4HJ9A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (cggttacggt)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 37
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj9A00
4A3BH 5IYCH 3E9IA 4A3FH 2PI2A 4LUVA 1LYLA 4YCUA 3G6EA 3NELA 2MFIA 3NBHB 4C3IH 3KF6B 2PI2E 4ME3A 3M4PA 2OWOA 1KIXA 2WB1G 4GKKL 4R4CA 1L1OC 1JJCB 4LF5Q 2NVQH 3KJPA 1H95A 4LF9L 1Y1VG 3UDGA 4DAMA 3UE1A 3I7FA 1PHJA 1YHBA 4DR4L 1HNZL 4P71A 5GQOA 4GKKQ 4B3RL 1KQSA 2UUBQ 4JI7Q 4DR3Q 3S2DH 1Q82C 1WCMH 4DR4Q 1E24A 1RIPA 2WP8J 2C35B 1HNZQ 4B3RQ 1CKOA 4X6AH 3HOXH 2UUAL 4A3MH 3CCSA 1EIFA 2UU9L 2LXKA 2KHJA 3K0XA 3RLNA 3E0EA 3W5OA 4A3IG 2ES2A 1B70B 5IP7H 2ZTDA 5M5YH 1QZGA 3I4OA 4NXNL 4BBRH 2UU9Q 1VCIA 2IT1A 4ALPA 1YHQA 1C7YA 3AFPA 1WI5A 1L1OB 4GLVB 5HY6A 3CD6A 4YY3L 2Q2UA 1RL2A 3K7AH 1VQ7A 4KHPQ 4XIGS 3I4NH 3S1QH 1Z47A 1EFWA 2UXDL 2OQ0A 4A3GH 3CCVA 3L7ZC 2VUMH 3K7UC 1IYJB 3CC4A 1MJCA 3UE0A 2UXDQ 3RLOA 1BBUA 4JG2A 5BR8Q 4JCVE 1PA6A 1I50H 3J80i 5IYBG 3MXNB 1Y1WG 3S1NH 4OX9L 4PZ6A 1XPUA 1N34L 1XJVA 2EQSA 4JI6L 1QVCA 4P75A 5C3EH 4GN4B 4LF7L 2N49A 1I94Q 2KHIA 1N34Q 4JI6Q 1BBWA 5FLXc 1HH2P 4LF7Q 1E22A 1JT8A 3MEFA 3J81i 1KRTA 2AWNA 5HGQA 4GNXC 1JE5A 2BH2A 1UWVA 1S3OA 4DK6C 3I55A 4DR2Q 4DR5L 1E1TA 2HHHL 3HOUH 2K50A 3ULPA 1VQ6A 4A3JH 5C4XH 4B3MQ 4PZ7A 1CKNB 3HOZH 4A3CG 3STBC 4LF6Q 1SMXA 3GTOH 4HIKA 4B3SL 3B6YA 3PGZA 2BH8A 1XMQL 3ICEA 4BY7G 2EIFA 1X55A 3NEMA 1X9NA 3PIOA 5LMUQ 3S1RH 3KLWA 1JJ2A 4B3SQ 2R7ZG 1XMQQ 4BY1H 3U50C 5IP9G 2ZTEA 4DR6Q 3G4SA 1YJNA 2JA7H 2R6GA 4J15A 4DKAC 4X64Q 2XGTA 4GNXB 1G6PA 4KHZA 1QZHA 3PIPA 4LF8Q 1SN8A 4HJAA 3L0OA 4R4OA 1K73C 2Z6KC 2V1CC 3HOVH 1MIUA 4JYAQ 3TEHB 2DUDA 4L5TA 5GROA 1EYGA 2ALYB 4O2DA 4HJ7A 2JJQA 2UXBL 3ERSX 1G291 4IPCA 4QIWE 4DV6Q 1Q12A 5M5WH 3UDIA 1WJJA 3CW2C 4WJ3M 1TWAH 4X65L 3KF8B 1K83H 3F2BA 3S16H 1VQJA 3DM3A 5GAHC 4A3LH 3PUZA 1AH9A 5C44G 1U0LA 3FHWA 5E7NA 1K0RA 1BVSA 2UXCQ 4X65Q 2R93G 1V1QA 3PO2G 1X54A 4JBKA 1M1KC 3CMAA 4Y7NH 1EIYB 4R4TA 2R92G 4LFBQ 1XMOQ 4A75A 1NTGA 2NZHA 5C44H 1VQGA 4QGUA 4O0AA 1U5KA 4LW1A 1PH1A 1X6OA 1Q1EA 2YU9H 4XTCS 4HIMA 2RHSB 2B63G 2I0QA 3EBEA 4YWMA 2UUCL 3FP9A 4UP8A 4DV7Q 4B3TL 4DV2L 4A3EG 2JA9A 1QUQA 4AIMA 5M3MG 4PZ8A 4A3DH 4BXXG 2JA8G 1NJIC 1J5EL 4DV0L 4B3TQ 3J80c 2WFWA 4AQYQ 3BU2A 4UPAA 4TQUS 1PH5A 3U58A 2JA5G 1XNRL 1IBLL 3PUXA 4DUZL 1I5FA 2N3SA 1YNXA 5M3MH 3AEVA 2BA0A 3PUYA 4GN5A 5IYDG 1VQOA 2AHOB 3S17H 3RR5A 3RNUA 3RZOH 3BJUA 3F1ZA 4GKJL 4QJFA 4HIOA 3ULLA 3KDFA 2K5VA 2VL6A 1K8AC 1UE7A 1WOCA 4LFCL 4A93G 1SR3A 2PQAA 3HKZE 3U4VA 2MNAA 1FJGL 3M4OH 2VS1A 2B3GA 4IPGA 2NVXH 2Y0SE 2AKWB 4LF9Q 4LFCQ 1O7IA 2BA1A 3JC66 1Q86C 2CWAA 1C9OA 3TS0A 2A1AA 4X62L 4JOIC 3RLFA 3J7A5 2IHEA 1Y1VH 4PG3A 3T1HL 4IFDI 3KOJA 2UUAQ 2VZAA 3KF6A 1JJGA 1G51A 4P74A 1FGUA 4OWTB 2A19A 4QY7A 4HIDA 2DGYA 3T1HQ 1VQBA 1UE1A 2R7FA 2HQLA 1R9TH 3TREA 4JI5L 1CUKA 4NXNQ 4JBJA 2N8NA 1N33L 4A3IH 4RMFA 2MO1A 4YCWA 3GO5A 3PUVA 4MZ9A 1HR0L 4YY3Q 4GLXA 4YHHL 2H5XA 3JAMc 4HJ9A 5FLMG 1VQDA 4LF4L 1JMCA 3AFQA 1VQAA 1AE3A 1PYSB 2E2JH 1N33Q 1V43A 1HR0Q 3J81j 2WAQE 5FJ8G 4YHHQ 1TXYA 3L2PA 1YI2A 2Q2IA 5DLQE 3H3VI 4GOPC 4LF4Q 4KLKA 3CCLA 2ZJQA 3UDXA 4OX9Q 2E8GA 5FLMH 5IY0A 3G48A 2I5LX 1LTLA 1TWFH 3T1YL 4AYBE 1YZ6A 1L1OA 3GD7A 5FJ8H 5IYBH 1Y1WH 2NVYH 2Q2HA 1L0WA 4DR7L 4DPGA 1CSPA 1GVPA 2GVAA 3T1YQ 4IPHA 1X65A 1AE2A 4UY8C 1VQFA 2GN5A 4R1JA 1D8LA 3PO3G 4DR7Q 1VQPA 2F4VL 4DR5Q 1VQ9A 1VQCA 4AH6A 2HHHQ 1CSQA 1N8RC 2ZTCA 4GOPB 4JI2L 4JOIA 1PH3A 2F4VQ 1KAWA 3CMEA 4YWKA 1HR0W 5C0XI 1Z9FA 4OXPA 1OTCA 1NBWA 4A3CH 4IJHA 1OXVA 3ULJA 4A4IA 4DV3L 4JI0L 4LNQA 1XNQL 4JI8L 3GTPH 4BY7H 2ATWA 1P16A 4YCVA 2GVBA 2VQEL 2VY3A 1YJ9A 2D0OA 4JI0Q 4DV3Q 1QVFA 2WB1E 1MJEA 5IP9H 4IOAA 1V9PA 2VQEQ 1CKNA 2HIXA 1HJPA 2D0PA 1N32L 1HZAA 3K81C 5JJKA 2YTXA 2UXBQ 5LMNL 3CQZH 2K52A 4OWXB 1N32Q 1KD1C 5K36G 2QGQA 1I3QH 1GM5A 5EAYA 3CPWA 1PH8A 2K5NA 3A5UA 2KCTA 3OTOL 1FL0A 4BA1I 3CCMA 4GNXA 1J6QA 2E2IH 3SGIA 1I6HH 3STBD 1UE6A 3M4QA 1E7ZA 3CPFA 5GAGC 4LUOA 1GKHA 3CCJA 4X66L 2VNUD 4GS3A 5AJ3L 1EOVA 2IX1A 2RHQB 1YJWA 4JV5L 3E9HA 3PSIA 2ZJPA 1C0AA 3GTLH 3M9BA 3I56A 3HOYG 2R93H 5AJ3Q 1X3FA 4IO9A 3PO2H 1OXTA 1LUZA 2K5HA 2E5LL 2R92H 4UP9A 5M3FG 1N36L 3RN2A 2YTVA 4DV5L 3M3YH 3BZKA 4JI4L 4OO1I 4JI3L 1VQLA 2UUCQ 3CCEA 2HT1A 1VQMA 1Y14B 2YYZA 2N78A 3FKIG 1PFSA 4C2MH 4DV2Q 2OTJA 3K8AA 4DV5Q 1TWCH 1UEBA 2B63H 4JI4Q 4OONA 1J5EQ 2Z6KA 4RG1A 3PV0A 3CCUA 4DV0Q 4JI3Q 2MQHA 1YHAA 5LMNW 5GADC 3CCRA 4A3EH 2KENA 2ZM6L 2JA6G 1SROA 3CAMA 1K9MC 1XNRQ 1E3PA 2JA8H 1IBLQ 4BXXH 4TVAB 2LXJA 3ZJYC 2QA4A 4DUZQ 1XTDA 4HJ8A 1HZCA 1IBKL 2ZM6Q 3J81c 1PH6A 4DV1L 1UE5A 5JEAJ 4EQ5A 4DV4L 2JA5H 2R7ZH 1KXLA 1IBMQ 1A63A 4A3BG 5IYCG 4YWLA 4A3FG 1Q8KA 1IXRA 1M90C 4DV4Q 4GKJQ 1PH2A 2AWOA 3J7ZC 1PH7A 2A8VA 5IYDH 1YEZA 2NZOA 4UP7A 1SRUA 4R4IA 5M5XH 3F2CA 3BZCA 1HZ9A 2EXDA 5IE8A 1Q46A 1FJGQ 2XTIA 1A62A 3F8TA 2JQOA 1PYBA 3A0JA 1KC8C 2B29A 1X3GA 3W1GA 4A93H 1A8VA 4MNOA 3PF5A 1SFOH 4LF5L 3DLLA 4R4QA 3TQYA 3Q8DA 1LM0A 4X62Q 2F52A 1WCMG 3CF5A 3KYHC 4LWCA 2QEXA 3K80C 3S2HH 3HOXG 1W3SA 1YVCA 2UUBL 4JI7L 4NXML 1MKHA 1CKMA 4DR3L 3NENA 4A3MG 4IFDJ 1XNQQ 2E2HH 1E1OA 1EUJA 2JK8A 4FDBA 2IY5B 2ID0A 5IP7G 1VQ8A 4NXMQ 4BBRG 1Q7YC 4JI5Q 3GTGH 3TS2A 2OTLA 4H02A 2K4KA 2NN6I 2F3IA 1HZBA 3I2ZA 1GD7A 3I4NG 2OCEA 1S72A 2AMCB 1TWGH 1XPOA 4A3GG 4OO1G 2CKZB 2VUMG 1P8LA 4KHPL 1NE3A 3GTMH 3IRBA 1VQIA 3ER0A 2OQKA 4NPSA 3OYYA 4HJ5A 1VQNA 5JEAG 1EQQA 1KRSA 3EN2A 3GTJH 4L5QA 4IPDA 1WFQA 5BR8L 1B7YB 3HFZB 1VQ4A 2FXQA 4BA2I 4OWWB 5C3EG 1IL2A 1EWIA 3A74A 4PMWA 4DNIA 4IOCA 1NY4A 2R7DA 4GLAC 3S24A 2IHFA 3PUWA 1OXXK 4MTNA 5H1SE 3S14H 1I94L 1KHIA 1QVGA 1VQHA 3HOUG 3LGJA 4NB3A 4P72A 1JB7A 1PH9A 4KI0A 1PVOA 4A3JG 4JI2Q 5C4XG 3PO3H 3HOZG 4DR2L 1A0IA 3AYHB 1NMGA 3OW2A 5IT9c 1VQEA 2MO0A 5ELNA 3H0GG 1IBML 3D0FA 4B3ML 3M7NA 2I5MX 4IFDG 4LF6L 1X56A 2CFMA 1Q1BA 5C0XJ 4K0KL 4BY1G 2IX0A 3RN5A 1KL9A 1OXUA 3A5ZB 1GO3E 1OXSC 3CP0A 4P73A 4JI8Q 2JA7G 3I4MG 1S40A 2L15A 5LMUL 4EX5A 4DK3C 2JEBI 1Q81C 3HKZG 4LFAL 3KJOA 1ASZA 3H0GH 4K0KQ 3PF4A 2K14A 4GOPA 4DR6L 2Y0SG 5JJLA 4JBWA 4JC0A 4X64L 3HOVG 4BBSG 4LFAQ 2CCZA 4LF8L 5J3BA 3F2DA 1PH4A 5ELOA 3U4ZA 2NN6G 4DUYL 4APVA 5LMNQ 1ASYA 3I4MH 1D7QA 4JYAL 3TRZA 1B8AA 4A3KG 2I5HA 1FVIA 2YTYA 1XPRA 2ZJRA 1X3EA 4DUYQ 3KFUA 4BBSH 2Z0SA 4Y52H 3OTOQ 4DV6L 4L5SA 3GDEA 3CXCA 3W1BA 4A3LG 4JI1L 4DR1L 1EQRA 3G71A 1NMFA 4GN3B 4QL5A 3JAMi 3VDYA 4X66Q 4A3KH 1VQ5A 2JEAI 2NVTH 3H3VH 2PMZE 4JI1Q 3M85A 4DR1Q 4JV5Q 1HNXL 2UXCL 4DAYB 3H15A 4WJ4A 3GTKH 4C3HH 5IWAL 4POFA 1QUQB 2WAQG 3S15H 1PV4A 3GTQH 1N9WA 2ASBA 1HNXQ 5JJIA 3HOYH 1WYDA 5IWAQ 3D31A 3AQQA 2E5LQ 3HOWG 4LFBL 1N36Q 1K3RA 4LUZA 3UDFA 1K8GA 1SLJA 1T9HA 2CQOA 4JBMA 1HNWL 1YBYA 2D62A 5M3FH 4AYBG 4A76A 5C0XG 2VW9A 4A3DG 2VQFL 3RZDH 4DV7L 3WWVA 2RF4A 1HNWQ 3FKIH 3HOWH 1YIJA 2LSSA 1W2BA 2CWPA 4L5RC 2VQFQ 4POGA 2HIVA 2K75A 3HKSA 3KDFB 5GAEC 4AQYL 3PCOB 1L2FA 4IJLA 1IZ6A 1IBKQ 4QQBX 4DV1Q 2PQAB 2JA6H 2Q2TA 2KBNA 2JE6I 2KCMA 4C3JH 5C4JH 2PNHA 1XMOL 3S1MH 3CCQA 1VS0A 1VQKA 1SE8A 3EIVA 2RCNA 3CC2A 1TWHH 1DGSA 1YITA 1BKBA 2YV5A 3CC7A
chains in the Genus database with same CATH superfamily
2PI2A 4YCUA 5EPJA 3KF6B 5G3LD 1RTNA 4R8NA 3PQIA 2WB1G 1JJCB 5F2DA 4LF5Q 2NVQH 2E2IB 1H95A 3SXHA 3I7FA 4DA2A 4P71A 4Y7NB 4B3RL 2AQ2B 2EPBA 2RVLA 4KY7A 4DR4Q 1E24A 2WP8J 2C35B 4X6AH 1U4MA 1RDPD 3JAML 2UUAL 1PMRA 2KHJA 2ES2A 3NSWA 2MP1A 1FYCA 1S5FD 2UU9Q 1AFPA 3HRZC 3AU7A 1YHQA 4UAIA 4ZAIA 1WI5A 1L1OB 3CD6A 5HY6A 3TN2A 1VQ7A 1EFWA 5JVG3 2WV6D 4A3GH 4OO1H 3KLSA 2VUMH 5FLXL 5G3LF 1IYJB 2N55A 1BBUA 4JG2A 3EJIA 1A2TA 3S1NH 4OX9L 3S17B 2FFKB 4FF1A 4NP5A 2GA4B 1XYIA 1XJVA 2EQSA 3IKJA 4ULLA 1SNMA 1KLGD 1WTRA 1QNUA 4K14A 1BBWA 5FLXc 3R3OA 4H13C 1E22A 4LF7Q 3C1EA 3MEFA 5HGQA 4TKOB 1JE5A 3TP5A 4DK6C 3I55A 4DR2Q 4DR5L 2H1EA 1E1TA 5C4XH 4A93B 3BYYB 1ESRA 1SFOB 4PZ7A 3R2TA 3NXWA 3I8ZA 2JP1A 3X3MA 1SMXA 4ZYSA 3B6YA 3OW7A 5KIXA 4ZKCB 1EEFD 2EJGC 4BY1H 2K1BA 2NB0A 1GUNA 2E2HB 4HN7A 2ZTEA 3VR6A 3MWYW 4X64Q 4DKAC 1G6PA 1QZHA 1SN8A 1TY2A 2F0OA 3L0OA 3SDZA 1K73C 2V1CC 3HOVH 3TEHB 5I2XA 2DUDA 4L5TA 1TS2A 2SEBD 2UXBL 3Q6SA 2JJQA 1G291 3BDCA 2E76C 3HS0C 4KD4A 3U9OA 1WJJA 1Y1WB 3KF8B 3S16H 3DM3A 3PUZA 3FPUB 1U0LA 3FHWA 3I91A 2UXCQ 2B2WC 3M7GA 1KABA 1X54A 4HCEA 3P75A 2A6HD 2EY5A 2RSNA 3SR1A 5KEEA 1CM9A 1B4OA 1U5KA 1SNQA 1W6KA 2BDOA 1PH1A 4XTCS 3O13A 4MHEA 5KNDA 3LNNA 4DAYA 1QUQA 4AIMA 2X6LA 4PZ8A 3MXGA 1CFMA 1NJIC 4BXXG 1IL8A 2LMCB 3DEOA 5KNCA 3J80E 2Z4HA 2L4NA 4TQUS 1FR3A 1ESFA 1IBLL 3A55A 4DUZL 3R2IA 2K05A 1YNXA 3AEVA 4GN5A 5T1IA 1ILQA 3BJUA 3F1ZA 2FMCA 4HIOA 2BE5D 3KDFA 3DMUA 1WOCA 4A93G 4DXGA 2B3GA 4IPGA 1WTVA 2Y0SE 1SDFA 4LFCQ 1O7IA 2BA1A 3L9AX 1DOMA 1Q86C 3EQLC 4RWSC 4IN3A 2IHEA 3OSOA 3NBHA 2UUAQ 1B53A 1JJGA 5T1GA 3HG9A 1FGUA 2O4XA 2A19A 3CU7A 1CQFA 1VQBA 1UE1A 5ELBA 5KYIA 1N33L 5EPKA 5FLMG 5HGTA 3RZDB 2E2JH 4KKSA 3T56B 3FKIB 4RA8A 1LTRD 4I7AA 4F88A 4B9WA 3UDXA 4DGZA 1R4PB 3NP8A 4OX9Q 1YNNC 5IY0A 3G48A 1LTLA 2CW0D 4XT3B 1YZ6A 3V2TA 2NVYH 1XTCD 2Q2HA 1L0WA 1SE2A 4DPGA 1CSPA 4DR7Q 1SXTA 2TMPA 4L63B 2RBMA 1F2ZA 4DR5Q 1VQCA 2K01A 4AH6A 2IX3A 1HTLD 3K58A 3NUCA 3MXPA 3D4WA 3C3LA 3S2DB 3EVQA 1DXMA 2RKSA 4JI0L 1XNQL 4JI8L 5E1FA 3E6ZX 4YCVA 2VQEL 3VR3A 4WFN3 1BCPC 1CKNA 1GHKA 1N32L 1HZAA 3K81C 5JJKA 2YTXA 2UXBQ 1BQQT 3K7AB 3QR8A 4ILWA 3I4NB 4OWXB 2QGQA 3QB3A 4FF3A 1G2TA 1FL0A 