4NB3A

Crystal structure of rpa70n in complex with a 3,4 dichlorophenylalanine atrip derived peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Discovery of a Potent Stapled Helix Peptide That Binds to the 70N Domain of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4nb3A00
2YTYA 4X64Q 3PO3H 4HIDA 1VQIA 4LUVA 3KFUA 1XTDA 4BY1H 2WAQE 2ZTCA 1VQFA 1LTLA 2OCEA 3HKZG 1E24A 3CF5A 3AFQA 2DUDA 3HOYH 3D31A 2BA1A 3G48A 2CCZA 1Z9FA 3TEHB 3DLLA 4R1JA 4DV7L 3RN5A 1Q86C 1R9TH 1K9MC 1N9WA 3HOVG 1PVOA 3PUWA 4DV1Q 1KAWA 4B3MQ 4HIKA 4IFDG 4LF9Q 1JJGA 1FJGQ 5IYCG 3HOVH 5EAYA 1TWCH 2YTXA 3S1RH 2NN6I 1IBKQ 4TVAB 1GD7A 3NENA 3A5UA 5IYCH 3GTMH 1TWGH 3FP9A 4OX9L 2UUCQ 1X6OA 1CSPA 2N49A 1QUQA 1TWAH 3CAMA 2DGYA 4JBWA 4YWLA 4PZ7A 3M4OH 1VQOA 1XPOA 1C7YA 1A63A 1XMOL 1AE2A 1I50H 2VQFL 1B8AA 1P8LA 1PYSB 4LF5L 1KD1C 1KHIA 4DV0L 4DR1Q 1E22A 4IPDA 4DAMA 2YU9H 4KHZA 1ASYA 1X54A 4L5QA 1CUKA 1Y1VG 4P75A 1JT8A 4LF4L 1FL0A 1GM5A 5GAEC 1Q7YC 2AWNA 2BA0A 1YHQA 1DGSA 1OXUA 1SLJA 4OXPA 4LFAQ 4BXXG 1Y1VH 4DR2L 3PF4A 4JC0A 4X65L 1N36Q 1E1OA 4IO9A 5LMNL 5JJLA 1Z47A 3KLWA 2NZOA 4LF8Q 1XNRL 4L5RC 3EN2A 2PQAA 4JCVE 3CP0A 4NB3A 2IX0A 4O2DA 4DR6Q 4A93G 2F4VQ 4Y7NH 1Y1WG 3BZKA 3H15A 1J5EL 2D0PA 1OTCA 2KHJA 3OYYA 3G4SA 3ULJA 4A93H 4L5TA 3GO5A 4IOCA 4HJ7A 2UUAQ 1YVCA 2OQKA 4LWCA 1Y1WH 1X3FA 1QVCA 4BBSG 3FHWA 5K36G 4OWXB 1YJNA 1C9OA 3Q8DA 3I55A 4GLVB 3KDFA 2UU9Q 4JI1Q 3CC4A 3M85A 4OWWB 3CCRA 1XNQQ 2UXDL 3T1HQ 1IBMQ 2MFIA 4DV6L 3CCQA 2K4KA 2B29A 4GN4B 4BBSH 1W2BA 4RG1A 4KI0A 2Q2UA 3FKIG 4GN3B 4DR4L 4K0KQ 3H0GG 3MXNB 3PSIA 1GO3E 1YZ6A 1CKNA 4C3IH 5IP9G 2E5LQ 2ALYB 2WP8J 4A3LG 2K52A 2PMZE 4AYBG 2Q2TA 5JEAG 4JI7Q 3VDYA 2Y0SE 2ZTDA 3S14H 3S1QH 2UXBL 4IJLA 3S2DH 3BJUA 2K50A 4DKAC 4GNXA 3KF6A 3ULPA 5IP9H 4IOAA 1BBWA 1C0AA 5IYBG 1G51A 4A3LH 2VS1A 3LGJA 4JI0Q 4LF9L 1SN8A 4JI2L 4HJ5A 1FJGL 2D62A 2JE6I 3UE0A 1VQNA 1YHBA 3OW2A 3PUYA 4GKJQ 4DV2Q 4JYAL 5IYBH 1QUQB 3CQZH 1NMGA 4OWTB 3STBC 4R4CA 5C0XG 4X62Q 5GADC 4NPSA 4LFBQ 5GQOA 5GAGC 3E9IA 2F3IA 4GS3A 4FDBA 3KOJA 4IPGA 1E3PA 1WFQA 2Q2IA 4LFCL 1HZAA 3W1GA 1ASZA 2UXCQ 5HGQA 4A3BH 1HZCA 4UP8A 1X56A 1KIXA 2RF4A 2UUBL 1Q8KA 4YY3Q 1NBWA 4C3HH 5LMUQ 4OO1I 1X9NA 4DV4Q 3NELA 3EIVA 4P71A 4PZ6A 3M4PA 3RLFA 3RLOA 1WYDA 3CCEA 1TXYA 1WCMG 3H3VI 2JA5G 4DNIA 1Q1EA 1VQBA 2LSSA 4XTCS 3J7ZC 4DR3Q 4UP7A 2JEAI 4X6AH 3CXCA 1TWHH 4J15A 4A3GH 1XMQL 1L2FA 1YIJA 3U4ZA 1BKBA 3PV0A 4BBRH 4DV3L 2JA5H 1N34Q 4NXML 4YWMA 4QGUA 2ASBA 3CMEA 1EFWA 1L1OA 2JEBI 5ELOA 1E1TA 3B6YA 1M90C 1PYBA 2IT1A 5M3MG 1VQHA 1EUJA 4IPCA 4X66L 2VL6A 4POFA 4GLXA 3CCVA 2N78A 2HIVA 3AQQA 2RCNA 4GN5A 4MTNA 1VQEA 5M5WH 5IWAQ 4A3IG 2UUAL 4GKKQ 1KRTA 4B3TL 2CWPA 2VQEQ 5M5YH 2NVXH 1IBLQ 2HT1A 1Y14B 4B3SL 2K5NA 2V1CC 1LUZA 4EQ5A 4DV5Q 1VQ8A 3E9HA 4IFDI 2JA8G 2HHHQ 3CD6A 1M1KC 2MO0A 4HJ9A 2Z6KC 1VQ6A 3L2PA 1KL9A 2IHEA 5IT9c 1X55A 5AJ3Q 4A3KG 1Q81C 4PMWA 2PI2E 1HNZL 4LF6Q 3RR5A 5H1SE 3W1BA 4AIMA 1I94Q 3UE1A 4DUZQ 4DR7L 4GOPC 5HY6A 1S72A 2JA8H 4L5SA 4UP9A 4WJ3M 1VQDA 1RIPA 2HIXA 3CPWA 2A19A 4A3KH 3KF6B 4JBJA 1K8GA 1JJCB 3UDIA 1L0WA 3PIPA 2PNHA 2R7DA 2WB1E 2K5VA 4LF7Q 1GVPA 4JI5L 3UDXA 3I7FA 4YHHQ 1PV4A 3CCLA 3AYHB 4KHPL 4JI8Q 5GAHC 1CKOA 1N33L 4QL5A 4O0AA 5FLMG 5E7NA 1HR0L 1X65A 2R7ZG 2ES2A 4NXNL 3RLNA 1PH1A 2ZM6L 3S16H 1SRUA 3A74A 5FLMH 3AEVA 3OTOQ 3RN2A 4A3EG 4UPAA 4JI6L 1KXLA 3GTGH 4JI4Q 4AQYQ 1NTGA 2F52A 3WWVA 4JI3Q 3PO2G 4B3RL 5M3FG 4BXXH 3BZCA 1N32Q 3CCJA 1HNWQ 3T1YL 5BR8Q 1AH9A 4A3EH 1EQRA 1W3SA 2ID0A 1HNXQ 5JJIA 2GVBA 4JV5L 3S2HH 4XIGS 5M3FH 3AFPA 2Q2HA 3KF8B 1VQCA 2CFMA 2K75A 1PH3A 3CCSA 1KC8C 3L0OA 4JOIC 2I5LX 1WI5A 3PCOB 3UDFA 5JJKA 1MJCA 1EIFA 3GTOH 2OTJA 2YYZA 2D0OA 3HFZB 1NJIC 2NZHA 3I4NG 4P74A 1YEZA 4DPGA 4YCWA 1L1OB 3JAMi 1A62A 3CC2A 4DK3C 1KQSA 4C3JH 2I0QA 4X64L 2E2JH 4DV7Q 1XPUA 3I4NH 1EYGA 1I6HH 1UEBA 3E0EA 1K8AC 4HIMA 3HOZG 5FJ8G 2EIFA 1PA6A 3CCUA 1T9HA 3F2CA 3FKIH 3GTLH 1BVSA 3H0GH 5GROA 2QA4A 5IE8A 1SMXA 2AMCB 3BU2A 1PH7A 2MQHA 4DV1L 4B3ML 2VY3A 3HOZH 5FJ8H 1VQ9A 3K80C 1OXSC 5IWAL 5C0XJ 3KJPA 4Y52H 1P16A 3J81i 3U4VA 1X3EA 4P73A 2FXQA 3J80i 5FLXc 2YV5A 4JBMA 4OX9Q 2B63G 3M7NA 3CC7A 1I5FA 1IBKL 1WJJA 2ATWA 4LF6L 1XMOQ 1J6QA 1NMFA 1H95A 2VQFQ 2XGTA 2VZAA 2UUCL 5IP7G 2B63H 3K7UC 5C0XI 4LF5Q 4POGA 1EWIA 3L7ZC 4DV0Q 2NVTH 2WAQG 1K3RA 2E2IH 1S3OA 2RHQB 5M5XH 4A3CG 1D8LA 4LF4Q 4R4TA 5IP7H 4DR1L 4R4IA 4P72A 3ERSX 4TQUS 2MNAA 1QVFA 1IL2A 3F2DA 4HIOA 1E7ZA 2KCMA 4A3CH 5LMNW 3CW2C 4A4IA 4DR2Q 1FGUA 3ER0A 3GDEA 4EX5A 1PH8A 4X65Q 2YTVA 4PZ8A 2R92G 5LMNQ 4DUYQ 4BA2I 1I3QH 2PQAB 3CMAA 4LFAL 1XNRQ 3GTJH 1WCMH 2N3SA 4HJ8A 3TRZA 4AYBE 1O7IA 1YHAA 1HZ9A 1N36L 1J5EQ 2R92H 1Q82C 4JI3L 4LF8L 4IFDJ 3TREA 4DR6L 2JQOA 1V9PA 2F4VL 1HNWL 2BH8A 2XTIA 3M4QA 3K7AH 3A5ZB 1QVGA 3F8TA 2AWOA 2WB1G 2E2HH 1A0IA 3KDFB 4IPHA 4UY8C 5M3MH 2R7FA 4BY1G 4DV6Q 2VW9A 4DR4Q 3HOXG 3G71A 1VQ7A 4A3IH 3S1NH 3PUZA 4A3FG 1KRSA 2UU9L 3K81C 4JI1L 4YCVA 3RNUA 1VQKA 1CKNB 1XNQL 3T1HL 3RZDH 1YJ9A 3PUXA 1MJEA 2C35B 4R4QA 1IBML 1YNXA 1VS0A 4ME3A 4APVA 3HOXH 1PH2A 2UXBQ 4K0KL 1D7QA 4A3FH 4GLAC 1YITA 1HZBA 3TQYA 2WFWA 4GNXB 3I4OA 1B70B 2E5LL 2NN6G 3MEFA 4JI7L 4JI2Q 2VNUD 3M3YH 1HH2P 4DAYB 1K83H 1LYLA 4JYAQ 1G6PA 2CKZB 3RZOH 1VQPA 4JI0L 3GD7A 4WJ4A 1CSQA 1VQLA 4R4OA 3CPFA 2NVQH 1B7YB 1PHJA 1SE8A 1SROA 1VQ4A 2IHFA 3SGIA 4DV2L 4LFCQ 4GKJL 2NVYH 1V1QA 4KLKA 2HQLA 1BBUA 3HKZE 5C3EG 4X62L 2UUBQ 4LFBL 1CKMA 2R7ZH 2OTLA 4DR5L 2UXCL 3K8AA 1MIUA 3J7A5 1K0RA 1VQAA 4LW1A 3IRBA 2K14A 4PG3A 5C3EH 4YCUA 4YWKA 1JB7A 4YY3L 2K5HA 1UE1A 3KYHC 2Y0SG 4QIWE 4A3MG 2OWOA 5LMUL 3PO2H 1TWFH 4MZ9A 1QZHA 4DV4L 4H02A 1WOCA 2Z6KA 1JE5A 2MO1A 2KBNA 1XMQQ 3M9BA 2QEXA 4GNXC 3STBD 4A3MH 4DV3Q 4GOPA 4DR3L 2KHIA 2VUMG 4NXMQ 2JJQA 2N8NA 1IYJB 2ZJQA 4DUYL 3HOUG 1NE3A 3HOWG 4A76A 4BY7G 2L15A 5JEAJ 1U5KA 3S1MH 4QQBX 4DK6C 2A8VA 2PI2A 5C4XG 1N34L 2VUMH 1AE3A 4LUZA 1SR3A 4JG2A 5DLQE 4X66Q 3KJOA 3HOUH 3HOWH 4BY7H 1UE5A 3I2ZA 2QGQA 5C4XH 1LM0A 1XPRA 4B3TQ 1A8VA 5IYDG 3K0XA 4B3SQ 3GTPH 1U0LA 2B3GA 2IX1A 1XJVA 3D0FA 1VQ5A 4GKKL 2EQSA 1QZGA 1HNZQ 2RHSB 2LXJA 2VQEL 1YJWA 4A3JG 5IYDH 1IBLL 1EIYB 1VQJA 1Q12A 4QY7A 2OQ0A 1IZ6A 4DV5L 1K73C 3S15H 4DR7Q 1IXRA 1YBYA 2CQOA 1SFOH 4AH6A 1OXVA 1YI2A 2HHHL 1Q46A 4LNQA 2KENA 2JA6G 5AJ3L 2JA7G 1G291 1V43A 3S24A 1UWVA 5C4JH 4A3JH 3PGZA 1PH4A 1I94L 4DUZL 4ALPA 3GTKH 2LXKA 4JI5Q 3NBHB 2I5MX 3PUVA 2H5XA 4MNOA 4DR5Q 4A75A 1PH9A 2JA6H 2JK8A 2JA7H 4JOIA 4OONA 3G6EA 1HR0W 4KHPQ 3U58A 1PFSA 5IY0A 1VCIA 1N33Q 1L1OC 3HKSA 2I5HA 4YHHL 4LF7L 1Q1BA 1JMCA 1HR0Q 3TS2A 1OXTA 2R6GA 5J3BA 1VQMA 3JAMc 4JI8L 4NXNQ 1FVIA 2ZM6Q 2JA9A 2CWAA 1RL2A 4A3BG 3ZJYC 2A1AA 2R93G 5C44G 3UDGA 1EOVA 4JI6Q 4C2MH 3I4MG 3CCMA 4B3RQ 3DM3A 2E8GA 2KCTA 5ELNA 1EQQA 1UE7A 2ZJRA 3PF5A 4OO1G 4QJFA 4IJHA 3I56A 1UE6A 4BA1I 5C44H 3OTOL 3T1YQ 2R93H 3JC66 3A0JA 4JI4L 4AQYL 3I4MH 1MKHA 4JV5Q 1X3GA 3J81j 2ZTEA 3J81c 1PH5A 3ICEA 1GKHA 1N32L 4HJAA 4LUOA 4A3GG 2AHOB 5BR8L 2IY5B 3J80c 1HJPA 3F1ZA 3PIOA 2Z0SA 1HNXL 2GN5A 2BH2A 3S17H 3TS0A 1PH6A 4GOPB 4BBRG 4RMFA 3ULLA 4A3DG 1NY4A 3GTQH 3H3VH 1VQGA 1OXXK 2AKWB 1JJ2A 4JBKA 3PO3G 3NEMA 1N8RC 2UXDQ 3U50C 2EXDA 3F2BA 3EBEA 2GVAA 4A3DH 3HOYG 2ZJPA 1S40A 3W5OA
chains in the Genus database with same CATH superfamily
3PO3H 3HZXA 1BO0A 4HIDA 3KFUA 2ZTCA 4FXGC 3AFQA 4EQOA 3HOYH 1Z9FA 3TEHB 2Z6BA 2D2CC 1EY8A 4DV7L 1R9TH 3QWNA 4DV1Q 5CMDA 3URYA 1FJGQ 5LHY1 3RUZA 1WTPA 1IHZA 1GUTA 2YTXA 4IUPA 1BOSA 1SMYC 4TVAB 2PO4A 2Z9HA 1YNJC 4IUVA 3T56B 1R9TB 5IYCH 3GTMH 4C1NI 4NKLA 1HA6A 2UUCQ 1STBA 2F3VA 2EY6A 3M3YB 4IN3A 3CAMA 2JN4A 2DGYA 4PZ7A 1A63A 3MEHA 1XMOL 5CYUA 1LO5D 4B9XA 1ICFB 1PYSB 4LF5L 1KD1C 2NVQB 3GTMB 1A3UA 4L5QA 4WJWA 1CUKA 1Y1VG 3PMFA 3GQBA 1O7YA 2AWNA 1QE6A 4WORA 1DGSA 2K5QA 1OXUA 4LFAQ 1DYQA 3PF4A 3T16A 3LWEA 4X3KA 4JC0A 1N36Q 1E1OA 1SNPA 5LMNL 1SE3A 3EA6A 5JJLA 1TWFB 2NZOA 3D6WA 4JCVE 1MSGA 1IW7C 4O2DA 4A93G 2IX0A 3SDZA 2JXMB 3FPPA 2B2YC 1J5EL 2Y0SB 1A3TA 1EFID 2V4DA 3J7YW 3G4SA 3T4AC 1NUCA 4IOCA 4C1NK 2CW0D 3CKIB 4LWCA 1SEBD 3TP6A 5K36G 1XWEA 2A69D 2UXDL 3CCRA 5I2XA 4K5VA 2K4KA 2F0QA 3SK4A 4K0KQ 4KY7A 2E2DC 1GO3E 3GTPB 4A3LG 1CA5A 4X3UA 3NK9A 5JEAG 2F0OA 2ZTDA 2CVRA 2KEDA 3S1QH 1B44D 3BJUA 2RSOA 3DHQA 1K28A 3ULPA 1LTID 1C0AA 2E75C 3LGJA 5CGKA 4LF9L 5ISRA 4HJ5A 3A56A 3GV3A 4JI2L 1ZYRD 1RODA 4V0BA 3TP8A 2JE6I 3VYTA 3OW2A 4CDEC 1HUNA 2Z4HA 5IYBH 1QUQB 3CQZH 3S1QB 1STGA 4RCOA 4R4CA 2K32A 4X62Q 4NPSA 1AZQA 3E9IA 2F3IA 4GS3A 4DR5Q 3KOJA 4AYBB 2Q2IA 3NWSA 5HGQA 1X56A 5C0XH 4RA8A 2UUBL 3SK6A 1EYDA 1WTRA 1ZXTA 2PZTA 3NTHA 1B9MA 1PTOC 1SYDA 3RLOA 2NWGA 1CFMA 1BXTA 1TXYA 3H3VI 5A35A 5C44B 3J7ZC 4X6AH 3KF8A 2JEAI 4J15A 4A3GH 3IKJA 1IL8A 2HDLA 2NB0A 2JA5H 1Q8IA 1QNUA 3J80L 3X3NA 4I7AA 2JEBI 1E1TA 1M90C 4A3GB 4G7HC 2PW5A 4ZCKA 4A3DB 2K33A 2SDFA 5M5WH 4GKKQ 4IUQA 1KDBA 4UDUC 2CWPA 1EY9A 4OIKA 2K5NA 2PCFB 3E9HA 2JA8G 1M1KC 1VQ6A 3L2PA 1VQ5A 1X55A 2A68C 4DR7L 1S72A 4UP9A 4RGNA 3CPWA 4A3KH 3KF6B 1JJCB 1SYBA 3UDIA 3PIPA 1CHQD 2R7DA 4YHHQ 2EXZA 4JI5L 3UDXA 1GUSA 4KHPL 4JI8Q 5T1GA 1PLFA 5GAHC 2QILA 5FLMG 4IZ8A 2F0UA 4FXKC 2ZM6L 3OTOQ 3RN2A 2YU9B 4AQYQ 1DOMA 1NTGA 3WWVA 1CQFA 1SNCA 2BDOA 1HA5A 1AH9A 1E0BA 1Y1VB 2GVBA 5M3FH 1JOQA 3OMCA 2TMPA 3H09A 4RGMA 5EKKA 3CCSA 1KC8C 2OTJA 2YYZA 2EZVA 3I4NG 1UAPA 1RDPD 4DPGA 4A93B 1KQSA 1SNMA 1EYGA 1UEBA 2PYKA 3P20A 1F9PA 2EIFA 1PA6A 5IE8A 4K5XA 2AMCB 3DWQA 