4NB3A

Crystal structure of rpa70n in complex with a 3,4 dichlorophenylalanine atrip derived peptide
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a Potent Stapled Helix Peptide That Binds to the 70N Domain of Replication Protein A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 31
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4nb3A00
3RR5A 4IPGA 2JA8G 5M3FH 1NBWA 3TQYA 3JAMi 4ME3A 1P8LA 1TWCH 2VY3A 1YHQA 1I94L 2UUCQ 2JA5H 5GAHC 2Q2TA 1FGUA 2I5MX 3BU2A 3GO5A 5ELOA 4NXMQ 3H3VI 4BXXH 2K4KA 4TQUS 4GNXA 2Z0SA 5IP7H 4NB3A 4OX9L 3RLNA 1VQEA 1YBYA 3KJOA 2HT1A 4JI0Q 5IYBG 3K81C 4R4TA 4PMWA 1XJVA 1VQKA 3KLWA 2OQKA 3Q8DA 1WI5A 5HY6A 4A3IH 4UP9A 3H0GH 2HHHQ 2E8GA 1K83H 1PA6A 1QVFA 3GTOH 2GN5A 1SE8A 4R4IA 4RMFA 3W1GA 1J5EQ 1C7YA 1NMFA 5FJ8H 3HOWG 3PF4A 3CCJA 1WOCA 4X64Q 5FJ8G 2JEBI 4GNXB 1N33Q 3HOWH 1PH8A 3STBC 1OXSC 1VQGA 3HOXG 1Q7YC 1VQAA 3HKZG 4DR6L 2EIFA 1X3GA 1YIJA 1EOVA 4LF9Q 1WCMH 3J80i 1JJGA 3F8TA 2R6GA 1I5FA 1K73C 5C0XI 4JBJA 4LF9L 4MNOA 4NPSA 2Z6KC 1GO3E 2F3IA 3T1YQ 4X65L 1NE3A 3EBEA 4P75A 4QGUA 3M4PA 4BA1I 2PMZE 3GDEA 2Y0SE 2UUAL 4LF6L 2UUBL 4B3TL 2Y0SG 4JBMA 1TXYA 2CQOA 2IX0A 2IY5B 5E7NA 5IP9G 1YJWA 1FJGQ 4DR3L 4DAYB 1BKBA 4GLAC 1Q12A 1YI2A 4IOAA 4OXPA 3CCMA 1S40A 3L7ZC 4GN4B 1YZ6A 1X3EA 4GOPA 4OWXB 1XPRA 2E2HH 3TS2A 4X6AH 4LUVA 4A3GG 3GTJH 1B7YB 4DR2L 1Z9FA 5IP9H 3AEVA 1HZCA 1V9PA 2NVXH 1V1QA 4A3FG 1RIPA 1VQIA 3CCQA 2KENA 3T1HQ 2HIXA 5AJ3Q 1HZAA 4BY7G 2XGTA 4C2MH 4OONA 3KFUA 4QJFA 1XMOL 2F4VQ 3HOZH 2K75A 3M4QA 1U0LA 3E9IA 4A3JH 1QZGA 2K5HA 1X9NA 3PUVA 1WCMG 4NXNQ 1EUJA 2YV5A 4HIOA 3A5ZB 3UDIA 3KOJA 4P74A 3HOXH 4DR1Q 3PF5A 2NN6G 1N36L 4X64L 3LGJA 3HOVH 2JA6H 1M90C 4JI2L 1PHJA 1J5EL 4C3HH 5IY0A 4A76A 4DV2L 3CMAA 2F4VL 5C44H 4BA2I 1K0RA 4K0KQ 4B3ML 3H0GG 4GLXA 2JEAI 1XMQL 4JI0L 4DKAC 1IZ6A 3M4OH 5IYBH 4YHHQ 1KC8C 4LFAQ 2E2JH 4B3SQ 4HJ7A 3OW2A 1UE6A 3TREA 1XPOA 1ASZA 4LW1A 4YWMA 2VW9A 3U58A 2I0QA 2B63H 1A0IA 4BXXG 3PO3G 3OTOL 1VQLA 1LM0A 4LFCQ 4DV5Q 4J15A 2IHFA 3D31A 3PUZA 1PH9A 4BBSG 5JJIA 4A3MG 4JYAQ 2JJQA 1RL2A 4C3IH 5M5YH 4RG1A 1PH2A 4A75A 4LF5Q 4K0KL 1KXLA 1U5KA 1EFWA 4Y7NH 1Q81C 1HZ9A 2R92G 1LYLA 1BVSA 4UP8A 1V43A 2RHSB 2ATWA 4KHZA 3I56A 1K8AC 1NTGA 1WFQA 1OXTA 1PYSB 1VQ4A 1M1KC 4GLVB 2JK8A 4DUYQ 3D0FA 1N8RC 4MTNA 3SGIA 2DGYA 3I4NG 3CMEA 1IBLQ 4IJLA 3NELA 4LUZA 1N34Q 4BBSH 3CC7A 3G6EA 2VQEQ 4DV6Q 1NMGA 3S16H 3PO3H 4LF5L 3OYYA 2VZAA 5AJ3L 3NEMA 3HOYG 3S1RH 3S17H 4R1JA 3J81j 4GOPB 4DV4Q 3CD6A 5K36G 3G4SA 1D7QA 1S72A 1KRTA 4DUYL 3CPWA 3F1ZA 4GN5A 4DR2Q 4B3SL 1R9TH 5JEAG 5C44G 4WJ4A 4IPHA 4AYBG 2A8VA 4BY1G 4YCVA 2V1CC 3K80C 4B3MQ 4DR7Q 1EQQA 5IYDG 1PH6A 1K3RA 4QY7A 4KHPQ 3I2ZA 3RLOA 3PUYA 4LF7L 1MJCA 4DV7Q 2K5NA 4YWKA 4DV1L 4GOPC 3TS0A 3ICEA 2UXCL 4Y52H 4GKKL 5C4JH 1AH9A 1YITA 1IBKL 1IL2A 2MQHA 1E1TA 5GAEC 1UE1A 4X66L 2CKZB 4JV5L 2AWNA 1P16A 2JQOA 1Y1VG 4GS3A 3KF6A 4JI3Q 4POGA 5IWAL 2MO1A 3PV0A 5BR8Q 3RNUA 1E24A 2ZJPA 4QL5A 2UU9L 2D62A 4DV6L 3PO2G 1MIUA 3JAMc 3RN2A 5JEAJ 1HR0L 3KF8B 2N78A 4A3GH 2NVQH 1Q8KA 3PCOB 1HR0Q 4A3LH 3CP0A 2ZJRA 2K14A 4PZ7A 2A1AA 4HJ9A 2E5LQ 4X62L 3E0EA 4JI6Q 1CKNA 3AFQA 4JI8Q 2HHHL 2DUDA 4B3RQ 4QIWE 4A3KG 4APVA 4LF8L 3I55A 4DAMA 3ER0A 4LNQA 1UE7A 5J3BA 4OX9Q 1KRSA 2EXDA 1VQNA 1IBML 2C35B 2OWOA 2UUBQ 4B3TQ 4LF7Q 4DUZL 1HNWL 3MXNB 4JI1L 2L15A 4A3DH 2I5LX 1CSPA 1E1OA 1G291 1I50H 2CWAA 1OXVA 1IXRA 3HKZE 2R93G 3KYHC 2YTYA 5GAGC 4B3RL 1EIYB 4HJ5A 4IPCA 4LWCA 2MNAA 3S1MH 1N9WA 2ZTDA 3KDFA 1X65A 5FLXc 4IO9A 1YNXA 3U4ZA 3I4OA 4DK3C 3CCSA 4DV3Q 2ASBA 4OO1G 5C3EG 4JI2Q 2LXJA 5IE8A 4IFDG 4GKJL 2QEXA 4LUOA 3ULPA 2IX1A 2R93H 2B29A 1Y1WG 2JA7G 4A3IG 1XNQQ 1VS0A 5EAYA 4A3DG 1SN8A 2F52A 2Q2HA 3L0OA 3GTKH 1TWHH 2NVTH 4JI5Q 3U4VA 3AQQA 5DLQE 3I4MG 4HJAA 3EN2A 4JI8L 4YCUA 2NN6I 3CCUA 4DV0L 3E9HA 1QVCA 3PSIA 1XMOQ 1EYGA 1L2FA 1IBLL 1HH2P 2ZJQA 3FKIH 1QUQA 2Z6KA 3CC4A 5M3FG 5M5WH 2JA8H 4QQBX 1UEBA 2NVYH 4A3CG 1S3OA 2XTIA 3KJPA 2PI2A 4AIMA 2AMCB 4DV3L 4C3JH 1I3QH 1GVPA 4A93H 2VUMH 4R4CA 3S14H 2Q2UA 3RZDH 2N49A 4JV5Q 4X66Q 2B3GA 3HKSA 4LFCL 3ULJA 2R7ZH 1Q1BA 1W2BA 4A3BG 1VQJA 3KDFB 1YEZA 2R7DA 2KCTA 2CCZA 3TEHB 4PZ8A 2QGQA 4JC0A 1Q1EA 4TVAB 1I94Q 4P71A 3S15H 1FVIA 1OXUA 2OQ0A 1PH1A 4WJ3M 1D8LA 5IYCH 5GQOA 1VQDA 1N32Q 3GD7A 4XIGS 2D0OA 3U50C 4JI5L 3ULLA 1EQRA 3K7UC 1QUQB 1JT8A 1VQHA 2RF4A 1Q46A 3S2HH 4DR1L 4KI0A 1Q82C 2MFIA 4BY1H 3NBHB 2ZTCA 1MKHA 4O2DA 5FLMG 4LF4Q 4DK6C 3HOUG 2ES2A 1KHIA 3BZCA 1VQPA 2JE6I 4IPDA 1WYDA 1YHBA 2JA9A 2WAQE 1JJ2A 1LUZA 4OO1I 1PH7A 1JE5A 4L5SA 1FL0A 1TWAH 2KCMA 3CAMA 1JJCB 3BZKA 1X3FA 4DV5L 1VQ8A 1A62A 2CFMA 2K50A 4MZ9A 1IBKQ 1EWIA 2KBNA 1TWFH 2AKWB 4KLKA 3ZJYC 1KQSA 1VQ7A 1E3PA 5C0XJ 3CCEA 4DUZQ 3M3YH 4IFDJ 1PH3A 2UUCL 3I4NH 4KHPL 1PH5A 2BH8A 1HZBA 3RN5A 2UXDQ 1OTCA 1G51A 5M3MG 2ZTEA 3J81i 2ZM6L 3CXCA 3M9BA 4A93G 4YCWA 1L1OC 1PH4A 5LMUL 1C0AA 4H02A 3S2DH 3OTOQ 4GNXC 1GD7A 3TRZA 3K7AH 2QA4A 2BA1A 2UUAQ 4LF6Q 3FKIG 1L1OA 1CKNB 2E2IH 3GTQH 1HNZQ 4X65Q 2KHJA 1B70B 2WP8J 4PG3A 3I4MH 1K9MC 1O7IA 1PV4A 2WB1E 5BR8L 5LMNQ 2PI2E 2E5LL 4JOIC 2WFWA 5C4XG 4YY3Q 2JA7H 3F2DA 1AE3A 1X54A 5FLMH 5C3EH 4AQYQ 2R7ZG 4UY8C 1G6PA 3HOVG 5IWAQ 5HGQA 1KIXA 1OXXK 4JI4Q 1E22A 3A74A 2ID0A 3UDXA 5LMUQ 1VCIA 2GVAA 2ALYB 3CF5A 1VQ9A 3H3VH 2ZM6Q 5GROA 2YU9H 4JBWA 4DR4L 4A3JG 1VQBA 1XNQL 1QVGA 4LFBQ 5ELNA 1KAWA 1SMXA 1SRUA 2EQSA 2KHIA 4UPAA 3CPFA 3AYHB 3PIOA 3CW2C 4P73A 1VQCA 3WWVA 1YJNA 5M5XH 4OWWB 4A3FH 3J80c 4L5TA 4A3KH 2NZHA 4DV0Q 4A3BH 2VQFL 4DR7L 1I6HH 3H15A 4JBKA 2AWOA 4EX5A 2HQLA 3DLLA 3UE1A 4EQ5A 2UXBQ 1H95A 1YHAA 2H5XA 4A4IA 4AQYL 4JI1Q 3IRBA 1GKHA 4AH6A 4HIMA 4LF4L 4L5QA 1E7ZA 2WB1G 1X56A 1VQFA 4A3CH 1L0WA 3CC2A 3CCVA 3W5OA 2K5VA 1VQOA 1SFOH 1L1OB 3B6YA 1NJIC 3W1BA 2YTXA 2BA0A 1N34L 3FP9A 3M7NA 4P72A 1JMCA 4O0AA 4FDBA 3J7A5 1HNXL 1CSQA 4DPGA 2FXQA 1SROA 1CKOA 5C0XG 3J7ZC 1VQMA 2UXCQ 5IT9c 1PVOA 1Y1WH 1B8AA 5GADC 4LFBL 1XPUA 2LXKA 2UXBL 1N32L 3GTMH 2RCNA 2MO0A 4GN3B 4JG2A 4JI3L 3HFZB 3NENA 3CQZH 4L5RC 2OTJA 1BBWA 3J81c 4R4OA 3UDGA 2VQFQ 2D0PA 3UDFA 1QZHA 1JB7A 2LSSA 3STBD 4X62Q 4JI6L 4OWTB 1FJGL 3PUXA 5C4XH 1BBUA 2PQAB 4UP7A 1Z47A 2RHQB 1WJJA 4HIKA 1K8GA 1DGSA 3AFPA 1IBMQ 5IP7G 3BJUA 1CUKA 2YYZA 4DR4Q 2N3SA 2CWPA 5LMNL 1YJ9A 4NXNL 2JA5G 4JI7L 3S1QH 4JI4L 3A5UA 4XTCS 5JJLA 1UWVA 2IT1A 4DR6Q 1A8VA 4IJHA 4JCVE 2A19A 2VS1A 3ERSX 3F2BA 4HJ8A 1N33L 4A3LG 4DV4L 3K0XA 1KL9A 1UE5A 1W3SA 3PIPA 4IOCA 1SLJA 4GKJQ 5M3MH 3M85A 2R92H 4R4QA 3UE0A 1XTDA 2AHOB 3PGZA 1HJPA 1NY4A 3PO2H 4A3MH 1XNRQ 3DM3A 4BBRG 4A3EG 3GTPH 1Y1VH 3JC66 4IFDI 4YWLA 1MJEA 4ALPA 2B63G 3CCLA 4GKKQ 2OTLA 1C9OA 3RLFA 3G71A 4NXML 1Q86C 1A63A 4DV7L 1TWGH 3VDYA 3EIVA 1X55A 3KF6B 4DR5L 1HNWQ 3HOUH 1T9HA 1Y14B 5IYDH 5LMNW 4DR3Q 4LF8Q 4DV2Q 3G48A 2VQEL 4DR5Q 3GTLH 2UXDL 1CKMA 1VQ5A 4PZ6A 2JA6G 3S1NH 3F2CA 1VQ6A 2I5HA 1GM5A 4AYBE 1HNXQ 1ASYA 4LFAL 2IHEA 4POFA 5IYCG 3T1YL 3K8AA 2PQAA 4YY3L 1SR3A 1XMQQ 1KD1C 1XNRL 1PFSA 3HOYH 4HIDA 3HOZG 4JI7Q 2PNHA 2VNUD 3GTGH 4BY7H 1HR0W 4JYAL 3FHWA 1YVCA 1J6QA 3RZOH 4BBRH 4A3EH 3I7FA 2N8NA 1LTLA 1IYJB 1X6OA 2OCEA 2Q2IA 2YTVA 2WAQG 3CCRA 3T1HL 2NZOA 2VL6A 1HNZL 3A0JA 1N36Q 3MEFA 1AE2A 1PYBA 2VUMG 2UU9Q 2K52A 4DV1Q 3S24A 3PUWA 4YHHL 4DNIA 4JOIA 2HIVA 2BH2A 5JJKA 2GVBA 5H1SE 1EIFA 2R7FA 3L2PA
chains in the Genus database with same CATH superfamily
3RR5A 5M3FH 1A3TA 1NBWA 1JCKB 1QNKA 2X6LA 2Z4IA 1NCVA 4F87A 1YHQA 1XYIA 4DA2A 5JVG3 1JQYD 4TQUS 2D9UA 1AZQA 3KJOA 3T53B 3D8GA 3K81C 4RWSC 1TWHB 3KLWA 2OQKA 1WI5A 2HHHQ 1K83H 1YNND 4IFDH 3W1GA 4RMFA 1ET6A 1O80A 1BR9A 1LT4D 1N33Q 4IUUA 4FXGC 1OXSC 5ELEA 3HKZG 4FYDA 3N6RA 3F8TA 1VMCA 3TMEA 2F3IA 1LV9A 1WD1A 2NYZD 4RA8A 4G7ZC 4X3KA 1QNUA 3GDEA 4LF6L 2WIIB 1U4PA 2UUBL 4B9XA 2Y0SG 2CQOA 5E7NA 4Z9CB 1TU2B 1I4PA 4DAYB 1YI2A 4IOAA 4K6DA 4OXPA 1PXUA 2F0KA 4GOPA 1X3EA 4KMUC 3HEJA 4A3GG 1Y1VB 3NQTA 1B7YB 3H09A 3R2TA 1HZCA 4QF4A 2L1BA 3T1HQ 1J8IA 3MFGA 3MXUA 4G57A 1MD2D 2NBFA 1SYGA 2K75A 2M2LA 1U0LA 4KY6A 3V96A 4NXNQ 4HIOA 3KOJA 1GUSA 4X64L 1TWFB 3HG9A 4JI2L 3MXPA 3ERQA 1LT6D 1TQOA 1E2VA 3D4DA 2ZXRA 1T5EA 1K0RA 3H0GG 4PMCA 3J7AV 5CV9A 3K6OA 4U673 1XMQL 3M4OH 1IZ6A 3S17B 5IYBH 4YHHQ 1EIGA 1KC8C 3RZOB 4A3EB 3JAML 3DEPA 4LFAQ 3TBIB 4HJ7A 2KVMA 2SEBD 3TREA 1EY5A 2NVYB 2WB1B 4DV5Q 3D31A 4ZKCB 4RG1A 1FR3A 5LL6X 1PRTD 2A68C 1Q81C 1D5XC 1V43A 4UP8A 4KHZA 1SE4A 1NTGA 4K6LA 4PQXA 5COYA 2JK8A 4DUYQ 1GJXA 1ESRA 1TY0A 3SGIA 4CKCA 2DGYA 1CA6A 4NP5A 1S4ZA 3CMEA 3QWNA 1GUNA 1K8OA 1I3QB 2VQEQ 1QG7A 4LF5L 4FVMA 3NEMA 2EYOA 1PRTF 1Y8OB 2Z9HA 1KRTA 4CDCC 2B63B 4N8FA 4DXFA 2A8VA 1EEFD 3FRPB 3TZDA 1A2TA 3K80C 2MGSA 3SK5A 3NE5B 4NDXA 3RLOA 4DV7Q 3TS0A 2K5NA 4YWKA 4GOPC 4K2KA 1BNZA 1CQFA 1EWCA 1K0SA 1KABA 3KF6A 4POGA 3GTLB 5L37A 5BR8Q 2OEOA 1BCPB 4QL5A 2UU9L 1PZKD 2CH4W 1MIUA 4A3GH 1GUTA 1V8QA 3E0EA 4B08A 2D2CC 3I4MB 3AFQA 3J80L 2D5DA 4LF8L 3DWPA 3ER0A 4LNQA 2EXDA 4UHVA 1VQNA 1HUMA 2C35B 2F1MA 3BVZA 4KJNA 3MXNB 1SYCA 2EJFC 3BDCA 2SNMA 5LHY1 1E1OA 4XT3B 2R93G 2YTYA 4B3RL 2HDMA 4IPCA 4LWCA 3S1MH 2AUJD 1X65A 2CQAA 4DV3Q 2ASBA 2G9HD 4IFDG 2R93H 4GKJL 2QEXA 2XN9C 4WFN3 1RD9D 3I91A 5E4XA 3L0OA 2WKCA 1TWHH 1SYFA 2L11A 3TDQA 4HJAA 2NN6I 1XMOQ 5AFWA 2ZJQA 4DK1A 2E2JB 2K32A 2R3ZA 1L0YB 4QQBX 2X69A 5M3FG 1S3OA 2XTIA 2PI2A 4OGQC 2EY6A 3S9WA 1AZPA 2WACA 4NW2A 5EBCA 1BXTA 1JWSD 1Q1BA 2NUCA 4A3BG 1TVXA 2R7ZB 5I9OA 2QGQA 5FO7B 2JP1A 5DM73 4TVAB 1I94Q 3NQIA 