4HJ9A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (cggttacggt)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
b'DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 37
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj9A00
3I4NH 3K7UC 3G4SA 1HR0Q 4R4IA 4GLAC 3M4OH 1Q1BA 4OWXB 4POFA 4LF8L 3I7FA 3HKZE 2NN6G 4GNXC 1Q7YC 2WAQE 4GN5A 4BBRG 3CAMA 3Q8DA 3HOZG 2VQEL 1UE5A 2KBNA 2ES2A 2NVYH 4B3TL 1Y1WG 3KDFA 1JB7A 1QVFA 5ELOA 1T9HA 1UE7A 4O2DA 1VQCA 1I94Q 4UP8A 4QQBX 2OQ0A 1E1TA 1NMGA 4B3ML 1TWHH 2D0OA 1VCIA 1CKMA 4JBJA 4P73A 1QZGA 4AH6A 1IBMQ 4IFDI 3K81C 3F2CA 4JI0Q 1VQDA 4QY7A 2VQFL 4DR2Q 4OWWB 5HY6A 5IY0A 1BVSA 1XMQL 5IP9G 4DV0Q 4P72A 4DV5L 1I3QH 4PZ8A 1MJCA 1EQRA 2RCNA 2UXBQ 4JC0A 1PYSB 3H15A 3H3VH 4H02A 1FGUA 3PUXA 1BBWA 3H3VI 1I50H 5LMNL 2ASBA 3HKZG 2UUCQ 2JA7H 3PUZA 3S1NH 1VQJA 2VZAA 2WAQG 1PHJA 4PMWA 2L15A 1KXLA 2Q2IA 4L5TA 5M3FH 4TVAB 4A3JG 4Y7NH 2MO1A 3S16H 1CSPA 1G6PA 1G291 2A1AA 1SN8A 3WWVA 1SE8A 3FKIG 1PH6A 2A8VA 1SROA 3CW2C 4KHPQ 5IP7G 1IBML 1CSQA 1VQLA 4JI0L 4A3LH 2B3GA 4DR2L 4UPAA 1OXVA 2MFIA 4DV0L 4WJ4A 4LUOA 3KFUA 3CCJA 2E2HH 2R92G 3MEFA 2EIFA 2K5NA 5EAYA 2UXBL 2B63H 3H0GH 5IYBH 2F3IA 2R93G 1LUZA 4K0KL 1Y1VG 1Q12A 1EIFA 1X65A 2I5LX 3BZKA 5JEAJ 1WJJA 2Q2HA 4DAYB 4NPSA 2ZJPA 3GTOH 1L1OB 3F8TA 3HOYG 2R7DA 3KF6A 1E1OA 4PG3A 1N34Q 1N32Q 2QEXA 1XTDA 1I5FA 1VQBA 4DR1L 2UUAL 1X9NA 1MKHA 4GNXA 4DV6L 2UUCL 4JI4L 3I4MG 4JV5Q 4A3FG 4AQYQ 2HIXA 2RHQB 4IO9A 1C0AA 2NVQH 1VQGA 4LNQA 4WJ3M 4BA2I 2GN5A 2MO0A 3RLFA 1XNQQ 1FJGQ 4HJ9A 5JEAG 4GLXA 4DV7L 3EN2A 1Q86C 3CCSA 1CKNB 1KQSA 5M3MG 3ICEA 4NB3A 4DV3Q 3HFZB 4DR5L 3M4QA 3CXCA 4X64Q 4POGA 4MTNA 1RL2A 3W1BA 2VS1A 4YY3L 1YHBA 2DGYA 4ME3A 3HOXG 2KCTA 4A3IH 3CCRA 3UDXA 3PUWA 4IJLA 3PIPA 4DAMA 3K8AA 2VNUD 2JEBI 1WYDA 1P8LA 1A63A 2EQSA 3KJOA 3E9IA 4A3CH 2K52A 2WP8J 4DV2L 3U4VA 1HNWL 1SRUA 4YCWA 4GOPC 1Q8KA 2ZM6Q 1W2BA 2K5HA 3K0XA 5BR8L 3GD7A 2JQOA 2F52A 4PZ7A 3RN2A 1N32L 2NVXH 3BJUA 4A3EG 4JI7Q 1E22A 3T1HQ 2LXKA 4JV5L 3E9HA 3HOWG 4JG2A 1KC8C 2NZOA 3PO3G 5C4XH 4JYAL 1IYJB 1JMCA 1PFSA 1XNQL 4RMFA 1GO3E 1PYBA 1V9PA 4IPGA 3I2ZA 1YJWA 1FJGL 3HOUH 4GKKQ 5DLQE 4DK6C 2R6GA 3GTMH 4YHHQ 1HZCA 3KDFB 3NELA 4BBRH 3OW2A 1N36Q 2H5XA 1O7IA 1Z9FA 5E7NA 1EQQA 4X64L 1V43A 1N9WA 1NTGA 4LW1A 3HOZH 2ATWA 1VQ8A 1Y1WH 2F4VQ 4AYBE 4JI1Q 4X66Q 3PV0A 1GKHA 4X62L 4JI2Q 2I0QA 3A0JA 2AMCB 4C2MH 4B3SL 4A3KG 4IPHA 2KCMA 1PH4A 1L2FA 2N8NA 3GTJH 1YHQA 1BBUA 2IX1A 4OO1G 1EOVA 1D7QA 1EIYB 2ALYB 2ZM6L 4R4CA 1HZBA 2VUMH 4EX5A 5FJ8G 4A93G 2OCEA 2ZJRA 3T1HL 2UU9L 2PQAB 2UUBQ 5IP9H 4GN3B 4JBMA 2ZTDA 1QVGA 1BKBA 3RR5A 1YIJA 5JJKA 2CWAA 3B6YA 2UXDQ 4R4OA 2R7ZH 1K8GA 4OX9Q 3RZOH 3KF8B 2Y0SE 3RN5A 4DR3Q 1KHIA 5ELNA 1K73C 1OXUA 1UE6A 4OWTB 4BY7G 2FXQA 3HOVH 3S1RH 5C0XI 1VQIA 1WFQA 1N36L 1XPUA 3DM3A 4QJFA 5GADC 2N49A 4QIWE 2E2JH 4DUZQ 2JJQA 1HR0L 4IFDJ 4A3DH 3D31A 4JI1L 4JI3Q 1YI2A 4A3JH 1E7ZA 1YHAA 4AYBG 1L1OC 4JI2L 4L5QA 4IJHA 1PH3A 4IOCA 4DNIA 3AFQA 1UEBA 4LF9L 5IP7H 5AJ3Q 1K9MC 4Y52H 3BZCA 3GTKH 4UP7A 4GOPA 3M7NA 5FLMG 1WCMG 3CD6A 1P16A 4IFDG 4HJAA 1EFWA 1I94L 1N8RC 2YU9H 1VQ6A 1E3PA 4BA1I 3CF5A 2WB1E 4HIOA 1VQPA 3A5UA 1R9TH 1X6OA 4R4QA 5C3EG 2R93H 1VQOA 5GAGC 3TQYA 1Y1VH 4KHZA 4NXMQ 2Y0SG 4GNXB 4DR3L 2JA6H 1PH9A 1OTCA 5IYDG 3HOYH 2HQLA 2JA9A 1X55A 2JA5G 4BY1H 3I4MH 2IY5B 4X6AH 4O0AA 4JCVE 5IWAQ 4JI6Q 3S1QH 4HIKA 4DR6Q 3G71A 2JA8G 4HIDA 4DV4Q 1Q82C 1PH2A 3OTOQ 1X3EA 2BA1A 1PV4A 2YYZA 1IBLQ 1XNRQ 5IYDH 1XPRA 2IX0A 3FHWA 5H1SE 2VW9A 1KL9A 1WI5A 4JBKA 4GLVB 4HJ8A 4JI5Q 5K36G 2VY3A 2YTVA 4R4TA 2R7FA 2YV5A 5J3BA 3CQZH 1KAWA 2BH8A 3UDIA 1B7YB 1B8AA 4JI8Q 1GM5A 2K4KA 1SLJA 3MXNB 2MQHA 2QGQA 5IYCH 3CPWA 3FP9A 4KHPL 3KOJA 1YVCA 4LF4Q 2YTXA 2RF4A 3LGJA 1HNZQ 1XMOQ 2K5VA 1Q81C 1ASYA 2OTLA 4LUVA 3UDGA 3CC2A 4NXML 3PO2H 4QGUA 1NE3A 1Q1EA 2VL6A 3CCMA 3F2DA 2KHIA 3TEHB 1AE2A 2C35B 3GDEA 2B63G 3CP0A 5IYBG 2NVTH 2N78A 4PZ6A 2JA7G 3ERSX 1S40A 3JAMi 4IOAA 3CCQA 1S72A 3RLNA 1QVCA 1VQ7A 2CQOA 4X65Q 4A3BH 1A8VA 4DK3C 2Q2UA 5C44G 1IBLL 4BBSH 3OYYA 1N34L 4A76A 3EBEA 1L1OA 2AHOB 1I6HH 4BXXH 2JK8A 3A74A 1A0IA 4LFAQ 3TREA 4AQYL 3T1YQ 3TS0A 3PCOB 4JI5L 1D8LA 2CWPA 4R1JA 1YJ9A 1PA6A 1IBKQ 3UE0A 1HH2P 2QA4A 1JT8A 1N33Q 1VS0A 1VQ5A 1IL2A 3J7A5 3J81c 1S3OA 3CMAA 1HNXQ 5GAEC 2I5MX 1PVOA 4DV1Q 4DV3L 3AQQA 3AEVA 2Q2TA 1Z47A 4B3TQ 1QUQA 2NN6I 4EQ5A 4YWLA 3PUYA 4UP9A 4DR4Q 1NJIC 4LF6Q 2ZJQA 3M4PA 1TWAH 3ER0A 5FJ8H 3M3YH 3I56A 2Z6KC 4A93H 1KIXA 1NBWA 5IE8A 2D62A 2GVBA 2BH2A 1WOCA 1VQFA 1X54A 3CCUA 1VQKA 1K0RA 4IPDA 2XGTA 1UWVA 3NENA 4L5SA 2CCZA 4GS3A 2HHHQ 2VQFQ 4C3JH 4GKJQ 2LXJA 2PMZE 4RG1A 3PGZA 1VQ9A 3GTGH 4JI7L 1XMQQ 4JOIC 1XPOA 4DV5Q 1Q46A 4BY7H 4DPGA 3JAMc 5M5WH 1X3GA 1IBKL 1B70B 1JJCB 4OONA 4UY8C 4GN4B 1N33L 4A3MG 3HOUG 4A3GG 3KLWA 2A19A 3CCEA 3TS2A 3SGIA 1HNXL 2PI2A 5LMNQ 4XTCS 3M85A 4DV1L 1PH1A 4GKKL 4YHHL 3RLOA 5GAHC 1HNWQ 2E2IH 3IRBA 3A5ZB 3E0EA 3K80C 3U58A 1PH5A 4GOPB 1YITA 3D0FA 1FVIA 3I4NG 1EUJA 1YBYA 1DGSA 1VQHA 4HIMA 5FLXc 1YNXA 5JJLA 1KRTA 2AWOA 2K50A 2F4VL 4JBWA 4X66L 4LF6L 4DR4L 5FLMH 1LM0A 1TWFH 1WCMH 2GVAA 4FDBA 3G6EA 1OXXK 1C7YA 3S17H 2JEAI 4NXNQ 1SR3A 2B29A 3U4ZA 1W3SA 3FKIH 4YCUA 3U50C 4XIGS 4A3BG 2CKZB 5C0XJ 2N3SA 3BU2A 3J7ZC 5LMUQ 2VUMG 4HJ7A 5C3EH 2XTIA 3M9BA 2HHHL 1K8AC 1JJ2A 4GKJL 3S1MH 3PIOA 4KLKA 4YWMA 3TRZA 5M5XH 3I4OA 3STBC 2OWOA 2UUBL 4LF5Q 1V1QA 4QL5A 3S2DH 3ZJYC 2R92H 2JA5H 3PF4A 4APVA 2R7ZG 2PQAA 3UE1A 3K7AH 4LFBQ 2UXDL 1J5EQ 4OX9L 1YJNA 1GVPA 3G48A 4K0KQ 2PI2E 2ZTEA 3KF6B 4MZ9A 5C0XG 2JA8H 1OXTA 4DR7Q 3GTPH 1SMXA 4P75A 4TQUS 4ALPA 1AH9A 4DR1Q 4YCVA 2UUAQ 4JI4Q 3HOVG 4DV6Q 4P74A 1OXSC 4IPCA 1Y14B 3ULJA 4A3FH 3RZDH 4LWCA 4DUZL 4LFCQ 4A3DG 4J15A 3PUVA 4JI3L 2ID0A 2YTYA 3W1GA 4DUYQ 1PH7A 2V1CC 1U0LA 5IT9c 4DV7Q 2D0PA 3F1ZA 4NXNL 3I55A 3J81i 2K75A 2Z6KA 5HGQA 1JE5A 1J6QA 3HKSA 5M3MH 5LMUL 4DR5Q 2HT1A 5AJ3L 3W5OA 1K3RA 2IT1A 2RHSB 5M3FG 3CC7A 3J81j 3ULLA 1UE1A 3L7ZC 1LTLA 4YY3Q 1X3FA 4LF7Q 3J80i 4DKAC 4LF5L 3HOXH 4JOIA 3GO5A 2NZHA 1H95A 1RIPA 2I5HA 3GTLH 4LFBL 1CKOA 2WB1G 1TXYA 4DV2Q 1J5EL 1VQNA 3KJPA 3PF5A 3VDYA 3CCLA 5GQOA 4A3LG 1HJPA 1TWCH 2WFWA 4DR7L 3CC4A 2JA6G 1VQEA 2EXDA 5BR8Q 1EWIA 1U5KA 4P71A 5C44H 2IHFA 4LUZA 4BY1G 3NEMA 1K83H 3CCVA 1HR0W 2LSSA 4A3EH 3H0GG 3EIVA 5GROA 4JYAQ 5IWAL 3HOWH 4JI6L 2UXCQ 4KI0A 2Z0SA 4LFCL 3PO3H 3JC66 3S24A 5LMNW 4DR6L 4OXPA 4DUYL 4DV4L 2K14A 3OTOL 1XNRL 3S15H 3AFPA 4AIMA 3RNUA 1YZ6A 3GTQH 4C3HH 3F2BA 3ULPA 2E5LQ 1X56A 2DUDA 2ZTCA 4C3IH 1QUQB 1KRSA 4YWKA 1SFOH 1CUKA 3NBHB 1FL0A 3AYHB 3L2PA 1M90C 4LF9Q 4B3RQ 3CMEA 2AWNA 3DLLA 1IZ6A 1NMFA 2BA0A 1HZAA 4LF7L 2KENA 4LF8Q 1MIUA 4X62Q 4JI8L 1TWGH 1L0WA 1IXRA 5IYCG 1G51A 1MJEA 4B3SQ 1A62A 4MNOA 1C9OA 1VQ4A 4A3KH 1KD1C 4A75A 1VQMA 1YEZA 4LF4L 1CKNA 3PO2G 1M1KC 1XMOL 1HNZL 4A4IA 5C4JH 2VQEQ 1PH8A 1XJVA 2PNHA 2OTJA 3S2HH 2CFMA 2E8GA 3J80c 4A3IG 4OO1I 1GD7A 2KHJA 1AE3A 3L0OA 1ASZA 2UU9Q 3UDFA 1E24A 4B3MQ 1LYLA 2MNAA 4A3CG 1VQAA 2UXCL 2JE6I 1NY4A 4HJ5A 3PSIA 1QZHA 2HIVA 4BBSG 4X65L 1EYGA 2OQKA 4A3MH 4A3GH 3KYHC 3CPFA 3S14H 4BXXG 5M5YH 2E5LL 1JJGA 4LFAL 5C4XG 2AKWB 4B3RL 3T1YL 1HZ9A 5JJIA 2IHEA 4L5RC 3STBD
chains in the Genus database with same CATH superfamily
3K7UC 3GTOB 1HR0Q 3M4OH 1Q1BA 2FINB 5EPKA 5CV8A 4GZYC 5I2YA 1JWUD 4JW0A 5E3FA 2VQEL 2ES2A 4B3TL 2NVYH 5JPMC 1Y1WG 3TP6A 5ELOA 1T9HA 1UE7A 4ULLA 4X3TA 1I94Q 3Q6SA 1PTOD 1HTPA 2LY7A 2D0OA 1VCIA 1CKMA 4P73A 4OELB 3VYRA 1B50A 3F2CA 1BO0A 1XTCD 1V1OA 3D4DA 4A3IB 5HY6A 1CQFA 3RMHA 1XMQL 5IT9E 3FPPA 4KHVA 2XVSA 5J39A 2UXBQ 4IURA 4R9WA 1GUTA 1PRTF 4FF3A 2EYLA 3NBIA 2F3WA 5LMNL 2K5DA 2CH4A 1JOQA 2VZAA 2ICEC 2WAQG 4WJWA 4PMWA 2L15A 2WIIB 1KXLA 2Q2IA 2IW3A 5M3FH 2K28A 3S16H 2ZXPA 3HOUB 2A1AA 1SE8A 2F0IA 1IBML 4ME5A 4LMQD 5F2DA 4O42A 3H3VC 1HXYD 2EYJA 1RF2D 4UPAA 3H09A 4WJ4A 4LUOA 4KKUA 2R92G 5FKAC 3GTJB 1YNNC 2M00A 5IYBH 2QF7A 2R93G 3OIQA 1QCBD 1OO9B 1Q12A 1EIFA 1X65A 2Q2HA 1B2TA 3HOYG 2QW7A 2R7DA 2QEXA 1XTDA 1I5FA 4DR1L 1C8CA 2UUAL 2UUCL 4JI4L 3J81E 4GNXA 1DONA 4ZRZA 4A3FG 1CA6A 2HIXA 2RHQB 2NVQH 2L55A 3FEWX 3BVZA 3RZOB 1AW7A 1EYAA 4BA2I 2GN5A 3RLFA 1XNQQ 3QR8A 1LTTD 4PV1C 1PRTD 3S1RB 3EN2A 5I4DA 3CCSA 1SEBD 5IIFA 4DV3Q 2E2JB 2K03A 3HFZB 4DR5L 1LACA 4X64Q 4POGA 4MTNA 1RL2A 1F77A 3W1BA 4MN3A 4WORA 2VS1A 1FD7D 1YHBA 1C4QA 2F3VA 2KCTA 2BE5C 3PIPA 4G7HC 1WYDA 3OIPA 3KJOA 4RA8A 3U4VA 4OL7A 1SRUA 1Q8KA 1IKLA 5C5MA 4PZ7A 1H9SB 3Q22A 1R4PB 2EYPA 3BJUA 3DEOA 5I6YA 4JV5L 3E9HA 3HOWG 2B2YC 4JG2A 1KC8C 2NZOA 1EEID 1PFSA 1Y1VB 1MSGA 1FJGL 2XSCA 3I2ZA 1SNMA 2QCPX 4C3HG 3KUPA 3I4MB 2IL8A 2R6GA 3GTMH 3KDFB 3NELA 4BBRH 2CW0D 1O7IA 1F9PA 1N9WA 5EBCA 3HOZH 4F7XA 4CDEC 4KTAA 4AYBE 3LNNA 2I0QA 3A0JA 4C2MH 1PH4A 1L2FA 1YHQA 2EY5A 1EIYB 4ZLTF 2VUMH 3NTIA 1EQVA 3NWSA 2ZJRA 5E1FA 5IP9H 2BDNA 2ZTDA 1QVGA 2KCCA 1DOKA 3RR5A 5JJKA 5A35A 3HZXA 2CWAA 3NK9A 3IKJA 3HRZC 4OX9Q 1EU3A 2K5QA 1D2BA 1OXUA 4BY7G 4DF7A 1VQIA 1N36L 3EROA 2F0EA 3NQTA 2WKDA 3R3OA 4TKOB 5HGTA 1EY0A 3D31A 4JI3Q 1PDQA 1E7ZA 4JI2L 4V190 4IJHA 1PH3A 1DM0B 2F1MA 2K33A 5C3WA 1F2LA 4CKCA 1G2TA 1MGSA 1ZKOA 5FLMG 1I6VC 1WCMG 3EJIA 4M1UB 3IAYA 3T16A 2L0CA 2WB1E 4HIOA 1X6OA 5GAGC 4Q5VA 3TQYA 5IYDG 4S3SA 1JC7A 4BY1H 1X55A 2IX3A 2IY5B 1F2ZA 1QE6A 4X6AH 1AN8A 1F9QA 2L4NA 2M9VA 4RCOA 1SNQA 4B9WA 1EYDA 4C3JB 3VR6A 1PH2A 3GTGB 2BA1A 1XPRA 2IX0A 2D5DA 2K6AA 1KL9A 1WI5A 3D6CA 4HJ8A 4XXEA 