2JA5H

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
135
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
total genus 16
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja5H00
4GLXA 2UUAL 1W2BA 1HZAA 1MJEA 4LUZA 4YHHL 4DV4Q 3ER0A 1OTCA 2AWNA 4GN5A 4UP8A 1D7QA 1Q46A 1TWCH 1YVCA 2NZHA 2JK8A 4J15A 2OWOA 3S2HH 1L1OB 5H1SE 1JMCA 2DUDA 1IBML 2V1CC 1WJJA 2UXDL 2OCEA 2UU9Q 2R7ZH 3WWVA 1X65A 3T1HQ 2ZTEA 1VQ7A 3T1YQ 2IHEA 4KI0A 5FJ8G 3M3YH 2UUAQ 4C3IH 1NE3A 4OONA 1G291 1IYJB 1S72A 1SFOH 1S3OA 4BY1G 4DV7L 3BU2A 4DV5Q 2OTJA 4IJHA 1XJVA 4P72A 4DAMA 4A4IA 3S17H 1TWAH 4NPSA 1HNXL 1WCMH 1SN8A 4IPCA 5GROA 4DR2Q 4O0AA 1EFWA 1C0AA 1SLJA 4YCVA 3SGIA 1VQKA 4QL5A 4A3LH 3DLLA 3BJUA 1Y1WG 4A3JG 4DR1L 1IXRA 1BVSA 1QUQB 1C9OA 4NXNQ 5AJ3L 1VQPA 3NENA 3TRZA 3KF8B 2KHIA 2B29A 3HOVH 2K52A 1JJCB 5HGQA 2IX0A 1QZHA 4X64L 3F2BA 2RHQB 4MZ9A 1PH5A 1UE1A 1VQCA 4QIWE 2UXDQ 3AQQA 3HOYH 4LFBL 1K3RA 1L1OA 1E24A 1LTLA 4DR3Q 1YI2A 3PUVA 1HNWL 2IY5B 1VQEA 1HR0Q 1Y1VG 2KCTA 3JAMi 3GDEA 3CPWA 2E2JH 4GKKQ 1Q86C 2VQEQ 1W3SA 1FJGQ 4GNXB 1VQNA 4KHPL 2YYZA 4JI4L 1PH9A 4YWMA 1K0RA 5BR8Q 1IBLQ 1PH3A 4DR5Q 2UXCL 1Q12A 2NN6G 3EBEA 4DR3L 4UY8C 1KXLA 2ATWA 4DV6L 4JI6L 4DK6C 1QVCA 4A3CG 1UWVA 2ZTCA 1IBKL 3H0GG 4LF4Q 1VQIA 1YHAA 3M4OH 1S40A 2MFIA 1OXUA 1CSQA 3HOXG 4JV5L 4X64Q 4EQ5A 3M85A 4IPHA 2NZOA 1IL2A 2RCNA 4JBMA 3CCVA 3HOYG 4JI1L 1A0IA 5E7NA 4LW1A 1X3EA 4JBJA 2MNAA 5GQOA 4BXXH 2ASBA 3JAMc 4HIOA 1IBLL 1YITA 5IYBG 4A93H 3S15H 4JC0A 2OTLA 3HOVG 1YNXA 3L2PA 4GNXC 3GTLH 1XMOQ 1G6PA 4NXNL 4GS3A 3J7ZC 3CCMA 1PH2A 3H3VI 3CMAA 1U5KA 4DKAC 2D0PA 1K73C 2E2HH 1N33L 4P75A 3GTPH 2WP8J 3FHWA 4K0KL 1KD1C 3I2ZA 3GTGH 4JI4Q 5C4XH 3A5UA 1Y14B 1XMQQ 4LNQA 2E2IH 3CCLA 2AWOA 2K5HA 2QEXA 1JJGA 2CWPA 1XPUA 4LFBQ 2CQOA 3HKZG 4BY1H 1Q82C 3OW2A 3K7AH 1NTGA 4YWKA 3I4MG 1CKMA 4A3IG 2KBNA 3RR5A 5IE8A 4APVA 1SMXA 3D31A 4HJ9A 1I3QH 3I55A 3CPFA 4MTNA 5IT9c 2R92H 1GO3E 1V9PA 3HOZH 2R7ZG 2WB1E 4X66L 2K50A 4AQYL 3K8AA 3DM3A 1N36Q 4DR5L 1E7ZA 1P16A 1X56A 4PG3A 4R4IA 2HT1A 4DV6Q 1K83H 4IJLA 1KAWA 4BY7G 1IBKQ 2JA6G 3KF6A 4YHHQ 2CKZB 1KRSA 5M3FG 4HJ8A 3KJPA 1M1KC 1QVFA 3K7UC 2HHHQ 4A3GG 1N9WA 4GN4B 2R92G 1MJCA 1CKNB 2VS1A 4UPAA 4K0KQ 3S1NH 2NVQH 4P71A 4A3IH 4YCWA 4LF6L 3I4MH 4A3BH 3T1YL 4DUYQ 3T1HL 3PIOA 3PSIA 3A74A 4OWTB 4JI8L 1UEBA 4YY3Q 1NY4A 2VQEL 4QQBX 2GN5A 3CW2C 4PZ6A 1V1QA 2BA0A 2PI2A 5JEAJ 4DK3C 4A3DH 4HJ5A 2ALYB 1NJIC 1QVGA 1GD7A 5GAEC 4QGUA 1H95A 2VUMH 3F1ZA 1HR0W 2Z6KC 1HNZL 2R6GA 3AFPA 3M4PA 1RL2A 4L5QA 3OTOQ 2A1AA 3KDFA 5LMUL 1X55A 2UXBQ 1EUJA 3JC66 3HOWG 1XPRA 1FVIA 3S2DH 4JI2Q 4YY3L 3PUYA 4DAYB 4GKJQ 5JJKA 3KJOA 1WI5A 1EWIA 1L2FA 3J81j 3GTMH 1R9TH 3B6YA 4JI5L 4C3HH 3KLWA 4UP9A 2PI2E 5HY6A 1HNXQ 4XTCS 3H0GH 4DR2L 4B3SL 1A63A 3K0XA 1PA6A 1EOVA 3F2DA 4DUYL 1PHJA 1N36L 3RN5A 5FLMG 4OX9L 4NXML 3KFUA 3Q8DA 1SE8A 3OYYA 1CKOA 1YHBA 2YTVA 1PV4A 4L5SA 2I5MX 4IOAA 4GLAC 1KC8C 1I5FA 2K75A 3PGZA 2HHHL 1HZCA 2EIFA 1TXYA 3PO3G 4JI1Q 1A8VA 2YTXA 2E8GA 1SROA 1BKBA 4L5TA 5IY0A 5BR8L 4B3RQ 3M4QA 3ICEA 1Y1VH 2VY3A 3ERSX 4LWCA 3F2CA 2IT1A 1UE7A 4X6AH 5IWAL 2WB1G 2AHOB 4R4QA 4QJFA 4A75A 1JE5A 2EQSA 1PFSA 1Z47A 4DV4L 4GOPB 4GKJL 5IP9H 3HOWH 4JI7Q 3ULJA 4POGA 4DUZL 2DGYA 2MQHA 1J5EQ 4OWWB 4BA2I 1PH6A 3J7A5 1LUZA 3CQZH 1VQOA 3GTQH 4ALPA 3GTJH 5GADC 1IZ6A 1X6OA 4LF8L 4IFDG 4R4OA 4HJ7A 2Q2UA 3EIVA 1YHQA 1N34Q 3W1GA 4JOIC 1EYGA 2JQOA 2MO0A 3CF5A 3GTKH 3UDFA 1X3FA 5IWAQ 4A3EH 4B3MQ 2A8VA 1E1OA 3PIPA 2JA8H 4A3LG 2K5NA 4DV1L 2NVYH 1TWGH 4GLVB 3CD6A 1N32L 1K8AC 1C7YA 2ZJQA 1J6QA 4XIGS 2VQFL 3UDGA 1XPOA 1HR0L 3GTOH 3G6EA 3RZOH 4B3RL 4LF9Q 2AKWB 3MEFA 5J3BA 4NB3A 4Y52H 2F3IA 1A62A 5IP7H 2ZJRA 4NXMQ 3E9HA 4A3GH 3IRBA 4JI8Q 3H15A 5M3FH 2ZM6Q 4YWLA 3TS0A 1I6HH 1MIUA 1MKHA 1VQAA 3CP0A 4DUZQ 3K81C 4IOCA 2BH8A 1XNQQ 4AQYQ 3J80i 3STBD 4OWXB 3HOZG 3HOUG 4LF8Q 3AFQA 2Y0SG 4P73A 1VQBA 1UE6A 4BBRG 1X3GA 3ZJYC 2D62A 3KYHC 4TVAB 2Z0SA 3UE1A 5JEAG 2ZM6L 1KQSA 3BZKA 1SR3A 2Q2TA 2A19A 3W1BA 4Y7NH 3G71A 2QA4A 1ASYA 3L0OA 5IYDG 1LM0A 3RZDH 4DR7L 1N32Q 3HKZE 1I94Q 2JA8G 3PUZA 1EQRA 4A3EG 2JA5H 4WJ3M 5ELNA 2JA9A 2I5HA 2RHSB 2B63G 2ID0A 5IYCH 4IFDJ 2LSSA 2VNUD 2L15A 3TEHB 2D0OA 5M3MH 3S1MH 3CCRA 5C44G 3PO2G 1YEZA 2JJQA 4GNXA 5IYBH 2E5LL 4A93G 2LXJA 2CCZA 4A3FH 5IP9G 1E1TA 4BXXG 3I56A 4A3MG 2R93G 4L5RC 3FKIG 4LUOA 3AEVA 1DGSA 1EQQA 1PVOA 1QUQA 4R1JA 2N49A 1HZBA 4X65L 4JYAL 5LMUQ 4WJ4A 3HOXH 5C0XG 2JEAI 4IPDA 2WAQE 4A3CH 2CFMA 2ZTDA 4DV7Q 2N3SA 1JB7A 3W5OA 1EIYB 3PO3H 1VQDA 3K80C 1VQ8A 4B3TQ 1IBMQ 1YZ6A 1TWFH 1HZ9A 3CCJA 1HNZQ 1PH8A 4JI0L 2YV5A 4IO9A 3STBC 2EXDA 1N34L 3F8TA 2KHJA 5C0XI 3PF5A 1RIPA 4O2DA 2F4VL 3RLOA 1FJGL 1OXSC 4DV3L 1QZGA 1K9MC 1GVPA 4JI7L 1N33Q 2E5LQ 4DV0L 1YBYA 2B3GA 2BH2A 4KHPQ 5LMNQ 1NBWA 4RMFA 1AE2A 1ASZA 1XNRQ 1FL0A 3M9BA 2N8NA 3NBHB 4LFAQ 3FP9A 3RLFA 1BBUA 4LF6Q 3U4ZA 4X65Q 1KIXA 4JYAQ 2K4KA 2JE6I 3PO2H 5M3MG 1Q1BA 2Z6KA 3A0JA 1X9NA 2HIVA 4DR4L 3S24A 5GAHC 4DR6L 2B63H 2PQAB 1Q8KA 4A3JH 3CCUA 2GVAA 1PYSB 4HIKA 2NVXH 3KOJA 3NELA 1P8LA 3HKSA 2OQ0A 3UDXA 3GD7A 4HJAA 1KRTA 5C4JH 1K8GA 4JI3Q 4LF9L 4ME3A 4DV2L 3J81i 3G4SA 1VQMA 4LFCL 3PV0A 4UP7A 5IYDH 3RNUA 1D8LA 1GKHA 2FXQA 3E0EA 3G48A 3TQYA 1VQHA 2GVBA 4JI6Q 4A3BG 2R7FA 2NN6I 4PMWA 1YJWA 4DV1Q 4RG1A 1B7YB 1OXVA 4DPGA 3KDFB 3CAMA 2VW9A 1N8RC 2I0QA 1JT8A 4BA1I 3S1QH 4BBRH 5FJ8H 4DR7Q 4C3JH 2KCMA 2MO1A 4PZ8A 5LMNL 1CKNA 1YJNA 1VQ5A 1XNQL 3HOUH 4LFAL 3UDIA 4POFA 1OXTA 5GAGC 1PYBA 2JA6H 4BY7H 1T9HA 3TREA 2K14A 5LMNW 4BBSH 4JI0Q 4R4TA 4BBSG 2HIXA 4YCUA 2VL6A 4X62L 2F4VQ 3PUXA 1B70B 1GM5A 3PF4A 2UUCL 2C35B 5JJLA 2IHFA 2N78A 5IP7G 2BA1A 3CCEA 1I50H 3I7FA 3CCSA 1VQFA 4HIMA 3ULPA 3CC4A 1KHIA 2RF4A 2WAQG 1I94L 4JBKA 4GN3B 1PH4A 1HH2P 1OXXK 2PQAA 3AYHB 2XGTA 3BZCA 1VCIA 4PZ7A 3RLNA 1WYDA 2LXKA 5C3EH 4DR1Q 4LFCQ 2ES2A 4LF5L 5AJ3Q 3L7ZC 3KF6B 4A3KH 2QGQA 3M7NA 5C4XG 2AMCB 4KHZA 1XMOL 1PH7A 1L0WA 2YU9H 4KLKA 4AH6A 4JI5Q 3S16H 2CWAA 3A5ZB 5K36G 3E9IA 4DV5L 4P74A 1VQ4A 5JJIA 1XMQL 1CUKA 1VQGA 2KENA 2Q2HA 1LYLA 1AH9A 3RN2A 2JA7G 2JEBI 3PUWA 3CC2A 1XTDA 1HNWQ 4LF7L 1WOCA 3I4NG 2ZJPA 2F52A 1HJPA 5M5WH 1PH1A 1M90C 4DV3Q 1J5EL 2PMZE 2Q2IA 3UE0A 3ULLA 4MNOA 2OQKA 3PCOB 4X66Q 4IPGA 4HIDA 4AIMA 1YIJA 1EIFA 1NMFA 3VDYA 1Q81C 1VQ6A 2K5VA 1WFQA 2UUBL 4LUVA 4AYBE 3U4VA 4X62Q 4LF4L 4B3ML 4DNIA 2HQLA 5M5YH 3CCQA 1AE3A 1FGUA 4GOPA 2YTYA 1E3PA 4FDBA 1L1OC 5C0XJ 3CC7A 1B8AA 2NVTH 3D0FA 5FLMH 3J81c 1SRUA 4QY7A 1UE5A 1VQ9A 1TWHH 1VS0A 3U50C 4DR6Q 3CMEA 4DV2Q 3MXNB 4C2MH 3LGJA 4GKKL 3HFZB 1VQLA 3FKIH 2UUBQ 4LF5Q 3GO5A 4A3MH 4JI2L 4OO1G 2R93H 1CSPA 3I4NH 2H5XA 4A3FG 5M5XH 1Z9FA 4JV5Q 2JA7H 4R4CA 4JBWA 3CXCA 2R7DA 1X54A 4JI3L 2XTIA 3NEMA 4AYBG 5C44H 2VQFQ 4EX5A 1VQJA 3S1RH 4B3TL 2VUMG 3TS2A 1Q1EA 5ELOA 3S14H 4OX9Q 5IYCG 1U0LA 4A3DG 2UXCQ 2I5LX 1Y1WH 4OO1I 3OTOL 3H3VH 4LF7Q 2UXBL 4A76A 3U58A 4TQUS 2JA5G 2PNHA 3I4OA 5EAYA 4H02A 1V43A 5DLQE 1KL9A 1WCMG 4OXPA 4A3KG 5FLXc 3EN2A 1JJ2A 1BBWA 2UUCQ 2Y0SE 4JOIA 2IX1A 4DR4Q 1O7IA 2VZAA 4IFDI 5C3EG 1Q7YC 4DV0Q 2WFWA 1YJ9A 1NMGA 1XNRL 4GOPC 1E22A 4B3SQ 3J80c 2UU9L 4JG2A 1G51A 4JCVE
chains in the Genus database with same CATH superfamily
1BOSA 4A3FB 4HEDA 2AWNA 4GN5A 1O7ZA 1D7QA 1Y1WB 2NZHA 3S2HH 1O80A 1L1OB 1RTOA 2J4XA 4DXGA 2A6EC 3OPOA 2UU9Q 3T1HQ 2KUMA 2LKVA 3VYRA 4I7AA 2AUKA 3SK8A 2XRQD 4LJZC 4CKBA 4BY1G 3FVQA 3CRLC 4IJHA 4P72A 4BY1B 5DM73 4HSVA 1QNUA 3S17H 1EFWA 1EIHA 4ZK9B 1VQKA 4P2CB 4MTKA 4DXFA 3DMUA 1C9OA 4NXNQ 1STEA 2B29A 3I90A 3OMCA 3HOVH 1R4QB 3NHHA 3F2BA 2HDMA 2RHQB 4MZ9A 5CBAE 1UE1A 2E2JB 1L1OA 4A3DB 1VQEA 3R2TA 2KCTA 1C4QA 1JWMD 1Q86C 2RDHA 4X3UA 4DFAA 1HPCA 3MXNA 1H9JA 1GJXA 3BVGA 5LL6S 5BR8Q 2UXCL 1F9SA 4DR3L 5DAUA 4JK1C 5CC4A 1XWEA 2JA7B 1KXLA 3H0GB 1UWVA 1KDBA 2ZTCA 3H0GG 1IBKL 2MFIA 1OXUA 4CDFC 4JV5L 3M85A 1ICFB 4LW1A 3QG1A 2MNAA 4BXXH 3DWQA 1IBLL 5EGTA 3SE0A 5IYBG 3S15H 2OTLA 3HOVG 1YNXA 3KLSA 1EQVA 1G6PA 3J7ZC 1PH2A 3AB9A 2K1BA 1N33L 5I2XA 1AFPA 3GTPH 3A8KE 3GTGH 3V96A 3VA5A 1Y14B 1XMQQ 1PZID 3CCLA 5C3XA 1BCPD 1WTRA 4DU9A 3C3LA 2F1MA 1NTGA 4J6HA 3RR5A 5IE8A 4J1MA 4K5XA 5EBCA 3RD4A 4MTNA 1GO3E 1V9PA 1KLUD 3HOZH 1KDAA 3K8AA 3OMGA 3DM3A 5C6AA 3X3NA 4R4IA 4FF1A 2HT1A 2L5TA 2IPKD 3D3RA 4IJLA 4BY7G 1IBKQ 3W2DA 4YHHQ 4NMZA 2EYHA 3KJPA 3EQLC 3K7UC 1K28A 1SNQA 2K01A 4ABNA 2VS1A 3SVMA 4A3IH 2X6LA 3T1YL 3PSIA 3A74A 4YY3Q 2L0CA 1NY4A 2Z9HA 4PZ6A 2VUMB 1V1QA 2BA0A 4A3DH 4PMCA 5TSSA 5GAEC 5E3FA 5FLXL 3F1ZA 3N6RA 2Z6KC 1F2LA 1S5ED 4L5QA 3M4PA 1RL2A 3OTOQ 4LK1C 1KAAA 2B39A 1XPRA 4QCLA 5JJKA 1WI5A 3J7YW 5COYA 5LHY1 3B6YA 4JI5L 4UP9A 2Z6BA 5HY6A 4XTCS 3GTLB 2PW5A 3FEWX 1DD2A 1PLFA 1PA6A 3G6JB 4DUYL 4WRDA 3KFUA 3T53B 1SE8A 4KY5A 1CKOA 3O13A 3OYYA 1Z6HA 2QDBA 2K75A 4R9WA 3PGZA 1EQTA 5A2QE 1HZCA 2EIFA 1TXYA 1VF5C 2F0MA 1VDZA 5IY0A 4L5TA 3VR5A 2JYOA 4TRDA 4R4QA 4A75A 1JE5A 2EQSA 3H6MA 4GKJL 4A3KB 4POGA 4DUZL 2DGYA 2MQHA 4BA2I 1K3BC 1LUZA 4G7ZC 5GADC 4IFDG 2KVMA 4R4OA 4HJ7A 1SNPA 5EJWA 1D1KA 1IYUA 4HMIA 1LTID 5ELEA 1ZYRC 1X3FA 1DOKA 3HOZB 3M4YA 4OIKA 5IGDA 1DYQA 4A3EB 2WAQB 1JCKB 4XIGS 3W3AA 4B3RL 3R3OA 2AKWB 4EQNA 1F9QA 4Y52H 2F3IA 1XX8A 5D3DA 1A62A 5FOBB 4NXMQ 4A3GH 3H15A 4G4KA 5IT9L 1I6HH 1MKHA 1VQAA 4IUUA 4DAVA 3L3OC 1BQQT 5M5YB 5E4WC 4IOCA 2BH8A 1XNQQ 3J80i 3STBD 5ELDA 3HOUG 4BBRB 3NXWA 4P73A 2PMZB 4BBRG 1YNJC 3UE1A 1UAPA 1KQSA 2Q2TA 3AMUA 4ZUJA 3G71A 1ONLA 1MD2D 4DR7L 