1IBLL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1iblL00
2R7FA 3CCVA 3KJOA 4JI1Q 2I0QA 1C7YA 4PZ7A 1HNWL 1HZCA 4BXXG 2MFIA 3OW2A 1VQMA 1YZ6A 1HR0W 3MXNB 3IRBA 2ATWA 2ZTEA 4DR2Q 1JJGA 1BKBA 3S16H 2VQFQ 2JQOA 5GQOA 1VQBA 3CC7A 1WCMG 2YTXA 3GTJH 1N32Q 4GS3A 1HR0L 5IY0A 5M5XH 5GADC 3U58A 4YCUA 5C3EH 4P74A 4JV5L 3F1ZA 5FLXc 5JJLA 3CCEA 3K80C 5IYBG 1A0IA 2UXBQ 3AFPA 1N33Q 3PO2H 5FLMH 2VQEL 1S3OA 1VQ9A 2JA7G 4LFAQ 2I5MX 2F52A 2WAQG 3BZKA 2JA9A 2OWOA 1NJIC 1Q1BA 1NE3A 4JBMA 2ZJPA 2HHHQ 1BBUA 4LUOA 1TXYA 3HFZB 5C0XG 1QVCA 5IYDG 4B3ML 3M9BA 1LM0A 1YBYA 3Q8DA 4RG1A 4A3EG 1Q86C 3GD7A 1J5EL 2ZJQA 4A75A 4QIWE 1MJCA 3CCRA 4LF5L 3A5ZB 3WWVA 1PH1A 1N36Q 4JYAL 1CKNA 4DV1L 1PH7A 3CAMA 1AE3A 1E1OA 3U4ZA 1Z47A 2BH2A 3HOVG 4DR4L 1UE7A 2JA5H 4BBRH 2B29A 3KYHC 4P75A 1K9MC 5C0XJ 1XMOL 3L7ZC 3B6YA 3KLWA 1N9WA 2DUDA 3NELA 3CMEA 4DV5L 3PIPA 4HJ5A 3EN2A 2E5LQ 2UUCQ 2JA6G 1SLJA 1Q82C 2N78A 4YCWA 3J81i 1HH2P 2EIFA 4IFDG 4YY3L 2ES2A 2VL6A 3CW2C 1A8VA 4LUZA 5IYBH 3PSIA 4R4QA 4DR3Q 3G4SA 4JI0L 2UUAL 3CMAA 4TQUS 4O2DA 1VQGA 4NB3A 1Q7YC 1IBLL 4JI5L 1CKOA 1VQIA 4APVA 4DV3L 2B63G 4X66L 2WB1G 2K50A 1XJVA 1L1OA 1S40A 1SMXA 4LF6L 2AWNA 4IFDJ 2YTVA 1PH4A 4JI3L 4YCVA 5JEAG 2YU9H 3FP9A 1N8RC 3PO3H 2F4VQ 2UXDQ 2OQKA 3ULPA 3NENA 4A3KH 4DAMA 1B8AA 4AH6A 2HT1A 3CCUA 1E3PA 3GTGH 3PGZA 4IO9A 4OWWB 5C0XI 1X54A 2HQLA 4A3BG 3A0JA 1VCIA 3GDEA 5JJKA 5JJIA 3HOVH 2ID0A 2R93G 3HOXG 1K3RA 4DV0L 5IP9G 1MKHA 5JEAJ 4ALPA 1BVSA 1KL9A 1PYBA 1HJPA 3M4PA 3RZOH 1HR0Q 4JV5Q 1V9PA 1QUQB 1ASYA 1D8LA 2E2IH 2ASBA 5GAGC 2JK8A 1TWHH 1EYGA 3HOZG 4A3GG 4IOAA 2VQEQ 2F3IA 2MO0A 4B3RL 1E7ZA 1SE8A 4IFDI 2RCNA 3S24A 1NBWA 1VS0A 2E8GA 4BY7G 1PH6A 1X9NA 4DV2L 1SROA 3J81c 4O0AA 5C44G 1GD7A 3RLFA 3NBHB 3RLOA 3E9HA 2B3GA 4GOPC 4A3DG 1TWCH 1J5EQ 4LF4L 4GKJQ 5AJ3L 3U4VA 4LF5Q 3F2CA 5C3EG 5M5WH 4HIDA 1YVCA 4JYAQ 4DV1Q 4X62L 4P71A 1CKNB 4A76A 1NY4A 4J15A 4MNOA 1G291 5FLMG 4L5RC 1EOVA 4LUVA 1VQOA 1KAWA 1HZBA 1XMOQ 2R93H 1SN8A 5IP9H 1SRUA 1FL0A 1MIUA 4BY1G 4DK3C 2NZHA 2D0PA 1Q8KA 2JE6I 2Q2IA 1L2FA 3FKIH 3HKZG 4DV5Q 4DR5Q 1MJEA 1JB7A 3HOWG 1E22A 2PI2E 4Y7NH 4A3JG 2R7ZG 3S2DH 4YY3Q 3FHWA 3PF5A 4BBSH 1EIFA 4OWTB 1XPOA 1TWGH 3UDGA 3HOZH 4JI0Q 2UUAQ 3S1QH 1HNZQ 1X6OA 1IBLQ 4DUYL 4IJLA 2K52A 4LF9L 4OXPA 4DV3Q 4X66Q 2HIXA 4BBRG 1OTCA 2JA5G 5LMUL 1FGUA 4XTCS 1XNRL 1L1OB 5IYCH 1XPRA 4BY7H 4OO1G 4LF6Q 4A93H 4JI3Q 3CC2A 5IE8A 2NVYH 4JBKA 5C44H 5IWAQ 1V43A 3ERSX 2KHJA 3CQZH 4A3DH 3W1GA 1CUKA 4YWKA 1I50H 4JI6L 4JI4L 3RZDH 4IJHA 1G51A 1GM5A 2IT1A 1VQ6A 1KHIA 4AYBE 4DV7L 1PH3A 4UP7A 1RL2A 2QA4A 1WFQA 3OTOQ 1A62A 1JE5A 2JEBI 2VY3A 4DV0Q 1TWFH 2VS1A 4R1JA 1K83H 4HIKA 1VQKA 1IYJB 1WOCA 2D62A 2KBNA 2E2JH 2RHSB 3A74A 2HIVA 4BY1H 3CP0A 3I4OA 3GTOH 3HOWH 4A3GH 2EXDA 1IZ6A 1ASZA 3JC66 3PCOB 4DKAC 4A3JH 3RNUA 1X3EA 3GTKH 3PUZA 4A3KG 3JAMi 2UUBL 3U50C 2A8VA 4JOIA 1Q81C 3PUXA 4JCVE 3RLNA 1PH8A 1UEBA 3K0XA 4ME3A 4QJFA 4DV2Q 3CD6A 2H5XA 2IHEA 1CSQA 4GOPB 4JI8L 1Z9FA 1FJGQ 4LF4Q 4JC0A 1JT8A 2WP8J 4X65L 2WAQE 4YHHL 5AJ3Q 4DR1L 4OX9L 2VUMH 4GLAC 3K8AA 4NXML 4OO1I 4X62Q 2Y0SG 1VQ7A 1YHQA 1B70B 2L15A 3E9IA 1YI2A 1YITA 4A3MH 2QGQA 3KOJA 3MEFA 1DGSA 3T1YQ 4DNIA 1XMQL 2CFMA 2YYZA 3I4NH 3HOUG 4POGA 1VQAA 4GN5A 1XNQQ 1L1OC 1QVGA 1PV4A 4BA1I 1VQ4A 2R6GA 1HZ9A 4JG2A 1OXVA 4L5TA 3KF6B 1VQLA 4UY8C 4JBWA 4LF8L 1UE6A 4AIMA 1QZGA 2C35B 3CC4A 2IHFA 2ALYB 2R7DA 4LFCL 4DUYQ 3UDIA 4IPDA 5BR8L 3GTLH 4LF9Q 3RN2A 4FDBA 3CCQA 2LXKA 1PA6A 2UXCL 1HNWQ 2XGTA 1XNRQ 5LMUQ 2IX1A 4UP8A 1Q1EA 5M3FH 1X3FA 4R4TA 4Y52H 3NEMA 4GLVB 4DK6C 1S72A 5LMNW 2E2HH 5E7NA 5ELNA 1VQ5A 3TRZA 1D7QA 3FKIG 3JAMc 2PQAA 2V1CC 2Q2UA 2WB1E 2K5HA 3HOYG 5LMNL 4BBSG 4DV7Q 1IXRA 1X56A 4A3FH 4JI7L 3KJPA 3G71A 3M3YH 1X3GA 1WI5A 3I2ZA 4BA2I 2NZOA 3W5OA 1N32L 1I3QH 1M90C 4A3LG 3OYYA 4QGUA 2IY5B 3S15H 1AE2A 1N34L 2KCTA 5IYCG 2CWAA 4A93G 1QVFA 2CQOA 3GTPH 3HOUH 2LXJA 4JI2L 1XPUA 4B3MQ 1O7IA 2YV5A 4C2MH 1HNXL 2UU9L 4K0KL 4DPGA 1K0RA 2UUBQ 1OXTA 1EUJA 4GN3B 4PMWA 1Q46A 2JA8H 4KHZA 5EAYA 3G48A 1YHBA 4R4OA 4DR4Q 2UXBL 3M4QA 4YWMA 1WYDA 4QY7A 3TEHB 5M5YH 3H15A 3F2BA 1G6PA 4DV4L 1KC8C 4JI8Q 2CKZB 2K5VA 1N36L 4X65Q 4YHHQ 4DR1Q 4OX9Q 1LYLA 4DUZL 4B3TL 2K5NA 2VW9A 2Z6KA 3ULJA 4IOCA 1OXXK 3HOYH 4MTNA 5GAEC 3UE0A 2ZTCA 5GAHC 1Q12A 4LNQA 2N8NA 1HZAA 3GTQH 2OTJA 3J80i 4OWXB 3F2DA 3H3VH 3BJUA 3PUVA 4A3LH 4JI5Q 1XMQQ 1IBKL 4WJ4A 4C3HH 3PUYA 2EQSA 4GKKL 2ZM6L 4C3IH 2ZJRA 3S1RH 2MQHA 4L5QA 3H3VI 3I4MH 3KF8B 2VNUD 4DV6L 3TS2A 4LF8Q 3BZCA 4UPAA 2VUMG 4KHPL 3CPWA 2RF4A 2JJQA 2OCEA 3HKZE 3AEVA 4LFCQ 4GNXA 5BR8Q 2GVBA 4UP9A 1XTDA 1Y1VG 2NVXH 2AKWB 1YJNA 3PV0A 1R9TH 4DR7L 1NTGA 3EIVA 1E1TA 1LUZA 3AFQA 3SGIA 4A3MG 4HJAA 5FJ8H 1EFWA 4HJ9A 1SR3A 2N3SA 2UXDL 1I94L 2CWPA 3CCJA 4NPSA 2Q2HA 3I4NG 1T9HA 1PH5A 3KFUA 3S1MH 2PQAB 4GLXA 3LGJA 4HJ8A 4R4IA 5LMNQ 3BU2A 2A1AA 4XIGS 5K36G 1X65A 4KLKA 1WJJA 2PNHA 4POFA 1IBML 2CCZA 4JI7Q 5C4XG 1J6QA 4C3JH 2K4KA 2BA0A 4EX5A 3HKSA 2R92H 3A5UA 4B3RQ 4A4IA 1YJWA 1CSPA 1QUQA 4JOIC 3KDFA 4MZ9A 4NXNL 4AQYL 1Y1WH 1N34Q 5GROA 1YJ9A 2I5HA 3G6EA 5M3FG 2NVTH 2JEAI 1V1QA 4JBJA 4JI2Q 1PH2A 2NN6G 4DR6L 1C9OA 2UU9Q 1HNXQ 4K0KQ 2KHIA 5M3MH 2K14A 2D0OA 2I5LX 1TWAH 4LF7L 1KXLA 4X64L 3J80c 5ELOA 3T1HL 1EQRA 4LWCA 2QEXA 3H0GG 4A3FG 4P73A 4A3IG 1M1KC 1K8GA 1Y1VH 3DM3A 4DAYB 1W2BA 1YEZA 2IX0A 2PI2A 3K81C 2MNAA 3CF5A 3TS0A 4GKJL 4DV4Q 1YNXA 1EQQA 1P16A 5IT9c 4WJ3M 3DLLA 1AH9A 4HIMA 1GVPA 3K7UC 4DUZQ 4B3TQ 1A63A 4PG3A 1B7YB 3TQYA 4BXXH 1W3SA 2ZTDA 3CCSA 2LSSA 3CCLA 4A3CG 1OXUA 5J3BA 5C4XH 1GKHA 2KENA 3S17H 1I5FA 4DR5L 1UE5A 2JA8G 1WCMH 1OXSC 1KRTA 1PVOA 2OQ0A 3PF4A 1IBKQ 2Y0SE 2XTIA 1FVIA 4IPGA 4LFBL 1VQNA 4GN4B 1QZHA 4GKKQ 1X55A 4B3SL 2ZM6Q 3RN5A 3AQQA 5C4JH 1Y14B 3M7NA 2Q2TA 3EBEA 3UDFA 3M85A 4DV6Q 1HNZL 1JMCA 2JA7H 4KHPQ 1VQJA 3F8TA 3S2HH 2FXQA 1JJCB 4JI1L 3K7AH 2NVQH 2OTLA 4JI4Q 4JI6Q 3UDXA 5IP7G 4GNXB 3ZJYC 1KD1C 3I56A 1EIYB 4IPCA 2NN6I 5HGQA 4DR7Q 1K73C 3H0GH 4DR2L 3S14H 4A3IH 5IYDH 1U0LA 5IWAL 4IPHA 5H1SE 2VQFL 2GN5A 4A3EH 4L5SA 1IL2A 1KIXA 4QL5A 2VZAA 1GO3E 2KCMA 1I94Q 3L0OA 3PO3G 3GO5A 2K75A 3STBC 3I4MG 1N33L 3OTOL 1RIPA 4HIOA 4TVAB 1IBMQ 2MO1A 1VQFA 4LFAL 4A3CH 2YTYA 3S1NH 4KI0A 3J7A5 1VQEA 4EQ5A 4NXNQ 2JA6H 1NMFA 2HHHL 1I6HH 4AQYQ 3KDFB 3RR5A 1YHAA 2AHOB 4OONA 5FJ8G 4R4CA 4PZ6A 3PIOA 3GTMH 4DR6Q 4X6AH 4HJ7A 1K8AC 2BH8A 1L0WA 1BBWA 3VDYA 4LF7Q 4X64Q 3CXCA 3D31A 1UE1A 4H02A 4RMFA 3T1HQ 1UWVA 2AMCB 1JJ2A 4PZ8A 4NXMQ 2B63H 5IP7H 3TREA 2Z6KC 4YWLA 4GOPA 2N49A 3CPFA 4LW1A 1SFOH 3L2PA 3CCMA 1U5KA 1PHJA 1FJGL 2R92G 3ICEA 2R7ZH 2AWOA 2A19A 2UUCL 2E5LL 1Y1WG 3W1BA 1YIJA 1VQCA 5DLQE 3D0FA 3PO2G 1C0AA 4A3BH 3ER0A 2GVAA 3ULLA 1VQPA 3I7FA 2PMZE 3AYHB 3PUWA 3HOXH 4DR3L 1VQ8A 1KRSA 5M3MG 1NMGA 2WFWA 3STBD 3J7ZC 1PYSB 3T1YL 4QQBX 3I55A 1PFSA 1VQHA 2DGYA 3E0EA 1P8LA 5HY6A 1XNQL 4GNXC 3J81j 4AYBG 3UE1A 3M4OH 3KF6A 1EWIA 4LFBQ 2UXCQ 1VQDA 4B3SQ 2F4VL 1E24A 2RHQB 1KQSA 1H95A 4P72A 2Z0SA 1PH9A 2BA1A 1CKMA 1LTLA
chains in the Genus database with same CATH superfamily
2I0QA 3KJOA 4JI1Q 5D65A 3TMEA 3OW2A 4IUUA 3MXNB 1JJGA 1BKBA 3P75A 3UI2A 3CC7A 4JV5L 3F1ZA 3W3AA 2RSNA 3A8IE 3AFPA 3PO2H 2VQEL 1C4QA 1S3OA 1ILQA 1PMRA 3NTKA 2O5JC 2JA7G 1EY0A 2C9OA 2EY1A 1H9RA 4N9TA 4FO2A 1Q1BA 3K7AB 5C0XG 2WAQB 5IYDG 3PO3G 2ZJQA 3GD7A 1KNEA 1J5EL 2CW0D 3A5ZB 3TSSA 1AE3A 2B2UA 1UE7A 3IKJA 1TKWB 3A8KE 1AZQA 4OO1H 2F0GA 2E75C 5C0XJ 3WOEA 1O7YA 3KLWA 5EJWA 2L55A 2E5LQ 2Z1CA 3EN2A 3TZUA 1Q82C 4YCWA 2EIFA 4IFDG 1HTPA 3CW2C 3OSOA 2ES2A 1A8VA 4LAAA 4LUZA 5IYBH 2JA6B 3G4SA 3DEOA 4TQUS 1VQGA 1EY6A 3GTMB 4APVA 4Q0FA 4IUPA 1XJVA 1S40A 3TP8A 2RDHA 1SMXA 4LF6L 2AWNA 3KF8A 4IFDJ 1F9RA 1MI2A 1B3AA 1PH4A 5EPLA 1LTTD 1N8RC 4X3KA 5IGBA 1GJXA 4AH6A 2HT1A 3CCUA 1E3PA 3GTGH 4OWWB 2R7ZB 1O7ZA 4DN4M 3A0JA 1VCIA 3GDEA 3HOVH 1Y8OB 2R93G 1K3RA 4XQJA 1Y8PB 4ME5A 4WJWA 3X3NA 1PYBA 3SK8A 3OPOA 3DWQA 3MFGA 3FMCA 1QUQB 2I46A 2E2IH 5GAGC 1TWHH 1EYGA 5CV8A 3M4OB 4B3RL 4NW2A 1E7ZA 3KBXA 1ILPA 4BY7G 1NBWA 1PH6A 1X9NA 4O42A 1F9QA 1LTGD 3RLOA 3E9HA 4A3DG 1TWCH 4LF4L 1G2TA 3F2CA 2A69C 2F0MA 1EZ8A 4ZAIA 3BVZA 4X62L 1CKNB 5C5MA 4A76A 1NY4A 4DAYA 4MNOA 5M5XB 1G291 2B2VC 5FLMG 4LUVA 1HZBA 2JN4A 1EQVA 1K8OA 5IP9H 2F0HA 2D0PA 1L2FA 3DEPA 1R4PB 3K5MA 2K33A 1TWAB 4YY3Q 3PF5A 4OWTB 3DUZA 4ZLTF 3HOZH 4JI0Q 2UUAQ 1HNZQ 2EYJA 2MPMA 4IJLA 5JVH3 2BCOA 4DV3Q 4X66Q 2NTTA 5IYCH 4DXGA 1BCPF 1PZID 2EDGA 2VB3X 1CM9A 4JBKA 2F0VA 2JA5B 1S5BD 1V43A 3ERSX 4KKTA 4JI6L 4JI4L 1G51A 1VF5C 1KHIA 3E0JA 3M4YA 1PH3A 3MWYW 3MZ5A 1SYGA 1BNZA 2E2JH 4R8IA 3CP0A 3HGBA 3I4OA 1BF4A 3GTOH 4A3GH 1SSOA 3BZDB 1HQMC 1DOKA 4DKAC 3ND9A 2EYLA 2ZT9C 3RNUA 1GUOA 3TZDA 1DXMA 1ICFB 1TS2A 2A6ED 3JAMi 2UUBL 4JW0A 2A8VA 2YU9B 4JCVE 5EBCA 2MGSA 1CSQA 4GOPB 1FJGQ 3SHLA 1JT8A 4X65L 4YHHL 4OX9L 4CDFC 2QCPX 4GLAC 1RKNA 2MJ8A 3K8AA 4H13C 4RKBA 5EPKA 1VQ7A 3RZOB 4BWGB 1B70B 2L15A 1QJOA 1JWMD 5EQ0A 1BOSA 3J80L 3E9IA 1EWCA 4FF3A 2CQAA 1TU2B 2CFMA 1TQOA 5IT9L 1HZ9A 4JG2A 1VQLA 3NTIA 4RHRA 2WB1B 5CC4A 4AIMA 1LV9A 1PTOB 4MTKA 4IPDA 5BR8L 4G7ZC 4LF9Q 4HR7B 1PA6A 1XNRQ 5M5WB 5CV5A 1X3FA 3NEMA 5FLXE 2WACA 2E2HH 1STBA 1SNCA 4KY7A 5DM63 2K5HA 4J8QA 3I4LA 1LABA 5LMNL 4DV7Q 3FKIB 2AUKA 3JAML 1X3GA 2PW5A 4Y7NB 1AZPA 3C1FA 4BA2I 1I4QA 2PZUA 5AFWA 1I3QH 4A3LG 4LJZC 3BYTB 1TWGB 3OHXC 4QGUA 4FNFA 2KCTA 1CA6A 3GTPH 2PQEA 2A74C 5FO7B 1XPUA 1STAA 2YV5A 