1Y8OB

Crystal structure of the pdk3-l2 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
97
Chain Sequence
b'SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8oB00
4H44C 2E75C 1OXSC 4HR7B 1VDZA 3PUYA 2D5DA 2NN6H 2E76C 4G7HC 3M4YA 3HGBA 4KN7C 1TKWB 1Q12A 3U9SA 3CRLC 3A7LA 3VA7A 3IKJA 5JEAH 2EJFC 1HQMC 2V4DA 3BG3A 3PV0A 1Y8PB 1LACA 3A8JE 1E2ZA 5K36H 3GD7A 1OXVA 2D62A 3PUVA 3OPOA 3QJYA 2EDGA 2PPBC 3MXUA 3LWUA 4DK1A 4TKOB 2B8FA 2CW0C 1ONLA 2JE6I 3DXJC 4KI0A 4GZYC 1DD2A 1CI3M 1H9RA 1QJOA 2A68D 2A6HC 2A6HD 1CFMA 1GUOA 2BA1A 2KCCA 1GJXA 4H0LC 1O7LA 1H9SB 1BDOA 1TU2B 1YNNC 1GUTA 1HTPA 1Q1EA 4KN4C 1Z6HA 4G7ZC 1FR3A 3VR3A 4OGQC 2Q8IB 2K32A 3PUXA 4JK1C 3SDZA 4DK0A 1Y69U 1ZYRC 2EJGC 5KNCA 3ND8A 4BA2I 3LNNA 3H94A 3PUWA 1K8MA 5C0XH 2BE5C 3IFTA 2A6EC 2D2CC 1ZKOA 3ND9A 3BDOA 1Q1BA 4IQZA 2DN8A 4KKTA 2QF7A 1GUGA 1Q90A 3VR2A 1DCZA 2O5IC 4KKUA 4OO1H 5K36G 2KA7A 2JEBI 4G7OC 3TZUA 2BDOA 2B8GA 4JBWA 2K7VA 4XIGS 4LJZC 4PV1C 1HCZA 4RCNA 2A69C 1H9SA 1FYCA 1OXTA 3OW7A 4KKSA 1GUSA 1OXUA 5BN4A 3T51B 1OXXK 3NE5B 2DNCA 1V8QA 1VF7A 1SMYC 2AWOA 3A8IE 3QIAA 4KMUC 3RLFA 1O78A 1H9MA 4IFDH 2JXMB 1A6XA 1H9JA 2BE5D 1VCIA 4H13C 3VR5A 2JEAI 1H9KA 2A6ED 1YNJC 2NN6G 3EQLC 1IW7C 2R6GA 1VF5C 3KLRA 5JEAG 1GHKA 5C0XG 1Y8NB 3T56B 4DNTB 2ZT9C 4BA1I 2A69D 1CTMA 2PNRC 3CRKC 2L5TA 4OO1G 3AB9A 3I4LA 2EJMA 3L7ZC 1LABA 2AUKA 1HPCA 1E2VA 2YYZA 3I73A 1EWHA 3N6RA 1Z7TA 1K8OA 2K33A 5BN5A 3MFYA 2PCFB 4KHZA 4TQUS 1GUNA 1T5EA 3FPPA 1IYVA 2IT1A 3A7AB 3W3AA 1PMRA 1B9MA 1IW7D 1B9NA 3A8KE 3OOCA 2AUJD 1IYUA 3M7NA 3D4RA 2BA0A 3D31A 4IFDG 3SE0A 3T53B 2NN6I 5A35A 2E74C 3WDNA 3P20A 3M85A 1Y8OB 4XTCS 2F1MA 3GQBA 1GHJA 1V43A 3PUZA 1G291 1I6VC 1E2WA 2LMCB 3VR6A 4DNRB 2DNEA 4I7ZC 2EVBA 3I72A 3VR4A 3FMCA 2O5JC 5BN3A 3QG1A 5KNBA 4L8JA 5KNDA 1DXMA 2A68C 4LK1C
chains in the Genus database with same CATH superfamily
4RAUC 1OXSC 5I2YA 1K83H 5M5XH 1LTGD 4O1NA 1XX8A 2XTIA 1F77A 1UE7A 4IJLA 1VQMA 4NXML 1EEFD 2EYJA 2VB3X 4EX5A 2LXJA 4KLKA 4UP7A 2M2LA 1E2ZA 4A3DH 2DY7A 1SYFA 1DGSA 5K5PA 3G7LA 2D62A 4ZKCB 1M8AA 3GTKH 3K5LA 2PPBC 3E5SA 1NNXA 2OEOA 4DK1A 4JW0A 4A3LH 2IHEA 3HOVH 1V9PA 1XNQL 2A6HD 3Q24A 1MBYA 1SYDA 3I7FA 3MTSA 1TU2B 1HTPA 4G7ZC 4BY7G 2A8VA 1EY7A 5FO7B 1F9QA 2L55A 4BY7B 4J1MA 1BCPC 4KHPQ 2KECA 2BOSA 4P72A 3ND8A 4IPCA 3J80c 1MI2A 4ABNA 3BZCA 2KOLA 3ND9A 1YBYA 4CGYB 1DCZA 1A15A 3FP9A 3OIPA 1KTKA 2AQ2B 2K7VA 4X6AH 4LF8Q 1IBML 2EOTA 1I4HA 4B3RL 1XNRL 2L9HA 4A3EG 1N33Q 4ZKBB 1JOOA 1NJIC 4LAAA 4P71A 5FO9B 4OIJA 4A3EB 3S15H 1XPOA 4KD3A 2R93G 1KLUD 3NWSA 2VQEQ 3JAMi 3EQLC 1RL2A 5KGUA 1V1OA 2RA4A 2R93B 1B1ZA 5IP9H 2B2UA 2ZJRA 1RD9D 2EJMA 5D3DA 4K2LA 4NXNQ 4JV5Q 3J7AV 2OQ0A 1A3VA 1BBUA 2RSNA 2KHJA 4JOIC 2K33A 2R7FA 4JBMA 1CKNB 2HCCA 1RF2D 4TQUS 1Y1VB 1S3OA 3A8KE 1LV9A 4EQPA 4OEMB 1Y8OB 5IP7H 1XMOQ 1I4QA 1PFMA 1PH1A 1I6HB 3K5NA 4A93G 3Q8DA 4XDXA 2UU9L 4OO1I 4MHEA 5BN3A 4DR4Q 4A93B 5LL6S 5I4DA 1U4PA 2NN6H 3HOUH 1F2MA 2L12A 1QCBD 3HP3A 1XPUA 1SBBB 4UP8A 3PO2H 1I4PA 3NUCA 4CKBA 4IFDI 2M9VA 1NR4A 4IJHA 2WV6D 2B3GA 1PZJD 2K01A 2UXDL 3D6CA 2KQ3A 4ODGA 2ZTEA 3MVVA 1QJOA 2O4XA 1PH2A 4C2MB 3JC66 3CCVA 4H0LC 3NEMA 1F9RA 1DOKA 2FFKB 4JC0A 2JQOA 1IHZA 4JI4L 1PTOF 3H94A 5GROA 2BE5C 4LF5L 4P74A 3IFTA 3GTOB 2ZJQA 5M5YB 5KYLA 5IE8A 2EPBA 1EOVA 4HSVA 4IUNA 3D4DA 1S5BD 2SOBA 3HKZG 1PFSA 2MUYA 4FF4A 3X3MA 4K8IA 4GOPC 1HA6A 4X65L 1SMYC 4HIOA 3C3LA 5FLXc 1ZYRD 1NMFA 1O78A 2EY2A 2LSSA 4P73A 4JI3L 1QUQB 3VR5A 4DGZA 3S1RH 3CCMA 3AYHB 5C4XH 4IO9A 2B2VC 4DV0Q 1N32L 3NQIA 1NY4A 4XXEA 3PIO3 1HZCA 1CHPD 1KNAA 5G3LD 1TWGH 3VYSA 5IGFA 4XYOA 3RLNA 4DU9A 1UNSA 4V190 5LHY1 3F2UA 1YNXA 1EY0A 3KF6A 1B9MA 1AE3A 5C3EB 3GTPH 1FNWA 4DAMA 4QGUA 1W6JA 3A5UA 4JI0Q 5M3MB 3OHXC 3ERQA 3GTQB 3J81E 1MSGA 3LGJA 5C0XI 3HRZC 4DF7A 4B08A 2D0PA 4DV6Q 2JA8G 4A3KH 4A3CH 2VXWA 3MWYW 1PFNA 3QG1A 1G6PA 1IL2A 2MQHA 3AFPA 1IKMA 2K4KA 4CDFC 4YY3Q 3E9IA 4PZ6A 4GN3B 2JA8B 5L37A 1TIID 2D5DA 4A3MG 1HXYD 3HGBA 2F3VA 3U9SA 1WVLA 3CRLC 3CF5A 2CCZA 3EVQA 3BG3A 5T1GA 4APVA 4A3MB 3OSOA 4KY5A 3UDXA 2CH4W 2XVSA 3UDFA 1BOSA 1C7YA 5M3FH 5IYCG 4ZUIA 3T16A 2E5LL 1B8AA 4X3KA 4K0KQ 4UDUC 5IP7G 1HZ9A 4LFAQ 3MXPA 1AZPA 3IFDA 4QL5A 2C5CA 1STAA 1Q46A 1MHWC 1WFQA 1ET6A 2JA6H 4DR7L 2ZXPA 1TS5A 2F0TA 4LF8L 1PV4A 4A3BG 1N33L 1HNWL 2B29A 2RHSB 2O5IC 4KKUA 3S1QB 1B70B 3PO2G 4A3BB 2R92G 2NWGA 3S1MH 1STHA 5JEAJ 5EQ0A 4IPHA 2NVXB 1TS3A 3HG9A 1FYCA 1X56A 2VQEL 2R92B 2RDFA 4NP5A 1A2TA 1N34Q 5KYIA 1EIGA 1CHQD 3KYHC 2ZM6Q 2WAQE 3CU7A 4DUYQ 4UAIA 1CA5A 4H13C 5D14A 3CPWA 3STBD 5C44H 4NXNL 1EFWA 1WOCA 5KRUA 2Q2UA 4UP9A 1PYBA 3DLLA 2EY5A 3G48A 5JEAG 3TDQA 1WTWA 4RKLA 3EA6A 4BA1I 1CTMA 4GKJL 4LF4Q 2KBNA 3EFXD 4GLXA 4BY1G 1WYDA 3NHHA 3OIQA 5CV7A 1Z7TA 5ELEA 5TSSA 1OTCA 4A3FB 4BY1B 1XMOL 1GUNA 1HUMA 3Q22A 3M7NA 3E0EA 3HKSA 3T1YQ 1TWHB 1D2BA 4DR4L 2NN6I 1GOZA 3FHWA 2K5NA 2NTTA 5GAGC 5DM73 5FJ8H 2NVQH 1AE2A 5IODA 3RZOB 4LF9Q 2ICEC 1HNZQ 1IZ6A 1NTGA 2PQAA 1SFOH 4WJ4A 3OW2A 1GKHA 4HIDA 1TKWB 5EKIA 3A7LA 2AQ3B 3KLWA 3KF8A 4N8FA 3F1ZA 1U9RA 1EZ6A 3HOXB 1PH4A 2UUAQ 3AFQA 1H9RA 3BVMA 3NBHA 1I5FA 1G2SA 4KN4C 2EYFA 2CVRA 2EY1A 1QZHA 4FNFA 2F4IA 2V1CC 2PNHA 5CC4A 3PQIA 5ELCA 4NDXA 2NVTB 3S14B 4FF1A 4IQZA 1ET9A 4KY6A 4IUTA 2D9UA 1WTXA 1PH6A 1DM0B 1TWAB 2YV5A 2JEBI 1MGSA 4NXMQ 4RCOA 3V96A 1W3SA 3OTOL 2QEXA 1H9SA 1E3PA 4B3TL 4KKSA 1B4OA 1GUSA 1FJGL 1KLGD 2Y0SG 4DKAC 2F0NA 5ELFA 2RDGA 4DV0L 1PH7A 2MGSA 2Y0SB 1XNQQ 2A6ED 4R4CA 4GKKL 1JC7A 1TXYA 2E2IB 1QNKA 4KK7A 4HN7A 1HZBA 1T9HA 5JVG3 4OWWB 4RH6A 3S2HH 1YJNA 4AIMA 3CMAA 3AMUA 2A73B 2AUKA 3I70A 4CDEC 1K8OA 4C1NK 4JOIA 3JAME 2PCFB 1YNJD 5M9OA 3ITPA 4LF6L 1IW7D 2B2WC 4QJFA 1IBMQ 4B3RQ 3K7UC 4K6DA 1XNRQ 3M3YH 4HIMA 1D8LA 1JJ2A 1V1QA 2XRQD 3SEBA 2DNEA 1STYA 3GTLB 1IYJB 3GTMH 5EBCA 5KNBA 2BCOA 3NQTA 4XYQA 4L5SA 1DXMA 1Y1WB 2QA4A 4GLVB 1VQ5A 2NVYB 1HTLD 3HEJA 3EROA 4C3HG 1QB5D 4KHVA 1MIUA 1VQHA 4C3HB 5EAYA 4Q5VA 3K57A 5FK9C 2RKSA 4LFAL 1BCPB 1E0BA 1C8CA 2RSOA 2CHBD 1SNOA 1OXVA 1LO5D 2FJ2A 2VB2X 4IALA 2PZWA 2Z9HA 3E9HA 4QMGA 1B3QA 1O80A 2JE6I 4N8X1 5C4HA 1VQ7A 2SNMA 4J6HA 2OQKA 5EJWA 1H9SB 4J15A 4CBVA 1VQ8A 3NTKA 3KOJA 2VZAA 1D5MC 4ZLTF 3GTGH 1WJJA 2Q8IB 3SDZA 1SEBD 2LFNA 2QKIC 1KXLA 1SNCA 3A54A 2UU9Q 1AFPA 5IYDH 3EN2A 5CBEE 4KKTA 4OO1H 3HOWB 1ML0D 4PZ7A 2NYZD 1HQRD 1L0YB 4FF2A 4JYAQ 5ISRA 4POGA 4LF7L 4PV1C 1GXDC 2A69C 4GN4B 2CWPA 2K75A 4NB3A 2K14A 1ESFA 2F0EA 1IBKL 4DR6L 2QDLA 4UY8C 1UEAB 4RGMA 3R8BA 3BJUA 2GVBA 2UXDQ 1DYQA 1CK1A 4IFDH 4POFA 2F3IA 1ILQA 1IXRA 1H9KA 4LF4L 3ONAB 1BF4A 2ZXRA 2R6GA 2VS1A 1PHJA 1JOKA 2RCNA 3WWVA 3TP6A 1G6ZA 3BVZA 2Q2TA 4JI4Q 3SXHA 3PIPA 2K5HA 5IWAQ 4A4IA 4LF5Q 1EWHA 4BBRG 1CSPA 2XGTA 3IRBA 2LKVA 2HT1A 3ULJA 2E2JB 2AHOB 4BBRB 4HCSA 1ASZA 1LT6D 4Y7NB 1O7ZA 3CCLA 2DJFC 1ICWA 4X3TA 3T53B 1VQBA 4X65Q 3D8GA 1EY6A 1AN8A 3GQBA 4H7BA 5CYUA 2RQXA 1C48A 1TQOA 4JI3Q 3FEWX 1YVCA 5J22A 1Q81C 1TT2A 1PH9A 4HCEA 4LK1C 4OIKA 4H44C 3BVGA 4A3IH 1EY4A 3ULLA 3S1NH 5IT9E 4XQNA 1VDZA 2I5MX 5HGTA 1EWIA 4FO2A 4FXGC 4C3JB 4ZCKA 4CKEA 1N32Q 3IKJA 2UUAL 3E3XA 2YTXA 1X54A 1PRTC 3AEVA 3SGIA 1LT3D 2BH8A 3P75A 3PUVA 1WTHA 4G4KA 2IWHA 1EZ8A 3MXUA 5D65A 3G6JB 3I56A 2KCNA 2EE1A 3K59A 4P75A 5JVH3 3SK5A 4R4OA 1VMPA 3NTHA 3M9BA 1YNNC 1TWFB 1B3AA 1EYCA 1PTOD 1CKNA 2JYOA 5F2DA 4RFBA 1SE2A 4BXXH 1EQRA 4C3IG 1KQSA 1EY5A 4GOPB 4DR3Q 1H95A 1HFGA 4PQXA 1Q86C 4C3IB 5C0XH 2F4VQ 1J9OA 1J6QA 2TSSA 5LMNL 1GUGA 2VW9A 2RBMA 1HR0L 5C4JH 3NPPA 5EKLA 3PCOB 2SEBD 1X32A 2LY7A 1YJ9A 1J5EL 3OW7A 3DM1A 4RHRA 3T51B 1VF7A 2E5LQ 4LFBQ 2VL6A 3G4SA 2Z4HA 2E8GA 5ELOA 3E6ZX 1SNQA 1XXGA 2HIVA 3H0GH 2H4OA 2YU9H 1GVPA 5IYDG 4DR7Q 4IFDJ 1QNUA 5CBAE 4OO1G 1XTDA 3EJIA 1G2TA 2PZUA 2EZVA 4HAEA 2H1EA 2N49A 2IJ0A 1HNWQ 1CT1D 3L0OA 4HMIA 5DAUA 4X64L 1BNZA 3A56A 1ILPA 1L2FA 3EBEA 3CXCA 3HKZE 4LMQD 2NZHA 2IT1A 4DPGA 3DWAA 3MEFA 3D31A 4IFDG 3RLOA 2K52A 4OHJA 1L0WA 3J80L 1II3A 2XWJB 4RA8A 1G291 1XJVA 2XNAC 3K6OA 5GAHC 1R4QB 5C6AA 4NMZA 1LUZA 3G71A 4A3JH 3M4OB 2JA5G 2I07B 4HR7B 3CC7A 1K8GA 2X69A 3HOYG 3KUPA 2JA5B 4GKJQ 1D1KA 1QUQA 1VQIA 3GDEA 1WD1A 3HS0C 1A62A 1HQMC 2F0VA 3HOYB 2PW5A 1LACA 4ALPA 1HHVA 3CCJA 1SE3A 1UE5A 2EDGA 1PA6A 3LWUA 4GS3A 2MJ8A 1ONLA 2B2TC 2RDHA 1GUOA 2QILA 5C4ZA 2L4NA 2EYLA 1BKBA 2UXBQ 3FPUB 1VMCA 3QO2A 2MO0A 2B63H 3PUXA 2ASBA 1TR5A 4A3IG 4EQ5A 4JYAL 5CGKA 2JA7G 2VQFL 1F9PA 2IHFA 3K0XA 4DK6C 3O13A 4K6LA 1BQQT 1UWVA 1EYAA 3BDOA 2CQAA 2K5DA 4RG1A 2OTJA 2JA7B 5DNFA 2IX3A 4G57A 