1IBLL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1iblL00
3KOJA 4QGUA 2D0OA 2ZTDA 4OXPA 4BBRG 4B3MQ 1XJVA 4BBRH 1S72A 3HOYH 1SE8A 2EIFA 3F8TA 1I3QH 2MNAA 1AE2A 1SN8A 2I0QA 4AQYL 1NJIC 3BJUA 4JCVE 2E2IH 1AH9A 2NZOA 3BZKA 2IX1A 4DV0Q 4BA2I 3CCMA 4R4CA 1PH3A 3KJOA 1XPRA 1TWAH 5BR8Q 2A8VA 2Q2UA 4JV5L 1K9MC 5C4XG 4OWWB 5C4XH 4AH6A 4KI0A 4LUZA 3T1YQ 1HZCA 3HOWG 5GAHC 4MTNA 1PH5A 2D62A 1V43A 2E2HH 3HOWH 3PO2H 3A5ZB 3EN2A 4X65L 1PH2A 3E9HA 4P72A 1IZ6A 2CCZA 1FGUA 4JI4Q 4LFCQ 3VDYA 2ID0A 4R4OA 3S15H 1YEZA 1N33Q 1Q46A 4C2MH 3PIPA 3J80c 1TWHH 4GLXA 1UE1A 1V9PA 1E24A 5IP7H 1H95A 2KHJA 1JJCB 2YTXA 3CPFA 1W2BA 2QEXA 4A3DG 5M3MH 4KHZA 5M3FG 4GN4B 3G4SA 5M3FH 3PF5A 1YJWA 3HOUH 3HOUG 3HOZG 2GN5A 2B3GA 2N49A 4XIGS 4B3ML 1XNQL 3HOZH 1HNWQ 1NTGA 2CQOA 2K5VA 2NVYH 1ASZA 2JA5G 1KIXA 4YWMA 1VQBA 2JA5H 2JEBI 3H0GG 1V1QA 3H0GH 3EIVA 1K8GA 4OO1G 2KCMA 1RL2A 4PMWA 3HKZE 3J80i 4GNXB 3F2DA 2JEAI 4R4QA 1IXRA 1CUKA 2IHEA 2VW9A 3AQQA 1PH6A 4DR6Q 4DV0L 4HJAA 4A76A 2E2JH 4JI3Q 1I6HH 1BVSA 2OQKA 5BR8L 4POGA 1JJGA 1X54A 4L5TA 3OYYA 3T1YL 2LXJA 3RZOH 4DV4Q 1N34Q 3M3YH 3CP0A 3I2ZA 4DR4Q 1W3SA 5FLXc 1EQQA 1VQ5A 4LFCL 1YJNA 4JI4L 1Y1WG 1Q81C 4LF9Q 1Y1WH 1QVFA 1N33L 1HNXQ 4NPSA 4UP8A 2E8GA 2Z0SA 5ELOA 4DV7Q 4OX9Q 4LFBQ 2ZM6Q 4YWLA 3PGZA 4TVAB 1KRTA 3GTPH 1A62A 4YCUA 2IX0A 3E0EA 1HNWL 3S1QH 4DV5Q 1MJEA 4QIWE 4LW1A 3CCRA 2UUBQ 2JQOA 3J7ZC 4A93G 4A93H 2PI2E 2WAQE 1XTDA 3I7FA 2VNUD 1UE7A 4AIMA 2N8NA 4A3FH 1J6QA 4O2DA 4QY7A 1WI5A 4JG2A 4P75A 4RG1A 5GADC 5C44G 4PG3A 5C0XI 5H1SE 1YHAA 1L1OB 5J3BA 3U50C 1N36Q 1GM5A 2R6GA 4DR6L 4JBKA 3HKZG 1G51A 4UPAA 5M5XH 4IFDI 1PVOA 3B6YA 4C3JH 3DLLA 1HZAA 4JI3L 1I94Q 1LUZA 2PQAA 1TXYA 2FXQA 5E7NA 2AKWB 4KLKA 3RZDH 1B70B 1YHQA 1PH8A 2NN6G 4NXMQ 3M85A 4JI2Q 4BY7G 4DV4L 4BY7H 1N34L 3G48A 2IT1A 3PSIA 5DLQE 4DR4L 2IY5B 1X3FA 1PH9A 4IFDJ 1PFSA 3KJPA 4LF9L 4GKKQ 4BY1H 1K73C 2JJQA 3M7NA 1HNXL 2Q2IA 3W5OA 4LF5L 4LF6Q 3S1NH 2K14A 3M4OH 1YZ6A 5FLMG 4LFBL 4IJLA 4OX9L 2B29A 2ZM6L 1QVCA 4B3RQ 1K3RA 4DKAC 3HKSA 4LNQA 2UUAQ 3PUZA 4GKJQ 4GS3A 5JJKA 3GTGH 4DV5L 2H5XA 1VQ7A 5JEAJ 4GLVB 3I4NG 3S2HH 3I4NH 2UUBL 2OTLA 4PZ6A 5K36G 4H02A 1PH4A 2YTYA 3UDXA 4BA1I 4A3EG 1XMOQ 4A3EH 4B3TQ 3H3VH 2ASBA 4FDBA 2WAQG 4UP7A 3RR5A 5JJIA 1N36L 4NB3A 2QA4A 1C9OA 1PHJA 4JI0Q 2BH2A 3UE1A 1I94L 4DAYB 3AFPA 4UP9A 4HJ7A 3GTLH 4LUOA 1YNXA 3ULJA 4DK3C 1NE3A 1NBWA 2I5HA 3RN2A 4HIDA 2F3IA 4NXML 4P73A 4APVA 4JI2L 2VQFQ 3K7AH 1LM0A 3KF6A 4GLAC 3STBD 1KQSA 2I5MX 3CQZH 5C3EG 3PF4A 3L0OA 1CKNB 5C3EH 1D8LA 1I5FA 4GKKL 1JT8A 3GDEA 3S16H 2NZHA 2CFMA 4LF6L 2MQHA 2XTIA 4B3RL 4IOCA 1CKOA 1N8RC 2UUAL 3U58A 4GKJL 2UXCQ 1VQPA 1UE6A 2VQEQ 3ULPA 4IO9A 4Y52H 4DV1L 1Z47A 1VS0A 2WB1E 2KHIA 4QL5A 1J5EQ 1Z9FA 1VQMA 1A63A 1YJ9A 1KAWA 1WOCA 1OXUA 3I56A 1CSPA 4XTCS 2I5LX 2XGTA 2D0PA 5HY6A 1SMXA 5IP7G 1X3GA 4WJ4A 2JA7G 2VS1A 5M3MG 2JA7H 1TWGH 4OWXB 1Y1VG 1N9WA 5IYBH 1Y1VH 1JJ2A 4JI0L 4GN5A 4DR1Q 5GROA 1PYBA 1T9HA 2L15A 2A1AA 3PIOA 2C35B 4LUVA 1VQ8A 1GD7A 3CAMA 1L0WA 2VQFL 2ZJQA 2OWOA 1XPUA 2UXBQ 4TQUS 3I4OA 3PUVA 2R7DA 2K50A 4A3KH 3H15A 3G71A 1C7YA 2GVAA 4A3LG 4HIMA 1G6PA 3FHWA 2VUMH 4A3LH 4X66Q 3TQYA 2Q2HA 3S24A 4IPGA 4DV6Q 4A3MG 2OQ0A 4A3MH 1M1KC 3CF5A 3RLNA 4YCVA 3STBC 2ALYB 2K4KA 3KF8B 2A19A 3TS0A 3JAMc 2UXCL 4DR3Q 2HHHQ 4X62Q 3CW2C 2VQEL 3CCUA 1WJJA 3UDFA 1S3OA 4HIKA 1VQLA 3I4MH 1J5EL 2ES2A 4K0KQ 4BXXG 3RNUA 4BXXH 1FL0A 1TWCH 1U0LA 1KD1C 2WB1G 1VQAA 1FJGQ 1YIJA 4JI5Q 4LWCA 2CWPA 1IBKQ 2HIVA 1IBLQ 2UU9Q 3F1ZA 4HJ9A 1EUJA 3MXNB 4A3GG 4A3GH 4AYBE 4DR1L 1ASYA 3GTQH 3JAMi 1X56A 3NEMA 1FVIA 5IT9c 2KCTA 4QQBX 4OONA 2YU9H 4JBWA 1OXVA 3KFUA 2K5HA 2MFIA 4DUYQ 4A3FG 3NENA 1Q86C 4LF4Q 4DAMA 2NVXH 2UXBL 1VQEA 1A8VA 5AJ3Q 4GOPB 1S40A 1N32Q 1A0IA 3CCEA 1WCMG 1WCMH 1YHBA 3NELA 3A74A 1NMGA 2HQLA 3CC7A 2WP8J 1KC8C 2N78A 4R1JA 5IYCG 3T1HQ 1I50H 2KBNA 3JC66 5IYCH 1VQJA 1GKHA 3CCSA 4X66L 2F4VQ 2UXDQ 4DV6L 4JYAQ 2K75A 3D31A 3BU2A 3CCQA 4GNXA 2OCEA 1LTLA 4DR3L 2HHHL 3CD6A 3KDFB 3PUWA 1QUQA 2AWNA 1OXSC 2JK8A 4MZ9A 4QJFA 5C4JH 4BY1G 5IY0A 4A4IA 4WJ3M 4X6AH 3GTOH 3K81C 4DR2Q 3CMAA 1PH1A 4K0KL 1KL9A 1G291 4J15A 3DM3A 3ER0A 2K52A 3IRBA 5GQOA 4LF8Q 4JI5L 4DV7L 5GAEC 2BA1A 1FJGL 1IBKL 4L5QA 3CC4A 3OTOQ 3GTKH 3M4PA 1IBLL 2UU9L 4NXNQ 1WYDA 1R9TH 4JOIC 3HOVG 1UWVA 2AWOA 3HOVH 2R92G 4JBMA 4Y7NH 2R92H 2N3SA 4JC0A 1SFOH 4AYBG 3ICEA 2JE6I 5EAYA 3J7A5 4DUYL 5LMUQ 4EX5A 2CWAA 2QGQA 1VQ4A 1YITA 1QZHA 4YWKA 4LF4L 3LGJA 3PO2G 1BBWA 1IYJB 1SROA 5AJ3L 3RN5A 1N32L 2HT1A 2PI2A 3TEHB 1IBMQ 1K8AC 3NBHB 1EOVA 1LYLA 1L2FA 3T1HL 4A75A 1JMCA 3CCLA 1HZ9A 3K80C 5C0XG 2F4VL 2UXDL 4JYAL 3W1GA 2NVQH 4ALPA 1CKMA 3W1BA 3K7UC 4MNOA 2RF4A 3PUXA 1BBUA 1SRUA 4JI7Q 4O0AA 1VQGA 1XPOA 3F2BA 1X65A 3GO5A 1U5KA 1XNRQ 2Z6KA 4X64Q 1K83H 4EQ5A 4DR2L 1IL2A 3CCJA 3PCOB 1Q12A 5HGQA 4LF8L 4HJ5A 5JJLA 3CCVA 1KHIA 3OTOL 1EIFA 1MKHA 1E3PA 4NXNL 4OO1I 3PUYA 4POFA 1HNZQ 2OTJA 3RLFA 1XNQQ 3S1RH 1X55A 1EWIA 4LF7Q 5ELNA 2DUDA 1HH2P 4B3SQ 4JI8Q 3PV0A 2E5LQ 1BKBA 3GTMH 2ZJRA 1UEBA 3M4QA 1MJCA 3RLOA 5LMUL 2KENA 4DV2Q 1VQFA 4JOIA 1HR0Q 2MO1A 5FJ8G 1PYSB 1O7IA 1OXTA 5FJ8H 1XMOL 4B3TL 4DR5Q 3PO3G 3PO3H 2YTVA 5IYBG 1IBML 2DGYA 3K8AA 3ULLA 1PV4A 2ZTEA 3CMEA 1SLJA 2LSSA 2ZJPA 3CXCA 1HR0W 1E22A 1HJPA 1E1OA 2R93G 2R93H 4DK6C 1MIUA 1NMFA 4IPDA 4JI7L 4UY8C 5IP9G 5IP9H 3TRZA 1Q8KA 4PZ8A 3S1MH 1DGSA 2F52A 3HOXG 1Q7YC 3HOXH 1KRSA 1XNRL 5IWAQ 2AHOB 3KLWA 4A3KG 1YVCA 4X64L 4IPCA 4GNXC 1YI2A 1VQHA 3K0XA 4LFAQ 2Q2TA 3L2PA 2VUMG 3M9BA 3A0JA 4JI6Q 2CKZB 4A3DH 1D7QA 3U4VA 1HNZL 1EIYB 2ATWA 1Q1BA 1CKNA 1VQCA 4YY3Q 4LF7L 3AFQA 3GTJH 4YHHQ 4JI8L 1UE5A 4B3SL 4IJHA 3G6EA 2E5LL 2PQAB 3TS2A 3SGIA 1HR0L 5M5WH 2RCNA 4DV2L 3CC2A 3OW2A 3ZJYC 3F2CA 4DR5L 2AMCB 1QVGA 1QUQB 1X6OA 2EXDA 3AEVA 3Q8DA 2NN6I 4DUZQ 1P8LA 3A5UA 1K0RA 2GVBA 2YV5A 4A3CG 4A3CH 4ME3A 4KHPQ 3GD7A 1WFQA 1QZGA 4A3BG 1AE3A 4A3BH 2R7FA 2UUCQ 2B63G 3TREA 2B63H 2Y0SE 2LXKA 3KYHC 4P74A 1Q1EA 3FP9A 5LMNQ 1VCIA 2BH8A 4HIOA 1VQ6A 2WFWA 1EFWA 5IWAL 4JI1Q 2VL6A 4GOPC 1CSQA 4JBJA 4L5RC 4LFAL 4LF5Q 1L1OC 4A3JG 1P16A 1PA6A 4A3JH 1JE5A 1X3EA 5LMNW 1YBYA 1OTCA 4DV3Q 1JB7A 2Z6KC 4DPGA 2VZAA 3L7ZC 4JI6L 2HIXA 1EQRA 1PH7A 3H3VI 4YY3L 4X62L 2YYZA 1XMQQ 4DR7Q 3ERSX 4YHHL 5IYDG 1X9NA 3CPWA 5IYDH 1VQNA 2RHQB 1NY4A 2VY3A 3HFZB 1Q82C 1GVPA 1VQIA 1B8AA 1B7YB 5C44H 2ZTCA 3D0FA 3KF6B 1VQOA 4C3HH 4IPHA 2MO0A 4DUZL 2PMZE 3E9IA 2NVTH 2R7ZG 1E7ZA 2V1CC 2R7ZH 2PNHA 3AYHB 3UE0A 3S2DH 1Y14B 3MEFA 4KHPL 3UDGA 2JA6G 4YCWA 4IOAA 3J81j 2UUCL 2JA6H 1E1TA 3FKIG 4AQYQ 1M90C 3FKIH 2BA0A 5C0XJ 4HJ8A 3I4MG 5M5YH 3S17H 4BBSG 3J81c 2RHSB 4BBSH 5LMNL 2Y0SG 3S14H 1GO3E 3EBEA 4R4IA 4JI1L 4GN3B 2IHFA 4A3IG 4L5SA 4A3IH 4DNIA 5FLMH 4JV5Q 4P71A 3UDIA 4DV3L 1C0AA 1KXLA 4IFDG 5GAGC 4PZ7A 4GOPA 1EYGA 1VQ9A 1L1OA 4RMFA 4X65Q 2JA9A 1VQDA 3J81i 1OXXK 1XMQL 4DR7L 3I55A 4DV1Q 1VQKA 4OWTB 3BZCA 3WWVA 2EQSA 2JA8G 4C3IH 2JA8H 5IE8A 1HZBA 3U4ZA 1SR3A 1RIPA 1TWFH 5JEAG 2K5NA 3KDFA 4R4TA 3HOYG
chains in the Genus database with same CATH superfamily
2D0OA 1ICWA 2ZTDA 4OXPA 3HOYH 2EIFA 1QE6A 2MNAA 2I0QA 3PQIA 4JCVE 2OEOA 2NZOA 3BZKA 3QB3A 2IX1A 1Q8IA 4Z9CB 4BA2I 1PH3A 4G57A 4RH6A 4JV5L 5C4XH 2VB3X 4LUZA 1PH5A 2D62A 2E2HH 2A73B 3PO2H 3A5ZB 1D5MC 4JI4Q 2ID0A 1V1PA 3G6JB 3NK9A 1JR0D 3NQIA 3GTQB 1Q46A 3J80c 3QOLA 1TWHH 2G9DA 1V9PA 4S3SA 2YU9B 4ZAIA 4A93B 4KK7A 3CPFA 2N88A 2QEXA 3HOUG 3OHXC 4CBVA 5M3FH 4R8IA 1XNQL 3HOZH 2F0VA 1PMRA 2JA5H 3BYYB 1KIXA 2JEBI 3H0GG 1V1QA 1I50B 3EIVA 2KCMA 2EVBA 4TKOB 4GNXB 2IHEA 2LY7A 3SHLA 1PH6A 2E2JH 4K2LA 1BVSA 5ELBA 2OQKA 4EQOA 4BY1B 4K5XA 1Y69U 4L5TA 3M4OB 2B2YA 1N34Q 3CP0A 3KLSX 3GTKB 2PZUA 4JI4L 1Y1WG 4KKSA 4RKBA 3T51B 4DV7Q 2HCCA 4LFBQ 2KA7A 3GTPH 3VR5A 3KBXA 3E0EA 1JC7A 5J1ZA 3S1QH 2M2LA 3K5MA 1MJEA 3J7ZC 2C5CA 2PI2E 2IW3A 3K5OA 1XTDA 2EYLA 1J6QA 3TS2A 5C44G 1XPUA 1LT4D 3U50C 2SOBA 3HKZG 4UPAA 4C56C 5I2YA 4DFAA 1LUZA 4ZUJA 2NBFA 4KLKA 1B70B 2NN6H 1N34L 3PSIA 2IY5B 1PFSA 3NUCA 2Q2IA 3S1NH 4KD4A 4LFBL 2AQ2B 3HKSA 2L5TA 4GKJQ 3GTGH 4XT3B 5JEAJ 3A7LA 5JPNC 3Q23A 4H02A 5K36H 2WV6D 3UDXA 4FDBA 2WAQG 4UP7A 1AEXA 1EY7A 2QA4A 1PHJA 4HJ7A 3GTLH 3ONAB 4TSSA 5ELEA 3RN2A 4HIDA 2LS01 4APVA 3SR1A 2B2UC 1LM0A 3STBD 3MXGA 2FMMA 1CKNB 3L0OA 3NWTA 5C3EH 1I5FA 4CJ1B 2DY8A 3GTJB 1G91A 3V2TA 1VMCA 3KLRA 1A15A 5M5WB 1CA6A 1B9MA 4IOCA 1CKOA 4GKJL 2UXCQ 1VQPA 2B2VC 4M8AA 2KHIA 3FDTA 2ZXRA 1JQYD 4H44C 4QL5A 1VQMA 4OIKA 1J5EQ 4FYDA 2FJ2A 1WOCA 3D6WA 2B63B 4ID6A 2I5LX 1SMXA 4P2CB 1RKNA 1TWGH 1Y1VG 2F0FA 4GN5A 4DR1Q 1I4PA 3I70A 1PFMA 1T9HA 5C5MA 4HSVA 1FNVA 3VYRA 1L0WA 2OWOA 3T16A 2UXBQ 2QDBA 3E5SA 2R7DA 4WJWA 3V96A 1DONA 1KLUD 2GVAA 1SNMA 4HIMA 3FHWA 4LNQA 1I4RA 2HUGA 1XWEA 2K4KA 1EIGA 2A19A 2UXCL 4KHVA 4DR3Q 1CHPD 3CW2C 4IALA 1YNNC 3H6MA 2R7ZB 4X3SA 1VQLA 1J5EL 3A55A 5FO7B 2ES2A 4K0KQ 1CQVA 3FKIB 4LWCA 3S17B 1IBLQ 2UU9Q 1A3TA 1IW7C 1EUJA 4A3GH 4DR1L 1ASYA 3GTQH 2OXPA 3NEMA 4QQBX 2YU9H 4DUYQ 5I6WA 4LF4Q 2UXBL 2NVQB 5AJ3Q 1N32Q 1NSNS 1A0IA 3CCEA 3A74A 2LMCB 3T1HQ 1I50H 5IYCH 2KOLA 2MP1A 2JA8B 2E76C 1LTLA 3R2TA 5KEEA 4DR3L 1OXSC 3DMUA 5IY0A 3CU7A 4WJ3M 3GTOH 3K81C 2IWHA 4DR2Q 4K0KL 4ZK9B 4J15A 3DM3A 3IRBA 2IPKD 4LF8Q 1LTSD 3OWEB 3CC4A 3GTKH 1IBLL 2UU9L 1BXTA 4F8MA 4JOIC 3A8IE 3K5LA 5IGDA 4Y7NH 4JBMA 3OMCA 1SFOH 2NUCA 5EAYA 4DUYL 4LF4L 2QGQA 3G7LA 1NNXA 1BBWA 5AJ3L 1N32L 1L0XB 2F0UA 2QCPX 3CRLC 