4NB3A

Crystal structure of rpa70n in complex with a 3,4 dichlorophenylalanine atrip derived peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a Potent Stapled Helix Peptide That Binds to the 70N Domain of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4nb3A00
3NELA 4DUYQ 1NTGA 1EIFA 2YV5A 1XNRL 1A0IA 1J5EL 4BXXG 3UDIA 4DUZL 4A3EG 1Q12A 2D62A 1K8AC 4JI6Q 2ES2A 1KD1C 2PNHA 1IBMQ 2B29A 4GLAC 3ULLA 1L1OC 5IYBH 5FLMG 2VY3A 3F2DA 4A3IH 3LGJA 4DR4L 3K0XA 3CD6A 5LMUL 4JV5L 5AJ3Q 2PQAA 2VQFQ 3OTOQ 2K75A 3T1YL 4LFAQ 3KDFA 2MO0A 3RLNA 1Q82C 1XPRA 1ASZA 4JBKA 4FDBA 4A93G 2HT1A 3NEMA 1H95A 3K7AH 3F2BA 5ELOA 2Q2HA 4A3FG 4ME3A 3M3YH 4A3BH 4HJ7A 1IXRA 1NMGA 1VQPA 4RMFA 4JI2Q 5M3FH 1U0LA 5IYCH 3PIOA 1XNQQ 1QVGA 3MXNB 4X65Q 1UWVA 1VQFA 2H5XA 4XIGS 1XNRQ 4A3DG 3FKIH 3HOXH 1CKNB 5JEAG 4DR1L 3HOVH 1OTCA 3ULJA 1G291 4DV5Q 4HJ5A 4DR2L 3JC66 2B63G 4YWMA 4UY8C 4DR5L 1X55A 2VS1A 1HNZL 4DR7L 1I94L 4HIOA 1YJWA 2NN6I 4P73A 3CMAA 4LF8L 4DK3C 4OONA 4UP8A 2NVQH 4DR4Q 4C3JH 5BR8L 5LMUQ 1R9TH 1Q7YC 2NVTH 4JV5Q 4A3LG 1FJGL 3H3VI 5IP9H 2KHIA 3CCSA 1I5FA 3I4MH 2Q2IA 1N8RC 1A62A 2N49A 4DKAC 2I5HA 4YWKA 3BJUA 3PGZA 5C4XG 1NBWA 1Q86C 1N32L 3K8AA 3ER0A 1VQLA 4JI7L 2UXCQ 4AYBE 4LF7L 4A3GH 4GN5A 3PF4A 4GOPA 5C0XG 2MFIA 4L5TA 2R7DA 4BY1G 1VQ6A 4PMWA 4POGA 1YJ9A 1Y1WG 4HIDA 2RCNA 2JA5G 1NY4A 2ZM6L 2JA6H 4DR1Q 3PUZA 3A0JA 4WJ3M 4BY7H 4OWWB 4AYBG 3TEHB 3CC2A 1VCIA 3W1BA 2E2IH 4P71A 1Z9FA 1HZAA 4GNXB 1HNZQ 1P16A 4DR7Q 4GOPC 4LF8Q 2CKZB 5LMNQ 4GKJQ 2BH8A 4DV6L 4BXXH 1HNWL 3PUYA 5BR8Q 5LMNW 4A3EH 4KHZA 3RN2A 4LFBQ 1RIPA 2F3IA 4MZ9A 4YY3Q 4B3MQ 4OXPA 4GLXA 4KHPL 5EAYA 4YCVA 1JMCA 3PSIA 2I5LX 4IJLA 4OWXB 1XPUA 5FJ8H 4DAMA 5FLMH 1WJJA 2EQSA 1Y14B 4BBRG 4JI7Q 1V9PA 5HY6A 4LF7Q 4LF6L 5GADC 3CCVA 2R7ZG 1KHIA 2DGYA 3NBHB 3KYHC 3UDFA 3JAMi 1C0AA 1PH6A 4JI3L 3S16H 3TS2A 4A3KG 2A1AA 1EUJA 2ALYB 2QGQA 3ERSX 1PV4A 1V1QA 3CMEA 4A3FH 4L5RC 3ZJYC 4JI4L 1E1OA 2UXBL 1IZ6A 2CQOA 4NXML 3CCEA 1X3EA 1PH5A 1SN8A 1IL2A 1LYLA 1WI5A 1Z47A 5M5YH 1VQCA 1EIYB 5M5XH 4X62L 4NB3A 2Q2TA 4X6AH 3D31A 2B63H 4HJ9A 4A3CG 1PH1A 2OCEA 4JI6L 1VQBA 1PVOA 3CCUA 1K3RA 1QUQA 5IY0A 3OYYA 1QZGA 3CCQA 1XMOL 1IBML 3U50C 3HOYG 3S15H 3PF5A 3PUVA 2DUDA 3CCJA 2QEXA 2IY5B 4J15A 4P74A 3OW2A 3GTGH 4BBSH 2K5NA 4A76A 1NMFA 4A3LH 5J3BA 4APVA 4IFDJ 4UP9A 2N3SA 5DLQE 2VQFL 3OTOL 3S2DH 1SR3A 1HNXL 5C4XH 4KLKA 5HGQA 3GTMH 4K0KL 1K8GA 2ZJPA 4QIWE 3RLFA 4AH6A 3HOUG 2LSSA 4B3TQ 3S2HH 1XPOA 2E2JH 4JI4Q 2UXBQ 1BBWA 1CKMA 4DV2L 3UE0A 4EQ5A 3K81C 1N36Q 1VQ7A 4UPAA 1G51A 1EQRA 4BY1H 1OXXK 3UE1A 4AQYQ 1EFWA 1EWIA 5IT9c 1KQSA 1CSPA 4JI2L 4DAYB 1XNQL 2E8GA 4X65L 1TWFH 2CWAA 1Y1WH 4X62Q 1QVFA 1S72A 3TREA 3J81i 2GVAA 4DNIA 3JAMc 4JYAL 4DV5L 3E0EA 1AE3A 3KF6B 3I7FA 1XMOQ 3RR5A 1PHJA 1X3GA 1I6HH 1ASYA 3M7NA 4IJHA 4PZ7A 3A74A 4RG1A 2JA8G 2OWOA 1PH9A 1B70B 4A3JG 1E7ZA 1SFOH 3CC7A 2VL6A 1HNXQ 2N78A 2VUMH 2MNAA 5M3MG 4K0KQ 2HIVA 4BBRH 2E5LQ 2C35B 4HIMA 2UXCL 1KRSA 1OXSC 1V43A 3PCOB 2LXJA 4DV2Q 1IYJB 2ZTDA 1MKHA 3RZDH 1X9NA 2R7ZH 5JEAJ 1J6QA 3B6YA 2I0QA 1YHBA 1GM5A 1PYBA 2CWPA 4NXNL 5GAGC 4A3KH 1E22A 1YNXA 4OX9L 3Q8DA 1SRUA 4YCUA 2CCZA 1T9HA 2JE6I 4GKKL 4JYAQ 5GAHC 2YTYA 4TQUS 3UDGA 2R7FA 2IHFA 5M5WH 5C44G 1JJ2A 1JJGA 1EOVA 3F2CA 4UP7A 5LMNL 4GKJL 2NZHA 2K5VA 2VZAA 4A3CH 3CQZH 4JI1L 3RNUA 4LFBL 4YY3L 4B3ML 3HOWG 1K83H 5C0XJ 1K0RA 4A4IA 3S14H 4B3RL 1E1TA 1P8LA 3U58A 4YWLA 3A5ZB 1N33L 3J81c 3M4QA 4IPDA 3PV0A 4LF4Q 3K7UC 3I56A 1BKBA 1KIXA 1L1OB 3PIPA 2PI2A 2CFMA 4NXNQ 3HOUH 4MNOA 3H0GG 4DR3L 4OX9Q 1Q1EA 2Y0SE 4R4QA 3NENA 3G6EA 4GKKQ 2Q2UA 3RN5A 5IYDG 3FHWA 1YJNA 3CPWA 1GD7A 2Z0SA 1GKHA 2AWNA 2PMZE 3PUWA 4LF5Q 2UXDL 1XMQL 1UEBA 3PO3G 3T1HQ 2JQOA 4NPSA 2OTLA 4JI1Q 4DV3L 3TS0A 2Y0SG 1JB7A 4IPHA 2B3GA 5JJKA 2PI2E 3CAMA 4DK6C 5GQOA 1PA6A 1IBKL 2A8VA 2R6GA 1A63A 4B3RQ 4C2MH 1I3QH 1UE7A 2PQAB 1MJEA 1UE1A 4L5SA 1N33Q 3CF5A 2V1CC 3H15A 3F1ZA 3EBEA 2I5MX 3KDFB 4HJAA 5GAEC 2JA8H 1L0WA 4LF9L 4P72A 1B7YB 1Y1VG 2GVBA 3GDEA 1LM0A 2WB1E 5FLXc 1PH8A 3GTLH 5M3MH 2QA4A 3BZCA 4A93H 4DR3Q 4JI8Q 3STBD 3PO2G 4B3TL 1Q46A 4P75A 2FXQA 4A3IG 3A5UA 4BA2I 4X64Q 4POFA 3HKZE 2YTVA 4GS3A 2WFWA 4JG2A 5C0XI 3AFPA 5C4JH 1N36L 2UXDQ 1X54A 3W5OA 1D8LA 4AQYL 2WB1G 1XMQQ 3HOZG 4QJFA 3CCLA 4A3DH 1SLJA 1N34Q 3S1QH 1YBYA 3MEFA 2E2HH 4DV3Q 3CXCA 2BA1A 1IBKQ 2UUAQ 1X6OA 2AKWB 2WAQE 3HKZG 1DGSA 5C44H 1HR0W 2IX1A 4WJ4A 3IRBA 4PZ8A 3AQQA 4DV0L 2AWOA 3ULPA 3E9IA 4LF9Q 3HOXG 4DV4L 2RHQB 1A8VA 2KENA 3HOWH 1E24A 2RHSB 4GOPB 2R92G 3SGIA 3TQYA 3DM3A 4X66Q 3I55A 4IO9A 4A3MG 3TRZA 5JJIA 1CKNA 3AYHB 1CUKA 1VQGA 2ZTCA 2E5LL 5IP7G 2JJQA 1S3OA 1IBLL 3I4NG 3RZOH 3GTJH 1K9MC 2HHHQ 2N8NA 1OXTA 3VDYA 1BVSA 3H0GH 3J7ZC 1C9OA 1EQQA 2JA5H 1YEZA 1QVCA 1KL9A 1VQHA 4YHHL 3DLLA 3KOJA 1U5KA 1WCMG 3PUXA 3U4VA 2NVYH 2NVXH 2JA7G 1VQOA 3BZKA 4R4IA 2BH2A 4DV0Q 1Q1BA 4DV7L 1SE8A 3M9BA 3L2PA 1YVCA 4DV4Q 4LWCA 2ZJRA 1SROA 1MJCA 3HFZB 5ELNA 1AH9A 2NN6G 2AMCB 2WP8J 4GN3B 1KRTA 1LTLA 5JJLA 2YYZA 2OQ0A 2HQLA 4QGUA 3S1NH 1IBLQ 1GO3E 3CC4A 1Y1VH 4LF4L 4GNXA 1JJCB 1PFSA 2EXDA 2K4KA 3M4OH 2R93G 4KI0A 3W1GA 3GTKH 5C3EG 1N9WA 1VQJA 3S1RH 3PO2H 4AIMA 1BBUA 1HZCA 5FJ8G 4YHHQ 2D0PA 1X56A 2JK8A 3CCMA 1E3PA 3WWVA 4IFDI 2GN5A 2JA9A 3G71A 2UU9L 4B3SL 3K80C 1VQ4A 1WOCA 4DPGA 1TWHH 3M4PA 1W2BA 4LF5L 3HOZH 4IOAA 5GROA 3T1HL 1B8AA 4DV7Q 1QUQB 2ID0A 4GNXC 1YZ6A 1EYGA 4R4CA 3ICEA 2D0OA 1X3FA 1K73C 2KHJA 4PG3A 3U4ZA 4QY7A 1YI2A 2UUCL 4LFCQ 3HOYH 1C7YA 4IPCA 3L0OA 3GTPH 1KC8C 4HJ8A 2OQKA 3S17H 4JI5L 4JBWA 4R1JA 5K36G 1SMXA 4DV1L 4GN4B 1I50H 4O2DA 1J5EQ 3EIVA 4JC0A 2MQHA 2YTXA 4LW1A 3S24A 2ASBA 4Y7NH 4DUZQ 4C3HH 1Q8KA 3CCRA 1VQEA 2R92H 2MO1A 4A3MH 3CPFA 4Y52H 2K5HA 4JCVE 2A19A 1TWCH 4JI8L 5IP7H 3S1MH 3HKSA 4MTNA 3I4NH 2XGTA 3KFUA 2KCTA 4PZ6A 4X64L 1KAWA 2UU9Q 1HZ9A 4B3SQ 3CW2C 4BBSG 3GTQH 1VQMA 1MIUA 1LUZA 2IT1A 4QL5A 4ALPA 3T1YQ 5E7NA 4DR6L 4JBMA 4H02A 3BU2A 2NZOA 3AEVA 2AHOB 3GD7A 1N34L 1YIJA 1VQ8A 1VS0A 5H1SE 5IWAL 1XTDA 2ATWA 4XTCS 1S40A 1WCMH 4BA1I 4JI0L 1OXVA 2OTJA 3RLOA 1HR0L 2UUCQ 1M1KC 1M90C 2UUAL 2JA7H 4OO1I 1VQIA 4JI5Q 1YHQA 4DV1Q 3KLWA 1X65A 1VQKA 2EIFA 4A3JH 3J80i 4DR2Q 2RF4A 3FP9A 4DR5Q 1VQAA 3GO5A 4HIKA 4X66L 1G6PA 2VQEL 4IOCA 1I94Q 2UUBL 3G4SA 2K14A 1TWAH 2KBNA 4R4OA 3KF8B 3G48A 5IYBG 1JT8A 2LXKA 1O7IA 1UE5A 3H3VH 3KF6A 1GVPA 1FJGQ 4IPGA 2HHHL 2R93H 1KXLA 3L7ZC 5C3EH 4DR6Q 2VUMG 4O0AA 3J7A5 1FVIA 1HH2P 2IHEA 1N32Q 5IWAQ 1RL2A 1JE5A 1VQDA 3UDXA 4JI0Q 4OO1G 3KJPA 4TVAB 3CP0A 3I2ZA 1HR0Q 4GLVB 4JOIA 4L5QA 1FGUA 3EN2A 2BA0A 1OXUA 4A3BG 3F8TA 4R4TA 3STBC 5M3FG 4QQBX 4JBJA 2JEAI 4LUZA 5IYCG 1VQ5A 3E9HA 3I4OA 1HJPA 2ZM6Q 1NJIC 3M85A 3FKIG 1W3SA 1YITA 1FL0A 2Z6KA 3HOVG 2L15A 2F4VL 4LUOA 4A75A 1CKOA 1HZBA 2WAQG 2VQEQ 2UUBQ 4DUYL 1NE3A 1XJVA 4JOIC 1CSQA 2ZTEA 4DV6Q 1HNWQ 4EX5A 1TXYA 2VW9A 1L2FA 2JEBI 4LUVA 5IE8A 2K50A 5IP9G 1QZHA 2XTIA 3GTOH 2HIXA 2KCMA 4KHPQ 1PH3A 3I4MG 1UE6A 1Q81C 4C3IH 2Z6KC 4LNQA 2F52A 3J80c 1D7QA 1VQ9A 1VQNA 4YCWA 4LF6Q 4A3GG 3D0FA 5IYDH 5AJ3L 1AE2A 1TWGH 3J81j 1PH4A 3PO3H 4LFAL 2YU9H 2ZJQA 3KJOA 4JI3Q 1PH2A 1PYSB 1YHAA 3AFQA 2JA6G 1PH7A 2VNUD 4IFDG 2K52A 2F4VQ 1L1OA 2IX0A 4BY7G 4LFCL 4NXMQ 1WYDA 4OWTB 1WFQA
chains in the Genus database with same CATH superfamily
4O1NA 1NTGA 4A3MB 3QO2A 1XNRL 2B2TA 1D5MC 1J5EL 3EFXD 4K6LA 5HURA 1Q12A 2Z8LA 5KYIA 2ES2A 1IBMQ 1RCVD 1ILPA 3SR1A 1HHVA 3F2DA 3URYA 5LMUL 1BCPB 1AW7A 2B2TC 1Q82C 3T1YL 4LFAQ 1XPRA 4FDBA 1SEBD 2RDGA 4A93G 2BCOA 2HT1A 1H95A 1S5ED 3K7AH 3F2BA 4OO1H 2Q2HA 5DNFA 2HDMA 1AN8A 1JWUD 4A3BH 1IXRA 1PRTB 4RMFA 3KF8A 3MFYA 4KHVA 3HOVH 1OTCA 1MSGA 1YNND 4DV5Q 4FP5D 2RA4A 1HNZL 2B2YA 2R93B 4XXEA 1F9RA 4P73A 4LF8L 5C3EB 1W6JA 4UP8A 5BN5A 5I2XA 1Q7YC 1L0YB 5I9PA 3H3VI 3DHQA 5IODA 1I5FA 1N8RC 1HTLD 1A62A 3PGZA 3OOCA 1NBWA 2JYOA 4FF1A 2UXCQ 4LF7L 3PF4A 5C0XG 4C1NK 1EY4A 4L5TA 3C3LA 1R4QB 5CBAE 2DJGC 2VB2X 4POGA 2JA6H 2RCNA 2ZM6L 4DR1Q 1TKWB 1MBYA 1ENFA 1TQOA 4K14A 2XRSD 3TEHB 4ABNA 4OWWB 2K6AA 3RUZA 2K01A 5CYUA 2E2IH 4P71A 4XT3B 1A2TA 5LMNQ 4XQJA 2BH8A 1I4RA 4LFBQ 4YY3Q 4B3MQ 4KHPL 1RJTA 4YCVA 1JMCA 4IJLA 1XPUA 5EPKA 5C5LA 4RHRA 4BBRG 4JI7Q 1RD9D 1Y14B 5HY6A 4DAVA 3R8BA 2A5HA 4KJOA 2K5DA 3KYHC 1NUCA 3TS2A 2PPBC 2QGQA 4RCOA 4CHTB 4A3FH 4L5RC 3LX0A 2CQOA 4NXML 4KD4A 1X3EA 3I3CA 5K36H 1STAA 1GUTA 4ZAIA 5JEAH 1F9PA 4A3IB 1PH1A 3I91A 1K3RA 1QZGA 1K0SA 1IBML 5CV7A 3U50C 3U9SA 5FK9C 2F0KA 3T51B 3CCJA 2IY5B 3OW2A 3GTGH 2K5NA 4A3LH 5J3BA 3VA7A 4IFDJ 3GV6A 2LFNA 3BVGA 4MIUA 1HNXL 1BCPC 4AH6A 2LSSA 3S2HH 2A69C 4JI4Q 3MXPA 1BQQT 1BBWA 1CKMA 1LTBD 4I65A 4UPAA 1EQRA 3J81L 1LTSD 3UE1A 2OT2A 3LNNA 1KQSA 1PRTC 2E8GA 1TWFH 4M1UB 4ZCKA 1Y1WH 1SE4A 1EYDA 3TZDA 2NVQB 4DV5L 3E0EA 3KF6B 3I7FA 2F0OA 2NVTB 4OHJA 3T16A 4IJHA 1Z7TA 3J80E 4PZ7A 3A74A 2OWOA 1QE6A 1EY8A 1SAPA 3VR2A 1E7ZA 2VL6A 2F0QA 3NTKA 3I70A 2K04A 2HIVA 2E5LQ 2J0TD 2UXCL 1V43A 4DV2Q 1Q8IA 2R7ZH 1GM5A 1PYBA 4NXNL 5GAGC 4P2CB 2O5IC 1YNXA 2Z4IA 5AFWA 4H44C 3Q23A 5ELDA 4HTHA 1T9HA 5GAHC 1EEFD 5D14A 3NK9A 4DGZA 4A3EB 3UDGA 3TP6A 1JJ2A 4TRDA 2CH4A 5LMNL 2RKSA 2XNAC 2ZXPA 2VZAA 4LFBL 4DNRB 4YY3L 4B3ML 3DEOA 3S14H 1U4LA 3D3RA 4M8AA 2IX3A 1HA6A 3A5ZB 3QOLA 4LF4Q 2ENBA 1SNQA 1TVXA 5BN3A 2L9HA 3HOUH 1Q1EA 5KYLA 4B9XA 3KLSA 2Z6BA 2X6LA 1D6EC 1CHQD 4LF5Q 1UEBA 4DK0A 1GUWA 1JB7A 3TS0A 4BBSB 3CAMA 4DK6C 5GQOA 2A8VA 1B3QA 1PZID 3ND9A 4X3SA 1UE1A 3I90A 3DEPA 3CF5A 3S2DB 