2JA5H

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja5H00
4QQBX 5IYCH 1VQDA 1N32Q 4JI3L 1VS0A 3M7NA 2YTVA 4UP8A 3NENA 1PH4A 4A93H 4OO1G 3MXNB 2UXCQ 1XPUA 3U58A 2Q2IA 3KDFB 3RN2A 1IL2A 2CKZB 3RR5A 3A0JA 2NZOA 1EFWA 1K0RA 1Q86C 2UUCL 2E2HH 2R6GA 4LFAL 1HNWQ 4DV7Q 4O2DA 1QVGA 4R4IA 4JI2Q 4MTNA 4IFDG 1PH7A 4YWLA 2LXJA 4LW1A 1GO3E 1PV4A 3PUWA 2WB1G 1X56A 3LGJA 4A3JH 3HKZE 1WJJA 2B63H 4OWXB 3CPWA 4LF4Q 3GTGH 1IZ6A 1YHAA 4JI1Q 3PUZA 3UE1A 3G4SA 4DR2L 2B3GA 1GD7A 1N33Q 1VQ5A 2E8GA 4GS3A 3JAMi 3GTOH 1QUQB 3A74A 2N8NA 1X55A 3NBHB 4DUYQ 4IJLA 2HHHQ 2R7ZG 3BJUA 2IX0A 1PYBA 1X3GA 4YCVA 4JV5Q 4IJHA 1KRSA 1GKHA 4YHHL 4DV0L 4JI4Q 5LMUL 3RNUA 2R7FA 1SROA 4OXPA 2YV5A 3CAMA 3CCVA 4GNXC 2JA6G 4IPCA 4GOPB 3HKZG 3J80c 1UWVA 5IYBG 5JEAG 1I94L 1NTGA 1NMGA 4DUZL 2VW9A 4A3GG 1L1OA 2OQKA 2JA6H 5HGQA 4HJAA 2E5LL 3K0XA 5GAHC 3S16H 4OO1I 4DR7Q 2R7ZH 1EIYB 4DV1Q 3EIVA 1KHIA 3GDEA 2XTIA 5J3BA 2WP8J 3M9BA 4R4QA 2NZHA 3TRZA 2QGQA 3PGZA 5IWAQ 3I2ZA 5FLMH 4DR4Q 2K5NA 1W2BA 3J81i 4PG3A 3PF5A 4B3SQ 4X66L 1YZ6A 2JA5H 3HOXH 4BBSH 2ZTCA 3S1NH 4L5SA 1YHQA 1CKMA 1LUZA 2ZJPA 1KQSA 1ASYA 4OX9L 1XNQQ 2B63G 4JI0L 3J81c 1N32L 4LF8Q 4A3IH 3F2DA 2ES2A 1EYGA 1X9NA 3CCLA 1JJGA 3F1ZA 4X65Q 1JMCA 2HIXA 2BA0A 2UXCL 1PVOA 1P16A 1Q1BA 4UP7A 2IHEA 2L15A 4LNQA 1UEBA 1SN8A 1BBWA 2I5LX 4YWMA 4BA1I 1K3RA 1VQMA 4A3CH 3CC4A 1HR0W 3CPFA 1I3QH 5M5YH 4GOPA 5IP9G 3RZDH 2UUCQ 4LFAQ 1HNWL 4KI0A 2RHSB 3AFQA 4C3IH 3J81j 5FJ8H 1XNRL 1X3EA 1JT8A 2N78A 2NVQH 3E0EA 1IBKQ 3HOZG 3AQQA 4JOIC 1PFSA 4QJFA 4DPGA 3PSIA 1J6QA 1EWIA 2N3SA 3PUYA 4DR6L 4WJ4A 3T1YQ 1Q82C 4O0AA 2MNAA 4HIMA 4JI1L 2D0OA 4OWWB 4NB3A 4LFBQ 4A3LH 2YTYA 1PH2A 3IRBA 1VQ8A 5C0XI 4JC0A 5LMNW 4DUYL 4IOCA 3PO2H 5GAGC 2HHHL 4JI6Q 3CP0A 3NELA 4DR3L 1K83H 4YHHQ 4DV0Q 4JI4L 2PQAB 1KL9A 4IFDI 3I4OA 4GLAC 4HIDA 3SGIA 2N49A 5M5WH 2KBNA 2E2JH 4NXNQ 1C0AA 1TWHH 4DV5L 1XPOA 2E5LQ 1W3SA 2JE6I 1PH1A 1C9OA 4DR1L 1HNXL 3RLNA 1VQEA 1OXUA 4DV1L 2PMZE 4DNIA 3TS0A 4XIGS 3JC66 3W5OA 1HJPA 4DR4L 1EOVA 1IBLL 1UE7A 3S1RH 4B3SL 4POGA 1Q7YC 1NY4A 4GOPC 3AEVA 2ZM6L 5FLXc 3OW2A 3HFZB 4OX9Q 4JBJA 3KOJA 4GNXA 5C3EH 3K80C 2EIFA 4A3MG 4JI0Q 4LF8L 5GQOA 4A4IA 1YJ9A 1CKNB 3PV0A 4JOIA 3DLLA 4LF6L 4X65L 2UUBQ 5FJ8G 1A8VA 1Y14B 3ULLA 1YVCA 2K14A 4X6AH 4C3HH 1HR0Q 5M3FH 2R92G 4DR5L 4KLKA 3HOUG 2WFWA 2K52A 5IE8A 1XJVA 4PMWA 1TWFH 1R9TH 4C3JH 1Q12A 4P75A 4BY1G 3TREA 4IO9A 1C7YA 1YNXA 1XNRQ 4GNXB 1SMXA 3FHWA 1XPRA 1IBKL 4A3IG 2A19A 2UXDL 2YYZA 4AIMA 5C0XJ 2E2IH 4A3BH 2EXDA 3M4OH 4DR6Q 1VQBA 4UY8C 3T1YL 1E7ZA 1Q46A 4DV2L 1N34L 4DK6C 1A62A 1CSQA 5LMNQ 2V1CC 1LTLA 1XTDA 3W1BA 3U4VA 3T1HQ 4APVA 5M3MG 4LFBL 5M5XH 2JA8G 1Z9FA 1E22A 3HOWG 2VQEL 2RF4A 3EBEA 2KENA 4A3EG 1S72A 4JI6L 5C44H 4GN3B 4DR3Q 4B3TL 4BXXG 4MNOA 3CCRA 1WYDA 2I5HA 2VUMG 2IHFA 3HKSA 3UDXA 1YITA 2YTXA 1HNZL 1BKBA 3KFUA 2R93G 1HZ9A 3KJPA 3RLFA 4A3KG 4A3GH 4JI8L 3WWVA 4NXNL 1IYJB 2HT1A 1TWAH 3E9IA 4LWCA 3FP9A 4QL5A 2I0QA 2JA7G 3KLWA 4DV5Q 4JG2A 3ULJA 3CCQA 3J7ZC 1MIUA 1GM5A 4A3KH 1MJCA 4DR1Q 4OONA 3CC7A 3CCUA 2Z6KA 1HNXQ 3MEFA 2K5HA 4XTCS 3OTOL 4HJ7A 3D31A 1U0LA 4ALPA 2VUMH 3U4ZA 1LYLA 3HOYG 2ZTEA 1E24A 2ZJRA 2ATWA 5C44G 2Q2TA 2D62A 4A3EH 1L1OC 3CMAA 2Z0SA 1IBLQ 4UPAA 4B3RQ 2WAQG 3L7ZC 5M3MH 4PZ8A 1I5FA 2ZM6Q 4DV6L 1KXLA 2VNUD 1YJNA 1WFQA 3F2CA 1IBMQ 4BA2I 1FL0A 4R4OA 4NPSA 4LF6Q 4OWTB 2ID0A 1X54A 2UUBL 1TWGH 4JBKA 3I4NH 1VQ9A 4LF9Q 2MFIA 1YBYA 2GVAA 2JK8A 4A76A 4JBMA 1HR0L 4DAMA 3KJOA 4DR5Q 1E1OA 3F8TA 3HOVG 1TXYA 1QVFA 2WAQE 1AE3A 3W1GA 3CC2A 5ELOA 4ME3A 2VZAA 1I50H 1UE6A 3STBC 3CCMA 1JE5A 3J80i 4LFCL 3CMEA 2UXDQ 2OTJA 2GVBA 2JQOA 3KF6B 1VQGA 3CCSA 1FGUA 2CQOA 4UP9A 1KC8C 4A3DG 1K73C 4P74A 4LUZA 4GKKQ 3PUVA 4DV2Q 3STBD 1N34Q 1M90C 5C3EG 4A3MH 3G6EA 5LMNL 1L2FA 1YEZA 3GD7A 3UDGA 1U5KA 3T1HL 3PO3G 3D0FA 1YJWA 2JEAI 5C4XH 4HJ9A 1NJIC 4MZ9A 2PNHA 1PA6A 1PHJA 2VQEQ 4R4TA 4HIKA 1MJEA 4B3TQ 2LXKA 2IT1A 3GTKH 3K81C 3PF4A 1HNZQ 1SRUA 1VQIA 1K9MC 2MO1A 3S14H 4P73A 3S2DH 4JI8Q 5GROA 1BBUA 2GN5A 4JCVE 4DK3C 4BBRH 3RZOH 3CW2C 1PYSB 2AKWB 1HZCA 1A0IA 3CD6A 3I4MG 1QVCA 5K36G 1VQCA 5IYDH 1PH9A 3BU2A 2Q2UA 5EAYA 1NMFA 4FDBA 4J15A 1QUQA 1B8AA 1VCIA 1FVIA 3OTOQ 3EN2A 1YIJA 1SFOH 2IY5B 2AWOA 2K4KA 1Y1WH 1JJ2A 2C35B 4PZ7A 1EIFA 1WOCA 2UUAL 3FKIG 3PCOB 1FJGL 2B29A 3CXCA 4B3RL 4L5TA 4PZ6A 4JI5L 5C4XG 1PH3A 3ER0A 3PIOA 4DV6Q 1V1QA 1AH9A 4JBWA 3UDIA 1TWCH 4HIOA 3H3VI 2LSSA 1IBML 3S24A 4A3DH 1N8RC 4KHPQ 4HJ5A 1LM0A 4LF7L 4LF9L 3DM3A 3RN5A 2KHIA 3I4MH 4QGUA 4B3MQ 3M3YH 3U50C 1PH8A 1E3PA 1UE5A 4L5QA 2QA4A 4KHZA 1G6PA 3TS2A 1VQKA 3M4QA 1GVPA 2JA9A 1OXXK 3BZKA 1Z47A 3OYYA 1NBWA 5H1SE 4LF5L 4LFCQ 1VQ4A 4JYAL 1WCMH 3A5ZB 3A5UA 2OWOA 3I4NG 5C4JH 1VQAA 2PI2A 5JJKA 2JJQA 4GKKL 3GTPH 1H95A 4GLVB 2AMCB 2VQFQ 3AFPA 1BVSA 1OXTA 2EQSA 2HIVA 3HOXG 2JA5G 2I5MX 1SE8A 3PIPA 4LUOA 1V9PA 1OTCA 3S17H 3M85A 4K0KL 3CCEA 1RIPA 4C2MH 5ELNA 3H3VH 1KRTA 4A75A 3HOYH 4H02A 1VQHA 4IPDA 3S1MH 4YWKA 3GTMH 2RHQB 5DLQE 3L2PA 2KCMA 2F4VL 1VQOA 5IY0A 3KDFA 4L5RC 1VQJA 3HOVH 2PQAA 3CF5A 5GADC 1J5EL 2UXBQ 1HZAA 4GKJQ 4DV4L 5IYBH 1UE1A 1MKHA 2DGYA 4DV3Q 3GTQH 2Q2HA 2XGTA 2KCTA 1VQ6A 1A63A 4BBSG 2DUDA 3E9HA 5C0XG 4NXML 2ALYB 1K8AC 2OQ0A 5AJ3L 3Q8DA 2UUAQ 1E1TA 1FJGQ 1VQPA 2IX1A 1JB7A 2KHJA 2R7DA 4JI5Q 4R4CA 2D0PA 1XMOL 3I7FA 2K75A 1KIXA 2NVXH 4TQUS 2CWPA 4JI7L 5BR8L 1YHBA 4EX5A 4IPGA 5JJIA 2K50A 1EQRA 1XMQQ 3CQZH 1B70B 2K5VA 3AYHB 1VQLA 1SLJA 1G51A 1HH2P 4A3BG 4KHPL 5JJLA 4A3JG 2UU9L 1NE3A 4QY7A 4LF7Q 1Q1EA 1O7IA 1EQQA 2ZJQA 3BZCA 4B3ML 3M4PA 4DKAC 1QZGA 1K8GA 1N9WA 2JA7H 1VQ7A 1PH6A 1WI5A 2CWAA 4HJ8A 3S15H 3GTLH 4Y52H 2R93H 2YU9H 3KF8B 5M3FG 2R92H 4YCUA 3UDFA 1L1OB 4YY3Q 3HOUH 1AE2A 1V43A 2F3IA 4WJ3M 4GN4B 4JYAQ 4LF5Q 1RL2A 5E7NA 2H5XA 3UE0A 1EUJA 2NN6I 3ZJYC 3TQYA 4AYBG 3JAMc 4BXXH 4A93G 2OCEA 3HOWH 4X62L 2JA8H 4X64Q 5IYCG 3H0GG 3TEHB 3L0OA 2VQFL 1SR3A 1KAWA 1S3OA 4AQYQ 3S1QH 1YI2A 1N36Q 4GLXA 1I6HH 1HZBA 4POFA 4LUVA 4K0KQ 2A1AA 4R1JA 1WCMG 3B6YA 4JI3Q 3I55A 1CSPA 2Y0SE 2VL6A 3KYHC 3S2HH 3I56A 3J7A5 4BY1H 2CFMA 1CUKA 2HQLA 4EQ5A 2F4VQ 3VDYA 2RCNA 4IPHA 1B7YB 2OTLA 2CCZA 4A3FG 1J5EQ 2UXBL 2BH8A 3PUXA 1Q81C 1PH5A 3NEMA 4GKJL 4DV7L 4DV4Q 1D7QA 2MQHA 1Q8KA 4JI2L 1KD1C 4DV3L 1CKNA 4P71A 4QIWE 4BY7H 4TVAB 4RG1A 1IXRA 1L0WA 1X6OA 3G48A 5IP7H 4IOAA 1P8LA 2WB1E 4NXMQ 4AH6A 4LF4L 5AJ3Q 1VQFA 4DR2Q 1N33L 1Y1VG 2FXQA 3FKIH 4P72A 5HY6A 4A3LG 1XMOQ 2JEBI 2NVYH 1VQNA 1OXVA 1Y1VH 1Y1WG 4JI7Q 1OXSC 2ZTDA 5BR8Q 2A8VA 3F2BA 2NN6G 1X3FA 3ERSX 1XMQL 1S40A 4JV5L 2Y0SG 2UU9Q 1QZHA 1X65A 4RMFA 5IYDG 2Z6KC 5IP7G 5GAEC 1CKOA 2VY3A 5LMUQ 1D8LA 3HOZH 4BY7G 4BBRG 3K7UC 1I94Q 4Y7NH 3H15A 5JEAJ 4DAYB 3CCJA 5IP9H 4DUZQ 3ICEA 1DGSA 2PI2E 4A3FH 4A3CG 1JJCB 2MO0A 4YY3L 1T9HA 1G291 3K7AH 3K8AA 3G71A 3ULPA 4IFDJ 4DR7L 3PO2G 2ASBA 3GTJH 2F52A 3GO5A 4AYBE 2QEXA 4X62Q 2NVTH 4X64L 4GN5A 1ASZA 1M1KC 2BA1A 5IWAL 4AQYL 3PO3H 5IT9c 1N36L 2BH2A 4X66Q 3RLOA 2AHOB 2VS1A 5FLMG 1XNQL 2AWNA 3KF6A 4YCWA 3H0GH
chains in the Genus database with same CATH superfamily
1UNSA 3QOLA 1N32Q 3NWSA 3HOXB 1PH4A 3A8KE 5CBEE 3U58A 1GUTA 1HTPA 1Q3LA 4K5VA 2F0NA 3I4NB 1TWGB 4RKBA 2R6GA 1HNWQ 1QCBD 4R4IA 4JI2Q 1QVGA 3SHLA 2CH4W 5T1GA 1A3TA 4LAAA 2IL8A 1BUVT 3P7JA 3HKZE 1HFNA 4KN4C 1IKLA 2B63H 4OWXB 1HA5A 2OEOA 4KK7A 3PUZA 2BE5D 1ENCA 3I8ZA 4GS3A 3GTOH 1EY7A 5M3FB 3QWNA 4DUYQ 2X6GA 2DN8A 2HHHQ 3KBGA 4JV5Q 3BYYB 4RKLA 4JI4Q 2R7FA 4DAVA 2QF7A 1DOLA 2F4IA 1X3QA 2XWJB 1SYDA 3CCVA 4GNXC 3J80c 1UWVA 1IYUA 4HJAA 5M5WB 2E5LL 5IGDA 5GAHC 5CYUA 5C3WA 4DR7Q 1EIYB 3EIVA 1HRJA 2R3ZA 3M9BA 4R8NA 3VA7A 3HOUB 3TRZA 2F0UA 2R92B 1I50B 2EDGA 4K5XA 5IGGA 3J81i 4X66L 1YZ6A 2JA5H 2ZTCA 4L5SA 1PDQA 1TT2A 1SXTA 2KOLA 1TS5A 1JMCA 1HPCA 2EY6A 3D8GA 3BDLA 1P16A 3C3LA 2IHEA 2L15A 4A3DB 1MSGA 4C3HG 1EQVA 5M5YH 1QNKA 3RZDH 1HR0W 1JJGA 2SNMA 1STEA 1HNWL 2RHSB 3IAYA 1HQMC 1ICFB 3J81j 1KNAA 1Y69U 1JT8A 2N78A 2E2DC 3EA6A 3KK7A 2NVQH 3HOZG 4DPGA 3PSIA 5ELEA 4C1NK 2ZT9C 1J6QA 5BN4A 4WJ4A 3D6WA 2MNAA 4OWWB 1TU2B 4FXGC 3GTQB 2YTYA 1F9PA 5C0XI 4WORA 3PIP3 2PPBC 4JI6Q 5IGBA 4RGTA 4JI4L 1FYCA 4HIDA 4GLAC 5I9OA 1AP0A 2NTSA 5COYA 1KABA 3S1MB 1RCVD 2Z1CA 4CDCC 1TWHH 3SK5A 1SYGA 1BXTA 1C9OA 5EBDA 2X6LA 4L63B 4XT1B 1VQEA 4KV6A 2SOBA 1I4QA 2YU9B 4XIGS 2A68D 3JC66 3W5OA 1IBLL 3S1RH 4B3SL 4A3EB 1WD0A 3C2PA 3EJIA 3K80C 4LF8L 3TP5A 1YJ9A 1CKNB 1XTCD 4FXDA 4JOIA 2UUBQ 2KJXA 1Y14B 2RDFA 3KLSX 4N8X1 1SNCA 2WFWA 2K52A 2Z8LA 5EKKA 5BN3A 5IE8A 3GTMB 1II3A 3TP7A 1C7YA 3FHWA 3DUZA 1VF5C 4FYDA 2QCPX 4HEDA 4A3IG 2UXDL 3SXHA 1VQBA 3MXPA 5EPLA 1S5BD 2V4DA 5C6AA 4DK6C 2Z4IA 4CJ2C 1CSQA 4APVA 1Z9FA 1NAPA 2KHSA 1EYDA 3HOVB 2F0FA 3HKSA 3RMHA 3UDXA 1YITA 2YTXA 3KFUA 1DZ1A 3R3OA 1KDBA 4MTKA 1HZ9A 3RLFA 4CHTB 4JI8L 3WWVA 4KY6A 3E9IA 2I0QA 1ET9A 3ULJA 3D6CA 1GM5A 4OONA 3CCUA 2K5HA 3WOEA 3D31A 1U0LA 4ME5A 1CZGA 3A7AB 3HOYG 2ATWA 2CQAA 2ZJRA 1L1OC 3H6MA 4F7XA 2A73B 4UPAA 3HOZB 3S9WA 2WAQG 4OL7A 3ZYYX 4DV6L 3FVQA 1EU3A 1F2LA 1EY0A 1U4LA 3I72A 4OWTB 2UUBL 2RBMA 5ISRA 1SMYC 2MFIA 4DAMA 1EWHA 3HOVG 1I4HA 2WAQE 5ELOA 2WIIB 4ME3A 2F0QA 1I50H 3MVVA 4RGMA 3S1QB 3CMEA 2JQOA 2QEJC 4XXEA 2EY5A 4P74A 1CK1A 3MAQA 1H9RA 2SDFA 2AQ2B 2MUYA 1U5KA 3BVGA 2JEAI 2IW3A 5C4XH 4DAPA 4MZ9A 1JCKB 2K5QA 1TY2A 2L12A 3K5LA 2RKSA 4QIWB 2B63B 4R4TA 4HIKA 1MJEA 2RDHA 4M1UB 2LXKA 2PW7A 3HS0C 4B3TQ 4A3GB 3R93A 3PF4A 1HNZQ 4K6DA 1SRUA 