4P71A 3NXWA 4XXEA 3S15H 1FVIA 4PMBA 5IYCH 5GQOA 2BDOA 5CV8A 3U50C 3ULLA 3P7JA 3SVMA 1SE3A 1LTGD 3LWEA 5M5WB 2JA8B 3A8KE 3HOUG 3CRKC 1KHIA 3BZCA 2ES2A 2JE6I 4IPDA 2WAQE 1LUZA 3EFXD 1GUOA 2E2DC 1PH7A 3S14B 4MHEA 1TWAH 2KCMA 4QUFA 3BZKA 4DV5L 1A62A 5C3EB 2J0TD 3BYYB 5J39A 1JWUD 2JA5B 2HCCA 3M3YH 3ZJYC 4F8MA 4PNYA 5M3MB 4KHPL 5FOBB 4RKLA 2UXDQ 1OTCA 5M3MG 2I46A 3CXCA 3C2PA 3NP8A 2F0LA 4YCWA 1ENAA 2PCFB 4QCLA 1C0AA 2WINB 4GNXC 1I4XA 3PQIA 1EWHA 2PNRC 5CBEE 1CKNB 5TSSA 5A2QE 2LS01 4X65Q 1WTQA 2WP8J 2PW7A 3K5MA 3I4MH 1O7IA 3BYTB 2J4XA 3QG1A 4F7XA 2WFWA 3K5NA 2JA7H 1D1KA 4ME5A 2X6GA 3GV6A 3I4LA 1Q3LA 2JSOA 2PO4A 2R7ZG 5J22A 1G6PA 2EYPA 3S16B 4ZLTF 3UDXA 4QUCA 2ZXOA 3ITPA 2A73B 2YU9H 4OELB 3M7GA 3VYUA 2EYHA 1SRUA 2MUYA 4HSVA 2AUKA 2O2LD 2QILA 2EQSA 4K8IA 2F0MA 3SK4A 3TP6A 3PIOA 1YJNA 5M5XH 4OWWB 4A3BH 4DV0Q 1A3UA 2VQFL 1PDQA 3VR6A 5JPMC 4UDUC 3UE1A 4EQ5A 3D4WA 2H5XA 2XIWA 3E5SA 4JI1Q 2F0JA 1GKHA 4HIMA 1VQFA 4RCOA 4C1NK 4X3TA 4A93B 5C44B 2B2YC 2F0UA 4HN7A 2FXQA 1SROA 1VQMA 5IT9c 5CGKA 5IOCA 4K2LA 1V1PA 4E6IA 1XPUA 1FGBD 1PFNA 4ZCKA 3H3VC 1N32L 2K03A 4JG2A 4JI3L 3HFZB 4G7HC 4L5RC 1K83B 4R4OA 2KUMA 1D6EC 4X62Q 3PUXA 5C4XH 1IW7C 1BBUA 4UP7A 1EFID 3NWTA 3V2TA 3A8JE 2YYZA 1HA6A 4DR4Q 4RAUC 4KKTA 1NR4A 1DOKA 5EJWA 2VS1A 3F2BA 1N33L 1GUWA 4DV4L 1UE5A 3PIPA 4GKJQ 3UE0A 3KBXA 4C3IG 4BBRG 1F9QA 3MAQA 3JC66 2B63G 1OO9B 1C9OA 2BCOA 2EJMA 1BF4A 3Q24A 2K01A 3NBIA 3EIVA 4RGOS 2B2VC 1X55A 4L6TB 1NR2A 5LMNW 4DR3Q 4LF8Q 1CKMA 2JA6G 1TWCB 4IUPA 2N88A 2I5HA 3DWQA 5FLXE 4LFAL 1ZEQX 3T1YL 3K8AA 2TSSA 2Q8RE 1CT1D 1SR3A 2EJGC 1FYCA 1WTHA 1XMQQ 2B2UC 2VNUD 3GTGH 3AU7A 1J6QA 4A3EH 2Q2IA 1X6OA 2WAQG 2VB2X 3HOWB 3A0JA 2K52A 1MSHA 3PUWA 4A3KB 5FK9C 4GZYC 3F2UA 3OHXC 1LTSD 5H1SE 2JA8G 3TQYA 4XQJA 1P8LA 1SYBA 2NWGA 2JA5H 1FGUA 2I5MX 5J1ZA 4NXMQ 1EQTA 1A2UA 1RF2D 2Z0SA 1YBYA 4JI0Q 5IYBG 1XJVA 4R4TA 3V05A 5HY6A 3Q8DA 4A3IH 3H0GH 4FF2A 4ILWA 3DWAA 3GTJB 1C7YA 4OO1H 3S1QB 1ML0D 5FJ8G 5DAUA 1YNNC 3STBC 1PH8A 1Z7TA 1RODA 1BOSA 4LF9Q 2PPBC 2KHSA 3J80i 1RTNA 4OEMB 4JBJA 5M9OA 4MNOA 5C0XI 4LF9L 2F0TA 5M3FB 4I65A 4QGUA 3M4PA 2PMZE 4B3TL 2OF1A 2JA6B 1F77A 1TXYA 2IY5B 1F9SA 1Q12A 1ICFB 2EXZA 1S40A 1FD7D 3PO2B 2E2HH 1K8MA 4XQNA 4DR2L 1Z9FA 1EY9A 3W2DA 1V9PA 5EGTA 4A3FG 3CCQA 1AP0A 1LTAD 5M5XB 3I73A 3HOZH 5KRUA 5K5PA 1EZ8A 4A3JH 1C48A 1QZGA 4G7OC 4XYOA 4EQPA 4CKEA 5FO9B 2DJGC 2NN6G 2R93B 2F3VA 5IT9L 1PHJA 1WTXA 1D2BA 4GLXA 4JI0L 4DKAC 3S1RB 5KYLA 2E2JH 1UE6A 1XPOA 1ASZA 4LW1A 4YWMA 2I0QA 2NVXB 3OTOL 1VQLA 1E2ZA 3VA7A 4LFCQ 1NSNS 3Q6SA 4A3MG 3OWEB 3LNNA 1KXLA 4BY7B 1CK1A 4H0LC 3R8BA 3DXJC 1ILQA 2MJ8A 1LYLA 2R92G 1KLUD 4IUNA 3I56A 1OXTA 1PYSB 5ELCA 1VF7A 2F0GA 4GLVB 4MTNA 1B4OA 2JXMB 3I4NG 4BBSH 2PZWA 3PO3H 1JOKA 1IHZA 2RSOA 1IKLA 2F0WA 3S17H 2O5IC 3A56A 2EYJA 4RKBA 1D7QA 3RD4A 3CPWA 4B3SL 4JK1C 1R9TH 4IPHA 4AYBG 3MXNA 4BY1G 2EY2A 2RKSA 3VR4A 4A3IB 2V1CC 2ICIA 4DR7Q 1BCPC 5CV6A 5IYDG 1PH6A 1A3VA 1U4LA 3PUYA 4CDFC 4DV1L 5C0XH 3ICEA 5IGFA 1KDAA 1B3AA 3KF8A 4XYQA 5BN4A 1E1TA 4RH6A 3HZXA 4GS3A 1I4QA 4JI3Q 1RKNA 3PV0A 4LK1C 4DV6L 2A5HA 3JAMc 1HR0L 3KF8B 4G4KA 3FEWX 4WORA 2NVQH 1D5ZC 1Q8KA 3GV3A 1HR0Q 2ZJRA 2K14A 4PZ7A 1LTTD 4JI6Q 4J6HA 2HHHL 4JI8Q 2A6HC 4KN7C 4ODGA 3I55A 3J81E 4M1UB 1UE7A 1KRSA 1DD2A 1HTPA 2F4IA 1M8AA 4LF7Q 1HNWL 3FPPA 1JC7A 1CZWA 1I50H 1HTLD 3HOZB 1OXVA 1IXRA 3HKZE 2LKVA 2MP1A 1EIYB 4HJ5A 2MNAA 5EBDA 2ZTDA 5FLXc 1YNXA 3U4ZA 4DK3C 4HSPA 4K5XA 2BE5D 5KYIA 3VYSA 2LXJA 5IE8A 1H9KA 5C3XA 3A7LA 1PFMA 1YNJD 2NTTA 2B29A 3MA2B 1VS0A 4A3DG 2F52A 3NBHA 2B39A 2NVTH 3U4VA 1JORA 5C6AA 3EN2A 4DV0L 4YCUA 1K8AC 1QVCA 3PSIA 1HH2P 4UAIA 3S2HB 3FKIH 2Z6KA 3CC4A 1MGSA 3KJPA 1VF5C 4AIMA 1TWGB 2Y0SB 3QJYA 4B9WA 4A93H 2VUMH 5I2YA 2JN4A 2N49A 1C4QA 2B3GA 1QCBD 1YEZA 4L63B 1SNCA 4MIUA 2CCZA 5ELDA 4K5WA 1KNAA 4Q5VA 1EYDA 4O1NA 2OQ0A 5JAVA 1N32Q 3TP8A 3GD7A 4JI5L 5IIFA 3SDZA 4DF7A 1VQHA 4KI0A 1Q82C 1NAPA 2MFIA 3GTQB 5D14A 1MKHA 2SOBA 3R2IA 1V1OA 4LF4Q 1HHVA 2PMZB 4OO1I 1JE5A 1FL0A 1BCPF 3OIQA 1X3FA 1GOZA 3SXHA 1T5XD 1TWFH 3ZYYX 5C0XJ 1WTVA 4IFDJ 1PH3A 2UUCL 2HCIA 3VYTA 1PH5A 1HZBA 3RN5A 1G51A 3J81i 3M9BA 3EA6A 2K28A 4IN3A 2IPKD 5D65A 5DNFA 3OTOQ 3TRZA 3K7AH 4LF6Q 2A74C 2K5DA 3KUPA 1X32A 2E2IH 4MN3A 3DM1A 1TS4A 1C8CA 1I6HB 2EVBA 1G6ZA 3C3LA 1WTPA 3QB3A 5LMNQ 2E5LL 4IALA 1SNPA 3F2DA 3UI2A 1AE3A 1X54A 5FLMH 5C3EH 2K6AA 4AQYQ 3DUZA 1TS2A 4BBSB 2L0CA 5CV7A 4JI4Q 1WTRA 1HQMC 3PO3B 5LMUQ 3BG3A 3CF5A 3DMUA 4FNFA 2ZM6Q 2A69C 2ICEC 4JBWA 3S1NB 1VQBA 1QVGA 4LFBQ 5ELNA 3SE0A 4DFAA 4UPAA 4NKLA 1VQCA 3WWVA 3J80c 4A3KH 2NVTB 2NZHA 3CQZB 4JBKA 2AWOA 3DLLA 2HQLA 3RZDB 1YHAA 3E0JA 3IRBA 2IW3A 5I6YA 4U68A 2WB1G 3HOVB 3CC2A 3VA5A 4IUQA 1EU3A 1UUPA 2QDLA 4C3HB 1NJIC 4HCSA 2VUMB 2QKIC 2YTXA 2RBMA 2BA0A 4YIJA 4CBVA 4H7BA 4P72A 1JMCA 1IYVA 4O0AA 1EOTA 1AN8A 4FDBA 1HNXL 1CKOA 2UXCQ 2NZ1D 1B8AA 5GADC 2IL8A 2WV6D 2LXKA 2GA4B 2KJXA 3SEBA 4GN3B 4NMZA 1S5DD 1PFBA 4EQOA 4CDDC 4C3IB 1PTOH 2EYFA 3UDGA 1QZHA 1JB7A 1AFPA 5K36H 2RHQB 1WJJA 1RTOA 3BJUA 4KD4A 2CWPA 1YJ9A 1HFNA 2E75C 4JI7L 4RGNA 3S1MB 1JOQA 1F2MA 1UWVA 2F0VA 1S5ED 3S2DB 1H9SB 3ERSX 4A3LG 4FXDA 1SLJA 3M85A 1STHA 1H9MA 1XTDA 2AHOB 2K33A 3PGZA 5ELFA 5KGUA 1XNRQ 1Y1VH 3CKIB 3OOCA 5EPKA 5CORA 1MJEA 1ENFA 3HKZB 1V1PB 2OTLA 4GKKQ 2DY7A 3BVMA 4QMGA 1Q86C 1A63A 1TWGH 4ZUJA 1SNOA 1S5BD 4DR5L 4F88A 1XX8A 4DR5Q 1MHWC 1GUGA 2UXDL 1U4MA 3I8ZA 5JEAH 3F2CA 1I4GA 4AYBE 1HNXQ 1KTKA 2FINB 3H94A 4DNRB 1SMYC 3HOYH 5C5LA 3T51B 2PNHA 4BY7H 3FHWA 3RZOH 3I7FA 2KECA 1IYJB 3G7LA 2YTVA 3EJIA 2VL6A 1LABA 1AE2A 4FF3A 3PIP3 2K7VA 5EPLA 4C3JG 4DNIA 1WCMB 4DN4M 2BH2A 5JJKA 4ZRZA 3URYA 2R7FA 1NMFA 5EPJA 2HDLA 2KA7A 3JAMi 4ME3A 3VR2A 1TWCH 2UUCQ 2F0HA 3SR1A 1JB3A 3M3YB 2Q2TA 3BU2A 4J8QA 4BXXH 2RDGA 3K58A 1R9TB 5IP7H 1B9MA 3RLNA 1VQEA 2HT1A 2EPBA 1VQKA 4UP9A 4CGYB 2E8GA 3NUCA 1J9OA 2GN5A 1SE8A 2NTSA 2EOTA 1J5EQ 3HOWG 2Q8IB 1SDFA 3HOWH 2E2IB 5CYUA 4P2CB 1Q7YC 2A6EC 3K57A 4DR6L 5G3LF 1X3GA 3RUZA 1YIJA 5IGBA 1R4PB 4AYBB 1SAPA 4NPSA 4R8IA 1GO3E 3MC0B 3T1YQ 1NE3A 1LTBD 3CHBD 4P75A 2PZUA 2UUAL 2Y0SE 4RFBA 1LT5D 2IX0A 5IP9G 1FJGQ 4DR3L 3H6MA 1BKBA 4GLAC 3D4RA 5FKAC 1ESFA 4GN4B 1YZ6A 2QF7A 3M4OB 2XWBB 1XPRA 4X6AH 4LUVA 3GTPB 3FMCA 4RHRA 1Y8NB 1RIPA 1SSOA 1HQRD 2HIXA 5AJ3Q 4BY7G 2XGTA 1BUVT 5KNDA 2F03A 4QJFA 2F4VQ 4M8AA 4A3MB 4Y7NB 4DU9A 3E9IA 1DONA 3U9SA 1WCMG 2CW0C 1SNMA 1EUJA 2YV5A 4DK0A 4ZUIA 3A5ZB 2AQ1B 4P74A 3HOXH 4WJWA 3HOVH 2B8FA 1M90C 3IFDA 3H91A 4C3HH 1STNA 4CKBA 3I4NB 3GTKB 4FXKC 3T56B 2PW5A 3CMAA 5C44H 2F4VL 4BA2I 4K0KQ 4B3ML 2JEAI 3X3NA 4C1NI 4RHSA 3NTHA 4B3SQ 3TP7A 4HTHA 3U58A 1EIHA 4RCNA 1A0IA 2O4XA 4J15A 3MHBA 3JAME 2IHFA 1PH9A 3PUZA 4JYAQ 1TY2A 5M5YH 3LWUA 4K0KL 1PH2A 4LF5Q 4A75A 1AEXA 4BWGB 1EFWA 1HZ9A 2OXPA 1BVSA 5EKLA 2L4NA 2RVLA 1WFQA 1EY4A 5HURA 3D0FA 1N8RC 3HP3A 4HCEA 4IJLA 3NELA 1LLRD 1N34Q 3G6EA 4QB4A 1LTID 3O13A 3OYYA 5C4ZA 2FMCA 2VZAA 3J81L 4R1JA 4HEDA 3J81j 4V0BA 3CD6A 1PTOF 4HMIA 3G4SA 5K36G 1S72A 4DUYL 3MVVA 4DR2Q 4GN5A 2HD3A 1BBXC 5C44G 1ZYRC 3OIPA 1EQQA 1Y8PB 3NPPA 1K3RA 4X3SA 4QY7A 4DGZA 5IGDA 2IX3A 1F2LA 3I2ZA 1JICA 4LF7L 4KHPQ 1HNWQ 4K14A 4GKKL 5C4JH 1YITA 1IL2A 1O7LA 5GAEC 1UE1A 4X66L 4JV5L 2AWNA 1P16A 2JQOA 1IKMA 1NNXA 3BDLA 1Z6HA 5IWAL 2MO1A 3RNUA 3PO2G 1E24A 1SJED 2D62A 3RN2A 4N9PA 1U9RA 3PCOB 4HJ9A 4X62L 3HS0C 4B3RQ 4A3KG 3K0YA 4DAMA 5J3BA 1W6JA 3A54A 1IBML 2UUBQ 4XDXA 1UNSA 1S5FD 2I5LX 1CSPA 2XRQD 3ONAB 4Q0FA 3RMHA 2CWAA 2F0OA 4RGMA 3AMUA 2J7ZA 3CU7A 3TP5A 1N9WA 1EY8A 1STBA 3I4OA 2QDBA 2XNAC 5C3EG 3WOFA 1Y1WG 1E2WA 3IAYA 1DJRD 1SN8A 3NTIA 5E1FA 1O7YA 4FF1A 3GTKH 1K3BC 2R92B 3MZ5A 1DOMA 2L12A 4N9TA 3AQQA 5DLQE 3CCUA 3E9HA 4FO2A 2K1BA 1IBLL 3K5OA 3T16A 1EZ6A 3Q22A 4A3CG 1SYDA 2MPMA 2AMCB 4C3JH 4KKUA 4H44C 1I3QH 1GVPA 4R4CA 3S14H 1HCZA 4X66Q 3HKSA 3ULJA 4K5VA 1VQJA 3KDFB 2R7DA 2KCTA 2XRSD 3TEHB 5C4HA 3I90A 1DZ1A 4JC0A 1Q1EA 1AW7A 1OXUA 3GQBA 4WJ3M 1HFGA 5A35A 1D8LA 1IL8A 4KY7A 4I7ZC 1SXTA 2H1EA 2D0OA 3QOJA 4JVZA 3K7UC 1PZID 1JT8A 3C46A 5I6WA 3NBHB 4O2DA 1BQQT 1GHKA 4EVOA 4DK6C 2K05A 1WYDA 1YHBA 1A15A 2JA9A 3EVQA 3CAMA 1VQ8A 2CFMA 3T4AC 5C4XB 3HOXB 1IBKQ 2L9HA 1EWIA 1EQVA 3D3RA 4A3GB 4KLKA 3J7YW 5C4JB 4DUZQ 4KV6A 3VYRA 4IQZA 2BH8A 4A93G 2ZTEA 2ZM6L 1L1OC 4PV1C 4DAPA 3P20A 1F9RA 1GD7A 3I3CA 2BA1A 3QOLA 4ULLA 2UUAQ 3FKIG 5CV4A 1LT3D 4ABNA 1HNZQ 1U4RA 2XVSA 2Q8TA 1K9MC 1PV4A 1KNEA 2WB1E 5BR8L 4R8NA 4JOIC 2NB0A 4YY3Q 2BOSA 3L9AX 1II3A 4C3HG 2Z4HA 3HOVG 5HGQA 2OT2A 2R61A 1OXXK 1E22A 3A74A 5KIXA 1VCIA 2GVAA 2ALYB 1VQ9A 1EEID 1EYCA 5GROA 3R93A 1XNQL 5ELBA 1KAWA 1SMXA 3ND9A 3CPFA 1ZYRD 3NHHA 2G9DA 1PTOD 3H15A 2IWHA 4EX5A 2K04A 2F0QA 1H95A 1CI3M 4A4IA 4LF4L 5C3WA 4L5QA 1E7ZA 1Y69U 4A3CH 1L0WA 2LFNA 5IGCA 4CHTB 3CCVA 1SFOH 2B2WC 3W1BA 3BS1A 1CZGA 1SNDA 4KHVA 2KCCA 3FP9A 2A68D 2YU9B 3KLRA 4DPGA 4KN4C 5C0XG 5T1GA 4X3UA 3OSOA 1Y1WH 1SBBB 1BCPD 4LAAA 2UXBL 2MO0A 1XTCD 3A7AB 3NENA 2OTJA 1BBWA 2LMCB 2Z8LA 3C1EA 1Z47A 3BDOA 4BY1B 4ZK9B 1B50A 1HUNA 3AFPA 1IBMQ 2SDFA 5IP7G 1CUKA 4OIKA 1LACA 2N3SA 3TZUA 5LMNL 1TIID 4NXNL 4JI4L 5JJLA 1CFMA 2XWJB 2IT1A 4DR6Q 1PYWD 1A8VA 2RSNA 4IJHA 4JCVE 5IT9E 4HJ8A 2ZXPA 3WOEA 3K0XA 1KL9A 3AB9A 2DNCA 1O7ZA 2AQ2B 1TR5A 2R92H 4ZQ3A 1FNVA 4C2MB 1HJPA 3PO2H 4A3MH 1DYQA 5IGGA 3GTPH 3E3XA 3LX0A 4IFDI 2F3WA 4ALPA 2H4OA 3RLFA 2ZT9C 4QIWB 2ENBA 1UAPA 1LO5D 4DAYA 2XSCA 3KF6B 1T9HA 2TMPA 4RGTA 