4G7OC 3GV3A 1PZJD 5C4XB 1SNPA 4EVOA 4HJAA 4EQPA 1Y69U 1HUNA 4P72A 2P5ZX 4FYDA 2DJFC 3NWTA 5FLXc 1PH8A 4FVMA 4A93H 4JI8Q 2RDFA 3PO2G 1II3A 3FRPB 4NDXA 4OIKA 4A3IG 1EY7A 1O7ZA 1U9RA 4FXKC 4OEMB 4POFA 4X64Q 3MTSA 5C0XI 2KA7A 3AFPA 1N34Q 5ELBA 1I6HB 1YBYA 2SEBD 1L0XB 3TBIB 1CA5A 2E2HH 5C44H 4WJ4A 4PZ8A 3AQQA 5A2QL 4S3SA 4LF9Q 1A8VA 3K7AB 1E24A 2IW3A 3MXNA 2X69A 3DM3A 4X66Q 3RZDB 5JJIA 1CKNA 5DM73 3K58A 3AYHB 1VQGA 2E5LL 2O2LD 5IP7G 4HSVA 1I6VC 1K9MC 2N8NA 2F0FA 5EKKA 1FR3A 3J7ZC 1QVCA 5M5WB 4YHHL 3DLLA 2FMCA 3KOJA 1EZ8A 2D5DA 3PUXA 1E2WA 1PTOB 4V190 3BZKA 4R4IA 2BH2A 1JWSD 1SE8A 1EQVA 2Q8TA 3I8ZA 1SROA 3T4AC 3HFZB 1SYCA 3KUPA 1K3BC 2YYZA 2Q8IB 3UI2A 1B9NA 3A7LA 1GO3E 2I07B 1Y1VH 4LF4L 1K8MA 3M4OH 1QCBD 2ZXRA 4HSPA 3GTKH 1VQJA 3X3NA 2K5QA 1HZCA 5FJ8G 2EJFC 1X56A 1PFBA 3G71A 4B3SL 2UU9L 2WKDA 1ET6A 1DYQA 3P7JA 4LF5L 5GROA 2NTSA 1B8AA 2B8FA 1QUQB 5G3LF 4DF7A 3ICEA 3M7GA 1DOLA 1K73C 4PG3A 1DZ1A 4IPCA 2JSOA 3ZYYX 2I46A 4TKOB 2B8GA 2ASBA 2YTXA 3GP7A 4DUZQ 1VQEA 2R92H 4A3MH 2JXMB 1B2TA 4ILWA 1XXGA 2A19A 4JI8L 4C3IG 3HKSA 2LKVA 3NTHA 3I4NH 4A3DB 2KCTA 4PZ6A 4X64L 4BBSG 3CW2C 3W3AA 3R93A 1VQMA 3OIPA 4LAAA 4QL5A 4DR6L 4JBMA 4H02A 1N34L 5H1SE 4XYOA 5I6WA 4BA1I 1FNWA 2BE5C 2Q8RE 1E0BA 1KDBA 1YHQA 4DN4M 5J39A 2F0PA 4WFN3 3KLWA 4X3KA 1VMCA 3J81E 1VQKA 2EIFA 1TU2B 4KY7A 3J80i 3V05A 3S2HB 4F88A 4DR5Q 1VQAA 3GO5A 4HIKA 3SE0A 2NN6H 3RZOB 4X66L 3TZUA 2KBNA 3G48A 1F9SA 1Y1WB 1XTCD 1GVPA 2N88A 1PDQA 3MAQA 2R93H 4AYBB 5C3EH 4WORA 1HH2P 2IHEA 4CDEC 5IWAQ 1RL2A 1VQDA 3NTIA 4OO1G 2QEJC 3I2ZA 3TDQA 1STYA 2KEDA 4L5QA 4RWSC 1OXUA 2Y0SB 4A3BG 4R4TA 3SDZA 1PTOC 2Z9HA 4JBJA 4NKLA 3M85A 1W3SA 2NUCA 2PMZB 2KCCA 1YITA 3HOVG 2L15A 1QB5D 4LUOA 3D6WA 1CKOA 5M9OA 2R7ZB 5J1ZA 3VYRA 2VQEQ 2UUBQ 4H13C 4DV6Q 1CSQA 1I4QA 3P20A 4CDCC 5IE8A 3MA2B 1UE6A 3AB9A 2PQEA 1GUNA 3MEHA 3HOZB 1PMRA 4YCWA 4LF6Q 5JPNC 4QCLA 3DXJC 2PNRC 1AE2A 2EDGA 3J81j 4PMBA 2QCPX 4JI3Q 4G57A 3HOYB 2V4DA 3S17B 2JA6G 2NB0A 1PH7A 1X32A 2K52A 1L1OA 2K7VA 1I4PA 1VDZA 1WYDA 2EY6A 4Q5VA 3HOUB 3UDIA 1MHWC 4DUZL 5CR3A 2D62A 4JI6Q 1KDCA 2EJGC 1C8CA 2AUJD 1L1OC 4E6IA 3K0YA 5IYBH 4NP5A 3MXGA 4A3IH 4IUNA 3CD6A 1CI3M 1WTXA 4JPBW 5AJ3Q 2PQAA 2VQFQ 2MO0A 3RLNA 1KABA 4C56C 2JA7B 2A68C 1ASZA 4JBKA 1F2YA 2SDFA 4A3FG 1CZGA 2PCFB 1ET9A 1NMGA 3BVMA 4JI2Q 4HJ7A 1VQPA 2E76C 2KVMA 3QOJA 4X65Q 1VQFA 1XNRQ 4A3DG 1EWHA 5JEAG 4IZ8A 1TWAB 3ULJA 1ZYRD 3JC66 4UY8C 4DR5L 1CT1D 4RHSA 1YJWA 2K28A 3I4LA 2NVQH 3HEJA 5LMUQ 2NVTH 2F0IA 4A3LG 1H9JA 5A2QE 2Q2IA 4DKAC 4YWKA 1S5CD 2TMPA 1MGSA 3K8AA 5I4DA 1U4MA 2F3VA 4AYBE 1CQFA 3OIQA 2MFIA 5KRUA 3R2IA 1OO9B 1KLGD 1YJ9A 1Y1WG 4H7BA 4WJ3M 4BY7H 4AYBG 2A74C 3K5OA 1HNZQ 4LF8Q 5KNBA 3GTOB 4GKJQ 4DV6L 2F03A 2L11A 4A3EH 2F3IA 2M2LA 4GLXA 4RAUC 1D1KA 5E4WC 5FJ8H 2XSCA 4DAMA 5FLMH 1V9PA 1JWMD 2YU9B 4LF7Q 4LF6L 1WTVA 2R7ZG 1KHIA 1LTRD 2R3ZA 2DY8A 1C0AA 1PH6A 4JI3L 4RKBA 1EUJA 3QG1A 3ZJYC 3ERQA 2UXBL 3CRKC 3CCEA 1IL2A 1WI5A 1BBXC 1EY0A 4EQOA 2K1BA 4X62L 4NB3A 4X6AH 5CV8A 4HJ9A 5CGKA 1U4RA 4JI6L 3EA6A 1VQBA 1PVOA 3CCUA 5IY0A 3HOYG 1MSHA 1S5DD 1V8QA 2DUDA 1KAAA 3PUVA 4ID6A 4P74A 1ESRA 4BBSH 3MFGA 3CHBD 1DJRD 2N3SA 5DLQE 2VQFL 3S2DH 5C4XH 5HGQA 4K0KL 3M3YB 3HOUG 2ZJPA 2B2VA 4QIWE 4ZUIA 4B3TQ 1F2MA 1UNSA 1TR5A 4OO1I 4BY1H 3HOXB 1N36Q 1G51A 3VYSA 2OXPA 1EFWA 4JI2L 1EWIA 1STNA 4QF4A 3WDNA 4DAYB 4X65L 2CWAA 2WAQB 5D3DA 3BDLA 5KEEA 1S72A 3J81i 2GVAA 1SYEA 3I4NB 4DXFA 1AE3A 4QUCA 2B2VC 3OWFA 1H9SB 1I6HH 3DWPA 1ASYA 4TSSA 1HXYD 4J8QA 4RG1A 1KLUD 1EIGA 1HNXQ 4KN7C 3DMUA 2KECA 1V1PA 3DUZA 4HIMA 2BDNA 1KRSA 3PCOB 2LXJA 1KNEA 1IYJB 3RZDH 1MKHA 2CWPA 3Q8DA 5JVG3 3DWQA 2JE6I 2CCZA 1BO0A 5C4ZA 3J7AV 2HQEA 4XT1B 3CKIB 1JQYD 1DM0B 5M5WH 5C44G 1EOVA 3F2CA 4GKJL 2K5VA 1PTOH 1ENAA 2B39A 4A3CH 3CRLC 4JI1L 3RNUA 1K0RA 2CW0C 4UDUC 4YWLA 4IPDA 5NUCA 2AQ2B 3PV0A 2TSSA 5IIFA 1BKBA 3PIPA 2CFMA 4NXNQ 4DAPA 3M4YA 1DONA 3G6EA 1HPCA 3ND8A 5M5XB 4CBVA 1JCKB 3FHWA 1YJNA 2RCFA 4ODGA 3CPWA 1GD7A 2Z0SA 3PQIA 2B63B 2UXDL 1GHKA 1PLFA 5CV9A 5EBDA 1XMQL 4U673 3VR5A 4NPSA 3KK7A 5IT9L 4DV3L 4RGNA 5JJKA 5EGTA 3QWNA 5C5MA 2R6GA 1A63A 5ISRA 2O4XA 1SMYC 3H15A 3KDFB 4CJ1B 3GTMB 4EGVA 1JOQA 1SYDA 1STGA 1Y1VG 4DU9A 1IW7C 2WKCA 4ZKBB 5CC4A 4DAYA 3BZCA 3PMFA 2ICIA 2FFKB 2M9VA 1O80A 4B3TL 4P75A 2FXQA 4IN3A 3A5UA 3HKZE 2YTVA 2WFWA 1N36L 4DNTB 3SVMA 3CCLA 1RF2D 2KCNA 4A3DH 3S1QH 2EYLA 1F2LA 1NCVA 2UUAQ 3IL8A 3HKZG 2WAQE 5KNCA 3MZ5A 1SNMA 1SFOB 1TT2A 4DV0L 2VUMB 3Q0AA 5LHY1 3HOXG 1BR9A 4U68A 2RHSB 5K5PA 4GOPB 2R92G 3I55A 3TQYA 4A3MG 4IO9A 4ZLTF 2XVSA 1CUKA 2ZTCA 4YIJA 1HA5A 1JOOA 1S3OA 1IBLL 3I4NG 3RZOH 1FNVA 1ML0D 5COYA 1EQQA 4IURA 4KD3A 1KL9A 1BCPF 3NQIA 3DWAA 3TMEA 1ENCA 3U4VA 3E5SA 1MI2A 3KLRA 1VQOA 2F1MA 2K03A 2EYOA 1XWEA 1K83B 1IKLA 3L2PA 3M9BA 3WOEA 4LWCA 2ZJRA 1MJCA 2KJXA 2NN6G 2K05A 1QOHA 2HQLA 1CK1A 3C1EA 1M8AA 2DNEA 2CH4W 3BYTB 2R93G 4BY7B 5BN4A 5G3LD 5C3EG 4AIMA 4YHHQ 2JK8A 5IGCA 1O78A 2J4XA 3NWSA 1TS5A 4MN3A 2MJ8A 3HOZH 3I72A 2F0WA 2N55A 2FINB 5EJWA 1EYGA 2X6GA 2D0OA 1X3FA 1S4ZA 5DEHA 2RBMA 4QY7A 2UUCL 2JA8B 3HOYH 3S17H 2KOLA 4JI5L 4HR7B 4R1JA 3GTLB 1SMXA 4GN4B 4X3UA 3EIVA 3HS0C 1YNNC 3CU7A 1B1ZA 3P1HA 3CPFA 1R4PB 2EOTA 1W6KA 2VXWA 5C4JB 2K5HA 2DNCA 3H91A 1KAWA 2UU9Q 4B3SQ 1GUSA 5ELCA 1LUZA 4ALPA 3H94A 3AEVA 3GD7A 3OPOA 1XTDA 2C9OA 3A56A 4JI0L 1HR0L 2UUAL 4KV6A 2JA7H 1VQIA 2R61A 3HOWB 1FGBD 1NR2A 1SYGA 4F8MA 4N8X1 4CJ2C 3RD4A 4IUQA 2MP1A 4BY1B 3GTJB 4IOCA 1YNJD 5CV6A 1TWAH 4R4OA 4RH6A 5IYBG 4O42A 3H0GB 1Y8OB 1ZKOA 3KF6A 1CA6A 5T1IA 1V1OA 1KXLA 1D5ZC 3L7ZC 4I7AA 4L8JA 4NMZA 1VF7A 4OGQC 4DR6Q 2VUMG 4O0AA 1N32Q 2NVXB 1DXMA 3UDXA 3C2PA 3CP0A 4OIJA 4GLVB 4JOIA 1KNAA 4DA2A 3GQBA 3F8TA 4UHVA 2PYKA 1ESFA 4IUVA 4LUZA 4ZRZA 1VQ5A 2E74C 3BDCA 2Z6KA 2HUGA 1LT5D 1HZBA 4DUYL 1NE3A 1XJVA 4JOIC 1NAPA 2JEBI 5IGBA 3MVVA 1QZHA 3GTOH 2HIXA 1JICA 4K5XA 2Z6KC 5ELFA 3J80c 1D7QA 2MPMA 1VQNA 1JC7A 3D0FA 3NBIA 5EPJA 1PH4A 2YU9H 1PH2A 1TS3A 3PIP3 4IFDG 4K5WA 4BY7G 3D4RA 3FVQA 4Y7NB 3D4WA 1DD2A 1ONLA 3NELA 5T1GA 1EIFA 3Q24A 3S1MB 4A3EG 2QDLA 1K8AC 1KD1C 5C6AA 2PNHA 2B29A 3ULLA 3GTQB 2ZXOA 5IT9E 5FLMG 1WTOA 1LO5D 4DR4L 3TN2A 3DM1A 4JV5L 4RGTA 1WCMB 2F0DA 1QILA 3P75A 5FO7B 4RA8A 3HP3A 4ME3A 3M3YH 5IGEA 5IYCH 1QVGA 4K5VA 1UWVA 1GOZA 1A3VA 4WJWA 3HOXH 1STBA 1A2UA 2C5CA 2VS1A 3SHLA 4DR7L 3NE5B 3QB3A 2NN6I 3K6OA 3VYTA 4DK3C 1SNOA 2F4IA 4G7ZC 5BR8L 3S1QB 3H09A 1Y8PB 2N49A 2I5HA 5C4XG 1HQRD 1B3AA 1Q86C 3ER0A 1VQLA 1N32L 2EXZA 4A3GH 1TY2A 3H6MA 4GN5A 5JJZA 2EYJA 4RKLA 4BY1G 1VQ6A 2QDBA 4XDXA 1ILQA 5KIXA 4HIDA 1NY4A 2B2UA 2H4OA 1FD7D 3QJYA 3A0JA 3CC2A 2WIIB 1BNZA 4GNXB 2F0TA 2RSNA 2CKZB 2NBFA 1H9KA 4DK1A 4BXXH 3PUYA 5LMNW 3K57A 1A15A 5D65A 3J7YW 4OXPA 2B2UC 3PSIA 4CKEA 4IALA 5KGUA 1WJJA 5IGGA 3PO3B 3FDTA 4B08A 4XQQA 2DGYA 3NBHB 1LTAD 2CQAA 3JAMi 4PNYA 1LT6D 1J8IA 5EBCA 4IQZA 2A1AA 3A7AB 2EZVA 2MUYA 5C3WA 1E1OA 1IZ6A 3IFTA 1IYVA 5DAUA 1PFMA 2QKIC 1EY6A 5M5XH 3TP5A 2Q2TA 1PTOF 3D31A 5IGFA 2B63H 2F0VA 4A3CG 3SEBA 2OCEA 5J22A 1QUQA 3OYYA 1XMOL 3PF5A 2WB1B 3E3XA 2QEXA 2SNSA 4J15A 4A76A 4APVA 1U4PA 1CHPD 4UP9A 1WTPA 1SR3A 2F0LA 3TSSA 4K8IA 3T13A 3A54A 3GTMH 5C4HA 1AEXA 2RQXA 4PQXA 1K8GA 5M3FB 3FPPA 3ONAB 2UXBQ 3FKIB 1GUGA 3UE0A 4EQ5A 2K33A 2WV6D 1F2ZA 1LTID 1OXXK 4AQYQ 2A6HD 5IT9c 3K59A 2EJMA 4X62Q 2G5DA 3MHBA 4KMUC 4DNIA 4JYAL 5FO8B 4C3JB 3HZXA 1D1IA 2QW7A 2VB3X 2PZTA 3RR5A 1PHJA 3H3VC 4BS9A 3I4MB 2EYMA 1PH9A 1B70B 1SFOH 3CC7A 2KQ3A 2VUMH 2MNAA 1RDPD 5FOBB 4K0KQ 4CKCA 2C35B 2F0EA 2EY1A 5C3XA 1J6QA 3B6YA 1EZ6A 3HRZC 4K8JA 1SE3A 4A3KH 1E22A 4J1MA 4OX9L 2KEEA 1SRUA 4YCUA 3K5LA 1JR0D 1IHZA 1WD0A 5EPLA 4GKKL 1A3UA 2IPKD 4TQUS 1JJGA 2IHFA 1DCZA 4MHEA 2NZ1D 2NZHA 5E4XA 1EYAA 4CGYB 1K83H 5C0XJ 4A4IA 4B3RL 1E1TA 3U58A 1N33L 3J81c 3M4QA 3S16B 5ELEA 1CQVA 3K5MA 1E2ZA 3K7UC 3I56A 1KIXA 3MC0B 2PI2A 4CJ0B 4F7XA 4DR3L 1BOSA 4IFDH 5TSSA 1JB3A 2Y0SE 4R4QA 2Q2UA 3TP7A 5IYDG 1GKHA 1C4QA 2AWNA 2PMZE 3PO3G 2JQOA 4KN4C 3S15B 1CTMA 3E0JA 4JI1Q 2Y0SG 4IPHA 1B53A 2PI2E 1TY0A 1PA6A 1IBKL 1UE7A 4L5SA 1MJEA 5KNDA 1LLRD 3JAML 2V1CC 2I5MX 5GAEC 2JA8H 1L0WA 1B7YB 1SE2A 2GVBA 3GDEA 1LM0A 2WB1E 3GTLH 2E2JB 5M3MH 2IJ0A 2XWJB 1JE4A 1JOKA 2AQ3B 3WOFA 5I6YA 4JG2A 4QMGA 5C4JH 3LWUA 2UXDQ 1X54A 4AQYL 2WB1G 1XMQQ 3HOZG 4DV3Q 1A3TA 1X6OA 3IRBA 2J7ZA 3ULPA 4G7HC 4BBRB 3BG3A 4DV4L 5EQ0A 3TP8A 2KENA 4ULLA 3HOWH 1RTOA 1O7LA 1J9OA 3SGIA 1EIHA 1LABA 1BCPD 4LK1C 1G2TA 3GTJH 2K32A 3VDYA 1T5XD 3H0GH 1C9OA 3OMGA 3W2DA 1YEZA 2EPBA 5CBEE 1RHPA 3A8KE 3EVQA 1SNDA 2K5WA 1U5KA 3D6CA 2NVXH 2JA7G 3VYUA 4N8FA 3CQZB 5CV5A 2H1EA 2FMMA 4DV0Q 1QG7A 2AUKA 4DV7L 4A3GB 1AH9A 1AP0A 2A6HC 3C46A 2AMCB 2WP8J 1EWCA 1Q3LA 4QGUA 2CHBD 5EKIA 1IBLQ 3BZDB 2CVRA 2K4KA 4KI0A 1N9WA 2PW7A 5I2YA 2L0CA 2D0PA 3CCMA 1E3PA 4RGMA 3WWVA 5FKAC 4KY6A 2GN5A 2JA9A 1VQ4A 4JK1C 1SJED 1W2BA 1WTQA 4IOAA 2EYPA 1TIID 4C2MB 1I3QB 2AQ1B 3QR8A 4FXDA 5DM63 2KHJA 3U4ZA 1SDFA 3RMHA 4KKUA 4HJ8A 2OQKA 1KC8C 3NP8A 3GTPH 1IL8A 4JBWA 4DV1L 1M4VA 2BOSA 4O2DA 4JC0A 1ZYRC 3S24A 4Y7NH 4C3HH 1Q8KA 1BUVT 4Y52H 3EROA 4JCVE 3S1MH 2D2CC 2GA4B 2PZWA 2FJ2A 4MTNA 1HQMC 3N52A 2E75C 3GTQH 2F0GA 3NUCA 1MIUA 2IT1A 1DOMA 2G9HD 3BU2A 3AU7A 1VS0A 1VQ8A 1E2VA 4XTCS 1WCMH 2UUCQ 2B2YC 2HCCA 1MD2D 3E6ZX 3OMCA 1O7YA 1STHA 3SK5A 4JI5Q 2QF7A 3ITPA 4ZK9B 1X65A 4HMIA 1I4GA 4DR2Q 2RF4A 1T5EA 3D4DA 3FP9A 1EY9A 5F2DA 1G6PA 1I94Q 3G4SA 2K14A 