2JA5H

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja5H00
4GS3A 1JB7A 3PF4A 2K50A 2BA0A 4QGUA 3T1HQ 4OO1G 4A3MG 1VQJA 3PUWA 3HOUH 4JYAL 1YHQA 3I4MH 1G291 1Q82C 2IHEA 1EIYB 4FDBA 2YV5A 2ZTEA 3GTJH 4HJ5A 3PF5A 3CMEA 5IYCH 5FLXc 2NN6G 1BKBA 4HIMA 3AQQA 5AJ3L 4DV1Q 3HKSA 2B3GA 1GVPA 1Y1VH 2ASBA 4BY7H 4LF8L 2VL6A 2OQKA 3I55A 4HJ9A 4QIWE 1CKNA 3B6YA 3PUYA 4DUYQ 4R4TA 3VDYA 1HNWL 1A0IA 3CMAA 1LYLA 1N32L 1EOVA 4X64Q 2I5MX 1YHBA 5LMNW 3J7ZC 1N33Q 4JI1L 2F4VL 1OXXK 1OXSC 4A3IG 3S16H 1HR0W 2PMZE 3UDGA 1MKHA 4C3HH 1EWIA 1YVCA 1S72A 3A0JA 2I5LX 2OCEA 1WYDA 4A3KG 2CWAA 1RL2A 1VQNA 1TWFH 1VQDA 2WAQE 3GD7A 2R7FA 4QY7A 3KJPA 5M5WH 2RF4A 4LF6L 1B7YB 2A1AA 2UXBQ 2YTXA 4GN4B 5HY6A 5LMUL 3RN5A 2IX1A 1XNQQ 1I94L 4JV5Q 3RLNA 5JEAJ 2UU9L 2VQEQ 1Q1BA 5IYBG 4DR4L 2PNHA 3L0OA 4WJ3M 4DAYB 1KL9A 4IJHA 4GNXA 2UUBQ 4JI4L 1YHAA 1VQ4A 3I2ZA 4LF7L 3PO2G 1X3FA 3CC2A 1AE3A 4Y7NH 4YHHQ 3HOUG 4DR1L 4A3LG 2UXDL 5FJ8G 4JG2A 5IYDH 2R7ZH 1PH5A 2MFIA 3W5OA 1VQHA 3PO3G 4JI2L 1IZ6A 3W1BA 4JI0L 4A3BG 4JI5L 4NB3A 3F2BA 4DUYL 3K8AA 1HNWQ 5C4XG 3PV0A 2QA4A 2NVTH 1JT8A 1ASZA 2JA5H 1LTLA 4LUZA 1IBKQ 5H1SE 2JA7H 1IBMQ 1C0AA 5M3MH 1KIXA 1PH9A 3T1YQ 1CSPA 2F3IA 2RHSB 2VS1A 2JA7G 4X62L 1WFQA 3PIPA 4DR6L 5C4JH 4JBWA 4MZ9A 4C3IH 1KD1C 2Q2TA 3D0FA 1K0RA 4HIDA 1JE5A 2KCMA 1SRUA 1PFSA 3MXNB 4DUZL 3S24A 2UU9Q 3S14H 2ZJQA 1XTDA 1XJVA 2Z6KC 1P8LA 3JAMi 2OTJA 1N34Q 3LGJA 4TQUS 3PUVA 5IE8A 3CD6A 3S17H 3CP0A 2VUMG 3OTOL 1HNXL 2E8GA 2K4KA 3IRBA 2YTVA 5LMNQ 3NELA 2E2HH 4JBKA 3HOYG 3CCEA 2AWOA 2AWNA 2ID0A 2ZM6Q 4OWWB 2NVQH 1B8AA 2MNAA 3HOXG 3CAMA 1PH8A 3FHWA 1VQMA 1XMQQ 4K0KQ 4H02A 4LF5L 2D0PA 2PI2E 1CUKA 5GAEC 4A3JG 4JI3L 3F2CA 4AQYL 4UY8C 2A8VA 3S1QH 4QJFA 1UWVA 3HKZG 3STBD 4BA1I 5C3EH 1VQEA 3U4ZA 1E3PA 1YNXA 5C0XI 4DV5L 4A3CH 2K5VA 5GROA 1QZGA 1D8LA 4DV6Q 4JI2Q 5JEAG 2KHJA 2IT1A 4RG1A 5IP9H 1VQ8A 5M3MG 1GM5A 4IOCA 2EIFA 1FGUA 1W2BA 3HOWH 3RZDH 2ZJPA 1M1KC 1QUQA 5IP9G 4DV2Q 1IBLQ 2ATWA 4LF9Q 1VS0A 5BR8L 1R9TH 2KHIA 5GAHC 3CCVA 4B3SQ 4OX9L 1VQLA 3TS0A 2WB1E 4A3DH 3K7AH 1V1QA 4NPSA 4JI5Q 3CC7A 1PVOA 1CKMA 4RMFA 1IXRA 3KOJA 1Y1WG 4EX5A 2WFWA 3BZKA 1KRSA 1IBKL 2ZM6L 1HZCA 1YITA 2PQAA 4YWLA 5IYCG 4LF4Q 3KFUA 4GNXC 1TWGH 5IP7H 4DV4L 1X3EA 1YJ9A 2E5LQ 4B3ML 4AIMA 2C35B 4O2DA 4R4IA 2PQAB 1E22A 3EIVA 1TWCH 1LM0A 3RR5A 3HFZB 1TWHH 4DV7Q 5C0XJ 2B63H 4YWMA 4YHHL 4DV5Q 2L15A 4XTCS 1HJPA 1HZBA 5M3FH 1PH6A 1JMCA 3A5ZB 4BA2I 1L2FA 3PUXA 4HJAA 1XPOA 5J3BA 1L1OC 4DR3L 1PH7A 1NJIC 1VCIA 2YTYA 1WOCA 4X64L 1EQQA 1N33L 2HT1A 4OWXB 3F2DA 3S1RH 2JA6G 3H3VH 2NVXH 4KHZA 2WAQG 4JBMA 5IT9c 1OTCA 2BH8A 4GNXB 4APVA 2Q2IA 2JA8H 4JI6Q 3I56A 3S2HH 1EIFA 1XNRL 1XMQL 3TRZA 4B3RQ 4DKAC 2MQHA 4OXPA 4P75A 4DK6C 5GAGC 4X62Q 5LMNL 4KHPQ 2UUAL 5JJIA 2NZOA 3E9IA 2LXJA 3JAMc 1FJGL 1KHIA 3UDFA 1K9MC 2EQSA 1HR0L 4HJ7A 2K5NA 3BJUA 3RLOA 1PA6A 4PZ8A 1MJEA 2E2JH 3GTQH 1T9HA 3CPFA 3M4PA 2VQEL 2ZTDA 1ASYA 1KC8C 4C2MH 4JI4Q 3M4QA 3HOZG 3L7ZC 3CPWA 1JJCB 3I4NH 2IX0A 3BU2A 4LUVA 4Y52H 2N3SA 3ZJYC 1BBWA 3DM3A 2BA1A 3OTOQ 3RLFA 4DR3Q 1X55A 2NZHA 2GVAA 4O0AA 4GLAC 2HHHL 4L5SA 5IP7G 2R92H 2B63G 1M90C 1SLJA 3CCJA 1VQAA 1D7QA 4QL5A 2I0QA 2R92G 3KF6A 2JEBI 4LFCL 1N9WA 1EYGA 2IHFA 3TEHB 3TQYA 3G4SA 2R7DA 3JC66 3BZCA 3HKZE 3J80i 1KXLA 4DV2L 1OXVA 2AMCB 3ER0A 5C3EG 3H15A 1NE3A 3HOVG 3CCLA 4DV3Q 2N49A 3U58A 1J5EQ 4DR2L 1HNZL 4A3GG 3AFPA 4DR7Q 4DV4Q 3FKIG 1L1OB 2CQOA 4YY3L 4JYAQ 1XNQL 3K7UC 4L5TA 4DR5L 4ALPA 1PV4A 4JV5L 2I5HA 4DR4Q 2VNUD 4YCWA 4JBJA 1AE2A 2ES2A 5EAYA 3U50C 3ULLA 1EUJA 4XIGS 3PIOA 1HZAA 1PYSB 2RHQB 1O7IA 5AJ3Q 3J80c 2F52A 5M3FG 5M5YH 2V1CC 4DV1L 4A3MH 2GVBA 3CC4A 3NBHB 4OONA 4DR1Q 4A3EG 4LF8Q 1HNXQ 3PO2H 2KCTA 2N78A 4IJLA 4A93G 1Y1WH 1VQBA 1VQPA 1E24A 4A3EH 2IY5B 5ELOA 3GTPH 4X65L 4JI7L 1A8VA 3KDFB 1BVSA 4QQBX 5C4XH 2JEAI 1JJGA 2CWPA 2D62A 1IYJB 4IFDG 3PSIA 4DV0L 2YYZA 1QVCA 4K0KL 3F1ZA 3E9HA 3S1NH 3H3VI 1N36L 4IPHA 3M85A 4JOIC 1X54A 2K52A 1L0WA 1K8AC 2MO0A 3I4NG 4BXXH 2VZAA 1H95A 3RNUA 3K0XA 1MJCA 1C7YA 1K3RA 4IFDJ 1YBYA 5IWAL 4DV7L 3ULPA 3KF6B 2EXDA 3CCUA 4HIOA 4TVAB 2UXDQ 2JA6H 1GD7A 1X56A 2Y0SE 4GN3B 3HOVH 4LWCA 1NMGA 4GKJL 1VQFA 2CCZA 1N32Q 1YEZA 3AYHB 4A3GH 3KF8B 1S40A 3FP9A 1E7ZA 2XGTA 4LFAQ 4AYBE 5HGQA 4A3FG 4UP9A 2OWOA 1UE5A 2Y0SG 1SN8A 1A62A 4IPDA 2LSSA 4L5RC 2RCNA 4NXNQ 3WWVA 3NEMA 1J6QA 4X6AH 3PO3H 1BBUA 4PZ7A 1KAWA 4A3JH 4A93H 1J5EL 4DAMA 2JA9A 2K14A 1UEBA 4B3MQ 2CFMA 1A63A 5ELNA 4JC0A 1C9OA 4KLKA 3EBEA 3RN2A 2R7ZG 1Q86C 4DV3L 3S1MH 1FVIA 3GTLH 4LUOA 1W3SA 1Y14B 1RIPA 5LMUQ 1XPUA 2AKWB 2HIXA 4LFBQ 4DR7L 3I7FA 1I6HH 3D31A 2QGQA 3PCOB 4GOPB 4A3CG 2ZTCA 4BY1H 1XMOL 1Q1EA 1Y1VG 4BY7G 2KENA 2Q2HA 4GN5A 1VQ7A 2UUBL 3PGZA 4GKKQ 5DLQE 2BH2A 4BY1G 3TS2A 2PI2A 1Q7YC 4A3DG 2JQOA 5M5XH 4BXXG 1TWAH 1IBLL 3F8TA 3J81c 2FXQA 4LW1A 3GTKH 1WCMH 1I50H 4LNQA 1VQ9A 2UXCL 1CKOA 1NBWA 3S2DH 2OTLA 1KRTA 4JI8Q 3ERSX 1V9PA 5IWAQ 4A3KH 4DR2Q 1HNZQ 2VY3A 4R1JA 4BBSG 3CW2C 3SGIA 3I4OA 1VQ6A 1SMXA 2ALYB 3GO5A 3G6EA 1B70B 5IY0A 5C44H 4B3TL 4P71A 4GKJQ 2DUDA 4HJ8A 5IYDG 2VQFL 1X65A 4GLVB 4A3BH 2NVYH 4YCVA 4LFBL 1CSQA 1EQRA 5BR8Q 3OW2A 4R4CA 3STBC 1JJ2A 1U5KA 4WJ4A 2JA8G 3G71A 4JOIA 4IPCA 1N34L 4MNOA 1WJJA 3TREA 3GTMH 2B29A 4IPGA 3E0EA 3CXCA 2F4VQ 1K83H 3DLLA 1PH1A 2K75A 4OO1I 3KLWA 1GKHA 3CCQA 3FKIH 4NXMQ 4B3RL 2UXCQ 2R6GA 2WP8J 2UUCQ 1NMFA 2NN6I 5GADC 1UE7A 4A4IA 1L1OA 1VQGA 3UE1A 4LF4L 4IOAA 3UE0A 3M9BA 4A76A 3T1HL 3L2PA 2E5LL 1Q8KA 4AQYQ 4JI3Q 3GTOH 3U4VA 1XMOQ 4UPAA 4X66Q 4YWKA 1WCMG 1HH2P 2Z0SA 1VQCA 3G48A 4L5QA 4GOPC 1TXYA 1GO3E 1Z9FA 4J15A 1WI5A 1E1OA 4LF9L 3M4OH 2VUMH 5C0XG 4LFAL 3KJOA 2R93G 2XTIA 4YCUA 1NY4A 1U0LA 3NENA 2QEXA 4KI0A 1I5FA 1SROA 2CKZB 4JI7Q 4JI0Q 4GKKL 1VQKA 4MTNA 1K8GA 3K80C 1X9NA 3HOXH 4JI1Q 3EN2A 3Q8DA 5FJ8H 3CCMA 2ZJRA 1Q81C 1HR0Q 4BBRH 5FLMH 3HOYH 3J7A5 1K73C 1I3QH 4LF5Q 4LFCQ 1CKNB 3H0GG 2VW9A 1XNRQ 1N8RC 4GOPA 2YU9H 4AYBG 3RZOH 4BBRG 5FLMG 2UUAQ 3CCSA 1OXUA 2HIVA 3H0GH 4JI8L 4GLXA 1YIJA 1IL2A 4B3TQ 3GTGH 1MIUA 2OQ0A 4LF6Q 2VQFQ 3J81i 3CQZH 1AH9A 3CCRA 1I94Q 4DV6L 1SR3A 1PH2A 2HQLA 4YY3Q 1PHJA 3ICEA 1YZ6A 2WB1G 4OWTB 5E7NA 4DUZQ 1VQIA 4HIKA 2GN5A 1PH3A 4POGA 4X66L 1YJNA 2K5HA 3I4MG 2Q2UA 4UP7A 2E2IH 1E1TA 3M7NA 3AEVA 4EQ5A 4C3JH 4JCVE 1SE8A 3KYHC 3UDXA 4KHPL 4AH6A 4NXNL 2HHHQ 4NXML 1UE1A 1QVGA 2LXKA 1Q46A 2KBNA 4R4OA 2R93H 4BBSH 2JA5G 4R4QA 5K36G 1X3GA 2AHOB 3ULJA 3T1YL 4DPGA 1P16A 1X6OA 3K81C 4PMWA 2N8NA 1N36Q 2D0OA 4DR5Q 4DR6Q 1V43A 2DGYA 3A5UA 3GDEA 4A3IH 3A74A 1EFWA 1FJGQ 5JJLA 1S3OA 4PG3A 1HZ9A 1PYBA 4DK3C 1G51A 3OYYA 1LUZA 4P72A 3CF5A 3KDFA 1NTGA 1DGSA 4LF7Q 2UXBL 3J81j 1QZHA 2A19A 1VQ5A 1UE6A 1OXTA 4P73A 1PH4A 1XPRA 4DNIA 1YI2A 3W1GA 3HOZH 1Q12A 4POFA 1KQSA 4IFDI 4IO9A 3UDIA 3M3YH 4PZ6A 2JJQA 4JI6L 1Z47A 3PUZA 4A75A 4P74A 4UP8A 4DV0Q 1SFOH 1IBML 4B3SL 1QUQB 4OX9Q 2Z6KA 1QVFA 2H5XA 3S15H 4A3FH 1VQOA 1YJWA 5GQOA 2JK8A 3HOWG 4X65Q 4ME3A 1FL0A 2JE6I 3AFQA 2UUCL 5IYBH 3MEFA 4A3LH 2MO1A 1G6PA 5C44G 5JJKA
chains in the Genus database with same CATH superfamily
2Z4IA 2BA0A 2F0UA 5JOBA 3TP5A 3T1HQ 1X3QA 2EY6A 1ENAA 3HKZB 1EIYB 4FO2A 2K32A 3GTJH 4HJ5A 5IYCH 4HIMA 5I6YA 1LTRD 4DV1Q 1O78A 3J81E 3HKSA 2ASBA 1Y1VH 5J1ZA 1SNCA 2VL6A 1DOKA 2OQKA 4HJ9A 3B6YA 2E2HB 1WVLA 1STBA 4RA8A 3J80E 1N32L 4IUUA 2I5MX 1YHBA 1SNPA 2F4VL 3R2IA 1OXXK 4A3IG 1G6ZA 3S16H 1HR0W 2SNSA 3UDGA 1MKHA 1RKNA 1YVCA 3OW7A 1PZID 4HN7A 2R7FA 4QY7A 3KJPA 4LF6L 4DU9A 2CW0D 4GN4B 3I4NB 3DWQA 2A69D 4JV5Q 2FMCA 1MI2A 2L11A 1ILQA 4A3JB 1TWGB 3L0OA 4WJ3M 1KL9A 3M4OB 1HRJA 3E5SA 4Y7NH 4YHHQ 4IZ8A 4DR1L 3NPPA 5FJ8G 2MFIA 1IZ6A 5IGFA 1D5XC 4JI0L 1HNWQ 3K8AA 2QA4A 2NVTH 4OO1H 1ASZA 1TS2A 3J81L 4LUZA 1SAPA 5H1SE 3C1EA 1KNAA 1PH9A 1CSPA 2A6HD 2RHSB 2Z8LA 4RAUC 4X62L 1WFQA 4DR6L 4JBWA 4IURA 1A3UA 1KD1C 3HRZC 1FR3A 1NAPA 1KABA 4G57A 1PXUA 4DUZL 3S24A 2UU9Q 5C5MA 3S14H 1Y8PB 2IPKD 5M5YB 1P8LA 3JAMi 2OTJA 1N34Q 3LGJA 3NTHA 4TQUS 2B2UA 2KQ3A 3CD6A 3OTOL 1HNXL 5IOCA 1SYCA 4A3BB 5LMNQ 4WJWA 3NELA 1O7LA 1C4QA 2B2TA 4L6TB 4MIUA 2ID0A 4QB4A 1B8AA 2MGSA 2MNAA 3HOXG 3CAMA 2NB0A 2PI2E 1G8ZD 3KK7A 4QJFA 1B9NA 3MHBA 1VQEA 1E3PA 2K28A 1TY2A 4DV6Q 4RG1A 1E0BA 1BCPD 1VQ8A 5M3MG 3R3OA 3HOWH 3GP7A 3W3AA 1MGSA 2NWGA 3OMCA 4LF9Q 2ATWA 1PFBA 2KHIA 2PQEA 3CCVA 5CGKA 2MJ8A 5I2XA 1UNSA 4JI5Q 3CC7A 4FNFA 1CKMA 3KOJA 4EX5A 3BZKA 1IBKL 2PQAA 4YWLA 4KJOA 5IP7H 2QKIC 1YJ9A 2E5LQ 5EPKA 1ESRA 1PLFA 1FD7D 1I4HA 2A6EC 1VMPA 2X69A 3I3CA 3QG1A 1TWCH 3RR5A 1FYCA 4H7BA 5EGTA 1EQVA 2KOLA 4YWMA 1HJPA 1B3QA 1HZBA 4N9PA 1PH6A 1WTPA 4BA2I 1L2FA 3MTSA 1PH7A 1QNUA 3DMUA 1WOCA 5C3WA 2HT1A 3F2DA 3S1RH 1CHPD 2B2VA 3VR6A 3A7AB 2JA8H 4CDEC 4A93B 5LL6X 3MXPA 3TRZA 4A3EB 5GAGC 1ENFA 4X62Q 2B2WC 1CQFA 1PTOC 2NZOA 2K1BA 2LXJA 1K9MC 1HR0L 2B8FA 3BJUA 1PA6A 3Q22A 3CPFA 4A3KB 1QJOA 3FKIB 2F4IA 4H13C 4JI4Q 4FF1A 2KVMA 1IW7C 1JJCB 3BU2A 3NQIA 5CMDA 2N3SA 2NZHA 3VYTA 2HHHL 4GLAC 4L5SA 4KKSA 3BVZA 1M90C 3CCJA 1VQAA 2OT2A 2R92G 2JEBI 1WTRA 4H44C 2IHFA 4C3IB 2WB1B 2F3VA 3D4DA 3JC66 1C48A 4OGQC 3ER0A 1H9KA 4I7ZC 4ZK9B 3MXUA 5EBDA 2Z6BA 4DV4Q 1B44D 4JYAQ 4ILWA 4JV5L 1EU4A 4OIKA 2F0QA 2G9HD 2VNUD 2RVLA 1AN8A 1SEBD 2I46A 2RHQB 3CC4A 2EOTA 4R9WA 3NBHB 4DR1Q 4LF8Q 3PO2H 4IJLA 4A3EH 2NN6H 2E76C 3GTPH 4JI7L 3LWEA 2R93B 1PZJD 1ZEQX 4KHVA 3H3VI 3M85A 3BS1A 2WINB 2K52A 2LS01 3ND8A 1L0WA 3R93A 3A8IE 3M7GA 1C7YA 2P5ZX 4TVAB 3CRKC 2Y0SE 