2UU9L 2VXWA 1H9SB 1ZKOA 1TS4A 1EUJA 1Q46A 5C44B 4K8IA 1S5DD 3CQZB 1YHBA 4DR4Q 1LTRD 1SE3A 5M5YH 1BBXC 3GP7A 1G6PA 3RUZA 1KC8C 1AFPA 1L0YB 3K0YA 4DR1Q 1TWFB 2PMZB 1DZ1A 2K5NA 1F9SA 2PW7A 3N52A 1YNJD 3ERQA 1HTLD 5C6AA 5JOBA 1Z7TA 2O2LD 4LNQA 4A3JB 1D5MC 3H3VH 3T56B 2HUGA 1CA5A 3TP7A 2ZM6L 4FXDA 1KABA 1QNUA 2MQHA 3DMUA 3KF8B 1STEA 4LF8Q 3BZCA 4UPAA 4KHPL 2F3VA 3EA6A 2OCEA 3HKZE 4LFCQ 2P5ZX 4X3UA 1Y1VG 2AKWB 4B9WA 3JAME 1NTGA 2NTSA 5FO8B 4A3MG 1SR3A 2N3SA 4GZYC 4TSSA 4HTHA 3CCJA 1EIGA 4NPSA 3KFUA 1JE4A 3S1MH 2PQAB 5I9PA 1DM0B 3LGJA 3BU2A 2EYHA 4KLKA 1PRTF 1WJJA 3I4NB 3U9OA 4C3JH 5E4XA 3A5UA 3T51B 4AQYL 1N34Q 4QIWB 3FRPB 1YJ9A 2NVTH 1GOZA 1PH2A 4DR6L 3KLSA 1SYBA 2D0OA 4LF7L 1KXLA 1ENCA 4ILWA 2H1EA 4LWCA 5IGCA 3H0GG 4DFAA 4A3FG 1ENFA 3DM3A 4DAYB 2JSOA 3K81C 1UAPA 3TS0A 4DV4Q 5I9OA 1P16A 3M3YB 4RCOA 3DLLA 1AH9A 3VYTA 1UEAB 3K7UC 1A63A 1HHVA 1LACA 5COYA 4IUQA 3RD4A 4P2CB 4ZKCB 4DR5L 3HG9A 3CRLC 3MHBA 1TWCB 3NHHA 2Y0SE 5KYLA 4IPGA 1J9OA 2HQEA 4B3SL 1IYUA 3P7JA 1NNXA 3EBEA 4XXEA 1VQJA 3F8TA 2FXQA 1JJCB 3K7AH 5G3LD 5T1IA 5C5LA 2VQFL 4L5SA 5H1SE 1F2LA 4KY6A 1JCKB 4F7XA 4IQZA 2ZXPA 4NMZA 2KVMA 1RIPA 4TVAB 4A3CH 4K6DA 2YTYA 1VF7A 3I4MB 1RJTA 1SNMA 1PFNA 4EQ5A 1DJRD 4NXNQ 1NMFA 2JA6H 3RR5A 1IW7D 1TIID 2AHOB 4OONA 3GTMH 1ESFA 1QE6A 1QG7A 1SMYC 4K8JA 1NCVA 4X64Q 3CXCA 4H02A 4ZUIA 1JJ2A 4PZ8A 1TS3A 2L1BA 5JEAH 1PHJA 2R92G 2R7ZH 2UUCL 2LMCB 1LTSD 1Q8IA 5CV7A 3D0FA 3PO2G 2Q8IB 3ULLA 3HOXH 1L0XB 3SEBA 1KRSA 2A68C 1TVXA 2F0SA 1PLFA 3I55A 1PTOF 3IFTA 5HY6A 1XNQL 3NBIA 3M4OH 4IN3A 3UE1A 1EWIA 1A15A 4KD3A 1WTQA 3BVGA 4RH6A 1DCZA 3D3RA 2F4VL 1KQSA 4AYBB 2BE5D 1PH9A 1WVLA 1MSHA 2KEDA 2R7FA 1KDCA 1C7YA 4PZ7A 4BXXG 2NZ1D 1VQMA 1YZ6A 1SE2A 1HR0W 3IRBA 4DR2Q 4LMQD 3BS1A 2K03A 3K5LA 2JQOA 5GQOA 1FNWA 1XXGA 2DNCA 2YTXA 4GS3A 5IY0A 5M5XH 5GADC 5C4XB 5FLXc 2MHVA 4KN7C 5IYBG 1A0IA 2B2WC 1N33Q 1U4PA 4JPBW 1NSNS 3OMGA 2I5MX 1PZKD 5C4JB 2F52A 4RKLA 2JA7B 1NUCA 1NE3A 4JBMA 4EVOA 4QMGA 1TXYA 3M9BA 2E76C 2JXMB 3K59A 4K2KA 3CCRA 4H44C 3WWVA 1PH1A 1N36Q 1F2MA 4JYAL 1CKNA 4DV1L 4R9WA 3CAMA 3HOVG 2BH2A 2EYMA 1Z47A 3U4ZA 2JA5H 1IKMA 3L9AX 1SJED 3KYHC 4LK1C 1XMOL 1CQFA 1N9WA 5LHY1 5JAVA 2DUDA 4H7BA 4ZUJA 3NELA 1IW7C 4DV5L 3A7AB 3KLSX 3S1NB 1DYQA 1I6HB 4DR3Q 3TP6A 5FKAC 2B8FA 2K50A 1TT2A 5HGTA 4JI3L 2YU9H 3FP9A 4KJNA 2LS01 4K5WA 3ULPA 3NENA 4DAMA 2HD3A 4OELB 1G8ZD 3CKIB 2L12A 3DXJC 3PGZA 5C0XI 1I4GA 2X6GA 5JPNC 5IP9G 1MKHA 1BVSA 1FYCA 2F0EA 1I4XA 1HJPA 3M4PA 4L8JA 3RZOH 1STHA 4JV5Q 3M7GA 1D8LA 1BUVT 3HOZG 2VQEQ 1KNAA 2MO0A 4M1UB 1XX8A 1KAAA 3K5OA 1NR4A 1KLGD 3T4AC 4IFDI 1CT1D 4FP5D 3J81c 1LTID 1PTOH 4O0AA 1GD7A 3RLFA 2KEEA 1JWUD 3NE5B 1J5EQ 3FDTA 4GKJQ 5AJ3L 2PO4A 5C3EG 3S16B 5M5WH 1ML0D 3SR1A 4J15A 4C1NK 2NVTB 1AEXA 1LT5D 4I7AA 3Q22A 1SRUA 1FL0A 4A3GG 2NZHA 1Q8KA 2F0UA 3FKIH 3HKZG 2GA4B 2F0PA 1JC7A 1E22A 4Y7NH 3FHWA 4OIJA 1EIFA 1STGA 1TWGH 5IGEA 1SNDA 3IFDA 4RGTA 4NP5A 3E5SA 4DUYL 2K52A 2HIXA 4BBRG 4XTCS 4QB4A 2CH4W 4LF6Q 3HRZC 1HQRD 3A7LA 5IE8A 1B3QA 5C44H 3CQZH 2SNSA 1I50H 2B2YC 4CGYB 4IJHA 1GM5A 1PZJD 1S4ZA 2A69D 1RL2A 4UP7A 2QA4A 4UHVA 2NUCA 3OTOQ 1JE5A 3W2DA 1TWFH 2XNAC 4L6TB 4HIKA 1IYJB 2DY8A 2KBNA 2EJMA 2M9VA 1CZGA 4J1MA 1SYDA 3PCOB 4A3JH 4DAPA 1H9SA 1X3EA 4A3KG 5TSSA 1LO5D 4WRDA 1F77A 1YNNC 1G2SA 1Q81C 3PUXA 5KYIA 4PMCA 1Y69U 3CD6A 2H5XA 3SK5A 3V96A 2KCNA 2RBMA 1Z9FA 4JI8L 4LF4Q 3AMUA 2PZWA 3SDZA 1ZYRC 4NXML 2FMCA 4X62Q 2Y0SG 2F0TA 1YHQA 3I70A 4HAEA 3FPUB 1YI2A 1YITA 1RDPD 4PNYA 5I2XA 4G4KA 1DGSA 3T1YQ 4CJ2C 1BDOA 1XMQL 3N6RA 4DAVA 2YYZA 3I4NH 5EKIA 1VQAA 4GN5A 4POGA 1L1OC 4DK1A 1QVGA 2R6GA 5K36H 1UE6A 1QZGA 3C2PA 2A6HC 3CC4A 2ENBA 2ALYB 4Z9CB 2R7DA 3UDIA 1GHJA 4FDBA 3RN2A 1HNWQ 2XGTA 2IX1A 1Q1EA 2EY6A 1GXDC 4R4TA 2XVSA 4DK6C 4MIUA 5ELNA 2B2TC 1PFBA 2PQAA 3HOXB 5C4HA 2WB1E 2Q2UA 2AQ2B 4BBSG 1IXRA 4JI7L 3KJPA 3M3YH 3S2DB 3ITPA 1M90C 1A2TA 3I73A 5DM73 2F0WA 4A93G 1GUWA 2CQOA 3VR5A 4B3MQ 3QG1A 1HNXL 4K0KL 2UUBQ 1EZ6A 3MXPA 4GN3B 2NVYB 2JA8H 2WKCA 4KHZA 5EGTA 2F0IA 3D4WA 3RZDB 1DONA 4YWMA 1FNVA 1WYDA 3NQTA 1STYA 4QY7A 3TEHB 1CI3M 3K5NA 3R2IA 2E74C 4X65Q 4YHHQ 4OX9Q 1LYLA 4XT1B 5D3IB 3ULJA 1OXXK 4BY1B 5GAHC 3A8JE 3HOWB 1HCZA 5ELBA 1Q12A 3HS0C 5EKKA 3TP5A 1HZAA 2OTJA 3J80i 3PUVA 4JI5Q 4WORA 4GKKL 2XIWA 1U4MA 1FNUA 2ZJRA 1MD2D 1WTWA 3I4MH 4L5QA 1IYVA 4DV6L 2WV6D 2VUMG 3FPPA 2RF4A 2OF1A 3AEVA 3I90A 1LT3D 5BR8Q 3R2TA 1XTDA 3PV0A 2EYOA 1E1TA 4PQXA 3AFQA 4HJ9A 4EQOA 4A3MB 4IUTA 3E3XA 3H3VC 4HJ8A 1E0BA 5LMNQ 3GV6A 2A1AA 4XIGS 4XT3B 5NUCA 3QWNA 1X65A 1SNPA 2Z8LA 1IBML 1HUNA 2K4KA 2BA0A 4FF2A 2K04A 3HKSA 2HDLA 3ONAB 5D14A 2DY7A 1YJWA 4JOIC 2I5HA 3G6EA 5M3FG 3VR2A 1V1OA 1E2WA 2EVBA 1IHZA 2NN6G 1C9OA 2UU9Q 1QOHA 3D8GA 2EJGC 2I5LX 3MA2B 1DOMA 1WD0A 4X3SA 1PXUA 2EXZA 5L37A 1WTHA 1YEZA 2PI2A 3C1EA 3CF5A 4WJ3M 1D6EC 4CKBA 4HIMA 4EGVA 1II3A 3G7LA 3TQYA 1SEBD 2K28A 1GUSA 4HMJA 2XWBB 3S15B 2LSSA 4A3CG 2B8GA 1Q3LA 3A55A 5C4XH 2WINB 3HOUB 3D6WA 1GKHA 2KJXA 4YIJA 5IGFA 4C2MB 1KRTA 1PVOA 3PF4A 1QNKA 4LFBL 1VQNA 1QZHA 3M7NA 2ZM6Q 3AQQA 3QB3A 1Y14B 4F87A 5C4JH 2FMMA 2V4DA 3M85A 1HNZL 2JA7H 4FVMA 4KHPQ 3I91A 1ET6A 1SXTA 2EY5A 1VDZA 1V1PA 2OTLA 2F0LA 3ZJYC 1EY5A 3H09A 5C0XH 2FHTA 5IYDH 1U0LA 2R7ZG 4IPHA 1IL2A 3HOYB 1KIXA 3NUCA 4RGOS 1FGBD 4C3HG 3GTQB 4MN3A 2EY2A 4PMBA 2K75A 3STBC 4C3IG 2MO1A 2M00A 3BYYB 4LFAL 3IAYA 3S1NH 3S1RB 3J7A5 2HCCA 1HPCA 5JJZA 1I6HH 5BN4A 2HHHL 4AQYQ 1I50B 4IFDH 3EQLC 5FJ8G 3J80E 3T53B 3Q0AA 3PIOA 4DR6Q 2NVXB 1R9TB 5CV4A 4HJ7A 1BBWA 4LF7Q 5KNBA 2LY7A 3I72A 3D31A 4RMFA 1UWVA 5IT9E 1SAPA 1M8AA 5IP7H 2Z6KC 4DF7A 1FJGL 3L2PA 1U5KA 1KDAA 1IKLA 2AWOA 3J81L 1Y1WG 3W1BA 4KN4C 4BS9A 1TR5A 1UNSA 1YIJA 2R92B 2B2VA 4L63B 4OGQC 1C0AA 4RAUC 5KNCA 3I7FA 1AP0A 3AYHB 3PUWA 5M3MG 3J7ZC 4OL7A 1PYSB 1CZWA 4QQBX 2F03A 2K5QA 1P8LA 4GNXC 2TMPA 2UXCQ 1VQDA 4B3SQ 1E24A 2LKVA 4R8NA 2Z0SA 2L11A 2BA1A 4ZYSA 5M9OA 3A54A 3CCVA 2Q8TA 1JOQA 2MFIA 3SXHA 1SMYD 2ATWA 2ZTEA 3S16H 3LX0A 4JVZA 2VQFQ 2NWGA 1VQBA 1A3VA 1WCMG 1GUNA 1N32Q 1HR0L 1QCBD 2DJGC 4P74A 3CCEA 1PRTC 3K80C 1EIHA 5FLMH 1RF2D 1O7LA 2K32A 1U4LA 1VQ9A 2FINB 3BZKA 2A68D 2JA9A 5KRUA 1RCVD 1MHWC 3SVMA 4LUOA 2NVQB 2UXBQ 1QVCA 1Q86C 1LM0A 3Q8DA 4A3EG 2RSOA 1SE4A 4A75A 1MJCA 4LF5L 2L9HA 3O13A 3S14B 4A3IB 1PH7A 1D5ZC 4DR4L 2G9DA 2DN8A 4ODGA 3MAQA 1K9MC 3MXUA 4OHJA 3L7ZC 2KUMA 1SDFA 1A3TA 1QILA 3PIP3 2UUCQ 3QIAA 1SLJA 2OXPA 2VL6A 2JA8B 1KDBA 1BXTA 4K2LA 5C4ZA 5A2QL 1Q7YC 1IBLL 5BN3A 4FXKC 5ELFA 1VQIA 2B63G 2WB1G 1LT6D 4Q5VA 3MEHA 2PCFB 2F4VQ 2UXDQ 2OQKA 2IWHA 1CK1A 1EYAA 1SFOB 1X54A 2HQLA 4A3BG 2PZTA 2ID0A 4DV0L 4DU9A 5DEHA 5CORA 3R93A 1EQTA 3LWEA 1KL9A 1HFGA 3MC0B 3DWAA 3TDQA 1V9PA 2D2CC 1EY7A 4XDXA 1ASYA 2ASBA 2JK8A 5EBDA 4IOAA 2F3IA 1K8MA 3PIO3 1SE8A 4RHSA 2EOTA 3T13A 2RCNA 1VS0A 5KEEA 4DV2L 1EYDA 3VR4A 5C44G 1VMCA 4GOPC 3U4VA 2IW3A 5KGUA 4JYAQ 4DV1Q 4P71A 2CH4A 3GTJB 2RDFA 3X3MA 5C3EB 1VQOA 1KAWA 1XMOQ 4E6IA 1MIUA 2JE6I 2Q2IA 4DV5Q 3G6JB 3T16A 1Z6HA 3J7AV 4DA2A 4A3JG 3S2DH 1HUMA 3EVQA 1XPOA 1EYCA 3OOCA 3EFXD 2F0QA 1PTOC 4NKLA 3QJYA 2CVRA 2M2LA 4IURA 3BDOA 3MVVA 1DOLA 1BQQT 5LMUL 1V1PB 4OO1G 1L1OB 4JI3Q 2C5CA 3CC2A 4WFN3 2NVYH 3K6OA 4BBRB 5IWAQ 2KHJA 2QDLA 4B08A 1CUKA 1JOKA 4YWKA 3QO2A 3RZDH 1VQ6A 5C3XA 2NB0A 1A62A 3PQIA 2JEBI 2QILA 1VQKA 4CJ1B 1WOCA 2D62A 2F1MA 4BY1H 3HOWH 1HRJA 2EXDA 1B9MA 1IZ6A 3CHBD 3JC66 5E3FA 1FR3A 1B4OA 1CQVA 2QDBA 3V05A 1XWEA 5G3LF 3PO3B 5CBEE 4A3KB 2J0TD 1PH8A 1UEBA 1ONLA 2B2UC 3H91A 1CHQD 5FOBB 1W6JA 2G5DA 2IHEA 2IJ0A 1EY9A 1PFMA 2WP8J 1MBYA 2WAQE 5AJ3Q 4ZQ3A 4IALA 2X69A 3DHQA 4CKEA 1WTVA 4A3MH 2RDGA 2Z9HA 3KOJA 3MEFA 2D5DA 1I4HA 2E2DC 4S3SA 4BA1I 1CHPD 4L5TA 4UY8C 4KV6A 1JQYD 4HN7A 2C35B 4C1NI 2IHFA 4B9XA 3NQIA 4DUYQ 3BG3A 4M8AA 5CV9A 1YNND 4UP8A 4Y52H 3NP8A 4GLVB 1AW7A 3TRZA 1A2UA 1D7QA 4KTAA 3JAMc 3BDCA 2R93B 1C8CA 3Q24A 1K3BC 3OMCA 1ZYRD 1X56A 3DM1A 1D1KA 4A3FH 4CHTB 1R4QB 3I2ZA 5E4WC 5IOCA 2NZOA 3IL8A 4BBSB 3C3LA 3OYYA 5LL6S 3S15H 3S1QB 5IYCG 2CWAA 2X6LA 3KBGA 1QVFA 3HOUH 2LXJA 4JI2L 4K14A 4C2MH 3A56A 4BY7B 4DPGA 1K0RA 4A93B 5E1FA 5LL6X 1OXTA 4PMWA 3RMHA 3AU7A 2A6HD 4K5VA 1SJHD 5EAYA 4A3DB 1SNOA 2B39A 3G48A 2BDOA 3H15A 4KMUC 3KUPA 4JI8Q 1N36L 1JWSD 2KOLA 4DUZL 4B3TL 1PDQA 2F0OA 2VW9A 1K83B 4XQNA 4IOCA 3HOYH 2LFNA 1LTAD 3MTSA 4MTNA 3UE0A 2ZTCA 5GAEC 2F3WA 2NYZD 1T5EA 2J7ZA 3GTQH 1KTKA 1NAPA 2A73B 4OWXB 3BJUA 1XMQQ 1IBKL 4WJ4A 3PUYA 2EQSA 1H9KA 1QWYA 3S1RH 3H3VI 3SK4A 1MSGA 4V190 3TS2A 2VNUD 2MUYA 2ICEC 5JPMC 5KNDA 1WTRA 2NVXH 4F8MA 1YJNA 2VUMB 1R9TH 4DR7L 5IGGA 2PYKA 2F0FA 2KCCA 3SGIA 1WTXA 4HJAA 4NDXA 1GUTA 1EFWA 3Q23A 1I94L 4O1NA 3CU7A 1S5ED 4I7ZC 3MFYA 1S5CD 5J39A 2RQXA 3TN2A 4HCSA 5C4XG 3NXWA 4JI7Q 2HCIA 4N8X1 2R92H 4B3RQ 4N8FA 1CSPA 1H9MA 4MZ9A 5GROA 2EPBA 2B2WA 2RKSA 2JEAI 1V1QA 3GTLB 1HNXQ 4K0KQ 5M3FB 1JICA 2K14A 1HXYD 3LNNA 1CTMA 3T1HL 1F9PA 1XTCD 4QF4A 4P73A 1JR0D 3NBHA 1W2BA 5I4DA 2IX0A 1BCPD 4GKJL 5IGDA 1EQQA 4ZRZA 3QOLA 2EYPA 5DAUA 4PG3A 5ISRA 4BXXH 1W3SA 3CCLA 1OXUA 5CR3A 1B44D 4UDUC 4CBVA 2G9HD 2H4OA 5I6WA 4DXFA 2WKDA 2XTIA 1FVIA 4GN4B 4GKKQ 1X55A 2F0NA 4K5XA 1SBBB 4DV6Q 1HA6A 4UAIA 4JI1L 2NVQH 4JI6Q 4JI4Q 5IP7G 4GNXB 1EIYB 3I56A 4IPCA 2NN6I 3K57A 1K73C 3OIQA 3S14H 1HFNA 4A3IH 3OWEB 4N9PA 4QL5A 2VZAA 1GO3E 1D1IA 2KCMA 3L0OA 4HMIA 3GO5A 2MP1A 4U68A 1PYWD 3OTOL 4KKUA 4C3HB 1IBMQ 3U9SA 4OEMB 