4NB3A

Crystal structure of rpa70n in complex with a 3,4 dichlorophenylalanine atrip derived peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a Potent Stapled Helix Peptide That Binds to the 70N Domain of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4nb3A00
4K0KL 2F4VQ 3RR5A 1KIXA 1QUQB 2IX0A 2PQAB 3I4NH 3E0EA 4R4TA 3HOXH 3KDFB 5IE8A 1UE6A 1OXVA 2YTYA 4IPGA 4B3SL 1I5FA 3M85A 1WI5A 4OWWB 1C9OA 1PVOA 2UUAL 2UUCL 2KCMA 1YHAA 3HOVG 4LF7L 1E1TA 5IYDG 5FLMG 4HIMA 3STBC 1SMXA 2K5NA 2VY3A 3UDXA 3T1HQ 1S72A 1C7YA 1XNRL 1XTDA 1KC8C 5JEAJ 4DR7Q 4HJAA 2I5LX 3PUXA 4NB3A 5C4XH 3HKZG 5AJ3L 1B7YB 2XTIA 4JI2Q 1TWHH 2D62A 4IO9A 1VQPA 2A8VA 1CKMA 3OTOQ 3IRBA 3UDFA 1KD1C 3TQYA 4XTCS 1N34Q 1Q86C 4LNQA 3S1NH 4QY7A 1VQ4A 1WJJA 4FDBA 4A3CH 1VQ6A 1PH9A 3CCEA 5IT9c 4QGUA 5GAEC 2NVYH 3K0XA 1PFSA 4GKJQ 4YCWA 1M1KC 2F52A 3KJPA 1OXUA 1WOCA 1XMOL 4J15A 1IXRA 4BY7H 4A3FH 4WJ4A 1MJCA 1K0RA 1QUQA 4GLAC 3J81j 5LMUQ 3HOUG 1EQQA 1QVGA 3KDFA 1IBLL 4IPDA 3GTOH 2ID0A 1GD7A 4A3EG 3CQZH 4LFAQ 4KHZA 4P72A 3CCJA 3E9IA 1N32Q 2VZAA 3W5OA 1FJGQ 1PH5A 3BZCA 4B3RL 2R6GA 4UP9A 1HZ9A 2YTVA 4PMWA 2UU9L 2Z6KC 1G6PA 2UUBL 4DV3L 2VS1A 2XGTA 2K50A 1Y1VG 2WAQG 2E8GA 3MEFA 4PZ7A 3ER0A 2YU9H 2OQKA 1VQAA 2ASBA 1EOVA 4R1JA 4LFBQ 3FP9A 4LFCL 4JBWA 3F1ZA 3FKIG 3L2PA 4DV5Q 2K75A 5DLQE 2JEAI 5IP7G 4DR6Q 3J81i 4GNXC 1CUKA 4IPCA 4C3HH 3S1QH 2NN6G 2OTJA 2NVXH 2R93H 2F4VL 3F2CA 3PUYA 4C3IH 4Y52H 4PZ6A 4DV1Q 3HOYG 1OXSC 1KL9A 1O7IA 2JA9A 3HOZH 3JAMi 3CC4A 2N78A 4A3BH 3RLFA 3KFUA 4GN4B 4KI0A 1J5EQ 1XJVA 1UE5A 4DKAC 5IYCG 1A8VA 1D8LA 3KF6B 1YJWA 3WWVA 5LMNW 5M5WH 2PNHA 2H5XA 4HJ9A 1YIJA 1HR0W 4MZ9A 3T1HL 5JEAG 2I5MX 2HIXA 1PH6A 4O0AA 1CSPA 1K3RA 4DR7L 1YJNA 1P16A 4P74A 5C44H 3S15H 2B29A 4DAYB 4JI2L 5K36G 4KHPQ 5JJLA 3OTOL 5IP9G 1SRUA 1VS0A 1IL2A 3PO2H 1N34L 3GO5A 3I4MH 4O2DA 1WCMH 2AWOA 3GDEA 3RN5A 4A3KG 5FJ8H 2ZTEA 2JA6H 4GKJL 4OONA 4JI7Q 1X9NA 2VQEQ 1AE3A 2QGQA 3EIVA 3TEHB 2AKWB 3L0OA 5FLXc 4DV0Q 2JA8G 3HKSA 2IHEA 1YEZA 2IT1A 1I3QH 1X65A 5LMUL 1NMGA 4A3LG 1Y1WG 1OTCA 1EFWA 1HZCA 1K9MC 4DV4Q 4LFAL 3PIPA 1N32L 1FJGL 5C0XI 1DGSA 1MKHA 3KF6A 3MXNB 4JOIC 3J7ZC 2KCTA 4L5SA 2RF4A 3CMAA 2PMZE 2RHSB 2WP8J 3CCQA 4P75A 3U58A 1PH3A 2BH2A 4BY1G 4JI6Q 2A19A 4AH6A 4NXNQ 4B3RQ 4LW1A 4LF6Q 1CKNB 5M3FH 1Q1EA 1GM5A 2D0PA 3CPWA 1X6OA 4GNXB 4UP7A 4LFBL 3AYHB 3GTKH 1UEBA 4L5QA 3PUWA 4HIOA 2I0QA 2N49A 2B3GA 1N8RC 4GS3A 4P71A 4DR6L 3GTGH 3PO3H 4X62Q 4B3TQ 1VQ9A 2NVTH 3I4OA 4A3JH 5HGQA 4LF8Q 4HIDA 4AQYQ 1VQIA 1Y14B 2LXKA 2HQLA 4DV1L 3S2DH 2EXDA 4IJHA 1HNWQ 2UXDQ 3AFPA 1EIYB 1K8GA 3H3VH 1E3PA 1J5EL 5IYCH 1U0LA 3CP0A 3LGJA 2N3SA 2CWPA 3OYYA 5IYBH 1HJPA 4DR5L 1VQ5A 3M4OH 3GTPH 2ZM6Q 1R9TH 2Z6KA 3NELA 1TWAH 2JE6I 3T1YQ 4X66Q 4A3IG 2HIVA 3UE1A 4KHPL 5C3EG 4BBSG 2YTXA 3FHWA 4BXXG 2YV5A 3H15A 1YJ9A 1CKNA 3NEMA 1SE8A 1Q81C 2OCEA 2Q2HA 1XNQQ 3DM3A 5J3BA 3EN2A 4GNXA 4A3GH 2UXBL 4DK3C 1JMCA 4JC0A 4DUYQ 1KRTA 1T9HA 4JI7L 2VQEL 2ZJQA 4DV0L 1VQNA 3OW2A 1PH4A 4GLVB 4B3MQ 3H0GG 4ME3A 4JBKA 2N8NA 1BBUA 1UWVA 4UPAA 4JI1Q 4APVA 4AYBG 5IWAQ 4JYAQ 1V9PA 1NTGA 4DV4L 1G291 1I94Q 1JJCB 1KAWA 2PQAA 1NJIC 4MTNA 2CKZB 4X64Q 1P8LA 1VQMA 2VUMH 5ELNA 1M90C 2JK8A 4JI5Q 1I50H 2CQOA 4BBRG 2B63H 2WFWA 3UDGA 2MO1A 4JI6L 4NXNL 4R4IA 3S24A 4LF6L 4OX9Q 3I56A 4LF9Q 1HH2P 2A1AA 1OXXK 2ZTCA 2BA1A 3UDIA 4R4QA 2OWOA 2IY5B 3HOWG 2JQOA 3AFQA 1N9WA 3K7UC 4YY3Q 2WB1E 5C0XJ 4DR2Q 4X62L 2Y0SE 1Q7YC 1VQ8A 4B3TL 1YITA 3U4ZA 2NZOA 3KOJA 1XPRA 4LF8L 5GAHC 1S40A 4AQYL 4A93H 2UXDL 3W1GA 2R92G 4YWLA 1I6HH 1VQOA 1HNWL 2CCZA 1PH8A 2K5HA 1KXLA 3PUVA 1V43A 3S17H 1E22A 1XPOA 3M7NA 1Z9FA 3RNUA 1NMFA 2ZM6L 1VCIA 4JOIA 3S2HH 4IFDI 1PH7A 3BJUA 2AWNA 3ERSX 2DUDA 4DR5Q 4DR4L 3HOVH 5FLMH 1S3OA 5IYDH 2JA7G 1LM0A 4X66L 3T1YL 1YHQA 4LUZA 3RN2A 2NZHA 3A74A 1EYGA 2PI2E 1JJGA 4OWTB 3KJOA 2ES2A 4BBSH 4JCVE 4BXXH 1TWFH 1X56A 3M4QA 3CCUA 4PZ8A 3Q8DA 1XNQL 4UY8C 1FL0A 2R7ZG 4DUYL 2Q2UA 1SN8A 2GVAA 3J81c 1VQHA 3GD7A 3HKZE 5IY0A 5M5XH 1IBKL 3GTQH 4B3ML 2UXBQ 3I4NG 4BA1I 1IZ6A 3PV0A 1A63A 4JI1L 2KHJA 5IWAL 3HOXG 3F2BA 4HIKA 3JAMc 4JI0Q 4JYAL 5HY6A 2GN5A 2Z0SA 1VQDA 2EIFA 4L5TA 4A3MG 1ASZA 3RLOA 1I94L 3HOUH 2UXCQ 4ALPA 3F8TA 3VDYA 2ATWA 4GKKQ 1VQJA 4X64L 2E2HH 3M4PA 4JI5L 1VQ7A 4A3EH 1HNZQ 4JI8Q 4DAMA 3J80i 1AH9A 3NENA 3G48A 4L5RC 1WFQA 1VQKA 1VQFA 1XMQQ 1PYSB 5JJKA 4OX9L 3A5ZB 1GVPA 1NE3A 3PCOB 5C4XG 2YYZA 5GAGC 5M3MG 4LF9L 2MNAA 1G51A 4LUOA 3CCLA 1Y1VH 1JB7A 3CCMA 5C0XG 2R7FA 3KYHC 3S16H 4EX5A 5BR8Q 3GTJH 4IPHA 3UE0A 2VW9A 1LYLA 2CFMA 4OO1I 1E7ZA 4KLKA 4YY3L 4DR2L 1JJ2A 2CWAA 1YZ6A 3FKIH 4HJ8A 3RZDH 2ZJRA 2IX1A 3S1MH 4A3CG 2E2JH 1PHJA 2WAQE 5IP7H 5M5YH 1WYDA 2JA5G 4POGA 2R92H 3RLNA 4TQUS 4GLXA 4QL5A 3TRZA 2VQFQ 3DLLA 2E2IH 4GN3B 4YHHQ 3G71A 4A3FG 3M9BA 5ELOA 2IHFA 3HOYH 1LTLA 1BBWA 3CCRA 2AHOB 1B70B 3CC7A 1SROA 3CC2A 2LXJA 1SFOH 1MIUA 4DK6C 2C35B 3TREA 3CMEA 1C0AA 2KHIA 2MQHA 1TXYA 4DR4Q 1N36Q 4DV2Q 2VL6A 1K83H 1VQLA 4P73A 2ZJPA 1EUJA 3BZKA 4IOCA 2HHHQ 3S14H 2OQ0A 4YCVA 5C4JH 4NXMQ 3GTLH 5IP9H 5LMNQ 2K52A 4IFDJ 1HR0Q 3PF5A 3CCSA 2NVQH 4LF5Q 3ZJYC 2ALYB 2D0OA 1GKHA 4YWMA 3PIOA 2R93G 1CSQA 4A3KH 1Q1BA 4Y7NH 3D31A 4A3DH 1CKOA 1X54A 1Z47A 1RIPA 4QJFA 4A3MH 4JI0L 2JA8H 1IBKQ 1YNXA 3HOZG 1VQGA 4A3BG 3J7A5 1V1QA 1EIFA 4YCUA 5EAYA 2MFIA 1HZAA 2UXCL 1QVCA 4GKKL 1Y1WH 1Q46A 4JG2A 3K80C 4DNIA 2VNUD 1L1OB 1J6QA 1HNZL 4C3JH 4JI8L 3RZOH 1N33Q 3CF5A 1E1OA 3AEVA 1XMQL 4JI3L 1NBWA 5M3MH 2KBNA 5C44G 1QZGA 3B6YA 4IJLA 4DUZQ 4BY1H 4GN5A 1IYJB 1EWIA 4GOPC 5BR8L 3PO2G 4JBMA 3AQQA 4DV7Q 1IBMQ 3CD6A 1A0IA 4IOAA 4DR1Q 1YHBA 3NBHB 1H95A 4JV5L 1QZHA 3I4MG 2BA0A 1KQSA 1OXTA 1WCMG 3K8AA 3U4VA 5FJ8G 2JA5H 2JA6G 1PA6A 3PF4A 1VQBA 4DV6Q 3M3YH 2K14A 1LUZA 4OXPA 1A62A 1E24A 4POFA 2VQFL 4YHHL 4R4OA 2MO0A 3CCVA 2I5HA 4R4CA 3A5UA 3E9HA 4X65Q 4A76A 1HNXQ 4A3DG 2PI2A 1W2BA 3KF8B 2F3IA 1X55A 3K81C 4UP8A 2L15A 2E5LQ 4LWCA 3PUZA 1FVIA 1YVCA 2GVBA 3ULPA 3PSIA 3ULLA 3I7FA 1KRSA 4QQBX 1L1OA 2HT1A 2AMCB 2KENA 4RMFA 1Q8KA 2K4KA 1FGUA 2K5VA 3CW2C 4DV2L 1N36L 1K8AC 3PGZA 4DR3Q 1KHIA 5M3FG 4WJ3M 4A3IH 3EBEA 2NN6I 2QEXA 1PH1A 2HHHL 2RHQB 4NXML 4IFDG 4MNOA 5C3EH 1NY4A 4QIWE 5LMNL 3U50C 3BU2A 1JE5A 5GQOA 1HR0L 4LF5L 3PO3G 2JEBI 1AE2A 4LF4Q 3H3VI 3F2DA 1Q12A 4A3JG 4JI4Q 3S1RH 4X6AH 3CAMA 4K0KQ 3H0GH 4XIGS 4H02A 1QVFA 1MJEA 4AIMA 1L2FA 4EQ5A 3G4SA 1RL2A 5IYBG 3KLWA 1PH2A 4PG3A 1TWCH 2FXQA 1GO3E 1U5KA 3CXCA 1Q82C 4B3SQ 3I55A 1YI2A 2QA4A 2UUAQ 2V1CC 3D0FA 1N33L 5JJIA 1K73C 2OTLA 2UUCQ 4AYBE 4GOPB 1ASYA 4LF7Q 4BBRH 1SLJA 2EQSA 1VQCA 1XNRQ 3A0JA 4A4IA 4DPGA 1HZBA 4DUZL 4A75A 1UE1A 1X3FA 3CPFA 1D7QA 3SGIA 4JI3Q 1L0WA 4HJ7A 1L1OC 1PYBA 5AJ3Q 4NPSA 2LSSA 4DV7L 1SR3A 1X3GA 2JJQA 4TVAB 4DR1L 1IBML 3HFZB 4OWXB 4A3GG 2BH8A 5H1SE 4BA2I 2DGYA 3G6EA 1VQEA 2Q2IA 3HOWH 4DV6L 4JV5Q 3JC66 3ICEA 2ZTDA 4LUVA 2R7DA 3I2ZA 3W1BA 4X65L 1XMOQ 1HNXL 4OO1G 1PV4A 2E5LL 4BY7G 3STBD 1IBLQ 2VUMG 3GTMH 3J80c 2B63G 3ULJA 5GADC 1JT8A 2Q2TA 3L7ZC 4A3LH 3TS2A 2UU9Q 1UE7A 4YWKA 5GROA 2JA7H 4DR3L 4GOPA 2WB1G 4DV3Q 2UUBQ 2Y0SG 1BVSA 4DV5L 3K7AH 4HJ5A 1X3EA 1BKBA 1B8AA 4RG1A 1XPUA 2R7ZH 2RCNA 4LFCQ 1W3SA 4LF4L 1YBYA 4C2MH 5E7NA 3TS0A 1EQRA 4JI4L 4A93G 4JBJA 1TWGH
chains in the Genus database with same CATH superfamily
4P2CB 1KIXA 1XX8A 3E0EA 1PRTF 3K5MA 1W6JA 1U4MA 2KQ3A 3MEHA 3STBC 3FDTA 1SMXA 2VY3A 3T1HQ 1XNRL 4M8AA 4DK0A 4Z9CB 2K5QA 5CV4A 4HJAA 4XYOA 4NB3A 5AJ3L 3HKZG 1TWHH 2D62A 3OMCA 2F0KA 3IRBA 3QO2A 5EKIA 1KD1C 3TQYA 4XTCS 4K2LA 4A3BB 2RDHA 4LNQA 1VQ4A 1TS2A 1DONA 3MXUA 1WTXA 1PFSA 5M5WB 1M1KC 1QG7A 1GUNA 1IKMA 1IXRA 1EWHA 5M9OA 1K0RA 3PIO3 3S15B 1QVGA 1RODA 1E2VA 4G7ZC 1MHWC 4OELB 5CYUA 4P72A 1LTRD 1H9SB 2VZAA 1PH5A 2R6GA 1G6PA 2Z9HA 1M8AA 2F0PA 2FMMA 2WAQG 1KDCA 2B2TA 4PZ7A 3BDOA 2OEOA 2BCOA 4CJ1B 3FP9A 4LFCL 5E4WC 1HTPA 2A5HA 4DR6Q 3J81i 2OTJA 4C3HH 1H9RA 1I4GA 2NVXH 2R93H 3F2CA 3PUYA 4C3IH 4DV1Q 3HOYG 1OXSC 1SDFA 3JAMi 1VMPA 3CC4A 4FXGC 4GN4B 1J5EQ 5IYCG 1G2TA 5M3FB 4IURA 5LMNW 4X3SA 3GTKB 3T1HL 2I5MX 2HIXA 3PO3B 3NP8A 5IGFA 2C5CA 1SJHD 2CQAA 4C2MB 3N52A 4K2KA 1IL2A 3I90A 3EJIA 3KLSX 2PYKA 3FVQA 1K0SA 3NPPA 5FJ8H 1RTOA 1EU4A 4OONA 2JA6H 4A3DG 2VQEQ 1FR3A 3DWQA 3EIVA 3TEHB 3L0OA 2KHSA 4MIUA 1JE4A 1I3QH 2DJFC 1HZCA 3PIPA 4MN3A 3IL8A 2A73B 1DGSA 1KNEA 1MKHA 4H0LC 4DXGA 1A15A 2A19A 4NXNQ 4B3RQ 1JR0D 4LF6Q 1PMRA 1S5DD 2WINB 4HR7B 4IUTA 5EGTA 4MHEA 2N49A 2LY7A 5CGKA 4GS3A 4DR6L 4HSVA 2RSNA 2EE1A 4HTHA 4FO2A 2KA7A 1EY9A 3OPOA 5HGQA 3VR6A 4A3JH 4NMZA 2UXDQ 4DV1L 1I50B 2XN9C 3H3VH 2KOLA 2F0OA 1E3PA 1J5EL 5JJIA 1U0LA 3OYYA 2N3SA 2WB1B 5KIXA 2K6AA 1R9TH 5JEAH 2Z6KA 4RKBA 3NELA 1IW7D 1EY6A 5EKLA 2CVRA 3MXNA 2X6GA 4A3IG 5C3EG 4BBSG 3CU7A 2B8GA 1XWEA 1PRTC 1CKNA 3BZDB 5JPMC 2OCEA 1JQYD 1LTSD 2RA4A 1ONLA 4C3IB 2CHBD 4DUYQ 3ZYYX 2VQEL 4B08A 1STYA 2PZTA 2ZJQA 4ZUIA 4B3MQ 2KEEA 5JAVA 3D4WA 1BBUA 4AYBG 3OW7A 4JI1Q 4APVA 5IWAQ 4JYAQ 3H3VC 1SSOA 5I2XA 1G291 2Z6BA 1KAWA 3KBXA 1P8LA 1B4OA 5ELNA 1M90C 2K01A 4BBRG 1ZEQX 2WFWA 2MO1A 2B8FA 4NXNL 3KLRA 1FNWA 4R4IA 3VR3A 4LF6L 2PCFB 3I56A 1HH2P 1JOOA 3NTIA 2LMCB 2BA1A 5JJZA 1PDQA 1N9WA 5C0XJ 1Q7YC 5CV7A 1SYBA 3P75A 1AZPA 5GAHC 3SE0A 2UXDL 3W1GA 4A3EB 2R92G 1RDPD 4YWLA 1I6HH 1VQOA 2CCZA 2BE5D 2NTSA 1B3AA 1MBYA 1U4RA 1E22A 3HZXA 3S17H 1WTRA 3RNUA 2AUKA 1HQMC 4K6DA 3BJUA 2AWNA 4N8FA 3W3AA 2ICIA 2JA7G 1PRTB 3RZDB 1JJGA 2NZHA 1EY8A 2ES2A 4JCVE 4BXXH 3CCUA 2R7ZG 