1Y8NB 4KJNA 1Z6HA 2LXKA 3H3VH 4WRDA 2JA5B 1NR4A 1FJGQ 1H9SA 2RSOA 3IKJA 5CORA 2B2WA 2NVYB 1JE5A 3L9AX 4PV1C 4JI0Q 2OEOA 3T56B 4TVAB 1HR0Q 1FGUA 1HFGA 2BA0A 2WACA 4IUUA 2EYHA 1GJXA 2JEAI 5IYCG 3E9HA 1NJIC 2Z1CA 4FF4A 3S1NB 2F4VL 2MGSA 4A75A 2B2WC 1CZWA 3D8GA 5FLXE 2WAQG 3A8JE 3NQTA 3C1FA 1G8ZD 2ZTEA 4A3KB 1HNWQ 3S1RB 3PO2B 4LUVA 2KCMA 1DOKA 3HG9A 1PH3A 1Q81C 5LL6X 4HAEA 1TWHB 1QNUA 2Z4HA 1VQ9A 4HCSA 4A3GG 5IYDH 1C48A 4FF2A 1BXTA 3PO3H 4LFAL 2ZJQA 1HCZA 1YHAA 3AFQA 1PRTF 2IX0A 1I50B 3IFDA 5I9OA 4OWTB 3SK4A 1WFQA 4DUYQ 4PMCA 1H9RA 1VMPA 2YV5A 1A0IA 1IYUA 4BXXG 1TWCB 1FYCA 2DY7A 3L3OC 1D5XC 1G2SA 4GLAC 1EQTA 2VY3A 3LGJA 2A73B 3K0XA 3Q6SA 1WD1A 3JAME 1D2BA 3OTOQ 2L5TA 2K75A 3KDFA 3QIAA 4R8IA 3NEMA 1WTRA 5ELOA 4RGOS 2F0JA 1ICWA 5EKLA 2FHTA 4A3JB 5M3FH 3AMUA 2A6ED 1U0LA 3PIOA 1XNQQ 4Z9CB 3MXNB 4XYQA 3A55A 2H5XA 3T53B 4XIGS 1UEAB 5M3MB 5IOCA 3FKIH 1CKNB 4DR1L 1G291 1QNKA 4HJ5A 4DR2L 2B63G 4ZYSA 4YWMA 3OWEB 1X55A 4HEDA 3Q22A 1I94L 1VF5C 4HIOA 3CMAA 4OONA 4KK7A 4DR4Q 3VR6A 4C3JH 1R9TH 4JV5Q 1B4OA 1FJGL 5IP9H 2XWBB 2KHIA 1WTHA 3CCSA 3I4MH 4JW0A 3BJUA 4JI7L 1RTNA 4I7ZC 1NNXA 2SNMA 4GOPA 2BE5D 2R7DA 4OELB 4IUTA 4PMWA 1K28A 1EYCA 2JA5G 3PUZA 2EYFA 1VCIA 3W1BA 3BYYB 1Z9FA 1HZAA 4DR7Q 1P16A 4GOPC 1B9MA 4C3IB 1HNWL 5BR8Q 2O5JC 2EE1A 4KHZA 3RN2A 2F0NA 5HGTA 1LTGD 1RIPA 4MZ9A 4Q0FA 4ZQ3A 5EAYA 1LT3D 2RVLA 2I5LX 4OWXB 1ZEQX 1TWGB 2EQSA 1SXTA 2HDLA 2WINB 5GADC 3MWYW 1B44D 3CCVA 3UDFA 4LMQD 4H0LC 4C1NI 2L4NA 3S16H 4A3KG 1PTOD 4L6TB 2ALYB 3ERSX 3V2TA 1PV4A 1V1QA 2MHVA 3CMEA 4JI4L 3HGBA 4K2LA 4KY5A 1G91A 1PH5A 1SN8A 1LYLA 1SJHD 1Z47A 4K2KA 1VQCA 5M5YH 1EIYB 3MXUA 1H9MA 3OHXC 1STEA 1LACA 2F3WA 4KKSA 3CCQA 3S15H 2NWGA 1BDOA 1X3QA 4HN7A 1NMFA 1IKMA 3OTOL 4KLKA 2HD3A 4A3BB 3GTPB 3RLFA 3NHHA 4FNFA 5C0XH 3U9OA 1XPOA 2E2JH 4DV2L 1VQ7A 3K81C 3HOVB 4C3HB 4MTKA 1CSPA 1XNQL 1F9QA 2RDHA 3VR4A 1QVFA 3TREA 3JAMc 4RCNA 1EY5A 3BVZA 3OW7A 1XMOQ 1SBBB 1X3GA 4HCEA 3M7NA 4FF3A 2JA8G 1A6XA 3EQLC 1S5BD 4A3JG 1UUPA 2L1BA 2N78A 4ZKCB 1FNUA 5M3MG 2LMCB 4BBRH 2A68D 4L63B 1PFNA 1OXSC 5CV4A 1S5FD 2JP1A 2KHSA 2XIWA 2ZTDA 2D9UA 1X9NA 5JEAJ 2JA6B 4KKTA 1YHBA 2I0QA 4CDFC 2E2IB 4CKBA 4N9PA 1SNCA 4JYAQ 2YTYA 3G6JB 3NXWA 5IGDA 2R7FA 3KBXA 4UP7A 3VA5A 2OF1A 1I4HA 1SYBA 3CQZH 1WTWA 3HOWG 2G9DA 2A6EC 1GHJA 4R9WA 1P8LA 3R3OA 1AFPA 1CM9A 2L55A 4X3TA 1PXUA 3R2TA 2EY2A 4A3FB 1L1OB 3FEWX 4MNOA 3H0GG 4OX9Q 3FPUB 4GKKQ 3NENA 2ZT9C 3RN5A 4FO2A 3PUWA 4ZUJA 3T1HQ 5D3IB 3K5NA 2OTLA 4DXGA 3GTGB 1XYIA 2B3GA 1EU3A 4LJZC 2JN4A 4B3RQ 4C2MH 1I3QH 2PQAB 1N33Q 3F1ZA 3EBEA 1G6ZA 1RODA 4LF9L 1I4XA 1ICFB 3IAYA 1YNJC 2QA4A 1KDAA 4DR3Q 1KTKA 5E3FA 3STBD 1SYFA 1Q46A 4BA2I 1TWFB 4GS3A 3W5OA 1D8LA 4EQNA 2XRQD 2HCIA 3OSOA 4QJFA 1SLJA 4QUFA 3MEFA 3CXCA 1TS2A 2BA1A 3EJIA 1IBKQ 5L37A 2AKWB 1DGSA 2IX1A 1HR0W 3KLSX 1LV9A 3N6RA 2AWOA 3E9IA 3PIO3 2BDOA 2RHQB 4C3HG 3TRZA 4KTAA 1GUOA 2PW5A 2JJQA 1HTPA 2HHHQ 4XQNA 1OXTA 1BVSA 2KUMA 2JA5H 5LL6S 1VQHA 5JPMC 4CDDC 1B50A 1WCMG 4QB4A 2NVYH 1R9TB 1WVLA 3G7LA 1Q1BA 4G4KA 1X3PA 3SXHA 3S14B 1YVCA 4OL7A 4DV4Q 5ELNA 2LY7A 2PO4A 1KRTA 4GN3B 3VR3A 1LTLA 5JJLA 1QJOA 2OQ0A 1TS4A 1EEID 3S1NH 3CC4A 3BS1A 4GNXA 1JJCB 1PFSA 2EXDA 3W1GA 1RKNA 3S1RH 3PO2H 1BBUA 1EFID 5FLXL 4JVZA 1ZXTA 5JVH3 4IFDI 3I73A 4QIWB 3K80C 5JOBA 1WOCA 4DPGA 1TWHH 3M4PA 1HFNA 3T1HL 4DV7Q 4GNXC 2ID0A 1YZ6A 2M00A 4R4CA 3NBHA 1F77A 1YI2A 4B9WA 4LFCQ 1C7YA 3L0OA 2L12A 5K36G 1I50H 2CW0D 2DN8A 2LS01 1J5EQ 2MQHA 2NYZD 4LW1A 4A93B 3S9WA 1QWYA 3CCRA 2MO1A 1CFMA 1JORA 1TWCH 5IP7H 5CMDA 3KBGA 4UAIA 5M5YB 3A8IE 2XGTA 3KFUA 1LT4D 4GZYC 1HZ9A 3V96A 1AZQA 2E2HB 3T1YQ 5E7NA 2IL8A 2NZOA 2AHOB 5C44B 4FXGC 1YIJA 2ATWA 5IWAL 1EL0A 1S40A 1OXVA 2OTJA 1Q90A 3RLOA 2PZUA 1M1KC 1M90C 3SK8A 3J7AF 3J80L 4DV1Q 2XN9C 2SOBA 1SMYD 3F2UA 4A3JH 1V1PB 1EOTA 1BF4A 2F0SA 1IW7D 2VQEL 3O13A 2UUBL 1JT8A 3KF8B 5JAVA 1HRJA 4K6DA 1NSNS 1O7IA 1UE5A 2F0HA 4ME5A 2F0UA 3NPPA 4IPGA 2HHHL 3SK6A 2NTTA 4NW2A 3LWEA 3J7A5 1FVIA 4J6HA 4BWGB 2IWHA 2F0MA 3KJPA 4HMJA 3NSWA 3EN2A 4R8NA 1UAPA 3STBC 5M3FG 4QQBX 3I4OA 1K8OA 1HJPA 2ZM6Q 3FKIG 3BDOA 1FL0A 3FMCA 4IUPA 1Y1VB 2QILA 2E2DC 3M4OB 2EVBA 3GTKB 4DFAA 4EX5A 1TXYA 2VW9A 1GXDC 2A69D 4C3JG 1L2FA 1HUMA 1AZPA 2K50A 5IP9G 4KHPQ 2XTIA 5A35A 3I4MG 4C3IH 5FO9B 1LTTD 2F52A 4RFBA 4LNQA 1PRTD 1SSOA 5E1FA 2ICEC 5AJ3L 1TWGH 1XX8A 3HKZB 4N9TA 3KJOA 1PYSB 1PYWD 2VNUD 3X3MA 2F4VQ 1PZKD 4LFCL 4NXMQ 2EY5A 1EU4A 4F87A 4V0BA 2R92B
chains in the Genus database with same CATH topology
3NELA 4DUYQ 1NTGA 1EIFA 2YV5A 1XNRL 1A0IA 1J5EL 4BXXG 3UDIA 4DUZL 4A3EG 1Q12A 2D62A 1K8AC 4JI6Q 2ES2A 1KD1C 2PNHA 1IBMQ 2B29A 4GLAC 3ULLA 1L1OC 5IYBH 5FLMG 2VY3A 3F2DA 4A3IH 3LGJA 4DR4L 3K0XA 3CD6A 5LMUL 4JV5L 5AJ3Q 2PQAA 2VQFQ 3OTOQ 2K75A 3T1YL 4LFAQ 3KDFA 2MO0A 3RLNA 1Q82C 1XPRA 1ASZA 4JBKA 4FDBA 4A93G 2HT1A 3NEMA 1H95A 3K7AH 3F2BA 5ELOA 2Q2HA 4A3FG 4ME3A 3M3YH 4A3BH 4HJ7A 1IXRA 1NMGA 1VQPA 4RMFA 4JI2Q 5M3FH 1U0LA 5IYCH 3PIOA 1XNQQ 1QVGA 3MXNB 4X65Q 1UWVA 1VQFA 2H5XA 4XIGS 1XNRQ 4A3DG 3FKIH 3HOXH 1CKNB 5JEAG 4DR1L 3HOVH 1OTCA 3ULJA 1G291 4DV5Q 4HJ5A 4DR2L 3JC66 2B63G 4YWMA 4UY8C 4DR5L 1X55A 2VS1A 1HNZL 4DR7L 1I94L 4HIOA 1YJWA 2NN6I 4P73A 3CMAA 4LF8L 4DK3C 4OONA 4UP8A 2NVQH 4DR4Q 4C3JH 5BR8L 5LMUQ 1R9TH 1Q7YC 2NVTH 4JV5Q 4A3LG 1FJGL 3H3VI 5IP9H 2KHIA 3CCSA 1I5FA 3I4MH 2Q2IA 1N8RC 1A62A 2N49A 4DKAC 2I5HA 4YWKA 3BJUA 3PGZA 5C4XG 1NBWA 1Q86C 1N32L 3K8AA 3ER0A 1VQLA 4JI7L 2UXCQ 4AYBE 4LF7L 4A3GH 4GN5A 3PF4A 4GOPA 5C0XG 2MFIA 4L5TA 2R7DA 4BY1G 1VQ6A 4PMWA 4POGA 1YJ9A 1Y1WG 4HIDA 2RCNA 2JA5G 1NY4A 2ZM6L 2JA6H 4DR1Q 3PUZA 3A0JA 4WJ3M 4BY7H 4OWWB 4AYBG 3TEHB 3CC2A 1VCIA 3W1BA 2E2IH 4P71A 1Z9FA 1HZAA 4GNXB 1HNZQ 1P16A 4DR7Q 4GOPC 4LF8Q 2CKZB 5LMNQ 4GKJQ 2BH8A 4DV6L 4BXXH 1HNWL 3PUYA 5BR8Q 5LMNW 4A3EH 4KHZA 3RN2A 4LFBQ 1RIPA 2F3IA 4MZ9A 4YY3Q 4B3MQ 4OXPA 4GLXA 4KHPL 5EAYA 4YCVA 1JMCA 3PSIA 2I5LX 4IJLA 4OWXB 1XPUA 5FJ8H 4DAMA 5FLMH 1WJJA 2EQSA 1Y14B 4BBRG 4JI7Q 1V9PA 5HY6A 4LF7Q 4LF6L 5GADC 3CCVA 2R7ZG 1KHIA 2DGYA 3NBHB 3KYHC 3UDFA 3JAMi 1C0AA 1PH6A 4JI3L 3S16H 3TS2A 4A3KG 2A1AA 1EUJA 2ALYB 2QGQA 3ERSX 1PV4A 1V1QA 3CMEA 4A3FH 4L5RC 3ZJYC 4JI4L 1E1OA 2UXBL 1IZ6A 2CQOA 4NXML 3CCEA 1X3EA 1PH5A 1SN8A 1IL2A 1LYLA 1WI5A 1Z47A 5M5YH 1VQCA 1EIYB 5M5XH 4X62L 4NB3A 2Q2TA 4X6AH 3D31A 2B63H 4HJ9A 4A3CG 1PH1A 2OCEA 4JI6L 1VQBA 1PVOA 3CCUA 1K3RA 1QUQA 5IY0A 3OYYA 1QZGA 3CCQA 1XMOL 1IBML 3U50C 3HOYG 3S15H 3PF5A 3PUVA 2DUDA 3CCJA 2QEXA 2IY5B 4J15A 4P74A 3OW2A 3GTGH 4BBSH 2K5NA 4A76A 1NMFA 4A3LH 5J3BA 4APVA 4IFDJ 4UP9A 2N3SA 5DLQE 2VQFL 3OTOL 3S2DH 1SR3A 1HNXL 5C4XH 4KLKA 5HGQA 3GTMH 4K0KL 1K8GA 2ZJPA 4QIWE 3RLFA 4AH6A 3HOUG 2LSSA 4B3TQ 3S2HH 1XPOA 2E2JH 4JI4Q 2UXBQ 1BBWA 1CKMA 4DV2L 3UE0A 4EQ5A 3K81C 1N36Q 1VQ7A 4UPAA 1G51A 1EQRA 4BY1H 1OXXK 3UE1A 4AQYQ 1EFWA 1EWIA 5IT9c 1KQSA 1CSPA 4JI2L 4DAYB 1XNQL 2E8GA 4X65L 1TWFH 2CWAA 1Y1WH 4X62Q 1QVFA 1S72A 3TREA 3J81i 2GVAA 4DNIA 3JAMc 4JYAL 4DV5L 3E0EA 1AE3A 3KF6B 3I7FA 1XMOQ 3RR5A 1PHJA 1X3GA 1I6HH 1ASYA 3M7NA 4IJHA 4PZ7A 3A74A 4RG1A 2JA8G 2OWOA 1PH9A 1B70B 4A3JG 1E7ZA 1SFOH 3CC7A 2VL6A 1HNXQ 2N78A 2VUMH 2MNAA 5M3MG 4K0KQ 2HIVA 4BBRH 2E5LQ 2C35B 4HIMA 2UXCL 1KRSA 1OXSC 1V43A 3PCOB 2LXJA 4DV2Q 1IYJB 2ZTDA 1MKHA 3RZDH 1X9NA 2R7ZH 5JEAJ 1J6QA 3B6YA 2I0QA 1YHBA 1GM5A 1PYBA 2CWPA 4NXNL 5GAGC 4A3KH 1E22A 1YNXA 4OX9L 3Q8DA 1SRUA 4YCUA 2CCZA 1T9HA 2JE6I 4GKKL 4JYAQ 5GAHC 2YTYA 4TQUS 3UDGA 2R7FA 2IHFA 5M5WH 5C44G 1JJ2A 1JJGA 1EOVA 3F2CA 4UP7A 5LMNL 4GKJL 2NZHA 2K5VA 2VZAA 4A3CH 3CQZH 4JI1L 3RNUA 4LFBL 4YY3L 4B3ML 3HOWG 1K83H 5C0XJ 1K0RA 4A4IA 3S14H 4B3RL 1E1TA 1P8LA 3U58A 4YWLA 3A5ZB 1N33L 3J81c 3M4QA 4IPDA 3PV0A 4LF4Q 3K7UC 3I56A 1BKBA 1KIXA 1L1OB 3PIPA 2PI2A 2CFMA 4NXNQ 3HOUH 4MNOA 3H0GG 4DR3L 4OX9Q 1Q1EA 2Y0SE 4R4QA 3NENA 3G6EA 4GKKQ 2Q2UA 3RN5A 5IYDG 3FHWA 1YJNA 3CPWA 1GD7A 2Z0SA 1GKHA 2AWNA 2PMZE 3PUWA 4LF5Q 2UXDL 1XMQL 1UEBA 3PO3G 3T1HQ 2JQOA 4NPSA 2OTLA 4JI1Q 4DV3L 3TS0A 2Y0SG 1JB7A 4IPHA 2B3GA 5JJKA 2PI2E 3CAMA 4DK6C 5GQOA 1PA6A 1IBKL 2A8VA 2R6GA 1A63A 4B3RQ 4C2MH 1I3QH 1UE7A 2PQAB 1MJEA 1UE1A 4L5SA 1N33Q 3CF5A 2V1CC 3H15A 3F1ZA 3EBEA 2I5MX 3KDFB 4HJAA 5GAEC 2JA8H 1L0WA 4LF9L 4P72A 1B7YB 1Y1VG 2GVBA 3GDEA 1LM0A 2WB1E 5FLXc 1PH8A 3GTLH 5M3MH 2QA4A 3BZCA 4A93H 4DR3Q 4JI8Q 3STBD 3PO2G 4B3TL 1Q46A 4P75A 2FXQA 4A3IG 3A5UA 4BA2I 4X64Q 4POFA 3HKZE 2YTVA 4GS3A 2WFWA 4JG2A 5C0XI 3AFPA 5C4JH 1N36L 2UXDQ 1X54A 3W5OA 1D8LA 4AQYL 2WB1G 1XMQQ 3HOZG 4QJFA 3CCLA 4A3DH 1SLJA 1N34Q 3S1QH 1YBYA 3MEFA 2E2HH 4DV3Q 3CXCA 2BA1A 1IBKQ 2UUAQ 1X6OA 2AKWB 2WAQE 3HKZG 1DGSA 5C44H 1HR0W 2IX1A 4WJ4A 3IRBA 4PZ8A 3AQQA 4DV0L 2AWOA 3ULPA 3E9IA 4LF9Q 3HOXG 4DV4L 2RHQB 1A8VA 2KENA 3HOWH 1E24A 2RHSB 4GOPB 2R92G 3SGIA 3TQYA 3DM3A 4X66Q 3I55A 4IO9A 4A3MG 3TRZA 5JJIA 1CKNA 3AYHB 1CUKA 1VQGA 2ZTCA 2E5LL 5IP7G 2JJQA 1S3OA 1IBLL 3I4NG 3RZOH 3GTJH 1K9MC 2HHHQ 2N8NA 1OXTA 3VDYA 1BVSA 3H0GH 3J7ZC 1C9OA 1EQQA 2JA5H 1YEZA 1QVCA 1KL9A 1VQHA 4YHHL 3DLLA 3KOJA 1U5KA 1WCMG 3PUXA 3U4VA 2NVYH 2NVXH 2JA7G 1VQOA 3BZKA 4R4IA 2BH2A 4DV0Q 1Q1BA 4DV7L 1SE8A 3M9BA 3L2PA 1YVCA 4DV4Q 4LWCA 2ZJRA 1SROA 1MJCA 3HFZB 5ELNA 1AH9A 2NN6G 2AMCB 2WP8J 4GN3B 1KRTA 1LTLA 5JJLA 2YYZA 2OQ0A 2HQLA 4QGUA 3S1NH 1IBLQ 1GO3E 3CC4A 1Y1VH 4LF4L 4GNXA 1JJCB 1PFSA 2EXDA 2K4KA 3M4OH 2R93G 4KI0A 3W1GA 3GTKH 5C3EG 1N9WA 1VQJA 3S1RH 3PO2H 4AIMA 