4A3JB 1MI2A 1BO0A 2B2WA 4OL7A 1W6KA 3G48A 2VQEL 1Q90A 4JPBW 4PZ6A 3OWFA 4TRDA 3P75A 1RDPD 3FVQA 4ID6A 2IHEA 2B2TA 3G6JB 5D3DA 1KD1C 2M9VA 4A3BB 3HOZG 4HIDA 2QW7A 3H0GB 4JI7Q 4XQQA 1HR0W 4JYAL 1YVCA 3TSSA 1LTLA 2OCEA 3T1HL 1KDCA 3MEFA 1PYBA 1PMRA 1DM0B 2VUMG 2KCNA 4DV1Q 4A3DB 3S24A 3BVGA 4JOIA 2HIVA 5HGTA 1EIFA 3IKJA 1QWYA 3L2PA 2I07B 2B8GA 4IPGA 1QILA 1O78A 2VY3A 1I94L 5GAHC 1SJHD 2F0FA 3GO5A 5ELOA 3H3VI 3FDTA 2K4KA 4GNXA 4OX9L 4NB3A 1GXDC 4PMWA 5EKKA 1S5CD 2DY8A 1PA6A 1QVFA 3GTOH 1MBYA 2B2TC 4R4IA 1QE6A 3DEOA 1NUCA 5FJ8H 3PF4A 3CCJA 1IW7D 3OW7A 1WOCA 4X64Q 4GNXB 1B3QA 2JEBI 3KK7A 5EQ0A 1VQGA 3SHLA 2EY5A 3HOXG 1VQAA 1G2TA 2EIFA 1FNWA 1EOVA 1WCMH 1JJGA 2R6GA 1I5FA 1K73C 1SEBD 2Z6KC 3P1HA 4X65L 3EBEA 3VR5A 3TN2A 4BA1I 2DJFC 1H9JA 3ND8A 4K8JA 1WTWA 1ICWA 4JBMA 1YJWA 1D1IA 4XT1B 5CMDA 3S15B 2KEDA 1CHPD 1D5MC 3CCMA 1SNQA 3L7ZC 1L0XB 4OWXB 3TS2A 1STEA 3GTJH 5IP9H 3AEVA 2NVXH 1V1QA 1VQIA 1G91A 2KENA 2CVRA 1HZAA 4C2MH 4OONA 3X3MA 3KFUA 1PTOC 1XMOL 3M4YA 3M4QA 2K5HA 1X9NA 3PUVA 2QCPX 2Z1CA 2EZVA 4CDEC 1SE2A 5JVH3 2E74C 3UDIA 2O5JC 4DR1Q 3PF5A 1N36L 3LGJA 3OPOA 5FO8B 2JA6H 2C5CA 1SFOB 3A8IE 1J5EL 5IY0A 4A76A 4DV2L 2CH4A 1M4VA 2RCFA 3GTGB 2E2HB 4BBRB 4I7AA 3OW2A 3A55A 1Y1WB 5IGEA 2VW9A 2B63H 4BXXG 3PO3G 1CA5A 1CM9A 1LM0A 3MEHA 1F9PA 2EDGA 2F0EA 4BBSG 5JJIA 4C3JB 2JJQA 1RL2A 3IL8A 4TKOB 4C3IH 3NWSA 1BDOA 1U5KA 4Y7NH 3VR3A 3E6ZX 2KEEA 2RHSB 3FKIB 2ATWA 3NK9A 5D3IB 1M1KC 1VQ4A 2KOLA 2Z6BA 3KLSX 4HMJA 1IBLQ 4LUZA 1VMPA 1JR0D 3CC7A 4DV6Q 1NMGA 3S16H 5F2DA 5CBAE 5AJ3L 3HOYG 3S1RH 2RQXA 4GOPB 4DV4Q 1I4RA 2NVQB 1PZJD 3F1ZA 1F2YA 5JEAG 1ILPA 4WJ4A 2EYLA 4A3FB 1KLGD 3I70A 1KDBA 4YCVA 5E3FA 1EY6A 1TS3A 4B3MQ 5M5YB 2NN6H 4KJOA 3HGBA 1MJCA 4Y52H 2UXCL 1G2SA 5DM63 4CJ0B 1AH9A 1IBKL 2MQHA 3J7AF 2CKZB 4ZAIA 1Y1VG 3MFYA 1EY0A 2ZJPA 1WTOA 5JPNC 2N55A 2HQEA 5JEAJ 2N78A 3IFTA 3T13A 4HAEA 5JOBA 3CP0A 4A3LH 1VDZA 2A1AA 5IODA 2E5LQ 3CRLC 2RA4A 2EY1A 3D6WA 1CKNA 4IUVA 2DUDA 2RDHA 4IUTA 4QIWE 4APVA 4EQNA 4KY5A 4OX9Q 1MSGA 4OIJA 1I6VC 2A6ED 2OWOA 2PYKA 4B3TQ 2A6HD 4DUZL 4JI1L 2L15A 2VB3X 5A2QL 4A3DH 3R3OA 1G291 5LL6S 3U9OA 3KYHC 2SNSA 5GAGC 1DXMA 2R7ZH 3KDFA 4IO9A 4OO1G 3CCSA 3Q0AA 2VXWA 4JI2Q 4LUOA 2BE5C 4J1MA 4BS9A 4CJ2C 3ULPA 2IX1A 2JA7G 4A3IG 3OMCA 1XNQQ 1JE4A 3DHQA 3GP7A 5EAYA 2E76C 2Q2HA 4JI5Q 5BN3A 3I4MG 1CQVA 4JI8L 1H9SA 1EYGA 1B2TA 1ENCA 1L2FA 3BZDB 4JW0A 1IYUA 1QUQA 5M5WH 2JA8H 1UEBA 2NVYH 1PLFA 4EGVA 4DV3L 2L55A 2EE1A 1HA5A 3K5LA 5E4WC 3RZDH 2Q2UA 4JV5Q 4LFCL 1W2BA 1EY7A 1SMYD 5I2XA 2PQEA 1KAAA 2MHVA 4PZ8A 2DNEA 4V190 1B53A 3FPUB 4FF4A 1R4QB 3HRZC 1PH1A 3GTMB 2EYMA 1VQDA 4KK7A 3D6CA 4XIGS 5EKIA 1EQRA 1X3PA 1QUQB 2RF4A 1Q46A 2F0PA 3WDNA 3S2HH 4DR1L 4FP5D 1B44D 1XWEA 4BY1H 2ZTCA 1TT2A 5I4DA 5FLMG 1G8ZD 1VQPA 2F0DA 4LJZC 2LY7A 4KKSA 5FLXL 1JJ2A 1PTOB 4L5SA 3KLSA 5KEEA 3L3OC 1JJCB 2JA7B 4KD3A 2K50A 4MZ9A 2AQ3B 2KBNA 3PMFA 2PZTA 5BN5A 2AKWB 1KQSA 1VQ7A 1E3PA 3CCEA 1TKWB 3I4NH 1HXYD 1LTRD 1PH4A 5CC4A 5LMUL 2RDFA 4H02A 1STGA 3S2DH 2C9OA 2QA4A 1QB5D 1L1OA 2DN8A 1ZXTA 3GTQH 4HR7B 3EROA 2KHJA 1B70B 4PG3A 1TS5A 1PRTC 5G3LD 3HOUB 2PI2E 3KBGA 1RJTA 3MWYW 5C4XG 4WRDA 1B1ZA 5JJZA 3MTSA 1ZKOA 4UY8C 1A6XA 5IWAQ 5ISRA 1X3QA 1KIXA 1EYAA 2FHTA 5T1IA 2ID0A 1EL0A 1XXGA 3C1FA 3H3VH 4DR4L 2HUGA 4A3JG 3PIO3 3K7AB 2WKDA 2KHIA 2CW0D 3AYHB 3CW2C 3OMGA 4P73A 4A3FH 3HOYB 4L5TA 4CJ1B 4DR7L 1I6HH 2FMMA 4DXGA 1JWMD 2IJ0A 4KTAA 4MTKA 3EQLC 2UXBQ 5NUCA 4AQYL 4AH6A 2FJ2A 1X56A 1H9RA 2F0NA 1STAA 2K5VA 3W5OA 1VQOA 1L1OB 3B6YA 2A69D 3J80E 1SYEA 3N52A 1N34L 4N8X1 5I9PA 1FNUA 3M7NA 1DCZA 3J7A5 1CSQA 1ET9A 4C56C 3J7ZC 1UEAB 5C5MA 1PVOA 1RCVD 4LFBL 1YNJC 4DNTB 2F0SA 3W3AA 3GTMH 2RCNA 3CQZH 2K5QA 2G5DA 3J81c 4LMQD 4O42A 3GTOB 2VQFQ 2D0PA 3UDFA 1QJOA 1TWAB 2LSSA 3STBD 4JI6L 1FJGL 2FFKB 4OWTB 1WVLA 2PQAB 2B2UA 4IURA 5KNBA 4HIKA 1B9NA 2CHBD 1K8GA 1DGSA 1F2ZA 2BDNA 2JA5G 3SK8A 4ZYSA 1JOOA 3A5UA 4XTCS 4IZ8A 2A19A 5DEHA 4IOCA 2B2VA 1E0BA 1W3SA 2L5TA 3SK6A 5M3MH 4H13C 1CHQD 4R4QA 2KQ3A 3K59A 3QO2A 1NY4A 1PRTB 3DM3A 4A3EG 4L8JA 1HPCA 1I4HA 4YWLA 1HRJA 3MXGA 3CCLA 1GHJA 2WAQB 3G71A 4NXML 1ONLA 2K5WA 2JYOA 4DV7L 3Q23A 4OHJA 5CV5A 3VDYA 3HOUH 1Y14B 5IYDH 2V4DA 4DV2Q 3GTLH 3QIAA 1VQ5A 3S1NH 1EU4A 3NSWA 5CR3A 1WD0A 1VQ6A 1GM5A 1ASYA 2QEJC 4POFA 5IYCG 2P5ZX 2PQAA 4YY3L 1K28A 1XNRL 1PFSA 1STYA 1RHPA 4ZKBB 4BBRH 2N8NA 3S1QH 4TSSA 4S3SA 3CCRA 2B2YA 2NZOA 1HNZL 1N36Q 1Q8IA 1CTMA 2UU9Q 1DOLA 1QOHA 2M00A 3I72A 5KNCA 3NTKA 4YHHL 4DAVA 3QR8A 1I50B 4R9WA 2GVBA 2F0IA
chains in the Genus database with same CATH topology
3RR5A 4IPGA 2JA8G 5M3FH 1NBWA 3TQYA 3JAMi 4ME3A 1P8LA 1TWCH 2VY3A 1YHQA 1I94L 2UUCQ 2JA5H 5GAHC 2Q2TA 1FGUA 2I5MX 3BU2A 3GO5A 5ELOA 4NXMQ 3H3VI 4BXXH 2K4KA 4TQUS 4GNXA 2Z0SA 5IP7H 4NB3A 4OX9L 3RLNA 1VQEA 1YBYA 3KJOA 2HT1A 4JI0Q 5IYBG 3K81C 4R4TA 4PMWA 1XJVA 1VQKA 3KLWA 2OQKA 3Q8DA 1WI5A 5HY6A 4A3IH 4UP9A 3H0GH 2HHHQ 2E8GA 1K83H 1PA6A 1QVFA 3GTOH 2GN5A 1SE8A 4R4IA 4RMFA 3W1GA 1J5EQ 1C7YA 1NMFA 5FJ8H 3HOWG 3PF4A 3CCJA 1WOCA 4X64Q 5FJ8G 2JEBI 4GNXB 1N33Q 3HOWH 1PH8A 3STBC 1OXSC 1VQGA 3HOXG 1Q7YC 1VQAA 3HKZG 4DR6L 2EIFA 1X3GA 1YIJA 1EOVA 4LF9Q 1WCMH 3J80i 1JJGA 3F8TA 2R6GA 1I5FA 1K73C 5C0XI 4JBJA 4LF9L 4MNOA 4NPSA 2Z6KC 1GO3E 2F3IA 3T1YQ 4X65L 1NE3A 3EBEA 4P75A 4QGUA 3M4PA 4BA1I 2PMZE 3GDEA 2Y0SE 2UUAL 4LF6L 2UUBL 4B3TL 2Y0SG 4JBMA 1TXYA 2CQOA 2IX0A 2IY5B 5E7NA 5IP9G 1YJWA 1FJGQ 4DR3L 4DAYB 1BKBA 4GLAC 1Q12A 1YI2A 4IOAA 4OXPA 3CCMA 1S40A 3L7ZC 4GN4B 1YZ6A 1X3EA 4GOPA 4OWXB 1XPRA 2E2HH 3TS2A 4X6AH 4LUVA 4A3GG 3GTJH 1B7YB 4DR2L 1Z9FA 5IP9H 3AEVA 1HZCA 1V9PA 2NVXH 1V1QA 4A3FG 1RIPA 1VQIA 3CCQA 2KENA 3T1HQ 2HIXA 5AJ3Q 1HZAA 4BY7G 2XGTA 4C2MH 4OONA 3KFUA 4QJFA 1XMOL 2F4VQ 3HOZH 2K75A 3M4QA 1U0LA 3E9IA 4A3JH 1QZGA 2K5HA 1X9NA 3PUVA 1WCMG 4NXNQ 1EUJA 2YV5A 4HIOA 3A5ZB 3UDIA 3KOJA 4P74A 3HOXH 4DR1Q 3PF5A 2NN6G 1N36L 4X64L 3LGJA 3HOVH 2JA6H 1M90C 4JI2L 1PHJA 1J5EL 4C3HH 5IY0A 4A76A 4DV2L 3CMAA 2F4VL 5C44H 4BA2I 1K0RA 4K0KQ 4B3ML 3H0GG 4GLXA 2JEAI 1XMQL 4JI0L 4DKAC 1IZ6A 3M4OH 5IYBH 4YHHQ 1KC8C 4LFAQ 2E2JH 4B3SQ 4HJ7A 3OW2A 1UE6A 3TREA 1XPOA 1ASZA 4LW1A 4YWMA 2VW9A 3U58A 2I0QA 2B63H 1A0IA 4BXXG 3PO3G 3OTOL 1VQLA 1LM0A 4LFCQ 4DV5Q 4J15A 2IHFA 3D31A 3PUZA 1PH9A 4BBSG 5JJIA 4A3MG 4JYAQ 2JJQA 1RL2A 4C3IH 5M5YH 4RG1A 1PH2A 4A75A 4LF5Q 4K0KL 1KXLA 1U5KA 1EFWA 4Y7NH 1Q81C 1HZ9A 2R92G 1LYLA 1BVSA 4UP8A 1V43A 2RHSB 2ATWA 4KHZA 3I56A 1K8AC 1NTGA 1WFQA 1OXTA 1PYSB 1VQ4A 1M1KC 4GLVB 2JK8A 4DUYQ 3D0FA 1N8RC 4MTNA 3SGIA 2DGYA 3I4NG 3CMEA 1IBLQ 4IJLA 3NELA 4LUZA 1N34Q 4BBSH 3CC7A 3G6EA 2VQEQ 4DV6Q 1NMGA 3S16H 3PO3H 4LF5L 3OYYA 2VZAA 5AJ3L 3NEMA 3HOYG 3S1RH 3S17H 4R1JA 3J81j 4GOPB 4DV4Q 3CD6A 5K36G 3G4SA 1D7QA 1S72A 1KRTA 4DUYL 3CPWA 3F1ZA 4GN5A 4DR2Q 4B3SL 1R9TH 5JEAG 5C44G 4WJ4A 4IPHA 4AYBG 2A8VA 4BY1G 4YCVA 2V1CC 3K80C 4B3MQ 4DR7Q 1EQQA 5IYDG 1PH6A 1K3RA 4QY7A 4KHPQ 3I2ZA 3RLOA 3PUYA 4LF7L 1MJCA 4DV7Q 2K5NA 4YWKA 4DV1L 4GOPC 3TS0A 3ICEA 2UXCL 4Y52H 4GKKL 5C4JH 1AH9A 1YITA 1IBKL 1IL2A 2MQHA 1E1TA 5GAEC 1UE1A 4X66L 2CKZB 4JV5L 2AWNA 1P16A 2JQOA 1Y1VG 4GS3A 3KF6A 4JI3Q 4POGA 5IWAL 2MO1A 3PV0A 5BR8Q 3RNUA 1E24A 2ZJPA 4QL5A 2UU9L 2D62A 4DV6L 3PO2G 1MIUA 3JAMc 3RN2A 5JEAJ 1HR0L 3KF8B 2N78A 4A3GH 2NVQH 1Q8KA 3PCOB 1HR0Q 4A3LH 3CP0A 2ZJRA 2K14A 4PZ7A 2A1AA 4HJ9A 2E5LQ 4X62L 3E0EA 4JI6Q 1CKNA 3AFQA 4JI8Q 2HHHL 2DUDA 4B3RQ 4QIWE 4A3KG 4APVA 4LF8L 3I55A 4DAMA 3ER0A 4LNQA 1UE7A 5J3BA 4OX9Q 1KRSA 2EXDA 1VQNA 1IBML 2C35B 2OWOA 2UUBQ 4B3TQ 4LF7Q 4DUZL 1HNWL 3MXNB 4JI1L 2L15A 4A3DH 2I5LX 1CSPA 1E1OA 1G291 1I50H 2CWAA 1OXVA 1IXRA 3HKZE 2R93G 3KYHC 2YTYA 5GAGC 4B3RL 1EIYB 4HJ5A 4IPCA 4LWCA 2MNAA 3S1MH 1N9WA 2ZTDA 3KDFA 1X65A 5FLXc 4IO9A 1YNXA 3U4ZA 3I4OA 4DK3C 3CCSA 4DV3Q 2ASBA 4OO1G 5C3EG 4JI2Q 2LXJA 5IE8A 4IFDG 4GKJL 2QEXA 4LUOA 3ULPA 2IX1A 2R93H 2B29A 1Y1WG 2JA7G 4A3IG 1XNQQ 1VS0A 5EAYA 4A3DG 1SN8A 2F52A 2Q2HA 3L0OA 3GTKH 1TWHH 2NVTH 4JI5Q 3U4VA 3AQQA 5DLQE 3I4MG 4HJAA 3EN2A 4JI8L 4YCUA 2NN6I 3CCUA 4DV0L 3E9HA 1QVCA 3PSIA 1XMOQ 1EYGA 1L2FA 1IBLL 1HH2P 2ZJQA 3FKIH 1QUQA 2Z6KA 3CC4A 5M3FG 5M5WH 2JA8H 4QQBX 1UEBA 2NVYH 4A3CG 1S3OA 2XTIA 3KJPA 2PI2A 4AIMA 2AMCB 4DV3L 4C3JH 1I3QH 1GVPA 4A93H 2VUMH 4R4CA 3S14H 2Q2UA 3RZDH 2N49A 4JV5Q 4X66Q 2B3GA 3HKSA 4LFCL 3ULJA 2R7ZH 1Q1BA 1W2BA 4A3BG 1VQJA 3KDFB 1YEZA 2R7DA 2KCTA 2CCZA 3TEHB 4PZ8A 2QGQA 4JC0A 1Q1EA 4TVAB 1I94Q 4P71A 3S15H 1FVIA 1OXUA 2OQ0A 1PH1A 4WJ3M 1D8LA 5IYCH 5GQOA 1VQDA 1N32Q 3GD7A 4XIGS 2D0OA 3U50C 4JI5L 3ULLA 1EQRA 3K7UC 1QUQB 1JT8A 1VQHA 2RF4A 1Q46A 3S2HH 4DR1L 4KI0A 1Q82C 2MFIA 4BY1H 3NBHB 2ZTCA 1MKHA 4O2DA 5FLMG 4LF4Q 4DK6C 3HOUG 2ES2A 1KHIA 3BZCA 1VQPA 2JE6I 4IPDA 1WYDA 1YHBA 2JA9A 2WAQE 1JJ2A 1LUZA 4OO1I 1PH7A 1JE5A 4L5SA 1FL0A 1TWAH 2KCMA 3CAMA 1JJCB 3BZKA 1X3FA 4DV5L 1VQ8A 1A62A 2CFMA 2K50A 4MZ9A 1IBKQ 1EWIA 2KBNA 1TWFH 2AKWB 4KLKA 3ZJYC 1KQSA 1VQ7A 1E3PA 5C0XJ 3CCEA 4DUZQ 3M3YH 4IFDJ 1PH3A 2UUCL 3I4NH 4KHPL 1PH5A 2BH8A 1HZBA 3RN5A 2UXDQ 1OTCA 1G51A 5M3MG 2ZTEA 3J81i 2ZM6L 3CXCA 3M9BA 4A93G 4YCWA 1L1OC 1PH4A 5LMUL 1C0AA 4H02A 3S2DH 3OTOQ 4GNXC 1GD7A 3TRZA 3K7AH 2QA4A 2BA1A 2UUAQ 4LF6Q 3FKIG 1L1OA 1CKNB 2E2IH 3GTQH 1HNZQ 4X65Q 2KHJA 1B70B 2WP8J 4PG3A 3I4MH 1K9MC 1O7IA 1PV4A 2WB1E 5BR8L 5LMNQ 2PI2E 2E5LL 4JOIC 2WFWA 5C4XG 4YY3Q 2JA7H 3F2DA 1AE3A 1X54A 5FLMH 5C3EH 4AQYQ 2R7ZG 4UY8C 1G6PA 3HOVG 5IWAQ 5HGQA 1KIXA 