4HJ9A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (cggttacggt)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
139
structure length
139
Chain Sequence
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 37
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj9A00
3I4NH 2IHFA 4MZ9A 1XMQL 3AEVA 5FJ8G 4DV1Q 4JBKA 1KRTA 5IT9c 4C2MH 3OYYA 4PZ7A 5M3FG 3H3VI 2VZAA 4DR6Q 1YJ9A 4BBSH 1LM0A 5J3BA 2QGQA 1KAWA 4OXPA 5FJ8H 4A3MH 4XIGS 1OXTA 1VQ9A 2E5LL 4JOIC 4JI1L 3W1BA 4DPGA 4BA2I 4A3IG 1VQCA 4OWXB 3KLWA 2K5HA 2E2JH 3PUVA 1Q8KA 1Z9FA 4JI6Q 2Z0SA 2NVYH 4LFAL 1OXVA 3HFZB 2QEXA 1WJJA 4DK3C 4B3TL 4YCVA 3CMEA 5LMNW 3WWVA 4HJ5A 2F4VQ 4IO9A 3CP0A 4NB3A 4A3IH 2UUBQ 3TRZA 1OTCA 2HQLA 3CXCA 3H15A 3KF6A 4PZ8A 1LYLA 4QL5A 4PMWA 4A3EH 4LF6Q 2WAQG 3I55A 3TREA 4OO1G 4IJLA 5JJIA 4X62L 2K4KA 4H02A 1X9NA 2WB1G 3FP9A 1PH2A 5IWAL 3UDIA 4DV3L 1HZ9A 1Y1VH 3CC7A 4DR5Q 4NXNQ 3PGZA 3KOJA 3A5ZB 5GAHC 1X3GA 1CSQA 2PQAA 2A8VA 2CWPA 4A3CH 2AMCB 1SMXA 1SFOH 4LFBQ 3T1YQ 3CF5A 1SRUA 1KXLA 4DV6Q 1YI2A 4L5QA 3ULLA 1S72A 4LUVA 2BA1A 2YU9H 2OWOA 2H5XA 2CCZA 1FL0A 5GAGC 5JEAJ 4Y7NH 4LF5Q 4HJ7A 4MTNA 4JBJA 5GAEC 3GTOH 2JE6I 1C7YA 1YIJA 3RZOH 1VS0A 4ME3A 4C3HH 1D7QA 1HNXL 1IL2A 4DUYL 3S17H 1TWAH 1V9PA 4JOIA 1NE3A 4R4IA 1YVCA 1G291 4A93G 4DR7L 1XMQQ 3MXNB 4A4IA 4DV0L 3S2DH 4P72A 2ALYB 3J80c 4HIDA 4OWWB 1T9HA 1SROA 4IJHA 3GTJH 1VQIA 3A5UA 5LMNQ 1N34L 2Y0SE 5M3MH 1MKHA 3JAMi 3LGJA 3OTOL 3I4MH 5IYCH 4UP9A 4A3KG 2RCNA 4UY8C 4A93H 1I6HH 1EQQA 4L5RC 2OQ0A 4GKKQ 5C4XG 2E5LQ 2KHJA 2UXDL 4PZ6A 1YEZA 1VQGA 5C44G 1QZGA 1KL9A 2RHSB 3PO2H 4X65L 3HOZG 4IOCA 1TWHH 3RN2A 1QVCA 1C9OA 4A3KH 2ATWA 1VQJA 4BXXG 4YHHL 3EIVA 4JI3L 4YCUA 4LFAQ 1N8RC 4IFDJ 3ULJA 3OW2A 3RLOA 3S1QH 1FVIA 2R7ZH 3TEHB 1S3OA 4APVA 2ES2A 2VQFL 1PFSA 4GN4B 2JA5G 2MO0A 1KIXA 2OQKA 3GO5A 3L0OA 4FDBA 4C3IH 1HR0L 2FXQA 1L1OB 3K80C 1L2FA 3DM3A 4X66L 1A0IA 1I94L 4Y52H 5IYBH 1M1KC 4QY7A 5HGQA 2JA5H 3NELA 1WFQA 4JI8L 4B3RQ 4NXML 1Q46A 3PF5A 4GLXA 4X62Q 2RHQB 3PUXA 1L1OC 3PCOB 4JC0A 5IYDG 3HKZE 1WI5A 1EIFA 5H1SE 4DV3Q 4YY3Q 3S2HH 1SN8A 2GVAA 2Z6KC 1TWFH 3G6EA 2C35B 4RMFA 2KENA 4IPHA 1CSPA 1EOVA 4A76A 5IYDH 4X6AH 1U0LA 2B63H 2K5VA 2VS1A 3I2ZA 1N9WA 5LMUQ 3K0XA 4DV4Q 4OO1I 3F1ZA 3S24A 2E2HH 5IP7G 2NZHA 1Q1BA 3M3YH 2N3SA 1BBUA 3ULPA 2JEBI 2PI2A 4OX9L 4EX5A 2VY3A 3K81C 4LF4Q 1WOCA 3UE1A 4AQYL 3F2CA 1GM5A 1K0RA 1UE6A 4JI4L 1HNXQ 3L2PA 1VQPA 2JJQA 2Q2UA 4JI7L 1HNWL 3GTQH 3BU2A 3PO3G 2Y0SG 1GKHA 1EIYB 1JJCB 5ELOA 3A0JA 3J81c 4A3DG 4DR7Q 5ELNA 3FKIG 1VQFA 1X56A 3GTPH 2IX1A 1NJIC 3OTOQ 1FJGL 1VQ6A 2JA6G 2I5HA 1PV4A 4A3DH 3U50C 3M85A 1FGUA 3FKIH 4LWCA 1PYSB 5GROA 4P73A 5M3FH 1XNRL 2UXDQ 3J80i 1VQOA 2K14A 3CMAA 2ID0A 4X65Q 4GOPB 4JYAQ 3IRBA 2JA6H 1N33L 1XPUA 1YBYA 3GTKH 4GKJL 1X54A 1PHJA 4YCWA 5IP9G 1IYJB 1JJGA 3RN5A 2VNUD 4DK6C 1L1OA 3HOYG 4UPAA 4HIKA 3PF4A 2YV5A 4DV2Q 4GOPC 1HR0Q 3I7FA 2F52A 1NMGA 3G48A 4X66Q 5C3EG 5AJ3L 1JJ2A 1I94Q 2UU9L 4LF8L 2Z6KA 1XNQL 2NVTH 3JC66 2VUMG 3RLFA 1CKMA 1Q81C 3GD7A 3HOYH 3HKZG 4JV5Q 1RL2A 3CCMA 4JI8Q 1UE7A 2QA4A 3G4SA 1N36L 2K5NA 3UE0A 4DAMA 1E22A 4GLVB 1CKOA 1CUKA 3CC2A 2LSSA 3EBEA 2VUMH 5C0XJ 3AFQA 1K9MC 1J5EL 1VQ4A 4C3JH 2WP8J 4LFCQ 3ERSX 3CPFA 2N49A 4JG2A 4KHPQ 1TWCH 3AQQA 1NMFA 3E9IA 1PH5A 4GLAC 4QIWE 1I5FA 2D62A 4LW1A 4LF7L 2JA8G 3K8AA 1QVGA 3GTMH 1I50H 3PUWA 2LXJA 4LUZA 2YTVA 3RR5A 3S15H 2ZTEA 4DUZL 3B6YA 2I5LX 1M90C 2N8NA 4EQ5A 3CCSA 1VQ7A 2OTJA 1YZ6A 2N78A 2NVQH 2JA8H 4X64Q 4KHZA 2DGYA 2HIXA 2L15A 5JEAG 4AQYQ 4A3JG 2OTLA 2ZJPA 1O7IA 4JI4Q 1VQHA 1VQ8A 4A3FG 1YJNA 1PH7A 1V1QA 3NBHB 4JI7Q 4A3GG 1HNWQ 3NENA 3CCQA 1X6OA 2BH2A 3STBD 2LXKA 1XPRA 4A3JH 1PH8A 2K75A 3K7UC 3CCRA 1BBWA 5C4JH 3VDYA 3TS2A 1OXXK 4YWMA 4A3GH 2VL6A 4DR4L 1VCIA 2IY5B 1AH9A 1YHAA 3U58A 1XMOL 1I3QH 4L5TA 2NN6G 1E1OA 4XTCS 4AYBE 4DAYB 2ZM6L 4GOPA 1GD7A 3J81i 2BA0A 1XNRQ 4JI1Q 1HJPA 2OCEA 4GN5A 1Y1WG 1K8GA 1Q7YC 3CAMA 2I0QA 1N33Q 5C4XH 4DV7L 4PG3A 1BVSA 5C44H 2NVXH 4B3TQ 3I4OA 1L0WA 4BBRG 4DR3L 3HOZH 4J15A 2V1CC 4IFDG 3GTLH 4BY1G 4BXXH 1IZ6A 2IX0A 5AJ3Q 4QGUA 1PH6A 4LF8Q 2UU9Q 4UP8A 4BBRH 3PIPA 1IBML 4O2DA 1VQLA 1HH2P 4HIOA 4BY1H 4KI0A 4R4CA 2XGTA 1PH9A 5IE8A 3G71A 2DUDA 1NBWA 1Q1EA 1WCMG 5IWAQ 3UDGA 1HR0W 5EAYA 4NPSA 1J5EQ 2F4VL 3DLLA 3CCVA 4JI5L 2UUBL 3W1GA 3CCJA 4WJ4A 1VQKA 4R1JA 2K52A 1WCMH 3HOWG 1NTGA 3M7NA 1KHIA 2MNAA 4O0AA 3E9HA 3GTGH 4DUZQ 2UUAL 1VQAA 4DR1L 4OWTB 1W3SA 3HOVG 1KRSA 4RG1A 2YTXA 4GNXB 1OXUA 3E0EA 5IP7H 1MIUA 4JI2L 2VQEL 2ZJQA 4JBMA 5IY0A 1MJEA 1SLJA 1C0AA 4DUYQ 1E1TA 1SR3A 1QVFA 2UUCL 2JA9A 1EQRA 3S1NH 2R7FA 1YNXA 4JCVE 1YJWA 2B29A 4GNXC 1PH4A 2HHHL 2Q2IA 4R4QA 4DV0Q 1N32L 4LFBL 4AYBG 3F2BA 3UDFA 3BZCA 3PV0A 1B70B 5M5XH 1D8LA 3J81j 1N34Q 1X55A 3KFUA 2JA7G 3PO3H 1VQEA 2D0OA 1H95A 1RIPA 3F8TA 1ASYA 2JEAI 1XMOQ 2CWAA 4KLKA 4P71A 2ZM6Q 1HZCA 3M9BA 2UXBL 4DV5L 3I4NG 1B8AA 2MFIA 3PUYA 4BA1I 1MJCA 3U4VA 1HNZL 2JA7H 2YYZA 2UXCL 1YITA 2Q2TA 1K8AC 4YHHQ 4JI3Q 4DV7Q 4YWLA 4BBSG 1OXSC 2CFMA 1VQMA 4A3MG 3MEFA 4DR3Q 1HZBA 2CQOA 2VQFQ 1PH3A 4HJAA 1KQSA 2BH8A 4TVAB 4HJ9A 5LMNL 1CKNA 2AKWB 2EQSA 2NN6I 4R4OA 5IP9H 4AIMA 1PVOA 1JE5A 1IBMQ 2R7DA 1P16A 2AHOB 4LNQA 4GKKL 2EIFA 2R6GA 2AWNA 5C3EH 1Q82C 3KJOA 4NXMQ 2HT1A 2A19A 2CKZB 1B7YB 4HIMA 3D0FA 3M4QA 2MQHA 1Q86C 3T1HL 3FHWA 3BZKA 2KHIA 4IFDI 3KDFA 1KD1C 5C0XG 3GDEA 2ZJRA 3U4ZA 1K83H 3F2DA 4A3EG 2ZTCA 5GADC 4JI5Q 1E24A 3J7ZC 3ER0A 2PI2E 4POFA 4GS3A 1Q12A 1UWVA 2VW9A 4R4TA 2B3GA 1A8VA 1Z47A 3D31A 1S40A 4BY7G 1XPOA 3AFPA 2R93G 4B3RL 3CCEA 1Y1VG 1XTDA 2ZTDA 3HKSA 1J6QA 1WYDA 4GNXA 1IBLL 2UUAQ 4DR1Q 4B3SL 3SGIA 2MO1A 1IBKL 3S1MH 3RNUA 4JI0L 4OX9Q 4BY7H 1K3RA 4JI2Q 3ZJYC 1TWGH 2R93H 4YWKA 1VQDA 2AWOA 2WFWA 2PMZE 4YY3L 2VQEQ 1XJVA 4A3CG 4QQBX 1P8LA 1NY4A 2K50A 2KCTA 3J7A5 2JK8A 5FLXc 3CQZH 4LF9L 2UUCQ 4B3ML 4DNIA 4MNOA 1V43A 5LMUL 3H0GG 4DV4L 2HHHQ 4P74A 4A3LG 1N32Q 4HJ8A 4A3FH 1EYGA 4L5SA 1QUQA 4OONA 5BR8L 4DR2L 1G51A 1X3FA 2JQOA 3H0GH 3PIOA 3HOXG 1GO3E 3KYHC 1FJGQ 3HOUG 1R9TH 4JBWA 4K0KL 4A3LH 2UXBQ 2RF4A 4DV5Q 3TS0A 4DKAC 4LF4L 4POGA 3CPWA 1X3EA 1HNZQ 3STBC 1YHBA 3H3VH 1X65A 2UXCQ 3HOXH 3HOUH 4GKJQ 2XTIA 3M4OH 4WJ3M 2YTYA 1VQNA 2Q2HA 5M3MG 1Y1WH 3TQYA 3I4MG 1IXRA 5IYCG 4DV1L 1K73C 1PH1A 3CC4A 4AH6A 2ASBA 3ICEA 1EWIA 3Q8DA 1UE5A 4DR6L 1VQ5A 2EXDA 1XNQQ 5E7NA 3PO2G 4A3BG 1YHQA 1EUJA 3RZDH 1CKNB 3L7ZC 5GQOA 1A62A 1QZHA 1AE3A 1AE2A 3K7AH 3KJPA 1N36Q 3S14H 2R7ZG 4A3BH 3AYHB 2GVBA 3CD6A 4JI6L 1VQBA 4ALPA 1BKBA 4JYAL 3BJUA 3T1HQ 1SE8A 2NZOA 5IYBG 2I5MX 1GVPA 1HZAA 2R92G 3KDFB 2A1AA 1G6PA 4DV2L 2KCMA 1PYBA 5JJKA 3KF8B 1LTLA 5HY6A 4LF6L 1E7ZA 4LF7Q 3KF6B 2R92H 4JV5L 1JT8A 1ASZA 1U5KA 1IBLQ 2E2IH 3HOWH 4IOAA 4B3SQ 1IBKQ 1EFWA 5C0XI 1W2BA 4JI0Q 2WAQE 5DLQE 1JMCA 2B63G 2KBNA 4IPDA 2E8GA 4P75A 4DR5L 4QJFA 4LFCL 4NXNL 4IPCA 3CCUA 3HOVH 2WB1E 3EN2A 1Y14B 4LF9Q 1A63A 5M5YH 4B3MQ 4KHPL 1UEBA 4A75A 5JJLA 3PUZA 3PSIA 5FLMG 2IT1A 1UE1A 3T1YL 2PQAB 3W5OA 4DV6L 5M5WH 3UDXA 2D0PA 3NEMA 2F3IA 4DR4Q 5BR8Q 4DR2Q 5FLMH 1QUQB 4LF5L 3S16H 4K0KQ 4GN3B 4UP7A 3M4PA 3CW2C 2HIVA 2PNHA 4X64L 3S1RH 2GN5A 3RLNA 3I56A 1PA6A 1DGSA 1LUZA 4TQUS 5K36G 4LUOA 1JB7A 3CCLA 2IHEA 1KC8C 1E3PA 3A74A 3JAMc 4IPGA 1TXYA
chains in the Genus database with same CATH superfamily
5KYIA 1XMQL 1NR4A 2F0LA 3MXPA 5IT9c 3OYYA 5M3FG 1BDOA 4FF2A 2KEDA 1YJ9A 2ICEC 2FINB 1I4RA 5D3DA 2J7ZA 1KAWA 5IODA 2Q8IB 4XIGS 3BYYB 4KJNA 4JI1L 1BCPB 2EY2A 4A3IG 2K1BA 2K7VA 3V05A 1G8ZD 2K5HA 2J0TD 1Q8KA 1V8QA 1PFNA 4K5WA 2Z0SA 1NCVA 4LFAL 1OXVA 4PZ8A 2A6HD 4K8JA 4A3EH 3TZDA 1AEXA 5CV6A 4K6DA 3K5LA 1K28A 4S3SA 4TSSA 2RA4A 2WB1G 5IWAL 3UDIA 1EY5A 1LTRD 4DV3L 1HZ9A 1Y1VH 1EL0A 4DXGA 2DY7A 3A5ZB 4IUQA 1JOOA 1X3GA 2K28A 4ZKCB 2CWPA 4WRDA 2Z9HA 1SFOH 3T1YQ 3CF5A 1YI2A 1B9NA 4C3HG 1S72A 3S1QB 5KIXA 4LF5Q 2Z4IA 3GTOH 1D2BA 1HNXL 1JWUD 1IL2A 1K3BC 3R3OA 1NE3A 1S5BD 4R4IA 5LHY1 3C2PA 4A93G 4DR7L 3FDTA 4FXGC 3S2DH 2ALYB 2EZVA 2HQEA 4IJHA 3GTJH 1VQIA 5FO7B 5LMNQ 1HUNA 2EYJA 5M3MH 3LGJA 3I4MH 4A3KG 3K0YA 1CFMA 1EQQA 4GKKQ 1CK1A 1JOKA 2E5LQ 2NBFA 4PZ6A 2RHSB 3PO2H 3HOZG 4IOCA 2F4IA 1LO5D 1QVCA 4JW0A 1HFGA 3N52A 2JA5G 1EU3A 1PFSA 2Q8RE 4C3IH 1L1OB 3OMCA 3S1RB 1A0IA 5IYBH 3LWEA 3CRKC 5CR3A 3W3AA 2JP1A 4GLXA 4X62Q 2RHQB 5I4DA 1VF5C 3PCOB 5EPLA 4YY3Q 3MFYA 5IGCA 2GVAA 2C35B 4RMFA 4IPHA 1AZPA 4K5XA 2B63H 5M3FB 3I2ZA 4OO1I 2E75C 3S24A 1VF7A 1AZQA 3M3YH 3ULPA 1BBUA 1ESFA 2FMMA 1SMYD 2PZWA 4QUCA 4FF1A 4A3IB 2WKCA 4OX9L 2EYPA 3UE1A 1GM5A 3F2CA 1K0RA 1UE6A 3MHBA 4MHEA 2F03A 2NWGA 3P7JA 1XTCD 4CDFC 3PIO3 3OW7A 4ZK9B 3PO3G 1CA5A 5C4ZA 5ELOA 2O4XA 5I2YA 5ELNA 3GTPH 1NJIC 1S5CD 2WIIB 1VQ6A 1EIHA 1PZJD 1PV4A 3U50C 1L0YB 2OT2A 2WB1B 3VR6A 1HTLD 1ZXTA 3IRBA 4K2KA 1X54A 5IP9G 3S15B 1IYJB 3WDNA 2RCFA 3K5OA 1L1OA 3PF4A 2YV5A 4DV2Q 1XWEA 1MHWC 1CZGA 1JJ2A 2JA8B 3WOFA 2Z6KA 4NP5A 4C3HB 1BCPD 1Q81C 2SOBA 5IGEA 4JV5Q 1RL2A 2QILA 5CV4A 2DY8A 4HAEA 2VUMH 2LSSA 4FF3A 5C0XJ 1SDFA 1K9MC 4A3GB 2A6HC 3ERSX 3EQLC 1PH5A 4GLAC 1I5FA 5KNBA 1B1ZA 1BXTA 1I50H 4CJ1B 4UAIA 4RGOS 5AFWA 1M90C 1C4QA 2CH4W 3J7YW 1DOMA 2F0QA 3HOZB 4IURA 2N78A 2NVQH 2OTJA 2SEBD 4KHZA 5JEAG 4AQYQ 2ZJPA 4JI4Q 1ENCA 4BWGB 3I73A 4ID6A 1BO0A 1EEFD 4A3FG 2JA5B 3IFTA 3NBHB 3T53B 3CCQA 1B3QA 1X6OA 3UI2A 4A3JH 2K75A 1BBWA 2BOSA 5C4JH 3OSOA 4YWMA 2IY5B 1AH9A 4RCOA 1ICFB 1I3QH 1SNOA 2NN6G 4X3SA 5C3WA 1XMOL 4JPBW 2OCEA 3R2TA 1WCMB 1K8GA 3A8JE 2I0QA 4DV7L 