1X56A 4GN3B 3OOCA 1F2YA 4LWCA 1NMGA 3P20A 5DNFA 4GKJL 1N32Q 1YEZA 2B63B 3KF8B 5CORA 3QO2A 2XGTA 4A3FG 1SBBB 1UE5A 4FXGC 1SN8A 2LSSA 2RCNA 4EQPA 4C3JB 3OIPA 3NTKA 5C44G 3PO3H 4A3JH 1J5EL 4DAMA 1E2VA 3P1HA 5ELNA 4TSSA 1TWHB 3K58A 2F0EA 2R7ZG 1IKMA 3A54A 3VYUA 3S1MH 1L0XB 1DYQA 5K36H 1LTSD 1I6HH 1BBXC 2ZTCA 5FLXE 4BY1H 3I72A 1Q1EA 1VF5C 2KENA 2Q2HA 2UUBL 4GKKQ 1SNOA 1STNA 4HCEA 3J81c 2A74C 1RTNA 5M5XB 4HSPA 4Z9CB 1VQ9A 2OTLA 5ELEA 3EROA 3S16B 4R1JA 4XYOA 1SMXA 4K8IA 1B70B 2PNRC 5IY0A 5C44H 4B3TL 4P71A 5I9PA 1Y1WB 5G3LF 2EJFC 3LWUA 3NWTA 4OL7A 4A3BH 4ZQ3A 3OW2A 1RD9D 1JOQA 1U5KA 2Y0SB 5CBAE 1WJJA 3ITPA 4DAVA 1LLRD 4ZUJA 3S17B 2JXMB 4K6DA 4KY5A 4NMZA 3GQBA 3Q24A 3G6JB 2E2DC 2OEOA 4K14A 4ID6A 1Q8KA 1CA6A 1DD2A 2LMCB 2SEBD 4X66Q 2Z0SA 3G48A 5KNCA 4ZAIA 1GO3E 1NCVA 1E1OA 1EIGA 4LF9L 3VR5A 2R93G 1ZKOA 5HURA 3PIO3 2QEXA 4KI0A 3K80C 2IW3A 5FO7B 4JI1Q 3Q8DA 5FJ8H 2ZJRA 5IT9E 1A6XA 1K73C 2Q8RE 4GOPA 1LABA 2UUAQ 4JI8L 3H0GH 2EZVA 4ABNA 3GTGH 4XT1B 1MIUA 2RA4A 3CQZH 4M8AA 1SJED 1PH2A 1JOKA 2WB1G 3TDQA 1ICWA 1DOLA 1W6KA 2GN5A 4PNYA 4X66L 1AZPA 4NKLA 3CQZB 4UP7A 2E2IH 3KLRA 3C1FA 3X3MA 4NXML 4NXNL 3PO2B 1QVGA 1G2TA 2AQ2B 2R93H 1X3GA 1LV9A 2AHOB 3ULJA 1XWEA 4DPGA 1X6OA 3BDLA 4DR5Q 3A5UA 1B2TA 4TKOB 4FXKC 5E1FA 1HZ9A 3CF5A 3OYYA 1LUZA 3J81j 3OMGA 1PFMA 1PH4A 3SXHA 1B53A 3HEJA 1EOTA 1Q12A 2B8GA 4IFDI 2F0TA 4IO9A 2JJQA 1Z47A 4WRDA 1KLGD 1T5EA 4LMQD 4A3FH 5GQOA 3S1RB 4X65Q 1MBYA 3CU7A 3MEFA 4DXFA 2F0SA 5JJKA 1TT2A 1EIHA 3PF4A 3HOUH 1YHQA 2GA4B 4FDBA 3TBIB 2YV5A 3IFDA 2F3WA 2LKVA 1LT6D 4OIJA 1S4ZA 2B3GA 3I55A 5E4WC 2BE5C 3PUYA 3VDYA 1I6HB 5EBCA 5LMNW 1H9RA 3HOYB 3J7ZC 1SSOA 4C3HG 4E6IA 2PMZE 1EWIA 1S72A 3TP8A 2SOBA 2QDBA 2CWAA 2FJ2A 5EKKA 1VQNA 2WAQE 2VB2X 3EJIA 2M00A 2QDLA 2RF4A 5M5WH 2A1AA 1JORA 2SDFA 2YU9B 3RLNA 1Q1BA 3P7JA 2PNHA 3EFXD 2EYOA 4JI4L 1RJTA 4IJHA 3S9WA 1VQ4A 3I2ZA 5CYUA 4LF7L 1AE3A 3I4LA 3HOUG 4A3LG 2JA6B 3PO3G 3W5OA 1VQHA 3A56A 4A3BG 4DAPA 4JI5L 3F2BA 4A3FB 3IAYA 1JT8A 2JA5H 1LTLA 5M3MH 2O5JC 4HMJA 3HOUB 2QF7A 5C4JH 3QIAA 5FO8B 2DY8A 3FDTA 3D0FA 4BBRB 2KCMA 2EY5A 3DM1A 3L9AX 5HGTA 2RDHA 1PRTB 4EGVA 1XTDA 2O4XA 3NXWA 5FKAC 5ISRA 3PUVA 5IE8A 3J7AV 3ND9A 1YNJD 1Y8NB 3CP0A 3I8ZA 3HGBA 4ZLTF 2YTVA 2TSSA 2E2HH 3HOYG 2ZM6Q 4OWWB 1PH8A 1XMQQ 4H02A 1EQTA 1BUVT 4UY8C 4JI3L 4AQYL 2J0TD 5G3LD 1UWVA 4IFDH 2PZWA 5C3EH 3U4ZA 5JVG3 1YNXA 4A3CH 1WTHA 3NHHA 5GROA 1ET9A 2IT1A 4HAEA 1DM0B 2X6LA 1PZKD 2EYPA 4KD4A 4XDXA 1FGUA 4IOCA 4K2KA 3RUZA 2R92B 3N6RA 1S5BD 1M1KC 5IP9G 4DV2Q 1IBLQ 1BO0A 4B3SQ 1JWUD 1VQLA 5A2QL 2H1EA 2KCNA 2WB1E 4A3DH 3K7AH 4M1UB 1V1QA 2ZXOA 2E2IB 4RMFA 3SK6A 1UAPA 2K05A 5E4XA 3MXNA 5IGCA 3SK8A 4LF4Q 1HXYD 2FMMA 4CDDC 4DV4L 4B3ML 3W2DA 1GUNA 4O2DA 4R4IA 2PQAB 5M3FB 1E22A 3I70A 2B63H 5ELFA 4HJAA 3D6WA 1XPOA 4DR3L 5CR3A 2JA6G 1N33L 4KHZA 4ME5A 2WAQG 4JBMA 5IT9c 1IHZA 2Q2IA 1JC7A 1B9MA 3T56B 1XNRL 4KHPQ 4DK6C 4OXPA 3GTGB 3LX0A 1JR0D 3E9IA 4K5WA 1E2ZA 2EQSA 5JEAH 4MHEA 4CKCA 4HJ7A 3RLOA 2E2JH 1MJEA 4PZ8A 4JK1C 3KBXA 3WDNA 1T9HA 2VQEL 4UHVA 1TWFB 1K28A 3N52A 5KYIA 5C0XH 2MUYA 2C5CA 4IUTA 4Y52H 2NTTA 3ZJYC 3DM3A 4O0AA 5IP7G 3DEPA 1TY0A 1M4VA 2XWBB 1EYAA 2I0QA 1EYDA 1F2ZA 4LFCL 1N9WA 3D8GA 2K03A 3BZCA 3HKZE 3F2UA 4MTKA 5F2DA 1KXLA 4WFN3 3H15A 1NE3A 1DCZA 4KKUA 4DR2L 1CM9A 5L37A 1SYEA 1V1PB 4XQNA 4A3GG 1YNNC 4UAIA 1CA5A 2CQOA 4ZUIA 4YY3L 5CV4A 1XNQL 4DR5L 2XNAC 4ALPA 2I5HA 3H0GB 1PRTC 2ES2A 4XT3B 4NDXA 1HZAA 1EEID 1O7IA 1S5ED 4PMBA 3J80c 4DV1L 4A3MH 1SYDA 2QEJC 1EY6A 2V1CC 5EQ0A 1CTMA 2N78A 2WV6D 3GTKB 4ZYSA 1VQPA 1A2UA 2IY5B 5ELOA 1A8VA 4QQBX 2JEAI 2CWPA 2D62A 3PSIA 4DV0L 1QVCA 3F1ZA 1HQRD 4IPHA 2DN8A 1X54A 4UDUC 2MO0A 3RNUA 3HZXA 1IW7D 1ONLA 1K3RA 1YBYA 5IWAL 4DV7L 2B2VC 3C2PA 2NZ1D 1GJXA 1GD7A 3T13A 1PTOF 1VQFA 2CCZA 1EZ6A 1SYFA 2KEEA 1LT3D 2XRSD 3NSWA 3MXGA 3FP9A 1STYA 4UP9A 2CW0C 2Y0SG 4IPDA 1KNEA 3VYSA 5M5WB 3D4RA 1R9TB 4PZ7A 3S2HB 3TZUA 1UEBA 2CFMA 4JC0A 4KLKA 3EBEA 4RCOA 3RN2A 5KYLA 1Q86C 1HFNA 1Y14B 5LMUQ 2N55A 4LFBQ 1F9PA 2E75C 3PCOB 1F9RA 1PTOD 2QGQA 4A3CG 1XMOL 1Y1VG 1VQ7A 3PGZA 2BH2A 4LK1C 1Q7YC 1QOHA 2JQOA 2EVBA 1IBLL 3F8TA 2NBFA 3URYA 1I50H 2F1MA 1TS5A 2EDGA 1CKOA 4ODGA 3ERSX 4JI8Q 4C56C 1V9PA 2PYKA 4A3KH 1WTOA 2VY3A 1ESFA 3K5NA 3S1NB 3DEOA 4BBSG 3CW2C 1EY0A 3SGIA 1NSNS 3GO5A 4GKJQ 4HJ8A 1EY5A 3S1QB 1X65A 1KTKA 1I6VC 1J8IA 2IWHA 1JJ2A 1S5CD 5BN3A 4WJ4A 2G5DA 5DEHA 4MNOA 3TREA 4HEDA 3GTMH 3I73A 1FGBD 4NXMQ 4DAYA 2MPMA 4PQXA 1NMFA 1DXMA 1UE7A 1L1OA 4A4IA 1SE2A 1B3AA 1SYBA 4A76A 3T1HL 3L2PA 2E5LL 4AQYQ 4JI3Q 1NUCA 3U4VA 1U4LA 4UPAA 2CH4W 4J15A 1Z9FA 4A3DB 2NVXB 2Z9HA 2B2WA 5C0XG 4LFAL 1HUNA 3SVMA 2XTIA 1NY4A 3NENA 5FO9B 1I5FA 1SROA 2CKZB 4JI7Q 2F0OA 5D3DA 4EVOA 3SR1A 3CCMA 1Q81C 5FLMH 4DK1A 2L1BA 3U9OA 4LFCQ 1N8RC 2YU9H 1LACA 4BBRG 4FF4A 5JPMC 1OXUA 1F77A 2AUKA 4GLXA 1IL2A 3S15B 4G7ZC 1WTXA 2R3ZA 5A35A 2N88A 4R8NA 1K0SA 1Z7TA 1TS3A 1AH9A 1I94Q 1A3TA 1SR3A 4YY3Q 1PHJA 1TIID 2EYMA 3V05A 1DONA 4C3IG 1TWCB 5CV5A 4POGA 4DNTB 5C4XB 4CJ0B 1VF7A 1ENCA 1E1TA 3M7NA 3K6OA 4C3JH 4KHPL 2C9OA 3KYHC 4H0LC 3UDXA 2HHHQ 2WAQB 1K8OA 2LXKA 2FFKB 2KBNA 1BCPB 4R4OA 3TP7A 4BBSH 4KTAA 4XQQA 1QCBD 5AFWA 1RDPD 4R4QA 2ICIA 4CJ1B 4HR7B 3K81C 2D2CC 2D0OA 1U4MA 2A68C 1V43A 2DGYA 3GDEA 1HTPA 5M3FG 1ML0D 1PYBA 4DK3C 3KDFA 4LF7Q 1JICA 1QZHA 1X32A 1I4XA 2RCFA 2A19A 1UE6A 4P73A 1SE4A 3GV3A 1XPRA 2JSOA 4BWGB 4DNIA 1YI2A 4MN3A 4X3TA 3UDIA 2A69C 4PZ6A 1JCKB 1X3PA 1QG7A 4BY7B 4UP8A 4OX9Q 1QVFA 1OO9B 1I4PA 2Z6KA 2F0VA 2H5XA 1VQOA 1K8MA 2JK8A 1DOMA 2QW7A 3NBHA 2JE6I 2UUCL 4A3LH 4J6HA 2ZXPA 2K50A 3MFYA 2CQAA 3PUWA 4A3MG 2WIIB 1G291 2IHEA 3I91A 2K5QA 1EL0A 3K0YA 1TKWB 3CMEA 5FLXc 1BKBA 3QOLA 1ET6A 3A55A 1GVPA 2IJ0A 4QIWE 1CKNA 5J22A 1HNWL 1A0IA 1LYLA 3Q6SA 1EOVA 1VDZA 1N33Q 3MZ5A 3NWSA 1OXSC 2KEDA 3QR8A 4C3HH 3ZYYX 2JN4A 3A0JA 2I5LX 2OCEA 4A3KG 2WACA 1RL2A 5IGDA 1VQDA 1I4GA 1B7YB 2IX1A 3RN5A 1ILPA 1I94L 3X3NA 2UU9L 2VQEQ 1SNQA 1CI3M 4GNXA 2UUBQ 4IALA 3PO2G 1SXTA 2UXDL 4JG2A 5IYDH 2R7ZH 5EPJA 4RCNA 4KY6A 3DWPA 3W1BA 5C5LA 1ZXTA 4S3SA 2VUMB 5C4XG 1EZ8A 1T5XD 2F03A 2JA7H 4KKTA 4RGOS 1IBMQ 1C0AA 2F3IA 5LL6S 2VS1A 4RWSC 3P75A 1HA5A 3JAML 4MZ9A 3EQLC 2Q2TA 3NE5B 2L55A 2PZUA 4HIDA 1JE5A 1SRUA 1PFSA 1II3A 3NK9A 3DHQA 2XRQD 3SHLA 4CKEA 2KJXA 4G4KA 1XYIA 1XJVA 2AQ3B 2Z6KC 5ELBA 2K04A 1LT5D 1MD2D 3MFGA 1SNDA 3KBGA 1EEFD 1W6JA 2E8GA 2F0KA 2K4KA 3IRBA 4PMCA 4LAAA 4JBKA 3CCEA 4QUCA 4K0KQ 3FHWA 4LF5L 2QILA 4A3JG 2A8VA 2F0LA 3S1QH 4IQZA 3PIP3 3HKZG 2O2LD 2K5VA 1E2WA 2XWJB 1KDAA 1QZGA 2CHBD 4JI2Q 2F0WA 2KHJA 3VR4A 4CDCC 5IP9H 5JEAG 3JAME 5C44B 3E6ZX 1LTAD 2J7ZA 2EIFA 1W2BA 3RZDH 2ZJPA 1QUQA 2HDMA 5BR8L 1F2MA 3TS0A 5ELDA 1QILA 1PMRA 1B1ZA 4RKBA 4NPSA 1Y1WG 2JYOA 3EVQA 1Q90A 2HUGA 3VYRA 1LTTD 3HOZH 3KFUA 1HZCA 4IUPA 3ERQA 4DK0A 4GNXC 1TWGH 3MVVA 1X3EA 5C6AA 4BBSB 2C35B 4Y7NB 1LM0A 1NNXA 3HFZB 4LJZC 4YHHL 2F0GA 4XTCS 5M3FH 1O7YA 3A5ZB 5J3BA 2Q8TA 1K3BC 4K8JA 1EWHA 4X64L 4OWXB 4FXDA 4TRDA 2HD3A 1OTCA 4GNXB 4APVA 1B50A 1SYGA 3D4WA 3S2HH 1EIFA 4B3RQ 1XMQL 4F8MA 4P75A 5JJIA 5JJZA 3I4MB 1V8QA 3JAMc 4FYDA 1KHIA 3UDFA 1TS4A 4B9WA 1PRTF 1CZGA 2ZTDA 4A3GB 1KC8C 3M4QA 4IUQA 3HOZG 4C3JG 1J9OA 2DNEA 3L7ZC 2DY7A 3VR3A 2EY1A 1STAA 4OELB 1WD1A 3I4NH 1GXDC 3FVQA 2KUMA 3TP6A 3OTOQ 1PDQA 1X55A 5IGBA 2HDLA 2VXWA 2B2YC 2A6ED 3BVMA 4QL5A 1PYWD 1EYGA 3TEHB 3TQYA 2F0FA 2R7DA 1RTOA 4I7AA 3SK5A 4ZCKA 1OXVA 5C3XA 3HOVG 3CCLA 3VA7A 4DV3Q 4ULLA 1XX8A 1TVXA 1HNZL 1KDCA 4DR7Q 3FKIG 1L1OB 4P2CB 3K7UC 4N8X1 2E74C 4JBJA 2BDOA 1AE2A 2L5TA 3FEWX 3KUPA 3U50C 1EUJA 4XIGS 4EQOA 1PYSB 5AJ3Q 3MA2B 4RGMA 2GVBA 3SE0A 1TR5A 1GUOA 1IL8A 3GTMB 1I4RA 3NP8A 1G91A 1Y1WH 1VQBA 2Q8IB 4U68A 2LY7A 3KDFB 4K6LA 1BVSA 5C4XH 1JJGA 4IFDG 1EY8A 3DWAA 3ONAB 1WCMB 1N36L 4JOIC 3H6MA 4N8FA 1K8AC 4BXXH 1WTQA 1H95A 1HHVA 1WTWA 3Q0AA 3ULPA 2Z4HA 2EXDA 3K5LA 2HCIA 2OXPA 4C1NI 3HOVH 4V190 1BR9A 3AYHB 2RBMA 4QMGA 3AU7A 1D5MC 4R8IA 1S5FD 2I07B 1S40A 2OWOA 1E7ZA 5HGQA 4AYBE 5COYA 4DFAA 2F0DA 3H94A 3RD4A 1IYVA 4DXGA 4L5RC 1WTVA 4I65A 3WWVA 3SK4A 3NEMA 1J6QA 1YNND 4X6AH 1BBUA 1K83B 1KAWA 3IL8A 3C3LA 2JA9A 2NUCA 2K14A 4B3MQ 4X3UA 1CQVA 1JOOA 4KK7A 2B2UC 3GTLH 2R7ZB 1RIPA 4EQNA 2EXZA 1U9RA 3OSOA 1H9JA 4XQJA 4GOPB 3HOXB 2DNCA 4BY7G 3J7AF 4GN5A 3S2DB 3AMUA 1I3QB 1TWAH 5J39A 3WOFA 2NTSA 2FXQA 1PTOB 3FPPA 1RHPA 4LW1A 2PPBC 1WCMH 4F88A 5T1IA 3OHXC 1EYCA 3FPUB 3S2DH 1SFOB 3PMFA 5T1GA 4L8JA 1RCVD 1HFGA 5IWAQ 3K5MA 1HNZQ 5ELCA 3PQIA 3D6CA 2ALYB 4RHRA 1L0YB 2DUDA 5FLXL 4GLVB 2NVYH 1CSQA 4R4CA 3STBC 3TMEA 4G7OC 2JA8G 3G71A 4JOIA 4IPCA 1N34L 1CHQD 3CXCA 2F4VQ 1K83H 2K5DA 3KLWA 1BCPC 3CCQA 4B3RL 2F0JA 3CHBD 3BVGA 2R6GA 3TN2A 5GADC 3GTLB 2HCCA 4IOAA 2LFNA 4LF4L 4NP5A 2BE5D 5DAUA 4DN4M 3GTOH 5NUCA 1D5ZC 1XMOQ 4DNRB 1VQCA 3E0JA 4GOPC 1IYUA 4RKLA 1I50B 3M4OH 1D1IA 4KMUC 2VUMH 3UI2A 3KJOA 4YCUA 5M3MB 1KLUD 4CDFC 3NTIA 4C3HB 1STGA 1VQKA 4JI0Q 1K8GA 4XYQA 1AZQA 1EY7A 3D3RA 1JB3A 3C46A 3J7A5 4BBRH 3HOYH 1LO5D 1XNRQ 1AW7A 3GTJB 1CFMA 4IUVA 5I9OA 3GTPB 5FLMG 3RZOH 2K33A 3CCSA 3M4YA 2HIVA 3V96A 1IKLA 1YIJA 1TQOA 2VQFQ 3J81i 4QIWB 4N9TA 3CCRA 1CK1A 2RSOA 3ICEA 4OWTB 4DUZQ 4HIKA 3J80L 1YJNA 1EY4A 2BOSA 2K5HA 4KN4C 5IGGA 2FHTA 4EQ5A 4JCVE 4G7HC 4AH6A 2KA7A 4B08A 1Q46A 1LTGD 3HG9A 2JA5G 4CHTB 3TSSA 3T1YL 1N36Q 1BXTA 2N8NA 4B9XA 4A3IH 2XSCA 3A74A 3MAQA 1S3OA 5E3FA 1JE4A 5DM63 