1PH7A 1PZJD 2MQHA 4DV1L 3K80C 1OXSC 4TSSA 4LAAA 3ZYYX 5IWAL 5C0XJ 5M9OA 4F88A 4DN4M 4ZQ3A 5E1FA 3K5OA 3U4VA 1ESRA 2FXQA 5FLXc 4OX9Q 2B63G 4XYQA 3M7NA 1B9NA 1I5FA 3FDTA 2J7ZA 1U9RA 1MSHA 4Q5VA 4WRDA 1NMFA 4MTKA 2XGTA 2UUCL 3MWYW 3D4DA 4DV0Q 1K3BC 5M5XH 3D3RA 2L11A 1D8LA 3WDNA 3A7LA 5EGTA 2EJGC 2Z8LA 3BVGA 1F77A 1QVFA 2F0HA 2F0KA 5LMNW 4A4IA 4DR2Q 1KABA 3GDEA 3EQLC 5M5XB 4H0LC 4PZ8A 2XN9C 3TSSA 4LFAL 2XIWA 3MC0B 4HJ8A 2MJ8A 4AYBE 1YHAA 1N36L 3SVMA 4JI3L 3NQTA 5I2YA 1C4QA 1AFPA 2OXPA 1A0IA 2FFKB 2FMMA 4HN7A 4BY1G 2VW9A 4DR4Q 3S1NH 2L12A 3K81C 3T53B 3RNUA 3RZDH 1YJ9A 3PUXA 2C35B 4IUTA 1QCBD 4R4QA 1VS0A 4ME3A 3BG3A 2UXBQ 4K0KL 4A3FH 1YITA 1HZBA 2F03A 1B70B 1D5MC 1WTVA 3MEFA 2VNUD 3D8GA 3RZDB 1MHWC 3K5NA 1LYLA 1EWHA 2K7VA 4KN7C 4NMZA 2XRSD 2JA8B 3RZOH 4WJ4A 1CSQA 4K8JA 2N88A 1B7YB 1SROA 5BN3A 5KYIA 1VQ4A 1HPCA 4LFCQ 4CJ1B 4LJZC 2ZT9C 4X62L 1CKMA 2OTLA 4DR5L 1JORA 2BE5C 2L4NA 1U4RA 1KDCA 3IRBA 2K14A 1EY4A 4OGQC 4YCUA 1I6VC 1QILA 3S16B 4C56C 1WOCA 4O1NA 4DV3Q 4GOPA 2VUMG 4NXMQ 2JJQA 2N8NA 2XWBB 3VR5A 4DUYL 3HOUG 4ZK9B 5JEAJ 4KK7A 4XT1B 3S1MH 2R3ZA 4LUZA 1SR3A 5DLQE 3HOWH 4BY7H 2QGQA 4J6HA 1LM0A 5I9PA 4B3TQ 1A8VA 3K0XA 4QUCA 4B08A 4B3SQ 1JWSD 3S1MB 2F0LA 5CBEE 1XJVA 5COYA 4GKKL 3I4NB 2RHSB 3DXJC 1U4PA 4QY7A 3S15H 4X3SA 5ELEA 4K2KA 4AH6A 1OXVA 2KA7A 1Q46A 2KENA 2JA6G 1G291 1V43A 3NP8A 3S24A 1EEFD 2EDGA 4XDXA 4ALPA 1ML0D 2WKCA 2I5MX 2H5XA 4JK1C 2JK8A 4HMIA 4JOIA 4ZUIA 1WTWA 2JA7H 3OOCA 3RD4A 1VCIA 1D2BA 1L1OC 3HKSA 2I5HA 4YHHL 2HCCA 4ZAIA 4MIUA 3MFGA 5J3BA 1STNA 4JI8L 5KNCA 1G91A 1ILPA 2A1AA 2QKIC 2R93G 2E2IB 2JA7B 3F2UA 4C2MH 4JI6Q 2EYJA 3DM3A 1A6XA 4OO1G 1HFNA 3OTOL 3NWTA 4RCNA 4AQYL 4I7ZC 4KJOA 4UHVA 3J81j 3VR2A 1PH5A 1GKHA 4OHJA 2WINB 2AHOB 1I3QB 3PIOA 1HJPA 5LL6X 3J80E 3TS0A 2E76C 1NY4A 1KDAA 4M8AA 1OXXK 3T51B 2PZWA 3H3VH 3J7AF 1N8RC 3PO3G 2UXDQ 4HEDA 1BCPC 4HMJA 3EBEA 2MUYA 3HOYG 2ZJPA 1RD9D 4PV1C 4BY1H 3CF5A 2DUDA 3D31A 3RN5A 1Q86C 1PVOA 2F0WA 4B3MQ 3EROA 4LF9Q 5IIFA 1YNNC 4BY1B 5IYCG 5EAYA 1RCVD 1TWCH 1GD7A 3NENA 3A5UA 2RA4A 4OX9L 2LFNA 2VXWA 1CSPA 1QUQA 2A5HA 1SYGA 3R2TA 2A6HC 1PTOF 1PDQA 1ZKOA 4DV0L 4DR1Q 4WFN3 1CT1D 4DAMA 1EYAA 1STEA 2NVYB 3R2IA 3L3OC 2BA0A 4FNFA 1IKLA 4O42A 4DR2L 1A2UA 1HQMC 3ERQA 1CI3M 4IO9A 4DNTB 2F1MA 1Z47A 2F0SA 3KLWA 4LF8Q 3EN2A 3FPUB 5BN4A 2F4VQ 1SJED 4Y7NH 3OYYA 1Z7TA 2B2VA 1LABA 1SDFA 1JB3A 3C1FA 4HJ7A 5CBAE 1Y1WH 4Z9CB 4DA2A 1QVCA 1RHPA 5KIXA 3FHWA 2VUMB 1C9OA 1S4ZA 3I55A 4OWWB 1HHVA 4HTHA 4JI1Q 1LTGD 3CC4A 3HOUB 1XNQQ 3T1HQ 3MVVA 3E5SA 2B29A 4GN4B 4DR4L 3FKIG 3H0GG 1A3VA 1NR2A 1SJHD 2M2LA 1LT5D 5EBCA 4XQNA 1CKNA 3MXGA 2WP8J 2K52A 2PMZE 4AYBG 4ULLA 2UXBL 1SXTA 1TU2B 2H4OA 4GNXA 3KF6A 3RMHA 5IYBG 2JSOA 2VS1A 4FYDA 3EFXD 1SN8A 3TN2A 2I07B 2WACA 2DJFC 5G3LF 3UE0A 1HXYD 3CRLC 4K5WA 4DV2Q 5C0XG 2JA6B 4RWSC 3DUZA 4FDBA 4IPGA 3W1GA 4LFCL 1HZAA 1HZCA 3TP5A 1J9OA 2RF4A 1JCKB 1CZWA 1TS2A 3J81E 1SMYD 1WYDA 5CV9A 3CCEA 5AFWA 1WCMG 2DNEA 2JA5G 4DNIA 1Q1EA 1VQBA 2R93B 4UP7A 3CXCA 1FYCA 2NZ1D 3C3LA 1MD2D 4RKLA 4FXDA 3PV0A 4DV3L 2BDNA 3VR4A 2O5IC 4NXML 3S17B 4QGUA 4CJ2C 2ASBA 3CMEA 1Y69U 1EFWA 3SK5A 2E74C 1D6EC 2IT1A 3BDLA 1EUJA 4QMGA 5JVG3 2VB2X 3CCVA 2N78A 5IWAQ 4A3IG 3PO3B 1L0YB 1VQEA 1S5FD 2UUAL 4B3TL 2VQEQ 1GUNA 1DONA 4B3SL 1PZID 1VQ8A 3HOYB 4IFDI 4HJ9A 2Z6KC 4A3KG 1KL9A 2IHEA 5IT9c 1D5XC 5AJ3Q 4PMWA 3QR8A 4AIMA 5H1SE 1I94Q 1JOKA 4IQZA 1TT2A 4CGYB 1RIPA 4HR7B 2A19A 1ESFA 2LMCB 4JBJA 1K8GA 2F0FA 3AU7A 1JWUD 1GVPA 3AYHB 2X6LA 1CKOA 1Y8PB 3RLNA 1WD1A 4S3SA 4JI6L 5F2DA 1KXLA 4JI3Q 5JOBA 5M3FG 2F0JA 2F0PA 2B39A 1KNEA 3KLRA 4EGVA 2EY5A 2Q2HA 3SXHA 1BF4A 4CBVA 2CFMA 2K75A 1QWYA 3L0OA 5IGDA 2I5LX 5JJKA 1MJCA 3GTOH 1O7LA 1G2TA 5EKLA 1NJIC 2Z4IA 2NZHA 1GHKA 4P74A 1YEZA 4YCWA 3JAMi 1A62A 3CC2A 4DK3C 3KBGA 4C3JH 5KYLA 2E2JH 1I6HH 3CCUA 1T9HA 4U68A 3FKIH 1PTOD 3R93A 3GTLH 3H0GH 5GROA 4B3ML 2VY3A 5FJ8H 1X3EA 4P73A 4JBMA 3FKIB 2CQAA 3H0GB 2RBMA 5IGCA 3PQIA 4LF6L 1J6QA 2VQFQ 5EBDA 1LLRD 2VZAA 2XNAC 3E6ZX 4POGA 1EWIA 2EPBA 4RFBA 1K3RA 2A6EC 2RHQB 3CQZB 2EVBA 5JJZA 4LF4Q 4DR1L 5J1ZA 5A2QL 4HIOA 1PH8A 1H9SB 3ER0A 4ZLTF 2A68D 4X65Q 2YTVA 5CV8A 2A69C 1EOTA 3A7AB 4DUYQ 1RF2D 4XT3B 4KTAA 1S5ED 2K03A 1WCMH 2N3SA 1O7IA 2C5CA 5C5LA 2F0GA 5D65A 5IGBA 4LF8L 3LNNA 4KKSA 1F9QA 1HNWL 2F4VL 3M4QA 1R4PB 3F8TA 5IGEA 2WB1G 1WCMB 2JA5B 2E2HH 1STYA 1VF7A 4UY8C 2R7FA 2I46A 2PPBC 5G3LD 4ODGA 1VQ7A 2HDMA 3OMGA 4KKUA 4A3IH 4A3FG 1AW7A 4JI1L 1RKNA 1CKNB 1XNQL 4ZRZA 3T1HL 4IUNA 4RKBA 5M5WB 1YNXA 5C5MA 1D1IA 1I4XA 5FK9C 4APVA 3HOXH 1K8OA 3OPOA 1ET6A 4GNXB 3I4OA 4A3IB 1HTLD 3I73A 4DAYB 1K83H 4FF3A 5E4XA 4JYAQ 1G6PA 3MFYA 4A3KB 3GD7A 1BNZA 2MPMA 3HEJA 2L9HA 4DV2L 1V1QA 2B2TA 2HQLA 4JW0A 4R9WA 2NYZD 3QO2A 1MIUA 1H9RA 4LW1A 4PG3A 5C3EH 3BYYB 1SSOA 1JB7A 5CV7A 2CHBD 2K5HA 1EEID 2JYOA 2FMCA 1JE5A 1SE2A 2MO1A 2KBNA 3M9BA 1DOLA 2QEXA 5CV4A 3STBD 4A3MH 3W2DA 4DNRB 3Q24A 4CDFC 4G4KA 1GXDC 3HOWG 5M3FB 4BY7G 3HGBA 3VR3A 4QQBX 4DK6C 1AE3A 1FR3A 5EQ0A 4JG2A 4H44C 3WOEA 3KJOA 4JPBW 3WOFA 5C4XH 2EYPA 1CQVA 2Z1CA 5C4ZA 1WVLA 2NTSA 1PTOH 5I6YA 3DWAA 2F0NA 1U0LA 2EYLA 2IX1A 3LX0A 3ND9A 2WIIB 2VQEL 5IYDH 2AUKA 5L37A 4K6DA 2WV6D 1IZ6A 3VYSA 1SFOH 3BZDB 5I9OA 4LNQA 1NCVA 1PTOB 1BBXC 5AJ3L 2JA7G 1PH4A 5C4JH 4A3JH 1UUPA 1G2SA 1O78A 1I94L 4N8FA 2HD3A 3PUVA 1WD0A 3G6EA 2L0CA 1PFSA 5IGFA 1AN8A 1Q1BA 1HR0Q 1OXTA 1PYWD 3JAMc 2P5ZX 3C46A 4K8IA 3VA7A 1EOVA 3DEOA 5ELNA 1UE7A 2C9OA 4IJHA 3J7AV 2VB3X 3JC66 3A0JA 3I4MH 1MKHA 4JV5Q 4ZKBB 3IL8A 3MA2B 4HJAA 4LUOA 2FHTA 4DK1A 3F1ZA 2L5TA 3GTQH 4JBKA 1JJ2A 2EXDA 5J39A 1S40A 2YTYA 1Y8OB 4X64Q 2F4IA 3DM1A 2BE5D 1VQIA 2MHVA 1XTDA 1CK1A 4G57A 3GTQB 1LTLA 2OCEA 1EIGA 3V96A 1FGBD 1W6KA 2BA1A 2K04A 1S5BD 2WB1B 3DLLA 1N9WA 1EL0A 3S1NB 4HIKA 1LV9A 1JJGA 1VMCA 4K14A 3HOVH 3S1RH 2NN6I 2RDHA 4FVMA 4A3FB 1PFMA 4IFDH 2MP1A 1CA6A 1XXGA 1CZGA 5DEHA 1TWGH 3FP9A 1TWAH 5EPJA 4YWLA 2XVSA 1XPOA 1U4MA 4LMQD 2VQFL 4QF4A 3RZOB 1B8AA 1GJXA 1JICA 2NBFA 1KHIA 2ICEC 2R61A 1WTHA 1TWGB 4RH6A 1QOHA 4KHZA 4P75A 4LF4L 1FL0A 3K59A 1SNDA 4YIJA 3NSWA 4OXPA 2GA4B 2G9HD 3G6JB 4X65L 1A2TA 3W3AA 1FNUA 3FVQA 5CV5A 2PQAA 4KY5A 3CP0A 4NB3A 1AZPA 2KEEA 1FNVA 3AB9A 3IFDA 1Y1WG 2PMZB 3BZKA 2D0PA 2KHJA 3NQIA 3OWFA 2AQ1B 2B2WA 3X3MA 3NTIA 3ULJA 4ZYSA 1O7ZA 4L5TA 4FF2A 2UUAQ 1JWMD 1YVCA 2OQKA 1X3FA 4EQPA 5FO8B 4CJ0B 3Q8DA 2UU9Q 4GLVB 3KDFA 4H13C 4N9PA 3M85A 3HOWB 3N6RA 3BDCA 2MFIA 4BY7B 3CCQA 4BBSH 1B2TA 4KI0A 2PZUA 2PW7A 4DAPA 3MXNB 2RKSA 2NTTA 1EY0A 3H91A 3CU7A 4ID6A 2E5LQ 2ALYB 2IX3A 2Q2TA 3VDYA 3S14H 4IJLA 3V05A 5BN5A 4DKAC 3S15B 3M7GA 4HCSA 2RSNA 5IP9H 1G51A 5FLXL 1IYUA 2D62A 3BS1A 1VQNA 1HRJA 4JYAL 1NMGA 3OIPA 3OIQA 2AQ2B 1KNAA 4FF4A 1HFGA 2J0TD 5GADC 4LFBQ 4RGOS 1B1ZA 5GQOA 4ME5A 3FRPB 5A2QE 1WFQA 1ASZA 2G5DA 1XX8A 2UXCQ 4UP8A 3VA5A 5ELDA 1B4OA 1Q8KA 2IL8A 1Z6HA 3JAML 1NBWA 1YNND 2M00A 4DV4Q 3NELA 4C2MB 1XTCD 1W6JA 4PZ6A 5I4DA 3RLFA 1E2WA 4BS9A 1F2ZA 5ELBA 1PZKD 1F2LA 4XTCS 1LTSD 4ILWA 1TWHH 3U4ZA 1EY5A 5J22A 4P2CB 4YWMA 5NUCA 4ZKCB 2SEBD 5ELOA 2DJGC 3B6YA 1G8ZD 5M3MG 1VQHA 1EU4A 3A8IE 4IPCA 4POFA 2VL6A 2CH4W 1NSNS 2ENBA 2HIVA 3AQQA 2RCNA 4GN5A 1R4QB 5C4HA 2NVXH 1IBLQ 1V8QA 5DM73 1F2MA 2HHHQ 1VMPA 4RAUC 2MO0A 3BVMA 4LF6Q 4LK1C 5JPMC 2PI2E 3HRZC 1QG7A 3W1BA 3UE1A 4DUZQ 3TMEA 4DXGA 4GOPC 4K2LA 3SHLA 1X32A 2B2UA 4L5SA 1H9MA 2NVXB 1VQDA 2HIXA 1TWCB 1PRTC 4H7BA 1FD7D 2WB1E 2PNHA 1J8IA 4LF7Q 5D14A 1ZEQX 3NE5B 1BDOA 4QL5A 1HTPA 4O0AA 3PIP3 2QDLA 5E7NA 1HR0L 2R7ZG 2ES2A 1B3QA 3ONAB 1H9SA 3Q6SA 3AEVA 3GTGH 1IYVA 1TVXA 4OL7A 5EPLA 3BZCA 1N32Q 5FO7B 3CCJA 1HNWQ 2HUGA 4A3EH 1HNXQ 5JJIA 1B50A 3HS0C 3MAQA 4JV5L 3S2HH 4XIGS 3A54A 3GTGB 3H94A 3A8JE 4JOIC 2HQEA 2L55A 5T1IA 4C3JG 1EIFA 4Y7NB 1B3AA 3Q23A 3S2HB 1L1OB 2J4XA 2RQXA 1Y1WB 4HSVA 4X64L 4L6TB 2X6GA 5FJ8G 3SEBA 1PFBA 1BVSA 2X69A 2QA4A 2O4XA 4FF1A 4KV6A 3HOZH 1VQ9A 3QIAA 3J81i 4DAYA 3E0JA 1DCZA 3QB3A 4PNYA 1IKMA 5C3WA 4DFAA 2B2YA 2KECA 2LKVA 3K7UC 3L7ZC 2AQ3B 2SNMA 1S3OA 1B53A 1ENFA 2A74C 4DGZA 5IP7H 1UNSA 1EIHA 2K6AA 1CHPD 1TIID 3ERSX 4P72A 4R4IA 2MNAA 5DAUA 1JC7A 4A3CH 1V1PB 1X3QA 1FGUA 1YNJD 4EX5A 3SR1A 2B8FA 1MI2A 4BA2I 4XQJA 2KCCA 2PQAB 3A55A 3M4YA 3CMAA 1VDZA 5DM63 3GTJH 1XNRQ 2FINB 3TRZA 2L1BA 3R3OA 2R92H 2JQOA 2BH8A 1RTNA 2XTIA 2AWOA 1AP0A 1TS4A 3KDFB 3I3CA 4IPHA 1SNOA 5M3MH 1CTMA 4DV6Q 1STHA 2PNRC 3K0YA 1QJOA 3HOXG 2UU9L 2F0MA 2O5JC 4YCVA 1VQKA 4NW2A 1MJEA 1IW7D 2F0IA 3C2PA 3K5MA 1D7QA 5M3MB 4GLAC 1M4VA 2E5LL 1F9RA 1PFNA 2EYHA 3NXWA 3M3YH 5EJWA 1HH2P 2K01A 2B2VC 2EY2A 2NN6H 1GOZA 5LL6S 4DU9A 1LT4D 2RCFA 2NVQH 1PHJA 1SE8A 1QB5D 4KLKA 3TDQA 5KEEA 1BBUA 5C3EG 4LFBL 5JPNC 2R7ZH 2UXCL 1U4LA 3K8AA 3J7A5 1K0RA 1VQAA 3E3XA 4YWKA 3EVQA 2K05A 3KYHC 4QIWE 4A3MG 3KK7A 1TWFH 4MZ9A 2PQEA 4DV4L 1QZHA 2R7ZB 1XMQQ 4B9WA 4GNXC 5E3FA 5EPKA 2KHIA 2ZJQA 1NE3A 3CHBD 1SE4A 4A76A 1SBBB 2L15A 1X3PA 4J1MA 1U5KA 5C4XG 2PI2A 2A6ED 2TSSA 3EJIA 4R8NA 4X66Q 5KGUA 4XXEA 3GTOB 4IUUA 5IYDG 2IJ0A 4G7OC 4CKEA 1T5XD 5D3DA 1STAA 3GTPH 4C3JB 3A8KE 2E2JB 3D0FA 1I6HB 1HNZQ 2LXJA 1YJWA 4C3IG 4A3JG 1IBLL 4PMBA 1VQJA 3S9WA 2F3WA 4PQXA 1K73C 3GTLB 1ONLA 2CQOA 4J8QA 5FLXE 5HURA 2HHHL 1UWVA 2XRQD 4DUZL 3GTKH 2MGSA 2B8GA 4MNOA 2EJMA 4DXFA 4OEMB 1Q90A 1HR0W 5IOCA 1N33Q 5C3XA 3D6CA 1JOOA 4N8X1 4LF7L 2CW0C 1VQMA 3OW7A 3GTKB 4NXNQ 1UEAB 3JAME 2CWAA 4A3BG 3ZJYC 3I8ZA 3I4MG 4B3RQ 1SYEA 4C3HG 2KCTA 5KNDA 