4DUYL 2JSOA 2GVAA 2Q2UA 2PNRC 4BS9A 5D14A 4B3ML 4DNTB 1A63A 4JI1L 5IWAL 4HIKA 4JYAL 3F2BA 5IGGA 4A3MG 1SYFA 2L9HA 3F8TA 1B3QA 4CKEA 2ATWA 1VQJA 3M4PA 1VQ7A 3AB9A 2N88A 3GTLB 1SBBB 1ILQA 1WFQA 1VQKA 4WJWA 1GVPA 1NE3A 5HURA 4A3KB 5C0XG 1D2BA 1KLUD 3KYHC 4HCSA 3S16H 3GTJH 4IQZA 4I7AA 1LYLA 4OGQC 3UE0A 1E7ZA 1QWYA 2ZJRA 4XXEA 1EEID 1PHJA 1CFMA 2C9OA 4QUFA 2F0TA 2JA5G 3A7LA 3TRZA 4QL5A 4CHTB 1A3TA 3G71A 2FHTA 4A3FG 3M9BA 2IHFA 3J80E 3HOYH 2L5TA 4KY7A 1B70B 2L1BA 1SROA 3CC2A 4KD3A 4DK6C 1EYAA 3SVMA 3TREA 3BG3A 2KHIA 2MQHA 5CV6A 4DR4Q 4LJZC 3PIP3 3V2TA 1VQLA 1EUJA 3BZKA 3S14H 4NXMQ 1SE4A 2CH4W 3C2PA 4CDDC 1LABA 4YWMA 1CSQA 2HCIA 2EOTA 2F0JA 4A3DH 1CKOA 1RIPA 2XNAC 1IBKQ 4A3BG 4ZAIA 1I4RA 4F87A 2XRSD 2MFIA 1WTOA 3MHBA 1Q46A 5ELBA 3K80C 4DNIA 3A7AB 2RSOA 4G4KA 4ZUJA 2F0LA 4PMCA 2F0HA 3DHQA 1D1IA 4L63B 5M3MH 1GJXA 1QZGA 3B6YA 3EROA 3U9SA 2PO4A 1CT1D 3VYUA 3TP8A 1A0IA 5IT9E 3H0GB 4JV5L 1DOLA 1QZHA 1TQOA 2BA0A 4LAAA 3HP3A 4TRDA 3U4VA 3PF4A 2SNSA 4XT3B 3M3YH 1YNJD 1LUZA 4XT1B 3A5UA 3FPUB 3KF8B 3K81C 2G5DA 1LV9A 1YVCA 2HDMA 3ULLA 1CTMA 2WV6D 1NNXA 2JP1A 1MD2D 4FF3A 3N6RA 1Q8KA 2QW7A 2K5VA 4KY6A 3NE5B 5M3FG 4A3IH 4NXML 5KNCA 5C3EH 1SAPA 1NY4A 4QIWE 5FKAC 4FXDA 4N9PA 5GQOA 5A35A 2JYOA 3R3OA 3PO3G 2JEBI 2A6HD 3TSSA 3NBHA 1XTCD 4C56C 4EVOA 1Q12A 4F7XA 3Q0AA 4K0KQ 5CORA 1L2FA 1PH2A 1RL2A 3EQLC 2FXQA 2F0IA 1GO3E 1U5KA 3DWAA 1YI2A 3K7AB 5EJWA 1CQVA 3D0FA 3H6MA 3CKIB 4BBRH 3A0JA 3R93A 4A4IA 1D5XC 3I70A 5I4DA 3SGIA 4RGTA 2RBMA 3A54A 3P20A 4JI3Q 1V1PA 1PYBA 2JJQA 2SEBD 3HFZB 4BA2I 2LS01 1VQEA 3JAME 5FLXE 3JC66 2B2VA 4KJNA 4LK1C 5D3IB 3F2UA 5D65A 1DYQA 1O80A 4OO1G 1XMOQ 2RDGA 1JORA 4KD4A 5M3MB 1BR9A 1U4LA 2ZXRA 3TS2A 2JA7H 2WB1G 1EY0A 5JPNC 1ZYRC 2EY6A 4DV3Q 3VYRA 4DV5L 4CKBA 3M3YB 1XPUA 2R7ZH 2D2CC 1A2TA 1PFMA 4KV6A 1UEAB 3CQZB 4K0KL 2FJ2A 3RR5A 1LTAD 2PQAB 5I2YA 4C3IG 1LTGD 4IUPA 3KDFB 5IE8A 2IL8A 3NTHA 4DK1A 5IYDG 4HIMA 3UDXA 1XTDA 4V190 5JEAJ 4C1NI 3PUXA 3S1QB 4TSSA 1FD7D 4WFN3 2A8VA 3A8KE 5C0XH 1CKMA 3OTOQ 3UDFA 1H9MA 5CV8A 1Q90A 1FYCA 2A68D 3G6JB 4RCOA 1PH9A 1VQ6A 5GAEC 4QF4A 1S5ED 2NVYH 2F0FA 4YCWA 3TP7A 2F52A 1OXUA 1XMOL 3ERQA 4BY7H 4A3FH 1MJCA 2MP1A 1B1ZA 4GLAC 2R3ZA 1EQQA 5C44B 1F9RA 4IPDA 4IUVA 4A3EG 4LFAQ 2O5IC 1H9KA 1FJGQ 3W5OA 3PO2B 1TU2B 1D1KA 3D6WA 4PMWA 4DV3L 3I4MB 1WCMB 1F77A 4RH6A 2E8GA 3MEFA 4XYQA 1AP0A 2X69A 1UUPA 2WKDA 4JBWA 1O7LA 1BOSA 2F0WA 5DLQE 1GUGA 5EPLA 3CHBD 1F2MA 2NN6G 5COYA 2X6LA 4NKLA 4Y52H 4PZ6A 3OWEB 3A56A 1O7IA 4A3BH 5G3LD 1LLRD 3T56B 3RLFA 4M1UB 1XJVA 1YJWA 1A8VA 2EYJA 1DJRD 5M5WH 2PNHA 2H5XA 5BN4A 5FO8B 5JEAG 1H9SA 1CSPA 3T53B 1YJNA 2HD3A 1P16A 4P74A 3S15H 5EPJA 2B29A 4DAYB 5K36G 5JJLA 1WVLA 3OTOL 2F0VA 1SRUA 3GO5A 2Z4IA 3P7JA 4O2DA 1BO0A 2AWOA 5CV9A 4A3KG 2ZTEA 1V8QA 3GTPB 1AE3A 2QGQA 2E2DC 2AKWB 5LL6X 2QDBA 1LT6D 1YEZA 2IHEA 1UNSA 4OIJA 2BOSA 1BCPD 1CQFA 4KY5A 4LFAL 1FJGL 5C0XI 3BYYB 4JOIC 2RF4A 1STHA 2PMZE 2RHSB 2WP8J 3CCQA 4RGMA 3U58A 1PH3A 4LW1A 5M3FH 1E2WA 1PZID 3NK9A 3URYA 3GTKH 1UEBA 4HIOA 1N8RC 1BQQT 4P71A 3PO3H 1HFGA 1KTKA 4BY7B 1EZ6A 4R9WA 3GV3A 4AQYQ 1KABA 2HQLA 2EXDA 2B63B 1QJOA 3AFPA 4FNFA 1EY4A 3CP0A 1WTQA 2IPKD 5KYLA 4DR5L 1HJPA 3J7AV 3M4OH 3D3RA 2Y0SB 2G9HD 3NWSA 3P1HA 2A6ED 1BXTA 2HIVA 1GHKA 2O4XA 2YTXA 4A93B 4BXXG 5J39A 2IWHA 1F9PA 2UXBL 1ILPA 1T9HA 2RQXA 1VQNA 1AW7A 3S2HB 3OW2A 5L37A 4GLVB 3H0GG 4ME3A 4CDCC 1UWVA 4OO1H 4EQPA 1NTGA 3X3MA 1NJIC 4FF4A 2WACA 1I50H 3EVQA 2Q8RE 3NBIA 1PXUA 4RFBA 4PV1C 4OX9Q 3S24A 1OXXK 2ZTCA 4HMIA 3GTQB 3UDIA 2IY5B 1A6XA 5K5PA 5LL6S 3AFQA 3QB3A 1Y8NB 3HOUB 2FMCA 5T1IA 3AU7A 4AQYL 4DAVA 3E6ZX 2H1EA 1D5MC 1PH8A 3PUVA 2VXWA 1JOQA 2O2LD 2ENBA 5DM73 1XPOA 1Z9FA 1WTWA 3PQIA 2FFKB 3OOCA 1S5CD 3J7YW 1Z7TA 1GOZA 2IX3A 5IYDH 1S3OA 1TS4A 2GA4B 4DXFA 3MZ5A 1EYGA 3S1MB 2NYZD 1TWFH 1X56A 4L6TB 4UY8C 1FL0A 2E2IB 1KLGD 1Y69U 2Q8TA 3MTSA 5T1GA 4RHRA 3Q24A 1VQHA 3GD7A 4HMJA 3HKZE 3M4OB 3EA6A 2KHJA 4L8JA 4JI0Q 2GN5A 4L5TA 2EIFA 4IZ8A 3RLOA 2UXCQ 4OEMB 4ALPA 3K57A 1K83B 4GKKQ 4ZRZA 1CI3M 4A3EH 2F03A 4ZK9B 5FOBB 5C4JB 1AH9A 3C1FA 3T4AC 1XMQQ 1SXTA 2F0SA 4OX9L 4OL7A 3I4LA 5GAGC 5M3MG 4LUOA 1A3UA 4FYDA 1II3A 4Y7NB 2CW0D 1V1OA 5BR8Q 5FO9B 2VW9A 4OO1I 2F3VA 3D4RA 1JJ2A 2CWAA 3RZDH 1MSGA 1Y1WB 2WAQE 2K05A 3LWEA 2NN6H 4GLXA 1VMCA 3C46A 4YHHQ 2PQEA 2PZUA 5ELOA 4ZYSA 1LTLA 2AHOB 2F0MA 4PQXA 4Q0FA 1SFOH 5A2QE 1MIUA 3NQTA 3M7GA 2F0EA 1K3BC 3DM1A 1GUSA 4RAUC 3QR8A 4DV2Q 2VL6A 3ITPA 2K33A 2ZJPA 5K36H 4YCVA 3GTLH 3OWFA 2VB2X 1HFNA 2ZXOA 1SE3A 3DEOA 1PTOF 2ALYB 1K28A 1B9NA 4A3KH 1CA6A 2DY8A 4JI0L 1YNXA 3R8BA 3K5LA 3J7A5 4YCUA 5EAYA 2UXCL 1HZAA 3VA7A 4GKKL 2VNUD 2M00A 1S4ZA 1T5EA 1J6QA 3IKJA 2EYPA 3J7AF 1E1OA 1TWFB 5C5MA 1NBWA 2F0QA 1XMQL 1PFNA 2KBNA 5C44G 1WTHA 3FMCA 3KLSA 4IJLA 4UDUC 1IYJB 5EBDA 3S1RB 5BR8L 3PO2G 1YNND 3AQQA 1IBMQ 3CD6A 4IOAA 1YHBA 2DNCA 3DXJC 3I4MG 1KQSA 1OXTA 1KDAA 1WCMG 3TP6A 1BF4A 5DAUA 4A3LG 1VQBA 4DV6Q 2K14A 4POFA 1A62A 1E24A 1F9QA 4YHHL 1QILA 2MO0A 2VB3X 4FP5D 5J22A 2I5HA 3E9HA 4RGNA 4UP8A 2L15A 3A8JE 2GVBA 1D5ZC 3J80L 4QQBX 2OXPA 1GUWA 1JWMD 2KENA 3SK6A 2B2WC 1K8AC 4DV2L 3R2IA 2P5ZX 1W6KA 2NN6I 1HA5A 1X32A 1STGA 2RHQB 1SYDA 5J1ZA 3BU2A 1Y8PB 1PZJD 4LF4Q 3H3VI 4IUUA 5JVG3 4KKTA 3H91A 2EYLA 3FRPB 3H0GH 1SFOB 1QVFA 2EYFA 3NXWA 4AIMA 1MJEA 4EQ5A 3G4SA 2QA4A 3KF8A 1PFBA 2V1CC 3L9AX 1CK1A 4AYBE 1ASYA 2EQSA 1LO5D 3CPFA 5CC4A 1Y8OB 1DD2A 4HJ7A 1TWGB 2A69C 5FO7B 2LSSA 3SXHA 1IBML 2EJFC 3I4NB 4LMQD 3HOXB 2DGYA 2Q2IA 4QCLA 2EZVA 4DV6L 2F0DA 4JV5Q 4R8NA 1R4PB 3HG9A 5IT9L 3ICEA 2K5WA 2NB0A 3W1BA 2L0CA 3RMHA 1PV4A 4BY7G 1CA5A 5ELCA 3STBD 5C4XB 4QMGA 5NUCA 1IBLQ 3J80c 1KNAA 2B63G 2Q2TA 1PTOH 4YWKA 3S1NB 2UUBQ 4XQNA 1SMYC 4YIJA 2Y0SG 3A8IE 1BUVT 3K7AH 4KJOA 4HN7A 1SE2A 1S5FD 2G9DA 1G6ZA 1VF5C 2LKVA 1W3SA 4LF4L 1YBYA 5E7NA 1EWCA 1BNZA 2L55A 2MJ8A 5ISRA 3GTOB 4A93G 3IFDA 1QUQB 4CBVA 4KMUC 4R4TA 1OXVA 4IPGA 1AN8A 3M85A 1BCPC 1C9OA 3GQBA 5IGCA 4ZQ3A 2KCMA 3QOLA 2QKIC 1YHAA 2YU9B 2WKCA 1PTOC 1KC8C 3KK7A 1Q8IA 4EQNA 4DR7Q 1B7YB 4JI2Q 4IO9A 3VR2A 2OF1A 5E3FA 3HOZB 1Q86C 3NUCA 4QY7A 3K58A 1WJJA 1ET9A 3DUZA 1LTID 5IT9c 1STEA 3K0XA 4GKJQ 3KJPA 4IUQA 3JAML 1IL8A 4K8JA 5FLXL 1DOKA 4J15A 4EQOA 1JC7A 5HGTA 3HOUG 3J81j 3KDFA 1IBLL 2EY1A 5I9PA 2XRQD 1GD7A 2RCFA 3CQZH 3E9IA 4JVZA 5JVH3 1DM0B 1N32Q 4UP9A 1HZ9A 2CH4A 2UUBL 1PLFA 2B2UC 3K0YA 2XGTA 4KKUA 2A6EC 1TS3A 2OT2A 2PZWA 1VQAA 2ASBA 1EOVA 4R1JA 3L2PA 5KNBA 3F1ZA 4DV5Q 2SDFA 2K75A 2PW5A 5LHY1 5IP7G 4OIKA 4GNXC 4IPCA 3S1QH 3TP5A 4GZYC 1BCPB 4ID6A 4HSPA 1EQVA 1KL9A 2JA9A 3VYSA 1B50A 5CMDA 3KFUA 1PTOB 1RTNA 1UE5A 2E75C 4DKAC 1D8LA 3KF6B 3WWVA 3QWNA 3SDZA 2EPBA 4N8X1 4HJ9A 4MZ9A 1CM9A 3ND9A 1PH6A 4O0AA 5C3XA 1K3RA 1RCVD 4DR7L 3GTGB 1EZ8A 5C44H 4JI2L 1F9SA 1EOTA 4KHPQ 3ND8A 3J81E 4RHSA 3PO2H 1VS0A 3S2DB 3VYTA 5EKKA 5C4ZA 3I4MH 3BVMA 1J8IA 1WCMH 3RN5A 2KUMA 4A3LH 4GKJL 1NAPA 2EJGC 5CBEE 4DV0Q 5FLXc 3HKSA 2XWBB 2IT1A 1X65A 1EQTA 2KVMA 1Y1WG 1EFWA 1K9MC 1A3VA 4DAPA 4DV4Q 1LT4D 1N32L 2NUCA 2WIIB 4CKCA 3J7ZC 4L5SA 4A3GB 3CMAA 2EYOA 4P75A 1PRTD 4G7OC 4F8MA 1GM5A 2D0PA 1X6OA 4GNXB 3AYHB 4ODGA 3PUWA 2I0QA 5I9OA 1ZXTA 4B3TQ 2JXMB 3I4OA 2J0TD 4TKOB 5ELEA 2VUMB 4HIDA 3Q23A 1VQIA 1Y14B 3CRLC 5EBCA 3H09A 4HAEA 5E4XA 4C1NK 1K8GA 2O5JC 2CWPA 1O7YA 3MC0B 4I7ZC 3GTPH 3SK5A 4NP5A 5C5LA 1TWAH 3BDCA 3E0JA 3SK8A 2JE6I 3T1YQ 4X66Q 4KHPL 4U68A 2YV5A 3H15A 3NQIA 2KCNA 3NEMA 1I4QA 3LX0A 2Q2HA 3BVZA 1LACA 4DK3C 4JC0A 3D6CA 1XXGA 4DV0L 3VA5A 3MFGA 2N8NA 3HOVB 4UPAA 1FNUA 1AEXA 4DV4L 1H9JA 1I94Q 3GP7A 2CKZB 2SNMA 4O42A 4X64Q 1VQMA 4JI5Q 1GUTA 2JK8A 2CQOA 2B63H 1G91A 5AFWA 1IW7C 4LF9Q 4X3TA 4R4QA 2EXZA 1B2TA 1HUMA 2JQOA 3K7UC 4DR2Q 2WB1E 5C6AA 4WORA 3HS0C 3O13A 1WD0A 4B3TL 2NZOA 3KOJA 1S40A 4A93H 1KXLA 1V43A 5C4HA 3M7NA 2AQ1B 4PNYA 1VCIA 4JOIA 3C1EA 3MA2B 1Y1VB 3S2HH 1SYCA 1X3PA 4MTKA 2DUDA 4DR5Q 1J9OA 1LM0A 1G8ZD 4X66L 3T1YL 1YHQA 4LUZA 3FKIB 4RWSC 3A74A 3RN2A 2PI2E 2E2JB 3KJOA 5M5YB 3SK4A 4PZ8A 3Q8DA 4DA2A 3D8GA 1EU3A 4G7HC 1B44D 2E74C 1EIHA 5IY0A 2HUGA 1CZWA 3GTQH 4K8IA 2UXBQ 3I4NG 4BA1I 2QEJC 3HOXG 3Q22A 5HY6A 5KYIA 1ASZA 1TWAB 1I94L 3HOUH 1T5XD 2BE5C 4EGVA 3VDYA 4X64L 2E2HH 4JI5L 1HNZQ 4JI8Q 3J80i 3NENA 2ZXPA 3G48A 2K32A 1VQFA 1C48A 4BWGB 3PCOB 5C4XG 4LF9L 2MNAA 1RD9D 3BS1A 4X3KA 2JA8B 4IPHA 4E6IA 1TIID 2CFMA 1JWUD 2MHVA 4DR2L 4R8IA 2IX1A 1E2ZA 3S1MH 3A55A 4A3CG 1QE6A 4K14A 5IP7H 4C3JB 1BBXC 4TQUS 3E3XA 3SEBA 3MXPA 3DLLA 1WD1A 2E2IH 4QUCA 4GN3B 1TR5A 1G2SA 3NHHA 1HCZA 3CCRA 4BY1B 3D4DA 4CJ2C 2FINB 3CMEA 1N36Q 1K83H 4ZCKA 4IOCA 2HHHQ 2F0GA 5C4JH 2L12A 1CHQD 5CBAE 4IFDJ 1HR0Q 3PF5A 3CCSA 2NVQH 3ZJYC 1HRJA 3OIQA 1GKHA 5IIFA 4F88A 5KNDA 4Y7NH 2LFNA 3I73A 1Z47A 4QJFA 2ZT9C 3HOZG 4QIWB 3OMGA 1EIFA 1GXDC 1QVCA 1TY2A 3OIPA 1Y1WH 1IHZA 1D6EC 4JG2A 3TDQA 1L1OB 4ILWA 1HNZL 4JI8L 3RZOH 1L0XB 1N33Q 1HPCA 4DUZQ 3T13A 4GN5A 4GOPC 2NBFA 4KN7C 4DV7Q 1STAA 3QG1A 4DR1Q 1TWCB 3EFXD 3K5NA 4OXPA 2B2YC 1IYVA 2E2HB 4R4CA 2J4XA 2DY7A 2PI2A 2E5LQ 4DNRB 4ZKCB 1FVIA 5EQ0A 4KN4C 5D3DA 3I7FA 1U4PA 2QF7A 2JN4A 2AMCB 4RMFA 3HOWB 2K4KA 1N36L 3PGZA 4DR3Q 1KHIA 5A2QL 4CDEC 4WJ3M 1PH1A 3EBEA 3DWPA 2QEXA 2HHHL 4IFDG 5C3WA 3U50C 1I6VC 1JE5A 1HR0L 3G7LA 4V0BA 3L3OC 3TBIB 1ML0D 2EJMA 3SHLA 4JI4Q 3S1RH 3GTMB 3WOFA 4XIGS 4H02A 1YNJC 2IJ0A 5IYBG 3KLWA 4PG3A 3T16A 3CXCA 1I4PA 2QCPX 4B3SQ 2F1MA 4ME5A 2UUAQ 3X3NA 1N33L 2UUCQ 1NR4A 2OTLA 1ZYRD 