1Y8OB

Crystal structure of the pdk3-l2 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
97
Chain Sequence
SYPPHMQVLLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYTDLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
publication title Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 97
sequence length 102
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2004-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y8oB00
4I7ZC 2K33A 3VR2A 2B8GA 2CW0C 2R6GA 1H9MA 1E2VA 3OW7A 5KNDA 1T5EA 2A6ED 5JEAH 2O5JC 4LJZC 4G7OC 4KI0A 4DK1A 4OO1H 3I73A 3PUVA 3PUXA 2EJFC 3PUYA 1BDOA 3NE5B 1FR3A 3QJYA 1VF5C 3OPOA 1VCIA 1EWHA 3I72A 1SMYC 1QJOA 2BDOA 4XTCS 2ZT9C 3TZUA 3FPPA 2EJMA 4IFDH 1Q90A 4RCNA 3BDOA 3VR3A 5KNBA 2A69D 1CTMA 2BA1A 1IW7C 1DCZA 3CRKC 3L7ZC 3PUWA 3PV0A 3QG1A 3T51B 1O7LA 1Y8PB 4G7HC 2D5DA 1GUGA 5JEAG 2PCFB 3M4YA 1G291 2AUJD 1OXTA 4G7ZC 4OO1G 4BA2I 1PMRA 3IFTA 1Q1EA 2KA7A 4GZYC 1DXMA 1Y8NB 3A8JE 3AB9A 2DNCA 2NN6I 2DNEA 2Q8IB 2O5IC 4IQZA 3D31A 3GQBA 2A69C 1IW7D 1Z7TA 2V4DA 5BN5A 3D4RA 1HQMC 3SE0A 5BN4A 1VDZA 1OXVA 3LNNA 2JEAI 1B9MA 1OXSC 5KNCA 1GUOA 3T53B 1Y8OB 1GHKA 2NN6H 3ND8A 4KN7C 1YNJC 3SDZA 1IYUA 3VR6A 1ZKOA 4DK0A 2BE5D 2EJGC 3A8KE 1GJXA 1ONLA 3A8IE 3U9SA 1H9SB 2QF7A 3EQLC 3MFYA 1TU2B 4H0LC 4KHZA 1TKWB 2JXMB 4JBWA 5A35A 1GUTA 2PNRC 5K36H 1GUSA 2DN8A 1DD2A 2AWOA 2D2CC 4BA1I 2BA0A 1K8OA 1CI3M 4LK1C 2D62A 5BN3A 3H94A 3A7AB 1IYVA 1LABA 4KMUC 2F1MA 3PUZA 1K8MA 2A68C 2BE5C 3IKJA 3P20A 3KLRA 4DNTB 2EVBA 3RLFA 2IT1A 3BG3A 3QIAA 1Y69U 2B8FA 1O78A 3FMCA 1H9KA 5C0XH 4IFDG 3HGBA 4OGQC 1H9JA 1V8QA 2E74C 2YYZA 2E76C 1OXUA 4PV1C 3ND9A 5K36G 3LWUA 2A68D 1VF7A 3W3AA 1Z6HA 1I6VC 4HR7B 4KKSA 3WDNA 1H9RA 2L5TA 3VA7A 1E2ZA 1FYCA 1H9SA 2K7VA 3VR4A 4KN4C 4TQUS 4H44C 1GUNA 1HCZA 2EDGA 1YNNC 1ZYRC 3I4LA 1OXXK 4KKUA 3T56B 3MXUA 1CFMA 1Q1BA 2JEBI 1E2WA 2KCCA 3CRLC 4XIGS 4DNRB 3M85A 2AUKA 5C0XG 1B9NA 2A6HC 3GD7A 1Q12A 4KKTA 3VR5A 3N6RA 1A6XA 3A7LA 2LMCB 4JK1C 2NN6G 1GHJA 1LACA 3OOCA 3M7NA 4H13C 1V43A 2K32A 1HPCA 4TKOB 2A6EC 3DXJC 2PPBC 4L8JA 2E75C 1HTPA 2A6HD 2JE6I
chains in the Genus database with same CATH superfamily
1OTCA 3UDFA 2B2UA 1BBUA 3CCLA 3WOEA 4KJOA 1PTOF 3ULLA 4CKEA 2C35B 3OW7A 2JN4A 2VUMG 4LJZC 1PRTD 1PH4A 3FDTA 2L1BA 3G6JB 5JOBA 3J7YW 3H0GH 3HOYB 3JAME 3OPOA 4K5XA 3UI2A 2N49A 3CPWA 5GAGC 1G2TA 3D0FA 1XPOA 3R8BA 3U4VA 3NTIA 2Y0SG 4NW2A 1AZPA 3KF8B 4KK7A 5FK9C 3HOYH 1ILPA 1HHVA 4B3RL 2NUCA 4A3KG 2KA7A 2ZXRA 3AB9A 2E2IB 1TS3A 4XYQA 2OXPA 3D31A 4LF5Q 3K7AB 3GTOB 4PZ8A 3OSOA 1E22A 2C5CA 2J7ZA 1OXSC 1VMPA 1PDQA 5C3WA 5KYIA 3KF6B 2ZM6Q 5FLXL 1VS0A 1WCMG 1LTAD 1AFPA 4JVZA 3I4NG 2E2IH 1BVSA 2X6LA 4H0LC 2WIIB 1AE2A 4JBWA 3K7AH 3T13A 4BBSB 1PYSB 3GTOH 3M4PA 2JYOA 4FO2A 1HNWL 2F0JA 3PIP3 4FXDA 1HQRD 4R4QA 1YVCA 4GN4B 1STBA 4KMUC 4DAVA 3PUZA 1BO0A 1U0LA 1Y1VB 5C44B 3CQZB 4GNXB 1KC8C 1SXTA 4DV2L 3KBGA 2OQKA 4ODGA 5C3EG 4YY3L 3VYSA 5D65A 1V8QA 1VQOA 4LF7L 1ESFA 3TS0A 1TWAB 2NB0A 2SNSA 1Q86C 1F9QA 1Y1VH 4DFAA 3CQZH 1EIFA 2IW3A 4DR1Q 5HY6A 4OWTB 3MXUA 1PV4A 4X62L 1HZCA 1Q3LA 5KRUA 4YHHQ 2K52A 4YCUA 1SSOA 4I7AA 2B2UC 1TWAH 1BF4A 1X3FA 1PYBA 1T9HA 1VQNA 4QY7A 2RDHA 1XNRQ 1D5XC 3OYYA 3W5OA 4GKKL 2K33A 4UDUC 5C4XB 4JI1Q 1PH3A 3I4OA 3S14H 3BYYB 4R1JA 3RNUA 2XIWA 2KOLA 5JEAH 4AYBG 4QCLA 5JEAJ 3PUYA 1ENFA 5GQOA 1FJGL 1XNQQ 1LT3D 1KRTA 5C4XH 4IPGA 4Y52H 2WP8J 4XQNA 3GO5A 3G4SA 1Q81C 1QUQA 2F0OA 1HJPA 4DR5Q 4RA8A 4YWKA 1STHA 5ELDA 3I56A 2YTVA 3BZCA 1VQHA 3GQBA 2A69C 1IW7D 1I5FA 2R3ZA 3S15B 2JSOA 3EIVA 3H6MA 3T1YQ 3TREA 1JR0D 4JI8Q 1UNSA 4F8MA 1IKLA 1S5FD 4DK0A 1B50A 5CV9A 3EQLC 4GLVB 4UP8A 5FO7B 1SR3A 2X6GA 3S15H 3F2DA 1K73C 1UE1A 5C4JB 2F0QA 4ALPA 1LABA 3H0GG 3IL8A 3WOFA 1WTRA 1EY0A 4GN5A 1B8AA 1KNEA 3TS2A 1AN8A 5FJ8H 1CM9A 1N9WA 1O78A 2Z1CA 3HGBA 4KJNA 1KAAA 4K5VA 1YIJA 4RH6A 1OXUA 1FL0A 4X3SA 4QUCA 5C4JH 4OO1I 4H02A 3HOYG 3N52A 1GUNA 2IY5B 1EIGA 3E0EA 4KKUA 5IP9H 2VQFL 2O2LD 2JEBI 1JOOA 1PRTB 4NXNQ 3UDIA 2ES2A 4JI2L 2PYKA 3AEVA 1SE3A 1GHJA 4XYOA 1HNZQ 2XVSA 4H13C 5DAUA 3UE1A 1ICWA 1F2MA 1S40A 2JA7G 1PRTC 2VL6A 2NVXB 1ET9A 1QUQB 5EKIA 4C3HB 1TWHB 3NENA 4A75A 1LT6D 3I8ZA 4PMCA 1JWUD 2QKIC 1PH6A 4IUNA 2RDFA 4HJ5A 1FNUA 1V1OA 1ENCA 4QQBX 4DV7Q 1CT1D 4K8JA 2NVXH 1MSGA 1SYBA 4C3HH 4BBSG 1TWHH 3F2BA 1GO3E 1C48A 3PF4A 3BZKA 1M90C 3EFXD 1L1OA 1BCPB 1MHWC 3FEWX 2EJMA 3E9HA 5C44G 2BH2A 4B3ML 2E5LL 3K5MA 4LF6L 2VQEQ 3CCEA 5M5WB 4LUOA 1TIID 5J3BA 2AUJD 1F2ZA 2WAQE 5M3FB 1BCPC 2EY6A 5E4XA 2DNCA 2XN9C 5IGCA 2NN6I 3SGIA 3WWVA 1EEFD 2CQAA 2YTXA 5CYUA 4GOPA 3SE0A 1VDZA 1NAPA 3MA2B 2RSOA 3CP0A 1EFWA 2DUDA 1Y1WB 1DOKA 3W2DA 2K5VA 3Q24A 4HJAA 5C6AA 5M3FH 2BE5D 4IFDJ 1ONLA 1RIPA 2CH4A 4MIUA 2ICIA 4UAIA 3X3NA 2DN8A 1R9TB 1SN8A 1LYLA 2HHHQ 3V2TA 1ET6A 5DM73 1WTOA 1Y1WH 1STYA 3TSSA 3IKJA 2EYHA 3I70A 3S17H 5C4XG 1STAA 1S3OA 2PZTA 4ZAIA 3RLOA 5KEEA 3J7AF 1SRUA 4IN3A 2Z4HA 2N55A 1R9TH 4BY1B 3GTGB 5HGQA 3BYTB 3KK7A 4NXML 4HR7B 4O1NA 4KKSA 2P5ZX 3VR4A 2K1BA 1XMOQ 2G5DA 5I2YA 2LKVA 1K0SA 4HCEA 1N33L 4X64L 4J1MA 4X66L 1UUPA 1B7YB 1O7ZA 3GTGH 2XGTA 3NQIA 2LMCB 4K0KQ 3KLWA 3TQYA 1L1OB 1E24A 2KECA 1EY9A 5FO8B 3STBD 4LMQD 1VQCA 4DR3L 1N34L 1SNPA 2K01A 5IIFA 1AE3A 2K05A 3G7LA 1GVPA 1I4HA 1PVOA 3RZOB 2EYMA 1HFGA 2F0PA 3HZXA 4FXKC 2F0IA 4GOPB 5KGUA 3LX0A 4LUZA 2EJFC 1P8LA 2JA6B 5LMNL 3NE5B 2Q2HA 1M4VA 1EWHA 1B2TA 1EY5A 2EYFA 1CHPD 1I50H 4FF4A 3RZOH 1TWCB 3BDLA 3DWAA 3Q0AA 4GOPC 1PH1A 1PFMA 3I91A 1CTMA 1GD7A 1IW7C 4JV5Q 2D5DA 3M4YA 2PQEA 3CHBD 2JA6H 4APVA 2EY1A 2F3WA 1AP0A 1PMRA 2F0GA 4P71A 4UY8C 4CJ2C 1TWCH 1DM0B 4MTNA 3ICEA 3QOJA 2JQOA 2GN5A 3ITPA 2TMPA 1BUVT 2SNMA 1P16A 2PQAA 1QVFA 5E4WC 5KNCA 4OHJA 2OTJA 2OCEA 1WTWA 3TP5A 2MNAA 3A56A 4DV0Q 2EYJA 2NVTB 2MO0A 3SXHA 2QDBA 3I2ZA 1TS4A 3S1MB 1DD2A 1WVLA 1I94L 4LK1C 4LFAL 1BNZA 3SK8A 1UE5A 1JT8A 1YNJD 4JI4Q 1PTOD 1DOMA 4R9WA 2LY7A 2A1AA 2Z0SA 4ZKBB 3Q23A 4LF4Q 4YCVA 2OTLA 1BR9A 4DNIA 2NVTH 4GS3A 1Y14B 2GVBA 5EPLA 1KHIA 2MGSA 2ZTEA 1HNXQ 3J81j 1FD7D 3HOZG 3S1MH 4UP9A 4PV1C 2JK8A 4DA2A 2UXDL 1BKBA 3H15A 4DR2L 1E2ZA 3RMHA 1VQMA 4DF7A 5EKLA 5LMNW 2I5LX 2WKDA 1JJGA 4JOIA 1J6QA 4P72A 3CD6A 2RCFA 4N9PA 2IX0A 5GROA 4OL7A 5IP7H 1FNVA 2Y0SB 2OT2A 4KKTA 2VUMH 1KAWA 1S5DD 1N36Q 1PFBA 1JB7A 3M7NA 5M3FG 1JJCB 1Q8KA 4A3KB 2RVLA 5ELNA 1EY6A 4IUVA 3ERQA 4C3JB 2A6HD 1WFQA 2NZOA 3M9BA 4DXFA 3MXPA 1D8LA 1SNCA 4JI6Q 1Y1WG 1G6PA 2O4XA 3E9IA 3NUCA 1PHJA 1TQOA 1AH9A 2F0FA 4YCWA 4PMBA 2O5JC 4CJ1B 1SFOB 1WCMB 4A3KH 3I4NB 4X65Q 1FR3A 4C3JH 2PQAB 3I72A 1JORA 1EYCA 2FXQA 2QGQA 1EEID 2ZT9C 4IZ8A 4DV3Q 1DZ1A 1C0AA 5JJLA 4LF5L 1BQQT 1SFOH 1O7LA 1WCMH 1GUGA 2EXZA 3I4NH 1VQIA 5DM63 4BY1G 4ZK9B 1D1KA 2ZM6L 4A4IA 3Q8DA 5ISRA 5IWAL 4B3SQ 2VB2X 2FHTA 2RCNA 3HOUB 3PSIA 1HZAA 4DV4L 4ME3A 2NZ1D 4RG1A 3G48A 5DLQE 1Y8OB 1VQLA 2EQSA 4XDXA 3PIPA 3L2PA 4IO9A 3NK9A 3BVGA 1CHQD 1PZID 4EGVA 1JE5A 1KNAA 2JXMB 3AYHB 1GUTA 3HOUH 1HA6A 2BA0A 3K81C 2B2VA 4HJ7A 2N3SA 5ELCA 4LAAA 3NWSA 3H91A 3RN5A 4XT1B 3CCMA 1STNA 2Z6BA 5BR8Q 3A5ZB 2PI2E 4JOIC 3CCJA 1CA6A 4JPBW 3SVMA 4AYBB 4C56C 3OHXC 3CAMA 2HQLA 4CDCC 3O13A 1IKMA 3C1FA 1G91A 5I9PA 2F0KA 1HCZA 2EDGA 1YHQA 2WFWA 4K6DA 3T56B 4A3GG 1HA5A 1BBXC 2WAQG 1YZ6A 4CKBA 5CBAE 1OO9B 5C0XG 4B3TQ 4L63B 3T1HQ 4JI1L 3HP3A 5IGEA 2RKSA 1Q7YC 2EYOA 1PLFA 5COYA 3M3YB 1PH2A 4O42A 2B2WC 2JE6I 1XPUA 4JBKA 4NP5A 2WACA 3C46A 1E1OA 4AIMA 4X6AH 1SBBB 4WJ3M 2MUYA 2LS01 1RL2A 4C3IB 1HUNA 3OTOL 4R4CA 3BS1A 1IL2A 1I3QB 4DR5L 1JICA 4OX9Q 1IBLQ 5AFWA 1SMYC 2N8NA 2WINB 3VR3A 4LWCA 3CRKC 4LF9L 4HMJA 4LF8Q 4RKLA 1NR4A 1I3QH 1EUJA 2AQ3B 2ZXOA 4R4IA 4DV1Q 5IP7G 3AQQA 1TR5A 3DUZA 1I6HB 1TY2A 5F2DA 1F9SA 3D4RA 5G3LF 2F03A 1NMFA 2QW7A 1UWVA 2B2VC 2BDNA 2R61A 2K28A 2YU9B 4ZYSA 4ZLTF 1SDFA 1YNJC 4DV5L 4X3KA 4JI5Q 1ICFB 3VA5A 1I6HH 1TU2B 4OWXB 1V1PA 4RGOS 1SE8A 1L0YB 4GKJQ 4A3JB 1JCKB 4IUUA 1I4QA 2SEBD 5M5YB 1UEAB 3GV6A 3MXGA 2YU9H 1N32L 3OIPA 4C3JG 2JA7B 2WKCA 5EBDA 2FJ2A 2MQHA 1CQVA 3BG3A 3QIAA 1IZ6A 2UXBQ 4EQNA 1WI5A 4N8FA 2V1CC 2AKWB 4UHVA 4A3JH 4DUZQ 2MPMA 2ICEC 4ZUIA 1HH2P 5M5YH 2JA7H 1X3PA 4P73A 3K5LA 3NPPA 5ELEA 1HNZL 4KD3A 3I4LA 2PMZB 5EJWA 3PMFA 3CRLC 5I4DA 3L9AX 1E2WA 3J81c 2R7ZB 1A3VA 2VXWA 3Q6SA 2DJGC 3IAYA 2HDLA 3NXWA 2AUKA 4FVMA 2A6HC 3ULJA 1Q12A 1NCVA 1L2FA 1B3AA 4DU9A 1YNND 1V43A 1HPCA 4BBSH 3TRZA 1K83B 4PZ7A 2R7ZH 3HOUG 1SYFA 4CDDC 1CKOA 5C44H 2K75A 1Q46A 2CW0C 1JOQA 1J5EQ 1IBMQ 4F7XA 1EY7A 1YEZA 4IFDI 1O7IA 2RQXA 2VQEL 1UE7A 3TBIB 1K83H 2UUAQ 4RWSC 3QJYA 3HKZE 