1NTGA 1DGSA 1MHWC 2SNMA 1OXTA 3Q23A 3K5OA 3W1GA 2ICEC 4POFA 4O1NA 5CV7A 5FK9C 4JI6L 1Y1VB 4RGTA 3FMCA 3PUZA 4P74A 1MSHA 4DV0Q 3QB3A 1IBML 1QUQB 1Z6HA 4V0BA 1LT4D 1QNKA 3S15H 1YJWA 3BZDB 3HOWG 4ME3A 1FL0A 3AFQA 3DXJC 5IYBH 1G6PA 1D1KA 1X9NA 4CBVA 4GS3A 1JB7A 1BOSA 3S14B 4C2MB 4QGUA 4OO1G 2RKSA 1VQJA 4JYAL 3OWEB 3I4MH 1Q82C 1GUSA 2ZTEA 2AQ1B 2H4OA 3MEHA 3PF5A 3R8BA 2NN6G 3AQQA 3O13A 5AJ3L 4BY7H 3IFTA 4LF8L 1QB5D 1C8CA 2F0NA 3BYYB 2A5HA 3BG3A 4DUYQ 4R4TA 2M9VA 3CMAA 1ZYRD 4X64Q 2M2LA 5CBEE 4JI1L 3NUCA 3VR2A 3EA6A 1TWAB 1WYDA 2L12A 1TWFH 3K7AB 3RMHA 1SJHD 1A3VA 3GD7A 1YNJC 2UXBQ 1RF2D 2YTXA 5LMUL 5HY6A 1DZ1A 1A15A 1XNQQ 5JEAJ 4QUFA 3HOWB 5IYBG 4DR4L 4DGZA 1HA6A 4DAYB 1WD0A 1YHAA 4CJ2C 1X3FA 3CC2A 5LHY1 2XVSA 3H91A 2XIWA 3T4AC 5CC4A 1PH5A 4JI2L 4NB3A 4DUYL 4QCLA 3PV0A 2KCCA 3L3OC 5BN5A 1EFID 5IT9L 5JPNC 1IBKQ 4RH6A 3KF8A 1KIXA 3T1YQ 2DJFC 4XXEA 2JA7G 3PIPA 1SMYD 4C3IH 3I90A 3U9SA 5KGUA 1K0RA 5JVH3 1M8AA 3MXNB 1HTLD 2ZJQA 1R4PB 4ZKCB 1TU2B 1GUGA 5KNDA 3A8JE 2A68D 1HUMA 3S17H 2VUMG 1MSGA 3KLSX 5EKIA 2K7VA 3QWNA 2EPBA 2AWOA 2AWNA 2CVRA 2NVQH 1VQMA 1UEAB 2D0PA 2D5DA 1CUKA 1U4PA 5GAEC 3F2CA 3GV6A 1F2LA 4K5VA 3STBD 4BA1I 5C0XI 4DV5L 4ZKBB 2F0IA 2B2YA 1I4QA 1Q8IA 3CRLC 1D8LA 1QE6A 4FP5D 1GM5A 5I2YA 2L0CA 3NBIA 1SE3A 1VS0A 1R9TH 5GAHC 4OX9L 3M3YB 4RFBA 1PVOA 4CKBA 1STEA 1IXRA 2WKCA 2WFWA 5M9OA 1KRSA 2ZM6L 1YITA 1XTCD 5IYCG 4Q0FA 2F0HA 5BN4A 2L4NA 2R61A 2F0MA 2JA7B 4AIMA 1BDOA 1FNVA 3EIVA 2EYJA 5KRUA 2K6AA 1TWHH 4DV7Q 5C0XJ 1U4RA 2L15A 4DV5Q 1JMCA 3PUXA 3H3VC 1NJIC 1L1OC 1VCIA 2ENBA 2JA5B 2YTYA 1LTBD 3CKIB 1EQQA 3H3VH 4DF7A 2BDNA 4BY1B 3A7LA 2NVXH 2BH8A 3RZOB 1EY9A 4JI6Q 1XXGA 2Z1CA 2VB3X 3I56A 2EJGC 4DKAC 2MQHA 4DA2A 5LMNL 4NW2A 1RODA 2UUAL 1BF4A 1FJGL 3LNNA 2K5NA 3GTQH 3M4PA 2B2TC 2PW5A 3KLSA 1ASYA 2F0PA 1ICFB 4J8QA 4C2MH 2D9UA 4JPBW 4KV6A 3TZDA 3MC0B 5C3EB 3CPWA 2KHSA 2IX0A 4RGNA 1PFNA 4LUVA 4AYBB 1V1OA 1BBWA 2BA1A 2V4DA 3IKJA 3RLFA 5EJWA 4DR3Q 2GVAA 2K01A 4HMIA 4JVZA 5C4ZA 2R92H 2B63G 5KNBA 1SLJA 1D7QA 1AFPA 1KDBA 3KF6A 1F9SA 4HSVA 4QF4A 3G4SA 3J7YW 3J80i 2AMCB 5C3EG 3BDCA 2N49A 3U58A 4KJNA 1J5EQ 4FF2A 1JWMD 3H09A 3AFPA 5TSSA 2IL8A 2NVYB 4L5TA 5C4JB 4X3KA 1PV4A 4DR4Q 4YCWA 5EAYA 3ULLA 5IGEA 2O5IC 3PIOA 4DV2L 2F52A 5M5YH 3K59A 2PCFB 4OONA 5I6WA 4PV1C 2ZT9C 4A3EG 1HNXQ 2KCTA 4A93G 4L63B 2RQXA 5EPLA 2RSNA 1BQQT 1E24A 4FVMA 2G9DA 4X65L 2A73B 3SDZA 1H9MA 2HQEA 4KD3A 1IYJB 1R4QB 2YYZA 4K0KL 4HTHA 1Y8OB 3E9HA 3V2TA 4OHJA 3S1NH 3GTQB 2EYLA 3I4NG 2VZAA 3K0XA 1LTID 4GZYC 1MJCA 4IFDJ 1G2SA 3AB9A 2NYZD 3KF6B 3CCUA 4HIOA 1ZYRC 2UXDQ 4C1NK 4CGYB 2JA6H 3RZDB 4A3IB 1GOZA 4A3GH 4LFAQ 1A62A 1O80A 3PO3B 1GHJA 4ZRZA 4NXNQ 2X6GA 1GUWA 4JW0A 4A93H 1A63A 3S1MB 1C9OA 3R2TA 2J4XA 4K5XA 1HCZA 1QWYA 2A6HC 3WOEA 4DV3L 4K2LA 1FVIA 2EY2A 2EYHA 4LUOA 1KAAA 3HS0C 1W3SA 1EWCA 3BYTB 1S5DD 2AKWB 2HIXA 1XPUA 4DR7L 3I7FA 3D31A 5CV9A 1HPCA 2B39A 1F9QA 2RDGA 3T16A 5DLQE 4BY1G 3TS2A 2PI2A 4A3DG 4KN7C 5M5XH 4F87A 4BXXG 3VA5A 3A8KE 5CV8A 5D3IB 1SMYC 4IUNA 3GTKH 1VMCA 4LNQA 4KY7A 2UXCL 1NBWA 3SEBA 1GUTA 4Q5VA 1KRTA 5DM73 5FOBB 3BDOA 4DR2Q 1B4OA 2EE1A 3G7LA 2CH4A 1D6EC 4IN3A 1AEXA 5CV6A 1SNMA 3I4OA 1VQ6A 1UUPA 3G6EA 4A3MB 1AP0A 1A2TA 3E3XA 1FNUA 5IYDG 2VQFL 2E2JB 4LFBL 4YCVA 2JA8B 5BR8Q 1EQRA 1JQYD 2ZXRA 5I4DA 2EYFA 2PMZB 4U673 2NVTB 1H9SA 2DJGC 2NVQB 1HQMC 3FRPB 2KECA 3OPOA 1FNWA 1PRTD 2B29A 4IPGA 3E0EA 3DLLA 5IODA 1PH1A 2K75A 4OO1I 1GHKA 1GKHA 3FKIH 2UXCQ 2IX3A 3T53B 2PZTA 2WP8J 2UUCQ 3QJYA 2NN6I 1VQGA 5D65A 3UE1A 3K57A 3UE0A 3M9BA 1EU3A 5C4HA 4J1MA 3T51B 5JAVA 4YWKA 1WCMG 1HH2P 2PW7A 4L5QA 3GTOB 1TXYA 1WI5A 3OWFA 1U0LA 1BCPF 5KIXA 5EKLA 4GKKL 2AUJD 4MTNA 3HOXH 3OIQA 3EN2A 4OEMB 1HR0Q 2EJMA 4WORA 1CT1D 5KEEA 1I3QH 4LF5Q 1CKNB 3H0GG 2VW9A 4FF3A 4AYBG 2OF1A 3HOZB 4B3TQ 2OQ0A 4RHSA 2RDFA 4LF6Q 1SDFA 1V1PA 3HOVB 4DV6L 2L9HA 3DUZA 2HQLA 2FINB 1YZ6A 5E7NA 4YIJA 1VQIA 2PO4A 1PH3A 1NR4A 2MHVA 1Q3LA 3I4MG 2Q2UA 5A2QE 3AEVA 1STHA 1SE8A 2BCOA 5D14A 4X3SA 1UE1A 2WKDA 4BS9A 3NQTA 3QOJA 1BNZA 5K36G 5K5PA 1P16A 3HP3A 4PMWA 4DR6Q 1EFWA 1FJGQ 2K5WA 5JJLA 4PG3A 1G51A 2UXBL 4O42A 4P72A 1DJRD 2XN9C 1D2BA 1VQ5A 1O7ZA 2JP1A 4HCSA 4F7XA 2TMPA 1PTOH 1KQSA 3M3YH 2MP1A 1NR2A 4A75A 1Y69U 1SFOH 4B3SL 2QCPX 3MWYW 5IIFA 1CZWA 1H9SB 2MO1A 1JWSD
chains in the Genus database with same CATH topology
4GS3A 1JB7A 3PF4A 2K50A 2BA0A 4QGUA 3T1HQ 4OO1G 4A3MG 1VQJA 3PUWA 3HOUH 4JYAL 1YHQA 3I4MH 1G291 1Q82C 2IHEA 1EIYB 4FDBA 2YV5A 2ZTEA 3GTJH 4HJ5A 3PF5A 3CMEA 5IYCH 5FLXc 2NN6G 1BKBA 4HIMA 3AQQA 5AJ3L 4DV1Q 3HKSA 2B3GA 1GVPA 1Y1VH 2ASBA 4BY7H 4LF8L 2VL6A 2OQKA 3I55A 4HJ9A 4QIWE 1CKNA 3B6YA 3PUYA 4DUYQ 4R4TA 3VDYA 1HNWL 1A0IA 3CMAA 1LYLA 1N32L 1EOVA 4X64Q 2I5MX 1YHBA 5LMNW 3J7ZC 1N33Q 4JI1L 2F4VL 1OXXK 1OXSC 4A3IG 3S16H 1HR0W 2PMZE 3UDGA 1MKHA 4C3HH 1EWIA 1YVCA 1S72A 3A0JA 2I5LX 2OCEA 1WYDA 4A3KG 2CWAA 1RL2A 1VQNA 1TWFH 1VQDA 2WAQE 3GD7A 2R7FA 4QY7A 3KJPA 5M5WH 2RF4A 4LF6L 1B7YB 2A1AA 2UXBQ 2YTXA 4GN4B 5HY6A 5LMUL 3RN5A 2IX1A 1XNQQ 1I94L 4JV5Q 3RLNA 5JEAJ 2UU9L 2VQEQ 1Q1BA 5IYBG 4DR4L 2PNHA 3L0OA 4WJ3M 4DAYB 1KL9A 4IJHA 4GNXA 2UUBQ 4JI4L 1YHAA 1VQ4A 3I2ZA 4LF7L 3PO2G 1X3FA 3CC2A 1AE3A 4Y7NH 4YHHQ 3HOUG 4DR1L 4A3LG 2UXDL 5FJ8G 4JG2A 5IYDH 2R7ZH 1PH5A 2MFIA 3W5OA 1VQHA 3PO3G 4JI2L 1IZ6A 3W1BA 4JI0L 4A3BG 4JI5L 4NB3A 3F2BA 4DUYL 3K8AA 1HNWQ 5C4XG 3PV0A 2QA4A 2NVTH 1JT8A 1ASZA 2JA5H 1LTLA 4LUZA 1IBKQ 5H1SE 2JA7H 1IBMQ 1C0AA 5M3MH 1KIXA 1PH9A 3T1YQ 1CSPA 2F3IA 2RHSB 2VS1A 2JA7G 4X62L 1WFQA 3PIPA 4DR6L 5C4JH 4JBWA 4MZ9A 4C3IH 1KD1C 2Q2TA 3D0FA 1K0RA 4HIDA 1JE5A 2KCMA 1SRUA 1PFSA 3MXNB 4DUZL 3S24A 2UU9Q 3S14H 2ZJQA 1XTDA 1XJVA 2Z6KC 1P8LA 3JAMi 2OTJA 1N34Q 3LGJA 4TQUS 3PUVA 5IE8A 3CD6A 3S17H 3CP0A 2VUMG 3OTOL 1HNXL 2E8GA 2K4KA 3IRBA 2YTVA 5LMNQ 3NELA 2E2HH 4JBKA 3HOYG 3CCEA 2AWOA 2AWNA 2ID0A 2ZM6Q 4OWWB 2NVQH 1B8AA 2MNAA 3HOXG 3CAMA 1PH8A 3FHWA 1VQMA 1XMQQ 4K0KQ 4H02A 4LF5L 2D0PA 2PI2E 1CUKA 5GAEC 4A3JG 4JI3L 3F2CA 4AQYL 4UY8C 2A8VA 3S1QH 4QJFA 1UWVA 3HKZG 3STBD 4BA1I 5C3EH 1VQEA 3U4ZA 1E3PA 1YNXA 5C0XI 4DV5L 4A3CH 2K5VA 5GROA 1QZGA 1D8LA 4DV6Q 4JI2Q 5JEAG 2KHJA 2IT1A 4RG1A 5IP9H 1VQ8A 5M3MG 1GM5A 4IOCA 2EIFA 1FGUA 1W2BA 3HOWH 3RZDH 2ZJPA 1M1KC 1QUQA 5IP9G 4DV2Q 1IBLQ 2ATWA 4LF9Q 1VS0A 5BR8L 1R9TH 2KHIA 5GAHC 3CCVA 4B3SQ 4OX9L 1VQLA 3TS0A 2WB1E 4A3DH 3K7AH 1V1QA 4NPSA 4JI5Q 3CC7A 1PVOA 1CKMA 4RMFA 1IXRA 3KOJA 1Y1WG 4EX5A 2WFWA 3BZKA 1KRSA 1IBKL 2ZM6L 1HZCA 1YITA 2PQAA 4YWLA 5IYCG 4LF4Q 3KFUA 4GNXC 1TWGH 5IP7H 4DV4L 1X3EA 1YJ9A 2E5LQ 4B3ML 4AIMA 2C35B 4O2DA 4R4IA 2PQAB 1E22A 3EIVA 1TWCH 1LM0A 3RR5A 3HFZB 1TWHH 4DV7Q 5C0XJ 2B63H 4YWMA 4YHHL 4DV5Q 2L15A 4XTCS 1HJPA 1HZBA 5M3FH 1PH6A 1JMCA 3A5ZB 4BA2I 1L2FA 3PUXA 4HJAA 1XPOA 5J3BA 1L1OC 4DR3L 1PH7A 1NJIC 1VCIA 2YTYA 1WOCA 4X64L 1EQQA 1N33L 2HT1A 4OWXB 3F2DA 3S1RH 2JA6G 3H3VH 2NVXH 4KHZA 2WAQG 4JBMA 5IT9c 1OTCA 2BH8A 4GNXB 4APVA 2Q2IA 2JA8H 4JI6Q 3I56A 3S2HH 1EIFA 1XNRL 1XMQL 3TRZA 4B3RQ 4DKAC 2MQHA 4OXPA 4P75A 4DK6C 5GAGC 4X62Q 5LMNL 4KHPQ 2UUAL 5JJIA 2NZOA 3E9IA 2LXJA 3JAMc 1FJGL 1KHIA 3UDFA 1K9MC 2EQSA 1HR0L 4HJ7A 2K5NA 3BJUA 3RLOA 1PA6A 4PZ8A 1MJEA 2E2JH 3GTQH 1T9HA 3CPFA 3M4PA 2VQEL 2ZTDA 1ASYA 1KC8C 4C2MH 4JI4Q 3M4QA 3HOZG 3L7ZC 3CPWA 1JJCB 3I4NH 2IX0A 3BU2A 4LUVA 4Y52H 2N3SA 3ZJYC 1BBWA 3DM3A 2BA1A 3OTOQ 3RLFA 4DR3Q 1X55A 2NZHA 2GVAA 4O0AA 4GLAC 2HHHL 4L5SA 5IP7G 2R92H 2B63G 1M90C 1SLJA 3CCJA 1VQAA 1D7QA 4QL5A 2I0QA 2R92G 3KF6A 2JEBI 4LFCL 1N9WA 1EYGA 2IHFA 3TEHB 3TQYA 3G4SA 2R7DA 3JC66 3BZCA 3HKZE 3J80i 1KXLA 4DV2L 1OXVA 2AMCB 3ER0A 5C3EG 3H15A 1NE3A 3HOVG 3CCLA 4DV3Q 2N49A 3U58A 1J5EQ 4DR2L 1HNZL 4A3GG 3AFPA 4DR7Q 4DV4Q 3FKIG 1L1OB 2CQOA 4YY3L 4JYAQ 1XNQL 3K7UC 4L5TA 4DR5L 4ALPA 1PV4A 4JV5L 2I5HA 4DR4Q 2VNUD 4YCWA 4JBJA 1AE2A 2ES2A 5EAYA 3U50C 3ULLA 1EUJA 4XIGS 3PIOA 1HZAA 1PYSB 2RHQB 1O7IA 5AJ3Q 3J80c 2F52A 5M3FG 5M5YH 2V1CC 4DV1L 4A3MH 2GVBA 3CC4A 3NBHB 4OONA 4DR1Q 4A3EG 4LF8Q 1HNXQ 3PO2H 2KCTA 2N78A 4IJLA 4A93G 1Y1WH 1VQBA 1VQPA 1E24A 4A3EH 2IY5B 5ELOA 3GTPH 4X65L 4JI7L 1A8VA 3KDFB 1BVSA 4QQBX 5C4XH 2JEAI 1JJGA 2CWPA 2D62A 1IYJB 4IFDG 3PSIA 4DV0L 2YYZA 1QVCA 4K0KL 3F1ZA 3E9HA 3S1NH 3H3VI 1N36L 4IPHA 3M85A 4JOIC 1X54A 2K52A 1L0WA 1K8AC 2MO0A 3I4NG 4BXXH 2VZAA 1H95A 3RNUA 3K0XA 1MJCA 1C7YA 1K3RA 4IFDJ 1YBYA 5IWAL 4DV7L 3ULPA 3KF6B 2EXDA 3CCUA 4HIOA 4TVAB 2UXDQ 2JA6H 1GD7A 1X56A 2Y0SE 4GN3B 3HOVH 4LWCA 1NMGA 4GKJL 1VQFA 2CCZA 1N32Q 1YEZA 3AYHB 4A3GH 3KF8B 1S40A 3FP9A 1E7ZA 2XGTA 4LFAQ 4AYBE 5HGQA 4A3FG 4UP9A 2OWOA 1UE5A 2Y0SG 1SN8A 1A62A 4IPDA 2LSSA 4L5RC 2RCNA 4NXNQ 3WWVA 3NEMA 1J6QA 4X6AH 3PO3H 1BBUA 4PZ7A 1KAWA 4A3JH 4A93H 1J5EL 4DAMA 2JA9A 2K14A 1UEBA 4B3MQ 2CFMA 1A63A 5ELNA 4JC0A 1C9OA 4KLKA 3EBEA 3RN2A 2R7ZG 1Q86C 4DV3L 3S1MH 1FVIA 3GTLH 4LUOA 1W3SA 1Y14B 1RIPA 5LMUQ 1XPUA 2AKWB 2HIXA 4LFBQ 4DR7L 3I7FA 1I6HH 3D31A 2QGQA 3PCOB 4GOPB 4A3CG 2ZTCA 4BY1H 1XMOL 1Q1EA 1Y1VG 4BY7G 2KENA 2Q2HA 4GN5A 1VQ7A 2UUBL 3PGZA 4GKKQ 5DLQE 2BH2A 4BY1G 3TS2A 2PI2A 1Q7YC 4A3DG 2JQOA 5M5XH 4BXXG 1TWAH 1IBLL 3F8TA 3J81c 2FXQA 4LW1A 3GTKH 1WCMH 1I50H 4LNQA 1VQ9A 2UXCL 1CKOA 1NBWA 3S2DH 2OTLA 1KRTA 4JI8Q 3ERSX 1V9PA 5IWAQ 4A3KH 4DR2Q 1HNZQ 2VY3A 4R1JA 4BBSG 3CW2C 3SGIA 3I4OA 1VQ6A 1SMXA 2ALYB 3GO5A 3G6EA 1B70B 5IY0A 5C44H 4B3TL 4P71A 4GKJQ 2DUDA 4HJ8A 5IYDG 2VQFL 1X65A 4GLVB 4A3BH 