5IYDG 3RZDH 3GV6A 1N32Q 5M5XB 1CI3M 1EQRA 3PUZA 3D4DA 4WJ3M 3KLRA 5IOCA 1H9KA 2EJFC 2RHSB 4KKTA 3KLSX 3V05A 2VNUD 3MAQA 2A68C 3CCRA 4DNRB 2JJQA 2E2IB 1H9RA 2CCZA 1BNZA 4K8JA 3I56A 3FKIG 5ELCA 1GUNA 1PVOA 1QUQA 1V1PB 4O1NA 5LMUQ 4B9XA 1SYBA 4IPDA 1STGA 4A3CH 4ZRZA 2P5ZX 1HUMA 3C2PA 1EY8A 1YZ6A 1PTOC 3CCJA 3E5SA 1TWGB 3OW7A 5J39A 2EXDA 1CTMA 3F8TA 3C1EA 1LTRD 3PF5A 1LTAD 4DA2A 3TP7A 1B9MA 1OXSC 1QZGA 1K9MC 1YBYA 2B3GA 4KHPQ 1NBWA 1ASZA 4KJNA 3RLFA 3FP9A 2D2CC 4X65Q 2Y0SB 2EYFA 2JE6I 3OIQA 3I4NB 1HFNA 1LLRD 3S24A 2HD3A 3MTSA 4A3JH 2F0PA 5KGUA 1PYSB 3KOJA 3UDXA 2CVRA 1KRTA 1AN8A 3BYYB 4JI3Q 2B2UC 2QCPX 4DV2L 3G4SA 3PV0A 4UP7A 3RNUA 2FXQA 2GVBA 1YJWA 1A3VA 4UDUC 2I0QA 4BA1I 1JT8A 2N55A 3DWPA 2KCMA 1ENFA 2KCCA 4A93B 2KHSA 4LFAL 2XN9C 4POFA 1OXTA 1TQOA 5LMNW 1H9SA 4C3HB 2VL6A 5EPJA 4X62L 2XRSD 4FXDA 3LX0A 2UUCL 2MPMA 4BWGB 4C3JG 1DZ1A 4ZYSA 5IP7G 3CC4A 4GN3B 1OXXK 4C3IB 1WYDA 5C3EH 2ES2A 2D9UA 3L7ZC 4A3KH 4KHZA 1PH7A 1J8IA 2RKSA 3I4LA 5K36G 4X3TA 4CKEA 1ILPA 4P74A 5JJIA 1J9OA 3K7AB 4WFN3 4N9TA 3RN2A 1HQMC 1XTDA 1HNWQ 1I3QB 1XYIA 4Z9CB 1WOCA 2NBFA 2F0LA 4IUTA 1HJPA 4KK7A 5M5WH 1PH1A 2EY6A 4XT3B 4DV3Q 1HHVA 1A3TA 2J0TD 3I8ZA 4X66Q 1YIJA 4AIMA 2PPBC 3VDYA 1ET6A 3H3VC 2MP1A 1WFQA 3ONAB 2UUBL 4X62Q 3CCQA 5M5YH 3DHQA 1E3PA 2NVTH 3D0FA 1ML0D 5FLMH 2DY8A 1VQ9A 4PQXA 3BYTB 1B3AA 2R93B 1CK1A 3I4MB 4A3MH 4JI2L 4OO1G 1CSPA 3K0YA 3I4NH 3QOJA 4JV5Q 4R4CA 2R7DA 4TKOB 4EX5A 5ELOA 4N9PA 5CYUA 1NR2A 1W6KA 5K36H 2I5LX 4DF7A 1EY0A 4S3SA 4A76A 2JA5G 2V4DA 2JA5B 4DR6Q 4A3KG 1BBWA 2Y0SE 2VZAA 3FKIB 5C4HA 5C3EG 4GOPC 4B3SQ 5G3LD 2NTSA 1LTGD 1U9RA 2PNRC 2UUAL 4LUZA 4YHHL 2F03A 3ER0A 1OTCA 4UP8A 3NP8A 1GUSA 3IFTA 2JK8A 2OWOA 5AFWA 5H1SE 1JMCA 3QB3A 3J7AF 2ZXPA 5E4XA 1WJJA 1SAPA 2OCEA 2R7ZH 3WWVA 2ZTEA 1Y8NB 2IHEA 4KI0A 3MXPA 4C3IH 3A54A 1B50A 1SFOH 1TWAH 1HNXL 1SNCA 3Q6SA 1SN8A 3IFDA 4O0AA 2O2LD 1C0AA 1MSGA 4MIUA 3DLLA 3BJUA 1FNVA 4A3JG 3GTJB 4A3JB 1BDOA 4K5VA 4M1UB 1QNKA 3KF8B 2KHIA 2JSOA 3KBGA 1EOTA 2OT2A 2IX0A 4X64L 4IUQA 1VQCA 3HOVB 2F0HA 3J81L 1LTLA 4GKKQ 2BDNA 3GDEA 3JAMi 2E2JH 1VF7A 2VQEQ 5KNBA 1SYEA 1FJGQ 3I72A 3HZXA 2WIIB 4DAPA 2ZXRA 1I4PA 2YYZA 5T1GA 1KABA 3HS0C 3GTMB 4DNTB 1D6EC 5M9OA 1Q12A 4IUPA 4X3KA 5JOBA 2ATWA 4DV6L 1SNOA 4KN4C 4A3CG 5EPLA 2EXZA 3M4OH 1CSQA 5C5LA 4EQ5A 3T51B 3Q22A 4RAUC 4JBMA 4O42A 3HOYG 1Q90A 5E7NA 5GQOA 1HUNA 2KEDA 5ELFA 1YITA 2B2YA 3L2PA 4IUVA 3EROA 3CCMA 1Y1VB 4U673 4MHEA 2E2HH 4P75A 2WP8J 2K28A 1RD9D 3H94A 2K5HA 2QEXA 4FNFA 1XPUA 4LFBQ 3GTPB 1H9SB 1B53A 4YWKA 4X3SA 1B1ZA 4ID6A 5JEAH 3TBIB 4APVA 1LTTD 1SMXA 3D31A 4QF4A 3SEBA 1G2SA 3ITPA 4AQYL 2CW0D 2EYPA 2HUGA 1E7ZA 1P16A 1O78A 4PG3A 1EY4A 5ISRA 4DV6Q 4HN7A 1KAWA 3KF6A 3TP5A 2CKZB 1KRSA 2B2TA 2O5JC 1QVFA 1E2ZA 1N9WA 4GN4B 2R92G 1MJCA 1CKNB 1CZGA 4KKSA 4K0KQ 1FNWA 3P20A 3S1NH 3HKZB 4P71A 3ND8A 4LF6L 2MGSA 1PDQA 2G5DA 4EGVA 3HOUB 3URYA 2GN5A 4XDXA 4Q5VA 4FO2A 2PI2A 3S14B 1TIID 2ALYB 1GD7A 4QGUA 1HR0W 2R6GA 1WTOA 5LMUL 1X55A 3JC66 3HOWG 3CU7A 4YY3L 4U68A 3A55A 2EY5A 3PUYA 4GKJQ 3GTMH 2IX3A 1EWIA 2B8GA 2PI2E 1HNXQ 4CDEC 1A63A 1EOVA 4M8AA 3F2DA 5CV5A 2A69D 1CM9A 3WOFA 1DOLA 2JXMB 4L5SA 2YTVA 5JVH3 2X6GA 1G8ZD 3NE5B 2D5DA 1STYA 3D4WA 3NTIA 3A8IE 3J7AV 2NZ1D 4JI1Q 1TY0A 1CQFA 4XXEA 4RCNA 1PRTF 4V190 1BKBA 5BR8L 3M4QA 4UHVA 5EKIA 1QB5D 1Y1VH 2VY3A 3WOEA 4LWCA 1BXTA 3F2CA 2LFNA 1SBBB 4X6AH 5IWAL 2AHOB 4QJFA 4HTHA 3TDQA 4GOPB 1SEBD 3HOWH 2X69A 3ULJA 4JI7Q 2EDGA 1J5EQ 1SE2A 1TS3A 2VXWA 1B44D 3GTQH 2AUJD 3GTKB 1KDCA 3GTJH 1IZ6A 1X6OA 1Y8OB 1WTWA 3BDLA 1N34Q 2JQOA 3CF5A 4A3EH 4B3MQ 2A8VA 1E1OA 3T16A 1JOQA 2QILA 1HCZA 1TWGH 2NYZD 3NQIA 3CD6A 1N32L 4RFBA 1U4PA 1EYDA 1C7YA 1I4XA 2BE5D 3GTOH 3RZOH 5CORA 1CQVA 1EY6A 5F2DA 4JI8Q 2BCOA 3I91A 4CDCC 1GHJA 3DXJC 1MIUA 3EJIA 3CP0A 3QWNA 1T5EA 5DEHA 2A73B 3AFQA 1NR4A 1X3GA 5JEAG 1S4ZA 2QA4A 3W1BA 4DK1A 2JA8G 2JP1A 4RWSC 4E6IA 4AYBB 1EEID 2B63G 1CT1D 2D0OA 2C5CA 3WDNA 3PO2G 1YEZA 1HTLD 4K2KA 1FYCA 5IYBH 3QJYA 2SDFA 5BN5A 1MI2A 4A3FH 1E1TA 4BXXG 3NUCA 4A3MG 4OO1H 1LABA 1PZJD 4L5RC 3AEVA 1E2WA 1DGSA 5FK9C 1EQQA 4JYAL 2K03A 3CQZB 2WAQE 1O7LA 1SMYD 2R3ZA 3W5OA 3A7AB 1EIYB 1YNJD 3K80C 4WJWA 1VQ8A 4QMGA 4NW2A 1PH8A 4JI0L 2YV5A 2FMMA 1ESRA 1T5XD 3STBC 1BCPB 1CHQD 2KHJA 2OEOA 1WCMB 1IW7C 3KBXA 1MHWC 1EY7A 4JI7L 1N33Q 2E5LQ 4HCSA 1DJRD 5LMNQ 1AE2A 2N8NA 3U4ZA 1OO9B 2CHBD 4C3JB 3R93A 5M3MG 3H91A 1B2TA 1QG7A 5GAHC 1VMCA 4KV6A 4K8IA 4HJAA 3UI2A 5C4JH 1JOOA 4LF9L 5CBEE 3VR3A 1VQMA 1D5ZC 3BS1A 1V8QA 3TQYA 3G48A 4RH6A 3SK6A 4A3BG 2L55A 4PMWA 1SJHD 1ET9A 2CH4A 4PMBA 4RG1A 2F0QA 3KDFB 1N8RC 2B2WC 3S1QH 5BN3A 4C3JH 4GZYC 3UDIA 1Y8PB 1Y69U 2JA6H 4BY7H 3TREA 4KMUC 3OWFA 5C3WA 4R4TA 2I07B 4YIJA 4YCUA 4FF4A 2HQEA 3S2HB 1L0XB 1YNNC 3PUXA 4F88A 1A15A 3TN2A 2IHFA 2BA1A 3I7FA 1KHIA 3MEHA 4HAEA 1I94L 1AZQA 1XTCD 3FRPB 3AYHB 2XGTA 4PZ7A 4RKLA 3RLNA 4LFCQ 2EYLA 2E2DC 1XMOL 4CJ0B 2RDGA 1S5BD 1IW7D 4JI5Q 1ENAA 2CWAA 3E9IA 5IGGA 1V1PA 1CUKA 2Q2HA 3K57A 1LYLA 3S16B 2PQEA 3JAME 1S5DD 2JA7G 2XVSA 4CKCA 2NTTA 1D5MC 3I4NG 2F52A 1WD0A 4FXKC 4K5WA 1MSHA 1X3PA 4HR7B 4ZUIA 3UE0A 4MNOA 3PO3B 2MJ8A 1EZ6A 1VQ6A 1Q81C 5D14A 1STBA 3NPPA 4B3ML 1EWHA 2HQLA 5D3IB 4DNIA 4GOPA 4XQJA 1L1OC 3CC7A 1TS4A 5M3FB 1E2VA 3OWEB 3NBIA 3U50C 1G2TA 3MXNB 4C2MH 5E1FA 1A2UA 4C3HG 1WTPA 3G7LA 3HFZB 2B2VA 5CMDA 1VQLA 2UUBQ 4LF5Q 4FF3A 3GO5A 2QKIC 4A3FG 3SK5A 2NWGA 2EZVA 3K5MA 4AYBG 4NP5A 5J22A 1VQJA 3OHXC 1Q1EA 2E74C 5IGFA 4XYQA 4HMJA 2UXCQ 2AQ1B 1F9RA 2IL8A 4OIJA 4TQUS 2PNHA 4H02A 5I6YA 5DLQE 1UEAB 4K2LA 1D2BA 1STHA 3EN2A 4DR4Q 1O7IA 5DM63 4JW0A 1Q7YC 1GUTA 1NMGA 1ICWA 1KLGD 1E22A 1NSNS 4JG2A 2Z8LA 2K33A 3IAYA 4JCVE 1MGSA 4GLXA 1W2BA 4IALA 2MHVA 4DV4Q 1LT3D 2L1BA 3DEPA 1EYAA 3HEJA 4L8JA 4J15A 3TP8A 2FFKB 2DUDA 2E75C 4PNYA 1RHPA 5CV7A 1JB3A 2B2TC 1IHZA 1CA5A 2UUAQ 3M3YH 2FMCA 2B2WA 3D6WA 1NE3A 3C1FA 3K5OA 1G291 1IYJB 1QE6A 3ERQA 1S72A 1G6ZA 4DAMA 4A4IA 4NPSA 2F0VA 1WCMH 1UNSA 5GROA 1JWSD 3E6ZX 1SLJA 3SGIA 2XSCA 3E3XA 1Y1WG 5IIFA 1IXRA 1QUQB 5AJ3L 4A3IB 1VQPA 3NENA 1B9NA 4F7XA 1Z7TA 4ULLA 2EVBA 5HGQA 5JAVA 1QZHA 2QW7A 5CV8A 1RDPD 4QIWE 2UXDQ 3TMEA 1HQRD 1I6HB 2IY5B 3PUVA 1HNWL 1DXMA 1Y1VG 3CPWA 3Q23A 4N8X1 4GNXB 3ND9A 2TSSA 1RCVD 3I70A 1EEFD 1JWUD 4KHPL 2VB3X 1PH9A 1QOHA 1PH3A 2O5IC 3SR1A 3PMFA 3M4OB 2NN6G 3ICEA 4UY8C 2K7VA 2A6ED 3MC0B 1QVCA 2FHTA 4LF4Q 2F3WA 3MFGA 1IL2A 2NZOA 4R8NA 3CCVA 3J80E 1E0BA 3KF8A 4JI1L 4JBJA 2ASBA 3JAMc 4HIOA 3NTHA 4A93H 2F0UA 4GNXC 2R92B 1XMOQ 4NXNL 3CRKC 3Q0AA 4MN3A 2L9HA 3BDOA 4DKAC 2D0PA 1F9PA 3NBHA 3I2ZA 4FF2A 4JI4Q 5C4XH 2E2IH 2CW0C 1AEXA 3EVQA 4ZLTF 2CWPA 1JJGA 2CQOA 1VMPA 3V2TA 4FYDA 1HA6A 1CKMA 1L0YB 2HCIA 2F0NA 2R92H 4G57A 4ZKCB 3CPFA 3I55A 2L12A 5KYIA 2M00A 2R7ZG 4X66L 2K50A 2G9HD 5J1ZA 1N36Q 3E0JA 3MWYW 1X56A 2JN4A 1BR9A 1K83H 4QB4A 1IL8A 4J8QA 5M3FG 4HJ8A 1M1KC 3M3YB 3QIAA 4A3GG 4A3GB 4UPAA 3Q24A 5LL6X 4L6TB 4DUYQ 2PZTA 2F0KA 5A2QL 3KK7A 2LS01 4OWTB 1UEBA 1F2MA 3CW2C 1K8MA 1K83B 5JEAJ 4DK3C 4HJ5A 5G3LF 1TU2B 1QVGA 1H95A 1PTOH 3R2IA 3MXUA 1I4GA 3AFPA 4TSSA 1FVIA 2F4IA 3K5NA 1WD1A 3KJOA 2K32A 1GHKA 1L2FA 4EQOA 4IQZA 1R9TH 4C3HH 3KLWA 3VYUA 2M2LA 4B08A 3H0GH 4B3SL 2EJGC 3K0XA 1PHJA 1N36L 3U9SA 3RN5A 1JQYD 5FLMG 4NXML 1GXDC 2M9VA 1PTOB 2F0JA 2F0FA 2I5MX 4XYOA 4IOAA 4GLAC 3SHLA 1I5FA 2A68D 5NUCA 3PO3G 1B4OA 1A8VA 2YTXA 1SROA 3EFXD 4B3RQ 4FVMA 2IT1A 2F0GA 1EU3A 1M4VA 2WB1G 2AQ3B 4DV4L 3S15B 1S5CD 5IP9H 5IODA 1PH6A 3J7A5 2RQXA 3T56B 3PIP3 1VQOA 3CQZH 1WVLA 5EPKA 3P75A 4ALPA 4F87A 3DEOA 2F3VA 4JOIC 4RGOS 1HA5A 3GTKH 3UDFA 5IWAQ 3PIPA 3MZ5A 4OGQC 1EWCA 3NWSA 4DV1L 1GUOA 4GLVB 1PRTC 2VQFL 1HR0L 1XPOA 2PW7A 3G6EA 5IGCA 4C3IG 3MEFA 1JR0D 2WINB 2KEEA 1B3QA 5J3BA 4N8FA 4C1NK 4LF9Q 2ZM6Q 3TP6A 4YWLA 1EU4A 1TS2A 3K81C 2Q8RE 3NTKA 4CJ2C 4AQYQ 4OWXB 3HOZG 4LF8Q 1LACA 2OF1A 1UE6A 1LV9A 2NVXB 3ZJYC 1Q3LA 4K6DA 4TVAB 2Z0SA 4ILWA 1UUPA 2A19A 3RUZA 1ASYA 3L0OA 2BOSA 2PZWA 1HTPA 2XNAC 3HKZE 4QIWB 4CJ1B 2Z1CA 1I94Q 2JA5H 1TR5A 2JA9A 4IFDJ 5IYCH 2LSSA 4H7BA 2L15A 3TEHB 4BY7B 5M3MH 5C44G 3TZDA 2B2YC 2E5LL 3FMCA 4EVOA 2NB0A 2R93G 4LUOA 1TWCB 3D4RA 1HZBA 4X65L 2JEAI 5CV4A 1LTBD 2IWHA 2CFMA 1BF4A 2ZTDA 4DV7Q 3HOXB 3QO2A 2ICEC 2N88A 4B3TQ 1IBMQ 3GV3A 1SNMA 4H44C 5C0XI 1TWAB 2ENBA 1RIPA 4RGMA 3RLOA 2NVTB 2FJ2A 4DV3L 1GVPA 2KQ3A 5K5PA 2BH2A 1EZ8A 1FL0A 4LFAQ 3NBHB 1EY9A 4LF6Q 1CHPD 1PYWD 1AZPA 4IUNA 1STNA 1IKLA 3PO2H 1GOZA 2PO4A 1X9NA 2HIVA 4DR4L 2B63H 1PTOF 1Q8KA 2PQAB 5I9OA 2GVAA 1YNND 4HIKA 1WTQA 1P8LA 2OQ0A 3GD7A 1K8GA 2PCFB 1QILA 1R4PB 5FKAC 3J81i 1U4LA 3D6CA 4LFCL 2RSOA 2WV6D 5IYDH 2J7ZA 1D8LA 4JI6Q 2RDFA 1C48A 2KECA 1PMRA 2NN6I 2R7FA 4DPGA 1OXVA 3CAMA 1NAPA 1AW7A 5JPNC 4BBRH 5FJ8H 3PO2B 4DR7Q 2MO1A 1CKNA 1VQ5A 3HOUH 1RTNA 1NCVA 1PYBA 1BCPC 5GAGC 3S1MB 2K14A 4B9WA 2O4XA 2Z4HA 3FPUB 4BBSG 2DNCA 2HIXA 3J80L 3F2UA 4BBSB 3VYTA 1PFBA 3PF4A 2DJFC 2H1EA 1DOMA 2C35B 5JJLA 3GP7A 2N78A 3CCEA 3CCSA 1I50H 3X3MA 5I4DA 1VQFA 3ULPA 1FGBD 2R7ZB 2RF4A 2WAQG 4JBKA 3K59A 2F0EA 3NWTA 1EIGA 5M5WB 1VCIA 2LXKA 5FLXE 2OXPA 5AJ3Q 2QGQA 1PRTB 1QJOA 2AMCB 2K05A 1JICA 3DM1A 2IW3A 2H4OA 3S16H 3A5ZB 2F0WA 4KY6A 4DAYA 3MHBA 5CV9A 1XMQL 3PUWA 4LF7L 2B8FA 4RGNA 3HOYB 2EOTA 3ULLA 3PCOB 4IZ8A 3H09A 5CR3A 5FO9B 1NMFA 3MFYA 2NN6H 2K5VA 3KUPA 1K8OA 1RF2D 4LUVA 4LF4L 4C1NI 4FDBA 5I9PA 5C0XJ 3J81c 2QEJC 3EA6A 1SRUA 1XXGA 4QY7A 1UE5A 4QUFA 1VS0A 