3PF5A 1KLGD 3I56A 2F0TA 2BOSA 3T1YQ 5C44H 4CHTB 5CR3A 3KLSA 3Q0AA 3I70A 1LTBD 3J81c 3ICEA 1N32L 2CH4A 2IY5B 1HNXL 2BH2A 2Z0SA 2GN5A 3BVZA 1PH6A 4BBRG 1TR5A 4OIJA 3K57A 2SOBA 1ZYRC 3PIO3 3F2BA 3T13A 2GVAA 4A3DH 3W5OA 3U9SA 1I4QA 4LUVA 2E2HB 2K1BA 2WAQE 5TSSA 1VQFA 2IWHA 2OT2A 1E24A 3HKZG 3G48A 3NBIA 2CCZA 3MXNA 4K6LA 4R1JA 1K9MC 3HOVG 2DY7A 1ENAA 3PUWA 1KAWA 2ZXRA 4EQNA 4IFDG 3KBXA 4CDCC 5IT9L 4RHRA 2QCPX 3HOXB 1IBKQ 3IAYA 1LT6D 1RTOA 2EYOA 5E4WC 1I4GA 1X6OA 2N49A 3M4OH 4JBWA 1K83B 1VQOA 1C7YA 3IFTA 1AE2A 1I50H 1P8LA 2Q8TA 1DD2A 3G7LA 4KD3A 1E22A 4IPDA 2IPKD 2YU9H 1ASYA 1X54A 1OO9B 3M4OB 1JT8A 3KUPA 1GM5A 1BCPF 5GAEC 1Q7YC 1YHQA 1I50B 1NNXA 1SLJA 4BXXG 1Y1VH 2BCOA 5C3EB 1EQTA 1GUGA 2H1EA 5CV6A 3GP7A 1XNRL 2M9VA 4L5RC 4DR6Q 4V190 1KAAA 3H15A 2HCIA 2QEJC 5KRUA 1OTCA 2G9DA 4A3MB 4PMCA 1GHJA 4FP5D 1E2ZA 5ELFA 4A93H 2OEOA 3GO5A 2EY1A 1D1KA 5HGTA 1F2YA 3DWPA 1SYCA 4BBSG 4KY6A 4OWXB 2O2LD 1YJNA 1IBMQ 2F0DA 4DV6L 5C4XB 5K36H 1W2BA 4RG1A 2Q2UA 1PRTF 4GN3B 4F8MA 1TKWB 3PSIA 3OSOA 1YZ6A 3K58A 4C3IH 4XYOA 5IP9G 1HUMA 4JI7Q 2Y0SE 4KKTA 3N52A 2DN8A 3S2DH 2K50A 4IOAA 1BBWA 1SFOB 4A3LH 4JI0Q 5JEAH 1TY0A 5C4JB 1FJGL 4C3IB 3P7JA 4A3JB 1G6ZA 1PXUA 1TQOA 1YHBA 3PUYA 4GKJQ 1TS3A 2OF1A 5JVH3 4OWTB 3STBC 1S5CD 3S2DB 3LWUA 2KHSA 5GAGC 1E3PA 1RJTA 2QDBA 1DM0B 5CC4A 5IGGA 2RDFA 4EVOA 4A3BH 1M8AA 1KIXA 4QCLA 1ICWA 4YY3Q 4NDXA 4C3HH 5LMUQ 4OO1I 1X9NA 1TY2A 3EIVA 3I4LA 4P71A 3M4PA 5EKIA 2EYFA 3O13A 4A3BB 4DR3Q 2LSSA 1FNWA 1II3A 3NTKA 3I4MB 3MXPA 4C3HB 1L2FA 1YIJA 1XMQL 4HAEA 1WTQA 4ABNA 1BKBA 4QUFA 4BBRH 3J81L 1N34Q 3K6OA 2N55A 3QOJA 5FOBB 1L1OA 3CRKC 1PYBA 2B2TC 1EQVA 2EJFC 4X66L 2QF7A 4BBRB 1XYIA 4GLXA 3QOLA 1KLUD 4F87A 4MTNA 4XQQA 1KRTA 4QB4A 2K5WA 5M5YH 2HT1A 1Y14B 1EU3A 2V1CC 1LUZA 4EQ5A 4DV5Q 5FKAC 2LS01 3CD6A 1V1OA 1Q81C 4KN4C 1HNZL 2D9UA 3RR5A 5JAVA 3HKZB 4M1UB 5HY6A 2JA8H 4CKCA 5M5YB 4WJ3M 1JR0D 3HOVB 3S1RB 5D3IB 1EY7A 1L0WA 1PMRA 3U9OA 2K5VA 1A15A 3I7FA 1PV4A 3NBHA 3CCLA 4CDDC 1Y8NB 1TWAB 1N33L 1TS5A 3H3VC 5CORA 1X65A 4NXNL 1L0XB 1PH1A 1V1PA 2ICIA 3S16H 1SRUA 3A74A 5FLMH 4A3EG 4UPAA 3D4WA 4JI4Q 5FO9B 2F52A 3TZUA 3PO2G 4B3RL 4BXXH 1LTTD 1O80A 5BR8Q 3T1YL 1EQRA 1W3SA 2ID0A 3QJYA 1ET9A 3AFPA 3P75A 3KF8B 1VQCA 1PH3A 5C6AA 4BWGB 4OELB 1D5ZC 3NPPA 1WI5A 3PCOB 3UDFA 3MZ5A 4HSPA 2D0OA 1I4HA 3HFZB 2LY7A 5I6WA 4TKOB 1DXMA 3H6MA 2KUMA 2I0QA 3SE0A 4DV7Q 1XPUA 3I4NH 4RHSA 3E0EA 1K8AC 1F9SA 4NP5A 4HIMA 3HOZG 1MBYA 3F2CA 4BBSB 1SMXA 2KQ3A 3BU2A 4N9TA 2ZXPA 3MXUA 3KJPA 4Y52H 1P16A 1EZ8A 1BCPD 1EY6A 4DF7A 1K0SA 1S5DD 3J80i 2YV5A 3S14B 3CC7A 1IBKL 1BQQT 1WJJA 1C48A 2ATWA 3Q22A 1XMOQ 1H95A 4TRDA 3K5LA 5DNFA 5IP7G 1Q3LA 2KOLA 4MHEA 3MHBA 5C0XI 4LF5Q 2B63H 2NVTH 2WAQG 3VR6A 1E2VA 2DY8A 1GUOA 2E2IH 3ND8A 4A3CG 1ILQA 2Q8RE 4R4TA 4DAVA 1H9KA 1DZ1A 2K5DA 1IL2A 4TQUS 4FO2A 3F2DA 3QG1A 1E7ZA 2KCMA 3OWEB 2B63B 3CW2C 2NVTB 1LTRD 5ELCA 1WTXA 1GUWA 4KMUC 2R92G 4KD4A 5LMNQ 4G7ZC 1I3QH 1QNKA 3I90A 1I4PA 2FJ2A 3BDOA 1HZ9A 1NR4A 1PRTD 2A6HD 1J5EQ 1Q82C 2KVMA 4IFDJ 3C1EA 3TREA 4DR6L 3ITPA 1TWHB 1EZ6A 1V9PA 3TP7A 3K7AH 3A5ZB 1QVGA 2DNCA 2F0EA 2A73B 4R8IA 1HQRD 4UAIA 3G71A 3PUZA 3K7AB 1KRSA 4F7XA 1NAPA 1IBML 5IT9E 2NUCA 1PH2A 3TQYA 2WFWA 4KHVA 1SNQA 4X3TA 4L63B 2NN6G 4JI7L 4JI2Q 4QIWB 1KTKA 4JVZA 1LTAD 2RDGA 2B2WC 3KLSX 4GZYC 2CKZB 2JP1A 1VF5C 1VQPA 4JI0L 2KJXA 1VQLA 4R4OA 3CPFA 4DK0A 4KJNA 3HG9A 2IHFA 3SGIA 4GKJL 2NVYH 3HP3A 1BR9A 4HCEA 3HKZE 2UUBQ 4RGTA 3UI2A 2EOTA 1EYCA 1K8MA 3VYUA 3D4RA 3R8BA 4YY3L 1UE1A 2Y0SG 2OWOA 3PO2H 5LMUL 1BUVT 4H02A 2Z6KA 1C8CA 3OHXC 1SAPA 2QW7A 3I91A 2D5DA 4DR3L 4A3EB 1DJRD 5IODA 1IYJB 2ZXOA 2KCNA 1EWCA 3NHHA 3PO2B 2SNSA 2XWJB 3V2TA 2A8VA 4IALA 1N34L 2VUMH 3HOUH 4MN3A 5KNBA 1UE5A 3I2ZA 1XPRA 3TZDA 2XSCA 2Q8IB 2EYMA 2B3GA 2EQSA 1QZGA 4CKBA 1JQYD 1AEXA 1EIYB 5K5PA 1Q12A 4DR7Q 1I4RA 2OQ0A 4DV5L 1IXRA 1YBYA 1ENCA 1YI2A 3FEWX 3HOZB 1HCZA 2AUJD 3PGZA 1SYFA 2LXKA 4JI5Q 3NBHB 4A75A 2EE1A 1BCPB 4E6IA 1PH9A 2JA6H 4KHPQ 4OONA 3U58A 5IY0A 2IW3A 1JMCA 2F0VA 3AMUA 3TS2A 2R6GA 3P1HA 4L8JA 4ZUJA 1FVIA 2ZM6Q 2JA9A 3DMUA 1RL2A 3I72A 5C44G 3UDGA 1H9JA 2K28A 3BYTB 3CCMA 2E8GA 1EQQA 2ZJRA 3FMCA 4QJFA 2WAQB 1UE6A 4BA1I 2R93H 1LT3D 3DEPA 4JI4L 1X3GA 2ZTEA 2WKDA 4OO1H 2B2UC 4A3GG 5BR8L 4U673 3VYRA 3J80c 3S17H 1MGSA 3GTJB 4I65A 4Q0FA 4GOPB 2RVLA 3NUCA 4IURA 3GV6A 4RMFA 3ULLA 1WTOA 4A3DG 1VQGA 2AKWB 2R92B 1CM9A 1T5EA 3MTSA 3NEMA 1PRTB 3U50C 1DOKA 1JE4A 3SK8A 1LACA 3L9AX 3TBIB
chains in the Genus database with same CATH topology
2YTYA 4X64Q 3PO3H 4HIDA 1VQIA 4LUVA 3KFUA 1XTDA 4BY1H 2WAQE 2ZTCA 1VQFA 1LTLA 2OCEA 3HKZG 1E24A 3CF5A 3AFQA 2DUDA 3HOYH 3D31A 2BA1A 3G48A 2CCZA 1Z9FA 3TEHB 3DLLA 4R1JA 4DV7L 3RN5A 1Q86C 1R9TH 1K9MC 1N9WA 3HOVG 1PVOA 3PUWA 4DV1Q 1KAWA 4B3MQ 4HIKA 4IFDG 4LF9Q 1JJGA 1FJGQ 5IYCG 3HOVH 5EAYA 1TWCH 2YTXA 3S1RH 2NN6I 1IBKQ 4TVAB 1GD7A 3NENA 3A5UA 5IYCH 3GTMH 1TWGH 3FP9A 4OX9L 2UUCQ 1X6OA 1CSPA 2N49A 1QUQA 1TWAH 3CAMA 2DGYA 4JBWA 4YWLA 4PZ7A 3M4OH 1VQOA 1XPOA 1C7YA 1A63A 1XMOL 1AE2A 1I50H 2VQFL 1B8AA 1P8LA 1PYSB 4LF5L 1KD1C 1KHIA 4DV0L 4DR1Q 1E22A 4IPDA 4DAMA 2YU9H 4KHZA 1ASYA 1X54A 4L5QA 1CUKA 1Y1VG 4P75A 1JT8A 4LF4L 1FL0A 1GM5A 5GAEC 1Q7YC 2AWNA 2BA0A 1YHQA 1DGSA 1OXUA 1SLJA 4OXPA 4LFAQ 4BXXG 1Y1VH 4DR2L 3PF4A 4JC0A 4X65L 1N36Q 1E1OA 4IO9A 5LMNL 5JJLA 1Z47A 3KLWA 2NZOA 4LF8Q 1XNRL 4L5RC 3EN2A 2PQAA 4JCVE 3CP0A 4NB3A 2IX0A 4O2DA 4DR6Q 4A93G 2F4VQ 4Y7NH 1Y1WG 3BZKA 3H15A 1J5EL 2D0PA 1OTCA 2KHJA 3OYYA 3G4SA 3ULJA 4A93H 4L5TA 3GO5A 4IOCA 4HJ7A 2UUAQ 1YVCA 2OQKA 4LWCA 1Y1WH 1X3FA 1QVCA 4BBSG 3FHWA 5K36G 4OWXB 1YJNA 1C9OA 3Q8DA 3I55A 4GLVB 3KDFA 2UU9Q 4JI1Q 3CC4A 3M85A 4OWWB 3CCRA 1XNQQ 2UXDL 3T1HQ 1IBMQ 2MFIA 4DV6L 3CCQA 2K4KA 2B29A 4GN4B 4BBSH 1W2BA 4RG1A 4KI0A 2Q2UA 3FKIG 4GN3B 4DR4L 4K0KQ 3H0GG 3MXNB 3PSIA 1GO3E 1YZ6A 1CKNA 4C3IH 5IP9G 2E5LQ 2ALYB 2WP8J 4A3LG 2K52A 2PMZE 4AYBG 2Q2TA 5JEAG 4JI7Q 3VDYA 2Y0SE 2ZTDA 3S14H 3S1QH 2UXBL 4IJLA 3S2DH 3BJUA 2K50A 4DKAC 4GNXA 3KF6A 3ULPA 5IP9H 4IOAA 1BBWA 1C0AA 5IYBG 1G51A 4A3LH 2VS1A 3LGJA 4JI0Q 4LF9L 1SN8A 4JI2L 4HJ5A 1FJGL 2D62A 2JE6I 3UE0A 1VQNA 1YHBA 3OW2A 3PUYA 4GKJQ 4DV2Q 4JYAL 5IYBH 1QUQB 3CQZH 1NMGA 4OWTB 3STBC 4R4CA 5C0XG 4X62Q 5GADC 4NPSA 4LFBQ 5GQOA 5GAGC 3E9IA 2F3IA 4GS3A 4FDBA 3KOJA 4IPGA 1E3PA 1WFQA 2Q2IA 4LFCL 1HZAA 3W1GA 1ASZA 2UXCQ 5HGQA 4A3BH 1HZCA 4UP8A 1X56A 1KIXA 2RF4A 2UUBL 1Q8KA 4YY3Q 1NBWA 4C3HH 5LMUQ 4OO1I 1X9NA 4DV4Q 3NELA 3EIVA 4P71A 4PZ6A 3M4PA 3RLFA 3RLOA 1WYDA 3CCEA 1TXYA 1WCMG 3H3VI 2JA5G 4DNIA 1Q1EA 1VQBA 2LSSA 4XTCS 3J7ZC 4DR3Q 4UP7A 2JEAI 4X6AH 3CXCA 1TWHH 4J15A 4A3GH 1XMQL 1L2FA 1YIJA 3U4ZA 1BKBA 3PV0A 4BBRH 4DV3L 2JA5H 1N34Q 4NXML 4YWMA 4QGUA 2ASBA 3CMEA 1EFWA 1L1OA 2JEBI 5ELOA 1E1TA 3B6YA 1M90C 1PYBA 2IT1A 5M3MG 1VQHA 1EUJA 4IPCA 4X66L 2VL6A 4POFA 4GLXA 3CCVA 2N78A 2HIVA 3AQQA 2RCNA 4GN5A 4MTNA 1VQEA 5M5WH 5IWAQ 4A3IG 2UUAL 4GKKQ 1KRTA 4B3TL 2CWPA 2VQEQ 5M5YH 2NVXH 1IBLQ 2HT1A 1Y14B 4B3SL 2K5NA 2V1CC 1LUZA 4EQ5A 4DV5Q 1VQ8A 3E9HA 4IFDI 2JA8G 2HHHQ 3CD6A 1M1KC 2MO0A 4HJ9A 2Z6KC 1VQ6A 3L2PA 1KL9A 2IHEA 5IT9c 1X55A 5AJ3Q 4A3KG 1Q81C 4PMWA 2PI2E 1HNZL 4LF6Q 3RR5A 5H1SE 3W1BA 4AIMA 1I94Q 3UE1A 4DUZQ 4DR7L 4GOPC 5HY6A 1S72A 2JA8H 4L5SA 4UP9A 4WJ3M 1VQDA 1RIPA 2HIXA 3CPWA 2A19A 4A3KH 3KF6B 4JBJA 1K8GA 1JJCB 3UDIA 1L0WA 3PIPA 2PNHA 2R7DA 2WB1E 2K5VA 4LF7Q 1GVPA 4JI5L 3UDXA 3I7FA 4YHHQ 1PV4A 3CCLA 3AYHB 4KHPL 4JI8Q 5GAHC 1CKOA 1N33L 4QL5A 4O0AA 5FLMG 5E7NA 1HR0L 1X65A 2R7ZG 2ES2A 4NXNL 3RLNA 1PH1A 2ZM6L 3S16H 1SRUA 3A74A 5FLMH 3AEVA 3OTOQ 3RN2A 4A3EG 4UPAA 4JI6L 1KXLA 3GTGH 4JI4Q 4AQYQ 1NTGA 2F52A 3WWVA 4JI3Q 3PO2G 4B3RL 5M3FG 4BXXH 3BZCA 1N32Q 3CCJA 1HNWQ 3T1YL 5BR8Q 1AH9A 4A3EH 1EQRA 1W3SA 2ID0A 1HNXQ 5JJIA 2GVBA 4JV5L 3S2HH 4XIGS 5M3FH 3AFPA 2Q2HA 3KF8B 1VQCA 2CFMA 2K75A 1PH3A 3CCSA 1KC8C 3L0OA 4JOIC 2I5LX 1WI5A 3PCOB 3UDFA 5JJKA 1MJCA 1EIFA 3GTOH 2OTJA 2YYZA 2D0OA 3HFZB 1NJIC 2NZHA 3I4NG 4P74A 1YEZA 4DPGA 4YCWA 1L1OB 3JAMi 1A62A 3CC2A 4DK3C 1KQSA 4C3JH 2I0QA 4X64L 2E2JH 4DV7Q 1XPUA 3I4NH 1EYGA 1I6HH 1UEBA 3E0EA 1K8AC 4HIMA 3HOZG 5FJ8G 2EIFA 1PA6A 3CCUA 1T9HA 3F2CA 3FKIH 3GTLH 1BVSA 3H0GH 5GROA 2QA4A 5IE8A 1SMXA 2AMCB 3BU2A 1PH7A 2MQHA 4DV1L 4B3ML 2VY3A 3HOZH 5FJ8H 1VQ9A 3K80C 1OXSC 5IWAL 5C0XJ 3KJPA 4Y52H 1P16A 3J81i 3U4VA 1X3EA 4P73A 2FXQA 3J80i 5FLXc 2YV5A 4JBMA 4OX9Q 2B63G 3M7NA 3CC7A 1I5FA 1IBKL 1WJJA 2ATWA 4LF6L 1XMOQ 1J6QA 1NMFA 1H95A 2VQFQ 2XGTA 2VZAA 2UUCL 5IP7G 2B63H 3K7UC 5C0XI 4LF5Q 4POGA 1EWIA 3L7ZC 4DV0Q 2NVTH 2WAQG 1K3RA 2E2IH 1S3OA 2RHQB 5M5XH 4A3CG 1D8LA 4LF4Q 4R4TA 5IP7H 4DR1L 4R4IA 4P72A 3ERSX 4TQUS 2MNAA 1QVFA 1IL2A 3F2DA 4HIOA 1E7ZA 2KCMA 4A3CH 5LMNW 3CW2C 4A4IA 4DR2Q 1FGUA 3ER0A 3GDEA 4EX5A 1PH8A 4X65Q 2YTVA 4PZ8A 2R92G 5LMNQ 4DUYQ 4BA2I 1I3QH 2PQAB 3CMAA 4LFAL 1XNRQ 3GTJH 1WCMH 2N3SA 4HJ8A 3TRZA 4AYBE 1O7IA 1YHAA 1HZ9A 1N36L 1J5EQ 2R92H 1Q82C 4JI3L 4LF8L 4IFDJ 3TREA 4DR6L 2JQOA 1V9PA 2F4VL 1HNWL 2BH8A 2XTIA 3M4QA 3K7AH 3A5ZB 1QVGA 3F8TA 2AWOA 2WB1G 2E2HH 1A0IA 3KDFB 4IPHA 4UY8C 5M3MH 2R7FA 4BY1G 4DV6Q 2VW9A 4DR4Q 3HOXG 3G71A 1VQ7A 4A3IH 3S1NH 3PUZA 4A3FG 1KRSA 2UU9L 3K81C 4JI1L 4YCVA 3RNUA 1VQKA 1CKNB 1XNQL 3T1HL 3RZDH 1YJ9A 3PUXA 1MJEA 2C35B 4R4QA 1IBML 1YNXA 1VS0A 4ME3A 4APVA 3HOXH 1PH2A 2UXBQ 4K0KL 1D7QA 4A3FH 4GLAC 1YITA 1HZBA 3TQYA 2WFWA 4GNXB 3I4OA 1B70B 2E5LL 2NN6G 3MEFA 4JI7L 