1BBUA 1HZCA 5FJ8G 4YHHQ 2D0PA 1X56A 2JK8A 3CCMA 1E3PA 3WWVA 4IFDI 2GN5A 2JA9A 3G71A 2UU9L 4B3SL 3K80C 1VQ4A 1WOCA 4DPGA 1TWHH 3M4PA 1W2BA 4LF5L 3HOZH 4IOAA 5GROA 3T1HL 1B8AA 4DV7Q 1QUQB 2ID0A 4GNXC 1YZ6A 1EYGA 4R4CA 3ICEA 2D0OA 1X3FA 1K73C 2KHJA 4PG3A 3U4ZA 4QY7A 1YI2A 2UUCL 4LFCQ 3HOYH 1C7YA 4IPCA 3L0OA 3GTPH 1KC8C 4HJ8A 2OQKA 3S17H 4JI5L 4JBWA 4R1JA 5K36G 1SMXA 4DV1L 4GN4B 1I50H 4O2DA 1J5EQ 3EIVA 4JC0A 2MQHA 2YTXA 4LW1A 3S24A 2ASBA 4Y7NH 4DUZQ 4C3HH 1Q8KA 3CCRA 1VQEA 2R92H 2MO1A 4A3MH 3CPFA 4Y52H 2K5HA 4JCVE 2A19A 1TWCH 4JI8L 5IP7H 3S1MH 3HKSA 4MTNA 3I4NH 2XGTA 3KFUA 2KCTA 4PZ6A 4X64L 1KAWA 2UU9Q 1HZ9A 4B3SQ 3CW2C 4BBSG 3GTQH 1VQMA 1MIUA 1LUZA 2IT1A 4QL5A 4ALPA 3T1YQ 5E7NA 4DR6L 4JBMA 4H02A 3BU2A 2NZOA 3AEVA 2AHOB 3GD7A 1N34L 1YIJA 1VQ8A 1VS0A 5H1SE 5IWAL 1XTDA 2ATWA 4XTCS 1S40A 1WCMH 4BA1I 4JI0L 1OXVA 2OTJA 3RLOA 1HR0L 2UUCQ 1M1KC 1M90C 2UUAL 2JA7H 4OO1I 1VQIA 4JI5Q 1YHQA 4DV1Q 3KLWA 1X65A 1VQKA 2EIFA 4A3JH 3J80i 4DR2Q 2RF4A 3FP9A 4DR5Q 1VQAA 3GO5A 4HIKA 4X66L 1G6PA 2VQEL 4IOCA 1I94Q 2UUBL 3G4SA 2K14A 1TWAH 2KBNA 4R4OA 3KF8B 3G48A 5IYBG 1JT8A 2LXKA 1O7IA 1UE5A 3H3VH 3KF6A 1GVPA 1FJGQ 4IPGA 2HHHL 2R93H 1KXLA 3L7ZC 5C3EH 4DR6Q 2VUMG 4O0AA 3J7A5 1FVIA 1HH2P 2IHEA 1N32Q 5IWAQ 1RL2A 1JE5A 1VQDA 3UDXA 4JI0Q 4OO1G 3KJPA 4TVAB 3CP0A 3I2ZA 1HR0Q 4GLVB 4JOIA 4L5QA 1FGUA 3EN2A 2BA0A 1OXUA 4A3BG 3F8TA 4R4TA 3STBC 5M3FG 4QQBX 4JBJA 2JEAI 4LUZA 5IYCG 1VQ5A 3E9HA 3I4OA 1HJPA 2ZM6Q 1NJIC 3M85A 3FKIG 1W3SA 1YITA 1FL0A 2Z6KA 3HOVG 2L15A 2F4VL 4LUOA 4A75A 1CKOA 1HZBA 2WAQG 2VQEQ 2UUBQ 4DUYL 1NE3A 1XJVA 4JOIC 1CSQA 2ZTEA 4DV6Q 1HNWQ 4EX5A 1TXYA 2VW9A 1L2FA 2JEBI 4LUVA 5IE8A 2K50A 5IP9G 1QZHA 2XTIA 3GTOH 2HIXA 2KCMA 4KHPQ 1PH3A 3I4MG 1UE6A 1Q81C 4C3IH 2Z6KC 4LNQA 2F52A 3J80c 1D7QA 1VQ9A 1VQNA 4YCWA 4LF6Q 4A3GG 3D0FA 5IYDH 5AJ3L 1AE2A 1TWGH 3J81j 1PH4A 3PO3H 4LFAL 2YU9H 2ZJQA 3KJOA 4JI3Q 1PH2A 1PYSB 1YHAA 3AFQA 2JA6G 1PH7A 2VNUD 4IFDG 2K52A 2F4VQ 1L1OA 2IX0A 4BY7G 4LFCL 4NXMQ 1WYDA 4OWTB 1WFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEL A;  4DUY Q;  1NTG A;  1EIF A;  2YV5 A;  1XNR L;  1A0I A;  1J5E L;  4BXX G;  3UDI A;  4DUZ L;  4A3E G;  1Q12 A;  2D62 A;  1K8A C;  4JI6 Q;  2ES2 A;  1KD1 C;  2PNH A;  1IBM Q;  2B29 A;  4GLA C;  3ULL A;  1L1O C;  5IYB H;  5FLM G;  2VY3 A;  3F2D A;  4A3I H;  3LGJ A;  4DR4 L;  3K0X A;  3CD6 A;  5LMU L;  4JV5 L;  5AJ3 Q;  2PQA A;  2VQF Q;  3OTO Q;  2K75 A;  3T1Y L;  4LFA Q;  3KDF A;  2MO0 A;  3RLN A;  1Q82 C;  1XPR A;  1ASZ A;  4JBK A;  4FDB A;  4A93 G;  2HT1 A;  3NEM A;  1H95 A;  3K7A H;  3F2B A;  5ELO A;  2Q2H A;  4A3F G;  4ME3 A;  3M3Y H;  4A3B H;  4HJ7 A;  1IXR A;  1NMG A;  1VQP A;  4RMF A;  4JI2 Q;  5M3F H;  1U0L A;  5IYC H;  3PIO A;  1XNQ Q;  1QVG A;  3MXN B;  4X65 Q;  1UWV A;  1VQF A;  2H5X A;  4XIG S;  1XNR Q;  4A3D G;  3FKI H;  3HOX H;  1CKN B;  5JEA G;  4DR1 L;  3HOV H;  1OTC A;  3ULJ A;  1G29 1;  4DV5 Q;  4HJ5 A;  4DR2 L;  3JC6 6;  2B63 G;  4YWM A;  4UY8 C;  4DR5 L;  1X55 A;  2VS1 A;  1HNZ L;  4DR7 L;  1I94 L;  4HIO A;  1YJW A;  2NN6 I;  4P73 A;  3CMA A;  4LF8 L;  4DK3 C;  4OON A;  4UP8 A;  2NVQ H;  4DR4 Q;  4C3J H;  5BR8 L;  5LMU Q;  1R9T H;  1Q7Y C;  2NVT H;  4JV5 Q;  4A3L G;  1FJG L;  3H3V I;  5IP9 H;  2KHI A;  3CCS A;  1I5F A;  3I4M H;  2Q2I A;  1N8R C;  1A62 A;  2N49 A;  4DKA C;  2I5H A;  4YWK A;  3BJU A;  3PGZ A;  5C4X G;  1NBW A;  1Q86 C;  1N32 L;  3K8A A;  3ER0 A;  1VQL A;  4JI7 L;  2UXC Q;  4AYB E;  4LF7 L;  4A3G H;  4GN5 A;  3PF4 A;  4GOP A;  5C0X G;  2MFI A;  4L5T A;  2R7D A;  4BY1 G;  1VQ6 A;  4PMW A;  4POG A;  1YJ9 A;  1Y1W G;  4HID A;  2RCN A;  2JA5 G;  1NY4 A;  2ZM6 L;  2JA6 H;  4DR1 Q;  3PUZ A;  3A0J A;  4WJ3 M;  4BY7 H;  4OWW B;  4AYB G;  3TEH B;  3CC2 A;  1VCI A;  3W1B A;  2E2I H;  4P71 A;  1Z9F A;  1HZA A;  4GNX B;  1HNZ Q;  1P16 A;  4DR7 Q;  4GOP C;  4LF8 Q;  2CKZ B;  5LMN Q;  4GKJ Q;  2BH8 A;  4DV6 L;  4BXX H;  1HNW L;  3PUY A;  5BR8 Q;  5LMN W;  4A3E H;  4KHZ A;  3RN2 A;  4LFB Q;  1RIP A;  2F3I A;  4MZ9 A;  4YY3 Q;  4B3M Q;  4OXP A;  4GLX A;  4KHP L;  5EAY A;  4YCV A;  1JMC A;  3PSI A;  2I5L X;  4IJL A;  4OWX B;  1XPU A;  5FJ8 H;  4DAM A;  5FLM H;  1WJJ A;  2EQS A;  1Y14 B;  4BBR G;  4JI7 Q;  1V9P A;  5HY6 A;  4LF7 Q;  4LF6 L;  5GAD C;  3CCV A;  2R7Z G;  1KHI A;  2DGY A;  3NBH B;  3KYH C;  3UDF A;  3JAM i;  1C0A A;  1PH6 A;  4JI3 L;  3S16 H;  3TS2 A;  4A3K G;  2A1A A;  1EUJ A;  2ALY B;  2QGQ A;  3ERS X;  1PV4 A;  1V1Q A;  3CME A;  4A3F H;  4L5R C;  3ZJY C;  4JI4 L;  1E1O A;  2UXB L;  1IZ6 A;  2CQO A;  4NXM L;  3CCE A;  1X3E A;  1PH5 A;  1SN8 A;  1IL2 A;  1LYL A;  1WI5 A;  1Z47 A;  5M5Y H;  1VQC A;  1EIY B;  5M5X H;  4X62 L;  4NB3 A;  2Q2T A;  4X6A H;  3D31 A;  2B63 H;  4HJ9 A;  4A3C G;  1PH1 A;  2OCE A;  4JI6 L;  1VQB A;  1PVO A;  3CCU A;  1K3R A;  1QUQ A;  5IY0 A;  3OYY A;  1QZG A;  3CCQ A;  1XMO L;  1IBM L;  3U50 C;  3HOY G;  3S15 H;  3PF5 A;  3PUV A;  2DUD A;  3CCJ A;  2QEX A;  2IY5 B;  4J15 A;  4P74 A;  3OW2 A;  3GTG H;  4BBS H;  2K5N A;  4A76 A;  1NMF A;  4A3L H;  5J3B A;  4APV A;  4IFD J;  4UP9 A;  2N3S A;  5DLQ E;  2VQF L;  3OTO L;  3S2D H;  1SR3 A;  1HNX L;  5C4X H;  4KLK A;  5HGQ A;  3GTM H;  4K0K L;  1K8G A;  2ZJP A;  4QIW E;  3RLF A;  4AH6 A;  3HOU G;  2LSS A;  4B3T Q;  3S2H H;  1XPO A;  2E2J H;  4JI4 Q;  2UXB Q;  1BBW A;  1CKM A;  4DV2 L;  3UE0 A;  4EQ5 A;  3K81 C;  1N36 Q;  1VQ7 A;  4UPA A;  1G51 A;  1EQR A;  4BY1 H;  1OXX K;  3UE1 A;  4AQY Q;  1EFW A;  1EWI A;  5IT9 c;  1KQS A;  1CSP A;  4JI2 L;  4DAY B;  1XNQ L;  2E8G A;  4X65 L;  1TWF H;  2CWA A;  1Y1W H;  4X62 Q;  1QVF A;  1S72 A;  3TRE A;  3J81 i;  2GVA A;  4DNI A;  3JAM c;  4JYA L;  4DV5 L;  3E0E A;  1AE3 A;  3KF6 B;  3I7F A;  1XMO Q;  3RR5 A;  1PHJ A;  1X3G A;  1I6H H;  1ASY A;  3M7N A;  4IJH A;  4PZ7 A;  3A74 A;  4RG1 A;  2JA8 G;  2OWO A;  1PH9 A;  1B70 B;  4A3J G;  1E7Z A;  1SFO H;  3CC7 A;  2VL6 A;  1HNX Q;  2N78 A;  2VUM H;  2MNA A;  5M3M G;  4K0K Q;  2HIV A;  4BBR H;  2E5L Q;  2C35 B;  4HIM A;  2UXC L;  1KRS A;  1OXS C;  1V43 A;  3PCO B;  2LXJ A;  4DV2 Q;  1IYJ B;  2ZTD A;  1MKH A;  3RZD H;  1X9N A;  2R7Z H;  5JEA J;  1J6Q A;  3B6Y A;  2I0Q A;  1YHB A;  1GM5 A;  1PYB A;  2CWP A;  4NXN L;  5GAG C;  4A3K H;  1E22 A;  1YNX A;  4OX9 L;  3Q8D A;  1SRU A;  4YCU A;  2CCZ A;  1T9H A;  2JE6 I;  4GKK L;  4JYA Q;  5GAH C;  2YTY A;  4TQU S;  3UDG A;  2R7F A;  2IHF A;  5M5W H;  5C44 G;  1JJ2 A;  1JJG A;  1EOV A;  3F2C A;  4UP7 A;  5LMN L;  4GKJ L;  2NZH A;  2K5V A;  2VZA A;  4A3C H;  3CQZ H;  4JI1 L;  3RNU A;  4LFB L;  4YY3 L;  4B3M L;  3HOW G;  1K83 H;  5C0X J;  1K0R A;  4A4I A;  3S14 H;  4B3R L;  1E1T A;  1P8L A;  3U58 A;  4YWL A;  3A5Z B;  1N33 L;  3J81 c;  3M4Q A;  4IPD A;  3PV0 A;  4LF4 Q;  3K7U C;  3I56 A;  1BKB A;  1KIX A;  1L1O B;  3PIP A;  2PI2 A;  2CFM A;  4NXN Q;  3HOU H;  4MNO A;  3H0G G;  4DR3 L;  4OX9 Q;  1Q1E A;  2Y0S E;  4R4Q A;  3NEN A;  3G6E A;  4GKK Q;  2Q2U A;  3RN5 A;  5IYD G;  3FHW A;  1YJN A;  3CPW A;  1GD7 A;  2Z0S A;  1GKH A;  2AWN A;  2PMZ E;  3PUW A;  4LF5 Q;  2UXD L;  1XMQ L;  1UEB A;  3PO3 G;  3T1H Q;  2JQO A;  4NPS A;  2OTL A;  4JI1 Q;  4DV3 L;  3TS0 A;  2Y0S G;  1JB7 A;  4IPH A;  2B3G A;  5JJK A;  2PI2 E;  3CAM A;  4DK6 C;  5GQO A;  1PA6 A;  1IBK L;  2A8V A;  2R6G A;  1A63 A;  4B3R Q;  4C2M H;  1I3Q H;  1UE7 A;  2PQA B;  1MJE A;  1UE1 A;  4L5S A;  1N33 Q;  3CF5 A;  2V1C C;  3H15 A;  3F1Z A;  3EBE A;  2I5M X;  3KDF B;  4HJA A;  5GAE C;  2JA8 H;  1L0W A;  4LF9 L;  4P72 A;  1B7Y B;  1Y1V G;  2GVB A;  3GDE A;  1LM0 A;  2WB1 E;  5FLX c;  1PH8 A;  3GTL H;  5M3M H;  2QA4 A;  3BZC A;  4A93 H;  4DR3 Q;  4JI8 Q;  3STB D;  3PO2 G;  4B3T L;  1Q46 A;  4P75 A;  2FXQ A;  4A3I G;  3A5U A;  4BA2 I;  4X64 Q;  4POF A;  3HKZ E;  2YTV A;  4GS3 A;  2WFW A;  4JG2 A;  5C0X I;  3AFP A;  5C4J H;  1N36 L;  2UXD Q;  1X54 A;  3W5O A;  1D8L A;  4AQY L;  2WB1 G;  1XMQ Q;  3HOZ G;  4QJF A;  3CCL A;  4A3D H;  1SLJ A;  1N34 Q;  3S1Q H;  1YBY A;  3MEF A;  2E2H H;  4DV3 Q;  3CXC A;  2BA1 A;  1IBK Q;  2UUA Q;  1X6O A;  2AKW B;  2WAQ E;  3HKZ G;  1DGS A;  5C44 H;  1HR0 W;  2IX1 A;  4WJ4 A;  3IRB A;  4PZ8 A;  3AQQ A;  4DV0 L;  2AWO A;  3ULP A;  3E9I A;  4LF9 Q;  3HOX G;  4DV4 L;  2RHQ B;  1A8V A;  2KEN A;  3HOW H;  1E24 A;  2RHS B;  4GOP B;  2R92 G;  3SGI A;  3TQY A;  3DM3 A;  4X66 Q;  3I55 A;  4IO9 A;  4A3M G;  3TRZ A;  5JJI A;  1CKN A;  3AYH B;  1CUK A;  1VQG A;  2ZTC A;  2E5L L;  5IP7 G;  2JJQ A;  1S3O A;  1IBL L;  3I4N G;  3RZO H;  3GTJ H;  1K9M C;  2HHH Q;  2N8N A;  1OXT A;  3VDY A;  1BVS A;  3H0G H;  3J7Z C;  1C9O A;  1EQQ A;  2JA5 H;  1YEZ A;  1QVC A;  1KL9 A;  1VQH A;  4YHH L;  3DLL A;  3KOJ A;  1U5K A;  1WCM G;  3PUX A;  3U4V A;  2NVY H;  2NVX H;  2JA7 G;  1VQO A;  3BZK A;  4R4I A;  2BH2 A;  4DV0 Q;  1Q1B A;  4DV7 L;  1SE8 A;  3M9B A;  3L2P A;  1YVC A;  4DV4 Q;  4LWC A;  2ZJR A;  1SRO A;  1MJC A;  3HFZ B;  5ELN A;  1AH9 A;  2NN6 G;  2AMC B;  2WP8 J;  4GN3 B;  1KRT A;  1LTL A;  5JJL A;  2YYZ A;  2OQ0 A;  2HQL A;  4QGU A;  3S1N H;  1IBL Q;  1GO3 E;  3CC4 A;  1Y1V H;  4LF4 L;  4GNX A;  1JJC B;  1PFS A;  2EXD A;  2K4K A;  3M4O H;  2R93 G;  4KI0 A;  3W1G A;  3GTK H;  5C3E G;  1N9W A;  1VQJ A;  3S1R H;  3PO2 H;  4AIM A;  1BBU A;  