3VA5A 3W2DA 2VY3A 3MA2B 3P1HA 2J0TD 3T51B 5J3BA 2O4XA 1B7YB 4XQJA 2K4KA 2E2IB 2M2LA 1J8IA 3KOJA 2WAQB 3LGJA 1XMOQ 2FMCA 5KNCA 1ASYA 3PO2H 4KKSA 1M4VA 3TEHB 3HP3A 2C35B 3SVMA 1D5MC 5IYBG 2NVTH 3CKIB 2F0QA 2JA7G 1T5EA 1S40A 3E6ZX 2B2UA 1DXMA 3OYYA 4DAVA 1UEAB 4A76A 3EBEA 1L1OA 5D14A 1TY2A 2R92B 2RKSA 1A0IA 3K7AB 4KJOA 1D6EC 4AQYL 1YJ9A 3X3MA 4XYOA 3UE0A 1KNAA 1J9OA 1HUMA 5CMDA 3J7A5 1HNXQ 5GAEC 4DV1Q 3AMUA 4A3FB 4U68A 1CA5A 1Z47A 4B3TQ 1NAPA 1B3AA 1QUQA 2NN6I 4ABNA 3NBHA 4DR4Q 2ZJQA 3I56A 4A93H 2F4IA 5EKIA 1QWYA 2GVBA 2IPKD 1VQFA 1JWMD 1PMRA 4FXKC 1VQKA 4DN4M 2XGTA 3SK4A 3NENA 1UUPA 2L12A 4GS3A 5EJWA 2LXJA 3BVMA 4RG1A 1XMQQ 1B53A 1Q46A 4DPGA 1IL8A 1X3GA 1IBKL 4GN4B 1N33L 4RGTA 4A3MG 1K83B 2A19A 5LMNQ 1PH1A 1CHQD 2Q8RE 3HOWB 4H13C 4GOPB 1YITA 4NDXA 4HIMA 1M8AA 5FLXc 1KRTA 3S15B 1SYGA 2F4VL 4X66L 4MHEA 3SEBA 3G6EA 1YNJD 4C3HB 4FDBA 2R3ZA 1SR3A 2B29A 2FHTA 3U4ZA 2A73B 1II3A 1KABA 3BU2A 2VUMG 1MHWC 3I70A 1O7YA 4L8JA 2MJ8A 3TP5A 3A8JE 4QL5A 2HCCA 2PQAA 3L9AX 3OSOA 1EY8A 4K14A 2A6HC 3G48A 3TMEA 3S2HB 4MZ9A 4X3SA 2JA8H 1OXTA 3GTPH 3TP7A 1JICA 3PQIA 4DR1Q 2QILA 2UUAQ 4JI4Q 2A69D 5FO8B 2I46A 3MXPA 1Y14B 5LL6S 3URYA 2F0UA 2ZT9C 2RA4A 2EVBA 4IUUA 3IFTA 1JWSD 3W1GA 4DUYQ 4A3GB 3S14B 5IT9c 4BY7B 3J81i 2Z6KA 3BYTB 3NHHA 1J6QA 3HKSA 1S5ED 5M3MH 4DR5Q 1Y8OB 5AJ3L 1VMCA 2MHVA 2RHSB 3N6RA 3M4OB 1QNKA 2SEBD 4QUFA 5KNDA 2OT2A 3J80i 4LF5L 1LTBD 2DY8A 3CRKC 3HOXH 3GO5A 2NZHA 1KLUD 3MXGA 2WB1G 1TXYA 2NVYB 4A3LG 3KJPA 2BDOA 1HJPA 1TWCH 2XNAC 3NE5B 2XIWA 1LT3D 4P71A 2IHFA 4BY1G 4A3EH 3H0GG 1TU2B 5GROA 5IWAL 3K5NA 4JI6L 5COYA 3JC66 5IGGA 3S24A 5LMNW 1DZ1A 2K14A 1CQVA 2WINB 2DJFC 3ULPA 2ZTCA 4YIJA 4YWKA 5KEEA 1FL0A 3AYHB 5JPNC 1STBA 1TWGH 2B2TA 1IXRA 3WOFA 1MJEA 4MNOA 3MXNA 2LS01 3R2IA 3RUZA 4LF4L 3PO2G 5M3FB 5C4JH 2HDMA 1DD2A 1XJVA 3S16B 3J80c 4A3IG 3A8IE 1GD7A 1SNPA 2E74C 2B2VA 2X69A 1BCPF 1VQAA 2UXCL 2PW5A 3G7LA 4IUQA 3PSIA 4UAIA 1PRTC 2SOBA 5FLXL 3TBIB 4RGNA 2F0MA 3CPFA 1H9SA 2E5LL 1BBXC 3MZ5A 3P20A 3K57A 4POFA 4LF8L 2F03A 3I7FA 3M4YA 4HCEA 2WAQE 2NVQB 5J22A 4HAEA 3Q8DA 2KBNA 3J7AV 3KDFA 1JB7A 4MIUA 1TKWB 4O2DA 2F0GA 1EU4A 2OQ0A 4B3ML 5I6WA 2NTSA 1IYVA 3BVGA 4CJ2C 3P7JA 2A68C 2CW0C 4OWWB 4KN7C 5IY0A 4P72A 4J8QA 4DV5L 4RH6A 1I3QH 4CKEA 1MJCA 1EQRA 2RCNA 2AQ3B 4OHJA 1WTOA 1NSNS 2KUMA 1SE3A 1RJTA 3PUXA 1BBWA 3H3VI 4B08A 2ASBA 2AUJD 3S1NH 2RSNA 2J4XA 4O1NA 4L5TA 1CSPA 2N88A 1G291 3GTMB 3QOLA 1SN8A 3WWVA 4BBRB 2A8VA 1SROA 5IP7G 1CSQA 1EZ6A 1S5BD 4QF4A 1BF4A 3HOZB 4JI0L 4FYDA 4DAPA 3IFDA 2NUCA 1SYEA 4DR2L 1OXVA 4C2MB 4DV0L 1G2SA 1A2UA 3MEFA 4QB4A 1A3UA 2MUYA 2LFNA 2PO4A 2K01A 2VUMB 1Y1VG 5ELBA 3H91A 4NPSA 1N32Q 1L1OB 4I65A 2PMZB 3I4MG 1X9NA 4DV6L 1G91A 1LV9A 2QDBA 4AQYQ 4F87A 4IO9A 1TQOA 4LNQA 4WJ3M 1GUWA 4HJ9A 2K05A 4GLXA 3J80L 5M9OA 5CYUA 2L5TA 3TZDA 5M3MG 3ICEA 3VYSA 3WOEA 1SMYC 2PZTA 4N8FA 3M4QA 2CQAA 3VYUA 4J1MA 1PTOF 1Q90A 2B2WA 4YY3L 4ME3A 2F0SA 3HOXG 3QJYA 3UDXA 3PUWA 4IJLA 2JEBI 1EY5A 1A63A 5EKKA 3GP7A 2K52A 1HNWL 4YCWA 2X6LA 2ZM6Q 2F0KA 3GD7A 1QOHA 2F52A 4A3EG 2Q8TA 2E75C 1LTGD 3D3RA 4JYAL 5C4XH 1JR0D 1IYJB 3EA6A 2MP1A 2F0TA 4RMFA 1PYBA 1V9PA 4DU9A 5FLXE 5JJZA 4ILWA 4BY1B 5DLQE 4DK6C 2D9UA 1AZQA 2EY2A 3I8ZA 1HZCA 1O80A 2JSOA 1EQQA 1V43A 4LW1A 5IODA 2ATWA 1VQ8A 3DWPA 3Q24A 2F4VQ 4X66Q 4X62L 1ESRA 3OW7A 3AU7A 2N8NA 1QJOA 2IX1A 4CJ1B 1D7QA 3H6MA 3O13A 3OHXC 4R4CA 1WD0A 2LKVA 3PIP3 1HCZA 5FJ8G 1BQQT 3T1HL 2P5ZX 2PQAB 3TSSA 1H9KA 1YIJA 5BN3A 3B6YA 4R4OA 5DM63 2R7ZH 1K8GA 3PO2B 3KF8B 4C3JG 3RN5A 3MFYA 5ELNA 3K59A 2NVTB 3I3CA 4ZCKA 1SXTA 4A3DH 4JI1L 1YI2A 2KA7A 2NVXB 4A3JH 2F0JA 5J1ZA 3R93A 1HA6A 3SK5A 5AJ3Q 1ILQA 4UP7A 4GOPA 2B8FA 4HJAA 1EFWA 3OOCA 4HTHA 4N8X1 1N8RC 1VQ6A 4BA1I 1VQPA 1CI3M 1GUSA 3KLSA 5HURA 4DR3L 2JA6H 1OTCA 4A93B 2DJGC 2HQLA 4DFAA 2JN4A 2JA9A 5CV4A 1HPCA 4JCVE 5IWAQ 4JI6Q 3S1QH 4HIKA 2XWBB 3G71A 4HSVA 2PYKA 1LTRD 3SK8A 1PV4A 5JVG3 5JEAH 2Z9HA 1NCVA 4JBKA 4JI5Q 1A15A 1I4GA 2C9OA 3I4LA 5K36G 2R7FA 1B3QA 1A6XA 2G9HD 4XT3B 1GM5A 3J80E 3MXNB 2D2CC 3CPWA 3FP9A 4LF4Q 2N55A 4RGMA 2OTLA 4NXML 1Q1EA 3F2DA 3DUZA 4RHRA 4KY6A 3CP0A 2N78A 3VR3A 1CT1D 3RLNA 1A8VA 2Q2UA 1IBLL 1N34L 3K5MA 1ESFA 1WTVA 1ET6A 2JK8A 3DEPA 3TS0A 1A2TA 3S2DH 3PCOB 1PA6A 1SJHD 2IWHA 1V1PA 4QUCA 2JA8B 3GTPB 1JT8A 1VQ5A 3W3AA 1S3OA 2FFKB 3CMAA 3ND9A 3NPPA 2I5MX 2KOLA 2NN6H 3V96A 3SXHA 3AEVA 3JAML 2Q2TA 4LAAA 1G6ZA 1ET9A 4UHVA 4OO1H 2Z4HA 4EQ5A 3BDCA 3M4PA 1TWAH 3ER0A 2CH4W 4IZ8A 5ELFA 5IE8A 1SBBB 1HTLD 5M3MB 5IGDA 4IPDA 4L5SA 2CCZA 2HHHQ 4GKJQ 2PMZE 3SR1A 3PGZA 4IUNA 2Z8LA 3HOXB 4Q0FA 4K2LA 1XPOA 4DV5Q 3HG9A 5M5WH 1TWCB 4A3GG 4A3EB 4GKKL 1PZKD 2NZ1D 2RBMA 3EFXD 1NUCA 3A5ZB 3E0EA 2NYZD 3K80C 2H4OA 1JJGA 1EUJA 1YBYA 4PQXA 1O7LA 4JBWA 4LF6L 3PMFA 1LM0A 1TWFH 3S17H 3OWFA 1OXXK 1C7YA 4N9TA 4NXNQ 4X3KA 1HHVA 1W3SA 3FKIH 3UI2A 4XIGS 2N3SA 3J7ZC 4HJ7A 5C3EH 3M9BA 1JJ2A 3FPUB 4KLKA 5I9OA 1VDZA 1F9RA 5M5XH 2UUBL 2QEJC 5KIXA 2JA5H 4APVA 2R7ZG 3UE1A 5C4JB 3I90A 1J5EQ 1LO5D 1GVPA 1LTSD 3KBXA 1YJNA 4DR7Q 4K6LA 1SMXA 4TQUS 4ALPA 1AH9A 3DM1A 3QO2A 4DV6Q 4RWSC 1IHZA 4LWCA 4LFCQ 4A3DG 4J15A 3MC0B 2ID0A 1PH7A 1LT5D 2WV6D 2WACA 4C1NI 2K75A 5LMUL 3W5OA 5M3FG 3ULLA 1UE1A 4YY3Q 1X3FA 4LF7Q 4DKAC 4JOIA 1H95A 2I5HA 1BCPC 2C5CA 4LFBL 1GUGA 1HNWQ 3PF5A 3VDYA 4IN3A 2WFWA 2JA6G 1EWIA 1U5KA 5C44H 1MD2D 5CBAE 3CCVA 2Z6BA 2OXPA 4JYAQ 2Z0SA 4FVMA 4L63B 3K5OA 4OXPA 3OTOL 4IUTA 1I3QB 1MI2A 2FMMA 4HCSA 2DUDA 4C3IH 3J7YW 1M90C 4QIWB 3CMEA 3FMCA 2AWNA 1NMFA 1HZAA 2KENA 5CV6A 1MIUA 2O5JC 4X62Q 1L0WA 1ZYRC 1L0YB 3S1NB 4ODGA 3SE0A 1VQ4A 1KD1C 4A3KH 1VQMA 2SNSA 2RDHA 4ZKBB 3VR5A 2VQEQ 1CHPD 2HQEA 2PNHA 2BOSA 4OO1I 2KHJA 3L0OA 1ASZA 1XYIA 1E2VA 3TZUA 5C4ZA 1TIID 2HIVA 1GOZA 1EYGA 3GQBA 4RAUC 4WRDA 3MWYW 3KYHC 1VF5C 2GA4B 4B3RL 3T1YL 5JJIA 4LF9L 4L5RC 1LLRD 4NW2A 3I4NH 3C1FA 4R4IA 4GLAC 4OWXB 2WKCA 4XDXA 4GNXC 2NN6G 1ICWA 1AFPA 4BBRG 4KD4A 4L6TB 3Q23A 3HOZG 4A3BH 3OMCA 2JP1A 2CVRA 3MTSA 1VQCA 1E1TA 1NMGA 1H9MA 4JBJA 1LTAD 1IBMQ 4IFDI 3K81C 1B4OA 1RKNA 1VQDA 2VQFL 3MFGA 1BVSA 5IP9G 2VB3X 4XT1B 4JC0A 1CZGA 4KY7A 3F2UA 4RKBA 3LWUA 3H15A 1YNND 3H3VH 5JAVA 1B44D 3KF8A 3NP8A 1I50H 3NTHA 4ZQ3A 3HKZG 2UUCQ 5D3IB 5C4XB 1VQJA 4OGQC 1PTOC 1UAPA 2HCIA 3TP8A 4E6IA 4Y7NH 1VF7A 3GV3A 2EJGC 5I2XA 4LK1C 3FKIG 2EJMA 3CW2C 1VQLA 4K8JA 2MFIA 3CCJA 2E2HH 4DNTB 2EIFA 2UXBL 3OWEB 1FYCA 1R4QB 1RDPD 1GUOA 5KRUA 2BE5D 5D3DA 1ZEQX 1EIGA 2I5LX 3KLRA 5JEAJ 3F8TA 4PG3A 1N34Q 1STNA 4KY5A 1EQTA 2PZWA 1TVXA 4JV5Q 2AQ1B 1V1PB 2R7ZB 1E2ZA 3DWAA 2XRQD 1F2YA 1QB5D 1GHJA 3TN2A 1I4PA 1SSOA 1FJGQ 4DV7L 1CKNB 5IOCA 1WTPA 3CXCA 4A3DB 2F0HA 5KYIA 2J7ZA 1CZWA 4A3JB 2ZXRA 3S9WA 1EFID 5DM73 2VNUD 4DAMA 1P8LA 2EQSA 4A3CH 2F0FA 3HGBA 1W2BA 2K5HA 5BR8L 5CBEE 2JQOA 2DN8A 2HUGA 1E22A 1F9SA 5D65A 5LHY1 1JMCA 1PLFA 1XNQL 1GO3E 2JA6B 1YJWA 3SK6A 1JE4A 2DNEA 4ZYSA 4GKKQ 3A7AB 4C3IG 1N36Q 1S5DD 3OW2A 1IKMA 5E7NA 4X64L 1NTGA 2PCFB 1EYCA 1Y1WH 3PV0A 5ELCA 4JI2Q 2G9DA 2AMCB 4B3SL 1KLGD 4IPHA 4A3KG 3MHBA 1PZJD 1HZBA 1STYA 3AB9A 4EX5A 4ZUIA 4A93G 2OCEA 4XYQA 1A3TA 2UUBQ 4GN3B 4JBMA 4IUPA 2F0NA 1BKBA 3E5SA 4TRDA 1O7ZA 1ONLA 1WTXA 1K3BC 1FGBD 1TY0A 2KEEA 1U4PA 4UDUC 1KHIA 1XXGA 1UE6A 2XWJB 3HOVH 5C0XI 2EXZA 1U9RA 3DM3A 4QJFA 1ML0D 4QIWE 2B2UC 4XQQA 2B39A 4IFDJ 1YHAA 2L1BA 1L1OC 4L5QA 4FNFA 3E0JA 4IOCA 3S2DB 3QOJA 2EDGA 1EEFD 3AFQA 2I07B 3R2TA 1Q8IA 3GTKH 4C1NK 2A74C 1P16A 5CC4A 1NR2A 3G6JB 2YU9H 3T13A 3BYYB 3CF5A 5EPJA 2B8GA 2B2YA 1R9TH 4KKTA 2R93H 1VQOA 4FXDA 1GHKA 1TWAB 2Y0SG 1PH9A 3HOYH 3I91A 2JA8G 5JVH3 1Q82C 3OTOQ 2YYZA 5DNFA 1HFNA 5M5WB 2VW9A 2KEDA 3BG3A 1SJED 1XX8A 5CV7A 1WVLA 2YTVA 3I72A 2YV5A 4G7ZC 3CQZH 3MAQA 1KAWA 3UDIA 4AYBB 1Q3LA 1BNZA 2MQHA 1K28A 2QGQA 3HKZB 3T56B 5IYCH 1W6JA 4KHPL 3NSWA 2YTXA 5JOBA 3UDGA 1TWFB 1NE3A 2E76C 3CCMA 3S17B 1AE2A 3GDEA 5IGEA 1C48A 3FKIB 3LX0A 4PZ6A 3JAMi 4IOAA 1VMPA 5C3EB 1QVCA 4DK3C 5E4WC 4X3UA 1D1KA 1RTNA 4BBSH 2F0OA 4DAYA 5M5XB 1L0XB 1TR5A 1I6HH 2JA5B 4BXXH 3A74A 4KN4C 3TREA 1SFOH 3T1YQ 4B3RQ 3K5LA 4R1JA 1IBKQ 4DNRB 1HH2P 1N33Q 4RHSA 1IW7D 1S4ZA 1IL2A 1PVOA 1MSHA 3CU7A 1WD1A 5K5PA 1JQYD 2LMCB 3DMUA 2H1EA 3PUYA 4UP9A 5G3LF 2JYOA 3M3YH 2Z6KC 1D1IA 1NBWA 1HQMC 2TMPA 1I4QA 1TT2A 1X54A 1K0RA 1UWVA 1SNDA 2VQFQ 1RHPA 4JI7L 3C2PA 4Z9CB 1EIHA 4BY7H 4KMUC 1B9MA 3JAMc 3CHBD 1JJCB 4OONA 4HN7A 4NP5A 4UY8C 4H44C 1SYBA 5C44B 5T1IA 3R8BA 2O5IC 2A6HD 4EGVA 2PI2A 1HNXL 4XTCS 4DV1L 5BN5A 4YHHL 2L9HA 4KD3A 1DOLA 3D4WA 4K5VA 1PH5A 1NR4A 5A2QL 1AEXA 2AWOA 2K50A 4DR4L 1SNOA 5FLMH 1WCMH 2GVAA 4BS9A 1CK1A 4C3IB 4J6HA 4OIJA 1BUVT 3RD4A 2OF1A 4YCUA 5C0XJ 5ELDA 1PTOH 3E3XA 2PNRC 3U9SA 2XTIA 1K8AC 2K1BA 4DA2A 3S1MH 2A5HA 4CDDC 3PIOA 2B2TC 1DCZA 4YWMA 3C46A 3TRZA 2OWOA 3I4OA 4LF5Q 1SE4A 5IYDH 4A3KB 3PF4A 5G3LD 1G8ZD 2UXDL 3OPOA 1KDAA 4P75A 2B2VC 3FVQA 3NTKA 4YCVA 3HOVG 1KNEA 2Q8IB 4P74A 1OXSC 2EYFA 4B9XA 4IPCA 4ZAIA 1YNJC 3RZDH 4DUZL 4FF4A 4H7BA 3PUVA 2NB0A 2RQXA 1U0LA 4DV7Q 2D0PA 3F1ZA 3I55A 4BWGB 1LT6D 2NTTA 3QB3A 2EE1A 1JE5A 5HGQA 2HT1A 3I4NB 2IT1A 1ENCA 3L7ZC 1LTLA 4ZKCB 2F0LA 3T4AC 1TS5A 5ISRA 5IGFA 1ENFA 2EOTA 3KBGA 3GTLH 1QILA 4CHTB 1CKOA 4A3BB 2JA7H 5LL6X 1VQEA 5BR8Q 3ONAB 2A69C 3NEMA 1HR0W 2LSSA 4FO2A 4DXFA 1U4LA 2UXCQ 3U9OA 3PO3H 1E0BA 1KDBA 1V8QA 4DR6L 4DUYL 4DV4L 1XNRL 3AFPA 2Y0SB 1YZ6A 3GTQH 3F2BA 4IUVA 2E5LQ 1X56A 4CGYB 1UNSA 1FR3A 1KRSA 5AFWA 1CUKA 3X3NA 3L2PA 