2UUBL 3ZYYX 1WTHA 3M4OB 1MI2A 4JG2A 3MFGA 4KHVA 1TY0A 3U4ZA 4AQYL 2NVYB 1XJVA 2R92B 1GXDC 3L7ZC 1SAPA 1V1PB 1SYCA 3F2UA 3KBXA 3J80c 2WV6D 3F2CA 1QZHA 4OWWB 2KEDA 1B70B 3NBIA 5D14A 4BA2I 2J4XA 3AU7A 3NP8A 2LSSA 1DXMA 4R4OA 3CC2A 5A2QL 3M4OH 1G8ZD 1EYAA 2JEAI 3EN2A 2NVYH 3RZDB 4JI3Q 2R92H 3KFUA 1B9MA 2Q8RE 1LT4D 1XTCD 3A74A 2DY8A 4HCSA 1SJHD 4DR4Q 5IT9E 3K0XA 2IPKD 1MIUA 1W3SA 5LMUQ 3A8IE 1E3PA 1L0XB 3NTKA 3VYTA 2K5QA 1BBWA 2I07B 2UUCQ 3K8AA 3SK4A 3RZDH 2KCMA 2BH8A 1KQSA 3JAMc 3S1QB 2K6AA 2UXCQ 4CKCA 1SJED 3DHQA 5JJKA 2H1EA 2PZWA 1H9JA 5KYLA 2A8VA 4UP7A 4C3IG 4HJ9A 1I6VC 4JCVE 2F4VQ 1HUMA 1H9SA 3S1QH 3H3VC 3A54A 4NPSA 1OXXK 3D4DA 1A62A 4A3BB 3H3VH 1AZQA 4R8NA 1D7QA 3PF5A 1VQEA 2XTIA 1YJNA 1VQKA 2K32A 4TKOB 4UPAA 3K6OA 3OMCA 2L15A 4A3BH 1STEA 2GVAA 2F52A 2K04A 3JC66 3MWYW 3FVQA 1K8AC 1A3TA 1WOCA 1CA5A 2H4OA 3HKZB 5C5LA 4DK1A 1IXRA 5M3MG 2F0SA 1QE6A 3S9WA 3NSWA 1WTPA 1EWCA 4B3RQ 4K5WA 1G2SA 1HR0L 4A3JG 2Q2IA 5T1IA 1NY4A 1S5ED 5HGTA 4HEDA 2BA1A 4DUYL 3PV0A 4ZCKA 4CDFC 2ZJPA 4G7HC 1PRTF 3HG9A 5L37A 4A3FG 4L5RC 2Z6KA 2ZJRA 1T5XD 5DEHA 3U9OA 3HOZB 1A3UA 2XWJB 3FP9A 4BWGB 2Q8IB 4DV0L 1S72A 1HQMC 3LGJA 2B63G 3RUZA 3A55A 2FMMA 2HCCA 1CQFA 2ALYB 4RCOA 5C4ZA 3U58A 2R7ZG 1RF2D 4NKLA 2AQ2B 3HOZH 2Q2TA 2KCNA 2BCOA 3A8KE 5LL6S 4DV2Q 4LF4L 1H9SB 3H09A 4K2KA 2HIXA 1IBKL 2D2CC 2JP1A 4K8IA 1HNXL 1ML0D 1PYWD 3CW2C 5ELBA 1C7YA 2F1MA 1KL9A 5EGTA 3Q22A 4U68A 1K3BC 1BCPF 1RCVD 3PO3B 3CMEA 2K5NA 5M5WH 4A3EB 2M2LA 2DGYA 4X62Q 3QO2A 1VQ8A 2ZXPA 1S4ZA 3PIO3 4EX5A 4DV6L 2K7VA 3CCQA 4H44C 3MVVA 1YNNC 2L12A 3PO3H 4L5SA 2KHIA 4PQXA 3AFPA 1HR0W 4A3CH 1EY4A 4JW0A 4A3EH 2A73B 4QJFA 4GKKQ 2R92G 4V190 1HRJA 3J81L 3PO2G 1U5KA 1XTDA 3SHLA 1SNOA 2FFKB 5FLXE 1XXGA 2M9VA 4TSSA 1QWYA 2B2YA 4A76A 2OQ0A 3ULPA 2NVQB 1EL0A 1FJGQ 3VR2A 5CV8A 4GLXA 1X3EA 5KNDA 4G7OC 3HS0C 3R2TA 3I73A 2JA8B 3R2IA 4BY1H 1KABA 2Z6KC 3HOVB 4ZQ3A 4EVOA 3M4QA 4NDXA 2KQ3A 3PUWA 4IPDA 1DCZA 4OIJA 1A2TA 3PCOB 2YTYA 2JA8H 3C2PA 1EQVA 2KVMA 3ER0A 1CKMA 3HOVH 3K57A 2DNEA 2F3VA 2XRSD 4PMWA 3QWNA 4ZRZA 1EIYB 4A3BG 3D6WA 2J0TD 4V0BA 4A3GB 4KHPL 2WAQB 4FXGC 1V9PA 3P7JA 4YWLA 5BR8L 4P2CB 1HZ9A 2E2JB 1LUZA 2A74C 3FKIB 1D5MC 2OWOA 3KJOA 3NHHA 4B9XA 5CR3A 4A3GH 3P20A 4MNOA 3S24A 2H5XA 1RDPD 4JBJA 1PFNA 2N78A 5C0XH 1ZYRD 5KIXA 4HIDA 2VQFQ 3S1NB 1W2BA 2HQEA 4CJ0B 3HKZG 4L5TA 2E2JH 3URYA 2K5WA 1PH5A 3FKIH 4DKAC 1QVGA 1VQFA 1Q82C 2F3IA 1QNKA 2ZTCA 2CCZA 4POGA 1D5ZC 5AJ3L 1Q1BA 2KCCA 2B2YC 2NTTA 3S1NH 1MBYA 3MTSA 2NZHA 1CSQA 2MP1A 3NQTA 4OONA 2SOBA 1H95A 1TXYA 3NELA 3M7GA 2JA5B 5G3LD 3ERSX 2F0LA 4DR6Q 1XYIA 3C1EA 4DN4M 4KTAA 4L8JA 4K6LA 4WRDA 1QVCA 3W3AA 4LNQA 2K50A 3HKSA 2VY3A 3F8TA 3A0JA 4FYDA 1YNXA 3G6EA 2R6GA 2R7FA 1H9MA 1ASYA 1X56A 5IODA 2JA5H 4ZKCB 3MEFA 2AWNA 5J1ZA 2E5LQ 4B3MQ 3PUVA 2VZAA 2UU9Q 4LF8L 5FLXc 5IYBG 1D6EC 1VCIA 1JJ2A 2PZUA 1W6KA 3SEBA 1SYGA 4XTCS 1GM5A 4CDEC 4KD4A 4F87A 4FF1A 3KLSA 1NMGA 1NE3A 4C2MB 1O80A 4A3LH 3PO3G 2B2TA 4A3CG 4M1UB 5T1GA 4G7ZC 4A3EG 2BOSA 1K9MC 1HZBA 1EIHA 5I6WA 3IFTA 3C3LA 5CV7A 4LW1A 4CBVA 1O7YA 5BN4A 4F88A 3GTJB 2B2WA 2Q8TA 1U4MA 3E0JA 4C2MH 4IURA 5M9OA 4HSVA 2I5HA 4HIOA 3VYRA 3K5NA 2F0HA 4ID6A 2NN6H 2AQ1B 3IRBA 1J8IA 2VNUD 5C5MA 2Z8LA 4X3TA 3QB3A 2EJGC 2OF1A 5EPKA 1F2YA 2E8GA 3MFYA 4ILWA 1MSHA 1WTXA 1XPRA 3GTJH 2AWOA 3KDFA 1K8OA 2MO1A 1A15A 2QA4A 3H94A 4NXMQ 1TWGB 5EQ0A 2C9OA 4DUZL 2BE5C 5IE8A 4IUQA 3AFQA 2Z9HA 4QGUA 1QG7A 1Y69U 2B8FA 2XSCA 3TN2A 1N33Q 3V05A 3DLLA 4A3IB 1LT5D 4IUPA 1E7ZA 2AMCB 1EZ8A 4YWMA 2G9DA 5K36G 3HOXB 2JA8G 1F2LA 4XQJA 5IGGA 4JI7Q 2CWPA 1BXTA 1C9OA 3HOVG 1QNUA 2JA9A 4DR3Q 4A3IH 2M00A 1N34Q 2D0PA 5IY0A 1KD1C 3CC4A 1JMCA 1E0BA 2Z4IA 4AH6A 2IHEA 3EBEA 4O2DA 1RD9D 4DR1L 1XWEA 2SDFA 3NEMA 1IBML 1NJIC 2L0CA 1YITA 4YHHL 3KYHC 2UUAL 4HAEA 4JYAQ 1E2VA 1CZWA 2EZVA 1SMXA 1XNRL 1NNXA 2PI2A 3STBC 4RGTA 4IJLA 2B2TC 1BDOA 2IX1A 3CC7A 4Z9CB 4R8IA 4B9WA 3K59A 3FKIG 3FPPA 1X55A 1C8CA 1X6OA 2A69D 3QG1A 5EAYA 3CU7A 3L3OC 3KDFB 3NBHA 4OO1G 1XNQL 1Y8NB 5H1SE 1K0RA 4QB4A 5LMUL 4IUTA 3M3YH 3LNNA 1SNQA 1A0IA 2UUCL 2X69A 4LFAQ 4RAUC 3ND8A 3GV3A 1ESRA 4KN7C 1IYUA 4HIKA 1ZKOA 4DAMA 4FP5D 4A3MB 3R3OA 1YJWA 2UXCL 4KHZA 4C3IH 2JA5G 3MC0B 4EQPA 1EQTA 2RF4A 4CHTB 3T1YL 4KLKA 4JI8L 2UXDQ 1L0WA 1PTOB 1KLUD 2PNHA 1TS5A 4MZ9A 5EBCA 3RLFA 1HTLD 4BY7G 2I0QA 1A2UA 4Q5VA 4A3MH 2KCTA 1DYQA 1II3A 3I7FA 1KDAA 2E76C 3I3CA 4K2LA 5GADC 1YI2A 2D0OA 4A3LG 1PTOC 3GDEA 4DR7Q 5M3MB 1PTOH 3HOWB 4TQUS 2EY5A 1WD0A 2F0NA 3DEPA 3FPUB 2ZJQA 1CFMA 4HJ8A 3I4MB 4LFBQ 4J6HA 4DNRB 4M8AA 3GD7A 1LTTD 3OMGA 3VR5A 1A6XA 1B53A 1EFID 2VS1A 2LXJA 2NN6G 3HFZB 2F0TA 1EOVA 2XRQD 5M3MH 2F4IA 2WB1E 3CKIB 4A3FB 3HOWH 3BU2A 3K58A 1JOKA 3G71A 1WD1A 4FNFA 1EU4A 3GTLB 4A93B 4DK3C 3I4MH 3BVZA 4NXNL 3E6ZX 5IGFA 4RMFA 3NBHB 2B63B 1J9OA 1S5BD 3K7UC 2A6ED 4A3FH 4KI0A 1XMQQ 4JBMA 3GTLH 4A93H 1PZKD 4HIMA 1FGUA 3TDQA 2E2HB 4LFCQ 1BCPD 1VQPA 1QJOA 3X3MA 3TZUA 2B63H 4BBRB 5IWAQ 4RCNA 2D9UA 5CV4A 4Y7NB 2CQOA 4DV4Q 4DV7L 4JI0Q 5JPNC 1PH9A 1G291 4A3IG 2FMCA 5E3FA 4FDBA 5FKAC 3A8JE 2E2HH 4OIKA 3HOXG 4BBRH 2MHVA 2A5HA 4Y7NH 1FGBD 1NTGA 3W1GA 1X3QA 1GUOA 3DWPA 2ZTDA 5FLMG 4EQ5A 3LWEA 4GNXC 1GUWA 3D3RA 2CH4W 4KY6A 5E1FA 1F9RA 5FOBB 1VMCA 2PNRC 3PO2B 2ID0A 2EE1A 4IOCA 1IYVA 3J7AV 5C3XA 4U673 3RR5A 4PG3A 1PXUA 3S14B 3PIOA 1DGSA 2F0EA 3PO2H 1RKNA 2HHHL 2YYZA 1CZGA 3ND9A 2B39A 1VQGA 5IGBA 3DM3A 4WJWA 1H9RA 2L5TA 2MJ8A 3E3XA 1FYCA 1KIXA 2F0VA 4K14A 3B6YA 2B3GA 1STGA 3T16A 2WB1B 3M85A 2HD3A 1I4GA 2N88A 3SR1A 3J7ZC 1R4PB 1C4QA 1CUKA 3TZDA 2PW7A 1B3QA 1VQJA 2RBMA 5CORA 1XMOL 2F0MA 4XT3B 3KOJA 4P75A 1SE4A 3OTOQ 4O0AA 1VQ6A 2FINB 2B8GA 4K0KL 1KTKA 4LF9Q 4A3MG 2KUMA 1K3RA 1EWIA 2LFNA 1F77A 1SE2A 5D3IB 1TT2A 1A63A 5KNBA 1GKHA 1PFSA 3K80C 2CKZB 1U4PA 1TVXA 1Y8PB 4WJ4A 2PCFB 5C0XI 1EU3A 4DV5Q 1Q1EA 1WYDA 2F0DA 3NWTA 3KUPA 4BXXH 2XNAC 1OXVA 4ZUJA 3CCRA 3HOWG 4JV5L 2RHQB 4YIJA 1UE6A 2K4KA 1DONA 1X54A 3T53B 4G57A 3I4MG 1N32Q 3VR6A 1YJ9A 1PA6A 3BDCA 1GOZA 1WJJA 1GUSA 1JE4A 3UDXA 1ENAA 1CI3M 1MD2D 4IPCA 5BN3A 5J39A 2KBNA 2IWHA 4A93G 4H7BA 1K8MA 2R7DA 1D2BA 4IJHA 3OW2A 2HCIA 3I90A 4DAPA 2IT1A 1IL8A 4RHSA 3CCUA 1ZXTA 1QZGA 3D4WA 2QEJC 3CXCA 1HNWQ 4DK6C 4WFN3 1M1KC 4JI4L 1D1IA 1VF7A 4RGNA 4QIWE 3OIQA 3BJUA 5GAHC 1SEBD 4KN4C 1X9NA 1B44D 4YY3Q 4LF7Q 3D6CA 4BBRG 2JJQA 1PH7A 4DR6L 2RDGA 3A5UA 4QL5A 1MJEA 1B9NA 1A8VA 3MZ5A 1WTQA 2R93B 4EQOA 2EIFA 4PZ6A 4RGMA 5IT9c 5EKKA 4KV6A 2A6EC 5IYBH 1Y1VG 3DXJC 2DJFC 1EZ6A 4MN3A 2PPBC 1HTPA 4C1NK 1JC7A 2UU9L 1U9RA 2UUBQ 5JAVA 2R93H 2L9HA 5I6YA 3J81i 4C1NI 1N36L 5GAEC 4AQYQ 1X32A 5JJZA 3TP7A 1LTID 1VF5C 3DEOA 4R4TA 3IFDA 2QCPX 4JI6L 3GTKB 2BDOA 2CFMA 4IFDH 3S17B 1QCBD 1VQAA 4LUVA 3T51B 5CV6A 1N8RC 4X65L 5JEAG 1R4QB 4PNYA 2EXDA 1K8GA 1QB5D 4G4KA 4OELB 2F0UA 4GZYC 1G51A 2O5IC 5LHY1 3GTKH 4DV3L 1YBYA 4QUFA 2AHOB 4A3DB 3K0YA 2IHFA 4NB3A 1X65A 1K28A 3MEHA 2NVQH 1CSPA 3RD4A 3SDZA 1KRSA 2IJ0A 2WB1G 3J80i 2EYPA 3EROA 3UDGA 1B1ZA 4B3SL 1NUCA 5K36H 1AW7A 1TS2A 3FRPB 4A3DH 3T4AC 3F1ZA 3UE0A 3D8GA 5E7NA 3J80L 1VQ9A 1KDCA 5CGKA 3BZDB 1PH8A 2E2DC 3RLNA 4E6IA 2EVBA 3TMEA 4BS9A 4JI7L 3HRZC 4RKBA 3U50C 5ELFA 4QIWB 1RJTA 1H9KA 1EY8A 2Y0SE 4OGQC 2LXKA 3OWFA 4Q0FA 2EY2A 2K03A 3MHBA 3TP8A 2A68D 1LTSD 3FHWA 3GTMB 2G9HD 3S1RB 3VA7A 3I55A 1EYGA 1I50B 1LLRD 2NWGA 3AMUA 1L1OC 1LTLA 2NBFA 3P1HA 5IYDH 1XX8A 3JAMi 4BXXG 2MFIA 5A2QE 1Z47A 5FJ8G 4N8X1 4MHEA 3R93A 1FNWA 4JK1C 3GTMH 1IYJB 1RTOA 3S1RH 1UAPA 1ZEQX 3JAML 4JYAL 5C0XJ 3OWEB 3TEHB 2KJXA 5HURA 5JJIA 3KLSX 1VQ7A 4JI2Q 2F0WA 5IP9G 4FF3A 5I2XA 4I7ZC 3RN2A 4B3TL 5C4HA 5JPMC 4NMZA 3T1HL 4J15A 5DNFA 2EOTA 1HR0Q 1SMYD 2RSNA 1HXYD 5NUCA 3ZJYC 4ABNA 2OEOA 1T5EA 2NYZD 1VQ5A 4FF2A 1LV9A 4OO1H 4DUYQ 2Q2UA 3PUXA 5IYCH 4KY7A 2B29A 4ME5A 4HTHA 1JWSD 1RTNA 3MXNA 4IPHA 1CK1A 3BDOA 1EQRA 2DY7A 4OX9L 4BY7B 1DJRD 1IBLL 1YHAA 1QOHA 3CCVA 1LTRD 1TWFB 1DOLA 4IALA 4J8QA 4C3HG 5CV5A 3CMAA 4LF6Q 1LTGD 4IQZA 4GLAC 1Z7TA 5BN5A 2EYLA 3QOLA 4TVAB 5CBEE 1IBKQ 1VQBA 3S2DB 1UEBA 4P74A 3DWQA 1SNMA 4BY7H 4DV1L 2VUMB 1TWFH 1I4PA 4QMGA 2KEEA 2R93G 2QF7A 2IX3A 1KLGD 1TKWB 5A35A 1PZJD 3L0OA 3KJPA 4MTKA 1MKHA 4OXPA 4BA1I 1E1TA 2XWBB 2TSSA 3QR8A 4KY5A 5ELOA 4XXEA 4AYBE 2D62A 3S2DH 3A7AB 2KHSA 4S3SA 1AEXA 1SLJA 4JI5L 3ONAB 5IOCA 1JWMD 4DR7L 3TP6A 4DV6Q 1SYDA 2VB3X 4TRDA 2QDLA 2L55A 4N9TA 1SYEA 2RA4A 2YV5A 4OEMB 4IFDG 4GKJL 1W6JA 1G6ZA 3EA6A 1JQYD 2E74C 1U4LA 2I46A 4LFBL 3LWUA 5JVG3 3GTQB 1VQ4A 3WDNA 5LL6X 2GA4B 4GN3B 3GP7A 2UXBL 2EPBA 3SK5A 4I65A 3W1BA 1CKNA 1FVIA 1IHZA 2ATWA 1EYDA 3N6RA 3NTHA 1VQDA 2HUGA 2CW0D 3MXNB 1NBWA 3GTQH 1KDBA 3VYUA 4DAYA 4DXGA 4L6TB 4X64Q 1I4RA 4QF4A 4X66Q 1QILA 4WORA 1X3GA 1XMQL 2K14A 2K5DA 5IT9L 4A3DG 1LO5D 1TWGH 4RHRA 1MGSA 3K5OA 1BOSA 4POFA 5EPJA 2CWAA 4LFCL 5C3EB 2PO4A 1MJCA 2CVRA 3P75A 4L5QA 2L11A 1U4RA 5I9OA 4JI0L 5IGDA 2KHJA 3HOXH 2HDMA 3EVQA 4RFBA 2I5MX 4DGZA 1F9PA 4IOAA 1JB3A 3BVMA 1Q90A 5C3EH 1J5EL 2ASBA 5FLMH 1HFNA 4DPGA 5JVH3 2CHBD 1SNDA 5LMNQ 5IYDG 1OXTA 3DMUA 5TSSA 3CF5A 1I4XA 1LTBD 4KHPQ 4HMIA 1M8AA 3J81E 3E5SA 2A19A 1B4OA 1KXLA 1S5CD 2HIVA 2IL8A 2V4DA 3J7A5 2L4NA 5J22A 3CCSA 4XQQA 3S16B 3SK6A 4B08A 2RHSB 1GHKA 5CMDA 5K5PA 4CGYB 2JA6G 1GJXA 3U9SA 1NSNS 1NR2A 4JI3L 3KF8A 3VDYA 2PW5A 5FO9B 1CKNB 1Q8IA 5IYCG 3S16H 2NTSA 3PQIA 4JC0A 3S2HB 3V96A 4DR4L 2A68C 2PMZE 3KLRA 4DNTB 1V1QA 4X3UA 4DAYB 3PGZA 2QEXA 3FMCA 3EJIA 5AJ3Q 1I94Q 1RHPA 3GTPB 1ASZA 1EQQA 5M5XB 3KF6A 3H3VI 2KENA 1Z6HA 3HEJA 3S2HH 1EOTA 1LM0A 3J80E 1ZYRC 1YHBA 4XIGS 2K5HA 3GTPH 4HN7A 1ILQA 2HT1A 4HSPA 5M5XH 2ENBA 3CPFA 2QILA 4GNXA 4DR2Q 3A7LA 3MAQA 2F4VL 5CC4A 1LACA 3OOCA 4ULLA 1RODA 2VW9A 3H0GB 5D3DA 3DM1A 2E75C 1WTVA 1SROA 1Z9FA