1QVGA 2B8GA 1V1PB 5C0XJ 4DUZL 1Q8KA 3CW2C 1I4GA 3TP7A 1DONA 2DY8A 5JPMC 3H3VH 5LMNW 2A1AA 4BXXG 2UXCL 5IWAL 1SRUA 1HR0W 1O7YA 1LTSD 1K83B 5M5XB 2O2LD 4LFCL 5C0XG 2F0FA 1K9MC 4A3DG 2Q8RE 4I7AA 2PNRC 1VS0A 2R7DA 3C1FA 1MJCA 1ZXTA 1KL9A 3LX0A 3X3NA 5DLQE 4A3DB 1LABA 1VQLA 4A3LG 3N6RA 3NENA 3GTKB 2EYHA 3HOVG 2AQ1B 4A76A 3FVQA 3HOVB 3HKZB 1SE8A 3OTOQ 1RDPD 4FXKC 4IZ8A 5GADC 4B3TQ 3RZDH 1HA5A 3Q23A 2QGQA 1BBWA 1FJGQ 5A35A 2CH4A 3NK9A 2OF1A 3H0GG 5LMUL 3PUZA 1SYEA 2GA4B 1GM5A 4M1UB 3K5MA 1A3TA 3FKIH 3I72A 1GUWA 4CJ1B 2WB1G 4GKKQ 2L1BA 3A5ZB 2A68C 4LNQA 1X55A 2Z6BA 3PUYA 3K5OA 2F0JA 3KJPA 3UI2A 3HZXA 4CDDC 2NUCA 5FOBB 5FLXL 2K50A 1JB3A 1FD7D 1HZAA 1N9WA 3K58A 3OPOA 4S3SA 4DV7L 4IUQA 3S15B 1UE1A 1DD2A 2CW0C 5C5LA 4A75A 4LF6Q 4DR3L 3OWEB 2F0LA 3SK8A 1SYBA 1F2ZA 2KCCA 3HOZH 5IP9G 3J7AF 2F4VL 2K1BA 3TREA 1K0SA 2QDBA 2MFIA 2GVAA 5EPLA 1VQ9A 1WCMH 4FF3A 1RODA 4K14A 2EQSA 4YHHL 2YTYA 2R7ZH 1PZKD 4KTAA 2HDMA 4HSPA 2WINB 2N78A 4DR2L 1LLRD 1CQVA 3G6EA 3RD4A 3DUZA 4R9WA 4YIJA 3V2TA 4LFBL 1PH5A 4RCNA 4DV4L 4DV1L 1KDCA 4R4TA 3M4PA 1OXXK 2DNCA 4KMUC 1M1KC 1ZEQX 2F0WA 3GV6A 1X9NA 1F9SA 5FLXE 5EPKA 3W1BA 2JXMB 1A6XA 2B63G 2NN6G 3OMGA 2F0UA 3CQZH 3HOUG 1FNVA 4IUUA 3F2CA 4HJAA 3GO5A 3T56B 5CR3A 3HOUB 4DNTB 2X6GA 1R9TH 3NSWA 4IN3A 3NWTA 3T13A 4F88A 5LL6X 2QCPX 3PO2B 2YYZA 2WP8J 3PIP3 2VY3A 4AQYQ 4DXFA 5E4XA 1PTOC 3C1EA 2VUMH 2C9OA 1STEA 2WKDA 5EPJA 1EQQA 1RIPA 4LF7Q 2Y0SE 4DV3L 3D4RA 1SLJA 2K5WA 4ZK9B 3SE0A 3TSSA 1WTRA 1FL0A 3V05A 1IBKQ 1I3QH 2UUBL 3WDNA 3GTJH 4DR6Q 1GHJA 1PYWD 2EY6A 1V43A 5AFWA 1PFBA 3K7AH 2LMCB 3VR6A 3Q6SA 4AYBG 3D3RA 3OMCA 4I7ZC 5NUCA 1EQVA 2I5LX 4RGTA 2UUCL 1EIHA 4L8JA 3I4MH 2A6HC 1NE3A 4KY7A 4AYBB 4F87A 3S16H 2F0GA 4PNYA 1JWSD 1K28A 3N52A 3KK7A 2OCEA 3ULPA 4M8AA 4KN7C 3W2DA 3VA7A 2I5HA 2G5DA 4HJ9A 2OTLA 1DOLA 1IKLA 1B53A 4JVZA 3VYUA 1VQEA 2E2HH 1JE5A 1CZWA 4YCUA 3NBIA 3C46A 1U4MA 2GN5A 5HURA 2UXBL 2HQLA 1A2UA 1G51A 1VQAA 5C3XA 5C4XG 3IL8A 3S1RB 2BA1A 2RVLA 5C4XB 1S5DD 3ERSX 3CMEA 3PO3H 3T1HL 4EVOA 1I94Q 5ELDA 5CV8A 1HRJA 1AW7A 5FLMH 4DK3C 3FRPB 1KNEA 3DEPA 4DNIA 4K8JA 1K8MA 5IIFA 3PMFA 1TWGB 3HFZB 4FP5D 1LTID 1VQ6A 2L0CA 1AH9A 1UAPA 1HUNA 2DUDA 3WOEA 2KA7A 3H3VI 1ENFA 2WIIB 4OX9Q 2E2DC 4F7XA 3J80i 3GTPB 3S2DH 3MZ5A 1JMCA 1JICA 1JWUD 1TWCH 3KBGA 3JAMc 3A8IE 1L1OC 4A3KG 4A3CG 2KCTA 1H9MA 3I4NH 1K3RA 1H9JA 1EIYB 4A3KB 4HMJA 3CAMA 1B44D 4RKBA 2R7ZG 3P7JA 1I50H 2K28A 2G9HD 1NBWA 2PZTA 5E1FA 1YI2A 1E1TA 3AB9A 4EGVA 2ICIA 5M3FG 1PVOA 4JI8L 5I2XA 2PO4A 3IAYA 5IGCA 5M5WH 5LMNQ 2EXDA 2FMMA 5M3FB 1MKHA 1T5EA 1HR0Q 4R8IA 1IYVA 1EWCA 1EFID 2JA6G 1J5EQ 3BYTB 3MAQA 4ZYSA 2E74C 1PRTB 3MHBA 3UDIA 4CJ2C 5CMDA 1BUVT 3M85A 1EY8A 2JA6B 1DOMA 1HFNA 4A3GH 1NSNS 3RR5A 1NAPA 2X6LA 1XYIA 1CKOA 3FMCA 4WJ3M 1CZGA 1VQDA 3KBXA 3OYYA 1S72A 2JK8A 4IUPA 1YITA 1JWMD 2ZTCA 3CC2A 3S1MB 1SNPA 1BR9A 1Q8IA 2JN4A 2VUMG 2EYPA 3NELA 4K5WA 1SJED 1A0IA 3I8ZA 3W5OA 4X64Q 4YWKA 4IOAA 5C44G 1K73C 1LTRD 1SYGA 4MZ9A 2B8FA 3BS1A 3U58A 4QUFA 5C44B 1CFMA 1M90C 3TN2A 4FXDA 3I4MG 1Z9FA 1S5ED 3D4WA 3M7GA 1EOTA 1UEBA 4O0AA 1KC8C 1ZYRC 4ZQ3A 4QQBX 3I4MB 4IURA 3R93A 4DR1L 1RCVD 3SHLA 2JJQA 3H3VC 3VR2A 4FYDA 1N36Q 3F8TA 4N9TA 2KVMA 4OWTB 4UHVA 2E2HB 3KDFB 4X3UA 4WJWA 1PH3A 5FJ8G 3U50C 1AZQA 1V8QA 3RLFA 3PO3G 2NVQB 4L6TB 1WTQA 5HGQA 2BE5D 4PMWA 1X3GA 2A5HA 1EYDA 1SFOB 5FLMG 1D5XC 1Y14B 4AQYL 4FDBA 1Y8NB 4BWGB 1SYCA 4BY7H 1KIXA 2HHHQ 5EBDA 2VQFQ 2XWBB 2R3ZA 1VQNA 1SMYD 4TVAB 5IT9c 5EGTA 2EYOA 1X3FA 1S5FD 4GOPA 4ME3A 1GO3E 1TVXA 1SNMA 2F0OA 2P5ZX 3QWNA 1B9NA 3OOCA 4E6IA 1BVSA 1YHAA 3QB3A 2WFWA 4DUZQ 1BCPF 3R2IA 3P20A 5HY6A 2K5QA 3GP7A 1TS2A 2NZ1D 1KAAA 3TRZA 1CM9A 4A3EH 4B3SL 4DNRB 2B2VA 5A2QL 1KDBA 2UXCQ 1U5KA 3LWEA 1KHIA 1A3UA 5CORA 4IUVA 3CPFA 2G9DA 2R93H 4DXGA 4ZAIA 4LFCQ 2J4XA 2ALYB 4DV5L 2EJFC 5D3IB 3MXGA 2DJGC 5ELNA 3VYRA 1SJHD 1IBLL 2Z1CA 1PZID 1LYLA 1U4LA 4NW2A 3I91A 3K80C 1I94L 4U68A 1JORA 1Y1VH 4XQJA 1VQKA 2Z0SA 4H02A 1PTOH 1AP0A 2AWNA 3PSIA 1Z6HA 1FR3A 4LUZA 4EQNA 5C3WA 2KJXA 5LMUQ 3S2HB 3J7A5 2BDNA 4DK0A 4OX9L 1I6HH 1MD2D 1G91A 4BA2I 1WTPA 1WTVA 3AQQA 3PF4A 2D2CC 3STBC 1ZKOA 4A93H 1B50A 2KEEA 5A2QE 3L3OC 2TMPA 2L15A 4WORA 3D0FA 3R2TA 3DWQA 4K5VA 3M3YB 1CSQA 3Q0AA 1X3QA 1X6OA 4L5TA 3RMHA 4DV7Q 5COYA 3DMUA 5IY0A 4FVMA 2JEAI 1CA6A 3GTMB 4K5XA 4RHSA 1YHBA 4C2MH 5FO8B 3RN2A 1C0AA 2JA9A 2K05A 3NP8A 3P1HA 3TEHB 3CKIB 2OWOA 4MNOA 2L5TA 1EU3A 3I4LA 3U4VA 2IX0A 4B3MQ 2HD3A 4YHHQ 3CHBD 3ICEA 2AKWB 4CDCC 1E2VA 3GTOH 1XPRA 5M5YH 3K0YA 2A74C 4BS9A 4DR2Q 1LT4D 2CFMA 1ASYA 4DAYA 1JJGA 1E7ZA 2PQEA 4DV4Q 4DV1Q 2N88A 4JBJA 3GTGB 3QOLA 2AMCB 3K81C 2KEDA 1C4QA 4L63B 1BXTA 2KCMA 1V1PA 2FMCA 5I6YA 3A0JA 4B9WA 4X62L 4X3SA 1CUKA 2K03A 1JQYD 2MNAA 4LWCA 4RGNA 3BDLA 1FGBD 1S4ZA 4DV2L 2FXQA 4GNXC 1RJTA 1EY9A 1VQJA 3PV0A 4WRDA 3CCRA 3DHQA 3KLSA 1RTOA 1KDAA 3S17H 3QJYA 3A55A 1TY0A 2J7ZA 4TKOB 1VQ4A 5C3EH 4DV3Q 2OT2A 1PLFA 4ZUJA 5CV9A 2CQOA 2KUMA 2IX1A 5M3MH 2UUBQ 2F0SA 3GTQH 1ENAA 1N36L 2WB1E 4YWLA 3I3CA 4GN5A 1WTOA 1MJEA 4HIKA 3D6WA 2UUCQ 3QR8A 3PUWA 2IL8A 1C9OA 4DAVA 2A6EC 3UE1A 1RHPA 2F0KA 4QIWB 2JA8H 2KHSA 2A19A 2ENBA 4G7OC 2NB0A 4CHTB 4A3MH 4JI2L 1Y1VG 4O2DA 2HCIA 4PG3A 3DEOA 2MP1A 3RUZA 1L1OA 1KRSA 2Z6KC 1PXUA 1F2YA 4DAYB 2HHHL 1PTOB 1YNJC 3CCEA 5IYCH 1IW7C 3J80E 2KENA 4A3IB 1VF5C 1JJCB 3KLRA 2M00A 3T1HQ 4BBSH 2ID0A 3S1NB 1DZ1A 2ZJPA 4O42A 1CKMA 1EL0A 1FVIA 3OWFA 3I73A 1JE4A 3H09A 3J7YW 1ENCA 1CQFA 1LTAD 3S1QH 2L11A 4HJ5A 4A3BH 3A7AB 4V0BA 2NVXH 4TRDA 2JSOA 4JI6Q 2K5VA 3M4QA 2R92H 5DM63 4OWXB 4JBKA 3J81c 4EQOA 1E2WA 1LT5D 2KHIA 3SR1A 5GQOA 1JOQA 5E4WC 4R4QA 3VA5A 4G7HC 2IY5B 5C4JB 3MA2B 5IGGA 5JJLA 1XMQQ 5JOBA 5JEAH 2J0TD 5IGDA 4JI8Q 1VQFA 3A8JE 2B2WA 3GD7A 1VQCA 3SK4A 1NCVA 4I65A 4A3FH 5BR8L 4BY1H 1S40A 3J81L 3DXJC 5J1ZA 1STNA 4DR5L 3CCQA 3H0GB 1PH8A 1NR2A 2YU9B 1TWHH 1Q1EA 4OELB 1U4RA 1D6EC 2B2YC 3VR3A 4AYBE 1HNXL 4OGQC 3UE0A 2FHTA 1JB7A 2WB1B 5KEEA 2D0OA 4JI5L 1SXTA 1Y69U 4QUCA 1L1OB 4JCVE 3RZOH 4NKLA 4KD4A 1O7IA 5AJ3L 1L0XB 2ES2A 3C2PA 5IGBA 2OXPA 2SDFA 2BDOA 4JBWA 2FINB 4XIGS 1QVFA 2NZOA 1HCZA 3MEHA 2F52A 1LM0A 1SMXA 1OXUA 5BN4A 1VQOA 2QW7A 3S17B 2VNUD 5C3EG 3MC0B 5T1IA 1D5ZC 1OO9B 2AWOA 4DN4M 2Q8TA 3L9AX 3KLSX 4A3JG 5M3MG 3HOXH 1SE4A 5IYBH 1NUCA 2WACA 1VCIA 2XN9C 2F0HA 2I46A 3NTIA 4A3JB 4B3ML 4XT3B 3U9OA 4RMFA 1GHKA 4YWMA 4MTKA 1Q82C 2ZT9C 3NXWA 3PF5A 2A69D 4XT1B 1A8VA 1PDQA 1IL8A 1KABA 4DR1Q 2NVTH 4LUVA 1DJRD 1I4XA 3S14H 2LXKA 4PZ8A 3BZDB 1B7YB 5I6WA 1ESRA 2F0DA 1TWAH 4L5QA 2BH2A 3MXNA 1E22A 3MFGA 5JPNC 4RGOS 3TQYA 2BA0A 3TS0A 1P16A 3K8AA 4XTCS 4JI7Q 2B63B 4WFN3 1VQGA 1I6VC 4KHPL 3S9WA 4BBSG 2EYMA 1QWYA 4BBSB 1WD0A 2E2IH 1SN8A 2E75C 3CCSA 1QILA 2WKCA 5J39A 2PYKA 2E76C 5ELBA 3M4YA 2XRSD 2ZXOA 3J7ZC 3KJOA 4OL7A 1Y8PB 5K36H 4ZRZA 2NBFA 1J8IA 1X3EA 3S24A 2I0QA 3DM3A 1R4PB 1EEID 4F8MA 4CJ0B 1SROA 3AU7A 1U0LA 4KI0A 1MSHA 3QOJA 2Z8LA 1O7LA 3J81j 4Y52H 4R8NA 2EIFA 1STGA 4JK1C 2XIWA 1PRTD 4B3SQ 1K3BC 4JV5L 1YJWA 3KF6B 3LNNA 5E3FA 4ILWA 3GTLH 1Y1WH 1Q1BA 1AEXA 2QF7A 1Q90A 5I9PA 5H1SE 2NVYH 1PYSB 4NPSA 4IPGA 3VDYA 3TZUA 4DV5Q 4JI1Q 3U4ZA 1YNND 4A3FG 4R4IA 3RZDB 4C3HH 1IBLQ 4X66Q 3FKIG 3NE5B 2JP1A 1RKNA 1KRTA 3FKIB 2CKZB 4ME5A 3MXNB 1SDFA 4AH6A 1HJPA 4K2KA 4ULLA 2B2UC 4XQQA 3L2PA 3I4OA 2NTSA 4OXPA 5JAVA 3RN5A 3ZJYC 2F0PA 3L7ZC 3RNUA 5CV6A 1STBA 1QVCA 4JI6L 1N8RC 1M4VA 4N9PA 4GLAC 3HOZG 1BCPD 5I9OA 3HOWH 5C5MA 1SNDA 5G3LF 1QE6A 1P8LA 4RWSC 1JCKB 2Z4IA 1X3PA 2C35B 3DWPA 1LTTD 2HDLA 2XSCA 4U673 3HOZB 1IYUA 3HOXG 5IYBG 1WCMG 2PMZE 4DAPA 4MTNA 2F1MA 4CKCA 1KD1C 4DA2A 1WCMB 3KDFA 2LS01 4HJ7A 2MO1A 1T5XD 1XMQL 2EVBA 2H5XA 3VR4A 2R7ZB 5KNDA 1A63A 3CP0A 3ZYYX 2F03A 3CC4A 2YTVA 3JAML 1Q12A 2V4DA 2HIXA 5J3BA 4GNXA 2IPKD 4PMBA 1NMGA 4MIUA 1B2TA 4R1JA 2Q2IA 2E2JH 1W2BA 4GZYC 4BBRH 1E24A 1K8AC 4Y7NH 3CQZB 2RF4A 1GJXA 2DGYA 2WAQG 2F0IA 1BDOA 2K04A 1GUTA 5GAEC 2N8NA 1YHQA 4IOCA 1TY2A 2WAQB 1R9TB 2MPMA 5IGEA 2QEJC 4X62Q 1EYGA 3H15A 3UDGA 5K36G 1XWEA 2VUMB 1EU4A 2PW7A 4QB4A 4DV2Q 4C3JH 2MHVA 1QG7A 1S5CD 2RHQB 3H6MA 2B2TA 4JI0L 1I3QB 4QF4A 3GTJB 2PQAB 3F2BA 3QIAA 1SR3A 3K7AB 3CD6A 2ATWA 1KAWA 2K6AA 1XTCD 5EKKA 4TSSA 1LTBD 2Z6KA 4DV6L 1G8ZD 1Z47A 3BYYB 3S16B 4YY3L 3KF8B 1PRTF 1TWFH 1EIFA 3EIVA 2Q2HA 4YCVA 3TP8A 3PIOA 1Y1WG 3CRKC 3TMEA 5JJKA 1K0RA 4OONA 3J81i 4IPDA 2PI2E 3NBHB 4Z9CB 4C3IH 1HPCA 5E7NA 3MFYA 2EXZA 4JI7L 3TBIB 4K0KL 1QZGA 5JJZA 1PMRA 3PO3B 4JI2Q 3R3OA 4GNXB 4KJOA 2PMZB 4UPAA 3FDTA 3WOFA 4J8QA 2F3WA 2HQEA 1JT8A 2PI2A 4KJNA 4QY7A 5IOCA 2N3SA 5CV5A 3BU2A 1SSOA 3I90A 2CWAA 3S2DB 1QOHA 1RTNA 3HOWG 4YCWA 4C1NI 1TWCB 3I4NG 3KFUA 4B9XA 1N34L 1FNUA 4LW1A 1Q7YC 2ZM6L 3I4NB 4PMCA 4DUYL 4HTHA 1CI3M 4C56C 4DFAA 2A68D 3H91A 3SVMA 2SNSA 3TS2A 3TP5A 4HJ8A 1Q3LA 2ZTDA 3VYTA 1I50B 2B2YA 3BZKA 4LUOA 2K32A 2R61A 1YEZA 3CCUA 5IT9L 5KIXA 4QCLA 2EJGC 3ER0A 5KNCA 1WI5A 4JI1L 3URYA 3I2ZA 3PGZA 3F2DA 4X66L 3M4OH 1GD7A 1I4RA 5M5WB 1VQPA 2DN8A 3E0JA 4L5RC 1EQTA 2CW0D 2HUGA 1YZ6A 2F0QA 1SAPA 1LTLA 2JA5H 1F2LA 2RCFA 4LJZC 1OXTA 3T1YL 4JPBW 3HOYH 4A3GG 1UUPA 1BO0A 2N55A 4JG2A 4P2CB 3SK6A 4A3GB 5BR8Q 2B39A 4KV6A 1UE6A 4LF9L 4DR5Q 1HNZL 1TS4A 3B6YA 1HNXQ 1BBXC 4QIWE 3A74A 3BDCA 4Q0FA 4JI5Q 1HH2P 1EUJA 1X65A 4ID6A 4HEDA 5DEHA 4C3JG 1E1OA 5CV4A 5FKAC 5AJ3Q 5BN5A 2JA7H 4KHZA 3GV3A 3FPPA 2IW3A 3W3AA 1D1IA 2F0MA 1W6KA 2AUJD 1YIJA 3TZDA 3I55A 1FGUA 5JJIA 1D7QA 3T4AC 3W1GA 1ICFB 1JR0D 4MN3A 2O5JC
