4XT3B

Structure of a viral gpcr bound to human chemokine cx3cl1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
EHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/signalling protein
molecule keywords G-protein coupled receptor homolog US28
publication title Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor.
pubmed doi rcsb
source organism Cytomegalovirus
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xt3B00
1MSGA 2EE1A 2FMMA 1NCVA 2FJ2A 1HUNA 1J8IA 4HCSA 2MP1A 3I91A 1U4MA 2RSNA 1HRJA 2JP1A 1DZ1A 1WTOA 1NAPA 1U4PA 1WTQA 2KECA 2L1BA 1RJTA 1AZPA 3G7LA 1G2SA 3DEOA 2L9HA 1WVLA 1C8CA 1DOMA 1JICA 1RODA 5EPKA 4ZLTF 5EPLA 2L11A 2L12A 5CMDA 1B50A 4UAIA 1PFBA 2X69A 2R3ZA 1DOKA 1SDFA 3KUPA 5D14A 1BBXC 1ICWA 2KUMA 5AFWA 2RA4A 1SSOA 2KEDA 4IURA 3LWEA 2EPBA 2FHTA 1DONA 1O80A 2VXWA 3MWYW 4CJ2C 1MGSA 5JJZA 3FDTA 5EQ0A 1AP0A 5T1IA 1F2LA 2KOLA 1XX8A 5CBAE 2B2VA 2KVMA 1HUMA 4QUCA 2N88A 3I8ZA 2CVRA 3GV3A 4OIKA 1JE4A 1ML0D 1SAPA 3GV6A 4X3UA 1EL0A 4X3SA 5E4XA 1ILPA 1B4OA 1B53A 4QUFA 2N55A 4XT3B 2HCCA 3F2UA 2K05A 1O7ZA 1IL8A 4ZKCB 1B2TA 4U68A 1RTNA 2L4NA 4ZAIA 2B2TC 4CJ1B 1U4LA 1NR4A 2XIWA 1HFNA 1X3QA 1M8AA 1HHVA 2B2UC 2NYZD 3ONAB 1WTWA 3SVMA 2HCIA 1X3PA 1ESRA 1KNEA 3HP3A 1QE6A 1WTRA 1XYIA 1EOTA 1O7YA 2H1EA 2MGSA 5CBEE 4IUVA 4OIJA 4IUPA 1WTVA 1F9PA 2M2LA 5E4WC 4IUQA 2K04A 2NWGA 2K03A 2KEEA 5DNFA 1CA6A 1MSHA 1QNKA 1VMPA 1RTOA 2B2WA 2B2YA 1J9OA 2RSOA 4CJ0B 1PLFA 1WTPA 1CM9A 1VMCA 4DN4M 5T1GA 1G91A 1HA6A 1B3AA 1IKLA 4HSVA 5D65A 5CORA 1QG7A 1ZXTA 2HUGA 4NW2A 2FFKB 2FINB 3TZDA 3KBXA 1S4ZA 2JYOA 4R9WA 1WD1A 1MI2A 3DEPA 1DOLA 1E0BA 4MN3A 2X6LA 1PFNA 1Q3LA 5COYA 4RWSC 1WD0A 2X6GA 1PFMA 1WTXA 1U4RA 1HFGA 4R8IA 1TVXA 4ZKBB 2MPMA 3H91A 3DM1A 3FPUB 4X3KA 1EQTA 2D9UA 3D6WA 1BNZA 1G6ZA 2MJ8A 1BO0A 4IUTA 3R93A 1X32A 1A15A 2K28A 4MHEA 4XDXA 1CA5A 1G2TA 2RVLA 3MTSA 2K01A 1F9QA 2DY7A 1ILQA 4IUUA 5EJWA 2IL8A 4HAEA 1EIHA 1LV9A 2EOTA 1GUWA 1IKMA 1AZQA 4LMQD 2HDMA 3IL8A 2K1BA 3QO2A 1F9SA 1EIGA 1PDQA 4O42A 4RAUC 2NZ1D 5EPJA 2DY8A 1RHPA 1KNAA 2HDLA 3N52A 2Q8TA 4X3TA 1F9RA 3TN2A 4RA8A 1BF4A 2SDFA 1NR2A 2B2TA 2BDNA 3I3CA 3I90A 3IFDA 2J7ZA 2B2UA 2Q8RE 3P7JA 4HEDA 4XT1B 2B2VC 3Q6SA 5EKIA 3UI2A 2B2WC 2B2YC 4ZK9B
chains in the Genus database with same CATH superfamily
2EE1A 1M4VA 4X65Q 1P8LA 2SNMA 3GO5A 3SGIA 3K0XA 2UUBL 3H0GB 3JAML 3U9OA 1G8ZD 2LFNA 2PW5A 3DWAA 3PF5A 2Y0SB 4IFDG 1SE8A 4G57A 1I94Q 1HZAA 4KI0A 3U4VA 2PZUA 1XNQQ 3M85A 1STEA 1FGBD 3P20A 1R4QB 3PUXA 4OONA 3EFXD 2WAQB 1J6QA 4YHHL 4P75A 3URYA 1MGSA 2QEXA 1YHQA 3BYYB 5K36H 4KN7C 4UY8C 4ME5A 2EXZA 1G291 4LF7L 4J6HA 2JA8G 3RN2A 1YNXA 1JE4A 2Z0SA 5IP9G 4R4OA 1JT8A 4JPBW 1IBKQ 1BOSA 3PO3H 2ZM6L 1IBKL 1E3PA 2H5XA 2JA6B 1GUOA 2RHSB 3NP8A 3HOVB 1KDCA 4HMIA 2A73B 1SMYC 4I65A 2XIWA 1FD7D 3TMEA 2NYZD 