4JI2Q 2VNUD 3M3YH 1HH2P 4DAYB 1K83H 1LYLA 4JYAQ 1G6PA 2CKZB 3RZOH 1VQPA 4JI0L 3GD7A 4WJ4A 1CSQA 1VQLA 4R4OA 3CPFA 2NVQH 1B7YB 1PHJA 1SE8A 1SROA 1VQ4A 2IHFA 3SGIA 4DV2L 4LFCQ 4GKJL 2NVYH 1V1QA 4KLKA 2HQLA 1BBUA 3HKZE 5C3EG 4X62L 2UUBQ 4LFBL 1CKMA 2R7ZH 2OTLA 4DR5L 2UXCL 3K8AA 1MIUA 3J7A5 1K0RA 1VQAA 4LW1A 3IRBA 2K14A 4PG3A 5C3EH 4YCUA 4YWKA 1JB7A 4YY3L 2K5HA 1UE1A 3KYHC 2Y0SG 4QIWE 4A3MG 2OWOA 5LMUL 3PO2H 1TWFH 4MZ9A 1QZHA 4DV4L 4H02A 1WOCA 2Z6KA 1JE5A 2MO1A 2KBNA 1XMQQ 3M9BA 2QEXA 4GNXC 3STBD 4A3MH 4DV3Q 4GOPA 4DR3L 2KHIA 2VUMG 4NXMQ 2JJQA 2N8NA 1IYJB 2ZJQA 4DUYL 3HOUG 1NE3A 3HOWG 4A76A 4BY7G 2L15A 5JEAJ 1U5KA 3S1MH 4QQBX 4DK6C 2A8VA 2PI2A 5C4XG 1N34L 2VUMH 1AE3A 4LUZA 1SR3A 4JG2A 5DLQE 4X66Q 3KJOA 3HOUH 3HOWH 4BY7H 1UE5A 3I2ZA 2QGQA 5C4XH 1LM0A 1XPRA 4B3TQ 1A8VA 5IYDG 3K0XA 4B3SQ 3GTPH 1U0LA 2B3GA 2IX1A 1XJVA 3D0FA 1VQ5A 4GKKL 2EQSA 1QZGA 1HNZQ 2RHSB 2LXJA 2VQEL 1YJWA 4A3JG 5IYDH 1IBLL 1EIYB 1VQJA 1Q12A 4QY7A 2OQ0A 1IZ6A 4DV5L 1K73C 3S15H 4DR7Q 1IXRA 1YBYA 2CQOA 1SFOH 4AH6A 1OXVA 1YI2A 2HHHL 1Q46A 4LNQA 2KENA 2JA6G 5AJ3L 2JA7G 1G291 1V43A 3S24A 1UWVA 5C4JH 4A3JH 3PGZA 1PH4A 1I94L 4DUZL 4ALPA 3GTKH 2LXKA 4JI5Q 3NBHB 2I5MX 3PUVA 2H5XA 4MNOA 4DR5Q 4A75A 1PH9A 2JA6H 2JK8A 2JA7H 4JOIA 4OONA 3G6EA 1HR0W 4KHPQ 3U58A 1PFSA 5IY0A 1VCIA 1N33Q 1L1OC 3HKSA 2I5HA 4YHHL 4LF7L 1Q1BA 1JMCA 1HR0Q 3TS2A 1OXTA 2R6GA 5J3BA 1VQMA 3JAMc 4JI8L 4NXNQ 1FVIA 2ZM6Q 2JA9A 2CWAA 1RL2A 4A3BG 3ZJYC 2A1AA 2R93G 5C44G 3UDGA 1EOVA 4JI6Q 4C2MH 3I4MG 3CCMA 4B3RQ 3DM3A 2E8GA 2KCTA 5ELNA 1EQQA 1UE7A 2ZJRA 3PF5A 4OO1G 4QJFA 4IJHA 3I56A 1UE6A 4BA1I 5C44H 3OTOL 3T1YQ 2R93H 3JC66 3A0JA 4JI4L 4AQYL 3I4MH 1MKHA 4JV5Q 1X3GA 3J81j 2ZTEA 3J81c 1PH5A 3ICEA 1GKHA 1N32L 4HJAA 4LUOA 4A3GG 2AHOB 5BR8L 2IY5B 3J80c 1HJPA 3F1ZA 3PIOA 2Z0SA 1HNXL 2GN5A 2BH2A 3S17H 3TS0A 1PH6A 4GOPB 4BBRG 4RMFA 3ULLA 4A3DG 1NY4A 3GTQH 3H3VH 1VQGA 1OXXK 2AKWB 1JJ2A 4JBKA 3PO3G 3NEMA 1N8RC 2UXDQ 3U50C 2EXDA 3F2BA 3EBEA 2GVAA 4A3DH 3HOYG 2ZJPA 1S40A 3W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTY A;  4X64 Q;  3PO3 H;  4HID A;  1VQI A;  4LUV A;  3KFU A;  1XTD A;  4BY1 H;  2WAQ E;  2ZTC A;  1VQF A;  1LTL A;  2OCE A;  3HKZ G;  1E24 A;  3CF5 A;  3AFQ A;  2DUD A;  3HOY H;  3D31 A;  2BA1 A;  3G48 A;  2CCZ A;  1Z9F A;  3TEH B;  3DLL A;  4R1J A;  4DV7 L;  3RN5 A;  1Q86 C;  1R9T H;  1K9M C;  1N9W A;  3HOV G;  1PVO A;  3PUW A;  4DV1 Q;  1KAW A;  4B3M Q;  4HIK A;  4IFD G;  4LF9 Q;  1JJG A;  1FJG Q;  5IYC G;  3HOV H;  5EAY A;  1TWC H;  2YTX A;  3S1R H;  2NN6 I;  1IBK Q;  4TVA B;  1GD7 A;  3NEN A;  3A5U A;  5IYC H;  3GTM H;  1TWG H;  3FP9 A;  4OX9 L;  2UUC Q;  1X6O A;  1CSP A;  2N49 A;  1QUQ A;  1TWA H;  3CAM A;  2DGY A;  4JBW A;  4YWL A;  4PZ7 A;  3M4O H;  1VQO A;  1XPO A;  1C7Y A;  1A63 A;  1XMO L;  1AE2 A;  1I50 H;  2VQF L;  1B8A A;  1P8L A;  1PYS B;  4LF5 L;  1KD1 C;  1KHI A;  4DV0 L;  4DR1 Q;  1E22 A;  4IPD A;  4DAM A;  2YU9 H;  4KHZ A;  1ASY A;  1X54 A;  4L5Q A;  1CUK A;  1Y1V G;  4P75 A;  1JT8 A;  4LF4 L;  1FL0 A;  1GM5 A;  5GAE C;  1Q7Y C;  2AWN A;  2BA0 A;  1YHQ A;  1DGS A;  1OXU A;  1SLJ A;  4OXP A;  4LFA Q;  4BXX G;  1Y1V H;  4DR2 L;  3PF4 A;  4JC0 A;  4X65 L;  1N36 Q;  1E1O A;  4IO9 A;  5LMN L;  5JJL A;  1Z47 A;  3KLW A;  2NZO A;  4LF8 Q;  1XNR L;  4L5R C;  3EN2 A;  2PQA A;  4JCV E;  3CP0 A;  4NB3 A;  2IX0 A;  4O2D A;  4DR6 Q;  4A93 G;  2F4V Q;  4Y7N H;  1Y1W G;  3BZK A;  3H15 A;  1J5E L;  2D0P A;  1OTC A;  2KHJ A;  3OYY A;  3G4S A;  3ULJ A;  4A93 H;  4L5T A;  3GO5 A;  4IOC A;  4HJ7 A;  2UUA Q;  1YVC A;  2OQK A;  4LWC A;  1Y1W H;  1X3F A;  1QVC A;  4BBS G;  3FHW A;  5K36 G;  4OWX B;  1YJN A;  1C9O A;  3Q8D A;  3I55 A;  4GLV B;  3KDF A;  2UU9 Q;  4JI1 Q;  3CC4 A;  3M85 A;  4OWW B;  3CCR A;  1XNQ Q;  2UXD L;  3T1H Q;  1IBM Q;  2MFI A;  4DV6 L;  3CCQ A;  2K4K A;  2B29 A;  4GN4 B;  4BBS H;  1W2B A;  4RG1 A;  4KI0 A;  2Q2U A;  3FKI G;  4GN3 B;  4DR4 L;  4K0K Q;  3H0G G;  3MXN B;  3PSI A;  1GO3 E;  1YZ6 A;  1CKN A;  4C3I H;  5IP9 G;  2E5L Q;  2ALY B;  2WP8 J;  4A3L G;  2K52 A;  2PMZ E;  4AYB G;  2Q2T A;  5JEA G;  4JI7 Q;  3VDY A;  2Y0S E;  2ZTD A;  3S14 H;  3S1Q H;  2UXB L;  4IJL A;  3S2D H;  3BJU A;  2K50 A;  4DKA C;  4GNX A;  3KF6 A;  3ULP A;  5IP9 H;  4IOA A;  1BBW A;  1C0A A;  5IYB G;  1G51 A;  4A3L H;  2VS1 A;  3LGJ A;  4JI0 Q;  4LF9 L;  1SN8 A;  4JI2 L;  4HJ5 A;  1FJG L;  2D62 A;  2JE6 I;  3UE0 A;  1VQN A;  1YHB A;  3OW2 A;  3PUY A;  4GKJ Q;  4DV2 Q;  4JYA L;  5IYB H;  1QUQ B;  3CQZ H;  1NMG A;  4OWT B;  3STB C;  4R4C A;  5C0X G;  4X62 Q;  5GAD C;  4NPS A;  4LFB Q;  5GQO A;  5GAG C;  3E9I A;  2F3I A;  4GS3 A;  4FDB A;  3KOJ A;  4IPG A;  1E3P A;  1WFQ A;  2Q2I A;  4LFC L;  1HZA A;  3W1G A;  1ASZ A;  2UXC Q;  5HGQ A;  4A3B H;  1HZC A;  4UP8 A;  1X56 A;  1KIX A;  2RF4 A;  2UUB L;  1Q8K A;  4YY3 Q;  1NBW A;  4C3H H;  5LMU Q;  4OO1 I;  1X9N A;  4DV4 Q;  3NEL A;  3EIV A;  4P71 A;  4PZ6 A;  3M4P A;  3RLF A;  3RLO A;  1WYD A;  3CCE A;  1TXY A;  1WCM G;  3H3V I;  2JA5 G;  4DNI A;  1Q1E A;  1VQB A;  2LSS A;  4XTC S;  3J7Z C;  4DR3 Q;  4UP7 A;  2JEA I;  4X6A H;  3CXC A;  1TWH H;  4J15 A;  4A3G H;  1XMQ L;  1L2F A;  1YIJ A;  3U4Z A;  1BKB A;  3PV0 A;  4BBR H;  4DV3 L;  2JA5 H;  1N34 Q;  4NXM L;  4YWM A;  4QGU A;  2ASB A;  3CME A;  1EFW A;  1L1O A;  2JEB I;  5ELO A;  1E1T A;  3B6Y A;  1M90 C;  1PYB A;  2IT1 A;  5M3M G;  1VQH A;  1EUJ A;  4IPC A;  4X66 L;  2VL6 A;  4POF A;  4GLX A;  3CCV A;  2N78 A;  2HIV A;  3AQQ A;  2RCN A;  4GN5 A;  4MTN A;  1VQE A;  5M5W H;  5IWA Q;  4A3I G;  2UUA L;  4GKK Q;  1KRT A;  4B3T L;  2CWP A;  2VQE Q;  5M5Y H;  2NVX H;  1IBL Q;  2HT1 A;  1Y14 B;  4B3S L;  2K5N A;  2V1C C;  1LUZ A;  4EQ5 A;  4DV5 Q;  1VQ8 A;  3E9H A;  4IFD I;  2JA8 G;  2HHH Q;  3CD6 A;  1M1K C;  2MO0 A;  4HJ9 A;  2Z6K C;  1VQ6 A;  3L2P A;  1KL9 A;  2IHE A;  5IT9 c;  1X55 A;  5AJ3 Q;  4A3K G;  1Q81 C;  4PMW A;  2PI2 E;  1HNZ L;  4LF6 Q;  3RR5 A;  5H1S E;  3W1B A;  4AIM A;  1I94 Q;  3UE1 A;  4DUZ Q;  4DR7 L;  4GOP C;  5HY6 A;  1S72 A;  2JA8 H;  4L5S A;  4UP9 A;  4WJ3 M;  1VQD A;  1RIP A;  2HIX A;  3CPW A;  2A19 A;  4A3K H;  3KF6 B;  4JBJ A;  1K8G A;  1JJC B;  3UDI A;  1L0W A;  3PIP A;  2PNH A;  2R7D A;  2WB1 E;  2K5V A;  4LF7 Q;  1GVP A;  4JI5 L;  3UDX A;  3I7F A;  4YHH Q;  1PV4 A;  3CCL A;  3AYH B;  4KHP L;  4JI8 Q;  5GAH C;  1CKO A;  1N33 L;  4QL5 A;  4O0A A;  5FLM G;  5E7N A;  1HR0 L;  1X65 A;  2R7Z G;  2ES2 A;  4NXN L;  3RLN A;  1PH1 A;  2ZM6 L;  3S16 H;  1SRU A;  3A74 A;  5FLM H;  3AEV A;  3OTO Q;  3RN2 A;  4A3E G;  4UPA A;  4JI6 L;  1KXL A;  3GTG H;  4JI4 Q;  4AQY Q;  1NTG A;  2F52 A;  3WWV A;  4JI3 Q;  3PO2 G;  4B3R L;  5M3F G;  4BXX H;  3BZC A;  1N32 Q;  3CCJ A;  1HNW Q;  3T1Y L;  5BR8 Q;  1AH9 A;  4A3E H;  1EQR A;  1W3S A;  2ID0 A;  1HNX Q;  5JJI A;  2GVB A;  4JV5 L;  3S2H H;  4XIG S;  5M3F H;  3AFP A;  2Q2H A;  3KF8 B;  1VQC A;  2CFM A;  2K75 A;  1PH3 A;  3CCS A;  1KC8 C;  3L0O A;  4JOI C;  2I5L X;  1WI5 A;  3PCO B;  3UDF A;  5JJK A;  1MJC A;  1EIF A;  3GTO H;  2OTJ A;  2YYZ A;  2D0O A;  3HFZ B;  1NJI C;  2NZH A;  3I4N G;  4P74 A;  1YEZ A;  4DPG A;  4YCW A;  1L1O B;  3JAM i;  1A62 A;  3CC2 A;  4DK3 C;  1KQS A;  4C3J H;  2I0Q A;  4X64 L;  2E2J H;  4DV7 Q;  1XPU A;  3I4N H;  1EYG A;  1I6H H;  1UEB A;  3E0E A;  1K8A C;  4HIM A;  3HOZ G;  5FJ8 G;  2EIF A;  1PA6 A;  3CCU A;  1T9H A;  3F2C A;  3FKI H;  3GTL H;  1BVS A;  3H0G H;  5GRO A;  2QA4 A;  5IE8 A;  1SMX A;  2AMC B;  3BU2 A;  1PH7 A;  2MQH A;  4DV1 L;  4B3M L;  2VY3 A;  3HOZ H;  5FJ8 H;  1VQ9 A;  3K80 C;  1OXS C;  5IWA L;  5C0X J;  3KJP A;  4Y52 H;  1P16 A;  3J81 i;  3U4V A;  1X3E A;  4P73 A;  2FXQ A;  3J80 i;  5FLX c;  2YV5 A;  4JBM A;  4OX9 Q;  2B63 G;  3M7N A;  3CC7 A;  1I5F A;  1IBK L;  1WJJ A;  2ATW A;  4LF6 L;  1XMO Q;  1J6Q A;  1NMF A;  1H95 A;  2VQF Q;  2XGT A;  2VZA A;  2UUC L;  5IP7 G;  2B63 H;  3K7U C;  5C0X I;  4LF5 Q;  4POG A;  1EWI A;  3L7Z C;  4DV0 Q;  2NVT H;  2WAQ G;  1K3R A;  2E2I H;  1S3O A;  2RHQ B;  5M5X H;  4A3C G;  1D8L A;  4LF4 Q;  4R4T A;  5IP7 H;  4DR1 L;  4R4I A;  4P72 A;  3ERS X;  4TQU S;  2MNA A;  1QVF A;  1IL2 A;  3F2D A;  4HIO A;  1E7Z A;  2KCM A;  4A3C H;  5LMN W;  3CW2 C;  4A4I A;  4DR2 Q;  1FGU A;  3ER0 A;  3GDE A;  4EX5 A;  1PH8 A;  4X65 Q;  2YTV A;  4PZ8 A;  2R92 G;  5LMN Q;  4DUY Q;  4BA2 I;  1I3Q H;  2PQA B;  3CMA A;  4LFA L;  1XNR Q;  3GTJ H;  1WCM H;  2N3S A;  4HJ8 A;  3TRZ A;  4AYB E;  1O7I A;  1YHA A;  1HZ9 A;  1N36 L;  1J5E Q;  2R92 H;  1Q82 C;  4JI3 L;  4LF8 L;  4IFD J;  3TRE A;  4DR6 L;  2JQO A;  1V9P A;  2F4V L;  1HNW L;  2BH8 A;  2XTI A;  3M4Q A;  3K7A H;  3A5Z B;  1QVG A;  3F8T A;  2AWO A;  2WB1 G;  2E2H H;  1A0I A;  3KDF B;  4IPH A;  4UY8 C;  5M3M H;  2R7F A;  4BY1 G;  4DV6 Q;  2VW9 A;  4DR4 Q;  3HOX G;  3G71 A;  1VQ7 A;  4A3I H;  3S1N H;  3PUZ A;  4A3F G;  1KRS A;  2UU9 L;  3K81 C;  4JI1 L;  4YCV A;  3RNU A;  1VQK A;  1CKN B;  1XNQ L;  3T1H L;  3RZD H;  1YJ9 A;  3PUX A;  1MJE A;  2C35 B;  4R4Q A;  1IBM L;  1YNX A;  1VS0 A;  4ME3 A;  4APV A;  3HOX H;  1PH2 A;  2UXB Q;  4K0K L;  1D7Q A;  4A3F H;  4GLA C;  1YIT A;  1HZB A;  3TQY A;  2WFW A;  4GNX B;  3I4O A;  1B70 B;  2E5L L;  2NN6 G;  3MEF A;  4JI7 L;  4JI2 Q;  2VNU