2NVYH 4YCVA 4LFBL 1CSQA 1EQRA 5BR8Q 3OW2A 4R4CA 3STBC 1JJ2A 1U5KA 4WJ4A 2JA8G 3G71A 4JOIA 4IPCA 1N34L 4MNOA 1WJJA 3TREA 3GTMH 2B29A 4IPGA 3E0EA 3CXCA 2F4VQ 1K83H 3DLLA 1PH1A 2K75A 4OO1I 3KLWA 1GKHA 3CCQA 3FKIH 4NXMQ 4B3RL 2UXCQ 2R6GA 2WP8J 2UUCQ 1NMFA 2NN6I 5GADC 1UE7A 4A4IA 1L1OA 1VQGA 3UE1A 4LF4L 4IOAA 3UE0A 3M9BA 4A76A 3T1HL 3L2PA 2E5LL 1Q8KA 4AQYQ 4JI3Q 3GTOH 3U4VA 1XMOQ 4UPAA 4X66Q 4YWKA 1WCMG 1HH2P 2Z0SA 1VQCA 3G48A 4L5QA 4GOPC 1TXYA 1GO3E 1Z9FA 4J15A 1WI5A 1E1OA 4LF9L 3M4OH 2VUMH 5C0XG 4LFAL 3KJOA 2R93G 2XTIA 4YCUA 1NY4A 1U0LA 3NENA 2QEXA 4KI0A 1I5FA 1SROA 2CKZB 4JI7Q 4JI0Q 4GKKL 1VQKA 4MTNA 1K8GA 3K80C 1X9NA 3HOXH 4JI1Q 3EN2A 3Q8DA 5FJ8H 3CCMA 2ZJRA 1Q81C 1HR0Q 4BBRH 5FLMH 3HOYH 3J7A5 1K73C 1I3QH 4LF5Q 4LFCQ 1CKNB 3H0GG 2VW9A 1XNRQ 1N8RC 4GOPA 2YU9H 4AYBG 3RZOH 4BBRG 5FLMG 2UUAQ 3CCSA 1OXUA 2HIVA 3H0GH 4JI8L 4GLXA 1YIJA 1IL2A 4B3TQ 3GTGH 1MIUA 2OQ0A 4LF6Q 2VQFQ 3J81i 3CQZH 1AH9A 3CCRA 1I94Q 4DV6L 1SR3A 1PH2A 2HQLA 4YY3Q 1PHJA 3ICEA 1YZ6A 2WB1G 4OWTB 5E7NA 4DUZQ 1VQIA 4HIKA 2GN5A 1PH3A 4POGA 4X66L 1YJNA 2K5HA 3I4MG 2Q2UA 4UP7A 2E2IH 1E1TA 3M7NA 3AEVA 4EQ5A 4C3JH 4JCVE 1SE8A 3KYHC 3UDXA 4KHPL 4AH6A 4NXNL 2HHHQ 4NXML 1UE1A 1QVGA 2LXKA 1Q46A 2KBNA 4R4OA 2R93H 4BBSH 2JA5G 4R4QA 5K36G 1X3GA 2AHOB 3ULJA 3T1YL 4DPGA 1P16A 1X6OA 3K81C 4PMWA 2N8NA 1N36Q 2D0OA 4DR5Q 4DR6Q 1V43A 2DGYA 3A5UA 3GDEA 4A3IH 3A74A 1EFWA 1FJGQ 5JJLA 1S3OA 4PG3A 1HZ9A 1PYBA 4DK3C 1G51A 3OYYA 1LUZA 4P72A 3CF5A 3KDFA 1NTGA 1DGSA 4LF7Q 2UXBL 3J81j 1QZHA 2A19A 1VQ5A 1UE6A 1OXTA 4P73A 1PH4A 1XPRA 4DNIA 1YI2A 3W1GA 3HOZH 1Q12A 4POFA 1KQSA 4IFDI 4IO9A 3UDIA 3M3YH 4PZ6A 2JJQA 4JI6L 1Z47A 3PUZA 4A75A 4P74A 4UP8A 4DV0Q 1SFOH 1IBML 4B3SL 1QUQB 4OX9Q 2Z6KA 1QVFA 2H5XA 3S15H 4A3FH 1VQOA 1YJWA 5GQOA 2JK8A 3HOWG 4X65Q 4ME3A 1FL0A 2JE6I 3AFQA 2UUCL 5IYBH 3MEFA 4A3LH 2MO1A 1G6PA 5C44G 5JJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GS3 A;  1JB7 A;  3PF4 A;  2K50 A;  2BA0 A;  4QGU A;  3T1H Q;  4OO1 G;  4A3M G;  1VQJ A;  3PUW A;  3HOU H;  4JYA L;  1YHQ A;  3I4M H;  1G29 1;  1Q82 C;  2IHE A;  1EIY B;  4FDB A;  2YV5 A;  2ZTE A;  3GTJ H;  4HJ5 A;  3PF5 A;  3CME A;  5IYC H;  5FLX c;  2NN6 G;  1BKB A;  4HIM A;  3AQQ A;  5AJ3 L;  4DV1 Q;  3HKS A;  2B3G A;  1GVP A;  1Y1V H;  2ASB A;  4BY7 H;  4LF8 L;  2VL6 A;  2OQK A;  3I55 A;  4HJ9 A;  4QIW E;  1CKN A;  3B6Y A;  3PUY A;  4DUY Q;  4R4T A;  3VDY A;  1HNW L;  1A0I A;  3CMA A;  1LYL A;  1N32 L;  1EOV A;  4X64 Q;  2I5M X;  1YHB A;  5LMN W;  3J7Z C;  1N33 Q;  4JI1 L;  2F4V L;  1OXX K;  1OXS C;  4A3I G;  3S16 H;  1HR0 W;  2PMZ E;  3UDG A;  1MKH A;  4C3H H;  1EWI A;  1YVC A;  1S72 A;  3A0J A;  2I5L X;  2OCE A;  1WYD A;  4A3K G;  2CWA A;  1RL2 A;  1VQN A;  1TWF H;  1VQD A;  2WAQ E;  3GD7 A;  2R7F A;  4QY7 A;  3KJP A;  5M5W H;  2RF4 A;  4LF6 L;  1B7Y B;  2A1A A;  2UXB Q;  2YTX A;  4GN4 B;  5HY6 A;  5LMU L;  3RN5 A;  2IX1 A;  1XNQ Q;  1I94 L;  4JV5 Q;  3RLN A;  5JEA J;  2UU9 L;  2VQE Q;  1Q1B A;  5IYB G;  4DR4 L;  2PNH A;  3L0O A;  4WJ3 M;  4DAY B;  1KL9 A;  4IJH A;  4GNX A;  2UUB Q;  4JI4 L;  1YHA A;  1VQ4 A;  3I2Z A;  4LF7 L;  3PO2 G;  1X3F A;  3CC2 A;  1AE3 A;  4Y7N H;  4YHH Q;  3HOU G;  4DR1 L;  4A3L G;  2UXD L;  5FJ8 G;  4JG2 A;  5IYD H;  2R7Z H;  1PH5 A;  2MFI A;  3W5O A;  1VQH A;  3PO3 G;  4JI2 L;  1IZ6 A;  3W1B A;  4JI0 L;  4A3B G;  4JI5 L;  4NB3 A;  3F2B A;  4DUY L;  3K8A A;  1HNW Q;  5C4X G;  3PV0 A;  2QA4 A;  2NVT H;  1JT8 A;  1ASZ A;  2JA5 H;  1LTL A;  4LUZ A;  1IBK Q;  5H1S E;  2JA7 H;  1IBM Q;  1C0A A;  5M3M H;  1KIX A;  1PH9 A;  3T1Y Q;  1CSP A;  2F3I A;  2RHS B;  2VS1 A;  2JA7 G;  4X62 L;  1WFQ A;  3PIP A;  4DR6 L;  5C4J H;  4JBW A;  4MZ9 A;  4C3I H;  1KD1 C;  2Q2T A;  3D0F A;  1K0R A;  4HID A;  1JE5 A;  2KCM A;  1SRU A;  1PFS A;  3MXN B;  4DUZ L;  3S24 A;  2UU9 Q;  3S14 H;  2ZJQ A;  1XTD A;  1XJV A;  2Z6K C;  1P8L A;  3JAM i;  2OTJ A;  1N34 Q;  3LGJ A;  4TQU S;  3PUV A;  5IE8 A;  3CD6 A;  3S17 H;  3CP0 A;  2VUM G;  3OTO L;  1HNX L;  2E8G A;  2K4K A;  3IRB A;  2YTV A;  5LMN Q;  3NEL A;  2E2H H;  4JBK A;  3HOY G;  3CCE A;  2AWO A;  2AWN A;  2ID0 A;  2ZM6 Q;  4OWW B;  2NVQ H;  1B8A A;  2MNA A;  3HOX G;  3CAM A;  1PH8 A;  3FHW A;  1VQM A;  1XMQ Q;  4K0K Q;  4H02 A;  4LF5 L;  2D0P A;  2PI2 E;  1CUK A;  5GAE C;  4A3J G;  4JI3 L;  3F2C A;  4AQY L;  4UY8 C;  2A8V A;  3S1Q H;  4QJF A;  1UWV A;  3HKZ G;  3STB D;  4BA1 I;  5C3E H;  1VQE A;  3U4Z A;  1E3P A;  1YNX A;  5C0X I;  4DV5 L;  4A3C H;  2K5V A;  5GRO A;  1QZG A;  1D8L A;  4DV6 Q;  4JI2 Q;  5JEA G;  2KHJ A;  2IT1 A;  4RG1 A;  5IP9 H;  1VQ8 A;  5M3M G;  1GM5 A;  4IOC A;  2EIF A;  1FGU A;  1W2B A;  3HOW H;  3RZD H;  2ZJP A;  1M1K C;  1QUQ A;  5IP9 G;  4DV2 Q;  1IBL Q;  2ATW A;  4LF9 Q;  1VS0 A;  5BR8 L;  1R9T H;  2KHI A;  5GAH C;  3CCV A;  4B3S Q;  4OX9 L;  1VQL A;  3TS0 A;  2WB1 E;  4A3D H;  3K7A H;  1V1Q A;  4NPS A;  4JI5 Q;  3CC7 A;  1PVO A;  1CKM A;  4RMF A;  1IXR A;  3KOJ A;  1Y1W G;  4EX5 A;  2WFW A;  3BZK A;  1KRS A;  1IBK L;  2ZM6 L;  1HZC A;  1YIT A;  2PQA A;  4YWL A;  5IYC G;  4LF4 Q;  3KFU A;  4GNX C;  1TWG H;  5IP7 H;  4DV4 L;  1X3E A;  1YJ9 A;  2E5L Q;  4B3M L;  4AIM A;  2C35 B;  4O2D A;  4R4I A;  2PQA B;  1E22 A;  3EIV A;  1TWC H;  1LM0 A;  3RR5 A;  3HFZ B;  1TWH H;  4DV7 Q;  5C0X J;  2B63 H;  4YWM A;  4YHH L;  4DV5 Q;  2L15 A;  4XTC S;  1HJP A;  1HZB A;  5M3F H;  1PH6 A;  1JMC A;  3A5Z B;  4BA2 I;  1L2F A;  3PUX A;  4HJA A;  1XPO A;  5J3B A;  1L1O C;  4DR3 L;  1PH7 A;  1NJI C;  1VCI A;  2YTY A;  1WOC A;  4X64 L;  1EQQ A;  1N33 L;  2HT1 A;  4OWX B;  3F2D A;  3S1R H;  2JA6 G;  3H3V H;  2NVX H;  4KHZ A;  2WAQ G;  4JBM A;  5IT9 c;  1OTC A;  2BH8 A;  4GNX B;  4APV A;  2Q2I A;  2JA8 H;  4JI6 Q;  3I56 A;  3S2H H;  1EIF A;  1XNR L;  1XMQ L;  3TRZ A;  4B3R Q;  4DKA C;  2MQH A;  4OXP A;  4P75 A;  4DK6 C;  5GAG C;  4X62 Q;  5LMN L;  4KHP Q;  2UUA L;  5JJI A;  2NZO A;  3E9I A;  2LXJ A;  3JAM c;  1FJG L;  1KHI A;  3UDF A;  1K9M C;  2EQS A;  1HR0 L;  4HJ7 A;  2K5N A;  3BJU A;  3RLO A;  1PA6 A;  4PZ8 A;  1MJE A;  2E2J H;  3GTQ H;  1T9H A;  3CPF A;  3M4P A;  2VQE L;  2ZTD A;  1ASY A;  1KC8 C;  4C2M H;  4JI4 Q;  3M4Q A;  3HOZ G;  3L7Z C;  3CPW A;  1JJC B;  3I4N H;  2IX0 A;  3BU2 A;  4LUV A;  4Y52 H;  2N3S A;  3ZJY C;  1BBW A;  3DM3 A;  2BA1 A;  3OTO Q;  3RLF A;  4DR3 Q;  1X55 A;  2NZH A;  2GVA A;  4O0A A;  4GLA C;  2HHH L;  4L5S A;  5IP7 G;  2R92 H;  2B63 G;  1M90 C;  1SLJ A;  3CCJ A;  1VQA A;  1D7Q A;  4QL5 A;  2I0Q A;  2R92 G;  3KF6 A;  2JEB I;  4LFC L;  1N9W A;  1EYG A;  2IHF A;  3TEH B;  3TQY A;  3G4S A;  2R7D A;  3JC6 6;  3BZC A;  3HKZ E;  3J80 i;  1KXL A;  4DV2 L;  1OXV A;  2AMC B;  3ER0 A;  5C3E G;  3H15 A;  1NE3 A;  3HOV G;  3CCL A;  4DV3 Q;  2N49 A;  3U58 A;  1J5E Q;  4DR2 L;  1HNZ L;  4A3G G;  3AFP A;  4DR7 Q;  4DV4 Q;  3FKI G;  1L1O B;  2CQO A;  4YY3 L;  4JYA Q;  1XNQ L;  3K7U C;  4L5T A;  4DR5 L;  4ALP A;  1PV4 A;  4JV5 L;  2I5H A;  4DR4 Q;  2VNU D;  4YCW A;  4JBJ A;  1AE2 A;  2ES2 A;  5EAY A;  3U50 C;  3ULL A;  1EUJ A;  4XIG S;  3PIO A;  1HZA A;  1PYS B;  2RHQ B;  1O7I A;  5AJ3 Q;  3J80 c;  2F52 A;  5M3F G;  5M5Y H;  2V1C C;  4DV1 L;  4A3M H;  2GVB A;  3CC4 A;  3NBH B;  4OON A;  4DR1 Q;  4A3E G;  4LF8 Q;  1HNX Q;  3PO2 H;  2KCT A;  2N78 A;  4IJL A;  4A93 G;  1Y1W H;  1VQB A;  1VQP A;  1E24 A;  4A3E H;  2IY5 B;  5ELO A;  3GTP H;  4X65 L;  4JI7 L;  1A8V A;  3KDF B;  1BVS A;  4QQB X;  5C4X H;  2JEA I;  1JJG A;  2CWP A;  2D62 A;  1IYJ B;  4IFD G;  3PSI A;  4DV0 L;  2YYZ A;  1QVC A;  4K0K L;  3F1Z A;  3E9H A;  3S1N H;  3H3V I;  1N36 L;  4IPH A;  3M85 A;  4JOI C;  1X54 A;  2K52 A;  1L0W A;  1K8A C;  2MO0 A;  3I4N G;  4BXX H;  2VZA A;  1H95 A;  3RNU A;  3K0X A;  1MJC A;  1C7Y A;  1K3R A;  4IFD J;  1YBY A;  5IWA L;  4DV7 L;  3ULP A;  3KF6 B;  2EXD A;  3CCU A;  4HIO A;  4TVA B;  2UXD Q;  2JA6 H;  1GD7 A;  1X56 A;  2Y0S E;  4GN3 B;  3HOV H;  4LWC A;  1NMG A;  4GKJ L;  1VQF A;  2CCZ A;  1N32 Q;  1YEZ A;  3AYH B;  4A3G H;  3KF8 B;  1S40 A;  3FP9 A;  1E7Z A;  2XGT A;  4LFA Q;  4AYB E;  5HGQ A;  4A3F G;  4UP9 A;  2OWO A;  1UE5 A;  2Y0S G;  1SN8 A;  1A62 A;  4IPD A;  2LSS A;  4L5R C;  2RCN A;  4NXN Q;  3WWV A;  3NEM A;  1J6Q A;  4X6A H;  3PO3 H;  1BBU A;  4PZ7 A;  1KAW A;  4A3J H;  4A93 H;  1J5E L;  4DAM A;  2JA9 A;  2K14 A;  1UEB A;  4B3M Q;  2CFM A;  1A63 A;  5ELN A;  4JC0 A;  1C9O A;  4KLK A;  3EBE A;  3RN2 A;  2R7Z G;  1Q86 C;  4DV3 L;  3S1M H;  1FVI A;  3GTL H;  4LUO A;  1W3S A;  1Y14 B;  1RIP A;  5LMU Q;  1XPU A;  2AKW B;  2HIX A;  4LFB Q;  4DR7 L;  3I7F A;  1I6H H;  3D31 A;  2QGQ A;  3PCO B;  4GOP B;  4A3C G;  2ZTC A;  4BY1 H;  1XMO L;  1Q1E A;  1Y1V G;  4BY7 G;  2KEN A;  2Q2H A;  4GN5 A;  1VQ7 A;  2UUB L;  3PGZ A;  4GKK Q;  5DLQ E;  2BH2 A;  4BY1 G;  3TS2 A;  2PI2 A;  1Q7Y C;  4A3D G;  2JQO A;  5M5X H;  4BXX G;  1TWA H;  1IBL L;  3F8T A;  3J81 c;  2FXQ A;  4LW1 A;  3GTK H;  1WCM H;  1I50 H;  4LNQ A;  1VQ9 A;  2UXC L;  1CKO A;  1NBW A;  3S2D H;  2OTL A;  1KRT A;  4JI8 Q;  3ERS X;  1V9P A;  5IWA Q;  4A3K H;  4DR2 Q;  1HNZ Q;  2VY3 A;  4R1J A;  4BBS G;  3CW2 C;  3SGI A;  3I4O A;  1VQ6 A;  1SMX A;  2ALY B;  3GO5 A;  3G6E A;  1B70 B;  5IY0 A;  5C44 H;  4B3T