3T1HL 1L2FA 5C0XH 4C2MB 4EVOA 3LWEA 3FVQA 1J9OA 1WD0A 3K7UC 4JI7Q 1D2BA 4O0AA 5D3IB 1VQGA 4M1UB 3R3OA 3SK8A 4CGYB 2NVYB 4DR2L 2XNAC 3CCJA 5HGQA 3H0GB 2B2TA 4LF8L 4HJ5A 3T13A 5C4ZA 4TRDA 3IL8A 4OO1I 2OTJA 1HH2P 4Q0FA 5EPKA 3SDZA 2G5DA 2KENA 1VQFA 5HURA 4A3BB 2BDOA 1O7IA 4XDXA 4G7ZC 2MGSA 4DR5Q 3PO3G 1EOTA 2ICEC 2RSOA 2A6EC 2EJMA 2DGYA 1DJRD 3I72A 1E0BA 3CMEA 2ZJPA 1Y1WB 1E22A 1HJPA 1E1OA 5DM73 1PFBA 4JI7L 4UY8C 1IHZA 1F9RA 4JW0A 1DGSA 1IL8A 4N9PA 1YVCA 4GNXC 1YI2A 2Q2TA 1CT1D 1STHA 3L2PA 1SMYC 2KCCA 3A0JA 2MPMA 4JI6Q 3U4VA 3EQLC 1GXDC 5C44B 1EIYB 5CGKA 1VQCA 4YY3Q 3HKZB 3GTJH 4IUQA 4ODGA 3TP7A 5CR3A 2PQAB 5M5WH 2A6HD 2F0TA 3OW2A 3ZJYC 3KLSA 4DR5L 2AMCB 4G4KA 3MTSA 1QUQB 1UAPA 2EXDA 4FO2A 2QILA 1MD2D 3NQTA 3ERQA 1JOKA 1G2TA 4A3CH 3GD7A 4L6TB 4HSPA 1H9SB 2UUCQ 2B63H 2CW0D 2ZXPA 1A6XA 4CHTB 3KYHC 1B9NA 3FP9A 5LMNQ 1SYBA 2O4XA 3J7AV 1SE2A 1S5CD 2VL6A 3S2HB 4A3JH 1OTCA 4DV3Q 4JI6L 2Z6KC 3D6CA 2VZAA 3L7ZC 5EPLA 4DPGA 2WAQB 3TBIB 4YY3L 4X62L 2J4XA 2Z4HA 5IYDH 2DNCA 2RHQB 1VQNA 1JWSD 2PMZB 1FGBD 3RUZA 1B7YB 2EE1A 3SK5A 1EL0A 4IPHA 3TDQA 3CQZB 3E9IA 3S2DH 1E7ZA 2R7ZH 3NTKA 3UDGA 4KN4C 1TKWB 2UUCL 2F1MA 2EDGA 3FKIH 3S17H 4BBSG 5C4XB 5LMNL 2Y0SG 1GO3E 3EBEA 1AZPA 3PO2B 3BDLA 3GP7A 2E2HB 2ZT9C 1RTNA 1EWCA 4MHEA 3EFXD 1PZKD 3TP5A 3P1HA 3VR6A 4DV3L 4GOPA 1L1OA 4X65Q 1SNDA 1STBA 1SJED 2JA5B 2Z9HA 3MWYW 2JA8H 1DOMA 5HGTA 3DXJC 1HZBA 1H9MA 1F2MA 3IFTA 5JEAG 3KDFA 4BBRG 2PW5A 3I8ZA 3TZDA 1SN8A 4KTAA 2RSNA 1NJIC 3BJUA 1SBBB 1F2YA 4R4CA 1IKLA 1HCZA 2A8VA 2Q2UA 2BOSA 1X3QA 3WOEA 4AH6A 1DD2A 4KI0A 1XXGA 5JVH3 2DNEA 3T1YQ 1HZCA 3K5NA 1CFMA 2EYJA 4RA8A 5J22A 3EN2A 4X65L 1IZ6A 3J7YW 1FGUA 4LFCQ 3NP8A 3VDYA 4R4OA 4C2MH 3PIPA 1F9SA 2FINB 4GLXA 1UE1A 5IP7H 2KHJA 1JJCB 5G3LF 3I4LA 4KHZA 4HMIA 1UNSA 4GN4B 3BYTB 5IGEA 3PF5A 3HOUH 3QO2A 1EY6A 2GN5A 5D3DA 1NTGA 2NVYH 2QDLA 3H0GH 1OO9B 2TSSA 1RL2A 5E3FA 4FF3A 3HKZE 1HPCA 3F2DA 3IAYA 4PV1C 3BVGA 5EKLA 3NTHA 2EY2A 3T1YL 2LXJA 5ELCA 4PMBA 1D6EC 1W3SA 1GUNA 4LFCL 1Y1WH 4BS9A 1HNXQ 2QKIC 4NPSA 2B2VA 4YWLA 3PGZA 3DWPA 4YCUA 1HXYD 2IX0A 3E6ZX 5DEHA 3SE0A 2KUMA 2UUBQ 2XIWA 1EU4A 2RVLA 2WAQE 3I7FA 2VNUD 1SYFA 3U9OA 3RMHA 4O2DA 4QY7A 1WI5A 5J3BA 3AB9A 1G51A 5I6YA 4C3JG 1K8MA 3DLLA 1I94Q 1YHQA 3RZDH 1SNCA 4NXMQ 2X6LA 4JI2Q 3G48A 2IT1A 5DLQE 4IFDJ 2XSCA 4CKCA 4GKKQ 2AQ1B 1HNXL 4N9TA 3W5OA 4LF5L 4LF6Q 2K14A 2AQ3B 2L1BA 1QVCA 2MJ8A 1K3RA 4HAEA 2F3VA 3PO3B 4CDFC 3I4NG 2QEJC 3S2HH 2UUBL 2K32A 2OTLA 4OGQC 2YTYA 4A3EG 2M00A 1PH4A 1XMOQ 4B3TQ 1ZKOA 1EY5A 3NWSA 4NB3A 1I94L 4DAYB 4K6LA 2Q8IB 3QJYA 3CRKC 1SEBD 3HS0C 1A3VA 3ULJA 4DK3C 3AMUA 1NBWA 1H9RA 4NXML 4P73A 4R9WA 4JI2L 1HUMA 3K7AH 4C1NK 2I5MX 3CQZH 2ICIA 1F9PA 4GKKL 3HEJA 4OL7A 4J6HA 2CFMA 4LF6L 3GV6A 3VYSA 4CKBA 2XTIA 1TR5A 1N8RC 2J7ZA 1HUNA 1IW7D 3OOCA 1GHKA 4A3GB 1BCPC 1PZID 1VMPA 2PCFB 1LT6D 1KAWA 1OXUA 4ZKBB 1CSPA 4XTCS 5EJWA 3MFGA 2F0IA 2NZ1D 3T4AC 5IP7G 4OWXB 1N9WA 1CK1A 1Y1VH 5IYBH 1J8IA 2RDGA 5GROA 1CTMA 2L15A 1UUPA 3PIOA 3LWUA 2L11A 1GD7A 2ZJQA 4DXFA 3KBGA 3PUVA 1VF7A 4G7OC 4A3KH 3G71A 1C7YA 4KMUC 1M4VA 4A3LG 2A69C 1WVLA 3M4YA 2Q2HA 3TQYA 4H13C 4IPGA 3GTOB 1IYVA 3URYA 1S5DD 2EYHA 4YCVA 3RLNA 3KF8B 3TS0A 1XYIA 2EXZA 2HHHQ 1E2WA 2VB2X 4NDXA 1WJJA 5CC4A 4BXXG 4Y7NB 3RNUA 4H7BA 1TWCH 1SFOB 1Y8OB 5BN5A 2WB1G 1VQAA 3BZDB 2CWPA 1IBKQ 3NHHA 5JAVA 2Y0SB 4HJ9A 1SNQA 1F2LA 3JAMi 1HHVA 4OONA 1EWHA 2MFIA 1Q86C 3VA7A 4DAMA 1MBYA 3V05A 4IURA 2F0WA 1NUCA 1SXTA 3NELA 1EZ6A 4CJ2C 2N78A 3CHBD 1WTVA 1VQJA 1GKHA 3CCSA 1QB5D 4JYAQ 1I4XA 3D31A 4GNXA 4WFN3 3CCQA 5F2DA 3VYUA 1NR2A 2HHHL 3CD6A 1TWFB 2JK8A 2SEBD 4QJFA 4BBRB 4K5VA 1A63A 1U4PA 1I3QB 1KL9A 1G291 1ZEQX 3ER0A 5GQOA 4DV7L 5GAEC 1VDZA 1IBKL 1O80A 3M4PA 3A56A 2PQEA 4PMCA 2A6ED 1R9TH 3HOVG 1DCZA 2AWOA 2F0LA 4JC0A 3ITPA 4I65A 1TWAB 5KGUA 4DF7A 3J7A5 2D9UA 2BCOA 5LMUQ 1VQ4A 3OWFA 1BO0A 3I4MH 3X3MA 2F3WA 5IT9L 3A54A 3RN5A 4XYQA 1NAPA 1IBMQ 1EOVA 4CDDC 1JMCA 2B39A 3HP3A 2F0HA 4JYAL 2HQEA 2MUYA 4ALPA 4IFDH 3GQBA 3OW7A 2A68C 1WTPA 1KDCA 3VR2A 3GO5A 1U5KA 2O5IC 2CHBD 2Z6KA 4MN3A 3D4DA 3PCOB 4OELB 3K58A 5M9OA 3CCVA 1PFNA 1E3PA 5KNBA 1HNZQ 3O13A 5C3WA 4FVMA 1EWIA 1STEA 4LF7Q 1WTOA 4B3SQ 1G2SA 3PV0A 4X3TA 3MAQA 4IUPA 3RLOA 1CHQD 4DV2Q 5LMUL 1HR0Q 4X6AH 2MO1A 3SEBA 1PYSB 2TMPA 1OXTA 1I4GA 3X3NA 4ZKCB 5I9OA 2CQAA 3PO3H 4KKUA 2YTVA 5IYBG 1IBML 3K8AA 4OIJA 5EBCA 3ULLA 5IGBA 1PV4A 1WD1A 2X6GA 1R4QB 2R93G 5E4XA 1MIUA 1NMFA 4IPDA 4A3JB 5IP9G 4PZ8A 1LABA 3S1MH 3HGBA 2F52A 3HOXG 3KLWA 4A3KG 5EGTA 4IPCA 2Z4IA 3K0XA 1TS2A 1RD9D 1R9TB 4A3DH 1D7QA 1HNZL 2ATWA 1CKNA 5CV8A 4LF7L 4C3JB 3AFQA 4CJ0B 4B3SL 1UE5A 1B3QA 4IJHA 3S2DB 5D65A 4K14A 1RODA 1HR0L 3S9WA 4DV2L 3D8GA 3R2IA 4R8NA 1Y8PB 1K0SA 1EY4A 5KRUA 2NN6I 1P8LA 2Z6BA 4ME3A 5A35A 4RAUC 1QZGA 5CYUA 1LTGD 1AE3A 2R7FA 2Y0SE 3D4RA 1FR3A 4P74A 1VCIA 2BH8A 1D1KA 4EQNA 2WFWA 4JI1Q 5JPMC 4QUCA 3I4NB 1STAA 1JE5A 1X3EA 4QIWB 4A3EB 3HRZC 2K1BA 2EJGC 1E2ZA 2JYOA 1K8OA 1XMQQ 4DR7Q 3EROA 4NKLA 1CZWA 2A5HA 2LKVA 1TQOA 2VY3A 1Q82C 1GVPA 3ZYYX 2P5ZX 2PZTA 3F2UA 1S5ED 2ZTCA 3D0FA 3KF6B 4GZYC 5I4DA 1MHWC 2QF7A 1STYA 2XWJB 3MEFA 5C3XA 2JA6G 4IOAA 3J81j 2RDFA 1R4PB 1E1TA 4AQYQ 3I4MG 4FF4A 2HD3A 2RHSB 3J81c 4FF2A 4BBSH 1LTTD 5T1GA 4JI1L 2K5QA 5IIFA 2IHFA 5EQ0A 1A2UA 5FLMH 1RDPD 4P71A 1H9JA 1PTOB 1HTLD 4IFDG 3MC0B 1PRTB 3EVQA 1VQ9A 4RMFA 2JA9A 1OXXK 2KHSA 1XMQL 3HOUB 4DR7L 3I55A 4DV1Q 3DEOA 5E1FA 4C3IG 3DM1A 1AFPA 5IE8A 1Q90A 1MGSA 4F88A 4HTHA 5EKKA 1SR3A 1TWFH 2K5NA 4FNFA 5JEAH 4QGUA 3D4WA 4BBRH 1IYUA 3J81E 1S72A 4QF4A 1SE8A 2WINB 3MEHA 3TZUA 1I3QH 4XT1B 4AQYL 2F0DA 2RQXA 1AH9A 1PRTF 4DV0Q 2B2YC 1XPRA 2MHVA 1TWAH 5BR8Q 1K3BC 3OIPA 1EYDA 1K9MC 4ABNA 3HOWG 5GAHC 1STGA 1B53A 1V43A 1HFNA 1BCPB 1PH2A 3E9HA 3QG1A 4P72A 2CCZA 1QILA 2WACA 3S15H 1N33Q 1E24A 2YTXA 4HN7A 1W2BA 4A3DG 5IOCA 1O7LA 2B3GA 2N49A 4ME5A 4XIGS 5IGFA 1ASZA 1VQBA 3OSOA 1K8GA 1GUGA 4OO1G 1I4HA 4K8IA 3J80i 2JEAI 3RZDB 4R4QA 1IXRA 1CUKA 2VW9A 3DWQA 3AQQA 4DV0L 1G6ZA 1PYWD 1BCPF 4I7AA 4A76A 1I6HH 1KDAA 4NW2A 5BR8L 3ND8A 4QUFA 3A8JE 4WRDA 1WTWA 2CH4W 4RCOA 3M3YH 3I2ZA 1SNPA 1HFGA 1EQQA 1VQ5A 2ENBA 1YJNA 4LF9Q 1Q81C 3DEPA 3CKIB 1QVFA 1FNUA 1N33L 1SAPA 3C2PA 1O7ZA 4K5WA 2E8GA 2Z0SA 5ELOA 4OX9Q 2K03A 4TVAB 1KRTA 1A62A 3K0YA 2RKSA 3WOFA 4QIWE 4ZYSA 4LW1A 4A93G 1O78A 1UE7A 4AIMA 2N8NA 5ISRA 2WKDA 5GADC 4A3FH 1K28A 4JG2A 4P75A 4RG1A 4PG3A 5C0XI 1YHAA 1L1OB 2R6GA 1FNWA 5M5XH 3K7AB 4DU9A 3B6YA 1ESFA 1II3A 4HMJA 4C3JH 1EFID 3JAME 4KJOA 3OIQA 2Q8RE 2PQAA 1TXYA 2FXQA 4G7HC 2AKWB 2X69A 1LO5D 4Q5VA 4BY7G 1S5FD 1TS5A 3ND9A 1X3FA 2K04A 3KJPA 4LF9L 4FF1A 4C1NI 2EY5A 3MZ5A 4L63B 2B8GA 1H9SA 5BN4A 1BCPD 5FLMG 4OX9L 2B29A 4CDEC 4FXDA 1T5XD 4DKAC 2UUAQ 4GS3A 5CV9A 5JJKA 3GV3A 1VQ7A 1ET9A 1Y1VB 2DN8A 3I4NH 1MI2A 2CH4A 3BDCA 4PZ6A 3SK4A 2EYFA 4B9WA 2I46A 4A3EH 3H3VH 3T56B 2ASBA 1BNZA 2R93B 3RR5A 4L8JA 1DXMA 1ONLA 2FFKB 4JI0Q 4QB4A 3PIP3 2BH2A 1LT3D 3AFPA 3SXHA 1TU2B 1YNXA 4LUOA 4A3KB 2I5HA 2A69D 5NUCA 2F3IA 3DUZA 3BS1A 2VQFQ 1GUOA 3H91A 4LK1C 3PF4A 5EPJA 1KABA 4HCEA 1D8LA 1EIHA 4EGVA 3GDEA 4FP5D 3S16H 2NZHA 4YIJA 3J81L 1W6KA 2L55A 2F0EA 2MQHA 3NPPA 1U9RA 5DNFA 1TWCB 2RDHA 2UUAL 3U58A 2NTTA 3D3RA 3M7GA 3MFYA 1UE6A 3ULPA 4Y52H 3NBHA 2WB1E 2KECA 3FPUB 1UEAB 1PTOH 3I56A 2R3ZA 4HEDA 4H0LC 2XGTA 5HY6A 3A8KE 4IUUA 2JA7G 2VS1A 4JI0L 1JJ2A 5CV5A 2EZVA 2XRSD 3Q6SA 2B8FA 2C35B 1MSHA 1VQ8A 2VQFL 4DXGA 5FK9C 4TQUS 4ZLTF 3I4OA 2SNSA 2K50A 2L4NA 1DZ1A 2B2UA 4K8JA 1G6PA 1DOKA 2VUMH 3TP6A 4A3LH 1M1KC 4DV6Q 1EEFD 4A3MG 1F2ZA 2EJFC 4ZCKA 3CF5A 1SYCA 4UAIA 2ALYB 2F0PA 4RGNA 1C8CA 1SYDA 1LACA 2NVTB 1RHPA 1NCVA 1S3OA 4BXXH 1A3UA 1FL0A 1U0LA 2SNMA 1FJGQ 1QNKA 3I4MB 2HIVA 5FO8B 3F1ZA 2D5DA 1YNJC 3MXNB 4ULLA 2F0SA 1X56A 2KJXA 2IX3A 3H3VC 5IT9c 2BE5C 3H09A 2K5HA 4A3FG 3NENA 2C9OA 2K7VA 1A8VA 1A2TA 1WCMG 1YHBA 2L12A 1NMGA 2EYOA 2WP8J 1KC8C 3E0JA 4R1JA 5G3LD 5FO9B 2F4VQ 4DV6L 2K75A 3TP8A 5CBAE 1JWUD 1TIID 2AWNA 2B2TC 1SSOA 5C4JH 3JAML 1PH1A 3CMAA 1SE3A 2K52A 1FJGL 1BR9A 3NTIA 5CBEE 5IT9E 2E2IB 2JXMB 1WTQA 4NXNQ 4MTKA 3HOVH 1PTOC 2R92G 1EY0A 2N3SA 4KJNA 1PRTC 4AYBG 1CI3M 2JE6I 4EX5A 2CWAA 1QZHA 3LGJA 3WDNA 1GOZA 2HT1A 3HOWB 2PI2A 3S1MB 1V1PB 1LYLA 4A75A 3CCLA 1HZ9A 3K80C 3N6RA 2F4VL 2E74C 1CKMA 3W1BA 5IGCA 3C1FA 2RF4A 3PUXA 5LL6S 1SRUA 1XPOA 4A3DB 3F2BA 5J39A 1X65A 1DM0B 5IODA 3K57A 2G9HD 4X64Q 4FXKC 2BDNA 1YNND 4EQ5A 1QCBD 3BG3A 3C1EA 5JJLA 1KHIA 2KEEA 1EIFA 1MKHA 2JSOA 4NXNL 3PUYA 4POFA 3RLFA 1D5XC 2NWGA 4XQQA 3S1RH 1X55A 1XNQQ 1D5ZC 2NTSA 4JI8Q 3P7JA 1CM9A 1BKBA 3GTMH 3M4QA 4JOIA 3W3AA 4B3TL 4EQPA 5FJ8G 1XMOL 3RZOB 3AU7A 4RFBA 2NB0A 2ZTEA 3TN2A 1SLJA 3CXCA 1PZJD 5CMDA 1EY9A 4LMQD 4XYOA 2R93H 1EYCA 2KEDA 1BDOA 1KDBA 5EBDA 5IP9H 4XQJA 1Q7YC 3HOXH 1KRSA 4DAYA 2F03A 4X64L 4RGOS 2VUMG 3M9BA 1ZYRC 4PNYA 2CKZB 2V4DA 4QCLA 3EJIA 1GJXA 3HG9A 5KYLA 2K05A 4JI8L 2DJGC 5KNDA 3G6EA 2E75C 1HQMC 4V190 3CC2A 1QWYA 4DNTB 2RCFA 3F2CA 5JJZA 4BY7B 2VXWA 1JWMD 5A2QE 3T53B 3AEVA 1EQVA 4BBSB 1GUWA 3A5UA 1K0RA 1TS3A 2YV5A 4KHPQ 4A3BG 3RD4A 3TREA 3J80E 1Q1EA 1VQ6A 2OT2A 1B3AA 3K59A 4GOPC 1L1OC 4PQXA 5LMNW 1YBYA 1G8ZD 1HRJA 2HIXA 1PH7A 5DAUA 2YYZA 1ET6A 4KY6A 1Z6HA 3ERSX 4ILWA 3L3OC 3QR8A 1X9NA 4ZUIA 1NY4A 3HFZB 1VQIA 4KV6A 1B8AA 2AUKA 1QNUA 1B2TA 3KF8A 4C3HG 2NVTH 2MO0A 2HDLA 2K5WA 4KHPL 2V1CC 2PNHA 1Y8NB 3AYHB 4KY7A 1Y14B 3P75A 