1OXXK 4JI4Q 1E22A 3A74A 2ID0A 3UDXA 5LMUQ 1VCIA 2GVAA 2ALYB 3CF5A 1VQ9A 3H3VH 2ZM6Q 5GROA 2YU9H 4JBWA 4DR4L 4A3JG 1VQBA 1XNQL 1QVGA 4LFBQ 5ELNA 1KAWA 1SMXA 1SRUA 2EQSA 2KHIA 4UPAA 3CPFA 3AYHB 3PIOA 3CW2C 4P73A 1VQCA 3WWVA 1YJNA 5M5XH 4OWWB 4A3FH 3J80c 4L5TA 4A3KH 2NZHA 4DV0Q 4A3BH 2VQFL 4DR7L 1I6HH 3H15A 4JBKA 2AWOA 4EX5A 2HQLA 3DLLA 3UE1A 4EQ5A 2UXBQ 1H95A 1YHAA 2H5XA 4A4IA 4AQYL 4JI1Q 3IRBA 1GKHA 4AH6A 4HIMA 4LF4L 4L5QA 1E7ZA 2WB1G 1X56A 1VQFA 4A3CH 1L0WA 3CC2A 3CCVA 3W5OA 2K5VA 1VQOA 1SFOH 1L1OB 3B6YA 1NJIC 3W1BA 2YTXA 2BA0A 1N34L 3FP9A 3M7NA 4P72A 1JMCA 4O0AA 4FDBA 3J7A5 1HNXL 1CSQA 4DPGA 2FXQA 1SROA 1CKOA 5C0XG 3J7ZC 1VQMA 2UXCQ 5IT9c 1PVOA 1Y1WH 1B8AA 5GADC 4LFBL 1XPUA 2LXKA 2UXBL 1N32L 3GTMH 2RCNA 2MO0A 4GN3B 4JG2A 4JI3L 3HFZB 3NENA 3CQZH 4L5RC 2OTJA 1BBWA 3J81c 4R4OA 3UDGA 2VQFQ 2D0PA 3UDFA 1QZHA 1JB7A 2LSSA 3STBD 4X62Q 4JI6L 4OWTB 1FJGL 3PUXA 5C4XH 1BBUA 2PQAB 4UP7A 1Z47A 2RHQB 1WJJA 4HIKA 1K8GA 1DGSA 3AFPA 1IBMQ 5IP7G 3BJUA 1CUKA 2YYZA 4DR4Q 2N3SA 2CWPA 5LMNL 1YJ9A 4NXNL 2JA5G 4JI7L 3S1QH 4JI4L 3A5UA 4XTCS 5JJLA 1UWVA 2IT1A 4DR6Q 1A8VA 4IJHA 4JCVE 2A19A 2VS1A 3ERSX 3F2BA 4HJ8A 1N33L 4A3LG 4DV4L 3K0XA 1KL9A 1UE5A 1W3SA 3PIPA 4IOCA 1SLJA 4GKJQ 5M3MH 3M85A 2R92H 4R4QA 3UE0A 1XTDA 2AHOB 3PGZA 1HJPA 1NY4A 3PO2H 4A3MH 1XNRQ 3DM3A 4BBRG 4A3EG 3GTPH 1Y1VH 3JC66 4IFDI 4YWLA 1MJEA 4ALPA 2B63G 3CCLA 4GKKQ 2OTLA 1C9OA 3RLFA 3G71A 4NXML 1Q86C 1A63A 4DV7L 1TWGH 3VDYA 3EIVA 1X55A 3KF6B 4DR5L 1HNWQ 3HOUH 1T9HA 1Y14B 5IYDH 5LMNW 4DR3Q 4LF8Q 4DV2Q 3G48A 2VQEL 4DR5Q 3GTLH 2UXDL 1CKMA 1VQ5A 4PZ6A 2JA6G 3S1NH 3F2CA 1VQ6A 2I5HA 1GM5A 4AYBE 1HNXQ 1ASYA 4LFAL 2IHEA 4POFA 5IYCG 3T1YL 3K8AA 2PQAA 4YY3L 1SR3A 1XMQQ 1KD1C 1XNRL 1PFSA 3HOYH 4HIDA 3HOZG 4JI7Q 2PNHA 2VNUD 3GTGH 4BY7H 1HR0W 4JYAL 3FHWA 1YVCA 1J6QA 3RZOH 4BBRH 4A3EH 3I7FA 2N8NA 1LTLA 1IYJB 1X6OA 2OCEA 2Q2IA 2YTVA 2WAQG 3CCRA 3T1HL 2NZOA 2VL6A 1HNZL 3A0JA 1N36Q 3MEFA 1AE2A 1PYBA 2VUMG 2UU9Q 2K52A 4DV1Q 3S24A 3PUWA 4YHHL 4DNIA 4JOIA 2HIVA 2BH2A 5JJKA 2GVBA 5H1SE 1EIFA 2R7FA 3L2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RR5 A;  4IPG A;  2JA8 G;  5M3F H;  1NBW A;  3TQY A;  3JAM i;  4ME3 A;  1P8L A;  1TWC H;  2VY3 A;  1YHQ A;  1I94 L;  2UUC Q;  2JA5 H;  5GAH C;  2Q2T A;  1FGU A;  2I5M X;  3BU2 A;  3GO5 A;  5ELO A;  4NXM Q;  3H3V I;  4BXX H;  2K4K A;  4TQU S;  4GNX A;  2Z0S A;  5IP7 H;  4NB3 A;  4OX9 L;  3RLN A;  1VQE A;  1YBY A;  3KJO A;  2HT1 A;  4JI0 Q;  5IYB G;  3K81 C;  4R4T A;  4PMW A;  1XJV A;  1VQK A;  3KLW A;  2OQK A;  3Q8D A;  1WI5 A;  5HY6 A;  4A3I H;  4UP9 A;  3H0G H;  2HHH Q;  2E8G A;  1K83 H;  1PA6 A;  1QVF A;  3GTO H;  2GN5 A;  1SE8 A;  4R4I A;  4RMF A;  3W1G A;  1J5E Q;  1C7Y A;  1NMF A;  5FJ8 H;  3HOW G;  3PF4 A;  3CCJ A;  1WOC A;  4X64 Q;  5FJ8 G;  2JEB I;  4GNX B;  1N33 Q;  3HOW H;  1PH8 A;  3STB C;  1OXS C;  1VQG A;  3HOX G;  1Q7Y C;  1VQA A;  3HKZ G;  4DR6 L;  2EIF A;  1X3G A;  1YIJ A;  1EOV A;  4LF9 Q;  1WCM H;  3J80 i;  1JJG A;  3F8T A;  2R6G A;  1I5F A;  1K73 C;  5C0X I;  4JBJ A;  4LF9 L;  4MNO A;  4NPS A;  2Z6K C;  1GO3 E;  2F3I A;  3T1Y Q;  4X65 L;  1NE3 A;  3EBE A;  4P75 A;  4QGU A;  3M4P A;  4BA1 I;  2PMZ E;  3GDE A;  2Y0S E;  2UUA L;  4LF6 L;  2UUB L;  4B3T L;  2Y0S G;  4JBM A;  1TXY A;  2CQO A;  2IX0 A;  2IY5 B;  5E7N A;  5IP9 G;  1YJW A;  1FJG Q;  4DR3 L;  4DAY B;  1BKB A;  4GLA C;  1Q12 A;  1YI2 A;  4IOA A;  4OXP A;  3CCM A;  1S40 A;  3L7Z C;  4GN4 B;  1YZ6 A;  1X3E A;  4GOP A;  4OWX B;  1XPR A;  2E2H H;  3TS2 A;  4X6A H;  4LUV A;  4A3G G;  3GTJ H;  1B7Y B;  4DR2 L;  1Z9F A;  5IP9 H;  3AEV A;  1HZC A;  1V9P A;  2NVX H;  1V1Q A;  4A3F G;  1RIP A;  1VQI A;  3CCQ A;  2KEN A;  3T1H Q;  2HIX A;  5AJ3 Q;  1HZA A;  4BY7 G;  2XGT A;  4C2M H;  4OON A;  3KFU A;  4QJF A;  1XMO L;  2F4V Q;  3HOZ H;  2K75 A;  3M4Q A;  1U0L A;  3E9I A;  4A3J H;  1QZG A;  2K5H A;  1X9N A;  3PUV A;  1WCM G;  4NXN Q;  1EUJ A;  2YV5 A;  4HIO A;  3A5Z B;  3UDI A;  3KOJ A;  4P74 A;  3HOX H;  4DR1 Q;  3PF5 A;  2NN6 G;  1N36 L;  4X64 L;  3LGJ A;  3HOV H;  2JA6 H;  1M90 C;  4JI2 L;  1PHJ A;  1J5E L;  4C3H H;  5IY0 A;  4A76 A;  4DV2 L;  3CMA A;  2F4V L;  5C44 H;  4BA2 I;  1K0R A;  4K0K Q;  4B3M L;  3H0G G;  4GLX A;  2JEA I;  1XMQ L;  4JI0 L;  4DKA C;  1IZ6 A;  3M4O H;  5IYB H;  4YHH Q;  1KC8 C;  4LFA Q;  2E2J H;  4B3S Q;  4HJ7 A;  3OW2 A;  1UE6 A;  3TRE A;  1XPO A;  1ASZ A;  4LW1 A;  4YWM A;  2VW9 A;  3U58 A;  2I0Q A;  2B63 H;  1A0I A;  4BXX G;  3PO3 G;  3OTO L;  1VQL A;  1LM0 A;  4LFC Q;  4DV5 Q;  4J15 A;  2IHF A;  3D31 A;  3PUZ A;  1PH9 A;  4BBS G;  5JJI A;  4A3M G;  4JYA Q;  2JJQ A;  1RL2 A;  4C3I H;  5M5Y H;  4RG1 A;  1PH2 A;  4A75 A;  4LF5 Q;  4K0K L;  1KXL A;  1U5K A;  1EFW A;  4Y7N H;  1Q81 C;  1HZ9 A;  2R92 G;  1LYL A;  1BVS A;  4UP8 A;  1V43 A;  2RHS B;  2ATW A;  4KHZ A;  3I56 A;  1K8A C;  1NTG A;  1WFQ A;  1OXT A;  1PYS B;  1VQ4 A;  1M1K C;  4GLV B;  2JK8 A;  4DUY Q;  3D0F A;  1N8R C;  4MTN A;  3SGI A;  2DGY A;  3I4N G;  3CME A;  1IBL Q;  4IJL A;  3NEL A;  4LUZ A;  1N34 Q;  4BBS H;  3CC7 A;  3G6E A;  2VQE Q;  4DV6 Q;  1NMG A;  3S16 H;  3PO3 H;  4LF5 L;  3OYY A;  2VZA A;  5AJ3 L;  3NEM A;  3HOY G;  3S1R H;  3S17 H;  4R1J A;  3J81 j;  4GOP B;  4DV4 Q;  3CD6 A;  5K36 G;  3G4S A;  1D7Q A;  1S72 A;  1KRT A;  4DUY L;  3CPW A;  3F1Z A;  4GN5 A;  4DR2 Q;  4B3S L;  1R9T H;  5JEA G;  5C44 G;  4WJ4 A;  4IPH A;  4AYB G;  2A8V A;  4BY1 G;  4YCV A;  2V1C C;  3K80 C;  4B3M Q;  4DR7 Q;  1EQQ A;  5IYD G;  1PH6 A;  1K3R A;  4QY7 A;  4KHP Q;  3I2Z A;  3RLO A;  3PUY A;  4LF7 L;  1MJC A;  4DV7 Q;  2K5N A;  4YWK A;  4DV1 L;  4GOP C;  3TS0 A;  3ICE A;  2UXC L;  4Y52 H;  4GKK L;  5C4J H;  1AH9 A;  1YIT A;  1IBK L;  1IL2 A;  2MQH A;  1E1T A;  5GAE C;  1UE1 A;  4X66 L;  2CKZ B;  4JV5 L;  2AWN A;  1P16 A;  2JQO A;  1Y1V G;  4GS3 A;  3KF6 A;  4JI3 Q;  4POG A;  5IWA L;  2MO1 A;  3PV0 A;  5BR8 Q;  3RNU A;  1E24 A;  2ZJP A;  4QL5 A;  2UU9 L;  2D62 A;  4DV6 L;  3PO2 G;  1MIU A;  3JAM c;  3RN2 A;  5JEA J;  1HR0 L;  3KF8 B;  2N78 A;  4A3G H;  2NVQ H;  1Q8K A;  3PCO B;  1HR0 Q;  4A3L H;  3CP0 A;  2ZJR A;  2K14 A;  4PZ7 A;  2A1A A;  4HJ9 A;  2E5L Q;  4X62 L;  3E0E A;  4JI6 Q;  1CKN A;  3AFQ A;  4JI8 Q;  2HHH L;  2DUD A;  4B3R Q;  4QIW E;  4A3K G;  4APV A;  4LF8 L;  3I55 A;  4DAM A;  3ER0 A;  4LNQ A;  1UE7 A;  5J3B A;  4OX9 Q;  1KRS A;  2EXD A;  1VQN A;  1IBM L;  2C35 B;  2OWO A;  2UUB Q;  4B3T Q;  4LF7 Q;  4DUZ L;  1HNW L;  3MXN B;  4JI1 L;  2L15 A;  4A3D H;  2I5L X;  1CSP A;  1E1O A;  1G29 1;  1I50 H;  2CWA A;  1OXV A;  1IXR A;  3HKZ E;  2R93 G;  3KYH C;  2YTY A;  5GAG C;  4B3R L;  1EIY B;  4HJ5 A;  4IPC A;  4LWC A;  2MNA A;  3S1M H;  1N9W A;  2ZTD A;  3KDF A;  1X65 A;  5FLX c;  4IO9 A;  1YNX A;  3U4Z A;  3I4O A;  4DK3 C;  3CCS A;  4DV3 Q;  2ASB A;  4OO1 G;  5C3E G;  4JI2 Q;  2LXJ A;  5IE8 A;  4IFD G;  4GKJ L;  2QEX A;  4LUO A;  3ULP A;  2IX1 A;  2R93 H;  2B29 A;  1Y1W G;  2JA7 G;  4A3I G;  1XNQ Q;  1VS0 A;  5EAY A;  4A3D G;  1SN8 A;  2F52 A;  2Q2H A;  3L0O A;  3GTK H;  1TWH H;  2NVT H;  4JI5 Q;  3U4V A;  3AQQ A;  5DLQ E;  3I4M G;  4HJA A;  3EN2 A;  4JI8 L;  4YCU A;  2NN6 I;  3CCU A;  4DV0 L;  3E9H A;  1QVC A;  3PSI A;  1XMO Q;  1EYG A;  1L2F A;  1IBL L;  1HH2 P;  2ZJQ A;  3FKI H;  1QUQ A;  2Z6K A;  3CC4 A;  5M3F G;  5M5W H;  2JA8 H;  4QQB X;  1UEB A;  2NVY H;  4A3C G;  1S3O A;  2XTI A;  3KJP A;  2PI2 A;  4AIM A;  2AMC B;  4DV3 L;  4C3J H;  1I3Q H;  1GVP A;  4A93 H;  2VUM H;  4R4C A;  3S14 H;  2Q2U A;  3RZD H;  2N49 A;  4JV5 Q;  4X66 Q;  2B3G A;  3HKS A;  4LFC L;  3ULJ A;  2R7Z H;  1Q1B A;  1W2B A;  4A3B G;  1VQJ A;  3KDF B;  1YEZ A;  2R7D A;  2KCT A;  2CCZ A;  3TEH B;  4PZ8 A;  2QGQ A;  4JC0 A;  1Q1E A;  4TVA B;  1I94 Q;  4P71 A;  3S15 H;  1FVI A;  1OXU A;  2OQ0 A;  1PH1 A;  4WJ3 M;  1D8L A;  5IYC H;  5GQO A;  1VQD A;  1N32 Q;  3GD7 A;  4XIG S;  2D0O A;  3U50 C;  4JI5 L;  3ULL A;  1EQR A;  3K7U C;  1QUQ B;  1JT8 A;  1VQH A;  2RF4 A;  1Q46 A;  3S2H H;  4DR1 L;  4KI0 A;  1Q82 C;  2MFI A;  4BY1 H;  3NBH B;  2ZTC A;  1MKH A;  4O2D A;  5FLM G;  4LF4 Q;  4DK6 C;  3HOU G;  2ES2 A;  1KHI A;  3BZC A;  1VQP A;  2JE6 I;  4IPD A;  1WYD A;  1YHB A;  2JA9 A;  2WAQ E;  1JJ2 A;  1LUZ A;  4OO1 I;  1PH7 A;  1JE5 A;  4L5S A;  1FL0 A;  1TWA H;  2KCM A;  3CAM A;  1JJC B;  3BZK A;  1X3F A;  4DV5 L;  1VQ8 A;  1A62 A;  2CFM A;  2K50 A;  4MZ9 A;  1IBK Q;  1EWI A;  2KBN A;  1TWF H;  2AKW B;  4KLK A;  3ZJY C;  1KQS A;  1VQ7 A;  1E3P A;  5C0X J;  3CCE A;  4DUZ Q;  3M3Y H;  4IFD J;  1PH3 A;  2UUC L;  3I4N H;  4KHP L;  1PH5 A;  2BH8 A;  1HZB A;  3RN5 A;  2UXD Q;  1OTC A;  1G51 A;  5M3M G;  2ZTE A;  3J81 i;  2ZM6 L;  3CXC A;  3M9B A;  4A93 G;  4YCW A;  1L1O C;  1PH4 A;  5LMU L;  1C0A A;  4H02 A;  3S2D H;  3OTO Q;  4GNX C;  1GD7 A;  3TRZ A;  3K7A H;  2QA4 A;  2BA1 A;  2UUA Q;  4LF6 Q;  3FKI G;  1L1O A;  1CKN B;  2E2I H;  3GTQ H;  1HNZ Q;  4X65 Q;  2KHJ A;  1B70 B;  2WP8 J;  4PG3 A;  3I4M H;  1K9M C;  1O7I A;  1PV4 A;  2WB1 E;  5BR8 L;  5LMN Q;  2PI2 E;  2E5L L;  4JOI C;  2WFW A;  5C4X G;  4YY3 Q;  2JA7 H;  3F2D A;  1AE3 A;  1X54 A;  5FLM H;  5C3E H;  4AQY Q;  2R7Z G;  4UY8 C;  1G6P A;  3HOV G;  5IWA Q;  5HGQ A;  1KIX A;  1OXX K;  4JI4 Q;  1E22 A;  3A74 A;  2ID0 