2JA5H

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
total genus 16
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja5H00
2AWOA 3CPWA 5IYDG 4DR5L 2HHHQ 3RN2A 4JBWA 1QUQA 3H0GH 4JG2A 3STBC 2VZAA 1IBML 4A3DG 4IFDI 1N33L 3KDFA 4IO9A 1K3RA 3CCRA 4DV0L 1XNQQ 4DR1L 4LFAQ 1Y1VG 2N3SA 2ID0A 1EWIA 3ULJA 2N49A 4JV5Q 4IPDA 1C0AA 4A3KG 4C3JH 1PH6A 3M9BA 4HIMA 4APVA 1VQIA 1JE5A 1UWVA 4X66L 4JI5Q 5JJLA 4B3RL 3TRZA 3M4QA 1BBUA 1X55A 2BH8A 2JA6H 4A93G 2VQEQ 4JOIC 1YIJA 4LFBL 2ALYB 2IY5B 4YY3Q 3J81i 1KIXA 1YJWA 2WB1E 4DAMA 1S40A 1K8AC 1HZCA 2I5MX 5LMUL 1SRUA 1I94Q 2UU9Q 2CWPA 1YHBA 3KJOA 3FP9A 4A3IG 1PH4A 4AYBE 3I7FA 4DV7L 1IBKL 3NENA 3CCEA 2YU9H 1YJNA 1PH3A 3HKZG 2BH2A 1WOCA 1YNXA 3PGZA 1LTLA 5GAGC 5IYCG 4JC0A 4X64L 1X9NA 4JBKA 2AMCB 3KF8B 4XIGS 2HQLA 4QIWE 2NZHA 2EIFA 5AJ3L 4LF4L 1HZBA 3F2DA 5HGQA 2NZOA 3S14H 2RHQB 1PH1A 2NVYH 2R7ZG 4YWMA 1VQGA 1J5EQ 4OWWB 3M4PA 3CPFA 2AWNA 4DV6L 1PH8A 4MTNA 3FKIG 4OX9Q 4J15A 2Y0SE 2AKWB 1VQ5A 4LF6Q 4DK6C 2I0QA 4JYAQ 1K0RA 1HNZL 1TWCH 4C3IH 2EQSA 4DUYQ 1BKBA 3HFZB 3OYYA 4LF5Q 2Z6KC 1Z9FA 4IJHA 1N32L 3KYHC 2OTLA 2V1CC 3CQZH 5J3BA 3L2PA 3GD7A 5IP9G 4YWKA 1U0LA 1QVGA 4DV3Q 1X3GA 2AHOB 3AFPA 4YHHQ 4KHPQ 1E24A 4AIMA 4OO1G 1KRSA 4LNQA 2MFIA 1YBYA 4QL5A 3G71A 3BZCA 3PIOA 3M85A 3PO2G 3UE1A 2IHEA 3TS0A 1OTCA 3DM3A 1OXXK 1XPRA 1KXLA 1VQKA 3PUVA 2JQOA 4GLXA 1LM0A 1YHQA 2K5NA 3HOWH 1HR0L 1GKHA 4GLAC 3GTQH 3CCSA 3J81j 2EXDA 1OXTA 4OONA 1M90C 4DV1Q 1VQCA 2UUAQ 4JI2L 2K5VA 3PF5A 2CKZB 1IBLL 3GTOH 5LMNQ 3JAMc 1PH9A 4A3CG 4LUVA 3UDIA 2VQFL 2B63G 1NTGA 4KI0A 4X65Q 4A76A 3EBEA 5BR8Q 2E8GA 5IP7H 3H15A 4AQYL 2FXQA 1GM5A 2NVTH 1VQDA 4LF8L 1TWHH 4DR7Q 4PZ8A 2R92H 4IFDG 3I55A 1HNXL 1NMGA 5C44G 5ELOA 2D62A 3RR5A 2LSSA 5JEAG 2ZM6L 4JI8L 2QEXA 4GKJQ 5ELNA 4C3HH 3OTOQ 4HJ5A 4A3MG 4P74A 2BA1A 2JEBI 4LF6L 1A63A 1CKNB 2JA9A 3HOXG 2OWOA 4DUYL 1Y1VH 2B3GA 1CKNA 5M3FH 2VL6A 4A3LH 4BBRG 4BY1G 2JA7G 1WI5A 3IRBA 2UUCQ 3ERSX 1YZ6A 1XJVA 3JAMi 2UXDQ 2JE6I 5C3EG 4OWTB 4DV3L 4YHHL 2R93G 2PI2E 4DV5L 4A3BH 3RNUA 4MZ9A 2A8VA 1L1OA 3KF6B 1EYGA 1SE8A 1VQJA 3RLOA 4OO1I 3KF6A 1CUKA 1VS0A 2JA8G 4OXPA 1HJPA 5M3MG 4DV2L 4B3SL 4B3TQ 4HIOA 1CSPA 4HJAA 1Y1WG 1Z47A 1AE2A 4DPGA 2VUMH 2GN5A 4GS3A 4RMFA 2Z0SA 4GKKQ 2JEAI 4BBSG 1D7QA 3AEVA 1C9OA 4DR4L 3TS2A 1HZAA 4JI0L 1CKMA 2DUDA 4O2DA 4ALPA 3M4OH 3G6EA 1E1OA 1IYJB 3E0EA 3Q8DA 2XGTA 1U5KA 4DUZQ 4HJ7A 2PI2A 1JT8A 3ULLA 2VNUD 3KJPA 3S2HH 2LXJA 2K14A 2UXBL 1OXUA 4DAYB 1QVCA 4UP8A 1W2BA 1PH2A 5M5XH 4NXNQ 5IY0A 2XTIA 4DR3L 5M5WH 1UE6A 2UXCQ 1X3EA 4JI4Q 3K0XA 1A0IA 3HOUH 3I4MG 2A1AA 3S1NH 5GAEC 2K52A 5EAYA 5C0XG 1BBWA 2JA5G 1C7YA 3W1GA 3TEHB 1XNRQ 3HOZG 3U50C 2JJQA 5JJIA 4X62L 3FHWA 2ZJRA 2HT1A 4K0KQ 3L7ZC 4EX5A 4LUZA 5IP9H 2PMZE 2UUCL 5H1SE 3G4SA 4HJ8A 1SMXA 4QY7A 1FL0A 2QGQA 4PG3A 3I4OA 2UUBQ 4BY7G 1WCMG 4JI7Q 2Q2IA 3T1YL 1HNWL 3PO2H 4DNIA 1JB7A 2Q2HA 1N36Q 3A5ZB 5IT9c 3NBHB 3CXCA 4DR2Q 4LF7Q 5C4XG 1PH5A 4DR6Q 3TREA 3UE0A 1Q86C 1X6OA 3UDFA 3UDGA 2PQAB 4IFDJ 4LF9Q 3W1BA 1B7YB 1LUZA 1EOVA 5JEAJ 1FJGL 3RZOH 4A3CH 5FLMG 2B63H 2F4VQ 3S1QH 5FLXc 4DUZL 3I4NG 2K4KA 3PO3G 3NEMA 4A3EG 3K7UC 4Y52H 2HHHL 1JJCB 4R4QA 1VQMA 3CAMA 4GOPB 2ZTCA 3CF5A 3T1HQ 4A3MH 4POGA 1YJ9A 1XNQL 1I5FA 4GOPA 3ER0A 3D0FA 2D0OA 3A0JA 2WAQG 4LFAL 3PUZA 5IWAQ 2E5LQ 4JV5L 4Y7NH 3JC66 1TWAH 5IYBG 4YCUA 3KFUA 2KHIA 5C0XI 3HKSA 4A3JH 4BY1H 2CFMA 4JI5L 1FVIA 2F3IA 3HOVG 1XMQQ 1G291 3PUXA 5C3EH 2VQEL 4YCWA 3H0GG 2HIVA 4YY3L 2NVXH 4L5SA 3CCQA 4LFCQ 1GO3E 2K5HA 4JI1Q 3KLWA 1PFSA 4P71A 1XMOQ 4AH6A 1M1KC 1I94L 2UU9L 5M3MH 1HH2P 1E1TA 4LF7L 1E3PA 5GROA 3GTJH 4QQBX 1OXVA 4DR6L 4EQ5A 4BBSH 1VQ4A 4YWLA 3HKZE 3MXNB 2WFWA 2B29A 1K83H 1D8LA 1UE1A 2ZTEA 1G6PA 2JA6G 4A3GG 1Q1EA 2ASBA 3PUWA 4DKAC 1KC8C 3D31A 5E7NA 4NXMQ 1JMCA 1ASZA 4L5RC 4L5QA 1YVCA 4JI3Q 1DGSA 1AE3A 1IXRA 1IL2A 2ATWA 5K36G 1K8GA 1XTDA 1PV4A 4R4CA 2Q2UA 3E9HA 3ZJYC 1J5EL 4B3MQ 5IYDH 4A3DH 3J80c 1MJCA 1VQEA 4P75A 4JBJA 4OX9L 4UY8C 3CD6A 4JYAL 1TWGH 1PA6A 1HR0W 4WJ3M 1HZ9A 1BVSA 1EUJA 2E2JH 4LF5L 3A5UA 3H3VI 1EIYB 4A3KH 4XTCS 3CC2A 4BXXG 2VY3A 1XPOA 2NN6G 4GNXB 4JBMA 1X3FA 4JI6Q 2JK8A 3WWVA 5DLQE 4UP9A 2CWAA 3F8TA 4DV4Q 3K7AH 4GNXA 3PUYA 4A93H 3PV0A 1XMQL 1VQLA 2A19A 3STBD 3ICEA 1IBMQ 3S16H 4IPGA 4L5TA 4BY7H 1WCMH 1UEBA 3HOYG 4DV0Q 1JJ2A 4DR1Q 4P72A 3J80i 4A3IH 1QZGA 1KHIA 1L0WA 1NY4A 5HY6A 4LUOA 3RZDH 1KD1C 2I5HA 1I6HH 2IX0A 2YV5A 1E22A 4X66Q 4DV1L 2UUAL 4B3RQ 1G51A 3F2CA 5LMNL 5IYCH 1CKOA 3AFQA 3CC4A 4LFBQ 1PVOA 2BA0A 4X65L 5BR8L 3J7ZC 5FLMH 1OXSC 1EFWA 1B70B 4IOAA 2LXKA 5LMUQ 1CSQA 3OW2A 1VQOA 1VQ9A 3PO3H 1B8AA 4BA1I 2R7ZH 1L1OC 4GKJL 4A3EH 3OTOL 4B3ML 3S17H 1KL9A 3GO5A 3I56A 1S3OA 4BA2I 3FKIH 2KENA 3KOJA 4DV7Q 1Q7YC 1IBKQ 4HIDA 4QGUA 1EQRA 1K9MC 2E2HH 4X64Q 2QA4A 4IPCA 1VQAA 2ZTDA 2VUMG 3GTPH 1EIFA 3E9IA 4JOIA 5IP7G 5AJ3Q 4LF4Q 1TWFH 4KHZA 3M7NA 1SFOH 4JI6L 1W3SA 4A3FG 2R92G 1P8LA 5GADC 1SR3A 2UXDL 2ZJPA 2NN6I 4X6AH 4DV4L 4H02A 1LYLA 4DV6Q 1QVFA 3S24A 3F2BA 4ME3A 3KDFB 4HJ9A 3CMEA 2YYZA 2Y0SG 4IJLA 1MJEA 2CCZA 1TXYA 1HNZQ 3K81C 3GTGH 1PYBA 4B3TL 4TQUS 3S1RH 1N32Q 4GKKL 4A3LG 3CCJA 3PCOB 5M3FG 1P16A 2HIXA 1WJJA 4MNOA 2CQOA 2PQAA 1Q81C 1PH7A 1J6QA 4A3GH 4A3BG 1NBWA 4P73A 5M5YH 4TVAB 3PIPA 1V1QA 1N34Q 3CW2C 2N78A 1JJGA 3CC7A 3BZKA 5C44H 2GVAA 1WYDA 1NJIC 1Q8KA 4PZ7A 1Q82C 1HR0Q 4NXNL 3MEFA 4GN5A 2Z6KA 4NB3A 2UXCL 1WFQA 1KRTA 4JI2Q 1GD7A 1KAWA 5IE8A 1MIUA 2KHJA 1VQPA 4JI4L 1RL2A 1IBLQ 3GTLH 1R9TH 2MO1A 2C35B 3HOXH 5FJ8G 3LGJA 1X54A 2VQFQ 1VQNA 1QZHA 1XNRL 1E7ZA 4BBRH 1X65A 4AQYQ 1YITA 2JA7H 4BXXH 4LF8Q 4K0KL 1SN8A 3CP0A 3GTKH 1HNXQ 4GN3B 4GN4B 3UDXA 2ZM6Q 4KHPL 1IZ6A 3CCMA 3BU2A 4QJFA 4JI8Q 3RLNA 5GAHC 3J7A5 1GVPA 2R93H 2VS1A 2UUBL 2MQHA 3B6YA 1Q1BA 4JI7L 3PF4A 1UE7A 2JA8H 1N36L 3HOUG 3HOYH 2DGYA 4DR2L 2K50A 1YI2A 3W5OA 4R4OA 3BJUA 1Y1WH 1A8VA 2YTXA 1UE5A 1PHJA 4GOPC 1VQ7A 1VQFA 3S15H 1N8RC 4PZ6A 2RCNA 4LF9L 1Y14B 3RN5A 1PYSB 4C2MH 3CCVA 3K80C 1FGUA 1V43A 4DV5Q 1K73C 4GLVB 2NVQH 2F4VL 1S72A 2GVBA 4A4IA 1AH9A 2E2IH 2OCEA 1N34L 3K8AA 4DV2Q 2MNAA 4B3SQ 5C0XJ 3F1ZA 4OWXB 2F52A 1T9HA 1VQ6A 1I50H 2MO0A 2PNHA 4A75A 4JCVE 3L0OA 4RG1A 3T1HL 4DR4Q 1YHAA 3GTMH 4DK3C 4JI0Q 1X56A 4HIKA 2ES2A 3I4MH 2JA5H 2WAQE 1VQ8A 2IT1A 4DR7L 5IWAL 2KBNA 2E5LL 3HOZH 3VDYA 3S2DH 1L2FA 3PSIA 1I3QH 2KCTA 4A3FH 1EQQA 2L15A 4DR5Q 2UXBQ 3U4ZA 3A74A 3CCUA 2RHSB 2I5LX 2OTJA 4WJ4A 2N8NA 3SGIA 4DR3Q 4LFCL 1N33Q 4JI1L 3CCLA 4NPSA 2R7DA 2IHFA 1XMOL 1RIPA 1XPUA 4IPHA 5C4XH 1V9PA 3U58A 1NMFA 1MKHA 4KLKA 2D0PA 3EN2A 3TQYA 4X62Q 4LW1A 4A3JG 4LWCA 1NE3A 4POFA 3M3YH 1VCIA 2OQKA 3AQQA 2ZJQA 1L1OB 2WB1G 4NXML 4GNXC 4R4TA 4R1JA 3T1YQ 3I4NH 1HNWQ 2YTVA 4JI3L 3RLFA 3GDEA 1SLJA 3I2ZA 3HOVH 3S1MH 3HOWG 3G48A 3U4VA 2R7FA 3DLLA 2WP8J 1Q12A 1Q46A 4O0AA 1VQBA 2YTYA 3AYHB 4YCVA 4AYBG 3EIVA 4FDBA 3CMAA 2Q2TA 1KQSA 2IX1A 3H3VH 4UPAA 1A62A 1SROA 4UP7A 5JJKA 1O7IA 3NELA 5GQOA 1N9WA 2KCMA 1ASYA 2H5XA 1VQHA 2OQ0A 4PMWA 4IOCA 1FJGQ 5FJ8H 2K75A 5C4JH 5IYBH 5LMNW 2RF4A 3J81c 2VW9A 3ULPA 1YEZA 4R4IA 1H95A 1QUQB 2R6GA
chains in the Genus database with same CATH superfamily
2IW3A 1KTKA 3IL8A 3RN2A 1IBML 3H09A 4N9TA 1XNQQ 4DR1L 4J1MA 4LFAQ 1Y1VG 3ULJA 1D1KA 4A3KG 3RZOB 3URYA 1QNKA 4APVA 1JE5A 1UWVA 4X66L 1R4QB 4JI5Q 2WIIB 3M4QA 1BBUA 2JA6H 2VQEQ 1PXUA 4LFBL 1A2TA 2EVBA 1KIXA 3V05A 4DF7A 1S40A 1K8AC 2I5MX 1TWCB 5LMUL 1C8CA 1YHBA 2AQ1B 4AYBE 5I6WA 4DV7L 1PH3A 3DXJC 3BG3A 1SYDA 5IYCG 4JC0A 1X9NA 2AMCB 3KF8B 2HQLA 4LF4L 2WB1B 3KF8A 5HGQA 1RKNA 2NZOA 1FNWA 4F88A 1TVXA 2JSOA 4OWWB 4RKLA 3CPFA 1A6XA 4JYAQ 3SK4A 4DK6C 2B2UC 2I0QA 1HA6A 1HNZL 4C3IH 2F0IA 1MHWC 1N32L 2VUMB 1H9RA 4O1NA 1U0LA 1PTOC 4KHPQ 2K5DA 4KY5A 1L0YB 1KRSA 4LNQA 2MFIA 2K1BA 4QL5A 2VB2X 4A3DB 3G71A 5JOBA 3PO2G 5EGTA 3TS0A 1OTCA 3DM3A 3VYUA 4MN3A 1LM0A 4YIJA 3HOWH 2B2TA 2EJGC 4PMBA 4GLAC 1B1ZA 3GTQH 2EXDA 1OXTA 4OONA 1ZKOA 3GTOH 2G5DA 3Q23A 4QB4A 1PH9A 4A3BB 2VQFL 1SSOA 2NWGA 4X65Q 4OGQC 3EBEA 5BR8Q 2E8GA 5IP7H 4IFDG 1VQDA 2R92H 5ELOA 2D62A 2QEXA 1H9SB 3BS1A 5KNDA 3OTOQ 4A3IB 1H9SA 3BYYB 4P74A 4K8IA 2JEBI 3K6OA 2JA9A 2X6GA 5M3FH 1TS4A 4BBRG 1VMCA 2UUCQ 3NTIA 3OMGA 1YZ6A 3JAMi 1RTOA 2JE6I 1KLGD 5KIXA 3BDCA 2R7ZB 4JVZA 4DV5L 1JWMD 4MZ9A 2A8VA 4WJWA 3S17B 1SE8A 1VQJA 4OO1I 4C1NI 4OXPA 1HJPA 2B2WC 4DK0A 3AMUA 1EL0A 1UNSA 1AE2A 2OEOA 3R93A 4GS3A 1EQTA 2NBFA 4BBSG 2F0QA 1ILPA 1STGA 2EY6A 2DUDA 3M4OH 1IYJB 4TKOB 2A5HA 3S2HH 2GA4B 1RDPD 2VXWA 3ERQA 2XTIA 4DR3L 1UE6A 1SNOA 4KD3A 4FF3A 5GAEC 2K52A 1BBWA 3TEHB 1CHPD 3U50C 2A6HC 2M2LA 2EYOA 3L7ZC 2CW0C 4LUZA 2UUCL 3C46A 1SMXA 2QGQA 2TSSA 4PG3A 1NR2A 4X3KA 4A3MB 1SYFA 2Q2IA 3T1YL 2Q2HA 2NYZD 4JPBW 3NBHB 3DMUA 2R3ZA 2MPMA 4Y7NB 3AU7A 4DR6Q 2XRSD 3NBHA 4KKSA 1Q86C 1X6OA 4BY1B 3UDGA 2PQAB 4IFDJ 1SJED 4LF9Q 4K6LA 4ZYSA 3P7JA 4HN7A 2R93B 5FLMG 5FLXc 3D4RA 2EJFC 4KTAA 1JE4A 1SNQA 2JA8B 5M3MB 2HHHL 3UI2A 4GOPB 4TRDA 1YJ9A 4GOPA 3OWEB 3TP8A 2D0OA 3A0JA 4BS9A 2WAQG 1Y8NB 1TY2A 4JV5L 1CTMA 1B53A 4O42A 3D3RA 2O5JC 3MVVA 3J80L 1BOSA 1DD2A 2Z1CA 4YY3L 2NVXH 2K05A 4LFCQ 1U9RA 1MSHA 2KECA 1LTRD 2UU9L 1J9OA 4DR6L 4YWLA 4KMUC 3OOCA 4P2CB 1Q1EA 3V96A 1FR3A 2ASBA 3PUWA 3TN2A 4IUPA 1LACA 3QR8A 4BY7B 1JMCA 1I4RA 1YVCA 5C3XA 2H4OA 2ICEC 5K36G 4CJ1B 1K8GA 4R4CA 5D3IB 2B2VA 1VQEA 1YNND 2MJ8A 4P75A 2DY8A 3KLSX 1TWGH 1PA6A 3HKZB 1BCPF 2K6AA 1LTAD 4LF5L 4DN4M 1UAPA 1Y69U 4A3KH 2OT2A 2VY3A 4JBMA 