3IL8A 1EQVA 4BBRG 4DR3L 5F2DA 2V1CC 4F7XA 3GTLH 4BY1G 4DA2A 5AJ3Q 4KN7C 4CDCC 3GTQB 3FPPA 3S1NB 3L3OC 3EJIA 1LTTD 1VDZA 1Q1EA 1ET9A 1GUTA 2WACA 4CDEC 4DGZA 1WTQA 4NPSA 3PO3B 3CCJA 4KHVA 5I6YA 5G3LF 1FGBD 1DCZA 2ZXOA 2NTSA 3HOWG 2BDNA 1X3QA 4KY6A 2KJXA 3SK6A 3E9HA 3W2DA 4ULLA 4DUZQ 1VQAA 2QKIC 2K5QA 1W3SA 3HOVG 1DD2A 1EU4A 4OGQC 2VQEL 1SLJA 3DMUA 5TSSA 1C0AA 1SR3A 2H4OA 1E0BA 2R7FA 1JICA 1PH4A 2B29A 4GNXC 2HHHL 2B2YC 1D5MC 1SMYC 3BZCA 1D8LA 2F0PA 1ASYA 2JEAI 2UXBL 3NPPA 4P71A 2ZM6Q 4WORA 1B8AA 2MFIA 5HGTA 1MJCA 4YIJA 3U4VA 2JA7H 2UXCL 2KQ3A 1RTOA 1JORA 2CFMA 1ML0D 1ZKOA 1RD9D 5LMNL 2EQSA 4AIMA 2R93B 1IBMQ 2R7DA 3VA7A 4GKKL 4V0BA 2EIFA 1O78A 2AWNA 4NXMQ 2HT1A 1IKLA 1B7YB 1U4PA 3M4QA 2MQHA 4J1MA 4DK1A 4A3FB 1IL8A 5M9OA 4A3EG 3DM1A 4JI5Q 3V2TA 1BCPC 3J7ZC 1FD7D 1SJED 3ER0A 1ESRA 2I07B 4GS3A 4POFA 2KECA 2B3GA 4KJOA 2G9DA 1UEAB 2MUYA 1BBXC 4Z9CB 1FR3A 1Y1VG 2VXWA 5KNDA 4DR1Q 1PTOB 4UDUC 3ONAB 4IUTA 1VQDA 4YY3L 1XJVA 5JPNC 3J7A5 4IUPA 2UUCQ 4RHRA 5FO9B 3S14B 4N8FA 4P74A 1N32Q 3L9AX 4H13C 3E6ZX 4M8AA 5EKLA 1QUQA 1SE2A 5BR8L 1G51A 3HOXG 3HOUG 4A3LH 5CBEE 2F0DA 2SNSA 1S5FD 3QO2A 2JXMB 1YHBA 2PW5A 3OWFA 4GKJQ 1EYDA 2YTYA 5M3MG 1I4XA 1F2ZA 1IXRA 3OHXC 4DV1L 3CC4A 2ASBA 3I4MG 3HOWB 1Q8IA 2L1BA 2EXDA 3PO2G 5E7NA 4KKUA 1EUJA 4DU9A 2PZTA 1YHQA 1NR2A 2PMZB 2KCCA 1H9JA 3HOVB 3KJPA 5M5YB 4A3BH 2F0WA 3AYHB 1VQBA 2GA4B 1BKBA 4C3IG 3BJUA 5A35A 5M5XB 5IYBG 2R92G 3KDFB 3U9SA 4DV2L 5EKIA 3J80L 3QG1A 3VYRA 4JV5L 1Z6HA 4RFBA 1F77A 1IBLQ 4ODGA 4B3SQ 1HTPA 5DLQE 3KK7A 1JOQA 2B63G 4C1NK 4IPDA 1STNA 2E8GA 4DR5L 4NXNL 2OXPA 4IPCA 3CCUA 2K33A 1Y14B 3TSSA 4LF9Q 4B3MQ 1SJHD 4OHJA 5CORA 4DV6L 3NEMA 5A2QL 3S16H 4K0KQ 2B2VC 4UP7A 1PA6A 2P5ZX 1DGSA 2RDHA 3H09A 1KC8C 1E3PA 3LX0A 4V190 3HS0C 4IPGA 4A3EB 1TXYA 1EZ8A 4MZ9A 3LNNA 3AEVA 5D14A 2B2TA 4PZ7A 4DR6Q 2WAQB 3M7GA 5J3BA 5CMDA 4A3MH 5FJ8H 1Y1VB 2JN4A 3KLSA 2DN8A 4OWXB 3E3XA 3KBXA 4JI6Q 4OEMB 2NVYH 2EYHA 3HFZB 4DK3C 5KRUA 1LV9A 1EY4A 1R9TB 1B44D 4DN4M 4EQPA 3GTOB 1C8CA 2PYKA 4LF6Q 3I55A 3Q22A 1SNPA 4IJLA 3MAQA 1KNEA 4G4KA 3HOUB 4WJWA 4H02A 1CM9A 3EVQA 3S2DB 4CKEA 5DAUA 4OO1H 3GTJB 2A69D 5M3MB 2EY6A 3J7AF 3PGZA 4IZ8A 3I4MB 4ME5A 1TS5A 1G91A 3MA2B 2A8VA 3K7AB 2Q8TA 4A3CH 2AMCB 3PO2B 1SMXA 1MD2D 1SRUA 1PTOD 4L5QA 4CJ2C 4LUVA 2N88A 2YU9H 2H5XA 3CKIB 4MTNA 1GUSA 3RZOH 2JE6I 1D7QA 1VS0A 3MFGA 4C3IB 2H1EA 3SDZA 1DZ1A 3Q23A 3S17H 1EEID 1V9PA 2R92B 4JOIA 1YVCA 2PPBC 3MXNB 4A4IA 1KDCA 4I65A 1AP0A 3MWYW 2RCNA 4L5RC 1F2LA 1YEZA 1VQGA 1BCPF 1QZGA 2B63B 1TWHH 3RN2A 3O13A 2EY5A 2QCPX 1D1KA 2KEEA 2B39A 4YCUA 2ZXPA 3ULJA 3OW2A 3RLOA 1FVIA 3M3YB 2ES2A 5DEHA 3R2IA 5J39A 3MXUA 1BUVT 5EBCA 3GO5A 1KIXA 1HR0L 1I94L 4Y52H 1TKWB 3BG3A 3NELA 1D5XC 5EPJA 4JI8L 3BDCA 4NXML 1Q46A 4JVZA 1Y8PB 2IWHA 3RD4A 5BN3A 4G57A 1HFNA 1SYDA 5FOBB 5IYDG 1WI5A 1EIFA 3V96A 5H1SE 5E4XA 1X32A 3GTPB 1TWFH 1QILA 2RQXA 5ELBA 2KENA 1EOVA 1PRTB 1U0LA 1N9WA 2C5CA 1EIGA 5I2XA 2E2HH 5FO8B 2X6GA 3K5NA 4X3KA 4MIUA 3MTSA 3K81C 4LF4Q 1WOCA 3R93A 1CHQD 1O7YA 3A56A 3OWEB 3QIAA 1HNWL 3TP6A 2QW7A 1EWHA 4FP5D 5IOCA 3A0JA 4A3DG 2O5JC 1SE4A 3URYA 1VQFA 2F3VA 2VUMB 2IX1A 4HN7A 3OTOQ 3TZUA 3FKIH 1FGUA 2L4NA 1PYSB 4G7ZC 4P73A 2UXDQ 1RTNA 2K14A 1GXDC 3CMAA 4X65Q 4GOPB 1JCKB 2F0UA 4O1NA 1F2YA 5CGKA 4JYAQ 2JA6H 3GTKH 1YBYA 4OIJA 4GKJL 4CKBA 1PHJA 1U4RA 1I50B 3GV3A 3A54A 1DM0B 4UPAA 3ZYYX 4Y7NB 3I7FA 2NVQB 3SK5A 4X66Q 4LF8L 1HRJA 3JC66 4PNYA 1CKMA 2X69A 3HOYH 1TWAB 3U9OA 3CRLC 4C3JG 1BR9A 3I90A 4A3JB 4RCNA 2O5IC 3ERQA 1ILPA 4GZYC 3AFQA 4ZLTF 4LFCQ 4TRDA 1I6HB 5ELDA 1I3QB 4JG2A 2A5HA 4KHPQ 3FEWX 1XX8A 3OMGA 2D62A 1KLGD 5CV5A 2JA8G 1QG7A 3RR5A 2YTVA 3I8ZA 2ZTEA 4EQ5A 1STEA 2G9HD 1B50A 1YZ6A 1PFMA 3GTLB 2DGYA 1A3UA 2B2UC 2NB0A 1LT3D 1K8OA 1YJNA 1V1QA 3VR3A 4JI7Q 4A3GG 1PTOC 2BH2A 2LXKA 1XPRA 2G5DA 1JB3A 1DYQA 3TS2A 3S2HB 1YHAA 4DAYB 1K8MA 2KVMA 4AYBE 4GOPA 3T4AC 1EFID 1XNRQ 1Q7YC 3CAMA 1N33Q 5C4XH 4PG3A 5FLXL 1BVSA 5C44H 2NVXH 1L0WA 4IFDG 2RDFA 2WKDA 4K2LA 2UU9Q 4UP8A 1O7ZA 4K6LA 4O2DA 1RJTA 2RDGA 3DWAA 2XGTA 5IE8A 5BN5A 3NWSA 1EYCA 1WTOA 1NBWA 1STHA 1WCMG 1LTBD 2FHTA 3GV6A 1J5EQ 4H7BA 2RSNA 1TIID 3W1GA 4A3DB 4WJ4A 2EVBA 4R1JA 2K52A 3K57A 4N9PA 4J8QA 2MNAA 2D9UA 2OF1A 2MHVA 3GTGH 1LT5D 3J80E 4FVMA 4JI2L 4MTKA 2L0CA 4KY5A 4JBMA 3SK4A 5IY0A 2EOTA 1F2MA 1PRTD 2C9OA 4DUYQ 1E1TA 1QVFA 2NVTB 1BOSA 3OOCA 1EQRA 1YNXA 4JCVE 1YJWA 2Q2IA 4DV0Q 4AYBG 1F9QA 3PV0A 3G7LA 1B70B 2KA7A 4DAYA 3KFUA 3TP8A 1RIPA 3F8TA 4C3JB 4KLKA 1HZCA 3PUYA 3PQIA 5LL6S 1HNZL 2EPBA 2F0VA 2Q2TA 2A74C 5A2QE 5LL6X 4YHHQ 1STBA 4YWLA 5NUCA 3I4LA 5E1FA 1CTMA 4A3MG 2A68D 3MEFA 2NTTA 3HP3A 2VQFQ 4TVAB 4HJ9A 2M9VA 1Y8NB 1CKNA 2NN6I 4B9WA 4LNQA 3AU7A 2R6GA 1PZKD 4BS9A 3KJOA 3BDOA 5C6AA 3QOJA 5EBDA 3EFXD 4HIMA 3AMUA 4UHVA 5COYA 3T1HL 3FHWA 3QOLA 2ZJRA 3U4ZA 5I9PA 1EY8A 3K6OA 1Q12A 1WTPA 2VW9A 4R4TA 1A8VA 1Z47A 4FNFA 1G6ZA 1KABA 2DNCA 3AFPA 2R93G 3BZDB 1EOTA 1J6QA 2UUAQ 1IBKL 3S1MH 4BY7H 3TP7A 1U9RA 3MVVA 2NZ1D 3NTIA 2AWOA 1H9RA 2PCFB 2PMZE 3MZ5A 5KGUA 1WTXA 1P8LA 4ABNA 2K50A 1SYEA 2KCTA 1CA6A 1K0SA 4MNOA 2NUCA 2F1MA 1M8AA 4A3BB 4L5SA 4PMBA 3ND9A 4XT3B 2E76C 3H0GH 1FJGQ 3PIOA 3KYHC 4KY7A 3NSWA 4JK1C 4DV5Q 3TS0A 4DKAC 4LF4L 1X3EA 3M4OH 2Q2HA 1W6KA 1PLFA 3QB3A 1C48A 1K73C 1PH1A 4AH6A 3Q8DA 5JOBA 1SYGA 1XNQQ 4IUNA 3OIQA 2E2DC 3L7ZC 2SDFA 5GQOA 2CQAA 1A62A 1AE3A 2WINB 1N36Q 3VR2A 2ENBA 3CD6A 4HTHA 4JYAL 4G7OC 5I9OA 1EY7A 1SE8A 2NZOA 1HZAA 1DOLA 3IKJA 4IUUA 1G6PA 1PYBA 4AYBB 1A3VA 1RDPD 3X3MA 3KF6B 4NW2A 2EYOA 1QE6A 5KNCA 1V1PB 2E2IH 1PTOF 3D4RA 4KD4A 1EFWA 4FXDA 1W2BA 4JI0Q 2WAQE 5KYLA 3HZXA 4LFCL 4A3MB 1A63A 1QNKA 3FPUB 4KHPL 1YNND 5JJLA 3PUZA 3PSIA 4X3UA 3T1YL 4ZAIA 3W5OA 3OPOA 3UDXA 1HUMA 1SNCA 2D0PA 4RGTA 2F3IA 4DR2Q 4HSVA 5FLMH 1QUQB 4LF5L 1PRTC 2K04A 5D3IB 1TQOA 3DEPA 2IW3A 2GN5A 1STAA 5L37A 3S1RH 4TQUS 3TN2A 4P2CB 3A74A 2RBMA 2EYLA 4KKSA 4RHSA 4C2MH 2VZAA 1KAAA 4R8IA 5IGDA 1TWGB 1LM0A 1VMCA 4OXPA 1OXTA 2E5LL 4KKTA 1IW7D 2CVRA 4DPGA 4BA2I 4KK7A 3KLWA 3PUVA 4U673 1CHPD 3PIP3 2B2WC 1WJJA 5LMNW 3WWVA 2F4VQ 4IO9A 4A3IH 4NB3A 2YU9B 3J81L 2JSOA 1OTCA 2HQLA 3CXCA 3H15A 3KF6A 3NP8A 2BE5D 3RZOB 1E2WA 3A8KE 3FVQA 4I7AA 5C0XH 1LYLA 2O2LD 4QL5A 2WAQG 1V1PA 1QWYA 3TREA 1SEBD 5JJIA 4X62L 3FMCA 4EGVA 1PH2A 3CC7A 1EY6A 3RZDB 1SNMA 2XWBB 3KOJA 2XN9C 1JE4A 4DNTB 1TWHB 5EKKA 4XQJA 2F0OA 4RWSC 5C3XA 3ULLA 1W6JA 1WD0A 1IYUA 2CCZA 1FL0A 1ONLA 4H0LC 3D6CA 4KMUC 5JEAJ 5GAGC 4HJ7A 3KUPA 4JBJA 5GAEC 1C7YA 1YIJA 4ME3A 4C3HH 4DUYL 5E3FA 3KLSX 5ELEA 5FKAC 1G291 1XMQQ 1A15A 4DV0L 1B9MA 3WOEA 4P72A 1EWCA 5KEEA 3J80c 4OWWB 1SROA 2Y0SE 4A93H 4HSPA 4ZRZA 5IYCH 4UY8C 3R8BA 1SYCA 1TWFB 4C56C 4KTAA 2I46A 2CW0D 5C4XG 2MJ8A 3P75A 2LMCB 5C44G 4EVOA 4A3KH 2ATWA 1OO9B 4YHHL 1N8RC 5M5WB 4LFAQ 2R7ZH 1M4VA 3TEHB 1S3OA 4APVA 2VQFL 4GN4B 1AN8A 1TY0A 2MO0A 4J6HA 3L0OA 2FXQA 3K80C 2K01A 3DM3A 1TVXA 1M1KC 5FLXE 4L6TB 1Q3LA 5HGQA 2JA5H 4K5VA 1I4PA 1WFQA 4B3RQ 4HCEA 1SAPA 1L1OC 1AW7A 1DXMA 4JC0A 3NTHA 4DV3Q 1SN8A 2B8GA 2Z6KC 2MPMA 1V1OA 3NQIA 3G6EA 1PZID 1CSPA 1H9SA 4A76A 3FKIB 2K5VA 4DV4Q 3K0XA 4DK0A 1MSHA 3NK9A 1QNUA 1Z7TA 2NZHA 2JA6B 3GTKB 1SXTA 1JC7A 4LK1C 3T16A 3D6WA 5HURA 4AQYL 4JI4L 1YNNC 1HNXQ 3L2PA 4N9TA 1BQQT 2JJQA 3GTQH 2EDGA 2Y0SG 1GKHA 5K36H 1JJCB 1MSGA 4DR7Q 2NYZD 1SYFA 2F0MA 1FJGL 2I5HA 1A3TA 1ENFA 3M85A 2HCIA 3AB9A 5GROA 5J1ZA 3J80i 3I70A 4CKCA 1XPUA 1SFOB 1YNJD 2F0HA 2L12A 4YCWA 2LY7A 1JJGA 3RN5A 2VNUD 4HIKA 2F52A 1NMGA 3G48A 5AJ3L 1XNQL 1IW7C 4QUFA 2VUMG 3BS1A 2KCNA 3CCMA 1UE7A 1NUCA 2ICIA 1N36L 1E2VA 2K5NA 3UE0A 1WTVA 3SXHA 2IPKD 4DAMA 1CKOA 1CUKA 3CC2A 1MGSA 1B2TA 3BVMA 3S9WA 1VQ4A 2BE5C 2F0EA 2AUJD 1DJRD 3CPFA 2AQ1B 3NTKA 2LFNA 1PRTF 1TWCH 1NMFA 3E9IA 4QIWE 4LW1A 3GTMH 3PUWA 1B3AA 2LXJA 3NHHA 4DUZL 5C4XB 4NMZA 3B6YA 4RKBA 5C44B 2N8NA 2NVXB 1TS2A 3X3NA 3CCSA 1VQ7A 1II3A 2K6AA 4X64Q 2L15A 4A3JG 1O7IA 5C4HA 4HMJA 4CBVA 3NENA 1UNSA 3STBD 2ZXRA 1PH8A 1RODA 2KHSA 3K7UC 1PDQA 3VDYA 1OXXK 1JQYD 2VL6A 2PZUA 2R3ZA 4QB4A 4XTCS 2ZM6L 2R61A 1FNWA 5EPKA 4KV6A 1WTWA 1HJPA 4GN5A 3D4WA 3KLRA 4RA8A 2SNMA 2MGSA 1O80A 2EYMA 2NN6H 2QEJC 2F0NA 4B3TQ 3I4OA 1U4LA 3GTGB 1HA5A 2EE1A 2HCCA 2D2CC 3MC0B 4BXXH 1MBYA 3K59A 1IZ6A 1PH6A 3D3RA 3H6MA 3NXWA 4BBRH 1IBML 1VQLA 3GP7A 5JJZA 1HH2P 4BY1H 1PH9A 3G71A 3QR8A 3RUZA 4I7ZC 3H91A 1HR0W 5EAYA 1FNVA 3DWPA 2F4VL 3DLLA 2Y0SB 3CCVA 4JI5L 1GOZA 3GQBA 3Q24A 3HEJA 3M7NA 1KHIA 4ZYSA 2A73B 4DR1L 1KDAA 1KNAA 4GNXB 2YTXA 4Q5VA 3E0EA 5IP7H 1TR5A 4U68A 2ZJQA 1MJEA 2UUCL 4WFN3 3TP5A 2F0SA 4FF4A 5E4WC 2QDBA 1N32L 4ILWA 3DXJC 5M5XH 3J81j 1N34Q 1X55A 2JA7G 1EQTA 1GUGA 1XMOQ 1CQVA 2F0JA 1QB5D 1GHKA 1MI2A 1YITA 1SNQA 4DV7Q 4JI3Q 1OXSC 4DR3Q 1HXYD 1PH3A 3P20A 2FMCA 4HJAA 1KQSA 1ET6A 3S1MB 4B9XA 4BY7B 2AKWB 3A8IE 1JE5A 3M4YA 2F0KA 2AHOB 4NKLA 1YNJC 5C3EH 3A55A 1Q82C 4HR7B 2A19A 3Q6SA 1SNDA 3D0FA 1Q86C 5C5MA 4N8X1 2KHIA 5C4JB 4IFDI 5C0XG 1D5ZC 1K83H 3H0GB 1E24A 1CZWA 3KF8A 2PI2E 5IT9L 1G2TA 1LABA 1UWVA 1DOKA 3VYUA 2E74C 3QJYA 4B3RL 3M4OB 3J81E 4GNXA 1IBLL 2DJFC 2B2YA 2A69C 3SGIA 2MO1A 4B3SL 2DJGC 3E0JA 4CJ0B 4XQNA 3ZJYC 4XXEA 2WFWA 2VQEQ 3H3VC 1GUOA 2JK8A 5FLXc 3CQZH 4LF9L 4B3ML 1RKNA 1PMRA 1V43A 2MP1A 4OL7A 4DV4L 3TDQA 2HHHQ 1GUNA 1S5DD 1TU2B 4A3LG 3VYTA 3FRPB 4HJ8A 3MXGA 3HG9A 4G7HC 4OONA 1X3FA 2JQOA 4K0KL 1GO3E 2IL8A 1R9TH 4M1UB 2UXBQ 2RSOA 1Y69U 2RF4A 5CV9A 3I91A 3CPWA 2DNEA 