2SNSA 4CDFC 1K9MC 3S14H 3S2DH 4JI8Q 5GROA 5K36H 2GN5A 2L1BA 3KF8A 3RZOH 4FVMA 3CD6A 1I6VC 3RD4A 1PH9A 2Q2UA 4E6IA 1VCIA 2HCIA 3EN2A 1YIJA 1SFOH 2RVLA 2K4KA 2C35B 4S3SA 3S2HB 4DNTB 4JI5L 1EYCA 5C4XG 1PH3A 4DV6Q 1TWCH 1U4MA 4RA8A 4HJ5A 2IPKD 4XQNA 4LF7L 4F87A 3DM3A 2TMPA 5KIXA 2CW0D 3M3YH 4B9WA 1O7YA 3U50C 2QA4A 1FD7D 1A3UA 2NUCA 1OXXK 5C3XA 2OF1A 1NBWA 1PRTC 1D5XC 4JYAL 2K5DA 3I4NG 2PI2A 5I2YA 2IWHA 4OHJA 2VQFQ 1BOSA 1ILQA 1JR0D 1OXTA 1HFGA 1RD9D 1Y8NB 2ZXPA 3NTIA 3TZUA 1MSHA 2JA5G 1PTOH 1AEXA 1RIPA 3K6OA 2HDMA 3GTMH 2RHQB 1SE2A 3NTKA 3H91A 3I3CA 1HHVA 3CF5A 1BCPF 4MIUA 5GADC 2UXBQ 3NQIA 2B2UC 1FNUA 1CA6A 5JEAH 4DV4L 1UE1A 3OHXC 3QIAA 2OQ0A 3SE0A 2UUAQ 4OIKA 1VQPA 2D0PA 2EYLA 4UDUC 4EX5A 2J0TD 4IPGA 2K50A 3N52A 3CQZH 2PNRC 1E2WA 4A3BG 4K8JA 2UU9L 3SK6A 3QJYA 5JJZA 1Q1EA 1O7IA 1JWSD 4DKAC 1VQ7A 1ESRA 3GTLH 4QUCA 1R4PB 1CM9A 1Q8IA 3DWAA 2F3IA 4JYAQ 2VNUD 3ZJYC 2K05A 3BG3A 5J1ZA 4A93G 2OCEA 3HOWH 4X62L 4KN7C 4X64Q 3L0OA 2VQFL 1EOTA 1YI2A 1STHA 1EY4A 1T5XD 1PMRA 4ID6A 3MTSA 1EYAA 1SSOA 3I56A 4JW0A 2CFMA 1C8CA 2JN4A 1CUKA 1F77A 3OMGA 5FLXL 1DJRD 2A6EC 1J5EQ 1PH5A 1Q90A 4DV7L 1JWUD 4DV4Q 1Q8KA 1G6ZA 4HTHA 1LT5D 4TVAB 5TSSA 2EYMA 3VYSA 1ICWA 3ND9A 4DA2A 4LF4L 3DHQA 3P20A 2NYZD 5CBAE 3HG9A 4DR2Q 1PRTB 4P2CB 2FXQA 3FKIH 1VDZA 3ERSX 2F0GA 1SBBB 3GTOB 3D4WA 4RMFA 1JOOA 5T1IA 3HOZH 3K58A 2Y0SB 3EVQA 3IFTA 4Y7NH 1BBXC 5JEAJ 4DUZQ 1DGSA 1QB5D 1JJCB 2MO0A 3K5MA 3BVZA 3MC0B 3PO2G 2ASBA 2F52A 4AYBE 2NVTH 2DY7A 5A35A 1L0XB 1WTOA 1ASZA 5IWAL 2KCCA 4ZLTF 1QG7A 1CA5A 1CQFA 3I2ZA 2HDLA 4YCWA 2J7ZA 5IYCH 1VQDA 3M3YB 4QQBX 4UP8A 2UXCQ 3KDFB 3A0JA 2NZOA 1EFWA 1Q86C 4TRDA 3LWEA 4BWGB 1AZPA 2TSSA 4DV7Q 1GJXA 3H94A 4IFDG 2LXJA 4LW1A 2WB1G 3LGJA 1WJJA 5IGCA 1RDPD 4LF4Q 3GTGH 3S15B 4JI1Q 4DR2L 2B3GA 3OW7A 1VQ5A 5C4ZA 5KYIA 1RHPA 2VUMB 5DEHA 1QUQB 3A74A 4KJNA 3BJUA 2IX0A 4YCVA 2Q8RE 1G8ZD 3BDCA 2P5ZX 4DV0L 4X3KA 5LMUL 3RNUA 2GA4B 1SROA 2JA6G 4GOPB 4IFDH 4OGQC 3T53B 1I94L 4QB4A 4DUZL 2QDLA 2OQKA 1EZ6A 3FPUB 3VR4A 5D3IB 4BY1B 1ZXTA 4OO1I 2R7ZH 5K5PA 1KHIA 3K5NA 1HXYD 2WP8J 4R4QA 1LTSD 1O7LA 5IWAQ 4IZ8A 2K5NA 4PMCA 3PF5A 2AQ1B 4JPBW 3S1NH 1YHQA 1CKMA 2F0WA 4RH6A 1ASYA 4CJ0B 4JI0L 1GUOA 3F2DA 3E0JA 1EYGA 2LY7A 4QF4A 4X65Q 2A69C 4UP7A 1VQMA 4A3CH 1KDAA 5KEEA 3CPFA 3DXJC 4KD3A 5EJWA 3C46A 4BBSB 1HA6A 1G2SA 2K32A 3NPPA 3EQLC 1EWIA 3T13A 3PUYA 4DR6L 1A6XA 3T1YQ 3GP7A 4UAIA 3KUPA 4HIMA 4O1NA 2B2WC 1TIID 2I07B 4LFBQ 4A3LH 1G2TA 1WVLA 1VQ8A 2F0LA 4JC0A 4NP5A 5LMNW 1B53A 3PO2H 3IFDA 4DR3L 5KNDA 1ESFA 4YHHQ 5KNCA 4X3SA 3SGIA 1A15A 2R93B 2N49A 3HP3A 2E2JH 1LABA 4DV5L 4ULLA 1HUMA 4DR1L 1S5DD 3FPPA 3RLNA 4UHVA 2A6HC 1OXUA 2NN6H 1QJOA 4X3UA 3TS0A 2A6HD 1SMYD 2F0HA 1EOVA 4DR4L 1UE7A 5LL6X 3VR5A 1NY4A 3AEVA 5KYLA 3KOJA 1IYVA 3ERQA 3VYRA 3DLLA 5LHY1 5ELFA 5FJ8G 4JVZA 1A3VA 1CT1D 4C3HH 1HR0Q 2K03A 4DR5L 2B2WA 5ELDA 1H9SB 4A3IB 5C4JB 1TWFH 5EKIA 4P75A 3TREA 1XNRQ 1YNXA 5C5LA 1IBKL 1IW7C 4AIMA 1I3QB 4UY8C 1AW7A 3HKZB 4EQOA 2V1CC 1LTLA 1XTDA 3CRKC 4WRDA 5EKLA 3T1HQ 4LFBL 5M5XH 1E22A 2XRSD 1EEID 1PTOF 3CRLC 3EBEA 4A3EG 5C44H 4GN3B 4MNOA 4NKLA 1HCZA 3GQBA 1WYDA 2I5HA 4XT3B 3KJPA 4A3KG 4A3GH 3OIQA 4KKTA 5M9OA 3FP9A 1PXUA 2JA7G 4DV5Q 1K83B 2L5TA 3EROA 3J7ZC 1MIUA 1B1ZA 1K8OA 1MJCA 4DR1Q 3CC7A 2Z6KA 4KY7A 2K04A 4XTCS 3OTOL 4HJ7A 4ALPA 2VUMH 4Y7NB 1QE6A 2NTTA 5C44G 2Q2TA 2EJGC 2D62A 4XYQA 4WFN3 4B3RQ 3L7ZC 2BOSA 3OWFA 1KXLA 1YJNA 4DAYA 1FL0A 1B3AA 4R4OA 2ID0A 3I4NH 3TP8A 1TWGH 2Z4HA 2NBFA 1EQTA 2WKDA 2EYPA 1DYQA 1TS3A 1D5MC 3MWYW 4JBMA 1TXYA 1AE3A 3W1GA 2EYJA 2JYOA 3CC2A 3TSSA 4RWSC 4H44C 1WTHA 1VMPA 3M4OB 2EY1A 2VZAA 3AB9A 2D9UA 1B50A 2CQOA 2PZUA 4UP9A 4F88A 4LUZA 2EPBA 4DV2Q 3ITPA 1R9TB 3CHBD 5LMNL 3GD7A 1XYIA 3PO3G 3T1HL 1NJIC 2F3VA 1PA6A 1PHJA 2OXPA 2D5DA 3GTGB 3GTLB 2VXWA 3SK8A 2NZ1D 3C1EA 3KBXA 1VQIA 2MO1A 4P73A 1NUCA 1SNQA 3WOFA 4BBRH 4OIJA 2HUGA 4A3MB 2ZXOA 3LX0A 3NWTA 5K36G 5EAYA 4FDBA 3W3AA 1FVIA 3OTOQ 1TWAB 2RA4A 3FDTA 4PZ7A 1EIFA 4DF7A 2FMMA 3CXCA 3MFGA 4B3RL 4OEMB 1I4GA 2R7ZB 4CBVA 4FF3A 3H3VI 1TR5A 2LSSA 5FO7B 4A3DH 3X3NA 1H9SA 1LM0A 1SE3A 3NK9A 5I2XA 4LF9L 2F0KA 2KHIA 2KQ3A 2CH4A 4B3MQ 1ZYRC 2F0MA 1PH8A 1E3PA 1LT3D 1UE5A 4L5QA 5C5MA 4KHZA 1M8AA 1AFPA 1G6PA 1VQKA 3M4QA 3BZKA 3OYYA 3KLRA 1JORA 1VQ4A 3A5ZB 4J1MA 3NUCA 1VQAA 3PQIA 5JJKA 2PYKA 4GLVB 4IALA 4KD4A 3WDNA 1ZYRD 3T4AC 4A3JB 2PQEA 1SE8A 2K7VA 4LUOA 3PIPA 1EY5A 1K28A 3S17H 4IUPA 3URYA 4C2MH 5ELNA 2A6ED 1SE4A 4TKOB 3H3VH 1VQHA 3VR2A 1LLRD 3OPOA 3S1MH 1KDCA 2F0DA 1S5FD 1TY0A 2KCMA 2B39A 2F4VL 1VQOA 1TVXA 4L5RC 2MHVA 3HOVH 1H9JA 2PQAA 1D2BA 3K5OA 2DGYA 4DV3Q 1XX8A 1L0YB 2XGTA 2KCTA 3S1RB 5C0XG 2ALYB 1K8AC 5AJ3L 3I4LA 3CU7A 2KHJA 4RFBA 4R4CA 1XMOL 2NVXH 4TQUS 1JICA 5JJIA 1QOHA 1XMQQ 3VR6A 1HH2P 4HMJA 4A3JG 4QY7A 1NNXA 3O13A 1BCPB 2RDGA 5FO9B 2CWAA 1FR3A 3SVMA 4HJ8A 2K33A 3S15H 1IHZA 3KF8B 4YY3Q 2CVRA 4WJWA 1AE2A 1V43A 3UE0A 1EUJA 3NTHA 4OO1H 1SR3A 4AQYQ 3S1QH 1N36Q 1WCMB 1TQOA 4IURA 1ENAA 2A1AA 2JXMB 3B6YA 3J80E 4IN3A 2Y0SE 3KYHC 5CV6A 5C4XB 4BY1H 3D4RA 4NW2A 1SAPA 3Q0AA 3SEBA 2RCNA 1OO9B 2CCZA 4FP5D 1Y8OB 4GKJL 1RKNA 1CTMA 2XSCA 2MQHA 3FRPB 4JI2L 1KD1C 4DV3L 2F0PA 4RGNA 2CW0C 4BY7H 4QIWE 3G48A 2LMCB 2WB1E 4NXMQ 5AJ3Q 2B8GA 1Z7TA 1KTKA 1PRTD 1Y1VG 4A3LG 2JEBI 2EZVA 1VQNA 2AQ3B 3OSOA 1Y1WG 2ZTDA 2A8VA 2NN6G 4ABNA 1FGBD 1LTAD 5EGTA 4BBRB 1QZHA 5IP7G 5GAEC 5D65A 5I6WA 5C3EB 3K7UC 4G4KA 1SYCA 1PTOC 4DAYB 5IP9H 1NR2A 3ONAB 2EVBA 3E6ZX 1AN8A 3T16A 4A3FH 4RHRA 1H9KA 3EFXD 2B2VC 3K7AH 3G71A 1MHWC 2F0JA 1I4XA 5KGUA 4DR7L 1DOMA 1H9MA 3BZDB 2HD3A 4G57A 2QKIC 4ZUJA 3PO3H 4EVOA 1N36L 2BH2A 2L55A 4X66Q 2F3WA 3RLOA 2E2JB 4FXKC 2AWNA 3TDQA 2BCOA 5I4DA 4IUTA 2K01A 3RZDB 1VS0A 3NENA 2JSOA 4C3IG 2KVMA 3RN2A 1DM0B 3RR5A 4I7AA 3GTJB 1IKMA 1K0RA 2UUCL 5KRUA 2E2HH 4LFAL 3OWEB 1PH7A 4YWLA 2D2CC 3U9SA 2L11A 1GO3E 3PUWA 1X56A 3H0GB 4A3JH 2JA7B 1ZKOA 2L9HA 4C2MB 1LV9A 2VB2X 3G4SA 2B2TA 1EEFD 4AYBB 2E8GA 4OELB 3JAMi 3L3OC 1DCZA 4IJLA 1YNNC 2R7ZG 4HN7A 1X3GA 1TWHB 2F0TA 4IJHA 1GKHA 1PFBA 4KKUA 3IL8A 4ZK9B 4OXPA 2YV5A 3CAMA 1Y8PB 4CDDC 3S1NB 2WKCA 1NTGA 1NMGA 4MHEA 2VW9A 5IGEA 1L1OA 2JA6H 5HGQA 5D3DA 4QCLA 2KUMA 2PCFB 5C4HA 5M5XB 4H7BA 1F9RA 3GDEA 3A8JE 2XTIA 5J3BA 1D1KA 5CV5A 1F2MA 3PGZA 2MP1A 2VB3X 4C56C 5FLMH 1W2BA 2PZTA 4PG3A 3NP8A 3KLSA 4N9TA 4B3SQ 4FNFA 4BBSH 1LUZA 2ZJPA 4OX9L 3C1FA 3A55A 1N32L 4LF8Q 3R2IA 2ES2A 3CCLA 1V1PA 4V0BA 1BO0A 4ODGA 4U673 1WD1A 2KA7A 3S17B 2K6AA 1UEBA 1SN8A 2FJ2A 4BA1I 2UUCQ 4GOPA 4LFAQ 4KI0A 4C3IH 3AFQA 2QILA 1XXGA 1X3EA 3T56B 4JOIC 1PFSA 4FO2A 1V1PB 4X3TA 2B2YA 3A54A 1GXDC 2KEEA 1IW7D 2SEBD 4NB3A 3CQZB 1PH2A 2EYHA 4CJ1B 4DUYL 1CFMA 5GAGC 2HHHL 4K5WA 1VF7A 3UI2A 1YNND 4DGZA 4IFDI 1GHJA 3I4OA 2DY8A 4I7ZC 4PQXA 4IQZA 5C44B 2KBNA 2PZWA 3HOYB 5CGKA 1XPOA 2E5LQ 5BN5A 3PMFA 3HOWB 1W6KA 2JE6I 4RCOA 4BS9A 1PH1A 1HNXL 1SNDA 5DNFA 4DNIA 5J22A 2FHTA 5JVG3 5LL6S 1LT6D 1HJPA 3VYTA 1RF2D 2EJFC 1Q7YC 1CZWA 4GOPC 2ZM6L 4K6LA 5FLXc 3HFZB 3D3RA 2XNAC 3OW2A 4OX9Q 2Z6BA 5F2DA 5C3EH 4A3MG 2EIFA 3GTPB 1M4VA 5GQOA 3PV0A 4KMUC 2FFKB 2F0IA 1A8VA 1B44D 2EOTA 4ZCKA 1YVCA 4KJOA 2R92G 3HOUG 5D14A 4PMWA 4C3JH 4BY1G 1SMXA 4U68A 3NBHA 3MFYA 1VMCA 3PO3B 2A19A 2YYZA 3Q23A 2E2IH 4A3BH 2EXDA 3M4OH 5M5YB 1O7ZA 1Q46A 1N34L 3W1BA 1PFMA 4LMQD 1X32A 3S14B 3S2DB 5DM73 2VQEL 2RF4A 2KENA 5CMDA 1S72A 4JI6L 2C9OA 4B3TL 4BXXG 3I70A 2IHFA 1S5CD 1HNZL 2N88A 1IYJB 2WV6D 1SFOB 4QL5A 4L6TB 4HCSA 5J39A 4JG2A 3CCQA 1NCVA 2NWGA 2WAQB 3CKIB 4IUUA 1HNXQ 1T5EA 2NVYB 3MEFA 4QMGA 4PV1C 2F0OA 1TWCB 3U4ZA 1LYLA 5I6YA 2ZTEA 1E24A 4G7OC 3M7GA 3MA2B 4C1NI 4MN3A 3CMAA 2Z0SA 1IBLQ 3NSWA 3TN2A 3V96A 4PZ8A 1I5FA 2ZM6Q 4IUQA 4BA2I 3F2CA 1I6HB 1W6JA 4NPSA 5IGFA 4JBKA 1X54A 1VQ9A 4RAUC 1JQYD 4A76A 3T51B 2RCFA 1UE6A 5M3MB 3STBC 3CCMA 5AFWA 1JE5A 3J80i 4LFCL 2UXDQ 3K59A 3KF6B 2K5WA 1QWYA 2XRQD 1VQGA 1N34Q 3D4DA 5C3EG 4A3MH 1L2FA 4EGVA 3UDGA 3V05A 1YJWA 2I46A 2PNHA 2VQEQ 2G9DA 3BVMA 3JAME 1UEAB 1K8MA 1RTNA 3QOJA 3GTKH 3H09A 1BBUA 4HR7B 3Q6SA 4JCVE 3OIPA 1PYSB 2AKWB 1E0BA 1HZCA 5IYDH 1I4PA 4J8QA 3MEHA 1NMFA 4J15A 4ZAIA 1U9RA 1EY8A 2AWOA 4L8JA 2IY5B 1Y1WH 1JJ2A 2JA6B 1JC7A 5DAUA 1WOCA 3SR1A 2UUAL 3FKIG 3PCOB 1FJGL 2B29A 3ER0A 3PIOA 1V1QA 4JBWA 3UDIA 4HIOA 3A7LA 3S24A 4K8IA 4K2KA 2NVXB 3SDZA 3RN5A 3I4MH 1SNMA 4HMIA 4QGUA 5CC4A 1FNWA 5EPKA 1LO5D 2WB1B 4A93B 2PMZB 1STAA 3TS2A 2JA9A 1Z47A 3VA5A 2EE1A 4G7ZC 4TSSA 2F03A 4LF5L 4LFCQ 3A5UA 2IX3A 1O80A 5C4JH 2KECA 2M9VA 3NHHA 5ELBA 1SNPA 2JJQA 2Q8IB 4C3IB 5HGTA 3GTPH 1V8QA 3AFPA 1CI3M 5JVH3 2EQSA 2HIVA 4BBSG 1A63A 1AZQA 1OTCA 3SK4A 3M85A 2IJ0A 4J6HA 4HSPA 4IPDA 4DU9A 4B9XA 4ZRZA 4HCEA 5KNBA 1V1OA 1SYBA 5DLQE 2FMCA 5CR3A 4B08A 4C3JB 3L2PA 3KDFA 1VQJA 1EIHA 1J5EL 1HZAA 1WTPA 5IYBH 1C4QA 5CORA 3Q24A 1VQ6A 2DUDA 3E9HA 3MXGA 1FJGQ 4R8IA 1PRTF 1JB7A 1EIGA 2R7DA 4JI5Q 3I7FA 1KIXA 2CWPA 5BR8L 1EQRA 2K5VA 3AYHB 1SLJA 1G51A 4N8FA 5JJLA 2MJ8A 1NE3A 1RJTA 4LF7Q 2XVSA 2NB0A 5HURA 2ZJQA 1QZGA 3N6RA 3QB3A 2JA7H 1N9WA 1WI5A 4Y52H 2JP1A 2R92H 4YCUA 3HOUH 1F9SA 4LF5Q 1RL2A 2E74C 2H5XA 5E7NA 4RHSA 2B8FA 2JA8H 3K7AB 3TEHB 1I6HH 2FINB 4POFA 1K0SA 1ONLA 4Z9CB 5EBCA 4FF1A 4JI3Q 4JK1C 2PW5A 3J7A5 3K0YA 2HQLA 1R4QB 4EQ5A 1D1IA 2ICIA 3Q22A 2OTLA 2UXBL 3PUXA 1Q81C 3NEMA 1JB3A 1D7QA 4XDXA 1STBA 1IXRA 1X6OA 5IP7H 5E3FA 4LK1C 2K28A 2A69D 4KY5A 1VQFA 3J7YW 2O5JC 1N33L 