1X65A 2Z8LA 1PA6A 4H0LC 1TWHB 3FEWX 5IGCA 4A3MB 2PQAA 4LW1A 1K0SA 3JC66 2M9VA 1F77A 1QVFA 1P16A 4L63B 2ID0A 3KDFB 1FNWA 4JI8Q 3M4PA 1HTPA 1AN8A 2WFWA 3S15H 3A5ZB 2VL6A 1ZYRC 5D65A 3TP7A 4CKBA 2MQHA 2IY5B 5BN3A 1L0XB 1D7QA 2FFKB 3H3VC 2BH8A 2B63G 3SE0A 5HGTA 1LT5D 1K8OA 3KLSX 4OEMB 4PQXA 1H9JA 2WIIB 4LUOA 3T53B 2Q2UA 1ASZA 1STAA 2ES2A 4CDFC 5I9OA 3UDIA 1KAAA 3D4DA 3A0JA 2R93G 1G6ZA 4IUTA 3HKZB 3HEJA 5I2YA 1PH4A 2R7ZG 3HOUG 5JPMC 1S5ED 5I2XA 2EOTA 4H02A 2E2IB 1B70B 1L1OC 5EPJA 3RD4A 2OEOA 4BWGB 1TWGH 1O78A 2R6GA 3CP0A 5GQOA 2B2UA 4MNOA 3CCQA 4L6TB 3UI2A 3DLLA 3E6ZX 1VQFA 4JC0A 3LNNA 3VA7A 1SNPA 4DXGA 3RR5A 1WTOA 4NXNL 3G71A 2L9HA 1C8CA 2F03A 3TSSA 5M3FB 4RGNA 3W5OA 1EY9A 4I7ZC 5IYBG 4AQYQ 3DHQA 1VQ9A 4MTNA 1I6HH 1KDAA 1D2BA 1L1OA 4LFAL 3NBHA 1O80A 2K7VA 3SK5A 2D62A 2UUCQ 2Z4IA 1GHJA 4K5VA 4BBSH 3L3OC 4RCOA 4OIKA 3GV6A 3N6RA 4HR7B 5JEAH 2RDGA 1B4OA 3VYUA 4AYBB 3F1ZA 1O7ZA 1EFWA 1WOCA 1UWVA 4U68A 1NY4A 3KJPA 4X62Q 1IYJB 2WAQE 1UE7A 5DM63 5GADC 3KJOA 1VQLA 2WINB 1KNEA 1K83B 1K9MC 4Y7NH 5CV6A 2IWHA 1JJ2A 4A3BH 4M1UB 4J1MA 2G9DA 2JE6I 2M2LA 1HR0Q 1Y1VH 2EYLA 3UE0A 1KD1C 4TQUS 1J9OA 3NBIA 4DR2Q 1X3GA 2QF7A 4M8AA 3K5MA 2EYJA 3J7A5 3F2DA 3A8IE 1IBMQ 1WD1A 1SYCA 1YNNC 4F7XA 1HQMC 4A3GG 4DK0A 1SYDA 5FJ8G 5LMUQ 5LMUL 4YY3L 2HQEA 4KKSA 2YU9B 1HZBA 3PV0A 3H91A 2Q8IB 4JI7Q 1YJ9A 3Q23A 1MBYA 1CT1D 5C0XH 4OO1G 1SR3A 4OELB 4DK1A 1CA5A 4JI0L 1JORA 5IGFA 4LF8Q 4WRDA 4KLKA 1ILQA 3HOYB 4YIJA 3OMGA 4A76A 1BR9A 1Y14B 4R4QA 4O42A 2VB3X 4PG3A 2L0CA 2HDLA 3STBC 3K58A 3E3XA 3ULPA 2JN4A 4BBRG 4X66L 1XMQQ 4DNRB 3NPPA 3MEFA 3NSWA 3I4MB 1XMQL 3HKZE 2WKDA 1MSGA 3FKIB 3BG3A 2E2HB 3MVVA 1U4MA 1W6KA 4H44C 5I9PA 2B29A 1DZ1A 1JCKB 1KLUD 3TS0A 1K8GA 4AH6A 3D0FA 3ITPA 3JAMc 3GTQH 4EQPA 3PUYA 1SFOH 2I07B 1RF2D 3MAQA 4A75A 2NN6I 1XPRA 1DGSA 2BE5D 1DONA 3MWYW 3D4RA 2BCOA 4CJ2C 1XX8A 1EQVA 2CH4A 2N88A 4A93G 3FP9A 3X3NA 5EAYA 4NP5A 5E4XA 1B53A 1O7IA 1V1PA 2EYFA 3BS1A 3KOJA 4JOIC 2PO4A 3MZ5A 4DXFA 1H9RA 1H9SB 1PH8A 5GAGC 2CWPA 4GN5A 4Q0FA 4DK3C 1NBWA 5M5WH 1BVSA 1WCMG 3KYHC 5GAEC 1TS5A 4DV7L 4DR5Q 1S5FD 1ENAA 5CV5A 1L1OB 4HIKA 3C1FA 1VDZA 4NB3A 2AQ3B 1I4QA 4BXXH 4JK1C 5C3EG 2JEAI 1HFNA 1G91A 5BR8Q 1EY0A 3PSIA 1QG7A 2PZWA 4EQ5A 4IFDH 5M5XH 1Q82C 1OXUA 1TKWB 2F0VA 2F0DA 2WB1G 4GLAC 4Q5VA 4R9WA 3C46A 4KHZA 3VR6A 4WORA 1STBA 1PH3A 1I3QB 1EY5A 3OW7A 3S24A 1LT3D 2K6AA 2HT1A 1LTTD 3OIQA 3PO2G 2NVTB 4WFN3 1J8IA 3I4NB 1YVCA 3M4QA 2Q2IA 4A3MH 2JA8H 2G5DA 4BY1G 4C3IB 1FNUA 3J81j 1I4PA 4O2DA 1F9SA 1Q8IA 4A3IG 1G6PA 3HOZB 1C48A 1LABA 1VQIA 1TWFH 1BF4A 3RUZA 1SMYD 5J22A 1JOOA 4N8FA 1V8QA 2B2VC 4AIMA 4ZK9B 1CQFA 2MHVA 5LMNW 1STYA 4IUNA 2RSNA 3WOEA 3U58A 1MJCA 1NAPA 3EN2A 2HHHQ 2EYPA 1KDBA 2HHHL 2O2LD 1Y1WG 4N9TA 4N9PA 4ZLTF 1ZYRD 4C1NK 3EBEA 4KY5A 4YWMA 5C0XJ 3CD6A 2WKCA 1KIXA 1TIID 