1JQYD 3A8KE 4CJ0B 4BA1I 2E2IH 2ZT9C 3V96A 1UE6A 1E7ZA 4LUOA 4C3HG 1BXTA 2IX1A 2KEEA 2RHQB 5K36H 2K7VA 1C0AA 3M9BA 3GV6A 4F87A 3TP6A 1IYUA 1AW7A 1OXTA 1SE3A 1WVLA 1K8MA 2E5LL 5FO8B 1BDOA 2YTVA 3M3YH 3HOUB 1VQLA 4FF4A 3X3NA 1Y14B 2YYZA 3FKIG 4DV5Q 1RD9D 3HOZB 4RKLA 4JI4Q 4RG1A 3PV0A 4OWWB 3MC0B 2MQHA 3H0GB 3LWUA 4G7HC 1H9JA 3CAMA 1LTSD 2F0HA 4BXXH 1IBLQ 4DUZQ 2LXJA 1XTDA 4XT1B 2ZM6Q 1QG7A 3J81E 4ZQ3A 2R7ZH 1A63A 1VMCA 5IYCG 4YWLA 1SNPA 2Q8RE 4OEMB 1S5CD 3CRKC 2AWOA 1WTHA 1PH2A 2A8VA 3LX0A 3W3AA 1RHPA 2NZOA 3MAQA 1SRUA 4ODGA 5C4HA 3BZCA 4KKTA 4CDFC 1E2VA 1LT4D 1PYBA 1H9SA 1X3GA 1TWAB 4A93H 3MA2B 3PF5A 1SFOH 1GUSA 3Q8DA 5J22A 1LM0A 3GTQB 2F52A 4PV1C 3HOYB 3M4YA 4JI7L 4NXML 1MKHA 3NENA 1SNCA 2XSCA 5D3IB 2E2HH 5DEHA 1U9RA 5IP7G 1HPCA 1VQ8A 2EOTA 1V1OA 3GTGH 3TS2A 1J8IA 2D2CC 4H02A 3FVQA 2FINB 2ICEC 3I4NG 1EQVA 3ND8A 1XPOA 1SYCA 2CKZB 1P8LA 1NE3A 3MFGA 3ER0A 1KAAA 2OQKA 2RCFA 3DM1A 3S1MB 4JK1C 1D5XC 3GTJH 3MEHA 1WFQA 3HFZB 4HSPA 5C3EG 2F1MA 4K5XA 3A74A 3S24A 4PQXA 2J7ZA 3NWTA 2KECA 1D5ZC 1I94L 1D5MC 1KHIA 3RZOB 4XQQA 2NVQB 3HOUG 3LGJA 4NB3A 1PH9A 5JAVA 4A3JG 3HOZG 4MN3A 2ICIA 5IT9E 1GOZA 1LTAD 3H0GG 2EY6A 4B3ML 1WTWA 1X56A 2CFMA 5C0XJ 1Y1VB 1XNQQ 1OXUA 3L3OC 1STBA 2L1BA 1OXSC 3CP0A 4JI8Q 4YIJA 1S40A 4KY5A 1L0YB 4DK3C 2JEBI 4LFAL 4K0KQ 3CHBD 4WRDA 2OT2A 2B2UC 4GOPA 4JBWA 5JVH3 4IUVA 1V8QA 4CDCC 4FYDA 4K8JA 4A3IB 4A3GB 2NN6G 1CK1A 2VUMB 1ASYA 1TY0A 1B2TA 4JYAL 3TRZA 4HR7B 1LABA 1NSNS 1RF2D 4XYOA 4DUYQ 1IW7D 1X3EA 2Z0SA 3S1NB 4L5SA 3FEWX 4A3LG 5EKIA 4GN3B 1F2LA 3H3VH 1PTOC 2JEAI 2EE1A 4JI1Q 3M85A 1TWFB 2B2TC 4LMQD 4DAYB 3H15A 4K2LA 5CV6A 4C3HH 1QUQB 3S15H 3EA6A 2QW7A 4KHVA 1HNXQ 5IWAQ 2E5LQ 5C4XB 1HTPA 3P20A 1JE4A 1SLJA 1S5DD 1T9HA 3IL8A 2A5HA 3K5NA 4A76A 4QMGA 5JPMC 5C0XG 2EY1A 2EYJA 2MJ8A 3RZDH 2ENBA 2RF4A 2D9UA 4N9TA 3FKIH 1W2BA 2VQFQ 2QEJC 2K75A 3Q23A 3KDFB 5GAEC 1TVXA 4QQBX 2DN8A 3W2DA 3HOVB 2PNHA 3QIAA 1SE8A 3EIVA 4HCSA 1DGSA 3HP3A 1YITA 1XMOQ 4P2CB 5IYCH 3G6EA 3NELA 2MFIA 3NBHB 3VR2A 1DOLA 1KNAA 2E2DC 1NR2A 3M4PA 4KTAA 4QUCA 5DM73 1KIXA 1EIHA 1DD2A 4CJ1B 1HHVA 1Y1VG 4DAMA 4DR4L 1YHBA 4GKKQ 3D6WA 4JW0A 5GQOA 2EYLA 2WAQB 1KQSA 4JI7Q 5LHY1 1QE6A 3S2DH 1NNXA 3GTLB 1RIPA 4PMCA 1HNZQ 2EZVA 1GUOA 4LK1C 1EIFA 2UU9L 5EGTA 3K0XA 3RLNA 3E0EA 1PDQA 4A3IG 5IP7H 3E0JA 1SYDA 3I4OA 4AYBB 4NXNL 4IUPA 1C7YA 2IT1A 4ALPA 3AFPA 4GLVB 2Q2UA 1RL2A 3K7AH 1SBBB 3I4NH 3S1QH 1Z47A 3IAYA 4DF7A 3L7ZC 3KUPA 3K7UC 3CC4A 1MJCA 3RLOA 2JA8B 4JCVE 4RGOS 1I50H 5IYBG 3MXNB 1XPUA 2JA5B 5C3EH 2DJGC 4LF7L 2N49A 1I94Q 2KHIA 1EYCA 1MSGA 4ZRZA 1IKMA 3GV3A 5FLXE 4GNXC 3J81i 2BH2A 2FMMA 1I4GA 3A8IE 3S9WA 2HCIA 3HOUH 2J4XA 3ULPA 1KDAA 4A3JH 2BOSA 4B3MQ 1CKNB 2B8GA 3HGBA 3NPPA 3HOZH 1YNJC 1JWSD 4HIKA 3OMGA 4BY7G 5IGDA 1X9NA 3PIOA 3S1RH 5DM63 1F9QA 1JJ2A 4B3SQ 5IP9G 3G4SA 1YJNA 2R6GA 4HJAA 4RHSA 1H9KA 1HUNA 4JYAQ 1MIUA 3Q22A 1DONA 1EYGA 2NN6H 1B9NA 4IPCA 4QIWE 1Q12A 4RKBA 3MXUA 1SYGA 1TWAH 3TP8A 2NVYB 3F2BA 1AH9A 3K5LA 4A3LH 1MGSA 5E7NA 4IALA 1K0RA 1MD2D 1SEBD 2PCFB 2F0PA 1V1QA 3NTKA 3OWFA 1M1KC 2LKVA 1NTGA 1FGBD 1X6OA 1CTMA 5CORA 1Q1EA 2YU9H 3URYA 3SE0A 4HMIA 2B63G 2I0QA 2IPKD 2PZWA 2UUCL 5LL6X 1LTID 2JA9A 5C0XH 2NZ1D 2JA8G 1J5EL 4B3TQ 2WFWA 3BU2A 4IUNA 2JA5G 2EJMA 2AUKA 1I5FA 1STHA 1H9SB 2NTSA 3BG3A 3BVMA 5M9OA 5M3MH 2O5JC 2BA0A 3D8GA 3RR5A 4S3SA 3RZOH 2A69C 4GKJL 5I2YA 2VL6A 1EYAA 4LFCL 2BCOA 3HKZE 5KRUA 3PIO3 1QILA 1EY5A 1NAPA 2CWAA 2NVTB 3DXJC 4M8AA 1PXUA 3RLFA 2LY7A 1L0XB 1SMYC 1Y1VH 4OELB 5HURA 1KTKA 3KOJA 2VZAA 2DJFC 3M3YB 2BDNA 4TRDA 4HIDA 3T1HQ 2R7FA 4FO2A 2WKCA 3TREA 2KHSA 4U68A 4JI5L 4L8JA 4NXNQ 4JBJA 2N8NA 4KJNA 2JN4A 4A3IH 1WTPA 4GLXA 2RDGA 3JAMc 2B8FA 1ET6A 4K6DA 3AFQA 1VQAA 5D65A 1U4RA 1V43A 2Q2IA 1EIGA 4HMJA 3QO2A 4KLKA 2R7ZB 2JXMB 5FO7B 4N8X1 4CBVA 3J7AV 1HXYD 3E5SA 4RGTA 2DNEA 4FVMA 2JA6B 1UUPA 2CH4A 1TWFH 1Q90A 4IUTA 5FJ8H 2CHBD 2KCNA 5IYBH 4DR7L 2GVAA 3T1YQ 1XX8A 4Q0FA 3I90A 1X65A 3PO3G 2GN5A 3TSSA 2IWHA 4OL7A 2AQ3B 4GOPB 1PH3A 2F0UA 1F9SA 3CMEA 4YWKA 1EY7A 5I6YA 2CH4W 2M9VA 5ELEA 5C0XI 1OTCA 5EQ0A 3GTGB 2VXWA 4IJHA 3ULJA 1WCMB 5FKAC 1RKNA 4LNQA 4BY7H 3QWNA 4IURA 2KCCA 1YJ9A 5ELFA 2D0OA 4DV3Q 1QVFA 4G57A 5IP9H 3I72A 3TZUA 1YNND 3FPPA 1U4PA 3CQZH 5JJZA 3GTJB 5I6WA 5K36G 2EYOA 1GM5A 3CPWA 3A5UA 1G2SA 2KCTA 3OTOL 1J6QA 2P5ZX 2PZUA 3SGIA 1QCBD 2XVSA 5CV5A 3STBD 2VNUD 3CCJA 4GS3A 4JV5L 5A35A 2MGSA 1ENAA 1SAPA 1Q8IA 2K28A 3TDQA 3GTLH 1G91A 5AJ3Q 3BVZA 4C1NK 3MZ5A 1TR5A 1LUZA 4XYQA 1AZPA 4DV5L 4N9PA 4JI4L 4OO1I 4MIUA 3CCEA 2UUCQ 1VQMA 2EYFA 1BCPD 5CR3A 1RJTA 2B63H 4J6HA 5KYLA 2F0KA 1J5EQ 3CCUA 2R7ZG 2VB2X 5LMNW 5GADC 3CCRA 1WTQA 2KENA 2ZM6L 2JA6G 1E3PA 2JA8H 4C3JG 3R8BA 2AQ1B 4TVAB 3TP7A 3ZJYC 3K59A 1K3BC 1SJED 2JA5H 1T5XD 3ND9A 3KLSX 4A3FG 4X3SA 1AZQA 4GKJQ 4C3IG 3J7ZC 3E3XA 2B2WA 4EGVA 5M5XH 3F2CA 2DY8A 1Q46A 1Y8NB 3A0JA 2B29A 1A8VA 1K83B 4C3HB 3DLLA 4R4QA 3S15B 1BCPF 5C4ZA 1WCMG 3KYHC 4RCOA 4LWCA 2QEXA 3K80C 3S2HH 3HOXG 1II3A 3KK7A 1CKMA 1EY6A 4JVZA 1DM0B 1E1OA 2JK8A 2N88A 1D1KA 4WORA 2NBFA 2XWBB 4BBRG 1Q7YC 4JI5Q 1S5ED 4LJZC 2DY7A 5EBCA 5BN5A 2Z1CA 2F3IA 3DHQA 1GD7A 2NUCA 1S72A 1LT6D 4KHPL 1SNOA 1VQIA 2EXZA 4KN4C 1DYQA 4QB4A 4WJWA 1B7YB 2FXQA 4BA2I 2FHTA 1EL0A 3UI2A 1WD0A 4DNIA 3NE5B 1ZXTA 5H1SE 4K5WA 1MBYA 1QVGA 1VQHA 2HCCA 4HSVA 2PW5A 2AUJD 3PO3H 2F3WA 3AYHB 1NMGA 3OW2A 2HD3A 1PRTB 5EKKA 4LF6L 5ELDA 1PFMA 4K0KL 2EDGA 2IX0A 3D4RA 1GO3E 5A2QL 2JA7G 4EX5A 1Q81C 2A6HC 4F8MA 3Q0AA 1G6ZA 3NK9A 4DR6L 5JJLA 2Y0SG 3DWAA 3S1QB 2Z9HA 3WOEA 4LF8L 1EOTA 1B9MA 3HZXA 2F0IA 3U4ZA 4DUYL 3T53B 3R93A 4APVA 1D7QA 3BVGA 2YTYA 1D6EC 1I50B 3KFUA 4BBSH 4Y52H 3OTOQ 3MFYA 3CXCA 2EYHA 4JI1L 1EQRA 5C3EB 1I6VC 1VQ5A 3VDYA 1LLRD 2NVTH 4DR1Q 4JV5Q 4DFAA 1HNXL 2D5DA 3GTKH 2QDLA 5IWAL 1HRJA 1N9WA 5JJIA 1WYDA 4A3JB 2BE5C 3ITPA 4LUZA 1K8GA 2F03A 2D62A 4J1MA 2VW9A 2VQFL 3S1RB 4DV7L 3G6JB 1HNWQ 1YIJA 1PLFA 2LSSA 2CWPA 4C1NI 2PW7A 2F0TA 2HIVA 3GTPB 1M4VA 4AQYL 4IJLA 1F9PA 2JA6H 1JORA 2Q2TA 2JE6I 2KCMA 4C3JH 1XMOL 2RCNA 1TWHH 5LL6S 1PTOD 1BF4A 2YV5A 1LT3D 3E9IA 4A3FH 4LUVA 1LYLA 2B2VC 4C3IH 3VA7A 2PI2E 4K6LA 1VF7A 3F2UA 4ME3A 4OIKA 1EYDA 4GKKL 3NHHA 1L1OC 3T51B 1CHQD 1WTXA 3UE1A 1HNZL 1G8ZD 2VB3X 1Q82C 1WCMH 2A73B 2PYKA 3HOXH 2YU9B 2K6AA 3PO2B 3CCSA 1LV9A 5EJWA 1B70B 1QZGA 4BBRH 1VCIA 1SNDA 1PTOF 4C2MB 4KHPQ 4YY3L 2SOBA 1CQVA 4XIGS 2K5QA 2EJFC 5IGGA 2L11A 5D14A 3CCVA 1AEXA 3V05A 2UXDQ 4DN4M 2X6GA 1O7ZA 5M3MB 3J7AF 5AFWA 5NUCA 3J80i 1XWEA 4PZ6A 2A6EC 1QVCA 4P75A 1N34Q 4JI6Q 1HH2P 1JT8A 2AWNA 1UWVA 1QJOA 1MSHA 3FRPB 3KLRA 1VQ6A 4A3CG 4LF6Q 3A7LA 4B3SL 5FOBB 2EY2A 3PGZA 3ICEA 2EIFA 2A68D 1IKLA 1X55A 3NEMA 3C46A 1JOOA 3KLWA 1PZID 1PTOH 3NTHA 4RCNA 1XMQQ 1PRTD 4DR6Q 2JA7H 2XN9C 2XGTA 2C9OA 3PIPA 4LF8Q 1JOKA 1ET9A 2Z6KC 3OPOA 3SVMA 3OIPA 4DXFA 4O2DA 4HJ7A 1KDBA 3ERSX 3H91A 4WJ3M 1K83H 2I07B 3NQTA 2R93G 4X65Q 3FMCA 4CHTB 3PO2G 1PYWD 2B2YC 3S14B 4JBKA 4LAAA 2L0CA 3VR5A 1EIYB 3D3RA 4R4TA 2R92G 3DWPA 4A75A 2NZHA 1PRTF 5C44H 4QGUA 1KLUD 5IOCA 2PO4A 4FP5D 1HQRD 2RHSB 2B2UA 2Q8IB 5FO9B 1GUWA 4YWMA 2K33A 4UP8A 4DV7Q 4B3TL 4DV2L 4C56C 4BY7B 2G9HD 5M3MG 4AQYQ 1BNZA 1JICA 1T5EA 1Y8OB 1F2YA 2N3SA 4KN7C 4ZKBB 2HQEA 3CQZB 3PUYA 4NDXA 1VQOA 1TS3A 3T13A 3I4LA 2AHOB 4CKBA 4QJFA 2B2TA 2XIWA 2K5VA 2NYZD 1K8AC 1SR3A 2B39A 2PQAA 3M4OH 5EPLA 2VS1A 3I70A 5CV4A 2AKWB 2CVRA 5I9PA 4CKCA 3PIP3 4IQZA 4X62L 4JOIC 1DCZA 1QWYA 3I3CA 4PG3A 3T1HL 4F7XA 4H7BA 1G51A 4P74A 5BN3A 1ZEQX 4QY7A 2DGYA 3Q24A 1LACA 2HQLA 1CUKA 2B63B 3OIQA 4YCWA 2MO1A 1HCZA 4MZ9A 3PUVA 1E2WA 4YY3Q 2H5XA 2F0NA 3K5OA 2L12A 3JAME 2WINB 1JMCA 1PYSB 3AMUA 1HR0Q 2OEOA 2WAQE 3J81j 5FJ8G 4YHHQ 1S5BD 1GHJA 5DLQE 3L2PA 3H3VI 2A69D 1F9RA 4LF4Q 3CCLA 1O7LA 3RD4A 1B3AA 2KVMA 2I5LX 1SE4A 3T1YL 1O80A 4AYBE 3GD7A 1C4QA 1EQTA 1J9OA 5M5XB 2E74C 4TSSA 2KOLA 4IPHA 3QJYA 1SMYD 1AE2A 4UY8C 1VQFA 1D8LA 4QF4A 1VQPA 3P7JA 5E4XA 1IW7C 2K5DA 1A3VA 1N8RC 4JI2L 4JOIA 2F4VQ 3S2HB 2XRQD 1ICFB 4ZCKA 1HQMC 1HR0W 2Q8TA 4IUUA 2TSSA 1K8OA 4OXPA 2F0GA 1JCKB 4A3CH 1OXVA 3GTPH 1B44D 4DV3L 5K5PA 1P16A 2VY3A 4A3MB 2M00A 1I4PA 2WB1E 2KEDA 2PMZB 2F0SA 1TS5A 1V9PA 4IOAA 3C1FA 1AN8A 4H0LC 2D0PA 1F77A 5LMNL 1Y8PB 5JOBA 4XDXA 3A56A 1GUTA 1PH8A 2ZXPA 2C5CA 5CV8A 4GNXA 4DU9A 2SDFA 1PFNA 5AJ3L 1BCPB 2PPBC 2R93H 3PO3B 1X3FA 3PO2H 2R92H 5M3FG 4O1NA 3BZKA 1MI2A 2OXPA 4DNRB 2HT1A 4DV2Q 4C2MH 2N78A 3NTIA 1PFSA 3K8AA 1A2UA 4OONA 4JI3Q 1CHPD 1YHAA 2RA4A 1TKWB 4K5VA 2QA4A 1IBKL 2F0MA 1CA5A 1PH6A 4DV1L 2QDBA 5JEAJ 1K0SA 4ZUJA 2X69A 1WTOA 1MHWC 5E3FA 4A3BG 5DAUA 1M90C 4DV4Q 4BBSB 1TIID 1PH7A 1YEZA 4R4IA 2SNSA 1HA5A 5IE8A 3F8TA 5TSSA 5M5WB 3W1GA 3GTKB 2RSOA 5CV9A 3AB9A 3BDOA 3TQYA 2WIIB 1STYA 4X62Q 4O42A 3CF5A 2V4DA 3K0YA 3BDLA 1A3TA 1W3SA 1YVCA 4ME5A 2UUBL 4A3MG 4DR3L 3QOJA 4IFDJ 4FDBA 1S4ZA 4HEDA 1STAA 1ZYRC 2K4KA 2NN6I 1HZBA 3I2ZA 2Z8LA 2OCEA 5I9OA 2AMCB 4KK7A 1VDZA 3GTMH 4A3DB 3OYYA 3H09A 4C3JB 1VQNA 1JR0D 5JEAG 1KRSA 1TWHB 4L5QA 5BR8L 1TS4A 1W6JA 1I4QA 2ZXRA 1QOHA 4A3FB 1NY4A 3CKIB 4C3IB 2IHFA 4CDEC 3PUWA 3K6OA 4UHVA 3S14H 1B3QA 5IIFA 2PQEA 1PVOA 2LFNA 4JI2Q 1SYFA 1C8CA 1A0IA 2NVXB 1VQEA 1STNA 5ELNA 1ILPA 3M7NA 4IFDG 3OMCA 3HOXB 4OGQC 1Q1BA 3TMEA 1IBMQ 1KL9A 4K2KA 4P73A 2KA7A 2L15A 5LMUL 2KJXA 3HKZG 4BBRB 1ASZA 1BOSA 2K14A 1R9TB 4BBSG 5L37A 1EU4A 2QF7A 3F2DA 1PH4A 5ELOA 1H9MA 2IL8A 5LMNQ 3I4MH 3BZDB 4UDUC 3A7AB 3NWSA 