1X3FA 2JK8A 5DLQE 3VR3A 1EIGA 2RDFA 4IPGA 1PYWD 3E6ZX 1WCMH 1UEBA 3G7LA 5CV7A 1Z7TA 5E1FA 3SK6A 3RZDH 2UUAL 4DV1L 3W3AA 4K5XA 3F2CA 5IYCH 1HQMC 1Q8IA 2ENBA 1EFWA 2K5WA 2F0NA 3OW2A 1CSQA 2ZXRA 1VQ9A 3T13A 3PO3H 4ILWA 4A3EH 4DFAA 1Q7YC 3K0YA 3ONAB 1WTXA 2VUMG 2F0VA 4HCSA 3EQLC 3HG9A 2HDLA 5C44B 1P8LA 2EYMA 2ZJPA 2NN6I 4RCNA 2WACA 5ELBA 3F2BA 2G9DA 4HJ9A 1SNCA 3K81C 2O4XA 5C5MA 2L1BA 5FO8B 1W6JA 4A3LG 2C9OA 1LV9A 3NTKA 4CJ2C 2O5IC 4K5WA 4L6TB 1EY8A 2CQOA 1Q81C 1K0SA 1J6QA 4A3GH 4A3BG 2N88A 1JCKB 4KKTA 3KLSA 2FMCA 3HOYB 1JJGA 3GQBA 3NK9A 3FMCA 2GVAA 1VMPA 4NXNL 4DGZA 4JI4L 4DR7Q 1EYAA 1STAA 2XNAC 1R9TH 1QCBD 3Q0AA 1X54A 2KEEA 4BBRH 1X65A 1YITA 4BXXH 5A35A 1SN8A 1HNXQ 4GN3B 2D5DA 2L11A 1IZ6A 3CCMA 3M7GA 2UUBL 3B6YA 2I07B 3BDOA 1ICFB 3PF4A 1FNVA 1LTTD 4XYQA 1H9KA 3W5OA 3BJUA 4QCLA 1A8VA 2QILA 4ID6A 3HOZB 2K04A 4KJOA 1I3QB 1VQFA 1F2LA 2JN4A 1F77A 1N8RC 5EPLA 4C2MH 1MGSA 1V43A 3DWAA 2X69A 4C3HB 4A4IA 2OCEA 3DM1A 3K8AA 4B3SQ 3T4AC 2B2YC 3F1ZA 4OWXB 2F3VA 2RDHA 2F52A 2LS01 3CRLC 4JCVE 3BDLA 4F7XA 3BYTB 3GTMH 4DK3C 1HUNA 1X56A 1FYCA 2FFKB 1VQ8A 2XIWA 4DR7L 5EKIA 4Q0FA 2E5LL 2E74C 3S2DH 5I9OA 1L2FA 3PSIA 5CV4A 1JOKA 2KCTA 1GUWA 2I46A 4WJ4A 3IKJA 2N8NA 3SGIA 1N33Q 5FK9C 4NPSA 2R7DA 1GUNA 1XPUA 3I70A 1JORA 4HMJA 1LTGD 2Z6BA 3TQYA 1SYEA 4G4KA 4POFA 5IGFA 2ZJQA 1L1OB 2SOBA 4ABNA 4R4TA 1PZJD 4R1JA 2YTVA 2BDOA 3HOWG 1AN8A 2K03A 2WP8J 1Q12A 1Q46A 4O0AA 1VQBA 2YTYA 1BR9A 3NBIA 2SDFA 3LWUA 1O7IA 1N9WA 2EYHA 2H5XA 4PMWA 5FJ8H 2K75A 5C4JH 4ULLA 3EROA 3J81c 1CT1D 1H95A 2HDMA 5EKLA 3STBC 4JG2A 1BXTA 1NNXA 5C3WA 2YU9B 1N33L 5KRUA 3KDFA 1EY0A 1K3RA 3DEOA 3DUZA 4OIKA 1QJOA 2N49A 2RQXA 3D4DA 4C3JH 3M9BA 4HIMA 5IOCA 4HTHA 3TRZA 4EVOA 3HRZC 4FXDA 3D6WA 1SNDA 4CDCC 2RBMA 5EQ0A 5FO7B 1YJWA 5K36H 1DJRD 3VYSA 4CBVA 1SRUA 1I94Q 3KJOA 2RVLA 3P1HA 1PH4A 1DONA 2KCCA 1IBKL 4JK1C 2QKIC 2SNMA 3HKZG 3PGZA 1WOCA 1YNXA 3SE0A 1LTLA 2BH2A 1EZ8A 2SNSA 5GAGC 1A3TA 2PW7A 3K57A 1AW7A 5DAUA 5AJ3L 5A2QL 2JXMB 4RGMA 3F2DA 1XWEA 2RHQB 4E6IA 1J5EQ 1Z6HA 2NTTA 4DV6L 3GTJB 4AYBB 4OX9Q 1DOLA 4J15A 2HCIA 5D65A 1TWCH 1WD0A 2EQSA 4DUYQ 3HFZB 3OYYA 4V0BA 2Z6KC 1A2UA 2V1CC 5J3BA 2Z9HA 3NP8A 4OL7A 1TWHB 1HUMA 4UHVA 5HGTA 4DV3Q 2AHOB 4YHHQ 1E24A 4OO1G 4K2KA 1HXYD 4G7ZC 2F1MA 3UE1A 1VQKA 3PUVA 3C3LA 2E2JB 4G7HC 4DXFA 2C5CA 1M90C 1VQCA 1PRTD 3MXUA 4DXGA 1SBBB 1IBLL 1BUVT 3K7AB 1D6EC 4A93B 3UDIA 2E75C 2VUMH 1ZYRC 1IW7D 4AQYL 4LF8L 5C44G 4EGVA 5JEAG 2ZM6L 3KLRA 2LSSA 4GKJQ 5ELNA 3L3OC 1B3QA 2L4NA 1LTBD 1PRTB 4EQNA 1EFID 2BCOA 4NW2A 3HOXG 4DUYL 2B3GA 4A3LH 1I4XA 3K5MA 1WI5A 3IRBA 3D8GA 3NPPA 3K58A 2K28A 2UXDQ 4DV3L 4YHHL 3OIPA 5M5XB 4A3BH 2M9VA 1EY4A 3KF6B 1SEBD 1EYGA 3FKIB 3KF6A 3J80E 1VS0A 2DNCA 3S1NB 1BO0A 4OEMB 4B3TQ 2E2HB 1ZXTA 4RMFA 2Z0SA 4GKKQ 1F2MA 3GTPB 1D7QA 3AEVA 4DR4L 4CDDC 1BCPC 1TWFB 1HZAA 4JI0L 1CKMA 1ZEQX 4ALPA 1E1OA 1RTNA 2B39A 2XGTA 2BE5D 1U5KA 3KUPA 3A55A 3OHXC 2KCNA 5NUCA 1SXTA 2K14A 3H91A 2UXBL 1W2BA 3S1RB 2EOTA 4KY6A 1OO9B 2UXCQ 1I4GA 3K0XA 5C4HA 5FLXL 2A69D 3HOZG 2B63B 4X62L 4KKUA 2ZJRA 4K0KQ 5IP9H 2PMZE 3G4SA 2XSCA 1IYUA 1EY5A 3VR2A 1CZWA 1WCMG 1XYIA 4KV6A 5EJWA 3N6RA 4FP5D 3GTLB 4DR2Q 5C4XG 1PH5A 2MUYA 3TREA 1TWAB 1STEA 4A3JB 2JA7B 5C3EB 1FJGL 5JEAJ 3J81E 2F4VQ 2WV6D 3PO3G 4A3EG 2KVMA 1HTPA 4QUFA 4Y52H 1JJCB 1YNJD 4R4QA 4RGOS 4A3MH 3T1HQ 4POGA 1B50A 1XNQL 1PTOB 4QMGA 4LFAL 1X3PA 4Y7NH 3Q22A 3JC66 2MHVA 2DN8A 5C0XI 2IJ0A 2K5QA 4BY1H 4JI5L 3HOVG 1XMQQ 1PFBA 4XT3B 2VQEL 3H0GG 2HIVA 4L5SA 1GO3E 4XQJA 4JI1Q 3KLWA 2XWJB 5ELCA 4P71A 1XMOQ 5M3MH 3MC0B 4QQBX 1OXVA 1K8MA 4EQ5A 1F9SA 1VQ4A 1X32A 2A6ED 2WFWA 2B29A 1D8LA 1UE1A 5D14A 2F0SA 4A3GG 1KC8C 4DAVA 1ASZA 4L5QA 1WTVA 4JI3Q 5G3LD 3MTSA 1AE3A 3MXGA 4DU9A 1I6HB 3SVMA 2PW5A 4JYAL 1V1PB 2B2TC 1MSGA 3M3YB 1V1PA 1BVSA 2F0UA 3H3VI 3A5UA 1EIYB 1GXDC 4BXXG 2NN6G 4RH6A 1JWUD 3QOJA 3RMHA 4DK1A 4GNXB 2FMMA 1QILA 3I4NB 3HP3A 4J6HA 4GNXA 4KHPL 1C4QA 3MWYW 3PV0A 1XMQL 2NB0A 2D2CC 4J8QA 4BY7H 4DV0Q 2KJXA 1CQVA 3J80i 3VA5A 5FOBB 4X3TA 2EE1A 1L0WA 3MA2B 1EEID 3T51B 1SFOB 1E22A 2AQ2B 1WTWA 4B3RQ 1G51A 1GHJA 2A6EC 1NAPA 4XT1B 1CKOA 3AFQA 3CC4A 4FYDA 4RGNA 1PVOA 4IUNA 4X65L 5BR8L 2HCCA 3A8KE 2LXKA 1F2YA 1D2BA 3OTOL 2LMCB 1KL9A 5CMDA 3I56A 1S3OA 3KOJA 1O7YA 3A54A 1K9MC 4X64Q 1ENFA 4ZKCB 1VQAA 2ZTDA 2KHSA 1EIFA 4JOIA 1G6ZA 2DNEA 5HURA 1EEFD 4U673 5GADC 1SR3A 4OO1H 1RF2D 4H02A 3S24A 3FEWX 1CZGA 4IJLA 1TXYA 3LWEA 4TQUS 4PMCA 3QOLA 5TSSA 2HIXA 3I73A 2PQAA 4WORA 1F2ZA 4ZAIA 4IALA 1I4HA 1LO5D 1NBWA 1QNUA 4MHEA 2WKCA 5M5YH 1JQYD 2Z4HA 3W2DA 1TQOA 5C44H 5JEAH 1Y1WB 1NJIC 1Q8KA 1HA5A 1HR0Q 4NB3A 1VQPA 1KRTA 4JI2Q 1RL2A 4RA8A 5BN3A 1S5FD 3HOXH 4PNYA 3FVQA 5FJ8G 3LGJA 5KYLA 2NVQB 1CQFA 1RD9D 3T56B 4NP5A 3GTKH 3UDXA 5IGGA 5I9PA 4JI8Q 1GVPA 1D5ZC 2MQHA 3HOYH 2JA5B 3GTOB 1STNA 1X3QA 4C3JG 2YTXA 3CKIB 1UE5A 3LNNA 4GOPC 5C6AA 3S15H 2RCNA 4A3FB 4LF9L 2PCFB 3CCVA 3NUCA 3K80C 1FGUA 3SHLA 3Q24A 5CV9A 1SYBA 3K5NA 1S72A 2GVBA 1O80A 2E2IH 3OSOA 5E4XA 3GV6A 4DV2Q 2XWBB 4R8NA 1T9HA 5I2XA 5M3FB 4RG1A 1YHAA 5JVH3 1UEAB 2IT1A 2L5TA 2OF1A 3HOZH 1I3QH 3OIQA 4DR5Q 3KBGA 1QE6A 2R61A 5BN5A 3A74A 1SYGA 2M00A 4LFCL 3G6JB 5A2QE 3MEHA 2B2VC 3J81L 5C4XH 1V9PA 3U58A 1MKHA 2P5ZX 4CDFC 4A3JG 1NE3A 4HMIA 5JVG3 1BBXC 3R2TA 2WB1G 1HNWQ 4N9PA 2PZUA 3I2ZA 1KAAA 3U4VA 2QCPX 1S5ED 3DLLA 1GJXA 4YCVA 2Q2TA 3AYHB 5IGCA 3EIVA 4MIUA 1YNNC 2E76C 3CMAA 2RCFA 4LMQD 1Q3LA 1KQSA 1SROA 4UP7A 1SMYD 2SEBD 2KCMA 3Q6SA 1ASYA 1VQHA 1I6VC 2RF4A 2VW9A 1YEZA 4R4IA 3HOVH 1AZPA 3FDTA 4DR5L 3DHQA 3H0GH 1LT6D 4A3DG 4IFDI 4FF1A 3I3CA 2EPBA 1JR0D 3VYRA 1C0AA 3S14B 1AZQA 5JJLA 4V190 1GOZA 3AB9A 2BH8A 1E2ZA 1TY0A 4I65A 4C1NK 1YIJA 2ALYB 2IY5B 4DAMA 1JICA 3P75A 1HZCA 4CKBA 2CWPA 4S3SA 3FP9A 4A3IG 1WVLA 3DWQA 3CQZB 3I7FA 3CCEA 1STHA 2YU9H 1KLUD 2BOSA 1A15A 2HQEA 2WKDA 4QIWE 2NZHA 3X3MA 2NN6H 1HZBA 2Q8RE 4DAPA 4HAEA 2NVYH 3NHHA 3VA7A 2R7ZG 1F9RA 4RGTA 2AWNA 5AFWA 4MTNA 2J7ZA 2Y0SE 2PYKA 1EU4A 1WTPA 1I4PA 1ENCA 1BKBA 1MI2A 1H9JA 4IJHA 2F0DA 1RCVD 3KYHC 4ODGA 2OTLA 2NVTB 5IP9G 4YWKA 1QVGA 1EWCA 2KQ3A 1X3GA 4KJNA 5FLXE 4AIMA 3C2PA 1BF4A 3N52A 3BZCA 3PIOA 3M85A 2IHEA 5LL6X 1KXLA 1Y1VB 5EPKA 1DCZA 1DM0B 5KEEA 1Y8PB 4A3KB 4EQOA 3J81j 3MXPA 1S4ZA 2CH4W 2K5VA 3PF5A 5LMNQ 3JAMc 4LUVA 1NTGA 4A76A 3H15A 4OELB 1GM5A 3R8BA 2FXQA 5CC4A 1TWHH 4PZ8A 4KY7A 1HNXL 3RUZA 1SNMA 5G3LF 1ML0D 4HJ5A 4A3MG 5CORA 2EYLA 1AFPA 2Q8IB 3VR5A 3K5LA 1U4LA 1CHQD 1PMRA 2Z8LA 4JW0A 5CYUA 4H44C 3EJIA 1D5XC 4BY1G 2F0FA 1EZ6A 1Q90A 4GZYC 4CJ0B 4OWTB 4XXEA 2R93G 2PI2E 1EWHA 1IYVA 5COYA 1L1OA 4XQNA 1T5EA 3RLOA 1D5MC 3HOUB 5KGUA 2JA8G 4B3SL 5BN4A 5M3MG 1SJHD 4HIOA 1CSPA 1Y1WG 2GN5A 3GP7A 1C9OA 1B4OA 1KABA 1HFNA 3TS2A 3I4LA 3G6EA 3E0EA 1NR4A 4HJ7A 4CKCA 1JT8A 2VNUD 3LX0A 3PO2B 3KJPA 2FHTA 2LXJA 3EA6A 4K6DA 1EY6A 3NXWA 1CI3M 1QVCA 4UP8A 1PH2A 5M5XH 5IY0A 5M5WH 1X3EA 4NMZA 5J39A 4ME5A 2A1AA 3S1NH 4PV1C 2JA5G 5C0XG 1XXGA 1C7YA 3W1GA 1XNRQ 3S1QB 2JJQA 3FHWA 4IUTA 4HJ8A 1BQQT 4BY7G 4JI7Q 2ZXOA 1N36Q 3A5ZB 3WOEA 5IT9c 1R9TB 2QDBA 1B9MA 3UDFA 1CM9A 3I91A 4BBRB 1DYQA 2CHBD 2PMZB 5DNFA 4N8X1 1LUZA 4HSPA 3RZOH 4A3CH 3ZYYX 2B63H 1ILQA 2K4KA 1GUGA 3A8IE 1NSNS 5F2DA 2O2LD 2ZTCA 3CF5A 4BBSB 1HHVA 3EVQA 1I5FA 3D0FA 1K83B 2F0MA 5IWAQ 2K32A 2EDGA 2E2DC 4TSSA 3TBIB 4I7AA 4XDXA 1TWAH 2KHIA 3HKSA 4A3JH 2CFMA 5L37A 1EQVA 1FVIA 2F3IA 4N8FA 3PUXA 5C3EH 4HSVA 4YCWA 4F8MA 3CCQA 3H6MA 2XN9C 1EIHA 2RKSA 1PFSA 1M1KC 1I94L 1FNUA 1HH2P 2WINB 4C56C 3J7AF 1DOMA 4FO2A 3M4YA 2K01A 4DKAC 3S16B 1QOHA 1IKMA 5E7NA 4NXMQ 3I90A 2X6LA 1DGSA 1LT5D 2A68D 1PV4A 1U4RA 4B3MQ 3E9HA 3ZJYC 1J5EL 1G91A 4A3DH 4OX9L 5CV6A 4IUVA 2BDNA 1DXMA 3A56A 3WWVA 2CWAA 5ISRA 4DV4Q 2IPKD 4IQZA 4G57A 5IODA 3WDNA 1LT3D 1IBMQ 3ICEA 4L5TA 4I7ZC 3HOYG 1K8OA 1BCPB 4DR1Q 4P72A 4A3IH 1QZGA 5JPMC 1FGBD 5I2YA 1I6HH 2YV5A 4X66Q 1QG7A 1PRTC 1GUTA 1QB5D 4CKEA 4LFBQ 2BA0A 1DZ1A 3J7ZC 1OXSC 1LT4D 1IW7C 4HR7B 1PDQA 3HZXA 3GTGB 5LMUQ 1HCZA 1O7LA 4PQXA 4BA1I 2EZVA 3K5OA 2R7ZH 1O78A 4GKJL 4B3ML 2F4IA 3S17H 3GO5A 4BA2I 2KENA 4DV7Q 2MP1A 4IN3A 3T53B 3S9WA 1JOQA 1R4PB 4QGUA 5DEHA 2KUMA 1SAPA 4IPCA 1HRJA 3E9IA 4LF4Q 1TS5A 1SFOH 1W3SA 2F0OA 3RD4A 2UXDL 4X6AH 4DV4L 4C3HG 5LHY1 2NTSA 3MFYA 5JJZA 1HNZQ 3OWFA 4FF4A 1PYBA 4RKBA 4B3TL 4OHJA 2D9UA 1N32Q 1TR5A 2N55A 5CV5A 4ZK9B 3CCJA 4GKKL 2AUKA 2IL8A 1WJJA 1PTOD 4U68A 1CA6A 1PH7A 3PQIA 4P73A 2BE5C 4TVAB 3KK7A 3CW2C 3VR4A 2N78A 3CC7A 3BZKA 2B2UA 1W6KA 2Z4IA 1WYDA 1Q82C 3MEFA 4RWSC 2UXCL 1WFQA 5IE8A 1MIUA 4LAAA 2C35B 2A69C 5T1GA 2VQFQ 1VQNA 1QZHA 2F0JA 1E7ZA 2ZT9C 2EYPA 4L63B 4K0KL 3CP0A 4GN4B 3QIAA 4QJFA 3J7A5 2R93H 2VS1A 5CBEE 1I50B 5IT9E 1Q1BA 1D1IA 2EXZA 1UE7A 2RSNA 2JA8H 2L12A 3HOUG 3I4MB 1LTID 4DR2L 2K50A 1YI2A 1Y1WH 3DWPA 4R4OA 2LFNA 3J7YW 1SDFA 1H9MA 4FVMA 1CK1A 1VQ7A 2F0EA 4PZ6A 1Y14B 4DNRB 3NQIA 1AEXA 4DV5Q 2NVQH 2F4VL 3J7AV 3TP7A 1AH9A 1SYCA 1VF7A 2MNAA 1VQ6A 1YNJC 2PNHA 4A75A 3C1FA 3T1HL 4X3UA 1FD7D 4HIKA 2ES2A 3R2IA 5E3FA 2JA5H 2WAQE 5C0XH 1O7ZA 3A7LA 1A3VA 1JWSD 2EYFA 5E4WC 1RHPA 1EQQA 4A3FH 3A7AB 3S1MB 3U4ZA 2B2WA 3CCUA 2I5LX 3CU7A 2OTJA 3VR6A 4DR3Q 1GUSA 2JP1A 4JI1L 1TU2B 1XMOL 1RIPA 4HEDA 2HD3A 5ELFA 1NMFA 1U4PA 3VYTA 3NQTA 2PO4A 2A6HD 4KLKA 2D0PA 1S5DD 4LW1A 2CW0D 4LWCA 1V1OA 1VCIA 3AQQA 3EFXD 2F0TA 4GNXC 3T1YQ 4JI3L 3TP6A 1SLJA 1C48A 3HGBA 3G48A 2A73B 4AYBG 3IFTA 2IX1A 4FDBA 3H3VH 4UDUC 