D;  3M3Y H;  1HH2 P;  4DAY B;  1K83 H;  1LYL A;  4JYA Q;  1G6P A;  2CKZ B;  3RZO H;  1VQP A;  4JI0 L;  3GD7 A;  4WJ4 A;  1CSQ A;  1VQL A;  4R4O A;  3CPF A;  2NVQ H;  1B7Y B;  1PHJ A;  1SE8 A;  1SRO A;  1VQ4 A;  2IHF A;  3SGI A;  4DV2 L;  4LFC Q;  4GKJ L;  2NVY H;  1V1Q A;  4KLK A;  2HQL A;  1BBU A;  3HKZ E;  5C3E G;  4X62 L;  2UUB Q;  4LFB L;  1CKM A;  2R7Z H;  2OTL A;  4DR5 L;  2UXC L;  3K8A A;  1MIU A;  3J7A 5;  1K0R A;  1VQA A;  4LW1 A;  3IRB A;  2K14 A;  4PG3 A;  5C3E H;  4YCU A;  4YWK A;  1JB7 A;  4YY3 L;  2K5H A;  1UE1 A;  3KYH C;  2Y0S G;  4QIW E;  4A3M G;  2OWO A;  5LMU L;  3PO2 H;  1TWF H;  4MZ9 A;  1QZH A;  4DV4 L;  4H02 A;  1WOC A;  2Z6K A;  1JE5 A;  2MO1 A;  2KBN A;  1XMQ Q;  3M9B A;  2QEX A;  4GNX C;  3STB D;  4A3M H;  4DV3 Q;  4GOP A;  4DR3 L;  2KHI A;  2VUM G;  4NXM Q;  2JJQ A;  2N8N A;  1IYJ B;  2ZJQ A;  4DUY L;  3HOU G;  1NE3 A;  3HOW G;  4A76 A;  4BY7 G;  2L15 A;  5JEA J;  1U5K A;  3S1M H;  4QQB X;  4DK6 C;  2A8V A;  2PI2 A;  5C4X G;  1N34 L;  2VUM H;  1AE3 A;  4LUZ A;  1SR3 A;  4JG2 A;  5DLQ E;  4X66 Q;  3KJO A;  3HOU H;  3HOW H;  4BY7 H;  1UE5 A;  3I2Z A;  2QGQ A;  5C4X H;  1LM0 A;  1XPR A;  4B3T Q;  1A8V A;  5IYD G;  3K0X A;  4B3S Q;  3GTP H;  1U0L A;  2B3G A;  2IX1 A;  1XJV A;  3D0F A;  1VQ5 A;  4GKK L;  2EQS A;  1QZG A;  1HNZ Q;  2RHS B;  2LXJ A;  2VQE L;  1YJW A;  4A3J G;  5IYD H;  1IBL L;  1EIY B;  1VQJ A;  1Q12 A;  4QY7 A;  2OQ0 A;  1IZ6 A;  4DV5 L;  1K73 C;  3S15 H;  4DR7 Q;  1IXR A;  1YBY A;  2CQO A;  1SFO H;  4AH6 A;  1OXV A;  1YI2 A;  2HHH L;  1Q46 A;  4LNQ A;  2KEN A;  2JA6 G;  5AJ3 L;  2JA7 G;  1G29 1;  1V43 A;  3S24 A;  1UWV A;  5C4J H;  4A3J H;  3PGZ A;  1PH4 A;  1I94 L;  4DUZ L;  4ALP A;  3GTK H;  2LXK A;  4JI5 Q;  3NBH B;  2I5M X;  3PUV A;  2H5X A;  4MNO A;  4DR5 Q;  4A75 A;  1PH9 A;  2JA6 H;  2JK8 A;  2JA7 H;  4JOI A;  4OON A;  3G6E A;  1HR0 W;  4KHP Q;  3U58 A;  1PFS A;  5IY0 A;  1VCI A;  1N33 Q;  1L1O C;  3HKS A;  2I5H A;  4YHH L;  4LF7 L;  1Q1B A;  1JMC A;  1HR0 Q;  3TS2 A;  1OXT A;  2R6G A;  5J3B A;  1VQM A;  3JAM c;  4JI8 L;  4NXN Q;  1FVI A;  2ZM6 Q;  2JA9 A;  2CWA A;  1RL2 A;  4A3B G;  3ZJY C;  2A1A A;  2R93 G;  5C44 G;  3UDG A;  1EOV A;  4JI6 Q;  4C2M H;  3I4M G;  3CCM A;  4B3R Q;  3DM3 A;  2E8G A;  2KCT A;  5ELN A;  1EQQ A;  1UE7 A;  2ZJR A;  3PF5 A;  4OO1 G;  4QJF A;  4IJH A;  3I56 A;  1UE6 A;  4BA1 I;  5C44 H;  3OTO L;  3T1Y Q;  2R93 H;  3JC6 6;  3A0J A;  4JI4 L;  4AQY L;  3I4M H;  1MKH A;  4JV5 Q;  1X3G A;  3J81 j;  2ZTE A;  3J81 c;  1PH5 A;  3ICE A;  1GKH A;  1N32 L;  4HJA A;  4LUO A;  4A3G G;  2AHO B;  5BR8 L;  2IY5 B;  3J80 c;  1HJP A;  3F1Z A;  3PIO A;  2Z0S A;  1HNX L;  2GN5 A;  2BH2 A;  3S17 H;  3TS0 A;  1PH6 A;  4GOP B;  4BBR G;  4RMF A;  3ULL A;  4A3D G;  1NY4 A;  3GTQ H;  3H3V H;  1VQG A;  1OXX K;  2AKW B;  1JJ2 A;  4JBK A;  3PO3 G;  3NEM A;  1N8R C;  2UXD Q;  3U50 C;  2EXD A;  3F2B A;  3EBE A;  2GVA A;  4A3D H;  3HOY G;  2ZJP A;  1S40 A;  3W5O A; 
#chains in the Genus database with same CATH topology
 3PO3 H;  3HZX A;  1BO0 A;  4HID A;  3KFU A;  2ZTC A;  4FXG C;  3AFQ A;  4EQO A;  3HOY H;  1Z9F A;  3TEH B;  2Z6B A;  2D2C C;  1EY8 A;  4DV7 L;  1R9T H;  3QWN A;  4DV1 Q;  5CMD A;  3URY A;  1FJG Q;  5LHY 1;  3RUZ A;  1WTP A;  1IHZ A;  1GUT A;  2YTX A;  4IUP A;  1BOS A;  1SMY C;  4TVA B;  2PO4 A;  2Z9H A;  1YNJ C;  4IUV A;  3T56 B;  1R9T B;  5IYC H;  3GTM H;  4C1N I;  4NKL A;  1HA6 A;  2UUC Q;  1STB A;  2F3V A;  2EY6 A;  3M3Y B;  4IN3 A;  3CAM A;  2JN4 A;  2DGY A;  4PZ7 A;  1A63 A;  3MEH A;  1XMO L;  5CYU A;  1LO5 D;  4B9X A;  1ICF B;  1PYS B;  4LF5 L;  1KD1 C;  2NVQ B;  3GTM B;  1A3U A;  4L5Q A;  4WJW A;  1CUK A;  1Y1V G;  3PMF A;  3GQB A;  1O7Y A;  2AWN A;  1QE6 A;  4WOR A;  1DGS A;  2K5Q A;  1OXU A;  4LFA Q;  1DYQ A;  3PF4 A;  3T16 A;  3LWE A;  4X3K A;  4JC0 A;  1N36 Q;  1E1O A;  1SNP A;  5LMN L;  1SE3 A;  3EA6 A;  5JJL A;  1TWF B;  2NZO A;  3D6W A;  4JCV E;  1MSG A;  1IW7 C;  4O2D A;  4A93 G;  2IX0 A;  3SDZ A;  2JXM B;  3FPP A;  2B2Y C;  1J5E L;  2Y0S B;  1A3T A;  1EFI D;  2V4D A;  3J7Y W;  3G4S A;  3T4A C;  1NUC A;  4IOC A;  4C1N K;  2CW0 D;  3CKI B;  4LWC A;  1SEB D;  3TP6 A;  5K36 G;  1XWE A;  2A69 D;  2UXD L;  3CCR A;  5I2X A;  4K5V A;  2K4K A;  2F0Q A;  3SK4 A;  4K0K Q;  4KY7 A;  2E2D C;  1GO3 E;  3GTP B;  4A3L G;  1CA5 A;  4X3U A;  3NK9 A;  5JEA G;  2F0O A;  2ZTD A;  2CVR A;  2KED A;  3S1Q H;  1B44 D;  3BJU A;  2RSO A;  3DHQ A;  1K28 A;  3ULP A;  1LTI D;  1C0A A;  2E75 C;  3LGJ A;  5CGK A;  4LF9 L;  5ISR A;  4HJ5 A;  3A56 A;  3GV3 A;  4JI2 L;  1ZYR D;  1ROD A;  4V0B A;  3TP8 A;  2JE6 I;  3VYT A;  3OW2 A;  4CDE C;  1HUN A;  2Z4H A;  5IYB H;  1QUQ B;  3CQZ H;  3S1Q B;  1STG A;  4RCO A;  4R4C A;  2K32 A;  4X62 Q;  4NPS A;  1AZQ A;  3E9I A;  2F3I A;  4GS3 A;  4DR5 Q;  3KOJ A;  4AYB B;  2Q2I A;  3NWS A;  5HGQ A;  1X56 A;  5C0X H;  4RA8 A;  2UUB L;  3SK6 A;  1EYD A;  1WTR A;  1ZXT A;  2PZT A;  3NTH A;  1B9M A;  1PTO C;  1SYD A;  3RLO A;  2NWG A;  1CFM A;  1BXT A;  1TXY A;  3H3V I;  5A35 A;  5C44 B;  3J7Z C;  4X6A H;  3KF8 A;  2JEA I;  4J15 A;  4A3G H;  3IKJ A;  1IL8 A;  2HDL A;  2NB0 A;  2JA5 H;  1Q8I A;  1QNU A;  3J80 L;  3X3N A;  4I7A A;  2JEB I;  1E1T A;  1M90 C;  4A3G B;  4G7H C;  2PW5 A;  4ZCK A;  4A3D B;  2K33 A;  2SDF A;  5M5W H;  4GKK Q;  4IUQ A;  1KDB A;  4UDU C;  2CWP A;  1EY9 A;  4OIK A;  2K5N A;  2PCF B;  3E9H A;  2JA8 G;  1M1K C;  1VQ6 A;  3L2P A;  1VQ5 A;  1X55 A;  2A68 C;  4DR7 L;  1S72 A;  4UP9 A;  4RGN A;  3CPW A;  4A3K H;  3KF6 B;  1JJC B;  1SYB A;  3UDI A;  3PIP A;  1CHQ D;  2R7D A;  4YHH Q;  2EXZ A;  4JI5 L;  3UDX A;  1GUS A;  4KHP L;  4JI8 Q;  5T1G A;  1PLF A;  5GAH C;  2QIL A;  5FLM G;  4IZ8 A;  2F0U A;  4FXK C;  2ZM6 L;  3OTO Q;  3RN2 A;  2YU9 B;  4AQY Q;  1DOM A;  1NTG A;  3WWV A;  1CQF A;  1SNC A;  2BDO A;  1HA5 A;  1AH9 A;  1E0B A;  1Y1V B;  2GVB A;  5M3F H;  1JOQ A;  3OMC A;  2TMP A;  3H09 A;  4RGM A;  5EKK A;  3CCS A;  1KC8 C;  2OTJ A;  2YYZ A;  2EZV A;  3I4N G;  1UAP A;  1RDP D;  4DPG A;  4A93 B;  1KQS A;  1SNM A;  1EYG A;  1UEB A;  2PYK A;  3P20 A;  1F9P A;  2EIF A;  1PA6 A;  5IE8 A;  4K5X A;  2AMC B;  3DWQ A;  1PH7 A;  1PZJ D;  2MQH A;  4DV1 L;  3K80 C;  1OXS C;  4TSS A;  4LAA A;  3ZYY X;  5IWA L;  5C0X J;  5M9O A;  4F88 A;  4DN4 M;  4ZQ3 A;  5E1F A;  3K5O A;  3U4V A;  1ESR A;  2FXQ A;  5FLX c;  4OX9 Q;  2B63 G;  4XYQ A;  3M7N A;  1B9N A;  1I5F A;  3FDT A;  2J7Z A;  1U9R A;  1MSH A;  4Q5V A;  4WRD A;  1NMF A;  4MTK A;  2XGT A;  2UUC L;  3MWY W;  3D4D A;  4DV0 Q;  1K3B C;  5M5X H;  3D3R A;  2L11 A;  1D8L A;  3WDN A;  3A7L A;  5EGT A;  2EJG C;  2Z8L A;  3BVG A;  1F77 A;  1QVF A;  2F0H A;  2F0K A;  5LMN W;  4A4I A;  4DR2 Q;  1KAB A;  3GDE A;  3EQL C;  5M5X B;  4H0L C;  4PZ8 A;  2XN9 C;  3TSS A;  4LFA L;  2XIW A;  3MC0 B;  4HJ8 A;  2MJ8 A;  4AYB E;  1YHA A;  1N36 L;  3SVM A;  4JI3 L;  3NQT A;  5I2Y A;  1C4Q A;  1AFP A;  2OXP A;  1A0I A;  2FFK B;  2FMM A;  4HN7 A;  4BY1 G;  2VW9 A;  4DR4 Q;  3S1N H;  2L12 A;  3K81 C;  3T53 B;  3RNU A;  3RZD H;  1YJ9 A;  3PUX A;  2C35 B;  4IUT A;  1QCB D;  4R4Q A;  1VS0 A;  4ME3 A;  3BG3 A;  2UXB Q;  4K0K L;  4A3F H;  1YIT A;  1HZB A;  2F03 A;  1B70 B;  1D5M C;  1WTV A;  3MEF A;  2VNU D;  3D8G A;  3RZD B;  1MHW C;  3K5N A;  1LYL A;  1EWH A;  2K7V A;  4KN7 C;  4NMZ A;  2XRS D;  2JA8 B;  3RZO H;  4WJ4 A;  1CSQ A;  4K8J A;  2N88 A;  1B7Y B;  1SRO A;  5BN3 A;  5KYI A;  1VQ4 A;  1HPC A;  4LFC Q;  4CJ1 B;  4LJZ C;  2ZT9 C;  4X62 L;  1CKM A;  2OTL A;  4DR5 L;  1JOR A;  2BE5 C;  2L4N A;  1U4R A;  1KDC A;  3IRB A;  2K14 A;  1EY4 A;  4OGQ C;  4YCU A;  1I6V C;  1QIL A;  3S16 B;  4C56 C;  1WOC A;  4O1N A;  4DV3 Q;  4GOP A;  2VUM G;  4NXM Q;  2JJQ A;  2N8N A;  2XWB B;  3VR5 A;  4DUY L;  3HOU G;  4ZK9 B;  5JEA J;  4KK7 A;  4XT1 B;  3S1M H;  2R3Z A;  4LUZ A;  1SR3 A;  5DLQ E;  3HOW H;  4BY7 H;  2QGQ A;  4J6H A;  1LM0 A;  5I9P A;  4B3T Q;  1A8V A;  3K0X A;  4QUC A;  4B08 A;  4B3S Q;  1JWS D;  3S1M B;  2F0L A;  5CBE E;  1XJV A;  5COY A;  4GKK L;  3I4N B;  2RHS B;  3DXJ C;  1U4P A;  4QY7 A;  3S15 H;  4X3S A;  5ELE A;  4K2K A;  4AH6 A;  1OXV A;  2KA7 A;  1Q46 A;  2KEN A;  2JA6 G;  1G29 1;  1V43 A;  3NP8 A;  3S24 A;  1EEF D;  2EDG A;  4XDX A;  4ALP A;  1ML0 D;  2WKC A;  2I5M X;  2H5X A;  4JK1 C;  2JK8 A;  4HMI A;  4JOI A;  4ZUI A;  1WTW A;  2JA7 H;  3OOC A;  3RD4 A;  1VCI A;  1D2B A;  1L1O C;  3HKS A;  2I5H A;  4YHH L;  2HCC A;  4ZAI A;  4MIU A;  3MFG A;  5J3B A;  1STN A;  4JI8 L;  5KNC A;  1G91 A;  1ILP A;  2A1A A;  2QKI C;  2R93 G;  2E2I B;  2JA7 B;  3F2U A;  4C2M H;  4JI6 Q;  2EYJ A;  3DM3 A;  1A6X A;  4OO1 G;  1HFN A;  3OTO L;  3NWT A;  4RCN A;  4AQY L;  4I7Z C;  4KJO A;  4UHV A;  3J81 j;  3VR2 A;  1PH5 A;  1GKH A;  4OHJ A;  2WIN B;  2AHO B;  1I3Q B;  3PIO A;  1HJP A;  5LL6 X;  3J80 E;  3TS0 A;  2E76 C;  1NY4 A;  1KDA A;  4M8A A;  1OXX K;  3T51 B;  2PZW A;  3H3V H;  3J7A F;  1N8R C;  3PO3 G;  2UXD Q;  4HED A;  1BCP C;  4HMJ A;  3EBE A;  2MUY A;  3HOY G;  2ZJP A;  1RD9 D;  4PV1 C;  4BY1 H;  3CF5 A;  2DUD A;  3D31 A;  3RN5 A;  1Q86 C;  1PVO A;  2F0W A;  4B3M Q;  3ERO A;  4LF9 Q;  5IIF A;  1YNN C;  4BY1 B;  5IYC G;  5EAY A;  1RCV D;  1TWC H;  