1Y8OB

Crystal structure of the pdk3-l2 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
97
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
total genus 15
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8oB00
4KN4C 4L8JA 2DNCA 1LABA 4PV1C 2K33A 3D31A 3AB9A 4XIGS 3VR2A 2O5IC 3M7NA 2K7VA 4RCNA 1HPCA 3CRLC 3P20A 1Q90A 3VR4A 4KI0A 4H0LC 1IYVA 1K8MA 1CFMA 3T56B 3NE5B 3ND9A 4TKOB 4OO1H 1I6VC 1LACA 1TU2B 3N6RA 1CTMA 4H13C 3QG1A 3M85A 4KHZA 3M4YA 3I4LA 1HQMC 1OXUA 1E2WA 2E76C 3OPOA 1ZYRC 4TQUS 1H9KA 2BE5C 4IFDG 2A69D 4KKSA 4OGQC 1HTPA 1FYCA 3PUWA 3I72A 1IW7C 4H44C 2KA7A 1EWHA 5K36G 5BN5A 1A6XA 2EVBA 3IFTA 5A35A 3DXJC 3FMCA 4LJZC 1PMRA 1YNNC 3HGBA 3VR5A 2EJFC 1G291 3A7AB 1GHJA 1IW7D 1Y8OB 2IT1A 2JE6I 4LK1C 3WDNA 2YYZA 5JEAH 2O5JC 1GJXA 2BA0A 3D4RA 2NN6G 4KN7C 1GUNA 1Y69U 5BN3A 2A6HC 2JEBI 1Q1BA 4DNRB 5BN4A 1V43A 1VF5C 2DNEA 1FR3A 2D2CC 2EJGC 4KMUC 5KNDA 1Z7TA 2E75C 1SMYC 2BA1A 3A8JE 3W3AA 3BG3A 2ZT9C 3MFYA 1OXXK 1H9MA 1Y8NB 2EDGA 2A6EC 1DXMA 1T5EA 1YNJC 2BE5D 2DN8A 2CW0C 4G7HC 2K32A 4GZYC 2NN6H 1H9JA 4KKUA 1B9MA 1OXTA 1Q12A 2PCFB 5JEAG 4DK0A 5C0XG 3PV0A 3OOCA 2E74C 3A7LA 3L7ZC 3PUVA 2JXMB 2B8GA 3ND8A 3T51B 3VR6A 3VR3A 1H9RA 1O7LA 1GHKA 2NN6I 5K36H 1GUTA 2D5DA 1CI3M 1VDZA 2QF7A 4JBWA 3PUYA 2KCCA 3EQLC 5KNBA 2AWOA 3H94A 3PUXA 4IFDH 1VF7A 1Y8PB 2A6HD 3OW7A 1DCZA 4OO1G 3U9SA 3CRKC 1GUSA 3A8KE 1ONLA 3KLRA 3LNNA 4I7ZC 3TZUA 4BA2I 2A69C 5C0XH 4KKTA 1VCIA 2A68C 1H9SA 2BDOA 3MXUA 2JEAI 1OXSC 4DK1A 2LMCB 3I73A 2AUJD 3VA7A 1DD2A 4IQZA 2PPBC 1OXVA 2PNRC 4G7OC 3QJYA 1QJOA 2AUKA 3GQBA 2V4DA 2EJMA 3FPPA 4G7ZC 4XTCS 2L5TA 1BDOA 3BDOA 1IYUA 4HR7B 1Z6HA 1HCZA 1Q1EA 3RLFA 5KNCA 2F1MA 1GUGA 1E2ZA 3T53B 1B9NA 4JK1C 1H9SB 2B8FA 4DNTB 1K8OA 2A68D 2A6ED 1TKWB 1ZKOA 3IKJA 3PUZA 1E2VA 3SDZA 4BA1I 2Q8IB 3LWUA 3SE0A 1GUOA 2D62A 1V8QA 2R6GA 3GD7A 3A8IE 1O78A 3QIAA
chains in the Genus database with same CATH superfamily
1X6OA 2R3ZA 1FNWA 3D31A 2UU9Q 1ZEQX 3KJPA 3F2DA 4PNYA 4LUOA 1N34L 2VUMB 3BVZA 1S72A 4ULLA 2JA8G 3G6EA 3DWAA 4XDXA 5GAHC 2E2HH 2E76C 2HQLA 3ER0A 1H9KA 2V1CC 3VYUA 1CKOA 3I72A 3CQZH 2OEOA 2F0EA 1WTQA 2A19A 3HOVB 1YNNC 4FNFA 3C3LA 2JE6I 2L15A 3OMGA 2MO0A 3KFUA 5EBDA 1VQAA 3W1BA 1SN8A 1B3QA 3IFDA 4DK6C 2HHHQ 1FL0A 2F0VA 2I07B 3J81E 4WRDA 3K81C 5CMDA 3PO2B 1QWYA 1A2TA 2EY5A 4L5QA 2TMPA 2MFIA 1PH9A 4JI5Q 3C2PA 1Y8NB 3PO2H 5KGUA 2MNAA 1KL9A 2K32A 2NN6H 4OELB 5IGGA 2YV5A 4IUNA 2E8GA 1CZWA 1VQ9A 1KDAA 5IY0A 2ZXRA 4AYBB 2CH4A 3T51B 3ND8A 4IUQA 1D1KA 4JI2Q 3I4MG 3T16A 3HOWG 2BOSA 4G57A 4N8FA 1X9NA 2E5LL 2B2WA 2K5NA 2RSNA 4XT1B 4A75A 2A5HA 4K0KQ 3FRPB 1BCPB 2A6HD 5C5MA 5C5LA 1ILQA 2JA6B 3E6ZX 2NVXB 2F0IA 1EIFA 2AQ2B 1VCIA 2A68C 4A3KB 5DEHA 3HKZG 4A3JG 3QB3A 2XWJB 3RMHA 5EKLA 4K8JA 2F0UA 2N55A 1JCKB 4NXMQ 3BZKA 3J81c 3DWPA 4XQQA 4MNOA 1VMPA 4BY1H 4DU9A 1CQFA 3OTOL 2K14A 4DNTB 4BBSG 1X3GA 1ZKOA 2HQEA 4JI5L 2XWBB 3MC0B 3A8IE 1B50A 3NBHA 3ULLA 4LF4Q 3LX0A 3QIAA 1KQSA 4O0AA 2Z6KC 2ASBA 4QUFA 5LMNW 5A2QE 2NWGA 3PMFA 5IT9L 2YTVA 1A3TA 3GTJH 1XMQQ 1PRTB 3J7YW 4A3BB 1I4RA 5GROA 4GKJL 1F9QA 3I4NB 1JJGA 3Q6SA 1SEBD 1IBLL 5IODA 1EIYB 1S3OA 4HCEA 3ULPA 1N33Q 2OQKA 5G3LD 1RL2A 1EY4A 4YIJA 3RLNA 1FGBD 2N8NA 3OHXC 2R93G 4GOPB 3PUWA 1EYDA 1PA6A 4DV2L 1IW7C 2VUMG 3S24A 1ICFB 2JP1A 1LTAD 3HGBA 5T1IA 1MJCA 2B2TA 5HGQA 1TWCB 1IBMQ 3CF5A 2UXDQ 1ZXTA 2O5JC 3V2TA 4KN7C 1DGSA 5E4WC 1W6KA 1WCMB 3CP0A 1PZKD 1WTOA 1LV9A 4OIJA 1F2YA 1VF5C 5J39A 3B6YA 1VQBA 2NVYH 2Z1CA 3QOJA 3EJIA 4GLAC 3NXWA 4PZ8A 2PQAA 3K0YA 2F0GA 2H4OA 4KKUA 2SDFA 2JYOA 4X66L 3L7ZC 4EGVA 2JXMB 2B2UC 2TSSA 4A3FG 4AQYQ 2NN6I 1XNRL 1AE2A 3F1ZA 3RZDB 1NMFA 4HJAA 2MJ8A 4ALPA 3SVMA 3T4AC 5JJZA 4OO1G 1QILA 4KTAA 5LHY1 3KLRA 4LF5L 2YU9B 3HOVG 4A93B 3FVQA 4EX5A 4DUYL 2RA4A 2SEBD 4KHPQ 1NSNS 1CK1A 3S2HH 1S5BD 2BH2A 2K5HA 3NENA 3MEFA 2HD3A 1I4PA 1PZJD 3BDCA 1Y1VH 1DZ1A 1AFPA 2L5TA 1EFID 4LF7Q 2J7ZA 1W2BA 5JOBA 1S5CD 1K3RA 3E9HA 1VQ4A 5C6AA 4JI0L 4DR3Q 1PVOA 2Q8TA 2B63H 4JYAL 4KHVA 3J80E 2R6GA 4HEDA 3D3RA 4AYBE 1G2SA 2VNUD 1CSPA 3ERSX 1HTLD 3WOEA 2WAQE 3FEWX 3CRLC 1XPUA 4H0LC 4DR4L 2MO1A 4PMCA 4BY1B 2Y0SE 1C48A 4PMBA 5I2YA 5COYA 4NXML 3OYYA 5JVH3 1TU2B 1XX8A 3TS0A 5CV6A 4Y7NH 3S9WA 4K6LA 1SYBA 1KDCA 1AZPA 1EYAA 2D0PA 3PSIA 4DV3Q 1HTPA 5M5WH 1PTOF 4P71A 4DK3C 3HOYG 5BN5A 5C0XI 5EBCA 1JORA 1EY6A 2AMCB 4DR7Q 3P7JA 3A7AB 1IW7D 1UE6A 4DAMA 3AU7A 2VQFL 2MHVA 2BA0A 4UAIA 4RFBA 5DNFA 4ME5A 4DR4Q 4QB4A 4CKCA 2ICIA 4UHVA 1X3EA 2QW7A 4A3FB 1RTOA 3RZOH 1B4OA 4NXNL 2KOLA 2PO4A 3NBIA 1U5KA 2ZT9C 2JA5G 1PHJA 3RZOB 2KVMA 3QR8A 2L55A 5M3MB 2HHHL 1KD1C 3ZYYX 1XWEA 4H7BA 1PRTD 2K05A 1MHWC 5IE8A 1TQOA 1JJCB 2KQ3A 3E9IA 4PQXA 4EVOA 1SYEA 4A3KG 3H94A 4JI8L 4R4IA 1HZBA 3DMUA 5HGTA 3OW7A 5ELCA 4ZCKA 5FOBB 1LT6D 3WWVA 1H9SA 1HXYD 2RHSB 3TP5A 3GTOB 3TS2A 4OWXB 1HNZQ 1PTOH 1ASYA 3CPWA 1C0AA 4DAYB 2KHSA 4RHSA 5C4ZA 4G7OC 5ELNA 4P75A 5IGFA 4QMGA 1GOZA 4JI4Q 1SBBB 2ALYB 3NWSA 1HFGA 2O4XA 4WORA 4GN4B 4DUZL 1A0IA 1G8ZD 2EYMA 1JB7A 3IKJA 3CCSA 5HY6A 1E2VA 3G48A 4ZQ3A 2JA8H 1C8CA 4YHHQ 1RJTA 3I91A 4LW1A 2NVYB 3D6CA 4XIGS 2F3IA 3AB9A 3OTOQ 1KNEA 4CDDC 1IZ6A 4MHEA 4OX9Q 4R9WA 4DV4L 1MJEA 1Q90A 1EY0A 2RKSA 4K2KA 1IYVA 2JK8A 3E5SA 3V05A 2C5CA 2XTIA 3PIPA 1K28A 4RMFA 4C3JB 3J80c 3JAMc 3M85A 4YCUA 1F9RA 1TWFH 1EFWA 2R93H 2EY2A 5EGTA 5IP7H 3KF8B 2IX1A 1EOTA 1YVCA 5ELDA 3CMAA 5CV9A 4XXEA 4DV6Q 2M2LA 2RQXA 1N33L 2O2LD 4O42A 1X55A 1TWGB 3WDNA 5M5XH 1BCPF 4P74A 4JI1L 1V43A 4EQ5A 1EWIA 1WTXA 2UUCL 4KMUC 2VL6A 1F2ZA 1L0WA 1D5XC 2E75C 4GNXA 2NVTH 1TXYA 1STHA 1PH8A 4JBKA 1D7QA 4JVZA 1T5EA 1YNJC 3AEVA 1TS3A 1ENAA 2NBFA 1YHQA 3D4DA 1T5XD 4IN3A 1SNPA 4JOIC 5EKIA 2WINB 2HT1A 1UE1A 2A8VA 3GTGH 3PIOA 1LTGD 1TWCH 2VQFQ 1E3PA 1D1IA 3OSOA 2KCCA 3EQLC 2AWOA 2X6GA 1X3QA 1NBWA 1O7ZA 5I9OA 4X3TA 3RNUA 5LMUQ 2ID0A 1PH2A 1XTDA 1STAA 3PO3H 2I46A 2AKWB 4LWCA 1PFBA 1K0RA 5FLXL 4K0KL 1B53A 4JOIA 4KY7A 4ZYSA 3T1YQ 4DR6L 4RGOS 1EIHA 5JPNC 2WB1G 2V4DA 1GO3E 2K01A 4RKLA 2PI2E 4B3MQ 1J9OA 3SR1A 1TS4A 5C4XH 5IYCH 1Q1EA 1V9PA 1E7ZA 1FJGL 4GKKL 2Z9HA 4HMJA 1YEZA 4HCSA 5EPLA 1B8AA 2FFKB 4HJ9A 4DV7Q 4LUZA 2WFWA 4MIUA 2Q8IB 1QZHA 5ISRA 4FXDA 1KNAA 1SROA 2EXZA 4XYQA 2D62A 5M5YH 2XRSD 4KV6A 4QF4A 2LXKA 1LT5D 3CCMA 1HZ9A 1HR0L 4DV1Q 3M7NA 4JI1Q 1GXDC 1CHQD 1K8MA 2CFMA 4A3GG 4IUTA 4NMZA 4IJLA 1U4LA 1C7YA 1N32L 4O1NA 4HJ8A 4JI7L 2JSOA 3SEBA 1NCVA 1JWSD 1CSQA 4DUYQ 3DLLA 1Y14B 3GO5A 4KKSA 4CGYB 2IWHA 3R3OA 1U4PA 4LF8Q 3CCUA 4LJZC 1LTTD 3U4VA 3M4OB 2E2IH 2KUMA 2JA6G 1Y8OB 1N34Q 2R7ZH 2WAQG 1OTCA 2VUMH 3CMEA 2LKVA 3TSSA 2I5MX 4DGZA 3PGZA 4KD3A 3GTQH 4OONA 2DNEA 5IYDG 1HZCA 1TVXA 2RVLA 1HR0W 1EIGA 1HH2P 1PFSA 3S14H 1C4QA 2L12A 2GN5A 1JT8A 4J15A 2DY8A 3BG3A 5ELBA 3NPPA 3L9AX 1WOCA 2GVBA 5GADC 3CC7A 2F0SA 4RGMA 3A7LA 3UE0A 5C4JB 4IZ8A 4X62Q 1VQ5A 3HOYH 1PFNA 3KBGA 4IFDJ 1AH9A 4DV5L 1SYFA 3PUYA 1IBML 1S4ZA 2G9HD 4X65Q 4Z9CB 5CORA 1K0SA 3HOXH 1VF7A 1XNQL 1C9OA 1NR2A 3QOLA 4LNQA 1ONLA 2K6AA 3LNNA 2Q2IA 1RCVD 1ICWA 1Y1WB 4IOCA 3L0OA 3QJYA 4RAUC 4DV5Q 3I3CA 1KAWA 3CC4A 5E1FA 1JB3A 2BCOA 5ELOA 4FF4A 2FHTA 3M4OH 1S5FD 2KECA 1I50H 2PMZB 3DEOA 3A74A 3A54A 3SDZA 3MXNA 1PH1A 4XQNA 1L0XB 5C3WA 4IUUA 4L5SA 3CHBD 4A3MH 4K5XA 1Y1VG 3S15B 2WAQB 3F2UA 4RCOA 1LO5D 2WKDA 2F0OA 3TEHB 2LS01 3NE5B 4IPDA 4QIWB 1TY0A 4ZUJA 2M9VA 3JAME 2OCEA 1UEBA 2PQAB 2QGQA 2HIXA 4IUVA 2EIFA 4F88A 4CKBA 1JE5A 3MHBA 3OPOA 4UY8C 4B3RQ 2VW9A 1G6PA 2R92B 3MWYW 1SAPA 4C3JG 4DPGA 4DV0L 1I4GA 2EVBA 4A3FH 4JW0A 5KEEA 1QNKA 2IY5B 2Z0SA 2R7ZB 3GDEA 1WFQA 1YHBA 2KBNA 1CA6A 1YHAA 4FDBA 3R8BA 3IAYA 2BH8A 2NTSA 1PH6A 4LF6Q 2KCTA 2F4IA 4TSSA 4UP7A 5NUCA 5IGEA 5IYCG 1LM0A 1L2FA 2EPBA 1ZYRD 1QB5D 4BBSB 5E4XA 3MFYA 1TWAB 1PTOC 2DN8A 2CW0C 4PG3A 3BZDB 5C0XG 4ABNA 1R9TB 1STGA 4DKAC 5IT9E 2PZUA 3I7FA 5KRUA 3WOFA 4HN7A 4LF7L 3W1GA 3F2CA 1H9RA 1CA5A 4B3ML 1LTID 4QUCA 1L1OB 2JN4A 3N52A 1F9PA 2ZTEA 5IYBG 2AQ1B 1H95A 4DV0Q 1VQPA 3PF4A 5IIFA 4BY7B 1I4QA 4KY5A 1MBYA 1YJ9A 4A3EB 4IQZA 1U4RA 1VQFA 4G4KA 3VYTA 4HJ7A 1SJED 1NMGA 2YTYA 3NTIA 2K1BA 5JJIA 5M3MG 2UXBQ 4G7ZC 4GLVB 2ENBA 4HTHA 1M8AA 5C3EG 4OX9L 2LY7A 1FVIA 1GUGA 1P8LA 2B8FA 4A3EH 2NZOA 3G4SA 3CXCA 1BUVT 3F8TA 2ZJPA 4CHTB 5E3FA 3I56A 4OHJA 2RCFA 1PYBA 1TWFB 2XIWA 5D14A 4ID6A 1T9HA 1R4PB 2J4XA 2VB2X 3ND9A 5IP7G 2UXDL 4N9PA 1Q8IA 5A2QL 4A3IG 1A15A 1B44D 3FKIG 1IHZA 3SK6A 3K59A 4DV6L 4TQUS 4NW2A 1CM9A 2A69D 1Q46A 1RD9D 2F0PA 4QGUA 1A63A 4I65A 1VQLA 2G9DA 4BBSH 3KUPA 2OWOA 4FXKC 4IURA 1M90C 2QEJC 