3NTHA 5J22A 2QKIC 2CHBD 4C3IB 4KI0A 3SK6A 1SYFA 2F0KA 1O80A 4V0BA 1PRTB 3KDFB 3BVMA 3NK9A 1YHAA 3ZYYX 4HSVA 1K8AC 2K6AA 1LTBD 1L0WA 2BOSA 3WOFA 4CDDC 3VDYA 5CMDA 4G7OC 3TREA 2N49A 3CPFA 3L3OC 4C3JG 1B53A 2XSCA 3SE0A 1SFOH 3CCMA 2A19A 2E5LL 5DLQE 2J4XA 1XYIA 3ER0A 2AQ3B 2GVAA 1Y1WB 1VQPA 2PMZE 1VQ8A 2WFWA 1JOOA 3STBD 3NPPA 3T1YL 3D4DA 2K01A 1F2YA 1PFSA 1VQHA 3E0EA 2XWJB 4FF4A 2K05A 5M3MB 2I07B 5T1GA 2F0DA 3KF6A 1BCPC 2CW0C 3TBIB 4LFBQ 3I3CA 2AUJD 1H95A 1Y1VB 4P72A 1CKMA 1LTLA 2ZXOA 1HZCA 3VYUA 1HNWL 2R61A 1EWHA 1RTNA 3H94A 2B2YA 3GTJH 4DNRB 3U58A 1D5XC 4YCUA 5CGKA 3HP3A 5C3EH 1TY2A 1SYEA 3D4RA 5JJLA 3S17B 1V8QA 1WCMB 4J6HA 3NWSA 4LFAQ 5FLXL 4TKOB 4TRDA 2WAQG 2OWOA 1NJIC 3S2HB 2ZJPA 2HHHQ 4ZK9B 1BBUA 5CBAE 3HFZB 4B3ML 1YBYA 4RG1A 4QCLA 4JK1C 4QIWE 3KLRA 3H0GB 4A3FB 1ZXTA 4A3EB 4RFBA 1E1OA 4FYDA 4BBRH 1LT4D 2RCFA 2B29A 4P75A 3B6YA 1H9JA 5JVG3 3CMEA 4HJ5A 3PIPA 2JA6G 2N78A 1TS5A 3J81i 1HH2P 2K5WA 4YY3L 4KJOA 1D2BA 3PSIA 4R4QA 1A6XA 1PRTD 3URYA 4JI0L 3VA7A 2UUAL 2PPBC 3CMAA 4O2DA 4NB3A 4JI5L 1CKOA 3DWPA 1W6KA 2VB2X 4X66L 4DV3L 3I8ZA 1L1OA 4QUFA 4X3TA 1JORA 2YTVA 4YCVA 5JEAG 2B63B 3PO3H 4A3KH 2A5HA 1B8AA 4IO9A 2NBFA 5JJKA 5JJIA 2DNEA 3HOXG 1B2TA 2JYOA 5JEAJ 2B2TA 4DGZA 4ALPA 4A3BB 3E6ZX 3VR3A 1G91A 1HR0Q 5A35A 5EPJA 1F2ZA 4HCEA 1CFMA 4IZ8A 1RD9D 3S24A 1EEFD 2E8GA 2RVLA 5EKLA 1SROA 4C56C 3NBHB 2EE1A 5ELDA 2B3GA 1X3QA 4LF5Q 4HIDA 1YVCA 2KHSA 3LWUA 5IODA 4G7HC 4L5RC 1EOVA 3VYRA 1K28A 4HSPA 2R93H 1SN8A 3PO2B 4BY1G 4DK3C 1JB7A 3HOWG 4DR5Q 1MJEA 4QUCA 1LLRD 2PI2E 1B50A 2A6EC 5K5PA 4BBSH 1G6ZA 1E2ZA 3UDGA 2XRQD 3S1QH 3HEJA 1X6OA 1IBLQ 5BN5A 4LF9L 1KLUD 4OXPA 1OTCA 2JA5G 1XNRL 4BY7H 1FGUA 3HZXA 1A3UA 2QW7A 1XPRA 4A93H 5ELEA 4CKCA 1VMPA 4G57A 4A3DH 3W1GA 2SOBA 1QB5D 1EFID 1SYCA 2IT1A 3GQBA 4AYBE 4DV7L 1I4PA 1WFQA 2VY3A 2Z6BA 2ICIA 1C48A 4DV0Q 5DNFA 3K58A 2OEOA 2VS1A 4R1JA 1K83H 1EOTA 2EYFA 2RHSB 3A74A 1DD2A 2HIVA 3KK7A 1STNA 1ASZA 1ESRA 4H0LC 1ET9A 2L0CA 3GTKH 3PUZA 2FFKB 3J81E 3U50C 4JOIA 1SNQA 1PTOD 3RLNA 3K0XA 4ME3A 4ID6A 4QJFA 4DV2Q 3GTGB 1S5FD 3VA5A 3HOVB 3QR8A 4JC0A 4DR1L 2VUMH 4OO1I 5F2DA 5FK9C 1O78A 5CYUA 1EU4A 4FXGC 3NSWA 2E2IB 2QGQA 3QOJA 4HEDA 1TWHB 4XQQA 1EY4A 4DNIA 3HOUG 2XRSD 1XNQQ 4K6LA 1PV4A 1VQ4A 1FD7D 1OXVA 1ENAA 3KF6B 1RHPA 4JBWA 4LF8L 5KIXA 1UUPA 2K7VA 4PV1C 3GV3A 2IL8A 4LFCL 3GTLH 1BO0A 3CCQA 2LXKA 1RODA 2UXCL 5LMUQ 4KY5A 5M3FH 3J7YW 3WDNA 2BDNA 1S72A 5LMNW 2NN6H 2RA4A 5E7NA 1VQ5A 3FKIG 2V1CC 1YNJC 2ZXRA 1U4RA 3H6MA 3HOYG 3MXNA 1E2VA 5CV6A 3G71A 1WI5A 4EQNA 1AN8A 1RTOA 3W5OA 1N32L 4ZKBB 3S9WA 3ND8A 3R3OA 3HOZB 2IY5B 1J8IA 1WTPA 1AE2A 1N34L 2L5TA 4CJ0B 4XYOA 4KHVA 1O7IA 3NWTA 2Z4IA 1WD1A 2N55A 4DK0A 4R4OA 2UXBL 3M4QA 3D6CA 3F2BA 1I6VC 4DV4L 5A2QE 5HURA 2CKZB 2K5VA 4KKSA 3EROA 5I6YA 2HDMA 2Z6KA 2E2JB 3BDLA 4ZCKA 4A3GB 3GTOB 3HKZB 5D3DA 1WTOA 4ABNA 2N8NA 3PMFA 3F2DA 2F4IA 4A3LH 2SDFA 4KD4A 4C3HH 1EU3A 1Q90A 4XYQA 2D9UA 4C3IH 3C46A 2SEBD 2KECA 3CPWA 2JJQA 2EJFC 1U9RA 4GNXA 2GVBA 3Q6SA 2SNMA 4UP9A 2IX3A 3EIVA 1LUZA 1OO9B 4FF1A 5FJ8H 2UXDL 3FVQA 1EL0A 1X3PA 3MXGA 2CWPA 3V2TA 2R3ZA 1GHKA 2Q2HA 3I4NG 1T9HA 1PH5A 4GLXA 2K1BA 3AB9A 4R4IA 1MGSA 5K36G 2PNHA 2N88A 4POFA 2CCZA 1J6QA 4RA8A 4EX5A 4A4IA 1QUQA 3EJIA 1T5XD 2Z4HA 3KDFA 4NXNL 1Y1WH 1EEID 4CDCC 2O5IC 4JBJA 4JI2Q 4RCNA 1TY0A 2K5DA 2AQ1B 2KHIA 4RGNA 5M3MH 1TWAH 4X64L 3J80c 2L4NA 2E2HB 5ELOA 1EQRA 2PNRC 2QEXA 5ELCA 1X32A 4A3IG 1M1KC 1K8GA 1Y1VH 2O4XA 2MNAA 1YNXA 2Y0SB 5IT9c 4F88A 1GVPA 5J1ZA 4DUZQ 4B3TQ 1I3QB 2QEJC 1B7YB 2ZTDA 3CCSA 1JB3A 5J3BA 3GTPB 4IUVA 1K0SA 2KENA 3S17H 1I5FA 3OW7A 3VYSA 1UE5A 2WIIB 1WCMH 2JA8G 1OXSC 2Q8RE 1HA5A 4MHEA 2OQ0A 3OWFA 1IBKQ 3RN5A 3P20A 2Q2TA 3UDFA 4I65A 1JMCA 3S2HH 4OIKA 5FO9B 3VR6A 5M5YB 3P1HA 3UDXA 1KD1C 4U673 1GUGA 1BCPB 5HGQA 4DR7Q 3H0GH 4DR2L 5IWAL 4A3EH 2GN5A 3F2UA 1I94Q 2KA7A 4KK7A 4DNTB 1B9NA 2JP1A 3I4MG 4RGMA 1N33L 3J7AF 4HIOA 4IUNA 1VQFA 1IL8A 1VQEA 1EY8A 2BE5C 4R4CA 3CRKC 4PZ6A 1B1ZA 5I2YA 4X6AH 2BH8A 3OIPA 1UE1A 3T1HQ 4NXMQ 2B63H 2AMCB 1I4RA 3R8BA 3S1MB 4YWLA 4GOPA 2OT2A 2QF7A 4ULLA 4CDEC 4LW1A 1M4VA 3ICEA 2DJFC 2KQ3A 3GTKB 4C3JB 2EZVA 1VQCA 1NR2A 4A3BH 4DR3L 5IIFA 1NMGA 4EQPA 2F0JA 2FJ2A 2DGYA 2TSSA 4RWSC 3J81j 4AYBG 1BR9A 5C3WA 1ICWA 2RHQB 1ZEQX 1Y8NB 3FEWX 2XN9C 2IPKD
chains in the Genus database with same CATH topology
2R7FA 3CCVA 3KJOA 4JI1Q 2I0QA 1C7YA 4PZ7A 1HNWL 1HZCA 4BXXG 2MFIA 3OW2A 1VQMA 1YZ6A 1HR0W 3MXNB 3IRBA 2ATWA 2ZTEA 4DR2Q 1JJGA 1BKBA 3S16H 2VQFQ 2JQOA 5GQOA 1VQBA 3CC7A 1WCMG 2YTXA 3GTJH 1N32Q 4GS3A 1HR0L 5IY0A 5M5XH 5GADC 3U58A 4YCUA 5C3EH 4P74A 4JV5L 3F1ZA 5FLXc 5JJLA 3CCEA 3K80C 5IYBG 1A0IA 2UXBQ 3AFPA 1N33Q 3PO2H 5FLMH 2VQEL 1S3OA 1VQ9A 2JA7G 4LFAQ 2I5MX 2F52A 2WAQG 3BZKA 2JA9A 2OWOA 1NJIC 1Q1BA 1NE3A 4JBMA 2ZJPA 2HHHQ 1BBUA 4LUOA 1TXYA 3HFZB 5C0XG 1QVCA 5IYDG 4B3ML 3M9BA 1LM0A 1YBYA 3Q8DA 4RG1A 4A3EG 1Q86C 3GD7A 1J5EL 2ZJQA 4A75A 4QIWE 1MJCA 3CCRA 4LF5L 3A5ZB 3WWVA 1PH1A 1N36Q 4JYAL 1CKNA 4DV1L 1PH7A 3CAMA 1AE3A 1E1OA 3U4ZA 1Z47A 2BH2A 3HOVG 4DR4L 1UE7A 2JA5H 4BBRH 2B29A 3KYHC 4P75A 1K9MC 5C0XJ 1XMOL 3L7ZC 3B6YA 3KLWA 1N9WA 2DUDA 3NELA 3CMEA 4DV5L 3PIPA 4HJ5A 3EN2A 2E5LQ 2UUCQ 2JA6G 1SLJA 1Q82C 2N78A 4YCWA 3J81i 1HH2P 2EIFA 4IFDG 4YY3L 2ES2A 2VL6A 3CW2C 1A8VA 4LUZA 5IYBH 3PSIA 4R4QA 4DR3Q 3G4SA 4JI0L 2UUAL 3CMAA 4TQUS 4O2DA 1VQGA 4NB3A 1Q7YC 1IBLL 4JI5L 1CKOA 1VQIA 4APVA 4DV3L 2B63G 4X66L 2WB1G 2K50A 1XJVA 1L1OA 1S40A 1SMXA 4LF6L 2AWNA 4IFDJ 2YTVA 1PH4A 4JI3L 4YCVA 5JEAG 2YU9H 3FP9A 1N8RC 3PO3H 2F4VQ 2UXDQ 2OQKA 3ULPA 3NENA 4A3KH 4DAMA 1B8AA 4AH6A 2HT1A 3CCUA 1E3PA 3GTGH 3PGZA 4IO9A 4OWWB 5C0XI 1X54A 2HQLA 4A3BG 3A0JA 1VCIA 3GDEA 5JJKA 5JJIA 3HOVH 2ID0A 2R93G 3HOXG 1K3RA 4DV0L 5IP9G 1MKHA 5JEAJ 4ALPA 1BVSA 1KL9A 1PYBA 1HJPA 3M4PA 3RZOH 1HR0Q 4JV5Q 1V9PA 1QUQB 1ASYA 1D8LA 2E2IH 2ASBA 5GAGC 2JK8A 1TWHH 1EYGA 3HOZG 4A3GG 4IOAA 2VQEQ 2F3IA 2MO0A 4B3RL 1E7ZA 1SE8A 4IFDI 2RCNA 3S24A 1NBWA 1VS0A 2E8GA 4BY7G 1PH6A 1X9NA 4DV2L 1SROA 3J81c 4O0AA 5C44G 1GD7A 3RLFA 3NBHB 3RLOA 3E9HA 2B3GA 4GOPC 4A3DG 1TWCH 1J5EQ 4LF4L 4GKJQ 5AJ3L 3U4VA 4LF5Q 3F2CA 5C3EG 5M5WH 4HIDA 1YVCA 4JYAQ 4DV1Q 4X62L 4P71A 1CKNB 4A76A 1NY4A 4J15A 4MNOA 1G291 5FLMG 4L5RC 1EOVA 4LUVA 1VQOA 1KAWA 1HZBA 1XMOQ 2R93H 1SN8A 5IP9H 1SRUA 1FL0A 1MIUA 4BY1G 4DK3C 2NZHA 2D0PA 1Q8KA 2JE6I 2Q2IA 1L2FA 3FKIH 3HKZG 4DV5Q 4DR5Q 1MJEA 1JB7A 3HOWG 1E22A 2PI2E 4Y7NH 4A3JG 2R7ZG 3S2DH 4YY3Q 3FHWA 3PF5A 4BBSH 1EIFA 4OWTB 1XPOA 1TWGH 3UDGA 3HOZH 4JI0Q 2UUAQ 3S1QH 1HNZQ 1X6OA 1IBLQ 4DUYL 4IJLA 2K52A 4LF9L 4OXPA 4DV3Q 4X66Q 2HIXA 4BBRG 1OTCA 2JA5G 5LMUL 1FGUA 4XTCS 1XNRL 1L1OB 5IYCH 1XPRA 4BY7H 4OO1G 4LF6Q 4A93H 4JI3Q 3CC2A 5IE8A 2NVYH 4JBKA 5C44H 5IWAQ 1V43A 3ERSX 2KHJA 3CQZH 4A3DH 3W1GA 1CUKA 4YWKA 1I50H 4JI6L 4JI4L 3RZDH 4IJHA 1G51A 1GM5A 2IT1A 1VQ6A 1KHIA 4AYBE 4DV7L 1PH3A 4UP7A 1RL2A 2QA4A 1WFQA 3OTOQ 1A62A 1JE5A 2JEBI 2VY3A 4DV0Q 1TWFH 2VS1A 4R1JA 1K83H 4HIKA 1VQKA 1IYJB 1WOCA 2D62A 2KBNA 2E2JH 2RHSB 3A74A 2HIVA 4BY1H 3CP0A 3I4OA 3GTOH 3HOWH 4A3GH 2EXDA 1IZ6A 1ASZA 3JC66 3PCOB 4DKAC 4A3JH 3RNUA 1X3EA 3GTKH 3PUZA 4A3KG 3JAMi 2UUBL 3U50C 2A8VA 4JOIA 1Q81C 3PUXA 4JCVE 3RLNA 1PH8A 1UEBA 3K0XA 4ME3A 4QJFA 4DV2Q 3CD6A 2H5XA 2IHEA 1CSQA 4GOPB 4JI8L 1Z9FA 1FJGQ 4LF4Q 4JC0A 1JT8A 2WP8J 4X65L 2WAQE 4YHHL 5AJ3Q 4DR1L 4OX9L 2VUMH 4GLAC 3K8AA 4NXML 4OO1I 4X62Q 2Y0SG 1VQ7A 1YHQA 1B70B 2L15A 3E9IA 1YI2A 1YITA 4A3MH 2QGQA 3KOJA 3MEFA 1DGSA 3T1YQ 4DNIA 1XMQL 2CFMA 2YYZA 3I4NH 3HOUG 4POGA 1VQAA 4GN5A 1XNQQ 1L1OC 1QVGA 1PV4A 4BA1I 1VQ4A 2R6GA 1HZ9A 4JG2A 1OXVA 4L5TA 3KF6B 1VQLA 4UY8C 4JBWA 4LF8L 1UE6A 4AIMA 1QZGA 2C35B 3CC4A 2IHFA 2ALYB 2R7DA 4LFCL 4DUYQ 3UDIA 4IPDA 5BR8L 3GTLH 4LF9Q 3RN2A 4FDBA 3CCQA 2LXKA 1PA6A 2UXCL 1HNWQ 2XGTA 1XNRQ 5LMUQ 2IX1A 4UP8A 1Q1EA 5M3FH 1X3FA 4R4TA 4Y52H 3NEMA 4GLVB 4DK6C 1S72A 5LMNW 2E2HH 5E7NA 5ELNA 1VQ5A 3TRZA 1D7QA 3FKIG 3JAMc 2PQAA 2V1CC 2Q2UA 2WB1E 2K5HA 3HOYG 5LMNL 4BBSG 4DV7Q 1IXRA 1X56A 4A3FH 4JI7L 3KJPA 3G71A 3M3YH 1X3GA 1WI5A 3I2ZA 4BA2I 2NZOA 3W5OA 1N32L 1I3QH 1M90C 4A3LG 3OYYA 4QGUA 2IY5B 3S15H 1AE2A 1N34L 2KCTA 5IYCG 2CWAA 4A93G 1QVFA 2CQOA 3GTPH 3HOUH 2LXJA 4JI2L 1XPUA 4B3MQ 1O7IA 2YV5A 4C2MH 1HNXL 2UU9L 4K0KL 4DPGA 1K0RA 2UUBQ 1OXTA 1EUJA 4GN3B 4PMWA 1Q46A 2JA8H 4KHZA 5EAYA 3G48A 1YHBA 4R4OA 4DR4Q 2UXBL 3M4QA 4YWMA 1WYDA 4QY7A 3TEHB 5M5YH 3H15A 3F2BA 1G6PA 4DV4L 1KC8C 4JI8Q 2CKZB 2K5VA 1N36L 4X65Q 4YHHQ 4DR1Q 4OX9Q 1LYLA 4DUZL 4B3TL 2K5NA 2VW9A 2Z6KA 3ULJA 4IOCA 1OXXK 3HOYH 4MTNA 5GAEC 3UE0A 2ZTCA 5GAHC 1Q12A 4LNQA 2N8NA 1HZAA 3GTQH 2OTJA 3J80i 4OWXB 3F2DA 3H3VH 3BJUA 3PUVA 4A3LH 4JI5Q 1XMQQ 1IBKL 4WJ4A 4C3HH 3PUYA 2EQSA 4GKKL 2ZM6L 4C3IH 2ZJRA 3S1RH 2MQHA 4L5QA 3H3VI 3I4MH 3KF8B 2VNUD 4DV6L 3TS2A 4LF8Q 3BZCA 4UPAA 2VUMG 4KHPL 3CPWA 2RF4A 2JJQA 2OCEA 3HKZE 3AEVA 4LFCQ 4GNXA 5BR8Q 2GVBA 4UP9A 1XTDA 1Y1VG 2NVXH 2AKWB 1YJNA 3PV0A 1R9TH 4DR7L 1NTGA 3EIVA 1E1TA 1LUZA 3AFQA 3SGIA 4A3MG 4HJAA 5FJ8H 1EFWA 4HJ9A 1SR3A 2N3SA 2UXDL 1I94L 2CWPA 3CCJA 4NPSA 2Q2HA 3I4NG 1T9HA 1PH5A 3KFUA 3S1MH 2PQAB 4GLXA 3LGJA 4HJ8A 4R4IA 5LMNQ 3BU2A 2A1AA 4XIGS 5K36G 1X65A 4KLKA 1WJJA 2PNHA 4POFA 1IBML 2CCZA 4JI7Q 5C4XG 1J6QA 4C3JH 2K4KA 2BA0A 4EX5A 3HKSA 2R92H 3A5UA 4B3RQ 4A4IA 1YJWA 1CSPA 1QUQA 4JOIC 3KDFA 4MZ9A 4NXNL 4AQYL 1Y1WH 1N34Q 5GROA 1YJ9A 2I5HA 3G6EA 