3PUVA 3K6OA 1VQEA 2Z9HA 3D6CA 5D14A 1I6VC 3HOWG 2KEDA 3PQIA 4FVMA 1F2ZA 4KD3A 2OT2A 4R4IA 3GQBA 2E2IH 2KOLA 1ZKOA 3B6YA 2B2VA 3D4WA 4QUCA 4QJFA 1PYWD 4GKJQ 5EBCA 3M4OH 4JYAL 5CC4A 1CZGA 5GAHC 3S14B 1WJJA 3F2UA 2L55A 3LWUA 1LTBD 4RMFA 2R7ZH 3F8TA 1OXXK 4IOCA 3BZCA 5I6YA 3ONAB 2OCEA 4X6AH 1VQDA 2NN6H 1QE6A 3IFTA 5M3FH 3S15B 3AB9A 1JJCB 1F9PA 1DD2A 4QY7A 1JB3A 3O13A 2HIVA 2K03A 4L8JA 4TVAB 1RTOA 1LTSD 2E74C 1TQOA 3CHBD 3CCLA 1HH2P 2NVXB 1BKBA 2VQEQ 1ZXTA 4FO2A 1IBLL 3HGBA 5CV9A 2OTLA 4ZRZA 4O0AA 1VQPA 4XYOA 3NTIA 1W6JA 1CTMA 3VR2A 1WD0A 4WJ3M 3BVMA 5C3WA 5C4HA 1DM0B 1TS2A 4LFBQ 3R3OA 1TVXA 2FMCA 4LFBL 1AW7A 4OWTB 1YITA 3SK6A 1KLGD 4L5QA 3TS2A 4X3KA 2E75C 2F52A 2MJ8A 3NWTA 3I2ZA 5IGDA 3WOFA 4B3SL 2RVLA 2ZJRA 1SRUA 2DY7A 3VA5A 1SJED 4GOPA 1TWGB 1VQGA 3LX0A 1X9NA 4LMQD 3F2CA 3S2DH 1A2TA 2PNRC 2KA7A 3N52A 4R1JA 1H95A 3W3AA 1VS0A 3P7JA 4XT1B 1HNWL 1TWCB 3VYSA 2O5JC 2KECA 5CORA 4IFDJ 4FF1A 4IJHA 4PZ8A 2F0NA 4DAMA 2VQFQ 2YU9H 2Z6KA 3T13A 3J7AV 1HQRD 5FO7B 1I6HB 1JOQA 5FK9C 3AFPA 2O4XA 2E5LL 3A5UA 3ERSX 3HOYH 1YNND 5C4XH 2OQKA 2RA4A 5D3IB 1LUZA 2VUMG 3BZKA 3U9SA 4CDEC 4LFCQ 5ELCA 2RCNA 1EWHA 2Z1CA 3PGZA 2HCCA 1STNA 3D31A 1SE2A 1A3UA 4ZKCB 1B2TA 4Y7NB 1V1QA 3NTHA 3OMCA 1VQHA 4A3BB 3CC4A 1WTWA 3SVMA 1FR3A 2N3SA 1JMCA 3HOZH 1D1IA 1QOHA 1Y1VB 2EY5A 4JBMA 2RDFA 3STBD 1N33Q 3CPFA 3CCMA 1VQ7A 3H3VH 1N9WA 5DNFA 3KDFA 2EYHA 3NENA 3EJIA 4JI6Q 2F0QA 3WWVA 4JI6L 1MJEA 3NQIA 2DNEA 2QGQA 2HUGA 4NW2A 3I7FA 2R92G 3A55A 5K5PA 2ZXRA 3ULJA 4JG2A 1E0BA 4XTCS 5COYA 1LACA 2ZJQA 4A3CH 1U4RA 4Z9CB 3PCOB 5JPNC 3GTKB 3QWNA 1Q1EA 4C2MB 3CC7A 3OIPA 3S9WA 3JAMi 3NTKA 1PH7A 1Q1BA 1V9PA 4B3RQ 1N36L 4BY7B 3EVQA 4IPDA 4A93H 5KNBA 4RGTA 3GTOH 4UP9A 1TR5A 3MXPA 3G6EA 4C56C 2VS1A 3K80C 1SXTA 1EEID 3V96A 2OWOA 2A68C 4RAUC 1QUQB 2IHFA 1KAWA 2ICIA 4C3HG 4RA8A 1NR2A 5EKLA 1KQSA 4A3FG 2K52A 2EZVA 4X64L 3HOXG 3T56B 1B7YB 2A74C 1M90C 3K7UC 1CSPA 3EIVA 4PV1C 2QEJC 4FDBA 1SFOB 1I4GA 1A8VA 1RJTA 3L9AX 1U0LA 3AYHB 5IGGA 3K0YA 3I4NH 3K5NA 2TSSA 2UU9Q 1PYBA 4LF6L 1PFBA 4A3EH 2PPBC 2BA1A 4A3DG 1GHKA 4PNYA 4IURA 4C3JG 1SJHD 2CFMA 5A2QE 1VQKA 1AP0A 2HQLA 1OTCA 2HIXA 5JVH3 3A8KE 4X65L 3PO2H 4EQNA 4ZUIA 5M5WB 3CCEA 3RN5A 4K6LA 1T5XD 2BOSA 4CDDC 5ELNA 4DR7Q 1UE6A 3CRLC 4LUZA 1I94L 2L4NA 1XXGA 1X3QA 1YNJC 1XNQL 3MXGA 1OXVA 2HCIA 4ZQ3A 3RZDH 1XYIA 1EOTA 2WAQG 4GLVB 2XWBB 4IUVA 4DAVA 5BN5A 4FYDA 4IUQA 4JI2Q 5M5XB 1A3TA 1JC7A 4JI2L 4DK6C 4A3KH 4K8JA 3TQYA 2WP8J 3Q0AA 4XIGS 2QA4A 2RKSA 3M9BA 1NMGA 4YCWA 1H9MA 3FMCA 1R9TH 1G51A 2KJXA 3DEPA 3V05A 3U4ZA 3S14H 2D2CC 3KF6B 1EY4A 5DEHA 3GTLH 5A35A 4CKCA 2F0IA 3DUZA 1IW7C 3M7NA 2JA8B 5HURA 5KEEA 2DUDA 1VQMA 3DM1A 1EY8A 3FPUB 5C0XI 4GNXC 1YEZA 4DF7A 4JI8L 2E2DC 1SNCA 5EJWA 2D0PA 1GXDC 2ASBA 4LNQA 2XRQD 1TWFB 3F2BA 1CUKA 1FGUA 3FVQA 3I56A 1RIPA 1IYVA 