chains in the Genus database with same CATH topology
2B2UA 3WOEA 4KJOA 1PTOF 4CKEA 3OW7A 4LJZC 1PRTD 3FDTA 2L1BA 3G6JB 5JOBA 3J7YW 3HOYB 3JAME 3OPOA 4K5XA 3UI2A 1G2TA 3R8BA 3NTIA 4NW2A 1AZPA 4KK7A 5FK9C 1ILPA 1HHVA 2NUCA 2KA7A 2ZXRA 3AB9A 2E2IB 1TS3A 4XYQA 2OXPA 3D31A 3K7AB 3GTOB 3OSOA 2C5CA 2J7ZA 1OXSC 1VMPA 1PDQA 5C3WA 5KYIA 5FLXL 1LTAD 1AFPA 2X6LA 4H0LC 2WIIB 4JBWA 3T13A 4BBSB 2JYOA 4FO2A 2F0JA 3PIP3 4FXDA 1HQRD 1STBA 4KMUC 4DAVA 3PUZA 1BO0A 5C44B 1Y1VB 3CQZB 1SXTA 3KBGA 4ODGA 3VYSA 5D65A 1V8QA 1ESFA 1TWAB 2NB0A 2SNSA 1F9QA 4DFAA 2IW3A 3MXUA 1Q3LA 5KRUA 1SSOA 2B2UC 1BF4A 2RDHA 1D5XC 2K33A 4UDUC 5C4XB 3BYYB 2XIWA 2KOLA 5JEAH 4QCLA 5JEAJ 3PUYA 1ENFA 1LT3D 2WP8J 4XQNA 3GO5A 2F0OA 4RA8A 1STHA 5ELDA 3GQBA 2A69C 1IW7D 2R3ZA 3S15B 2JSOA 3H6MA 1JR0D 1UNSA 4F8MA 1IKLA 1S5FD 4DK0A 1B50A 5CV9A 3EQLC 5FO7B 2X6GA 5C4JB 2F0QA 1LABA 3IL8A 3WOFA 1WTRA 1EY0A 1KNEA 1AN8A 1CM9A 1O78A 2Z1CA 3HGBA 4KJNA 1KAAA 4K5VA 4RH6A 1OXUA 4X3SA 4QUCA 4OO1I 3N52A 1GUNA 1EIGA 4KKUA 2O2LD 2JEBI 1JOOA 1PRTB 2PYKA 1SE3A 1GHJA 4XYOA 2XVSA 4H13C 5DAUA 1ICWA 1F2MA 1PRTC 2NVXB 1ET9A 5EKIA 4C3HB 1TWHB 1LT6D 3I8ZA 4PMCA 1JWUD 2QKIC 4IUNA 2RDFA 1FNUA 1V1OA 1ENCA 1CT1D 4K8JA 1MSGA 1SYBA 1C48A 3EFXD 1BCPB 3FEWX 2EJMA 3K5MA 5M5WB 1TIID 2AUJD 1F2ZA 5M3FB 1BCPC 2EY6A 5E4XA 2DNCA 2XN9C 5IGCA 2NN6I 1EEFD 2CQAA 5CYUA 3SE0A 1VDZA 1NAPA 3MA2B 2RSOA 1Y1WB 1DOKA 3W2DA 3Q24A 5C6AA 2BE5D 4IFDJ 1ONLA 4MIUA 2ICIA 4UAIA 3X3NA 2DN8A 1R9TB 3V2TA 1ET6A 5DM73 1WTOA 1STYA 3TSSA 3IKJA 2EYHA 3I70A 1STAA 2PZTA 4ZAIA 5KEEA 3J7AF 4IN3A 2Z4HA 2N55A 4BY1B 3GTGB 3BYTB 3KK7A 4HR7B 4O1NA 4KKSA 3VR4A 2K1BA 5I2YA 2LKVA 4HCEA 4J1MA 1UUPA 1O7ZA 3NQIA 2LMCB 2KECA 1EY9A 5FO8B 4LMQD 1SNPA 2K01A 5IIFA 3G7LA 2K05A 1I4HA 3RZOB 2EYMA 1HFGA 2F0PA 3HZXA 4FXKC 2F0IA 5KGUA 3LX0A 2EJFC 2JA6B 3NE5B 1M4VA 1EWHA 1B2TA 1EY5A 2EYFA 1CHPD 4FF4A 1TWCB 3BDLA 3DWAA 3Q0AA 1PFMA 3I91A 1CTMA 1IW7C 2D5DA 3M4YA 2PQEA 3CHBD 1AP0A 2EY1A 2F3WA 1PMRA 2F0GA 4CJ2C 1DM0B 3QOJA 3ITPA 2TMPA 1BUVT 2SNMA 5E4WC 5KNCA 4OHJA 1WTWA 3TP5A 3A56A 2EYJA 2NVTB 3SXHA 2QDBA 1TS4A 3S1MB 1DD2A 1WVLA 4LK1C 1BNZA 3SK8A 1YNJD 1PTOD 1DOMA 4R9WA 2LY7A 4ZKBB 3Q23A 1BR9A 5EPLA 2MGSA 1FD7D 4PV1C 4DA2A 1E2ZA 3RMHA 4DF7A 5EKLA 2WKDA 4N9PA 2IX0A 4OL7A 1FNVA 2Y0SB 2OT2A 4KKTA 1S5DD 1PFBA 3M7NA 4A3KB 2RVLA 1EY6A 4IUVA 3ERQA 4C3JB 2A6HD 4DXFA 3MXPA 1SNCA 2O4XA 3NUCA 1TQOA 2F0FA 4PMBA 2O5JC 4CJ1B 1SFOB 1WCMB 3I4NB 1FR3A 3I72A 1JORA 1EYCA 1EEID 2ZT9C 4IZ8A 1DZ1A 1BQQT 1O7LA 1GUGA 2EXZA 5DM63 4ZK9B 1D1KA 5ISRA 3HOUB 2VB2X 2FHTA 2NZ1D 1Y8OB 4XDXA 3NK9A 3BVGA 1CHQD 1PZID 4EGVA 1KNAA 2JXMB 1GUTA 1HA6A 2BA0A 2B2VA 5ELCA 4LAAA 3NWSA 3H91A 4XT1B 1STNA 1CA6A 3SVMA 4AYBB 4C56C 3OHXC 1G91A 1IKMA 3O13A 3C1FA 5I9PA 2F0KA 1HCZA 2EDGA 4K6DA 3T56B 1HA5A 1BBXC 4CKBA 5CBAE 1OO9B 5C0XG 4L63B 3HP3A 5IGEA 2RKSA 2EYOA 1PLFA 5COYA 3M3YB 4O42A 2B2WC 2JE6I 4NP5A 2WACA 3C46A 1SBBB 2MUYA 2LS01 4C3IB 1HUNA 3BS1A 1I3QB 1JICA 5AFWA 1SMYC 2WINB 3VR3A 3CRKC 4HMJA 4RKLA 1NR4A 2AQ3B 2ZXOA 1TR5A 3DUZA 1I6HB 1TY2A 5F2DA 1F9SA 3D4RA 5G3LF 2F03A 2B2VC 2BDNA 2R61A 2K28A 2YU9B 4ZYSA 4ZLTF 1SDFA 1YNJC 4X3KA 3VA5A 1TU2B 1V1PA 4RGOS 1L0YB 4A3JB 1JCKB 4IUUA 1I4QA 2SEBD 5M5YB 1UEAB 3GV6A 3MXGA 3OIPA 4C3JG 2JA7B 2WKCA 5EBDA 2FJ2A 1CQVA 3BG3A 3QIAA 4EQNA 2MPMA 2ICEC 4ZUIA 1X3PA 3K5LA 3NPPA 5ELEA 4KD3A 3I4LA 2PMZB 5EJWA 3PMFA 3CRLC 5I4DA 3L9AX 1E2WA 2R7ZB 1A3VA 2VXWA 3Q6SA 3IAYA 2HDLA 3NXWA 2AUKA 4FVMA 2A6HC 1Q12A 1NCVA 1B3AA 4DU9A 1YNND 1V43A 1HPCA 1K83B 1SYFA 2CW0C 1JOQA 4F7XA 1EY7A 4IFDI 2RQXA 3TBIB 4RWSC 3QJYA 3ZYYX 3M4OB 1MI2A 3MFGA 4KHVA 1TY0A 2NVYB 2R92B 1GXDC 3L7ZC 1SAPA 1V1PB 1SYCA 3F2UA 3KBXA 2WV6D 2KEDA 3NBIA 5D14A 4BA2I 2J4XA 3AU7A 3NP8A 1DXMA 5A2QL 1G8ZD 1EYAA 2JEAI 3RZDB 1B9MA 2Q8RE 1LT4D 1XTCD 2DY8A 4HCSA 1SJHD 5IT9E 2IPKD 3A8IE 1L0XB 3NTKA 3VYTA 2K5QA 2I07B 3SK4A 3S1QB 2K6AA 4CKCA 1SJED 3DHQA 2H1EA 2PZWA 1H9JA 5KYLA 4C3IG 1I6VC 1HUMA 1H9SA 3H3VC 3A54A 1OXXK 3D4DA 4A3BB 1AZQA 4R8NA 2K32A 4TKOB 3K6OA 3OMCA 1STEA 2K04A 3MWYW 3FVQA 1A3TA 1CA5A 2H4OA 3HKZB 5C5LA 4DK1A 2F0SA 1QE6A 3S9WA 3NSWA 1WTPA 1EWCA 4K5WA 1G2SA 5T1IA 1S5ED 5HGTA 4HEDA 2BA1A 3PV0A 4G7HC 1PRTF 3HG9A 1T5XD 5DEHA 3U9OA 3HOZB 1A3UA 2XWJB 4BWGB 2Q8IB 1HQMC 3RUZA 3A55A 2FMMA 2HCCA 1CQFA 4RCOA 5C4ZA 1RF2D 4NKLA 2AQ2B 2KCNA 2BCOA 3A8KE 5LL6S 1H9SB 3H09A 4K2KA 2D2CC 2JP1A 4K8IA 1ML0D 1PYWD 5ELBA 2F1MA 5EGTA 3Q22A 4U68A 1BCPF 1RCVD 3PO3B 4A3EB 2M2LA 3QO2A 2ZXPA 1S4ZA 3PIO3 2K7VA 4H44C 3MVVA 1YNNC 2L12A 4PQXA 1EY4A 2A73B 4V190 1HRJA 3J81L 3SHLA 1SNOA 2FFKB 5FLXE 1XXGA 4TSSA 1QWYA 2B2YA 2NVQB 1EL0A 3VR2A 5CV8A 5KNDA 4G7OC 3HS0C 3R2TA 3I73A 2JA8B 3R2IA 1KABA 3HOVB 4ZQ3A 4EVOA 4NDXA 2KQ3A 3PUWA 1DCZA 4OIJA 1A2TA 3C2PA 1EQVA 2KVMA 3K57A 2DNEA 2F3VA 2XRSD 4PMWA 3QWNA 4ZRZA 3D6WA 2J0TD 4V0BA 4A3GB 2WAQB 4FXGC 3P7JA 4P2CB 2E2JB 2A74C 3FKIB 1D5MC 3NHHA 4B9XA 5CR3A 3P20A 1RDPD 1PFNA 5C0XH 1ZYRD 5KIXA 3S1NB 2HQEA 4CJ0B 3URYA 2K5WA 1QNKA 1D5ZC 1Q1BA 2KCCA 2B2YC 2NTTA 1MBYA 3MTSA 2MP1A 3NQTA 2SOBA 3M7GA 2JA5B 5G3LD 2F0LA 1XYIA 3C1EA 4DN4M 4KTAA 4L8JA 4K6LA 4WRDA 3W3AA 4FYDA 2R6GA 1H9MA 5IODA 4ZKCB 2AWNA 5J1ZA 3PUVA 1D6EC 1VCIA 2PZUA 1W6KA 3SEBA 1SYGA 4XTCS 4KD4A 4F87A 4FF1A 3KLSA 4C2MB 1O80A 2B2TA 4M1UB 5T1GA 4G7ZC 2BOSA 1EIHA 5I6WA 3IFTA 3C3LA 5CV7A 4CBVA 1O7YA 5BN4A 4F88A 3GTJB 2B2WA 2Q8TA 1U4MA 3E0JA 4IURA 5M9OA 4HSVA 3VYRA 3K5NA 2F0HA 4ID6A 2NN6H 2AQ1B 1J8IA 2VNUD 5C5MA 2Z8LA 4X3TA 3QB3A 2EJGC 2OF1A 5EPKA 1F2YA 3MFYA 4ILWA 1MSHA 1WTXA 2AWOA 1K8OA 1A15A 3H94A 1TWGB 5EQ0A 2C9OA 2BE5C 4IUQA 1QG7A 1Y69U 2B8FA 2XSCA 3TN2A 3V05A 4A3IB 1LT5D 4IUPA 1EZ8A 2G9DA 5K36G 3HOXB 1F2LA 4XQJA 5IGGA 1BXTA 1QNUA 2M00A 1E0BA 2Z4IA 1RD9D 1XWEA 2SDFA 2L0CA 4HAEA 1E2VA 1CZWA 2EZVA 4RGTA 2B2TC 1BDOA 2IX1A 4Z9CB 4R8IA 4B9WA 3K59A 3FPPA 1C8CA 2A69D 3QG1A 3CU7A 3L3OC 3NBHA 4OO1G 1Y8NB 4QB4A 4IUTA 3LNNA 1SNQA 2X69A 4RAUC 3ND8A 3GV3A 1ESRA 4KN7C 1IYUA 1ZKOA 4FP5D 4A3MB 3R3OA 4KHZA 3MC0B 4EQPA 1EQTA 4CHTB 1PTOB 1KLUD 1TS5A 3RLFA 5EBCA 1HTLD 1A2UA 4Q5VA 1DYQA 1II3A 1KDAA 2E76C 3I3CA 4K2LA 1PTOC 5M3MB 1PTOH 3HOWB 4TQUS 2EY5A 1WD0A 2F0NA 3DEPA 3FPUB 1CFMA 3I4MB 4J6HA 4DNRB 4M8AA 3GD7A 1LTTD 3OMGA 3VR5A 1A6XA 1B53A 1EFID 2NN6G 2F0TA 2XRQD 2F4IA 3CKIB 4A3FB 3K58A 1JOKA 1WD1A 4FNFA 1EU4A 3GTLB 4A93B 3BVZA 3E6ZX 5IGFA 2B63B 1J9OA 1S5BD 2A6ED 4KI0A 1PZKD 3TDQA 2E2HB 1BCPD 1QJOA 3X3MA 3TZUA 4BBRB 4RCNA 2D9UA 5CV4A 4Y7NB 5JPNC 1G291 2FMCA 5E3FA 5FKAC 3A8JE 4OIKA 2MHVA 2A5HA 1FGBD 1X3QA 1GUOA 3DWPA 3LWEA 1GUWA 3D3RA 4KY6A 5E1FA 1F9RA 5FOBB 1VMCA 2PNRC 3PO2B 2ID0A 2EE1A 1IYVA 3J7AV 5C3XA 4U673 1PXUA 3S14B 2F0EA 1RKNA 2YYZA 1CZGA 3ND9A 2B39A 5IGBA 4WJWA 1H9RA 2L5TA 2MJ8A 1FYCA 2F0VA 4K14A 1STGA 3T16A 2WB1B 3M85A 1I4GA 2N88A 3SR1A 1R4PB 1C4QA 3TZDA 2PW7A 2RBMA 5CORA 2F0MA 4XT3B 1SE4A 2FINB 2B8GA 1KTKA 2KUMA 2LFNA 1F77A 1SE2A 5D3IB 1TT2A 5KNBA 1U4PA 1TVXA 1Y8PB 2PCFB 5C0XI 1EU3A 1Q1EA 2F0DA 3NWTA 3KUPA 2XNAC 1OXVA 4ZUJA 4YIJA 1DONA 3T53B 4G57A 3VR6A 3BDCA 1GOZA 1GUSA 1JE4A 1ENAA 1CI3M 1MD2D 5BN3A 5J39A 2IWHA 4H7BA 1K8MA 1D2BA 2HCIA 3I90A 4DAPA 2IT1A 1IL8A 4RHSA 1ZXTA 3D4WA 2QEJC 4WFN3 1D1IA 1VF7A 4RGNA 3OIQA 1SEBD 4KN4C 1B44D 3D6CA 2RDGA 1B9NA 1WTQA 3MZ5A 2R93B 4EQOA 4RGMA 5EKKA 4KV6A 2A6EC 3DXJC 4MN3A 1EZ6A 2PPBC 1HTPA 4C1NK 