4HJ9A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (cggttacggt)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 37
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj9A00
3EBEA 1VQCA 4JC0A 4DAYB 1A0IA 2NZOA 1K83H 2DGYA 1XMQQ 4JI7Q 2NVQH 2ES2A 4A93H 4XIGS 1FL0A 3Q8DA 4DV0Q 3JAMc 3CMAA 4X65Q 3H15A 1PH5A 2OTLA 1CKNB 2ZTEA 5JEAJ 2IX1A 1N32L 1BKBA 1Q12A 1TWGH 3FKIG 4LUOA 2EXDA 4P71A 1PH3A 4JI1L 1HR0Q 1EFWA 2D0PA 1TWCH 5IP9G 2ZJQA 2YTVA 4IJLA 5EAYA 5IYCH 2MNAA 4BBSH 4O0AA 5C0XG 3KYHC 1PH9A 5C3EH 1O7IA 4DUYL 3UE1A 3S2DH 4DPGA 4C2MH 1EWIA 5M5YH 1YBYA 3F2CA 4AQYL 3PO3G 4QY7A 3NEMA 1N32Q 1IBKL 2H5XA 1PH2A 1PH8A 3H3VH 4JI1Q 1TWHH 2IHFA 3MXNB 1VQ5A 4H02A 5IYBH 2E2JH 1VQAA 1HZ9A 2JA7H 3K7UC 1N8RC 2R92H 1OXUA 1X3GA 4DUYQ 4B3SL 3EIVA 2N49A 4GNXA 2K5NA 3HOVG 4AQYQ 3TQYA 4R4CA 3BJUA 1LUZA 1K73C 1IBKQ 2CQOA 3KF8B 3TEHB 3HOXG 3T1HQ 4UY8C 3HOYH 3NENA 4BXXG 1I3QH 1Q1EA 4LUZA 5DLQE 1GVPA 1LTLA 4A3EG 1SFOH 1UE7A 4RMFA 1YVCA 4UP8A 4A3LH 1C0AA 3GD7A 4P75A 2CCZA 4K0KL 4J15A 4JOIC 4B3SQ 2JEAI 3E0EA 4Y52H 2MFIA 1YJNA 2NVYH 1U0LA 3F8TA 2ZM6L 4A93G 1V43A 1KC8C 5GAEC 2UXBL 3I2ZA 3DM3A 3CXCA 4C3HH 4GN3B 3CCRA 4DR2L 3KDFA 3CCJA 4K0KQ 3SGIA 3CCQA 5GROA 1HZCA 4QIWE 3J80i 4IO9A 2NVXH 3I4NG 4IPCA 2A1AA 2YTXA 2ZM6Q 1EYGA 1YNXA 4YHHL 4IOCA 3ULPA 1X3FA 4BY7H 2E5LL 3S15H 2UXBQ 5H1SE 4DV5L 1JJCB 4DR2Q 3GTJH 2QEXA 3KJOA 4DV6L 3RZDH 2R7ZG 1I6HH 4A75A 1G6PA 1XTDA 1AE3A 3T1YL 1VQMA 2E2HH 3EN2A 5M3MG 4GLVB 3B6YA 5HGQA 2CWAA 4YHHQ 4WJ4A 3UDGA 3MEFA 2R7FA 3J81i 2E5LQ 4DV5Q 2R6GA 1Q8KA 1JJ2A 3J7ZC 2Q2HA 4IPDA 1XMOL 2JA8H 3U4ZA 1CSQA 3CCVA 4GNXB 4DV6Q 2LXJA 1NMFA 1KL9A 4YWLA 4DUZL 3T1YQ 3ERSX 2WAQE 3CQZH 3PV0A 4O2DA 4PMWA 4DAMA 4IFDG 1JB7A 1TWAH 1JMCA 3UDXA 3FHWA 1BVSA 1NY4A 3ULLA 1KRSA 1XMOQ 1QVCA 1KAWA 3H0GG 4OO1G 1FJGL 1HJPA 4DUZQ 3D0FA 2F4VL 1V9PA 5LMNL 3M3YH 3PO3H 4A3FH 3S1NH 3A0JA 1VQDA 2RF4A 4YY3L 2HIVA 1UE1A 1KD1C 5GQOA 1Z47A 2ZJRA 1RIPA 1S40A 4HIOA 2A19A 4R1JA 3RLNA 4HJAA 1PHJA 4LF8L 3S16H 3U50C 4KI0A 1FJGQ 1GD7A 1N33L 3I4MH 4GKKQ 3K80C 5FJ8G 1HZBA 3L2PA 1W2BA 4BY7G 4LFBL 4EQ5A 1K8AC 2F4VQ 2CKZB 1C9OA 3KLWA 2IY5B 4UPAA 5JJKA 4YY3Q 3HOXH 5K36G 2VS1A 1PH1A 3S17H 4A3EH 1K3RA 1SMXA 3D31A 2ATWA 4LF8Q 2BH2A 2YTYA 3TS0A 3TS2A 1YHAA 3M85A 1NJIC 1N33Q 4IPGA 4HJ8A 4JI0L 4DV3Q 3HKSA 1HNXL 2PI2E 1VQ7A 1X6OA 3ICEA 2AWOA 3F1ZA 4GOPA 1VQLA 2E2IH 2JA8G 4DR4L 2VL6A 4GKJL 3F2DA 2L15A 3RN5A 2AKWB 2WP8J 4LF7L 2JEBI 3HKZE 4HJ5A 3CAMA 3K8AA 4X66L 1VQEA 4GS3A 1K0RA 4PG3A 3CC4A 3M7NA 1SROA 4JI2L 1B70B 3UDIA 1YHBA 2RCNA 2WAQG 4JI0Q 5C44G 1OXXK 4YCWA 1HNXQ 4P74A 1X55A 4DR4Q 3I4NH 3PUVA 4GKJQ 5FLMH 3CF5A 3W1GA 5IWAL 2OCEA 4P73A 3AQQA 4LF7Q 3CMEA 1VCIA 2QA4A 1AE2A 4X66Q 4ALPA 1N9WA 1I50H 1VQOA 1J5EL 1LYLA 1DGSA 1V1QA 1OXTA 3JC66 5C0XJ 4JI2Q 4A3FG 2YU9H 1QVFA 3T1HL 2R7ZH 4MNOA 1OTCA 2KCMA 3DLLA 4LF6L 1JE5A 2WB1E 1P16A 5M3MH 1H95A 3NELA 1YEZA 5IWAQ 5LMUL 3I4MG 2Y0SG 4R4IA 2Q2UA 5GAGC 1EOVA 4JI5L 1VQ4A 4NXNL 5IY0A 1J5EQ 2JA5H 4APVA 3PGZA 4A3GH 1PYSB 4UP7A 2HIXA 4L5QA 2ID0A 3GDEA 3KJPA 4LF6Q 2NVTH 3M9BA 5LMUQ 5C0XI 3CCUA 1IXRA 2UXCL 3RR5A 5IE8A 3GTGH 2BA0A 4JI5Q 4P72A 4NXNQ 2VNUD 1IL2A 2OQKA 2RHQB 2I5LX 1YHQA 3KFUA 3H0GH 1WCMG 5C4JH 3G71A 1HR0W 1OXSC 4YCVA 4Y7NH 3A5UA 2ZTDA 2DUDA 1M90C 1KIXA 2CFMA 3ULJA 3OYYA 4R4QA 1QVGA 4XTCS 1XJVA 1KRTA 1FGUA 1WI5A 3GTLH 3HKZG 4A3BH 3S1QH 3CCLA 2UXCQ 2NN6I 1QUQA 1YIJA 2OWOA 1BBUA 4NPSA 3GO5A 5GADC 5FLMG 5GAHC 5FJ8H 1Y1WG 1IYJB 4OWXB 4GOPC 1TWFH 4DR6L 2R93H 1A63A 2B29A 3F2BA 4L5SA 2V1CC 3PF4A 1VQKA 1ASYA 4A3MG 4PZ6A 1SR3A 3VDYA 3OTOL 2JA6G 1J6QA 1B8AA 5IP7H 5FLXc 4JBMA 1WJJA 1EQRA 3AFPA 3U4VA 4L5TA 1E7ZA 3AFQA 2GN5A 3JAMi 2WB1G 3PIOA 1I94L 4DR6Q 2KHJA 4DV4L 1IZ6A 1X56A 1IBML 2JQOA 2JA5G 3GTQH 3PUYA 4DK3C 4A3GG 4JI6L 3RNUA 2AWNA 2KBNA 3M4QA 3CCEA 4HIDA 4NB3A 3OTOQ 4JI8L 3ER0A 4GN5A 5JJLA 4GLAC 3UE0A 4DV7Q 5C44H 1S72A 2D0OA 1I94Q 3L0OA 4DV4Q 1CSPA 3BZCA 4NXML 3CCMA 4HIMA 1IBMQ 4LF9Q 4IFDJ 1YZ6A 2OTJA 1FVIA 4JBWA 4JI6Q 2VY3A 4QGUA 4GKKL 3H3VI 2VZAA 2KCTA 3K81C 4B3TQ 4A3IH 3PCOB 4JI8Q 4LF5L 4KHZA 1IBLL 1Y14B 1N36L 2PMZE 2K5VA 2JA9A 3J7A5 4A3BG 4X64L 1YJWA 3KDFB 3W1BA 1L1OC 2HHHL 1G291 4NXMQ 3HFZB 2MO0A 5IT9c 3M4OH 2UXDL 4OWTB 1I5FA 4PZ7A 4DR1L 1BBWA 2JE6I 4WJ3M 1Y1VG 2UUBL 4DV3L 3I55A 1WYDA 3WWVA 1A62A 1X65A 1VQGA 1IBLQ 2K5HA 1N36Q 2WFWA 1M1KC 4LF5Q 3A74A 3HOZG 1MKHA 1PFSA 1UEBA 4OXPA 5BR8L 1PVOA 3CP0A 1UE6A 4R4TA 4X64Q 1XPUA 3HOUG 2ZTCA 2HHHQ 5ELOA 3RLFA 2VQEQ 2UXDQ 5IP7G 3PO2G 3GTMH 4DR1Q 3A5ZB 3TREA 4GLXA 3STBC 1YJ9A 1VQNA 1S3OA 2IX0A 2UUBQ 5J3BA 1VQIA 1N34L 3KF6A 4BBRG 5M5XH 4HJ7A 1SE8A 2Z6KC 4BY1G 3S2HH 1HZAA 1WCMH 2K75A 5BR8Q 2MQHA 5E7NA 4A3JG 3W5OA 2A8VA 1U5KA 2LXKA 1Q81C 1PA6A 1C7YA 4HJ9A 1EUJA 2KENA 3STBD 1PH7A 3J80c 3IRBA 4R4OA 4DV1L 2R93G 4EX5A 1N34Q 1WFQA 3G48A 1WOCA 1VS0A 1JJGA 1SLJA 3I7FA 2VQFL 1NE3A 4LFAL 1Y1WH 4DR7L 2I5HA 4A3IG 3CC7A 4DK6C 4A3MH 1EIFA 2E8GA 3CPWA 4DV1Q 4JI3L 1JT8A 2HT1A 4PZ8A 2JA6H 5LMNW 1ASZA 5JEAG 1E22A 1PH6A 2N78A 3J81c 4YWKA 1CKOA 1TXYA 4LFAQ 1Q1BA 2VQFQ 1GO3E 3CD6A 4DR7Q 3NBHB 1XPRA 4HIKA 5IYDG 2OQ0A 1B7YB 1Z9FA 2F52A 2RHSB 4DNIA 4JG2A 2K14A 5C4XG 2B63G 1AH9A 4JI3Q 4A3KG 1UWVA 4QJFA 1E24A 4DKAC 2IT1A 1XNRL 3S14H 4JCVE 2Q2IA 2XTIA 3I4OA 1NTGA 1L1OA 1L0WA 4A3CG 2N8NA 4LW1A 1KXLA 4IPHA 2YYZA 4YCUA 5JJIA 2UU9L 3FP9A 4GN4B 2PQAA 3KF6B 3UDFA 2I0QA 4LNQA 4GOPB 2CWPA 1XNRQ 4BA2I 1PH4A 4KLKA 2ZJPA 2NN6G 4A76A 2JK8A 4MZ9A 3BU2A 4JV5L 4AH6A 2NZHA 1SN8A 2VUMH 1D7QA 4ME3A 2AHOB 3PF5A 1K8GA 3TRZA 1QZHA 3AYHB 1PV4A 3LGJA 2UU9Q 4DR5L 2Z6KA 1K9MC 1D8LA 1Y1VH 1VQ9A 4OX9L 4LWCA 1L2FA 1NBWA 4X62L 4B3ML 4A3DG 4JI4L 5AJ3L 3HOZH 1G51A 2I5MX 1KQSA 2VW9A 2K52A 3RZOH 2B3GA 4JV5Q 3I56A 1P8LA 2PNHA 3K7AH 2Z0SA 3HOUH 2GVAA 2ASBA 3RN2A 4IJHA 4DR5Q 3PO2H 3CW2C 1VQ8A 4LF4L 4OX9Q 1HNZL 4DR3L 4JYAL 4DV7L 4X62Q 3HOWH 1MIUA 4B3MQ 4BBRH 2GVBA 4AYBE 4JI4Q 5AJ3Q 4BY1H 4JBJA 4JBKA 4LF9L 3OW2A 4AIMA 1Q46A 2JJQA 5IYCG 3G6EA 2YV5A 4A3JH 4BBSG 2FXQA 1CKMA 3E9IA 1GKHA 2EQSA 3E9HA 3PIPA 5C3EG 2UUCL 3U58A 3PUXA 4B3TL 3GTKH 1VQJA 2ALYB 4LF4Q 1GM5A 1HNZQ 2IHEA 2LSSA 3K0XA 4RG1A 4DR3Q 3CPFA 4OWWB 4JYAQ 5M3FH 1L1OB 1VQHA 2BA1A 4UP9A 2AMCB 5M5WH 4QQBX 3PSIA 4QL5A 5IYBG 1VQ6A 1NMGA 1EQQA 3ZJYC 1E1TA 4A4IA 1X3EA 2N3SA 2UUCQ 2JA7G 2R92G 2PQAB 2XGTA 4TQUS 1X9NA 3KOJA 3S1MH 1XPOA 1KHIA 4LFCL 3HOYG 2VUMG 2PI2A 1HH2P 4MTNA 1CKNA 2MO1A 2VQEL 1PYBA 1Q86C 1MJEA 4KHPL 1VQPA 1QUQB 2KHIA 1EIYB 4A3LG 3GTOH 3AEVA 2K50A 3PUZA 4DV2L 3FKIH 4B3RL 5IYDH 3RLOA 5ELNA 2F3IA 1OXVA 4POFA 3G4SA 5C4XH 5IP9H 4IFDI 2B63H 4A3KH 4LFCQ 1X54A 1QZGA 4GNXC 2R7DA 2UUAL 4KHPQ 1UE5A 3M4PA 1HNWL 4L5RC 1VQBA 4POGA 1A8VA 4A3CH 1XNQL 4OO1I 3S24A 4DV2Q 3HOWG 4B3RQ 2C35B 3BZKA 1YI2A 4X6AH 4FDBA 4JOIA 4OONA 2Y0SE 4C3IH 1RL2A 1W3SA 4TVAB 4AYBG 3GTPH 3PUWA 2Q2TA 4LUVA 2UUAQ 1Q82C 1YITA 1T9HA 1MJCA 2D62A 5LMNQ 3HOVH 1HNWQ 4C3JH 2BH8A 1XNQQ 1Q7YC 2QGQA 1XMQL 4JI7L 5HY6A 1E1OA 4BXXH 5M3FG 3S1RH 2HQLA 1R9TH 4DV0L 1LM0A 1E3PA 2EIFA 4X65L 3J81j 3CC2A 1CUKA 3CCSA 1SRUA 3L7ZC 4A3DH 1VQFA 4YWMA 2K4KA 1HR0L 4BA1I 4LFBQ 4IOAA
chains in the Genus database with same CATH superfamily
3EBEA 4KTAA 4A93H 3KBXA 4JI7Q 4HN7A 1FL0A 3CMAA 2SEBD 4Q0FA 5CR3A 1BKBA 4QUFA 2EXDA 4KKSA 3SK6A 2ZJQA 5EAYA 5IYCH 4O0AA 2MHVA 1FNWA 2NZ1D 1O7IA 4C2MH 1EWIA 5M5YH 3F2CA 3QIAA 1CM9A 2QKIC 3H3VH 1TWHH 2M9VA 3VYSA 1W6JA 1VQAA 3KLSA 5IGGA 1QB5D 5BN3A 3EIVA 3QJYA 3HOVG 4AQYQ 4K2KA 1LUZA 3P7JA 3H94A 3KF8B 3T1HQ 3HOYH 3NENA 3WDNA 4A3LH 1JE4A 3SEBA 4K5VA 3CKIB 4J15A 4B3SQ 1NR4A 2IW3A 1U0LA 3GTGB 4KK7A 2WINB 3J7AV 4H7BA 2LKVA 2UXBL 3I2ZA 5K5PA 3HS0C 2EJFC 3OIQA 3SGIA 3CCQA 1EY0A 1WTHA 1HZCA 3J80i 5JVG3 2EOTA 4IPCA 3MFYA 4YHHL 3ULPA 4BY7H 2E5LL 2F0QA 1NR2A 2Q8IB 1U4RA 2QEXA 4DV6L 1TWFB 2R7ZG 3K5MA 1AE3A 1EFID 1CA5A 4DNRB 1HTPA 4ME5A 1SYCA 3UDGA 2JA8H 1EEID 2LXJA 4G7ZC 4BY1B 1STHA 4PNYA 5EBCA 1GUNA 4O2DA 4CGYB 2WKCA 4G7HC 4IFDG 3GTKB 2BE5C 3UDXA 3EROA 4OIKA 2XWBB 1NY4A 1K0SA 4EQPA 1U9RA 1KAWA 2SNMA 5C4ZA 2B2VC 1HJPA 3MTSA 3BDOA 5I4DA 4FF1A 5LMNL 2F4VL 3M3YH 4A3FH 2RF4A 1U4PA 4A3IB 1O7ZA 1UE1A 5BN4A 1Z47A 1RIPA 3K59A 4KI0A 1GD7A 3K80C 1HZBA 4LJZC 1PRTD 3KLWA 3C1EA 4YY3Q 4J1MA 5KNBA 3D31A 1B1ZA 4JVZA 5LL6X 1S5BD 3M85A 1N33Q 2M2LA 2F0DA 4HJ8A 2NBFA 3P1HA 2EVBA 1C4QA 4ZUIA 3ICEA 3F1ZA 2HDMA 4DFAA 2DNEA 5FOBB 3F2DA 2L15A 4K8JA 3CU7A 1PTOH 4B9XA 2WP8J 3WOEA 2E75C 3CAMA 3HGBA 4GS3A 1K0RA 3M7NA 5KYLA 1AP0A 1SROA 4K8IA 4JI2L 1B70B 4KMUC 1EWCA 2WAQG 3FDTA 3GQBA 3OMGA 4JI0Q 1OXXK 4YCWA 5I6YA 2KVMA 5FLMH 2B2UC 5IWAL 3D8GA 1S5ED 4LF7Q 3S1RB 1TQOA 1VCIA 1ZXTA 2QA4A 2HCIA 3JC66 5C0XJ 2HQEA 1OTCA 2NTSA 3KBGA 1YEZA 2LFNA 1LACA 3I4MG 2Y0SG 1MSGA 2Q2UA 1EOVA 3I8ZA 4E6IA 1WTRA 4NXNL 2JA5H 5IODA 1BCPC 4K6DA 5EBDA 5KEEA 4A3GH 4UP7A 2H1EA 2HIXA 4V190 3S14B 2I07B 5C0XI 2K33A 4JI5Q 4C2MB 5M5YB 4P72A 4RCOA 5D3DA 3HRZC 2RHQB 3Q6SA 1CZWA 4XT1B 1TY2A 4B9WA 2ZTDA 4Y7NH 1KIXA 3P20A 3MXGA 3ULJA 2DNCA 4IUNA 4BWGB 1Y8PB 1PZKD 1Q8IA 3S1QH 2OWOA 5C5MA 5GADC 4HCEA 4PMBA 1UUPA 2PPBC 3HOYB 2VUMB 5D3IB 4DA2A 1IW7D 5FJ8H 2O5IC 4DR6L 1A63A 4L5SA 5K36H 3VDYA 3HOZB 3Q23A 1J6QA 1B8AA 5FLXc 4JBMA 4ZQ3A 1E7ZA 3AFQA 2GN5A 1HTLD 3PO2B 4KN7C 2KHJA 1B4OA 1X56A 1IBML 2JQOA 1RODA 2KBNA 4IUVA 3CCEA 3IL8A 4GN5A 1PRTB 2B2YC 4GLAC 3UE0A 1RTOA 2B2TC 3L0OA 4HIMA 4LF9Q 1TS4A 4NP5A 1XTCD 4RA8A 4QGUA 3A55A 4ABNA 2L12A 