5M3FG 2NVTH 2JEAI 1V1QA 4JBJA 4JI2Q 1PH2A 2NN6G 4DR6L 1C9OA 2UU9Q 1HNXQ 4K0KQ 2KHIA 5M3MH 2K14A 2D0OA 2I5LX 1TWAH 4LF7L 1KXLA 4X64L 3J80c 5ELOA 3T1HL 1EQRA 4LWCA 2QEXA 3H0GG 4A3FG 4P73A 4A3IG 1M1KC 1K8GA 1Y1VH 3DM3A 4DAYB 1W2BA 1YEZA 2IX0A 2PI2A 3K81C 2MNAA 3CF5A 3TS0A 4GKJL 4DV4Q 1YNXA 1EQQA 1P16A 5IT9c 4WJ3M 3DLLA 1AH9A 4HIMA 1GVPA 3K7UC 4DUZQ 4B3TQ 1A63A 4PG3A 1B7YB 3TQYA 4BXXH 1W3SA 2ZTDA 3CCSA 2LSSA 3CCLA 4A3CG 1OXUA 5J3BA 5C4XH 1GKHA 2KENA 3S17H 1I5FA 4DR5L 1UE5A 2JA8G 1WCMH 1OXSC 1KRTA 1PVOA 2OQ0A 3PF4A 1IBKQ 2Y0SE 2XTIA 1FVIA 4IPGA 4LFBL 1VQNA 4GN4B 1QZHA 4GKKQ 1X55A 4B3SL 2ZM6Q 3RN5A 3AQQA 5C4JH 1Y14B 3M7NA 2Q2TA 3EBEA 3UDFA 3M85A 4DV6Q 1HNZL 1JMCA 2JA7H 4KHPQ 1VQJA 3F8TA 3S2HH 2FXQA 1JJCB 4JI1L 3K7AH 2NVQH 2OTLA 4JI4Q 4JI6Q 3UDXA 5IP7G 4GNXB 3ZJYC 1KD1C 3I56A 1EIYB 4IPCA 2NN6I 5HGQA 4DR7Q 1K73C 3H0GH 4DR2L 3S14H 4A3IH 5IYDH 1U0LA 5IWAL 4IPHA 5H1SE 2VQFL 2GN5A 4A3EH 4L5SA 1IL2A 1KIXA 4QL5A 2VZAA 1GO3E 2KCMA 1I94Q 3L0OA 3PO3G 3GO5A 2K75A 3STBC 3I4MG 1N33L 3OTOL 1RIPA 4HIOA 4TVAB 1IBMQ 2MO1A 1VQFA 4LFAL 4A3CH 2YTYA 3S1NH 4KI0A 3J7A5 1VQEA 4EQ5A 4NXNQ 2JA6H 1NMFA 2HHHL 1I6HH 4AQYQ 3KDFB 3RR5A 1YHAA 2AHOB 4OONA 5FJ8G 4R4CA 4PZ6A 3PIOA 3GTMH 4DR6Q 4X6AH 4HJ7A 1K8AC 2BH8A 1L0WA 1BBWA 3VDYA 4LF7Q 4X64Q 3CXCA 3D31A 1UE1A 4H02A 4RMFA 3T1HQ 1UWVA 2AMCB 1JJ2A 4PZ8A 4NXMQ 2B63H 5IP7H 3TREA 2Z6KC 4YWLA 4GOPA 2N49A 3CPFA 4LW1A 1SFOH 3L2PA 3CCMA 1U5KA 1PHJA 1FJGL 2R92G 3ICEA 2R7ZH 2AWOA 2A19A 2UUCL 2E5LL 1Y1WG 3W1BA 1YIJA 1VQCA 5DLQE 3D0FA 3PO2G 1C0AA 4A3BH 3ER0A 2GVAA 3ULLA 1VQPA 3I7FA 2PMZE 3AYHB 3PUWA 3HOXH 4DR3L 1VQ8A 1KRSA 5M3MG 1NMGA 2WFWA 3STBD 3J7ZC 1PYSB 3T1YL 4QQBX 3I55A 1PFSA 1VQHA 2DGYA 3E0EA 1P8LA 5HY6A 1XNQL 4GNXC 3J81j 4AYBG 3UE1A 3M4OH 3KF6A 1EWIA 4LFBQ 2UXCQ 1VQDA 4B3SQ 2F4VL 1E24A 2RHQB 1KQSA 1H95A 4P72A 2Z0SA 1PH9A 2BA1A 1CKMA 1LTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7F A;  3CCV A;  3KJO A;  4JI1 Q;  2I0Q A;  1C7Y A;  4PZ7 A;  1HNW L;  1HZC A;  4BXX G;  2MFI A;  3OW2 A;  1VQM A;  1YZ6 A;  1HR0 W;  3MXN B;  3IRB A;  2ATW A;  2ZTE A;  4DR2 Q;  1JJG A;  1BKB A;  3S16 H;  2VQF Q;  2JQO A;  5GQO A;  1VQB A;  3CC7 A;  1WCM G;  2YTX A;  3GTJ H;  1N32 Q;  4GS3 A;  1HR0 L;  5IY0 A;  5M5X H;  5GAD C;  3U58 A;  4YCU A;  5C3E H;  4P74 A;  4JV5 L;  3F1Z A;  5FLX c;  5JJL A;  3CCE A;  3K80 C;  5IYB G;  1A0I A;  2UXB Q;  3AFP A;  1N33 Q;  3PO2 H;  5FLM H;  2VQE L;  1S3O A;  1VQ9 A;  2JA7 G;  4LFA Q;  2I5M X;  2F52 A;  2WAQ G;  3BZK A;  2JA9 A;  2OWO A;  1NJI C;  1Q1B A;  1NE3 A;  4JBM A;  2ZJP A;  2HHH Q;  1BBU A;  4LUO A;  1TXY A;  3HFZ B;  5C0X G;  1QVC A;  5IYD G;  4B3M L;  3M9B A;  1LM0 A;  1YBY A;  3Q8D A;  4RG1 A;  4A3E G;  1Q86 C;  3GD7 A;  1J5E L;  2ZJQ A;  4A75 A;  4QIW E;  1MJC A;  3CCR A;  4LF5 L;  3A5Z B;  3WWV A;  1PH1 A;  1N36 Q;  4JYA L;  1CKN A;  4DV1 L;  1PH7 A;  3CAM A;  1AE3 A;  1E1O A;  3U4Z A;  1Z47 A;  2BH2 A;  3HOV G;  4DR4 L;  1UE7 A;  2JA5 H;  4BBR H;  2B29 A;  3KYH C;  4P75 A;  1K9M C;  5C0X J;  1XMO L;  3L7Z C;  3B6Y A;  3KLW A;  1N9W A;  2DUD A;  3NEL A;  3CME A;  4DV5 L;  3PIP A;  4HJ5 A;  3EN2 A;  2E5L Q;  2UUC Q;  2JA6 G;  1SLJ A;  1Q82 C;  2N78 A;  4YCW A;  3J81 i;  1HH2 P;  2EIF A;  4IFD G;  4YY3 L;  2ES2 A;  2VL6 A;  3CW2 C;  1A8V A;  4LUZ A;  5IYB H;  3PSI A;  4R4Q A;  4DR3 Q;  3G4S A;  4JI0 L;  2UUA L;  3CMA A;  4TQU S;  4O2D A;  1VQG A;  4NB3 A;  1Q7Y C;  1IBL L;  4JI5 L;  1CKO A;  1VQI A;  4APV A;  4DV3 L;  2B63 G;  4X66 L;  2WB1 G;  2K50 A;  1XJV A;  1L1O A;  1S40 A;  1SMX A;  4LF6 L;  2AWN A;  4IFD J;  2YTV A;  1PH4 A;  4JI3 L;  4YCV A;  5JEA G;  2YU9 H;  3FP9 A;  1N8R C;  3PO3 H;  2F4V Q;  2UXD Q;  2OQK A;  3ULP A;  3NEN A;  4A3K H;  4DAM A;  1B8A A;  4AH6 A;  2HT1 A;  3CCU A;  1E3P A;  3GTG H;  3PGZ A;  4IO9 A;  4OWW B;  5C0X I;  1X54 A;  2HQL A;  4A3B G;  3A0J A;  1VCI A;  3GDE A;  5JJK A;  5JJI A;  3HOV H;  2ID0 A;  2R93 G;  3HOX G;  1K3R A;  4DV0 L;  5IP9 G;  1MKH A;  5JEA J;  4ALP A;  1BVS A;  1KL9 A;  1PYB A;  1HJP A;  3M4P A;  3RZO H;  1HR0 Q;  4JV5 Q;  1V9P A;  1QUQ B;  1ASY A;  1D8L A;  2E2I H;  2ASB A;  5GAG C;  2JK8 A;  1TWH H;  1EYG A;  3HOZ G;  4A3G G;  4IOA A;  2VQE Q;  2F3I A;  2MO0 A;  4B3R L;  1E7Z A;  1SE8 A;  4IFD I;  2RCN A;  3S24 A;  1NBW A;  1VS0 A;  2E8G A;  4BY7 G;  1PH6 A;  1X9N A;  4DV2 L;  1SRO A;  3J81 c;  4O0A A;  5C44 G;  1GD7 A;  3RLF A;  3NBH B;  3RLO A;  3E9H A;  2B3G A;  4GOP C;  4A3D G;  1TWC H;  1J5E Q;  4LF4 L;  4GKJ Q;  5AJ3 L;  3U4V A;  4LF5 Q;  3F2C A;  5C3E G;  5M5W H;  4HID A;  1YVC A;  4JYA Q;  4DV1 Q;  4X62 L;  4P71 A;  1CKN B;  4A76 A;  1NY4 A;  4J15 A;  4MNO A;  1G29 1;  5FLM G;  4L5R C;  1EOV A;  4LUV A;  1VQO A;  1KAW A;  1HZB A;  1XMO Q;  2R93 H;  1SN8 A;  5IP9 H;  1SRU A;  1FL0 A;  1MIU A;  4BY1 G;  4DK3 C;  2NZH A;  2D0P A;  1Q8K A;  2JE6 I;  2Q2I A;  1L2F A;  3FKI H;  3HKZ G;  4DV5 Q;  4DR5 Q;  1MJE A;  1JB7 A;  3HOW G;  1E22 A;  2PI2 E;  4Y7N H;  4A3J G;  2R7Z G;  3S2D H;  4YY3 Q;  3FHW A;  3PF5 A;  4BBS H;  1EIF A;  4OWT B;  1XPO A;  1TWG H;  3UDG A;  3HOZ H;  4JI0 Q;  2UUA Q;  3S1Q H;  1HNZ Q;  1X6O A;  1IBL Q;  4DUY L;  4IJL A;  2K52 A;  4LF9 L;  4OXP A;  4DV3 Q;  4X66 Q;  2HIX A;  4BBR G;  1OTC A;  2JA5 G;  5LMU L;  1FGU A;  4XTC S;  1XNR L;  1L1O B;  5IYC H;  1XPR A;  4BY7 H;  4OO1 G;  4LF6 Q;  4A93 H;  4JI3 Q;  3CC2 A;  5IE8 A;  2NVY H;  4JBK A;  5C44 H;  5IWA Q;  1V43 A;  3ERS X;  2KHJ A;  3CQZ H;  4A3D H;  3W1G A;  1CUK A;  4YWK A;  1I50 H;  4JI6 L;  4JI4 L;  3RZD H;  4IJH A;  1G51 A;  1GM5 A;  2IT1 A;  1VQ6 A;  1KHI A;  4AYB E;  4DV7 L;  1PH3 A;  4UP7 A;  1RL2 A;  2QA4 A;  1WFQ A;  3OTO Q;  1A62 A;  1JE5 A;  2JEB I;  2VY3 A;  4DV0 Q;  1TWF H;  2VS1 A;  4R1J A;  1K83 H;  4HIK A;  1VQK A;  1IYJ B;  1WOC A;  2D62 A;  2KBN A;  2E2J H;  2RHS B;  3A74 A;  2HIV A;  4BY1 H;  3CP0 A;  3I4O A;  3GTO H;  3HOW H;  4A3G H;  2EXD A;  1IZ6 A;  1ASZ A;  3JC6 6;  3PCO B;  4DKA C;  4A3J H;  3RNU A;  1X3E A;  3GTK H;  3PUZ A;  4A3K G;  3JAM i;  2UUB L;  3U50 C;  2A8V A;  4JOI A;  1Q81 C;  3PUX A;  4JCV E;  3RLN A;  1PH8 A;  1UEB A;  3K0X A;  4ME3 A;  4QJF A;  4DV2 Q;  3CD6 A;  2H5X A;  2IHE A;  1CSQ A;  4GOP B;  4JI8 L;  1Z9F A;  1FJG Q;  4LF4 Q;  4JC0 A;  1JT8 A;  2WP8 J;  4X65 L;  2WAQ E;  4YHH L;  5AJ3 Q;  4DR1 L;  4OX9 L;  2VUM H;  4GLA C;  3K8A A;  4NXM L;  4OO1 I;  4X62 Q;  2Y0S G;  1VQ7 A;  1YHQ A;  1B70 B;  2L15 A;  3E9I A;  1YI2 A;  1YIT A;  4A3M H;  2QGQ A;  3KOJ A;  3MEF A;  1DGS A;  3T1Y Q;  4DNI A;  1XMQ L;  2CFM A;  2YYZ A;  3I4N H;  3HOU G;  4POG A;  1VQA A;  4GN5 A;  1XNQ Q;  1L1O C;  1QVG A;  1PV4 A;  4BA1 I;  1VQ4 A;  2R6G A;  1HZ9 A;  4JG2 A;  1OXV A;  4L5T A;  3KF6 B;  1VQL A;  4UY8 C;  4JBW A;  4LF8 L;  1UE6 A;  4AIM A;  1QZG A;  2C35 B;  3CC4 A;  2IHF A;  2ALY B;  2R7D A;  4LFC L;  4DUY Q;  3UDI A;  4IPD A;  5BR8 L;  3GTL H;  4LF9 Q;  3RN2 A;  4FDB A;  3CCQ A;  2LXK A;  1PA6 A;  2UXC L;  1HNW Q;  2XGT A;  1XNR Q;  5LMU Q;  2IX1 A;  4UP8 A;  1Q1E A;  5M3F H;  1X3F A;  4R4T A;  4Y52 H;  3NEM A;  4GLV B;  4DK6 C;  1S72 A;  5LMN W;  2E2H H;  5E7N A;  5ELN A;  1VQ5 A;  3TRZ A;  1D7Q A;  3FKI G;  3JAM c;  2PQA A;  2V1C C;  2Q2U A;  2WB1 E;  2K5H A;  3HOY G;  5LMN L;  4BBS G;  4DV7 Q;  1IXR A;  1X56 A;  4A3F H;  4JI7 L;  3KJP A;  3G71 A;  3M3Y H;  1X3G A;  1WI5 A;  3I2Z A;  4BA2 I;  2NZO A;  3W5O A;  1N32 L;  1I3Q H;  1M90 C;  4A3L G;  3OYY A;  4QGU A;  2IY5 B;  3S15 H;  1AE2 A;  1N34 L;  2KCT A;  5IYC G;  2CWA A;  4A93 G;  1QVF A;  2CQO A;  3GTP H;  3HOU H;  2LXJ A;  4JI2 L;  1XPU A;  4B3M Q;  1O7I A;  2YV5 A;  4C2M H;  1HNX L;  2UU9 L;  4K0K L;  4DPG A;  1K0R A;  2UUB Q;  1OXT A;  1EUJ A;  4GN3 B;  4PMW A;  1Q46 A;  2JA8 H;  4KHZ A;  5EAY A;  3G48 A;  1YHB A;  4R4O A;  4DR4 Q;  2UXB L;  3M4Q A;  4YWM A;  1WYD A;  4QY7 A;  3TEH B;  5M5Y H;  3H15 A;  3F2B A;  1G6P A;  4DV4 L;  1KC8 C;  4JI8 Q;  2CKZ B;  2K5V A;  1N36 L;  4X65 Q;  4YHH Q;  4DR1 Q;  4OX9 Q;  1LYL A;  4DUZ L;  4B3T L;  2K5N A;  2VW9 A;  2Z6K A;  3ULJ A;  4IOC A;  1OXX K;  3HOY H;  4MTN A;  5GAE C;  3UE0 A;  2ZTC A;  5GAH C;  1Q12 A;  4LNQ A;  2N8N A;  1HZA A;  3GTQ H;  2OTJ A;  3J80 i;  4OWX B;  3F2D A;  3H3V H;  3BJU A;  3PUV A;  4A3L H;  4JI5 Q;  1XMQ Q;  1IBK L;  4WJ4 A;  4C3H H;  3PUY A;  2EQS A;  4GKK L;  2ZM6 L;  4C3I H;  2ZJR A;  3S1R H;  2MQH A;  4L5Q A;  3H3V I;  3I4M H;  3KF8 B;  2VNU D;  4DV6 L;  3TS2 A;  4LF8 Q;  3BZC A;  4UPA A;  2VUM G;  4KHP L;  3CPW A;  2RF4 A;  2JJQ A;  2OCE A;  3HKZ E;  3AEV A;  4LFC Q;  4GNX A;  5BR8 Q;  2GVB A;  4UP9 A;  1XTD A;  1Y1V G;  2NVX H;  2AKW B;  1YJN A;  3PV0 A;  1R9T H;  4DR7 L;  1NTG A;  3EIV A;  1E1T A;  1LUZ A;  3AFQ A;  3SGI A;  4A3M G;  4HJA A;  5FJ8 H;  1EFW A;  4HJ9 A;  1SR3 A;  2N3S A;  2UXD L;  1I94 L;  2CWP A;  3CCJ A;  4NPS A;  2Q2H A;  3I4N G;  1T9H A;  1PH5 A;  3KFU A;  3S1M H;  2PQA B;  4GLX A;  3LGJ A;  4HJ8 A;  4R4I A;  5LMN Q;  3BU2 A;  2A1A A;  4XIG S;  5K36 G;  1X65 A;  4KLK A;  1WJJ A;  2PNH A;  4POF A;  1IBM L;  2CCZ A;  4JI7 Q;  5C4X G;  1J6Q A;  4C3J H;  2K4K A;  2BA0 A;  4EX5 A;  3HKS A;  2R92 H;  3A5U A;  4B3R Q;  4A4I A;  1YJW A;  1CSP A;  1QUQ A;  4JOI C;  3KDF