chains in the Genus database with same CATH topology
4RAUC 1OXSC 5I2YA 1LTGD 4O1NA 1XX8A 1F77A 1EEFD 2EYJA 2VB3X 2M2LA 1E2ZA 2DY7A 1SYFA 5K5PA 3G7LA 2D62A 4ZKCB 1M8AA 3K5LA 2PPBC 3E5SA 2OEOA 4DK1A 2A6HD 3Q24A 1MBYA 1SYDA 3MTSA 1TU2B 1HTPA 4G7ZC 1EY7A 5FO7B 1F9QA 2L55A 4BY7B 4J1MA 1BCPC 2KECA 2BOSA 3ND8A 1MI2A 4ABNA 2KOLA 3ND9A 4CGYB 1DCZA 1A15A 3OIPA 1KTKA 2AQ2B 2K7VA 2EOTA 1I4HA 2L9HA 4ZKBB 1JOOA 4LAAA 5FO9B 4OIJA 4A3EB 4KD3A 1KLUD 3NWSA 3EQLC 5KGUA 1V1OA 2RA4A 2R93B 1B1ZA 2B2UA 1RD9D 2EJMA 5D3DA 4K2LA 3J7AV 1A3VA 2RSNA 2K33A 2HCCA 1RF2D 4TQUS 1Y1VB 3A8KE 1LV9A 4EQPA 1Y8OB 1PFMA 1I4QA 1I6HB 3K5NA 4XDXA 4OO1I 4MHEA 5BN3A 4A93B 5LL6S 5I4DA 1U4PA 2NN6H 1F2MA 2L12A 1QCBD 3HP3A 1SBBB 1I4PA 3NUCA 4CKBA 4IFDI 2M9VA 1NR4A 2WV6D 1PZJD 2K01A 3D6CA 2KQ3A 4ODGA 3MVVA 1QJOA 2O4XA 4C2MB 4H0LC 1F9RA 1DOKA 2FFKB 1IHZA 1PTOF 3H94A 2BE5C 3IFTA 3GTOB 5M5YB 5KYLA 2EPBA 4HSVA 4IUNA 3D4DA 1S5BD 2SOBA 2MUYA 4FF4A 3X3MA 4K8IA 1HA6A 1SMYC 3C3LA 1ZYRD 1O78A 2EY2A 3VR5A 4DGZA 2B2VC 3NQIA 4XXEA 3PIO3 1CHPD 1KNAA 5G3LD 3VYSA 5IGFA 4XYOA 4DU9A 1UNSA 4V190 5LHY1 3F2UA 1EY0A 1B9MA 5C3EB 1FNWA 1W6JA 5M3MB 3OHXC 3ERQA 3GTQB 3J81E 1MSGA 5C0XI 3HRZC 4DF7A 4B08A 2VXWA 3MWYW 1PFNA 3QG1A 1IKMA 2JA8B 1TIID 2D5DA 1HXYD 3HGBA 2F3VA 3U9SA 1WVLA 3CRLC 3EVQA 3BG3A 5T1GA 4A3MB 3OSOA 4KY5A 2XVSA 1BOSA 4ZUIA 3T16A 4X3KA 4UDUC 3MXPA 1AZPA 3IFDA 2C5CA 1STAA 1ET6A 2ZXPA 1TS5A 2F0TA 2O5IC 4KKUA 3S1QB 4A3BB 2NWGA 1STHA 5JEAJ 5EQ0A 2NVXB 1TS3A 3HG9A 1FYCA 2R92B 2RDFA 4NP5A 1A2TA 5KYIA 1EIGA 1CHQD 3CU7A 4UAIA 1CA5A 4H13C 5D14A 5KRUA 2EY5A 5JEAG 3TDQA 1WTWA 4RKLA 3EA6A 4BA1I 1CTMA 3EFXD 3NHHA 3OIQA 5CV7A 1Z7TA 5ELEA 5TSSA 4A3FB 4BY1B 1GUNA 1HUMA 3Q22A 3M7NA 1TWHB 1D2BA 2NN6I 1GOZA 2NTTA 5DM73 5IODA 3RZOB 2ICEC 1TKWB 5EKIA 3A7LA 2AQ3B 3KF8A 1U9RA 1EZ6A 3HOXB 1H9RA 3BVMA 3NBHA 1G2SA 4KN4C 2EYFA 2CVRA 2EY1A 4FNFA 2F4IA 5CC4A 5ELCA 4NDXA 2NVTB 3S14B 4FF1A 4KY6A 4IQZA 1ET9A 4IUTA 2D9UA 1WTXA 1DM0B 1TWAB 2JEBI 1MGSA 4RCOA 3V96A 1H9SA 4KKSA 1B4OA 1GUSA 1KLGD 2F0NA 5ELFA 2RDGA 2MGSA 2Y0SB 2A6ED 1JC7A 2E2IB 1QNKA 4KK7A 4HN7A 5JVG3 4RH6A 3AMUA 2A73B 2AUKA 3I70A 1K8OA 4C1NK 3JAME 2PCFB 1YNJD 5M9OA 3ITPA 1IW7D 2B2WC 4K6DA 2XRQD 3SEBA 2DNEA 1STYA 3GTLB 5EBCA 5KNBA 2BCOA 3NQTA 4XYQA 1DXMA 1Y1WB 2NVYB 1HTLD 3HEJA 3EROA 4C3HG 1QB5D 4KHVA 4C3HB 4Q5VA 3K57A 5FK9C 2RKSA 1BCPB 1E0BA 1C8CA 2RSOA 2CHBD 1SNOA 1OXVA 1LO5D 2FJ2A 2VB2X 4IALA 2PZWA 4QMGA 1O80A 2JE6I 5C4HA 2SNMA 4J6HA 5EJWA 1H9SB 4CBVA 3NTKA 1D5MC 4ZLTF 2Q8IB 3SDZA 1SEBD 2LFNA 2QKIC 1SNCA 3A54A 1AFPA 5CBEE 4KKTA 4OO1H 3HOWB 1ML0D 2NYZD 1HQRD 1L0YB 4FF2A 5ISRA 4PV1C 1GXDC 2A69C 1ESFA 2F0EA 1UEAB 4RGMA 3R8BA 1DYQA 1CK1A 4IFDH 1ILQA 1H9KA 3ONAB 1BF4A 2ZXRA 2R6GA 1JOKA 3TP6A 1G6ZA 3BVZA 3SXHA 1EWHA 2LKVA 2E2JB 4BBRB 4HCSA 1LT6D 4Y7NB 1O7ZA 1ICWA 4X3TA 3T53B 3D8GA 1EY6A 1AN8A 3GQBA 4H7BA 5CYUA 2RQXA 1C48A 1TQOA 3FEWX 5J22A 1TT2A 4HCEA 4LK1C 4OIKA 4H44C 3BVGA 1EY4A 5IT9E 4XQNA 1VDZA 5HGTA 4FO2A 4FXGC 4C3JB 4CKEA 3IKJA 1PRTC 1LT3D 3P75A 3PUVA 4G4KA 2IWHA 1EZ8A 3MXUA 5D65A 3G6JB 2KCNA 2EE1A 3K59A 5JVH3 3SK5A 1VMPA 3NTHA 1YNNC 1TWFB 1B3AA 1EYCA 1PTOD 2JYOA 5F2DA 4RFBA 1SE2A 4C3IG 1EY5A 1HFGA 4PQXA 4C3IB 5C0XH 1J9OA 2TSSA 1GUGA 2RBMA 3NPPA 5EKLA 2SEBD 1X32A 2LY7A 3OW7A 3DM1A 4RHRA 3T51B 1VF7A 2Z4HA 3E6ZX 1SNQA 1XXGA 2H4OA 4IFDJ 1QNUA 5CBAE 4OO1G 3EJIA 1G2TA 2PZUA 2EZVA 4HAEA 2H1EA 2IJ0A 1CT1D 4HMIA 5DAUA 1BNZA 3A56A 1ILPA 4LMQD 2IT1A 3DWAA 3D31A 4IFDG 4OHJA 3J80L 1II3A 2XWJB 4RA8A 1G291 2XNAC 3K6OA 1R4QB 5C6AA 4NMZA 3M4OB 2I07B 4HR7B 2X69A 3KUPA 2JA5B 1D1KA 1WD1A 3HS0C 1HQMC 2F0VA 3HOYB 2PW5A 1LACA 1HHVA 1SE3A 2EDGA 3LWUA 2MJ8A 1ONLA 2B2TC 2RDHA 1GUOA 2QILA 5C4ZA 2L4NA 2EYLA 3FPUB 1VMCA 3QO2A 3PUXA 1TR5A 5CGKA 1F9PA 3O13A 4K6LA 1BQQT 1EYAA 3BDOA 2CQAA 2K5DA 2JA7B 5DNFA 2IX3A 4G57A 2B8GA 1V1PB 5C0XJ 1I4GA 3TP7A 1DONA 2DY8A 5JPMC 1O7YA 1LTSD 1K83B 5M5XB 2O2LD 5C0XG 2F0FA 2Q8RE 2PNRC 3C1FA 1ZXTA 3LX0A 3X3NA 4A3DB 1LABA 3N6RA 3GTKB 2EYHA 2AQ1B 3FVQA 3HOVB 3HKZB 1RDPD 4FXKC 4IZ8A 1HA5A 3Q23A 5A35A 3NK9A 2OF1A 3PUZA 1SYEA 2GA4B 4M1UB 3K5MA 1A3TA 3I72A 1GUWA 4CJ1B 2L1BA 2A68C 3PUYA 3K5OA 2F0JA 3UI2A 3HZXA 2NUCA 5FOBB 5FLXL 1JB3A 1FD7D 3K58A 3OPOA 4S3SA 4IUQA 3S15B 1DD2A 2CW0C 5C5LA 3OWEB 2F0LA 3SK8A 1SYBA 1F2ZA 2KCCA 3J7AF 2K1BA 2QDBA 5EPLA 4FF3A 1RODA 4K14A 1PZKD 4KTAA 2HDMA 4HSPA 2WINB 1LLRD 1CQVA 3RD4A 3DUZA 4R9WA 4YIJA 3V2TA 4RCNA 1KDCA 1OXXK 2DNCA 4KMUC 1ZEQX 2F0WA 3GV6A 1F9SA 5FLXE 5EPKA 2JXMB 1A6XA 2NN6G 3OMGA 2F0UA 1FNVA 4IUUA 3GO5A 3T56B 5CR3A 3HOUB 4DNTB 2X6GA 3NSWA 4IN3A 3NWTA 3T13A 4F88A 5LL6X 2QCPX 3PO2B 2YYZA 2WP8J 3PIP3 4DXFA 5E4XA 1PTOC 3C1EA 2C9OA 1STEA 2WKDA 5EPJA 3D4RA 4ZK9B 2K5WA 3SE0A 3TSSA 1WTRA 3V05A 3WDNA 1PYWD 1GHJA 2EY6A 1V43A 5AFWA 1PFBA 2LMCB 3VR6A 3Q6SA 3D3RA 3OMCA 4I7ZC 5NUCA 1EQVA 4RGTA 1EIHA 4L8JA 2A6HC 4AYBB 4KY7A 4F87A 2F0GA 4PNYA 1JWSD 3N52A 3KK7A 4M8AA 4KN7C 3W2DA 3VA7A 1DOLA 1IKLA 1B53A 3VYUA 1CZWA 3NBIA 3C46A 1U4MA 5HURA 1A2UA 5C3XA 3IL8A 3S1RB 2BA1A 2RVLA 5C4XB 1S5DD 4EVOA 5ELDA 5CV8A 1HRJA 1AW7A 3FRPB 1KNEA 3DEPA 4K8JA 1K8MA 5IIFA 3PMFA 1TWGB 4FP5D 1LTID 2L0CA 1UAPA 1HUNA 3WOEA 2KA7A 1ENFA 2WIIB 2E2DC 4F7XA 3GTPB 3MZ5A 1JICA 1JWUD 3KBGA 3A8IE 1H9MA 1H9JA 4A3KB 4HMJA 1B44D 4RKBA 3P7JA 2K28A 2G9HD 2PZTA 5E1FA 3AB9A 4EGVA 2ICIA 5I2XA 2PO4A 3IAYA 5IGCA 5M3FB 2FMMA 1T5EA 4R8IA 1IYVA 1EWCA 1EFID 3BYTB 3MAQA 4ZYSA 2E74C 1PRTB 3MHBA 4CJ2C 5CMDA 3M85A 1BUVT 2JA6B 1EY8A 1HFNA 1DOMA 1NSNS 1NAPA 2X6LA 1XYIA 3FMCA 1CZGA 3KBXA 4IUPA 1JWMD 3S1MB 1SNPA 1BR9A 1Q8IA 2EYPA 4K5WA 1SJED 3I8ZA 1LTRD 1SYGA 2B8FA 3BS1A 4QUFA 5C44B 1CFMA 3TN2A 4FXDA 1S5ED 3D4WA 3M7GA 1EOTA 1ZYRC 4ZQ3A 3I4MB 4IURA 3R93A 1RCVD 3SHLA 3H3VC 4FYDA 3VR2A 4N9TA 2KVMA 2E2HB 4X3UA 4WJWA 1AZQA 1V8QA 3RLFA 2NVQB 4L6TB 1WTQA 2BE5D 4PMWA 2A5HA 1EYDA 1SFOB 1D5XC 1Y8NB 4BWGB 1SYCA 5EBDA 2XWBB 2R3ZA 1SMYD 5EGTA 2EYOA 1S5FD 1TVXA 1SNMA 2F0OA 3QWNA 1B9NA 3OOCA 4E6IA 3QB3A 1BCPF 3R2IA 3P20A 2K5QA 3GP7A 1TS2A 2NZ1D 1KAAA 1CM9A 4DNRB 2B2VA 5A2QL 1KDBA 3LWEA 1A3UA 5CORA 4IUVA 2G9DA 4DXGA 4ZAIA 2J4XA 2EJFC 5D3IB 3MXGA 3VYRA 1SJHD 2Z1CA 1PZID 1U4LA 4NW2A 3I91A 4U68A 1JORA 4XQJA 1PTOH 1AP0A 2AWNA 1Z6HA 1FR3A 4EQNA 5C3WA 2KJXA 3S2HB 2BDNA 4DK0A 1MD2D 1G91A 4BA2I 1WTPA 1WTVA 2D2CC 1ZKOA 1B50A 2KEEA 5A2QE 3L3OC 2TMPA 4WORA 3R2TA 3DWQA 4K5VA 3M3YB 3Q0AA 1X3QA 3RMHA 5COYA 3DMUA 4FVMA 2JEAI 1CA6A 3GTMB 4K5XA 4RHSA 5FO8B 2K05A 3NP8A 3P1HA 3CKIB 2L5TA 1EU3A 3I4LA 2IX0A 3CHBD 1E2VA 3K0YA 2A74C 4BS9A 1LT4D 4DAYA 2PQEA 2N88A 3GTGB 3QOLA 2KEDA 1C4QA 4L63B 1BXTA 1V1PA 2FMCA 5I6YA 4B9WA 4X3SA 2K03A 1JQYD 4RGNA 3BDLA 1FGBD 1S4ZA 1RJTA 1EY9A 3PV0A 4WRDA 3DHQA 3KLSA 1RTOA 1KDAA 3QJYA 3A55A 1TY0A 2J7ZA 4TKOB 2OT2A 1PLFA 4ZUJA 5CV9A 2KUMA 2IX1A 2F0SA 1ENAA 3I3CA 1WTOA 3D6WA 3PUWA 2IL8A 4DAVA 2A6EC 1RHPA 4QIWB 2F0KA 2KHSA 2ENBA 4G7OC 2NB0A 4CHTB 2HCIA 3DEOA 2MP1A 3RUZA 1PXUA 1F2YA 1PTOB 1YNJC 1IW7C 3J80E 4A3IB 1VF5C 3KLRA 2M00A 3S1NB 2ID0A 1DZ1A 4O42A 1EL0A 3OWFA 3I73A 1JE4A 3H09A 3J7YW 1ENCA 1CQFA 1LTAD 2L11A 3A7AB 4V0BA 4TRDA 2JSOA 5DM63 4EQOA 1E2WA 1LT5D 3SR1A 1JOQA 5E4WC 3VA5A 4G7HC 5C4JB 3MA2B 5IGGA 5JOBA 5JEAH 2J0TD 5IGDA 3A8JE 2B2WA 3GD7A 3SK4A 1NCVA 4I65A 3J81L 3DXJC 5J1ZA 1STNA 3H0GB 1NR2A 2YU9B 1Q1EA 1U4RA 1D6EC 2B2YC 3VR3A 4OGQC 2FHTA 2WB1B 5KEEA 1SXTA 1Y69U 4QUCA 4NKLA 4KD4A 1L0XB 3C2PA 5IGBA 2OXPA 2SDFA 2BDOA 4JBWA 2FINB 4XIGS 1HCZA 3MEHA 1OXUA 5BN4A 3S17B 2VNUD 3MC0B 5T1IA 1D5ZC 1OO9B 