3DEOA 1S5ED 2NVYH 2O5IC 1OXSC 5BR8Q 3F2BA 1BF4A 3G6JB 4N9PA 1S40A 1MGSA 2UU9Q 1X65A 4KKSA 2Z6KC 5LMUQ 1CKOA 2VY3A 1D8LA 2DJGC 4BBRG 1JOQA 2M00A 1I94Q 3H15A 5CV4A 4DXFA 4ZQ3A 2R61A 1KLUD 1PZKD 4LJZC 1T9HA 1G291 2B2YC 2EY2A 1PZID 1Y1VB 1CHPD 1RODA 3GV6A 1STYA 3GTJH 3GO5A 4G7HC 4X62Q 4O42A 4X64L 1M1KC 2BA1A 3BS1A 1TS2A 2AHOB 5FLMG 1XNQL 3JAML 1ZEQX 2F1MA 3H0GH 4JI3L 3J7AV 3M7NA 2YTVA 4A93H 4OO1G 3MXNB 3DM1A 5A2QE 1XPUA 2Q2IA 4RGOS 1IL2A 2CKZB 2AUKA 1O78A 3W2DA 1WTQA 3J7AF 4O2DA 4HAEA 4MTNA 1PV4A 3CPWA 3L9AX 1IZ6A 1YHAA 4A3KB 3DMUA 3UE1A 1N33Q 1ILPA 1GD7A 4R9WA 2MPMA 2O4XA 3A8IE 2N8NA 3FEWX 1X55A 3NBHB 1DD2A 4ZYSA 2RQXA 1PYBA 1KRSA 3NBIA 4YHHL 5JPMC 3FKIB 4CDEC 1C48A 3TMEA 2E2IB 4IPCA 2G9HD 3HKZG 4PNYA 5IYBG 1Z6HA 5JEAG 4A3GG 1PZJD 1MI2A 2PO4A 3K0XA 5JAVA 3S16H 3I4MB 3RZOB 4DV1Q 3P75A 3BDOA 2C5CA 1A2TA 2ICEC 5IOCA 2NZHA 2QGQA 2DNCA 5JPNC 4CKEA 4DR4Q 1LACA 1SEBD 1EY6A 3TP6A 3HOXH 3AU7A 1XNQQ 1STNA 2B63G 1KQSA 4IUVA 5DM63 3J81c 2NVTB 4A3IH 1SJHD 1LT4D 1X9NA 3F1ZA 2HIXA 2BA0A 2UXCL 1PVOA 1Q1BA 4C3JG 4LNQA 1BBWA 2I5LX 4YWMA 1K3RA 3CC4A 1I3QH 4NDXA 5IP9G 5ELCA 5FJ8H 2LKVA 1XNRL 2JA5B 3E0EA 1IBKQ 3AQQA 2EYFA 4QJFA 1J8IA 2N3SA 1Q82C 4O0AA 5FLXE 4JI1L 2D0OA 3DEPA 2B2UA 3QR8A 3PIO3 3IRBA 3J81L 1ET6A 4IOCA 2A68C 3CP0A 3NELA 1K83H 4DV0Q 1D6EC 2PQAB 1KL9A 2F0EA 5A2QL 4FF2A 2HCCA 1JE4A 5M5WH 4NXNQ 3K57A 1EFID 2DNEA 1JWMD 3NE5B 2BE5C 3RUZA 1UUPA 1C0AA 1QILA 1W3SA 1B4OA 4K2LA 1EU4A 4V190 2E75C 2F0VA 1E2ZA 2F0SA 4DV1L 3J80L 2PMZE 4EQPA 4YIJA 3GTKB 1LTGD 3HGBA 1PFNA 4POGA 4JBJA 1RTOA 2H4OA 4GNXA 4JI0Q 3BYTB 2JA8B 3M4YA 4A4IA 1I4RA 5E4XA 4LF6L 4X65L 1PTOD 3ULLA 2KEDA 2XWBB 2K14A 4X6AH 5M3FH 4QUFA 4KLKA 1BNZA 2CHBD 1XJVA 1R9TH 5L37A 1NR4A 1Q12A 4IO9A 1B9MA 4XYOA 4GNXB 1PYWD 1XPRA 3A56A 1BQQT 5C0XJ 2E2HB 4DR6Q 2MGSA 2WACA 3T1YL 1E7ZA 1GOZA 4DV2L 4K14A 1A62A 5LMNQ 2BDOA 1NSNS 4DK1A 3U4VA 5M3MG 4ZKCB 2JA8G 1HUNA 3HOWG 5G3LD 4DR3Q 3CCRA 2VUMG 1BKBA 1BCPC 1B2TA 2R93G 1LTRD 4NXNL 1JOKA 1TWAH 2HT1A 1SDFA 4LWCA 1UAPA 3KLWA 4DN4M 1BCPD 3MHBA 2ZXRA 3TBIB 2A74C 4A3KH 1LTBD 5FKAC 1WTVA 2K1BA 1BDOA 3R2TA 2X69A 3OOCA 2RSNA 1S4ZA 1WTXA 4ILWA 4A3EH 2XIWA 1IL8A 3FMCA 5E4WC 5M3MH 1PLFA 3X3MA 5C0XH 2L4NA 4FF4A 1WFQA 1QNUA 1SYEA 1IBMQ 4LF6Q 1A2UA 4LF9Q 1BR9A 1YBYA 2GVAA 2JK8A 1HR0L 4Q0FA 3KJOA 4DR5Q 1E1OA 3F8TA 5JOBA 1QVFA 2A5HA 2DJFC 1FNVA 1GHKA 1CQVA 3H3VC 4H0LC 1E2VA 4C3HB 2GVBA 2OTJA 5IIFA 1FGUA 3CCSA 4A3DG 4NMZA 1KC8C 1K73C 1TWFB 3PUVA 1M90C 3STBD 4GKKQ 2J4XA 3G6EA 1YEZA 1GUSA 1DONA 3D0FA 4HJ9A 2EYOA 3HEJA 2ENBA 3QO2A 1Y1WB 1EY9A 2IT1A 3DWPA 2O2LD 3K81C 2B2VA 1EZ8A 3MZ5A 5NUCA 2BDNA 2L0CA 1ML0D 1F2ZA 3LNNA 4XQJA 4DK3C 3CW2C 3I4MG 1A0IA 1QVCA 2QDBA 1VQCA 3BU2A 5FO8B 1F9QA 3HRZC 1QUQA 1B8AA 2EJMA 2N55A 4IUNA 4ZUIA 3LWUA 2QW7A 3TZDA 4L5TA 1TS4A 2EXZA 4PZ6A 3AMUA 1AH9A 1IBML 1N8RC 5FOBB 4KHPQ 3U9OA 1U4RA 1HTLD 3E3XA 3I91A 4RCNA 5CV7A 5FK9C 3E5SA 4Q5VA 5IT9E 1B3QA 3GV3A 5EQ0A 1WTWA 1MBYA 1TKWB 1GVPA 5CV9A 5H1SE 4CGYB 1WCMH 1SNOA 2OWOA 1EWCA 1U4PA 1EL0A 4GKKL 1H95A 1WTRA 2AMCB 1BVSA 3HOXG 2I5MX 4A3BB 3J81E 1V9PA 4K0KL 3CCEA 1KRTA 4A75A 3HOYH 4H02A 4YWKA 2M2LA 1SYFA 4BY7B 1LTID 2NVQB 4H13C 5IY0A 1XWEA 3NQTA 1YNJD 4GKJQ 2B2TC 1J9OA 2OT2A 1MKHA 1GUNA 4DXGA 3GTQH 2Q2HA 1HQRD 5CV8A 4NXML 3ND8A 3Q8DA 1E1TA 1ENFA 2IX1A 1DXMA 2K75A 4JI7L 2E76C 1YHBA 3V2TA 5EPJA 3VR3A 1B70B 1VQLA 4A3FB 5G3LF 4KHPL 4DNRB 3VYUA 2WINB 1EQQA 3BZCA 3R8BA 4B3ML 3M4PA 1K8GA 1GUGA 1PH6A 1YNJC 4DK0A 2R93H 2YU9H 5M3FG 3UDFA 1L1OB 2Q8TA 1LTTD 4PMBA 4WJ3M 4GN4B 5I9PA 4BXXH 4AYBG 2NN6I 3JAMc 3TQYA 1KLGD 3HZXA 3NXWA 5IYCG 3H0GG 1X3PA 4GZYC 1KAWA 1S3OA 4M8AA 4GLXA 1HZBA 4LUVA 4CKBA 4KTAA 4K0KQ 2KCNA 1STGA 4R1JA 2HQEA 1WCMG 3I73A 3I55A 1CSPA 4F8MA 2VL6A 3S2HH 1KAAA 3I90A 2F4VQ 4KHVA 3VDYA 1SJED 1B7YB 4IPHA 2LFNA 4XQQA 1K3BC 2BH8A 4A3FG 4ZKBB 2G5DA 2RSOA 3OMCA 1CKNA 4P71A 1F2YA 4RG1A 1L0WA 4IOAA 1P8LA 4EQNA 4AH6A 2H1EA 3DWQA 3PO2B 3F2UA 4P72A 5HY6A 1XMOQ 1OXVA 1Y1VH 5IT9L 4JI7Q 2LS01 1X3FA 1XMQL 2Z9HA 4JV5L 3MXUA 2Y0SG 1DOKA 5IYDG 5IODA 1G91A 5E1FA 4BY7G 1MD2D 1PTOB 4I65A 1CHQD 3IKJA 3CCJA 2AUJD 3ICEA 2PI2E 4A3CG 4YY3L 3MXNA 3P1HA 3K8AA 3ULPA 4IFDJ 2XN9C 4CKCA 3G7LA 1KNEA 2QEXA 3S16B 4GN5A 4HSVA 1D5ZC 4AQYL 1GUWA 5IT9c 4DFAA 1B9NA 2VS1A 3KF6A 3QG1A
chains in the Genus database with same CATH topology
4QQBX 5IYCH 1VQDA 1N32Q 4JI3L 1VS0A 3M7NA 2YTVA 4UP8A 3NENA 1PH4A 4A93H 4OO1G 3MXNB 2UXCQ 1XPUA 3U58A 2Q2IA 3KDFB 3RN2A 1IL2A 2CKZB 3RR5A 3A0JA 2NZOA 1EFWA 1K0RA 1Q86C 2UUCL 2E2HH 2R6GA 4LFAL 1HNWQ 4DV7Q 4O2DA 1QVGA 4R4IA 4JI2Q 4MTNA 4IFDG 1PH7A 4YWLA 2LXJA 4LW1A 1GO3E 1PV4A 3PUWA 2WB1G 1X56A 3LGJA 4A3JH 3HKZE 1WJJA 2B63H 4OWXB 3CPWA 4LF4Q 3GTGH 1IZ6A 1YHAA 4JI1Q 3PUZA 3UE1A 3G4SA 4DR2L 2B3GA 1GD7A 1N33Q 1VQ5A 2E8GA 4GS3A 3JAMi 3GTOH 1QUQB 3A74A 2N8NA 1X55A 3NBHB 4DUYQ 4IJLA 2HHHQ 2R7ZG 3BJUA 2IX0A 1PYBA 1X3GA 4YCVA 4JV5Q 4IJHA 1KRSA 1GKHA 4YHHL 4DV0L 4JI4Q 5LMUL 3RNUA 2R7FA 1SROA 4OXPA 2YV5A 3CAMA 3CCVA 4GNXC 2JA6G 4IPCA 4GOPB 3HKZG 3J80c 1UWVA 5IYBG 5JEAG 1I94L 1NTGA 1NMGA 4DUZL 2VW9A 4A3GG 1L1OA 2OQKA 2JA6H 5HGQA 4HJAA 2E5LL 3K0XA 5GAHC 3S16H 4OO1I 4DR7Q 2R7ZH 1EIYB 4DV1Q 3EIVA 1KHIA 3GDEA 2XTIA 5J3BA 2WP8J 3M9BA 4R4QA 2NZHA 3TRZA 2QGQA 3PGZA 5IWAQ 3I2ZA 5FLMH 4DR4Q 2K5NA 1W2BA 3J81i 4PG3A 3PF5A 4B3SQ 4X66L 1YZ6A 2JA5H 3HOXH 4BBSH 2ZTCA 3S1NH 4L5SA 1YHQA 1CKMA 1LUZA 2ZJPA 1KQSA 1ASYA 4OX9L 1XNQQ 2B63G 4JI0L 3J81c 1N32L 4LF8Q 4A3IH 3F2DA 2ES2A 1EYGA 1X9NA 3CCLA 1JJGA 3F1ZA 4X65Q 1JMCA 2HIXA 2BA0A 2UXCL 1PVOA 1P16A 1Q1BA 4UP7A 2IHEA 2L15A 4LNQA 1UEBA 1SN8A 1BBWA 2I5LX 4YWMA 4BA1I 1K3RA 1VQMA 4A3CH 3CC4A 1HR0W 3CPFA 1I3QH 5M5YH 4GOPA 5IP9G 3RZDH 2UUCQ 4LFAQ 1HNWL 4KI0A 2RHSB 3AFQA 4C3IH 3J81j 5FJ8H 1XNRL 1X3EA 1JT8A 2N78A 2NVQH 3E0EA 1IBKQ 3HOZG 3AQQA 4JOIC 1PFSA 4QJFA 4DPGA 3PSIA 1J6QA 1EWIA 2N3SA 3PUYA 4DR6L 4WJ4A 3T1YQ 1Q82C 4O0AA 2MNAA 4HIMA 4JI1L 2D0OA 4OWWB 4NB3A 4LFBQ 4A3LH 2YTYA 1PH2A 3IRBA 1VQ8A 5C0XI 4JC0A 5LMNW 4DUYL 4IOCA 3PO2H 5GAGC 2HHHL 4JI6Q 3CP0A 3NELA 4DR3L 1K83H 4YHHQ 4DV0Q 4JI4L 2PQAB 1KL9A 4IFDI 3I4OA 4GLAC 4HIDA 3SGIA 2N49A 5M5WH 2KBNA 2E2JH 4NXNQ 1C0AA 1TWHH 4DV5L 1XPOA 2E5LQ 1W3SA 2JE6I 1PH1A 1C9OA 4DR1L 1HNXL 3RLNA 1VQEA 1OXUA 4DV1L 2PMZE 4DNIA 3TS0A 4XIGS 3JC66 3W5OA 1HJPA 4DR4L 1EOVA 1IBLL 1UE7A 3S1RH 4B3SL 4POGA 1Q7YC 1NY4A 4GOPC 3AEVA 2ZM6L 5FLXc 3OW2A 3HFZB 4OX9Q 4JBJA 3KOJA 4GNXA 5C3EH 3K80C 2EIFA 4A3MG 4JI0Q 4LF8L 5GQOA 4A4IA 1YJ9A 1CKNB 3PV0A 4JOIA 3DLLA 4LF6L 4X65L 2UUBQ 5FJ8G 1A8VA 1Y14B 3ULLA 1YVCA 2K14A 4X6AH 4C3HH 1HR0Q 5M3FH 2R92G 4DR5L 4KLKA 3HOUG 2WFWA 2K52A 5IE8A 1XJVA 4PMWA 1TWFH 1R9TH 4C3JH 1Q12A 4P75A 4BY1G 3TREA 4IO9A 1C7YA 1YNXA 1XNRQ 4GNXB 1SMXA 3FHWA 1XPRA 1IBKL 4A3IG 2A19A 2UXDL 2YYZA 4AIMA 5C0XJ 2E2IH 4A3BH 2EXDA 3M4OH 4DR6Q 1VQBA 4UY8C 3T1YL 1E7ZA 1Q46A 4DV2L 1N34L 4DK6C 1A62A 1CSQA 5LMNQ 2V1CC 1LTLA 1XTDA 3W1BA 3U4VA 3T1HQ 4APVA 5M3MG 4LFBL 5M5XH 2JA8G 1Z9FA 1E22A 3HOWG 2VQEL 2RF4A 3EBEA 2KENA 4A3EG 1S72A 4JI6L 5C44H 4GN3B 4DR3Q 4B3TL 4BXXG 4MNOA 3CCRA 1WYDA 2I5HA 2VUMG 2IHFA 3HKSA 3UDXA 1YITA 2YTXA 1HNZL 1BKBA 3KFUA 2R93G 1HZ9A 3KJPA 3RLFA 4A3KG 4A3GH 4JI8L 3WWVA 4NXNL 1IYJB 2HT1A 1TWAH 3E9IA 4LWCA 3FP9A 4QL5A 2I0QA 2JA7G 3KLWA 4DV5Q 4JG2A 3ULJA 3CCQA 3J7ZC 1MIUA 1GM5A 4A3KH 1MJCA 4DR1Q 4OONA 3CC7A 3CCUA 2Z6KA 1HNXQ 3MEFA 2K5HA 4XTCS 3OTOL 4HJ7A 3D31A 1U0LA 4ALPA 2VUMH 3U4ZA 1LYLA 3HOYG 2ZTEA 1E24A 2ZJRA 2ATWA 5C44G 2Q2TA 2D62A 4A3EH 1L1OC 3CMAA 2Z0SA 1IBLQ 4UPAA 4B3RQ 2WAQG 3L7ZC 5M3MH 4PZ8A 1I5FA 2ZM6Q 4DV6L 1KXLA 2VNUD 1YJNA 1WFQA 3F2CA 1IBMQ 4BA2I 1FL0A 4R4OA 4NPSA 4LF6Q 4OWTB 2ID0A 1X54A 2UUBL 1TWGH 4JBKA 3I4NH 1VQ9A 4LF9Q 2MFIA 1YBYA 2GVAA 2JK8A 4A76A 4JBMA 1HR0L 4DAMA 3KJOA 4DR5Q 1E1OA 3F8TA 3HOVG 1TXYA 1QVFA 2WAQE 1AE3A 3W1GA 3CC2A 5ELOA 4ME3A 2VZAA 1I50H 1UE6A 3STBC 3CCMA 1JE5A 3J80i 4LFCL 3CMEA 2UXDQ 2OTJA 2GVBA 2JQOA 3KF6B 1VQGA 3CCSA 1FGUA 2CQOA 4UP9A 1KC8C 4A3DG 1K73C 4P74A 4LUZA 4GKKQ 3PUVA 4DV2Q 3STBD 1N34Q 1M90C 5C3EG 4A3MH 3G6EA 5LMNL 1L2FA 1YEZA 3GD7A 3UDGA 1U5KA 3T1HL 3PO3G 3D0FA 1YJWA 2JEAI 5C4XH 4HJ9A 1NJIC 4MZ9A 2PNHA 1PA6A 1PHJA 2VQEQ 4R4TA 4HIKA 1MJEA 4B3TQ 2LXKA 2IT1A 3GTKH 3K81C 3PF4A 1HNZQ 1SRUA 1VQIA 1K9MC 2MO1A 3S14H 4P73A 3S2DH 4JI8Q 5GROA 1BBUA 2GN5A 4JCVE 4DK3C 4BBRH 3RZOH 3CW2C 1PYSB 2AKWB 1HZCA 1A0IA 3CD6A 3I4MG 1QVCA 5K36G 1VQCA 5IYDH 1PH9A 3BU2A 2Q2UA 5EAYA 1NMFA 4FDBA 4J15A 1QUQA 1B8AA 1VCIA 1FVIA 3OTOQ 3EN2A 1YIJA 1SFOH 2IY5B 2AWOA 2K4KA 1Y1WH 1JJ2A 2C35B 4PZ7A 1EIFA 1WOCA 2UUAL 3FKIG 3PCOB 1FJGL 2B29A 3CXCA 4B3RL 4L5TA 4PZ6A 4JI5L 5C4XG 1PH3A 3ER0A 3PIOA 4DV6Q 1V1QA 1AH9A 4JBWA 3UDIA 1TWCH 4HIOA 3H3VI 2LSSA 1IBML 3S24A 4A3DH 1N8RC 4KHPQ 4HJ5A 1LM0A 4LF7L 4LF9L 3DM3A 3RN5A 2KHIA 3I4MH 4QGUA 4B3MQ 3M3YH 3U50C 1PH8A 1E3PA 1UE5A 4L5QA 2QA4A 4KHZA 1G6PA 3TS2A 1VQKA 3M4QA 1GVPA 2JA9A 1OXXK 3BZKA 1Z47A 3OYYA 1NBWA 5H1SE 4LF5L 4LFCQ 1VQ4A 4JYAL 1WCMH 3A5ZB 3A5UA 2OWOA 3I4NG 5C4JH 1VQAA 2PI2A 5JJKA 2JJQA 4GKKL 3GTPH 1H95A 4GLVB 2AMCB 2VQFQ 3AFPA 1BVSA 1OXTA 2EQSA 2HIVA 3HOXG 2JA5G 2I5MX 1SE8A 3PIPA 4LUOA 1V9PA 1OTCA 3S17H 3M85A 4K0KL 3CCEA 1RIPA 4C2MH 5ELNA 3H3VH 1KRTA 4A75A 3HOYH 4H02A 1VQHA 4IPDA 3S1MH 4YWKA 3GTMH 2RHQB 5DLQE 3L2PA 2KCMA 2F4VL 1VQOA 5IY0A 3KDFA 4L5RC 1VQJA 3HOVH 2PQAA 3CF5A 5GADC 1J5EL 2UXBQ 1HZAA 4GKJQ 