TD 5IIFA 2XIWA 3I91A 5KNDA 2B2TC 2DNCA 1YNND 2F0FA 1KLUD 5F2DA 4OO1G 4B9XA 3H94A 3QB3A 3HOYB 3TMEA 3OWEB 2K1BA 5G3LF 1KNAA 2L12A 2F0UA 3EA6A 3RMHA 2EYPA 4HSPA 1OXSC 2K28A 5CMDA 2RA4A 4ILWA 2B2YC 3K57A 1SFOB 3CU7A 2X69A 3M3YB 3OMCA 3BYTB 3BDOA 5C4ZA 2NYZD 1SYEA 3A7AB 1EY6A 2K01A 2PW5A 4WRDA 2K7VA 2LMCB 2Y0SB 3K0YA 1I4HA 4WORA 2TSSA 3SE0A 3K5MA 3R2TA 5EQ0A 4R9WA 1PRTC 3D6CA 2VB2X 4ZLTF 1HPCA 3GTOB 1S5FD 2L55A 4QF4A 2D62A 2BDOA 1HXYD 4DK1A 3PIO3 3KF8A 5JVH3 2IJ0A 3OW7A 1U4LA 1LT4D 2MJ8A 2PZWA 3BG3A 5C0XJ 3OOCA 2L1BA 4F87A 2WP8J 4IZ8A 1A15A 2F3WA 2SNSA 5EKKA 2PZTA 2BDNA 4IN3A 1B9MA 1D1KA 2F0NA 3TP6A 1PRTD 4XQNA 2F0OA 4OGQC 4RGOS 5LHY1 2AWOA 2VB3X 2IX1A 1QJOA 2WKDA 2K04A 2K33A 2F03A 4A3KB 1VF7A 3R8BA 3T51B 4BA1I 5D65A 2F0TA 3AB9A 3R3OA 4HMIA 1JORA 3JAML 3NXWA 5E3FA 3VYTA 1E0BA 3QO2A 3CQZB 3D6WA 3MXUA 3VR3A 3PUZA 2QILA 1KAAA 1VF5C 1EY4A 3ND9A 1LO5D 2B2UA 3T56B 4BY7B 3CRLC 2K5QA 1DD2A 1MSHA 2B2YA 3KLRA 3NSWA 1SNQA 2O4XA 4OIJA 4RKBA 3WOEA 2CHBD 4LAAA 4MHEA 4CKCA 5BN3A 1W6KA 4A3FB 1SNCA 4RCNA 1OXVA 1B3AA 2KVMA 4QUCA 5ELDA 3VR2A 2EDGA 4LK1C 1FR3A 3EJIA 4KKTA 3WDNA 3HOXB 2B2VA 3GV3A 5JEAJ 4KY7A 1F2ZA 2IWHA 1WTRA 1A3VA 3MWYW 4KN4C 1XTCD 4XT3B 1IYVA 5EBCA 4RCOA 1NR4A 3TP7A 3NWSA 3C1EA 1BXTA 5IOCA 1VMPA 3P20A 1PRTB 2F0WA 4Z9CB 2B2WA 3FKIB 2RKSA 5C0XG 1DOLA 3MC0B 2R6GA 1OO9B 5J1ZA 1OXXK 4FVMA 1BCPD 1JWUD 1IW7C 5HURA 1GOZA 3U9OA 4OO1H 5C3WA 3MZ5A 1JOQA 4O42A 1I50B 3GTPB 5IGGA 1CTMA 3E5SA 2E2IB 4HCSA 1AEXA 1MD2D 4AYBB 1AN8A 1A3TA 1Q1BA 1Z6HA 3FPUB 4RAUC 2F0HA 1I4QA 5BN5A 1SSOA 2QF7A 1LTGD 1CM9A 1CI3M 1L0YB 2G9DA 4ID6A 1DXMA 1IW7D 4A3DB 2MGSA 1LTBD 2GA4B 2NVQB 1Z7TA 1HUNA 1DYQA 2XSCA 3M7NA 3T53B 3NUCA 1SMYC 1ET6A 4H44C 2A6EC 1EOTA 2F0PA 1SJED 1KABA 1KNEA 4C3JG 1LACA 1Q8IA 3TZUA 1I4XA 1GHJA 4A3IB 1EY0A 2R7ZB 5NUCA 1UUPA 3RZOB 3W2DA 4UDUC 3G6JB 1ILPA 4F88A 4RWSC 5C3EB 4E6IA 1M8AA 4A3JB 2FFKB 1BDOA 2MHVA 2ENBA 1BCPB 1SMYD 3S1NB 3GTGB 2A6ED 2E2DC 1Y1VB 3E0JA 4K6LA 2PW7A 5G3LD 2ZXOA 4FXDA 1KDAA 1DOKA 3MXPA 2F0DA 3G7LA 2B39A 2F0GA 1TS4A 1TR5A 2L4NA 5KYLA 3OHXC 3I72A 1RKNA 2BOSA 1F77A 2V4DA 4HMJA 1BR9A 2A69C 1VDZA 4H0LC 1SE4A 1KTKA 3CKIB 1SDFA 3C1FA 4QB4A 1PLFA 5EKIA 1EY5A 2D2CC 1TWAB 4XYQA 4PMWA 1BF4A 1F2MA 2HQEA 4CKBA 3OIQA 4EQOA 4K5WA 3DXJC 2OF1A 4RHRA 2RDHA 1M4VA 1EFID 1JE4A 4RGNA 2A69D 1H9SB 1EYAA 2NUCA 1TY0A 1HFNA 5IGDA 3P7JA 1LABA 1H9JA 2AUKA 1U4PA 2MPMA 4KTAA 3DUZA 3MFYA 5K5PA 1GHKA 1PTOC 1HHVA 2J7ZA 4U673 2SDFA 1Q12A 4YIJA 5I2XA 1Q90A 3CHBD 5M5WB 1TIID 1JR0D 3ITPA 3K59A 2PQEA 2HCCA 4DNTB 2D5DA 3U9SA 4XTCS 1UEAB 1E2WA 4KY5A 4UAIA 2WAQB 4FF1A 3HOWB 1FD7D 5FKAC 2WACA 5C0XH 1DONA 1GUSA 4IUNA 2IL8A 3QOLA 1HA5A 3EVQA 1U4MA 4TSSA 5CV6A 1BO0A 5J39A 1Z47A 1PTOD 2KECA 2J4XA 4A3EB 2RDFA 2EYMA 2X6GA 3D4DA 2A68C 2AQ2B 3DEPA 2JP1A 2NVYB 4B08A 5IGFA 5FO7B 1EWHA 1K8MA 4HTHA 1SYBA 3MHBA 3H09A 2I46A 3LNNA 3S1MB 2L9HA 3URYA 1R4PB 1U9RA 3BVZA 4KD3A 3UI2A 4FNFA 4IUVA 3FRPB 5I4DA 4DU9A 3GTMB 1EIHA 5LL6S 3GTJB 1HTPA 1CA5A 2KA7A 1STYA 5E4XA 1PFBA 5CR3A 4GZYC 3BS1A 2JA6B 1A6XA 2QDBA 1Q3LA 4WJWA 1EYCA 5LL6X 4IUQA 3D4WA 1LTSD 2AUJD 2L11A 1RTNA 4NMZA 1V1PA 2QKIC 2XWBB 1HFGA 1EEFD 2EJFC 4CHTB 5C5MA 3I8ZA 2EYFA 2F3VA 5EJWA 3BVMA 1K83B 5M5XB 1GUWA 2EY6A 5KRUA 4LMQD 2N88A 3PIP3 1O7LA 1LTRD 4KD4A 3TSSA 1CHPD 3QOJA 3RD4A 4C3HB 4G7OC 3FMCA 2HDLA 1WD0A 2F1MA 3FVQA 3I4NB 5HGTA 1K8OA 3A8KE 1DCZA 4TRDA 3GTQB 3L9AX 2KCNA 1PDQA 5KNBA 4FYDA 1LT6D 3H91A 5ELEA 3QJYA 1EL0A 1F2YA 2L0CA 5FLXL 1D5ZC 5TSSA 3OMGA 4DK0A 1DOMA 5KIXA 3GTKB 1SXTA 3NTIA 2HDMA 5M9OA 3MVVA 4RKLA 2FINB 1TS2A 4XDXA 1ZKOA 3NWTA 1SE2A 2B2UC 4K8IA 3NTKA 4BBRB 3S16B 2KEEA 1D5MC 4C2MB 2JXMB 2PCFB 4HAEA 5JVG3 2KQ3A 5CBEE 1Y8OB 5C0XI 3Q0AA 1X3PA 1I6HB 3A8JE 4DAVA 4B9WA 5EPLA 2BCOA 3PUYA 3X3NA 4KJNA 1HQMC 4IQZA 4C1NK 2EE1A 5C44B 5CV8A 4XXEA 2B2VC 2X6LA 2E2JB 3DEOA 2AQ3B 3D3RA 4FP5D 4C1NI 2IX3A 3GP7A 5T1GA 5JPMC 1RHPA 3I3CA 1BNZA 1B9NA 2KJXA 1TWCB 4CJ2C 4R8IA 2C9OA 3BYYB 3L7ZC 4KMUC 3VA7A 2TMPA 1FNWA 4G7ZC 2WKCA 3MXNA 4CJ1B 3KLSX 2B2WC 3I90A 3SK4A 1SNOA 3TP8A 3KBXA 5A2QE 1B50A 3W3AA 2B63B 1O80A 1TVXA 4H13C 3FDTA 4J1MA 1ENCA 3IFDA 3KUPA 1D1IA 4KI0A 4ZUIA 3HOZB 3QIAA 2NBFA 2ZT9C 4QUFA 3M4YA 3VYRA 3A8IE 1PTOF 1JC7A 2E75C 1LTAD 4J6HA 2NN6G 1DZ1A 3TBIB 2I07B 2OT2A 2LKVA 1MI2A 3M4OB 3PO2B 2SEBD 5T1IA 2R92B 1F9PA 3NP8A 1ONLA 4DN4M 2O2LD 2EYOA 1OXTA 1PZJD 1EY8A 4S3SA 5CBAE 5KNCA 1WTWA 3HOUB 3FEWX 2E74C 3K58A 4FF3A 1S5BD 1AFPA 3BVGA 1GJXA 1EWCA 1C4QA 3ZYYX 5EGTA 2NTTA 3SR1A 4CGYB 1HA6A 2EY2A 1ZXTA 1CQFA 3A7LA 5CV4A 4RGTA 2NWGA 3Q6SA 1WTPA 3DWQA 2PPBC 3RZDB 5ELFA 5IGBA 3DM1A 3S1RB 3VR4A 1TY2A 3NPPA 4KK7A 3VYUA 1NSNS 3SDZA 3NK9A 3T16A 3KBGA 1S5DD 2WV6D 2IT1A 3K5NA 1ZEQX 2RSOA 4P2CB 3SK8A 3SVMA 1LT5D 5KEEA 2F0VA 1NCVA 1V43A 1GXDC 1TS3A 4K6DA 2A5HA 4G4KA 3SXHA 2JA8B 2A73B 2FMMA 2PZUA 4XT1B 1ZYRC 1WD1A 1JOKA 1IHZA 3VR5A 2E2HB 3GO5A 4Y7NB 3VYSA 1Y8NB 1GUOA 3C46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQB A;  2AUJ D;  1E2Z A;  2D62 A;  1ONL A;  2DN8 A;  4DNR B;  1LAB A;  1H9J A;  2BDO A;  1OXT A;  2AUK A;  2Q8I B;  2BE5 D;  5KNC A;  4DK1 A;  3MFY A;  3N6R A;  1GHK A;  3I73 A;  2JE6 I;  3M85 A;  2A6H D;  4KN4 C;  2EJF C;  1IYV A;  1I6V C;  1CFM A;  3OW7 A;  3FPP A;  1Q12 A;  4TKO B;  2E74 C;  1VCI A;  1Q90 A;  3D4R A;  1FYC A;  1GJX A;  3BG3 A;  2DNE A;  4KN7 C;  4HR7 B;  4I7Z C;  1BDO A;  1B9N A;  3OOC A;  4DNT B;  2D5D A;  2A68 D;  3IKJ A;  2O5I C;  3U9S A;  3P20 A;  3VR6 A;  2PNR C;  4XTC S;  3ND8 A;  1E2W A;  2YYZ A;  5K36 G;  4KKU A;  5KND A;  2A6E D;  5C0X G;  3L7Z C;  4KMU C;  3CRK C;  2DNC A;  3VA7 A;  2R6G A;  1B9M A;  4G7H C;  1O7L