3K6OA 3CMEA 4DV2Q 4C56C 4GKKL 2EJMA 3SXHA 3ZYYX 3FKIH 4K6LA 3K58A 4KN7C 1LO5D 2A5HA 5M5XH 1Z9FA 4JBWA 3CXCA 1X54A 4B3TL 3P1HA 3TS2A 2DY7A 4ZAIA 3S14H 4OX9Q 4RCOA 4A3DG 5C44B 2DN8A 4CGYB 4LF7Q 4EQPA 2UXBL 3U58A 1HXYD 1RJTA 5EAYA 1V43A 1LTSD 1KL9A 4OXPA 5FLXc 2UUCQ 2ZT9C 1F2YA 2WFWA 3J80c 2EPBA 2UU9L 4ZKBB 2PYKA 4DK0A 1HZAA 2BE5C 1MJEA 3SDZA 1SJED 1Q46A 2KOLA 1SMYC 1TWCH 1YVCA 2BDOA 3BZDB 1PXUA 4R8IA 1JOKA 4RGTA 2TMPA 1IBML 1ZYRD 2V1CC 2UXDL 1I50B 4OL7A 1X65A 1IKMA 2K5QA 4QUCA 3T1YQ 1VQ7A 3I73A 3HOWB 3PIO3 5FJ8G 2F0DA 3MVVA 2ICIA 2K5DA 5C3EB 1TY2A 4OONA 1ZKOA 4ZQ3A 3VR2A 1S3OA 4DV7L 3S1NB 3BU2A 4DV5Q 2OTJA 2HDLA 1XJVA 1EY5A 4IPCA 4WORA 4DR2Q 1GUGA 4YCVA 4A3LH 4QL5A 4PV1C 4ODGA 4CDDC 4DR1L 1BVSA 2NVQB 4IFDH 1TWHB 3DWAA 2K52A 2KCNA 1JJCB 1HFGA 1KNAA 1JORA 1PH5A 3AQQA 3HOYH 4LFBL 1K3RA 5EQ0A 5KYLA 1E24A 3HGBA 4DGZA 4DR3Q 1YI2A 3GTOB 3RZOB 1U4MA 5IGEA 1W3SA 1VQNA 4JPBW 4I7ZC 4JI4L 3AU7A 4YWMA 1K0RA 3A7LA 1IBLQ 5I6WA 4NKLA 4DR5Q 3EBEA 3BVZA 2R61A 4JI6L 2F0SA 4DK6C 1SE4A 2F0OA 1VQIA 1YHAA 1S40A 2EY1A 3HOXG 1O7YA 4X64Q 4ZCKA 4IPHA 2RCNA 3D8GA 1A0IA 1X3EA 3HP3A 2L4NA 1A6XA 4JC0A 4UAIA 2K5WA 3GTLH 1ESFA 4GS3A 3H3VI 3CMAA 3GTQB 1U5KA 2WB1B 2DNEA 4XQNA 1K73C 3I3CA 3HG9A 3FHWA 4K0KL 1KD1C 2HCCA 3QOLA 2AQ2B 2SNMA 4DN4M 2RCFA 3A5UA 4XT1B 4LNQA 2AWOA 1V1OA 3HKZG 1X3QA 1Q82C 4BY1H 3OW2A 3K7AH 3I4MG 1RKNA 4A3IG 1DCZA 2KBNA 2Z4IA 3J81E 4OEMB 1I3QH 4HJ9A 1U4RA 5IT9c 3S9WA 2JA8B 1JC7A 2WB1E 4H0LC 3QR8A 4IN3A 2E2HB 4DR5L 5EKKA 2B63B 1TWFB 1C8CA 2PZUA 5KNDA 1W6JA 3VA7A 2JA6G 2HHHQ 3OIPA 1CA6A 4V0BA 5CV6A 2RA4A 2DJGC 3T13A 3T4AC 2NVQH 1CFMA 4YCWA 3I4MH 4A3BH 2A69C 3T1HL 2F0IA 3PIOA 3BVMA 3A8JE 4JI8L 4L63B 3NSWA 3U9OA 3FPPA 2VQEL 4QQBX 1FNUA 2EY2A 3GQBA 1LT4D 1NJIC 1QWYA 3M7GA 2VUMH 5JVG3 4RHRA 1HNZL 4H13C 2UXBQ 2A1AA 3KDFA 1EUJA 3S2DH 4JI2Q 3CKIB 3IKJA 1TS5A 3OSOA 4KHVA 4DAYB 2CH4W 3J81j 2SOBA 3IL8A 3A56A 1M8AA 5I2YA 1EYCA 3JAML 4DR2L 2WKDA 3PQIA 4OX9L 3Q8DA 1PV4A 1YHBA 1KC8C 4KD4A 1WTXA 2HHHL 4XQQA 1ZEQX 3S2DB 1X32A 5KRUA 1EFID 3NQTA 2E8GA 3RMHA 3LWUA 1STAA 2SNSA 1K0SA 3ERSX 5D65A 1UE7A 2ZXOA 2Q8IB 3SK4A 1PFSA 1Z47A 2NUCA 5KEEA 4I65A 1BCPF 4LAAA 2RBMA 3DUZA 1HRJA 4OWWB 2XWJB 5BN4A 4OELB 4IURA 4LF8L 1G91A 2A6HC 2Q2UA 3EIVA 5FO7B 1YHQA 3W1GA 1BO0A 1EYGA 2MO0A 1I4HA 2L11A 4A3LG 5KNCA 2JA8H 2K5NA 1PFNA 2NVYH 4NDXA 5HGTA 5EKLA 1K8AC 2ZJQA 1J6QA 3UDGA 1I6VC 1Q8IA 1A3UA 2E76C 4NB3A 1PTOD 5IP7H 2ZJRA 3E9HA 3IRBA 5C4JB 3S1QB 5M3FH 2EYJA 3TS0A 5IGBA 4DUZQ 1S5FD 4KD3A 4KY7A 3VR4A 4KJOA 1IYVA 1CZWA 2MUYA 2WACA 2LMCB 2Y0SG 3MA2B 5C5MA 1VQBA 1TVXA 4ME5A 2D62A 3KYHC 4RKBA 4K14A 1I4QA 2ZM6L 3BZKA 1SR3A 1TKWB 4RA8A 4Y7NH 2EYMA 1LM0A 1LT5D 2K6AA 2WKCA 1NUCA 3N52A 4A3EG 5ELNA 4Q0FA 4LMQD 2KA7A 2SEBD 2I5HA 2ID0A 3S1MH 4GNXA 4A93G 2LXJA 1GUWA 5IP9G 4Y7NB 1PFMA 5C4ZA 1H9MA 5A35A 2XWBB 4FXGC 1SFOB 4R1JA 2N49A 4WJ4A 3HOXH 5C0XG 1SNDA 2G9DA 3HRZC 2N3SA 2VB2X 1JB7A 3PO3H 1F2ZA 1VQDA 3VYSA 5DNFA 1SYCA 4F8MA 4RHSA 1TWFH 1HZ9A 1HNZQ 1EL0A 3BG3A 4IO9A 1N34L 1SXTA 4G7OC 3GTGB 2KJXA 2LY7A 1SE3A 4O2DA 2EYOA 3K5LA 1BBXC 1FJGL 2F4VL 5C0XH 4A3BB 3FDTA 4DV0L 5CGKA 3LNNA 4RMFA 1XNRQ 3M9BA 3VR6A 1BBUA 4JYAQ 1KIXA 2K4KA 2C9OA 1Q1BA 2Z6KA 3A0JA 4G7HC 1PRTD 1FR3A 4DR6L 4C2MB 3S1RB 5EBDA 3CCUA 2NVXH 3NELA 3HKSA 2NVYB 4ME3A 5L37A 2K04A 5T1IA 2RVLA 1GKHA 3E0EA 3RZDB 1ZXTA 1VQHA 3NK9A 4DV1Q 1B7YB 3TZUA 2VW9A 2CQAA 5JPMC 1RODA 4PZ8A 5LMNL 1YJNA 1A2TA 1XNQL 3P7JA 4JVZA 2FINB 1D1IA 2EE1A 1T9HA 5M3MB 2Q8TA 1D5XC 4BBSH 4JI0Q 2F0TA 2F4VQ 4KKUA 1DM0B 1B70B 1GM5A 3R8BA 2B2UA 4HIMA 3TRZA 2A74C 1PH4A 3OOCA 1HH2P 3BDCA 2PQAA 1SYGA 3BZCA 1R9TB 1BUVT 4CBVA 4DR1Q 4LF5L 3KF6B 2JA6B 4BS9A 3M7NA 5C4XG 1ENCA 3S17B 5C4XB 1L0WA 2YU9H 4KLKA 4AH6A 1FD7D 1KNEA 4DV5L 3TSSA 1VQ4A 1VQGA 2KENA 1JE4A 3C46A 1AH9A 3CHBD 2JEBI 2QDLA 3CC2A 2ZJPA 1M90C 5KIXA 1J5EL 2B2VC 2PMZE 1F77A 2Q2IA 1PZKD 2I46A 2OQKA 4IPGA 2YU9B 4HIDA 1EIFA 2A6HD 5FO8B 1SYDA 4CHTB 4AYBE 2XIWA 3U4VA 1AE3A 2RSNA 1FGUA 2YTYA 1B8AA 1MBYA 5JJZA 2IJ0A 4HCEA 5HURA 1TWHH 1WTHA 1KTKA 1NNXA 5IT9E 4A3MB 4OHJA 3L9AX 3LGJA 1DONA 2R93H 1QCBD 1TT2A 2H5XA 2JA7H 3MXGA 4JI3L 2XTIA 3NEMA 5C44H 2VQFQ 3S1RH 1HR0Q 2VUMG 1WTVA 2GA4B 5IYCG 2QF7A 1U0LA 4KTAA 1SYFA 1Y1WH 4OO1I 3OTOL 4FP5D 4HSPA 3H3VH 1ILQA 1AP0A 3I4OA 1WCMG 1SSOA 1JJ2A 2IX1A 4JOIA 4IFDI 4DV0Q 1YJ9A 3LWEA 1II3A 5ELBA 1XNRL 1I4RA 1G51A 1LT6D 1SDFA
chains in the Genus database with same CATH topology
4GLXA 2UUAL 1W2BA 1HZAA 1MJEA 4LUZA 4YHHL 4DV4Q 3ER0A 1OTCA 2AWNA 4GN5A 4UP8A 1D7QA 1Q46A 1TWCH 1YVCA 2NZHA 2JK8A 4J15A 2OWOA 3S2HH 1L1OB 5H1SE 1JMCA 2DUDA 1IBML 2V1CC 1WJJA 2UXDL 2OCEA 2UU9Q 2R7ZH 3WWVA 1X65A 3T1HQ 2ZTEA 1VQ7A 3T1YQ 2IHEA 4KI0A 5FJ8G 3M3YH 2UUAQ 4C3IH 1NE3A 4OONA 1G291 1IYJB 1S72A 1SFOH 1S3OA 4BY1G 4DV7L 3BU2A 4DV5Q 2OTJA 4IJHA 1XJVA 4P72A 4DAMA 4A4IA 3S17H 1TWAH 4NPSA 1HNXL 1WCMH 1SN8A 4IPCA 5GROA 4DR2Q 4O0AA 1EFWA 1C0AA 1SLJA 4YCVA 3SGIA 1VQKA 4QL5A 4A3LH 3DLLA 3BJUA 1Y1WG 4A3JG 4DR1L 1IXRA 1BVSA 1QUQB 1C9OA 4NXNQ 5AJ3L 1VQPA 3NENA 3TRZA 3KF8B 2KHIA 2B29A 3HOVH 2K52A 1JJCB 5HGQA 2IX0A 1QZHA 4X64L 3F2BA 2RHQB 4MZ9A 1PH5A 1UE1A 1VQCA 4QIWE 2UXDQ 3AQQA 3HOYH 4LFBL 1K3RA 1L1OA 1E24A 1LTLA 4DR3Q 1YI2A 3PUVA 1HNWL 2IY5B 1VQEA 1HR0Q 1Y1VG 2KCTA 3JAMi 3GDEA 3CPWA 2E2JH 4GKKQ 1Q86C 2VQEQ 1W3SA 1FJGQ 4GNXB 1VQNA 4KHPL 2YYZA 4JI4L 1PH9A 4YWMA 1K0RA 5BR8Q 1IBLQ 1PH3A 4DR5Q 2UXCL 1Q12A 2NN6G 3EBEA 4DR3L 4UY8C 1KXLA 2ATWA 4DV6L 4JI6L 4DK6C 1QVCA 4A3CG 1UWVA 2ZTCA 1IBKL 3H0GG 4LF4Q 1VQIA 1YHAA 3M4OH 1S40A 2MFIA 1OXUA 1CSQA 3HOXG 4JV5L 4X64Q 4EQ5A 3M85A 4IPHA 2NZOA 1IL2A 2RCNA 4JBMA 3CCVA 3HOYG 4JI1L 1A0IA 5E7NA 4LW1A 1X3EA 4JBJA 2MNAA 5GQOA 4BXXH 2ASBA 3JAMc 4HIOA 1IBLL 1YITA 5IYBG 4A93H 3S15H 4JC0A 2OTLA 3HOVG 1YNXA 3L2PA 4GNXC 3GTLH 1XMOQ 1G6PA 4NXNL 4GS3A 3J7ZC 3CCMA 1PH2A 3H3VI 3CMAA 1U5KA 4DKAC 2D0PA 1K73C 2E2HH 1N33L 4P75A 3GTPH 2WP8J 3FHWA 4K0KL 1KD1C 3I2ZA 3GTGH 4JI4Q 5C4XH 3A5UA 1Y14B 1XMQQ 4LNQA 2E2IH 3CCLA 2AWOA 2K5HA 2QEXA 1JJGA 2CWPA 1XPUA 4LFBQ 2CQOA 3HKZG 4BY1H 1Q82C 3OW2A 3K7AH 1NTGA 4YWKA 3I4MG 1CKMA 4A3IG 2KBNA 3RR5A 5IE8A 4APVA 1SMXA 3D31A 4HJ9A 1I3QH 3I55A 3CPFA 4MTNA 5IT9c 2R92H 1GO3E 1V9PA 3HOZH 2R7ZG 2WB1E 4X66L 2K50A 4AQYL 3K8AA 3DM3A 1N36Q 4DR5L 1E7ZA 1P16A 1X56A 4PG3A 4R4IA 2HT1A 4DV6Q 1K83H 4IJLA 1KAWA 4BY7G 1IBKQ 2JA6G 3KF6A 4YHHQ 2CKZB 1KRSA 5M3FG 4HJ8A 3KJPA 1M1KC 1QVFA 3K7UC 2HHHQ 4A3GG 1N9WA 4GN4B 2R92G 1MJCA 1CKNB 2VS1A 4UPAA 4K0KQ 3S1NH 2NVQH 4P71A 4A3IH 4YCWA 4LF6L 3I4MH 4A3BH 3T1YL 4DUYQ 3T1HL 3PIOA 3PSIA 3A74A 4OWTB 4JI8L 1UEBA 4YY3Q 1NY4A 2VQEL 4QQBX 2GN5A 3CW2C 4PZ6A 1V1QA 2BA0A 2PI2A 5JEAJ 4DK3C 4A3DH 4HJ5A 2ALYB 1NJIC 1QVGA 1GD7A 5GAEC 4QGUA 1H95A 2VUMH 3F1ZA 1HR0W 2Z6KC 1HNZL 2R6GA 3AFPA 3M4PA 1RL2A 4L5QA 3OTOQ 2A1AA 3KDFA 5LMUL 1X55A 2UXBQ 1EUJA 3JC66 3HOWG 1XPRA 1FVIA 3S2DH 4JI2Q 4YY3L 3PUYA 4DAYB 4GKJQ 5JJKA 3KJOA 1WI5A 1EWIA 1L2FA 3J81j 3GTMH 1R9TH 3B6YA 4JI5L 4C3HH 3KLWA 4UP9A 2PI2E 5HY6A 1HNXQ 4XTCS 3H0GH 4DR2L 4B3SL 1A63A 3K0XA 1PA6A 1EOVA 3F2DA 4DUYL 1PHJA 1N36L 3RN5A 5FLMG 4OX9L 4NXML 3KFUA 3Q8DA 1SE8A 3OYYA 1CKOA 1YHBA 2YTVA 1PV4A 4L5SA 2I5MX 4IOAA 4GLAC 1KC8C 1I5FA 2K75A 3PGZA 2HHHL 1HZCA 2EIFA 1TXYA 3PO3G 4JI1Q 1A8VA 2YTXA 2E8GA 1SROA 1BKBA 4L5TA 5IY0A 5BR8L 4B3RQ 3M4QA 3ICEA 1Y1VH 2VY3A 3ERSX 4LWCA 3F2CA 2IT1A 1UE7A 4X6AH 5IWAL 2WB1G 2AHOB 4R4QA 4QJFA 4A75A 1JE5A 2EQSA 1PFSA 1Z47A 4DV4L 4GOPB 4GKJL 5IP9H 3HOWH 4JI7Q 3ULJA 4POGA 4DUZL 2DGYA 2MQHA 1J5EQ 4OWWB 4BA2I 1PH6A 3J7A5 1LUZA 3CQZH 1VQOA 3GTQH 4ALPA 3GTJH 5GADC 1IZ6A 1X6OA 4LF8L 4IFDG 4R4OA 4HJ7A 2Q2UA 3EIVA 1YHQA 1N34Q 3W1GA 4JOIC 1EYGA 2JQOA 2MO0A 3CF5A 3GTKH 3UDFA 1X3FA 5IWAQ 4A3EH 4B3MQ 2A8VA 1E1OA 3PIPA 2JA8H 4A3LG 2K5NA 4DV1L 2NVYH 1TWGH 4GLVB 3CD6A 1N32L 1K8AC 1C7YA 2ZJQA 1J6QA 4XIGS 2VQFL 3UDGA 1XPOA 1HR0L 3GTOH 3G6EA 3RZOH 4B3RL 4LF9Q 2AKWB 3MEFA 5J3BA 4NB3A 4Y52H 2F3IA 1A62A 5IP7H 2ZJRA 4NXMQ 3E9HA 4A3GH 3IRBA 4JI8Q 3H15A 5M3FH 2ZM6Q 4YWLA 3TS0A 1I6HH 1MIUA 1MKHA 1VQAA 3CP0A 4DUZQ 3K81C 4IOCA 2BH8A 1XNQQ 4AQYQ 3J80i 3STBD 4OWXB 3HOZG 3HOUG 4LF8Q 3AFQA 2Y0SG 4P73A 1VQBA 1UE6A 4BBRG 1X3GA 3ZJYC 2D62A 3KYHC 4TVAB 2Z0SA 3UE1A 5JEAG 2ZM6L 1KQSA 3BZKA 1SR3A 2Q2TA 2A19A 3W1BA 4Y7NH 3G71A 2QA4A 1ASYA 3L0OA 5IYDG 1LM0A 3RZDH 4DR7L 1N32Q 3HKZE 1I94Q 2JA8G 3PUZA 1EQRA 4A3EG 2JA5H 4WJ3M 5ELNA 2JA9A 2I5HA 2RHSB 2B63G 2ID0A 5IYCH 4IFDJ 2LSSA 2VNUD 2L15A 3TEHB 2D0OA 5M3MH 3S1MH 3CCRA 5C44G 3PO2G 1YEZA 2JJQA 4GNXA 5IYBH 2E5LL 4A93G 2LXJA 2CCZA 4A3FH 5IP9G 1E1TA 4BXXG 3I56A 4A3MG 2R93G 4L5RC 3FKIG 4LUOA 3AEVA 1DGSA 1EQQA 1PVOA 1QUQA 4R1JA 2N49A 1HZBA 4X65L 4JYAL 5LMUQ 4WJ4A 3HOXH 5C0XG 2JEAI 4IPDA 2WAQE 4A3CH 2CFMA 2ZTDA 4DV7Q 2N3SA 1JB7A 3W5OA 1EIYB 3PO3H 1VQDA 3K80C 1VQ8A 4B3TQ 1IBMQ 1YZ6A 1TWFH 1HZ9A 3CCJA 1HNZQ 1PH8A 4JI0L 2YV5A 4IO9A 3STBC 2EXDA 1N34L 3F8TA 2KHJA 5C0XI 3PF5A 1RIPA 4O2DA 2F4VL 3RLOA 1FJGL 1OXSC 4DV3L 1QZGA 1K9MC 1GVPA 4JI7L 1N33Q 2E5LQ 4DV0L 1YBYA 2B3GA 2BH2A 4KHPQ 5LMNQ 1NBWA 4RMFA 1AE2A 1ASZA 1XNRQ 1FL0A 3M9BA 2N8NA 3NBHB 4LFAQ 3FP9A 3RLFA 1BBUA 4LF6Q 3U4ZA 4X65Q 1KIXA 4JYAQ 2K4KA 2JE6I 3PO2H 5M3MG 1Q1BA 2Z6KA 3A0JA 1X9NA 2HIVA 4DR4L 3S24A 5GAHC 4DR6L 2B63H 2PQAB 1Q8KA 4A3JH 3CCUA 2GVAA 1PYSB 4HIKA 2NVXH 3KOJA 3NELA 1P8LA 3HKSA 2OQ0A 3UDXA 3GD7A 4HJAA 1KRTA 5C4JH 1K8GA 4JI3Q 4LF9L 4ME3A 4DV2L 