2A6ED 3STBC 4QIWB 1X65A 2UXCQ 3HOXH 3HOUH 2XTIA 1NNXA 1Y1WH 5IYCG 3ICEA 1EWIA 2E2IB 3HGBA 1LT6D 3NWTA 4DR6L 1VQ5A 2B2WA 3NQTA 4A3BG 2Z6BA 1CKNB 1I4QA 4Q0FA 1QZHA 2K5DA 1PYWD 4FO2A 3K7AH 4RGNA 2R7ZG 4JI6L 2B2TC 3EA6A 1PXUA 2I5MX 4KD3A 2A1AA 4XYOA 2KCMA 5JJKA 4OELB 3VR5A 4LF6L 4LF7Q 2JA7B 2R92H 3H94A 4EQNA 3CHBD 1ASZA 4IOAA 4EQOA 1KTKA 4C2MB 2KBNA 4P75A 2N55A 4QJFA 3C1EA 4DXFA 2QF7A 3EN2A 4A75A 2IT1A 1UE1A 2PQAB 4XQQA 1J8IA 4DR4Q 5BR8Q 4ZQ3A 3TMEA 4GN3B 3M4PA 3CW2C 2HIVA 1SE3A 4X64L 3I56A 3BDLA 5K36G 2K03A 4LUOA 3CCLA 2IHEA 1EZ6A 2PW7A 3JAMc 3I4NH 2IHFA 5FJ8G 4DV1Q 4JBKA 1KRTA 3H3VI 1DONA 4BBSH 1ZEQX 5DM73 2QGQA 3VA5A 1VQ9A 2Z1CA 1HQRD 4JOIC 3W1BA 3VR4A 1WD1A 1VQCA 2E2JH 4HEDA 1Z9FA 2CH4A 1A2TA 3DWQA 4DAVA 3JAML 2QEXA 4B3TL 4YCVA 3CMEA 3I3CA 4HJ5A 5C5LA 3CP0A 2KUMA 2UUBQ 3TRZA 2L55A 1Q90A 1JR0D 1CQFA 2F3WA 4PMWA 1F9RA 4OO1G 3QWNA 1HPCA 4CHTB 2K4KA 1X9NA 1UUPA 3FP9A 4C1NI 1LTGD 4DR5Q 5DNFA 5JPMC 4NXNQ 2B2VA 4A93B 5GAHC 2XRQD 4FXKC 1CSQA 2PQAA 1KLUD 4LFBQ 1KXLA 4DV6Q 4A3KB 2JYOA 3C3LA 2BA1A 2OWOA 2XSCA 2R7ZB 4Y7NH 2ZT9C 1F9PA 2X6LA 1TWAH 5CYUA 1SBBB 5ISRA 5ELCA 3ND8A 4F88A 4ZKBB 3A7AB 4HIDA 1QCBD 1H9KA 1T9HA 3IFDA 3A5UA 1N34L 2HUGA 3JAMi 1MKHA 3OTOL 1I6HH 4UP9A 2A6EC 2OQ0A 4ZUIA 2KHJA 2UXDL 1KL9A 1X3PA 5CBAE 4X65L 4K14A 1C9OA 2IX3A 1VQJA 4BXXG 2XRSD 3EIVA 4JI3L 4IFDJ 4QCLA 5JAVA 3S1QH 2F0GA 4B08A 3S16B 2OQKA 4FDBA 1XYIA 4IALA 4X66L 1L2FA 4QY7A 5JVH3 1ENAA 3PF5A 2VB3X 2EJFC 3PUXA 1IYVA 3HKZE 4O42A 1HQMC 3S2HH 3SHLA 1WVLA 3C46A 2AQ2B 1F9SA 2CHBD 5IYDH 4ZUJA 4X6AH 2F0FA 2B8FA 2VS1A 5LMUQ 3F1ZA 3I72A 1EY9A 3DEOA 1Y8OB 5IP7G 1Q1BA 3J7AV 2NVYB 2N3SA 1QJOA 2JEBI 2PI2A 4EX5A 2BCOA 1R4QB 2Z8LA 2VY3A 5I6WA 2OEOA 1ZYRD 3CU7A 3NBHA 4XDXA 2KOLA 3DHQA 1VQPA 2Q2UA 4JI7L 3BU2A 5CV8A 4MN3A 1EIYB 3J81c 4RKLA 2F0TA 3FKIG 1TS3A 3E5SA 3KBGA 1RCVD 4X3TA 1X56A 2XNAC 3T51B 2JA6G 4A3DH 3NBIA 1QOHA 2K5WA 4LWCA 2HDMA 5M3FH 1SSOA 1XNRL 2EJGC 1VQOA 1VMPA 2ID0A 1TWCB 1BF4A 2A68C 1N33L 4HCSA 3LWUA 3GTMB 1SYBA 2HD3A 4DK6C 3IAYA 3HOYG 1WTHA 4GOPC 4KN4C 1HR0Q 5C3EG 1I94Q 2UU9L 2NVTH 4RAUC 5BN4A 3RLFA 2L9HA 3GD7A 4QF4A 2WV6D 3HKZG 1CI3M 3SVMA 3S17B 4JI8Q 2QA4A 3G4SA 1E22A 4GLVB 1GHJA 3EBEA 2HDLA 3VYSA 1G2SA 1LACA 3P1HA 5IGBA 1J5EL 4C3JH 2WP8J 2N49A 3AQQA 1H9SB 2XIWA 4LF7L 2FFKB 3K8AA 1H9MA 1QVGA 3S15H 4LUZA 3SR1A 2PQEA 2I5LX 5T1IA 5IT9E 2AUKA 3A7LA 2JA8H 3D8GA 2HIXA 2OTLA 4RGMA 4K8IA 2PO4A 1VQHA 1VQ8A 3PMFA 5IGGA 4BBRB 1PH7A 1HNWQ 4BY1B 2AQ3B 1RHPA 3CCRA 2VB2X 3MEHA 4QMGA 4H44C 1EY0A 4A3GH 4DR4L 1VCIA 1AFPA 3U58A 4L5TA 5EGTA 1E1OA 1GD7A 3J81i 2BA0A 4JI1Q 1Y1WG 3T13A 2PNRC 4R9WA 1R4PB 2XWJB 4NDXA 2E2HB 5D65A 5J22A 5CC4A 3HOZH 4J15A 1A2UA 3K5MA 3BVGA 4OIKA 2IX0A 2V4DA 4QGUA 1E2ZA 4LF8Q 3PIPA 5EJWA 1LTSD 4IFDH 1B4OA 4HIOA 4KI0A 4IUVA 4R4CA 4LJZC 1STYA 2DUDA 5IWAQ 3UDGA 1NAPA 3D4DA 2LKVA 1NSNS 2UUBL 1LLRD 4L8JA 1VQKA 4A3CG 1WCMH 2TMPA 2FJ2A 4RH6A 2B2UA 1B53A 1NTGA 2IJ0A 4O0AA 1O7LA 2UUAL 4L63B 4OWTB 1KRSA 4RG1A 1OXUA 1MIUA 2L5TA 4IQZA 4DFAA 3ITPA 2JA9A 2TSSA 3HOYB 4LMQD 3S1NH 5JVG3 5C3EB 4R4QA 4LFBL 3F2BA 3EROA 1U4MA 3UDFA 4E6IA 4F87A 3HKZB 3PO3H 1VQEA 2D0OA 1H95A 1I6VC 2EY1A 1ZYRC 2CWAA 1K83B 3M9BA 4DV5L 3I4NG 4DAPA 1CT1D 4BA1I 2K05A 2YYZA 4HMIA 1K8AC 1UAPA 4BBSG 1VQMA 1HZBA 2CQOA 5ELFA 2BH8A 1A6XA 1JWSD 4R4OA 5IP9H 1PVOA 2K32A 4IN3A 1P16A 1LTAD 3CQZB 2CKZB 2Z4HA 4CDDC 3BZKA 1T5EA 3KDFA 1KD1C 3GDEA 3RMHA 3F2DA 2ZTCA 5GADC 1XXGA 1FYCA 3SE0A 1S40A 5FK9C 3D31A 3JAME 4BY7G 1PFBA 2D5DA 2J4XA 4PMCA 1XPOA 1GJXA 3HOXB 3CCEA 4F8MA 3HKSA 1XTDA 2ZTDA 1WYDA 1Y1WB 1TS4A 3RNUA 4JI0L 4OX9Q 3DUZA 1K3RA 4JI2Q 1T5XD 1TWGH 4YWKA 2R93H 4QQBX 2EJMA 1NY4A 1FNUA 5G3LD 5T1GA 4TKOB 3G6JB 4DNIA 5IIFA 5EQ0A 1EYAA 5JEAH 3H0GG 5LMUL 3T56B 4ZCKA 3OIPA 2QDLA 4A3FH 1EYGA 2RVLA 2F0IA 4DR2L 1D1IA 4JBWA 3C1FA 4POGA 3SEBA 1IHZA 3SK8A 4FYDA 1HNZQ 1I4GA 3H3VH 1LTID 2LS01 4WJ3M 1VQNA 3BVZA 1PTOH 3TQYA 3BYTB 1UE5A 4DF7A 2CW0C 3K58A 5CV7A 3RZDH 1GUWA 3Q0AA 4XT1B 1AE2A 1KDBA 3F2UA 3S14H 1HHVA 1L0XB 2BDOA 4PQXA 1HCZA 2GVBA 2XVSA 4ALPA 3T1HQ 1JWMD 2EXZA 1D6EC 3HRZC 1I4HA 1GVPA 3N6RA 5DM63 4CGYB 1RF2D 5K5PA 2L11A 3KF8B 4PV1C 1LTLA 5HY6A 2EYFA 1E7ZA 1BNZA 1JT8A 4R8NA 3I4NB 1IKMA 1U5KA 3HOWH 1TY2A 1IBKQ 5C0XI 1S4ZA 2M00A 2M2LA 1TT2A 1JMCA 4BBSB 3HOVH 2WB1E 5M5YH 1ICWA 1UEBA 3NE5B 5FLMG 1WTRA 2E2JB 1ILQA 5M5WH 1HA6A 4XYQA 4DNRB 5IGFA 1J9OA 2RKSA 3TBIB 2PNHA 3RLNA 1LT4D 1LUZA 1S5ED 1STGA 4LAAA 1JB7A 3NUCA 3MXNA
chains in the Genus database with same CATH topology
3I4NH 2IHFA 4MZ9A 1XMQL 3AEVA 5FJ8G 4DV1Q 4JBKA 1KRTA 5IT9c 4C2MH 3OYYA 4PZ7A 5M3FG 3H3VI 2VZAA 4DR6Q 1YJ9A 4BBSH 1LM0A 5J3BA 2QGQA 1KAWA 4OXPA 5FJ8H 4A3MH 4XIGS 1OXTA 1VQ9A 2E5LL 4JOIC 4JI1L 3W1BA 4DPGA 4BA2I 4A3IG 1VQCA 4OWXB 3KLWA 2K5HA 2E2JH 3PUVA 1Q8KA 1Z9FA 4JI6Q 2Z0SA 2NVYH 4LFAL 1OXVA 3HFZB 2QEXA 1WJJA 4DK3C 4B3TL 4YCVA 3CMEA 5LMNW 3WWVA 4HJ5A 2F4VQ 4IO9A 3CP0A 4NB3A 4A3IH 2UUBQ 3TRZA 1OTCA 2HQLA 3CXCA 3H15A 3KF6A 4PZ8A 1LYLA 4QL5A 4PMWA 4A3EH 4LF6Q 2WAQG 3I55A 3TREA 4OO1G 4IJLA 5JJIA 4X62L 2K4KA 4H02A 1X9NA 2WB1G 3FP9A 1PH2A 5IWAL 3UDIA 4DV3L 1HZ9A 1Y1VH 3CC7A 4DR5Q 4NXNQ 3PGZA 3KOJA 3A5ZB 5GAHC 1X3GA 1CSQA 2PQAA 2A8VA 2CWPA 4A3CH 2AMCB 1SMXA 1SFOH 4LFBQ 3T1YQ 3CF5A 1SRUA 1KXLA 4DV6Q 1YI2A 4L5QA 3ULLA 1S72A 4LUVA 2BA1A 2YU9H 2OWOA 2H5XA 2CCZA 1FL0A 5GAGC 5JEAJ 4Y7NH 4LF5Q 4HJ7A 4MTNA 4JBJA 5GAEC 3GTOH 2JE6I 1C7YA 1YIJA 3RZOH 1VS0A 4ME3A 4C3HH 1D7QA 1HNXL 1IL2A 4DUYL 3S17H 1TWAH 1V9PA 4JOIA 1NE3A 4R4IA 1YVCA 1G291 4A93G 4DR7L 1XMQQ 3MXNB 4A4IA 4DV0L 3S2DH 4P72A 2ALYB 3J80c 4HIDA 4OWWB 1T9HA 1SROA 4IJHA 3GTJH 1VQIA 3A5UA 5LMNQ 1N34L 2Y0SE 5M3MH 1MKHA 3JAMi 3LGJA 3OTOL 3I4MH 5IYCH 4UP9A 4A3KG 2RCNA 4UY8C 4A93H 1I6HH 1EQQA 4L5RC 2OQ0A 4GKKQ 5C4XG 2E5LQ 2KHJA 2UXDL 4PZ6A 1YEZA 1VQGA 5C44G 1QZGA 1KL9A 2RHSB 3PO2H 4X65L 3HOZG 4IOCA 1TWHH 3RN2A 1QVCA 1C9OA 4A3KH 2ATWA 1VQJA 4BXXG 4YHHL 3EIVA 4JI3L 4YCUA 4LFAQ 1N8RC 4IFDJ 3ULJA 3OW2A 3RLOA 3S1QH 1FVIA 2R7ZH 3TEHB 1S3OA 4APVA 2ES2A 2VQFL 1PFSA 4GN4B 2JA5G 2MO0A 1KIXA 2OQKA 3GO5A 3L0OA 4FDBA 4C3IH 1HR0L 2FXQA 1L1OB 3K80C 1L2FA 3DM3A 4X66L 1A0IA 1I94L 4Y52H 5IYBH 1M1KC 4QY7A 5HGQA 2JA5H 3NELA 1WFQA 4JI8L 4B3RQ 4NXML 1Q46A 3PF5A 4GLXA 4X62Q 2RHQB 3PUXA 1L1OC 3PCOB 4JC0A 5IYDG 3HKZE 1WI5A 1EIFA 5H1SE 4DV3Q 4YY3Q 3S2HH 1SN8A 2GVAA 2Z6KC 1TWFH 3G6EA 2C35B 4RMFA 2KENA 4IPHA 1CSPA 1EOVA 4A76A 5IYDH 4X6AH 1U0LA 2B63H 2K5VA 2VS1A 3I2ZA 1N9WA 5LMUQ 3K0XA 4DV4Q 4OO1I 3F1ZA 3S24A 2E2HH 5IP7G 2NZHA 1Q1BA 3M3YH 2N3SA 1BBUA 3ULPA 2JEBI 2PI2A 4OX9L 4EX5A 2VY3A 3K81C 4LF4Q 1WOCA 3UE1A 4AQYL 3F2CA 1GM5A 1K0RA 1UE6A 4JI4L 1HNXQ 3L2PA 1VQPA 2JJQA 2Q2UA 4JI7L 1HNWL 3GTQH 3BU2A 3PO3G 2Y0SG 1GKHA 1EIYB 1JJCB 5ELOA 3A0JA 3J81c 4A3DG 4DR7Q 5ELNA 3FKIG 1VQFA 1X56A 3GTPH 2IX1A 1NJIC 3OTOQ 1FJGL 1VQ6A 2JA6G 2I5HA 1PV4A 4A3DH 3U50C 3M85A 1FGUA 3FKIH 4LWCA 1PYSB 5GROA 4P73A 5M3FH 1XNRL 2UXDQ 3J80i 1VQOA 2K14A 3CMAA 2ID0A 4X65Q 4GOPB 4JYAQ 3IRBA 2JA6H 1N33L 1XPUA 1YBYA 3GTKH 4GKJL 1X54A 1PHJA 4YCWA 5IP9G 1IYJB 1JJGA 3RN5A 2VNUD 4DK6C 1L1OA 3HOYG 4UPAA 4HIKA 3PF4A 2YV5A 4DV2Q 4GOPC 1HR0Q 3I7FA 2F52A 1NMGA 3G48A 4X66Q 5C3EG 5AJ3L 1JJ2A 1I94Q 2UU9L 4LF8L 2Z6KA 1XNQL 2NVTH 3JC66 2VUMG 3RLFA 1CKMA 1Q81C 3GD7A 3HOYH 3HKZG 4JV5Q 1RL2A 3CCMA 4JI8Q 1UE7A 2QA4A 3G4SA 1N36L 2K5NA 3UE0A 4DAMA 1E22A 4GLVB 1CKOA 1CUKA 3CC2A 2LSSA 3EBEA 2VUMH 5C0XJ 3AFQA 1K9MC 1J5EL 1VQ4A 4C3JH 2WP8J 4LFCQ 3ERSX 3CPFA 2N49A 4JG2A 4KHPQ 1TWCH 3AQQA 1NMFA 3E9IA 1PH5A 4GLAC 4QIWE 1I5FA 2D62A 4LW1A 4LF7L 2JA8G 3K8AA 1QVGA 3GTMH 1I50H 3PUWA 2LXJA 4LUZA 2YTVA 3RR5A 3S15H 2ZTEA 4DUZL 3B6YA 2I5LX 1M90C 2N8NA 4EQ5A 3CCSA 1VQ7A 2OTJA 1YZ6A 2N78A 2NVQH 2JA8H 4X64Q 4KHZA 2DGYA 2HIXA 2L15A 5JEAG 4AQYQ 4A3JG 2OTLA 2ZJPA 1O7IA 4JI4Q 1VQHA 1VQ8A 4A3FG 1YJNA 1PH7A 1V1QA 3NBHB 4JI7Q 4A3GG 1HNWQ 3NENA 3CCQA 1X6OA 2BH2A 3STBD 2LXKA 1XPRA 4A3JH 1PH8A 2K75A 3K7UC 3CCRA 1BBWA 5C4JH 3VDYA 3TS2A 1OXXK 4YWMA 4A3GH 2VL6A 4DR4L 1VCIA 2IY5B 1AH9A 1YHAA 3U58A 1XMOL 1I3QH 4L5TA 2NN6G 1E1OA 4XTCS 4AYBE 4DAYB 2ZM6L 4GOPA 1GD7A 3J81i 2BA0A 1XNRQ 4JI1Q 1HJPA 2OCEA 4GN5A 1Y1WG 1K8GA 1Q7YC 3CAMA 2I0QA 1N33Q 5C4XH 4DV7L 4PG3A 1BVSA 5C44H 2NVXH 4B3TQ 3I4OA 1L0WA 4BBRG 4DR3L 3HOZH 4J15A 2V1CC 4IFDG 3GTLH 4BY1G 4BXXH 1IZ6A 2IX0A 5AJ3Q 4QGUA 1PH6A 4LF8Q 2UU9Q 4UP8A 4BBRH 3PIPA 1IBML 4O2DA 1VQLA 1HH2P 4HIOA 4BY1H 4KI0A 4R4CA 2XGTA 1PH9A 5IE8A 3G71A 2DUDA 1NBWA 1Q1EA 1WCMG 5IWAQ 3UDGA 1HR0W 5EAYA 4NPSA 1J5EQ 2F4VL 3DLLA 3CCVA 4JI5L 2UUBL 3W1GA 3CCJA 4WJ4A 1VQKA 4R1JA 2K52A 1WCMH 3HOWG 1NTGA 3M7NA 1KHIA 2MNAA 4O0AA 3E9HA 3GTGH 4DUZQ 2UUAL 1VQAA 4DR1L 4OWTB 1W3SA 3HOVG 1KRSA 4RG1A 2YTXA 4GNXB 1OXUA 3E0EA 5IP7H 1MIUA 4JI2L 2VQEL 2ZJQA 4JBMA 5IY0A 1MJEA 1SLJA 1C0AA 4DUYQ 1E1TA 1SR3A 1QVFA 2UUCL 2JA9A 1EQRA 3S1NH 2R7FA 1YNXA 4JCVE 1YJWA 2B29A 4GNXC 1PH4A 2HHHL 2Q2IA 4R4QA 4DV0Q 1N32L 4LFBL 4AYBG 3F2BA 3UDFA 3BZCA 3PV0A 1B70B 5M5XH 1D8LA 3J81j 1N34Q 1X55A 3KFUA 2JA7G 3PO3H 1VQEA 2D0OA 1H95A 1RIPA 3F8TA 1ASYA 2JEAI 1XMOQ 2CWAA 4KLKA 4P71A 2ZM6Q 1HZCA 3M9BA 2UXBL 4DV5L 3I4NG 1B8AA 2MFIA 3PUYA 4BA1I 1MJCA 3U4VA 1HNZL 2JA7H 2YYZA 2UXCL 1YITA 2Q2TA 1K8AC 4YHHQ 4JI3Q 4DV7Q 4YWLA 4BBSG 1OXSC 2CFMA 1VQMA 4A3MG 3MEFA 4DR3Q 1HZBA 2CQOA 2VQFQ 1PH3A 4HJAA 1KQSA 2BH8A 4TVAB 4HJ9A 5LMNL 1CKNA 2AKWB 2EQSA 2NN6I 4R4OA 5IP9H 4AIMA 1PVOA 1JE5A 1IBMQ 