2AWOA 4DN4M 2Q8TA 3L9AX 3KLSX 1SE4A 1NUCA 2WACA 1VCIA 2XN9C 2F0HA 2I46A 3NTIA 4A3JB 4XT3B 3U9OA 1GHKA 2ZT9C 3NXWA 2A69D 4XT1B 1PDQA 1IL8A 1KABA 1DJRD 1I4XA 3BZDB 5I6WA 1ESRA 2F0DA 3MXNA 3MFGA 5JPNC 4RGOS 2BA0A 2B63B 4XTCS 4WFN3 1I6VC 3S9WA 2EYMA 1QWYA 4BBSB 1WD0A 2E75C 1QILA 2WKCA 5J39A 2PYKA 2E76C 5ELBA 3M4YA 2XRSD 2ZXOA 4OL7A 1Y8PB 5K36H 4ZRZA 2NBFA 1J8IA 1R4PB 1EEID 4F8MA 4CJ0B 3AU7A 4KI0A 1MSHA 3QOJA 2Z8LA 1O7LA 4R8NA 1STGA 4JK1C 2XIWA 1PRTD 3LNNA 5E3FA 4ILWA 1Q1BA 1AEXA 2QF7A 1Q90A 5I9PA 3TZUA 1YNND 3RZDB 3NE5B 2JP1A 1RKNA 3FKIB 4ME5A 1SDFA 4K2KA 4ULLA 2B2UC 4XQQA 2NTSA 5JAVA 2F0PA 3L7ZC 5CV6A 1STBA 1M4VA 4N9PA 1BCPD 5I9OA 5C5MA 1SNDA 5G3LF 1QE6A 4RWSC 1JCKB 1X3PA 2Z4IA 4U673 1LTTD 2HDLA 3DWPA 2XSCA 3HOZB 1IYUA 4DAPA 2F1MA 4CKCA 4DA2A 1WCMB 2LS01 1T5XD 2EVBA 3VR4A 2R7ZB 5KNDA 3ZYYX 2F03A 3JAML 1Q12A 2V4DA 2IPKD 4PMBA 4MIUA 1B2TA 4GZYC 3CQZB 1GJXA 2F0IA 1BDOA 2K04A 1GUTA 1TY2A 2WAQB 1R9TB 2MPMA 5IGEA 2QEJC 5K36G 1XWEA 2VUMB 1EU4A 2PW7A 4QB4A 2MHVA 1QG7A 1S5CD 3H6MA 2B2TA 1I3QB 4QF4A 3GTJB 3QIAA 3K7AB 2K6AA 1XTCD 5EKKA 4TSSA 1LTBD 1G8ZD 1Z47A 3BYYB 3S16B 1PRTF 3TP8A 3CRKC 3TMEA 4Z9CB 1HPCA 3MFYA 2EXZA 3TBIB 5JJZA 1PMRA 3PO3B 3R3OA 4KJOA 2PMZB 3FDTA 3WOFA 4J8QA 2F3WA 2HQEA 4KJNA 5IOCA 5CV5A 1SSOA 3I90A 3S2DB 1QOHA 1RTNA 4C1NI 1TWCB 4B9XA 1FNUA 3I4NB 4PMCA 4HTHA 1CI3M 4C56C 4DFAA 2A68D 3H91A 3SVMA 2SNSA 3TP5A 1Q3LA 3VYTA 1I50B 2B2YA 2K32A 2R61A 5IT9L 5KIXA 4QCLA 2EJGC 5KNCA 3URYA 1I4RA 5M5WB 2DN8A 3E0JA 1EQTA 2CW0D 2HUGA 2F0QA 1SAPA 1F2LA 4LJZC 1OXTA 1UUPA 1BO0A 2N55A 4P2CB 3SK6A 4A3GB 2B39A 4KV6A 1TS4A 1BBXC 3BDCA 4Q0FA 4ID6A 4HEDA 5DEHA 4C3JG 5CV4A 5FKAC 5BN5A 4KHZA 3GV3A 3FPPA 2IW3A 3W3AA 1D1IA 2F0MA 1W6KA 2AUJD 3TZDA 3T4AC 1JR0D 4MN3A 2O5JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H44 C;  2E75 C;  1OXS C;  4HR7 B;  1VDZ A;  3PUY A;  2D5D A;  2NN6 H;  2E76 C;  4G7H C;  3M4Y A;  3HGB A;  4KN7 C;  1TKW B;  1Q12 A;  3U9S A;  3CRL C;  3A7L A;  3VA7 A;  3IKJ A;  5JEA H;  2EJF C;  1HQM C;  2V4D A;  3BG3 A;  3PV0 A;  1Y8P B;  1LAC A;  3A8J E;  1E2Z A;  5K36 H;  3GD7 A;  1OXV A;  2D62 A;  3PUV A;  3OPO A;  3QJY A;  2EDG A;  2PPB C;  3MXU A;  3LWU A;  4DK1 A;  4TKO B;  2B8F A;  2CW0 C;  1ONL A;  2JE6 I;  3DXJ C;  4KI0 A;  4GZY C;  1DD2 A;  1CI3 M;  1H9R A;  1QJO A;  2A68 D;  2A6H C;  2A6H D;  1CFM A;  1GUO A;  2BA1 A;  2KCC A;  1GJX A;  4H0L C;  1O7L A;  1H9S B;  1BDO A;  1TU2 B;  1YNN C;  1GUT A;  1HTP A;  1Q1E A;  4KN4 C;  1Z6H A;  4G7Z C;  1FR3 A;  3VR3 A;  4OGQ C;  2Q8I B;  2K32 A;  3PUX A;  4JK1 C;  3SDZ A;  4DK0 A;  1Y69 U;  1ZYR C;  2EJG C;  5KNC A;  3ND8 A;  4BA2 I;  3LNN A;  3H94 A;  3PUW A;  1K8M A;  5C0X H;  2BE5 C;  3IFT A;  2A6E C;  2D2C C;  1ZKO A;  3ND9 A;  3BDO A;  1Q1B A;  4IQZ A;  2DN8 A;  4KKT A;  2QF7 A;  1GUG A;  1Q90 A;  3VR2 A;  1DCZ A;  2O5I C;  4KKU A;  4OO1 H;  5K36 G;  2KA7 A;  2JEB I;  4G7O C;  3TZU A;  2BDO A;  2B8G A;  4JBW A;  2K7V A;  4XIG S;  4LJZ C;  4PV1 C;  1HCZ A;  4RCN A;  2A69 C;  1H9S A;  1FYC A;  1OXT A;  3OW7 A;  4KKS A;  1GUS A;  1OXU A;  5BN4 A;  3T51 B;  1OXX K;  3NE5 B;  2DNC A;  1V8Q A;  1VF7 A;  1SMY C;  2AWO A;  3A8I E;  3QIA A;  4KMU C;  3RLF A;  1O78 A;  1H9M A;  4IFD H;  2JXM B;  1A6X A;  1H9J A;  2BE5 D;  1VCI A;  4H13 C;  3VR5 A;  2JEA I;  1H9K A;  2A6E D;  1YNJ C;  2NN6 G;  3EQL C;  1IW7 C;  2R6G A;  1VF5 C;  3KLR A;  5JEA G;  1GHK A;  5C0X G;  1Y8N B;  3T56 B;  4DNT B;  2ZT9 C;  4BA1 I;  2A69 D;  1CTM A;  2PNR C;  3CRK C;  2L5T A;  4OO1 G;  3AB9 A;  3I4L A;  2EJM A;  3L7Z C;  1LAB A;  2AUK A;  1HPC A;  1E2V A;  2YYZ A;  3I73 A;  1EWH A;  3N6R A;  1Z7T A;  1K8O A;  2K33 A;  5BN5 A;  3MFY A;  2PCF B;  4KHZ A;  4TQU S;  1GUN A;  1T5E A;  3FPP A;  1IYV A;  2IT1 A;  3A7A B;  3W3A A;  1PMR A;  1B9M A;  1IW7 D;  1B9N A;  3A8K E;  3OOC A;  2AUJ D;  1IYU A;  3M7N A;  3D4R A;  2BA0 A;  3D31 A;  4IFD G;  3SE0 A;  3T53 B;  2NN6 I;  5A35 A;  2E74 C;  3WDN A;  3P20 A;  3M85 A;  1Y8O B;  4XTC S;  2F1M A;  3GQB A;  1GHJ A;  1V43 A;  3PUZ A;  1G29 1;  1I6V C;  1E2W A;  2LMC B;  3VR6 A;  4DNR B;  2DNE A;  4I7Z C;  2EVB A;  3I72 A;  3VR4 A;  3FMC A;  2O5J C;  5BN3 A;  3QG1 A;  5KNB A;  4L8J A;  5KND A;  1DXM A;  2A68 C;  4LK1 C; 
#chains in the Genus database with same CATH topology
 4RAU C;  1OXS C;  5I2Y A;  1K83 H;  5M5X H;  1LTG D;  4O1N A;  1XX8 A;  2XTI A;  1F77 A;  1UE7 A;  4IJL A;  1VQM A;  4NXM L;  1EEF D;  2EYJ A;  2VB3 X;  4EX5 A;  2LXJ A;  4KLK A;  4UP7 A;  2M2L A;  1E2Z A;  4A3D H;  2DY7 A;  1SYF A;  1DGS A;  5K5P A;  3G7L A;  2D62 A;  4ZKC B;  1M8A A;  3GTK H;  3K5L A;  2PPB C;  3E5S A;  1NNX A;  2OEO A;  4DK1 A;  4JW0 A;  4A3L H;  2IHE A;  3HOV H;  1V9P A;  1XNQ L;  2A6H D;  3Q24 A;  1MBY A;  1SYD A;  3I7F A;  3MTS A;  1TU2 B;  1HTP A;  4G7Z C;  4BY7 G;  2A8V A;  1EY7 A;  5FO7 B;  1F9Q A;  2L55 A;  4BY7 B;  4J1M A;  1BCP C;  4KHP Q;  2KEC A;  2BOS A;  4P72 A;  3ND8 A;  4IPC A;  3J80 c;  1MI2 A;  4ABN A;  3BZC A;  2KOL A;  3ND9 A;  1YBY A;  4CGY B;  1DCZ A;  1A15 A;  3FP9 A;  3OIP A;  1KTK A;  2AQ2 B;  2K7V A;  4X6A H;  4LF8 Q;  1IBM L;  2EOT A;  1I4H A;  4B3R L;  1XNR L;  2L9H A;  4A3E G;  1N33 Q;  4ZKB B;  1JOO A;  1NJI C;  4LAA A;  4P71 A;  5FO9 B;  4OIJ A;  4A3E B;  3S15 H;  1XPO A;  4KD3 A;  2R93 G;  1KLU D;  3NWS A;  2VQE Q;  3JAM i;  3EQL C;  1RL2 A;  5KGU A;  1V1O A;  2RA4 A;  2R93 B;  1B1Z A;  5IP9 H;  2B2U A;  2ZJR A;  1RD9 D;  2EJM A;  5D3D A;  4K2L A;  4NXN Q;  4JV5 Q;  3J7A V;  2OQ0 A;  1A3V A;  1BBU A;  2RSN A;  2KHJ A;  4JOI C;  2K33 A;  2R7F A;  4JBM A;  1CKN B;  2HCC A;  1RF2 D;  4TQU S;  1Y1V B;  1S3O A;  3A8K E;  1LV9 A;  4EQP A;  4OEM B;  1Y8O B;  5IP7 H;  1XMO Q;  1I4Q A;  1PFM A;  1PH1 A;  1I6H B;  3K5N A;  4A93 G;  3Q8D A;  4XDX A;  2UU9 L;  4OO1 I;  4MHE A;  5BN3 A;  4DR4 Q;  4A93 B;  5LL6 S;  5I4D A;  1U4P A;  2NN6 H;  3HOU H;  1F2M A;  2L12 A;  1QCB D;  3HP3 A;  1XPU A;  1SBB B;  4UP8 A;  3PO2 H;  1I4P A;  3NUC A;  4CKB A;  4IFD I;  2M9V A;  1NR4 A;  4IJH A;  2WV6 D;  2B3G A;  1PZJ D;  2K01 A;  2UXD L;  3D6C A;  2KQ3 A;  4ODG A;  2ZTE A;  3MVV A;  1QJO A;  2O4X A;  1PH2 A;  4C2M B;  3JC6 6;  3CCV A;  4H0L C;  3NEM A;  1F9R A;  1DOK A;  2FFK B;  4JC0 A;  2JQO A;  1IHZ A;  4JI4 L;  1PTO F;  3H94 A;  5GRO A;  2BE5 C;  4LF5 L;  4P74 A;  3IFT A;  3GTO B;  2ZJQ A;  5M5Y B;  5KYL A;  5IE8 A;  2EPB A;  1EOV A;  4HSV A;  4IUN A;  3D4D A;  1S5B D;  2SOB A;  3HKZ G;  1PFS A;  2MUY A;  4FF4 A;  3X3M A;  4K8I A;  4GOP C;  1HA6 A;  4X65 L;  1SMY C;  4HIO A;  3C3L A;  5FLX c;  1ZYR D;  1NMF A;  1O78 A;  2EY2 A;  2LSS A;  4P73 A;  4JI3 L;  1QUQ B;  3VR5 A;  4DGZ A;  3S1R H;  3CCM A;  3AYH B;  5C4X H;  4IO9 A;  2B2V C;  4DV0 Q;  1N32 L;  3NQI A;  1NY4 A;  4XXE A;  3PIO 3;  1HZC A;  1CHP D;  1KNA A;  5G3L D;  1TWG H;  3VYS A;  5IGF A;  4XYO A;  3RLN A;  4DU9 A;  1UNS A;  4V19 0;  5LHY 1;  3F2U A;  1YNX A;  1EY0 A;  3KF6 A;  1B9M A;  1AE3 A;  5C3E B;  3GTP H;  1FNW A;  4DAM A;  4QGU A;  1W6J A;  3A5U A;  4JI0 Q;  5M3M B;  3OHX C;  3ERQ A;  3GTQ B;  3J81 E;  1MSG A;  3LGJ A;  5C0X I;  3HRZ C;  4DF7 A;  4B08 A;  2D0P A;  4DV6 Q;  2JA8 G;  4A3K H;  4A3C H;  2VXW A;  3MWY W;  1PFN A;  3QG1 A;  1G6P A;  1IL2 A;  2MQH A;  3AFP A;  1IKM A;  2K4K A;  4CDF C;  4YY3 Q;  3E9I A;  4PZ6 A;  4GN3 B;  2JA8 B;  5L37 A;  1TII D;  2D5D A;  4A3M G;  1HXY D;  3HGB A;  2F3V A;  3U9S A;  1WVL A;  3CRL C;  3CF5 A;  2CCZ A;  3EVQ A;  3BG3 A;  5T1G A;  4APV A;  4A3M B;  3OSO A;  4KY5 A;  3UDX A;  2CH4 W;  2XVS A;  3UDF A;  1BOS A;  1C7Y A;  5M3F H;  5IYC G;  4ZUI A;  3T16 A;  2E5L L;  1B8A A;  4X3K A;  4K0K Q;  4UDU C;  5IP7 G;  1HZ9 A;  4LFA Q;  3MXP A;  1AZP A;  3IFD A;  4QL5 A;  2C5C A;  1STA A;  1Q46 A;  1MHW C;  1WFQ A;  1ET6 A;  2JA6 H;  4DR7 L;  2ZXP A;  1TS5 A;  2F0T A;  4LF8 L;  1PV4 A;  4A3B G;  1N33 L;  1HNW L;  2B29 A;  2RHS B;  2O5I C;  4KKU A;  3S1Q B;  1B70 B;  3PO2 G;  4A3B B;  2R92 G;  2NWG A;  3S1M H;  1STH A;  5JEA J;  5EQ0 A;  4IPH A;  2NVX B;  1TS3 A;  3HG9 A;  1FYC A;  1X56 A;  2VQE L;  2R92 B;  2RDF A;  4NP5 A;  1A2T A;  1N34 Q;  5KYI A;  1EIG A;  1CHQ D;  3KYH C;  2ZM6 Q;  2WAQ E;  3CU7 A;  4DUY Q;  4UAI A;  1CA5 A;  4H13 C;  5D14 A;  3CPW A;  3STB D;  5C44 H;  4NXN L;  1EFW A;  1WOC A;  5KRU A;  2Q2U A;  4UP9 A;  1PYB A;  3DLL A;  