1IBLL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1iblL00
3T1HQ 3KYHC 4A3IG 2H5XA 3ULLA 1Q82C 3S15H 2VW9A 3A5UA 3OYYA 5IYBH 4BY1H 4H02A 2KBNA 4GOPB 2OCEA 3HOZG 3HOYH 1CUKA 4JI6Q 3EIVA 4A3CH 1N8RC 4OWXB 3CAMA 3J80i 1KL9A 4A3FG 2R7ZG 4P74A 4A3KG 1VQMA 4DUZL 4GKJQ 4GN4B 5IP9G 1O7IA 1UWVA 3MEFA 3HOVG 4AIMA 4YY3Q 4X66L 1VQGA 5C44G 1S72A 4A3JH 1I94Q 1JT8A 1IYJB 2HIXA 1CKNA 1PHJA 1KD1C 1K3RA 1M90C 1WJJA 2R92H 2CCZA 3UDIA 4P73A 1X3EA 3HKZE 3GD7A 4GS3A 4O0AA 2UXDQ 1YIJA 3PCOB 4LF7L 1X6OA 2ZM6Q 4A3BH 2I5HA 1SN8A 2F52A 1NMFA 2DGYA 2KCTA 2MO1A 4LUZA 4ME3A 4DAMA 4R4CA 1N36L 2UXCL 1WCMH 1HR0Q 3AYHB 1VQKA 2UUAQ 1HNWQ 3GTLH 4YWMA 1BKBA 4DR5Q 2OQKA 2K5HA 2AKWB 3S16H 1S40A 1G6PA 2A1AA 3NBHB 3KF6B 4JI2Q 1FL0A 1YJNA 2N3SA 5BR8L 3F1ZA 3S24A 3PF4A 4HJ9A 5IP7G 4R1JA 1K0RA 4JOIA 4BY7G 5IYDH 4B3MQ 1XMQL 4OO1G 5AJ3Q 3CPWA 3BJUA 4DV7Q 4JI4L 2IY5B 3DM3A 3KDFB 1YJ9A 2K14A 1YITA 1RL2A 1X56A 3F2BA 3HOWH 2KCMA 2UUBQ 3J7A5 5JJKA 2ES2A 1EUJA 4OO1I 3KJOA 4DV3L 4HIOA 2B63H 1VS0A 2JK8A 2UXBL 3CCEA 2K52A 3K81C 2EIFA 1HNXL 2JA6G 5IYCH 1YNXA 4DV4Q 2VQEL 2YTVA 4IPHA 5H1SE 2XTIA 3NENA 4QJFA 3FKIG 3ULJA 4IPGA 4LUOA 1VQPA 4POGA 4NXML 1N32Q 5GAHC 1OTCA 4JI5L 3H0GH 3PO3G 4WJ4A 1XNRL 4UPAA 4DR2L 1CKMA 1HJPA 3OW2A 2OWOA 4HIKA 1XMOL 2RHQB 3H3VI 2NVXH 4GN5A 2JA8H 5JJLA 2N78A 4IPDA 3E9HA 3RLFA 5M3FG 4QIWE 4DNIA 2KENA 4LWCA 4XIGS 3U50C 2F4VQ 4DV6Q 1PH7A 2K5VA 3U58A 3S1RH 1JB7A 1SRUA 4LUVA 3GTGH 1H95A 2GVAA 4B3RL 3PUWA 1Q46A 3BZKA 1IZ6A 3HOUG 3KLWA 4YCUA 4YHHQ 4LF9Q 2KHIA 1E22A 4DV1L 2JEBI 4UP8A 2Z0SA 1Q86C 2D0PA 1LTLA 4DK3C 3J81j 1G51A 3IRBA 3RN5A 2NVTH 1AE2A 1SMXA 4NXNQ 2OTJA 2ID0A 4YWKA 3F2CA 2YU9H 4R4QA 4X64L 3HOXH 2K5NA 3LGJA 4EQ5A 1EQRA 3CF5A 5ELOA 1KRTA 1FJGL 2K75A 3GO5A 2CWAA 1HR0W 3I4OA 5IWAL 1I3QH 1I50H 3VDYA 4IO9A 3TREA 4L5SA 4DR6Q 1MKHA 2PMZE 4YCWA 4JC0A 4QL5A 1Y14B 5M3MH 1W2BA 3ZJYC 1EQQA 1XNQL 4LFBQ 2E5LL 1HNZL 1IBLQ 4JI1L 4A76A 1VQHA 4JI8L 4POFA 2VS1A 4BBSH 1JE5A 3G4SA 4LF8Q 1B7YB 1VQ9A 3K7AH 5GROA 3RLNA 3CCRA 2Q2UA 1QUQB 1IBMQ 4GKKL 1VQ5A 1LYLA 4C2MH 4KLKA 4P75A 3CP0A 4DUYQ 1K8GA 4LFAL 1EOVA 3JC66 3CCLA 2ASBA 2R92G 1VQOA 3L2PA 1D8LA 2WB1E 4R4OA 3EBEA 3CMAA 2YYZA 4X65Q 4OWTB 4GNXC 3GDEA 1Q1BA 1SR3A 3E9IA 4DPGA 3T1YQ 4AYBG 1N33L 4KHPL 4JI3L 1YHAA 2Q2TA 2IX1A 3I4NG 4JV5Q 1RIPA 3PF5A 1PH8A 3HFZB 4AQYQ 1YJWA 1X9NA 3M85A 2JA5G 1XTDA 1R9TH 3PO2H 3HKZG 1E1TA 2QEXA 1NE3A 1VQNA 4X62Q 1TWGH 4HJ8A 1QZHA 2L15A 2N8NA 1X54A 2AHOB 4IFDJ 1K83H 1HZ9A 2F3IA 2GN5A 2JEAI 4DAYB 1CKOA 3DLLA 2WFWA 5GADC 1GO3E 4AYBE 2R7FA 5E7NA 2IT1A 3J81i 1VCIA 2AMCB 1N34L 1V1QA 3RLOA 1ASZA 3G48A 1K9MC 3D31A 4JYAQ 5IYDG 3I4MG 1CSQA 4DV2L 1YI2A 1G291 3TEHB 1EWIA 1X3FA 1Q7YC 2E2HH 4OX9Q 1TWHH 4YWLA 3OTOQ 1UE7A 1OXXK 1GD7A 3HOWG 1SE8A 3E0EA 1Y1WG 2VZAA 1FVIA 3M3YH 4FDBA 4A75A 5GAEC 4A3LH 4PZ7A 1L1OC 4DV5L 2K50A 1MJEA 1HZCA 3EN2A 1PH9A 2HHHL 2CFMA 4LFCQ 3AQQA 4YCVA 5IE8A 3F2DA 3KF8B 3TQYA 1J6QA 1P16A 4B3SL 4L5RC 1X55A 4GOPA 2A19A 1YVCA 5C4XH 1VQJA 3JAMc 2ATWA 4LF5L 4JI0L 4A3IH 4AH6A 1AH9A 3H0GG 3UE0A 3J7ZC 3U4ZA 4HIDA 1IBKQ 4GN3B 1S3OA 4A93G 4A3MG 4GNXB 3UE1A 1WOCA 5FLXc 4DV0Q 3HOZH 3CCMA 5ELNA 3W5OA 3T1HL 2IHFA 1Z47A 2YTXA 4IJHA 4A3FH 1C9OA 2R7ZH 4DR7L 4A3KH 2ZTCA 5IY0A 3TS2A 4KI0A 4UP7A 5IP9H 4LF4Q 2LSSA 1DGSA 1WFQA 3F8TA 3HOVH 4DR1Q 4JI6L 2UU9Q 5C44H 1PH5A 5LMNQ 5FLMG 2Z6KA 4NPSA 1QVGA 1J5EQ 1JJGA 5C3EH 5JEAG 4GKJL 4DR4Q 2E2IH 3Q8DA 1KHIA 2D0OA 4MZ9A 3K8AA 4R4IA 4DR3Q 4YY3L 4B3TQ 4C3HH 1I94L 3NELA 3ERSX 2C35B 3GTJH 2PQAB 1HZBA 1SROA 5HGQA 4A4IA 2EXDA 3HOXG 4UP9A 3KF6A 3PUXA 3M4OH 1V9PA 4TVAB 5M5XH 2UXDL 2NZOA 4MNOA 1P8LA 1L2FA 4BBRG 4IOAA 4OWWB 2JA7G 1W3SA 2AWNA 1M1KC 2I0QA 4OXPA 2B3GA 2OQ0A 2ZM6L 3G71A 1L1OB 2NZHA 2K4KA 2RCNA 3CC4A 3PIOA 5LMUQ 2QA4A 2YTYA 1VQDA 3KDFA 1HR0L 5IP7H 2UUAL 2I5MX 2R7DA 3A0JA 1HNWL 3I56A 1PH1A 2VQFQ 1Q1EA 1Q12A 5C4JH 4DR5L 2ZJQA 3CCSA 4BY7H 5DLQE 2ALYB 2WAQG 1FGUA 3FHWA 2UUCQ 4JI7Q 4A3GG 3J80c 4K0KQ 4JI2L 2BH2A 3S17H 4A3DG 2VNUD 1PFSA 3L7ZC 1YHBA 1C0AA 3PSIA 2NVQH 4B3ML 4EX5A 4QY7A 5GQOA 5AJ3L 2VUMG 3CQZH 4JOIC 4DV7L 3RNUA 4RG1A 1HZAA 2VY3A 4DUZQ 1B70B 1QVCA 1Z9FA 4BY1G 5IYBG 2PI2A 2ZTDA 3WWVA 2WAQE 4PMWA 4Y7NH 2JA6H 1WI5A 2WB1G 4TQUS 2UUBL 3HOYG 4X66Q 3AFQA 4JBKA 4A3CG 4QGUA 1L0WA 3FKIH 2HIVA 1JJ2A 1VQFA 1IXRA 3HKSA 3PO3H 3PV0A 4DV4L 1V43A 3CCQA 3UDGA 3GTKH 3A74A 4IOCA 3CC7A 1MJCA 3MXNB 1A8VA 1YEZA 2Z6KC 4A3JG 4LF7Q 1SFOH 3GTPH 3CMEA 1IL2A 5C0XJ 5M3FH 1A63A 1N32L 1N36Q 2IHEA 2UXCQ 2WP8J 5IT9c 2D62A 1PH3A 2JJQA 2MQHA 1XPRA 1BBUA 1NBWA 1CKNB 3UDFA 2ZJRA 1LUZA 1Y1VH 3B6YA 1VQLA 3AEVA 5J3BA 3HOUH 5FJ8H 3UDXA 4A3BG 3S1NH 2QGQA 5LMNW 3STBC 2F4VL 1VQBA 3GTOH 1E7ZA 4DK6C 4DV6L 1WCMG 1JMCA 2B29A 1XMQQ 1TWAH 4JBWA 5M5YH 5M5WH 4YHHL 4JI4Q 2EQSA 4LF6Q 1UEBA 4LF9L 2R93H 3W1BA 1YBYA 4NB3A 1YZ6A 1KC8C 3CCJA 1I5FA 2PNHA 1UE1A 3KOJA 4GLVB 1PVOA 4IPCA 3K0XA 3KFUA 4NXNL 4DV3Q 2LXJA 3D0FA 3S2HH 2UXBQ 4C3IH 3I55A 4XTCS 1HNXQ 1Q81C 1VQ8A 1GKHA 4RMFA 2VQEQ 1EIYB 2XGTA 3CXCA 1QUQA 1NTGA 4DR6L 3G6EA 5HY6A 5GAGC 4P71A 2B63G 2BA0A 4NXMQ 1VQIA 3PUVA 1UE6A 4DKAC 4JI5Q 3S2DH 1TXYA 5IYCG 1XNRQ 4DR2Q 1K73C 5K36G 4LFBL 2KHJA 4A3EH 1QZGA 2VL6A 1XMOQ 1IBLL 2LXKA 4KHZA 5C3EG 4OONA 2Q2HA 2BA1A 4JBJA 3S14H 4LF8L 3CCVA 1U5KA 3K7UC 1AE3A 1X65A 3L0OA 3PUZA 3U4VA 1IBML 3I4NH 4Y52H 2HQLA 2YV5A 4DUYL 3TS0A 2I5LX 4JBMA 1PA6A 1KRSA 4B3RQ 4IJLA 2JA5H 2ZJPA 1KIXA 2FXQA 2JA8G 2GVBA 4LF6L 3GTQH 4X65L 4HIMA 3ER0A 3T1YL 4K0KL 3KJPA 4DV1Q 3CD6A 3M7NA 1VQ7A 1OXTA 3H15A 4HJAA 3STBD 1VQAA 4JV5L 4X6AH 2JE6I 5JJIA 1TWFH 4AQYL 4HJ7A 2CQOA 1XJVA 2JQOA 2A8VA 2BH8A 1E1OA 1PV4A 4J15A 4APVA 4X62L 2R6GA 1A62A 3I4MH 4UY8C 4X64Q 2Q2IA 1C7YA 3FP9A 3GTMH 4DR7Q 1FJGQ 4P72A 4L5QA 1A0IA 3W1GA 5IWAQ 4MTNA 4PZ6A 4O2DA 1PH4A 1HH2P 1Y1WH 4JYAL 1TWCH 3M9BA 3PGZA 1VQ6A 1XNQQ 5C0XG 4BXXG 1I6HH 4OX9L 2E5LQ 2CWPA 1LM0A 3M4QA 3OTOL 4L5TA 1HNZQ 1OXSC 4JI1Q 3BZCA 1PYSB 4JI8Q 3I7FA 4GKKQ 5M3MG 1QVFA 1Q8KA 1VQ4A 4LFAQ 4GNXA 5C0XI 4PG3A 1E24A 1KXLA 1NJIC 1KAWA 4LFCL 2PI2E 4BBSG 4GLXA 1CSPA 1N33Q 2NVYH 3SGIA 3S1MH 3S1QH 4IFDG 4KHPQ 4BXXH 4A93H 4JI3Q 4BA2I 4A3MH 2MFIA 3ICEA 4QQBX 1X3GA 3CW2C 4LW1A 4C3JH 1B8AA 1GVPA 2MNAA 1KQSA 1EFWA 1YHQA 4GOPC 4JG2A 3RR5A 3CPFA 3J81c 1BVSA 3A5ZB 1U0LA 1IBKL 4IFDI 1Y1VG 2AWOA 4DV0L 3BU2A 1SLJA 1EIFA 5FJ8G 2RHSB 5FLMH 1E3PA 3K80C 4JCVE 3JAMi 2OTLA 3H3VH 3PO2G 3PIPA 1N34Q 4LF4L 3TRZA 2PQAA 2E8GA 4HJ5A 4GLAC 5EAYA 4DV2Q 4DR1L 4PZ8A 4BA1I 2UU9L 5LMNL 2R93G 3PUYA 1J5EL 3RZOH 2HT1A 4WJ3M 2N49A 2JA9A 2Y0SG 1OXUA 3RZDH 4DR4L 1L1OA 1ASYA 1VQEA 1MIUA 1OXVA 3CCUA 4DR3L 1JJCB 2CKZB 2ZTEA 4BBRH 1NY4A 3I2ZA 3RN2A 1K8AC 4ALPA 4B3TL 2JA7H 4DV5Q 1GM5A 1T9HA 1XPUA 2HHHQ 3ULPA 2RF4A 3AFPA 1VQCA 2V1CC 3CC2A 2IX0A 2NN6G 5JEAJ 4A3LG 4B3SQ 5BR8Q 1PH6A 2Y0SE 2DUDA 4R4TA 3NEMA 4A3GH 2E2JH 1BBWA 4LNQA 4LF5Q 4JI0Q 4A3DH 3M4PA 1XPOA 1WYDA 1UE5A 5LMUL 1PH2A 4A3EG 1N9WA 1NMGA 1PYBA 2VQFL 1D7QA 2NN6I 2VUMH 2UUCL 4JI7L 5C4XG 2MO0A 1EYGA
chains in the Genus database with same CATH superfamily
1C8CA 2H5XA 3A5UA 2EY2A 3OYYA 5J22A 3EA6A 3HOYH 3HOZG 1G8ZD 1N8RC 1O7ZA 5I6WA 4A3FG 1I6VC 4P74A 4A3KG 4GKJQ 2EY6A 1L0YB 3MEFA 3HOVG 5J39A 4EQOA 5DM63 4ABNA 4X66L 3CHBD 4KN7C 2FINB 1PHJA 1CKNA 3KLSX 1SYCA 3BG3A 3UDIA 3HKZE 2UXDQ 1YIJA 2F0TA 1LTTD 1G6ZA 2ZM6Q 4A3BH 5C44B 4DAMA 3HG9A 1HTPA 4R4CA 2F0DA 1WCMH 4PQXA 1HNWQ 2K7VA 4YWMA 1BKBA 2OQKA 3S16H 5E4XA 1S40A 1G6PA 4DAPA 4RGTA 3S24A 3PF4A 4HJ9A 3NP8A 3GTJB 1K0RA 2NVXB 2RDGA 5M5XB 2IY5B 4ID6A 1SEBD 4DNRB 4NMZA 1YITA 2NYZD 1X56A 3HOWH 4FXGC 2PZTA 1O7LA 2IPKD 1Z6HA 3I72A 1SNMA 4XQQA 4CDCC 4DV3L 2JK8A 3CCEA 2JA6G 2IL8A 5IYCH 2EY5A 2YTVA 1IHZA 5H1SE 1GUNA 4NP5A 3FKIG 2NVQB 4IPGA 3OW7A 1MD2D 2OWOA 2F0JA 1JWSD 4QB4A 4GN5A 2Z8LA 3BDLA 5M3FG 1NR4A 3P7JA 1JB7A 1SRUA 3GTGH 3RMHA 2GVAA 1IYVA 3PUWA 4K5VA 2QF7A 3KLWA 4M8AA 1QNUA 2QDLA 4DV1L 3MTSA 4UP8A 2XWBB 2Z0SA 1Q86C 3NTKA 3K5OA 1HHVA 2QILA 4DK3C 3J81j 1G51A 4ILWA 1F2MA 2ID0A 1B9NA 4OIJA 2K5NA 1DM0B 4EQ5A 3PO2B 2K75A 2EYFA 2H4OA 1SSOA 3TBIB 5IWAL 1I3QH 1I4QA 1G91A 4L5SA 1AZQA 1YNJC 2PMZE 4JC0A 5M5YB 1RHPA 4C3IG 3S9WA 1W2BA 1IYUA 1UAPA 3TDQA 5TSSA 1HNZL 1TIID 3DXJC 2VS1A 4POFA 1B7YB 1QNKA 1VQ9A 3CCRA 2Q2UA 4C2MH 4KLKA 1K8GA 3S2HB 1EOVA 1JICA 3JC66 4CKBA 1VQOA 1D8LA 1W6JA 2YYZA 4GNXC 1Q1BA 1SR3A 4DPGA 2GA4B 4H44C 4AYBG 1YHAA 1RIPA 1CQFA 1K3BC 1PH8A 3ITPA 5KNCA 2JA5G 3S2DB 1XTDA 1CZGA 2QEXA 4A3EB 1WD1A 3QOJA 3QWNA 1LTBD 3EFXD 4IFDJ 1K83H 1HZ9A 1W6KA 4I7AA 3VR4A 4AYBE 2SEBD 2IT1A 3BDOA 1V1QA 5I4DA 3AMUA 3G48A 1STHA 3WOFA 5IYDG 3GTQB 2HUGA 4FNFA 1O80A 3I4MG 4DV2L 1Q7YC 1SJED 1X3FA 2E2HH 2AUJD 1UE7A 3M3YH 4CGYB 2K33A 4A75A 5GAEC 4OGQC 1TVXA 2EYPA 2XRSD 1ILPA 1LTAD 1HZCA 5C3WA 2CFMA 2Z6BA 2ICIA 4QUFA 3TQYA 4FXDA 1H9RA 2A19A 1YVCA 2A6HD 4RWSC 5FOBB 5IGCA 3LWUA 1LTRD 2B2WC 3U4ZA 1F9PA 1S3OA 2NTSA 3SK8A 3HOZH 5FLXc 1S5BD 4DFAA 4A3FH 3ERQA 1NSNS 3CU7A 1C9OA 1B3AA 4A3KH 2ZTCA 1SE2A 4LF4Q 1SJHD 1WFQA 3HOVH 4DR1Q 2UU9Q 2NVYB 4HCSA 4A3MB 5A35A 2LKVA 3SK5A 5C3EH 2EXZA 2K32A 4DR4Q 4G7OC 4MZ9A 4DR3Q 4B3TQ 4CKCA 1S5FD 5KIXA 3C46A 2BDNA 3PQIA 1I94L 1KTKA 3NELA 5HGQA 4A4IA 1BCPB 1V9PA 5G3LF 2AWNA 2KOLA 1M1KC 4OXPA 2OQ0A 2DY8A 1HR0L 2UUAL 3RZDB 2VQFQ 5C4JH 1EIGA 3J80E 2UUCQ 4A3GG 1FGUA 2JA7B 1ENAA 4LMQD 1PYWD 1YHBA 1C0AA 4ODGA 4IUTA 4B3ML 1IL8A 2VUMG 3SHLA 4XDXA 1JORA 4K5XA 2E2JB 1QVCA 