1JC7A 1U9RA 5JAVA 2L9HA 5I6YA 4C1NI 1X32A 5JJZA 3TP7A 1LTID 1VF5C 3DEOA 3IFDA 2QCPX 3GTKB 2BDOA 4IFDH 3S17B 1QCBD 3T51B 5CV6A 5JEAG 1R4QB 4PNYA 1QB5D 4G4KA 4GZYC 2F0UA 2O5IC 5LHY1 4QUFA 4A3DB 3K0YA 3MEHA 3RD4A 3SDZA 2IJ0A 2EYPA 3EROA 1B1ZA 1NUCA 5K36H 1AW7A 1TS2A 3FRPB 3T4AC 3D8GA 3J80L 1KDCA 5CGKA 3BZDB 2E2DC 4E6IA 2EVBA 3TMEA 4BS9A 3HRZC 4RKBA 5ELFA 4QIWB 1RJTA 1H9KA 1EY8A 4OGQC 3OWFA 4Q0FA 2EY2A 2K03A 3MHBA 3TP8A 2A68D 1LTSD 3GTMB 2G9HD 3S1RB 3VA7A 1I50B 1LLRD 2NWGA 3AMUA 2NBFA 3P1HA 1XX8A 5A2QE 1Z47A 4MHEA 3R93A 1FNWA 4JK1C 1RTOA 1UAPA 1ZEQX 3JAML 5C0XJ 3OWEB 2KJXA 5HURA 3KLSX 2F0WA 4FF3A 5I2XA 4I7ZC 5C4HA 5JPMC 4NMZA 5DNFA 2EOTA 1SMYD 2RSNA 1HXYD 5NUCA 4ABNA 2OEOA 1T5EA 2NYZD 4FF2A 1LV9A 4OO1H 3PUXA 4KY7A 4ME5A 4HTHA 1JWSD 1RTNA 3MXNA 1CK1A 3BDOA 2DY7A 4BY7B 1DJRD 1QOHA 1LTRD 1TWFB 1DOLA 4IALA 4J8QA 4C3HG 5CV5A 1LTGD 4IQZA 1Z7TA 5BN5A 2EYLA 3QOLA 5CBEE 3S2DB 3DWQA 1SNMA 2VUMB 1I4PA 4QMGA 2KEEA 2QF7A 2IX3A 1KLGD 5A35A 1TKWB 1PZJD 4BA1I 2XWBB 4KY5A 2TSSA 4XXEA 2D62A 3A7AB 2KHSA 4S3SA 1AEXA 5IOCA 3ONAB 1JWMD 3TP6A 1SYDA 2VB3X 4TRDA 2L55A 4N9TA 1SYEA 2RA4A 4IFDG 1W6JA 1G6ZA 3EA6A 1JQYD 2E74C 1U4LA 2I46A 3LWUA 5JVG3 3GTQB 3WDNA 5LL6X 2GA4B 3GP7A 2EPBA 3SK5A 4I65A 1IHZA 1EYDA 3N6RA 3NTHA 2HUGA 2CW0D 1KDBA 3VYUA 4DAYA 4DXGA 4L6TB 1I4RA 4QF4A 1QILA 4WORA 2K5DA 5IT9L 1LO5D 4RHRA 1MGSA 3K5OA 1BOSA 5EPJA 5C3EB 2PO4A 2CVRA 3P75A 2L11A 1U4RA 5I9OA 5IGDA 2HDMA 3EVQA 4RFBA 4DGZA 1F9PA 1JB3A 3BVMA 1Q90A 1HFNA 5JVH3 2CHBD 1SNDA 1OXTA 3DMUA 5TSSA 1I4XA 1LTBD 4HMIA 1M8AA 3J81E 3E5SA 1B4OA 1S5CD 2IL8A 2V4DA 2L4NA 5J22A 4XQQA 3S16B 3SK6A 4B08A 1GHKA 5CMDA 5K5PA 4CGYB 1GJXA 3U9SA 1NSNS 1NR2A 3KF8A 2PW5A 5FO9B 1Q8IA 2NTSA 3S2HB 3V96A 2A68C 3KLRA 4DNTB 4X3UA 3FMCA 3EJIA 1RHPA 3GTPB 5M5XB 1Z6HA 3HEJA 1EOTA 3J80E 1ZYRC 4XIGS 4HN7A 1ILQA 4HSPA 2ENBA 2QILA 3A7LA 3MAQA 5CC4A 1LACA 3OOCA 4ULLA 1RODA 3H0GB 5D3DA 3DM1A 2E75C 1WTVA 2M9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I7Z C;  2K33 A;  3VR2 A;  2B8G A;  2CW0 C;  2R6G A;  1H9M A;  1E2V A;  3OW7 A;  5KND A;  1T5E A;  2A6E D;  5JEA H;  2O5J C;  4LJZ C;  4G7O C;  4KI0 A;  4DK1 A;  4OO1 H;  3I73 A;  3PUV A;  3PUX A;  2EJF C;  3PUY A;  1BDO A;  3NE5 B;  1FR3 A;  3QJY A;  1VF5 C;  3OPO A;  1VCI A;  1EWH A;  3I72 A;  1SMY C;  1QJO A;  2BDO A;  4XTC S;  2ZT9 C;  3TZU A;  3FPP A;  2EJM A;  4IFD H;  1Q90 A;  4RCN A;  3BDO A;  3VR3 A;  5KNB A;  2A69 D;  1CTM A;  2BA1 A;  1IW7 C;  1DCZ A;  3CRK C;  3L7Z C;  3PUW A;  3PV0 A;  3QG1 A;  3T51 B;  1O7L A;  1Y8P B;  4G7H C;  2D5D A;  1GUG A;  5JEA G;  2PCF B;  3M4Y A;  1G29 1;  2AUJ D;  1OXT A;  4G7Z C;  4OO1 G;  4BA2 I;  1PMR A;  3IFT A;  1Q1E A;  2KA7 A;  4GZY C;  1DXM A;  1Y8N B;  3A8J E;  3AB9 A;  2DNC A;  2NN6 I;  2DNE A;  2Q8I B;  2O5I C;  4IQZ A;  3D31 A;  3GQB A;  2A69 C;  1IW7 D;  1Z7T A;  2V4D A;  5BN5 A;  3D4R A;  1HQM C;  3SE0 A;  5BN4 A;  1VDZ A;  1OXV A;  3LNN A;  2JEA I;  1B9M A;  1OXS C;  5KNC A;  1GUO A;  3T53 B;  1Y8O B;  1GHK A;  2NN6 H;  3ND8 A;  4KN7 C;  1YNJ C;  3SDZ A;  1IYU A;  3VR6 A;  1ZKO A;  4DK0 A;  2BE5 D;  2EJG C;  3A8K E;  1GJX A;  1ONL A;  3A8I E;  3U9S A;  1H9S B;  2QF7 A;  3EQL C;  3MFY A;  1TU2 B;  4H0L C;  4KHZ A;  1TKW B;  2JXM B;  4JBW A;  5A35 A;  1GUT A;  2PNR C;  5K36 H;  1GUS A;  2DN8 A;  1DD2 A;  2AWO A;  2D2C C;  4BA1 I;  2BA0 A;  1K8O A;  1CI3 M;  4LK1 C;  2D62 A;  5BN3 A;  3H94 A;  3A7A B;  1IYV A;  1LAB A;  4KMU C;  2F1M A;  3PUZ A;  1K8M A;  2A68 C;  2BE5 C;  3IKJ A;  3P20 A;  3KLR A;  4DNT B;  2EVB A;  3RLF A;  2IT1 A;  3BG3 A;  3QIA A;  1Y69 U;  2B8F A;  1O78 A;  3FMC A;  1H9K A;  5C0X H;  4IFD G;  3HGB A;  4OGQ C;  1H9J A;  1V8Q A;  2E74 C;  2YYZ A;  2E76 C;  1OXU A;  4PV1 C;  3ND9 A;  5K36 G;  3LWU A;  2A68 D;  1VF7 A;  3W3A A;  1Z6H A;  1I6V C;  4HR7 B;  4KKS A;  3WDN A;  1H9R A;  2L5T A;  3VA7 A;  1E2Z A;  1FYC A;  1H9S A;  2K7V A;  3VR4 A;  4KN4 C;  4TQU S;  4H44 C;  1GUN A;  1HCZ A;  2EDG A;  1YNN C;  1ZYR C;  3I4L A;  1OXX K;  4KKU A;  3T56 B;  3MXU A;  1CFM A;  1Q1B A;  2JEB I;  1E2W A;  2KCC A;  3CRL C;  4XIG S;  4DNR B;  3M85 A;  2AUK A;  5C0X G;  1B9N A;  2A6H C;  3GD7 A;  1Q12 A;  4KKT A;  3VR5 A;  3N6R A;  1A6X A;  3A7L A;  2LMC B;  4JK1 C;  2NN6 G;  1GHJ A;  1LAC A;  3OOC A;  3M7N A;  4H13 C;  1V43 A;  2K32 A;  1HPC A;  4TKO B;  2A6E C;  3DXJ C;  2PPB C;  4L8J A;  2E75 C;  1HTP A;  2A6H D;  2JE6 I; 
#chains in the Genus database with same CATH topology
 1OTC A;  3UDF A;  2B2U A;  1BBU A;  3CCL A;  3WOE A;  4KJO A;  1PTO F;  3ULL A;  4CKE A;  2C35 B;  3OW7 A;  2JN4 A;  2VUM G;  4LJZ C;  1PRT D;  1PH4 A;  3FDT A;  2L1B A;  3G6J B;  5JOB A;  3J7Y W;  3H0G H;  3HOY B;  3JAM E;  3OPO A;  4K5X A;  3UI2 A;  2N49 A;  3CPW A;  5GAG C;  1G2T A;  3D0F A;  1XPO A;  3R8B A;  3U4V A;  3NTI A;  2Y0S G;  4NW2 A;  1AZP A;  3KF8 B;  4KK7 A;  5FK9 C;  3HOY H;  1ILP A;  1HHV A;  4B3R L;  2NUC A;  4A3K G;  2KA7 A;  2ZXR A;  3AB9 A;  2E2I B;  1TS3 A;  4XYQ A;  2OXP A;  3D31 A;  4LF5 Q;  3K7A B;  3GTO B;  4PZ8 A;  3OSO A;  1E22 A;  2C5C A;  2J7Z A;  1OXS C;  1VMP A;  1PDQ A;  5C3W A;  5KYI A;  3KF6 B;  2ZM6 Q;  5FLX L;  1VS0 A;  1WCM G;  1LTA D;  1AFP A;  4JVZ A;  3I4N G;  2E2I H;  1BVS A;  2X6L A;  4H0L C;  2WII B;  1AE2 A;  4JBW A;  3K7A H;  3T13 A;  4BBS B;  1PYS B;  3GTO H;  3M4P A;  2JYO A;  4FO2 A;  1HNW L;  2F0J A;  3PIP 3;  4FXD A;  1HQR D;  4R4Q A;  1YVC A;  4GN4 B;  1STB A;  4KMU C;  4DAV A;  3PUZ A;  1BO0 A;  1U0L A;  1Y1V B;  5C44 B;  3CQZ B;  4GNX B;  1KC8 C;  1SXT A;  4DV2 L;  3KBG A;  2OQK A;  4ODG A;  5C3E G;  4YY3 L;  3VYS A;  5D65 A;  1V8Q A;  1VQO A;  4LF7 L;  1ESF A;  3TS0 A;  1TWA B;  2NB0 A;  2SNS A;  1Q86 C;  1F9Q A;  1Y1V H;  4DFA A;  3CQZ H;  1EIF A;  2IW3 A;  4DR1 Q;  5HY6 A;  4OWT B;  3MXU A;  1PV4 A;  4X62 L;  1HZC A;  1Q3L A;  5KRU A;  4YHH Q;  2K52 A;  4YCU A;  1SSO A;  4I7A A;  2B2U C;  1TWA H;  1BF4 A;  1X3F A;  1PYB A;  1T9H A;  1VQN A;  4QY7 A;  2RDH A;  1XNR Q;  1D5X C;  3OYY A;  3W5O A;  4GKK L;  2K33 A;  4UDU C;  5C4X B;  4JI1 Q;  1PH3 A;  3I4O A;  3S14 H;  3BYY B;  4R1J A;  3RNU A;  2XIW A;  2KOL A;  5JEA H;  4AYB G;  4QCL A;  5JEA J;  3PUY A;  1ENF A;  5GQO A;  1FJG L;  1XNQ Q;  1LT3 D;  1KRT A;  5C4X H;  4IPG A;  4Y52 H;  2WP8 J;  4XQN A;  3GO5 A;  3G4S A;  1Q81 C;  1QUQ A;  2F0O A;  1HJP A;  4DR5 Q;  4RA8 A;  4YWK A;  1STH A;  5ELD A;  3I56 A;  2YTV A;  3BZC A;  1VQH A;  3GQB A;  2A69 C;  1IW7 D;  1I5F A;  2R3Z A;  3S15 B;  2JSO A;  3EIV A;  3H6M A;  3T1Y Q;  3TRE A;  1JR0 D;  4JI8 Q;  1UNS A;  4F8M A;  1IKL A;  1S5F D;  4DK0 A;  1B50 A;  5CV9 A;  3EQL C;  4GLV B;  4UP8 A;  5FO7 B;  1SR3 A;  2X6G A;  3S15 H;  3F2D A;  1K73 C;  1UE1 A;  5C4J B;  2F0Q A;  4ALP A;  1LAB A;  3H0G G;  3IL8 A;  3WOF A;  1WTR A;  1EY0 A;  4GN5 A;  1B8A A;  1KNE A;  3TS2 A;  1AN8 A;  5FJ8 H;  1CM9 A;  1N9W A;  1O78 A;  2Z1C A;  3HGB A;  4KJN A;  1KAA A;  4K5V A;  1YIJ A;  4RH6 A;  1OXU A;  1FL0 A;  4X3S A;  4QUC A;  5C4J H;  4OO1 I;  4H02 A;  3HOY G;  3N52 A;  1GUN A;  2IY5 B;  1EIG A;  3E0E A;  4KKU A;  5IP9 H;  2VQF L;  2O2L D;  2JEB I;  1JOO A;  1PRT B;  4NXN Q;  3UDI A;  2ES2 A;  4JI2 L;  2PYK A;  3AEV A;  1SE3 A;  1GHJ A;  4XYO A;  1HNZ Q;  2XVS A;  4H13 C;  5DAU A;  3UE1 A;  1ICW A;  1F2M A;  1S40 A;  2JA7 G;  1PRT C;  2VL6 A;  2NVX B;  1ET9 A;  1QUQ B;  5EKI A;  4C3H B;  1TWH B;  3NEN A;  4A75 A;  1LT6 D;  3I8Z A;  4PMC A;  1JWU D;  2QKI C;  1PH6 A;  4IUN A;  2RDF A;  4HJ5 A;  1FNU A;  1V1O A;  1ENC A;  4QQB X;  4DV7 Q;  1CT1 D;  4K8J A;  2NVX H;  1MSG A;  1SYB A;  4C3H H;  4BBS G;  1TWH H;  3F2B A;  1GO3 E;  1C48 A;  3PF4 A;  3BZK A;  1M90 C;  3EFX D;  1L1O A;  1BCP B;  1MHW C;  3FEW X;  2EJM A;  3E9H A;  5C44 G;  2BH2 A;  4B3M L;  2E5L L;  3K5M A;  4LF6 L;  2VQE Q;  3CCE A;  5M5W B;  4LUO A;  1TII D;  5J3B A;  2AUJ D;  1F2Z A;  2WAQ E;  5M3F B;  1BCP C;  2EY6 A;  5E4X A;  2DNC A;  2XN9 C;  5IGC A;  2NN6 I;  3SGI A;  3WWV A;  1EEF D;  2CQA A;  2YTX A;  5CYU A;  4GOP A;  3SE0 A;  1VDZ A;  1NAP A;  3MA2 B;  2RSO A;  3CP0 A;  1EFW A;  2DUD A;  1Y1W B;  1DOK A;  3W2D A;  2K5V A;  3Q24 A;  4HJA A;  5C6A A;  5M3F H;  2BE5 D;  4IFD J;  1ONL A;  1RIP A;  2CH4 A;  4MIU A;  2ICI A;  4UAI A;  3X3N A;  2DN8 A;  1R9T B;  1SN8 A;  1LYL A;  2HHH Q;  3V2T A;  1ET6 A;  5DM7 3;  1WTO A;  1Y1W H;  1STY A;  