2EYPA 3UE0A 5COYA 2JA6H 1F77A 1LTAD 1MSGA 2JP1A 1M90C 2BA0A 5C0XJ 4HJ8A 1AW7A 1DYQA 3BVMA 4RHSA 3VA5A 4CKEA 1GUSA 2D2CC 1AN8A 4A3IG 4L5SA 4IZ8A 4IUVA 3S15B 2WIIB 4DK1A 3UDIA 3FPPA 1DOLA 1SJHD 1QJOA 1C0AA 1SMYD 2HDMA 2SDFA 4PZ7A 5GAGC 1KXLA 3HZXA 2JA7B 1VQDA 4DA2A 1BF4A 1VQKA 1XX8A 5CORA 3BVZA 2EPBA 4C3IH 3U4ZA 4R4TA 3HOYG 3KOJA 1BUVT 1TS4A 4B3MQ 3Q22A 3F8TA 3C3LA 1LTRD 1D1IA 4DNRB 1AE2A 1I6HB 1TY2A 1PLFA 4A3MB 3U9SA 2E2IH 3TSSA 3SK6A 3M3YB 3CCMA 3Q0AA 1S5BD 3KJOA 1U4LA 1AZQA 5C4XG 4OWWB 2K6AA 3PO2G 4MTNA 3HOWH 1LTBD 1T5EA 4X3KA 1RCVD 1V1OA 3QIAA 1YEZA 2B2WC 1E2VA 4J1MA 5E4WC 3FRPB 1H95A 4XQNA 2WKCA 2PYKA 4A3FB 2F0MA 5M3MH 4IN3A 5M3FG 3G4SA 1YJWA 2NVXB 1JICA 3HOZG 3IKJA 2F0GA 5JOBA 4B3ML 1HNWQ 1WCMB 5M5XB 2CQOA 2K5VA 2JA5G 2XWBB 4YWMA 1LLRD 1C48A 4KD3A 4J8QA 1KNEA 1ICFB 4OO1H 4PMWA 2FMCA 1WTRA 4JK1C 3MA2B 4BWGB 1I4QA 4DR6Q 2PZWA 4HJAA 2LFNA 4JI3Q 1B44D 4POGA 1JJGA 1X54A 3OYYA 3RZOH 4DV4Q 4DR4Q 3P20A 5FLXc 5A2QL 2K01A 2R92B 1Z7TA 4DN4M 4UP8A 1PXUA 4AYBB 2ZM6Q 3DWAA 2CVRA 3N52A 3J80L 4HR7B 1KTKA 1HNWL 5CV4A 4DV5Q 5LL6X 3CCRA 2JQOA 4A93H 1ENCA 4UDUC 1PH9A 1XJVA 1X3PA 4IQZA 5JVG3 3NE5B 5BN3A 5H1SE 1N36Q 1GM5A 4DR6L 1PVOA 4JBKA 5AFWA 4IFDI 2PW7A 1HZAA 4JI3L 3MXUA 4X3UA 1FD7D 4B08A 1AP0A 3H94A 3S16B 1STNA 1K83B 1LV9A 5E7NA 5FLXE 1QOHA 1PH8A 2NN6G 2DY7A 3M85A 4DV4L 4BY7H 4DR4L 3LX0A 4BY1H 2EY6A 1K73C 2JJQA 3M7NA 3M4OH 1YZ6A 4IJLA 2ZM6L 2NYZD 4B3RQ 2F0NA 4O42A 3PUZA 4RCNA 1L0YB 5CV6A 2H5XA 4DV5L 4GLVB 4JVZA 4CDCC 5I2XA 3MVVA 5K36G 4BA1I 5DM63 5JJIA 1KLGD 1N36L 2L0CA 1C9OA 1ESRA 3UE1A 2OF1A 5FOBB 4UP9A 1NE3A 2XRQD 1SNOA 1JE4A 4LAAA 2VUMB 3OPOA 3KF6A 1PTOF 4GLAC 1KQSA 5C3EG 1ENAA 1JT8A 3LNNA 2EY1A 5C5LA 1ILPA 1JOOA 4B3RL 1KNAA 2WB1B 4MIUA 4HCSA 2VQEQ 1QG7A 1GUTA 4IO9A 1YNJD 4NP5A 2L9HA 5IGGA 4DV1L 1Z47A 1VS0A 1Z9FA 1YJ9A 2K28A 2BE5D 3BDOA 1W6JA 1VF5C 2D0PA 4WJ4A 1X3GA 5M3MG 2JA7H 2K33A 1H9KA 1PYBA 1SE4A 3I73A 1JORA 4KKTA 2A1AA 4LUVA 3CAMA 4DK0A 2AUJD 4N8X1 1V8QA 1TY0A 1CQFA 1PDQA 3H15A 4RKLA 5C4JB 1BOSA 1B4OA 4X66Q 1SYEA 2F4IA 3S24A 2OQ0A 4A3MH 3STBC 3JAMc 3I91A 4X62Q 2VQEL 4C3HB 4K6DA 3CCUA 3UDFA 1PTOD 4HIKA 3HOVB 4DGZA 5EKIA 1HA5A 1PRTD 4JPBW 4V0BA 1KD1C 1YIJA 4JI5Q 2PNRC 2Z8LA 5M5YB 5T1IA 3EA6A 3S14B 4N8FA 4A3GG 1EQTA 4AYBE 1EU3A 2RA4A 1FVIA 3KK7A 2KCTA 4A3IB 2I07B 4JBWA 1OXVA 3KFUA 4NMZA 1WTXA 2RBMA 2NVXH 1VQEA 3E3XA 4GOPB 1S40A 1HTPA 1B1ZA 2XVSA 1WCMH 4RWSC 2HQLA 3CC7A 5IYCG 2KBNA 3JC66 4X66L 2UXDQ 1SYGA 3BU2A 2OCEA 3KDFB 1KAAA 3PUWA 1QUQA 4RGMA 5K5PA 4MZ9A 1EEID 2GA4B 4BY1G 3HOYB 1Q3LA 3S1RB 1BQQT 5CV7A 1U4RA 4A4IA 3J7AF 2IL8A 5FLXL 3FMCA 1XTCD 2H4OA 2N55A 4JI5L 2BA1A 3GTMB 2H1EA 4L5QA 3OTOQ 1WYDA 1ENFA 2M9VA 1UWVA 1NR4A 2R92H 4OEMB 4U673 3K6OA 3ICEA 5KIXA 5TSSA 3PMFA 1YITA 5ELDA 4YWKA 1SROA 1IYJB 2KVMA 3KUPA 4OHJA 3TEHB 4UHVA 1K8AC 3NBHB 1LT5D 4B9XA 3HOXB 5C0XG 3Q24A 2UXDL 3W1GA 2J0TD 1TWHB 2NVQH 3MHBA 1ZYRD 4MNOA 2Q8TA 1BBUA 2DJFC 2PPBC 5M3FB 1XNRQ 1ILQA 4U68A 3HOZB 1K83H 1IL2A 1X32A 1EY8A 1Q12A 5C6AA 3OTOL 1U4MA 4LJZC 1O7YA 1HA6A 5ELNA 2DUDA 2E2JB 2E5LQ 2ZJRA 1UEBA 1MJCA 4ZQ3A 5FJ8H 3OMGA 3C46A 3IFDA 1TVXA 5LHY1 1HR0W 2LSSA 3R93A 5KNCA 4DK6C 1RF2D 3W2DA 3TRZA 1Q8KA 3A7AB 3GTPB 4RHRA 1ML0D 3NSWA 1XNRL 5IWAQ 2AHOB 3S1QB 1RJTA 1TT2A 1VQHA 4LFAQ 5C4HA 1M8AA 3NXWA 1Q1BA 4I7ZC 1BBXC 1S4ZA 4YHHQ 2E5LL 3VR4A 3SGIA 1B50A 2RCNA 5I9PA 2EYMA 2JA6B 4E6IA 1JCKB 1QVGA 3SVMA 1X6OA 1WTHA 3Q8DA 3I3CA 4DUZQ 4DAVA 4A3CG 2GVBA 2F0OA 2A74C 1CZGA 1FYCA 1WFQA 3VYTA 4A3BH 2B63G 3S1NB 2LXKA 4KN7C 4O1NA 4QMGA 5L37A 2KQ3A 4WORA 4HIOA 2A68D 4IUTA 1EFWA 3GTGB 5IWAL 1JOQA 1CSQA 4JBJA 4L5RC 4LFAL 4LF5Q 4A3JG 1P16A 1PA6A 3FEWX 2EOTA 4FXGC 1JB7A 2B2WA 3R8BA 4C3IB 2ZXOA 3DHQA 1EQRA 4KY5A 3MXPA 2FHTA 3H3VI 1EZ8A 4RGTA 4DAPA 3QWNA 4YHHL 1SDFA 5FKAC 2R61A 5IYDG 4K2KA 3CPWA 3GTLB 4F87A 1I6VC 5C44H 2JN4A 3TMEA 2K5DA 4ZRZA 1VQOA 1CA5A 4C3HH 4IUNA 3VR3A 4DUZL 2PMZE 2F0KA 2R7ZG 5C3EB 3QOJA 4YCWA 5ELFA 4F7XA 2A6HC 3I90A 3FKIG 2F0JA 2HCIA 5M5YH 2KCNA 3S14H 3MXNA 4R4IA 4GN3B 4A3IH 1ZXTA 4DNIA 1LTID 2CW0C 4JV5Q 1JB3A 2IJ0A 1IKMA 1EYAA 1EYGA 2Z1CA 2O5JC 1TWGB 5KYIA 5M3MB 3J81i 3NBIA 1C4QA 4XXEA 2F0QA 2E2DC 2O2LD 4OWTB 3BZCA 1RTOA 3UI2A 5D14A 3WWVA 2EQSA 3L9AX 3PIO3 2JA8G 1HQRD 1GHJA 2PO4A 1F9QA 2XN9C 2QW7A 1RIPA
chains in the Genus database with same CATH topology
3KOJA 4QGUA 2D0OA 2ZTDA 4OXPA 4BBRG 4B3MQ 1XJVA 4BBRH 1S72A 3HOYH 1SE8A 2EIFA 3F8TA 1I3QH 2MNAA 1AE2A 1SN8A 2I0QA 4AQYL 1NJIC 3BJUA 4JCVE 2E2IH 1AH9A 2NZOA 3BZKA 2IX1A 4DV0Q 4BA2I 3CCMA 4R4CA 1PH3A 3KJOA 1XPRA 1TWAH 5BR8Q 2A8VA 2Q2UA 4JV5L 1K9MC 5C4XG 4OWWB 5C4XH 4AH6A 4KI0A 4LUZA 3T1YQ 1HZCA 3HOWG 5GAHC 4MTNA 1PH5A 2D62A 1V43A 2E2HH 3HOWH 3PO2H 3A5ZB 3EN2A 4X65L 1PH2A 3E9HA 4P72A 1IZ6A 2CCZA 1FGUA 4JI4Q 4LFCQ 3VDYA 2ID0A 4R4OA 3S15H 1YEZA 1N33Q 1Q46A 4C2MH 3PIPA 3J80c 1TWHH 4GLXA 1UE1A 1V9PA 1E24A 5IP7H 1H95A 2KHJA 1JJCB 2YTXA 3CPFA 1W2BA 2QEXA 4A3DG 5M3MH 4KHZA 5M3FG 4GN4B 3G4SA 5M3FH 3PF5A 1YJWA 3HOUH 3HOUG 3HOZG 2GN5A 2B3GA 2N49A 4XIGS 4B3ML 1XNQL 3HOZH 1HNWQ 1NTGA 2CQOA 2K5VA 2NVYH 1ASZA 2JA5G 1KIXA 4YWMA 1VQBA 2JA5H 2JEBI 3H0GG 1V1QA 3H0GH 3EIVA 1K8GA 4OO1G 2KCMA 1RL2A 4PMWA 3HKZE 3J80i 4GNXB 3F2DA 2JEAI 4R4QA 1IXRA 1CUKA 2IHEA 2VW9A 3AQQA 1PH6A 4DR6Q 4DV0L 4HJAA 4A76A 2E2JH 4JI3Q 1I6HH 1BVSA 2OQKA 5BR8L 4POGA 1JJGA 1X54A 4L5TA 3OYYA 3T1YL 2LXJA 3RZOH 4DV4Q 1N34Q 3M3YH 3CP0A 3I2ZA 4DR4Q 1W3SA 5FLXc 1EQQA 1VQ5A 4LFCL 1YJNA 4JI4L 1Y1WG 1Q81C 4LF9Q 1Y1WH 1QVFA 1N33L 1HNXQ 4NPSA 4UP8A 2E8GA 2Z0SA 5ELOA 4DV7Q 4OX9Q 4LFBQ 2ZM6Q 4YWLA 3PGZA 4TVAB 1KRTA 3GTPH 1A62A 4YCUA 2IX0A 3E0EA 1HNWL 3S1QH 4DV5Q 1MJEA 4QIWE 4LW1A 3CCRA 2UUBQ 2JQOA 3J7ZC 4A93G 4A93H 2PI2E 2WAQE 1XTDA 3I7FA 2VNUD 1UE7A 4AIMA 2N8NA 4A3FH 1J6QA 4O2DA 4QY7A 1WI5A 4JG2A 4P75A 4RG1A 5GADC 5C44G 4PG3A 5C0XI 5H1SE 1YHAA 1L1OB 5J3BA 3U50C 1N36Q 1GM5A 2R6GA 4DR6L 4JBKA 3HKZG 1G51A 4UPAA 5M5XH 4IFDI 1PVOA 3B6YA 4C3JH 3DLLA 1HZAA 4JI3L 1I94Q 1LUZA 2PQAA 1TXYA 2FXQA 5E7NA 2AKWB 4KLKA 3RZDH 1B70B 1YHQA 1PH8A 2NN6G 4NXMQ 3M85A 4JI2Q 4BY7G 4DV4L 4BY7H 1N34L 3G48A 2IT1A 3PSIA 5DLQE 4DR4L 2IY5B 1X3FA 1PH9A 4IFDJ 1PFSA 3KJPA 4LF9L 4GKKQ 4BY1H 1K73C 2JJQA 3M7NA 1HNXL 2Q2IA 3W5OA 4LF5L 4LF6Q 3S1NH 2K14A 3M4OH 1YZ6A 5FLMG 4LFBL 4IJLA 4OX9L 2B29A 2ZM6L 1QVCA 4B3RQ 1K3RA 4DKAC 3HKSA 4LNQA 2UUAQ 3PUZA 4GKJQ 4GS3A 5JJKA 3GTGH 4DV5L 2H5XA 1VQ7A 5JEAJ 4GLVB 3I4NG 3S2HH 3I4NH 2UUBL 2OTLA 4PZ6A 5K36G 4H02A 1PH4A 2YTYA 3UDXA 4BA1I 4A3EG 1XMOQ 4A3EH 4B3TQ 3H3VH 2ASBA 4FDBA 2WAQG 4UP7A 3RR5A 5JJIA 1N36L 4NB3A 2QA4A 1C9OA 1PHJA 4JI0Q 2BH2A 3UE1A 1I94L 4DAYB 3AFPA 4UP9A 4HJ7A 3GTLH 4LUOA 1YNXA 3ULJA 4DK3C 1NE3A 1NBWA 2I5HA 3RN2A 4HIDA 2F3IA 4NXML 4P73A 4APVA 4JI2L 2VQFQ 3K7AH 1LM0A 3KF6A 4GLAC 3STBD 1KQSA 2I5MX 3CQZH 5C3EG 3PF4A 3L0OA 1CKNB 5C3EH 1D8LA 1I5FA 4GKKL 1JT8A 3GDEA 3S16H 2NZHA 2CFMA 4LF6L 2MQHA 2XTIA 4B3RL 4IOCA 1CKOA 1N8RC 2UUAL 3U58A 4GKJL 2UXCQ 1VQPA 1UE6A 2VQEQ 3ULPA 4IO9A 4Y52H 4DV1L 1Z47A 1VS0A 2WB1E 2KHIA 4QL5A 1J5EQ 1Z9FA 1VQMA 1A63A 1YJ9A 1KAWA 1WOCA 1OXUA 3I56A 1CSPA 4XTCS 2I5LX 2XGTA 2D0PA 5HY6A 1SMXA 5IP7G 1X3GA 4WJ4A 2JA7G 2VS1A 5M3MG 2JA7H 1TWGH 4OWXB 1Y1VG 1N9WA 5IYBH 1Y1VH 1JJ2A 4JI0L 4GN5A 4DR1Q 5GROA 1PYBA 1T9HA 2L15A 2A1AA 3PIOA 2C35B 4LUVA 1VQ8A 1GD7A 3CAMA 1L0WA 2VQFL 2ZJQA 2OWOA 1XPUA 2UXBQ 4TQUS 3I4OA 3PUVA 2R7DA 2K50A 4A3KH 3H15A 3G71A 1C7YA 2GVAA 4A3LG 4HIMA 1G6PA 3FHWA 2VUMH 4A3LH 4X66Q 3TQYA 2Q2HA 3S24A 4IPGA 4DV6Q 4A3MG 2OQ0A 4A3MH 1M1KC 3CF5A 3RLNA 4YCVA 3STBC 2ALYB 2K4KA 3KF8B 2A19A 3TS0A 3JAMc 2UXCL 4DR3Q 2HHHQ 4X62Q 3CW2C 2VQEL 3CCUA 1WJJA 3UDFA 1S3OA 4HIKA 1VQLA 3I4MH 1J5EL 2ES2A 4K0KQ 4BXXG 3RNUA 4BXXH 1FL0A 1TWCH 1U0LA 1KD1C 2WB1G 1VQAA 1FJGQ 1YIJA 4JI5Q 4LWCA 2CWPA 1IBKQ 2HIVA 1IBLQ 2UU9Q 3F1ZA 4HJ9A 1EUJA 3MXNB 4A3GG 4A3GH 4AYBE 4DR1L 1ASYA 3GTQH 3JAMi 1X56A 3NEMA 1FVIA 5IT9c 2KCTA 4QQBX 4OONA 2YU9H 4JBWA 1OXVA 3KFUA 2K5HA 2MFIA 4DUYQ 4A3FG 3NENA 1Q86C 4LF4Q 4DAMA 2NVXH 2UXBL 1VQEA 1A8VA 5AJ3Q 4GOPB 1S40A 1N32Q 1A0IA 3CCEA 1WCMG 1WCMH 1YHBA 3NELA 3A74A 1NMGA 2HQLA 3CC7A 2WP8J 1KC8C 2N78A 4R1JA 5IYCG 3T1HQ 1I50H 2KBNA 3JC66 5IYCH 1VQJA 1GKHA 3CCSA 4X66L 2F4VQ 2UXDQ 4DV6L 4JYAQ 2K75A 3D31A 3BU2A 3CCQA 4GNXA 2OCEA 1LTLA 4DR3L 2HHHL 3CD6A 3KDFB 3PUWA 1QUQA 2AWNA 1OXSC 2JK8A 4MZ9A 4QJFA 5C4JH 4BY1G 5IY0A 4A4IA 4WJ3M 4X6AH 3GTOH 3K81C 4DR2Q 3CMAA 1PH1A 4K0KL 1KL9A 1G291 4J15A 3DM3A 3ER0A 2K52A 3IRBA 5GQOA 4LF8Q 4JI5L 4DV7L 5GAEC 2BA1A 1FJGL 1IBKL 4L5QA 3CC4A 3OTOQ 3GTKH 3M4PA 1IBLL 2UU9L 4NXNQ 1WYDA 1R9TH 4JOIC 3HOVG 1UWVA 2AWOA 3HOVH 2R92G 4JBMA 4Y7NH 2R92H 2N3SA 4JC0A 1SFOH 4AYBG 3ICEA 2JE6I 5EAYA 3J7A5 4DUYL 5LMUQ 4EX5A 2CWAA 2QGQA 1VQ4A 1YITA 1QZHA 4YWKA 4LF4L 3LGJA 3PO2G 1BBWA 1IYJB 1SROA 5AJ3L 3RN5A 1N32L 2HT1A 2PI2A 3TEHB 1IBMQ 1K8AC 3NBHB 1EOVA 1LYLA 1L2FA 3T1HL 4A75A 1JMCA 3CCLA 1HZ9A 3K80C 5C0XG 2F4VL 2UXDL 4JYAL 3W1GA 2NVQH 4ALPA 1CKMA 3W1BA 3K7UC 4MNOA 2RF4A 3PUXA 1BBUA 1SRUA 4JI7Q 4O0AA 1VQGA 1XPOA 3F2BA 1X65A 3GO5A 1U5KA 1XNRQ 2Z6KA 4X64Q 1K83H 4EQ5A 4DR2L 1IL2A 3CCJA 3PCOB 1Q12A 5HGQA 4LF8L 4HJ5A 5JJLA 3CCVA 1KHIA 3OTOL 1EIFA 1MKHA 1E3PA 4NXNL 4OO1I 3PUYA 4POFA 1HNZQ 2OTJA 3RLFA 1XNQQ 3S1RH 1X55A 1EWIA 4LF7Q 5ELNA 2DUDA 1HH2P 4B3SQ 4JI8Q 3PV0A 2E5LQ 1BKBA 3GTMH 2ZJRA 1UEBA 3M4QA 1MJCA 3RLOA 5LMUL 2KENA 4DV2Q 1VQFA 