3J81i 3G4SA 1VQMA 4LFCL 3PV0A 4UP7A 5IYDH 3RNUA 1D8LA 1GKHA 2FXQA 3E0EA 3G48A 3TQYA 1VQHA 2GVBA 4JI6Q 4A3BG 2R7FA 2NN6I 4PMWA 1YJWA 4DV1Q 4RG1A 1B7YB 1OXVA 4DPGA 3KDFB 3CAMA 2VW9A 1N8RC 2I0QA 1JT8A 4BA1I 3S1QH 4BBRH 5FJ8H 4DR7Q 4C3JH 2KCMA 2MO1A 4PZ8A 5LMNL 1CKNA 1YJNA 1VQ5A 1XNQL 3HOUH 4LFAL 3UDIA 4POFA 1OXTA 5GAGC 1PYBA 2JA6H 4BY7H 1T9HA 3TREA 2K14A 5LMNW 4BBSH 4JI0Q 4R4TA 4BBSG 2HIXA 4YCUA 2VL6A 4X62L 2F4VQ 3PUXA 1B70B 1GM5A 3PF4A 2UUCL 2C35B 5JJLA 2IHFA 2N78A 5IP7G 2BA1A 3CCEA 1I50H 3I7FA 3CCSA 1VQFA 4HIMA 3ULPA 3CC4A 1KHIA 2RF4A 2WAQG 1I94L 4JBKA 4GN3B 1PH4A 1HH2P 1OXXK 2PQAA 3AYHB 2XGTA 3BZCA 1VCIA 4PZ7A 3RLNA 1WYDA 2LXKA 5C3EH 4DR1Q 4LFCQ 2ES2A 4LF5L 5AJ3Q 3L7ZC 3KF6B 4A3KH 2QGQA 3M7NA 5C4XG 2AMCB 4KHZA 1XMOL 1PH7A 1L0WA 2YU9H 4KLKA 4AH6A 4JI5Q 3S16H 2CWAA 3A5ZB 5K36G 3E9IA 4DV5L 4P74A 1VQ4A 5JJIA 1XMQL 1CUKA 1VQGA 2KENA 2Q2HA 1LYLA 1AH9A 3RN2A 2JA7G 2JEBI 3PUWA 3CC2A 1XTDA 1HNWQ 4LF7L 1WOCA 3I4NG 2ZJPA 2F52A 1HJPA 5M5WH 1PH1A 1M90C 4DV3Q 1J5EL 2PMZE 2Q2IA 3UE0A 3ULLA 4MNOA 2OQKA 3PCOB 4X66Q 4IPGA 4HIDA 4AIMA 1YIJA 1EIFA 1NMFA 3VDYA 1Q81C 1VQ6A 2K5VA 1WFQA 2UUBL 4LUVA 4AYBE 3U4VA 4X62Q 4LF4L 4B3ML 4DNIA 2HQLA 5M5YH 3CCQA 1AE3A 1FGUA 4GOPA 2YTYA 1E3PA 4FDBA 1L1OC 5C0XJ 3CC7A 1B8AA 2NVTH 3D0FA 5FLMH 3J81c 1SRUA 4QY7A 1UE5A 1VQ9A 1TWHH 1VS0A 3U50C 4DR6Q 3CMEA 4DV2Q 3MXNB 4C2MH 3LGJA 4GKKL 3HFZB 1VQLA 3FKIH 2UUBQ 4LF5Q 3GO5A 4A3MH 4JI2L 4OO1G 2R93H 1CSPA 3I4NH 2H5XA 4A3FG 5M5XH 1Z9FA 4JV5Q 2JA7H 4R4CA 4JBWA 3CXCA 2R7DA 1X54A 4JI3L 2XTIA 3NEMA 4AYBG 5C44H 2VQFQ 4EX5A 1VQJA 3S1RH 4B3TL 2VUMG 3TS2A 1Q1EA 5ELOA 3S14H 4OX9Q 5IYCG 1U0LA 4A3DG 2UXCQ 2I5LX 1Y1WH 4OO1I 3OTOL 3H3VH 4LF7Q 2UXBL 4A76A 3U58A 4TQUS 2JA5G 2PNHA 3I4OA 5EAYA 4H02A 1V43A 5DLQE 1KL9A 1WCMG 4OXPA 4A3KG 5FLXc 3EN2A 1JJ2A 1BBWA 2UUCQ 2Y0SE 4JOIA 2IX1A 4DR4Q 1O7IA 2VZAA 4IFDI 5C3EG 1Q7YC 4DV0Q 2WFWA 1YJ9A 1NMGA 1XNRL 4GOPC 1E22A 4B3SQ 3J80c 2UU9L 4JG2A 1G51A 4JCVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLX A;  2UUA L;  1W2B A;  1HZA A;  1MJE A;  4LUZ A;  4YHH L;  4DV4 Q;  3ER0 A;  1OTC A;  2AWN A;  4GN5 A;  4UP8 A;  1D7Q A;  1Q46 A;  1TWC H;  1YVC A;  2NZH A;  2JK8 A;  4J15 A;  2OWO A;  3S2H H;  1L1O B;  5H1S E;  1JMC A;  2DUD A;  1IBM L;  2V1C C;  1WJJ A;  2UXD L;  2OCE A;  2UU9 Q;  2R7Z H;  3WWV A;  1X65 A;  3T1H Q;  2ZTE A;  1VQ7 A;  3T1Y Q;  2IHE A;  4KI0 A;  5FJ8 G;  3M3Y H;  2UUA Q;  4C3I H;  1NE3 A;  4OON A;  1G29 1;  1IYJ B;  1S72 A;  1SFO H;  1S3O A;  4BY1 G;  4DV7 L;  3BU2 A;  4DV5 Q;  2OTJ A;  4IJH A;  1XJV A;  4P72 A;  4DAM A;  4A4I A;  3S17 H;  1TWA H;  4NPS A;  1HNX L;  1WCM H;  1SN8 A;  4IPC A;  5GRO A;  4DR2 Q;  4O0A A;  1EFW A;  1C0A A;  1SLJ A;  4YCV A;  3SGI A;  1VQK A;  4QL5 A;  4A3L H;  3DLL A;  3BJU A;  1Y1W G;  4A3J G;  4DR1 L;  1IXR A;  1BVS A;  1QUQ B;  1C9O A;  4NXN Q;  5AJ3 L;  1VQP A;  3NEN A;  3TRZ A;  3KF8 B;  2KHI A;  2B29 A;  3HOV H;  2K52 A;  1JJC B;  5HGQ A;  2IX0 A;  1QZH A;  4X64 L;  3F2B A;  2RHQ B;  4MZ9 A;  1PH5 A;  1UE1 A;  1VQC A;  4QIW E;  2UXD Q;  3AQQ A;  3HOY H;  4LFB L;  1K3R A;  1L1O A;  1E24 A;  1LTL A;  4DR3 Q;  1YI2 A;  3PUV A;  1HNW L;  2IY5 B;  1VQE A;  1HR0 Q;  1Y1V G;  2KCT A;  3JAM i;  3GDE A;  3CPW A;  2E2J H;  4GKK Q;  1Q86 C;  2VQE Q;  1W3S A;  1FJG Q;  4GNX B;  1VQN A;  4KHP L;  2YYZ A;  4JI4 L;  1PH9 A;  4YWM A;  1K0R A;  5BR8 Q;  1IBL Q;  1PH3 A;  4DR5 Q;  2UXC L;  1Q12 A;  2NN6 G;  3EBE A;  4DR3 L;  4UY8 C;  1KXL A;  2ATW A;  4DV6 L;  4JI6 L;  4DK6 C;  1QVC A;  4A3C G;  1UWV A;  2ZTC A;  1IBK L;  3H0G G;  4LF4 Q;  1VQI A;  1YHA A;  3M4O H;  1S40 A;  2MFI A;  1OXU A;  1CSQ A;  3HOX G;  4JV5 L;  4X64 Q;  4EQ5 A;  3M85 A;  4IPH A;  2NZO A;  1IL2 A;  2RCN A;  4JBM A;  3CCV A;  3HOY G;  4JI1 L;  1A0I A;  5E7N A;  4LW1 A;  1X3E A;  4JBJ A;  2MNA A;  5GQO A;  4BXX H;  2ASB A;  3JAM c;  4HIO A;  1IBL L;  1YIT A;  5IYB G;  4A93 H;  3S15 H;  4JC0 A;  2OTL A;  3HOV G;  1YNX A;  3L2P A;  4GNX C;  3GTL H;  1XMO Q;  1G6P A;  4NXN L;  4GS3 A;  3J7Z C;  3CCM A;  1PH2 A;  3H3V I;  3CMA A;  1U5K A;  4DKA C;  2D0P A;  1K73 C;  2E2H H;  1N33 L;  4P75 A;  3GTP H;  2WP8 J;  3FHW A;  4K0K L;  1KD1 C;  3I2Z A;  3GTG H;  4JI4 Q;  5C4X H;  3A5U A;  1Y14 B;  1XMQ Q;  4LNQ A;  2E2I H;  3CCL A;  2AWO A;  2K5H A;  2QEX A;  1JJG A;  2CWP A;  1XPU A;  4LFB Q;  2CQO A;  3HKZ G;  4BY1 H;  1Q82 C;  3OW2 A;  3K7A H;  1NTG A;  4YWK A;  3I4M G;  1CKM A;  4A3I G;  2KBN A;  3RR5 A;  5IE8 A;  4APV A;  1SMX A;  3D31 A;  4HJ9 A;  1I3Q H;  3I55 A;  3CPF A;  4MTN A;  5IT9 c;  2R92 H;  1GO3 E;  1V9P A;  3HOZ H;  2R7Z G;  2WB1 E;  4X66 L;  2K50 A;  4AQY L;  3K8A A;  3DM3 A;  1N36 Q;  4DR5 L;  1E7Z A;  1P16 A;  1X56 A;  4PG3 A;  4R4I A;  2HT1 A;  4DV6 Q;  1K83 H;  4IJL A;  1KAW A;  4BY7 G;  1IBK Q;  2JA6 G;  3KF6 A;  4YHH Q;  2CKZ B;  1KRS A;  5M3F G;  4HJ8 A;  3KJP A;  1M1K C;  1QVF A;  3K7U C;  2HHH Q;  4A3G G;  1N9W A;  4GN4 B;  2R92 G;  1MJC A;  1CKN B;  2VS1 A;  4UPA A;  4K0K Q;  3S1N H;  2NVQ H;  4P71 A;  4A3I H;  4YCW A;  4LF6 L;  3I4M H;  4A3B H;  3T1Y L;  4DUY Q;  3T1H L;  3PIO A;  3PSI A;  3A74 A;  4OWT B;  4JI8 L;  1UEB A;  4YY3 Q;  1NY4 A;  2VQE L;  4QQB X;  2GN5 A;  3CW2 C;  4PZ6 A;  1V1Q A;  2BA0 A;  2PI2 A;  5JEA J;  4DK3 C;  4A3D H;  4HJ5 A;  2ALY B;  1NJI C;  1QVG A;  1GD7 A;  5GAE C;  4QGU A;  1H95 A;  2VUM H;  3F1Z A;  1HR0 W;  2Z6K C;  1HNZ L;  2R6G A;  3AFP A;  3M4P A;  1RL2 A;  4L5Q A;  3OTO Q;  2A1A A;  3KDF A;  5LMU L;  1X55 A;  2UXB Q;  1EUJ A;  3JC6 6;  3HOW G;  1XPR A;  1FVI A;  3S2D H;  4JI2 Q;  4YY3 L;  3PUY A;  4DAY B;  4GKJ Q;  5JJK A;  3KJO A;  1WI5 A;  1EWI A;  1L2F A;  3J81 j;  3GTM H;  1R9T H;  3B6Y A;  4JI5 L;  4C3H H;  3KLW A;  4UP9 A;  2PI2 E;  5HY6 A;  1HNX Q;  4XTC S;  3H0G H;  4DR2 L;  4B3S L;  1A63 A;  3K0X A;  1PA6 A;  1EOV A;  3F2D A;  4DUY L;  1PHJ A;  1N36 L;  3RN5 A;  5FLM G;  4OX9 L;  4NXM L;  3KFU A;  3Q8D A;  1SE8 A;  3OYY A;  1CKO A;  1YHB A;  2YTV A;  1PV4 A;  4L5S A;  2I5M X;  4IOA A;  4GLA C;  1KC8 C;  1I5F A;  2K75 A;  3PGZ A;  2HHH L;  1HZC A;  2EIF A;  1TXY A;  3PO3 G;  4JI1 Q;  1A8V A;  2YTX A;  2E8G A;  1SRO A;  1BKB A;  4L5T A;  5IY0 A;  5BR8 L;  4B3R Q;  3M4Q A;  3ICE A;  1Y1V H;  2VY3 A;  3ERS X;  4LWC A;  3F2C A;  2IT1 A;  1UE7 A;  4X6A H;  5IWA L;  2WB1 G;  2AHO B;  4R4Q A;  4QJF A;  4A75 A;  1JE5 A;  2EQS A;  1PFS A;  1Z47 A;  4DV4 L;  4GOP B;  4GKJ L;  5IP9 H;  3HOW H;  4JI7 Q;  3ULJ A;  4POG A;  4DUZ L;  2DGY A;  2MQH A;  1J5E Q;  4OWW B;  4BA2 I;  1PH6 A;  3J7A 5;  1LUZ A;  3CQZ H;  1VQO A;  3GTQ H;  4ALP A;  3GTJ H;  5GAD C;  1IZ6 A;  1X6O A;  4LF8 L;  4IFD G;  4R4O A;  4HJ7 A;  2Q2U A;  3EIV A;  1YHQ A;  1N34 Q;  3W1G A;  4JOI C;  1EYG A;  2JQO A;  2MO0 A;  3CF5 A;  3GTK H;  3UDF A;  1X3F A;  5IWA Q;  4A3E H;  4B3M Q;  2A8V A;  1E1O A;  3PIP A;  2JA8 H;  4A3L G;  2K5N A;  4DV1 L;  2NVY H;  1TWG H;  4GLV B;  3CD6 A;  1N32 L;  1K8A C;  1C7Y A;  2ZJQ A;  1J6Q A;  4XIG S;  2VQF L;  3UDG A;  1XPO A;  1HR0 L;  3GTO H;  3G6E A;  3RZO H;  4B3R L;  4LF9 Q;  2AKW B;  3MEF A;  5J3B A;  4NB3 A;  4Y52 H;  2F3I A;  1A62 A;  5IP7 H;  2ZJR A;  4NXM Q;  3E9H A;  4A3G H;  3IRB A;  4JI8 Q;  3H15 A;  5M3F H;  2ZM6 Q;  4YWL A;  3TS0 A;  1I6H H;  1MIU A;  1MKH A;  1VQA A;  3CP0 A;  4DUZ Q;  3K81 C;  4IOC A;  2BH8 A;  1XNQ Q;  4AQY Q;  3J80 i;  3STB D;  4OWX B;  3HOZ G;  3HOU G;  4LF8 Q;  3AFQ A;  2Y0S G;  4P73 A;  1VQB A;  1UE6 A;  4BBR G;  1X3G A;  3ZJY C;  2D62 A;  3KYH C;  4TVA B;  2Z0S A;  3UE1 A;  5JEA G;  2ZM6 L;  1KQS A;  3BZK A;  1SR3 A;  2Q2T A;  2A19 A;  3W1B A;  4Y7N H;  3G71 A;  2QA4 A;  1ASY A;  3L0O A;  5IYD G;  1LM0 A;  3RZD H;  4DR7 L;  1N32 Q;  3HKZ E;  1I94 Q;  2JA8 G;  3PUZ A;  1EQR A;  4A3E G;  2JA5 H;  4WJ3 M;  5ELN A;  2JA9 A;  2I5H A;  2RHS B;  2B63 G;  2ID0 A;  5IYC H;  4IFD J;  2LSS A;  2VNU D;  2L15 A;  3TEH B;  2D0O A;  5M3M H;  3S1M H;  3CCR A;  5C44 G;  3PO2 G;  1YEZ A;  2JJQ A;  4GNX A;  5IYB H;  2E5L L;  4A93 G;  2LXJ A;  2CCZ A;  4A3F H;  5IP9 G;  1E1T A;  4BXX G;  3I56 A;  4A3M G;  2R93 G;  4L5R C;  3FKI G;  4LUO A;  3AEV A;  1DGS A;  1EQQ A;  1PVO A;  1QUQ A;  4R1J A;  2N49 A;  1HZB A;  4X65 L;  4JYA L;  5LMU Q;  4WJ4 A;  3HOX H;  5C0X G;  2JEA I;  4IPD A;  2WAQ E;  4A3C H;  2CFM A;  2ZTD A;  4DV7 Q;  2N3S A;  1JB7 A;  3W5O A;  1EIY B;  3PO3 H;  1VQD A;  3K80 C;  1VQ8 A;  4B3T Q;  1IBM Q;  1YZ6 A;  1TWF H;  1HZ9 A;  3CCJ A;  1HNZ Q;  1PH8 A;  4JI0 L;  2YV5 A;  4IO9 A;  3STB C;  2EXD A;  1N34 L;  3F8T A;  2KHJ A;  5C0X I;  3PF5 A;  1RIP A;  4O2D A;  2F4V L;  3RLO A;  1FJG L;  1OXS C;  4DV3 L;  1QZG A;  1K9M C;  1GVP A;  4JI7 L;  1N33 Q;  2E5L Q;  4DV0 L;  1YBY A;  2B3G A;  2BH2 A;  4KHP Q;  5LMN Q;  1NBW A;  4RMF A;  1AE2 A;  1ASZ A;  1XNR Q;  1FL0 A;  3M9B A;  2N8N A;  3NBH B;  4LFA Q;  3FP9 A;  3RLF A;  1BBU A;  4LF6 Q;  3U4Z A;  4X65 Q;  1KIX A;  4JYA Q;  2K4K A;  2JE6 I;  3PO2 H;  5M3M G;  1Q1B A;  2Z6K A;  3A0J A;  1X9N A;  2HIV A;  4DR4 L;  3S24 A;  5GAH C;  4DR6 L;  2B63 H;  2PQA B;  1Q8K A;  4A3J H;  3CCU A;  2GVA A;  1PYS B;  4HIK A;  2NVX H;  3KOJ A;  3NEL A;  1P8L A;  3HKS A;  2OQ0 A;  3UDX A;  3GD7 A;  4HJA A;  1KRT A;  5C4J H;  1K8G A;  4JI3 Q;  4LF9 