2R7DA 1P16A 2AHOB 4LNQA 4GKKL 2EIFA 2R6GA 2AWNA 5C3EH 1Q82C 3KJOA 4NXMQ 2HT1A 2A19A 2CKZB 1B7YB 4HIMA 3D0FA 3M4QA 2MQHA 1Q86C 3T1HL 3FHWA 3BZKA 2KHIA 4IFDI 3KDFA 1KD1C 5C0XG 3GDEA 2ZJRA 3U4ZA 1K83H 3F2DA 4A3EG 2ZTCA 5GADC 4JI5Q 1E24A 3J7ZC 3ER0A 2PI2E 4POFA 4GS3A 1Q12A 1UWVA 2VW9A 4R4TA 2B3GA 1A8VA 1Z47A 3D31A 1S40A 4BY7G 1XPOA 3AFPA 2R93G 4B3RL 3CCEA 1Y1VG 1XTDA 2ZTDA 3HKSA 1J6QA 1WYDA 4GNXA 1IBLL 2UUAQ 4DR1Q 4B3SL 3SGIA 2MO1A 1IBKL 3S1MH 3RNUA 4JI0L 4OX9Q 4BY7H 1K3RA 4JI2Q 3ZJYC 1TWGH 2R93H 4YWKA 1VQDA 2AWOA 2WFWA 2PMZE 4YY3L 2VQEQ 1XJVA 4A3CG 4QQBX 1P8LA 1NY4A 2K50A 2KCTA 3J7A5 2JK8A 5FLXc 3CQZH 4LF9L 2UUCQ 4B3ML 4DNIA 4MNOA 1V43A 5LMUL 3H0GG 4DV4L 2HHHQ 4P74A 4A3LG 1N32Q 4HJ8A 4A3FH 1EYGA 4L5SA 1QUQA 4OONA 5BR8L 4DR2L 1G51A 1X3FA 2JQOA 3H0GH 3PIOA 3HOXG 1GO3E 3KYHC 1FJGQ 3HOUG 1R9TH 4JBWA 4K0KL 4A3LH 2UXBQ 2RF4A 4DV5Q 3TS0A 4DKAC 4LF4L 4POGA 3CPWA 1X3EA 1HNZQ 3STBC 1YHBA 3H3VH 1X65A 2UXCQ 3HOXH 3HOUH 4GKJQ 2XTIA 3M4OH 4WJ3M 2YTYA 1VQNA 2Q2HA 5M3MG 1Y1WH 3TQYA 3I4MG 1IXRA 5IYCG 4DV1L 1K73C 1PH1A 3CC4A 4AH6A 2ASBA 3ICEA 1EWIA 3Q8DA 1UE5A 4DR6L 1VQ5A 2EXDA 1XNQQ 5E7NA 3PO2G 4A3BG 1YHQA 1EUJA 3RZDH 1CKNB 3L7ZC 5GQOA 1A62A 1QZHA 1AE3A 1AE2A 3K7AH 3KJPA 1N36Q 3S14H 2R7ZG 4A3BH 3AYHB 2GVBA 3CD6A 4JI6L 1VQBA 4ALPA 1BKBA 4JYAL 3BJUA 3T1HQ 1SE8A 2NZOA 5IYBG 2I5MX 1GVPA 1HZAA 2R92G 3KDFB 2A1AA 1G6PA 4DV2L 2KCMA 1PYBA 5JJKA 3KF8B 1LTLA 5HY6A 4LF6L 1E7ZA 4LF7Q 3KF6B 2R92H 4JV5L 1JT8A 1ASZA 1U5KA 1IBLQ 2E2IH 3HOWH 4IOAA 4B3SQ 1IBKQ 1EFWA 5C0XI 1W2BA 4JI0Q 2WAQE 5DLQE 1JMCA 2B63G 2KBNA 4IPDA 2E8GA 4P75A 4DR5L 4QJFA 4LFCL 4NXNL 4IPCA 3CCUA 3HOVH 2WB1E 3EN2A 1Y14B 4LF9Q 1A63A 5M5YH 4B3MQ 4KHPL 1UEBA 4A75A 5JJLA 3PUZA 3PSIA 5FLMG 2IT1A 1UE1A 3T1YL 2PQAB 3W5OA 4DV6L 5M5WH 3UDXA 2D0PA 3NEMA 2F3IA 4DR4Q 5BR8Q 4DR2Q 5FLMH 1QUQB 4LF5L 3S16H 4K0KQ 4GN3B 4UP7A 3M4PA 3CW2C 2HIVA 2PNHA 4X64L 3S1RH 2GN5A 3RLNA 3I56A 1PA6A 1DGSA 1LUZA 4TQUS 5K36G 4LUOA 1JB7A 3CCLA 2IHEA 1KC8C 1E3PA 3A74A 3JAMc 4IPGA 1TXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N H;  2IHF A;  4MZ9 A;  1XMQ L;  3AEV A;  5FJ8 G;  4DV1 Q;  4JBK A;  1KRT A;  5IT9 c;  4C2M H;  3OYY A;  4PZ7 A;  5M3F G;  3H3V I;  2VZA A;  4DR6 Q;  1YJ9 A;  4BBS H;  1LM0 A;  5J3B A;  2QGQ A;  1KAW A;  4OXP A;  5FJ8 H;  4A3M H;  4XIG S;  1OXT A;  1VQ9 A;  2E5L L;  4JOI C;  4JI1 L;  3W1B A;  4DPG A;  4BA2 I;  4A3I G;  1VQC A;  4OWX B;  3KLW A;  2K5H A;  2E2J H;  3PUV A;  1Q8K A;  1Z9F A;  4JI6 Q;  2Z0S A;  2NVY H;  4LFA L;  1OXV A;  3HFZ B;  2QEX A;  1WJJ A;  4DK3 C;  4B3T L;  4YCV A;  3CME A;  5LMN W;  3WWV A;  4HJ5 A;  2F4V Q;  4IO9 A;  3CP0 A;  4NB3 A;  4A3I H;  2UUB Q;  3TRZ A;  1OTC A;  2HQL A;  3CXC A;  3H15 A;  3KF6 A;  4PZ8 A;  1LYL A;  4QL5 A;  4PMW A;  4A3E H;  4LF6 Q;  2WAQ G;  3I55 A;  3TRE A;  4OO1 G;  4IJL A;  5JJI A;  4X62 L;  2K4K A;  4H02 A;  1X9N A;  2WB1 G;  3FP9 A;  1PH2 A;  5IWA L;  3UDI A;  4DV3 L;  1HZ9 A;  1Y1V H;  3CC7 A;  4DR5 Q;  4NXN Q;  3PGZ A;  3KOJ A;  3A5Z B;  5GAH C;  1X3G A;  1CSQ A;  2PQA A;  2A8V A;  2CWP A;  4A3C H;  2AMC B;  1SMX A;  1SFO H;  4LFB Q;  3T1Y Q;  3CF5 A;  1SRU A;  1KXL A;  4DV6 Q;  1YI2 A;  4L5Q A;  3ULL A;  1S72 A;  4LUV A;  2BA1 A;  2YU9 H;  2OWO A;  2H5X A;  2CCZ A;  1FL0 A;  5GAG C;  5JEA J;  4Y7N H;  4LF5 Q;  4HJ7 A;  4MTN A;  4JBJ A;  5GAE C;  3GTO H;  2JE6 I;  1C7Y A;  1YIJ A;  3RZO H;  1VS0 A;  4ME3 A;  4C3H H;  1D7Q A;  1HNX L;  1IL2 A;  4DUY L;  3S17 H;  1TWA H;  1V9P A;  4JOI A;  1NE3 A;  4R4I A;  1YVC A;  1G29 1;  4A93 G;  4DR7 L;  1XMQ Q;  3MXN B;  4A4I A;  4DV0 L;  3S2D H;  4P72 A;  2ALY B;  3J80 c;  4HID A;  4OWW B;  1T9H A;  1SRO A;  4IJH A;  3GTJ H;  1VQI A;  3A5U A;  5LMN Q;  1N34 L;  2Y0S E;  5M3M H;  1MKH A;  3JAM i;  3LGJ A;  3OTO L;  3I4M H;  5IYC H;  4UP9 A;  4A3K G;  2RCN A;  4UY8 C;  4A93 H;  1I6H H;  1EQQ A;  4L5R C;  2OQ0 A;  4GKK Q;  5C4X G;  2E5L Q;  2KHJ A;  2UXD L;  4PZ6 A;  1YEZ A;  1VQG A;  5C44 G;  1QZG A;  1KL9 A;  2RHS B;  3PO2 H;  4X65 L;  3HOZ G;  4IOC A;  1TWH H;  3RN2 A;  1QVC A;  1C9O A;  4A3K H;  2ATW A;  1VQJ A;  4BXX G;  4YHH L;  3EIV A;  4JI3 L;  4YCU A;  4LFA Q;  1N8R C;  4IFD J;  3ULJ A;  3OW2 A;  3RLO A;  3S1Q H;  1FVI A;  2R7Z H;  3TEH B;  1S3O A;  4APV A;  2ES2 A;  2VQF L;  1PFS A;  4GN4 B;  2JA5 G;  2MO0 A;  1KIX A;  2OQK A;  3GO5 A;  3L0O A;  4FDB A;  4C3I H;  1HR0 L;  2FXQ A;  1L1O B;  3K80 C;  1L2F A;  3DM3 A;  4X66 L;  1A0I A;  1I94 L;  4Y52 H;  5IYB H;  1M1K C;  4QY7 A;  5HGQ A;  2JA5 H;  3NEL A;  1WFQ A;  4JI8 L;  4B3R Q;  4NXM L;  1Q46 A;  3PF5 A;  4GLX A;  4X62 Q;  2RHQ B;  3PUX A;  1L1O C;  3PCO B;  4JC0 A;  5IYD G;  3HKZ E;  1WI5 A;  1EIF A;  5H1S E;  4DV3 Q;  4YY3 Q;  3S2H H;  1SN8 A;  2GVA A;  2Z6K C;  1TWF H;  3G6E A;  2C35 B;  4RMF A;  2KEN A;  4IPH A;  1CSP A;  1EOV A;  4A76 A;  5IYD H;  4X6A H;  1U0L A;  2B63 H;  2K5V A;  2VS1 A;  3I2Z A;  1N9W A;  5LMU Q;  3K0X A;  4DV4 Q;  4OO1 I;  3F1Z A;  3S24 A;  2E2H H;  5IP7 G;  2NZH A;  1Q1B A;  3M3Y H;  2N3S A;  1BBU A;  3ULP A;  2JEB I;  2PI2 A;  4OX9 L;  4EX5 A;  2VY3 A;  3K81 C;  4LF4 Q;  1WOC A;  3UE1 A;  4AQY L;  3F2C A;  1GM5 A;  1K0R A;  1UE6 A;  4JI4 L;  1HNX Q;  3L2P A;  1VQP A;  2JJQ A;  2Q2U A;  4JI7 L;  1HNW L;  3GTQ H;  3BU2 A;  3PO3 G;  2Y0S G;  1GKH A;  1EIY B;  1JJC B;  5ELO A;  3A0J A;  3J81 c;  4A3D G;  4DR7 Q;  5ELN A;  3FKI G;  1VQF A;  1X56 A;  3GTP H;  2IX1 A;  1NJI C;  3OTO Q;  1FJG L;  1VQ6 A;  2JA6 G;  2I5H A;  1PV4 A;  4A3D H;  3U50 C;  3M85 A;  1FGU A;  3FKI H;  4LWC A;  1PYS B;  5GRO A;  4P73 A;  5M3F H;  1XNR L;  2UXD Q;  3J80 i;  1VQO A;  2K14 A;  3CMA A;  2ID0 A;  4X65 Q;  4GOP B;  4JYA Q;  3IRB A;  2JA6 H;  1N33 L;  1XPU A;  1YBY A;  3GTK H;  4GKJ L;  1X54 A;  1PHJ A;  4YCW A;  5IP9 G;  1IYJ B;  1JJG A;  3RN5 A;  2VNU D;  4DK6 C;  1L1O A;  3HOY G;  4UPA A;  4HIK A;  3PF4 A;  2YV5 A;  4DV2 Q;  4GOP C;  1HR0 Q;  3I7F A;  2F52 A;  1NMG A;  3G48 A;  4X66 Q;  5C3E G;  5AJ3 L;  1JJ2 A;  1I94 Q;  2UU9 L;  4LF8 L;  2Z6K A;  1XNQ L;  2NVT H;  3JC6 6;  2VUM G;  3RLF A;  1CKM A;  1Q81 C;  3GD7 A;  3HOY H;  3HKZ G;  4JV5 Q;  1RL2 A;  3CCM A;  4JI8 Q;  1UE7 A;  2QA4 A;  3G4S A;  1N36 L;  2K5N A;  3UE0 A;  4DAM A;  1E22 A;  4GLV B;  1CKO A;  1CUK A;  3CC2 A;  2LSS A;  3EBE A;  2VUM H;  5C0X J;  3AFQ A;  1K9M C;  1J5E L;  1VQ4 A;  4C3J H;  2WP8 J;  4LFC Q;  3ERS X;  3CPF A;  2N49 A;  4JG2 A;  4KHP Q;  1TWC H;  3AQQ A;  1NMF A;  3E9I A;  1PH5 A;  4GLA C;  4QIW E;  1I5F A;  2D62 A;  4LW1 A;  4LF7 L;  2JA8 G;  3K8A A;  1QVG A;  3GTM H;  1I50 H;  3PUW A;  2LXJ A;  4LUZ A;  2YTV A;  3RR5 A;  3S15 H;  2ZTE A;  4DUZ L;  3B6Y A;  2I5L X;  1M90 C;  2N8N A;  4EQ5 A;  3CCS A;  1VQ7 A;  2OTJ A;  1YZ6 A;  2N78 A;  2NVQ H;  2JA8 H;  4X64 Q;  4KHZ A;  2DGY A;  2HIX A;  2L15 A;  5JEA G;  4AQY Q;  4A3J G;  2OTL A;  2ZJP A;  1O7I A;  4JI4 Q;  1VQH A;  1VQ8 A;  4A3F G;  1YJN A;  1PH7 A;  1V1Q A;  3NBH B;  4JI7 Q;  4A3G G;  1HNW Q;  3NEN A;  3CCQ A;  1X6O A;  2BH2 A;  3STB D;  2LXK A;  1XPR A;  4A3J H;  1PH8 A;  2K75 A;  3K7U C;  3CCR A;  1BBW A;  5C4J H;  3VDY A;  3TS2 A;  1OXX K;  4YWM A;  4A3G H;  2VL6 A;  4DR4 L;  1VCI A;  2IY5 B;  1AH9 A;  1YHA A;  3U58 A;  1XMO L;  1I3Q H;  4L5T A;  2NN6 G;  1E1O A;  4XTC S;  4AYB E;  4DAY B;  2ZM6 L;  4GOP A;  1GD7 A;  3J81 i;  2BA0 A;  1XNR Q;  4JI1 Q;  1HJP A;  2OCE A;  4GN5 A;  1Y1W G;  1K8G A;  1Q7Y C;  3CAM A;  2I0Q A;  1N33 Q;  5C4X H;  4DV7 L;  4PG3 A;  1BVS A;  5C44 H;  2NVX H;  4B3T Q;  3I4O A;  1L0W A;  4BBR G;  4DR3 L;  3HOZ H;  4J15 A;  2V1C C;  4IFD G;  3GTL H;  4BY1 G;  4BXX H;  1IZ6 A;  2IX0 A;  5AJ3 Q;  4QGU A;  1PH6 A;  4LF8 Q;  2UU9 Q;  4UP8 A;  4BBR H;  3PIP A;  1IBM L;  4O2D A;  1VQL A;  1HH2 P;  4HIO A;  4BY1 H;  4KI0 A;  4R4C A;  2XGT A;  1PH9 A;  5IE8 A;  3G71 A;  2DUD A;  1NBW A;  1Q1E A;  1WCM G;  5IWA Q;  3UDG A;  1HR0 W;  5EAY A;  4NPS A;  1J5E Q;  2F4V L;  3DLL A;  3CCV A;  4JI5 L;  2UUB L;  3W1G A;  3CCJ A;  4WJ4 A;  1VQK A;  4R1J A;  2K52 A;  1WCM H;  3HOW G;  1NTG A;  3M7N A;  1KHI A;  2MNA A;  4O0A A;  3E9H A;  3GTG H;  4DUZ Q;  2UUA L;  1VQA A;  4DR1 L;  4OWT B;  1W3S A;  3HOV G;  1KRS A;  4RG1 A;  2YTX A;  4GNX B;  1OXU A;  3E0E A;  5IP7 H;  1MIU A;  4JI2 L;  2VQE L;  2ZJQ A;  4JBM A;  5IY0 A;  1MJE A;  1SLJ A;  1C0A A;  4DUY Q;  1E1T A;  1SR3 A;  1QVF A;  2UUC L;  2JA9 A;  1EQR A;  3S1N H;  2R7F A;  1YNX A;  4JCV E;  1YJW A;  2B29 A;  4GNX C;  1PH4 A;  2HHH L;  2Q2I A;  4R4Q A;  4DV0 Q;  1N32 L;  4LFB L;  4AYB G;  3F2B A;  3UDF A;  3BZC A;  3PV0 A;  1B70 B;  5M5X H;  1D8L A;  3J81 j;  1N34 Q;  1X55 A;  3KFU A;  2JA7 G;  3PO3 H;  1VQE A;  2D0O A;  1H95 A;  1RIP A;  3F8T A;  1ASY A;  2JEA I;  1XMO Q;  2CWA A;  4KLK A;  4P71 A;  2ZM6 Q;  1HZC A;  3M9B A;  2UXB L;  4DV5 L;  3I4N G;  1B8A A;  2MFI A;  3PUY A;  4BA1 I;  1MJC A;  3U4V A;  1HNZ L;  2JA7 H;  2YYZ A;  2UXC L;  1YIT A;  2Q2T A;  1K8A C;  4YHH Q;  4JI3 Q;  4DV7 Q;  4YWL A;  4BBS G;  1OXS C;  2CFM A;  1VQM A;  4A3M G;  3MEF A;  4DR3 Q;  1HZB A;  2CQO A;  2VQF Q;  1PH3 A;  4HJA A;  1KQS A;  2BH8 A;  4TVA B;  4HJ9 A;  5LMN L;  1CKN A;  2AKW B;  2EQS A;  2NN6 I;  4R4O A;  5IP9 H;  4AIM A;  1PVO A;  1JE5 A;  1IBM Q;  2R7D A;  1P16 A;  