3NK9A 1KNAA 2NVXH 1SYBA 2UXDQ 3I90A 3PUZA 1BBWA 4P74A 5ELFA 2F0EA 1JWMD 1HXYD 2B2WC 2JJQA 5CV4A 1NCVA 3SDZA 2YTVA 4HCSA 5IYDH 1U9RA 2JP1A 2F0GA 2IT1A 3OHXC 4PZ6A 1KRSA 2NUCA 1QILA 3S1NH 4QQBX 5CMDA 1B50A 2VB2X 2CQOA 1XNRQ 4IALA 1EWIA 1K73C 1E1OA 3ND9A 3U50C 1SSOA 4EVOA 3LWEA 2KHIA 1QVGA 3M4OB 5CYUA 2R93B 3MHBA 2ZT9C 4CDCC 1B9NA 2R7ZB 3Q24A 2EY2A 4DKAC 3CAMA 3HOUB 1EL0A 2F0LA 1TWCH 3AQQA 4KV6A 4QGUA 1UAPA 3T1YQ 1SBBB 1H9SA 5IT9L 2QDLA 2B2TC 1JOKA 1PYSB 4AQYL 3ICEA 3J80i 2N8NA 4A4IA 1JWUD 5IWAQ 3DWQA 1SE4A 3MXNB 4IUPA 1EFID 2VNUD 2Y0SE 2UUCL 3QJYA 1CA6A 5C44H 2LKVA 4QIWB 3S1QH 1PFSA 1LTAD 2H4OA 1XPOA 2F0TA 3R2TA 5JJKA 4IFDI 1PZJD 3Q8DA 5IYCH 4X62L 2X6GA 3FRPB 4XQQA 1Z9FA 2WV6D 1GM5A 2EXDA 1ENFA 4DV3Q 1EQQA 1PZID 4F8MA 2CHBD 4XQNA 5HY6A 3EROA 1HR0L 1X32A 1QNUA 2XGTA 5FLXL 1Z7TA 4HJAA 2CW0C 3S2DB 4HJ5A 1SYEA 1BBUA 2YYZA 5EKKA 4DR2L 3NQTA 4DV1Q 4A3JG 3I4OA 1N32Q 4P2CB 5TSSA 1IBML 4ABNA 4UHVA 1E2VA 1EWCA 1I4HA 2XNAC 4XXEA 3CCSA 3J80L 5J39A 2EQSA 2KENA 4DUYQ 3L7ZC 3BDOA 4DUYL 2VZAA 1IZ6A 4JI7L 3NHHA 1VQNA 1YZ6A 1PTOH 1RL2A 5FOBB 3GTKH 1NMFA 4LF4Q 1U4PA 4C2MH 4P71A 1D8LA 4LF8L 2KBNA 2LXKA 3BVGA 4QMGA 4DNTB 5C4XB 2IX1A 3K59A 4DUZQ 4A3GB 2TMPA 4DUZL 4BY7H 4RKBA 1ICFB 4UAIA 2K14A 1A3VA 2R3ZA 1DOKA 4KY7A 2PNHA 1CFMA 2PQEA 2FHTA 2ATWA 5EQ0A 1U5KA 1ET6A 1LTLA 1FJGQ 4G7HC 2F0KA 3I4MG 5I6WA 3I8ZA 2CVRA 2QILA 3FKIG 1K3RA 5J1ZA 2UXCQ 3VR4A 2YV5A 1Y8NB 2AQ1B 1GUTA 4PMCA 4KHPQ 4GNXB 1CKOA 1UUPA 2ZJPA 1LT6D 4ZAIA 2JA5H 3E0JA 4CJ1B 5A2QL 1STGA 5IP7G 1CHQD 4BBRB 3CRKC 3J81E 1ZEQX 5LL6S 3GTMH 4YWLA 2A68D 1O7YA 4JI4Q 2DJFC 1BCPC 4DFAA 3PIP3 4JI4L 1VF7A 3HOXH 1NJIC 2KHJA 3QR8A 5C4ZA 1HNZQ 2C35B 1VQJA 5CV7A 4CJ0B 3OWEB 1HJPA 2PCFB 3QOJA 1EU3A 2K5DA 4HSVA 3UDGA 4JCVE 2DJGC 3S1MH 5IGEA 1MI2A 3NWSA 1OO9B 1Q3LA 2GVAA 3H09A 1E24A 2D0OA 5JAVA 4R8IA 1XTCD 4DR5L 3MFYA 2UUAQ 4A93B 4C3JH 2HD3A 3J7YW 4DV6Q 1TY2A 3GTOB 4QIWE 4AYBE 1FYCA 4WJWA 2V1CC 4OHJA 1NSNS 5BR8L 1EY7A 4JOIA 1PXUA 2PW7A 1PDQA 2NZ1D 2M00A 2DY8A 5CR3A 3T51B 3HKSA 2JK8A 3I3CA 1V43A 1YNJD 5EKIA 4POGA 2K32A 3BYTB 2B2YC 5JVG3 1HA5A 2FMMA 5C3EB 1II3A 1JR0D 2XSCA 5E7NA 1I50H 1KABA 2EJFC 2D5DA 5NUCA 3T1HQ 2UXBQ 1M1KC 2G9HD 2K5VA 2UXBL 1YBYA 4NMZA 5IP9H 1WVLA 4A3EB 1K3BC 2O5IC 3EQLC 1UE5A 4DR1Q 4IOAA 1GUSA 3HOZG 5FO8B 4QCLA 2CKZB 3PO2B 3FPPA 3T4AC 1STHA 3FDTA 2C5CA 4BA2I 1TY0A 5CBAE 2KVMA 1HZCA 2EY1A 1TWAB 1IW7D 1SAPA 3I72A 3AMUA 3CCRA 1ILPA 3H15A 4PZ7A 4DV4Q 4JBKA 4A3IB 3S16B 3RZDB 1HCZA 2EJMA 1NR4A 3CPWA 1LT4D 5IGBA 1PTOC 1PVOA 3E5SA 4J8QA 3CCUA 3HP3A 5K36G 2B63H 1AE2A 1RDPD 4QL5A 1EOVA 5IT9c 1NTGA 4A3KB 4TSSA 5F2DA 4E6IA 3PO3G 2LY7A 1TS3A 5E1FA 3H3VI 1EEFD 3BDCA 1MSHA 1VMPA 4A3LG 4KKUA 1PLFA 4IO9A 1R9TB 1Y1WB 4GKJL 1B3AA 2R93H 5L37A 5J3BA 4HIMA 4IPGA 3C3LA 3GTPH 3GTLB 5C5MA 3HOUH 3BU2A 1R4PB 4MN3A 