A;  1H9S A;  4G7Z C;  3A7L A;  5K36 H;  4IFD G;  5C0X H;  1OXX K;  1T5E A;  3OPO A;  2EJG C;  4OGQ C;  4OO1 G;  1GUS A;  3H94 A;  2PPB C;  2AWO A;  3FMC A;  4G7O C;  4XIG S;  4IFD H;  1IW7 C;  2F1M A;  2EJM A;  1QJO A;  4OO1 H;  1TU2 B;  3W3A A;  2K33 A;  3PUV A;  2KCC A;  3VR4 A;  5A35 A;  1K8O A;  3A8K E;  1CTM A;  1VF7 A;  2JEA I;  1DCZ A;  2NN6 I;  3HGB A;  3I72 A;  3T51 B;  4BA1 I;  4KHZ A;  4JBW A;  5KNB A;  4L8J A;  3SDZ A;  2V4D A;  1OXS C;  3AB9 A;  2A69 C;  4H13 C;  1VDZ A;  3QJY A;  4H0L C;  5BN4 A;  2A68 C;  2EVB A;  2B8F A;  1Q1B A;  1Z6H A;  2IT1 A;  3MXU A;  3VR3 A;  4DK0 A;  2L5T A;  1YNJ C;  3PUZ A;  4JK1 C;  1EWH A;  1K8M A;  4KI0 A;  1IYU A;  4PV1 C;  3RLF A;  4LJZ C;  2B8G A;  3QG1 A;  1VF5 C;  3BDO A;  3LNN A;  3ND9 A;  2BE5 C;  3T56 B;  2D2C C;  5BN5 A;  2BA1 A;  2QF7 A;  1V43 A;  2E76 C;  1ZKO A;  3CRL C;  2JEB I;  2A6H C;  1OXU A;  3A7A B;  3IFT A;  3QIA A;  3EQL C;  1PMR A;  1GUN A;  1CI3 M;  1DD2 A;  2ZT9 C;  1GUG A;  3KLR A;  3M4Y A;  3PUX A;  4BA2 I;  1O78 A;  4KKS A;  3A8I E;  1DXM A;  2K32 A;  2K7V A;  2LMC B;  1E2V A;  1IW7 D;  2JXM B;  2PCF B;  1Y8P B;  1Z7T A;  1ZYR C;  2E75 C;  1Q1E A;  1HTP A;  1V8Q A;  3M7N A;  2CW0 C;  2KA7 A;  2NN6 G;  4TQU S;  3T53 B;  3VR5 A;  5JEA G;  5BN3 A;  3DXJ C;  1SMY C;  1H9M A;  3D31 A;  2A6E C;  3NE5 B;  1H9K A;  1Y8O B;  4H44 C;  4RCN A;  3SE0 A;  1OXV A;  3LWU A;  4GZY C;  2NN6 H;  5JEA H;  1YNN C;  3A8J E;  3PV0 A;  2A69 D;  1H9S B;  1HCZ A;  1A6X A;  1LAC A;  3VR2 A;  1GUT A;  1Y8N B;  2EDG A;  4LK1 C;  2O5J C;  3GD7 A;  3PUY A;  2BA0 A;  3TZU A;  3PUW A;  1GHJ A;  1TKW B;  1FR3 A;  1Y69 U;  1HPC A;  1HQM C;  1GUO A;  4IQZ A;  3I4L A;  4KKT A;  3WDN A;  1H9R A;  1G29 1; 
#chains in the Genus database with same CATH topology
 1PH7 A;  4A3J H;  5LMN W;  1JCK B;  4M1U B;  3JAM E;  1NY4 A;  2JE6 I;  3R2I A;  3M85 A;  3AMU A;  3S1N H;  2RVL A;  5E1F A;  4A3G B;  3HZX A;  4MZ9 A;  4C3H G;  1RTO A;  1FYC A;  2EY5 A;  4R4Q A;  3F2U A;  1HUM A;  1C48 A;  4UY8 C;  4B3R L;  1GD7 A;  1ZYR D;  3P1H A;  1EQQ A;  1STE A;  1N9W A;  2VQE Q;  2K05 A;  3WOF A;  1S5C D;  4DV4 Q;  5K36 G;  4LF5 Q;  3S1Q B;  1AE3 A;  1PFS A;  3CRK C;  4HJA A;  1ESR A;  1NAP A;  1XMO L;  4B3T L;  1RJT A;  2FMC A;  4IFD G;  1F9S A;  4IUU A;  4K0K L;  1KRT A;  4PMB A;  3I4M G;  5COY A;  3MTS A;  2IPK D;  3K7A B;  1PZI D;  3CXC A;  4L6T B;  2WIN B;  4JBW A;  5M3M H;  2VQF Q;  1JT8 A;  1IBL L;  1EWI A;  4JOI C;  3TZD A;  2Z6B A;  1TWA H;  4BBR G;  4A93 H;  1HTL D;  1JIC A;  1EIF A;  1RF2 D;  5ELN A;  1B4O A;  1I3Q B;  3T4A C;  1G91 A;  1UNS A;  5CYU A;  1IKL A;  1CZW A;  1LT3 D;  5EPJ A;  3JC6 6;  2BA1 A;  3H3V C;  5DAU A;  4DK3 C;  1RD9 D;  1PFM A;  1TWH B;  1XNR Q;  3PIP A;  4O1N A;  4DV7 Q;  4BA2 I;  2ZJR A;  1N32 Q;  1XNQ L;  1G2S A;  1DM0 B;  1WYD A;  5C44 G;  1ILQ A;  1KHI A;  1N33 L;  1EU4 A;  4IAL A;  1O7Z A;  2ZM6 Q;  4BY1 H;  4TQU S;  1TXY A;  3D31 A;  1K0R A;  2CWP A;  5M3M B;  2NN6 H;  2PI2 E;  3X3M A;  2M00 A;  4JBM A;  4A93 B;  2IHE A;  3L2P A;  2UXB L;  3J7A 5;  5M5W H;  1EQT A;  1MSG A;  2Q2H A;  4C56 C;  1VQ9 A;  2ZJP A;  4JI2 Q;  3UE0 A;  1D6E C;  3U4V A;  1PXU A;  5EBD A;  2QDL A;  3S2D H;  2XWJ B;  4EQN A;  4DUZ Q;  1ICW A;  5EKL A;  5C6A A;  4JI8 L;  2AKW B;  3F2B A;  2RBM A;  3ERQ A;  3HOW H;  1L0X B;  4KN7 C;  4R1J A;  1TQO A;  2O5I C;  4K8J A;  1EQR A;  1WTO A;  1JQY D;  5AFW A;  5M5Y H;  2YYZ A;  5ISR A;  4XQJ A;  2MNA A;  4BY1 B;  1WCM H;  4HIM A;  4O2D A;  2KOL A;  1H9S A;  4JI4 Q;  1SJH D;  4MNO A;  2IW3 A;  3HKZ B;  2EJG C;  2WB1 E;  4KHP Q;  4WFN 3;  1G8Z D;  2AWN A;  4QMG A;  1J9O A;  1MIU A;  5CC4 A;  2LS0 1;  1M90 C;  1HZA A;  1K8A C;  4NXN Q;  1VQN A;  3J7A V;  3HOZ G;  1SAP A;  1SNM A;  2Q2I A;  4CBV A;  3F1Z A;  2SOB A;  1YVC A;  2CFM A;  5C3E H;  5D14 A;  1DJR D;  3S2D B;  4GN4 B;  1WTX A;  5IT9 L;  4DF7 A;  3S1M H;  1JB7 A;  4GOP A;  2GVA A;  4FF2 A;  2WB1 G;  1SLJ A;  4JI1 Q;  4JK1 C;  4V19 0;  3QG1 A;  4X62 Q;  5M5Y B;  4QIW B;  4K5V A;  2BE5 C;  3GTJ H;  2RHQ B;  1WCM B;  1HZ9 A;  4JOI A;  2A6H C;  1OXU A;  3S17 B;  3NBI A;  5C4J H;  4MIU A;  4R8N A;  2EYH A;  3SHL A;  1EU3 A;  1E2V A;  2R92 G;  1B2T A;  4I7A A;  4IPC A;  3L3O C;  1AZP A;  2CW0 C;  2R93 H;  5FOB B;  2M2L A;  5E4W C;  1S40 A;  4OHJ A;  2D0P A;  5CV9 A;  1NJI C;  5ELC A;  3DM3 A;  1RCV D;  3HOU G;  1VS0 A;  4N9P A;  1B70 B;  1GUT A;  3J81 j;  4MTK A;  2O5J C;  3T1Y Q;  1TKW B;  3O13 A;  1LTI D;  4Q5V A;  4K14 A;  1TS5 A;  1H9R A;  4NXM L;  1ASY A;  4HCE A;  1X3Q A;  5C4H A;  4OEL B;  3I56 A;  2AMC B;  2KCT A;  1Y1W G;  1JB3 A;  2BE5 D;  3KLS A;  1SYD A;  4YCW A;  1K83 H;  2A6H D;  3J80 L;  1UEB A;  1I6V C;  3C2P A;  4QCL A;  1VCI A;  5J3B A;  4KV6 A;  1LTT D;  5C4J B;  4DR1 Q;  1B3Q A;  5I6Y A;  4K2L A;  1FJG L;  3C3L A;  4DR1 L;  4C3H H;  2A68 D;  3Q22 A;  3NQT A;  3OWF A;  1PH9 A;  1PTO H;  2CW0 D;  1S5E D;  2F0L A;  3VR6 A;  1WVL A;  2UUB L;  2R93 B;  1QNK A;  4KHV A;  1SRO A;  3CF5 A;  1BOS A;  2ALY B;  5K36 H;  1MKH A;  2EYJ A;  3T1H L;  4ZAI A;  1AP0 A;  3UE1 A;  1PA6 A;  1L1O C;  4IFD H;  3SK5 A;  1PFN A;  1STH A;  5DNF A;  1BUV T;  4LF7 L;  2Z8L A;  4QGU A;  3CCU A;  3I4M H;  1V1P B;  3A74 A;  3NBH A;  1G6Z A;  1U4R A;  2NN6 I;  3HGB A;  4IUR A;  4OWX B;  1YIJ A;  3GTK H;  1L2F A;  5GAE C;  4DR2 Q;  5FK9 C;  4FXK C;  1AW7 A;  5IGE A;  2YTX A;  1QWY A;  2F0J A;  2LY7 A;  3AFP A;  2EVB A;  2JYO A;  2H1E A;  4LNQ A;  2JA7 G;  5JOB A;  5JAV A;  3OTO Q;  1KXL A;  2F0I A;  5I6W A;  5IGC A;  3QWN A;  