4HJ9A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (cggttacggt)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
total genus 37
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj9A00
1WI5A 3GTLH 4GNXA 1Y1VH 3D0FA 1NBWA 4YWLA 4JI6L 4IFDJ 3JAMi 1VQCA 3OYYA 4GS3A 4AYBG 3JAMc 3KJOA 1IBKL 1YJNA 4R4TA 1FJGL 4JV5Q 3S1MH 2JA5H 2BH2A 1KIXA 2NZOA 2ZJRA 1Q81C 2B63H 3KDFA 4GOPB 5IT9c 1X54A 4R4IA 4K0KL 1EOVA 2HQLA 4A93H 3PIOA 3CAMA 3CCUA 1XJVA 4LF5Q 3GO5A 1KQSA 3STBC 2WAQE 3EIVA 1Q7YC 3GTOH 4JBMA 4RG1A 1VQLA 4LF6Q 1VQEA 5J3BA 4NPSA 3MEFA 1BBWA 1X55A 5IYCH 1OTCA 3CCLA 2V1CC 4R4CA 1VQHA 2IY5B 4A3CH 3I4MG 4KHPQ 1TWAH 1YNXA 3GTPH 3PO2H 2HIXA 4A3JH 1V1QA 4LW1A 1C9OA 1GKHA 3RLOA 5GAGC 2YU9H 3CC7A 4JI4L 4LF7Q 4LF6L 3L2PA 2ES2A 4LNQA 3CF5A 3KOJA 1GM5A 3I56A 4DV3Q 4A3FH 3HOWH 4WJ3M 2KHIA 1KAWA 1Q46A 5LMNL 4A3IG 4X65L 1SE8A 1RIPA 3FKIH 2BH8A 2FXQA 1J5EQ 2E5LL 1KHIA 4JI2Q 2AWOA 1VQ8A 4JI8L 4DAYB 4LF7L 4O2DA 1XMQQ 2EQSA 4A3LG 2JK8A 2JA8G 4DK3C 3NEMA 3HOYH 4A3IH 1HNXQ 4DV3L 1KRSA 2CFMA 4X64L 3HOVH 4XTCS 1SFOH 4LWCA 4DV7L 1N34L 1J5EL 2JA8H 4APVA 4A3LH 1X56A 3NENA 4PMWA 2ASBA 1PYSB 4HIDA 2Q2UA 3S17H 4A3DG 1I3QH 3D31A 1PH7A 2C35B 3OTOL 1Y1WH 3H0GG 1HNXL 3UDGA 4C3IH 3M4QA 4X64Q 5C44H 2JA7H 1BKBA 3J81j 2UUAQ 4IOAA 5IP9G 4AH6A 1MJEA 2NN6I 4DKAC 5C0XI 4HJ7A 1VQ7A 3CCJA 2I5MX 2JEBI 3OTOQ 5IP9H 4AIMA 3I2ZA 3U50C 1IL2A 1GO3E 1VQOA 3ICEA 5FLMG 4DUYQ 1Q1BA 3HKZE 4QIWE 4YY3L 3GTKH 1YHAA 2ATWA 2VZAA 4KHPL 4IFDG 1XPOA 3S15H 3PUXA 2B63G 4YCWA 1U5KA 2GN5A 4L5SA 5GAEC 3RN2A 4HIOA 1VQKA 2IHFA 4DR1L 3L7ZC 3RR5A 1E7ZA 3W1BA 5M5XH 4BXXG 5FJ8H 1IZ6A 3CC2A 1VQNA 1VQAA 4DK6C 4BY7H 1JE5A 1Q82C 1JB7A 2E5LQ 4A3EG 1L1OA 1TWFH 1NY4A 3L0OA 4PZ6A 1CSPA 3F2BA 4JI8Q 3S1RH 1HR0W 1JMCA 1N33L 4GNXC 1XMQL 2IX1A 3KF6B 4TVAB 3J80i 2PI2E 3K8AA 4LFCL 3HOXH 1PH6A 3AQQA 2XGTA 5C3EH 3CXCA 4A3KH 2QEXA 4DV2Q 4QL5A 1JT8A 4OONA 3KF8B 1PH9A 2NZHA 2WB1G 3CCSA 4MNOA 4DV7Q 1N34Q 4ME3A 4FDBA 1YJ9A 1MJCA 3S2DH 3Q8DA 4DR6L 1PVOA 1G6PA 2E8GA 1EYGA 2R7DA 4UP8A 4LF8L 4LFCQ 3NELA 1K73C 2VL6A 2R93G 1EQRA 2RHQB 2OQKA 1RL2A 3CMEA 3F8TA 3A5UA 4P73A 4GLAC 2B29A 4NXMQ 1VQ4A 3ULPA 1GVPA 2XTIA 4AQYQ 1KD1C 2UUAL 1JJCB 4IPDA 3ERSX 1NMFA 1G291 4BY1G 4HJAA 4A3GG 3KDFB 5LMNW 4GOPA 2Y0SG 1EQQA 5JJLA 5IP7H 1YI2A 2JA6G 3KYHC 1OXSC 4IPHA 4LFBL 1SROA 1YBYA 4YCUA 4DUYL 1BVSA 4NXML 4AQYL 1XNRL 4YY3Q 4GN4B 4JCVE 1HZAA 2L15A 2OCEA 4X66L 3I4MH 2VQEQ 3TQYA 4L5RC 3CC4A 2IHEA 1DGSA 3F1ZA 4JYAL 5IP7G 3TRZA 3CCQA 2R7ZH 3PSIA 4DR1Q 2ZJQA 2HHHQ 4GNXB 1P16A 4DR7L 1HZBA 4LF9Q 1XNRQ 2F4VQ 1AE2A 4UP9A 1Y1VG 3T1HQ 2K5HA 2ZTDA 5IE8A 1XNQL 1Y1WG 1S3OA 1MKHA 3TS0A 4P71A 4WJ4A 1V9PA 1J6QA 1N33Q 1UE6A 3U58A 4QJFA 4C2MH 4DR5L 1PA6A 4A75A 2D0OA 1X3GA 4KHZA 4MTNA 5HY6A 3RNUA 1HZCA 3U4ZA 1CSQA 4DV2L 3K81C 4BA2I 2F4VL 3S1NH 3HOVG 4DR2Q 3SGIA 2UXBQ 3STBD 2JE6I 1XNQQ 2PNHA 4JI7Q 4DR6Q 2MO1A 5FJ8G 4YCVA 5M3FH 1E1TA 2MQHA 3AFPA 4LF8Q 2CWAA 2IX0A 5K36G 5ELNA 2Z6KC 4AYBE 3MXNB 4A3JG 1PHJA 3PUZA 2ZJPA 1PFSA 4DV4L 3EN2A 1X65A 3A74A 2OTLA 4JI7L 1HNWL 3PCOB 1E1OA 3CW2C 4BXXH 2VS1A 4B3ML 3E9HA 1QVCA 5JJIA 1WYDA 5FLXc 3BJUA 1K8AC 4LFBQ 3PO2G 3G4SA 5LMUL 5FLMH 3J81i 3RN5A 4X66Q 4L5TA 4P75A 2VQEL 4GOPC 3K0XA 1UE5A 1VQDA 4C3HH 1CKNA 1VQ9A 4JYAQ 4B3MQ 3PO3G 2N49A 3TS2A 4A3MG 1WCMG 2JEAI 2HHHL 1GD7A 4DR7Q 2ID0A 3I4NH 4LF9L 4BY1H 3FP9A 2R6GA 1Q8KA 5LMUQ 4A3GH 3T1HL 4KLKA 2RCNA 1FGUA 1EWIA 4DR3Q 2QGQA 1EIFA 1VQBA 4GKKL 4DR5Q 2WB1E 3H0GH 1UWVA 2RF4A 3M9BA 4IOCA 1I6HH 5JEAJ 1QZGA 4DR2L 2K14A 3KF6A 1SLJA 1TWCH 2UUCQ 2UXBL 1IYJB 1CUKA 4DR3L 1N36L 2I5HA 4BBRG 2AHOB 4A3MH 2E2HH 4YWKA 4IPCA 4ALPA 2RHSB 4R4QA 3ULLA 4EQ5A 1T9HA 3K80C 2UU9Q 3S1QH 2KBNA 5M3MG 1FVIA 2NVQH 1VQMA 2ZM6L 3K7AH 3HOWG 4LFAL 2Y0SE 2B3GA 1SRUA 1N8RC 4DV4Q 2Q2HA 1SR3A 3J7A5 2A1AA 1HNWQ 1VS0A 3S24A 1EFWA 3CCEA 2DUDA 2R7ZG 4JBWA 5M5YH 3CD6A 1KL9A 1KRTA 4BBSG 1K0RA 2UU9L 2KENA 2YV5A 4PG3A 4QGUA 5ELOA 4OWWB 1K83H 2VUMG 2CQOA 1HZ9A 1QVGA 3DLLA 2BA1A 2ZM6Q 1HNZL 3W5OA 2NVXH 3VDYA 1VQ5A 1PH2A 3OW2A 4OXPA 2MFIA 2MO0A 4TQUS 1I94Q 3HOUH 3UDFA 4X62Q 1ASZA 4A3DH 1B7YB 2VUMH 5M3MH 3PV0A 1WJJA 4PZ7A 5GROA 1D8LA 1C7YA 1IBML 1WOCA 2CKZB 1HNZQ 1PYBA 3NBHB 2CCZA 2ZTEA 2ZTCA 3E9IA 5C3EG 2R93H 4GKKQ 3FHWA 1A63A 3M7NA 4JC0A 4A3BG 1W3SA 3HOYG 1YJWA 2EIFA 4JOIC 3H15A 3DM3A 1IBMQ 2NVTH 1N32Q 4R4OA 3F2DA 1A62A 4YWMA 1TXYA 4OWTB 2K5NA 2UUCL 4YHHL 2K4KA 1QUQB 4UP7A 1IBLL 3M85A 1N36Q 2R92G 2UXDL 5E7NA 1BBUA 1NTGA 2YTYA 2PQAA 2F52A 2LSSA 3PUVA 4KI0A 1E24A 1V43A 1N32L 3TEHB 3J7ZC 2E2IH 1Q12A 1PH3A 1XPRA 5GAHC 4OX9Q 4LFAQ 1K8GA 4HJ9A 4YHHQ 4DV6Q 1LM0A 4GLVB 4A3FG 1Q86C 2D0PA 5IYBG 2OTJA 4BY7G 4JI0Q 4JI1L 2WAQG 2D62A 1KC8C 1D7QA 1O7IA 1K9MC 2K50A 4DPGA 3I4NG 1C0AA 1TWHH 4HJ8A 1XPUA 3CCVA 2LXJA 4LF4L 1SMXA 5IYDG 1IXRA 3ER0A 2JJQA 3G48A 3BZKA 4OX9L 3EBEA 2JA9A 2YYZA 3T1YL 4DV6L 2N3SA 1VQFA 1S72A 3KJPA 4QY7A 1PH8A 4RMFA 2YTVA 3E0EA 1S40A 3AEVA 4JI0L 3GTGH 3HOZH 4PZ8A 5IYDH 3KFUA 1I94L 2MNAA 1YVCA 2I5LX 4X62L 4IO9A 5IYCG 4OO1G 3PF4A 2JA5G 1R9TH 1VQJA 3BU2A 1E22A 3W1GA 3UE0A 5C4XH 1OXVA 4LF4Q 1EIYB 4DNIA 3S16H 3T1YQ 1B8AA 1PH1A 2K5VA 1YEZA 3ZJYC 1QVFA 4A93G 1M1KC 2R7FA 5IWAQ 3HOXG 3PIPA 1X3FA 1CKNB 3RZOH 4A3KG 1TWGH 3KLWA 5HGQA 2OWOA 4Y52H 5GQOA 2VW9A 4O0AA 3CCMA 1X6OA 3AYHB 2EXDA 3H3VH 4UY8C 1NMGA 4DV1Q 1X3EA 1CKMA 3I55A 1IBLQ 4JG2A 3M4PA 1QZHA 1YHBA 4GKJL 1XMOL 1NJIC 2UXDQ 4JI3L 1K3RA 4B3TL 5GADC 1M90C 2PQAB 1OXUA 1HJPA 5M5WH 4P72A 1W2BA 4DV0Q 3JC66 4DR4Q 3RZDH 3UDIA 4A3BH 3HOUG 4DV1L 4NXNQ 1G51A 5JJKA 3GTJH 2I0QA 3GD7A 2UXCL 4GKJQ 4A76A 4JI1Q 2JQOA 4JI3Q 3H3VI 4DV5Q 1ASYA 1H95A 2PMZE 1WCMH 3J80c 4BBSH 2JA6H 1QUQA 2IT1A 2AMCB 4HIMA 4LUVA 4C3JH 2ALYB 3I4OA 4DV0L 1PH5A 5JEAG 4B3SL 5C4XG 2VQFQ 3HFZB 1HR0L 2KCTA 4GN5A 4LUOA 3F2CA 4GLXA 2E2JH 4JI5Q 3G6EA 3PO3H 4B3RQ 1KXLA 1LTLA 1VQ6A 1LUZA 2KCMA 2VY3A 5C0XG 4A3CG 3TREA 2NN6G 4OWXB 4DV5L 3J81c 4QQBX 1A0IA 5DLQE 4L5QA 4LUZA 1VCIA 5M3FG 2PI2A 1UE1A 1CKOA 2CWPA 4MZ9A 4DAMA 3AFQA 4BBRH 2UUBQ 3M4OH 4B3SQ 1I50H 1L2FA 2VQFL 1MIUA 4J15A 3RLFA 1JJ2A 4B3RL 3CQZH 1VQIA 4DUZQ 1I5FA 1N9WA 4JOIA 1PH4A 1AE3A 5IWAL 4IFDI 3LGJA 3PF5A 2DGYA 3UE1A 2Z6KA 1PV4A 1A8VA 1B70B 2UUBL 1OXXK 3IRBA 4HIKA 1UE7A 1Q1EA 4H02A 5H1SE 1XTDA 3WWVA 2VNUD 1P8LA 4NB3A 1LYLA 1L1OC 1HH2P 1VQGA 2HT1A 2R92H 1XMOQ 3CP0A 4B3TQ 1Y14B 3CPWA 3A5ZB 1SN8A 4IJHA 1Z47A 4POGA 2WFWA 4JI6Q 4GN3B 2A19A 3CPFA 3A0JA 1X9NA 3PUYA 1L0WA 4OO1I 4DR4L 3FKIG 4IPGA 3HOZG 3PGZA 5AJ3L 3GTMH 4JV5L 1U0LA 4BA1I 3U4VA 5IY0A 5C4JH 1AH9A 4NXNL 4R1JA 4XIGS 4A3EH 4A4IA 2UXCQ 4JBKA 2Z0SA 4K0KQ 3BZCA 2AKWB 4UPAA 4JBJA 2YTXA 1YITA 5EAYA 2KHJA 1YIJA 4LF5L 4JI2L 5AJ3Q 4JI5L 1HR0Q 2N8NA 4X6AH 2QA4A 5BR8L 1FL0A 3M3YH 1UEBA 4POFA 5IYBH 2GVAA 2AWNA 1L1OB 2BA0A 1VQPA 2JA7G 3PUWA 3CCRA 3I7FA 5C44G 3B6YA 1NE3A 1Z9FA 2A8VA 3UDXA 1OXTA 3HKZG 2K52A 4JI4Q 2GVBA 2OQ0A 4Y7NH 3S14H 2WP8J 2F3IA 4DUZL 1YZ6A 3CMAA 2LXKA 2N78A 5BR8Q 2K75A 5LMNQ 1E3PA 4X65Q 4P74A 1WFQA 2H5XA 3GTQH 2Q2IA 3K7UC 3G71A 2Q2TA 3S2HH 4EX5A 3GDEA 1YHQA 4IJLA 1IBKQ 1FJGQ 2NVYH 3RLNA 3ULJA 1JJGA 1EUJA 3HKSA 2HIVA 4HJ5A 5C0XJ
chains in the Genus database with same CATH superfamily
3GTLH 4GNXA 2JA8B 1ENFA 1NBWA 4YWLA 3VR4A 5I9OA 5FO9B 1E2WA 1QG7A 4R4TA 5J22A 2CVRA 2JXMB 1JC7A 3PIO3 1KIXA 3FEWX 5C4JB 1EQVA 4GOPB 3NK9A 4R4IA 4K0KL 4OGQC 2KEDA 4A93H 4PNYA 3CAMA 1XJVA 4LF5Q 3GO5A 1KQSA 1Q7YC 1VQLA 2H4OA 1BBWA 4DAVA 2V1CC 1Y8NB 4R4CA 1KABA 3V05A 1VQHA 3I4MB 4RCNA 3HZXA 3PO2H 5EPKA 2A68C 4A3JH 4LW1A 1C9OA 3T56B 1HTLD 4LNQA 4C3JG 3L2PA 2ES2A 1Q90A 3KOJA 3I56A 2XNAC 2FJ2A 3ITPA 1Q46A 1UEAB 3LWEA 4HSVA 3FKIH 3A56A 3LWUA 1J5EQ 2E5LL 3MA2B 2AWOA 2SDFA 2JK8A 1DOMA 4A3IH 2CFMA 2D9UA 3HOVH 1DYQA 3L9AX 2F1MA 4DV7L 3NBIA 4APVA 2A6EC 1X56A 4J1MA 1PYSB 2AQ2B 1EY7A 3MXGA 3D31A 4K6LA 1U9RA 2LKVA 5CV9A 3NTKA 5C44H 3PIP3 1AZQA 3OIQA 1E2ZA 4K5WA 2I5MX 5EBCA 4EQPA 1BF4A 2NTTA 1IL2A 1JORA 2HDLA 2D2CC 5FLMG 3BVMA 4DUYQ 3ONAB 1Z7TA 4IZ8A 3S15H 3H0GB 2B63G 4YCWA 3HOUB 1I6VC 3L7ZC 3W1BA 5M5XH 2K01A 5FJ8H 3CC2A 4Q5VA 3IAYA 4BY7H 1JE5A 1L1OA 3L0OA 1CSPA 2PI2E 2L5TA 5C3EH 1JB3A 2NYZD 4OONA 3KF8B 2WB1G 1TS2A 1EIHA 1XX8A 1IW7D 1YJ9A 2X69A 2E8GA 4KKSA 4UP8A 1TVXA 2R93G 1RL2A 3CMEA 1STHA 2B29A 2K03A 5D14A 3K58A 2XTIA 1KD1C 2UUAL 1GUTA 1NMFA 4BY1G 4HJAA 1EYDA 4A3GG 3RZOB 3HOYB 2Y0SG 5IGDA 5JJLA 2RA4A 1QOHA 2RQXA 4R8IA 4ZQ3A 4AQYL 4YY3Q 4GN4B 2VQEQ 3VA5A 4L5RC 2IHEA 3F1ZA 4JYAL 5IP7G 2PW7A 1H9SA 5A35A 2A5HA 4BS9A 2J4XA 1P16A 3MVVA 2NUCA 1XNRQ 4RHSA 2LFNA 1S3OA 1TR5A 3MTSA 1V9PA 1J6QA 1IW7C 1EWCA 3SE0A 1EZ6A 1PZID 1F77A 1B2TA 3PMFA 2UXBQ 2JE6I 4DR6Q 2MO1A 5EKKA 5M3FH 1E1TA 2QDLA 1RJTA 4BBRB 4HCSA 3NXWA 2ZJPA 1A15A 1EU4A 5EBDA 1Y1VB 4DXGA 4DV4L 3A74A 2OTLA 1HNWL 5C4XB 1E1OA 1D1KA 4BXXH 1A3TA 1RTNA 1WTQA 4B3ML 3E6ZX 3E9HA 1QVCA 1WYDA 1AW7A 5FLMH 3H6MA 4DAYA 2I07B 1TY2A 1KAAA 1VQDA 3J80E 1SXTA 4B3MQ 2A69C 4OELB 4A3MB 1LT4D 3TS2A 4FXDA 2HHHL 4DR7Q 2ID0A 1TWHB 4LF9L 3FP9A 1Q8KA 4HN7A 1O7LA 2ENBA 4FO2A 1VQBA 2R61A 4GKKL 1I4PA 2RF4A 3J81L 1I6HH 3MAQA 1PLFA 4CDDC 3S1NB 3A8IE 4KY7A 5FLXE 4XYQA 4QIWB 3S1QB 4XDXA 1N36L 3F2UA 3QOLA 1B53A 1MHWC 3ULLA 3PO3B 3QWNA 3S14B 1PTOD 4EQ5A 3L3OC 3K7AH 1DOLA 1PTOB 1UUPA 2Y0SE 1SRUA 1N8RC 3AMUA 1VS0A 1EFWA 3CCEA 2R7ZG 4WJWA 5M5YH 3CD6A 1KRTA 4BBSG 5EPJA 2EYFA 2F0KA 4QGUA 2F0SA 2L4NA 1ZKOA 1K8OA 3DLLA 2BA1A 2MJ8A 2FMMA 3GP7A 1LTID 