1HZC A;  5FJ8 G;  4YHH Q;  2D0P A;  1X56 A;  2JK8 A;  3CCM A;  1E3P A;  3WWV A;  4IFD I;  2GN5 A;  2JA9 A;  3G71 A;  2UU9 L;  4B3S L;  3K80 C;  1VQ4 A;  1WOC A;  4DPG A;  1TWH H;  3M4P A;  1W2B A;  4LF5 L;  3HOZ H;  4IOA A;  5GRO A;  3T1H L;  1B8A A;  4DV7 Q;  1QUQ B;  2ID0 A;  4GNX C;  1YZ6 A;  1EYG A;  4R4C A;  3ICE A;  2D0O A;  1X3F A;  1K73 C;  2KHJ A;  4PG3 A;  3U4Z A;  4QY7 A;  1YI2 A;  2UUC L;  4LFC Q;  3HOY H;  1C7Y A;  4IPC A;  3L0O A;  3GTP H;  1KC8 C;  4HJ8 A;  2OQK A;  3S17 H;  4JI5 L;  4JBW A;  4R1J A;  5K36 G;  1SMX A;  4DV1 L;  4GN4 B;  1I50 H;  4O2D A;  1J5E Q;  3EIV A;  4JC0 A;  2MQH A;  2YTX A;  4LW1 A;  3S24 A;  2ASB A;  4Y7N H;  4DUZ Q;  4C3H H;  1Q8K A;  3CCR A;  1VQE A;  2R92 H;  2MO1 A;  4A3M H;  3CPF A;  4Y52 H;  2K5H A;  4JCV E;  2A19 A;  1TWC H;  4JI8 L;  5IP7 H;  3S1M H;  3HKS A;  4MTN A;  3I4N H;  2XGT A;  3KFU A;  2KCT A;  4PZ6 A;  4X64 L;  1KAW A;  2UU9 Q;  1HZ9 A;  4B3S Q;  3CW2 C;  4BBS G;  3GTQ H;  1VQM A;  1MIU A;  1LUZ A;  2IT1 A;  4QL5 A;  4ALP A;  3T1Y Q;  5E7N A;  4DR6 L;  4JBM A;  4H02 A;  3BU2 A;  2NZO A;  3AEV A;  2AHO B;  3GD7 A;  1N34 L;  1YIJ A;  1VQ8 A;  1VS0 A;  5H1S E;  5IWA L;  1XTD A;  2ATW A;  4XTC S;  1S40 A;  1WCM H;  4BA1 I;  4JI0 L;  1OXV A;  2OTJ A;  3RLO A;  1HR0 L;  2UUC Q;  1M1K C;  1M90 C;  2UUA L;  2JA7 H;  4OO1 I;  1VQI A;  4JI5 Q;  1YHQ A;  4DV1 Q;  3KLW A;  1X65 A;  1VQK A;  2EIF A;  4A3J H;  3J80 i;  4DR2 Q;  2RF4 A;  3FP9 A;  4DR5 Q;  1VQA A;  3GO5 A;  4HIK A;  4X66 L;  1G6P A;  2VQE L;  4IOC A;  1I94 Q;  2UUB L;  3G4S A;  2K14 A;  1TWA H;  2KBN A;  4R4O A;  3KF8 B;  3G48 A;  5IYB G;  1JT8 A;  2LXK A;  1O7I A;  1UE5 A;  3H3V H;  3KF6 A;  1GVP A;  1FJG Q;  4IPG A;  2HHH L;  2R93 H;  1KXL A;  3L7Z C;  5C3E H;  4DR6 Q;  2VUM G;  4O0A A;  3J7A 5;  1FVI A;  1HH2 P;  2IHE A;  1N32 Q;  5IWA Q;  1RL2 A;  1JE5 A;  1VQD A;  3UDX A;  4JI0 Q;  4OO1 G;  3KJP A;  4TVA B;  3CP0 A;  3I2Z A;  1HR0 Q;  4GLV B;  4JOI A;  4L5Q A;  1FGU A;  3EN2 A;  2BA0 A;  1OXU A;  4A3B G;  3F8T A;  4R4T A;  3STB C;  5M3F G;  4QQB X;  4JBJ A;  2JEA I;  4LUZ A;  5IYC G;  1VQ5 A;  3E9H A;  3I4O A;  1HJP A;  2ZM6 Q;  1NJI C;  3M85 A;  3FKI G;  1W3S A;  1YIT A;  1FL0 A;  2Z6K A;  3HOV G;  2L15 A;  2F4V L;  4LUO A;  4A75 A;  1CKO A;  1HZB A;  2WAQ G;  2VQE Q;  2UUB Q;  4DUY L;  1NE3 A;  1XJV A;  4JOI C;  1CSQ A;  2ZTE A;  4DV6 Q;  1HNW Q;  4EX5 A;  1TXY A;  2VW9 A;  1L2F A;  2JEB I;  4LUV A;  5IE8 A;  2K50 A;  5IP9 G;  1QZH A;  2XTI A;  3GTO H;  2HIX A;  2KCM A;  4KHP Q;  1PH3 A;  3I4M G;  1UE6 A;  1Q81 C;  4C3I H;  2Z6K C;  4LNQ A;  2F52 A;  3J80 c;  1D7Q A;  1VQ9 A;  1VQN A;  4YCW A;  4LF6 Q;  4A3G G;  3D0F A;  5IYD H;  5AJ3 L;  1AE2 A;  1TWG H;  3J81 j;  1PH4 A;  3PO3 H;  4LFA L;  2YU9 H;  2ZJQ A;  3KJO A;  4JI3 Q;  1PH2 A;  1PYS B;  1YHA A;  3AFQ A;  2JA6 G;  1PH7 A;  2VNU D;  4IFD G;  2K52 A;  2F4V Q;  1L1O A;  2IX0 A;  4BY7 G;  4LFC L;  4NXM Q;  1WYD A;  4OWT B;  1WFQ A; 
#chains in the Genus database with same CATH topology
 4O1N A;  1NTG A;  4A3M B;  3QO2 A;  1XNR L;  2B2T A;  1D5M C;  1J5E L;  3EFX D;  4K6L A;  5HUR A;  1Q12 A;  2Z8L A;  5KYI A;  2ES2 A;  1IBM Q;  1RCV D;  1ILP A;  3SR1 A;  1HHV A;  3F2D A;  3URY A;  5LMU L;  1BCP B;  1AW7 A;  2B2T C;  1Q82 C;  3T1Y L;  4LFA Q;  1XPR A;  4FDB A;  1SEB D;  2RDG A;  4A93 G;  2BCO A;  2HT1 A;  1H95 A;  1S5E D;  3K7A H;  3F2B A;  4OO1 H;  2Q2H A;  5DNF A;  2HDM A;  1AN8 A;  1JWU D;  4A3B H;  1IXR A;  1PRT B;  4RMF A;  3KF8 A;  3MFY A;  4KHV A;  3HOV H;  1OTC A;  1MSG A;  1YNN D;  4DV5 Q;  4FP5 D;  2RA4 A;  1HNZ L;  2B2Y A;  2R93 B;  4XXE A;  1F9R A;  4P73 A;  4LF8 L;  5C3E B;  1W6J A;  4UP8 A;  5BN5 A;  5I2X A;  1Q7Y C;  1L0Y B;  5I9P A;  3H3V I;  3DHQ A;  5IOD A;  1I5F A;  1N8R C;  1HTL D;  1A62 A;  3PGZ A;  3OOC A;  1NBW A;  2JYO A;  4FF1 A;  2UXC Q;  4LF7 L;  3PF4 A;  5C0X G;  4C1N K;  1EY4 A;  4L5T A;  3C3L A;  1R4Q B;  5CBA E;  2DJG C;  2VB2 X;  4POG A;  2JA6 H;  2RCN A;  2ZM6 L;  4DR1 Q;  1TKW B;  1MBY A;  1ENF A;  1TQO A;  4K14 A;  2XRS D;  3TEH B;  4ABN A;  4OWW B;  2K6A A;  3RUZ A;  2K01 A;  5CYU A;  2E2I H;  4P71 A;  4XT3 B;  1A2T A;  5LMN Q;  4XQJ A;  2BH8 A;  1I4R A;  4LFB Q;  4YY3 Q;  4B3M Q;  4KHP L;  1RJT A;  4YCV A;  1JMC A;  4IJL A;  1XPU A;  5EPK A;  5C5L A;  4RHR A;  4BBR G;  4JI7 Q;  1RD9 D;  1Y14 B;  5HY6 A;  4DAV A;  3R8B A;  2A5H A;  4KJO A;  2K5D A;  3KYH C;  1NUC A;  3TS2 A;  2PPB C;  2QGQ A;  4RCO A;  4CHT B;  4A3F H;  4L5R C;  3LX0 A;  2CQO A;  4NXM L;  4KD4 A;  1X3E A;  3I3C A;  5K36 H;  1STA A;  1GUT A;  4ZAI A;  5JEA H;  1F9P A;  4A3I B;  1PH1 A;  3I91 A;  1K3R A;  1QZG A;  1K0S A;  1IBM L;  5CV7 A;  3U50 C;  3U9S A;  5FK9 C;  2F0K A;  3T51 B;  3CCJ A;  2IY5 B;  3OW2 A;  3GTG H;  2K5N A;  4A3L H;  5J3B A;  3VA7 A;  4IFD J;  3GV6 A;  2LFN A;  3BVG A;  4MIU A;  1HNX L;  1BCP C;  4AH6 A;  2LSS A;  3S2H H;  2A69 C;  4JI4 Q;  3MXP A;  1BQQ T;  1BBW A;  1CKM A;  1LTB D;  4I65 A;  4UPA A;  1EQR A;  3J81 L;  1LTS D;  3UE1 A;  2OT2 A;  3LNN A;  1KQS A;  1PRT C;  2E8G A;  1TWF H;  4M1U B;  4ZCK A;  1Y1W H;  1SE4 A;  1EYD A;  3TZD A;  2NVQ B;  4DV5 L;  3E0E A;  3KF6 B;  3I7F A;  2F0O A;  2NVT B;  4OHJ A;  3T16 A;  4IJH A;  1Z7T A;  3J80 E;  4PZ7 A;  3A74 A;  2OWO A;  1QE6 A;  1EY8 A;  1SAP A;  3VR2 A;  1E7Z A;  2VL6 A;  2F0Q A;  3NTK A;  3I70 A;  2K04 A;  2HIV A;  2E5L Q;  2J0T D;  2UXC L;  1V43 A;  4DV2 Q;  1Q8I A;  2R7Z H;  1GM5 A;  1PYB A;  4NXN L;  5GAG C;  4P2C B;  2O5I C;  1YNX A;  2Z4I A;  5AFW A;  4H44 C;  3Q23 A;  5ELD A;  4HTH A;  1T9H A;  5GAH C;  1EEF D;  5D14 A;  3NK9 A;  4DGZ A;  4A3E B;  3UDG A;  3TP6 A;  1JJ2 A;  4TRD A;  2CH4 A;  5LMN L;  2RKS A;  2XNA C;  2ZXP A;  2VZA A;  4LFB L;  4DNR B;  4YY3 L;  4B3M L;  3DEO A;  3S14 H;  1U4L A;  3D3R A;  4M8A A;  2IX3 A;  1HA6 A;  3A5Z B;  3QOL A;  4LF4 Q;  2ENB A;  1SNQ A;  1TVX A;  5BN3 A;  2L9H A;  3HOU H;  1Q1E A;  5KYL A;  4B9X A;  3KLS A;  2Z6B A;  2X6L A;  1D6E C;  1CHQ D;  4LF5 Q;  1UEB A;  4DK0 A;  1GUW A;  1JB7 A;  3TS0 A;  4BBS B;  3CAM A;  4DK6 C;  5GQO A;  2A8V A;  1B3Q A;  1PZI D;  3ND9 A;  4X3S A;  1UE1 A;  3I90 A;  3DEP A;  3CF5 A;  3S2D B;  4G7O C;  3GV3 A;  1PZJ D;  5C4X B;  1SNP A;  4EVO A;  4HJA A;  4EQP A;  1Y69 U;  1HUN A;  4P72 A;  2P5Z X;  4FYD A;  2DJF C;  3NWT A;  5FLX c;  1PH8 A;  4FVM A;  4A93 H;  4JI8 Q;  2RDF A;  3PO2 G;  1II3 A;  3FRP B;  4NDX A;  4OIK A;  4A3I G;  1EY7 A;  1O7Z A;  1U9R A;  4FXK C;  4OEM B;  4POF A;  4X64 Q;  3MTS A;  5C0X I;  2KA7 A;  3AFP A;  1N34 Q;  5ELB A;  1I6H B;  1YBY A;  2SEB D;  1L0X B;  3TBI B;  1CA5 A;  2E2H H;  5C44 H;  4WJ4 A;  4PZ8 A;  3AQQ A;  5A2Q L;  4S3S A;  4LF9 Q;  1A8V A;  3K7A B;  1E24 A;  2IW3 A;  3MXN A;  2X69 A;  3DM3 A;  4X66 Q;  3RZD B;  5JJI A;  1CKN A;  5DM7 3;  3K58 A;  3AYH B;  1VQG A;  2E5L L;  2O2L D;  5IP7 G;  4HSV A;  1I6V C;  1K9M C;  2N8N A;  2F0F A;  5EKK A;  1FR3 A;  3J7Z C;  1QVC A;  5M5W B;  4YHH L;  3DLL A;  2FMC A;  3KOJ A;  1EZ8 A;  2D5D A;  3PUX A;  1E2W A;  1PTO B;  4V19 0;  3BZK A;  4R4I A;  2BH2 A;  1JWS D;  1SE8 A;  1EQV A;  2Q8T A;  3I8Z A;  1SRO A;  3T4A C;  3HFZ B;  1SYC A;  3KUP A;  1K3B C;  2YYZ A;  2Q8I B;  3UI2 A;  1B9N A;  3A7L A;  1GO3 E;  2I07 B;  1Y1V H;  4LF4 L;  1K8M A;  3M4O H;  1QCB D;  2ZXR A;  4HSP A;  3GTK H;  1VQJ A;  3X3N A;  2K5Q A;  1HZC A;  5FJ8 G;  2EJF C;  1X56 A;  1PFB A;  3G71 A;  4B3S L;  2UU9 L;  2WKD A;  1ET6 A;  1DYQ A;  3P7J A;  4LF5 L;  5GRO A;  2NTS A;  1B8A A;  2B8F A;  1QUQ B;  5G3L F;  4DF7 A;  3ICE A;  3M7G A;  1DOL A;  1K73 C;  4PG3 A;  1DZ1 A;  4IPC A;  2JSO A;  3ZYY X;  2I46 A;  4TKO B;  2B8G A;  2ASB A;  2YTX A;  3GP7 A;  4DUZ Q;  1VQE A;  2R92 H;  4A3M H;  2JXM B;  1B2T A;  4ILW A;  1XXG A;  2A19 A;  4JI8 L;  4C3I G;  3HKS A;  2LKV A;  3NTH A;  3I4N H;  4A3D B;  2KCT A;  4PZ6 A;  4X64 L;  4BBS G;  3CW2 C;  3W3A A;  3R93 A;  1VQM A;  3OIP A;  4LAA A;  4QL5 A;  4DR6 L;  4JBM A;  4H02 A;  1N34 L;  5H1S E;  4XYO A;  5I6W A;  4BA1 I;  1FNW A;  2BE5 C;  2Q8R E;  1E0B A;  1KDB A;  1YHQ A;  4DN4 M;  5J39 A;  2F0P A;  4WFN 3;  3KLW A;  4X3K A;  1VMC A;  3J81 E;  1VQK A;  2EIF A;  1TU2 B;  4KY7 A;  3J80 i;  3V05 A;  3S2H B;  4F88 A;  4DR5 Q;  1VQA A;  3GO5 A;  4HIK A;  3SE0 A;  2NN6 H;  3RZO B;  4X66 L;  3TZU A;  2KBN A;  3G48 A;  1F9S A;  1Y1W B;  1XTC D;  1GVP A;  2N88 A;  1PDQ A;  3MAQ A;  2R93 H;  4AYB B;  5C3E H;  4WOR A;  1HH2 P;  2IHE A;  4CDE C;  5IWA Q;  1RL2 A;  1VQD A;  3NTI A;  4OO1 G;  2QEJ C;  3I2Z A;  3TDQ A;  1STY A;  2KED A;  4L5Q A;  4RWS C;  1OXU A;  2Y0S B;  4A3B G;  4R4T A;  3SDZ A;  1PTO C;  2Z9H A;  4JBJ A;  4NKL A;  3M85 A;  1W3S A;  2NUC A;  2PMZ B;  2KCC A;  1YIT A;  3HOV G;  2L15 A;  1QB5 D;  4LUO A;  3D6W A;  1CKO A;  5M9O A;  2R7Z B;  5J1Z A;  3VYR A;  2VQE Q;  2UUB Q;  4H13 C;  4DV6 Q;  1CSQ A;  1I4Q A;  3P20 A;  4CDC C;  5IE8 A;  3MA2 B;  1UE6 A;  3AB9 A;  2PQE A;  1GUN A;  3MEH A;  3HOZ B;  1PMR A;  4YCW A;  4LF6 Q;  5JPN C;  4QCL A;  3DXJ C;  2PNR C;  1AE2 A;  2EDG A;  3J81 j;  4PMB A;  2QCP X;  4JI3 Q;  4G57 A;  3HOY B;  2V4D A;  3S17 B;  2JA6 G;  2NB0 A;  1PH7 A;  1X32 A;  2K52 A;  1L1O A;  2K7V A;  1I4P A;  1VDZ A;  1WYD