1XPRA 2IJ0A 5C6AA 2ZJRA 5A2QE 4DAPA 1VMPA 1GXDC 2I46A 4DV6L 3W1BA 4V0BA 4DR1L 4ZK9B 4R9WA 4QL5A 5CV7A 3JAMi 4A3KH 3T16A 3D4DA 3TBIB 4V190 1KNEA 5ISRA 4WJ4A 2EVBA 4FNFA 1HUMA 1DJRD 1PV4A 3D31A 3AQQA 4LFBL 5DNFA 4BWGB 3WOFA 3K57A 3UDFA 4JBMA 4KMUC 4KJOA 1HNWL 3OHXC 1YBYA 5M3FH 1CT1D 4A3DG 2F0VA 1PTOB 3HOWH 5FK9C 4L5RC 2JA7B 1A15A 2MHVA 4POGA 4HAEA 4IZ8A 3HKSA 2O2LD 3VR4A 1IBKQ 1V1PA 3WDNA 4DV1Q 2PQAB 2Y0SB 2KBNA 4RAUC 1SYBA 3CCQA 1JC7A 4DK0A 1XXGA 3CC7A 4A3BH 1HFNA 3SK4A 2WKDA 1I3QB 2RQXA 4KY6A 5J39A 2OWOA 2L5TA 3IFDA 4R4CA 1H9RA 3KJPA 4BS9A 1I6HB 2ZXOA 4LF9L 4QUFA 3UDGA 1PHJA 5IGBA 1ZKOA 2UUBQ 4DR3Q 5IGFA 5C44B 4B3RQ 1CKOA 4EQOA 2PNRC 4A3MH 2OF1A 4OIJA 2LXKA 3W5OA 2ZTDA 5M5YH 1BO0A 3H6MA 3BYTB 3SEBA 1I4HA 5KGUA 1LTGD 4X3UA 2UXDL 1TWCB 2G9DA 2OQ0A 2NWGA 4A3EB 3UE0A 4KKUA 5BR8Q 1E2ZA 3DWQA 4FXKC 1PA6A 5CGKA 4CDDC 5JEAH 1Y1WG 1N34L 1I4XA 4JI6L 3HEJA 4GN4B 1EY4A 1TQOA 3M4OB 1ENFA 4R8IA 1KRTA 1S3OA 2K03A 3PMFA 2QCPX 3EFXD 2HHHL 3MVVA 2K50A 3ERQA 1NCVA 2EYPA 2F0DA 4CGYB 5J1ZA 3STBC 3GTOH 3MXNA 4QCLA 2BH8A 1XMQL 2O5IC 4IFDH 5LMUQ 4XQNA 3U50C 1PZJD 4RHRA 1HFGA 4Q5VA 1LTTD 4J15A 1UNSA 2A74C 4GNXB 4KHZA 4R4OA 4G7OC 1IHZA 1Z7TA 2F0QA 4PMBA 1BBXC 2A6ED 1TWGB 5GROA 1Q3LA 1RODA 2ALYB 4NKLA 4RGNA 4DV6Q 4HTHA 1FD7D 3GQBA 5M5WH 4EVOA 3UDIA 1CA6A 3CW2C 4X65L 1VQJA 5GAHC 4FXDA 2MPMA 5C44G 1BVSA 4EQNA 3SK6A 3C2PA 2R3ZA 3J80L 3CMAA 2H4OA 4Y7NH 4LFBQ 1A3UA 1CZWA 1VQGA 1TT2A 4O0AA 4LW1A 3CRLC 2QILA 4HIMA 4NMZA 3EBEA 5D3DA 4OHJA 4ID6A 1QB5D 3FP9A 1C48A 1O78A 4A3EG 2MUYA 2KUMA 4A3DH 1NR4A 3P1HA 4DV0L 3J80c 4NW2A 4UPAA 1JB3A 4XXEA 1PH5A 3U58A 1XNRL 4H44C 3PUXA 1X3PA 2HDMA 3ONAB 5IYDG 2G5DA 2SNMA 2F0FA 3KBXA 5I4DA 3S17H 3RNUA 4I65A 3ULLA 2HDLA 2LS01 1SYEA 1AP0A 1UE7A 3U4VA 2MNAA 1FJGL 2NVXH 2CW0C 4LF9Q 2R93B 2F0EA 5E4WC 3J7YW 3JC66 2J0TD 1C9OA 4DK1A 3TS0A 4B9XA 2A1AA 1SSOA 3J7A5 1A6XA 5COYA 4IFDI 3NQIA 2XNAC 2R92B 1PZKD 3KF6A 3I73A 4OWTB 3VA5A 1PFBA 2F0WA 1R9TH 2XRSD 1ML0D 4RMFA 3GO5A 1HR0L 4YHHL 1HA6A 5EBDA 4HJ9A 1QNKA 1VQDA 4LF4L 1N33Q 3VYTA 1AE3A 1GUGA 1TXYA 1YI2A 1STGA 4GOPC 5KNBA 2ZJQA 2B2VA 2F3VA 2E8GA 4KV6A 2F0JA 4FXGC 5FLMH 5C4JB 2PZTA 3K5MA 4ABNA 1CI3M 4MTKA 1L1OA 1EWCA 1Y1WH 1BR9A 3T4AC 1GVPA 2IW3A 4R1JA 2F4VL 3IFTA 1VQ9A 2HHHQ 1CSQA 2ZTCA 1OO9B 5IGEA 4PNYA 1KAWA 3ZYYX 2JYOA 3LWEA 1ONLA 4I7ZC 3GP7A 1Z9FA 1NBWA 2Z6BA 4A4IA 5C3WA 2ATWA 1ICWA 2QKIC 1E0BA 2GVBA 4JI0Q 1MJEA 1EZ6A 5ELCA 3SK5A 5IGCA 2VQEQ 3GTMB 2HIXA 1HJPA 2NTTA 1B50A 1I4RA 1VF5C 2F0LA 2K52A 1Y69U 1N32Q 1KD1C 1I3QH 4DNTB 5EAYA 2RDHA 2K5NA 3CCMA 1I6HH 1YNJD 2L55A 2Z4IA 3M4QA 1UAPA 3CPFA 5GAGC 1GKHA 4X66L 1EOVA 1YJWA 4DAVA 3E9HA 3PSIA 2ZJPA 1EZ8A 3I56A 3HOYG 2M2LA 4GZYC 5CYUA 1LO5D 4IO9A 1FNUA 1F2MA 1STEA 2DNCA 1V1PB 2K5HA 3KF8A 4UP9A 4X3KA 4JPBW 3SHLA 5CC4A 5CBAE 5IODA 1EEID 3J81L 1BUVT 3RN2A 1N36L 4JI3L 4N8FA 2OTJA 3DUZA 1TWCH 1UEBA 1CZGA 2Z6KA 4DV0Q 3H3VC 1EY8A 4X3TA 4A3EH 3KBGA 1SROA 1K9MC 1XNRQ 1EFID 4HJ8A 4BY1B 1HZCA 1FNWA 1NUCA 3J81c 3I4MB 1UE5A 4B08A 4DV4L 4EQ5A 1KXLA 4IUQA 1R4QB 3N6RA 1Q8KA 1IXRA 4CKEA 5IYDH 4UP7A 1HZ9A 2B2YA 2EXDA 4A3KB 2XTIA 5CMDA 1FJGQ 1A62A 1TU2B 2JQOA 4G7ZC 1KC8C 1EY0A 1DOKA 5C5LA 4MNOA 1RTOA 3S16B 4LF5L 2JSOA 5CBEE 4E6IA 3RMHA 3QG1A 1SJHD 1EUJA 2IY5B 2RDFA 4RH6A 2ID0A 4NXMQ 5M3FB 3FDTA 3NBIA 1IYVA 3QOLA 2OTLA 1K28A 3HOWB 3VYSA 2K04A 1LT5D 1TWGH 4A3GG 4OO1G 2VUMG 3SK8A 2K5WA 3IRBA 4K8IA 3MHBA 3OOCA 4NPSA 1LTBD 4HJ5A 1FNVA 2A68C 1EQQA 2EYMA 3EN2A 4IPDA 3D6CA 1VQ4A 4M1UB 1PRTC 4Z9CB 5IT9L 1IL2A 1EWIA 4A3BB 4PMWA 4RGMA 2K32A 4IOCA 2R7DA 4GLAC 1X3QA 1OXXK 4MTNA 4G4KA 1D2BA 1U4LA 1JOQA 1JB7A 4P72A 4KI0A 5EKLA 5C4XG 4L6TB 4DR2L 2HUGA 5IT9c 1Z6HA 2MO0A 1IBML 1ZYRD 3D0FA 2WB1B 2I5MX 4XQJA 4QIWB 1UEAB 4BY1G 3RN5A 3A5ZB 1EY9A 3I4MG 3DEPA 5M5YB 4ZLTF 3KJOA 3H0GH 1GJXA 3PF4A 2KQ3A 4JC0A 4X64L 3HOVG 4LFAQ 2CCZA 2XWJB 5J3BA 2L9HA 3H94A 3OWEB 1KDCA 1RCVD 1B8AA 4A3KG 2I5HA 1DZ1A 1FVIA 2E2JB 4U673 2F4IA 3A54A 1B1ZA 3GDEA 3N52A 4CJ2C 3G71A 4ZUIA 3VYRA 1NMFA 5JPNC 1WD1A 4X66Q 2PMZE 1JWMD 4FF2A 2UXCL 3TZDA 5BN4A 4POFA 1EU3A 2WACA 2WAQG 3MTSA 3VYUA 3GTQH 1M8AA 2ASBA 3G7LA 1ENCA 2E75C 3HOYH 1O7YA 3HOWG 2CQAA 1N36Q 4RFBA 1K3RA 2FJ2A 3GTOB 2CQOA 3U9SA 4AYBG 5C3XA 4KD3A 3A8JE 4EQPA 3WWVA 3RUZA 1EWHA 3HKZB 3PCOB 1L2FA 5C5MA 1IZ6A 3EROA 3BS1A 1JWUD 4J8QA 2R61A 5C4JH 3S1MH 1X32A 1VS0A 1VQKA 3CC2A 1D1IA 1BKBA
chains in the Genus database with same CATH topology
4A3BH 5IYCH 3E9IA 4A3FH 2PI2A 4LUVA 1LYLA 4YCUA 3G6EA 3NELA 2MFIA 3NBHB 4C3IH 3KF6B 2PI2E 4ME3A 3M4PA 2OWOA 1KIXA 2WB1G 4GKKL 4R4CA 1L1OC 1JJCB 4LF5Q 2NVQH 3KJPA 1H95A 4LF9L 1Y1VG 3UDGA 4DAMA 3UE1A 3I7FA 1PHJA 1YHBA 4DR4L 1HNZL 4P71A 5GQOA 4GKKQ 4B3RL 1KQSA 2UUBQ 4JI7Q 4DR3Q 3S2DH 1Q82C 1WCMH 4DR4Q 1E24A 1RIPA 2WP8J 2C35B 1HNZQ 4B3RQ 1CKOA 4X6AH 3HOXH 2UUAL 4A3MH 3CCSA 1EIFA 2UU9L 2LXKA 2KHJA 3K0XA 3RLNA 3E0EA 3W5OA 4A3IG 2ES2A 1B70B 5IP7H 2ZTDA 5M5YH 1QZGA 3I4OA 4NXNL 4BBRH 2UU9Q 1VCIA 2IT1A 4ALPA 1YHQA 1C7YA 3AFPA 1WI5A 1L1OB 4GLVB 5HY6A 3CD6A 4YY3L 2Q2UA 1RL2A 3K7AH 1VQ7A 4KHPQ 4XIGS 3I4NH 3S1QH 1Z47A 1EFWA 2UXDL 2OQ0A 4A3GH 3CCVA 3L7ZC 2VUMH 3K7UC 1IYJB 3CC4A 1MJCA 3UE0A 2UXDQ 3RLOA 1BBUA 4JG2A 5BR8Q 4JCVE 1PA6A 1I50H 3J80i 5IYBG 3MXNB 1Y1WG 3S1NH 4OX9L 4PZ6A 1XPUA 1N34L 1XJVA 2EQSA 4JI6L 1QVCA 4P75A 5C3EH 4GN4B 4LF7L 2N49A 1I94Q 2KHIA 1N34Q 4JI6Q 1BBWA 5FLXc 1HH2P 4LF7Q 1E22A 1JT8A 3MEFA 3J81i 1KRTA 2AWNA 5HGQA 4GNXC 1JE5A 2BH2A 1UWVA 1S3OA 4DK6C 3I55A 4DR2Q 4DR5L 1E1TA 2HHHL 3HOUH 2K50A 3ULPA 1VQ6A 4A3JH 5C4XH 4B3MQ 4PZ7A 1CKNB 3HOZH 4A3CG 3STBC 4LF6Q 1SMXA 3GTOH 4HIKA 4B3SL 3B6YA 3PGZA 2BH8A 1XMQL 3ICEA 4BY7G 2EIFA 1X55A 3NEMA 1X9NA 3PIOA 5LMUQ 3S1RH 3KLWA 1JJ2A 4B3SQ 2R7ZG 1XMQQ 4BY1H 3U50C 5IP9G 2ZTEA 4DR6Q 3G4SA 1YJNA 2JA7H 2R6GA 4J15A 4DKAC 4X64Q 2XGTA 4GNXB 1G6PA 4KHZA 1QZHA 3PIPA 4LF8Q 1SN8A 4HJAA 3L0OA 4R4OA 1K73C 2Z6KC 2V1CC 3HOVH 1MIUA 4JYAQ 3TEHB 2DUDA 4L5TA 5GROA 1EYGA 2ALYB 4O2DA 4HJ7A 2JJQA 2UXBL 3ERSX 1G291 4IPCA 4QIWE 4DV6Q 1Q12A 5M5WH 3UDIA 1WJJA 3CW2C 4WJ3M 1TWAH 4X65L 3KF8B 1K83H 3F2BA 3S16H 1VQJA 3DM3A 5GAHC 4A3LH 3PUZA 1AH9A 5C44G 1U0LA 3FHWA 5E7NA 1K0RA 1BVSA 2UXCQ 4X65Q 2R93G 1V1QA 3PO2G 1X54A 4JBKA 1M1KC 3CMAA 4Y7NH 1EIYB 4R4TA 2R92G 4LFBQ 1XMOQ 4A75A 1NTGA 2NZHA 5C44H 1VQGA 4QGUA 4O0AA 1U5KA 4LW1A 1PH1A 1X6OA 1Q1EA 2YU9H 4XTCS 4HIMA 2RHSB 2B63G 2I0QA 3EBEA 4YWMA 2UUCL 3FP9A 4UP8A 4DV7Q 4B3TL 4DV2L 4A3EG 2JA9A 1QUQA 4AIMA 5M3MG 4PZ8A 4A3DH 4BXXG 2JA8G 1NJIC 1J5EL 4DV0L 4B3TQ 3J80c 2WFWA 4AQYQ 3BU2A 4UPAA 4TQUS 1PH5A 3U58A 2JA5G 1XNRL 1IBLL 3PUXA 4DUZL 1I5FA 2N3SA 1YNXA 5M3MH 3AEVA 2BA0A 3PUYA 4GN5A 5IYDG 1VQOA 2AHOB 3S17H 3RR5A 3RNUA 3RZOH 3BJUA 3F1ZA 4GKJL 4QJFA 4HIOA 3ULLA 3KDFA 2K5VA 2VL6A 1K8AC 1UE7A 1WOCA 4LFCL 4A93G 1SR3A 2PQAA 3HKZE 3U4VA 2MNAA 1FJGL 3M4OH 2VS1A 2B3GA 4IPGA 2NVXH 2Y0SE 2AKWB 4LF9Q 4LFCQ 1O7IA 2BA1A 3JC66 1Q86C 2CWAA 1C9OA 3TS0A 2A1AA 4X62L 4JOIC 3RLFA 3J7A5 2IHEA 1Y1VH 4PG3A 3T1HL 4IFDI 3KOJA 2UUAQ 2VZAA 3KF6A 1JJGA 1G51A 4P74A 1FGUA 4OWTB 2A19A 4QY7A 4HIDA 2DGYA 3T1HQ 1VQBA 1UE1A 2R7FA 2HQLA 1R9TH 3TREA 4JI5L 1CUKA 4NXNQ 4JBJA 2N8NA 1N33L 4A3IH 4RMFA 2MO1A 4YCWA 3GO5A 3PUVA 4MZ9A 1HR0L 4YY3Q 4GLXA 4YHHL 2H5XA 3JAMc 4HJ9A 5FLMG 1VQDA 4LF4L 1JMCA 3AFQA 1VQAA 1AE3A 1PYSB 2E2JH 1N33Q 1V43A 1HR0Q 3J81j 2WAQE 5FJ8G 4YHHQ 1TXYA 3L2PA 1YI2A 2Q2IA 5DLQE 3H3VI 4GOPC 4LF4Q 4KLKA 3CCLA 2ZJQA 3UDXA 4OX9Q 2E8GA 5FLMH 5IY0A 3G48A 2I5LX 1LTLA 1TWFH 3T1YL 4AYBE 1YZ6A 1L1OA 3GD7A 5FJ8H 5IYBH 1Y1WH 2NVYH 2Q2HA 1L0WA 4DR7L 4DPGA 1CSPA 1GVPA 2GVAA 3T1YQ 4IPHA 1X65A 1AE2A 4UY8C 1VQFA 2GN5A 4R1JA 1D8LA 3PO3G 4DR7Q 1VQPA 2F4VL 4DR5Q 1VQ9A 1VQCA 4AH6A 2HHHQ 1CSQA 1N8RC 2ZTCA 4GOPB 4JI2L 4JOIA 1PH3A 2F4VQ 1KAWA 3CMEA 4YWKA 1HR0W 5C0XI 1Z9FA 4OXPA 1OTCA 1NBWA 4A3CH 4IJHA 1OXVA 3ULJA 4A4IA 4DV3L 4JI0L 4LNQA 1XNQL 4JI8L 3GTPH 4BY7H 2ATWA 1P16A 4YCVA 2GVBA 2VQEL 2VY3A 1YJ9A 2D0OA 4JI0Q 4DV3Q 1QVFA 2WB1E 1MJEA 5IP9H 4IOAA 1V9PA 2VQEQ 1CKNA 2HIXA 1HJPA 2D0PA 1N32L 1HZAA 3K81C 5JJKA 2YTXA 2UXBQ 5LMNL 3CQZH 2K52A 4OWXB 1N32Q 1KD1C 5K36G 2QGQA 1I3QH 1GM5A 5EAYA 3CPWA 1PH8A 2K5NA 3A5UA 2KCTA 3OTOL 1FL0A 4BA1I 3CCMA 4GNXA 1J6QA 2E2IH 3SGIA 1I6HH 3STBD 1UE6A 3M4QA 1E7ZA 3CPFA 5GAGC 4LUOA 1GKHA 3CCJA 4X66L 2VNUD 4GS3A 5AJ3L 1EOVA 2IX1A 2RHQB 1YJWA 4JV5L 3E9HA 3PSIA 2ZJPA 1C0AA 3GTLH 3M9BA 3I56A 3HOYG 2R93H 5AJ3Q 1X3FA 4IO9A 3PO2H 1OXTA 1LUZA 2K5HA 2E5LL 2R92H 4UP9A 5M3FG 1N36L 3RN2A 2YTVA 4DV5L 3M3YH 3BZKA 4JI4L 4OO1I 4JI3L 1VQLA 2UUCQ 3CCEA 2HT1A 1VQMA 1Y14B 2YYZA 2N78A 3FKIG 1PFSA 4C2MH 4DV2Q 2OTJA 3K8AA 4DV5Q 1TWCH 1UEBA 2B63H 4JI4Q 4OONA 1J5EQ 2Z6KA 4RG1A 3PV0A 3CCUA 4DV0Q 4JI3Q 2MQHA 1YHAA 5LMNW 5GADC 3CCRA 4A3EH 2KENA 2ZM6L 2JA6G 1SROA 3CAMA 1K9MC 1XNRQ 1E3PA 2JA8H 1IBLQ 4BXXH 4TVAB 2LXJA 3ZJYC 2QA4A 4DUZQ 1XTDA 4HJ8A 1HZCA 1IBKL 2ZM6Q 3J81c 1PH6A 4DV1L 1UE5A 5JEAJ 4EQ5A 4DV4L 2JA5H 2R7ZH 1KXLA 1IBMQ 1A63A 4A3BG 5IYCG 4YWLA 4A3FG 1Q8KA 1IXRA 1M90C 4DV4Q 4GKJQ 1PH2A 2AWOA 3J7ZC 1PH7A 2A8VA 5IYDH 1YEZA 2NZOA 4UP7A 1SRUA 4R4IA 5M5XH 3F2CA 3BZCA 1HZ9A 2EXDA 5IE8A 1Q46A 1FJGQ 2XTIA 1A62A 3F8TA 2JQOA 1PYBA 3A0JA 1KC8C 2B29A 1X3GA 3W1GA 4A93H 1A8VA 4MNOA 3PF5A 1SFOH 4LF5L 3DLLA 4R4QA 3TQYA 3Q8DA 1LM0A 4X62Q 2F52A 1WCMG 3CF5A 3KYHC 4LWCA 2QEXA 3K80C 3S2HH 3HOXG 1W3SA 1YVCA 2UUBL 4JI7L 4NXML 1MKHA 1CKMA 4DR3L 3NENA 