2EY5 A;  3G48 A;  5JEA G;  3TDQ A;  1WTW A;  4RKL A;  3EA6 A;  4BA1 I;  1CTM A;  4GKJ L;  4LF4 Q;  2KBN A;  3EFX D;  4GLX A;  4BY1 G;  1WYD A;  3NHH A;  3OIQ A;  5CV7 A;  1Z7T A;  5ELE A;  5TSS A;  1OTC A;  4A3F B;  4BY1 B;  1XMO L;  1GUN A;  1HUM A;  3Q22 A;  3M7N A;  3E0E A;  3HKS A;  3T1Y Q;  1TWH B;  1D2B A;  4DR4 L;  2NN6 I;  1GOZ A;  3FHW A;  2K5N A;  2NTT A;  5GAG C;  5DM7 3;  5FJ8 H;  2NVQ H;  1AE2 A;  5IOD A;  3RZO B;  4LF9 Q;  2ICE C;  1HNZ Q;  1IZ6 A;  1NTG A;  2PQA A;  1SFO H;  4WJ4 A;  3OW2 A;  1GKH A;  4HID A;  1TKW B;  5EKI A;  3A7L A;  2AQ3 B;  3KLW A;  3KF8 A;  4N8F A;  3F1Z A;  1U9R A;  1EZ6 A;  3HOX B;  1PH4 A;  2UUA Q;  3AFQ A;  1H9R A;  3BVM A;  3NBH A;  1I5F A;  1G2S A;  4KN4 C;  2EYF A;  2CVR A;  2EY1 A;  1QZH A;  4FNF A;  2F4I A;  2V1C C;  2PNH A;  5CC4 A;  3PQI A;  5ELC A;  4NDX A;  2NVT B;  3S14 B;  4FF1 A;  4IQZ A;  1ET9 A;  4KY6 A;  4IUT A;  2D9U A;  1WTX A;  1PH6 A;  1DM0 B;  1TWA B;  2YV5 A;  2JEB I;  1MGS A;  4NXM Q;  4RCO A;  3V96 A;  1W3S A;  3OTO L;  2QEX A;  1H9S A;  1E3P A;  4B3T L;  4KKS A;  1B4O A;  1GUS A;  1FJG L;  1KLG D;  2Y0S G;  4DKA C;  2F0N A;  5ELF A;  2RDG A;  4DV0 L;  1PH7 A;  2MGS A;  2Y0S B;  1XNQ Q;  2A6E D;  4R4C A;  4GKK L;  1JC7 A;  1TXY A;  2E2I B;  1QNK A;  4KK7 A;  4HN7 A;  1HZB A;  1T9H A;  5JVG 3;  4OWW B;  4RH6 A;  3S2H H;  1YJN A;  4AIM A;  3CMA A;  3AMU A;  2A73 B;  2AUK A;  3I70 A;  4CDE C;  1K8O A;  4C1N K;  4JOI A;  3JAM E;  2PCF B;  1YNJ D;  5M9O A;  3ITP A;  4LF6 L;  1IW7 D;  2B2W C;  4QJF A;  1IBM Q;  4B3R Q;  3K7U C;  4K6D A;  1XNR Q;  3M3Y H;  4HIM A;  1D8L A;  1JJ2 A;  1V1Q A;  2XRQ D;  3SEB A;  2DNE A;  1STY A;  3GTL B;  1IYJ B;  3GTM H;  5EBC A;  5KNB A;  2BCO A;  3NQT A;  4XYQ A;  4L5S A;  1DXM A;  1Y1W B;  2QA4 A;  4GLV B;  1VQ5 A;  2NVY B;  1HTL D;  3HEJ A;  3ERO A;  4C3H G;  1QB5 D;  4KHV A;  1MIU A;  1VQH A;  4C3H B;  5EAY A;  4Q5V A;  3K57 A;  5FK9 C;  2RKS A;  4LFA L;  1BCP B;  1E0B A;  1C8C A;  2RSO A;  2CHB D;  1SNO A;  1OXV A;  1LO5 D;  2FJ2 A;  2VB2 X;  4IAL A;  2PZW A;  2Z9H A;  3E9H A;  4QMG A;  1B3Q A;  1O80 A;  2JE6 I;  4N8X 1;  5C4H A;  1VQ7 A;  2SNM A;  4J6H A;  2OQK A;  5EJW A;  1H9S B;  4J15 A;  4CBV A;  1VQ8 A;  3NTK A;  3KOJ A;  2VZA A;  1D5M C;  4ZLT F;  3GTG H;  1WJJ A;  2Q8I B;  3SDZ A;  1SEB D;  2LFN A;  2QKI C;  1KXL A;  1SNC A;  3A54 A;  2UU9 Q;  1AFP A;  5IYD H;  3EN2 A;  5CBE E;  4KKT A;  4OO1 H;  3HOW B;  1ML0 D;  4PZ7 A;  2NYZ D;  1HQR D;  1L0Y B;  4FF2 A;  4JYA Q;  5ISR A;  4POG A;  4LF7 L;  4PV1 C;  1GXD C;  2A69 C;  4GN4 B;  2CWP A;  2K75 A;  4NB3 A;  2K14 A;  1ESF A;  2F0E A;  1IBK L;  4DR6 L;  2QDL A;  4UY8 C;  1UEA B;  4RGM A;  3R8B A;  3BJU A;  2GVB A;  2UXD Q;  1DYQ A;  1CK1 A;  4IFD H;  4POF A;  2F3I A;  1ILQ A;  1IXR A;  1H9K A;  4LF4 L;  3ONA B;  1BF4 A;  2ZXR A;  2R6G A;  2VS1 A;  1PHJ A;  1JOK A;  2RCN A;  3WWV A;  3TP6 A;  1G6Z A;  3BVZ A;  2Q2T A;  4JI4 Q;  3SXH A;  3PIP A;  2K5H A;  5IWA Q;  4A4I A;  4LF5 Q;  1EWH A;  4BBR G;  1CSP A;  2XGT A;  3IRB A;  2LKV A;  2HT1 A;  3ULJ A;  2E2J B;  2AHO B;  4BBR B;  4HCS A;  1ASZ A;  1LT6 D;  4Y7N B;  1O7Z A;  3CCL A;  2DJF C;  1ICW A;  4X3T A;  3T53 B;  1VQB A;  4X65 Q;  3D8G A;  1EY6 A;  1AN8 A;  3GQB A;  4H7B A;  5CYU A;  2RQX A;  1C48 A;  1TQO A;  4JI3 Q;  3FEW X;  1YVC A;  5J22 A;  1Q81 C;  1TT2 A;  1PH9 A;  4HCE A;  4LK1 C;  4OIK A;  4H44 C;  3BVG A;  4A3I H;  1EY4 A;  3ULL A;  3S1N H;  5IT9 E;  4XQN A;  1VDZ A;  2I5M X;  5HGT A;  1EWI A;  4FO2 A;  4FXG C;  4C3J B;  4ZCK A;  4CKE A;  1N32 Q;  3IKJ A;  2UUA L;  3E3X A;  2YTX A;  1X54 A;  1PRT C;  3AEV A;  3SGI A;  1LT3 D;  2BH8 A;  3P75 A;  3PUV A;  1WTH A;  4G4K A;  2IWH A;  1EZ8 A;  3MXU A;  5D65 A;  3G6J B;  3I56 A;  2KCN A;  2EE1 A;  3K59 A;  4P75 A;  5JVH 3;  3SK5 A;  4R4O A;  1VMP A;  3NTH A;  3M9B A;  1YNN C;  1TWF B;  1B3A A;  1EYC A;  1PTO D;  1CKN A;  2JYO A;  5F2D A;  4RFB A;  1SE2 A;  4BXX H;  1EQR A;  4C3I G;  1KQS A;  1EY5 A;  4GOP B;  4DR3 Q;  1H95 A;  1HFG A;  4PQX A;  1Q86 C;  4C3I B;  5C0X H;  2F4V Q;  1J9O A;  1J6Q A;  2TSS A;  5LMN L;  1GUG A;  2VW9 A;  2RBM A;  1HR0 L;  5C4J H;  3NPP A;  5EKL A;  3PCO B;  2SEB D;  1X32 A;  2LY7 A;  1YJ9 A;  1J5E L;  3OW7 A;  3DM1 A;  4RHR A;  3T51 B;  1VF7 A;  2E5L Q;  4LFB Q;  2VL6 A;  3G4S A;  2Z4H A;  2E8G A;  5ELO A;  3E6Z X;  1SNQ A;  1XXG A;  2HIV A;  3H0G H;  2H4O A;  2YU9 H;  1GVP A;  5IYD G;  4DR7 Q;  4IFD J;  1QNU A;  5CBA E;  4OO1 G;  1XTD A;  3EJI A;  1G2T A;  2PZU A;  2EZV A;  4HAE A;  2H1E A;  2N49 A;  2IJ0 A;  1HNW Q;  1CT1 D;  3L0O A;  4HMI A;  5DAU A;  4X64 L;  1BNZ A;  3A56 A;  1ILP A;  1L2F A;  3EBE A;  3CXC A;  3HKZ E;  4LMQ D;  2NZH A;  2IT1 A;  4DPG A;  3DWA A;  3MEF A;  3D31 A;  4IFD G;  3RLO A;  2K52 A;  4OHJ A;  1L0W A;  3J80 L;  1II3 A;  2XWJ B;  4RA8 A;  1G29 1;  1XJV A;  2XNA C;  3K6O A;  5GAH C;  1R4Q B;  5C6A A;  4NMZ A;  1LUZ A;  3G71 A;  4A3J H;  3M4O B;  2JA5 G;  2I07 B;  4HR7 B;  3CC7 A;  1K8G A;  2X69 A;  3HOY G;  3KUP A;  2JA5 B;  4GKJ Q;  1D1K A;  1QUQ A;  1VQI A;  3GDE A;  1WD1 A;  3HS0 C;  1A62 A;  1HQM C;  2F0V A;  3HOY B;  2PW5 A;  1LAC A;  4ALP A;  1HHV A;  3CCJ A;  1SE3 A;  1UE5 A;  2EDG A;  1PA6 A;  3LWU A;  4GS3 A;  2MJ8 A;  1ONL A;  2B2T C;  2RDH A;  1GUO A;  2QIL A;  5C4Z A;  2L4N A;  2EYL A;  1BKB A;  2UXB Q;  3FPU B;  1VMC A;  3QO2 A;  2MO0 A;  2B63 H;  3PUX A;  2ASB A;  1TR5 A;  4A3I G;  4EQ5 A;  4JYA L;  5CGK A;  2JA7 G;  2VQF L;  1F9P A;  2IHF A;  3K0X A;  4DK6 C;  3O13 A;  4K6L A;  1BQQ T;  1UWV A;  1EYA A;  3BDO A;  2CQA A;  2K5D A;  4RG1 A;  2OTJ A;  2JA7 B;  5DNF A;  2IX3 A;  4G57 A;  1QVG A;  2B8G A;  1V1P B;  5C0X J;  4DUZ L;  1Q8K A;  3CW2 C;  1I4G A;  3TP7 A;  1DON A;  2DY8 A;  5JPM C;  3H3V H;  5LMN W;  2A1A A;  4BXX G;  2UXC L;  5IWA L;  1SRU A;  1HR0 W;  1O7Y A;  1LTS D;  1K83 B;  5M5X B;  2O2L D;  4LFC L;  5C0X G;  2F0F A;  1K9M C;  4A3D G;  2Q8R E;  4I7A A;  2PNR C;  1VS0 A;  2R7D A;  3C1F A;  1MJC A;  1ZXT A;  1KL9 A;  3LX0 A;  3X3N A;  5DLQ E;  4A3D B;  1LAB A;  1VQL A;  4A3L G;  3N6R A;  3NEN A;  3GTK B;  2EYH A;  3HOV G;  2AQ1 B;  4A76 A;  3FVQ A;  3HOV B;  3HKZ B;  1SE8 A;  3OTO Q;  1RDP D;  4FXK C;  4IZ8 A;  5GAD C;  4B3T Q;  3RZD H;  1HA5 A;  3Q23 A;  2QGQ A;  1BBW A;  1FJG Q;  5A35 A;  2CH4 A;  3NK9 A;  2OF1 A;  3H0G G;  5LMU L;  3PUZ A;  1SYE A;  2GA4 B;  1GM5 A;  4M1U B;  3K5M A;  1A3T A;  3FKI H;  3I72 A;  1GUW A;  4CJ1 B;  2WB1 G;  4GKK Q;  2L1B A;  3A5Z B;  2A68 C;  4LNQ A;  1X55 A;  2Z6B A;  3PUY A;  3K5O A;  2F0J A;  3KJP A;  3UI2 A;  3HZX A;  4CDD C;  2NUC A;  5FOB B;  5FLX L;  2K50 A;  1JB3 A;  1FD7 D;  1HZA A;  1N9W A;  3K58 A;  3OPO A;  4S3S A;  4DV7 L;  4IUQ A;  3S15 B;  1UE1 A;  1DD2 A;  2CW0 C;  5C5L A;  4A75 A;  4LF6 Q;  4DR3 L;  3OWE B;  2F0L A;  3SK8 A;  1SYB A;  1F2Z A;  2KCC A;  3HOZ H;  5IP9 G;  3J7A F;  2F4V L;  2K1B A;  3TRE A;  1K0S A;  2QDB A;  2MFI A;  2GVA A;  5EPL A;  1VQ9 A;  1WCM H;  4FF3 A;  1ROD A;  4K14 A;  2EQS A;  4YHH L;  2YTY A;  2R7Z H;  1PZK D;  4KTA A;  2HDM A;  4HSP A;  2WIN B;  2N78 A;  4DR2 L;  1LLR D;  1CQV A;  3G6E A;  3RD4 A;  3DUZ A;  4R9W A;  4YIJ A;  3V2T A;  4LFB L;  1PH5 A;  4RCN A;  4DV4 L;  4DV1 L;  1KDC A;  4R4T A;  3M4P A;  1OXX K;  2DNC A;  4KMU C;  1M1K C;  1ZEQ X;  2F0W A;  3GV6 A;  1X9N A;  1F9S A;  5FLX E;  5EPK A;  3W1B A;  2JXM B;  1A6X A;  2B63 G;  2NN6 G;  3OMG A;  2F0U A;  3CQZ H;  3HOU G;  1FNV A;  4IUU A;  3F2C A;  4HJA A;  3GO5 A;  3T56 B;  5CR3 A;  3HOU B;  4DNT B;  2X6G A;  1R9T H;  3NSW A;  4IN3 A;  3NWT A;  3T13 A;  4F88 A;  5LL6 X;  2QCP X;  3PO2 B;  2YYZ A;  2WP8 J;  3PIP 3;  2VY3 A;  4AQY Q;  4DXF A;  5E4X A;  1PTO C;  3C1E A;  2VUM H;  2C9O A;  1STE A;  2WKD A;  5EPJ A;  1EQQ A;  1RIP A;  4LF7 Q;  2Y0S E;  4DV3 L;  3D4R A;  1SLJ A;  2K5W A;  4ZK9 B;  3SE0 A;  3TSS A;  1WTR A;  1FL0 A;  3V05 A;  1IBK Q;  1I3Q H;  2UUB L;  3WDN A;  3GTJ H;  4DR6 Q;  1GHJ A;  1PYW D;  2EY6 A;  1V43 A;  5AFW A;  1PFB A;  3K7A H;  2LMC B;  3VR6 A;  3Q6S A;  4AYB G;  3D3R A;  3OMC A;  4I7Z C;  5NUC A;  1EQV A;  2I5L X;  4RGT A;  2UUC L;  1EIH A;  4L8J A;  3I4M H;  2A6H C;  1NE3 A;  4KY7 A;  4AYB B;  4F87 A;  3S16 H;  2F0G A;  4PNY A;  1JWS D;  1K28 A;  3N52 A;  3KK7 A;  2OCE A;  3ULP A;  4M8A A;  4KN7 C;  