1PH2A 3C1EA 1CQVA 5G3LD 4XXEA 2VUMH 1RCVD 5C5MA 4PZ7A 1I4RA 1X3QA 4RGOS 2F0MA 2CKZB 1HNZQ 1EY8A 3NBHB 4XYOA 5C4HA 4IURA 1CTMA 2F3WA 4JC0A 4A3BB 1YJWA 2NBFA 2EIFA 3I73A 3K5OA 4JOIC 3A54A 3DM3A 2NVTH 1N32Q 5EJWA 4K5VA 3F2DA 4RH6A 4OWTB 4YHHL 1QUQB 5LL6S 3M85A 1AZPA 4FF4A 5KYLA 2R3ZA 5E7NA 4IN3A 4KI0A 2QW7A 5C0XH 1Q12A 3A7LA 1NR4A 2WKDA 4HJ9A 4YHHQ 4A3FG 1LM0A 4GLVB 2D0PA 4BY7G 4JI1L 2F0IA 2D62A 1KC8C 3JAME 1K9MC 2CW0D 1TWHH 5I6YA 5IYDG 1IXRA 3D8GA 3DWPA 3EBEA 4G57A 5IT9L 2YYZA 1VQ6A 3AEVA 3GTGH 4F88A 1ICFB 5E3FA 1H9JA 3HOZH 5IYDH 1F2YA 4DU9A 5KEEA 3ZJYC 1F2LA 2RCFA 3C3LA 5IWAQ 2BCOA 2KJXA 2M00A 3P1HA 3KLWA 2VW9A 1EY5A 3C1FA 1X6OA 3AYHB 1HXYD 1LACA 4DV1Q 2SOBA 1X3EA 2CQAA 1IBLQ 3N52A 1YHBA 4HMJA 5IGGA 4HMIA 4DV0Q 4TRDA 4A3BH 2A69D 2WAQB 4DV1L 4OL7A 1IKLA 3R3OA 1LT5D 4KK7A 5CC4A 4Q0FA 4BBSH 2F0VA 3TP8A 4C3JH 2ALYB 1A3UA 3SDZA 1PH5A 4K6DA 5JEAG 5C4XG 3DUZA 2VQFQ 4GLXA 1K0SA 4EQOA 3NBHA 3G6EA 1LUZA 3N6RA 4DV5L 3I70A 5I4DA 5M3FG 2F4IA 3NQIA 1UE1A 1CKOA 2CWPA 3I8ZA 4DAMA 3M4OH 1WTXA 2VQFL 3TZUA 2IL8A 3CQZH 4M8AA 2Q8RE 3BDCA 1MSGA 1AE3A 2LY7A 3LGJA 4L63B 4P2CB 4ZK9B 1AP0A 3PF5A 5C3WA 3UE1A 4ME5A 3GTPB 1A8VA 2UUBL 2DJGC 1CK1A 2WACA 1XTDA 1P8LA 1LYLA 1F9PA 2CHBD 1SYCA 2WINB 1RF2D 3CPWA 3OOCA 2A19A 3CPFA 1ONLA 1L0WA 2XRQD 3HOZG 3U4VA 4NXNL 4V0BA 4A4IA 1SEBD 3BZCA 3VYSA 2EE1A 4UPAA 4B08A 4C1NI 2DN8A 5AJ3Q 3VYRA 2N8NA 3FVQA 3CQZB 2B63B 4X6AH 2QA4A 2A6HD 5BR8L 4QCLA 1UEBA 2JN4A 1L1OB 3CCRA 4RGMA 2F0FA 4ABNA 1LT3D 2GVBA 4RA8A 4Y7NH 2WP8J 2OT2A 5CORA 4DUZL 1YZ6A 2N78A 5FOBB 4HSPA 3WOFA 5LMNQ 1B1ZA 5IODA 1WFQA 3GTQH 5DEHA 3VR5A 3G71A 2Q2TA 2J0TD 4C3IB 1HHVA 2KECA 5JVG3 1FJGQ 2NVYH 3KBXA 2EZVA 1EQTA 3HOVB 2HIVA 4POGA 1JICA 5J39A 5BN3A 1YNJC 3D0FA 2HCIA 4JI6L 3OYYA 4GS3A 4TSSA 2F0WA 1SE2A 3OW7A 1FJGL 4JV5Q 2B2YC 2NZOA 2ZJRA 4K14A 3KDFA 4ZCKA 4FXGC 5IT9c 1AFPA 3BG3A 1EOVA 2EYPA 2HQLA 3PIOA 2BE5C 3CCUA 1YNND 4N9TA 3STBC 2WAQE 2BDOA 4LF6Q 3MEFA 3P75A 2JA7B 1F9SA 3CCLA 1GOZA 2N55A 2DY8A 1D2BA 1STAA 3NTIA 1V1QA 5GAGC 1GKHA 1JOOA 2R93B 4LF6L 4KN7C 4JI4L 1EEID 2N88A 2KHSA 3SEBA 2A6ED 1K3BC 2PCFB 4S3SA 4A3FH 3HOWH 1KAWA 4A93B 4A3IG 1DJRD 3D3RA 4X65L 4CKBA 2BH8A 2L12A 2HUGA 3Q23A 1VQ8A 4JI8L 3OWEB 3TP5A 4DAYB 3LX0A 2Z1CA 4A3LG 2JA8G 3RMHA 3NEMA 1HNXQ 3QIAA 2XRSD 1N34L 2JA8H 4C3JB 3TP6A 3GTLB 1R4QB 2MGSA 3NENA 2ASBA 2Q8TA 4CJ1B 2KVMA 1PH7A 2EVBA 3OTOL 3GV6A 2HQEA 4XQJA 4C3IH 1RDPD 1VMCA 4AH6A 1CQFA 5BN4A 2DY7A 1S5DD 1S5BD 4AIMA 3HOXB 1TWCB 1GO3E 3M4YA 2KCNA 4QIWE 4YY3L 3GTKH 4CDEC 5A2QL 2I46A 4L5SA 3KLSA 1D6EC 1VQKA 1NSNS 1PFMA 3RR5A 1SYBA 1E7ZA 1VQAA 1TS3A 4FP5D 1K83B 5K36H 4A3EG 1TWFH 4PZ6A 1NY4A 4ZAIA 1HR0W 4JI2L 3F2BA 2IX1A 4RFBA 4LFCL 1EY6A 2IWHA 4QUCA 2XGTA 3CXCA 1FNVA 4KN4C 3MHBA 5C3XA 1JT8A 3IFTA 2E76C 2NZHA 1PZJD 4MNOA 4DK0A 4EGVA 4ME3A 4FDBA 1YNNC 4H44C 2R7DA 4CJ0B 4LFCQ 3DMUA 2OQKA 3FMCA 2PZWA 1VQ4A 1W6JA 4K5XA 3ERSX 5ISRA 3KDFB 2GA4B 2A73B 3T16A 1EQQA 5C6AA 1HA6A 5IP7H 1YI2A 4IPHA 1YBYA 4DUYL 1BVSA 1BCPD 4E6IA 3I4MH 3TQYA 1D5XC 3CC4A 2ZXOA 1WTPA 2FFKB 3CCQA 2R7ZH 2FHTA 3HOZB 2ZJQA 4GNXB 4DR7L 4XQQA 1AE2A 4UDUC 2ZTDA 5IE8A 1HFGA 1B3QA 3A8KE 1CM9A 3U58A 2K6AA 1BDOA 1RODA 4EQNA 1PA6A 2D0OA 5HY6A 1SJED 1HZCA 3RNUA 1CSQA 3S1NH 5A2QE 1V8QA 3STBD 3M3YB 2Z4HA 3CU7A 2G9DA 2IX0A 5FO8B 1S4ZA 1KNAA 3MXNB 4CJ2C 1PTOH 3G7LA 1FR3A 4JK1C 5FLXL 2CH4A 4DK1A 4JI7L 4OEMB 4IUQA 3J81E 3NP8A 4GZYC 1Y8PB 1EU3A 5JJIA 2C5CA 5DM73 5FLXc 1E2VA 5D65A 3PO2G 3G4SA 5LMUL 1HPCA 3TDQA 3J81i 4L5TA 4KD3A 1JWUD 2AQ1B 2VQEL 1H9RA 1VQ9A 1CKNA 4RGNA 2E2HB 4A3MG 1OO9B 2JEAI 1CA6A 1ET6A 3JAML 1F9QA 3I4NH 2EYHA 3D6CA 4DNTB 4QUFA 1EWIA 4DR3Q 1WTWA 3HP3A 2K05A 2NVQB 1E0BA 1I4XA 3J7AF 5IGEA 1PYWD 3HKZB 2R92B 4DR3L 4BBRG 1LTSD 1WTHA 2AHOB 4IPCA 5C44B 1MGSA 4RGTA 1T9HA 2UU9Q 3S1QH 5M3MG 3FPPA 1VQMA 2ZM6L 4IFDH 5C3EB 2Q2HA 4CBVA 5CMDA 2A1AA 1KL9A 2PZUA 1XTCD 2KENA 2YV5A 2UU9L 3S1MB 5ELOA 1ESFA 5IGCA 1K83H 2CQOA 1QVGA 2ZM6Q 3OW2A 4OXPA 2MFIA 2MO0A 1ICWA 2MHVA 3OIPA 4X62Q 2LMCB 3R8BA 2NVYB 1WJJA 4HAEA 3KF8A 4I65A 5M3MH 2E2IB 3ERQA 1PYBA 1KLGD 3ND9A 2Z9HA 2CCZA 1MBYA 3GTJB 1ML0D 4GKKQ 1A63A 3M7NA 1U4RA 1QNKA 1KLUD 1IBMQ 2O2LD 2K5NA 2K4KA 1ZXTA 1IBLL 1T5EA 2R92G 1JQYD 4FNFA 5M3FB 2F52A 4OO1H 4PQXA 2B8FA 3J7ZC 1PH3A 2VB2X 4LFAQ 1K8GA 3SVMA 3AB9A 2OTJA 3H3VC 3TBIB 4JI0Q 2K32A 1O7IA 1SNMA 1PMRA 4DPGA 4BY1B 4A3GB 2LXJA 1SMXA 1EY0A 3G48A 2B2UC 2N3SA 3O13A 4RMFA 2YTVA 3VA7A 2ICEC 1S40A 3P7JA 4JI0L 5M9OA 2G5DA 1I94L 1LTRD 3AU7A 5IYCG 3PF4A 1TWFB 2K1BA 4BY7B 3S16H 3T1YQ 4OIKA 1PH1A 1QVFA 3ZYYX 3CRLC 2AQ3B 4M1UB 3PIPA 3RZOH 3VYTA 1XWEA 4A3KG 1ET9A 1ESRA 2JP1A 1K28A 4UY8C 1NMGA 1WTRA 1NUCA 3I72A 1QZHA 1K3RA 3EJIA 1OXUA 5M5WH 5ELFA 1LT6D 3UDIA 4NXNQ 1B3AA 2F0QA 3GD7A 4GKJQ 4Z9CB 2JQOA 2PQEA 4L8JA 1PTOC 1GUOA 4JI3Q 3H3VI 1I4QA 3S1RB 1DONA 3MXPA 2E2JH 3HFZB 5I2YA 3F2CA 4LUOA 3KLSX 3URYA 3TP7A 1STBA 4B3RQ 1KXLA 4RAUC 4CDCC 4LK1C 1TT2A 2VY3A 3ND8A 4QQBX 4CGYB 1A0IA 1I3QB 3IKJA 2PI2A 3AFQA 1MIUA 5E4XA 4J15A 1JJ2A 3HOWB 1N9WA 4JOIA 1PH4A 5IWAL 3NWSA 1PV4A 1UE7A 2EYJA 5H1SE 3MXUA 5CV4A 1L1OC 1NCVA 1HH2P 1EYCA 2HT1A 4B3TQ 1Y14B 3A5ZB 1SN8A 4IJHA 1Z47A 4GN3B 3A0JA 3PUYA 5CYUA 4AYBB 4IPGA 3GTMH 4JV5L 1U0LA 3VR2A 1AH9A 4NP5A 1AEXA 4A3IB 4JBKA 3K0YA 4HR7B 4JBJA 2FMCA 1YITA 1V1PB 1YIJA 4RKLA 3BDLA 4RKBA 4FF2A 4JI5L 1HR0Q 1EOTA 2EY6A 1DM0B 2B39A 3DEPA 3MC0B 1RHPA 4FXKC 1B9NA 5IYBH 5C44G 1NE3A 1Z9FA 2A8VA 4JI4Q 5L37A 4A3EB 1SYGA 3W2DA 3IFDA 4P74A 5KGUA 3BDOA 3K7UC 3S2HH 3WDNA 1YHQA 1A6XA 4IJLA 3ULJA 2RBMA 2BE5D 3HEJA 4ULLA 1WI5A 1AN8A 1Y1VH 1QWYA 1D5MC 3JAMi 1PFNA 4AYBG 3JAMc 3KJOA 1IBKL 1B50A 2Q8IB 3S1MH 5KNBA 4X3UA 2JA5H 5CV8A 2BH2A 2DNCA 2KCCA 1X54A 1HQRD 1G2SA 2EJMA 3EIVA 2NVTB 4JBMA 4RG1A 2P5ZX 1X55A 1TY0A 3BYTB 1CHQD 3GTMB 2IY5B 4KHVA 4A3CH 4NW2A 3E5SA 1TWAH 3S17B 1YNXA 3GTPH 2MUYA 2HIXA 1HCZA 3RLOA 2YU9H 5CR3A 5G3LF 3CC7A 4N9PA 4LF7Q 3CF5A 4K8JA 4WORA 4DV3Q 4A3DB 2EOTA 5LMNL 2FXQA 4FYDA 2VUMB 1KHIA 4JI2Q 3SR1A 3R2TA 4LF7L 1XMQQ 2EQSA 5KNDA 4DV3L 2IPKD 4X64L 1SFOH 5D3IB 1J5EL 4A3LH 3A8JE 3S17H 2Q2UA 1SSOA 4O42A 3UDGA 4X64Q 1SNDA 2AUKA 3DEOA 2NN6I 1QE6A 1VQ7A 3SK6A 3CCJA 1GUNA 2PNRC 1Q8IA 4XT1B 1QNUA 3HKZE 1H9MA 1YHAA 2ATWA 4KHPL 1SFOB 5EKLA 4L6TB 5GAEC 3RN2A 4KKUA 1LTGD 4HIOA 4DR1L 3R93A 2OEOA 4BXXG 4DK6C 1M4VA 4JPBW 4ZKBB 1JB7A 4N8X1 1JMCA 2A68D 1N33L 3D4DA 4JI8Q 2JA6B 4GNXC 4G7HC 4TVAB 3HOXH 3K8AA 2X6LA 3AQQA 4A3KH 2QEXA 4MTKA 4DV2Q 4QL5A 3K7AB 1G2TA 2RDHA 2CW0C 1PH9A 4Y7NB 1N34Q 2F0NA 4UHVA 3J7YW 1MJCA 3S2DH 3Q8DA 2B2UA 3I91A 4OIJA 2ZT9C 1EYGA 3R2IA 3E3XA 4LF8L 3BZDB 2RHQB 3F8TA 5I9PA 4GLAC 4NXMQ 1HA5A 3ULPA 1O7ZA 1GVPA 4AQYQ 5CV6A 2K04A 1TWGB 3EQLC 2HD3A 4GOPA 1LTBD 4LMQD 2H1EA 1C8CA 1OXSC 2Z6BA 4NXML 4YCUA 1XNRL 1W6KA 2NVXB 4BWGB 1NAPA 4X66L 1HZAA 2OCEA 1PXUA 3H09A 3OWFA 4KTAA 3X3NA 2KUMA 1Y1VG 3T1HQ 4P71A 1SYDA 1XXGA 4QJFA 2JYOA 4C2MH 4A75A 4MTNA 4CHTB 3U4ZA 4BA2I 1EEFD 5CBAE 3HOVG 1CHPD 1MI2A 3Q22A 5IT9E 1KDAA 4DAPA 1CA5A 4X3KA 1KTKA 1JOQA 5ELBA 2G9HD 5K36G 2RKSA 4AYBE 3EA6A 4A3JG 5DAUA 1PFSA 3EVQA 3M7GA 3EN2A 3PCOB 3CW2C 2VS1A 1B44D 1II3A 5KIXA 1LV9A 3K6OA 1TQOA 2QEJC 4QMGA 1LTTD 3BJUA 1K8AC 4LFBQ 2F0PA 3NQTA 4P75A 1LTAD 3K0XA 3SK8A 3KBGA 2F0EA 1SNQA 4WRDA 1HFNA 3PO3G 2N49A 1GUWA 2RCNA 3FKIB 1FGUA 3NWTA 2QGQA 2B2YA 3CHBD 4DR5Q 2KA7A 4I7ZC 1UWVA 3M9BA 2NWGA 4IOCA 3NHHA 5JEAJ 1QZGA 4DR2L 3S2HB 2K14A 2MPMA 4TKOB 1NR2A 1TWCH 2UUCQ 3GTQB 1IYJB 2I5HA 1B4OA 2XN9C 1FD7D 2E2HH 1I4HA 4YWKA 4R4QA 2WIIB 4G7OC 4NKLA 1IHZA 1S5ED 2KBNA 1FVIA 2B2VA 1SDFA 4LFAL 3J7A5 1SR3A 1NNXA 3S24A 5T1IA 4DXFA 1ILPA 4JBWA 1RTOA 1K0RA 4DFAA 4KJOA 1HZ9A 1HNZL 1QCBD 1U4MA 1QB5D 2OF1A 2V4DA 5HGTA 1I94Q 4DN4M 3HOUH 3UDFA 1IL8A 1O80A 1L0YB 1D8LA 3X3MA 2ZTCA 2EJGC 3E9IA 3T53B 4HEDA 2R93H 3FHWA 5IIFA 1W3SA 3HOYG 4HCEA 1CZGA 3H15A 1TIID 2NZ1D 2VXWA 1A62A 1TXYA 4K8IA 1JWMD 5ELEA 1F9RA 3SXHA 1MD2D 1RKNA 4RCOA 1BBUA 1NTGA 5M3MB 1T5XD 4ILWA 4ZLTF 2LSSA 1E24A 3RZDB 1DXMA 2F0DA 1N32L 5KYIA 1SE4A 1XPRA 2E75C 5GAHC 1Q86C 1D5ZC 1SNOA 5IYBG 2E2DC 1TKWB 1D7QA 1FYCA 2IW3A 3I4NG 2L0CA 1C0AA 1X32A 1XPUA 4LF4L 3HG9A 2DJFC 2JJQA 3NE5B 3BZKA 4FVMA 4ZKCB 1BNZA 5CV7A 1VQFA 1DCZA 3KJPA 4QY7A 1PH8A 2EY1A 3QJYA 2RDFA 3KFUA 1EY9A 1YVCA 4X62L 4IO9A 3OPOA 1V1OA 1GXDC 5DNFA 4CKCA 1E22A 3W1GA 3UE0A 4LF4Q 2HCCA 3DM1A 1EIYB 1B8AA 3FDTA 4NDXA 2K5VA 1YEZA 1M1KC 2R7FA 4C56C 1X3FA 1CKNB 1JR0D 1TWGH 1MSHA 3GV3A 2OWOA 5GQOA 4O0AA 3CCMA 3V2TA 4KJNA 2MP1A 1U4PA 2PZTA 2SEBD 1CKMA 4JG2A 3OMGA 2UXDQ 4B3TL 2ICIA 4C2MB 1M90C 2EY2A 2PQAB 1HJPA 3S16B 3K57A 1EFID 3HOUG 5JJKA 1EWHA 3GTJH 4A76A 1H95A 4DV5Q 2PMZE 2YU9B 2RVLA 4K2LA 2L55A 2JA6H 1FNWA 4HIMA 2AMCB 3MFYA 1Y69U 4LUVA 4DV0L 1TU2B 1HR0L 4GN5A 4JI5Q 3QB3A 1BCPC 2J7ZA 2QCPX 3FPUB 2KCMA 2QKIC 4OWXB 5JEAH 4PMCA 5E1FA 3J81c 1KNEA 4MN3A 1VCIA 1G91A 2UUBQ 4MZ9A 3SHLA 3K5MA 5COYA 1VF5C 1VQIA 2NTSA 1I5FA 1SBBB 2PPBC 4IFDI 2PYKA 2DGYA 4FF1A 3PO2B 1B70B 1A3VA 3IRBA 3FRPB 2E74C 4HIKA 2KEEA 1Q1EA 2KQ3A 4H02A 2L11A 4NB3A 1A2TA 1VQGA 1VF7A 1XMOQ 1EL0A 2B2VC 3CP0A 2WFWA 3KK7A 1X9NA 1HTPA 4DR4L 5HURA 3PGZA 5AJ3L 4U673 4BA1I 4DA2A 5C4JH 1JWSD 3C46A 4XIGS 4A3EH 3D4RA 2UXCQ 2Z0SA 4K0KQ 2AKWB 2YTXA 5EAYA 4LF5L 1PTOF 2SNSA 3K5NA 5EKIA 3Q0AA 2WKCA 1EIGA 3M3YH 4POFA 2GVAA 2AWNA 2BA0A 3PUWA 3K5LA 3B6YA 1ZYRD 3UDXA 2OXPA 1OXTA 1CFMA 2K52A 3HKZG 5JPNC 4JW0A 3I3CA 