4DV4L 5IYBH 1UE1A 1MKHA 2DGYA 4DV3Q 3GTQH 2Q2HA 2XGTA 2KCTA 1VQ6A 1A63A 4BBSG 2DUDA 3E9HA 5C0XG 4NXML 2ALYB 1K8AC 2OQ0A 5AJ3L 3Q8DA 2UUAQ 1E1TA 1FJGQ 1VQPA 2IX1A 1JB7A 2KHJA 2R7DA 4JI5Q 4R4CA 2D0PA 1XMOL 3I7FA 2K75A 1KIXA 2NVXH 4TQUS 2CWPA 4JI7L 5BR8L 1YHBA 4EX5A 4IPGA 5JJIA 2K50A 1EQRA 1XMQQ 3CQZH 1B70B 2K5VA 3AYHB 1VQLA 1SLJA 1G51A 1HH2P 4A3BG 4KHPL 5JJLA 4A3JG 2UU9L 1NE3A 4QY7A 4LF7Q 1Q1EA 1O7IA 1EQQA 2ZJQA 3BZCA 4B3ML 3M4PA 4DKAC 1QZGA 1K8GA 1N9WA 2JA7H 1VQ7A 1PH6A 1WI5A 2CWAA 4HJ8A 3S15H 3GTLH 4Y52H 2R93H 2YU9H 3KF8B 5M3FG 2R92H 4YCUA 3UDFA 1L1OB 4YY3Q 3HOUH 1AE2A 1V43A 2F3IA 4WJ3M 4GN4B 4JYAQ 4LF5Q 1RL2A 5E7NA 2H5XA 3UE0A 1EUJA 2NN6I 3ZJYC 3TQYA 4AYBG 3JAMc 4BXXH 4A93G 2OCEA 3HOWH 4X62L 2JA8H 4X64Q 5IYCG 3H0GG 3TEHB 3L0OA 2VQFL 1SR3A 1KAWA 1S3OA 4AQYQ 3S1QH 1YI2A 1N36Q 4GLXA 1I6HH 1HZBA 4POFA 4LUVA 4K0KQ 2A1AA 4R1JA 1WCMG 3B6YA 4JI3Q 3I55A 1CSPA 2Y0SE 2VL6A 3KYHC 3S2HH 3I56A 3J7A5 4BY1H 2CFMA 1CUKA 2HQLA 4EQ5A 2F4VQ 3VDYA 2RCNA 4IPHA 1B7YB 2OTLA 2CCZA 4A3FG 1J5EQ 2UXBL 2BH8A 3PUXA 1Q81C 1PH5A 3NEMA 4GKJL 4DV7L 4DV4Q 1D7QA 2MQHA 1Q8KA 4JI2L 1KD1C 4DV3L 1CKNA 4P71A 4QIWE 4BY7H 4TVAB 4RG1A 1IXRA 1L0WA 1X6OA 3G48A 5IP7H 4IOAA 1P8LA 2WB1E 4NXMQ 4AH6A 4LF4L 5AJ3Q 1VQFA 4DR2Q 1N33L 1Y1VG 2FXQA 3FKIH 4P72A 5HY6A 4A3LG 1XMOQ 2JEBI 2NVYH 1VQNA 1OXVA 1Y1VH 1Y1WG 4JI7Q 1OXSC 2ZTDA 5BR8Q 2A8VA 3F2BA 2NN6G 1X3FA 3ERSX 1XMQL 1S40A 4JV5L 2Y0SG 2UU9Q 1QZHA 1X65A 4RMFA 5IYDG 2Z6KC 5IP7G 5GAEC 1CKOA 2VY3A 5LMUQ 1D8LA 3HOZH 4BY7G 4BBRG 3K7UC 1I94Q 4Y7NH 3H15A 5JEAJ 4DAYB 3CCJA 5IP9H 4DUZQ 3ICEA 1DGSA 2PI2E 4A3FH 4A3CG 1JJCB 2MO0A 4YY3L 1T9HA 1G291 3K7AH 3K8AA 3G71A 3ULPA 4IFDJ 4DR7L 3PO2G 2ASBA 3GTJH 2F52A 3GO5A 4AYBE 2QEXA 4X62Q 2NVTH 4X64L 4GN5A 1ASZA 1M1KC 2BA1A 5IWAL 4AQYL 3PO3H 5IT9c 1N36L 2BH2A 4X66Q 3RLOA 2AHOB 2VS1A 5FLMG 1XNQL 2AWNA 3KF6A 4YCWA 3H0GH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQB X;  5IYC H;  1VQD A;  1N32 Q;  4JI3 L;  1VS0 A;  3M7N A;  2YTV A;  4UP8 A;  3NEN A;  1PH4 A;  4A93 H;  4OO1 G;  3MXN B;  2UXC Q;  1XPU A;  3U58 A;  2Q2I A;  3KDF B;  3RN2 A;  1IL2 A;  2CKZ B;  3RR5 A;  3A0J A;  2NZO A;  1EFW A;  1K0R A;  1Q86 C;  2UUC L;  2E2H H;  2R6G A;  4LFA L;  1HNW Q;  4DV7 Q;  4O2D A;  1QVG A;  4R4I A;  4JI2 Q;  4MTN A;  4IFD G;  1PH7 A;  4YWL A;  2LXJ A;  4LW1 A;  1GO3 E;  1PV4 A;  3PUW A;  2WB1 G;  1X56 A;  3LGJ A;  4A3J H;  3HKZ E;  1WJJ A;  2B63 H;  4OWX B;  3CPW A;  4LF4 Q;  3GTG H;  1IZ6 A;  1YHA A;  4JI1 Q;  3PUZ A;  3UE1 A;  3G4S A;  4DR2 L;  2B3G A;  1GD7 A;  1N33 Q;  1VQ5 A;  2E8G A;  4GS3 A;  3JAM i;  3GTO H;  1QUQ B;  3A74 A;  2N8N A;  1X55 A;  3NBH B;  4DUY Q;  4IJL A;  2HHH Q;  2R7Z G;  3BJU A;  2IX0 A;  1PYB A;  1X3G A;  4YCV A;  4JV5 Q;  4IJH A;  1KRS A;  1GKH A;  4YHH L;  4DV0 L;  4JI4 Q;  5LMU L;  3RNU A;  2R7F A;  1SRO A;  4OXP A;  2YV5 A;  3CAM A;  3CCV A;  4GNX C;  2JA6 G;  4IPC A;  4GOP B;  3HKZ G;  3J80 c;  1UWV A;  5IYB G;  5JEA G;  1I94 L;  1NTG A;  1NMG A;  4DUZ L;  2VW9 A;  4A3G G;  1L1O A;  2OQK A;  2JA6 H;  5HGQ A;  4HJA A;  2E5L L;  3K0X A;  5GAH C;  3S16 H;  4OO1 I;  4DR7 Q;  2R7Z H;  1EIY B;  4DV1 Q;  3EIV A;  1KHI A;  3GDE A;  2XTI A;  5J3B A;  2WP8 J;  3M9B A;  4R4Q A;  2NZH A;  3TRZ A;  2QGQ A;  3PGZ A;  5IWA Q;  3I2Z A;  5FLM H;  4DR4 Q;  2K5N A;  1W2B A;  3J81 i;  4PG3 A;  3PF5 A;  4B3S Q;  4X66 L;  1YZ6 A;  2JA5 H;  3HOX H;  4BBS H;  2ZTC A;  3S1N H;  4L5S A;  1YHQ A;  1CKM A;  1LUZ A;  2ZJP A;  1KQS A;  1ASY A;  4OX9 L;  1XNQ Q;  2B63 G;  4JI0 L;  3J81 c;  1N32 L;  4LF8 Q;  4A3I H;  3F2D A;  2ES2 A;  1EYG A;  1X9N A;  3CCL A;  1JJG A;  3F1Z A;  4X65 Q;  1JMC A;  2HIX A;  2BA0 A;  2UXC L;  1PVO A;  1P16 A;  1Q1B A;  4UP7 A;  2IHE A;  2L15 A;  4LNQ A;  1UEB A;  1SN8 A;  1BBW A;  2I5L X;  4YWM A;  4BA1 I;  1K3R A;  1VQM A;  4A3C H;  3CC4 A;  1HR0 W;  3CPF A;  1I3Q H;  5M5Y H;  4GOP A;  5IP9 G;  3RZD H;  2UUC Q;  4LFA Q;  1HNW L;  4KI0 A;  2RHS B;  3AFQ A;  4C3I H;  3J81 j;  5FJ8 H;  1XNR L;  1X3E A;  1JT8 A;  2N78 A;  2NVQ H;  3E0E A;  1IBK Q;  3HOZ G;  3AQQ A;  4JOI C;  1PFS A;  4QJF A;  4DPG A;  3PSI A;  1J6Q A;  1EWI A;  2N3S A;  3PUY A;  4DR6 L;  4WJ4 A;  3T1Y Q;  1Q82 C;  4O0A A;  2MNA A;  4HIM A;  4JI1 L;  2D0O A;  4OWW B;  4NB3 A;  4LFB Q;  4A3L H;  2YTY A;  1PH2 A;  3IRB A;  1VQ8 A;  5C0X I;  4JC0 A;  5LMN W;  4DUY L;  4IOC A;  3PO2 H;  5GAG C;  2HHH L;  4JI6 Q;  3CP0 A;  3NEL A;  4DR3 L;  1K83 H;  4YHH Q;  4DV0 Q;  4JI4 L;  2PQA B;  1KL9 A;  4IFD I;  3I4O A;  4GLA C;  4HID A;  3SGI A;  2N49 A;  5M5W H;  2KBN A;  2E2J H;  4NXN Q;  1C0A A;  1TWH H;  4DV5 L;  1XPO A;  2E5L Q;  1W3S A;  2JE6 I;  1PH1 A;  1C9O A;  4DR1 L;  1HNX L;  3RLN A;  1VQE A;  1OXU A;  4DV1 L;  2PMZ E;  4DNI A;  3TS0 A;  4XIG S;  3JC6 6;  3W5O A;  1HJP A;  4DR4 L;  1EOV A;  1IBL L;  1UE7 A;  3S1R H;  4B3S L;  4POG A;  1Q7Y C;  1NY4 A;  4GOP C;  3AEV A;  2ZM6 L;  5FLX c;  3OW2 A;  3HFZ B;  4OX9 Q;  4JBJ A;  3KOJ A;  4GNX A;  5C3E H;  3K80 C;  2EIF A;  4A3M G;  4JI0 Q;  4LF8 L;  5GQO A;  4A4I A;  1YJ9 A;  1CKN B;  3PV0 A;  4JOI A;  3DLL A;  4LF6 L;  4X65 L;  2UUB Q;  5FJ8 G;  1A8V A;  1Y14 B;  3ULL A;  1YVC A;  2K14 A;  4X6A H;  4C3H H;  1HR0 Q;  5M3F H;  2R92 G;  4DR5 L;  4KLK A;  3HOU G;  2WFW A;  2K52 A;  5IE8 A;  1XJV A;  4PMW A;  1TWF H;  1R9T H;  4C3J H;  1Q12 A;  4P75 A;  4BY1 G;  3TRE A;  4IO9 A;  1C7Y A;  1YNX A;  1XNR Q;  4GNX B;  1SMX A;  3FHW A;  1XPR A;  1IBK L;  4A3I G;  2A19 A;  2UXD L;  2YYZ A;  4AIM A;  5C0X J;  2E2I H;  4A3B H;  2EXD A;  3M4O H;  4DR6 Q;  1VQB A;  4UY8 C;  3T1Y L;  1E7Z A;  1Q46 A;  4DV2 L;  1N34 L;  4DK6 C;  1A62 A;  1CSQ A;  5LMN Q;  2V1C C;  1LTL A;  1XTD A;  3W1B A;  3U4V A;  3T1H Q;  4APV A;  5M3M G;  4LFB L;  5M5X H;  2JA8 G;  1Z9F A;  1E22 A;  3HOW G;  2VQE L;  2RF4 A;  3EBE A;  2KEN A;  4A3E G;  1S72 A;  4JI6 L;  5C44 H;  4GN3 B;  4DR3 Q;  4B3T L;  4BXX G;  4MNO A;  3CCR A;  1WYD A;  2I5H A;  2VUM G;  2IHF A;  3HKS A;  3UDX A;  1YIT A;  2YTX A;  1HNZ L;  1BKB A;  3KFU A;  2R93 G;  1HZ9 A;  3KJP A;  3RLF A;  4A3K G;  4A3G H;  4JI8 L;  3WWV A;  4NXN L;  1IYJ B;  2HT1 A;  1TWA H;  3E9I A;  4LWC A;  3FP9 A;  4QL5 A;  2I0Q A;  2JA7 G;  3KLW A;  4DV5 Q;  4JG2 A;  3ULJ A;  3CCQ A;  3J7Z C;  1MIU A;  1GM5 A;  4A3K H;  1MJC A;  4DR1 Q;  4OON A;  3CC7 A;  3CCU A;  2Z6K A;  1HNX Q;  3MEF A;  2K5H A;  4XTC S;  3OTO L;  4HJ7 A;  3D31 A;  1U0L A;  4ALP A;  2VUM H;  3U4Z A;  1LYL A;  3HOY G;  2ZTE A;  1E24 A;  2ZJR A;  2ATW A;  5C44 G;  2Q2T A;  2D62 A;  4A3E H;  1L1O C;  3CMA A;  2Z0S A;  1IBL Q;  4UPA A;  4B3R Q;  2WAQ G;  3L7Z C;  5M3M H;  4PZ8 A;  1I5F A;  2ZM6 Q;  4DV6 L;  1KXL A;  2VNU D;  1YJN A;  1WFQ A;  3F2C A;  1IBM Q;  4BA2 I;  1FL0 A;  4R4O A;  4NPS A;  4LF6 Q;  4OWT B;  2ID0 A;  1X54 A;  2UUB L;  1TWG H;  4JBK A;  3I4N H;  1VQ9 A;  4LF9 Q;  2MFI A;  1YBY A;  2GVA A;  2JK8 A;  4A76 A;  4JBM A;  1HR0 L;  4DAM A;  3KJO A;  4DR5 Q;  1E1O A;  3F8T A;  3HOV G;  1TXY A;  1QVF A;  2WAQ E;  1AE3 A;  3W1G A;  3CC2 A;  5ELO A;  4ME3 A;  2VZA A;  1I50 H;  1UE6 A;  3STB C;  3CCM A;  1JE5 A;  3J80 i;  4LFC L;  3CME A;  2UXD Q;  2OTJ A;  2GVB A;  2JQO A;  3KF6 B;  1VQG A;  3CCS A;  1FGU A;  2CQO A;  4UP9 A;  1KC8 C;  4A3D G;  1K73 C;  4P74 A;  4LUZ A;  4GKK Q;  3PUV A;  4DV2 Q;  3STB D;  1N34 Q;  1M90 C;  5C3E G;  4A3M H;  3G6E A;  5LMN L;  1L2F A;  1YEZ A;  3GD7 A;  3UDG A;  1U5K A;  3T1H L;  3PO3 G;  3D0F A;  1YJW A;  2JEA I;  5C4X H;  4HJ9 A;  1NJI C;  4MZ9 A;  2PNH A;  1PA6 A;  1PHJ A;  2VQE Q;  4R4T A;  4HIK A;  1MJE A;  4B3T Q;  2LXK A;  2IT1 A;  3GTK H;  3K81 C;  3PF4 A;  1HNZ Q;  1SRU A;  1VQI A;  1K9M C;  2MO1 A;  3S14 H;  4P73 A;  3S2D H;  4JI8 Q;  5GRO A;  1BBU A;  2GN5 A;  4JCV E;  4DK3 C;  4BBR H;  3RZO H;  3CW2 C;  1PYS B;  2AKW B;  1HZC A;  1A0I A;  3CD6 A;  3I4M G;  1QVC A;  5K36 G;  1VQC A;  5IYD H;  1PH9 A;  3BU2 A;  2Q2U A;  5EAY A;  1NMF A;  4FDB A;  4J15 A;  1QUQ A;  1B8A A;  1VCI A;  1FVI A;  3OTO Q;  3EN2 A;  1YIJ A;  1SFO H;  2IY5 B;  2AWO A;  2K4K A;  1Y1W H;  1JJ2 A;  2C35 B;  4PZ7 A;  1EIF A;  1WOC A;  2UUA L;  3FKI G;  3PCO B;  1FJG L;  2B29 A;  3CXC A;  4B3R L;  4L5T A;  4PZ6 A;  4JI5 L;  5C4X G;  1PH3 A;  3ER0 A;  3PIO A;  4DV6 Q;  1V1Q A;  1AH9 A;  4JBW A;  3UDI A;  1TWC H;  4HIO A;  3H3V I;  2LSS A;  1IBM L;  3S24 A;  4A3D H;  1N8R C;  4KHP Q;  4HJ5 A;  1LM0 A;  4LF7 L;  4LF9 L;  3DM3 A;  3RN5 A;  2KHI A;  3I4M H;  4QGU A;  4B3M Q;  3M3Y H;  3U50 C;  1PH8 A;  1E3P A;  1UE5 A;  4L5Q A;  2QA4 A;  4KHZ A;  1G6P A;  3TS2 A;  1VQK A;  3M4Q A;  1GVP A;  2JA9 A;  1OXX K;  3BZK A;  1Z47 A;  3OYY A;  1NBW A;  5H1S E;  4LF5 L;  4LFC Q;  1VQ4 A;  4JYA L;  1WCM H;  3A5Z B;  3A5U A;  2OWO A;  3I4N G;  5C4J H;  1VQA A;  2PI2 A;  5JJK A;  2JJQ A;  4GKK L;  3GTP H;  1H95 A;  4GLV B;  2AMC B;  2VQF Q;  3AFP A;  1BVS A;  1OXT A;  2EQS A;  2HIV A;  3HOX G;  2JA5 G;  2I5M X;  1SE8 A;  3PIP A;  4LUO A;  1V9P A;  1OTC A;  3S17 H;  3M85 A;  4K0K L;  3CCE A;  1RIP A;  4C2M H;  5ELN A;  3H3V H;  1KRT A;  4A75 A;  3HOY H;  4H02 A;  1VQH A;  4IPD A;  3S1M H;  4YWK A;  3GTM H;  2RHQ B;  5DLQ E;  3L2P A;  2KCM A;  2F4V L;  1VQO A;  5IY0 A;  3KDF A;  4L5R