3TSS A;  3IKJ A;  2EYH A;  3I70 A;  3S17 H;  5C4X G;  1STA A;  1S3O A;  2PZT A;  4ZAI A;  3RLO A;  5KEE A;  3J7A F;  1SRU A;  4IN3 A;  2Z4H A;  2N55 A;  1R9T H;  4BY1 B;  3GTG B;  5HGQ A;  3BYT B;  3KK7 A;  4NXM L;  4HR7 B;  4O1N A;  4KKS A;  2P5Z X;  3VR4 A;  2K1B A;  1XMO Q;  2G5D A;  5I2Y A;  2LKV A;  1K0S A;  4HCE A;  1N33 L;  4X64 L;  4J1M A;  4X66 L;  1UUP A;  1B7Y B;  1O7Z A;  3GTG H;  2XGT A;  3NQI A;  2LMC B;  4K0K Q;  3KLW A;  3TQY A;  1L1O B;  1E24 A;  2KEC A;  1EY9 A;  5FO8 B;  3STB D;  4LMQ D;  1VQC A;  4DR3 L;  1N34 L;  1SNP A;  2K01 A;  5IIF A;  1AE3 A;  2K05 A;  3G7L A;  1GVP A;  1I4H A;  1PVO A;  3RZO B;  2EYM A;  1HFG A;  2F0P A;  3HZX A;  4FXK C;  2F0I A;  4GOP B;  5KGU A;  3LX0 A;  4LUZ A;  2EJF C;  1P8L A;  2JA6 B;  5LMN L;  3NE5 B;  2Q2H A;  1M4V A;  1EWH A;  1B2T A;  1EY5 A;  2EYF A;  1CHP D;  1I50 H;  4FF4 A;  3RZO H;  1TWC B;  3BDL A;  3DWA A;  3Q0A A;  4GOP C;  1PH1 A;  1PFM A;  3I91 A;  1CTM A;  1GD7 A;  1IW7 C;  4JV5 Q;  2D5D A;  3M4Y A;  2PQE A;  3CHB D;  2JA6 H;  4APV A;  2EY1 A;  2F3W A;  1AP0 A;  1PMR A;  2F0G A;  4P71 A;  4UY8 C;  4CJ2 C;  1TWC H;  1DM0 B;  4MTN A;  3ICE A;  3QOJ A;  2JQO A;  2GN5 A;  3ITP A;  2TMP A;  1BUV T;  2SNM A;  1P16 A;  2PQA A;  1QVF A;  5E4W C;  5KNC A;  4OHJ A;  2OTJ A;  2OCE A;  1WTW A;  3TP5 A;  2MNA A;  3A56 A;  4DV0 Q;  2EYJ A;  2NVT B;  2MO0 A;  3SXH A;  2QDB A;  3I2Z A;  1TS4 A;  3S1M B;  1DD2 A;  1WVL A;  1I94 L;  4LK1 C;  4LFA L;  1BNZ A;  3SK8 A;  1UE5 A;  1JT8 A;  1YNJ D;  4JI4 Q;  1PTO D;  1DOM A;  4R9W A;  2LY7 A;  2A1A A;  2Z0S A;  4ZKB B;  3Q23 A;  4LF4 Q;  4YCV A;  2OTL A;  1BR9 A;  4DNI A;  2NVT H;  4GS3 A;  1Y14 B;  2GVB A;  5EPL A;  1KHI A;  2MGS A;  2ZTE A;  1HNX Q;  3J81 j;  1FD7 D;  3HOZ G;  3S1M H;  4UP9 A;  4PV1 C;  2JK8 A;  4DA2 A;  2UXD L;  1BKB A;  3H15 A;  4DR2 L;  1E2Z A;  3RMH A;  1VQM A;  4DF7 A;  5EKL A;  5LMN W;  2I5L X;  2WKD A;  1JJG A;  4JOI A;  1J6Q A;  4P72 A;  3CD6 A;  2RCF A;  4N9P A;  2IX0 A;  5GRO A;  4OL7 A;  5IP7 H;  1FNV A;  2Y0S B;  2OT2 A;  4KKT A;  2VUM H;  1KAW A;  1S5D D;  1N36 Q;  1PFB A;  1JB7 A;  3M7N A;  5M3F G;  1JJC B;  1Q8K A;  4A3K B;  2RVL A;  5ELN A;  1EY6 A;  4IUV A;  3ERQ A;  4C3J B;  2A6H D;  1WFQ A;  2NZO A;  3M9B A;  4DXF A;  3MXP A;  1D8L A;  1SNC A;  4JI6 Q;  1Y1W G;  1G6P A;  2O4X A;  3E9I A;  3NUC A;  1PHJ A;  1TQO A;  1AH9 A;  2F0F A;  4YCW A;  4PMB A;  2O5J C;  4CJ1 B;  1SFO B;  1WCM B;  4A3K H;  3I4N B;  4X65 Q;  1FR3 A;  4C3J H;  2PQA B;  3I72 A;  1JOR A;  1EYC A;  2FXQ A;  2QGQ A;  1EEI D;  2ZT9 C;  4IZ8 A;  4DV3 Q;  1DZ1 A;  1C0A A;  5JJL A;  4LF5 L;  1BQQ T;  1SFO H;  1O7L A;  1WCM H;  1GUG A;  2EXZ A;  3I4N H;  1VQI A;  5DM6 3;  4BY1 G;  4ZK9 B;  1D1K A;  2ZM6 L;  4A4I A;  3Q8D A;  5ISR A;  5IWA L;  4B3S Q;  2VB2 X;  2FHT A;  2RCN A;  3HOU B;  3PSI A;  1HZA A;  4DV4 L;  4ME3 A;  2NZ1 D;  4RG1 A;  3G48 A;  5DLQ E;  1Y8O B;  1VQL A;  2EQS A;  4XDX A;  3PIP A;  3L2P A;  4IO9 A;  3NK9 A;  3BVG A;  1CHQ D;  1PZI D;  4EGV A;  1JE5 A;  1KNA A;  2JXM B;  3AYH B;  1GUT A;  3HOU H;  1HA6 A;  2BA0 A;  3K81 C;  2B2V A;  4HJ7 A;  2N3S A;  5ELC A;  4LAA A;  3NWS A;  3H91 A;  3RN5 A;  4XT1 B;  3CCM A;  1STN A;  2Z6B A;  5BR8 Q;  3A5Z B;  2PI2 E;  4JOI C;  3CCJ A;  1CA6 A;  4JPB W;  3SVM A;  4AYB B;  4C56 C;  3OHX C;  3CAM A;  2HQL A;  4CDC C;  3O13 A;  1IKM A;  3C1F A;  1G91 A;  5I9P A;  2F0K A;  1HCZ A;  2EDG A;  1YHQ A;  2WFW A;  4K6D A;  3T56 B;  4A3G G;  1HA5 A;  1BBX C;  2WAQ G;  1YZ6 A;  4CKB A;  5CBA E;  1OO9 B;  5C0X G;  4B3T Q;  4L63 B;  3T1H Q;  4JI1 L;  3HP3 A;  5IGE A;  2RKS A;  1Q7Y C;  2EYO A;  1PLF A;  5COY A;  3M3Y B;  1PH2 A;  4O42 A;  2B2W C;  2JE6 I;  1XPU A;  4JBK A;  4NP5 A;  2WAC A;  3C46 A;  1E1O A;  4AIM A;  4X6A H;  1SBB B;  4WJ3 M;  2MUY A;  2LS0 1;  1RL2 A;  4C3I B;  1HUN A;  3OTO L;  4R4C A;  3BS1 A;  1IL2 A;  1I3Q B;  4DR5 L;  1JIC A;  4OX9 Q;  1IBL Q;  5AFW A;  1SMY C;  2N8N A;  2WIN B;  3VR3 A;  4LWC A;  3CRK C;  4LF9 L;  4HMJ A;  4LF8 Q;  4RKL A;  1NR4 A;  1I3Q H;  1EUJ A;  2AQ3 B;  2ZXO A;  4R4I A;  4DV1 Q;  5IP7 G;  3AQQ A;  1TR5 A;  3DUZ A;  1I6H B;  1TY2 A;  5F2D A;  1F9S A;  3D4R A;  5G3L F;  2F03 A;  1NMF A;  2QW7 A;  1UWV A;  2B2V C;  2BDN A;  2R61 A;  2K28 A;  2YU9 B;  4ZYS A;  4ZLT F;  1SDF A;  1YNJ C;  4DV5 L;  4X3K A;  4JI5 Q;  1ICF B;  3VA5 A;  1I6H H;  1TU2 B;  4OWX B;  1V1P A;  4RGO S;  1SE8 A;  1L0Y B;  4GKJ Q;  4A3J B;  1JCK B;  4IUU A;  1I4Q A;  2SEB D;  5M5Y B;  1UEA B;  3GV6 A;  3MXG A;  2YU9 H;  1N32 L;  3OIP A;  4C3J G;  2JA7 B;  2WKC A;  5EBD A;  2FJ2 A;  2MQH A;  1CQV A;  3BG3 A;  3QIA A;  1IZ6 A;  2UXB Q;  4EQN A;  1WI5 A;  4N8F A;  2V1C C;  2AKW B;  4UHV A;  4A3J H;  4DUZ Q;  2MPM A;  2ICE C;  4ZUI A;  1HH2 P;  5M5Y H;  2JA7 H;  1X3P A;  4P73 A;  3K5L A;  3NPP A;  5ELE A;  1HNZ L;  4KD3 A;  3I4L A;  2PMZ B;  5EJW A;  3PMF A;  3CRL C;  5I4D A;  3L9A X;  1E2W A;  3J81 c;  2R7Z B;  1A3V A;  2VXW A;  3Q6S A;  2DJG C;  3IAY A;  2HDL A;  3NXW A;  2AUK A;  4FVM A;  2A6H C;  3ULJ A;  1Q12 A;  1NCV A;  1L2F A;  1B3A A;  4DU9 A;  1YNN D;  1V43 A;  1HPC A;  4BBS H;  3TRZ A;  1K83 B;  4PZ7 A;  2R7Z H;  3HOU G;  1SYF A;  4CDD C;  1CKO A;  5C44 H;  2K75 A;  1Q46 A;  2CW0 C;  1JOQ A;  1J5E Q;  1IBM Q;  4F7X A;  1EY7 A;  1YEZ A;  4IFD I;  1O7I A;  2RQX A;  2VQE L;  1UE7 A;  3TBI B;  1K83 H;  2UUA Q;  4RWS C;  3QJY A;  3HKZ E;  2UUB L;  3ZYY X;  1WTH A;  3M4O B;  1MI2 A;  4JG2 A;  3MFG A;  4KHV A;  1TY0 A;  3U4Z A;  4AQY L;  2NVY B;  1XJV A;  2R92 B;  1GXD C;  3L7Z C;  1SAP A;  1V1P B;  1SYC A;  3F2U A;  3KBX A;  3J80 c;  2WV6 D;  3F2C A;  1QZH A;  4OWW B;  2KED A;  1B70 B;  3NBI A;  5D14 A;  4BA2 I;  2J4X A;  3AU7 A;  3NP8 A;  2LSS A;  1DXM A;  4R4O A;  3CC2 A;  5A2Q L;  3M4O H;  1G8Z D;  1EYA A;  2JEA I;  3EN2 A;  2NVY H;  3RZD B;  4JI3 Q;  2R92 H;  3KFU A;  1B9M A;  2Q8R E;  1LT4 D;  1XTC D;  3A74 A;  2DY8 A;  4HCS A;  1SJH D;  4DR4 Q;  5IT9 E;  3K0X A;  2IPK D;  1MIU A;  1W3S A;  5LMU Q;  3A8I E;  1E3P A;  1L0X B;  3NTK A;  3VYT A;  2K5Q A;  1BBW A;  2I07 B;  2UUC Q;  3K8A A;  3SK4 A;  3RZD H;  2KCM A;  2BH8 A;  1KQS A;  3JAM c;  3S1Q B;  2K6A A;  2UXC Q;  4CKC A;  1SJE D;  3DHQ A;  5JJK A;  2H1E A;  2PZW A;  1H9J A;  5KYL A;  2A8V A;  4UP7 A;  4C3I G;  4HJ9 A;  1I6V C;  4JCV E;  2F4V Q;  1HUM A;  1H9S A;  3S1Q H;  3H3V C;  3A54 A;  4NPS A;  1OXX K;  3D4D A;  1A62 A;  4A3B B;  3H3V H;  1AZQ A;  4R8N A;  1D7Q A;  3PF5 A;  1VQE A;  2XTI A;  1YJN A;  1VQK A;  2K32 A;  4TKO B;  4UPA A;  3K6O A;  3OMC A;  2L15 A;  4A3B H;  1STE A;  2GVA A;  2F52 A;  2K04 A;  3JC6 6;  3MWY W;  3FVQ A;  1K8A C;  1A3T A;  1WOC A;  1CA5 A;  2H4O A;  3HKZ B;  5C5L A;  4DK1 A;  1IXR A;  5M3M G;  2F0S A;  1QE6 A;  3S9W A;  3NSW A;  1WTP A;  1EWC A;  4B3R Q;  4K5W A;  1G2S A;  1HR0 L;  4A3J G;  2Q2I A;  5T1I A;  1NY4 A;  1S5E D;  5HGT A;  4HED A;  2BA1 A;  4DUY L;  3PV0 A;  4ZCK A;  4CDF C;  2ZJP A;  4G7H C;  1PRT F;  3HG9 A;  5L37 A;  4A3F G;  4L5R C;  2Z6K A;  2ZJR A;  1T5X D;  5DEH A;  3U9O A;  3HOZ B;  1A3U A;  2XWJ B;  3FP9 A;  4BWG B;  2Q8I B;  4DV0 L;  1S72 A;  1HQM C;  3LGJ A;  2B63 G;  3RUZ A;  3A55 A;  2FMM A;  2HCC A;  1CQF A;  2ALY B;  4RCO A;  5C4Z A;  3U58 A;  2R7Z G;  1RF2 D;  4NKL A;  2AQ2 B;  3HOZ H;  2Q2T A;  2KCN A;  2BCO A;  3A8K E;  5LL6 S;  4DV2 Q;  4LF4 L;  1H9S B;  3H09 A;  4K2K A;  2HIX A;  1IBK L;  2D2C C;  2JP1 A;  4K8I A;  1HNX L;  1ML0 D;  1PYW D;  3CW2 C;  5ELB A;  1C7Y A;  2F1M A;  1KL9 A;  5EGT A;  3Q22 A;  4U68 A;  1K3B C;  1BCP F;  1RCV D;  3PO3 B;  3CME A;  2K5N A;  5M5W H;  4A3E B;  2M2L A;  2DGY A;  4X62 Q;  3QO2 A;  1VQ8 A;  2ZXP A;  1S4Z A;  3PIO 3;  4EX5 A;  4DV6 L;  2K7V A;  3CCQ A;  4H44 C;  3MVV A;  1YNN C;  2L12 A;  3PO3 H;  4L5S A;  2KHI A;  4PQX A;  3AFP A;  1HR0 W;  4A3C H;  1EY4 A;  4JW0 A;  4A3E H;  2A73 B;  4QJF A;  4GKK Q;  2R92 G;  4V19 0;  1HRJ A;  3J81 L;  3PO2 G;  1U5K A;  1XTD A;  3SHL A;  1SNO A;  2FFK B;  5FLX E;  1XXG A;  2M9V A;  4TSS A;  1QWY A;  2B2Y A;  4A76 A;  2OQ0 A;  3ULP A;  2NVQ B;  1EL0 A;  1FJG Q;  3VR2 A;  5CV8 A;  4GLX A;  1X3E A;  5KND A;  4G7O C;  3HS0 C;  3R2T A;  3I73 A;  2JA8 B;  3R2I A;  4BY1 H;  1KAB A;  2Z6K C;  3HOV B;  4ZQ3 A;  4EVO A;  3M4Q A;  4NDX A;  2KQ3 A;  3PUW A;  4IPD A;  1DCZ A;  4OIJ A;  1A2T A;  3PCO