4PV1 C;  4BBR H;  2UXD Q;  1IYU A;  1IBK Q;  2WII B;  2EY1 A;  1PTO B;  2NZO A;  2EZV A;  5KGU A;  4YCV A;  4BXX G;  2UU9 Q;  4KY6 A;  2E76 C;  1EYD A;  4OWW B;  2DUD A;  1W2B A;  2F4I A;  1PMR A;  1Q86 C;  2JA5 B;  4LF9 Q;  3LGJ A;  1I6H H;  1O78 A;  1IXR A;  2IHF A;  2VXW A;  4H7B A;  4X65 Q;  1O7I A;  1C8C A;  1Q1E A;  4DV6 Q;  3I4M B;  3BDL A;  3OSO A;  1V8Q A;  4RMF A;  3KJP A;  4DV0 L;  3JAM i;  5C44 H;  4APV A;  2MO0 A;  1IBM Q;  2RCF A;  5FO8 B;  4HSV A;  2XN9 C;  4RH6 A;  3LWU A;  2HUG A;  3KFU A;  5LMU Q;  1HCZ A;  4X3S A;  2E2J H;  2G9H D;  4A3G G;  2OXP A;  1AZQ A;  3H0G G;  1MGS A;  5LMU L;  2BH8 A;  4JI3 L;  2Z4H A;  3B6Y A;  4NKL A;  1WFQ A;  1O7Y A;  1E2Z A;  3NEN A;  2RDG A;  1EZ8 A;  3AU7 A;  3HRZ C;  2HIX A;  4P75 A;  3I73 A;  4FO2 A;  1KQS A;  2ZXP A;  3J80 c;  2NB0 A;  1KAW A;  2K5V A;  1EOV A;  2JQO A;  4GNX C;  4A3M G;  2YTY A;  2K52 A;  2PNR C;  2XRS D;  2XNA C;  4ZUJ A;  1ET9 A;  4AIM A;  2K5N A;  2KUM A;  1T5E A;  3OPO A;  2RHS B;  4V0B A;  4UPA A;  1CA6 A;  5IOD A;  3J80 E;  4X64 Q;  3Q23 A;  4DXG A;  5A35 A;  4UP8 A;  2F0Q A;  1DGS A;  3VDY A;  2K5W A;  3IL8 A;  4J15 A;  4RA8 A;  3V96 A;  2RSN A;  4JPB W;  2HQL A;  3HOZ H;  3CMA A;  1CHQ D;  4KJO A;  1PYW D;  3TEH B;  1IYJ B;  3CCQ A;  4DFA A;  2DY7 A;  1QE6 A;  3FHW A;  4UP9 A;  4G57 A;  3J81 L;  3SGI A;  5IYB G;  5ELO A;  2Q2U A;  2H5X A;  4LJZ C;  3RLF A;  5EPK A;  3S9W A;  2EYL A;  1SYC A;  2AQ1 B;  4IUP A;  5EAY A;  5DM7 3;  1WTV A;  1EEI D;  3MXN B;  4CDD C;  2YV5 A;  2JEB I;  2DY8 A;  4DR5 L;  3K81 C;  3STB D;  4C3I G;  1XWE A;  3M7G A;  4JBJ A;  4YHH L;  4BBS G;  4GKK L;  1A2U A;  1LYL A;  1VQ8 A;  3CCV A;  3M4O H;  4R4C A;  2R92 H;  2NZ1 D;  1H9M A;  3NE5 B;  3HKZ E;  1A2T A;  3VA5 A;  3DMU A;  1NE3 A;  4IFD I;  3CCS A;  3GD7 A;  5J22 A;  1SBB B;  3PUW A;  4DK6 C;  5LMN Q;  1NUC A;  3HOU H;  1ESF A;  3PO3 B;  2ZJQ A;  2QCP X;  2Q8I B;  4GN5 A;  1G29 1;  1FNU A;  2N55 A;  1F9R A;  1VMC A;  3BZD B;  5CGK A;  2DN8 A;  3CCR A;  4DNR B;  5JJZ A;  4GKJ Q;  2B3G A;  1JJC B;  2ZXR A;  1VQ6 A;  1F9Q A;  2WB1 B;  2KED A;  3IRB A;  1UE1 A;  4CKE A;  2D9U A;  4F8M A;  1QG7 A;  3V05 A;  1Y1W H;  3ERS X;  5FLX E;  2F0K A;  1E24 A;  3HKZ G;  2BH2 A;  4JV5 Q;  3D4R A;  1VQE A;  1QUQ B;  1JWS D;  2B2T A;  1K3R A;  4DR3 Q;  2EIF A;  4IOA A;  4L63 B;  4WJ3 M;  2JSO A;  3RZD H;  1ENF A;  3E9H A;  1SNP A;  2R7F A;  4ME5 A;  4DAP A;  2F52 A;  1YNX A;  3K5O A;  3M4P A;  3MFG A;  4ZKC B;  2XTI A;  1QZH A;  1C7Y A;  1IZ6 A;  4A3C G;  2NVX H;  1ENA A;  1K8G A;  2OEO A;  2A74 C;  3OIP A;  1TU2 B;  1B53 A;  4J8Q A;  4M8A A;  3KF6 B;  1A8V A;  3K6O A;  2JEA I;  1S3O A;  3J7A F;  4KHZ A;  2YU9 H;  4L8J A;  1SND A;  1VQA A;  4R4I A;  1CZG A;  5AJ3 L;  4GNX B;  1RIP A;  1Y1W B;  4IFD J;  5COR A;  5BN4 A;  2G5D A;  1KLG D;  2H4O A;  3J81 c;  1CT1 D;  4LF6 L;  1X3E A;  3GDE A;  2JA7 H;  2KHJ A;  1EYG A;  1X9N A;  1YHQ A;  4FXG C;  2JN4 A;  1VQ5 A;  4MN3 A;  1BCP C;  2EOT A;  3TDQ A;  4ME3 A;  5CV5 A;  1E1O A;  2E2H H;  3EQL C;  2R3Z A;  1BQQ T;  3P75 A;  4CDE C;  4BXX H;  3PUX A;  5I9O A;  1CK1 A;  4KKS A;  1X3G A;  2NVX B;  3HP3 A;  2ZTE A;  5IP9 G;  4P73 A;  1PYS B;  1E1T A;  3KK7 A;  3PMF A;  4YWL A;  5KYI A;  3J81 E;  5E7N A;  3H15 A;  3I70 A;  3DHQ A;  2YU9 B;  1QVG A;  2VUM G;  1V1O A;  3HOV B;  2F0M A;  1G51 A;  1EQV A;  4IJL A;  5M3F B;  1EIY B;  4A3G H;  1QB5 D;  5D3I B;  3GQB A;  1FGB D;  4RHS A;  3H0G H;  3ZJY C;  2JA7 B;  1EY9 A;  1STA A;  1TWF H;  4X66 Q;  1HRJ A;  1QIL A;  3N6R A;  3DWA A;  1OTC A;  1BKB A;  4CJ0 B;  4DXF A;  2UUC L;  1CFM A;  2NVT B;  1HR0 L;  4DV2 Q;  2HCI A;  3EFX D;  4AQY L;  4B3S Q;  3EN2 A;  4ZRZ A;  4DV2 L;  2C5C A;  4YWM A;  1PH8 A;  1ML0 D;  5D3D A;  3S15 H;  3K7A H;  4KKU A;  2SNM A;  4A3M H;  1UAP A;  3NHH A;  1VQG A;  2JA9 A;  2UUA Q;  2PYK A;  2Z0S A;  3SK6 A;  2UXC Q;  4DA2 A;  2ICE C;  5C5L A;  4DAY A;  1QCB D;  2K6A A;  4GN3 B;  2FHT A;  2KCC A;  3H0G B;  3HS0 C;  2IX0 A;  5I2Y A;  5C4X B;  4JI5 Q;  1MJC A;  1TWF B;  1BBX C;  1I3Q H;  4JI5 L;  4A76 A;  2B29 A;  4A75 A;  4JW0 A;  3GV6 A;  1F2L A;  2R61 A;  1PH6 A;  3K5L A;  2VQE L;  2JA5 G;  4A3B B;  3CW2 C;  4DV4 L;  1RDP D;  4OL7 A;  4LF5 L;  1TWH H;  2RCN A;  5DM6 3;  3V2T A;  2L5T A;  1YNJ C;  1TT2 A;  3E3X A;  4GOP C;  1T5X D;  4PNY A;  5IYB H;  2B8G A;  2Q8T A;  3S15 B;  4XQQ A;  3D8G A;  1Y14 B;  4A3M B;  3ER0 A;  1Q46 A;  4P74 A;  2XRQ D;  2M9V A;  1GUN A;  1EIG A;  4NDX A;  1GUG A;  3CP0 A;  2NTS A;  2F0E A;  2MUY A;  3FP9 A;  4RGM A;  2VQF L;  1D2B A;  1J8I A;  4C3I H;  1NR2 A;  3KJO A;  4HJ8 A;  2FXQ A;  2PO4 A;  1PZK D;  2EXZ A;  3U58 A;  5JEA G;  3EIV A;  4BBS H;  3N52 A;  1H9K A;  3W1G A;  1X55 A;  3PV0 A;  1LV9 A;  4ULL A;  4ZQ3 A;  3NQI A;  3HOY G;  1Y69 U;  1MJE A;  4F7X A;  1II3 A;  2LFN A;  4R4T A;  1X32 A;  1YNJ D;  1SYG A;  5JPN C;  4Y52 H;  1HZB A;  1XNR L;  1VQ4 A;  4U68 A;  1EY7 A;  4PMC A;  4DV7 L;  4HIO A;  3K7U C;  1N32 L;  1KDB A;  3Q24 A;  2Y0S E;  2ZTD A;  1KDC A;  5IYD G;  3J80 i;  2CQA A;  4IUT A;  1L0W A;  2ZM6 L;  1IL2 A;  3TP5 A;  3LWE A;  3BJU A;  4JBK A;  4HR7 B;  1NMF A;  1CQV A;  3E0E A;  3HEJ A;  4C3I B;  4OIK A;  1R4Q B;  1SE8 A;  5BR8 Q;  3ND8 A;  4QQB X;  3CME A;  1M1K C;  4BBS B;  4G7H C;  4X3T A;  1WTQ A;  3NTH A;  4EX5 A;  1AH9 A;  2Y0S G;  3I7F A;  4BWG B;  3MA2 B;  4JI2 L;  4XIG S;  3T13 A;  1PRT F;  4A3L G;  1EZ6 A;  4A3C H;  3PUV A;  4DUZ L;  4CDC C;  3RN2 A;  1XMQ Q;  2Z4I A;  4ABN A;  5ELB A;  4ODG A;  1D7Q A;  1NNX A;  4XYO A;  1XYI A;  