C;  1VQJ A;  3HOV H;  2PQA A;  3CF5 A;  5GAD C;  1J5E L;  2UXB Q;  1HZA A;  4GKJ Q;  4DV4 L;  5IYB H;  1UE1 A;  1MKH A;  2DGY A;  4DV3 Q;  3GTQ H;  2Q2H A;  2XGT A;  2KCT A;  1VQ6 A;  1A63 A;  4BBS G;  2DUD A;  3E9H A;  5C0X G;  4NXM L;  2ALY B;  1K8A C;  2OQ0 A;  5AJ3 L;  3Q8D A;  2UUA Q;  1E1T A;  1FJG Q;  1VQP A;  2IX1 A;  1JB7 A;  2KHJ A;  2R7D A;  4JI5 Q;  4R4C A;  2D0P A;  1XMO L;  3I7F A;  2K75 A;  1KIX A;  2NVX H;  4TQU S;  2CWP A;  4JI7 L;  5BR8 L;  1YHB A;  4EX5 A;  4IPG A;  5JJI A;  2K50 A;  1EQR A;  1XMQ Q;  3CQZ H;  1B70 B;  2K5V A;  3AYH B;  1VQL A;  1SLJ A;  1G51 A;  1HH2 P;  4A3B G;  4KHP L;  5JJL A;  4A3J G;  2UU9 L;  1NE3 A;  4QY7 A;  4LF7 Q;  1Q1E A;  1O7I A;  1EQQ A;  2ZJQ A;  3BZC A;  4B3M L;  3M4P A;  4DKA C;  1QZG A;  1K8G A;  1N9W A;  2JA7 H;  1VQ7 A;  1PH6 A;  1WI5 A;  2CWA A;  4HJ8 A;  3S15 H;  3GTL H;  4Y52 H;  2R93 H;  2YU9 H;  3KF8 B;  5M3F G;  2R92 H;  4YCU A;  3UDF A;  1L1O B;  4YY3 Q;  3HOU H;  1AE2 A;  1V43 A;  2F3I A;  4WJ3 M;  4GN4 B;  4JYA Q;  4LF5 Q;  1RL2 A;  5E7N A;  2H5X A;  3UE0 A;  1EUJ A;  2NN6 I;  3ZJY C;  3TQY A;  4AYB G;  3JAM c;  4BXX H;  4A93 G;  2OCE A;  3HOW H;  4X62 L;  2JA8 H;  4X64 Q;  5IYC G;  3H0G G;  3TEH B;  3L0O A;  2VQF L;  1SR3 A;  1KAW A;  1S3O A;  4AQY Q;  3S1Q H;  1YI2 A;  1N36 Q;  4GLX A;  1I6H H;  1HZB A;  4POF A;  4LUV A;  4K0K Q;  2A1A A;  4R1J A;  1WCM G;  3B6Y A;  4JI3 Q;  3I55 A;  1CSP A;  2Y0S E;  2VL6 A;  3KYH C;  3S2H H;  3I56 A;  3J7A 5;  4BY1 H;  2CFM A;  1CUK A;  2HQL A;  4EQ5 A;  2F4V Q;  3VDY A;  2RCN A;  4IPH A;  1B7Y B;  2OTL A;  2CCZ A;  4A3F G;  1J5E Q;  2UXB L;  2BH8 A;  3PUX A;  1Q81 C;  1PH5 A;  3NEM A;  4GKJ L;  4DV7 L;  4DV4 Q;  1D7Q A;  2MQH A;  1Q8K A;  4JI2 L;  1KD1 C;  4DV3 L;  1CKN A;  4P71 A;  4QIW E;  4BY7 H;  4TVA B;  4RG1 A;  1IXR A;  1L0W A;  1X6O A;  3G48 A;  5IP7 H;  4IOA A;  1P8L A;  2WB1 E;  4NXM Q;  4AH6 A;  4LF4 L;  5AJ3 Q;  1VQF A;  4DR2 Q;  1N33 L;  1Y1V G;  2FXQ A;  3FKI H;  4P72 A;  5HY6 A;  4A3L G;  1XMO Q;  2JEB I;  2NVY H;  1VQN A;  1OXV A;  1Y1V H;  1Y1W G;  4JI7 Q;  1OXS C;  2ZTD A;  5BR8 Q;  2A8V A;  3F2B A;  2NN6 G;  1X3F A;  3ERS X;  1XMQ L;  1S40 A;  4JV5 L;  2Y0S G;  2UU9 Q;  1QZH A;  1X65 A;  4RMF A;  5IYD G;  2Z6K C;  5IP7 G;  5GAE C;  1CKO A;  2VY3 A;  5LMU Q;  1D8L A;  3HOZ H;  4BY7 G;  4BBR G;  3K7U C;  1I94 Q;  4Y7N H;  3H15 A;  5JEA J;  4DAY B;  3CCJ A;  5IP9 H;  4DUZ Q;  3ICE A;  1DGS A;  2PI2 E;  4A3F H;  4A3C G;  1JJC B;  2MO0 A;  4YY3 L;  1T9H A;  1G29 1;  3K7A H;  3K8A A;  3G71 A;  3ULP A;  4IFD J;  4DR7 L;  3PO2 G;  2ASB A;  3GTJ H;  2F52 A;  3GO5 A;  4AYB E;  2QEX A;  4X62 Q;  2NVT H;  4X64 L;  4GN5 A;  1ASZ A;  1M1K C;  2BA1 A;  5IWA L;  4AQY L;  3PO3 H;  5IT9 c;  1N36 L;  2BH2 A;  4X66 Q;  3RLO A;  2AHO B;  2VS1 A;  5FLM G;  1XNQ L;  2AWN A;  3KF6 A;  4YCW A;  3H0G H; 
#chains in the Genus database with same CATH topology
 1UNS A;  3QOL A;  1N32 Q;  3NWS A;  3HOX B;  1PH4 A;  3A8K E;  5CBE E;  3U58 A;  1GUT A;  1HTP A;  1Q3L A;  4K5V A;  2F0N A;  3I4N B;  1TWG B;  4RKB A;  2R6G A;  1HNW Q;  1QCB D;  4R4I A;  4JI2 Q;  1QVG A;  3SHL A;  2CH4 W;  5T1G A;  1A3T A;  4LAA A;  2IL8 A;  1BUV T;  3P7J A;  3HKZ E;  1HFN A;  4KN4 C;  1IKL A;  2B63 H;  4OWX B;  1HA5 A;  2OEO A;  4KK7 A;  3PUZ A;  2BE5 D;  1ENC A;  3I8Z A;  4GS3 A;  3GTO H;  1EY7 A;  5M3F B;  3QWN A;  4DUY Q;  2X6G A;  2DN8 A;  2HHH Q;  3KBG A;  4JV5 Q;  3BYY B;  4RKL A;  4JI4 Q;  2R7F A;  4DAV A;  2QF7 A;  1DOL A;  2F4I A;  1X3Q A;  2XWJ B;  1SYD A;  3CCV A;  4GNX C;  3J80 c;  1UWV A;  1IYU A;  4HJA A;  5M5W B;  2E5L L;  5IGD A;  5GAH C;  5CYU A;  5C3W A;  4DR7 Q;  1EIY B;  3EIV A;  1HRJ A;  2R3Z A;  3M9B A;  4R8N A;  3VA7 A;  3HOU B;  3TRZ A;  2F0U A;  2R92 B;  1I50 B;  2EDG A;  4K5X A;  5IGG A;  3J81 i;  4X66 L;  1YZ6 A;  2JA5 H;  2ZTC A;  4L5S A;  1PDQ A;  1TT2 A;  1SXT A;  2KOL A;  1TS5 A;  1JMC A;  1HPC A;  2EY6 A;  3D8G A;  3BDL A;  1P16 A;  3C3L A;  2IHE A;  2L15 A;  4A3D B;  1MSG A;  4C3H G;  1EQV A;  5M5Y H;  1QNK A;  3RZD H;  1HR0 W;  1JJG A;  2SNM A;  1STE A;  1HNW L;  2RHS B;  3IAY A;  1HQM C;  1ICF B;  3J81 j;  1KNA A;  1Y69 U;  1JT8 A;  2N78 A;  2E2D C;  3EA6 A;  3KK7 A;  2NVQ H;  3HOZ G;  4DPG A;  3PSI A;  5ELE A;  4C1N K;  2ZT9 C;  1J6Q A;  5BN4 A;  4WJ4 A;  3D6W A;  2MNA A;  4OWW B;  1TU2 B;  4FXG C;  3GTQ B;  2YTY A;  1F9P A;  5C0X I;  4WOR A;  3PIP 3;  2PPB C;  4JI6 Q;  5IGB A;  4RGT A;  4JI4 L;  1FYC A;  4HID A;  4GLA C;  5I9O A;  1AP0 A;  2NTS A;  5COY A;  1KAB A;  3S1M B;  1RCV D;  2Z1C A;  4CDC C;  1TWH H;  3SK5 A;  1SYG A;  1BXT A;  1C9O A;  5EBD A;  2X6L A;  4L63 B;  4XT1 B;  1VQE A;  4KV6 A;  2SOB A;  1I4Q A;  2YU9 B;  4XIG S;  2A68 D;  3JC6 6;  3W5O A;  1IBL L;  3S1R H;  4B3S L;  4A3E B;  1WD0 A;  3C2P A;  3EJI A;  3K80 C;  4LF8 L;  3TP5 A;  1YJ9 A;  1CKN B;  1XTC D;  4FXD A;  4JOI A;  2UUB Q;  2KJX A;  1Y14 B;  2RDF A;  3KLS X;  4N8X 1;  1SNC A;  2WFW A;  2K52 A;  2Z8L A;  5EKK A;  5BN3 A;  5IE8 A;  3GTM B;  1II3 A;  3TP7 A;  1C7Y A;  3FHW A;  3DUZ A;  1VF5 C;  4FYD A;  2QCP X;  4HED A;  4A3I G;  2UXD L;  3SXH A;  1VQB A;  3MXP A;  5EPL A;  1S5B D;  2V4D A;  5C6A A;  4DK6 C;  2Z4I A;  4CJ2 C;  1CSQ A;  4APV A;  1Z9F A;  1NAP A;  2KHS A;  1EYD A;  3HOV B;  2F0F A;  3HKS A;  3RMH A;  3UDX A;  1YIT A;  2YTX A;  3KFU A;  1DZ1 A;  3R3O A;  1KDB A;  4MTK A;  1HZ9 A;  3RLF A;  4CHT B;  4JI8 L;  3WWV A;  4KY6 A;  3E9I A;  2I0Q A;  1ET9 A;  3ULJ A;  3D6C A;  1GM5 A;  4OON A;  3CCU A;  2K5H A;  3WOE A;  3D31 A;  1U0L A;  4ME5 A;  1CZG A;  3A7A B;  3HOY G;  2ATW A;  2CQA A;  2ZJR A;  1L1O C;  3H6M A;  4F7X A;  2A73 B;  4UPA A;  3HOZ B;  3S9W A;  2WAQ G;  4OL7 A;  3ZYY X;  4DV6 L;  3FVQ A;  1EU3 A;  1F2L A;  1EY0 A;  1U4L A;  3I72 A;  4OWT B;  2UUB L;  2RBM A;  5ISR A;  1SMY C;  2MFI A;  4DAM A;  1EWH A;  3HOV G;  1I4H A;  2WAQ E;  5ELO A;  2WII B;  4ME3 A;  2F0Q A;  1I50 H;  3MVV A;  4RGM A;  3S1Q B;  3CME A;  2JQO A;  2QEJ C;  4XXE A;  2EY5 A;  4P74 A;  1CK1 A;  3MAQ A;  1H9R A;  2SDF A;  2AQ2 B;  2MUY A;  1U5K A;  3BVG A;  2JEA I;  2IW3 A;  5C4X H;  4DAP A;  4MZ9 A;  1JCK B;  2K5Q A;  1TY2 A;  2L12 A;  3K5L A;  2RKS A;  4QIW B;  2B63 B;  4R4T A;  4HIK A;  1MJE A;  2RDH A;  4M1U B;  2LXK A;  2PW7 A;  3HS0 C;  4B3T Q;  4A3G B;  3R93 A;  3PF4 A;  1HNZ Q;  4K6D A;  1SRU A;  2SNS A;  4CDF C;  1K9M C;  3S14 H;  3S2D H;  4JI8 Q;  5GRO A;  5K36 H;  2GN5 A;  2L1B A;  3KF8 A;  3RZO H;  4FVM A;  3CD6 A;  1I6V C;  3RD4 A;  1PH9 A;  2Q2U A;  4E6I A;  1VCI A;  2HCI A;  3EN2 A;  1YIJ A;  1SFO H;  2RVL A;  2K4K A;  2C35 B;  4S3S A;  3S2H B;  4DNT B;  4JI5 L;  1EYC A;  5C4X G;  1PH3 A;  4DV6 Q;  1TWC H;  1U4M A;  4RA8 A;  4HJ5 A;  2IPK D;  4XQN A;  4LF7 L;  4F87 A;  3DM3 A;  2TMP A;  5KIX A;  2CW0 D;  3M3Y H;  4B9W A;  1O7Y A;  3U50 C;  2QA4 A;  1FD7 D;  1A3U A;  2NUC A;  1OXX K;  5C3X A;  2OF1 A;  1NBW A;  1PRT C;  1D5X C;  4JYA L;  2K5D A;  3I4N G;  2PI2 A;  5I2Y A;  2IWH A;  4OHJ A;  2VQF Q;  1BOS A;  1ILQ A;  1JR0 D;  1OXT A;  1HFG A;  1RD9 D;  1Y8N B;  2ZXP A;  3NTI A;  3TZU A;  1MSH A;  2JA5 G;  1PTO H;  1AEX A;  1RIP A;  3K6O A;  2HDM A;  3GTM H;  2RHQ B;  1SE2 A;  3NTK A;  3H91 A;  3I3C A;  1HHV A;  3CF5 A;  1BCP F;  4MIU A;  5GAD C;  2UXB Q;  3NQI A;  2B2U C;  1FNU A;  1CA6 A;  5JEA H;  4DV4 L;  1UE1 A;  3OHX C;  3QIA A;  2OQ0 A;  3SE0 A;  2UUA Q;  4OIK A;  1VQP A;  2D0P A;  2EYL A;  4UDU C;  4EX5 A;  2J0T D;  4IPG A;  2K50 A;  3N52 A;  3CQZ H;  2PNR C;  1E2W A;  4A3B G;  4K8J A;  2UU9 L;  3SK6 A;  3QJY A;  5JJZ A;  1Q1E A;  1O7I A;  1JWS D;  4DKA C;  1VQ7 A;  1ESR A;  3GTL H;  4QUC A;  1R4P B;  1CM9 A;  1Q8I A;  3DWA A;  2F3I A;  4JYA Q;  2VNU D;  3ZJY C;  2K05 A;  3BG3 A;  5J1Z A;  4A93 G;  2OCE A;  3HOW H;  4X62 L;  4KN7 C;  4X64 Q;  3L0O A;  2VQF L;  1EOT A;  1YI2 A;  1STH A;  1EY4 A;  1T5X D;  1PMR A;  4ID6 A;  3MTS A;  1EYA A;  1SSO A;  3I56 A;  4JW0 A;  2CFM A;  1C8C A;  2JN4 A;  1CUK A;  1F77 A;  3OMG A;  5FLX L;  1DJR D;  2A6E C;  1J5E Q;  1PH5 A;  1Q90 A;  4DV7 L;  1JWU D;  4DV4 Q;  1Q8K A;  1G6Z A;  4HTH A;  1LT5 D;  4TVA B;  5TSS A;  2EYM A;  3VYS A;  1ICW A;  3ND9 A;  4DA2 A;  4LF4 L;  3DHQ A;  3P20 A;  2NYZ D;  5CBA E;  3HG9 A;  4DR2 Q;  1PRT B;  4P2C B;  2FXQ A;  3FKI H;  1VDZ A;  3ERS X;  2F0G A;  1SBB B;  3GTO B;  3D4W A;  4RMF A;  1JOO A;  5T1I A;  3HOZ H;  3K58 A;  2Y0S B;  3EVQ A;  3IFT A;  4Y7N H;  1BBX C;  5JEA J;  4DUZ Q;  1DGS A;  1QB5 D;  1JJC B;  2MO0 A;  3K5M A;  3BVZ A;  3MC0 B;  3PO2 G;  2ASB A;  2F52 A;  4AYB E;  2NVT H;  2DY7 A;  5A35 A;  1L0X B;  1WTO A;  1ASZ A;  5IWA L;  2KCC A;  4ZLT F;  1QG7 A;  1CA5 A;  1CQF A;  3I2Z A;  2HDL A;  4YCW A;  2J7Z A;  5IYC H;  1VQD A;  3M3Y B;  4QQB X;  4UP8 A;  2UXC Q;  3KDF B;  3A0J A;  2NZO A;  1EFW A;  1Q86 C;  4TRD A;  3LWE A;  4BWG B;  1AZP A;  2TSS A;  4DV7 Q;  1GJX A;  3H94 A;  4IFD G;  2LXJ A;  4LW1 A;  2WB1 G;  3LGJ A;  1WJJ A;  5IGC A;  1RDP D;  4LF4 Q;  3GTG H;  3S15 B;  4JI1 Q;  4DR2 L;  2B3G A;  3OW7 A;  1VQ5 A;  5C4Z A;  5KYI A;  1RHP A;  2VUM B;  5DEH A;  1QUQ B;  3A74 A;  4KJN A;  3BJU A;  2IX0 A;  4YCV A;  2Q8R E;  1G8Z D;  3BDC A;  