2JA6B 1EY9A 1E0BA 4IOCA 2OQ0A 2EJMA 3K59A 1WTOA 2QW7A 1KNAA 1QUQB 2R6GA 4UAIA 2AWOA 3V2TA 5IYDG 3CPWA 2HHHQ 4JBWA 1QUQA 2VZAA 1NCVA 4IO9A 2CVRA 3CCRA 4DV0L 3TSSA 4H7BA 2N3SA 2ID0A 1EWIA 2DJFC 1EU3A 4JV5Q 4IPDA 4F87A 3SXHA 3I8ZA 1PH6A 5KNCA 3ND9A 1VQIA 4B3RL 5C5LA 1X55A 2XVSA 4A93G 1EYCA 4JOIC 1EYDA 4YY3Q 3J81i 2WB1E 5LL6S 3WOFA 1SNPA 1ICWA 1KDBA 1ET6A 2B8FA 3ITPA 4OIJA 4C3IB 2UU9Q 3SK5A 4NDXA 3IAYA 3E5SA 1IHZA 3TDQA 3U9SA 2RA4A 1RJTA 3NENA 1B44D 1YJNA 2B8GA 2NZ1D 4Q5VA 3HEJA 5IIFA 4X64L 5DM63 4JBKA 4XIGS 4RAUC 3E3XA 2EIFA 3S14H 3MFGA 3A8JE 1PH1A 1ENAA 4DNTB 1JB3A 1JOOA 1VQGA 4YWMA 3HOWB 3M4PA 1PH8A 3GTQB 3JAML 3FKIG 2AKWB 1VQ5A 4LF6Q 1ESRA 1K0RA 1TKWB 1ESFA 3HS0C 4LF5Q 1Z9FA 4QIWB 1SE2A 4ZQ3A 3CQZH 4R8IA 3L2PA 3GD7A 2PNRC 2R92B 2DJGC 3AFPA 1II3A 4R9WA 1M8AA 1YBYA 2K33A 2Y0SB 5IGEA 4NKLA 1OXXK 1WTRA 1XPRA 2JQOA 4GLXA 1YHQA 2K5NA 3TP5A 1GKHA 1HR0L 1IL8A 2J4XA 3CCSA 4CGYB 1Y8OB 4ZUJA 4DV1Q 2UUAQ 4JI2L 1PRTF 2CKZB 4A3CG 2B63G 4KI0A 2IWHA 2NVTH 4FXKC 3QO2A 1F9PA 3I55A 1GHKA 1NMGA 3RR5A 4JI8L 3SDZA 4C3HH 3BZDB 4DA2A 1AP0A 2BA1A 1LTSD 4LF6L 2EY5A 3M4OB 4Z9CB 1A63A 1CKNB 4RCOA 2OWOA 1Y1VH 1CA5A 1STYA 1CKNA 2VL6A 2JA7G 4MTKA 3S2HB 3ERSX 4EQPA 1XJVA 5C3EG 1K3BC 3E0JA 3RNUA 5ELEA 5CGKA 1NUCA 1CUKA 1PFMA 4DV2L 2PZWA 3MHBA 4HJAA 1Z47A 4DPGA 2JEAI 5JPNC 3H3VC 4O2DA 3Q8DA 3GV3A 5IT9L 1TS3A 4DUZQ 3ND8A 2PI2A 3ULLA 2EY1A 3U9OA 4WRDA 1DOKA 2J0TD 1OXUA 4DAYB 4X3SA 4NXNQ 4DAYA 1B2TA 5K5PA 4JI4Q 2QDLA 1A0IA 3HOUH 3I4MG 5EAYA 1UUPA 1S5CD 2PPBC 5M5YB 5JJIA 2A74C 5FKAC 4H0LC 2HT1A 4EX5A 5H1SE 2LKVA 4QY7A 1VDZA 1FL0A 2KOLA 4BWGB 3I4OA 2UUBQ 1HNWL 3PO2H 1PFNA 4DNIA 1JB7A 2AQ3B 3CXCA 4B9XA 4LF7Q 1EY7A 3HOXB 5M9OA 3UE0A 3MAQA 3SEBA 3BVGA 3FRPB 2F0KA 3GTKB 3W1BA 1SMYC 1PZID 1B7YB 1PTOF 1EOVA 3P20A 3OMCA 2NVXB 3S1QH 4KHVA 4DUZL 3I4NG 2EYJA 3QJYA 4IFDH 3SK8A 3NEMA 4KD4A 3NWSA 3K7UC 1T5XD 4FXGC 5KYIA 1QWYA 1I4QA 4K14A 1VQMA 3CAMA 1U4MA 3CRKC 3FPUB 3S15B 3ER0A 1ET9A 2TMPA 3PUZA 2E5LQ 3NTHA 1ONLA 5IYBG 4M8AA 4YCUA 3KFUA 5C4ZA 5EPJA 1B9NA 2E2IB 1G291 1F9QA 3PMFA 2ICIA 2B2YA 1TWGB 1G8ZD 2K5HA 3BVZA 2G9HD 5IGDA 1GUOA 4H13C 4AH6A 1E1TA 1A3UA 1E3PA 2F0GA 5GROA 3GTJH 4LF7L 4BBSH 5EBDA 2ZXPA 4RHRA 3HKZE 3MXNB 1K83H 1G6PA 1LABA 2ZTEA 2JA6G 3MXNA 3D31A 3TZDA 1WCMB 1WD1A 4L5RC 1HFGA 3FPPA 2NUCA 1HPCA 2ATWA 1IXRA 1IL2A 1E2VA 1XTDA 2Q2UA 1PLFA 5IYDH 2FINB 3RZDB 5C4XB 4K5VA 1EOTA 3J80c 1MJCA 4JBJA 4UY8C 3CD6A 5T1IA 4IURA 1HR0W 4WJ3M 2AUJD 5FO9B 1HZ9A 1EUJA 2E2JH 4ZLTF 1G2SA 3CC2A 4XTCS 1XPOA 1PZKD 4JI6Q 4HCEA 1L0XB 4UP9A 3F8TA 3PO3B 2Q8TA 3K7AH 4A93H 3PUYA 1MD2D 5CR3A 3PIO3 4A3EB 1WTQA 1VQLA 4FF2A 3NSWA 1TT2A 2A19A 3STBD 3S16H 1TIID 2KEDA 5CBAE 2F0WA 1JJ2A 3IFDA 4C3IG 4WFN3 4ZRZA 1K28A 1KHIA 2PQEA 1NY4A 2FJ2A 4LUOA 5HY6A 1KD1C 2I5HA 2V4DA 5I4DA 2IX0A 3D4WA 4IUUA 3OW7A 3HOVB 5J22A 5LMNL 3D6CA 3H0GB 5FLMH 4IOAA 1B70B 4CHTB 1B3AA 1VQOA 1B8AA 4LJZC 1L1OC 1BDOA 2DY7A 3FKIH 4KN7C 1IBKQ 4HIDA 4XQQA 4IUQA 1CFMA 2KA7A 1EQRA 5ELDA 2E2HH 4A3GB 2QA4A 5D3DA 4LK1C 4XYOA 3GTPH 5IP7G 2PZTA 4K8JA 2F0PA 5AJ3Q 1TWFH 4KHZA 3M7NA 2CH4A 3DEPA 4A3FG 4JI6L 2R92G 4RFBA 4CDEC 1LYLA 4DV6Q 1QVFA 2XRQD 4ME3A 2HUGA 3TMEA 4G7OC 3KDFB 2EY2A 1TS2A 3CMEA 2YYZA 2Y0SG 3KBXA 1MJEA 2CCZA 1KDCA 3GTGH 2RSOA 3S1RH 1SE4A 3CHBD 5M3FG 3I72A 3PCOB 1P16A 2F3WA 4MNOA 1WTHA 2NVYB 4M1UB 2F03A 5KNBA 3PIPA 1V1QA 5EBCA 1N34Q 3L9AX 1XX8A 3C1EA 1IKLA 4PZ7A 3R3OA 4ZKBB 4GN5A 2Z6KA 1GD7A 1KAWA 2KHJA 3GTLH 1HTLD 1IBLQ 4ZUIA 4C2MB 2MO1A 3SR1A 2L55A 2LY7A 1XNRL 1ZYRD 4AQYQ 1BNZA 2JA7H 1E2WA 3F2UA 4LF8Q 1LLRD 2ZM6Q 1HQRD 3BU2A 3RLNA 5GAHC 2F0HA 2H1EA 4JI7L 5I6YA 3GTMB 3QWNA 1N36L 2DGYA 4RHSA 1JC7A 4B9WA 1PHJA 3S2DB 2K7VA 5JAVA 3NWTA 1PTOH 3RN5A 1PYSB 3PIP3 1K73C 4GLVB 3TZUA 4QF4A 4FNFA 1N34L 2CQAA 2QF7A 5C0XJ 5IGBA 3NE5B 1I50H 1V8QA 2MO0A 3H94A 1STBA 3L0OA 4DR4Q 1BCPD 4JI0Q 2VB3X 2IX3A 3I4MH 5IWAL 1VF5C 2KBNA 1MBYA 3VDYA 1KNEA 4KN4C 3QB3A 3O13A 2L15A 1J8IA 2UXBQ 3OPOA 2RHSB 4B08A 1XTCD 3CCLA 5DM73 3MZ5A 2IHFA 2WAQB 4ZCKA 4IPHA 4K2LA 2L9HA 5C4JB 1KDAA 3EN2A 4X62Q 3JAME 4QUCA 3BVMA 3M3YH 2QEJC 2OQKA 3T16A 4IZ8A 4NXML 5M5WB 3I4NH 1M4VA 2RDGA 2L0CA 3RLFA 3GDEA 4KK7A 2A68C 3S1MH 1SE3A 2R7FA 4C3JB 3QG1A 2JYOA 2OXPA 4UPAA 1A62A 5JJKA 1RODA 3X3NA 3NELA 4L8JA 5CV8A 5GQOA 1FJGQ 1G2TA 5IYBH 2F0LA 5LMNW 2MGSA 5J1ZA 3ULPA 5EKKA 1S5BD
chains in the Genus database with same CATH topology
2AWOA 3CPWA 5IYDG 4DR5L 2HHHQ 3RN2A 4JBWA 1QUQA 3H0GH 4JG2A 3STBC 2VZAA 1IBML 4A3DG 4IFDI 1N33L 3KDFA 4IO9A 1K3RA 3CCRA 4DV0L 1XNQQ 4DR1L 4LFAQ 1Y1VG 2N3SA 2ID0A 1EWIA 3ULJA 2N49A 4JV5Q 4IPDA 1C0AA 4A3KG 4C3JH 1PH6A 3M9BA 4HIMA 4APVA 1VQIA 1JE5A 1UWVA 4X66L 4JI5Q 5JJLA 4B3RL 3TRZA 3M4QA 1BBUA 1X55A 2BH8A 2JA6H 4A93G 2VQEQ 4JOIC 1YIJA 4LFBL 2ALYB 2IY5B 4YY3Q 3J81i 1KIXA 1YJWA 2WB1E 4DAMA 1S40A 1K8AC 1HZCA 2I5MX 5LMUL 1SRUA 1I94Q 2UU9Q 2CWPA 1YHBA 3KJOA 3FP9A 4A3IG 1PH4A 4AYBE 3I7FA 4DV7L 1IBKL 3NENA 3CCEA 2YU9H 1YJNA 1PH3A 3HKZG 2BH2A 1WOCA 1YNXA 3PGZA 1LTLA 5GAGC 5IYCG 4JC0A 4X64L 1X9NA 4JBKA 2AMCB 3KF8B 4XIGS 2HQLA 4QIWE 2NZHA 2EIFA 5AJ3L 4LF4L 1HZBA 3F2DA 5HGQA 2NZOA 3S14H 2RHQB 1PH1A 2NVYH 2R7ZG 4YWMA 1VQGA 1J5EQ 4OWWB 3M4PA 3CPFA 2AWNA 4DV6L 1PH8A 4MTNA 3FKIG 4OX9Q 4J15A 2Y0SE 2AKWB 1VQ5A 4LF6Q 4DK6C 2I0QA 4JYAQ 1K0RA 1HNZL 1TWCH 4C3IH 2EQSA 4DUYQ 1BKBA 3HFZB 3OYYA 4LF5Q 2Z6KC 1Z9FA 4IJHA 1N32L 3KYHC 2OTLA 2V1CC 3CQZH 5J3BA 3L2PA 3GD7A 5IP9G 4YWKA 1U0LA 1QVGA 4DV3Q 1X3GA 2AHOB 3AFPA 4YHHQ 4KHPQ 1E24A 4AIMA 4OO1G 1KRSA 4LNQA 2MFIA 1YBYA 4QL5A 3G71A 3BZCA 3PIOA 3M85A 3PO2G 3UE1A 2IHEA 3TS0A 1OTCA 3DM3A 1OXXK 1XPRA 1KXLA 1VQKA 3PUVA 2JQOA 4GLXA 1LM0A 1YHQA 2K5NA 3HOWH 1HR0L 1GKHA 4GLAC 3GTQH 3CCSA 3J81j 2EXDA 1OXTA 4OONA 1M90C 4DV1Q 1VQCA 2UUAQ 4JI2L 2K5VA 3PF5A 2CKZB 1IBLL 3GTOH 5LMNQ 3JAMc 1PH9A 4A3CG 4LUVA 3UDIA 2VQFL 2B63G 1NTGA 4KI0A 4X65Q 4A76A 3EBEA 5BR8Q 2E8GA 5IP7H 3H15A 4AQYL 2FXQA 1GM5A 2NVTH 1VQDA 4LF8L 1TWHH 4DR7Q 4PZ8A 2R92H 4IFDG 3I55A 1HNXL 1NMGA 5C44G 5ELOA 2D62A 3RR5A 2LSSA 5JEAG 2ZM6L 4JI8L 2QEXA 4GKJQ 5ELNA 4C3HH 3OTOQ 4HJ5A 4A3MG 4P74A 2BA1A 2JEBI 4LF6L 1A63A 1CKNB 2JA9A 3HOXG 2OWOA 4DUYL 1Y1VH 2B3GA 1CKNA 5M3FH 2VL6A 4A3LH 4BBRG 4BY1G 2JA7G 1WI5A 3IRBA 2UUCQ 3ERSX 1YZ6A 1XJVA 3JAMi 2UXDQ 2JE6I 5C3EG 4OWTB 4DV3L 4YHHL 2R93G 2PI2E 4DV5L 4A3BH 3RNUA 4MZ9A 2A8VA 1L1OA 3KF6B 1EYGA 1SE8A 1VQJA 3RLOA 4OO1I 3KF6A 1CUKA 1VS0A 2JA8G 4OXPA 1HJPA 5M3MG 4DV2L 4B3SL 4B3TQ 4HIOA 1CSPA 4HJAA 1Y1WG 1Z47A 1AE2A 4DPGA 2VUMH 2GN5A 4GS3A 4RMFA 2Z0SA 4GKKQ 2JEAI 4BBSG 1D7QA 3AEVA 1C9OA 4DR4L 3TS2A 1HZAA 4JI0L 1CKMA 2DUDA 4O2DA 4ALPA 3M4OH 3G6EA 1E1OA 1IYJB 3E0EA 3Q8DA 2XGTA 1U5KA 4DUZQ 4HJ7A 2PI2A 1JT8A 3ULLA 2VNUD 3KJPA 3S2HH 2LXJA 2K14A 2UXBL 1OXUA 4DAYB 1QVCA 4UP8A 1W2BA 1PH2A 5M5XH 4NXNQ 5IY0A 2XTIA 4DR3L 5M5WH 1UE6A 2UXCQ 1X3EA 4JI4Q 3K0XA 1A0IA 3HOUH 3I4MG 2A1AA 3S1NH 5GAEC 2K52A 5EAYA 5C0XG 1BBWA 2JA5G 1C7YA 3W1GA 3TEHB 1XNRQ 3HOZG 3U50C 2JJQA 5JJIA 4X62L 3FHWA 2ZJRA 2HT1A 4K0KQ 3L7ZC 4EX5A 4LUZA 5IP9H 2PMZE 2UUCL 5H1SE 3G4SA 4HJ8A 1SMXA 4QY7A 1FL0A 2QGQA 4PG3A 3I4OA 2UUBQ 4BY7G 1WCMG 4JI7Q 2Q2IA 3T1YL 1HNWL 3PO2H 4DNIA 1JB7A 2Q2HA 1N36Q 3A5ZB 5IT9c 3NBHB 3CXCA 4DR2Q 4LF7Q 5C4XG 1PH5A 4DR6Q 3TREA 3UE0A 1Q86C 1X6OA 3UDFA 3UDGA 2PQAB 4IFDJ 4LF9Q 3W1BA 1B7YB 1LUZA 1EOVA 5JEAJ 1FJGL 3RZOH 4A3CH 5FLMG 2B63H 2F4VQ 3S1QH 5FLXc 4DUZL 3I4NG 2K4KA 3PO3G 3NEMA 4A3EG 3K7UC 4Y52H 2HHHL 1JJCB 4R4QA 1VQMA 3CAMA 4GOPB 2ZTCA 3CF5A 3T1HQ 4A3MH 4POGA 1YJ9A 1XNQL 1I5FA 4GOPA 3ER0A 3D0FA 2D0OA 3A0JA 2WAQG 4LFAL 3PUZA 5IWAQ 2E5LQ 4JV5L 4Y7NH 3JC66 1TWAH 5IYBG 4YCUA 3KFUA 2KHIA 5C0XI 3HKSA 4A3JH 4BY1H 2CFMA 4JI5L 1FVIA 2F3IA 3HOVG 1XMQQ 1G291 3PUXA 5C3EH 2VQEL 4YCWA 3H0GG 2HIVA 4YY3L 2NVXH 4L5SA 3CCQA 4LFCQ 1GO3E 2K5HA 4JI1Q 3KLWA 1PFSA 4P71A 1XMOQ 4AH6A 1M1KC 1I94L 2UU9L 5M3MH 1HH2P 1E1TA 4LF7L 1E3PA 5GROA 3GTJH 4QQBX 1OXVA 4DR6L 4EQ5A 4BBSH 1VQ4A 4YWLA 3HKZE 3MXNB 2WFWA 2B29A 1K83H 1D8LA 1UE1A 2ZTEA 1G6PA 2JA6G 4A3GG 1Q1EA 2ASBA 3PUWA 4DKAC 1KC8C 3D31A 5E7NA 4NXMQ 1JMCA 1ASZA 4L5RC 4L5QA 1YVCA 4JI3Q 1DGSA 1AE3A 1IXRA 1IL2A 2ATWA 5K36G 1K8GA 1XTDA 1PV4A 4R4CA 2Q2UA 3E9HA 3ZJYC 1J5EL 4B3MQ 5IYDH 4A3DH 3J80c 1MJCA 1VQEA 4P75A 4JBJA 4OX9L 4UY8C 3CD6A 4JYAL 1TWGH 1PA6A 1HR0W 4WJ3M 1HZ9A 1BVSA 1EUJA 2E2JH 4LF5L 3A5UA 3H3VI 1EIYB 4A3KH 4XTCS 3CC2A 4BXXG 2VY3A 1XPOA 2NN6G 4GNXB 4JBMA 1X3FA 4JI6Q 2JK8A 3WWVA 5DLQE 4UP9A 2CWAA 3F8TA 4DV4Q 3K7AH 4GNXA 3PUYA 4A93H 3PV0A 1XMQL 1VQLA 2A19A 3STBD 3ICEA 1IBMQ 3S16H 4IPGA 4L5TA 4BY7H 1WCMH 1UEBA 3HOYG 4DV0Q 1JJ2A 4DR1Q 4P72A 3J80i 4A3IH 1QZGA 1KHIA 1L0WA 1NY4A 5HY6A 4LUOA 3RZDH 1KD1C 2I5HA 1I6HH 2IX0A 2YV5A 1E22A 4X66Q 4DV1L 2UUAL 4B3RQ 1G51A 3F2CA 5LMNL 5IYCH 1CKOA 3AFQA 3CC4A 4LFBQ 1PVOA 2BA0A 4X65L 5BR8L 3J7ZC 5FLMH 1OXSC 1EFWA 1B70B 4IOAA 2LXKA 5LMUQ 1CSQA 3OW2A 1VQOA 1VQ9A 3PO3H 1B8AA 4BA1I 2R7ZH 1L1OC 4GKJL 4A3EH 3OTOL 4B3ML 3S17H 1KL9A 3GO5A 3I56A 1S3OA 4BA2I 3FKIH 2KENA 3KOJA 4DV7Q 1Q7YC 1IBKQ 4HIDA 4QGUA 1EQRA 1K9MC 2E2HH 4X64Q 2QA4A 4IPCA 1VQAA 2ZTDA 2VUMG 3GTPH 1EIFA 3E9IA 4JOIA 5IP7G 5AJ3Q 4LF4Q 1TWFH 4KHZA 3M7NA 1SFOH 4JI6L 1W3SA 4A3FG 2R92G 1P8LA 5GADC 1SR3A 2UXDL 2ZJPA 2NN6I 4X6AH 4DV4L 4H02A 1LYLA 4DV6Q 1QVFA 3S24A 3F2BA 4ME3A 3KDFB 4HJ9A 3CMEA 2YYZA 2Y0SG 4IJLA 1MJEA 2CCZA 1TXYA 1HNZQ 3K81C 3GTGH 1PYBA 4B3TL 4TQUS 3S1RH 