4BY1G 2KJXA 3VR5A 1N32Q 1LTRD 1PFMA 5J3BA 1HRJA 5ELFA 1WCMH 2NN6G 1Y1VB 2ZXPA 4FVMA 1TWGH 1A62A 4YWMA 3H09A 2SNSA 3L2PA 4DV4Q 5D3DA 2UXCL 1XPRA 2FMMA 2L11A 1IL8A 1HHVA 1Z7TA 1NAPA 4OO1I 1LT3D 1SDFA 3K58A 4P72A 1KLGD 2R92H 5FO8B 3S17H 4UP8A 3PQIA 3KDFB 4J8QA 4PZ7A 1VQ7A 1WTVA 1BCPD 2OQ0A 1HA6A 3TDQA 1EY9A 3EIVA 4LFAL 4IPCA 3CCVA 1UAPA 3S2DH 3JAML 4R4OA 3MXNB 4XYOA 5C44B 4DR7L 1F2MA 3T1YL 4DR6Q 2IW3A 3X3NA 3TP6A 5IP9G 1F2LA 1SE2A 4YWLA 2RHQB 3CRKC 4DF7A 4KKTA 5C4HA 2JEAI 4DR5Q 1O7IA 1HNWL 2ZJRA 4WJWA 4JI3L 5ELEA 1P16A 3GQBA 4K8IA 2EJMA 4B9XA 3BDOA 3H3VI 1FNVA 4YY3Q 3RLFA 4BBRG 2JA7G 2MQHA 2B2UA 4DV1L 1J5EQ 3HOZH 3MAQA 4POGA 4ZAIA 2VB3X 3ICEA 1V1PA 5I4DA 4A3KH 3TRZA 1FGUA 2QEXA 4FF1A 3GD7A 1ASZA 1HUMA 1B1ZA 1U4MA 2IL8A 3TP7A 3SGIA 4DV7L 4KN4C 1DM0B 4LUVA 1LABA 2H1EA 5FLMH 2K7VA 1VQJA 1K8AC 1FJGQ 4GKKQ 1HZAA 4YY3L 2ZM6L 4K14A 1BR9A 1BO0A 1HNXQ 3HOYB 4E6IA 1EQTA 3HRZC 1I6VC 4IO9A 4A3DH 2K75A 3PCOB 4OIKA 5G3LF 2KEDA 3R93A 3M9BA 4A3MB 5GQOA 4C3IG 4DR5L 1E2WA 1ENFA 4BXXG 4IFDG 2K52A 1QG7A 1FYCA 4H44C 2B63B 2QKIC 2FJ2A 2EE1A 3IFTA 5JJKA 3V96A 1TWHH 2JA7H 3AFQA 3D4RA 1BOSA 4X62L 1PH4A 2WKCA 2EY1A 1I4XA 3FHWA 1BBWA 3I90A 4X3UA 5GAGC 4DNIA 2UU9L 2EJGC 5FLXE 4RGNA 2QDLA 3I8ZA 5JPMC 2B2TC 3TZDA 3K57A 4HAEA 4IPHA 4FF3A 2NVXH 1OXXK 4IALA 2YU9H 2BE5D 3C1FA 5I6YA 4JI0Q 1QUQA 3AMUA 2PCFB 3KDFA 3H3VH 2E74C 2L9HA 4O2DA 2NZHA 1X3PA 2ICEC 1M1KC 3HOUH 3CD6A 1N36L 2VS1A 1EEID 3R2IA 4A93G 4KHPL 4EQPA 1HNZL 3G71A 5IWAQ 1BBUA 3SXHA 4CKEA 1JE4A 3MXUA 3S14B 1AE3A 3CCEA 2WACA 2R92G 1NNXA 1PRTC 3TN2A 2WV6D 3I4MB 4JI7Q 4C56C 1QJOA 4J1MA 4QY7A 1LTSD 1XNRQ 4A3DB 2E2DC 4C3IB 2P5ZX 1BDOA 3K7AH 2B2WC 1LTLA 1MD2D 2F0KA 2F1MA 3HOVH 1EZ8A 4LMQD 1VQEA 5CGKA 4JC0A 5CV4A 4LF4L 3SK8A 3PO3B 1BNZA 1MIUA 4YHHL 4A4IA 4WJ3M 1G51A 3RLOA 5M3FH 1B2TA 2EYJA 1BBXC 1A3VA 1S5ED 2CKZB 4A3IH 1CFMA 2F0MA 1BCPC 1KLUD 1SXTA 4BS9A 1YIJA 5TSSA 3I4LA 2R7FA 1A8VA 2WB1B 4FF2A 1TWAH 2H5XA 4I7AA 4R4TA 1Y1WG 1SSOA 4K6DA 1Q81C 5M9OA 2F4VQ 3FMCA 2UUAQ 1I50B 1PYSB 1G291 2K5DA 1GJXA 2AHOB 1KDBA 4HIKA 3GTPH 1KRSA 2F0HA 2N78A 2OXPA 2F03A 5FK9C 3K5LA 1KABA 2Q2TA 3S16H 2HDLA 3A8JE 3ULJA 2A1AA 3OWFA 1J8IA 1II3A 4DR2L 4NXNQ 5C3EB 1QOHA 4DR3L 1SFOB 3HOXB 1VQDA 4GOPA 1JMCA 1LT4D 4JI6L 3U9OA 4A3EG 3CAMA 1UWVA 3I70A 2F0WA 4C3IH 1V1PB 3GTMH 3PUXA 1KHIA 4DXFA 5M3FG 3S1RB 1QE6A 4K5WA 3HKZE 1QNUA 2SNMA 1PH5A 1SYDA 5CV5A 5FO9B 1MSGA 3KLWA 1TY2A 1U0LA 4KD4A 1JR0D 4APVA 2IX3A 1N8RC 1CZGA 3PIO3 2ZXOA 4LFAQ 4WJ4A 5LL6X 4AQYL 4A3IB 5GAEC 3HS0C 3HOZG 1RDPD 5KNCA 4X66Q 2Z4HA 3TQYA 1KC8C 1SNQA 1KXLA 3JAMi 2A6ED 1CQVA 1PZID 3OWEB 4KK7A 1AP0A 2OTLA 3GTOH 2IPKD 3NEMA 1X56A 3I2ZA 3VA5A 4CDCC 4R4CA 1IL2A 1YJWA 1IBKL 4RCNA 2SOBA 4RGTA 3VR4A 2UUBL 4GN5A 3CC2A 1LACA 4ODGA 2MUYA 2CW0D 2UUAL 2RCNA 4KJNA 1RTNA 3D4WA 4X64Q 4LFBL 5IGCA 2ZJQA 1QVCA 1G2TA 3S1QH 1X3FA 1ZYRC 1VQKA 4A3MG 2JA8B 2XSCA 4BY7H 1NTGA 1PXUA 3NTKA 3CCQA 4CBVA 2PZTA 2XVSA 3HKZB 4MN3A 4A3JB 1XNQQ 2KHJA 2JA5H 3J7A5 3RN2A 1N36Q 1AW7A 1KTKA 2YYZA 2AWNA 5JEAH 2X69A 5C4XB 3BZCA 1DOMA 1RHPA 3OIQA 1I5FA 2E2IB 3M3YH 1FR3A 3UDFA 1EU4A 2JQOA 4GOPC 1W6JA 3DHQA 4EQNA 5C3XA 4A3CG 3J7AF 5M5WB 1V1QA 1K9MC 4BBRB 1SRUA 2YTXA 1D5ZC 2EOTA 1OXTA 4PZ6A 3K5MA 1SLJA 4A3DG 4NKLA 2B8GA 2HCCA 1VMCA 3VR3A 3IL8A 4GN3B 3VDYA 3M4QA 1YITA 2L4NA 4RG1A 2KCNA 4UDUC 4TRDA 3S1MB 3D6WA 1RIPA 4KLKA 5M5YB 3U9SA 5AJ3Q 5CV7A 1HA5A 4N9TA 4DV3L 2F0LA 2A69C 1KRTA 5DM73 3RN5A 5IWAL 4X6AH 1OXSC 1IKMA 4JV5Q 3I73A 4X64L 4LFBQ 3NWTA 5BR8Q 1SMXA 3EVQA 2DY7A 2AUKA 1NR4A 1O80A 5IYDH 1PDQA 1MGSA 3BJUA 4JI6Q 4B3TQ 1CKMA 4JK1C 1HR0Q 3NSWA 5C3EH 1WTRA 5I6WA 2RF4A 1YBYA 3DWQA 1L1OA 3LWUA 3H3VC 3K5OA 2EYOA 4CJ0B 1O78A 4R8NA 2LXJA 1SMYD 4LF6L 4NP5A 3STBC 2EQSA 2G5DA 2R7DA 3UE1A 1UE5A 1HPCA 3GTLH 2F0DA 2Y0SG 2RDHA 1I94Q 2A74C 2QILA 2B63G 3KJOA 4A3GH 2PI2A 3N6RA 5EQ0A 1EYGA 4M1UB 5BR8L 1SNMA 1I6HB 1OXUA 1QCBD 1L1OC 2K5VA 3GP7A 3EFXD 1EY5A 2KA7A 4A76A 1EWHA 3BVMA 1A6XA 2PNHA 3EA6A 3NQTA 4K5VA 4M8AA 1L0YB 2WP8J 1Y69U 1I94L 2A6HC 1K3BC 2GVAA 2D2CC 3LGJA 1CUKA 1S5DD 3ERQA 1G91A 3W3AA 2M00A 1GVPA 1TIID 3FKIH 4J6HA 2CQAA 4G7HC 1LUZA 4L6TB 5EAYA 3KOJA 3O13A 3OOCA 4C3JH 1GM5A 2C9OA 4B3TL 1K8GA 1O7LA 2CWPA 3BS1A 3K80C 2QA4A 3K6OA 2HCIA 1HJPA 4L5TA 1NE3A 1WTWA 1PYWD 1WCMG 3A5UA 4ZKCB 5C4XG 4QJFA 3NK9A 2MP1A 4CJ1B 2MGSA 1ESRA 4QIWE 1YNND 1JICA 4DK1A 4C3HG 3K8AA 4V0BA 4X3SA 1HUNA 3J81L 3S1MH 1TS2A 3MZ5A 4AYBG 4BWGB 1UE7A 1E1OA 4GKJQ 1Z6HA 1GKHA 4IOAA 4JBJA 1IBKQ 5CBAE 3T53B 4R8IA 1EZ6A 1SJHD 3PUZA 4BA1I 3QO2A 4HMIA 3HEJA 2R61A 3I55A 2E2JH 1IKLA 3S1NB 1CHPD 4ZK9B 2KENA 4QQBX 2KCMA 3K7AB 2JA7B 3A56A 4YCVA 3G6JB 5M3MH 1HFNA 2HIVA 3M4YA 4KHZA 3I4MH 3QWNA 3PF5A 1YJNA 4OWTB 2EYHA 2VZAA 5T1GA 3X3MA 4LFCL 3TMEA 3KF6B 5K36G 1IBLQ 4JI8Q 1TR5A 2E5LQ 4Q0FA 5L37A 3TREA 3NQIA 4WFN3 2UUBQ 3GTGB 5FJ8H 1J6QA 1E24A 2JA9A 5C44G 1Q1BA 2WIIB 3MXPA 1ENCA 2RDFA 2E2JB 3STBD 1EOVA 3CPFA 4IPGA 1JC7A 1SMYC 4DR2Q 2BA1A 3BVGA 3J80L 2NZ1D 1JWUD 1CKNA 4A93H 2JA6H 5EPJA 4MTNA 5JVG3 1QUQB 1LLRD 2NVTB 2B2VA 1R4QB 1BF4A 1Q12A 1FNUA 2IHFA 5LMNQ 1J5EL 1VQIA 2RBMA 2ES2A 3PO2G 3VYRA 5IP9H 5K36H 3BYYB 4OXPA 2UXBL 2QF7A 3VYSA 4QL5A 4JPBW 1EU3A 1TWHB 1NJIC 4IUPA 1SNCA 3FP9A 3RR5A 1EQVA 4FP5D 1JQYD 3AYHB 1PLFA 1WTHA 3TZUA 4BA2I 1W3SA 2BDOA 3FDTA 3OW2A 2BDNA 2DJGC 3P75A 2R93B 2Z4IA 2AUJD 5CV8A 5C44H 5CYUA 5FJ8G 3S2DB 1YNXA 1VQGA 2CWAA 4C1NK 1I3QH 1ET6A 1HNXL 1DOLA 1NUCA 1PH7A 2Z6KA 1RF2D 1VQ8A 4BXXH 3A55A 5IGBA 3CQZB 3M7GA 2QDBA 1D2BA 3MVVA 3J7ZC 3S17B 4P73A 4IFDI 1MI2A 1WVLA 1V8QA 2E2HB 3R2TA 2F0NA 1M4VA 1XTCD 4FO2A 3CCJA 4S3SA 1E22A 3RZDH 3D0FA 3PO3G 1AN8A 3UDIA 1KIXA 4B08A 3NHHA 4KI0A 3I4NH 1BKBA 5FLMG 4TKOB 1BXTA 1XXGA 1WJJA 1Y1WH 1PTOB 4U68A 5LL6S 2VXWA 5AJ3L 4F8MA 1TS5A 3MTSA 1EQQA 3H6MA 3MFGA 5JAVA 2A73B 4A3GB 1D6EC 1K73C 2F3VA 2EJFC 1PTOD 4DR1L 1XYIA 5FO7B 2XRQD 1EQRA 1E1TA 4L63B 1UUPA 2OF1A 3GTLB 4DNRB 2XGTA 5DAUA 1SFOH 2B29A 3FPUB 4XQJA 4RHRA 4DA2A 1H9MA 3U50C 3HFZB 4Q5VA 3P1HA 4B3SQ 2A6EC 3KLSA 2PMZE 3PV0A 4A3LH 1XMOL 1MKHA 2FXQA 1SYGA 4KY6A 3PUVA 3OMCA 3GTPB 2N88A 2CH4W 1GHKA 1GUTA 2CQOA 2D5DA 2ATWA 2ZTCA 3GTJB 1PRTF 2R7ZG 1ML0D 2F0JA 2Q8RE 2K4KA 4X3KA 1XPOA 1Y8PB 1DCZA 3KF6A 3CCLA 3L3OC 5J1ZA 4DAVA 1PH3A 3GTKH 3RUZA 5C0XH 5CC4A 4FXGC 1HQRD 1SE4A 5EJWA 3KBXA 1PV4A 2F52A 1EY8A 4Y7NB 4DAYA 2DGYA 3AQQA 4IJHA 5DM63 1QVFA 2K28A 4XTCS 4RH6A 3Q8DA 4HR7B 4U673 2K03A 1BVSA 1HCZA 2B3GA 1A2UA 5KYLA 4RKBA 1B9NA 1K8OA 2Y0SB 4Y52H 3CU7A 1DYQA 4CDFC 4DFAA 3MEHA 1GUOA 4OEMB 1STEA 1UEAB 3H91A 4L8JA 2DNCA 1JOKA 3BYTB 3EBEA 2I5LX 1VQOA 2IHEA 3M3YB 1RKNA 3C46A 3GV6A 4RA8A 4DN4M 4CJ2C 3T56B 5M5XB 5FKAC 3A5ZB 3TBIB 4TVAB 4C1NI 4PMWA 1CTMA 3QG1A 2CHBD 2X6LA 1HNWQ 2L0CA 3SK4A 3S2HB 2EXDA 3FKIB 4YCWA 1STNA 4P2CB 2NTTA 1EUJA 3S1QB 2PYKA 4ZRZA 4GLXA 3I4NG 5IGDA 3G7LA 1QZGA 2D9UA 3OIPA 2VY3A 3K7UC 1FD7D 1GHJA 5D65A 5IOCA 3HP3A 2HUGA 2WB1E 3SHLA 3KF8A 5BN4A 2JJQA 5D3IB 5F2DA 5LMNL 1ET9A 3NBHB 1VQNA 5IYBH 4YWKA 4F87A 2L1BA 5CBEE 1SNOA 1H9JA 1B9MA 4JG2A 2UUCQ 1Z9FA 5JEAG 3W5OA 3U58A 1WTPA 1VQHA 2RSOA 3VR6A 2K5WA 3CKIB 4JBWA 4C3HB 4LF9Q 5I2XA 4BY7G 4DXGA 4JV5L 3H0GH 3J80i 1OO9B 4LFCQ 1NY4A 2N3SA 2EYFA 3A8KE 1Z47A 3H15A 2NVQB 1UNSA 5I9PA 1X54A 3S1RH 2AQ3B 2F0TA 4CDEC 1DD2A 2Z6BA 4X65L 3GTMB 3ONAB 4C2MB 2QCPX 4R4QA 1DOKA 2Q2UA 4NB3A 3FPPA 2FINB 1K83B 5FLXc 3NP8A 4A3BH 3A0JA 5C4JH 3HZXA 3JC66 3PIP3 3ITPA 1E2ZA 2NB0A 3HOWH 4A3BG 4K2LA 3UDXA 4F7XA 2F0QA 3KK7A 2A68D 3TP8A 1Q82C 4B3SL 1CKNB 3LWEA 1GD7A 4LAAA 4HIOA 2VQEL 3J81j 2VQEQ 3C1EA 4ZKBB 4PV1C 2O5IC 5EPKA 3VR2A 2UXCQ 3P20A 5KIXA 4DUZQ 2B2YA 1JWMD 1TT2A 3T13A 3DM3A 3HKSA 4OO1H 1ESFA 4OWWB 1S40A 1D5MC 2LSSA 2J0TD 4HJ5A 3S1NH 1HQMC 3DM1A 2F3WA 4B9WA 1B70B 1JOOA 3J7AV 4OGQC 4POFA 3CCRA 3MA2B 5HURA 4ZUIA 2IJ0A 2XNAC 2EY6A 5A35A 1D8LA 3DXJC 1U9RA 1KAAA 4JCVE 1YNJD 5JJLA 4LK1C 1SR3A 2FMCA 1JJ2A 1K83H 3K5NA 4UP9A 1VQ6A 5BN3A 2JEBI 1WD0A 1WD1A 5CR3A 3H0GG 3Q22A 1AZQA 3W2DA 2N49A 5EKKA 3M4PA 3ZJYC 3HOXG 2B2VC 2OTJA 2OT2A 3NTHA 2EDGA 1X32A 4GZYC 3T1HL 2I0QA 4DK0A 1ILPA 3D8GA 4C3HH 2K04A 1G6ZA 1V1OA 3GTQB 2DJFC 5J22A 1CI3M 4JI4L 4DR1Q 1EL0A 2C35B 5KNBA 2Z8LA 1VQCA 4LF8L 2RDGA 4OL7A 4BBRH 2NUCA 3E0JA 4I7ZC 1STBA 4L5RC 4DAPA 2B39A 1Q8KA 5KYIA 4B3RL 3DUZA 4RWSC 1Q3LA 3DEPA 3VA7A 4ILWA 2PPBC 1OXVA 2CVRA 4FYDA 4LF9L 3KLSX 4AIMA 3HOUB 1QVGA 3RD4A 4JI2L 1IYUA 2ZM6Q 2EZVA 1SE8A 3U4ZA 2JA5B 4H02A 3IRBA 2MPMA 4QCLA 4NPSA 2PQEA 1YZ6A 4HSPA 3BU2A 4MTKA 4NDXA 1B3AA 2D0OA 1I4HA 1B7YB 2K33A 2KEEA 3Q23A 1I6HH 2IX0A 1X65A 1F77A 2EYLA 1GUWA 3CW2C 4GS3A 5H1SE 2PW5A 2EYPA 4EQOA 1BQQT 1VQMA 4ZLTF 3EROA 4JI3Q 4H13C 4MZ9A 2F4VL 5DLQE 1XJVA 4R1JA 3AFPA 3HG9A 1AEXA 3I4OA 4HIDA 2K5QA 5E7NA 4GNXB 2BE5C 4A3LG 5LMUL 4LF5Q 1EY7A 1LYLA 3UI2A 1PMRA 2B2YC 4HSVA 4N8X1 2IT1A 3EN2A 1GUNA 1SE3A 3Q0AA 1EYCA 3GV3A 1E0BA 1XMOQ 2PZWA 3BDLA 1R9TH 3T1HQ 1O7YA 5KNDA 4V190 2F0FA 4KJOA 1Q86C 5AFWA 3GTKB 4HIMA 1WYDA 2NVQH 2GA4B 4JYAQ 1DONA 1DXMA 3HOZB 4AH6A 5C0XJ 1A3UA 2HDMA 5K5PA 3HOUG 2I5HA 1LTBD 3URYA 2DUDA 1F9SA 1MSHA 1VDZA 2LFNA 1CT1D 1SYCA 3E0EA 4XT3B 2NYZD 4IFDH 3F2BA 3Q24A 1YI2A 4DV2Q 4ME3A 3NELA 5M3FB 1GUSA 5IT9c 1EEFD 3J81i 2K50A 3MXGA 3KYHC 3S16B 1IXRA 2Q2HA 3UDGA 2LMCB 4GNXC 3HOWB 3K0XA 2ZTDA 5JEAJ 2PW7A 2XN9C 2PNRC 1Q7YC 2CCZA 1WI5A 1EWCA 1VS0A 3SK5A 1JOQA 2KHIA 1I3QB 4C2MH 4JBMA 1XMQL 4A3CH 1STYA 1SNDA 1N9WA 3S15H 1RODA 3E3XA 1H9SB 1DJRD 1TKWB 4A3JH 3SE0A 4UPAA 3NUCA 1IYJB 3H0GB