4B3TQ 4JI8Q 2JA9A 3X3MA 1SSOA 3TP5A 1VMPA 1YJWA 3W1BA 2UXDL 2MO0A 5IT9c 4OWTB 2JE6I 2UUBL 5IIFA 3I55A 5KRUA 2KEDA 4LF5Q 3SXHA 1R4PB 2K5HA 2V4DA 3TSSA 3GTOB 1PFSA 3FKIB 5BR8L 1F2LA 1VF5C 3TBIB 3I91A 2ZTCA 2EYOA 5IP7G 4KJOA 3A5ZB 4Z9CB 2IX0A 1TS2A 5CV5A 4HJ7A 1LTBD 1SE8A 4BY1G 1X3QA 3S2HH 3F2UA 2ZXRA 2K75A 2IX3A 4XYQA 1QCBD 1NAPA 2PYKA 2NN6H 1A3UA 1Q81C 1HUMA 1TY0A 1YNND 1PH7A 5CGKA 3IRBA 2EYLA 1WOCA 3J81L 3OIPA 2OXPA 5J22A 2KOLA 4LFAL 1K8OA 2F0EA 2AUKA 2I5HA 1E2WA 4A3IG 3CC7A 4DK6C 4A3MH 3ONAB 5JEAG 2X69A 1EU3A 4K14A 3OMCA 1K83B 1PTOB 2WIIB 1PRTF 2VQFQ 3CD6A 4G7OC 4DR7Q 5C6AA 2EY5A 4HIKA 2C5CA 1MBYA 1AH9A 2F0VA 4DKAC 4I7ZC 2EZVA 1O7YA 2Q2IA 2QDBA 2XTIA 1L0WA 2XN9C 4DXFA 5JJIA 2FMMA 2L5TA 4N8X1 1A3TA 1H9MA 2RVLA 4GOPB 1XNRQ 1PH4A 2E2JB 4A76A 3BU2A 4AH6A 1EY6A 3S9WA 1D7QA 2AHOB 5T1IA 1K8GA 1QZHA 1STGA 3QWNA 2Z6KA 1Y1VH 4OEMB 2K5WA 4LWCA 4KJNA 1NBWA 2OEOA 4B3ML 1RD9D 2EJMA 1AW7A 1DCZA 2K5DA 2VW9A 2KCNA 4JV5Q 1P8LA 3K7AH 3C3LA 1D2BA 3HOUH 4N9PA 2EYFA 5FKAC 1JICA 4J8QA 4Y7NB 4LF4L 4OX9Q 3TZUA 1QWYA 1SNDA 4DV7L 4X62Q 1MIUA 4JI4Q 1FD7D 3SHLA 4AIMA 1Q46A 5C5LA 5IYCG 2XSCA 2YV5A 3PIPA 2UUCL 4Y52H 2NVXB 4CDFC 3Q0AA 3SDZA 3NTKA 2LSSA 5G3LD 4DR3Q 4KD3A 2FINB 3SVMA 2BA1A 2AMCB 1AZQA 4QQBX 3GTJB 1PTOF 5A2QL 1EQQA 4JPBW 4A4IA 4FXGC 2N3SA 2L11A 4DAYA 4TQUS 1WVLA 3C2PA 1RDPD 1CHQD 4LFCL 4L8JA 3HOYG 2VUMG 3R2TA 1SMYC 4KHPL 1MJEA 2VQEL 5F2DA 1Q86C 1I4QA 1QUQB 4A3LG 4O42A 3PUZA 4DV2L 1IYUA 4B3RL 3RLOA 2F3IA 3CQZB 4QCLA 5IP9H 3MHBA 1HPCA 5C0XH 5CBEE 1UE5A 3BYYB 2K1BA 4L5RC 2Z4HA 4HSVA 3J81E 4OO1I 1A8VA 1WTOA 3T53B 1ET9A 3A8IE 1YI2A 2XIWA 1DM0B 3S1NB 4C3IH 3GTPH 1STEA 2Q2TA 1KNAA 2EJGC 4LUVA 4UAIA 2D62A 4O1NA 1J9OA 2QGQA 4JI7L 5HY6A 4BXXH 3DHQA 1EY5A 1NUCA 2ZXPA 3JAML 1LM0A 1MI2A 1CUKA 3L7ZC 1VQFA 4YWMA 1JOQA 1SJED 2EY2A 3ZYYX 4JC0A 2F0NA 4DAYB 2NZOA 2DGYA 4MN3A 2NVQH 3S2HB 4HR7B 4X65Q 1PH5A 3BVMA 3I4LA 3QO2A 1G2TA 1GUOA 1TWGH 3FKIG 4P71A 1PH3A 1D5ZC 3VA5A 1TWCH 1V1PB 2MNAA 1PH9A 4XDXA 3BDCA 4DPGA 4AQYL 2PNRC 1KDAA 4QY7A 1N32Q 1PH2A 2OF1A 5IYBH 1RTNA 4F87A 3MA2B 3K7UC 1N8RC 2R92H 1OXUA 4DUYQ 4B3SL 4GNXA 2K5NA 3TQYA 3BJUA 1K73C 5ELEA 3QOLA 3AMUA 1IBKQ 2CQOA 2WB1B 4X3TA 4G57A 1I3QH 1Q1EA 5DLQE 3NHHA 5J1ZA 1SFOH 1YVCA 1X3PA 1A2TA 3GD7A 2Z1CA 3EA6A 2NVTB 2JEAI 3NE5B 2JP1A 3I3CA 5JPNC 1EYCA 3K5LA 3BYTB 1YJNA 1ESRA 4FNFA 1B53A 2NVYH 1V43A 2XRSD 5GAEC 3DM3A 1BUVT 4C3HH 4KY6A 3CCRA 1PFMA 5IOCA 3L3OC 1DOLA 3KDFA 1D5MC 3I73A 5A2QE 4QIWE 4A3BB 1BDOA 3UI2A 2E74C 1YNXA 3A7AB 1ZEQX 1SYGA 3A8JE 5H1SE 1Y1VB 2J7ZA 4QIWB 2R93B 1G6PA 4A75A 4Q5VA 2E2HH 3K7AB 5CV9A 3HOUB 4GLVB 5HGQA 1VF7A 3VYUA 1SE2A 4XT3B 1STBA 4DV5Q 1Q8KA 3TRZA 2Q2HA 1S5CD 3U4ZA 3MZ5A 4GNXB 1PZID 1NMFA 1S4ZA 4YWLA 1LT6D 3T1YQ 2WAQE 4PMWA 1B2TA 3GV3A 1JB7A 2RDFA 5CV7A 3K5OA 1BVSA 1EQTA 2WACA 3K0YA 2WAQB 1XMOQ 1XXGA 1SMYD 1GHJA 4DUZQ 3OPOA 3LX0A 4ILWA 1AEXA 3A0JA 1PRTC 4YY3L 2HIVA 4UDUC 1KD1C 4DGZA 1JCKB 3W2DA 3RLNA 4HJAA 3S16H 2XWJB 1FJGQ 1N33L 1PXUA 5G3LF 5FJ8G 5E1FA 4OELB 5JJKA 3ITPA 2J0TD 3QR8A 5K36G 3NP8A 2NTTA 4LF8Q 3TS2A 3TS0A 1SXTA 3HEJA 4OL7A 2LS01 1KABA 4JI0L 3HKSA 5FK9C 1VQ7A 1X6OA 2AWOA 1VQLA 2E2IH 3RD4A 1WTQA 2AKWB 3C46A 4LF7L 5M5XB 2JEBI 1JQYD 4HTHA 3TN2A 3EFXD 2H4OA 5ELCA 4PG3A 3GTPB 5FO7B 4ZAIA 3VR2A 4KY7A 1EY7A 1TKWB 3MXPA 1X55A 4DR4Q 4GKJQ 3CF5A 3W1GA 2OCEA 2JSOA 3PIO3 1LTTD 1SAPA 1VQOA 1LYLA 2SNSA 4QMGA 3NSWA 1S5DD 2A73B 1JE5A 4DK0A 5M3MH 1PLFA 1F2MA 2F0UA 4JI5L 1EEFD 3PGZA 4CKBA 1LT5D 3DWQA 1TWGB 4CJ2C 4JK1C 2QILA 2ID0A 1TWCB 3GDEA 4LF6Q 1F77A 1W6KA 1PTOC 1IXRA 4KKUA 3OWFA 3RR5A 1KLGD 2BA0A 1IL2A 2I5LX 3KFUA 1EYAA 3H0GH 1TR5A 2N55A 1EOTA 1OXSC 4YCVA 1HR0W 4OO1H 1IW7C 2E2DC 2G5DA 3OYYA 4ZK9B 2HD3A 3GTLH 4OHJA 4L63B 4N9TA 2UXCQ 2NN6I 3C1FA 2RA4A 1AFPA 4LAAA 1ENCA 5DNFA 4OWXB 4GOPC 4F8MA 2F0TA 2V1CC 1ASYA 4A3MG 4PZ6A 1LTGD 1SR3A 4XQNA 1SYBA 2F0LA 3RZOB 3X3NA 2NVYB 1EQRA 1ICWA 5D65A 2WB1G 3GTQH 2F0MA 1IL8A 1K8MA 3HOWB 3RNUA 4HIDA 1GUWA 3OTOQ 4JI8L 5JJLA 4C1NK 5C44H 1S72A 1CSPA 3L9AX 4IFDJ 5CC4A 3MVVA 4KY5A 4JI6Q 2VY3A 2J4XA 4GKKL 3H09A 3K81C 2B8GA 3PCOB 4LF5L 1Y14B 1DZ1A 4A3BG 2A6HD 1XX8A 5JJZA 2AUJD 2K6AA 2PCFB 3S1MB 1G291 3M4OH 1Y1VG 4B08A 1LLRD 2VXWA 4DV3L 3WWVA 2R93G 2EYPA 2JXMB 5KNDA 1MKHA 1UEBA 4OXPA 5KYIA 1UE6A 4R4TA 1XPUA 3HOUG 3GTMH 3J80L 3TREA 1YNNC 3MXNA 2KUMA 5J3BA 2Z6KC 3SE0A 1HZAA 1WCMH 5E7NA 3ND9A 3S16B 1EUJA 4IZ8A 3M4YA 2RSNA 5DAUA 5FO8B 1N34Q 3G48A 3IFDA 1JJGA 2XVSA 2N88A 2FHTA 4XYOA 3I7FA 2VQFL 1NE3A 1R9TB 4DR7L 4XQJA 2R3ZA 1EIFA 2E8GA 4HCSA 5M9OA 4DV1Q 2NB0A 4PZ8A 5LMNW 1E22A 2QEJC 4A93B 4R8NA 4FP5D 1XPRA 2DY7A 1LV9A 2OQ0A 1Z9FA 2F52A 2Z9HA 2RHSB 2PW5A 1E24A 1XNRL 1AN8A 4JCVE 2X6GA 3SK8A 1NTGA 4RGOS 2N8NA 3I70A 1U4MA 3NTIA 4I7AA 1YNJD 2KEEA 4C3IG 4GN4B 4LNQA 2D5DA 1TWHB 2CWPA 5CV4A 4BA2I 1XYIA 2CH4W 5CV6A 2HCCA 1MSHA 2JK8A 4JV5L 1PTOD 5CBAE 4DN4M 1Y8OB 3K6OA 3PF5A 1Z6HA 4OX9L 4X62L 3E3XA 5BN5A 4JI4L 2G9DA 1MGSA 3OWEB 2K52A 1JOKA 1VMCA 1ET6A 2Z0SA 1UEAB 2EXZA 1A15A 4DR5Q 3D4DA 5EKKA 3CW2C 1E2VA 4DR3L 1ENAA 2C9OA 2DJFC 5COYA 4JBKA 3OW2A 4WRDA 2JJQA 2A69D 1SE3A 3DXJC 3E9IA 4IUUA 1GKHA 4NMZA 1SNOA 3BVGA 3NBIA 1VQJA 1GM5A 4RG1A 3SK4A 3K0XA 2BCOA 2CQAA 2HUGA 3CPFA 4OWWB 4JYAQ 5M3FH 4BY7B 1HA6A 3T13A 4CKEA 5M5WH 2XNAC 1RF2D 2F3WA 4QL5A 5IYBG 1E1TA 2R92G 4CDEC 1XPOA 4TSSA 4K2LA 1BXTA 3J80E 2PI2A 1LTAD 1CKNA 2JA8B 1PYBA 3TDQA 3D4WA 1AZPA 4DAPA 4RHRA 1GOZA 2EYMA 4DNTB 5ELNA 1OXVA 4POFA 3G4SA 3K57A 2B63H 1B9MA 4A3KH 4ZRZA 2R7DA 4GNXC 2VB3X 4EQNA 3IAYA 3VYRA 4WORA 3M4PA 1JWSD 4C3HG 2QDLA 4A3CH 3S24A 3HOWG 5HGTA 2C35B 3M3YB 4A3FB 4X6AH 1SYFA 1ESFA 3DM1A 1K3BC 3PUWA 2UUAQ 1YITA 2OT2A 3HOVH 1HNWQ 4KV6A 4MIUA 5LMNQ 1HXYD 4C3JH 1Q7YC 1ONLA 2HQLA 1H9RA 1IYVA 4X65L 4NDXA 3CCSA 2BDOA 1SRUA 1KDCA 1II3A 4F7XA 1A3VA 1VQCA 4XXEA 1C48A 1XMQQ 2K5QA 2MGSA 2ES2A 4XIGS 4DV0Q 3H15A 1B50A 4WFN3 1CKNB 5JEAJ 1N32L 2MJ8A 1Q12A 1PYWD 4LUOA 4R9WA 3HKZB 4EVOA 2YTVA 4IJLA 4BBSH 2B8FA 3OOCA 3KYHC 4DUYL 3S2DH 1RHPA 1EQVA 2NUCA 1IBKL 3DMUA 2H5XA 1DD2A 3IFTA 1GUSA 4JI1Q 2AQ3B 4NKLA 1FGBD 1T5XD 2KECA 1G91A 1EZ6A 2K03A 2N49A 4YIJA 3TMEA 2O4XA 3FPPA 1HCZA 3TEHB 4UY8C 1STNA 2L4NA 2JA5B 4LUZA 3VR4A 1LTLA 1B3AA 4A3GB 4RMFA 4UP8A 1C0AA 3O13A 4P75A 2CCZA 1EIHA 4JOIC 5EQ0A 3E0EA 1A2UA 3P75A 3F8TA 4A93G 2EE1A 4CBVA 1KC8C 1I4HA 3NPPA 1GXDC 1IKLA 1Q90A 3BZDB 3W3AA 4K0KQ 4IO9A 3S1QB 1EYGA 2ZM6Q 3SR1A 1CQVA 4ZYSA 1ILQA 3MC0B 3S15H 4DV5L 1JJCB 4DR2Q 3R2IA 1WD0A 3RZDH 1I6HH 3URYA 3T1YL 5M3MG 1UAPA 3B6YA 1GUGA 2KQ3A 2B2UA 4RKLA 2R6GA 5E4XA 4IPDA 1XMOL 4K5XA 4DUZL 3PQIA 5CYUA 2K28A 2LMCB 4DAMA 1TWAH 3FHWA 2RCFA 1MHWC 1QVCA 3H0GG 2F0GA 2XRQD 4OO1G 4FF2A 1FJGL 5IGDA 5M5WB 1WD1A 3D0FA 3VR3A 3PO3H 4IURA 1VQDA 3R93A 1GHKA 2A5HA 1SNQA 3U9OA 3DWAA 4KN4C 1FYCA 4HIOA 4LF8L 5C3WA 2PMZB 3I4MH 3L2PA 2B2WA 1W2BA 4BY7G 3MAQA 3D4RA 2K05A 4EQ5A 1KLUD 5DM73 4LFBL 1EYDA 1C9OA 2IY5B 3NWTA 3HOXH 2VS1A 1PH1A 4A3EH 1K3RA 1SMXA 5IGBA 4A3KB 1YHAA 5JAVA 1BF4A 3KUPA 1NJIC 1FR3A 1BR9A 4DR4L 3NTHA 2JA8G 4GKJL 2VL6A 1JWMD 2O2LD 3QB3A 4HJ5A 1VQEA 3FMCA 1K28A 3CC4A 4RCNA 1I4XA 1HFGA 2KA7A 3UDIA 2PO4A 1LTSD 5C44G 1HNXQ 1NSNS 4P74A 2K01A 4C3JB 2QCPX 3I4NH 3PUVA 3AQQA 4X66Q 1PZJD 1I50H 1DGSA 1V1QA 1Y8NB 4A3FG 1QVFA 4H0LC 3T1HL 4MNOA 3J7YW 4A3MB 3OSOA 4LF6L 2WB1E 1P16A 4ZUJA 1H95A 1JWUD 3E6ZX 4R4IA 1VQ4A 1SE4A 5IY0A 1J5EQ 4APVA 1PYSB 4C56C 4L5QA 4BBSB 5LMUQ 2CW0D 2Q8RE 2D9UA 3S2DB 2UXCL 1X32A 3GTGH 5CV8A 4L6TB 1B9NA 1WCMG 3G71A 3J7AF 4IN3A 1QVGA 1XJVA 1KRTA 4ZKCB 1EY8A 3VA7A 3HKZG 2AQ1B 3CCLA 1V8QA 1BBUA 4NPSA 5FLXL 3GO5A 5FLMG 4EQOA 1TT2A 2L9HA 1IYJB 3AB9A 4IUQA 3H3VC 1TWFH 3F2BA 1VQKA 1LT4D 2ZT9C 3OTOL 4GZYC 2A6ED 5IP7H 5JPMC 1WJJA 3U4VA 4CDDC 1H9JA 3CRLC 3PIOA 2JA5G 5DEHA 4DK3C 4A3GG 4JI6L 4NB3A 3D3RA 4AYBB 2KCCA 1ZYRD 4DV7Q 3S15B 2A6HC 3QOJA 1I94Q 1D5XC 4DV4Q 5IT9L 3BZCA 1DXMA 4KD4A 1FVIA 1S5FD 3MFGA 4IQZA 2VZAA 2KCTA 3TP8A 4A3IH 1U4LA 3JAME 4CHTB 3J7A5 2L0CA 5JEAH 5NUCA 3KDFB 4NXMQ 4I65A 4PQXA 1SBBB 3LWUA 3NBHA 1BBWA 4WJ3M 2TMPA 3EQLC 1WYDA 1GJXA 1A62A 1SYEA 1VQGA 1X65A 1IBLQ 2NYZD 2WFWA 1N36Q 1M1KC 3A74A 1BOSA 5LHY1 2SOBA 1PVOA 4X64Q 1CTMA 2HHHQ 5ELOA 5C3XA 2VQEQ 1DJRD 4DR1Q 4GLXA 1YJ9A 3Q24A 1N34L 3PO3B 3KF6A 1KNEA 2GA4B 3T4AC 3W5OA 1WTPA 1L0XB 1EL0A 1SNPA 2K04A 2A8VA 1HRJA 2LXKA 4C3IB 1PA6A 4HJ9A 2KENA 3STBD 1G6ZA 4DV1L 1ENFA 4M8AA 1SLJA 3HOXB 3IKJA 4TKOB 1Y1WH 5EPJA 2Z4IA 4XQQA 1HFNA 1RKNA 2HT1A 1O78A 2JA6H 1ASZA 1F9PA 3A7LA 3J81c 4IALA 4YWKA 1EWHA 2NVQB 1CKOA 5D14A 3N52A 2F03A 1F9QA 1GO3E 1HHVA 3NBHB 4FVMA 1YNJC 3K58A 3H6MA 4DNIA 4HMIA 4JG2A 2B63G 1TVXA 1I4RA 4A3KG 1UWVA 4JI3Q 3S14H 1Y69U 3I4NB 4NW2A 3I4OA 4EGVA 1L1OA 3FEWX 5FLXE 1O80A 4A3CG 1DOKA 2A68D 1KXLA 4IPHA 2YYZA 1I50B 1WTXA 3UDFA 3KF6B 5EPKA 2I0QA 3ND8A 2A74C 4KLKA 2NN6G 1FNVA 4C3JG 4IUTA 2R92B 1SN8A 2VUMH 4ME3A 1PV4A 3AYHB 2UU9Q 3LGJA 4DR5L 1H9SA 4QUCA 1EIGA 4RKBA 1VQ9A 1I3QB 1L2FA 1SFOB 1SNMA 3HOZH 1G51A 2B3GA 2PNHA 2X6LA 1LO5D 2GVAA 2A69C 1L0YB 1R4QB 2L1BA 2PZWA 3PO2H 5IT9E 4OGQC 5ISRA 4JYAL 3E5SA 4BBRH 4C3HB 2JYOA 5AJ3Q 1JR0D 4LF9L 3PMFA 4HAEA 3G6EA 4A3JH 4BBSG 2FXQA 1CKMA 4LK1C 4B3TL 2Z8LA 3PUXA 2ALYB 2ZXOA 4FF3A 3FPUB 4HMJA 1HNZQ 3TZDA 5KNCA 1L1OB 5EPLA 1VQHA 4PV1C 4UP9A 1EZ8A 1VDZA 3PSIA 2KJXA 1F2YA 4V0BA 3ZJYC 2IJ0A 5CORA 4X3UA 3ERQA 2E2HB 1CHPD 1SYDA 3VYTA 2XGTA 1X9NA 3KOJA 3MEHA 1HH2P 