A;  4MZ9 A;  4NXN L;  4AQY L;  1Y1W H;  1N34 Q;  5GRO A;  1YJ9 A;  2I5H A;  3G6E A;  5M3F G;  2NVT H;  2JEA I;  1V1Q A;  4JBJ A;  4JI2 Q;  1PH2 A;  2NN6 G;  4DR6 L;  1C9O A;  2UU9 Q;  1HNX Q;  4K0K Q;  2KHI A;  5M3M H;  2K14 A;  2D0O A;  2I5L X;  1TWA H;  4LF7 L;  1KXL A;  4X64 L;  3J80 c;  5ELO A;  3T1H L;  1EQR A;  4LWC A;  2QEX A;  3H0G G;  4A3F G;  4P73 A;  4A3I G;  1M1K C;  1K8G A;  1Y1V H;  3DM3 A;  4DAY B;  1W2B A;  1YEZ A;  2IX0 A;  2PI2 A;  3K81 C;  2MNA A;  3CF5 A;  3TS0 A;  4GKJ L;  4DV4 Q;  1YNX A;  1EQQ A;  1P16 A;  5IT9 c;  4WJ3 M;  3DLL A;  1AH9 A;  4HIM A;  1GVP A;  3K7U C;  4DUZ Q;  4B3T Q;  1A63 A;  4PG3 A;  1B7Y B;  3TQY A;  4BXX H;  1W3S A;  2ZTD A;  3CCS A;  2LSS A;  3CCL A;  4A3C G;  1OXU A;  5J3B A;  5C4X H;  1GKH A;  2KEN A;  3S17 H;  1I5F A;  4DR5 L;  1UE5 A;  2JA8 G;  1WCM H;  1OXS C;  1KRT A;  1PVO A;  2OQ0 A;  3PF4 A;  1IBK Q;  2Y0S E;  2XTI A;  1FVI A;  4IPG A;  4LFB L;  1VQN A;  4GN4 B;  1QZH A;  4GKK Q;  1X55 A;  4B3S L;  2ZM6 Q;  3RN5 A;  3AQQ A;  5C4J H;  1Y14 B;  3M7N A;  2Q2T A;  3EBE A;  3UDF A;  3M85 A;  4DV6 Q;  1HNZ L;  1JMC A;  2JA7 H;  4KHP Q;  1VQJ A;  3F8T A;  3S2H H;  2FXQ A;  1JJC B;  4JI1 L;  3K7A H;  2NVQ H;  2OTL A;  4JI4 Q;  4JI6 Q;  3UDX A;  5IP7 G;  4GNX B;  3ZJY C;  1KD1 C;  3I56 A;  1EIY B;  4IPC A;  2NN6 I;  5HGQ A;  4DR7 Q;  1K73 C;  3H0G H;  4DR2 L;  3S14 H;  4A3I H;  5IYD H;  1U0L A;  5IWA L;  4IPH A;  5H1S E;  2VQF L;  2GN5 A;  4A3E H;  4L5S A;  1IL2 A;  1KIX A;  4QL5 A;  2VZA A;  1GO3 E;  2KCM A;  1I94 Q;  3L0O A;  3PO3 G;  3GO5 A;  2K75 A;  3STB C;  3I4M G;  1N33 L;  3OTO L;  1RIP A;  4HIO A;  4TVA B;  1IBM Q;  2MO1 A;  1VQF A;  4LFA L;  4A3C H;  2YTY A;  3S1N H;  4KI0 A;  3J7A 5;  1VQE A;  4EQ5 A;  4NXN Q;  2JA6 H;  1NMF A;  2HHH L;  1I6H H;  4AQY Q;  3KDF B;  3RR5 A;  1YHA A;  2AHO B;  4OON A;  5FJ8 G;  4R4C A;  4PZ6 A;  3PIO A;  3GTM H;  4DR6 Q;  4X6A H;  4HJ7 A;  1K8A C;  2BH8 A;  1L0W A;  1BBW A;  3VDY A;  4LF7 Q;  4X64 Q;  3CXC A;  3D31 A;  1UE1 A;  4H02 A;  4RMF A;  3T1H Q;  1UWV A;  2AMC B;  1JJ2 A;  4PZ8 A;  4NXM Q;  2B63 H;  5IP7 H;  3TRE A;  2Z6K C;  4YWL A;  4GOP A;  2N49 A;  3CPF A;  4LW1 A;  1SFO H;  3L2P A;  3CCM A;  1U5K A;  1PHJ A;  1FJG L;  2R92 G;  3ICE A;  2R7Z H;  2AWO A;  2A19 A;  2UUC L;  2E5L L;  1Y1W G;  3W1B A;  1YIJ A;  1VQC A;  5DLQ E;  3D0F A;  3PO2 G;  1C0A A;  4A3B H;  3ER0 A;  2GVA A;  3ULL A;  1VQP A;  3I7F A;  2PMZ E;  3AYH B;  3PUW A;  3HOX H;  4DR3 L;  1VQ8 A;  1KRS A;  5M3M G;  1NMG A;  2WFW A;  3STB D;  3J7Z C;  1PYS B;  3T1Y L;  4QQB X;  3I55 A;  1PFS A;  1VQH A;  2DGY A;  3E0E A;  1P8L A;  5HY6 A;  1XNQ L;  4GNX C;  3J81 j;  4AYB G;  3UE1 A;  3M4O H;  3KF6 A;  1EWI A;  4LFB Q;  2UXC Q;  1VQD A;  4B3S Q;  2F4V L;  1E24 A;  2RHQ B;  1KQS A;  1H95 A;  4P72 A;  2Z0S A;  1PH9 A;  2BA1 A;  1CKM A;  1LTL A; 
#chains in the Genus database with same CATH topology
 2I0Q A;  3KJO A;  4JI1 Q;  5D65 A;  3TME A;  3OW2 A;  4IUU A;  3MXN B;  1JJG A;  1BKB A;  3P75 A;  3UI2 A;  3CC7 A;  4JV5 L;  3F1Z A;  3W3A A;  2RSN A;  3A8I E;  3AFP A;  3PO2 H;  2VQE L;  1C4Q A;  1S3O A;  1ILQ A;  1PMR A;  3NTK A;  2O5J C;  2JA7 G;  1EY0 A;  2C9O A;  2EY1 A;  1H9R A;  4N9T A;  4FO2 A;  1Q1B A;  3K7A B;  5C0X G;  2WAQ B;  5IYD G;  3PO3 G;  2ZJQ A;  3GD7 A;  1KNE A;  1J5E L;  2CW0 D;  3A5Z B;  3TSS A;  1AE3 A;  2B2U A;  1UE7 A;  3IKJ A;  1TKW B;  3A8K E;  1AZQ A;  4OO1 H;  2F0G A;  2E75 C;  5C0X J;  3WOE A;  1O7Y A;  3KLW A;  5EJW A;  2L55 A;  2E5L Q;  2Z1C A;  3EN2 A;  3TZU A;  1Q82 C;  4YCW A;  2EIF A;  4IFD G;  1HTP A;  3CW2 C;  3OSO A;  2ES2 A;  1A8V A;  4LAA A;  4LUZ A;  5IYB H;  2JA6 B;  3G4S A;  3DEO A;  4TQU S;  1VQG A;  1EY6 A;  3GTM B;  4APV A;  4Q0F A;  4IUP A;  1XJV A;  1S40 A;  3TP8 A;  2RDH A;  1SMX A;  4LF6 L;  2AWN A;  3KF8 A;  4IFD J;  1F9R A;  1MI2 A;  1B3A A;  1PH4 A;  5EPL A;  1LTT D;  1N8R C;  4X3K A;  5IGB A;  1GJX A;  4AH6 A;  2HT1 A;  3CCU A;  1E3P A;  3GTG H;  4OWW B;  2R7Z B;  1O7Z A;  4DN4 M;  3A0J A;  1VCI A;  3GDE A;  3HOV H;  1Y8O B;  2R93 G;  1K3R A;  4XQJ A;  1Y8P B;  4ME5 A;  4WJW A;  3X3N A;  1PYB A;  3SK8 A;  3OPO A;  3DWQ A;  3MFG A;  3FMC A;  1QUQ B;  2I46 A;  2E2I H;  5GAG C;  1TWH H;  1EYG A;  5CV8 A;  3M4O B;  4B3R L;  4NW2 A;  1E7Z A;  3KBX A;  1ILP A;  4BY7 G;  1NBW A;  1PH6 A;  1X9N A;  4O42 A;  1F9Q A;  1LTG D;  3RLO A;  3E9H A;  4A3D G;  1TWC H;  4LF4 L;  1G2T A;  3F2C A;  2A69 C;  2F0M A;  1EZ8 A;  4ZAI A;  3BVZ A;  4X62 L;  1CKN B;  5C5M A;  4A76 A;  1NY4 A;  4DAY A;  4MNO A;  5M5X B;  1G29 1;  2B2V C;  5FLM G;  4LUV A;  1HZB A;  2JN4 A;  1EQV A;  1K8O A;  5IP9 H;  2F0H A;  2D0P A;  1L2F A;  3DEP A;  1R4P B;  3K5M A;  2K33 A;  1TWA B;  4YY3 Q;  3PF5 A;  4OWT B;  3DUZ A;  4ZLT F;  3HOZ H;  4JI0 Q;  2UUA Q;  1HNZ Q;  2EYJ A;  2MPM A;  4IJL A;  5JVH 3;  2BCO A;  4DV3 Q;  4X66 Q;  2NTT A;  5IYC H;  4DXG A;  1BCP F;  1PZI D;  2EDG A;  2VB3 X;  1CM9 A;  4JBK A;  2F0V A;  2JA5 B;  1S5B D;  1V43 A;  3ERS X;  4KKT A;  4JI6 L;  4JI4 L;  1G51 A;  1VF5 C;  1KHI A;  3E0J A;  3M4Y A;  1PH3 A;  3MWY W;  3MZ5 A;  1SYG A;  1BNZ A;  2E2J H;  4R8I A;  3CP0 A;  3HGB A;  3I4O A;  1BF4 A;  3GTO H;  4A3G H;  1SSO A;  3BZD B;  1HQM C;  1DOK A;  4DKA C;  3ND9 A;  2EYL A;  2ZT9 C;  3RNU A;  1GUO A;  3TZD A;  1DXM A;  1ICF B;  1TS2 A;  2A6E D;  3JAM i;  2UUB L;  4JW0 A;  2A8V A;  2YU9 B;  4JCV E;  5EBC A;  2MGS A;  1CSQ A;  4GOP B;  1FJG Q;  3SHL A;  1JT8 A;  4X65 L;  4YHH L;  4OX9 L;  4CDF C;  2QCP X;  4GLA C;  1RKN A;  2MJ8 A;  3K8A A;  4H13 C;  4RKB A;  5EPK A;  1VQ7 A;  3RZO B;  4BWG B;  1B70 B;  2L15 A;  1QJO A;  1JWM D;  5EQ0 A;  1BOS A;  3J80 L;  3E9I A;  1EWC A;  4FF3 A;  2CQA A;  1TU2 B;  2CFM A;  1TQO A;  5IT9 L;  1HZ9 A;  4JG2 A;  1VQL A;  3NTI A;  4RHR A;  2WB1 B;  5CC4 A;  4AIM A;  1LV9 A;  1PTO B;  4MTK A;  4IPD A;  5BR8 L;  4G7Z C;  4LF9 Q;  4HR7 B;  1PA6 A;  1XNR Q;  5M5W B;  5CV5 A;  1X3F A;  3NEM A;  5FLX E;  2WAC A;  2E2H H;  1STB A;  1SNC A;  4KY7 A;  5DM6 3;  2K5H A;  4J8Q A;  3I4L A;  1LAB A;  5LMN L;  4DV7 Q;  3FKI B;  2AUK A;  3JAM L;  1X3G A;  2PW5 A;  4Y7N B;  1AZP A;  3C1F A;  4BA2 I;  1I4Q A;  2PZU A;  5AFW A;  1I3Q H;  4A3L G;  4LJZ C;  3BYT B;  1TWG B;  3OHX C;  4QGU A;  4FNF A;  2KCT A;  1CA6 A;  3GTP H;  2PQE A;  2A74 C;  5FO7 B;  1XPU A;  1STA A;  2YV5 A;  2UU9 L;  2VXW A;  1H9S B;  1ZKO A;  1TS4 A;  1EUJ A;  1Q46 A;  5C44 B;  4K8I A;  1S5D D;  3CQZ B;  1YHB A;  4DR4 Q;  1LTR D;  1SE3 A;  5M5Y H;  1BBX C;  3GP7 A;  1G6P A;  3RUZ A;  1KC8 C;  1AFP A;  1L0Y B;  3K0Y A;  4DR1 Q;  1TWF B;  2PMZ B;  1DZ1 A;  2K5N A;  1F9S A;  2PW7 A;  3N52 A;  1YNJ D;  3ERQ A;  1HTL D;  5C6A A;  5JOB A;  1Z7T A;  2O2L D;  4LNQ A;  4A3J B;  1D5M C;  3H3V H;  3T56 B;  2HUG A;  1CA5 A;  3TP7 A;  2ZM6 L;  4FXD A;  1KAB A;  1QNU A;  2MQH A;  3DMU A;  3KF8 B;  1STE A;  4LF8 Q;  3BZC A;  4UPA A;  4KHP L;  2F3V A;  3EA6 A;  2OCE A;  3HKZ E;  4LFC Q;  2P5Z X;  4X3U A;  1Y1V G;  2AKW B;  4B9W A;  3JAM E;  1NTG A;  2NTS A;  5FO8 B;  4A3M G;  1SR3 A;  2N3S A;  4GZY C;  4TSS A;  4HTH A;  3CCJ A;  1EIG A;  4NPS A;  3KFU A;  1JE4 A;  3S1M H;  2PQA B;  5I9P A;  1DM0 B;  3LGJ A;  3BU2 A;  2EYH A;  4KLK A;  1PRT F;  1WJJ A;  3I4N B;  3U9O A;  4C3J H;  5E4X A;  3A5U A;  3T51 B;  4AQY L;  1N34 Q;  4QIW B;  3FRP B;  1YJ9 A;  2NVT H;  1GOZ A;  1PH2 A;  4DR6 L;  3KLS A;  1SYB A;  2D0O A;  4LF7 L;  1KXL A;  1ENC A;  4ILW A;  2H1E A;  4LWC A;  5IGC A;  3H0G G;  4DFA A;  4A3F G;  1ENF A;  3DM3 A;  4DAY B;  2JSO A;  3K81 C;  1UAP A;  3TS0 A;  4DV4 Q;  5I9O A;  1P16 A;  3M3Y B;  4RCO A;  3DLL A;  1AH9 A;  3VYT A;  1UEA B;  3K7U C;  1A63 A;  1HHV A;  1LAC A;  5COY A;  4IUQ A;  3RD4 A;  4P2C B;  4ZKC B;  4DR5 L;  3HG9 A;  3CRL C;  3MHB A;  1TWC B;  3NHH A;  2Y0S E;  5KYL A;  4IPG A;  1J9O A;  2HQE A;  4B3S L;  1IYU A;  3P7J A;  1NNX A;  3EBE A;  4XXE A;  1VQJ A;  3F8T A;  2FXQ A;  1JJC B;  3K7A H;  5G3L D;  5T1I A;  5C5L A;  2VQF L;  4L5S A;  5H1S E;  1F2L A;  4KY6 A;  1JCK B;  4F7X A;  4IQZ A;  2ZXP A;  4NMZ A;  2KVM A;  1RIP A;  4TVA B;  4A3C H;  4K6D A;  2YTY A;  1VF7 A;  3I4M B;  1RJT A;  1SNM A;  1PFN A;  4EQ5 A;  1DJR D;  4NXN Q;  1NMF A;  2JA6 H;  3RR5 A;  1IW7 D;  1TII D;  2AHO B;  4OON A;  3GTM H;  1ESF A;  1QE6 A;  1QG7 A;  1SMY C;  4K8J A;  1NCV A;  4X64 Q;  3CXC A;  4H02 A;  4ZUI A;  1JJ2 A;  4PZ8 A;  1TS3 A;  2L1B A;  5JEA H;  1PHJ A;  2R92 G;  2R7Z H;  2UUC L;  2LMC B;  1LTS D;  1Q8I A;  5CV7 A;  3D0F A;  3PO2 G;  2Q8I B;  3ULL A;  3HOX H;  1L0X B;  3SEB A;  1KRS A;  2A68 C;  1TVX A;  2F0S A;  1PLF A;  3I55 A;  1PTO F;  3IFT A;  5HY6 A;  1XNQ L;  3NBI A;  3M4O H;  4IN3 A;  3UE1 A;  1EWI A;  1A15 A;  4KD3 A;  1WTQ A;  3BVG A;  4RH6 A;  1DCZ A;  3D3R A;  2F4V L;  1KQS A;  4AYB B;  2BE5 D;  1PH9 A;  1WVL A;  1MSH A;  2KED A;  2R7F A;  1KDC A;  1C7Y A;  4PZ7 A;  4BXX G;  2NZ1 D;  1VQM A;  1YZ6 A;  1SE2 A;  1HR0 W;  3IRB A;  4DR2 Q;  4LMQ D;  3BS1 A;  2K03 A;  3K5L A;  2JQO A;  5GQO A;  1FNW A;  1XXG A;  2DNC A;  2YTX A;  4GS3 A;  5IY0 A;  5M5X H;  5GAD C;  5C4X B;  5FLX c;  2MHV A;  4KN7 C;  5IYB G;  1A0I A;  2B2W C;  1N33 Q;  1U4P A;  