chains in the Genus database with same CATH topology
2R3ZA 1FNWA 3D31A 1ZEQX 4PNYA 2VUMB 3BVZA 4ULLA 3DWAA 4XDXA 2E76C 1H9KA 3VYUA 3I72A 2OEOA 2F0EA 1WTQA 3HOVB 1YNNC 4FNFA 3C3LA 2JE6I 3OMGA 5EBDA 3IFDA 2F0VA 2I07B 3J81E 4WRDA 5CMDA 3PO2B 1QWYA 1A2TA 2EY5A 2TMPA 3C2PA 1Y8NB 5KGUA 2K32A 2NN6H 5IGGA 4IUNA 1CZWA 1KDAA 2ZXRA 4AYBB 3T51B 3ND8A 4IUQA 1D1KA 3T16A 2BOSA 4G57A 2B2WA 2RSNA 4XT1B 2A5HA 3FRPB 1BCPB 2A6HD 5C5MA 5C5LA 1ILQA 2JA6B 3E6ZX 2NVXB 2F0IA 2AQ2B 1VCIA 2A68C 4A3KB 5DEHA 3QB3A 2XWJB 3RMHA 5EKLA 4K8JA 2F0UA 2N55A 1JCKB 3DWPA 4XQQA 1VMPA 4DU9A 1CQFA 4DNTB 1ZKOA 2HQEA 2XWBB 3MC0B 3A8IE 1B50A 3NBHA 3LX0A 3QIAA 4QUFA 5A2QE 2NWGA 3PMFA 5IT9L 1A3TA 1PRTB 3J7YW 4A3BB 1I4RA 1F9QA 3I4NB 3Q6SA 1SEBD 5IODA 4HCEA 5G3LD 1EY4A 4YIJA 1FGBD 3OHXC 3PUWA 1EYDA 1IW7C 2JP1A 1LTAD 3HGBA 5T1IA 2B2TA 1TWCB 2O5JC 1ZXTA 3V2TA 4KN7C 5E4WC 1W6KA 1WCMB 1WTOA 1PZKD 1LV9A 4OIJA 1F2YA 1VF5C 5J39A 2Z1CA 3QOJA 3EJIA 3NXWA 3K0YA 2F0GA 2H4OA 4KKUA 2SDFA 2JYOA 3L7ZC 4EGVA 2JXMB 2B2UC 2TSSA 2NN6I 3RZDB 2MJ8A 3SVMA 3T4AC 5JJZA 4OO1G 1QILA 5LHY1 4KTAA 3KLRA 2YU9B 4A93B 3FVQA 2RA4A 2SEBD 1NSNS 1CK1A 1S5BD 1I4PA 1PZJD 3BDCA 1DZ1A 1AFPA 2L5TA 1EFID 2J7ZA 5JOBA 1S5CD 5C6AA 2Q8TA 4KHVA 3J80E 2R6GA 4HEDA 3D3RA 1G2SA 2VNUD 1HTLD 3WOEA 3FEWX 3CRLC 4H0LC 4PMCA 4BY1B 1C48A 4PMBA 5I2YA 5COYA 5JVH3 1TU2B 1XX8A 5CV6A 3S9WA 4K6LA 1SYBA 1KDCA 1AZPA 1EYAA 1HTPA 1PTOF 5BN5A 5C0XI 5EBCA 1JORA 1EY6A 3P7JA 3A7AB 1IW7D 3AU7A 2MHVA 2BA0A 4UAIA 4RFBA 5DNFA 4ME5A 4QB4A 4CKCA 2ICIA 4A3FB 1RTOA 1B4OA 2KOLA 2PO4A 3NBIA 2ZT9C 3RZOB 2KVMA 2L55A 5M3MB 3ZYYX 1XWEA 4H7BA 1PRTD 2K05A 1TQOA 2KQ3A 4PQXA 4EVOA 1SYEA 3H94A 3DMUA 5HGTA 3OW7A 5ELCA 5FOBB 3GTOB 1LT6D 1H9SA 1HXYD 3TP5A 1PTOH 2KHSA 4RHSA 5C4ZA 4G7OC 5IGFA 4QMGA 1GOZA 1SBBB 3NWSA 1HFGA 2O4XA 4WORA 1G8ZD 2EYMA 3IKJA 1E2VA 4ZQ3A 1C8CA 1RJTA 3I91A 2NVYB 3D6CA 4XIGS 3AB9A 1KNEA 4MHEA 4R9WA 1Q90A 1EY0A 2RKSA 4K2KA 1IYVA 3E5SA 3V05A 2C5CA 4C3JB 3M85A 1F9RA 2EY2A 5EGTA 2IX1A 1EOTA 5ELDA 5CV9A 4XXEA 2M2LA 2RQXA 2O2LD 4O42A 1TWGB 3WDNA 1BCPF 1V43A 1WTXA 4KMUC 1F2ZA 1D5XC 2E75C 1STHA 1T5EA 1YNJC 1TS3A 1ENAA 2NBFA 3D4DA 1T5XD 4IN3A 1SNPA 5EKIA 2WINB 1LTGD 1D1IA 3OSOA 2KCCA 3EQLC 2AWOA 2X6GA 1X3QA 1O7ZA 5I9OA 4X3TA 2ID0A 1STAA 2I46A 1PFBA 5FLXL 1B53A 4KY7A 4ZYSA 4RGOS 1EIHA 5JPNC 2V4DA 2K01A 4RKLA 1J9OA 3SR1A 1TS4A 1Q1EA 4HMJA 4HCSA 5EPLA 2FFKB 4MIUA 2Q8IB 4FXDA 5ISRA 1KNAA 2EXZA 4XYQA 2D62A 2XRSD 4KV6A 4QF4A 1LT5D 3M7NA 1GXDC 1CHQD 1K8MA 4IUTA 4NMZA 1U4LA 4O1NA 2JSOA 3SEBA 1NCVA 1JWSD 3GO5A 4KKSA 4CGYB 2IWHA 3R3OA 1U4PA 4LJZC 1LTTD 3M4OB 2KUMA 1Y8OB 2LKVA 3TSSA 4DGZA 4KD3A 2DNEA 1TVXA 2RVLA 1EIGA 1C4QA 2L12A 2DY8A 3BG3A 5ELBA 3NPPA 3L9AX 2F0SA 4RGMA 3A7LA 5C4JB 4IZ8A 1PFNA 3KBGA 4IFDJ 1SYFA 3PUYA 1S4ZA 2G9HD 4Z9CB 5CORA 1VF7A 1NR2A 3QOLA 1ONLA 2K6AA 3LNNA 1RCVD 1ICWA 1Y1WB 3QJYA 4RAUC 3I3CA 5E1FA 1JB3A 2BCOA 4FF4A 2FHTA 1S5FD 2KECA 2PMZB 3DEOA 3A54A 3SDZA 3MXNA 4XQNA 1L0XB 5C3WA 4IUUA 3CHBD 4K5XA 3S15B 2WAQB 3F2UA 4RCOA 1LO5D 2WKDA 2F0OA 2LS01 3NE5B 4QIWB 1TY0A 4ZUJA 2M9VA 3JAME 4IUVA 4F88A 4CKBA 3MHBA 3OPOA 2R92B 3MWYW 1SAPA 4C3JG 1I4GA 2EVBA 5KEEA 1QNKA 2R7ZB 1CA6A 3R8BA 3IAYA 2NTSA 2F4IA 4TSSA 5NUCA 5IGEA 2EPBA 1ZYRD 1QB5D 4BBSB 5E4XA 3MFYA 1TWAB 1PTOC 2DN8A 2CW0C 3BZDB 5C0XG 4ABNA 1R9TB 1STGA 5IT9E 2PZUA 5KRUA 3WOFA 4HN7A 1CA5A 1H9RA 1LTID 4QUCA 3N52A 1F9PA 2AQ1B 5IIFA 4BY7B 1I4QA 4KY5A 1MBYA 4A3EB 4IQZA 1U4RA 4G4KA 3VYTA 1SJED 3NTIA 2K1BA 4G7ZC 2ENBA 4HTHA 1M8AA 2LY7A 1GUGA 2B8FA 1BUVT 4CHTB 5E3FA 4OHJA 1TWFB 2XIWA 5D14A 4ID6A 1R4PB 2J4XA 2VB2X 3ND9A 4N9PA 1Q8IA 5A2QL 1A15A 1B44D 1IHZA 3SK6A 3K59A 4TQUS 4NW2A 1CM9A 2A69D 2F0PA 1RD9D 4I65A 2G9DA 3KUPA 4FXKC 4IURA 2QEJC 2KJXA 3VR5A 1LTRD 1PFMA 1HRJA 5ELFA 2NN6G 1Y1VB 2ZXPA 4FVMA 3H09A 2SNSA 5D3DA 2FMMA 2L11A 1IL8A 1HHVA 1Z7TA 1NAPA 4OO1I 1LT3D 1SDFA 3K58A 1KLGD 5FO8B 4J8QA 1WTVA 1BCPD 1HA6A 3TDQA 1EY9A 1UAPA 3JAML 4XYOA 5C44B 1F2MA 2IW3A 3X3NA 3TP6A 1F2LA 1SE2A 3CRKC 4DF7A 4KKTA 5C4HA 2JEAI 4WJWA 5ELEA 3GQBA 4K8IA 2EJMA 4B9XA 3BDOA 1FNVA 3RLFA 2B2UA 3MAQA 4ZAIA 2VB3X 1V1PA 5I4DA 4FF1A 3GD7A 1U4MA 1HUMA 1B1ZA 2IL8A 3TP7A 4KN4C 1DM0B 1LABA 2H1EA 2K7VA 4K14A 1BR9A 1BO0A 3HOYB 4E6IA 1EQTA 3HRZC 1I6VC 4OIKA 5G3LF 2KEDA 3R93A 4A3MB 4C3IG 1E2WA 1ENFA 4IFDG 1QG7A 1FYCA 4H44C 2B63B 2QKIC 2FJ2A 2EE1A 3IFTA 3V96A 3D4RA 1BOSA 2WKCA 2EY1A 1I4XA 3I90A 4X3UA 2EJGC 5FLXE 4RGNA 3I8ZA 5JPMC 2B2TC 3TZDA 3K57A 4HAEA 4FF3A 1OXXK 4IALA 2BE5D 3C1FA 5I6YA 3AMUA 2PCFB 2E74C 2L9HA 1X3PA 2ICEC 1EEID 3R2IA 4EQPA 3SXHA 4CKEA 1JE4A 3MXUA 3S14B 2WACA 1PRTC 3TN2A 2WV6D 3I4MB 4C56C 1QJOA 4J1MA 1LTSD 4A3DB 2E2DC 4C3IB 1BDOA 2B2WC 1MD2D 2F0KA 2F1MA 1EZ8A 4LMQD 5CGKA 5CV4A 3SK8A 3PO3B 1BNZA 1B2TA 2EYJA 1BBXC 1A3VA 1S5ED 1CFMA 2F0MA 1BCPC 1KLUD 1SXTA 4BS9A 5TSSA 3I4LA 2WB1B 4FF2A 1SSOA 4K6DA 5M9OA 3FMCA 1I50B 1G291 2K5DA 1GJXA 1KDBA 2F0HA 2OXPA 2F03A 5FK9C 3K5LA 1KABA 2HDLA 3A8JE 3OWFA 1J8IA 1II3A 5C3EB 1QOHA 1SFOB 3HOXB 1LT4D 3U9OA 3I70A 2F0WA 1V1PB 3PUXA 4DXFA 3S1RB 1QE6A 4K5WA 1QNUA 2SNMA 1SYDA 5CV5A 5FO9B 1MSGA 1TY2A 4KD4A 1JR0D 2IX3A 1CZGA 3PIO3 2ZXOA 5LL6X 4A3IB 3HS0C 1RDPD 5KNCA 2Z4HA 1SNQA 2A6ED 1CQVA 1PZID 3OWEB 4KK7A 1AP0A 2IPKD 3VA5A 4RCNA 2SOBA 4RGTA 3VR4A 1LACA 4ODGA 2MUYA 2CW0D 4KJNA 1RTNA 3D4WA 5IGCA 1G2TA 1ZYRC 2JA8B 2XSCA 1PXUA 3NTKA 4CBVA 2PZTA 2XVSA 3HKZB 4MN3A 4A3JB 1AW7A 1KTKA 2YYZA 2AWNA 5JEAH 2X69A 5C4XB 1DOMA 1RHPA 3OIQA 2E2IB 1FR3A 1EU4A 1W6JA 3DHQA 4EQNA 5C3XA 3J7AF 5M5WB 4BBRB 1D5ZC 2EOTA 1OXTA 3K5MA 4NKLA 2B8GA 2HCCA 1VMCA 3VR3A 3IL8A 2L4NA 2KCNA 4UDUC 4TRDA 3S1MB 3D6WA 5M5YB 3U9SA 5CV7A 1HA5A 4N9TA 2F0LA 2A69C 5DM73 1OXSC 1IKMA 3I73A 3NWTA 3EVQA 2DY7A 2AUKA 1NR4A 1O80A 1PDQA 1MGSA 4JK1C 3NSWA 1WTRA 5I6WA 3DWQA 3LWUA 3H3VC 3K5OA 2EYOA 4CJ0B 1O78A 4R8NA 1SMYD 4NP5A 1HPCA 2F0DA 2RDHA 2A74C 2QILA 3N6RA 5EQ0A 4M1UB 1SNMA 1I6HB 1OXUA 1QCBD 3GP7A 3EFXD 1EY5A 2KA7A 1EWHA 3BVMA 1A6XA 3EA6A 3NQTA 4K5VA 4M8AA 1L0YB 2WP8J 1Y69U 2A6HC 2D2CC 1S5DD 3ERQA 1G91A 3W3AA 2M00A 1TIID 4J6HA 2CQAA 4G7HC 4L6TB 3O13A 3OOCA 2C9OA 1O7LA 3BS1A 3K6OA 2HCIA 1WTWA 1PYWD 4ZKCB 3NK9A 2MP1A 4CJ1B 2MGSA 1ESRA 1YNND 1JICA 4DK1A 4C3HG 4V0BA 4X3SA 1HUNA 3J81L 1TS2A 3MZ5A 4BWGB 1Z6HA 5CBAE 3T53B 4R8IA 1EZ6A 1SJHD 3PUZA 4BA1I 3QO2A 4HMIA 3HEJA 2R61A 1IKLA 3S1NB 1CHPD 4ZK9B 3K7AB 2JA7B 3A56A 3G6JB 1HFNA 4KHZA 3M4YA 3QWNA 2EYHA 5T1GA 3X3MA 3TMEA 5K36G 1TR5A 4Q0FA 3NQIA 4WFN3 3GTGB 1Q1BA 2WIIB 3MXPA 1ENCA 2RDFA 2E2JB 1JC7A 1SMYC 2BA1A 3BVGA 3J80L 2NZ1D 1JWUD 5EPJA 5JVG3 1LLRD 2NVTB 2B2VA 1R4QB 1BF4A 1Q12A 1FNUA 2RBMA 3VYRA 5K36H 3BYYB 2QF7A 3VYSA 1EU3A 1TWHB 4IUPA 1SNCA 1EQVA 4FP5D 1JQYD 1PLFA 3TZUA 4BA2I 2BDOA 3FDTA 2BDNA 3P75A 2R93B 2Z4IA 2AUJD 5CV8A 5CYUA 3S2DB 4C1NK 1ET6A 1DOLA 1NUCA 1RF2D 3A55A 5IGBA 3CQZB 3M7GA 2QDBA 1D2BA 3MVVA 3S17B 4IFDI 1MI2A 1WVLA 1V8QA 2E2HB 3R2TA 2F0NA 1M4VA 1XTCD 4FO2A 4S3SA 1AN8A 4B08A 3NHHA 4KI0A 4TKOB 1BXTA 1XXGA 1PTOB 4U68A 5LL6S 2VXWA 4F8MA 1TS5A 3MTSA 3H6MA 3MFGA 5JAVA 2A73B 4A3GB 1D6EC 2F3VA 2EJFC 1PTOD 1XYIA 5FO7B 2XRQD 4L63B 1UUPA 2OF1A 3GTLB 4DNRB 5DAUA 3FPUB 4XQJA 4RHRA 4DA2A 1H9MA 4Q5VA 3P1HA 2A6EC 3KLSA 3PV0A 1SYGA 4KY6A 3PUVA 3OMCA 3GTPB 2N88A 1GHKA 1GUTA 2D5DA 3GTJB 1PRTF 1ML0D 2F0JA 2Q8RE 4X3KA 1Y8PB 1DCZA 3L3OC 5J1ZA 4DAVA 5C0XH 3RUZA 5CC4A 4FXGC 1HQRD 1SE4A 5EJWA 3KBXA 1EY8A 4Y7NB 4DAYA 5DM63 2K28A 4XTCS 4RH6A 4U673 4HR7B 2K03A 1HCZA 1A2UA 5KYLA 4RKBA 1B9NA 