L;  4ME3 A;  4DV2 L;  3J81 i;  3G4S A;  1VQM A;  4LFC L;  3PV0 A;  4UP7 A;  5IYD H;  3RNU A;  1D8L A;  1GKH A;  2FXQ A;  3E0E A;  3G48 A;  3TQY A;  1VQH A;  2GVB A;  4JI6 Q;  4A3B G;  2R7F A;  2NN6 I;  4PMW A;  1YJW A;  4DV1 Q;  4RG1 A;  1B7Y B;  1OXV A;  4DPG A;  3KDF B;  3CAM A;  2VW9 A;  1N8R C;  2I0Q A;  1JT8 A;  4BA1 I;  3S1Q H;  4BBR H;  5FJ8 H;  4DR7 Q;  4C3J H;  2KCM A;  2MO1 A;  4PZ8 A;  5LMN L;  1CKN A;  1YJN A;  1VQ5 A;  1XNQ L;  3HOU H;  4LFA L;  3UDI A;  4POF A;  1OXT A;  5GAG C;  1PYB A;  2JA6 H;  4BY7 H;  1T9H A;  3TRE A;  2K14 A;  5LMN W;  4BBS H;  4JI0 Q;  4R4T A;  4BBS G;  2HIX A;  4YCU A;  2VL6 A;  4X62 L;  2F4V Q;  3PUX A;  1B70 B;  1GM5 A;  3PF4 A;  2UUC L;  2C35 B;  5JJL A;  2IHF A;  2N78 A;  5IP7 G;  2BA1 A;  3CCE A;  1I50 H;  3I7F A;  3CCS A;  1VQF A;  4HIM A;  3ULP A;  3CC4 A;  1KHI A;  2RF4 A;  2WAQ G;  1I94 L;  4JBK A;  4GN3 B;  1PH4 A;  1HH2 P;  1OXX K;  2PQA A;  3AYH B;  2XGT A;  3BZC A;  1VCI A;  4PZ7 A;  3RLN A;  1WYD A;  2LXK A;  5C3E H;  4DR1 Q;  4LFC Q;  2ES2 A;  4LF5 L;  5AJ3 Q;  3L7Z C;  3KF6 B;  4A3K H;  2QGQ A;  3M7N A;  5C4X G;  2AMC B;  4KHZ A;  1XMO L;  1PH7 A;  1L0W A;  2YU9 H;  4KLK A;  4AH6 A;  4JI5 Q;  3S16 H;  2CWA A;  3A5Z B;  5K36 G;  3E9I A;  4DV5 L;  4P74 A;  1VQ4 A;  5JJI A;  1XMQ L;  1CUK A;  1VQG A;  2KEN A;  2Q2H A;  1LYL A;  1AH9 A;  3RN2 A;  2JA7 G;  2JEB I;  3PUW A;  3CC2 A;  1XTD A;  1HNW Q;  4LF7 L;  1WOC A;  3I4N G;  2ZJP A;  2F52 A;  1HJP A;  5M5W H;  1PH1 A;  1M90 C;  4DV3 Q;  1J5E L;  2PMZ E;  2Q2I A;  3UE0 A;  3ULL A;  4MNO A;  2OQK A;  3PCO B;  4X66 Q;  4IPG A;  4HID A;  4AIM A;  1YIJ A;  1EIF A;  1NMF A;  3VDY A;  1Q81 C;  1VQ6 A;  2K5V A;  1WFQ A;  2UUB L;  4LUV A;  4AYB E;  3U4V A;  4X62 Q;  4LF4 L;  4B3M L;  4DNI A;  2HQL A;  5M5Y H;  3CCQ A;  1AE3 A;  1FGU A;  4GOP A;  2YTY A;  1E3P A;  4FDB A;  1L1O C;  5C0X J;  3CC7 A;  1B8A A;  2NVT H;  3D0F A;  5FLM H;  3J81 c;  1SRU A;  4QY7 A;  1UE5 A;  1VQ9 A;  1TWH H;  1VS0 A;  3U50 C;  4DR6 Q;  3CME A;  4DV2 Q;  3MXN B;  4C2M H;  3LGJ A;  4GKK L;  3HFZ B;  1VQL A;  3FKI H;  2UUB Q;  4LF5 Q;  3GO5 A;  4A3M H;  4JI2 L;  4OO1 G;  2R93 H;  1CSP A;  3I4N H;  2H5X A;  4A3F G;  5M5X H;  1Z9F A;  4JV5 Q;  2JA7 H;  4R4C A;  4JBW A;  3CXC A;  2R7D A;  1X54 A;  4JI3 L;  2XTI A;  3NEM A;  4AYB G;  5C44 H;  2VQF Q;  4EX5 A;  1VQJ A;  3S1R H;  4B3T L;  2VUM G;  3TS2 A;  1Q1E A;  5ELO A;  3S14 H;  4OX9 Q;  5IYC G;  1U0L A;  4A3D G;  2UXC Q;  2I5L X;  1Y1W H;  4OO1 I;  3OTO L;  3H3V H;  4LF7 Q;  2UXB L;  4A76 A;  3U58 A;  4TQU S;  2JA5 G;  2PNH A;  3I4O A;  5EAY A;  4H02 A;  1V43 A;  5DLQ E;  1KL9 A;  1WCM G;  4OXP A;  4A3K G;  5FLX c;  3EN2 A;  1JJ2 A;  1BBW A;  2UUC Q;  2Y0S E;  4JOI A;  2IX1 A;  4DR4 Q;  1O7I A;  2VZA A;  4IFD I;  5C3E G;  1Q7Y C;  4DV0 Q;  2WFW A;  1YJ9 A;  1NMG A;  1XNR L;  4GOP C;  1E22 A;  4B3S Q;  3J80 c;  2UU9 L;  4JG2 A;  1G51 A;  4JCV E; 
#chains in the Genus database with same CATH topology
 1BOS A;  4A3F B;  4HED A;  2AWN A;  4GN5 A;  1O7Z A;  1D7Q A;  1Y1W B;  2NZH A;  3S2H H;  1O80 A;  1L1O B;  1RTO A;  2J4X A;  4DXG A;  2A6E C;  3OPO A;  2UU9 Q;  3T1H Q;  2KUM A;  2LKV A;  3VYR A;  4I7A A;  2AUK A;  3SK8 A;  2XRQ D;  4LJZ C;  4CKB A;  4BY1 G;  3FVQ A;  3CRL C;  4IJH A;  4P72 A;  4BY1 B;  5DM7 3;  4HSV A;  1QNU A;  3S17 H;  1EFW A;  1EIH A;  4ZK9 B;  1VQK A;  4P2C B;  4MTK A;  4DXF A;  3DMU A;  1C9O A;  4NXN Q;  1STE A;  2B29 A;  3I90 A;  3OMC A;  3HOV H;  1R4Q B;  3NHH A;  3F2B A;  2HDM A;  2RHQ B;  4MZ9 A;  5CBA E;  1UE1 A;  2E2J B;  1L1O A;  4A3D B;  1VQE A;  3R2T A;  2KCT A;  1C4Q A;  1JWM D;  1Q86 C;  2RDH A;  4X3U A;  4DFA A;  1HPC A;  3MXN A;  1H9J A;  1GJX A;  3BVG A;  5LL6 S;  5BR8 Q;  2UXC L;  1F9S A;  4DR3 L;  5DAU A;  4JK1 C;  5CC4 A;  1XWE A;  2JA7 B;  1KXL A;  3H0G B;  1UWV A;  1KDB A;  2ZTC A;  3H0G G;  1IBK L;  2MFI A;  1OXU A;  4CDF C;  4JV5 L;  3M85 A;  1ICF B;  4LW1 A;  3QG1 A;  2MNA A;  4BXX H;  3DWQ A;  1IBL L;  5EGT A;  3SE0 A;  5IYB G;  3S15 H;  2OTL A;  3HOV G;  1YNX A;  3KLS A;  1EQV A;  1G6P A;  3J7Z C;  1PH2 A;  3AB9 A;  2K1B A;  1N33 L;  5I2X A;  1AFP A;  3GTP H;  3A8K E;  3GTG H;  3V96 A;  3VA5 A;  1Y14 B;  1XMQ Q;  1PZI D;  3CCL A;  5C3X A;  1BCP D;  1WTR A;  4DU9 A;  3C3L A;  2F1M A;  1NTG A;  4J6H A;  3RR5 A;  5IE8 A;  4J1M A;  4K5X A;  5EBC A;  3RD4 A;  4MTN A;  1GO3 E;  1V9P A;  1KLU D;  3HOZ H;  1KDA A;  3K8A A;  3OMG A;  3DM3 A;  5C6A A;  3X3N A;  4R4I A;  4FF1 A;  2HT1 A;  2L5T A;  2IPK D;  3D3R A;  4IJL A;  4BY7 G;  1IBK Q;  3W2D A;  4YHH Q;  4NMZ A;  2EYH A;  3KJP A;  3EQL C;  3K7U C;  1K28 A;  1SNQ A;  2K01 A;  4ABN A;  2VS1 A;  3SVM A;  4A3I H;  2X6L A;  3T1Y L;  3PSI A;  3A74 A;  4YY3 Q;  2L0C A;  1NY4 A;  2Z9H A;  4PZ6 A;  2VUM B;  1V1Q A;  2BA0 A;  4A3D H;  4PMC A;  5TSS A;  5GAE C;  5E3F A;  5FLX L;  3F1Z A;  3N6R A;  2Z6K C;  1F2L A;  1S5E D;  4L5Q A;  3M4P A;  1RL2 A;  3OTO Q;  4LK1 C;  1KAA A;  2B39 A;  1XPR A;  4QCL A;  5JJK A;  1WI5 A;  3J7Y W;  5COY A;  5LHY 1;  3B6Y A;  4JI5 L;  4UP9 A;  2Z6B A;  5HY6 A;  4XTC S;  3GTL B;  2PW5 A;  3FEW X;  1DD2 A;  1PLF A;  1PA6 A;  3G6J B;  4DUY L;  4WRD A;  3KFU A;  3T53 B;  1SE8 A;  4KY5 A;  1CKO A;  3O13 A;  3OYY A;  1Z6H A;  2QDB A;  2K75 A;  4R9W A;  3PGZ A;  1EQT A;  5A2Q E;  1HZC A;  2EIF A;  1TXY A;  1VF5 C;  2F0M A;  1VDZ A;  5IY0 A;  4L5T A;  3VR5 A;  2JYO A;  4TRD A;  4R4Q A;  4A75 A;  1JE5 A;  2EQS A;  3H6M A;  4GKJ L;  4A3K B;  4POG A;  4DUZ L;  2DGY A;  2MQH A;  4BA2 I;  1K3B C;  1LUZ A;  4G7Z C;  5GAD C;  4IFD G;  2KVM A;  4R4O A;  4HJ7 A;  1SNP A;  5EJW A;  1D1K A;  1IYU A;  4HMI A;  1LTI D;  5ELE A;  1ZYR C;  1X3F A;  1DOK A;  3HOZ B;  3M4Y A;  4OIK A;  5IGD A;  1DYQ A;  4A3E B;  2WAQ B;  1JCK B;  4XIG S;  3W3A A;  4B3R L;  3R3O A;  2AKW B;  4EQN A;  1F9Q A;  4Y52 H;  2F3I A;  1XX8 A;  5D3D A;  1A62 A;  5FOB B;  4NXM Q;  4A3G H;  3H15 A;  4G4K A;  5IT9 L;  1I6H H;  1MKH A;  1VQA A;  4IUU A;  4DAV A;  3L3O C;  1BQQ T;  5M5Y B;  5E4W C;  4IOC A;  2BH8 A;  1XNQ Q;  3J80 i;  3STB D;  5ELD A;  3HOU G;  4BBR B;  3NXW A;  4P73 A;  2PMZ B;  4BBR G;  1YNJ C;  3UE1 A;  1UAP A;  1KQS A;  2Q2T A;  3AMU A;  4ZUJ A;  3G71 A;  1ONL A;  1MD2 D;  4DR7 L;  5IYD G;  3RZD H;  3GV6 A;  1N32 Q;  5M5X B;  1CI3 M;  1EQR A;  3PUZ A;  3D4D A;  4WJ3 M;  3KLR A;  5IOC A;  1H9K A;  2EJF C;  2RHS B;  4KKT A;  3KLS X;  3V05 A;  2VNU D;  3MAQ A;  2A68 C;  3CCR A;  4DNR B;  2JJQ A;  2E2I B;  1H9R A;  2CCZ A;  1BNZ A;  4K8J A;  3I56 A;  3FKI G;  5ELC A;  1GUN A;  1PVO A;  1QUQ A;  1V1P B;  4O1N A;  5LMU Q;  4B9X A;  1SYB A;  4IPD A;  1STG A;  4A3C H;  4ZRZ A;  2P5Z X;  1HUM A;  3C2P A;  1EY8 A;  1YZ6 A;  1PTO C;  3CCJ A;  3E5S A;  1TWG B;  3OW7 A;  5J39 A;  2EXD A;  1CTM A;  3F8T A;  3C1E A;  1LTR D;  3PF5 A;  1LTA D;  4DA2 A;  3TP7 A;  1B9M A;  1OXS C;  1QZG A;  1K9M C;  1YBY A;  2B3G A;  4KHP Q;  1NBW A;  1ASZ A;  4KJN A;  3RLF A;  3FP9 A;  2D2C C;  4X65 Q;  2Y0S B;  2EYF A;  2JE6 I;  3OIQ A;  3I4N B;  1HFN A;  1LLR D;  3S24 A;  2HD3 A;  3MTS A;  4A3J H;  2F0P A;  5KGU A;  1PYS B;  3KOJ A;  3UDX A;  2CVR A;  1KRT A;  1AN8 A;  3BYY B;  4JI3 Q;  2B2U C;  2QCP X;  4DV2 L;  3G4S A;  3PV0 A;  4UP7 A;  3RNU A;  2FXQ A;  2GVB A;  1YJW A;  1A3V A;  4UDU C;  2I0Q A;  4BA1 I;  1JT8 A;  2N55 A;  3DWP A;  2KCM A;  1ENF A;  2KCC A;  4A93 B;  2KHS A;  4LFA L;  2XN9 C;  4POF A;  1OXT A;  1TQO A;  5LMN W;  1H9S A;  4C3H B;  2VL6 A;  5EPJ A;  4X62 L;  2XRS D;  4FXD A;  3LX0 A;  2UUC L;  2MPM A;  4BWG B;  4C3J G;  1DZ1 A;  4ZYS A;  5IP7 G;  3CC4 A;  4GN3 B;  1OXX K;  4C3I B;  1WYD A;  5C3E H;  2ES2 A;  2D9U A;  3L7Z C;  4A3K H;  4KHZ A;  1PH7 A;  1J8I A;  2RKS A;  3I4L A;  5K36 G;  4X3T A;  4CKE A;  1ILP A;  4P74 A;  5JJI A;  1J9O A;  3K7A B;  4WFN 3;  4N9T A;  3RN2 A;  1HQM C;  1XTD A;  1HNW Q;  1I3Q B;  1XYI A;  4Z9C B;  1WOC A;  2NBF A;  2F0L A;  4IUT A;  1HJP A;  4KK7 A;  5M5W H;  1PH1 A;  2EY6 A;  4XT3 B;  4DV3 Q;  1HHV A;  1A3T A;  2J0T D;  3I8Z A;  4X66 Q;  1YIJ A;  4AIM A;  2PPB C;  3VDY A;  1ET6 A;  3H3V C;  2MP1 A;  1WFQ A;  3ONA B;  2UUB L;  4X62 Q;  3CCQ A;  5M5Y H;  3DHQ A;  1E3P A;  2NVT H;  3D0F A;  1ML0 D;  5FLM H;  2DY8 A;  1VQ9 A;  4PQX A;  3BYT B;  1B3A A;  2R93 B;  1CK1 A;  3I4M B;  4A3M H;  4JI2 L;  4OO1 G;  1CSP A;  3K0Y A;  3I4N H;  3QOJ A;  4JV5 Q;  4R4C A;  2R7D A;  4TKO B;  4EX5 A;  5ELO A;  4N9P A;  5CYU A;  1NR2 A;  1W6K A;  5K36 H;  2I5L X;  4DF7 A;  1EY0 A;  4S3S A;  4A76 A;  2JA5 G;  2V4D A;  2JA5 B;  4DR6 Q;  4A3K G;  1BBW A;  2Y0S E;  2VZA A;  3FKI B;  5C4H A;  5C3E G;  4GOP C;  4B3S Q;  5G3L D;  2NTS A;  1LTG D;  1U9R A;  2PNR C;  2UUA L;  4LUZ A;  4YHH L;  2F03 A;  3ER0 A;  1OTC A;  4UP8 A;  3NP8 A;  1GUS A;  3IFT A;  2JK8 A;  2OWO A;  5AFW A;  5H1S E;  1JMC A;  3QB3 A;  3J7A F;  2ZXP A;  5E4X A;  1WJJ A;  1SAP A;  2OCE A;  2R7Z H;  3WWV A;  2ZTE A;  1Y8N B;  2IHE A;  4KI0 A;  3MXP A;  4C3I H;  3A54 A;  1B50 A;  1SFO H;  1TWA H;  1HNX L;  1SNC A;  3Q6S A;  1SN8 A;  3IFD A;  4O0A A;  2O2L D;  1C0A A;  1MSG A;  4MIU A;  3DLL A;  3BJU A;  1FNV A;  4A3J G;  3GTJ B;  4A3J B;  1BDO A;  4K5V A;  4M1U B;  1QNK A;  3KF8 