4JPB W;  1NSN S;  3OMG A;  2I5M X;  1PZK D;  5C4J B;  2F52 A;  4RKL A;  2JA7 B;  1NUC A;  1NE3 A;  4JBM A;  4EVO A;  4QMG A;  1TXY A;  3M9B A;  2E76 C;  2JXM B;  3K59 A;  4K2K A;  3CCR A;  4H44 C;  3WWV A;  1PH1 A;  1N36 Q;  1F2M A;  4JYA L;  1CKN A;  4DV1 L;  4R9W A;  3CAM A;  3HOV G;  2BH2 A;  2EYM A;  1Z47 A;  3U4Z A;  2JA5 H;  1IKM A;  3L9A X;  1SJE D;  3KYH C;  4LK1 C;  1XMO L;  1CQF A;  1N9W A;  5LHY 1;  5JAV A;  2DUD A;  4H7B A;  4ZUJ A;  3NEL A;  1IW7 C;  4DV5 L;  3A7A B;  3KLS X;  3S1N B;  1DYQ A;  1I6H B;  4DR3 Q;  3TP6 A;  5FKA C;  2B8F A;  2K50 A;  1TT2 A;  5HGT A;  4JI3 L;  2YU9 H;  3FP9 A;  4KJN A;  2LS0 1;  4K5W A;  3ULP A;  3NEN A;  4DAM A;  2HD3 A;  4OEL B;  1G8Z D;  3CKI B;  2L12 A;  3DXJ C;  3PGZ A;  5C0X I;  1I4G A;  2X6G A;  5JPN C;  5IP9 G;  1MKH A;  1BVS A;  1FYC A;  2F0E A;  1I4X A;  1HJP A;  3M4P A;  4L8J A;  3RZO H;  1STH A;  4JV5 Q;  3M7G A;  1D8L A;  1BUV T;  3HOZ G;  2VQE Q;  1KNA A;  2MO0 A;  4M1U B;  1XX8 A;  1KAA A;  3K5O A;  1NR4 A;  1KLG D;  3T4A C;  4IFD I;  1CT1 D;  4FP5 D;  3J81 c;  1LTI D;  1PTO H;  4O0A A;  1GD7 A;  3RLF A;  2KEE A;  1JWU D;  3NE5 B;  1J5E Q;  3FDT A;  4GKJ Q;  5AJ3 L;  2PO4 A;  5C3E G;  3S16 B;  5M5W H;  1ML0 D;  3SR1 A;  4J15 A;  4C1N K;  2NVT B;  1AEX A;  1LT5 D;  4I7A A;  3Q22 A;  1SRU A;  1FL0 A;  4A3G G;  2NZH A;  1Q8K A;  2F0U A;  3FKI H;  3HKZ G;  2GA4 B;  2F0P A;  1JC7 A;  1E22 A;  4Y7N H;  3FHW A;  4OIJ A;  1EIF A;  1STG A;  1TWG H;  5IGE A;  1SND A;  3IFD A;  4RGT A;  4NP5 A;  3E5S A;  4DUY L;  2K52 A;  2HIX A;  4BBR G;  4XTC S;  4QB4 A;  2CH4 W;  4LF6 Q;  3HRZ C;  1HQR D;  3A7L A;  5IE8 A;  1B3Q A;  5C44 H;  3CQZ H;  2SNS A;  1I50 H;  2B2Y C;  4CGY B;  4IJH A;  1GM5 A;  1PZJ D;  1S4Z A;  2A69 D;  1RL2 A;  4UP7 A;  2QA4 A;  4UHV A;  2NUC A;  3OTO Q;  1JE5 A;  3W2D A;  1TWF H;  2XNA C;  4L6T B;  4HIK A;  1IYJ B;  2DY8 A;  2KBN A;  2EJM A;  2M9V A;  1CZG A;  4J1M A;  1SYD A;  3PCO B;  4A3J H;  4DAP A;  1H9S A;  1X3E A;  4A3K G;  5TSS A;  1LO5 D;  4WRD A;  1F77 A;  1YNN C;  1G2S A;  1Q81 C;  3PUX A;  5KYI A;  4PMC A;  1Y69 U;  3CD6 A;  2H5X A;  3SK5 A;  3V96 A;  2KCN A;  2RBM A;  1Z9F A;  4JI8 L;  4LF4 Q;  3AMU A;  2PZW A;  3SDZ A;  1ZYR C;  4NXM L;  2FMC A;  4X62 Q;  2Y0S G;  2F0T A;  1YHQ A;  3I70 A;  4HAE A;  3FPU B;  1YI2 A;  1YIT A;  1RDP D;  4PNY A;  5I2X A;  4G4K A;  1DGS A;  3T1Y Q;  4CJ2 C;  1BDO A;  1XMQ L;  3N6R A;  4DAV A;  2YYZ A;  3I4N H;  5EKI A;  1VQA A;  4GN5 A;  4POG A;  1L1O C;  4DK1 A;  1QVG A;  2R6G A;  5K36 H;  1UE6 A;  1QZG A;  3C2P A;  2A6H C;  3CC4 A;  2ENB A;  2ALY B;  4Z9C B;  2R7D A;  3UDI A;  1GHJ A;  4FDB A;  3RN2 A;  1HNW Q;  2XGT A;  2IX1 A;  1Q1E A;  2EY6 A;  1GXD C;  4R4T A;  2XVS A;  4DK6 C;  4MIU A;  5ELN A;  2B2T C;  1PFB A;  2PQA A;  3HOX B;  5C4H A;  2WB1 E;  2Q2U A;  2AQ2 B;  4BBS G;  1IXR A;  4JI7 L;  3KJP A;  3M3Y H;  3S2D B;  3ITP A;  1M90 C;  1A2T A;  3I73 A;  5DM7 3;  2F0W A;  4A93 G;  1GUW A;  2CQO A;  3VR5 A;  4B3M Q;  3QG1 A;  1HNX L;  4K0K L;  2UUB Q;  1EZ6 A;  3MXP A;  4GN3 B;  2NVY B;  2JA8 H;  2WKC A;  4KHZ A;  5EGT A;  2F0I A;  3D4W A;  3RZD B;  1DON A;  4YWM A;  1FNV A;  1WYD A;  3NQT A;  1STY A;  4QY7 A;  3TEH B;  1CI3 M;  3K5N A;  3R2I A;  2E74 C;  4X65 Q;  4YHH Q;  4OX9 Q;  1LYL A;  4XT1 B;  5D3I B;  3ULJ A;  1OXX K;  4BY1 B;  5GAH C;  3A8J E;  3HOW B;  1HCZ A;  5ELB A;  1Q12 A;  3HS0 C;  5EKK A;  3TP5 A;  1HZA A;  2OTJ A;  3J80 i;  3PUV A;  4JI5 Q;  4WOR A;  4GKK L;  2XIW A;  1U4M A;  1FNU A;  2ZJR A;  1MD2 D;  1WTW A;  3I4M H;  4L5Q A;  1IYV A;  4DV6 L;  2WV6 D;  2VUM G;  3FPP A;  2RF4 A;  2OF1 A;  3AEV A;  3I90 A;  1LT3 D;  5BR8 Q;  3R2T A;  1XTD A;  3PV0 A;  2EYO A;  1E1T A;  4PQX A;  3AFQ A;  4HJ9 A;  4EQO A;  4A3M B;  4IUT A;  3E3X A;  3H3V C;  4HJ8 A;  1E0B A;  5LMN Q;  3GV6 A;  2A1A A;  4XIG S;  4XT3 B;  5NUC A;  3QWN A;  1X65 A;  1SNP A;  2Z8L A;  1IBM L;  1HUN A;  2K4K A;  2BA0 A;  4FF2 A;  2K04 A;  3HKS A;  2HDL A;  3ONA B;  5D14 A;  2DY7 A;  1YJW A;  4JOI C;  2I5H A;  3G6E A;  5M3F G;  3VR2 A;  1V1O A;  1E2W A;  2EVB A;  1IHZ A;  2NN6 G;  1C9O A;  2UU9 Q;  1QOH A;  3D8G A;  2EJG C;  2I5L X;  3MA2 B;  1DOM A;  1WD0 A;  4X3S A;  1PXU A;  2EXZ A;  5L37 A;  1WTH A;  1YEZ A;  2PI2 A;  3C1E A;  3CF5 A;  4WJ3 M;  1D6E C;  4CKB A;  4HIM A;  4EGV A;  1II3 A;  3G7L A;  3TQY A;  1SEB D;  2K28 A;  1GUS A;  4HMJ A;  2XWB B;  3S15 B;  2LSS A;  4A3C G;  2B8G A;  1Q3L A;  3A55 A;  5C4X H;  2WIN B;  3HOU B;  3D6W A;  1GKH A;  2KJX A;  4YIJ A;  5IGF A;  4C2M B;  1KRT A;  1PVO A;  3PF4 A;  1QNK A;  4LFB L;  1VQN A;  1QZH A;  3M7N A;  2ZM6 Q;  3AQQ A;  3QB3 A;  1Y14 B;  4F87 A;  5C4J H;  2FMM A;  2V4D A;  3M85 A;  1HNZ L;  2JA7 H;  4FVM A;  4KHP Q;  3I91 A;  1ET6 A;  1SXT A;  2EY5 A;  1VDZ A;  1V1P A;  2OTL A;  2F0L A;  3ZJY C;  1EY5 A;  3H09 A;  5C0X H;  2FHT A;  5IYD H;  1U0L A;  2R7Z G;  4IPH A;  1IL2 A;  3HOY B;  1KIX A;  3NUC A;  4RGO S;  1FGB D;  4C3H G;  3GTQ B;  4MN3 A;  2EY2 A;  4PMB A;  2K75 A;  3STB C;  4C3I G;  2MO1 A;  2M00 A;  3BYY B;  4LFA L;  3IAY A;  3S1N H;  3S1R B;  3J7A 5;  2HCC A;  1HPC A;  5JJZ A;  1I6H H;  5BN4 A;  2HHH L;  4AQY Q;  1I50 B;  4IFD H;  3EQL C;  5FJ8 G;  3J80 E;  3T53 B;  3Q0A A;  3PIO A;  4DR6 Q;  2NVX B;  1R9T B;  5CV4 A;  4HJ7 A;  1BBW A;  4LF7 Q;  5KNB A;  2LY7 A;  3I72 A;  3D31 A;  4RMF A;  1UWV A;  5IT9 E;  1SAP A;  1M8A A;  5IP7 H;  2Z6K C;  4DF7 A;  1FJG L;  3L2P A;  1U5K A;  1KDA A;  1IKL A;  2AWO A;  3J81 L;  1Y1W G;  3W1B A;  4KN4 C;  4BS9 A;  1TR5 A;  1UNS A;  1YIJ A;  2R92 B;  2B2V A;  4L63 B;  4OGQ C;  1C0A A;  4RAU C;  5KNC A;  3I7F A;  1AP0 A;  3AYH B;  3PUW A;  5M3M G;  3J7Z C;  4OL7 A;  1PYS B;  1CZW A;  4QQB X;  2F03 A;  2K5Q A;  1P8L A;  4GNX C;  2TMP A;  2UXC Q;  1VQD A;  4B3S Q;  1E24 A;  2LKV A;  4R8N A;  2Z0S A;  2L11 A;  2BA1 A;  4ZYS A;  5M9O A;  3A54 A;  3CCV A;  2Q8T A;  1JOQ A;  2MFI A;  3SXH A;  1SMY D;  2ATW A;  2ZTE A;  3S16 H;  3LX0 A;  4JVZ A;  2VQF Q;  2NWG A;  1VQB A;  1A3V A;  1WCM G;  1GUN A;  1N32 Q;  1HR0 L;  1QCB D;  2DJG C;  4P74 A;  3CCE A;  1PRT C;  3K80 C;  1EIH A;  5FLM H;  1RF2 D;  1O7L A;  2K32 A;  1U4L A;  1VQ9 A;  2FIN B;  3BZK A;  2A68 D;  2JA9 A;  5KRU A;  1RCV D;  1MHW C;  3SVM A;  4LUO A;  2NVQ B;  2UXB Q;  1QVC A;  1Q86 C;  1LM0 A;  3Q8D A;  4A3E G;  2RSO A;  1SE4 A;  4A75 A;  1MJC A;  4LF5 L;  2L9H A;  3O13 A;  3S14 B;  4A3I B;  1PH7 A;  1D5Z C;  4DR4 L;  2G9D A;  2DN8 A;  4ODG A;  3MAQ A;  1K9M C;  3MXU A;  4OHJ A;  3L7Z C;  2KUM A;  1SDF A;  1A3T A;  1QIL A;  3PIP 3;  2UUC Q;  3QIA A;  1SLJ A;  2OXP A;  2VL6 A;  2JA8 B;  1KDB A;  1BXT A;  4K2L A;  5C4Z A;  5A2Q L;  1Q7Y C;  1IBL L;  5BN3 A;  4FXK C;  5ELF A;  1VQI A;  2B63 G;  2WB1 G;  1LT6 D;  4Q5V A;  3MEH A;  2PCF B;  2F4V Q;  2UXD Q;  2OQK A;  2IWH A;  1CK1 A;  1EYA A;  1SFO B;  1X54 A;  2HQL A;  4A3B G;  2PZT A;  2ID0 A;  4DV0 L;  4DU9 A;  5DEH A;  5COR A;  3R93 A;  1EQT A;  3LWE A;  1KL9 A;  1HFG A;  3MC0 B;  3DWA A;  3TDQ A;  1V9P A;  2D2C C;  1EY7 A;  4XDX A;  1ASY A;  2ASB A;  2JK8 A;  5EBD A;  4IOA A;  2F3I A;  1K8M A;  3PIO 3;  1SE8 A;  4RHS A;  2EOT A;  3T13 A;  2RCN A;  1VS0 A;  5KEE A;  4DV2 L;  1EYD A;  3VR4 A;  5C44 G;  1VMC A;  4GOP C;  3U4V A;  2IW3 A;  5KGU A;  4JYA Q;  4DV1 Q;  4P71 A;  2CH4 A;  3GTJ B;  2RDF A;  3X3M A;  5C3E B;  1VQO A;  1KAW A;  1XMO Q;  4E6I A;  1MIU A;  2JE6 I;  2Q2I A;  4DV5 Q;  3G6J B;  3T16 A;  1Z6H A;  3J7A V;  4DA2 A;  4A3J G;  3S2D H;  1HUM A;  3EVQ A;  1XPO A;  1EYC A;  3OOC A;  3EFX D;  2F0Q A;  1PTO C;  4NKL A;  3QJY A;  2CVR A;  2M2L A;  4IUR A;  3BDO A;  3MVV A;  1DOL A;  1BQQ T;  5LMU L;  1V1P B;  4OO1 G;  1L1O B;  4JI3 Q;  2C5C A;  3CC2 A;  4WFN 3;  2NVY H;  3K6O A;  4BBR B;  5IWA Q;  2KHJ A;  2QDL A;  4B08 A;  1CUK A;  1JOK A;  4YWK A;  3QO2 A;  3RZD H;  1VQ6 A;  5C3X A;  2NB0 A;  1A62 A;  3PQI A;  2JEB I;  2QIL A;  1VQK A;  4CJ1 B;  1WOC A;  2D62 A;  2F1M A;  4BY1 H;  3HOW H;  1HRJ A;  2EXD A;  1B9M A;  1IZ6 A;  3CHB D;  3JC6 6;  5E3F A;  1FR3 A;  1B4O A;  1CQV A;  2QDB A;  3V05 A;  1XWE A;  5G3L F;  3PO3 B;  5CBE E;  4A3K B;  2J0T D;  1PH8 A;  1UEB A;  1ONL A;  2B2U C;  3H91 A;  1CHQ D;  5FOB B;  1W6J A;  2G5D A;  2IHE A;  2IJ0 A;  1EY9 A;  1PFM A;  2WP8 J;  1MBY A;  2WAQ E;  5AJ3 Q;  4ZQ3 A;  4IAL A;  2X69 A;  3DHQ A;  4CKE A;  1WTV A;  4A3M H;  2RDG A;  2Z9H A;  3KOJ A;  3MEF A;  2D5D A;  1I4H A;  2E2D C;  4S3S A;  4BA1 I;  1CHP D;  4L5T A;  4UY8 C;  4KV6 A;  1JQY D;  4HN7 A;  2C35 B;  4C1N I;  2IHF A;  4B9X A;  3NQI A;  4DUY Q;  3BG3 A;  4M8A A;  5CV9 A;  1YNN D;  4UP8 A;  4Y52 H;  3NP8 A;  4GLV B;  1AW7 A;  3TRZ A;  1A2U A;  1D7Q A;  4KTA A;  3JAM c;  3BDC A;  2R93 B;  1C8C A;  3Q24 A;  1K3B C;  3OMC A;  1ZYR D;  1X56 A;  3DM1 A;  1D1K A;  4A3F H;  4CHT B;  1R4Q B;  3I2Z A;  5E4W C;  5IOC A;  2NZO A;  3IL8 A;  4BBS B;  3C3L A;  3OYY A;  5LL6 S;  3S15 H;  3S1Q B;  5IYC G;  2CWA A;  2X6L A;  3KBG A;  1QVF A;  3HOU H;  2LXJ A;  4JI2 L;  4K14 A;  4C2M H;  3A56 A;  4BY7 B;  4DPG A;  1K0R A;  4A93 B;  5E1F A;  5LL6 X;  1OXT A;  4PMW A;  3RMH A;  3AU7 A;  2A6H D;  4K5V A;  1SJH D;  5EAY A;  4A3D B;  1SNO