1RTOA 2XRSD 3DLLA 2RCFA 4HMIA 4LF8Q 1I50B 4JI8L 4B3SQ 5IYCG 1G51A 5IGCA 2SNMA 1C9OA 1CKNA 1HNZL 4A4IA 4HR7B 2PQEA 2QDLA 4Y7NB 2CFMA 1AE3A 4B3MQ 4CDFC 3MVVA 2JE6I 3A54A 3ITPA 2PPBC 4BBSG 5EGTA 4X65L 2KHSA 5KGUA 1WTQA 4A3MH 2E2HB 4K2KA 4BXXG 5M5YH 2ENBA 4LFAL 5C4XG 2AKWB 3HEJA 2A68D 1HZ9A 1Y8NB 2IHEA 3STBD 1A3VA 3G4SA 2KVMA 1AZPA 4TSSA 4NKLA 3HKZE 1Q7YC 3C3LA 4GN5A 5BN4A 3CAMA 4C56C 2PW7A 1SNCA 1UE5A 5A2QE 1QVFA 3LWEA 3OMGA 3N52A 5DAUA 1ICFB 3K58A 4HSPA 2KECA 4UP8A 4QQBX 4IFDH 1S5FD 1TWHH 5CV5A 2FJ2A 1QZGA 4AH6A 1DOMA 4JI0Q 1SAPA 2B2WC 1GJXA 4QY7A 4DR2Q 1TWGB 3SDZA 2NWGA 4R8IA 2EYOA 4DV0Q 1I4RA 3GV6A 4PZ8A 2HD3A 1PYSB 1K0SA 2V4DA 4H02A 4EQOA 1FGUA 2X6GA 1W6KA 3PUZA 4K8IA 1IYUA 3MXUA 5C5LA 1B9NA 1LTID 4TVAB 4A3JG 2MO1A 2EY1A 1G6PA 1X3PA 2EY6A 1PH6A 4KHPQ 4FP5D 4A3LH 1Y1WB 1S5CD 2B3GA 1PXUA 1SMYD 4LJZC 1JB3A 3A7LA 1K8OA 2EJFC 2EYHA 3KFUA 1STGA 2K5NA 5EAYA 2B63H 3H0GH 2F3IA 2A6ED 1Y69U 1LUZA 2Z4IA 4K0KL 3V05A 3BZKA 4DAYB 1WJJA 2ZJPA 3GTOH 4CJ0B 5FOBB 3KF6A 1E1OA 1VQBA 3BS1A 1EWHA 4N9PA 4CBVA 1MKHA 4MTKA 2Z1CA 1BXTA 1KAAA 1VQGA 1WTHA 1HQRD 2MO0A 1GUNA 4V0BA 5JEAG 4KJNA 3HOVB 1Q86C 1KQSA 4FF2A 1LABA 4NB3A 2RVLA 4PMCA 2DGYA 2F0PA 4A3IH 2TSSA 1JOKA 3CCRA 2F0DA 3K8AA 5C3XA 2G5DA 3E9IA 3J7AF 1DYQA 2WP8J 4FXGC 3JAME 4DV2L 3GTKB 4GOPC 2EYMA 3M7GA 1K8MA 3K0XA 1N32L 3RN2A 4KV6A 2NVXH 2YU9B 1RCVD 1WTWA 4JI7Q 1T5XD 3NUCA 3T1HQ 2LXKA 3NXWA 3VR4A 1R9TB 4XQNA 3PO3G 2DNCA 2R93B 4K6DA 3ZYYX 2OEOA 3HOYB 4IPGA 4I7ZC 3ERQA 2EPBA 2XN9C 4IALA 3K0YA 3HOUH 1BCPB 4YHHQ 2RDGA 3FRPB 2SDFA 2H5XA 1Z9FA 5C4HA 2EZVA 4JI1Q 4QMGA 1GKHA 3BDLA 2AUKA 2KCMA 1DJRD 3GTJH 1PFBA 1BDOA 1BBUA 3A8KE 4OO1G 1EOVA 5EBDA 1PFNA 1X3QA 2ALYB 2ZM6L 3CQZB 2UU9L 1EY4A 2KJXA 3A56A 1F2MA 1IW7C 2QKIC 2KQ3A 2UXDQ 4DXGA 1D5ZC 2KCNA 3RZOH 4ZK9B 2Y0SE 4DK1A 5C0XH 1TS4A 4DR3Q 3SHLA 1H9RA 3ND8A 1K73C 4OWTB 1SDFA 2FXQA 3DWQA 3P75A 4HMJA 2R61A 3S1RH 1WFQA 1XPUA 3BDOA 5GADC 2N49A 2E2JH 4U673 4DUZQ 2JJQA 4BBSB 1HR0L 1ZXTA 4AYBG 1I6HB 4I7AA 1SFOB 3NWTA 4DNIA 1UEBA 5IP7H 1K9MC 1EL0A 4RFBA 1CFMA 4Y52H 1PFMA 3BZCA 3T53B 4H0LC 3M7NA 1STAA 3CD6A 4IFDG 1I94L 3EVQA 4JK1C 3K6OA 1E3PA 1SE2A 3A5UA 1EOTA 5EKLA 1CM9A 4R4QA 5C3EG 1EZ8A 5NUCA 4QCLA 1Y1VH 4KHZA 4NXMQ 4G4KA 4GNXB 3M3YB 4JPBW 1JCKB 1EWCA 2JA5G 3I4MH 4O0AA 2AQ2B 4DR6Q 4HIDA 4DV4Q 1XNRQ 1X3EA 1IBLQ 3H94A 1Z6HA 5T1GA 3FHWA 5H1SE 2NBFA 1HA5A 4GLVB 4M8AA 1ENAA 1EY6A 4R4TA 2BH8A 1B8AA 4JI8Q 1SLJA 2VB2X 5CR3A 1YVCA 2RF4A 1HNZQ 2K5VA 4P2CB 1EY7A 1Q81C 4LUVA 5DEHA 3CC2A 4G7OC 4QGUA 1WCMB 2VL6A 2DY7A 2KHIA 3DXJC 1WTRA 3D8GA 2CHBD 3I73A 3QWNA 1EY9A 2B63G 1FNVA 3ERSX 1PTOB 4NMZA 1HFGA 1TS3A 4IQZA 3CCQA 1S72A 1VQ7A 2CQOA 4X65Q 3S1MB 1SYCA 2RDFA 5C44G 4HEDA 1I4HA 1BOSA 2AHOB 5CORA 1SYFA 3BZDB 4LFAQ 1PZID 2JXMB 1C0AA 4JI5L 1D8LA 2CWPA 2QA4A 5ELEA 1VS0A 3J81c 3L3OC 1QNUA 4RGOS 3Q0AA 5EQ0A 4ZUJA 2RSOA 5TSSA 4DV3L 3AQQA 4PNYA 3RZDB 3VYTA 3S1QB 4R8NA 4EQNA 3D6WA 5KYLA 1FNUA 3FDTA 4YWLA 3WDNA 4DK0A 3DHQA 1NJIC 4LF6Q 5FJ8H 1KIXA 4WFN3 2D62A 3C1EA 1LT4D 1WOCA 5L37A 2IJ0A 2BH2A 3CCUA 2K32A 1X32A 4C3JH 1VQ9A 5FO7B 3GTGH 2VXWA 4JOIC 3GTLB 1RD9D 2O2LD 4F8MA 2JA7B 3HS0C 1B70B 1Y8PB 1STHA 3HOUG 3KLWA 3CCEA 5EPLA 4OEMB 3TS2A 3SGIA 1RODA 3M85A 3RLOA 3QIAA 4RCNA 5GAHC 2E2IH 3IRBA 3QG1A 3U58A 3PO3B 3D0FA 1FVIA 3I4NG 1DGSA 1VQHA 3TDQA 1YNXA 5JJLA 1KDCA 1U4MA 3GTQB 2JEAI 4K5XA 1TS2A 4ID6A 3U50C 4A3BG 1PRTB 2CKZB 5LMUQ 3MEHA 4EQPA 2HHHL 4GKJL 1BR9A 5E4XA 2ICIA 5IT9L 1Z7TA 3STBC 4EVOA 2ZXOA 1V1QA 3ZJYC 2R92H 4LFBQ 3K7AH 4OX9L 4K0KQ 2PI2E 2ZTEA 3KF6B 1NNXA 1BCPD 5C0XG 2MPMA 4OIKA 3ULJA 4A3FH 1O78A 1E2WA 3KK7A 5K36H 2F0VA 3D4RA 3A55A 4JI3L 4A3MB 2PZUA 2YTYA 2V1CC 5M5YB 4NXNL 1U4RA 1H9JA 2L11A 1K3RA 1I4XA 3J81j 3CC7A 5FO9B 5FK9C 3IL8A 3VA7A 5CV9A 1QG7A 1RIPA 1SYDA 1J5EL 4K5WA 1JOOA 1ZYRD 4DV2Q 3CCLA 1VQNA 3PIO3 5GQOA 5C6AA 4DR7L 3CC4A 4PMBA 2EXDA 1JORA 5CGKA 4LUZA 1K83H 1TWHB 2K5WA 3J81L 3EIVA 4KK7A 1XWEA 4JVZA 5IGBA 3HOWH 4KI0A 4LFCL 4CDCC 3VR2A 4FF1A 1HUNA 3S15H 4AIMA 4DGZA 3RNUA 1PYWD 3NQIA 1CTMA 4C3HH 1FNWA 1QUQB 2HDLA 4G57A 1KTKA 3NBHB 4LF9Q 2K04A 1ILPA 1IZ6A 2BA0A 4LF7L 2A6EC 1A62A 4A75A 1YEZA 5KNBA 1B1ZA 1M1KC 4F88A 1XMOL 1PH8A 4CKBA 2OTJA 3S2HH 2E8GA 2K7VA 1STEA 2UU9Q 2BCOA 3UDFA 1E24A 1LYLA 3CRLC 2MNAA 4A3CG 1NY4A 2WB1B 1MBYA 4HJ5A 1HRJA 1QZHA 3V2TA 1GXDC 1AP0A 3EQLC 4RKLA 2OQKA 4A3GH 3S14H 2MGSA 2B63B 2F0WA 3H0GB 1D5XC 5I9PA 2E2DC 1PHJA 3KLSX
chains in the Genus database with same CATH topology
3I4NH 3K7UC 3G4SA 1HR0Q 4R4IA 4GLAC 3M4OH 1Q1BA 4OWXB 4POFA 4LF8L 3I7FA 3HKZE 2NN6G 4GNXC 1Q7YC 2WAQE 4GN5A 4BBRG 3CAMA 3Q8DA 3HOZG 2VQEL 1UE5A 2KBNA 2ES2A 2NVYH 4B3TL 1Y1WG 3KDFA 1JB7A 1QVFA 5ELOA 1T9HA 1UE7A 4O2DA 1VQCA 1I94Q 4UP8A 4QQBX 2OQ0A 1E1TA 1NMGA 4B3ML 1TWHH 2D0OA 1VCIA 1CKMA 4JBJA 4P73A 1QZGA 4AH6A 1IBMQ 4IFDI 3K81C 3F2CA 4JI0Q 1VQDA 4QY7A 2VQFL 4DR2Q 4OWWB 5HY6A 5IY0A 1BVSA 1XMQL 5IP9G 4DV0Q 4P72A 4DV5L 1I3QH 4PZ8A 1MJCA 1EQRA 2RCNA 2UXBQ 4JC0A 1PYSB 3H15A 3H3VH 4H02A 1FGUA 3PUXA 1BBWA 3H3VI 1I50H 5LMNL 2ASBA 3HKZG 2UUCQ 2JA7H 3PUZA 3S1NH 1VQJA 2VZAA 2WAQG 1PHJA 4PMWA 2L15A 1KXLA 2Q2IA 4L5TA 5M3FH 4TVAB 4A3JG 4Y7NH 2MO1A 3S16H 1CSPA 1G6PA 1G291 2A1AA 1SN8A 3WWVA 1SE8A 3FKIG 1PH6A 2A8VA 1SROA 3CW2C 4KHPQ 5IP7G 1IBML 1CSQA 1VQLA 4JI0L 4A3LH 2B3GA 4DR2L 4UPAA 1OXVA 2MFIA 4DV0L 4WJ4A 4LUOA 3KFUA 3CCJA 2E2HH 2R92G 3MEFA 2EIFA 2K5NA 5EAYA 2UXBL 2B63H 3H0GH 5IYBH 2F3IA 2R93G 1LUZA 4K0KL 1Y1VG 1Q12A 1EIFA 1X65A 2I5LX 3BZKA 5JEAJ 1WJJA 2Q2HA 4DAYB 4NPSA 2ZJPA 3GTOH 1L1OB 3F8TA 3HOYG 2R7DA 3KF6A 1E1OA 4PG3A 1N34Q 1N32Q 2QEXA 1XTDA 1I5FA 1VQBA 4DR1L 2UUAL 1X9NA 1MKHA 4GNXA 4DV6L 2UUCL 4JI4L 3I4MG 4JV5Q 4A3FG 4AQYQ 2HIXA 2RHQB 4IO9A 1C0AA 2NVQH 1VQGA 4LNQA 4WJ3M 4BA2I 2GN5A 2MO0A 3RLFA 1XNQQ 1FJGQ 4HJ9A 5JEAG 4GLXA 4DV7L 3EN2A 1Q86C 3CCSA 1CKNB 1KQSA 5M3MG 3ICEA 4NB3A 4DV3Q 3HFZB 4DR5L 3M4QA 3CXCA 4X64Q 4POGA 4MTNA 1RL2A 3W1BA 2VS1A 4YY3L 1YHBA 2DGYA 4ME3A 3HOXG 2KCTA 4A3IH 3CCRA 3UDXA 3PUWA 4IJLA 3PIPA 4DAMA 3K8AA 2VNUD 2JEBI 1WYDA 1P8LA 1A63A 2EQSA 3KJOA 3E9IA 4A3CH 2K52A 2WP8J 4DV2L 3U4VA 1HNWL 1SRUA 4YCWA 4GOPC 1Q8KA 2ZM6Q 1W2BA 2K5HA 3K0XA 5BR8L 3GD7A 2JQOA 2F52A 4PZ7A 3RN2A 1N32L 2NVXH 3BJUA 4A3EG 4JI7Q 1E22A 3T1HQ 2LXKA 4JV5L 3E9HA 3HOWG 4JG2A 1KC8C 2NZOA 3PO3G 5C4XH 4JYAL 1IYJB 1JMCA 1PFSA 1XNQL 4RMFA 1GO3E 1PYBA 1V9PA 4IPGA 3I2ZA 1YJWA 1FJGL 3HOUH 4GKKQ 5DLQE 4DK6C 2R6GA 3GTMH 4YHHQ 1HZCA 3KDFB 3NELA 4BBRH 3OW2A 1N36Q 2H5XA 1O7IA 1Z9FA 5E7NA 1EQQA 4X64L 1V43A 1N9WA 1NTGA 4LW1A 3HOZH 2ATWA 1VQ8A 1Y1WH 2F4VQ 4AYBE 4JI1Q 4X66Q 3PV0A 1GKHA 4X62L 4JI2Q 2I0QA 3A0JA 2AMCB 4C2MH 4B3SL 4A3KG 4IPHA 2KCMA 1PH4A 1L2FA 2N8NA 3GTJH 1YHQA 1BBUA 2IX1A 4OO1G 1EOVA 1D7QA 1EIYB 2ALYB 2ZM6L 4R4CA 1HZBA 2VUMH 4EX5A 5FJ8G 4A93G 2OCEA 2ZJRA 3T1HL 2UU9L 2PQAB 2UUBQ 5IP9H 4GN3B 4JBMA 2ZTDA 1QVGA 1BKBA 3RR5A 1YIJA 5JJKA 2CWAA 3B6YA 2UXDQ 4R4OA 2R7ZH 1K8GA 4OX9Q 3RZOH 3KF8B 2Y0SE 3RN5A 4DR3Q 1KHIA 5ELNA 1K73C 1OXUA 1UE6A 4OWTB 4BY7G 2FXQA 3HOVH 3S1RH 5C0XI 1VQIA 1WFQA 1N36L 1XPUA 3DM3A 4QJFA 5GADC 2N49A 4QIWE 2E2JH 4DUZQ 2JJQA 1HR0L 4IFDJ 4A3DH 3D31A 4JI1L 4JI3Q 1YI2A 4A3JH 1E7ZA 1YHAA 4AYBG 1L1OC 4JI2L 4L5QA 4IJHA 1PH3A 4IOCA 4DNIA 3AFQA 1UEBA 4LF9L 5IP7H 5AJ3Q 1K9MC 4Y52H 3BZCA 3GTKH 4UP7A 4GOPA 3M7NA 5FLMG 1WCMG 3CD6A 1P16A 4IFDG 4HJAA 1EFWA 1I94L 1N8RC 2YU9H 1VQ6A 1E3PA 4BA1I 3CF5A 2WB1E 4HIOA 1VQPA 3A5UA 1R9TH 1X6OA 4R4QA 5C3EG 2R93H 1VQOA 5GAGC 3TQYA 1Y1VH 4KHZA 4NXMQ 2Y0SG 4GNXB 4DR3L 2JA6H 1PH9A 1OTCA 5IYDG 3HOYH 2HQLA 2JA9A 1X55A 2JA5G 4BY1H 3I4MH 2IY5B 4X6AH 4O0AA 4JCVE 5IWAQ 4JI6Q 3S1QH 4HIKA 4DR6Q 3G71A 2JA8G 4HIDA 4DV4Q 1Q82C 1PH2A 3OTOQ 1X3EA 2BA1A 1PV4A 2YYZA 1IBLQ 1XNRQ 5IYDH 1XPRA 2IX0A 3FHWA 5H1SE 2VW9A 1KL9A 1WI5A 4JBKA 4GLVB 4HJ8A 4JI5Q 5K36G 2VY3A 2YTVA 4R4TA 2R7FA 2YV5A 5J3BA 3CQZH 1KAWA 2BH8A 3UDIA 1B7YB 1B8AA 4JI8Q 1GM5A 2K4KA 1SLJA 3MXNB 2MQHA 2QGQA 5IYCH 3CPWA 3FP9A 4KHPL 3KOJA 1YVCA 4LF4Q 2YTXA 2RF4A 3LGJA 1HNZQ 1XMOQ 2K5VA 1Q81C 1ASYA 2OTLA 4LUVA 3UDGA 3CC2A 4NXML 3PO2H 4QGUA 1NE3A 1Q1EA 2VL6A 3CCMA 3F2DA 2KHIA 3TEHB 1AE2A 2C35B 3GDEA 2B63G 3CP0A 5IYBG 2NVTH 2N78A 4PZ6A 2JA7G 3ERSX 1S40A 3JAMi 4IOAA 3CCQA 1S72A 3RLNA 1QVCA 1VQ7A 2CQOA 4X65Q 4A3BH 1A8VA 4DK3C 2Q2UA 5C44G 1IBLL 4BBSH 3OYYA 1N34L 4A76A 3EBEA 1L1OA 2AHOB 1I6HH 4BXXH 2JK8A 3A74A 1A0IA 4LFAQ 3TREA 4AQYL 3T1YQ 3TS0A 3PCOB 4JI5L 1D8LA 2CWPA 4R1JA 1YJ9A 1PA6A 1IBKQ 3UE0A 1HH2P 2QA4A 1JT8A 1N33Q 1VS0A 1VQ5A 1IL2A 3J7A5 3J81c 1S3OA 3CMAA 1HNXQ 5GAEC 2I5MX 1PVOA 4DV1Q 4DV3L 3AQQA 3AEVA 2Q2TA 1Z47A 4B3TQ 1QUQA 2NN6I 4EQ5A 4YWLA 3PUYA 4UP9A 4DR4Q 1NJIC 4LF6Q 2ZJQA 3M4PA 1TWAH 3ER0A 5FJ8H 3M3YH 3I56A 2Z6KC 4A93H 1KIXA 1NBWA 5IE8A 2D62A 2GVBA 2BH2A 1WOCA 1VQFA 1X54A 3CCUA 1VQKA 1K0RA 4IPDA 2XGTA 1UWVA 3NENA 4L5SA 2CCZA 4GS3A 2HHHQ 2VQFQ 4C3JH 4GKJQ 2LXJA 2PMZE 4RG1A 3PGZA 1VQ9A 3GTGH 4JI7L 1XMQQ 4JOIC 1XPOA 4DV5Q 1Q46A 4BY7H 4DPGA 3JAMc 5M5WH 1X3GA 1IBKL 1B70B 1JJCB 4OONA 4UY8C 4GN4B 1N33L 4A3MG 3HOUG 4A3GG 3KLWA 2A19A 3CCEA 3TS2A 3SGIA 1HNXL 2PI2A 5LMNQ 4XTCS 3M85A 4DV1L 1PH1A 4GKKL 4YHHL 3RLOA 5GAHC 1HNWQ 2E2IH 3IRBA 3A5ZB 3E0EA 3K80C 3U58A 1PH5A 4GOPB 1YITA 3D0FA 1FVIA 3I4NG 1EUJA 1YBYA 1DGSA 1VQHA 4HIMA 5FLXc 1YNXA 5JJLA 1KRTA 2AWOA 2K50A 2F4VL 4JBWA 4X66L 4LF6L 4DR4L 5FLMH 1LM0A 1TWFH 1WCMH 2GVAA 4FDBA 3G6EA 1OXXK 1C7YA 3S17H 