4MTNA 1TIID 1Q3LA 2MO1A 2KHIA 1KDBA 1EIYB 3OHXC 3GTOH 3AEVA 2K50A 1DONA 1NNXA 1H9SB 3FKIH 5IYDH 5I6WA 5C4XH 4IFDI 4ZLTF 1RCVD 1QZGA 2EYHA 2UUAL 1HNWL 2EYJA 1VQBA 3N6RA 3GV6A 5FO9B 4OONA 3H91A 1RL2A 4AYBG 5I2XA 5EKLA 3M7GA 1MJCA 2F3VA 4ID6A 1XNQQ 1D6EC 1XMQL 1XWEA 1QOHA 4DV0L 2EIFA 5IGFA 4A3DH 4M1UB 1EY9A 4BA1I 3DEOA 2BOSA 4IOAA 2F0KA 1A0IA 1K83H 3Q22A 2DY8A 3BDLA 1QG7A 2E2IB 3Q8DA 2RQXA 3JAMc 2EPBA 4HSPA 2OTLA 2ZTEA 2IX1A 1LTID 3FRPB 1PFNA 4RAUC 1HR0Q 1EFWA 2WKDA 4JI1L 2D0PA 5IP9G 4K6LA 5J39A 2F4IA 1GUTA 5C0XG 1TS5A 4RWSC 1EU4A 5C3EH 5E3FA 3UE1A 3PO3G 3A54A 1YBYA 3HZXA 4BS9A 1Y1WB 3NEMA 2LY7A 1PH8A 1IKMA 2IHFA 3MXNB 1VQ5A 4H02A 2E2JH 3K5NA 5CMDA 2JA6B 1HZ9A 2JA7H 4MHEA 1X3GA 1F2ZA 2RSOA 5M3MB 4R4CA 3HOXG 4BXXG 1GVPA 4A3EG 1UE7A 4RGMA 5IGCA 4MTKA 1LTRD 4ZKBB 4K0KL 2K32A 4R8IA 2AQ2B 4CKCA 2E76C 2MFIA 2Z6BA 3I72A 2TSSA 2F1MA 2CHBD 2B2WC 2ZM6L 2F0FA 1ML0D 1BQQT 3CXCA 3H0GB 4GN3B 4DR2L 2KHSA 3CCJA 5EGTA 5GROA 3GTLB 4PMCA 4X3SA 2NVXH 3I4NG 2WV6D 3I90A 2A1AA 2YTXA 4IOCA 1X3FA 2UXBQ 1SEBD 2CH4A 1PMRA 1BBXC 4CDCC 1I6VC 3GTJH 3KJOA 1ICFB 1CT1D 1XTDA 1VQMA 1CFMA 3BG3A 3EN2A 2IWHA 4K5WA 1WTVA 4YHHQ 2CWAA 4WJ4A 3MEFA 2R7FA 3J81i 2E5LQ 1JJ2A 3J7ZC 3CCVA 1CSQA 4DV6Q 4BBRB 1KL9A 3DWPA 3GTQB 1CK1A 3ERSX 1FNUA 4FXDA 4A3JB 3CQZH 3PV0A 5A35A 2D2CC 5DM63 1JMCA 1STYA 1C8CA 1A6XA 3ULLA 1KRSA 5C44B 1V1OA 1H9KA 4WJWA 1ZKOA 2BDNA 2IPKD 2QW7A 5HURA 1V9PA 4DU9A 5ELBA 2ICEC 3R3OA 3S1NH 2BE5D 3NXWA 5GQOA 2ZJRA 4FYDA 4OIJA 1S40A 2A19A 4R1JA 1PHJA 3U50C 2EY6A 3V2TA 4GKKQ 3E0JA 3M4OB 2RKSA 1K8AC 2F4VQ 2CKZB 4UPAA 3BVZA 2MUYA 1F9SA 1KTKA 3NQTA 5KIXA 3S17H 3GP7A 5C4XB 2ATWA 2BH2A 2YTYA 3KK7A 4IPGA 4DV3Q 3TP7A 1HNXL 2PI2E 3GTMB 4GOPA 2HDLA 3RN5A 1D1KA 1PDQA 2F0PA 3HKZE 1RJTA 2EY1A 1CZGA 4X66L 3K8AA 1WCMB 3OW7A 5IGEA 4QF4A 1YHBA 2RCNA 3T56B 3BS1A 4P73A 3CMEA 1AE2A 3NQIA 2PQEA 3CHBD 1N9WA 4ALPA 1J5EL 1TU2B 4RH6A 1JORA 1OXTA 3SK5A 4JI2Q 2YU9H 4A3DB 2R7ZH 4U673 2KCMA 1CI3M 3DEPA 3DLLA 1EY4A 4FO2A 5ELFA 3NELA 5LMUL 5IWAQ 2CW0C 2RDHA 5GAGC 2B2VA 1PFBA 1WTWA 1O7LA 4KHVA 3KJPA 2NVTH 4HEDA 3M9BA 4DXGA 3D6CA 4IFDH 2F0IA 1HUNA 3CCUA 3NUCA 5C3EB 5IE8A 4NXNQ 2VNUD 1BCPD 4S3SA 2OQKA 1YHQA 2RDGA 5C4JH 3A5UA 1M90C 2DUDA 2CFMA 1JB3A 4R4QA 4P2CB 4XTCS 1FGUA 1WI5A 2JA7B 4A3BH 1BNZA 1QUQA 1YIJA 1UNSA 4DK1A 2A6EC 3MWYW 5GAHC 1D1IA 1Y1WG 3QG1A 2VB2X 2R93H 1IHZA 2B29A 3PF4A 2DJGC 2PW7A 5JVH3 2JA6G 1J8IA 5ELDA 3AFPA 1NCVA 4L5TA 1ZYRC 2B39A 3JAMi 1I94L 4X3KA 4DR6Q 4DV4L 1IZ6A 3EJIA 4ZCKA 3PUYA 2PZUA 2AWNA 3M4QA 4KKTA 4N8FA 1DOMA 5KGUA 3ER0A 2D0OA 2FMCA 1G2SA 4NXML 3CCMA 1IBMQ 1G8ZD 2OTJA 1YZ6A 4JBWA 5M3FB 3R8BA 3H3VI 1I4PA 3NK9A 3RMHA 3T16A 5I9PA 2F0WA 4KHZA 1IBLL 1N36L 2PMZE 2K5VA 4X64L 3LNNA 2PZTA 1LT3D 2HHHL 1L1OC 3HFZB 2IL8A 4PZ7A 1I5FA 2DN8A 2K7VA 4DR1L 1V1PA 1E2ZA 3FVQA 2QF7A 1B44D 3HOZG 3WOFA 1SNCA 4DAVA 3CP0A 2UXDQ 3RLFA 2B63B 2F0JA 3PO2G 1VQNA 3STBC 3V05A 1S3OA 2UUBQ 2G9HD 1VQIA 4BBRG 5M5XH 4FXKC 3U9SA 4DF7A 5BR8Q 3DUZA 2MQHA 4A3JG 3AU7A 1U5KA 1C7YA 4J6HA 4JW0A 3J80c 4R4OA 4IUPA 4EX5A 3HOVB 1WFQA 4FF4A 1VS0A 1SJHD 2FJ2A 4QB4A 2SDFA 3D6WA 3S17B 1CA6A 1BCPB 3VR5A 3CPWA 1JT8A 3PIP3 1QILA 4JI3L 2B2YA 1QJOA 1QNKA 3HP3A 3KLSX 1PH6A 2N78A 2B2TA 4C1NI 1TXYA 4LFAQ 1Q1BA 2A68C 2EDGA 5IYDG 4ULLA 1B7YB 1T5EA 5C4XG 1TS3A 2K14A 5I9OA 5T1GA 4QJFA 4LMQD 5E4WC 2IT1A 4G4KA 1ILPA 2CVRA 1Z7TA 3G7LA 5EJWA 2JN4A 4LW1A 3EVQA 4YCUA 3VR6A 1JOOA 2UU9L 2YU9B 3FP9A 2PQAA 2R7ZB 3MXUA 5C4HA 2R61A 1F9RA 2ZJPA 1I4GA 1HA5A 4MZ9A 2NZHA 2Q8TA 1SDFA 2MP1A 1KAAA 1K9MC 1D8LA 1OO9B 1STAA 4H44C 4A3DG 5AJ3L 2RBMA 1CQFA 2I5MX 1KQSA 3KLRA 3RZOH 3I56A 3V96A 3LWEA 2ASBA 3RN2A 4IJHA 1M4VA 5C4JB 1VQ8A 1QNUA 1HNZL 4RGTA 1MD2D 3HOWH 4ODGA 4B3MQ 2GVBA 4AYBE 3RUZA 3TP6A 4JBJA 4BY1H 1HQMC 1BO0A 4RHSA 2EQSA 2F0SA 3E9HA 3GTKH 5C3EG 3U58A 4TRDA 1BCPF 5EKIA 4LF4Q 2IHEA 3CRKC 4CJ0B 5I2YA 1VQ6A 3A8KE 1NMGA 3RZDB 1B3QA 1I6HB 1E0BA 1X3EA 3NWSA 5JOBA 2UUCQ 4RGNA 2PQAB 2JA7G 4UHVA 3S1MH 1KHIA 2ENBA 2NWGA 2MPMA 1LABA 2F0OA 4U68A 1JC7A 1HQRD 1VQPA 2P5ZX 1M8AA 1TWAB 5LL6S 4H13C 2M00A 4LFCQ 1X54A 3T51B 4KHPQ 1DYQA 5L37A 3A56A 4POGA 1XNQL 4DV2Q 4RFBA 4B3RQ 3BZKA 1QE6A 3G6JB 4FDBA 5TSSA 4JOIA 2Y0SE 1W3SA 4TVAB 2L55A 1Q82C 2F0HA 2I46A 1T9HA 3KF8A 2O5JC 2ICIA 5AFWA 4CJ1B 4F88A 3I4MB 2BH8A 2Y0SB 1E1OA 5M3FG 3S1RH 1R9TH 1E3PA 2FFKB 3J81j 3CC2A 4A3EB 1HR0L 2K4KA 4LFBQ 3HG9A
chains in the Genus database with same CATH topology
3EBEA 1VQCA 4JC0A 4DAYB 1A0IA 2NZOA 1K83H 2DGYA 1XMQQ 4JI7Q 2NVQH 2ES2A 4A93H 4XIGS 1FL0A 3Q8DA 4DV0Q 3JAMc 3CMAA 4X65Q 3H15A 1PH5A 2OTLA 1CKNB 2ZTEA 5JEAJ 2IX1A 1N32L 1BKBA 1Q12A 1TWGH 3FKIG 4LUOA 2EXDA 4P71A 1PH3A 4JI1L 1HR0Q 1EFWA 2D0PA 1TWCH 5IP9G 2ZJQA 2YTVA 4IJLA 5EAYA 5IYCH 2MNAA 4BBSH 4O0AA 5C0XG 3KYHC 1PH9A 5C3EH 1O7IA 4DUYL 3UE1A 3S2DH 4DPGA 4C2MH 1EWIA 5M5YH 1YBYA 3F2CA 4AQYL 3PO3G 4QY7A 3NEMA 1N32Q 1IBKL 2H5XA 1PH2A 1PH8A 3H3VH 4JI1Q 1TWHH 2IHFA 3MXNB 1VQ5A 4H02A 5IYBH 2E2JH 1VQAA 1HZ9A 2JA7H 3K7UC 1N8RC 2R92H 1OXUA 1X3GA 4DUYQ 4B3SL 3EIVA 2N49A 4GNXA 2K5NA 3HOVG 4AQYQ 3TQYA 4R4CA 3BJUA 1LUZA 1K73C 1IBKQ 2CQOA 3KF8B 3TEHB 3HOXG 3T1HQ 4UY8C 3HOYH 3NENA 4BXXG 1I3QH 1Q1EA 4LUZA 5DLQE 1GVPA 1LTLA 4A3EG 1SFOH 1UE7A 4RMFA 1YVCA 4UP8A 4A3LH 1C0AA 3GD7A 4P75A 2CCZA 4K0KL 4J15A 4JOIC 4B3SQ 2JEAI 3E0EA 4Y52H 2MFIA 1YJNA 2NVYH 1U0LA 3F8TA 2ZM6L 4A93G 1V43A 1KC8C 5GAEC 2UXBL 3I2ZA 3DM3A 3CXCA 4C3HH 4GN3B 3CCRA 4DR2L 3KDFA 3CCJA 4K0KQ 3SGIA 3CCQA 5GROA 1HZCA 4QIWE 3J80i 4IO9A 2NVXH 3I4NG 4IPCA 2A1AA 2YTXA 2ZM6Q 1EYGA 1YNXA 4YHHL 4IOCA 3ULPA 1X3FA 4BY7H 2E5LL 3S15H 2UXBQ 5H1SE 4DV5L 1JJCB 4DR2Q 3GTJH 2QEXA 3KJOA 4DV6L 3RZDH 2R7ZG 1I6HH 4A75A 1G6PA 1XTDA 1AE3A 3T1YL 1VQMA 2E2HH 3EN2A 5M3MG 4GLVB 3B6YA 5HGQA 2CWAA 4YHHQ 4WJ4A 3UDGA 3MEFA 2R7FA 3J81i 2E5LQ 4DV5Q 2R6GA 1Q8KA 1JJ2A 3J7ZC 2Q2HA 4IPDA 1XMOL 2JA8H 3U4ZA 1CSQA 3CCVA 4GNXB 4DV6Q 2LXJA 1NMFA 1KL9A 4YWLA 4DUZL 3T1YQ 3ERSX 2WAQE 3CQZH 3PV0A 4O2DA 4PMWA 4DAMA 4IFDG 1JB7A 1TWAH 1JMCA 3UDXA 3FHWA 1BVSA 1NY4A 3ULLA 1KRSA 1XMOQ 1QVCA 1KAWA 3H0GG 4OO1G 1FJGL 1HJPA 4DUZQ 3D0FA 2F4VL 1V9PA 5LMNL 3M3YH 3PO3H 4A3FH 3S1NH 3A0JA 1VQDA 2RF4A 4YY3L 2HIVA 1UE1A 1KD1C 5GQOA 1Z47A 2ZJRA 1RIPA 1S40A 4HIOA 2A19A 4R1JA 3RLNA 4HJAA 1PHJA 4LF8L 3S16H 3U50C 4KI0A 1FJGQ 1GD7A 1N33L 3I4MH 4GKKQ 3K80C 5FJ8G 1HZBA 3L2PA 1W2BA 4BY7G 4LFBL 4EQ5A 1K8AC 2F4VQ 2CKZB 1C9OA 3KLWA 2IY5B 4UPAA 5JJKA 4YY3Q 3HOXH 5K36G 2VS1A 1PH1A 3S17H 4A3EH 1K3RA 1SMXA 3D31A 2ATWA 4LF8Q 2BH2A 2YTYA 3TS0A 3TS2A 1YHAA 3M85A 1NJIC 1N33Q 4IPGA 4HJ8A 4JI0L 4DV3Q 3HKSA 1HNXL 2PI2E 1VQ7A 1X6OA 3ICEA 2AWOA 3F1ZA 4GOPA 1VQLA 2E2IH 2JA8G 4DR4L 2VL6A 4GKJL 3F2DA 2L15A 3RN5A 2AKWB 2WP8J 4LF7L 2JEBI 3HKZE 4HJ5A 3CAMA 3K8AA 4X66L 1VQEA 4GS3A 1K0RA 4PG3A 3CC4A 3M7NA 1SROA 4JI2L 1B70B 3UDIA 1YHBA 2RCNA 2WAQG 4JI0Q 5C44G 1OXXK 4YCWA 1HNXQ 4P74A 1X55A 4DR4Q 3I4NH 3PUVA 4GKJQ 5FLMH 3CF5A 3W1GA 5IWAL 2OCEA 4P73A 3AQQA 4LF7Q 3CMEA 1VCIA 2QA4A 1AE2A 4X66Q 4ALPA 1N9WA 1I50H 1VQOA 1J5EL 1LYLA 1DGSA 1V1QA 1OXTA 3JC66 5C0XJ 4JI2Q 4A3FG 2YU9H 1QVFA 3T1HL 2R7ZH 4MNOA 1OTCA 2KCMA 3DLLA 4LF6L 1JE5A 2WB1E 1P16A 5M3MH 1H95A 3NELA 1YEZA 5IWAQ 5LMUL 3I4MG 2Y0SG 4R4IA 2Q2UA 5GAGC 1EOVA 4JI5L 1VQ4A 4NXNL 5IY0A 1J5EQ 2JA5H 4APVA 3PGZA 4A3GH 1PYSB 4UP7A 2HIXA 4L5QA 2ID0A 3GDEA 3KJPA 4LF6Q 2NVTH 3M9BA 5LMUQ 5C0XI 3CCUA 1IXRA 2UXCL 3RR5A 5IE8A 3GTGH 2BA0A 4JI5Q 4P72A 4NXNQ 2VNUD 1IL2A 2OQKA 2RHQB 2I5LX 1YHQA 3KFUA 3H0GH 1WCMG 5C4JH 3G71A 1HR0W 1OXSC 4YCVA 4Y7NH 3A5UA 2ZTDA 2DUDA 1M90C 1KIXA 2CFMA 3ULJA 3OYYA 4R4QA 1QVGA 4XTCS 1XJVA 1KRTA 1FGUA 1WI5A 3GTLH 3HKZG 4A3BH 3S1QH 3CCLA 2UXCQ 2NN6I 1QUQA 1YIJA 2OWOA 1BBUA 4NPSA 3GO5A 5GADC 5FLMG 5GAHC 5FJ8H 1Y1WG 1IYJB 4OWXB 4GOPC 1TWFH 4DR6L 2R93H 1A63A 2B29A 3F2BA 4L5SA 2V1CC 3PF4A 1VQKA 1ASYA 4A3MG 4PZ6A 1SR3A 3VDYA 3OTOL 2JA6G 1J6QA 1B8AA 5IP7H 5FLXc 4JBMA 1WJJA 1EQRA 3AFPA 3U4VA 4L5TA 1E7ZA 3AFQA 2GN5A 3JAMi 2WB1G 3PIOA 1I94L 4DR6Q 2KHJA 4DV4L 1IZ6A 1X56A 1IBML 2JQOA 2JA5G 3GTQH 3PUYA 4DK3C 4A3GG 4JI6L 3RNUA 2AWNA 2KBNA 3M4QA 3CCEA 4HIDA 4NB3A 3OTOQ 4JI8L 3ER0A 4GN5A 5JJLA 4GLAC 3UE0A 4DV7Q 5C44H 1S72A 2D0OA 1I94Q 3L0OA 4DV4Q 1CSPA 3BZCA 4NXML 3CCMA 4HIMA 1IBMQ 4LF9Q 4IFDJ 1YZ6A 2OTJA 1FVIA 4JBWA 4JI6Q 2VY3A 4QGUA 4GKKL 3H3VI 2VZAA 2KCTA 3K81C 4B3TQ 4A3IH 3PCOB 4JI8Q 4LF5L 4KHZA 1IBLL 1Y14B 1N36L 2PMZE 2K5VA 2JA9A 3J7A5 4A3BG 4X64L 1YJWA 3KDFB 3W1BA 1L1OC 2HHHL 1G291 4NXMQ 3HFZB 2MO0A 5IT9c 3M4OH 2UXDL 4OWTB 1I5FA 4PZ7A 4DR1L 1BBWA 2JE6I 4WJ3M 1Y1VG 2UUBL 4DV3L 3I55A 1WYDA 3WWVA 1A62A 1X65A 1VQGA 1IBLQ 2K5HA 1N36Q 2WFWA 1M1KC 4LF5Q 3A74A 3HOZG 1MKHA 1PFSA 1UEBA 4OXPA 5BR8L 1PVOA 3CP0A 1UE6A 4R4TA 4X64Q 1XPUA 3HOUG 2ZTCA 2HHHQ 5ELOA 3RLFA 2VQEQ 2UXDQ 5IP7G 3PO2G 3GTMH 4DR1Q 3A5ZB 3TREA 4GLXA 3STBC 1YJ9A 1VQNA 1S3OA 2IX0A 2UUBQ 5J3BA 1VQIA 1N34L 3KF6A 4BBRG 5M5XH 4HJ7A 1SE8A 2Z6KC 4BY1G 3S2HH 1HZAA 1WCMH 2K75A 5BR8Q 2MQHA 5E7NA 4A3JG 3W5OA 2A8VA 1U5KA 2LXKA 1Q81C 1PA6A 1C7YA 4HJ9A 1EUJA 2KENA 3STBD 1PH7A 3J80c 3IRBA 4R4OA 4DV1L 2R93G 4EX5A 1N34Q 1WFQA 3G48A 1WOCA 1VS0A 1JJGA 1SLJA 3I7FA 2VQFL 1NE3A 4LFAL 1Y1WH 4DR7L 2I5HA 4A3IG 3CC7A 4DK6C 4A3MH 1EIFA 2E8GA 3CPWA 4DV1Q 4JI3L 1JT8A 2HT1A 4PZ8A 2JA6H 5LMNW 1ASZA 5JEAG 1E22A 1PH6A 2N78A 3J81c 4YWKA 1CKOA 1TXYA 4LFAQ 1Q1BA 2VQFQ 1GO3E 3CD6A 4DR7Q 3NBHB 1XPRA 4HIKA 5IYDG 2OQ0A 