5IYBG 4XT3B 2JA6H 2ZTDA 4Y7NH 2WB1G 2UUBL 3FDTA 4X66Q 4A3CG 1L0WA 2OXPA 3KLSA 4R9WA 3FKIH 4K2KA 1WTPA 2Z1CA 2E74C 2RCFA 4MIUA 3PV0A 1QJOA 1PFBA 3CCQA 2K5WA 3HP3A 3MXNB 2O5IC 2B2YA 3HOYB 3CMEA 1TS5A 5M3FH 1GHKA 1A63A 2EPBA 1SNCA 2DJGC 2JJQA 2MQHA 1XPRA 1SDFA 5E4WC 2JP1A 1LLRD 2B2TA 3UDXA 2F4VL 1ICWA 4DV6L 2BE5D 4HSPA 1TY0A 1TWAH 4H13C 4YHHL 1XYIA 1RTNA 4LF9L 4K8JA 1HUNA 2EYOA 3CCJA 1I5FA 4A3BB 4PMBA 1WCMB 4IPCA 4UAIA 2MUYA 4NXNL 4DV3Q 2F3VA 2RA4A 3S16B 4C3IH 3R2IA 4XTCS 1Q81C 4RMFA 1EIYB 2XGTA 4FF2A 4DR6L 2B63G 2BA0A 3ND8A 4CJ2C 1QZGA 4N9TA 2DJFC 2VL6A 4ZAIA 3TP7A 3HOWB 2J0TD 5HGTA 3Q23A 5I2XA 3T13A 4TKOB 4LF8L 1U5KA 3U4VA 2JXMB 2YV5A 3TS0A 1PA6A 2HD3A 2JA5H 3DHQA 1KIXA 4G57A 4J8QA 1GJXA 4HIMA 3T1YL 4DV1Q 3OMGA 1VQ7A 1M8AA 5JJIA 2A68D 4AQYL 4ZCKA 3QR8A 2A8VA 4J15A 4X62L 3I4MH 2PW7A 2J4XA 3N52A 5IWAQ 4MTNA 4ZUIA 3VYRA 3GTGB 1HH2P 5FO7B 4JPBW 2ENBA 5EBCA 3IAYA 1A2TA 1VQ6A 2EE1A 3EJIA 1HNZQ 1OXSC 3BZCA 1Y69U 3D6WA 3HS0C 1QVFA 4G7ZC 4YIJA 1KXLA 1E24A 3HEJA 2F0NA 2PI2E 4BBSG 4GLXA 1I3QB 4IFDG 3NQIA 3H6MA 3LNNA 2MFIA 3K57A 1BDOA 5JJZA 1GVPA 1KQSA 3J81E 3RR5A 1HXYD 2M00A 3AB9A 3CPFA 5KYLA 1DYQA 1R4QB 1E2WA 2AWOA 3BU2A 2EY1A 1LT5D 4DGZA 3H3VH 4C2MB 5CV9A 2IX3A 1WTWA 1JB3A 2L55A 4GLAC 4DV2Q 4BA1I 3R8BA 5LMNL 1T5EA 3Q0AA 3A7AB 3TP5A 4QCLA 1VQEA 1MIUA 2DN8A 1BNZA 3I2ZA 2O2LD 1GM5A 1FYCA 1K83B 4DAVA 3FRPB 5BN4A 4FF1A 3CC2A 5JEAJ 2NN6G 3GP7A 2CHBD 4O1NA 3BS1A 1PH6A 1HCZA 4A3GH 1CHQD 1BBWA 3ZYYX 1IW7D 2QEJC 1XPOA 2E2HB 5CV7A 5LMUL 2ZXRA 1Y8OB 1Z7TA 2X6LA 1PYBA 3M3YB 1RTOA 2VUMH 2KEEA 4JI7L 4K0KL 4IURA 5C4XG 4X6AH 1EYGA 4A3IG 5IYBH 4H02A 4GOPB 1KNAA 2OCEA 4XQJA 1GOZA 1CUKA 1TS2A 2K5QA 3EIVA 3QIAA 4A3CH 4CHTB 3MXNA 2N55A 2NTTA 1O7IA 1B50A 2F0KA 1EZ8A 2QDBA 3KBXA 3MXUA 1I94Q 1JT8A 3HOZB 4IUVA 1M90C 1E2ZA 1CFMA 4P73A 2PCFB 4O0AA 4A3KB 3A8KE 1X6OA 2VB2X 4M1UB 3MAQA 4X3SA 2I5HA 1D5MC 1SN8A 1NMFA 2B2YC 1N36L 1HR0Q 1VQKA 2UUAQ 5C3EB 2EZVA 1DJRD 2K5HA 2A1AA 3NBHB 2JSOA 2B2TC 4C56C 3J80L 4DK1A 1CK1A 4R1JA 4B3MQ 1XMQL 2D2CC 3I8ZA 2PZUA 2K14A 5KYIA 1RL2A 2PW5A 4RGMA 2F0IA 2UUBQ 5JJKA 2B2UA 1EUJA 4OO1I 3KJOA 2RSNA 5C4JB 4HIOA 2B63H 2IW3A 2QKIC 2EIFA 3H09A 4KMUC 4Z9CB 4IPHA 3NENA 4QJFA 1BBXC 3ULJA 4LAAA 4LUOA 4C1NK 2F0LA 4NXML 4JI5L 5JPMC 5I6YA 4WJ4A 4KTAA 2PNRC 1XMOL 1BO0A 1GUTA 2JA6B 4Y7NB 2Z9HA 5FK9C 3E9HA 1F2ZA 2KA7A 4QIWE 3RLFA 2KENA 3U50C 2F4VQ 3FKIB 4DV6Q 3S1RH 5E3FA 4LUVA 3W2DA 3TMEA 4FO2A 3BZKA 3HOUG 5DAUA 4YHHQ 4LF9Q 1EOTA 2JEBI 2FJ2A 3NUCA 5CR3A 2L5TA 5CV5A 5M3FB 3QB3A 5DEHA 2L11A 2NVTH 1GHJA 1AE2A 1LACA 1LV9A 5EJWA 4NXNQ 3F2CA 2E2DC 4NKLA 2PPBC 1S5ED 4X64L 3HOXH 3LGJA 1EQRA 2CWAA 2F0UA 1HA6A 3T16A 3VDYA 4DR6Q 1S5DD 4PMCA 1MKHA 1SMYD 4YCWA 3IFDA 2WV6D 3R2TA 2JYOA 1O78A 2A5HA 2CQAA 3ZJYC 2Y0SB 2E5LL 5M9OA 4JI1L 1VQHA 2G9DA 4JI8L 4BBSH 4LF8Q 4IFDH 1IKLA 3RLNA 1DD2A 3MVVA 4GKKL 1HFGA 1VQ5A 1LYLA 1DONA 4C3IB 4LFAL 2R92G 3EBEA 1JWMD 3T1YQ 3GDEA 1N33L 4ZQ3A 4H7BA 4JI3L 3I4NG 2Q2TA 3PF5A 4AQYQ 4F87A 3HKZG 1E1TA 1NE3A 4X62Q 4CDDC 2N8NA 2IWHA 3K5LA 1CKOA 3DLLA 5GADC 1S4ZA 2R7FA 1D1IA 2AMCB 2JA5B 3D31A 1PRTB 5JVG3 1QE6A 4B9XA 2Q8RE 2XWJB 4YWLA 4R8IA 2K05A 1BCPC 5D65A 1K28A 3E0EA 3OWFA 2VZAA 2F0WA 2NN6H 3A7LA 5G3LD 4O42A 1ZXTA 1STEA 2K50A 1MJEA 3I4MB 4IN3A 1PH9A 3SDZA 4RKBA 5CC4A 3KF8B 1A3TA 1P16A 4GOPA 1R4PB 1DOLA 4DN4M 5C4XH 1HQMC 1VQJA 4JI0L 4A3IH 3H0GG 3UE0A 2K28A 2CVRA 4KJOA 2FFKB 4GN3B 3J81L 4L8JA 1WOCA 3VR6A 5ELNA 1U4LA 2IHFA 2I07B 1EU3A 4KI0A 1TT2A 2LSSA 1H9JA 1DCZA 4JI6L 5IODA 5LMNQ 4NPSA 4OELB 3C1FA 4Q0FA 5JEAG 2EYMA 4X3TA 1TY2A 3GV6A 2E2IH 3IKJA 4R4IA 4YY3L 3FEWX 1GUGA 1PZKD 3ERSX 3DEPA 3OWEB 2EXDA 3NBHA 4CBVA 4TVAB 2K6AA 4BBRG 1AW7A 4IOAA 3EROA 1L1OB 3G7LA 4P2CB 2K4KA 2RCNA 3CC4A 2XSCA 5LMUQ 1A2UA 3OHXC 2I5MX 5LHY1 3SK4A 1SFOB 1B3QA 2ZJQA 2ALYB 4JI7Q 4K0KQ 2EJFC 4JI2L 3S17H 1PFSA 4N8X1 3L7ZC 3LWEA 3PSIA 1GUOA 4F8MA 5AJ3L 4U68A 1H9SB 3RNUA 4RG1A 1HZAA 1G2SA 4A3GB 5FO9B 1Z9FA 1TS4A 3A55A 3I4LA 3NBIA 3E0JA 1C4QA 2HIVA 1JJ2A 2VUMB 2B2UC 3HKSA 2Q8IB 1SXTA 3GTKH 1QWYA 3A74A 4IOCA 1D5ZC 1MJCA 5EKKA 2Z6KC 4A3JG 3HZXA 2WB1B 2EDGA 1IL2A 1KDCA 1BCPF 2IHEA 1N36Q 3NTIA 4XT1B 1BBUA 1ET9A 3UDFA 2HCCA 5BN3A 2ZJRA 1Y1VH 1XXGA 3HOUH 5J3BA 5FJ8H 1TU2B 2QGQA 2P5ZX 3CRKC 1E7ZA 2TMPA 2MGSA 1XMQQ 1D2BA 2LY7A 4DNTB 4KN4C 5M5WH 2R93H 2EQSA 3CRLC 1EY5A 1UE1A 2RKSA 3WDNA 3KOJA 4GLVB 5EPLA 1NNXA 1Q90A 3GQBA 3O13A 3KFUA 1WTVA 2WKDA 1EY0A 5COYA 1VQ8A 2X69A 1NTGA 4B9WA 4FP5D 3FMCA 2DNEA 4BWGB 4NXMQ 4JI5Q 2F0VA 4FXKC 5K36G 4EVOA 2KHJA 4XXEA 3DWPA 1XMOQ 1IBLL 4KHZA 3EQLC 3MA2B 4JBJA 4FF3A 5C6AA 3S14H 4DA2A 3CCVA 4KD3A 4JVZA 3L0OA 3I4NH 4Y52H 2B63B 1GUSA 1KRSA 3HRZC 1TS3A 2FXQA 4X65L 1QCBD 3KJPA 4IUUA 3M7NA 1OXTA 2KUMA 2JE6I 2K04A 5A2QE 1XJVA 1TKWB 3DWQA 4KD4A 1PV4A 1A62A 1GUWA 3K6OA 3MFYA 4UY8C 4X64Q 1C7YA 2SDFA 4K14A 3E6ZX 3GTMH 1BOSA 1HRJA 1V8QA 2K1BA 3S1RB 1F2LA 2XVSA 3W1GA 2IJ0A 3IL8A 1SBBB 3BDCA 1TWCH 3KF8A 4OX9L 2E5LQ 3M4QA 3OTOL 1AFPA 4EGVA 4JI1Q 4JI8Q 1QOHA 2NVTB 3C3LA 1A3UA 2BOSA 2PQEA 3R93A 2PO4A 5EQ0A 4GKKQ 5M3MG 2VXWA 2B8FA 1VQ4A 1JOOA 5ELFA 4LFAQ 4RA8A 5C0XI 3HOXB 4QMGA 1NJIC 2G9HD 4LFCL 1N33Q 3S1MH 2CH4A 1WTHA 2FHTA 4JI3Q 3NQTA 4LW1A 3E3XA 4V0BA 4GOPC 2RVLA 4JG2A 1BVSA 1LABA 1VDZA 3X3MA 1IBKL 4KK7A 1Y8PB 4BBSB 5L37A 2WINB 4DV0L 2F4IA 1SLJA 1EZ6A 2RHSB 4HCEA 1E3PA 1EY9A 3PO2G 5CV4A 1BR9A 5JEAH 5ELBA 3TRZA 1U4PA 2E8GA 2N88A 3MFGA 3OPOA 2HT1A 2N49A 2JA9A 1OXUA 1QG7A 2AQ1B 1L1OA 3MC0B 2RDHA 4BBRH 3RN2A 1K8AC 4ALPA 1A6XA 1XPUA 5D3IB 1B1ZA 3ULPA 2RF4A 2Z4HA 2OF1A 4A3LG 5LL6X 1MGSA 1SNOA 4RCNA 4R4TA 3NEMA 4DK0A 1MHWC 1SYFA 4JI0Q 2ZXPA 3M4PA 1ILQA 1H9SA 4A3EG 2CW0D 1D7QA 1PTOD 2MO0A 2DY7A 4ZKCB 1JOQA 3S15H 1TR5A 2VW9A 2KBNA 2NWGA 4JI6Q 5D14A 4OWXB 3CAMA 4CJ1B 4LK1C 2O4XA 1KDBA 2R7ZG 1VQMA 4HMJA 5C4XB 4GN4B 3VR5A 4HAEA 5IP9G 1UEAB 4A3IB 1CTMA 4AIMA 3KBGA 3OSOA 4YY3Q 4A3JH 1IYJB 1FD7D 1KD1C 4PV1C 5JAVA 1STAA 3GD7A 4C3HG 5CMDA 1A15A 1PTOH 2DGYA 5ELDA 2UXCL 1NCVA 3H94A 3LX0A 1EYCA 2E2IB 1H9KA 2E76C 2EYLA 1RF2D 4JI2Q 1YJNA 2N3SA 2E75C 5BR8L 1SYGA 3AU7A 2WKCA 4XQNA 5JOBA 4BY7G 5IYDH 4OO1G 3W3AA 5AJ3Q 3CPWA 3BJUA 2MHVA 4ME5A 4JI4L 1YJ9A 5IGGA 1V1OA 3F2BA 3I3CA 2KCMA 2A6EC 4ZKBB 3J7A5 1STBA 5EPJA 1FNUA 3SR1A 1VS0A 2UXBL 2K52A 3F2UA 3K81C 3S17B 1YNXA 1I4RA 1I4HA 2KEDA 1EIHA 1A3VA 1VQPA 4POGA 2C5CA 5GAHC 1QILA 4RGOS 3PO3G 1XNRL 4DR2L 1CKMA 1HJPA 3OW2A 4HIKA 2RHQB 3OIPA 3H3VI 4ZRZA 2NVXH 5JJLA 1EWHA 2N78A 4IPDA 4X3KA 4LWCA 2M9VA 1VMPA 1NAPA 4HSVA 2K5VA 3U58A 1PH7A 1CZWA 1H95A 1IZ6A 2Q8TA 4YCUA 3GTKB 4RKLA 1ONLA 3TZUA 1E22A 1EYAA 3VA5A 1I4GA 1U9RA 1HUMA 2XNAC 2D0PA 2G5DA 3RN5A 3IRBA 1SMXA 1PRTC 1PZJD 1Y1VB 1FNVA 4YWKA 2YU9H 3HOUB 1FGBD 1PDQA 4R4QA 1SYBA 4DR7L 3TS2A 3L9AX 5ELOA 1KRTA 3GO5A 1HR0W 4G4KA 3SVMA 1BF4A 1I50H 4IO9A 1PZID 2SNMA 1B2TA 5M5WB 2R93B 5M3MH 1EQQA 2HCIA 1XNQL 5CGKA 1E0BA 1IBLQ 4A76A 3TN2A 5DNFA 1JE5A 5HURA 5GROA 3Q22A 1NR2A 3CP0A 3U9SA 1F9SA 3A8JE 2ASBA 2F0MA 3L2PA 4R4OA 4X65Q 4OWTB 1RCVD 4KHPL 1CM9A 4S3SA 4KY5A 3M7GA 1X9NA 3PO2H 1R9TH 3NXWA 2A69C 3TP6A 1VQNA 1TWGH 4HJ8A 2L15A 5A2QL 1X54A 3G6JB 1LTSD 2GN5A 3S14B 2JEAI 4DAYB 2WFWA 3I4NB 1SYDA 1VCIA 1ASZA 3HKZB 1CSQA 4A3FB 1YI2A 1G291 3TEHB 1EWIA 4OX9Q 1TWHH 3H3VC 1ENFA 3OTOQ 1MSHA 3BZDB 3OMCA 5E1FA 3VR3A 3HOWG 1SE8A 1Y1WG 3HOVB 1FVIA 2EJGC 4FDBA 3T53B 4A3LH 4PZ7A 1L1OC 2PZWA 3GTMB 3EN2A 2HHHL 1SE3A 4LFCQ 3AQQA 5IE8A 2I46A 3F2DA 1ZYRD 3N6RA 4B3SL 1TWCB 3JAMc 4LF5L 1JE4A 2EOTA 4AH6A 1AH9A 3J7ZC 2A73B 3D4RA 5FLXE 4HIDA 1IBKQ 4A93G 2OEOA 2L4NA 4DV0Q 3CCMA 1T5XD 4C3JG 3T1HL 2YTXA 2R7ZH 4Q5VA 5IP9H 5K5PA 3S1MB 1LT4D 1PH5A 4GZYC 5FLMG 2Z6KA 1QVGA 5T1IA 4OIKA 1STNA 4XYQA 1PRTF 5DM73 1KHIA 4ZUJA 3K8AA 1WTQA 4C3HH 1F9QA 1K8MA 3P75A 1TQOA 5CV6A 2C35B 4OHJA 1HZBA 3NWTA 1BCPD 3L3OC 3M4OH 2PYKA 4C1NI 2NZOA 1WTXA 4MNOA 1L2FA 3BYTB 4DF7A 1W3SA 2I0QA 2F0GA 1H9MA 2KVMA 1STYA 1VF7A 2A74C 4XYOA 3PIOA 1VQDA 1IW7C 1HPCA 3PIP3 4DR5L 4BY7H 4OO1H 5I9OA 3CCSA 4UHVA 1VMCA 5DLQE 3FHWA 1KAAA 2WAQG 4BBRB 3J80c 5C4HA 4A3DG 2VNUD 4K6DA 1ESFA 4EX5A 3R3OA 4CJ0B 3CQZH 3U9OA 4DV7L 2PMZB 2VY3A 4QF4A 3NSWA 4BY1G 1TWAB 1B9MA 2WAQE 4PMWA 1WI5A 1JWUD 4TQUS 4JBKA 3AFQA 5C4ZA 1SYEA 1D6EC 4DU9A 1VQFA 4RHSA 1X3PA 3MEHA 3PO3H 4DV4L 4G7HC 3UDGA 3S15B 3CC7A 1A8VA 3GTPH 3HGBA 1N32L 2UXCQ 2WP8J 5IT9c 5NUCA 3V96A 1VQLA 3AEVA 5KGUA 3A56A 5LMNW 3S1NH 3STBC 4DXFA 1CA6A 4A3JB 3GTOH 2K03A 4DK6C 2Z4IA 2B29A 2JN4A 3A54A 4AYBB 4RH6A 1YNNC 4JI4Q 1UEBA 3VYUA 3URYA 1D5XC 1YZ6A 4NB3A 4N8FA 1LTID 1PTOB 4HR7B 4RAUC 4TRDA 1QB5D 1V1PB 1PXUA 1EQVA 2RBMA 4R8NA 3FVQA 1KLGD 2KECA 2ICEC 3D0FA 3E5SA 2UXBQ 4EQPA 3CXCA 1YNJD 5IOCA 1PFNA 1AP0A 4IUQA 3MZ5A 3VYSA 1VQIA 5KEEA 1ZEQX 1UE6A 1F9RA 1TXYA 1XNRQ 4DR2Q 4LFBL 2LXKA 5C3EG 3TZDA 2BDOA 4KY6A 4OONA 2Q2HA 2BA1A 5KNDA 3I90A 1CA5A 3VR2A 2CH4W 3TP8A 3K7UC 1AE3A 1X65A 3PUZA 1IBML 1ZKOA 1IKMA 1SNQA 4DUYL 1AEXA 2MJ8A 4IJLA 2ZJPA 4EQNA 2JA8G 4DAYA 4LF6L 2F0SA 5KRUA 4HJAA 4JV5L 4DXGA 3J7YW 1TWFH 3GV3A 1EEFD 3QJYA 4WRDA 4APVA 1EU4A 1RKNA 3NPPA 5EKIA 3Q24A 3FP9A 4DR7Q 1CQVA 3C1EA 4O2DA 1PH4A 2XN9C 1Y1WH 4JYAL 3J7AF 5IGEA 1C48A 2AQ2B 1SMYC 3PGZA 4BXXG 1XNQQ 5C0XG 1I6HH 2CWPA 1LM0A 4K8IA 4L5TA 3RD4A 2DNCA 3SXHA 3J7AV 2NUCA 2YU9B 1ENCA 2F0PA 4IALA 2L1BA 4PG3A 1WTRA 4KJNA 4IZ8A 1KAWA 4KKTA 3H91A 1PFMA 1I50B 3SGIA 3S1QH 4KHPQ 4A93H 4ZLTF 