4GOPB 4LF7Q 2AQ2B 3QIAA 1VQCA 4DPGA 2EYHA 1HZBA 4DUZL 4A75A 1UE1A 1X3FA 2K5DA 1C4QA 2NVQB 4IN3A 4DV7L 1X3GA 4TVAB 4DR1L 2NWGA 4K5WA 4A3GG 2B2TC 4RGOS 2BH8A 3I3CA 5G3LF 2PPBC 1K8MA 3RUZA 5H1SE 5ELDA 2NZ1D 1FGBD 3E5SA 4CGYB 1SYGA 4H7BA 4HEDA 2A6HC 4LUVA 4RKLA 2PW7A 3RZOB 1C8CA 2E5LL 2VUMG 1TWHB 3MAQA 1TKWB 1AFPA 1JT8A 2UU9Q 5GROA 5BN3A 4DR3L 1QCBD 2Z4HA 4HJ5A 1X3EA 3IAYA 4UHVA 3TMEA 1Q3LA 2K04A 1NR2A 3MWYW 1BCPF 2HDLA 3LWUA 4ABNA 3TS0A 1EQRA 4JI4L 4L5RC 4JBJA 1TWGH 1RF2D 2DNEA 2F4VQ 3I4NH 2IX0A 3I8ZA 3HOXH 1UE6A 2YTYA 4KHVA 4B3SL 1NSNS 1I5FA 4OWWB 1WI5A 1PVOA 2UUAL 5DM63 2B39A 2UUCL 4JK1C 2B2WA 3HOVG 4LF7L 1E1TA 5FLMG 2K5NA 1S72A 1C7YA 2KJXA 1DZ1A 3GV6A 3HEJA 2I5LX 4C3HB 5C4XH 2R93B 2XTIA 2NVXB 1VQPA 5I6YA 2L4NA 1F2ZA 1N34Q 3S1NH 2K28A 4FDBA 4A3CH 3CCEA 3NWTA 4QGUA 4ZKBB 1HXYD 1WOCA 1GUOA 1ENCA 3IFTA 1LTBD 4WJ4A 1QUQA 5LMUQ 2EY2A 3GTOH 2ID0A 1U9RA 4KHZA 3CCJA 3BZCA 4B3RL 2UU9L 2YTVA 2Z6KC 1QB5D 2VS1A 3NTKA 4FF2A 2K50A 1Y1VG 1QOHA 2RDFA 5DNFA 2JA6B 3ER0A 2YU9H 2OQKA 2F4IA 4LFBQ 1I3QB 3FKIG 1X3QA 2PMZB 2JEAI 4KKSA 1CUKA 3C3LA 2F4VL 2A68C 3UI2A 3BYTB 4X3UA 1ICFB 4DFAA 3HOZH 2N78A 1IKLA 4N9TA 4KI0A 4IUNA 1YIJA 1HR0W 1MSHA 2HQEA 3K5OA 4Q5VA 3ONAB 5KRUA 1DOMA 2AUJD 1E0BA 4A3JB 5IP9G 1GHJA 2ICEC 1N34L 1JB3A 3MVVA 4IALA 4CDFC 3OSOA 3GDEA 1TS5A 4JI7Q 1X9NA 1R9TB 2JA8G 3QOJA 4UAIA 2M2LA 1HHVA 5LMUL 1JICA 1NMGA 4FVMA 1OO9B 1OTCA 1JOKA 2KCCA 4C3JG 2TMPA 2RVLA 2NTTA 3KF6A 3MXNB 2KCTA 1XYIA 2SOBA 2BH2A 4BY1G 4JI6Q 4AH6A 1CKNB 1Q1EA 5IOCA 1SNPA 3CPWA 4UP7A 4LFBL 4IFDH 4L5QA 2BDNA 2B3GA 3GTGH 4X62Q 1VQ9A 2NVTH 3R2TA 5I6WA 4LF8Q 2LXKA 3S2DH 1QNUA 4IJHA 1HNWQ 3BDLA 1EIYB 1CHPD 5IYCH 5IYBH 3LGJA 1VQ5A 2ZM6Q 4U673 1LTTD 2K7VA 2QDLA 2B2UA 2K03A 4ZLTF 4S3SA 3UE1A 4FF1A 1TVXA 2F0UA 2MUYA 3FHWA 2EVBA 1YJ9A 3SR1A 1KDBA 1SE8A 1Q81C 1I6HB 2QILA 1XNQQ 3DM3A 5J3BA 1MGSA 3EN2A 4GNXA 3S17B 4A3GH 1JMCA 5IGEA 1KRTA 1R4QB 4DN4M 3J81L 2DN8A 4JI7L 3K6OA 2I07B 3I72A 1PH4A 4JBKA 3FEWX 5EPKA 4RA8A 4XDXA 1MI2A 1V9PA 1NUCA 1JJCB 2PQAA 4MTNA 3HKZB 2VUMH 4I65A 3UDGA 1IYUA 4K6LA 4FXKC 4JI6L 4DGZA 4XQJA 1SNOA 2A1AA 1ET6A 1EY7A 2OWOA 4DF7A 3HOWG 4NW2A 4YY3Q 1EYCA 4J8QA 4X62L 2Y0SE 5FK9C 1VQ8A 1YITA 3U4ZA 4LF8L 1ZKOA 1XPRA 3W2DA 1JWSD 1HNWL 1AZQA 1SNCA 2K5HA 2XSCA 3TZUA 1HUNA 2XIWA 1NMFA 2ZM6L 2L11A 2A74C 2WAQB 5BN5A 2IW3A 1PH7A 4IFDI 3ERSX 4DR4L 3S16B 3GTJB 3HOVH 1EYDA 4RCNA 5FLMH 4ULLA 1O7ZA 2EDGA 4OWTB 4BBSH 1PZKD 3S9WA 3M4QA 1XNQL 4H44C 2NVTB 3HOYB 3MFYA 3RD4A 1SN8A 1UAPA 3J81c 1Z6HA 5M5XH 1IBKL 2D5DA 1SNMA 1PYWD 4KK7A 3U9OA 2J7ZA 1LT3D 1IZ6A 3PV0A 1WTVA 3JAMc 1RHPA 2Z0SA 1VQDA 4KTAA 3WOEA 2AQ3B 1SYEA 2BDOA 2K1BA 3DMUA 1LT5D 5CR3A 3S14B 4DAMA 2EY5A 5JJKA 1PYSB 2E76C 3A5ZB 2YYZA 4WRDA 1G51A 3LNNA 1SJED 1Y1VH 1JB7A 3CCMA 3CCLA 2M9VA 2R7FA 4A3DB 4EX5A 1B53A 4KLKA 4YY3L 5DEHA 4DAYA 1YZ6A 3FKIH 4HJ8A 3OHXC 4DU9A 2RKSA 2E2JH 5M5YH 1WYDA 2R92H 4POGA 3RLNA 2VQFQ 1F2YA 5KGUA 2EYMA 2N55A 1BBWA 1NCVA 4HCEA 3CC7A 1HQRD 4B9WA 4J6HA 2LXJA 1STNA 4JW0A 2C35B 1SNQA 1C0AA 1TXYA 1DXMA 4XQQA 4P73A 1EL0A 1A2UA 1TY0A 2OQ0A 5IP9H 5LMNQ 2K52A 2CW0C 4OHJA 4LF5Q 4C3HG 4CJ0B 2D0OA 2R93G 3CRKC 3PIOA 1Q1BA 3D31A 5KEEA 1RKNA 1X54A 2JA8H 2B2VC 4A3MH 2MPMA 4O1NA 1VQGA 5JOBA 1EY5A 1V1QA 2HCCA 1SEBD 3M4YA 2Z1CA 4A3IB 4C3JH 1ICWA 5C3EB 4BBSB 3CF5A 3AEVA 1M4VA 4JI3L 2KECA 1I4HA 4K5VA 4BY1H 1EWIA 3V96A 4JBMA 5M5XB 5IGDA 1H95A 3NBHB 1K8OA 4AYBB 1WTPA 1DCZA 5ELFA 3K8AA 5FJ8G 2JA5H 2R61A 2JA6G 1PA6A 2VQFL 1I4XA 2F0NA 4R4OA 3CCVA 5TSSA 1HNXQ 3DEPA 3MXGA 4BBRB 4X65Q 4NDXA 4A76A 1W2BA 1RJTA 1X55A 2F3IA 4K5XA 4LWCA 3PUZA 2XVSA 1TT2A 1EFID 1ESRA 3ULPA 1S5BD 3PSIA 1KRSA 2MGSA 3KUPA 1L1OA 2HT1A 3PMFA 3AMUA 1FGUA 2A69D 3CW2C 1V1PB 2D9UA 4MNOA 5LMNL 2R92B 1HA6A 1KAAA 2V4DA 4LF5L 1EIGA 1L0YB 1BDOA 1YNNC 1F2LA 1AE2A 3F2DA 2F3WA 4A3JG 3I91A 3V05A 1SNDA 4X6AH 1EEFD 3CAMA 3KBGA 1VDZA 5E1FA 3VR4A 4B9XA 4QB4A 2JA7B 1TWCH 4J1MA 1HTLD 1Q82C 3I55A 3T51B 1K73C 1SMYD 3Q6SA 2Q8IB 2R7ZB 1ENFA 1SLJA 1XNRQ 5CV5A 1D7QA 4G57A 1CZGA 1L0WA 1L1OC 2I46A 3HRZC 5AJ3Q 4NPSA 1SR3A 4OWXB 3HOWH 3G6EA 3K59A 4A3MB 3HGBA 3WDNA 2DJGC 3TZDA 4PMBA 2ZTDA 1FNVA 2R7DA 3I2ZA 4X65L 1HNXL 1JCKB 1QNKA 4H13C 2XWJB 3QJYA 1O78A 1PTOD 2H4OA 3GTMH 4JPBW 5IODA 3ULJA 5GADC 2KEDA 3L7ZC 1ENAA 1UE7A 3BVGA 4GOPA 2Z8LA 1BVSA 2NVYB 5IGBA 5F2DA 2JA5B 1BKBA 1B8AA 3TN2A 4RG1A 1STBA 1B9MA 2RCNA 4A3FB 4LFCQ 2B2YA 3H94A 4C2MH 2TSSA 1ESFA 3NSWA 1VF7A 3VR5A 3FPPA
chains in the Genus database with same CATH topology
4K0KL 2F4VQ 3RR5A 1KIXA 1QUQB 2IX0A 2PQAB 3I4NH 3E0EA 4R4TA 3HOXH 3KDFB 5IE8A 1UE6A 1OXVA 2YTYA 4IPGA 4B3SL 1I5FA 3M85A 1WI5A 4OWWB 1C9OA 1PVOA 2UUAL 2UUCL 2KCMA 1YHAA 3HOVG 4LF7L 1E1TA 5IYDG 5FLMG 4HIMA 3STBC 1SMXA 2K5NA 2VY3A 3UDXA 3T1HQ 1S72A 1C7YA 1XNRL 1XTDA 1KC8C 5JEAJ 4DR7Q 4HJAA 2I5LX 3PUXA 4NB3A 5C4XH 3HKZG 5AJ3L 1B7YB 2XTIA 4JI2Q 1TWHH 2D62A 4IO9A 1VQPA 2A8VA 1CKMA 3OTOQ 3IRBA 3UDFA 1KD1C 3TQYA 4XTCS 1N34Q 1Q86C 4LNQA 3S1NH 4QY7A 1VQ4A 1WJJA 4FDBA 4A3CH 1VQ6A 1PH9A 3CCEA 5IT9c 4QGUA 5GAEC 2NVYH 3K0XA 1PFSA 4GKJQ 4YCWA 1M1KC 2F52A 3KJPA 1OXUA 1WOCA 1XMOL 4J15A 1IXRA 4BY7H 4A3FH 4WJ4A 1MJCA 1K0RA 1QUQA 4GLAC 3J81j 5LMUQ 3HOUG 1EQQA 1QVGA 3KDFA 1IBLL 4IPDA 3GTOH 2ID0A 1GD7A 4A3EG 3CQZH 4LFAQ 4KHZA 4P72A 3CCJA 3E9IA 1N32Q 2VZAA 3W5OA 1FJGQ 1PH5A 3BZCA 4B3RL 2R6GA 4UP9A 1HZ9A 2YTVA 4PMWA 2UU9L 2Z6KC 1G6PA 2UUBL 4DV3L 2VS1A 2XGTA 2K50A 1Y1VG 2WAQG 2E8GA 3MEFA 4PZ7A 3ER0A 2YU9H 2OQKA 1VQAA 2ASBA 1EOVA 4R1JA 4LFBQ 3FP9A 4LFCL 4JBWA 3F1ZA 3FKIG 3L2PA 4DV5Q 2K75A 5DLQE 2JEAI 5IP7G 4DR6Q 3J81i 4GNXC 1CUKA 4IPCA 4C3HH 3S1QH 2NN6G 2OTJA 2NVXH 2R93H 2F4VL 3F2CA 3PUYA 4C3IH 4Y52H 4PZ6A 4DV1Q 3HOYG 1OXSC 1KL9A 1O7IA 2JA9A 3HOZH 3JAMi 3CC4A 2N78A 4A3BH 3RLFA 3KFUA 4GN4B 4KI0A 1J5EQ 1XJVA 1UE5A 4DKAC 5IYCG 1A8VA 1D8LA 3KF6B 1YJWA 3WWVA 5LMNW 5M5WH 2PNHA 2H5XA 4HJ9A 1YIJA 1HR0W 4MZ9A 3T1HL 5JEAG 2I5MX 2HIXA 1PH6A 4O0AA 1CSPA 1K3RA 4DR7L 1YJNA 1P16A 4P74A 5C44H 3S15H 2B29A 4DAYB 4JI2L 5K36G 4KHPQ 5JJLA 3OTOL 5IP9G 1SRUA 1VS0A 1IL2A 3PO2H 1N34L 3GO5A 3I4MH 4O2DA 1WCMH 2AWOA 3GDEA 3RN5A 4A3KG 5FJ8H 2ZTEA 2JA6H 4GKJL 4OONA 4JI7Q 1X9NA 2VQEQ 1AE3A 2QGQA 3EIVA 3TEHB 2AKWB 3L0OA 5FLXc 4DV0Q 2JA8G 3HKSA 2IHEA 1YEZA 2IT1A 1I3QH 1X65A 5LMUL 1NMGA 4A3LG 1Y1WG 1OTCA 1EFWA 1HZCA 1K9MC 4DV4Q 4LFAL 3PIPA 1N32L 1FJGL 5C0XI 1DGSA 1MKHA 3KF6A 3MXNB 4JOIC 3J7ZC 2KCTA 4L5SA 2RF4A 3CMAA 2PMZE 2RHSB 2WP8J 3CCQA 4P75A 3U58A 1PH3A 2BH2A 4BY1G 4JI6Q 2A19A 4AH6A 4NXNQ 4B3RQ 4LW1A 4LF6Q 1CKNB 5M3FH 1Q1EA 1GM5A 2D0PA 3CPWA 1X6OA 4GNXB 4UP7A 4LFBL 3AYHB 3GTKH 1UEBA 4L5QA 3PUWA 4HIOA 2I0QA 2N49A 2B3GA 1N8RC 4GS3A 4P71A 4DR6L 3GTGH 3PO3H 4X62Q 4B3TQ 1VQ9A 2NVTH 3I4OA 4A3JH 5HGQA 4LF8Q 4HIDA 4AQYQ 1VQIA 1Y14B 2LXKA 2HQLA 4DV1L 3S2DH 2EXDA 4IJHA 1HNWQ 2UXDQ 3AFPA 1EIYB 1K8GA 3H3VH 1E3PA 1J5EL 5IYCH 1U0LA 3CP0A 3LGJA 2N3SA 2CWPA 3OYYA 5IYBH 1HJPA 4DR5L 1VQ5A 3M4OH 3GTPH 2ZM6Q 1R9TH 2Z6KA 3NELA 1TWAH 2JE6I 3T1YQ 4X66Q 4A3IG 2HIVA 3UE1A 4KHPL 5C3EG 4BBSG 2YTXA 3FHWA 4BXXG 2YV5A 3H15A 1YJ9A 1CKNA 3NEMA 1SE8A 1Q81C 2OCEA 2Q2HA 1XNQQ 3DM3A 5J3BA 3EN2A 4GNXA 4A3GH 2UXBL 4DK3C 1JMCA 4JC0A 4DUYQ 1KRTA 1T9HA 4JI7L 2VQEL 2ZJQA 4DV0L 1VQNA 3OW2A 1PH4A 4GLVB 4B3MQ 3H0GG 4ME3A 4JBKA 2N8NA 1BBUA 1UWVA 4UPAA 4JI1Q 4APVA 4AYBG 5IWAQ 4JYAQ 1V9PA 1NTGA 4DV4L 1G291 1I94Q 1JJCB 1KAWA 2PQAA 1NJIC 4MTNA 2CKZB 4X64Q 1P8LA 1VQMA 2VUMH 5ELNA 1M90C 2JK8A 4JI5Q 1I50H 2CQOA 4BBRG 2B63H 2WFWA 3UDGA 2MO1A 4JI6L 4NXNL 4R4IA 3S24A 4LF6L 4OX9Q 3I56A 4LF9Q 1HH2P 2A1AA 1OXXK 2ZTCA 2BA1A 3UDIA 4R4QA 2OWOA 2IY5B 3HOWG 2JQOA 3AFQA 1N9WA 3K7UC 4YY3Q 2WB1E 5C0XJ 4DR2Q 4X62L 2Y0SE 1Q7YC 1VQ8A 4B3TL 1YITA 3U4ZA 2NZOA 3KOJA 1XPRA 4LF8L 5GAHC 1S40A 4AQYL 4A93H 2UXDL 3W1GA 2R92G 4YWLA 1I6HH 1VQOA 1HNWL 2CCZA 1PH8A 2K5HA 1KXLA 3PUVA 1V43A 3S17H 1E22A 1XPOA 3M7NA 1Z9FA 3RNUA 1NMFA 2ZM6L 1VCIA 4JOIA 3S2HH 4IFDI 1PH7A 3BJUA 2AWNA 3ERSX 2DUDA 4DR5Q 4DR4L 3HOVH 5FLMH 1S3OA 5IYDH 2JA7G 1LM0A 4X66L 3T1YL 1YHQA 4LUZA 3RN2A 2NZHA 3A74A 1EYGA 2PI2E 1JJGA 4OWTB 3KJOA 2ES2A 4BBSH 4JCVE 4BXXH 1TWFH 1X56A 3M4QA 3CCUA 4PZ8A 3Q8DA 1XNQL 4UY8C 1FL0A 2R7ZG 4DUYL 2Q2UA 1SN8A 2GVAA 3J81c 1VQHA 3GD7A 3HKZE 5IY0A 5M5XH 1IBKL 3GTQH 4B3ML 2UXBQ 3I4NG 4BA1I 1IZ6A 3PV0A 1A63A 4JI1L 2KHJA 5IWAL 3HOXG 3F2BA 4HIKA 3JAMc 4JI0Q 4JYAL 5HY6A 2GN5A 2Z0SA 1VQDA 2EIFA 4L5TA 4A3MG 1ASZA 3RLOA 1I94L 3HOUH 2UXCQ 4ALPA 3F8TA 3VDYA 2ATWA 4GKKQ 1VQJA 4X64L 2E2HH 3M4PA 4JI5L 1VQ7A 4A3EH 1HNZQ 4JI8Q 4DAMA 3J80i 1AH9A 3NENA 3G48A 4L5RC 1WFQA 1VQKA 1VQFA 1XMQQ 1PYSB 5JJKA 4OX9L 3A5ZB 1GVPA 1NE3A 3PCOB 5C4XG 2YYZA 5GAGC 5M3MG 4LF9L 2MNAA 1G51A 4LUOA 3CCLA 1Y1VH 1JB7A 3CCMA 5C0XG 2R7FA 3KYHC 3S16H 4EX5A 5BR8Q 3GTJH 4IPHA 3UE0A 2VW9A 1LYLA 2CFMA 4OO1I 1E7ZA 4KLKA 4YY3L 4DR2L 1JJ2A 2CWAA 1YZ6A 3FKIH 4HJ8A 3RZDH 2ZJRA 2IX1A 3S1MH 4A3CG 2E2JH 1PHJA 2WAQE 5IP7H 5M5YH 1WYDA 2JA5G 4POGA 2R92H 3RLNA 4TQUS 4GLXA 4QL5A 3TRZA 2VQFQ 3DLLA 2E2IH 4GN3B 4YHHQ 3G71A 4A3FG 3M9BA 5ELOA 2IHFA 3HOYH 1LTLA 1BBWA 3CCRA 2AHOB 1B70B 3CC7A 1SROA 3CC2A 2LXJA 1SFOH 1MIUA 4DK6C 2C35B 3TREA 3CMEA 1C0AA 2KHIA 2MQHA 1TXYA 4DR4Q 1N36Q 4DV2Q 2VL6A 1K83H 1VQLA 4P73A 2ZJPA 1EUJA 3BZKA 4IOCA 2HHHQ 3S14H 2OQ0A 4YCVA 5C4JH 4NXMQ 3GTLH 5IP9H 5LMNQ 2K52A 4IFDJ 1HR0Q 3PF5A 3CCSA 2NVQH 4LF5Q 3ZJYC 2ALYB 2D0OA 1GKHA 4YWMA 3PIOA 2R93G 1CSQA 4A3KH 1Q1BA 