B;  2KHI A;  2JSO A;  3KBG A;  1EOT A;  2OT2 A;  2IX0 A;  4X64 L;  4IUQ A;  1VQC A;  3HOV B;  2F0H A;  3J81 L;  1LTL A;  4GKK Q;  2BDN A;  3GDE A;  3JAM i;  2E2J H;  1VF7 A;  2VQE Q;  5KNB A;  1SYE A;  1FJG Q;  3I72 A;  3HZX A;  2WII B;  4DAP A;  2ZXR A;  1I4P A;  2YYZ A;  5T1G A;  1KAB A;  3HS0 C;  3GTM B;  4DNT B;  1D6E C;  5M9O A;  1Q12 A;  4IUP A;  4X3K A;  5JOB A;  2ATW A;  4DV6 L;  1SNO A;  4KN4 C;  4A3C G;  5EPL A;  2EXZ A;  3M4O H;  1CSQ A;  5C5L A;  4EQ5 A;  3T51 B;  3Q22 A;  4RAU C;  4JBM A;  4O42 A;  3HOY G;  1Q90 A;  5E7N A;  5GQO A;  1HUN A;  2KED A;  5ELF A;  1YIT A;  2B2Y A;  3L2P A;  4IUV A;  3ERO A;  3CCM A;  1Y1V B;  4U67 3;  4MHE A;  2E2H H;  4P75 A;  2WP8 J;  2K28 A;  1RD9 D;  3H94 A;  2K5H A;  2QEX A;  4FNF A;  1XPU A;  4LFB Q;  3GTP B;  1H9S B;  1B53 A;  4YWK A;  4X3S A;  1B1Z A;  4ID6 A;  5JEA H;  3TBI B;  4APV A;  1LTT D;  1SMX A;  3D31 A;  4QF4 A;  3SEB A;  1G2S A;  3ITP A;  4AQY L;  2CW0 D;  2EYP A;  2HUG A;  1E7Z A;  1P16 A;  1O78 A;  4PG3 A;  1EY4 A;  5ISR A;  4DV6 Q;  4HN7 A;  1KAW A;  3KF6 A;  3TP5 A;  2CKZ B;  1KRS A;  2B2T A;  2O5J C;  1QVF A;  1E2Z A;  1N9W A;  4GN4 B;  2R92 G;  1MJC A;  1CKN B;  1CZG A;  4KKS A;  4K0K Q;  1FNW A;  3P20 A;  3S1N H;  3HKZ B;  4P71 A;  3ND8 A;  4LF6 L;  2MGS A;  1PDQ A;  2G5D A;  4EGV A;  3HOU B;  3URY A;  2GN5 A;  4XDX A;  4Q5V A;  4FO2 A;  2PI2 A;  3S14 B;  1TII D;  2ALY B;  1GD7 A;  4QGU A;  1HR0 W;  2R6G A;  1WTO A;  5LMU L;  1X55 A;  3JC6 6;  3HOW G;  3CU7 A;  4YY3 L;  4U68 A;  3A55 A;  2EY5 A;  3PUY A;  4GKJ Q;  3GTM H;  2IX3 A;  1EWI A;  2B8G A;  2PI2 E;  1HNX Q;  4CDE C;  1A63 A;  1EOV A;  4M8A A;  3F2D A;  5CV5 A;  2A69 D;  1CM9 A;  3WOF A;  1DOL A;  2JXM B;  4L5S A;  2YTV A;  5JVH 3;  2X6G A;  1G8Z D;  3NE5 B;  2D5D A;  1STY A;  3D4W A;  3NTI A;  3A8I E;  3J7A V;  2NZ1 D;  4JI1 Q;  1TY0 A;  1CQF A;  4XXE A;  4RCN A;  1PRT F;  4V19 0;  1BKB A;  5BR8 L;  3M4Q A;  4UHV A;  5EKI A;  1QB5 D;  1Y1V H;  2VY3 A;  3WOE A;  4LWC A;  1BXT A;  3F2C A;  2LFN A;  1SBB B;  4X6A H;  5IWA L;  2AHO B;  4QJF A;  4HTH A;  3TDQ A;  4GOP B;  1SEB D;  3HOW H;  2X69 A;  3ULJ A;  4JI7 Q;  2EDG A;  1J5E Q;  1SE2 A;  1TS3 A;  2VXW A;  1B44 D;  3GTQ H;  2AUJ D;  3GTK B;  1KDC A;  3GTJ H;  1IZ6 A;  1X6O A;  1Y8O B;  1WTW A;  3BDL A;  1N34 Q;  2JQO A;  3CF5 A;  4A3E H;  4B3M Q;  2A8V A;  1E1O A;  3T16 A;  1JOQ A;  2QIL A;  1HCZ A;  1TWG H;  2NYZ D;  3NQI A;  3CD6 A;  1N32 L;  4RFB A;  1U4P A;  1EYD A;  1C7Y A;  1I4X A;  2BE5 D;  3GTO H;  3RZO H;  5COR A;  1CQV A;  1EY6 A;  5F2D A;  4JI8 Q;  2BCO A;  3I91 A;  4CDC C;  1GHJ A;  3DXJ C;  1MIU A;  3EJI A;  3CP0 A;  3QWN A;  1T5E A;  5DEH A;  2A73 B;  3AFQ A;  1NR4 A;  1X3G A;  5JEA G;  1S4Z A;  2QA4 A;  3W1B A;  4DK1 A;  2JA8 G;  2JP1 A;  4RWS C;  4E6I A;  4AYB B;  1EEI D;  2B63 G;  1CT1 D;  2D0O A;  2C5C A;  3WDN A;  3PO2 G;  1YEZ A;  1HTL D;  4K2K A;  1FYC A;  5IYB H;  3QJY A;  2SDF A;  5BN5 A;  1MI2 A;  4A3F H;  1E1T A;  4BXX G;  3NUC A;  4A3M G;  4OO1 H;  1LAB A;  1PZJ D;  4L5R C;  3AEV A;  1E2W A;  1DGS A;  5FK9 C;  1EQQ A;  4JYA L;  2K03 A;  3CQZ B;  2WAQ E;  1O7L A;  1SMY D;  2R3Z A;  3W5O A;  3A7A B;  1EIY B;  1YNJ D;  3K80 C;  4WJW A;  1VQ8 A;  4QMG A;  4NW2 A;  1PH8 A;  4JI0 L;  2YV5 A;  2FMM A;  1ESR A;  1T5X D;  3STB C;  1BCP B;  1CHQ D;  2KHJ A;  2OEO A;  1WCM B;  1IW7 C;  3KBX A;  1MHW C;  1EY7 A;  4JI7 L;  1N33 Q;  2E5L Q;  4HCS A;  1DJR D;  5LMN Q;  1AE2 A;  2N8N A;  3U4Z A;  1OO9 B;  2CHB D;  4C3J B;  3R93 A;  5M3M G;  3H91 A;  1B2T A;  1QG7 A;  5GAH C;  1VMC A;  4KV6 A;  4K8I A;  4HJA A;  3UI2 A;  5C4J H;  1JOO A;  4LF9 L;  5CBE E;  3VR3 A;  1VQM A;  1D5Z C;  3BS1 A;  1V8Q A;  3TQY A;  3G48 A;  4RH6 A;  3SK6 A;  4A3B G;  2L55 A;  4PMW A;  1SJH D;  1ET9 A;  2CH4 A;  4PMB A;  4RG1 A;  2F0Q A;  3KDF B;  1N8R C;  2B2W C;  3S1Q H;  5BN3 A;  4C3J H;  4GZY C;  3UDI A;  1Y8P B;  1Y69 U;  2JA6 H;  4BY7 H;  3TRE A;  4KMU C;  3OWF A;  5C3W A;  4R4T A;  2I07 B;  4YIJ A;  4YCU A;  4FF4 A;  2HQE A;  3S2H B;  1L0X B;  1YNN C;  3PUX A;  4F88 A;  1A15 A;  3TN2 A;  2IHF A;  2BA1 A;  3I7F A;  1KHI A;  3MEH A;  4HAE A;  1I94 L;  1AZQ A;  1XTC D;  3FRP B;  3AYH B;  2XGT A;  4PZ7 A;  4RKL A;  3RLN A;  4LFC Q;  2EYL A;  2E2D C;  1XMO L;  4CJ0 B;  2RDG A;  1S5B D;  1IW7 D;  4JI5 Q;  1ENA A;  2CWA A;  3E9I A;  5IGG A;  1V1P A;  1CUK A;  2Q2H A;  3K57 A;  1LYL A;  3S16 B;  2PQE A;  3JAM E;  1S5D D;  2JA7 G;  2XVS A;  4CKC A;  2NTT A;  1D5M C;  3I4N G;  2F52 A;  1WD0 A;  4FXK C;  4K5W A;  1MSH A;  1X3P A;  4HR7 B;  4ZUI A;  3UE0 A;  4MNO A;  3PO3 B;  2MJ8 A;  1EZ6 A;  1VQ6 A;  1Q81 C;  5D14 A;  1STB A;  3NPP A;  4B3M L;  1EWH A;  2HQL A;  5D3I B;  4DNI A;  4GOP A;  4XQJ A;  1L1O C;  3CC7 A;  1TS4 A;  5M3F B;  1E2V A;  3OWE B;  3NBI A;  3U50 C;  1G2T A;  3MXN B;  4C2M H;  5E1F A;  1A2U A;  4C3H G;  1WTP A;  3G7L A;  3HFZ B;  2B2V A;  5CMD A;  1VQL A;  2UUB Q;  4LF5 Q;  4FF3 A;  3GO5 A;  2QKI C;  4A3F G;  3SK5 A;  2NWG A;  2EZV A;  3K5M A;  4AYB G;  4NP5 A;  5J22 A;  1VQJ A;  3OHX C;  1Q1E A;  2E74 C;  5IGF A;  4XYQ A;  4HMJ A;  2UXC Q;  2AQ1 B;  1F9R A;  2IL8 A;  4OIJ A;  4TQU S;  2PNH A;  4H02 A;  5I6Y A;  5DLQ E;  1UEA B;  4K2L A;  1D2B A;  1STH A;  3EN2 A;  4DR4 Q;  1O7I A;  5DM6 3;  4JW0 A;  1Q7Y C;  1GUT A;  1NMG A;  1ICW A;  1KLG D;  1E22 A;  1NSN S;  4JG2 A;  2Z8L A;  2K33 A;  3IAY A;  4JCV E;  1MGS A;  4GLX A;  1W2B A;  4IAL A;  2MHV A;  4DV4 Q;  1LT3 D;  2L1B A;  3DEP A;  1EYA A;  3HEJ A;  4L8J A;  4J15 A;  3TP8 A;  2FFK B;  2DUD A;  2E75 C;  4PNY A;  1RHP A;  5CV7 A;  1JB3 A;  2B2T C;  1IHZ A;  1CA5 A;  2UUA Q;  3M3Y H;  2FMC A;  2B2W A;  3D6W A;  1NE3 A;  3C1F A;  3K5O A;  1G29 1;  1IYJ B;  1QE6 A;  3ERQ A;  1S72 A;  1G6Z A;  4DAM A;  4A4I A;  4NPS A;  2F0V A;  1WCM H;  1UNS A;  5GRO A;  1JWS D;  3E6Z X;  1SLJ A;  3SGI A;  2XSC A;  3E3X A;  1Y1W G;  5IIF A;  1IXR A;  1QUQ B;  5AJ3 L;  4A3I B;  1VQP A;  3NEN A;  1B9N A;  4F7X A;  1Z7T A;  4ULL A;  2EVB A;  5HGQ A;  5JAV A;  1QZH A;  2QW7 A;  5CV8 A;  1RDP D;  4QIW E;  2UXD Q;  3TME A;  1HQR D;  1I6H B;  2IY5 B;  3PUV A;  1HNW L;  1DXM A;  1Y1V G;  3CPW A;  3Q23 A;  4N8X 1;  4GNX B;  3ND9 A;  2TSS A;  1RCV D;  3I70 A;  1EEF D;  1JWU D;  4KHP L;  2VB3 X;  1PH9 A;  1QOH A;  1PH3 A;  2O5I C;  3SR1 A;  3PMF A;  3M4O B;  2NN6 G;  3ICE A;  4UY8 C;  2K7V A;  2A6E D;  3MC0 B;  1QVC A;  2FHT A;  4LF4 Q;  2F3W A;  3MFG A;  1IL2 A;  2NZO A;  4R8N A;  3CCV A;  3J80 E;  1E0B A;  3KF8 A;  4JI1 L;  4JBJ A;  2ASB A;  3JAM c;  4HIO A;  3NTH A;  4A93 H;  2F0U A;  4GNX C;  2R92 B;  1XMO Q;  4NXN L;  3CRK C;  3Q0A A;  4MN3 A;  2L9H A;  3BDO A;  4DKA C;  2D0P A;  1F9P A;  3NBH A;  3I2Z A;  4FF2 A;  4JI4 Q;  5C4X H;  2E2I H;  2CW0 C;  1AEX A;  3EVQ A;  4ZLT F;  2CWP A;  1JJG A;  2CQO A;  1VMP A;  3V2T A;  4FYD A;  1HA6 A;  1CKM A;  1L0Y B;  2HCI A;  2F0N A;  2R92 H;  4G57 A;  4ZKC B;  3CPF A;  3I55 A;  2L12 A;  5KYI A;  2M00 A;  2R7Z G;  4X66 L;  2K50 A;  2G9H D;  5J1Z A;  1N36 Q;  3E0J A;  3MWY W;  1X56 A;  2JN4 A;  1BR9 A;  1K83 H;  4QB4 A;  1IL8 A;  4J8Q A;  5M3F G;  4HJ8 A;  1M1K C;  3M3Y B;  3QIA A;  4A3G G;  4A3G B;  4UPA A;  3Q24 A;  5LL6 X;  4L6T B;  4DUY Q;  2PZT A;  2F0K A;  5A2Q L;  3KK7 A;  2LS0 1;  4OWT B;  1UEB A;  1F2M A;  3CW2 C;  1K8M A;  1K83 B;  5JEA J;  4DK3 C;  4HJ5 A;  5G3L F;  1TU2 B;  1QVG A;  1H95 A;  1PTO H;  3R2I A;  3MXU A;  1I4G A;  3AFP A;  4TSS A;  1FVI A;  2F4I A;  3K5N A;  1WD1 A;  3KJO A;  2K32 A;  1GHK A;  1L2F A;  4EQO A;  4IQZ A;  1R9T H;  4C3H H;  3KLW A;  3VYU A;  2M2L A;  4B08 A;  3H0G H;  4B3S L;  2EJG C;  3K0X A;  1PHJ A;  1N36 L;  3U9S A;  3RN5 A;  1JQY D;  5FLM G;  4NXM L;  1GXD C;  2M9V A;  1PTO B;  2F0J A;  2F0F A;  2I5M X;  4XYO A;  4IOA A;  4GLA C;  3SHL A;  1I5F A;  2A68 D;  5NUC A;  3PO3 G;  1B4O A;  1A8V A;  2YTX A;  1SRO A;  3EFX D;  4B3R Q;  4FVM A;  2IT1 A;  2F0G A;  1EU3 A;  1M4V A;  2WB1 G;  2AQ3 B;  4DV4 L;  3S15 B;  1S5C D;  5IP9 H;  5IOD A;  1PH6 A;  3J7A 5;  2RQX A;  3T56 B;  3PIP 3;  1VQO A;  3CQZ H;  1WVL A;  5EPK A;  3P75 A;  4ALP A;  4F87 A;  3DEO A;  2F3V A;  4JOI C;  4RGO S;  1HA5 A;  3GTK H;  3UDF A;  5IWA Q;  3PIP A;  3MZ5 A;  4OGQ C;  1EWC A;  3NWS A;  4DV1 L;  1GUO A;  4GLV B;  1PRT C;  2VQF L;  1HR0 L;  1XPO A;  2PW7 A;  3G6E A;  5IGC A;  4C3I G;  3MEF A;  1JR0 D;  2WIN B;  2KEE A;  1B3Q A;  5J3B A;  4N8F A;  4C1N K;  4LF9 Q;  2ZM6 Q;  3TP6 A;  4YWL A;  1EU4 A;  1TS2 A;  3K81 C;  2Q8R E;  3NTK A;  4CJ2 C;  4AQY Q;  4OWX B;  3HOZ G;  4LF8 Q;  1LAC A;  2OF1 A;  1UE6 A;  1LV9 A;  2NVX B;  3ZJY C;  1Q3L A;  4K6D A;  4TVA B;  2Z0S A;  4ILW A;  1UUP A;  2A19 A;  3RUZ A;  1ASY A;  3L0O A;  2BOS A;  2PZW A;  1HTP A;  2XNA C;  3HKZ E;  4QIW B;  4CJ1 B;  2Z1C A;  1I94 Q;  2JA5 H;  1TR5 A;  2JA9 A;  4IFD J;  5IYC H;  2LSS A;  4H7B A;  2L15 A;  3TEH B;  4BY7 B;  5M3M H;  5C44 G;  3TZD A;  2B2Y C;  2E5L L;  3FMC A;  4EVO A;  2NB0 A;  2R93 G;  4LUO A;  1TWC B;  3D4R A;  1HZB A;  4X65 L;  2JEA I;  5CV4 A;  1LTB D;  2IWH A;  2CFM A;  1BF4 A;  2ZTD A;  4DV7 Q;  3HOX B;  3QO2 A;  2ICE C;  2N88 A;  4B3T Q;  1IBM Q;  3GV3 A;  1SNM A;  4H44 C;  5C0X I;  1TWA B;  