1GD7 A;  3NEN A;  3A5U A;  2RA4 A;  4OX9 L;  2LFN A;  2VXW A;  1CSP A;  1QUQ A;  2A5H A;  1SYG A;  3R2T A;  2A6H C;  1PTO F;  1PDQ A;  1ZKO A;  4DV0 L;  4DR1 Q;  4WFN 3;  1CT1 D;  4DAM A;  1EYA A;  1STE A;  2NVY B;  3R2I A;  3L3O C;  2BA0 A;  4FNF A;  1IKL A;  4O42 A;  4DR2 L;  1A2U A;  1HQM C;  3ERQ A;  1CI3 M;  4IO9 A;  4DNT B;  2F1M A;  1Z47 A;  2F0S A;  3KLW A;  4LF8 Q;  3EN2 A;  3FPU B;  5BN4 A;  2F4V Q;  1SJE D;  4Y7N H;  3OYY A;  1Z7T A;  2B2V A;  1LAB A;  1SDF A;  1JB3 A;  3C1F A;  4HJ7 A;  5CBA E;  1Y1W H;  4Z9C B;  4DA2 A;  1QVC A;  1RHP A;  5KIX A;  3FHW A;  2VUM B;  1C9O A;  1S4Z A;  3I55 A;  4OWW B;  1HHV A;  4HTH A;  4JI1 Q;  1LTG D;  3CC4 A;  3HOU B;  1XNQ Q;  3T1H Q;  3MVV A;  3E5S A;  2B29 A;  4GN4 B;  4DR4 L;  3FKI G;  3H0G G;  1A3V A;  1NR2 A;  1SJH D;  2M2L A;  1LT5 D;  5EBC A;  4XQN A;  1CKN A;  3MXG A;  2WP8 J;  2K52 A;  2PMZ E;  4AYB G;  4ULL A;  2UXB L;  1SXT A;  1TU2 B;  2H4O A;  4GNX A;  3KF6 A;  3RMH A;  5IYB G;  2JSO A;  2VS1 A;  4FYD A;  3EFX D;  1SN8 A;  3TN2 A;  2I07 B;  2WAC A;  2DJF C;  5G3L F;  3UE0 A;  1HXY D;  3CRL C;  4K5W A;  4DV2 Q;  5C0X G;  2JA6 B;  4RWS C;  3DUZ A;  4FDB A;  4IPG A;  3W1G A;  4LFC L;  1HZA A;  1HZC A;  3TP5 A;  1J9O A;  2RF4 A;  1JCK B;  1CZW A;  1TS2 A;  3J81 E;  1SMY D;  1WYD A;  5CV9 A;  3CCE A;  5AFW A;  1WCM G;  2DNE A;  2JA5 G;  4DNI A;  1Q1E A;  1VQB A;  2R93 B;  4UP7 A;  3CXC A;  1FYC A;  2NZ1 D;  3C3L A;  1MD2 D;  4RKL A;  4FXD A;  3PV0 A;  4DV3 L;  2BDN A;  3VR4 A;  2O5I C;  4NXM L;  3S17 B;  4QGU A;  4CJ2 C;  2ASB A;  3CME A;  1Y69 U;  1EFW A;  3SK5 A;  2E74 C;  1D6E C;  2IT1 A;  3BDL A;  1EUJ A;  4QMG A;  5JVG 3;  2VB2 X;  3CCV A;  2N78 A;  5IWA Q;  4A3I G;  3PO3 B;  1L0Y B;  1VQE A;  1S5F D;  2UUA L;  4B3T L;  2VQE Q;  1GUN A;  1DON A;  4B3S L;  1PZI D;  1VQ8 A;  3HOY B;  4IFD I;  4HJ9 A;  2Z6K C;  4A3K G;  1KL9 A;  2IHE A;  5IT9 c;  1D5X C;  5AJ3 Q;  4PMW A;  3QR8 A;  4AIM A;  5H1S E;  1I94 Q;  1JOK A;  4IQZ A;  1TT2 A;  4CGY B;  1RIP A;  4HR7 B;  2A19 A;  1ESF A;  2LMC B;  4JBJ A;  1K8G A;  2F0F A;  3AU7 A;  1JWU D;  1GVP A;  3AYH B;  2X6L A;  1CKO A;  1Y8P B;  3RLN A;  1WD1 A;  4S3S A;  4JI6 L;  5F2D A;  1KXL A;  4JI3 Q;  5JOB A;  5M3F G;  2F0J A;  2F0P A;  2B39 A;  1KNE A;  3KLR A;  4EGV A;  2EY5 A;  2Q2H A;  3SXH A;  1BF4 A;  4CBV A;  2CFM A;  2K75 A;  1QWY A;  3L0O A;  5IGD A;  2I5L X;  5JJK A;  1MJC A;  3GTO H;  1O7L A;  1G2T A;  5EKL A;  1NJI C;  2Z4I A;  2NZH A;  1GHK A;  4P74 A;  1YEZ A;  4YCW A;  3JAM i;  1A62 A;  3CC2 A;  4DK3 C;  3KBG A;  4C3J H;  5KYL A;  2E2J H;  1I6H H;  3CCU A;  1T9H A;  4U68 A;  3FKI H;  1PTO D;  3R93 A;  3GTL H;  3H0G H;  5GRO A;  4B3M L;  2VY3 A;  5FJ8 H;  1X3E A;  4P73 A;  4JBM A;  3FKI B;  2CQA A;  3H0G B;  2RBM A;  5IGC A;  3PQI A;  4LF6 L;  1J6Q A;  2VQF Q;  5EBD A;  1LLR D;  2VZA A;  2XNA C;  3E6Z X;  4POG A;  1EWI A;  2EPB A;  4RFB A;  1K3R A;  2A6E C;  2RHQ B;  3CQZ B;  2EVB A;  5JJZ A;  4LF4 Q;  4DR1 L;  5J1Z A;  5A2Q L;  4HIO A;  1PH8 A;  1H9S B;  3ER0 A;  4ZLT F;  2A68 D;  4X65 Q;  2YTV A;  5CV8 A;  2A69 C;  1EOT A;  3A7A B;  4DUY Q;  1RF2 D;  4XT3 B;  4KTA A;  1S5E D;  2K03 A;  1WCM H;  2N3S A;  1O7I A;  2C5C A;  5C5L A;  2F0G A;  5D65 A;  5IGB A;  4LF8 L;  3LNN A;  4KKS A;  1F9Q A;  1HNW L;  2F4V L;  3M4Q A;  1R4P B;  3F8T A;  5IGE A;  2WB1 G;  1WCM B;  2JA5 B;  2E2H H;  1STY A;  1VF7 A;  4UY8 C;  2R7F A;  2I46 A;  2PPB C;  5G3L D;  4ODG A;  1VQ7 A;  2HDM A;  3OMG A;  4KKU A;  4A3I H;  4A3F G;  1AW7 A;  4JI1 L;  1RKN A;  1CKN B;  1XNQ L;  4ZRZ A;  3T1H L;  4IUN A;  4RKB A;  5M5W B;  1YNX A;  5C5M A;  1D1I A;  1I4X A;  5FK9 C;  4APV A;  3HOX H;  1K8O A;  3OPO A;  1ET6 A;  4GNX B;  3I4O A;  4A3I B;  1HTL D;  3I73 A;  4DAY B;  1K83 H;  4FF3 A;  5E4X A;  4JYA Q;  1G6P A;  3MFY A;  4A3K B;  3GD7 A;  1BNZ A;  2MPM A;  3HEJ A;  2L9H A;  4DV2 L;  1V1Q A;  2B2T A;  2HQL A;  4JW0 A;  4R9W A;  2NYZ D;  3QO2 A;  1MIU A;  1H9R A;  4LW1 A;  4PG3 A;  5C3E H;  3BYY B;  1SSO A;  1JB7 A;  5CV7 A;  2CHB D;  2K5H A;  1EEI D;  2JYO A;  2FMC A;  1JE5 A;  1SE2 A;  2MO1 A;  2KBN A;  3M9B A;  1DOL A;  2QEX A;  5CV4 A;  3STB D;  4A3M H;  3W2D A;  4DNR B;  3Q24 A;  4CDF C;  4G4K A;  1GXD C;  3HOW G;  5M3F B;  4BY7 G;  3HGB A;  3VR3 A;  4QQB X;  4DK6 C;  1AE3 A;  1FR3 A;  5EQ0 A;  4JG2 A;  4H44 C;  3WOE A;  3KJO A;  4JPB W;  3WOF A;  5C4X H;  2EYP A;  1CQV A;  2Z1C A;  5C4Z A;  1WVL A;  2NTS A;  1PTO H;  5I6Y A;  3DWA A;  2F0N A;  1U0L A;  2EYL A;  2IX1 A;  3LX0 A;  3ND9 A;  2WII B;  2VQE L;  5IYD H;  2AUK A;  5L37 A;  4K6D A;  2WV6 D;  1IZ6 A;  3VYS A;  1SFO H;  3BZD B;  5I9O A;  4LNQ A;  1NCV A;  1PTO B;  1BBX C;  5AJ3 L;  2JA7 G;  1PH4 A;  5C4J H;  4A3J H;  1UUP A;  1G2S A;  1O78 A;  1I94 L;  4N8F A;  2HD3 A;  3PUV A;  1WD0 A;  3G6E A;  2L0C A;  1PFS A;  5IGF A;  1AN8 A;  1Q1B A;  1HR0 Q;  1OXT A;  1PYW D;  3JAM c;  2P5Z X;  3C46 A;  4K8I A;  3VA7 A;  1EOV A;  3DEO A;  5ELN A;  1UE7 A;  2C9O A;  4IJH A;  3J7A V;  2VB3 X;  3JC6 6;  3A0J A;  3I4M H;  1MKH A;  4JV5 Q;  4ZKB B;  3IL8 A;  3MA2 B;  4HJA A;  4LUO A;  2FHT A;  4DK1 A;  3F1Z A;  2L5T A;  3GTQ H;  4JBK A;  1JJ2 A;  2EXD A;  5J39 A;  1S40 A;  2YTY A;  1Y8O B;  4X64 Q;  2F4I A;  3DM1 A;  2BE5 D;  1VQI A;  2MHV A;  1XTD A;  1CK1 A;  4G57 A;  3GTQ B;  1LTL A;  2OCE A;  1EIG A;  3V96 A;  1FGB D;  1W6K A;  2BA1 A;  2K04 A;  1S5B D;  2WB1 B;  3DLL A;  1N9W A;  1EL0 A;  3S1N B;  4HIK A;  1LV9 A;  1JJG A;  1VMC A;  4K14 A;  3HOV H;  3S1R H;  2NN6 I;  2RDH A;  4FVM A;  4A3F B;  1PFM A;  4IFD H;  2MP1 A;  1CA6 A;  1XXG A;  1CZG A;  5DEH A;  1TWG H;  3FP9 A;  1TWA H;  5EPJ A;  4YWL A;  2XVS A;  1XPO A;  1U4M A;  4LMQ D;  2VQF L;  4QF4 A;  3RZO B;  1B8A A;  1GJX A;  1JIC A;  2NBF A;  1KHI A;  2ICE C;  2R61 A;  1WTH A;  1TWG B;  4RH6 A;  1QOH A;  4KHZ A;  4P75 A;  4LF4 L;  1FL0 A;  3K59 A;  1SND A;  4YIJ A;  3NSW A;  4OXP A;  2GA4 B;  2G9H D;  3G6J B;  4X65 L;  1A2T A;  3W3A A;  1FNU A;  3FVQ A;  5CV5 A;  2PQA A;  4KY5 A;  3CP0 A;  4NB3 A;  1AZP A;  2KEE A;  1FNV A;  3AB9 A;  3IFD A;  1Y1W G;  2PMZ B;  3BZK A;  2D0P A;  2KHJ A;  3NQI A;  3OWF A;  2AQ1 B;  2B2W A;  3X3M A;  3NTI A;  3ULJ A;  4ZYS A;  1O7Z A;  4L5T A;  4FF2 A;  2UUA Q;  1JWM D;  1YVC A;  2OQK A;  1X3F A;  4EQP A;  5FO8 B;  4CJ0 B;  3Q8D A;  2UU9 Q;  4GLV B;  3KDF A;  4H13 C;  4N9P A;  3M85 A;  3HOW B;  3N6R A;  3BDC A;  2MFI A;  4BY7 B;  3CCQ A;  4BBS H;  1B2T A;  4KI0 A;  2PZU A;  2PW7 A;  4DAP A;  3MXN B;  2RKS A;  2NTT A;  1EY0 A;  3H91 A;  3CU7 A;  4ID6 A;  2E5L Q;  2ALY B;  2IX3 A;  2Q2T A;  3VDY A;  3S14 H;  4IJL A;  3V05 A;  5BN5 A;  4DKA C;  3S15 B;  3M7G A;  4HCS A;  2RSN A;  5IP9 H;  1G51 A;  5FLX L;  1IYU A;  2D62 A;  3BS1 A;  1VQN A;  1HRJ A;  4JYA L;  1NMG A;  3OIP A;  3OIQ A;  2AQ2 B;  1KNA A;  4FF4 A;  1HFG A;  2J0T D;  5GAD C;  4LFB Q;  4RGO S;  1B1Z A;  5GQO A;  4ME5 A;  3FRP B;  5A2Q E;  1WFQ A;  1ASZ A;  2G5D A;  1XX8 A;  2UXC Q;  4UP8 A;  3VA5 A;  5ELD A;  1B4O A;  1Q8K A;  2IL8 A;  1Z6H A;  3JAM L;  1NBW A;  1YNN D;  2M00 A;  4DV4 Q;  3NEL A;  4C2M B;  1XTC D;  1W6J A;  4PZ6 A;  5I4D A;  3RLF A;  1E2W A;  4BS9 A;  1F2Z A;  5ELB A;  1PZK D;  1F2L A;  4XTC S;  1LTS D;  4ILW A;  1TWH H;  3U4Z A;  1EY5 A;  5J22 A;  4P2C B;  4YWM A;  5NUC A;  4ZKC B;  2SEB D;  5ELO A;  2DJG C;  3B6Y A;  1G8Z D;  5M3M G;  1VQH A;  1EU4 A;  3A8I E;  4IPC A;  4POF A;  2VL6 A;  2CH4 W;  1NSN S;  2ENB A;  2HIV A;  3AQQ A;  2RCN A;  4GN5 A;  1R4Q B;  5C4H A;  2NVX H;  1IBL Q;  1V8Q A;  5DM7 3;  1F2M A;  2HHH Q;  1VMP A;  4RAU C;  2MO0 A;  3BVM A;  4LF6 Q;  4LK1 C;  5JPM C;  2PI2 E;  3HRZ C;  1QG7 A;  3W1B A;  3UE1 A;  4DUZ Q;  3TME A;  4DXG A;  4GOP C;  4K2L A;  3SHL A;  1X32 A;  2B2U A;  4L5S A;  1H9M A;  2NVX B;  1VQD A;  2HIX A;  1TWC B;  1PRT C;  4H7B A;  1FD7 D;  2WB1 E;  2PNH A;  1J8I A;  4LF7 Q;  5D14 A;  1ZEQ X;  3NE5 B;  1BDO A;  4QL5 A;  1HTP A;  4O0A A;  3PIP 3;  2QDL A;  5E7N A;  1HR0 L;  2R7Z G;  2ES2 A;  1B3Q A;  3ONA B;  1H9S A;  3Q6S A;  3AEV A;  3GTG H;  1IYV A;  1TVX A;  4OL7 A;  5EPL A;  3BZC A;  1N32 Q;  5FO7 B;  3CCJ A;  1HNW Q;  2HUG A;  4A3E H;  1HNX Q;  5JJI A;  1B50 A;  3HS0 C;  3MAQ A;  4JV5 L;  3S2H H;  4XIG S;  3A54 A;  3GTG B;  3H94 A;  3A8J E;  4JOI C;  2HQE A;  2L55 A;  5T1I A;  4C3J G;  1EIF A;  4Y7N B;  1B3A A;  3Q23 A;  3S2H B;  1L1O B;  2J4X A;  2RQX A;  1Y1W B;  4HSV A;  4X64 L;  4L6T B;  2X6G A;  5FJ8 G;  3SEB A;  1PFB A;  1BVS A;  2X69 A;  2QA4 A;  2O4X A;  4FF1 A;  4KV6 A;  3HOZ H;  1VQ9 A;  3QIA A;  3J81 i;  4DAY A;  3E0J A;  1DCZ A;  3QB3 A;  4PNY A;  1IKM A;  5C3W A;  4DFA A;  2B2Y A;  2KEC A;  2LKV A;  3K7U C;  3L7Z C;  2AQ3 B;  2SNM A;  1S3O A;  1B53 A;  1ENF A;  2A74 C;  4DGZ A;  5IP7 H;  1UNS A;  1EIH A;  2K6A A;  1CHP D;  1TII D;  3ERS X;  4P72 A;  4R4I A;  2MNA A;  5DAU A;  1JC7 A;  4A3C H;  1V1P B;  1X3Q A;  1FGU A;  1YNJ D;  4EX5 A;  3SR1 A;  2B8F A;  1MI2 A;  4BA2 I;  4XQJ A;  2KCC A;  2PQA B;  3A55 A;  3M4Y A;  3CMA A;  1VDZ A;  5DM6 3;  3GTJ H;  1XNR Q;  2FIN B;  3TRZ A;  2L1B A;  3R3O A;  2R92 H;  2JQO A;  2BH8 A;  1RTN A;  2XTI A;  2AWO A;  1AP0 A;  1TS4 A;  3KDF B;  3I3C A;  4IPH A;  1SNO