4A3MG 4IFDJ 1XNQQ 2E2HH 1E1OA 1EUJA 2JK8A 4FDBA 2IY5B 2ID0A 5IP7G 1VQ8A 4NXMQ 4BBRG 1Q7YC 4JI5Q 3GTGH 3TS2A 2OTLA 4H02A 2K4KA 2NN6I 2F3IA 1HZBA 3I2ZA 1GD7A 3I4NG 2OCEA 1S72A 2AMCB 1TWGH 1XPOA 4A3GG 4OO1G 2CKZB 2VUMG 1P8LA 4KHPL 1NE3A 3GTMH 3IRBA 1VQIA 3ER0A 2OQKA 4NPSA 3OYYA 4HJ5A 1VQNA 5JEAG 1EQQA 1KRSA 3EN2A 3GTJH 4L5QA 4IPDA 1WFQA 5BR8L 1B7YB 3HFZB 1VQ4A 2FXQA 4BA2I 4OWWB 5C3EG 1IL2A 1EWIA 3A74A 4PMWA 4DNIA 4IOCA 1NY4A 2R7DA 4GLAC 3S24A 2IHFA 3PUWA 1OXXK 4MTNA 5H1SE 3S14H 1I94L 1KHIA 1QVGA 1VQHA 3HOUG 3LGJA 4NB3A 4P72A 1JB7A 1PH9A 4KI0A 1PVOA 4A3JG 4JI2Q 5C4XG 3PO3H 3HOZG 4DR2L 1A0IA 3AYHB 1NMGA 3OW2A 5IT9c 1VQEA 2MO0A 5ELNA 3H0GG 1IBML 3D0FA 4B3ML 3M7NA 2I5MX 4IFDG 4LF6L 1X56A 2CFMA 1Q1BA 5C0XJ 4K0KL 4BY1G 2IX0A 3RN5A 1KL9A 1OXUA 3A5ZB 1GO3E 1OXSC 3CP0A 4P73A 4JI8Q 2JA7G 3I4MG 1S40A 2L15A 5LMUL 4EX5A 4DK3C 2JEBI 1Q81C 3HKZG 4LFAL 3KJOA 1ASZA 3H0GH 4K0KQ 3PF4A 2K14A 4GOPA 4DR6L 2Y0SG 5JJLA 4JBWA 4JC0A 4X64L 3HOVG 4BBSG 4LFAQ 2CCZA 4LF8L 5J3BA 3F2DA 1PH4A 5ELOA 3U4ZA 2NN6G 4DUYL 4APVA 5LMNQ 1ASYA 3I4MH 1D7QA 4JYAL 3TRZA 1B8AA 4A3KG 2I5HA 1FVIA 2YTYA 1XPRA 2ZJRA 1X3EA 4DUYQ 3KFUA 4BBSH 2Z0SA 4Y52H 3OTOQ 4DV6L 4L5SA 3GDEA 3CXCA 3W1BA 4A3LG 4JI1L 4DR1L 1EQRA 3G71A 1NMFA 4GN3B 4QL5A 3JAMi 3VDYA 4X66Q 4A3KH 1VQ5A 2JEAI 2NVTH 3H3VH 2PMZE 4JI1Q 3M85A 4DR1Q 4JV5Q 1HNXL 2UXCL 4DAYB 3H15A 4WJ4A 3GTKH 4C3HH 5IWAL 4POFA 1QUQB 2WAQG 3S15H 1PV4A 3GTQH 1N9WA 2ASBA 1HNXQ 5JJIA 3HOYH 1WYDA 5IWAQ 3D31A 3AQQA 2E5LQ 3HOWG 4LFBL 1N36Q 1K3RA 4LUZA 3UDFA 1K8GA 1SLJA 1T9HA 2CQOA 4JBMA 1HNWL 1YBYA 2D62A 5M3FH 4AYBG 4A76A 5C0XG 2VW9A 4A3DG 2VQFL 3RZDH 4DV7L 3WWVA 2RF4A 1HNWQ 3FKIH 3HOWH 1YIJA 2LSSA 1W2BA 2CWPA 4L5RC 2VQFQ 4POGA 2HIVA 2K75A 3HKSA 3KDFB 5GAEC 4AQYL 3PCOB 1L2FA 4IJLA 1IZ6A 1IBKQ 4QQBX 4DV1Q 2PQAB 2JA6H 2Q2TA 2KBNA 2JE6I 2KCMA 4C3JH 5C4JH 2PNHA 1XMOL 3S1MH 3CCQA 1VS0A 1VQKA 1SE8A 3EIVA 2RCNA 3CC2A 1TWHH 1DGSA 1YITA 1BKBA 2YV5A 3CC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B H;  5IYC H;  3E9I A;  4A3F H;  2PI2 A;  4LUV A;  1LYL A;  4YCU A;  3G6E A;  3NEL A;  2MFI A;  3NBH B;  4C3I H;  3KF6 B;  2PI2 E;  4ME3 A;  3M4P A;  2OWO A;  1KIX A;  2WB1 G;  4GKK L;  4R4C A;  1L1O C;  1JJC B;  4LF5 Q;  2NVQ H;  3KJP A;  1H95 A;  4LF9 L;  1Y1V G;  3UDG A;  4DAM A;  3UE1 A;  3I7F A;  1PHJ A;  1YHB A;  4DR4 L;  1HNZ L;  4P71 A;  5GQO A;  4GKK Q;  4B3R L;  1KQS A;  2UUB Q;  4JI7 Q;  4DR3 Q;  3S2D H;  1Q82 C;  1WCM H;  4DR4 Q;  1E24 A;  1RIP A;  2WP8 J;  2C35 B;  1HNZ Q;  4B3R Q;  1CKO A;  4X6A H;  3HOX H;  2UUA L;  4A3M H;  3CCS A;  1EIF A;  2UU9 L;  2LXK A;  2KHJ A;  3K0X A;  3RLN A;  3E0E A;  3W5O A;  4A3I G;  2ES2 A;  1B70 B;  5IP7 H;  2ZTD A;  5M5Y H;  1QZG A;  3I4O A;  4NXN L;  4BBR H;  2UU9 Q;  1VCI A;  2IT1 A;  4ALP A;  1YHQ A;  1C7Y A;  3AFP A;  1WI5 A;  1L1O B;  4GLV B;  5HY6 A;  3CD6 A;  4YY3 L;  2Q2U A;  1RL2 A;  3K7A H;  1VQ7 A;  4KHP Q;  4XIG S;  3I4N H;  3S1Q H;  1Z47 A;  1EFW A;  2UXD L;  2OQ0 A;  4A3G H;  3CCV A;  3L7Z C;  2VUM H;  3K7U C;  1IYJ B;  3CC4 A;  1MJC A;  3UE0 A;  2UXD Q;  3RLO A;  1BBU A;  4JG2 A;  5BR8 Q;  4JCV E;  1PA6 A;  1I50 H;  3J80 i;  5IYB G;  3MXN B;  1Y1W G;  3S1N H;  4OX9 L;  4PZ6 A;  1XPU A;  1N34 L;  1XJV A;  2EQS A;  4JI6 L;  1QVC A;  4P75 A;  5C3E H;  4GN4 B;  4LF7 L;  2N49 A;  1I94 Q;  2KHI A;  1N34 Q;  4JI6 Q;  1BBW A;  5FLX c;  1HH2 P;  4LF7 Q;  1E22 A;  1JT8 A;  3MEF A;  3J81 i;  1KRT A;  2AWN A;  5HGQ A;  4GNX C;  1JE5 A;  2BH2 A;  1UWV A;  1S3O A;  4DK6 C;  3I55 A;  4DR2 Q;  4DR5 L;  1E1T A;  2HHH L;  3HOU H;  2K50 A;  3ULP A;  1VQ6 A;  4A3J H;  5C4X H;  4B3M Q;  4PZ7 A;  1CKN B;  3HOZ H;  4A3C G;  3STB C;  4LF6 Q;  1SMX A;  3GTO H;  4HIK A;  4B3S L;  3B6Y A;  3PGZ A;  2BH8 A;  1XMQ L;  3ICE A;  4BY7 G;  2EIF A;  1X55 A;  3NEM A;  1X9N A;  3PIO A;  5LMU Q;  3S1R H;  3KLW A;  1JJ2 A;  4B3S Q;  2R7Z G;  1XMQ Q;  4BY1 H;  3U50 C;  5IP9 G;  2ZTE A;  4DR6 Q;  3G4S A;  1YJN A;  2JA7 H;  2R6G A;  4J15 A;  4DKA C;  4X64 Q;  2XGT A;  4GNX B;  1G6P A;  4KHZ A;  1QZH A;  3PIP A;  4LF8 Q;  1SN8 A;  4HJA A;  3L0O A;  4R4O A;  1K73 C;  2Z6K C;  2V1C C;  3HOV H;  1MIU A;  4JYA Q;  3TEH B;  2DUD A;  4L5T A;  5GRO A;  1EYG A;  2ALY B;  4O2D A;  4HJ7 A;  2JJQ A;  2UXB L;  3ERS X;  1G29 1;  4IPC A;  4QIW E;  4DV6 Q;  1Q12 A;  5M5W H;  3UDI A;  1WJJ A;  3CW2 C;  4WJ3 M;  1TWA H;  4X65 L;  3KF8 B;  1K83 H;  3F2B A;  3S16 H;  1VQJ A;  3DM3 A;  5GAH C;  4A3L H;  3PUZ A;  1AH9 A;  5C44 G;  1U0L A;  3FHW A;  5E7N A;  1K0R A;  1BVS A;  2UXC Q;  4X65 Q;  2R93 G;  1V1Q A;  3PO2 G;  1X54 A;  4JBK A;  1M1K C;  3CMA A;  4Y7N H;  1EIY B;  4R4T A;  2R92 G;  4LFB Q;  1XMO Q;  4A75 A;  1NTG A;  2NZH A;  5C44 H;  1VQG A;  4QGU A;  4O0A A;  1U5K A;  4LW1 A;  1PH1 A;  1X6O A;  1Q1E A;  2YU9 H;  4XTC S;  4HIM A;  2RHS B;  2B63 G;  2I0Q A;  3EBE A;  4YWM A;  2UUC L;  3FP9 A;  4UP8 A;  4DV7 Q;  4B3T L;  4DV2 L;  4A3E G;  2JA9 A;  1QUQ A;  4AIM A;  5M3M G;  4PZ8 A;  4A3D H;  4BXX G;  2JA8 G;  1NJI C;  1J5E L;  4DV0 L;  4B3T Q;  3J80 c;  2WFW A;  4AQY Q;  3BU2 A;  4UPA A;  4TQU S;  1PH5 A;  3U58 A;  2JA5 G;  1XNR L;  1IBL L;  3PUX A;  4DUZ L;  1I5F A;  2N3S A;  1YNX A;  5M3M H;  3AEV A;  2BA0 A;  3PUY A;  4GN5 A;  5IYD G;  1VQO A;  2AHO B;  3S17 H;  3RR5 A;  3RNU A;  3RZO H;  3BJU A;  3F1Z A;  4GKJ L;  4QJF A;  4HIO A;  3ULL A;  3KDF A;  2K5V A;  2VL6 A;  1K8A C;  1UE7 A;  1WOC A;  4LFC L;  4A93 G;  1SR3 A;  2PQA A;  3HKZ E;  3U4V A;  2MNA A;  1FJG L;  3M4O H;  2VS1 A;  2B3G A;  4IPG A;  2NVX H;  2Y0S E;  2AKW B;  4LF9 Q;  4LFC Q;  1O7I A;  2BA1 A;  3JC6 6;  1Q86 C;  2CWA A;  1C9O A;  3TS0 A;  2A1A A;  4X62 L;  4JOI C;  3RLF A;  3J7A 5;  2IHE A;  1Y1V H;  4PG3 A;  3T1H L;  4IFD I;  3KOJ A;  2UUA Q;  2VZA A;  3KF6 A;  1JJG A;  1G51 A;  4P74 A;  1FGU A;  4OWT B;  2A19 A;  4QY7 A;  4HID A;  2DGY A;  3T1H Q;  1VQB A;  1UE1 A;  2R7F A;  2HQL A;  1R9T H;  3TRE A;  4JI5 L;  1CUK A;  4NXN Q;  4JBJ A;  2N8N A;  1N33 L;  4A3I H;  4RMF A;  2MO1 A;  4YCW A;  3GO5 A;  3PUV A;  4MZ9 A;  1HR0 L;  4YY3 Q;  4GLX A;  4YHH L;  2H5X A;  3JAM c;  4HJ9 A;  5FLM G;  1VQD A;  4LF4 L;  1JMC A;  3AFQ A;  1VQA A;  1AE3 A;  1PYS B;  2E2J H;  1N33 Q;  1V43 A;  1HR0 Q;  3J81 j;  2WAQ E;  5FJ8 G;  4YHH Q;  1TXY A;  3L2P A;  1YI2 A;  2Q2I A;  5DLQ E;  3H3V I;  4GOP C;  4LF4 Q;  4KLK A;  3CCL A;  2ZJQ A;  3UDX A;  4OX9 Q;  2E8G A;  5FLM H;  5IY0 A;  3G48 A;  2I5L X;  1LTL A;  1TWF H;  3T1Y L;  4AYB E;  1YZ6 A;  1L1O A;  3GD7 A;  5FJ8 H;  5IYB H;  1Y1W H;  2NVY H;  2Q2H A;  1L0W A;  4DR7 L;  4DPG A;  1CSP A;  1GVP A;  2GVA A;  3T1Y Q;  4IPH A;  1X65 A;  1AE2 A;  4UY8 C;  1VQF A;  2GN5 A;  4R1J A;  1D8L A;  3PO3 G;  4DR7 Q;  1VQP A;  2F4V L;  4DR5 Q;  1VQ9 A;  1VQC A;  4AH6 A;  2HHH Q;  1CSQ A;  1N8R C;  2ZTC A;  4GOP B;  4JI2 L;  4JOI A;  1PH3 A;  2F4V Q;  1KAW A;  3CME A;  4YWK A;  1HR0 W;  5C0X I;  1Z9F A;  4OXP A;  1OTC A;  1NBW A;  4A3C H;  4IJH A;  1OXV A;  3ULJ A;  4A4I A;  4DV3 L;  4JI0 L;  4LNQ A;  1XNQ L;  4JI8 L;  3GTP H;  4BY7 H;  2ATW A;  1P16 A;  4YCV A;  2GVB A;  2VQE L;  2VY3 A;  1YJ9 A;  2D0O A;  4JI0 Q;  4DV3 Q;  1QVF A;  2WB1 E;  1MJE A;  5IP9 H;  4IOA A;  1V9P A;  2VQE Q;  1CKN A;  2HIX A;  1HJP A;  2D0P A;  1N32 L;  1HZA A;  3K81 C;  5JJK A;  2YTX A;  2UXB Q;  5LMN L;  3CQZ H;  2K52 A;  4OWX B;  1N32 Q;  1KD1 C;  5K36 G;  2QGQ A;  1I3Q H;  1GM5 A;  5EAY A;  3CPW A;  1PH8 A;  2K5N A;  3A5U A;  2KCT A;  3OTO L;  1FL0 A;  4BA1 I;  3CCM A;  4GNX A;  1J6Q A;  2E2I H;  3SGI A;  1I6H H;  3STB D;  1UE6 A;  3M4Q A;  1E7Z A;  3CPF A;  5GAG C;  4LUO A;  1GKH A;  3CCJ A;  4X66 L;  2VNU D;  4GS3 A;  5AJ3 L;  1EOV A;  2IX1 A;  2RHQ B;  1YJW A;  4JV5 L;  3E9H A;  3PSI A;  2ZJP A;  1C0A A;  3GTL H;  3M9B A;  3I56 A;  3HOY G;  2R93 H;  5AJ3 Q;  1X3F A;  4IO9 A;  3PO2 H;  1OXT A;  1LUZ A;  2K5H A;  2E5L L;  2R92 H;  4UP9 A;  5M3F G;  1N36 L;  3RN2 A;  2YTV A;  4DV5 L;  3M3Y H;  3BZK A;  4JI4 L;  4OO1 I;  4JI3 L;  1VQL A;  2UUC Q;  3CCE A;  2HT1 A;  1VQM A;  1Y14 B;  2YYZ A;  2N78 A;  3FKI G;  1PFS A;  4C2M H;  4DV2 Q;  2OTJ A;  3K8A A;  4DV5 Q;  1TWC H;  1UEB A;  2B63 H;  4JI4 Q;  4OON A;  1J5E Q;  2Z6K A;  4RG1 A;  3PV0 A;  3CCU A;  4DV0 Q;  4JI3 Q;  2MQH A;  1YHA A;  5LMN W;  5GAD C;  3CCR A;  4A3E H;  2KEN A;  2ZM6 L;  2JA6 G;  1SRO A;  3CAM A;  1K9M C;  1XNR Q;  1E3P A;  2JA8 H;  1IBL Q;  4BXX H;  4TVA B;  2LXJ A;  3ZJY C;  2QA4 A;  4DUZ Q;  1XTD A;  4HJ8 A;  1HZC A;  1IBK L;  2ZM6 Q;  3J81 c;  1PH6 A;  4DV1 L;  1UE5 A;  5JEA J;  4EQ5 A;  4DV4 L;  2JA5 H;  2R7Z H;  1KXL A;  1IBM Q;  1A63 A;  4A3B G;  5IYC G;  4YWL A;  4A3F G;  1Q8K A;  1IXR A;  1M90 C;  4DV4 Q;  4GKJ Q;  1PH2 A;  2AWO A;  3J7Z C;  1PH7 A;  2A8V A;  5IYD H;  1YEZ A;  2NZO A;  4UP7 A;  1SRU A;  4R4I A;  5M5X H;  3F2C A;  3BZC A;  1HZ9 A;  2EXD A;  5IE8 A;  1Q46 A;  1FJG Q;  2XTI A;  1A62 A;  3F8T A;  2JQO A;  1PYB A;  3A0J A;  1KC8 C;  2B29 A;  1X3G A;  3W1G A;  4A93 H;  1A8V A;  4MNO A;  3PF5 A;  1SFO H;  4LF5 L;  3DLL A;  4R4Q A;  3TQY A;  3Q8D A;  1LM0 A;  4X62 Q;  2F52 A;  1WCM G;  3CF5 A;  3KYH C;  4LWC A;  2QEX A;  3K80 C;  3S2H H;  3HOX G;  1W3S A;  1YVC A;  2UUB L;  4JI7 L;  4NXM L;  1MKH A;  