3HOWB 4LAAA 1WFQA 4RWSC 1EUJA 1UEBA 2NBFA 4NPSA 1ASYA 1GO3E 1BXTA 4RKLA 1SMXA 1VQ5A 1BO0A 3MTSA 2F0PA 1XMOQ 1F9QA 1W3SA 1KRTA 1EIHA 1F2YA 4B3TQ 2VQEL 1TXYA 4RGOS 3ZYYX 3GTGB 1CHPD 4K5WA 1CKNB 5FLXc 1QUQA 1UNSA 1PMRA 5IYBH 1XTDA 3KF8B 1X55A 4K2LA 3PIO3 2I5MX 2NVQH 1LO5D 1LTID 1BCPB 3I91A 1L0YB 1VQ6A 4JI3Q 3S1NB 3SHLA 5M3MG 4S3SA 4JI3L 3RLOA 3J80c 2NTTA 3G7LA 1E2ZA 3T16A 1PH9A 5M5YB 2ZTEA 2K4KA 2Z4HA 1Y69U 1C4QA 4UDUC 1CK1A 2ICEC 3A54A 3L0OA 5EGTA 3W2DA 4PMWA 3KUPA 3TBIB 1FVIA 2I0QA 3KLWA 5I4DA 3TP8A 2EPBA 1Q12A 4R8NA 2Q2TA 5T1IA 1YJNA 1EIYB 2IX3A 4MIUA 4HIDA 2WACA 1Z47A 1MIUA 2N55A 1KHIA 2VQFL 1QVCA 1BDOA 1X6OA 1T5EA 4GN4B 2CW0D 1SNOA 1W2BA 2XTIA 1D5XC 4APVA 2NZHA 4A3JH 4ME3A 2K75A 5D3DA 1A62A 1PH5A 5C44B 3P75A 1YI2A 4BBSG 5FJ8H 4A3GH 3MFGA 3BVZA 1K0RA 5JEAG 3S1QB 3TP6A 4QF4A 5FO9B 4JV5Q 2MUYA 3G48A 1A0IA 3CQZB 4LFCL 1WTPA 2K5QA 4P73A 4OO1H 1IKLA 1J5EQ 2IHEA 4GN3B 1J5EL 4GKKQ 3J81L 2VY3A 4QB4A 1EZ6A 4FXGC 1LLRD 4RG1A 5C3XA 1XJVA 4DR6Q 1VQOA 1PFNA 4A3BG 3OW2A 2L15A 3KF6A 4LF9Q 2VUMB 4FXDA 4LF9L 1Q86C 1Y8OB 2J4XA 1FNVA 4BBRH 1N33L 1B8AA 2K33A 3C1EA 3CCJA 1BNZA 2A69C 5KYIA 1A15A 3RZOB 1EYAA 2LS01 2P5ZX 3UE1A 2K01A 4IUUA 1LV9A 4YWKA 1IKMA 4G7OC 1Q90A 2ENBA 2SOBA 4HEDA 1PTOB 2RF4A 2J0TD 1S40A 4HJ9A 1BCPD 1E2WA 2F0UA 3D8GA 4K0KQ 4N8X1 4MZ9A 3R2IA 4B3RL 3HZXA 2R92B 4DV5Q 2EYOA 3DEOA 5JJLA 4DV5L 1RODA 1VF5C 1LYLA 3E9IA 1QB5D 5KIXA 2L12A 3SR1A 4K2KA 1QWYA 1BCPF 5AJ3Q 1VQ4A 4GS3A 1HZ9A 2KUMA 4OXPA 4NXMQ 1LM0A 4CKEA 4NXML 1WCMH 2A1AA 1PRTB 4RHSA 2NVYH 2LXJA 2NB0A 4J15A 5FLMG 2OF1A 1GUNA 3A7LA 2QKIC 2JA5B 4X3SA 1YHBA 1S3OA 1K8AC 4GZYC 2A8VA 3OYYA 1E22A 4B9WA 5C3EH 4DR4Q 3GTMB 3MXUA 1E1TA 4ULLA 1QZHA 2QDBA 2UU9L 2RHQB 1PH2A 3HOXB 4HJ8A 1YJWA 4ID6A 3QOLA 4DR3Q 4I7AA 4DR3L 3MXNA 4NDXA 1Q81C 3I73A 2JA7G 2LMCB 2RSOA 1D6EC 2Z6BA 3S1MB 1SNMA 1UEAB 2RDHA 3ZJYC 5T1GA 5LMNQ 3H0GG 5LMNL 1X3FA 1JJGA 2Y0SG 3OPOA 1TWAH 4RHRA 4DAPA 3S2HH 4DR7L 1BUVT 4A3DB 3RNUA 4LF5Q 2MO1A 4C3JB 4BY1H 4LF5L 1PFMA 2K5HA 4A3IH 4B3MQ 3S16H 3OTOQ 2CQAA 3NEMA 2KQ3A 2MPMA 4JI1Q 4HIOA 2UUBQ 4BXXG 4JI1L 5IOCA 4DNIA 2XWJB 3D6WA 1JQYD 1G2TA 2NZOA 2EVBA 2PI2A 3LGJA 1VQBA 5C4JH 3BJUA 4UP8A 1YIJA 1RCVD 2F0JA 2JA6G 4YCVA 2I5HA 3HOVG 2K1BA 4HSPA 1Y1WH 4KHVA 2A6EC 4YHHQ 4BS9A 2SDFA 4DU9A 4XQJA 1T9HA 1I50B 4OWXB 3I4LA 2QCPX 1PTOD 3Q6SA 2IPKD 4HN7A 5KRUA 3J7ZC 4LF7Q 5C6AA 3HOWH 1MKHA 4A3MG 1Q8KA 3D3RA 4P72A 2ZM6Q 2A6HC 1C9OA 3W1GA 1HRJA 1KTKA 2K5WA 3K5OA 3G4SA 5CV8A 4K5XA 1DYQA 4A3LH 1PTOF 1HPCA 2F4IA 5EPLA 2GN5A 2F0MA 3KBGA 1ESFA 2GA4B 2PZTA 2UXDL 4UPAA 2VXWA 5JJZA 1PRTD 2R7FA 1CZWA 3GTGH 5G3LD 2F0OA 1I5FA 2ZTCA 1NE3A 3CKIB 1VQAA 4EQOA 4XYQA 1D1KA 1CQVA 3HKZG 4GNXA 1PRTF 2XVSA 3G6JB 2B63B 5G3LF 1S5BD 1HHVA 2B2UC 1RD9D 1A63A 1ESRA 2A19A 4CGYB 1XNRL 5M5YH 4ILWA 1A6XA 2CCZA 1WTVA 4OIJA 