2JEAI 4NXNQ 1SR3A 2B29A 3U4ZA 1W3SA 3FKIH 4YCUA 3U50C 4XIGS 4A3BG 2CKZB 5C0XJ 2N3SA 3BU2A 3J7ZC 5LMUQ 2VUMG 4HJ7A 5C3EH 2XTIA 3M9BA 2HHHL 1K8AC 1JJ2A 4GKJL 3S1MH 3PIOA 4KLKA 4YWMA 3TRZA 5M5XH 3I4OA 3STBC 2OWOA 2UUBL 4LF5Q 1V1QA 4QL5A 3S2DH 3ZJYC 2R92H 2JA5H 3PF4A 4APVA 2R7ZG 2PQAA 3UE1A 3K7AH 4LFBQ 2UXDL 1J5EQ 4OX9L 1YJNA 1GVPA 3G48A 4K0KQ 2PI2E 2ZTEA 3KF6B 4MZ9A 5C0XG 2JA8H 1OXTA 4DR7Q 3GTPH 1SMXA 4P75A 4TQUS 4ALPA 1AH9A 4DR1Q 4YCVA 2UUAQ 4JI4Q 3HOVG 4DV6Q 4P74A 1OXSC 4IPCA 1Y14B 3ULJA 4A3FH 3RZDH 4LWCA 4DUZL 4LFCQ 4A3DG 4J15A 3PUVA 4JI3L 2ID0A 2YTYA 3W1GA 4DUYQ 1PH7A 2V1CC 1U0LA 5IT9c 4DV7Q 2D0PA 3F1ZA 4NXNL 3I55A 3J81i 2K75A 2Z6KA 5HGQA 1JE5A 1J6QA 3HKSA 5M3MH 5LMUL 4DR5Q 2HT1A 5AJ3L 3W5OA 1K3RA 2IT1A 2RHSB 5M3FG 3CC7A 3J81j 3ULLA 1UE1A 3L7ZC 1LTLA 4YY3Q 1X3FA 4LF7Q 3J80i 4DKAC 4LF5L 3HOXH 4JOIA 3GO5A 2NZHA 1H95A 1RIPA 2I5HA 3GTLH 4LFBL 1CKOA 2WB1G 1TXYA 4DV2Q 1J5EL 1VQNA 3KJPA 3PF5A 3VDYA 3CCLA 5GQOA 4A3LG 1HJPA 1TWCH 2WFWA 4DR7L 3CC4A 2JA6G 1VQEA 2EXDA 5BR8Q 1EWIA 1U5KA 4P71A 5C44H 2IHFA 4LUZA 4BY1G 3NEMA 1K83H 3CCVA 1HR0W 2LSSA 4A3EH 3H0GG 3EIVA 5GROA 4JYAQ 5IWAL 3HOWH 4JI6L 2UXCQ 4KI0A 2Z0SA 4LFCL 3PO3H 3JC66 3S24A 5LMNW 4DR6L 4OXPA 4DUYL 4DV4L 2K14A 3OTOL 1XNRL 3S15H 3AFPA 4AIMA 3RNUA 1YZ6A 3GTQH 4C3HH 3F2BA 3ULPA 2E5LQ 1X56A 2DUDA 2ZTCA 4C3IH 1QUQB 1KRSA 4YWKA 1SFOH 1CUKA 3NBHB 1FL0A 3AYHB 3L2PA 1M90C 4LF9Q 4B3RQ 3CMEA 2AWNA 3DLLA 1IZ6A 1NMFA 2BA0A 1HZAA 4LF7L 2KENA 4LF8Q 1MIUA 4X62Q 4JI8L 1TWGH 1L0WA 1IXRA 5IYCG 1G51A 1MJEA 4B3SQ 1A62A 4MNOA 1C9OA 1VQ4A 4A3KH 1KD1C 4A75A 1VQMA 1YEZA 4LF4L 1CKNA 3PO2G 1M1KC 1XMOL 1HNZL 4A4IA 5C4JH 2VQEQ 1PH8A 1XJVA 2PNHA 2OTJA 3S2HH 2CFMA 2E8GA 3J80c 4A3IG 4OO1I 1GD7A 2KHJA 1AE3A 3L0OA 1ASZA 2UU9Q 3UDFA 1E24A 4B3MQ 1LYLA 2MNAA 4A3CG 1VQAA 2UXCL 2JE6I 1NY4A 4HJ5A 3PSIA 1QZHA 2HIVA 4BBSG 4X65L 1EYGA 2OQKA 4A3MH 4A3GH 3KYHC 3CPFA 3S14H 4BXXG 5M5YH 2E5LL 1JJGA 4LFAL 5C4XG 2AKWB 4B3RL 3T1YL 1HZ9A 5JJIA 2IHEA 4L5RC 3STBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N H;  3K7U C;  3G4S A;  1HR0 Q;  4R4I A;  4GLA C;  3M4O H;  1Q1B A;  4OWX B;  4POF A;  4LF8 L;  3I7F A;  3HKZ E;  2NN6 G;  4GNX C;  1Q7Y C;  2WAQ E;  4GN5 A;  4BBR G;  3CAM A;  3Q8D A;  3HOZ G;  2VQE L;  1UE5 A;  2KBN A;  2ES2 A;  2NVY H;  4B3T L;  1Y1W G;  3KDF A;  1JB7 A;  1QVF A;  5ELO A;  1T9H A;  1UE7 A;  4O2D A;  1VQC A;  1I94 Q;  4UP8 A;  4QQB X;  2OQ0 A;  1E1T A;  1NMG A;  4B3M L;  1TWH H;  2D0O A;  1VCI A;  1CKM A;  4JBJ A;  4P73 A;  1QZG A;  4AH6 A;  1IBM Q;  4IFD I;  3K81 C;  3F2C A;  4JI0 Q;  1VQD A;  4QY7 A;  2VQF L;  4DR2 Q;  4OWW B;  5HY6 A;  5IY0 A;  1BVS A;  1XMQ L;  5IP9 G;  4DV0 Q;  4P72 A;  4DV5 L;  1I3Q H;  4PZ8 A;  1MJC A;  1EQR A;  2RCN A;  2UXB Q;  4JC0 A;  1PYS B;  3H15 A;  3H3V H;  4H02 A;  1FGU A;  3PUX A;  1BBW A;  3H3V I;  1I50 H;  5LMN L;  2ASB A;  3HKZ G;  2UUC Q;  2JA7 H;  3PUZ A;  3S1N H;  1VQJ A;  2VZA A;  2WAQ G;  1PHJ A;  4PMW A;  2L15 A;  1KXL A;  2Q2I A;  4L5T A;  5M3F H;  4TVA B;  4A3J G;  4Y7N H;  2MO1 A;  3S16 H;  1CSP A;  1G6P A;  1G29 1;  2A1A A;  1SN8 A;  3WWV A;  1SE8 A;  3FKI G;  1PH6 A;  2A8V A;  1SRO A;  3CW2 C;  4KHP Q;  5IP7 G;  1IBM L;  1CSQ A;  1VQL A;  4JI0 L;  4A3L H;  2B3G A;  4DR2 L;  4UPA A;  1OXV A;  2MFI A;  4DV0 L;  4WJ4 A;  4LUO A;  3KFU A;  3CCJ A;  2E2H H;  2R92 G;  3MEF A;  2EIF A;  2K5N A;  5EAY A;  2UXB L;  2B63 H;  3H0G H;  5IYB H;  2F3I A;  2R93 G;  1LUZ A;  4K0K L;  1Y1V G;  1Q12 A;  1EIF A;  1X65 A;  2I5L X;  3BZK A;  5JEA J;  1WJJ A;  2Q2H A;  4DAY B;  4NPS A;  2ZJP A;  3GTO H;  1L1O B;  3F8T A;  3HOY G;  2R7D A;  3KF6 A;  1E1O A;  4PG3 A;  1N34 Q;  1N32 Q;  2QEX A;  1XTD A;  1I5F A;  1VQB A;  4DR1 L;  2UUA L;  1X9N A;  1MKH A;  4GNX A;  4DV6 L;  2UUC L;  4JI4 L;  3I4M G;  4JV5 Q;  4A3F G;  4AQY Q;  2HIX A;  2RHQ B;  4IO9 A;  1C0A A;  2NVQ H;  1VQG A;  4LNQ A;  4WJ3 M;  4BA2 I;  2GN5 A;  2MO0 A;  3RLF A;  1XNQ Q;  1FJG Q;  4HJ9 A;  5JEA G;  4GLX A;  4DV7 L;  3EN2 A;  1Q86 C;  3CCS A;  1CKN B;  1KQS A;  5M3M G;  3ICE A;  4NB3 A;  4DV3 Q;  3HFZ B;  4DR5 L;  3M4Q A;  3CXC A;  4X64 Q;  4POG A;  4MTN A;  1RL2 A;  3W1B A;  2VS1 A;  4YY3 L;  1YHB A;  2DGY A;  4ME3 A;  3HOX G;  2KCT A;  4A3I H;  3CCR A;  3UDX A;  3PUW A;  4IJL A;  3PIP A;  4DAM A;  3K8A A;  2VNU D;  2JEB I;  1WYD A;  1P8L A;  1A63 A;  2EQS A;  3KJO A;  3E9I A;  4A3C H;  2K52 A;  2WP8 J;  4DV2 L;  3U4V A;  1HNW L;  1SRU A;  4YCW A;  4GOP C;  1Q8K A;  2ZM6 Q;  1W2B A;  2K5H A;  3K0X A;  5BR8 L;  3GD7 A;  2JQO A;  2F52 A;  4PZ7 A;  3RN2 A;  1N32 L;  2NVX H;  3BJU A;  4A3E G;  4JI7 Q;  1E22 A;  3T1H Q;  2LXK A;  4JV5 L;  3E9H A;  3HOW G;  4JG2 A;  1KC8 C;  2NZO A;  3PO3 G;  5C4X H;  4JYA L;  1IYJ B;  1JMC A;  1PFS A;  1XNQ L;  4RMF A;  1GO3 E;  1PYB A;  1V9P A;  4IPG A;  3I2Z A;  1YJW A;  1FJG L;  3HOU H;  4GKK Q;  5DLQ E;  4DK6 C;  2R6G A;  3GTM H;  4YHH Q;  1HZC A;  3KDF B;  3NEL A;  4BBR H;  3OW2 A;  1N36 Q;  2H5X A;  1O7I A;  1Z9F A;  5E7N A;  1EQQ A;  4X64 L;  1V43 A;  1N9W A;  1NTG A;  4LW1 A;  3HOZ H;  2ATW A;  1VQ8 A;  1Y1W H;  2F4V Q;  4AYB E;  4JI1 Q;  4X66 Q;  3PV0 A;  1GKH A;  4X62 L;  4JI2 Q;  2I0Q A;  3A0J A;  2AMC B;  4C2M H;  4B3S L;  4A3K G;  4IPH A;  2KCM A;  1PH4 A;  1L2F A;  2N8N A;  3GTJ H;  1YHQ A;  1BBU A;  2IX1 A;  4OO1 G;  1EOV A;  1D7Q A;  1EIY B;  2ALY B;  2ZM6 L;  4R4C A;  1HZB A;  2VUM H;  4EX5 A;  5FJ8 G;  4A93 G;  2OCE A;  2ZJR A;  3T1H L;  2UU9 L;  2PQA B;  2UUB Q;  5IP9 H;  4GN3 B;  4JBM A;  2ZTD A;  1QVG A;  1BKB A;  3RR5 A;  1YIJ A;  5JJK A;  2CWA A;  3B6Y A;  2UXD Q;  4R4O A;  2R7Z H;  1K8G A;  4OX9 Q;  3RZO H;  3KF8 B;  2Y0S E;  3RN5 A;  4DR3 Q;  1KHI A;  5ELN A;  1K73 C;  1OXU A;  1UE6 A;  4OWT B;  4BY7 G;  2FXQ A;  3HOV H;  3S1R H;  5C0X I;  1VQI A;  1WFQ A;  1N36 L;  1XPU A;  3DM3 A;  4QJF A;  5GAD C;  2N49 A;  4QIW E;  2E2J H;  4DUZ Q;  2JJQ A;  1HR0 L;  4IFD J;  4A3D H;  3D31 A;  4JI1 L;  4JI3 Q;  1YI2 A;  4A3J H;  1E7Z A;  1YHA A;  4AYB G;  1L1O C;  4JI2 L;  4L5Q A;  4IJH A;  1PH3 A;  4IOC A;  4DNI A;  3AFQ A;  1UEB A;  4LF9 L;  5IP7 H;  5AJ3 Q;  1K9M C;  4Y52 H;  3BZC A;  3GTK H;  4UP7 A;  4GOP A;  3M7N A;  5FLM G;  1WCM G;  3CD6 A;  1P16 A;  4IFD G;  4HJA A;  1EFW A;  1I94 L;  1N8R C;  2YU9 H;  1VQ6 A;  1E3P A;  4BA1 I;  3CF5 A;  2WB1 E;  4HIO A;  1VQP A;  3A5U A;  1R9T H;  1X6O A;  4R4Q A;  5C3E G;  2R93 H;  1VQO A;  5GAG C;  3TQY A;  1Y1V H;  4KHZ A;  4NXM Q;  2Y0S G;  4GNX B;  4DR3 L;  2JA6 H;  1PH9 A;  1OTC A;  5IYD G;  3HOY H;  2HQL A;  2JA9 A;  1X55 A;  2JA5 G;  4BY1 H;  3I4M H;  2IY5 B;  4X6A H;  4O0A A;  4JCV E;  5IWA Q;  4JI6 Q;  3S1Q H;  4HIK A;  4DR6 Q;  3G71 A;  2JA8 G;  4HID A;  4DV4 Q;  1Q82 C;  1PH2 A;  3OTO Q;  1X3E A;  2BA1 A;  1PV4 A;  2YYZ A;  1IBL Q;  1XNR Q;  5IYD H;  1XPR A;  2IX0 A;  3FHW A;  5H1S E;  2VW9 A;  1KL9 A;  1WI5 A;  4JBK A;  4GLV B;  4HJ8 A;  4JI5 Q;  5K36 G;  2VY3 A;  2YTV A;  4R4T A;  2R7F A;  2YV5 A;  5J3B A;  3CQZ H;  1KAW A;  2BH8 A;  3UDI A;  1B7Y B;  1B8A A;  4JI8 Q;  1GM5 A;  2K4K A;  1SLJ A;  3MXN B;  2MQH A;  2QGQ A;  5IYC H;  3CPW A;  3FP9 A;  4KHP L;  3KOJ A;  1YVC A;  4LF4 Q;  2YTX A;  2RF4 A;  3LGJ A;  1HNZ Q;  1XMO Q;  2K5V A;  1Q81 C;  1ASY A;  2OTL A;  4LUV A;  3UDG A;  3CC2 A;  4NXM L;  3PO2 H;  4QGU A;  1NE3 A;  1Q1E A;  2VL6 A;  3CCM A;  3F2D A;  2KHI A;  3TEH B;  1AE2 A;  2C35 B;  3GDE A;  2B63 G;  3CP0 A;  5IYB G;  2NVT H;  2N78 A;  4PZ6 A;  2JA7 G;  3ERS X;  1S40 A;  3JAM i;  4IOA A;  3CCQ A;  1S72 A;  3RLN A;  1QVC A;  1VQ7 A;  2CQO A;  4X65 Q;  4A3B H;  1A8V A;  4DK3 C;  2Q2U A;  5C44 G;  1IBL L;  4BBS H;  3OYY A;  1N34 L;  4A76 A;  3EBE A;  1L1O A;  2AHO B;  1I6H H;  4BXX H;  2JK8 A;  3A74 A;  1A0I A;  4LFA Q;  3TRE A;  4AQY L;  3T1Y Q;  3TS0 A;  3PCO B;  4JI5 L;  1D8L A;  2CWP A;  4R1J A;  1YJ9 A;  1PA6 A;  1IBK Q;  3UE0 A;  1HH2 P;  2QA4 A;  1JT8 A;  1N33 Q;  1VS0 A;  1VQ5 A;  1IL2 A;  3J7A 5;  3J81 c;  1S3O A;  3CMA A;  1HNX Q;  5GAE C;  2I5M X;  1PVO A;  4DV1 Q;  4DV3 L;  3AQQ A;  3AEV A;  2Q2T A;  1Z47 A;  4B3T Q;  1QUQ A;  2NN6 I;  4EQ5 A;  4YWL A;  3PUY A;  4UP9 A;  4DR4 Q;  1NJI C;  4LF6 Q;  2ZJQ A;  3M4P A;  1TWA H;  3ER0 A;  5FJ8 H;  3M3Y H;  3I56 A;  2Z6K C;  4A93 H;  1KIX A;  1NBW A;  5IE8 A;  2D62 A;  2GVB A;  2BH2 A;  1WOC A;  1VQF A;  1X54 A;  3CCU A;  1VQK A;  1K0R A;  4IPD A;  2XGT A;  1UWV A;  3NEN A;  4L5S A;  2CCZ A;  4GS3 A;  2HHH Q;  2VQF Q;  4C3J H;  4GKJ Q;  2LXJ A;  2PMZ E;  4RG1 A;  3PGZ A;  1VQ9 A;  3GTG H;  4JI7 L;  1XMQ Q;  4JOI C;  1XPO A;  4DV5 Q;  1Q46 A;  4BY7 H;  4DPG A;  3JAM c;  5M5W H;  1X3G A;  1IBK L;  1B70 B;  1JJC B;  4OON A;  4UY8 C;  4GN4 B;  1N33 L;  4A3M G;  3HOU G;  4A3G G;  3KLW A;  2A19 A;  3CCE A;  3TS2 A;  3SGI A;  1HNX L;  2PI2 A;  5LMN Q;  4XTC S;  3M85 A;  4DV1 L;  1PH1 A;  4GKK L;  4YHH L;  3RLO A;  5GAH C;  1HNW Q;  2E2I H;  3IRB A;  3A5Z B;  3E0E A;  3K80 C;  3U58 A;  1PH5 A;  4GOP B;  1YIT A;  3D0F A;  1FVI A;  3I4N G;  1EUJ A;  1YBY A;  1DGS A;  1VQH A;  4HIM A;  5FLX c;  1YNX A;  5JJL A;  1KRT A;  2AWO A;  2K50 A;  2F4V L;  4JBW A;  4X66 L;  4LF6 L;  4DR4 L;  5FLM H;  1LM0 A;  1TWF H;  1WCM H;  2GVA A;  4FDB A;  3G6E A;  1OXX K;  1C7Y A;  3S17 H;  