1CKM A;  4DR3 L;  3NEN A;  4A3M G;  4IFD J;  1XNQ Q;  2E2H H;  1E1O A;  1EUJ A;  2JK8 A;  4FDB A;  2IY5 B;  2ID0 A;  5IP7 G;  1VQ8 A;  4NXM Q;  4BBR G;  1Q7Y C;  4JI5 Q;  3GTG H;  3TS2 A;  2OTL A;  4H02 A;  2K4K A;  2NN6 I;  2F3I A;  1HZB A;  3I2Z A;  1GD7 A;  3I4N G;  2OCE A;  1S72 A;  2AMC B;  1TWG H;  1XPO A;  4A3G G;  4OO1 G;  2CKZ B;  2VUM G;  1P8L A;  4KHP L;  1NE3 A;  3GTM H;  3IRB A;  1VQI A;  3ER0 A;  2OQK A;  4NPS A;  3OYY A;  4HJ5 A;  1VQN A;  5JEA G;  1EQQ A;  1KRS A;  3EN2 A;  3GTJ H;  4L5Q A;  4IPD A;  1WFQ A;  5BR8 L;  1B7Y B;  3HFZ B;  1VQ4 A;  2FXQ A;  4BA2 I;  4OWW B;  5C3E G;  1IL2 A;  1EWI A;  3A74 A;  4PMW A;  4DNI A;  4IOC A;  1NY4 A;  2R7D A;  4GLA C;  3S24 A;  2IHF A;  3PUW A;  1OXX K;  4MTN A;  5H1S E;  3S14 H;  1I94 L;  1KHI A;  1QVG A;  1VQH A;  3HOU G;  3LGJ A;  4NB3 A;  4P72 A;  1JB7 A;  1PH9 A;  4KI0 A;  1PVO A;  4A3J G;  4JI2 Q;  5C4X G;  3PO3 H;  3HOZ G;  4DR2 L;  1A0I A;  3AYH B;  1NMG A;  3OW2 A;  5IT9 c;  1VQE A;  2MO0 A;  5ELN A;  3H0G G;  1IBM L;  3D0F A;  4B3M L;  3M7N A;  2I5M X;  4IFD G;  4LF6 L;  1X56 A;  2CFM A;  1Q1B A;  5C0X J;  4K0K L;  4BY1 G;  2IX0 A;  3RN5 A;  1KL9 A;  1OXU A;  3A5Z B;  1GO3 E;  1OXS C;  3CP0 A;  4P73 A;  4JI8 Q;  2JA7 G;  3I4M G;  1S40 A;  2L15 A;  5LMU L;  4EX5 A;  4DK3 C;  2JEB I;  1Q81 C;  3HKZ G;  4LFA L;  3KJO A;  1ASZ A;  3H0G H;  4K0K Q;  3PF4 A;  2K14 A;  4GOP A;  4DR6 L;  2Y0S G;  5JJL A;  4JBW A;  4JC0 A;  4X64 L;  3HOV G;  4BBS G;  4LFA Q;  2CCZ A;  4LF8 L;  5J3B A;  3F2D A;  1PH4 A;  5ELO A;  3U4Z A;  2NN6 G;  4DUY L;  4APV A;  5LMN Q;  1ASY A;  3I4M H;  1D7Q A;  4JYA L;  3TRZ A;  1B8A A;  4A3K G;  2I5H A;  1FVI A;  2YTY A;  1XPR A;  2ZJR A;  1X3E A;  4DUY Q;  3KFU A;  4BBS H;  2Z0S A;  4Y52 H;  3OTO Q;  4DV6 L;  4L5S A;  3GDE A;  3CXC A;  3W1B A;  4A3L G;  4JI1 L;  4DR1 L;  1EQR A;  3G71 A;  1NMF A;  4GN3 B;  4QL5 A;  3JAM i;  3VDY A;  4X66 Q;  4A3K H;  1VQ5 A;  2JEA I;  2NVT H;  3H3V H;  2PMZ E;  4JI1 Q;  3M85 A;  4DR1 Q;  4JV5 Q;  1HNX L;  2UXC L;  4DAY B;  3H15 A;  4WJ4 A;  3GTK H;  4C3H H;  5IWA L;  4POF A;  1QUQ B;  2WAQ G;  3S15 H;  1PV4 A;  3GTQ H;  1N9W A;  2ASB A;  1HNX Q;  5JJI A;  3HOY H;  1WYD A;  5IWA Q;  3D31 A;  3AQQ A;  2E5L Q;  3HOW G;  4LFB L;  1N36 Q;  1K3R A;  4LUZ A;  3UDF A;  1K8G A;  1SLJ A;  1T9H A;  2CQO A;  4JBM A;  1HNW L;  1YBY A;  2D62 A;  5M3F H;  4AYB G;  4A76 A;  5C0X G;  2VW9 A;  4A3D G;  2VQF L;  3RZD H;  4DV7 L;  3WWV A;  2RF4 A;  1HNW Q;  3FKI H;  3HOW H;  1YIJ A;  2LSS A;  1W2B A;  2CWP A;  4L5R C;  2VQF Q;  4POG A;  2HIV A;  2K75 A;  3HKS A;  3KDF B;  5GAE C;  4AQY L;  3PCO B;  1L2F A;  4IJL A;  1IZ6 A;  1IBK Q;  4QQB X;  4DV1 Q;  2PQA B;  2JA6 H;  2Q2T A;  2KBN A;  2JE6 I;  2KCM A;  4C3J H;  5C4J H;  2PNH A;  1XMO L;  3S1M H;  3CCQ A;  1VS0 A;  1VQK A;  1SE8 A;  3EIV A;  2RCN A;  3CC2 A;  1TWH H;  1DGS A;  1YIT A;  1BKB A;  2YV5 A;  3CC7 A; 
#chains in the Genus database with same CATH topology
 2PI2 A;  4YCU A;  5EPJ A;  3KF6 B;  5G3L D;  1RTN A;  4R8N A;  3PQI A;  2WB1 G;  1JJC B;  5F2D A;  4LF5 Q;  2NVQ H;  2E2I B;  1H95 A;  3SXH A;  3I7F A;  4DA2 A;  4P71 A;  4Y7N B;  4B3R L;  2AQ2 B;  2EPB A;  2RVL A;  4KY7 A;  4DR4 Q;  1E24 A;  2WP8 J;  2C35 B;  4X6A H;  1U4M A;  1RDP D;  3JAM L;  2UUA L;  1PMR A;  2KHJ A;  2ES2 A;  3NSW A;  2MP1 A;  1FYC A;  1S5F D;  2UU9 Q;  1AFP A;  3HRZ C;  3AU7 A;  1YHQ A;  4UAI A;  4ZAI A;  1WI5 A;  1L1O B;  3CD6 A;  5HY6 A;  3TN2 A;  1VQ7 A;  1EFW A;  5JVG 3;  2WV6 D;  4A3G H;  4OO1 H;  3KLS A;  2VUM H;  5FLX L;  5G3L F;  1IYJ B;  2N55 A;  1BBU A;  4JG2 A;  3EJI A;  1A2T A;  3S1N H;  4OX9 L;  3S17 B;  2FFK B;  4FF1 A;  4NP5 A;  2GA4 B;  1XYI A;  1XJV A;  2EQS A;  3IKJ A;  4ULL A;  1SNM A;  1KLG D;  1WTR A;  1QNU A;  4K14 A;  1BBW A;  5FLX c;  3R3O A;  4H13 C;  1E22 A;  4LF7 Q;  3C1E A;  3MEF A;  5HGQ A;  4TKO B;  1JE5 A;  3TP5 A;  4DK6 C;  3I55 A;  4DR2 Q;  4DR5 L;  2H1E A;  1E1T A;  5C4X H;  4A93 B;  3BYY B;  1ESR A;  1SFO B;  4PZ7 A;  3R2T A;  3NXW A;  3I8Z A;  2JP1 A;  3X3M A;  1SMX A;  4ZYS A;  3B6Y A;  3OW7 A;  5KIX A;  4ZKC B;  1EEF D;  2EJG C;  4BY1 H;  2K1B A;  2NB0 A;  1GUN A;  2E2H B;  4HN7 A;  2ZTE A;  3VR6 A;  3MWY W;  4X64 Q;  4DKA C;  1G6P A;  1QZH A;  1SN8 A;  1TY2 A;  2F0O A;  3L0O A;  3SDZ A;  1K73 C;  2V1C C;  3HOV H;  3TEH B;  5I2X A;  2DUD A;  4L5T A;  1TS2 A;  2SEB D;  2UXB L;  3Q6S A;  2JJQ A;  1G29 1;  3BDC A;  2E76 C;  3HS0 C;  4KD4 A;  3U9O A;  1WJJ A;  1Y1W B;  3KF8 B;  3S16 H;  3DM3 A;  3PUZ A;  3FPU B;  1U0L A;  3FHW A;  3I91 A;  2UXC Q;  2B2W C;  3M7G A;  1KAB A;  1X54 A;  4HCE A;  3P75 A;  2A6H D;  2EY5 A;  2RSN A;  3SR1 A;  5KEE A;  1CM9 A;  1B4O A;  1U5K A;  1SNQ A;  1W6K A;  2BDO A;  1PH1 A;  4XTC S;  3O13 A;  4MHE A;  5KND A;  3LNN A;  4DAY A;  1QUQ A;  4AIM A;  2X6L A;  4PZ8 A;  3MXG A;  1CFM A;  1NJI C;  4BXX G;  1IL8 A;  2LMC B;  3DEO A;  5KNC A;  3J80 E;  2Z4H A;  2L4N A;  4TQU S;  1FR3 A;  1ESF A;  1IBL L;  3A55 A;  4DUZ L;  3R2I A;  2K05 A;  1YNX A;  3AEV A;  4GN5 A;  5T1I A;  1ILQ A;  3BJU A;  3F1Z A;  2FMC A;  4HIO A;  2BE5 D;  3KDF A;  3DMU A;  1WOC A;  4A93 G;  4DXG A;  2B3G A;  4IPG A;  1WTV A;  2Y0S E;  1SDF A;  4LFC Q;  1O7I A;  2BA1 A;  3L9A X;  1DOM A;  1Q86 C;  3EQL C;  4RWS C;  4IN3 A;  2IHE A;  3OSO A;  3NBH A;  2UUA Q;  1B53 A;  1JJG A;  5T1G A;  3HG9 A;  1FGU A;  2O4X A;  2A19 A;  3CU7 A;  1CQF A;  1VQB A;  1UE1 A;  5ELB A;  5KYI A;  1N33 L;  5EPK A;  5FLM G;  5HGT A;  3RZD B;  2E2J H;  4KKS A;  3T56 B;  3FKI B;  4RA8 A;  1LTR D;  4I7A A;  4F88 A;  4B9W A;  3UDX A;  4DGZ A;  1R4P B;  3NP8 A;  4OX9 Q;  1YNN C;  5IY0 A;  3G48 A;  1LTL A;  2CW0 D;  4XT3 B;  1YZ6 A;  3V2T A;  2NVY H;  1XTC D;  2Q2H A;  1L0W A;  1SE2 A;  4DPG A;  1CSP A;  4DR7 Q;  1SXT A;  2TMP A;  4L63 B;  2RBM A;  1F2Z A;  4DR5 Q;  1VQC A;  2K01 A;  4AH6 A;  2IX3 A;  1HTL D;  3K58 A;  3NUC A;  3MXP A;  3D4W A;  3C3L A;  3S2D B;  3EVQ A;  1DXM A;  2RKS A;  4JI0 L;  1XNQ L;  4JI8 L;  5E1F A;  3E6Z X;  4YCV A;  2VQE L;  3VR3 A;  4WFN 3;  1BCP C;  1CKN A;  1GHK A;  1N32 L;  1HZA A;  3K81 C;  5JJK A;  2YTX A;  2UXB Q;  1BQQ T;  3K7A B;  3QR8 A;  4ILW A;  3I4N B;  4OWX B;  2QGQ A;  3QB3 A;  4FF3 A;  1G2T A;  1FL0 A;  1JQY D;  3A8K E;  4CJ0 B;  4BA1 I;  2E2I H;  2ZT9 C;  3V96 A;  1UE6 A;  1E7Z A;  4LUO A;  4C3H G;  1BXT A;  2IX1 A;  2KEE A;  2RHQ B;  5K36 H;  2K7V A;  1C0A A;  3M9B A;  3GV6 A;  4F87 A;  3TP6 A;  1IYU A;  1AW7 A;  1OXT A;  1SE3 A;  1WVL A;  1K8M A;  2E5L L;  5FO8 B;  1BDO A;  2YTV A;  3M3Y H;  3HOU B;  1VQL A;  4FF4 A;  3X3N A;  1Y14 B;  2YYZ A;  3FKI G;  4DV5 Q;  1RD9 D;  3HOZ B;  4RKL A;  4JI4 Q;  4RG1 A;  3PV0 A;  4OWW B;  3MC0 B;  2MQH A;  3H0G B;  3LWU A;  4G7H C;  1H9J A;  3CAM A;  1LTS D;  2F0H A;  4BXX H;  1IBL Q;  4DUZ Q;  2LXJ A;  1XTD A;  4XT1 B;  2ZM6 Q;  1QG7 A;  3J81 E;  4ZQ3 A;  2R7Z H;  1A63 A;  1VMC A;  5IYC G;  4YWL A;  1SNP A;  2Q8R E;  4OEM B;  1S5C D;  3CRK C;  2AWO A;  1WTH A;  1PH2 A;  2A8V A;  3LX0 A;  3W3A A;  1RHP A;  2NZO A;  3MAQ A;  1SRU A;  4ODG A;  5C4H A;  3BZC A;  4KKT A;  4CDF C;  1E2V A;  1LT4 D;  1PYB A;  1H9S A;  1X3G A;  1TWA B;  4A93 H;  3MA2 B;  3PF5 A;  1SFO H;  1GUS A;  3Q8D A;  5J22 A;  1LM0 A;  3GTQ B;  2F52 A;  4PV1 C;  3HOY B;  3M4Y A;  4JI7 L;  4NXM L;  1MKH A;  3NEN A;  1SNC A;  2XSC A;  5D3I B;  2E2H H;  5DEH A;  1U9R A;  5IP7 G;  1HPC A;  1VQ8 A;  2EOT A;  1V1O A;  3GTG H;  3TS2 A;  1J8I A;  2D2C C;  4H02 A;  3FVQ A;  2FIN B;  2ICE C;  3I4N G;  1EQV A;  3ND8 A;  1XPO A;  1SYC A;  2CKZ B;  1P8L A;  1NE3 A;  3MFG A;  3ER0 A;  1KAA A;  2OQK A;  2RCF A;  3DM1 A;  3S1M B;  4JK1 C;  1D5X C;  3GTJ H;  3MEH A;  1WFQ A;  3HFZ B;  4HSP A;  5C3E G;  2F1M A;  4K5X A;  3A74 A;  3S24 A;  4PQX A;  2J7Z A;  3NWT A;  2KEC A;  1D5Z C;  1I94 L;  1D5M C;  1KHI A;  3RZO B;  4XQQ A;  2NVQ B;  3HOU G;  3LGJ A;  4NB3 A;  1PH9 A;  5JAV A;  4A3J G;  3HOZ G;  4MN3 A;  2ICI A;  5IT9 E;  1GOZ A;  1LTA D;  3H0G G;  2EY6 A;  4B3M L;  1WTW A;  1X56 A;  2CFM A;  5C0X J;  1Y1V B;  1XNQ Q;  1OXU A;  3L3O C;  1STB A;  2L1B A;  1OXS C;  3CP0 A;  4JI8 Q;  4YIJ A;  1S40 A;  4KY5 A;  1L0Y B;  4DK3 C;  2JEB I;  4LFA L;  4K0K Q;  3CHB D;  4WRD A;  2OT2 A;  2B2U C;  4GOP A;  4JBW A;  5JVH 3;  4IUV A;  1V8Q A;  4CDC C;  4FYD A;  4K8J A;  4A3I B;  4A3G B;  2NN6 G;  1CK1 A;  2VUM B;  1ASY A;  1TY0 A;  1B2T A;  4JYA L;  3TRZ A;  4HR7 B;  1LAB A;  1NSN S;  1RF2 D;  4XYO A;  4DUY Q;  1IW7 D;  1X3E A;  2Z0S A;  3S1N B;  4L5S A;  3FEW X;  4A3L G;  5EKI A;  4GN3 B;  1F2L A;  3H3V H;  1PTO C;  2JEA I;  2EE1 A;  4JI1 Q;  3M85 A;  1TWF B;  2B2T C;  4LMQ D;  4DAY B;  3H15 A;  4K2L A;  5CV6 A;  4C3H H;  1QUQ B;  3S15 H;  3EA6 A;  2QW7 A;  4KHV A;  1HNX Q;  5IWA Q;  2E5L Q;  5C4X B;  1HTP A;  3P20 A;  1JE4 A;  1SLJ A;  1S5D D;  1T9H A;  3IL8 A;  2A5H A;  3K5N A;  4A76 A;  4QMG A;  5JPM C;  5C0X G;  2EY1 A;  2EYJ A;  2MJ8 A;  3RZD H;  2ENB A;  2RF4 A;  2D9U A;  4N9T A;  3FKI H;  1W2B A;  2VQF Q;  2QEJ C;  2K75 A;  3Q23 A;  3KDF B;  5GAE C;  1TVX A;  4QQB X;  2DN8 A;  3W2D A;  3HOV B;  2PNH A;  3QIA A;  1SE8 A;  3EIV A;  4HCS A;  1DGS A;  3HP3 A;  1YIT A;  1XMO Q;  