1N32Q 4GKKL 4A3LG 3CCJA 3PCOB 5M3FG 1P16A 2HIXA 1WJJA 4MNOA 2CQOA 2PQAA 1Q81C 1PH7A 1J6QA 4A3GH 4A3BG 1NBWA 4P73A 5M5YH 4TVAB 3PIPA 1V1QA 1N34Q 3CW2C 2N78A 1JJGA 3CC7A 3BZKA 5C44H 2GVAA 1WYDA 1NJIC 1Q8KA 4PZ7A 1Q82C 1HR0Q 4NXNL 3MEFA 4GN5A 2Z6KA 4NB3A 2UXCL 1WFQA 1KRTA 4JI2Q 1GD7A 1KAWA 5IE8A 1MIUA 2KHJA 1VQPA 4JI4L 1RL2A 1IBLQ 3GTLH 1R9TH 2MO1A 2C35B 3HOXH 5FJ8G 3LGJA 1X54A 2VQFQ 1VQNA 1QZHA 1XNRL 1E7ZA 4BBRH 1X65A 4AQYQ 1YITA 2JA7H 4BXXH 4LF8Q 4K0KL 1SN8A 3CP0A 3GTKH 1HNXQ 4GN3B 4GN4B 3UDXA 2ZM6Q 4KHPL 1IZ6A 3CCMA 3BU2A 4QJFA 4JI8Q 3RLNA 5GAHC 3J7A5 1GVPA 2R93H 2VS1A 2UUBL 2MQHA 3B6YA 1Q1BA 4JI7L 3PF4A 1UE7A 2JA8H 1N36L 3HOUG 3HOYH 2DGYA 4DR2L 2K50A 1YI2A 3W5OA 4R4OA 3BJUA 1Y1WH 1A8VA 2YTXA 1UE5A 1PHJA 4GOPC 1VQ7A 1VQFA 3S15H 1N8RC 4PZ6A 2RCNA 4LF9L 1Y14B 3RN5A 1PYSB 4C2MH 3CCVA 3K80C 1FGUA 1V43A 4DV5Q 1K73C 4GLVB 2NVQH 2F4VL 1S72A 2GVBA 4A4IA 1AH9A 2E2IH 2OCEA 1N34L 3K8AA 4DV2Q 2MNAA 4B3SQ 5C0XJ 3F1ZA 4OWXB 2F52A 1T9HA 1VQ6A 1I50H 2MO0A 2PNHA 4A75A 4JCVE 3L0OA 4RG1A 3T1HL 4DR4Q 1YHAA 3GTMH 4DK3C 4JI0Q 1X56A 4HIKA 2ES2A 3I4MH 2JA5H 2WAQE 1VQ8A 2IT1A 4DR7L 5IWAL 2KBNA 2E5LL 3HOZH 3VDYA 3S2DH 1L2FA 3PSIA 1I3QH 2KCTA 4A3FH 1EQQA 2L15A 4DR5Q 2UXBQ 3U4ZA 3A74A 3CCUA 2RHSB 2I5LX 2OTJA 4WJ4A 2N8NA 3SGIA 4DR3Q 4LFCL 1N33Q 4JI1L 3CCLA 4NPSA 2R7DA 2IHFA 1XMOL 1RIPA 1XPUA 4IPHA 5C4XH 1V9PA 3U58A 1NMFA 1MKHA 4KLKA 2D0PA 3EN2A 3TQYA 4X62Q 4LW1A 4A3JG 4LWCA 1NE3A 4POFA 3M3YH 1VCIA 2OQKA 3AQQA 2ZJQA 1L1OB 2WB1G 4NXML 4GNXC 4R4TA 4R1JA 3T1YQ 3I4NH 1HNWQ 2YTVA 4JI3L 3RLFA 3GDEA 1SLJA 3I2ZA 3HOVH 3S1MH 3HOWG 3G48A 3U4VA 2R7FA 3DLLA 2WP8J 1Q12A 1Q46A 4O0AA 1VQBA 2YTYA 3AYHB 4YCVA 4AYBG 3EIVA 4FDBA 3CMAA 2Q2TA 1KQSA 2IX1A 3H3VH 4UPAA 1A62A 1SROA 4UP7A 5JJKA 1O7IA 3NELA 5GQOA 1N9WA 2KCMA 1ASYA 2H5XA 1VQHA 2OQ0A 4PMWA 4IOCA 1FJGQ 5FJ8H 2K75A 5C4JH 5IYBH 5LMNW 2RF4A 3J81c 2VW9A 3ULPA 1YEZA 4R4IA 1H95A 1QUQB 2R6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWO A;  3CPW A;  5IYD G;  4DR5 L;  2HHH Q;  3RN2 A;  4JBW A;  1QUQ A;  3H0G H;  4JG2 A;  3STB C;  2VZA A;  1IBM L;  4A3D G;  4IFD I;  1N33 L;  3KDF A;  4IO9 A;  1K3R A;  3CCR A;  4DV0 L;  1XNQ Q;  4DR1 L;  4LFA Q;  1Y1V G;  2N3S A;  2ID0 A;  1EWI A;  3ULJ A;  2N49 A;  4JV5 Q;  4IPD A;  1C0A A;  4A3K G;  4C3J H;  1PH6 A;  3M9B A;  4HIM A;  4APV A;  1VQI A;  1JE5 A;  1UWV A;  4X66 L;  4JI5 Q;  5JJL A;  4B3R L;  3TRZ A;  3M4Q A;  1BBU A;  1X55 A;  2BH8 A;  2JA6 H;  4A93 G;  2VQE Q;  4JOI C;  1YIJ A;  4LFB L;  2ALY B;  2IY5 B;  4YY3 Q;  3J81 i;  1KIX A;  1YJW A;  2WB1 E;  4DAM A;  1S40 A;  1K8A C;  1HZC A;  2I5M X;  5LMU L;  1SRU A;  1I94 Q;  2UU9 Q;  2CWP A;  1YHB A;  3KJO A;  3FP9 A;  4A3I G;  1PH4 A;  4AYB E;  3I7F A;  4DV7 L;  1IBK L;  3NEN A;  3CCE A;  2YU9 H;  1YJN A;  1PH3 A;  3HKZ G;  2BH2 A;  1WOC A;  1YNX A;  3PGZ A;  1LTL A;  5GAG C;  5IYC G;  4JC0 A;  4X64 L;  1X9N A;  4JBK A;  2AMC B;  3KF8 B;  4XIG S;  2HQL A;  4QIW E;  2NZH A;  2EIF A;  5AJ3 L;  4LF4 L;  1HZB A;  3F2D A;  5HGQ A;  2NZO A;  3S14 H;  2RHQ B;  1PH1 A;  2NVY H;  2R7Z G;  4YWM A;  1VQG A;  1J5E Q;  4OWW B;  3M4P A;  3CPF A;  2AWN A;  4DV6 L;  1PH8 A;  4MTN A;  3FKI G;  4OX9 Q;  4J15 A;  2Y0S E;  2AKW B;  1VQ5 A;  4LF6 Q;  4DK6 C;  2I0Q A;  4JYA Q;  1K0R A;  1HNZ L;  1TWC H;  4C3I H;  2EQS A;  4DUY Q;  1BKB A;  3HFZ B;  3OYY A;  4LF5 Q;  2Z6K C;  1Z9F A;  4IJH A;  1N32 L;  3KYH C;  2OTL A;  2V1C C;  3CQZ H;  5J3B A;  3L2P A;  3GD7 A;  5IP9 G;  4YWK A;  1U0L A;  1QVG A;  4DV3 Q;  1X3G A;  2AHO B;  3AFP A;  4YHH Q;  4KHP Q;  1E24 A;  4AIM A;  4OO1 G;  1KRS A;  4LNQ A;  2MFI A;  1YBY A;  4QL5 A;  3G71 A;  3BZC A;  3PIO A;  3M85 A;  3PO2 G;  3UE1 A;  2IHE A;  3TS0 A;  1OTC A;  3DM3 A;  1OXX K;  1XPR A;  1KXL A;  1VQK A;  3PUV A;  2JQO A;  4GLX A;  1LM0 A;  1YHQ A;  2K5N A;  3HOW H;  1HR0 L;  1GKH A;  4GLA C;  3GTQ H;  3CCS A;  3J81 j;  2EXD A;  1OXT A;  4OON A;  1M90 C;  4DV1 Q;  1VQC A;  2UUA Q;  4JI2 L;  2K5V A;  3PF5 A;  2CKZ B;  1IBL L;  3GTO H;  5LMN Q;  3JAM c;  1PH9 A;  4A3C G;  4LUV A;  3UDI A;  2VQF L;  2B63 G;  1NTG A;  4KI0 A;  4X65 Q;  4A76 A;  3EBE A;  5BR8 Q;  2E8G A;  5IP7 H;  3H15 A;  4AQY L;  2FXQ A;  1GM5 A;  2NVT H;  1VQD A;  4LF8 L;  1TWH H;  4DR7 Q;  4PZ8 A;  2R92 H;  4IFD G;  3I55 A;  1HNX L;  1NMG A;  5C44 G;  5ELO A;  2D62 A;  3RR5 A;  2LSS A;  5JEA G;  2ZM6 L;  4JI8 L;  2QEX A;  4GKJ Q;  5ELN A;  4C3H H;  3OTO Q;  4HJ5 A;  4A3M G;  4P74 A;  2BA1 A;  2JEB I;  4LF6 L;  1A63 A;  1CKN B;  2JA9 A;  3HOX G;  2OWO A;  4DUY L;  1Y1V H;  2B3G A;  1CKN A;  5M3F H;  2VL6 A;  4A3L H;  4BBR G;  4BY1 G;  2JA7 G;  1WI5 A;  3IRB A;  2UUC Q;  3ERS X;  1YZ6 A;  1XJV A;  3JAM i;  2UXD Q;  2JE6 I;  5C3E G;  4OWT B;  4DV3 L;  4YHH L;  2R93 G;  2PI2 E;  4DV5 L;  4A3B H;  3RNU A;  4MZ9 A;  2A8V A;  1L1O A;  3KF6 B;  1EYG A;  1SE8 A;  1VQJ A;  3RLO A;  4OO1 I;  3KF6 A;  1CUK A;  1VS0 A;  2JA8 G;  4OXP A;  1HJP A;  5M3M G;  4DV2 L;  4B3S L;  4B3T Q;  4HIO A;  1CSP A;  4HJA A;  1Y1W G;  1Z47 A;  1AE2 A;  4DPG A;  2VUM H;  2GN5 A;  4GS3 A;  4RMF A;  2Z0S A;  4GKK Q;  2JEA I;  4BBS G;  1D7Q A;  3AEV A;  1C9O A;  4DR4 L;  3TS2 A;  1HZA A;  4JI0 L;  1CKM A;  2DUD A;  4O2D A;  4ALP A;  3M4O H;  3G6E A;  1E1O A;  1IYJ B;  3E0E A;  3Q8D A;  2XGT A;  1U5K A;  4DUZ Q;  4HJ7 A;  2PI2 A;  1JT8 A;  3ULL A;  2VNU D;  3KJP A;  3S2H H;  2LXJ A;  2K14 A;  2UXB L;  1OXU A;  4DAY B;  1QVC A;  4UP8 A;  1W2B A;  1PH2 A;  5M5X H;  4NXN Q;  5IY0 A;  2XTI A;  4DR3 L;  5M5W H;  1UE6 A;  2UXC Q;  1X3E A;  4JI4 Q;  3K0X A;  1A0I A;  3HOU H;  3I4M G;  2A1A A;  3S1N H;  5GAE C;  2K52 A;  5EAY A;  5C0X G;  1BBW A;  2JA5 G;  1C7Y A;  3W1G A;  3TEH B;  1XNR Q;  3HOZ G;  3U50 C;  2JJQ A;  5JJI A;  4X62 L;  3FHW A;  2ZJR A;  2HT1 A;  4K0K Q;  3L7Z C;  4EX5 A;  4LUZ A;  5IP9 H;  2PMZ E;  2UUC L;  5H1S E;  3G4S A;  4HJ8 A;  1SMX A;  4QY7 A;  1FL0 A;  2QGQ A;  4PG3 A;  3I4O A;  2UUB Q;  4BY7 G;  1WCM G;  4JI7 Q;  2Q2I A;  3T1Y L;  1HNW L;  3PO2 H;  4DNI A;  1JB7 A;  2Q2H A;  1N36 Q;  3A5Z B;  5IT9 c;  3NBH B;  3CXC A;  4DR2 Q;  4LF7 Q;  5C4X G;  1PH5 A;  4DR6 Q;  3TRE A;  3UE0 A;  1Q86 C;  1X6O A;  3UDF A;  3UDG A;  2PQA B;  4IFD J;  4LF9 Q;  3W1B A;  1B7Y B;  1LUZ A;  1EOV A;  5JEA J;  1FJG L;  3RZO H;  4A3C H;  5FLM G;  2B63 H;  2F4V Q;  3S1Q H;  5FLX c;  4DUZ L;  3I4N G;  2K4K A;  3PO3 G;  3NEM A;  4A3E G;  3K7U C;  4Y52 H;  2HHH L;  1JJC B;  4R4Q A;  1VQM A;  3CAM A;  4GOP B;  2ZTC A;  3CF5 A;  3T1H Q;  4A3M H;  4POG A;  1YJ9 A;  1XNQ L;  1I5F A;  4GOP A;  3ER0 A;  3D0F A;  2D0O A;  3A0J A;  2WAQ G;  4LFA L;  3PUZ A;  5IWA Q;  2E5L Q;  4JV5 L;  4Y7N H;  3JC6 6;  1TWA H;  5IYB G;  4YCU A;  3KFU A;  2KHI A;  5C0X I;  3HKS A;  4A3J H;  4BY1 H;  2CFM A;  4JI5 L;  1FVI A;  2F3I A;  3HOV G;  1XMQ Q;  1G29 1;  3PUX A;  5C3E H;  2VQE L;  4YCW A;  3H0G G;  2HIV A;  4YY3 L;  2NVX H;  4L5S A;  3CCQ A;  4LFC Q;  1GO3 E;  2K5H A;  4JI1 Q;  3KLW A;  1PFS A;  4P71 A;  1XMO Q;  4AH6 A;  1M1K C;  1I94 L;  2UU9 L;  5M3M H;  1HH2 P;  1E1T A;  4LF7 L;  1E3P A;  5GRO A;  3GTJ H;  4QQB X;  1OXV A;  4DR6 L;  4EQ5 A;  4BBS H;  1VQ4 A;  4YWL A;  3HKZ E;  3MXN B;  2WFW A;  2B29 A;  1K83 H;  1D8L A;  1UE1 A;  2ZTE A;  1G6P A;  2JA6 G;  4A3G G;  1Q1E A;  2ASB A;  3PUW A;  4DKA C;  1KC8 C;  3D31 A;  5E7N A;  4NXM Q;  1JMC A;  1ASZ A;  4L5R C;  4L5Q A;  1YVC A;  4JI3 Q;  1DGS A;  1AE3 A;  1IXR A;  1IL2 A;  2ATW A;  5K36 G;  1K8G A;  1XTD A;  1PV4 A;  4R4C A;  2Q2U A;  3E9H A;  3ZJY C;  1J5E L;  4B3M Q;  5IYD H;  4A3D H;  3J80 c;  1MJC A;  1VQE A;  4P75 A;  4JBJ A;  4OX9 L;  4UY8 C;  3CD6 A;  4JYA L;  1TWG H;  1PA6 A;  1HR0 W;  4WJ3 M;  1HZ9 A;  1BVS A;  1EUJ A;  2E2J H;  4LF5 L;  3A5U A;  3H3V I;  1EIY B;  4A3K H;  4XTC S;  3CC2 A;  4BXX G;  2VY3 A;  1XPO A;  2NN6 G;  4GNX B;  4JBM A;  1X3F A;  4JI6 Q;  2JK8 A;  3WWV A;  5DLQ E;  4UP9 A;  2CWA A;  3F8T A;  4DV4 Q;  3K7A H;  4GNX A;  3PUY A;  4A93 H;  3PV0 A;  1XMQ L;  1VQL A;  2A19 A;  3STB D;  3ICE A;  1IBM Q;  3S16 H;  4IPG A;  4L5T A;  4BY7 H;  1WCM H;  1UEB A;  3HOY G;  4DV0 Q;  1JJ2 A;  4DR1 Q;  4P72 A;  3J80 i;  4A3I H;  1QZG A;  1KHI A;  1L0W A;  1NY4 A;  5HY6 A;  4LUO A;  3RZD H;  1KD1 C;  2I5H A;  1I6H H;  2IX0 A;  2YV5 A;  1E22 A;  4X66 Q;  4DV1 L;  2UUA L;  4B3R Q;  1G51 A;  3F2C A;  5LMN L;  5IYC H;  1CKO A;  3AFQ A;  3CC4 A;  4LFB Q;  1PVO A;  2BA0 A;  4X65 L;  5BR8 L;  3J7Z C;  5FLM H;  1OXS C;  1EFW A;  1B70 B;  4IOA A;  2LXK A;  5LMU Q;  1CSQ A;  3OW2 A;  1VQO A;  1VQ9 A;  3PO3 H;  1B8A A;  4BA1 I;  2R7Z H;  1L1O C;  4GKJ L;  4A3E H;  3OTO L;  4B3M L;  3S17 H;  1KL9 A;  3GO5 A;  3I56 A;  1S3O A;  4BA2 I;  3FKI H;  2KEN A;  3KOJ A;  4DV7 Q;  1Q7Y C;  1IBK Q;  4HID A;  4QGU A;  1EQR A;  1K9M C;  2E2H H;  4X64 Q;  2QA4 A;  4IPC A;  1VQA A;  2ZTD A;  2VUM G;  3GTP H;  1EIF A;  3E9I A;  4JOI A;  5IP7 G;  5AJ3 Q;  4LF4 Q;  1TWF H;  4KHZ A;  3M7N A;  1SFO H;  4JI6 L;  1W3S A;  4A3F G;  2R92 G;  1P8L A;  5GAD C;  1SR3 A;  2UXD L;  2ZJP A;  2NN6 I;  4X6A H;  4DV4 L;  4H02 A;  1LYL A;  4DV6 Q;  1QVF A;  3S24 A;  3F2B A;  4ME3 A;  3KDF B;  4HJ9 A;  3CME A;  2YYZ A;  2Y0S G;  4IJL A;  1MJE A;  2CCZ A;  1TXY A;  1HNZ Q;  3K81 