A;  2B39 A;  3G48 A;  2BDO A;  3H15 A;  4KMU C;  3KUP A;  4JI8 Q;  1N36 L;  1JWS D;  2KOL A;  4DUZ L;  4B3T L;  1PDQ A;  2F0O A;  2VW9 A;  1K83 B;  4XQN A;  4IOC A;  3HOY H;  2LFN A;  1LTA D;  3MTS A;  4MTN A;  3UE0 A;  2ZTC A;  5GAE C;  2F3W A;  2NYZ D;  1T5E A;  2J7Z A;  3GTQ H;  1KTK A;  1NAP A;  2A73 B;  4OWX B;  3BJU A;  1XMQ Q;  1IBK L;  4WJ4 A;  3PUY A;  2EQS A;  1H9K A;  1QWY A;  3S1R H;  3H3V I;  3SK4 A;  1MSG A;  4V19 0;  3TS2 A;  2VNU D;  2MUY A;  2ICE C;  5JPM C;  5KND A;  1WTR A;  2NVX H;  4F8M A;  1YJN A;  2VUM B;  1R9T H;  4DR7 L;  5IGG A;  2PYK A;  2F0F A;  2KCC A;  3SGI A;  1WTX A;  4HJA A;  4NDX A;  1GUT A;  1EFW A;  3Q23 A;  1I94 L;  4O1N A;  3CU7 A;  1S5E D;  4I7Z C;  3MFY A;  1S5C D;  5J39 A;  2RQX A;  3TN2 A;  4HCS A;  5C4X G;  3NXW A;  4JI7 Q;  2HCI A;  4N8X 1;  2R92 H;  4B3R Q;  4N8F A;  1CSP A;  1H9M A;  4MZ9 A;  5GRO A;  2EPB A;  2B2W A;  2RKS A;  2JEA I;  1V1Q A;  3GTL B;  1HNX Q;  4K0K Q;  5M3F B;  1JIC A;  2K14 A;  1HXY D;  3LNN A;  1CTM A;  3T1H L;  1F9P A;  1XTC D;  4QF4 A;  4P73 A;  1JR0 D;  3NBH A;  1W2B A;  5I4D A;  2IX0 A;  1BCP D;  4GKJ L;  5IGD A;  1EQQ A;  4ZRZ A;  3QOL A;  2EYP A;  5DAU A;  4PG3 A;  5ISR A;  4BXX H;  1W3S A;  3CCL A;  1OXU A;  5CR3 A;  1B44 D;  4UDU C;  4CBV A;  2G9H D;  2H4O A;  5I6W A;  4DXF A;  2WKD A;  2XTI A;  1FVI A;  4GN4 B;  4GKK Q;  1X55 A;  2F0N A;  4K5X A;  1SBB B;  4DV6 Q;  1HA6 A;  4UAI A;  4JI1 L;  2NVQ H;  4JI6 Q;  4JI4 Q;  5IP7 G;  4GNX B;  1EIY B;  3I56 A;  4IPC A;  2NN6 I;  3K57 A;  1K73 C;  3OIQ A;  3S14 H;  1HFN A;  4A3I H;  3OWE B;  4N9P A;  4QL5 A;  2VZA A;  1GO3 E;  1D1I A;  2KCM A;  3L0O A;  4HMI A;  3GO5 A;  2MP1 A;  4U68 A;  1PYW D;  3OTO L;  4KKU A;  4C3H B;  1IBM Q;  3U9S A;  4OEM B;  3NTH A;  5J22 A;  2QKI C;  2CHB D;  4C3I B;  4KI0 A;  3SK6 A;  1SYF A;  2F0K A;  1O80 A;  4V0B A;  1PRT B;  3KDF B;  3BVM A;  3NK9 A;  1YHA A;  3ZYY X;  4HSV A;  1K8A C;  2K6A A;  1LTB D;  1L0W A;  2BOS A;  3WOF A;  4CDD C;  3VDY A;  5CMD A;  4G7O C;  3TRE A;  2N49 A;  3CPF A;  3L3O C;  4C3J G;  1B53 A;  2XSC A;  3SE0 A;  1SFO H;  3CCM A;  2A19 A;  2E5L L;  5DLQ E;  2J4X A;  1XYI A;  3ER0 A;  2AQ3 B;  2GVA A;  1Y1W B;  1VQP A;  2PMZ E;  1VQ8 A;  2WFW A;  1JOO A;  3STB D;  3NPP A;  3T1Y L;  3D4D A;  2K01 A;  1F2Y A;  1PFS A;  1VQH A;  3E0E A;  2XWJ B;  4FF4 A;  2K05 A;  5M3M B;  2I07 B;  5T1G A;  2F0D A;  3KF6 A;  1BCP C;  2CW0 C;  3TBI B;  4LFB Q;  3I3C A;  2AUJ D;  1H95 A;  1Y1V B;  4P72 A;  1CKM A;  1LTL A;  2ZXO A;  1HZC A;  3VYU A;  1HNW L;  2R61 A;  1EWH A;  1RTN A;  3H94 A;  2B2Y A;  3GTJ H;  4DNR B;  3U58 A;  1D5X C;  4YCU A;  5CGK A;  3HP3 A;  5C3E H;  1TY2 A;  1SYE A;  3D4R A;  5JJL A;  3S17 B;  1V8Q A;  1WCM B;  4J6H A;  3NWS A;  4LFA Q;  5FLX L;  4TKO B;  4TRD A;  2WAQ G;  2OWO A;  1NJI C;  3S2H B;  2ZJP A;  2HHH Q;  4ZK9 B;  1BBU A;  5CBA E;  3HFZ B;  4B3M L;  1YBY A;  4RG1 A;  4QCL A;  4JK1 C;  4QIW E;  3KLR A;  3H0G B;  4A3F B;  1ZXT A;  4A3E B;  4RFB A;  1E1O A;  4FYD A;  4BBR H;  1LT4 D;  2RCF A;  2B29 A;  4P75 A;  3B6Y A;  1H9J A;  5JVG 3;  3CME A;  4HJ5 A;  3PIP A;  2JA6 G;  2N78 A;  1TS5 A;  3J81 i;  1HH2 P;  2K5W A;  4YY3 L;  4KJO A;  1D2B A;  3PSI A;  4R4Q A;  1A6X A;  1PRT D;  3URY A;  4JI0 L;  3VA7 A;  2UUA L;  2PPB C;  3CMA A;  4O2D A;  4NB3 A;  4JI5 L;  1CKO A;  3DWP A;  1W6K A;  2VB2 X;  4X66 L;  4DV3 L;  3I8Z A;  1L1O A;  4QUF A;  4X3T A;  1JOR A;  2YTV A;  4YCV A;  5JEA G;  2B63 B;  3PO3 H;  4A3K H;  2A5H A;  1B8A A;  4IO9 A;  2NBF A;  5JJK A;  5JJI A;  2DNE A;  3HOX G;  1B2T A;  2JYO A;  5JEA J;  2B2T A;  4DGZ A;  4ALP A;  4A3B B;  3E6Z X;  3VR3 A;  1G91 A;  1HR0 Q;  5A35 A;  5EPJ A;  1F2Z A;  4HCE A;  1CFM A;  4IZ8 A;  1RD9 D;  3S24 A;  1EEF D;  2E8G A;  2RVL A;  5EKL A;  1SRO A;  4C56 C;  3NBH B;  2EE1 A;  5ELD A;  2B3G A;  1X3Q A;  4LF5 Q;  4HID A;  1YVC A;  2KHS A;  3LWU A;  5IOD A;  4G7H C;  4L5R C;  1EOV A;  3VYR A;  1K28 A;  4HSP A;  2R93 H;  1SN8 A;  3PO2 B;  4BY1 G;  4DK3 C;  1JB7 A;  3HOW G;  4DR5 Q;  1MJE A;  4QUC A;  1LLR D;  2PI2 E;  1B50 A;  2A6E C;  5K5P A;  4BBS H;  1G6Z A;  1E2Z A;  3UDG A;  2XRQ D;  3S1Q H;  3HEJ A;  1X6O A;  1IBL Q;  5BN5 A;  4LF9 L;  1KLU D;  4OXP A;  1OTC A;  2JA5 G;  1XNR L;  4BY7 H;  1FGU A;  3HZX A;  1A3U A;  2QW7 A;  1XPR A;  4A93 H;  5ELE A;  4CKC A;  1VMP A;  4G57 A;  4A3D H;  3W1G A;  2SOB A;  1QB5 D;  1EFI D;  1SYC A;  2IT1 A;  3GQB A;  4AYB E;  4DV7 L;  1I4P A;  1WFQ A;  2VY3 A;  2Z6B A;  2ICI A;  1C48 A;  4DV0 Q;  5DNF A;  3K58 A;  2OEO A;  2VS1 A;  4R1J A;  1K83 H;  1EOT A;  2EYF A;  2RHS B;  3A74 A;  1DD2 A;  2HIV A;  3KK7 A;  1STN A;  1ASZ A;  1ESR A;  4H0L C;  1ET9 A;  2L0C A;  3GTK H;  3PUZ A;  2FFK B;  3J81 E;  3U50 C;  4JOI A;  1SNQ A;  1PTO D;  3RLN A;  3K0X A;  4ME3 A;  4ID6 A;  4QJF A;  4DV2 Q;  3GTG B;  1S5F D;  3VA5 A;  3HOV B;  3QR8 A;  4JC0 A;  4DR1 L;  2VUM H;  4OO1 I;  5F2D A;  5FK9 C;  1O78 A;  5CYU A;  1EU4 A;  4FXG C;  3NSW A;  2E2I B;  2QGQ A;  3QOJ A;  4HED A;  1TWH B;  4XQQ A;  1EY4 A;  4DNI A;  3HOU G;  2XRS D;  1XNQ Q;  4K6L A;  1PV4 A;  1VQ4 A;  1FD7 D;  1OXV A;  1ENA A;  3KF6 B;  1RHP A;  4JBW A;  4LF8 L;  5KIX A;  1UUP A;  2K7V A;  4PV1 C;  3GV3 A;  2IL8 A;  4LFC L;  3GTL H;  1BO0 A;  3CCQ A;  2LXK A;  1ROD A;  2UXC L;  5LMU Q;  4KY5 A;  5M3F H;  3J7Y W;  3WDN A;  2BDN A;  1S72 A;  5LMN W;  2NN6 H;  2RA4 A;  5E7N A;  1VQ5 A;  3FKI G;  2V1C C;  1YNJ C;  2ZXR A;  1U4R A;  3H6M A;  3HOY G;  3MXN A;  1E2V A;  5CV6 A;  3G71 A;  1WI5 A;  4EQN A;  1AN8 A;  1RTO A;  3W5O A;  1N32 L;  4ZKB B;  3S9W A;  3ND8 A;  3R3O A;  3HOZ B;  2IY5 B;  1J8I A;  1WTP A;  1AE2 A;  1N34 L;  2L5T A;  4CJ0 B;  4XYO A;  4KHV A;  1O7I A;  3NWT A;  2Z4I A;  1WD1 A;  2N55 A;  4DK0 A;  4R4O A;  2UXB L;  3M4Q A;  3D6C A;  3F2B A;  1I6V C;  4DV4 L;  5A2Q E;  5HUR A;  2CKZ B;  2K5V A;  4KKS A;  3ERO A;  5I6Y A;  2HDM A;  2Z6K A;  2E2J B;  3BDL A;  4ZCK A;  4A3G B;  3GTO B;  3HKZ B;  5D3D A;  1WTO A;  4ABN A;  2N8N A;  3PMF A;  3F2D A;  2F4I A;  4A3L H;  2SDF A;  4KD4 A;  4C3H H;  1EU3 A;  1Q90 A;  4XYQ A;  2D9U A;  4C3I H;  3C46 A;  2SEB D;  2KEC A;  3CPW A;  2JJQ A;  2EJF C;  1U9R A;  4GNX A;  2GVB A;  3Q6S A;  2SNM A;  4UP9 A;  2IX3 A;  3EIV A;  1LUZ A;  1OO9 B;  4FF1 A;  5FJ8 H;  2UXD L;  3FVQ A;  1EL0 A;  1X3P A;  3MXG A;  2CWP A;  3V2T A;  2R3Z A;  1GHK A;  2Q2H A;  3I4N G;  1T9H A;  1PH5 A;  4GLX A;  2K1B A;  3AB9 A;  4R4I A;  1MGS A;  5K36 G;  2PNH A;  2N88 A;  4POF A;  2CCZ A;  1J6Q A;  4RA8 A;  4EX5 A;  4A4I A;  1QUQ A;  3EJI A;  1T5X D;  2Z4H A;  3KDF A;  4NXN L;  1Y1W H;  1EEI D;  4CDC C;  2O5I C;  4JBJ A;  4JI2 Q;  4RCN A;  1TY0 A;  2K5D A;  2AQ1 B;  2KHI A;  4RGN A;  5M3M H;  1TWA H;  4X64 L;  3J80 c;  2L4N A;  2E2H B;  5ELO A;  1EQR A;  2PNR C;  2QEX A;  5ELC A;  1X32 A;  4A3I G;  1M1K C;  1K8G A;  1Y1V H;  2O4X A;  2MNA A;  1YNX A;  2Y0S B;  5IT9 c;  4F88 A;  1GVP A;  5J1Z A;  4DUZ Q;  4B3T Q;  1I3Q B;  2QEJ C;  1B7Y B;  2ZTD A;  3CCS A;  1JB3 A;  5J3B A;  3GTP B;  4IUV A;  1K0S A;  2KEN A;  3S17 H;  1I5F A;  3OW7 A;  3VYS A;  1UE5 A;  2WII B;  1WCM H;  2JA8 G;  1OXS C;  2Q8R E;  1HA5 A;  4MHE A;  2OQ0 A;  3OWF A;  1IBK Q;  3RN5 A;  3P20 A;  2Q2T A;  3UDF A;  4I65 A;  1JMC A;  3S2H H;  4OIK A;  5FO9 B;  3VR6 A;  5M5Y B;  3P1H A;  3UDX A;  1KD1 C;  4U67 3;  1GUG A;  1BCP B;  5HGQ A;  4DR7 Q;  3H0G H;  4DR2 L;  5IWA L;  4A3E H;  2GN5 A;  3F2U A;  1I94 Q;  2KA7 A;  4KK7 A;  4DNT B;  1B9N A;  2JP1 A;  3I4M G;  4RGM A;  1N33 L;  3J7A F;  4HIO A;  4IUN A;  1VQF A;  1IL8 A;  1VQE A;  1EY8 A;  2BE5 C;  4R4C A;  3CRK C;  4PZ6 A;  1B1Z A;  5I2Y A;  4X6A H;  2BH8 A;  3OIP A;  1UE1 A;  3T1H Q;  4NXM Q;  2B63 H;  2AMC B;  1I4R A;  3R8B A;  3S1M B;  4YWL A;  4GOP A;  2OT2 A;  2QF7 A;  4ULL A;  4CDE C;  4LW1 A;  1M4V A;  3ICE A;  2DJF C;  2KQ3 A;  3GTK B;  4C3J B;  2EZV A;  1VQC A;  1NR2 A;  4A3B H;  4DR3 L;  5IIF A;  1NMG A;  4EQP A;  2F0J A;  2FJ2 A;  2DGY A;  2TSS A;  4RWS C;  3J81 j;  4AYB G;  1BR9 A;  5C3W A;  1ICW A;  2RHQ B;  1ZEQ X;  1Y8N B;  3FEW X;  2XN9 C;  2IPK D; 
#chains in the Genus database with same CATH homology