4BA2I 5D3DA 1X3GA 3CW2C 1DZ1A 1O7YA 2RDFA 4C3JH 1B8AA 2MNAA 4KKSA 5M3MB 2NBFA 3NHHA 3J81c 3A5ZB 1EIFA 5FLMH 3K80C 3JAMi 4JCVE 3MXGA 3PIPA 2B2VA 1B53A 4HJ5A 4PZ8A 3BVGA 5JVH3 1J5EL 3RZOH 2L0CA 4RCOA 2SOBA 2Y0SG 1SNPA 3K58A 1R9TB 1OXVA 4QUCA 2QCPX 4HEDA 2ZTEA 2CKZB 4K6LA 1NY4A 1TWGB 3VA7A 2MPMA 1RJTA 2F0QA 1Y8NB 1KABA 2HHHQ 1CI3M 3AFPA 3KK7A 3CKIB 4B3SQ 2Y0SE 2DUDA 4LF5Q 4A3DH 1WYDA 3BVMA 1HQRD 1TWHB 3Q6SA 2NB0A 1PH2A 1N9WA 1NMGA 2ZXOA 2MP1A 3T1HQ 3KYHC 5FLXL 3BYYB 3ULLA 1Q82C 4BY1H 3QO2A 5IIFA 3J80i 1KL9A 4DUZL 4L63B 2HDLA 1UWVA 4KV6A 1JQYD 1VQGA 5C44G 1S72A 2AQ3B 2LMCB 3BVZA 2HIXA 1K3RA 1WJJA 2R92H 2CCZA 1MBYA 2R7ZB 4ULLA 1X3EA 4GS3A 3PCOB 4NW2A 4IUPA 4LF7L 5ELCA 3KUPA 2KCTA 2F52A 2MO1A 4LNQA 4LUZA 4ME3A 3AYHB 3GTLH 4DR5Q 2KHSA 5C5LA 2AKWB 3FPUB 3K0YA 1V1PA 1EL0A 3KF6B 1RODA 1FL0A 4C3HB 1XX8A 5I2YA 1CT1D 1WTOA 3F1ZA 3IFTA 1EY4A 5IP7G 3JAME 2RQXA 4JOIA 3M4OB 4DV7Q 3DM3A 3KDFB 1DOKA 1SNDA 5ISRA 1U4RA 2ES2A 5CBEE 4BY7B 5IGDA 5KNBA 1HNXL 4DV4Q 2VQEL 4MHEA 2L9HA 2XTIA 4K5WA 3CQZB 3MHBA 1N32Q 1OTCA 3H0GH 4UPAA 1PLFA 5CORA 3C2PA 2JA8H 4U673 5JPNC 4DNIA 4XIGS 4CDFC 1EY7A 4B3RL 3OIQA 3PO3B 1Q46A 3NK9A 1JR0D 1ESRA 3ONAB 1PMRA 2KHIA 3GTPB 4CKEA 2EYJA 4I65A 4E6IA 2C9OA 3D4WA 4KKUA 5IGBA 1LTLA 1CHPD 2KCNA 3QOLA 2OTJA 4WJWA 2EVBA 1D1KA 3S1NB 2BCOA 3CF5A 4BXXH 3GTOB 5C0XH 1FJGL 2M2LA 3I4OA 2QW7A 3TREA 1ML0D 2A6ED 3K5MA 1K8OA 3K5NA 1ICFB 5ELEA 4QL5A 1Y14B 4LFBQ 1F77A 2SNSA 1JOKA 1EFID 3G4SA 4RHRA 2IX1A 3K7AH 2A6HC 5EGTA 4BS9A 1QUQB 1IBMQ 1EQTA 5CV8A 4P75A 4DUYQ 1LTGD 3CCLA 5EPKA 5IT9E 1WVLA 2WB1E 3V2TA 1KLUD 3DM1A 1II3A 4MTKA 5CBAE 3CMAA 2H1EA 4LF6Q 3E9IA 1EYDA 1SE4A 3D3RA 4JV5Q 3UI2A 3HFZB 1YJWA 3M85A 3NTHA 5LL6S 3RUZA 4I7ZC 4CDEC 5C3XA 4L6TB 2F1MA 1MSGA 3DWAA 1QZHA 1BUVT 4F88A 2AHOB 3D6CA 3SEBA 2F3IA 5F2DA 1GO3E 5E7NA 3J81i 1EEID 1N34L 3RLOA 1K9MC 4JYAQ 4FVMA 1PRTD 2B2VC 4KHVA 1XTCD 3D4DA 2F3WA 1UUPA 3V05A 1OXXK 1TWFB 1JC7A 1GD7A 2KCCA 3SE0A 2R3ZA 1NUCA 2B8GA 1K0SA 4DV5L 2XIWA 2R61A 3DEOA 4YCVA 1J6QA 4L5RC 4J1MA 2NZ1D 4J6HA 1X55A 5AFWA 1Y1WB 2VB3X 2ATWA 1WD0A 1I6HB 2EYHA 3EVQA 1L0XB 4PNYA 3PMFA 3UE1A 4GNXB 4A3MG 3W5OA 1Z47A 4IJHA 4OL7A 1J8IA 5IY0A 3T51B 4UP7A 2A69D 1DGSA 4UDUC 3F8TA 3S1QB 5C44H 3I73A 2V4DA 2F0EA 1J5EQ 4A93B 5K36H 3PIO3 4F7XA 1JJGA 4GKJL 4C3JB 4HTHA 3Q8DA 2D0OA 3T4AC 4FF4A 3SK6A 3GTJH 2PQAB 1SROA 4QIWB 3HOXG 4UP9A 3KF6A 3PUXA 5I9PA 1X32A 3TSSA 5M5XH 1X3QA 2UXDL 1RDPD 3ND9A 1P8LA 3M4YA 4OWWB 2JA7G 1HA5A 2B3GA 2ZM6L 3G71A 2BE5C 2NZHA 2HQEA 4RGNA 3RZOB 3MWYW 4KY7A 2YTYA 2QA4A 3KDFA 5IP7H 2R7DA 3A0JA 1HNWL 3I56A 1PH1A 1Q1EA 1Q12A 4ZK9B 2CW0C 1VF5C 2BH2A 1PTOC 2LFNA 2NVQH 1KDAA 4QY7A 5GQOA 2B39A 2LS01 3KLRA 4JOIC 2WAQB 3DUZA 4DUZQ 1B70B 4A3DB 2PI2A 3WWVA 3HOYG 1FR3A 4QGUA 3D8GA 1UNSA 1IXRA 1OO9B 2L12A 4V190 1V43A 1S5CD 2X6GA 4BY1B 2D9UA 1YEZA 4LF7Q 5CYUA 1SFOH 5J1ZA 5C0XJ 3QG1A 2D62A 1PH3A 1NBWA 1CKNB 1G2TA 1LUZA 3B6YA 4A3BG 1VQBA 2AUKA 3FPPA 4B08A 1WCMG 2A68C 1JMCA 2R92B 4N9PA 4JBWA 5M5YH 3JAML 1ET6A 3W1BA 1YBYA 1KC8C 2J7ZA 2PNHA 2KQ3A 2F0OA 1PVOA 3GTLB 3K0XA 5BN5A 2LXJA 5T1GA 3S2HH 3I55A 1HNXQ 1GKHA 2VQEQ 1I4XA 1QUQA 3OOCA 3G6EA 5HY6A 4HMIA 5GAGC 4P71A 4RFBA 1E2VA 4IQZA 5FO8B 3PUVA 4DKAC 2FMCA 3S2DH 2TSSA 5IYCG 1K73C 4A3EH 1DXMA 4HN7A 1B4OA 1LO5D 2HQLA 4JBMA 2I5LX 4B3RQ 1JCKB 4H0LC 3GTQH 2GVBA 3ER0A 3CD6A 3H15A 3STBD 1VQAA 1EWCA 3MXPA 2OT2A 3H0GB 4HJ7A 1SAPA 2CQOA 2JQOA 4FYDA 2BH8A 1E1OA 1Q3LA 2R6GA 1YNND 2JA8B 1PTOF 3NE5B 2Q2IA 1FJGQ 4P72A 1LT3D 3VYTA 4L5QA 1A0IA 2F03A 1I4PA 4PZ6A 1BQQT 1J9OA 1U4MA 3I70A 1AN8A 2WACA 2D5DA 3M9BA 1BXTA 2FMMA 4JW0A 1MI2A 1PYSB 3I7FA 1KNEA 2XRQD 1EY6A 2HDMA 1Q8KA 4OEMB 4GNXA 1FNWA 1B44D 1CSPA 2NVYH 4QQBX 4MN3A 5IT9L 4A3MH 3ICEA 3DMUA 5EKLA 1HTLD 1EFWA 1YHQA 4ZYSA 2F0HA 1LT6D 1U0LA 1EY8A 2ZT9C 3A8IE 4IFDI 1Y1VG 4NDXA 1AZPA 5FJ8G 3K59A 3K7AB 2OTLA 3NWSA 1Q8IA 3P20A 1N34Q 4LF4L 1GXDC 2PQAA 3I91A 5IGFA 1M4VA 2WIIB 5EAYA 4DR1L 1F2YA 4WORA 2UU9L 3X3NA 2R93G 3PUYA 4IUNA 4WJ3M 2RSOA 4WFN3 1DOMA 3RZDH 4DR4L 1STGA 5C5MA 4JK1C 1ASYA 3CCUA 2O5JC 2KJXA 1HFNA 4DR3L 1JJCB 4B3TL 2JA7H 4K2LA 5EBDA 4DV5Q 2K5DA 1T9HA 3T56B 4X3UA 4TSSA 1VQCA 2V1CC 2F0FA 2IX0A 5BR8Q 1ZYRC 5FKAC 3WOEA 2E2JH 1RD9D 1XWEA 2B2WA 2EJMA 1UE5A 3P1HA 2VQFL 4LJZC 2K01A 2NN6I 2UUCL
chains in the Genus database with same CATH topology
3T1HQ 3KYHC 4A3IG 2H5XA 3ULLA 1Q82C 3S15H 2VW9A 3A5UA 3OYYA 5IYBH 4BY1H 4H02A 2KBNA 4GOPB 2OCEA 3HOZG 3HOYH 1CUKA 4JI6Q 3EIVA 4A3CH 1N8RC 4OWXB 3CAMA 3J80i 1KL9A 4A3FG 2R7ZG 4P74A 4A3KG 1VQMA 4DUZL 4GKJQ 4GN4B 5IP9G 1O7IA 1UWVA 3MEFA 3HOVG 4AIMA 4YY3Q 4X66L 1VQGA 5C44G 1S72A 4A3JH 1I94Q 1JT8A 1IYJB 2HIXA 1CKNA 1PHJA 1KD1C 1K3RA 1M90C 1WJJA 2R92H 2CCZA 3UDIA 4P73A 1X3EA 3HKZE 3GD7A 4GS3A 4O0AA 2UXDQ 1YIJA 3PCOB 4LF7L 1X6OA 2ZM6Q 4A3BH 2I5HA 1SN8A 2F52A 1NMFA 2DGYA 2KCTA 2MO1A 4LUZA 4ME3A 4DAMA 4R4CA 1N36L 2UXCL 1WCMH 1HR0Q 3AYHB 1VQKA 2UUAQ 1HNWQ 3GTLH 4YWMA 1BKBA 4DR5Q 2OQKA 2K5HA 2AKWB 3S16H 1S40A 1G6PA 2A1AA 3NBHB 3KF6B 4JI2Q 1FL0A 1YJNA 2N3SA 5BR8L 3F1ZA 3S24A 3PF4A 4HJ9A 5IP7G 4R1JA 1K0RA 4JOIA 4BY7G 5IYDH 4B3MQ 1XMQL 4OO1G 5AJ3Q 3CPWA 3BJUA 4DV7Q 4JI4L 2IY5B 3DM3A 3KDFB 1YJ9A 2K14A 1YITA 1RL2A 1X56A 3F2BA 3HOWH 2KCMA 2UUBQ 3J7A5 5JJKA 2ES2A 1EUJA 4OO1I 3KJOA 4DV3L 4HIOA 2B63H 1VS0A 2JK8A 2UXBL 3CCEA 2K52A 3K81C 2EIFA 1HNXL 2JA6G 5IYCH 1YNXA 4DV4Q 2VQEL 2YTVA 4IPHA 5H1SE 2XTIA 3NENA 4QJFA 3FKIG 3ULJA 4IPGA 4LUOA 1VQPA 4POGA 4NXML 1N32Q 5GAHC 1OTCA 4JI5L 3H0GH 3PO3G 4WJ4A 1XNRL 4UPAA 4DR2L 1CKMA 1HJPA 3OW2A 2OWOA 4HIKA 1XMOL 2RHQB 3H3VI 2NVXH 4GN5A 2JA8H 5JJLA 2N78A 4IPDA 3E9HA 3RLFA 5M3FG 4QIWE 4DNIA 2KENA 4LWCA 4XIGS 3U50C 2F4VQ 4DV6Q 1PH7A 2K5VA 3U58A 3S1RH 1JB7A 1SRUA 4LUVA 3GTGH 1H95A 2GVAA 4B3RL 3PUWA 1Q46A 3BZKA 1IZ6A 3HOUG 3KLWA 4YCUA 4YHHQ 4LF9Q 2KHIA 1E22A 4DV1L 2JEBI 4UP8A 2Z0SA 1Q86C 2D0PA 1LTLA 4DK3C 3J81j 1G51A 3IRBA 3RN5A 2NVTH 1AE2A 1SMXA 4NXNQ 2OTJA 2ID0A 4YWKA 3F2CA 2YU9H 4R4QA 4X64L 3HOXH 2K5NA 3LGJA 4EQ5A 1EQRA 3CF5A 5ELOA 1KRTA 1FJGL 2K75A 3GO5A 2CWAA 1HR0W 3I4OA 5IWAL 1I3QH 1I50H 3VDYA 4IO9A 3TREA 4L5SA 4DR6Q 1MKHA 2PMZE 4YCWA 4JC0A 4QL5A 1Y14B 5M3MH 1W2BA 3ZJYC 1EQQA 1XNQL 4LFBQ 2E5LL 1HNZL 1IBLQ 4JI1L 4A76A 1VQHA 4JI8L 4POFA 2VS1A 4BBSH 1JE5A 3G4SA 4LF8Q 1B7YB 1VQ9A 3K7AH 5GROA 3RLNA 3CCRA 2Q2UA 1QUQB 1IBMQ 4GKKL 1VQ5A 1LYLA 4C2MH 4KLKA 4P75A 3CP0A 4DUYQ 1K8GA 4LFAL 1EOVA 3JC66 3CCLA 2ASBA 2R92G 1VQOA 3L2PA 1D8LA 2WB1E 4R4OA 3EBEA 3CMAA 2YYZA 4X65Q 4OWTB 4GNXC 3GDEA 1Q1BA 1SR3A 3E9IA 4DPGA 3T1YQ 4AYBG 1N33L 4KHPL 4JI3L 1YHAA 2Q2TA 2IX1A 3I4NG 4JV5Q 1RIPA 3PF5A 1PH8A 3HFZB 4AQYQ 1YJWA 1X9NA 3M85A 2JA5G 1XTDA 1R9TH 3PO2H 3HKZG 1E1TA 2QEXA 1NE3A 1VQNA 4X62Q 1TWGH 4HJ8A 1QZHA 2L15A 2N8NA 1X54A 2AHOB 4IFDJ 1K83H 1HZ9A 2F3IA 2GN5A 2JEAI 4DAYB 1CKOA 3DLLA 2WFWA 5GADC 1GO3E 4AYBE 2R7FA 5E7NA 2IT1A 3J81i 1VCIA 2AMCB 1N34L 1V1QA 3RLOA 1ASZA 3G48A 1K9MC 3D31A 4JYAQ 5IYDG 3I4MG 1CSQA 4DV2L 1YI2A 1G291 3TEHB 1EWIA 1X3FA 1Q7YC 2E2HH 4OX9Q 1TWHH 4YWLA 3OTOQ 1UE7A 1OXXK 1GD7A 3HOWG 1SE8A 3E0EA 1Y1WG 2VZAA 1FVIA 3M3YH 4FDBA 4A75A 5GAEC 4A3LH 4PZ7A 1L1OC 4DV5L 2K50A 1MJEA 1HZCA 3EN2A 1PH9A 2HHHL 2CFMA 4LFCQ 3AQQA 4YCVA 5IE8A 3F2DA 3KF8B 3TQYA 1J6QA 1P16A 4B3SL 4L5RC 1X55A 4GOPA 2A19A 1YVCA 5C4XH 1VQJA 3JAMc 2ATWA 4LF5L 4JI0L 4A3IH 4AH6A 1AH9A 3H0GG 3UE0A 3J7ZC 3U4ZA 4HIDA 1IBKQ 4GN3B 1S3OA 4A93G 4A3MG 4GNXB 3UE1A 1WOCA 5FLXc 4DV0Q 3HOZH 3CCMA 5ELNA 3W5OA 3T1HL 2IHFA 1Z47A 2YTXA 4IJHA 4A3FH 1C9OA 2R7ZH 4DR7L 4A3KH 2ZTCA 5IY0A 3TS2A 4KI0A 4UP7A 5IP9H 4LF4Q 2LSSA 1DGSA 1WFQA 3F8TA 3HOVH 4DR1Q 4JI6L 2UU9Q 5C44H 1PH5A 5LMNQ 5FLMG 2Z6KA 4NPSA 1QVGA 1J5EQ 1JJGA 5C3EH 5JEAG 4GKJL 4DR4Q 2E2IH 3Q8DA 1KHIA 2D0OA 4MZ9A 3K8AA 4R4IA 4DR3Q 4YY3L 4B3TQ 4C3HH 1I94L 3NELA 3ERSX 2C35B 3GTJH 2PQAB 1HZBA 1SROA 5HGQA 4A4IA 2EXDA 3HOXG 4UP9A 3KF6A 3PUXA 3M4OH 1V9PA 4TVAB 5M5XH 2UXDL 2NZOA 4MNOA 1P8LA 1L2FA 4BBRG 4IOAA 4OWWB 2JA7G 1W3SA 2AWNA 1M1KC 2I0QA 4OXPA 2B3GA 2OQ0A 2ZM6L 3G71A 1L1OB 2NZHA 2K4KA 2RCNA 3CC4A 3PIOA 5LMUQ 2QA4A 2YTYA 1VQDA 3KDFA 1HR0L 5IP7H 2UUAL 2I5MX 2R7DA 3A0JA 1HNWL 3I56A 1PH1A 2VQFQ 1Q1EA 1Q12A 5C4JH 4DR5L 2ZJQA 3CCSA 4BY7H 5DLQE 2ALYB 2WAQG 1FGUA 3FHWA 2UUCQ 4JI7Q 4A3GG 3J80c 4K0KQ 4JI2L 2BH2A 3S17H 4A3DG 2VNUD 1PFSA 3L7ZC 1YHBA 1C0AA 3PSIA 2NVQH 4B3ML 4EX5A 4QY7A 5GQOA 5AJ3L 2VUMG 3CQZH 4JOIC 4DV7L 3RNUA 4RG1A 1HZAA 2VY3A 4DUZQ 1B70B 1QVCA 1Z9FA 4BY1G 5IYBG 2PI2A 2ZTDA 3WWVA 2WAQE 4PMWA 4Y7NH 2JA6H 1WI5A 2WB1G 4TQUS 2UUBL 3HOYG 4X66Q 3AFQA 4JBKA 4A3CG 4QGUA 1L0WA 3FKIH 2HIVA 1JJ2A 1VQFA 1IXRA 3HKSA 3PO3H 3PV0A 4DV4L 1V43A 3CCQA 3UDGA 3GTKH 3A74A 4IOCA 3CC7A 1MJCA 3MXNB 1A8VA 1YEZA 2Z6KC 4A3JG 4LF7Q 1SFOH 3GTPH 3CMEA 1IL2A 5C0XJ 5M3FH 1A63A 1N32L 1N36Q 2IHEA 2UXCQ 2WP8J 5IT9c 2D62A 1PH3A 2JJQA 2MQHA 1XPRA 1BBUA 1NBWA 1CKNB 3UDFA 2ZJRA 1LUZA 1Y1VH 3B6YA 1VQLA 3AEVA 5J3BA 3HOUH 5FJ8H 3UDXA 4A3BG 3S1NH 2QGQA 5LMNW 3STBC 2F4VL 1VQBA 3GTOH 1E7ZA 4DK6C 4DV6L 1WCMG 1JMCA 2B29A 1XMQQ 1TWAH 4JBWA 5M5YH 5M5WH 4YHHL 4JI4Q 2EQSA 4LF6Q 1UEBA 4LF9L 2R93H 3W1BA 1YBYA 4NB3A 1YZ6A 1KC8C 3CCJA 1I5FA 2PNHA 1UE1A 3KOJA 4GLVB 1PVOA 4IPCA 3K0XA 3KFUA 4NXNL 4DV3Q 2LXJA 3D0FA 3S2HH 2UXBQ 4C3IH 3I55A 4XTCS 1HNXQ 1Q81C 1VQ8A 1GKHA 4RMFA 2VQEQ 1EIYB 2XGTA 3CXCA 1QUQA 1NTGA 4DR6L 3G6EA 5HY6A 5GAGC 4P71A 2B63G 2BA0A 4NXMQ 