C;  3GTG H;  1PYB A;  4B3T L;  4TQU S;  3S1R H;  1N32 Q;  4GKK L;  4A3L G;  3CCJ A;  3PCO B;  5M3F G;  1P16 A;  2HIX A;  1WJJ A;  4MNO A;  2CQO A;  2PQA A;  1Q81 C;  1PH7 A;  1J6Q A;  4A3G H;  4A3B G;  1NBW A;  4P73 A;  5M5Y H;  4TVA B;  3PIP A;  1V1Q A;  1N34 Q;  3CW2 C;  2N78 A;  1JJG A;  3CC7 A;  3BZK A;  5C44 H;  2GVA A;  1WYD A;  1NJI C;  1Q8K A;  4PZ7 A;  1Q82 C;  1HR0 Q;  4NXN L;  3MEF A;  4GN5 A;  2Z6K A;  4NB3 A;  2UXC L;  1WFQ A;  1KRT A;  4JI2 Q;  1GD7 A;  1KAW A;  5IE8 A;  1MIU A;  2KHJ A;  1VQP A;  4JI4 L;  1RL2 A;  1IBL Q;  3GTL H;  1R9T H;  2MO1 A;  2C35 B;  3HOX H;  5FJ8 G;  3LGJ A;  1X54 A;  2VQF Q;  1VQN A;  1QZH A;  1XNR L;  1E7Z A;  4BBR H;  1X65 A;  4AQY Q;  1YIT A;  2JA7 H;  4BXX H;  4LF8 Q;  4K0K L;  1SN8 A;  3CP0 A;  3GTK H;  1HNX Q;  4GN3 B;  4GN4 B;  3UDX A;  2ZM6 Q;  4KHP L;  1IZ6 A;  3CCM A;  3BU2 A;  4QJF A;  4JI8 Q;  3RLN A;  5GAH C;  3J7A 5;  1GVP A;  2R93 H;  2VS1 A;  2UUB L;  2MQH A;  3B6Y A;  1Q1B A;  4JI7 L;  3PF4 A;  1UE7 A;  2JA8 H;  1N36 L;  3HOU G;  3HOY H;  2DGY A;  4DR2 L;  2K50 A;  1YI2 A;  3W5O A;  4R4O A;  3BJU A;  1Y1W H;  1A8V A;  2YTX A;  1UE5 A;  1PHJ A;  4GOP C;  1VQ7 A;  1VQF A;  3S15 H;  1N8R C;  4PZ6 A;  2RCN A;  4LF9 L;  1Y14 B;  3RN5 A;  1PYS B;  4C2M H;  3CCV A;  3K80 C;  1FGU A;  1V43 A;  4DV5 Q;  1K73 C;  4GLV B;  2NVQ H;  2F4V L;  1S72 A;  2GVB A;  4A4I A;  1AH9 A;  2E2I H;  2OCE A;  1N34 L;  3K8A A;  4DV2 Q;  2MNA A;  4B3S Q;  5C0X J;  3F1Z A;  4OWX B;  2F52 A;  1T9H A;  1VQ6 A;  1I50 H;  2MO0 A;  2PNH A;  4A75 A;  4JCV E;  3L0O A;  4RG1 A;  3T1H L;  4DR4 Q;  1YHA A;  3GTM H;  4DK3 C;  4JI0 Q;  1X56 A;  4HIK A;  2ES2 A;  3I4M H;  2JA5 H;  2WAQ E;  1VQ8 A;  2IT1 A;  4DR7 L;  5IWA L;  2KBN A;  2E5L L;  3HOZ H;  3VDY A;  3S2D H;  1L2F A;  3PSI A;  1I3Q H;  2KCT A;  4A3F H;  1EQQ A;  2L15 A;  4DR5 Q;  2UXB Q;  3U4Z A;  3A74 A;  3CCU A;  2RHS B;  2I5L X;  2OTJ A;  4WJ4 A;  2N8N A;  3SGI A;  4DR3 Q;  4LFC L;  1N33 Q;  4JI1 L;  3CCL A;  4NPS A;  2R7D A;  2IHF A;  1XMO L;  1RIP A;  1XPU A;  4IPH A;  5C4X H;  1V9P A;  3U58 A;  1NMF A;  1MKH A;  4KLK A;  2D0P A;  3EN2 A;  3TQY A;  4X62 Q;  4LW1 A;  4A3J G;  4LWC A;  1NE3 A;  4POF A;  3M3Y H;  1VCI A;  2OQK A;  3AQQ A;  2ZJQ A;  1L1O B;  2WB1 G;  4NXM L;  4GNX C;  4R4T A;  4R1J A;  3T1Y Q;  3I4N H;  1HNW Q;  2YTV A;  4JI3 L;  3RLF A;  3GDE A;  1SLJ A;  3I2Z A;  3HOV H;  3S1M H;  3HOW G;  3G48 A;  3U4V A;  2R7F A;  3DLL A;  2WP8 J;  1Q12 A;  1Q46 A;  4O0A A;  1VQB A;  2YTY A;  3AYH B;  4YCV A;  4AYB G;  3EIV A;  4FDB A;  3CMA A;  2Q2T A;  1KQS A;  2IX1 A;  3H3V H;  4UPA A;  1A62 A;  1SRO A;  4UP7 A;  5JJK A;  1O7I A;  3NEL A;  5GQO A;  1N9W A;  2KCM A;  1ASY A;  2H5X A;  1VQH A;  2OQ0 A;  4PMW A;  4IOC A;  1FJG Q;  5FJ8 H;  2K75 A;  5C4J H;  5IYB H;  5LMN W;  2RF4 A;  3J81 c;  2VW9 A;  3ULP A;  1YEZ A;  4R4I A;  1H95 A;  1QUQ B;  2R6G A; 
#chains in the Genus database with same CATH topology
 2IW3 A;  1KTK A;  3IL8 A;  3RN2 A;  1IBM L;  3H09 A;  4N9T A;  1XNQ Q;  4DR1 L;  4J1M A;  4LFA Q;  1Y1V G;  3ULJ A;  1D1K A;  4A3K G;  3RZO B;  3URY A;  1QNK A;  4APV A;  1JE5 A;  1UWV A;  4X66 L;  1R4Q B;  4JI5 Q;  2WII B;  3M4Q A;  1BBU A;  2JA6 H;  2VQE Q;  1PXU A;  4LFB L;  1A2T A;  2EVB A;  1KIX A;  3V05 A;  4DF7 A;  1S40 A;  1K8A C;  2I5M X;  1TWC B;  5LMU L;  1C8C A;  1YHB A;  2AQ1 B;  4AYB E;  5I6W A;  4DV7 L;  1PH3 A;  3DXJ C;  3BG3 A;  1SYD A;  5IYC G;  4JC0 A;  1X9N A;  2AMC B;  3KF8 B;  2HQL A;  4LF4 L;  2WB1 B;  3KF8 A;  5HGQ A;  1RKN A;  2NZO A;  1FNW A;  4F88 A;  1TVX A;  2JSO A;  4OWW B;  4RKL A;  3CPF A;  1A6X A;  4JYA Q;  3SK4 A;  4DK6 C;  2B2U C;  2I0Q A;  1HA6 A;  1HNZ L;  4C3I H;  2F0I A;  1MHW C;  1N32 L;  2VUM B;  1H9R A;  4O1N A;  1U0L A;  1PTO C;  4KHP Q;  2K5D A;  4KY5 A;  1L0Y B;  1KRS A;  4LNQ A;  2MFI A;  2K1B A;  4QL5 A;  2VB2 X;  4A3D B;  3G71 A;  5JOB A;  3PO2 G;  5EGT A;  3TS0 A;  1OTC A;  3DM3 A;  3VYU A;  4MN3 A;  1LM0 A;  4YIJ A;  3HOW H;  2B2T A;  2EJG C;  4PMB A;  4GLA C;  1B1Z A;  3GTQ H;  2EXD A;  1OXT A;  4OON A;  1ZKO A;  3GTO H;  2G5D A;  3Q23 A;  4QB4 A;  1PH9 A;  4A3B B;  2VQF L;  1SSO A;  2NWG A;  4X65 Q;  4OGQ C;  3EBE A;  5BR8 Q;  2E8G A;  5IP7 H;  4IFD G;  1VQD A;  2R92 H;  5ELO A;  2D62 A;  2QEX A;  1H9S B;  3BS1 A;  5KND A;  3OTO Q;  4A3I B;  1H9S A;  3BYY B;  4P74 A;  4K8I A;  2JEB I;  3K6O A;  2JA9 A;  2X6G A;  5M3F H;  1TS4 A;  4BBR G;  1VMC A;  2UUC Q;  3NTI A;  3OMG A;  1YZ6 A;  3JAM i;  1RTO A;  2JE6 I;  1KLG D;  5KIX A;  3BDC A;  2R7Z B;  4JVZ A;  4DV5 L;  1JWM D;  4MZ9 A;  2A8V A;  4WJW A;  3S17 B;  1SE8 A;  1VQJ A;  4OO1 I;  4C1N I;  4OXP A;  1HJP A;  2B2W C;  4DK0 A;  3AMU A;  1EL0 A;  1UNS A;  1AE2 A;  2OEO A;  3R93 A;  4GS3 A;  1EQT A;  2NBF A;  4BBS G;  2F0Q A;  1ILP A;  1STG A;  2EY6 A;  2DUD A;  3M4O H;  1IYJ B;  4TKO B;  2A5H A;  3S2H H;  2GA4 B;  1RDP D;  2VXW A;  3ERQ A;  2XTI A;  4DR3 L;  1UE6 A;  1SNO A;  4KD3 A;  4FF3 A;  5GAE C;  2K52 A;  1BBW A;  3TEH B;  1CHP D;  3U50 C;  2A6H C;  2M2L A;  2EYO A;  3L7Z C;  2CW0 C;  4LUZ A;  2UUC L;  3C46 A;  1SMX A;  2QGQ A;  2TSS A;  4PG3 A;  1NR2 A;  4X3K A;  4A3M B;  1SYF A;  2Q2I A;  3T1Y L;  2Q2H A;  2NYZ D;  4JPB W;  3NBH B;  3DMU A;  2R3Z A;  2MPM A;  4Y7N B;  3AU7 A;  4DR6 Q;  2XRS D;  3NBH A;  4KKS A;  1Q86 C;  1X6O A;  4BY1 B;  3UDG A;  2PQA B;  4IFD J;  1SJE D;  4LF9 Q;  4K6L A;  4ZYS A;  3P7J A;  4HN7 A;  2R93 B;  5FLM G;  5FLX c;  3D4R A;  2EJF C;  4KTA A;  1JE4 A;  1SNQ A;  2JA8 B;  5M3M B;  2HHH L;  3UI2 A;  4GOP B;  4TRD A;  1YJ9 A;  4GOP A;  3OWE B;  3TP8 A;  2D0O A;  3A0J A;  4BS9 A;  2WAQ G;  1Y8N B;  1TY2 A;  4JV5 L;  1CTM A;  1B53 A;  4O42 A;  3D3R A;  2O5J C;  3MVV A;  3J80 L;  1BOS A;  1DD2 A;  2Z1C A;  4YY3 L;  2NVX H;  2K05 A;  4LFC Q;  1U9R A;  1MSH A;  2KEC A;  1LTR D;  2UU9 L;  1J9O A;  4DR6 L;  4YWL A;  4KMU C;  3OOC A;  4P2C B;  1Q1E A;  3V96 A;  1FR3 A;  2ASB A;  3PUW A;  3TN2 A;  4IUP A;  1LAC A;  3QR8 A;  4BY7 B;  1JMC A;  1I4R A;  1YVC A;  5C3X A;  2H4O A;  2ICE C;  5K36 G;  4CJ1 B;  1K8G A;  4R4C A;  5D3I B;  2B2V A;  1VQE A;  1YNN D;  2MJ8 A;  4P75 A;  2DY8 A;  3KLS X;  1TWG H;  1PA6 A;  3HKZ B;  1BCP F;  2K6A A;  1LTA D;  4LF5 L;  4DN4 M;  1UAP A;  1Y69 U;  4A3K H;  2OT2 A;  2VY3 A;  4JBM A;  1X3F A;  2JK8 A;  5DLQ E;  3VR3 A;  1EIG A;  2RDF A;  4IPG A;  1PYW D;  3E6Z X;  1WCM H;  1UEB A;  3G7L A;  5CV7 A;  1Z7T A;  5E1F A;  3SK6 A;  3RZD H;  2UUA L;  4DV1 L;  3W3A A;  4K5X A;  3F2C A;  5IYC H;  1HQM C;  1Q8I A;  2ENB A;  1EFW A;  2K5W A;  2F0N A;  3OW2 A;  1CSQ A;  2ZXR A;  1VQ9 A;  3T13 A;  3PO3 H;  4ILW A;  4A3E H;  4DFA A;  1Q7Y C;  3K0Y A;  3ONA B;  1WTX A;  2VUM G;  2F0V A;  4HCS A;  3EQL C;  3HG9 A;  2HDL A;  5C44 B;  1P8L A;  2EYM A;  2ZJP A;  2NN6 I;  4RCN A;  2WAC A;  5ELB A;  3F2B A;  2G9D A;  4HJ9 A;  1SNC A;  3K81 C;  2O4X A;  5C5M A;  2L1B A;  5FO8 B;  1W6J A;  4A3L G;  2C9O A;  1LV9 A;  3NTK A;  4CJ2 C;  2O5I C;  4K5W A;  4L6T B;  1EY8 A;  2CQO A;  1Q81 C;  1K0S A;  1J6Q A;  4A3G H;  4A3B G;  2N88 A;  1JCK B;  4KKT A;  3KLS A;  2FMC A;  3HOY B;  1JJG A;  3GQB A;  3NK9 A;  3FMC A;  2GVA A;  1VMP A;  4NXN L;  4DGZ A;  4JI4 L;  4DR7 Q;  1EYA A;  1STA A;  2XNA C;  1R9T H;  1QCB D;  3Q0A A;  1X54 A;  2KEE A;  4BBR H;  1X65 A;  1YIT A;  4BXX H;  5A35 A;  1SN8 A;  1HNX Q;  4GN3 B;  2D5D A;  2L11 A;  1IZ6 A;  3CCM A;  3M7G A;  2UUB L;  3B6Y A;  2I07 B;  3BDO A;  1ICF B;  3PF4 A;  1FNV A;  1LTT D;  4XYQ A;  1H9K A;  3W5O A;  3BJU A;  4QCL A;  1A8V A;  2QIL A;  4ID6 A;  3HOZ B;  2K04 A;  4KJO A;  1I3Q B;  1VQF A;  1F2L A;  2JN4 A;  1F77 A;  1N8R C;  5EPL A;  4C2M H;  1MGS A;  1V43 A;  3DWA A;  2X69 A;  4C3H B;  4A4I A;  2OCE A;  3DM1 A;  3K8A A;  4B3S Q;  3T4A C;  2B2Y C;  3F1Z A;  4OWX B;  2F3V A;  2RDH A;  2F52 A;  2LS0 1;  3CRL C;  4JCV E;  3BDL A;  4F7X A;  3BYT B;  3GTM H;  4DK3 C;  1HUN A;  1X56 A;  1FYC A;  2FFK B;  1VQ8 A;  2XIW A;  4DR7 L;  5EKI A;  4Q0F A;  2E5L L;  2E74 C;  3S2D H;  5I9O A;  1L2F A;  3PSI A;  5CV4 A;  1JOK A;  2KCT A;  1GUW A;  2I46 A;  4WJ4 A;  3IKJ A;  2N8N A;  3SGI A;  1N33 Q;  5FK9 C;  4NPS A;  2R7D A;  1GUN A;  1XPU A;  3I70 A;  1JOR A;  4HMJ A;  1LTG D;  2Z6B A;  3TQY A;  1SYE A;  4G4K A;  4POF A;  5IGF A;  2ZJQ A;  1L1O B;  2SOB A;  4ABN A;  4R4T A;  1PZJ D;  4R1J A;  2YTV A;  2BDO A;  3HOW G;  1AN8 A;  2K03 A;  2WP8 J;  1Q12 A;  1Q46 A;  4O0A A;  1VQB A;  2YTY A;  1BR9 A;  3NBI A;  2SDF A;  3LWU A;  1O7I A;  1N9W A;  2EYH A;  2H5X A;  4PMW A;  5FJ8 H;  2K75 A;  5C4J H;  4ULL A;  3ERO A;  3J81 c;  1CT1 D;  1H95 A;  2HDM A;  5EKL A;  3STB C;  4JG2 A;  1BXT A;  1NNX A;  5C3W A;  2YU9 B;  1N33 L;  5KRU A;  3KDF A;  1EY0 A;  1K3R A;  3DEO A;  3DUZ A;  4OIK A;  1QJO A;  2N49 A;  2RQX A;  3D4D A;  4C3J H;  3M9B A;  4HIM A;  5IOC A;  4HTH A;  3TRZ A;  4EVO A;  3HRZ C;  4FXD A;  3D6W A;  1SND A;  4CDC C;  2RBM A;  5EQ0 A;  5FO7 B;  1YJW A;  5K36 H;  1DJR D;  3VYS A;  4CBV A;  1SRU A;  1I94 Q;  3KJO A;  2RVL A;  3P1H A;  1PH4 A;  1DON A;  2KCC A;  1IBK L;  4JK1 C;  2QKI C;  2SNM A;  3HKZ G;  3PGZ A;  1WOC A;  1YNX A;  3SE0 A;  1LTL A;  2BH2 A;  1EZ8 A;  2SNS A;  5GAG C;  1A3T A;  2PW7 A;  3K57 A;  1AW7 A;  5DAU A;  5AJ3 L;  5A2Q L;  2JXM B;  4RGM A;  3F2D A;  1XWE A;  2RHQ B;  4E6I A;  1J5E Q;  1Z6H A;  2NTT A;  4DV6 L;  3GTJ B;  4AYB B;  4OX9 Q;  1DOL A;  4J15 A;  2HCI A;  5D65 A;  1TWC H;  1WD0 A;  2EQS A;  4DUY Q;  3HFZ B;  3OYY A;  4V0B A;  2Z6K C;  1A2U A;  2V1C C;  5J3B A;  2Z9H A;  3NP8 A;  4OL7 A;  1TWH B;  1HUM A;  4UHV A;  5HGT A;  4DV3 Q;  2AHO B;  4YHH Q;  1E24 A;  4OO1 G;  4K2K A;  1HXY D;  4G7Z C;  2F1M A;  3UE1 A;  1VQK A;  3PUV A;  3C3L A;  2E2J B;  4G7H C;  4DXF A;  2C5C A;  1M90 C;  1VQC A;  1PRT D;  3MXU A;  4DXG A;  1SBB B;  1IBL L;  1BUV T;  3K7A B;  1D6E C;  4A93 B;  3UDI A;  2E75 C;  2VUM H;  1ZYR C;  1IW7 D;  4AQY L;  4LF8 L;  5C44 G;  4EGV A;  5JEA G;  2ZM6 L;  3KLR A;  2LSS A;  4GKJ Q;  5ELN A;  3L3O C;  1B3Q A;  2L4N A;  1LTB D;  1PRT B;  4EQN A;  1EFI D;  2BCO A;  4NW2 A;  3HOX G;  4DUY L;  2B3G A;  4A3L H;  1I4X A;  3K5M A;  1WI5 A;  3IRB A;  3D8G A;  3NPP A;  3K58 A;  2K28 A;  2UXD Q;  4DV3 L;  4YHH L;  3OIP A;  5M5X B;  4A3B H;  2M9V A;  1EY4 A;  3KF6 B;  1SEB D;  1EYG A;  3FKI B;  3KF6 A;  3J80 E;  1VS0 A;  2DNC A;  3S1N B;  1BO0 A;  4OEM B;  4B3T Q;  2E2H B;  1ZXT A;  4RMF A;  2Z0S A;  4GKK Q;  1F2M A;  3GTP B;  1D7Q A;  3AEV A;  4DR4 L;  4CDD C;  1BCP C;  1TWF B;  1HZA A;  4JI0 L;  1CKM A;  1ZEQ X;  4ALP A;  1E1O A;  1RTN A;  2B39 A;  2XGT A;  2BE5 D;  1U5K A;  3KUP A;  3A55 A;  3OHX C;  2KCN A;  5NUC A;  1SXT A;  2K14 A;  3H91 A;  2UXB L;  1W2B A;  3S1R B;  2EOT A;  4KY6 A;  1OO9 B;  2UXC Q;  1I4G A;  3K0X A;  5C4H A;  5FLX L;  2A69 D;  3HOZ G;  2B63 B;  4X62 L;  4KKU A;  2ZJR A;  4K0K Q;  5IP9 H;  2PMZ E;  3G4S A;  2XSC A;  1IYU A;  1EY5 A;  3VR2 A;  1CZW A;  1WCM G;  1XYI A;  4KV6 A;  5EJW A;  3N6R A;  4FP5 D;  3GTL B;  4DR2 Q;  5C4X G;  1PH5 A;  2MUY A;  3TRE A;  1TWA B;  1STE A;  4A3J B;  2JA7 B;  5C3E B;  1FJG L;  5JEA J;  3J81 E;  2F4V Q;  2WV6 D;  3PO3 G;  4A3E G;  2KVM A;  1HTP A;  4QUF A;  4Y52 H;  1JJC B;  1YNJ D;  4R4Q A;  4RGO S;  4A3M H;  3T1H Q;  4POG A;  1B50 A;  1XNQ L;  1PTO B;  4QMG A;  4LFA L;  1X3P A;  4Y7N H;  3Q22 A;  3JC6 6;  2MHV A;  2DN8 A;  5C0X I;  2IJ0 A;  2K5Q A;  4BY1 H;  4JI5 L;  3HOV G;  1XMQ Q;  1PFB A;  4XT3 B;  2VQE L;  3H0G G;  2HIV A;  4L5S A;  1GO3 E;  4XQJ A;  4JI1 Q;  3KLW A;  2XWJ B;  5ELC A;  4P71 A;  1XMO Q;  5M3M H;  3MC0 B;  4QQB X;  1OXV A;  1K8M A;  4EQ5 A;  1F9S A;  1VQ4 A;  1X32 A;  2A6E D;  2WFW A;  2B29 A;  1D8L A;  1UE1 A;  5D14 A;  2F0S A;  4A3G G;  1KC8 C;  4DAV A;  1ASZ A;  4L5Q A;  1WTV A;  4JI3 Q;  5G3L D;  3MTS A;  1AE3 A;  3MXG A;  4DU9 A;  1I6H B;  3SVM A;  2PW5 A;  4JYA L;  1V1P B;  2B2T C;  1MSG A;  3M3Y B;  1V1P A;  1BVS A;  2F0U A;  3H3V I;  3A5U A;  1EIY B;  1GXD C;  4BXX G;  2NN6 G;  4RH6 A;  1JWU D;  3QOJ A;  3RMH A;  4DK1 A;  4GNX B;  2FMM A;  1QIL A;  3I4N B;  3HP3 A;  4J6H A;  4GNX A;  4KHP L;  1C4Q A;  3MWY W;  3PV0 A;  1XMQ L;  2NB0 A;  2D2C C;  4J8Q A;  4BY7 H;  4DV0 Q;  2KJX A;  1CQV A;  3J80 i;  3VA5 A;  5FOB B;  4X3T A;  2EE1 A;  1L0W A;  3MA2 B;  1EEI D;  3T51 B;  1SFO B;  1E22 A;  2AQ2 B;  1WTW A;  4B3R Q;  1G51 A;  1GHJ A;  2A6E C;  1NAP A;  4XT1 B;  1CKO A;  3AFQ A;  3CC4 A;  4FYD A;  4RGN A;  1PVO A;  4IUN A;  4X65 L;  5BR8 L;  2HCC A;  3A8K E;  2LXK A;  1F2Y A;  1D2B A;  3OTO L;  2LMC B;  1KL9 A;  5CMD A;  3I56 A;  1S3O A;  3KOJ A;  1O7Y A;  3A54 A;  1K9M C;  4X64 Q;  1ENF A;  4ZKC B;  1VQA A;  2ZTD A;  2KHS A;  1EIF A;  4JOI A;  1G6Z A;  2DNE A;  5HUR A;  1EEF D;  4U67 3;  5GAD C;  1SR3 A;  4OO1 H;  1RF2 D;  4H02 A;  3S24 A;  3FEW X;  1CZG A;  4IJL A;  1TXY A;  3LWE A;  4TQU S;  4PMC A;  3QOL A;  5TSS A;  2HIX A;  3I73 A;  2PQA A;  4WOR A;  1F2Z A;  4ZAI A;  4IAL A;  1I4H A;  1LO5 D;  1NBW A;  1QNU A;  4MHE A;  2WKC A;  5M5Y H;  1JQY D;  2Z4H A;  3W2D A;  1TQO A;  5C44 H;  5JEA H;  1Y1W B;  1NJI C;  1Q8K A;  1HA5 A;  1HR0 Q;  4NB3 A;  1VQP A;  1KRT A;  4JI2 Q;  1RL2 A;  4RA8 A;  5BN3 A;  1S5F D;  3HOX H;  4PNY A;  3FVQ A;  5FJ8 G;  3LGJ A;  5KYL A;  2NVQ B;  1CQF A;  1RD9 D;  3T56 B;  4NP5 A;  3GTK H;  3UDX A;  5IGG A;  5I9P A;  4JI8 Q;  1GVP A;  1D5Z C;  2MQH A;  3HOY H;  2JA5 B;  3GTO B;  1STN A;  1X3Q A;  4C3J G;  2YTX A;  3CKI B;  1UE5 A;  3LNN A;  4GOP C;  5C6A A;  3S15 H;  2RCN A;  4A3F B;  4LF9 L;  2PCF B;  3CCV A;  3NUC A;  3K80 C;  1FGU A;  3SHL A;  3Q24 A;  5CV9 A;  1SYB A;  3K5N A;  1S72 A;  2GVB A;  1O80 A;  2E2I H;  3OSO A;  5E4X A;  3GV6 A;  4DV2 Q;  2XWB B;  4R8N A;  1T9H A;  5I2X A;  5M3F B;  4RG1 A;  1YHA A;  5JVH 3;  1UEA B;  2IT1 A;  2L5T A;  2OF1 A;  3HOZ H;  1I3Q H;  3OIQ A;  4DR5 Q;  3KBG A;  1QE6 A;  2R61 A;  5BN5 A;  3A74 A;  1SYG A;  2M00 A;  4LFC L;  3G6J B;  5A2Q E;  3MEH A;  2B2V C;  3J81 L;  5C4X H;  1V9P A;  3U58 A;  1MKH A;  2P5Z X;  4CDF C;  4A3J G;  1NE3 A;  4HMI A;  5JVG 3;  1BBX C;  3R2T A;  2WB1 G;  1HNW Q;  4N9P A;  2PZU A;  3I2Z A;  1KAA A;  3U4V A;  2QCP X;  1S5E D;  3DLL A;  1GJX A;  4YCV A;  2Q2T A;  3AYH B;  5IGC A;  3EIV A;  4MIU A;  1YNN C;  2E76 C;  3CMA A;  2RCF A;  4LMQ D;  1Q3L A;  1KQS A;  1SRO A;  4UP7 A;  1SMY D;  2SEB D;  2KCM A;  3Q6S A;  1ASY A;  1VQH A;  1I6V C;  2RF4 A;  2VW9 A;  1YEZ A;  4R4I A;  3HOV H;  1AZP A;  3FDT A;  4DR5 L;  3DHQ A;  3H0G H;  1LT6 D;  4A3D G;  4IFD I;  4FF1 A;  3I3C A;  2EPB A;  1JR0 D;  3VYR A;  1C0A A;  3S14 B;  1AZQ A;  5JJL A;  4V19 0;  1GOZ A;  3AB9 A;  2BH8 A;  1E2Z A;  1TY0 A;  4I65 A;  4C1N K;  1YIJ A;  2ALY B;  2IY5 B;  4DAM A;  1JIC A;  3P75 A;  1HZC A;  4CKB A;  2CWP A;  4S3S A;  3FP9 A;  4A3I G;  1WVL A;  3DWQ A;  3CQZ B;  3I7F A;  3CCE A;  1STH A;  2YU9 H;  1KLU D;  2BOS A;  1A15 A;  2HQE A;  2WKD A;  4QIW E;  2NZH A;  3X3M A;  2NN6 H;  1HZB A;  2Q8R E;  4DAP A;  4HAE A;  2NVY H;  3NHH A;  3VA7 A;  2R7Z G;  1F9R A;  4RGT A;  2AWN A;  5AFW A;  4MTN A;  2J7Z A;  2Y0S E;  2PYK A;  1EU4 A;  1WTP A;  1I4P A;  1ENC A;  1BKB A;  1MI2 A;  1H9J A;  4IJH A;  2F0D A;  1RCV D;  3KYH C;  4ODG A;  2OTL A;  2NVT B;  5IP9 G;  4YWK A;  1QVG A;  1EWC A;  2KQ3 A;  1X3G A;  4KJN A;  5FLX E;  4AIM A;  3C2P A;  1BF4 A;  3N52 A;  3BZC A;  3PIO A;  3M85 A;  2IHE A;  5LL6 X;  1KXL A;  1Y1V B;  5EPK A;  1DCZ A;  1DM0 B;  5KEE A;  1Y8P B;  4A3K B;  4EQO A;  3J81 j;  3MXP A;  1S4Z A;  2CH4 W;  2K5V A;  3PF5 A;  5LMN Q;  3JAM c;  4LUV A;  1NTG A;  4A76 A;  3H15 A;  4OEL B;  1GM5 A;  3R8B A;  2FXQ A;  5CC4 A;  1TWH H;  4PZ8 A;  4KY7 A;  1HNX L;  3RUZ A;  1SNM A;  5G3L F;  1ML0 D;  4HJ5 A;  4A3M G;  5COR A;  2EYL A;  1AFP A;  2Q8I B;  3VR5 A;  3K5L A;  1U4L A;  1CHQ D;  1PMR A;  2Z8L A;  4JW0 A;  5CYU A;  4H44 C;  3EJI A;  1D5X C;  4BY1 G;  2F0F A;  1EZ6 A;  1Q90 A;  4GZY C;  4CJ0 B;  4OWT B;  4XXE A;  2R93 G;  2PI2 E;  1EWH A;  1IYV A;  5COY A;  1L1O A;  4XQN A;  1T5E A;  3RLO A;  1D5M C;  3HOU B;  5KGU A;  2JA8 G;  4B3S L;  5BN4 A;  5M3M G;  1SJH D;  4HIO A;  1CSP A;  1Y1W G;  2GN5 A;  3GP7 A;  1C9O A;  1B4O A;  1KAB A;  1HFN A;  3TS2 A;  3I4L A;  3G6E A;  3E0E A;  1NR4 A;  4HJ7 A;  4CKC A;  1JT8 A;  2VNU D;  3LX0 A;  3PO2 B;  3KJP A;  2FHT A;  2LXJ A;  3EA6 A;  4K6D A;  1EY6 A;  3NXW A;  1CI3 M;  1QVC A;  4UP8 A;  1PH2 A;  5M5X H;  5IY0 A;  5M5W H;  1X3E A;  4NMZ A;  5J39 A;  4ME5 A;  2A1A A;  3S1N H;  4PV1 C;  2JA5 G;  5C0X G;  1XXG A;  1C7Y A;  3W1G A;  1XNR Q;  3S1Q B;  2JJQ A;  3FHW A;  4IUT A;  4HJ8 A;  1BQQ T;  4BY7 G;  4JI7 Q;  2ZXO A;  1N36 Q;  3A5Z B;  3WOE A;  5IT9 c;  1R9T B;  2QDB A;  1B9M A;  3UDF A;  1CM9 A;  3I91 A;  4BBR B;  1DYQ A;  2CHB D;  2PMZ B;  5DNF A;  4N8X 1;  1LUZ A;  4HSP A;  3RZO H;  4A3C H;  3ZYY X;  2B63 H;  1ILQ A;  2K4K A;  1GUG A;  3A8I E;  1NSN S;  5F2D A;  2O2L D;  2ZTC A;  3CF5 A;  4BBS B;  1HHV A;  3EVQ A;  1I5F A;  3D0F A;  1K83 B;  2F0M A;  5IWA Q;  2K32 A;  2EDG A;  2E2D C;  4TSS A;  3TBI B;  4I7A A;  4XDX A;  1TWA H;  2KHI A;  3HKS A;  4A3J H;  2CFM A;  5L37 A;  1EQV A;  1FVI A;  2F3I A;  4N8F A;  3PUX A;  5C3E H;  4HSV A;  4YCW A;  4F8M A;  3CCQ A;  3H6M A;  2XN9 C;  1EIH A;  2RKS A;  1PFS A;  1M1K C;  1I94 L;  1FNU A;  1HH2 P;  2WIN B;  4C56 C;  3J7A F;  1DOM A;  4FO2 A;  3M4Y A;  2K01 A;  4DKA C;  3S16 B;  1QOH A;  1IKM A;  5E7N A;  4NXM Q;  3I90 A;  2X6L A;  1DGS A;  1LT5 D;  2A68 D;  1PV4 A;  1U4R A;  4B3M Q;  3E9H A;  3ZJY C;  1J5E L;  1G91 A;  4A3D H;  4OX9 L;  5CV6 A;  4IUV A;  2BDN A;  1DXM A;  3A56 A;  3WWV A;  2CWA A;  5ISR A;  4DV4 Q;  2IPK D;  4IQZ A;  4G57 A;  5IOD A;  3WDN A;  1LT3 D;  1IBM Q;  3ICE A;  4L5T A;  4I7Z C;  3HOY G;  1K8O A;  1BCP B;  4DR1 Q;  4P72 A;  4A3I H;  1QZG A;  5JPM C;  1FGB D;  5I2Y A;  1I6H H;  2YV5 A;  4X66 Q;  1QG7 A;  1PRT C;  1GUT A;  1QB5 D;  4CKE A;  4LFB Q;  2BA0 A;  1DZ1 A;  3J7Z C;  1OXS C;  1LT4 D;  1IW7 C;  4HR7 B;  1PDQ A;  3HZX A;  3GTG B;  5LMU Q;  1HCZ A;  1O7L A;  4PQX A;  4BA1 I;  2EZV A;  3K5O A;  2R7Z H;  1O78 A;  4GKJ L;  4B3M L;  2F4I A;  3S17 H;  3GO5 A;  4BA2 I;  2KEN A;  4DV7 Q;  2MP1 A;  4IN3 A;  3T53 B;  3S9W A;  1JOQ A;  1R4P B;  4QGU A;  5DEH A;  2KUM A;  1SAP A;  4IPC A;  1HRJ A;  3E9I A;  4LF4 Q;  1TS5 A;  1SFO H;  1W3S A;  2F0O A;  3RD4 A;  2UXD L;  4X6A H;  4DV4 L;  4C3H G;  5LHY 1;  2NTS