1K8OA 2Y0SB 3CU7A 1DYQA 4DFAA 3MEHA 1GUOA 1STEA 1UEAB 3H91A 4L8JA 2DNCA 1JOKA 3BYTB 3M3YB 1RKNA 3C46A 3GV6A 4RA8A 4DN4M 4CJ2C 3T56B 5M5XB 5FKAC 3TBIB 4C1NI 4PMWA 1CTMA 3QG1A 2CHBD 2X6LA 2L0CA 3SK4A 3S2HB 3FKIB 1STNA 4P2CB 2NTTA 3S1QB 2PYKA 4ZRZA 5IGDA 3G7LA 2D9UA 3OIPA 1FD7D 1GHJA 5D65A 5IOCA 3HP3A 2HUGA 3SHLA 3KF8A 5BN4A 5D3IB 5F2DA 1ET9A 4F87A 2L1BA 5CBEE 1SNOA 1H9JA 1B9MA 5JEAG 1WTPA 2RSOA 3VR6A 2K5WA 3CKIB 4JBWA 4C3HB 5I2XA 4DXGA 1OO9B 2EYFA 3A8KE 1Z47A 2NVQB 1UNSA 5I9PA 2AQ3B 2F0TA 1DD2A 3GTMB 3ONAB 4C2MB 2QCPX 1DOKA 3FPPA 2FINB 1K83B 3NP8A 3HZXA 3PIP3 3ITPA 1E2ZA 2NB0A 4K2LA 4F7XA 2F0QA 3KK7A 2A68D 3TP8A 4LAAA 3LWEA 3C1EA 4ZKBB 4PV1C 2O5IC 5EPKA 3VR2A 3P20A 5KIXA 2B2YA 1JWMD 1TT2A 3T13A 4OO1H 1ESFA 1D5MC 2J0TD 1HQMC 3DM1A 2F3WA 4B9WA 1JOOA 3J7AV 4OGQC 3MA2B 5HURA 4ZUIA 2IJ0A 2XNAC 2EY6A 5A35A 3DXJC 1U9RA 1KAAA 1YNJD 4LK1C 2FMCA 3K5NA 5BN3A 2JEBI 1WD0A 1WD1A 5CR3A 3Q22A 1AZQA 3W2DA 5EKKA 2B2VC 2OT2A 3NTHA 2EDGA 1X32A 4GZYC 4DK0A 1ILPA 3D8GA 2K04A 1G6ZA 1V1OA 3GTQB 5J22A 1CI3M 1EL0A 5KNBA 2Z8LA 2RDGA 4OL7A 2NUCA 3E0JA 4I7ZC 1STBA 4DAPA 2B39A 5KYIA 3DUZA 4RWSC 1Q3LA 3DEPA 3VA7A 4ILWA 2PPBC 1OXVA 2CVRA 4FYDA 3KLSX 3HOUB 3RD4A 1IYUA 2EZVA 2JA5B 2MPMA 4QCLA 2PQEA 4HSPA 4NDXA 1B3AA 1I4HA 2K33A 2KEEA 3Q23A 2IX0A 1F77A 2EYLA 1GUWA 2PW5A 2EYPA 4EQOA 1BQQT 4ZLTF 3EROA 4H13C 3HG9A 1AEXA 2K5QA 2BE5C 1EY7A 3UI2A 1PMRA 2B2YC 4HSVA 2IT1A 1GUNA 1SE3A 3Q0AA 1EYCA 3GV3A 1E0BA 2PZWA 3BDLA 1O7YA 5KNDA 4V190 2F0FA 4KJOA 5AFWA 3GTKB 2GA4B 1DONA 1DXMA 3HOZB 5C0XJ 1A3UA 2HDMA 5K5PA 1LTBD 3URYA 1F9SA 1MSHA 1VDZA 2LFNA 1CT1D 1SYCA 4XT3B 2NYZD 4IFDH 3Q24A 5M3FB 1GUSA 1EEFD 3MXGA 3S16B 2LMCB 3HOWB 5JEAJ 2PW7A 2XN9C 2PNRC 1EWCA 3SK5A 1JOQA 1I3QB 1STYA 1SNDA 1RODA 1H9SB 1DJRD 1TKWB 3SE0A 3NUCA 3H0GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN4 C;  4L8J A;  2DNC A;  1LAB A;  4PV1 C;  2K33 A;  3D31 A;  3AB9 A;  4XIG S;  3VR2 A;  2O5I C;  3M7N A;  2K7V A;  4RCN A;  1HPC A;  3CRL C;  3P20 A;  1Q90 A;  3VR4 A;  4KI0 A;  4H0L C;  1IYV A;  1K8M A;  1CFM A;  3T56 B;  3NE5 B;  3ND9 A;  4TKO B;  4OO1 H;  1I6V C;  1LAC A;  1TU2 B;  3N6R A;  1CTM A;  4H13 C;  3QG1 A;  3M85 A;  4KHZ A;  3M4Y A;  3I4L A;  1HQM C;  1OXU A;  1E2W A;  2E76 C;  3OPO A;  1ZYR C;  4TQU S;  1H9K A;  2BE5 C;  4IFD G;  2A69 D;  4KKS A;  4OGQ C;  1HTP A;  1FYC A;  3PUW A;  3I72 A;  1IW7 C;  4H44 C;  2KA7 A;  1EWH A;  5K36 G;  5BN5 A;  1A6X A;  2EVB A;  3IFT A;  5A35 A;  3DXJ C;  3FMC A;  4LJZ C;  1PMR A;  1YNN C;  3HGB A;  3VR5 A;  2EJF C;  1G29 1;  3A7A B;  1GHJ A;  1IW7 D;  1Y8O B;  2IT1 A;  2JE6 I;  4LK1 C;  3WDN A;  2YYZ A;  5JEA H;  2O5J C;  1GJX A;  2BA0 A;  3D4R A;  2NN6 G;  4KN7 C;  1GUN A;  1Y69 U;  5BN3 A;  2A6H C;  2JEB I;  1Q1B A;  4DNR B;  5BN4 A;  1V43 A;  1VF5 C;  2DNE A;  1FR3 A;  2D2C C;  2EJG C;  4KMU C;  5KND A;  1Z7T A;  2E75 C;  1SMY C;  2BA1 A;  3A8J E;  3W3A A;  3BG3 A;  2ZT9 C;  3MFY A;  1OXX K;  1H9M A;  1Y8N B;  2EDG A;  2A6E C;  1DXM A;  1T5E A;  1YNJ C;  2BE5 D;  2DN8 A;  2CW0 C;  4G7H C;  2K32 A;  4GZY C;  2NN6 H;  1H9J A;  4KKU A;  1B9M A;  1OXT A;  1Q12 A;  2PCF B;  5JEA G;  4DK0 A;  5C0X G;  3PV0 A;  3OOC A;  2E74 C;  3A7L A;  3L7Z C;  3PUV A;  2JXM B;  2B8G A;  3ND8 A;  3T51 B;  3VR6 A;  3VR3 A;  1H9R A;  1O7L A;  1GHK A;  2NN6 I;  5K36 H;  1GUT A;  2D5D A;  1CI3 M;  1VDZ A;  2QF7 A;  4JBW A;  3PUY A;  2KCC A;  3EQL C;  5KNB A;  2AWO A;  3H94 A;  3PUX A;  4IFD H;  1VF7 A;  1Y8P B;  2A6H D;  3OW7 A;  1DCZ A;  4OO1 G;  3U9S A;  3CRK C;  1GUS A;  3A8K E;  1ONL A;  3KLR A;  3LNN A;  4I7Z C;  3TZU A;  4BA2 I;  2A69 C;  5C0X H;  4KKT A;  1VCI A;  2A68 C;  1H9S A;  2BDO A;  3MXU A;  2JEA I;  1OXS C;  4DK1 A;  2LMC B;  3I73 A;  2AUJ D;  3VA7 A;  1DD2 A;  4IQZ A;  2PPB C;  1OXV A;  2PNR C;  4G7O C;  3QJY A;  1QJO A;  2AUK A;  3GQB A;  2V4D A;  2EJM A;  3FPP A;  4G7Z C;  4XTC S;  2L5T A;  1BDO A;  3BDO A;  1IYU A;  4HR7 B;  1Z6H A;  1HCZ A;  1Q1E A;  3RLF A;  5KNC A;  2F1M A;  1GUG A;  1E2Z A;  3T53 B;  1B9N A;  4JK1 C;  1H9S B;  2B8F A;  4DNT B;  1K8O A;  2A68 D;  2A6E D;  1TKW B;  1ZKO A;  3IKJ A;  3PUZ A;  1E2V A;  3SDZ A;  4BA1 I;  2Q8I B;  3LWU A;  3SE0 A;  1GUO A;  2D62 A;  1V8Q A;  2R6G A;  3GD7 A;  3A8I E;  1O78 A;  3QIA A; 
#chains in the Genus database with same CATH topology
 1X6O A;  2R3Z A;  1FNW A;  3D31 A;  2UU9 Q;  1ZEQ X;  3KJP A;  3F2D A;  4PNY A;  4LUO A;  1N34 L;  2VUM B;  3BVZ A;  1S72 A;  4ULL A;  2JA8 G;  3G6E A;  3DWA A;  4XDX A;  5GAH C;  2E2H H;  2E76 C;  2HQL A;  3ER0 A;  1H9K A;  2V1C C;  3VYU A;  1CKO A;  3I72 A;  3CQZ H;  2OEO A;  2F0E A;  1WTQ A;  2A19 A;  3HOV B;  1YNN C;  4FNF A;  3C3L A;  2JE6 I;  2L15 A;  3OMG A;  2MO0 A;  3KFU A;  5EBD A;  1VQA A;  3W1B A;  1SN8 A;  1B3Q A;  3IFD A;  4DK6 C;  2HHH Q;  1FL0 A;  2F0V A;  2I07 B;  3J81 E;  4WRD A;  3K81 C;  5CMD A;  3PO2 B;  1QWY A;  1A2T A;  2EY5 A;  4L5Q A;  2TMP A;  2MFI A;  1PH9 A;  4JI5 Q;  3C2P A;  1Y8N B;  3PO2 H;  5KGU A;  2MNA A;  1KL9 A;  2K32 A;  2NN6 H;  4OEL B;  5IGG A;  2YV5 A;  4IUN A;  2E8G A;  1CZW A;  1VQ9 A;  1KDA A;  5IY0 A;  2ZXR A;  4AYB B;  2CH4 A;  3T51 B;  3ND8 A;  4IUQ A;  1D1K A;  4JI2 Q;  3I4M G;  3T16 A;  3HOW G;  2BOS A;  4G57 A;  4N8F A;  1X9N A;  2E5L L;  2B2W A;  2K5N A;  2RSN A;  4XT1 B;  4A75 A;  2A5H A;  4K0K Q;  3FRP B;  1BCP B;  2A6H D;  5C5M A;  5C5L A;  1ILQ A;  2JA6 B;  3E6Z X;  2NVX B;  2F0I A;  1EIF A;  2AQ2 B;  1VCI A;  2A68 C;  4A3K B;  5DEH A;  3HKZ G;  4A3J G;  3QB3 A;  2XWJ B;  3RMH A;  5EKL A;  4K8J A;  2F0U A;  2N55 A;  1JCK B;  4NXM Q;  3BZK A;  3J81 c;  3DWP A;  4XQQ A;  4MNO A;  1VMP A;  4BY1 H;  4DU9 A;  1CQF A;  3OTO L;  2K14 A;  4DNT B;  4BBS G;  1X3G A;  1ZKO A;  2HQE A;  4JI5 L;  2XWB B;  3MC0 B;  3A8I E;  1B50 A;  3NBH A;  3ULL A;  4LF4 Q;  3LX0 A;  3QIA A;  1KQS A;  4O0A A;  2Z6K C;  2ASB A;  4QUF A;  5LMN W;  5A2Q E;  2NWG A;  3PMF A;  5IT9 L;  2YTV A;  1A3T A;  3GTJ H;  1XMQ Q;  1PRT B;  3J7Y W;  4A3B B;  1I4R A;  5GRO A;  4GKJ L;  1F9Q A;  3I4N B;  1JJG A;  3Q6S A;  1SEB D;  1IBL L;  5IOD A;  1EIY B;  1S3O A;  4HCE A;  3ULP A;  1N33 Q;  2OQK A;  5G3L D;  1RL2 A;  1EY4 A;  4YIJ A;  3RLN A;  1FGB D;  2N8N A;  3OHX C;  2R93 G;  4GOP B;  3PUW A;  1EYD A;  1PA6 A;  4DV2 L;  1IW7 C;  2VUM G;  3S24 A;  1ICF B;  2JP1 A;  1LTA D;  3HGB A;  5T1I A;  1MJC A;  2B2T A;  5HGQ A;  1TWC B;  1IBM Q;  3CF5 A;  2UXD Q;  1ZXT A;  2O5J C;  3V2T A;  4KN7 C;  1DGS A;  5E4W C;  1W6K A;  1WCM B;  3CP0 A;  1PZK D;  1WTO A;  1LV9 A;  4OIJ A;  1F2Y A;  1VF5 C;  5J39 A;  3B6Y A;  1VQB A;  2NVY H;  2Z1C A;  3QOJ A;  3EJI A;  4GLA C;  3NXW A;  4PZ8 A;  2PQA A;  3K0Y A;  2F0G A;  2H4O A;  4KKU A;  2SDF A;  2JYO A;  4X66 L;  3L7Z C;  4EGV A;  2JXM B;  2B2U C;  2TSS A;  4A3F G;  4AQY Q;  2NN6 I;  1XNR L;  1AE2 A;  3F1Z A;  3RZD B;  1NMF A;  4HJA A;  2MJ8 A;  4ALP A;  3SVM A;  3T4A C;  5JJZ A;  4OO1 G;  1QIL A;  4KTA A;  5LHY 1;  3KLR A;  4LF5 L;  2YU9 B;  3HOV G;  4A93 B;  3FVQ A;  4EX5 A;  4DUY L;  2RA4 A;  2SEB D;  4KHP Q;  1NSN S;  1CK1 A;  3S2H H;  1S5B D;  2BH2 A;  2K5H A;  3NEN A;  3MEF A;  2HD3 A;  1I4P A;  1PZJ D;  3BDC A;  1Y1V H;  1DZ1 A;  1AFP A;  2L5T A;  1EFI D;  4LF7 Q;  2J7Z A;  1W2B A;  5JOB A;  1S5C D;  1K3R A;  3E9H A;  1VQ4 A;  5C6A A;  4JI0 L;  4DR3 Q;  1PVO A;  2Q8T A;  2B63 H;  4JYA L;  4KHV A;  3J80 E;  2R6G A;  4HED A;  3D3R A;  4AYB E;  1G2S A;  2VNU D;  1CSP A;  3ERS X;  1HTL D;  3WOE A;  2WAQ E;  3FEW X;  3CRL C;  1XPU A;  4H0L C;  4DR4 L;  2MO1 A;  4PMC A;  4BY1 B;  2Y0S E;  1C48 A;  4PMB A;  5I2Y A;  5COY A;  4NXM L;  3OYY A;  5JVH 3;  1TU2 B;  1XX8 A;  3TS0 A;  5CV6 A;  4Y7N H;  3S9W A;  4K6L A;  1SYB A;  1KDC A;  1AZP A;  1EYA A;  2D0P A;  3PSI A;  4DV3 Q;  1HTP A;  5M5W H;  1PTO F;  4P71 A;  4DK3 C;  3HOY G;  5BN5 A;  5C0X I;  5EBC A;  1JOR A;  1EY6 A;  2AMC B;  4DR7 Q;  3P7J A;  3A7A B;  1IW7 D;  1UE6 A;  4DAM A;  3AU7 A;  2VQF L;  2MHV A;  2BA0 A;  4UAI A;  4RFB A;  5DNF A;  4ME5 A;  4DR4 Q;  4QB4 A;  4CKC A;  2ICI A;  4UHV A;  1X3E A;  2QW7 A;  4A3F B;  1RTO A;  3RZO H;  1B4O A;  4NXN L;  2KOL A;  2PO4 A;  3NBI A;  1U5K A;  2ZT9 C;  2JA5 G;  1PHJ A;  3RZO B;  2KVM A;  3QR8 A;  2L55 A;  5M3M B;  2HHH L;  1KD1 C;  3ZYY X;  1XWE A;  4H7B A;  1PRT D;  2K05 A;  1MHW C;  5IE8 A;  1TQO A;  1JJC