A;  3UDX A;  5LMU Q;  1VCI A;  2GVA A;  2ALY B;  3CF5 A;  1VQ9 A;  3H3V H;  2ZM6 Q;  5GRO A;  2YU9 H;  4JBW A;  4DR4 L;  4A3J G;  1VQB A;  1XNQ L;  1QVG A;  4LFB Q;  5ELN A;  1KAW A;  1SMX A;  1SRU A;  2EQS A;  2KHI A;  4UPA A;  3CPF A;  3AYH B;  3PIO A;  3CW2 C;  4P73 A;  1VQC A;  3WWV A;  1YJN A;  5M5X H;  4OWW B;  4A3F H;  3J80 c;  4L5T A;  4A3K H;  2NZH A;  4DV0 Q;  4A3B H;  2VQF L;  4DR7 L;  1I6H H;  3H15 A;  4JBK A;  2AWO A;  4EX5 A;  2HQL A;  3DLL A;  3UE1 A;  4EQ5 A;  2UXB Q;  1H95 A;  1YHA A;  2H5X A;  4A4I A;  4AQY L;  4JI1 Q;  3IRB A;  1GKH A;  4AH6 A;  4HIM A;  4LF4 L;  4L5Q A;  1E7Z A;  2WB1 G;  1X56 A;  1VQF A;  4A3C H;  1L0W A;  3CC2 A;  3CCV A;  3W5O A;  2K5V A;  1VQO A;  1SFO H;  1L1O B;  3B6Y A;  1NJI C;  3W1B A;  2YTX A;  2BA0 A;  1N34 L;  3FP9 A;  3M7N A;  4P72 A;  1JMC A;  4O0A A;  4FDB A;  3J7A 5;  1HNX L;  1CSQ A;  4DPG A;  2FXQ A;  1SRO A;  1CKO A;  5C0X G;  3J7Z C;  1VQM A;  2UXC Q;  5IT9 c;  1PVO A;  1Y1W H;  1B8A A;  5GAD C;  4LFB L;  1XPU A;  2LXK A;  2UXB L;  1N32 L;  3GTM H;  2RCN A;  2MO0 A;  4GN3 B;  4JG2 A;  4JI3 L;  3HFZ B;  3NEN A;  3CQZ H;  4L5R C;  2OTJ A;  1BBW A;  3J81 c;  4R4O A;  3UDG A;  2VQF Q;  2D0P A;  3UDF A;  1QZH A;  1JB7 A;  2LSS A;  3STB D;  4X62 Q;  4JI6 L;  4OWT B;  1FJG L;  3PUX A;  5C4X H;  1BBU A;  2PQA B;  4UP7 A;  1Z47 A;  2RHQ B;  1WJJ A;  4HIK A;  1K8G A;  1DGS A;  3AFP A;  1IBM Q;  5IP7 G;  3BJU A;  1CUK A;  2YYZ A;  4DR4 Q;  2N3S A;  2CWP A;  5LMN L;  1YJ9 A;  4NXN L;  2JA5 G;  4JI7 L;  3S1Q H;  4JI4 L;  3A5U A;  4XTC S;  5JJL A;  1UWV A;  2IT1 A;  4DR6 Q;  1A8V A;  4IJH A;  4JCV E;  2A19 A;  2VS1 A;  3ERS X;  3F2B A;  4HJ8 A;  1N33 L;  4A3L G;  4DV4 L;  3K0X A;  1KL9 A;  1UE5 A;  1W3S A;  3PIP A;  4IOC A;  1SLJ A;  4GKJ Q;  5M3M H;  3M85 A;  2R92 H;  4R4Q A;  3UE0 A;  1XTD A;  2AHO B;  3PGZ A;  1HJP A;  1NY4 A;  3PO2 H;  4A3M H;  1XNR Q;  3DM3 A;  4BBR G;  4A3E G;  3GTP H;  1Y1V H;  3JC6 6;  4IFD I;  4YWL A;  1MJE A;  4ALP A;  2B63 G;  3CCL A;  4GKK Q;  2OTL A;  1C9O A;  3RLF A;  3G71 A;  4NXM L;  1Q86 C;  1A63 A;  4DV7 L;  1TWG H;  3VDY A;  3EIV A;  1X55 A;  3KF6 B;  4DR5 L;  1HNW Q;  3HOU H;  1T9H A;  1Y14 B;  5IYD H;  5LMN W;  4DR3 Q;  4LF8 Q;  4DV2 Q;  3G48 A;  2VQE L;  4DR5 Q;  3GTL H;  2UXD L;  1CKM A;  1VQ5 A;  4PZ6 A;  2JA6 G;  3S1N H;  3F2C A;  1VQ6 A;  2I5H A;  1GM5 A;  4AYB E;  1HNX Q;  1ASY A;  4LFA L;  2IHE A;  4POF A;  5IYC G;  3T1Y L;  3K8A A;  2PQA A;  4YY3 L;  1SR3 A;  1XMQ Q;  1KD1 C;  1XNR L;  1PFS A;  3HOY H;  4HID A;  3HOZ G;  4JI7 Q;  2PNH A;  2VNU D;  3GTG H;  4BY7 H;  1HR0 W;  4JYA L;  3FHW A;  1YVC A;  1J6Q A;  3RZO H;  4BBR H;  4A3E H;  3I7F A;  2N8N A;  1LTL A;  1IYJ B;  1X6O A;  2OCE A;  2Q2I A;  2YTV A;  2WAQ G;  3CCR A;  3T1H L;  2NZO A;  2VL6 A;  1HNZ L;  3A0J A;  1N36 Q;  3MEF A;  1AE2 A;  1PYB A;  2VUM G;  2UU9 Q;  2K52 A;  4DV1 Q;  3S24 A;  3PUW A;  4YHH L;  4DNI A;  4JOI A;  2HIV A;  2BH2 A;  5JJK A;  2GVB A;  5H1S E;  1EIF A;  2R7F A;  3L2P A; 
#chains in the Genus database with same CATH topology
 3RR5 A;  5M3F H;  1A3T A;  1NBW A;  1JCK B;  1QNK A;  2X6L A;  2Z4I A;  1NCV A;  4F87 A;  1YHQ A;  1XYI A;  4DA2 A;  5JVG 3;  1JQY D;  4TQU S;  2D9U A;  1AZQ A;  3KJO A;  3T53 B;  3D8G A;  3K81 C;  4RWS C;  1TWH B;  3KLW A;  2OQK A;  1WI5 A;  2HHH Q;  1K83 H;  1YNN D;  4IFD H;  3W1G A;  4RMF A;  1ET6 A;  1O80 A;  1BR9 A;  1LT4 D;  1N33 Q;  4IUU A;  4FXG C;  1OXS C;  5ELE A;  3HKZ G;  4FYD A;  3N6R A;  3F8T A;  1VMC A;  3TME A;  2F3I A;  1LV9 A;  1WD1 A;  2NYZ D;  4RA8 A;  4G7Z C;  4X3K A;  1QNU A;  3GDE A;  4LF6 L;  2WII B;  1U4P A;  2UUB L;  4B9X A;  2Y0S G;  2CQO A;  5E7N A;  4Z9C B;  1TU2 B;  1I4P A;  4DAY B;  1YI2 A;  4IOA A;  4K6D A;  4OXP A;  1PXU A;  2F0K A;  4GOP A;  1X3E A;  4KMU C;  3HEJ A;  4A3G G;  1Y1V B;  3NQT A;  1B7Y B;  3H09 A;  3R2T A;  1HZC A;  4QF4 A;  2L1B A;  3T1H Q;  1J8I A;  3MFG A;  3MXU A;  4G57 A;  1MD2 D;  2NBF A;  1SYG A;  2K75 A;  2M2L A;  1U0L A;  4KY6 A;  3V96 A;  4NXN Q;  4HIO A;  3KOJ A;  1GUS A;  4X64 L;  1TWF B;  3HG9 A;  4JI2 L;  3MXP A;  3ERQ A;  1LT6 D;  1TQO A;  1E2V A;  3D4D A;  2ZXR A;  1T5E A;  1K0R A;  3H0G G;  4PMC A;  3J7A V;  5CV9 A;  3K6O A;  4U67 3;  1XMQ L;  3M4O H;  1IZ6 A;  3S17 B;  5IYB H;  4YHH Q;  1EIG A;  1KC8 C;  3RZO B;  4A3E B;  3JAM L;  3DEP A;  4LFA Q;  3TBI B;  4HJ7 A;  2KVM A;  2SEB D;  3TRE A;  1EY5 A;  2NVY B;  2WB1 B;  4DV5 Q;  3D31 A;  4ZKC B;  4RG1 A;  1FR3 A;  5LL6 X;  1PRT D;  2A68 C;  1Q81 C;  1D5X C;  1V43 A;  4UP8 A;  4KHZ A;  1SE4 A;  1NTG A;  4K6L A;  4PQX A;  5COY A;  2JK8 A;  4DUY Q;  1GJX A;  1ESR A;  1TY0 A;  3SGI A;  4CKC A;  2DGY A;  1CA6 A;  4NP5 A;  1S4Z A;  3CME A;  3QWN A;  1GUN A;  1K8O A;  1I3Q B;  2VQE Q;  1QG7 A;  4LF5 L;  4FVM A;  3NEM A;  2EYO A;  1PRT F;  1Y8O B;  2Z9H A;  1KRT A;  4CDC C;  2B63 B;  4N8F A;  4DXF A;  2A8V A;  1EEF D;  3FRP B;  3TZD A;  1A2T A;  3K80 C;  2MGS A;  3SK5 A;  3NE5 B;  4NDX A;  3RLO A;  4DV7 Q;  3TS0 A;  2K5N A;  4YWK A;  4GOP C;  4K2K A;  1BNZ A;  1CQF A;  1EWC A;  1K0S A;  1KAB A;  3KF6 A;  4POG A;  3GTL B;  5L37 A;  5BR8 Q;  2OEO A;  1BCP B;  4QL5 A;  2UU9 L;  1PZK D;  2CH4 W;  1MIU A;  4A3G H;  1GUT A;  1V8Q A;  3E0E A;  4B08 A;  2D2C C;  3I4M B;  3AFQ A;  3J80 L;  2D5D A;  4LF8 L;  3DWP A;  3ER0 A;  4LNQ A;  2EXD A;  4UHV A;  1VQN A;  1HUM A;  2C35 B;  2F1M A;  3BVZ A;  4KJN A;  3MXN B;  1SYC A;  2EJF C;  3BDC A;  2SNM A;  5LHY 1;  1E1O A;  4XT3 B;  2R93 G;  2YTY A;  4B3R L;  2HDM A;  4IPC A;  4LWC A;  3S1M H;  2AUJ D;  1X65 A;  2CQA A;  4DV3 Q;  2ASB A;  2G9H D;  4IFD G;  2R93 H;  4GKJ L;  2QEX A;  2XN9 C;  4WFN 3;  1RD9 D;  3I91 A;  5E4X A;  3L0O A;  2WKC A;  1TWH H;  1SYF A;  2L11 A;  3TDQ A;  4HJA A;  2NN6 I;  1XMO Q;  5AFW A;  2ZJQ A;  4DK1 A;  2E2J B;  2K32 A;  2R3Z A;  1L0Y B;  4QQB X;  2X69 A;  5M3F G;  1S3O A;  2XTI A;  2PI2 A;  4OGQ C;  2EY6 A;  3S9W A;  1AZP A;  2WAC A;  4NW2 A;  5EBC A;  1BXT A;  1JWS D;  1Q1B A;  2NUC A;  4A3B G;  1TVX A;  2R7Z B;  5I9O A;  2QGQ A;  5FO7 B;  2JP1 A;  5DM7 3;  4TVA B;  1I94 Q;  3NQI A;  4P71 A;  3NXW A;  4XXE A;  3S15 H;  1FVI A;  4PMB A;  5IYC H;  5GQO A;  2BDO A;  5CV8 A;  3U50 C;  3ULL A;  3P7J A;  3SVM A;  1SE3 A;  1LTG D;  3LWE A;  5M5W B;  2JA8 B;  3A8K E;  3HOU G;  3CRK C;  1KHI A;  3BZC A;  2ES2 A;  2JE6 I;  4IPD A;  2WAQ E;  1LUZ A;  3EFX D;  1GUO A;  2E2D C;  1PH7 A;  3S14 B;  4MHE A;  1TWA H;  2KCM A;  4QUF A;  3BZK A;  4DV5 L;  1A62 A;  5C3E B;  2J0T D;  3BYY B;  5J39 A;  1JWU D;  2JA5 B;  2HCC A;  3M3Y H;  3ZJY C;  4F8M A;  4PNY A;  5M3M B;  4KHP L;  5FOB B;  4RKL A;  2UXD Q;  1OTC A;  5M3M G;  2I46 A;  3CXC A;  3C2P A;  3NP8 A;  2F0L A;  4YCW A;  1ENA A;  2PCF B;  4QCL A;  1C0A A;  2WIN B;  4GNX C;  1I4X A;  3PQI A;  1EWH A;  2PNR C;  5CBE E;  1CKN B;  5TSS A;  5A2Q E;  2LS0 1;  4X65 Q;  1WTQ A;  2WP8 J;  2PW7 A;  3K5M A;  3I4M H;  1O7I A;  3BYT B;  2J4X A;  3QG1 A;  4F7X A;  2WFW A;  3K5N A;  2JA7 H;  1D1K A;  4ME5 A;  2X6G A;  3GV6 A;  3I4L A;  1Q3L A;  2JSO A;  2PO4 A;  2R7Z G;  5J22 A;  1G6P A;  2EYP A;  3S16 B;  4ZLT F;  3UDX A;  4QUC A;  2ZXO A;  3ITP A;  2A73 B;  2YU9 H;  4OEL B;  3M7G A;  3VYU A;  2EYH A;  1SRU A;  2MUY A;  4HSV A;  2AUK A;  2O2L D;  2QIL A;  2EQS A;  4K8I A;  2F0M A;  3SK4 A;  3TP6 A;  3PIO A;  1YJN A;  5M5X H;  4OWW B;  4A3B H;  4DV0 Q;  1A3U A;  2VQF L;  1PDQ A;  3VR6 A;  5JPM C;  4UDU C;  3UE1 A;  4EQ5 A;  3D4W A;  2H5X A;  2XIW A;  3E5S A;  4JI1 Q;  2F0J A;  1GKH A;  4HIM A;  1VQF A;  4RCO A;  4C1N K;  4X3T A;  4A93 B;  5C44 B;  2B2Y C;  2F0U A;  4HN7 A;  2FXQ A;  1SRO A;  1VQM A;  5IT9 c;  5CGK A;  5IOC A;  4K2L A;  1V1P A;  4E6I A;  1XPU A;  1FGB D;  1PFN A;  4ZCK A;  3H3V C;  1N32 L;  2K03 A;  4JG2 A;  4JI3 L;  3HFZ B;  4G7H C;  4L5R C;  1K83 B;  4R4O A;  2KUM A;  1D6E C;  4X62 Q;  3PUX A;  5C4X H;  1IW7 C;  1BBU A;  4UP7 A;  1EFI D;  3NWT A;  3V2T A;  3A8J E;  2YYZ A;  1HA6 A;  4DR4 Q;  4RAU C;  4KKT A;  1NR4 A;  1DOK A;  5EJW A;  2VS1 A;  3F2B A;  1N33 L;  1GUW A;  4DV4 L;  1UE5 A;  3PIP A;  4GKJ Q;  3UE0 A;  3KBX A;  4C3I G;  4BBR G;  1F9Q A;  3MAQ A;  3JC6 6;  2B63 G;  1OO9 B;  1C9O A;  2BCO A;  2EJM A;  1BF4 A;  3Q24 A;  2K01 A;  3NBI A;  3EIV A;  4RGO S;  2B2V C;  1X55 A;  4L6T B;  1NR2 A;  5LMN W;  4DR3 Q;  4LF8 Q;  1CKM A;  2JA6 G;  1TWC B;  4IUP A;  2N88 A;  2I5H A;  3DWQ A;  5FLX E;  4LFA L;  1ZEQ X;  3T1Y L;  3K8A A;  2TSS A;  2Q8R E;  1CT1 D;  1SR3 A;  2EJG C;  1FYC A;  1WTH A;  1XMQ Q;  2B2U C;  2VNU D;  3GTG H;  3AU7 A;  1J6Q A;  4A3E H;  2Q2I A;  1X6O A;  2WAQ G;  2VB2 X;  3HOW B;  3A0J A;  2K52 A;  1MSH A;  3PUW A;  4A3K B;  5FK9 C;  4GZY C;  3F2U A;  3OHX C;  1LTS D;  5H1S E;  2JA8 G;  3TQY A;  4XQJ A;  1P8L A;  1SYB A;  2NWG A;  2JA5 H;  1FGU A;  2I5M X;  5J1Z A;  4NXM Q;  1EQT A;  1A2U A;  1RF2 D;  2Z0S A;  1YBY A;  4JI0 Q;  5IYB G;  1XJV A;  4R4T A;  3V05 A;  5HY6 A;  3Q8D A;  4A3I H;  3H0G H;  4FF2 A;  4ILW A;  3DWA A;  3GTJ B;  1C7Y A;  4OO1 H;  3S1Q B;  1ML0 D;  5FJ8 G;  5DAU A;  1YNN C;  3STB C;  1PH8 A;  1Z7T A;  1ROD A;  1BOS A;  4LF9 Q;  2PPB C;  2KHS A;  3J80 i;  1RTN A;  4OEM B;  4JBJ A;  5M9O A;  4MNO A;  5C0X I;  