A;  5M3M H;  1CTM A;  4DV6 Q;  1STH A;  2PNR C;  3K0Y A;  1QJO A;  3HOX G;  2UU9 L;  2F0M A;  2O5J C;  4YCV A;  1VQK A;  4NW2 A;  1MJE A;  1IW7 D;  2F0I A;  3C2P A;  3K5M A;  1D7Q A;  5M3M B;  4GLA C;  1M4V A;  2E5L L;  1F9R A;  1PFN A;  2EYH A;  3NXW A;  3M3Y H;  5EJW A;  1HH2 P;  2K01 A;  2B2V C;  2EY2 A;  2NN6 H;  1GOZ A;  5LL6 S;  4DU9 A;  1LT4 D;  2RCF A;  2NVQ H;  1PHJ A;  1SE8 A;  1QB5 D;  4KLK A;  3TDQ A;  5KEE A;  1BBU A;  5C3E G;  4LFB L;  5JPN C;  2R7Z H;  2UXC L;  1U4L A;  3K8A A;  3J7A 5;  1K0R A;  1VQA A;  3E3X A;  4YWK A;  3EVQ A;  2K05 A;  3KYH C;  4QIW E;  4A3M G;  3KK7 A;  1TWF H;  4MZ9 A;  2PQE A;  4DV4 L;  1QZH A;  2R7Z B;  1XMQ Q;  4B9W A;  4GNX C;  5E3F A;  5EPK A;  2KHI A;  2ZJQ A;  1NE3 A;  3CHB D;  1SE4 A;  4A76 A;  1SBB B;  2L15 A;  1X3P A;  4J1M A;  1U5K A;  5C4X G;  2PI2 A;  2A6E D;  2TSS A;  3EJI A;  4R8N A;  4X66 Q;  5KGU A;  4XXE A;  3GTO B;  4IUU A;  5IYD G;  2IJ0 A;  4G7O C;  4CKE A;  1T5X D;  5D3D A;  1STA A;  3GTP H;  4C3J B;  3A8K E;  2E2J B;  3D0F A;  1I6H B;  1HNZ Q;  2LXJ A;  1YJW A;  4C3I G;  4A3J G;  1IBL L;  4PMB A;  1VQJ A;  3S9W A;  2F3W A;  4PQX A;  1K73 C;  3GTL B;  1ONL A;  2CQO A;  4J8Q A;  5FLX E;  5HUR A;  2HHH L;  1UWV A;  2XRQ D;  4DUZ L;  3GTK H;  2MGS A;  2B8G A;  4MNO A;  2EJM A;  4DXF A;  4OEM B;  1Q90 A;  1HR0 W;  5IOC A;  1N33 Q;  5C3X A;  3D6C A;  1JOO A;  4N8X 1;  4LF7 L;  2CW0 C;  1VQM A;  3OW7 A;  3GTK B;  4NXN Q;  1UEA B;  3JAM E;  2CWA A;  4A3B G;  3ZJY C;  3I8Z A;  3I4M G;  4B3R Q;  1SYE A;  4C3H G;  2KCT A;  5KND A;  3PF5 A;  1KLG D;  3I56 A;  2F0T A;  2BOS A;  3T1Y Q;  5C44 H;  4CHT B;  5CR3 A;  3KLS A;  3Q0A A;  3I70 A;  1LTB D;  3J81 c;  3ICE A;  1N32 L;  2CH4 A;  2IY5 B;  1HNX L;  2BH2 A;  2Z0S A;  2GN5 A;  3BVZ A;  1PH6 A;  4BBR G;  1TR5 A;  4OIJ A;  3K57 A;  2SOB A;  1ZYR C;  3PIO 3;  3F2B A;  3T13 A;  2GVA A;  4A3D H;  3W5O A;  3U9S A;  1I4Q A;  4LUV A;  2E2H B;  2K1B A;  2WAQ E;  5TSS A;  1VQF A;  2IWH A;  2OT2 A;  1E24 A;  3HKZ G;  3G48 A;  3NBI A;  2CCZ A;  3MXN A;  4K6L A;  4R1J A;  1K9M C;  3HOV G;  2DY7 A;  1ENA A;  3PUW A;  1KAW A;  2ZXR A;  4EQN A;  4IFD G;  3KBX A;  4CDC C;  5IT9 L;  4RHR A;  2QCP X;  3HOX B;  1IBK Q;  3IAY A;  1LT6 D;  1RTO A;  2EYO A;  5E4W C;  1I4G A;  1X6O A;  2N49 A;  3M4O H;  4JBW A;  1K83 B;  1VQO A;  1C7Y A;  3IFT A;  1AE2 A;  1I50 H;  1P8L A;  2Q8T A;  1DD2 A;  3G7L A;  4KD3 A;  1E22 A;  4IPD A;  2IPK D;  2YU9 H;  1ASY A;  1X54 A;  1OO9 B;  3M4O B;  1JT8 A;  3KUP A;  1GM5 A;  1BCP F;  5GAE C;  1Q7Y C;  1YHQ A;  1I50 B;  1NNX A;  1SLJ A;  4BXX G;  1Y1V H;  2BCO A;  5C3E B;  1EQT A;  1GUG A;  2H1E A;  5CV6 A;  3GP7 A;  1XNR L;  2M9V A;  4L5R C;  4DR6 Q;  4V19 0;  1KAA A;  3H15 A;  2HCI A;  2QEJ C;  5KRU A;  1OTC A;  2G9D A;  4A3M B;  4PMC A;  1GHJ A;  4FP5 D;  1E2Z A;  5ELF A;  4A93 H;  2OEO A;  3GO5 A;  2EY1 A;  1D1K A;  5HGT A;  1F2Y A;  3DWP A;  1SYC A;  4BBS G;  4KY6 A;  4OWX B;  2O2L D;  1YJN A;  1IBM Q;  2F0D A;  4DV6 L;  5C4X B;  5K36 H;  1W2B A;  4RG1 A;  2Q2U A;  1PRT F;  4GN3 B;  4F8M A;  1TKW B;  3PSI A;  3OSO A;  1YZ6 A;  3K58 A;  4C3I H;  4XYO A;  5IP9 G;  1HUM A;  4JI7 Q;  2Y0S E;  4KKT A;  3N52 A;  2DN8 A;  3S2D H;  2K50 A;  4IOA A;  1BBW A;  1SFO B;  4A3L H;  4JI0 Q;  5JEA H;  1TY0 A;  5C4J B;  1FJG L;  4C3I B;  3P7J A;  4A3J B;  1G6Z A;  1PXU A;  1TQO A;  1YHB A;  3PUY A;  4GKJ Q;  1TS3 A;  2OF1 A;  5JVH 3;  4OWT B;  3STB C;  1S5C D;  3S2D B;  3LWU A;  2KHS A;  5GAG C;  1E3P A;  1RJT A;  2QDB A;  1DM0 B;  5CC4 A;  5IGG A;  2RDF A;  4EVO A;  4A3B H;  1M8A A;  1KIX A;  4QCL A;  1ICW A;  4YY3 Q;  4NDX A;  4C3H H;  5LMU Q;  4OO1 I;  1X9N A;  1TY2 A;  3EIV A;  3I4L A;  4P71 A;  3M4P A;  5EKI A;  2EYF A;  3O13 A;  4A3B B;  4DR3 Q;  2LSS A;  1FNW A;  1II3 A;  3NTK A;  3I4M B;  3MXP A;  4C3H B;  1L2F A;  1YIJ A;  1XMQ L;  4HAE A;  1WTQ A;  4ABN A;  1BKB A;  4QUF A;  4BBR H;  3J81 L;  1N34 Q;  3K6O A;  2N55 A;  3QOJ A;  5FOB B;  1L1O A;  3CRK C;  1PYB A;  2B2T C;  1EQV A;  2EJF C;  4X66 L;  2QF7 A;  4BBR B;  1XYI A;  4GLX A;  3QOL A;  1KLU D;  4F87 A;  4MTN A;  4XQQ A;  1KRT A;  4QB4 A;  2K5W A;  5M5Y H;  2HT1 A;  1Y14 B;  1EU3 A;  2V1C C;  1LUZ A;  4EQ5 A;  4DV5 Q;  5FKA C;  2LS0 1;  3CD6 A;  1V1O A;  1Q81 C;  4KN4 C;  1HNZ L;  2D9U A;  3RR5 A;  5JAV A;  3HKZ B;  4M1U B;  5HY6 A;  2JA8 H;  4CKC A;  5M5Y B;  4WJ3 M;  1JR0 D;  3HOV B;  3S1R B;  5D3I B;  1EY7 A;  1L0W A;  1PMR A;  3U9O A;  2K5V A;  1A15 A;  3I7F A;  1PV4 A;  3NBH A;  3CCL A;  4CDD C;  1Y8N B;  1TWA B;  1N33 L;  1TS5 A;  3H3V C;  5COR A;  1X65 A;  4NXN L;  1L0X B;  1PH1 A;  1V1P A;  2ICI A;  3S16 H;  1SRU A;  3A74 A;  5FLM H;  4A3E G;  4UPA A;  3D4W A;  4JI4 Q;  5FO9 B;  2F52 A;  3TZU A;  3PO2 G;  4B3R L;  4BXX H;  1LTT D;  1O80 A;  5BR8 Q;  3T1Y L;  1EQR A;  1W3S A;  2ID0 A;  3QJY A;  1ET9 A;  3AFP A;  3P75 A;  3KF8 B;  1VQC A;  1PH3 A;  5C6A A;  4BWG B;  4OEL B;  1D5Z C;  3NPP A;  1WI5 A;  3PCO B;  3UDF A;  3MZ5 A;  4HSP A;  2D0O A;  1I4H A;  3HFZ B;  2LY7 A;  5I6W A;  4TKO B;  1DXM A;  3H6M A;  2KUM A;  2I0Q A;  3SE0 A;  4DV7 Q;  1XPU A;  3I4N H;  4RHS A;  3E0E A;  1K8A C;  1F9S A;  4NP5 A;  4HIM A;  3HOZ G;  1MBY A;  3F2C A;  4BBS B;  1SMX A;  2KQ3 A;  3BU2 A;  4N9T A;  2ZXP A;  3MXU A;  3KJP A;  4Y52 H;  1P16 A;  1EZ8 A;  1BCP D;  1EY6 A;  4DF7 A;  1K0S A;  1S5D D;  3J80 i;  2YV5 A;  3S14 B;  3CC7 A;  1IBK L;  1BQQ T;  1WJJ A;  1C48 A;  2ATW A;  3Q22 A;  1XMO Q;  1H95 A;  4TRD A;  3K5L A;  5DNF A;  5IP7 G;  1Q3L A;  2KOL A;  4MHE A;  3MHB A;  5C0X I;  4LF5 Q;  2B63 H;  2NVT H;  2WAQ G;  3VR6 A;  1E2V A;  2DY8 A;  1GUO A;  2E2I H;  3ND8 A;  4A3C G;  1ILQ A;  2Q8R E;  4R4T A;  4DAV A;  1H9K A;  1DZ1 A;  2K5D A;  1IL2 A;  4TQU S;  4FO2 A;  3F2D A;  3QG1 A;  1E7Z A;  2KCM A;  3OWE B;  2B63 B;  3CW2 C;  2NVT B;  1LTR D;  5ELC A;  1WTX A;  1GUW A;  4KMU C;  2R92 G;  4KD4 A;  5LMN Q;  4G7Z C;  1I3Q H;  1QNK A;  3I90 A;  1I4P A;  2FJ2 A;  3BDO A;  1HZ9 A;  1NR4 A;  1PRT D;  2A6H D;  1J5E Q;  1Q82 C;  2KVM A;  4IFD J;  3C1E A;  3TRE A;  4DR6 L;  3ITP A;  1TWH B;  1EZ6 A;  1V9P A;  3TP7 A;  3K7A H;  3A5Z B;  1QVG A;  2DNC A;  2F0E A;  2A73 B;  4R8I A;  1HQR D;  4UAI A;  3G71 A;  3PUZ A;  3K7A B;  1KRS A;  4F7X A;  1NAP A;  1IBM L;  5IT9 E;  2NUC A;  1PH2 A;  3TQY A;  2WFW A;  4KHV A;  1SNQ A;  4X3T A;  4L63 B;  2NN6 G;  4JI7 L;  4JI2 Q;  4QIW B;  1KTK A;  4JVZ A;  1LTA D;  2RDG A;  2B2W C;  3KLS X;  4GZY C;  2CKZ B;  2JP1 A;  1VF5 C;  1VQP A;  4JI0 L;  2KJX A;  1VQL A;  4R4O A;  3CPF A;  4DK0 A;  4KJN A;  3HG9 A;  2IHF A;  3SGI A;  4GKJ L;  2NVY H;  3HP3 A;  1BR9 A;  4HCE A;  3HKZ E;  2UUB Q;  4RGT A;  3UI2 A;  2EOT A;  1EYC A;  1K8M A;  3VYU A;  3D4R A;  3R8B A;  4YY3 L;  1UE1 A;  2Y0S G;  2OWO A;  3PO2 H;  5LMU L;  1BUV T;  4H02 A;  2Z6K A;  1C8C A;  3OHX C;  1SAP A;  2QW7 A;  3I91 A;  2D5D A;  4DR3 L;  4A3E B;  1DJR D;  5IOD A;  1IYJ B;  2ZXO A;  2KCN A;  1EWC A;  3NHH A;  3PO2 B;  2SNS A;  2XWJ B;  3V2T A;  2A8V A;  4IAL A;  1N34 L;  2VUM H;  3HOU H;  4MN3 A;  5KNB A;  1UE5 A;  3I2Z A;  1XPR A;  3TZD A;  2XSC A;  2Q8I B;  2EYM A;  2B3G A;  2EQS A;  1QZG A;  4CKB A;  1JQY D;  1AEX A;  1EIY B;  5K5P A;  1Q12 A;  4DR7 Q;  1I4R A;  2OQ0 A;  4DV5 L;  1IXR A;  1YBY A;  1ENC A;  1YI2 A;  3FEW X;  3HOZ B;  1HCZ A;  2AUJ D;  3PGZ A;  1SYF A;  2LXK A;  4JI5 Q;  3NBH B;  4A75 A;  2EE1 A;  1BCP B;  4E6I A;  1PH9 A;  2JA6 H;  4KHP Q;  4OON A;  3U58 A;  5IY0 A;  2IW3 A;  1JMC A;  2F0V A;  3AMU A;  3TS2 A;  2R6G A;  3P1H A;  4L8J A;  4ZUJ A;  1FVI A;  2ZM6 Q;  2JA9 A;  3DMU A;  1RL2 A;  3I72 A;  5C44 G;  3UDG A;  1H9J A;  2K28 A;  3BYT B;  3CCM A;  2E8G A;  1EQQ A;  2ZJR A;  3FMC A;  4QJF A;  2WAQ B;  1UE6 A;  4BA1 I;  2R93 H;  1LT3 D;  3DEP A;  4JI4 L;  1X3G A;  2ZTE A;  2WKD A;  4OO1 H;  2B2U C;  4A3G G;  5BR8 L;  4U67 3;  3VYR A;  3J80 c;  3S17 H;  1MGS A;  3GTJ B;  4I65 A;  4Q0F A;  4GOP B;  2RVL A;  3NUC A;  4IUR A;  3GV6 A;  4RMF A;  3ULL A;  1WTO A;  4A3D G;  1VQG A;  2AKW B;  2R92 B;  1CM9 A;  1T5E A;  3MTS A;  3NEM A;  1PRT B;  3U50 C;  1DOK A;  1JE4 A;  3SK8 A;  1LAC A;  3L9A X;  3TBI B; 
#chains in the Genus database with same CATH homology