2JEA I;  4NXN Q;  1SR3 A;  2B29 A;  3U4Z A;  1W3S A;  3FKI H;  4YCU A;  3U50 C;  4XIG S;  4A3B G;  2CKZ B;  5C0X J;  2N3S A;  3BU2 A;  3J7Z C;  5LMU Q;  2VUM G;  4HJ7 A;  5C3E H;  2XTI A;  3M9B A;  2HHH L;  1K8A C;  1JJ2 A;  4GKJ L;  3S1M H;  3PIO A;  4KLK A;  4YWM A;  3TRZ A;  5M5X H;  3I4O A;  3STB C;  2OWO A;  2UUB L;  4LF5 Q;  1V1Q A;  4QL5 A;  3S2D H;  3ZJY C;  2R92 H;  2JA5 H;  3PF4 A;  4APV A;  2R7Z G;  2PQA A;  3UE1 A;  3K7A H;  4LFB Q;  2UXD L;  1J5E Q;  4OX9 L;  1YJN A;  1GVP A;  3G48 A;  4K0K Q;  2PI2 E;  2ZTE A;  3KF6 B;  4MZ9 A;  5C0X G;  2JA8 H;  1OXT A;  4DR7 Q;  3GTP H;  1SMX A;  4P75 A;  4TQU S;  4ALP A;  1AH9 A;  4DR1 Q;  4YCV A;  2UUA Q;  4JI4 Q;  3HOV G;  4DV6 Q;  4P74 A;  1OXS C;  4IPC A;  1Y14 B;  3ULJ A;  4A3F H;  3RZD H;  4LWC A;  4DUZ L;  4LFC Q;  4A3D G;  4J15 A;  3PUV A;  4JI3 L;  2ID0 A;  2YTY A;  3W1G A;  4DUY Q;  1PH7 A;  2V1C C;  1U0L A;  5IT9 c;  4DV7 Q;  2D0P A;  3F1Z A;  4NXN L;  3I55 A;  3J81 i;  2K75 A;  2Z6K A;  5HGQ A;  1JE5 A;  1J6Q A;  3HKS A;  5M3M H;  5LMU L;  4DR5 Q;  2HT1 A;  5AJ3 L;  3W5O A;  1K3R A;  2IT1 A;  2RHS B;  5M3F G;  3CC7 A;  3J81 j;  3ULL A;  1UE1 A;  3L7Z C;  1LTL A;  4YY3 Q;  1X3F A;  4LF7 Q;  3J80 i;  4DKA C;  4LF5 L;  3HOX H;  4JOI A;  3GO5 A;  2NZH A;  1H95 A;  1RIP A;  2I5H A;  3GTL H;  4LFB L;  1CKO A;  2WB1 G;  1TXY A;  4DV2 Q;  1J5E L;  1VQN A;  3KJP A;  3PF5 A;  3VDY A;  3CCL A;  5GQO A;  4A3L G;  1HJP A;  1TWC H;  2WFW A;  4DR7 L;  3CC4 A;  2JA6 G;  1VQE A;  2EXD A;  5BR8 Q;  1EWI A;  1U5K A;  4P71 A;  5C44 H;  2IHF A;  4LUZ A;  4BY1 G;  3NEM A;  1K83 H;  3CCV A;  1HR0 W;  2LSS A;  4A3E H;  3H0G G;  3EIV A;  5GRO A;  4JYA Q;  5IWA L;  3HOW H;  4JI6 L;  2UXC Q;  4KI0 A;  2Z0S A;  4LFC L;  3PO3 H;  3JC6 6;  3S24 A;  5LMN W;  4DR6 L;  4OXP A;  4DUY L;  4DV4 L;  2K14 A;  3OTO L;  1XNR L;  3S15 H;  3AFP A;  4AIM A;  3RNU A;  1YZ6 A;  3GTQ H;  4C3H H;  3F2B A;  3ULP A;  2E5L Q;  1X56 A;  2DUD A;  2ZTC A;  4C3I H;  1QUQ B;  1KRS A;  4YWK A;  1SFO H;  1CUK A;  3NBH B;  1FL0 A;  3AYH B;  3L2P A;  1M90 C;  4LF9 Q;  4B3R Q;  3CME A;  2AWN A;  3DLL A;  1IZ6 A;  1NMF A;  2BA0 A;  1HZA A;  4LF7 L;  2KEN A;  4LF8 Q;  1MIU A;  4X62 Q;  4JI8 L;  1TWG H;  1L0W A;  1IXR A;  5IYC G;  1G51 A;  1MJE A;  4B3S Q;  1A62 A;  4MNO A;  1C9O A;  1VQ4 A;  4A3K H;  1KD1 C;  4A75 A;  1VQM A;  1YEZ A;  4LF4 L;  1CKN A;  3PO2 G;  1M1K C;  1XMO L;  1HNZ L;  4A4I A;  5C4J H;  2VQE Q;  1PH8 A;  1XJV A;  2PNH A;  2OTJ A;  3S2H H;  2CFM A;  2E8G A;  3J80 c;  4A3I G;  4OO1 I;  1GD7 A;  2KHJ A;  1AE3 A;  3L0O A;  1ASZ A;  2UU9 Q;  3UDF A;  1E24 A;  4B3M Q;  1LYL A;  2MNA A;  4A3C G;  1VQA A;  2UXC L;  2JE6 I;  1NY4 A;  4HJ5 A;  3PSI A;  1QZH A;  2HIV A;  4BBS G;  4X65 L;  1EYG A;  2OQK A;  4A3M H;  4A3G H;  3KYH C;  3CPF A;  3S14 H;  4BXX G;  5M5Y H;  2E5L L;  1JJG A;  4LFA L;  5C4X G;  2AKW B;  4B3R L;  3T1Y L;  1HZ9 A;  5JJI A;  2IHE A;  4L5R C;  3STB D; 
#chains in the Genus database with same CATH topology
 3K7U C;  3GTO B;  1HR0 Q;  3M4O H;  1Q1B A;  2FIN B;  5EPK A;  5CV8 A;  4GZY C;  5I2Y A;  1JWU D;  4JW0 A;  5E3F A;  2VQE L;  2ES2 A;  4B3T L;  2NVY H;  5JPM C;  1Y1W G;  3TP6 A;  5ELO A;  1T9H A;  1UE7 A;  4ULL A;  4X3T A;  1I94 Q;  3Q6S A;  1PTO D;  1HTP A;  2LY7 A;  2D0O A;  1VCI A;  1CKM A;  4P73 A;  4OEL B;  3VYR A;  1B50 A;  3F2C A;  1BO0 A;  1XTC D;  1V1O A;  3D4D A;  4A3I B;  5HY6 A;  1CQF A;  3RMH A;  1XMQ L;  5IT9 E;  3FPP A;  4KHV A;  2XVS A;  5J39 A;  2UXB Q;  4IUR A;  4R9W A;  1GUT A;  1PRT F;  4FF3 A;  2EYL A;  3NBI A;  2F3W A;  5LMN L;  2K5D A;  2CH4 A;  1JOQ A;  2VZA A;  2ICE C;  2WAQ G;  4WJW A;  4PMW A;  2L15 A;  2WII B;  1KXL A;  2Q2I A;  2IW3 A;  5M3F H;  2K28 A;  3S16 H;  2ZXP A;  3HOU B;  2A1A A;  1SE8 A;  2F0I A;  1IBM L;  4ME5 A;  4LMQ D;  5F2D A;  4O42 A;  3H3V C;  1HXY D;  2EYJ A;  1RF2 D;  4UPA A;  3H09 A;  4WJ4 A;  4LUO A;  4KKU A;  2R92 G;  5FKA C;  3GTJ B;  1YNN C;  2M00 A;  5IYB H;  2QF7 A;  2R93 G;  3OIQ A;  1QCB D;  1OO9 B;  1Q12 A;  1EIF A;  1X65 A;  2Q2H A;  1B2T A;  3HOY G;  2QW7 A;  2R7D A;  2QEX A;  1XTD A;  1I5F A;  4DR1 L;  1C8C A;  2UUA L;  2UUC L;  4JI4 L;  3J81 E;  4GNX A;  1DON A;  4ZRZ A;  4A3F G;  1CA6 A;  2HIX A;  2RHQ B;  2NVQ H;  2L55 A;  3FEW X;  3BVZ A;  3RZO B;  1AW7 A;  1EYA A;  4BA2 I;  2GN5 A;  3RLF A;  1XNQ Q;  3QR8 A;  1LTT D;  4PV1 C;  1PRT D;  3S1R B;  3EN2 A;  5I4D A;  3CCS A;  1SEB D;  5IIF A;  4DV3 Q;  2E2J B;  2K03 A;  3HFZ B;  4DR5 L;  1LAC A;  4X64 Q;  4POG A;  4MTN A;  1RL2 A;  1F77 A;  3W1B A;  4MN3 A;  4WOR A;  2VS1 A;  1FD7 D;  1YHB A;  1C4Q A;  2F3V A;  2KCT A;  2BE5 C;  3PIP A;  4G7H C;  1WYD A;  3OIP A;  3KJO A;  4RA8 A;  3U4V A;  4OL7 A;  1SRU A;  1Q8K A;  1IKL A;  5C5M A;  4PZ7 A;  1H9S B;  3Q22 A;  1R4P B;  2EYP A;  3BJU A;  3DEO A;  5I6Y A;  4JV5 L;  3E9H A;  3HOW G;  2B2Y C;  4JG2 A;  1KC8 C;  2NZO A;  1EEI D;  1PFS A;  1Y1V B;  1MSG A;  1FJG L;  2XSC A;  3I2Z A;  1SNM A;  2QCP X;  4C3H G;  3KUP A;  3I4M B;  2IL8 A;  2R6G A;  3GTM H;  3KDF B;  3NEL A;  4BBR H;  2CW0 D;  1O7I A;  1F9P A;  1N9W A;  5EBC A;  3HOZ H;  4F7X A;  4CDE C;  4KTA A;  4AYB E;  3LNN A;  2I0Q A;  3A0J A;  4C2M H;  1PH4 A;  1L2F A;  1YHQ A;  2EY5 A;  1EIY B;  4ZLT F;  2VUM H;  3NTI A;  1EQV A;  3NWS A;  2ZJR A;  5E1F A;  5IP9 H;  2BDN A;  2ZTD A;  1QVG A;  2KCC A;  1DOK A;  3RR5 A;  5JJK A;  5A35 A;  3HZX A;  2CWA A;  3NK9 A;  3IKJ A;  3HRZ C;  4OX9 Q;  1EU3 A;  2K5Q A;  1D2B A;  1OXU A;  4BY7 G;  4DF7 A;  1VQI A;  1N36 L;  3ERO A;  2F0E A;  3NQT A;  2WKD A;  3R3O A;  4TKO B;  5HGT A;  1EY0 A;  3D31 A;  4JI3 Q;  1PDQ A;  1E7Z A;  4JI2 L;  4V19 0;  4IJH A;  1PH3 A;  1DM0 B;  2F1M A;  2K33 A;  5C3W A;  1F2L A;  4CKC A;  1G2T A;  1MGS A;  1ZKO A;  5FLM G;  1I6V C;  1WCM G;  3EJI A;  4M1U B;  3IAY A;  3T16 A;  2L0C A;  2WB1 E;  4HIO A;  1X6O A;  5GAG C;  4Q5V A;  3TQY A;  5IYD G;  4S3S A;  1JC7 A;  4BY1 H;  1X55 A;  2IX3 A;  2IY5 B;  1F2Z A;  1QE6 A;  4X6A H;  1AN8 A;  1F9Q A;  2L4N A;  2M9V A;  4RCO A;  1SNQ A;  4B9W A;  1EYD A;  4C3J B;  3VR6 A;  1PH2 A;  3GTG B;  2BA1 A;  1XPR A;  2IX0 A;  2D5D A;  2K6A A;  1KL9 A;  1WI5 A;  3D6C A;  4HJ8 A;  4XXE A;  3VA5 A;  3W2D A;  2VY3 A;  3MA2 B;  3P1H A;  2J0T D;  3T51 B;  5J3B A;  2O4X A;  1B7Y B;  4XQJ A;  2K4K A;  2E2I B;  2M2L A;  1J8I A;  3KOJ A;  2WAQ B;  3LGJ A;  1XMO Q;  2FMC A;  5KNC A;  1ASY A;  3PO2 H;  4KKS A;  1M4V A;  3TEH B;  3HP3 A;  2C35 B;  3SVM A;  1D5M C;  5IYB G;  2NVT H;  3CKI B;  2F0Q A;  2JA7 G;  1T5E A;  1S40 A;  3E6Z X;  2B2U A;  1DXM A;  3OYY A;  4DAV A;  1UEA B;  4A76 A;  3EBE A;  1L1O A;  5D14 A;  1TY2 A;  2R92 B;  2RKS A;  1A0I A;  3K7A B;  4KJO A;  1D6E C;  4AQY L;  1YJ9 A;  3X3M A;  4XYO A;  3UE0 A;  1KNA A;  1J9O A;  1HUM A;  5CMD A;  3J7A 5;  1HNX Q;  5GAE C;  4DV1 Q;  3AMU A;  4A3F B;  4U68 A;  1CA5 A;  1Z47 A;  4B3T Q;  1NAP A;  1B3A A;  1QUQ A;  2NN6 I;  4ABN A;  3NBH A;  4DR4 Q;  2ZJQ A;  3I56 A;  4A93 H;  2F4I A;  5EKI A;  1QWY A;  2GVB A;  2IPK D;  1VQF A;  1JWM D;  1PMR A;  4FXK C;  1VQK A;  4DN4 M;  2XGT A;  3SK4 A;  3NEN A;  1UUP A;  2L12 A;  4GS3 A;  5EJW A;  2LXJ A;  3BVM A;  4RG1 A;  1XMQ Q;  1B53 A;  1Q46 A;  4DPG A;  1IL8 A;  1X3G A;  1IBK L;  4GN4 B;  1N33 L;  4RGT A;  4A3M G;  1K83 B;  2A19 A;  5LMN Q;  1PH1 A;  1CHQ D;  2Q8R E;  3HOW B;  4H13 C;  4GOP B;  1YIT A;  4NDX A;  4HIM A;  1M8A A;  5FLX c;  1KRT A;  3S15 B;  1SYG A;  2F4V L;  4X66 L;  4MHE A;  3SEB A;  3G6E A;  1YNJ D;  4C3H B;  4FDB A;  2R3Z A;  1SR3 A;  2B29 A;  2FHT A;  3U4Z A;  2A73 B;  1II3 A;  1KAB A;  3BU2 A;  2VUM G;  1MHW C;  3I70 A;  1O7Y A;  4L8J A;  2MJ8 A;  3TP5 A;  3A8J E;  4QL5 A;  2HCC A;  2PQA A;  3L9A X;  3OSO A;  1EY8 A;  4K14 A;  2A6H C;  3G48 A;  3TME A;  3S2H B;  4MZ9 A;  4X3S A;  2JA8 H;  1OXT A;  3GTP H;  3TP7 A;  1JIC A;  3PQI A;  4DR1 Q;  2QIL A;  2UUA Q;  4JI4 Q;  2A69 D;  5FO8 B;  2I46 A;  3MXP A;  1Y14 B;  5LL6 S;  3URY A;  2F0U A;  2ZT9 C;  2RA4 A;  2EVB A;  4IUU A;  3IFT A;  1JWS D;  3W1G A;  4DUY Q;  4A3G B;  3S14 B;  5IT9 c;  4BY7 B;  3J81 i;  2Z6K A;  3BYT B;  3NHH A;  1J6Q A;  3HKS A;  1S5E D;  5M3M H;  4DR5 Q;  1Y8O B;  5AJ3 L;  1VMC A;  2MHV A;  2RHS B;  3N6R A;  3M4O B;  1QNK A;  2SEB D;  4QUF A;  5KND A;  2OT2 A;  3J80 i;  4LF5 L;  1LTB D;  2DY8 A;  3CRK C;  3HOX H;  3GO5 A;  2NZH A;  1KLU D;  3MXG A;  2WB1 G;  1TXY A;  2NVY B;  4A3L G;  3KJP A;  2BDO A;  1HJP A;  1TWC H;  2XNA C;  3NE5 B;  2XIW A;  1LT3 D;  4P71 A;  2IHF A;  4BY1 G;  4A3E H;  3H0G G;  1TU2 B;  5GRO A;  5IWA L;  3K5N A;  4JI6 L;  5COY A;  3JC6 6;  5IGG A;  3S24 A;  5LMN W;  1DZ1 A;  2K14 A;  1CQV A;  2WIN B;  2DJF C;  3ULP A;  2ZTC A;  4YIJ A;  4YWK A;  5KEE A;  1FL0 A;  3AYH B;  5JPN C;  1STB A;  1TWG H;  2B2T A;  1IXR A;  3WOF A;  1MJE A;  4MNO A;  3MXN A;  2LS0 1;  3R2I A;  3RUZ A;  4LF4 L;  3PO2 G;  5M3F B;  5C4J H;  2HDM A;  1DD2 A;  1XJV A;  3S16 B;  3J80 c;  4A3I G;  3A8I E;  1GD7 A;  1SNP A;  2E74 C;  2B2V A;  2X69 A;  1BCP F;  1VQA A;  2UXC L;  2PW5 A;  3G7L A;  4IUQ A;  3PSI A;  4UAI A;  1PRT C;  2SOB A;  5FLX L;  3TBI B;  4RGN A;  2F0M A;  3CPF A;  1H9S A;  2E5L L;  1BBX C;  3MZ5 A;  3P20 