4JOIA 1HR0Q 2MO1A 5FJ8G 1PYSB 1O7IA 1OXTA 5FJ8H 1XMOL 4B3TL 4DR5Q 3PO3G 3PO3H 2YTVA 5IYBG 1IBML 2DGYA 3K8AA 3ULLA 1PV4A 2ZTEA 3CMEA 1SLJA 2LSSA 2ZJPA 3CXCA 1HR0W 1E22A 1HJPA 1E1OA 2R93G 2R93H 4DK6C 1MIUA 1NMFA 4IPDA 4JI7L 4UY8C 5IP9G 5IP9H 3TRZA 1Q8KA 4PZ8A 3S1MH 1DGSA 2F52A 3HOXG 1Q7YC 3HOXH 1KRSA 1XNRL 5IWAQ 2AHOB 3KLWA 4A3KG 1YVCA 4X64L 4IPCA 4GNXC 1YI2A 1VQHA 3K0XA 4LFAQ 2Q2TA 3L2PA 2VUMG 3M9BA 3A0JA 4JI6Q 2CKZB 4A3DH 1D7QA 3U4VA 1HNZL 1EIYB 2ATWA 1Q1BA 1CKNA 1VQCA 4YY3Q 4LF7L 3AFQA 3GTJH 4YHHQ 4JI8L 1UE5A 4B3SL 4IJHA 3G6EA 2E5LL 2PQAB 3TS2A 3SGIA 1HR0L 5M5WH 2RCNA 4DV2L 3CC2A 3OW2A 3ZJYC 3F2CA 4DR5L 2AMCB 1QVGA 1QUQB 1X6OA 2EXDA 3AEVA 3Q8DA 2NN6I 4DUZQ 1P8LA 3A5UA 1K0RA 2GVBA 2YV5A 4A3CG 4A3CH 4ME3A 4KHPQ 3GD7A 1WFQA 1QZGA 4A3BG 1AE3A 4A3BH 2R7FA 2UUCQ 2B63G 3TREA 2B63H 2Y0SE 2LXKA 3KYHC 4P74A 1Q1EA 3FP9A 5LMNQ 1VCIA 2BH8A 4HIOA 1VQ6A 2WFWA 1EFWA 5IWAL 4JI1Q 2VL6A 4GOPC 1CSQA 4JBJA 4L5RC 4LFAL 4LF5Q 1L1OC 4A3JG 1P16A 1PA6A 4A3JH 1JE5A 1X3EA 5LMNW 1YBYA 1OTCA 4DV3Q 1JB7A 2Z6KC 4DPGA 2VZAA 3L7ZC 4JI6L 2HIXA 1EQRA 1PH7A 3H3VI 4YY3L 4X62L 2YYZA 1XMQQ 4DR7Q 3ERSX 4YHHL 5IYDG 1X9NA 3CPWA 5IYDH 1VQNA 2RHQB 1NY4A 2VY3A 3HFZB 1Q82C 1GVPA 1VQIA 1B8AA 1B7YB 5C44H 2ZTCA 3D0FA 3KF6B 1VQOA 4C3HH 4IPHA 2MO0A 4DUZL 2PMZE 3E9IA 2NVTH 2R7ZG 1E7ZA 2V1CC 2R7ZH 2PNHA 3AYHB 3UE0A 3S2DH 1Y14B 3MEFA 4KHPL 3UDGA 2JA6G 4YCWA 4IOAA 3J81j 2UUCL 2JA6H 1E1TA 3FKIG 4AQYQ 1M90C 3FKIH 2BA0A 5C0XJ 4HJ8A 3I4MG 5M5YH 3S17H 4BBSG 3J81c 2RHSB 4BBSH 5LMNL 2Y0SG 3S14H 1GO3E 3EBEA 4R4IA 4JI1L 4GN3B 2IHFA 4A3IG 4L5SA 4A3IH 4DNIA 5FLMH 4JV5Q 4P71A 3UDIA 4DV3L 1C0AA 1KXLA 4IFDG 5GAGC 4PZ7A 4GOPA 1EYGA 1VQ9A 1L1OA 4RMFA 4X65Q 2JA9A 1VQDA 3J81i 1OXXK 1XMQL 4DR7L 3I55A 4DV1Q 1VQKA 4OWTB 3BZCA 3WWVA 2EQSA 2JA8G 4C3IH 2JA8H 5IE8A 1HZBA 3U4ZA 1SR3A 1RIPA 1TWFH 5JEAG 2K5NA 3KDFA 4R4TA 3HOYG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOJ A;  4QGU A;  2D0O A;  2ZTD A;  4OXP A;  4BBR G;  4B3M Q;  1XJV A;  4BBR H;  1S72 A;  3HOY H;  1SE8 A;  2EIF A;  3F8T A;  1I3Q H;  2MNA A;  1AE2 A;  1SN8 A;  2I0Q A;  4AQY L;  1NJI C;  3BJU A;  4JCV E;  2E2I H;  1AH9 A;  2NZO A;  3BZK A;  2IX1 A;  4DV0 Q;  4BA2 I;  3CCM A;  4R4C A;  1PH3 A;  3KJO A;  1XPR A;  1TWA H;  5BR8 Q;  2A8V A;  2Q2U A;  4JV5 L;  1K9M C;  5C4X G;  4OWW B;  5C4X H;  4AH6 A;  4KI0 A;  4LUZ A;  3T1Y Q;  1HZC A;  3HOW G;  5GAH C;  4MTN A;  1PH5 A;  2D62 A;  1V43 A;  2E2H H;  3HOW H;  3PO2 H;  3A5Z B;  3EN2 A;  4X65 L;  1PH2 A;  3E9H A;  4P72 A;  1IZ6 A;  2CCZ A;  1FGU A;  4JI4 Q;  4LFC Q;  3VDY A;  2ID0 A;  4R4O A;  3S15 H;  1YEZ A;  1N33 Q;  1Q46 A;  4C2M H;  3PIP A;  3J80 c;  1TWH H;  4GLX A;  1UE1 A;  1V9P A;  1E24 A;  5IP7 H;  1H95 A;  2KHJ A;  1JJC B;  2YTX A;  3CPF A;  1W2B A;  2QEX A;  4A3D G;  5M3M H;  4KHZ A;  5M3F G;  4GN4 B;  3G4S A;  5M3F H;  3PF5 A;  1YJW A;  3HOU H;  3HOU G;  3HOZ G;  2GN5 A;  2B3G A;  2N49 A;  4XIG S;  4B3M L;  1XNQ L;  3HOZ H;  1HNW Q;  1NTG A;  2CQO A;  2K5V A;  2NVY H;  1ASZ A;  2JA5 G;  1KIX A;  4YWM A;  1VQB A;  2JA5 H;  2JEB I;  3H0G G;  1V1Q A;  3H0G H;  3EIV A;  1K8G A;  4OO1 G;  2KCM A;  1RL2 A;  4PMW A;  3HKZ E;  3J80 i;  4GNX B;  3F2D A;  2JEA I;  4R4Q A;  1IXR A;  1CUK A;  2IHE A;  2VW9 A;  3AQQ A;  1PH6 A;  4DR6 Q;  4DV0 L;  4HJA A;  4A76 A;  2E2J H;  4JI3 Q;  1I6H H;  1BVS A;  2OQK A;  5BR8 L;  4POG A;  1JJG A;  1X54 A;  4L5T A;  3OYY A;  3T1Y L;  2LXJ A;  3RZO H;  4DV4 Q;  1N34 Q;  3M3Y H;  3CP0 A;  3I2Z A;  4DR4 Q;  1W3S A;  5FLX c;  1EQQ A;  1VQ5 A;  4LFC L;  1YJN A;  4JI4 L;  1Y1W G;  1Q81 C;  4LF9 Q;  1Y1W H;  1QVF A;  1N33 L;  1HNX Q;  4NPS A;  4UP8 A;  2E8G A;  2Z0S A;  5ELO A;  4DV7 Q;  4OX9 Q;  4LFB Q;  2ZM6 Q;  4YWL A;  3PGZ A;  4TVA B;  1KRT A;  3GTP H;  1A62 A;  4YCU A;  2IX0 A;  3E0E A;  1HNW L;  3S1Q H;  4DV5 Q;  1MJE A;  4QIW E;  4LW1 A;  3CCR A;  2UUB Q;  2JQO A;  3J7Z C;  4A93 G;  4A93 H;  2PI2 E;  2WAQ E;  1XTD A;  3I7F A;  2VNU D;  1UE7 A;  4AIM A;  2N8N A;  4A3F H;  1J6Q A;  4O2D A;  4QY7 A;  1WI5 A;  4JG2 A;  4P75 A;  4RG1 A;  5GAD C;  5C44 G;  4PG3 A;  5C0X I;  5H1S E;  1YHA A;  1L1O B;  5J3B A;  3U50 C;  1N36 Q;  1GM5 A;  2R6G A;  4DR6 L;  4JBK A;  3HKZ G;  1G51 A;  4UPA A;  5M5X H;  4IFD I;  1PVO A;  3B6Y A;  4C3J H;  3DLL A;  1HZA A;  4JI3 L;  1I94 Q;  1LUZ A;  2PQA A;  1TXY A;  2FXQ A;  5E7N A;  2AKW B;  4KLK A;  3RZD H;  1B70 B;  1YHQ A;  1PH8 A;  2NN6 G;  4NXM Q;  3M85 A;  4JI2 Q;  4BY7 G;  4DV4 L;  4BY7 H;  1N34 L;  3G48 A;  2IT1 A;  3PSI A;  5DLQ E;  4DR4 L;  2IY5 B;  1X3F A;  1PH9 A;  4IFD J;  1PFS A;  3KJP A;  4LF9 L;  4GKK Q;  4BY1 H;  1K73 C;  2JJQ A;  3M7N A;  1HNX L;  2Q2I A;  3W5O A;  4LF5 L;  4LF6 Q;  3S1N H;  2K14 A;  3M4O H;  1YZ6 A;  5FLM G;  4LFB L;  4IJL A;  4OX9 L;  2B29 A;  2ZM6 L;  1QVC A;  4B3R Q;  1K3R A;  4DKA C;  3HKS A;  4LNQ A;  2UUA Q;  3PUZ A;  4GKJ Q;  4GS3 A;  5JJK A;  3GTG H;  4DV5 L;  2H5X A;  1VQ7 A;  5JEA J;  4GLV B;  3I4N G;  3S2H H;  3I4N H;  2UUB L;  2OTL A;  4PZ6 A;  5K36 G;  4H02 A;  1PH4 A;  2YTY A;  3UDX A;  4BA1 I;  4A3E G;  1XMO Q;  4A3E H;  4B3T Q;  3H3V H;  2ASB A;  4FDB A;  2WAQ G;  4UP7 A;  3RR5 A;  5JJI A;  1N36 L;  4NB3 A;  2QA4 A;  1C9O A;  1PHJ A;  4JI0 Q;  2BH2 A;  3UE1 A;  1I94 L;  4DAY B;  3AFP A;  4UP9 A;  4HJ7 A;  3GTL H;  4LUO A;  1YNX A;  3ULJ A;  4DK3 C;  1NE3 A;  1NBW A;  2I5H A;  3RN2 A;  4HID A;  2F3I A;  4NXM L;  4P73 A;  4APV A;  4JI2 L;  2VQF Q;  3K7A H;  1LM0 A;  3KF6 A;  4GLA C;  3STB D;  1KQS A;  2I5M X;  3CQZ H;  5C3E G;  3PF4 A;  3L0O A;  1CKN B;  5C3E H;  1D8L A;  1I5F A;  4GKK L;  1JT8 A;  3GDE A;  3S16 H;  2NZH A;  2CFM A;  4LF6 L;  2MQH A;  2XTI A;  4B3R L;  4IOC A;  1CKO A;  1N8R C;  2UUA L;  3U58 A;  4GKJ L;  2UXC Q;  1VQP A;  1UE6 A;  2VQE Q;  3ULP A;  4IO9 A;  4Y52 H;  4DV1 L;  1Z47 A;  1VS0 A;  2WB1 E;  2KHI A;  4QL5 A;  1J5E Q;  1Z9F A;  1VQM A;  1A63 A;  1YJ9 A;  1KAW A;  1WOC A;  1OXU A;  3I56 A;  1CSP A;  4XTC S;  2I5L X;  2XGT A;  2D0P A;  5HY6 A;  1SMX A;  5IP7 G;  1X3G A;  4WJ4 A;  2JA7 G;  2VS1 A;  5M3M G;  2JA7 H;  1TWG H;  4OWX B;  1Y1V G;  1N9W A;  5IYB H;  1Y1V H;  1JJ2 A;  4JI0 L;  4GN5 A;  4DR1 Q;  5GRO A;  1PYB A;  1T9H A;  2L15 A;  2A1A A;  3PIO A;  2C35 B;  4LUV A;  1VQ8 A;  1GD7 A;  3CAM A;  1L0W A;  2VQF L;  2ZJQ A;  2OWO A;  1XPU A;  2UXB Q;  4TQU S;  3I4O A;  3PUV A;  2R7D A;  2K50 A;  4A3K H;  3H15 A;  3G71 A;  1C7Y A;  2GVA A;  4A3L G;  4HIM A;  1G6P A;  3FHW A;  2VUM H;  4A3L H;  4X66 Q;  3TQY A;  2Q2H A;  3S24 A;  4IPG A;  4DV6 Q;  4A3M G;  2OQ0 A;  4A3M H;  1M1K C;  3CF5 A;  3RLN A;  4YCV A;  3STB C;  2ALY B;  2K4K A;  3KF8 B;  2A19 A;  3TS0 A;  3JAM c;  2UXC L;  4DR3 Q;  2HHH Q;  4X62 Q;  3CW2 C;  2VQE L;  3CCU A;  1WJJ A;  3UDF A;  1S3O A;  4HIK A;  1VQL A;  3I4M H;  1J5E L;  2ES2 A;  4K0K Q;  4BXX G;  3RNU A;  4BXX H;  1FL0 A;  1TWC H;  1U0L A;  1KD1 C;  2WB1 G;  1VQA A;  1FJG Q;  1YIJ A;  4JI5 Q;  4LWC A;  2CWP A;  1IBK Q;  2HIV A;  1IBL Q;  2UU9 Q;  3F1Z A;  4HJ9 A;  1EUJ A;  3MXN B;  4A3G G;  4A3G H;  4AYB E;  4DR1 L;  1ASY A;  3GTQ H;  3JAM i;  1X56 A;  3NEM A;  1FVI A;  5IT9 c;  2KCT A;  4QQB X;  4OON A;  2YU9 H;  4JBW A;  1OXV A;  3KFU A;  2K5H A;  2MFI A;  4DUY Q;  4A3F G;  3NEN A;  1Q86 C;  4LF4 Q;  4DAM A;  2NVX H;  2UXB L;  1VQE A;  1A8V A;  5AJ3 Q;  4GOP B;  1S40 A;  1N32 Q;  1A0I A;  3CCE A;  1WCM G;  1WCM H;  1YHB A;  3NEL A;  3A74 A;  1NMG A;  2HQL A;  3CC7 A;  2WP8 J;  1KC8 C;  2N78 A;  4R1J A;  5IYC G;  3T1H Q;  1I50 H;  2KBN A;  3JC6 6;  5IYC H;  1VQJ A;  1GKH A;  3CCS A;  4X66 L;  2F4V Q;  2UXD Q;  4DV6 L;  4JYA Q;  2K75 A;  3D31 A;  3BU2 A;  3CCQ A;  4GNX A;  2OCE A;  1LTL A;  4DR3 L;  2HHH L;  3CD6 A;  3KDF B;  3PUW A;  1QUQ A;  2AWN A;  1OXS C;  2JK8 A;  4MZ9 A;  4QJF A;  5C4J H;  4BY1 G;  5IY0 A;  4A4I A;  4WJ3 M;  4X6A H;  3GTO H;  3K81 C;  4DR2 Q;  3CMA A;  1PH1 A;  4K0K L;  1KL9 A;  1G29 1;  4J15 A;  3DM3 A;  3ER0 A;  2K52 A;  3IRB A;  5GQO A;  4LF8 Q;  4JI5 L;  4DV7 L;  5GAE C;  2BA1 A;  1FJG L;  1IBK L;  4L5Q A;  3CC4 A;  3OTO Q;  3GTK H;  3M4P A;  1IBL L;  2UU9 L;  4NXN Q;  1WYD A;  1R9T H;  4JOI C;  3HOV G;  1UWV A;  2AWO A;  3HOV H;  2R92 G;  4JBM A;  4Y7N H;  2R92 H;  2N3S A;  4JC0 A;  1SFO H;  4AYB G;  3ICE A;  2JE6 I;  5EAY A;  3J7A 5;  4DUY L;  5LMU Q;  4EX5 A;  2CWA A;  2QGQ A;  1VQ4 A;  1YIT A;  1QZH A;  4YWK A;  4LF4 L;  3LGJ A;  3PO2 G;  1BBW A;  1IYJ B;  1SRO A;  5AJ3 L;  3RN5 A;  1N32 L;  2HT1 A;  2PI2 A;  3TEH B;  1IBM Q;  1K8A C;  3NBH B;  1EOV A;  1LYL A;  1L2F A;  3T1H L;  4A75 A;  1JMC A;  3CCL A;  1HZ9 A;  3K80 C;  5C0X G;  2F4V L;  2UXD L;  4JYA L;  3W1G A;  2NVQ H;  4ALP A;  1CKM A;  3W1B A;  3K7U C;  4MNO A;  2RF4 A;  3PUX A;  1BBU A;  1SRU A;  4JI7 Q;  4O0A A;  1VQG A;  1XPO A;  3F2B A;  1X65 A;  3GO5 A;  1U5K A;  1XNR Q;  2Z6K A;  4X64 Q;  1K83 H;  4EQ5 A;  4DR2 L;  1IL2 A;  3CCJ A;  3PCO B;  1Q12 A;  5HGQ A;  4LF8 L;  4HJ5 A;  5JJL A;  3CCV A;  1KHI A;  3OTO L;  1EIF A;  1MKH A;  1E3P A;  4NXN L;  4OO1 I;  3PUY A;  4POF A;  1HNZ Q;  2OTJ A;  3RLF A;  1XNQ Q;  3S1R H;  1X55 A;  1EWI A;  4LF7 Q;  5ELN A;  2DUD A;  1HH2 P;  4B3S Q;  4JI8 Q;  3PV0 A;  2E5L Q;  1BKB A;  3GTM