3VYTA 1C7YA 1Q46A 2VW9A 1IXRA 3P1HA 1PHJA 3GTPB 2B2WA 3IRBA 2R7DA 2V4DA 4DN4M 5JJIA 1HA6A 1PV4A 3MC0B 3AFQA 3RLFA 2DN8A 5M3MH 2AUJD 3T1YL 2NN6G 3TEHB 2AQ2B 1DOLA 1X3EA 4CHTB 5M3FG 1UE1A 3M7GA 4FF3A 3HFZB 1Z6HA 4IPCA 1B1ZA 3KLSA 1KC8C 3J81c 2IX0A 1WTHA 2YTYA 5IWAL 1JWSD 1X56A 4KMUC 3VYRA 2QW7A 4XDXA 4NXNQ 3S17H 3RLNA 4JVZA 4AYBG 3NUCA 3FHWA 3I55A 3CQZH 1D5MC 2BDOA 1AFPA 1C0AA 2NVQB 4LFAQ 5H1SE 2B2TA 3UDFA 1EU4A 4FF4A 1OXTA 4RGMA 5GROA 5LHY1 4K6DA 4DV3L 4F87A 1K8MA 2VUMH 2F3IA 1EYDA 4O1NA 3CC2A 1D5ZC 3RZOH 3TZUA 4DV1L 1EYGA 2E2JB 1N32L 3IAYA 1ICWA 4L5RC 1B9MA 4JI5Q 3OOCA 4JI5L 5KNDA 4MTKA 3QIAA 1KXLA 2R61A 1A2UA 2GVBA 2CWAA 2F4VQ 1VQCA 4QUFA 2F4VL 4A3JB 3HG9A 2BH2A 3CMAA 1IL8A 4LF4L 2A69D 1Q7YC 3AU7A 1DJRD 4KKTA 3TREA 3M3YH 3HOYG 5C4XG 4NKLA 4ZYSA 4KTAA 4HJ7A 3SEBA 4B3ML 4YY3Q 2B39A 2R92H 3C2PA 3CMEA 4H7BA 3S1RH 2PQAB 5ELBA 2E76C 4F88A 4JI0Q 3DXJC 5E4WC 1QZGA 1AEXA 1BQQT 2KEEA 1FJGL 3GTJH 1VMCA 2B8GA 4POFA 4V0BA 2UXCL 2KCTA 1CI3M 4L5TA 1V1OA 3WDNA 4KHPL 4Y52H 3KBXA 4PMBA 3GP7A 2MNAA 4KK7A 5E3FA 2X6LA 4X66Q 2EJGC 1WTXA 3TDQA 3VDYA 2F0WA 3DWPA 4C3HH 2PYKA 4A3FH 3CW2C 2MO0A 5JOBA 1EZ8A 5IE8A 3QB3A 3H94A 4MHEA 1DCZA 5C5LA 5IY0A 1HNZL 5FLMH 3DM3A 3X3MA 4HAEA 4IPHA 2K50A 4IJLA 4KJOA 1GUWA 4L5SA 4A3CG 1EIGA 1DXMA 3CXCA 2Q8TA 3TN2A 2E8GA 1CKNA 1SROA 1F9RA 1LTRD 1SN8A 4IN3A 3IKJA 2J7ZA 3KF8A 1QJOA 4A3DH 4HCEA 2JA9A 3K7AB 2UUAL 3A7AB 2FJ2A 4DV6L 2JA7H 3V2TA 4FNFA 3J7AF 1G2SA 2F3WA 3H0GH 1DOMA 1WI5A 1S72A 2I5LX 5EPKA 1HNXQ 2A5HA 1WCMB 3I70A 5DAUA 1HNXL 4DV7Q 2NVYB 3K8AA 2LSSA 1H9KA 3HS0C 1SDFA 1AE3A 1NUCA 2ZXPA 3K57A 3M4YA 3NBHB 4B08A 2MFIA 1YHAA 2PI2E 5HGQA 1ML0D 2AWOA 4R4CA 3K81C 1KL9A 2C9OA 4XT3B 1K28A 4OX9Q 3I4NG 4WJ4A 3T1HL 2WB1B 1QCBD 4OX9L 4A3EG 1E7ZA 3SXHA 3ND8A 4RFBA 3ERQA 5CGKA 4C3IG 2JA6H 3HOVH 5JEAJ 4RH6A 1X3PA 2F3VA 4DR1L 1I4RA 2A6ED 2JEBI 2Q2HA 2AHOB 1JB7A 2AUKA 1TWHH 4V190 2B2YA 4LK1C 2PMZB 1GVPA 1CM9A 3ULLA 3S2HB 1MHWC 4OO1I 4BY1B 2A6HD 1IL2A 2B8FA 3RMHA 4DV4L 3TZDA 2JYOA 4B9XA 3A74A 3PF4A 3NELA 4ALPA 2ZTDA 2EIFA 3H6MA 1B3QA 3MA2B 4R4TA 5DM73 2ZXOA 4A3KG 4TKOB 5LL6X 5C4JB 1S5CD 2JXMB 1CSQA 3KK7A 2EDGA 3HRZC 4JBJA 1S5DD 1L0WA 4BA1I 2FXQA 3JAME 2XRSD 4JBWA 3CCVA 4K14A 1AZQA 3MEHA 3QO2A 1TS4A 2F1MA 1RHPA 5KNCA 2OQ0A 4DV0Q 4X3TA 4H13C 4DV0L 1PRTC 3PO3B 5EBDA 2KCMA 2RQXA 3GD7A 1HUNA 2SNSA 4JYAQ 3E9HA 4EX5A 1IYUA 1SYGA 2JQOA 4G7ZC 4DAYA 2L1BA 1AZPA 1RKNA 4ZCKA 1XMOL 4DGZA 2EYMA 2X69A 1GOZA 4B3TL 4IQZA 4OL7A 1LTGD 4DV2Q 4OGQC 4DV2L 5IYDG 5KYLA 3OSOA 1F2LA 4HMJA 2NTSA 1HUMA 3ER0A 3AEVA 4YCUA 3GV3A 1EIFA 1SNQA 4GOPC 1PH1A 3PMFA 1MD2D 1V1PB 1X54A 2KCCA 2IW3A 5FKAC 3TRZA 3J81i 1IBLQ 2F0FA 5DLQE 1CKMA 1U4LA 3KLRA 1TU2B 1M8AA 5IODA 4KN4C 2YTXA 1HTLD 4TRDA 2BA0A 4FP5D 2EY6A 2OXPA 2H1EA 2MGSA 5CBEE 1TT2A 3VR3A 3PIPA 3SK4A 2E2JH 2B3GA 