A;  3MFY A;  5JJZ A;  1HNZ Q;  3OWF A;  4FF4 A;  1PYB A;  4RKB A;  4B3T L;  4OHJ A;  2D9U A;  1N32 Q;  1TR5 A;  2N55 A;  5CV5 A;  4ZK9 B;  3CCJ A;  4GKK L;  2AUK A;  2IL8 A;  1WJJ A;  1PTO D;  4U68 A;  1CA6 A;  1PH7 A;  3PQI A;  4P73 A;  2BE5 C;  4TVA B;  3KK7 A;  3CW2 C;  3VR4 A;  2N78 A;  3CC7 A;  3BZK A;  2B2U A;  1W6K A;  2Z4I A;  1WYD A;  1Q82 C;  3MEF A;  4RWS C;  2UXC L;  1WFQ A;  5IE8 A;  1MIU A;  4LAA A;  2C35 B;  2A69 C;  5T1G A;  2VQF Q;  1VQN A;  1QZH A;  2F0J A;  1E7Z A;  2ZT9 C;  2EYP A;  4L63 B;  4K0K L;  3CP0 A;  4GN4 B;  3QIA A;  4QJF A;  3J7A 5;  2R93 H;  2VS1 A;  5CBE E;  1I50 B;  5IT9 E;  1Q1B A;  1D1I A;  2EXZ A;  1UE7 A;  2RSN A;  2JA8 H;  2L12 A;  3HOU G;  3I4M B;  1LTI D;  4DR2 L;  2K50 A;  1YI2 A;  1Y1W H;  3DWP A;  4R4O A;  2LFN A;  3J7Y W;  1SDF A;  1H9M A;  4FVM A;  1CK1 A;  1VQ7 A;  2F0E A;  4PZ6 A;  1Y14 B;  4DNR B;  3NQI A;  1AEX A;  4DV5 Q;  2NVQ H;  2F4V L;  3J7A V;  3TP7 A;  1AH9 A;  1SYC A;  1VF7 A;  2MNA A;  1VQ6 A;  1YNJ C;  2PNH A;  4A75 A;  3C1F A;  3T1H L;  4X3U A;  1FD7 D;  4HIK A;  2ES2 A;  3R2I A;  5E3F A;  2JA5 H;  2WAQ E;  5C0X H;  1O7Z A;  3A7L A;  1A3V A;  1JWS D;  2EYF A;  5E4W C;  1RHP A;  1EQQ A;  4A3F H;  3A7A B;  3S1M B;  3U4Z A;  2B2W A;  3CCU A;  2I5L X;  3CU7 A;  2OTJ A;  3VR6 A;  4DR3 Q;  1GUS A;  2JP1 A;  4JI1 L;  1TU2 B;  1XMO L;  1RIP A;  4HED A;  2HD3 A;  5ELF A;  1NMF A;  1U4P A;  3VYT A;  3NQT A;  2PO4 A;  2A6H D;  4KLK A;  2D0P A;  1S5D D;  4LW1 A;  2CW0 D;  4LWC A;  1V1O A;  1VCI A;  3AQQ A;  3EFX D;  2F0T A;  4GNX C;  3T1Y Q;  4JI3 L;  3TP6 A;  1SLJ A;  1C48 A;  3HGB A;  3G48 A;  2A73 B;  4AYB G;  3IFT A;  2IX1 A;  4FDB A;  3H3V H;  4UDU C;  2JA6 B;  1EY9 A;  1E0B A;  4IOC A;  2OQ0 A;  2EJM A;  3K59 A;  1WTO A;  2QW7 A;  1KNA A;  1QUQ B;  2R6G A;  4UAI A;  2AWO A;  3V2T A;  5IYD G;  3CPW A;  2HHH Q;  4JBW A;  1QUQ A;  2VZA A;  1NCV A;  4IO9 A;  2CVR A;  3CCR A;  4DV0 L;  3TSS A;  4H7B A;  2N3S A;  2ID0 A;  1EWI A;  2DJF C;  1EU3 A;  4JV5 Q;  4IPD A;  4F87 A;  3SXH A;  3I8Z A;  1PH6 A;  5KNC A;  3ND9 A;  1VQI A;  4B3R L;  5C5L A;  1X55 A;  2XVS A;  4A93 G;  1EYC A;  4JOI C;  1EYD A;  4YY3 Q;  3J81 i;  2WB1 E;  5LL6 S;  3WOF A;  1SNP A;  1ICW A;  1KDB A;  1ET6 A;  2B8F A;  3ITP A;  4OIJ A;  4C3I B;  2UU9 Q;  3SK5 A;  4NDX A;  3IAY A;  3E5S A;  1IHZ A;  3TDQ A;  3U9S A;  2RA4 A;  1RJT A;  3NEN A;  1B44 D;  1YJN A;  2B8G A;  2NZ1 D;  4Q5V A;  3HEJ A;  5IIF A;  4X64 L;  5DM6 3;  4JBK A;  4XIG S;  4RAU C;  3E3X A;  2EIF A;  3S14 H;  3MFG A;  3A8J E;  1PH1 A;  1ENA A;  4DNT B;  1JB3 A;  1JOO A;  1VQG A;  4YWM A;  3HOW B;  3M4P A;  1PH8 A;  3GTQ B;  3JAM L;  3FKI G;  2AKW B;  1VQ5 A;  4LF6 Q;  1ESR A;  1K0R A;  1TKW B;  1ESF A;  3HS0 C;  4LF5 Q;  1Z9F A;  4QIW B;  1SE2 A;  4ZQ3 A;  3CQZ H;  4R8I A;  3L2P A;  3GD7 A;  2PNR C;  2R92 B;  2DJG C;  3AFP A;  1II3 A;  4R9W A;  1M8A A;  1YBY A;  2K33 A;  2Y0S B;  5IGE A;  4NKL A;  1OXX K;  1WTR A;  1XPR A;  2JQO A;  4GLX A;  1YHQ A;  2K5N A;  3TP5 A;  1GKH A;  1HR0 L;  1IL8 A;  2J4X A;  3CCS A;  4CGY B;  1Y8O B;  4ZUJ A;  4DV1 Q;  2UUA Q;  4JI2 L;  1PRT F;  2CKZ B;  4A3C G;  2B63 G;  4KI0 A;  2IWH A;  2NVT H;  4FXK C;  3QO2 A;  1F9P A;  3I55 A;  1GHK A;  1NMG A;  3RR5 A;  4JI8 L;  3SDZ A;  4C3H H;  3BZD B;  4DA2 A;  1AP0 A;  2BA1 A;  1LTS D;  4LF6 L;  2EY5 A;  3M4O B;  4Z9C B;  1A63 A;  1CKN B;  4RCO A;  2OWO A;  1Y1V H;  1CA5 A;  1STY A;  1CKN A;  2VL6 A;  2JA7 G;  4MTK A;  3S2H B;  3ERS X;  4EQP A;  1XJV A;  5C3E G;  1K3B C;  3E0J A;  3RNU A;  5ELE A;  5CGK A;  1NUC A;  1CUK A;  1PFM A;  4DV2 L;  2PZW A;  3MHB A;  4HJA A;  1Z47 A;  4DPG A;  2JEA I;  5JPN C;  3H3V C;  4O2D A;  3Q8D A;  3GV3 A;  5IT9 L;  1TS3 A;  4DUZ Q;  3ND8 A;  2PI2 A;  3ULL A;  2EY1 A;  3U9O A;  4WRD A;  1DOK A;  2J0T D;  1OXU A;  4DAY B;  4X3S A;  4NXN Q;  4DAY A;  1B2T A;  5K5P A;  4JI4 Q;  2QDL A;  1A0I A;  3HOU H;  3I4M G;  5EAY A;  1UUP A;  1S5C D;  2PPB C;  5M5Y B;  5JJI A;  2A74 C;  5FKA C;  4H0L C;  2HT1 A;  4EX5 A;  5H1S E;  2LKV A;  4QY7 A;  1VDZ A;  1FL0 A;  2KOL A;  4BWG B;  3I4O A;  2UUB Q;  1HNW L;  3PO2 H;  1PFN A;  4DNI A;  1JB7 A;  2AQ3 B;  3CXC A;  4B9X A;  4LF7 Q;  1EY7 A;  3HOX B;  5M9O A;  3UE0 A;  3MAQ A;  3SEB A;  3BVG A;  3FRP B;  2F0K A;  3GTK B;  3W1B A;  1SMY C;  1PZI D;  1B7Y B;  1PTO F;  1EOV A;  3P20 A;  3OMC A;  2NVX B;  3S1Q H;  4KHV A;  4DUZ L;  3I4N G;  2EYJ A;  3QJY A;  4IFD H;  3SK8 A;  3NEM A;  4KD4 A;  3NWS A;  3K7U C;  1T5X D;  4FXG C;  5KYI A;  1QWY A;  1I4Q A;  4K14 A;  1VQM A;  3CAM A;  1U4M A;  3CRK C;  3FPU B;  3S15 B;  3ER0 A;  1ET9 A;  2TMP A;  3PUZ A;  2E5L Q;  3NTH A;  1ONL A;  5IYB G;  4M8A A;  4YCU A;  3KFU A;  5C4Z A;  5EPJ A;  1B9N A;  2E2I B;  1G29 1;  1F9Q A;  3PMF A;  2ICI A;  2B2Y A;  1TWG B;  1G8Z D;  2K5H A;  3BVZ A;  2G9H D;  5IGD A;  1GUO A;  4H13 C;  4AH6 A;  1E1T A;  1A3U A;  1E3P A;  2F0G A;  5GRO A;  3GTJ H;  4LF7 L;  4BBS H;  5EBD A;  2ZXP A;  4RHR A;  3HKZ E;  3MXN B;  1K83 H;  1G6P A;  1LAB A;  2ZTE A;  2JA6 G;  3MXN A;  3D31 A;  3TZD A;  1WCM B;  1WD1 A;  4L5R C;  1HFG A;  3FPP A;  2NUC A;  1HPC A;  2ATW A;  1IXR A;  1IL2 A;  1E2V A;  1XTD A;  2Q2U A;  1PLF A;  5IYD H;  2FIN B;  3RZD B;  5C4X B;  4K5V A;  1EOT A;  3J80 c;  1MJC A;  4JBJ A;  4UY8 C;  3CD6 A;  5T1I A;  4IUR A;  1HR0 W;  4WJ3 M;  2AUJ D;  5FO9 B;  1HZ9 A;  1EUJ A;  2E2J H;  4ZLT F;  1G2S A;  3CC2 A;  4XTC S;  1XPO A;  1PZK D;  4JI6 Q;  4HCE A;  1L0X B;  4UP9 A;  3F8T A;  3PO3 B;  2Q8T A;  3K7A H;  4A93 H;  3PUY A;  1MD2 D;  5CR3 A;  3PIO 3;  4A3E B;  1WTQ A;  1VQL A;  4FF2 A;  3NSW A;  1TT2 A;  2A19 A;  3STB D;  3S16 H;  1TII D;  2KED A;  5CBA E;  2F0W A;  1JJ2 A;  3IFD A;  4C3I G;  4WFN 3;  4ZRZ A;  1K28 A;  1KHI A;  2PQE A;  1NY4 A;  2FJ2 A;  4LUO A;  5HY6 A;  1KD1 C;  2I5H A;  2V4D A;  5I4D A;  2IX0 A;  3D4W A;  4IUU A;  3OW7 A;  3HOV B;  5J22 A;  5LMN L;  3D6C A;  3H0G B;  5FLM H;  4IOA A;  1B70 B;  4CHT B;  1B3A A;  1VQO A;  1B8A A;  4LJZ C;  1L1O C;  1BDO A;  2DY7 A;  3FKI H;  4KN7 C;  1IBK Q;  4HID A;  4XQQ A;  4IUQ A;  1CFM A;  2KA7 A;  1EQR A;  5ELD A;  2E2H H;  4A3G B;  2QA4 A;  5D3D A;  4LK1 C;  4XYO A;  3GTP H;  5IP7 G;  2PZT A;  4K8J A;  2F0P A;  5AJ3 Q;  1TWF H;  4KHZ A;  3M7N A;  2CH4 A;  3DEP A;  4A3F G;  4JI6 L;  2R92 G;  4RFB A;  4CDE C;  1LYL A;  4DV6 Q;  1QVF A;  2XRQ D;  4ME3 A;  2HUG A;  3TME A;  4G7O C;  3KDF B;  2EY2 A;  1TS2 A;  3CME A;  2YYZ A;  2Y0S G;  3KBX A;  1MJE A;  2CCZ A;  1KDC A;  3GTG H;  2RSO A;  3S1R H;  1SE4 A;  3CHB D;  5M3F G;  3I72 A;  3PCO B;  1P16 A;  2F3W A;  4MNO A;  1WTH A;  2NVY B;  4M1U B;  2F03 A;  5KNB A;  3PIP A;  1V1Q A;  5EBC A;  1N34 Q;  3L9A X;  1XX8 A;  3C1E A;  1IKL A;  4PZ7 A;  3R3O A;  4ZKB B;  4GN5 A;  2Z6K A;  1GD7 A;  1KAW A;  2KHJ A;  3GTL H;  1HTL D;  1IBL Q;  4ZUI A;  4C2M B;  2MO1 A;  3SR1 A;  2L55 A;  2LY7 A;  1XNR L;  1ZYR D;  4AQY Q;  1BNZ A;  2JA7 H;  1E2W A;  3F2U A;  4LF8 Q;  1LLR D;  2ZM6 Q;  1HQR D;  3BU2 A;  3RLN A;  5GAH C;  2F0H A;  2H1E A;  4JI7 L;  5I6Y A;  3GTM B;  3QWN A;  1N36 L;  2DGY A;  4RHS A;  1JC7 A;  4B9W A;  1PHJ A;  3S2D B;  2K7V A;  5JAV A;  3NWT A;  1PTO H;  3RN5 A;  1PYS B;  3PIP 3;  1K73 C;  4GLV B;  3TZU A;  4QF4 A;  4FNF A;  1N34 L;  2CQA A;  2QF7 A;  5C0X J;  5IGB A;  3NE5 B;  1I50 H;  1V8Q A;  2MO0 A;  3H94 A;  1STB A;  3L0O A;  4DR4 Q;  1BCP D;  4JI0 Q;  2VB3 X;  2IX3 A;  3I4M H;  5IWA L;  1VF5 C;  2KBN A;  1MBY A;  3VDY A;  1KNE A;  4KN4 C;  3QB3 A;  3O13 A;  2L15 A;  1J8I A;  2UXB Q;  3OPO A;  2RHS B;  4B08 A;  1XTC D;  3CCL A;  5DM7 3;  3MZ5 A;  2IHF A;  2WAQ B;  4ZCK A;  4IPH A;  4K2L A;  2L9H A;  5C4J B;  1KDA A;  3EN2 A;  4X62 Q;  3JAM E;  4QUC A;  3BVM A;  3M3Y H;  2QEJ C;  2OQK A;  3T16 A;  4IZ8 A;  4NXM L;  5M5W B;  3I4N H;  1M4V A;  2RDG A;  2L0C A;  3RLF A;  3GDE A;  4KK7 A;  2A68 C;  3S1M H;  1SE3 A;  2R7F A;  4C3J B;  3QG1 A;  2JYO A;  2OXP A;  4UPA A;  1A62 A;  5JJK A;  1ROD A;  3X3N A;  3NEL A;  4L8J A;  5CV8 A;  5GQO A;  1FJG Q;  1G2T A;  5IYB H;  2F0L A;  5LMN W;  2MGS A;  5J1Z A;  3ULP A;  5EKK A;  1S5B D; 
#chains in the Genus database with same CATH homology