B;  2YTY A;  2JA8 H;  3C2P A;  1EQV A;  2KVM A;  3ER0 A;  1CKM A;  3HOV H;  3K57 A;  2DNE A;  2F3V A;  2XRS D;  4PMW A;  3QWN A;  4ZRZ A;  1EIY B;  4A3B G;  3D6W A;  2J0T D;  4V0B A;  4A3G B;  4KHP L;  2WAQ B;  4FXG C;  1V9P A;  3P7J A;  4YWL A;  5BR8 L;  4P2C B;  1HZ9 A;  2E2J B;  1LUZ A;  2A74 C;  3FKI B;  1D5M C;  2OWO A;  3KJO A;  3NHH A;  4B9X A;  5CR3 A;  4A3G H;  3P20 A;  4MNO A;  3S24 A;  2H5X A;  1RDP D;  4JBJ A;  1PFN A;  2N78 A;  5C0X H;  1ZYR D;  5KIX A;  4HID A;  2VQF Q;  3S1N B;  1W2B A;  2HQE A;  4CJ0 B;  3HKZ G;  4L5T A;  2E2J H;  3URY A;  2K5W A;  1PH5 A;  3FKI H;  4DKA C;  1QVG A;  1VQF A;  1Q82 C;  2F3I A;  1QNK A;  2ZTC A;  2CCZ A;  4POG A;  1D5Z C;  5AJ3 L;  1Q1B A;  2KCC A;  2B2Y C;  2NTT A;  3S1N H;  1MBY A;  3MTS A;  2NZH A;  1CSQ A;  2MP1 A;  3NQT A;  4OON A;  2SOB A;  1H95 A;  1TXY A;  3NEL A;  3M7G A;  2JA5 B;  5G3L D;  3ERS X;  2F0L A;  4DR6 Q;  1XYI A;  3C1E A;  4DN4 M;  4KTA A;  4L8J A;  4K6L A;  4WRD A;  1QVC A;  3W3A A;  4LNQ A;  2K50 A;  3HKS A;  2VY3 A;  3F8T A;  3A0J A;  4FYD A;  1YNX A;  3G6E A;  2R6G A;  2R7F A;  1H9M A;  1ASY A;  1X56 A;  5IOD A;  2JA5 H;  4ZKC B;  3MEF A;  2AWN A;  5J1Z A;  2E5L Q;  4B3M Q;  3PUV A;  2VZA A;  2UU9 Q;  4LF8 L;  5FLX c;  5IYB G;  1D6E C;  1VCI A;  1JJ2 A;  2PZU A;  1W6K A;  3SEB A;  1SYG A;  4XTC S;  1GM5 A;  4CDE C;  4KD4 A;  4F87 A;  4FF1 A;  3KLS A;  1NMG A;  1NE3 A;  4C2M B;  1O80 A;  4A3L H;  3PO3 G;  2B2T A;  4A3C G;  4M1U B;  5T1G A;  4G7Z C;  4A3E G;  2BOS A;  1K9M C;  1HZB A;  1EIH A;  5I6W A;  3IFT A;  3C3L A;  5CV7 A;  4LW1 A;  4CBV A;  1O7Y A;  5BN4 A;  4F88 A;  3GTJ B;  2B2W A;  2Q8T A;  1U4M A;  3E0J A;  4C2M H;  4IUR A;  5M9O A;  4HSV A;  2I5H A;  4HIO A;  3VYR A;  3K5N A;  2F0H A;  4ID6 A;  2NN6 H;  2AQ1 B;  3IRB A;  1J8I A;  2VNU D;  5C5M A;  2Z8L A;  4X3T A;  3QB3 A;  2EJG C;  2OF1 A;  5EPK A;  1F2Y A;  2E8G A;  3MFY A;  4ILW A;  1MSH A;  1WTX A;  1XPR A;  3GTJ H;  2AWO A;  3KDF A;  1K8O A;  2MO1 A;  1A15 A;  2QA4 A;  3H94 A;  4NXM Q;  1TWG B;  5EQ0 A;  2C9O A;  4DUZ L;  2BE5 C;  5IE8 A;  4IUQ A;  3AFQ A;  2Z9H A;  4QGU A;  1QG7 A;  1Y69 U;  2B8F A;  2XSC A;  3TN2 A;  1N33 Q;  3V05 A;  3DLL A;  4A3I B;  1LT5 D;  4IUP A;  1E7Z A;  2AMC B;  1EZ8 A;  4YWM A;  2G9D A;  5K36 G;  3HOX B;  2JA8 G;  1F2L A;  4XQJ A;  5IGG A;  4JI7 Q;  2CWP A;  1BXT A;  1C9O A;  3HOV G;  1QNU A;  2JA9 A;  4DR3 Q;  4A3I H;  2M00 A;  1N34 Q;  2D0P A;  5IY0 A;  1KD1 C;  3CC4 A;  1JMC A;  1E0B A;  2Z4I A;  4AH6 A;  2IHE A;  3EBE A;  4O2D A;  1RD9 D;  4DR1 L;  1XWE A;  2SDF A;  3NEM A;  1IBM L;  1NJI C;  2L0C A;  1YIT A;  4YHH L;  3KYH C;  2UUA L;  4HAE A;  4JYA Q;  1E2V A;  1CZW A;  2EZV A;  1SMX A;  1XNR L;  1NNX A;  2PI2 A;  3STB C;  4RGT A;  4IJL A;  2B2T C;  1BDO A;  2IX1 A;  3CC7 A;  4Z9C B;  4R8I A;  4B9W A;  3K59 A;  3FKI G;  3FPP A;  1X55 A;  1C8C A;  1X6O A;  2A69 D;  3QG1 A;  5EAY A;  3CU7 A;  3L3O C;  3KDF B;  3NBH A;  4OO1 G;  1XNQ L;  1Y8N B;  5H1S E;  1K0R A;  4QB4 A;  5LMU L;  4IUT A;  3M3Y H;  3LNN A;  1SNQ A;  1A0I A;  2UUC L;  2X69 A;  4LFA Q;  4RAU C;  3ND8 A;  3GV3 A;  1ESR A;  4KN7 C;  1IYU A;  4HIK A;  1ZKO A;  4DAM A;  4FP5 D;  4A3M B;  3R3O A;  1YJW A;  2UXC L;  4KHZ A;  4C3I H;  2JA5 G;  3MC0 B;  4EQP A;  1EQT A;  2RF4 A;  4CHT B;  3T1Y L;  4KLK A;  4JI8 L;  2UXD Q;  1L0W A;  1PTO B;  1KLU D;  2PNH A;  1TS5 A;  4MZ9 A;  5EBC A;  3RLF A;  1HTL D;  4BY7 G;  2I0Q A;  1A2U A;  4Q5V A;  4A3M H;  2KCT A;  1DYQ A;  1II3 A;  3I7F A;  1KDA A;  2E76 C;  3I3C A;  4K2L A;  5GAD C;  1YI2 A;  2D0O A;  4A3L G;  1PTO C;  3GDE A;  4DR7 Q;  5M3M B;  1PTO H;  3HOW B;  4TQU S;  2EY5 A;  1WD0 A;  2F0N A;  3DEP A;  3FPU B;  2ZJQ A;  1CFM A;  4HJ8 A;  3I4M B;  4LFB Q;  4J6H A;  4DNR B;  4M8A A;  3GD7 A;  1LTT D;  3OMG A;  3VR5 A;  1A6X A;  1B53 A;  1EFI D;  2VS1 A;  2LXJ A;  2NN6 G;  3HFZ B;  2F0T A;  1EOV A;  2XRQ D;  5M3M H;  2F4I A;  2WB1 E;  3CKI B;  4A3F B;  3HOW H;  3BU2 A;  3K58 A;  1JOK A;  3G71 A;  1WD1 A;  4FNF A;  1EU4 A;  3GTL B;  4A93 B;  4DK3 C;  3I4M H;  3BVZ A;  4NXN L;  3E6Z X;  5IGF A;  4RMF A;  3NBH B;  2B63 B;  1J9O A;  1S5B D;  3K7U C;  2A6E D;  4A3F H;  4KI0 A;  1XMQ Q;  4JBM A;  3GTL H;  4A93 H;  1PZK D;  4HIM A;  1FGU A;  3TDQ A;  2E2H B;  4LFC Q;  1BCP D;  1VQP A;  1QJO A;  3X3M A;  3TZU A;  2B63 H;  4BBR B;  5IWA Q;  4RCN A;  2D9U A;  5CV4 A;  4Y7N B;  2CQO A;  4DV4 Q;  4DV7 L;  4JI0 Q;  5JPN C;  1PH9 A;  1G29 1;  4A3I G;  2FMC A;  5E3F A;  4FDB A;  5FKA C;  3A8J E;  2E2H H;  4OIK A;  3HOX G;  4BBR H;  2MHV A;  2A5H A;  4Y7N H;  1FGB D;  1NTG A;  3W1G A;  1X3Q A;  1GUO A;  3DWP A;  2ZTD A;  5FLM G;  4EQ5 A;  3LWE A;  4GNX C;  1GUW A;  3D3R A;  2CH4 W;  4KY6 A;  5E1F A;  1F9R A;  5FOB B;  1VMC A;  2PNR C;  3PO2 B;  2ID0 A;  2EE1 A;  4IOC A;  1IYV A;  3J7A V;  5C3X A;  4U67 3;  3RR5 A;  4PG3 A;  1PXU A;  3S14 B;  3PIO A;  1DGS A;  2F0E A;  3PO2 H;  1RKN A;  2HHH L;  2YYZ A;  1CZG A;  3ND9 A;  2B39 A;  1VQG A;  5IGB A;  3DM3 A;  4WJW A;  1H9R A;  2L5T A;  2MJ8 A;  3E3X A;  1FYC A;  1KIX A;  2F0V A;  4K14 A;  3B6Y A;  2B3G A;  1STG A;  3T16 A;  2WB1 B;  3M85 A;  2HD3 A;  1I4G A;  2N88 A;  3SR1 A;  3J7Z C;  1R4P B;  1C4Q A;  1CUK A;  3TZD A;  2PW7 A;  1B3Q A;  1VQJ A;  2RBM A;  5COR A;  1XMO L;  2F0M A;  4XT3 B;  3KOJ A;  4P75 A;  1SE4 A;  3OTO Q;  4O0A A;  1VQ6 A;  2FIN B;  2B8G A;  4K0K L;  1KTK A;  4LF9 Q;  4A3M G;  2KUM A;  1K3R A;  1EWI A;  2LFN A;  1F77 A;  1SE2 A;  5D3I B;  1TT2 A;  1A63 A;  5KNB A;  1GKH A;  1PFS A;  3K80 C;  2CKZ B;  1U4P A;  1TVX A;  1Y8P B;  4WJ4 A;  2PCF B;  5C0X I;  1EU3 A;  4DV5 Q;  1Q1E A;  1WYD A;  2F0D A;  3NWT A;  3KUP A;  4BXX H;  2XNA C;  1OXV A;  4ZUJ A;  3CCR A;  3HOW G;  4JV5 L;  2RHQ B;  4YIJ A;  1UE6 A;  2K4K A;  1DON A;  1X54 A;  3T53 B;  4G57 A;  3I4M G;  1N32 Q;  3VR6 A;  1YJ9 A;  1PA6 A;  3BDC A;  1GOZ A;  1WJJ A;  1GUS A;  1JE4 A;  3UDX A;  1ENA A;  1CI3 M;  1MD2 D;  4IPC A;  5BN3 A;  5J39 A;  2KBN A;  2IWH A;  4A93 G;  4H7B A;  1K8M A;  2R7D A;  1D2B A;  4IJH A;  3OW2 A;  2HCI A;  3I90 A;  4DAP A;  2IT1 A;  1IL8 A;  4RHS A;  3CCU A;  1ZXT A;  1QZG A;  3D4W A;  2QEJ C;  3CXC A;  1HNW Q;  4DK6 C;  4WFN 3;  1M1K C;  4JI4 L;  1D1I A;  1VF7 A;  4RGN A;  4QIW E;  3OIQ A;  3BJU A;  5GAH C;  1SEB D;  4KN4 C;  1X9N A;  1B44 D;  4YY3 Q;  4LF7 Q;  3D6C A;  4BBR G;  2JJQ A;  1PH7 A;  4DR6 L;  2RDG A;  3A5U A;  4QL5 A;  1MJE A;  1B9N A;  1A8V A;  3MZ5 A;  1WTQ A;  2R93 B;  4EQO A;  2EIF A;  4PZ6 A;  4RGM A;  5IT9 c;  5EKK A;  4KV6 A;  2A6E C;  5IYB H;  1Y1V G;  3DXJ C;  2DJF C;  1EZ6 A;  4MN3 A;  2PPB C;  1HTP A;  4C1N K;  1JC7 A;  2UU9 L;  1U9R A;  2UUB Q;  5JAV A;  2R93 H;  2L9H A;  5I6Y A;  3J81 i;  4C1N I;  1N36 L;  5GAE C;  4AQY Q;  1X32 A;  5JJZ A;  3TP7 A;  1LTI D;  1VF5 C;  3DEO A;  4R4T A;  3IFD A;  2QCP X;  4JI6 L;  3GTK B;  2BDO A;  2CFM A;  4IFD H;  3S17 B;  1QCB D;  1VQA A;  4LUV A;  3T51 B;  5CV6 A;  1N8R C;  4X65 L;  5JEA G;  1R4Q B;  4PNY A;  2EXD A;  1K8G A;  1QB5 D;  4G4K A;  4OEL B;  2F0U A;  4GZY C;  1G51 A;  2O5I C;  5LHY 1;  3GTK H;  4DV3 L;  1YBY A;  4QUF A;  2AHO B;  4A3D B;  3K0Y A;  2IHF A;  4NB3 A;  1X65 A;  1K28 A;  3MEH A;  2NVQ H;  1CSP A;  3RD4 A;  3SDZ A;  1KRS A;  2IJ0 A;  2WB1 G;  3J80 i;  2EYP A;  3ERO A;  3UDG A;  1B1Z A;  4B3S L;  1NUC A;  5K36 H;  1AW7 A;  1TS2 A;  3FRP B;  4A3D H;  3T4A C;  3F1Z A;  3UE0 A;  3D8G A;  5E7N A;  3J80 L;  1VQ9 A;  1KDC A;  5CGK A;  3BZD B;  1PH8 A;  2E2D C;  3RLN A;  4E6I A;  2EVB A;  3TME A;  4BS9 A;  4JI7 L;  3HRZ C;  4RKB A;  3U50 C;  5ELF A;  4QIW B;  1RJT A;  1H9K A;  1EY8 A;  2Y0S E;  4OGQ C;  2LXK A;  3OWF A;  4Q0F A;  2EY2 A;  2K03 A;  3MHB A;  3TP8 A;  2A68 D;  1LTS D;  3FHW A;  3GTM B;  2G9H D;  3S1R B;  3VA7 A;  3I55 A;  1EYG A;  1I50 B;  1LLR D;  2NWG A;  3AMU A;  1L1O C;  1LTL A;  2NBF A;  3P1H A;  5IYD H;  1XX8 A;  3JAM i;  4BXX G;  2MFI A;  5A2Q E;  1Z47 A;  5FJ8 G;  4N8X 1;  4MHE A;  3R93 A;  1FNW A;  4JK1 C;  3GTM H;  1IYJ B;  1RTO A;  3S1R H;  1UAP A;  1ZEQ X;  3JAM L;  4JYA L;  5C0X J;  3OWE B;  3TEH B;  2KJX A;  5HUR A;  5JJI A;  3KLS X;  1VQ7 A;  4JI2 Q;  2F0W A;  5IP9 G;  4FF3 A;  5I2X A;  4I7Z C;  3RN2 A;  4B3T L;  5C4H A;  5JPM C;  4NMZ A;  3T1H L;  4J15 A;  5DNF A;  2EOT A;  1HR0 Q;  1SMY D;  2RSN A;  1HXY D;  5NUC A;  3ZJY