2Z6KC 3NXWA 1K83H 5M3MB 2NWGA 2WB1E 4B3SQ 4OWWB 4G4KA 2DNCA 2FINB 1S4ZA 1NNXA 2AMCB 1GKHA 1HNWQ 1EQRA 1GUGA 3W1BA 4RCNA 1AH9A 4ZKBB 3A8JE 2PMZE 4U673 5C44G 3S17B 2N49A 2D9UA 1OXSC 4DPGA 4JV5L 4GLXA 3A56A 2E5LQ 4FXKC 5IYCG 1EY6A 4GKKL 2HDMA 3IL8A 2RBMA 3KFUA 5IT9E 2ALYB 4BBSB 4DR6L 4KJNA 3IFDA 1N8RC 4UP7A 4ZUJA 2I46A 2SEBD 1SEBD 1Y1VG 4ODGA 3L2PA 1SNDA 1JE5A 2MP1A 4K8IA 5ISRA 3I4MH 1WTQA 1ONLA 4LJZC 3FKIH 3VR5A 1IHZA 2E2HH 1GD7A 1JICA 3K5LA 2L11A 4DA2A 3BDLA 3E0EA 5BN4A 4FF2A 5IIFA 1BBXC 5AFWA 5IP7H 3BZDB 5C0XG 1HR0W 1ET9A 2DGYA 1L2FA 5ELEA 2KHSA 1SYFA 3UDXA 4X3UA 3M3YB 5M9OA 4KD4A 4JW0A 2K05A 4DAYB 2CH4W 2F0SA 4BY7G 4K0KL 3CF5A 3K7AH 1VCIA 5FLXE 1RTNA 1SE3A 5ELDA 1N34Q 3S1RB 1N34L 1FL0A 2L5TA 5AJ3L 1WTRA 1SLJA 3GTJB 4EGVA 4LWCA 1I4XA 3SK8A 1O7LA 2XN9C 4C1NI 2K5NA 2K04A 3J80E 1ENCA 1N36Q 1VQ8A 1QNKA 2IJ0A 1F2MA 3DMUA 2KCNA 1XWEA 2F0HA 2JA5G 1XPUA 3PUWA 4HTHA 3Q22A 3NE5B 4DR4L 2OTJA 4C3HB 2BE5C 4A3FB 3QG1A 4X64Q 1WYDA 1HFGA 1GJXA 1I3QH 4CBVA 3GDEA 1EQTA 2RCFA 3R93A 1EYCA 2K28A 4LUVA 3GTQB 5KGUA 3EA6A 4KY6A 2NVTH 2AKWB 1B44D 1PH6A 2IL8A 4GOPB 4LF6Q 5ELOA 2JSOA 3OWFA 3CU7A 4IZ8A 2BDNA 4C3IH 2N78A 2Q8RE 2JA7B 1Y8PB 1PZKD 3PIOA 2AWNA 3R8BA 3TP5A 3OTOL
chains in the Genus database with same CATH topology
2EE1A 1M4VA 2SNMA 3GO5A 3H0GB 3JAML 3U9OA 1G8ZD 2LFNA 2PW5A 3DWAA 2Y0SB 4IFDG 4G57A 4KI0A 2PZUA 3M85A 1STEA 1FGBD 3P20A 1R4QB 3PUXA 3EFXD 2WAQB 3URYA 1MGSA 3BYYB 5K36H 4KN7C 4ME5A 2EXZA 1G291 4J6HA 1JE4A 1BOSA 2JA6B 1GUOA 3NP8A 3HOVB 1KDCA 4HMIA 2A73B 1SMYC 4I65A 2XIWA 1FD7D 3TMEA 2NYZD 2Z8LA 4H0LC 1TWHB 3FEWX 5IGCA 4A3MB 2M9VA 1F77A 4L63B 2ID0A 1FNWA 1HTPA 1AN8A 1ZYRC 5D65A 3TP7A 4CKBA 5BN3A 1L0XB 2FFKB 3H3VC 3SE0A 5HGTA 1LT5D 1K8OA 3KLSX 4PQXA 1H9JA 2WIIB 3T53B 1STAA 5I9OA 1KAAA 3D4DA 1G6ZA 4IUTA 3HKZB 3HEJA 5I2YA 5JPMC 1S5ED 5I2XA 2EOTA 2E2IB 5EPJA 3RD4A 2OEOA 4BWGB 1O78A 2R6GA 2B2UA 4L6TB 3UI2A 3E6ZX 3LNNA 3VA7A 1SNPA 4DXGA 1WTOA 2L9HA 1C8CA 2F03A 3TSSA 5M3FB 4RGNA 1EY9A 4I7ZC 3DHQA 1KDAA 1D2BA 3NBHA 1O80A 2K7VA 3SK5A 2D62A 2Z4IA 1GHJA 4K5VA 3L3OC 4RCOA 4OIKA 3GV6A 3N6RA 4HR7B 5JEAH 2RDGA 1B4OA 3VYUA 4AYBB 1O7ZA 4U68A 5DM63 2WINB 1KNEA 1K83B 5CV6A 2IWHA 4M1UB 4J1MA 2G9DA 2JE6I 2M2LA 2EYLA 4TQUS 1J9OA 3NBIA 2QF7A 4M8AA 3K5MA 2EYJA 3A8IE 1WD1A 1SYCA 1YNNC 4F7XA 1HQMC 4DK0A 1SYDA 2HQEA 4KKSA 2YU9B 3PV0A 3H91A 2Q8IB 3Q23A 1MBYA 1CT1D 5C0XH 4OO1G 4DK1A 1CA5A 1JORA 5IGFA 4WRDA 1ILQA 3HOYB 4YIJA 3OMGA 1BR9A 4O42A 2VB3X 2L0CA 2HDLA 3K58A 4DNRB 3NPPA 3NSWA 3I4MB 2WKDA 1MSGA 3FKIB 3BG3A 2E2HB 3MVVA 1U4MA 1W6KA 4H44C 5I9PA 1DZ1A 1JCKB 1KLUD 3ITPA 4EQPA 3PUYA 2I07B 1RF2D 3MAQA 2NN6I 2BE5D 1DONA 3MWYW 3D4RA 2BCOA 4CJ2C 1XX8A 1EQVA 2N88A 3X3NA 4NP5A 5E4XA 1B53A 3BS1A 1V1PA 2EYFA 2PO4A 3MZ5A 4DXFA 1H9RA 1H9SB 4Q0FA 1TS5A 1S5FD 1ENAA 5CV5A 