1B7YB 1Z9FA 2F52A 2RHSB 4DNIA 4JG2A 2K14A 5C4XG 2B63G 1AH9A 4JI3Q 4A3KG 1UWVA 4QJFA 1E24A 4DKAC 2IT1A 1XNRL 3S14H 4JCVE 2Q2IA 2XTIA 3I4OA 1NTGA 1L1OA 1L0WA 4A3CG 2N8NA 4LW1A 1KXLA 4IPHA 2YYZA 4YCUA 5JJIA 2UU9L 3FP9A 4GN4B 2PQAA 3KF6B 3UDFA 2I0QA 4LNQA 4GOPB 2CWPA 1XNRQ 4BA2I 1PH4A 4KLKA 2ZJPA 2NN6G 4A76A 2JK8A 4MZ9A 3BU2A 4JV5L 4AH6A 2NZHA 1SN8A 2VUMH 1D7QA 4ME3A 2AHOB 3PF5A 1K8GA 3TRZA 1QZHA 3AYHB 1PV4A 3LGJA 2UU9Q 4DR5L 2Z6KA 1K9MC 1D8LA 1Y1VH 1VQ9A 4OX9L 4LWCA 1L2FA 1NBWA 4X62L 4B3ML 4A3DG 4JI4L 5AJ3L 3HOZH 1G51A 2I5MX 1KQSA 2VW9A 2K52A 3RZOH 2B3GA 4JV5Q 3I56A 1P8LA 2PNHA 3K7AH 2Z0SA 3HOUH 2GVAA 2ASBA 3RN2A 4IJHA 4DR5Q 3PO2H 3CW2C 1VQ8A 4LF4L 4OX9Q 1HNZL 4DR3L 4JYAL 4DV7L 4X62Q 3HOWH 1MIUA 4B3MQ 4BBRH 2GVBA 4AYBE 4JI4Q 5AJ3Q 4BY1H 4JBJA 4JBKA 4LF9L 3OW2A 4AIMA 1Q46A 2JJQA 5IYCG 3G6EA 2YV5A 4A3JH 4BBSG 2FXQA 1CKMA 3E9IA 1GKHA 2EQSA 3E9HA 3PIPA 5C3EG 2UUCL 3U58A 3PUXA 4B3TL 3GTKH 1VQJA 2ALYB 4LF4Q 1GM5A 1HNZQ 2IHEA 2LSSA 3K0XA 4RG1A 4DR3Q 3CPFA 4OWWB 4JYAQ 5M3FH 1L1OB 1VQHA 2BA1A 4UP9A 2AMCB 5M5WH 4QQBX 3PSIA 4QL5A 5IYBG 1VQ6A 1NMGA 1EQQA 3ZJYC 1E1TA 4A4IA 1X3EA 2N3SA 2UUCQ 2JA7G 2R92G 2PQAB 2XGTA 4TQUS 1X9NA 3KOJA 3S1MH 1XPOA 1KHIA 4LFCL 3HOYG 2VUMG 2PI2A 1HH2P 4MTNA 1CKNA 2MO1A 2VQEL 1PYBA 1Q86C 1MJEA 4KHPL 1VQPA 1QUQB 2KHIA 1EIYB 4A3LG 3GTOH 3AEVA 2K50A 3PUZA 4DV2L 3FKIH 4B3RL 5IYDH 3RLOA 5ELNA 2F3IA 1OXVA 4POFA 3G4SA 5C4XH 5IP9H 4IFDI 2B63H 4A3KH 4LFCQ 1X54A 1QZGA 4GNXC 2R7DA 2UUAL 4KHPQ 1UE5A 3M4PA 1HNWL 4L5RC 1VQBA 4POGA 1A8VA 4A3CH 1XNQL 4OO1I 3S24A 4DV2Q 3HOWG 4B3RQ 2C35B 3BZKA 1YI2A 4X6AH 4FDBA 4JOIA 4OONA 2Y0SE 4C3IH 1RL2A 1W3SA 4TVAB 4AYBG 3GTPH 3PUWA 2Q2TA 4LUVA 2UUAQ 1Q82C 1YITA 1T9HA 1MJCA 2D62A 5LMNQ 3HOVH 1HNWQ 4C3JH 2BH8A 1XNQQ 1Q7YC 2QGQA 1XMQL 4JI7L 5HY6A 1E1OA 4BXXH 5M3FG 3S1RH 2HQLA 1R9TH 4DV0L 1LM0A 1E3PA 2EIFA 4X65L 3J81j 3CC2A 1CUKA 3CCSA 1SRUA 3L7ZC 4A3DH 1VQFA 4YWMA 2K4KA 1HR0L 4BA1I 4LFBQ 4IOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBE A;  1VQC A;  4JC0 A;  4DAY B;  1A0I A;  2NZO A;  1K83 H;  2DGY A;  1XMQ Q;  4JI7 Q;  2NVQ H;  2ES2 A;  4A93 H;  4XIG S;  1FL0 A;  3Q8D A;  4DV0 Q;  3JAM c;  3CMA A;  4X65 Q;  3H15 A;  1PH5 A;  2OTL A;  1CKN B;  2ZTE A;  5JEA J;  2IX1 A;  1N32 L;  1BKB A;  1Q12 A;  1TWG H;  3FKI G;  4LUO A;  2EXD A;  4P71 A;  1PH3 A;  4JI1 L;  1HR0 Q;  1EFW A;  2D0P A;  1TWC H;  5IP9 G;  2ZJQ A;  2YTV A;  4IJL A;  5EAY A;  5IYC H;  2MNA A;  4BBS H;  4O0A A;  5C0X G;  3KYH C;  1PH9 A;  5C3E H;  1O7I A;  4DUY L;  3UE1 A;  3S2D H;  4DPG A;  4C2M H;  1EWI A;  5M5Y H;  1YBY A;  3F2C A;  4AQY L;  3PO3 G;  4QY7 A;  3NEM A;  1N32 Q;  1IBK L;  2H5X A;  1PH2 A;  1PH8 A;  3H3V H;  4JI1 Q;  1TWH H;  2IHF A;  3MXN B;  1VQ5 A;  4H02 A;  5IYB H;  2E2J H;  1VQA A;  1HZ9 A;  2JA7 H;  3K7U C;  1N8R C;  2R92 H;  1OXU A;  1X3G A;  4DUY Q;  4B3S L;  3EIV A;  2N49 A;  4GNX A;  2K5N A;  3HOV G;  4AQY Q;  3TQY A;  4R4C A;  3BJU A;  1LUZ A;  1K73 C;  1IBK Q;  2CQO A;  3KF8 B;  3TEH B;  3HOX G;  3T1H Q;  4UY8 C;  3HOY H;  3NEN A;  4BXX G;  1I3Q H;  1Q1E A;  4LUZ A;  5DLQ E;  1GVP A;  1LTL A;  4A3E G;  1SFO H;  1UE7 A;  4RMF A;  1YVC A;  4UP8 A;  4A3L H;  1C0A A;  3GD7 A;  4P75 A;  2CCZ A;  4K0K L;  4J15 A;  4JOI C;  4B3S Q;  2JEA I;  3E0E A;  4Y52 H;  2MFI A;  1YJN A;  2NVY H;  1U0L A;  3F8T A;  2ZM6 L;  4A93 G;  1V43 A;  1KC8 C;  5GAE C;  2UXB L;  3I2Z A;  3DM3 A;  3CXC A;  4C3H H;  4GN3 B;  3CCR A;  4DR2 L;  3KDF A;  3CCJ A;  4K0K Q;  3SGI A;  3CCQ A;  5GRO A;  1HZC A;  4QIW E;  3J80 i;  4IO9 A;  2NVX H;  3I4N G;  4IPC A;  2A1A A;  2YTX A;  2ZM6 Q;  1EYG A;  1YNX A;  4YHH L;  4IOC A;  3ULP A;  1X3F A;  4BY7 H;  2E5L L;  3S15 H;  2UXB Q;  5H1S E;  4DV5 L;  1JJC B;  4DR2 Q;  3GTJ H;  2QEX A;  3KJO A;  4DV6 L;  3RZD H;  2R7Z G;  1I6H H;  4A75 A;  1G6P A;  1XTD A;  1AE3 A;  3T1Y L;  1VQM A;  2E2H H;  3EN2 A;  5M3M G;  4GLV B;  3B6Y A;  5HGQ A;  2CWA A;  4YHH Q;  4WJ4 A;  3UDG A;  3MEF A;  2R7F A;  3J81 i;  2E5L Q;  4DV5 Q;  2R6G A;  1Q8K A;  1JJ2 A;  3J7Z C;  2Q2H A;  4IPD A;  1XMO L;  2JA8 H;  3U4Z A;  1CSQ A;  3CCV A;  4GNX B;  4DV6 Q;  2LXJ A;  1NMF A;  1KL9 A;  4YWL A;  4DUZ L;  3T1Y Q;  3ERS X;  2WAQ E;  3CQZ H;  3PV0 A;  4O2D A;  4PMW A;  4DAM A;  4IFD G;  1JB7 A;  1TWA H;  1JMC A;  3UDX A;  3FHW A;  1BVS A;  1NY4 A;  3ULL A;  1KRS A;  1XMO Q;  1QVC A;  1KAW A;  3H0G G;  4OO1 G;  1FJG L;  1HJP A;  4DUZ Q;  3D0F A;  2F4V L;  1V9P A;  5LMN L;  3M3Y H;  3PO3 H;  4A3F H;  3S1N H;  3A0J A;  1VQD A;  2RF4 A;  4YY3 L;  2HIV A;  1UE1 A;  1KD1 C;  5GQO A;  1Z47 A;  2ZJR A;  1RIP A;  1S40 A;  4HIO A;  2A19 A;  4R1J A;  3RLN A;  4HJA A;  1PHJ A;  4LF8 L;  3S16 H;  3U50 C;  4KI0 A;  1FJG Q;  1GD7 A;  1N33 L;  3I4M H;  4GKK Q;  3K80 C;  5FJ8 G;  1HZB A;  3L2P A;  1W2B A;  4BY7 G;  4LFB L;  4EQ5 A;  1K8A C;  2F4V Q;  2CKZ B;  1C9O A;  3KLW A;  2IY5 B;  4UPA A;  5JJK A;  4YY3 Q;  3HOX H;  5K36 G;  2VS1 A;  1PH1 A;  3S17 H;  4A3E H;  1K3R A;  1SMX A;  3D31 A;  2ATW A;  4LF8 Q;  2BH2 A;  2YTY A;  3TS0 A;  3TS2 A;  1YHA A;  3M85 A;  1NJI C;  1N33 Q;  4IPG A;  4HJ8 A;  4JI0 L;  4DV3 Q;  3HKS A;  1HNX L;  2PI2 E;  1VQ7 A;  1X6O A;  3ICE A;  2AWO A;  3F1Z A;  4GOP A;  1VQL A;  2E2I H;  2JA8 G;  4DR4 L;  2VL6 A;  4GKJ L;  3F2D A;  2L15 A;  3RN5 A;  2AKW B;  2WP8 J;  4LF7 L;  2JEB I;  3HKZ E;  4HJ5 A;  3CAM A;  3K8A A;  4X66 L;  1VQE A;  4GS3 A;  1K0R A;  4PG3 A;  3CC4 A;  3M7N A;  1SRO A;  4JI2 L;  1B70 B;  3UDI A;  1YHB A;  2RCN A;  2WAQ G;  4JI0 Q;  5C44 G;  1OXX K;  4YCW A;  1HNX Q;  4P74 A;  1X55 A;  4DR4 Q;  3I4N H;  3PUV A;  4GKJ Q;  5FLM H;  3CF5 A;  3W1G A;  5IWA L;  2OCE A;  4P73 A;  3AQQ A;  4LF7 Q;  3CME A;  1VCI A;  2QA4 A;  1AE2 A;  4X66 Q;  4ALP A;  1N9W A;  1I50 H;  1VQO A;  1J5E L;  1LYL A;  1DGS A;  1V1Q A;  1OXT A;  3JC6 6;  5C0X J;  4JI2 Q;  4A3F G;  2YU9 H;  1QVF A;  3T1H L;  2R7Z H;  4MNO A;  1OTC A;  2KCM A;  3DLL A;  4LF6 L;  1JE5 A;  2WB1 E;  1P16 A;  5M3M H;  1H95 A;  3NEL A;  1YEZ A;  5IWA Q;  5LMU L;  3I4M G;  2Y0S G;  4R4I A;  2Q2U A;  5GAG C;  1EOV A;  4JI5 L;  1VQ4 A;  4NXN L;  5IY0 A;  1J5E Q;  2JA5 H;  4APV A;  3PGZ A;  4A3G H;  1PYS B;  4UP7 A;  2HIX A;  4L5Q A;  2ID0 A;  3GDE A;  3KJP A;  4LF6 Q;  2NVT H;  3M9B A;  5LMU Q;  5C0X I;  3CCU A;  1IXR A;  2UXC L;  3RR5 A;  5IE8 A;  3GTG H;  2BA0 A;  4JI5 Q;  4P72 A;  4NXN Q;  2VNU D;  1IL2 A;  2OQK A;  2RHQ B;  2I5L X;  1YHQ A;  3KFU A;  3H0G H;  1WCM G;  5C4J H;  3G71 A;  1HR0 W;  1OXS C;  4YCV A;  4Y7N H;  3A5U A;  2ZTD A;  2DUD A;  1M90 C;  1KIX A;  2CFM A;  3ULJ A;  3OYY A;  4R4Q A;  1QVG A;  4XTC S;  1XJV A;  1KRT A;  1FGU A;  1WI5 A;  3GTL H;  3HKZ G;  4A3B H;  3S1Q H;  3CCL A;  2UXC Q;  2NN6 I;  1QUQ A;  1YIJ A;  2OWO A;  1BBU A;  4NPS A;  3GO5 A;  5GAD C;  5FLM G;  5GAH C;  5FJ8 H;  1Y1W G;  1IYJ B;  4OWX B;  4GOP C;  1TWF H;  4DR6 L;  2R93 H;  1A63 A;  2B29 A;  3F2B A;  4L5S A;  2V1C C;  3PF4 A;  1VQK A;  1ASY A;  4A3M G;  4PZ6 A;  1SR3 A;  3VDY A;  3OTO L;  2JA6 G;  1J6Q A;  1B8A A;  5IP7 H;  5FLX c;  4JBM A;  1WJJ A;  1EQR A;  3AFP A;  3U4V A;  4L5T A;  1E7Z A;  3AFQ A;  2GN5 A;  3JAM i;  2WB1 G;  3PIO A;  1I94 L;  4DR6 Q;  2KHJ A;  4DV4 L;  1IZ6 A;  1X56 A;  1IBM L;  2JQO A;  2JA5 G;  3GTQ H;  3PUY A;  4DK3 C;  4A3G G;  4JI6 L;  3RNU A;  2AWN A;  2KBN A;  3M4Q A;  3CCE A;  4HID A;  4NB3 A;  3OTO Q;  4JI8 L;  3ER0 A;  4GN5 A;  5JJL A;  4GLA C;  3UE0 A;  4DV7 Q;  5C44 H;  1S72 A;  2D0O A;  1I94 Q;  3L0O A;  4DV4 Q;  1CSP A;  3BZC A;  4NXM L;  3CCM A;  4HIM A;  1IBM Q;  4LF9 Q;  4IFD J;  1YZ6 A;  2OTJ A;  1FVI A;  4JBW A;  4JI6 Q;  2VY3 A;  4QGU A;  4GKK L;  3H3V I;  2VZA A;  2KCT A;  3K81 C;  4B3T Q;  4A3I H;  3PCO B;  4JI8 Q;  4LF5 L;  4KHZ A;  1IBL L;  1Y14 B;  1N36 L;  2PMZ E;  2K5V A;  2JA9 A;  3J7A 5;  4A3B G;  4X64 L;  1YJW A;  3KDF B;  3W1B A;  1L1O C;  2HHH L;  1G29 1;  4NXM Q;  3HFZ B;  2MO0 A;  5IT9 c;  3M4O H;  2UXD L;  4OWT B;  1I5F A;  4PZ7 A;  4DR1 L;  1BBW A;  2JE6 I;  4WJ3 M;  1Y1V G;  2UUB L;  4DV3 L;  3I55 A;  1WYD A;  3WWV A;  1A62 A;  1X65 A;  1VQG A;  1IBL Q;  2K5H A;  1N36 Q;  2WFW A;  1M1K C;  4LF5 Q;  3A74 A;  3HOZ G;  1MKH A;  1PFS A;  1UEB A;  4OXP A;  5BR8 L;  1PVO A;  3CP0 A;  1UE6 A;  4R4T A;  4X64 Q;  1XPU A;  3HOU G;  2ZTC A;  2HHH Q;  5ELO A;  3RLF A;  2VQE Q;  2UXD Q;  5IP7 G;  3PO2 G;  3GTM H;  4DR1 Q;  3A5Z B;  3TRE A;  4GLX A;  3STB C;  1YJ9 A;  1VQN A;  1S3O A;  2IX0 A;  2UUB Q;  5J3B A;  1VQI A;  1N34 L;  3KF6 A;  4BBR G;  5M5X H;  4HJ7 A;  1SE8 A;  2Z6K C;  4BY1 G;  3S2H H;  1HZA A;  1WCM H;  2K75 A;  5BR8 Q;  2MQH A;  5E7N A;  4A3J G;  3W5O A;  2A8V A;  1U5K A;  2LXK A;  1Q81 C;  1PA6 A;  1C7Y A;  4HJ9 A;  1EUJ A;  2KEN A;  3STB D;  1PH7 A;  3J80 c;  3IRB A;  4R4O A;  4DV1 L;  2R93 G;  4EX5 A;  1N34 Q;  1WFQ A;  3G48 A;  1WOC A;  1VS0 A;  1JJG A;  1SLJ A;  3I7F A;  2VQF L;  1NE3 A;  4LFA L;  1Y1W H;  4DR7 L;  2I5H A;  4A3I G;  3CC7 A;  4DK6 C;  4A3M H;  1EIF A;  2E8G A;  3CPW A;  4DV1 Q;  4JI3 L;  1JT8 A;  2HT1 A;  4PZ8 A;  2JA6 H;  5LMN W;  1ASZ A;  5JEA G;  1E22 A;  1PH6 A;  2N78 A;  3J81 c;  4YWK A;  1CKO A;  1TXY A;  4LFA Q;  1Q1B A;  2VQF Q;  1GO3 E;  3CD6 A;  4DR7 Q;  3NBH B;  1XPR A;  