L;  4P71 A;  4GKJ Q;  2DUD A;  4HJ8 A;  5IYD G;  2VQF L;  1X65 A;  4GLV B;  4A3B H;  2NVY H;  4YCV A;  4LFB L;  1CSQ A;  1EQR A;  5BR8 Q;  3OW2 A;  4R4C A;  3STB C;  1JJ2 A;  1U5K A;  4WJ4 A;  2JA8 G;  3G71 A;  4JOI A;  4IPC A;  1N34 L;  4MNO A;  1WJJ A;  3TRE A;  3GTM H;  2B29 A;  4IPG A;  3E0E A;  3CXC A;  2F4V Q;  1K83 H;  3DLL A;  1PH1 A;  2K75 A;  4OO1 I;  3KLW A;  1GKH A;  3CCQ A;  3FKI H;  4NXM Q;  4B3R L;  2UXC Q;  2R6G A;  2WP8 J;  2UUC Q;  1NMF A;  2NN6 I;  5GAD C;  1UE7 A;  4A4I A;  1L1O A;  1VQG A;  3UE1 A;  4LF4 L;  4IOA A;  3UE0 A;  3M9B A;  4A76 A;  3T1H L;  3L2P A;  2E5L L;  1Q8K A;  4AQY Q;  4JI3 Q;  3GTO H;  3U4V A;  1XMO Q;  4UPA A;  4X66 Q;  4YWK A;  1WCM G;  1HH2 P;  2Z0S A;  1VQC A;  3G48 A;  4L5Q A;  4GOP C;  1TXY A;  1GO3 E;  1Z9F A;  4J15 A;  1WI5 A;  1E1O A;  4LF9 L;  3M4O H;  2VUM H;  5C0X G;  4LFA L;  3KJO A;  2R93 G;  2XTI A;  4YCU A;  1NY4 A;  1U0L A;  3NEN A;  2QEX A;  4KI0 A;  1I5F A;  1SRO A;  2CKZ B;  4JI7 Q;  4JI0 Q;  4GKK L;  1VQK A;  4MTN A;  1K8G A;  3K80 C;  1X9N A;  3HOX H;  4JI1 Q;  3EN2 A;  3Q8D A;  5FJ8 H;  3CCM A;  2ZJR A;  1Q81 C;  1HR0 Q;  4BBR H;  5FLM H;  3HOY H;  3J7A 5;  1K73 C;  1I3Q H;  4LF5 Q;  4LFC Q;  1CKN B;  3H0G G;  2VW9 A;  1XNR Q;  1N8R C;  4GOP A;  2YU9 H;  4AYB G;  3RZO H;  4BBR G;  5FLM G;  2UUA Q;  3CCS A;  1OXU A;  2HIV A;  3H0G H;  4JI8 L;  4GLX A;  1YIJ A;  1IL2 A;  4B3T Q;  3GTG H;  1MIU A;  2OQ0 A;  4LF6 Q;  2VQF Q;  3J81 i;  3CQZ H;  1AH9 A;  3CCR A;  1I94 Q;  4DV6 L;  1SR3 A;  1PH2 A;  2HQL A;  4YY3 Q;  1PHJ A;  3ICE A;  1YZ6 A;  2WB1 G;  4OWT B;  5E7N A;  4DUZ Q;  1VQI A;  4HIK A;  2GN5 A;  1PH3 A;  4POG A;  4X66 L;  1YJN A;  2K5H A;  3I4M G;  2Q2U A;  4UP7 A;  2E2I H;  1E1T A;  3M7N A;  3AEV A;  4EQ5 A;  4C3J H;  4JCV E;  1SE8 A;  3KYH C;  3UDX A;  4KHP L;  4AH6 A;  4NXN L;  2HHH Q;  4NXM L;  1UE1 A;  1QVG A;  2LXK A;  1Q46 A;  2KBN A;  4R4O A;  2R93 H;  4BBS H;  2JA5 G;  4R4Q A;  5K36 G;  1X3G A;  2AHO B;  3ULJ A;  3T1Y L;  4DPG A;  1P16 A;  1X6O A;  3K81 C;  4PMW A;  2N8N A;  1N36 Q;  2D0O A;  4DR5 Q;  4DR6 Q;  1V43 A;  2DGY A;  3A5U A;  3GDE A;  4A3I H;  3A74 A;  1EFW A;  1FJG Q;  5JJL A;  1S3O A;  4PG3 A;  1HZ9 A;  1PYB A;  4DK3 C;  1G51 A;  3OYY A;  1LUZ A;  4P72 A;  3CF5 A;  3KDF A;  1NTG A;  1DGS A;  4LF7 Q;  2UXB L;  3J81 j;  1QZH A;  2A19 A;  1VQ5 A;  1UE6 A;  1OXT A;  4P73 A;  1PH4 A;  1XPR A;  4DNI A;  1YI2 A;  3W1G A;  3HOZ H;  1Q12 A;  4POF A;  1KQS A;  4IFD I;  4IO9 A;  3UDI A;  3M3Y H;  4PZ6 A;  2JJQ A;  4JI6 L;  1Z47 A;  3PUZ A;  4A75 A;  4P74 A;  4UP8 A;  4DV0 Q;  1SFO H;  1IBM L;  4B3S L;  1QUQ B;  4OX9 Q;  2Z6K A;  1QVF A;  2H5X A;  3S15 H;  4A3F H;  1VQO A;  1YJW A;  5GQO A;  2JK8 A;  3HOW G;  4X65 Q;  4ME3 A;  1FL0 A;  2JE6 I;  3AFQ A;  2UUC L;  5IYB H;  3MEF A;  4A3L H;  2MO1 A;  1G6P A;  5C44 G;  5JJK A; 
#chains in the Genus database with same CATH topology
 2Z4I A;  2BA0 A;  2F0U A;  5JOB A;  3TP5 A;  3T1H Q;  1X3Q A;  2EY6 A;  1ENA A;  3HKZ B;  1EIY B;  4FO2 A;  2K32 A;  3GTJ H;  4HJ5 A;  5IYC H;  4HIM A;  5I6Y A;  1LTR D;  4DV1 Q;  1O78 A;  3J81 E;  3HKS A;  2ASB A;  1Y1V H;  5J1Z A;  1SNC A;  2VL6 A;  1DOK A;  2OQK A;  4HJ9 A;  3B6Y A;  2E2H B;  1WVL A;  1STB A;  4RA8 A;  3J80 E;  1N32 L;  4IUU A;  2I5M X;  1YHB A;  1SNP A;  2F4V L;  3R2I A;  1OXX K;  4A3I G;  1G6Z A;  3S16 H;  1HR0 W;  2SNS A;  3UDG A;  1MKH A;  1RKN A;  1YVC A;  3OW7 A;  1PZI D;  4HN7 A;  2R7F A;  4QY7 A;  3KJP A;  4LF6 L;  4DU9 A;  2CW0 D;  4GN4 B;  3I4N B;  3DWQ A;  2A69 D;  4JV5 Q;  2FMC A;  1MI2 A;  2L11 A;  1ILQ A;  4A3J B;  1TWG B;  3L0O A;  4WJ3 M;  1KL9 A;  3M4O B;  1HRJ A;  3E5S A;  4Y7N H;  4YHH Q;  4IZ8 A;  4DR1 L;  3NPP A;  5FJ8 G;  2MFI A;  1IZ6 A;  5IGF A;  1D5X C;  4JI0 L;  1HNW Q;  3K8A A;  2QA4 A;  2NVT H;  4OO1 H;  1ASZ A;  1TS2 A;  3J81 L;  4LUZ A;  1SAP A;  5H1S E;  3C1E A;  1KNA A;  1PH9 A;  1CSP A;  2A6H D;  2RHS B;  2Z8L A;  4RAU C;  4X62 L;  1WFQ A;  4DR6 L;  4JBW A;  4IUR A;  1A3U A;  1KD1 C;  3HRZ C;  1FR3 A;  1NAP A;  1KAB A;  4G57 A;  1PXU A;  4DUZ L;  3S24 A;  2UU9 Q;  5C5M A;  3S14 H;  1Y8P B;  2IPK D;  5M5Y B;  1P8L A;  3JAM i;  2OTJ A;  1N34 Q;  3LGJ A;  3NTH A;  4TQU S;  2B2U A;  2KQ3 A;  3CD6 A;  3OTO L;  1HNX L;  5IOC A;  1SYC A;  4A3B B;  5LMN Q;  4WJW A;  3NEL A;  1O7L A;  1C4Q A;  2B2T A;  4L6T B;  4MIU A;  2ID0 A;  4QB4 A;  1B8A A;  2MGS A;  2MNA A;  3HOX G;  3CAM A;  2NB0 A;  2PI2 E;  1G8Z D;  3KK7 A;  4QJF A;  1B9N A;  3MHB A;  1VQE A;  1E3P A;  2K28 A;  1TY2 A;  4DV6 Q;  4RG1 A;  1E0B A;  1BCP D;  1VQ8 A;  5M3M G;  3R3O A;  3HOW H;  3GP7 A;  3W3A A;  1MGS A;  2NWG A;  3OMC A;  4LF9 Q;  2ATW A;  1PFB A;  2KHI A;  2PQE A;  3CCV A;  5CGK A;  2MJ8 A;  5I2X A;  1UNS A;  4JI5 Q;  3CC7 A;  4FNF A;  1CKM A;  3KOJ A;  4EX5 A;  3BZK A;  1IBK L;  2PQA A;  4YWL A;  4KJO A;  5IP7 H;  2QKI C;  1YJ9 A;  2E5L Q;  5EPK A;  1ESR A;  1PLF A;  1FD7 D;  1I4H A;  2A6E C;  1VMP A;  2X69 A;  3I3C A;  3QG1 A;  1TWC H;  3RR5 A;  1FYC A;  4H7B A;  5EGT A;  1EQV A;  2KOL A;  4YWM A;  1HJP A;  1B3Q A;  1HZB A;  4N9P A;  1PH6 A;  1WTP A;  4BA2 I;  1L2F A;  3MTS A;  1PH7 A;  1QNU A;  3DMU A;  1WOC A;  5C3W A;  2HT1 A;  3F2D A;  3S1R H;  1CHP D;  2B2V A;  3VR6 A;  3A7A B;  2JA8 H;  4CDE C;  4A93 B;  5LL6 X;  3MXP A;  3TRZ A;  4A3E B;  5GAG C;  1ENF A;  4X62 Q;  2B2W C;  1CQF A;  1PTO C;  2NZO A;  2K1B A;  2LXJ A;  1K9M C;  1HR0 L;  2B8F A;  3BJU A;  1PA6 A;  3Q22 A;  3CPF A;  4A3K B;  1QJO A;  3FKI B;  2F4I A;  4H13 C;  4JI4 Q;  4FF1 A;  2KVM A;  1IW7 C;  1JJC B;  3BU2 A;  3NQI A;  5CMD A;  2N3S A;  2NZH A;  3VYT A;  2HHH L;  4GLA C;  4L5S A;  4KKS A;  3BVZ A;  1M90 C;  3CCJ A;  1VQA A;  2OT2 A;  2R92 G;  2JEB I;  1WTR A;  4H44 C;  2IHF A;  4C3I B;  2WB1 B;  2F3V A;  3D4D A;  3JC6 6;  1C48 A;  4OGQ C;  3ER0 A;  1H9K A;  4I7Z C;  4ZK9 B;  3MXU A;  5EBD A;  2Z6B A;  4DV4 Q;  1B44 D;  4JYA Q;  4ILW A;  4JV5 L;  1EU4 A;  4OIK A;  2F0Q A;  2G9H D;  2VNU D;  2RVL A;  1AN8 A;  1SEB D;  2I46 A;  2RHQ B;  3CC4 A;  2EOT A;  4R9W A;  3NBH B;  4DR1 Q;  4LF8 Q;  3PO2 H;  4IJL A;  4A3E H;  2NN6 H;  2E76 C;  3GTP H;  4JI7 L;  3LWE A;  2R93 B;  1PZJ D;  1ZEQ X;  4KHV A;  3H3V I;  3M85 A;  3BS1 A;  2WIN B;  2K52 A;  2LS0 1;  3ND8 A;  1L0W A;  3R93 A;  3A8I E;  3M7G A;  1C7Y A;  2P5Z X;  4TVA B;  3CRK C;  2Y0S E;  1X56 A;  4GN3 B;  3OOC A;  1F2Y A;  4LWC A;  1NMG A;  3P20 A;  5DNF A;  4GKJ L;  1N32 Q;  1YEZ A;  2B63 B;  3KF8 B;  5COR A;  3QO2 A;  2XGT A;  4A3F G;  1SBB B;  1UE5 A;  4FXG C;  1SN8 A;  2LSS A;  2RCN A;  4EQP A;  4C3J B;  3OIP A;  3NTK A;  5C44 G;  3PO3 H;  4A3J H;  1J5E L;  4DAM A;  1E2V A;  3P1H A;  5ELN A;  4TSS A;  1TWH B;  3K58 A;  2F0E A;  2R7Z G;  1IKM A;  3A54 A;  3VYU A;  3S1M H;  1L0X B;  1DYQ A;  5K36 H;  1LTS D;  1I6H H;  1BBX C;  2ZTC A;  5FLX E;  4BY1 H;  3I72 A;  1Q1E A;  1VF5 C;  2KEN A;  2Q2H A;  2UUB L;  4GKK Q;  1SNO A;  1STN A;  4HCE A;  3J81 c;  2A74 C;  1RTN A;  5M5X B;  4HSP A;  4Z9C B;  1VQ9 A;  2OTL A;  5ELE A;  3ERO A;  3S16 B;  4R1J A;  4XYO A;  1SMX A;  4K8I A;  1B70 B;  2PNR C;  5IY0 A;  5C44 H;  4B3T L;  4P71 A;  5I9P A;  1Y1W B;  5G3L F;  2EJF C;  3LWU A;  3NWT A;  4OL7 A;  4A3B H;  4ZQ3 A;  3OW2 A;  1RD9 D;  1JOQ A;  1U5K A;  2Y0S B;  5CBA E;  1WJJ A;  3ITP A;  4DAV A;  1LLR D;  4ZUJ A;  3S17 B;  2JXM B;  4K6D A;  4KY5 A;  4NMZ A;  3GQB A;  3Q24 A;  3G6J B;  2E2D C;  2OEO A;  4K14 A;  4ID6 A;  1Q8K A;  1CA6 A;  1DD2 A;  2LMC B;  2SEB D;  4X66 Q;  2Z0S A;  3G48 A;  5KNC A;  4ZAI A;  1GO3 E;  1NCV A;  1E1O A;  1EIG A;  4LF9 L;  3VR5 A;  2R93 G;  1ZKO A;  5HUR A;  3PIO 3;  2QEX A;  4KI0 A;  3K80 C;  2IW3 A;  5FO7 B;  4JI1 Q;  3Q8D A;  5FJ8 H;  2ZJR A;  5IT9 E;  1A6X A;  1K73 C;  2Q8R E;  4GOP A;  1LAB A;  2UUA Q;  4JI8 L;  3H0G H;  2EZV A;  4ABN A;  3GTG H;  4XT1 B;  1MIU A;  2RA4 A;  3CQZ H;  4M8A A;  1SJE D;  1PH2 A;  1JOK A;  2WB1 G;  3TDQ A;  1ICW A;  1DOL A;  1W6K A;  2GN5 A;  4PNY A;  4X66 L;  1AZP A;  4NKL A;  3CQZ B;  4UP7 A;  2E2I H;  3KLR A;  3C1F A;  3X3M A;  4NXM L;  4NXN L;  3PO2 B;  1QVG A;  1G2T A;  2AQ2 B;  2R93 H;  1X3G A;  1LV9 A;  2AHO B;  3ULJ A;  1XWE A;  4DPG A;  1X6O A;  3BDL A;  4DR5 Q;  3A5U A;  1B2T A;  4TKO B;  4FXK C;  5E1F A;  1HZ9 A;  3CF5 A;  3OYY A;  1LUZ A;  3J81 j;  3OMG A;  1PFM A;  1PH4 A;  3SXH A;  1B53 A;  3HEJ A;  1EOT A;  1Q12 A;  2B8G A;  4IFD I;  2F0T A;  4IO9 A;  2JJQ A;  1Z47 A;  4WRD A;  1KLG D;  1T5E A;  4LMQ D;  4A3F H;  5GQO A;  3S1R B;  4X65 Q;  1MBY A;  3CU7 A;  3MEF A;  4DXF A;  2F0S A;  5JJK A;  1TT2 A;  1EIH A;  3PF4 A;  3HOU H;  1YHQ A;  2GA4 B;  4FDB A;  3TBI B;  2YV5 A;  3IFD A;  2F3W A;  2LKV A;  1LT6 D;  4OIJ A;  1S4Z A;  2B3G A;  3I55 A;  5E4W C;  2BE5 C;  3PUY A;  3VDY A;  1I6H B;  5EBC A;  5LMN W;  1H9R A;  3HOY B;  3J7Z C;  1SSO A;  4C3H G;  4E6I A;  2PMZ E;  1EWI A;  1S72 A;  3TP8 A;  2SOB A;  2QDB A;  2CWA A;  2FJ2 A;  5EKK A;  1VQN A;  2WAQ E;  2VB2 X;  3EJI A;  2M00 A;  2QDL A;  2RF4 A;  5M5W H;  2A1A A;  1JOR A;  2SDF A;  2YU9 B;  3RLN A;  1Q1B A;  3P7J A;  2PNH A;  3EFX D;  2EYO A;  4JI4 L;  1RJT A;  4IJH A;  3S9W A;  1VQ4 A;  3I2Z A;  5CYU A;  