2P5Z X;  4DV0 L;  4X3K A;  5LMU L;  3RNU A;  2GA4 B;  1SRO A;  2JA6 G;  4GOP B;  4IFD H;  4OGQ C;  3T53 B;  1I94 L;  4QB4 A;  4DUZ L;  2QDL A;  2OQK A;  1EZ6 A;  3FPU B;  3VR4 A;  5D3I B;  4BY1 B;  1ZXT A;  4OO1 I;  2R7Z H;  5K5P A;  1KHI A;  3K5N A;  1HXY D;  2WP8 J;  4R4Q A;  1LTS D;  1O7L A;  5IWA Q;  4IZ8 A;  2K5N A;  4PMC A;  3PF5 A;  2AQ1 B;  4JPB W;  3S1N H;  1YHQ A;  1CKM A;  2F0W A;  4RH6 A;  1ASY A;  4CJ0 B;  4JI0 L;  1GUO A;  3F2D A;  3E0J A;  1EYG A;  2LY7 A;  4QF4 A;  4X65 Q;  2A69 C;  4UP7 A;  1VQM A;  4A3C H;  1KDA A;  5KEE A;  3CPF A;  3DXJ C;  4KD3 A;  5EJW A;  3C46 A;  4BBS B;  1HA6 A;  1G2S A;  2K32 A;  3NPP A;  3EQL C;  1EWI A;  3T13 A;  3PUY A;  4DR6 L;  1A6X A;  3T1Y Q;  3GP7 A;  4UAI A;  3KUP A;  4HIM A;  4O1N A;  2B2W C;  1TII D;  2I07 B;  4LFB Q;  4A3L H;  1G2T A;  1WVL A;  1VQ8 A;  2F0L A;  4JC0 A;  4NP5 A;  5LMN W;  1B53 A;  3PO2 H;  3IFD A;  4DR3 L;  5KND A;  1ESF A;  4YHH Q;  5KNC A;  4X3S A;  3SGI A;  1A15 A;  2R93 B;  2N49 A;  3HP3 A;  2E2J H;  1LAB A;  4DV5 L;  4ULL A;  1HUM A;  4DR1 L;  1S5D D;  3FPP A;  3RLN A;  4UHV A;  2A6H C;  1OXU A;  2NN6 H;  1QJO A;  4X3U A;  3TS0 A;  2A6H D;  1SMY D;  2F0H A;  1EOV A;  4DR4 L;  1UE7 A;  5LL6 X;  3VR5 A;  1NY4 A;  3AEV A;  5KYL A;  3KOJ A;  1IYV A;  3ERQ A;  3VYR A;  3DLL A;  5LHY 1;  5ELF A;  5FJ8 G;  4JVZ A;  1A3V A;  1CT1 D;  4C3H H;  1HR0 Q;  2K03 A;  4DR5 L;  2B2W A;  5ELD A;  1H9S B;  4A3I B;  5C4J B;  1TWF H;  5EKI A;  4P75 A;  3TRE A;  1XNR Q;  1YNX A;  5C5L A;  1IBK L;  1IW7 C;  4AIM A;  1I3Q B;  4UY8 C;  1AW7 A;  3HKZ B;  4EQO A;  2V1C C;  1LTL A;  1XTD A;  3CRK C;  4WRD A;  5EKL A;  3T1H Q;  4LFB L;  5M5X H;  1E22 A;  2XRS D;  1EEI D;  1PTO F;  3CRL C;  3EBE A;  4A3E G;  5C44 H;  4GN3 B;  4MNO A;  4NKL A;  1HCZ A;  3GQB A;  1WYD A;  2I5H A;  4XT3 B;  3KJP A;  4A3K G;  4A3G H;  3OIQ A;  4KKT A;  5M9O A;  3FP9 A;  1PXU A;  2JA7 G;  4DV5 Q;  1K83 B;  2L5T A;  3ERO A;  3J7Z C;  1MIU A;  1B1Z A;  1K8O A;  1MJC A;  4DR1 Q;  3CC7 A;  2Z6K A;  4KY7 A;  2K04 A;  4XTC S;  3OTO L;  4HJ7 A;  4ALP A;  2VUM H;  4Y7N B;  1QE6 A;  2NTT A;  5C44 G;  2Q2T A;  2EJG C;  2D62 A;  4XYQ A;  4WFN 3;  4B3R Q;  3L7Z C;  2BOS A;  3OWF A;  1KXL A;  1YJN A;  4DAY A;  1FL0 A;  1B3A A;  4R4O A;  2ID0 A;  3I4N H;  3TP8 A;  1TWG H;  2Z4H A;  2NBF A;  1EQT A;  2WKD A;  2EYP A;  1DYQ A;  1TS3 A;  1D5M C;  3MWY W;  4JBM A;  1TXY A;  1AE3 A;  3W1G A;  2EYJ A;  2JYO A;  3CC2 A;  3TSS A;  4RWS C;  4H44 C;  1WTH A;  1VMP A;  3M4O B;  2EY1 A;  2VZA A;  3AB9 A;  2D9U A;  1B50 A;  2CQO A;  2PZU A;  4UP9 A;  4F88 A;  4LUZ A;  2EPB A;  4DV2 Q;  3ITP A;  1R9T B;  3CHB D;  5LMN L;  3GD7 A;  1XYI A;  3PO3 G;  3T1H L;  1NJI C;  2F3V A;  1PA6 A;  1PHJ A;  2OXP A;  2D5D A;  3GTG B;  3GTL B;  2VXW A;  3SK8 A;  2NZ1 D;  3C1E A;  3KBX A;  1VQI A;  2MO1 A;  4P73 A;  1NUC A;  1SNQ A;  3WOF A;  4BBR H;  4OIJ A;  2HUG A;  4A3M B;  2ZXO A;  3LX0 A;  3NWT A;  5K36 G;  5EAY A;  4FDB A;  3W3A A;  1FVI A;  3OTO Q;  1TWA B;  2RA4 A;  3FDT A;  4PZ7 A;  1EIF A;  4DF7 A;  2FMM A;  3CXC A;  3MFG A;  4B3R L;  4OEM B;  1I4G A;  2R7Z B;  4CBV A;  4FF3 A;  3H3V I;  1TR5 A;  2LSS A;  5FO7 B;  4A3D H;  3X3N A;  1H9S A;  1LM0 A;  1SE3 A;  3NK9 A;  5I2X A;  4LF9 L;  2F0K A;  2KHI A;  2KQ3 A;  2CH4 A;  4B3M Q;  1ZYR C;  2F0M A;  1PH8 A;  1E3P A;  1LT3 D;  1UE5 A;  4L5Q A;  5C5M A;  4KHZ A;  1M8A A;  1AFP A;  1G6P A;  1VQK A;  3M4Q A;  3BZK A;  3OYY A;  3KLR A;  1JOR A;  1VQ4 A;  3A5Z B;  4J1M A;  3NUC A;  1VQA A;  3PQI A;  5JJK A;  2PYK A;  4GLV B;  4IAL A;  4KD4 A;  3WDN A;  1ZYR D;  3T4A C;  4A3J B;  2PQE A;  1SE8 A;  2K7V A;  4LUO A;  3PIP A;  1EY5 A;  1K28 A;  3S17 H;  4IUP A;  3URY A;  4C2M H;  5ELN A;  2A6E D;  1SE4 A;  4TKO B;  3H3V H;  1VQH A;  3VR2 A;  1LLR D;  3OPO A;  3S1M H;  1KDC A;  2F0D A;  1S5F D;  1TY0 A;  2KCM A;  2B39 A;  2F4V L;  1VQO A;  1TVX A;  4L5R C;  2MHV A;  3HOV H;  1H9J A;  2PQA A;  1D2B A;  3K5O A;  2DGY A;  4DV3 Q;  1XX8 A;  1L0Y B;  2XGT A;  2KCT A;  3S1R B;  5C0X G;  2ALY B;  1K8A C;  5AJ3 L;  3I4L A;  3CU7 A;  2KHJ A;  4RFB A;  4R4C A;  1XMO L;  2NVX H;  4TQU S;  1JIC A;  5JJI A;  1QOH A;  1XMQ Q;  3VR6 A;  1HH2 P;  4HMJ A;  4A3J G;  4QY7 A;  1NNX A;  3O13 A;  1BCP B;  2RDG A;  5FO9 B;  2CWA A;  1FR3 A;  3SVM A;  4HJ8 A;  2K33 A;  3S15 H;  1IHZ A;  3KF8 B;  4YY3 Q;  2CVR A;  4WJW A;  1AE2 A;  1V43 A;  3UE0 A;  1EUJ A;  3NTH A;  4OO1 H;  1SR3 A;  4AQY Q;  3S1Q H;  1N36 Q;  1WCM B;  1TQO A;  4IUR A;  1ENA A;  2A1A A;  2JXM B;  3B6Y A;  3J80 E;  4IN3 A;  2Y0S E;  3KYH C;  5CV6 A;  5C4X B;  4BY1 H;  3D4R A;  4NW2 A;  1SAP A;  3Q0A A;  3SEB A;  2RCN A;  1OO9 B;  2CCZ A;  4FP5 D;  1Y8O B;  4GKJ L;  1RKN A;  1CTM A;  2XSC A;  2MQH A;  3FRP B;  4JI2 L;  1KD1 C;  4DV3 L;  2F0P A;  4RGN A;  2CW0 C;  4BY7 H;  4QIW E;  3G48 A;  2LMC B;  2WB1 E;  4NXM Q;  5AJ3 Q;  2B8G A;  1Z7T A;  1KTK A;  1PRT D;  1Y1V G;  4A3L G;  2JEB I;  2EZV A;  1VQN A;  2AQ3 B;  3OSO A;  1Y1W G;  2ZTD A;  2A8V A;  2NN6 G;  4ABN A;  1FGB D;  1LTA D;  5EGT A;  4BBR B;  1QZH A;  5IP7 G;  5GAE C;  5D65 A;  5I6W A;  5C3E B;  3K7U C;  4G4K A;  1SYC A;  1PTO C;  4DAY B;  5IP9 H;  1NR2 A;  3ONA B;  2EVB A;  3E6Z X;  1AN8 A;  3T16 A;  4A3F H;  4RHR A;  1H9K A;  3EFX D;  2B2V C;  3K7A H;  3G71 A;  1MHW C;  2F0J A;  1I4X A;  5KGU A;  4DR7 L;  1DOM A;  1H9M A;  3BZD B;  2HD3 A;  4G57 A;  2QKI C;  4ZUJ A;  3PO3 H;  4EVO A;  1N36 L;  2BH2 A;  2L55 A;  4X66 Q;  2F3W A;  3RLO A;  2E2J B;  4FXK C;  2AWN A;  3TDQ A;  2BCO A;  5I4D A;  4IUT A;  2K01 A;  3RZD B;  1VS0 A;  3NEN A;  2JSO A;  4C3I G;  2KVM A;  3RN2 A;  1DM0 B;  3RR5 A;  4I7A A;  3GTJ B;  1IKM A;  1K0R A;  2UUC L;  5KRU A;  2E2H H;  4LFA L;  3OWE B;  1PH7 A;  4YWL A;  2D2C C;  3U9S A;  2L11 A;  1GO3 E;  3PUW A;  1X56 A;  3H0G B;  4A3J H;  2JA7 B;  1ZKO A;  2L9H A;  4C2M B;  1LV9 A;  2VB2 X;  3G4S A;  2B2T A;  1EEF D;  4AYB B;  2E8G A;  4OEL B;  3JAM i;  3L3O C;  1DCZ A;  4IJL A;  1YNN C;  2R7Z G;  4HN7 A;  1X3G A;  1TWH B;  2F0T A;  4IJH A;  1GKH A;  1PFB A;  4KKU A;  3IL8 A;  4ZK9 B;  4OXP A;  2YV5 A;  3CAM A;  1Y8P B;  4CDD C;  3S1N B;  2WKC A;  1NTG A;  1NMG A;  4MHE A;  2VW9 A;  5IGE A;  1L1O A;  2JA6 H;  5HGQ A;  5D3D A;  4QCL A;  2KUM A;  2PCF B;  5C4H A;  5M5X B;  4H7B A;  1F9R A;  3GDE A;  3A8J E;  2XTI A;  5J3B A;  1D1K A;  5CV5 A;  1F2M A;  3PGZ A;  2MP1 A;  2VB3 X;  4C56 C;  5FLM H;  1W2B A;  2PZT A;  4PG3 A;  3NP8 A;  3KLS A;  4N9T A;  4B3S Q;  4FNF A;  4BBS H;  1LUZ A;  2ZJP A;  4OX9 L;  3C1F A;  3A55 A;  1N32 L;  4LF8 Q;  3R2I A;  2ES2 A;  3CCL A;  1V1P A;  4V0B A;  1BO0 A;  4ODG A;  4U67 3;  1WD1 A;  2KA7 A;  3S17 B;  2K6A A;  1UEB A;  1SN8 A;  2FJ2 A;  4BA1 I;  2UUC Q;  4GOP A;  4LFA Q;  4KI0 A;  4C3I H;  3AFQ A;  2QIL A;  1XXG A;  1X3E A;  3T56 B;  4JOI C;  1PFS A;  4FO2 A;  1V1P B;  4X3T A;  2B2Y A;  3A54 A;  1GXD C;  2KEE A;  1IW7 D;  2SEB D;  4NB3 A;  3CQZ B;  1PH2 A;  2EYH A;  4CJ1 B;  4DUY L;  1CFM A;  5GAG C;  2HHH L;  4K5W A;  1VF7 A;  3UI2 A;  1YNN D;  4DGZ A;  4IFD I;  1GHJ A;  3I4O A;  2DY8 A;  4I7Z C;  4PQX A;  4IQZ A;  5C44 B;  2KBN A;  2PZW A;  3HOY B;  5CGK A;  1XPO A;  2E5L Q;  5BN5 A;  3PMF A;  3HOW B;  1W6K A;  2JE6 I;  4RCO A;  4BS9 A;  1PH1 A;  1HNX L;  1SND A;  5DNF A;  4DNI A;  5J22 A;  2FHT A;  5JVG 3;  5LL6 S;  1LT6 D;  1HJP A;  3VYT A;  1RF2 D;  2EJF C;  1Q7Y C;  1CZW A;  4GOP C;  2ZM6 L;  4K6L A;  5FLX c;  3HFZ B;  3D3R A;  2XNA C;  3OW2 A;  4OX9 Q;  2Z6B A;  5F2D A;  5C3E H;  4A3M G;  2EIF A;  3GTP B;  1M4V A;  5GQO A;  3PV0 A;  4KMU C;  2FFK B;  2F0I A;  1A8V A;  1B44 D;  2EOT A;  4ZCK A;  1YVC A;  4KJO A;  2R92 G;  3HOU G;  5D14 A;  4PMW A;  4C3J H;  4BY1 G;  1SMX A;  4U68 A;  3NBH A;  3MFY A;  1VMC A;  3PO3 B;  2A19 A;  2YYZ A;  3Q23 A;  2E2I H;  4A3B H;  2EXD A;  3M4O H;  5M5Y B;  1O7Z A;  1Q46 A;  1N34 L;  3W1B A;  1PFM A;  4LMQ D;  1X32 A;  3S14 B;  3S2D B;  5DM7 3;  2VQE L;  2RF4 A;  2KEN A;  5CMD A;  1S72 A;  4JI6 L;  2C9O A;  4B3T L;  4BXX G;  3I70 A;  2IHF A;  1S5C D;  1HNZ L;  2N88 A;  1IYJ B;  2WV6 D;  1SFO B;  4QL5 A;  4L6T B;  4HCS A;  5J39 A;  4JG2 A;  3CCQ A;  1NCV A;  2NWG A;  2WAQ B;  3CKI B;  4IUU A;  1HNX Q;  1T5E A;  2NVY B;  3MEF A;  4QMG A;  4PV1 C;  2F0O A;  1TWC B;  3U4Z A;  1LYL A;  5I6Y A;  2ZTE A;  1E24 A;  4G7O C;  3M7G A;  3MA2 B;  4C1N I;  4MN3 A;  3CMA A;  2Z0S A;  1IBL Q;  3NSW A;  3TN2 A;  3V96 A;  4PZ8 A;  1I5F A;  2ZM6 Q;  4IUQ A;  4BA2 I;  3F2C A;  1I6H B;  1W6J A;  4NPS A;  5IGF A;  4JBK A;  1X54 A;  1VQ9 A;  4RAU C;  1JQY D;  4A76 A;  3T51 B;  2RCF A;  1UE6 A;  5M3M B;  3STB C;  3CCM A;  5AFW A;  1JE5 A;  3J80 i;  4LFC L;  2UXD Q;  3K59 A;  3KF6 B;  2K5W A;  1QWY A;  2XRQ D;  1VQG A;  1N34 Q;  3D4D A;  5C3E G;  4A3M H;  1L2F A;  4EGV A;  3UDG A;  3V05 A;  1YJW A;  2I46 A;  2PNH A;  2VQE Q;  2G9D A;  3BVM A;  3JAM E;  1UEA B;  1K8M A;  1RTN A;  3QOJ A;  3GTK H;  3H09 A;  1BBU A;  4HR7 B;  3Q6S A;  4JCV E;  3OIP A;  1PYS B;  2AKW B;  1E0B A;  1HZC A;  5IYD H;  1I4P A;  4J8Q A;  3MEH A;  1NMF A;  4J15 A;  4ZAI A;  1U9R A;  1EY8 A;  2AWO A;  4L8J A;  2IY5 B;  1Y1W H;  1JJ2 A;  2JA6 B;  1JC7 