4Y7NH 3D31A 4A3DH 1CKOA 1X54A 1Z47A 1RIPA 4QJFA 4A3MH 4JI0L 2JA8H 1IBKQ 1YNXA 3HOZG 1VQGA 4A3BG 3J7A5 1V1QA 1EIFA 4YCUA 5EAYA 2MFIA 1HZAA 2UXCL 1QVCA 4GKKL 1Y1WH 1Q46A 4JG2A 3K80C 4DNIA 2VNUD 1L1OB 1J6QA 1HNZL 4C3JH 4JI8L 3RZOH 1N33Q 3CF5A 1E1OA 3AEVA 1XMQL 4JI3L 1NBWA 5M3MH 2KBNA 5C44G 1QZGA 3B6YA 4IJLA 4DUZQ 4BY1H 4GN5A 1IYJB 1EWIA 4GOPC 5BR8L 3PO2G 4JBMA 3AQQA 4DV7Q 1IBMQ 3CD6A 1A0IA 4IOAA 4DR1Q 1YHBA 3NBHB 1H95A 4JV5L 1QZHA 3I4MG 2BA0A 1KQSA 1OXTA 1WCMG 3K8AA 3U4VA 5FJ8G 2JA5H 2JA6G 1PA6A 3PF4A 1VQBA 4DV6Q 3M3YH 2K14A 1LUZA 4OXPA 1A62A 1E24A 4POFA 2VQFL 4YHHL 4R4OA 2MO0A 3CCVA 2I5HA 4R4CA 3A5UA 3E9HA 4X65Q 4A76A 1HNXQ 4A3DG 2PI2A 1W2BA 3KF8B 2F3IA 1X55A 3K81C 4UP8A 2L15A 2E5LQ 4LWCA 3PUZA 1FVIA 1YVCA 2GVBA 3ULPA 3PSIA 3ULLA 3I7FA 1KRSA 4QQBX 1L1OA 2HT1A 2AMCB 2KENA 4RMFA 1Q8KA 2K4KA 1FGUA 2K5VA 3CW2C 4DV2L 1N36L 1K8AC 3PGZA 4DR3Q 1KHIA 5M3FG 4WJ3M 4A3IH 3EBEA 2NN6I 2QEXA 1PH1A 2HHHL 2RHQB 4NXML 4IFDG 4MNOA 5C3EH 1NY4A 4QIWE 5LMNL 3U50C 3BU2A 1JE5A 5GQOA 1HR0L 4LF5L 3PO3G 2JEBI 1AE2A 4LF4Q 3H3VI 3F2DA 1Q12A 4A3JG 4JI4Q 3S1RH 4X6AH 3CAMA 4K0KQ 3H0GH 4XIGS 4H02A 1QVFA 1MJEA 4AIMA 1L2FA 4EQ5A 3G4SA 1RL2A 5IYBG 3KLWA 1PH2A 4PG3A 1TWCH 2FXQA 1GO3E 1U5KA 3CXCA 1Q82C 4B3SQ 3I55A 1YI2A 2QA4A 2UUAQ 2V1CC 3D0FA 1N33L 5JJIA 1K73C 2OTLA 2UUCQ 4AYBE 4GOPB 1ASYA 4LF7Q 4BBRH 1SLJA 2EQSA 1VQCA 1XNRQ 3A0JA 4A4IA 4DPGA 1HZBA 4DUZL 4A75A 1UE1A 1X3FA 3CPFA 1D7QA 3SGIA 4JI3Q 1L0WA 4HJ7A 1L1OC 1PYBA 5AJ3Q 4NPSA 2LSSA 4DV7L 1SR3A 1X3GA 2JJQA 4TVAB 4DR1L 1IBML 3HFZB 4OWXB 4A3GG 2BH8A 5H1SE 4BA2I 2DGYA 3G6EA 1VQEA 2Q2IA 3HOWH 4DV6L 4JV5Q 3JC66 3ICEA 2ZTDA 4LUVA 2R7DA 3I2ZA 3W1BA 4X65L 1XMOQ 1HNXL 4OO1G 1PV4A 2E5LL 4BY7G 3STBD 1IBLQ 2VUMG 3GTMH 3J80c 2B63G 3ULJA 5GADC 1JT8A 2Q2TA 3L7ZC 4A3LH 3TS2A 2UU9Q 1UE7A 4YWKA 5GROA 2JA7H 4DR3L 4GOPA 2WB1G 4DV3Q 2UUBQ 2Y0SG 1BVSA 4DV5L 3K7AH 4HJ5A 1X3EA 1BKBA 1B8AA 4RG1A 1XPUA 2R7ZH 2RCNA 4LFCQ 1W3SA 4LF4L 1YBYA 4C2MH 5E7NA 3TS0A 1EQRA 4JI4L 4A93G 4JBJA 1TWGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K L;  2F4V Q;  3RR5 A;  1KIX A;  1QUQ B;  2IX0 A;  2PQA B;  3I4N H;  3E0E A;  4R4T A;  3HOX H;  3KDF B;  5IE8 A;  1UE6 A;  1OXV A;  2YTY A;  4IPG A;  4B3S L;  1I5F A;  3M85 A;  1WI5 A;  4OWW B;  1C9O A;  1PVO A;  2UUA L;  2UUC L;  2KCM A;  1YHA A;  3HOV G;  4LF7 L;  1E1T A;  5IYD G;  5FLM G;  4HIM A;  3STB C;  1SMX A;  2K5N A;  2VY3 A;  3UDX A;  3T1H Q;  1S72 A;  1C7Y A;  1XNR L;  1XTD A;  1KC8 C;  5JEA J;  4DR7 Q;  4HJA A;  2I5L X;  3PUX A;  4NB3 A;  5C4X H;  3HKZ G;  5AJ3 L;  1B7Y B;  2XTI A;  4JI2 Q;  1TWH H;  2D62 A;  4IO9 A;  1VQP A;  2A8V A;  1CKM A;  3OTO Q;  3IRB A;  3UDF A;  1KD1 C;  3TQY A;  4XTC S;  1N34 Q;  1Q86 C;  4LNQ A;  3S1N H;  4QY7 A;  1VQ4 A;  1WJJ A;  4FDB A;  4A3C H;  1VQ6 A;  1PH9 A;  3CCE A;  5IT9 c;  4QGU A;  5GAE C;  2NVY H;  3K0X A;  1PFS A;  4GKJ Q;  4YCW A;  1M1K C;  2F52 A;  3KJP A;  1OXU A;  1WOC A;  1XMO L;  4J15 A;  1IXR A;  4BY7 H;  4A3F H;  4WJ4 A;  1MJC A;  1K0R A;  1QUQ A;  4GLA C;  3J81 j;  5LMU Q;  3HOU G;  1EQQ A;  1QVG A;  3KDF A;  1IBL L;  4IPD A;  3GTO H;  2ID0 A;  1GD7 A;  4A3E G;  3CQZ H;  4LFA Q;  4KHZ A;  4P72 A;  3CCJ A;  3E9I A;  1N32 Q;  2VZA A;  3W5O A;  1FJG Q;  1PH5 A;  3BZC A;  4B3R L;  2R6G A;  4UP9 A;  1HZ9 A;  2YTV A;  4PMW A;  2UU9 L;  2Z6K C;  1G6P A;  2UUB L;  4DV3 L;  2VS1 A;  2XGT A;  2K50 A;  1Y1V G;  2WAQ G;  2E8G A;  3MEF A;  4PZ7 A;  3ER0 A;  2YU9 H;  2OQK A;  1VQA A;  2ASB A;  1EOV A;  4R1J A;  4LFB Q;  3FP9 A;  4LFC L;  4JBW A;  3F1Z A;  3FKI G;  3L2P A;  4DV5 Q;  2K75 A;  5DLQ E;  2JEA I;  5IP7 G;  4DR6 Q;  3J81 i;  4GNX C;  1CUK A;  4IPC A;  4C3H H;  3S1Q H;  2NN6 G;  2OTJ A;  2NVX H;  2R93 H;  2F4V L;  3F2C A;  3PUY A;  4C3I H;  4Y52 H;  4PZ6 A;  4DV1 Q;  3HOY G;  1OXS C;  1KL9 A;  1O7I A;  2JA9 A;  3HOZ H;  3JAM i;  3CC4 A;  2N78 A;  4A3B H;  3RLF A;  3KFU A;  4GN4 B;  4KI0 A;  1J5E Q;  1XJV A;  1UE5 A;  4DKA C;  5IYC G;  1A8V A;  1D8L A;  3KF6 B;  1YJW A;  3WWV A;  5LMN W;  5M5W H;  2PNH A;  2H5X A;  4HJ9 A;  1YIJ A;  1HR0 W;  4MZ9 A;  3T1H L;  5JEA G;  2I5M X;  2HIX A;  1PH6 A;  4O0A A;  1CSP A;  1K3R A;  4DR7 L;  1YJN A;  1P16 A;  4P74 A;  5C44 H;  3S15 H;  2B29 A;  4DAY B;  4JI2 L;  5K36 G;  4KHP Q;  5JJL A;  3OTO L;  5IP9 G;  1SRU A;  1VS0 A;  1IL2 A;  3PO2 H;  1N34 L;  3GO5 A;  3I4M H;  4O2D A;  1WCM H;  2AWO A;  3GDE A;  3RN5 A;  4A3K G;  5FJ8 H;  2ZTE A;  2JA6 H;  4GKJ L;  4OON A;  4JI7 Q;  1X9N A;  2VQE Q;  1AE3 A;  2QGQ A;  3EIV A;  3TEH B;  2AKW B;  3L0O A;  5FLX c;  4DV0 Q;  2JA8 G;  3HKS A;  2IHE A;  1YEZ A;  2IT1 A;  1I3Q H;  1X65 A;  5LMU L;  1NMG A;  4A3L G;  1Y1W G;  1OTC A;  1EFW A;  1HZC A;  1K9M C;  4DV4 Q;  4LFA L;  3PIP A;  1N32 L;  1FJG L;  5C0X I;  1DGS A;  1MKH A;  3KF6 A;  3MXN B;  4JOI C;  3J7Z C;  2KCT A;  4L5S A;  2RF4 A;  3CMA A;  2PMZ E;  2RHS B;  2WP8 J;  3CCQ A;  4P75 A;  3U58 A;  1PH3 A;  2BH2 A;  4BY1 G;  4JI6 Q;  2A19 A;  4AH6 A;  4NXN Q;  4B3R Q;  4LW1 A;  4LF6 Q;  1CKN B;  5M3F H;  1Q1E A;  1GM5 A;  2D0P A;  3CPW A;  1X6O A;  4GNX B;  4UP7 A;  4LFB L;  3AYH B;  3GTK H;  1UEB A;  4L5Q A;  3PUW A;  4HIO A;  2I0Q A;  2N49 A;  2B3G A;  1N8R C;  4GS3 A;  4P71 A;  4DR6 L;  3GTG H;  3PO3 H;  4X62 Q;  4B3T Q;  1VQ9 A;  2NVT H;  3I4O A;  4A3J H;  5HGQ A;  4LF8 Q;  4HID A;  4AQY Q;  1VQI A;  1Y14 B;  2LXK A;  2HQL A;  4DV1 L;  3S2D H;  2EXD A;  4IJH A;  1HNW Q;  2UXD Q;  3AFP A;  1EIY B;  1K8G A;  3H3V H;  1E3P A;  1J5E L;  5IYC H;  1U0L A;  3CP0 A;  3LGJ A;  2N3S A;  2CWP A;  3OYY A;  5IYB H;  1HJP A;  4DR5 L;  1VQ5 A;  3M4O H;  3GTP H;  2ZM6 Q;  1R9T H;  2Z6K A;  3NEL A;  1TWA H;  2JE6 I;  3T1Y Q;  4X66 Q;  4A3I G;  2HIV A;  3UE1 A;  4KHP L;  5C3E G;  4BBS G;  2YTX A;  3FHW A;  4BXX G;  2YV5 A;  3H15 A;  1YJ9 A;  1CKN A;  3NEM A;  1SE8 A;  1Q81 C;  2OCE A;  2Q2H A;  1XNQ Q;  3DM3 A;  5J3B A;  3EN2 A;  4GNX A;  4A3G H;  2UXB L;  4DK3 C;  1JMC A;  4JC0 A;  4DUY Q;  1KRT A;  1T9H A;  4JI7 L;  2VQE L;  2ZJQ A;  4DV0 L;  1VQN A;  3OW2 A;  1PH4 A;  4GLV B;  4B3M Q;  3H0G G;  4ME3 A;  4JBK A;  2N8N A;  1BBU A;  1UWV A;  4UPA A;  4JI1 Q;  4APV A;  4AYB G;  5IWA Q;  4JYA Q;  1V9P A;  1NTG A;  4DV4 L;  1G29 1;  1I94 Q;  1JJC B;  1KAW A;  2PQA A;  1NJI C;  4MTN A;  2CKZ B;  4X64 Q;  1P8L A;  1VQM A;  2VUM H;  5ELN A;  1M90 C;  2JK8 A;  4JI5 Q;  1I50 H;  2CQO A;  4BBR G;  2B63 H;  2WFW A;  3UDG A;  2MO1 A;  4JI6 L;  4NXN L;  4R4I A;  3S24 A;  4LF6 L;  4OX9 Q;  3I56 A;  4LF9 Q;  1HH2 P;  2A1A A;  1OXX K;  2ZTC A;  2BA1 A;  3UDI A;  4R4Q A;  2OWO A;  2IY5 B;  3HOW G;  2JQO A;  3AFQ A;  1N9W A;  3K7U C;  4YY3 Q;  2WB1 E;  5C0X J;  4DR2 Q;  4X62 L;  2Y0S E;  1Q7Y C;  1VQ8 A;  4B3T L;  1YIT A;  3U4Z A;  2NZO A;  3KOJ A;  1XPR A;  4LF8 L;  5GAH C;  1S40 A;  4AQY L;  4A93 H;  2UXD L;  3W1G A;  2R92 G;  4YWL A;  1I6H H;  1VQO A;  1HNW L;  2CCZ A;  1PH8 A;  2K5H A;  1KXL A;  3PUV A;  1V43 A;  3S17 H;  1E22 A;  1XPO A;  3M7N A;  1Z9F A;  3RNU A;  1NMF A;  2ZM6 L;  1VCI A;  4JOI A;  3S2H H;  4IFD I;  1PH7 A;  3BJU A;  2AWN A;  3ERS X;  2DUD A;  4DR5 Q;  4DR4 L;  3HOV H;  5FLM H;  1S3O A;  5IYD H;  2JA7 G;  1LM0 A;  4X66 L;  3T1Y L;  1YHQ A;  4LUZ A;  3RN2 A;  2NZH A;  3A74 A;  1EYG A;  2PI2 E;  1JJG A;  4OWT B;  3KJO A;  2ES2 A;  4BBS H;  4JCV E;  4BXX H;  1TWF H;  1X56 A;  3M4Q A;  3CCU A;  4PZ8 A;  3Q8D A;  1XNQ L;  4UY8 C;  1FL0 A;  2R7Z G;  4DUY L;  2Q2U A;  1SN8 A;  2GVA A;  3J81 c;  1VQH A;  3GD7 A;  3HKZ E;  5IY0 A;  5M5X H;  1IBK L;  3GTQ H;  4B3M L;  2UXB Q;  3I4N G;  4BA1 I;  1IZ6 A;  3PV0 A;  1A63 A;  4JI1 L;  2KHJ A;  5IWA L;  3HOX G;  3F2B A;  4HIK A;  3JAM c;  4JI0 Q;  4JYA L;  5HY6 A;  2GN5 A;  2Z0S A;  1VQD A;  2EIF A;  4L5T A;  4A3M G;  1ASZ A;  3RLO A;  1I94 L;  3HOU H;  2UXC Q;  4ALP A;  3F8T A;  3VDY A;  2ATW A;  4GKK Q;  1VQJ A;  4X64 L;  2E2H H;  3M4P A;  4JI5 L;  1VQ7 A;  4A3E H;  1HNZ Q;  4JI8 Q;  4DAM A;  3J80 i;  1AH9 A;  3NEN A;  3G48 A;  4L5R C;  1WFQ A;  1VQK A;  1VQF A;  1XMQ Q;  1PYS B;  5JJK A;  4OX9 L;  3A5Z B;  1GVP A;  1NE3 A;  3PCO B;  5C4X G;  2YYZ A;  5GAG C;  5M3M G;  4LF9 L;  2MNA A;  1G51 A;  4LUO A;  3CCL A;  1Y1V H;  1JB7 A;  3CCM A;  5C0X G;  2R7F A;  3KYH C;  3S16 H;  4EX5 A;  5BR8 Q;  3GTJ H;  4IPH A;  3UE0 A;  2VW9 A;  1LYL A;  2CFM A;  4OO1 I;  1E7Z A;  4KLK A;  4YY3 L;  4DR2 L;  1JJ2 A;  2CWA A;  1YZ6 A;  3FKI H;  4HJ8 A;  3RZD H;  2ZJR A;  2IX1 A;  3S1M H;  4A3C G;  2E2J H;  1PHJ A;  2WAQ E;  5IP7 H;  5M5Y H;  1WYD A;  2JA5 G;  4POG A;  2R92 H;  3RLN A;  4TQU S;  4GLX A;  4QL5 A;  3TRZ A;  2VQF Q;  3DLL A;  2E2I H;  4GN3 B;  4YHH Q;  3G71 A;  4A3F G;  3M9B A;  5ELO A;  2IHF A;  3HOY H;  1LTL A;  1BBW A;  3CCR A;  2AHO B;  1B70 B;  3CC7 A;  1SRO A;  3CC2 A;  2LXJ A;  1SFO H;  1MIU A;  4DK6 C;  2C35 B;  3TRE A;  3CME A;  1C0A A;  2KHI A;  2MQH A;  1TXY A;  4DR4 Q;  1N36 Q;  4DV2 Q;  2VL6 A;  1K83 H;  1VQL A;  4P73 A;  2ZJP A;  1EUJ A;  3BZK A;  4IOC A;  2HHH Q;  3S14 H;  2OQ0 A;  4YCV A;  5C4J H;  4NXM Q;  3GTL H;  5IP9 H;  5LMN Q;  2K52 A;  4IFD J;  1HR0 Q;  3PF5 A;  3CCS A;  2NVQ H;  4LF5 Q;  3ZJY C;  2ALY B;  2D0O A;  1GKH A;  4YWM A;  3PIO A;  2R93 G;  1CSQ A;  4A3K H;  1Q1B A;  4Y7N H;  3D31 