A;  2EY6 A;  4Q5V A;  3HOU B;  3UDI A;  1MHW C;  4DUZ L;  5CR3 A;  2D62 A;  4JI6 Q;  1KDC A;  2EJG C;  1C8C A;  2AUJ D;  1L1O C;  4E6I A;  3K0Y A;  5IYB H;  4NP5 A;  3MXG A;  4A3I H;  4IUN A;  3CD6 A;  1CI3 M;  1WTX A;  4JPB W;  5AJ3 Q;  2PQA A;  2VQF Q;  2MO0 A;  3RLN A;  1KAB A;  4C56 C;  2JA7 B;  2A68 C;  1ASZ A;  4JBK A;  1F2Y A;  2SDF A;  4A3F G;  1CZG A;  2PCF B;  1ET9 A;  1NMG A;  3BVM A;  4JI2 Q;  4HJ7 A;  1VQP A;  2E76 C;  2KVM A;  3QOJ A;  4X65 Q;  1VQF A;  1XNR Q;  4A3D G;  1EWH A;  5JEA G;  4IZ8 A;  1TWA B;  3ULJ A;  1ZYR D;  3JC6 6;  4UY8 C;  4DR5 L;  1CT1 D;  4RHS A;  1YJW A;  2K28 A;  3I4L A;  2NVQ H;  3HEJ A;  5LMU Q;  2NVT H;  2F0I A;  4A3L G;  1H9J A;  5A2Q E;  2Q2I A;  4DKA C;  4YWK A;  1S5C D;  2TMP A;  1MGS A;  3K8A A;  5I4D A;  1U4M A;  2F3V A;  4AYB E;  1CQF A;  3OIQ A;  2MFI A;  5KRU A;  3R2I A;  1OO9 B;  1KLG D;  1YJ9 A;  1Y1W G;  4H7B A;  4WJ3 M;  4BY7 H;  4AYB G;  2A74 C;  3K5O A;  1HNZ Q;  4LF8 Q;  5KNB A;  3GTO B;  4GKJ Q;  4DV6 L;  2F03 A;  2L11 A;  4A3E H;  2F3I A;  2M2L A;  4GLX A;  4RAU C;  1D1K A;  5E4W C;  5FJ8 H;  2XSC A;  4DAM A;  5FLM H;  1V9P A;  1JWM D;  2YU9 B;  4LF7 Q;  4LF6 L;  1WTV A;  2R7Z G;  1KHI A;  1LTR D;  2R3Z A;  2DY8 A;  1C0A A;  1PH6 A;  4JI3 L;  4RKB A;  1EUJ A;  3QG1 A;  3ZJY C;  3ERQ A;  2UXB L;  3CRK C;  3CCE A;  1IL2 A;  1WI5 A;  1BBX C;  1EY0 A;  4EQO A;  2K1B A;  4X62 L;  4NB3 A;  4X6A H;  5CV8 A;  4HJ9 A;  5CGK A;  1U4R A;  4JI6 L;  3EA6 A;  1VQB A;  1PVO A;  3CCU A;  5IY0 A;  3HOY G;  1MSH A;  1S5D D;  1V8Q A;  2DUD A;  1KAA A;  3PUV A;  4ID6 A;  4P74 A;  1ESR A;  4BBS H;  3MFG A;  3CHB D;  1DJR D;  2N3S A;  5DLQ E;  2VQF L;  3S2D H;  5C4X H;  5HGQ A;  4K0K L;  3M3Y B;  3HOU G;  2ZJP A;  2B2V A;  4QIW E;  4ZUI A;  4B3T Q;  1F2M A;  1UNS A;  1TR5 A;  4OO1 I;  4BY1 H;  3HOX B;  1N36 Q;  1G51 A;  3VYS A;  2OXP A;  1EFW A;  4JI2 L;  1EWI A;  1STN A;  4QF4 A;  3WDN A;  4DAY B;  4X65 L;  2CWA A;  2WAQ B;  5D3D A;  3BDL A;  5KEE A;  1S72 A;  3J81 i;  2GVA A;  1SYE A;  3I4N B;  4DXF A;  1AE3 A;  4QUC A;  2B2V C;  3OWF A;  1H9S B;  1I6H H;  3DWP A;  1ASY A;  4TSS A;  1HXY D;  4J8Q A;  4RG1 A;  1KLU D;  1EIG A;  1HNX Q;  4KN7 C;  3DMU A;  2KEC A;  1V1P A;  3DUZ A;  4HIM A;  2BDN A;  1KRS A;  3PCO B;  2LXJ A;  1KNE A;  1IYJ B;  3RZD H;  1MKH A;  2CWP A;  3Q8D A;  5JVG 3;  3DWQ A;  2JE6 I;  2CCZ A;  1BO0 A;  5C4Z A;  3J7A V;  2HQE A;  4XT1 B;  3CKI B;  1JQY D;  1DM0 B;  5M5W H;  5C44 G;  1EOV A;  3F2C A;  4GKJ L;  2K5V A;  1PTO H;  1ENA A;  2B39 A;  4A3C H;  3CRL C;  4JI1 L;  3RNU A;  1K0R A;  2CW0 C;  4UDU C;  4YWL A;  4IPD A;  5NUC A;  2AQ2 B;  3PV0 A;  2TSS A;  5IIF A;  1BKB A;  3PIP A;  2CFM A;  4NXN Q;  4DAP A;  3M4Y A;  1DON A;  3G6E A;  1HPC A;  3ND8 A;  5M5X B;  4CBV A;  1JCK B;  3FHW A;  1YJN A;  2RCF A;  4ODG A;  3CPW A;  1GD7 A;  2Z0S A;  3PQI A;  2B63 B;  2UXD L;  1GHK A;  1PLF A;  5CV9 A;  5EBD A;  1XMQ L;  4U67 3;  3VR5 A;  4NPS A;  3KK7 A;  5IT9 L;  4DV3 L;  4RGN A;  5JJK A;  5EGT A;  3QWN A;  5C5M A;  2R6G A;  1A63 A;  5ISR A;  2O4X A;  1SMY C;  3H15 A;  3KDF B;  4CJ1 B;  3GTM B;  4EGV A;  1JOQ A;  1SYD A;  1STG A;  1Y1V G;  4DU9 A;  1IW7 C;  2WKC A;  4ZKB B;  5CC4 A;  4DAY A;  3BZC A;  3PMF A;  2ICI A;  2FFK B;  2M9V A;  1O80 A;  4B3T L;  4P75 A;  2FXQ A;  4IN3 A;  3A5U A;  3HKZ E;  2YTV A;  2WFW A;  1N36 L;  4DNT B;  3SVM A;  3CCL A;  1RF2 D;  2KCN A;  4A3D H;  3S1Q H;  2EYL A;  1F2L A;  1NCV A;  2UUA Q;  3IL8 A;  3HKZ G;  2WAQ E;  5KNC A;  3MZ5 A;  1SNM A;  1SFO B;  1TT2 A;  4DV0 L;  2VUM B;  3Q0A A;  5LHY 1;  3HOX G;  1BR9 A;  4U68 A;  2RHS B;  5K5P A;  4GOP B;  2R92 G;  3I55 A;  3TQY A;  4A3M G;  4IO9 A;  4ZLT F;  2XVS A;  1CUK A;  2ZTC A;  4YIJ A;  1HA5 A;  1JOO A;  1S3O A;  1IBL L;  3I4N G;  3RZO H;  1FNV A;  1ML0 D;  5COY A;  1EQQ A;  4IUR A;  4KD3 A;  1KL9 A;  1BCP F;  3NQI A;  3DWA A;  3TME A;  1ENC A;  3U4V A;  3E5S A;  1MI2 A;  3KLR A;  1VQO A;  2F1M A;  2K03 A;  2EYO A;  1XWE A;  1K83 B;  1IKL A;  3L2P A;  3M9B A;  3WOE A;  4LWC A;  2ZJR A;  1MJC A;  2KJX A;  2NN6 G;  2K05 A;  1QOH A;  2HQL A;  1CK1 A;  3C1E A;  1M8A A;  2DNE A;  2CH4 W;  3BYT B;  2R93 G;  4BY7 B;  5BN4 A;  5G3L D;  5C3E G;  4AIM A;  4YHH Q;  2JK8 A;  5IGC A;  1O78 A;  2J4X A;  3NWS A;  1TS5 A;  4MN3 A;  2MJ8 A;  3HOZ H;  3I72 A;  2F0W A;  2N55 A;  2FIN B;  5EJW A;  1EYG A;  2X6G A;  2D0O A;  1X3F A;  1S4Z A;  5DEH A;  2RBM A;  4QY7 A;  2UUC L;  2JA8 B;  3HOY H;  3S17 H;  2KOL A;  4JI5 L;  4HR7 B;  4R1J A;  3GTL B;  1SMX A;  4GN4 B;  4X3U A;  3EIV A;  3HS0 C;  1YNN C;  3CU7 A;  1B1Z A;  3P1H A;  3CPF A;  1R4P B;  2EOT A;  1W6K A;  2VXW A;  5C4J B;  2K5H A;  2DNC A;  3H91 A;  1KAW A;  2UU9 Q;  4B3S Q;  1GUS A;  5ELC A;  1LUZ A;  4ALP A;  3H94 A;  3AEV A;  3GD7 A;  3OPO A;  1XTD A;  2C9O A;  3A56 A;  4JI0 L;  1HR0 L;  2UUA L;  4KV6 A;  2JA7 H;  1VQI A;  2R61 A;  3HOW B;  1FGB D;  1NR2 A;  1SYG A;  4F8M A;  4N8X 1;  4CJ2 C;  3RD4 A;  4IUQ A;  2MP1 A;  4BY1 B;  3GTJ B;  4IOC A;  1YNJ D;  5CV6 A;  1TWA H;  4R4O A;  4RH6 A;  5IYB G;  4O42 A;  3H0G B;  1Y8O B;  1ZKO A;  3KF6 A;  1CA6 A;  5T1I A;  1V1O A;  1KXL A;  1D5Z C;  3L7Z C;  4I7A A;  4L8J A;  4NMZ A;  1VF7 A;  4OGQ C;  4DR6 Q;  2VUM G;  4O0A A;  1N32 Q;  2NVX B;  1DXM A;  3UDX A;  3C2P A;  3CP0 A;  4OIJ A;  4GLV B;  4JOI A;  1KNA A;  4DA2 A;  3GQB A;  3F8T A;  4UHV A;  2PYK A;  1ESF A;  4IUV A;  4LUZ A;  4ZRZ A;  1VQ5 A;  2E74 C;  3BDC A;  2Z6K A;  2HUG A;  1LT5 D;  1HZB A;  4DUY L;  1NE3 A;  1XJV A;  4JOI C;  1NAP A;  2JEB I;  5IGB A;  3MVV A;  1QZH A;  3GTO H;  2HIX A;  1JIC A;  4K5X A;  2Z6K C;  5ELF A;  3J80 c;  1D7Q A;  2MPM A;  1VQN A;  1JC7 A;  3D0F A;  3NBI A;  5EPJ A;  1PH4 A;  2YU9 H;  1PH2 A;  1TS3 A;  3PIP 3;  4IFD G;  4K5W A;  4BY7 G;  3D4R A;  3FVQ A;  4Y7N B;  3D4W A;  1DD2 A;  1ONL A;  3NEL A;  5T1G A;  1EIF A;  3Q24 A;  3S1M B;  4A3E G;  2QDL A;  1K8A C;  1KD1 C;  5C6A A;  2PNH A;  2B29 A;  3ULL A;  3GTQ B;  2ZXO A;  5IT9 E;  5FLM G;  1WTO A;  1LO5 D;  4DR4 L;  3TN2 A;  3DM1 A;  4JV5 L;  4RGT A;  1WCM B;  2F0D A;  1QIL A;  3P75 A;  5FO7 B;  4RA8 A;  3HP3 A;  4ME3 A;  3M3Y H;  5IGE A;  5IYC H;  1QVG A;  4K5V A;  1UWV A;  1GOZ A;  1A3V A;  4WJW A;  3HOX H;  1STB A;  1A2U A;  2C5C A;  2VS1 A;  3SHL A;  4DR7 L;  3NE5 B;  3QB3 A;  2NN6 I;  3K6O A;  3VYT A;  4DK3 C;  1SNO A;  2F4I A;  4G7Z C;  5BR8 L;  3S1Q B;  3H09 A;  1Y8P B;  2N49 A;  2I5H A;  5C4X G;  1HQR D;  1B3A A;  1Q86 C;  3ER0 A;  1VQL A;  1N32 L;  2EXZ A;  4A3G H;  1TY2 A;  3H6M A;  4GN5 A;  5JJZ A;  2EYJ A;  4RKL A;  4BY1 G;  1VQ6 A;  2QDB A;  4XDX A;  1ILQ A;  5KIX A;  4HID A;  1NY4 A;  2B2U A;  2H4O A;  1FD7 D;  3QJY A;  3A0J A;  3CC2 A;  2WII B;  1BNZ A;  4GNX B;  2F0T A;  2RSN A;  2CKZ B;  2NBF A;  1H9K A;  4DK1 A;  4BXX H;  3PUY A;  5LMN W;  3K57 A;  1A15 A;  5D65 A;  3J7Y W;  4OXP A;  2B2U C;  3PSI A;  4CKE A;  4IAL A;  5KGU A;  1WJJ A;  5IGG A;  3PO3 B;  3FDT A;  4B08 A;  4XQQ A;  2DGY A;  3NBH B;  1LTA D;  2CQA A;  3JAM i;  4PNY A;  1LT6 D;  1J8I A;  5EBC A;  4IQZ A;  2A1A A;  3A7A B;  2EZV A;  2MUY A;  5C3W A;  1E1O A;  1IZ6 A;  3IFT A;  1IYV A;  5DAU A;  1PFM A;  2QKI C;  1EY6 A;  5M5X H;  3TP5 A;  2Q2T A;  1PTO F;  3D31 A;  5IGF A;  2B63 H;  2F0V A;  4A3C G;  3SEB A;  2OCE A;  5J22 A;  1QUQ A;  3OYY A;  1XMO L;  3PF5 A;  2WB1 B;  3E3X A;  2QEX A;  2SNS A;  4J15 A;  4A76 A;  4APV A;  1U4P A;  1CHP D;  4UP9 A;  1WTP A;  1SR3 A;  2F0L A;  3TSS A;  4K8I A;  3T13 A;  3A54 A;  3GTM H;  5C4H A;  1AEX A;  2RQX A;  4PQX A;  1K8G A;  5M3F B;  3FPP A;  3ONA B;  2UXB Q;  3FKI B;  1GUG A;  3UE0 A;  4EQ5 A;  2K33 A;  2WV6 D;  1F2Z A;  1LTI D;  1OXX K;  4AQY Q;  2A6H D;  5IT9 c;  3K59 A;  2EJM A;  4X62 Q;  2G5D A;  3MHB A;  4KMU C;  4DNI A;  4JYA L;  5FO8 B;  4C3J B;  3HZX A;  1D1I A;  2QW7 A;  2VB3 X;  2PZT A;  3RR5 A;  1PHJ A;  3H3V C;  4BS9 A;  3I4M B;  2EYM A;  1PH9 A;  1B70 B;  1SFO H;  3CC7 A;  2KQ3 A;  2VUM H;  2MNA A;  1RDP D;  5FOB B;  4K0K Q;  4CKC A;  2C35 B;  2F0E A;  2EY1 A;  5C3X A;  1J6Q A;  3B6Y A;  1EZ6 A;  3HRZ C;  4K8J A;  1SE3 A;  4A3K H;  1E22 A;  4J1M A;  4OX9 L;  2KEE A;  1SRU A;  4YCU A;  3K5L A;  1JR0 D;  1IHZ A;  1WD0 A;  5EPL A;  4GKK L;  1A3U A;  2IPK D;  4TQU S;  1JJG A;  2IHF A;  1DCZ A;  4MHE A;  2NZ1 D;  2NZH A;  5E4X A;  1EYA A;  4CGY B;  1K83 H;  5C0X J;  4A4I A;  4B3R L;  1E1T A;  3U58 A;  1N33 L;  3J81 c;  3M4Q A;  3S16 B;  5ELE A;  1CQV A;  3K5M A;  1E2Z A;  3K7U C;  3I56 A;  1KIX A;  3MC0 B;  2PI2 A;  4CJ0 B;  4F7X A;  4DR3 L;  1BOS A;  4IFD H;  5TSS A;  1JB3 A;  2Y0S E;  4R4Q A;  2Q2U A;  3TP7 A;  5IYD G;  1GKH A;  1C4Q A;  2AWN A;  2PMZ E;  3PO3 G;  2JQO A;  4KN4 C;  3S15 B;  1CTM A;  3E0J A;  4JI1 Q;  2Y0S G;  4IPH A;  1B53 A;  2PI2 E;  1TY0 A;  1PA6 A;  1IBK L;  1UE7 A;  4L5S A;  1MJE A;  5KND A;  1LLR D;  3JAM L;  2V1C C;  2I5M X;  5GAE C;  2JA8 H;  1L0W A;  1B7Y B;  1SE2 A;  2GVB A;  3GDE A;  1LM0 A;  2WB1 E;  3GTL H;  2E2J B;  5M3M H;  2IJ0 A;  2XWJ B;  1JE4 A;  1JOK A;  2AQ3 B;  3WOF A;  5I6Y A;  4JG2 A;  4QMG A;  5C4J H;  3LWU A;  2UXD Q;  1X54 A;  4AQY L;  2WB1 G;  1XMQ Q;  3HOZ G;  4DV3 Q;  1A3T A;  1X6O A;  3IRB A;  2J7Z A;  