2AHO B;  4LNQ A;  4GKK L;  2EIF A;  2R6G A;  2AWN A;  5C3E H;  1Q82 C;  3KJO A;  4NXM Q;  2HT1 A;  2A19 A;  2CKZ B;  1B7Y B;  4HIM A;  3D0F A;  3M4Q A;  2MQH A;  1Q86 C;  3T1H L;  3FHW A;  3BZK A;  2KHI A;  4IFD I;  3KDF A;  1KD1 C;  5C0X G;  3GDE A;  2ZJR A;  3U4Z A;  1K83 H;  3F2D A;  4A3E G;  2ZTC A;  5GAD C;  4JI5 Q;  1E24 A;  3J7Z C;  3ER0 A;  2PI2 E;  4POF A;  4GS3 A;  1Q12 A;  1UWV A;  2VW9 A;  4R4T A;  2B3G A;  1A8V A;  1Z47 A;  3D31 A;  1S40 A;  4BY7 G;  1XPO A;  3AFP A;  2R93 G;  4B3R L;  3CCE A;  1Y1V G;  1XTD A;  2ZTD A;  3HKS A;  1J6Q A;  1WYD A;  4GNX A;  1IBL L;  2UUA Q;  4DR1 Q;  4B3S L;  3SGI A;  2MO1 A;  1IBK L;  3S1M H;  3RNU A;  4JI0 L;  4OX9 Q;  4BY7 H;  1K3R A;  4JI2 Q;  3ZJY C;  1TWG H;  2R93 H;  4YWK A;  1VQD A;  2AWO A;  2WFW A;  2PMZ E;  4YY3 L;  2VQE Q;  1XJV A;  4A3C G;  4QQB X;  1P8L A;  1NY4 A;  2K50 A;  2KCT A;  3J7A 5;  2JK8 A;  5FLX c;  3CQZ H;  4LF9 L;  2UUC Q;  4B3M L;  4DNI A;  4MNO A;  1V43 A;  5LMU L;  3H0G G;  4DV4 L;  2HHH Q;  4P74 A;  4A3L G;  1N32 Q;  4HJ8 A;  4A3F H;  1EYG A;  4L5S A;  1QUQ A;  4OON A;  5BR8 L;  4DR2 L;  1G51 A;  1X3F A;  2JQO A;  3H0G H;  3PIO A;  3HOX G;  1GO3 E;  3KYH C;  1FJG Q;  3HOU G;  1R9T H;  4JBW A;  4K0K L;  4A3L H;  2UXB Q;  2RF4 A;  4DV5 Q;  3TS0 A;  4DKA C;  4LF4 L;  4POG A;  3CPW A;  1X3E A;  1HNZ Q;  3STB C;  1YHB A;  3H3V H;  1X65 A;  2UXC Q;  3HOX H;  3HOU H;  4GKJ Q;  2XTI A;  3M4O H;  4WJ3 M;  2YTY A;  1VQN A;  2Q2H A;  5M3M G;  1Y1W H;  3TQY A;  3I4M G;  1IXR A;  5IYC G;  4DV1 L;  1K73 C;  1PH1 A;  3CC4 A;  4AH6 A;  2ASB A;  3ICE A;  1EWI A;  3Q8D A;  1UE5 A;  4DR6 L;  1VQ5 A;  2EXD A;  1XNQ Q;  5E7N A;  3PO2 G;  4A3B G;  1YHQ A;  1EUJ A;  3RZD H;  1CKN B;  3L7Z C;  5GQO A;  1A62 A;  1QZH A;  1AE3 A;  1AE2 A;  3K7A H;  3KJP A;  1N36 Q;  3S14 H;  2R7Z G;  4A3B H;  3AYH B;  2GVB A;  3CD6 A;  4JI6 L;  1VQB A;  4ALP A;  1BKB A;  4JYA L;  3BJU A;  3T1H Q;  1SE8 A;  2NZO A;  5IYB G;  2I5M X;  1GVP A;  1HZA A;  2R92 G;  3KDF B;  2A1A A;  1G6P A;  4DV2 L;  2KCM A;  1PYB A;  5JJK A;  3KF8 B;  1LTL A;  5HY6 A;  4LF6 L;  1E7Z A;  4LF7 Q;  3KF6 B;  2R92 H;  4JV5 L;  1JT8 A;  1ASZ A;  1U5K A;  1IBL Q;  2E2I H;  3HOW H;  4IOA A;  4B3S Q;  1IBK Q;  1EFW A;  5C0X I;  1W2B A;  4JI0 Q;  2WAQ E;  5DLQ E;  1JMC A;  2B63 G;  2KBN A;  4IPD A;  2E8G A;  4P75 A;  4DR5 L;  4QJF A;  4LFC L;  4NXN L;  4IPC A;  3CCU A;  3HOV H;  2WB1 E;  3EN2 A;  1Y14 B;  4LF9 Q;  1A63 A;  5M5Y H;  4B3M Q;  4KHP L;  1UEB A;  4A75 A;  5JJL A;  3PUZ A;  3PSI A;  5FLM G;  2IT1 A;  1UE1 A;  3T1Y L;  2PQA B;  3W5O A;  4DV6 L;  5M5W H;  3UDX A;  2D0P A;  3NEM A;  2F3I A;  4DR4 Q;  5BR8 Q;  4DR2 Q;  5FLM H;  1QUQ B;  4LF5 L;  3S16 H;  4K0K Q;  4GN3 B;  4UP7 A;  3M4P A;  3CW2 C;  2HIV A;  2PNH A;  4X64 L;  3S1R H;  2GN5 A;  3RLN A;  3I56 A;  1PA6 A;  1DGS A;  1LUZ A;  4TQU S;  5K36 G;  4LUO A;  1JB7 A;  3CCL A;  2IHE A;  1KC8 C;  1E3P A;  3A74 A;  3JAM c;  4IPG A;  1TXY A; 
#chains in the Genus database with same CATH topology
 5KYI A;  1XMQ L;  1NR4 A;  2F0L A;  3MXP A;  5IT9 c;  3OYY A;  5M3F G;  1BDO A;  4FF2 A;  2KED A;  1YJ9 A;  2ICE C;  2FIN B;  1I4R A;  5D3D A;  2J7Z A;  1KAW A;  5IOD A;  2Q8I B;  4XIG S;  3BYY B;  4KJN A;  4JI1 L;  1BCP B;  2EY2 A;  4A3I G;  2K1B A;  2K7V A;  3V05 A;  1G8Z D;  2K5H A;  2J0T D;  1Q8K A;  1V8Q A;  1PFN A;  4K5W A;  2Z0S A;  1NCV A;  4LFA L;  1OXV A;  4PZ8 A;  2A6H D;  4K8J A;  4A3E H;  3TZD A;  1AEX A;  5CV6 A;  4K6D A;  3K5L A;  1K28 A;  4S3S A;  4TSS A;  2RA4 A;  2WB1 G;  5IWA L;  3UDI A;  1EY5 A;  1LTR D;  4DV3 L;  1HZ9 A;  1Y1V H;  1EL0 A;  4DXG A;  2DY7 A;  3A5Z B;  4IUQ A;  1JOO A;  1X3G A;  2K28 A;  4ZKC B;  2CWP A;  4WRD A;  2Z9H A;  1SFO H;  3T1Y Q;  3CF5 A;  1YI2 A;  1B9N A;  4C3H G;  1S72 A;  3S1Q B;  5KIX A;  4LF5 Q;  2Z4I A;  3GTO H;  1D2B A;  1HNX L;  1JWU D;  1IL2 A;  1K3B C;  3R3O A;  1NE3 A;  1S5B D;  4R4I A;  5LHY 1;  3C2P A;  4A93 G;  4DR7 L;  3FDT A;  4FXG C;  3S2D H;  2ALY B;  2EZV A;  2HQE A;  4IJH A;  3GTJ H;  1VQI A;  5FO7 B;  5LMN Q;  1HUN A;  2EYJ A;  5M3M H;  3LGJ A;  3I4M H;  4A3K G;  3K0Y A;  1CFM A;  1EQQ A;  4GKK Q;  1CK1 A;  1JOK A;  2E5L Q;  2NBF A;  4PZ6 A;  2RHS B;  3PO2 H;  3HOZ G;  4IOC A;  2F4I A;  1LO5 D;  1QVC A;  4JW0 A;  1HFG A;  3N52 A;  2JA5 G;  1EU3 A;  1PFS A;  2Q8R E;  4C3I H;  1L1O B;  3OMC A;  3S1R B;  1A0I A;  5IYB H;  3LWE A;  3CRK C;  5CR3 A;  3W3A A;  2JP1 A;  4GLX A;  4X62 Q;  2RHQ B;  5I4D A;  1VF5 C;  3PCO B;  5EPL A;  4YY3 Q;  3MFY A;  5IGC A;  2GVA A;  2C35 B;  4RMF A;  4IPH A;  1AZP A;  4K5X A;  2B63 H;  5M3F B;  3I2Z A;  4OO1 I;  2E75 C;  3S24 A;  1VF7 A;  1AZQ A;  3M3Y H;  3ULP A;  1BBU A;  1ESF A;  2FMM A;  1SMY D;  2PZW A;  4QUC A;  4FF1 A;  4A3I B;  2WKC A;  4OX9 L;  2EYP A;  3UE1 A;  1GM5 A;  3F2C A;  1K0R A;  1UE6 A;  3MHB A;  4MHE A;  2F03 A;  2NWG A;  3P7J A;  1XTC D;  4CDF C;  3PIO 3;  3OW7 A;  4ZK9 B;  3PO3 G;  1CA5 A;  5C4Z A;  5ELO A;  2O4X A;  5I2Y A;  5ELN A;  3GTP H;  1NJI C;  1S5C D;  2WII B;  1VQ6 A;  1EIH A;  1PZJ D;  1PV4 A;  3U50 C;  1L0Y B;  2OT2 A;  2WB1 B;  3VR6 A;  1HTL D;  1ZXT A;  3IRB A;  4K2K A;  1X54 A;  5IP9 G;  3S15 B;  1IYJ B;  3WDN A;  2RCF A;  3K5O A;  1L1O A;  3PF4 A;  2YV5 A;  4DV2 Q;  1XWE A;  1MHW C;  1CZG A;  1JJ2 A;  2JA8 B;  3WOF A;  2Z6K A;  4NP5 A;  4C3H B;  1BCP D;  1Q81 C;  2SOB A;  5IGE A;  4JV5 Q;  1RL2 A;  2QIL A;  5CV4 A;  2DY8 A;  4HAE A;  2VUM H;  2LSS A;  4FF3 A;  5C0X J;  1SDF A;  1K9M C;  4A3G B;  2A6H C;  3ERS X;  3EQL C;  1PH5 A;  4GLA C;  1I5F A;  5KNB A;  1B1Z A;  1BXT A;  1I50 H;  4CJ1 B;  4UAI A;  4RGO S;  5AFW A;  1M90 C;  1C4Q A;  2CH4 W;  3J7Y W;  1DOM A;  2F0Q A;  3HOZ B;  4IUR A;  2N78 A;  2NVQ H;  2OTJ A;  2SEB D;  4KHZ A;  5JEA G;  4AQY Q;  2ZJP A;  4JI4 Q;  1ENC A;  4BWG B;  3I73 A;  4ID6 A;  1BO0 A;  1EEF D;  4A3F G;  2JA5 B;  3IFT A;  3NBH B;  3T53 B;  3CCQ A;  1B3Q A;  1X6O A;  3UI2 A;  4A3J H;  2K75 A;  1BBW A;  2BOS A;  5C4J H;  3OSO A;  4YWM A;  2IY5 B;  1AH9 A;  4RCO A;  1ICF B;  1I3Q H;  1SNO A;  2NN6 G;  4X3S A;  5C3W A;  1XMO L;  4JPB W;  2OCE A;  3R2T A;  1WCM B;  1K8G A;  3A8J E;  2I0Q A;  4DV7 L;  3IL8 A;  1EQV A;  4BBR G;  4DR3 L;  5F2D A;  2V1C C;  4F7X A;  3GTL H;  4BY1 G;  4DA2 A;  5AJ3 Q;  4KN7 C;  4CDC C;  3GTQ B;  3FPP A;  3S1N B;  3L3O C;  3EJI A;  1LTT D;  1VDZ A;  1Q1E A;  1ET9 A;  1GUT A;  2WAC A;  4CDE C;  4DGZ A;  1WTQ A;  4NPS A;  3PO3 B;  3CCJ A;  4KHV A;  5I6Y A;  5G3L F;  1FGB D;  1DCZ A;  2ZXO A;  2NTS A;  3HOW G;  2BDN A;  1X3Q A;  4KY6 A;  2KJX A;  3SK6 A;  3E9H A;  3W2D A;  4ULL A;  4DUZ Q;  1VQA A;  2QKI C;  2K5Q A;  1W3S A;  3HOV G;  1DD2 A;  1EU4 A;  4OGQ C;  2VQE L;  1SLJ A;  3DMU A;  5TSS A;  1C0A A;  1SR3 A;  2H4O A;  1E0B A;  2R7F A;  1JIC A;  1PH4 A;  2B29 A;  4GNX C;  2HHH L;  2B2Y C;  1D5M C;  1SMY C;  3BZC A;  1D8L A;  2F0P A;  1ASY A;  2JEA I;  2UXB L;  3NPP A;  4P71 A;  2ZM6 Q;  4WOR A;  1B8A A;  2MFI A;  5HGT A;  1MJC A;  4YIJ A;  3U4V A;  2JA7 H;  2UXC L;  2KQ3 A;  1RTO A;  1JOR A;  2CFM A;  1ML0 D;  1ZKO A;  1RD9 D;  5LMN L;  2EQS A;  4AIM A;  2R93 B;  1IBM Q;  2R7D A;  3VA7 A;  4GKK L;  4V0B A;  2EIF A;  1O78 A;  2AWN A;  4NXM Q;  2HT1 A;  1IKL A;  1B7Y B;  1U4P A;  3M4Q A;  2MQH A;  4J1M A;  4DK1 A;  4A3F B;  1IL8 A;  5M9O A;  4A3E G;  3DM1 A;  4JI5 Q;  3V2T A;  1BCP C;  3J7Z C;  1FD7 D;  1SJE D;  3ER0 A;  1ESR A;  2I07 B;  4GS3 A;  4POF A;  2KEC A;  2B3G A;  4KJO A;  2G9D A;  1UEA B;  2MUY A;  1BBX C;  4Z9C B;  1FR3 A;  1Y1V G;  2VXW A;  5KND A;  4DR1 Q;  1PTO B;  4UDU C;  3ONA B;  4IUT A;  1VQD A;  4YY3 L;  1XJV A;  5JPN C;  3J7A 5;  4IUP A;  2UUC Q;  4RHR A;  5FO9 B;  3S14 B;  4N8F A;  4P74 A;  1N32 Q;  3L9A X;  4H13 C;  3E6Z X;  4M8A A;  5EKL A;  1QUQ A;  1SE2 A;  5BR8 L;  1G51 A;  3HOX G;  3HOU G;  4A3L H;  5CBE E;  2F0D A;  2SNS A;  1S5F D;  3QO2 A;  2JXM B;  1YHB A;  2PW5 A;  3OWF A;  4GKJ Q;  1EYD A;  2YTY A;  5M3M G;  1I4X A;  1F2Z A;  1IXR A;  3OHX C;  4DV1 L;  3CC4 A;  2ASB A;  3I4M G;  3HOW B;  1Q8I A;  2L1B A;  2EXD A;  3PO2 G;  5E7N A;  4KKU A;  1EUJ A;  4DU9 A;  2PZT A;  1YHQ A;  1NR2 A;  2PMZ B;  2KCC A;  1H9J A;  3HOV B;  3KJP A;  5M5Y B;  4A3B H;  2F0W A;  3AYH B;  1VQB A;  2GA4 B;  1BKB A;  4C3I G;  3BJU A;  5A35 A;  5M5X B;  5IYB G;  2R92 G;  3KDF B;  3U9S A;  4DV2 L;  5EKI A;  3J80 L;  3QG1 A;  3VYR A;  4JV5 L;  1Z6H A;  4RFB A;  1F77 A;  1IBL Q;  4ODG A;  4B3S Q;  1HTP A;  5DLQ E;  3KK7 A;  1JOQ A;  2B63 G;  4C1N K;  4IPD A;  1STN A;  2E8G A;  4DR5 L;  4NXN L;  2OXP A;  4IPC A;  3CCU A;  2K33 A;  1Y14 B;  3TSS A;  4LF9 Q;  4B3M Q;  1SJH D;  4OHJ A;  5COR A;  4DV6 L;  3NEM A;  5A2Q L;  3S16 H;  4K0K Q;  2B2V C;  4UP7 A;  1PA6 A;  2P5Z X;  1DGS A;  2RDH A;  3H09 A;  1KC8 C;  1E3P A;  3LX0 A;  4V19 0;  3HS0 C;  4IPG A;  4A3E B;  1TXY A;  1EZ8 A;  4MZ9 A;  3LNN A;  3AEV A;  5D14 A;  2B2T A;  4PZ7 A;  4DR6 Q;  2WAQ B;  3M7G A;  5J3B A;  5CMD A;  4A3M H;  5FJ8 H;  1Y1V B;  2JN4 A;  3KLS A;  2DN8 A;  4OWX B;  3E3X A;  3KBX A;  4JI6 Q;  4OEM B;  2NVY H;  2EYH A;  3HFZ B;  4DK3 C;  5KRU A;  1LV9 A;  1EY4 A;  1R9T B;  1B44 D;  4DN4 M;  4EQP A;  3GTO B;  1C8C A;  2PYK A;  4LF6 Q;  