 2R7F A;  3CCV A;  3KJO A;  4JI1 Q;  2I0Q A;  1C7Y A;  4PZ7 A;  1HNW L;  1HZC A;  4BXX G;  2MFI A;  3OW2 A;  1VQM A;  1YZ6 A;  1HR0 W;  3MXN B;  3IRB A;  2ATW A;  2ZTE A;  4DR2 Q;  1JJG A;  1BKB A;  3S16 H;  2VQF Q;  2JQO A;  5GQO A;  1VQB A;  3CC7 A;  1WCM G;  2YTX A;  3GTJ H;  1N32 Q;  4GS3 A;  1HR0 L;  5IY0 A;  5M5X H;  5GAD C;  3U58 A;  4YCU A;  5C3E H;  4P74 A;  4JV5 L;  3F1Z A;  5FLX c;  5JJL A;  3CCE A;  3K80 C;  5IYB G;  1A0I A;  2UXB Q;  3AFP A;  1N33 Q;  3PO2 H;  5FLM H;  2VQE L;  1S3O A;  1VQ9 A;  2JA7 G;  4LFA Q;  2I5M X;  2F52 A;  2WAQ G;  3BZK A;  2JA9 A;  2OWO A;  1NJI C;  1Q1B A;  1NE3 A;  4JBM A;  2ZJP A;  2HHH Q;  1BBU A;  4LUO A;  1TXY A;  3HFZ B;  5C0X G;  1QVC A;  5IYD G;  4B3M L;  3M9B A;  1LM0 A;  1YBY A;  3Q8D A;  4RG1 A;  4A3E G;  1Q86 C;  3GD7 A;  1J5E L;  2ZJQ A;  4A75 A;  4QIW E;  1MJC A;  3CCR A;  4LF5 L;  3A5Z B;  3WWV A;  1PH1 A;  1N36 Q;  4JYA L;  1CKN A;  4DV1 L;  1PH7 A;  3CAM A;  1AE3 A;  1E1O A;  3U4Z A;  1Z47 A;  2BH2 A;  3HOV G;  4DR4 L;  1UE7 A;  2JA5 H;  4BBR H;  2B29 A;  3KYH C;  4P75 A;  1K9M C;  5C0X J;  1XMO L;  3L7Z C;  3B6Y A;  3KLW A;  1N9W A;  2DUD A;  3NEL A;  3CME A;  4DV5 L;  3PIP A;  4HJ5 A;  3EN2 A;  2E5L Q;  2UUC Q;  2JA6 G;  1SLJ A;  1Q82 C;  2N78 A;  4YCW A;  3J81 i;  1HH2 P;  2EIF A;  4IFD G;  4YY3 L;  2ES2 A;  2VL6 A;  3CW2 C;  1A8V A;  4LUZ A;  5IYB H;  3PSI A;  4R4Q A;  4DR3 Q;  3G4S A;  4JI0 L;  2UUA L;  3CMA A;  4TQU S;  4O2D A;  1VQG A;  4NB3 A;  1Q7Y C;  1IBL L;  4JI5 L;  1CKO A;  1VQI A;  4APV A;  4DV3 L;  2B63 G;  4X66 L;  2WB1 G;  2K50 A;  1XJV A;  1L1O A;  1S40 A;  1SMX A;  4LF6 L;  2AWN A;  4IFD J;  2YTV A;  1PH4 A;  4JI3 L;  4YCV A;  5JEA G;  2YU9 H;  3FP9 A;  1N8R C;  3PO3 H;  2F4V Q;  2UXD Q;  2OQK A;  3ULP A;  3NEN A;  4A3K H;  4DAM A;  1B8A A;  4AH6 A;  2HT1 A;  3CCU A;  1E3P A;  3GTG H;  3PGZ A;  4IO9 A;  4OWW B;  5C0X I;  1X54 A;  2HQL A;  4A3B G;  3A0J A;  1VCI A;  3GDE A;  5JJK A;  5JJI A;  3HOV H;  2ID0 A;  2R93 G;  3HOX G;  1K3R A;  4DV0 L;  5IP9 G;  1MKH A;  5JEA J;  4ALP A;  1BVS A;  1KL9 A;  1PYB A;  1HJP A;  3M4P A;  3RZO H;  1HR0 Q;  4JV5 Q;  1V9P A;  1QUQ B;  1ASY A;  1D8L A;  2E2I H;  2ASB A;  5GAG C;  2JK8 A;  1TWH H;  1EYG A;  3HOZ G;  4A3G G;  4IOA A;  2VQE Q;  2F3I A;  2MO0 A;  4B3R L;  1E7Z A;  1SE8 A;  4IFD I;  2RCN A;  3S24 A;  1NBW A;  1VS0 A;  2E8G A;  4BY7 G;  1PH6 A;  1X9N A;  4DV2 L;  1SRO A;  3J81 c;  4O0A A;  5C44 G;  1GD7 A;  3RLF A;  3NBH B;  3RLO A;  3E9H A;  2B3G A;  4GOP C;  4A3D G;  1TWC H;  1J5E Q;  4LF4 L;  4GKJ Q;  5AJ3 L;  3U4V A;  4LF5 Q;  3F2C A;  5C3E G;  5M5W H;  4HID A;  1YVC A;  4JYA Q;  4DV1 Q;  4X62 L;  4P71 A;  1CKN B;  4A76 A;  1NY4 A;  4J15 A;  4MNO A;  1G29 1;  5FLM G;  4L5R C;  1EOV A;  4LUV A;  1VQO A;  1KAW A;  1HZB A;  1XMO Q;  2R93 H;  1SN8 A;  5IP9 H;  1SRU A;  1FL0 A;  1MIU A;  4BY1 G;  4DK3 C;  2NZH A;  2D0P A;  1Q8K A;  2JE6 I;  2Q2I A;  1L2F A;  3FKI H;  3HKZ G;  4DV5 Q;  4DR5 Q;  1MJE A;  1JB7 A;  3HOW G;  1E22 A;  2PI2 E;  4Y7N H;  4A3J G;  2R7Z G;  3S2D H;  4YY3 Q;  3FHW A;  3PF5 A;  4BBS H;  1EIF A;  4OWT B;  1XPO A;  1TWG H;  3UDG A;  3HOZ H;  4JI0 Q;  2UUA Q;  3S1Q H;  1HNZ Q;  1X6O A;  1IBL Q;  4DUY L;  4IJL A;  2K52 A;  4LF9 L;  4OXP A;  4DV3 Q;  4X66 Q;  2HIX A;  4BBR G;  1OTC A;  2JA5 G;  5LMU L;  1FGU A;  4XTC S;  1XNR L;  1L1O B;  5IYC H;  1XPR A;  4BY7 H;  4OO1 G;  4LF6 Q;  4A93 H;  4JI3 Q;  3CC2 A;  5IE8 A;  2NVY H;  4JBK A;  5C44 H;  5IWA Q;  1V43 A;  3ERS X;  2KHJ A;  3CQZ H;  4A3D H;  3W1G A;  1CUK A;  4YWK A;  1I50 H;  4JI6 L;  4JI4 L;  3RZD H;  4IJH A;  1G51 A;  1GM5 A;  2IT1 A;  1VQ6 A;  1KHI A;  4AYB E;  4DV7 L;  1PH3 A;  4UP7 A;  1RL2 A;  2QA4 A;  1WFQ A;  3OTO Q;  1A62 A;  1JE5 A;  2JEB I;  2VY3 A;  4DV0 Q;  1TWF H;  2VS1 A;  4R1J A;  1K83 H;  4HIK A;  1VQK A;  1IYJ B;  1WOC A;  2D62 A;  2KBN A;  2E2J H;  2RHS B;  3A74 A;  2HIV A;  4BY1 H;  3CP0 A;  3I4O A;  3GTO H;  3HOW H;  4A3G H;  2EXD A;  1IZ6 A;  1ASZ A;  3JC6 6;  3PCO B;  4DKA C;  4A3J H;  3RNU A;  1X3E A;  3GTK H;  3PUZ A;  4A3K G;  3JAM i;  2UUB L;  3U50 C;  2A8V A;  4JOI A;  1Q81 C;  3PUX A;  4JCV E;  3RLN A;  1PH8 A;  1UEB A;  3K0X A;  4ME3 A;  4QJF A;  4DV2 Q;  3CD6 A;  2H5X A;  2IHE A;  1CSQ A;  4GOP B;  4JI8 L;  1Z9F A;  1FJG Q;  4LF4 Q;  4JC0 A;  1JT8 A;  2WP8 J;  4X65 L;  2WAQ E;  4YHH L;  5AJ3 Q;  4DR1 L;  4OX9 L;  2VUM H;  4GLA C;  3K8A A;  4NXM L;  4OO1 I;  4X62 Q;  2Y0S G;  1VQ7 A;  1YHQ A;  1B70 B;  2L15 A;  3E9I A;  1YI2 A;  1YIT A;  4A3M H;  2QGQ A;  3KOJ A;  3MEF A;  1DGS A;  3T1Y Q;  4DNI A;  1XMQ L;  2CFM A;  2YYZ A;  3I4N H;  3HOU G;  4POG A;  1VQA A;  4GN5 A;  1XNQ Q;  1L1O C;  1QVG A;  1PV4 A;  4BA1 I;  1VQ4 A;  2R6G A;  1HZ9 A;  4JG2 A;  1OXV A;  4L5T A;  3KF6 B;  1VQL A;  4UY8 C;  4JBW A;  4LF8 L;  1UE6 A;  4AIM A;  1QZG A;  2C35 B;  3CC4 A;  2IHF A;  2ALY B;  2R7D A;  4LFC L;  4DUY Q;  3UDI A;  4IPD A;  5BR8 L;  3GTL H;  4LF9 Q;  3RN2 A;  4FDB A;  3CCQ A;  2LXK A;  1PA6 A;  2UXC L;  1HNW Q;  2XGT A;  1XNR Q;  5LMU Q;  2IX1 A;  4UP8 A;  1Q1E A;  5M3F H;  1X3F A;  4R4T A;  4Y52 H;  3NEM A;  4GLV B;  4DK6 C;  1S72 A;  5LMN W;  2E2H H;  5E7N A;  5ELN A;  1VQ5 A;  3TRZ A;  1D7Q A;  3FKI G;  3JAM c;  2PQA A;  2V1C C;  2Q2U A;  2WB1 E;  2K5H A;  3HOY G;  5LMN L;  4BBS G;  4DV7 Q;  1IXR A;  1X56 A;  4A3F H;  4JI7 L;  3KJP A;  3G71 A;  3M3Y H;  1X3G A;  1WI5 A;  3I2Z A;  4BA2 I;  2NZO A;  3W5O A;  1N32 L;  1I3Q H;  1M90 C;  4A3L G;  3OYY A;  4QGU A;  2IY5 B;  3S15 H;  1AE2 A;  1N34 L;  2KCT A;  5IYC G;  2CWA A;  4A93 G;  1QVF A;  2CQO A;  3GTP H;  3HOU H;  2LXJ A;  4JI2 L;  1XPU A;  4B3M Q;  1O7I A;  2YV5 A;  4C2M H;  1HNX L;  2UU9 L;  4K0K L;  4DPG A;  1K0R A;  2UUB Q;  1OXT A;  1EUJ A;  4GN3 B;  4PMW A;  1Q46 A;  2JA8 H;  4KHZ A;  5EAY A;  3G48 A;  1YHB A;  4R4O A;  4DR4 Q;  2UXB L;  3M4Q A;  4YWM A;  1WYD A;  4QY7 A;  3TEH B;  5M5Y H;  3H15 A;  3F2B A;  1G6P A;  4DV4 L;  1KC8 C;  4JI8 Q;  2CKZ B;  2K5V A;  1N36 L;  4X65 Q;  4YHH Q;  4DR1 Q;  4OX9 Q;  1LYL A;  4DUZ L;  4B3T L;  2K5N A;  2VW9 A;  2Z6K A;  3ULJ A;  4IOC A;  1OXX K;  3HOY H;  4MTN A;  5GAE C;  3UE0 A;  2ZTC A;  5GAH C;  1Q12 A;  4LNQ A;  2N8N A;  1HZA A;  3GTQ H;  2OTJ A;  3J80 i;  4OWX B;  3F2D A;  3H3V H;  3BJU A;  3PUV A;  4A3L H;  4JI5 Q;  1XMQ Q;  1IBK L;  4WJ4 A;  4C3H H;  3PUY A;  2EQS A;  4GKK L;  2ZM6 L;  4C3I H;  2ZJR A;  3S1R H;  2MQH A;  4L5Q A;  3H3V I;  3I4M H;  3KF8 B;  2VNU D;  4DV6 L;  3TS2 A;  4LF8 Q;  3BZC A;  4UPA A;  2VUM G;  4KHP L;  3CPW A;  2RF4 A;  2JJQ A;  2OCE A;  3HKZ E;  3AEV A;  4LFC Q;  4GNX A;  5BR8 Q;  2GVB A;  4UP9 A;  1XTD A;  1Y1V G;  2NVX H;  2AKW B;  1YJN A;  3PV0 A;  1R9T H;  4DR7 L;  1NTG A;  3EIV A;  1E1T A;  1LUZ A;  3AFQ A;  3SGI A;  4A3M G;  4HJA A;  5FJ8 H;  1EFW A;  4HJ9 A;  1SR3 A;  2N3S A;  2UXD L;  1I94 L;  2CWP A;  3CCJ A;  4NPS A;  2Q2H A;  3I4N G;  1T9H A;  1PH5 A;  3KFU A;  3S1M H;  2PQA B;  4GLX A;  3LGJ A;  4HJ8 A;  4R4I A;  5LMN Q;  3BU2 A;  2A1A A;  4XIG S;  5K36 G;  1X65 A;  4KLK A;  1WJJ A;  2PNH A;  4POF A;  1IBM L;  2CCZ A;  4JI7 Q;  5C4X G;  1J6Q A;  4C3J H;  2K4K A;  2BA0 A;  4EX5 A;  3HKS A;  2R92 H;  3A5U A;  4B3R Q;  4A4I A;  1YJW A;  1CSP A;  1QUQ A;  4JOI C;  3KDF A;  4MZ9 A;  4NXN L;  4AQY L;  1Y1W H;  1N34 Q;  5GRO A;  1YJ9 A;  2I5H A;  3G6E A;  5M3F G;  2NVT H;  2JEA I;  1V1Q A;  4JBJ A;  4JI2 Q;  1PH2 A;  2NN6 G;  4DR6 L;  1C9O A;  2UU9 Q;  1HNX Q;  4K0K Q;  2KHI A;  5M3M H;  2K14 A;  2D0O A;  2I5L X;  1TWA H;  4LF7 L;  1KXL A;  4X64 L;  3J80 c;  5ELO A;  3T1H L;  1EQR A;  4LWC A;  2QEX A;  3H0G G;  4A3F G;  4P73 A;  4A3I G;  1M1K C;  1K8G A;  1Y1V H;  3DM3 A;  4DAY B;  1W2B A;  1YEZ A;  2IX0 A;  2PI2 A;  3K81 C;  2MNA A;  3CF5 A;  3TS0 A;  4GKJ L;  4DV4 Q;  1YNX A;  1EQQ A;  1P16 A;  5IT9 c;  4WJ3 M;  3DLL A;  1AH9 A;  4HIM A;  1GVP A;  3K7U C;  4DUZ Q;  4B3T Q;  1A63 A;  4PG3 A;  1B7Y B;  3TQY A;  4BXX H;  1W3S A;  2ZTD A;  3CCS A;  2LSS A;  3CCL A;  4A3C G;  1OXU A;  5J3B A;  5C4X H;  1GKH A;  2KEN A;  3S17 H;  1I5F A;  4DR5 L;  1UE5 A;  2JA8 G;  1WCM H;  1OXS C;  1KRT A;  1PVO A;  2OQ0 A;  3PF4 A;  1IBK Q;  2Y0S E;  2XTI A;  1FVI A;  4IPG A;  4LFB L;  1VQN A;  4GN4 B;  1QZH A;  4GKK Q;  1X55 A;  4B3S L;  2ZM6 Q;  3RN5 A;  3AQQ A;  5C4J H;  1Y14 B;  3M7N A;  2Q2T A;  3EBE A;  3UDF A;  3M85 A;  4DV6 Q;  1HNZ L;  1JMC A;  2JA7 H;  4KHP Q;  1VQJ A;  3F8T A;  3S2H H;  2FXQ A;  1JJC B;  4JI1 L;  3K7A H;  2NVQ H;  2OTL A;  4JI4 Q;  4JI6 Q;  3UDX A;  5IP7 G;  4GNX B;  3ZJY C;  1KD1 C;  3I56 A;  1EIY B;  4IPC A;  2NN6 I;  5HGQ A;  4DR7 Q;  1K73 C;  3H0G H;  4DR2 L;  3S14 H;  4A3I H;  5IYD H;  1U0L A;  5IWA L;  4IPH A;  5H1S E;  2VQF L;  2GN5 A;  4A3E H;  4L5S A;  1IL2 A;  1KIX A;  4QL5 A;  2VZA A;  1GO3 E;  2KCM A;  1I94 Q;  3L0O A;  3PO3 G;  3GO5 A;  2K75 A;  3STB C;  3I4M G;  1N33 L;  3OTO L;  1RIP A;  4HIO A;  4TVA B;  1IBM Q;  2MO1 A;  1VQF A;  4LFA L;  4A3C H;  2YTY A;  3S1N H;  4KI0 A;  3J7A 5;  1VQE A;  4EQ5 A;  4NXN Q;  2JA6 H;  1NMF A;  2HHH L;  1I6H H;  4AQY Q;  3KDF B;  3RR5 A;  1YHA A;  2AHO B;  4OON A;  5FJ8 G;  4R4C A;  4PZ6 A;  3PIO A;  3GTM H;  4DR6 Q;  4X6A H;  4HJ7 A;  1K8A C;  2BH8 A;  1L0W A;  1BBW A;  3VDY A;  4LF7 Q;  4X64 Q;  3CXC A;  3D31 A;  1UE1 A;  4H02 A;  4RMF A;  3T1H Q;  1UWV A;  2AMC B;  1JJ2 A;  4PZ8 A;  4NXM Q;  2B63 H;  5IP7 H;  3TRE A;  2Z6K C;  4YWL A;  4GOP A;  2N49 A;  3CPF A;  4LW1 A;  1SFO H;  3L2P A;  3CCM A;  1U5K A;  1PHJ A;  1FJG L;  2R92 G;  3ICE A;  2R7Z H;  2AWO A;  2A19 A;  2UUC L;  2E5L L;  1Y1W G;  3W1B A;  1YIJ A;  1VQC A;  5DLQ E;  3D0F A;  3PO2 G;  1C0A A;  4A3B H;  3ER0 A;  2GVA A;  3ULL A;  1VQP A;  3I7F A;  2PMZ E;  3AYH B;  3PUW A;  3HOX H;  4DR3 L;  1VQ8 A;  1KRS A;  5M3M G;  1NMG A;  2WFW A;  3STB D;  3J7Z C;  1PYS B;  3T1Y L;  4QQB X;  3I55 A;  1PFS A;  1VQH A;  2DGY A;  3E0E A;  1P8L A;  5HY6 A;  1XNQ L;  4GNX C;  3J81 j;  4AYB G;  3UE1 A;  3M4O H;  3KF6 A;  1EWI A;  4LFB Q;  2UXC Q;  1VQD A;  4B3S Q;  2F4V L;  1E24 A;  2RHQ B;  1KQS A;  1H95 A;  4P72 A;  2Z0S A;  1PH9 A;  2BA1 A;  1CKM A;  1LTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...