H;  2ZJR A;  1UEB A;  3M4Q A;  1MJC A;  3RLO A;  5LMU L;  2KEN A;  4DV2 Q;  1VQF A;  4JOI A;  1HR0 Q;  2MO1 A;  5FJ8 G;  1PYS B;  1O7I A;  1OXT A;  5FJ8 H;  1XMO L;  4B3T L;  4DR5 Q;  3PO3 G;  3PO3 H;  2YTV A;  5IYB G;  1IBM L;  2DGY A;  3K8A A;  3ULL A;  1PV4 A;  2ZTE A;  3CME A;  1SLJ A;  2LSS A;  2ZJP A;  3CXC A;  1HR0 W;  1E22 A;  1HJP A;  1E1O A;  2R93 G;  2R93 H;  4DK6 C;  1MIU A;  1NMF A;  4IPD A;  4JI7 L;  4UY8 C;  5IP9 G;  5IP9 H;  3TRZ A;  1Q8K A;  4PZ8 A;  3S1M H;  1DGS A;  2F52 A;  3HOX G;  1Q7Y C;  3HOX H;  1KRS A;  1XNR L;  5IWA Q;  2AHO B;  3KLW A;  4A3K G;  1YVC A;  4X64 L;  4IPC A;  4GNX C;  1YI2 A;  1VQH A;  3K0X A;  4LFA Q;  2Q2T A;  3L2P A;  2VUM G;  3M9B A;  3A0J A;  4JI6 Q;  2CKZ B;  4A3D H;  1D7Q A;  3U4V A;  1HNZ L;  1EIY B;  2ATW A;  1Q1B A;  1CKN A;  1VQC A;  4YY3 Q;  4LF7 L;  3AFQ A;  3GTJ H;  4YHH Q;  4JI8 L;  1UE5 A;  4B3S L;  4IJH A;  3G6E A;  2E5L L;  2PQA B;  3TS2 A;  3SGI A;  1HR0 L;  5M5W H;  2RCN A;  4DV2 L;  3CC2 A;  3OW2 A;  3ZJY C;  3F2C A;  4DR5 L;  2AMC B;  1QVG A;  1QUQ B;  1X6O A;  2EXD A;  3AEV A;  3Q8D A;  2NN6 I;  4DUZ Q;  1P8L A;  3A5U A;  1K0R A;  2GVB A;  2YV5 A;  4A3C G;  4A3C H;  4ME3 A;  4KHP Q;  3GD7 A;  1WFQ A;  1QZG A;  4A3B G;  1AE3 A;  4A3B H;  2R7F A;  2UUC Q;  2B63 G;  3TRE A;  2B63 H;  2Y0S E;  2LXK A;  3KYH C;  4P74 A;  1Q1E A;  3FP9 A;  5LMN Q;  1VCI A;  2BH8 A;  4HIO A;  1VQ6 A;  2WFW A;  1EFW A;  5IWA L;  4JI1 Q;  2VL6 A;  4GOP C;  1CSQ A;  4JBJ A;  4L5R C;  4LFA L;  4LF5 Q;  1L1O C;  4A3J G;  1P16 A;  1PA6 A;  4A3J H;  1JE5 A;  1X3E A;  5LMN W;  1YBY A;  1OTC A;  4DV3 Q;  1JB7 A;  2Z6K C;  4DPG A;  2VZA A;  3L7Z C;  4JI6 L;  2HIX A;  1EQR A;  1PH7 A;  3H3V I;  4YY3 L;  4X62 L;  2YYZ A;  1XMQ Q;  4DR7 Q;  3ERS X;  4YHH L;  5IYD G;  1X9N A;  3CPW A;  5IYD H;  1VQN A;  2RHQ B;  1NY4 A;  2VY3 A;  3HFZ B;  1Q82 C;  1GVP A;  1VQI A;  1B8A A;  1B7Y B;  5C44 H;  2ZTC A;  3D0F A;  3KF6 B;  1VQO A;  4C3H H;  4IPH A;  2MO0 A;  4DUZ L;  2PMZ E;  3E9I A;  2NVT H;  2R7Z G;  1E7Z A;  2V1C C;  2R7Z H;  2PNH A;  3AYH B;  3UE0 A;  3S2D H;  1Y14 B;  3MEF A;  4KHP L;  3UDG A;  2JA6 G;  4YCW A;  4IOA A;  3J81 j;  2UUC L;  2JA6 H;  1E1T A;  3FKI G;  4AQY Q;  1M90 C;  3FKI H;  2BA0 A;  5C0X J;  4HJ8 A;  3I4M G;  5M5Y H;  3S17 H;  4BBS G;  3J81 c;  2RHS B;  4BBS H;  5LMN L;  2Y0S G;  3S14 H;  1GO3 E;  3EBE A;  4R4I A;  4JI1 L;  4GN3 B;  2IHF A;  4A3I G;  4L5S A;  4A3I H;  4DNI A;  5FLM H;  4JV5 Q;  4P71 A;  3UDI A;  4DV3 L;  1C0A A;  1KXL A;  4IFD G;  5GAG C;  4PZ7 A;  4GOP A;  1EYG A;  1VQ9 A;  1L1O A;  4RMF A;  4X65 Q;  2JA9 A;  1VQD A;  3J81 i;  1OXX K;  1XMQ L;  4DR7 L;  3I55 A;  4DV1 Q;  1VQK A;  4OWT B;  3BZC A;  3WWV A;  2EQS A;  2JA8 G;  4C3I H;  2JA8 H;  5IE8 A;  1HZB A;  3U4Z A;  1SR3 A;  1RIP A;  1TWF H;  5JEA G;  2K5N A;  3KDF A;  4R4T A;  3HOY G; 
#chains in the Genus database with same CATH topology
 2D0O A;  1ICW A;  2ZTD A;  4OXP A;  3HOY H;  2EIF A;  1QE6 A;  2MNA A;  2I0Q A;  3PQI A;  4JCV E;  2OEO A;  2NZO A;  3BZK A;  3QB3 A;  2IX1 A;  1Q8I A;  4Z9C B;  4BA2 I;  1PH3 A;  4G57 A;  4RH6 A;  4JV5 L;  5C4X H;  2VB3 X;  4LUZ A;  1PH5 A;  2D62 A;  2E2H H;  2A73 B;  3PO2 H;  3A5Z B;  1D5M C;  4JI4 Q;  2ID0 A;  1V1P A;  3G6J B;  3NK9 A;  1JR0 D;  3NQI A;  3GTQ B;  1Q46 A;  3J80 c;  3QOL A;  1TWH H;  2G9D A;  1V9P A;  4S3S A;  2YU9 B;  4ZAI A;  4A93 B;  4KK7 A;  3CPF A;  2N88 A;  2QEX A;  3HOU G;  3OHX C;  4CBV A;  5M3F H;  4R8I A;  1XNQ L;  3HOZ H;  2F0V A;  1PMR A;  2JA5 H;  3BYY B;  1KIX A;  2JEB I;  3H0G G;  1V1Q A;  1I50 B;  3EIV A;  2KCM A;  2EVB A;  4TKO B;  4GNX B;  2IHE A;  2LY7 A;  3SHL A;  1PH6 A;  2E2J H;  4K2L A;  1BVS A;  5ELB A;  2OQK A;  4EQO A;  4BY1 B;  4K5X A;  1Y69 U;  4L5T A;  3M4O B;  2B2Y A;  1N34 Q;  3CP0 A;  3KLS X;  3GTK B;  2PZU A;  4JI4 L;  1Y1W G;  4KKS A;  4RKB A;  3T51 B;  4DV7 Q;  2HCC A;  4LFB Q;  2KA7 A;  3GTP H;  3VR5 A;  3KBX A;  3E0E A;  1JC7 A;  5J1Z A;  3S1Q H;  2M2L A;  3K5M A;  1MJE A;  3J7Z C;  2C5C A;  2PI2 E;  2IW3 A;  3K5O A;  1XTD A;  2EYL A;  1J6Q A;  3TS2 A;  5C44 G;  1XPU A;  1LT4 D;  3U50 C;  2SOB A;  3HKZ G;  4UPA A;  4C56 C;  5I2Y A;  4DFA A;  1LUZ A;  4ZUJ A;  2NBF A;  4KLK A;  1B70 B;  2NN6 H;  1N34 L;  3PSI A;  2IY5 B;  1PFS A;  3NUC A;  2Q2I A;  3S1N H;  4KD4 A;  4LFB L;  2AQ2 B;  3HKS A;  2L5T A;  4GKJ Q;  3GTG H;  4XT3 B;  5JEA J;  3A7L A;  5JPN C;  3Q23 A;  4H02 A;  5K36 H;  2WV6 D;  3UDX A;  4FDB A;  2WAQ G;  4UP7 A;  1AEX A;  1EY7 A;  2QA4 A;  1PHJ A;  4HJ7 A;  3GTL H;  3ONA B;  4TSS A;  5ELE A;  3RN2 A;  4HID A;  2LS0 1;  4APV A;  3SR1 A;  2B2U C;  1LM0 A;  3STB D;  3MXG A;  2FMM A;  1CKN B;  3L0O A;  3NWT A;  5C3E H;  1I5F A;  4CJ1 B;  2DY8 A;  3GTJ B;  1G91 A;  3V2T A;  1VMC A;  3KLR A;  1A15 A;  5M5W B;  1CA6 A;  1B9M A;  4IOC A;  1CKO A;  4GKJ L;  2UXC Q;  1VQP A;  2B2V C;  4M8A A;  2KHI A;  3FDT A;  2ZXR A;  1JQY D;  4H44 C;  4QL5 A;  1VQM A;  4OIK A;  1J5E Q;  4FYD A;  2FJ2 A;  1WOC A;  3D6W A;  2B63 B;  4ID6 A;  2I5L X;  1SMX A;  4P2C B;  1RKN A;  1TWG H;  1Y1V G;  2F0F A;  4GN5 A;  4DR1 Q;  1I4P A;  3I70 A;  1PFM A;  1T9H A;  5C5M A;  4HSV A;  1FNV A;  3VYR A;  1L0W A;  2OWO A;  3T16 A;  2UXB Q;  2QDB A;  3E5S A;  2R7D A;  4WJW A;  3V96 A;  1DON A;  1KLU D;  2GVA A;  1SNM A;  4HIM A;  3FHW A;  4LNQ A;  1I4R A;  2HUG A;  1XWE A;  2K4K A;  1EIG A;  2A19 A;  2UXC L;  4KHV A;  4DR3 Q;  1CHP D;  3CW2 C;  4IAL A;  1YNN C;  3H6M A;  2R7Z B;  4X3S A;  1VQL A;  1J5E L;  3A55 A;  5FO7 B;  2ES2 A;  4K0K Q;  1CQV A;  3FKI B;  4LWC A;  3S17 B;  1IBL Q;  2UU9 Q;  1A3T A;  1IW7 C;  1EUJ A;  4A3G H;  4DR1 L;  1ASY A;  3GTQ H;  2OXP A;  3NEM A;  4QQB X;  2YU9 H;  4DUY Q;  5I6W A;  4LF4 Q;  2UXB L;  2NVQ B;  5AJ3 Q;  1N32 Q;  1NSN S;  1A0I A;  3CCE A;  3A74 A;  2LMC B;  3T1H Q;  1I50 H;  5IYC H;  2KOL A;  2MP1 A;  2JA8 B;  2E76 C;  1LTL A;  3R2T A;  5KEE A;  4DR3 L;  1OXS C;  3DMU A;  5IY0 A;  3CU7 A;  4WJ3 M;  3GTO H;  3K81 C;  2IWH A;  4DR2 Q;  4K0K L;  4ZK9 B;  4J15 A;  3DM3 A;  3IRB A;  2IPK D;  4LF8 Q;  1LTS D;  3OWE B;  3CC4 A;  3GTK H;  1IBL L;  2UU9 L;  1BXT A;  4F8M A;  4JOI C;  3A8I E;  3K5L A;  5IGD A;  4Y7N H;  4JBM A;  3OMC A;  1SFO H;  2NUC A;  5EAY A;  4DUY L;  4LF4 L;  2QGQ A;  3G7L A;  1NNX A;  1BBW A;  5AJ3 L;  1N32 L;  1L0X B;  2F0U A;  2QCP X;  3CRL C;  3T1H L;  1L2F A;  5C0X H;  4C2M B;  4EVO A;  3LWE A;  3FVQ A;  1J9O A;  1WD0 A;  3K7U C;  4JI7 Q;  1D2B A;  4O0A A;  5D3I B;  1VQG A;  4M1U B;  3R3O A;  3SK8 A;  4CGY B;  2NVY B;  4DR2 L;  2XNA C;  3CCJ A;  5HGQ A;  3H0G B;  2B2T A;  4LF8 L;  4HJ5 A;  3T13 A;  5C4Z A;  4TRD A;  3IL8 A;  4OO1 I;  2OTJ A;  1HH2 P;  4Q0F A;  5EPK A;  3SDZ A;  2G5D A;  2KEN A;  1VQF A;  5HUR A;  4A3B B;  2BDO A;  1O7I A;  4XDX A;  4G7Z C;  2MGS A;  4DR5 Q;  3PO3 G;  1EOT A;  2ICE C;  2RSO A;  2A6E C;  2EJM A;  2DGY A;  1DJR D;  3I72 A;  1E0B A;  3CME A;  2ZJP A;  1Y1W B;  1E22 A;  1HJP A;  1E1O A;  5DM7 3;  1PFB A;  4JI7 L;  4UY8 C;  1IHZ A;  1F9R A;  4JW0 A;  1DGS A;  1IL8 A;  4N9P A;  1YVC A;  4GNX C;  1YI2 A;  2Q2T A;  1CT1 D;  1STH A;  3L2P A;  1SMY C;  2KCC A;  3A0J A;  2MPM A;  4JI6 Q;  3U4V A;  3EQL C;  1GXD C;  5C44 B;  1EIY B;  5CGK A;  1VQC A;  4YY3 Q;  3HKZ B;  3GTJ H;  4IUQ A;  4ODG A;  3TP7 A;  5CR3 A;  2PQA B;  5M5W H;  2A6H D;  2F0T A;  3OW2 A;  3ZJY C;  3KLS A;  4DR5 L;  2AMC B;  4G4K A;  3MTS A;  1QUQ B;  1UAP A;  2EXD A;  4FO2 A;  2QIL A;  1MD2 D;  3NQT A;  3ERQ A;  1JOK A;  1G2T A;  4A3C H;  3GD7 A;  4L6T B;  4HSP A;  1H9S B;  2UUC Q;  2B63 H;  2CW0 D;  2ZXP A;  1A6X A;  4CHT B;  3KYH C;  1B9N A;  3FP9 A;  5LMN Q;  1SYB A;  2O4X A;  3J7A V;  1SE2 A;  1S5C D;  2VL6 A;  3S2H B;  4A3J H;  1OTC A;  4DV3 Q;  4JI6 L;  2Z6K C;  3D6C A;  2VZA A;  3L7Z C;  5EPL A;  4DPG A;  2WAQ B;  3TBI B;  4YY3 L;  4X62 L;  2J4X A;  2Z4H A;  5IYD H;  2DNC A;  2RHQ B;  1VQN A;  1JWS D;  2PMZ B;  1FGB D;  3RUZ A;  1B7Y B;  2EE1 A;  3SK5 A;  1EL0 A;  4IPH A;  3TDQ A;  3CQZ B;  3E9I A;  3S2D H;  1E7Z A;  2R7Z H;  3NTK A;  3UDG A;  4KN4 C;  1TKW B;  2UUC L;  2F1M A;  2EDG A;  3FKI H;  3S17 H;  4BBS G;  5C4X B;  5LMN L;  2Y0S G;  1GO3 E;  3EBE A;  1AZP A;  3PO2 B;  3BDL A;  3GP7 A;  2E2H B;  2ZT9 C;  1RTN A;  1EWC A;  4MHE A;  3EFX D;  1PZK D;  3TP5 A;  3P1H A;  3VR6 A;  4DV3 L;  4GOP A;  1L1O A;  4X65 Q;  1SND A;  1STB A;  1SJE D;  2JA5 B;  2Z9H A;  3MWY W;  2JA8 H;  1DOM A;  5HGT A;  3DXJ C;  1HZB A;  1H9M A;  1F2M A;  3IFT A;  5JEA G;  3KDF A;  4BBR G;  2PW5 A;  3I8Z A;  3TZD A;  1SN8 A;  4KTA A;  2RSN A;  1NJI C;  3BJU A;  1SBB B;  1F2Y A;  4R4C A;  1IKL A;  1HCZ A;  2A8V A;  2Q2U A;  2BOS A;  1X3Q A;  3WOE A;  4AH6 A;  1DD2 A;  4KI0 A;  1XXG A;  5JVH 3;  2DNE A;  3T1Y Q;  1HZC A;  3K5N A;  1CFM A;  2EYJ A;  4RA8 A;  5J22 A;  3EN2 A;  4X65 L;  1IZ6 A;  3J7Y W;  1FGU A;  4LFC Q;  3NP8 A;  3VDY A;  4R4O A;  4C2M H;  3PIP A;  1F9S A;  2FIN B;  4GLX A;  1UE1 A;  5IP7 H;  2KHJ A;  1JJC B;  5G3L F;  3I4L A;  4KHZ A;  4HMI A;  1UNS A;  4GN4 B;  3BYT B;  5IGE A;  3PF5 A;  3HOU H;  3QO2 A;  1EY6 A;  2GN5 A;  5D3D A;  1NTG A;  2NVY H;  2QDL A;  3H0G H;  1OO9 B;  2TSS A;  1RL2 A;  