3I55 A;  3Q22 A;  1SNP A;  4IJL A;  3MAQ A;  1KNE A;  4G4K A;  3HOU B;  4WJW A;  4H02 A;  1CM9 A;  3EVQ A;  3S2D B;  4CKE A;  5DAU A;  4OO1 H;  3GTJ B;  2A69 D;  5M3M B;  2EY6 A;  3J7A F;  3PGZ A;  4IZ8 A;  3I4M B;  4ME5 A;  1TS5 A;  1G91 A;  3MA2 B;  2A8V A;  3K7A B;  2Q8T A;  4A3C H;  2AMC B;  3PO2 B;  1SMX A;  1MD2 D;  1SRU A;  1PTO D;  4L5Q A;  4CJ2 C;  4LUV A;  2N88 A;  2YU9 H;  2H5X A;  3CKI B;  4MTN A;  1GUS A;  3RZO H;  2JE6 I;  1D7Q A;  1VS0 A;  3MFG A;  4C3I B;  2H1E A;  3SDZ A;  1DZ1 A;  3Q23 A;  3S17 H;  1EEI D;  1V9P A;  2R92 B;  4JOI A;  1YVC A;  2PPB C;  3MXN B;  4A4I A;  1KDC A;  4I65 A;  1AP0 A;  3MWY W;  2RCN A;  4L5R C;  1F2L A;  1YEZ A;  1VQG A;  1BCP F;  1QZG A;  2B63 B;  1TWH H;  3RN2 A;  3O13 A;  2EY5 A;  2QCP X;  1D1K A;  2KEE A;  2B39 A;  4YCU A;  2ZXP A;  3ULJ A;  3OW2 A;  3RLO A;  1FVI A;  3M3Y B;  2ES2 A;  5DEH A;  3R2I A;  5J39 A;  3MXU A;  1BUV T;  5EBC A;  3GO5 A;  1KIX A;  1HR0 L;  1I94 L;  4Y52 H;  1TKW B;  3BG3 A;  3NEL A;  1D5X C;  5EPJ A;  4JI8 L;  3BDC A;  4NXM L;  1Q46 A;  4JVZ A;  1Y8P B;  2IWH A;  3RD4 A;  5BN3 A;  4G57 A;  1HFN A;  1SYD A;  5FOB B;  5IYD G;  1WI5 A;  1EIF A;  3V96 A;  5H1S E;  5E4X A;  1X32 A;  3GTP B;  1TWF H;  1QIL A;  2RQX A;  5ELB A;  2KEN A;  1EOV A;  1PRT B;  1U0L A;  1N9W A;  2C5C A;  1EIG A;  5I2X A;  2E2H H;  5FO8 B;  2X6G A;  3K5N A;  4X3K A;  4MIU A;  3MTS A;  3K81 C;  4LF4 Q;  1WOC A;  3R93 A;  1CHQ D;  1O7Y A;  3A56 A;  3OWE B;  3QIA A;  1HNW L;  3TP6 A;  2QW7 A;  1EWH A;  4FP5 D;  5IOC A;  3A0J A;  4A3D G;  2O5J C;  1SE4 A;  3URY A;  1VQF A;  2F3V A;  2VUM B;  2IX1 A;  4HN7 A;  3OTO Q;  3TZU A;  3FKI H;  1FGU A;  2L4N A;  1PYS B;  4G7Z C;  4P73 A;  2UXD Q;  1RTN A;  2K14 A;  1GXD C;  3CMA A;  4X65 Q;  4GOP B;  1JCK B;  2F0U A;  4O1N A;  1F2Y A;  5CGK A;  4JYA Q;  2JA6 H;  3GTK H;  1YBY A;  4OIJ A;  4GKJ L;  4CKB A;  1PHJ A;  1U4R A;  1I50 B;  3GV3 A;  3A54 A;  1DM0 B;  4UPA A;  3ZYY X;  4Y7N B;  3I7F A;  2NVQ B;  3SK5 A;  4X66 Q;  4LF8 L;  1HRJ A;  3JC6 6;  4PNY A;  1CKM A;  2X69 A;  3HOY H;  1TWA B;  3U9O A;  3CRL C;  4C3J G;  1BR9 A;  3I90 A;  4A3J B;  4RCN A;  2O5I C;  3ERQ A;  1ILP A;  4GZY C;  3AFQ A;  4ZLT F;  4LFC Q;  4TRD A;  1I6H B;  5ELD A;  1I3Q B;  4JG2 A;  2A5H A;  4KHP Q;  3FEW X;  1XX8 A;  3OMG A;  2D62 A;  1KLG D;  5CV5 A;  2JA8 G;  1QG7 A;  3RR5 A;  2YTV A;  3I8Z A;  2ZTE A;  4EQ5 A;  1STE A;  2G9H D;  1B50 A;  1YZ6 A;  1PFM A;  3GTL B;  2DGY A;  1A3U A;  2B2U C;  2NB0 A;  1LT3 D;  1K8O A;  1YJN A;  1V1Q A;  3VR3 A;  4JI7 Q;  4A3G G;  1PTO C;  2BH2 A;  2LXK A;  1XPR A;  2G5D A;  1JB3 A;  1DYQ A;  3TS2 A;  3S2H B;  1YHA A;  4DAY B;  1K8M A;  2KVM A;  4AYB E;  4GOP A;  3T4A C;  1EFI D;  1XNR Q;  1Q7Y C;  3CAM A;  1N33 Q;  5C4X H;  4PG3 A;  5FLX L;  1BVS A;  5C44 H;  2NVX H;  1L0W A;  4IFD G;  2RDF A;  2WKD A;  4K2L A;  2UU9 Q;  4UP8 A;  1O7Z A;  4K6L A;  4O2D A;  1RJT A;  2RDG A;  3DWA A;  2XGT A;  5IE8 A;  5BN5 A;  3NWS A;  1EYC A;  1WTO A;  1NBW A;  1STH A;  1WCM G;  1LTB D;  2FHT A;  3GV6 A;  1J5E Q;  4H7B A;  2RSN A;  1TII D;  3W1G A;  4A3D B;  4WJ4 A;  2EVB A;  4R1J A;  2K52 A;  3K57 A;  4N9P A;  4J8Q A;  2MNA A;  2D9U A;  2OF1 A;  2MHV A;  3GTG H;  1LT5 D;  3J80 E;  4FVM A;  4JI2 L;  4MTK A;  2L0C A;  4KY5 A;  4JBM A;  3SK4 A;  5IY0 A;  2EOT A;  1F2M A;  1PRT D;  2C9O A;  4DUY Q;  1E1T A;  1QVF A;  2NVT B;  1BOS A;  3OOC A;  1EQR A;  1YNX A;  4JCV E;  1YJW A;  2Q2I A;  4DV0 Q;  4AYB G;  1F9Q A;  3PV0 A;  3G7L A;  1B70 B;  2KA7 A;  4DAY A;  3KFU A;  3TP8 A;  1RIP A;  3F8T A;  4C3J B;  4KLK A;  1HZC A;  3PUY A;  3PQI A;  5LL6 S;  1HNZ L;  2EPB A;  2F0V A;  2Q2T A;  2A74 C;  5A2Q E;  5LL6 X;  4YHH Q;  1STB A;  4YWL A;  5NUC A;  3I4L A;  5E1F A;  1CTM A;  4A3M G;  2A68 D;  3MEF A;  2NTT A;  3HP3 A;  2VQF Q;  4TVA B;  4HJ9 A;  2M9V A;  1Y8N B;  1CKN A;  2NN6 I;  4B9W A;  4LNQ A;  3AU7 A;  2R6G A;  1PZK D;  4BS9 A;  3KJO A;  3BDO A;  5C6A A;  3QOJ A;  5EBD A;  3EFX D;  4HIM A;  3AMU A;  4UHV A;  5COY A;  3T1H L;  3FHW A;  3QOL A;  2ZJR A;  3U4Z A;  5I9P A;  1EY8 A;  3K6O A;  1Q12 A;  1WTP A;  2VW9 A;  4R4T A;  1A8V A;  1Z47 A;  4FNF A;  1G6Z A;  1KAB A;  2DNC A;  3AFP A;  2R93 G;  3BZD B;  1EOT A;  1J6Q A;  2UUA Q;  1IBK L;  3S1M H;  4BY7 H;  3TP7 A;  1U9R A;  3MVV A;  2NZ1 D;  3NTI A;  2AWO A;  1H9R A;  2PCF B;  2PMZ E;  3MZ5 A;  5KGU A;  1WTX A;  1P8L A;  4ABN A;  2K50 A;  1SYE A;  2KCT A;  1CA6 A;  1K0S A;  4MNO A;  2NUC A;  2F1M A;  1M8A A;  4A3B B;  4L5S A;  4PMB A;  3ND9 A;  4XT3 B;  2E76 C;  3H0G H;  1FJG Q;  3PIO A;  3KYH C;  4KY7 A;  3NSW A;  4JK1 C;  4DV5 Q;  3TS0 A;  4DKA C;  4LF4 L;  1X3E A;  3M4O H;  2Q2H A;  1W6K A;  1PLF A;  3QB3 A;  1C48 A;  1K73 C;  1PH1 A;  4AH6 A;  3Q8D A;  5JOB A;  1SYG A;  1XNQ Q;  4IUN A;  3OIQ A;  2E2D C;  3L7Z C;  2SDF A;  5GQO A;  2CQA A;  1A62 A;  1AE3 A;  2WIN B;  1N36 Q;  3VR2 A;  2ENB A;  3CD6 A;  4HTH A;  4JYA L;  4G7O C;  5I9O A;  1EY7 A;  1SE8 A;  2NZO A;  1HZA A;  1DOL A;  3IKJ A;  4IUU A;  1G6P A;  1PYB A;  4AYB B;  1A3V A;  1RDP D;  3X3M A;  3KF6 B;  4NW2 A;  2EYO A;  1QE6 A;  5KNC A;  1V1P B;  2E2I H;  1PTO F;  3D4R A;  4KD4 A;  1EFW A;  4FXD A;  1W2B A;  4JI0 Q;  2WAQ E;  5KYL A;  3HZX A;  4LFC L;  4A3M B;  1A63 A;  1QNK A;  3FPU B;  4KHP L;  1YNN D;  5JJL A;  3PUZ A;  3PSI A;  4X3U A;  3T1Y L;  4ZAI A;  3W5O A;  3OPO A;  3UDX A;  1HUM A;  1SNC A;  2D0P A;  4RGT A;  2F3I A;  4DR2 Q;  4HSV A;  5FLM H;  1QUQ B;  4LF5 L;  1PRT C;  2K04 A;  5D3I B;  1TQO A;  3DEP A;  2IW3 A;  2GN5 A;  1STA A;  5L37 A;  3S1R H;  4TQU S;  3TN2 A;  4P2C B;  3A74 A;  2RBM A;  2EYL A;  4KKS A;  4RHS A;  4C2M H;  2VZA A;  1KAA A;  4R8I A;  5IGD A;  1TWG B;  1LM0 A;  1VMC A;  4OXP A;  1OXT A;  2E5L L;  4KKT A;  1IW7 D;  2CVR A;  4DPG A;  4BA2 I;  4KK7 A;  3KLW A;  3PUV A;  4U67 3;  1CHP D;  3PIP 3;  2B2W C;  1WJJ A;  5LMN W;  3WWV A;  2F4V Q;  4IO9 A;  4A3I H;  4NB3 A;  2YU9 B;  3J81 L;  2JSO A;  1OTC A;  2HQL A;  3CXC A;  3H15 A;  3KF6 A;  3NP8 A;  2BE5 D;  3RZO B;  1E2W A;  3A8K E;  3FVQ A;  4I7A A;  5C0X H;  1LYL A;  2O2L D;  4QL5 A;  2WAQ G;  1V1P A;  1QWY A;  3TRE A;  1SEB D;  5JJI A;  4X62 L;  3FMC A;  4EGV A;  1PH2 A;  3CC7 A;  1EY6 A;  3RZD B;  1SNM A;  2XWB B;  3KOJ A;  2XN9 C;  1JE4 A;  4DNT B;  1TWH B;  5EKK A;  4XQJ A;  2F0O A;  4RWS C;  5C3X A;  3ULL A;  1W6J A;  1WD0 A;  1IYU A;  2CCZ A;  1FL0 A;  1ONL A;  4H0L C;  3D6C A;  4KMU C;  5JEA J;  5GAG C;  4HJ7 A;  3KUP A;  4JBJ A;  5GAE C;  1C7Y A;  1YIJ A;  4ME3 A;  4C3H H;  4DUY L;  5E3F A;  3KLS X;  5ELE A;  5FKA C;  1G29 1;  1XMQ Q;  1A15 A;  4DV0 L;  1B9M A;  3WOE A;  4P72 A;  1EWC A;  5KEE A;  3J80 c;  4OWW B;  1SRO A;  2Y0S E;  4A93 H;  4HSP A;  4ZRZ A;  5IYC H;  4UY8 C;  3R8B A;  1SYC A;  1TWF B;  4C56 C;  4KTA A;  2I46 A;  2CW0 D;  5C4X G;  2MJ8 A;  3P75 A;  2LMC B;  5C44 G;  4EVO A;  4A3K H;  2ATW A;  1OO9 B;  4YHH L;  1N8R C;  5M5W B;  4LFA Q;  2R7Z H;  1M4V A;  3TEH B;  1S3O A;  4APV A;  2VQF L;  4GN4 B;  1AN8 A;  1TY0 A;  2MO0 A;  4J6H A;  3L0O A;  2FXQ A;  3K80 C;  2K01 A;  3DM3 A;  1TVX A;  1M1K C;  5FLX E;  4L6T B;  1Q3L A;  5HGQ A;  2JA5 H;  4K5V A;  1I4P A;  1WFQ A;  4B3R Q;  4HCE A;  1SAP A;  1L1O C;  1AW7 A;  1DXM A;  4JC0 A;  3NTH A;  4DV3 Q;  1SN8 A;  2B8G A;  2Z6K C;  2MPM A;  1V1O A;  3NQI A;  3G6E A;  1PZI D;  1CSP A;  1H9S A;  4A76 A;  3FKI B;  2K5V A;  4DV4 Q;  3K0X A;  4DK0 A;  1MSH A;  3NK9 A;  1QNU A;  1Z7T A;  2NZH A;  2JA6 B;  3GTK B;  1SXT A;  1JC7 A;  4LK1 C;  3T16 A;  3D6W A;  5HUR A;  4AQY L;  4JI4 L;  1YNN C;  1HNX Q;  3L2P A;  4N9T A;  1BQQ T;  2JJQ A;  3GTQ H;  2EDG A;  2Y0S G;  1GKH A;  5K36 H;  1JJC B;  1MSG A;  4DR7 Q;  2NYZ D;  1SYF A;  2F0M A;  1FJG L;  2I5H A;  1A3T A;  1ENF A;  3M85 A;  2HCI A;  3AB9 A;  5GRO A;  5J1Z A;  3J80 i;  3I70 A;  4CKC A;  1XPU A;  1SFO B;  1YNJ D;  2F0H A;  2L12 A;  4YCW A;  2LY7 A;  1JJG A;  3RN5 A;  2VNU D;  4HIK A;  2F52 A;  1NMG A;  3G48 A;  5AJ3 L;  1XNQ L;  1IW7 C;  4QUF A;  2VUM G;  3BS1 A;  2KCN A;  3CCM A;  1UE7 A;  1NUC A;  2ICI A;  1N36 L;  1E2V A;  2K5N A;  3UE0 A;  1WTV A;  3SXH A;  2IPK D;  4DAM A;  1CKO A;  1CUK A;  3CC2 A;  1MGS A;  1B2T A;  3BVM A;  3S9W A;  1VQ4 A;  2BE5 C;  2F0E A;  2AUJ D;  1DJR D;  3CPF A;  2AQ1 B;  3NTK A;  2LFN A;  1PRT F;  1TWC H;  1NMF A;  3E9I A;  4QIW E;  4LW1 A;  3GTM H;  3PUW A;  1B3A A;  2LXJ A;  3NHH A;  4DUZ L;  5C4X B;  4NMZ A;  3B6Y A;  4RKB A;  5C44 B;  2N8N A;  2NVX B;  1TS2 A;  3X3N A;  3CCS A;  1VQ7 A;  1II3 A;  2K6A A;  4X64 Q;  2L15 A;  4A3J G;  1O7I A;  5C4H A;  4HMJ A;  4CBV A;  3NEN A;  1UNS A;  3STB D;  2ZXR A;  1PH8 A;  1ROD A;  2KHS A;  3K7U C;  1PDQ A;  3VDY A;  1OXX K;  1JQY D;  2VL6 A;  2PZU A;  2R3Z A;  4QB4 A;  4XTC S;  2ZM6 L;  2R61 A;  1FNW A;  5EPK A;  4KV6 A;  1WTW A;  1HJP A;  4GN5 A;  3D4W A;  3KLR A;  4RA8 A;  2SNM A;  2MGS A;  1O80 A;  2EYM A;  2NN6 H;  2QEJ C;  2F0N A;  4B3T Q;  3I4O A;  1U4L A;  3GTG B;  1HA5 A;  2EE1 A;  2HCC A;  2D2C C;  3MC0 B;  4BXX H;  1MBY A;  3K59 A;  1IZ6 A;  1PH6 A;  3D3R A;  3H6M A;  3NXW A;  4BBR H;  1IBM L;  1VQL A;  3GP7 A;  5JJZ A;  1HH2 P;  4BY1 H;  1PH9 A;  3G71 A;  3QR8 A;  3RUZ A;  4I7Z C;  3H91 A;  1HR0 W;  5EAY A;  1FNV A;  3DWP A;  2F4V L;  3DLL A;  2Y0S B;  3CCV A;  4JI5 L;  1GOZ A;  3GQB A;  3Q24 A;  3HEJ A;  3M7N A;  1KHI A;  4ZYS A;  2A73 B;  4DR1 L;  1KDA A;  1KNA A;  4GNX B;  2YTX A;  4Q5V A;  3E0E A;  5IP7 H;  1TR5 A;  4U68 A;  2ZJQ A;  1MJE A;  2UUC L;  4WFN 3;  3TP5 A;  2F0S A;  4FF4 A;  5E4W C;  2QDB A;  1N32 L;  4ILW A;  3DXJ C;  5M5X H;  3J81 j;  1N34 Q;  1X55 A;  2JA7 G;  1EQT A;  1GUG A;  1XMO Q;  1CQV A;  2F0J A;  1QB5 D;  1GHK A;  1MI2 A;  1YIT A;  1SNQ A;  4DV7 Q;  4JI3 Q;  1OXS C;  4DR3 Q;  1HXY D;  1PH3 A;  3P20 A;  2FMC A;  4HJA A;  1KQS A;  1ET6 A;  3S1M B;  4B9X A;  4BY7 B;  2AKW B;  3A8I E;  1JE5 A;  3M4Y A;  2F0K A;  2AHO B;  4NKL A;  1YNJ C;  5C3E H;  3A55 A;  1Q82 C;  4HR7 B;  2A19 A;  3Q6S A;  1SND A;  3D0F A;  1Q86 C;  5C5M A;  4N8X 1;  2KHI A;  5C4J B;  4IFD I;  5C0X G;  1D5Z C;  1K83 H;  3H0G B;  1E24 A;  1CZW A;  3KF8 A;  2PI2 E;  5IT9 L;  1G2T A;  1LAB A;  1UWV A;  1DOK A;  3VYU A;  2E74 C;  3QJY A;  4B3R L;  3M4O B;  3J81 E;  4GNX A;  1IBL L;  2DJF C;  2B2Y A;  2A69 C;  3SGI A;  2MO1 A;  4B3S L;  2DJG C;  3E0J A;  4CJ0 B;  4XQN A;  3ZJY C;  4XXE A;  2WFW A;  2VQE Q;  3H3V C;  1GUO A;  2JK8 A;  5FLX c;  3CQZ H;  4LF9 L;  4B3M L;  1RKN A;  1PMR A;  1V43 A;  2MP1 A;  4OL7 A;  4DV4 L;  3TDQ A;  2HHH Q;  1GUN A;  1S5D D;  1TU2 B;  4A3L G;  3VYT A;  3FRP B;  4HJ8 A;  3MXG A;  3HG9 A;  4G7H C;  4OON A;  1X3F A;  2JQO A;  4K0K L;  1GO3 E;  2IL8 A;  1R9T H;  4M1U B;  2UXB Q;  2RSO A;  1Y69 U;  2RF4 A;  5CV9 A;  3I91 A;  3CPW A;  2DNE A;  2A6E D;  3STB C;  4QIW B;  1X65 A;  2UXC Q;  3HOX H;  3HOU H;  2XTI A;  1NNX A;  1Y1W H;  5IYC G;  3ICE A;  1EWI A;  2E2I B;  3HGB A;  1LT6 D;  3NWT A;  4DR6 L;  1VQ5 A;  2B2W A;  3NQT A;  4A3B G;  2Z6B A;  1CKN B;  1I4Q A;  4Q0F A;  1QZH A;  2K5D A;  1PYW D;  4FO2 A;  3K7A H;  4RGN A;  2R7Z G;  4JI6 L;  2B2T C;  3EA6 A;  1PXU A;  2I5M X;  4KD3 A;  2A1A A;  4XYO A;  2KCM A;  5JJK A;  4OEL B;  3VR5 A;  4LF6 L;  4LF7 Q;  2JA7 B;  2R92 H;  3H94 A;  4EQN A;  3CHB D;  1ASZ A;  4IOA A;  4EQO A;  1KTK A;  4C2M B;  2KBN A;  4P75 A;  2N55 A;  4QJF A;  3C1E A;  4DXF A;  2QF7 A;  3EN2 A;  4A75 A;  2IT1 A;  1UE1 A;  2PQA B;  4XQQ A;  1J8I A;  4DR4 Q;  5BR8 Q;  4ZQ3 A;  3TME A;  4GN3 B;  3M4P A;  3CW2 C;  2HIV A;  1SE3 A;  4X64 L;  3I56 A;  3BDL A;  5K36 G;  2K03 A;  4LUO A;  3CCL A;  2IHE A;  1EZ6 A;  2PW7 A;  3JAM c;  3I4N H;  2IHF A;  5FJ8 G;  4DV1 Q;  4JBK A;  1KRT A;  3H3V I;  1DON A;  4BBS H;  1ZEQ X;  5DM7 3;  2QGQ A;  3VA5 A;  1VQ9 A;  2Z1C A;  1HQR D;  4JOI C;  3W1B A;  3VR4 A;  1WD1 A;  1VQC A;  2E2J H;  4HED A;  1Z9F A;  2CH4 A;  1A2T A;  3DWQ A;  4DAV A;  3JAM L;  2QEX A;  4B3T L;  4YCV A;  3CME A;  3I3C A;  4HJ5 A;  5C5L A;  3CP0 A;  2KUM A;  2UUB Q;  3TRZ A;  2L55 A;  1Q90 A;  1JR0 D;  1CQF A;  2F3W A;  4PMW A;  1F9R A;  4OO1 G;  3QWN A;  1HPC A;  4CHT B;  2K4K A;  1X9N A;  1UUP A;  3FP9 A;  4C1N I;  1LTG D;  4DR5 Q;  5DNF A;  5JPM C;  4NXN Q;  2B2V A;  4A93 B;  5GAH C;  2XRQ D;  4FXK C;  1CSQ A;  2PQA A;  1KLU D;  4LFB Q;  1KXL A;  4DV6 Q;  4A3K B;  2JYO A;  3C3L A;  2BA1 A;  2OWO A;  2XSC A;  2R7Z B;  4Y7N H;  2ZT9 C;  1F9P A;  2X6L A;  1TWA H;  5CYU A;  1SBB B;  5ISR A;  5ELC A;  3ND8 A;  4F88 A;  4ZKB B;  3A7A B;  4HID A;  1QCB D;  1H9K A;  1T9H A;  3IFD A;  3A5U A;  1N34 L;  2HUG A;  3JAM i;  1MKH A;  3OTO L;  1I6H H;  4UP9 A;  2A6E C;  2OQ0 A;  4ZUI A;  2KHJ A;  2UXD L;  1KL9 A;  1X3P A;  5CBA E;  4X65 L;  4K14 A;  1C9O A;  2IX3 A;  1VQJ A;  4BXX G;  2XRS D;  3EIV A;  4JI3 L;  4IFD J;  4QCL A;  5JAV A;  3S1Q H;  2F0G A;  4B08 A;  3S16 B;  2OQK A;  4FDB A;  1XYI A;  4IAL A;  4X66 L;  1L2F A;  4QY7 A;  5JVH 3;  1ENA A;  3PF5 A;  2VB3 X;  2EJF C;  3PUX A;  1IYV A;  3HKZ E;  4O42 A;  1HQM C;  3S2H H;  3SHL A;  1WVL A;  3C46 A;  2AQ2 B;  1F9S A;  2CHB D;  5IYD H;  4ZUJ A;  4X6A H;  2F0F A;  2B8F A;  2VS1 A;  5LMU Q;  3F1Z A;  3I72 A;  1EY9 A;  3DEO A;  1Y8O B;  5IP7 G;  1Q1B A;  3J7A V;  2NVY B;  2N3S A;  1QJO A;  2JEB I;  2PI2 A;  4EX5 A;  2BCO A;  1R4Q B;  2Z8L A;  2VY3 A;  5I6W A;  2OEO A;  1ZYR D;  3CU7 A;  3NBH A;  4XDX A;  2KOL A;  3DHQ A;  1VQP A;  2Q2U A;  4JI7 L;  3BU2 A;  5CV8 A;  4MN3 A;  1EIY B;  3J81 c;  4RKL A;  2F0T A;  3FKI G;  1TS3 A;  3E5S A;  3KBG A;  1RCV D;  4X3T A;  1X56 A;  2XNA C;  3T51 B;  2JA6 G;  4A3D H;  3NBI A;  1QOH A;  2K5W A;  4LWC A;  2HDM A;  5M3F H;  1SSO A;  1XNR L;  2EJG C;  1VQO A;  1VMP A;  2ID0 A;  1TWC B;  1BF4 A;  2A68 C;  1N33 L;  4HCS A;  3LWU A;  3GTM B;  1SYB A;  2HD3 A;  4DK6 C;  3IAY A;  3HOY G;  1WTH A;  4GOP C;  4KN4 C;  1HR0 Q;  5C3E G;  1I94 Q;  2UU9 L;  2NVT H;  4RAU C;  5BN4 A;  3RLF A;  2L9H A;  3GD7 A;  4QF4 A;  2WV6 D;  3HKZ G;  1CI3 M;  3SVM A;  3S17 B;  4JI8 Q;  2QA4 A;  3G4S A;  1E22 A;  4GLV B;  1GHJ A;  3EBE A;  2HDL A;  3VYS A;  1G2S A;  1LAC A;  3P1H A;  5IGB A;  1J5E L;  4C3J H;  2WP8 J;  2N49 A;  3AQQ A;  1H9S B;  2XIW A;  4LF7 L;  2FFK B;  3K8A A;  1H9M A;  1QVG A;  3S15 H;  4LUZ A;  3SR1 A;  2PQE A;  2I5L X;  5T1I A;  5IT9 E;  2AUK A;  3A7L A;  2JA8 H;  3D8G A;  2HIX A;  2OTL A;  4RGM A;  4K8I A;  2PO4 A;  1VQH A;  1VQ8 A;  3PMF A;  5IGG A;  4BBR B;  1PH7 A;  1HNW Q;  4BY1 B;  2AQ3 B;  1RHP A;  3CCR A;  2VB2 X;  3MEH A;  4QMG A;  4H44 C;  1EY0 A;  4A3G H;  4DR4 L;  1VCI A;  1AFP A;  3U58 A;  4L5T A;  5EGT A;  1E1O A;  1GD7 A;  3J81 i;  2BA0 A;  4JI1 Q;  1Y1W G;  3T13 A;  2PNR C;  4R9W A;  1R4P B;  2XWJ B;  4NDX A;  2E2H B;  5D65 A;  5J22 A;  5CC4 A;  3HOZ H;  4J15 A;  1A2U A;  3K5M A;  3BVG A;  4OIK A;  2IX0 A;  2V4D A;  4QGU A;  1E2Z A;  4LF8 Q;  3PIP A;  5EJW A;  1LTS D;  4IFD H;  1B4O A;  4HIO A;  4KI0 A;  4IUV A;  4R4C A;  4LJZ C;  1STY A;  2DUD A;  5IWA Q;  3UDG A;  1NAP A;  3D4D A;  2LKV A;  1NSN S;  2UUB L;  1LLR D;  4L8J A;  1VQK A;  4A3C G;  1WCM H;  2TMP A;  2FJ2 A;  4RH6 A;  2B2U A;  1B53 A;  1NTG A;  2IJ0 A;  4O0A A;  1O7L A;  2UUA L;  4L63 B;  4OWT B;  1KRS A;  4RG1 A;  1OXU A;  1MIU A;  2L5T A;  4IQZ A;  4DFA A;  3ITP A;  2JA9 A;  2TSS A;  3HOY B;  4LMQ D;  3S1N H;  5JVG 3;  5C3E B;  4R4Q A;  4LFB L;  3F2B A;  3ERO A;  1U4M A;  3UDF A;  4E6I A;  4F87 A;  3HKZ B;  3PO3 H;  1VQE A;  2D0O A;  1H95 A;  1I6V C;  2EY1 A;  1ZYR C;  2CWA A;  1K83 B;  3M9B A;  4DV5 L;  3I4N G;  4DAP A;  1CT1 D;  4BA1 I;  2K05 A;  2YYZ A;  4HMI A;  1K8A C;  1UAP A;  4BBS G;  1VQM A;  1HZB A;  2CQO A;  5ELF A;  2BH8 A;  1A6X A;  1JWS D;  4R4O A;  5IP9 H;  1PVO A;  2K32 A;  4IN3 A;  1P16 A;  1LTA D;  3CQZ B;  2CKZ B;  2Z4H A;  4CDD C;  3BZK A;  1T5E A;  3KDF A;  1KD1 C;  3GDE A;  3RMH A;  3F2D A;  2ZTC A;  5GAD C;  1XXG A;  1FYC A;  3SE0 A;  1S40 A;  5FK9 C;  3D31 A;  3JAM E;  4BY7 G;  1PFB A;  2D5D A;  2J4X A;  4PMC A;  1XPO A;  1GJX A;  3HOX B;  3CCE A;  4F8M A;  3HKS A;  1XTD A;  2ZTD A;  1WYD A;  1Y1W B;  1TS4 A;  3RNU A;  4JI0 L;  4OX9 Q;  3DUZ A;  1K3R A;  4JI2 Q;  1T5X D;  1TWG H;  4YWK A;  2R93 H;  4QQB X;  2EJM A;  1NY4 A;  1FNU A;  5G3L D;  5T1G A;  4TKO B;  3G6J B;  4DNI A;  5IIF A;  5EQ0 A;  1EYA A;  5JEA H;  3H0G G;  5LMU L;  3T56 B;  4ZCK A;  3OIP A;  2QDL A;  4A3F H;  1EYG A;  2RVL A;  2F0I A;  4DR2 L;  1D1I A;  4JBW A;  3C1F A;  4POG A;  3SEB A;  1IHZ A;  3SK8 A;  4FYD A;  1HNZ Q;  1I4G A;  3H3V H;  1LTI D;  2LS0 1;  4WJ3 M;  1VQN A;  3BVZ A;  1PTO H;  3TQY A;  3BYT B;  1UE5 A;  4DF7 A;  2CW0 C;  3K58 A;  5CV7 A;  3RZD H;  1GUW A;  3Q0A A;  4XT1 B;  1AE2 A;  1KDB A;  3F2U A;  3S14 H;  1HHV A;  1L0X B;  2BDO A;  4PQX A;  1HCZ A;  2GVB A;  2XVS A;  4ALP A;  3T1H Q;  1JWM D;  2EXZ A;  1D6E C;  3HRZ C;  1I4H A;  1GVP A;  3N6R A;  5DM6 3;  4CGY B;  1RF2 D;  5K5P A;  2L11 A;  3KF8 B;  4PV1 C;  1LTL A;  5HY6 A;  2EYF A;  1E7Z A;  1BNZ A;  1JT8 A;  4R8N A;  3I4N B;  1IKM A;  1U5K A;  3HOW H;  1TY2 A;  1IBK Q;  5C0X I;  1S4Z A;  2M00 A;  2M2L A;  1TT2 A;  1JMC A;  4BBS B;  3HOV H;  2WB1 E;  5M5Y H;  1ICW A;  1UEB A;  3NE5 B;  5FLM G;  1WTR A;  2E2J B;  1ILQ A;  5M5W H;  1HA6 A;  4XYQ A;  4DNR B;  5IGF A;  1J9O A;  2RKS A;  3TBI B;  2PNH A;  3RLN A;  1LT4 D;  1LUZ A;  1S5E D;  1STG A;  4LAA A;  1JB7 A;  3NUC A;  3MXN A; 
#chains in the Genus database with same CATH homology