A;  3K57 A;  4POF A;  4LF8 L;  2F03 A;  3I7F A;  3M4Y A;  4HCE A;  2WAQ E;  2NVQ B;  5J22 A;  4HAE A;  3Q8D A;  2KBN A;  3J7A V;  3KDF A;  1JB7 A;  4MIU A;  1TKW B;  4O2D A;  2F0G A;  1EU4 A;  2OQ0 A;  4B3M L;  5I6W A;  2NTS A;  1IYV A;  3BVG A;  4CJ2 C;  3P7J A;  2A68 C;  2CW0 C;  4OWW B;  4KN7 C;  5IY0 A;  4P72 A;  4J8Q A;  4DV5 L;  4RH6 A;  1I3Q H;  4CKE A;  1MJC A;  1EQR A;  2RCN A;  2AQ3 B;  4OHJ A;  1WTO A;  1NSN S;  2KUM A;  1SE3 A;  1RJT A;  3PUX A;  1BBW A;  3H3V I;  4B08 A;  2ASB A;  2AUJ D;  3S1N H;  2RSN A;  2J4X A;  4O1N A;  4L5T A;  1CSP A;  2N88 A;  1G29 1;  3GTM B;  3QOL A;  1SN8 A;  3WWV A;  4BBR B;  2A8V A;  1SRO A;  5IP7 G;  1CSQ A;  1EZ6 A;  1S5B D;  4QF4 A;  1BF4 A;  3HOZ B;  4JI0 L;  4FYD A;  4DAP A;  3IFD A;  2NUC A;  1SYE A;  4DR2 L;  1OXV A;  4C2M B;  4DV0 L;  1G2S A;  1A2U A;  3MEF A;  4QB4 A;  1A3U A;  2MUY A;  2LFN A;  2PO4 A;  2K01 A;  2VUM B;  1Y1V G;  5ELB A;  3H91 A;  4NPS A;  1N32 Q;  1L1O B;  4I65 A;  2PMZ B;  3I4M G;  1X9N A;  4DV6 L;  1G91 A;  1LV9 A;  2QDB A;  4AQY Q;  4F87 A;  4IO9 A;  1TQO A;  4LNQ A;  4WJ3 M;  1GUW A;  4HJ9 A;  2K05 A;  4GLX A;  3J80 L;  5M9O A;  5CYU A;  2L5T A;  3TZD A;  5M3M G;  3ICE A;  3VYS A;  3WOE A;  1SMY C;  2PZT A;  4N8F A;  3M4Q A;  2CQA A;  3VYU A;  4J1M A;  1PTO F;  1Q90 A;  2B2W A;  4YY3 L;  4ME3 A;  2F0S A;  3HOX G;  3QJY A;  3UDX A;  3PUW A;  4IJL A;  2JEB I;  1EY5 A;  1A63 A;  5EKK A;  3GP7 A;  2K52 A;  1HNW L;  4YCW A;  2X6L A;  2ZM6 Q;  2F0K A;  3GD7 A;  1QOH A;  2F52 A;  4A3E G;  2Q8T A;  2E75 C;  1LTG D;  3D3R A;  4JYA L;  5C4X H;  1JR0 D;  1IYJ B;  3EA6 A;  2MP1 A;  2F0T A;  4RMF A;  1PYB A;  1V9P A;  4DU9 A;  5FLX E;  5JJZ A;  4ILW A;  4BY1 B;  5DLQ E;  4DK6 C;  2D9U A;  1AZQ A;  2EY2 A;  3I8Z A;  1HZC A;  1O80 A;  2JSO A;  1EQQ A;  1V43 A;  4LW1 A;  5IOD A;  2ATW A;  1VQ8 A;  3DWP A;  3Q24 A;  2F4V Q;  4X66 Q;  4X62 L;  1ESR A;  3OW7 A;  3AU7 A;  2N8N A;  1QJO A;  2IX1 A;  4CJ1 B;  1D7Q A;  3H6M A;  3O13 A;  3OHX C;  4R4C A;  1WD0 A;  2LKV A;  3PIP 3;  1HCZ A;  5FJ8 G;  1BQQ T;  3T1H L;  2P5Z X;  2PQA B;  3TSS A;  1H9K A;  1YIJ A;  5BN3 A;  3B6Y A;  4R4O A;  5DM6 3;  2R7Z H;  1K8G A;  3PO2 B;  3KF8 B;  4C3J G;  3RN5 A;  3MFY A;  5ELN A;  3K59 A;  2NVT B;  3I3C A;  4ZCK A;  1SXT A;  4A3D H;  4JI1 L;  1YI2 A;  2KA7 A;  2NVX B;  4A3J H;  2F0J A;  5J1Z A;  3R93 A;  1HA6 A;  3SK5 A;  5AJ3 Q;  1ILQ A;  4UP7 A;  4GOP A;  2B8F A;  4HJA A;  1EFW A;  3OOC A;  4HTH A;  4N8X 1;  1N8R C;  1VQ6 A;  4BA1 I;  1VQP A;  1CI3 M;  1GUS A;  3KLS A;  5HUR A;  4DR3 L;  2JA6 H;  1OTC A;  4A93 B;  2DJG C;  2HQL A;  4DFA A;  2JN4 A;  2JA9 A;  5CV4 A;  1HPC A;  4JCV E;  5IWA Q;  4JI6 Q;  3S1Q H;  4HIK A;  2XWB B;  3G71 A;  4HSV A;  2PYK A;  1LTR D;  3SK8 A;  1PV4 A;  5JVG 3;  5JEA H;  2Z9H A;  1NCV A;  4JBK A;  4JI5 Q;  1A15 A;  1I4G A;  2C9O A;  3I4L A;  5K36 G;  2R7F A;  1B3Q A;  1A6X A;  2G9H D;  4XT3 B;  1GM5 A;  3J80 E;  3MXN B;  2D2C C;  3CPW A;  3FP9 A;  4LF4 Q;  2N55 A;  4RGM A;  2OTL A;  4NXM L;  1Q1E A;  3F2D A;  3DUZ A;  4RHR A;  4KY6 A;  3CP0 A;  2N78 A;  3VR3 A;  1CT1 D;  3RLN A;  1A8V A;  2Q2U A;  1IBL L;  1N34 L;  3K5M A;  1ESF A;  1WTV A;  1ET6 A;  2JK8 A;  3DEP A;  3TS0 A;  1A2T A;  3S2D H;  3PCO B;  1PA6 A;  1SJH D;  2IWH A;  1V1P A;  4QUC A;  2JA8 B;  3GTP B;  1JT8 A;  1VQ5 A;  3W3A A;  1S3O A;  2FFK B;  3CMA A;  3ND9 A;  3NPP A;  2I5M X;  2KOL A;  2NN6 H;  3V96 A;  3SXH A;  3AEV A;  3JAM L;  2Q2T A;  4LAA A;  1G6Z A;  1ET9 A;  4UHV A;  4OO1 H;  2Z4H A;  4EQ5 A;  3BDC A;  3M4P A;  1TWA H;  3ER0 A;  2CH4 W;  4IZ8 A;  5ELF A;  5IE8 A;  1SBB B;  1HTL D;  5M3M B;  5IGD A;  4IPD A;  4L5S A;  2CCZ A;  2HHH Q;  4GKJ Q;  2PMZ E;  3SR1 A;  3PGZ A;  4IUN A;  2Z8L A;  3HOX B;  4Q0F A;  4K2L A;  1XPO A;  4DV5 Q;  3HG9 A;  5M5W H;  1TWC B;  4A3G G;  4A3E B;  4GKK L;  1PZK D;  2NZ1 D;  2RBM A;  3EFX D;  1NUC A;  3A5Z B;  3E0E A;  2NYZ D;  3K80 C;  2H4O A;  1JJG A;  1EUJ A;  1YBY A;  4PQX A;  1O7L A;  4JBW A;  4LF6 L;  3PMF A;  1LM0 A;  1TWF H;  3S17 H;  3OWF A;  1OXX K;  1C7Y A;  4N9T A;  4NXN Q;  4X3K A;  1HHV A;  1W3S A;  3FKI H;  3UI2 A;  4XIG S;  2N3S A;  3J7Z C;  4HJ7 A;  5C3E H;  3M9B A;  1JJ2 A;  3FPU B;  4KLK A;  5I9O A;  1VDZ A;  1F9R A;  5M5X H;  2UUB L;  2QEJ C;  5KIX A;  2JA5 H;  4APV A;  2R7Z G;  3UE1 A;  5C4J B;  3I90 A;  1J5E Q;  1LO5 D;  1GVP A;  1LTS D;  3KBX A;  1YJN A;  4DR7 Q;  4K6L A;  1SMX A;  4TQU S;  4ALP A;  1AH9 A;  3DM1 A;  3QO2 A;  4DV6 Q;  4RWS C;  1IHZ A;  4LWC A;  4LFC Q;  4A3D G;  4J15 A;  3MC0 B;  2ID0 A;  1PH7 A;  1LT5 D;  2WV6 D;  2WAC A;  4C1N I;  2K75 A;  5LMU L;  3W5O A;  5M3F G;  3ULL A;  1UE1 A;  4YY3 Q;  1X3F A;  4LF7 Q;  4DKA C;  4JOI A;  1H95 A;  2I5H A;  1BCP C;  2C5C A;  4LFB L;  1GUG A;  1HNW Q;  3PF5 A;  3VDY A;  4IN3 A;  2WFW A;  2JA6 G;  1EWI A;  1U5K A;  5C44 H;  1MD2 D;  5CBA E;  3CCV A;  2Z6B A;  2OXP A;  4JYA Q;  2Z0S A;  4FVM A;  4L63 B;  3K5O A;  4OXP A;  3OTO L;  4IUT A;  1I3Q B;  1MI2 A;  2FMM A;  4HCS A;  2DUD A;  4C3I H;  3J7Y W;  1M90 C;  4QIW B;  3CME A;  3FMC A;  2AWN A;  1NMF A;  1HZA A;  2KEN A;  5CV6 A;  1MIU A;  2O5J C;  4X62 Q;  1L0W A;  1ZYR C;  1L0Y B;  3S1N B;  4ODG A;  3SE0 A;  1VQ4 A;  1KD1 C;  4A3K H;  1VQM A;  2SNS A;  2RDH A;  4ZKB B;  3VR5 A;  2VQE Q;  1CHP D;  2HQE A;  2PNH A;  2BOS A;  4OO1 I;  2KHJ A;  3L0O A;  1ASZ A;  1XYI A;  1E2V A;  3TZU A;  5C4Z A;  1TII D;  2HIV A;  1GOZ A;  1EYG A;  3GQB A;  4RAU C;  4WRD A;  3MWY W;  3KYH C;  1VF5 C;  2GA4 B;  4B3R L;  3T1Y L;  5JJI A;  4LF9 L;  4L5R C;  1LLR D;  4NW2 A;  3I4N H;  3C1F A;  4R4I A;  4GLA C;  4OWX B;  2WKC A;  4XDX A;  4GNX C;  2NN6 G;  1ICW A;  1AFP A;  4BBR G;  4KD4 A;  4L6T B;  3Q23 A;  3HOZ G;  4A3B H;  3OMC A;  2JP1 A;  2CVR A;  3MTS A;  1VQC A;  1E1T A;  1NMG A;  1H9M A;  4JBJ A;  1LTA D;  1IBM Q;  4IFD I;  3K81 C;  1B4O A;  1RKN A;  1VQD A;  2VQF L;  3MFG A;  1BVS A;  5IP9 G;  2VB3 X;  4XT1 B;  4JC0 A;  1CZG A;  4KY7 A;  3F2U A;  4RKB A;  3LWU A;  3H15 A;  1YNN D;  3H3V H;  5JAV A;  1B44 D;  3KF8 A;  3NP8 A;  1I50 H;  3NTH A;  4ZQ3 A;  3HKZ G;  2UUC Q;  5D3I B;  5C4X B;  1VQJ A;  4OGQ C;  1PTO C;  1UAP A;  2HCI A;  3TP8 A;  4E6I A;  4Y7N H;  1VF7 A;  3GV3 A;  2EJG C;  5I2X A;  4LK1 C;  3FKI G;  2EJM A;  3CW2 C;  1VQL A;  4K8J A;  2MFI A;  3CCJ A;  2E2H H;  4DNT B;  2EIF A;  2UXB L;  3OWE B;  1FYC A;  1R4Q B;  1RDP D;  1GUO A;  5KRU A;  2BE5 D;  5D3D A;  1ZEQ X;  1EIG A;  2I5L X;  3KLR A;  5JEA J;  3F8T A;  4PG3 A;  1N34 Q;  1STN A;  4KY5 A;  1EQT A;  2PZW A;  1TVX A;  4JV5 Q;  2AQ1 B;  1V1P B;  2R7Z B;  1E2Z A;  3DWA A;  2XRQ D;  1F2Y A;  1QB5 D;  1GHJ A;  3TN2 A;  1I4P A;  1SSO A;  1FJG Q;  4DV7 L;  1CKN B;  5IOC A;  1WTP A;  3CXC A;  4A3D B;  2F0H A;  5KYI A;  2J7Z A;  1CZW A;  4A3J B;  2ZXR A;  3S9W A;  1EFI D;  5DM7 3;  2VNU D;  4DAM A;  1P8L A;  2EQS A;  4A3C H;  2F0F A;  3HGB A;  1W2B A;  2K5H A;  5BR8 L;  5CBE E;  2JQO A;  2DN8 A;  2HUG A;  1E22 A;  1F9S A;  5D65 A;  5LHY 1;  1JMC A;  1PLF A;  1XNQ L;  1GO3 E;  2JA6 B;  1YJW A;  3SK6 A;  1JE4 A;  2DNE A;  4ZYS A;  4GKK Q;  3A7A B;  4C3I G;  1N36 Q;  1S5D D;  3OW2 A;  1IKM A;  5E7N A;  4X64 L;  1NTG A;  2PCF B;  1EYC A;  1Y1W H;  3PV0 A;  5ELC A;  4JI2 Q;  2G9D A;  2AMC B;  4B3S L;  1KLG D;  4IPH A;  4A3K G;  3MHB A;  1PZJ D;  1HZB A;  1STY A;  3AB9 A;  4EX5 A;  4ZUI A;  4A93 G;  2OCE A;  4XYQ A;  1A3T A;  2UUB Q;  4GN3 B;  4JBM A;  4IUP A;  2F0N A;  1BKB A;  3E5S A;  4TRD A;  1O7Z A;  1ONL A;  1WTX A;  1K3B C;  1FGB D;  1TY0 A;  2KEE A;  1U4P A;  4UDU C;  1KHI A;  1XXG A;  1UE6 A;  2XWJ B;  3HOV H;  5C0X I;  2EXZ A;  1U9R A;  3DM3 A;  4QJF A;  1ML0 D;  4QIW E;  2B2U C;  4XQQ A;  2B39 A;  4IFD J;  1YHA A;  2L1B A;  1L1O C;  4L5Q A;  4FNF A;  3E0J A;  4IOC A;  3S2D B;  3QOJ A;  2EDG A;  1EEF D;  3AFQ A;  2I07 B;  3R2T A;  1Q8I A;  3GTK H;  4C1N K;  2A74 C;  1P16 A;  5CC4 A;  1NR2 A;  3G6J B;  2YU9 H;  3T13 A;  3BYY B;  3CF5 A;  5EPJ A;  2B8G A;  2B2Y A;  1R9T H;  4KKT A;  2R93 H;  1VQO A;  4FXD A;  1GHK A;  1TWA B;  2Y0S G;  1PH9 A;  3HOY H;  3I91 A;  2JA8 G;  5JVH 3;  1Q82 C;  3OTO Q;  2YYZ A;  5DNF A;  1HFN A;  5M5W B;  2VW9 A;  2KED A;  3BG3 A;  1SJE D;  1XX8 A;  5CV7 A;  1WVL A;  2YTV A;  3I72 A;  2YV5 A;  4G7Z C;  3CQZ H;  3MAQ A;  1KAW A;  3UDI A;  4AYB B;  1Q3L A;  1BNZ A;  2MQH A;  1K28 A;  2QGQ A;  3HKZ B;  3T56 B;  5IYC H;  1W6J A;  4KHP L;  3NSW A;  2YTX A;  5JOB A;  3UDG A;  1TWF B;  1NE3 A;  2E76 C;  3CCM A;  3S17 B;  1AE2 A;  3GDE A;  5IGE A;  1C48 A;  3FKI B;  3LX0 A;  4PZ6 A;  3JAM i;  4IOA A;  1VMP A;  5C3E B;  1QVC A;  4DK3 C;  5E4W C;  4X3U A;  1D1K A;  1RTN A;  4BBS H;  2F0O A;  4DAY A;  5M5X B;  1L0X B;  1TR5 A;  1I6H H;  2JA5 B;  4BXX H;  3A74 A;  4KN4 C;  3TRE A;  1SFO H;  3T1Y Q;  4B3R Q;  3K5L A;  4R1J A;  1IBK Q;  4DNR B;  1HH2 P;  1N33 Q;  4RHS A;  1IW7 D;  1S4Z A;  1IL2 A;  1PVO A;  1MSH A;  3CU7 A;  1WD1 A;  5K5P A;  1JQY D;  2LMC B;  3DMU A;  2H1E A;  3PUY A;  4UP9 A;  5G3L F;  2JYO A;  3M3Y H;  2Z6K C;  1D1I A;  1NBW A;  1HQM C;  2TMP A;  1I4Q A;  1TT2 A;  1X54 A;  1K0R A;  1UWV A;  1SND A;  2VQF Q;  1RHP A;  4JI7 L;  3C2P A;  4Z9C B;  1EIH A;  4BY7 