2B8F A;  1I4G A;  3S17 H;  4JI4 L;  2K03 A;  2KHS A;  1SE3 A;  5FO9 B;  4LF8 Q;  1IKM A;  3A54 A;  4GS3 A;  4HJ7 A;  1PYB A;  1I4R A;  4KHP L;  3GTL H;  4EGV A;  3S2H H;  3S14 B;  1VQK A;  2XVS A;  1G2T A;  4OO1 I;  2F0S A;  1X65 A;  1YJ9 A;  1STG A;  3BZC A;  3IFT A;  2N8N A;  4NXN L;  4I65 A;  1HNW Q;  4R4O A;  2IY5 B;  3RN5 A;  1FVI A;  1XXG A;  2FJ2 A;  2RQX A;  3PO3 G;  3R93 A;  2K32 A;  1JMC A;  4HN7 A;  1Y8P B;  2D0O A;  3G4S A;  3AYH B;  3H3V H;  3A55 A;  4K2K A;  5IP9 H;  3RUZ A;  1UE7 A;  3OW2 A;  3CPW A;  2CVR A;  2I5M X;  1STN A;  1K3B C;  2PMZ B;  4YY3 Q;  1Q7Y C;  4JI1 L;  1NTG A;  4LW1 A;  2OTJ A;  4DR6 Q;  4X62 L;  4A3K G;  3E6Z X;  3I4L A;  2VUM H;  4DR6 L;  4PQX A;  3J7Y W;  4NP5 A;  3MEH A;  3SEB A;  3PF4 A;  1B44 D;  2F4V Q;  4HJ9 A;  4QY7 A;  1SYF A;  4ZK9 B;  3GTL B;  3S2H B;  1KL9 A;  2HHH Q;  4JI6 Q;  2EPB A;  1X56 A;  2CH4 A;  1W6J A;  3HG9 A;  4TKO B;  3BDC A;  2JK8 A;  4EQP A;  4X3K A;  3G6E A;  4ZKB B;  5CV7 A;  1YJW A;  3IKJ A;  1GM5 A;  2I5H A;  3TN2 A;  3T1Y L;  4GLX A;  1HQR D;  2MP1 A;  5I9P A;  1STB A;  2A1A A;  2ID0 A;  3ONA B;  2ICI A;  4A3F G;  1BCP F;  2VUM B;  2EJM A;  1S4Z A;  4X3U A;  1X54 A;  1JOO A;  3A56 A;  1I4P A;  3MEF A;  2E8G A;  1R9T H;  2Z6K C;  3ERO A;  1LTL A;  3H6M A;  1A3U A;  4Q0F A;  4HED A;  1D5X C;  3MXG A;  2JA5 H;  1XX8 A;  4FF4 A;  4L5R C;  1MBY A;  3LX0 A;  3PGZ A;  5C3X A;  1A63 A;  3I2Z A;  4LFC Q;  1PHJ A;  1TWG B;  1QOH A;  4QL5 A;  2KBN A;  3HOV G;  3KOJ A;  5M3F G;  4LFA Q;  3MAQ A;  4DR7 Q;  4LUO A;  2K5D A;  1LLR D;  1SR3 A;  3NBH B;  5IT9 c;  3FKI G;  4DR2 L;  3HKS A;  4AYB E;  2K14 A;  1SEB D;  1QNU A;  5A2Q L;  2CCZ A;  1R9T B;  2Q8R E;  3OTO L;  1IL8 A;  4DV3 Q;  4DR4 Q;  4WJ4 A;  1B1Z A;  5JEA H;  1YNN C;  1ROD A;  2UXD L;  1IBK L;  2Z1C A;  3DWP A;  2BA0 A;  4ZYS A;  2VNU D;  4DV5 Q;  4JCV E;  3CAM A;  4K5X A;  1FNV A;  4N9T A;  3HOY H;  2UU9 L;  4KLK A;  4DGZ A;  4DV5 L;  2QW7 A;  4EVO A;  2QEJ C;  2OWO A;  4LF9 L;  4FDB A;  5DEH A;  5IT9 E;  4RG1 A;  3OYY A;  1FGU A;  4AYB G;  3IAY A;  4N8X 1;  3AQQ A;  4X65 L;  4C3J B;  1KD1 C;  4DV6 L;  3FPP A;  4BS9 A;  1IBM L;  2DNE A;  4NW2 A;  4I7Z C;  5IYD H;  4RFB A;  3M3Y H;  4OX9 Q;  1N36 Q;  3TQY A;  1JWM D;  2J0T D;  5IYC G;  5IIF A;  5C4X G;  2XIW A;  1VQI A;  3I91 A;  5KND A;  2B2T C;  2DNC A;  1YNN D;  1E3P A;  2F0F A;  1KLU D;  5F2D A;  4A3B G;  4OO1 G;  4B9X A;  1CKN A;  3H94 A;  5FLM G;  3QB3 A;  4P72 A;  3H3V I;  3HOY B;  3TME A;  3OWE B;  2K1B A;  1GKH A;  2HIV A;  5G3L F;  1KNA A;  4A3L H;  2L12 A;  2F0U A;  3EA6 A;  2VZA A;  3RMH A;  3CCE A;  2EYP A;  2GVB A;  4HSP A;  4A3I G;  5JJK A;  1OXS C;  2K28 A;  2LXJ A;  5CMD A;  2OQK A;  2RA4 A;  4ILW A;  1S72 A;  1EFW A;  2B2Y C;  3K57 A;  3GTO H;  3A5Z B;  1SFO B;  4POG A;  3CU7 A;  2X69 A;  3M3Y B;  4PZ7 A;  3OMC A;  3BYT B;  1SN8 A;  2XGT A;  4IPD A;  1CSQ A;  3BDO A;  5C4Z A;  2DGY A;  2NYZ D;  2Z6K A;  1SYE A;  4X64 L;  3A7A B;  1EY6 A;  2K01 A;  2PW5 A;  4WRD A;  1CUK A;  2K7V A;  3KDF A;  2LMC B;  2Y0S B;  1Y1V G;  2K4K A;  3K0Y A;  2QGQ A;  3KYH C;  3PO3 H;  1I4H A;  4WOR A;  1N34 Q;  3AFQ A;  2TSS A;  3SE0 A;  3K5M A;  1N34 L;  3R2T A;  3DLL A;  1HZC A;  5EQ0 A;  4R9W A;  1PRT C;  1L1O B;  3D6C A;  2VB2 X;  4ZLT F;  1HPC A;  3GTO B;  4IJH A;  1S5F D;  2PI2 A;  2KEN A;  2L55 A;  4QF4 A;  4JYA Q;  2D62 A;  4A3K H;  2EXD A;  2KCM A;  2BDO A;  3A5U A;  1HXY D;  4DK1 A;  3PIO 3;  3KF8 A;  5JVH 3;  2IJ0 A;  3S24 A;  2WFW A;  3M9B A;  3OW7 A;  1X3F A;  1U4L A;  1LT4 D;  2MJ8 A;  2PZW A;  2EQS A;  1K28 A;  3BG3 A;  3D0F A;  3F8T A;  5C0X J;  3OOC A;  2L1B A;  4F87 A;  2WP8 J;  4IZ8 A;  3RLO A;  1A15 A;  4L5T A;  2F3W A;  2K50 A;  1SMX A;  2SNS A;  5EKK A;  5LMN L;  2PZT A;  2BDN A;  4IN3 A;  1B9M A;  3BU2 A;  1D1K A;  4O0A A;  2F0N A;  5H1S E;  3TP6 A;  3WWV A;  1PRT D;  4XQN A;  2F0O A;  4OGQ C;  4RGO S;  4GKJ L;  2N3S A;  5LHY 1;  2AWO A;  2VB3 X;  2IX1 A;  1QJO A;  2WKD A;  2K04 A;  5GAH C;  4L5S A;  2K33 A;  2F03 A;  4A3K B;  4A3F H;  2PMZ E;  1VF7 A;  4JV5 L;  3R8B A;  3T51 B;  4BA1 I;  4HIK A;  1BVS A;  5D65 A;  2F0T A;  4DR3 L;  3AB9 A;  2PNH A;  1BBU A;  1KRS A;  3R3O A;  4HMI A;  1JOR A;  3JAM L;  3NXW A;  5E3F A;  3VYT A;  1E0B A;  3QO2 A;  2WAQ E;  2VY3 A;  3CQZ B;  3D6W A;  2A8V A;  3MXU A;  3VR3 A;  3CCM A;  3PUZ A;  2QIL A;  5IWA Q;  1KAA A;  1VF5 C;  1EY4 A;  3ND9 A;  1LO5 D;  2B2U A;  2V1C C;  3T56 B;  4BY7 B;  3CRL C;  1K73 C;  2K5Q A;  1KC8 C;  1DD2 A;  1MSH A;  2B2Y A;  3KLR A;  3NSW A;  3ULP A;  1SNQ A;  3CCL A;  2O4X A;  3NEL A;  4JC0 A;  4OIJ A;  1PH1 A;  4RKB A;  3WOE A;  2CHB D;  3HOV H;  5M3F H;  1UE6 A;  2WAQ G;  4DKA C;  4LAA A;  4MHE A;  4CKC A;  3FKI H;  2E5L Q;  5BN3 A;  1W6K A;  4A3F B;  1SNC A;  4RCN A;  4X6A H;  1OXV A;  1QVC A;  1B3A A;  2KVM A;  4QUC A;  5ELD A;  3VR2 A;  2EDG A;  4LK1 C;  3UDG A;  3RR5 A;  3C46 A;  1FR3 A;  3EBE A;  2NVT H;  3EJI A;  4KKT A;  3WDN A;  3HOX B;  2B2V A;  1I50 H;  3GTP H;  2VS1 A;  4A3E G;  3GV3 A;  5JEA J;  2E2I H;  4KY7 A;  1F2Z A;  2IWH A;  4GLA C;  1WTR A;  1A3V A;  3MWY W;  4KN4 C;  1XTC D;  4XT3 B;  1IYV A;  5EBC A;  4RCO A;  2C35 B;  3PF5 A;  1NR4 A;  3TP7 A;  3NWS A;  1YI2 A;  4PG3 A;  3NEM A;  3C1E A;  3J7Z C;  1BXT A;  5IOC A;  2R7D A;  1VMP A;  3P20 A;  1PRT B;  2F0W A;  4Z9C B;  2B2W A;  3FKI B;  2RKS A;  5C0X G;  1DOL A;  3MC0 B;  2R6G A;  2PQA A;  4CDF C;  5IYC H;  5C4X H;  1XTD A;  1OO9 B;  2RF4 A;  5J1Z A;  1OXX K;  4FVM A;  1BCP D;  1JWU D;  1PV4 A;  3QR8 A;  4X66 L;  1PVO A;  