3W2D A;  3VA7 A;  2I5H A;  2G5D A;  4HJ9 A;  2OTL A;  1DOL A;  1IKL A;  1B53 A;  4JVZ A;  3VYU A;  1VQE A;  2E2H H;  1JE5 A;  1CZW A;  4YCU A;  3NBI A;  3C46 A;  1U4M A;  2GN5 A;  5HUR A;  2UXB L;  2HQL A;  1A2U A;  1G51 A;  1VQA A;  5C3X A;  5C4X G;  3IL8 A;  3S1R B;  2BA1 A;  2RVL A;  5C4X B;  1S5D D;  3ERS X;  3CME A;  3PO3 H;  3T1H L;  4EVO A;  1I94 Q;  5ELD A;  5CV8 A;  1HRJ A;  1AW7 A;  5FLM H;  4DK3 C;  3FRP B;  1KNE A;  3DEP A;  4DNI A;  4K8J A;  1K8M A;  5IIF A;  3PMF A;  1TWG B;  3HFZ B;  4FP5 D;  1LTI D;  1VQ6 A;  2L0C A;  1AH9 A;  1UAP A;  1HUN A;  2DUD A;  3WOE A;  2KA7 A;  3H3V I;  1ENF A;  2WII B;  4OX9 Q;  2E2D C;  4F7X A;  3J80 i;  3GTP B;  3S2D H;  3MZ5 A;  1JMC A;  1JIC A;  1JWU D;  1TWC H;  3KBG A;  3JAM c;  3A8I E;  1L1O C;  4A3K G;  4A3C G;  2KCT A;  1H9M A;  3I4N H;  1K3R A;  1H9J A;  1EIY B;  4A3K B;  4HMJ A;  3CAM A;  1B44 D;  4RKB A;  2R7Z G;  3P7J A;  1I50 H;  2K28 A;  2G9H D;  1NBW A;  2PZT A;  5E1F A;  1YI2 A;  1E1T A;  3AB9 A;  4EGV A;  2ICI A;  5M3F G;  1PVO A;  4JI8 L;  5I2X A;  2PO4 A;  3IAY A;  5IGC A;  5M5W H;  5LMN Q;  2EXD A;  2FMM A;  5M3F B;  1MKH A;  1T5E A;  1HR0 Q;  4R8I A;  1IYV A;  1EWC A;  1EFI D;  2JA6 G;  1J5E Q;  3BYT B;  3MAQ A;  4ZYS A;  2E74 C;  1PRT B;  3MHB A;  3UDI A;  4CJ2 C;  5CMD A;  1BUV T;  3M85 A;  1EY8 A;  2JA6 B;  1DOM A;  1HFN A;  4A3G H;  1NSN S;  3RR5 A;  1NAP A;  2X6L A;  1XYI A;  1CKO A;  3FMC A;  4WJ3 M;  1CZG A;  1VQD A;  3KBX A;  3OYY A;  1S72 A;  2JK8 A;  4IUP A;  1YIT A;  1JWM D;  2ZTC A;  3CC2 A;  3S1M B;  1SNP A;  1BR9 A;  1Q8I A;  2JN4 A;  2VUM G;  2EYP A;  3NEL A;  4K5W A;  1SJE D;  1A0I A;  3I8Z A;  3W5O A;  4X64 Q;  4YWK A;  4IOA A;  5C44 G;  1K73 C;  1LTR D;  1SYG A;  4MZ9 A;  2B8F A;  3BS1 A;  3U58 A;  4QUF A;  5C44 B;  1CFM A;  1M90 C;  3TN2 A;  4FXD A;  3I4M G;  1Z9F A;  1S5E D;  3D4W A;  3M7G A;  1EOT A;  1UEB A;  4O0A A;  1KC8 C;  1ZYR C;  4ZQ3 A;  4QQB X;  3I4M B;  4IUR A;  3R93 A;  4DR1 L;  1RCV D;  3SHL A;  2JJQ A;  3H3V C;  3VR2 A;  4FYD A;  1N36 Q;  3F8T A;  4N9T A;  2KVM A;  4OWT B;  4UHV A;  2E2H B;  3KDF B;  4X3U A;  4WJW A;  1PH3 A;  5FJ8 G;  3U50 C;  1AZQ A;  1V8Q A;  3RLF A;  3PO3 G;  2NVQ B;  4L6T B;  1WTQ A;  5HGQ A;  2BE5 D;  4PMW A;  1X3G A;  2A5H A;  1EYD A;  1SFO B;  5FLM G;  1D5X C;  1Y14 B;  4AQY L;  4FDB A;  1Y8N B;  4BWG B;  1SYC A;  4BY7 H;  1KIX A;  2HHH Q;  5EBD A;  2VQF Q;  2XWB B;  2R3Z A;  1VQN A;  1SMY D;  4TVA B;  5IT9 c;  5EGT A;  2EYO A;  1X3F A;  1S5F D;  4GOP A;  4ME3 A;  1GO3 E;  1TVX A;  1SNM A;  2F0O A;  2P5Z X;  3QWN A;  1B9N A;  3OOC A;  4E6I A;  1BVS A;  1YHA A;  3QB3 A;  2WFW A;  4DUZ Q;  1BCP F;  3R2I A;  3P20 A;  5HY6 A;  2K5Q A;  3GP7 A;  1TS2 A;  2NZ1 D;  1KAA A;  3TRZ A;  1CM9 A;  4A3E H;  4B3S L;  4DNR B;  2B2V A;  5A2Q L;  1KDB A;  2UXC Q;  1U5K A;  3LWE A;  1KHI A;  1A3U A;  5COR A;  4IUV A;  3CPF A;  2G9D A;  2R93 H;  4DXG A;  4ZAI A;  4LFC Q;  2J4X A;  2ALY B;  4DV5 L;  2EJF C;  5D3I B;  3MXG A;  2DJG C;  5ELN A;  3VYR A;  1SJH D;  1IBL L;  2Z1C A;  1PZI D;  1LYL A;  1U4L A;  4NW2 A;  3I91 A;  3K80 C;  1I94 L;  4U68 A;  1JOR A;  1Y1V H;  4XQJ A;  1VQK A;  2Z0S A;  4H02 A;  1PTO H;  1AP0 A;  2AWN A;  3PSI A;  1Z6H A;  1FR3 A;  4LUZ A;  4EQN A;  5C3W A;  2KJX A;  5LMU Q;  3S2H B;  3J7A 5;  2BDN A;  4DK0 A;  4OX9 L;  1I6H H;  1MD2 D;  1G91 A;  4BA2 I;  1WTP A;  1WTV A;  3AQQ A;  3PF4 A;  2D2C C;  3STB C;  1ZKO A;  4A93 H;  1B50 A;  2KEE A;  5A2Q E;  3L3O C;  2TMP A;  2L15 A;  4WOR A;  3D0F A;  3R2T A;  3DWQ A;  4K5V A;  3M3Y B;  1CSQ A;  3Q0A A;  1X3Q A;  1X6O A;  4L5T A;  3RMH A;  4DV7 Q;  5COY A;  3DMU A;  5IY0 A;  4FVM A;  2JEA I;  1CA6 A;  3GTM B;  4K5X A;  4RHS A;  1YHB A;  4C2M H;  5FO8 B;  3RN2 A;  1C0A A;  2JA9 A;  2K05 A;  3NP8 A;  3P1H A;  3TEH B;  3CKI B;  2OWO A;  4MNO A;  2L5T A;  1EU3 A;  3I4L A;  3U4V A;  2IX0 A;  4B3M Q;  2HD3 A;  4YHH Q;  3CHB D;  3ICE A;  2AKW B;  4CDC C;  1E2V A;  3GTO H;  1XPR A;  5M5Y H;  3K0Y A;  2A74 C;  4BS9 A;  4DR2 Q;  1LT4 D;  2CFM A;  1ASY A;  4DAY A;  1JJG A;  1E7Z A;  2PQE A;  4DV4 Q;  4DV1 Q;  2N88 A;  4JBJ A;  3GTG B;  3QOL A;  2AMC B;  3K81 C;  2KED A;  1C4Q A;  4L63 B;  1BXT A;  2KCM A;  1V1P A;  2FMC A;  5I6Y A;  3A0J A;  4B9W A;  4X62 L;  4X3S A;  1CUK A;  2K03 A;  1JQY D;  2MNA A;  4LWC A;  4RGN A;  3BDL A;  1FGB D;  1S4Z A;  4DV2 L;  2FXQ A;  4GNX C;  1RJT A;  1EY9 A;  1VQJ A;  3PV0 A;  4WRD A;  3CCR A;  3DHQ A;  3KLS A;  1RTO A;  1KDA A;  3S17 H;  3QJY A;  3A55 A;  1TY0 A;  2J7Z A;  4TKO B;  1VQ4 A;  5C3E H;  4DV3 Q;  2OT2 A;  1PLF A;  4ZUJ A;  5CV9 A;  2CQO A;  2KUM A;  2IX1 A;  5M3M H;  2UUB Q;  2F0S A;  3GTQ H;  1ENA A;  1N36 L;  2WB1 E;  4YWL A;  3I3C A;  4GN5 A;  1WTO A;  1MJE A;  4HIK A;  3D6W A;  2UUC Q;  3QR8 A;  3PUW A;  2IL8 A;  1C9O A;  4DAV A;  2A6E C;  3UE1 A;  1RHP A;  2F0K A;  4QIW B;  2JA8 H;  2KHS A;  2A19 A;  2ENB A;  4G7O C;  2NB0 A;  4CHT B;  4A3M H;  4JI2 L;  1Y1V G;  4O2D A;  2HCI A;  4PG3 A;  3DEO A;  2MP1 A;  3RUZ A;  1L1O A;  1KRS A;  2Z6K C;  1PXU A;  1F2Y A;  4DAY B;  2HHH L;  1PTO B;  1YNJ C;  3CCE A;  5IYC H;  1IW7 C;  3J80 E;  2KEN A;  4A3I B;  1VF5 C;  1JJC B;  3KLR A;  2M00 A;  3T1H Q;  4BBS H;  2ID0 A;  3S1N B;  1DZ1 A;  2ZJP A;  4O42 A;  1CKM A;  1EL0 A;  1FVI A;  3OWF A;  3I73 A;  1JE4 A;  3H09 A;  3J7Y W;  1ENC A;  1CQF A;  1LTA D;  3S1Q H;  2L11 A;  4HJ5 A;  4A3B H;  3A7A B;  4V0B A;  2NVX H;  4TRD A;  2JSO A;  4JI6 Q;  2K5V A;  3M4Q A;  2R92 H;  5DM6 3;  4OWX B;  4JBK A;  3J81 c;  4EQO A;  1E2W A;  1LT5 D;  2KHI A;  3SR1 A;  5GQO A;  1JOQ A;  5E4W C;  4R4Q A;  3VA5 A;  4G7H C;  2IY5 B;  5C4J B;  3MA2 B;  5IGG A;  5JJL A;  1XMQ Q;  5JOB A;  5JEA H;  2J0T D;  5IGD A;  4JI8 Q;  1VQF A;  3A8J E;  2B2W A;  3GD7 A;  1VQC A;  3SK4 A;  1NCV A;  4I65 A;  4A3F H;  5BR8 L;  4BY1 H;  1S40 A;  3J81 L;  3DXJ C;  5J1Z A;  1STN A;  4DR5 L;  3CCQ A;  3H0G B;  1PH8 A;  1NR2 A;  2YU9 B;  1TWH H;  1Q1E A;  4OEL B;  1U4R A;  1D6E C;  2B2Y C;  3VR3 A;  4AYB E;  1HNX L;  4OGQ C;  3UE0 A;  2FHT A;  1JB7 A;  2WB1 B;  5KEE A;  2D0O A;  4JI5 L;  1SXT A;  1Y69 U;  4QUC A;  1L1O B;  4JCV E;  3RZO H;  4NKL A;  4KD4 A;  1O7I A;  5AJ3 L;  1L0X B;  2ES2 A;  3C2P A;  5IGB A;  2OXP A;  2SDF A;  2BDO A;  4JBW A;  2FIN B;  4XIG S;  1QVF A;  2NZO A;  1HCZ A;  3MEH A;  2F52 A;  1LM0 A;  1SMX A;  1OXU A;  5BN4 A;  1VQO A;  2QW7 A;  3S17 B;  2VNU D;  5C3E G;  3MC0 B;  5T1I A;  1D5Z C;  1OO9 B;  2AWO A;  4DN4 M;  2Q8T A;  3L9A X;  3KLS X;  4A3J G;  5M3M G;  3HOX H;  1SE4 A;  5IYB H;  1NUC A;  2WAC A;  1VCI A;  2XN9 C;  2F0H A;  2I46 A;  3NTI A;  4A3J B;  4B3M L;  4XT3 B;  3U9O A;  4RMF A;  1GHK A;  4YWM A;  4MTK A;  1Q82 C;  2ZT9 C;  3NXW A;  3PF5 A;  2A69 D;  4XT1 B;  1A8V A;  1PDQ A;  1IL8 A;  1KAB A;  4DR1 Q;  2NVT H;  4LUV A;  1DJR D;  1I4X A;  3S14 H;  2LXK A;  4PZ8 A;  3BZD B;  1B7Y B;  5I6W A;  1ESR A;  2F0D A;  1TWA H;  4L5Q A;  2BH2 A;  3MXN A;  1E22 A;  3MFG A;  5JPN C;  4RGO S;  3TQY A;  2BA0 A;  3TS0 A;  1P16 A;  3K8A A;  4XTC S;  4JI7 Q;  2B63 B;  4WFN 3;  1VQG A;  1I6V C;  4KHP L;  3S9W A;  4BBS G;  2EYM A;  1QWY A;  4BBS B;  1WD0 A;  2E2I H;  1SN8 A;  2E75 C;  3CCS A;  1QIL A;  2WKC A;  5J39 A;  2PYK A;  2E76 C;  5ELB A;  3M4Y A;  2XRS D;  2ZXO A;  3J7Z C;  3KJO A;  4OL7 A;  1Y8P B;  5K36 H;  4ZRZ A;  2NBF A;  1J8I A;  1X3E A;  3S24 A;  2I0Q A;  3DM3 A;  1R4P B;  1EEI D;  4F8M A;  4CJ0 B;  1SRO A;  3AU7 A;  1U0L A;  4KI0 A;  1MSH A;  3QOJ A;  2Z8L A;  1O7L A;  3J81 j;  4Y52 H;  4R8N A;  2EIF A;  1STG A;  4JK1 C;  2XIW A;  1PRT D;  4B3S Q;  1K3B C;  4JV5 L;  1YJW A;  3KF6 B;  3LNN A;  5E3F A;  4ILW A;  3GTL H;  1Y1W H;  1Q1B A;  1AEX A;  2QF7 A;  1Q90 A;  5I9P A;  5H1S E;  2NVY H;  1PYS B;  4NPS A;  4IPG A;  3VDY A;  3TZU A;  4DV5 Q;  4JI1 Q;  3U4Z A;  1YNN D;  4A3F G;  4R4I A;  3RZD B;  4C3H H;  1IBL Q;  4X66 Q;  3FKI G;  3NE5 B;  2JP1 A;  1RKN A;  1KRT A;  3FKI B;  2CKZ B;  4ME5 A;  3MXN B;  1SDF A;  4AH6 A;  1HJP A;  4K2K A;  4ULL A;  2B2U C;  4XQQ A;  3L2P A;  3I4O A;  2NTS A;  4OXP A;  5JAV A;  3RN5 A;  3ZJY C;  2F0P A;  3L7Z C;  3RNU A;  5CV6 A;  1STB A;  1QVC A;  4JI6 L;  1N8R C;  1M4V A;  4N9P A;  4GLA C;  3HOZ G;  1BCP D;  5I9O A;  3HOW H;  5C5M A;  1SND A;  5G3L F;  1QE6 A;  1P8L A;  4RWS C;  