 2AWO A;  3CPW A;  5IYD G;  4DR5 L;  2HHH Q;  3RN2 A;  4JBW A;  1QUQ A;  3H0G H;  4JG2 A;  3STB C;  2VZA A;  1IBM L;  4A3D G;  4IFD I;  1N33 L;  3KDF A;  4IO9 A;  1K3R A;  3CCR A;  4DV0 L;  1XNQ Q;  4DR1 L;  4LFA Q;  1Y1V G;  2N3S A;  2ID0 A;  1EWI A;  3ULJ A;  2N49 A;  4JV5 Q;  4IPD A;  1C0A A;  4A3K G;  4C3J H;  1PH6 A;  3M9B A;  4HIM A;  4APV A;  1VQI A;  1JE5 A;  1UWV A;  4X66 L;  4JI5 Q;  5JJL A;  4B3R L;  3TRZ A;  3M4Q A;  1BBU A;  1X55 A;  2BH8 A;  2JA6 H;  4A93 G;  2VQE Q;  4JOI C;  1YIJ A;  4LFB L;  2ALY B;  2IY5 B;  4YY3 Q;  3J81 i;  1KIX A;  1YJW A;  2WB1 E;  4DAM A;  1S40 A;  1K8A C;  1HZC A;  2I5M X;  5LMU L;  1SRU A;  1I94 Q;  2UU9 Q;  2CWP A;  1YHB A;  3KJO A;  3FP9 A;  4A3I G;  1PH4 A;  4AYB E;  3I7F A;  4DV7 L;  1IBK L;  3NEN A;  3CCE A;  2YU9 H;  1YJN A;  1PH3 A;  3HKZ G;  2BH2 A;  1WOC A;  1YNX A;  3PGZ A;  1LTL A;  5GAG C;  5IYC G;  4JC0 A;  4X64 L;  1X9N A;  4JBK A;  2AMC B;  3KF8 B;  4XIG S;  2HQL A;  4QIW E;  2NZH A;  2EIF A;  5AJ3 L;  4LF4 L;  1HZB A;  3F2D A;  5HGQ A;  2NZO A;  3S14 H;  2RHQ B;  1PH1 A;  2NVY H;  2R7Z G;  4YWM A;  1VQG A;  1J5E Q;  4OWW B;  3M4P A;  3CPF A;  2AWN A;  4DV6 L;  1PH8 A;  4MTN A;  3FKI G;  4OX9 Q;  4J15 A;  2Y0S E;  2AKW B;  1VQ5 A;  4LF6 Q;  4DK6 C;  2I0Q A;  4JYA Q;  1K0R A;  1HNZ L;  1TWC H;  4C3I H;  2EQS A;  4DUY Q;  1BKB A;  3HFZ B;  3OYY A;  4LF5 Q;  2Z6K C;  1Z9F A;  4IJH A;  1N32 L;  3KYH C;  2OTL A;  2V1C C;  3CQZ H;  5J3B A;  3L2P A;  3GD7 A;  5IP9 G;  4YWK A;  1U0L A;  1QVG A;  4DV3 Q;  1X3G A;  2AHO B;  3AFP A;  4YHH Q;  4KHP Q;  1E24 A;  4AIM A;  4OO1 G;  1KRS A;  4LNQ A;  2MFI A;  1YBY A;  4QL5 A;  3G71 A;  3BZC A;  3PIO A;  3M85 A;  3PO2 G;  3UE1 A;  2IHE A;  3TS0 A;  1OTC A;  3DM3 A;  1OXX K;  1XPR A;  1KXL A;  1VQK A;  3PUV A;  2JQO A;  4GLX A;  1LM0 A;  1YHQ A;  2K5N A;  3HOW H;  1HR0 L;  1GKH A;  4GLA C;  3GTQ H;  3CCS A;  3J81 j;  2EXD A;  1OXT A;  4OON A;  1M90 C;  4DV1 Q;  1VQC A;  2UUA Q;  4JI2 L;  2K5V A;  3PF5 A;  2CKZ B;  1IBL L;  3GTO H;  5LMN Q;  3JAM c;  1PH9 A;  4A3C G;  4LUV A;  3UDI A;  2VQF L;  2B63 G;  1NTG A;  4KI0 A;  4X65 Q;  4A76 A;  3EBE A;  5BR8 Q;  2E8G A;  5IP7 H;  3H15 A;  4AQY L;  2FXQ A;  1GM5 A;  2NVT H;  1VQD A;  4LF8 L;  1TWH H;  4DR7 Q;  4PZ8 A;  2R92 H;  4IFD G;  3I55 A;  1HNX L;  1NMG A;  5C44 G;  5ELO A;  2D62 A;  3RR5 A;  2LSS A;  5JEA G;  2ZM6 L;  4JI8 L;  2QEX A;  4GKJ Q;  5ELN A;  4C3H H;  3OTO Q;  4HJ5 A;  4A3M G;  4P74 A;  2BA1 A;  2JEB I;  4LF6 L;  1A63 A;  1CKN B;  2JA9 A;  3HOX G;  2OWO A;  4DUY L;  1Y1V H;  2B3G A;  1CKN A;  5M3F H;  2VL6 A;  4A3L H;  4BBR G;  4BY1 G;  2JA7 G;  1WI5 A;  3IRB A;  2UUC Q;  3ERS X;  1YZ6 A;  1XJV A;  3JAM i;  2UXD Q;  2JE6 I;  5C3E G;  4OWT B;  4DV3 L;  4YHH L;  2R93 G;  2PI2 E;  4DV5 L;  4A3B H;  3RNU A;  4MZ9 A;  2A8V A;  1L1O A;  3KF6 B;  1EYG A;  1SE8 A;  1VQJ A;  3RLO A;  4OO1 I;  3KF6 A;  1CUK A;  1VS0 A;  2JA8 G;  4OXP A;  1HJP A;  5M3M G;  4DV2 L;  4B3S L;  4B3T Q;  4HIO A;  1CSP A;  4HJA A;  1Y1W G;  1Z47 A;  1AE2 A;  4DPG A;  2VUM H;  2GN5 A;  4GS3 A;  4RMF A;  2Z0S A;  4GKK Q;  2JEA I;  4BBS G;  1D7Q A;  3AEV A;  1C9O A;  4DR4 L;  3TS2 A;  1HZA A;  4JI0 L;  1CKM A;  2DUD A;  4O2D A;  4ALP A;  3M4O H;  3G6E A;  1E1O A;  1IYJ B;  3E0E A;  3Q8D A;  2XGT A;  1U5K A;  4DUZ Q;  4HJ7 A;  2PI2 A;  1JT8 A;  3ULL A;  2VNU D;  3KJP A;  3S2H H;  2LXJ A;  2K14 A;  2UXB L;  1OXU A;  4DAY B;  1QVC A;  4UP8 A;  1W2B A;  1PH2 A;  5M5X H;  4NXN Q;  5IY0 A;  2XTI A;  4DR3 L;  5M5W H;  1UE6 A;  2UXC Q;  1X3E A;  4JI4 Q;  3K0X A;  1A0I A;  3HOU H;  3I4M G;  2A1A A;  3S1N H;  5GAE C;  2K52 A;  5EAY A;  5C0X G;  1BBW A;  2JA5 G;  1C7Y A;  3W1G A;  3TEH B;  1XNR Q;  3HOZ G;  3U50 C;  2JJQ A;  5JJI A;  4X62 L;  3FHW A;  2ZJR A;  2HT1 A;  4K0K Q;  3L7Z C;  4EX5 A;  4LUZ A;  5IP9 H;  2PMZ E;  2UUC L;  5H1S E;  3G4S A;  4HJ8 A;  1SMX A;  4QY7 A;  1FL0 A;  2QGQ A;  4PG3 A;  3I4O A;  2UUB Q;  4BY7 G;  1WCM G;  4JI7 Q;  2Q2I A;  3T1Y L;  1HNW L;  3PO2 H;  4DNI A;  1JB7 A;  2Q2H A;  1N36 Q;  3A5Z B;  5IT9 c;  3NBH B;  3CXC A;  4DR2 Q;  4LF7 Q;  5C4X G;  1PH5 A;  4DR6 Q;  3TRE A;  3UE0 A;  1Q86 C;  1X6O A;  3UDF A;  3UDG A;  2PQA B;  4IFD J;  4LF9 Q;  3W1B A;  1B7Y B;  1LUZ A;  1EOV A;  5JEA J;  1FJG L;  3RZO H;  4A3C H;  5FLM G;  2B63 H;  2F4V Q;  3S1Q H;  5FLX c;  4DUZ L;  3I4N G;  2K4K A;  3PO3 G;  3NEM A;  4A3E G;  3K7U C;  4Y52 H;  2HHH L;  1JJC B;  4R4Q A;  1VQM A;  3CAM A;  4GOP B;  2ZTC A;  3CF5 A;  3T1H Q;  4A3M H;  4POG A;  1YJ9 A;  1XNQ L;  1I5F A;  4GOP A;  3ER0 A;  3D0F A;  2D0O A;  3A0J A;  2WAQ G;  4LFA L;  3PUZ A;  5IWA Q;  2E5L Q;  4JV5 L;  4Y7N H;  3JC6 6;  1TWA H;  5IYB G;  4YCU A;  3KFU A;  2KHI A;  5C0X I;  3HKS A;  4A3J H;  4BY1 H;  2CFM A;  4JI5 L;  1FVI A;  2F3I A;  3HOV G;  1XMQ Q;  1G29 1;  3PUX A;  5C3E H;  2VQE L;  4YCW A;  3H0G G;  2HIV A;  4YY3 L;  2NVX H;  4L5S A;  3CCQ A;  4LFC Q;  1GO3 E;  2K5H A;  4JI1 Q;  3KLW A;  1PFS A;  4P71 A;  1XMO Q;  4AH6 A;  1M1K C;  1I94 L;  2UU9 L;  5M3M H;  1HH2 P;  1E1T A;  4LF7 L;  1E3P A;  5GRO A;  3GTJ H;  4QQB X;  1OXV A;  4DR6 L;  4EQ5 A;  4BBS H;  1VQ4 A;  4YWL A;  3HKZ E;  3MXN B;  2WFW A;  2B29 A;  1K83 H;  1D8L A;  1UE1 A;  2ZTE A;  1G6P A;  2JA6 G;  4A3G G;  1Q1E A;  2ASB A;  3PUW A;  4DKA C;  1KC8 C;  3D31 A;  5E7N A;  4NXM Q;  1JMC A;  1ASZ A;  4L5R C;  4L5Q A;  1YVC A;  4JI3 Q;  1DGS A;  1AE3 A;  1IXR A;  1IL2 A;  2ATW A;  5K36 G;  1K8G A;  1XTD A;  1PV4 A;  4R4C A;  2Q2U A;  3E9H A;  3ZJY C;  1J5E L;  4B3M Q;  5IYD H;  4A3D H;  3J80 c;  1MJC A;  1VQE A;  4P75 A;  4JBJ A;  4OX9 L;  4UY8 C;  3CD6 A;  4JYA L;  1TWG H;  1PA6 A;  1HR0 W;  4WJ3 M;  1HZ9 A;  1BVS A;  1EUJ A;  2E2J H;  4LF5 L;  3A5U A;  3H3V I;  1EIY B;  4A3K H;  4XTC S;  3CC2 A;  4BXX G;  2VY3 A;  1XPO A;  2NN6 G;  4GNX B;  4JBM A;  1X3F A;  4JI6 Q;  2JK8 A;  3WWV A;  5DLQ E;  4UP9 A;  2CWA A;  3F8T A;  4DV4 Q;  3K7A H;  4GNX A;  3PUY A;  4A93 H;  3PV0 A;  1XMQ L;  1VQL A;  2A19 A;  3STB D;  3ICE A;  1IBM Q;  3S16 H;  4IPG A;  4L5T A;  4BY7 H;  1WCM H;  1UEB A;  3HOY G;  4DV0 Q;  1JJ2 A;  4DR1 Q;  4P72 A;  3J80 i;  4A3I H;  1QZG A;  1KHI A;  1L0W A;  1NY4 A;  5HY6 A;  4LUO A;  3RZD H;  1KD1 C;  2I5H A;  1I6H H;  2IX0 A;  2YV5 A;  1E22 A;  4X66 Q;  4DV1 L;  2UUA L;  4B3R Q;  1G51 A;  3F2C A;  5LMN L;  5IYC H;  1CKO A;  3AFQ A;  3CC4 A;  4LFB Q;  1PVO A;  2BA0 A;  4X65 L;  5BR8 L;  3J7Z C;  5FLM H;  1OXS C;  1EFW A;  1B70 B;  4IOA A;  2LXK A;  5LMU Q;  1CSQ A;  3OW2 A;  1VQO A;  1VQ9 A;  3PO3 H;  1B8A A;  4BA1 I;  2R7Z H;  1L1O C;  4GKJ L;  4A3E H;  3OTO L;  4B3M L;  3S17 H;  1KL9 A;  3GO5 A;  3I56 A;  1S3O A;  4BA2 I;  3FKI H;  2KEN A;  3KOJ A;  4DV7 Q;  1Q7Y C;  1IBK Q;  4HID A;  4QGU A;  1EQR A;  1K9M C;  2E2H H;  4X64 Q;  2QA4 A;  4IPC A;  1VQA A;  2ZTD A;  2VUM G;  3GTP H;  1EIF A;  3E9I A;  4JOI A;  5IP7 G;  5AJ3 Q;  4LF4 Q;  1TWF H;  4KHZ A;  3M7N A;  1SFO H;  4JI6 L;  1W3S A;  4A3F G;  2R92 G;  1P8L A;  5GAD C;  1SR3 A;  2UXD L;  2ZJP A;  2NN6 I;  4X6A H;  4DV4 L;  4H02 A;  1LYL A;  4DV6 Q;  1QVF A;  3S24 A;  3F2B A;  4ME3 A;  3KDF B;  4HJ9 A;  3CME A;  2YYZ A;  2Y0S G;  4IJL A;  1MJE A;  2CCZ A;  1TXY A;  1HNZ Q;  3K81 C;  3GTG H;  1PYB A;  4B3T L;  4TQU S;  3S1R H;  1N32 Q;  4GKK L;  4A3L G;  3CCJ A;  3PCO B;  5M3F G;  1P16 A;  2HIX A;  1WJJ A;  4MNO A;  2CQO A;  2PQA A;  1Q81 C;  1PH7 A;  1J6Q A;  4A3G H;  4A3B G;  1NBW A;  4P73 A;  5M5Y H;  4TVA B;  3PIP A;  1V1Q A;  1N34 Q;  3CW2 C;  2N78 A;  1JJG A;  3CC7 A;  3BZK A;  5C44 H;  2GVA A;  1WYD A;  1NJI C;  1Q8K A;  4PZ7 A;  1Q82 C;  1HR0 Q;  4NXN L;  3MEF A;  4GN5 A;  2Z6K A;  4NB3 A;  2UXC L;  1WFQ A;  1KRT A;  4JI2 Q;  1GD7 A;  1KAW A;  5IE8 A;  1MIU A;  2KHJ A;  1VQP A;  4JI4 L;  1RL2 A;  1IBL Q;  3GTL H;  1R9T H;  2MO1 A;  2C35 B;  3HOX H;  5FJ8 G;  3LGJ A;  1X54 A;  2VQF Q;  1VQN A;  1QZH A;  1XNR L;  1E7Z A;  4BBR H;  1X65 A;  4AQY Q;  1YIT A;  2JA7 H;  4BXX H;  4LF8 Q;  4K0K L;  1SN8 A;  3CP0 A;  3GTK H;  1HNX Q;  4GN3 B;  4GN4 B;  3UDX A;  2ZM6 Q;  4KHP L;  1IZ6 A;  3CCM A;  3BU2 A;  4QJF A;  4JI8 Q;  3RLN A;  5GAH C;  3J7A 5;  1GVP A;  2R93 H;  2VS1 A;  2UUB L;  2MQH A;  3B6Y A;  1Q1B A;  4JI7 L;  3PF4 A;  1UE7 A;  2JA8 H;  1N36 L;  3HOU G;  3HOY H;  2DGY A;  4DR2 L;  2K50 A;  1YI2 A;  3W5O A;  4R4O A;  3BJU A;  1Y1W H;  1A8V A;  2YTX A;  1UE5 A;  1PHJ A;  4GOP C;  1VQ7 A;  1VQF A;  3S15 H;  1N8R C;  4PZ6 A;  2RCN A;  4LF9 L;  1Y14 B;  3RN5 A;  1PYS B;  4C2M H;  3CCV A;  3K80 C;  1FGU A;  1V43 A;  4DV5 Q;  1K73 C;  4GLV B;  2NVQ H;  2F4V L;  1S72 A;  2GVB A;  4A4I A;  1AH9 A;  2E2I H;  2OCE A;  1N34 L;  3K8A A;  4DV2 Q;  2MNA A;  4B3S Q;  5C0X J;  3F1Z A;  4OWX B;  2F52 A;  1T9H A;  1VQ6 A;  1I50 H;  2MO0 A;  2PNH A;  4A75 A;  4JCV E;  3L0O A;  4RG1 A;  3T1H L;  4DR4 Q;  1YHA A;  3GTM H;  4DK3 C;  4JI0 Q;  1X56 A;  4HIK A;  2ES2 A;  3I4M H;  2JA5 H;  2WAQ E;  1VQ8 A;  2IT1 A;  4DR7 L;  5IWA L;  2KBN A;  2E5L L;  3HOZ H;  3VDY A;  3S2D H;  1L2F A;  3PSI A;  1I3Q H;  2KCT A;  4A3F H;  1EQQ A;  2L15 A;  4DR5 Q;  2UXB Q;  3U4Z A;  3A74 A;  3CCU A;  2RHS B;  2I5L X;  2OTJ A;  4WJ4 A;  2N8N A;  3SGI A;  4DR3 Q;  4LFC L;  1N33 Q;  4JI1 L;  3CCL A;  4NPS A;  2R7D A;  2IHF A;  1XMO L;  1RIP A;  1XPU A;  4IPH A;  5C4X H;  1V9P A;  3U58 A;  1NMF A;  1MKH A;  4KLK A;  2D0P A;  3EN2 A;  3TQY A;  4X62 Q;  4LW1 A;  4A3J G;  4LWC A;  1NE3 A;  4POF A;  3M3Y H;  1VCI A;  2OQK A;  3AQQ A;  2ZJQ A;  1L1O B;  2WB1 G;  4NXM L;  4GNX C;  4R4T A;  4R1J A;  3T1Y Q;  3I4N H;  1HNW Q;  2YTV A;  4JI3 L;  3RLF A;  3GDE A;  1SLJ A;  3I2Z A;  3HOV H;  3S1M H;  3HOW G;  3G48 A;  3U4V A;  2R7F A;  3DLL A;  2WP8 J;  1Q12 A;  1Q46 A;  4O0A A;  1VQB A;  2YTY A;  3AYH B;  4YCV A;  4AYB G;  3EIV A;  4FDB A;  3CMA A;  2Q2T A;  1KQS A;  2IX1 A;  3H3V H;  4UPA A;  1A62 A;  1SRO A;  4UP7 A;  5JJK A;  1O7I A;  3NEL A;  5GQO A;  1N9W A;  2KCM A;  1ASY A;  2H5X A;  1VQH A;  2OQ0 A;  4PMW A;  4IOC A;  1FJG Q;  5FJ8 H;  2K75 A;  5C4J H;  5IYB H;  5LMN W;  2RF4 A;  3J81 c;  2VW9 A;  3ULP A;  1YEZ A;  4R4I A;  1H95 A;  1QUQ B;  2R6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...