B;  2KQ3 A;  3E9I A;  4PQX A;  4EVO A;  1SYE A;  4A3K G;  3H94 A;  4JI8 L;  4R4I A;  1HZB A;  3DMU A;  5HGT A;  3OW7 A;  5ELC A;  4ZCK A;  5FOB B;  1LT6 D;  3WWV A;  1H9S A;  1HXY D;  2RHS B;  3TP5 A;  3GTO B;  3TS2 A;  4OWX B;  1HNZ Q;  1PTO H;  1ASY A;  3CPW A;  1C0A A;  4DAY B;  2KHS A;  4RHS A;  5C4Z A;  4G7O C;  5ELN A;  4P75 A;  5IGF A;  4QMG A;  1GOZ A;  4JI4 Q;  1SBB B;  2ALY B;  3NWS A;  1HFG A;  2O4X A;  4WOR A;  4GN4 B;  4DUZ L;  1A0I A;  1G8Z D;  2EYM A;  1JB7 A;  3IKJ A;  3CCS A;  5HY6 A;  1E2V A;  3G48 A;  4ZQ3 A;  2JA8 H;  1C8C A;  4YHH Q;  1RJT A;  3I91 A;  4LW1 A;  2NVY B;  3D6C A;  4XIG S;  2F3I A;  3AB9 A;  3OTO Q;  1KNE A;  4CDD C;  1IZ6 A;  4MHE A;  4OX9 Q;  4R9W A;  4DV4 L;  1MJE A;  1Q90 A;  1EY0 A;  2RKS A;  4K2K A;  1IYV A;  2JK8 A;  3E5S A;  3V05 A;  2C5C A;  2XTI A;  3PIP A;  1K28 A;  4RMF A;  4C3J B;  3J80 c;  3JAM c;  3M85 A;  4YCU A;  1F9R A;  1TWF H;  1EFW A;  2R93 H;  2EY2 A;  5EGT A;  5IP7 H;  3KF8 B;  2IX1 A;  1EOT A;  1YVC A;  5ELD A;  3CMA A;  5CV9 A;  4XXE A;  4DV6 Q;  2M2L A;  2RQX A;  1N33 L;  2O2L D;  4O42 A;  1X55 A;  1TWG B;  3WDN A;  5M5X H;  1BCP F;  4P74 A;  4JI1 L;  1V43 A;  4EQ5 A;  1EWI A;  1WTX A;  2UUC L;  4KMU C;  2VL6 A;  1F2Z A;  1L0W A;  1D5X C;  2E75 C;  4GNX A;  2NVT H;  1TXY A;  1STH A;  1PH8 A;  4JBK A;  1D7Q A;  4JVZ A;  1T5E A;  1YNJ C;  3AEV A;  1TS3 A;  1ENA A;  2NBF A;  1YHQ A;  3D4D A;  1T5X D;  4IN3 A;  1SNP A;  4JOI C;  5EKI A;  2WIN B;  2HT1 A;  1UE1 A;  2A8V A;  3GTG H;  3PIO A;  1LTG D;  1TWC H;  2VQF Q;  1E3P A;  1D1I A;  3OSO A;  2KCC A;  3EQL C;  2AWO A;  2X6G A;  1X3Q A;  1NBW A;  1O7Z A;  5I9O A;  4X3T A;  3RNU A;  5LMU Q;  2ID0 A;  1PH2 A;  1XTD A;  1STA A;  3PO3 H;  2I46 A;  2AKW B;  4LWC A;  1PFB A;  1K0R A;  5FLX L;  4K0K L;  1B53 A;  4JOI A;  4KY7 A;  4ZYS A;  3T1Y Q;  4DR6 L;  4RGO S;  1EIH A;  5JPN C;  2WB1 G;  2V4D A;  1GO3 E;  2K01 A;  4RKL A;  2PI2 E;  4B3M Q;  1J9O A;  3SR1 A;  1TS4 A;  5C4X H;  5IYC H;  1Q1E A;  1V9P A;  1E7Z A;  1FJG L;  4GKK L;  2Z9H A;  4HMJ A;  1YEZ A;  4HCS A;  5EPL A;  1B8A A;  2FFK B;  4HJ9 A;  4DV7 Q;  4LUZ A;  2WFW A;  4MIU A;  2Q8I B;  1QZH A;  5ISR A;  4FXD A;  1KNA A;  1SRO A;  2EXZ A;  4XYQ A;  2D62 A;  5M5Y H;  2XRS D;  4KV6 A;  4QF4 A;  2LXK A;  1LT5 D;  3CCM A;  1HZ9 A;  1HR0 L;  4DV1 Q;  3M7N A;  4JI1 Q;  1GXD C;  1CHQ D;  1K8M A;  2CFM A;  4A3G G;  4IUT A;  4NMZ A;  4IJL A;  1U4L A;  1C7Y A;  1N32 L;  4O1N A;  4HJ8 A;  4JI7 L;  2JSO A;  3SEB A;  1NCV A;  1JWS D;  1CSQ A;  4DUY Q;  3DLL A;  1Y14 B;  3GO5 A;  4KKS A;  4CGY B;  2IWH A;  3R3O A;  1U4P A;  4LF8 Q;  3CCU A;  4LJZ C;  1LTT D;  3U4V A;  3M4O B;  2E2I H;  2KUM A;  2JA6 G;  1Y8O B;  1N34 Q;  2R7Z H;  2WAQ G;  1OTC A;  2VUM H;  3CME A;  2LKV A;  3TSS A;  2I5M X;  4DGZ A;  3PGZ A;  4KD3 A;  3GTQ H;  4OON A;  2DNE A;  5IYD G;  1HZC A;  1TVX A;  2RVL A;  1HR0 W;  1EIG A;  1HH2 P;  1PFS A;  3S14 H;  1C4Q A;  2L12 A;  2GN5 A;  1JT8 A;  4J15 A;  2DY8 A;  3BG3 A;  5ELB A;  3NPP A;  3L9A X;  1WOC A;  2GVB A;  5GAD C;  3CC7 A;  2F0S A;  4RGM A;  3A7L A;  3UE0 A;  5C4J B;  4IZ8 A;  4X62 Q;  1VQ5 A;  3HOY H;  1PFN A;  3KBG A;  4IFD J;  1AH9 A;  4DV5 L;  1SYF A;  3PUY A;  1IBM L;  1S4Z A;  2G9H D;  4X65 Q;  4Z9C B;  5COR A;  1K0S A;  3HOX H;  1VF7 A;  1XNQ L;  1C9O A;  1NR2 A;  3QOL A;  4LNQ A;  1ONL A;  2K6A A;  3LNN A;  2Q2I A;  1RCV D;  1ICW A;  1Y1W B;  4IOC A;  3L0O A;  3QJY A;  4RAU C;  4DV5 Q;  3I3C A;  1KAW A;  3CC4 A;  5E1F A;  1JB3 A;  2BCO A;  5ELO A;  4FF4 A;  2FHT A;  3M4O H;  1S5F D;  2KEC A;  1I50 H;  2PMZ B;  3DEO A;  3A74 A;  3A54 A;  3SDZ A;  3MXN A;  1PH1 A;  4XQN A;  1L0X B;  5C3W A;  4IUU A;  4L5S A;  3CHB D;  4A3M H;  4K5X A;  1Y1V G;  3S15 B;  2WAQ B;  3F2U A;  4RCO A;  1LO5 D;  2WKD A;  2F0O A;  3TEH B;  2LS0 1;  3NE5 B;  4IPD A;  4QIW B;  1TY0 A;  4ZUJ A;  2M9V A;  3JAM E;  2OCE A;  1UEB A;  2PQA B;  2QGQ A;  2HIX A;  4IUV A;  2EIF A;  4F88 A;  4CKB A;  1JE5 A;  3MHB A;  3OPO A;  4UY8 C;  4B3R Q;  2VW9 A;  1G6P A;  2R92 B;  3MWY W;  1SAP A;  4C3J G;  4DPG A;  4DV0 L;  1I4G A;  2EVB A;  4A3F H;  4JW0 A;  5KEE A;  1QNK A;  2IY5 B;  2Z0S A;  2R7Z B;  3GDE A;  1WFQ A;  1YHB A;  2KBN A;  1CA6 A;  1YHA A;  4FDB A;  3R8B A;  3IAY A;  2BH8 A;  2NTS A;  1PH6 A;  4LF6 Q;  2KCT A;  2F4I A;  4TSS A;  4UP7 A;  5NUC A;  5IGE A;  5IYC G;  1LM0 A;  1L2F A;  2EPB A;  1ZYR D;  1QB5 D;  4BBS B;  5E4X A;  3MFY A;  1TWA B;  1PTO C;  2DN8 A;  2CW0 C;  4PG3 A;  3BZD B;  5C0X G;  4ABN A;  1R9T B;  1STG A;  4DKA C;  5IT9 E;  2PZU A;  3I7F A;  5KRU A;  3WOF A;  4HN7 A;  4LF7 L;  3W1G A;  3F2C A;  1H9R A;  1CA5 A;  4B3M L;  1LTI D;  4QUC A;  1L1O B;  2JN4 A;  3N52 A;  1F9P A;  2ZTE A;  5IYB G;  2AQ1 B;  1H95 A;  4DV0 Q;  1VQP A;  3PF4 A;  5IIF A;  4BY7 B;  1I4Q A;  4KY5 A;  1MBY A;  1YJ9 A;  4A3E B;  4IQZ A;  1U4R A;  1VQF A;  4G4K A;  3VYT A;  4HJ7 A;  1SJE D;  1NMG A;  2YTY A;  3NTI A;  2K1B A;  5JJI A;  5M3M G;  2UXB Q;  4G7Z C;  4GLV B;  2ENB A;  4HTH A;  1M8A A;  5C3E G;  4OX9 L;  2LY7 A;  1FVI A;  1GUG A;  1P8L A;  2B8F A;  4A3E H;  2NZO A;  3G4S A;  3CXC A;  1BUV T;  3F8T A;  2ZJP A;  4CHT B;  5E3F A;  3I56 A;  4OHJ A;  2RCF A;  1PYB A;  1TWF B;  2XIW A;  5D14 A;  4ID6 A;  1T9H A;  1R4P B;  2J4X A;  2VB2 X;  3ND9 A;  5IP7 G;  2UXD L;  4N9P A;  1Q8I A;  5A2Q L;  4A3I G;  1A15 A;  1B44 D;  3FKI G;  1IHZ A;  3SK6 A;  3K59 A;  4DV6 L;  4TQU S;  4NW2 A;  1CM9 A;  2A69 D;  1Q46 A;  1RD9 D;  2F0P A;  4QGU A;  1A63 A;  4I65 A;  1VQL A;  2G9D A;  4BBS H;  3KUP A;  2OWO A;  4FXK C;  4IUR A;  1M90 C;  2QEJ C;  4BY1 G;  2KJX A;  3VR5 A;  1N32 Q;  1LTR D;  1PFM A;  5J3B A;  1HRJ A;  5ELF A;  1WCM H;  2NN6 G;  1Y1V B;  2ZXP A;  4FVM A;  1TWG H;  1A62 A;  4YWM A;  3H09 A;  2SNS A;  3L2P A;  4DV4 Q;  5D3D A;  2UXC L;  1XPR A;  2FMM A;  2L11 A;  1IL8 A;  1HHV A;  1Z7T A;  1NAP A;  4OO1 I;  1LT3 D;  1SDF A;  3K58 A;  4P72 A;  1KLG D;  2R92 H;  5FO8 B;  3S17 H;  4UP8 A;  3PQI A;  3KDF B;  4J8Q A;  4PZ7 A;  1VQ7 A;  1WTV A;  1BCP D;  2OQ0 A;  1HA6 A;  3TDQ A;  1EY9 A;  3EIV A;  4LFA L;  4IPC A;  3CCV A;  1UAP A;  3S2D H;  3JAM L;  4R4O A;  3MXN B;  4XYO A;  5C44 B;  4DR7 L;  1F2M A;  3T1Y L;  4DR6 Q;  2IW3 A;  3X3N A;  3TP6 A;  5IP9 G;  1F2L A;  1SE2 A;  4YWL A;  2RHQ B;  3CRK C;  4DF7 A;  4KKT A;  5C4H A;  2JEA I;  4DR5 Q;  1O7I A;  1HNW L;  2ZJR A;  4WJW A;  4JI3 L;  5ELE A;  1P16 A;  3GQB A;  4K8I A;  2EJM A;  4B9X A;  3BDO A;  3H3V I;  1FNV A;  4YY3 Q;  3RLF A;  4BBR G;  2JA7 G;  2MQH A;  2B2U A;  4DV1 L;  1J5E Q;  3HOZ H;  3MAQ A;  4POG A;  4ZAI A;  2VB3 X;  3ICE A;  1V1P A;  5I4D A;  4A3K H;  3TRZ A;  1FGU A;  2QEX A;  4FF1 A;  3GD7 A;  1ASZ A;  1HUM A;  1B1Z A;  1U4M A;  2IL8 A;  3TP7 A;  3SGI A;  4DV7 L;  4KN4 C;  1DM0 B;  4LUV A;  1LAB A;  2H1E A;  5FLM H;  2K7V A;  1VQJ A;  1K8A C;  1FJG Q;  4GKK Q;  1HZA A;  4YY3 L;  2ZM6 L;  4K14 A;  1BR9 A;  1BO0 A;  1HNX Q;  3HOY B;  4E6I A;  1EQT A;  3HRZ C;  1I6V C;  4IO9 A;  4A3D H;  2K75 A;  3PCO B;  4OIK A;  5G3L F;  2KED A;  3R93 A;  3M9B A;  4A3M B;  5GQO A;  4C3I G;  4DR5 L;  1E2W A;  1ENF A;  4BXX G;  4IFD G;  2K52 A;  1QG7 A;  1FYC A;  4H44 C;  2B63 B;  2QKI C;  2FJ2 A;  2EE1 A;  3IFT A;  5JJK A;  3V96 A;  1TWH H;  2JA7 H;  3AFQ A;  3D4R A;  1BOS A;  4X62 L;  1PH4 A;  2WKC A;  2EY1 A;  1I4X A;  3FHW A;  1BBW A;  3I90 A;  4X3U A;  5GAG C;  4DNI A;  2UU9 L;  2EJG C;  5FLX E;  4RGN A;  2QDL A;  3I8Z A;  5JPM C;  2B2T C;  3TZD A;  3K57 A;  4HAE A;  4IPH A;  4FF3 A;  2NVX H;  1OXX K;  4IAL A;  2YU9 H;  2BE5 D;  3C1F A;  5I6Y A;  4JI0 Q;  1QUQ A;  3AMU A;  2PCF B;  3KDF A;  3H3V H;  2E74 C;  2L9H A;  4O2D A;  2NZH A;  1X3P A;  2ICE C;  1M1K C;  3HOU H;  3CD6 A;  1N36 L;  2VS1 A;  1EEI D;  3R2I A;  4A93 G;  4KHP L;  4EQP A;  1HNZ L;  3G71 A;  5IWA Q;  1BBU A;  3SXH A;  4CKE A;  1JE4 A;  3MXU A;  3S14 B;  1AE3 A;  3CCE A;  2WAC A;  2R92 G;  1NNX A;  1PRT C;  3TN2 A;  2WV6 D;  3I4M B;  4JI7 Q;  4C56 C;  1QJO A;  4J1M A;  4QY7 A;  1LTS D;  1XNR Q;  4A3D B;  2E2D C;  4C3I B;  2P5Z X;  1BDO A;  3K7A H;  2B2W C;  1LTL A;  1MD2 D;  2F0K A;  2F1M A;  3HOV H;  1EZ8 A;  4LMQ D;  1VQE A;  5CGK A;  4JC0 A;  5CV4 A;  4LF4 L;  3SK8 A;  3PO3 B;  1BNZ A;  1MIU A;  4YHH L;  4A4I A;  4WJ3 M;  1G51 A;  3RLO A;  5M3F H;  