C;  4ABN A;  2OEO A;  1T5E A;  2NYZ D;  1VQ5 A;  4FF2 A;  1LV9 A;  4OO1 H;  4DUY Q;  2Q2U A;  3PUX A;  5IYC H;  4KY7 A;  2B29 A;  4ME5 A;  4HTH A;  1JWS D;  1RTN A;  3MXN A;  4IPH A;  1CK1 A;  3BDO A;  1EQR A;  2DY7 A;  4OX9 L;  4BY7 B;  1DJR D;  1IBL L;  1YHA A;  1QOH A;  3CCV A;  1LTR D;  1TWF B;  1DOL A;  4IAL A;  4J8Q A;  4C3H G;  5CV5 A;  3CMA A;  4LF6 Q;  1LTG D;  4IQZ A;  4GLA C;  1Z7T A;  5BN5 A;  2EYL A;  3QOL A;  4TVA B;  5CBE E;  1IBK Q;  1VQB A;  3S2D B;  1UEB A;  4P74 A;  3DWQ A;  1SNM A;  4BY7 H;  4DV1 L;  2VUM B;  1TWF H;  1I4P A;  4QMG A;  2KEE A;  2R93 G;  2QF7 A;  2IX3 A;  1KLG D;  1TKW B;  5A35 A;  1PZJ D;  3L0O A;  3KJP A;  4MTK A;  1MKH A;  4OXP A;  4BA1 I;  1E1T A;  2XWB B;  2TSS A;  3QR8 A;  4KY5 A;  5ELO A;  4XXE A;  4AYB E;  2D62 A;  3S2D H;  3A7A B;  2KHS A;  4S3S A;  1AEX A;  1SLJ A;  4JI5 L;  3ONA B;  5IOC A;  1JWM D;  4DR7 L;  3TP6 A;  4DV6 Q;  1SYD A;  2VB3 X;  4TRD A;  2QDL A;  2L55 A;  4N9T A;  1SYE A;  2RA4 A;  2YV5 A;  4OEM B;  4IFD G;  4GKJ L;  1W6J A;  1G6Z A;  3EA6 A;  1JQY D;  2E74 C;  1U4L A;  2I46 A;  4LFB L;  3LWU A;  5JVG 3;  3GTQ B;  1VQ4 A;  3WDN A;  5LL6 X;  2GA4 B;  4GN3 B;  3GP7 A;  2UXB L;  2EPB A;  3SK5 A;  4I65 A;  3W1B A;  1CKN A;  1FVI A;  1IHZ A;  2ATW A;  1EYD A;  3N6R A;  3NTH A;  1VQD A;  2HUG A;  2CW0 D;  3MXN B;  1NBW A;  3GTQ H;  1KDB A;  3VYU A;  4DAY A;  4DXG A;  4L6T B;  4X64 Q;  1I4R A;  4QF4 A;  4X66 Q;  1QIL A;  4WOR A;  1X3G A;  1XMQ L;  2K14 A;  2K5D A;  5IT9 L;  4A3D G;  1LO5 D;  1TWG H;  4RHR A;  1MGS A;  3K5O A;  1BOS A;  4POF A;  5EPJ A;  2CWA A;  4LFC L;  5C3E B;  2PO4 A;  1MJC A;  2CVR A;  3P75 A;  4L5Q A;  2L11 A;  1U4R A;  5I9O A;  4JI0 L;  5IGD A;  2KHJ A;  3HOX H;  2HDM A;  3EVQ A;  4RFB A;  2I5M X;  4DGZ A;  1F9P A;  4IOA A;  1JB3 A;  3BVM A;  1Q90 A;  5C3E H;  1J5E L;  2ASB A;  5FLM H;  1HFN A;  4DPG A;  5JVH 3;  2CHB D;  1SND A;  5LMN Q;  5IYD G;  1OXT A;  3DMU A;  5TSS A;  3CF5 A;  1I4X A;  1LTB D;  4KHP Q;  4HMI A;  1M8A A;  3J81 E;  3E5S A;  2A19 A;  1B4O A;  1KXL A;  1S5C D;  2HIV A;  2IL8 A;  2V4D A;  3J7A 5;  2L4N A;  5J22 A;  3CCS A;  4XQQ A;  3S16 B;  3SK6 A;  4B08 A;  2RHS B;  1GHK A;  5CMD A;  5K5P A;  4CGY B;  2JA6 G;  1GJX A;  3U9S A;  1NSN S;  1NR2 A;  4JI3 L;  3KF8 A;  3VDY A;  2PW5 A;  5FO9 B;  1CKN B;  1Q8I A;  5IYC G;  3S16 H;  2NTS A;  3PQI A;  4JC0 A;  3S2H B;  3V96 A;  4DR4 L;  2A68 C;  2PMZ E;  3KLR A;  4DNT B;  1V1Q A;  4X3U A;  4DAY B;  3PGZ A;  2QEX A;  3FMC A;  3EJI A;  5AJ3 Q;  1I94 Q;  1RHP A;  3GTP B;  1ASZ A;  1EQQ A;  5M5X B;  3KF6 A;  3H3V I;  2KEN A;  1Z6H A;  3HEJ A;  3S2H H;  1EOT A;  1LM0 A;  3J80 E;  1ZYR C;  1YHB A;  4XIG S;  2K5H A;  3GTP H;  4HN7 A;  1ILQ A;  2HT1 A;  4HSP A;  5M5X H;  2ENB A;  3CPF A;  2QIL A;  4GNX A;  4DR2 Q;  3A7L A;  3MAQ A;  2F4V L;  5CC4 A;  1LAC A;  3OOC A;  4ULL A;  1ROD A;  2VW9 A;  3H0G B;  5D3D A;  3DM1 A;  2E75 C;  1WTV A;  1SRO A;  1Z9F A; 
#chains in the Genus database with same CATH homology
 2B2U A;  3WOE A;  4KJO A;  1PTO F;  4CKE A;  3OW7 A;  4LJZ C;  1PRT D;  3FDT A;  2L1B A;  3G6J B;  5JOB A;  3J7Y W;  3HOY B;  3JAM E;  3OPO A;  4K5X A;  3UI2 A;  1G2T A;  3R8B A;  3NTI A;  4NW2 A;  1AZP A;  4KK7 A;  5FK9 C;  1ILP A;  1HHV A;  2NUC A;  2KA7 A;  2ZXR A;  3AB9 A;  2E2I B;  1TS3 A;  4XYQ A;  2OXP A;  3D31 A;  3K7A B;  3GTO B;  3OSO A;  2C5C A;  2J7Z A;  1OXS C;  1VMP A;  1PDQ A;  5C3W A;  5KYI A;  5FLX L;  1LTA D;  1AFP A;  2X6L A;  4H0L C;  2WII B;  4JBW A;  3T13 A;  4BBS B;  2JYO A;  4FO2 A;  2F0J A;  3PIP 3;  4FXD A;  1HQR D;  1STB A;  4KMU C;  4DAV A;  3PUZ A;  1BO0 A;  5C44 B;  1Y1V B;  3CQZ B;  1SXT A;  3KBG A;  4ODG A;  3VYS A;  5D65 A;  1V8Q A;  1ESF A;  1TWA B;  2NB0 A;  2SNS A;  1F9Q A;  4DFA A;  2IW3 A;  3MXU A;  1Q3L A;  5KRU A;  1SSO A;  2B2U C;  1BF4 A;  2RDH A;  1D5X C;  2K33 A;  4UDU C;  5C4X B;  3BYY B;  2XIW A;  2KOL A;  5JEA H;  4QCL A;  5JEA J;  3PUY A;  1ENF A;  1LT3 D;  2WP8 J;  4XQN A;  3GO5 A;  2F0O A;  4RA8 A;  1STH A;  5ELD A;  3GQB A;  2A69 C;  1IW7 D;  2R3Z A;  3S15 B;  2JSO A;  3H6M A;  1JR0 D;  1UNS A;  4F8M A;  1IKL A;  1S5F D;  4DK0 A;  1B50 A;  5CV9 A;  3EQL C;  5FO7 B;  2X6G A;  5C4J B;  2F0Q A;  1LAB A;  3IL8 A;  3WOF A;  1WTR A;  1EY0 A;  1KNE A;  1AN8 A;  1CM9 A;  1O78 A;  2Z1C A;  3HGB A;  4KJN A;  1KAA A;  4K5V A;  4RH6 A;  1OXU A;  4X3S A;  4QUC A;  4OO1 I;  3N52 A;  1GUN A;  1EIG A;  4KKU A;  2O2L D;  2JEB I;  1JOO A;  1PRT B;  2PYK A;  1SE3 A;  1GHJ A;  4XYO A;  2XVS A;  4H13 C;  5DAU A;  1ICW A;  1F2M A;  1PRT C;  2NVX B;  1ET9 A;  5EKI A;  4C3H B;  1TWH B;  1LT6 D;  3I8Z A;  4PMC A;  1JWU D;  2QKI C;  4IUN A;  2RDF A;  1FNU A;  1V1O A;  1ENC A;  1CT1 D;  4K8J A;  1MSG A;  1SYB A;  1C48 A;  3EFX D;  1BCP B;  3FEW X;  2EJM A;  3K5M A;  5M5W B;  1TII D;  2AUJ D;  1F2Z A;  5M3F B;  1BCP C;  2EY6 A;  5E4X A;  2DNC A;  2XN9 C;  5IGC A;  2NN6 I;  1EEF D;  2CQA A;  5CYU A;  3SE0 A;  1VDZ A;  1NAP A;  3MA2 B;  2RSO A;  1Y1W B;  1DOK A;  3W2D A;  3Q24 A;  5C6A A;  2BE5 D;  4IFD J;  1ONL A;  4MIU A;  2ICI A;  4UAI A;  3X3N A;  2DN8 A;  1R9T B;  3V2T A;  1ET6 A;  5DM7 3;  1WTO A;  1STY A;  3TSS A;  3IKJ A;  2EYH A;  3I70 A;  1STA A;  2PZT A;  4ZAI A;  5KEE A;  3J7A F;  4IN3 A;  2Z4H A;  2N55 A;  4BY1 B;  3GTG B;  3BYT B;  3KK7 A;  4HR7 B;  4O1N A;  4KKS A;  3VR4 A;  2K1B A;  5I2Y A;  2LKV A;  4HCE A;  4J1M A;  1UUP A;  1O7Z A;  3NQI A;  2LMC B;  2KEC A;  1EY9 A;  5FO8 B;  4LMQ D;  1SNP A;  2K01 A;  5IIF A;  3G7L A;  2K05 A;  1I4H A;  3RZO B;  2EYM A;  1HFG A;  2F0P A;  3HZX A;  4FXK C;  2F0I A;  5KGU A;  3LX0 A;  2EJF C;  2JA6 B;  3NE5 B;  1M4V A;  1EWH A;  1B2T A;  1EY5 A;  2EYF A;  1CHP D;  4FF4 A;  1TWC B;  3BDL A;  3DWA A;  3Q0A A;  1PFM A;  3I91 A;  1CTM A;  1IW7 C;  2D5D A;  3M4Y A;  2PQE A;  3CHB D;  1AP0 A;  2EY1 A;  2F3W A;  1PMR A;  2F0G A;  4CJ2 C;  1DM0 B;  3QOJ A;  3ITP A;  2TMP A;  1BUV T;  2SNM A;  5E4W C;  5KNC A;  4OHJ A;  1WTW A;  3TP5 A;  3A56 A;  2EYJ A;  2NVT B;  3SXH A;  2QDB A;  1TS4 A;  3S1M B;  1DD2 A;  1WVL A;  4LK1 C;  1BNZ A;  3SK8 A;  1YNJ D;  1PTO D;  1DOM A;  4R9W A;  2LY7 A;  4ZKB B;  3Q23 A;  1BR9 A;  5EPL A;  2MGS A;  1FD7 D;  4PV1 C;  4DA2 A;  1E2Z A;  3RMH A;  4DF7 A;  5EKL A;  2WKD A;  4N9P A;  2IX0 A;  4OL7 A;  1FNV A;  2Y0S B;  2OT2 A;  4KKT A;  1S5D D;  1PFB A;  3M7N A;  4A3K B;  2RVL A;  1EY6 A;  4IUV A;  3ERQ A;  4C3J B;  2A6H D;  4DXF A;  3MXP A;  1SNC A;  2O4X A;  3NUC A;  1TQO A;  2F0F A;  4PMB A;  2O5J C;  4CJ1 B;  1SFO B;  1WCM B;  3I4N B;  1FR3 A;  3I72 A;  1JOR A;  1EYC A;  1EEI D;  2ZT9 C;  4IZ8 A;  1DZ1 A;  1BQQ T;  1O7L A;  1GUG A;  2EXZ A;  5DM6 3;  4ZK9 B;  1D1K A;  5ISR A;  3HOU B;  2VB2 X;  2FHT A;  2NZ1 D;  1Y8O B;  4XDX A;  3NK9 A;  3BVG A;  1CHQ D;  1PZI D;  4EGV A;  1KNA A;  2JXM B;  1GUT A;  1HA6 A;  2BA0 A;  2B2V A;  5ELC A;  4LAA A;  3NWS A;  3H91 A;  4XT1 B;  1STN A;  1CA6 A;  3SVM A;  4AYB B;  4C56 C;  3OHX C;  1G91 A;  1IKM A;  3O13 A;  3C1F A;  5I9P A;  2F0K A;  1HCZ A;  2EDG A;  4K6D A;  3T56 B;  1HA5 A;  1BBX C;  4CKB A;  5CBA E;  1OO9 B;  5C0X G;  4L63 B;  3HP3 A;  5IGE A;  2RKS A;  2EYO A;  1PLF A;  5COY A;  3M3Y B;  4O42 A;  2B2W C;  2JE6 I;  4NP5 A;  2WAC A;  3C46 A;  1SBB B;  2MUY A;  2LS0 1;  4C3I B;  1HUN A;  3BS1 A;  1I3Q B;  1JIC A;  5AFW A;  1SMY C;  2WIN B;  3VR3 A;  3CRK C;  4HMJ A;  4RKL A;  1NR4 A;  2AQ3 B;  2ZXO A;  1TR5 A;  3DUZ A;  1I6H B;  1TY2 A;  5F2D A;  1F9S A;  3D4R A;  5G3L F;  2F03 A;  2B2V C;  2BDN A;  2R61 A;  2K28 A;  2YU9 B;  4ZYS A;  4ZLT F;  1SDF A;  1YNJ C;  4X3K A;  3VA5 A;  1TU2 B;  1V1P A;  4RGO S;  1L0Y B;  4A3J B;  1JCK B;  4IUU A;  1I4Q A;  2SEB D;  5M5Y B;  1UEA B;  3GV6 A;  3MXG A;  3OIP A;  4C3J G;  2JA7 B;  2WKC A;  5EBD A;  2FJ2 A;  1CQV A;  3BG3 A;  3QIA A;  4EQN A;  2MPM A;  2ICE C;  4ZUI A;  1X3P A;  3K5L A;  3NPP A;  5ELE A;  4KD3 A;  3I4L A;  2PMZ B;  5EJW A;  3PMF A;  3CRL C;  5I4D A;  3L9A X;  1E2W A;  2R7Z B;  1A3V A;  2VXW A;  3Q6S A;  3IAY A;  2HDL A;  3NXW A;  2AUK A;  4FVM A;  2A6H C;  1Q12 A;  1NCV A;  1B3A A;  4DU9 A;  1YNN D;  1V43 A;  1HPC A;  1K83 B;  1SYF A;  2CW0 C;  1JOQ A;  4F7X A;  1EY7 A;  4IFD I;  2RQX A;  3TBI B;  4RWS C;  3QJY A;  3ZYY X;  3M4O B;  1MI2 A;  3MFG A;  4KHV A;  1TY0 A;  2NVY B;  2R92 B;  1GXD C;  