1VQIA 3PUVA 1UE6A 4DKAC 4JI5Q 3S2DH 1TXYA 5IYCG 1XNRQ 4DR2Q 1K73C 5K36G 4LFBL 2KHJA 4A3EH 1QZGA 2VL6A 1XMOQ 1IBLL 2LXKA 4KHZA 5C3EG 4OONA 2Q2HA 2BA1A 4JBJA 3S14H 4LF8L 3CCVA 1U5KA 3K7UC 1AE3A 1X65A 3L0OA 3PUZA 3U4VA 1IBML 3I4NH 4Y52H 2HQLA 2YV5A 4DUYL 3TS0A 2I5LX 4JBMA 1PA6A 1KRSA 4B3RQ 4IJLA 2JA5H 2ZJPA 1KIXA 2FXQA 2JA8G 2GVBA 4LF6L 3GTQH 4X65L 4HIMA 3ER0A 3T1YL 4K0KL 3KJPA 4DV1Q 3CD6A 3M7NA 1VQ7A 1OXTA 3H15A 4HJAA 3STBD 1VQAA 4JV5L 4X6AH 2JE6I 5JJIA 1TWFH 4AQYL 4HJ7A 2CQOA 1XJVA 2JQOA 2A8VA 2BH8A 1E1OA 1PV4A 4J15A 4APVA 4X62L 2R6GA 1A62A 3I4MH 4UY8C 4X64Q 2Q2IA 1C7YA 3FP9A 3GTMH 4DR7Q 1FJGQ 4P72A 4L5QA 1A0IA 3W1GA 5IWAQ 4MTNA 4PZ6A 4O2DA 1PH4A 1HH2P 1Y1WH 4JYAL 1TWCH 3M9BA 3PGZA 1VQ6A 1XNQQ 5C0XG 4BXXG 1I6HH 4OX9L 2E5LQ 2CWPA 1LM0A 3M4QA 3OTOL 4L5TA 1HNZQ 1OXSC 4JI1Q 3BZCA 1PYSB 4JI8Q 3I7FA 4GKKQ 5M3MG 1QVFA 1Q8KA 1VQ4A 4LFAQ 4GNXA 5C0XI 4PG3A 1E24A 1KXLA 1NJIC 1KAWA 4LFCL 2PI2E 4BBSG 4GLXA 1CSPA 1N33Q 2NVYH 3SGIA 3S1MH 3S1QH 4IFDG 4KHPQ 4BXXH 4A93H 4JI3Q 4BA2I 4A3MH 2MFIA 3ICEA 4QQBX 1X3GA 3CW2C 4LW1A 4C3JH 1B8AA 1GVPA 2MNAA 1KQSA 1EFWA 1YHQA 4GOPC 4JG2A 3RR5A 3CPFA 3J81c 1BVSA 3A5ZB 1U0LA 1IBKL 4IFDI 1Y1VG 2AWOA 4DV0L 3BU2A 1SLJA 1EIFA 5FJ8G 2RHSB 5FLMH 1E3PA 3K80C 4JCVE 3JAMi 2OTLA 3H3VH 3PO2G 3PIPA 1N34Q 4LF4L 3TRZA 2PQAA 2E8GA 4HJ5A 4GLAC 5EAYA 4DV2Q 4DR1L 4PZ8A 4BA1I 2UU9L 5LMNL 2R93G 3PUYA 1J5EL 3RZOH 2HT1A 4WJ3M 2N49A 2JA9A 2Y0SG 1OXUA 3RZDH 4DR4L 1L1OA 1ASYA 1VQEA 1MIUA 1OXVA 3CCUA 4DR3L 1JJCB 2CKZB 2ZTEA 4BBRH 1NY4A 3I2ZA 3RN2A 1K8AC 4ALPA 4B3TL 2JA7H 4DV5Q 1GM5A 1T9HA 1XPUA 2HHHQ 3ULPA 2RF4A 3AFPA 1VQCA 2V1CC 3CC2A 2IX0A 2NN6G 5JEAJ 4A3LG 4B3SQ 5BR8Q 1PH6A 2Y0SE 2DUDA 4R4TA 3NEMA 4A3GH 2E2JH 1BBWA 4LNQA 4LF5Q 4JI0Q 4A3DH 3M4PA 1XPOA 1WYDA 1UE5A 5LMUL 1PH2A 4A3EG 1N9WA 1NMGA 1PYBA 2VQFL 1D7QA 2NN6I 2VUMH 2UUCL 4JI7L 5C4XG 2MO0A 1EYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H Q;  3KYH C;  4A3I G;  2H5X A;  3ULL A;  1Q82 C;  3S15 H;  2VW9 A;  3A5U A;  3OYY A;  5IYB H;  4BY1 H;  4H02 A;  2KBN A;  4GOP B;  2OCE A;  3HOZ G;  3HOY H;  1CUK A;  4JI6 Q;  3EIV A;  4A3C H;  1N8R C;  4OWX B;  3CAM A;  3J80 i;  1KL9 A;  4A3F G;  2R7Z G;  4P74 A;  4A3K G;  1VQM A;  4DUZ L;  4GKJ Q;  4GN4 B;  5IP9 G;  1O7I A;  1UWV A;  3MEF A;  3HOV G;  4AIM A;  4YY3 Q;  4X66 L;  1VQG A;  5C44 G;  1S72 A;  4A3J H;  1I94 Q;  1JT8 A;  1IYJ B;  2HIX A;  1CKN A;  1PHJ A;  1KD1 C;  1K3R A;  1M90 C;  1WJJ A;  2R92 H;  2CCZ A;  3UDI A;  4P73 A;  1X3E A;  3HKZ E;  3GD7 A;  4GS3 A;  4O0A A;  2UXD Q;  1YIJ A;  3PCO B;  4LF7 L;  1X6O A;  2ZM6 Q;  4A3B H;  2I5H A;  1SN8 A;  2F52 A;  1NMF A;  2DGY A;  2KCT A;  2MO1 A;  4LUZ A;  4ME3 A;  4DAM A;  4R4C A;  1N36 L;  2UXC L;  1WCM H;  1HR0 Q;  3AYH B;  1VQK A;  2UUA Q;  1HNW Q;  3GTL H;  4YWM A;  1BKB A;  4DR5 Q;  2OQK A;  2K5H A;  2AKW B;  3S16 H;  1S40 A;  1G6P A;  2A1A A;  3NBH B;  3KF6 B;  4JI2 Q;  1FL0 A;  1YJN A;  2N3S A;  5BR8 L;  3F1Z A;  3S24 A;  3PF4 A;  4HJ9 A;  5IP7 G;  4R1J A;  1K0R A;  4JOI A;  4BY7 G;  5IYD H;  4B3M Q;  1XMQ L;  4OO1 G;  5AJ3 Q;  3CPW A;  3BJU A;  4DV7 Q;  4JI4 L;  2IY5 B;  3DM3 A;  3KDF B;  1YJ9 A;  2K14 A;  1YIT A;  1RL2 A;  1X56 A;  3F2B A;  3HOW H;  2KCM A;  2UUB Q;  3J7A 5;  5JJK A;  2ES2 A;  1EUJ A;  4OO1 I;  3KJO A;  4DV3 L;  4HIO A;  2B63 H;  1VS0 A;  2JK8 A;  2UXB L;  3CCE A;  2K52 A;  3K81 C;  2EIF A;  1HNX L;  2JA6 G;  5IYC H;  1YNX A;  4DV4 Q;  2VQE L;  2YTV A;  4IPH A;  5H1S E;  2XTI A;  3NEN A;  4QJF A;  3FKI G;  3ULJ A;  4IPG A;  4LUO A;  1VQP A;  4POG A;  4NXM L;  1N32 Q;  5GAH C;  1OTC A;  4JI5 L;  3H0G H;  3PO3 G;  4WJ4 A;  1XNR L;  4UPA A;  4DR2 L;  1CKM A;  1HJP A;  3OW2 A;  2OWO A;  4HIK A;  1XMO L;  2RHQ B;  3H3V I;  2NVX H;  4GN5 A;  2JA8 H;  5JJL A;  2N78 A;  4IPD A;  3E9H A;  3RLF A;  5M3F G;  4QIW E;  4DNI A;  2KEN A;  4LWC A;  4XIG S;  3U50 C;  2F4V Q;  4DV6 Q;  1PH7 A;  2K5V A;  3U58 A;  3S1R H;  1JB7 A;  1SRU A;  4LUV A;  3GTG H;  1H95 A;  2GVA A;  4B3R L;  3PUW A;  1Q46 A;  3BZK A;  1IZ6 A;  3HOU G;  3KLW A;  4YCU A;  4YHH Q;  4LF9 Q;  2KHI A;  1E22 A;  4DV1 L;  2JEB I;  4UP8 A;  2Z0S A;  1Q86 C;  2D0P A;  1LTL A;  4DK3 C;  3J81 j;  1G51 A;  3IRB A;  3RN5 A;  2NVT H;  1AE2 A;  1SMX A;  4NXN Q;  2OTJ A;  2ID0 A;  4YWK A;  3F2C A;  2YU9 H;  4R4Q A;  4X64 L;  3HOX H;  2K5N A;  3LGJ A;  4EQ5 A;  1EQR A;  3CF5 A;  5ELO A;  1KRT A;  1FJG L;  2K75 A;  3GO5 A;  2CWA A;  1HR0 W;  3I4O A;  5IWA L;  1I3Q H;  1I50 H;  3VDY A;  4IO9 A;  3TRE A;  4L5S A;  4DR6 Q;  1MKH A;  2PMZ E;  4YCW A;  4JC0 A;  4QL5 A;  1Y14 B;  5M3M H;  1W2B A;  3ZJY C;  1EQQ A;  1XNQ L;  4LFB Q;  2E5L L;  1HNZ L;  1IBL Q;  4JI1 L;  4A76 A;  1VQH A;  4JI8 L;  4POF A;  2VS1 A;  4BBS H;  1JE5 A;  3G4S A;  4LF8 Q;  1B7Y B;  1VQ9 A;  3K7A H;  5GRO A;  3RLN A;  3CCR A;  2Q2U A;  1QUQ B;  1IBM Q;  4GKK L;  1VQ5 A;  1LYL A;  4C2M H;  4KLK A;  4P75 A;  3CP0 A;  4DUY Q;  1K8G A;  4LFA L;  1EOV A;  3JC6 6;  3CCL A;  2ASB A;  2R92 G;  1VQO A;  3L2P A;  1D8L A;  2WB1 E;  4R4O A;  3EBE A;  3CMA A;  2YYZ A;  4X65 Q;  4OWT B;  4GNX C;  3GDE A;  1Q1B A;  1SR3 A;  3E9I A;  4DPG A;  3T1Y Q;  4AYB G;  1N33 L;  4KHP L;  4JI3 L;  1YHA A;  2Q2T A;  2IX1 A;  3I4N G;  4JV5 Q;  1RIP A;  3PF5 A;  1PH8 A;  3HFZ B;  4AQY Q;  1YJW A;  1X9N A;  3M85 A;  2JA5 G;  1XTD A;  1R9T H;  3PO2 H;  3HKZ G;  1E1T A;  2QEX A;  1NE3 A;  1VQN A;  4X62 Q;  1TWG H;  4HJ8 A;  1QZH A;  2L15 A;  2N8N A;  1X54 A;  2AHO B;  4IFD J;  1K83 H;  1HZ9 A;  2F3I A;  2GN5 A;  2JEA I;  4DAY B;  1CKO A;  3DLL A;  2WFW A;  5GAD C;  1GO3 E;  4AYB E;  2R7F A;  5E7N A;  2IT1 A;  3J81 i;  1VCI A;  2AMC B;  1N34 L;  1V1Q A;  3RLO A;  1ASZ A;  3G48 A;  1K9M C;  3D31 A;  4JYA Q;  5IYD G;  3I4M G;  1CSQ A;  4DV2 L;  1YI2 A;  1G29 1;  3TEH B;  1EWI A;  1X3F A;  1Q7Y C;  2E2H H;  4OX9 Q;  1TWH H;  4YWL A;  3OTO Q;  1UE7 A;  1OXX K;  1GD7 A;  3HOW G;  1SE8 A;  3E0E A;  1Y1W G;  2VZA A;  1FVI A;  3M3Y H;  4FDB A;  4A75 A;  5GAE C;  4A3L H;  4PZ7 A;  1L1O C;  4DV5 L;  2K50 A;  1MJE A;  1HZC A;  3EN2 A;  1PH9 A;  2HHH L;  2CFM A;  4LFC Q;  3AQQ A;  4YCV A;  5IE8 A;  3F2D A;  3KF8 B;  3TQY A;  1J6Q A;  1P16 A;  4B3S L;  4L5R C;  1X55 A;  4GOP A;  2A19 A;  1YVC A;  5C4X H;  1VQJ A;  3JAM c;  2ATW A;  4LF5 L;  4JI0 L;  4A3I H;  4AH6 A;  1AH9 A;  3H0G G;  3UE0 A;  3J7Z C;  3U4Z A;  4HID A;  1IBK Q;  4GN3 B;  1S3O A;  4A93 G;  4A3M G;  4GNX B;  3UE1 A;  1WOC A;  5FLX c;  4DV0 Q;  3HOZ H;  3CCM A;  5ELN A;  3W5O A;  3T1H L;  2IHF A;  1Z47 A;  2YTX A;  4IJH A;  4A3F H;  1C9O A;  2R7Z H;  4DR7 L;  4A3K H;  2ZTC A;  5IY0 A;  3TS2 A;  4KI0 A;  4UP7 A;  5IP9 H;  4LF4 Q;  2LSS A;  1DGS A;  1WFQ A;  3F8T A;  3HOV H;  4DR1 Q;  4JI6 L;  2UU9 Q;  5C44 H;  1PH5 A;  5LMN Q;  5FLM G;  2Z6K A;  4NPS A;  1QVG A;  1J5E Q;  1JJG A;  5C3E H;  5JEA G;  4GKJ L;  4DR4 Q;  2E2I H;  3Q8D A;  1KHI A;  2D0O A;  4MZ9 A;  3K8A A;  4R4I A;  4DR3 Q;  4YY3 L;  4B3T Q;  4C3H H;  1I94 L;  3NEL A;  3ERS X;  2C35 B;  3GTJ H;  2PQA B;  1HZB A;  1SRO A;  5HGQ A;  4A4I A;  2EXD A;  3HOX G;  4UP9 A;  3KF6 A;  3PUX A;  3M4O H;  1V9P A;  4TVA B;  5M5X H;  2UXD L;  2NZO A;  4MNO A;  1P8L A;  1L2F A;  4BBR G;  4IOA A;  4OWW B;  2JA7 G;  1W3S A;  2AWN A;  1M1K C;  2I0Q A;  4OXP A;  2B3G A;  2OQ0 A;  2ZM6 L;  3G71 A;  1L1O B;  2NZH A;  2K4K A;  2RCN A;  3CC4 A;  3PIO A;  5LMU Q;  2QA4 A;  2YTY A;  1VQD A;  3KDF A;  1HR0 L;  5IP7 H;  2UUA L;  2I5M X;  2R7D A;  3A0J A;  1HNW L;  3I56 A;  1PH1 A;  2VQF Q;  1Q1E A;  1Q12 A;  5C4J H;  4DR5 L;  2ZJQ A;  3CCS A;  4BY7 H;  5DLQ E;  2ALY B;  2WAQ G;  1FGU A;  3FHW A;  2UUC Q;  4JI7 Q;  4A3G G;  3J80 c;  4K0K Q;  4JI2 L;  2BH2 A;  3S17 H;  4A3D G;  2VNU D;  1PFS A;  3L7Z C;  1YHB A;  1C0A A;  3PSI A;  2NVQ H;  4B3M L;  4EX5 A;  4QY7 A;  5GQO A;  5AJ3 L;  2VUM G;  3CQZ H;  4JOI C;  4DV7 L;  3RNU A;  4RG1 A;  1HZA A;  2VY3 A;  4DUZ Q;  1B70 B;  1QVC A;  1Z9F A;  4BY1 G;  5IYB G;  2PI2 A;  2ZTD A;  3WWV A;  2WAQ E;  4PMW A;  4Y7N H;  2JA6 H;  1WI5 A;  2WB1 G;  4TQU S;  2UUB L;  3HOY G;  4X66 Q;  3AFQ A;  4JBK A;  4A3C G;  4QGU A;  1L0W A;  3FKI H;  2HIV A;  1JJ2 A;  1VQF A;  1IXR A;  3HKS A;  3PO3 H;  3PV0 A;  4DV4 L;  1V43 A;  3CCQ A;  3UDG A;  3GTK H;  3A74 A;  4IOC A;  3CC7 A;  1MJC A;  3MXN B;  1A8V A;  1YEZ A;  2Z6K C;  4A3J G;  4LF7 Q;  1SFO H;  3GTP H;  3CME A;  1IL2 A;  5C0X J;  5M3F H;  1A63 A;  1N32 L;  1N36 Q;  2IHE A;  2UXC Q;  2WP8 J;  5IT9 c;  2D62 A;  1PH3 A;  2JJQ A;  2MQH A;  1XPR A;  1BBU A;  1NBW A;  1CKN B;  3UDF A;  2ZJR A;  1LUZ A;  1Y1V H;  3B6Y A;  1VQL A;  3AEV A;  5J3B A;  3HOU H;  5FJ8 H;  3UDX A;  4A3B G;  3S1N H;  2QGQ A;  5LMN W;  3STB C;  2F4V L;  1VQB A;  3GTO H;  1E7Z A;  4DK6 C;  4DV6 L;  1WCM G;  1JMC A;  2B29 A;  1XMQ Q;  1TWA H;  4JBW A;  5M5Y H;  5M5W H;  4YHH L;  4JI4 Q;  2EQS A;  4LF6 Q;  1UEB A;  4LF9 L;  2R93 H;  3W1B A;  1YBY A;  4NB3 A;  1YZ6 A;  1KC8 C;  3CCJ A;  1I5F A;  2PNH A;  1UE1 A;  3KOJ A;  4GLV B;  1PVO A;  4IPC A;  3K0X A;  3KFU A;  4NXN L;  4DV3 Q;  2LXJ A;  3D0F A;  3S2H H;  2UXB Q;  4C3I H;  3I55 A;  4XTC S;  1HNX Q;  1Q81 C;  1VQ8 A;  1GKH A;  4RMF A;  2VQE Q;  1EIY B;  2XGT A;  3CXC A;  1QUQ A;  1NTG A;  4DR6 L;  3G6E A;  5HY6 A;  5GAG C;  4P71 A;  2B63 G;  2BA0 A;  4NXM Q;  1VQI A;  3PUV A;  1UE6 A;  4DKA C;  4JI5 Q;  3S2D H;  1TXY A;  5IYC G;  1XNR Q;  4DR2 Q;  1K73 C;  5K36 G;  4LFB L;  2KHJ A;  4A3E H;  1QZG A;  2VL6 A;  1XMO Q;  1IBL L;  2LXK A;  4KHZ A;  5C3E G;  4OON A;  2Q2H A;  2BA1 A;  4JBJ A;  3S14 H;  4LF8 L;  3CCV A;  1U5K A;  3K7U C;  1AE3 A;  1X65 A;  3L0O A;  3PUZ A;  3U4V A;  1IBM L;  3I4N H;  4Y52 H;  2HQL A;  2YV5 A;  4DUY L;  3TS0 A;  2I5L X;  4JBM A;  1PA6 A;  1KRS A;  4B3R Q;  4IJL A;  2JA5 H;  2ZJP A;  1KIX A;  2FXQ A;  2JA8 G;  2GVB A;  4LF6 L;  3GTQ H;  4X65 L;  4HIM A;  3ER0 A;  3T1Y L;  4K0K L;  3KJP A;  4DV1 Q;  3CD6 A;  3M7N A;  1VQ7 A;  1OXT A;  3H15 A;  4HJA A;  3STB D;  1VQA A;  4JV5 L;  4X6A H;  2JE6 I;  5JJI A;  1TWF H;  4AQY L;  4HJ7 A;  2CQO A;  1XJV A;  2JQO A;  2A8V A;  2BH8 A;  1E1O A;  1PV4 A;  4J15 A;  4APV A;  4X62 L;  2R6G A;  1A62 A;  3I4M H;  4UY8 C;  4X64 Q;  2Q2I A;  1C7Y A;  3FP9 A;  3GTM H;  4DR7 Q;  1FJG Q;  4P72 A;  4L5Q A;  1A0I A;  3W1G A;  5IWA Q;  4MTN A;  4PZ6 A;  4O2D A;  1PH4 A;  1HH2 P;  1Y1W H;  4JYA L;  1TWC H;  3M9B A;  3PGZ A;  1VQ6 A;  1XNQ Q;  5C0X G;  4BXX G;  1I6H H;  4OX9 L;  2E5L Q;  2CWP A;  1LM0 A;  3M4Q A;  3OTO L;  4L5T A;  1HNZ Q;  1OXS C;  4JI1 Q;  3BZC A;  1PYS B;  4JI8 Q;  3I7F A;  4GKK Q;  5M3M G;  1QVF A;  1Q8K A;  1VQ4 A;  4LFA Q;  4GNX A;  5C0X I;  4PG3 A;  1E24 A;  1KXL A;  1NJI C;  1KAW A;  4LFC L;  2PI2 E;  4BBS G;  4GLX A;  1CSP A;  1N33 Q;  2NVY H;  3SGI A;  3S1M H;  3S1Q H;  4IFD G;  4KHP Q;  4BXX H;  4A93 H;  4JI3 Q;  4BA2 I;  4A3M H;  2MFI A;  3ICE A;  4QQB X;  1X3G A;  3CW2 C;  4LW1 A;  4C3J H;  1B8A A;  1GVP A;  2MNA A;  1KQS A;  1EFW A;  1YHQ A;  4GOP C;  4JG2 A;  3RR5 A;  3CPF A;  3J81 c;  1BVS A;  3A5Z B;  1U0L A;  1IBK L;  4IFD I;  1Y1V G;  2AWO A;  4DV0 L;  3BU2 A;  1SLJ A;  1EIF A;  5FJ8 G;  2RHS B;  5FLM H;  1E3P A;  3K80 C;  4JCV E;  3JAM i;  2OTL A;  3H3V H;  3PO2 G;  3PIP A;  1N34 Q;  4LF4 L;  3TRZ A;  2PQA A;  2E8G A;  4HJ5 A;  4GLA C;  5EAY A;  4DV2 Q;  4DR1 L;  4PZ8 A;  4BA1 I;  2UU9 L;  5LMN L;  2R93 G;  3PUY A;  1J5E L;  3RZO H;  2HT1 A;  4WJ3 M;  2N49 A;  2JA9 A;  2Y0S G;  1OXU A;  3RZD H;  4DR4 L;  1L1O A;  1ASY A;  1VQE A;  1MIU A;  1OXV A;  3CCU A;  4DR3 L;  1JJC B;  2CKZ B;  2ZTE A;  4BBR H;  1NY4 A;  3I2Z A;  3RN2 A;  1K8A C;  4ALP A;  4B3T L;  2JA7 H;  4DV5 Q;  1GM5 A;  1T9H A;  1XPU A;  2HHH Q;  3ULP A;  2RF4 A;  3AFP A;  1VQC A;  2V1C C;  3CC2 A;  2IX0 A;  2NN6 G;  5JEA J;  4A3L G;  4B3S Q;  5BR8 Q;  1PH6 A;  2Y0S E;  2DUD A;  4R4T A;  3NEM A;  4A3G H;  2E2J H;  1BBW A;  4LNQ A;  4LF5 Q;  4JI0 Q;  4A3D H;  3M4P A;  1XPO A;  1WYD A;  1UE5 A;  5LMU L;  1PH2 A;  4A3E G;  1N9W A;  1NMG A;  1PYB A;  2VQF L;  1D7Q A;  2NN6 I;  2VUM H;  2UUC L;  4JI7 L;  5C4X G;  2MO0 A;  1EYG A; 
#chains in the Genus database with same CATH topology
 1C8C A;  2H5X A;  3A5U A;  2EY2 A;  3OYY A;  5J22 A;  3EA6 A;  3HOY H;  3HOZ G;  1G8Z D;  1N8R C;  1O7Z A;  5I6W A;  4A3F G;  1I6V C;  4P74 A;  4A3K G;  4GKJ Q;  2EY6 A;  1L0Y B;  3MEF A;  3HOV G;  5J39 A;  4EQO A;  5DM6 3;  4ABN A;  4X66 L;  3CHB D;  4KN7 C;  2FIN B;  1PHJ A;  1CKN A;  3KLS X;  1SYC A;  3BG3 A;  3UDI A;  3HKZ E;  2UXD Q;  1YIJ A;  2F0T A;  1LTT D;  1G6Z A;  2ZM6 Q;  4A3B H;  5C44 B;  4DAM A;  3HG9 A;  1HTP A;  4R4C A;  2F0D A;  1WCM H;  4PQX A;  1HNW Q;  2K7V A;  4YWM A;  1BKB A;  2OQK A;  3S16 H;  5E4X A;  1S40 A;  1G6P A;  4DAP A;  4RGT A;  3S24 A;  3PF4 A;  4HJ9 A;  3NP8 A;  3GTJ B;  1K0R A;  2NVX B;  2RDG A;  5M5X B;  2IY5 B;  4ID6 A;  1SEB D;  4DNR B;  4NMZ A;  1YIT A;  2NYZ D;  1X56 A;  3HOW H;  4FXG C;  2PZT A;  1O7L A;  2IPK D;  1Z6H A;  3I72 A;  1SNM A;  4XQQ A;  4CDC C;  4DV3 L;  2JK8 A;  3CCE A;  2JA6 G;  2IL8 A;  5IYC H;  2EY5 A;  2YTV A;  1IHZ A;  5H1S E;  1GUN A;  4NP5 A;  3FKI G;  2NVQ B;  4IPG A;  3OW7 A;  1MD2 D;  2OWO A;  2F0J A;  1JWS D;  4QB4 A;  4GN5 A;  2Z8L A;  3BDL A;  5M3F G;  1NR4 A;  3P7J A;  1JB7 A;  1SRU A;  3GTG H;  3RMH A;  2GVA A;  1IYV A;  3PUW A;  4K5V A;  2QF7 A;  3KLW A;  4M8A A;  1QNU A;  2QDL A;  4DV1 L;  3MTS A;  4UP8 A;  2XWB B;  2Z0S A;  1Q86 C;  3NTK A;  3K5O A;  1HHV A;  2QIL A;  4DK3 C;  3J81 j;  1G51 A;  4ILW A;  1F2M A;  2ID0 A;  1B9N A;  4OIJ A;  2K5N A;  1DM0 B;  4EQ5 A;  3PO2 B;  2K75 A;  2EYF A;  2H4O A;  1SSO A;  3TBI B;  5IWA L;  1I3Q H;  1I4Q A;  1G91 A;  4L5S A;  1AZQ A;  1YNJ C;  2PMZ E;  4JC0 A;  5M5Y B;  1RHP A;  4C3I G;  3S9W A;  1W2B A;  1IYU A;  1UAP A;  3TDQ A;  5TSS A;  1HNZ L;  1TII D;  3DXJ C;  2VS1 A;  4POF A;  1B7Y B;  1QNK A;  1VQ9 A;  3CCR A;  2Q2U A;  4C2M H;  4KLK A;  1K8G A;  3S2H B;  1EOV A;  1JIC A;  3JC6 6;  4CKB A;  1VQO A;  1D8L A;  1W6J A;  2YYZ A;  4GNX C;  1Q1B A;  1SR3 A;  4DPG A;  2GA4 B;  4H44 C;  4AYB G;  1YHA A;  1RIP A;  1CQF A;  1K3B C;  1PH8 A;  3ITP A;  5KNC A;  2JA5 G;  3S2D B;  1XTD A;  1CZG A;  2QEX A;  4A3E B;  1WD1 A;  3QOJ A;  3QWN A;  1LTB D;  3EFX D;  4IFD J;  1K83 H;  1HZ9 A;  1W6K A;  4I7A A;  3VR4 A;  4AYB E;  2SEB D;  2IT1 A;  3BDO A;  1V1Q A;  5I4D A;  3AMU A;  3G48 A;  1STH A;  3WOF A;  5IYD G;  3GTQ B;  2HUG A;  4FNF A;  1O80 A;  3I4M G;  4DV2 L;  1Q7Y C;  1SJE D;  1X3F A;  2E2H H;  2AUJ D;  1UE7 A;  3M3Y H;  4CGY B;  2K33 A;  4A75 A;  5GAE C;  4OGQ C;  1TVX A;  2EYP A;  2XRS D;  1ILP A;  1LTA D;  1HZC A;  5C3W A;  2CFM A;  2Z6B A;  2ICI A;  4QUF A;  3TQY A;  4FXD A;  1H9R A;  2A19 A;  1YVC A;  2A6H D;  4RWS C;  5FOB B;  5IGC A;  3LWU A;  1LTR D;  2B2W C;  3U4Z A;  1F9P A;  1S3O A;  2NTS A;  3SK8 A;  3HOZ H;  5FLX c;  1S5B D;  4DFA A;  4A3F H;  3ERQ A;  1NSN S;  3CU7 A;  1C9O A;  1B3A A;  4A3K H;  2ZTC A;  1SE2 A;  4LF4 Q;  1SJH D;  1WFQ A;  3HOV H;  4DR1 Q;  2UU9 Q;  2NVY B;  4HCS A;  4A3M B;  5A35 A;  2LKV A;  3SK5 A;  5C3E H;  2EXZ A;  2K32 A;  4DR4 Q;  4G7O C;  4MZ9 A;  4DR3 Q;  4B3T Q;  4CKC A;  1S5F D;  5KIX A;  3C46 A;  2BDN A;  3PQI A;  1I94 L;  1KTK A;  3NEL A;  5HGQ A;  4A4I A;  1BCP B;  1V9P A;  5G3L F;  2AWN A;  2KOL A;  1M1K C;  4OXP A;  2OQ0 A;  2DY8 A;  1HR0 L;  2UUA L;  3RZD B;  2VQF Q;  5C4J H;  1EIG A;  3J80 E;  2UUC Q;  4A3G G;  1FGU A;  2JA7 B;  1ENA A;  4LMQ D;  1PYW D;  1YHB A;  1C0A A;  4ODG A;  4IUT A;  4B3M L;  1IL8 A;  2VUM G;  3SHL A;  4XDX A;  1JOR A;  4K5X A;  2E2J B;  1QVC A;  5IYB G;  4XT3 B;  2JA6 H;  2ZTD A;  4Y7N H;  2WB1 G;  2UUB L;  3FDT A;  4X66 Q;  4A3C G;  1L0W A;  2OXP A;  3KLS A;  4R9W A;  3FKI H;  4K2K A;  1WTP A;  2Z1C A;  2E74 C;  2RCF A;  4MIU A;  3PV0 A;  1QJO A;  1PFB A;  3CCQ A;  2K5W A;  3HP3 A;  3MXN B;  2O5I C;  2B2Y A;  3HOY B;  3CME A;  1TS5 A;  5M3F H;  1GHK A;  1A63 A;  2EPB A;  1SNC A;  2DJG C;  2JJQ A;  2MQH A;  1XPR A;  1SDF A;  5E4W C;  2JP1 A;  1LLR D;  2B2T A;  3UDX A;  2F4V L;  1ICW A;  4DV6 L;  2BE5 D;  4HSP A;  1TY0 A;  1TWA H;  4H13 C;  4YHH L;  1XYI A;  1RTN A;  4LF9 L;  4K8J A;  1HUN A;  2EYO A;  3CCJ A;  1I5F A;  4A3B B;  4PMB A;  1WCM B;  4IPC A;  4UAI A;  2MUY A;  4NXN L;  4DV3 Q;  2F3V A;  2RA4 A;  3S16 B;  4C3I H;  3R2I A;  4XTC S;  1Q81 C;  4RMF A;  1EIY B;  2XGT A;  4FF2 A;  4DR6 L;  2B63 G;  2BA0 A;  3ND8 A;  4CJ2 C;  1QZG A;  4N9T A;  2DJF C;  2VL6 A;  4ZAI A;  3TP7 A;  3HOW B;  2J0T D;  5HGT A;  3Q23 A;  5I2X A;  3T13 A;  4TKO B;  4LF8 L;  1U5K A;  3U4V A;  2JXM B;  2YV5 A;  3TS0 A;  1PA6 A;  2HD3 A;  2JA5 H;  3DHQ A;  1KIX A;  4G57 A;  4J8Q A;  1GJX A;  4HIM A;  3T1Y L;  4DV1 Q;  3OMG A;  1VQ7 A;  1M8A A;  5JJI A;  2A68 D;  4AQY L;  4ZCK A;  3QR8 A;  2A8V A;  4J15 A;  4X62 L;  3I4M H;  2PW7 A;  2J4X A;  3N52 A;  5IWA Q;  4MTN A;  4ZUI A;  3VYR A;  3GTG B;  1HH2 P;  5FO7 B;  4JPB W;  2ENB A;  5EBC A;  3IAY A;  1A2T A;  1VQ6 A;  2EE1 A;  3EJI A;  1HNZ Q;  1OXS C;  3BZC A;  1Y69 U;  3D6W A;  3HS0 C;  1QVF A;  4G7Z C;  4YIJ A;  1KXL A;  1E24 A;  3HEJ A;  2F0N A;  2PI2 E;  4BBS G;  4GLX A;  1I3Q B;  4IFD G;  3NQI A;  3H6M A;  3LNN A;  2MFI A;  3K57 A;  1BDO A;  5JJZ A;  1GVP A;  1KQS A;  3J81 E;  3RR5 A;  1HXY D;  2M00 A;  3AB9 A;  3CPF A;  5KYL A;  1DYQ A;  1R4Q B;  1E2W A;  2AWO A;  3BU2 A;  2EY1 A;  1LT5 D;  4DGZ A;  3H3V H;  4C2M B;  5CV9 A;  2IX3 A;  1WTW A;  1JB3 A;  2L55 A;  4GLA C;  4DV2 Q;  4BA1 I;  3R8B A;  5LMN L;  1T5E A;  3Q0A A;  3A7A B;  3TP5 A;  4QCL A;  1VQE A;  1MIU A;  2DN8 A;  1BNZ A;  3I2Z A;  2O2L D;  1GM5 A;  1FYC A;  1K83 B;  4DAV A;  3FRP B;  5BN4 A;  4FF1 A;  3CC2 A;  5JEA J;  2NN6 G;  3GP7 A;  2CHB D;  4O1N A;  3BS1 A;  1PH6 A;  1HCZ A;  4A3G H;  1CHQ D;  1BBW A;  3ZYY X;  1IW7 D;  2QEJ C;  1XPO A;  2E2H B;  5CV7 A;  5LMU L;  2ZXR A;  1Y8O B;  1Z7T A;  2X6L A;  1PYB A;  3M3Y B;  1RTO A;  2VUM H;  2KEE A;  4JI7 L;  4K0K L;  4IUR A;  5C4X G;  4X6A H;  1EYG A;  4A3I G;  5IYB H;  4H02 A;  4GOP B;  1KNA A;  2OCE A;  4XQJ A;  1GOZ A;  1CUK A;  1TS2 A;  2K5Q A;  3EIV A;  3QIA A;  4A3C H;  4CHT B;  3MXN A;  2N55 A;  2NTT A;  1O7I A;  1B50 A;  2F0K A;  1EZ8 A;  2QDB A;  3KBX A;  3MXU A;  1I94 Q;  1JT8 A;  3HOZ B;  4IUV A;  1M90 C;  1E2Z A;  1CFM A;  4P73 A;  2PCF B;  4O0A A;  4A3K B;  3A8K E;  1X6O A;  2VB2 X;  4M1U B;  3MAQ A;  4X3S A;  2I5H A;  1D5M C;  