4P2C B;  5IYC H;  3G6E A;  3NEL A;  2MFI A;  3NBH B;  3VR2 A;  1DOL A;  1KNA A;  2E2D C;  1NR2 A;  3M4P A;  4KTA A;  4QUC A;  5DM7 3;  1KIX A;  1EIH A;  1DD2 A;  4CJ1 B;  1HHV A;  1Y1V G;  4DAM A;  4DR4 L;  1YHB A;  4GKK Q;  3D6W A;  4JW0 A;  5GQO A;  2EYL A;  2WAQ B;  1KQS A;  4JI7 Q;  5LHY 1;  1QE6 A;  3S2D H;  1NNX A;  3GTL B;  1RIP A;  4PMC A;  1HNZ Q;  2EZV A;  1GUO A;  4LK1 C;  1EIF A;  2UU9 L;  5EGT A;  3K0X A;  3RLN A;  3E0E A;  1PDQ A;  4A3I G;  5IP7 H;  3E0J A;  1SYD A;  3I4O A;  4AYB B;  4NXN L;  4IUP A;  1C7Y A;  2IT1 A;  4ALP A;  3AFP A;  4GLV B;  2Q2U A;  1RL2 A;  3K7A H;  1SBB B;  3I4N H;  3S1Q H;  1Z47 A;  3IAY A;  4DF7 A;  3L7Z C;  3KUP A;  3K7U C;  3CC4 A;  1MJC A;  3RLO A;  2JA8 B;  4JCV E;  4RGO S;  1I50 H;  5IYB G;  3MXN B;  1XPU A;  2JA5 B;  5C3E H;  2DJG C;  4LF7 L;  2N49 A;  1I94 Q;  2KHI A;  1EYC A;  1MSG A;  4ZRZ A;  1IKM A;  3GV3 A;  5FLX E;  4GNX C;  3J81 i;  2BH2 A;  2FMM A;  1I4G A;  3A8I E;  3S9W A;  2HCI A;  3HOU H;  2J4X A;  3ULP A;  1KDA A;  4A3J H;  2BOS A;  4B3M Q;  1CKN B;  2B8G A;  3HGB A;  3NPP A;  3HOZ H;  1YNJ C;  1JWS D;  4HIK A;  3OMG A;  4BY7 G;  5IGD A;  1X9N A;  3PIO A;  3S1R H;  5DM6 3;  1F9Q A;  1JJ2 A;  4B3S Q;  5IP9 G;  3G4S A;  1YJN A;  2R6G A;  4HJA A;  4RHS A;  1H9K A;  1HUN A;  4JYA Q;  1MIU A;  3Q22 A;  1DON A;  1EYG A;  2NN6 H;  1B9N A;  4IPC A;  4QIW E;  1Q12 A;  4RKB A;  3MXU A;  1SYG A;  1TWA H;  3TP8 A;  2NVY B;  3F2B A;  1AH9 A;  3K5L A;  4A3L H;  1MGS A;  5E7N A;  4IAL A;  1K0R A;  1MD2 D;  1SEB D;  2PCF B;  2F0P A;  1V1Q A;  3NTK A;  3OWF A;  1M1K C;  2LKV A;  1NTG A;  1FGB D;  1X6O A;  1CTM A;  5COR A;  1Q1E A;  2YU9 H;  3URY A;  3SE0 A;  4HMI A;  2B63 G;  2I0Q A;  2IPK D;  2PZW A;  2UUC L;  5LL6 X;  1LTI D;  2JA9 A;  5C0X H;  2NZ1 D;  2JA8 G;  1J5E L;  4B3T Q;  2WFW A;  3BU2 A;  4IUN A;  2JA5 G;  2EJM A;  2AUK A;  1I5F A;  1STH A;  1H9S B;  2NTS A;  3BG3 A;  3BVM A;  5M9O A;  5M3M H;  2O5J C;  2BA0 A;  3D8G A;  3RR5 A;  4S3S A;  3RZO H;  2A69 C;  4GKJ L;  5I2Y A;  2VL6 A;  1EYA A;  4LFC L;  2BCO A;  3HKZ E;  5KRU A;  3PIO 3;  1QIL A;  1EY5 A;  1NAP A;  2CWA A;  2NVT B;  3DXJ C;  4M8A A;  1PXU A;  3RLF A;  2LY7 A;  1L0X B;  1SMY C;  1Y1V H;  4OEL B;  5HUR A;  1KTK A;  3KOJ A;  2VZA A;  2DJF C;  3M3Y B;  2BDN A;  4TRD A;  4HID A;  3T1H Q;  2R7F A;  4FO2 A;  2WKC A;  3TRE A;  2KHS A;  4U68 A;  4JI5 L;  4L8J A;  4NXN Q;  4JBJ A;  2N8N A;  4KJN A;  2JN4 A;  4A3I H;  1WTP A;  4GLX A;  2RDG A;  3JAM c;  2B8F A;  1ET6 A;  4K6D A;  3AFQ A;  1VQA A;  5D65 A;  1U4R A;  1V43 A;  2Q2I A;  1EIG A;  4HMJ A;  3QO2 A;  4KLK A;  2R7Z B;  2JXM B;  5FO7 B;  4N8X 1;  4CBV A;  3J7A V;  1HXY D;  3E5S A;  4RGT A;  2DNE A;  4FVM A;  2JA6 B;  1UUP A;  2CH4 A;  1TWF H;  1Q90 A;  4IUT A;  5FJ8 H;  2CHB D;  2KCN A;  5IYB H;  4DR7 L;  2GVA A;  3T1Y Q;  1XX8 A;  4Q0F A;  3I90 A;  1X65 A;  3PO3 G;  2GN5 A;  3TSS A;  2IWH A;  4OL7 A;  2AQ3 B;  4GOP B;  1PH3 A;  2F0U A;  1F9S A;  3CME A;  4YWK A;  1EY7 A;  5I6Y A;  2CH4 W;  2M9V A;  5ELE A;  5C0X I;  1OTC A;  5EQ0 A;  3GTG B;  2VXW A;  4IJH A;  3ULJ A;  1WCM B;  5FKA C;  1RKN A;  4LNQ A;  4BY7 H;  3QWN A;  4IUR A;  2KCC A;  1YJ9 A;  5ELF A;  2D0O A;  4DV3 Q;  1QVF A;  4G57 A;  5IP9 H;  3I72 A;  3TZU A;  1YNN D;  3FPP A;  1U4P A;  3CQZ H;  5JJZ A;  3GTJ B;  5I6W A;  5K36 G;  2EYO A;  1GM5 A;  3CPW A;  3A5U A;  1G2S A;  2KCT A;  3OTO L;  1J6Q A;  2P5Z X;  2PZU A;  3SGI A;  1QCB D;  2XVS A;  5CV5 A;  3STB D;  2VNU D;  3CCJ A;  4GS3 A;  4JV5 L;  5A35 A;  2MGS A;  1ENA A;  1SAP A;  1Q8I A;  2K28 A;  3TDQ A;  3GTL H;  1G91 A;  5AJ3 Q;  3BVZ A;  4C1N K;  3MZ5 A;  1TR5 A;  1LUZ A;  4XYQ A;  1AZP A;  4DV5 L;  4N9P A;  4JI4 L;  4OO1 I;  4MIU A;  3CCE A;  2UUC Q;  1VQM A;  2EYF A;  1BCP D;  5CR3 A;  1RJT A;  2B63 H;  4J6H A;  5KYL A;  2F0K A;  1J5E Q;  3CCU A;  2R7Z G;  2VB2 X;  5LMN W;  5GAD C;  3CCR A;  1WTQ A;  2KEN A;  2ZM6 L;  2JA6 G;  1E3P A;  2JA8 H;  4C3J G;  3R8B A;  2AQ1 B;  4TVA B;  3TP7 A;  3ZJY C;  3K59 A;  1K3B C;  1SJE D;  2JA5 H;  1T5X D;  3ND9 A;  3KLS X;  4A3F G;  4X3S A;  1AZQ A;  4GKJ Q;  4C3I G;  3J7Z C;  3E3X A;  2B2W A;  4EGV A;  5M5X H;  3F2C A;  2DY8 A;  1Q46 A;  1Y8N B;  3A0J A;  2B29 A;  1A8V A;  1K83 B;  4C3H B;  3DLL A;  4R4Q A;  3S15 B;  1BCP F;  5C4Z A;  1WCM G;  3KYH C;  4RCO A;  4LWC A;  2QEX A;  3K80 C;  3S2H H;  3HOX G;  1II3 A;  3KK7 A;  1CKM A;  1EY6 A;  4JVZ A;  1DM0 B;  1E1O A;  2JK8 A;  2N88 A;  1D1K A;  4WOR A;  2NBF A;  2XWB B;  4BBR G;  1Q7Y C;  4JI5 Q;  1S5E D;  4LJZ C;  2DY7 A;  5EBC A;  5BN5 A;  2Z1C A;  2F3I A;  3DHQ A;  1GD7 A;  2NUC A;  1S72 A;  1LT6 D;  4KHP L;  1SNO A;  1VQI A;  2EXZ A;  4KN4 C;  1DYQ A;  4QB4 A;  4WJW A;  1B7Y B;  2FXQ A;  4BA2 I;  2FHT A;  1EL0 A;  3UI2 A;  1WD0 A;  4DNI A;  3NE5 B;  1ZXT A;  5H1S E;  4K5W A;  1MBY A;  1QVG A;  1VQH A;  2HCC A;  4HSV A;  2PW5 A;  2AUJ D;  3PO3 H;  2F3W A;  3AYH B;  1NMG A;  3OW2 A;  2HD3 A;  1PRT B;  5EKK A;  4LF6 L;  5ELD A;  1PFM A;  4K0K L;  2EDG A;  2IX0 A;  3D4R A;  1GO3 E;  5A2Q L;  2JA7 G;  4EX5 A;  1Q81 C;  2A6H C;  4F8M A;  3Q0A A;  1G6Z A;  3NK9 A;  4DR6 L;  5JJL A;  2Y0S G;  3DWA A;  3S1Q B;  2Z9H A;  3WOE A;  4LF8 L;  1EOT A;  1B9M A;  3HZX A;  2F0I A;  3U4Z A;  4DUY L;  3T53 B;  3R93 A;  4APV A;  1D7Q A;  3BVG A;  2YTY A;  1D6E C;  1I50 B;  3KFU A;  4BBS H;  4Y52 H;  3OTO Q;  3MFY A;  3CXC A;  2EYH A;  4JI1 L;  1EQR A;  5C3E B;  1I6V C;  1VQ5 A;  3VDY A;  1LLR D;  2NVT H;  4DR1 Q;  4JV5 Q;  4DFA A;  1HNX L;  2D5D A;  3GTK H;  2QDL A;  5IWA L;  1HRJ A;  1N9W A;  5JJI A;  1WYD A;  4A3J B;  2BE5 C;  3ITP A;  4LUZ A;  1K8G A;  2F03 A;  2D62 A;  4J1M A;  2VW9 A;  2VQF L;  3S1R B;  4DV7 L;  3G6J B;  1HNW Q;  1YIJ A;  1PLF A;  2LSS A;  2CWP A;  4C1N I;  2PW7 A;  2F0T A;  2HIV A;  3GTP B;  1M4V A;  4AQY L;  4IJL A;  1F9P A;  2JA6 H;  1JOR A;  2Q2T A;  2JE6 I;  2KCM A;  4C3J H;  1XMO L;  2RCN A;  1TWH H;  5LL6 S;  1PTO D;  1BF4 A;  2YV5 A;  1LT3 D;  3E9I A;  4A3F H;  4LUV A;  1LYL A;  2B2V C;  4C3I H;  3VA7 A;  2PI2 E;  4K6L A;  1VF7 A;  3F2U A;  4ME3 A;  4OIK A;  1EYD A;  4GKK L;  3NHH A;  1L1O C;  3T51 B;  1CHQ D;  1WTX A;  3UE1 A;  1HNZ L;  1G8Z D;  2VB3 X;  1Q82 C;  1WCM H;  2A73 B;  2PYK A;  3HOX H;  2YU9 B;  2K6A A;  3PO2 B;  3CCS A;  1LV9 A;  5EJW A;  1B70 B;  1QZG A;  4BBR H;  1VCI A;  1SND A;  1PTO F;  4C2M B;  4KHP Q;  4YY3 L;  2SOB A;  1CQV A;  4XIG S;  2K5Q A;  2EJF C;  5IGG A;  2L11 A;  5D14 A;  3CCV A;  1AEX A;  3V05 A;  2UXD Q;  4DN4 M;  2X6G A;  1O7Z A;  5M3M B;  3J7A F;  5AFW A;  5NUC A;  3J80 i;  1XWE A;  4PZ6 A;  2A6E C;  1QVC A;  4P75 A;  1N34 Q;  4JI6 Q;  1HH2 P;  1JT8 A;  2AWN A;  1UWV A;  1QJO A;  1MSH A;  3FRP B;  3KLR A;  1VQ6 A;  4A3C G;  4LF6 Q;  3A7L A;  4B3S L;  5FOB B;  2EY2 A;  3PGZ A;  3ICE A;  2EIF A;  2A68 D;  1IKL A;  1X55 A;  3NEM A;  3C46 A;  1JOO A;  3KLW A;  1PZI D;  1PTO H;  3NTH A;  4RCN A;  1XMQ Q;  1PRT D;  4DR6 Q;  2JA7 H;  2XN9 C;  2XGT A;  2C9O A;  3PIP A;  4LF8 Q;  1JOK A;  1ET9 A;  2Z6K C;  3OPO A;  3SVM A;  3OIP A;  4DXF A;  4O2D A;  4HJ7 A;  1KDB A;  3ERS X;  3H91 A;  4WJ3 M;  1K83 H;  2I07 B;  3NQT A;  2R93 G;  4X65 Q;  3FMC A;  4CHT B;  3PO2 G;  1PYW D;  2B2Y C;  3S14 B;  4JBK A;  4LAA A;  2L0C A;  3VR5 A;  1EIY B;  3D3R A;  4R4T A;  2R92 G;  3DWP A;  4A75 A;  2NZH A;  1PRT F;  5C44 H;  4QGU A;  1KLU D;  5IOC A;  2PO4 A;  4FP5 D;  1HQR D;  2RHS B;  2B2U A;  2Q8I B;  5FO9 B;  1GUW A;  4YWM A;  2K33 A;  4UP8 A;  4DV7 Q;  4B3T L;  4DV2 L;  4C56 C;  4BY7 B;  2G9H D;  5M3M G;  4AQY Q;  1BNZ A;  1JIC A;  1T5E A;  1Y8O B;  1F2Y A;  2N3S A;  4KN7 C;  4ZKB B;  2HQE A;  3CQZ B;  3PUY A;  4NDX A;  1VQO A;  1TS3 A;  3T13 A;  3I4L A;  2AHO B;  4CKB A;  4QJF A;  2B2T A;  2XIW A;  2K5V A;  2NYZ D;  1K8A C;  1SR3 A;  2B39 A;  2PQA A;  3M4O H;  5EPL A;  2VS1 A;  3I70 A;  5CV4 A;  2AKW B;  2CVR A;  5I9P A;  4CKC A;  3PIP 3;  4IQZ A;  4X62 L;  4JOI C;  1DCZ A;  1QWY A;  3I3C A;  4PG3 A;  3T1H L;  4F7X A;  4H7B A;  1G51 A;  4P74 A;  5BN3 A;  1ZEQ X;  4QY7 A;  2DGY A;  3Q24 A;  1LAC A;  2HQL A;  1CUK A;  2B63 B;  3OIQ A;  4YCW A;  2MO1 A;  1HCZ A;  4MZ9 A;  3PUV A;  1E2W A;  4YY3 Q;  2H5X A;  2F0N A;  3K5O A;  2L12 A;  3JAM E;  2WIN B;  1JMC A;  1PYS B;  3AMU A;  1HR0 Q;  2OEO A;  2WAQ E;  3J81 j;  5FJ8 G;  4YHH Q;  1S5B D;  1GHJ A;  5DLQ E;  3L2P A;  3H3V I;  2A69 D;  1F9R A;  4LF4 Q;  3CCL A;  1O7L A;  3RD4 A;  1B3A A;  2KVM A;  2I5L X;  1SE4 A;  3T1Y L;  1O80 A;  4AYB E;  3GD7 A;  1C4Q A;  1EQT A;  1J9O A;  5M5X B;  2E74 C;  4TSS A;  2KOL A;  4IPH A;  3QJY A;  1SMY D;  1AE2 A;  4UY8 C;  1VQF A;  1D8L A;  4QF4 A;  1VQP A;  3P7J A;  5E4X A;  1IW7 C;  2K5D A;  1A3V A;  1N8R C;  4JI2 L;  4JOI A;  2F4V Q;  3S2H B;  2XRQ D;  1ICF B;  4ZCK A;  1HQM C;  1HR0 W;  2Q8T A;  4IUU A;  2TSS A;  1K8O A;  4OXP A;  2F0G A;  1JCK B;  4A3C H;  1OXV A;  3GTP H;  1B44 D;  4DV3 L;  5K5P A;  1P16 A;  2VY3 A;  4A3M B;  2M00 A;  1I4P A;  2WB1 E;  2KED A;  2PMZ B;  2F0S A;  1TS5 A;  1V9P A;  4IOA A;  3C1F A;  1AN8 A;  4H0L C;  2D0P A;  1F77 A;  5LMN L;  1Y8P B;  5JOB A;  4XDX A;  3A56 A;  1GUT A;  1PH8 A;  2ZXP A;  2C5C A;  5CV8 A;  4GNX A;  4DU9 