1IW7 C;  1GOZ A;  3U9O A;  5HUR A;  4ZCK A;  2NVQ H;  4A3B H;  4OO1 H;  5C3W A;  3MZ5 A;  1JOQ A;  5FLM H;  4O42 A;  1I50 B;  3GTP B;  5IGG A;  1CTM A;  3E5S A;  2QA4 A;  4OON A;  2JA6 G;  2E2I B;  4HCS A;  1AEX A;  1MD2 D;  3UDF A;  4OEM B;  2QEX A;  2LXK A;  4B3S L;  4AYB B;  1AN8 A;  1G6P A;  3Q8D A;  4A3I H;  1A3T A;  1Q1B A;  1Z6H A;  1Q8K A;  3ULJ A;  2UUA L;  3UDI A;  1Z9F A;  3FPU B;  1D8L A;  1YJN A;  1K9M C;  4RAU C;  4HJ5 A;  2UXC L;  1VQJ A;  3HFZ B;  2F0H A;  1I4Q A;  4NB3 A;  5BN5 A;  2JJQ A;  1SSO A;  2QF7 A;  1LTG D;  1CM9 A;  2LSS A;  1CI3 M;  1L0Y B;  2G9D A;  4ID6 A;  1DXM A;  1IW7 D;  4A3D B;  2MGS A;  1LTB D;  2GA4 B;  2NVQ B;  1Z7T A;  1HUN A;  1DYQ A;  3I4O A;  2XSC A;  3M7N A;  4OXP A;  3T53 B;  3GTG H;  3BZK A;  3NUC A;  1LUZ A;  1SMY C;  1ET6 A;  4H44 C;  2A6E C;  4LUV A;  1EOT A;  1Y1V H;  2F0P A;  5IP7 G;  3W5O A;  4B3R Q;  1SJE D;  1KAB A;  1KNE A;  4C3J G;  1LAC A;  1Q8I A;  3I4N G;  3TZU A;  1I4X A;  1GHJ A;  4A3I B;  1EY0 A;  3UDX A;  2R7Z B;  5NUC A;  1XMO Q;  4B3T Q;  1UUP A;  3RZO B;  3W2D A;  4UDU C;  3G6J B;  4K0K Q;  1ILP A;  1VQL A;  1U5K A;  1PH4 A;  4F88 A;  1YIT A;  4RWS C;  2YTV A;  4DV1 Q;  5C3E B;  4P71 A;  1A62 A;  4DV1 L;  4E6I A;  1M8A A;  4A3J B;  2FFK B;  1IBL Q;  1BDO A;  2MHV A;  2ENB A;  1BCP B;  2HD3 A;  1SMY D;  3S1N B;  3GTG B;  2A6E D;  2E2D C;  1NMG A;  1Y1V B;  3E0J A;  5GQO A;  4ALP A;  4K6L A;  1XJV A;  2PW7 A;  5G3L D;  2ZXO A;  4IPG A;  4EQ5 A;  4FXD A;  4N8F A;  1KDA A;  1DOK A;  3MXP A;  2F0D A;  3G7L A;  2B39 A;  1QVF A;  1BBW A;  5JJL A;  2F0G A;  1TS4 A;  1TR5 A;  2L4N A;  5KYL A;  3OHX C;  3I72 A;  1RKN A;  1XNQ Q;  2BOS A;  5GRO A;  1F77 A;  4MTN A;  2DJF C;  3CC4 A;  2V4D A;  1N33 Q;  4HMJ A;  1BR9 A;  1P8L A;  1VQO A;  2A69 C;  3S14 H;  1VDZ A;  4H0L C;  5BR8 L;  1SE4 A;  1KTK A;  3CKI B;  1SDF A;  3C1F A;  4QB4 A;  1PLF A;  2K5H A;  5EKI A;  3TS0 A;  5IE8 A;  1EY5 A;  3AEV A;  2D2C C;  1TWA B;  2UXB Q;  4QJF A;  1U0L A;  1JE5 A;  1T9H A;  4XYQ A;  1NBW A;  4PMW A;  1BF4 A;  1F2M A;  4DAM A;  1XMQ L;  2HQE A;  4CKB A;  3OIQ A;  5GAD C;  1J5E Q;  4EQO A;  4K5W A;  4JI8 Q;  1J5E L;  4IO9 A;  1QZG A;  1PH5 A;  3DXJ C;  2OF1 A;  4RHR A;  2RDH A;  1M4V A;  1EFI D;  1JE4 A;  4RGN A;  2A69 D;  1H9S B;  3TRE A;  4LF8 L;  1EYA A;  2NUC A;  4DUY Q;  1HR0 W;  1ICF B;  1VQM A;  1TY0 A;  2B63 G;  1HFN A;  4DUY L;  1N8R C;  5IGD A;  2N78 A;  3P7J A;  4DNI A;  1HNW L;  1LAB A;  1H9J A;  2AUK A;  1U4P A;  2MPM A;  4KTA A;  3DUZ A;  3MFY A;  3E9I A;  1HJP A;  5K5P A;  4JI7 Q;  1PTO C;  1GHK A;  4A3E H;  1HHV A;  2J7Z A;  4U67 3;  1E7Z A;  4JI7 L;  4LFB Q;  2SDF A;  1Q12 A;  4YIJ A;  5I2X A;  1Q90 A;  5HY6 A;  3CHB D;  5M5W B;  1TII D;  1JR0 D;  2MQH A;  2NVY H;  4LFB L;  3ITP A;  3K59 A;  2PQE A;  4GOP B;  2HCC A;  4DNT B;  4YY3 L;  2D5D A;  3U9S A;  4XTC S;  1UEA B;  1E2W A;  4KY5 A;  3PSI A;  1VQC A;  4UAI A;  2P5Z X;  2WAQ B;  4FF1 A;  3HOW B;  1FD7 D;  5FKA C;  2WAC A;  5C0X H;  1DON A;  2F4V L;  3U50 C;  1GUS A;  4IUN A;  3CCJ A;  2IL8 A;  3QOL A;  1HA5 A;  3CC7 A;  3EVQ A;  1U4M A;  1HNZ Q;  4TSS A;  5CV6 A;  3GTM H;  1A0I A;  1BO0 A;  2HHH L;  4JI6 L;  5J39 A;  5HGQ A;  2CQO A;  1Z47 A;  1HNZ L;  4NPS A;  1X6O A;  4LWC A;  1WI5 A;  4BY7 G;  1PTO D;  2KEC A;  2J4X A;  3CC2 A;  4A3E B;  1B8A A;  2JA6 H;  3PO2 G;  2RDF A;  2EYM A;  2X6G A;  3PIO A;  1TWG H;  5JJI A;  3D4D A;  2A68 C;  2AQ2 B;  3DEP A;  2JP1 A;  2NVY B;  1Q81 C;  4B08 A;  2OTL A;  5IGF A;  4GLV B;  5FO7 B;  4OWT B;  1EWH A;  1K8M A;  1KIX A;  4HTH A;  1SYB A;  3G71 A;  3MHB A;  1WOC A;  3H09 A;  2I46 A;  3LNN A;  2ATW A;  3S1M B;  1GVP A;  2L9H A;  4NXM Q;  3URY A;  2MO1 A;  1R4P B;  1SRU A;  1XPO A;  1U9R A;  3BVZ A;  4KD3 A;  4FNF A;  4IUV A;  3UI2 A;  3ICE A;  3PQI A;  3FRP B;  3HOX G;  5I4D A;  4DU9 A;  3GTM B;  1EIH A;  5LL6 S;  3GTJ B;  5M5X H;  1HTP A;  1CA5 A;  2KA7 A;  1STY A;  5E4X A;  3RLN A;  3J81 i;  2ES2 A;  1PFB A;  1FJG Q;  5CR3 A;  4GZY C;  3BS1 A;  2JA6 B;  1YHB A;  1A6X A;  2UUB Q;  2QDB A;  2I5L X;  5IP7 H;  1Q3L A;  3K8A A;  4WJW A;  1B7Y B;  4L5Q A;  4C3J H;  1EYC A;  5LL6 X;  4IUQ A;  4LFC L;  3D4W A;  3I4N H;  2VL6 A;  1LTS D;  2AUJ D;  2L11 A;  1RTN A;  3T1H Q;  3GTQ H;  4NMZ A;  1V1P A;  2K75 A;  2QKI C;  2XWB B;  1E22 A;  4LFA L;  4DR7 L;  1HFG A;  1EEF D;  4LF7 Q;  2EJF C;  4CHT B;  5C5M A;  3I8Z A;  2EYF A;  1PH3 A;  2N49 A;  2F3V A;  5EJW A;  3G48 A;  3BVM A;  3CPF A;  4DV3 L;  4DR4 L;  1VQB A;  1GO3 E;  1K83 B;  5M5X B;  1GUW A;  2EY6 A;  1XPR A;  5KRU A;  1VQ7 A;  4LMQ D;  2N88 A;  3PIP 3;  4A4I A;  1O7L A;  2JA8 G;  1V1Q A;  1LTR D;  3RNU A;  4KD4 A;  3TSS A;  1CHP D;  3QOJ A;  3RD4 A;  4C3H B;  3S16 H;  1I94 Q;  3FMC A;  4G7O C;  2HDL A;  1WD0 A;  4C2M H;  2F1M A;  3FVQ A;  1YEZ A;  2HT1 A;  5FJ8 G;  1I94 L;  3I4N B;  3F2C A;  1SFO H;  5HGT A;  1K8O A;  4JVZ A;  3A8K E;  1DCZ A;  4TRD A;  3GTQ B;  1WTH A;  3L9A X;  2KCN A;  1PDQ A;  5KNB A;  4IOC A;  4FYD A;  3K0X A;  4OX9 L;  1LT6 D;  3H91 A;  5ELE A;  4DV0 Q;  1N36 L;  3QJY A;  1EL0 A;  1F2Y A;  2L0C A;  4POF A;  3I55 A;  1ASZ A;  5FLX L;  2L15 A;  4A3D G;  1D5Z C;  5TSS A;  3OMG A;  4DK0 A;  1VQD A;  1DOM A;  4PZ8 A;  5KIX A;  3GTK B;  1SXT A;  3NTI A;  1WJJ A;  2HDM A;  5M9O A;  4JI3 Q;  3MVV A;  4RKL A;  1VQF A;  2FIN B;  2Z9H A;  1TS2 A;  4XDX A;  1CSP A;  1ZKO A;  1CKN B;  3NWT A;  1SE2 A;  2B2U C;  5DLQ E;  4K8I A;  3NTK A;  2GN5 A;  4BBR B;  3S16 B;  3W1B A;  2KEE A;  2R7Z G;  1D5M C;  2NZH A;  3TS2 A;  4C2M B;  2JXM B;  