A;  4A3D H;  1CKO A;  1X54 A;  1Z47 A;  1RIP A;  4QJF A;  4A3M H;  4JI0 L;  2JA8 H;  1IBK Q;  1YNX A;  3HOZ G;  1VQG A;  4A3B G;  3J7A 5;  1V1Q A;  1EIF A;  4YCU A;  5EAY A;  2MFI A;  1HZA A;  2UXC L;  1QVC A;  4GKK L;  1Y1W H;  1Q46 A;  4JG2 A;  3K80 C;  4DNI A;  2VNU D;  1L1O B;  1J6Q A;  1HNZ L;  4C3J H;  4JI8 L;  3RZO H;  1N33 Q;  3CF5 A;  1E1O A;  3AEV A;  1XMQ L;  4JI3 L;  1NBW A;  5M3M H;  2KBN A;  5C44 G;  1QZG A;  3B6Y A;  4IJL A;  4DUZ Q;  4BY1 H;  4GN5 A;  1IYJ B;  1EWI A;  4GOP C;  5BR8 L;  3PO2 G;  4JBM A;  3AQQ A;  4DV7 Q;  1IBM Q;  3CD6 A;  1A0I A;  4IOA A;  4DR1 Q;  1YHB A;  3NBH B;  1H95 A;  4JV5 L;  1QZH A;  3I4M G;  2BA0 A;  1KQS A;  1OXT A;  1WCM G;  3K8A A;  3U4V A;  5FJ8 G;  2JA5 H;  2JA6 G;  1PA6 A;  3PF4 A;  1VQB A;  4DV6 Q;  3M3Y H;  2K14 A;  1LUZ A;  4OXP A;  1A62 A;  1E24 A;  4POF A;  2VQF L;  4YHH L;  4R4O A;  2MO0 A;  3CCV A;  2I5H A;  4R4C A;  3A5U A;  3E9H A;  4X65 Q;  4A76 A;  1HNX Q;  4A3D G;  2PI2 A;  1W2B A;  3KF8 B;  2F3I A;  1X55 A;  3K81 C;  4UP8 A;  2L15 A;  2E5L Q;  4LWC A;  3PUZ A;  1FVI A;  1YVC A;  2GVB A;  3ULP A;  3PSI A;  3ULL A;  3I7F A;  1KRS A;  4QQB X;  1L1O A;  2HT1 A;  2AMC B;  2KEN A;  4RMF A;  1Q8K A;  2K4K A;  1FGU A;  2K5V A;  3CW2 C;  4DV2 L;  1N36 L;  1K8A C;  3PGZ A;  4DR3 Q;  1KHI A;  5M3F G;  4WJ3 M;  4A3I H;  3EBE A;  2NN6 I;  2QEX A;  1PH1 A;  2HHH L;  2RHQ B;  4NXM L;  4IFD G;  4MNO A;  5C3E H;  1NY4 A;  4QIW E;  5LMN L;  3U50 C;  3BU2 A;  1JE5 A;  5GQO A;  1HR0 L;  4LF5 L;  3PO3 G;  2JEB I;  1AE2 A;  4LF4 Q;  3H3V I;  3F2D A;  1Q12 A;  4A3J G;  4JI4 Q;  3S1R H;  4X6A H;  3CAM A;  4K0K Q;  3H0G H;  4XIG S;  4H02 A;  1QVF A;  1MJE A;  4AIM A;  1L2F A;  4EQ5 A;  3G4S A;  1RL2 A;  5IYB G;  3KLW A;  1PH2 A;  4PG3 A;  1TWC H;  2FXQ A;  1GO3 E;  1U5K A;  3CXC A;  1Q82 C;  4B3S Q;  3I55 A;  1YI2 A;  2QA4 A;  2UUA Q;  2V1C C;  3D0F A;  1N33 L;  5JJI A;  1K73 C;  2OTL A;  2UUC Q;  4AYB E;  4GOP B;  1ASY A;  4LF7 Q;  4BBR H;  1SLJ A;  2EQS A;  1VQC A;  1XNR Q;  3A0J A;  4A4I A;  4DPG A;  1HZB A;  4DUZ L;  4A75 A;  1UE1 A;  1X3F A;  3CPF A;  1D7Q A;  3SGI A;  4JI3 Q;  1L0W A;  4HJ7 A;  1L1O C;  1PYB A;  5AJ3 Q;  4NPS A;  2LSS A;  4DV7 L;  1SR3 A;  1X3G A;  2JJQ A;  4TVA B;  4DR1 L;  1IBM L;  3HFZ B;  4OWX B;  4A3G G;  2BH8 A;  5H1S E;  4BA2 I;  2DGY A;  3G6E A;  1VQE A;  2Q2I A;  3HOW H;  4DV6 L;  4JV5 Q;  3JC6 6;  3ICE A;  2ZTD A;  4LUV A;  2R7D A;  3I2Z A;  3W1B A;  4X65 L;  1XMO Q;  1HNX L;  4OO1 G;  1PV4 A;  2E5L L;  4BY7 G;  3STB D;  1IBL Q;  2VUM G;  3GTM H;  3J80 c;  2B63 G;  3ULJ A;  5GAD C;  1JT8 A;  2Q2T A;  3L7Z C;  4A3L H;  3TS2 A;  2UU9 Q;  1UE7 A;  4YWK A;  5GRO A;  2JA7 H;  4DR3 L;  4GOP A;  2WB1 G;  4DV3 Q;  2UUB Q;  2Y0S G;  1BVS A;  4DV5 L;  3K7A H;  4HJ5 A;  1X3E A;  1BKB A;  1B8A A;  4RG1 A;  1XPU A;  2R7Z H;  2RCN A;  4LFC Q;  1W3S A;  4LF4 L;  1YBY A;  4C2M H;  5E7N A;  3TS0 A;  1EQR A;  4JI4 L;  4A93 G;  4JBJ A;  1TWG H; 
#chains in the Genus database with same CATH topology
 4P2C B;  1KIX A;  1XX8 A;  3E0E A;  1PRT F;  3K5M A;  1W6J A;  1U4M A;  2KQ3 A;  3MEH A;  3STB C;  3FDT A;  1SMX A;  2VY3 A;  3T1H Q;  1XNR L;  4M8A A;  4DK0 A;  4Z9C B;  2K5Q A;  5CV4 A;  4HJA A;  4XYO A;  4NB3 A;  5AJ3 L;  3HKZ G;  1TWH H;  2D62 A;  3OMC A;  2F0K A;  3IRB A;  3QO2 A;  5EKI A;  1KD1 C;  3TQY A;  4XTC S;  4K2L A;  4A3B B;  2RDH A;  4LNQ A;  1VQ4 A;  1TS2 A;  1DON A;  3MXU A;  1WTX A;  1PFS A;  5M5W B;  1M1K C;  1QG7 A;  1GUN A;  1IKM A;  1IXR A;  1EWH A;  5M9O A;  1K0R A;  3PIO 3;  3S15 B;  1QVG A;  1ROD A;  1E2V A;  4G7Z C;  1MHW C;  4OEL B;  5CYU A;  4P72 A;  1LTR D;  1H9S B;  2VZA A;  1PH5 A;  2R6G A;  1G6P A;  2Z9H A;  1M8A A;  2F0P A;  2FMM A;  2WAQ G;  1KDC A;  2B2T A;  4PZ7 A;  3BDO A;  2OEO A;  2BCO A;  4CJ1 B;  3FP9 A;  4LFC L;  5E4W C;  1HTP A;  2A5H A;  4DR6 Q;  3J81 i;  2OTJ A;  4C3H H;  1H9R A;  1I4G A;  2NVX H;  2R93 H;  3F2C A;  3PUY A;  4C3I H;  4DV1 Q;  3HOY G;  1OXS C;  1SDF A;  3JAM i;  1VMP A;  3CC4 A;  4FXG C;  4GN4 B;  1J5E Q;  5IYC G;  1G2T A;  5M3F B;  4IUR A;  5LMN W;  4X3S A;  3GTK B;  3T1H L;  2I5M X;  2HIX A;  3PO3 B;  3NP8 A;  5IGF A;  2C5C A;  1SJH D;  2CQA A;  4C2M B;  3N52 A;  4K2K A;  1IL2 A;  3I90 A;  3EJI A;  3KLS X;  2PYK A;  3FVQ A;  1K0S A;  3NPP A;  5FJ8 H;  1RTO A;  1EU4 A;  4OON A;  2JA6 H;  4A3D G;  2VQE Q;  1FR3 A;  3DWQ A;  3EIV A;  3TEH B;  3L0O A;  2KHS A;  4MIU A;  1JE4 A;  1I3Q H;  2DJF C;  1HZC A;  3PIP A;  4MN3 A;  3IL8 A;  2A73 B;  1DGS A;  1KNE A;  1MKH A;  4H0L C;  4DXG A;  1A15 A;  2A19 A;  4NXN Q;  4B3R Q;  1JR0 D;  4LF6 Q;  1PMR A;  1S5D D;  2WIN B;  4HR7 B;  4IUT A;  5EGT A;  4MHE A;  2N49 A;  2LY7 A;  5CGK A;  4GS3 A;  4DR6 L;  4HSV A;  2RSN A;  2EE1 A;  4HTH A;  4FO2 A;  2KA7 A;  1EY9 A;  3OPO A;  5HGQ A;  3VR6 A;  4A3J H;  4NMZ A;  2UXD Q;  4DV1 L;  1I50 B;  2XN9 C;  3H3V H;  2KOL A;  2F0O A;  1E3P A;  1J5E L;  5JJI A;  1U0L A;  3OYY A;  2N3S A;  2WB1 B;  5KIX A;  2K6A A;  1R9T H;  5JEA H;  2Z6K A;  4RKB A;  3NEL A;  1IW7 D;  1EY6 A;  5EKL A;  2CVR A;  3MXN A;  2X6G A;  4A3I G;  5C3E G;  4BBS G;  3CU7 A;  2B8G A;  1XWE A;  1PRT C;  1CKN A;  3BZD B;  5JPM C;  2OCE A;  1JQY D;  1LTS D;  2RA4 A;  1ONL A;  4C3I B;  2CHB D;  4DUY Q;  3ZYY X;  2VQE L;  4B08 A;  1STY A;  2PZT A;  2ZJQ A;  4ZUI A;  4B3M Q;  2KEE A;  5JAV A;  3D4W A;  1BBU A;  4AYB G;  3OW7 A;  4JI1 Q;  4APV A;  5IWA Q;  4JYA Q;  3H3V C;  1SSO A;  5I2X A;  1G29 1;  2Z6B A;  1KAW A;  3KBX A;  1P8L A;  1B4O A;  5ELN A;  1M90 C;  2K01 A;  4BBR G;  1ZEQ X;  2WFW A;  2MO1 A;  2B8F A;  4NXN L;  3KLR A;  1FNW A;  4R4I A;  3VR3 A;  4LF6 L;  2PCF B;  3I56 A;  1HH2 P;  1JOO A;  3NTI A;  2LMC B;  2BA1 A;  5JJZ A;  1PDQ A;  1N9W A;  5C0X J;  1Q7Y C;  5CV7 A;  1SYB A;  3P75 A;  1AZP A;  5GAH C;  3SE0 A;  2UXD L;  3W1G A;  4A3E B;  2R92 G;  1RDP D;  4YWL A;  1I6H H;  1VQO A;  2CCZ A;  2BE5 D;  2NTS A;  1B3A A;  1MBY A;  1U4R A;  1E22 A;  3HZX A;  3S17 H;  1WTR A;  3RNU A;  2AUK A;  1HQM C;  4K6D A;  3BJU A;  2AWN A;  4N8F A;  3W3A A;  2ICI A;  2JA7 G;  1PRT B;  3RZD B;  1JJG A;  2NZH A;  1EY8 A;  2ES2 A;  4JCV E;  4BXX H;  3CCU A;  2R7Z G;  4DUY L;  2JSO A;  2GVA A;  2Q2U A;  2PNR C;  4BS9 A;  5D14 A;  4B3M L;  4DNT B;  1A63 A;  4JI1 L;  5IWA L;  4HIK A;  4JYA L;  3F2B A;  5IGG A;  4A3M G;  1SYF A;  2L9H A;  3F8T A;  1B3Q A;  4CKE A;  2ATW A;  1VQJ A;  3M4P A;  1VQ7 A;  3AB9 A;  2N88 A;  3GTL B;  1SBB B;  1ILQ A;  1WFQ A;  1VQK A;  4WJW A;  1GVP A;  1NE3 A;  5HUR A;  4A3K B;  5C0X G;  1D2B A;  1KLU D;  3KYH C;  4HCS A;  3S16 H;  3GTJ H;  4IQZ A;  4I7A A;  1LYL A;  4OGQ C;  3UE0 A;  1E7Z A;  1QWY A;  2ZJR A;  4XXE A;  1EEI D;  1PHJ A;  1CFM A;  2C9O A;  4QUF A;  2F0T A;  2JA5 G;  3A7L A;  3TRZ A;  4QL5 A;  4CHT B;  1A3T A;  3G71 A;  2FHT A;  4A3F G;  3M9B A;  2IHF A;  3J80 E;  3HOY H;  2L5T A;  4KY7 A;  1B70 B;  2L1B A;  1SRO A;  3CC2 A;  4KD3 A;  4DK6 C;  1EYA A;  3SVM A;  3TRE A;  3BG3 A;  2KHI A;  2MQH A;  5CV6 A;  4DR4 Q;  4LJZ C;  3PIP 3;  3V2T A;  1VQL A;  1EUJ A;  3BZK A;  3S14 H;  4NXM Q;  1SE4 A;  2CH4 W;  3C2P A;  4CDD C;  1LAB A;  4YWM A;  1CSQ A;  2HCI A;  2EOT A;  2F0J A;  4A3D H;  1CKO A;  1RIP A;  2XNA C;  1IBK Q;  4A3B G;  4ZAI A;  1I4R A;  4F87 A;  2XRS D;  2MFI A;  1WTO A;  3MHB A;  1Q46 A;  5ELB A;  3K80 C;  4DNI A;  3A7A B;  2RSO A;  4G4K A;  4ZUJ A;  2F0L A;  4PMC A;  2F0H A;  3DHQ A;  1D1I A;  4L63 B;  5M3M H;  1GJX A;  1QZG A;  3B6Y A;  3ERO A;  3U9S A;  2PO4 A;  1CT1 D;  3VYU A;  3TP8 A;  1A0I A;  5IT9 E;  3H0G B;  4JV5 L;  1DOL A;  1QZH A;  1TQO A;  2BA0 A;  4LAA A;  3HP3 A;  4TRD A;  3U4V A;  3PF4 A;  2SNS A;  4XT3 B;  3M3Y H;  1YNJ D;  1LUZ A;  4XT1 B;  3A5U A;  3FPU B;  3KF8 B;  3K81 C;  2G5D A;  1LV9 A;  1YVC A;  2HDM A;  3ULL A;  1CTM A;  2WV6 D;  1NNX A;  2JP1 A;  1MD2 D;  4FF3 A;  3N6R A;  1Q8K A;  2QW7 A;  2K5V A;  4KY6 A;  3NE5 B;  5M3F G;  4A3I H;  4NXM L;  5KNC A;  5C3E H;  1SAP A;  1NY4 A;  4QIW E;  5FKA C;  4FXD A;  4N9P A;  5GQO A;  5A35 A;  2JYO A;  3R3O A;  3PO3 G;  2JEB I;  2A6H D;  3TSS A;  3NBH A;  1XTC D;  4C56 C;  4EVO A;  1Q12 A;  4F7X A;  3Q0A A;  4K0K Q;  5COR A;  1L2F A;  1PH2 A;  1RL2 A;  3EQL C;  2FXQ A;  2F0I A;  1GO3 E;  1U5K A;  3DWA A;  1YI2 A;  3K7A B;  5EJW A;  1CQV A;  3D0F A;  3H6M A;  3CKI B;  4BBR H;  3A0J A;  3R93 A;  4A4I A;  1D5X C;  3I70 A;  5I4D A;  3SGI A;  4RGT A;  2RBM A;  3A54 A;  3P20 A;  4JI3 Q;  1V1P A;  1PYB A;  2JJQ A;  2SEB D;  3HFZ B;  4BA2 I;  2LS0 1;  1VQE A;  3JAM E;  5FLX E;  3JC6 6;  2B2V A;  4KJN A;  4LK1 C;  5D3I B;  3F2U A;  5D65 A;  1DYQ A;  1O80 A;  4OO1 G;  1XMO Q;  2RDG A;  1JOR A;  4KD4 A;  5M3M B;  1BR9 A;  1U4L A;  2ZXR A;  3TS2 A;  2JA7 H;  2WB1 G;  1EY0 A;  5JPN C;  1ZYR C;  2EY6 A;  4DV3 Q;  3VYR A;  4DV5 L;  4CKB A;  3M3Y B;  1XPU A;  2R7Z H;  2D2C C;  1A2T A;  1PFM A;  4KV6 A;  1UEA B;  3CQZ B;  4K0K L;  2FJ2 A;  3RR5 A;  1LTA D;  2PQA B;  5I2Y A;  4C3I G;  1LTG D;  4IUP A;  3KDF B;  5IE8 A;  2IL8 A;  3NTH A;  4DK1 A;  5IYD G;  4HIM A;  3UDX A;  1XTD A;  4V19 0;  5JEA J;  4C1N I;  3PUX A;  3S1Q B;  4TSS A;  1FD7 D;  4WFN 3;  2A8V A;  3A8K E;  5C0X H;  1CKM A;  3OTO Q;  3UDF