A;  2SDF A;  1PFN A;  5AJ3 L;  1BCP B;  2PPB C;  2R93 H;  3PO3 B;  1X3F A;  3PO2 H;  2R92 H;  5M3F G;  4O1N A;  3BZK A;  1MI2 A;  2OXP A;  4DNR B;  2HT1 A;  4DV2 Q;  4C2M H;  2N78 A;  3NTI A;  1PFS A;  3K8A A;  1A2U A;  4OON A;  4JI3 Q;  1CHP D;  1YHA A;  2RA4 A;  1TKW B;  4K5V A;  2QA4 A;  1IBK L;  2F0M A;  1CA5 A;  1PH6 A;  4DV1 L;  2QDB A;  5JEA J;  1K0S A;  4ZUJ A;  2X69 A;  1WTO A;  1MHW C;  5E3F A;  4A3B G;  5DAU A;  1M90 C;  4DV4 Q;  4BBS B;  1TII D;  1PH7 A;  1YEZ A;  4R4I A;  2SNS A;  1HA5 A;  5IE8 A;  3F8T A;  5TSS A;  5M5W B;  3W1G A;  3GTK B;  2RSO A;  5CV9 A;  3AB9 A;  3BDO A;  3TQY A;  2WII B;  1STY A;  4X62 Q;  4O42 A;  3CF5 A;  2V4D A;  3K0Y A;  3BDL A;  1A3T A;  1W3S A;  1YVC A;  4ME5 A;  2UUB L;  4A3M G;  4DR3 L;  3QOJ A;  4IFD J;  4FDB A;  1S4Z A;  4HED A;  1STA A;  1ZYR C;  2K4K A;  2NN6 I;  1HZB A;  3I2Z A;  2Z8L A;  2OCE A;  5I9O A;  2AMC B;  4KK7 A;  1VDZ A;  3GTM H;  4A3D B;  3OYY A;  3H09 A;  4C3J B;  1VQN A;  1JR0 D;  5JEA G;  1KRS A;  1TWH B;  4L5Q A;  5BR8 L;  1TS4 A;  1W6J A;  1I4Q A;  2ZXR A;  1QOH A;  4A3F B;  1NY4 A;  3CKI B;  4C3I B;  2IHF A;  4CDE C;  3PUW A;  3K6O A;  4UHV A;  3S14 H;  1B3Q A;  5IIF A;  2PQE A;  1PVO A;  2LFN A;  4JI2 Q;  1SYF A;  1C8C A;  1A0I A;  2NVX B;  1VQE A;  1STN A;  5ELN A;  1ILP A;  3M7N A;  4IFD G;  3OMC A;  3HOX B;  4OGQ C;  1Q1B A;  3TME A;  1IBM Q;  1KL9 A;  4K2K A;  4P73 A;  2KA7 A;  2L15 A;  5LMU L;  2KJX A;  3HKZ G;  4BBR B;  1ASZ A;  1BOS A;  2K14 A;  1R9T B;  4BBS G;  5L37 A;  1EU4 A;  2QF7 A;  3F2D A;  1PH4 A;  5ELO A;  1H9M A;  2IL8 A;  5LMN Q;  3I4M H;  3BZD B;  4UDU C;  3A7A B;  3NWS A;  1XPR A;  2IJ0 A;  5C6A A;  2ZJR A;  5A2Q E;  4DAP A;  1VMP A;  1GXD C;  2I46 A;  4DV6 L;  3W1B A;  4V0B A;  4DR1 L;  4ZK9 B;  4R9W A;  4QL5 A;  5CV7 A;  3JAM i;  4A3K H;  3T16 A;  3D4D A;  3TBI B;  4V19 0;  1KNE A;  5ISR A;  4WJ4 A;  2EVB A;  4FNF A;  1HUM A;  1DJR D;  1PV4 A;  3D31 A;  3AQQ A;  4LFB L;  5DNF A;  4BWG B;  3WOF A;  3K57 A;  3UDF A;  4JBM A;  4KMU C;  4KJO A;  1HNW L;  3OHX C;  1YBY A;  5M3F H;  1CT1 D;  4A3D G;  2F0V A;  1PTO B;  3HOW H;  5FK9 C;  4L5R C;  2JA7 B;  1A15 A;  2MHV A;  4POG A;  4HAE A;  4IZ8 A;  3HKS A;  2O2L D;  3VR4 A;  1IBK Q;  1V1P A;  3WDN A;  4DV1 Q;  2PQA B;  2Y0S B;  2KBN A;  4RAU C;  1SYB A;  3CCQ A;  1JC7 A;  4DK0 A;  1XXG A;  3CC7 A;  4A3B H;  1HFN A;  3SK4 A;  2WKD A;  1I3Q B;  2RQX A;  4KY6 A;  5J39 A;  2OWO A;  2L5T A;  3IFD A;  4R4C A;  1H9R A;  3KJP A;  4BS9 A;  1I6H B;  2ZXO A;  4LF9 L;  4QUF A;  3UDG A;  1PHJ A;  5IGB A;  1ZKO A;  2UUB Q;  4DR3 Q;  5IGF A;  5C44 B;  4B3R Q;  1CKO A;  4EQO A;  2PNR C;  4A3M H;  2OF1 A;  4OIJ A;  2LXK A;  3W5O A;  2ZTD A;  5M5Y H;  1BO0 A;  3H6M A;  3BYT B;  3SEB A;  1I4H A;  5KGU A;  1LTG D;  4X3U A;  2UXD L;  1TWC B;  2G9D A;  2OQ0 A;  2NWG A;  4A3E B;  3UE0 A;  4KKU A;  5BR8 Q;  1E2Z A;  3DWQ A;  4FXK C;  1PA6 A;  5CGK A;  4CDD C;  5JEA H;  1Y1W G;  1N34 L;  1I4X A;  4JI6 L;  3HEJ A;  4GN4 B;  1EY4 A;  1TQO A;  3M4O B;  1ENF A;  4R8I A;  1KRT A;  1S3O A;  2K03 A;  3PMF A;  2QCP X;  3EFX D;  2HHH L;  3MVV A;  2K50 A;  3ERQ A;  1NCV A;  2EYP A;  2F0D A;  4CGY B;  5J1Z A;  3STB C;  3GTO H;  3MXN A;  4QCL A;  2BH8 A;  1XMQ L;  2O5I C;  4IFD H;  5LMU Q;  4XQN A;  3U50 C;  1PZJ D;  4RHR A;  1HFG A;  4Q5V A;  1LTT D;  4J15 A;  1UNS A;  2A74 C;  4GNX B;  4KHZ A;  4R4O A;  4G7O C;  1IHZ A;  1Z7T A;  2F0Q A;  4PMB A;  1BBX C;  2A6E D;  1TWG B;  5GRO A;  1Q3L A;  1ROD A;  2ALY B;  4NKL A;  4RGN A;  4DV6 Q;  4HTH A;  1FD7 D;  3GQB A;  5M5W H;  4EVO A;  3UDI A;  1CA6 A;  3CW2 C;  4X65 L;  1VQJ A;  5GAH C;  4FXD A;  2MPM A;  5C44 G;  1BVS A;  4EQN A;  3SK6 A;  3C2P A;  2R3Z A;  3J80 L;  3CMA A;  2H4O A;  4Y7N H;  4LFB Q;  1A3U A;  1CZW A;  1VQG A;  1TT2 A;  4O0A A;  4LW1 A;  3CRL C;  2QIL A;  4HIM A;  4NMZ A;  3EBE A;  5D3D A;  4OHJ A;  4ID6 A;  1QB5 D;  3FP9 A;  1C48 A;  1O78 A;  4A3E G;  2MUY A;  2KUM A;  4A3D H;  1NR4 A;  3P1H A;  4DV0 L;  3J80 c;  4NW2 A;  4UPA A;  1JB3 A;  4XXE A;  1PH5 A;  3U58 A;  1XNR L;  4H44 C;  3PUX A;  1X3P A;  2HDM A;  3ONA B;  5IYD G;  2G5D A;  2SNM A;  2F0F A;  3KBX A;  5I4D A;  3S17 H;  3RNU A;  4I65 A;  3ULL A;  2HDL A;  2LS0 1;  1SYE A;  1AP0 A;  1UE7 A;  3U4V A;  2MNA A;  1FJG L;  2NVX H;  2CW0 C;  4LF9 Q;  2R93 B;  2F0E A;  5E4W C;  3J7Y W;  3JC6 6;  2J0T D;  1C9O A;  4DK1 A;  3TS0 A;  4B9X A;  2A1A A;  1SSO A;  3J7A 5;  1A6X A;  5COY A;  4IFD I;  3NQI A;  2XNA C;  2R92 B;  1PZK D;  3KF6 A;  3I73 A;  4OWT B;  3VA5 A;  1PFB A;  2F0W A;  1R9T H;  2XRS D;  1ML0 D;  4RMF A;  3GO5 A;  1HR0 L;  4YHH L;  1HA6 A;  5EBD A;  4HJ9 A;  1QNK A;  1VQD A;  4LF4 L;  1N33 Q;  3VYT A;  1AE3 A;  1GUG A;  1TXY A;  1YI2 A;  1STG A;  4GOP C;  5KNB A;  2ZJQ A;  2B2V A;  2F3V A;  2E8G A;  4KV6 A;  2F0J A;  4FXG C;  5FLM H;  5C4J B;  2PZT A;  3K5M A;  4ABN A;  1CI3 M;  4MTK A;  1L1O A;  1EWC A;  1Y1W H;  1BR9 A;  3T4A C;  1GVP A;  2IW3 A;  4R1J A;  2F4V L;  3IFT A;  1VQ9 A;  2HHH Q;  1CSQ A;  2ZTC A;  1OO9 B;  5IGE A;  4PNY A;  1KAW A;  3ZYY X;  2JYO A;  3LWE A;  1ONL A;  4I7Z C;  3GP7 A;  1Z9F A;  1NBW A;  2Z6B A;  4A4I A;  5C3W A;  2ATW A;  1ICW A;  2QKI C;  1E0B A;  2GVB A;  4JI0 Q;  1MJE A;  1EZ6 A;  5ELC A;  3SK5 A;  5IGC A;  2VQE Q;  3GTM B;  2HIX A;  1HJP A;  2NTT A;  1B50 A;  1I4R A;  1VF5 C;  2F0L A;  2K52 A;  1Y69 U;  1N32 Q;  1KD1 C;  1I3Q H;  4DNT B;  5EAY A;  2RDH A;  2K5N A;  3CCM A;  1I6H H;  1YNJ D;  2L55 A;  2Z4I A;  3M4Q A;  1UAP A;  3CPF A;  5GAG C;  1GKH A;  4X66 L;  1EOV A;  1YJW A;  4DAV A;  3E9H A;  3PSI A;  2ZJP A;  1EZ8 A;  3I56 A;  3HOY G;  2M2L A;  4GZY C;  5CYU A;  1LO5 D;  4IO9 A;  1FNU A;  1F2M A;  1STE A;  2DNC A;  1V1P B;  2K5H A;  3KF8 A;  4UP9 A;  4X3K A;  4JPB W;  3SHL A;  5CC4 A;  5CBA E;  5IOD A;  1EEI D;  3J81 L;  1BUV T;  3RN2 A;  1N36 L;  4JI3 L;  4N8F A;  2OTJ A;  3DUZ A;  1TWC H;  1UEB A;  1CZG A;  2Z6K A;  4DV0 Q;  3H3V C;  1EY8 A;  4X3T A;  4A3E H;  3KBG A;  1SRO A;  1K9M C;  1XNR Q;  1EFI D;  4HJ8 A;  4BY1 B;  1HZC A;  1FNW A;  1NUC A;  3J81 c;  3I4M B;  1UE5 A;  4B08 A;  4DV4 L;  4EQ5 A;  1KXL A;  4IUQ A;  1R4Q B;  3N6R A;  1Q8K A;  1IXR A;  4CKE A;  5IYD H;  4UP7 A;  1HZ9 A;  2B2Y A;  2EXD A;  4A3K B;  2XTI A;  5CMD A;  1FJG Q;  1A62 A;  1TU2 B;  2JQO A;  4G7Z C;  1KC8 C;  1EY0 A;  1DOK A;  5C5L A;  4MNO A;  1RTO A;  3S16 B;  4LF5 L;  2JSO A;  5CBE E;  4E6I A;  3RMH A;  3QG1 A;  1SJH D;  1EUJ A;  2IY5 B;  2RDF A;  4RH6 A;  2ID0 A;  4NXM Q;  5M3F B;  3FDT A;  3NBI A;  1IYV A;  3QOL A;  2OTL A;  1K28 A;  3HOW B;  3VYS A;  2K04 A;  1LT5 D;  1TWG H;  4A3G G;  4OO1 G;  2VUM G;  3SK8 A;  2K5W A;  3IRB A;  4K8I A;  3MHB A;  3OOC A;  4NPS A;  1LTB D;  4HJ5 A;  1FNV A;  2A68 C;  1EQQ A;  2EYM A;  3EN2 A;  4IPD A;  3D6C A;  1VQ4 A;  4M1U B;  1PRT C;  4Z9C B;  5IT9 L;  1IL2 A;  1EWI A;  4A3B B;  4PMW A;  4RGM A;  2K32 A;  4IOC A;  2R7D A;  4GLA C;  1X3Q A;  1OXX K;  4MTN A;  4G4K A;  1D2B A;  1U4L A;  1JOQ A;  1JB7 A;  4P72 A;  4KI0 A;  5EKL A;  5C4X G;  4L6T B;  4DR2 L;  2HUG A;  5IT9 c;  1Z6H A;  2MO0 A;  1IBM L;  1ZYR D;  3D0F A;  2WB1 B;  2I5M X;  4XQJ A;  4QIW B;  1UEA B;  4BY1 G;  3RN5 A;  3A5Z B;  1EY9 A;  3I4M G;  3DEP A;  5M5Y B;  4ZLT F;  3KJO A;  3H0G H;  1GJX A;  3PF4 A;  2KQ3 A;  4JC0 A;  4X64 L;  3HOV G;  4LFA Q;  2CCZ A;  2XWJ B;  5J3B A;  2L9H A;  3H94 A;  3OWE B;  1KDC A;  1RCV D;  1B8A A;  4A3K G;  2I5H A;  1DZ1 A;  1FVI A;  2E2J B;  4U67 3;  2F4I A;  3A54 A;  1B1Z A;  3GDE A;  3N52 A;  4CJ2 C;  3G71 A;  4ZUI A;  3VYR A;  1NMF A;  5JPN C;  1WD1 A;  4X66 Q;  2PMZ E;  1JWM D;  4FF2 A;  2UXC L;  3TZD A;  5BN4 A;  4POF A;  1EU3 A;  2WAC A;  2WAQ G;  3MTS A;  3VYU A;  3GTQ H;  1M8A A;  2ASB A;  3G7L A;  1ENC A;  2E75 C;  3HOY H;  1O7Y A;  3HOW G;  2CQA A;  1N36 Q;  4RFB A;  1K3R A;  2FJ2 A;  3GTO B;  2CQO A;  3U9S A;  4AYB G;  5C3X A;  4KD3 A;  3A8J E;  4EQP A;  3WWV A;  3RUZ A;  1EWH A;  3HKZ B;  3PCO B;  1L2F A;  5C5M A;  1IZ6 A;  3ERO A;  3BS1 A;  1JWU D;  4J8Q A;  2R61 A;  5C4J H;  3S1M H;  1X32 A;  1VS0 A;  1VQK A;  3CC2 A;  1D1I A;  1BKB A; 
#chains in the Genus database with same CATH homology