2F3VA 3S14H 1BO0A 2F3IA 3S2DB 3A7AB 5BR8Q 4C1NK 4C3HB 2K75A 3CRKC 3OMCA 2H5XA 3LNNA 2Q2IA 1DD2A 1F2ZA 1VMPA 3RLNA 1GJXA 1JJGA 4LAAA 3HKSA 2F0HA 4YIJA 4HJ5A 3EFXD 1STYA 4IFDJ 1VQCA 1X3PA 1YJNA 5TSSA 3MXNA 3VR6A 1H9KA 4IUVA 1C4QA 2B63H 1Q81C 5DM63 4DNRB 4MHEA 1V1PA 5IGBA 3GTOH 2QILA 1VQEA 5J3BA 4NPSA 4HTHA 5IYCH 1OTCA 1KDBA 1O78A 1TS5A 4XQNA 3I4MG 1J8IA 3U9OA 4KHPQ 1I4GA 1ILQA 4R8NA 4IUNA 4IALA 1GM5A 5K5PA 4WJ3M 2KHIA 4IUUA 4MIUA 4ZUJA 3T51B 1SE8A 1RIPA 4R9WA 1DZ1A 2EYOA 1C48A 2K7VA 3EROA 1YNJD 1SMYC 4O2DA 2LS01 1S5FD 4DK3C 3HOYH 1KRSA 3J7AV 2B2WA 4XTCS 4LWCA 4JVZA 5JPMC 4PMWA 4A3JB 4A3DG 4HIDA 1BUVT 1I3QH 2C35B 1Y1WH 3H0GG 3HS0C 1HNXL 3M4QA 4WFN3 2JA7H 3D6WA 1BKBA 3J81j 2UUAQ 4IOAA 5IP9G 1MJEA 4ZYSA 4DKAC 5C0XI 4HJ7A 2JEBI 3OTOQ 4H0LC 5IP9H 3I2ZA 3U50C 2L9HA 1VQOA 3ICEA 1Q1BA 1O7YA 5I2XA 2VZAA 4IFDG 1F2MA 1XPOA 3PUXA 3V96A 5M5WB 1U5KA 2GN5A 1ENAA 2JA5B 4F7XA 1PZKD 2IHFA 3TSSA 2FINB 3G6JB 1IZ6A 1VQNA 2EY5A 4QF4A 1Q82C 1ZEQX 5LL6X 2IX3A 3S9WA 2E5LQ 1R9TB 3WOEA 3S1RH 4A3FB 2VNUD 2IJ0A 3RUZA 1XMQL 3KF6B 3J80i 1PH6A 3Q6SA 4ID6A 2F0GA 1PRTF 3W3AA 2K5WA 3QG1A 3CCSA 4DV7Q 3OHXC 1STNA 4DR6L 1QILA 1PVOA 1G6PA 5CBEE 1SE3A 3NELA 2VL6A 1K73C 1EQRA 3IL8A 1SAPA 3A5UA 3GTGB 3TZDA 4P73A 3A55A 3T13A 3MZ5A 1G6ZA 1JJCB 4IPDA 3DXJC 3C2PA 3GTKB 2XIWA 1G291 1WTOA 5LMNW 5EPLA 1QJOA 4H7BA 2JA6G 3KYHC 4V190 4LFBL 1SROA 1PDQA 4KMUC 1SJHD 4O1NA 4JCVE 2L15A 1K8MA 1DGSA 1IYVA 3TRZA 2VB3X 2HDMA 2KOLA 3PSIA 4DR1Q 2HHHQ 3UI2A 3KLRA 5KNCA 1HZBA 4LF9Q 2B2TC 2F4VQ 5JOBA 1WD1A 1D1IA 4UP9A 3Q24A 2DNEA 2K5HA 3MWYW 1XNQL 2ZXPA 1Y1WG 1MKHA 3TS0A 2XWBB 4WJ4A 1CI3M 1N33Q 1J9OA 1UE6A 3K59A 4DR5L 2RDGA 3MFGA 1X3GA 4KHZA 4OHJA 4DV2L 3BVZA 3K81C 5T1GA 2F4VL 1WD0A 4DR2Q 3SGIA 3S15B 4DF7A 3VYUA 1XNQQ 4XT3B 1CZWA 4KY6A 2PNHA 4JI7Q 4F8MA 5FJ8G 4YCVA 2MQHA 4I7AA 3AFPA 4LF8Q 1GHJA 2CWAA 3NTHA 5ELNA 2Z6KC 4G7ZC 1PHJA 3PUZA 5IGFA 1L0XB 1X65A 3GQBA 4ZRZA 5JVH3 1HQMC 2JSOA 1SYFA 4A3KB 1IYUA 1WVLA 3BS1A 3RN5A 4BBSB 4X66Q 3SK5A 4GOPC 1DOKA 1UE5A 4C3HH 4X3TA 5C4ZA 4JYAQ 5AFWA 1IKMA 1WCMG 4ODGA 1GD7A 1G8ZD 4B9XA 2R6GA 5LMUQ 4BY1H 2O5IC 4A3GH 3I90A 5M5XB 3BVGA 4KLKA 1BXTA 3T1HL 1PRTC 1TS4A 5EQ0A 3U9SA 4F87A 1Q3LA 1ZYRC 1EY4A 2F0OA 1HUMA 1EIFA 2WB1E 3H0GH 4PV1C 1CT1D 2TSSA 4IQZA 2AUJD 2XVSA 3DWAA 5CGKA 4G4KA 3KF6A 1SLJA 5FO7B 2UXBL 1HUNA 1CUKA 1FGBD 2EXZA 2XSCA 1ENCA 1BCPB 4A3MH 4IUTA 2RHSB 4ALPA 3KUPA 3K80C 1XYIA 2NVQH 5C5LA 3HOWG 1R4PB 3D4WA 2B3GA 2F0JA 4DV4Q 4CDFC 1VDZA 3VR3A 5IOCA 1HNWQ 4IUPA 2DUDA 3H94A 1KDCA 2QDBA 4PG3A 1JE4A 4OWWB 2VUMG 4N8FA 2F03A 3QO2A 4PMBA 1PRTB 1STGA 3W5OA 2NVXH 3DWQA 5KRUA 4QB4A 1EYAA 3VDYA 5I6WA 1VQ5A 1PRTD 2NB0A 4TQUS 3PQIA 1HRJA 5LHY1 1ASZA 4A3DH 1B7YB 3PV0A 5GROA 1C7YA 2K5QA 1WOCA 1IBML 3HGBA 2ZTEA 5C3EG 4KV6A 3HRZC 4A3BG 1H9SB 3T4AC 3GTOB 1SNPA 4R4OA 4NMZA 4YWMA 2TMPA 2UUCL 2EDGA 4UP7A 2PW5A 1N36Q 2UXDL 1Y8OB 4KD4A 2YTYA 4X3SA 2PQAA 4ZUIA 3PUVA 1V43A 3TEHB 2E2IH 3M4OB 4OX9Q 4DV6Q 5EGTA 4KKTA 2M2LA 2WAQG 2Z4IA 1BBXC 2K50A 5M5YB 4CKEA 3I4NB 4HJ8A 3CCVA 2RSOA 3ER0A 4OX9L 2JA9A 1RD9D 3T1YL 4DV6L 1S72A 3NPPA 2M9VA 3E0EA 1SNCA 2EPBA 4PZ8A 3CKIB 2B2TA 2MNAA 1M8AA 2I5LX 1WTVA 4OO1G 2JA5G 1R9TH 1VQJA 3BU2A 5C4XH 1OXVA 5E4WC 4DNIA 5JAVA 5ELCA 4A93G 1FNUA 2K28A 1UNSA 2A74C 3DHQA 3HOXG 1LLRD 4J8QA 1I6HB 1I50B 5HGQA 2Z8LA 4Y52H 1PFBA 2RSNA 3H91A 2EXDA 3H3VH 1BQQT 3I55A 3M4PA 4GKJL 2BDNA 1XMOL 1NJIC 4JI3L 5GADC 3NSWA 4B9WA 4P72A 1W2BA 2B2WC 3JC66 2SNMA 4DR4Q 3RZDH 2F0TA 4RHRA 1G51A 5D3DA 4C3HG 2I0QA 2PMZB 2UXCL 1Y1WB 4JI1Q 3SK4A 1ASYA 1WCMH 3J80c 2A6HC 1QUQA 2IT1A 1B9MA 4RWSC 3E0JA 3I4OA 1JOKA 2NN6H 2B8GA 4B3SL 2R7ZB 2KCTA 3PO3H 2L1BA 1SMYD 4FF3A 1LTLA 5NUCA 3MEHA 3RD4A 4A3CG 4UAIA 5C0XG 3TREA 2NN6G 2O5JC 5DLQE 4L5QA 4LUZA 1GHKA 5J1ZA 3TN2A 4BBRH 5F2DA 4U68A 1I50H 1L2FA 2QF7A 5ELDA 4B3SQ 1Z6HA 3J80L 3RLFA 4B3RL 4DUZQ 2X6GA 1LABA 5FK9C 3TMEA 5CV5A 2Z6KA 1TWAB 3NUCA 1OXXK 2EYLA 2WB1B 2O4XA 3WWVA 2F0LA 1U4LA 5BN5A 4LJZC 1UAPA 2R92H 3OSOA 4JI6Q 1WCMB 5FKAC 4EVOA 4OO1I 1STEA 3FKIG 4DGZA 5IY0A 5JJZA 4R1JA 2PO4A 2K33A 3I4LA 3BYYB 2Y0SB 3QR8A 1GUSA 2KHJA 1S5CD 1SYEA 1A2UA 4KY5A 2D5DA 2F0UA 2K5DA 2ZXRA 1GUGA 1FL0A 1BCPF 1JCKB 1VQPA 2JA7G 2BOSA 3I7FA 2EJFC 1LO5D 4J6HA 1BOSA 2OQ0A 3CMAA 2LXKA 2E2JB 1EZ8A 1E3PA 4H13C 4X65Q 3QOJA 2CH4W 1BR9A 4K2KA 4C3IG 4EX5A 3GDEA 1IBKQ 2C9OA 2EYMA 3P20A 1EUJA 2WV6D 2XWJB 5C0XJ
chains in the Genus database with same CATH topology
1WI5A 3GTLH 4GNXA 1Y1VH 3D0FA 1NBWA 4YWLA 4JI6L 4IFDJ 3JAMi 1VQCA 3OYYA 4GS3A 4AYBG 3JAMc 3KJOA 1IBKL 1YJNA 4R4TA 1FJGL 4JV5Q 3S1MH 2JA5H 2BH2A 1KIXA 2NZOA 2ZJRA 1Q81C 2B63H 3KDFA 4GOPB 5IT9c 1X54A 4R4IA 4K0KL 1EOVA 2HQLA 4A93H 3PIOA 3CAMA 3CCUA 1XJVA 4LF5Q 3GO5A 1KQSA 3STBC 2WAQE 3EIVA 1Q7YC 3GTOH 4JBMA 4RG1A 1VQLA 4LF6Q 1VQEA 5J3BA 4NPSA 3MEFA 1BBWA 1X55A 5IYCH 1OTCA 3CCLA 2V1CC 4R4CA 1VQHA 2IY5B 4A3CH 3I4MG 4KHPQ 1TWAH 1YNXA 3GTPH 3PO2H 2HIXA 4A3JH 1V1QA 4LW1A 1C9OA 1GKHA 3RLOA 5GAGC 2YU9H 3CC7A 4JI4L 4LF7Q 4LF6L 3L2PA 2ES2A 4LNQA 3CF5A 3KOJA 1GM5A 3I56A 4DV3Q 4A3FH 3HOWH 4WJ3M 2KHIA 1KAWA 1Q46A 5LMNL 4A3IG 4X65L 1SE8A 1RIPA 3FKIH 2BH8A 2FXQA 1J5EQ 2E5LL 1KHIA 4JI2Q 2AWOA 1VQ8A 4JI8L 4DAYB 4LF7L 4O2DA 1XMQQ 2EQSA 4A3LG 2JK8A 2JA8G 4DK3C 3NEMA 3HOYH 4A3IH 1HNXQ 4DV3L 1KRSA 2CFMA 4X64L 3HOVH 4XTCS 1SFOH 4LWCA 4DV7L 1N34L 1J5EL 2JA8H 4APVA 4A3LH 1X56A 3NENA 4PMWA 2ASBA 1PYSB 4HIDA 2Q2UA 3S17H 4A3DG 1I3QH 3D31A 1PH7A 2C35B 3OTOL 1Y1WH 3H0GG 1HNXL 3UDGA 4C3IH 3M4QA 4X64Q 5C44H 2JA7H 1BKBA 3J81j 2UUAQ 4IOAA 5IP9G 4AH6A 1MJEA 2NN6I 4DKAC 5C0XI 4HJ7A 1VQ7A 3CCJA 2I5MX 2JEBI 3OTOQ 5IP9H 4AIMA 3I2ZA 3U50C 1IL2A 1GO3E 1VQOA 3ICEA 5FLMG 4DUYQ 1Q1BA 3HKZE 4QIWE 4YY3L 3GTKH 1YHAA 2ATWA 2VZAA 4KHPL 4IFDG 1XPOA 3S15H 3PUXA 2B63G 4YCWA 1U5KA 2GN5A 4L5SA 5GAEC 3RN2A 4HIOA 1VQKA 2IHFA 4DR1L 3L7ZC 3RR5A 1E7ZA 3W1BA 5M5XH 4BXXG 5FJ8H 1IZ6A 3CC2A 1VQNA 1VQAA 4DK6C 4BY7H 1JE5A 1Q82C 1JB7A 2E5LQ 4A3EG 1L1OA 1TWFH 1NY4A 3L0OA 4PZ6A 1CSPA 3F2BA 4JI8Q 3S1RH 1HR0W 1JMCA 1N33L 4GNXC 1XMQL 2IX1A 3KF6B 4TVAB 3J80i 2PI2E 3K8AA 4LFCL 3HOXH 1PH6A 3AQQA 2XGTA 5C3EH 3CXCA 4A3KH 2QEXA 4DV2Q 4QL5A 1JT8A 4OONA 3KF8B 1PH9A 2NZHA 2WB1G 3CCSA 4MNOA 4DV7Q 1N34Q 4ME3A 4FDBA 1YJ9A 1MJCA 3S2DH 3Q8DA 4DR6L 1PVOA 1G6PA 2E8GA 1EYGA 2R7DA 4UP8A 4LF8L 4LFCQ 3NELA 1K73C 2VL6A 2R93G 1EQRA 2RHQB 2OQKA 1RL2A 3CMEA 3F8TA 3A5UA 4P73A 4GLAC 2B29A 4NXMQ 1VQ4A 3ULPA 1GVPA 2XTIA 4AQYQ 1KD1C 2UUAL 1JJCB 4IPDA 3ERSX 1NMFA 1G291 4BY1G 4HJAA 4A3GG 3KDFB 5LMNW 4GOPA 2Y0SG 1EQQA 5JJLA 5IP7H 1YI2A 2JA6G 3KYHC 1OXSC 4IPHA 4LFBL 1SROA 1YBYA 4YCUA 4DUYL 1BVSA 4NXML 4AQYL 1XNRL 4YY3Q 4GN4B 4JCVE 1HZAA 2L15A 2OCEA 4X66L 3I4MH 2VQEQ 3TQYA 4L5RC 3CC4A 2IHEA 1DGSA 3F1ZA 4JYAL 5IP7G 3TRZA 3CCQA 2R7ZH 3PSIA 4DR1Q 2ZJQA 2HHHQ 4GNXB 1P16A 4DR7L 1HZBA 4LF9Q 1XNRQ 2F4VQ 1AE2A 4UP9A 1Y1VG 3T1HQ 2K5HA 2ZTDA 5IE8A 1XNQL 1Y1WG 1S3OA 1MKHA 3TS0A 4P71A 4WJ4A 1V9PA 1J6QA 1N33Q 1UE6A 3U58A 4QJFA 4C2MH 4DR5L 1PA6A 4A75A 2D0OA 1X3GA 4KHZA 4MTNA 5HY6A 3RNUA 1HZCA 3U4ZA 1CSQA 4DV2L 3K81C 4BA2I 2F4VL 3S1NH 3HOVG 4DR2Q 3SGIA 2UXBQ 3STBD 2JE6I 1XNQQ 2PNHA 4JI7Q 4DR6Q 2MO1A 5FJ8G 4YCVA 5M3FH 1E1TA 2MQHA 3AFPA 4LF8Q 2CWAA 2IX0A 5K36G 5ELNA 2Z6KC 4AYBE 3MXNB 4A3JG 1PHJA 3PUZA 2ZJPA 1PFSA 4DV4L 3EN2A 1X65A 3A74A 2OTLA 4JI7L 1HNWL 3PCOB 1E1OA 3CW2C 4BXXH 2VS1A 4B3ML 3E9HA 1QVCA 5JJIA 1WYDA 5FLXc 3BJUA 1K8AC 4LFBQ 3PO2G 3G4SA 5LMUL 5FLMH 3J81i 3RN5A 4X66Q 4L5TA 4P75A 2VQEL 4GOPC 3K0XA 1UE5A 1VQDA 4C3HH 1CKNA 1VQ9A 4JYAQ 4B3MQ 3PO3G 2N49A 3TS2A 4A3MG 1WCMG 2JEAI 2HHHL 1GD7A 4DR7Q 2ID0A 3I4NH 4LF9L 4BY1H 3FP9A 2R6GA 1Q8KA 5LMUQ 4A3GH 3T1HL 4KLKA 2RCNA 1FGUA 1EWIA 4DR3Q 2QGQA 1EIFA 1VQBA 4GKKL 4DR5Q 2WB1E 3H0GH 1UWVA 2RF4A 3M9BA 4IOCA 1I6HH 5JEAJ 1QZGA 4DR2L 2K14A 3KF6A 1SLJA 1TWCH 2UUCQ 2UXBL 1IYJB 1CUKA 4DR3L 1N36L 2I5HA 4BBRG 2AHOB 4A3MH 2E2HH 4YWKA 4IPCA 4ALPA 2RHSB 4R4QA 3ULLA 4EQ5A 1T9HA 3K80C 2UU9Q 3S1QH 2KBNA 5M3MG 1FVIA 2NVQH 1VQMA 2ZM6L 3K7AH 3HOWG 4LFAL 2Y0SE 2B3GA 1SRUA 1N8RC 4DV4Q 2Q2HA 1SR3A 3J7A5 2A1AA 1HNWQ 1VS0A 3S24A 1EFWA 3CCEA 2DUDA 2R7ZG 4JBWA 5M5YH 3CD6A 1KL9A 1KRTA 4BBSG 1K0RA 2UU9L 2KENA 2YV5A 4PG3A 4QGUA 5ELOA 4OWWB 1K83H 2VUMG 2CQOA 1HZ9A 1QVGA 3DLLA 2BA1A 2ZM6Q 1HNZL 3W5OA 2NVXH 3VDYA 1VQ5A 1PH2A 3OW2A 4OXPA 2MFIA 2MO0A 4TQUS 1I94Q 3HOUH 3UDFA 4X62Q 1ASZA 4A3DH 1B7YB 2VUMH 5M3MH 3PV0A 1WJJA 4PZ7A 5GROA 1D8LA 1C7YA 1IBML 1WOCA 2CKZB 1HNZQ 1PYBA 3NBHB 2CCZA 2ZTEA 2ZTCA 3E9IA 5C3EG 2R93H 4GKKQ 3FHWA 1A63A 3M7NA 4JC0A 4A3BG 1W3SA 3HOYG 1YJWA 2EIFA 4JOIC 3H15A 3DM3A 1IBMQ 2NVTH 1N32Q 4R4OA 3F2DA 1A62A 4YWMA 1TXYA 4OWTB 2K5NA 2UUCL 4YHHL 2K4KA 1QUQB 4UP7A 1IBLL 3M85A 1N36Q 2R92G 2UXDL 5E7NA 1BBUA 1NTGA 2YTYA 2PQAA 2F52A 2LSSA 3PUVA 4KI0A 1E24A 1V43A 1N32L 3TEHB 3J7ZC 2E2IH 1Q12A 1PH3A 1XPRA 5GAHC 4OX9Q 4LFAQ 1K8GA 4HJ9A 4YHHQ 4DV6Q 1LM0A 4GLVB 4A3FG 1Q86C 2D0PA 5IYBG 2OTJA 4BY7G 4JI0Q 4JI1L 2WAQG 2D62A 1KC8C 1D7QA 1O7IA 1K9MC 2K50A 4DPGA 3I4NG 1C0AA 1TWHH 4HJ8A 1XPUA 3CCVA 2LXJA 4LF4L 1SMXA 5IYDG 1IXRA 3ER0A 2JJQA 3G48A 3BZKA 4OX9L 3EBEA 2JA9A 2YYZA 3T1YL 4DV6L 2N3SA 1VQFA 1S72A 3KJPA 4QY7A 1PH8A 4RMFA 2YTVA 3E0EA 1S40A 3AEVA 4JI0L 3GTGH 3HOZH 4PZ8A 5IYDH 3KFUA 1I94L 2MNAA 1YVCA 2I5LX 4X62L 4IO9A 5IYCG 4OO1G 3PF4A 2JA5G 1R9TH 1VQJA 3BU2A 1E22A 3W1GA 3UE0A 5C4XH 1OXVA 4LF4Q 1EIYB 4DNIA 3S16H 3T1YQ 1B8AA 