 3I4N H;  2IHF A;  4MZ9 A;  1XMQ L;  3AEV A;  5FJ8 G;  4DV1 Q;  4JBK A;  1KRT A;  5IT9 c;  4C2M H;  3OYY A;  4PZ7 A;  5M3F G;  3H3V I;  2VZA A;  4DR6 Q;  1YJ9 A;  4BBS H;  1LM0 A;  5J3B A;  2QGQ A;  1KAW A;  4OXP A;  5FJ8 H;  4A3M H;  4XIG S;  1OXT A;  1VQ9 A;  2E5L L;  4JOI C;  4JI1 L;  3W1B A;  4DPG A;  4BA2 I;  4A3I G;  1VQC A;  4OWX B;  3KLW A;  2K5H A;  2E2J H;  3PUV A;  1Q8K A;  1Z9F A;  4JI6 Q;  2Z0S A;  2NVY H;  4LFA L;  1OXV A;  3HFZ B;  2QEX A;  1WJJ A;  4DK3 C;  4B3T L;  4YCV A;  3CME A;  5LMN W;  3WWV A;  4HJ5 A;  2F4V Q;  4IO9 A;  3CP0 A;  4NB3 A;  4A3I H;  2UUB Q;  3TRZ A;  1OTC A;  2HQL A;  3CXC A;  3H15 A;  3KF6 A;  4PZ8 A;  1LYL A;  4QL5 A;  4PMW A;  4A3E H;  4LF6 Q;  2WAQ G;  3I55 A;  3TRE A;  4OO1 G;  4IJL A;  5JJI A;  4X62 L;  2K4K A;  4H02 A;  1X9N A;  2WB1 G;  3FP9 A;  1PH2 A;  5IWA L;  3UDI A;  4DV3 L;  1HZ9 A;  1Y1V H;  3CC7 A;  4DR5 Q;  4NXN Q;  3PGZ A;  3KOJ A;  3A5Z B;  5GAH C;  1X3G A;  1CSQ A;  2PQA A;  2A8V A;  2CWP A;  4A3C H;  2AMC B;  1SMX A;  1SFO H;  4LFB Q;  3T1Y Q;  3CF5 A;  1SRU A;  1KXL A;  4DV6 Q;  1YI2 A;  4L5Q A;  3ULL A;  1S72 A;  4LUV A;  2BA1 A;  2YU9 H;  2OWO A;  2H5X A;  2CCZ A;  1FL0 A;  5GAG C;  5JEA J;  4Y7N H;  4LF5 Q;  4HJ7 A;  4MTN A;  4JBJ A;  5GAE C;  3GTO H;  2JE6 I;  1C7Y A;  1YIJ A;  3RZO H;  1VS0 A;  4ME3 A;  4C3H H;  1D7Q A;  1HNX L;  1IL2 A;  4DUY L;  3S17 H;  1TWA H;  1V9P A;  4JOI A;  1NE3 A;  4R4I A;  1YVC A;  1G29 1;  4A93 G;  4DR7 L;  1XMQ Q;  3MXN B;  4A4I A;  4DV0 L;  3S2D H;  4P72 A;  2ALY B;  3J80 c;  4HID A;  4OWW B;  1T9H A;  1SRO A;  4IJH A;  3GTJ H;  1VQI A;  3A5U A;  5LMN Q;  1N34 L;  2Y0S E;  5M3M H;  1MKH A;  3JAM i;  3LGJ A;  3OTO L;  3I4M H;  5IYC H;  4UP9 A;  4A3K G;  2RCN A;  4UY8 C;  4A93 H;  1I6H H;  1EQQ A;  4L5R C;  2OQ0 A;  4GKK Q;  5C4X G;  2E5L Q;  2KHJ A;  2UXD L;  4PZ6 A;  1YEZ A;  1VQG A;  5C44 G;  1QZG A;  1KL9 A;  2RHS B;  3PO2 H;  4X65 L;  3HOZ G;  4IOC A;  1TWH H;  3RN2 A;  1QVC A;  1C9O A;  4A3K H;  2ATW A;  1VQJ A;  4BXX G;  4YHH L;  3EIV A;  4JI3 L;  4YCU A;  4LFA Q;  1N8R C;  4IFD J;  3ULJ A;  3OW2 A;  3RLO A;  3S1Q H;  1FVI A;  2R7Z H;  3TEH B;  1S3O A;  4APV A;  2ES2 A;  2VQF L;  1PFS A;  4GN4 B;  2JA5 G;  2MO0 A;  1KIX A;  2OQK A;  3GO5 A;  3L0O A;  4FDB A;  4C3I H;  1HR0 L;  2FXQ A;  1L1O B;  3K80 C;  1L2F A;  3DM3 A;  4X66 L;  1A0I A;  1I94 L;  4Y52 H;  5IYB H;  1M1K C;  4QY7 A;  5HGQ A;  2JA5 H;  3NEL A;  1WFQ A;  4JI8 L;  4B3R Q;  4NXM L;  1Q46 A;  3PF5 A;  4GLX A;  4X62 Q;  2RHQ B;  3PUX A;  1L1O C;  3PCO B;  4JC0 A;  5IYD G;  3HKZ E;  1WI5 A;  1EIF A;  5H1S E;  4DV3 Q;  4YY3 Q;  3S2H H;  1SN8 A;  2GVA A;  2Z6K C;  1TWF H;  3G6E A;  2C35 B;  4RMF A;  2KEN A;  4IPH A;  1CSP A;  1EOV A;  4A76 A;  5IYD H;  4X6A H;  1U0L A;  2B63 H;  2K5V A;  2VS1 A;  3I2Z A;  1N9W A;  5LMU Q;  3K0X A;  4DV4 Q;  4OO1 I;  3F1Z A;  3S24 A;  2E2H H;  5IP7 G;  2NZH A;  1Q1B A;  3M3Y H;  2N3S A;  1BBU A;  3ULP A;  2JEB I;  2PI2 A;  4OX9 L;  4EX5 A;  2VY3 A;  3K81 C;  4LF4 Q;  1WOC A;  3UE1 A;  4AQY L;  3F2C A;  1GM5 A;  1K0R A;  1UE6 A;  4JI4 L;  1HNX Q;  3L2P A;  1VQP A;  2JJQ A;  2Q2U A;  4JI7 L;  1HNW L;  3GTQ H;  3BU2 A;  3PO3 G;  2Y0S G;  1GKH A;  1EIY B;  1JJC B;  5ELO A;  3A0J A;  3J81 c;  4A3D G;  4DR7 Q;  5ELN A;  3FKI G;  1VQF A;  1X56 A;  3GTP H;  2IX1 A;  1NJI C;  3OTO Q;  1FJG L;  1VQ6 A;  2JA6 G;  2I5H A;  1PV4 A;  4A3D H;  3U50 C;  3M85 A;  1FGU A;  3FKI H;  4LWC A;  1PYS B;  5GRO A;  4P73 A;  5M3F H;  1XNR L;  2UXD Q;  3J80 i;  1VQO A;  2K14 A;  3CMA A;  2ID0 A;  4X65 Q;  4GOP B;  4JYA Q;  3IRB A;  2JA6 H;  1N33 L;  1XPU A;  1YBY A;  3GTK H;  4GKJ L;  1X54 A;  1PHJ A;  4YCW A;  5IP9 G;  1IYJ B;  1JJG A;  3RN5 A;  2VNU D;  4DK6 C;  1L1O A;  3HOY G;  4UPA A;  4HIK A;  3PF4 A;  2YV5 A;  4DV2 Q;  4GOP C;  1HR0 Q;  3I7F A;  2F52 A;  1NMG A;  3G48 A;  4X66 Q;  5C3E G;  5AJ3 L;  1JJ2 A;  1I94 Q;  2UU9 L;  4LF8 L;  2Z6K A;  1XNQ L;  2NVT H;  3JC6 6;  2VUM G;  3RLF A;  1CKM A;  1Q81 C;  3GD7 A;  3HOY H;  3HKZ G;  4JV5 Q;  1RL2 A;  3CCM A;  4JI8 Q;  1UE7 A;  2QA4 A;  3G4S A;  1N36 L;  2K5N A;  3UE0 A;  4DAM A;  1E22 A;  4GLV B;  1CKO A;  1CUK A;  3CC2 A;  2LSS A;  3EBE A;  2VUM H;  5C0X J;  3AFQ A;  1K9M C;  1J5E L;  1VQ4 A;  4C3J H;  2WP8 J;  4LFC Q;  3ERS X;  3CPF A;  2N49 A;  4JG2 A;  4KHP Q;  1TWC H;  3AQQ A;  1NMF A;  3E9I A;  1PH5 A;  4GLA C;  4QIW E;  1I5F A;  2D62 A;  4LW1 A;  4LF7 L;  2JA8 G;  3K8A A;  1QVG A;  3GTM H;  1I50 H;  3PUW A;  2LXJ A;  4LUZ A;  2YTV A;  3RR5 A;  3S15 H;  2ZTE A;  4DUZ L;  3B6Y A;  2I5L X;  1M90 C;  2N8N A;  4EQ5 A;  3CCS A;  1VQ7 A;  2OTJ A;  1YZ6 A;  2N78 A;  2NVQ H;  2JA8 H;  4X64 Q;  4KHZ A;  2DGY A;  2HIX A;  2L15 A;  5JEA G;  4AQY Q;  4A3J G;  2OTL A;  2ZJP A;  1O7I A;  4JI4 Q;  1VQH A;  1VQ8 A;  4A3F G;  1YJN A;  1PH7 A;  1V1Q A;  3NBH B;  4JI7 Q;  4A3G G;  1HNW Q;  3NEN A;  3CCQ A;  1X6O A;  2BH2 A;  3STB D;  2LXK A;  1XPR A;  4A3J H;  1PH8 A;  2K75 A;  3K7U C;  3CCR A;  1BBW A;  5C4J H;  3VDY A;  3TS2 A;  1OXX K;  4YWM A;  4A3G H;  2VL6 A;  4DR4 L;  1VCI A;  2IY5 B;  1AH9 A;  1YHA A;  3U58 A;  1XMO L;  1I3Q H;  4L5T A;  2NN6 G;  1E1O A;  4XTC S;  4AYB E;  4DAY B;  2ZM6 L;  4GOP A;  1GD7 A;  3J81 i;  2BA0 A;  1XNR Q;  4JI1 Q;  1HJP A;  2OCE A;  4GN5 A;  1Y1W G;  1K8G A;  1Q7Y C;  3CAM A;  2I0Q A;  1N33 Q;  5C4X H;  4DV7 L;  4PG3 A;  1BVS A;  5C44 H;  2NVX H;  4B3T Q;  3I4O A;  1L0W A;  4BBR G;  4DR3 L;  3HOZ H;  4J15 A;  2V1C C;  4IFD G;  3GTL H;  4BY1 G;  4BXX H;  1IZ6 A;  2IX0 A;  5AJ3 Q;  4QGU A;  1PH6 A;  4LF8 Q;  2UU9 Q;  4UP8 A;  4BBR H;  3PIP A;  1IBM L;  4O2D A;  1VQL A;  1HH2 P;  4HIO A;  4BY1 H;  4KI0 A;  4R4C A;  2XGT A;  1PH9 A;  5IE8 A;  3G71 A;  2DUD A;  1NBW A;  1Q1E A;  1WCM G;  5IWA Q;  3UDG A;  1HR0 W;  5EAY A;  4NPS A;  1J5E Q;  2F4V L;  3DLL A;  3CCV A;  4JI5 L;  2UUB L;  3W1G A;  3CCJ A;  4WJ4 A;  1VQK A;  4R1J A;  2K52 A;  1WCM H;  3HOW G;  1NTG A;  3M7N A;  1KHI A;  2MNA A;  4O0A A;  3E9H A;  3GTG H;  4DUZ Q;  2UUA L;  1VQA A;  4DR1 L;  4OWT B;  1W3S A;  3HOV G;  1KRS A;  4RG1 A;  2YTX A;  4GNX B;  1OXU A;  3E0E A;  5IP7 H;  1MIU A;  4JI2 L;  2VQE L;  2ZJQ A;  4JBM A;  5IY0 A;  1MJE A;  1SLJ A;  1C0A A;  4DUY Q;  1E1T A;  1SR3 A;  1QVF A;  2UUC L;  2JA9 A;  1EQR A;  3S1N H;  2R7F A;  1YNX A;  4JCV E;  1YJW A;  2B29 A;  4GNX C;  1PH4 A;  2HHH L;  2Q2I A;  4R4Q A;  4DV0 Q;  1N32 L;  4LFB L;  4AYB G;  3F2B A;  3UDF A;  3BZC A;  3PV0 A;  1B70 B;  5M5X H;  1D8L A;  3J81 j;  1N34 Q;  1X55 A;  3KFU A;  2JA7 G;  3PO3 H;  1VQE A;  2D0O A;  1H95 A;  1RIP A;  3F8T A;  1ASY A;  2JEA I;  1XMO Q;  2CWA A;  4KLK A;  4P71 A;  2ZM6 Q;  1HZC A;  3M9B A;  2UXB L;  4DV5 L;  3I4N G;  1B8A A;  2MFI A;  3PUY A;  4BA1 I;  1MJC A;  3U4V A;  1HNZ L;  2JA7 H;  2YYZ A;  2UXC L;  1YIT A;  2Q2T A;  1K8A C;  4YHH Q;  4JI3 Q;  4DV7 Q;  4YWL A;  4BBS G;  1OXS C;  2CFM A;  1VQM A;  4A3M G;  3MEF A;  4DR3 Q;  1HZB A;  2CQO A;  2VQF Q;  1PH3 A;  4HJA A;  1KQS A;  2BH8 A;  4TVA B;  4HJ9 A;  5LMN L;  1CKN A;  2AKW B;  2EQS A;  2NN6 I;  4R4O A;  5IP9 H;  4AIM A;  1PVO A;  1JE5 A;  1IBM Q;  2R7D A;  1P16 A;  2AHO B;  4LNQ A;  4GKK L;  2EIF A;  2R6G A;  2AWN A;  5C3E H;  1Q82 C;  3KJO A;  4NXM Q;  2HT1 A;  2A19 A;  2CKZ B;  1B7Y B;  4HIM A;  3D0F A;  3M4Q A;  2MQH A;  1Q86 C;  3T1H L;  3FHW A;  3BZK A;  2KHI A;  4IFD I;  3KDF A;  1KD1 C;  5C0X G;  3GDE A;  2ZJR A;  3U4Z A;  1K83 H;  3F2D A;  4A3E G;  2ZTC A;  5GAD C;  4JI5 Q;  1E24 A;  3J7Z C;  3ER0 A;  2PI2 E;  4POF A;  4GS3 A;  1Q12 A;  1UWV A;  2VW9 A;  4R4T A;  2B3G A;  1A8V A;  1Z47 A;  3D31 A;  1S40 A;  4BY7 G;  1XPO A;  3AFP A;  2R93 G;  4B3R L;  3CCE A;  1Y1V G;  1XTD A;  2ZTD A;  3HKS A;  1J6Q A;  1WYD A;  4GNX A;  1IBL L;  2UUA Q;  4DR1 Q;  4B3S L;  3SGI A;  2MO1 A;  1IBK L;  3S1M H;  3RNU A;  4JI0 L;  4OX9 Q;  4BY7 H;  1K3R A;  4JI2 Q;  3ZJY C;  1TWG H;  2R93 H;  4YWK A;  1VQD A;  2AWO A;  2WFW A;  2PMZ E;  4YY3 L;  2VQE Q;  1XJV A;  4A3C G;  4QQB X;  1P8L A;  1NY4 A;  2K50 A;  2KCT A;  3J7A 5;  2JK8 A;  5FLX c;  3CQZ H;  4LF9 L;  2UUC Q;  4B3M L;  4DNI A;  4MNO A;  1V43 A;  5LMU L;  3H0G G;  4DV4 L;  2HHH Q;  4P74 A;  4A3L G;  1N32 Q;  4HJ8 A;  4A3F H;  1EYG A;  4L5S A;  1QUQ A;  4OON A;  5BR8 L;  4DR2 L;  1G51 A;  1X3F A;  2JQO A;  3H0G H;  3PIO A;  3HOX G;  1GO3 E;  3KYH C;  1FJG Q;  3HOU G;  1R9T H;  4JBW A;  4K0K L;  4A3L H;  2UXB Q;  2RF4 A;  4DV5 Q;  3TS0 A;  4DKA C;  4LF4 L;  4POG A;  3CPW A;  1X3E A;  1HNZ Q;  3STB C;  1YHB A;  3H3V H;  1X65 A;  2UXC Q;  3HOX H;  3HOU H;  4GKJ Q;  2XTI A;  3M4O H;  4WJ3 M;  2YTY A;  1VQN A;  2Q2H A;  5M3M G;  1Y1W H;  3TQY A;  3I4M G;  1IXR A;  5IYC G;  4DV1 L;  1K73 C;  1PH1 A;  3CC4 A;  4AH6 A;  2ASB A;  3ICE A;  1EWI A;  3Q8D A;  1UE5 A;  4DR6 L;  1VQ5 A;  2EXD A;  1XNQ Q;  5E7N A;  3PO2 G;  4A3B G;  1YHQ A;  1EUJ A;  3RZD H;  1CKN B;  3L7Z C;  5GQO A;  1A62 A;  1QZH A;  1AE3 A;  1AE2 A;  3K7A H;  3KJP A;  1N36 Q;  3S14 H;  2R7Z G;  4A3B H;  3AYH B;  2GVB A;  3CD6 A;  4JI6 L;  1VQB A;  4ALP A;  1BKB A;  4JYA L;  3BJU A;  3T1H Q;  1SE8 A;  2NZO A;  5IYB G;  2I5M X;  1GVP A;  1HZA A;  2R92 G;  3KDF B;  2A1A A;  1G6P A;  4DV2 L;  2KCM A;  1PYB A;  5JJK A;  3KF8 B;  1LTL A;  5HY6 A;  4LF6 L;  1E7Z A;  4LF7 Q;  3KF6 B;  2R92 H;  4JV5 L;  1JT8 A;  1ASZ A;  1U5K A;  1IBL Q;  2E2I H;  3HOW H;  4IOA A;  4B3S Q;  1IBK Q;  1EFW A;  5C0X I;  1W2B A;  4JI0 Q;  2WAQ E;  5DLQ E;  1JMC A;  2B63 G;  2KBN A;  4IPD A;  2E8G A;  4P75 A;  4DR5 L;  4QJF A;  4LFC L;  4NXN L;  4IPC A;  3CCU A;  3HOV H;  2WB1 E;  3EN2 A;  1Y14 B;  4LF9 Q;  1A63 A;  5M5Y H;  4B3M Q;  4KHP L;  1UEB A;  4A75 A;  5JJL A;  3PUZ A;  3PSI A;  5FLM G;  2IT1 A;  1UE1 A;  3T1Y L;  2PQA B;  3W5O A;  4DV6 L;  5M5W H;  3UDX A;  2D0P A;  3NEM A;  2F3I A;  4DR4 Q;  5BR8 Q;  4DR2 Q;  5FLM H;  1QUQ B;  4LF5 L;  3S16 H;  4K0K Q;  4GN3 B;  4UP7 A;  3M4P A;  3CW2 C;  2HIV A;  2PNH A;  4X64 L;  3S1R H;  2GN5 A;  3RLN A;  3I56 A;  1PA6 A;  1DGS A;  1LUZ A;  4TQU S;  5K36 G;  4LUO A;  1JB7 A;  3CCL A;  2IHE A;  1KC8 C;  1E3P A;  3A74 A;  3JAM c;  4IPG A;  1TXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...