A;  1H9M A;  5CV8 A;  1Q90 A;  1FYC A;  2A68 D;  3G6J B;  4RCO A;  1PH9 A;  1VQ6 A;  5GAE C;  4QF4 A;  1S5E D;  2NVY H;  2F0F A;  4YCW A;  3TP7 A;  2F52 A;  1OXU A;  1XMO L;  3ERQ A;  4BY7 H;  4A3F H;  1MJC A;  2MP1 A;  1B1Z A;  4GLA C;  2R3Z A;  1EQQ A;  5C44 B;  1F9R A;  4IPD A;  4IUV A;  4A3E G;  4LFA Q;  2O5I C;  1H9K A;  1FJG Q;  3W5O A;  3PO2 B;  1TU2 B;  1D1K A;  3D6W A;  4PMW A;  4DV3 L;  3I4M B;  1WCM B;  1F77 A;  4RH6 A;  2E8G A;  3MEF A;  4XYQ A;  1AP0 A;  2X69 A;  1UUP A;  2WKD A;  4JBW A;  1O7L A;  1BOS A;  2F0W A;  5DLQ E;  1GUG A;  5EPL A;  3CHB D;  1F2M A;  2NN6 G;  5COY A;  2X6L A;  4NKL A;  4Y52 H;  4PZ6 A;  3OWE B;  3A56 A;  1O7I A;  4A3B H;  5G3L D;  1LLR D;  3T56 B;  3RLF A;  4M1U B;  1XJV A;  1YJW A;  1A8V A;  2EYJ A;  1DJR D;  5M5W H;  2PNH A;  2H5X A;  5BN4 A;  5FO8 B;  5JEA G;  1H9S A;  1CSP A;  3T53 B;  1YJN A;  2HD3 A;  1P16 A;  4P74 A;  3S15 H;  5EPJ A;  2B29 A;  4DAY B;  5K36 G;  5JJL A;  1WVL A;  3OTO L;  2F0V A;  1SRU A;  3GO5 A;  2Z4I A;  3P7J A;  4O2D A;  1BO0 A;  2AWO A;  5CV9 A;  4A3K G;  2ZTE A;  1V8Q A;  3GTP B;  1AE3 A;  2QGQ A;  2E2D C;  2AKW B;  5LL6 X;  2QDB A;  1LT6 D;  1YEZ A;  2IHE A;  1UNS A;  4OIJ A;  2BOS A;  1BCP D;  1CQF A;  4KY5 A;  4LFA L;  1FJG L;  5C0X I;  3BYY B;  4JOI C;  2RF4 A;  1STH A;  2PMZ E;  2RHS B;  2WP8 J;  3CCQ A;  4RGM A;  3U58 A;  1PH3 A;  4LW1 A;  5M3F H;  1E2W A;  1PZI D;  3NK9 A;  3URY A;  3GTK H;  1UEB A;  4HIO A;  1N8R C;  1BQQ T;  4P71 A;  3PO3 H;  1HFG A;  1KTK A;  4BY7 B;  1EZ6 A;  4R9W A;  3GV3 A;  4AQY Q;  1KAB A;  2HQL A;  2EXD A;  2B63 B;  1QJO A;  3AFP A;  4FNF A;  1EY4 A;  3CP0 A;  1WTQ A;  2IPK D;  5KYL A;  4DR5 L;  1HJP A;  3J7A V;  3M4O H;  3D3R A;  2Y0S B;  2G9H D;  3NWS A;  3P1H A;  2A6E D;  1BXT A;  2HIV A;  1GHK A;  2O4X A;  2YTX A;  4A93 B;  4BXX G;  5J39 A;  2IWH A;  1F9P A;  2UXB L;  1ILP A;  1T9H A;  2RQX A;  1VQN A;  1AW7 A;  3S2H B;  3OW2 A;  5L37 A;  4GLV B;  3H0G G;  4ME3 A;  4CDC C;  1UWV A;  4OO1 H;  4EQP A;  1NTG A;  3X3M A;  1NJI C;  4FF4 A;  2WAC A;  1I50 H;  3EVQ A;  2Q8R E;  3NBI A;  1PXU A;  4RFB A;  4PV1 C;  4OX9 Q;  3S24 A;  1OXX K;  2ZTC A;  4HMI A;  3GTQ B;  3UDI A;  2IY5 B;  1A6X A;  5K5P A;  5LL6 S;  3AFQ A;  3QB3 A;  1Y8N B;  3HOU B;  2FMC A;  5T1I A;  3AU7 A;  4AQY L;  4DAV A;  3E6Z X;  2H1E A;  1D5M C;  1PH8 A;  3PUV A;  2VXW A;  1JOQ A;  2O2L D;  2ENB A;  5DM7 3;  1XPO A;  1Z9F A;  1WTW A;  3PQI A;  2FFK B;  3OOC A;  1S5C D;  3J7Y W;  1Z7T A;  1GOZ A;  2IX3 A;  5IYD H;  1S3O A;  1TS4 A;  2GA4 B;  4DXF A;  3MZ5 A;  1EYG A;  3S1M B;  2NYZ D;  1TWF H;  1X56 A;  4L6T B;  4UY8 C;  1FL0 A;  2E2I B;  1KLG D;  1Y69 U;  2Q8T A;  3MTS A;  5T1G A;  4RHR A;  3Q24 A;  1VQH A;  3GD7 A;  4HMJ A;  3HKZ E;  3M4O B;  3EA6 A;  2KHJ A;  4L8J A;  4JI0 Q;  2GN5 A;  4L5T A;  2EIF A;  4IZ8 A;  3RLO A;  2UXC Q;  4OEM B;  4ALP A;  3K57 A;  1K83 B;  4GKK Q;  4ZRZ A;  1CI3 M;  4A3E H;  2F03 A;  4ZK9 B;  5FOB B;  5C4J B;  1AH9 A;  3C1F A;  3T4A C;  1XMQ Q;  1SXT A;  2F0S A;  4OX9 L;  4OL7 A;  3I4L A;  5GAG C;  5M3M G;  4LUO A;  1A3U A;  4FYD A;  1II3 A;  4Y7N B;  2CW0 D;  1V1O A;  5BR8 Q;  5FO9 B;  2VW9 A;  4OO1 I;  2F3V A;  3D4R A;  1JJ2 A;  2CWA A;  3RZD H;  1MSG A;  1Y1W B;  2WAQ E;  2K05 A;  3LWE A;  2NN6 H;  4GLX A;  1VMC A;  3C46 A;  4YHH Q;  2PQE A;  2PZU A;  5ELO A;  4ZYS A;  1LTL A;  2AHO B;  2F0M A;  4PQX A;  4Q0F A;  1SFO H;  5A2Q E;  1MIU A;  3NQT A;  3M7G A;  2F0E A;  1K3B C;  3DM1 A;  1GUS A;  4RAU C;  3QR8 A;  4DV2 Q;  2VL6 A;  3ITP A;  2K33 A;  2ZJP A;  5K36 H;  4YCV A;  3GTL H;  3OWF A;  2VB2 X;  1HFN A;  2ZXO A;  1SE3 A;  3DEO A;  1PTO F;  2ALY B;  1K28 A;  1B9N A;  4A3K H;  1CA6 A;  2DY8 A;  4JI0 L;  1YNX A;  3R8B A;  3K5L A;  3J7A 5;  4YCU A;  5EAY A;  2UXC L;  1HZA A;  3VA7 A;  4GKK L;  2VNU D;  2M00 A;  1S4Z A;  1T5E A;  1J6Q A;  3IKJ A;  2EYP A;  3J7A F;  1E1O A;  1TWF B;  5C5M A;  1NBW A;  2F0Q A;  1XMQ L;  1PFN A;  2KBN A;  5C44 G;  1WTH A;  3FMC A;  3KLS A;  4IJL A;  4UDU C;  1IYJ B;  5EBD A;  3S1R B;  5BR8 L;  3PO2 G;  1YNN D;  3AQQ A;  1IBM Q;  3CD6 A;  4IOA A;  1YHB A;  2DNC A;  3DXJ C;  3I4M G;  1KQS A;  1OXT A;  1KDA A;  1WCM G;  3TP6 A;  1BF4 A;  5DAU A;  4A3L G;  1VQB A;  4DV6 Q;  2K14 A;  4POF A;  1A62 A;  1E24 A;  1F9Q A;  4YHH L;  1QIL A;  2MO0 A;  2VB3 X;  4FP5 D;  5J22 A;  2I5H A;  3E9H A;  4RGN A;  4UP8 A;  2L15 A;  3A8J E;  2GVB A;  1D5Z C;  3J80 L;  4QQB X;  2OXP A;  1GUW A;  1JWM D;  2KEN A;  3SK6 A;  2B2W C;  1K8A C;  4DV2 L;  3R2I A;  2P5Z X;  1W6K A;  2NN6 I;  1HA5 A;  1X32 A;  1STG A;  2RHQ B;  1SYD A;  5J1Z A;  3BU2 A;  1Y8P B;  1PZJ D;  4LF4 Q;  3H3V I;  4IUU A;  5JVG 3;  4KKT A;  3H91 A;  2EYL A;  3FRP B;  3H0G H;  1SFO B;  1QVF A;  2EYF A;  3NXW A;  4AIM A;  1MJE A;  4EQ5 A;  3G4S A;  2QA4 A;  3KF8 A;  1PFB A;  2V1C C;  3L9A X;  1CK1 A;  4AYB E;  1ASY A;  2EQS A;  1LO5 D;  3CPF A;  5CC4 A;  1Y8O B;  1DD2 A;  4HJ7 A;  1TWG B;  2A69 C;  5FO7 B;  2LSS A;  3SXH A;  1IBM L;  2EJF C;  3I4N B;  4LMQ D;  3HOX B;  2DGY A;  2Q2I A;  4QCL A;  2EZV A;  4DV6 L;  2F0D A;  4JV5 Q;  4R8N A;  1R4P B;  3HG9 A;  5IT9 L;  3ICE A;  2K5W A;  2NB0 A;  3W1B A;  2L0C A;  3RMH A;  1PV4 A;  4BY7 G;  1CA5 A;  5ELC A;  3STB D;  5C4X B;  4QMG A;  5NUC A;  1IBL Q;  3J80 c;  1KNA A;  2B63 G;  2Q2T A;  1PTO H;  4YWK A;  3S1N B;  2UUB Q;  4XQN A;  1SMY C;  4YIJ A;  2Y0S G;  3A8I E;  1BUV T;  3K7A H;  4KJO A;  4HN7 A;  1SE2 A;  1S5F D;  2G9D A;  1G6Z A;  1VF5 C;  2LKV A;  1W3S A;  4LF4 L;  1YBY A;  5E7N A;  1EWC A;  1BNZ A;  2L55 A;  2MJ8 A;  5ISR A;  3GTO B;  4A93 G;  3IFD A;  1QUQ B;  4CBV A;  4KMU C;  4R4T A;  1OXV A;  4IPG A;  1AN8 A;  3M85 A;  1BCP C;  1C9O A;  3GQB A;  5IGC A;  4ZQ3 A;  2KCM A;  3QOL A;  2QKI C;  1YHA A;  2YU9 B;  2WKC A;  1PTO C;  1KC8 C;  3KK7 A;  1Q8I A;  4EQN A;  4DR7 Q;  1B7Y B;  4JI2 Q;  4IO9 A;  3VR2 A;  2OF1 A;  5E3F A;  3HOZ B;  1Q86 C;  3NUC A;  4QY7 A;  3K58 A;  1WJJ A;  1ET9 A;  3DUZ A;  1LTI D;  5IT9 c;  1STE A;  3K0X A;  4GKJ Q;  3KJP A;  4IUQ A;  3JAM L;  1IL8 A;  4K8J A;  5FLX L;  1DOK A;  4J15 A;  4EQO A;  1JC7 A;  5HGT A;  3HOU G;  3J81 j;  3KDF A;  1IBL L;  2EY1 A;  5I9P A;  2XRQ D;  1GD7 A;  2RCF A;  3CQZ H;  3E9I A;  4JVZ A;  5JVH 3;  1DM0 B;  1N32 Q;  4UP9 A;  1HZ9 A;  2CH4 A;  2UUB L;  1PLF A;  2B2U C;  3K0Y A;  2XGT A;  4KKU A;  2A6E C;  1TS3 A;  2OT2 A;  2PZW A;  1VQA A;  2ASB A;  1EOV A;  4R1J A;  3L2P A;  5KNB A;  3F1Z A;  4DV5 Q;  2SDF A;  2K75 A;  2PW5 A;  5LHY 1;  5IP7 G;  4OIK A;  4GNX C;  4IPC A;  3S1Q H;  3TP5 A;  4GZY C;  1BCP B;  4ID6 A;  4HSP A;  1EQV A;  1KL9 A;  2JA9 A;  3VYS A;  1B50 A;  5CMD A;  3KFU A;  1PTO B;  1RTN A;  1UE5 A;  2E75 C;  4DKA C;  1D8L A;  3KF6 B;  3WWV A;  3QWN A;  3SDZ A;  2EPB A;  4N8X 1;  4HJ9 A;  4MZ9 A;  1CM9 A;  3ND9 A;  1PH6 A;  4O0A A;  5C3X A;  1K3R A;  1RCV D;  4DR7 L;  3GTG B;  1EZ8 A;  5C44 H;  4JI2 L;  1F9S A;  1EOT A;  4KHP Q;  3ND8 A;  3J81 E;  4RHS A;  3PO2 H;  1VS0 A;  3S2D B;  3VYT A;  5EKK A;  5C4Z A;  3I4M H;  3BVM A;  1J8I A;  1WCM H;  3RN5 A;  2KUM A;  4A3L H;  4GKJ L;  1NAP A;  2EJG C;  5CBE E;  4DV0 Q;  5FLX c;  3HKS A;  2XWB B;  2IT1 A;  1X65 A;  1EQT A;  2KVM A;  1Y1W G;  1EFW A;  1K9M C;  1A3V A;  4DAP A;  4DV4 Q;  1LT4 D;  1N32 L;  2NUC A;  2WII B;  4CKC A;  3J7Z C;  4L5S A;  4A3G B;  3CMA A;  2EYO A;  4P75 A;  1PRT D;  4G7O C;  4F8M A;  1GM5 A;  2D0P A;  1X6O A;  4GNX B;  3AYH B;  4ODG A;  3PUW A;  2I0Q A;  5I9O A;  1ZXT A;  4B3T Q;  2JXM B;  3I4O A;  2J0T D;  4TKO B;  5ELE A;  2VUM B;  4HID A;  3Q23 A;  1VQI A;  1Y14 B;  3CRL C;  5EBC A;  3H09 A;  4HAE A;  5E4X A;  4C1N K;  1K8G A;  2O5J C;  2CWP A;  1O7Y A;  3MC0 B;  4I7Z C;  3GTP H;  3SK5 A;  4NP5 A;  5C5L A;  1TWA H;  3BDC A;  3E0J A;  3SK8 A;  2JE6 I;  3T1Y Q;  4X66 Q;  4KHP L;  4U68 A;  2YV5 A;  3H15 A;  3NQI A;  2KCN A;  3NEM A;  1I4Q A;  3LX0 A;  2Q2H A;  3BVZ A;  1LAC A;  4DK3 C;  4JC0 A;  3D6C A;  1XXG A;  4DV0 L;  3VA5 A;  3MFG A;  2N8N A;  3HOV B;  4UPA A;  1FNU A;  1AEX A;  4DV4 L;  1H9J A;  1I94 Q;  3GP7 A;  2CKZ B;  2SNM A;  4O42 A;  4X64 Q;  1VQM A;  4JI5 Q;  1GUT A;  2JK8 A;  2CQO A;  2B63 H;  1G91 A;  5AFW A;  1IW7 C;  4LF9 Q;  4X3T A;  4R4Q A;  2EXZ A;  1B2T A;  1HUM A;  2JQO A;  3K7U C;  4DR2 Q;  2WB1 E;  5C6A A;  4WOR A;  3HS0 C;  3O13 A;  1WD0 A;  4B3T L;  2NZO A;  3KOJ A;  1S40 A;  4A93 H;  1KXL A;  1V43 A;  5C4H A;  3M7N A;  2AQ1 B;  4PNY A;  1VCI A;  4JOI A;  3C1E A;  3MA2 B;  1Y1V B;  3S2H H;  1SYC A;  1X3P A;  4MTK A;  2DUD A;  4DR5 Q;  1J9O A;  1LM0 A;  1G8Z D;  4X66 L;  3T1Y L;  1YHQ A;  4LUZ A;  3FKI B;  4RWS C;  3A74 A;  3RN2 A;  2PI2 E;  2E2J B;  3KJO A;  5M5Y B;  3SK4 A;  4PZ8 A;  3Q8D A;  4DA2 A;  3D8G A;  1EU3 A;  4G7H C;  1B44 D;  2E74 C;  1EIH A;  5IY0 A;  2HUG A;  1CZW A;  3GTQ H;  4K8I A;  2UXB Q;  3I4N G;  4BA1 I;  2QEJ C;  3HOX G;  3Q22 A;  5HY6 A;  5KYI A;  1ASZ A;  1TWA B;  1I94 L;  3HOU H;  1T5X D;  2BE5 C;  4EGV A;  3VDY A;  4X64 L;  2E2H H;  4JI5 L;  1HNZ Q;  4JI8 Q;  3J80 i;  3NEN A;  2ZXP A;  3G48 A;  2K32 A;  1VQF A;  1C48 A;  4BWG B;  3PCO B;  5C4X G;  4LF9 L;  2MNA A;  1RD9 D;  3BS1 A;  4X3K A;  2JA8 B;  4IPH A;  4E6I A;  1TII D;  