2PCF B;  1TWC H;  4YWK A;  2MFI A;  4HAE A;  5JVG 3;  2KQ3 A;  5CBE E;  1Y8O B;  5C0X I;  3L0O A;  3Q0A A;  1X3P A;  1I6H B;  3A8J E;  4DAV A;  4JI0 Q;  4B9W A;  5EPL A;  5C3E G;  2AHO B;  2BCO A;  5GAG C;  3PUY A;  3X3N A;  4JI0 L;  2F3I A;  4KJN A;  1HQM C;  4IQZ A;  4A3J G;  3M4Q A;  4C1N K;  2EE1 A;  1YBY A;  1MHW C;  5C44 B;  3TRZ A;  1LM0 A;  5CV8 A;  4XXE A;  2B63 H;  2B2V C;  2X6L A;  2E2J B;  3STB C;  3DEO A;  2AQ3 B;  3D3R A;  4FP5 D;  4C1N I;  2IX3 A;  1HNX Q;  3GP7 A;  5T1G A;  5JPM C;  4AH6 A;  3KDF B;  1RHP A;  1HNX L;  3I3C A;  1BNZ A;  1B9N A;  4H02 A;  2KJX A;  1TWC B;  4CJ2 C;  4R8I A;  2C9O A;  1VQP A;  3BYY B;  3L7Z C;  4KMU C;  3VA7 A;  2TMP A;  1FNW A;  4G7Z C;  2WKC A;  3MXN A;  4CJ1 B;  1L1O A;  4JYA L;  3KLS X;  2B2W C;  3I90 A;  2ZTC A;  3SK4 A;  3K80 C;  1PH2 A;  1SNO A;  3TP8 A;  3KBX A;  5A2Q E;  4DR5 Q;  2I0Q A;  3CQZ H;  3W3A A;  1B50 A;  5M3M G;  3KF8 B;  2B63 B;  4YHH Q;  2DJG C;  4GKK Q;  1O80 A;  4A93 G;  1Q82 C;  4BY7 H;  1TVX A;  4H13 C;  1P16 A;  3FDT A;  4J1M A;  5FLX c;  3PO2 H;  1ENC A;  1UE5 A;  3IFD A;  3KUP A;  1D1I A;  3PCO B;  4KI0 A;  4ZUI A;  3HOZ B;  1H95 A;  4PZ6 A;  4JG2 A;  2OQ0 A;  3ULL A;  4IPH A;  3QIA A;  2NBF A;  1W3S A;  2ZT9 C;  4QUF A;  3M4Y A;  3VYR A;  3A8I E;  4BY1 G;  1YZ6 A;  1PTO F;  1JC7 A;  1QUQ A;  2E75 C;  1LTA D;  4LUZ A;  4LF4 Q;  4J6H A;  2NN6 G;  3HOX H;  1DZ1 A;  1CKM A;  4LF4 L;  3TBI B;  1UWV A;  2I07 B;  3KLW A;  4QIW E;  5IWA L;  2OT2 A;  2LKV A;  1MI2 A;  3M4O B;  3U4Z A;  3PO2 B;  2SEB D;  4HID A;  5T1I A;  2R92 B;  4UP7 A;  1F9P A;  1C0A A;  3NP8 A;  3S1R H;  1ONL A;  4DN4 M;  2O2L D;  2EYO A;  1XPU A;  1OXT A;  1PZJ D;  1EY8 A;  3KF6 A;  4S3S A;  5CBA E;  5KNC A;  1V9P A;  1WTW A;  3HOW G;  1EUJ A;  1YHA A;  3HOU B;  3FEW X;  2E74 C;  4GNX A;  2Q2T A;  3K58 A;  2E5L L;  1S5B D;  4FF3 A;  1AFP A;  3BVG A;  1GJX A;  1EWC A;  1C4Q A;  3ZYY X;  5EGT A;  5AJ3 Q;  2NTT A;  1WCM G;  3SR1 A;  4CGY B;  1HA6 A;  3A0J A;  2EY2 A;  4LF6 Q;  1ZXT A;  1CQF A;  2CH4 W;  3A7L A;  5CV4 A;  4RGT A;  2NWG A;  3Q6S A;  1WTP A;  3DWQ A;  2JA8 H;  2PPB C;  3RZD B;  5ELF A;  5IGB A;  1AE2 A;  3DM1 A;  3S1R B;  3VR4 A;  5L37 A;  1TY2 A;  4UHV A;  3NPP A;  4KK7 A;  5FJ8 H;  2CKZ B;  3VYU A;  1NSN S;  3SDZ A;  3NK9 A;  3T16 A;  4Y7N H;  1CKO A;  3KBG A;  1S5D D;  2CWA A;  2WV6 D;  2IT1 A;  3K5N A;  1ZEQ X;  2RSO A;  2VW9 A;  4TVA B;  4P2C B;  3SK8 A;  3SVM A;  4A3D H;  1LT5 D;  5KEE A;  2PQA B;  2F0V A;  4B3M Q;  1NCV A;  1J6Q A;  5IY0 A;  1V43 A;  1GXD C;  4B3M L;  2A19 A;  1TS3 A;  4K6D A;  2A5H A;  1RL2 A;  1JJG A;  4G4K A;  3SXH A;  2JA8 B;  2A73 B;  1HH2 P;  2FMM A;  2PZU A;  2R93 G;  1VQH A;  4XT1 B;  1ZYR C;  2UUC Q;  3JAM c;  1WD1 A;  1FL0 A;  2R7Z H;  1JOK A;  1C9O A;  1HR0 Q;  1IHZ A;  3VR5 A;  3RZO H;  3S1Q H;  2E2H B;  2OCE A;  4AQY Q;  1JJ2 A;  3CD6 A;  2ASB A;  3GO5 A;  4Y7N B;  3VYS A;  2KHI A;  1Y8N B;  4DPG A;  1I5F A;  1K0S A;  1GUO A;  4YCU A;  4DAY B;  3F2D A; 
#chains in the Genus database with same CATH homology
 1JCK B;  4M1U B;  3JAM E;  2JE6 I;  3R2I A;  3M85 A;  3AMU A;  2RVL A;  5E1F A;  4A3G B;  3HZX A;  4C3H G;  1RTO A;  1FYC A;  2EY5 A;  3F2U A;  1HUM A;  1C48 A;  1ZYR D;  3P1H A;  1STE A;  2K05 A;  3WOF A;  1S5C D;  5K36 G;  3S1Q B;  3CRK C;  1ESR A;  1NAP A;  1RJT A;  2FMC A;  4IFD G;  1F9S A;  4IUU A;  4PMB A;  5COY A;  3MTS A;  2IPK D;  3K7A B;  1PZI D;  4L6T B;  2WIN B;  4JBW A;  3TZD A;  1HTL D;  1JIC A;  1RF2 D;  1B4O A;  1I3Q B;  3T4A C;  1G91 A;  1UNS A;  5CYU A;  1IKL A;  1CZW A;  1LT3 D;  5EPJ A;  2BA1 A;  3H3V C;  5DAU A;  1RD9 D;  1PFM A;  1TWH B;  4O1N A;  4BA2 I;  1G2S A;  1DM0 B;  1ILQ A;  1EU4 A;  4IAL A;  1O7Z A;  4TQU S;  3D31 A;  5M3M B;  2NN6 H;  3X3M A;  2M00 A;  4A93 B;  1EQT A;  1MSG A;  4C56 C;  1D6E C;  1PXU A;  5EBD A;  2XWJ B;  4EQN A;  1ICW A;  5EKL A;  5C6A A;  2RBM A;  3ERQ A;  1L0X B;  4KN7 C;  1TQO A;  2O5I C;  4K8J A;  1WTO A;  1JQY D;  5AFW A;  4XQJ A;  2YYZ A;  5ISR A;  4BY1 B;  2KOL A;  1H9S A;  1SJH D;  2IW3 A;  3HKZ B;  2EJG C;  4WFN 3;  1G8Z D;  2AWN A;  4QMG A;  1J9O A;  5CC4 A;  2LS0 1;  3J7A V;  1SAP A;  1SNM A;  4CBV A;  2SOB A;  5D14 A;  1DJR D;  3S2D B;  1WTX A;  5IT9 L;  4DF7 A;  4FF2 A;  4V19 0;  4JK1 C;  3QG1 A;  5M5Y B;  4QIW B;  4K5V A;  2BE5 C;  1WCM B;  2A6H C;  1OXU A;  3S17 B;  3NBI A;  4MIU A;  4R8N A;  2EYH A;  3SHL A;  1EU3 A;  1E2V A;  1B2T A;  3L3O C;  1AZP A;  2CW0 C;  5FOB B;  2M2L A;  5E4W C;  4OHJ A;  5CV9 A;  5ELC A;  1RCV D;  4N9P A;  1GUT A;  2O5J C;  1TKW B;  3O13 A;  1LTI D;  4Q5V A;  4K14 A;  1TS5 A;  1H9R A;  4HCE A;  1X3Q A;  5C4H A;  1JB3 A;  2BE5 D;  3KLS A;  1SYD A;  2A6H D;  3J80 L;  1I6V C;  3C2P A;  4QCL A;  1VCI A;  4KV6 A;  1LTT D;  5C4J B;  5I6Y A;  4K2L A;  3C3L A;  2A68 D;  3Q22 A;  3NQT A;  3OWF A;  1PTO H;  2CW0 D;  1S5E D;  2F0L A;  3VR6 A;  1WVL A;  2R93 B;  1QNK A;  4KHV A;  1BOS A;  5K36 H;  2EYJ A;  4ZAI A;  1AP0 A;  4IFD H;  3SK5 A;  1PFN A;  1STH A;  5DNF A;  1BUV T;  2Z8L A;  1V1P B;  3NBH A;  1G6Z A;  1U4R A;  2NN6 I;  3HGB A;  4IUR A;  5FK9 C;  4FXK C;  1AW7 A;  5IGE A;  1QWY A;  2F0J A;  2LY7 A;  2EVB A;  2JYO A;  2H1E A;  5JOB A;  5JAV A;  2F0I A;  5I6W A;  5IGC A;  3QWN A;  4PV1 C;  1IYU A;  2WII B;  2EY1 A;  1PTO B;  2EZV A;  5KGU A;  4KY6 A;  2E76 C;  1EYD A;  2F4I A;  1PMR A;  2JA5 B;  1O78 A;  2VXW A;  4H7B A;  1C8C A;  1Q1E A;  3I4M B;  3BDL A;  3OSO A;  1V8Q A;  5FO8 B;  4HSV A;  2XN9 C;  4RH6 A;  3LWU A;  2HUG A;  1HCZ A;  4X3S A;  2G9H D;  2OXP A;  