H;  4KMU C;  1B9M A;  3JAM c;  3CHB D;  1JJC B;  4OON A;  4HN7 A;  4NP5 A;  4UY8 C;  4H44 C;  1SYB A;  5C44 B;  5T1I A;  3R8B A;  2O5I C;  2A6H D;  4EGV A;  2PI2 A;  1HNX L;  4XTC S;  4DV1 L;  5BN5 A;  4YHH L;  2L9H A;  4KD3 A;  1DOL A;  3D4W A;  4K5V A;  1PH5 A;  1NR4 A;  5A2Q L;  1AEX A;  2AWO A;  2K50 A;  4DR4 L;  1SNO A;  5FLM H;  1WCM H;  2GVA A;  4BS9 A;  1CK1 A;  4C3I B;  4J6H A;  4OIJ A;  1BUV T;  3RD4 A;  2OF1 A;  4YCU A;  5C0X J;  5ELD A;  1PTO H;  3E3X A;  2PNR C;  3U9S A;  2XTI A;  1K8A C;  2K1B A;  4DA2 A;  3S1M H;  2A5H A;  4CDD C;  3PIO A;  2B2T C;  1DCZ A;  4YWM A;  3C46 A;  3TRZ A;  2OWO A;  3I4O A;  4LF5 Q;  1SE4 A;  5IYD H;  4A3K B;  3PF4 A;  5G3L D;  1G8Z D;  2UXD L;  3OPO A;  1KDA A;  4P75 A;  2B2V C;  3FVQ A;  3NTK A;  4YCV A;  3HOV G;  1KNE A;  2Q8I B;  4P74 A;  1OXS C;  2EYF A;  4B9X A;  4IPC A;  4ZAI A;  1YNJ C;  3RZD H;  4DUZ L;  4FF4 A;  4H7B A;  3PUV A;  2NB0 A;  2RQX A;  1U0L A;  4DV7 Q;  2D0P A;  3F1Z A;  3I55 A;  4BWG B;  1LT6 D;  2NTT A;  3QB3 A;  2EE1 A;  1JE5 A;  5HGQ A;  2HT1 A;  3I4N B;  2IT1 A;  1ENC A;  3L7Z C;  1LTL A;  4ZKC B;  2F0L A;  3T4A C;  1TS5 A;  5ISR A;  5IGF A;  1ENF A;  2EOT A;  3KBG A;  3GTL H;  1QIL A;  4CHT B;  1CKO A;  4A3B B;  2JA7 H;  5LL6 X;  1VQE A;  5BR8 Q;  3ONA B;  2A69 C;  3NEM A;  1HR0 W;  2LSS A;  4FO2 A;  4DXF A;  1U4L A;  2UXC Q;  3U9O A;  3PO3 H;  1E0B A;  1KDB A;  1V8Q A;  4DR6 L;  4DUY L;  4DV4 L;  1XNR L;  3AFP A;  2Y0S B;  1YZ6 A;  3GTQ H;  3F2B A;  4IUV A;  2E5L Q;  1X56 A;  4CGY B;  1UNS A;  1FR3 A;  1KRS A;  5AFW A;  1CUK A;  3X3N A;  3L2P A;  1RTO A;  2XRS D;  3DLL A;  2RCF A;  4HMI A;  4LF8 Q;  1I50 B;  4JI8 L;  4B3S Q;  5IYC G;  1G51 A;  5IGC A;  2SNM A;  1C9O A;  1CKN A;  1HNZ L;  4A4I A;  4HR7 B;  2PQE A;  2QDL A;  4Y7N B;  2CFM A;  1AE3 A;  4B3M Q;  4CDF C;  3MVV A;  2JE6 I;  3A54 A;  3ITP A;  2PPB C;  4BBS G;  5EGT A;  4X65 L;  2KHS A;  5KGU A;  1WTQ A;  4A3M H;  2E2H B;  4K2K A;  4BXX G;  5M5Y H;  2ENB A;  4LFA L;  5C4X G;  2AKW B;  3HEJ A;  2A68 D;  1HZ9 A;  1Y8N B;  2IHE A;  3STB D;  1A3V A;  3G4S A;  2KVM A;  1AZP A;  4TSS A;  4NKL A;  3HKZ E;  1Q7Y C;  3C3L A;  4GN5 A;  5BN4 A;  3CAM A;  4C56 C;  2PW7 A;  1SNC A;  1UE5 A;  5A2Q E;  1QVF A;  3LWE A;  3OMG A;  3N52 A;  5DAU A;  1ICF B;  3K58 A;  4HSP A;  2KEC A;  4UP8 A;  4QQB X;  4IFD H;  1S5F D;  1TWH H;  5CV5 A;  2FJ2 A;  1QZG A;  4AH6 A;  1DOM A;  4JI0 Q;  1SAP A;  2B2W C;  1GJX A;  4QY7 A;  4DR2 Q;  1TWG B;  3SDZ A;  2NWG A;  4R8I A;  2EYO A;  4DV0 Q;  1I4R A;  3GV6 A;  4PZ8 A;  2HD3 A;  1PYS B;  1K0S A;  2V4D A;  4H02 A;  4EQO A;  1FGU A;  2X6G A;  1W6K A;  3PUZ A;  4K8I A;  1IYU A;  3MXU A;  5C5L A;  1B9N A;  1LTI D;  4TVA B;  4A3J G;  2MO1 A;  2EY1 A;  1G6P A;  1X3P A;  2EY6 A;  1PH6 A;  4KHP Q;  4FP5 D;  4A3L H;  1Y1W B;  1S5C D;  2B3G A;  1PXU A;  1SMY D;  4LJZ C;  1JB3 A;  3A7L A;  1K8O A;  2EJF C;  2EYH A;  3KFU A;  1STG A;  2K5N A;  5EAY A;  2B63 H;  3H0G H;  2F3I A;  2A6E D;  1Y69 U;  1LUZ A;  2Z4I A;  4K0K L;  3V05 A;  3BZK A;  4DAY B;  1WJJ A;  2ZJP A;  3GTO H;  4CJ0 B;  5FOB B;  3KF6 A;  1E1O A;  1VQB A;  3BS1 A;  1EWH A;  4N9P A;  4CBV A;  1MKH A;  4MTK A;  2Z1C A;  1BXT A;  1KAA A;  1VQG A;  1WTH A;  1HQR D;  2MO0 A;  1GUN A;  4V0B A;  5JEA G;  4KJN A;  3HOV B;  1Q86 C;  1KQS A;  4FF2 A;  1LAB A;  4NB3 A;  2RVL A;  4PMC A;  2DGY A;  2F0P A;  4A3I H;  2TSS A;  1JOK A;  3CCR A;  2F0D A;  3K8A A;  5C3X A;  2G5D A;  3E9I A;  3J7A F;  1DYQ A;  2WP8 J;  4FXG C;  3JAM E;  4DV2 L;  3GTK B;  4GOP C;  2EYM A;  3M7G A;  1K8M A;  3K0X A;  1N32 L;  3RN2 A;  4KV6 A;  2NVX H;  2YU9 B;  1RCV D;  1WTW A;  4JI7 Q;  1T5X D;  3NUC A;  3T1H Q;  2LXK A;  3NXW A;  3VR4 A;  1R9T B;  4XQN A;  3PO3 G;  2DNC A;  2R93 B;  4K6D A;  3ZYY X;  2OEO A;  3HOY B;  4IPG A;  4I7Z C;  3ERQ A;  2EPB A;  2XN9 C;  4IAL A;  3K0Y A;  3HOU H;  1BCP B;  4YHH Q;  2RDG A;  3FRP B;  2SDF A;  2H5X A;  1Z9F A;  5C4H A;  2EZV A;  4JI1 Q;  4QMG A;  1GKH A;  3BDL A;  2AUK A;  2KCM A;  1DJR D;  3GTJ H;  1PFB A;  1BDO A;  1BBU A;  3A8K E;  4OO1 G;  1EOV A;  5EBD A;  1PFN A;  1X3Q A;  2ALY B;  2ZM6 L;  3CQZ B;  2UU9 L;  1EY4 A;  2KJX A;  3A56 A;  1F2M A;  1IW7 C;  2QKI C;  2KQ3 A;  2UXD Q;  4DXG A;  1D5Z C;  2KCN A;  3RZO H;  4ZK9 B;  2Y0S E;  4DK1 A;  5C0X H;  1TS4 A;  4DR3 Q;  3SHL A;  1H9R A;  3ND8 A;  1K73 C;  4OWT B;  1SDF A;  2FXQ A;  3DWQ A;  3P75 A;  4HMJ A;  2R61 A;  3S1R H;  1WFQ A;  1XPU A;  3BDO A;  5GAD C;  2N49 A;  2E2J H;  4U67 3;  4DUZ Q;  2JJQ A;  4BBS B;  1HR0 L;  1ZXT A;  4AYB G;  1I6H B;  4I7A A;  1SFO B;  3NWT A;  4DNI A;  1UEB A;  5IP7 H;  1K9M C;  1EL0 A;  4RFB A;  1CFM A;  4Y52 H;  1PFM A;  3BZC A;  3T53 B;  4H0L C;  3M7N A;  1STA A;  3CD6 A;  4IFD G;  1I94 L;  3EVQ A;  4JK1 C;  3K6O A;  1E3P A;  1SE2 A;  3A5U A;  1EOT A;  5EKL A;  1CM9 A;  4R4Q A;  5C3E G;  1EZ8 A;  5NUC A;  4QCL A;  1Y1V H;  4KHZ A;  4NXM Q;  4G4K A;  4GNX B;  3M3Y B;  4JPB W;  1JCK B;  1EWC A;  2JA5 G;  3I4M H;  4O0A A;  2AQ2 B;  4DR6 Q;  4HID A;  4DV4 Q;  1XNR Q;  1X3E A;  1IBL Q;  3H94 A;  1Z6H A;  5T1G A;  3FHW A;  5H1S E;  2NBF A;  1HA5 A;  4GLV B;  4M8A A;  1ENA A;  1EY6 A;  4R4T A;  2BH8 A;  1B8A A;  4JI8 Q;  1SLJ A;  2VB2 X;  5CR3 A;  1YVC A;  2RF4 A;  1HNZ Q;  2K5V A;  4P2C B;  1EY7 A;  1Q81 C;  4LUV A;  5DEH A;  3CC2 A;  4G7O C;  4QGU A;  1WCM B;  2VL6 A;  2DY7 A;  2KHI A;  3DXJ C;  1WTR A;  3D8G A;  2CHB D;  3I73 A;  3QWN A;  1EY9 A;  2B63 G;  1FNV A;  3ERS X;  1PTO B;  4NMZ A;  1HFG A;  1TS3 A;  4IQZ A;  3CCQ A;  1S72 A;  1VQ7 A;  2CQO A;  4X65 Q;  3S1M B;  1SYC A;  2RDF A;  5C44 G;  4HED A;  1I4H A;  1BOS A;  2AHO B;  5COR A;  1SYF A;  3BZD B;  4LFA Q;  1PZI D;  2JXM B;  1C0A A;  4JI5 L;  1D8L A;  2CWP A;  2QA4 A;  5ELE A;  1VS0 A;  3J81 c;  3L3O C;  1QNU A;  4RGO S;  3Q0A A;  5EQ0 A;  4ZUJ A;  2RSO A;  5TSS A;  4DV3 L;  3AQQ A;  4PNY A;  3RZD B;  3VYT A;  3S1Q B;  4R8N A;  4EQN A;  3D6W A;  5KYL A;  1FNU A;  3FDT A;  4YWL A;  3WDN A;  4DK0 A;  3DHQ A;  1NJI C;  4LF6 Q;  5FJ8 H;  1KIX A;  4WFN 3;  2D62 A;  3C1E A;  1LT4 D;  1WOC A;  5L37 A;  2IJ0 A;  2BH2 A;  3CCU A;  2K32 A;  1X32 A;  4C3J H;  1VQ9 A;  5FO7 B;  3GTG H;  2VXW A;  4JOI C;  3GTL B;  1RD9 D;  2O2L D;  4F8M A;  2JA7 B;  3HS0 C;  1B70 B;  1Y8P B;  1STH A;  3HOU G;  3KLW A;  3CCE A;  5EPL A;  4OEM B;  3TS2 A;  3SGI A;  1ROD A;  3M85 A;  3RLO A;  3QIA A;  4RCN A;  5GAH C;  2E2I H;  3IRB A;  3QG1 A;  3U58 A;  3PO3 B;  3D0F A;  1FVI A;  3I4N G;  1DGS A;  1VQH A;  3TDQ A;  1YNX A;  5JJL A;  1KDC A;  1U4M A;  3GTQ B;  2JEA I;  4K5X A;  1TS2 A;  4ID6 A;  3U50 C;  4A3B G;  1PRT B;  2CKZ B;  5LMU Q;  3MEH A;  4EQP A;  2HHH L;  4GKJ L;  1BR9 A;  5E4X A;  2ICI A;  5IT9 L;  1Z7T A;  3STB C;  4EVO A;  2ZXO A;  1V1Q A;  3ZJY C;  2R92 H;  4LFB Q;  3K7A H;  4OX9 L;  4K0K Q;  2PI2 E;  2ZTE A;  3KF6 B;  1NNX A;  1BCP D;  5C0X G;  2MPM A;  4OIK A;  3ULJ A;  4A3F H;  1O78 A;  1E2W A;  3KK7 A;  5K36 H;  2F0V A;  3D4R A;  3A55 A;  4JI3 L;  4A3M B;  2PZU A;  2YTY A;  2V1C C;  5M5Y B;  4NXN L;  1U4R A;  1H9J A;  2L11 A;  1K3R A;  1I4X A;  3J81 j;  3CC7 A;  5FO9 B;  5FK9 C;  3IL8 A;  3VA7 A;  5CV9 A;  1QG7 A;  1RIP A;  1SYD A;  1J5E L;  4K5W A;  1JOO A;  1ZYR D;  4DV2 Q;  3CCL A;  1VQN A;  3PIO 3;  5GQO A;  5C6A A;  4DR7 L;  3CC4 A;  4PMB A;  2EXD A;  1JOR A;  5CGK A;  4LUZ A;  1K83 H;  1TWH B;  2K5W A;  3J81 L;  3EIV A;  4KK7 A;  1XWE A;  4JVZ A;  5IGB A;  3HOW H;  4KI0 A;  4LFC L;  4CDC C;  3VR2 A;  4FF1 A;  1HUN A;  3S15 H;  4AIM A;  4DGZ A;  3RNU A;  1PYW D;  3NQI A;  1CTM A;  4C3H H;  1FNW A;  1QUQ B;  2HDL A;  4G57 A;  1KTK A;  3NBH B;  4LF9 Q;  2K04 A;  1ILP A;  1IZ6 A;  2BA0 A;  4LF7 L;  2A6E C;  1A62 A;  4A75 A;  1YEZ A;  5KNB A;  1B1Z A;  1M1K C;  4F88 A;  1XMO L;  1PH8 A;  4CKB A;  2OTJ A;  3S2H H;  2E8G A;  2K7V A;  1STE A;  2UU9 Q;  2BCO A;  3UDF A;  1E24 A;  1LYL A;  3CRL C;  2MNA A;  4A3C G;  1NY4 A;  2WB1 B;  1MBY A;  4HJ5 A;  1HRJ A;  1QZH A;  3V2T A;  1GXD C;  1AP0 A;  3EQL C;  4RKL A;  2OQK A;  4A3G H;  3S14 H;  2MGS A;  2B63 B;  2F0W A;  3H0G B;  1D5X C;  5I9P A;  2E2D C;  1PHJ A;  3KLS X; 
#chains in the Genus database with same CATH homology