2CFM A;  1JWU D;  2MHV A;  4DR2 L;  4R8I A;  2IX1 A;  1E2Z A;  3S1M H;  3A55 A;  4A3C G;  1QE6 A;  4K14 A;  5IP7 H;  4C3J B;  1BBX C;  4TQU S;  3E3X A;  3SEB A;  3MXP A;  3DLL A;  1WD1 A;  2E2I H;  4QUC A;  4GN3 B;  1TR5 A;  1G2S A;  3NHH A;  1HCZ A;  3CCR A;  4BY1 B;  3D4D A;  4CJ2 C;  2FIN B;  3CME A;  1N36 Q;  1K83 H;  4ZCK A;  4IOC A;  2HHH Q;  2F0G A;  5C4J H;  2L12 A;  1CHQ D;  5CBA E;  4IFD J;  1HR0 Q;  3PF5 A;  3CCS A;  2NVQ H;  3ZJY C;  1HRJ A;  3OIQ A;  1GKH A;  5IIF A;  4F88 A;  5KND A;  4Y7N H;  2LFN A;  3I73 A;  1Z47 A;  4QJF A;  2ZT9 C;  3HOZ G;  4QIW B;  3OMG A;  1EIF A;  1GXD C;  1QVC A;  1TY2 A;  3OIP A;  1Y1W H;  1IHZ A;  1D6E C;  4JG2 A;  3TDQ A;  1L1O B;  4ILW A;  1HNZ L;  4JI8 L;  3RZO H;  1L0X B;  1N33 Q;  1HPC A;  4DUZ Q;  3T13 A;  4GN5 A;  4GOP C;  2NBF A;  4KN7 C;  4DV7 Q;  1STA A;  3QG1 A;  4DR1 Q;  1TWC B;  3EFX D;  3K5N A;  4OXP A;  2B2Y C;  1IYV A;  2E2H B;  4R4C A;  2J4X A;  2DY7 A;  2PI2 A;  2E5L Q;  4DNR B;  4ZKC B;  1FVI A;  5EQ0 A;  4KN4 C;  5D3D A;  3I7F A;  1U4P A;  2QF7 A;  2JN4 A;  2AMC B;  4RMF A;  3HOW B;  2K4K A;  1N36 L;  3PGZ A;  4DR3 Q;  1KHI A;  5A2Q L;  4CDE C;  4WJ3 M;  1PH1 A;  3EBE A;  3DWP A;  2QEX A;  2HHH L;  4IFD G;  5C3W A;  3U50 C;  1I6V C;  1JE5 A;  1HR0 L;  3G7L A;  4V0B A;  3L3O C;  3TBI B;  1ML0 D;  2EJM A;  3SHL A;  4JI4 Q;  3S1R H;  3GTM B;  3WOF A;  4XIG S;  4H02 A;  1YNJ C;  2IJ0 A;  5IYB G;  3KLW A;  4PG3 A;  3T16 A;  3CXC A;  1I4P A;  2QCP X;  4B3S Q;  2F1M A;  4ME5 A;  2UUA Q;  3X3N A;  1N33 L;  2UUC Q;  1NR4 A;  2OTL A;  1ZYR D;  4GOP B;  4LF7 Q;  2AQ2 B;  3QIA A;  1VQC A;  4DPG A;  2EYH A;  1HZB A;  4DUZ L;  4A75 A;  1UE1 A;  1X3F A;  2K5D A;  1C4Q A;  2NVQ B;  4IN3 A;  4DV7 L;  1X3G A;  4TVA B;  4DR1 L;  2NWG A;  4K5W A;  4A3G G;  2B2T C;  4RGO S;  2BH8 A;  3I3C A;  5G3L F;  2PPB C;  1K8M A;  3RUZ A;  5H1S E;  5ELD A;  2NZ1 D;  1FGB D;  3E5S A;  4CGY B;  1SYG A;  4H7B A;  4HED A;  2A6H C;  4LUV A;  4RKL A;  2PW7 A;  3RZO B;  1C8C A;  2E5L L;  2VUM G;  1TWH B;  3MAQ A;  1TKW B;  1AFP A;  1JT8 A;  2UU9 Q;  5GRO A;  5BN3 A;  4DR3 L;  1QCB D;  2Z4H A;  4HJ5 A;  1X3E A;  3IAY A;  4UHV A;  3TME A;  1Q3L A;  2K04 A;  1NR2 A;  3MWY W;  1BCP F;  2HDL A;  3LWU A;  4ABN A;  3TS0 A;  1EQR A;  4JI4 L;  4L5R C;  4JBJ A;  1TWG H;  1RF2 D;  2DNE A;  2F4V Q;  3I4N H;  2IX0 A;  3I8Z A;  3HOX H;  1UE6 A;  2YTY A;  4KHV A;  4B3S L;  1NSN S;  1I5F A;  4OWW B;  1WI5 A;  1PVO A;  2UUA L;  5DM6 3;  2B39 A;  2UUC L;  4JK1 C;  2B2W A;  3HOV G;  4LF7 L;  1E1T A;  5FLM G;  2K5N A;  1S72 A;  1C7Y A;  2KJX A;  1DZ1 A;  3GV6 A;  3HEJ A;  2I5L X;  4C3H B;  5C4X H;  2R93 B;  2XTI A;  2NVX B;  1VQP A;  5I6Y A;  2L4N A;  1F2Z A;  1N34 Q;  3S1N H;  2K28 A;  4FDB A;  4A3C H;  3CCE A;  3NWT A;  4QGU A;  4ZKB B;  1HXY D;  1WOC A;  1GUO A;  1ENC A;  3IFT A;  1LTB D;  4WJ4 A;  1QUQ A;  5LMU Q;  2EY2 A;  3GTO H;  2ID0 A;  1U9R A;  4KHZ A;  3CCJ A;  3BZC A;  4B3R L;  2UU9 L;  2YTV A;  2Z6K C;  1QB5 D;  2VS1 A;  3NTK A;  4FF2 A;  2K50 A;  1Y1V G;  1QOH A;  2RDF A;  5DNF A;  2JA6 B;  3ER0 A;  2YU9 H;  2OQK A;  2F4I A;  4LFB Q;  1I3Q B;  3FKI G;  1X3Q A;  2PMZ B;  2JEA I;  4KKS A;  1CUK A;  3C3L A;  2F4V L;  2A68 C;  3UI2 A;  3BYT B;  4X3U A;  1ICF B;  4DFA A;  3HOZ H;  2N78 A;  1IKL A;  4N9T A;  4KI0 A;  4IUN A;  1YIJ A;  1HR0 W;  1MSH A;  2HQE A;  3K5O A;  4Q5V A;  3ONA B;  5KRU A;  1DOM A;  2AUJ D;  1E0B A;  4A3J B;  5IP9 G;  1GHJ A;  2ICE C;  1N34 L;  1JB3 A;  3MVV A;  4IAL A;  4CDF C;  3OSO A;  3GDE A;  1TS5 A;  4JI7 Q;  1X9N A;  1R9T B;  2JA8 G;  3QOJ A;  4UAI A;  2M2L A;  1HHV A;  5LMU L;  1JIC A;  1NMG A;  4FVM A;  1OO9 B;  1OTC A;  1JOK A;  2KCC A;  4C3J G;  2TMP A;  2RVL A;  2NTT A;  3KF6 A;  3MXN B;  2KCT A;  1XYI A;  2SOB A;  2BH2 A;  4BY1 G;  4JI6 Q;  4AH6 A;  1CKN B;  1Q1E A;  5IOC A;  1SNP A;  3CPW A;  4UP7 A;  4LFB L;  4IFD H;  4L5Q A;  2BDN A;  2B3G A;  3GTG H;  4X62 Q;  1VQ9 A;  2NVT H;  3R2T A;  5I6W A;  4LF8 Q;  2LXK A;  3S2D H;  1QNU A;  4IJH A;  1HNW Q;  3BDL A;  1EIY B;  1CHP D;  5IYC H;  5IYB H;  3LGJ A;  1VQ5 A;  2ZM6 Q;  4U67 3;  1LTT D;  2K7V A;  2QDL A;  2B2U A;  2K03 A;  4ZLT F;  4S3S A;  3UE1 A;  4FF1 A;  1TVX A;  2F0U A;  2MUY A;  3FHW A;  2EVB A;  1YJ9 A;  3SR1 A;  1KDB A;  1SE8 A;  1Q81 C;  1I6H B;  2QIL A;  1XNQ Q;  3DM3 A;  5J3B A;  1MGS A;  3EN2 A;  4GNX A;  3S17 B;  4A3G H;  1JMC A;  5IGE A;  1KRT A;  1R4Q B;  4DN4 M;  3J81 L;  2DN8 A;  4JI7 L;  3K6O A;  2I07 B;  3I72 A;  1PH4 A;  4JBK A;  3FEW X;  5EPK A;  4RA8 A;  4XDX A;  1MI2 A;  1V9P A;  1NUC A;  1JJC B;  2PQA A;  4MTN A;  3HKZ B;  2VUM H;  4I65 A;  3UDG A;  1IYU A;  4K6L A;  4FXK C;  4JI6 L;  4DGZ A;  4XQJ A;  1SNO A;  2A1A A;  1ET6 A;  1EY7 A;  2OWO A;  4DF7 A;  3HOW G;  4NW2 A;  4YY3 Q;  1EYC A;  4J8Q A;  4X62 L;  2Y0S E;  5FK9 C;  1VQ8 A;  1YIT A;  3U4Z A;  4LF8 L;  1ZKO A;  1XPR A;  3W2D A;  1JWS D;  1HNW L;  1AZQ A;  1SNC A;  2K5H A;  2XSC A;  3TZU A;  1HUN A;  2XIW A;  1NMF A;  2ZM6 L;  2L11 A;  2A74 C;  2WAQ B;  5BN5 A;  2IW3 A;  1PH7 A;  4IFD I;  3ERS X;  4DR4 L;  3S16 B;  3GTJ B;  3HOV H;  1EYD A;  4RCN A;  5FLM H;  4ULL A;  1O7Z A;  2EDG A;  4OWT B;  4BBS H;  1PZK D;  3S9W A;  3M4Q A;  1XNQ L;  4H44 C;  2NVT B;  3HOY B;  3MFY A;  3RD4 A;  1SN8 A;  1UAP A;  3J81 c;  1Z6H A;  5M5X H;  1IBK L;  2D5D A;  1SNM A;  1PYW D;  4KK7 A;  3U9O A;  2J7Z A;  1LT3 D;  1IZ6 A;  3PV0 A;  1WTV A;  3JAM c;  1RHP A;  2Z0S A;  1VQD A;  4KTA A;  3WOE A;  2AQ3 B;  1SYE A;  2BDO A;  2K1B A;  3DMU A;  1LT5 D;  5CR3 A;  3S14 B;  4DAM A;  2EY5 A;  5JJK A;  1PYS B;  2E76 C;  3A5Z B;  2YYZ A;  4WRD A;  1G51 A;  3LNN A;  1SJE D;  1Y1V H;  1JB7 A;  3CCM A;  3CCL A;  2M9V A;  2R7F A;  4A3D B;  4EX5 A;  1B53 A;  4KLK A;  4YY3 L;  5DEH A;  4DAY A;  1YZ6 A;  3FKI H;  4HJ8 A;  3OHX C;  4DU9 A;  2RKS A;  2E2J H;  5M5Y H;  1WYD A;  2R92 H;  4POG A;  3RLN A;  2VQF Q;  1F2Y A;  5KGU A;  2EYM A;  2N55 A;  1BBW A;  1NCV A;  4HCE A;  3CC7 A;  1HQR D;  4B9W A;  4J6H A;  2LXJ A;  1STN A;  4JW0 A;  2C35 B;  1SNQ A;  1C0A A;  1TXY A;  1DXM A;  4XQQ A;  4P73 A;  1EL0 A;  1A2U A;  1TY0 A;  2OQ0 A;  5IP9 H;  5LMN Q;  2K52 A;  2CW0 C;  4OHJ A;  4LF5 Q;  4C3H G;  4CJ0 B;  2D0O A;  2R93 G;  3CRK C;  3PIO A;  1Q1B A;  3D31 A;  5KEE A;  1RKN A;  1X54 A;  2JA8 H;  2B2V C;  4A3M H;  2MPM A;  4O1N A;  1VQG A;  5JOB A;  1EY5 A;  1V1Q A;  2HCC A;  1SEB D;  3M4Y A;  2Z1C A;  4A3I B;  4C3J H;  1ICW A;  5C3E B;  4BBS B;  3CF5 A;  3AEV A;  1M4V A;  4JI3 L;  2KEC A;  1I4H A;  4K5V A;  4BY1 H;  1EWI A;  3V96 A;  4JBM A;  5M5X B;  5IGD A;  1H95 A;  3NBH B;  1K8O A;  4AYB B;  1WTP A;  1DCZ A;  5ELF A;  3K8A A;  5FJ8 G;  2JA5 H;  2R61 A;  2JA6 G;  1PA6 A;  2VQF L;  1I4X A;  2F0N A;  4R4O A;  3CCV A;  5TSS A;  1HNX Q;  3DEP A;  3MXG A;  4BBR B;  4X65 Q;  4NDX A;  4A76 A;  1W2B A;  1RJT A;  1X55 A;  2F3I A;  4K5X A;  4LWC A;  3PUZ A;  2XVS A;  1TT2 A;  1EFI D;  1ESR A;  3ULP A;  1S5B D;  3PSI A;  1KRS A;  2MGS A;  3KUP A;  1L1O A;  2HT1 A;  3PMF A;  3AMU A;  1FGU A;  2A69 D;  3CW2 C;  1V1P B;  2D9U A;  4MNO A;  5LMN L;  2R92 B;  1HA6 A;  1KAA A;  2V4D A;  4LF5 L;  1EIG A;  1L0Y B;  1BDO A;  1YNN C;  1F2L A;  1AE2 A;  3F2D A;  2F3W A;  4A3J G;  3I91 A;  3V05 A;  1SND A;  4X6A H;  1EEF D;  3CAM A;  3KBG A;  1VDZ A;  5E1F A;  3VR4 A;  4B9X A;  4QB4 A;  2JA7 B;  1TWC H;  4J1M A;  1HTL D;  1Q82 C;  3I55 A;  3T51 B;  1K73 C;  1SMY D;  3Q6S A;  2Q8I B;  2R7Z B;  1ENF A;  1SLJ A;  1XNR Q;  5CV5 A;  1D7Q A;  4G57 A;  1CZG A;  1L0W A;  1L1O C;  2I46 A;  3HRZ C;  5AJ3 Q;  4NPS A;  1SR3 A;  4OWX B;  3HOW H;  3G6E A;  3K59 A;  4A3M B;  3HGB A;  3WDN A;  2DJG C;  3TZD A;  4PMB A;  2ZTD A;  1FNV A;  2R7D A;  3I2Z A;  4X65 L;  1HNX L;  1JCK B;  1QNK A;  4H13 C;  2XWJ B;  3QJY A;  1O78 A;  1PTO D;  2H4O A;  3GTM H;  4JPB W;  5IOD A;  3ULJ A;  5GAD C;  2KED A;  3L7Z C;  1ENA A;  1UE7 A;  3BVG A;  4GOP A;  2Z8L A;  1BVS A;  2NVY B;  5IGB A;  5F2D A;  2JA5 B;  1BKB A;  1B8A A;  3TN2 A;  4RG1 A;  1STB A;  1B9M A;  2RCN A;  4A3F B;  4LFC Q;  2B2Y A;  3H94 A;  4C2M H;  2TSS A;  1ESF A;  3NSW A;  1VF7 A;  3VR5 A;  3FPP A; 
#chains in the Genus database with same CATH homology