4LF9 L;  2F0T A;  5M3F B;  4I65 A;  4QGU A;  3M4P A;  2PMZ E;  4B3T L;  2OF1 A;  2JA6 B;  1F77 A;  1TXY A;  2IY5 B;  1F9S A;  1Q12 A;  1ICF B;  2EXZ A;  1S40 A;  1FD7 D;  3PO2 B;  2E2H H;  1K8M A;  4XQN A;  4DR2 L;  1Z9F A;  1EY9 A;  3W2D A;  1V9P A;  5EGT A;  4A3F G;  3CCQ A;  1AP0 A;  1LTA D;  5M5X B;  3I73 A;  3HOZ H;  5KRU A;  5K5P A;  1EZ8 A;  4A3J H;  1C48 A;  1QZG A;  4G7O C;  4XYO A;  4EQP A;  4CKE A;  5FO9 B;  2DJG C;  2NN6 G;  2R93 B;  2F3V A;  5IT9 L;  1PHJ A;  1WTX A;  1D2B A;  4GLX A;  4JI0 L;  4DKA C;  3S1R B;  5KYL A;  2E2J H;  1UE6 A;  1XPO A;  1ASZ A;  4LW1 A;  4YWM A;  2I0Q A;  2NVX B;  3OTO L;  1VQL A;  1E2Z A;  3VA7 A;  4LFC Q;  1NSN S;  3Q6S A;  4A3M G;  3OWE B;  3LNN A;  1KXL A;  4BY7 B;  1CK1 A;  4H0L C;  3R8B A;  3DXJ C;  1ILQ A;  2MJ8 A;  1LYL A;  2R92 G;  1KLU D;  4IUN A;  3I56 A;  1OXT A;  1PYS B;  5ELC A;  1VF7 A;  2F0G A;  4GLV B;  4MTN A;  1B4O A;  2JXM B;  3I4N G;  4BBS H;  2PZW A;  3PO3 H;  1JOK A;  1IHZ A;  2RSO A;  1IKL A;  2F0W A;  3S17 H;  2O5I C;  3A56 A;  2EYJ A;  4RKB A;  1D7Q A;  3RD4 A;  3CPW A;  4B3S L;  4JK1 C;  1R9T H;  4IPH A;  4AYB G;  3MXN A;  4BY1 G;  2EY2 A;  2RKS A;  3VR4 A;  4A3I B;  2V1C C;  2ICI A;  4DR7 Q;  1BCP C;  5CV6 A;  5IYD G;  1PH6 A;  1A3V A;  1U4L A;  3PUY A;  4CDF C;  4DV1 L;  5C0X H;  3ICE A;  5IGF A;  1KDA A;  1B3A A;  3KF8 A;  4XYQ A;  5BN4 A;  1E1T A;  4RH6 A;  3HZX A;  4GS3 A;  1I4Q A;  4JI3 Q;  1RKN A;  3PV0 A;  4LK1 C;  4DV6 L;  2A5H A;  3JAM c;  1HR0 L;  3KF8 B;  4G4K A;  3FEW X;  4WOR A;  2NVQ H;  1D5Z C;  1Q8K A;  3GV3 A;  1HR0 Q;  2ZJR A;  2K14 A;  4PZ7 A;  1LTT D;  4JI6 Q;  4J6H A;  2HHH L;  4JI8 Q;  2A6H C;  4KN7 C;  4ODG A;  3I55 A;  3J81 E;  4M1U B;  1UE7 A;  1KRS A;  1DD2 A;  1HTP A;  2F4I A;  1M8A A;  4LF7 Q;  1HNW L;  3FPP A;  1JC7 A;  1CZW A;  1I50 H;  1HTL D;  3HOZ B;  1OXV A;  1IXR A;  3HKZ E;  2LKV A;  2MP1 A;  1EIY B;  4HJ5 A;  2MNA A;  5EBD A;  2ZTD A;  5FLX c;  1YNX A;  3U4Z A;  4DK3 C;  4HSP A;  4K5X A;  2BE5 D;  5KYI A;  3VYS A;  2LXJ A;  5IE8 A;  1H9K A;  5C3X A;  3A7L A;  1PFM A;  1YNJ D;  2NTT A;  2B29 A;  3MA2 B;  1VS0 A;  4A3D G;  2F52 A;  3NBH A;  2B39 A;  2NVT H;  3U4V A;  1JOR A;  5C6A A;  3EN2 A;  4DV0 L;  4YCU A;  1K8A C;  1QVC A;  3PSI A;  1HH2 P;  4UAI A;  3S2H B;  3FKI H;  2Z6K A;  3CC4 A;  1MGS A;  3KJP A;  1VF5 C;  4AIM A;  1TWG B;  2Y0S B;  3QJY A;  4B9W A;  4A93 H;  2VUM H;  5I2Y A;  2JN4 A;  2N49 A;  1C4Q A;  2B3G A;  1QCB D;  1YEZ A;  4L63 B;  1SNC A;  4MIU A;  2CCZ A;  5ELD A;  4K5W A;  1KNA A;  4Q5V A;  1EYD A;  4O1N A;  2OQ0 A;  5JAV A;  1N32 Q;  3TP8 A;  3GD7 A;  4JI5 L;  5IIF A;  3SDZ A;  4DF7 A;  1VQH A;  4KI0 A;  1Q82 C;  1NAP A;  2MFI A;  3GTQ B;  5D14 A;  1MKH A;  2SOB A;  3R2I A;  1V1O A;  4LF4 Q;  1HHV A;  2PMZ B;  4OO1 I;  1JE5 A;  1FL0 A;  1BCP F;  3OIQ A;  1X3F A;  1GOZ A;  3SXH A;  1T5X D;  1TWF H;  3ZYY X;  5C0X J;  1WTV A;  4IFD J;  1PH3 A;  2UUC L;  2HCI A;  3VYT A;  1PH5 A;  1HZB A;  3RN5 A;  1G51 A;  3J81 i;  3M9B A;  3EA6 A;  2K28 A;  4IN3 A;  2IPK D;  5D65 A;  5DNF A;  3OTO Q;  3TRZ A;  3K7A H;  4LF6 Q;  2A74 C;  2K5D A;  3KUP A;  1X32 A;  2E2I H;  4MN3 A;  3DM1 A;  1TS4 A;  1C8C A;  1I6H B;  2EVB A;  1G6Z A;  3C3L A;  1WTP A;  3QB3 A;  5LMN Q;  2E5L L;  4IAL A;  1SNP A;  3F2D A;  3UI2 A;  1AE3 A;  1X54 A;  5FLM H;  5C3E H;  2K6A A;  4AQY Q;  3DUZ A;  1TS2 A;  4BBS B;  2L0C A;  5CV7 A;  4JI4 Q;  1WTR A;  1HQM C;  3PO3 B;  5LMU Q;  3BG3 A;  3CF5 A;  3DMU A;  4FNF A;  2ZM6 Q;  2A69 C;  2ICE C;  4JBW A;  3S1N B;  1VQB A;  1QVG A;  4LFB Q;  5ELN A;  3SE0 A;  4DFA A;  4UPA A;  4NKL A;  1VQC A;  3WWV A;  3J80 c;  4A3K H;  2NVT B;  2NZH A;  3CQZ B;  4JBK A;  2AWO A;  3DLL A;  2HQL A;  3RZD B;  1YHA A;  3E0J A;  3IRB A;  2IW3 A;  5I6Y A;  4U68 A;  2WB1 G;  3HOV B;  3CC2 A;  3VA5 A;  4IUQ A;  1EU3 A;  1UUP A;  2QDL A;  4C3H B;  1NJI C;  4HCS A;  2VUM B;  2QKI C;  2YTX A;  2RBM A;  2BA0 A;  4YIJ A;  4CBV A;  4H7B A;  4P72 A;  1JMC A;  1IYV A;  4O0A A;  1EOT A;  1AN8 A;  4FDB A;  1HNX L;  1CKO A;  2UXC Q;  2NZ1 D;  1B8A A;  5GAD C;  2IL8 A;  2WV6 D;  2LXK A;  2GA4 B;  2KJX A;  3SEB A;  4GN3 B;  4NMZ A;  1S5D D;  1PFB A;  4EQO A;  4CDD C;  4C3I B;  1PTO H;  2EYF A;  3UDG A;  1QZH A;  1JB7 A;  1AFP A;  5K36 H;  2RHQ B;  1WJJ A;  1RTO A;  3BJU A;  4KD4 A;  2CWP A;  1YJ9 A;  1HFN A;  2E75 C;  4JI7 L;  4RGN A;  3S1M B;  1JOQ A;  1F2M A;  1UWV A;  2F0V A;  1S5E D;  3S2D B;  1H9S B;  3ERS X;  4A3L G;  4FXD A;  1SLJ A;  3M85 A;  1STH A;  1H9M A;  1XTD A;  2AHO B;  2K33 A;  3PGZ A;  5ELF A;  5KGU A;  1XNR Q;  1Y1V H;  3CKI B;  3OOC A;  5EPK A;  5COR A;  1MJE A;  1ENF A;  3HKZ B;  1V1P B;  2OTL A;  4GKK Q;  2DY7 A;  3BVM A;  4QMG A;  1Q86 C;  1A63 A;  1TWG H;  4ZUJ A;  1SNO A;  1S5B D;  4DR5 L;  4F88 A;  1XX8 A;  4DR5 Q;  1MHW C;  1GUG A;  2UXD L;  1U4M A;  3I8Z A;  5JEA H;  3F2C A;  1I4G A;  4AYB E;  1HNX Q;  1KTK A;  2FIN B;  3H94 A;  4DNR B;  1SMY C;  3HOY H;  5C5L A;  3T51 B;  2PNH A;  4BY7 H;  3FHW A;  3RZO H;  3I7F A;  2KEC A;  1IYJ B;  3G7L A;  2YTV A;  3EJI A;  2VL6 A;  1LAB A;  1AE2 A;  4FF3 A;  3PIP 3;  2K7V A;  5EPL A;  4C3J G;  4DNI A;  1WCM B;  4DN4 M;  2BH2 A;  5JJK A;  4ZRZ A;  3URY A;  2R7F A;  1NMF A;  5EPJ A;  2HDL A;  2KA7 A;  3JAM i;  4ME3 A;  3VR2 A;  1TWC H;  2UUC Q;  2F0H A;  3SR1 A;  1JB3 A;  3M3Y B;  2Q2T A;  3BU2 A;  4J8Q A;  4BXX H;  2RDG A;  3K58 A;  1R9T B;  5IP7 H;  1B9M A;  3RLN A;  1VQE A;  2HT1 A;  2EPB A;  1VQK A;  4UP9 A;  4CGY B;  2E8G A;  3NUC A;  1J9O A;  2GN5 A;  1SE8 A;  2NTS A;  2EOT A;  1J5E Q;  3HOW G;  2Q8I B;  1SDF A;  3HOW H;  2E2I B;  5CYU A;  4P2C B;  1Q7Y C;  2A6E C;  3K57 A;  4DR6 L;  5G3L F;  1X3G A;  3RUZ A;  1YIJ A;  5IGB A;  1R4P B;  4AYB B;  1SAP A;  4NPS A;  4R8I A;  1GO3 E;  3MC0 B;  3T1Y Q;  1NE3 A;  1LTB D;  3CHB D;  4P75 A;  2PZU A;  2UUA L;  2Y0S E;  4RFB A;  1LT5 D;  2IX0 A;  5IP9 G;  1FJG Q;  4DR3 L;  3H6M A;  1BKB A;  4GLA C;  3D4R A;  5FKA C;  1ESF A;  4GN4 B;  1YZ6 A;  2QF7 A;  3M4O B;  2XWB B;  1XPR A;  4X6A H;  4LUV A;  3GTP B;  3FMC A;  4RHR A;  1Y8N B;  1RIP A;  1SSO A;  1HQR D;  2HIX A;  5AJ3 Q;  4BY7 G;  2XGT A;  1BUV T;  5KND A;  2F03 A;  4QJF A;  2F4V Q;  4M8A A;  4A3M B;  4Y7N B;  4DU9 A;  3E9I A;  1DON A;  3U9S A;  1WCM G;  2CW0 C;  1SNM A;  1EUJ A;  2YV5 A;  4DK0 A;  4ZUI A;  3A5Z B;  2AQ1 B;  4P74 A;  3HOX H;  4WJW A;  3HOV H;  2B8F A;  1M90 C;  3IFD A;  3H91 A;  4C3H H;  1STN A;  4CKB A;  3I4N B;  3GTK B;  4FXK C;  3T56 B;  2PW5 A;  3CMA A;  5C44 H;  2F4V L;  4BA2 I;  4K0K Q;  4B3M L;  2JEA I;  3X3N A;  4C1N I;  4RHS A;  3NTH A;  4B3S Q;  3TP7 A;  4HTH A;  3U58 A;  1EIH A;  4RCN A;  1A0I A;  2O4X A;  4J15 A;  3MHB A;  3JAM E;  2IHF A;  1PH9 A;  3PUZ A;  4JYA Q;  1TY2 A;  5M5Y H;  3LWU A;  4K0K L;  1PH2 A;  4LF5 Q;  4A75 A;  1AEX A;  4BWG B;  1EFW A;  1HZ9 A;  2OXP A;  1BVS A;  5EKL A;  2L4N A;  2RVL A;  1WFQ A;  1EY4 A;  5HUR A;  3D0F A;  1N8R C;  3HP3 A;  4HCE A;  4IJL A;  3NEL A;  1LLR D;  1N34 Q;  3G6E A;  4QB4 A;  1LTI D;  3O13 A;  3OYY A;  5C4Z A;  2FMC A;  2VZA A;  3J81 L;  4R1J A;  4HED A;  3J81 j;  4V0B A;  3CD6 A;  1PTO F;  4HMI A;  3G4S A;  5K36 G;  1S72 A;  4DUY L;  3MVV A;  4DR2 Q;  4GN5 A;  2HD3 A;  1BBX C;  5C44 G;  1ZYR C;  3OIP A;  1EQQ A;  1Y8P B;  3NPP A;  1K3R A;  4X3S A;  4QY7 A;  4DGZ A;  5IGD A;  2IX3 A;  1F2L A;  3I2Z A;  1JIC A;  4LF7 L;  4KHP Q;  1HNW Q;  4K14 A;  4GKK L;  5C4J H;  1YIT A;  1IL2 A;  1O7L A;  5GAE C;  1UE1 A;  4X66 L;  4JV5 L;  2AWN A;  1P16 A;  2JQO A;  1IKM A;  1NNX A;  3BDL A;  1Z6H A;  5IWA L;  2MO1 A;  3RNU A;  3PO2 G;  1E24 A;  1SJE D;  2D62 A;  3RN2 A;  4N9P A;  1U9R A;  3PCO B;  4HJ9 A;  4X62 L;  3HS0 C;  4B3R Q;  4A3K G;  3K0Y A;  4DAM A;  5J3B A;  1W6J A;  3A54 A;  1IBM L;  2UUB Q;  4XDX A;  1UNS A;  1S5F D;  2I5L X;  1CSP A;  2XRQ D;  3ONA B;  4Q0F A;  3RMH A;  2CWA A;  2F0O A;  4RGM A;  3AMU A;  2J7Z A;  3CU7 A;  3TP5 A;  1N9W A;  1EY8 A;  1STB A;  3I4O A;  2QDB A;  2XNA C;  5C3E G;  3WOF A;  1Y1W G;  1E2W A;  3IAY A;  1DJR D;  1SN8 A;  3NTI A;  5E1F A;  1O7Y A;  4FF1 A;  3GTK H;  1K3B C;  2R92 B;  3MZ5 A;  1DOM A;  2L12 A;  4N9T A;  3AQQ A;  5DLQ E;  3CCU A;  3E9H A;  4FO2 A;  2K1B A;  1IBL L;  3K5O A;  3T16 A;  1EZ6 A;  3Q22 A;  4A3C G;  1SYD A;  2MPM A;  2AMC B;  4C3J H;  4KKU A;  4H44 C;  1I3Q H;  1GVP A;  4R4C A;  3S14 H;  1HCZ A;  4X66 Q;  3HKS A;  3ULJ A;  4K5V A;  1VQJ A;  3KDF B;  2R7D A;  2KCT A;  2XRS D;  3TEH B;  5C4H A;  3I90 A;  1DZ1 A;  4JC0 A;  1Q1E A;  1AW7 A;  1OXU A;  3GQB A;  4WJ3 M;  1HFG A;  5A35 A;  1D8L A;  1IL8 A;  4KY7 A;  4I7Z C;  1SXT A;  2H1E A;  2D0O A;  3QOJ A;  4JVZ A;  3K7U C;  1PZI D;  1JT8 A;  3C46 A;  5I6W A;  3NBH B;  4O2D A;  1BQQ T;  1GHK A;  4EVO A;  4DK6 C;  2K05 A;  1WYD A;  1YHB A;  1A15 A;  2JA9 A;  3EVQ A;  3CAM A;  1VQ8 A;  2CFM A;  3T4A C;  5C4X B;  3HOX B;  1IBK Q;  2L9H A;  1EWI A;  1EQV A;  3D3R A;  4A3G B;  4KLK A;  3J7Y W;  5C4J B;  4DUZ Q;  4KV6 A;  3VYR A;  4IQZ A;  2BH8 A;  4A93 G;  2ZTE A;  2ZM6 L;  1L1O C;  4PV1 C;  4DAP A;  3P20 A;  1F9R A;  1GD7 A;  3I3C A;  2BA1 A;  3QOL A;  4ULL A;  2UUA Q;  3FKI G;  5CV4 A;  1LT3 D;  4ABN A;  1HNZ Q;  1U4R A;  2XVS