4LF7 L;  1AE3 A;  3I4L A;  3HOU G;  4A3L G;  2JA6 B;  3PO3 G;  3W5O A;  1VQH A;  3A56 A;  4A3B G;  4DAP A;  4JI5 L;  3F2B A;  4A3F B;  3IAY A;  1JT8 A;  2JA5 H;  1LTL A;  5M3M H;  2O5J C;  4HMJ A;  3HOU B;  2QF7 A;  5C4J H;  3QIA A;  5FO8 B;  2DY8 A;  3FDT A;  3D0F A;  4BBR B;  2KCM A;  2EY5 A;  3DM1 A;  3L9A X;  5HGT A;  2RDH A;  1PRT B;  4EGV A;  1XTD A;  2O4X A;  3NXW A;  5FKA C;  5ISR A;  3PUV A;  5IE8 A;  3J7A V;  3ND9 A;  1YNJ D;  1Y8N B;  3CP0 A;  3I8Z A;  3HGB A;  4ZLT F;  2YTV A;  2TSS A;  2E2H H;  3HOY G;  2ZM6 Q;  4OWW B;  1PH8 A;  1XMQ Q;  4H02 A;  1EQT A;  1BUV T;  4UY8 C;  4JI3 L;  4AQY L;  2J0T D;  5G3L D;  1UWV A;  4IFD H;  2PZW A;  5C3E H;  3U4Z A;  5JVG 3;  1YNX A;  4A3C H;  1WTH A;  3NHH A;  5GRO A;  1ET9 A;  2IT1 A;  4HAE A;  1DM0 B;  2X6L A;  1PZK D;  2EYP A;  4KD4 A;  4XDX A;  1FGU A;  4IOC A;  4K2K A;  3RUZ A;  2R92 B;  3N6R A;  1S5B D;  1M1K C;  5IP9 G;  4DV2 Q;  1IBL Q;  1BO0 A;  4B3S Q;  1JWU D;  1VQL A;  5A2Q L;  2H1E A;  2KCN A;  2WB1 E;  4A3D H;  3K7A H;  4M1U B;  1V1Q A;  2ZXO A;  2E2I B;  4RMF A;  3SK6 A;  1UAP A;  2K05 A;  5E4X A;  3MXN A;  5IGC A;  3SK8 A;  4LF4 Q;  1HXY D;  2FMM A;  4CDD C;  4DV4 L;  4B3M L;  3W2D A;  1GUN A;  4O2D A;  4R4I A;  2PQA B;  5M3F B;  1E22 A;  3I70 A;  2B63 H;  5ELF A;  4HJA A;  3D6W A;  1XPO A;  4DR3 L;  5CR3 A;  2JA6 G;  1N33 L;  4KHZ A;  4ME5 A;  2WAQ G;  4JBM A;  5IT9 c;  1IHZ A;  2Q2I A;  1JC7 A;  1B9M A;  3T56 B;  1XNR L;  4KHP Q;  4DK6 C;  4OXP A;  3GTG B;  3LX0 A;  1JR0 D;  3E9I A;  4K5W A;  1E2Z A;  2EQS A;  5JEA H;  4MHE A;  4CKC A;  4HJ7 A;  3RLO A;  2E2J H;  1MJE A;  4PZ8 A;  4JK1 C;  3KBX A;  3WDN A;  1T9H A;  2VQE L;  4UHV A;  1TWF B;  1K28 A;  3N52 A;  5KYI A;  5C0X H;  2MUY A;  2C5C A;  4IUT A;  4Y52 H;  2NTT A;  3ZJY C;  3DM3 A;  4O0A A;  5IP7 G;  3DEP A;  1TY0 A;  1M4V A;  2XWB B;  1EYA A;  2I0Q A;  1EYD A;  1F2Z A;  4LFC L;  1N9W A;  3D8G A;  2K03 A;  3BZC A;  3HKZ E;  3F2U A;  4MTK A;  5F2D A;  1KXL A;  4WFN 3;  3H15 A;  1NE3 A;  1DCZ A;  4KKU A;  4DR2 L;  1CM9 A;  5L37 A;  1SYE A;  1V1P B;  4XQN A;  4A3G G;  1YNN C;  4UAI A;  1CA5 A;  2CQO A;  4ZUI A;  4YY3 L;  5CV4 A;  1XNQ L;  4DR5 L;  2XNA C;  4ALP A;  2I5H A;  3H0G B;  1PRT C;  2ES2 A;  4XT3 B;  4NDX A;  1HZA A;  1EEI D;  1O7I A;  1S5E D;  4PMB A;  3J80 c;  4DV1 L;  4A3M H;  1SYD A;  2QEJ C;  1EY6 A;  2V1C C;  5EQ0 A;  1CTM A;  2N78 A;  2WV6 D;  3GTK B;  4ZYS A;  1VQP A;  1A2U A;  2IY5 B;  5ELO A;  1A8V A;  4QQB X;  2JEA I;  2CWP A;  2D62 A;  3PSI A;  4DV0 L;  1QVC A;  3F1Z A;  1HQR D;  4IPH A;  2DN8 A;  1X54 A;  4UDU C;  2MO0 A;  3RNU A;  3HZX A;  1IW7 D;  1ONL A;  1K3R A;  1YBY A;  5IWA L;  4DV7 L;  2B2V C;  3C2P A;  2NZ1 D;  1GJX A;  1GD7 A;  3T13 A;  1PTO F;  1VQF A;  2CCZ A;  1EZ6 A;  1SYF A;  2KEE A;  1LT3 D;  2XRS D;  3NSW A;  3MXG A;  3FP9 A;  1STY A;  4UP9 A;  2CW0 C;  2Y0S G;  4IPD A;  1KNE A;  3VYS A;  5M5W B;  3D4R A;  1R9T B;  4PZ7 A;  3S2H B;  3TZU A;  1UEB A;  2CFM A;  4JC0 A;  4KLK A;  3EBE A;  4RCO A;  3RN2 A;  5KYL A;  1Q86 C;  1HFN A;  1Y14 B;  5LMU Q;  2N55 A;  4LFB Q;  1F9P A;  2E75 C;  3PCO B;  1F9R A;  1PTO D;  2QGQ A;  4A3C G;  1XMO L;  1Y1V G;  1VQ7 A;  3PGZ A;  2BH2 A;  4LK1 C;  1Q7Y C;  1QOH A;  2JQO A;  2EVB A;  1IBL L;  3F8T A;  2NBF A;  3URY A;  1I50 H;  2F1M A;  1TS5 A;  2EDG A;  1CKO A;  4ODG A;  3ERS X;  4JI8 Q;  4C56 C;  1V9P A;  2PYK A;  4A3K H;  1WTO A;  2VY3 A;  1ESF A;  3K5N A;  3S1N B;  3DEO A;  4BBS G;  3CW2 C;  1EY0 A;  3SGI A;  1NSN S;  3GO5 A;  4GKJ Q;  4HJ8 A;  1EY5 A;  3S1Q B;  1X65 A;  1KTK A;  1I6V C;  1J8I A;  2IWH A;  1JJ2 A;  1S5C D;  5BN3 A;  4WJ4 A;  2G5D A;  5DEH A;  4MNO A;  3TRE A;  4HED A;  3GTM H;  3I73 A;  1FGB D;  4NXM Q;  4DAY A;  2MPM A;  4PQX A;  1NMF A;  1DXM A;  1UE7 A;  1L1O A;  4A4I A;  1SE2 A;  1B3A A;  1SYB A;  4A76 A;  3T1H L;  3L2P A;  2E5L L;  4AQY Q;  4JI3 Q;  1NUC A;  3U4V A;  1U4L A;  4UPA A;  2CH4 W;  4J15 A;  1Z9F A;  4A3D B;  2NVX B;  2Z9H A;  2B2W A;  5C0X G;  4LFA L;  1HUN A;  3SVM A;  2XTI A;  1NY4 A;  3NEN A;  5FO9 B;  1I5F A;  1SRO A;  2CKZ B;  4JI7 Q;  2F0O A;  5D3D A;  4EVO A;  3SR1 A;  3CCM A;  1Q81 C;  5FLM H;  4DK1 A;  2L1B A;  3U9O A;  4LFC Q;  1N8R C;  2YU9 H;  1LAC A;  4BBR G;  4FF4 A;  5JPM C;  1OXU A;  1F77 A;  2AUK A;  4GLX A;  1IL2 A;  3S15 B;  4G7Z C;  1WTX A;  2R3Z A;  5A35 A;  2N88 A;  4R8N A;  1K0S A;  1Z7T A;  1TS3 A;  1AH9 A;  1I94 Q;  1A3T A;  1SR3 A;  4YY3 Q;  1PHJ A;  1TII D;  2EYM A;  3V05 A;  1DON A;  4C3I G;  1TWC B;  5CV5 A;  4POG A;  4DNT B;  5C4X B;  4CJ0 B;  1VF7 A;  1ENC A;  1E1T A;  3M7N A;  3K6O A;  4C3J H;  4KHP L;  2C9O A;  3KYH C;  4H0L C;  3UDX A;  2HHH Q;  2WAQ B;  1K8O A;  2LXK A;  2FFK B;  2KBN A;  1BCP B;  4R4O A;  3TP7 A;  4BBS H;  4KTA A;  4XQQ A;  1QCB D;  5AFW A;  1RDP D;  4R4Q A;  2ICI A;  4CJ1 B;  4HR7 B;  3K81 C;  2D2C C;  2D0O A;  1U4M A;  2A68 C;  1V43 A;  2DGY A;  3GDE A;  1HTP A;  5M3F G;  1ML0 D;  1PYB A;  4DK3 C;  3KDF A;  4LF7 Q;  1JIC A;  1QZH A;  1X32 A;  1I4X A;  2RCF A;  2A19 A;  1UE6 A;  4P73 A;  1SE4 A;  3GV3 A;  1XPR A;  2JSO A;  4BWG B;  4DNI A;  1YI2 A;  4MN3 A;  4X3T A;  3UDI A;  2A69 C;  4PZ6 A;  1JCK B;  1X3P A;  1QG7 A;  4BY7 B;  4UP8 A;  4OX9 Q;  1QVF A;  1OO9 B;  1I4P A;  2Z6K A;  2F0V A;  2H5X A;  1VQO A;  1K8M A;  2JK8 A;  1DOM A;  2QW7 A;  3NBH A;  2JE6 I;  2UUC L;  4A3L H;  4J6H A;  2ZXP A;  2K50 A;  3MFY A;  2CQA A;  3PUW A;  4A3M G;  2WII B;  1G29 1;  2IHE A;  3I91 A;  2K5Q A;  1EL0 A;  3K0Y A;  1TKW B;  3CME A;  5FLX c;  1BKB A;  3QOL A;  1ET6 A;  3A55 A;  1GVP A;  2IJ0 A;  4QIW E;  1CKN A;  5J22 A;  1HNW L;  1A0I A;  1LYL A;  3Q6S A;  1EOV A;  1VDZ A;  1N33 Q;  3MZ5 A;  3NWS A;  1OXS C;  2KED A;  3QR8 A;  4C3H H;  3ZYY X;  2JN4 A;  3A0J A;  2I5L X;  2OCE A;  4A3K G;  2WAC A;  1RL2 A;  5IGD A;  1VQD A;  1I4G A;  1B7Y B;  2IX1 A;  3RN5 A;  1ILP A;  1I94 L;  3X3N A;  2UU9 L;  2VQE Q;  1SNQ A;  1CI3 M;  4GNX A;  2UUB Q;  4IAL A;  3PO2 G;  1SXT A;  2UXD L;  4JG2 A;  5IYD H;  2R7Z H;  5EPJ A;  4RCN A;  4KY6 A;  3DWP A;  3W1B A;  5C5L A;  1ZXT A;  4S3S A;  2VUM B;  5C4X G;  1EZ8 A;  1T5X D;  2F03 A;  2JA7 H;  4KKT A;  4RGO S;  1IBM Q;  1C0A A;  2F3I A;  5LL6 S;  2VS1 A;  4RWS C;  3P75 A;  1HA5 A;  3JAM L;  4MZ9 A;  3EQL C;  2Q2T A;  3NE5 B;  2L55 A;  2PZU A;  4HID A;  1JE5 A;  1SRU A;  1PFS A;  1II3 A;  3NK9 A;  3DHQ A;  2XRQ D;  3SHL A;  4CKE A;  2KJX A;  4G4K A;  1XYI A;  1XJV A;  2AQ3 B;  2Z6K C;  5ELB A;  2K04 A;  1LT5 D;  1MD2 D;  3MFG A;  1SND A;  3KBG A;  1EEF D;  1W6J A;  2E8G A;  2F0K A;  2K4K A;  3IRB A;  4PMC A;  4LAA A;  4JBK A;  3CCE A;  4QUC A;  4K0K Q;  3FHW A;  4LF5 L;  2QIL A;  4A3J G;  2A8V A;  2F0L A;  3S1Q H;  4IQZ A;  3PIP 3;  3HKZ G;  2O2L D;  2K5V A;  1E2W A;  2XWJ B;  1KDA A;  1QZG A;  2CHB D;  4JI2 Q;  2F0W A;  2KHJ A;  3VR4 A;  4CDC C;  5IP9 H;  5JEA G;  3JAM E;  5C44 B;  3E6Z X;  1LTA D;  2J7Z A;  2EIF A;  1W2B A;  3RZD H;  2ZJP A;  1QUQ A;  2HDM A;  5BR8 L;  1F2M A;  3TS0 A;  5ELD A;  1QIL A;  1PMR A;  1B1Z A;  4RKB A;  4NPS A;  1Y1W G;  2JYO A;  3EVQ A;  1Q90 A;  2HUG A;  3VYR A;  1LTT D;  3HOZ H;  3KFU A;  1HZC A;  4IUP A;  3ERQ A;  4DK0 A;  4GNX C;  1TWG H;  3MVV A;  1X3E A;  5C6A A;  4BBS B;  2C35 B;  4Y7N B;  1LM0 A;  1NNX A;  3HFZ B;  4LJZ C;  4YHH L;  2F0G A;  4XTC S;  5M3F H;  1O7Y A;  3A5Z B;  5J3B A;  2Q8T A;  1K3B C;  4K8J A;  1EWH A;  4X64 L;  4OWX B;  4FXD A;  4TRD A;  2HD3 A;  1OTC A;  4GNX B;  4APV A;  1B50 A;  1SYG A;  3D4W A;  3S2H H;  1EIF A;  4B3R Q;  1XMQ L;  4F8M A;  4P75 A;  5JJI A;  5JJZ A;  3I4M B;  1V8Q A;  3JAM c;  4FYD A;  1KHI A;  3UDF A;  1TS4 A;  4B9W A;  1PRT F;  1CZG A;  2ZTD A;  4A3G B;  1KC8 C;  3M4Q A;  4IUQ A;  3HOZ G;  4C3J G;  1J9O A;  2DNE A;  3L7Z C;  2DY7 A;  3VR3 A;  2EY1 A;  1STA A;  4OEL B;  1WD1 A;  3I4N H;  1GXD C;  3FVQ A;  2KUM A;  3TP6 A;  3OTO Q;  1PDQ A;  1X55 A;  5IGB A;  2HDL A;  2VXW A;  2B2Y C;  2A6E D;  3BVM A;  4QL5 A;  1PYW D;  1EYG A;  3TEH B;  3TQY A;  2F0F A;  2R7D A;  1RTO A;  4I7A A;  3SK5 A;  4ZCK A;  1OXV A;  5C3X A;  3HOV G;  3CCL A;  3VA7 A;  4DV3 Q;  4ULL A;  1XX8 A;  1TVX A;  1HNZ L;  1KDC A;  4DR7 Q;  3FKI G;  1L1O B;  4P2C B;  3K7U C;  4N8X 1;  2E74 C;  4JBJ A;  2BDO A;  1AE2 A;  2L5T A;  3FEW X;  3KUP A;  3U50 C;  1EUJ A;  4XIG S;  4EQO A;  1PYS B;  5AJ3 Q;  3MA2 B;  4RGM A;  2GVB A;  3SE0 A;  1TR5 A;  1GUO A;  1IL8 A;  3GTM B;  1I4R A;  3NP8 A;  1G91 A;  1Y1W H;  1VQB A;  2Q8I B;  4U68 A;  2LY7 A;  3KDF B;  4K6L A;  1BVS A;  5C4X H;  1JJG A;  4IFD G;  1EY8 A;  3DWA A;  3ONA B;  1WCM B;  1N36 L;  4JOI C;  3H6M A;  4N8F A;  1K8A C;  4BXX H;  1WTQ A;  1H95 A;  1HHV A;  1WTW A;  3Q0A A;  3ULP A;  2Z4H A;  2EXD A;  3K5L A;  2HCI A;  2OXP A;  4C1N I;  3HOV H;  4V19 0;  1BR9 A;  3AYH B;  2RBM A;  4QMG A;  3AU7 A;  1D5M C;  4R8I A;  1S5F D;  2I07 B;  1S40 A;  2OWO A;  1E7Z A;  5HGQ A;  4AYB E;  5COY A;  4DFA A;  2F0D A;  3H94 A;  3RD4 A;  1IYV A;  4DXG A;  4L5R C;  1WTV A;  4I65 A;  3WWV A;  3SK4 A;  3NEM A;  1J6Q A;  1YNN D;  4X6A H;  1BBU A;  1K83 B;  1KAW A;  3IL8 A;  3C3L A;  2JA9 A;  2NUC A;  2K14 A;  4B3M Q;  4X3U A;  1CQV A;  1JOO