1B2T A;  2EYJ A;  1BBX C;  1A3V A;  1S5E D;  2CKZ B;  4A3I H;  1CFM A;  2F0M A;  1BCP C;  1KLU D;  1SXT A;  4BS9 A;  1YIJ A;  5TSS A;  3I4L A;  2R7F A;  1A8V A;  2WB1 B;  4FF2 A;  1TWA H;  2H5X A;  4I7A A;  4R4T A;  1Y1W G;  1SSO A;  4K6D A;  1Q81 C;  5M9O A;  2F4V Q;  3FMC A;  2UUA Q;  1I50 B;  1PYS B;  1G29 1;  2K5D A;  1GJX A;  2AHO B;  1KDB A;  4HIK A;  3GTP H;  1KRS A;  2F0H A;  2N78 A;  2OXP A;  2F03 A;  5FK9 C;  3K5L A;  1KAB A;  2Q2T A;  3S16 H;  2HDL A;  3A8J E;  3ULJ A;  2A1A A;  3OWF A;  1J8I A;  1II3 A;  4DR2 L;  4NXN Q;  5C3E B;  1QOH A;  4DR3 L;  1SFO B;  3HOX B;  1VQD A;  4GOP A;  1JMC A;  1LT4 D;  4JI6 L;  3U9O A;  4A3E G;  3CAM A;  1UWV A;  3I70 A;  2F0W A;  4C3I H;  1V1P B;  3GTM H;  3PUX A;  1KHI A;  4DXF A;  5M3F G;  3S1R B;  1QE6 A;  4K5W A;  3HKZ E;  1QNU A;  2SNM A;  1PH5 A;  1SYD A;  5CV5 A;  5FO9 B;  1MSG A;  3KLW A;  1TY2 A;  1U0L A;  4KD4 A;  1JR0 D;  4APV A;  2IX3 A;  1N8R C;  1CZG A;  3PIO 3;  2ZXO A;  4LFA Q;  4WJ4 A;  5LL6 X;  4AQY L;  4A3I B;  5GAE C;  3HS0 C;  3HOZ G;  1RDP D;  5KNC A;  4X66 Q;  2Z4H A;  3TQY A;  1KC8 C;  1SNQ A;  1KXL A;  3JAM i;  2A6E D;  1CQV A;  1PZI D;  3OWE B;  4KK7 A;  1AP0 A;  2OTL A;  3GTO H;  2IPK D;  3NEM A;  1X56 A;  3I2Z A;  3VA5 A;  4CDC C;  4R4C A;  1IL2 A;  1YJW A;  1IBK L;  4RCN A;  2SOB A;  4RGT A;  3VR4 A;  2UUB L;  4GN5 A;  3CC2 A;  1LAC A;  4ODG A;  2MUY A;  2CW0 D;  2UUA L;  2RCN A;  4KJN A;  1RTN A;  3D4W A;  4X64 Q;  4LFB L;  5IGC A;  2ZJQ A;  1QVC A;  1G2T A;  3S1Q H;  1X3F A;  1ZYR C;  1VQK A;  4A3M G;  2JA8 B;  2XSC A;  4BY7 H;  1NTG A;  1PXU A;  3NTK A;  3CCQ A;  4CBV A;  2PZT A;  2XVS A;  3HKZ B;  4MN3 A;  4A3J B;  1XNQ Q;  2KHJ A;  2JA5 H;  3J7A 5;  3RN2 A;  1N36 Q;  1AW7 A;  1KTK A;  2YYZ A;  2AWN A;  5JEA H;  2X69 A;  5C4X B;  3BZC A;  1DOM A;  1RHP A;  3OIQ A;  1I5F A;  2E2I B;  3M3Y H;  1FR3 A;  3UDF A;  1EU4 A;  2JQO A;  4GOP C;  1W6J A;  3DHQ A;  4EQN A;  5C3X A;  4A3C G;  3J7A F;  5M5W B;  1V1Q A;  1K9M C;  4BBR B;  1SRU A;  2YTX A;  1D5Z C;  2EOT A;  1OXT A;  4PZ6 A;  3K5M A;  1SLJ A;  4A3D G;  4NKL A;  2B8G A;  2HCC A;  1VMC A;  3VR3 A;  3IL8 A;  4GN3 B;  3VDY A;  3M4Q A;  1YIT A;  2L4N A;  4RG1 A;  2KCN A;  4UDU C;  4TRD A;  3S1M B;  3D6W A;  1RIP A;  4KLK A;  5M5Y B;  3U9S A;  5AJ3 Q;  5CV7 A;  1HA5 A;  4N9T A;  4DV3 L;  2F0L A;  2A69 C;  1KRT A;  5DM7 3;  3RN5 A;  5IWA L;  4X6A H;  1OXS C;  1IKM A;  4JV5 Q;  3I73 A;  4X64 L;  4LFB Q;  3NWT A;  5BR8 Q;  1SMX A;  3EVQ A;  2DY7 A;  2AUK A;  1NR4 A;  1O80 A;  5IYD H;  1PDQ A;  1MGS A;  3BJU A;  4JI6 Q;  4B3T Q;  1CKM A;  4JK1 C;  1HR0 Q;  3NSW A;  5C3E H;  1WTR A;  5I6W A;  2RF4 A;  1YBY A;  3DWQ A;  1L1O A;  3LWU A;  3H3V C;  3K5O A;  2EYO A;  4CJ0 B;  1O78 A;  4R8N A;  2LXJ A;  1SMY D;  4LF6 L;  4NP5 A;  3STB C;  2EQS A;  2G5D A;  2R7D A;  3UE1 A;  1UE5 A;  1HPC A;  3GTL H;  2F0D A;  2Y0S G;  2RDH A;  1I94 Q;  2A74 C;  2QIL A;  2B63 G;  3KJO A;  4A3G H;  2PI2 A;  3N6R A;  5EQ0 A;  1EYG A;  4M1U B;  5BR8 L;  1SNM A;  1I6H B;  1OXU A;  1QCB D;  1L1O C;  2K5V A;  3GP7 A;  3EFX D;  1EY5 A;  2KA7 A;  4A76 A;  1EWH A;  3BVM A;  1A6X A;  2PNH A;  3EA6 A;  3NQT A;  4K5V A;  4M8A A;  1L0Y B;  2WP8 J;  1Y69 U;  1I94 L;  2A6H C;  1K3B C;  2GVA A;  2D2C C;  3LGJ A;  1CUK A;  1S5D D;  3ERQ A;  1G91 A;  3W3A A;  2M00 A;  1GVP A;  1TII D;  3FKI H;  4J6H A;  2CQA A;  4G7H C;  1LUZ A;  4L6T B;  5EAY A;  3KOJ A;  3O13 A;  3OOC A;  4C3J H;  1GM5 A;  2C9O A;  4B3T L;  1K8G A;  1O7L A;  2CWP A;  3BS1 A;  3K80 C;  2QA4 A;  3K6O A;  2HCI A;  1HJP A;  4L5T A;  1NE3 A;  1WTW A;  1PYW D;  1WCM G;  3A5U A;  4ZKC B;  5C4X G;  4QJF A;  3NK9 A;  2MP1 A;  4CJ1 B;  2MGS A;  1ESR A;  4QIW E;  1YNN D;  1JIC A;  4DK1 A;  4C3H G;  3K8A A;  4V0B A;  4X3S A;  1HUN A;  3J81 L;  3S1M H;  1TS2 A;  3MZ5 A;  4AYB G;  4BWG B;  1UE7 A;  1E1O A;  4GKJ Q;  1Z6H A;  1GKH A;  4IOA A;  4JBJ A;  1IBK Q;  5CBA E;  3T53 B;  4R8I A;  1EZ6 A;  1SJH D;  3PUZ A;  4BA1 I;  3QO2 A;  4HMI A;  3HEJ A;  2R61 A;  3I55 A;  2E2J H;  1IKL A;  3S1N B;  1CHP D;  4ZK9 B;  2KEN A;  4QQB X;  2KCM A;  3K7A B;  2JA7 B;  3A56 A;  4YCV A;  3G6J B;  5M3M H;  1HFN A;  2HIV A;  3M4Y A;  4KHZ A;  3I4M H;  3QWN A;  3PF5 A;  1YJN A;  4OWT B;  2EYH A;  2VZA A;  5T1G A;  3X3M A;  4LFC L;  3TME A;  3KF6 B;  5K36 G;  1IBL Q;  4JI8 Q;  1TR5 A;  2E5L Q;  4Q0F A;  5L37 A;  3TRE A;  3NQI A;  4WFN 3;  2UUB Q;  3GTG B;  5FJ8 H;  1J6Q A;  1E24 A;  2JA9 A;  5C44 G;  1Q1B A;  2WII B;  3MXP A;  1ENC A;  2RDF A;  2E2J B;  3STB D;  1EOV A;  3CPF A;  4IPG A;  1JC7 A;  1SMY C;  4DR2 Q;  2BA1 A;  3BVG A;  3J80 L;  2NZ1 D;  1JWU D;  1CKN A;  4A93 H;  2JA6 H;  5EPJ A;  4MTN A;  5JVG 3;  1QUQ B;  1LLR D;  2NVT B;  2B2V A;  1R4Q B;  1BF4 A;  1Q12 A;  1FNU A;  2IHF A;  5LMN Q;  1J5E L;  1VQI A;  2RBM A;  2ES2 A;  3PO2 G;  3VYR A;  5IP9 H;  5K36 H;  3BYY B;  4OXP A;  2UXB L;  2QF7 A;  3VYS A;  4QL5 A;  4JPB W;  1EU3 A;  1TWH B;  1NJI C;  4IUP A;  1SNC A;  3FP9 A;  3RR5 A;  1EQV A;  4FP5 D;  1JQY D;  3AYH B;  1PLF A;  1WTH A;  3TZU A;  4BA2 I;  1W3S A;  2BDO A;  3FDT A;  3OW2 A;  2BDN A;  2DJG C;  3P75 A;  2R93 B;  2Z4I A;  2AUJ D;  5CV8 A;  5C44 H;  5CYU A;  5FJ8 G;  3S2D B;  1YNX A;  1VQG A;  2CWA A;  4C1N K;  1I3Q H;  1ET6 A;  1HNX L;  1DOL A;  1NUC A;  1PH7 A;  2Z6K A;  1RF2 D;  1VQ8 A;  4BXX H;  3A55 A;  5IGB A;  3CQZ B;  3M7G A;  2QDB A;  1D2B A;  3MVV A;  3J7Z C;  3S17 B;  4P73 A;  4IFD I;  1MI2 A;  1WVL A;  1V8Q A;  2E2H B;  3R2T A;  2F0N A;  1M4V A;  1XTC D;  4FO2 A;  3CCJ A;  4S3S A;  1E22 A;  3RZD H;  3D0F A;  3PO3 G;  1AN8 A;  3UDI A;  1KIX A;  4B08 A;  3NHH A;  4KI0 A;  3I4N H;  1BKB A;  5FLM G;  4TKO B;  1BXT A;  1XXG A;  1WJJ A;  1Y1W H;  1PTO B;  4U68 A;  5LL6 S;  2VXW A;  5AJ3 L;  4F8M A;  1TS5 A;  3MTS A;  1EQQ A;  3H6M A;  3MFG A;  5JAV A;  2A73 B;  4A3G B;  1D6E C;  1K73 C;  2F3V A;  2EJF C;  1PTO D;  4DR1 L;  1XYI A;  5FO7 B;  2XRQ D;  1EQR A;  1E1T A;  4L63 B;  1UUP A;  2OF1 A;  3GTL B;  4DNR B;  2XGT A;  5DAU A;  1SFO H;  2B29 A;  3FPU B;  4XQJ A;  4RHR A;  4DA2 A;  1H9M A;  3U50 C;  3HFZ B;  4Q5V A;  3P1H A;  4B3S Q;  2A6E C;  3KLS A;  2PMZ E;  3PV0 A;  4A3L H;  1XMO L;  1MKH A;  2FXQ A;  1SYG A;  4KY6 A;  3PUV A;  3OMC A;  3GTP B;  2N88 A;  2CH4 W;  1GHK A;  1GUT A;  2CQO A;  2D5D A;  2ATW A;  2ZTC A;  3GTJ B;  1PRT F;  2R7Z G;  1ML0 D;  2F0J A;  2Q8R E;  2K4K A;  4X3K A;  1XPO A;  1Y8P B;  1DCZ A;  3KF6 A;  3CCL A;  3L3O C;  5J1Z A;  4DAV A;  1PH3 A;  3GTK H;  3RUZ A;  5C0X H;  5CC4 A;  4FXG C;  1HQR D;  1SE4 A;  5EJW A;  3KBX A;  1PV4 A;  2F52 A;  1EY8 A;  4Y7N B;  4DAY A;  2DGY A;  3AQQ A;  4IJH A;  5DM6 3;  1QVF A;  2K28 A;  4XTC S;  4RH6 A;  3Q8D A;  4HR7 B;  4U67 3;  2K03 A;  1BVS A;  1HCZ A;  2B3G A;  1A2U A;  5KYL A;  4RKB A;  1B9N A;  1K8O A;  2Y0S B;  4Y52 H;  3CU7 A;  1DYQ A;  4CDF C;  4DFA A;  3MEH A;  1GUO A;  4OEM B;  1STE A;  1UEA B;  3H91 A;  4L8J A;  2DNC A;  1JOK A;  3BYT B;  3EBE A;  2I5L X;  1VQO A;  2IHE A;  3M3Y B;  1RKN A;  3C46 A;  3GV6 A;  4RA8 A;  4DN4 M;  4CJ2 C;  3T56 B;  5M5X B;  5FKA C;  3A5Z B;  3TBI B;  4TVA B;  4C1N I;  4PMW A;  1CTM A;  3QG1 A;  2CHB D;  2X6L A;  1HNW Q;  2L0C A;  3SK4 A;  3S2H B;  2EXD A;  3FKI B;  4YCW A;  1STN A;  4P2C B;  2NTT A;  1EUJ A;  3S1Q B;  2PYK A;  4ZRZ A;  4GLX A;  3I4N G;  5IGD A;  3G7L A;  1QZG A;  2D9U A;  3OIP A;  2VY3 A;  3K7U C;  1FD7 D;  1GHJ A;  5D65 A;  5IOC A;  3HP3 A;  2HUG A;  2WB1 E;  3SHL A;  3KF8 A;  5BN4 A;  2JJQ A;  5D3I B;  5F2D A;  5LMN L;  1ET9 A;  3NBH B;  1VQN A;  5IYB H;  4YWK A;  4F87 A;  2L1B A;  5CBE E;  1SNO A;  1H9J A;  1B9M A;  4JG2 A;  2UUC Q;  1Z9F A;  5JEA G;  3W5O A;  3U58 A;  1WTP A;  1VQH A;  2RSO A;  3VR6 A;  2K5W A;  3CKI B;  4JBW A;  4C3H B;  4LF9 Q;  5I2X A;  4BY7 G;  4DXG A;  4JV5 L;  3H0G H;  3J80 i;  1OO9 B;  4LFC Q;  1NY4 A;  2N3S A;  2EYF A;  3A8K E;  1Z47 A;  3H15 A;  2NVQ B;  1UNS A;  5I9P A;  1X54 A;  3S1R H;  2AQ3 B;  2F0T A;  4CDE C;  1DD2 A;  2Z6B A;  4X65 L;  3GTM B;  3ONA B;  4C2M B;  2QCP X;  4R4Q A;  1DOK A;  2Q2U A;  4NB3 A;  3FPP A;  2FIN B;  1K83 B;  5FLX c;  3NP8 A;  4A3B H;  3A0J A;  5C4J H;  3HZX A;  3JC6 6;  3PIP 3;  3ITP A;  1E2Z A;  2NB0 A;  3HOW H;  4A3B G;  4K2L A;  3UDX A;  4F7X A;  2F0Q A;  3KK7 A;  2A68 D;  3TP8 