1AZQ A;  1MGS A;  2Z4H A;  4NKL A;  1O7Y A;  1E2Z A;  2RDG A;  1EZ8 A;  3AU7 A;  3HRZ C;  3I73 A;  4FO2 A;  2ZXP A;  2NB0 A;  2PNR C;  2XRS D;  2XNA C;  4ZUJ A;  1ET9 A;  2KUM A;  1T5E A;  3OPO A;  4V0B A;  1CA6 A;  5IOD A;  3J80 E;  3Q23 A;  4DXG A;  5A35 A;  2F0Q A;  2K5W A;  3IL8 A;  4RA8 A;  3V96 A;  2RSN A;  1CHQ D;  4KJO A;  1PYW D;  4DFA A;  2DY7 A;  1QE6 A;  4G57 A;  3J81 L;  3RLF A;  4LJZ C;  5EPK A;  3S9W A;  2EYL A;  1SYC A;  2AQ1 B;  4IUP A;  5DM7 3;  1WTV A;  1EEI D;  2JEB I;  2DY8 A;  4C3I G;  1XWE A;  3M7G A;  1A2U A;  2NZ1 D;  1H9M A;  3NE5 B;  1A2T A;  3VA5 A;  3DMU A;  4IFD I;  3GD7 A;  5J22 A;  1SBB B;  3PUW A;  1NUC A;  3PO3 B;  1ESF A;  2Q8I B;  2QCP X;  1G29 1;  1FNU A;  2N55 A;  1F9R A;  1VMC A;  3BZD B;  5CGK A;  2DN8 A;  4DNR B;  5JJZ A;  2ZXR A;  1F9Q A;  2WB1 B;  2KED A;  4CKE A;  2D9U A;  4F8M A;  1QG7 A;  3V05 A;  5FLX E;  2F0K A;  3D4R A;  1JWS D;  2B2T A;  4L63 B;  2JSO A;  1ENF A;  1SNP A;  4ME5 A;  4DAP A;  3K5O A;  3MFG A;  4ZKC B;  1ENA A;  2OEO A;  2A74 C;  3OIP A;  1TU2 B;  1B53 A;  4J8Q A;  4M8A A;  3K6O A;  2JEA I;  3J7A F;  4KHZ A;  4L8J A;  1SND A;  1CZG A;  4IFD J;  1Y1W B;  5COR A;  5BN4 A;  1KLG D;  2H4O A;  1CT1 D;  4FXG C;  4MN3 A;  1BCP C;  2EOT A;  3TDQ A;  5CV5 A;  3EQL C;  2R3Z A;  1BQQ T;  3P75 A;  3PUX A;  5I9O A;  1CK1 A;  4KKS A;  2NVX B;  3HP3 A;  3KK7 A;  3PMF A;  5KYI A;  3J81 E;  3I70 A;  3DHQ A;  2YU9 B;  1V1O A;  3HOV B;  2F0M A;  5M3F B;  1EQV A;  1QB5 D;  5D3I B;  3GQB A;  1FGB D;  4RHS A;  2JA7 B;  1EY9 A;  1STA A;  1HRJ A;  1QIL A;  3N6R A;  3DWA A;  4CJ0 B;  4DXF A;  1CFM A;  2NVT B;  2HCI A;  3EFX D;  4ZRZ A;  2C5C A;  1ML0 D;  5D3D A;  4KKU A;  2SNM A;  1UAP A;  3NHH A;  2PYK A;  3SK6 A;  4DA2 A;  2ICE C;  5C5L A;  4DAY A;  1QCB D;  2K6A A;  2FHT A;  2KCC A;  3H0G B;  3HS0 C;  2IX0 A;  5I2Y A;  5C4X B;  1TWF B;  1BBX C;  3GV6 A;  1F2L A;  2R61 A;  3K5L A;  4A3B B;  1RDP D;  4OL7 A;  5DM6 3;  3V2T A;  2L5T A;  1YNJ C;  1TT2 A;  1T5X D;  4PNY A;  2B8G A;  2Q8T A;  3S15 B;  4XQQ A;  3D8G A;  4A3M B;  2XRQ D;  2M9V A;  1GUN A;  1EIG A;  4NDX A;  1GUG A;  2NTS A;  2F0E A;  2MUY A;  4RGM A;  1D2B A;  1J8I A;  1NR2 A;  2PO4 A;  1PZK D;  2EXZ A;  5JEA G;  3N52 A;  1H9K A;  3PV0 A;  1LV9 A;  4ULL A;  4ZQ3 A;  3NQI A;  1Y69 U;  4F7X A;  1II3 A;  2LFN A;  1X32 A;  1YNJ D;  1SYG A;  5JPN C;  4U68 A;  1EY7 A;  4PMC A;  1KDB A;  3Q24 A;  1KDC A;  2CQA A;  4IUT A;  3TP5 A;  3LWE A;  4HR7 B;  1CQV A;  3HEJ A;  4C3I B;  4OIK A;  1R4Q B;  3ND8 A;  4BBS B;  4G7H C;  4X3T A;  1WTQ A;  3NTH A;  4BWG B;  3MA2 B;  4XIG S;  3T13 A;  1PRT F;  1EZ6 A;  3PUV A;  2Z4I A;  4ABN A;  5ELB A;  4ODG A;  4XYO A;  1XYI A;  2B8F A;  1I4G A;  2K03 A;  2KHS A;  1SE3 A;  5FO9 B;  1IKM A;  3A54 A;  1I4R A;  4EGV A;  3S14 B;  2XVS A;  1G2T A;  4OO1 I;  2F0S A;  1STG A;  3IFT A;  4I65 A;  1XXG A;  2FJ2 A;  2RQX A;  3R93 A;  2K32 A;  4HN7 A;  1Y8P B;  3A55 A;  4K2K A;  3RUZ A;  2CVR A;  1STN A;  2PMZ B;  3E6Z X;  3I4L A;  4PQX A;  3J7Y W;  4NP5 A;  3MEH A;  3SEB A;  1B44 D;  1SYF A;  4ZK9 B;  3GTL B;  3S2H B;  2EPB A;  1W6J A;  3HG9 A;  4TKO B;  3BDC A;  4EQP A;  4X3K A;  4ZKB B;  5CV7 A;  3IKJ A;  3TN2 A;  1HQR D;  2MP1 A;  5I9P A;  1STB A;  2ID0 A;  3ONA B;  2ICI A;  1BCP F;  2VUM B;  2EJM A;  1S4Z A;  4X3U A;  1JOO A;  3A56 A;  1I4P A;  3ERO A;  3H6M A;  1A3U A;  4Q0F A;  4HED A;  1D5X C;  3MXG A;  1XX8 A;  4FF4 A;  1MBY A;  3LX0 A;  5C3X A;  1TWG B;  1QOH A;  3MAQ A;  2K5D A;  1LLR D;  1SEB D;  1QNU A;  5A2Q L;  1R9T B;  2Q8R E;  1IL8 A;  1B1Z A;  5JEA H;  1YNN C;  1ROD A;  2Z1C A;  3DWP A;  2BA0 A;  4ZYS A;  2VNU D;  4K5X A;  4N9T A;  1FNV A;  4DGZ A;  4EVO A;  2QEJ C;  5DEH A;  5IT9 E;  3IAY A;  4C3J B;  3FPP A;  4BS9 A;  2DNE A;  4NW2 A;  4I7Z C;  4RFB A;  1JWM D;  2J0T D;  5IIF A;  2XIW A;  3I91 A;  5KND A;  2B2T C;  2DNC A;  1YNN D;  2F0F A;  1KLU D;  5F2D A;  4OO1 G;  4B9X A;  3H94 A;  3QB3 A;  3HOY B;  3TME A;  3OWE B;  2K1B A;  5G3L F;  1KNA A;  2L12 A;  2F0U A;  3EA6 A;  3RMH A;  2EYP A;  4HSP A;  1OXS C;  2K28 A;  5CMD A;  2RA4 A;  4ILW A;  2B2Y C;  3K57 A;  1SFO B;  3CU7 A;  2X69 A;  3M3Y B;  3OMC A;  3BYT B;  3BDO A;  5C4Z A;  2NYZ D;  1SYE A;  3A7A B;  1EY6 A;  2K01 A;  2PW5 A;  4WRD A;  2K7V A;  2LMC B;  2Y0S B;  3K0Y A;  1I4H A;  4WOR A;  2TSS A;  3SE0 A;  3K5M A;  3R2T A;  5EQ0 A;  4R9W A;  1PRT C;  3D6C A;  2VB2 X;  4ZLT F;  1HPC A;  3GTO B;  1S5F D;  2L55 A;  4QF4 A;  2D62 A;  2BDO A;  1HXY D;  4DK1 A;  3PIO 3;  3KF8 A;  5JVH 3;  2IJ0 A;  3OW7 A;  1U4L A;  1LT4 D;  2MJ8 A;  2PZW A;  3BG3 A;  5C0X J;  3OOC A;  2L1B A;  4F87 A;  2WP8 J;  4IZ8 A;  1A15 A;  2F3W A;  2SNS A;  5EKK A;  2PZT A;  2BDN A;  4IN3 A;  1B9M A;  1D1K A;  2F0N A;  3TP6 A;  1PRT D;  4XQN A;  2F0O A;  4OGQ C;  4RGO S;  5LHY 1;  2AWO A;  2VB3 X;  2IX1 A;  1QJO A;  2WKD A;  2K04 A;  2K33 A;  2F03 A;  4A3K B;  1VF7 A;  3R8B A;  3T51 B;  4BA1 I;  5D65 A;  2F0T A;  3AB9 A;  3R3O A;  4HMI A;  1JOR A;  3JAM L;  3NXW A;  5E3F A;  3VYT A;  1E0B A;  3QO2 A;  3CQZ B;  3D6W A;  3MXU A;  3VR3 A;  3PUZ A;  2QIL A;  1KAA A;  1VF5 C;  1EY4 A;  3ND9 A;  1LO5 D;  2B2U A;  3T56 B;  4BY7 B;  3CRL C;  2K5Q A;  1DD2 A;  1MSH A;  2B2Y A;  3KLR A;  3NSW A;  1SNQ A;  2O4X A;  4OIJ A;  4RKB A;  3WOE A;  2CHB D;  4LAA A;  4MHE A;  4CKC A;  5BN3 A;  1W6K A;  4A3F B;  1SNC A;  4RCN A;  1OXV A;  1B3A A;  2KVM A;  4QUC A;  5ELD A;  3VR2 A;  2EDG A;  4LK1 C;  1FR3 A;  3EJI A;  4KKT A;  3WDN A;  3HOX B;  2B2V A;  3GV3 A;  5JEA J;  4KY7 A;  1F2Z A;  2IWH