A;  4KK7 A;  2B2U C;  3GTL H;  2R7Z B;  1RIP A;  4EQN A;  2EXZ A;  1U9R A;  3OSO A;  1H9J A;  4XQJ A;  4GOP B;  3HOX B;  2DNC A;  4BY7 G;  3J7A F;  4GN5 A;  3S2D B;  3AMU A;  1I3Q B;  1TWA H;  5J39 A;  3WOF A;  2NTS A;  2FXQ A;  1PTO B;  3FPP A;  1RHP A;  4LW1 A;  2PPB C;  1WCM H;  4F88 A;  5T1I A;  3OHX C;  1EYC A;  3FPU B;  3S2D H;  1SFO B;  3PMF A;  5T1G A;  4L8J A;  1RCV D;  1HFG A;  5IWA Q;  3K5M A;  1HNZ Q;  5ELC A;  3PQI A;  3D6C A;  2ALY B;  4RHR A;  1L0Y B;  2DUD A;  5FLX L;  4GLV B;  2NVY H;  1CSQ A;  4R4C A;  3STB C;  3TME A;  4G7O C;  2JA8 G;  3G71 A;  4JOI A;  4IPC A;  1N34 L;  1CHQ D;  3CXC A;  2F4V Q;  1K83 H;  2K5D A;  3KLW A;  1BCP C;  3CCQ A;  4B3R L;  2F0J A;  3CHB D;  3BVG A;  2R6G A;  3TN2 A;  5GAD C;  3GTL B;  2HCC A;  4IOA A;  2LFN A;  4LF4 L;  4NP5 A;  2BE5 D;  5DAU A;  4DN4 M;  3GTO H;  5NUC A;  1D5Z C;  1XMO Q;  4DNR B;  1VQC A;  3E0J A;  4GOP C;  1IYU A;  4RKL A;  1I50 B;  3M4O H;  1D1I A;  4KMU C;  2VUM H;  3UI2 A;  3KJO A;  4YCU A;  5M3M B;  1KLU D;  4CDF C;  3NTI A;  4C3H B;  1STG A;  1VQK A;  4JI0 Q;  1K8G A;  4XYQ A;  1AZQ A;  1EY7 A;  3D3R A;  1JB3 A;  3C46 A;  3J7A 5;  4BBR H;  3HOY H;  1LO5 D;  1XNR Q;  1AW7 A;  3GTJ B;  1CFM A;  4IUV A;  5I9O A;  3GTP B;  5FLM G;  3RZO H;  2K33 A;  3CCS A;  3M4Y A;  2HIV A;  3V96 A;  1IKL A;  1YIJ A;  1TQO A;  2VQF Q;  3J81 i;  4QIW B;  4N9T A;  3CCR A;  1CK1 A;  2RSO A;  3ICE A;  4OWT B;  4DUZ Q;  4HIK A;  3J80 L;  1YJN A;  1EY4 A;  2BOS A;  2K5H A;  4KN4 C;  5IGG A;  2FHT A;  4EQ5 A;  4JCV E;  4G7H C;  4AH6 A;  2KA7 A;  4B08 A;  1Q46 A;  1LTG D;  3HG9 A;  2JA5 G;  4CHT B;  3TSS A;  3T1Y L;  1N36 Q;  1BXT A;  2N8N A;  4B9X A;  4A3I H;  2XSC A;  3A74 A;  3MAQ A;  1S3O A;  5E3F A;  1JE4 A;  5DM6 3;  1NTG A;  1DGS A;  1MHW C;  2SNM A;  1OXT A;  3Q23 A;  3K5O A;  3W1G A;  2ICE C;  4POF A;  4O1N A;  5CV7 A;  5FK9 C;  4JI6 L;  1Y1V B;  4RGT A;  3FMC A;  3PUZ A;  4P74 A;  1MSH A;  4DV0 Q;  3QB3 A;  1IBM L;  1QUQ B;  1Z6H A;  4V0B A;  1LT4 D;  1QNK A;  3S15 H;  1YJW A;  3BZD B;  3HOW G;  4ME3 A;  1FL0 A;  3AFQ A;  3DXJ C;  5IYB H;  1G6P A;  1D1K A;  1X9N A;  4CBV A;  4GS3 A;  1JB7 A;  1BOS A;  3S14 B;  4C2M B;  4QGU A;  4OO1 G;  2RKS A;  1VQJ A;  4JYA L;  3OWE B;  3I4M H;  1Q82 C;  1GUS A;  2ZTE A;  2AQ1 B;  2H4O A;  3MEH A;  3PF5 A;  3R8B A;  2NN6 G;  3AQQ A;  3O13 A;  5AJ3 L;  4BY7 H;  3IFT A;  4LF8 L;  1QB5 D;  1C8C A;  2F0N A;  3BYY B;  2A5H A;  3BG3 A;  4DUY Q;  4R4T A;  2M9V A;  3CMA A;  1ZYR D;  4X64 Q;  2M2L A;  5CBE E;  4JI1 L;  3NUC A;  3VR2 A;  3EA6 A;  1TWA B;  1WYD A;  2L12 A;  1TWF H;  3K7A B;  3RMH A;  1SJH D;  1A3V A;  3GD7 A;  1YNJ C;  2UXB Q;  1RF2 D;  2YTX A;  5LMU L;  5HY6 A;  1DZ1 A;  1A15 A;  1XNQ Q;  5JEA J;  4QUF A;  3HOW B;  5IYB G;  4DR4 L;  4DGZ A;  1HA6 A;  4DAY B;  1WD0 A;  1YHA A;  4CJ2 C;  1X3F A;  3CC2 A;  5LHY 1;  2XVS A;  3H91 A;  2XIW A;  3T4A C;  5CC4 A;  1PH5 A;  4JI2 L;  4NB3 A;  4DUY L;  4QCL A;  3PV0 A;  2KCC A;  3L3O C;  5BN5 A;  1EFI D;  5IT9 L;  5JPN C;  1IBK Q;  4RH6 A;  3KF8 A;  1KIX A;  3T1Y Q;  2DJF C;  4XXE A;  2JA7 G;  3PIP A;  1SMY D;  4C3I H;  3I90 A;  3U9S A;  5KGU A;  1K0R A;  5JVH 3;  1M8A A;  3MXN B;  1HTL D;  2ZJQ A;  1R4P B;  4ZKC B;  1TU2 B;  1GUG A;  5KND A;  3A8J E;  2A68 D;  1HUM A;  3S17 H;  2VUM G;  1MSG A;  3KLS X;  5EKI A;  2K7V A;  3QWN A;  2EPB A;  2AWO A;  2AWN A;  2CVR A;  2NVQ H;  1VQM A;  1UEA B;  2D0P A;  2D5D A;  1CUK A;  1U4P A;  5GAE C;  3F2C A;  3GV6 A;  1F2L A;  4K5V A;  3STB D;  4BA1 I;  5C0X I;  4DV5 L;  4ZKB B;  2F0I A;  2B2Y A;  1I4Q A;  1Q8I A;  3CRL C;  1D8L A;  1QE6 A;  4FP5 D;  1GM5 A;  5I2Y A;  2L0C A;  3NBI A;  1SE3 A;  1VS0 A;  1R9T H;  5GAH C;  4OX9 L;  3M3Y B;  4RFB A;  1PVO A;  4CKB A;  1STE A;  1IXR A;  2WKC A;  2WFW A;  5M9O A;  1KRS A;  2ZM6 L;  1YIT A;  1XTC D;  5IYC G;  4Q0F A;  2F0H A;  5BN4 A;  2L4N A;  2R61 A;  2F0M A;  2JA7 B;  4AIM A;  1BDO A;  1FNV A;  3EIV A;  2EYJ A;  5KRU A;  2K6A A;  1TWH H;  4DV7 Q;  5C0X J;  1U4R A;  2L15 A;  4DV5 Q;  1JMC A;  3PUX A;  3H3V C;  1NJI C;  1L1O C;  1VCI A;  2ENB A;  2JA5 B;  2YTY A;  1LTB D;  3CKI B;  1EQQ A;  3H3V H;  4DF7 A;  2BDN A;  4BY1 B;  3A7L A;  2NVX H;  2BH8 A;  3RZO B;  1EY9 A;  4JI6 Q;  1XXG A;  2Z1C A;  2VB3 X;  3I56 A;  2EJG C;  4DKA C;  2MQH A;  4DA2 A;  5LMN L;  4NW2 A;  1ROD A;  2UUA L;  1BF4 A;  1FJG L;  3LNN A;  2K5N A;  3GTQ H;  3M4P A;  2B2T C;  2PW5 A;  3KLS A;  1ASY A;  2F0P A;  1ICF B;  4J8Q A;  4C2M H;  2D9U A;  4JPB W;  4KV6 A;  3TZD A;  3MC0 B;  5C3E B;  3CPW A;  2KHS A;  2IX0 A;  4RGN A;  1PFN A;  4LUV A;  4AYB B;  1V1O A;  1BBW A;  2BA1 A;  2V4D A;  3IKJ A;  3RLF A;  5EJW A;  4DR3 Q;  2GVA A;  2K01 A;  4HMI A;  4JVZ A;  5C4Z A;  2R92 H;  2B63 G;  5KNB A;  1SLJ A;  1D7Q A;  1AFP A;  1KDB A;  3KF6 A;  1F9S A;  4HSV A;  4QF4 A;  3G4S A;  3J7Y W;  3J80 i;  2AMC B;  5C3E G;  3BDC A;  2N49 A;  3U58 A;  4KJN A;  1J5E Q;  4FF2 A;  1JWM D;  3H09 A;  3AFP A;  5TSS A;  2IL8 A;  2NVY B;  4L5T A;  5C4J B;  4X3K A;  1PV4 A;  4DR4 Q;  4YCW A;  5EAY A;  3ULL A;  5IGE A;  2O5I C;  3PIO A;  4DV2 L;  2F52 A;  5M5Y H;  3K59 A;  2PCF B;  4OON A;  5I6W A;  4PV1 C;  2ZT9 C;  4A3E G;  1HNX Q;  2KCT A;  4A93 G;  4L63 B;  2RQX A;  5EPL A;  2RSN A;  1BQQ T;  1E24 A;  4FVM A;  2G9D A;  4X65 L;  2A73 B;  3SDZ A;  1H9M A;  2HQE A;  4KD3 A;  1IYJ B;  1R4Q B;  2YYZ A;  4K0K L;  4HTH A;  1Y8O B;  3E9H A;  3V2T A;  4OHJ A;  3S1N H;  3GTQ B;  2EYL A;  3I4N G;  2VZA A;  3K0X A;  1LTI D;  4GZY C;  1MJC A;  4IFD J;  1G2S A;  3AB9 A;  2NYZ D;  3KF6 B;  3CCU A;  4HIO A;  1ZYR C;  2UXD Q;  4C1N K;  4CGY B;  2JA6 H;  3RZD B;  4A3I B;  1GOZ A;  4A3G H;  4LFA Q;  1A62 A;  1O80 A;  3PO3 B;  1GHJ A;  4ZRZ A;  4NXN Q;  2X6G A;  1GUW A;  4JW0 A;  4A93 H;  1A63 A;  3S1M B;  1C9O A;  3R2T A;  2J4X A;  4K5X A;  1HCZ A;  1QWY A;  2A6H C;  3WOE A;  4DV3 L;  4K2L A;  1FVI A;  2EY2 A;  2EYH A;  4LUO A;  1KAA A;  3HS0 C;  1W3S A;  1EWC A;  3BYT B;  1S5D D;  2AKW B;  2HIX A;  1XPU A;  4DR7 L;  3I7F A;  3D31 A;  5CV9 A;  1HPC A;  2B39 A;  1F9Q A;  2RDG A;  3T16 A;  5DLQ E;  4BY1 G;  3TS2 A;  2PI2 A;  4A3D G;  4KN7 C;  5M5X H;  4F87 A;  4BXX G;  3VA5 A;  3A8K E;  5CV8 A;  5D3I B;  1SMY C;  4IUN A;  3GTK H;  1VMC A;  4LNQ A;  4KY7 A;  2UXC L;  1NBW A;  3SEB A;  1GUT A;  4Q5V A;  1KRT A;  5DM7 3;  5FOB B;  3BDO A;  4DR2 Q;  1B4O A;  2EE1 A;  3G7L A;  2CH4 A;  1D6E C;  4IN3 A;  1AEX A;  5CV6 A;  1SNM A;  3I4O A;  1VQ6 A;  1UUP A;  3G6E A;  4A3M B;  1AP0 A;  1A2T A;  3E3X A;  1FNU A;  5IYD G;  2VQF L;  2E2J B;  4LFB L;  4YCV A;  2JA8 B;  5BR8 Q;  1EQR A;  1JQY D;  2ZXR A;  5I4D A;  2EYF A;  2PMZ B;  4U67 3;  2NVT B;  1H9S A;  2DJG C;  2NVQ B;  1HQM C;  3FRP B;  2KEC A;  3OPO A;  1FNW A;  1PRT D;  2B29 A;  4IPG A;  3E0E A;  3DLL A;  5IOD A;  1PH1 A;  2K75 A;  4OO1 I;  1GHK A;  1GKH A;  3FKI H;  2UXC Q;  2IX3 A;  3T53 B;  2PZT A;  2WP8 J;  2UUC Q;  3QJY A;  2NN6 I;  1VQG A;  5D65 A;  3UE1 A;  3K57 A;  3UE0 A;  3M9B A;  1EU3 A;  5C4H A;  4J1M A;  3T51 B;  5JAV A;  4YWK A;  1WCM G;  1HH2 P;  2PW7 A;  4L5Q A;  3GTO B;  1TXY A;  1WI5 A;  3OWF A;  1U0L A;  1BCP F;  5KIX A;  5EKL A;  4GKK L;  2AUJ D;  4MTN A;  3HOX H;  3OIQ A;  3EN2 A;  4OEM B;  1HR0 Q;  2EJM A;  4WOR A;  1CT1 D;  5KEE A;  1I3Q H;  4LF5 Q;  1CKN B;  3H0G G;  2VW9 A;  4FF3 A;  4AYB G;  2OF1 A;  3HOZ B;  4B3T Q;  2OQ0 A;  4RHS A;  2RDF A;  4LF6 Q;  1SDF A;  1V1P A;  3HOV B;  4DV6 L;  2L9H A;  3DUZ A;  2HQL A;  2FIN B;  1YZ6 A;  5E7N A;  4YIJ A;  1VQI A;  2PO4 A;  1PH3 A;  1NR4 A;  2MHV A;  1Q3L A;  3I4M G;  2Q2U A;  5A2Q E;  3AEV A;  1STH A;  1SE8 A;  2BCO A;  5D14 A;  4X3S A;  1UE1 A;  2WKD A;  4BS9 A;  3NQT A;  3QOJ A;  1BNZ A;  5K36 G;  5K5P A;  1P16 A;  3HP3 A;  4PMW A;  4DR6 Q;  1EFW A;  1FJG Q;  2K5W A;  5JJL A;  4PG3 A;  1G51 A;  2UXB L;  4O42 A;  4P72 A;  1DJR D;  2XN9 C;  1D2B A;  1VQ5 A;  1O7Z A;  2JP1 A;  4HCS A;  4F7X A;  2TMP A;  1PTO H;  1KQS A;  3M3Y H;  2MP1 A;  1NR2 A;  4A75 A;  1Y69 U;  1SFO H;  4B3S L;  2QCP X;  3MWY W;  5IIF A;  1CZW A;  1H9S B;  2MO1 A;  1JWS D; 
#chains in the Genus database with same CATH homology