 4A3B H;  5IYC H;  3E9I A;  4A3F H;  2PI2 A;  4LUV A;  1LYL A;  4YCU A;  3G6E A;  3NEL A;  2MFI A;  3NBH B;  4C3I H;  3KF6 B;  2PI2 E;  4ME3 A;  3M4P A;  2OWO A;  1KIX A;  2WB1 G;  4GKK L;  4R4C A;  1L1O C;  1JJC B;  4LF5 Q;  2NVQ H;  3KJP A;  1H95 A;  4LF9 L;  1Y1V G;  3UDG A;  4DAM A;  3UE1 A;  3I7F A;  1PHJ A;  1YHB A;  4DR4 L;  1HNZ L;  4P71 A;  5GQO A;  4GKK Q;  4B3R L;  1KQS A;  2UUB Q;  4JI7 Q;  4DR3 Q;  3S2D H;  1Q82 C;  1WCM H;  4DR4 Q;  1E24 A;  1RIP A;  2WP8 J;  2C35 B;  1HNZ Q;  4B3R Q;  1CKO A;  4X6A H;  3HOX H;  2UUA L;  4A3M H;  3CCS A;  1EIF A;  2UU9 L;  2LXK A;  2KHJ A;  3K0X A;  3RLN A;  3E0E A;  3W5O A;  4A3I G;  2ES2 A;  1B70 B;  5IP7 H;  2ZTD A;  5M5Y H;  1QZG A;  3I4O A;  4NXN L;  4BBR H;  2UU9 Q;  1VCI A;  2IT1 A;  4ALP A;  1YHQ A;  1C7Y A;  3AFP A;  1WI5 A;  1L1O B;  4GLV B;  5HY6 A;  3CD6 A;  4YY3 L;  2Q2U A;  1RL2 A;  3K7A H;  1VQ7 A;  4KHP Q;  4XIG S;  3I4N H;  3S1Q H;  1Z47 A;  1EFW A;  2UXD L;  2OQ0 A;  4A3G H;  3CCV A;  3L7Z C;  2VUM H;  3K7U C;  1IYJ B;  3CC4 A;  1MJC A;  3UE0 A;  2UXD Q;  3RLO A;  1BBU A;  4JG2 A;  5BR8 Q;  4JCV E;  1PA6 A;  1I50 H;  3J80 i;  5IYB G;  3MXN B;  1Y1W G;  3S1N H;  4OX9 L;  4PZ6 A;  1XPU A;  1N34 L;  1XJV A;  2EQS A;  4JI6 L;  1QVC A;  4P75 A;  5C3E H;  4GN4 B;  4LF7 L;  2N49 A;  1I94 Q;  2KHI A;  1N34 Q;  4JI6 Q;  1BBW A;  5FLX c;  1HH2 P;  4LF7 Q;  1E22 A;  1JT8 A;  3MEF A;  3J81 i;  1KRT A;  2AWN A;  5HGQ A;  4GNX C;  1JE5 A;  2BH2 A;  1UWV A;  1S3O A;  4DK6 C;  3I55 A;  4DR2 Q;  4DR5 L;  1E1T A;  2HHH L;  3HOU H;  2K50 A;  3ULP A;  1VQ6 A;  4A3J H;  5C4X H;  4B3M Q;  4PZ7 A;  1CKN B;  3HOZ H;  4A3C G;  3STB C;  4LF6 Q;  1SMX A;  3GTO H;  4HIK A;  4B3S L;  3B6Y A;  3PGZ A;  2BH8 A;  1XMQ L;  3ICE A;  4BY7 G;  2EIF A;  1X55 A;  3NEM A;  1X9N A;  3PIO A;  5LMU Q;  3S1R H;  3KLW A;  1JJ2 A;  4B3S Q;  2R7Z G;  1XMQ Q;  4BY1 H;  3U50 C;  5IP9 G;  2ZTE A;  4DR6 Q;  3G4S A;  1YJN A;  2JA7 H;  2R6G A;  4J15 A;  4DKA C;  4X64 Q;  2XGT A;  4GNX B;  1G6P A;  4KHZ A;  1QZH A;  3PIP A;  4LF8 Q;  1SN8 A;  4HJA A;  3L0O A;  4R4O A;  1K73 C;  2Z6K C;  2V1C C;  3HOV H;  1MIU A;  4JYA Q;  3TEH B;  2DUD A;  4L5T A;  5GRO A;  1EYG A;  2ALY B;  4O2D A;  4HJ7 A;  2JJQ A;  2UXB L;  3ERS X;  1G29 1;  4IPC A;  4QIW E;  4DV6 Q;  1Q12 A;  5M5W H;  3UDI A;  1WJJ A;  3CW2 C;  4WJ3 M;  1TWA H;  4X65 L;  3KF8 B;  1K83 H;  3F2B A;  3S16 H;  1VQJ A;  3DM3 A;  5GAH C;  4A3L H;  3PUZ A;  1AH9 A;  5C44 G;  1U0L A;  3FHW A;  5E7N A;  1K0R A;  1BVS A;  2UXC Q;  4X65 Q;  2R93 G;  1V1Q A;  3PO2 G;  1X54 A;  4JBK A;  1M1K C;  3CMA A;  4Y7N H;  1EIY B;  4R4T A;  2R92 G;  4LFB Q;  1XMO Q;  4A75 A;  1NTG A;  2NZH A;  5C44 H;  1VQG A;  4QGU A;  4O0A A;  1U5K A;  4LW1 A;  1PH1 A;  1X6O A;  1Q1E A;  2YU9 H;  4XTC S;  4HIM A;  2RHS B;  2B63 G;  2I0Q A;  3EBE A;  4YWM A;  2UUC L;  3FP9 A;  4UP8 A;  4DV7 Q;  4B3T L;  4DV2 L;  4A3E G;  2JA9 A;  1QUQ A;  4AIM A;  5M3M G;  4PZ8 A;  4A3D H;  4BXX G;  2JA8 G;  1NJI C;  1J5E L;  4DV0 L;  4B3T Q;  3J80 c;  2WFW A;  4AQY Q;  3BU2 A;  4UPA A;  4TQU S;  1PH5 A;  3U58 A;  2JA5 G;  1XNR L;  1IBL L;  3PUX A;  4DUZ L;  1I5F A;  2N3S A;  1YNX A;  5M3M H;  3AEV A;  2BA0 A;  3PUY A;  4GN5 A;  5IYD G;  1VQO A;  2AHO B;  3S17 H;  3RR5 A;  3RNU A;  3RZO H;  3BJU A;  3F1Z A;  4GKJ L;  4QJF A;  4HIO A;  3ULL A;  3KDF A;  2K5V A;  2VL6 A;  1K8A C;  1UE7 A;  1WOC A;  4LFC L;  4A93 G;  1SR3 A;  2PQA A;  3HKZ E;  3U4V A;  2MNA A;  1FJG L;  3M4O H;  2VS1 A;  2B3G A;  4IPG A;  2NVX H;  2Y0S E;  2AKW B;  4LF9 Q;  4LFC Q;  1O7I A;  2BA1 A;  3JC6 6;  1Q86 C;  2CWA A;  1C9O A;  3TS0 A;  2A1A A;  4X62 L;  4JOI C;  3RLF A;  3J7A 5;  2IHE A;  1Y1V H;  4PG3 A;  3T1H L;  4IFD I;  3KOJ A;  2UUA Q;  2VZA A;  3KF6 A;  1JJG A;  1G51 A;  4P74 A;  1FGU A;  4OWT B;  2A19 A;  4QY7 A;  4HID A;  2DGY A;  3T1H Q;  1VQB A;  1UE1 A;  2R7F A;  2HQL A;  1R9T H;  3TRE A;  4JI5 L;  1CUK A;  4NXN Q;  4JBJ A;  2N8N A;  1N33 L;  4A3I H;  4RMF A;  2MO1 A;  4YCW A;  3GO5 A;  3PUV A;  4MZ9 A;  1HR0 L;  4YY3 Q;  4GLX A;  4YHH L;  2H5X A;  3JAM c;  4HJ9 A;  5FLM G;  1VQD A;  4LF4 L;  1JMC A;  3AFQ A;  1VQA A;  1AE3 A;  1PYS B;  2E2J H;  1N33 Q;  1V43 A;  1HR0 Q;  3J81 j;  2WAQ E;  5FJ8 G;  4YHH Q;  1TXY A;  3L2P A;  1YI2 A;  2Q2I A;  5DLQ E;  3H3V I;  4GOP C;  4LF4 Q;  4KLK A;  3CCL A;  2ZJQ A;  3UDX A;  4OX9 Q;  2E8G A;  5FLM H;  5IY0 A;  3G48 A;  2I5L X;  1LTL A;  1TWF H;  3T1Y L;  4AYB E;  1YZ6 A;  1L1O A;  3GD7 A;  5FJ8 H;  5IYB H;  1Y1W H;  2NVY H;  2Q2H A;  1L0W A;  4DR7 L;  4DPG A;  1CSP A;  1GVP A;  2GVA A;  3T1Y Q;  4IPH A;  1X65 A;  1AE2 A;  4UY8 C;  1VQF A;  2GN5 A;  4R1J A;  1D8L A;  3PO3 G;  4DR7 Q;  1VQP A;  2F4V L;  4DR5 Q;  1VQ9 A;  1VQC A;  4AH6 A;  2HHH Q;  1CSQ A;  1N8R C;  2ZTC A;  4GOP B;  4JI2 L;  4JOI A;  1PH3 A;  2F4V Q;  1KAW A;  3CME A;  4YWK A;  1HR0 W;  5C0X I;  1Z9F A;  4OXP A;  1OTC A;  1NBW A;  4A3C H;  4IJH A;  1OXV A;  3ULJ A;  4A4I A;  4DV3 L;  4JI0 L;  4LNQ A;  1XNQ L;  4JI8 L;  3GTP H;  4BY7 H;  2ATW A;  1P16 A;  4YCV A;  2GVB A;  2VQE L;  2VY3 A;  1YJ9 A;  2D0O A;  4JI0 Q;  4DV3 Q;  1QVF A;  2WB1 E;  1MJE A;  5IP9 H;  4IOA A;  1V9P A;  2VQE Q;  1CKN A;  2HIX A;  1HJP A;  2D0P A;  1N32 L;  1HZA A;  3K81 C;  5JJK A;  2YTX A;  2UXB Q;  5LMN L;  3CQZ H;  2K52 A;  4OWX B;  1N32 Q;  1KD1 C;  5K36 G;  2QGQ A;  1I3Q H;  1GM5 A;  5EAY A;  3CPW A;  1PH8 A;  2K5N A;  3A5U A;  2KCT A;  3OTO L;  1FL0 A;  4BA1 I;  3CCM A;  4GNX A;  1J6Q A;  2E2I H;  3SGI A;  1I6H H;  3STB D;  1UE6 A;  3M4Q A;  1E7Z A;  3CPF A;  5GAG C;  4LUO A;  1GKH A;  3CCJ A;  4X66 L;  2VNU D;  4GS3 A;  5AJ3 L;  1EOV A;  2IX1 A;  2RHQ B;  1YJW A;  4JV5 L;  3E9H A;  3PSI A;  2ZJP A;  1C0A A;  3GTL H;  3M9B A;  3I56 A;  3HOY G;  2R93 H;  5AJ3 Q;  1X3F A;  4IO9 A;  3PO2 H;  1OXT A;  1LUZ A;  2K5H A;  2E5L L;  2R92 H;  4UP9 A;  5M3F G;  1N36 L;  3RN2 A;  2YTV A;  4DV5 L;  3M3Y H;  3BZK A;  4JI4 L;  4OO1 I;  4JI3 L;  1VQL A;  2UUC Q;  3CCE A;  2HT1 A;  1VQM A;  1Y14 B;  2YYZ A;  2N78 A;  3FKI G;  1PFS A;  4C2M H;  4DV2 Q;  2OTJ A;  3K8A A;  4DV5 Q;  1TWC H;  1UEB A;  2B63 H;  4JI4 Q;  4OON A;  1J5E Q;  2Z6K A;  4RG1 A;  3PV0 A;  3CCU A;  4DV0 Q;  4JI3 Q;  2MQH A;  1YHA A;  5LMN W;  5GAD C;  3CCR A;  4A3E H;  2KEN A;  2ZM6 L;  2JA6 G;  1SRO A;  3CAM A;  1K9M C;  1XNR Q;  1E3P A;  2JA8 H;  1IBL Q;  4BXX H;  4TVA B;  2LXJ A;  3ZJY C;  2QA4 A;  4DUZ Q;  1XTD A;  4HJ8 A;  1HZC A;  1IBK L;  2ZM6 Q;  3J81 c;  1PH6 A;  4DV1 L;  1UE5 A;  5JEA J;  4EQ5 A;  4DV4 L;  2JA5 H;  2R7Z H;  1KXL A;  1IBM Q;  1A63 A;  4A3B G;  5IYC G;  4YWL A;  4A3F G;  1Q8K A;  1IXR A;  1M90 C;  4DV4 Q;  4GKJ Q;  1PH2 A;  2AWO A;  3J7Z C;  1PH7 A;  2A8V A;  5IYD H;  1YEZ A;  2NZO A;  4UP7 A;  1SRU A;  4R4I A;  5M5X H;  3F2C A;  3BZC A;  1HZ9 A;  2EXD A;  5IE8 A;  1Q46 A;  1FJG Q;  2XTI A;  1A62 A;  3F8T A;  2JQO A;  1PYB A;  3A0J A;  1KC8 C;  2B29 A;  1X3G A;  3W1G A;  4A93 H;  1A8V A;  4MNO A;  3PF5 A;  1SFO H;  4LF5 L;  3DLL A;  4R4Q A;  3TQY A;  3Q8D A;  1LM0 A;  4X62 Q;  2F52 A;  1WCM G;  3CF5 A;  3KYH C;  4LWC A;  2QEX A;  3K80 C;  3S2H H;  3HOX G;  1W3S A;  1YVC A;  2UUB L;  4JI7 L;  4NXM L;  1MKH A;  1CKM A;  4DR3 L;  3NEN A;  4A3M G;  4IFD J;  1XNQ Q;  2E2H H;  1E1O A;  1EUJ A;  2JK8 A;  4FDB A;  2IY5 B;  2ID0 A;  5IP7 G;  1VQ8 A;  4NXM Q;  4BBR G;  1Q7Y C;  4JI5 Q;  3GTG H;  3TS2 A;  2OTL A;  4H02 A;  2K4K A;  2NN6 I;  2F3I A;  1HZB A;  3I2Z A;  1GD7 A;  3I4N G;  2OCE A;  1S72 A;  2AMC B;  1TWG H;  1XPO A;  4A3G G;  4OO1 G;  2CKZ B;  2VUM G;  1P8L A;  4KHP L;  1NE3 A;  3GTM H;  3IRB A;  1VQI A;  3ER0 A;  2OQK A;  4NPS A;  3OYY A;  4HJ5 A;  1VQN A;  5JEA G;  1EQQ A;  1KRS A;  3EN2 A;  3GTJ H;  4L5Q A;  4IPD A;  1WFQ A;  5BR8 L;  1B7Y B;  3HFZ B;  1VQ4 A;  2FXQ A;  4BA2 I;  4OWW B;  5C3E G;  1IL2 A;  1EWI A;  3A74 A;  4PMW A;  4DNI A;  4IOC A;  1NY4 A;  2R7D A;  4GLA C;  3S24 A;  2IHF A;  3PUW A;  1OXX K;  4MTN A;  5H1S E;  3S14 H;  1I94 L;  1KHI A;  1QVG A;  1VQH A;  3HOU G;  3LGJ A;  4NB3 A;  4P72 A;  1JB7 A;  1PH9 A;  4KI0 A;  1PVO A;  4A3J G;  4JI2 Q;  5C4X G;  3PO3 H;  3HOZ G;  4DR2 L;  1A0I A;  3AYH B;  1NMG A;  3OW2 A;  5IT9 c;  1VQE A;  2MO0 A;  5ELN A;  3H0G G;  1IBM L;  3D0F A;  4B3M L;  3M7N A;  2I5M X;  4IFD G;  4LF6 L;  1X56 A;  2CFM A;  1Q1B A;  5C0X J;  4K0K L;  4BY1 G;  2IX0 A;  3RN5 A;  1KL9 A;  1OXU A;  3A5Z B;  1GO3 E;  1OXS C;  3CP0 A;  4P73 A;  4JI8 Q;  2JA7 G;  3I4M G;  1S40 A;  2L15 A;  5LMU L;  4EX5 A;  4DK3 C;  2JEB I;  1Q81 C;  3HKZ G;  4LFA L;  3KJO A;  1ASZ A;  3H0G H;  4K0K Q;  3PF4 A;  2K14 A;  4GOP A;  4DR6 L;  2Y0S G;  5JJL A;  4JBW A;  4JC0 A;  4X64 L;  3HOV G;  4BBS G;  4LFA Q;  2CCZ A;  4LF8 L;  5J3B A;  3F2D A;  1PH4 A;  5ELO A;  3U4Z A;  2NN6 G;  4DUY L;  4APV A;  5LMN Q;  1ASY A;  3I4M H;  1D7Q A;  4JYA L;  3TRZ A;  1B8A A;  4A3K G;  2I5H A;  1FVI A;  2YTY A;  1XPR A;  2ZJR A;  1X3E A;  4DUY Q;  3KFU A;  4BBS H;  2Z0S A;  4Y52 H;  3OTO Q;  4DV6 L;  4L5S A;  3GDE A;  3CXC A;  3W1B A;  4A3L G;  4JI1 L;  4DR1 L;  1EQR A;  3G71 A;  1NMF A;  4GN3 B;  4QL5 A;  3JAM i;  3VDY A;  4X66 Q;  4A3K H;  1VQ5 A;  2JEA I;  2NVT H;  3H3V H;  2PMZ E;  4JI1 Q;  3M85 A;  4DR1 Q;  4JV5 Q;  1HNX L;  2UXC L;  4DAY B;  3H15 A;  4WJ4 A;  3GTK H;  4C3H H;  5IWA L;  4POF A;  1QUQ B;  2WAQ G;  3S15 H;  1PV4 A;  3GTQ H;  1N9W A;  2ASB A;  1HNX Q;  5JJI A;  3HOY H;  1WYD A;  5IWA Q;  3D31 A;  3AQQ A;  2E5L Q;  3HOW G;  4LFB L;  1N36 Q;  1K3R A;  4LUZ A;  3UDF A;  1K8G A;  1SLJ A;  1T9H A;  2CQO A;  4JBM A;  1HNW L;  1YBY A;  2D62 A;  5M3F H;  4AYB G;  4A76 A;  5C0X G;  2VW9 A;  4A3D G;  2VQF L;  3RZD H;  4DV7 L;  3WWV A;  2RF4 A;  1HNW Q;  3FKI H;  3HOW H;  1YIJ A;  2LSS A;  1W2B A;  2CWP A;  4L5R C;  2VQF Q;  4POG A;  2HIV A;  2K75 A;  3HKS A;  3KDF B;  5GAE C;  4AQY L;  3PCO B;  1L2F A;  4IJL A;  1IZ6 A;  1IBK Q;  4QQB X;  4DV1 Q;  2PQA B;  2JA6 H;  2Q2T A;  2KBN A;  2JE6 I;  2KCM A;  4C3J H;  5C4J H;  2PNH A;  1XMO L;  3S1M H;  3CCQ A;  1VS0 A;  1VQK A;  1SE8 A;  3EIV A;  2RCN A;  3CC2 A;  1TWH H;  1DGS A;  1YIT A;  1BKB A;  2YV5 A;  3CC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...