A;  1WTR A;  1A3V A;  3MWY W;  4KN4 C;  1XTC D;  4XT3 B;  1IYV A;  5EBC A;  4RCO A;  1NR4 A;  3TP7 A;  3NWS A;  3C1E A;  1BXT A;  5IOC A;  1VMP A;  3P20 A;  1PRT B;  2F0W A;  4Z9C B;  2B2W A;  3FKI B;  2RKS A;  5C0X G;  1DOL A;  3MC0 B;  2R6G A;  1OO9 B;  5J1Z A;  1OXX K;  4FVM A;  1BCP D;  1JWU D;  1IW7 C;  5HUR A;  1GOZ A;  3U9O A;  4OO1 H;  5C3W A;  3MZ5 A;  1JOQ A;  4O42 A;  1I50 B;  3GTP B;  5IGG A;  1CTM A;  3E5S A;  2E2I B;  4HCS A;  1AEX A;  1MD2 D;  4AYB B;  1AN8 A;  1A3T A;  1Q1B A;  1Z6H A;  3FPU B;  4RAU C;  2F0H A;  1I4Q A;  5BN5 A;  1SSO A;  2QF7 A;  1LTG D;  1CM9 A;  1CI3 M;  1L0Y B;  2G9D A;  4ID6 A;  1DXM A;  1IW7 D;  4A3D B;  2MGS A;  1LTB D;  2GA4 B;  2NVQ B;  1Z7T A;  1HUN A;  1DYQ A;  2XSC A;  3M7N A;  3T53 B;  3NUC A;  1SMY C;  1ET6 A;  4H44 C;  2A6E C;  1EOT A;  2F0P A;  1SJE D;  1KAB A;  1KNE A;  4C3J G;  1LAC A;  1Q8I A;  3TZU A;  1I4X A;  1GHJ A;  4A3I B;  1EY0 A;  2R7Z B;  5NUC A;  1UUP A;  3RZO B;  3W2D A;  4UDU C;  3G6J B;  1ILP A;  4F88 A;  4RWS C;  5C3E B;  4E6I A;  1M8A A;  4A3J B;  2FFK B;  1BDO A;  2MHV A;  2ENB A;  1BCP B;  1SMY D;  3S1N B;  3GTG B;  2A6E D;  2E2D C;  1Y1V B;  3E0J A;  4K6L A;  2PW7 A;  5G3L D;  2ZXO A;  4FXD A;  1KDA A;  1DOK A;  3MXP A;  2F0D A;  3G7L A;  2B39 A;  2F0G A;  1TS4 A;  1TR5 A;  2L4N A;  5KYL A;  3OHX C;  3I72 A;  1RKN A;  2BOS A;  1F77 A;  2V4D A;  4HMJ A;  1BR9 A;  2A69 C;  1VDZ A;  4H0L C;  1SE4 A;  1KTK A;  3CKI B;  1SDF A;  3C1F A;  4QB4 A;  1PLF A;  5EKI A;  1EY5 A;  2D2C C;  1TWA B;  4XYQ A;  4PMW A;  1BF4 A;  1F2M A;  2HQE A;  4CKB A;  3OIQ A;  4EQO A;  4K5W A;  3DXJ C;  2OF1 A;  4RHR A;  2RDH A;  1M4V A;  1EFI D;  1JE4 A;  4RGN A;  2A69 D;  1H9S B;  1EYA A;  2NUC A;  1TY0 A;  1HFN A;  5IGD A;  3P7J A;  1LAB A;  1H9J A;  2AUK A;  1U4P A;  2MPM A;  4KTA A;  3DUZ A;  3MFY A;  5K5P A;  1GHK A;  1PTO C;  1HHV A;  2J7Z A;  4U67 3;  2SDF A;  1Q12 A;  4YIJ A;  5I2X A;  1Q90 A;  3CHB D;  5M5W B;  1TII D;  1JR0 D;  3ITP A;  3K59 A;  2PQE A;  2HCC A;  4DNT B;  2D5D A;  3U9S A;  4XTC S;  1UEA B;  1E2W A;  4KY5 A;  4UAI A;  2WAQ B;  4FF1 A;  3HOW B;  1FD7 D;  5FKA C;  2WAC A;  5C0X H;  1DON A;  1GUS A;  4IUN A;  2IL8 A;  3QOL A;  1HA5 A;  3EVQ A;  1U4M A;  4TSS A;  5CV6 A;  1BO0 A;  5J39 A;  1Z47 A;  1PTO D;  2KEC A;  2J4X A;  4A3E B;  2RDF A;  2EYM A;  2X6G A;  3D4D A;  2A68 C;  2AQ2 B;  3DEP A;  2JP1 A;  2NVY B;  4B08 A;  5IGF A;  5FO7 B;  1EWH A;  1K8M A;  4HTH A;  1SYB A;  3MHB A;  3H09 A;  2I46 A;  3LNN A;  3S1M B;  2L9H A;  3URY A;  1R4P B;  1U9R A;  3BVZ A;  4KD3 A;  3UI2 A;  4FNF A;  4IUV A;  3FRP B;  5I4D A;  4DU9 A;  3GTM B;  1EIH A;  5LL6 S;  3GTJ B;  1HTP A;  1CA5 A;  2KA7 A;  1STY A;  5E4X A;  1PFB A;  5CR3 A;  4GZY C;  3BS1 A;  2JA6 B;  1A6X A;  2QDB A;  1Q3L A;  4WJW A;  1EYC A;  5LL6 X;  4IUQ A;  3D4W A;  1LTS D;  2AUJ D;  2L11 A;  1RTN A;  4NMZ A;  1V1P A;  2QKI C;  2XWB B;  1HFG A;  1EEF D;  2EJF C;  4CHT B;  5C5M A;  3I8Z A;  2EYF A;  2F3V A;  5EJW A;  3BVM A;  1K83 B;  5M5X B;  1GUW A;  2EY6 A;  5KRU A;  4LMQ D;  2N88 A;  3PIP 3;  1O7L A;  1LTR D;  4KD4 A;  3TSS A;  1CHP D;  3QOJ A;  3RD4 A;  4C3H B;  4G7O C;  3FMC A;  2HDL A;  1WD0 A;  2F1M A;  3FVQ A;  3I4N B;  5HGT A;  1K8O A;  3A8K E;  1DCZ A;  4TRD A;  3GTQ B;  3L9A X;  2KCN A;  1PDQ A;  5KNB A;  4FYD A;  1LT6 D;  3H91 A;  5ELE A;  3QJY A;  1EL0 A;  1F2Y A;  2L0C A;  5FLX L;  1D5Z C;  5TSS A;  3OMG A;  4DK0 A;  1DOM A;  5KIX A;  3GTK B;  1SXT A;  3NTI A;  2HDM A;  5M9O A;  3MVV A;  4RKL A;  2FIN B;  1TS2 A;  4XDX A;  1ZKO A;  3NWT A;  1SE2 A;  2B2U C;  4K8I A;  3NTK A;  4BBR B;  3S16 B;  2KEE A;  1D5M C;  4C2M B;  2JXM B;  2PCF B;  4HAE A;  5JVG 3;  2KQ3 A;  5CBE E;  1Y8O B;  5C0X I;  3Q0A A;  1X3P A;  1I6H B;  3A8J E;  4DAV A;  4B9W A;  5EPL A;  2BCO A;  3PUY A;  3X3N A;  4KJN A;  1HQM C;  4IQZ A;  4C1N K;  2EE1 A;  5C44 B;  5CV8 A;  4XXE A;  2B2V C;  2X6L A;  2E2J B;  3DEO A;  2AQ3 B;  3D3R A;  4FP5 D;  4C1N I;  2IX3 A;  3GP7 A;  5T1G A;  5JPM C;  1RHP A;  3I3C A;  1BNZ A;  1B9N A;  2KJX A;  1TWC B;  4CJ2 C;  4R8I A;  2C9O A;  3BYY B;  3L7Z C;  4KMU C;  3VA7 A;  2TMP A;  1FNW A;  4G7Z C;  2WKC A;  3MXN A;  4CJ1 B;  3KLS X;  2B2W C;  3I90 A;  3SK4 A;  1SNO A;  3TP8 A;  3KBX A;  5A2Q E;  1B50 A;  3W3A A;  2B63 B;  1O80 A;  1TVX A;  4H13 C;  3FDT A;  4J1M A;  1ENC A;  3IFD A;  3KUP A;  1D1I A;  4KI0 A;  4ZUI A;  3HOZ B;  3QIA A;  2NBF A;  2ZT9 C;  4QUF A;  3M4Y A;  3VYR A;  3A8I E;  1PTO F;  1JC7 A;  2E75 C;  1LTA D;  4J6H A;  2NN6 G;  1DZ1 A;  3TBI B;  2I07 B;  2OT2 A;  2LKV A;  1MI2 A;  3M4O B;  3PO2 B;  2SEB D;  5T1I A;  2R92 B;  1F9P A;  3NP8 A;  1ONL A;  4DN4 M;  2O2L D;  2EYO A;  1OXT A;  1PZJ D;  1EY8 A;  4S3S A;  5CBA E;  5KNC A;  1WTW A;  3HOU B;  3FEW X;  2E74 C;  3K58 A;  4FF3 A;  1S5B D;  1AFP A;  3BVG A;  1GJX A;  1EWC A;  1C4Q A;  3ZYY X;  5EGT A;  2NTT A;  3SR1 A;  4CGY B;  1HA6 A;  2EY2 A;  1ZXT A;  1CQF A;  3A7L A;  5CV4 A;  4RGT A;  2NWG A;  3Q6S A;  1WTP A;  3DWQ A;  2PPB C;  3RZD B;  5ELF A;  5IGB A;  3DM1 A;  3S1R B;  3VR4 A;  1TY2 A;  3NPP A;  4KK7 A;  3VYU A;  1NSN S;  3SDZ A;  3NK9 A;  3T16 A;  3KBG A;  1S5D D;  2WV6 D;  2IT1 A;  3K5N A;  1ZEQ X;  2RSO A;  4P2C B;  3SK8 A;  3SVM A;  1LT5 D;  5KEE A;  2F0V A;  1NCV A;  1V43 A;  1GXD C;  1TS3 A;  4K6D A;  2A5H A;  4G4K A;  3SXH A;  2JA8 B;  2A73 B;  2FMM A;  2PZU A;  4XT1 B;  1ZYR C;  1WD1 A;  1JOK A;  1IHZ A;  3VR5 A;  2E2H B;  3GO5 A;  4Y7N B;  3VYS A;  1Y8N B;  1GUO A;  3C46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...