 3I4N H;  3K7U C;  3G4S A;  1HR0 Q;  4R4I A;  4GLA C;  3M4O H;  1Q1B A;  4OWX B;  4POF A;  4LF8 L;  3I7F A;  3HKZ E;  2NN6 G;  4GNX C;  1Q7Y C;  2WAQ E;  4GN5 A;  4BBR G;  3CAM A;  3Q8D A;  3HOZ G;  2VQE L;  1UE5 A;  2KBN A;  2ES2 A;  2NVY H;  4B3T L;  1Y1W G;  3KDF A;  1JB7 A;  1QVF A;  5ELO A;  1T9H A;  1UE7 A;  4O2D A;  1VQC A;  1I94 Q;  4UP8 A;  4QQB X;  2OQ0 A;  1E1T A;  1NMG A;  4B3M L;  1TWH H;  2D0O A;  1VCI A;  1CKM A;  4JBJ A;  4P73 A;  1QZG A;  4AH6 A;  1IBM Q;  4IFD I;  3K81 C;  3F2C A;  4JI0 Q;  1VQD A;  4QY7 A;  2VQF L;  4DR2 Q;  4OWW B;  5HY6 A;  5IY0 A;  1BVS A;  1XMQ L;  5IP9 G;  4DV0 Q;  4P72 A;  4DV5 L;  1I3Q H;  4PZ8 A;  1MJC A;  1EQR A;  2RCN A;  2UXB Q;  4JC0 A;  1PYS B;  3H15 A;  3H3V H;  4H02 A;  1FGU A;  3PUX A;  1BBW A;  3H3V I;  1I50 H;  5LMN L;  2ASB A;  3HKZ G;  2UUC Q;  2JA7 H;  3PUZ A;  3S1N H;  1VQJ A;  2VZA A;  2WAQ G;  1PHJ A;  4PMW A;  2L15 A;  1KXL A;  2Q2I A;  4L5T A;  5M3F H;  4TVA B;  4A3J G;  4Y7N H;  2MO1 A;  3S16 H;  1CSP A;  1G6P A;  1G29 1;  2A1A A;  1SN8 A;  3WWV A;  1SE8 A;  3FKI G;  1PH6 A;  2A8V A;  1SRO A;  3CW2 C;  4KHP Q;  5IP7 G;  1IBM L;  1CSQ A;  1VQL A;  4JI0 L;  4A3L H;  2B3G A;  4DR2 L;  4UPA A;  1OXV A;  2MFI A;  4DV0 L;  4WJ4 A;  4LUO A;  3KFU A;  3CCJ A;  2E2H H;  2R92 G;  3MEF A;  2EIF A;  2K5N A;  5EAY A;  2UXB L;  2B63 H;  3H0G H;  5IYB H;  2F3I A;  2R93 G;  1LUZ A;  4K0K L;  1Y1V G;  1Q12 A;  1EIF A;  1X65 A;  2I5L X;  3BZK A;  5JEA J;  1WJJ A;  2Q2H A;  4DAY B;  4NPS A;  2ZJP A;  3GTO H;  1L1O B;  3F8T A;  3HOY G;  2R7D A;  3KF6 A;  1E1O A;  4PG3 A;  1N34 Q;  1N32 Q;  2QEX A;  1XTD A;  1I5F A;  1VQB A;  4DR1 L;  2UUA L;  1X9N A;  1MKH A;  4GNX A;  4DV6 L;  2UUC L;  4JI4 L;  3I4M G;  4JV5 Q;  4A3F G;  4AQY Q;  2HIX A;  2RHQ B;  4IO9 A;  1C0A A;  2NVQ H;  1VQG A;  4LNQ A;  4WJ3 M;  4BA2 I;  2GN5 A;  2MO0 A;  3RLF A;  1XNQ Q;  1FJG Q;  4HJ9 A;  5JEA G;  4GLX A;  4DV7 L;  3EN2 A;  1Q86 C;  3CCS A;  1CKN B;  1KQS A;  5M3M G;  3ICE A;  4NB3 A;  4DV3 Q;  3HFZ B;  4DR5 L;  3M4Q A;  3CXC A;  4X64 Q;  4POG A;  4MTN A;  1RL2 A;  3W1B A;  2VS1 A;  4YY3 L;  1YHB A;  2DGY A;  4ME3 A;  3HOX G;  2KCT A;  4A3I H;  3CCR A;  3UDX A;  3PUW A;  4IJL A;  3PIP A;  4DAM A;  3K8A A;  2VNU D;  2JEB I;  1WYD A;  1P8L A;  1A63 A;  2EQS A;  3KJO A;  3E9I A;  4A3C H;  2K52 A;  2WP8 J;  4DV2 L;  3U4V A;  1HNW L;  1SRU A;  4YCW A;  4GOP C;  1Q8K A;  2ZM6 Q;  1W2B A;  2K5H A;  3K0X A;  5BR8 L;  3GD7 A;  2JQO A;  2F52 A;  4PZ7 A;  3RN2 A;  1N32 L;  2NVX H;  3BJU A;  4A3E G;  4JI7 Q;  1E22 A;  3T1H Q;  2LXK A;  4JV5 L;  3E9H A;  3HOW G;  4JG2 A;  1KC8 C;  2NZO A;  3PO3 G;  5C4X H;  4JYA L;  1IYJ B;  1JMC A;  1PFS A;  1XNQ L;  4RMF A;  1GO3 E;  1PYB A;  1V9P A;  4IPG A;  3I2Z A;  1YJW A;  1FJG L;  3HOU H;  4GKK Q;  5DLQ E;  4DK6 C;  2R6G A;  3GTM H;  4YHH Q;  1HZC A;  3KDF B;  3NEL A;  4BBR H;  3OW2 A;  1N36 Q;  2H5X A;  1O7I A;  1Z9F A;  5E7N A;  1EQQ A;  4X64 L;  1V43 A;  1N9W A;  1NTG A;  4LW1 A;  3HOZ H;  2ATW A;  1VQ8 A;  1Y1W H;  2F4V Q;  4AYB E;  4JI1 Q;  4X66 Q;  3PV0 A;  1GKH A;  4X62 L;  4JI2 Q;  2I0Q A;  3A0J A;  2AMC B;  4C2M H;  4B3S L;  4A3K G;  4IPH A;  2KCM A;  1PH4 A;  1L2F A;  2N8N A;  3GTJ H;  1YHQ A;  1BBU A;  2IX1 A;  4OO1 G;  1EOV A;  1D7Q A;  1EIY B;  2ALY B;  2ZM6 L;  4R4C A;  1HZB A;  2VUM H;  4EX5 A;  5FJ8 G;  4A93 G;  2OCE A;  2ZJR A;  3T1H L;  2UU9 L;  2PQA B;  2UUB Q;  5IP9 H;  4GN3 B;  4JBM A;  2ZTD A;  1QVG A;  1BKB A;  3RR5 A;  1YIJ A;  5JJK A;  2CWA A;  3B6Y A;  2UXD Q;  4R4O A;  2R7Z H;  1K8G A;  4OX9 Q;  3RZO H;  3KF8 B;  2Y0S E;  3RN5 A;  4DR3 Q;  1KHI A;  5ELN A;  1K73 C;  1OXU A;  1UE6 A;  4OWT B;  4BY7 G;  2FXQ A;  3HOV H;  3S1R H;  5C0X I;  1VQI A;  1WFQ A;  1N36 L;  1XPU A;  3DM3 A;  4QJF A;  5GAD C;  2N49 A;  4QIW E;  2E2J H;  4DUZ Q;  2JJQ A;  1HR0 L;  4IFD J;  4A3D H;  3D31 A;  4JI1 L;  4JI3 Q;  1YI2 A;  4A3J H;  1E7Z A;  1YHA A;  4AYB G;  1L1O C;  4JI2 L;  4L5Q A;  4IJH A;  1PH3 A;  4IOC A;  4DNI A;  3AFQ A;  1UEB A;  4LF9 L;  5IP7 H;  5AJ3 Q;  1K9M C;  4Y52 H;  3BZC A;  3GTK H;  4UP7 A;  4GOP A;  3M7N A;  5FLM G;  1WCM G;  3CD6 A;  1P16 A;  4IFD G;  4HJA A;  1EFW A;  1I94 L;  1N8R C;  2YU9 H;  1VQ6 A;  1E3P A;  4BA1 I;  3CF5 A;  2WB1 E;  4HIO A;  1VQP A;  3A5U A;  1R9T H;  1X6O A;  4R4Q A;  5C3E G;  2R93 H;  1VQO A;  5GAG C;  3TQY A;  1Y1V H;  4KHZ A;  4NXM Q;  2Y0S G;  4GNX B;  4DR3 L;  2JA6 H;  1PH9 A;  1OTC A;  5IYD G;  3HOY H;  2HQL A;  2JA9 A;  1X55 A;  2JA5 G;  4BY1 H;  3I4M H;  2IY5 B;  4X6A H;  4O0A A;  4JCV E;  5IWA Q;  4JI6 Q;  3S1Q H;  4HIK A;  4DR6 Q;  3G71 A;  2JA8 G;  4HID A;  4DV4 Q;  1Q82 C;  1PH2 A;  3OTO Q;  1X3E A;  2BA1 A;  1PV4 A;  2YYZ A;  1IBL Q;  1XNR Q;  5IYD H;  1XPR A;  2IX0 A;  3FHW A;  5H1S E;  2VW9 A;  1KL9 A;  1WI5 A;  4JBK A;  4GLV B;  4HJ8 A;  4JI5 Q;  5K36 G;  2VY3 A;  2YTV A;  4R4T A;  2R7F A;  2YV5 A;  5J3B A;  3CQZ H;  1KAW A;  2BH8 A;  3UDI A;  1B7Y B;  1B8A A;  4JI8 Q;  1GM5 A;  2K4K A;  1SLJ A;  3MXN B;  2MQH A;  2QGQ A;  5IYC H;  3CPW A;  3FP9 A;  4KHP L;  3KOJ A;  1YVC A;  4LF4 Q;  2YTX A;  2RF4 A;  3LGJ A;  1HNZ Q;  1XMO Q;  2K5V A;  1Q81 C;  1ASY A;  2OTL A;  4LUV A;  3UDG A;  3CC2 A;  4NXM L;  3PO2 H;  4QGU A;  1NE3 A;  1Q1E A;  2VL6 A;  3CCM A;  3F2D A;  2KHI A;  3TEH B;  1AE2 A;  2C35 B;  3GDE A;  2B63 G;  3CP0 A;  5IYB G;  2NVT H;  2N78 A;  4PZ6 A;  2JA7 G;  3ERS X;  1S40 A;  3JAM i;  4IOA A;  3CCQ A;  1S72 A;  3RLN A;  1QVC A;  1VQ7 A;  2CQO A;  4X65 Q;  4A3B H;  1A8V A;  4DK3 C;  2Q2U A;  5C44 G;  1IBL L;  4BBS H;  3OYY A;  1N34 L;  4A76 A;  3EBE A;  1L1O A;  2AHO B;  1I6H H;  4BXX H;  2JK8 A;  3A74 A;  1A0I A;  4LFA Q;  3TRE A;  4AQY L;  3T1Y Q;  3TS0 A;  3PCO B;  4JI5 L;  1D8L A;  2CWP A;  4R1J A;  1YJ9 A;  1PA6 A;  1IBK Q;  3UE0 A;  1HH2 P;  2QA4 A;  1JT8 A;  1N33 Q;  1VS0 A;  1VQ5 A;  1IL2 A;  3J7A 5;  3J81 c;  1S3O A;  3CMA A;  1HNX Q;  5GAE C;  2I5M X;  1PVO A;  4DV1 Q;  4DV3 L;  3AQQ A;  3AEV A;  2Q2T A;  1Z47 A;  4B3T Q;  1QUQ A;  2NN6 I;  4EQ5 A;  4YWL A;  3PUY A;  4UP9 A;  4DR4 Q;  1NJI C;  4LF6 Q;  2ZJQ A;  3M4P A;  1TWA H;  3ER0 A;  5FJ8 H;  3M3Y H;  3I56 A;  2Z6K C;  4A93 H;  1KIX A;  1NBW A;  5IE8 A;  2D62 A;  2GVB A;  2BH2 A;  1WOC A;  1VQF A;  1X54 A;  3CCU A;  1VQK A;  1K0R A;  4IPD A;  2XGT A;  1UWV A;  3NEN A;  4L5S A;  2CCZ A;  4GS3 A;  2HHH Q;  2VQF Q;  4C3J H;  4GKJ Q;  2LXJ A;  2PMZ E;  4RG1 A;  3PGZ A;  1VQ9 A;  3GTG H;  4JI7 L;  1XMQ Q;  4JOI C;  1XPO A;  4DV5 Q;  1Q46 A;  4BY7 H;  4DPG A;  3JAM c;  5M5W H;  1X3G A;  1IBK L;  1B70 B;  1JJC B;  4OON A;  4UY8 C;  4GN4 B;  1N33 L;  4A3M G;  3HOU G;  4A3G G;  3KLW A;  2A19 A;  3CCE A;  3TS2 A;  3SGI A;  1HNX L;  2PI2 A;  5LMN Q;  4XTC S;  3M85 A;  4DV1 L;  1PH1 A;  4GKK L;  4YHH L;  3RLO A;  5GAH C;  1HNW Q;  2E2I H;  3IRB A;  3A5Z B;  3E0E A;  3K80 C;  3U58 A;  1PH5 A;  4GOP B;  1YIT A;  3D0F A;  1FVI A;  3I4N G;  1EUJ A;  1YBY A;  1DGS A;  1VQH A;  4HIM A;  5FLX c;  1YNX A;  5JJL A;  1KRT A;  2AWO A;  2K50 A;  2F4V L;  4JBW A;  4X66 L;  4LF6 L;  4DR4 L;  5FLM H;  1LM0 A;  1TWF H;  1WCM H;  2GVA A;  4FDB A;  3G6E A;  1OXX K;  1C7Y A;  3S17 H;  2JEA I;  4NXN Q;  1SR3 A;  2B29 A;  3U4Z A;  1W3S A;  3FKI H;  4YCU A;  3U50 C;  4XIG S;  4A3B G;  2CKZ B;  5C0X J;  2N3S A;  3BU2 A;  3J7Z C;  5LMU Q;  2VUM G;  4HJ7 A;  5C3E H;  2XTI A;  3M9B A;  2HHH L;  1K8A C;  1JJ2 A;  4GKJ L;  3S1M H;  3PIO A;  4KLK A;  4YWM A;  3TRZ A;  5M5X H;  3I4O A;  3STB C;  2OWO A;  2UUB L;  4LF5 Q;  1V1Q A;  4QL5 A;  3S2D H;  3ZJY C;  2R92 H;  2JA5 H;  3PF4 A;  4APV A;  2R7Z G;  2PQA A;  3UE1 A;  3K7A H;  4LFB Q;  2UXD L;  1J5E Q;  4OX9 L;  1YJN A;  1GVP A;  3G48 A;  4K0K Q;  2PI2 E;  2ZTE A;  3KF6 B;  4MZ9 A;  5C0X G;  2JA8 H;  1OXT A;  4DR7 Q;  3GTP H;  1SMX A;  4P75 A;  4TQU S;  4ALP A;  1AH9 A;  4DR1 Q;  4YCV A;  2UUA Q;  4JI4 Q;  3HOV G;  4DV6 Q;  4P74 A;  1OXS C;  4IPC A;  1Y14 B;  3ULJ A;  4A3F H;  3RZD H;  4LWC A;  4DUZ L;  4LFC Q;  4A3D G;  4J15 A;  3PUV A;  4JI3 L;  2ID0 A;  2YTY A;  3W1G A;  4DUY Q;  1PH7 A;  2V1C C;  1U0L A;  5IT9 c;  4DV7 Q;  2D0P A;  3F1Z A;  4NXN L;  3I55 A;  3J81 i;  2K75 A;  2Z6K A;  5HGQ A;  1JE5 A;  1J6Q A;  3HKS A;  5M3M H;  5LMU L;  4DR5 Q;  2HT1 A;  5AJ3 L;  3W5O A;  1K3R A;  2IT1 A;  2RHS B;  5M3F G;  3CC7 A;  3J81 j;  3ULL A;  1UE1 A;  3L7Z C;  1LTL A;  4YY3 Q;  1X3F A;  4LF7 Q;  3J80 i;  4DKA C;  4LF5 L;  3HOX H;  4JOI A;  3GO5 A;  2NZH A;  1H95 A;  1RIP A;  2I5H A;  3GTL H;  4LFB L;  1CKO A;  2WB1 G;  1TXY A;  4DV2 Q;  1J5E L;  1VQN A;  3KJP A;  3PF5 A;  3VDY A;  3CCL A;  5GQO A;  4A3L G;  1HJP A;  1TWC H;  2WFW A;  4DR7 L;  3CC4 A;  2JA6 G;  1VQE A;  2EXD A;  5BR8 Q;  1EWI A;  1U5K A;  4P71 A;  5C44 H;  2IHF A;  4LUZ A;  4BY1 G;  3NEM A;  1K83 H;  3CCV A;  1HR0 W;  2LSS A;  4A3E H;  3H0G G;  3EIV A;  5GRO A;  4JYA Q;  5IWA L;  3HOW H;  4JI6 L;  2UXC Q;  4KI0 A;  2Z0S A;  4LFC L;  3PO3 H;  3JC6 6;  3S24 A;  5LMN W;  4DR6 L;  4OXP A;  4DUY L;  4DV4 L;  2K14 A;  3OTO L;  1XNR L;  3S15 H;  3AFP A;  4AIM A;  3RNU A;  1YZ6 A;  3GTQ H;  4C3H H;  3F2B A;  3ULP A;  2E5L Q;  1X56 A;  2DUD A;  2ZTC A;  4C3I H;  1QUQ B;  1KRS A;  4YWK A;  1SFO H;  1CUK A;  3NBH B;  1FL0 A;  3AYH B;  3L2P A;  1M90 C;  4LF9 Q;  4B3R Q;  3CME A;  2AWN A;  3DLL A;  1IZ6 A;  1NMF A;  2BA0 A;  1HZA A;  4LF7 L;  2KEN A;  4LF8 Q;  1MIU A;  4X62 Q;  4JI8 L;  1TWG H;  1L0W A;  1IXR A;  5IYC G;  1G51 A;  1MJE A;  4B3S Q;  1A62 A;  4MNO A;  1C9O A;  1VQ4 A;  4A3K H;  1KD1 C;  4A75 A;  1VQM A;  1YEZ A;  4LF4 L;  1CKN A;  3PO2 G;  1M1K C;  1XMO L;  1HNZ L;  4A4I A;  5C4J H;  2VQE Q;  1PH8 A;  1XJV A;  2PNH A;  2OTJ A;  3S2H H;  2CFM A;  2E8G A;  3J80 c;  4A3I G;  4OO1 I;  1GD7 A;  2KHJ A;  1AE3 A;  3L0O A;  1ASZ A;  2UU9 Q;  3UDF A;  1E24 A;  4B3M Q;  1LYL A;  2MNA A;  4A3C G;  1VQA A;  2UXC L;  2JE6 I;  1NY4 A;  4HJ5 A;  3PSI A;  1QZH A;  2HIV A;  4BBS G;  4X65 L;  1EYG A;  2OQK A;  4A3M H;  4A3G H;  3KYH C;  3CPF A;  3S14 H;  4BXX G;  5M5Y H;  2E5L L;  1JJG A;  4LFA L;  5C4X G;  2AKW B;  4B3R L;  3T1Y L;  1HZ9 A;  5JJI A;  2IHE A;  4L5R C;  3STB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...