1PH1A 2K5VA 1YEZA 3ZJYC 1QVFA 4A93G 1M1KC 2R7FA 5IWAQ 3HOXG 3PIPA 1X3FA 1CKNB 3RZOH 4A3KG 1TWGH 3KLWA 5HGQA 2OWOA 4Y52H 5GQOA 2VW9A 4O0AA 3CCMA 1X6OA 3AYHB 2EXDA 3H3VH 4UY8C 1NMGA 4DV1Q 1X3EA 1CKMA 3I55A 1IBLQ 4JG2A 3M4PA 1QZHA 1YHBA 4GKJL 1XMOL 1NJIC 2UXDQ 4JI3L 1K3RA 4B3TL 5GADC 1M90C 2PQAB 1OXUA 1HJPA 5M5WH 4P72A 1W2BA 4DV0Q 3JC66 4DR4Q 3RZDH 3UDIA 4A3BH 3HOUG 4DV1L 4NXNQ 1G51A 5JJKA 3GTJH 2I0QA 3GD7A 2UXCL 4GKJQ 4A76A 4JI1Q 2JQOA 4JI3Q 3H3VI 4DV5Q 1ASYA 1H95A 2PMZE 1WCMH 3J80c 4BBSH 2JA6H 1QUQA 2IT1A 2AMCB 4HIMA 4LUVA 4C3JH 2ALYB 3I4OA 4DV0L 1PH5A 5JEAG 4B3SL 5C4XG 2VQFQ 3HFZB 1HR0L 2KCTA 4GN5A 4LUOA 3F2CA 4GLXA 2E2JH 4JI5Q 3G6EA 3PO3H 4B3RQ 1KXLA 1LTLA 1VQ6A 1LUZA 2KCMA 2VY3A 5C0XG 4A3CG 3TREA 2NN6G 4OWXB 4DV5L 3J81c 4QQBX 1A0IA 5DLQE 4L5QA 4LUZA 1VCIA 5M3FG 2PI2A 1UE1A 1CKOA 2CWPA 4MZ9A 4DAMA 3AFQA 4BBRH 2UUBQ 3M4OH 4B3SQ 1I50H 1L2FA 2VQFL 1MIUA 4J15A 3RLFA 1JJ2A 4B3RL 3CQZH 1VQIA 4DUZQ 1I5FA 1N9WA 4JOIA 1PH4A 1AE3A 5IWAL 4IFDI 3LGJA 3PF5A 2DGYA 3UE1A 2Z6KA 1PV4A 1A8VA 1B70B 2UUBL 1OXXK 3IRBA 4HIKA 1UE7A 1Q1EA 4H02A 5H1SE 1XTDA 3WWVA 2VNUD 1P8LA 4NB3A 1LYLA 1L1OC 1HH2P 1VQGA 2HT1A 2R92H 1XMOQ 3CP0A 4B3TQ 1Y14B 3CPWA 3A5ZB 1SN8A 4IJHA 1Z47A 4POGA 2WFWA 4JI6Q 4GN3B 2A19A 3CPFA 3A0JA 1X9NA 3PUYA 1L0WA 4OO1I 4DR4L 3FKIG 4IPGA 3HOZG 3PGZA 5AJ3L 3GTMH 4JV5L 1U0LA 4BA1I 3U4VA 5IY0A 5C4JH 1AH9A 4NXNL 4R1JA 4XIGS 4A3EH 4A4IA 2UXCQ 4JBKA 2Z0SA 4K0KQ 3BZCA 2AKWB 4UPAA 4JBJA 2YTXA 1YITA 5EAYA 2KHJA 1YIJA 4LF5L 4JI2L 5AJ3Q 4JI5L 1HR0Q 2N8NA 4X6AH 2QA4A 5BR8L 1FL0A 3M3YH 1UEBA 4POFA 5IYBH 2GVAA 2AWNA 1L1OB 2BA0A 1VQPA 2JA7G 3PUWA 3CCRA 3I7FA 5C44G 3B6YA 1NE3A 1Z9FA 2A8VA 3UDXA 1OXTA 3HKZG 2K52A 4JI4Q 2GVBA 2OQ0A 4Y7NH 3S14H 2WP8J 2F3IA 4DUZL 1YZ6A 3CMAA 2LXKA 2N78A 5BR8Q 2K75A 5LMNQ 1E3PA 4X65Q 4P74A 1WFQA 2H5XA 3GTQH 2Q2IA 3K7UC 3G71A 2Q2TA 3S2HH 4EX5A 3GDEA 1YHQA 4IJLA 1IBKQ 1FJGQ 2NVYH 3RLNA 3ULJA 1JJGA 1EUJA 3HKSA 2HIVA 4HJ5A 5C0XJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI5 A;  3GTL H;  4GNX A;  1Y1V H;  3D0F A;  1NBW A;  4YWL A;  4JI6 L;  4IFD J;  3JAM i;  1VQC A;  3OYY A;  4GS3 A;  4AYB G;  3JAM c;  3KJO A;  1IBK L;  1YJN A;  4R4T A;  1FJG L;  4JV5 Q;  3S1M H;  2JA5 H;  2BH2 A;  1KIX A;  2NZO A;  2ZJR A;  1Q81 C;  2B63 H;  3KDF A;  4GOP B;  5IT9 c;  1X54 A;  4R4I A;  4K0K L;  1EOV A;  2HQL A;  4A93 H;  3PIO A;  3CAM A;  3CCU A;  1XJV A;  4LF5 Q;  3GO5 A;  1KQS A;  3STB C;  2WAQ E;  3EIV A;  1Q7Y C;  3GTO H;  4JBM A;  4RG1 A;  1VQL A;  4LF6 Q;  1VQE A;  5J3B A;  4NPS A;  3MEF A;  1BBW A;  1X55 A;  5IYC H;  1OTC A;  3CCL A;  2V1C C;  4R4C A;  1VQH A;  2IY5 B;  4A3C H;  3I4M G;  4KHP Q;  1TWA H;  1YNX A;  3GTP H;  3PO2 H;  2HIX A;  4A3J H;  1V1Q A;  4LW1 A;  1C9O A;  1GKH A;  3RLO A;  5GAG C;  2YU9 H;  3CC7 A;  4JI4 L;  4LF7 Q;  4LF6 L;  3L2P A;  2ES2 A;  4LNQ A;  3CF5 A;  3KOJ A;  1GM5 A;  3I56 A;  4DV3 Q;  4A3F H;  3HOW H;  4WJ3 M;  2KHI A;  1KAW A;  1Q46 A;  5LMN L;  4A3I G;  4X65 L;  1SE8 A;  1RIP A;  3FKI H;  2BH8 A;  2FXQ A;  1J5E Q;  2E5L L;  1KHI A;  4JI2 Q;  2AWO A;  1VQ8 A;  4JI8 L;  4DAY B;  4LF7 L;  4O2D A;  1XMQ Q;  2EQS A;  4A3L G;  2JK8 A;  2JA8 G;  4DK3 C;  3NEM A;  3HOY H;  4A3I H;  1HNX Q;  4DV3 L;  1KRS A;  2CFM A;  4X64 L;  3HOV H;  4XTC S;  1SFO H;  4LWC A;  4DV7 L;  1N34 L;  1J5E L;  2JA8 H;  4APV A;  4A3L H;  1X56 A;  3NEN A;  4PMW A;  2ASB A;  1PYS B;  4HID A;  2Q2U A;  3S17 H;  4A3D G;  1I3Q H;  3D31 A;  1PH7 A;  2C35 B;  3OTO L;  1Y1W H;  3H0G G;  1HNX L;  3UDG A;  4C3I H;  3M4Q A;  4X64 Q;  5C44 H;  2JA7 H;  1BKB A;  3J81 j;  2UUA Q;  4IOA A;  5IP9 G;  4AH6 A;  1MJE A;  2NN6 I;  4DKA C;  5C0X I;  4HJ7 A;  1VQ7 A;  3CCJ A;  2I5M X;  2JEB I;  3OTO Q;  5IP9 H;  4AIM A;  3I2Z A;  3U50 C;  1IL2 A;  1GO3 E;  1VQO A;  3ICE A;  5FLM G;  4DUY Q;  1Q1B A;  3HKZ E;  4QIW E;  4YY3 L;  3GTK H;  1YHA A;  2ATW A;  2VZA A;  4KHP L;  4IFD G;  1XPO A;  3S15 H;  3PUX A;  2B63 G;  4YCW A;  1U5K A;  2GN5 A;  4L5S A;  5GAE C;  3RN2 A;  4HIO A;  1VQK A;  2IHF A;  4DR1 L;  3L7Z C;  3RR5 A;  1E7Z A;  3W1B A;  5M5X H;  4BXX G;  5FJ8 H;  1IZ6 A;  3CC2 A;  1VQN A;  1VQA A;  4DK6 C;  4BY7 H;  1JE5 A;  1Q82 C;  1JB7 A;  2E5L Q;  4A3E G;  1L1O A;  1TWF H;  1NY4 A;  3L0O A;  4PZ6 A;  1CSP A;  3F2B A;  4JI8 Q;  3S1R H;  1HR0 W;  1JMC A;  1N33 L;  4GNX C;  1XMQ L;  2IX1 A;  3KF6 B;  4TVA B;  3J80 i;  2PI2 E;  3K8A A;  4LFC L;  3HOX H;  1PH6 A;  3AQQ A;  2XGT A;  5C3E H;  3CXC A;  4A3K H;  2QEX A;  4DV2 Q;  4QL5 A;  1JT8 A;  4OON A;  3KF8 B;  1PH9 A;  2NZH A;  2WB1 G;  3CCS A;  4MNO A;  4DV7 Q;  1N34 Q;  4ME3 A;  4FDB A;  1YJ9 A;  1MJC A;  3S2D H;  3Q8D A;  4DR6 L;  1PVO A;  1G6P A;  2E8G A;  1EYG A;  2R7D A;  4UP8 A;  4LF8 L;  4LFC Q;  3NEL A;  1K73 C;  2VL6 A;  2R93 G;  1EQR A;  2RHQ B;  2OQK A;  1RL2 A;  3CME A;  3F8T A;  3A5U A;  4P73 A;  4GLA C;  2B29 A;  4NXM Q;  1VQ4 A;  3ULP A;  1GVP A;  2XTI A;  4AQY Q;  1KD1 C;  2UUA L;  1JJC B;  4IPD A;  3ERS X;  1NMF A;  1G29 1;  4BY1 G;  4HJA A;  4A3G G;  3KDF B;  5LMN W;  4GOP A;  2Y0S G;  1EQQ A;  5JJL A;  5IP7 H;  1YI2 A;  2JA6 G;  3KYH C;  1OXS C;  4IPH A;  4LFB L;  1SRO A;  1YBY A;  4YCU A;  4DUY L;  1BVS A;  4NXM L;  4AQY L;  1XNR L;  4YY3 Q;  4GN4 B;  4JCV E;  1HZA A;  2L15 A;  2OCE A;  4X66 L;  3I4M H;  2VQE Q;  3TQY A;  4L5R C;  3CC4 A;  2IHE A;  1DGS A;  3F1Z A;  4JYA L;  5IP7 G;  3TRZ A;  3CCQ A;  2R7Z H;  3PSI A;  4DR1 Q;  2ZJQ A;  2HHH Q;  4GNX B;  1P16 A;  4DR7 L;  1HZB A;  4LF9 Q;  1XNR Q;  2F4V Q;  1AE2 A;  4UP9 A;  1Y1V G;  3T1H Q;  2K5H A;  2ZTD A;  5IE8 A;  1XNQ L;  1Y1W G;  1S3O A;  1MKH A;  3TS0 A;  4P71 A;  4WJ4 A;  1V9P A;  1J6Q A;  1N33 Q;  1UE6 A;  3U58 A;  4QJF A;  4C2M H;  4DR5 L;  1PA6 A;  4A75 A;  2D0O A;  1X3G A;  4KHZ A;  4MTN A;  5HY6 A;  3RNU A;  1HZC A;  3U4Z A;  1CSQ A;  4DV2 L;  3K81 C;  4BA2 I;  2F4V L;  3S1N H;  3HOV G;  4DR2 Q;  3SGI A;  2UXB Q;  3STB D;  2JE6 I;  1XNQ Q;  2PNH A;  4JI7 Q;  4DR6 Q;  2MO1 A;  5FJ8 G;  4YCV A;  5M3F H;  1E1T A;  2MQH A;  3AFP A;  4LF8 Q;  2CWA A;  2IX0 A;  5K36 G;  5ELN A;  2Z6K C;  4AYB E;  3MXN B;  4A3J G;  1PHJ A;  3PUZ A;  2ZJP A;  1PFS A;  4DV4 L;  3EN2 A;  1X65 A;  3A74 A;  2OTL A;  4JI7 L;  1HNW L;  3PCO B;  1E1O A;  3CW2 C;  4BXX H;  2VS1 A;  4B3M L;  3E9H A;  1QVC A;  5JJI A;  1WYD A;  5FLX c;  3BJU A;  1K8A C;  4LFB Q;  3PO2 G;  3G4S A;  5LMU L;  5FLM H;  3J81 i;  3RN5 A;  4X66 Q;  4L5T A;  4P75 A;  2VQE L;  4GOP C;  3K0X A;  1UE5 A;  1VQD A;  4C3H H;  1CKN A;  1VQ9 A;  4JYA Q;  4B3M Q;  3PO3 G;  2N49 A;  3TS2 A;  4A3M G;  1WCM G;  2JEA I;  2HHH L;  1GD7 A;  4DR7 Q;  2ID0 A;  3I4N H;  4LF9 L;  4BY1 H;  3FP9 A;  2R6G A;  1Q8K A;  5LMU Q;  4A3G H;  3T1H L;  4KLK A;  2RCN A;  1FGU A;  1EWI A;  4DR3 Q;  2QGQ A;  1EIF A;  1VQB A;  4GKK L;  4DR5 Q;  2WB1 E;  3H0G H;  1UWV A;  2RF4 A;  3M9B A;  4IOC A;  1I6H H;  5JEA J;  1QZG A;  4DR2 L;  2K14 A;  3KF6 A;  1SLJ A;  1TWC H;  2UUC Q;  2UXB L;  1IYJ B;  1CUK A;  4DR3 L;  1N36 L;  2I5H A;  4BBR G;  2AHO B;  4A3M H;  2E2H H;  4YWK A;  4IPC A;  4ALP A;  2RHS B;  4R4Q A;  3ULL A;  4EQ5 A;  1T9H A;  3K80 C;  2UU9 Q;  3S1Q H;  2KBN A;  5M3M G;  1FVI A;  2NVQ H;  1VQM A;  2ZM6 L;  3K7A H;  3HOW G;  4LFA L;  2Y0S E;  2B3G A;  1SRU A;  1N8R C;  4DV4 Q;  2Q2H A;  1SR3 A;  3J7A 5;  2A1A A;  1HNW Q;  1VS0 A;  3S24 A;  1EFW A;  3CCE A;  2DUD A;  2R7Z G;  4JBW A;  5M5Y H;  3CD6 A;  1KL9 A;  1KRT A;  4BBS G;  1K0R A;  2UU9 L;  2KEN A;  2YV5 A;  4PG3 A;  4QGU A;  5ELO A;  4OWW B;  1K83 H;  2VUM G;  2CQO A;  1HZ9 A;  1QVG A;  3DLL A;  2BA1 A;  2ZM6 Q;  1HNZ L;  3W5O A;  2NVX H;  3VDY A;  1VQ5 A;  1PH2 A;  3OW2 A;  4OXP A;  2MFI A;  2MO0 A;  4TQU S;  1I94 Q;  3HOU H;  3UDF A;  4X62 Q;  1ASZ A;  4A3D H;  1B7Y B;  2VUM H;  5M3M H;  3PV0 A;  1WJJ A;  4PZ7 A;  5GRO A;  1D8L A;  1C7Y A;  1IBM L;  1WOC A;  2CKZ B;  1HNZ Q;  1PYB A;  3NBH B;  2CCZ A;  2ZTE A;  2ZTC A;  3E9I A;  5C3E G;  2R93 H;  4GKK Q;  3FHW A;  1A63 A;  3M7N A;  4JC0 A;  4A3B G;  1W3S A;  3HOY G;  1YJW A;  2EIF A;  4JOI C;  3H15 A;  3DM3 A;  1IBM Q;  2NVT H;  1N32 Q;  4R4O A;  3F2D A;  1A62 A;  4YWM A;  1TXY A;  4OWT B;  2K5N A;  2UUC L;  4YHH L;  2K4K A;  1QUQ B;  4UP7 A;  1IBL L;  3M85 A;  1N36 Q;  2R92 G;  2UXD L;  5E7N A;  1BBU A;  1NTG A;  2YTY A;  2PQA A;  2F52 A;  2LSS A;  3PUV A;  4KI0 A;  1E24 A;  1V43 A;  1N32 L;  3TEH B;  3J7Z C;  2E2I H;  1Q12 A;  1PH3 A;  1XPR A;  5GAH C;  4OX9 Q;  4LFA Q;  1K8G A;  4HJ9 A;  4YHH Q;  4DV6 Q;  1LM0 A;  4GLV B;  4A3F G;  1Q86 C;  2D0P A;  5IYB G;  2OTJ A;  4BY7 G;  4JI0 Q;  4JI1 L;  2WAQ G;  2D62 A;  1KC8 C;  1D7Q A;  1O7I A;  1K9M C;  2K50 A;  4DPG A;  3I4N G;  1C0A A;  1TWH H;  4HJ8 A;  1XPU A;  3CCV A;  2LXJ A;  4LF4 L;  1SMX A;  5IYD G;  1IXR A;  3ER0 A;  2JJQ A;  3G48 A;  3BZK A;  4OX9 L;  3EBE A;  2JA9 A;  2YYZ A;  3T1Y L;  4DV6 L;  2N3S A;  1VQF A;  1S72 A;  3KJP A;  4QY7 A;  1PH8 A;  4RMF A;  2YTV A;  3E0E A;  1S40 A;  3AEV A;  4JI0 L;  3GTG H;  3HOZ H;  4PZ8 A;  5IYD H;  3KFU A;  1I94 L;  2MNA A;  1YVC A;  2I5L X;  4X62 L;  4IO9 A;  5IYC G;  4OO1 G;  3PF4 A;  2JA5 G;  1R9T H;  1VQJ A;  3BU2 A;  1E22 A;  3W1G A;  3UE0 A;  5C4X H;  1OXV A;  4LF4 Q;  1EIY B;  4DNI A;  3S16 