A;  5DAU A;  1WOC A;  3SR1 A;  2UUA L;  3FKI G;  3PCO B;  1FJG L;  2B29 A;  3ER0 A;  3PIO A;  1V1Q A;  4JBW A;  3UDI A;  4HIO A;  3A7L A;  3S24 A;  4K8I A;  4K2K A;  2NVX B;  3SDZ A;  3RN5 A;  3I4M H;  1SNM A;  4HMI A;  4QGU A;  5CC4 A;  1FNW A;  5EPK A;  1LO5 D;  2WB1 B;  4A93 B;  2PMZ B;  1STA A;  3TS2 A;  2JA9 A;  1Z47 A;  3VA5 A;  2EE1 A;  4G7Z C;  4TSS A;  2F03 A;  4LF5 L;  4LFC Q;  3A5U A;  2IX3 A;  1O80 A;  5C4J H;  2KEC A;  2M9V A;  3NHH A;  5ELB A;  1SNP A;  2JJQ A;  2Q8I B;  4C3I B;  5HGT A;  3GTP H;  1V8Q A;  3AFP A;  1CI3 M;  5JVH 3;  2EQS A;  2HIV A;  4BBS G;  1A63 A;  1AZQ A;  1OTC A;  3SK4 A;  3M85 A;  2IJ0 A;  4J6H A;  4HSP A;  4IPD A;  4DU9 A;  4B9X A;  4ZRZ A;  4HCE A;  5KNB A;  1V1O A;  1SYB A;  5DLQ E;  2FMC A;  5CR3 A;  4B08 A;  4C3J B;  3L2P A;  3KDF A;  1VQJ A;  1EIH A;  1J5E L;  1HZA A;  1WTP A;  5IYB H;  1C4Q A;  5COR A;  3Q24 A;  1VQ6 A;  2DUD A;  3E9H A;  3MXG A;  1FJG Q;  4R8I A;  1PRT F;  1JB7 A;  1EIG A;  2R7D A;  4JI5 Q;  3I7F A;  1KIX A;  2CWP A;  5BR8 L;  1EQR A;  2K5V A;  3AYH B;  1SLJ A;  1G51 A;  4N8F A;  5JJL A;  2MJ8 A;  1NE3 A;  1RJT A;  4LF7 Q;  2XVS A;  2NB0 A;  5HUR A;  2ZJQ A;  1QZG A;  3N6R A;  3QB3 A;  2JA7 H;  1N9W A;  1WI5 A;  4Y52 H;  2JP1 A;  2R92 H;  4YCU A;  3HOU H;  1F9S A;  4LF5 Q;  1RL2 A;  2E74 C;  2H5X A;  5E7N A;  4RHS A;  2B8F A;  2JA8 H;  3K7A B;  3TEH B;  1I6H H;  2FIN B;  4POF A;  1K0S A;  1ONL A;  4Z9C B;  5EBC A;  4FF1 A;  4JI3 Q;  4JK1 C;  2PW5 A;  3J7A 5;  3K0Y A;  2HQL A;  1R4Q B;  4EQ5 A;  1D1I A;  2ICI A;  3Q22 A;  2OTL A;  2UXB L;  3PUX A;  1Q81 C;  3NEM A;  1JB3 A;  1D7Q A;  4XDX A;  1STB A;  1IXR A;  1X6O A;  5IP7 H;  5E3F A;  4LK1 C;  2K28 A;  2A69 D;  4KY5 A;  1VQF A;  3J7Y W;  2O5J C;  1N33 L;  3DEO A;  1S5E D;  2NVY H;  2O5I C;  1OXS C;  5BR8 Q;  3F2B A;  1BF4 A;  3G6J B;  4N9P A;  1S40 A;  1MGS A;  2UU9 Q;  1X65 A;  4KKS A;  2Z6K C;  5LMU Q;  1CKO A;  2VY3 A;  1D8L A;  2DJG C;  4BBR G;  1JOQ A;  2M00 A;  1I94 Q;  3H15 A;  5CV4 A;  4DXF A;  4ZQ3 A;  2R61 A;  1KLU D;  1PZK D;  4LJZ C;  1T9H A;  1G29 1;  2B2Y C;  2EY2 A;  1PZI D;  1Y1V B;  1CHP D;  1ROD A;  3GV6 A;  1STY A;  3GTJ H;  3GO5 A;  4G7H C;  4X62 Q;  4O42 A;  4X64 L;  1M1K C;  2BA1 A;  3BS1 A;  1TS2 A;  2AHO B;  5FLM G;  1XNQ L;  3JAM L;  1ZEQ X;  2F1M A;  3H0G H;  4JI3 L;  3J7A V;  3M7N A;  2YTV A;  4A93 H;  4OO1 G;  3MXN B;  3DM1 A;  5A2Q E;  1XPU A;  2Q2I A;  4RGO S;  1IL2 A;  2CKZ B;  2AUK A;  1O78 A;  3W2D A;  1WTQ A;  3J7A F;  4O2D A;  4HAE A;  4MTN A;  1PV4 A;  3CPW A;  3L9A X;  1IZ6 A;  1YHA A;  4A3K B;  3DMU A;  3UE1 A;  1N33 Q;  1ILP A;  1GD7 A;  4R9W A;  2MPM A;  2O4X A;  3A8I E;  2N8N A;  3FEW X;  1X55 A;  3NBH B;  1DD2 A;  4ZYS A;  2RQX A;  1PYB A;  1KRS A;  3NBI A;  4YHH L;  5JPM C;  3FKI B;  4CDE C;  1C48 A;  3TME A;  2E2I B;  4IPC A;  2G9H D;  3HKZ G;  4PNY A;  5IYB G;  1Z6H A;  5JEA G;  4A3G G;  1PZJ D;  1MI2 A;  2PO4 A;  3K0X A;  5JAV A;  3S16 H;  3I4M B;  3RZO B;  4DV1 Q;  3P75 A;  3BDO A;  2C5C A;  1A2T A;  2ICE C;  5IOC A;  2NZH A;  2QGQ A;  2DNC A;  5JPN C;  4CKE A;  4DR4 Q;  1LAC A;  1SEB D;  1EY6 A;  3TP6 A;  3HOX H;  3AU7 A;  1XNQ Q;  1STN A;  2B63 G;  1KQS A;  4IUV A;  5DM6 3;  3J81 c;  2NVT B;  4A3I H;  1SJH D;  1LT4 D;  1X9N A;  3F1Z A;  2HIX A;  2BA0 A;  2UXC L;  1PVO A;  1Q1B A;  4C3J G;  4LNQ A;  1BBW A;  2I5L X;  4YWM A;  1K3R A;  3CC4 A;  1I3Q H;  4NDX A;  5IP9 G;  5ELC A;  5FJ8 H;  2LKV A;  1XNR L;  2JA5 B;  3E0E A;  1IBK Q;  3AQQ A;  2EYF A;  4QJF A;  1J8I A;  2N3S A;  1Q82 C;  4O0A A;  5FLX E;  4JI1 L;  2D0O A;  3DEP A;  2B2U A;  3QR8 A;  3PIO 3;  3IRB A;  3J81 L;  1ET6 A;  4IOC A;  2A68 C;  3CP0 A;  3NEL A;  1K83 H;  4DV0 Q;  1D6E C;  2PQA B;  1KL9 A;  2F0E A;  5A2Q L;  4FF2 A;  2HCC A;  1JE4 A;  5M5W H;  4NXN Q;  3K57 A;  1EFI D;  2DNE A;  1JWM D;  3NE5 B;  2BE5 C;  3RUZ A;  1UUP A;  1C0A A;  1QIL A;  1W3S A;  1B4O A;  4K2L A;  1EU4 A;  4V19 0;  2E75 C;  2F0V A;  1E2Z A;  2F0S A;  4DV1 L;  3J80 L;  2PMZ E;  4EQP A;  4YIJ A;  3GTK B;  1LTG D;  3HGB A;  1PFN A;  4POG A;  4JBJ A;  1RTO A;  2H4O A;  4GNX A;  4JI0 Q;  3BYT B;  2JA8 B;  3M4Y A;  4A4I A;  1I4R A;  5E4X A;  4LF6 L;  4X65 L;  1PTO D;  3ULL A;  2KED A;  2XWB B;  2K14 A;  4X6A H;  5M3F H;  4QUF A;  4KLK A;  1BNZ A;  2CHB D;  1XJV A;  1R9T H;  5L37 A;  1NR4 A;  1Q12 A;  4IO9 A;  1B9M A;  4XYO A;  4GNX B;  1PYW D;  1XPR A;  3A56 A;  1BQQ T;  5C0X J;  2E2H B;  4DR6 Q;  2MGS A;  2WAC A;  3T1Y L;  1E7Z A;  1GOZ A;  4DV2 L;  4K14 A;  1A62 A;  5LMN Q;  2BDO A;  1NSN S;  4DK1 A;  3U4V A;  5M3M G;  4ZKC B;  2JA8 G;  1HUN A;  3HOW G;  5G3L D;  4DR3 Q;  3CCR A;  2VUM G;  1BKB A;  1BCP C;  1B2T A;  2R93 G;  1LTR D;  4NXN L;  1JOK A;  1TWA H;  2HT1 A;  1SDF A;  4LWC A;  1UAP A;  3KLW A;  4DN4 M;  1BCP D;  3MHB A;  2ZXR A;  3TBI B;  2A74 C;  4A3K H;  1LTB D;  5FKA C;  1WTV A;  2K1B A;  1BDO A;  3R2T A;  2X69 A;  3OOC A;  2RSN A;  1S4Z A;  1WTX A;  4ILW A;  4A3E H;  2XIW A;  1IL8 A;  3FMC A;  5E4W C;  5M3M H;  1PLF A;  3X3M A;  5C0X H;  2L4N A;  4FF4 A;  1WFQ A;  1QNU A;  1SYE A;  1IBM Q;  4LF6 Q;  1A2U A;  4LF9 Q;  1BR9 A;  1YBY A;  2GVA A;  2JK8 A;  1HR0 L;  4Q0F A;  3KJO A;  4DR5 Q;  1E1O A;  3F8T A;  5JOB A;  1QVF A;  2A5H A;  2DJF C;  1FNV A;  1GHK A;  1CQV A;  3H3V C;  4H0L C;  1E2V A;  4C3H B;  2GVB A;  2OTJ A;  5IIF A;  1FGU A;  3CCS A;  4A3D G;  4NMZ A;  1KC8 C;  1K73 C;  1TWF B;  3PUV A;  1M90 C;  3STB D;  4GKK Q;  2J4X A;  3G6E A;  1YEZ A;  1GUS A;  1DON A;  3D0F A;  4HJ9 A;  2EYO A;  3HEJ A;  2ENB A;  3QO2 A;  1Y1W B;  1EY9 A;  2IT1 A;  3DWP A;  2O2L D;  3K81 C;  2B2V A;  1EZ8 A;  3MZ5 A;  5NUC A;  2BDN A;  2L0C A;  1ML0 D;  1F2Z A;  3LNN A;  4XQJ A;  4DK3 C;  3CW2 C;  3I4M G;  1A0I A;  1QVC A;  2QDB A;  1VQC A;  3BU2 A;  5FO8 B;  1F9Q A;  3HRZ C;  1QUQ A;  1B8A A;  2EJM A;  2N55 A;  4IUN A;  4ZUI A;  3LWU A;  2QW7 A;  3TZD A;  4L5T A;  1TS4 A;  2EXZ A;  4PZ6 A;  3AMU A;  1AH9 A;  1IBM L;  1N8R C;  5FOB B;  4KHP Q;  3U9O A;  1U4R A;  1HTL D;  3E3X A;  3I91 A;  4RCN A;  5CV7 A;  5FK9 C;  3E5S A;  4Q5V A;  5IT9 E;  1B3Q A;  3GV3 A;  5EQ0 A;  1WTW A;  1MBY A;  1TKW B;  1GVP A;  5CV9 A;  5H1S E;  4CGY B;  1WCM H;  1SNO A;  2OWO A;  1EWC A;  1U4P A;  1EL0 A;  4GKK L;  1H95 A;  1WTR A;  2AMC B;  1BVS A;  3HOX G;  2I5M X;  4A3B B;  3J81 E;  1V9P A;  4K0K L;  3CCE A;  1KRT A;  4A75 A;  3HOY H;  4H02 A;  4YWK A;  2M2L A;  1SYF A;  4BY7 B;  1LTI D;  2NVQ B;  4H13 C;  5IY0 A;  1XWE A;  3NQT A;  1YNJ D;  4GKJ Q;  2B2T C;  1J9O A;  2OT2 A;  1MKH A;  1GUN A;  4DXG A;  3GTQ H;  2Q2H A;  1HQR D;  5CV8 A;  4NXM L;  3ND8 A;  3Q8D A;  1E1T A;  1ENF A;  2IX1 A;  1DXM A;  2K75 A;  4JI7 L;  2E76 C;  1YHB A;  3V2T A;  5EPJ A;  3VR3 A;  1B70 B;  1VQL A;  4A3F B;  5G3L F;  4KHP L;  4DNR B;  3VYU A;  2WIN B;  1EQQ A;  3BZC A;  3R8B A;  4B3M L;  3M4P A;  1K8G A;  1GUG A;  1PH6 A;  1YNJ C;  4DK0 A;  2R93 H;  2YU9 H;  5M3F G;  3UDF A;  1L1O B;  2Q8T A;  1LTT D;  4PMB A;  4WJ3 M;  4GN4 B;  5I9P A;  4BXX H;  4AYB G;  2NN6 I;  3JAM c;  3TQY A;  1KLG D;  3HZX A;  3NXW A;  5IYC G;  3H0G G;  1X3P A;  4GZY C;  1KAW A;  1S3O A;  4M8A A;  4GLX A;  1HZB A;  4LUV A;  4CKB A;  4KTA A;  4K0K Q;  2KCN A;  1STG A;  4R1J A;  2HQE A;  1WCM G;  3I73 A;  3I55 A;  1CSP A;  4F8M A;  2VL6 A;  3S2H H;  1KAA A;  3I90 A;  2F4V Q;  4KHV A;  3VDY A;  1SJE D;  1B7Y B;  4IPH A;  2LFN A;  4XQQ A;  1K3B C;  2BH8 A;  4A3F G;  4ZKB B;  2G5D A;  2RSO A;  3OMC A;  1CKN A;  4P71 A;  1F2Y A;  4RG1 A;  1L0W A;  4IOA A;  1P8L A;  4EQN A;  4AH6 A;  2H1E A;  3DWQ A;  3PO2 B;  3F2U A;  4P72 A;  5HY6 A;  1XMO Q;  1OXV A;  1Y1V H;  5IT9 L;  4JI7 Q;  2LS0 1;  1X3F A;  1XMQ L;  2Z9H A;  4JV5 L;  3MXU A;  2Y0S G;  1DOK A;  5IYD G;  5IOD A;  1G91 A;  5E1F A;  4BY7 G;  1MD2 D;  1PTO B;  4I65 A;  1CHQ D;  3IKJ A;  3CCJ A;  2AUJ D;  3ICE A;  2PI2 E;  4A3C G;  4YY3 L;  3MXN A;  3P1H A;  3K8A A;  3ULP A;  4IFD J;  2XN9 C;  4CKC A;  3G7L A;  1KNE A;  2QEX A;  3S16 B;  4GN5 A;  4HSV A;  1D5Z C;  4AQY L;  1GUW A;  5IT9 c;  4DFA A;  1B9N A;  2VS1 A;  3KF6 A;  3QG1 A; 
#chains in the Genus database with same CATH homology