3ULP A;  4G7H C;  4BBR B;  3BG3 A;  4DV4 L;  5EQ0 A;  3TP8 A;  2KEN A;  4ULL A;  3HOW H;  1RTO A;  1O7L A;  1J9O A;  3SGI A;  1EIH A;  1LAB A;  1BCP D;  4LK1 C;  1G2T A;  3GTJ H;  2K32 A;  3VDY A;  1T5X D;  3H0G H;  1C9O A;  3OMG A;  3W2D A;  1YEZ A;  2EPB A;  5CBE E;  1RHP A;  3A8K E;  3EVQ A;  1SND A;  2K5W A;  1U5K A;  3D6C A;  2NVX H;  2JA7 G;  3VYU A;  4N8F A;  3CQZ B;  5CV5 A;  2H1E A;  2FMM A;  4DV0 Q;  1QG7 A;  2AUK A;  4DV7 L;  4A3G B;  1AH9 A;  1AP0 A;  2A6H C;  3C46 A;  2AMC B;  2WP8 J;  1EWC A;  1Q3L A;  4QGU A;  2CHB D;  5EKI A;  1IBL Q;  3BZD B;  2CVR A;  2K4K A;  4KI0 A;  1N9W A;  2PW7 A;  5I2Y A;  2L0C A;  2D0P A;  3CCM A;  1E3P A;  4RGM A;  3WWV A;  5FKA C;  4KY6 A;  2GN5 A;  2JA9 A;  1VQ4 A;  4JK1 C;  1SJE D;  1W2B A;  1WTQ A;  4IOA A;  2EYP A;  1TII D;  4C2M B;  1I3Q B;  2AQ1 B;  3QR8 A;  4FXD A;  5DM6 3;  2KHJ A;  3U4Z A;  1SDF A;  3RMH A;  4KKU A;  4HJ8 A;  2OQK A;  1KC8 C;  3NP8 A;  3GTP H;  1IL8 A;  4JBW A;  4DV1 L;  1M4V A;  2BOS A;  4O2D A;  4JC0 A;  1ZYR C;  3S24 A;  4Y7N H;  4C3H H;  1Q8K A;  1BUV T;  4Y52 H;  3ERO A;  4JCV E;  3S1M H;  2D2C C;  2GA4 B;  2PZW A;  2FJ2 A;  4MTN A;  1HQM C;  3N52 A;  2E75 C;  3GTQ H;  2F0G A;  3NUC A;  1MIU A;  2IT1 A;  1DOM A;  2G9H D;  3BU2 A;  3AU7 A;  1VS0 A;  1VQ8 A;  1E2V A;  4XTC S;  1WCM H;  2UUC Q;  2B2Y C;  2HCC A;  1MD2 D;  3E6Z X;  3OMC A;  1O7Y A;  1STH A;  3SK5 A;  4JI5 Q;  2QF7 A;  3ITP A;  4ZK9 B;  1X65 A;  4HMI A;  1I4G A;  4DR2 Q;  2RF4 A;  1T5E A;  3D4D A;  3FP9 A;  1EY9 A;  5F2D A;  1G6P A;  1I94 Q;  3G4S A;  2K14 A;  1Y8N B;  4KJN A;  1Z6H A;  2LXK A;  3H3V H;  4WRD A;  2JA5 B;  1NR4 A;  1FJG Q;  1H9S A;  2RSO A;  3IKJ A;  5COR A;  2B2W A;  2NVY B;  1JE5 A;  3L9A X;  4PV1 C;  4JI0 Q;  2OEO A;  3T56 B;  4TVA B;  1HR0 Q;  1FGU A;  1HFG A;  2BA0 A;  2WAC A;  4IUU A;  2EYH A;  1GJX A;  2JEA I;  5IYC G;  3E9H A;  1NJI C;  2Z1C A;  4FF4 A;  3S1N B;  2F4V L;  2MGS A;  4A75 A;  2B2W C;  1CZW A;  3D8G A;  5FLX E;  2WAQ G;  3A8J E;  3NQT A;  3C1F A;  1G8Z D;  2ZTE A;  4A3K B;  1HNW Q;  3S1R B;  3PO2 B;  4LUV A;  2KCM A;  1DOK A;  3HG9 A;  1PH3 A;  1Q81 C;  5LL6 X;  4HAE A;  1TWH B;  1QNU A;  2Z4H A;  1VQ9 A;  4HCS A;  4A3G G;  5IYD H;  1C48 A;  4FF2 A;  1BXT A;  3PO3 H;  4LFA L;  2ZJQ A;  1HCZ A;  1YHA A;  3AFQ A;  1PRT F;  2IX0 A;  1I50 B;  3IFD A;  5I9O A;  4OWT B;  3SK4 A;  1WFQ A;  4DUY Q;  4PMC A;  1H9R A;  1VMP A;  2YV5 A;  1A0I A;  1IYU A;  4BXX G;  1TWC B;  1FYC A;  2DY7 A;  3L3O C;  1D5X C;  1G2S A;  4GLA C;  1EQT A;  2VY3 A;  3LGJ A;  2A73 B;  3K0X A;  3Q6S A;  1WD1 A;  3JAM E;  1D2B A;  3OTO Q;  2L5T A;  2K75 A;  3KDF A;  3QIA A;  4R8I A;  3NEM A;  1WTR A;  5ELO A;  4RGO S;  2F0J A;  1ICW A;  5EKL A;  2FHT A;  4A3J B;  5M3F H;  3AMU A;  2A6E D;  1U0L A;  3PIO A;  1XNQ Q;  4Z9C B;  3MXN B;  4XYQ A;  3A55 A;  2H5X A;  3T53 B;  4XIG S;  1UEA B;  5M3M B;  5IOC A;  3FKI H;  1CKN B;  4DR1 L;  1G29 1;  1QNK A;  4HJ5 A;  4DR2 L;  2B63 G;  4ZYS A;  4YWM A;  3OWE B;  1X55 A;  4HED A;  3Q22 A;  1I94 L;  1VF5 C;  4HIO A;  3CMA A;  4OON A;  4KK7 A;  4DR4 Q;  3VR6 A;  4C3J H;  1R9T H;  4JV5 Q;  1B4O A;  1FJG L;  5IP9 H;  2XWB B;  2KHI A;  1WTH A;  3CCS A;  3I4M H;  4JW0 A;  3BJU A;  4JI7 L;  1RTN A;  4I7Z C;  1NNX A;  2SNM A;  4GOP A;  2BE5 D;  2R7D A;  4OEL B;  4IUT A;  4PMW A;  1K28 A;  1EYC A;  2JA5 G;  3PUZ A;  2EYF A;  1VCI A;  3W1B A;  3BYY B;  1Z9F A;  1HZA A;  4DR7 Q;  1P16 A;  4GOP C;  1B9M A;  4C3I B;  1HNW L;  5BR8 Q;  2O5J C;  2EE1 A;  4KHZ A;  3RN2 A;  2F0N A;  5HGT A;  1LTG D;  1RIP A;  4MZ9 A;  4Q0F A;  4ZQ3 A;  5EAY A;  1LT3 D;  2RVL A;  2I5L X;  4OWX B;  1ZEQ X;  1TWG B;  2EQS A;  1SXT A;  2HDL A;  2WIN B;  5GAD C;  3MWY W;  1B44 D;  3CCV A;  3UDF A;  4LMQ D;  4H0L C;  4C1N I;  2L4N A;  3S16 H;  4A3K G;  1PTO D;  4L6T B;  2ALY B;  3ERS X;  3V2T A;  1PV4 A;  1V1Q A;  2MHV A;  3CME A;  4JI4 L;  3HGB A;  4K2L A;  4KY5 A;  1G91 A;  1PH5 A;  1SN8 A;  1LYL A;  1SJH D;  1Z47 A;  4K2K A;  1VQC A;  5M5Y H;  1EIY B;  3MXU A;  1H9M A;  3OHX C;  1STE A;  1LAC A;  2F3W A;  4KKS A;  3CCQ A;  3S15 H;  2NWG A;  1BDO A;  1X3Q A;  4HN7 A;  1NMF A;  1IKM A;  3OTO L;  4KLK A;  2HD3 A;  4A3B B;  3GTP B;  3RLF A;  3NHH A;  4FNF A;  5C0X H;  3U9O A;  1XPO A;  2E2J H;  4DV2 L;  1VQ7 A;  3K81 C;  3HOV B;  4C3H B;  4MTK A;  1CSP A;  1XNQ L;  1F9Q A;  2RDH A;  3VR4 A;  1QVF A;  3TRE A;  3JAM c;  4RCN A;  1EY5 A;  3BVZ A;  3OW7 A;  1XMO Q;  1SBB B;  1X3G A;  4HCE A;  3M7N A;  4FF3 A;  2JA8 G;  1A6X A;  3EQL C;  1S5B D;  4A3J G;  1UUP A;  2L1B A;  2N78 A;  4ZKC B;  1FNU A;  5M3M G;  2LMC B;  4BBR H;  2A68 D;  4L63 B;  1PFN A;  1OXS C;  5CV4 A;  1S5F D;  2JP1 A;  2KHS A;  2XIW A;  2ZTD A;  2D9U A;  1X9N A;  5JEA J;  2JA6 B;  4KKT A;  1YHB A;  2I0Q A;  4CDF C;  2E2I B;  4CKB A;  4N9P A;  1SNC A;  4JYA Q;  2YTY A;  3G6J B;  3NXW A;  5IGD A;  2R7F A;  3KBX A;  4UP7 A;  3VA5 A;  2OF1 A;  1I4H A;  1SYB A;  3CQZ H;  1WTW A;  3HOW G;  2G9D A;  2A6E C;  1GHJ A;  4R9W A;  1P8L A;  3R3O A;  1AFP A;  1CM9 A;  2L55 A;  4X3T A;  1PXU A;  3R2T A;  2EY2 A;  4A3F B;  1L1O B;  3FEW X;  4MNO A;  3H0G G;  4OX9 Q;  3FPU B;  4GKK Q;  3NEN A;  2ZT9 C;  3RN5 A;  4FO2 A;  3PUW A;  4ZUJ A;  3T1H Q;  5D3I B;  3K5N A;  2OTL A;  4DXG A;  3GTG B;  1XYI A;  2B3G A;  1EU3 A;  4LJZ C;  2JN4 A;  4B3R Q;  4C2M H;  1I3Q H;  2PQA B;  1N33 Q;  3F1Z A;  3EBE A;  1G6Z A;  1ROD A;  4LF9 L;  1I4X A;  1ICF B;  3IAY A;  1YNJ C;  2QA4 A;  1KDA A;  4DR3 Q;  1KTK A;  5E3F A;  3STB D;  1SYF A;  1Q46 A;  4BA2 I;  1TWF B;  4GS3 A;  3W5O A;  1D8L A;  4EQN A;  2XRQ D;  2HCI A;  3OSO A;  4QJF A;  1SLJ A;  4QUF A;  3MEF A;  3CXC A;  1TS2 A;  2BA1 A;  3EJI A;  1IBK Q;  5L37 A;  2AKW B;  1DGS A;  2IX1 A;  1HR0 W;  3KLS X;  1LV9 A;  3N6R A;  2AWO A;  3E9I A;  3PIO 3;  2BDO A;  2RHQ B;  4C3H G;  3TRZ A;  4KTA A;  1GUO A;  2PW5 A;  2JJQ A;  1HTP A;  2HHH Q;  4XQN A;  1OXT A;  1BVS A;  2KUM A;  2JA5 H;  5LL6 S;  1VQH A;  5JPM C;  4CDD C;  1B50 A;  1WCM G;  4QB4 A;  2NVY H;  1R9T B;  1WVL A;  3G7L A;  1Q1B A;  4G4K A;  1X3P A;  3SXH A;  3S14 B;  1YVC A;  4OL7 A;  4DV4 Q;  5ELN A;  2LY7 A;  2PO4 A;  1KRT A;  4GN3 B;  3VR3 A;  1LTL A;  5JJL A;  1QJO A;  2OQ0 A;  1TS4 A;  1EEI D;  3S1N H;  3CC4 A;  3BS1 A;  4GNX A;  1JJC B;  1PFS A;  2EXD A;  3W1G A;  1RKN A;  3S1R H;  3PO2 H;  1BBU A;  1EFI D;  5FLX L;  4JVZ A;  1ZXT A;  5JVH 3;  4IFD I;  3I73 A;  4QIW B;  3K80 C;  5JOB A;  1WOC A;  4DPG A;  1TWH H;  3M4P A;  1HFN A;  3T1H L;  4DV7 Q;  4GNX C;  2ID0 A;  1YZ6 A;  2M00 A;  4R4C A;  3NBH A;  1F77 A;  1YI2 A;  4B9W A;  4LFC Q;  1C7Y A;  3L0O A;  2L12 A;  5K36 G;  1I50 H;  2CW0 D;  2DN8 A;  2LS0 1;  1J5E Q;  2MQH A;  2NYZ D;  4LW1 A;  4A93 B;  3S9W A;  1QWY A;  3CCR A;  2MO1 A;  1CFM A;  1JOR A;  1TWC H;  5IP7 H;  5CMD A;  3KBG A;  4UAI A;  5M5Y B;  3A8I E;  2XGT A;  3KFU A;  1LT4 D;  4GZY C;  1HZ9 A;  3V96 A;  1AZQ A;  2E2H B;  3T1Y Q;  5E7N A;  2IL8 A;  2NZO A;  2AHO B;  5C44 B;  4FXG C;  1YIJ A;  2ATW A;  5IWA L;  1EL0 A;  1S40 A;  1OXV A;  2OTJ A;  1Q90 A;  3RLO A;  2PZU A;  1M1K C;  1M90 C;  3SK8 A;  3J7A F;  3J80 L;  4DV1 Q;  2XN9 C;  2SOB A;  1SMY D;  3F2U A;  4A3J H;  1V1P B;  1EOT A;  1BF4 A;  2F0S A;  1IW7 D;  2VQE L;  3O13 A;  2UUB L;  1JT8 A;  3KF8 B;  5JAV A;  1HRJ A;  4K6D A;  1NSN S;  1O7I A;  1UE5 A;  2F0H A;  4ME5 A;  2F0U A;  3NPP A;  4IPG A;  2HHH L;  3SK6 A;  2NTT A;  4NW2 A;  3LWE A;  3J7A 5;  1FVI A;  4J6H A;  4BWG B;  2IWH A;  2F0M A;  3KJP A;  4HMJ A;  3NSW A;  3EN2 A;  4R8N A;  1UAP A;  3STB C;  5M3F G;  4QQB X;  3I4O A;  1K8O A;  1HJP A;  2ZM6 Q;  3FKI G;  3BDO A;  1FL0 A;  3FMC A;  4IUP A;  1Y1V B;  2QIL A;  2E2D C;  3M4O B;  2EVB A;  3GTK B;  4DFA A;  4EX5 A;  1TXY A;  2VW9 A;  1GXD C;  2A69 D;  4C3J G;  1L2F A;  1HUM A;  1AZP A;  2K50 A;  5IP9 G;  4KHP Q;  2XTI A;  5A35 A;  3I4M G;  4C3I H;  5FO9 B;  1LTT D;  2F52 A;  4RFB A;  4LNQ A;  1PRT D;  1SSO A;  5E1F A;  2ICE C;  5AJ3 L;  1TWG H;  1XX8 A;  3HKZ B;  4N9T A;  3KJO A;  1PYS B;  1PYW D;  2VNU D;  3X3M A;  2F4V Q;  1PZK D;  4LFC L;  4NXM Q;  2EY5 A;  1EU4 A;  4F87 A;  4V0B A;  2R92 B; 
#chains in the Genus database with same CATH homology