H;  3T1Y Q;  1B8A A;  1PH1 A;  2K5V A;  1YEZ A;  3ZJY C;  1QVF A;  4A93 G;  1M1K C;  2R7F A;  5IWA Q;  3HOX G;  3PIP A;  1X3F A;  1CKN B;  3RZO H;  4A3K G;  1TWG H;  3KLW A;  5HGQ A;  2OWO A;  4Y52 H;  5GQO A;  2VW9 A;  4O0A A;  3CCM A;  1X6O A;  3AYH B;  2EXD A;  3H3V H;  4UY8 C;  1NMG A;  4DV1 Q;  1X3E A;  1CKM A;  3I55 A;  1IBL Q;  4JG2 A;  3M4P A;  1QZH A;  1YHB A;  4GKJ L;  1XMO L;  1NJI C;  2UXD Q;  4JI3 L;  1K3R A;  4B3T L;  5GAD C;  1M90 C;  2PQA B;  1OXU A;  1HJP A;  5M5W H;  4P72 A;  1W2B A;  4DV0 Q;  3JC6 6;  4DR4 Q;  3RZD H;  3UDI A;  4A3B H;  3HOU G;  4DV1 L;  4NXN Q;  1G51 A;  5JJK A;  3GTJ H;  2I0Q A;  3GD7 A;  2UXC L;  4GKJ Q;  4A76 A;  4JI1 Q;  2JQO A;  4JI3 Q;  3H3V I;  4DV5 Q;  1ASY A;  1H95 A;  2PMZ E;  1WCM H;  3J80 c;  4BBS H;  2JA6 H;  1QUQ A;  2IT1 A;  2AMC B;  4HIM A;  4LUV A;  4C3J H;  2ALY B;  3I4O A;  4DV0 L;  1PH5 A;  5JEA G;  4B3S L;  5C4X G;  2VQF Q;  3HFZ B;  1HR0 L;  2KCT A;  4GN5 A;  4LUO A;  3F2C A;  4GLX A;  2E2J H;  4JI5 Q;  3G6E A;  3PO3 H;  4B3R Q;  1KXL A;  1LTL A;  1VQ6 A;  1LUZ A;  2KCM A;  2VY3 A;  5C0X G;  4A3C G;  3TRE A;  2NN6 G;  4OWX B;  4DV5 L;  3J81 c;  4QQB X;  1A0I A;  5DLQ E;  4L5Q A;  4LUZ A;  1VCI A;  5M3F G;  2PI2 A;  1UE1 A;  1CKO A;  2CWP A;  4MZ9 A;  4DAM A;  3AFQ A;  4BBR H;  2UUB Q;  3M4O H;  4B3S Q;  1I50 H;  1L2F A;  2VQF L;  1MIU A;  4J15 A;  3RLF A;  1JJ2 A;  4B3R L;  3CQZ H;  1VQI A;  4DUZ Q;  1I5F A;  1N9W A;  4JOI A;  1PH4 A;  1AE3 A;  5IWA L;  4IFD I;  3LGJ A;  3PF5 A;  2DGY A;  3UE1 A;  2Z6K A;  1PV4 A;  1A8V A;  1B70 B;  2UUB L;  1OXX K;  3IRB A;  4HIK A;  1UE7 A;  1Q1E A;  4H02 A;  5H1S E;  1XTD A;  3WWV A;  2VNU D;  1P8L A;  4NB3 A;  1LYL A;  1L1O C;  1HH2 P;  1VQG A;  2HT1 A;  2R92 H;  1XMO Q;  3CP0 A;  4B3T Q;  1Y14 B;  3CPW A;  3A5Z B;  1SN8 A;  4IJH A;  1Z47 A;  4POG A;  2WFW A;  4JI6 Q;  4GN3 B;  2A19 A;  3CPF A;  3A0J A;  1X9N A;  3PUY A;  1L0W A;  4OO1 I;  4DR4 L;  3FKI G;  4IPG A;  3HOZ G;  3PGZ A;  5AJ3 L;  3GTM H;  4JV5 L;  1U0L A;  4BA1 I;  3U4V A;  5IY0 A;  5C4J H;  1AH9 A;  4NXN L;  4R1J A;  4XIG S;  4A3E H;  4A4I A;  2UXC Q;  4JBK A;  2Z0S A;  4K0K Q;  3BZC A;  2AKW B;  4UPA A;  4JBJ A;  2YTX A;  1YIT A;  5EAY A;  2KHJ A;  1YIJ A;  4LF5 L;  4JI2 L;  5AJ3 Q;  4JI5 L;  1HR0 Q;  2N8N A;  4X6A H;  2QA4 A;  5BR8 L;  1FL0 A;  3M3Y H;  1UEB A;  4POF A;  5IYB H;  2GVA A;  2AWN A;  1L1O B;  2BA0 A;  1VQP A;  2JA7 G;  3PUW A;  3CCR A;  3I7F A;  5C44 G;  3B6Y A;  1NE3 A;  1Z9F A;  2A8V A;  3UDX A;  1OXT A;  3HKZ G;  2K52 A;  4JI4 Q;  2GVB A;  2OQ0 A;  4Y7N H;  3S14 H;  2WP8 J;  2F3I A;  4DUZ L;  1YZ6 A;  3CMA A;  2LXK A;  2N78 A;  5BR8 Q;  2K75 A;  5LMN Q;  1E3P A;  4X65 Q;  4P74 A;  1WFQ A;  2H5X A;  3GTQ H;  2Q2I A;  3K7U C;  3G71 A;  2Q2T A;  3S2H H;  4EX5 A;  3GDE A;  1YHQ A;  4IJL A;  1IBK Q;  1FJG Q;  2NVY H;  3RLN A;  3ULJ A;  1JJG A;  1EUJ A;  3HKS A;  2HIV A;  4HJ5 A;  5C0X J; 
#chains in the Genus database with same CATH topology
 3GTL H;  4GNX A;  2JA8 B;  1ENF A;  1NBW A;  4YWL A;  3VR4 A;  5I9O A;  5FO9 B;  1E2W A;  1QG7 A;  4R4T A;  5J22 A;  2CVR A;  2JXM B;  1JC7 A;  3PIO 3;  1KIX A;  3FEW X;  5C4J B;  1EQV A;  4GOP B;  3NK9 A;  4R4I A;  4K0K L;  4OGQ C;  2KED A;  4A93 H;  4PNY A;  3CAM A;  1XJV A;  4LF5 Q;  3GO5 A;  1KQS A;  1Q7Y C;  1VQL A;  2H4O A;  1BBW A;  4DAV A;  2V1C C;  1Y8N B;  4R4C A;  1KAB A;  3V05 A;  1VQH A;  3I4M B;  4RCN A;  3HZX A;  3PO2 H;  5EPK A;  2A68 C;  4A3J H;  4LW1 A;  1C9O A;  3T56 B;  1HTL D;  4LNQ A;  4C3J G;  3L2P A;  2ES2 A;  1Q90 A;  3KOJ A;  3I56 A;  2XNA C;  2FJ2 A;  3ITP A;  1Q46 A;  1UEA B;  3LWE A;  4HSV A;  3FKI H;  3A56 A;  3LWU A;  1J5E Q;  2E5L L;  3MA2 B;  2AWO A;  2SDF A;  2JK8 A;  1DOM A;  4A3I H;  2CFM A;  2D9U A;  3HOV H;  1DYQ A;  3L9A X;  2F1M A;  4DV7 L;  3NBI A;  4APV A;  2A6E C;  1X56 A;  4J1M A;  1PYS B;  2AQ2 B;  1EY7 A;  3MXG A;  3D31 A;  4K6L A;  1U9R A;  2LKV A;  5CV9 A;  3NTK A;  5C44 H;  3PIP 3;  1AZQ A;  3OIQ A;  1E2Z A;  4K5W A;  2I5M X;  5EBC A;  4EQP A;  1BF4 A;  2NTT A;  1IL2 A;  1JOR A;  2HDL A;  2D2C C;  5FLM G;  3BVM A;  4DUY Q;  3ONA B;  1Z7T A;  4IZ8 A;  3S15 H;  3H0G B;  2B63 G;  4YCW A;  3HOU B;  1I6V C;  3L7Z C;  3W1B A;  5M5X H;  2K01 A;  5FJ8 H;  3CC2 A;  4Q5V A;  3IAY A;  4BY7 H;  1JE5 A;  1L1O A;  3L0O A;  1CSP A;  2PI2 E;  2L5T A;  5C3E H;  1JB3 A;  2NYZ D;  4OON A;  3KF8 B;  2WB1 G;  1TS2 A;  1EIH A;  1XX8 A;  1IW7 D;  1YJ9 A;  2X69 A;  2E8G A;  4KKS A;  4UP8 A;  1TVX A;  2R93 G;  1RL2 A;  3CME A;  1STH A;  2B29 A;  2K03 A;  5D14 A;  3K58 A;  2XTI A;  1KD1 C;  2UUA L;  1GUT A;  1NMF A;  4BY1 G;  4HJA A;  1EYD A;  4A3G G;  3RZO B;  3HOY B;  2Y0S G;  5IGD A;  5JJL A;  2RA4 A;  1QOH A;  2RQX A;  4R8I A;  4ZQ3 A;  4AQY L;  4YY3 Q;  4GN4 B;  2VQE Q;  3VA5 A;  4L5R C;  2IHE A;  3F1Z A;  4JYA L;  5IP7 G;  2PW7 A;  1H9S A;  5A35 A;  2A5H A;  4BS9 A;  2J4X A;  1P16 A;  3MVV A;  2NUC A;  1XNR Q;  4RHS A;  2LFN A;  1S3O A;  1TR5 A;  3MTS A;  1V9P A;  1J6Q A;  1IW7 C;  1EWC A;  3SE0 A;  1EZ6 A;  1PZI D;  1F77 A;  1B2T A;  3PMF A;  2UXB Q;  2JE6 I;  4DR6 Q;  2MO1 A;  5EKK A;  5M3F H;  1E1T A;  2QDL A;  1RJT A;  4BBR B;  4HCS A;  3NXW A;  2ZJP A;  1A15 A;  1EU4 A;  5EBD A;  1Y1V B;  4DXG A;  4DV4 L;  3A74 A;  2OTL A;  1HNW L;  5C4X B;  1E1O A;  1D1K A;  4BXX H;  1A3T A;  1RTN A;  1WTQ A;  4B3M L;  3E6Z X;  3E9H A;  1QVC A;  1WYD A;  1AW7 A;  5FLM H;  3H6M A;  4DAY A;  2I07 B;  1TY2 A;  1KAA A;  1VQD A;  3J80 E;  1SXT A;  4B3M Q;  2A69 C;  4OEL B;  4A3M B;  1LT4 D;  3TS2 A;  4FXD A;  2HHH L;  4DR7 Q;  2ID0 A;  1TWH B;  4LF9 L;  3FP9 A;  1Q8K A;  4HN7 A;  1O7L A;  2ENB A;  4FO2 A;  1VQB A;  2R61 A;  4GKK L;  1I4P A;  2RF4 A;  3J81 L;  1I6H H;  3MAQ A;  1PLF A;  4CDD C;  3S1N B;  3A8I E;  4KY7 A;  5FLX E;  4XYQ A;  4QIW B;  3S1Q B;  4XDX A;  1N36 L;  3F2U A;  3QOL A;  1B53 A;  1MHW C;  3ULL A;  3PO3 B;  3QWN A;  3S14 B;  1PTO D;  4EQ5 A;  3L3O C;  3K7A H;  1DOL A;  1PTO B;  1UUP A;  2Y0S E;  1SRU A;  1N8R C;  3AMU A;  1VS0 A;  1EFW A;  3CCE A;  2R7Z G;  4WJW A;  5M5Y H;  3CD6 A;  1KRT A;  4BBS G;  5EPJ A;  2EYF A;  2F0K A;  4QGU A;  2F0S A;  2L4N A;  1ZKO A;  1K8O A;  3DLL A;  2BA1 A;  2MJ8 A;  2FMM A;  3GP7 A;  1LTI D;  1PH2 A;  3C1E A;  1CQV A;  5G3L D;  4XXE A;  2VUM H;  1RCV D;  5C5M A;  4PZ7 A;  1I4R A;  1X3Q A;  4RGO S;  2F0M A;  2CKZ B;  1HNZ Q;  1EY8 A;  3NBH B;  4XYO A;  5C4H A;  4IUR A;  1CTM A;  2F3W A;  4JC0 A;  4A3B B;  1YJW A;  2NBF A;  2EIF A;  3I73 A;  3K5O A;  4JOI C;  3A54 A;  3DM3 A;  2NVT H;  1N32 Q;  5EJW A;  4K5V A;  3F2D A;  4RH6 A;  4OWT B;  4YHH L;  1QUQ B;  5LL6 S;  3M85 A;  1AZP A;  4FF4 A;  5KYL A;  2R3Z A;  5E7N A;  4IN3 A;  4KI0 A;  2QW7 A;  5C0X H;  1Q12 A;  3A7L A;  1NR4 A;  2WKD A;  4HJ9 A;  4YHH Q;  4A3F G;  1LM0 A;  4GLV B;  2D0P A;  4BY7 G;  4JI1 L;  2F0I A;  2D62 A;  1KC8 C;  3JAM E;  1K9M C;  2CW0 D;  1TWH H;  5I6Y A;  5IYD G;  1IXR A;  3D8G A;  3DWP A;  3EBE A;  4G57 A;  5IT9 L;  2YYZ A;  1VQ6 A;  3AEV A;  3GTG H;  4F88 A;  1ICF B;  5E3F A;  1H9J A;  3HOZ H;  5IYD H;  1F2Y A;  4DU9 A;  5KEE A;  3ZJY C;  1F2L A;  2RCF A;  3C3L A;  5IWA Q;  2BCO A;  2KJX A;  2M00 A;  3P1H A;  3KLW A;  2VW9 A;  1EY5 A;  3C1F A;  1X6O A;  3AYH B;  1HXY D;  1LAC A;  4DV1 Q;  2SOB A;  1X3E A;  2CQA A;  1IBL Q;  3N52 A;  1YHB A;  4HMJ A;  5IGG A;  4HMI A;  4DV0 Q;  4TRD A;  4A3B H;  2A69 D;  2WAQ B;  4DV1 L;  4OL7 A;  1IKL A;  3R3O A;  1LT5 D;  4KK7 A;  5CC4 A;  4Q0F A;  4BBS H;  2F0V A;  3TP8 A;  4C3J H;  2ALY B;  1A3U A;  3SDZ A;  1PH5 A;  4K6D A;  5JEA G;  5C4X G;  3DUZ A;  2VQF Q;  4GLX A;  1K0S A;  4EQO A;  3NBH A;  3G6E A;  1LUZ A;  3N6R A;  4DV5 L;  3I70 A;  5I4D A;  5M3F G;  2F4I A;  3NQI A;  1UE1 A;  1CKO A;  2CWP A;  3I8Z A;  4DAM A;  3M4O H;  1WTX A;  2VQF L;  3TZU A;  2IL8 A;  3CQZ H;  4M8A A;  2Q8R E;  3BDC A;  1MSG A;  1AE3 A;  2LY7 A;  3LGJ A;  4L63 B;  4P2C B;  4ZK9 B;  1AP0 A;  3PF5 A;  5C3W A;  3UE1 A;  4ME5 A;  3GTP B;  1A8V A;  2UUB L;  2DJG C;  1CK1 A;  2WAC A;  1XTD A;  1P8L A;  1LYL A;  1F9P A;  2CHB D;  1SYC A;  2WIN B;  1RF2 D;  3CPW A;  3OOC A;  2A19 A;  3CPF A;  1ONL A;  1L0W A;  2XRQ D;  3HOZ G;  3U4V A;  4NXN L;  4V0B A;  4A4I A;  1SEB D;  3BZC A;  3VYS A;  2EE1 A;  4UPA A;  4B08 A;  4C1N I;  2DN8 A;  5AJ3 Q;  3VYR A;  2N8N A;  3FVQ A;  3CQZ B;  2B63 B;  4X6A H;  2QA4 A;  2A6H D;  5BR8 L;  4QCL A;  1UEB A;  2JN4 A;  1L1O B;  3CCR A;  4RGM A;  2F0F A;  4ABN A;  1LT3 D;  2GVB A;  4RA8 A;  4Y7N H;  2WP8 J;  2OT2 A;  5COR A;  4DUZ L;  1YZ6 A;  2N78 A;  5FOB B;  4HSP A;  3WOF A;  5LMN Q;  1B1Z A;  5IOD A;  1WFQ A;  3GTQ H;  5DEH A;  3VR5 A;  3G71 A;  2Q2T A;  2J0T D;  4C3I B;  1HHV A;  2KEC A;  5JVG 3;  1FJG Q;  2NVY H;  3KBX A;  2EZV A;  1EQT A;  3HOV B;  2HIV A;  4POG A;  1JIC A;  5J39 A;  5BN3 A;  1YNJ C;  3D0F A;  2HCI A;  4JI6 L;  3OYY A;  4GS3 A;  4TSS A;  2F0W A;  1SE2 A;  3OW7 A;  1FJG L;  4JV5 Q;  2B2Y C;  2NZO A;  2ZJR A;  4K14 A;  3KDF A;  4ZCK A;  4FXG C;  5IT9 c;  1AFP A;  3BG3 A;  1EOV A;  2EYP A;  2HQL A;  3PIO A;  2BE5 C;  3CCU A;  1YNN D;  4N9T A;  3STB C;  2WAQ E;  2BDO A;  4LF6 Q;  3MEF A;  3P75 A;  2JA7 B;  1F9S A;  3CCL