 4QQB X;  5IYC H;  1VQD A;  1N32 Q;  4JI3 L;  1VS0 A;  3M7N A;  2YTV A;  4UP8 A;  3NEN A;  1PH4 A;  4A93 H;  4OO1 G;  3MXN B;  2UXC Q;  1XPU A;  3U58 A;  2Q2I A;  3KDF B;  3RN2 A;  1IL2 A;  2CKZ B;  3RR5 A;  3A0J A;  2NZO A;  1EFW A;  1K0R A;  1Q86 C;  2UUC L;  2E2H H;  2R6G A;  4LFA L;  1HNW Q;  4DV7 Q;  4O2D A;  1QVG A;  4R4I A;  4JI2 Q;  4MTN A;  4IFD G;  1PH7 A;  4YWL A;  2LXJ A;  4LW1 A;  1GO3 E;  1PV4 A;  3PUW A;  2WB1 G;  1X56 A;  3LGJ A;  4A3J H;  3HKZ E;  1WJJ A;  2B63 H;  4OWX B;  3CPW A;  4LF4 Q;  3GTG H;  1IZ6 A;  1YHA A;  4JI1 Q;  3PUZ A;  3UE1 A;  3G4S A;  4DR2 L;  2B3G A;  1GD7 A;  1N33 Q;  1VQ5 A;  2E8G A;  4GS3 A;  3JAM i;  3GTO H;  1QUQ B;  3A74 A;  2N8N A;  1X55 A;  3NBH B;  4DUY Q;  4IJL A;  2HHH Q;  2R7Z G;  3BJU A;  2IX0 A;  1PYB A;  1X3G A;  4YCV A;  4JV5 Q;  4IJH A;  1KRS A;  1GKH A;  4YHH L;  4DV0 L;  4JI4 Q;  5LMU L;  3RNU A;  2R7F A;  1SRO A;  4OXP A;  2YV5 A;  3CAM A;  3CCV A;  4GNX C;  2JA6 G;  4IPC A;  4GOP B;  3HKZ G;  3J80 c;  1UWV A;  5IYB G;  5JEA G;  1I94 L;  1NTG A;  1NMG A;  4DUZ L;  2VW9 A;  4A3G G;  1L1O A;  2OQK A;  2JA6 H;  5HGQ A;  4HJA A;  2E5L L;  3K0X A;  5GAH C;  3S16 H;  4OO1 I;  4DR7 Q;  2R7Z H;  1EIY B;  4DV1 Q;  3EIV A;  1KHI A;  3GDE A;  2XTI A;  5J3B A;  2WP8 J;  3M9B A;  4R4Q A;  2NZH A;  3TRZ A;  2QGQ A;  3PGZ A;  5IWA Q;  3I2Z A;  5FLM H;  4DR4 Q;  2K5N A;  1W2B A;  3J81 i;  4PG3 A;  3PF5 A;  4B3S Q;  4X66 L;  1YZ6 A;  2JA5 H;  3HOX H;  4BBS H;  2ZTC A;  3S1N H;  4L5S A;  1YHQ A;  1CKM A;  1LUZ A;  2ZJP A;  1KQS A;  1ASY A;  4OX9 L;  1XNQ Q;  2B63 G;  4JI0 L;  3J81 c;  1N32 L;  4LF8 Q;  4A3I H;  3F2D A;  2ES2 A;  1EYG A;  1X9N A;  3CCL A;  1JJG A;  3F1Z A;  4X65 Q;  1JMC A;  2HIX A;  2BA0 A;  2UXC L;  1PVO A;  1P16 A;  1Q1B A;  4UP7 A;  2IHE A;  2L15 A;  4LNQ A;  1UEB A;  1SN8 A;  1BBW A;  2I5L X;  4YWM A;  4BA1 I;  1K3R A;  1VQM A;  4A3C H;  3CC4 A;  1HR0 W;  3CPF A;  1I3Q H;  5M5Y H;  4GOP A;  5IP9 G;  3RZD H;  2UUC Q;  4LFA Q;  1HNW L;  4KI0 A;  2RHS B;  3AFQ A;  4C3I H;  3J81 j;  5FJ8 H;  1XNR L;  1X3E A;  1JT8 A;  2N78 A;  2NVQ H;  3E0E A;  1IBK Q;  3HOZ G;  3AQQ A;  4JOI C;  1PFS A;  4QJF A;  4DPG A;  3PSI A;  1J6Q A;  1EWI A;  2N3S A;  3PUY A;  4DR6 L;  4WJ4 A;  3T1Y Q;  1Q82 C;  4O0A A;  2MNA A;  4HIM A;  4JI1 L;  2D0O A;  4OWW B;  4NB3 A;  4LFB Q;  4A3L H;  2YTY A;  1PH2 A;  3IRB A;  1VQ8 A;  5C0X I;  4JC0 A;  5LMN W;  4DUY L;  4IOC A;  3PO2 H;  5GAG C;  2HHH L;  4JI6 Q;  3CP0 A;  3NEL A;  4DR3 L;  1K83 H;  4YHH Q;  4DV0 Q;  4JI4 L;  2PQA B;  1KL9 A;  4IFD I;  3I4O A;  4GLA C;  4HID A;  3SGI A;  2N49 A;  5M5W H;  2KBN A;  2E2J H;  4NXN Q;  1C0A A;  1TWH H;  4DV5 L;  1XPO A;  2E5L Q;  1W3S A;  2JE6 I;  1PH1 A;  1C9O A;  4DR1 L;  1HNX L;  3RLN A;  1VQE A;  1OXU A;  4DV1 L;  2PMZ E;  4DNI A;  3TS0 A;  4XIG S;  3JC6 6;  3W5O A;  1HJP A;  4DR4 L;  1EOV A;  1IBL L;  1UE7 A;  3S1R H;  4B3S L;  4POG A;  1Q7Y C;  1NY4 A;  4GOP C;  3AEV A;  2ZM6 L;  5FLX c;  3OW2 A;  3HFZ B;  4OX9 Q;  4JBJ A;  3KOJ A;  4GNX A;  5C3E H;  3K80 C;  2EIF A;  4A3M G;  4JI0 Q;  4LF8 L;  5GQO A;  4A4I A;  1YJ9 A;  1CKN B;  3PV0 A;  4JOI A;  3DLL A;  4LF6 L;  4X65 L;  2UUB Q;  5FJ8 G;  1A8V A;  1Y14 B;  3ULL A;  1YVC A;  2K14 A;  4X6A H;  4C3H H;  1HR0 Q;  5M3F H;  2R92 G;  4DR5 L;  4KLK A;  3HOU G;  2WFW A;  2K52 A;  5IE8 A;  1XJV A;  4PMW A;  1TWF H;  1R9T H;  4C3J H;  1Q12 A;  4P75 A;  4BY1 G;  3TRE A;  4IO9 A;  1C7Y A;  1YNX A;  1XNR Q;  4GNX B;  1SMX A;  3FHW A;  1XPR A;  1IBK L;  4A3I G;  2A19 A;  2UXD L;  2YYZ A;  4AIM A;  5C0X J;  2E2I H;  4A3B H;  2EXD A;  3M4O H;  4DR6 Q;  1VQB A;  4UY8 C;  3T1Y L;  1E7Z A;  1Q46 A;  4DV2 L;  1N34 L;  4DK6 C;  1A62 A;  1CSQ A;  5LMN Q;  2V1C C;  1LTL A;  1XTD A;  3W1B A;  3U4V A;  3T1H Q;  4APV A;  5M3M G;  4LFB L;  5M5X H;  2JA8 G;  1Z9F A;  1E22 A;  3HOW G;  2VQE L;  2RF4 A;  3EBE A;  2KEN A;  4A3E G;  1S72 A;  4JI6 L;  5C44 H;  4GN3 B;  4DR3 Q;  4B3T L;  4BXX G;  4MNO A;  3CCR A;  1WYD A;  2I5H A;  2VUM G;  2IHF A;  3HKS A;  3UDX A;  1YIT A;  2YTX A;  1HNZ L;  1BKB A;  3KFU A;  2R93 G;  1HZ9 A;  3KJP A;  3RLF A;  4A3K G;  4A3G H;  4JI8 L;  3WWV A;  4NXN L;  1IYJ B;  2HT1 A;  1TWA H;  3E9I A;  4LWC A;  3FP9 A;  4QL5 A;  2I0Q A;  2JA7 G;  3KLW A;  4DV5 Q;  4JG2 A;  3ULJ A;  3CCQ A;  3J7Z C;  1MIU A;  1GM5 A;  4A3K H;  1MJC A;  4DR1 Q;  4OON A;  3CC7 A;  3CCU A;  2Z6K A;  1HNX Q;  3MEF A;  2K5H A;  4XTC S;  3OTO L;  4HJ7 A;  3D31 A;  1U0L A;  4ALP A;  2VUM H;  3U4Z A;  1LYL A;  3HOY G;  2ZTE A;  1E24 A;  2ZJR A;  2ATW A;  5C44 G;  2Q2T A;  2D62 A;  4A3E H;  1L1O C;  3CMA A;  2Z0S A;  1IBL Q;  4UPA A;  4B3R Q;  2WAQ G;  3L7Z C;  5M3M H;  4PZ8 A;  1I5F A;  2ZM6 Q;  4DV6 L;  1KXL A;  2VNU D;  1YJN A;  1WFQ A;  3F2C A;  1IBM Q;  4BA2 I;  1FL0 A;  4R4O A;  4NPS A;  4LF6 Q;  4OWT B;  2ID0 A;  1X54 A;  2UUB L;  1TWG H;  4JBK A;  3I4N H;  1VQ9 A;  4LF9 Q;  2MFI A;  1YBY A;  2GVA A;  2JK8 A;  4A76 A;  4JBM A;  1HR0 L;  4DAM A;  3KJO A;  4DR5 Q;  1E1O A;  3F8T A;  3HOV G;  1TXY A;  1QVF A;  2WAQ E;  1AE3 A;  3W1G A;  3CC2 A;  5ELO A;  4ME3 A;  2VZA A;  1I50 H;  1UE6 A;  3STB C;  3CCM A;  1JE5 A;  3J80 i;  4LFC L;  3CME A;  2UXD Q;  2OTJ A;  2GVB A;  2JQO A;  3KF6 B;  1VQG A;  3CCS A;  1FGU A;  2CQO A;  4UP9 A;  1KC8 C;  4A3D G;  1K73 C;  4P74 A;  4LUZ A;  4GKK Q;  3PUV A;  4DV2 Q;  3STB D;  1N34 Q;  1M90 C;  5C3E G;  4A3M H;  3G6E A;  5LMN L;  1L2F A;  1YEZ A;  3GD7 A;  3UDG A;  1U5K A;  3T1H L;  3PO3 G;  3D0F A;  1YJW A;  2JEA I;  5C4X H;  4HJ9 A;  1NJI C;  4MZ9 A;  2PNH A;  1PA6 A;  1PHJ A;  2VQE Q;  4R4T A;  4HIK A;  1MJE A;  4B3T Q;  2LXK A;  2IT1 A;  3GTK H;  3K81 C;  3PF4 A;  1HNZ Q;  1SRU A;  1VQI A;  1K9M C;  2MO1 A;  3S14 H;  4P73 A;  3S2D H;  4JI8 Q;  5GRO A;  1BBU A;  2GN5 A;  4JCV E;  4DK3 C;  4BBR H;  3RZO H;  3CW2 C;  1PYS B;  2AKW B;  1HZC A;  1A0I A;  3CD6 A;  3I4M G;  1QVC A;  5K36 G;  1VQC A;  5IYD H;  1PH9 A;  3BU2 A;  2Q2U A;  5EAY A;  1NMF A;  4FDB A;  4J15 A;  1QUQ A;  1B8A A;  1VCI A;  1FVI A;  3OTO Q;  3EN2 A;  1YIJ A;  1SFO H;  2IY5 B;  2AWO A;  2K4K A;  1Y1W H;  1JJ2 A;  2C35 B;  4PZ7 A;  1EIF A;  1WOC A;  2UUA L;  3FKI G;  3PCO B;  1FJG L;  2B29 A;  3CXC A;  4B3R L;  4L5T A;  4PZ6 A;  4JI5 L;  5C4X G;  1PH3 A;  3ER0 A;  3PIO A;  4DV6 Q;  1V1Q A;  1AH9 A;  4JBW A;  3UDI A;  1TWC H;  4HIO A;  3H3V I;  2LSS A;  1IBM L;  3S24 A;  4A3D H;  1N8R C;  4KHP Q;  4HJ5 A;  1LM0 A;  4LF7 L;  4LF9 L;  3DM3 A;  3RN5 A;  2KHI A;  3I4M H;  4QGU A;  4B3M Q;  3M3Y H;  3U50 C;  1PH8 A;  1E3P A;  1UE5 A;  4L5Q A;  2QA4 A;  4KHZ A;  1G6P A;  3TS2 A;  1VQK A;  3M4Q A;  1GVP A;  2JA9 A;  1OXX K;  3BZK A;  1Z47 A;  3OYY A;  1NBW A;  5H1S E;  4LF5 L;  4LFC Q;  1VQ4 A;  4JYA L;  1WCM H;  3A5Z B;  3A5U A;  2OWO A;  3I4N G;  5C4J H;  1VQA A;  2PI2 A;  5JJK A;  2JJQ A;  4GKK L;  3GTP H;  1H95 A;  4GLV B;  2AMC B;  2VQF Q;  3AFP A;  1BVS A;  1OXT A;  2EQS A;  2HIV A;  3HOX G;  2JA5 G;  2I5M X;  1SE8 A;  3PIP A;  4LUO A;  1V9P A;  1OTC A;  3S17 H;  3M85 A;  4K0K L;  3CCE A;  1RIP A;  4C2M H;  5ELN A;  3H3V H;  1KRT A;  4A75 A;  3HOY H;  4H02 A;  1VQH A;  4IPD A;  3S1M H;  4YWK A;  3GTM H;  2RHQ B;  5DLQ E;  3L2P A;  2KCM A;  2F4V L;  1VQO A;  5IY0 A;  3KDF A;  4L5R C;  1VQJ A;  3HOV H;  2PQA A;  3CF5 A;  5GAD C;  1J5E L;  2UXB Q;  1HZA A;  4GKJ Q;  4DV4 L;  5IYB H;  1UE1 A;  1MKH A;  2DGY A;  4DV3 Q;  3GTQ H;  2Q2H A;  2XGT A;  2KCT A;  1VQ6 A;  1A63 A;  4BBS G;  2DUD A;  3E9H A;  5C0X G;  4NXM L;  2ALY B;  1K8A C;  2OQ0 A;  5AJ3 L;  3Q8D A;  2UUA Q;  1E1T A;  1FJG Q;  1VQP A;  2IX1 A;  1JB7 A;  2KHJ A;  2R7D A;  4JI5 Q;  4R4C A;  2D0P A;  1XMO L;  3I7F A;  2K75 A;  1KIX A;  2NVX H;  4TQU S;  2CWP A;  4JI7 L;  5BR8 L;  1YHB A;  4EX5 A;  4IPG A;  5JJI A;  2K50 A;  1EQR A;  1XMQ Q;  3CQZ H;  1B70 B;  2K5V A;  3AYH B;  1VQL A;  1SLJ A;  1G51 A;  1HH2 P;  4A3B G;  4KHP L;  5JJL A;  4A3J G;  2UU9 L;  1NE3 A;  4QY7 A;  4LF7 Q;  1Q1E A;  1O7I A;  1EQQ A;  2ZJQ A;  3BZC A;  4B3M L;  3M4P A;  4DKA C;  1QZG A;  1K8G A;  1N9W A;  2JA7 H;  1VQ7 A;  1PH6 A;  1WI5 A;  2CWA A;  4HJ8 A;  3S15 H;  3GTL H;  4Y52 H;  2R93 H;  2YU9 H;  3KF8 B;  5M3F G;  2R92 H;  4YCU A;  3UDF A;  1L1O B;  4YY3 Q;  3HOU H;  1AE2 A;  1V43 A;  2F3I A;  4WJ3 M;  4GN4 B;  4JYA Q;  4LF5 Q;  1RL2 A;  5E7N A;  2H5X A;  3UE0 A;  1EUJ A;  2NN6 I;  3ZJY C;  3TQY A;  4AYB G;  3JAM c;  4BXX H;  4A93 G;  2OCE A;  3HOW H;  4X62 L;  2JA8 H;  4X64 Q;  5IYC G;  3H0G G;  3TEH B;  3L0O A;  2VQF L;  1SR3 A;  1KAW A;  1S3O A;  4AQY Q;  3S1Q H;  1YI2 A;  1N36 Q;  4GLX A;  1I6H H;  1HZB A;  4POF A;  4LUV A;  4K0K Q;  2A1A A;  4R1J A;  1WCM G;  3B6Y A;  4JI3 Q;  3I55 A;  1CSP A;  2Y0S E;  2VL6 A;  3KYH C;  3S2H H;  3I56 A;  3J7A 5;  4BY1 H;  2CFM A;  1CUK A;  2HQL A;  4EQ5 A;  2F4V Q;  3VDY A;  2RCN A;  4IPH A;  1B7Y B;  2OTL A;  2CCZ A;  4A3F G;  1J5E Q;  2UXB L;  2BH8 A;  3PUX A;  1Q81 C;  1PH5 A;  3NEM A;  4GKJ L;  4DV7 L;  4DV4 Q;  1D7Q A;  2MQH A;  1Q8K A;  4JI2 L;  1KD1 C;  4DV3 L;  1CKN A;  4P71 A;  4QIW E;  4BY7 H;  4TVA B;  4RG1 A;  1IXR A;  1L0W A;  1X6O A;  3G48 A;  5IP7 H;  4IOA A;  1P8L A;  2WB1 E;  4NXM Q;  4AH6 A;  4LF4 L;  5AJ3 Q;  1VQF A;  4DR2 Q;  1N33 L;  1Y1V G;  2FXQ A;  3FKI H;  4P72 A;  5HY6 A;  4A3L G;  1XMO Q;  2JEB I;  2NVY H;  1VQN A;  1OXV A;  1Y1V H;  1Y1W G;  4JI7 Q;  1OXS C;  2ZTD A;  5BR8 Q;  2A8V A;  3F2B A;  2NN6 G;  1X3F A;  3ERS X;  1XMQ L;  1S40 A;  4JV5 L;  2Y0S G;  2UU9 Q;  1QZH A;  1X65 A;  4RMF A;  5IYD G;  2Z6K C;  5IP7 G;  5GAE C;  1CKO A;  2VY3 A;  5LMU Q;  1D8L A;  3HOZ H;  4BY7 G;  4BBR G;  3K7U C;  1I94 Q;  4Y7N H;  3H15 A;  5JEA J;  4DAY B;  3CCJ A;  5IP9 H;  4DUZ Q;  3ICE A;  1DGS A;  2PI2 E;  4A3F H;  4A3C G;  1JJC B;  2MO0 A;  4YY3 L;  1T9H A;  1G29 1;  3K7A H;  3K8A A;  3G71 A;  3ULP A;  4IFD J;  4DR7 L;  3PO2 G;  2ASB A;  3GTJ H;  2F52 A;  3GO5 A;  4AYB E;  2QEX A;  4X62 Q;  2NVT H;  4X64 L;  4GN5 A;  1ASZ A;  1M1K C;  2BA1 A;  5IWA L;  4AQY L;  3PO3 H;  5IT9 c;  1N36 L;  2BH2 A;  4X66 Q;  3RLO A;  2AHO B;  2VS1 A;  5FLM G;  1XNQ L;  2AWN A;  3KF6 A;  4YCW A;  3H0G H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...