4HIK A;  5IYD G;  2OQ0 A;  1B7Y B;  1Z9F A;  2F52 A;  2RHS B;  4DNI A;  4JG2 A;  2K14 A;  5C4X G;  2B63 G;  1AH9 A;  4JI3 Q;  4A3K G;  1UWV A;  4QJF A;  1E24 A;  4DKA C;  2IT1 A;  1XNR L;  3S14 H;  4JCV E;  2Q2I A;  2XTI A;  3I4O A;  1NTG A;  1L1O A;  1L0W A;  4A3C G;  2N8N A;  4LW1 A;  1KXL A;  4IPH A;  2YYZ A;  4YCU A;  5JJI A;  2UU9 L;  3FP9 A;  4GN4 B;  2PQA A;  3KF6 B;  3UDF A;  2I0Q A;  4LNQ A;  4GOP B;  2CWP A;  1XNR Q;  4BA2 I;  1PH4 A;  4KLK A;  2ZJP A;  2NN6 G;  4A76 A;  2JK8 A;  4MZ9 A;  3BU2 A;  4JV5 L;  4AH6 A;  2NZH A;  1SN8 A;  2VUM H;  1D7Q A;  4ME3 A;  2AHO B;  3PF5 A;  1K8G A;  3TRZ A;  1QZH A;  3AYH B;  1PV4 A;  3LGJ A;  2UU9 Q;  4DR5 L;  2Z6K A;  1K9M C;  1D8L A;  1Y1V H;  1VQ9 A;  4OX9 L;  4LWC A;  1L2F A;  1NBW A;  4X62 L;  4B3M L;  4A3D G;  4JI4 L;  5AJ3 L;  3HOZ H;  1G51 A;  2I5M X;  1KQS A;  2VW9 A;  2K52 A;  3RZO H;  2B3G A;  4JV5 Q;  3I56 A;  1P8L A;  2PNH A;  3K7A H;  2Z0S A;  3HOU H;  2GVA A;  2ASB A;  3RN2 A;  4IJH A;  4DR5 Q;  3PO2 H;  3CW2 C;  1VQ8 A;  4LF4 L;  4OX9 Q;  1HNZ L;  4DR3 L;  4JYA L;  4DV7 L;  4X62 Q;  3HOW H;  1MIU A;  4B3M Q;  4BBR H;  2GVB A;  4AYB E;  4JI4 Q;  5AJ3 Q;  4BY1 H;  4JBJ A;  4JBK A;  4LF9 L;  3OW2 A;  4AIM A;  1Q46 A;  2JJQ A;  5IYC G;  3G6E A;  2YV5 A;  4A3J H;  4BBS G;  2FXQ A;  1CKM A;  3E9I A;  1GKH A;  2EQS A;  3E9H A;  3PIP A;  5C3E G;  2UUC L;  3U58 A;  3PUX A;  4B3T L;  3GTK H;  1VQJ A;  2ALY B;  4LF4 Q;  1GM5 A;  1HNZ Q;  2IHE A;  2LSS A;  3K0X A;  4RG1 A;  4DR3 Q;  3CPF A;  4OWW B;  4JYA Q;  5M3F H;  1L1O B;  1VQH A;  2BA1 A;  4UP9 A;  2AMC B;  5M5W H;  4QQB X;  3PSI A;  4QL5 A;  5IYB G;  1VQ6 A;  1NMG A;  1EQQ A;  3ZJY C;  1E1T A;  4A4I A;  1X3E A;  2N3S A;  2UUC Q;  2JA7 G;  2R92 G;  2PQA B;  2XGT A;  4TQU S;  1X9N A;  3KOJ A;  3S1M H;  1XPO A;  1KHI A;  4LFC L;  3HOY G;  2VUM G;  2PI2 A;  1HH2 P;  4MTN A;  1CKN A;  2MO1 A;  2VQE L;  1PYB A;  1Q86 C;  1MJE A;  4KHP L;  1VQP A;  1QUQ B;  2KHI A;  1EIY B;  4A3L G;  3GTO H;  3AEV A;  2K50 A;  3PUZ A;  4DV2 L;  3FKI H;  4B3R L;  5IYD H;  3RLO A;  5ELN A;  2F3I A;  1OXV A;  4POF A;  3G4S A;  5C4X H;  5IP9 H;  4IFD I;  2B63 H;  4A3K H;  4LFC Q;  1X54 A;  1QZG A;  4GNX C;  2R7D A;  2UUA L;  4KHP Q;  1UE5 A;  3M4P A;  1HNW L;  4L5R C;  1VQB A;  4POG A;  1A8V A;  4A3C H;  1XNQ L;  4OO1 I;  3S24 A;  4DV2 Q;  3HOW G;  4B3R Q;  2C35 B;  3BZK A;  1YI2 A;  4X6A H;  4FDB A;  4JOI A;  4OON A;  2Y0S E;  4C3I H;  1RL2 A;  1W3S A;  4TVA B;  4AYB G;  3GTP H;  3PUW A;  2Q2T A;  4LUV A;  2UUA Q;  1Q82 C;  1YIT A;  1T9H A;  1MJC A;  2D62 A;  5LMN Q;  3HOV H;  1HNW Q;  4C3J H;  2BH8 A;  1XNQ Q;  1Q7Y C;  2QGQ A;  1XMQ L;  4JI7 L;  5HY6 A;  1E1O A;  4BXX H;  5M3F G;  3S1R H;  2HQL A;  1R9T H;  4DV0 L;  1LM0 A;  1E3P A;  2EIF A;  4X65 L;  3J81 j;  3CC2 A;  1CUK A;  3CCS A;  1SRU A;  3L7Z C;  4A3D H;  1VQF A;  4YWM A;  2K4K A;  1HR0 L;  4BA1 I;  4LFB Q;  4IOA A; 
#chains in the Genus database with same CATH topology
 3EBE A;  4KTA A;  4A93 H;  3KBX A;  4JI7 Q;  4HN7 A;  1FL0 A;  3CMA A;  2SEB D;  4Q0F A;  5CR3 A;  1BKB A;  4QUF A;  2EXD A;  4KKS A;  3SK6 A;  2ZJQ A;  5EAY A;  5IYC H;  4O0A A;  2MHV A;  1FNW A;  2NZ1 D;  1O7I A;  4C2M H;  1EWI A;  5M5Y H;  3F2C A;  3QIA A;  1CM9 A;  2QKI C;  3H3V H;  1TWH H;  2M9V A;  3VYS A;  1W6J A;  1VQA A;  3KLS A;  5IGG A;  1QB5 D;  5BN3 A;  3EIV A;  3QJY A;  3HOV G;  4AQY Q;  4K2K A;  1LUZ A;  3P7J A;  3H94 A;  3KF8 B;  3T1H Q;  3HOY H;  3NEN A;  3WDN A;  4A3L H;  1JE4 A;  3SEB A;  4K5V A;  3CKI B;  4J15 A;  4B3S Q;  1NR4 A;  2IW3 A;  1U0L A;  3GTG B;  4KK7 A;  2WIN B;  3J7A V;  4H7B A;  2LKV A;  2UXB L;  3I2Z A;  5K5P A;  3HS0 C;  2EJF C;  3OIQ A;  3SGI A;  3CCQ A;  1EY0 A;  1WTH A;  1HZC A;  3J80 i;  5JVG 3;  2EOT A;  4IPC A;  3MFY A;  4YHH L;  3ULP A;  4BY7 H;  2E5L L;  2F0Q A;  1NR2 A;  2Q8I B;  1U4R A;  2QEX A;  4DV6 L;  1TWF B;  2R7Z G;  3K5M A;  1AE3 A;  1EFI D;  1CA5 A;  4DNR B;  1HTP A;  4ME5 A;  1SYC A;  3UDG A;  2JA8 H;  1EEI D;  2LXJ A;  4G7Z C;  4BY1 B;  1STH A;  4PNY A;  5EBC A;  1GUN A;  4O2D A;  4CGY B;  2WKC A;  4G7H C;  4IFD G;  3GTK B;  2BE5 C;  3UDX A;  3ERO A;  4OIK A;  2XWB B;  1NY4 A;  1K0S A;  4EQP A;  1U9R A;  1KAW A;  2SNM A;  5C4Z A;  2B2V C;  1HJP A;  3MTS A;  3BDO A;  5I4D A;  4FF1 A;  5LMN L;  2F4V L;  3M3Y H;  4A3F H;  2RF4 A;  1U4P A;  4A3I B;  1O7Z A;  1UE1 A;  5BN4 A;  1Z47 A;  1RIP A;  3K59 A;  4KI0 A;  1GD7 A;  3K80 C;  1HZB A;  4LJZ C;  1PRT D;  3KLW A;  3C1E A;  4YY3 Q;  4J1M A;  5KNB A;  3D31 A;  1B1Z A;  4JVZ A;  5LL6 X;  1S5B D;  3M85 A;  1N33 Q;  2M2L A;  2F0D A;  4HJ8 A;  2NBF A;  3P1H A;  2EVB A;  1C4Q A;  4ZUI A;  3ICE A;  3F1Z A;  2HDM A;  4DFA A;  2DNE A;  5FOB B;  3F2D A;  2L15 A;  4K8J A;  3CU7 A;  1PTO H;  4B9X A;  2WP8 J;  3WOE A;  2E75 C;  3CAM A;  3HGB A;  4GS3 A;  1K0R A;  3M7N A;  5KYL A;  1AP0 A;  1SRO A;  4K8I A;  4JI2 L;  1B70 B;  4KMU C;  1EWC A;  2WAQ G;  3FDT A;  3GQB A;  3OMG A;  4JI0 Q;  1OXX K;  4YCW A;  5I6Y A;  2KVM A;  5FLM H;  2B2U C;  5IWA L;  3D8G A;  1S5E D;  4LF7 Q;  3S1R B;  1TQO A;  1VCI A;  1ZXT A;  2QA4 A;  2HCI A;  3JC6 6;  5C0X J;  2HQE A;  1OTC A;  2NTS A;  3KBG A;  1YEZ A;  2LFN A;  1LAC A;  3I4M G;  2Y0S G;  1MSG A;  2Q2U A;  1EOV A;  3I8Z A;  4E6I A;  1WTR A;  4NXN L;  2JA5 H;  5IOD A;  1BCP C;  4K6D A;  5EBD A;  5KEE A;  4A3G H;  4UP7 A;  2H1E A;  2HIX A;  4V19 0;  3S14 B;  2I07 B;  5C0X I;  2K33 A;  4JI5 Q;  4C2M B;  5M5Y B;  4P72 A;  4RCO A;  5D3D A;  3HRZ C;  2RHQ B;  3Q6S A;  1CZW A;  4XT1 B;  1TY2 A;  4B9W A;  2ZTD A;  4Y7N H;  1KIX A;  3P20 A;  3MXG A;  3ULJ A;  2DNC A;  4IUN A;  4BWG B;  1Y8P B;  1PZK D;  1Q8I A;  3S1Q H;  2OWO A;  5C5M A;  5GAD C;  4HCE A;  4PMB A;  1UUP A;  2PPB C;  3HOY B;  2VUM B;  5D3I B;  4DA2 A;  1IW7 D;  5FJ8 H;  2O5I C;  4DR6 L;  1A63 A;  4L5S A;  5K36 H;  3VDY A;  3HOZ B;  3Q23 A;  1J6Q A;  1B8A A;  5FLX c;  4JBM A;  4ZQ3 A;  1E7Z A;  3AFQ A;  2GN5 A;  1HTL D;  3PO2 B;  4KN7 C;  2KHJ A;  1B4O A;  1X56 A;  1IBM L;  2JQO A;  1ROD A;  2KBN A;  4IUV A;  3CCE A;  3IL8 A;  4GN5 A;  1PRT B;  2B2Y C;  4GLA C;  3UE0 A;  1RTO A;  2B2T C;  3L0O A;  4HIM A;  4LF9 Q;  1TS4 A;  4NP5 A;  1XTC D;  4RA8 A;  4QGU A;  3A55 A;  4ABN A;  2L12 A;  4B3T Q;  4JI8 Q;  2JA9 A;  3X3M A;  1SSO A;  3TP5 A;  1VMP A;  1YJW A;  3W1B A;  2UXD L;  2MO0 A;  5IT9 c;  4OWT B;  2JE6 I;  2UUB L;  5IIF A;  3I55 A;  5KRU A;  2KED A;  4LF5 Q;  3SXH A;  1R4P B;  2K5H A;  2V4D A;  3TSS A;  3GTO B;  1PFS A;  3FKI B;  5BR8 L;  1F2L A;  1VF5 C;  3TBI B;  3I91 A;  2ZTC A;  2EYO A;  5IP7 G;  4KJO A;  3A5Z B;  4Z9C B;  2IX0 A;  1TS2 A;  5CV5 A;  4HJ7 A;  1LTB D;  1SE8 A;  4BY1 G;  1X3Q A;  3S2H H;  3F2U A;  2ZXR A;  2K75 A;  2IX3 A;  4XYQ A;  1QCB D;  1NAP A;  2PYK A;  2NN6 H;  1A3U A;  1Q81 C;  1HUM A;  1TY0 A;  1YNN D;  1PH7 A;  5CGK A;  3IRB A;  2EYL A;  1WOC A;  3J81 L;  3OIP A;  2OXP A;  5J22 A;  2KOL A;  4LFA L;  1K8O A;  2F0E A;  2AUK A;  2I5H A;  1E2W A;  4A3I G;  3CC7 A;  4DK6 C;  4A3M H;  3ONA B;  5JEA G;  2X69 A;  1EU3 A;  4K14 A;  3OMC A;  1K83 B;  1PTO B;  2WII B;  1PRT F;  2VQF Q;  3CD6 A;  4G7O C;  4DR7 Q;  5C6A A;  2EY5 A;  4HIK A;  2C5C A;  1MBY A;  1AH9 A;  2F0V A;  4DKA C;  4I7Z C;  2EZV A;  1O7Y A;  2Q2I A;  2QDB A;  2XTI A;  1L0W A;  2XN9 C;  4DXF A;  5JJI A;  2FMM A;  2L5T A;  4N8X 1;  1A3T A;  1H9M A;  2RVL A;  4GOP B;  1XNR Q;  1PH4 A;  2E2J B;  4A76 A;  3BU2 A;  4AH6 A;  1EY6 A;  3S9W A;  1D7Q A;  2AHO B;  5T1I A;  1K8G A;  1QZH A;  1STG A;  3QWN A;  2Z6K A;  1Y1V H;  4OEM B;  2K5W A;  4LWC A;  4KJN A;  1NBW A;  2OEO A;  4B3M L;  1RD9 D;  2EJM A;  1AW7 A;  1DCZ A;  2K5D A;  2VW9 A;  2KCN A;  4JV5 Q;  1P8L A;  3K7A H;  3C3L A;  1D2B A;  3HOU H;  4N9P A;  2EYF A;  5FKA C;  1JIC A;  4J8Q A;  4Y7N B;  4LF4 L;  4OX9 Q;  3TZU A;  1QWY A;  1SND A;  4DV7 L;  4X62 Q;  1MIU A;  4JI4 Q;  1FD7 D;  3SHL A;  4AIM A;  1Q46 A;  5C5L A;  5IYC G;  2XSC A;  2YV5 A;  3PIP A;  2UUC L;  4Y52 H;  2NVX B;  4CDF C;  3Q0A A;  3SDZ A;  3NTK A;  2LSS A;  5G3L D;  4DR3 Q;  4KD3 A;  2FIN B;  3SVM A;  2BA1 A;  2AMC B;  1AZQ A;  4QQB X;  3GTJ B;  1PTO F;  5A2Q L;  1EQQ A;  4JPB W;  4A4I A;  4FXG C;  2N3S A;  2L11 A;  4DAY A;  4TQU S;  1WVL A;  3C2P A;  1RDP D;  1CHQ D;  4LFC L;  4L8J A;  3HOY G;  2VUM G;  3R2T A;  1SMY C;  4KHP L;  1MJE A;  2VQE L;  5F2D A;  1Q86 C;  1I4Q A;  1QUQ B;  4A3L G;  4O42 A;  3PUZ A;  4DV2 L;  1IYU A;  4B3R L;  3RLO A;  2F3I A;  3CQZ B;  4QCL A;  5IP9 H;  3MHB A;  1HPC A;  5C0X H;  5CBE E;  1UE5 A;  3BYY B;  2K1B A;  4L5R C;  2Z4H A;  4HSV A;  3J81 E;  4OO1 I;  1A8V A;  1WTO A;  3T53 B;  1ET9 A;  3A8I E;  1YI2 A;  2XIW A;  1DM0 B;  3S1N B;  4C3I H;  3GTP H;  1STE A;  2Q2T A;  1KNA A;  2EJG C;  4LUV A;  4UAI A;  2D62 A;  4O1N A;  1J9O A;  2QGQ A;  4JI7 L;  5HY6 A;  4BXX H;  3DHQ A;  1EY5 A;  1NUC A;  2ZXP A;  3JAM L;  1LM0 A;  1MI2 A;  1CUK A;  3L7Z C;  1VQF A;  4YWM A;  1JOQ A;  1SJE D;  2EY2 A;  3ZYY X;  4JC0 A;  2F0N A;  4DAY B;  2NZO A;  2DGY A;  4MN3 A;  2NVQ H;  3S2H B;  4HR7 B;  4X65 Q;  1PH5 A;  3BVM A;  3I4L A;  3QO2 A;  1G2T A;  1GUO A;  1TWG H;  3FKI G;  4P71 A;  1PH3 A;  1D5Z C;  3VA5 A;  1TWC H;  