1SN8 A;  1NMF A;  2B2Y C;  1N36 L;  1HR0 Q;  1VQK A;  2UUA Q;  5C3E B;  2EZV A;  1DJR D;  2K5H A;  2A1A A;  3NBH B;  2JSO A;  2B2T C;  4C56 C;  3J80 L;  4DK1 A;  1CK1 A;  4R1J A;  4B3M Q;  1XMQ L;  2D2C C;  3I8Z A;  2PZU A;  2K14 A;  5KYI A;  1RL2 A;  2PW5 A;  4RGM A;  2F0I A;  2UUB Q;  5JJK A;  2B2U A;  1EUJ A;  4OO1 I;  3KJO A;  2RSN A;  5C4J B;  4HIO A;  2B63 H;  2IW3 A;  2QKI C;  2EIF A;  3H09 A;  4KMU C;  4Z9C B;  4IPH A;  3NEN A;  4QJF A;  1BBX C;  3ULJ A;  4LAA A;  4LUO A;  4C1N K;  2F0L A;  4NXM L;  4JI5 L;  5JPM C;  5I6Y A;  4WJ4 A;  4KTA A;  2PNR C;  1XMO L;  1BO0 A;  1GUT A;  2JA6 B;  4Y7N B;  2Z9H A;  5FK9 C;  3E9H A;  1F2Z A;  2KA7 A;  4QIW E;  3RLF A;  2KEN A;  3U50 C;  2F4V Q;  3FKI B;  4DV6 Q;  3S1R H;  5E3F A;  4LUV A;  3W2D A;  3TME A;  4FO2 A;  3BZK A;  3HOU G;  5DAU A;  4YHH Q;  4LF9 Q;  1EOT A;  2JEB I;  2FJ2 A;  3NUC A;  5CR3 A;  2L5T A;  5CV5 A;  5M3F B;  3QB3 A;  5DEH A;  2L11 A;  2NVT H;  1GHJ A;  1AE2 A;  1LAC A;  1LV9 A;  5EJW A;  4NXN Q;  3F2C A;  2E2D C;  4NKL A;  2PPB C;  1S5E D;  4X64 L;  3HOX H;  3LGJ A;  1EQR A;  2CWA A;  2F0U A;  1HA6 A;  3T16 A;  3VDY A;  4DR6 Q;  1S5D D;  4PMC A;  1MKH A;  1SMY D;  4YCW A;  3IFD A;  2WV6 D;  3R2T A;  2JYO A;  1O78 A;  2A5H A;  2CQA A;  3ZJY C;  2Y0S B;  2E5L L;  5M9O A;  4JI1 L;  1VQH A;  2G9D A;  4JI8 L;  4BBS H;  4LF8 Q;  4IFD H;  1IKL A;  3RLN A;  1DD2 A;  3MVV A;  4GKK L;  1HFG A;  1VQ5 A;  1LYL A;  1DON A;  4C3I B;  4LFA L;  2R92 G;  3EBE A;  1JWM D;  3T1Y Q;  3GDE A;  1N33 L;  4ZQ3 A;  4H7B A;  4JI3 L;  3I4N G;  2Q2T A;  3PF5 A;  4AQY Q;  4F87 A;  3HKZ G;  1E1T A;  1NE3 A;  4X62 Q;  4CDD C;  2N8N A;  2IWH A;  3K5L A;  1CKO A;  3DLL A;  5GAD C;  1S4Z A;  2R7F A;  1D1I A;  2AMC B;  2JA5 B;  3D31 A;  1PRT B;  5JVG 3;  1QE6 A;  4B9X A;  2Q8R E;  2XWJ B;  4YWL A;  4R8I A;  2K05 A;  1BCP C;  5D65 A;  1K28 A;  3E0E A;  3OWF A;  2VZA A;  2F0W A;  2NN6 H;  3A7L A;  5G3L D;  4O42 A;  1ZXT A;  1STE A;  2K50 A;  1MJE A;  3I4M B;  4IN3 A;  1PH9 A;  3SDZ A;  4RKB A;  5CC4 A;  3KF8 B;  1A3T A;  1P16 A;  4GOP A;  1R4P B;  1DOL A;  4DN4 M;  5C4X H;  1HQM C;  1VQJ A;  4JI0 L;  4A3I H;  3H0G G;  3UE0 A;  2K28 A;  2CVR A;  4KJO A;  2FFK B;  4GN3 B;  3J81 L;  4L8J A;  1WOC A;  3VR6 A;  5ELN A;  1U4L A;  2IHF A;  2I07 B;  1EU3 A;  4KI0 A;  1TT2 A;  2LSS A;  1H9J A;  1DCZ A;  4JI6 L;  5IOD A;  5LMN Q;  4NPS A;  4OEL B;  3C1F A;  4Q0F A;  5JEA G;  2EYM A;  4X3T A;  1TY2 A;  3GV6 A;  2E2I H;  3IKJ A;  4R4I A;  4YY3 L;  3FEW X;  1GUG A;  1PZK D;  3ERS X;  3DEP A;  3OWE B;  2EXD A;  3NBH A;  4CBV A;  4TVA B;  2K6A A;  4BBR G;  1AW7 A;  4IOA A;  3ERO A;  1L1O B;  3G7L A;  4P2C B;  2K4K A;  2RCN A;  3CC4 A;  2XSC A;  5LMU Q;  1A2U A;  3OHX C;  2I5M X;  5LHY 1;  3SK4 A;  1SFO B;  1B3Q A;  2ZJQ A;  2ALY B;  4JI7 Q;  4K0K Q;  2EJF C;  4JI2 L;  3S17 H;  1PFS A;  4N8X 1;  3L7Z C;  3LWE A;  3PSI A;  1GUO A;  4F8M A;  5AJ3 L;  4U68 A;  1H9S B;  3RNU A;  4RG1 A;  1HZA A;  1G2S A;  4A3G B;  5FO9 B;  1Z9F A;  1TS4 A;  3A55 A;  3I4L A;  3NBI A;  3E0J A;  1C4Q A;  2HIV A;  1JJ2 A;  2VUM B;  2B2U C;  3HKS A;  2Q8I B;  1SXT A;  3GTK H;  1QWY A;  3A74 A;  4IOC A;  1D5Z C;  1MJC A;  5EKK A;  2Z6K C;  4A3J G;  3HZX A;  2WB1 B;  2EDG A;  1IL2 A;  1KDC A;  1BCP F;  2IHE A;  1N36 Q;  3NTI A;  4XT1 B;  1BBU A;  1ET9 A;  3UDF A;  2HCC A;  5BN3 A;  2ZJR A;  1Y1V H;  1XXG A;  3HOU H;  5J3B A;  5FJ8 H;  1TU2 B;  2QGQ A;  2P5Z X;  3CRK C;  1E7Z A;  2TMP A;  2MGS A;  1XMQ Q;  1D2B A;  2LY7 A;  4DNT B;  4KN4 C;  5M5W H;  2R93 H;  2EQS A;  3CRL C;  1EY5 A;  1UE1 A;  2RKS A;  3WDN A;  3KOJ A;  4GLV B;  5EPL A;  1NNX A;  1Q90 A;  3GQB A;  3O13 A;  3KFU A;  1WTV A;  2WKD A;  1EY0 A;  5COY A;  1VQ8 A;  2X69 A;  1NTG A;  4B9W A;  4FP5 D;  3FMC A;  2DNE A;  4BWG B;  4NXM Q;  4JI5 Q;  2F0V A;  4FXK C;  5K36 G;  4EVO A;  2KHJ A;  4XXE A;  3DWP A;  1XMO Q;  1IBL L;  4KHZ A;  3EQL C;  3MA2 B;  4JBJ A;  4FF3 A;  5C6A A;  3S14 H;  4DA2 A;  3CCV A;  4KD3 A;  4JVZ A;  3L0O A;  3I4N H;  4Y52 H;  2B63 B;  1GUS A;  1KRS A;  3HRZ C;  1TS3 A;  2FXQ A;  4X65 L;  1QCB D;  3KJP A;  4IUU A;  3M7N A;  1OXT A;  2KUM A;  2JE6 I;  2K04 A;  5A2Q E;  1XJV A;  1TKW B;  3DWQ A;  4KD4 A;  1PV4 A;  1A62 A;  1GUW A;  3K6O A;  3MFY A;  4UY8 C;  4X64 Q;  1C7Y A;  2SDF A;  4K14 A;  3E6Z X;  3GTM H;  1BOS A;  1HRJ A;  1V8Q A;  2K1B A;  3S1R B;  1F2L A;  2XVS A;  3W1G A;  2IJ0 A;  3IL8 A;  1SBB B;  3BDC A;  1TWC H;  3KF8 A;  4OX9 L;  2E5L Q;  3M4Q A;  3OTO L;  1AFP A;  4EGV A;  4JI1 Q;  4JI8 Q;  1QOH A;  2NVT B;  3C3L A;  1A3U A;  2BOS A;  2PQE A;  3R93 A;  2PO4 A;  5EQ0 A;  4GKK Q;  5M3M G;  2VXW A;  2B8F A;  1VQ4 A;  1JOO A;  5ELF A;  4LFA Q;  4RA8 A;  5C0X I;  3HOX B;  4QMG A;  1NJI C;  2G9H D;  4LFC L;  1N33 Q;  3S1M H;  2CH4 A;  1WTH A;  2FHT A;  4JI3 Q;  3NQT A;  4LW1 A;  3E3X A;  4V0B A;  4GOP C;  2RVL A;  4JG2 A;  1BVS A;  1LAB A;  1VDZ A;  3X3M A;  1IBK L;  4KK7 A;  1Y8P B;  4BBS B;  5L37 A;  2WIN B;  4DV0 L;  2F4I A;  1SLJ A;  1EZ6 A;  2RHS B;  4HCE A;  1E3P A;  1EY9 A;  3PO2 G;  5CV4 A;  1BR9 A;  5JEA H;  5ELB A;  3TRZ A;  1U4P A;  2E8G A;  2N88 A;  3MFG A;  3OPO A;  2HT1 A;  2N49 A;  2JA9 A;  1OXU A;  1QG7 A;  2AQ1 B;  1L1O A;  3MC0 B;  2RDH A;  4BBR H;  3RN2 A;  1K8A C;  4ALP A;  1A6X A;  1XPU A;  5D3I B;  1B1Z A;  3ULP A;  2RF4 A;  2Z4H A;  2OF1 A;  4A3L G;  5LL6 X;  1MGS A;  1SNO A;  4RCN A;  4R4T A;  3NEM A;  4DK0 A;  1MHW C;  1SYF A;  4JI0 Q;  2ZXP A;  3M4P A;  1ILQ A;  1H9S A;  4A3E G;  2CW0 D;  1D7Q A;  1PTO D;  2MO0 A;  2DY7 A;  4ZKC B;  1JOQ A;  3S15 H;  1TR5 A;  2VW9 A;  2KBN A;  2NWG A;  4JI6 Q;  5D14 A;  4OWX B;  3CAM A;  4CJ1 B;  4LK1 C;  2O4X A;  1KDB A;  2R7Z G;  1VQM A;  4HMJ A;  5C4X B;  4GN4 B;  3VR5 A;  4HAE A;  5IP9 G;  1UEA B;  4A3I B;  1CTM A;  4AIM A;  3KBG A;  3OSO A;  4YY3 Q;  4A3J H;  1IYJ B;  1FD7 D;  1KD1 C;  4PV1 C;  5JAV A;  1STA A;  3GD7 A;  4C3H G;  5CMD A;  1A15 A;  1PTO H;  2DGY A;  5ELD A;  2UXC L;  1NCV A;  3H94 A;  3LX0 A;  1EYC A;  2E2I B;  1H9K A;  2E76 C;  2EYL A;  1RF2 D;  4JI2 Q;  1YJN A;  2N3S A;  2E75 C;  5BR8 L;  1SYG A;  3AU7 A;  2WKC A;  4XQN A;  5JOB A;  4BY7 G;  5IYD H;  4OO1 G;  3W3A A;  5AJ3 Q;  3CPW A;  3BJU A;  2MHV A;  4ME5 A;  4JI4 L;  1YJ9 A;  5IGG A;  1V1O A;  3F2B A;  3I3C A;  2KCM A;  2A6E C;  4ZKB B;  3J7A 5;  1STB A;  5EPJ A;  1FNU A;  3SR1 A;  1VS0 A;  2UXB L;  2K52 A;  3F2U A;  3K81 C;  3S17 B;  1YNX A;  1I4R A;  1I4H A;  2KED A;  1EIH A;  1A3V A;  1VQP A;  4POG A;  2C5C A;  5GAH C;  1QIL A;  4RGO S;  3PO3 G;  1XNR L;  4DR2 L;  1CKM A;  1HJP A;  3OW2 A;  4HIK A;  2RHQ B;  3OIP A;  3H3V I;  4ZRZ A;  2NVX H;  5JJL A;  1EWH A;  2N78 A;  4IPD A;  4X3K A;  4LWC A;  2M9V A;  1VMP A;  1NAP A;  4HSV A;  2K5V A;  3U58 A;  1PH7 A;  1CZW A;  1H95 A;  1IZ6 A;  2Q8T A;  4YCU A;  3GTK B;  4RKL A;  1ONL A;  3TZU A;  1E22 A;  1EYA A;  3VA5 A;  1I4G A;  1U9R A;  1HUM A;  2XNA C;  2D0P A;  2G5D A;  3RN5 A;  3IRB A;  1SMX A;  1PRT C;  1PZJ D;  1Y1V B;  1FNV A;  4YWK A;  2YU9 H;  3HOU B;  1FGB D;  1PDQ A;  4R4Q A;  1SYB A;  4DR7 L;  3TS2 A;  3L9A X;  5ELO A;  1KRT A;  3GO5 A;  1HR0 W;  4G4K A;  3SVM A;  1BF4 A;  1I50 H;  4IO9 A;  1PZI D;  2SNM A;  1B2T A;  5M5W B;  2R93 B;  5M3M H;  1EQQ A;  2HCI A;  1XNQ L;  5CGK A;  1E0B A;  1IBL Q;  4A76 A;  3TN2 A;  5DNF A;  1JE5 A;  5HUR A;  5GRO A;  3Q22 A;  1NR2 A;  3CP0 A;  3U9S A;  1F9S A;  3A8J E;  2ASB A;  2F0M A;  3L2P A;  4R4O A;  4X65 Q;  4OWT B;  1RCV D;  4KHP L;  1CM9 A;  4S3S A;  4KY5 A;  3M7G A;  1X9N A;  3PO2 H;  1R9T H;  3NXW A;  2A69 C;  3TP6 A;  1VQN A;  1TWG H;  4HJ8 A;  2L15 A;  5A2Q L;  1X54 A;  3G6J B;  1LTS D;  2GN5 A;  3S14 B;  2JEA I;  4DAY B;  2WFW A;  3I4N B;  1SYD A;  1VCI A;  1ASZ A;  3HKZ B;  1CSQ A;  4A3F B;  1YI2 A;  1G29 1;  3TEH B;  1EWI A;  4OX9 Q;  1TWH H;  3H3V C;  1ENF A;  3OTO Q;  1MSH A;  3BZD B;  3OMC A;  5E1F A;  3VR3 A;  3HOW G;  1SE8 A;  1Y1W G;  3HOV B;  1FVI A;  2EJG C;  4FDB A;  3T53 B;  4A3L H;  4PZ7 A;  1L1O C;  2PZW A;  3GTM B;  3EN2 A;  2HHH L;  1SE3 A;  4LFC Q;  3AQQ A;  5IE8 A;  2I46 A;  3F2D A;  1ZYR D;  3N6R A;  4B3S L;  1TWC B;  3JAM c;  4LF5 L;  1JE4 A;  2EOT A;  4AH6 A;  1AH9 A;  3J7Z C;  2A73 B;  3D4R A;  5FLX E;  4HID A;  1IBK Q;  4A93 G;  2OEO A;  2L4N A;  4DV0 Q;  3CCM A;  1T5X D;  4C3J G;  3T1H L;  2YTX A;  2R7Z H;  4Q5V A;  5IP9 H;  5K5P A;  3S1M B;  1LT4 D;  1PH5 A;  4GZY C;  5FLM G;  2Z6K A;  1QVG A;  5T1I A;  4OIK A;  1STN A;  4XYQ A;  1PRT F;  5DM7 3;  1KHI A;  4ZUJ A;  3K8A A;  1WTQ A;  4C3H H;  1F9Q A;  1K8M A;  3P75 A;  1TQO A;  5CV6 A;  2C35 B;  4OHJ A;  1HZB A;  3NWT A;  1BCP D;  3L3O C;  3M4O H;  2PYK A;  4C1N I;  2NZO A;  1WTX A;  4MNO A;  1L2F A;  3BYT B;  4DF7 A;  1W3S A;  2I0Q A;  2F0G A;  1H9M A;  2KVM A;  1STY A;  1VF7 A;  2A74 C;  4XYO A;  3PIO A;  1VQD A;  1IW7 C;  1HPC A;  3PIP 3;  4DR5 L;  4BY7 H;  4OO1 H;  5I9O A;  3CCS A;  4UHV A;  1VMC A;  5DLQ E;  3FHW A;  1KAA A;  2WAQ G;  4BBR B;  3J80 c;  5C4H A;  4A3D G;  2VNU D;  4K6D A;  1ESF A;  4EX5 A;  3R3O A;  4CJ0 B;  3CQZ H;  3U9O A;  4DV7 L;  2PMZ B;  2VY3 A;  4QF4 A;  3NSW A;  4BY1 G;  1TWA B;  1B9M A;  2WAQ E;  4PMW A;  1WI5 A;  1JWU D;  4TQU S;  4JBK A;  3AFQ A;  5C4Z A;  1SYE A;  1D6E C;  4DU9 A;  1VQF A;  4RHS A;  1X3P A;  3MEH A;  3PO3 H;  4DV4 L;  4G7H C;  3UDG A;  3S15 B;  3CC7 A;  1A8V A;  3GTP H;  3HGB A;  1N32 L;  2UXC Q;  2WP8 J;  5IT9 c;  5NUC A;  3V96 A;  1VQL A;  3AEV A;  5KGU A;  3A56 A;  5LMN W;  3S1N H;  3STB C;  4DXF A;  1CA6 A;  4A3J B;  3GTO H;  2K03 A;  4DK6 C;  2Z4I A;  2B29 A;  2JN4 A;  3A54 A;  4AYB B;  4RH6 A;  1YNN C;  4JI4 Q;  1UEB A;  3VYU A;  3URY A;  1D5X C;  1YZ6 A;  4NB3 A;  4N8F A;  1LTI D;  1PTO B;  4HR7 B;  4RAU C;  4TRD A;  1QB5 D;  1V1P B;  1PXU A;  1EQV A;  2RBM A;  4R8N A;  3FVQ A;  1KLG D;  2KEC A;  2ICE C;  3D0F A;  3E5S A;  2UXB Q;  4EQP A;  3CXC A;  1YNJ D;  5IOC A;  1PFN A;  1AP0 A;  4IUQ A;  3MZ5 A;  3VYS A;  1VQI A;  5KEE A;  1ZEQ X;  1UE6 A;  1F9R A;  1TXY A;  1XNR Q;  4DR2 Q;  4LFB L;  2LXK A;  5C3E G;  3TZD A;  2BDO A;  4KY6 A;  4OON A;  2Q2H A;  2BA1 A;  5KND A;  3I90 A;  1CA5 A;  3VR2 A;  2CH4 W;  3TP8 A;  3K7U C;  1AE3 A;  1X65 A;  3PUZ A;  1IBM L;  1ZKO A;  1IKM A;  1SNQ A;  4DUY L;  1AEX A;  2MJ8 A;  4IJL A;  2ZJP A;  4EQN A;  2JA8 G;  4DAY A;  4LF6 L;  2F0S A;  5KRU A;  4HJA A;  4JV5 L;  4DXG A;  3J7Y W;  1TWF H;  3GV3 A;  1EEF D;  3QJY A;  4WRD A;  4APV A;  1EU4 A;  1RKN A;  3NPP A;  5EKI A;  3Q24 A;  3FP9 A;  4DR7 Q;  1CQV A;  3C1E A;  4O2D A;  1PH4 A;  2XN9 C;  1Y1W H;  4JYA L;  3J7A F;  5IGE A;  1C48 A;  2AQ2 B;  1SMY C;  3PGZ A;  4BXX G;  1XNQ Q;  5C0X G;  1I6H H;  2CWP A;  1LM0 A;  4K8I A;  4L5T A;  3RD4 A;  2DNC A;  3SXH A;  3J7A V;  2NUC A;  2YU9 B;  1ENC A;  2F0P A;  4IAL A;  2L1B A;  4PG3 A;  1WTR A;  4KJN A;  4IZ8 A;  1KAW A;  4KKT A;  3H91 A;  1PFM A;  1I50 B;  3SGI A;  3S1Q H;  4KHP Q;  4A93 H;  4ZLT F;  4BA2 I;  5D3D A;  1X3G A;  3CW2 C;  1DZ1 A;  1O7Y A;  2RDF A;  4C3J H;  1B8A A;  2MNA A;  4KKS A;  5M3M B;  2NBF A;  3NHH A;  3J81 c;  3A5Z B;  1EIF A;  5FLM H;  3K80 C;  3JAM i;  4JCV E;  3MXG A;  3PIP A;  2B2V A;  1B53 A;  4HJ5 A;  4PZ8 A;  3BVG A;  5JVH 3;  1J5E L;  3RZO H;  2L0C A;  4RCO A;  2SOB A;  2Y0S G;  1SNP A;  3K58 A;  1R9T B;  1OXV A;  4QUC A;  2QCP X;  4HED A;  2ZTE A;  2CKZ B;  4K6L A;  1NY4 A;  1TWG B;  3VA7 A;  2MPM A;  1RJT A;  2F0Q A;  1Y8N B;  1KAB A;  2HHH Q;  1CI3 M;  3AFP A;  3KK7 A;  3CKI B;  4B3S Q;  2Y0S E;  2DUD A;  4LF5 Q;  4A3D H;  1WYD A;  3BVM A;  1HQR D;  1TWH B;  3Q6S A;  2NB0 A;  1PH2 A;  1N9W A;  1NMG A;  2ZXO A;  2MP1 A;  3T1H Q;  3KYH C;  5FLX L;  3BYY B;  3ULL A;  1Q82 C;  4BY1 H;  3QO2 A;  5IIF A;  3J80 i;  1KL9 A;  4DUZ L;  4L63 B;  2HDL A;  1UWV A;  4KV6 A;  1JQY D;  1VQG A;  5C44 G;  1S72 A;  2AQ3 B;  2LMC B;  3BVZ A;  2HIX A;  1K3R A;  1WJJ A;  2R92 H;  2CCZ A;  1MBY A;  2R7Z B;  4ULL A;  1X3E A;  4GS3 A;  3PCO B;  4NW2 A;  4IUP A;  4LF7 L;  5ELC A;  3KUP A;  2KCT A;  2F52 A;  2MO1 A;  4LNQ A;  4LUZ A;  4ME3 A;  3AYH B;  3GTL H;  4DR5 Q;  2KHS A;  5C5L A;  2AKW B;  3FPU B;  3K0Y A;  1V1P A;  1EL0 A;  3KF6 B;  1ROD A;  1FL0 A;  4C3H B;  1XX8 A;  5I2Y A;  1CT1 D;  1WTO A;  3F1Z A;  3IFT A;  1EY4 A;  5IP7 G;  3JAM E;  2RQX A;  4JOI A;  3M4O B;  4DV7 Q;  3DM3 A;  3KDF B;  1DOK A;  1SND A;  5ISR A;  1U4R A;  2ES2 A;  5CBE E;  4BY7 B;  5IGD A;  5KNB A;  1HNX L;  4DV4 Q;  2VQE L;  4MHE A;  2L9H A;  2XTI A;  4K5W A;  3CQZ B;  3MHB A;  1N32 Q;  1OTC A;  3H0G H;  4UPA A;  1PLF A;  5COR A;  3C2P A;  2JA8 H;  4U67 3;  5JPN C;  4DNI A;  4XIG S;  4CDF C;  1EY7 A;  4B3R L;  3OIQ A;  3PO3 B;  1Q46 A;  3NK9 A;  1JR0 D;  1ESR A;  3ONA B;  1PMR A;  2KHI A;  3GTP B;  4CKE A;  2EYJ A;  4I65 A;  4E6I A;  2C9O A;  3D4W A;  4KKU A;  5IGB A;  1LTL A;  1CHP D;  2KCN A;  3QOL A;  2OTJ A;  4WJW A;  2EVB A;  1D1K A;  3S1N B;  2BCO A;  3CF5 A;  4BXX H;  3GTO B;  5C0X H;  1FJG L;  2M2L A;  3I4O A;  2QW7 A;  3TRE A;  1ML0 D;  2A6E D;  3K5M A;  1K8O A;  3K5N A;  1ICF B;  5ELE A;  4QL5 A;  1Y14 B;  4LFB Q;  1F77 A;  2SNS A;  1JOK A;  1EFI D;  3G4S A;  4RHR A;  2IX1 A;  3K7A H;  2A6H C;  5EGT A;  4BS9 A;  1QUQ B;  1IBM Q;  1EQT A;  5CV8 A;  4P75 A;  4DUY Q;  1LTG D;  3CCL A;  5EPK A;  5IT9 E;  1WVL A;  2WB1 E;  3V2T A;  1KLU D;  3DM1 A;  1II3 A;  4MTK A;  5CBA E;  3CMA A;  2H1E A;  4LF6 Q;  3E9I A;  1EYD A;  1SE4 A;  3D3R A;  4JV5 Q;  3UI2 A;  3HFZ B;  1YJW A;  3M85 A;  3NTH A;  5LL6 S;  3RUZ A;  4I7Z C;  4CDE C;  5C3X A;  4L6T B;  2F1M A;  1MSG A;  3DWA A;  1QZH A;  1BUV T;  4F88 A;  2AHO B;  3D6C A;  3SEB A;  2F3I A;  5F2D A;  1GO3 E;  5E7N A;  3J81 i;  1EEI D;  1N34 L;  3RLO A;  1K9M C;  4JYA Q;  4FVM A;  1PRT D;  2B2V C;  4KHV A;  1XTC D;  3D4D A;  2F3W A;  1UUP A;  3V05 A;  1OXX K;  1TWF B;  1JC7 A;  1GD7 A;  2KCC A;  3SE0 A;  2R3Z A;  1NUC A;  2B8G A;  1K0S A;  4DV5 L;  2XIW A;  2R61 A;  3DEO A;  4YCV A;  1J6Q A;  4L5R C;  4J1M A;  2NZ1 D;  4J6H A;  1X55 A;  5AFW A;  1Y1W B;  2VB3 X;  2ATW A;  1WD0 A;  1I6H B;  2EYH A;  3EVQ A;  1L0X B;  4PNY A;  3PMF A;  3UE1 A;  4GNX B;  4A3M G;  3W5O A;  1Z47 A;  4IJH A;  4OL7 A;  1J8I A;  5IY0 A;  3T51 B;  4UP7 A;  2A69 D;  1DGS A;  4UDU C;  3F8T A;  3S1Q B;  5C44 H;  3I73 A;  2V4D A;  2F0E A;  1J5E Q;  4A93 B;  5K36 H;  3PIO 3;  4F7X A;  1JJG A;  4GKJ L;  4C3J B;  4HTH A;  3Q8D A;  2D0O A;  3T4A C;  4FF4 A;  3SK6 A;  3GTJ H;  2PQA B;  1SRO A;  4QIW B;  3HOX G;  4UP9 A;  3KF6 A;  3PUX A;  5I9P A;  1X32 A;  3TSS A;  5M5X H;  1X3Q A;  2UXD L;  1RDP D;  3ND9 A;  1P8L A;  3M4Y A;  4OWW B;  2JA7 G;  1HA5 A;  2B3G A;  2ZM6 L;  3G71 A;  2BE5 C;  2NZH A;  2HQE A;  4RGN A;  3RZO B;  3MWY W;  4KY7 A;  2YTY A;  2QA4 A;  3KDF A;  5IP7 H;  2R7D A;  3A0J A;  1HNW L;  3I56 A;  1PH1 A;  1Q1E A;  1Q12 A;  4ZK9 B;  2CW0 C;  1VF5 C;  2BH2 A;  1PTO C;  2LFN A;  2NVQ H;  1KDA A;  4QY7 A;  5GQO A;  2B39 A;  2LS0 1;  3KLR A;  4JOI C;  2WAQ B;  3DUZ A;  4DUZ Q;  1B70 B;  4A3D B;  2PI2 A;  3WWV A;  3HOY G;  1FR3 A;  4QGU A;  3D8G A;  1UNS A;  1IXR A;  1OO9 B;  2L12 A;  4V19 0;  1V43 A;  1S5C D;  2X6G A;  4BY1 B;  2D9U A;  1YEZ A;  4LF7 Q;  5CYU A;  1SFO H;  5J1Z A;  5C0X J;  3QG1 A;  2D62 A;  1PH3 A;  1NBW A;  1CKN B;  1G2T A;  1LUZ A;  3B6Y A;  4A3B G;  1VQB A;  2AUK A;  3FPP A;  4B08 A;  1WCM G;  2A68 C;  1JMC A;  2R92 B;  4N9P A;  4JBW A;  5M5Y H;  3JAM L;  1ET6 A;  3W1B A;  1YBY A;  1KC8 C;  2J7Z A;  2PNH A;  2KQ3 A;  2F0O A;  1PVO A;  3GTL B;  3K0X A;  5BN5 A;  2LXJ A;  5T1G A;  3S2H H;  3I55 A;  1HNX Q;  1GKH A;  2VQE Q;  1I4X A;  1QUQ A;  3OOC A;  3G6E A;  5HY6 A;  4HMI A;  5GAG C;  4P71 A;  4RFB A;  1E2V A;  4IQZ A;  5FO8 B;  3PUV A;  4DKA C;  2FMC A;  3S2D H;  2TSS A;  5IYC G;  1K73 C;  4A3E H;  1DXM A;  4HN7 A;  1B4O A;  1LO5 D;  2HQL A;  4JBM A;  2I5L X;  4B3R Q;  1JCK B;  4H0L C;  3GTQ H;  2GVB A;  3ER0 A;  3CD6 A;  3H15 A;  3STB D;  1VQA A;  1EWC A;  3MXP A;  2OT2 A;  3H0G B;  4HJ7 A;  1SAP A;  2CQO A;  2JQO A;  4FYD A;  2BH8 A;  1E1O A;  1Q3L A;  2R6G A;  1YNN D;  2JA8 B;  1PTO F;  3NE5 B;  2Q2I A;  1FJG Q;  4P72 A;  1LT3 D;  3VYT A;  4L5Q A;  1A0I A;  2F03 A;  1I4P A;  4PZ6 A;  1BQQ T;  1J9O A;  1U4M A;  3I70 A;  1AN8 A;  2WAC A;  2D5D A;  3M9B A;  1BXT A;  2FMM A;  4JW0 A;  1MI2 A;  1PYS B;  3I7F A;  1KNE A;  2XRQ D;  1EY6 A;  2HDM A;  1Q8K A;  4OEM B;  4GNX A;  1FNW A;  1B44 D;  1CSP A;  2NVY H;  4QQB X;  4MN3 A;  5IT9 L;  4A3M H;  3ICE A;  3DMU A;  5EKL A;  1HTL D;  1EFW A;  1YHQ A;  4ZYS A;  2F0H A;  1LT6 D;  1U0L A;  1EY8 A;  2ZT9 C;  3A8I E;  4IFD I;  1Y1V G;  4NDX A;  1AZP A;  5FJ8 G;  3K59 A;  3K7A B;  2OTL A;  3NWS A;  1Q8I A;  3P20 A;  1N34 Q;  4LF4 L;  1GXD C;  2PQA A;  3I91 A;  5IGF A;  1M4V A;  2WII B;  5EAY A;  4DR1 L;  1F2Y A;  4WOR A;  2UU9 L;  3X3N A;  2R93 G;  3PUY A;  4IUN A;  4WJ3 M;  2RSO A;  4WFN 3;  1DOM A;  3RZD H;  4DR4 L;  1STG A;  5C5M A;  4JK1 C;  1ASY A;  3CCU A;  2O5J C;  2KJX A;  1HFN A;  4DR3 L;  1JJC B;  4B3T L;  2JA7 H;  4K2L A;  5EBD A;  4DV5 Q;  2K5D A;  1T9H A;  3T56 B;  4X3U A;  4TSS A;  1VQC A;  2V1C C;  2F0F A;  2IX0 A;  5BR8 Q;  1ZYR C;  5FKA C;  3WOE A;  2E2J H;  1RD9 D;  1XWE A;  2B2W A;  2EJM A;  1UE5 A;  3P1H A;  2VQF L;  4LJZ C;  2K01 A;  2NN6 I;  2UUC L; 
#chains in the Genus database with same CATH homology