1JCK B;  2Z4I A;  1X3P A;  2C35 B;  3DWP A;  1LTT D;  2HDL A;  2XSC A;  4U67 3;  3HOZ B;  1IYU A;  3HOX G;  5IYB G;  1WCM G;  2PMZ E;  4DAP A;  4MTN A;  2F1M A;  4CKC A;  1KD1 C;  4DA2 A;  1WCM B;  3KDF A;  2LS0 1;  4HJ7 A;  2MO1 A;  1T5X D;  1XMQ L;  2EVB A;  2H5X A;  3VR4 A;  2R7Z B;  5KND A;  1A63 A;  3CP0 A;  3ZYY X;  2F03 A;  3CC4 A;  2YTV A;  3JAM L;  1Q12 A;  2V4D A;  2HIX A;  5J3B A;  4GNX A;  2IPK D;  4PMB A;  1NMG A;  4MIU A;  1B2T A;  4R1J A;  2Q2I A;  2E2J H;  1W2B A;  4GZY C;  4BBR H;  1E24 A;  1K8A C;  4Y7N H;  3CQZ B;  2RF4 A;  1GJX A;  2DGY A;  2WAQ G;  2F0I A;  1BDO A;  2K04 A;  1GUT A;  5GAE C;  2N8N A;  1YHQ A;  4IOC A;  1TY2 A;  2WAQ B;  1R9T B;  2MPM A;  5IGE A;  2QEJ C;  4X62 Q;  1EYG A;  3H15 A;  3UDG A;  5K36 G;  1XWE A;  2VUM B;  1EU4 A;  2PW7 A;  4QB4 A;  4DV2 Q;  4C3J H;  2MHV A;  1QG7 A;  1S5C D;  2RHQ B;  3H6M A;  2B2T A;  4JI0 L;  1I3Q B;  4QF4 A;  3GTJ B;  2PQA B;  3F2B A;  3QIA A;  1SR3 A;  3K7A B;  3CD6 A;  2ATW A;  1KAW A;  2K6A A;  1XTC D;  5EKK A;  4TSS A;  1LTB D;  2Z6K A;  4DV6 L;  1G8Z D;  1Z47 A;  3BYY B;  3S16 B;  4YY3 L;  3KF8 B;  1PRT F;  1TWF H;  1EIF A;  3EIV A;  2Q2H A;  4YCV A;  3TP8 A;  3PIO A;  1Y1W G;  3CRK C;  3TME A;  5JJK A;  1K0R A;  4OON A;  3J81 i;  4IPD A;  2PI2 E;  3NBH B;  4Z9C B;  4C3I H;  1HPC A;  5E7N A;  3MFY A;  2EXZ A;  4JI7 L;  3TBI B;  4K0K L;  1QZG A;  5JJZ A;  1PMR A;  3PO3 B;  4JI2 Q;  3R3O A;  4GNX B;  4KJO A;  2PMZ B;  4UPA A;  3FDT A;  3WOF A;  4J8Q A;  2F3W A;  2HQE A;  1JT8 A;  2PI2 A;  4KJN A;  4QY7 A;  5IOC A;  2N3S A;  5CV5 A;  3BU2 A;  1SSO A;  3I90 A;  2CWA A;  3S2D B;  1QOH A;  1RTN A;  3HOW G;  4YCW A;  4C1N I;  1TWC B;  3I4N G;  3KFU A;  4B9X A;  1N34 L;  1FNU A;  4LW1 A;  1Q7Y C;  2ZM6 L;  3I4N B;  4PMC A;  4DUY L;  4HTH A;  1CI3 M;  4C56 C;  4DFA A;  2A68 D;  3H91 A;  3SVM A;  2SNS A;  3TS2 A;  3TP5 A;  4HJ8 A;  1Q3L A;  2ZTD A;  3VYT A;  1I50 B;  2B2Y A;  3BZK A;  4LUO A;  2K32 A;  2R61 A;  1YEZ A;  3CCU A;  5IT9 L;  5KIX A;  4QCL A;  2EJG C;  3ER0 A;  5KNC A;  1WI5 A;  4JI1 L;  3URY A;  3I2Z A;  3PGZ A;  3F2D A;  4X66 L;  3M4O H;  1GD7 A;  1I4R A;  5M5W B;  1VQP A;  2DN8 A;  3E0J A;  4L5R C;  1EQT A;  2CW0 D;  2HUG A;  1YZ6 A;  2F0Q A;  1SAP A;  1LTL A;  2JA5 H;  1F2L A;  2RCF A;  4LJZ C;  1OXT A;  3T1Y L;  4JPB W;  3HOY H;  4A3G G;  1UUP A;  1BO0 A;  2N55 A;  4JG2 A;  4P2C B;  3SK6 A;  4A3G B;  5BR8 Q;  2B39 A;  4KV6 A;  1UE6 A;  4LF9 L;  4DR5 Q;  1HNZ L;  1TS4 A;  3B6Y A;  1HNX Q;  1BBX C;  4QIW E;  3A74 A;  3BDC A;  4Q0F A;  4JI5 Q;  1HH2 P;  1EUJ A;  1X65 A;  4ID6 A;  4HED A;  5DEH A;  4C3J G;  1E1O A;  5CV4 A;  5FKA C;  5AJ3 Q;  5BN5 A;  2JA7 H;  4KHZ A;  3GV3 A;  3FPP A;  2IW3 A;  3W3A A;  1D1I A;  2F0M A;  1W6K A;  2AUJ D;  1YIJ A;  3TZD A;  3I55 A;  1FGU A;  5JJI A;  1D7Q A;  3T4A C;  3W1G A;  1ICF B;  1JR0 D;  4MN3 A;  2O5J C; 
#chains in the Genus database with same CATH homology
 4RAU C;  1OXS C;  5I2Y A;  1LTG D;  4O1N A;  1XX8 A;  1F77 A;  1EEF D;  2EYJ A;  2VB3 X;  2M2L A;  1E2Z A;  2DY7 A;  1SYF A;  5K5P A;  3G7L A;  2D62 A;  4ZKC B;  1M8A A;  3K5L A;  2PPB C;  3E5S A;  2OEO A;  4DK1 A;  2A6H D;  3Q24 A;  1MBY A;  1SYD A;  3MTS A;  1TU2 B;  1HTP A;  4G7Z C;  1EY7 A;  5FO7 B;  1F9Q A;  2L55 A;  4BY7 B;  4J1M A;  1BCP C;  2KEC A;  2BOS A;  3ND8 A;  1MI2 A;  4ABN A;  2KOL A;  3ND9 A;  4CGY B;  1DCZ A;  1A15 A;  3OIP A;  1KTK A;  2AQ2 B;  2K7V A;  2EOT A;  1I4H A;  2L9H A;  4ZKB B;  1JOO A;  4LAA A;  5FO9 B;  4OIJ A;  4A3E B;  4KD3 A;  1KLU D;  3NWS A;  3EQL C;  5KGU A;  1V1O A;  2RA4 A;  2R93 B;  1B1Z A;  2B2U A;  1RD9 D;  2EJM A;  5D3D A;  4K2L A;  3J7A V;  1A3V A;  2RSN A;  2K33 A;  2HCC A;  1RF2 D;  4TQU S;  1Y1V B;  3A8K E;  1LV9 A;  4EQP A;  1Y8O B;  1PFM A;  1I4Q A;  1I6H B;  3K5N A;  4XDX A;  4OO1 I;  4MHE A;  5BN3 A;  4A93 B;  5LL6 S;  5I4D A;  1U4P A;  2NN6 H;  1F2M A;  2L12 A;  1QCB D;  3HP3 A;  1SBB B;  1I4P A;  3NUC A;  4CKB A;  4IFD I;  2M9V A;  1NR4 A;  2WV6 D;  1PZJ D;  2K01 A;  3D6C A;  2KQ3 A;  4ODG A;  3MVV A;  1QJO A;  2O4X A;  4C2M B;  4H0L C;  1F9R A;  1DOK A;  2FFK B;  1IHZ A;  1PTO F;  3H94 A;  2BE5 C;  3IFT A;  3GTO B;  5M5Y B;  5KYL A;  2EPB A;  4HSV A;  4IUN A;  3D4D A;  1S5B D;  2SOB A;  2MUY A;  4FF4 A;  3X3M A;  4K8I A;  1HA6 A;  1SMY C;  3C3L A;  1ZYR D;  1O78 A;  2EY2 A;  3VR5 A;  4DGZ A;  2B2V C;  3NQI A;  4XXE A;  3PIO 3;  1CHP D;  1KNA A;  5G3L D;  3VYS A;  5IGF A;  4XYO A;  4DU9 A;  1UNS A;  4V19 0;  5LHY 1;  3F2U A;  1EY0 A;  1B9M A;  5C3E B;  1FNW A;  1W6J A;  5M3M B;  3OHX C;  3ERQ A;  3GTQ B;  3J81 E;  1MSG A;  5C0X I;  3HRZ C;  4DF7 A;  4B08 A;  2VXW A;  3MWY W;  1PFN A;  3QG1 A;  1IKM A;  2JA8 B;  1TII D;  2D5D A;  1HXY D;  3HGB A;  2F3V A;  3U9S A;  1WVL A;  3CRL C;  3EVQ A;  3BG3 A;  5T1G A;  4A3M B;  3OSO A;  4KY5 A;  2XVS A;  1BOS A;  4ZUI A;  3T16 A;  4X3K A;  4UDU C;  3MXP A;  1AZP A;  3IFD A;  2C5C A;  1STA A;  1ET6 A;  2ZXP A;  1TS5 A;  2F0T A;  2O5I C;  4KKU A;  3S1Q B;  4A3B B;  2NWG A;  1STH A;  5JEA J;  5EQ0 A;  2NVX B;  1TS3 A;  3HG9 A;  1FYC A;  2R92 B;  2RDF A;  4NP5 A;  1A2T A;  5KYI A;  1EIG A;  1CHQ D;  3CU7 A;  4UAI A;  1CA5 A;  4H13 C;  5D14 A;  5KRU A;  2EY5 A;  5JEA G;  3TDQ A;  1WTW A;  4RKL A;  3EA6 A;  4BA1 I;  1CTM A;  3EFX D;  3NHH A;  3OIQ A;  5CV7 A;  1Z7T A;  5ELE A;  5TSS A;  4A3F B;  4BY1 B;  1GUN A;  1HUM A;  3Q22 A;  3M7N A;  1TWH B;  1D2B A;  2NN6 I;  1GOZ A;  2NTT A;  5DM7 3;  5IOD A;  3RZO B;  2ICE C;  1TKW B;  5EKI A;  3A7L A;  2AQ3 B;  3KF8 A;  1U9R A;  1EZ6 A;  3HOX B;  1H9R A;  3BVM A;  3NBH A;  1G2S A;  4KN4 C;  2EYF A;  2CVR A;  2EY1 A;  4FNF A;  2F4I A;  5CC4 A;  5ELC A;  4NDX A;  2NVT B;  3S14 B;  4FF1 A;  4KY6 A;  4IQZ A;  1ET9 A;  4IUT A;  2D9U A;  1WTX A;  1DM0 B;  1TWA B;  2JEB I;  1MGS A;  4RCO A;  3V96 A;  1H9S A;  4KKS A;  1B4O A;  1GUS A;  1KLG D;  2F0N A;  5ELF A;  2RDG A;  2MGS A;  2Y0S B;  2A6E D;  1JC7 A;  2E2I B;  1QNK A;  4KK7 A;  4HN7 A;  5JVG 3;  4RH6 A;  3AMU A;  2A73 B;  2AUK A;  3I70 A;  1K8O A;  4C1N K;  3JAM E;  2PCF B;  1YNJ D;  5M9O A;  3ITP A;  1IW7 D;  2B2W C;  4K6D A;  2XRQ D;  3SEB A;  2DNE A;  1STY A;  3GTL B;  5EBC A;  5KNB A;  2BCO A;  3NQT A;  4XYQ A;  1DXM A;  1Y1W B;  2NVY B;  1HTL D;  3HEJ A;  3ERO A;  4C3H G;  1QB5 D;  4KHV A;  4C3H B;  4Q5V A;  3K57 A;  5FK9 C;  2RKS A;  1BCP B;  1E0B A;  1C8C A;  2RSO A;  2CHB D;  1SNO A;  1OXV A;  1LO5 D;  2FJ2 A;  2VB2 X;  4IAL A;  2PZW A;  4QMG A;  1O80 A;  2JE6 I;  5C4H A;  2SNM A;  4J6H A;  5EJW A;  1H9S B;  4CBV A;  3NTK A;  1D5M C;  4ZLT F;  2Q8I B;  3SDZ A;  1SEB D;  2LFN A;  2QKI C;  1SNC A;  3A54 A;  1AFP A;  5CBE E;  4KKT A;  4OO1 H;  3HOW B;  1ML0 D;  2NYZ D;  1HQR D;  1L0Y B;  4FF2 A;  5ISR A;  4PV1 C;  1GXD C;  2A69 C;  1ESF A;  2F0E A;  1UEA B;  4RGM A;  3R8B A;  1DYQ A;  1CK1 A;  4IFD H;  1ILQ A;  1H9K A;  3ONA B;  1BF4 A;  2ZXR A;  2R6G A;  1JOK A;  3TP6 A;  1G6Z A;  3BVZ A;  3SXH A;  1EWH A;  2LKV A;  2E2J B;  4BBR B;  4HCS A;  1LT6 D;  4Y7N B;  1O7Z A;  1ICW A;  4X3T A;  3T53 B;  3D8G A;  1EY6 A;  1AN8 A;  3GQB A;  4H7B A;  5CYU A;  2RQX A;  1C48 A;  1TQO A;  3FEW X;  5J22 A;  1TT2 A;  4HCE A;  4LK1 C;  4OIK A;  4H44 C;  3BVG A;  1EY4 A;  5IT9 E;  4XQN A;  1VDZ A;  5HGT A;  4FO2 A;  4FXG C;  4C3J B;  4CKE A;  3IKJ A;  1PRT C;  1LT3 D;  3P75 A;  3PUV A;  4G4K A;  2IWH A;  1EZ8 A;  3MXU A;  5D65 A;  3G6J B;  2KCN A;  2EE1 A;  3K59 A;  5JVH 3;  3SK5 A;  1VMP A;  3NTH A;  1YNN C;  1TWF B;  1B3A A;  1EYC A;  1PTO D;  2JYO A;  5F2D A;  4RFB A;  1SE2 A;  4C3I G;  1EY5 A;  1HFG A;  4PQX A;  4C3I B;  5C0X H;  1J9O A;  2TSS A;  1GUG A;  2RBM A;  3NPP A;  5EKL A;  2SEB D;  1X32 A;  2LY7 A;  3OW7 A;  3DM1 A;  4RHR A;  3T51 B;  1VF7 A;  2Z4H A;  3E6Z X;  1SNQ A;  1XXG A;  2H4O A;  4IFD J;  1QNU A;  5CBA E;  4OO1 G;  3EJI A;  1G2T A;  2PZU A;  2EZV A;  4HAE A;  2H1E A;  2IJ0 A;  1CT1 D;  4HMI A;  5DAU A;  1BNZ A;  3A56 A;  1ILP A;  4LMQ D;  2IT1 A;  3DWA A;  3D31 A;  4IFD G;  4OHJ A;  3J80 L;  1II3 A;  2XWJ B;  4RA8 A;  1G29 1;  2XNA C;  3K6O A;  1R4Q B;  5C6A A;  4NMZ A;  3M4O B;  2I07 B;  4HR7 B;  2X69 A;  3KUP A;  2JA5 B;  1D1K A;  1WD1 A;  3HS0 C;  1HQM C;  2F0V A;  3HOY B;  2PW5 A;  1LAC A;  1HHV A;  1SE3 A;  2EDG A;  3LWU A;  2MJ8 