1V1P B;  2MNA A;  1PH9 A;  4XDX A;  3BDC A;  4DPG A;  4AQY L;  2PNR C;  1KDA A;  4QY7 A;  1N32 Q;  1PH2 A;  2OF1 A;  5IYB H;  1RTN A;  4F87 A;  3MA2 B;  3K7U C;  1N8R C;  2R92 H;  1OXU A;  4DUY Q;  4B3S L;  4GNX A;  2K5N A;  3TQY A;  3BJU A;  1K73 C;  5ELE A;  3QOL A;  3AMU A;  1IBK Q;  2CQO A;  2WB1 B;  4X3T A;  4G57 A;  1I3Q H;  1Q1E A;  5DLQ E;  3NHH A;  5J1Z A;  1SFO H;  1YVC A;  1X3P A;  1A2T A;  3GD7 A;  2Z1C A;  3EA6 A;  2NVT B;  2JEA I;  3NE5 B;  2JP1 A;  3I3C A;  5JPN C;  1EYC A;  3K5L A;  3BYT B;  1YJN A;  1ESR A;  4FNF A;  1B53 A;  2NVY H;  1V43 A;  2XRS D;  5GAE C;  3DM3 A;  1BUV T;  4C3H H;  4KY6 A;  3CCR A;  1PFM A;  5IOC A;  3L3O C;  1DOL A;  3KDF A;  1D5M C;  3I73 A;  5A2Q E;  4QIW E;  4A3B B;  1BDO A;  3UI2 A;  2E74 C;  1YNX A;  3A7A B;  1ZEQ X;  1SYG A;  3A8J E;  5H1S E;  1Y1V B;  2J7Z A;  4QIW B;  2R93 B;  1G6P A;  4A75 A;  4Q5V A;  2E2H H;  3K7A B;  5CV9 A;  3HOU B;  4GLV B;  5HGQ A;  1VF7 A;  3VYU A;  1SE2 A;  4XT3 B;  1STB A;  4DV5 Q;  1Q8K A;  3TRZ A;  2Q2H A;  1S5C D;  3U4Z A;  3MZ5 A;  4GNX B;  1PZI D;  1NMF A;  1S4Z A;  4YWL A;  1LT6 D;  3T1Y Q;  2WAQ E;  4PMW A;  1B2T A;  3GV3 A;  1JB7 A;  2RDF A;  5CV7 A;  3K5O A;  1BVS A;  1EQT A;  2WAC A;  3K0Y A;  2WAQ B;  1XMO Q;  1XXG A;  1SMY D;  1GHJ A;  4DUZ Q;  3OPO A;  3LX0 A;  4ILW A;  1AEX A;  3A0J A;  1PRT C;  4YY3 L;  2HIV A;  4UDU C;  1KD1 C;  4DGZ A;  1JCK B;  3W2D A;  3RLN A;  4HJA A;  3S16 H;  2XWJ B;  1FJG Q;  1N33 L;  1PXU A;  5G3L F;  5FJ8 G;  5E1F A;  4OEL B;  5JJK A;  3ITP A;  2J0T D;  3QR8 A;  5K36 G;  3NP8 A;  2NTT A;  4LF8 Q;  3TS2 A;  3TS0 A;  1SXT A;  3HEJ A;  4OL7 A;  2LS0 1;  1KAB A;  4JI0 L;  3HKS A;  5FK9 C;  1VQ7 A;  1X6O A;  2AWO A;  1VQL A;  2E2I H;  3RD4 A;  1WTQ A;  2AKW B;  3C46 A;  4LF7 L;  5M5X B;  2JEB I;  1JQY D;  4HTH A;  3TN2 A;  3EFX D;  2H4O A;  5ELC A;  4PG3 A;  3GTP B;  5FO7 B;  4ZAI A;  3VR2 A;  4KY7 A;  1EY7 A;  1TKW B;  3MXP A;  1X55 A;  4DR4 Q;  4GKJ Q;  3CF5 A;  3W1G A;  2OCE A;  2JSO A;  3PIO 3;  1LTT D;  1SAP A;  1VQO A;  1LYL A;  2SNS A;  4QMG A;  3NSW A;  1S5D D;  2A73 B;  1JE5 A;  4DK0 A;  5M3M H;  1PLF A;  1F2M A;  2F0U A;  4JI5 L;  1EEF D;  3PGZ A;  4CKB A;  1LT5 D;  3DWQ A;  1TWG B;  4CJ2 C;  4JK1 C;  2QIL A;  2ID0 A;  1TWC B;  3GDE A;  4LF6 Q;  1F77 A;  1W6K A;  1PTO C;  1IXR A;  4KKU A;  3OWF A;  3RR5 A;  1KLG D;  2BA0 A;  1IL2 A;  2I5L X;  3KFU A;  1EYA A;  3H0G H;  1TR5 A;  2N55 A;  1EOT A;  1OXS C;  4YCV A;  1HR0 W;  4OO1 H;  1IW7 C;  2E2D C;  2G5D A;  3OYY A;  4ZK9 B;  2HD3 A;  3GTL H;  4OHJ A;  4L63 B;  4N9T A;  2UXC Q;  2NN6 I;  3C1F A;  2RA4 A;  1AFP A;  4LAA A;  1ENC A;  5DNF A;  4OWX B;  4GOP C;  4F8M A;  2F0T A;  2V1C C;  1ASY A;  4A3M G;  4PZ6 A;  1LTG D;  1SR3 A;  4XQN A;  1SYB A;  2F0L A;  3RZO B;  3X3N A;  2NVY B;  1EQR A;  1ICW A;  5D65 A;  2WB1 G;  3GTQ H;  2F0M A;  1IL8 A;  1K8M A;  3HOW B;  3RNU A;  4HID A;  1GUW A;  3OTO Q;  4JI8 L;  5JJL A;  4C1N K;  5C44 H;  1S72 A;  1CSP A;  3L9A X;  4IFD J;  5CC4 A;  3MVV A;  4KY5 A;  4JI6 Q;  2VY3 A;  2J4X A;  4GKK L;  3H09 A;  3K81 C;  2B8G A;  3PCO B;  4LF5 L;  1Y14 B;  1DZ1 A;  4A3B G;  2A6H D;  1XX8 A;  5JJZ A;  2AUJ D;  2K6A A;  2PCF B;  3S1M B;  1G29 1;  3M4O H;  1Y1V G;  4B08 A;  1LLR D;  2VXW A;  4DV3 L;  3WWV A;  2R93 G;  2EYP A;  2JXM B;  5KND A;  1MKH A;  1UEB A;  4OXP A;  5KYI A;  1UE6 A;  4R4T A;  1XPU A;  3HOU G;  3GTM H;  3J80 L;  3TRE A;  1YNN C;  3MXN A;  2KUM A;  5J3B A;  2Z6K C;  3SE0 A;  1HZA A;  1WCM H;  5E7N A;  3ND9 A;  3S16 B;  1EUJ A;  4IZ8 A;  3M4Y A;  2RSN A;  5DAU A;  5FO8 B;  1N34 Q;  3G48 A;  3IFD A;  1JJG A;  2XVS A;  2N88 A;  2FHT A;  4XYO A;  3I7F A;  2VQF L;  1NE3 A;  1R9T B;  4DR7 L;  4XQJ A;  2R3Z A;  1EIF A;  2E8G A;  4HCS A;  5M9O A;  4DV1 Q;  2NB0 A;  4PZ8 A;  5LMN W;  1E22 A;  2QEJ C;  4A93 B;  4R8N A;  4FP5 D;  1XPR A;  2DY7 A;  1LV9 A;  2OQ0 A;  1Z9F A;  2F52 A;  2Z9H A;  2RHS B;  2PW5 A;  1E24 A;  1XNR L;  1AN8 A;  4JCV E;  2X6G A;  3SK8 A;  1NTG A;  4RGO S;  2N8N A;  3I70 A;  1U4M A;  3NTI A;  4I7A A;  1YNJ D;  2KEE A;  4C3I G;  4GN4 B;  4LNQ A;  2D5D A;  1TWH B;  2CWP A;  5CV4 A;  4BA2 I;  1XYI A;  2CH4 W;  5CV6 A;  2HCC A;  1MSH A;  2JK8 A;  4JV5 L;  1PTO D;  5CBA E;  4DN4 M;  1Y8O B;  3K6O A;  3PF5 A;  1Z6H A;  4OX9 L;  4X62 L;  3E3X A;  5BN5 A;  4JI4 L;  2G9D A;  1MGS A;  3OWE B;  2K52 A;  1JOK A;  1VMC A;  1ET6 A;  2Z0S A;  1UEA B;  2EXZ A;  1A15 A;  4DR5 Q;  3D4D A;  5EKK A;  3CW2 C;  1E2V A;  4DR3 L;  1ENA A;  2C9O A;  2DJF C;  5COY A;  4JBK A;  3OW2 A;  4WRD A;  2JJQ A;  2A69 D;  1SE3 A;  3DXJ C;  3E9I A;  4IUU A;  1GKH A;  4NMZ A;  1SNO A;  3BVG A;  3NBI A;  1VQJ A;  1GM5 A;  4RG1 A;  3SK4 A;  3K0X A;  2BCO A;  2CQA A;  2HUG A;  3CPF A;  4OWW B;  4JYA Q;  5M3F H;  4BY7 B;  1HA6 A;  3T13 A;  4CKE A;  5M5W H;  2XNA C;  1RF2 D;  2F3W A;  4QL5 A;  5IYB G;  1E1T A;  2R92 G;  4CDE C;  1XPO A;  4TSS A;  4K2L A;  1BXT A;  3J80 E;  2PI2 A;  1LTA D;  1CKN A;  2JA8 B;  1PYB A;  3TDQ A;  3D4W A;  1AZP A;  4DAP A;  4RHR A;  1GOZ A;  2EYM A;  4DNT B;  5ELN A;  1OXV A;  4POF A;  3G4S A;  3K57 A;  2B63 H;  1B9M A;  4A3K H;  4ZRZ A;  2R7D A;  4GNX C;  2VB3 X;  4EQN A;  3IAY A;  3VYR A;  4WOR A;  3M4P A;  1JWS D;  4C3H G;  2QDL A;  4A3C H;  3S24 A;  3HOW G;  5HGT A;  2C35 B;  3M3Y B;  4A3F B;  4X6A H;  1SYF A;  1ESF A;  3DM1 A;  1K3B C;  3PUW A;  2UUA Q;  1YIT A;  2OT2 A;  3HOV H;  1HNW Q;  4KV6 A;  4MIU A;  5LMN Q;  1HXY D;  4C3J H;  1Q7Y C;  1ONL A;  2HQL A;  1H9R A;  1IYV A;  4X65 L;  4NDX A;  3CCS A;  2BDO A;  1SRU A;  1KDC A;  1II3 A;  4F7X A;  1A3V A;  1VQC A;  4XXE A;  1C48 A;  1XMQ Q;  2K5Q A;  2MGS A;  2ES2 A;  4XIG S;  4DV0 Q;  3H15 A;  1B50 A;  4WFN 3;  1CKN B;  5JEA J;  1N32 L;  2MJ8 A;  1Q12 A;  1PYW D;  4LUO A;  4R9W A;  3HKZ B;  4EVO A;  2YTV A;  4IJL A;  4BBS H;  2B8F A;  3OOC A;  3KYH C;  4DUY L;  3S2D H;  1RHP A;  1EQV A;  2NUC A;  1IBK L;  3DMU A;  2H5X A;  1DD2 A;  3IFT A;  1GUS A;  4JI1 Q;  2AQ3 B;  4NKL A;  1FGB D;  1T5X D;  2KEC A;  1G91 A;  1EZ6 A;  2K03 A;  2N49 A;  4YIJ A;  3TME A;  2O4X A;  3FPP A;  1HCZ A;  3TEH B;  4UY8 C;  1STN A;  2L4N A;  2JA5 B;  4LUZ A;  3VR4 A;  1LTL A;  1B3A A;  4A3G B;  4RMF A;  4UP8 A;  1C0A A;  3O13 A;  4P75 A;  2CCZ A;  1EIH A;  4JOI C;  5EQ0 A;  3E0E A;  1A2U A;  3P75 A;  3F8T A;  4A93 G;  2EE1 A;  4CBV A;  1KC8 C;  1I4H A;  3NPP A;  1GXD C;  1IKL A;  1Q90 A;  3BZD B;  3W3A A;  4K0K Q;  4IO9 A;  3S1Q B;  1EYG A;  2ZM6 Q;  3SR1 A;  1CQV A;  4ZYS A;  1ILQ A;  3MC0 B;  3S15 H;  4DV5 L;  1JJC B;  4DR2 Q;  3R2I A;  1WD0 A;  3RZD H;  1I6H H;  3URY A;  3T1Y L;  5M3M G;  1UAP A;  3B6Y A;  1GUG A;  2KQ3 A;  2B2U A;  4RKL A;  2R6G A;  5E4X A;  4IPD A;  1XMO L;  4K5X A;  4DUZ L;  3PQI A;  5CYU A;  2K28 A;  2LMC B;  4DAM A;  1TWA H;  3FHW A;  2RCF A;  1MHW C;  1QVC A;  3H0G G;  2F0G A;  2XRQ D;  4OO1 G;  4FF2 A;  1FJG L;  5IGD A;  5M5W B;  1WD1 A;  3D0F A;  3VR3 A;  3PO3 H;  4IUR A;  1VQD A;  3R93 A;  1GHK A;  2A5H A;  1SNQ A;  3U9O A;  3DWA A;  4KN4 C;  1FYC A;  4HIO A;  4LF8 L;  5C3W A;  2PMZ B;  3I4M H;  3L2P A;  2B2W A;  1W2B A;  4BY7 G;  3MAQ A;  3D4R A;  2K05 A;  4EQ5 A;  1KLU D;  5DM7 3;  4LFB L;  1EYD A;  1C9O A;  2IY5 B;  3NWT A;  3HOX H;  2VS1 A;  1PH1 A;  4A3E H;  1K3R A;  1SMX A;  5IGB A;  4A3K B;  1YHA A;  5JAV A;  1BF4 A;  3KUP A;  1NJI C;  1FR3 A;  1BR9 A;  4DR4 L;  3NTH A;  2JA8 G;  4GKJ L;  2VL6 A;  1JWM D;  2O2L D;  3QB3 A;  4HJ5 A;  1VQE A;  3FMC A;  1K28 A;  3CC4 A;  4RCN A;  1I4X A;  1HFG A;  2KA7 A;  3UDI A;  2PO4 A;  1LTS D;  5C44 G;  1HNX Q;  1NSN S;  4P74 A;  2K01 A;  4C3J B;  2QCP X;  3I4N H;  3PUV A;  3AQQ A;  4X66 Q;  1PZJ D;  1I50 H;  1DGS A;  1V1Q A;  1Y8N B;  4A3F G;  1QVF A;  4H0L C;  3T1H L;  4MNO A;  3J7Y W;  4A3M B;  3OSO A;  4LF6 L;  2WB1 E;  1P16 A;  4ZUJ A;  1H95 A;  1JWU D;  3E6Z X;  4R4I A;  1VQ4 A;  1SE4 A;  5IY0 A;  1J5E Q;  4APV A;  1PYS B;  4C56 C;  4L5Q A;  4BBS B;  5LMU Q;  2CW0 D;  2Q8R E;  2D9U A;  3S2D B;  2UXC L;  1X32 A;  3GTG H;  5CV8 A;  4L6T B;  1B9N A;  1WCM G;  3G71 A;  3J7A F;  4IN3 A;  1QVG A;  1XJV A;  1KRT A;  4ZKC B;  1EY8 A;  3VA7 A;  3HKZ G;  2AQ1 B;  3CCL A;  1V8Q A;  1BBU A;  4NPS A;  5FLX L;  3GO5 A;  5FLM G;  4EQO A;  1TT2 A;  2L9H A;  1IYJ B;  3AB9 A;  4IUQ A;  3H3V C;  1TWF H;  3F2B A;  1VQK A;  1LT4 D;  2ZT9 C;  3OTO L;  4GZY C;  2A6E D;  5IP7 H;  5JPM C;  1WJJ A;  3U4V A;  4CDD C;  1H9J A;  3CRL C;  3PIO A;  2JA5 G;  5DEH A;  4DK3 C;  4A3G G;  4JI6 L;  4NB3 A;  3D3R A;  4AYB B;  2KCC A;  1ZYR D;  4DV7 Q;  3S15 B;  2A6H C;  3QOJ A;  1I94 Q;  1D5X C;  4DV4 Q;  5IT9 L;  3BZC A;  1DXM A;  4KD4 A;  1FVI A;  1S5F D;  3MFG A;  4IQZ A;  2VZA A;  2KCT A;  3TP8 A;  4A3I H;  1U4L A;  3JAM E;  4CHT B;  3J7A 5;  2L0C A;  5JEA H;  5NUC A;  3KDF B;  4NXM Q;  4I65 A;  4PQX A;  1SBB B;  3LWU A;  3NBH A;  1BBW A;  4WJ3 M;  2TMP A;  3EQL C;  1WYD A;  1GJX A;  1A62 A;  1SYE A;  1VQG A;  1X65 A;  1IBL Q;  2NYZ D;  2WFW A;  1N36 Q;  1M1K C;  3A74 A;  1BOS A;  5LHY 1;  2SOB A;  1PVO A;  4X64 Q;  1CTM A;  2HHH Q;  5ELO A;  5C3X A;  2VQE Q;  1DJR D;  4DR1 Q;  4GLX A;  1YJ9 A;  3Q24 A;  1N34 L;  3PO3 B;  3KF6 A;  1KNE A;  