5E3F A;  4FF3 A;  3HKZ E;  1HPC A;  3F2D A;  3IAY A;  4PV1 C;  3BVG A;  5EKL A;  3NTH A;  2EY2 A;  3T1Y L;  2LXJ A;  5ELC A;  4PMB A;  1D6E C;  1W3S A;  1GUN A;  4LFC L;  1Y1W H;  4BS9 A;  1HNX Q;  2QKI C;  4NPS A;  2B2V A;  4YWL A;  3PGZ A;  3DWP A;  4YCU A;  1HXY D;  2IX0 A;  3E6Z X;  5DEH A;  3SE0 A;  2KUM A;  2UUB Q;  2XIW A;  1EU4 A;  2RVL A;  2WAQ E;  3I7F A;  2VNU D;  1SYF A;  3U9O A;  3RMH A;  4O2D A;  4QY7 A;  1WI5 A;  5J3B A;  3AB9 A;  1G51 A;  5I6Y A;  4C3J G;  1K8M A;  3DLL A;  1I94 Q;  1YHQ A;  3RZD H;  1SNC A;  4NXM Q;  2X6L A;  4JI2 Q;  3G48 A;  2IT1 A;  5DLQ E;  4IFD J;  2XSC A;  4CKC A;  4GKK Q;  2AQ1 B;  1HNX L;  4N9T A;  3W5O A;  4LF5 L;  4LF6 Q;  2K14 A;  2AQ3 B;  2L1B A;  1QVC A;  2MJ8 A;  1K3R A;  4HAE A;  2F3V A;  3PO3 B;  4CDF C;  3I4N G;  2QEJ C;  3S2H H;  2UUB L;  2K32 A;  2OTL A;  4OGQ C;  2YTY A;  4A3E G;  2M00 A;  1PH4 A;  1XMO Q;  4B3T Q;  1ZKO A;  1EY5 A;  3NWS A;  4NB3 A;  1I94 L;  4DAY B;  4K6L A;  2Q8I B;  3QJY A;  3CRK C;  1SEB D;  3HS0 C;  1A3V A;  3ULJ A;  4DK3 C;  3AMU A;  1NBW A;  1H9R A;  4NXM L;  4P73 A;  4R9W A;  4JI2 L;  1HUM A;  3K7A H;  4C1N K;  2I5M X;  3CQZ H;  2ICI A;  1F9P A;  4GKK L;  3HEJ A;  4OL7 A;  4J6H A;  2CFM A;  4LF6 L;  3GV6 A;  3VYS A;  4CKB A;  2XTI A;  1TR5 A;  1N8R C;  2J7Z A;  1HUN A;  1IW7 D;  3OOC A;  1GHK A;  4A3G B;  1BCP C;  1PZI D;  1VMP A;  2PCF B;  1LT6 D;  1KAW A;  1OXU A;  4ZKB B;  1CSP A;  4XTC S;  5EJW A;  3MFG A;  2F0I A;  2NZ1 D;  3T4A C;  5IP7 G;  4OWX B;  1N9W A;  1CK1 A;  1Y1V H;  5IYB H;  1J8I A;  2RDG A;  5GRO A;  1CTM A;  2L15 A;  1UUP A;  3PIO A;  3LWU A;  2L11 A;  1GD7 A;  2ZJQ A;  4DXF A;  3KBG A;  3PUV A;  1VF7 A;  4G7O C;  4A3K H;  3G71 A;  1C7Y A;  4KMU C;  1M4V A;  4A3L G;  2A69 C;  1WVL A;  3M4Y A;  2Q2H A;  3TQY A;  4H13 C;  4IPG A;  3GTO B;  1IYV A;  3URY A;  1S5D D;  2EYH A;  4YCV A;  3RLN A;  3KF8 B;  3TS0 A;  1XYI A;  2EXZ A;  2HHH Q;  1E2W A;  2VB2 X;  4NDX A;  1WJJ A;  5CC4 A;  4BXX G;  4Y7N B;  3RNU A;  4H7B A;  1TWC H;  1SFO B;  1Y8O B;  5BN5 A;  2WB1 G;  1VQA A;  3BZD B;  2CWP A;  1IBK Q;  3NHH A;  5JAV A;  2Y0S B;  4HJ9 A;  1SNQ A;  1F2L A;  3JAM i;  1HHV A;  4OON A;  1EWH A;  2MFI A;  1Q86 C;  3VA7 A;  4DAM A;  1MBY A;  3V05 A;  4IUR A;  2F0W A;  1NUC A;  1SXT A;  3NEL A;  1EZ6 A;  4CJ2 C;  2N78 A;  3CHB D;  1WTV A;  1VQJ A;  1GKH A;  3CCS A;  1QB5 D;  4JYA Q;  1I4X A;  3D31 A;  4GNX A;  4WFN 3;  3CCQ A;  5F2D A;  3VYU A;  1NR2 A;  2HHH L;  3CD6 A;  1TWF B;  2JK8 A;  2SEB D;  4QJF A;  4BBR B;  4K5V A;  1A63 A;  1U4P A;  1I3Q B;  1KL9 A;  1G29 1;  1ZEQ X;  3ER0 A;  5GQO A;  4DV7 L;  5GAE C;  1VDZ A;  1IBK L;  1O80 A;  3M4P A;  3A56 A;  2PQE A;  4PMC A;  2A6E D;  1R9T H;  3HOV G;  1DCZ A;  2AWO A;  2F0L A;  4JC0 A;  3ITP A;  4I65 A;  1TWA B;  5KGU A;  4DF7 A;  3J7A 5;  2D9U A;  2BCO A;  5LMU Q;  1VQ4 A;  3OWF A;  1BO0 A;  3I4M H;  3X3M A;  2F3W A;  5IT9 L;  3A54 A;  3RN5 A;  4XYQ A;  1NAP A;  1IBM Q;  1EOV A;  4CDD C;  1JMC A;  2B39 A;  3HP3 A;  2F0H A;  4JYA L;  2HQE A;  2MUY A;  4ALP A;  4IFD H;  3GQB A;  3OW7 A;  2A68 C;  1WTP A;  1KDC A;  3VR2 A;  3GO5 A;  1U5K A;  2O5I C;  2CHB D;  2Z6K A;  4MN3 A;  3D4D A;  3PCO B;  4OEL B;  3K58 A;  5M9O A;  3CCV A;  1PFN A;  1E3P A;  5KNB A;  1HNZ Q;  3O13 A;  5C3W A;  4FVM A;  1EWI A;  1STE A;  4LF7 Q;  1WTO A;  4B3S Q;  1G2S A;  3PV0 A;  4X3T A;  3MAQ A;  4IUP A;  3RLO A;  1CHQ D;  4DV2 Q;  5LMU L;  1HR0 Q;  4X6A H;  2MO1 A;  3SEB A;  1PYS B;  2TMP A;  1OXT A;  1I4G A;  3X3N A;  4ZKC B;  5I9O A;  2CQA A;  3PO3 H;  4KKU A;  2YTV A;  5IYB G;  1IBM L;  3K8A A;  4OIJ A;  5EBC A;  3ULL A;  5IGB A;  1PV4 A;  1WD1 A;  2X6G A;  1R4Q B;  2R93 G;  5E4X A;  1MIU A;  1NMF A;  4IPD A;  4A3J B;  5IP9 G;  4PZ8 A;  1LAB A;  3S1M H;  3HGB A;  2F52 A;  3HOX G;  3KLW A;  4A3K G;  5EGT A;  4IPC A;  2Z4I A;  3K0X A;  1TS2 A;  1RD9 D;  1R9T B;  4A3D H;  1D7Q A;  1HNZ L;  2ATW A;  1CKN A;  5CV8 A;  4LF7 L;  4C3J B;  3AFQ A;  4CJ0 B;  4B3S L;  1UE5 A;  1B3Q A;  4IJH A;  3S2D B;  5D65 A;  4K14 A;  1ROD A;  1HR0 L;  3S9W A;  4DV2 L;  3D8G A;  3R2I A;  4R8N A;  1Y8P B;  1K0S A;  1EY4 A;  5KRU A;  2NN6 I;  1P8L A;  2Z6B A;  4ME3 A;  5A35 A;  4RAU C;  1QZG A;  5CYU A;  1LTG D;  1AE3 A;  2R7F A;  2Y0S E;  3D4R A;  1FR3 A;  4P74 A;  1VCI A;  2BH8 A;  1D1K A;  4EQN A;  2WFW A;  4JI1 Q;  5JPM C;  4QUC A;  3I4N B;  1STA A;  1JE5 A;  1X3E A;  4QIW B;  4A3E B;  3HRZ C;  2K1B A;  2EJG C;  1E2Z A;  2JYO A;  1K8O A;  1XMQ Q;  4DR7 Q;  3ERO A;  4NKL A;  1CZW A;  2A5H A;  2LKV A;  1TQO A;  2VY3 A;  1Q82 C;  1GVP A;  3ZYY X;  2P5Z X;  2PZT A;  3F2U A;  1S5E D;  2ZTC A;  3D0F A;  3KF6 B;  4GZY C;  5I4D A;  1MHW C;  2QF7 A;  1STY A;  2XWJ B;  3MEF A;  5C3X A;  2JA6 G;  4IOA A;  3J81 j;  2RDF A;  1R4P B;  1E1T A;  4AQY Q;  3I4M G;  4FF4 A;  2HD3 A;  2RHS B;  3J81 c;  4FF2 A;  4BBS H;  1LTT D;  5T1G A;  4JI1 L;  2K5Q A;  5IIF A;  2IHF A;  5EQ0 A;  1A2U A;  5FLM H;  1RDP D;  4P71 A;  1H9J A;  1PTO B;  1HTL D;  4IFD G;  3MC0 B;  1PRT B;  3EVQ A;  1VQ9 A;  4RMF A;  2JA9 A;  1OXX K;  2KHS A;  1XMQ L;  3HOU B;  4DR7 L;  3I55 A;  4DV1 Q;  3DEO A;  5E1F A;  4C3I G;  3DM1 A;  1AFP A;  5IE8 A;  1Q90 A;  1MGS A;  4F88 A;  4HTH A;  5EKK A;  1SR3 A;  1TWF H;  2K5N A;  4FNF A;  5JEA H;  4QGU A;  3D4W A;  4BBR H;  1IYU A;  3J81 E;  1S72 A;  4QF4 A;  1SE8 A;  2WIN B;  3MEH A;  3TZU A;  1I3Q H;  4XT1 B;  4AQY L;  2F0D A;  2RQX A;  1AH9 A;  1PRT F;  4DV0 Q;  2B2Y C;  1XPR A;  2MHV A;  1TWA H;  5BR8 Q;  1K3B C;  3OIP A;  1EYD A;  1K9M C;  4ABN A;  3HOW G;  5GAH C;  1STG A;  1B53 A;  1V43 A;  1HFN A;  1BCP B;  1PH2 A;  3E9H A;  3QG1 A;  4P72 A;  2CCZ A;  1QIL A;  2WAC A;  3S15 H;  1N33 Q;  1E24 A;  2YTX A;  4HN7 A;  1W2B A;  4A3D G;  5IOC A;  1O7L A;  2B3G A;  2N49 A;  4ME5 A;  4XIG S;  5IGF A;  1ASZ A;  1VQB A;  3OSO A;  1K8G A;  1GUG A;  4OO1 G;  1I4H A;  4K8I A;  3J80 i;  2JEA I;  3RZD B;  4R4Q A;  1IXR A;  1CUK A;  2VW9 A;  3DWQ A;  3AQQ A;  4DV0 L;  1G6Z A;  1PYW D;  1BCP F;  4I7A A;  4A76 A;  1I6H H;  1KDA A;  4NW2 A;  5BR8 L;  3ND8 A;  4QUF A;  3A8J E;  4WRD A;  1WTW A;  2CH4 W;  4RCO A;  3M3Y H;  3I2Z A;  1SNP A;  1HFG A;  1EQQ A;  1VQ5 A;  2ENB A;  1YJN A;  4LF9 Q;  1Q81 C;  3DEP A;  3CKI B;  1QVF A;  1FNU A;  1N33 L;  1SAP A;  3C2P A;  1O7Z A;  4K5W A;  2E8G A;  2Z0S A;  5ELO A;  4OX9 Q;  2K03 A;  4TVA B;  1KRT A;  1A62 A;  3K0Y A;  2RKS A;  3WOF A;  4QIW E;  4ZYS A;  4LW1 A;  4A93 G;  1O78 A;  1UE7 A;  4AIM A;  2N8N A;  5ISR A;  2WKD A;  5GAD C;  4A3F H;  1K28 A;  4JG2 A;  4P75 A;  4RG1 A;  4PG3 A;  5C0X I;  1YHA A;  1L1O B;  2R6G A;  1FNW A;  5M5X H;  3K7A B;  4DU9 A;  3B6Y A;  1ESF A;  1II3 A;  4HMJ A;  4C3J H;  1EFI D;  3JAM E;  4KJO A;  3OIQ A;  2Q8R E;  2PQA A;  1TXY A;  2FXQ A;  4G7H C;  2AKW B;  2X69 A;  1LO5 D;  4Q5V A;  4BY7 G;  1S5F D;  1TS5 A;  3ND9 A;  1X3F A;  2K04 A;  3KJP A;  4LF9 L;  4FF1 A;  4C1N I;  2EY5 A;  3MZ5 A;  4L63 B;  2B8G A;  1H9S A;  5BN4 A;  1BCP D;  5FLM G;  4OX9 L;  2B29 A;  4CDE C;  4FXD A;  1T5X D;  4DKA C;  2UUA Q;  4GS3 A;  5CV9 A;  5JJK A;  3GV3 A;  1VQ7 A;  1ET9 A;  1Y1V B;  2DN8 A;  3I4N H;  1MI2 A;  2CH4 A;  3BDC A;  4PZ6 A;  3SK4 A;  2EYF A;  4B9W A;  2I46 A;  4A3E H;  3H3V H;  3T56 B;  2ASB A;  1BNZ A;  2R93 B;  3RR5 A;  4L8J A;  1DXM A;  1ONL A;  2FFK B;  4JI0 Q;  4QB4 A;  3PIP 3;  2BH2 A;  1LT3 D;  3AFP A;  3SXH A;  1TU2 B;  1YNX A;  4LUO A;  4A3K B;  2I5H A;  2A69 D;  5NUC A;  2F3I A;  3DUZ A;  3BS1 A;  2VQF Q;  1GUO A;  3H91 A;  4LK1 C;  3PF4 A;  5EPJ A;  1KAB A;  4HCE A;  1D8L A;  1EIH A;  4EGV A;  3GDE A;  4FP5 D;  3S16 H;  2NZH A;  4YIJ A;  3J81 L;  1W6K A;  2L55 A;  2F0E A;  2MQH A;  3NPP A;  1U9R A;  5DNF A;  1TWC B;  2RDH A;  2UUA L;  3U58 A;  2NTT A;  3D3R A;  3M7G A;  3MFY A;  1UE6 A;  3ULP A;  4Y52 H;  3NBH A;  2WB1 E;  2KEC A;  3FPU B;  1UEA B;  1PTO H;  3I56 A;  2R3Z A;  4HED A;  4H0L C;  2XGT A;  5HY6 A;  3A8K E;  4IUU A;  2JA7 G;  2VS1 A;  4JI0 L;  1JJ2 A;  5CV5 A;  2EZV A;  2XRS D;  3Q6S A;  2B8F A;  2C35 B;  1MSH A;  1VQ8 A;  2VQF L;  4DXG A;  5FK9 C;  4TQU S;  4ZLT F;  3I4O A;  2SNS A;  2K50 A;  2L4N A;  1DZ1 A;  2B2U A;  4K8J A;  1G6P A;  1DOK A;  2VUM H;  3TP6 A;  4A3L H;  1M1K C;  4DV6 Q;  1EEF D;  4A3M G;  1F2Z A;  2EJF C;  4ZCK A;  3CF5 A;  1SYC A;  4UAI A;  2ALY B;  2F0P A;  4RGN A;  1C8C A;  1SYD A;  1LAC A;  2NVT B;  1RHP A;  1NCV A;  1S3O A;  4BXX H;  1A3U A;  1FL0 A;  1U0L A;  2SNM A;  1FJG Q;  1QNK A;  3I4M B;  2HIV A;  5FO8 B;  3F1Z A;  2D5D A;  1YNJ C;  3MXN B;  4ULL A;  2F0S A;  1X56 A;  2KJX A;  2IX3 A;  3H3V C;  5IT9 c;  2BE5 C;  3H09 A;  2K5H A;  4A3F G;  3NEN A;  2C9O A;  2K7V A;  1A8V A;  1A2T A;  1WCM G;  1YHB A;  2L12 A;  1NMG A;  2EYO A;  2WP8 J;  1KC8 C;  3E0J A;  4R1J A;  5G3L D;  5FO9 B;  2F4V Q;  4DV6 L;  2K75 A;  3TP8 A;  5CBA E;  1JWU D;  1TII D;  2AWN A;  2B2T C;  1SSO A;  5C4J H;  3JAM L;  1PH1 A;  3CMA A;  1SE3 A;  2K52 A;  1FJG L;  1BR9 A;  3NTI A;  5CBE E;  5IT9 E;  2E2I B;  2JXM B;  1WTQ A;  4NXN Q;  4MTK A;  3HOV H;  1PTO C;  2R92 G;  1EY0 A;  2N3S A;  4KJN A;  1PRT C;  4AYB G;  1CI3 M;  2JE6 I;  4EX5 A;  2CWA A;  1QZH A;  3LGJ A;  