 3NEL A;  4DUY Q;  1NTG A;  1EIF A;  2YV5 A;  1XNR L;  1A0I A;  1J5E L;  4BXX G;  3UDI A;  4DUZ L;  4A3E G;  1Q12 A;  2D62 A;  1K8A C;  4JI6 Q;  2ES2 A;  1KD1 C;  2PNH A;  1IBM Q;  2B29 A;  4GLA C;  3ULL A;  1L1O C;  5IYB H;  5FLM G;  2VY3 A;  3F2D A;  4A3I H;  3LGJ A;  4DR4 L;  3K0X A;  3CD6 A;  5LMU L;  4JV5 L;  5AJ3 Q;  2PQA A;  2VQF Q;  3OTO Q;  2K75 A;  3T1Y L;  4LFA Q;  3KDF A;  2MO0 A;  3RLN A;  1Q82 C;  1XPR A;  1ASZ A;  4JBK A;  4FDB A;  4A93 G;  2HT1 A;  3NEM A;  1H95 A;  3K7A H;  3F2B A;  5ELO A;  2Q2H A;  4A3F G;  4ME3 A;  3M3Y H;  4A3B H;  4HJ7 A;  1IXR A;  1NMG A;  1VQP A;  4RMF A;  4JI2 Q;  5M3F H;  1U0L A;  5IYC H;  3PIO A;  1XNQ Q;  1QVG A;  3MXN B;  4X65 Q;  1UWV A;  1VQF A;  2H5X A;  4XIG S;  1XNR Q;  4A3D G;  3FKI H;  3HOX H;  1CKN B;  5JEA G;  4DR1 L;  3HOV H;  1OTC A;  3ULJ A;  1G29 1;  4DV5 Q;  4HJ5 A;  4DR2 L;  3JC6 6;  2B63 G;  4YWM A;  4UY8 C;  4DR5 L;  1X55 A;  2VS1 A;  1HNZ L;  4DR7 L;  1I94 L;  4HIO A;  1YJW A;  2NN6 I;  4P73 A;  3CMA A;  4LF8 L;  4DK3 C;  4OON A;  4UP8 A;  2NVQ H;  4DR4 Q;  4C3J H;  5BR8 L;  5LMU Q;  1R9T H;  1Q7Y C;  2NVT H;  4JV5 Q;  4A3L G;  1FJG L;  3H3V I;  5IP9 H;  2KHI A;  3CCS A;  1I5F A;  3I4M H;  2Q2I A;  1N8R C;  1A62 A;  2N49 A;  4DKA C;  2I5H A;  4YWK A;  3BJU A;  3PGZ A;  5C4X G;  1NBW A;  1Q86 C;  1N32 L;  3K8A A;  3ER0 A;  1VQL A;  4JI7 L;  2UXC Q;  4AYB E;  4LF7 L;  4A3G H;  4GN5 A;  3PF4 A;  4GOP A;  5C0X G;  2MFI A;  4L5T A;  2R7D A;  4BY1 G;  1VQ6 A;  4PMW A;  4POG A;  1YJ9 A;  1Y1W G;  4HID A;  2RCN A;  2JA5 G;  1NY4 A;  2ZM6 L;  2JA6 H;  4DR1 Q;  3PUZ A;  3A0J A;  4WJ3 M;  4BY7 H;  4OWW B;  4AYB G;  3TEH B;  3CC2 A;  1VCI A;  3W1B A;  2E2I H;  4P71 A;  1Z9F A;  1HZA A;  4GNX B;  1HNZ Q;  1P16 A;  4DR7 Q;  4GOP C;  4LF8 Q;  2CKZ B;  5LMN Q;  4GKJ Q;  2BH8 A;  4DV6 L;  4BXX H;  1HNW L;  3PUY A;  5BR8 Q;  5LMN W;  4A3E H;  4KHZ A;  3RN2 A;  4LFB Q;  1RIP A;  2F3I A;  4MZ9 A;  4YY3 Q;  4B3M Q;  4OXP A;  4GLX A;  4KHP L;  5EAY A;  4YCV A;  1JMC A;  3PSI A;  2I5L X;  4IJL A;  4OWX B;  1XPU A;  5FJ8 H;  4DAM A;  5FLM H;  1WJJ A;  2EQS A;  1Y14 B;  4BBR G;  4JI7 Q;  1V9P A;  5HY6 A;  4LF7 Q;  4LF6 L;  5GAD C;  3CCV A;  2R7Z G;  1KHI A;  2DGY A;  3NBH B;  3KYH C;  3UDF A;  3JAM i;  1C0A A;  1PH6 A;  4JI3 L;  3S16 H;  3TS2 A;  4A3K G;  2A1A A;  1EUJ A;  2ALY B;  2QGQ A;  3ERS X;  1PV4 A;  1V1Q A;  3CME A;  4A3F H;  4L5R C;  3ZJY C;  4JI4 L;  1E1O A;  2UXB L;  1IZ6 A;  2CQO A;  4NXM L;  3CCE A;  1X3E A;  1PH5 A;  1SN8 A;  1IL2 A;  1LYL A;  1WI5 A;  1Z47 A;  5M5Y H;  1VQC A;  1EIY B;  5M5X H;  4X62 L;  4NB3 A;  2Q2T A;  4X6A H;  3D31 A;  2B63 H;  4HJ9 A;  4A3C G;  1PH1 A;  2OCE A;  4JI6 L;  1VQB A;  1PVO A;  3CCU A;  1K3R A;  1QUQ A;  5IY0 A;  3OYY A;  1QZG A;  3CCQ A;  1XMO L;  1IBM L;  3U50 C;  3HOY G;  3S15 H;  3PF5 A;  3PUV A;  2DUD A;  3CCJ A;  2QEX A;  2IY5 B;  4J15 A;  4P74 A;  3OW2 A;  3GTG H;  4BBS H;  2K5N A;  4A76 A;  1NMF A;  4A3L H;  5J3B A;  4APV A;  4IFD J;  4UP9 A;  2N3S A;  5DLQ E;  2VQF L;  3OTO L;  3S2D H;  1SR3 A;  1HNX L;  5C4X H;  4KLK A;  5HGQ A;  3GTM H;  4K0K L;  1K8G A;  2ZJP A;  4QIW E;  3RLF A;  4AH6 A;  3HOU G;  2LSS A;  4B3T Q;  3S2H H;  1XPO A;  2E2J H;  4JI4 Q;  2UXB Q;  1BBW A;  1CKM A;  4DV2 L;  3UE0 A;  4EQ5 A;  3K81 C;  1N36 Q;  1VQ7 A;  4UPA A;  1G51 A;  1EQR A;  4BY1 H;  1OXX K;  3UE1 A;  4AQY Q;  1EFW A;  1EWI A;  5IT9 c;  1KQS A;  1CSP A;  4JI2 L;  4DAY B;  1XNQ L;  2E8G A;  4X65 L;  1TWF H;  2CWA A;  1Y1W H;  4X62 Q;  1QVF A;  1S72 A;  3TRE A;  3J81 i;  2GVA A;  4DNI A;  3JAM c;  4JYA L;  4DV5 L;  3E0E A;  1AE3 A;  3KF6 B;  3I7F A;  1XMO Q;  3RR5 A;  1PHJ A;  1X3G A;  1I6H H;  1ASY A;  3M7N A;  4IJH A;  4PZ7 A;  3A74 A;  4RG1 A;  2JA8 G;  2OWO A;  1PH9 A;  1B70 B;  4A3J G;  1E7Z A;  1SFO H;  3CC7 A;  2VL6 A;  1HNX Q;  2N78 A;  2VUM H;  2MNA A;  5M3M G;  4K0K Q;  2HIV A;  4BBR H;  2E5L Q;  2C35 B;  4HIM A;  2UXC L;  1KRS A;  1OXS C;  1V43 A;  3PCO B;  2LXJ A;  4DV2 Q;  1IYJ B;  2ZTD A;  1MKH A;  3RZD H;  1X9N A;  2R7Z H;  5JEA J;  1J6Q A;  3B6Y A;  2I0Q A;  1YHB A;  1GM5 A;  1PYB A;  2CWP A;  4NXN L;  5GAG C;  4A3K H;  1E22 A;  1YNX A;  4OX9 L;  3Q8D A;  1SRU A;  4YCU A;  2CCZ A;  1T9H A;  2JE6 I;  4GKK L;  4JYA Q;  5GAH C;  2YTY A;  4TQU S;  3UDG A;  2R7F A;  2IHF A;  5M5W H;  5C44 G;  1JJ2 A;  1JJG A;  1EOV A;  3F2C A;  4UP7 A;  5LMN L;  4GKJ L;  2NZH A;  2K5V A;  2VZA A;  4A3C H;  3CQZ H;  4JI1 L;  3RNU A;  4LFB L;  4YY3 L;  4B3M L;  3HOW G;  1K83 H;  5C0X J;  1K0R A;  4A4I A;  3S14 H;  4B3R L;  1E1T A;  1P8L A;  3U58 A;  4YWL A;  3A5Z B;  1N33 L;  3J81 c;  3M4Q A;  4IPD A;  3PV0 A;  4LF4 Q;  3K7U C;  3I56 A;  1BKB A;  1KIX A;  1L1O B;  3PIP A;  2PI2 A;  2CFM A;  4NXN Q;  3HOU H;  4MNO A;  3H0G G;  4DR3 L;  4OX9 Q;  1Q1E A;  2Y0S E;  4R4Q A;  3NEN A;  3G6E A;  4GKK Q;  2Q2U A;  3RN5 A;  5IYD G;  3FHW A;  1YJN A;  3CPW A;  1GD7 A;  2Z0S A;  1GKH A;  2AWN A;  2PMZ E;  3PUW A;  4LF5 Q;  2UXD L;  1XMQ L;  1UEB A;  3PO3 G;  3T1H Q;  2JQO A;  4NPS A;  2OTL A;  4JI1 Q;  4DV3 L;  3TS0 A;  2Y0S G;  1JB7 A;  4IPH A;  2B3G A;  5JJK A;  2PI2 E;  3CAM A;  4DK6 C;  5GQO A;  1PA6 A;  1IBK L;  2A8V A;  2R6G A;  1A63 A;  4B3R Q;  4C2M H;  1I3Q H;  1UE7 A;  2PQA B;  1MJE A;  1UE1 A;  4L5S A;  1N33 Q;  3CF5 A;  2V1C C;  3H15 A;  3F1Z A;  3EBE A;  2I5M X;  3KDF B;  4HJA A;  5GAE C;  2JA8 H;  1L0W A;  4LF9 L;  4P72 A;  1B7Y B;  1Y1V G;  2GVB A;  3GDE A;  1LM0 A;  2WB1 E;  5FLX c;  1PH8 A;  3GTL H;  5M3M H;  2QA4 A;  3BZC A;  4A93 H;  4DR3 Q;  4JI8 Q;  3STB D;  3PO2 G;  4B3T L;  1Q46 A;  4P75 A;  2FXQ A;  4A3I G;  3A5U A;  4BA2 I;  4X64 Q;  4POF A;  3HKZ E;  2YTV A;  4GS3 A;  2WFW A;  4JG2 A;  5C0X I;  3AFP A;  5C4J H;  1N36 L;  2UXD Q;  1X54 A;  3W5O A;  1D8L A;  4AQY L;  2WB1 G;  1XMQ Q;  3HOZ G;  4QJF A;  3CCL A;  4A3D H;  1SLJ A;  1N34 Q;  3S1Q H;  1YBY A;  3MEF A;  2E2H H;  4DV3 Q;  3CXC A;  2BA1 A;  1IBK Q;  2UUA Q;  1X6O A;  2AKW B;  2WAQ E;  3HKZ G;  1DGS A;  5C44 H;  1HR0 W;  2IX1 A;  4WJ4 A;  3IRB A;  4PZ8 A;  3AQQ A;  4DV0 L;  2AWO A;  3ULP A;  3E9I A;  4LF9 Q;  3HOX G;  4DV4 L;  2RHQ B;  1A8V A;  2KEN A;  3HOW H;  1E24 A;  2RHS B;  4GOP B;  2R92 G;  3SGI A;  3TQY A;  3DM3 A;  4X66 Q;  3I55 A;  4IO9 A;  4A3M G;  3TRZ A;  5JJI A;  1CKN A;  3AYH B;  1CUK A;  1VQG A;  2ZTC A;  2E5L L;  5IP7 G;  2JJQ A;  1S3O A;  1IBL L;  3I4N G;  3RZO H;  3GTJ H;  1K9M C;  2HHH Q;  2N8N A;  1OXT A;  3VDY A;  1BVS A;  3H0G H;  3J7Z C;  1C9O A;  1EQQ A;  2JA5 H;  1YEZ A;  1QVC A;  1KL9 A;  1VQH A;  4YHH L;  3DLL A;  3KOJ A;  1U5K A;  1WCM G;  3PUX A;  3U4V A;  2NVY H;  2NVX H;  2JA7 G;  1VQO A;  3BZK A;  4R4I A;  2BH2 A;  4DV0 Q;  1Q1B A;  4DV7 L;  1SE8 A;  3M9B A;  3L2P A;  1YVC A;  4DV4 Q;  4LWC A;  2ZJR A;  1SRO A;  1MJC A;  3HFZ B;  5ELN A;  1AH9 A;  2NN6 G;  2AMC B;  2WP8 J;  4GN3 B;  1KRT A;  1LTL A;  5JJL A;  2YYZ A;  2OQ0 A;  2HQL A;  4QGU A;  3S1N H;  1IBL Q;  1GO3 E;  3CC4 A;  1Y1V H;  4LF4 L;  4GNX A;  1JJC B;  1PFS A;  2EXD A;  2K4K A;  3M4O H;  2R93 G;  4KI0 A;  3W1G A;  3GTK H;  5C3E G;  1N9W A;  1VQJ A;  3S1R H;  3PO2 H;  4AIM A;  1BBU A;  1HZC A;  5FJ8 G;  4YHH Q;  2D0P A;  1X56 A;  2JK8 A;  3CCM A;  1E3P A;  3WWV A;  4IFD I;  2GN5 A;  2JA9 A;  3G71 A;  2UU9 L;  4B3S L;  3K80 C;  1VQ4 A;  1WOC A;  4DPG A;  1TWH H;  3M4P A;  1W2B A;  4LF5 L;  3HOZ H;  4IOA A;  5GRO A;  3T1H L;  1B8A A;  4DV7 Q;  1QUQ B;  2ID0 A;  4GNX C;  1YZ6 A;  1EYG A;  4R4C A;  3ICE A;  2D0O A;  1X3F A;  1K73 C;  2KHJ A;  4PG3 A;  3U4Z A;  4QY7 A;  1YI2 A;  2UUC L;  4LFC Q;  3HOY H;  1C7Y A;  4IPC A;  3L0O A;  3GTP H;  1KC8 C;  4HJ8 A;  2OQK A;  3S17 H;  4JI5 L;  4JBW A;  4R1J A;  5K36 G;  1SMX A;  4DV1 L;  4GN4 B;  1I50 H;  4O2D A;  1J5E Q;  3EIV A;  4JC0 A;  2MQH A;  2YTX A;  4LW1 A;  3S24 A;  2ASB A;  4Y7N H;  4DUZ Q;  4C3H H;  1Q8K A;  3CCR A;  1VQE A;  2R92 H;  2MO1 A;  4A3M H;  3CPF A;  4Y52 H;  2K5H A;  4JCV E;  2A19 A;  1TWC H;  4JI8 L;  5IP7 H;  3S1M H;  3HKS A;  4MTN A;  3I4N H;  2XGT A;  3KFU A;  2KCT A;  4PZ6 A;  4X64 L;  1KAW A;  2UU9 Q;  1HZ9 A;  4B3S Q;  3CW2 C;  4BBS G;  3GTQ H;  1VQM A;  1MIU A;  1LUZ A;  2IT1 A;  4QL5 A;  4ALP A;  3T1Y Q;  5E7N A;  4DR6 L;  4JBM A;  4H02 A;  3BU2 A;  2NZO A;  3AEV A;  2AHO B;  3GD7 A;  1N34 L;  1YIJ A;  1VQ8 A;  1VS0 A;  5H1S E;  5IWA L;  1XTD A;  2ATW A;  4XTC S;  1S40 A;  1WCM H;  4BA1 I;  4JI0 L;  1OXV A;  2OTJ A;  3RLO A;  1HR0 L;  2UUC Q;  1M1K C;  1M90 C;  2UUA L;  2JA7 H;  4OO1 I;  1VQI A;  4JI5 Q;  1YHQ A;  4DV1 Q;  3KLW A;  1X65 A;  1VQK A;  2EIF A;  4A3J H;  3J80 i;  4DR2 Q;  2RF4 A;  3FP9 A;  4DR5 Q;  1VQA A;  3GO5 A;  4HIK A;  4X66 L;  1G6P A;  2VQE L;  4IOC A;  1I94 Q;  2UUB L;  3G4S A;  2K14 A;  1TWA H;  2KBN A;  4R4O A;  3KF8 B;  3G48 A;  5IYB G;  1JT8 A;  2LXK A;  1O7I A;  1UE5 A;  3H3V H;  3KF6 A;  1GVP A;  1FJG Q;  4IPG A;  2HHH L;  2R93 H;  1KXL A;  3L7Z C;  5C3E H;  4DR6 Q;  2VUM G;  4O0A A;  3J7A 5;  1FVI A;  1HH2 P;  2IHE A;  1N32 Q;  5IWA Q;  1RL2 A;  1JE5 A;  1VQD A;  3UDX A;  4JI0 Q;  4OO1 G;  3KJP A;  4TVA B;  3CP0 A;  3I2Z A;  1HR0 Q;  4GLV B;  4JOI A;  4L5Q A;  1FGU A;  3EN2 A;  2BA0 A;  1OXU A;  4A3B G;  3F8T A;  4R4T A;  3STB C;  5M3F G;  4QQB X;  4JBJ A;  2JEA I;  4LUZ A;  5IYC G;  1VQ5 A;  3E9H A;  3I4O A;  1HJP A;  2ZM6 Q;  1NJI C;  3M85 A;  3FKI G;  1W3S A;  1YIT A;  1FL0 A;  2Z6K A;  3HOV G;  2L15 A;  2F4V L;  4LUO A;  4A75 A;  1CKO A;  1HZB A;  2WAQ G;  2VQE Q;  2UUB Q;  4DUY L;  1NE3 A;  1XJV A;  4JOI C;  1CSQ A;  2ZTE A;  4DV6 Q;  1HNW Q;  4EX5 A;  1TXY A;  2VW9 A;  1L2F A;  2JEB I;  4LUV A;  5IE8 A;  2K50 A;  5IP9 G;  1QZH A;  2XTI A;  3GTO H;  2HIX A;  2KCM A;  4KHP Q;  1PH3 A;  3I4M G;  1UE6 A;  1Q81 C;  4C3I H;  2Z6K C;  4LNQ A;  2F52 A;  3J80 c;  1D7Q A;  1VQ9 A;  1VQN A;  4YCW A;  4LF6 Q;  4A3G G;  3D0F A;  5IYD H;  5AJ3 L;  1AE2 A;  1TWG H;  3J81 j;  1PH4 A;  3PO3 H;  4LFA L;  2YU9 H;  2ZJQ A;  3KJO A;  4JI3 Q;  1PH2 A;  1PYS B;  1YHA A;  3AFQ A;  2JA6 G;  1PH7 A;  2VNU D;  4IFD G;  2K52 A;  2F4V Q;  1L1O A;  2IX0 A;  4BY7 G;  4LFC L;  4NXM Q;  1WYD A;  4OWT B;  1WFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...