2GA4 B;  3T4A C;  3W5O A;  1WTP A;  1L0X B;  1EL0 A;  1SNP A;  2K04 A;  2A8V A;  1HRJ A;  2LXK A;  4C3I B;  1PA6 A;  4HJ9 A;  2KEN A;  3STB D;  1G6Z A;  4DV1 L;  1ENF A;  4M8A A;  1SLJ A;  3HOX B;  3IKJ A;  4TKO B;  1Y1W H;  5EPJ A;  2Z4I A;  4XQQ A;  1HFN A;  1RKN A;  2HT1 A;  1O78 A;  2JA6 H;  1ASZ A;  1F9P A;  3A7L A;  3J81 c;  4IAL A;  4YWK A;  1EWH A;  2NVQ B;  1CKO A;  5D14 A;  3N52 A;  2F03 A;  1F9Q A;  1GO3 E;  1HHV A;  3NBH B;  4FVM A;  1YNJ C;  3K58 A;  3H6M A;  4DNI A;  4HMI A;  4JG2 A;  2B63 G;  1TVX A;  1I4R A;  4A3K G;  1UWV A;  4JI3 Q;  3S14 H;  1Y69 U;  3I4N B;  4NW2 A;  3I4O A;  4EGV A;  1L1O A;  3FEW X;  5FLX E;  1O80 A;  4A3C G;  1DOK A;  2A68 D;  1KXL A;  4IPH A;  2YYZ A;  1I50 B;  1WTX A;  3UDF A;  3KF6 B;  5EPK A;  2I0Q A;  3ND8 A;  2A74 C;  4KLK A;  2NN6 G;  1FNV A;  4C3J G;  4IUT A;  2R92 B;  1SN8 A;  2VUM H;  4ME3 A;  1PV4 A;  3AYH B;  2UU9 Q;  3LGJ A;  4DR5 L;  1H9S A;  4QUC A;  1EIG A;  4RKB A;  1VQ9 A;  1I3Q B;  1L2F A;  1SFO B;  1SNM A;  3HOZ H;  1G51 A;  2B3G A;  2PNH A;  2X6L A;  1LO5 D;  2GVA A;  2A69 C;  1L0Y B;  1R4Q B;  2L1B A;  2PZW A;  3PO2 H;  5IT9 E;  4OGQ C;  5ISR A;  4JYA L;  3E5S A;  4BBR H;  4C3H B;  2JYO A;  5AJ3 Q;  1JR0 D;  4LF9 L;  3PMF A;  4HAE A;  3G6E A;  4A3J H;  4BBS G;  2FXQ A;  1CKM A;  4LK1 C;  4B3T L;  2Z8L A;  3PUX A;  2ALY B;  2ZXO A;  4FF3 A;  3FPU B;  4HMJ A;  1HNZ Q;  3TZD A;  5KNC A;  1L1O B;  5EPL A;  1VQH A;  4PV1 C;  4UP9 A;  1EZ8 A;  1VDZ A;  3PSI A;  2KJX A;  1F2Y A;  4V0B A;  3ZJY C;  2IJ0 A;  5COR A;  4X3U A;  3ERQ A;  2E2H B;  1CHP D;  1SYD A;  3VYT A;  2XGT A;  1X9N A;  3KOJ A;  3MEH A;  1HH2 P;  4MTN A;  1TII D;  1Q3L A;  2MO1 A;  2KHI A;  1KDB A;  1EIY B;  3OHX C;  3GTO H;  3AEV A;  2K50 A;  1DON A;  1NNX A;  1H9S B;  3FKI H;  5IYD H;  5I6W A;  5C4X H;  4IFD I;  4ZLT F;  1RCV D;  1QZG A;  2EYH A;  2UUA L;  1HNW L;  2EYJ A;  1VQB A;  3N6R A;  3GV6 A;  5FO9 B;  4OON A;  3H91 A;  1RL2 A;  4AYB G;  5I2X A;  5EKL A;  3M7G A;  1MJC A;  2F3V A;  4ID6 A;  1XNQ Q;  1D6E C;  1XMQ L;  1XWE A;  1QOH A;  4DV0 L;  2EIF A;  5IGF A;  4A3D H;  4M1U B;  1EY9 A;  4BA1 I;  3DEO A;  2BOS A;  4IOA A;  2F0K A;  1A0I A;  1K83 H;  3Q22 A;  2DY8 A;  3BDL A;  1QG7 A;  2E2I B;  3Q8D A;  2RQX A;  3JAM c;  2EPB A;  4HSP A;  2OTL A;  2ZTE A;  2IX1 A;  1LTI D;  3FRP B;  1PFN A;  4RAU C;  1HR0 Q;  1EFW A;  2WKD A;  4JI1 L;  2D0P A;  5IP9 G;  4K6L A;  5J39 A;  2F4I A;  1GUT A;  5C0X G;  1TS5 A;  4RWS C;  1EU4 A;  5C3E H;  5E3F A;  3UE1 A;  3PO3 G;  3A54 A;  1YBY A;  3HZX A;  4BS9 A;  1Y1W B;  3NEM A;  2LY7 A;  1PH8 A;  1IKM A;  2IHF A;  3MXN B;  1VQ5 A;  4H02 A;  2E2J H;  3K5N A;  5CMD A;  2JA6 B;  1HZ9 A;  2JA7 H;  4MHE A;  1X3G A;  1F2Z A;  2RSO A;  5M3M B;  4R4C A;  3HOX G;  4BXX G;  1GVP A;  4A3E G;  1UE7 A;  4RGM A;  5IGC A;  4MTK A;  1LTR D;  4ZKB B;  4K0K L;  2K32 A;  4R8I A;  2AQ2 B;  4CKC A;  2E76 C;  2MFI A;  2Z6B A;  3I72 A;  2TSS A;  2F1M A;  2CHB D;  2B2W C;  2ZM6 L;  2F0F A;  1ML0 D;  1BQQ T;  3CXC A;  3H0G B;  4GN3 B;  4DR2 L;  2KHS A;  3CCJ A;  5EGT A;  5GRO A;  3GTL B;  4PMC A;  4X3S A;  2NVX H;  3I4N G;  2WV6 D;  3I90 A;  2A1A A;  2YTX A;  4IOC A;  1X3F A;  2UXB Q;  1SEB D;  2CH4 A;  1PMR A;  1BBX C;  4CDC C;  1I6V C;  3GTJ H;  3KJO A;  1ICF B;  1CT1 D;  1XTD A;  1VQM A;  1CFM A;  3BG3 A;  3EN2 A;  2IWH A;  4K5W A;  1WTV A;  4YHH Q;  2CWA A;  4WJ4 A;  3MEF A;  2R7F A;  3J81 i;  2E5L Q;  1JJ2 A;  3J7Z C;  3CCV A;  1CSQ A;  4DV6 Q;  4BBR B;  1KL9 A;  3DWP A;  3GTQ B;  1CK1 A;  3ERS X;  1FNU A;  4FXD A;  4A3J B;  3CQZ H;  3PV0 A;  5A35 A;  2D2C C;  5DM6 3;  1JMC A;  1STY A;  1C8C A;  1A6X A;  3ULL A;  1KRS A;  5C44 B;  1V1O A;  1H9K A;  4WJW A;  1ZKO A;  2BDN A;  2IPK D;  2QW7 A;  5HUR A;  1V9P A;  4DU9 A;  5ELB A;  2ICE C;  3R3O A;  3S1N H;  2BE5 D;  3NXW A;  5GQO A;  2ZJR A;  4FYD A;  4OIJ A;  1S40 A;  2A19 A;  4R1J A;  1PHJ A;  3U50 C;  2EY6 A;  3V2T A;  4GKK Q;  3E0J A;  3M4O B;  2RKS A;  1K8A C;  2F4V Q;  2CKZ B;  4UPA A;  3BVZ A;  2MUY A;  1F9S A;  1KTK A;  3NQT A;  5KIX A;  3S17 H;  3GP7 A;  5C4X B;  2ATW A;  2BH2 A;  2YTY A;  3KK7 A;  4IPG A;  4DV3 Q;  3TP7 A;  1HNX L;  2PI2 E;  3GTM B;  4GOP A;  2HDL A;  3RN5 A;  1D1K A;  1PDQ A;  2F0P A;  3HKZ E;  1RJT A;  2EY1 A;  1CZG A;  4X66 L;  3K8A A;  1WCM B;  3OW7 A;  5IGE A;  4QF4 A;  1YHB A;  2RCN A;  3T56 B;  3BS1 A;  4P73 A;  3CME A;  1AE2 A;  3NQI A;  2PQE A;  3CHB D;  1N9W A;  4ALP A;  1J5E L;  1TU2 B;  4RH6 A;  1JOR A;  1OXT A;  3SK5 A;  4JI2 Q;  2YU9 H;  4A3D B;  2R7Z H;  4U67 3;  2KCM A;  1CI3 M;  3DEP A;  3DLL A;  1EY4 A;  4FO2 A;  5ELF A;  3NEL A;  5LMU L;  5IWA Q;  2CW0 C;  2RDH A;  5GAG C;  2B2V A;  1PFB A;  1WTW A;  1O7L A;  4KHV A;  3KJP A;  2NVT H;  4HED A;  3M9B A;  4DXG A;  3D6C A;  4IFD H;  2F0I A;  1HUN A;  3CCU A;  3NUC A;  5C3E B;  5IE8 A;  4NXN Q;  2VNU D;  1BCP D;  4S3S A;  2OQK A;  1YHQ A;  2RDG A;  5C4J H;  3A5U A;  1M90 C;  2DUD A;  2CFM A;  1JB3 A;  4R4Q A;  4P2C B;  4XTC S;  1FGU A;  1WI5 A;  2JA7 B;  4A3B H;  1BNZ A;  1QUQ A;  1YIJ A;  1UNS A;  4DK1 A;  2A6E C;  3MWY W;  5GAH C;  1D1I A;  1Y1W G;  3QG1 A;  2VB2 X;  2R93 H;  1IHZ A;  2B29 A;  3PF4 A;  2DJG C;  2PW7 A;  5JVH 3;  2JA6 G;  1J8I A;  5ELD A;  3AFP A;  1NCV A;  4L5T A;  1ZYR C;  2B39 A;  3JAM i;  1I94 L;  4X3K A;  4DR6 Q;  4DV4 L;  1IZ6 A;  3EJI A;  4ZCK A;  3PUY A;  2PZU A;  2AWN A;  3M4Q A;  4KKT A;  4N8F A;  1DOM A;  5KGU A;  3ER0 A;  2D0O A;  2FMC A;  1G2S A;  4NXM L;  3CCM A;  1IBM Q;  1G8Z D;  2OTJ A;  1YZ6 A;  4JBW A;  5M3F B;  3R8B A;  3H3V I;  1I4P A;  3NK9 A;  3RMH A;  3T16 A;  5I9P A;  2F0W A;  4KHZ A;  1IBL L;  1N36 L;  2PMZ E;  2K5V A;  4X64 L;  3LNN A;  2PZT A;  1LT3 D;  2HHH L;  1L1O C;  3HFZ B;  2IL8 A;  4PZ7 A;  1I5F A;  2DN8 A;  2K7V A;  4DR1 L;  1V1P A;  1E2Z A;  3FVQ A;  2QF7 A;  1B44 D;  3HOZ G;  3WOF A;  1SNC A;  4DAV A;  3CP0 A;  2UXD Q;  3RLF A;  2B63 B;  2F0J A;  3PO2 G;  1VQN A;  3STB C;  3V05 A;  1S3O A;  2UUB Q;  2G9H D;  1VQI A;  4BBR G;  5M5X H;  4FXK C;  3U9S A;  4DF7 A;  5BR8 Q;  3DUZ A;  2MQH A;  4A3J G;  3AU7 A;  1U5K A;  1C7Y A;  4J6H A;  4JW0 A;  3J80 c;  4R4O A;  4IUP A;  4EX5 A;  3HOV B;  1WFQ A;  4FF4 A;  1VS0 A;  1SJH D;  2FJ2 A;  4QB4 A;  2SDF A;  3D6W A;  3S17 B;  1CA6 A;  1BCP B;  3VR5 A;  3CPW A;  1JT8 A;  3PIP 3;  1QIL A;  4JI3 L;  2B2Y A;  1QJO A;  1QNK A;  3HP3 A;  3KLS X;  1PH6 A;  2N78 A;  2B2T A;  4C1N I;  1TXY A;  4LFA Q;  1Q1B A;  2A68 C;  2EDG A;  5IYD G;  4ULL A;  1B7Y B;  1T5E A;  5C4X G;  1TS3 A;  2K14 A;  5I9O A;  5T1G A;  4QJF A;  4LMQ D;  5E4W C;  2IT1 A;  4G4K A;  1ILP A;  2CVR A;  1Z7T A;  3G7L A;  5EJW A;  2JN4 A;  4LW1 A;  3EVQ A;  4YCU A;  3VR6 A;  1JOO A;  2UU9 L;  2YU9 B;  3FP9 A;  2PQA A;  2R7Z B;  3MXU A;  5C4H A;  2R61 A;  1F9R A;  2ZJP A;  1I4G A;  1HA5 A;  4MZ9 A;  2NZH A;  2Q8T A;  1SDF A;  2MP1 A;  1KAA A;  1K9M C;  1D8L A;  1OO9 B;  1STA A;  4H44 C;  4A3D G;  5AJ3 L;  2RBM A;  1CQF A;  2I5M X;  1KQS A;  3KLR A;  3RZO H;  3I56 A;  3V96 A;  3LWE A;  2ASB A;  3RN2 A;  4IJH A;  1M4V A;  5C4J B;  1VQ8 A;  1QNU A;  1HNZ L;  4RGT A;  1MD2 D;  3HOW H;  4ODG A;  4B3M Q;  2GVB A;  4AYB E;  3RUZ A;  3TP6 A;  4JBJ A;  4BY1 H;  1HQM C;  1BO0 A;  4RHS A;  2EQS A;  2F0S A;  3E9H A;  3GTK H;  5C3E G;  3U58 A;  4TRD A;  1BCP F;  5EKI A;  4LF4 Q;  2IHE A;  3CRK C;  4CJ0 B;  5I2Y A;  1VQ6 A;  3A8K E;  1NMG A;  3RZD B;  1B3Q A;  1I6H B;  1E0B A;  1X3E A;  3NWS A;  5JOB A;  2UUC Q;  4RGN A;  2PQA B;  2JA7 G;  4UHV A;  3S1M H;  1KHI A;  2ENB A;  2NWG A;  2MPM A;  1LAB A;  2F0O A;  4U68 A;  1JC7 A;  1HQR D;  1VQP A;  2P5Z X;  1M8A A;  1TWA B;  5LL6 S;  4H13 C;  2M00 A;  4LFC Q;  1X54 A;  3T51 B;  4KHP Q;  1DYQ A;  5L37 A;  3A56 A;  4POG A;  1XNQ L;  4DV2 Q;  4RFB A;  4B3R Q;  3BZK A;  1QE6 A;  3G6J B;  4FDB A;  5TSS A;  4JOI A;  2Y0S E;  1W3S A;  4TVA B;  2L55 A;  1Q82 C;  2F0H A;  2I46 A;  1T9H A;  3KF8 A;  2O5J C;  2ICI A;  5AFW A;  4CJ1 B;  4F88 A;  3I4M B;  2BH8 A;  2Y0S B;  1E1O A;  5M3F G;  3S1R H;  1R9T H;  1E3P A;  2FFK B;  3J81 j;  3CC2 A;  4A3E B;  1HR0 L;  2K4K A;  4LFB Q;  3HG9 A; 
#chains in the Genus database with same CATH homology