A;  1GOZ A;  2N55 A;  2DY8 A;  1D2B A;  1STA A;  3NTI A;  1V1Q A;  5GAG C;  1GKH A;  1JOO A;  2R93 B;  4LF6 L;  4KN7 C;  4JI4 L;  1EEI D;  2N88 A;  2KHS A;  3SEB A;  2A6E D;  1K3B C;  2PCF B;  4S3S A;  4A3F H;  3HOW H;  1KAW A;  4A93 B;  4A3I G;  1DJR D;  3D3R A;  4X65 L;  4CKB A;  2BH8 A;  2L12 A;  2HUG A;  3Q23 A;  1VQ8 A;  4JI8 L;  3OWE B;  3TP5 A;  4DAY B;  3LX0 A;  2Z1C A;  4A3L G;  2JA8 G;  3RMH A;  3NEM A;  1HNX Q;  3QIA A;  2XRS D;  1N34 L;  2JA8 H;  4C3J B;  3TP6 A;  3GTL B;  1R4Q B;  2MGS A;  3NEN A;  2ASB A;  2Q8T A;  4CJ1 B;  2KVM A;  1PH7 A;  2EVB A;  3OTO L;  3GV6 A;  2HQE A;  4XQJ A;  4C3I H;  1RDP D;  1VMC A;  4AH6 A;  1CQF A;  5BN4 A;  2DY7 A;  1S5D D;  1S5B D;  4AIM A;  3HOX B;  1TWC B;  1GO3 E;  3M4Y A;  2KCN A;  4QIW E;  4YY3 L;  3GTK H;  4CDE C;  5A2Q L;  2I46 A;  4L5S A;  3KLS A;  1D6E C;  1VQK A;  1NSN S;  1PFM A;  3RR5 A;  1SYB A;  1E7Z A;  1VQA A;  1TS3 A;  4FP5 D;  1K83 B;  5K36 H;  4A3E G;  1TWF H;  4PZ6 A;  1NY4 A;  4ZAI A;  1HR0 W;  4JI2 L;  3F2B A;  2IX1 A;  4RFB A;  4LFC L;  1EY6 A;  2IWH A;  4QUC A;  2XGT A;  3CXC A;  1FNV A;  4KN4 C;  3MHB A;  5C3X A;  1JT8 A;  3IFT A;  2E76 C;  2NZH A;  1PZJ D;  4MNO A;  4DK0 A;  4EGV A;  4ME3 A;  4FDB A;  1YNN C;  4H44 C;  2R7D A;  4CJ0 B;  4LFC Q;  3DMU A;  2OQK A;  3FMC A;  2PZW A;  1VQ4 A;  1W6J A;  4K5X A;  3ERS X;  5ISR A;  3KDF B;  2GA4 B;  2A73 B;  3T16 A;  1EQQ A;  5C6A A;  1HA6 A;  5IP7 H;  1YI2 A;  4IPH A;  1YBY A;  4DUY L;  1BVS A;  1BCP D;  4E6I A;  3I4M H;  3TQY A;  1D5X C;  3CC4 A;  2ZXO A;  1WTP A;  2FFK B;  3CCQ A;  2R7Z H;  2FHT A;  3HOZ B;  2ZJQ A;  4GNX B;  4DR7 L;  4XQQ A;  1AE2 A;  4UDU C;  2ZTD A;  5IE8 A;  1HFG A;  1B3Q A;  3A8K E;  1CM9 A;  3U58 A;  2K6A A;  1BDO A;  1ROD A;  4EQN A;  1PA6 A;  2D0O A;  5HY6 A;  1SJE D;  1HZC A;  3RNU A;  1CSQ A;  3S1N H;  5A2Q E;  1V8Q A;  3STB D;  3M3Y B;  2Z4H A;  3CU7 A;  2G9D A;  2IX0 A;  5FO8 B;  1S4Z A;  1KNA A;  3MXN B;  4CJ2 C;  1PTO H;  3G7L A;  1FR3 A;  4JK1 C;  5FLX L;  2CH4 A;  4DK1 A;  4JI7 L;  4OEM B;  4IUQ A;  3J81 E;  3NP8 A;  4GZY C;  1Y8P B;  1EU3 A;  5JJI A;  2C5C A;  5DM7 3;  5FLX c;  1E2V A;  5D65 A;  3PO2 G;  3G4S A;  5LMU L;  1HPC A;  3TDQ A;  3J81 i;  4L5T A;  4KD3 A;  1JWU D;  2AQ1 B;  2VQE L;  1H9R A;  1VQ9 A;  1CKN A;  4RGN A;  2E2H B;  4A3M G;  1OO9 B;  2JEA I;  1CA6 A;  1ET6 A;  3JAM L;  1F9Q A;  3I4N H;  2EYH A;  3D6C A;  4DNT B;  4QUF A;  1EWI A;  4DR3 Q;  1WTW A;  3HP3 A;  2K05 A;  2NVQ B;  1E0B A;  1I4X A;  3J7A F;  5IGE A;  1PYW D;  3HKZ B;  2R92 B;  4DR3 L;  4BBR G;  1LTS D;  1WTH A;  2AHO B;  4IPC A;  5C44 B;  1MGS A;  4RGT A;  1T9H A;  2UU9 Q;  3S1Q H;  5M3M G;  3FPP A;  1VQM A;  2ZM6 L;  4IFD H;  5C3E B;  2Q2H A;  4CBV A;  5CMD A;  2A1A A;  1KL9 A;  2PZU A;  1XTC D;  2KEN A;  2YV5 A;  2UU9 L;  3S1M B;  5ELO A;  1ESF A;  5IGC A;  1K83 H;  2CQO A;  1QVG A;  2ZM6 Q;  3OW2 A;  4OXP A;  2MFI A;  2MO0 A;  1ICW A;  2MHV A;  3OIP A;  4X62 Q;  2LMC B;  3R8B A;  2NVY B;  1WJJ A;  4HAE A;  3KF8 A;  4I65 A;  5M3M H;  2E2I B;  3ERQ A;  1PYB A;  1KLG D;  3ND9 A;  2Z9H A;  2CCZ A;  1MBY A;  3GTJ B;  1ML0 D;  4GKK Q;  1A63 A;  3M7N A;  1U4R A;  1QNK A;  1KLU D;  1IBM Q;  2O2L D;  2K5N A;  2K4K A;  1ZXT A;  1IBL L;  1T5E A;  2R92 G;  1JQY D;  4FNF A;  5M3F B;  2F52 A;  4OO1 H;  4PQX A;  2B8F A;  3J7Z C;  1PH3 A;  2VB2 X;  4LFA Q;  1K8G A;  3SVM A;  3AB9 A;  2OTJ A;  3H3V C;  3TBI B;  4JI0 Q;  2K32 A;  1O7I A;  1SNM A;  1PMR A;  4DPG A;  4BY1 B;  4A3G B;  2LXJ A;  1SMX A;  1EY0 A;  3G48 A;  2B2U C;  2N3S A;  3O13 A;  4RMF A;  2YTV A;  3VA7 A;  2ICE C;  1S40 A;  3P7J A;  4JI0 L;  5M9O A;  2G5D A;  1I94 L;  1LTR D;  3AU7 A;  5IYC G;  3PF4 A;  1TWF B;  2K1B A;  4BY7 B;  3S16 H;  3T1Y Q;  4OIK A;  1PH1 A;  1QVF A;  3ZYY X;  3CRL C;  2AQ3 B;  4M1U B;  3PIP A;  3RZO H;  3VYT A;  1XWE A;  4A3K G;  1ET9 A;  1ESR A;  2JP1 A;  1K28 A;  4UY8 C;  1NMG A;  1WTR A;  1NUC A;  3I72 A;  1QZH A;  1K3R A;  3EJI A;  1OXU A;  5M5W H;  5ELF A;  1LT6 D;  3UDI A;  4NXN Q;  1B3A A;  2F0Q A;  3GD7 A;  4GKJ Q;  4Z9C B;  2JQO A;  2PQE A;  4L8J A;  1PTO C;  1GUO A;  4JI3 Q;  3H3V I;  1I4Q A;  3S1R B;  1DON A;  3MXP A;  2E2J H;  3HFZ B;  5I2Y A;  3F2C A;  4LUO A;  3KLS X;  3URY A;  3TP7 A;  1STB A;  4B3R Q;  1KXL A;  4RAU C;  4CDC C;  4LK1 C;  1TT2 A;  2VY3 A;  3ND8 A;  4QQB X;  4CGY B;  1A0I A;  1I3Q B;  3IKJ A;  2PI2 A;  3AFQ A;  1MIU A;  5E4X A;  4J15 A;  1JJ2 A;  3HOW B;  1N9W A;  4JOI A;  1PH4 A;  5IWA L;  3NWS A;  1PV4 A;  1UE7 A;  2EYJ A;  5H1S E;  3MXU A;  5CV4 A;  1L1O C;  1NCV A;  1HH2 P;  1EYC A;  2HT1 A;  4B3T Q;  1Y14 B;  3A5Z B;  1SN8 A;  4IJH A;  1Z47 A;  4GN3 B;  3A0J A;  3PUY A;  5CYU A;  4AYB B;  4IPG A;  3GTM H;  4JV5 L;  1U0L A;  3VR2 A;  1AH9 A;  4NP5 A;  1AEX A;  4A3I B;  4JBK A;  3K0Y A;  4HR7 B;  4JBJ A;  2FMC A;  1YIT A;  1V1P B;  1YIJ A;  4RKL A;  3BDL A;  4RKB A;  4FF2 A;  4JI5 L;  1HR0 Q;  1EOT A;  2EY6 A;  1DM0 B;  2B39 A;  3DEP A;  3MC0 B;  1RHP A;  4FXK C;  1B9N A;  5IYB H;  5C44 G;  1NE3 A;  1Z9F A;  2A8V A;  4JI4 Q;  5L37 A;  4A3E B;  1SYG A;  3W2D A;  3IFD A;  4P74 A;  5KGU A;  3BDO A;  3K7U C;  3S2H H;  3WDN A;  1YHQ A;  1A6X A;  4IJL A;  3ULJ A;  2RBM A;  2BE5 D;  3HEJ A;  4ULL A;  1WI5 A;  1AN8 A;  1Y1V H;  1QWY A;  1D5M C;  3JAM i;  1PFN A;  4AYB G;  3JAM c;  3KJO A;  1IBK L;  1B50 A;  2Q8I B;  3S1M H;  5KNB A;  4X3U A;  2JA5 H;  5CV8 A;  2BH2 A;  2DNC A;  2KCC A;  1X54 A;  1HQR D;  1G2S A;  2EJM A;  3EIV A;  2NVT B;  4JBM A;  4RG1 A;  2P5Z X;  1X55 A;  1TY0 A;  3BYT B;  1CHQ D;  3GTM B;  2IY5 B;  4KHV A;  4A3C H;  4NW2 A;  3E5S A;  1TWA H;  3S17 B;  1YNX A;  3GTP H;  2MUY A;  2HIX A;  1HCZ A;  3RLO A;  2YU9 H;  5CR3 A;  5G3L F;  3CC7 A;  4N9P A;  4LF7 Q;  3CF5 A;  4K8J A;  4WOR A;  4DV3 Q;  4A3D B;  2EOT A;  5LMN L;  2FXQ A;  4FYD A;  2VUM B;  1KHI A;  4JI2 Q;  3SR1 A;  3R2T A;  4LF7 L;  1XMQ Q;  2EQS A;  5KND A;  4DV3 L;  2IPK D;  4X64 L;  1SFO H;  5D3I B;  1J5E L;  4A3L H;  3A8J E;  3S17 H;  2Q2U A;  1SSO A;  4O42 A;  3UDG A;  4X64 Q;  1SND A;  2AUK A;  3DEO A;  2NN6 I;  1QE6 A;  1VQ7 A;  3SK6 A;  3CCJ A;  1GUN A;  2PNR C;  1Q8I A;  4XT1 B;  1QNU A;  3HKZ E;  1H9M A;  1YHA A;  2ATW A;  4KHP L;  1SFO B;  5EKL A;  4L6T B;  5GAE C;  3RN2 A;  4KKU A;  1LTG D;  4HIO A;  4DR1 L;  3R93 A;  2OEO A;  4BXX G;  4DK6 C;  1M4V A;  4JPB W;  4ZKB B;  1JB7 A;  4N8X 1;  1JMC A;  2A68 D;  1N33 L;  3D4D A;  4JI8 Q;  2JA6 B;  4GNX C;  4G7H C;  4TVA B;  3HOX H;  3K8A A;  2X6L A;  3AQQ A;  4A3K H;  2QEX A;  4MTK A;  4DV2 Q;  4QL5 A;  3K7A B;  1G2T A;  2RDH A;  2CW0 C;  1PH9 A;  4Y7N B;  1N34 Q;  2F0N A;  4UHV A;  3J7Y W;  1MJC A;  3S2D H;  3Q8D A;  2B2U A;  3I91 A;  4OIJ A;  2ZT9 C;  1EYG A;  3R2I A;  3E3X A;  4LF8 L;  3BZD B;  2RHQ B;  3F8T A;  5I9P A;  4GLA C;  4NXM Q;  1HA5 A;  3ULP A;  1O7Z A;  1GVP A;  4AQY Q;  5CV6 A;  2K04 A;  1TWG B;  3EQL C;  2HD3 A;  4GOP A;  1LTB D;  4LMQ D;  2H1E A;  1C8C A;  1OXS C;  2Z6B A;  4NXM L;  4YCU A;  1XNR L;  1W6K A;  2NVX B;  4BWG B;  1NAP A;  4X66 L;  1HZA A;  2OCE A;  1PXU A;  3H09 A;  3OWF A;  4KTA A;  3X3N A;  2KUM A;  1Y1V G;  3T1H Q;  4P71 A;  1SYD A;  1XXG A;  4QJF A;  2JYO A;  4C2M H;  4A75 A;  4MTN A;  4CHT B;  3U4Z A;  4BA2 I;  1EEF D;  5CBA E;  3HOV G;  1CHP D;  1MI2 A;  3Q22 A;  5IT9 E;  1KDA A;  4DAP A;  1CA5 A;  4X3K A;  1KTK A;  1JOQ A;  5ELB A;  2G9H D;  5K36 G;  2RKS A;  4AYB E;  3EA6 A;  4A3J G;  5DAU A;  1PFS A;  3EVQ A;  3M7G A;  3EN2 A;  3PCO B;  3CW2 C;  2VS1 A;  1B44 D;  1II3 A;  5KIX A;  1LV9 A;  3K6O A;  1TQO A;  2QEJ C;  4QMG A;  1LTT D;  3BJU A;  1K8A C;  4LFB Q;  2F0P A;  3NQT A;  4P75 A;  1LTA D;  3K0X A;  3SK8 A;  3KBG A;  2F0E A;  1SNQ A;  4WRD A;  1HFN A;  3PO3 G;  2N49 A;  1GUW A;  2RCN A;  3FKI B;  1FGU A;  3NWT A;  2QGQ A;  2B2Y A;  3CHB D;  4DR5 Q;  2KA7 A;  4I7Z C;  1UWV A;  3M9B A;  2NWG A;  4IOC A;  3NHH A;  5JEA J;  1QZG A;  4DR2 L;  3S2H B;  2K14 A;  2MPM A;  4TKO B;  1NR2 A;  1TWC H;  2UUC Q;  3GTQ B;  1IYJ B;  2I5H A;  1B4O A;  2XN9 C;  1FD7 D;  2E2H H;  1I4H A;  4YWK A;  4R4Q A;  2WII B;  4G7O C;  4NKL A;  1IHZ A;  1S5E D;  2KBN A;  1FVI A;  2B2V A;  1SDF A;  4LFA L;  3J7A 5;  1SR3 A;  1NNX A;  3S24 A;  5T1I A;  4DXF A;  1ILP A;  4JBW A;  1RTO A;  1K0R A;  4DFA A;  4KJO A;  1HZ9 A;  1HNZ L;  1QCB D;  1U4M A;  1QB5 D;  2OF1 A;  2V4D A;  5HGT A;  1I94 Q;  4DN4 M;  3HOU H;  3UDF A;  1IL8 A;  1O80 A;  1L0Y B;  1D8L A;  3X3M A;  2ZTC A;  2EJG C;  3E9I A;  3T53 B;  4HED A;  2R93 H;  3FHW A;  5IIF A;  1W3S A;  3HOY G;  4HCE A;  1CZG A;  3H15 A;  1TII D;  2NZ1 D;  2VXW A;  1A62 A;  1TXY A;  4K8I A;  1JWM D;  5ELE A;  1F9R A;  3SXH A;  1MD2 D;  1RKN A;  4RCO A;  1BBU A;  1NTG A;  5M3M B;  1T5X D;  4ILW A;  4ZLT F;  2LSS A;  1E24 A;  3RZD B;  1DXM A;  2F0D A;  1N32 L;  5KYI A;  1SE4 A;  1XPR A;  2E75 C;  5GAH C;  1Q86 C;  1D5Z C;  1SNO A;  5IYB G;  2E2D C;  1TKW B;  1D7Q A;  1FYC A;  2IW3 A;  3I4N G;  2L0C A;  1C0A A;  1X32 A;  1XPU A;  4LF4 L;  3HG9 A;  2DJF C;  2JJQ A;  3NE5 B;  3BZK A;  4FVM A;  4ZKC B;  1BNZ A;  5CV7 A;  1VQF A;  1DCZ A;  3KJP A;  4QY7 A;  1PH8 A;  2EY1 A;  3QJY A;  2RDF A;  3KFU A;  1EY9 A;  1YVC A;  