3L7Z C;  1SAP A;  1V1P B;  1SYC A;  3F2U A;  3KBX A;  2WV6 D;  2KED A;  3NBI A;  5D14 A;  4BA2 I;  2J4X A;  3AU7 A;  3NP8 A;  1DXM A;  5A2Q L;  1G8Z D;  1EYA A;  2JEA I;  3RZD B;  1B9M A;  2Q8R E;  1LT4 D;  1XTC D;  2DY8 A;  4HCS A;  1SJH D;  5IT9 E;  2IPK D;  3A8I E;  1L0X B;  3NTK A;  3VYT A;  2K5Q A;  2I07 B;  3SK4 A;  3S1Q B;  2K6A A;  4CKC A;  1SJE D;  3DHQ A;  2H1E A;  2PZW A;  1H9J A;  5KYL A;  4C3I G;  1I6V C;  1HUM A;  1H9S A;  3H3V C;  3A54 A;  1OXX K;  3D4D A;  4A3B B;  1AZQ A;  4R8N A;  2K32 A;  4TKO B;  3K6O A;  3OMC A;  1STE A;  2K04 A;  3MWY W;  3FVQ A;  1A3T A;  1CA5 A;  2H4O A;  3HKZ B;  5C5L A;  4DK1 A;  2F0S A;  1QE6 A;  3S9W A;  3NSW A;  1WTP A;  1EWC A;  4K5W A;  1G2S A;  5T1I A;  1S5E D;  5HGT A;  4HED A;  2BA1 A;  3PV0 A;  4G7H C;  1PRT F;  3HG9 A;  1T5X D;  5DEH A;  3U9O A;  3HOZ B;  1A3U A;  2XWJ B;  4BWG B;  2Q8I B;  1HQM C;  3RUZ A;  3A55 A;  2FMM A;  2HCC A;  1CQF A;  4RCO A;  5C4Z A;  1RF2 D;  4NKL A;  2AQ2 B;  2KCN A;  2BCO A;  3A8K E;  5LL6 S;  1H9S B;  3H09 A;  4K2K A;  2D2C C;  2JP1 A;  4K8I A;  1ML0 D;  1PYW D;  5ELB A;  2F1M A;  5EGT A;  3Q22 A;  4U68 A;  1BCP F;  1RCV D;  3PO3 B;  4A3E B;  2M2L A;  3QO2 A;  2ZXP A;  1S4Z A;  3PIO 3;  2K7V A;  4H44 C;  3MVV A;  1YNN C;  2L12 A;  4PQX A;  1EY4 A;  2A73 B;  4V19 0;  1HRJ A;  3J81 L;  3SHL A;  1SNO A;  2FFK B;  5FLX E;  1XXG A;  4TSS A;  1QWY A;  2B2Y A;  2NVQ B;  1EL0 A;  3VR2 A;  5CV8 A;  5KND A;  4G7O C;  3HS0 C;  3R2T A;  3I73 A;  2JA8 B;  3R2I A;  1KAB A;  3HOV B;  4ZQ3 A;  4EVO A;  4NDX A;  2KQ3 A;  3PUW A;  1DCZ A;  4OIJ A;  1A2T A;  3C2P A;  1EQV A;  2KVM A;  3K57 A;  2DNE A;  2F3V A;  2XRS D;  4PMW A;  3QWN A;  4ZRZ A;  3D6W A;  2J0T D;  4V0B A;  4A3G B;  2WAQ B;  4FXG C;  3P7J A;  4P2C B;  2E2J B;  2A74 C;  3FKI B;  1D5M C;  3NHH A;  4B9X A;  5CR3 A;  3P20 A;  1RDP D;  1PFN A;  5C0X H;  1ZYR D;  5KIX A;  3S1N B;  2HQE A;  4CJ0 B;  3URY A;  2K5W A;  1QNK A;  1D5Z C;  1Q1B A;  2KCC A;  2B2Y C;  2NTT A;  1MBY A;  3MTS A;  2MP1 A;  3NQT A;  2SOB A;  3M7G A;  2JA5 B;  5G3L D;  2F0L A;  1XYI A;  3C1E A;  4DN4 M;  4KTA A;  4L8J A;  4K6L A;  4WRD A;  3W3A A;  4FYD A;  2R6G A;  1H9M A;  5IOD A;  4ZKC B;  2AWN A;  5J1Z A;  3PUV A;  1D6E C;  1VCI A;  2PZU A;  1W6K A;  3SEB A;  1SYG A;  4XTC S;  4KD4 A;  4F87 A;  4FF1 A;  3KLS A;  4C2M B;  1O80 A;  2B2T A;  4M1U B;  5T1G A;  4G7Z C;  2BOS A;  1EIH A;  5I6W A;  3IFT A;  3C3L A;  5CV7 A;  4CBV A;  1O7Y A;  5BN4 A;  4F88 A;  3GTJ B;  2B2W A;  2Q8T A;  1U4M A;  3E0J A;  4IUR A;  5M9O A;  4HSV A;  3VYR A;  3K5N A;  2F0H A;  4ID6 A;  2NN6 H;  2AQ1 B;  1J8I A;  2VNU D;  5C5M A;  2Z8L A;  4X3T A;  3QB3 A;  2EJG C;  2OF1 A;  5EPK A;  1F2Y A;  3MFY A;  4ILW A;  1MSH A;  1WTX A;  2AWO A;  1K8O A;  1A15 A;  3H94 A;  1TWG B;  5EQ0 A;  2C9O A;  2BE5 C;  4IUQ A;  1QG7 A;  1Y69 U;  2B8F A;  2XSC A;  3TN2 A;  3V05 A;  4A3I B;  1LT5 D;  4IUP A;  1EZ8 A;  2G9D A;  5K36 G;  3HOX B;  1F2L A;  4XQJ A;  5IGG A;  1BXT A;  1QNU A;  2M00 A;  1E0B A;  2Z4I A;  1RD9 D;  1XWE A;  2SDF A;  2L0C A;  4HAE A;  1E2V A;  1CZW A;  2EZV A;  4RGT A;  2B2T C;  1BDO A;  2IX1 A;  4Z9C B;  4R8I A;  4B9W A;  3K59 A;  3FPP A;  1C8C A;  2A69 D;  3QG1 A;  3CU7 A;  3L3O C;  3NBH A;  4OO1 G;  1Y8N B;  4QB4 A;  4IUT A;  3LNN A;  1SNQ A;  2X69 A;  4RAU C;  3ND8 A;  3GV3 A;  1ESR A;  4KN7 C;  1IYU A;  1ZKO A;  4FP5 D;  4A3M B;  3R3O A;  4KHZ A;  3MC0 B;  4EQP A;  1EQT A;  4CHT B;  1PTO B;  1KLU D;  1TS5 A;  3RLF A;  5EBC A;  1HTL D;  1A2U A;  4Q5V A;  1DYQ A;  1II3 A;  1KDA A;  2E76 C;  3I3C A;  4K2L A;  1PTO C;  5M3M B;  1PTO H;  3HOW B;  4TQU S;  2EY5 A;  1WD0 A;  2F0N A;  3DEP A;  3FPU B;  1CFM A;  3I4M B;  4J6H A;  4DNR B;  4M8A A;  3GD7 A;  1LTT D;  3OMG A;  3VR5 A;  1A6X A;  1B53 A;  1EFI D;  2NN6 G;  2F0T A;  2XRQ D;  2F4I A;  3CKI B;  4A3F B;  3K58 A;  1JOK A;  1WD1 A;  4FNF A;  1EU4 A;  3GTL B;  4A93 B;  3BVZ A;  3E6Z X;  5IGF A;  2B63 B;  1J9O A;  1S5B D;  2A6E D;  4KI0 A;  1PZK D;  3TDQ A;  2E2H B;  1BCP D;  1QJO A;  3X3M A;  3TZU A;  4BBR B;  4RCN A;  2D9U A;  5CV4 A;  4Y7N B;  5JPN C;  1G29 1;  2FMC A;  5E3F A;  5FKA C;  3A8J E;  4OIK A;  2MHV A;  2A5H A;  1FGB D;  1X3Q A;  1GUO A;  3DWP A;  3LWE A;  1GUW A;  3D3R A;  4KY6 A;  5E1F A;  1F9R A;  5FOB B;  1VMC A;  2PNR C;  3PO2 B;  2ID0 A;  2EE1 A;  1IYV A;  3J7A V;  5C3X A;  4U67 3;  1PXU A;  3S14 B;  2F0E A;  1RKN A;  2YYZ A;  1CZG A;  3ND9 A;  2B39 A;  5IGB A;  4WJW A;  1H9R A;  2L5T A;  2MJ8 A;  1FYC A;  2F0V A;  4K14 A;  1STG A;  3T16 A;  2WB1 B;  3M85 A;  1I4G A;  2N88 A;  3SR1 A;  1R4P B;  1C4Q A;  3TZD A;  2PW7 A;  2RBM A;  5COR A;  2F0M A;  4XT3 B;  1SE4 A;  2FIN B;  2B8G A;  1KTK A;  2KUM A;  2LFN A;  1F77 A;  1SE2 A;  5D3I B;  1TT2 A;  5KNB A;  1U4P A;  1TVX A;  1Y8P B;  2PCF B;  5C0X I;  1EU3 A;  1Q1E A;  2F0D A;  3NWT A;  3KUP A;  2XNA C;  1OXV A;  4ZUJ A;  4YIJ A;  1DON A;  3T53 B;  4G57 A;  3VR6 A;  3BDC A;  1GOZ A;  1GUS A;  1JE4 A;  1ENA A;  1CI3 M;  1MD2 D;  5BN3 A;  5J39 A;  2IWH A;  4H7B A;  1K8M A;  1D2B A;  2HCI A;  3I90 A;  4DAP A;  2IT1 A;  1IL8 A;  4RHS A;  1ZXT A;  3D4W A;  2QEJ C;  4WFN 3;  1D1I A;  1VF7 A;  4RGN A;  3OIQ A;  1SEB D;  4KN4 C;  1B44 D;  3D6C A;  2RDG A;  1B9N A;  1WTQ A;  3MZ5 A;  2R93 B;  4EQO A;  4RGM A;  5EKK A;  4KV6 A;  2A6E C;  3DXJ C;  4MN3 A;  1EZ6 A;  2PPB C;  1HTP A;  4C1N K;  1JC7 A;  1U9R A;  5JAV A;  2L9H A;  5I6Y A;  4C1N I;  1X32 A;  5JJZ A;  3TP7 A;  1LTI D;  1VF5 C;  3DEO A;  3IFD A;  2QCP X;  3GTK B;  2BDO A;  4IFD H;  3S17 B;  1QCB D;  3T51 B;  5CV6 A;  5JEA G;  1R4Q B;  4PNY A;  1QB5 D;  4G4K A;  4GZY C;  2F0U A;  2O5I C;  5LHY 1;  4QUF A;  4A3D B;  3K0Y A;  3MEH A;  3RD4 A;  3SDZ A;  2IJ0 A;  2EYP A;  3ERO A;  1B1Z A;  1NUC A;  5K36 H;  1AW7 A;  1TS2 A;  3FRP B;  3T4A C;  3D8G A;  3J80 L;  1KDC A;  5CGK A;  3BZD B;  2E2D C;  4E6I A;  2EVB A;  3TME A;  4BS9 A;  3HRZ C;  4RKB A;  5ELF A;  4QIW B;  1RJT A;  1H9K A;  1EY8 A;  4OGQ C;  3OWF A;  4Q0F A;  2EY2 A;  2K03 A;  3MHB A;  3TP8 A;  2A68 D;  1LTS D;  3GTM B;  2G9H D;  3S1R B;  3VA7 A;  1I50 B;  1LLR D;  2NWG A;  3AMU A;  2NBF A;  3P1H A;  1XX8 A;  5A2Q E;  1Z47 A;  4MHE A;  3R93 A;  1FNW A;  4JK1 C;  1RTO A;  1UAP A;  1ZEQ X;  3JAM L;  5C0X J;  3OWE B;  2KJX A;  5HUR A;  3KLS X;  2F0W A;  4FF3 A;  5I2X A;  4I7Z C;  5C4H A;  5JPM C;  4NMZ A;  5DNF A;  2EOT A;  1SMY D;  2RSN A;  1HXY D;  5NUC A;  4ABN A;  2OEO A;  1T5E A;  2NYZ D;  4FF2 A;  1LV9 A;  4OO1 H;  3PUX A;  4KY7 A;  4ME5 A;  4HTH A;  1JWS D;  1RTN A;  3MXN A;  1CK1 A;  3BDO A;  2DY7 A;  4BY7 B;  1DJR D;  1QOH A;  1LTR D;  1TWF B;  1DOL A;  4IAL A;  4J8Q A;  4C3H G;  5CV5 A;  1LTG D;  4IQZ A;  1Z7T A;  5BN5 A;  2EYL A;  3QOL A;  5CBE E;  3S2D B;  3DWQ A;  1SNM A;  2VUM B;  1I4P A;  4QMG A;  2KEE A;  2QF7 A;  2IX3 A;  1KLG D;  5A35 A;  1TKW B;  1PZJ D;  4BA1 I;  2XWB B;  4KY5 A;  2TSS A;  4XXE A;  2D62 A;  3A7A B;  2KHS A;  4S3S A;  1AEX A;  5IOC A;  3ONA B;  1JWM D;  3TP6 A;  1SYD A;  2VB3 X;  4TRD A;  2L55 A;  4N9T A;  1SYE A;  2RA4 A;  4IFD G;  1W6J A;  1G6Z A;  3EA6 A;  1JQY D;  2E74 C;  1U4L A;  2I46 A;  3LWU A;  5JVG 3;  3GTQ B;  3WDN A;  5LL6 X;  2GA4 B;  3GP7 A;  2EPB A;  3SK5 A;  4I65 A;  1IHZ A;  1EYD A;  3N6R A;  3NTH A;  2HUG A;  2CW0 D;  1KDB A;  3VYU A;  4DAY A;  4DXG A;  4L6T B;  1I4R A;  4QF4 A;  1QIL A;  4WOR A;  2K5D A;  5IT9 L;  1LO5 D;  4RHR A;  1MGS A;  3K5O A;  1BOS A;  5EPJ A;  5C3E B;  2PO4 A;  2CVR A;  3P75 A;  2L11 A;  1U4R A;  5I9O A;  5IGD A;  2HDM A;  3EVQ A;  4RFB A;  4DGZ A;  1F9P A;  1JB3 A;  3BVM A;  1Q90 A;  1HFN A;  5JVH 3;  2CHB D;  1SND A;  1OXT A;  3DMU A;  5TSS A;  1I4X A;  1LTB D;  4HMI A;  1M8A A;  3J81 E;  3E5S A;  1B4O A;  1S5C D;  2IL8 A;  2V4D A;  2L4N A;  5J22 A;  4XQQ A;  3S16 B;  3SK6 A;  4B08 A;  1GHK A;  5CMD A;  5K5P A;  4CGY B;  1GJX A;  3U9S A;  1NSN S;  1NR2 A;  3KF8 A;  2PW5 A;  5FO9 B;  1Q8I A;  2NTS A;  3S2H B;  3V96 A;  2A68 C;  3KLR A;  4DNT B;  4X3U A;  3FMC A;  3EJI A;  1RHP A;  3GTP B;  5M5X B;  1Z6H A;  3HEJ A;  1EOT A;  3J80 E;  1ZYR C;  4XIG S;  4HN7 A;  1ILQ A;  4HSP A;  2ENB A;  2QIL A;  3A7L A;  3MAQ A;  5CC4 A;  1LAC A;  3OOC A;  4ULL A;  1ROD A;  3H0G B;  5D3D A;  3DM1 A;  2E75 C;  1WTV A;  2M9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...