3WDN A;  1GOZ A;  2HT1 A;  3HOW B;  2PI2 A;  3S1M B;  1V1P B;  1LYL A;  4A75 A;  3CCL A;  1HZ9 A;  3K80 C;  3N6R A;  2F4V L;  2E74 C;  1CKM A;  3W1B A;  5IGC A;  3C1F A;  2RF4 A;  3PUX A;  5LL6 S;  1SRU A;  1XPO A;  4A3D B;  3F2B A;  5J39 A;  1X65 A;  1DM0 B;  5IOD A;  3K57 A;  2G9H D;  4X64 Q;  4FXK C;  2BDN A;  1YNN D;  4EQ5 A;  1QCB D;  3BG3 A;  3C1E A;  5JJL A;  1KHI A;  2KEE A;  1EIF A;  1MKH A;  2JSO A;  4NXN L;  3PUY A;  4POF A;  3RLF A;  1D5X C;  2NWG A;  4XQQ A;  3S1R H;  1X55 A;  1XNQ Q;  1D5Z C;  2NTS A;  4JI8 Q;  3P7J A;  1CM9 A;  1BKB A;  3GTM H;  3M4Q A;  4JOI A;  3W3A A;  4B3T L;  4EQP A;  5FJ8 G;  1XMO L;  3RZO B;  3AU7 A;  4RFB A;  2NB0 A;  2ZTE A;  3TN2 A;  1SLJ A;  3CXC A;  1PZJ D;  5CMD A;  1EY9 A;  4LMQ D;  4XYO A;  2R93 H;  1EYC A;  2KED A;  1BDO A;  1KDB A;  5EBD A;  5IP9 H;  4XQJ A;  1Q7Y C;  3HOX H;  1KRS A;  4DAY A;  2F03 A;  4X64 L;  4RGO S;  2VUM G;  3M9B A;  1ZYR C;  4PNY A;  2CKZ B;  2V4D A;  4QCL A;  3EJI A;  1GJX A;  3HG9 A;  5KYL A;  2K05 A;  4JI8 L;  2DJG C;  5KND A;  3G6E A;  2E75 C;  1HQM C;  4V19 0;  3CC2 A;  1QWY A;  4DNT B;  2RCF A;  3F2C A;  5JJZ A;  4BY7 B;  2VXW A;  1JWM D;  5A2Q E;  3T53 B;  3AEV A;  1EQV A;  4BBS B;  1GUW A;  3A5U A;  1K0R A;  1TS3 A;  2YV5 A;  4KHP Q;  4A3B G;  3RD4 A;  3TRE A;  3J80 E;  1Q1E A;  1VQ6 A;  2OT2 A;  1B3A A;  3K59 A;  4GOP C;  1L1O C;  4PQX A;  5LMN W;  1YBY A;  1G8Z D;  1HRJ A;  2HIX A;  1PH7 A;  5DAU A;  2YYZ A;  1ET6 A;  4KY6 A;  1Z6H A;  3ERS X;  4ILW A;  3L3O C;  3QR8 A;  1X9N A;  4ZUI A;  1NY4 A;  3HFZ B;  1VQI A;  4KV6 A;  1B8A A;  2AUK A;  1QNU A;  1B2T A;  3KF8 A;  4C3H G;  2NVT H;  2MO0 A;  2HDL A;  2K5W A;  4KHP L;  2V1C C;  2PNH A;  1Y8N B;  3AYH B;  4KY7 A;  1Y14 B;  3P75 A;  2EYP A;  3UE0 A;  5COY A;  2JA6 H;  1F77 A;  1LTA D;  1MSG A;  2JP1 A;  1M90 C;  2BA0 A;  5C0X J;  4HJ8 A;  1AW7 A;  1DYQ A;  3BVM A;  4RHS A;  3VA5 A;  4CKE A;  1GUS A;  2D2C C;  1AN8 A;  4A3I G;  4L5S A;  4IZ8 A;  4IUV A;  3S15 B;  2WII B;  4DK1 A;  3UDI A;  3FPP A;  1DOL A;  1SJH D;  1QJO A;  1C0A A;  1SMY D;  2HDM A;  2SDF A;  4PZ7 A;  5GAG C;  1KXL A;  3HZX A;  2JA7 B;  1VQD A;  4DA2 A;  1BF4 A;  1VQK A;  1XX8 A;  5COR A;  3BVZ A;  2EPB A;  4C3I H;  3U4Z A;  4R4T A;  3HOY G;  3KOJ A;  1BUV T;  1TS4 A;  4B3M Q;  3Q22 A;  3F8T A;  3C3L A;  1LTR D;  1D1I A;  4DNR B;  1AE2 A;  1I6H B;  1TY2 A;  1PLF A;  4A3M B;  3U9S A;  2E2I H;  3TSS A;  3SK6 A;  3M3Y B;  3CCM A;  3Q0A A;  1S5B D;  3KJO A;  1U4L A;  1AZQ A;  5C4X G;  4OWW B;  2K6A A;  3PO2 G;  4MTN A;  3HOW H;  1LTB D;  1T5E A;  4X3K A;  1RCV D;  1V1O A;  3QIA A;  1YEZ A;  2B2W C;  1E2V A;  4J1M A;  5E4W C;  3FRP B;  1H95 A;  4XQN A;  2WKC A;  2PYK A;  4A3F B;  2F0M A;  5M3M H;  4IN3 A;  5M3F G;  3G4S A;  1YJW A;  2NVX B;  1JIC A;  3HOZ G;  3IKJ A;  2F0G A;  5JOB A;  4B3M L;  1HNW Q;  1WCM B;  5M5X B;  2CQO A;  2K5V A;  2JA5 G;  2XWB B;  4YWM A;  1LLR D;  1C48 A;  4KD3 A;  4J8Q A;  1KNE A;  1ICF B;  4OO1 H;  4PMW A;  2FMC A;  1WTR A;  4JK1 C;  3MA2 B;  4BWG B;  1I4Q A;  4DR6 Q;  2PZW A;  4HJA A;  2LFN A;  4JI3 Q;  1B44 D;  4POG A;  1JJG A;  1X54 A;  3OYY A;  3RZO H;  4DV4 Q;  4DR4 Q;  3P20 A;  5FLX c;  5A2Q L;  2K01 A;  2R92 B;  1Z7T A;  4DN4 M;  4UP8 A;  1PXU A;  4AYB B;  2ZM6 Q;  3DWA A;  2CVR A;  3N52 A;  3J80 L;  4HR7 B;  1KTK A;  1HNW L;  5CV4 A;  4DV5 Q;  5LL6 X;  3CCR A;  2JQO A;  4A93 H;  1ENC A;  4UDU C;  1PH9 A;  1XJV A;  1X3P A;  4IQZ A;  5JVG 3;  3NE5 B;  5BN3 A;  5H1S E;  1N36 Q;  1GM5 A;  4DR6 L;  1PVO A;  4JBK A;  5AFW A;  4IFD I;  2PW7 A;  1HZA A;  4JI3 L;  3MXU A;  4X3U A;  1FD7 D;  4B08 A;  1AP0 A;  3H94 A;  3S16 B;  1STN A;  1K83 B;  1LV9 A;  5E7N A;  5FLX E;  1QOH A;  1PH8 A;  2NN6 G;  2DY7 A;  3M85 A;  4DV4 L;  4BY7 H;  4DR4 L;  3LX0 A;  4BY1 H;  2EY6 A;  1K73 C;  2JJQ A;  3M7N A;  3M4O H;  1YZ6 A;  4IJL A;  2ZM6 L;  2NYZ D;  4B3R Q;  2F0N A;  4O42 A;  3PUZ A;  4RCN A;  1L0Y B;  5CV6 A;  2H5X A;  4DV5 L;  4GLV B;  4JVZ A;  4CDC C;  5I2X A;  3MVV A;  5K36 G;  4BA1 I;  5DM6 3;  5JJI A;  1KLG D;  1N36 L;  2L0C A;  1C9O A;  1ESR A;  3UE1 A;  2OF1 A;  5FOB B;  4UP9 A;  1NE3 A;  2XRQ D;  1SNO A;  1JE4 A;  4LAA A;  2VUM B;  3OPO A;  3KF6 A;  1PTO F;  4GLA C;  1KQS A;  5C3E G;  1ENA A;  1JT8 A;  3LNN A;  2EY1 A;  5C5L A;  1ILP A;  1JOO A;  4B3R L;  1KNA A;  2WB1 B;  4MIU A;  4HCS A;  2VQE Q;  1QG7 A;  1GUT A;  4IO9 A;  1YNJ D;  4NP5 A;  2L9H A;  5IGG A;  4DV1 L;  1Z47 A;  1VS0 A;  1Z9F A;  1YJ9 A;  2K28 A;  2BE5 D;  3BDO A;  1W6J A;  1VF5 C;  2D0P A;  4WJ4 A;  1X3G A;  5M3M G;  2JA7 H;  2K33 A;  1H9K A;  1PYB A;  1SE4 A;  3I73 A;  1JOR A;  4KKT A;  2A1A A;  4LUV A;  3CAM A;  4DK0 A;  2AUJ D;  4N8X 1;  1V8Q A;  1TY0 A;  1CQF A;  1PDQ A;  3H15 A;  4RKL A;  5C4J B;  1BOS A;  1B4O A;  4X66 Q;  1SYE A;  2F4I A;  3S24 A;  2OQ0 A;  4A3M H;  3STB C;  3JAM c;  3I91 A;  4X62 Q;  2VQE L;  4C3H B;  4K6D A;  3CCU A;  3UDF A;  1PTO D;  4HIK A;  3HOV B;  4DGZ A;  5EKI A;  1HA5 A;  1PRT D;  4JPB W;  4V0B A;  1KD1 C;  1YIJ A;  4JI5 Q;  2PNR C;  2Z8L A;  5M5Y B;  5T1I A;  3EA6 A;  3S14 B;  4N8F A;  4A3G G;  1EQT A;  4AYB E;  1EU3 A;  2RA4 A;  1FVI A;  3KK7 A;  2KCT A;  4A3I B;  2I07 B;  4JBW A;  1OXV A;  3KFU A;  4NMZ A;  1WTX A;  2RBM A;  2NVX H;  1VQE A;  3E3X A;  4GOP B;  1S40 A;  1HTP A;  1B1Z A;  2XVS A;  1WCM H;  4RWS C;  2HQL A;  3CC7 A;  5IYC G;  2KBN A;  3JC6 6;  4X66 L;  2UXD Q;  1SYG A;  3BU2 A;  2OCE A;  3KDF B;  1KAA A;  3PUW A;  1QUQ A;  4RGM A;  5K5P A;  4MZ9 A;  1EEI D;  2GA4 B;  4BY1 G;  3HOY B;  1Q3L A;  3S1R B;  1BQQ T;  5CV7 A;  1U4R A;  4A4I A;  3J7A F;  2IL8 A;  5FLX L;  3FMC A;  1XTC D;  2H4O A;  2N55 A;  4JI5 L;  2BA1 A;  3GTM B;  2H1E A;  4L5Q A;  3OTO Q;  1WYD A;  1ENF A;  2M9V A;  1UWV A;  1NR4 A;  2R92 H;  4OEM B;  4U67 3;  3K6O A;  3ICE A;  5KIX A;  5TSS A;  3PMF A;  1YIT A;  5ELD A;  4YWK A;  1SRO A;  1IYJ B;  2KVM A;  3KUP A;  4OHJ A;  3TEH B;  4UHV A;  1K8A C;  3NBH B;  1LT5 D;  4B9X A;  3HOX B;  5C0X G;  3Q24 A;  2UXD L;  3W1G A;  2J0T D;  1TWH B;  2NVQ H;  3MHB A;  1ZYR D;  4MNO A;  2Q8T A;  1BBU A;  2DJF C;  2PPB C;  5M3F B;  1XNR Q;  1ILQ A;  4U68 A;  3HOZ B;  1K83 H;  1IL2 A;  1X32 A;  1EY8 A;  1Q12 A;  5C6A A;  3OTO L;  1U4M A;  4LJZ C;  1O7Y A;  1HA6 A;  5ELN A;  2DUD A;  2E2J B;  2E5L Q;  2ZJR A;  1UEB A;  1MJC A;  4ZQ3 A;  5FJ8 H;  3OMG A;  3C46 A;  3IFD A;  1TVX A;  5LHY 1;  1HR0 W;  2LSS A;  3R93 A;  5KNC A;  4DK6 C;  1RF2 D;  3W2D A;  3TRZ A;  1Q8K A;  3A7A B;  3GTP B;  4RHR A;  1ML0 D;  3NSW A;  1XNR L;  5IWA Q;  2AHO B;  3S1Q B;  1RJT A;  1TT2 A;  1VQH A;  4LFA Q;  5C4H A;  1M8A A;  3NXW A;  1Q1B A;  4I7Z C;  1BBX C;  1S4Z A;  4YHH Q;  2E5L L;  3VR4 A;  3SGI A;  1B50 A;  2RCN A;  5I9P A;  2EYM A;  2JA6 B;  4E6I A;  1JCK B;  1QVG A;  3SVM A;  1X6O A;  1WTH A;  3Q8D A;  3I3C A;  4DUZ Q;  4DAV A;  4A3C G;  2GVB A;  2F0O A;  2A74 C;  1CZG A;  1FYC A;  1WFQ A;  3VYT A;  4A3B H;  2B63 G;  3S1N B;  2LXK A;  4KN7 C;  4O1N A;  4QMG A;  5L37 A;  2KQ3 A;  4WOR A;  4HIO A;  2A68 D;  4IUT A;  1EFW A;  3GTG B;  5IWA L;  1JOQ A;  1CSQ A;  4JBJ A;  4L5R C;  4LFA L;  4LF5 Q;  4A3J G;  1P16 A;  1PA6 A;  3FEW X;  2EOT A;  4FXG C;  1JB7 A;  2B2W A;  3R8B A;  4C3I B;  2ZXO A;  3DHQ A;  1EQR A;  4KY5 A;  3MXP A;  2FHT A;  3H3V I;  1EZ8 A;  4RGT A;  4DAP A;  3QWN A;  4YHH L;  1SDF A;  5FKA C;  2R61 A;  5IYD G;  4K2K A;  3CPW A;  3GTL B;  4F87 A;  1I6V C;  5C44 H;  2JN4 A;  3TME A;  2K5D A;  4ZRZ A;  1VQO A;  1CA5 A;  4C3H H;  4IUN A;  3VR3 A;  4DUZ L;  2PMZ E;  2F0K A;  2R7Z G;  5C3E B;  3QOJ A;  4YCW A;  5ELF A;  4F7X A;  2A6H C;  3I90 A;  3FKI G;  2F0J A;  2HCI A;  5M5Y H;  2KCN A;  3S14 H;  3MXN A;  4R4I A;  4GN3 B;  4A3I H;  1ZXT A;  4DNI A;  1LTI D;  2CW0 C;  4JV5 Q;  1JB3 A;  2IJ0 A;  1IKM A;  1EYA A;  1EYG A;  2Z1C A;  2O5J C;  1TWG B;  5KYI A;  5M3M B;  3J81 i;  3NBI A;  1C4Q A;  4XXE A;  2F0Q A;  2E2D C;  2O2L D;  4OWT B;  3BZC A;  1RTO A;  3UI2 A;  5D14 A;  3WWV A;  2EQS A;  3L9A X;  3PIO 3;  2JA8 G;  1HQR D;  1GHJ A;  2PO4 A;  1F9Q A;  2XN9 C;  2QW7 A;  1RIP A; 
#chains in the Genus database with same CATH homology