4X62 L;  4IO9 A;  3OPO A;  1V1O A;  1GXD C;  5DNF A;  4CKC A;  1E22 A;  3W1G A;  3UE0 A;  4LF4 Q;  2HCC A;  3DM1 A;  1EIY B;  1B8A A;  3FDT A;  4NDX A;  2K5V A;  1YEZ A;  1M1K C;  2R7F A;  4C56 C;  1X3F A;  1CKN B;  1JR0 D;  1TWG H;  1MSH A;  3GV3 A;  2OWO A;  5GQO A;  4O0A A;  3CCM A;  3V2T A;  4KJN A;  2MP1 A;  1U4P A;  2PZT A;  2SEB D;  1CKM A;  4JG2 A;  3OMG A;  2UXD Q;  4B3T L;  2ICI A;  4C2M B;  1M90 C;  2EY2 A;  2PQA B;  1HJP A;  3S16 B;  3K57 A;  1EFI D;  3HOU G;  5JJK A;  1EWH A;  3GTJ H;  4A76 A;  1H95 A;  4DV5 Q;  2PMZ E;  2YU9 B;  2RVL A;  4K2L A;  2L55 A;  2JA6 H;  1FNW A;  4HIM A;  2AMC B;  3MFY A;  1Y69 U;  4LUV A;  4DV0 L;  1TU2 B;  1HR0 L;  4GN5 A;  4JI5 Q;  3QB3 A;  1BCP C;  2J7Z A;  2QCP X;  3FPU B;  2KCM A;  2QKI C;  4OWX B;  5JEA H;  4PMC A;  5E1F A;  3J81 c;  1KNE A;  4MN3 A;  1VCI A;  1G91 A;  2UUB Q;  4MZ9 A;  3SHL A;  3K5M A;  5COY A;  1VF5 C;  1VQI A;  2NTS A;  1I5F A;  1SBB B;  2PPB C;  4IFD I;  2PYK A;  2DGY A;  4FF1 A;  3PO2 B;  1B70 B;  1A3V A;  3IRB A;  3FRP B;  2E74 C;  4HIK A;  2KEE A;  1Q1E A;  2KQ3 A;  4H02 A;  2L11 A;  4NB3 A;  1A2T A;  1VQG A;  1VF7 A;  1XMO Q;  1EL0 A;  2B2V C;  3CP0 A;  2WFW A;  3KK7 A;  1X9N A;  1HTP A;  4DR4 L;  5HUR A;  3PGZ A;  5AJ3 L;  4U67 3;  4BA1 I;  4DA2 A;  5C4J H;  1JWS D;  3C46 A;  4XIG S;  4A3E H;  3D4R A;  2UXC Q;  2Z0S A;  4K0K Q;  2AKW B;  2YTX A;  5EAY A;  4LF5 L;  1PTO F;  2SNS A;  3K5N A;  5EKI A;  3Q0A A;  2WKC A;  1EIG A;  3M3Y H;  4POF A;  2GVA A;  2AWN A;  2BA0 A;  3PUW A;  3K5L A;  3B6Y A;  1ZYR D;  3UDX A;  2OXP A;  1OXT A;  1CFM A;  2K52 A;  3HKZ G;  5JPN C;  4JW0 A;  3I3C A;  2F3V A;  3S14 H;  1BO0 A;  2F3I A;  3S2D B;  3A7A B;  5BR8 Q;  4C1N K;  4C3H B;  2K75 A;  3CRK C;  3OMC A;  2H5X A;  3LNN A;  2Q2I A;  1DD2 A;  1F2Z A;  1VMP A;  3RLN A;  1GJX A;  1JJG A;  4LAA A;  3HKS A;  2F0H A;  4YIJ A;  4HJ5 A;  3EFX D;  1STY A;  4IFD J;  1VQC A;  1X3P A;  1YJN A;  5TSS A;  3MXN A;  3VR6 A;  1H9K A;  4IUV A;  1C4Q A;  2B63 H;  1Q81 C;  5DM6 3;  4DNR B;  4MHE A;  1V1P A;  5IGB A;  3GTO H;  2QIL A;  1VQE A;  5J3B A;  4NPS A;  4HTH A;  5IYC H;  1OTC A;  1KDB A;  1O78 A;  1TS5 A;  4XQN A;  3I4M G;  1J8I A;  3U9O A;  4KHP Q;  1I4G A;  1ILQ A;  4R8N A;  4IUN A;  4IAL A;  1GM5 A;  5K5P A;  4WJ3 M;  2KHI A;  4IUU A;  4MIU A;  4ZUJ A;  3T51 B;  1SE8 A;  1RIP A;  4R9W A;  1DZ1 A;  2EYO A;  1C48 A;  2K7V A;  3ERO A;  1YNJ D;  1SMY C;  4O2D A;  2LS0 1;  1S5F D;  4DK3 C;  3HOY H;  1KRS A;  3J7A V;  2B2W A;  4XTC S;  4LWC A;  4JVZ A;  5JPM C;  4PMW A;  4A3J B;  4A3D G;  4HID A;  1BUV T;  1I3Q H;  2C35 B;  1Y1W H;  3H0G G;  3HS0 C;  1HNX L;  3M4Q A;  4WFN 3;  2JA7 H;  3D6W A;  1BKB A;  3J81 j;  2UUA Q;  4IOA A;  5IP9 G;  1MJE A;  4ZYS A;  4DKA C;  5C0X I;  4HJ7 A;  2JEB I;  3OTO Q;  4H0L C;  5IP9 H;  3I2Z A;  3U50 C;  2L9H A;  1VQO A;  3ICE A;  1Q1B A;  1O7Y A;  5I2X A;  2VZA A;  4IFD G;  1F2M A;  1XPO A;  3PUX A;  3V96 A;  5M5W B;  1U5K A;  2GN5 A;  1ENA A;  2JA5 B;  4F7X A;  1PZK D;  2IHF A;  3TSS A;  2FIN B;  3G6J B;  1IZ6 A;  1VQN A;  2EY5 A;  4QF4 A;  1Q82 C;  1ZEQ X;  5LL6 X;  2IX3 A;  3S9W A;  2E5L Q;  1R9T B;  3WOE A;  3S1R H;  4A3F B;  2VNU D;  2IJ0 A;  3RUZ A;  1XMQ L;  3KF6 B;  3J80 i;  1PH6 A;  3Q6S A;  4ID6 A;  2F0G A;  1PRT F;  3W3A A;  2K5W A;  3QG1 A;  3CCS A;  4DV7 Q;  3OHX C;  1STN A;  4DR6 L;  1QIL A;  1PVO A;  1G6P A;  5CBE E;  1SE3 A;  3NEL A;  2VL6 A;  1K73 C;  1EQR A;  3IL8 A;  1SAP A;  3A5U A;  3GTG B;  3TZD A;  4P73 A;  3A55 A;  3T13 A;  3MZ5 A;  1G6Z A;  1JJC B;  4IPD A;  3DXJ C;  3C2P A;  3GTK B;  2XIW A;  1G29 1;  1WTO A;  5LMN W;  5EPL A;  1QJO A;  4H7B A;  2JA6 G;  3KYH C;  4V19 0;  4LFB L;  1SRO A;  1PDQ A;  4KMU C;  1SJH D;  4O1N A;  4JCV E;  2L15 A;  1K8M A;  1DGS A;  1IYV A;  3TRZ A;  2VB3 X;  2HDM A;  2KOL A;  3PSI A;  4DR1 Q;  2HHH Q;  3UI2 A;  3KLR A;  5KNC A;  1HZB A;  4LF9 Q;  2B2T C;  2F4V Q;  5JOB A;  1WD1 A;  1D1I A;  4UP9 A;  3Q24 A;  2DNE A;  2K5H A;  3MWY W;  1XNQ L;  2ZXP A;  1Y1W G;  1MKH A;  3TS0 A;  2XWB B;  4WJ4 A;  1CI3 M;  1N33 Q;  1J9O A;  1UE6 A;  3K59 A;  4DR5 L;  2RDG A;  3MFG A;  1X3G A;  4KHZ A;  4OHJ A;  4DV2 L;  3BVZ A;  3K81 C;  5T1G A;  2F4V L;  1WD0 A;  4DR2 Q;  3SGI A;  3S15 B;  4DF7 A;  3VYU A;  1XNQ Q;  4XT3 B;  1CZW A;  4KY6 A;  2PNH A;  4JI7 Q;  4F8M A;  5FJ8 G;  4YCV A;  2MQH A;  4I7A A;  3AFP A;  4LF8 Q;  1GHJ A;  2CWA A;  3NTH A;  5ELN A;  2Z6K C;  4G7Z C;  1PHJ A;  3PUZ A;  5IGF A;  1L0X B;  1X65 A;  3GQB A;  4ZRZ A;  5JVH 3;  1HQM C;  2JSO A;  1SYF A;  4A3K B;  1IYU A;  1WVL A;  3BS1 A;  3RN5 A;  4BBS B;  4X66 Q;  3SK5 A;  4GOP C;  1DOK A;  1UE5 A;  4C3H H;  4X3T A;  5C4Z A;  4JYA Q;  5AFW A;  1IKM A;  1WCM G;  4ODG A;  1GD7 A;  1G8Z D;  4B9X A;  2R6G A;  5LMU Q;  4BY1 H;  2O5I C;  4A3G H;  3I90 A;  5M5X B;  3BVG A;  4KLK A;  1BXT A;  3T1H L;  1PRT C;  1TS4 A;  5EQ0 A;  3U9S A;  4F87 A;  1Q3L A;  1ZYR C;  1EY4 A;  2F0O A;  1HUM A;  1EIF A;  2WB1 E;  3H0G H;  4PV1 C;  1CT1 D;  2TSS A;  4IQZ A;  2AUJ D;  2XVS A;  3DWA A;  5CGK A;  4G4K A;  3KF6 A;  1SLJ A;  5FO7 B;  2UXB L;  1HUN A;  1CUK A;  1FGB D;  2EXZ A;  2XSC A;  1ENC A;  1BCP B;  4A3M H;  4IUT A;  2RHS B;  4ALP A;  3KUP A;  3K80 C;  1XYI A;  2NVQ H;  5C5L A;  3HOW G;  1R4P B;  3D4W A;  2B3G A;  2F0J A;  4DV4 Q;  4CDF C;  1VDZ A;  3VR3 A;  5IOC A;  1HNW Q;  4IUP A;  2DUD A;  3H94 A;  1KDC A;  2QDB A;  4PG3 A;  1JE4 A;  4OWW B;  2VUM G;  4N8F A;  2F03 A;  3QO2 A;  4PMB A;  1PRT B;  1STG A;  3W5O A;  2NVX H;  3DWQ A;  5KRU A;  4QB4 A;  1EYA A;  3VDY A;  5I6W A;  1VQ5 A;  1PRT D;  2NB0 A;  4TQU S;  3PQI A;  1HRJ A;  5LHY 1;  1ASZ A;  4A3D H;  1B7Y B;  3PV0 A;  5GRO A;  1C7Y A;  2K5Q A;  1WOC A;  1IBM L;  3HGB A;  2ZTE A;  5C3E G;  4KV6 A;  3HRZ C;  4A3B G;  1H9S B;  3T4A C;  3GTO B;  1SNP A;  4R4O A;  4NMZ A;  4YWM A;  2TMP A;  2UUC L;  2EDG A;  4UP7 A;  2PW5 A;  1N36 Q;  2UXD L;  1Y8O B;  4KD4 A;  2YTY A;  4X3S A;  2PQA A;  4ZUI A;  3PUV A;  1V43 A;  3TEH B;  2E2I H;  3M4O B;  4OX9 Q;  4DV6 Q;  5EGT A;  4KKT A;  2M2L A;  2WAQ G;  2Z4I A;  1BBX C;  2K50 A;  5M5Y B;  4CKE A;  3I4N B;  4HJ8 A;  3CCV A;  2RSO A;  3ER0 A;  4OX9 L;  2JA9 A;  1RD9 D;  3T1Y L;  4DV6 L;  1S72 A;  3NPP A;  2M9V A;  3E0E A;  1SNC A;  2EPB A;  4PZ8 A;  3CKI B;  2B2T A;  2MNA A;  1M8A A;  2I5L X;  1WTV A;  4OO1 G;  2JA5 G;  1R9T H;  1VQJ A;  3BU2 A;  5C4X H;  1OXV A;  5E4W C;  4DNI A;  5JAV A;  5ELC A;  4A93 G;  1FNU A;  2K28 A;  1UNS A;  2A74 C;  3DHQ A;  3HOX G;  1LLR D;  4J8Q A;  1I6H B;  1I50 B;  5HGQ A;  2Z8L A;  4Y52 H;  1PFB A;  2RSN A;  3H91 A;  2EXD A;  3H3V H;  1BQQ T;  3I55 A;  3M4P A;  4GKJ L;  2BDN A;  1XMO L;  1NJI C;  4JI3 L;  5GAD C;  3NSW A;  4B9W A;  4P72 A;  1W2B A;  2B2W C;  3JC6 6;  2SNM A;  4DR4 Q;  3RZD H;  2F0T A;  4RHR A;  1G51 A;  5D3D A;  4C3H G;  2I0Q A;  2PMZ B;  2UXC L;  1Y1W B;  4JI1 Q;  3SK4 A;  1ASY A;  1WCM H;  3J80 c;  2A6H C;  1QUQ A;  2IT1 A;  1B9M A;  4RWS C;  3E0J A;  3I4O A;  1JOK A;  2NN6 H;  2B8G A;  4B3S L;  2R7Z B;  2KCT A;  3PO3 H;  2L1B A;  1SMY D;  4FF3 A;  1LTL A;  5NUC A;  3MEH A;  3RD4 A;  4A3C G;  4UAI A;  5C0X G;  3TRE A;  2NN6 G;  2O5J C;  5DLQ E;  4L5Q A;  4LUZ A;  1GHK A;  5J1Z A;  3TN2 A;  4BBR H;  5F2D A;  4U68 A;  1I50 H;  1L2F A;  2QF7 A;  5ELD A;  4B3S Q;  1Z6H A;  3J80 L;  3RLF A;  4B3R L;  4DUZ Q;  2X6G A;  1LAB A;  5FK9 C;  3TME A;  5CV5 A;  2Z6K A;  1TWA B;  3NUC A;  1OXX K;  2EYL A;  2WB1 B;  2O4X A;  3WWV A;  2F0L A;  1U4L A;  5BN5 A;  4LJZ C;  1UAP A;  2R92 H;  3OSO A;  4JI6 Q;  1WCM B;  5FKA C;  4EVO A;  4OO1 I;  1STE A;  3FKI G;  4DGZ A;  5IY0 A;  5JJZ A;  4R1J A;  2PO4 A;  2K33 A;  3I4L A;  3BYY B;  2Y0S B;  3QR8 A;  1GUS A;  2KHJ A;  1S5C D;  1SYE A;  1A2U A;  4KY5 A;  2D5D A;  2F0U A;  2K5D A;  2ZXR A;  1GUG A;  1FL0 A;  1BCP F;  1JCK B;  1VQP A;  2JA7 G;  2BOS A;  3I7F A;  2EJF C;  1LO5 D;  4J6H A;  1BOS A;  2OQ0 A;  3CMA A;  2LXK A;  2E2J B;  1EZ8 A;  1E3P A;  4H13 C;  4X65 Q;  3QOJ A;  2CH4 W;  1BR9 A;  4K2K A;  4C3I G;  4EX5 A;  3GDE A;  1IBK Q;  2C9O A;  2EYM A;  3P20 A;  1EUJ A;  2WV6 D;  2XWJ B;  5C0X J; 
#chains in the Genus database with same CATH homology