A;  1ONL A;  2B2T C;  2RDH A;  1GUO A;  2QIL A;  5C4Z A;  2L4N A;  2EYL A;  3FPU B;  1VMC A;  3QO2 A;  3PUX A;  1TR5 A;  5CGK A;  1F9P A;  3O13 A;  4K6L A;  1BQQ T;  1EYA A;  3BDO A;  2CQA A;  2K5D A;  2JA7 B;  5DNF A;  2IX3 A;  4G57 A;  2B8G A;  1V1P B;  5C0X J;  1I4G A;  3TP7 A;  1DON A;  2DY8 A;  5JPM C;  1O7Y A;  1LTS D;  1K83 B;  5M5X B;  2O2L D;  5C0X G;  2F0F A;  2Q8R E;  2PNR C;  3C1F A;  1ZXT A;  3LX0 A;  3X3N A;  4A3D B;  1LAB A;  3N6R A;  3GTK B;  2EYH A;  2AQ1 B;  3FVQ A;  3HOV B;  3HKZ B;  1RDP D;  4FXK C;  4IZ8 A;  1HA5 A;  3Q23 A;  5A35 A;  3NK9 A;  2OF1 A;  3PUZ A;  1SYE A;  2GA4 B;  4M1U B;  3K5M A;  1A3T A;  3I72 A;  1GUW A;  4CJ1 B;  2L1B A;  2A68 C;  3PUY A;  3K5O A;  2F0J A;  3UI2 A;  3HZX A;  2NUC A;  5FOB B;  5FLX L;  1JB3 A;  1FD7 D;  3K58 A;  3OPO A;  4S3S A;  4IUQ A;  3S15 B;  1DD2 A;  2CW0 C;  5C5L A;  3OWE B;  2F0L A;  3SK8 A;  1SYB A;  1F2Z A;  2KCC A;  3J7A F;  2K1B A;  2QDB A;  5EPL A;  4FF3 A;  1ROD A;  4K14 A;  1PZK D;  4KTA A;  2HDM A;  4HSP A;  2WIN B;  1LLR D;  1CQV A;  3RD4 A;  3DUZ A;  4R9W A;  4YIJ A;  3V2T A;  4RCN A;  1KDC A;  1OXX K;  2DNC A;  4KMU C;  1ZEQ X;  2F0W A;  3GV6 A;  1F9S A;  5FLX E;  5EPK A;  2JXM B;  1A6X A;  2NN6 G;  3OMG A;  2F0U A;  1FNV A;  4IUU A;  3GO5 A;  3T56 B;  5CR3 A;  3HOU B;  4DNT B;  2X6G A;  3NSW A;  4IN3 A;  3NWT A;  3T13 A;  4F88 A;  5LL6 X;  2QCP X;  3PO2 B;  2YYZ A;  2WP8 J;  3PIP 3;  4DXF A;  5E4X A;  1PTO C;  3C1E A;  2C9O A;  1STE A;  2WKD A;  5EPJ A;  3D4R A;  4ZK9 B;  2K5W A;  3SE0 A;  3TSS A;  1WTR A;  3V05 A;  3WDN A;  1PYW D;  1GHJ A;  2EY6 A;  1V43 A;  5AFW A;  1PFB A;  2LMC B;  3VR6 A;  3Q6S A;  3D3R A;  3OMC A;  4I7Z C;  5NUC A;  1EQV A;  4RGT A;  1EIH A;  4L8J A;  2A6H C;  4AYB B;  4KY7 A;  4F87 A;  2F0G A;  4PNY A;  1JWS D;  3N52 A;  3KK7 A;  4M8A A;  4KN7 C;  3W2D A;  3VA7 A;  1DOL A;  1IKL A;  1B53 A;  3VYU A;  1CZW A;  3NBI A;  3C46 A;  1U4M A;  5HUR A;  1A2U A;  5C3X A;  3IL8 A;  3S1R B;  2BA1 A;  2RVL A;  5C4X B;  1S5D D;  4EVO A;  5ELD A;  5CV8 A;  1HRJ A;  1AW7 A;  3FRP B;  1KNE A;  3DEP A;  4K8J A;  1K8M A;  5IIF A;  3PMF A;  1TWG B;  4FP5 D;  1LTI D;  2L0C A;  1UAP A;  1HUN A;  3WOE A;  2KA7 A;  1ENF A;  2WII B;  2E2D C;  4F7X A;  3GTP B;  3MZ5 A;  1JIC A;  1JWU D;  3KBG A;  3A8I E;  1H9M A;  1H9J A;  4A3K B;  4HMJ A;  1B44 D;  4RKB A;  3P7J A;  2K28 A;  2G9H D;  2PZT A;  5E1F A;  3AB9 A;  4EGV A;  2ICI A;  5I2X A;  2PO4 A;  3IAY A;  5IGC A;  5M3F B;  2FMM A;  1T5E A;  4R8I A;  1IYV A;  1EWC A;  1EFI D;  3BYT B;  3MAQ A;  4ZYS A;  2E74 C;  1PRT B;  3MHB A;  4CJ2 C;  5CMD A;  3M85 A;  1BUV T;  2JA6 B;  1EY8 A;  1HFN A;  1DOM A;  1NSN S;  1NAP A;  2X6L A;  1XYI A;  3FMC A;  1CZG A;  3KBX A;  4IUP A;  1JWM D;  3S1M B;  1SNP A;  1BR9 A;  1Q8I A;  2EYP A;  4K5W A;  1SJE D;  3I8Z A;  1LTR D;  1SYG A;  2B8F A;  3BS1 A;  4QUF A;  5C44 B;  1CFM A;  3TN2 A;  4FXD A;  1S5E D;  3D4W A;  3M7G A;  1EOT A;  1ZYR C;  4ZQ3 A;  3I4M B;  4IUR A;  3R93 A;  1RCV D;  3SHL A;  3H3V C;  4FYD A;  3VR2 A;  4N9T A;  2KVM A;  2E2H B;  4X3U A;  4WJW A;  1AZQ A;  1V8Q A;  3RLF A;  2NVQ B;  4L6T B;  1WTQ A;  2BE5 D;  4PMW A;  2A5H A;  1EYD A;  1SFO B;  1D5X C;  1Y8N B;  4BWG B;  1SYC A;  5EBD A;  2XWB B;  2R3Z A;  1SMY D;  5EGT A;  2EYO A;  1S5F D;  1TVX A;  1SNM A;  2F0O A;  3QWN A;  1B9N A;  3OOC A;  4E6I A;  3QB3 A;  1BCP F;  3R2I A;  3P20 A;  2K5Q A;  3GP7 A;  1TS2 A;  2NZ1 D;  1KAA A;  1CM9 A;  4DNR B;  2B2V A;  5A2Q L;  1KDB A;  3LWE A;  1A3U A;  5COR A;  4IUV A;  2G9D A;  4DXG A;  4ZAI A;  2J4X A;  2EJF C;  5D3I B;  3MXG A;  3VYR A;  1SJH D;  2Z1C A;  1PZI D;  1U4L A;  4NW2 A;  3I91 A;  4U68 A;  1JOR A;  4XQJ A;  1PTO H;  1AP0 A;  2AWN A;  1Z6H A;  1FR3 A;  4EQN A;  5C3W A;  2KJX A;  3S2H B;  2BDN A;  4DK0 A;  1MD2 D;  1G91 A;  4BA2 I;  1WTP A;  1WTV A;  2D2C C;  1ZKO A;  1B50 A;  2KEE A;  5A2Q E;  3L3O C;  2TMP A;  4WOR A;  3R2T A;  3DWQ A;  4K5V A;  3M3Y B;  3Q0A A;  1X3Q A;  3RMH A;  5COY A;  3DMU A;  4FVM A;  2JEA I;  1CA6 A;  3GTM B;  4K5X A;  4RHS A;  5FO8 B;  2K05 A;  3NP8 A;  3P1H A;  3CKI B;  2L5T A;  1EU3 A;  3I4L A;  2IX0 A;  3CHB D;  1E2V A;  3K0Y A;  2A74 C;  4BS9 A;  1LT4 D;  4DAY A;  2PQE A;  2N88 A;  3GTG B;  3QOL A;  2KED A;  1C4Q A;  4L63 B;  1BXT A;  1V1P A;  2FMC A;  5I6Y A;  4B9W A;  4X3S A;  2K03 A;  1JQY D;  4RGN A;  3BDL A;  1FGB D;  1S4Z A;  1RJT A;  1EY9 A;  3PV0 A;  4WRD A;  3DHQ A;  3KLS A;  1RTO A;  1KDA A;  3QJY A;  3A55 A;  1TY0 A;  2J7Z A;  4TKO B;  2OT2 A;  1PLF A;  4ZUJ A;  5CV9 A;  2KUM A;  2IX1 A;  2F0S A;  1ENA A;  3I3C A;  1WTO A;  3D6W A;  3PUW A;  2IL8 A;  4DAV A;  2A6E C;  1RHP A;  4QIW B;  2F0K A;  2KHS A;  2ENB A;  4G7O C;  2NB0 A;  4CHT B;  2HCI A;  3DEO A;  2MP1 A;  3RUZ A;  1PXU A;  1F2Y A;  1PTO B;  1YNJ C;  1IW7 C;  3J80 E;  4A3I B;  1VF5 C;  3KLR A;  2M00 A;  3S1N B;  2ID0 A;  1DZ1 A;  4O42 A;  1EL0 A;  3OWF A;  3I73 A;  1JE4 A;  3H09 A;  3J7Y W;  1ENC A;  1CQF A;  1LTA D;  2L11 A;  3A7A B;  4V0B A;  4TRD A;  2JSO A;  5DM6 3;  4EQO A;  1E2W A;  1LT5 D;  3SR1 A;  1JOQ A;  5E4W C;  3VA5 A;  4G7H C;  5C4J B;  3MA2 B;  5IGG A;  5JOB A;  5JEA H;  2J0T D;  5IGD A;  3A8J E;  2B2W A;  3GD7 A;  3SK4 A;  1NCV A;  4I65 A;  3J81 L;  3DXJ C;  5J1Z A;  1STN A;  3H0G B;  1NR2 A;  2YU9 B;  1Q1E A;  1U4R A;  1D6E C;  2B2Y C;  3VR3 A;  4OGQ C;  2FHT A;  2WB1 B;  5KEE A;  1SXT A;  1Y69 U;  4QUC A;  4NKL A;  4KD4 A;  1L0X B;  3C2P A;  5IGB A;  2OXP A;  2SDF A;  2BDO A;  4JBW A;  2FIN B;  4XIG S;  1HCZ A;  3MEH A;  1OXU A;  5BN4 A;  3S17 B;  2VNU D;  3MC0 B;  5T1I A;  1D5Z C;  1OO9 B;  2AWO A;  4DN4 M;  2Q8T A;  3L9A X;  3KLS X;  1SE4 A;  1NUC A;  2WAC A;  1VCI A;  2XN9 C;  2F0H A;  2I46 A;  3NTI A;  4A3J B;  4XT3 B;  3U9O A;  1GHK A;  2ZT9 C;  3NXW A;  2A69 D;  4XT1 B;  1PDQ A;  1IL8 A;  1KAB A;  1DJR D;  1I4X A;  3BZD B;  5I6W A;  1ESR A;  2F0D A;  3MXN A;  3MFG A;  5JPN C;  4RGO S;  2BA0 A;  2B63 B;  4XTC S;  4WFN 3;  1I6V C;  3S9W A;  2EYM A;  1QWY A;  4BBS B;  1WD0 A;  2E75 C;  1QIL A;  2WKC A;  5J39 A;  2PYK A;  2E76 C;  5ELB A;  3M4Y A;  2XRS D;  2ZXO A;  4OL7 A;  1Y8P B;  5K36 H;  4ZRZ A;  2NBF A;  1J8I A;  1R4P B;  1EEI D;  4F8M A;  4CJ0 B;  3AU7 A;  4KI0 A;  1MSH A;  3QOJ A;  2Z8L A;  1O7L A;  4R8N A;  1STG A;  4JK1 C;  2XIW A;  1PRT D;  3LNN A;  5E3F A;  4ILW A;  1Q1B A;  1AEX A;  2QF7 A;  1Q90 A;  5I9P A;  3TZU A;  1YNN D;  3RZD B;  3NE5 B;  2JP1 A;  1RKN A;  3FKI B;  4ME5 A;  1SDF A;  4K2K A;  4ULL A;  2B2U C;  4XQQ A;  2NTS A;  5JAV A;  2F0P A;  3L7Z C;  5CV6 A;  1STB A;  1M4V A;  4N9P A;  1BCP D;  5I9O A;  5C5M A;  1SND A;  5G3L F;  1QE6 A;  4RWS C;  1JCK B;  1X3P A;  2Z4I A;  4U67 3;  1LTT D;  2HDL A;  3DWP A;  2XSC A;  3HOZ B;  1IYU A;  4DAP A;  2F1M A;  4CKC A;  4DA2 A;  1WCM B;  2LS0 1;  1T5X D;  2EVB A;  3VR4 A;  2R7Z B;  5KND A;  3ZYY X;  2F03 A;  3JAM L;  1Q12 A;  2V4D A;  2IPK D;  4PMB A;  4MIU A;  1B2T A;  4GZY C;  3CQZ B;  1GJX A;  2F0I A;  1BDO A;  2K04 A;  1GUT A;  1TY2 A;  2WAQ B;  1R9T B;  2MPM A;  5IGE A;  2QEJ C;  5K36 G;  1XWE A;  2VUM B;  1EU4 A;  2PW7 A;  4QB4 A;  2MHV A;  1QG7 A;  1S5C D;  3H6M A;  2B2T A;  1I3Q B;  4QF4 A;  3GTJ B;  3QIA A;  3K7A B;  2K6A A;  1XTC D;  5EKK A;  4TSS A;  1LTB D;  1G8Z D;  1Z47 A;  3BYY B;  3S16 B;  1PRT F;  3TP8 A;  3CRK C;  3TME A;  4Z9C B;  1HPC A;  3MFY A;  2EXZ A;  3TBI B;  5JJZ A;  1PMR A;  3PO3 B;  3R3O A;  4KJO A;  2PMZ B;  3FDT A;  3WOF A;  4J8Q A;  2F3W A;  2HQE A;  4KJN A;  5IOC A;  5CV5 A;  1SSO A;  3I90 A;  3S2D B;  1QOH A;  1RTN A;  4C1N I;  1TWC B;  4B9X A;  1FNU A;  3I4N B;  4PMC A;  4HTH A;  1CI3 M;  4C56 C;  4DFA A;  2A68 D;  3H91 A;  3SVM A;  2SNS A;  3TP5 A;  1Q3L A;  3VYT A;  1I50 B;  2B2Y A;  2K32 A;  2R61 A;  5IT9 L;  5KIX A;  4QCL A;  2EJG C;  5KNC A;  3URY A;  1I4R A;  5M5W B;  2DN8 A;  3E0J A;  1EQT A;  2CW0 D;  2HUG A;  2F0Q A;  1SAP A;  1F2L A;  4LJZ C;  1OXT A;  1UUP A;  1BO0 A;  2N55 A;  4P2C B;  3SK6 A;  4A3G B;  2B39 A;  4KV6 A;  1TS4 A;  1BBX C;  3BDC A;  4Q0F A;  4ID6 A;  4HED A;  5DEH A;  4C3J G;  5CV4 A;  5FKA C;  5BN5 A;  4KHZ A;  3GV3 A;  3FPP A;  2IW3 A;  3W3A A;  1D1I A;  2F0M A;  1W6K A;  2AUJ D;  3TZD A;  3T4A C;  1JR0 D;  4MN3 A;  2O5J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...