 2YTY A;  4X64 Q;  3PO3 H;  4HID A;  1VQI A;  4LUV A;  3KFU A;  1XTD A;  4BY1 H;  2WAQ E;  2ZTC A;  1VQF A;  1LTL A;  2OCE A;  3HKZ G;  1E24 A;  3CF5 A;  3AFQ A;  2DUD A;  3HOY H;  3D31 A;  2BA1 A;  3G48 A;  2CCZ A;  1Z9F A;  3TEH B;  3DLL A;  4R1J A;  4DV7 L;  3RN5 A;  1Q86 C;  1R9T H;  1K9M C;  1N9W A;  3HOV G;  1PVO A;  3PUW A;  4DV1 Q;  1KAW A;  4B3M Q;  4HIK A;  4IFD G;  4LF9 Q;  1JJG A;  1FJG Q;  5IYC G;  3HOV H;  5EAY A;  1TWC H;  2YTX A;  3S1R H;  2NN6 I;  1IBK Q;  4TVA B;  1GD7 A;  3NEN A;  3A5U A;  5IYC H;  3GTM H;  1TWG H;  3FP9 A;  4OX9 L;  2UUC Q;  1X6O A;  1CSP A;  2N49 A;  1QUQ A;  1TWA H;  3CAM A;  2DGY A;  4JBW A;  4YWL A;  4PZ7 A;  3M4O H;  1VQO A;  1XPO A;  1C7Y A;  1A63 A;  1XMO L;  1AE2 A;  1I50 H;  2VQF L;  1B8A A;  1P8L A;  1PYS B;  4LF5 L;  1KD1 C;  1KHI A;  4DV0 L;  4DR1 Q;  1E22 A;  4IPD A;  4DAM A;  2YU9 H;  4KHZ A;  1ASY A;  1X54 A;  4L5Q A;  1CUK A;  1Y1V G;  4P75 A;  1JT8 A;  4LF4 L;  1FL0 A;  1GM5 A;  5GAE C;  1Q7Y C;  2AWN A;  2BA0 A;  1YHQ A;  1DGS A;  1OXU A;  1SLJ A;  4OXP A;  4LFA Q;  4BXX G;  1Y1V H;  4DR2 L;  3PF4 A;  4JC0 A;  4X65 L;  1N36 Q;  1E1O A;  4IO9 A;  5LMN L;  5JJL A;  1Z47 A;  3KLW A;  2NZO A;  4LF8 Q;  1XNR L;  4L5R C;  3EN2 A;  2PQA A;  4JCV E;  3CP0 A;  4NB3 A;  2IX0 A;  4O2D A;  4DR6 Q;  4A93 G;  2F4V Q;  4Y7N H;  1Y1W G;  3BZK A;  3H15 A;  1J5E L;  2D0P A;  1OTC A;  2KHJ A;  3OYY A;  3G4S A;  3ULJ A;  4A93 H;  4L5T A;  3GO5 A;  4IOC A;  4HJ7 A;  2UUA Q;  1YVC A;  2OQK A;  4LWC A;  1Y1W H;  1X3F A;  1QVC A;  4BBS G;  3FHW A;  5K36 G;  4OWX B;  1YJN A;  1C9O A;  3Q8D A;  3I55 A;  4GLV B;  3KDF A;  2UU9 Q;  4JI1 Q;  3CC4 A;  3M85 A;  4OWW B;  3CCR A;  1XNQ Q;  2UXD L;  3T1H Q;  1IBM Q;  2MFI A;  4DV6 L;  3CCQ A;  2K4K A;  2B29 A;  4GN4 B;  4BBS H;  1W2B A;  4RG1 A;  4KI0 A;  2Q2U A;  3FKI G;  4GN3 B;  4DR4 L;  4K0K Q;  3H0G G;  3MXN B;  3PSI A;  1GO3 E;  1YZ6 A;  1CKN A;  4C3I H;  5IP9 G;  2E5L Q;  2ALY B;  2WP8 J;  4A3L G;  2K52 A;  2PMZ E;  4AYB G;  2Q2T A;  5JEA G;  4JI7 Q;  3VDY A;  2Y0S E;  2ZTD A;  3S14 H;  3S1Q H;  2UXB L;  4IJL A;  3S2D H;  3BJU A;  2K50 A;  4DKA C;  4GNX A;  3KF6 A;  3ULP A;  5IP9 H;  4IOA A;  1BBW A;  1C0A A;  5IYB G;  1G51 A;  4A3L H;  2VS1 A;  3LGJ A;  4JI0 Q;  4LF9 L;  1SN8 A;  4JI2 L;  4HJ5 A;  1FJG L;  2D62 A;  2JE6 I;  3UE0 A;  1VQN A;  1YHB A;  3OW2 A;  3PUY A;  4GKJ Q;  4DV2 Q;  4JYA L;  5IYB H;  1QUQ B;  3CQZ H;  1NMG A;  4OWT B;  3STB C;  4R4C A;  5C0X G;  4X62 Q;  5GAD C;  4NPS A;  4LFB Q;  5GQO A;  5GAG C;  3E9I A;  2F3I A;  4GS3 A;  4FDB A;  3KOJ A;  4IPG A;  1E3P A;  1WFQ A;  2Q2I A;  4LFC L;  1HZA A;  3W1G A;  1ASZ A;  2UXC Q;  5HGQ A;  4A3B H;  1HZC A;  4UP8 A;  1X56 A;  1KIX A;  2RF4 A;  2UUB L;  1Q8K A;  4YY3 Q;  1NBW A;  4C3H H;  5LMU Q;  4OO1 I;  1X9N A;  4DV4 Q;  3NEL A;  3EIV A;  4P71 A;  4PZ6 A;  3M4P A;  3RLF A;  3RLO A;  1WYD A;  3CCE A;  1TXY A;  1WCM G;  3H3V I;  2JA5 G;  4DNI A;  1Q1E A;  1VQB A;  2LSS A;  4XTC S;  3J7Z C;  4DR3 Q;  4UP7 A;  2JEA I;  4X6A H;  3CXC A;  1TWH H;  4J15 A;  4A3G H;  1XMQ L;  1L2F A;  1YIJ A;  3U4Z A;  1BKB A;  3PV0 A;  4BBR H;  4DV3 L;  2JA5 H;  1N34 Q;  4NXM L;  4YWM A;  4QGU A;  2ASB A;  3CME A;  1EFW A;  1L1O A;  2JEB I;  5ELO A;  1E1T A;  3B6Y A;  1M90 C;  1PYB A;  2IT1 A;  5M3M G;  1VQH A;  1EUJ A;  4IPC A;  4X66 L;  2VL6 A;  4POF A;  4GLX A;  3CCV A;  2N78 A;  2HIV A;  3AQQ A;  2RCN A;  4GN5 A;  4MTN A;  1VQE A;  5M5W H;  5IWA Q;  4A3I G;  2UUA L;  4GKK Q;  1KRT A;  4B3T L;  2CWP A;  2VQE Q;  5M5Y H;  2NVX H;  1IBL Q;  2HT1 A;  1Y14 B;  4B3S L;  2K5N A;  2V1C C;  1LUZ A;  4EQ5 A;  4DV5 Q;  1VQ8 A;  3E9H A;  4IFD I;  2JA8 G;  2HHH Q;  3CD6 A;  1M1K C;  2MO0 A;  4HJ9 A;  2Z6K C;  1VQ6 A;  3L2P A;  1KL9 A;  2IHE A;  5IT9 c;  1X55 A;  5AJ3 Q;  4A3K G;  1Q81 C;  4PMW A;  2PI2 E;  1HNZ L;  4LF6 Q;  3RR5 A;  5H1S E;  3W1B A;  4AIM A;  1I94 Q;  3UE1 A;  4DUZ Q;  4DR7 L;  4GOP C;  5HY6 A;  1S72 A;  2JA8 H;  4L5S A;  4UP9 A;  4WJ3 M;  1VQD A;  1RIP A;  2HIX A;  3CPW A;  2A19 A;  4A3K H;  3KF6 B;  4JBJ A;  1K8G A;  1JJC B;  3UDI A;  1L0W A;  3PIP A;  2PNH A;  2R7D A;  2WB1 E;  2K5V A;  4LF7 Q;  1GVP A;  4JI5 L;  3UDX A;  3I7F A;  4YHH Q;  1PV4 A;  3CCL A;  3AYH B;  4KHP L;  4JI8 Q;  5GAH C;  1CKO A;  1N33 L;  4QL5 A;  4O0A A;  5FLM G;  5E7N A;  1HR0 L;  1X65 A;  2R7Z G;  2ES2 A;  4NXN L;  3RLN A;  1PH1 A;  2ZM6 L;  3S16 H;  1SRU A;  3A74 A;  5FLM H;  3AEV A;  3OTO Q;  3RN2 A;  4A3E G;  4UPA A;  4JI6 L;  1KXL A;  3GTG H;  4JI4 Q;  4AQY Q;  1NTG A;  2F52 A;  3WWV A;  4JI3 Q;  3PO2 G;  4B3R L;  5M3F G;  4BXX H;  3BZC A;  1N32 Q;  3CCJ A;  1HNW Q;  3T1Y L;  5BR8 Q;  1AH9 A;  4A3E H;  1EQR A;  1W3S A;  2ID0 A;  1HNX Q;  5JJI A;  2GVB A;  4JV5 L;  3S2H H;  4XIG S;  5M3F H;  3AFP A;  2Q2H A;  3KF8 B;  1VQC A;  2CFM A;  2K75 A;  1PH3 A;  3CCS A;  1KC8 C;  3L0O A;  4JOI C;  2I5L X;  1WI5 A;  3PCO B;  3UDF A;  5JJK A;  1MJC A;  1EIF A;  3GTO H;  2OTJ A;  2YYZ A;  2D0O A;  3HFZ B;  1NJI C;  2NZH A;  3I4N G;  4P74 A;  1YEZ A;  4DPG A;  4YCW A;  1L1O B;  3JAM i;  1A62 A;  3CC2 A;  4DK3 C;  1KQS A;  4C3J H;  2I0Q A;  4X64 L;  2E2J H;  4DV7 Q;  1XPU A;  3I4N H;  1EYG A;  1I6H H;  1UEB A;  3E0E A;  1K8A C;  4HIM A;  3HOZ G;  5FJ8 G;  2EIF A;  1PA6 A;  3CCU A;  1T9H A;  3F2C A;  3FKI H;  3GTL H;  1BVS A;  3H0G H;  5GRO A;  2QA4 A;  5IE8 A;  1SMX A;  2AMC B;  3BU2 A;  1PH7 A;  2MQH A;  4DV1 L;  4B3M L;  2VY3 A;  3HOZ H;  5FJ8 H;  1VQ9 A;  3K80 C;  1OXS C;  5IWA L;  5C0X J;  3KJP A;  4Y52 H;  1P16 A;  3J81 i;  3U4V A;  1X3E A;  4P73 A;  2FXQ A;  3J80 i;  5FLX c;  2YV5 A;  4JBM A;  4OX9 Q;  2B63 G;  3M7N A;  3CC7 A;  1I5F A;  1IBK L;  1WJJ A;  2ATW A;  4LF6 L;  1XMO Q;  1J6Q A;  1NMF A;  1H95 A;  2VQF Q;  2XGT A;  2VZA A;  2UUC L;  5IP7 G;  2B63 H;  3K7U C;  5C0X I;  4LF5 Q;  4POG A;  1EWI A;  3L7Z C;  4DV0 Q;  2NVT H;  2WAQ G;  1K3R A;  2E2I H;  1S3O A;  2RHQ B;  5M5X H;  4A3C G;  1D8L A;  4LF4 Q;  4R4T A;  5IP7 H;  4DR1 L;  4R4I A;  4P72 A;  3ERS X;  4TQU S;  2MNA A;  1QVF A;  1IL2 A;  3F2D A;  4HIO A;  1E7Z A;  2KCM A;  4A3C H;  5LMN W;  3CW2 C;  4A4I A;  4DR2 Q;  1FGU A;  3ER0 A;  3GDE A;  4EX5 A;  1PH8 A;  4X65 Q;  2YTV A;  4PZ8 A;  2R92 G;  5LMN Q;  4DUY Q;  4BA2 I;  1I3Q H;  2PQA B;  3CMA A;  4LFA L;  1XNR Q;  3GTJ H;  1WCM H;  2N3S A;  4HJ8 A;  3TRZ A;  4AYB E;  1O7I A;  1YHA A;  1HZ9 A;  1N36 L;  1J5E Q;  2R92 H;  1Q82 C;  4JI3 L;  4LF8 L;  4IFD J;  3TRE A;  4DR6 L;  2JQO A;  1V9P A;  2F4V L;  1HNW L;  2BH8 A;  2XTI A;  3M4Q A;  3K7A H;  3A5Z B;  1QVG A;  3F8T A;  2AWO A;  2WB1 G;  2E2H H;  1A0I A;  3KDF B;  4IPH A;  4UY8 C;  5M3M H;  2R7F A;  4BY1 G;  4DV6 Q;  2VW9 A;  4DR4 Q;  3HOX G;  3G71 A;  1VQ7 A;  4A3I H;  3S1N H;  3PUZ A;  4A3F G;  1KRS A;  2UU9 L;  3K81 C;  4JI1 L;  4YCV A;  3RNU A;  1VQK A;  1CKN B;  1XNQ L;  3T1H L;  3RZD H;  1YJ9 A;  3PUX A;  1MJE A;  2C35 B;  4R4Q A;  1IBM L;  1YNX A;  1VS0 A;  4ME3 A;  4APV A;  3HOX H;  1PH2 A;  2UXB Q;  4K0K L;  1D7Q A;  4A3F H;  4GLA C;  1YIT A;  1HZB A;  3TQY A;  2WFW A;  4GNX B;  3I4O A;  1B70 B;  2E5L L;  2NN6 G;  3MEF A;  4JI7 L;  4JI2 Q;  2VNU D;  3M3Y H;  1HH2 P;  4DAY B;  1K83 H;  1LYL A;  4JYA Q;  1G6P A;  2CKZ B;  3RZO H;  1VQP A;  4JI0 L;  3GD7 A;  4WJ4 A;  1CSQ A;  1VQL A;  4R4O A;  3CPF A;  2NVQ H;  1B7Y B;  1PHJ A;  1SE8 A;  1SRO A;  1VQ4 A;  2IHF A;  3SGI A;  4DV2 L;  4LFC Q;  4GKJ L;  2NVY H;  1V1Q A;  4KLK A;  2HQL A;  1BBU A;  3HKZ E;  5C3E G;  4X62 L;  2UUB Q;  4LFB L;  1CKM A;  2R7Z H;  2OTL A;  4DR5 L;  2UXC L;  3K8A A;  1MIU A;  3J7A 5;  1K0R A;  1VQA A;  4LW1 A;  3IRB A;  2K14 A;  4PG3 A;  5C3E H;  4YCU A;  4YWK A;  1JB7 A;  4YY3 L;  2K5H A;  1UE1 A;  3KYH C;  2Y0S G;  4QIW E;  4A3M G;  2OWO A;  5LMU L;  3PO2 H;  1TWF H;  4MZ9 A;  1QZH A;  4DV4 L;  4H02 A;  1WOC A;  2Z6K A;  1JE5 A;  2MO1 A;  2KBN A;  1XMQ Q;  3M9B A;  2QEX A;  4GNX C;  3STB D;  4A3M H;  4DV3 Q;  4GOP A;  4DR3 L;  2KHI A;  2VUM G;  4NXM Q;  2JJQ A;  2N8N A;  1IYJ B;  2ZJQ A;  4DUY L;  3HOU G;  1NE3 A;  3HOW G;  4A76 A;  4BY7 G;  2L15 A;  5JEA J;  1U5K A;  3S1M H;  4QQB X;  4DK6 C;  2A8V A;  2PI2 A;  5C4X G;  1N34 L;  2VUM H;  1AE3 A;  4LUZ A;  1SR3 A;  4JG2 A;  5DLQ E;  4X66 Q;  3KJO A;  3HOU H;  3HOW H;  4BY7 H;  1UE5 A;  3I2Z A;  2QGQ A;  5C4X H;  1LM0 A;  1XPR A;  4B3T Q;  1A8V A;  5IYD G;  3K0X A;  4B3S Q;  3GTP H;  1U0L A;  2B3G A;  2IX1 A;  1XJV A;  3D0F A;  1VQ5 A;  4GKK L;  2EQS A;  1QZG A;  1HNZ Q;  2RHS B;  2LXJ A;  2VQE L;  1YJW A;  4A3J G;  5IYD H;  1IBL L;  1EIY B;  1VQJ A;  1Q12 A;  4QY7 A;  2OQ0 A;  1IZ6 A;  4DV5 L;  1K73 C;  3S15 H;  4DR7 Q;  1IXR A;  1YBY A;  2CQO A;  1SFO H;  4AH6 A;  1OXV A;  1YI2 A;  2HHH L;  1Q46 A;  4LNQ A;  2KEN A;  2JA6 G;  5AJ3 L;  2JA7 G;  1G29 1;  1V43 A;  3S24 A;  1UWV A;  5C4J H;  4A3J H;  3PGZ A;  1PH4 A;  1I94 L;  4DUZ L;  4ALP A;  3GTK H;  2LXK A;  4JI5 Q;  3NBH B;  2I5M X;  3PUV A;  2H5X A;  4MNO A;  4DR5 Q;  4A75 A;  1PH9 A;  2JA6 H;  2JK8 A;  2JA7 H;  4JOI A;  4OON A;  3G6E A;  1HR0 W;  4KHP Q;  3U58 A;  1PFS A;  5IY0 A;  1VCI A;  1N33 Q;  1L1O C;  3HKS A;  2I5H A;  4YHH L;  4LF7 L;  1Q1B A;  1JMC A;  1HR0 Q;  3TS2 A;  1OXT A;  2R6G A;  5J3B A;  1VQM A;  3JAM c;  4JI8 L;  4NXN Q;  1FVI A;  2ZM6 Q;  2JA9 A;  2CWA A;  1RL2 A;  4A3B G;  3ZJY C;  2A1A A;  2R93 G;  5C44 G;  3UDG A;  1EOV A;  4JI6 Q;  4C2M H;  3I4M G;  3CCM A;  4B3R Q;  3DM3 A;  2E8G A;  2KCT A;  5ELN A;  1EQQ A;  1UE7 A;  2ZJR A;  3PF5 A;  4OO1 G;  4QJF A;  4IJH A;  3I56 A;  1UE6 A;  4BA1 I;  5C44 H;  3OTO L;  3T1Y Q;  2R93 H;  3JC6 6;  3A0J A;  4JI4 L;  4AQY L;  3I4M H;  1MKH A;  4JV5 Q;  1X3G A;  3J81 j;  2ZTE A;  3J81 c;  1PH5 A;  3ICE A;  1GKH A;  1N32 L;  4HJA A;  4LUO A;  4A3G G;  2AHO B;  5BR8 L;  2IY5 B;  3J80 c;  1HJP A;  3F1Z A;  3PIO A;  2Z0S A;  1HNX L;  2GN5 A;  2BH2 A;  3S17 H;  3TS0 A;  1PH6 A;  4GOP B;  4BBR G;  4RMF A;  3ULL A;  4A3D G;  1NY4 A;  3GTQ H;  3H3V H;  1VQG A;  1OXX K;  2AKW B;  1JJ2 A;  4JBK A;  3PO3 G;  3NEM A;  1N8R C;  2UXD Q;  3U50 C;  2EXD A;  3F2B A;  3EBE A;  2GVA A;  4A3D H;  3HOY G;  2ZJP A;  1S40 A;  3W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...