2ENB A;  1RIP A;  4RGM A;  3RLO A;  2NVT B;  2FJ2 A;  4DV3 L;  1GVP A;  2KQ3 A;  5K5P A;  2BH2 A;  1EZ8 A;  1FL0 A;  4LFA Q;  3NBH B;  1EY9 A;  4LF6 Q;  1CHP D;  1PYW D;  1AZP A;  4IUN A;  1STN A;  1IKL A;  3PO2 H;  1GOZ A;  2PO4 A;  1X9N A;  2HIV A;  4DR4 L;  2B63 H;  1PTO F;  1Q8K A;  2PQA B;  5I9O A;  2GVA A;  1YNN D;  4HIK A;  1WTQ A;  1P8L A;  2OQ0 A;  3GD7 A;  1K8G A;  2PCF B;  1QIL A;  1R4P B;  5FKA C;  3J81 i;  1U4L A;  3D6C A;  4LFC L;  2RSO A;  2WV6 D;  5IYD H;  2J7Z A;  1D8L A;  4JI6 Q;  2RDF A;  1C48 A;  2KEC A;  1PMR A;  2NN6 I;  2R7F A;  4DPG A;  1OXV A;  3CAM A;  1NAP A;  1AW7 A;  5JPN C;  4BBR H;  5FJ8 H;  3PO2 B;  4DR7 Q;  2MO1 A;  1CKN A;  1VQ5 A;  3HOU H;  1RTN A;  1NCV A;  1PYB A;  1BCP C;  5GAG C;  3S1M B;  2K14 A;  4B9W A;  2O4X A;  2Z4H A;  3FPU B;  4BBS G;  2DNC A;  2HIX A;  3J80 L;  3F2U A;  4BBS B;  3VYT A;  1PFB A;  3PF4 A;  2DJF C;  2H1E A;  1DOM A;  2C35 B;  5JJL A;  3GP7 A;  2N78 A;  3CCE A;  3CCS A;  1I50 H;  3X3M A;  5I4D A;  1VQF A;  3ULP A;  1FGB D;  2R7Z B;  2RF4 A;  2WAQ G;  4JBK A;  3K59 A;  2F0E A;  3NWT A;  1EIG A;  5M5W B;  1VCI A;  2LXK A;  5FLX E;  2OXP A;  5AJ3 Q;  2QGQ A;  1PRT B;  1QJO A;  2AMC B;  2K05 A;  1JIC A;  3DM1 A;  2IW3 A;  2H4O A;  3S16 H;  3A5Z B;  2F0W A;  4KY6 A;  4DAY A;  3MHB A;  5CV9 A;  1XMQ L;  3PUW A;  4LF7 L;  2B8F A;  4RGN A;  3HOY B;  2EOT A;  3ULL A;  3PCO B;  4IZ8 A;  3H09 A;  5CR3 A;  5FO9 B;  1NMF A;  3MFY A;  2NN6 H;  2K5V A;  3KUP A;  1K8O A;  1RF2 D;  4LUV A;  4LF4 L;  4C1N I;  4FDB A;  5I9P A;  5C0X J;  3J81 c;  2QEJ C;  3EA6 A;  1SRU A;  1XXG A;  4QY7 A;  1UE5 A;  4QUF A;  1VS0 A;  3K6O A;  3CME A;  4DV2 Q;  4C56 C;  4GKK L;  2EJM A;  3SXH A;  3ZYY X;  3FKI H;  4K6L A;  3K58 A;  4KN7 C;  1LO5 D;  2A5H A;  5M5X H;  1Z9F A;  4JBW A;  3CXC A;  1X54 A;  4B3T L;  3P1H A;  3TS2 A;  2DY7 A;  4ZAI A;  3S14 H;  4OX9 Q;  4RCO A;  4A3D G;  5C44 B;  2DN8 A;  4CGY B;  4LF7 Q;  4EQP A;  2UXB L;  3U58 A;  1HXY D;  1RJT A;  5EAY A;  1V43 A;  1LTS D;  1KL9 A;  4OXP A;  5FLX c;  2UUC Q;  2ZT9 C;  1F2Y A;  2WFW A;  3J80 c;  2EPB A;  2UU9 L;  4ZKB B;  2PYK A;  4DK0 A;  1HZA A;  2BE5 C;  1MJE A;  3SDZ A;  1SJE D;  1Q46 A;  2KOL A;  1SMY C;  1TWC H;  1YVC A;  2BDO A;  3BZD B;  1PXU A;  4R8I A;  1JOK A;  4RGT A;  2TMP A;  1IBM L;  1ZYR D;  2V1C C;  2UXD L;  1I50 B;  4OL7 A;  1X65 A;  1IKM A;  2K5Q A;  4QUC A;  3T1Y Q;  1VQ7 A;  3I73 A;  3HOW B;  3PIO 3;  5FJ8 G;  2F0D A;  3MVV A;  2ICI A;  2K5D A;  5C3E B;  1TY2 A;  4OON A;  1ZKO A;  4ZQ3 A;  3VR2 A;  1S3O A;  4DV7 L;  3S1N B;  3BU2 A;  4DV5 Q;  2OTJ A;  2HDL A;  1XJV A;  1EY5 A;  4IPC A;  4WOR A;  4DR2 Q;  1GUG A;  4YCV A;  4A3L H;  4QL5 A;  4PV1 C;  4ODG A;  4CDD C;  4DR1 L;  1BVS A;  2NVQ B;  4IFD H;  1TWH B;  3DWA A;  2K52 A;  2KCN A;  1JJC B;  1HFG A;  1KNA A;  1JOR A;  1PH5 A;  3AQQ A;  3HOY H;  4LFB L;  1K3R A;  5EQ0 A;  5KYL A;  1E24 A;  3HGB A;  4DGZ A;  4DR3 Q;  1YI2 A;  3GTO B;  3RZO B;  1U4M A;  5IGE A;  1W3S A;  1VQN A;  4JPB W;  4I7Z C;  4JI4 L;  3AU7 A;  4YWM A;  1K0R A;  3A7L A;  1IBL Q;  5I6W A;  4NKL A;  4DR5 Q;  3EBE A;  3BVZ A;  2R61 A;  4JI6 L;  2F0S A;  4DK6 C;  1SE4 A;  2F0O A;  1VQI A;  1YHA A;  1S40 A;  2EY1 A;  3HOX G;  1O7Y A;  4X64 Q;  4ZCK A;  4IPH A;  2RCN A;  3D8G A;  1A0I A;  1X3E A;  3HP3 A;  2L4N A;  1A6X A;  4JC0 A;  4UAI A;  2K5W A;  3GTL H;  1ESF A;  4GS3 A;  3H3V I;  3CMA A;  3GTQ B;  1U5K A;  2WB1 B;  2DNE A;  4XQN A;  1K73 C;  3I3C A;  3HG9 A;  3FHW A;  4K0K L;  1KD1 C;  2HCC A;  3QOL A;  2AQ2 B;  2SNM A;  4DN4 M;  2RCF A;  3A5U A;  4XT1 B;  4LNQ A;  2AWO A;  1V1O A;  3HKZ G;  1X3Q A;  1Q82 C;  4BY1 H;  3OW2 A;  3K7A H;  3I4M G;  1RKN A;  4A3I G;  1DCZ A;  2KBN A;  2Z4I A;  3J81 E;  4OEM B;  1I3Q H;  4HJ9 A;  1U4R A;  5IT9 c;  3S9W A;  2JA8 B;  1JC7 A;  2WB1 E;  4H0L C;  3QR8 A;  4IN3 A;  2E2H B;  4DR5 L;  5EKK A;  2B63 B;  1TWF B;  1C8C A;  2PZU A;  5KND A;  1W6J A;  3VA7 A;  2JA6 G;  2HHH Q;  3OIP A;  1CA6 A;  4V0B A;  5CV6 A;  2RA4 A;  2DJG C;  3T13 A;  3T4A C;  2NVQ H;  1CFM A;  4YCW A;  3I4M H;  4A3B H;  2A69 C;  3T1H L;  2F0I A;  3PIO A;  3BVM A;  3A8J E;  4JI8 L;  4L63 B;  3NSW A;  3U9O A;  3FPP A;  2VQE L;  4QQB X;  1FNU A;  2EY2 A;  3GQB A;  1LT4 D;  1NJI C;  1QWY A;  3M7G A;  2VUM H;  5JVG 3;  4RHR A;  1HNZ L;  4H13 C;  2UXB Q;  2A1A A;  3KDF A;  1EUJ A;  3S2D H;  4JI2 Q;  3CKI B;  3IKJ A;  1TS5 A;  3OSO A;  4KHV A;  4DAY B;  2CH4 W;  3J81 j;  2SOB A;  3IL8 A;  3A56 A;  1M8A A;  5I2Y A;  1EYC A;  3JAM L;  4DR2 L;  2WKD A;  3PQI A;  4OX9 L;  3Q8D A;  1PV4 A;  1YHB A;  1KC8 C;  4KD4 A;  1WTX A;  2HHH L;  4XQQ A;  1ZEQ X;  3S2D B;  1X32 A;  5KRU A;  1EFI D;  3NQT A;  2E8G A;  3RMH A;  3LWU A;  1STA A;  2SNS A;  1K0S A;  3ERS X;  5D65 A;  1UE7 A;  2ZXO A;  2Q8I B;  3SK4 A;  1PFS A;  1Z47 A;  2NUC A;  5KEE A;  4I65 A;  1BCP F;  4LAA A;  2RBM A;  3DUZ A;  1HRJ A;  4OWW B;  2XWJ B;  5BN4 A;  4OEL B;  4IUR A;  4LF8 L;  1G91 A;  2A6H C;  2Q2U A;  3EIV A;  5FO7 B;  1YHQ A;  3W1G A;  1BO0 A;  1EYG A;  2MO0 A;  1I4H A;  2L11 A;  4A3L G;  5KNC A;  2JA8 H;  2K5N A;  1PFN A;  2NVY H;  4NDX A;  5HGT A;  5EKL A;  1K8A C;  2ZJQ A;  1J6Q A;  3UDG A;  1I6V C;  1Q8I A;  1A3U A;  2E76 C;  4NB3 A;  1PTO D;  5IP7 H;  2ZJR A;  3E9H A;  3IRB A;  5C4J B;  3S1Q B;  5M3F H;  2EYJ A;  3TS0 A;  5IGB A;  4DUZ Q;  1S5F D;  4KD3 A;  4KY7 A;  3VR4 A;  4KJO A;  1IYV A;  1CZW A;  2MUY A;  2WAC A;  2LMC B;  2Y0S G;  3MA2 B;  5C5M A;  1VQB A;  1TVX A;  4ME5 A;  2D62 A;  3KYH C;  4RKB A;  4K14 A;  1I4Q A;  2ZM6 L;  3BZK A;  1SR3 A;  1TKW B;  4RA8 A;  4Y7N H;  2EYM A;  1LM0 A;  1LT5 D;  2K6A A;  2WKC A;  1NUC A;  3N52 A;  4A3E G;  5ELN A;  4Q0F A;  4LMQ D;  2KA7 A;  2SEB D;  2I5H A;  2ID0 A;  3S1M H;  4GNX A;  4A93 G;  2LXJ A;  1GUW A;  5IP9 G;  4Y7N B;  1PFM A;  5C4Z A;  1H9M A;  5A35 A;  2XWB B;  4FXG C;  1SFO B;  4R1J A;  2N49 A;  4WJ4 A;  3HOX H;  5C0X G;  1SND A;  2G9D A;  3HRZ C;  2N3S A;  2VB2 X;  1JB7 A;  3PO3 H;  1F2Z A;  1VQD A;  3VYS A;  5DNF A;  1SYC A;  4F8M A;  4RHS A;  1TWF H;  1HZ9 A;  1HNZ Q;  1EL0 A;  3BG3 A;  4IO9 A;  1N34 L;  1SXT A;  4G7O C;  3GTG B;  2KJX A;  2LY7 A;  1SE3 A;  4O2D A;  2EYO A;  3K5L A;  1BBX C;  1FJG L;  2F4V L;  5C0X H;  4A3B B;  3FDT A;  4DV0 L;  5CGK A;  3LNN A;  4RMF A;  1XNR Q;  3M9B A;  3VR6 A;  1BBU A;  4JYA Q;  1KIX A;  2K4K A;  2C9O A;  1Q1B A;  2Z6K A;  3A0J A;  4G7H C;  1PRT D;  1FR3 A;  4DR6 L;  4C2M B;  3S1R B;  5EBD A;  3CCU A;  2NVX H;  3NEL A;  3HKS A;  2NVY B;  4ME3 A;  5L37 A;  2K04 A;  5T1I A;  2RVL A;  1GKH A;  3E0E A;  3RZD B;  1ZXT A;  1VQH A;  3NK9 A;  4DV1 Q;  1B7Y B;  3TZU A;  2VW9 A;  2CQA A;  5JPM C;  1ROD A;  4PZ8 A;  5LMN L;  1YJN A;  1A2T A;  1XNQ L;  3P7J A;  4JVZ A;  2FIN B;  1D1I A;  2EE1 A;  1T9H A;  5M3M B;  2Q8T A;  1D5X C;  4BBS H;  4JI0 Q;  2F0T A;  2F4V Q;  4KKU A;  1DM0 B;  1B70 B;  1GM5 A;  3R8B A;  2B2U A;  4HIM A;  3TRZ A;  2A74 C;  1PH4 A;  3OOC A;  1HH2 P;  3BDC A;  2PQA A;  1SYG A;  3BZC A;  1R9T B;  1BUV T;  4CBV A;  4DR1 Q;  4LF5 L;  3KF6 B;  2JA6 B;  4BS9 A;  3M7N A;  5C4X G;  1ENC A;  3S17 B;  5C4X B;  1L0W A;  2YU9 H;  4KLK A;  4AH6 A;  1FD7 D;  1KNE A;  4DV5 L;  3TSS A;  1VQ4 A;  1VQG A;  2KEN A;  1JE4 A;  3C46 A;  1AH9 A;  3CHB D;  2JEB I;  2QDL A;  3CC2 A;  2ZJP A;  1M90 C;  5KIX A;  1J5E L;  2B2V C;  2PMZ E;  1F77 A;  2Q2I A;  1PZK D;  2I46 A;  2OQK A;  4IPG A;  2YU9 B;  4HID A;  1EIF A;  2A6H D;  5FO8 B;  1SYD A;  4CHT B;  4AYB E;  2XIW A;  3U4V A;  1AE3 A;  2RSN A;  1FGU A;  2YTY A;  1B8A A;  1MBY A;  5JJZ A;  2IJ0 A;  4HCE A;  5HUR A;  1TWH H;  1WTH A;  1KTK A;  1NNX A;  5IT9 E;  4A3M B;  4OHJ A;  3L9A X;  3LGJ A;  1DON A;  2R93 H;  1QCB D;  1TT2 A;  2H5X A;  2JA7 H;  3MXG A;  4JI3 L;  2XTI A;  3NEM A;  5C44 H;  2VQF Q;  3S1R H;  1HR0 Q;  2VUM G;  1WTV A;  2GA4 B;  5IYC G;  2QF7 A;  1U0L A;  4KTA A;  1SYF A;  1Y1W H;  4OO1 I;  3OTO L;  4FP5 D;  4HSP A;  3H3V H;  1ILQ A;  1AP0 A;  3I4O A;  1WCM G;  1SSO A;  1JJ2 A;  2IX1 A;  4JOI A;  4IFD I;  4DV0 Q;  1YJ9 A;  3LWE A;  1II3 A;  5ELB A;  1XNR L;  1I4R A;  1G51 A;  1LT6 D;  1SDF A; 
#chains in the Genus database with same CATH homology