A;  1Q82 C;  4B3S L;  1CKN B;  3LWE A;  1GD7 A;  4LAA A;  4HIO A;  2VQE L;  3J81 j;  2VQE Q;  3C1E A;  4ZKB B;  4PV1 C;  2O5I C;  5EPK A;  3VR2 A;  2UXC Q;  3P20 A;  5KIX A;  4DUZ Q;  2B2Y A;  1JWM D;  1TT2 A;  3T13 A;  3DM3 A;  3HKS A;  4OO1 H;  1ESF A;  4OWW B;  1S40 A;  1D5M C;  2LSS A;  2J0T D;  4HJ5 A;  3S1N H;  1HQM C;  3DM1 A;  2F3W A;  4B9W A;  1B70 B;  1JOO A;  3J7A V;  4OGQ C;  4POF A;  3CCR A;  3MA2 B;  5HUR A;  4ZUI A;  2IJ0 A;  2XNA C;  2EY6 A;  5A35 A;  1D8L A;  3DXJ C;  1U9R A;  1KAA A;  4JCV E;  1YNJ D;  5JJL A;  4LK1 C;  1SR3 A;  2FMC A;  1JJ2 A;  1K83 H;  3K5N A;  4UP9 A;  1VQ6 A;  5BN3 A;  2JEB I;  1WD0 A;  1WD1 A;  5CR3 A;  3H0G G;  3Q22 A;  1AZQ A;  3W2D A;  2N49 A;  5EKK A;  3M4P A;  3ZJY C;  3HOX G;  2B2V C;  2OTJ A;  2OT2 A;  3NTH A;  2EDG A;  1X32 A;  4GZY C;  3T1H L;  2I0Q A;  4DK0 A;  1ILP A;  3D8G A;  4C3H H;  2K04 A;  1G6Z A;  1V1O A;  3GTQ B;  2DJF C;  5J22 A;  1CI3 M;  4JI4 L;  4DR1 Q;  1EL0 A;  2C35 B;  5KNB A;  2Z8L A;  1VQC A;  4LF8 L;  2RDG A;  4OL7 A;  4BBR H;  2NUC A;  3E0J A;  4I7Z C;  1STB A;  4L5R C;  4DAP A;  2B39 A;  1Q8K A;  5KYI A;  4B3R L;  3DUZ A;  4RWS C;  1Q3L A;  3DEP A;  3VA7 A;  4ILW A;  2PPB C;  1OXV A;  2CVR A;  4FYD A;  4LF9 L;  3KLS X;  4AIM A;  3HOU B;  1QVG A;  3RD4 A;  4JI2 L;  1IYU A;  2ZM6 Q;  2EZV A;  1SE8 A;  3U4Z A;  2JA5 B;  4H02 A;  3IRB A;  2MPM A;  4QCL A;  4NPS A;  2PQE A;  1YZ6 A;  4HSP A;  3BU2 A;  4MTK A;  4NDX A;  1B3A A;  2D0O A;  1I4H A;  1B7Y B;  2K33 A;  2KEE A;  3Q23 A;  1I6H H;  2IX0 A;  1X65 A;  1F77 A;  2EYL A;  1GUW A;  3CW2 C;  4GS3 A;  5H1S E;  2PW5 A;  2EYP A;  4EQO A;  1BQQ T;  1VQM A;  4ZLT F;  3ERO A;  4JI3 Q;  4H13 C;  4MZ9 A;  2F4V L;  5DLQ E;  1XJV A;  4R1J A;  3AFP A;  3HG9 A;  1AEX A;  3I4O A;  4HID A;  2K5Q A;  5E7N A;  4GNX B;  2BE5 C;  4A3L G;  5LMU L;  4LF5 Q;  1EY7 A;  1LYL A;  3UI2 A;  1PMR A;  2B2Y C;  4HSV A;  4N8X 1;  2IT1 A;  3EN2 A;  1GUN A;  1SE3 A;  3Q0A A;  1EYC A;  3GV3 A;  1E0B A;  1XMO Q;  2PZW A;  3BDL A;  1R9T H;  3T1H Q;  1O7Y A;  5KND A;  4V19 0;  2F0F A;  4KJO A;  1Q86 C;  5AFW A;  3GTK B;  4HIM A;  1WYD A;  2NVQ H;  2GA4 B;  4JYA Q;  1DON A;  1DXM A;  3HOZ B;  4AH6 A;  5C0X J;  1A3U A;  2HDM A;  5K5P A;  3HOU G;  2I5H A;  1LTB D;  3URY A;  2DUD A;  1F9S A;  1MSH A;  1VDZ A;  2LFN A;  1CT1 D;  1SYC A;  3E0E A;  4XT3 B;  2NYZ D;  4IFD H;  3F2B A;  3Q24 A;  1YI2 A;  4DV2 Q;  4ME3 A;  3NEL A;  5M3F B;  1GUS A;  5IT9 c;  1EEF D;  3J81 i;  2K50 A;  3MXG A;  3KYH C;  3S16 B;  1IXR A;  2Q2H A;  3UDG A;  2LMC B;  4GNX C;  3HOW B;  3K0X A;  2ZTD A;  5JEA J;  2PW7 A;  2XN9 C;  2PNR C;  1Q7Y C;  2CCZ A;  1WI5 A;  1EWC A;  1VS0 A;  3SK5 A;  1JOQ A;  2KHI A;  1I3Q B;  4C2M H;  4JBM A;  1XMQ L;  4A3C H;  1STY A;  1SND A;  1N9W A;  3S15 H;  1ROD A;  3E3X A;  1H9S B;  1DJR D;  1TKW B;  4A3J H;  3SE0 A;  4UPA A;  3NUC A;  1IYJ B;  3H0G B; 
#chains in the Genus database with same CATH homology
 2R3Z A;  1FNW A;  3D31 A;  1ZEQ X;  4PNY A;  2VUM B;  3BVZ A;  4ULL A;  3DWA A;  4XDX A;  2E76 C;  1H9K A;  3VYU A;  3I72 A;  2OEO A;  2F0E A;  1WTQ A;  3HOV B;  1YNN C;  4FNF A;  3C3L A;  2JE6 I;  3OMG A;  5EBD A;  3IFD A;  2F0V A;  2I07 B;  3J81 E;  4WRD A;  5CMD A;  3PO2 B;  1QWY A;  1A2T A;  2EY5 A;  2TMP A;  3C2P A;  1Y8N B;  5KGU A;  2K32 A;  2NN6 H;  5IGG A;  4IUN A;  1CZW A;  1KDA A;  2ZXR A;  4AYB B;  3T51 B;  3ND8 A;  4IUQ A;  1D1K A;  3T16 A;  2BOS A;  4G57 A;  2B2W A;  2RSN A;  4XT1 B;  2A5H A;  3FRP B;  1BCP B;  2A6H D;  5C5M A;  5C5L A;  1ILQ A;  2JA6 B;  3E6Z X;  2NVX B;  2F0I A;  2AQ2 B;  1VCI A;  2A68 C;  4A3K B;  5DEH A;  3QB3 A;  2XWJ B;  3RMH A;  5EKL A;  4K8J A;  2F0U A;  2N55 A;  1JCK B;  3DWP A;  4XQQ A;  1VMP A;  4DU9 A;  1CQF A;  4DNT B;  1ZKO A;  2HQE A;  2XWB B;  3MC0 B;  3A8I E;  1B50 A;  3NBH A;  3LX0 A;  3QIA A;  4QUF A;  5A2Q E;  2NWG A;  3PMF A;  5IT9 L;  1A3T A;  1PRT B;  3J7Y W;  4A3B B;  1I4R A;  1F9Q A;  3I4N B;  3Q6S A;  1SEB D;  5IOD A;  4HCE A;  5G3L D;  1EY4 A;  4YIJ A;  1FGB D;  3OHX C;  3PUW A;  1EYD A;  1IW7 C;  2JP1 A;  1LTA D;  3HGB A;  5T1I A;  2B2T A;  1TWC B;  2O5J C;  1ZXT A;  3V2T A;  4KN7 C;  5E4W C;  1W6K A;  1WCM B;  1WTO A;  1PZK D;  1LV9 A;  4OIJ A;  1F2Y A;  1VF5 C;  5J39 A;  2Z1C A;  3QOJ A;  3EJI A;  3NXW A;  3K0Y A;  2F0G A;  2H4O A;  4KKU A;  2SDF A;  2JYO A;  3L7Z C;  4EGV A;  2JXM B;  2B2U C;  2TSS A;  2NN6 I;  3RZD B;  2MJ8 A;  3SVM A;  3T4A C;  5JJZ A;  4OO1 G;  1QIL A;  5LHY 1;  4KTA A;  3KLR A;  2YU9 B;  4A93 B;  3FVQ A;  2RA4 A;  2SEB D;  1NSN S;  1CK1 A;  1S5B D;  1I4P A;  1PZJ D;  3BDC A;  1DZ1 A;  1AFP A;  2L5T A;  1EFI D;  2J7Z A;  5JOB A;  1S5C D;  5C6A A;  2Q8T A;  4KHV A;  3J80 E;  2R6G A;  4HED A;  3D3R A;  1G2S A;  2VNU D;  1HTL D;  3WOE A;  3FEW X;  3CRL C;  4H0L C;  4PMC A;  4BY1 B;  1C48 A;  4PMB A;  5I2Y A;  5COY A;  5JVH 3;  1TU2 B;  1XX8 A;  5CV6 A;  3S9W A;  4K6L A;  1SYB A;  1KDC A;  1AZP A;  1EYA A;  1HTP A;  1PTO F;  5BN5 A;  5C0X I;  5EBC A;  1JOR A;  1EY6 A;  3P7J A;  3A7A B;  1IW7 D;  3AU7 A;  2MHV A;  2BA0 A;  4UAI A;  4RFB A;  5DNF A;  4ME5 A;  4QB4 A;  4CKC A;  2ICI A;  4A3F B;  1RTO A;  1B4O A;  2KOL A;  2PO4 A;  3NBI A;  2ZT9 C;  3RZO B;  2KVM A;  2L55 A;  5M3M B;  3ZYY X;  1XWE A;  4H7B A;  1PRT D;  2K05 A;  1TQO A;  2KQ3 A;  4PQX A;  4EVO A;  1SYE A;  3H94 A;  3DMU A;  5HGT A;  3OW7 A;  5ELC A;  5FOB B;  3GTO B;  1LT6 D;  1H9S A;  1HXY D;  3TP5 A;  1PTO H;  2KHS A;  4RHS A;  5C4Z A;  4G7O C;  5IGF A;  4QMG A;  1GOZ A;  1SBB B;  3NWS A;  1HFG A;  2O4X A;  4WOR A;  1G8Z D;  2EYM A;  3IKJ A;  1E2V A;  4ZQ3 A;  1C8C A;  1RJT A;  3I91 A;  2NVY B;  3D6C A;  4XIG S;  3AB9 A;  1KNE A;  4MHE A;  4R9W A;  1Q90 A;  1EY0 A;  2RKS A;  4K2K A;  1IYV A;  3E5S A;  3V05 A;  2C5C A;  4C3J B;  3M85 A;  1F9R A;  2EY2 A;  5EGT A;  2IX1 A;  1EOT A;  5ELD A;  5CV9 A;  4XXE A;  2M2L A;  2RQX A;  2O2L D;  4O42 A;  1TWG B;  3WDN A;  1BCP F;  1V43 A;  1WTX A;  4KMU C;  1F2Z A;  1D5X C;  2E75 C;  1STH A;  1T5E A;  1YNJ C;  1TS3 A;  1ENA A;  2NBF A;  3D4D A;  1T5X D;  4IN3 A;  1SNP A;  5EKI A;  2WIN B;  1LTG D;  1D1I A;  3OSO A;  2KCC A;  3EQL C;  2AWO A;  2X6G A;  1X3Q A;  1O7Z A;  5I9O A;  4X3T A;  2ID0 A;  1STA A;  2I46 A;  1PFB A;  5FLX L;  1B53 A;  4KY7 A;  4ZYS A;  4RGO S;  1EIH A;  5JPN C;  2V4D A;  2K01 A;  4RKL A;  1J9O A;  3SR1 A;  1TS4 A;  1Q1E A;  4HMJ A;  4HCS A;  5EPL A;  2FFK B;  4MIU A;  2Q8I B;  4FXD A;  5ISR A;  1KNA A;  2EXZ A;  4XYQ A;  2D62 A;  2XRS D;  4KV6 A;  4QF4 A;  1LT5 D;  3M7N A;  1GXD C;  1CHQ D;  1K8M A;  4IUT A;  4NMZ A;  1U4L A;  4O1N A;  2JSO A;  3SEB A;  1NCV A;  1JWS D;  3GO5 A;  4KKS A;  4CGY B;  2IWH A;  3R3O A;  1U4P A;  4LJZ C;  1LTT D;  3M4O B;  2KUM A;  1Y8O B;  2LKV A;  3TSS A;  4DGZ A;  4KD3 A;  2DNE A;  1TVX A;  2RVL A;  1EIG A;  1C4Q A;  2L12 A;  2DY8 A;  3BG3 A;  5ELB A;  3NPP A;  3L9A X;  2F0S A;  4RGM A;  3A7L A;  5C4J B;  4IZ8 A;  1PFN A;  3KBG A;  4IFD J;  1SYF A;  3PUY A;  1S4Z A;  2G9H D;  4Z9C B;  5COR A;  1VF7 A;  1NR2 A;  3QOL A;  1ONL A;  2K6A A;  3LNN A;  1RCV D;  1ICW A;  1Y1W B;  3QJY A;  4RAU C;  3I3C A;  5E1F A;  1JB3 A;  2BCO A;  4FF4 A;  2FHT A;  1S5F D;  2KEC A;  2PMZ B;  3DEO A;  3A54 A;  3SDZ A;  3MXN A;  4XQN A;  1L0X B;  5C3W A;  4IUU A;  3CHB D;  4K5X A;  3S15 B;  2WAQ B;  3F2U A;  4RCO A;  1LO5 D;  2WKD A;  2F0O A;  2LS0 1;  3NE5 B;  4QIW B;  1TY0 A;  4ZUJ A;  2M9V A;  3JAM E;  4IUV A;  4F88 A;  4CKB A;  3MHB A;  3OPO A;  2R92 B;  3MWY W;  1SAP A;  4C3J G;  1I4G A;  2EVB A;  5KEE A;  1QNK A;  2R7Z B;  1CA6 A;  3R8B A;  3IAY A;  2NTS A;  2F4I A;  4TSS A;  5NUC A;  5IGE A;  2EPB A;  1ZYR D;  1QB5 D;  4BBS B;  5E4X A;  3MFY A;  1TWA B;  1PTO C;  2DN8 A;  2CW0 C;  3BZD B;  5C0X G;  4ABN A;  1R9T B;  1STG A;  5IT9 E;  2PZU A;  5KRU A;  3WOF A;  4HN7 A;  1CA5 A;  1H9R A;  1LTI D;  4QUC A;  3N52 A;  1F9P A;  2AQ1 B;  5IIF A;  4BY7 B;  1I4Q A;  4KY5 A;  1MBY A;  4A3E B;  4IQZ A;  1U4R A;  4G4K A;  3VYT A;  1SJE D;  3NTI A;  2K1B A;  4G7Z C;  2ENB A;  4HTH A;  1M8A A;  2LY7 A;  1GUG A;  2B8F A;  1BUV T;  4CHT B;  5E3F A;  4OHJ A;  1TWF B;  2XIW A;  5D14 A;  4ID6 A;  1R4P B;  2J4X A;  2VB2 X;  3ND9 A;  4N9P A;  1Q8I A;  5A2Q L;  1A15 A;  1B44 D;  1IHZ A;  3SK6 A;  3K59 A;  4TQU S;  4NW2 A;  