 3KOJ A;  4QGU A;  2D0O A;  2ZTD A;  4OXP A;  4BBR G;  4B3M Q;  1XJV A;  4BBR H;  1S72 A;  3HOY H;  1SE8 A;  2EIF A;  3F8T A;  1I3Q H;  2MNA A;  1AE2 A;  1SN8 A;  2I0Q A;  4AQY L;  1NJI C;  3BJU A;  4JCV E;  2E2I H;  1AH9 A;  2NZO A;  3BZK A;  2IX1 A;  4DV0 Q;  4BA2 I;  3CCM A;  4R4C A;  1PH3 A;  3KJO A;  1XPR A;  1TWA H;  5BR8 Q;  2A8V A;  2Q2U A;  4JV5 L;  1K9M C;  5C4X G;  4OWW B;  5C4X H;  4AH6 A;  4KI0 A;  4LUZ A;  3T1Y Q;  1HZC A;  3HOW G;  5GAH C;  4MTN A;  1PH5 A;  2D62 A;  1V43 A;  2E2H H;  3HOW H;  3PO2 H;  3A5Z B;  3EN2 A;  4X65 L;  1PH2 A;  3E9H A;  4P72 A;  1IZ6 A;  2CCZ A;  1FGU A;  4JI4 Q;  4LFC Q;  3VDY A;  2ID0 A;  4R4O A;  3S15 H;  1YEZ A;  1N33 Q;  1Q46 A;  4C2M H;  3PIP A;  3J80 c;  1TWH H;  4GLX A;  1UE1 A;  1V9P A;  1E24 A;  5IP7 H;  1H95 A;  2KHJ A;  1JJC B;  2YTX A;  3CPF A;  1W2B A;  2QEX A;  4A3D G;  5M3M H;  4KHZ A;  5M3F G;  4GN4 B;  3G4S A;  5M3F H;  3PF5 A;  1YJW A;  3HOU H;  3HOU G;  3HOZ G;  2GN5 A;  2B3G A;  2N49 A;  4XIG S;  4B3M L;  1XNQ L;  3HOZ H;  1HNW Q;  1NTG A;  2CQO A;  2K5V A;  2NVY H;  1ASZ A;  2JA5 G;  1KIX A;  4YWM A;  1VQB A;  2JA5 H;  2JEB I;  3H0G G;  1V1Q A;  3H0G H;  3EIV A;  1K8G A;  4OO1 G;  2KCM A;  1RL2 A;  4PMW A;  3HKZ E;  3J80 i;  4GNX B;  3F2D A;  2JEA I;  4R4Q A;  1IXR A;  1CUK A;  2IHE A;  2VW9 A;  3AQQ A;  1PH6 A;  4DR6 Q;  4DV0 L;  4HJA A;  4A76 A;  2E2J H;  4JI3 Q;  1I6H H;  1BVS A;  2OQK A;  5BR8 L;  4POG A;  1JJG A;  1X54 A;  4L5T A;  3OYY A;  3T1Y L;  2LXJ A;  3RZO H;  4DV4 Q;  1N34 Q;  3M3Y H;  3CP0 A;  3I2Z A;  4DR4 Q;  1W3S A;  5FLX c;  1EQQ A;  1VQ5 A;  4LFC L;  1YJN A;  4JI4 L;  1Y1W G;  1Q81 C;  4LF9 Q;  1Y1W H;  1QVF A;  1N33 L;  1HNX Q;  4NPS A;  4UP8 A;  2E8G A;  2Z0S A;  5ELO A;  4DV7 Q;  4OX9 Q;  4LFB Q;  2ZM6 Q;  4YWL A;  3PGZ A;  4TVA B;  1KRT A;  3GTP H;  1A62 A;  4YCU A;  2IX0 A;  3E0E A;  1HNW L;  3S1Q H;  4DV5 Q;  1MJE A;  4QIW E;  4LW1 A;  3CCR A;  2UUB Q;  2JQO A;  3J7Z C;  4A93 G;  4A93 H;  2PI2 E;  2WAQ E;  1XTD A;  3I7F A;  2VNU D;  1UE7 A;  4AIM A;  2N8N A;  4A3F H;  1J6Q A;  4O2D A;  4QY7 A;  1WI5 A;  4JG2 A;  4P75 A;  4RG1 A;  5GAD C;  5C44 G;  4PG3 A;  5C0X I;  5H1S E;  1YHA A;  1L1O B;  5J3B A;  3U50 C;  1N36 Q;  1GM5 A;  2R6G A;  4DR6 L;  4JBK A;  3HKZ G;  1G51 A;  4UPA A;  5M5X H;  4IFD I;  1PVO A;  3B6Y A;  4C3J H;  3DLL A;  1HZA A;  4JI3 L;  1I94 Q;  1LUZ A;  2PQA A;  1TXY A;  2FXQ A;  5E7N A;  2AKW B;  4KLK A;  3RZD H;  1B70 B;  1YHQ A;  1PH8 A;  2NN6 G;  4NXM Q;  3M85 A;  4JI2 Q;  4BY7 G;  4DV4 L;  4BY7 H;  1N34 L;  3G48 A;  2IT1 A;  3PSI A;  5DLQ E;  4DR4 L;  2IY5 B;  1X3F A;  1PH9 A;  4IFD J;  1PFS A;  3KJP A;  4LF9 L;  4GKK Q;  4BY1 H;  1K73 C;  2JJQ A;  3M7N A;  1HNX L;  2Q2I A;  3W5O A;  4LF5 L;  4LF6 Q;  3S1N H;  2K14 A;  3M4O H;  1YZ6 A;  5FLM G;  4LFB L;  4IJL A;  4OX9 L;  2B29 A;  2ZM6 L;  1QVC A;  4B3R Q;  1K3R A;  4DKA C;  3HKS A;  4LNQ A;  2UUA Q;  3PUZ A;  4GKJ Q;  4GS3 A;  5JJK A;  3GTG H;  4DV5 L;  2H5X A;  1VQ7 A;  5JEA J;  4GLV B;  3I4N G;  3S2H H;  3I4N H;  2UUB L;  2OTL A;  4PZ6 A;  5K36 G;  4H02 A;  1PH4 A;  2YTY A;  3UDX A;  4BA1 I;  4A3E G;  1XMO Q;  4A3E H;  4B3T Q;  3H3V H;  2ASB A;  4FDB A;  2WAQ G;  4UP7 A;  3RR5 A;  5JJI A;  1N36 L;  4NB3 A;  2QA4 A;  1C9O A;  1PHJ A;  4JI0 Q;  2BH2 A;  3UE1 A;  1I94 L;  4DAY B;  3AFP A;  4UP9 A;  4HJ7 A;  3GTL H;  4LUO A;  1YNX A;  3ULJ A;  4DK3 C;  1NE3 A;  1NBW A;  2I5H A;  3RN2 A;  4HID A;  2F3I A;  4NXM L;  4P73 A;  4APV A;  4JI2 L;  2VQF Q;  3K7A H;  1LM0 A;  3KF6 A;  4GLA C;  3STB D;  1KQS A;  2I5M X;  3CQZ H;  5C3E G;  3PF4 A;  3L0O A;  1CKN B;  5C3E H;  1D8L A;  1I5F A;  4GKK L;  1JT8 A;  3GDE A;  3S16 H;  2NZH A;  2CFM A;  4LF6 L;  2MQH A;  2XTI A;  4B3R L;  4IOC A;  1CKO A;  1N8R C;  2UUA L;  3U58 A;  4GKJ L;  2UXC Q;  1VQP A;  1UE6 A;  2VQE Q;  3ULP A;  4IO9 A;  4Y52 H;  4DV1 L;  1Z47 A;  1VS0 A;  2WB1 E;  2KHI A;  4QL5 A;  1J5E Q;  1Z9F A;  1VQM A;  1A63 A;  1YJ9 A;  1KAW A;  1WOC A;  1OXU A;  3I56 A;  1CSP A;  4XTC S;  2I5L X;  2XGT A;  2D0P A;  5HY6 A;  1SMX A;  5IP7 G;  1X3G A;  4WJ4 A;  2JA7 G;  2VS1 A;  5M3M G;  2JA7 H;  1TWG H;  4OWX B;  1Y1V G;  1N9W A;  5IYB H;  1Y1V H;  1JJ2 A;  4JI0 L;  4GN5 A;  4DR1 Q;  5GRO A;  1PYB A;  1T9H A;  2L15 A;  2A1A A;  3PIO A;  2C35 B;  4LUV A;  1VQ8 A;  1GD7 A;  3CAM A;  1L0W A;  2VQF L;  2ZJQ A;  2OWO A;  1XPU A;  2UXB Q;  4TQU S;  3I4O A;  3PUV A;  2R7D A;  2K50 A;  4A3K H;  3H15 A;  3G71 A;  1C7Y A;  2GVA A;  4A3L G;  4HIM A;  1G6P A;  3FHW A;  2VUM H;  4A3L H;  4X66 Q;  3TQY A;  2Q2H A;  3S24 A;  4IPG A;  4DV6 Q;  4A3M G;  2OQ0 A;  4A3M H;  1M1K C;  3CF5 A;  3RLN A;  4YCV A;  3STB C;  2ALY B;  2K4K A;  3KF8 B;  2A19 A;  3TS0 A;  3JAM c;  2UXC L;  4DR3 Q;  2HHH Q;  4X62 Q;  3CW2 C;  2VQE L;  3CCU A;  1WJJ A;  3UDF A;  1S3O A;  4HIK A;  1VQL A;  3I4M H;  1J5E L;  2ES2 A;  4K0K Q;  4BXX G;  3RNU A;  4BXX H;  1FL0 A;  1TWC H;  1U0L A;  1KD1 C;  2WB1 G;  1VQA A;  1FJG Q;  1YIJ A;  4JI5 Q;  4LWC A;  2CWP A;  1IBK Q;  2HIV A;  1IBL Q;  2UU9 Q;  3F1Z A;  4HJ9 A;  1EUJ A;  3MXN B;  4A3G G;  4A3G H;  4AYB E;  4DR1 L;  1ASY A;  3GTQ H;  3JAM i;  1X56 A;  3NEM A;  1FVI A;  5IT9 c;  2KCT A;  4QQB X;  4OON A;  2YU9 H;  4JBW A;  1OXV A;  3KFU A;  2K5H A;  2MFI A;  4DUY Q;  4A3F G;  3NEN A;  1Q86 C;  4LF4 Q;  4DAM A;  2NVX H;  2UXB L;  1VQE A;  1A8V A;  5AJ3 Q;  4GOP B;  1S40 A;  1N32 Q;  1A0I A;  3CCE A;  1WCM G;  1WCM H;  1YHB A;  3NEL A;  3A74 A;  1NMG A;  2HQL A;  3CC7 A;  2WP8 J;  1KC8 C;  2N78 A;  4R1J A;  5IYC G;  3T1H Q;  1I50 H;  2KBN A;  3JC6 6;  5IYC H;  1VQJ A;  1GKH A;  3CCS A;  4X66 L;  2F4V Q;  2UXD Q;  4DV6 L;  4JYA Q;  2K75 A;  3D31 A;  3BU2 A;  3CCQ A;  4GNX A;  2OCE A;  1LTL A;  4DR3 L;  2HHH L;  3CD6 A;  3KDF B;  3PUW A;  1QUQ A;  2AWN A;  1OXS C;  2JK8 A;  4MZ9 A;  4QJF A;  5C4J H;  4BY1 G;  5IY0 A;  4A4I A;  4WJ3 M;  4X6A H;  3GTO H;  3K81 C;  4DR2 Q;  3CMA A;  1PH1 A;  4K0K L;  1KL9 A;  1G29 1;  4J15 A;  3DM3 A;  3ER0 A;  2K52 A;  3IRB A;  5GQO A;  4LF8 Q;  4JI5 L;  4DV7 L;  5GAE C;  2BA1 A;  1FJG L;  1IBK L;  4L5Q A;  3CC4 A;  3OTO Q;  3GTK H;  3M4P A;  1IBL L;  2UU9 L;  4NXN Q;  1WYD A;  1R9T H;  4JOI C;  3HOV G;  1UWV A;  2AWO A;  3HOV H;  2R92 G;  4JBM A;  4Y7N H;  2R92 H;  2N3S A;  4JC0 A;  1SFO H;  4AYB G;  3ICE A;  2JE6 I;  5EAY A;  3J7A 5;  4DUY L;  5LMU Q;  4EX5 A;  2CWA A;  2QGQ A;  1VQ4 A;  1YIT A;  1QZH A;  4YWK A;  4LF4 L;  3LGJ A;  3PO2 G;  1BBW A;  1IYJ B;  1SRO A;  5AJ3 L;  3RN5 A;  1N32 L;  2HT1 A;  2PI2 A;  3TEH B;  1IBM Q;  1K8A C;  3NBH B;  1EOV A;  1LYL A;  1L2F A;  3T1H L;  4A75 A;  1JMC A;  3CCL A;  1HZ9 A;  3K80 C;  5C0X G;  2F4V L;  2UXD L;  4JYA L;  3W1G A;  2NVQ H;  4ALP A;  1CKM A;  3W1B A;  3K7U C;  4MNO A;  2RF4 A;  3PUX A;  1BBU A;  1SRU A;  4JI7 Q;  4O0A A;  1VQG A;  1XPO A;  3F2B A;  1X65 A;  3GO5 A;  1U5K A;  1XNR Q;  2Z6K A;  4X64 Q;  1K83 H;  4EQ5 A;  4DR2 L;  1IL2 A;  3CCJ A;  3PCO B;  1Q12 A;  5HGQ A;  4LF8 L;  4HJ5 A;  5JJL A;  3CCV A;  1KHI A;  3OTO L;  1EIF A;  1MKH A;  1E3P A;  4NXN L;  4OO1 I;  3PUY A;  4POF A;  1HNZ Q;  2OTJ A;  3RLF A;  1XNQ Q;  3S1R H;  1X55 A;  1EWI A;  4LF7 Q;  5ELN A;  2DUD A;  1HH2 P;  4B3S Q;  4JI8 Q;  3PV0 A;  2E5L Q;  1BKB A;  3GTM H;  2ZJR A;  1UEB A;  3M4Q A;  1MJC A;  3RLO A;  5LMU L;  2KEN A;  4DV2 Q;  1VQF A;  4JOI A;  1HR0 Q;  2MO1 A;  5FJ8 G;  1PYS B;  1O7I A;  1OXT A;  5FJ8 H;  1XMO L;  4B3T L;  4DR5 Q;  3PO3 G;  3PO3 H;  2YTV A;  5IYB G;  1IBM L;  2DGY A;  3K8A A;  3ULL A;  1PV4 A;  2ZTE A;  3CME A;  1SLJ A;  2LSS A;  2ZJP A;  3CXC A;  1HR0 W;  1E22 A;  1HJP A;  1E1O A;  2R93 G;  2R93 H;  4DK6 C;  1MIU A;  1NMF A;  4IPD A;  4JI7 L;  4UY8 C;  5IP9 G;  5IP9 H;  3TRZ A;  1Q8K A;  4PZ8 A;  3S1M H;  1DGS A;  2F52 A;  3HOX G;  1Q7Y C;  3HOX H;  1KRS A;  1XNR L;  5IWA Q;  2AHO B;  3KLW A;  4A3K G;  1YVC A;  4X64 L;  4IPC A;  4GNX C;  1YI2 A;  1VQH A;  3K0X A;  4LFA Q;  2Q2T A;  3L2P A;  2VUM G;  3M9B A;  3A0J A;  4JI6 Q;  2CKZ B;  4A3D H;  1D7Q A;  3U4V A;  1HNZ L;  1EIY B;  2ATW A;  1Q1B A;  1CKN A;  1VQC A;  4YY3 Q;  4LF7 L;  3AFQ A;  3GTJ H;  4YHH Q;  4JI8 L;  1UE5 A;  4B3S L;  4IJH A;  3G6E A;  2E5L L;  2PQA B;  3TS2 A;  3SGI A;  1HR0 L;  5M5W H;  2RCN A;  4DV2 L;  3CC2 A;  3OW2 A;  3ZJY C;  3F2C A;  4DR5 L;  2AMC B;  1QVG A;  1QUQ B;  1X6O A;  2EXD A;  3AEV A;  3Q8D A;  2NN6 I;  4DUZ Q;  1P8L A;  3A5U A;  1K0R A;  2GVB A;  2YV5 A;  4A3C G;  4A3C H;  4ME3 A;  4KHP Q;  3GD7 A;  1WFQ A;  1QZG A;  4A3B G;  1AE3 A;  4A3B H;  2R7F A;  2UUC Q;  2B63 G;  3TRE A;  2B63 H;  2Y0S E;  2LXK A;  3KYH C;  4P74 A;  1Q1E A;  3FP9 A;  5LMN Q;  1VCI A;  2BH8 A;  4HIO A;  1VQ6 A;  2WFW A;  1EFW A;  5IWA L;  4JI1 Q;  2VL6 A;  4GOP C;  1CSQ A;  4JBJ A;  4L5R C;  4LFA L;  4LF5 Q;  1L1O C;  4A3J G;  1P16 A;  1PA6 A;  4A3J H;  1JE5 A;  1X3E A;  5LMN W;  1YBY A;  1OTC A;  4DV3 Q;  1JB7 A;  2Z6K C;  4DPG A;  2VZA A;  3L7Z C;  4JI6 L;  2HIX A;  1EQR A;  1PH7 A;  3H3V I;  4YY3 L;  4X62 L;  2YYZ A;  1XMQ Q;  4DR7 Q;  3ERS X;  4YHH L;  5IYD G;  1X9N A;  3CPW A;  5IYD H;  1VQN A;  2RHQ B;  1NY4 A;  2VY3 A;  3HFZ B;  1Q82 C;  1GVP A;  1VQI A;  1B8A A;  1B7Y B;  5C44 H;  2ZTC A;  3D0F A;  3KF6 B;  1VQO A;  4C3H H;  4IPH A;  2MO0 A;  4DUZ L;  2PMZ E;  3E9I A;  2NVT H;  2R7Z G;  1E7Z A;  2V1C C;  2R7Z H;  2PNH A;  3AYH B;  3UE0 A;  3S2D H;  1Y14 B;  3MEF A;  4KHP L;  3UDG A;  2JA6 G;  4YCW A;  4IOA A;  3J81 j;  2UUC L;  2JA6 H;  1E1T A;  3FKI G;  4AQY Q;  1M90 C;  3FKI H;  2BA0 A;  5C0X J;  4HJ8 A;  3I4M G;  5M5Y H;  3S17 H;  4BBS G;  3J81 c;  2RHS B;  4BBS H;  5LMN L;  2Y0S G;  3S14 H;  1GO3 E;  3EBE A;  4R4I A;  4JI1 L;  4GN3 B;  2IHF A;  4A3I G;  4L5S A;  4A3I H;  4DNI A;  5FLM H;  4JV5 Q;  4P71 A;  3UDI A;  4DV3 L;  1C0A A;  1KXL A;  4IFD G;  5GAG C;  4PZ7 A;  4GOP A;  1EYG A;  1VQ9 A;  1L1O A;  4RMF A;  4X65 Q;  2JA9 A;  1VQD A;  3J81 i;  1OXX K;  1XMQ L;  4DR7 L;  3I55 A;  4DV1 Q;  1VQK A;  4OWT B;  3BZC A;  3WWV A;  2EQS A;  2JA8 G;  4C3I H;  2JA8 H;  5IE8 A;  1HZB A;  3U4Z A;  1SR3 A;  1RIP A;  1TWF H;  5JEA G;  2K5N A;  3KDF A;  4R4T A;  3HOY G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...