 3T1H Q;  3KYH C;  4A3I G;  2H5X A;  3ULL A;  1Q82 C;  3S15 H;  2VW9 A;  3A5U A;  3OYY A;  5IYB H;  4BY1 H;  4H02 A;  2KBN A;  4GOP B;  2OCE A;  3HOZ G;  3HOY H;  1CUK A;  4JI6 Q;  3EIV A;  4A3C H;  1N8R C;  4OWX B;  3CAM A;  3J80 i;  1KL9 A;  4A3F G;  2R7Z G;  4P74 A;  4A3K G;  1VQM A;  4DUZ L;  4GKJ Q;  4GN4 B;  5IP9 G;  1O7I A;  1UWV A;  3MEF A;  3HOV G;  4AIM A;  4YY3 Q;  4X66 L;  1VQG A;  5C44 G;  1S72 A;  4A3J H;  1I94 Q;  1JT8 A;  1IYJ B;  2HIX A;  1CKN A;  1PHJ A;  1KD1 C;  1K3R A;  1M90 C;  1WJJ A;  2R92 H;  2CCZ A;  3UDI A;  4P73 A;  1X3E A;  3HKZ E;  3GD7 A;  4GS3 A;  4O0A A;  2UXD Q;  1YIJ A;  3PCO B;  4LF7 L;  1X6O A;  2ZM6 Q;  4A3B H;  2I5H A;  1SN8 A;  2F52 A;  1NMF A;  2DGY A;  2KCT A;  2MO1 A;  4LUZ A;  4ME3 A;  4DAM A;  4R4C A;  1N36 L;  2UXC L;  1WCM H;  1HR0 Q;  3AYH B;  1VQK A;  2UUA Q;  1HNW Q;  3GTL H;  4YWM A;  1BKB A;  4DR5 Q;  2OQK A;  2K5H A;  2AKW B;  3S16 H;  1S40 A;  1G6P A;  2A1A A;  3NBH B;  3KF6 B;  4JI2 Q;  1FL0 A;  1YJN A;  2N3S A;  5BR8 L;  3F1Z A;  3S24 A;  3PF4 A;  4HJ9 A;  5IP7 G;  4R1J A;  1K0R A;  4JOI A;  4BY7 G;  5IYD H;  4B3M Q;  1XMQ L;  4OO1 G;  5AJ3 Q;  3CPW A;  3BJU A;  4DV7 Q;  4JI4 L;  2IY5 B;  3DM3 A;  3KDF B;  1YJ9 A;  2K14 A;  1YIT A;  1RL2 A;  1X56 A;  3F2B A;  3HOW H;  2KCM A;  2UUB Q;  3J7A 5;  5JJK A;  2ES2 A;  1EUJ A;  4OO1 I;  3KJO A;  4DV3 L;  4HIO A;  2B63 H;  1VS0 A;  2JK8 A;  2UXB L;  3CCE A;  2K52 A;  3K81 C;  2EIF A;  1HNX L;  2JA6 G;  5IYC H;  1YNX A;  4DV4 Q;  2VQE L;  2YTV A;  4IPH A;  5H1S E;  2XTI A;  3NEN A;  4QJF A;  3FKI G;  3ULJ A;  4IPG A;  4LUO A;  1VQP A;  4POG A;  4NXM L;  1N32 Q;  5GAH C;  1OTC A;  4JI5 L;  3H0G H;  3PO3 G;  4WJ4 A;  1XNR L;  4UPA A;  4DR2 L;  1CKM A;  1HJP A;  3OW2 A;  2OWO A;  4HIK A;  1XMO L;  2RHQ B;  3H3V I;  2NVX H;  4GN5 A;  2JA8 H;  5JJL A;  2N78 A;  4IPD A;  3E9H A;  3RLF A;  5M3F G;  4QIW E;  4DNI A;  2KEN A;  4LWC A;  4XIG S;  3U50 C;  2F4V Q;  4DV6 Q;  1PH7 A;  2K5V A;  3U58 A;  3S1R H;  1JB7 A;  1SRU A;  4LUV A;  3GTG H;  1H95 A;  2GVA A;  4B3R L;  3PUW A;  1Q46 A;  3BZK A;  1IZ6 A;  3HOU G;  3KLW A;  4YCU A;  4YHH Q;  4LF9 Q;  2KHI A;  1E22 A;  4DV1 L;  2JEB I;  4UP8 A;  2Z0S A;  1Q86 C;  2D0P A;  1LTL A;  4DK3 C;  3J81 j;  1G51 A;  3IRB A;  3RN5 A;  2NVT H;  1AE2 A;  1SMX A;  4NXN Q;  2OTJ A;  2ID0 A;  4YWK A;  3F2C A;  2YU9 H;  4R4Q A;  4X64 L;  3HOX H;  2K5N A;  3LGJ A;  4EQ5 A;  1EQR A;  3CF5 A;  5ELO A;  1KRT A;  1FJG L;  2K75 A;  3GO5 A;  2CWA A;  1HR0 W;  3I4O A;  5IWA L;  1I3Q H;  1I50 H;  3VDY A;  4IO9 A;  3TRE A;  4L5S A;  4DR6 Q;  1MKH A;  2PMZ E;  4YCW A;  4JC0 A;  4QL5 A;  1Y14 B;  5M3M H;  1W2B A;  3ZJY C;  1EQQ A;  1XNQ L;  4LFB Q;  2E5L L;  1HNZ L;  1IBL Q;  4JI1 L;  4A76 A;  1VQH A;  4JI8 L;  4POF A;  2VS1 A;  4BBS H;  1JE5 A;  3G4S A;  4LF8 Q;  1B7Y B;  1VQ9 A;  3K7A H;  5GRO A;  3RLN A;  3CCR A;  2Q2U A;  1QUQ B;  1IBM Q;  4GKK L;  1VQ5 A;  1LYL A;  4C2M H;  4KLK A;  4P75 A;  3CP0 A;  4DUY Q;  1K8G A;  4LFA L;  1EOV A;  3JC6 6;  3CCL A;  2ASB A;  2R92 G;  1VQO A;  3L2P A;  1D8L A;  2WB1 E;  4R4O A;  3EBE A;  3CMA A;  2YYZ A;  4X65 Q;  4OWT B;  4GNX C;  3GDE A;  1Q1B A;  1SR3 A;  3E9I A;  4DPG A;  3T1Y Q;  4AYB G;  1N33 L;  4KHP L;  4JI3 L;  1YHA A;  2Q2T A;  2IX1 A;  3I4N G;  4JV5 Q;  1RIP A;  3PF5 A;  1PH8 A;  3HFZ B;  4AQY Q;  1YJW A;  1X9N A;  3M85 A;  2JA5 G;  1XTD A;  1R9T H;  3PO2 H;  3HKZ G;  1E1T A;  2QEX A;  1NE3 A;  1VQN A;  4X62 Q;  1TWG H;  4HJ8 A;  1QZH A;  2L15 A;  2N8N A;  1X54 A;  2AHO B;  4IFD J;  1K83 H;  1HZ9 A;  2F3I A;  2GN5 A;  2JEA I;  4DAY B;  1CKO A;  3DLL A;  2WFW A;  5GAD C;  1GO3 E;  4AYB E;  2R7F A;  5E7N A;  2IT1 A;  3J81 i;  1VCI A;  2AMC B;  1N34 L;  1V1Q A;  3RLO A;  1ASZ A;  3G48 A;  1K9M C;  3D31 A;  4JYA Q;  5IYD G;  3I4M G;  1CSQ A;  4DV2 L;  1YI2 A;  1G29 1;  3TEH B;  1EWI A;  1X3F A;  1Q7Y C;  2E2H H;  4OX9 Q;  1TWH H;  4YWL A;  3OTO Q;  1UE7 A;  1OXX K;  1GD7 A;  3HOW G;  1SE8 A;  3E0E A;  1Y1W G;  2VZA A;  1FVI A;  3M3Y H;  4FDB A;  4A75 A;  5GAE C;  4A3L H;  4PZ7 A;  1L1O C;  4DV5 L;  2K50 A;  1MJE A;  1HZC A;  3EN2 A;  1PH9 A;  2HHH L;  2CFM A;  4LFC Q;  3AQQ A;  4YCV A;  5IE8 A;  3F2D A;  3KF8 B;  3TQY A;  1J6Q A;  1P16 A;  4B3S L;  4L5R C;  1X55 A;  4GOP A;  2A19 A;  1YVC A;  5C4X H;  1VQJ A;  3JAM c;  2ATW A;  4LF5 L;  4JI0 L;  4A3I H;  4AH6 A;  1AH9 A;  3H0G G;  3UE0 A;  3J7Z C;  3U4Z A;  4HID A;  1IBK Q;  4GN3 B;  1S3O A;  4A93 G;  4A3M G;  4GNX B;  3UE1 A;  1WOC A;  5FLX c;  4DV0 Q;  3HOZ H;  3CCM A;  5ELN A;  3W5O A;  3T1H L;  2IHF A;  1Z47 A;  2YTX A;  4IJH A;  4A3F H;  1C9O A;  2R7Z H;  4DR7 L;  4A3K H;  2ZTC A;  5IY0 A;  3TS2 A;  4KI0 A;  4UP7 A;  5IP9 H;  4LF4 Q;  2LSS A;  1DGS A;  1WFQ A;  3F8T A;  3HOV H;  4DR1 Q;  4JI6 L;  2UU9 Q;  5C44 H;  1PH5 A;  5LMN Q;  5FLM G;  2Z6K A;  4NPS A;  1QVG A;  1J5E Q;  1JJG A;  5C3E H;  5JEA G;  4GKJ L;  4DR4 Q;  2E2I H;  3Q8D A;  1KHI A;  2D0O A;  4MZ9 A;  3K8A A;  4R4I A;  4DR3 Q;  4YY3 L;  4B3T Q;  4C3H H;  1I94 L;  3NEL A;  3ERS X;  2C35 B;  3GTJ H;  2PQA B;  1HZB A;  1SRO A;  5HGQ A;  4A4I A;  2EXD A;  3HOX G;  4UP9 A;  3KF6 A;  3PUX A;  3M4O H;  1V9P A;  4TVA B;  5M5X H;  2UXD L;  2NZO A;  4MNO A;  1P8L A;  1L2F A;  4BBR G;  4IOA A;  4OWW B;  2JA7 G;  1W3S A;  2AWN A;  1M1K C;  2I0Q A;  4OXP A;  2B3G A;  2OQ0 A;  2ZM6 L;  3G71 A;  1L1O B;  2NZH A;  2K4K A;  2RCN A;  3CC4 A;  3PIO A;  5LMU Q;  2QA4 A;  2YTY A;  1VQD A;  3KDF A;  1HR0 L;  5IP7 H;  2UUA L;  2I5M X;  2R7D A;  3A0J A;  1HNW L;  3I56 A;  1PH1 A;  2VQF Q;  1Q1E A;  1Q12 A;  5C4J H;  4DR5 L;  2ZJQ A;  3CCS A;  4BY7 H;  5DLQ E;  2ALY B;  2WAQ G;  1FGU A;  3FHW A;  2UUC Q;  4JI7 Q;  4A3G G;  3J80 c;  4K0K Q;  4JI2 L;  2BH2 A;  3S17 H;  4A3D G;  2VNU D;  1PFS A;  3L7Z C;  1YHB A;  1C0A A;  3PSI A;  2NVQ H;  4B3M L;  4EX5 A;  4QY7 A;  5GQO A;  5AJ3 L;  2VUM G;  3CQZ H;  4JOI C;  4DV7 L;  3RNU A;  4RG1 A;  1HZA A;  2VY3 A;  4DUZ Q;  1B70 B;  1QVC A;  1Z9F A;  4BY1 G;  5IYB G;  2PI2 A;  2ZTD A;  3WWV A;  2WAQ E;  4PMW A;  4Y7N H;  2JA6 H;  1WI5 A;  2WB1 G;  4TQU S;  2UUB L;  3HOY G;  4X66 Q;  3AFQ A;  4JBK A;  4A3C G;  4QGU A;  1L0W A;  3FKI H;  2HIV A;  1JJ2 A;  1VQF A;  1IXR A;  3HKS A;  3PO3 H;  3PV0 A;  4DV4 L;  1V43 A;  3CCQ A;  3UDG A;  3GTK H;  3A74 A;  4IOC A;  3CC7 A;  1MJC A;  3MXN B;  1A8V A;  1YEZ A;  2Z6K C;  4A3J G;  4LF7 Q;  1SFO H;  3GTP H;  3CME A;  1IL2 A;  5C0X J;  5M3F H;  1A63 A;  1N32 L;  1N36 Q;  2IHE A;  2UXC Q;  2WP8 J;  5IT9 c;  2D62 A;  1PH3 A;  2JJQ A;  2MQH A;  1XPR A;  1BBU A;  1NBW A;  1CKN B;  3UDF A;  2ZJR A;  1LUZ A;  1Y1V H;  3B6Y A;  1VQL A;  3AEV A;  5J3B A;  3HOU H;  5FJ8 H;  3UDX A;  4A3B G;  3S1N H;  2QGQ A;  5LMN W;  3STB C;  2F4V L;  1VQB A;  3GTO H;  1E7Z A;  4DK6 C;  4DV6 L;  1WCM G;  1JMC A;  2B29 A;  1XMQ Q;  1TWA H;  4JBW A;  5M5Y H;  5M5W H;  4YHH L;  4JI4 Q;  2EQS A;  4LF6 Q;  1UEB A;  4LF9 L;  2R93 H;  3W1B A;  1YBY A;  4NB3 A;  1YZ6 A;  1KC8 C;  3CCJ A;  1I5F A;  2PNH A;  1UE1 A;  3KOJ A;  4GLV B;  1PVO A;  4IPC A;  3K0X A;  3KFU A;  4NXN L;  4DV3 Q;  2LXJ A;  3D0F A;  3S2H H;  2UXB Q;  4C3I H;  3I55 A;  4XTC S;  1HNX Q;  1Q81 C;  1VQ8 A;  1GKH A;  4RMF A;  2VQE Q;  1EIY B;  2XGT A;  3CXC A;  1QUQ A;  1NTG A;  4DR6 L;  3G6E A;  5HY6 A;  5GAG C;  4P71 A;  2B63 G;  2BA0 A;  4NXM Q;  1VQI A;  3PUV A;  1UE6 A;  4DKA C;  4JI5 Q;  3S2D H;  1TXY A;  5IYC G;  1XNR Q;  4DR2 Q;  1K73 C;  5K36 G;  4LFB L;  2KHJ A;  4A3E H;  1QZG A;  2VL6 A;  1XMO Q;  1IBL L;  2LXK A;  4KHZ A;  5C3E G;  4OON A;  2Q2H A;  2BA1 A;  4JBJ A;  3S14 H;  4LF8 L;  3CCV A;  1U5K A;  3K7U C;  1AE3 A;  1X65 A;  3L0O A;  3PUZ A;  3U4V A;  1IBM L;  3I4N H;  4Y52 H;  2HQL A;  2YV5 A;  4DUY L;  3TS0 A;  2I5L X;  4JBM A;  1PA6 A;  1KRS A;  4B3R Q;  4IJL A;  2JA5 H;  2ZJP A;  1KIX A;  2FXQ A;  2JA8 G;  2GVB A;  4LF6 L;  3GTQ H;  4X65 L;  4HIM A;  3ER0 A;  3T1Y L;  4K0K L;  3KJP A;  4DV1 Q;  3CD6 A;  3M7N A;  1VQ7 A;  1OXT A;  3H15 A;  4HJA A;  3STB D;  1VQA A;  4JV5 L;  4X6A H;  2JE6 I;  5JJI A;  1TWF H;  4AQY L;  4HJ7 A;  2CQO A;  1XJV A;  2JQO A;  2A8V A;  2BH8 A;  1E1O A;  1PV4 A;  4J15 A;  4APV A;  4X62 L;  2R6G A;  1A62 A;  3I4M H;  4UY8 C;  4X64 Q;  2Q2I A;  1C7Y A;  3FP9 A;  3GTM H;  4DR7 Q;  1FJG Q;  4P72 A;  4L5Q A;  1A0I A;  3W1G A;  5IWA Q;  4MTN A;  4PZ6 A;  4O2D A;  1PH4 A;  1HH2 P;  1Y1W H;  4JYA L;  1TWC H;  3M9B A;  3PGZ A;  1VQ6 A;  1XNQ Q;  5C0X G;  4BXX G;  1I6H H;  4OX9 L;  2E5L Q;  2CWP A;  1LM0 A;  3M4Q A;  3OTO L;  4L5T A;  1HNZ Q;  1OXS C;  4JI1 Q;  3BZC A;  1PYS B;  4JI8 Q;  3I7F A;  4GKK Q;  5M3M G;  1QVF A;  1Q8K A;  1VQ4 A;  4LFA Q;  4GNX A;  5C0X I;  4PG3 A;  1E24 A;  1KXL A;  1NJI C;  1KAW A;  4LFC L;  2PI2 E;  4BBS G;  4GLX A;  1CSP A;  1N33 Q;  2NVY H;  3SGI A;  3S1M H;  3S1Q H;  4IFD G;  4KHP Q;  4BXX H;  4A93 H;  4JI3 Q;  4BA2 I;  4A3M H;  2MFI A;  3ICE A;  4QQB X;  1X3G A;  3CW2 C;  4LW1 A;  4C3J H;  1B8A A;  1GVP A;  2MNA A;  1KQS A;  1EFW A;  1YHQ A;  4GOP C;  4JG2 A;  3RR5 A;  3CPF A;  3J81 c;  1BVS A;  3A5Z B;  1U0L A;  1IBK L;  4IFD I;  1Y1V G;  2AWO A;  4DV0 L;  3BU2 A;  1SLJ A;  1EIF A;  5FJ8 G;  2RHS B;  5FLM H;  1E3P A;  3K80 C;  4JCV E;  3JAM i;  2OTL A;  3H3V H;  3PO2 G;  3PIP A;  1N34 Q;  4LF4 L;  3TRZ A;  2PQA A;  2E8G A;  4HJ5 A;  4GLA C;  5EAY A;  4DV2 Q;  4DR1 L;  4PZ8 A;  4BA1 I;  2UU9 L;  5LMN L;  2R93 G;  3PUY A;  1J5E L;  3RZO H;  2HT1 A;  4WJ3 M;  2N49 A;  2JA9 A;  2Y0S G;  1OXU A;  3RZD H;  4DR4 L;  1L1O A;  1ASY A;  1VQE A;  1MIU A;  1OXV A;  3CCU A;  4DR3 L;  1JJC B;  2CKZ B;  2ZTE A;  4BBR H;  1NY4 A;  3I2Z A;  3RN2 A;  1K8A C;  4ALP A;  4B3T L;  2JA7 H;  4DV5 Q;  1GM5 A;  1T9H A;  1XPU A;  2HHH Q;  3ULP A;  2RF4 A;  3AFP A;  1VQC A;  2V1C C;  3CC2 A;  2IX0 A;  2NN6 G;  5JEA J;  4A3L G;  4B3S Q;  5BR8 Q;  1PH6 A;  2Y0S E;  2DUD A;  4R4T A;  3NEM A;  4A3G H;  2E2J H;  1BBW A;  4LNQ A;  4LF5 Q;  4JI0 Q;  4A3D H;  3M4P A;  1XPO A;  1WYD A;  1UE5 A;  5LMU L;  1PH2 A;  4A3E G;  1N9W A;  1NMG A;  1PYB A;  2VQF L;  1D7Q A;  2NN6 I;  2VUM H;  2UUC L;  4JI7 L;  5C4X G;  2MO0 A;  1EYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...