A;  2Q8T A;  1K9M C;  1PV4 A;  1KNE A;  2WB1 E;  5BR8 L;  4R8N A;  4JOI C;  2NB0 A;  4YY3 Q;  2BOS A;  3L9A X;  1II3 A;  4C3H G;  2Z4H A;  3HOV G;  5HGQ A;  2OT2 A;  2R61 A;  1OXX K;  1E22 A;  3A74 A;  5KIX A;  1VCI A;  2GVA A;  2ALY B;  1VQ9 A;  1EEI D;  1EYC A;  5GRO A;  3R93 A;  1XNQ L;  5ELB A;  1KAW A;  1SMX A;  3ND9 A;  3CPF A;  1ZYR D;  3NHH A;  2G9D A;  1PTO D;  3H15 A;  2IWH A;  4EX5 A;  2K04 A;  2F0Q A;  1H95 A;  1CI3 M;  4A4I A;  4LF4 L;  5C3W A;  4L5Q A;  1E7Z A;  1Y69 U;  4A3C H;  1L0W A;  2LFN A;  5IGC A;  4CHT B;  3CCV A;  1SFO H;  2B2W C;  3W1B A;  3BS1 A;  1CZG A;  1SND A;  4KHV A;  2KCC A;  3FP9 A;  2A68 D;  2YU9 B;  3KLR A;  4DPG A;  4KN4 C;  5C0X G;  5T1G A;  4X3U A;  3OSO A;  1Y1W H;  1SBB B;  1BCP D;  4LAA A;  2UXB L;  2MO0 A;  1XTC D;  3A7A B;  3NEN A;  2OTJ A;  1BBW A;  2LMC B;  2Z8L A;  3C1E A;  1Z47 A;  3BDO A;  4BY1 B;  4ZK9 B;  1B50 A;  1HUN A;  3AFP A;  1IBM Q;  2SDF A;  5IP7 G;  1CUK A;  4OIK A;  1LAC A;  2N3S A;  3TZU A;  5LMN L;  1TII D;  4NXN L;  4JI4 L;  5JJL A;  1CFM A;  2XWJ B;  2IT1 A;  4DR6 Q;  1PYW D;  1A8V A;  2RSN A;  4IJH A;  4JCV E;  5IT9 E;  4HJ8 A;  2ZXP A;  3WOE A;  3K0X A;  1KL9 A;  3AB9 A;  2DNC A;  1O7Z A;  2AQ2 B;  1TR5 A;  2R92 H;  4ZQ3 A;  1FNV A;  4C2M B;  1HJP A;  3PO2 H;  4A3M H;  1DYQ A;  5IGG A;  3GTP H;  3E3X A;  3LX0 A;  4IFD I;  2F3W A;  4ALP A;  2H4O A;  3RLF A;  2ZT9 C;  4QIW B;  2ENB A;  1UAP A;  1LO5 D;  4DAY A;  2XSC A;  3KF6 B;  1T9H A;  2TMP A;  4RGT A;  4A3J B;  1MI2 A;  1BO0 A;  2B2W A;  4OL7 A;  1W6K A;  3G48 A;  2VQE L;  1Q90 A;  4JPB W;  4PZ6 A;  3OWF A;  4TRD A;  3P75 A;  1RDP D;  3FVQ A;  4ID6 A;  2IHE A;  2B2T A;  3G6J B;  5D3D A;  1KD1 C;  2M9V A;  4A3B B;  3HOZ G;  4HID A;  2QW7 A;  3H0G B;  4JI7 Q;  4XQQ A;  1HR0 W;  4JYA L;  1YVC A;  3TSS A;  1LTL A;  2OCE A;  3T1H L;  1KDC A;  3MEF A;  1PYB A;  1PMR A;  1DM0 B;  2VUM G;  2KCN A;  4DV1 Q;  4A3D B;  3S24 A;  3BVG A;  4JOI A;  2HIV A;  5HGT A;  1EIF A;  3IKJ A;  1QWY A;  3L2P A;  2I07 B;  2B8G A;  4IPG A;  1QIL A;  1O78 A;  2VY3 A;  1I94 L;  5GAH C;  1SJH D;  2F0F A;  3GO5 A;  5ELO A;  3H3V I;  3FDT A;  2K4K A;  4GNX A;  4OX9 L;  4NB3 A;  1GXD C;  4PMW A;  5EKK A;  1S5C D;  2DY8 A;  1PA6 A;  1QVF A;  3GTO H;  1MBY A;  2B2T C;  4R4I A;  1QE6 A;  3DEO A;  1NUC A;  5FJ8 H;  3PF4 A;  3CCJ A;  1IW7 D;  3OW7 A;  1WOC A;  4X64 Q;  4GNX B;  1B3Q A;  2JEB I;  3KK7 A;  5EQ0 A;  1VQG A;  3SHL A;  2EY5 A;  3HOX G;  1VQA A;  1G2T A;  2EIF A;  1FNW A;  1EOV A;  1WCM H;  1JJG A;  2R6G A;  1I5F A;  1K73 C;  1SEB D;  2Z6K C;  3P1H A;  4X65 L;  3EBE A;  3VR5 A;  3TN2 A;  4BA1 I;  2DJF C;  1H9J A;  3ND8 A;  4K8J A;  1WTW A;  1ICW A;  4JBM A;  1YJW A;  1D1I A;  4XT1 B;  5CMD A;  3S15 B;  2KED A;  1CHP D;  1D5M C;  3CCM A;  1SNQ A;  3L7Z C;  1L0X B;  4OWX B;  3TS2 A;  1STE A;  3GTJ H;  5IP9 H;  3AEV A;  2NVX H;  1V1Q A;  1VQI A;  1G91 A;  2KEN A;  2CVR A;  1HZA A;  4C2M H;  4OON A;  3X3M A;  3KFU A;  1PTO C;  1XMO L;  3M4Y A;  3M4Q A;  2K5H A;  1X9N A;  3PUV A;  2QCP X;  2Z1C A;  2EZV A;  4CDE C;  1SE2 A;  5JVH 3;  2E74 C;  3UDI A;  2O5J C;  4DR1 Q;  3PF5 A;  1N36 L;  3LGJ A;  3OPO A;  5FO8 B;  2JA6 H;  2C5C A;  1SFO B;  3A8I E;  1J5E L;  5IY0 A;  4A76 A;  4DV2 L;  2CH4 A;  1M4V A;  2RCF A;  3GTG B;  2E2H B;  4BBR B;  4I7A A;  3OW2 A;  3A55 A;  1Y1W B;  5IGE A;  2VW9 A;  2B63 H;  4BXX G;  3PO3 G;  1CA5 A;  1CM9 A;  1LM0 A;  3MEH A;  1F9P A;  2EDG A;  2F0E A;  4BBS G;  5JJI A;  4C3J B;  2JJQ A;  1RL2 A;  3IL8 A;  4TKO B;  4C3I H;  3NWS A;  1BDO A;  1U5K A;  4Y7N H;  3VR3 A;  3E6Z X;  2KEE A;  2RHS B;  3FKI B;  2ATW A;  3NK9 A;  5D3I B;  1M1K C;  1VQ4 A;  2KOL A;  2Z6B A;  3KLS X;  4HMJ A;  1IBL Q;  4LUZ A;  1VMP A;  1JR0 D;  3CC7 A;  4DV6 Q;  1NMG A;  3S16 H;  5F2D A;  5CBA E;  5AJ3 L;  3HOY G;  3S1R H;  2RQX A;  4GOP B;  4DV4 Q;  1I4R A;  2NVQ B;  1PZJ D;  3F1Z A;  1F2Y A;  5JEA G;  1ILP A;  4WJ4 A;  2EYL A;  4A3F B;  1KLG D;  3I70 A;  1KDB A;  4YCV A;  5E3F A;  1EY6 A;  1TS3 A;  4B3M Q;  5M5Y B;  2NN6 H;  4KJO A;  3HGB A;  1MJC A;  4Y52 H;  2UXC L;  1G2S A;  5DM6 3;  4CJ0 B;  1AH9 A;  1IBK L;  2MQH A;  3J7A F;  2CKZ B;  4ZAI A;  1Y1V G;  3MFY A;  1EY0 A;  2ZJP A;  1WTO A;  5JPN C;  2N55 A;  2HQE A;  5JEA J;  2N78 A;  3IFT A;  3T13 A;  4HAE A;  5JOB A;  3CP0 A;  4A3L H;  1VDZ A;  2A1A A;  5IOD A;  2E5L Q;  3CRL C;  2RA4 A;  2EY1 A;  3D6W A;  1CKN A;  4IUV A;  2DUD A;  2RDH A;  4IUT A;  4QIW E;  4APV A;  4EQN A;  4KY5 A;  4OX9 Q;  1MSG A;  4OIJ A;  1I6V C;  2A6E D;  2OWO A;  2PYK A;  4B3T Q;  2A6H D;  4DUZ L;  4JI1 L;  2L15 A;  2VB3 X;  5A2Q L;  4A3D H;  3R3O A;  1G29 1;  5LL6 S;  3U9O A;  3KYH C;  2SNS A;  5GAG C;  1DXM A;  2R7Z H;  3KDF A;  4IO9 A;  4OO1 G;  3CCS A;  3Q0A A;  2VXW A;  4JI2 Q;  4LUO A;  2BE5 C;  4J1M A;  4BS9 A;  4CJ2 C;  3ULP A;  2IX1 A;  2JA7 G;  4A3I G;  3OMC A;  1XNQ Q;  1JE4 A;  3DHQ A;  3GP7 A;  5EAY A;  2E76 C;  2Q2H A;  4JI5 Q;  5BN3 A;  3I4M G;  1CQV A;  4JI8 L;  1H9S A;  1EYG A;  1B2T A;  1ENC A;  1L2F A;  3BZD B;  4JW0 A;  1IYU A;  1QUQ A;  5M5W H;  2JA8 H;  1UEB A;  2NVY H;  1PLF A;  4EGV A;  4DV3 L;  2L55 A;  2EE1 A;  1HA5 A;  3K5L A;  5E4W C;  3RZD H;  2Q2U A;  4JV5 Q;  4LFC L;  1W2B A;  1EY7 A;  1SMY D;  5I2X A;  2PQE A;  1KAA A;  2MHV A;  4PZ8 A;  2DNE A;  4V19 0;  1B53 A;  3FPU B;  4FF4 A;  1R4Q B;  3HRZ C;  1PH1 A;  3GTM B;  2EYM A;  1VQD A;  4KK7 A;  3D6C A;  4XIG S;  5EKI A;  1EQR A;  1X3P A;  1QUQ B;  2RF4 A;  1Q46 A;  2F0P A;  3WDN A;  3S2H H;  4DR1 L;  4FP5 D;  1B44 D;  1XWE A;  4BY1 H;  2ZTC A;  1TT2 A;  5I4D A;  5FLM G;  1G8Z D;  1VQP A;  2F0D A;  4LJZ C;  2LY7 A;  4KKS A;  5FLX L;  1JJ2 A;  1PTO B;  4L5S A;  3KLS A;  5KEE A;  3L3O C;  1JJC B;  2JA7 B;  4KD3 A;  2K50 A;  4MZ9 A;  2AQ3 B;  2KBN A;  3PMF A;  2PZT A;  5BN5 A;  2AKW B;  1KQS A;  1VQ7 A;  1E3P A;  3CCE A;  1TKW B;  3I4N H;  1HXY D;  1LTR D;  1PH4 A;  5CC4 A;  5LMU L;  2RDF A;  4H02 A;  1STG A;  3S2D H;  2C9O A;  2QA4 A;  1QB5 D;  1L1O A;  2DN8 A;  1ZXT A;  3GTQ H;  4HR7 B;  3ERO A;  2KHJ A;  1B70 B;  4PG3 A;  1TS5 A;  1PRT C;  5G3L D;  3HOU B;  2PI2 E;  3KBG A;  1RJT A;  3MWY W;  5C4X G;  4WRD A;  1B1Z A;  5JJZ A;  3MTS A;  1ZKO A;  4UY8 C;  1A6X A;  5IWA Q;  5ISR A;  1X3Q A;  1KIX A;  1EYA A;  2FHT A;  5T1I A;  2ID0 A;  1EL0 A;  1XXG A;  3C1F A;  3H3V H;  4DR4 L;  2HUG A;  4A3J G;  3PIO 3;  3K7A B;  2WKD A;  2KHI A;  2CW0 D;  3AYH B;  3CW2 C;  3OMG A;  4P73 A;  4A3F H;  3HOY B;  4L5T A;  4CJ1 B;  4DR7 L;  1I6H H;  2FMM A;  4DXG A;  1JWM D;  2IJ0 A;  4KTA A;  4MTK A;  3EQL C;  2UXB Q;  5NUC A;  4AQY L;  4AH6 A;  2FJ2 A;  1X56 A;  1H9R A;  2F0N A;  1STA A;  2K5V A;  3W5O A;  1VQO A;  1L1O B;  3B6Y A;  2A69 D;  3J80 E;  1SYE A;  3N52 A;  1N34 L;  4N8X 1;  5I9P A;  1FNU A;  3M7N A;  1DCZ A;  3J7A 5;  1CSQ A;  1ET9 A;  4C56 C;  3J7Z C;  1UEA B;  5C5M A;  1PVO A;  1RCV D;  4LFB L;  1YNJ C;  4DNT B;  2F0S A;  3W3A A;  3GTM H;  2RCN A;  3CQZ H;  2K5Q A;  2G5D A;  3J81 c;  4LMQ D;  4O42 A;  3GTO B;  2VQF Q;  2D0P A;  3UDF A;  1QJO A;  1TWA B;  2LSS A;  3STB D;  4JI6 L;  1FJG L;  2FFK B;  4OWT B;  1WVL A;  2PQA B;  2B2U A;  4IUR A;  5KNB A;  4HIK A;  1B9N A;  2CHB D;  1K8G A;  1DGS A;  1F2Z A;  2BDN A;  2JA5 G;  3SK8 A;  4ZYS A;  1JOO A;  3A5U A;  4XTC S;  4IZ8 A;  2A19 A;  5DEH A;  4IOC A;  2B2V A;  1E0B A;  1W3S A;  2L5T A;  3SK6 A;  5M3M H;  4H13 C;  1CHQ D;  4R4Q A;  2KQ3 A;  3K59 A;  3QO2 A;  1NY4 A;  1PRT B;  3DM3 A;  4A3E G;  4L8J A;  1HPC A;  1I4H A;  4YWL A;  1HRJ A;  3MXG A;  3CCL A;  1GHJ A;  2WAQ B;  3G71 A;  4NXM L;  1ONL A;  2K5W A;  2JYO A;  4DV7 L;  3Q23 A;  4OHJ A;  5CV5 A;  3VDY A;  3HOU H;  1Y14 B;  5IYD H;  2V4D A;  4DV2 Q;  3GTL H;  3QIA A;  1VQ5 A;  3S1N H;  1EU4 A;  3NSW A;  5CR3 A;  1WD0 A;  1VQ6 A;  1GM5 A;  1ASY A;  2QEJ C;  4POF A;  5IYC G;  2P5Z X;  2PQA A;  4YY3 L;  1K28 A;  1XNR L;  1PFS A;  1STY A;  1RHP A;  4ZKB B;  4BBR H;  2N8N A;  3S1Q H;  4TSS A;  4S3S A;  3CCR A;  2B2Y A;  2NZO A;  1HNZ L;  1N36 Q;  1Q8I A;  1CTM A;  2UU9 Q;  1DOL A;  1QOH A;  2M00 A;  3I72 A;  5KNC A;  3NTK A;  4YHH L;  4DAV A;  3QR8 A;  1I50 B;  4R9W A;  2GVB A;  2F0I A; 
#chains in the Genus database with same CATH homology