 4K0K L;  2F4V Q;  3RR5 A;  1KIX A;  1QUQ B;  2IX0 A;  2PQA B;  3I4N H;  3E0E A;  4R4T A;  3HOX H;  3KDF B;  5IE8 A;  1UE6 A;  1OXV A;  2YTY A;  4IPG A;  4B3S L;  1I5F A;  3M85 A;  1WI5 A;  4OWW B;  1C9O A;  1PVO A;  2UUA L;  2UUC L;  2KCM A;  1YHA A;  3HOV G;  4LF7 L;  1E1T A;  5IYD G;  5FLM G;  4HIM A;  3STB C;  1SMX A;  2K5N A;  2VY3 A;  3UDX A;  3T1H Q;  1S72 A;  1C7Y A;  1XNR L;  1XTD A;  1KC8 C;  5JEA J;  4DR7 Q;  4HJA A;  2I5L X;  3PUX A;  4NB3 A;  5C4X H;  3HKZ G;  5AJ3 L;  1B7Y B;  2XTI A;  4JI2 Q;  1TWH H;  2D62 A;  4IO9 A;  1VQP A;  2A8V A;  1CKM A;  3OTO Q;  3IRB A;  3UDF A;  1KD1 C;  3TQY A;  4XTC S;  1N34 Q;  1Q86 C;  4LNQ A;  3S1N H;  4QY7 A;  1VQ4 A;  1WJJ A;  4FDB A;  4A3C H;  1VQ6 A;  1PH9 A;  3CCE A;  5IT9 c;  4QGU A;  5GAE C;  2NVY H;  3K0X A;  1PFS A;  4GKJ Q;  4YCW A;  1M1K C;  2F52 A;  3KJP A;  1OXU A;  1WOC A;  1XMO L;  4J15 A;  1IXR A;  4BY7 H;  4A3F H;  4WJ4 A;  1MJC A;  1K0R A;  1QUQ A;  4GLA C;  3J81 j;  5LMU Q;  3HOU G;  1EQQ A;  1QVG A;  3KDF A;  1IBL L;  4IPD A;  3GTO H;  2ID0 A;  1GD7 A;  4A3E G;  3CQZ H;  4LFA Q;  4KHZ A;  4P72 A;  3CCJ A;  3E9I A;  1N32 Q;  2VZA A;  3W5O A;  1FJG Q;  1PH5 A;  3BZC A;  4B3R L;  2R6G A;  4UP9 A;  1HZ9 A;  2YTV A;  4PMW A;  2UU9 L;  2Z6K C;  1G6P A;  2UUB L;  4DV3 L;  2VS1 A;  2XGT A;  2K50 A;  1Y1V G;  2WAQ G;  2E8G A;  3MEF A;  4PZ7 A;  3ER0 A;  2YU9 H;  2OQK A;  1VQA A;  2ASB A;  1EOV A;  4R1J A;  4LFB Q;  3FP9 A;  4LFC L;  4JBW A;  3F1Z A;  3FKI G;  3L2P A;  4DV5 Q;  2K75 A;  5DLQ E;  2JEA I;  5IP7 G;  4DR6 Q;  3J81 i;  4GNX C;  1CUK A;  4IPC A;  4C3H H;  3S1Q H;  2NN6 G;  2OTJ A;  2NVX H;  2R93 H;  2F4V L;  3F2C A;  3PUY A;  4C3I H;  4Y52 H;  4PZ6 A;  4DV1 Q;  3HOY G;  1OXS C;  1KL9 A;  1O7I A;  2JA9 A;  3HOZ H;  3JAM i;  3CC4 A;  2N78 A;  4A3B H;  3RLF A;  3KFU A;  4GN4 B;  4KI0 A;  1J5E Q;  1XJV A;  1UE5 A;  4DKA C;  5IYC G;  1A8V A;  1D8L A;  3KF6 B;  1YJW A;  3WWV A;  5LMN W;  5M5W H;  2PNH A;  2H5X A;  4HJ9 A;  1YIJ A;  1HR0 W;  4MZ9 A;  3T1H L;  5JEA G;  2I5M X;  2HIX A;  1PH6 A;  4O0A A;  1CSP A;  1K3R A;  4DR7 L;  1YJN A;  1P16 A;  4P74 A;  5C44 H;  3S15 H;  2B29 A;  4DAY B;  4JI2 L;  5K36 G;  4KHP Q;  5JJL A;  3OTO L;  5IP9 G;  1SRU A;  1VS0 A;  1IL2 A;  3PO2 H;  1N34 L;  3GO5 A;  3I4M H;  4O2D A;  1WCM H;  2AWO A;  3GDE A;  3RN5 A;  4A3K G;  5FJ8 H;  2ZTE A;  2JA6 H;  4GKJ L;  4OON A;  4JI7 Q;  1X9N A;  2VQE Q;  1AE3 A;  2QGQ A;  3EIV A;  3TEH B;  2AKW B;  3L0O A;  5FLX c;  4DV0 Q;  2JA8 G;  3HKS A;  2IHE A;  1YEZ A;  2IT1 A;  1I3Q H;  1X65 A;  5LMU L;  1NMG A;  4A3L G;  1Y1W G;  1OTC A;  1EFW A;  1HZC A;  1K9M C;  4DV4 Q;  4LFA L;  3PIP A;  1N32 L;  1FJG L;  5C0X I;  1DGS A;  1MKH A;  3KF6 A;  3MXN B;  4JOI C;  3J7Z C;  2KCT A;  4L5S A;  2RF4 A;  3CMA A;  2PMZ E;  2RHS B;  2WP8 J;  3CCQ A;  4P75 A;  3U58 A;  1PH3 A;  2BH2 A;  4BY1 G;  4JI6 Q;  2A19 A;  4AH6 A;  4NXN Q;  4B3R Q;  4LW1 A;  4LF6 Q;  1CKN B;  5M3F H;  1Q1E A;  1GM5 A;  2D0P A;  3CPW A;  1X6O A;  4GNX B;  4UP7 A;  4LFB L;  3AYH B;  3GTK H;  1UEB A;  4L5Q A;  3PUW A;  4HIO A;  2I0Q A;  2N49 A;  2B3G A;  1N8R C;  4GS3 A;  4P71 A;  4DR6 L;  3GTG H;  3PO3 H;  4X62 Q;  4B3T Q;  1VQ9 A;  2NVT H;  3I4O A;  4A3J H;  5HGQ A;  4LF8 Q;  4HID A;  4AQY Q;  1VQI A;  1Y14 B;  2LXK A;  2HQL A;  4DV1 L;  3S2D H;  2EXD A;  4IJH A;  1HNW Q;  2UXD Q;  3AFP A;  1EIY B;  1K8G A;  3H3V H;  1E3P A;  1J5E L;  5IYC H;  1U0L A;  3CP0 A;  3LGJ A;  2N3S A;  2CWP A;  3OYY A;  5IYB H;  1HJP A;  4DR5 L;  1VQ5 A;  3M4O H;  3GTP H;  2ZM6 Q;  1R9T H;  2Z6K A;  3NEL A;  1TWA H;  2JE6 I;  3T1Y Q;  4X66 Q;  4A3I G;  2HIV A;  3UE1 A;  4KHP L;  5C3E G;  4BBS G;  2YTX A;  3FHW A;  4BXX G;  2YV5 A;  3H15 A;  1YJ9 A;  1CKN A;  3NEM A;  1SE8 A;  1Q81 C;  2OCE A;  2Q2H A;  1XNQ Q;  3DM3 A;  5J3B A;  3EN2 A;  4GNX A;  4A3G H;  2UXB L;  4DK3 C;  1JMC A;  4JC0 A;  4DUY Q;  1KRT A;  1T9H A;  4JI7 L;  2VQE L;  2ZJQ A;  4DV0 L;  1VQN A;  3OW2 A;  1PH4 A;  4GLV B;  4B3M Q;  3H0G G;  4ME3 A;  4JBK A;  2N8N A;  1BBU A;  1UWV A;  4UPA A;  4JI1 Q;  4APV A;  4AYB G;  5IWA Q;  4JYA Q;  1V9P A;  1NTG A;  4DV4 L;  1G29 1;  1I94 Q;  1JJC B;  1KAW A;  2PQA A;  1NJI C;  4MTN A;  2CKZ B;  4X64 Q;  1P8L A;  1VQM A;  2VUM H;  5ELN A;  1M90 C;  2JK8 A;  4JI5 Q;  1I50 H;  2CQO A;  4BBR G;  2B63 H;  2WFW A;  3UDG A;  2MO1 A;  4JI6 L;  4NXN L;  4R4I A;  3S24 A;  4LF6 L;  4OX9 Q;  3I56 A;  4LF9 Q;  1HH2 P;  2A1A A;  1OXX K;  2ZTC A;  2BA1 A;  3UDI A;  4R4Q A;  2OWO A;  2IY5 B;  3HOW G;  2JQO A;  3AFQ A;  1N9W A;  3K7U C;  4YY3 Q;  2WB1 E;  5C0X J;  4DR2 Q;  4X62 L;  2Y0S E;  1Q7Y C;  1VQ8 A;  4B3T L;  1YIT A;  3U4Z A;  2NZO A;  3KOJ A;  1XPR A;  4LF8 L;  5GAH C;  1S40 A;  4AQY L;  4A93 H;  2UXD L;  3W1G A;  2R92 G;  4YWL A;  1I6H H;  1VQO A;  1HNW L;  2CCZ A;  1PH8 A;  2K5H A;  1KXL A;  3PUV A;  1V43 A;  3S17 H;  1E22 A;  1XPO A;  3M7N A;  1Z9F A;  3RNU A;  1NMF A;  2ZM6 L;  1VCI A;  4JOI A;  3S2H H;  4IFD I;  1PH7 A;  3BJU A;  2AWN A;  3ERS X;  2DUD A;  4DR5 Q;  4DR4 L;  3HOV H;  5FLM H;  1S3O A;  5IYD H;  2JA7 G;  1LM0 A;  4X66 L;  3T1Y L;  1YHQ A;  4LUZ A;  3RN2 A;  2NZH A;  3A74 A;  1EYG A;  2PI2 E;  1JJG A;  4OWT B;  3KJO A;  2ES2 A;  4BBS H;  4JCV E;  4BXX H;  1TWF H;  1X56 A;  3M4Q A;  3CCU A;  4PZ8 A;  3Q8D A;  1XNQ L;  4UY8 C;  1FL0 A;  2R7Z G;  4DUY L;  2Q2U A;  1SN8 A;  2GVA A;  3J81 c;  1VQH A;  3GD7 A;  3HKZ E;  5IY0 A;  5M5X H;  1IBK L;  3GTQ H;  4B3M L;  2UXB Q;  3I4N G;  4BA1 I;  1IZ6 A;  3PV0 A;  1A63 A;  4JI1 L;  2KHJ A;  5IWA L;  3HOX G;  3F2B A;  4HIK A;  3JAM c;  4JI0 Q;  4JYA L;  5HY6 A;  2GN5 A;  2Z0S A;  1VQD A;  2EIF A;  4L5T A;  4A3M G;  1ASZ A;  3RLO A;  1I94 L;  3HOU H;  2UXC Q;  4ALP A;  3F8T A;  3VDY A;  2ATW A;  4GKK Q;  1VQJ A;  4X64 L;  2E2H H;  3M4P A;  4JI5 L;  1VQ7 A;  4A3E H;  1HNZ Q;  4JI8 Q;  4DAM A;  3J80 i;  1AH9 A;  3NEN A;  3G48 A;  4L5R C;  1WFQ A;  1VQK A;  1VQF A;  1XMQ Q;  1PYS B;  5JJK A;  4OX9 L;  3A5Z B;  1GVP A;  1NE3 A;  3PCO B;  5C4X G;  2YYZ A;  5GAG C;  5M3M G;  4LF9 L;  2MNA A;  1G51 A;  4LUO A;  3CCL A;  1Y1V H;  1JB7 A;  3CCM A;  5C0X G;  2R7F A;  3KYH C;  3S16 H;  4EX5 A;  5BR8 Q;  3GTJ H;  4IPH A;  3UE0 A;  2VW9 A;  1LYL A;  2CFM A;  4OO1 I;  1E7Z A;  4KLK A;  4YY3 L;  4DR2 L;  1JJ2 A;  2CWA A;  1YZ6 A;  3FKI H;  4HJ8 A;  3RZD H;  2ZJR A;  2IX1 A;  3S1M H;  4A3C G;  2E2J H;  1PHJ A;  2WAQ E;  5IP7 H;  5M5Y H;  1WYD A;  2JA5 G;  4POG A;  2R92 H;  3RLN A;  4TQU S;  4GLX A;  4QL5 A;  3TRZ A;  2VQF Q;  3DLL A;  2E2I H;  4GN3 B;  4YHH Q;  3G71 A;  4A3F G;  3M9B A;  5ELO A;  2IHF A;  3HOY H;  1LTL A;  1BBW A;  3CCR A;  2AHO B;  1B70 B;  3CC7 A;  1SRO A;  3CC2 A;  2LXJ A;  1SFO H;  1MIU A;  4DK6 C;  2C35 B;  3TRE A;  3CME A;  1C0A A;  2KHI A;  2MQH A;  1TXY A;  4DR4 Q;  1N36 Q;  4DV2 Q;  2VL6 A;  1K83 H;  1VQL A;  4P73 A;  2ZJP A;  1EUJ A;  3BZK A;  4IOC A;  2HHH Q;  3S14 H;  2OQ0 A;  4YCV A;  5C4J H;  4NXM Q;  3GTL H;  5IP9 H;  5LMN Q;  2K52 A;  4IFD J;  1HR0 Q;  3PF5 A;  3CCS A;  2NVQ H;  4LF5 Q;  3ZJY C;  2ALY B;  2D0O A;  1GKH A;  4YWM A;  3PIO A;  2R93 G;  1CSQ A;  4A3K H;  1Q1B A;  4Y7N H;  3D31 A;  4A3D H;  1CKO A;  1X54 A;  1Z47 A;  1RIP A;  4QJF A;  4A3M H;  4JI0 L;  2JA8 H;  1IBK Q;  1YNX A;  3HOZ G;  1VQG A;  4A3B G;  3J7A 5;  1V1Q A;  1EIF A;  4YCU A;  5EAY A;  2MFI A;  1HZA A;  2UXC L;  1QVC A;  4GKK L;  1Y1W H;  1Q46 A;  4JG2 A;  3K80 C;  4DNI A;  2VNU D;  1L1O B;  1J6Q A;  1HNZ L;  4C3J H;  4JI8 L;  3RZO H;  1N33 Q;  3CF5 A;  1E1O A;  3AEV A;  1XMQ L;  4JI3 L;  1NBW A;  5M3M H;  2KBN A;  5C44 G;  1QZG A;  3B6Y A;  4IJL A;  4DUZ Q;  4BY1 H;  4GN5 A;  1IYJ B;  1EWI A;  4GOP C;  5BR8 L;  3PO2 G;  4JBM A;  3AQQ A;  4DV7 Q;  1IBM Q;  3CD6 A;  1A0I A;  4IOA A;  4DR1 Q;  1YHB A;  3NBH B;  1H95 A;  4JV5 L;  1QZH A;  3I4M G;  2BA0 A;  1KQS A;  1OXT A;  1WCM G;  3K8A A;  3U4V A;  5FJ8 G;  2JA5 H;  2JA6 G;  1PA6 A;  3PF4 A;  1VQB A;  4DV6 Q;  3M3Y H;  2K14 A;  1LUZ A;  4OXP A;  1A62 A;  1E24 A;  4POF A;  2VQF L;  4YHH L;  4R4O A;  2MO0 A;  3CCV A;  2I5H A;  4R4C A;  3A5U A;  3E9H A;  4X65 Q;  4A76 A;  1HNX Q;  4A3D G;  2PI2 A;  1W2B A;  3KF8 B;  2F3I A;  1X55 A;  3K81 C;  4UP8 A;  2L15 A;  2E5L Q;  4LWC A;  3PUZ A;  1FVI A;  1YVC A;  2GVB A;  3ULP A;  3PSI A;  3ULL A;  3I7F A;  1KRS A;  4QQB X;  1L1O A;  2HT1 A;  2AMC B;  2KEN A;  4RMF A;  1Q8K A;  2K4K A;  1FGU A;  2K5V A;  3CW2 C;  4DV2 L;  1N36 L;  1K8A C;  3PGZ A;  4DR3 Q;  1KHI A;  5M3F G;  4WJ3 M;  4A3I H;  3EBE A;  2NN6 I;  2QEX A;  1PH1 A;  2HHH L;  2RHQ B;  4NXM L;  4IFD G;  4MNO A;  5C3E H;  1NY4 A;  4QIW E;  5LMN L;  3U50 C;  3BU2 A;  1JE5 A;  5GQO A;  1HR0 L;  4LF5 L;  3PO3 G;  2JEB I;  1AE2 A;  4LF4 Q;  3H3V I;  3F2D A;  1Q12 A;  4A3J G;  4JI4 Q;  3S1R H;  4X6A H;  3CAM A;  4K0K Q;  3H0G H;  4XIG S;  4H02 A;  1QVF A;  1MJE A;  4AIM A;  1L2F A;  4EQ5 A;  3G4S A;  1RL2 A;  5IYB G;  3KLW A;  1PH2 A;  4PG3 A;  1TWC H;  2FXQ A;  1GO3 E;  1U5K A;  3CXC A;  1Q82 C;  4B3S Q;  3I55 A;  1YI2 A;  2QA4 A;  2UUA Q;  2V1C C;  3D0F A;  1N33 L;  5JJI A;  1K73 C;  2OTL A;  2UUC Q;  4AYB E;  4GOP B;  1ASY A;  4LF7 Q;  4BBR H;  1SLJ A;  2EQS A;  1VQC A;  1XNR Q;  3A0J A;  4A4I A;  4DPG A;  1HZB A;  4DUZ L;  4A75 A;  1UE1 A;  1X3F A;  3CPF A;  1D7Q A;  3SGI A;  4JI3 Q;  1L0W A;  4HJ7 A;  1L1O C;  1PYB A;  5AJ3 Q;  4NPS A;  2LSS A;  4DV7 L;  1SR3 A;  1X3G A;  2JJQ A;  4TVA B;  4DR1 L;  1IBM L;  3HFZ B;  4OWX B;  4A3G G;  2BH8 A;  5H1S E;  4BA2 I;  2DGY A;  3G6E A;  1VQE A;  2Q2I A;  3HOW H;  4DV6 L;  4JV5 Q;  3JC6 6;  3ICE A;  2ZTD A;  4LUV A;  2R7D A;  3I2Z A;  3W1B A;  4X65 L;  1XMO Q;  1HNX L;  4OO1 G;  1PV4 A;  2E5L L;  4BY7 G;  3STB D;  1IBL Q;  2VUM G;  3GTM H;  3J80 c;  2B63 G;  3ULJ A;  5GAD C;  1JT8 A;  2Q2T A;  3L7Z C;  4A3L H;  3TS2 A;  2UU9 Q;  1UE7 A;  4YWK A;  5GRO A;  2JA7 H;  4DR3 L;  4GOP A;  2WB1 G;  4DV3 Q;  2UUB Q;  2Y0S G;  1BVS A;  4DV5 L;  3K7A H;  4HJ5 A;  1X3E A;  1BKB A;  1B8A A;  4RG1 A;  1XPU A;  2R7Z H;  2RCN A;  4LFC Q;  1W3S A;  4LF4 L;  1YBY A;  4C2M H;  5E7N A;  3TS0 A;  1EQR A;  4JI4 L;  4A93 G;  4JBJ A;  1TWG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...