1CM9 A;  2A69 D;  2F0P A;  1RD9 D;  4I65 A;  2G9D A;  3KUP A;  4FXK C;  4IUR A;  2QEJ C;  2KJX A;  3VR5 A;  1LTR D;  1PFM A;  1HRJ A;  5ELF A;  2NN6 G;  1Y1V B;  2ZXP A;  4FVM A;  3H09 A;  2SNS A;  5D3D A;  2FMM A;  2L11 A;  1IL8 A;  1HHV A;  1Z7T A;  1NAP A;  4OO1 I;  1LT3 D;  1SDF A;  3K58 A;  1KLG D;  5FO8 B;  4J8Q A;  1WTV A;  1BCP D;  1HA6 A;  3TDQ A;  1EY9 A;  1UAP A;  3JAM L;  4XYO A;  5C44 B;  1F2M A;  2IW3 A;  3X3N A;  3TP6 A;  1F2L A;  1SE2 A;  3CRK C;  4DF7 A;  4KKT A;  5C4H A;  2JEA I;  4WJW A;  5ELE A;  3GQB A;  4K8I A;  2EJM A;  4B9X A;  3BDO A;  1FNV A;  3RLF A;  2B2U A;  3MAQ A;  4ZAI A;  2VB3 X;  1V1P A;  5I4D A;  4FF1 A;  3GD7 A;  1U4M A;  1HUM A;  1B1Z A;  2IL8 A;  3TP7 A;  4KN4 C;  1DM0 B;  1LAB A;  2H1E A;  2K7V A;  4K14 A;  1BR9 A;  1BO0 A;  3HOY B;  4E6I A;  1EQT A;  3HRZ C;  1I6V C;  4OIK A;  5G3L F;  2KED A;  3R93 A;  4A3M B;  4C3I G;  1E2W A;  1ENF A;  4IFD G;  1QG7 A;  1FYC A;  4H44 C;  2B63 B;  2QKI C;  2FJ2 A;  2EE1 A;  3IFT A;  3V96 A;  3D4R A;  1BOS A;  2WKC A;  2EY1 A;  1I4X A;  3I90 A;  4X3U A;  2EJG C;  5FLX E;  4RGN A;  3I8Z A;  5JPM C;  2B2T C;  3TZD A;  3K57 A;  4HAE A;  4FF3 A;  1OXX K;  4IAL A;  2BE5 D;  3C1F A;  5I6Y A;  3AMU A;  2PCF B;  2E74 C;  2L9H A;  1X3P A;  2ICE C;  1EEI D;  3R2I A;  4EQP A;  3SXH A;  4CKE A;  1JE4 A;  3MXU A;  3S14 B;  2WAC A;  1PRT C;  3TN2 A;  2WV6 D;  3I4M B;  4C56 C;  1QJO A;  4J1M A;  1LTS D;  4A3D B;  2E2D C;  4C3I B;  1BDO A;  2B2W C;  1MD2 D;  2F0K A;  2F1M A;  1EZ8 A;  4LMQ D;  5CGK A;  5CV4 A;  3SK8 A;  3PO3 B;  1BNZ A;  1B2T A;  2EYJ A;  1BBX C;  1A3V A;  1S5E D;  1CFM A;  2F0M A;  1BCP C;  1KLU D;  1SXT A;  4BS9 A;  5TSS A;  3I4L A;  2WB1 B;  4FF2 A;  1SSO A;  4K6D A;  5M9O A;  3FMC A;  1I50 B;  1G29 1;  2K5D A;  1GJX A;  1KDB A;  2F0H A;  2OXP A;  2F03 A;  5FK9 C;  3K5L A;  1KAB A;  2HDL A;  3A8J E;  3OWF A;  1J8I A;  1II3 A;  5C3E B;  1QOH A;  1SFO B;  3HOX B;  1LT4 D;  3U9O A;  3I70 A;  2F0W A;  1V1P B;  3PUX A;  4DXF A;  3S1R B;  1QE6 A;  4K5W A;  1QNU A;  2SNM A;  1SYD A;  5CV5 A;  5FO9 B;  1MSG A;  1TY2 A;  4KD4 A;  1JR0 D;  2IX3 A;  1CZG A;  3PIO 3;  2ZXO A;  5LL6 X;  4A3I B;  3HS0 C;  1RDP D;  5KNC A;  2Z4H A;  1SNQ A;  2A6E D;  1CQV A;  1PZI D;  3OWE B;  4KK7 A;  1AP0 A;  2IPK D;  3VA5 A;  4RCN A;  2SOB A;  4RGT A;  3VR4 A;  1LAC A;  4ODG A;  2MUY A;  2CW0 D;  4KJN A;  1RTN A;  3D4W A;  5IGC A;  1G2T A;  1ZYR C;  2JA8 B;  2XSC A;  1PXU A;  3NTK A;  4CBV A;  2PZT A;  2XVS A;  3HKZ B;  4MN3 A;  4A3J B;  1AW7 A;  1KTK A;  2YYZ A;  2AWN A;  5JEA H;  2X69 A;  5C4X B;  1DOM A;  1RHP A;  3OIQ A;  2E2I B;  1FR3 A;  1EU4 A;  1W6J A;  3DHQ A;  4EQN A;  5C3X A;  3J7A F;  5M5W B;  4BBR B;  1D5Z C;  2EOT A;  1OXT A;  3K5M A;  4NKL A;  2B8G A;  2HCC A;  1VMC A;  3VR3 A;  3IL8 A;  2L4N A;  2KCN A;  4UDU C;  4TRD A;  3S1M B;  3D6W A;  5M5Y B;  3U9S A;  5CV7 A;  1HA5 A;  4N9T A;  2F0L A;  2A69 C;  5DM7 3;  1OXS C;  1IKM A;  3I73 A;  3NWT A;  3EVQ A;  2DY7 A;  2AUK A;  1NR4 A;  1O80 A;  1PDQ A;  1MGS A;  4JK1 C;  3NSW A;  1WTR A;  5I6W A;  3DWQ A;  3LWU A;  3H3V C;  3K5O A;  2EYO A;  4CJ0 B;  1O78 A;  4R8N A;  1SMY D;  4NP5 A;  1HPC A;  2F0D A;  2RDH A;  2A74 C;  2QIL A;  3N6R A;  5EQ0 A;  4M1U B;  1SNM A;  1I6H B;  1OXU A;  1QCB D;  3GP7 A;  3EFX D;  1EY5 A;  2KA7 A;  1EWH A;  3BVM A;  1A6X A;  3EA6 A;  3NQT A;  4K5V A;  4M8A A;  1L0Y B;  2WP8 J;  1Y69 U;  2A6H C;  2D2C C;  1S5D D;  3ERQ A;  1G91 A;  3W3A A;  2M00 A;  1TII D;  4J6H A;  2CQA A;  4G7H C;  4L6T B;  3O13 A;  3OOC A;  2C9O A;  1O7L A;  3BS1 A;  3K6O A;  2HCI A;  1WTW A;  1PYW D;  4ZKC B;  3NK9 A;  2MP1 A;  4CJ1 B;  2MGS A;  1ESR A;  1YNN D;  1JIC A;  4DK1 A;  4C3H G;  4V0B A;  4X3S A;  1HUN A;  3J81 L;  1TS2 A;  3MZ5 A;  4BWG B;  1Z6H A;  5CBA E;  3T53 B;  4R8I A;  1EZ6 A;  1SJH D;  3PUZ A;  4BA1 I;  3QO2 A;  4HMI A;  3HEJ A;  2R61 A;  1IKL A;  3S1N B;  1CHP D;  4ZK9 B;  3K7A B;  2JA7 B;  3A56 A;  3G6J B;  1HFN A;  4KHZ A;  3M4Y A;  3QWN A;  2EYH A;  5T1G A;  3X3M A;  3TME A;  5K36 G;  1TR5 A;  4Q0F A;  3NQI A;  4WFN 3;  3GTG B;  1Q1B A;  2WII B;  3MXP A;  1ENC A;  2RDF A;  2E2J B;  1JC7 A;  1SMY C;  2BA1 A;  3BVG A;  3J80 L;  2NZ1 D;  1JWU D;  5EPJ A;  5JVG 3;  1LLR D;  2NVT B;  2B2V A;  1R4Q B;  1BF4 A;  1Q12 A;  1FNU A;  2RBM A;  3VYR A;  5K36 H;  3BYY B;  2QF7 A;  3VYS A;  1EU3 A;  1TWH B;  4IUP A;  1SNC A;  1EQV A;  4FP5 D;  1JQY D;  1PLF A;  3TZU A;  4BA2 I;  2BDO A;  3FDT A;  2BDN A;  3P75 A;  2R93 B;  2Z4I A;  2AUJ D;  5CV8 A;  5CYU A;  3S2D B;  4C1N K;  1ET6 A;  1DOL A;  1NUC A;  1RF2 D;  3A55 A;  5IGB A;  3CQZ B;  3M7G A;  2QDB A;  1D2B A;  3MVV A;  3S17 B;  4IFD I;  1MI2 A;  1WVL A;  1V8Q A;  2E2H B;  3R2T A;  2F0N A;  1M4V A;  1XTC D;  4FO2 A;  4S3S A;  1AN8 A;  4B08 A;  3NHH A;  4KI0 A;  4TKO B;  1BXT A;  1XXG A;  1PTO B;  4U68 A;  5LL6 S;  2VXW A;  4F8M A;  1TS5 A;  3MTS A;  3H6M A;  3MFG A;  5JAV A;  2A73 B;  4A3G B;  1D6E C;  2F3V A;  2EJF C;  1PTO D;  1XYI A;  5FO7 B;  2XRQ D;  4L63 B;  1UUP A;  2OF1 A;  3GTL B;  4DNR B;  5DAU A;  3FPU B;  4XQJ A;  4RHR A;  4DA2 A;  1H9M A;  4Q5V A;  3P1H A;  2A6E C;  3KLS A;  3PV0 A;  1SYG A;  4KY6 A;  3PUV A;  3OMC A;  3GTP B;  2N88 A;  1GHK A;  1GUT A;  2D5D A;  3GTJ B;  1PRT F;  1ML0 D;  2F0J A;  2Q8R E;  4X3K A;  1Y8P B;  1DCZ A;  3L3O C;  5J1Z A;  4DAV A;  5C0X H;  3RUZ A;  5CC4 A;  4FXG C;  1HQR D;  1SE4 A;  5EJW A;  3KBX A;  1EY8 A;  4Y7N B;  4DAY A;  5DM6 3;  2K28 A;  4XTC S;  4RH6 A;  4U67 3;  4HR7 B;  2K03 A;  1HCZ A;  1A2U A;  5KYL A;  4RKB A;  1B9N A;  1K8O A;  2Y0S B;  3CU7 A;  1DYQ A;  4DFA A;  3MEH A;  1GUO A;  1STE A;  1UEA B;  3H91 A;  4L8J A;  2DNC A;  1JOK A;  3BYT B;  3M3Y B;  1RKN A;  3C46 A;  3GV6 A;  4RA8 A;  4DN4 M;  4CJ2 C;  3T56 B;  5M5X B;  5FKA C;  3TBI B;  4C1N I;  4PMW A;  1CTM A;  3QG1 A;  2CHB D;  2X6L A;  2L0C A;  3SK4 A;  3S2H B;  3FKI B;  1STN A;  4P2C B;  2NTT A;  3S1Q B;  2PYK A;  4ZRZ A;  5IGD A;  3G7L A;  2D9U A;  3OIP A;  1FD7 D;  1GHJ A;  5D65 A;  5IOC A;  3HP3 A;  2HUG A;  3SHL A;  3KF8 A;  5BN4 A;  5D3I B;  5F2D A;  1ET9 A;  4F87 A;  2L1B A;  5CBE E;  1SNO A;  1H9J A;  1B9M A;  5JEA G;  1WTP A;  2RSO A;  3VR6 A;  2K5W A;  3CKI B;  4JBW A;  4C3H B;  5I2X A;  4DXG A;  1OO9 B;  2EYF A;  3A8K E;  1Z47 A;  2NVQ B;  1UNS A;  5I9P A;  2AQ3 B;  2F0T A;  1DD2 A;  3GTM B;  3ONA B;  4C2M B;  2QCP X;  1DOK A;  3FPP A;  2FIN B;  1K83 B;  3NP8 A;  3HZX A;  3PIP 3;  3ITP A;  1E2Z A;  2NB0 A;  4K2L A;  4F7X A;  2F0Q A;  3KK7 A;  2A68 D;  3TP8 A;  4LAA A;  3LWE A;  3C1E A;  4ZKB B;  4PV1 C;  2O5I C;  5EPK A;  3VR2 A;  3P20 A;  5KIX A;  2B2Y A;  1JWM D;  1TT2 A;  3T13 A;  4OO1 H;  1ESF A;  1D5M C;  2J0T D;  1HQM C;  3DM1 A;  2F3W A;  4B9W A;  1JOO A;  3J7A V;  4OGQ C;  3MA2 B;  5HUR A;  4ZUI A;  2IJ0 A;  2XNA C;  2EY6 A;  5A35 A;  3DXJ C;  1U9R A;  1KAA A;  1YNJ D;  4LK1 C;  2FMC A;  3K5N A;  5BN3 A;  2JEB I;  1WD0 A;  1WD1 A;  5CR3 A;  3Q22 A;  1AZQ A;  3W2D A;  5EKK A;  2B2V C;  2OT2 A;  3NTH A;  2EDG A;  1X32 A;  4GZY C;  4DK0 A;  1ILP A;  3D8G A;  2K04 A;  1G6Z A;  1V1O A;  3GTQ B;  5J22 A;  1CI3 M;  1EL0 A;  5KNB A;  2Z8L A;  2RDG A;  4OL7 A;  2NUC A;  3E0J A;  4I7Z C;  1STB A;  4DAP A;  2B39 A;  5KYI A;  3DUZ A;  4RWS C;  1Q3L A;  3DEP A;  3VA7 A;  4ILW A;  2PPB C;  1OXV A;  2CVR A;  4FYD A;  3KLS X;  3HOU B;  3RD4 A;  1IYU A;  2EZV A;  2JA5 B;  2MPM A;  4QCL A;  2PQE A;  4HSP A;  4NDX A;  1B3A A;  1I4H A;  2K33 A;  2KEE A;  3Q23 A;  2IX0 A;  1F77 A;  2EYL A;  1GUW A;  2PW5 A;  2EYP A;  4EQO A;  1BQQ T;  4ZLT F;  3ERO A;  4H13 C;  3HG9 A;  1AEX A;  2K5Q A;  2BE5 C;  1EY7 A;  3UI2 A;  1PMR A;  2B2Y C;  4HSV A;  2IT1 A;  1GUN A;  1SE3 A;  3Q0A A;  1EYC A;  3GV3 A;  1E0B A;  2PZW A;  3BDL A;  1O7Y A;  5KND A;  4V19 0;  2F0F A;  4KJO A;  5AFW A;  3GTK B;  2GA4 B;  1DON A;  1DXM A;  3HOZ B;  5C0X J;  1A3U A;  2HDM A;  5K5P A;  1LTB D;  3URY A;  1F9S A;  1MSH A;  1VDZ A;  2LFN A;  1CT1 D;  1SYC A;  4XT3 B;  2NYZ D;  4IFD H;  3Q24 A;  5M3F B;  1GUS A;  1EEF D;  3MXG A;  3S16 B;  2LMC B;  3HOW B;  5JEA J;  2PW7 A;  2XN9 C;  2PNR C;  1EWC A;  3SK5 A;  1JOQ A;  1I3Q B;  1STY A;  1SND A;  1ROD A;  1H9S B;  1DJR D;  1TKW B;  3SE0 A;  3NUC A;  3H0G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...