 4GS3 A;  1JB7 A;  3PF4 A;  2K50 A;  2BA0 A;  4QGU A;  3T1H Q;  4OO1 G;  4A3M G;  1VQJ A;  3PUW A;  3HOU H;  4JYA L;  1YHQ A;  3I4M H;  1G29 1;  1Q82 C;  2IHE A;  1EIY B;  4FDB A;  2YV5 A;  2ZTE A;  3GTJ H;  4HJ5 A;  3PF5 A;  3CME A;  5IYC H;  5FLX c;  2NN6 G;  1BKB A;  4HIM A;  3AQQ A;  5AJ3 L;  4DV1 Q;  3HKS A;  2B3G A;  1GVP A;  1Y1V H;  2ASB A;  4BY7 H;  4LF8 L;  2VL6 A;  2OQK A;  3I55 A;  4HJ9 A;  4QIW E;  1CKN A;  3B6Y A;  3PUY A;  4DUY Q;  4R4T A;  3VDY A;  1HNW L;  1A0I A;  3CMA A;  1LYL A;  1N32 L;  1EOV A;  4X64 Q;  2I5M X;  1YHB A;  5LMN W;  3J7Z C;  1N33 Q;  4JI1 L;  2F4V L;  1OXX K;  1OXS C;  4A3I G;  3S16 H;  1HR0 W;  2PMZ E;  3UDG A;  1MKH A;  4C3H H;  1EWI A;  1YVC A;  1S72 A;  3A0J A;  2I5L X;  2OCE A;  1WYD A;  4A3K G;  2CWA A;  1RL2 A;  1VQN A;  1TWF H;  1VQD A;  2WAQ E;  3GD7 A;  2R7F A;  4QY7 A;  3KJP A;  5M5W H;  2RF4 A;  4LF6 L;  1B7Y B;  2A1A A;  2UXB Q;  2YTX A;  4GN4 B;  5HY6 A;  5LMU L;  3RN5 A;  2IX1 A;  1XNQ Q;  1I94 L;  4JV5 Q;  3RLN A;  5JEA J;  2UU9 L;  2VQE Q;  1Q1B A;  5IYB G;  4DR4 L;  2PNH A;  3L0O A;  4WJ3 M;  4DAY B;  1KL9 A;  4IJH A;  4GNX A;  2UUB Q;  4JI4 L;  1YHA A;  1VQ4 A;  3I2Z A;  4LF7 L;  3PO2 G;  1X3F A;  3CC2 A;  1AE3 A;  4Y7N H;  4YHH Q;  3HOU G;  4DR1 L;  4A3L G;  2UXD L;  5FJ8 G;  4JG2 A;  5IYD H;  2R7Z H;  1PH5 A;  2MFI A;  3W5O A;  1VQH A;  3PO3 G;  4JI2 L;  1IZ6 A;  3W1B A;  4JI0 L;  4A3B G;  4JI5 L;  4NB3 A;  3F2B A;  4DUY L;  3K8A A;  1HNW Q;  5C4X G;  3PV0 A;  2QA4 A;  2NVT H;  1JT8 A;  1ASZ A;  2JA5 H;  1LTL A;  4LUZ A;  1IBK Q;  5H1S E;  2JA7 H;  1IBM Q;  1C0A A;  5M3M H;  1KIX A;  1PH9 A;  3T1Y Q;  1CSP A;  2F3I A;  2RHS B;  2VS1 A;  2JA7 G;  4X62 L;  1WFQ A;  3PIP A;  4DR6 L;  5C4J H;  4JBW A;  4MZ9 A;  4C3I H;  1KD1 C;  2Q2T A;  3D0F A;  1K0R A;  4HID A;  1JE5 A;  2KCM A;  1SRU A;  1PFS A;  3MXN B;  4DUZ L;  3S24 A;  2UU9 Q;  3S14 H;  2ZJQ A;  1XTD A;  1XJV A;  2Z6K C;  1P8L A;  3JAM i;  2OTJ A;  1N34 Q;  3LGJ A;  4TQU S;  3PUV A;  5IE8 A;  3CD6 A;  3S17 H;  3CP0 A;  2VUM G;  3OTO L;  1HNX L;  2E8G A;  2K4K A;  3IRB A;  2YTV A;  5LMN Q;  3NEL A;  2E2H H;  4JBK A;  3HOY G;  3CCE A;  2AWO A;  2AWN A;  2ID0 A;  2ZM6 Q;  4OWW B;  2NVQ H;  1B8A A;  2MNA A;  3HOX G;  3CAM A;  1PH8 A;  3FHW A;  1VQM A;  1XMQ Q;  4K0K Q;  4H02 A;  4LF5 L;  2D0P A;  2PI2 E;  1CUK A;  5GAE C;  4A3J G;  4JI3 L;  3F2C A;  4AQY L;  4UY8 C;  2A8V A;  3S1Q H;  4QJF A;  1UWV A;  3HKZ G;  3STB D;  4BA1 I;  5C3E H;  1VQE A;  3U4Z A;  1E3P A;  1YNX A;  5C0X I;  4DV5 L;  4A3C H;  2K5V A;  5GRO A;  1QZG A;  1D8L A;  4DV6 Q;  4JI2 Q;  5JEA G;  2KHJ A;  2IT1 A;  4RG1 A;  5IP9 H;  1VQ8 A;  5M3M G;  1GM5 A;  4IOC A;  2EIF A;  1FGU A;  1W2B A;  3HOW H;  3RZD H;  2ZJP A;  1M1K C;  1QUQ A;  5IP9 G;  4DV2 Q;  1IBL Q;  2ATW A;  4LF9 Q;  1VS0 A;  5BR8 L;  1R9T H;  2KHI A;  5GAH C;  3CCV A;  4B3S Q;  4OX9 L;  1VQL A;  3TS0 A;  2WB1 E;  4A3D H;  3K7A H;  1V1Q A;  4NPS A;  4JI5 Q;  3CC7 A;  1PVO A;  1CKM A;  4RMF A;  1IXR A;  3KOJ A;  1Y1W G;  4EX5 A;  2WFW A;  3BZK A;  1KRS A;  1IBK L;  2ZM6 L;  1HZC A;  1YIT A;  2PQA A;  4YWL A;  5IYC G;  4LF4 Q;  3KFU A;  4GNX C;  1TWG H;  5IP7 H;  4DV4 L;  1X3E A;  1YJ9 A;  2E5L Q;  4B3M L;  4AIM A;  2C35 B;  4O2D A;  4R4I A;  2PQA B;  1E22 A;  3EIV A;  1TWC H;  1LM0 A;  3RR5 A;  3HFZ B;  1TWH H;  4DV7 Q;  5C0X J;  2B63 H;  4YWM A;  4YHH L;  4DV5 Q;  2L15 A;  4XTC S;  1HJP A;  1HZB A;  5M3F H;  1PH6 A;  1JMC A;  3A5Z B;  4BA2 I;  1L2F A;  3PUX A;  4HJA A;  1XPO A;  5J3B A;  1L1O C;  4DR3 L;  1PH7 A;  1NJI C;  1VCI A;  2YTY A;  1WOC A;  4X64 L;  1EQQ A;  1N33 L;  2HT1 A;  4OWX B;  3F2D A;  3S1R H;  2JA6 G;  3H3V H;  2NVX H;  4KHZ A;  2WAQ G;  4JBM A;  5IT9 c;  1OTC A;  2BH8 A;  4GNX B;  4APV A;  2Q2I A;  2JA8 H;  4JI6 Q;  3I56 A;  3S2H H;  1EIF A;  1XNR L;  1XMQ L;  3TRZ A;  4B3R Q;  4DKA C;  2MQH A;  4OXP A;  4P75 A;  4DK6 C;  5GAG C;  4X62 Q;  5LMN L;  4KHP Q;  2UUA L;  5JJI A;  2NZO A;  3E9I A;  2LXJ A;  3JAM c;  1FJG L;  1KHI A;  3UDF A;  1K9M C;  2EQS A;  1HR0 L;  4HJ7 A;  2K5N A;  3BJU A;  3RLO A;  1PA6 A;  4PZ8 A;  1MJE A;  2E2J H;  3GTQ H;  1T9H A;  3CPF A;  3M4P A;  2VQE L;  2ZTD A;  1ASY A;  1KC8 C;  4C2M H;  4JI4 Q;  3M4Q A;  3HOZ G;  3L7Z C;  3CPW A;  1JJC B;  3I4N H;  2IX0 A;  3BU2 A;  4LUV A;  4Y52 H;  2N3S A;  3ZJY C;  1BBW A;  3DM3 A;  2BA1 A;  3OTO Q;  3RLF A;  4DR3 Q;  1X55 A;  2NZH A;  2GVA A;  4O0A A;  4GLA C;  2HHH L;  4L5S A;  5IP7 G;  2R92 H;  2B63 G;  1M90 C;  1SLJ A;  3CCJ A;  1VQA A;  1D7Q A;  4QL5 A;  2I0Q A;  2R92 G;  3KF6 A;  2JEB I;  4LFC L;  1N9W A;  1EYG A;  2IHF A;  3TEH B;  3TQY A;  3G4S A;  2R7D A;  3JC6 6;  3BZC A;  3HKZ E;  3J80 i;  1KXL A;  4DV2 L;  1OXV A;  2AMC B;  3ER0 A;  5C3E G;  3H15 A;  1NE3 A;  3HOV G;  3CCL A;  4DV3 Q;  2N49 A;  3U58 A;  1J5E Q;  4DR2 L;  1HNZ L;  4A3G G;  3AFP A;  4DR7 Q;  4DV4 Q;  3FKI G;  1L1O B;  2CQO A;  4YY3 L;  4JYA Q;  1XNQ L;  3K7U C;  4L5T A;  4DR5 L;  4ALP A;  1PV4 A;  4JV5 L;  2I5H A;  4DR4 Q;  2VNU D;  4YCW A;  4JBJ A;  1AE2 A;  2ES2 A;  5EAY A;  3U50 C;  3ULL A;  1EUJ A;  4XIG S;  3PIO A;  1HZA A;  1PYS B;  2RHQ B;  1O7I A;  5AJ3 Q;  3J80 c;  2F52 A;  5M3F G;  5M5Y H;  2V1C C;  4DV1 L;  4A3M H;  2GVB A;  3CC4 A;  3NBH B;  4OON A;  4DR1 Q;  4A3E G;  4LF8 Q;  1HNX Q;  3PO2 H;  2KCT A;  2N78 A;  4IJL A;  4A93 G;  1Y1W H;  1VQB A;  1VQP A;  1E24 A;  4A3E H;  2IY5 B;  5ELO A;  3GTP H;  4X65 L;  4JI7 L;  1A8V A;  3KDF B;  1BVS A;  4QQB X;  5C4X H;  2JEA I;  1JJG A;  2CWP A;  2D62 A;  1IYJ B;  4IFD G;  3PSI A;  4DV0 L;  2YYZ A;  1QVC A;  4K0K L;  3F1Z A;  3E9H A;  3S1N H;  3H3V I;  1N36 L;  4IPH A;  3M85 A;  4JOI C;  1X54 A;  2K52 A;  1L0W A;  1K8A C;  2MO0 A;  3I4N G;  4BXX H;  2VZA A;  1H95 A;  3RNU A;  3K0X A;  1MJC A;  1C7Y A;  1K3R A;  4IFD J;  1YBY A;  5IWA L;  4DV7 L;  3ULP A;  3KF6 B;  2EXD A;  3CCU A;  4HIO A;  4TVA B;  2UXD Q;  2JA6 H;  1GD7 A;  1X56 A;  2Y0S E;  4GN3 B;  3HOV H;  4LWC A;  1NMG A;  4GKJ L;  1VQF A;  2CCZ A;  1N32 Q;  1YEZ A;  3AYH B;  4A3G H;  3KF8 B;  1S40 A;  3FP9 A;  1E7Z A;  2XGT A;  4LFA Q;  4AYB E;  5HGQ A;  4A3F G;  4UP9 A;  2OWO A;  1UE5 A;  2Y0S G;  1SN8 A;  1A62 A;  4IPD A;  2LSS A;  4L5R C;  2RCN A;  4NXN Q;  3WWV A;  3NEM A;  1J6Q A;  4X6A H;  3PO3 H;  1BBU A;  4PZ7 A;  1KAW A;  4A3J H;  4A93 H;  1J5E L;  4DAM A;  2JA9 A;  2K14 A;  1UEB A;  4B3M Q;  2CFM A;  1A63 A;  5ELN A;  4JC0 A;  1C9O A;  4KLK A;  3EBE A;  3RN2 A;  2R7Z G;  1Q86 C;  4DV3 L;  3S1M H;  1FVI A;  3GTL H;  4LUO A;  1W3S A;  1Y14 B;  1RIP A;  5LMU Q;  1XPU A;  2AKW B;  2HIX A;  4LFB Q;  4DR7 L;  3I7F A;  1I6H H;  3D31 A;  2QGQ A;  3PCO B;  4GOP B;  4A3C G;  2ZTC A;  4BY1 H;  1XMO L;  1Q1E A;  1Y1V G;  4BY7 G;  2KEN A;  2Q2H A;  4GN5 A;  1VQ7 A;  2UUB L;  3PGZ A;  4GKK Q;  5DLQ E;  2BH2 A;  4BY1 G;  3TS2 A;  2PI2 A;  1Q7Y C;  4A3D G;  2JQO A;  5M5X H;  4BXX G;  1TWA H;  1IBL L;  3F8T A;  3J81 c;  2FXQ A;  4LW1 A;  3GTK H;  1WCM H;  1I50 H;  4LNQ A;  1VQ9 A;  2UXC L;  1CKO A;  1NBW A;  3S2D H;  2OTL A;  1KRT A;  4JI8 Q;  3ERS X;  1V9P A;  5IWA Q;  4A3K H;  4DR2 Q;  1HNZ Q;  2VY3 A;  4R1J A;  4BBS G;  3CW2 C;  3SGI A;  3I4O A;  1VQ6 A;  1SMX A;  2ALY B;  3GO5 A;  3G6E A;  1B70 B;  5IY0 A;  5C44 H;  4B3T L;  4P71 A;  4GKJ Q;  2DUD A;  4HJ8 A;  5IYD G;  2VQF L;  1X65 A;  4GLV B;  4A3B H;  2NVY H;  4YCV A;  4LFB L;  1CSQ A;  1EQR A;  5BR8 Q;  3OW2 A;  4R4C A;  3STB C;  1JJ2 A;  1U5K A;  4WJ4 A;  2JA8 G;  3G71 A;  4JOI A;  4IPC A;  1N34 L;  4MNO A;  1WJJ A;  3TRE A;  3GTM H;  2B29 A;  4IPG A;  3E0E A;  3CXC A;  2F4V Q;  1K83 H;  3DLL A;  1PH1 A;  2K75 A;  4OO1 I;  3KLW A;  1GKH A;  3CCQ A;  3FKI H;  4NXM Q;  4B3R L;  2UXC Q;  2R6G A;  2WP8 J;  2UUC Q;  1NMF A;  2NN6 I;  5GAD C;  1UE7 A;  4A4I A;  1L1O A;  1VQG A;  3UE1 A;  4LF4 L;  4IOA A;  3UE0 A;  3M9B A;  4A76 A;  3T1H L;  3L2P A;  2E5L L;  1Q8K A;  4AQY Q;  4JI3 Q;  3GTO H;  3U4V A;  1XMO Q;  4UPA A;  4X66 Q;  4YWK A;  1WCM G;  1HH2 P;  2Z0S A;  1VQC A;  3G48 A;  4L5Q A;  4GOP C;  1TXY A;  1GO3 E;  1Z9F A;  4J15 A;  1WI5 A;  1E1O A;  4LF9 L;  3M4O H;  2VUM H;  5C0X G;  4LFA L;  3KJO A;  2R93 G;  2XTI A;  4YCU A;  1NY4 A;  1U0L A;  3NEN A;  2QEX A;  4KI0 A;  1I5F A;  1SRO A;  2CKZ B;  4JI7 Q;  4JI0 Q;  4GKK L;  1VQK A;  4MTN A;  1K8G A;  3K80 C;  1X9N A;  3HOX H;  4JI1 Q;  3EN2 A;  3Q8D A;  5FJ8 H;  3CCM A;  2ZJR A;  1Q81 C;  1HR0 Q;  4BBR H;  5FLM H;  3HOY H;  3J7A 5;  1K73 C;  1I3Q H;  4LF5 Q;  4LFC Q;  1CKN B;  3H0G G;  2VW9 A;  1XNR Q;  1N8R C;  4GOP A;  2YU9 H;  4AYB G;  3RZO H;  4BBR G;  5FLM G;  2UUA Q;  3CCS A;  1OXU A;  2HIV A;  3H0G H;  4JI8 L;  4GLX A;  1YIJ A;  1IL2 A;  4B3T Q;  3GTG H;  1MIU A;  2OQ0 A;  4LF6 Q;  2VQF Q;  3J81 i;  3CQZ H;  1AH9 A;  3CCR A;  1I94 Q;  4DV6 L;  1SR3 A;  1PH2 A;  2HQL A;  4YY3 Q;  1PHJ A;  3ICE A;  1YZ6 A;  2WB1 G;  4OWT B;  5E7N A;  4DUZ Q;  1VQI A;  4HIK A;  2GN5 A;  1PH3 A;  4POG A;  4X66 L;  1YJN A;  2K5H A;  3I4M G;  2Q2U A;  4UP7 A;  2E2I H;  1E1T A;  3M7N A;  3AEV A;  4EQ5 A;  4C3J H;  4JCV E;  1SE8 A;  3KYH C;  3UDX A;  4KHP L;  4AH6 A;  4NXN L;  2HHH Q;  4NXM L;  1UE1 A;  1QVG A;  2LXK A;  1Q46 A;  2KBN A;  4R4O A;  2R93 H;  4BBS H;  2JA5 G;  4R4Q A;  5K36 G;  1X3G A;  2AHO B;  3ULJ A;  3T1Y L;  4DPG A;  1P16 A;  1X6O A;  3K81 C;  4PMW A;  2N8N A;  1N36 Q;  2D0O A;  4DR5 Q;  4DR6 Q;  1V43 A;  2DGY A;  3A5U A;  3GDE A;  4A3I H;  3A74 A;  1EFW A;  1FJG Q;  5JJL A;  1S3O A;  4PG3 A;  1HZ9 A;  1PYB A;  4DK3 C;  1G51 A;  3OYY A;  1LUZ A;  4P72 A;  3CF5 A;  3KDF A;  1NTG A;  1DGS A;  4LF7 Q;  2UXB L;  3J81 j;  1QZH A;  2A19 A;  1VQ5 A;  1UE6 A;  1OXT A;  4P73 A;  1PH4 A;  1XPR A;  4DNI A;  1YI2 A;  3W1G A;  3HOZ H;  1Q12 A;  4POF A;  1KQS A;  4IFD I;  4IO9 A;  3UDI A;  3M3Y H;  4PZ6 A;  2JJQ A;  4JI6 L;  1Z47 A;  3PUZ A;  4A75 A;  4P74 A;  4UP8 A;  4DV0 Q;  1SFO H;  1IBM L;  4B3S L;  1QUQ B;  4OX9 Q;  2Z6K A;  1QVF A;  2H5X A;  3S15 H;  4A3F H;  1VQO A;  1YJW A;  5GQO A;  2JK8 A;  3HOW G;  4X65 Q;  4ME3 A;  1FL0 A;  2JE6 I;  3AFQ A;  2UUC L;  5IYB H;  3MEF A;  4A3L H;  2MO1 A;  1G6P A;  5C44 G;  5JJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...