 3RR5 A;  4IPG A;  2JA8 G;  5M3F H;  1NBW A;  3TQY A;  3JAM i;  4ME3 A;  1P8L A;  1TWC H;  2VY3 A;  1YHQ A;  1I94 L;  2UUC Q;  2JA5 H;  5GAH C;  2Q2T A;  1FGU A;  2I5M X;  3BU2 A;  3GO5 A;  5ELO A;  4NXM Q;  3H3V I;  4BXX H;  2K4K A;  4TQU S;  4GNX A;  2Z0S A;  5IP7 H;  4NB3 A;  4OX9 L;  3RLN A;  1VQE A;  1YBY A;  3KJO A;  2HT1 A;  4JI0 Q;  5IYB G;  3K81 C;  4R4T A;  4PMW A;  1XJV A;  1VQK A;  3KLW A;  2OQK A;  3Q8D A;  1WI5 A;  5HY6 A;  4A3I H;  4UP9 A;  3H0G H;  2HHH Q;  2E8G A;  1K83 H;  1PA6 A;  1QVF A;  3GTO H;  2GN5 A;  1SE8 A;  4R4I A;  4RMF A;  3W1G A;  1J5E Q;  1C7Y A;  1NMF A;  5FJ8 H;  3HOW G;  3PF4 A;  3CCJ A;  1WOC A;  4X64 Q;  5FJ8 G;  2JEB I;  4GNX B;  1N33 Q;  3HOW H;  1PH8 A;  3STB C;  1OXS C;  1VQG A;  3HOX G;  1Q7Y C;  1VQA A;  3HKZ G;  4DR6 L;  2EIF A;  1X3G A;  1YIJ A;  1EOV A;  4LF9 Q;  1WCM H;  3J80 i;  1JJG A;  3F8T A;  2R6G A;  1I5F A;  1K73 C;  5C0X I;  4JBJ A;  4LF9 L;  4MNO A;  4NPS A;  2Z6K C;  1GO3 E;  2F3I A;  3T1Y Q;  4X65 L;  1NE3 A;  3EBE A;  4P75 A;  4QGU A;  3M4P A;  4BA1 I;  2PMZ E;  3GDE A;  2Y0S E;  2UUA L;  4LF6 L;  2UUB L;  4B3T L;  2Y0S G;  4JBM A;  1TXY A;  2CQO A;  2IX0 A;  2IY5 B;  5E7N A;  5IP9 G;  1YJW A;  1FJG Q;  4DR3 L;  4DAY B;  1BKB A;  4GLA C;  1Q12 A;  1YI2 A;  4IOA A;  4OXP A;  3CCM A;  1S40 A;  3L7Z C;  4GN4 B;  1YZ6 A;  1X3E A;  4GOP A;  4OWX B;  1XPR A;  2E2H H;  3TS2 A;  4X6A H;  4LUV A;  4A3G G;  3GTJ H;  1B7Y B;  4DR2 L;  1Z9F A;  5IP9 H;  3AEV A;  1HZC A;  1V9P A;  2NVX H;  1V1Q A;  4A3F G;  1RIP A;  1VQI A;  3CCQ A;  2KEN A;  3T1H Q;  2HIX A;  5AJ3 Q;  1HZA A;  4BY7 G;  2XGT A;  4C2M H;  4OON A;  3KFU A;  4QJF A;  1XMO L;  2F4V Q;  3HOZ H;  2K75 A;  3M4Q A;  1U0L A;  3E9I A;  4A3J H;  1QZG A;  2K5H A;  1X9N A;  3PUV A;  1WCM G;  4NXN Q;  1EUJ A;  2YV5 A;  4HIO A;  3A5Z B;  3UDI A;  3KOJ A;  4P74 A;  3HOX H;  4DR1 Q;  3PF5 A;  2NN6 G;  1N36 L;  4X64 L;  3LGJ A;  3HOV H;  2JA6 H;  1M90 C;  4JI2 L;  1PHJ A;  1J5E L;  4C3H H;  5IY0 A;  4A76 A;  4DV2 L;  3CMA A;  2F4V L;  5C44 H;  4BA2 I;  1K0R A;  4K0K Q;  4B3M L;  3H0G G;  4GLX A;  2JEA I;  1XMQ L;  4JI0 L;  4DKA C;  1IZ6 A;  3M4O H;  5IYB H;  4YHH Q;  1KC8 C;  4LFA Q;  2E2J H;  4B3S Q;  4HJ7 A;  3OW2 A;  1UE6 A;  3TRE A;  1XPO A;  1ASZ A;  4LW1 A;  4YWM A;  2VW9 A;  3U58 A;  2I0Q A;  2B63 H;  1A0I A;  4BXX G;  3PO3 G;  3OTO L;  1VQL A;  1LM0 A;  4LFC Q;  4DV5 Q;  4J15 A;  2IHF A;  3D31 A;  3PUZ A;  1PH9 A;  4BBS G;  5JJI A;  4A3M G;  4JYA Q;  2JJQ A;  1RL2 A;  4C3I H;  5M5Y H;  4RG1 A;  1PH2 A;  4A75 A;  4LF5 Q;  4K0K L;  1KXL A;  1U5K A;  1EFW A;  4Y7N H;  1Q81 C;  1HZ9 A;  2R92 G;  1LYL A;  1BVS A;  4UP8 A;  1V43 A;  2RHS B;  2ATW A;  4KHZ A;  3I56 A;  1K8A C;  1NTG A;  1WFQ A;  1OXT A;  1PYS B;  1VQ4 A;  1M1K C;  4GLV B;  2JK8 A;  4DUY Q;  3D0F A;  1N8R C;  4MTN A;  3SGI A;  2DGY A;  3I4N G;  3CME A;  1IBL Q;  4IJL A;  3NEL A;  4LUZ A;  1N34 Q;  4BBS H;  3CC7 A;  3G6E A;  2VQE Q;  4DV6 Q;  1NMG A;  3S16 H;  3PO3 H;  4LF5 L;  3OYY A;  2VZA A;  5AJ3 L;  3NEM A;  3HOY G;  3S1R H;  3S17 H;  4R1J A;  3J81 j;  4GOP B;  4DV4 Q;  3CD6 A;  5K36 G;  3G4S A;  1D7Q A;  1S72 A;  1KRT A;  4DUY L;  3CPW A;  3F1Z A;  4GN5 A;  4DR2 Q;  4B3S L;  1R9T H;  5JEA G;  5C44 G;  4WJ4 A;  4IPH A;  4AYB G;  2A8V A;  4BY1 G;  4YCV A;  2V1C C;  3K80 C;  4B3M Q;  4DR7 Q;  1EQQ A;  5IYD G;  1PH6 A;  1K3R A;  4QY7 A;  4KHP Q;  3I2Z A;  3RLO A;  3PUY A;  4LF7 L;  1MJC A;  4DV7 Q;  2K5N A;  4YWK A;  4DV1 L;  4GOP C;  3TS0 A;  3ICE A;  2UXC L;  4Y52 H;  4GKK L;  5C4J H;  1AH9 A;  1YIT A;  1IBK L;  1IL2 A;  2MQH A;  1E1T A;  5GAE C;  1UE1 A;  4X66 L;  2CKZ B;  4JV5 L;  2AWN A;  1P16 A;  2JQO A;  1Y1V G;  4GS3 A;  3KF6 A;  4JI3 Q;  4POG A;  5IWA L;  2MO1 A;  3PV0 A;  5BR8 Q;  3RNU A;  1E24 A;  2ZJP A;  4QL5 A;  2UU9 L;  2D62 A;  4DV6 L;  3PO2 G;  1MIU A;  3JAM c;  3RN2 A;  5JEA J;  1HR0 L;  3KF8 B;  2N78 A;  4A3G H;  2NVQ H;  1Q8K A;  3PCO B;  1HR0 Q;  4A3L H;  3CP0 A;  2ZJR A;  2K14 A;  4PZ7 A;  2A1A A;  4HJ9 A;  2E5L Q;  4X62 L;  3E0E A;  4JI6 Q;  1CKN A;  3AFQ A;  4JI8 Q;  2HHH L;  2DUD A;  4B3R Q;  4QIW E;  4A3K G;  4APV A;  4LF8 L;  3I55 A;  4DAM A;  3ER0 A;  4LNQ A;  1UE7 A;  5J3B A;  4OX9 Q;  1KRS A;  2EXD A;  1VQN A;  1IBM L;  2C35 B;  2OWO A;  2UUB Q;  4B3T Q;  4LF7 Q;  4DUZ L;  1HNW L;  3MXN B;  4JI1 L;  2L15 A;  4A3D H;  2I5L X;  1CSP A;  1E1O A;  1G29 1;  1I50 H;  2CWA A;  1OXV A;  1IXR A;  3HKZ E;  2R93 G;  3KYH C;  2YTY A;  5GAG C;  4B3R L;  1EIY B;  4HJ5 A;  4IPC A;  4LWC A;  2MNA A;  3S1M H;  1N9W A;  2ZTD A;  3KDF A;  1X65 A;  5FLX c;  4IO9 A;  1YNX A;  3U4Z A;  3I4O A;  4DK3 C;  3CCS A;  4DV3 Q;  2ASB A;  4OO1 G;  5C3E G;  4JI2 Q;  2LXJ A;  5IE8 A;  4IFD G;  4GKJ L;  2QEX A;  4LUO A;  3ULP A;  2IX1 A;  2R93 H;  2B29 A;  1Y1W G;  2JA7 G;  4A3I G;  1XNQ Q;  1VS0 A;  5EAY A;  4A3D G;  1SN8 A;  2F52 A;  2Q2H A;  3L0O A;  3GTK H;  1TWH H;  2NVT H;  4JI5 Q;  3U4V A;  3AQQ A;  5DLQ E;  3I4M G;  4HJA A;  3EN2 A;  4JI8 L;  4YCU A;  2NN6 I;  3CCU A;  4DV0 L;  3E9H A;  1QVC A;  3PSI A;  1XMO Q;  1EYG A;  1L2F A;  1IBL L;  1HH2 P;  2ZJQ A;  3FKI H;  1QUQ A;  2Z6K A;  3CC4 A;  5M3F G;  5M5W H;  2JA8 H;  4QQB X;  1UEB A;  2NVY H;  4A3C G;  1S3O A;  2XTI A;  3KJP A;  2PI2 A;  4AIM A;  2AMC B;  4DV3 L;  4C3J H;  1I3Q H;  1GVP A;  4A93 H;  2VUM H;  4R4C A;  3S14 H;  2Q2U A;  3RZD H;  2N49 A;  4JV5 Q;  4X66 Q;  2B3G A;  3HKS A;  4LFC L;  3ULJ A;  2R7Z H;  1Q1B A;  1W2B A;  4A3B G;  1VQJ A;  3KDF B;  1YEZ A;  2R7D A;  2KCT A;  2CCZ A;  3TEH B;  4PZ8 A;  2QGQ A;  4JC0 A;  1Q1E A;  4TVA B;  1I94 Q;  4P71 A;  3S15 H;  1FVI A;  1OXU A;  2OQ0 A;  1PH1 A;  4WJ3 M;  1D8L A;  5IYC H;  5GQO A;  1VQD A;  1N32 Q;  3GD7 A;  4XIG S;  2D0O A;  3U50 C;  4JI5 L;  3ULL A;  1EQR A;  3K7U C;  1QUQ B;  1JT8 A;  1VQH A;  2RF4 A;  1Q46 A;  3S2H H;  4DR1 L;  4KI0 A;  1Q82 C;  2MFI A;  4BY1 H;  3NBH B;  2ZTC A;  1MKH A;  4O2D A;  5FLM G;  4LF4 Q;  4DK6 C;  3HOU G;  2ES2 A;  1KHI A;  3BZC A;  1VQP A;  2JE6 I;  4IPD A;  1WYD A;  1YHB A;  2JA9 A;  2WAQ E;  1JJ2 A;  1LUZ A;  4OO1 I;  1PH7 A;  1JE5 A;  4L5S A;  1FL0 A;  1TWA H;  2KCM A;  3CAM A;  1JJC B;  3BZK A;  1X3F A;  4DV5 L;  1VQ8 A;  1A62 A;  2CFM A;  2K50 A;  4MZ9 A;  1IBK Q;  1EWI A;  2KBN A;  1TWF H;  2AKW B;  4KLK A;  3ZJY C;  1KQS A;  1VQ7 A;  1E3P A;  5C0X J;  3CCE A;  4DUZ Q;  3M3Y H;  4IFD J;  1PH3 A;  2UUC L;  3I4N H;  4KHP L;  1PH5 A;  2BH8 A;  1HZB A;  3RN5 A;  2UXD Q;  1OTC A;  1G51 A;  5M3M G;  2ZTE A;  3J81 i;  2ZM6 L;  3CXC A;  3M9B A;  4A93 G;  4YCW A;  1L1O C;  1PH4 A;  5LMU L;  1C0A A;  4H02 A;  3S2D H;  3OTO Q;  4GNX C;  1GD7 A;  3TRZ A;  3K7A H;  2QA4 A;  2BA1 A;  2UUA Q;  4LF6 Q;  3FKI G;  1L1O A;  1CKN B;  2E2I H;  3GTQ H;  1HNZ Q;  4X65 Q;  2KHJ A;  1B70 B;  2WP8 J;  4PG3 A;  3I4M H;  1K9M C;  1O7I A;  1PV4 A;  2WB1 E;  5BR8 L;  5LMN Q;  2PI2 E;  2E5L L;  4JOI C;  2WFW A;  5C4X G;  4YY3 Q;  2JA7 H;  3F2D A;  1AE3 A;  1X54 A;  5FLM H;  5C3E H;  4AQY Q;  2R7Z G;  4UY8 C;  1G6P A;  3HOV G;  5IWA Q;  5HGQ A;  1KIX A;  1OXX K;  4JI4 Q;  1E22 A;  3A74 A;  2ID0 A;  3UDX A;  5LMU Q;  1VCI A;  2GVA A;  2ALY B;  3CF5 A;  1VQ9 A;  3H3V H;  2ZM6 Q;  5GRO A;  2YU9 H;  4JBW A;  4DR4 L;  4A3J G;  1VQB A;  1XNQ L;  1QVG A;  4LFB Q;  5ELN A;  1KAW A;  1SMX A;  1SRU A;  2EQS A;  2KHI A;  4UPA A;  3CPF A;  3AYH B;  3PIO A;  3CW2 C;  4P73 A;  1VQC A;  3WWV A;  1YJN A;  5M5X H;  4OWW B;  4A3F H;  3J80 c;  4L5T A;  4A3K H;  2NZH A;  4DV0 Q;  4A3B H;  2VQF L;  4DR7 L;  1I6H H;  3H15 A;  4JBK A;  2AWO A;  4EX5 A;  2HQL A;  3DLL A;  3UE1 A;  4EQ5 A;  2UXB Q;  1H95 A;  1YHA A;  2H5X A;  4A4I A;  4AQY L;  4JI1 Q;  3IRB A;  1GKH A;  4AH6 A;  4HIM A;  4LF4 L;  4L5Q A;  1E7Z A;  2WB1 G;  1X56 A;  1VQF A;  4A3C H;  1L0W A;  3CC2 A;  3CCV A;  3W5O A;  2K5V A;  1VQO A;  1SFO H;  1L1O B;  3B6Y A;  1NJI C;  3W1B A;  2YTX A;  2BA0 A;  1N34 L;  3FP9 A;  3M7N A;  4P72 A;  1JMC A;  4O0A A;  4FDB A;  3J7A 5;  1HNX L;  1CSQ A;  4DPG A;  2FXQ A;  1SRO A;  1CKO A;  5C0X G;  3J7Z C;  1VQM A;  2UXC Q;  5IT9 c;  1PVO A;  1Y1W H;  1B8A A;  5GAD C;  4LFB L;  1XPU A;  2LXK A;  2UXB L;  1N32 L;  3GTM H;  2RCN A;  2MO0 A;  4GN3 B;  4JG2 A;  4JI3 L;  3HFZ B;  3NEN A;  3CQZ H;  4L5R C;  2OTJ A;  1BBW A;  3J81 c;  4R4O A;  3UDG A;  2VQF Q;  2D0P A;  3UDF A;  1QZH A;  1JB7 A;  2LSS A;  3STB D;  4X62 Q;  4JI6 L;  4OWT B;  1FJG L;  3PUX A;  5C4X H;  1BBU A;  2PQA B;  4UP7 A;  1Z47 A;  2RHQ B;  1WJJ A;  4HIK A;  1K8G A;  1DGS A;  3AFP A;  1IBM Q;  5IP7 G;  3BJU A;  1CUK A;  2YYZ A;  4DR4 Q;  2N3S A;  2CWP A;  5LMN L;  1YJ9 A;  4NXN L;  2JA5 G;  4JI7 L;  3S1Q H;  4JI4 L;  3A5U A;  4XTC S;  5JJL A;  1UWV A;  2IT1 A;  4DR6 Q;  1A8V A;  4IJH A;  4JCV E;  2A19 A;  2VS1 A;  3ERS X;  3F2B A;  4HJ8 A;  1N33 L;  4A3L G;  4DV4 L;  3K0X A;  1KL9 A;  1UE5 A;  1W3S A;  3PIP A;  4IOC A;  1SLJ A;  4GKJ Q;  5M3M H;  3M85 A;  2R92 H;  4R4Q A;  3UE0 A;  1XTD A;  2AHO B;  3PGZ A;  1HJP A;  1NY4 A;  3PO2 H;  4A3M H;  1XNR Q;  3DM3 A;  4BBR G;  4A3E G;  3GTP H;  1Y1V H;  3JC6 6;  4IFD I;  4YWL A;  1MJE A;  4ALP A;  2B63 G;  3CCL A;  4GKK Q;  2OTL A;  1C9O A;  3RLF A;  3G71 A;  4NXM L;  1Q86 C;  1A63 A;  4DV7 L;  1TWG H;  3VDY A;  3EIV A;  1X55 A;  3KF6 B;  4DR5 L;  1HNW Q;  3HOU H;  1T9H A;  1Y14 B;  5IYD H;  5LMN W;  4DR3 Q;  4LF8 Q;  4DV2 Q;  3G48 A;  2VQE L;  4DR5 Q;  3GTL H;  2UXD L;  1CKM A;  1VQ5 A;  4PZ6 A;  2JA6 G;  3S1N H;  3F2C A;  1VQ6 A;  2I5H A;  1GM5 A;  4AYB E;  1HNX Q;  1ASY A;  4LFA L;  2IHE A;  4POF A;  5IYC G;  3T1Y L;  3K8A A;  2PQA A;  4YY3 L;  1SR3 A;  1XMQ Q;  1KD1 C;  1XNR L;  1PFS A;  3HOY H;  4HID A;  3HOZ G;  4JI7 Q;  2PNH A;  2VNU D;  3GTG H;  4BY7 H;  1HR0 W;  4JYA L;  3FHW A;  1YVC A;  1J6Q A;  3RZO H;  4BBR H;  4A3E H;  3I7F A;  2N8N A;  1LTL A;  1IYJ B;  1X6O A;  2OCE A;  2Q2I A;  2YTV A;  2WAQ G;  3CCR A;  3T1H L;  2NZO A;  2VL6 A;  1HNZ L;  3A0J A;  1N36 Q;  3MEF A;  1AE2 A;  1PYB A;  2VUM G;  2UU9 Q;  2K52 A;  4DV1 Q;  3S24 A;  3PUW A;  4YHH L;  4DNI A;  4JOI A;  2HIV A;  2BH2 A;  5JJK A;  2GVB A;  5H1S E;  1EIF A;  2R7F A;  3L2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...