 1WI5 A;  3GTL H;  4GNX A;  1Y1V H;  3D0F A;  1NBW A;  4YWL A;  4JI6 L;  4IFD J;  3JAM i;  1VQC A;  3OYY A;  4GS3 A;  4AYB G;  3JAM c;  3KJO A;  1IBK L;  1YJN A;  4R4T A;  1FJG L;  4JV5 Q;  3S1M H;  2JA5 H;  2BH2 A;  1KIX A;  2NZO A;  2ZJR A;  1Q81 C;  2B63 H;  3KDF A;  4GOP B;  5IT9 c;  1X54 A;  4R4I A;  4K0K L;  1EOV A;  2HQL A;  4A93 H;  3PIO A;  3CAM A;  3CCU A;  1XJV A;  4LF5 Q;  3GO5 A;  1KQS A;  3STB C;  2WAQ E;  3EIV A;  1Q7Y C;  3GTO H;  4JBM A;  4RG1 A;  1VQL A;  4LF6 Q;  1VQE A;  5J3B A;  4NPS A;  3MEF A;  1BBW A;  1X55 A;  5IYC H;  1OTC A;  3CCL A;  2V1C C;  4R4C A;  1VQH A;  2IY5 B;  4A3C H;  3I4M G;  4KHP Q;  1TWA H;  1YNX A;  3GTP H;  3PO2 H;  2HIX A;  4A3J H;  1V1Q A;  4LW1 A;  1C9O A;  1GKH A;  3RLO A;  5GAG C;  2YU9 H;  3CC7 A;  4JI4 L;  4LF7 Q;  4LF6 L;  3L2P A;  2ES2 A;  4LNQ A;  3CF5 A;  3KOJ A;  1GM5 A;  3I56 A;  4DV3 Q;  4A3F H;  3HOW H;  4WJ3 M;  2KHI A;  1KAW A;  1Q46 A;  5LMN L;  4A3I G;  4X65 L;  1SE8 A;  1RIP A;  3FKI H;  2BH8 A;  2FXQ A;  1J5E Q;  2E5L L;  1KHI A;  4JI2 Q;  2AWO A;  1VQ8 A;  4JI8 L;  4DAY B;  4LF7 L;  4O2D A;  1XMQ Q;  2EQS A;  4A3L G;  2JK8 A;  2JA8 G;  4DK3 C;  3NEM A;  3HOY H;  4A3I H;  1HNX Q;  4DV3 L;  1KRS A;  2CFM A;  4X64 L;  3HOV H;  4XTC S;  1SFO H;  4LWC A;  4DV7 L;  1N34 L;  1J5E L;  2JA8 H;  4APV A;  4A3L H;  1X56 A;  3NEN A;  4PMW A;  2ASB A;  1PYS B;  4HID A;  2Q2U A;  3S17 H;  4A3D G;  1I3Q H;  3D31 A;  1PH7 A;  2C35 B;  3OTO L;  1Y1W H;  3H0G G;  1HNX L;  3UDG A;  4C3I H;  3M4Q A;  4X64 Q;  5C44 H;  2JA7 H;  1BKB A;  3J81 j;  2UUA Q;  4IOA A;  5IP9 G;  4AH6 A;  1MJE A;  2NN6 I;  4DKA C;  5C0X I;  4HJ7 A;  1VQ7 A;  3CCJ A;  2I5M X;  2JEB I;  3OTO Q;  5IP9 H;  4AIM A;  3I2Z A;  3U50 C;  1IL2 A;  1GO3 E;  1VQO A;  3ICE A;  5FLM G;  4DUY Q;  1Q1B A;  3HKZ E;  4QIW E;  4YY3 L;  3GTK H;  1YHA A;  2ATW A;  2VZA A;  4KHP L;  4IFD G;  1XPO A;  3S15 H;  3PUX A;  2B63 G;  4YCW A;  1U5K A;  2GN5 A;  4L5S A;  5GAE C;  3RN2 A;  4HIO A;  1VQK A;  2IHF A;  4DR1 L;  3L7Z C;  3RR5 A;  1E7Z A;  3W1B A;  5M5X H;  4BXX G;  5FJ8 H;  1IZ6 A;  3CC2 A;  1VQN A;  1VQA A;  4DK6 C;  4BY7 H;  1JE5 A;  1Q82 C;  1JB7 A;  2E5L Q;  4A3E G;  1L1O A;  1TWF H;  1NY4 A;  3L0O A;  4PZ6 A;  1CSP A;  3F2B A;  4JI8 Q;  3S1R H;  1HR0 W;  1JMC A;  1N33 L;  4GNX C;  1XMQ L;  2IX1 A;  3KF6 B;  4TVA B;  3J80 i;  2PI2 E;  3K8A A;  4LFC L;  3HOX H;  1PH6 A;  3AQQ A;  2XGT A;  5C3E H;  3CXC A;  4A3K H;  2QEX A;  4DV2 Q;  4QL5 A;  1JT8 A;  4OON A;  3KF8 B;  1PH9 A;  2NZH A;  2WB1 G;  3CCS A;  4MNO A;  4DV7 Q;  1N34 Q;  4ME3 A;  4FDB A;  1YJ9 A;  1MJC A;  3S2D H;  3Q8D A;  4DR6 L;  1PVO A;  1G6P A;  2E8G A;  1EYG A;  2R7D A;  4UP8 A;  4LF8 L;  4LFC Q;  3NEL A;  1K73 C;  2VL6 A;  2R93 G;  1EQR A;  2RHQ B;  2OQK A;  1RL2 A;  3CME A;  3F8T A;  3A5U A;  4P73 A;  4GLA C;  2B29 A;  4NXM Q;  1VQ4 A;  3ULP A;  1GVP A;  2XTI A;  4AQY Q;  1KD1 C;  2UUA L;  1JJC B;  4IPD A;  3ERS X;  1NMF A;  1G29 1;  4BY1 G;  4HJA A;  4A3G G;  3KDF B;  5LMN W;  4GOP A;  2Y0S G;  1EQQ A;  5JJL A;  5IP7 H;  1YI2 A;  2JA6 G;  3KYH C;  1OXS C;  4IPH A;  4LFB L;  1SRO A;  1YBY A;  4YCU A;  4DUY L;  1BVS A;  4NXM L;  4AQY L;  1XNR L;  4YY3 Q;  4GN4 B;  4JCV E;  1HZA A;  2L15 A;  2OCE A;  4X66 L;  3I4M H;  2VQE Q;  3TQY A;  4L5R C;  3CC4 A;  2IHE A;  1DGS A;  3F1Z A;  4JYA L;  5IP7 G;  3TRZ A;  3CCQ A;  2R7Z H;  3PSI A;  4DR1 Q;  2ZJQ A;  2HHH Q;  4GNX B;  1P16 A;  4DR7 L;  1HZB A;  4LF9 Q;  1XNR Q;  2F4V Q;  1AE2 A;  4UP9 A;  1Y1V G;  3T1H Q;  2K5H A;  2ZTD A;  5IE8 A;  1XNQ L;  1Y1W G;  1S3O A;  1MKH A;  3TS0 A;  4P71 A;  4WJ4 A;  1V9P A;  1J6Q A;  1N33 Q;  1UE6 A;  3U58 A;  4QJF A;  4C2M H;  4DR5 L;  1PA6 A;  4A75 A;  2D0O A;  1X3G A;  4KHZ A;  4MTN A;  5HY6 A;  3RNU A;  1HZC A;  3U4Z A;  1CSQ A;  4DV2 L;  3K81 C;  4BA2 I;  2F4V L;  3S1N H;  3HOV G;  4DR2 Q;  3SGI A;  2UXB Q;  3STB D;  2JE6 I;  1XNQ Q;  2PNH A;  4JI7 Q;  4DR6 Q;  2MO1 A;  5FJ8 G;  4YCV A;  5M3F H;  1E1T A;  2MQH A;  3AFP A;  4LF8 Q;  2CWA A;  2IX0 A;  5K36 G;  5ELN A;  2Z6K C;  4AYB E;  3MXN B;  4A3J G;  1PHJ A;  3PUZ A;  2ZJP A;  1PFS A;  4DV4 L;  3EN2 A;  1X65 A;  3A74 A;  2OTL A;  4JI7 L;  1HNW L;  3PCO B;  1E1O A;  3CW2 C;  4BXX H;  2VS1 A;  4B3M L;  3E9H A;  1QVC A;  5JJI A;  1WYD A;  5FLX c;  3BJU A;  1K8A C;  4LFB Q;  3PO2 G;  3G4S A;  5LMU L;  5FLM H;  3J81 i;  3RN5 A;  4X66 Q;  4L5T A;  4P75 A;  2VQE L;  4GOP C;  3K0X A;  1UE5 A;  1VQD A;  4C3H H;  1CKN A;  1VQ9 A;  4JYA Q;  4B3M Q;  3PO3 G;  2N49 A;  3TS2 A;  4A3M G;  1WCM G;  2JEA I;  2HHH L;  1GD7 A;  4DR7 Q;  2ID0 A;  3I4N H;  4LF9 L;  4BY1 H;  3FP9 A;  2R6G A;  1Q8K A;  5LMU Q;  4A3G H;  3T1H L;  4KLK A;  2RCN A;  1FGU A;  1EWI A;  4DR3 Q;  2QGQ A;  1EIF A;  1VQB A;  4GKK L;  4DR5 Q;  2WB1 E;  3H0G H;  1UWV A;  2RF4 A;  3M9B A;  4IOC A;  1I6H H;  5JEA J;  1QZG A;  4DR2 L;  2K14 A;  3KF6 A;  1SLJ A;  1TWC H;  2UUC Q;  2UXB L;  1IYJ B;  1CUK A;  4DR3 L;  1N36 L;  2I5H A;  4BBR G;  2AHO B;  4A3M H;  2E2H H;  4YWK A;  4IPC A;  4ALP A;  2RHS B;  4R4Q A;  3ULL A;  4EQ5 A;  1T9H A;  3K80 C;  2UU9 Q;  3S1Q H;  2KBN A;  5M3M G;  1FVI A;  2NVQ H;  1VQM A;  2ZM6 L;  3K7A H;  3HOW G;  4LFA L;  2Y0S E;  2B3G A;  1SRU A;  1N8R C;  4DV4 Q;  2Q2H A;  1SR3 A;  3J7A 5;  2A1A A;  1HNW Q;  1VS0 A;  3S24 A;  1EFW A;  3CCE A;  2DUD A;  2R7Z G;  4JBW A;  5M5Y H;  3CD6 A;  1KL9 A;  1KRT A;  4BBS G;  1K0R A;  2UU9 L;  2KEN A;  2YV5 A;  4PG3 A;  4QGU A;  5ELO A;  4OWW B;  1K83 H;  2VUM G;  2CQO A;  1HZ9 A;  1QVG A;  3DLL A;  2BA1 A;  2ZM6 Q;  1HNZ L;  3W5O A;  2NVX H;  3VDY A;  1VQ5 A;  1PH2 A;  3OW2 A;  4OXP A;  2MFI A;  2MO0 A;  4TQU S;  1I94 Q;  3HOU H;  3UDF A;  4X62 Q;  1ASZ A;  4A3D H;  1B7Y B;  2VUM H;  5M3M H;  3PV0 A;  1WJJ A;  4PZ7 A;  5GRO A;  1D8L A;  1C7Y A;  1IBM L;  1WOC A;  2CKZ B;  1HNZ Q;  1PYB A;  3NBH B;  2CCZ A;  2ZTE A;  2ZTC A;  3E9I A;  5C3E G;  2R93 H;  4GKK Q;  3FHW A;  1A63 A;  3M7N A;  4JC0 A;  4A3B G;  1W3S A;  3HOY G;  1YJW A;  2EIF A;  4JOI C;  3H15 A;  3DM3 A;  1IBM Q;  2NVT H;  1N32 Q;  4R4O A;  3F2D A;  1A62 A;  4YWM A;  1TXY A;  4OWT B;  2K5N A;  2UUC L;  4YHH L;  2K4K A;  1QUQ B;  4UP7 A;  1IBL L;  3M85 A;  1N36 Q;  2R92 G;  2UXD L;  5E7N A;  1BBU A;  1NTG A;  2YTY A;  2PQA A;  2F52 A;  2LSS A;  3PUV A;  4KI0 A;  1E24 A;  1V43 A;  1N32 L;  3TEH B;  3J7Z C;  2E2I H;  1Q12 A;  1PH3 A;  1XPR A;  5GAH C;  4OX9 Q;  4LFA Q;  1K8G A;  4HJ9 A;  4YHH Q;  4DV6 Q;  1LM0 A;  4GLV B;  4A3F G;  1Q86 C;  2D0P A;  5IYB G;  2OTJ A;  4BY7 G;  4JI0 Q;  4JI1 L;  2WAQ G;  2D62 A;  1KC8 C;  1D7Q A;  1O7I A;  1K9M C;  2K50 A;  4DPG A;  3I4N G;  1C0A A;  1TWH H;  4HJ8 A;  1XPU A;  3CCV A;  2LXJ A;  4LF4 L;  1SMX A;  5IYD G;  1IXR A;  3ER0 A;  2JJQ A;  3G48 A;  3BZK A;  4OX9 L;  3EBE A;  2JA9 A;  2YYZ A;  3T1Y L;  4DV6 L;  2N3S A;  1VQF A;  1S72 A;  3KJP A;  4QY7 A;  1PH8 A;  4RMF A;  2YTV A;  3E0E A;  1S40 A;  3AEV A;  4JI0 L;  3GTG H;  3HOZ H;  4PZ8 A;  5IYD H;  3KFU A;  1I94 L;  2MNA A;  1YVC A;  2I5L X;  4X62 L;  4IO9 A;  5IYC G;  4OO1 G;  3PF4 A;  2JA5 G;  1R9T H;  1VQJ A;  3BU2 A;  1E22 A;  3W1G A;  3UE0 A;  5C4X H;  1OXV A;  4LF4 Q;  1EIY B;  4DNI A;  3S16 H;  3T1Y Q;  1B8A A;  1PH1 A;  2K5V A;  1YEZ A;  3ZJY C;  1QVF A;  4A93 G;  1M1K C;  2R7F A;  5IWA Q;  3HOX G;  3PIP A;  1X3F A;  1CKN B;  3RZO H;  4A3K G;  1TWG H;  3KLW A;  5HGQ A;  2OWO A;  4Y52 H;  5GQO A;  2VW9 A;  4O0A A;  3CCM A;  1X6O A;  3AYH B;  2EXD A;  3H3V H;  4UY8 C;  1NMG A;  4DV1 Q;  1X3E A;  1CKM A;  3I55 A;  1IBL Q;  4JG2 A;  3M4P A;  1QZH A;  1YHB A;  4GKJ L;  1XMO L;  1NJI C;  2UXD Q;  4JI3 L;  1K3R A;  4B3T L;  5GAD C;  1M90 C;  2PQA B;  1OXU A;  1HJP A;  5M5W H;  4P72 A;  1W2B A;  4DV0 Q;  3JC6 6;  4DR4 Q;  3RZD H;  3UDI A;  4A3B H;  3HOU G;  4DV1 L;  4NXN Q;  1G51 A;  5JJK A;  3GTJ H;  2I0Q A;  3GD7 A;  2UXC L;  4GKJ Q;  4A76 A;  4JI1 Q;  2JQO A;  4JI3 Q;  3H3V I;  4DV5 Q;  1ASY A;  1H95 A;  2PMZ E;  1WCM H;  3J80 c;  4BBS H;  2JA6 H;  1QUQ A;  2IT1 A;  2AMC B;  4HIM A;  4LUV A;  4C3J H;  2ALY B;  3I4O A;  4DV0 L;  1PH5 A;  5JEA G;  4B3S L;  5C4X G;  2VQF Q;  3HFZ B;  1HR0 L;  2KCT A;  4GN5 A;  4LUO A;  3F2C A;  4GLX A;  2E2J H;  4JI5 Q;  3G6E A;  3PO3 H;  4B3R Q;  1KXL A;  1LTL A;  1VQ6 A;  1LUZ A;  2KCM A;  2VY3 A;  5C0X G;  4A3C G;  3TRE A;  2NN6 G;  4OWX B;  4DV5 L;  3J81 c;  4QQB X;  1A0I A;  5DLQ E;  4L5Q A;  4LUZ A;  1VCI A;  5M3F G;  2PI2 A;  1UE1 A;  1CKO A;  2CWP A;  4MZ9 A;  4DAM A;  3AFQ A;  4BBR H;  2UUB Q;  3M4O H;  4B3S Q;  1I50 H;  1L2F A;  2VQF L;  1MIU A;  4J15 A;  3RLF A;  1JJ2 A;  4B3R L;  3CQZ H;  1VQI A;  4DUZ Q;  1I5F A;  1N9W A;  4JOI A;  1PH4 A;  1AE3 A;  5IWA L;  4IFD I;  3LGJ A;  3PF5 A;  2DGY A;  3UE1 A;  2Z6K A;  1PV4 A;  1A8V A;  1B70 B;  2UUB L;  1OXX K;  3IRB A;  4HIK A;  1UE7 A;  1Q1E A;  4H02 A;  5H1S E;  1XTD A;  3WWV A;  2VNU D;  1P8L A;  4NB3 A;  1LYL A;  1L1O C;  1HH2 P;  1VQG A;  2HT1 A;  2R92 H;  1XMO Q;  3CP0 A;  4B3T Q;  1Y14 B;  3CPW A;  3A5Z B;  1SN8 A;  4IJH A;  1Z47 A;  4POG A;  2WFW A;  4JI6 Q;  4GN3 B;  2A19 A;  3CPF A;  3A0J A;  1X9N A;  3PUY A;  1L0W A;  4OO1 I;  4DR4 L;  3FKI G;  4IPG A;  3HOZ G;  3PGZ A;  5AJ3 L;  3GTM H;  4JV5 L;  1U0L A;  4BA1 I;  3U4V A;  5IY0 A;  5C4J H;  1AH9 A;  4NXN L;  4R1J A;  4XIG S;  4A3E H;  4A4I A;  2UXC Q;  4JBK A;  2Z0S A;  4K0K Q;  3BZC A;  2AKW B;  4UPA A;  4JBJ A;  2YTX A;  1YIT A;  5EAY A;  2KHJ A;  1YIJ A;  4LF5 L;  4JI2 L;  5AJ3 Q;  4JI5 L;  1HR0 Q;  2N8N A;  4X6A H;  2QA4 A;  5BR8 L;  1FL0 A;  3M3Y H;  1UEB A;  4POF A;  5IYB H;  2GVA A;  2AWN A;  1L1O B;  2BA0 A;  1VQP A;  2JA7 G;  3PUW A;  3CCR A;  3I7F A;  5C44 G;  3B6Y A;  1NE3 A;  1Z9F A;  2A8V A;  3UDX A;  1OXT A;  3HKZ G;  2K52 A;  4JI4 Q;  2GVB A;  2OQ0 A;  4Y7N H;  3S14 H;  2WP8 J;  2F3I A;  4DUZ L;  1YZ6 A;  3CMA A;  2LXK A;  2N78 A;  5BR8 Q;  2K75 A;  5LMN Q;  1E3P A;  4X65 Q;  4P74 A;  1WFQ A;  2H5X A;  3GTQ H;  2Q2I A;  3K7U C;  3G71 A;  2Q2T A;  3S2H H;  4EX5 A;  3GDE A;  1YHQ A;  4IJL A;  1IBK Q;  1FJG Q;  2NVY H;  3RLN A;  3ULJ A;  1JJG A;  1EUJ A;  3HKS A;  2HIV A;  4HJ5 A;  5C0X J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...