 4GLX A;  2UUA L;  1W2B A;  1HZA A;  1MJE A;  4LUZ A;  4YHH L;  4DV4 Q;  3ER0 A;  1OTC A;  2AWN A;  4GN5 A;  4UP8 A;  1D7Q A;  1Q46 A;  1TWC H;  1YVC A;  2NZH A;  2JK8 A;  4J15 A;  2OWO A;  3S2H H;  1L1O B;  5H1S E;  1JMC A;  2DUD A;  1IBM L;  2V1C C;  1WJJ A;  2UXD L;  2OCE A;  2UU9 Q;  2R7Z H;  3WWV A;  1X65 A;  3T1H Q;  2ZTE A;  1VQ7 A;  3T1Y Q;  2IHE A;  4KI0 A;  5FJ8 G;  3M3Y H;  2UUA Q;  4C3I H;  1NE3 A;  4OON A;  1G29 1;  1IYJ B;  1S72 A;  1SFO H;  1S3O A;  4BY1 G;  4DV7 L;  3BU2 A;  4DV5 Q;  2OTJ A;  4IJH A;  1XJV A;  4P72 A;  4DAM A;  4A4I A;  3S17 H;  1TWA H;  4NPS A;  1HNX L;  1WCM H;  1SN8 A;  4IPC A;  5GRO A;  4DR2 Q;  4O0A A;  1EFW A;  1C0A A;  1SLJ A;  4YCV A;  3SGI A;  1VQK A;  4QL5 A;  4A3L H;  3DLL A;  3BJU A;  1Y1W G;  4A3J G;  4DR1 L;  1IXR A;  1BVS A;  1QUQ B;  1C9O A;  4NXN Q;  5AJ3 L;  1VQP A;  3NEN A;  3TRZ A;  3KF8 B;  2KHI A;  2B29 A;  3HOV H;  2K52 A;  1JJC B;  5HGQ A;  2IX0 A;  1QZH A;  4X64 L;  3F2B A;  2RHQ B;  4MZ9 A;  1PH5 A;  1UE1 A;  1VQC A;  4QIW E;  2UXD Q;  3AQQ A;  3HOY H;  4LFB L;  1K3R A;  1L1O A;  1E24 A;  1LTL A;  4DR3 Q;  1YI2 A;  3PUV A;  1HNW L;  2IY5 B;  1VQE A;  1HR0 Q;  1Y1V G;  2KCT A;  3JAM i;  3GDE A;  3CPW A;  2E2J H;  4GKK Q;  1Q86 C;  2VQE Q;  1W3S A;  1FJG Q;  4GNX B;  1VQN A;  4KHP L;  2YYZ A;  4JI4 L;  1PH9 A;  4YWM A;  1K0R A;  5BR8 Q;  1IBL Q;  1PH3 A;  4DR5 Q;  2UXC L;  1Q12 A;  2NN6 G;  3EBE A;  4DR3 L;  4UY8 C;  1KXL A;  2ATW A;  4DV6 L;  4JI6 L;  4DK6 C;  1QVC A;  4A3C G;  1UWV A;  2ZTC A;  1IBK L;  3H0G G;  4LF4 Q;  1VQI A;  1YHA A;  3M4O H;  1S40 A;  2MFI A;  1OXU A;  1CSQ A;  3HOX G;  4JV5 L;  4X64 Q;  4EQ5 A;  3M85 A;  4IPH A;  2NZO A;  1IL2 A;  2RCN A;  4JBM A;  3CCV A;  3HOY G;  4JI1 L;  1A0I A;  5E7N A;  4LW1 A;  1X3E A;  4JBJ A;  2MNA A;  5GQO A;  4BXX H;  2ASB A;  3JAM c;  4HIO A;  1IBL L;  1YIT A;  5IYB G;  4A93 H;  3S15 H;  4JC0 A;  2OTL A;  3HOV G;  1YNX A;  3L2P A;  4GNX C;  3GTL H;  1XMO Q;  1G6P A;  4NXN L;  4GS3 A;  3J7Z C;  3CCM A;  1PH2 A;  3H3V I;  3CMA A;  1U5K A;  4DKA C;  2D0P A;  1K73 C;  2E2H H;  1N33 L;  4P75 A;  3GTP H;  2WP8 J;  3FHW A;  4K0K L;  1KD1 C;  3I2Z A;  3GTG H;  4JI4 Q;  5C4X H;  3A5U A;  1Y14 B;  1XMQ Q;  4LNQ A;  2E2I H;  3CCL A;  2AWO A;  2K5H A;  2QEX A;  1JJG A;  2CWP A;  1XPU A;  4LFB Q;  2CQO A;  3HKZ G;  4BY1 H;  1Q82 C;  3OW2 A;  3K7A H;  1NTG A;  4YWK A;  3I4M G;  1CKM A;  4A3I G;  2KBN A;  3RR5 A;  5IE8 A;  4APV A;  1SMX A;  3D31 A;  4HJ9 A;  1I3Q H;  3I55 A;  3CPF A;  4MTN A;  5IT9 c;  2R92 H;  1GO3 E;  1V9P A;  3HOZ H;  2R7Z G;  2WB1 E;  4X66 L;  2K50 A;  4AQY L;  3K8A A;  3DM3 A;  1N36 Q;  4DR5 L;  1E7Z A;  1P16 A;  1X56 A;  4PG3 A;  4R4I A;  2HT1 A;  4DV6 Q;  1K83 H;  4IJL A;  1KAW A;  4BY7 G;  1IBK Q;  2JA6 G;  3KF6 A;  4YHH Q;  2CKZ B;  1KRS A;  5M3F G;  4HJ8 A;  3KJP A;  1M1K C;  1QVF A;  3K7U C;  2HHH Q;  4A3G G;  1N9W A;  4GN4 B;  2R92 G;  1MJC A;  1CKN B;  2VS1 A;  4UPA A;  4K0K Q;  3S1N H;  2NVQ H;  4P71 A;  4A3I H;  4YCW A;  4LF6 L;  3I4M H;  4A3B H;  3T1Y L;  4DUY Q;  3T1H L;  3PIO A;  3PSI A;  3A74 A;  4OWT B;  4JI8 L;  1UEB A;  4YY3 Q;  1NY4 A;  2VQE L;  4QQB X;  2GN5 A;  3CW2 C;  4PZ6 A;  1V1Q A;  2BA0 A;  2PI2 A;  5JEA J;  4DK3 C;  4A3D H;  4HJ5 A;  2ALY B;  1NJI C;  1QVG A;  1GD7 A;  5GAE C;  4QGU A;  1H95 A;  2VUM H;  3F1Z A;  1HR0 W;  2Z6K C;  1HNZ L;  2R6G A;  3AFP A;  3M4P A;  1RL2 A;  4L5Q A;  3OTO Q;  2A1A A;  3KDF A;  5LMU L;  1X55 A;  2UXB Q;  1EUJ A;  3JC6 6;  3HOW G;  1XPR A;  1FVI A;  3S2D H;  4JI2 Q;  4YY3 L;  3PUY A;  4DAY B;  4GKJ Q;  5JJK A;  3KJO A;  1WI5 A;  1EWI A;  1L2F A;  3J81 j;  3GTM H;  1R9T H;  3B6Y A;  4JI5 L;  4C3H H;  3KLW A;  4UP9 A;  2PI2 E;  5HY6 A;  1HNX Q;  4XTC S;  3H0G H;  4DR2 L;  4B3S L;  1A63 A;  3K0X A;  1PA6 A;  1EOV A;  3F2D A;  4DUY L;  1PHJ A;  1N36 L;  3RN5 A;  5FLM G;  4OX9 L;  4NXM L;  3KFU A;  3Q8D A;  1SE8 A;  3OYY A;  1CKO A;  1YHB A;  2YTV A;  1PV4 A;  4L5S A;  2I5M X;  4IOA A;  4GLA C;  1KC8 C;  1I5F A;  2K75 A;  3PGZ A;  2HHH L;  1HZC A;  2EIF A;  1TXY A;  3PO3 G;  4JI1 Q;  1A8V A;  2YTX A;  2E8G A;  1SRO A;  1BKB A;  4L5T A;  5IY0 A;  5BR8 L;  4B3R Q;  3M4Q A;  3ICE A;  1Y1V H;  2VY3 A;  3ERS X;  4LWC A;  3F2C A;  2IT1 A;  1UE7 A;  4X6A H;  5IWA L;  2WB1 G;  2AHO B;  4R4Q A;  4QJF A;  4A75 A;  1JE5 A;  2EQS A;  1PFS A;  1Z47 A;  4DV4 L;  4GOP B;  4GKJ L;  5IP9 H;  3HOW H;  4JI7 Q;  3ULJ A;  4POG A;  4DUZ L;  2DGY A;  2MQH A;  1J5E Q;  4OWW B;  4BA2 I;  1PH6 A;  3J7A 5;  1LUZ A;  3CQZ H;  1VQO A;  3GTQ H;  4ALP A;  3GTJ H;  5GAD C;  1IZ6 A;  1X6O A;  4LF8 L;  4IFD G;  4R4O A;  4HJ7 A;  2Q2U A;  3EIV A;  1YHQ A;  1N34 Q;  3W1G A;  4JOI C;  1EYG A;  2JQO A;  2MO0 A;  3CF5 A;  3GTK H;  3UDF A;  1X3F A;  5IWA Q;  4A3E H;  4B3M Q;  2A8V A;  1E1O A;  3PIP A;  2JA8 H;  4A3L G;  2K5N A;  4DV1 L;  2NVY H;  1TWG H;  4GLV B;  3CD6 A;  1N32 L;  1K8A C;  1C7Y A;  2ZJQ A;  1J6Q A;  4XIG S;  2VQF L;  3UDG A;  1XPO A;  1HR0 L;  3GTO H;  3G6E A;  3RZO H;  4B3R L;  4LF9 Q;  2AKW B;  3MEF A;  5J3B A;  4NB3 A;  4Y52 H;  2F3I A;  1A62 A;  5IP7 H;  2ZJR A;  4NXM Q;  3E9H A;  4A3G H;  3IRB A;  4JI8 Q;  3H15 A;  5M3F H;  2ZM6 Q;  4YWL A;  3TS0 A;  1I6H H;  1MIU A;  1MKH A;  1VQA A;  3CP0 A;  4DUZ Q;  3K81 C;  4IOC A;  2BH8 A;  1XNQ Q;  4AQY Q;  3J80 i;  3STB D;  4OWX B;  3HOZ G;  3HOU G;  4LF8 Q;  3AFQ A;  2Y0S G;  4P73 A;  1VQB A;  1UE6 A;  4BBR G;  1X3G A;  3ZJY C;  2D62 A;  3KYH C;  4TVA B;  2Z0S A;  3UE1 A;  5JEA G;  2ZM6 L;  1KQS A;  3BZK A;  1SR3 A;  2Q2T A;  2A19 A;  3W1B A;  4Y7N H;  3G71 A;  2QA4 A;  1ASY A;  3L0O A;  5IYD G;  1LM0 A;  3RZD H;  4DR7 L;  1N32 Q;  3HKZ E;  1I94 Q;  2JA8 G;  3PUZ A;  1EQR A;  4A3E G;  2JA5 H;  4WJ3 M;  5ELN A;  2JA9 A;  2I5H A;  2RHS B;  2B63 G;  2ID0 A;  5IYC H;  4IFD J;  2LSS A;  2VNU D;  2L15 A;  3TEH B;  2D0O A;  5M3M H;  3S1M H;  3CCR A;  5C44 G;  3PO2 G;  1YEZ A;  2JJQ A;  4GNX A;  5IYB H;  2E5L L;  4A93 G;  2LXJ A;  2CCZ A;  4A3F H;  5IP9 G;  1E1T A;  4BXX G;  3I56 A;  4A3M G;  2R93 G;  4L5R C;  3FKI G;  4LUO A;  3AEV A;  1DGS A;  1EQQ A;  1PVO A;  1QUQ A;  4R1J A;  2N49 A;  1HZB A;  4X65 L;  4JYA L;  5LMU Q;  4WJ4 A;  3HOX H;  5C0X G;  2JEA I;  4IPD A;  2WAQ E;  4A3C H;  2CFM A;  2ZTD A;  4DV7 Q;  2N3S A;  1JB7 A;  3W5O A;  1EIY B;  3PO3 H;  1VQD A;  3K80 C;  1VQ8 A;  4B3T Q;  1IBM Q;  1YZ6 A;  1TWF H;  1HZ9 A;  3CCJ A;  1HNZ Q;  1PH8 A;  4JI0 L;  2YV5 A;  4IO9 A;  3STB C;  2EXD A;  1N34 L;  3F8T A;  2KHJ A;  5C0X I;  3PF5 A;  1RIP A;  4O2D A;  2F4V L;  3RLO A;  1FJG L;  1OXS C;  4DV3 L;  1QZG A;  1K9M C;  1GVP A;  4JI7 L;  1N33 Q;  2E5L Q;  4DV0 L;  1YBY A;  2B3G A;  2BH2 A;  4KHP Q;  5LMN Q;  1NBW A;  4RMF A;  1AE2 A;  1ASZ A;  1XNR Q;  1FL0 A;  3M9B A;  2N8N A;  3NBH B;  4LFA Q;  3FP9 A;  3RLF A;  1BBU A;  4LF6 Q;  3U4Z A;  4X65 Q;  1KIX A;  4JYA Q;  2K4K A;  2JE6 I;  3PO2 H;  5M3M G;  1Q1B A;  2Z6K A;  3A0J A;  1X9N A;  2HIV A;  4DR4 L;  3S24 A;  5GAH C;  4DR6 L;  2B63 H;  2PQA B;  1Q8K A;  4A3J H;  3CCU A;  2GVA A;  1PYS B;  4HIK A;  2NVX H;  3KOJ A;  3NEL A;  1P8L A;  3HKS A;  2OQ0 A;  3UDX A;  3GD7 A;  4HJA A;  1KRT A;  5C4J H;  1K8G A;  4JI3 Q;  4LF9 L;  4ME3 A;  4DV2 L;  3J81 i;  3G4S A;  1VQM A;  4LFC L;  3PV0 A;  4UP7 A;  5IYD H;  3RNU A;  1D8L A;  1GKH A;  2FXQ A;  3E0E A;  3G48 A;  3TQY A;  1VQH A;  2GVB A;  4JI6 Q;  4A3B G;  2R7F A;  2NN6 I;  4PMW A;  1YJW A;  4DV1 Q;  4RG1 A;  1B7Y B;  1OXV A;  4DPG A;  3KDF B;  3CAM A;  2VW9 A;  1N8R C;  2I0Q A;  1JT8 A;  4BA1 I;  3S1Q H;  4BBR H;  5FJ8 H;  4DR7 Q;  4C3J H;  2KCM A;  2MO1 A;  4PZ8 A;  5LMN L;  1CKN A;  1YJN A;  1VQ5 A;  1XNQ L;  3HOU H;  4LFA L;  3UDI A;  4POF A;  1OXT A;  5GAG C;  1PYB A;  2JA6 H;  4BY7 H;  1T9H A;  3TRE A;  2K14 A;  5LMN W;  4BBS H;  4JI0 Q;  4R4T A;  4BBS G;  2HIX A;  4YCU A;  2VL6 A;  4X62 L;  2F4V Q;  3PUX A;  1B70 B;  1GM5 A;  3PF4 A;  2UUC L;  2C35 B;  5JJL A;  2IHF A;  2N78 A;  5IP7 G;  2BA1 A;  3CCE A;  1I50 H;  3I7F A;  3CCS A;  1VQF A;  4HIM A;  3ULP A;  3CC4 A;  1KHI A;  2RF4 A;  2WAQ G;  1I94 L;  4JBK A;  4GN3 B;  1PH4 A;  1HH2 P;  1OXX K;  2PQA A;  3AYH B;  2XGT A;  3BZC A;  1VCI A;  4PZ7 A;  3RLN A;  1WYD A;  2LXK A;  5C3E H;  4DR1 Q;  4LFC Q;  2ES2 A;  4LF5 L;  5AJ3 Q;  3L7Z C;  3KF6 B;  4A3K H;  2QGQ A;  3M7N A;  5C4X G;  2AMC B;  4KHZ A;  1XMO L;  1PH7 A;  1L0W A;  2YU9 H;  4KLK A;  4AH6 A;  4JI5 Q;  3S16 H;  2CWA A;  3A5Z B;  5K36 G;  3E9I A;  4DV5 L;  4P74 A;  1VQ4 A;  5JJI A;  1XMQ L;  1CUK A;  1VQG A;  2KEN A;  2Q2H A;  1LYL A;  1AH9 A;  3RN2 A;  2JA7 G;  2JEB I;  3PUW A;  3CC2 A;  1XTD A;  1HNW Q;  4LF7 L;  1WOC A;  3I4N G;  2ZJP A;  2F52 A;  1HJP A;  5M5W H;  1PH1 A;  1M90 C;  4DV3 Q;  1J5E L;  2PMZ E;  2Q2I A;  3UE0 A;  3ULL A;  4MNO A;  2OQK A;  3PCO B;  4X66 Q;  4IPG A;  4HID A;  4AIM A;  1YIJ A;  1EIF A;  1NMF A;  3VDY A;  1Q81 C;  1VQ6 A;  2K5V A;  1WFQ A;  2UUB L;  4LUV A;  4AYB E;  3U4V A;  4X62 Q;  4LF4 L;  4B3M L;  4DNI A;  2HQL A;  5M5Y H;  3CCQ A;  1AE3 A;  1FGU A;  4GOP A;  2YTY A;  1E3P A;  4FDB A;  1L1O C;  5C0X J;  3CC7 A;  1B8A A;  2NVT H;  3D0F A;  5FLM H;  3J81 c;  1SRU A;  4QY7 A;  1UE5 A;  1VQ9 A;  1TWH H;  1VS0 A;  3U50 C;  4DR6 Q;  3CME A;  4DV2 Q;  3MXN B;  4C2M H;  3LGJ A;  4GKK L;  3HFZ B;  1VQL A;  3FKI H;  2UUB Q;  4LF5 Q;  3GO5 A;  4A3M H;  4JI2 L;  4OO1 G;  2R93 H;  1CSP A;  3I4N H;  2H5X A;  4A3F G;  5M5X H;  1Z9F A;  4JV5 Q;  2JA7 H;  4R4C A;  4JBW A;  3CXC A;  2R7D A;  1X54 A;  4JI3 L;  2XTI A;  3NEM A;  4AYB G;  5C44 H;  2VQF Q;  4EX5 A;  1VQJ A;  3S1R H;  4B3T L;  2VUM G;  3TS2 A;  1Q1E A;  5ELO A;  3S14 H;  4OX9 Q;  5IYC G;  1U0L A;  4A3D G;  2UXC Q;  2I5L X;  1Y1W H;  4OO1 I;  3OTO L;  3H3V H;  4LF7 Q;  2UXB L;  4A76 A;  3U58 A;  4TQU S;  2JA5 G;  2PNH A;  3I4O A;  5EAY A;  4H02 A;  1V43 A;  5DLQ E;  1KL9 A;  1WCM G;  4OXP A;  4A3K G;  5FLX c;  3EN2 A;  1JJ2 A;  1BBW A;  2UUC Q;  2Y0S E;  4JOI A;  2IX1 A;  4DR4 Q;  1O7I A;  2VZA A;  4IFD I;  5C3E G;  1Q7Y C;  4DV0 Q;  2WFW A;  1YJ9 A;  1NMG A;  1XNR L;  4GOP C;  1E22 A;  4B3S Q;  3J80 c;  2UU9 L;  4JG2 A;  1G51 A;  4JCV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...