 3EBE A;  1VQC A;  4JC0 A;  4DAY B;  1A0I A;  2NZO A;  1K83 H;  2DGY A;  1XMQ Q;  4JI7 Q;  2NVQ H;  2ES2 A;  4A93 H;  4XIG S;  1FL0 A;  3Q8D A;  4DV0 Q;  3JAM c;  3CMA A;  4X65 Q;  3H15 A;  1PH5 A;  2OTL A;  1CKN B;  2ZTE A;  5JEA J;  2IX1 A;  1N32 L;  1BKB A;  1Q12 A;  1TWG H;  3FKI G;  4LUO A;  2EXD A;  4P71 A;  1PH3 A;  4JI1 L;  1HR0 Q;  1EFW A;  2D0P A;  1TWC H;  5IP9 G;  2ZJQ A;  2YTV A;  4IJL A;  5EAY A;  5IYC H;  2MNA A;  4BBS H;  4O0A A;  5C0X G;  3KYH C;  1PH9 A;  5C3E H;  1O7I A;  4DUY L;  3UE1 A;  3S2D H;  4DPG A;  4C2M H;  1EWI A;  5M5Y H;  1YBY A;  3F2C A;  4AQY L;  3PO3 G;  4QY7 A;  3NEM A;  1N32 Q;  1IBK L;  2H5X A;  1PH2 A;  1PH8 A;  3H3V H;  4JI1 Q;  1TWH H;  2IHF A;  3MXN B;  1VQ5 A;  4H02 A;  5IYB H;  2E2J H;  1VQA A;  1HZ9 A;  2JA7 H;  3K7U C;  1N8R C;  2R92 H;  1OXU A;  1X3G A;  4DUY Q;  4B3S L;  3EIV A;  2N49 A;  4GNX A;  2K5N A;  3HOV G;  4AQY Q;  3TQY A;  4R4C A;  3BJU A;  1LUZ A;  1K73 C;  1IBK Q;  2CQO A;  3KF8 B;  3TEH B;  3HOX G;  3T1H Q;  4UY8 C;  3HOY H;  3NEN A;  4BXX G;  1I3Q H;  1Q1E A;  4LUZ A;  5DLQ E;  1GVP A;  1LTL A;  4A3E G;  1SFO H;  1UE7 A;  4RMF A;  1YVC A;  4UP8 A;  4A3L H;  1C0A A;  3GD7 A;  4P75 A;  2CCZ A;  4K0K L;  4J15 A;  4JOI C;  4B3S Q;  2JEA I;  3E0E A;  4Y52 H;  2MFI A;  1YJN A;  2NVY H;  1U0L A;  3F8T A;  2ZM6 L;  4A93 G;  1V43 A;  1KC8 C;  5GAE C;  2UXB L;  3I2Z A;  3DM3 A;  3CXC A;  4C3H H;  4GN3 B;  3CCR A;  4DR2 L;  3KDF A;  3CCJ A;  4K0K Q;  3SGI A;  3CCQ A;  5GRO A;  1HZC A;  4QIW E;  3J80 i;  4IO9 A;  2NVX H;  3I4N G;  4IPC A;  2A1A A;  2YTX A;  2ZM6 Q;  1EYG A;  1YNX A;  4YHH L;  4IOC A;  3ULP A;  1X3F A;  4BY7 H;  2E5L L;  3S15 H;  2UXB Q;  5H1S E;  4DV5 L;  1JJC B;  4DR2 Q;  3GTJ H;  2QEX A;  3KJO A;  4DV6 L;  3RZD H;  2R7Z G;  1I6H H;  4A75 A;  1G6P A;  1XTD A;  1AE3 A;  3T1Y L;  1VQM A;  2E2H H;  3EN2 A;  5M3M G;  4GLV B;  3B6Y A;  5HGQ A;  2CWA A;  4YHH Q;  4WJ4 A;  3UDG A;  3MEF A;  2R7F A;  3J81 i;  2E5L Q;  4DV5 Q;  2R6G A;  1Q8K A;  1JJ2 A;  3J7Z C;  2Q2H A;  4IPD A;  1XMO L;  2JA8 H;  3U4Z A;  1CSQ A;  3CCV A;  4GNX B;  4DV6 Q;  2LXJ A;  1NMF A;  1KL9 A;  4YWL A;  4DUZ L;  3T1Y Q;  3ERS X;  2WAQ E;  3CQZ H;  3PV0 A;  4O2D A;  4PMW A;  4DAM A;  4IFD G;  1JB7 A;  1TWA H;  1JMC A;  3UDX A;  3FHW A;  1BVS A;  1NY4 A;  3ULL A;  1KRS A;  1XMO Q;  1QVC A;  1KAW A;  3H0G G;  4OO1 G;  1FJG L;  1HJP A;  4DUZ Q;  3D0F A;  2F4V L;  1V9P A;  5LMN L;  3M3Y H;  3PO3 H;  4A3F H;  3S1N H;  3A0J A;  1VQD A;  2RF4 A;  4YY3 L;  2HIV A;  1UE1 A;  1KD1 C;  5GQO A;  1Z47 A;  2ZJR A;  1RIP A;  1S40 A;  4HIO A;  2A19 A;  4R1J A;  3RLN A;  4HJA A;  1PHJ A;  4LF8 L;  3S16 H;  3U50 C;  4KI0 A;  1FJG Q;  1GD7 A;  1N33 L;  3I4M H;  4GKK Q;  3K80 C;  5FJ8 G;  1HZB A;  3L2P A;  1W2B A;  4BY7 G;  4LFB L;  4EQ5 A;  1K8A C;  2F4V Q;  2CKZ B;  1C9O A;  3KLW A;  2IY5 B;  4UPA A;  5JJK A;  4YY3 Q;  3HOX H;  5K36 G;  2VS1 A;  1PH1 A;  3S17 H;  4A3E H;  1K3R A;  1SMX A;  3D31 A;  2ATW A;  4LF8 Q;  2BH2 A;  2YTY A;  3TS0 A;  3TS2 A;  1YHA A;  3M85 A;  1NJI C;  1N33 Q;  4IPG A;  4HJ8 A;  4JI0 L;  4DV3 Q;  3HKS A;  1HNX L;  2PI2 E;  1VQ7 A;  1X6O A;  3ICE A;  2AWO A;  3F1Z A;  4GOP A;  1VQL A;  2E2I H;  2JA8 G;  4DR4 L;  2VL6 A;  4GKJ L;  3F2D A;  2L15 A;  3RN5 A;  2AKW B;  2WP8 J;  4LF7 L;  2JEB I;  3HKZ E;  4HJ5 A;  3CAM A;  3K8A A;  4X66 L;  1VQE A;  4GS3 A;  1K0R A;  4PG3 A;  3CC4 A;  3M7N A;  1SRO A;  4JI2 L;  1B70 B;  3UDI A;  1YHB A;  2RCN A;  2WAQ G;  4JI0 Q;  5C44 G;  1OXX K;  4YCW A;  1HNX Q;  4P74 A;  1X55 A;  4DR4 Q;  3I4N H;  3PUV A;  4GKJ Q;  5FLM H;  3CF5 A;  3W1G A;  5IWA L;  2OCE A;  4P73 A;  3AQQ A;  4LF7 Q;  3CME A;  1VCI A;  2QA4 A;  1AE2 A;  4X66 Q;  4ALP A;  1N9W A;  1I50 H;  1VQO A;  1J5E L;  1LYL A;  1DGS A;  1V1Q A;  1OXT A;  3JC6 6;  5C0X J;  4JI2 Q;  4A3F G;  2YU9 H;  1QVF A;  3T1H L;  2R7Z H;  4MNO A;  1OTC A;  2KCM A;  3DLL A;  4LF6 L;  1JE5 A;  2WB1 E;  1P16 A;  5M3M H;  1H95 A;  3NEL A;  1YEZ A;  5IWA Q;  5LMU L;  3I4M G;  2Y0S G;  4R4I A;  2Q2U A;  5GAG C;  1EOV A;  4JI5 L;  1VQ4 A;  4NXN L;  5IY0 A;  1J5E Q;  2JA5 H;  4APV A;  3PGZ A;  4A3G H;  1PYS B;  4UP7 A;  2HIX A;  4L5Q A;  2ID0 A;  3GDE A;  3KJP A;  4LF6 Q;  2NVT H;  3M9B A;  5LMU Q;  5C0X I;  3CCU A;  1IXR A;  2UXC L;  3RR5 A;  5IE8 A;  3GTG H;  2BA0 A;  4JI5 Q;  4P72 A;  4NXN Q;  2VNU D;  1IL2 A;  2OQK A;  2RHQ B;  2I5L X;  1YHQ A;  3KFU A;  3H0G H;  1WCM G;  5C4J H;  3G71 A;  1HR0 W;  1OXS C;  4YCV A;  4Y7N H;  3A5U A;  2ZTD A;  2DUD A;  1M90 C;  1KIX A;  2CFM A;  3ULJ A;  3OYY A;  4R4Q A;  1QVG A;  4XTC S;  1XJV A;  1KRT A;  1FGU A;  1WI5 A;  3GTL H;  3HKZ G;  4A3B H;  3S1Q H;  3CCL A;  2UXC Q;  2NN6 I;  1QUQ A;  1YIJ A;  2OWO A;  1BBU A;  4NPS A;  3GO5 A;  5GAD C;  5FLM G;  5GAH C;  5FJ8 H;  1Y1W G;  1IYJ B;  4OWX B;  4GOP C;  1TWF H;  4DR6 L;  2R93 H;  1A63 A;  2B29 A;  3F2B A;  4L5S A;  2V1C C;  3PF4 A;  1VQK A;  1ASY A;  4A3M G;  4PZ6 A;  1SR3 A;  3VDY A;  3OTO L;  2JA6 G;  1J6Q A;  1B8A A;  5IP7 H;  5FLX c;  4JBM A;  1WJJ A;  1EQR A;  3AFP A;  3U4V A;  4L5T A;  1E7Z A;  3AFQ A;  2GN5 A;  3JAM i;  2WB1 G;  3PIO A;  1I94 L;  4DR6 Q;  2KHJ A;  4DV4 L;  1IZ6 A;  1X56 A;  1IBM L;  2JQO A;  2JA5 G;  3GTQ H;  3PUY A;  4DK3 C;  4A3G G;  4JI6 L;  3RNU A;  2AWN A;  2KBN A;  3M4Q A;  3CCE A;  4HID A;  4NB3 A;  3OTO Q;  4JI8 L;  3ER0 A;  4GN5 A;  5JJL A;  4GLA C;  3UE0 A;  4DV7 Q;  5C44 H;  1S72 A;  2D0O A;  1I94 Q;  3L0O A;  4DV4 Q;  1CSP A;  3BZC A;  4NXM L;  3CCM A;  4HIM A;  1IBM Q;  4LF9 Q;  4IFD J;  1YZ6 A;  2OTJ A;  1FVI A;  4JBW A;  4JI6 Q;  2VY3 A;  4QGU A;  4GKK L;  3H3V I;  2VZA A;  2KCT A;  3K81 C;  4B3T Q;  4A3I H;  3PCO B;  4JI8 Q;  4LF5 L;  4KHZ A;  1IBL L;  1Y14 B;  1N36 L;  2PMZ E;  2K5V A;  2JA9 A;  3J7A 5;  4A3B G;  4X64 L;  1YJW A;  3KDF B;  3W1B A;  1L1O C;  2HHH L;  1G29 1;  4NXM Q;  3HFZ B;  2MO0 A;  5IT9 c;  3M4O H;  2UXD L;  4OWT B;  1I5F A;  4PZ7 A;  4DR1 L;  1BBW A;  2JE6 I;  4WJ3 M;  1Y1V G;  2UUB L;  4DV3 L;  3I55 A;  1WYD A;  3WWV A;  1A62 A;  1X65 A;  1VQG A;  1IBL Q;  2K5H A;  1N36 Q;  2WFW A;  1M1K C;  4LF5 Q;  3A74 A;  3HOZ G;  1MKH A;  1PFS A;  1UEB A;  4OXP A;  5BR8 L;  1PVO A;  3CP0 A;  1UE6 A;  4R4T A;  4X64 Q;  1XPU A;  3HOU G;  2ZTC A;  2HHH Q;  5ELO A;  3RLF A;  2VQE Q;  2UXD Q;  5IP7 G;  3PO2 G;  3GTM H;  4DR1 Q;  3A5Z B;  3TRE A;  4GLX A;  3STB C;  1YJ9 A;  1VQN A;  1S3O A;  2IX0 A;  2UUB Q;  5J3B A;  1VQI A;  1N34 L;  3KF6 A;  4BBR G;  5M5X H;  4HJ7 A;  1SE8 A;  2Z6K C;  4BY1 G;  3S2H H;  1HZA A;  1WCM H;  2K75 A;  5BR8 Q;  2MQH A;  5E7N A;  4A3J G;  3W5O A;  2A8V A;  1U5K A;  2LXK A;  1Q81 C;  1PA6 A;  1C7Y A;  4HJ9 A;  1EUJ A;  2KEN A;  3STB D;  1PH7 A;  3J80 c;  3IRB A;  4R4O A;  4DV1 L;  2R93 G;  4EX5 A;  1N34 Q;  1WFQ A;  3G48 A;  1WOC A;  1VS0 A;  1JJG A;  1SLJ A;  3I7F A;  2VQF L;  1NE3 A;  4LFA L;  1Y1W H;  4DR7 L;  2I5H A;  4A3I G;  3CC7 A;  4DK6 C;  4A3M H;  1EIF A;  2E8G A;  3CPW A;  4DV1 Q;  4JI3 L;  1JT8 A;  2HT1 A;  4PZ8 A;  2JA6 H;  5LMN W;  1ASZ A;  5JEA G;  1E22 A;  1PH6 A;  2N78 A;  3J81 c;  4YWK A;  1CKO A;  1TXY A;  4LFA Q;  1Q1B A;  2VQF Q;  1GO3 E;  3CD6 A;  4DR7 Q;  3NBH B;  1XPR A;  4HIK A;  5IYD G;  2OQ0 A;  1B7Y B;  1Z9F A;  2F52 A;  2RHS B;  4DNI A;  4JG2 A;  2K14 A;  5C4X G;  2B63 G;  1AH9 A;  4JI3 Q;  4A3K G;  1UWV A;  4QJF A;  1E24 A;  4DKA C;  2IT1 A;  1XNR L;  3S14 H;  4JCV E;  2Q2I A;  2XTI A;  3I4O A;  1NTG A;  1L1O A;  1L0W A;  4A3C G;  2N8N A;  4LW1 A;  1KXL A;  4IPH A;  2YYZ A;  4YCU A;  5JJI A;  2UU9 L;  3FP9 A;  4GN4 B;  2PQA A;  3KF6 B;  3UDF A;  2I0Q A;  4LNQ A;  4GOP B;  2CWP A;  1XNR Q;  4BA2 I;  1PH4 A;  4KLK A;  2ZJP A;  2NN6 G;  4A76 A;  2JK8 A;  4MZ9 A;  3BU2 A;  4JV5 L;  4AH6 A;  2NZH A;  1SN8 A;  2VUM H;  1D7Q A;  4ME3 A;  2AHO B;  3PF5 A;  1K8G A;  3TRZ A;  1QZH A;  3AYH B;  1PV4 A;  3LGJ A;  2UU9 Q;  4DR5 L;  2Z6K A;  1K9M C;  1D8L A;  1Y1V H;  1VQ9 A;  4OX9 L;  4LWC A;  1L2F A;  1NBW A;  4X62 L;  4B3M L;  4A3D G;  4JI4 L;  5AJ3 L;  3HOZ H;  1G51 A;  2I5M X;  1KQS A;  2VW9 A;  2K52 A;  3RZO H;  2B3G A;  4JV5 Q;  3I56 A;  1P8L A;  2PNH A;  3K7A H;  2Z0S A;  3HOU H;  2GVA A;  2ASB A;  3RN2 A;  4IJH A;  4DR5 Q;  3PO2 H;  3CW2 C;  1VQ8 A;  4LF4 L;  4OX9 Q;  1HNZ L;  4DR3 L;  4JYA L;  4DV7 L;  4X62 Q;  3HOW H;  1MIU A;  4B3M Q;  4BBR H;  2GVB A;  4AYB E;  4JI4 Q;  5AJ3 Q;  4BY1 H;  4JBJ A;  4JBK A;  4LF9 L;  3OW2 A;  4AIM A;  1Q46 A;  2JJQ A;  5IYC G;  3G6E A;  2YV5 A;  4A3J H;  4BBS G;  2FXQ A;  1CKM A;  3E9I A;  1GKH A;  2EQS A;  3E9H A;  3PIP A;  5C3E G;  2UUC L;  3U58 A;  3PUX A;  4B3T L;  3GTK H;  1VQJ A;  2ALY B;  4LF4 Q;  1GM5 A;  1HNZ Q;  2IHE A;  2LSS A;  3K0X A;  4RG1 A;  4DR3 Q;  3CPF A;  4OWW B;  4JYA Q;  5M3F H;  1L1O B;  1VQH A;  2BA1 A;  4UP9 A;  2AMC B;  5M5W H;  4QQB X;  3PSI A;  4QL5 A;  5IYB G;  1VQ6 A;  1NMG A;  1EQQ A;  3ZJY C;  1E1T A;  4A4I A;  1X3E A;  2N3S A;  2UUC Q;  2JA7 G;  2R92 G;  2PQA B;  2XGT A;  4TQU S;  1X9N A;  3KOJ A;  3S1M H;  1XPO A;  1KHI A;  4LFC L;  3HOY G;  2VUM G;  2PI2 A;  1HH2 P;  4MTN A;  1CKN A;  2MO1 A;  2VQE L;  1PYB A;  1Q86 C;  1MJE A;  4KHP L;  1VQP A;  1QUQ B;  2KHI A;  1EIY B;  4A3L G;  3GTO H;  3AEV A;  2K50 A;  3PUZ A;  4DV2 L;  3FKI H;  4B3R L;  5IYD H;  3RLO A;  5ELN A;  2F3I A;  1OXV A;  4POF A;  3G4S A;  5C4X H;  5IP9 H;  4IFD I;  2B63 H;  4A3K H;  4LFC Q;  1X54 A;  1QZG A;  4GNX C;  2R7D A;  2UUA L;  4KHP Q;  1UE5 A;  3M4P A;  1HNW L;  4L5R C;  1VQB A;  4POG A;  1A8V A;  4A3C H;  1XNQ L;  4OO1 I;  3S24 A;  4DV2 Q;  3HOW G;  4B3R Q;  2C35 B;  3BZK A;  1YI2 A;  4X6A H;  4FDB A;  4JOI A;  4OON A;  2Y0S E;  4C3I H;  1RL2 A;  1W3S A;  4TVA B;  4AYB G;  3GTP H;  3PUW A;  2Q2T A;  4LUV A;  2UUA Q;  1Q82 C;  1YIT A;  1T9H A;  1MJC A;  2D62 A;  5LMN Q;  3HOV H;  1HNW Q;  4C3J H;  2BH8 A;  1XNQ Q;  1Q7Y C;  2QGQ A;  1XMQ L;  4JI7 L;  5HY6 A;  1E1O A;  4BXX H;  5M3F G;  3S1R H;  2HQL A;  1R9T H;  4DV0 L;  1LM0 A;  1E3P A;  2EIF A;  4X65 L;  3J81 j;  3CC2 A;  1CUK A;  3CCS A;  1SRU A;  3L7Z C;  4A3D H;  1VQF A;  4YWM A;  2K4K A;  1HR0 L;  4BA1 I;  4LFB Q;  4IOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...