3C1FA 1VDZA 2AQ3B 1I4QA 4JK1C 2JEAI 1HFNA 1G91A 1EY0A 1QG7A 2PZWA 4IFDH 1OXUA 1TKWB 2F0VA 2F0DA 4Q5VA 4R9WA 3C46A 4KHZA 3VR6A 4WORA 1STBA 1I3QB 1EY5A 3OW7A 1LT3D 2K6AA 1LTTD 3OIQA 2NVTB 4WFN3 1J8IA 3I4NB 4C3IB 1FNUA 1I4PA 1F9SA 1Q8IA 3HOZB 1C48A 1LABA 1BF4A 3RUZA 1SMYD 5J22A 1JOOA 1V8QA 2B2VC 4ZK9B 1CQFA 2MHVA 1STYA 4IUNA 2RSNA 3WOEA 1NAPA 2EYPA 1KDBA 2O2LD 4N9TA 4N9PA 4ZLTF 1ZYRD 4C1NK 4KY5A 5C0XJ 2WKCA 1TIID 3PUVA 3K6OA 5D14A 3D6CA 1I6VC 2KEDA 4FVMA 4KD3A 1F2ZA 2OT2A 3GQBA 2KOLA 1ZKOA 2B2VA 3D4WA 4QUCA 1PYWD 5EBCA 5CC4A 1CZGA 3S14B 3F2UA 2L55A 3LWUA 1LTBD 1OXXK 5I6YA 3ONAB 2NN6H 1QE6A 3IFTA 3S15B 3AB9A 1F9PA 1DD2A 1JB3A 3O13A 2K03A 4L8JA 1RTOA 1LTSD 2E74C 1TQOA 3CHBD 2NVXB 1ZXTA 4FO2A 3HGBA 5CV9A 4ZRZA 4XYOA 3NTIA 1W6JA 1CTMA 3VR2A 1WD0A 3BVMA 5C3WA 5C4HA 1DM0B 1TS2A 3R3OA 1TVXA 2FMCA 1AW7A 3SK6A 1KLGD 4X3KA 2E75C 2MJ8A 3NWTA 5IGDA 3WOFA 2RVLA 2DY7A 3VA5A 1SJED 1TWGB 3LX0A 4LMQD 1A2TA 2PNRC 2KA7A 3N52A 3W3AA 3P7JA 4XT1B 1TWCB 3VYSA 2O5JC 5CORA 2KECA 4IFDJ 4FF1A 2F0NA 3T13A 3J7AV 1HQRD 5FO7B 1I6HB 1JOQA 5FK9C 2O4XA 1YNND 2RA4A 5D3IB 3U9SA 5ELCA 1EWHA 2Z1CA 2HCCA 1STNA 3D31A 1SE2A 1A3UA 4ZKCB 1B2TA 4Y7NB 3NTHA 3OMCA 4A3BB 1WTWA 3SVMA 1FR3A 1D1IA 1QOHA 1Y1VB 2EY5A 2RDFA 5DNFA 2EYHA 3EJIA 2F0QA 3NQIA 2DNEA 2HUGA 4NW2A 3A55A 5K5PA 2ZXRA 1E0BA 4XTCS 5COYA 1LACA 1U4RA 4Z9CB 5JPNC 3GTKB 3QWNA 1Q1EA 4C2MB 3OIPA 3S9WA 3NTKA 1Q1BA 4BY7B 3EVQA 5KNBA 4RGTA 1TR5A 3MXPA 4C56C 1SXTA 1EEID 3V96A 2A68C 4RAUC 2ICIA 4C3HG 4RA8A 1NR2A 5EKLA 2EZVA 3T56B 2A74C 4PV1C 2QEJC 1SFOB 1I4GA 1RJTA 3L9AX 5IGGA 3K0YA 3K5NA 2TSSA 1PFBA 2PPBC 2BA1A 1GHKA 4PNYA 4IURA 4C3JG 1SJHD 5A2QE 1AP0A 5JVH3 3A8KE 4EQNA 4ZUIA 5M5WB 4K6LA 1T5XD 2BOSA 3CRLC 2L4NA 1XXGA 1X3QA 1YNJC 3MXGA 1OXVA 2HCIA 4ZQ3A 1XYIA 1EOTA 4IUVA 2XWBB 4DAVA 5BN5A 4FYDA 4IUQA 5M5XB 1A3TA 1JC7A 4K8JA 2WP8J 3Q0AA 4XIGS 2RKSA 1H9MA 3FMCA 2KJXA 3DEPA 3V05A 2D2CC 1EY4A 5DEHA 5A35A 4CKCA 2F0IA 3DUZA 1IW7C 3M7NA 2JA8B 5HURA 5KEEA 3DM1A 1EY8A 3FPUB 5C0XI 4DF7A 2E2DC 1SNCA 5EJWA 1GXDC 2XRQD 1TWFB 3FVQA 1IYVA 3NK9A 1KNAA 1SYBA 3I90A 3PUZA 5ELFA 2F0EA 1JWMD 1HXYD 2B2WC 5CV4A 1NCVA 3SDZA 4HCSA 1U9RA 2JP1A 2F0GA 2IT1A 3OHXC 2NUCA 1QILA 5CMDA 1B50A 2VB2X 4IALA 3ND9A 1SSOA 4EVOA 3LWEA 3M4OB 2R93B 5CYUA 3MHBA 2ZT9C 1B9NA 2R7ZB 3Q24A 2EY2A 3HOUB 1EL0A 2F0LA 4KV6A 1UAPA 1SBBB 1H9SA 5IT9L 2B2TC 1JOKA 1JWUD 3DWQA 1SE4A 4IUPA 1EFID 2VNUD 3QJYA 1CA6A 2LKVA 4QIWB 1LTAD 2H4OA 2F0TA 3R2TA 4IFDI 1PZJD 2X6GA 3FRPB 4XQQA 2WV6D 1ENFA 1PZID 4F8MA 2CHBD 4XQNA 3EROA 1X32A 1QNUA 5FLXL 1Z7TA 2CW0C 3S2DB 1SYEA 2YYZA 5EKKA 3NQTA 4P2CB 5TSSA 4ABNA 1E2VA 4XXEA 1EWCA 1I4HA 2XNAC 3J80L 5J39A 3L7ZC 3BDOA 3NHHA 1PTOH 5FOBB 1U4PA 4QMGA 3BVGA 4DNTB 5C4XB 2IX1A 3K59A 4A3GB 2TMPA 4RKBA 4UAIA 1A3VA 2R3ZA 1DOKA 4KY7A 1CFMA 2PQEA 2FHTA 5EQ0A 1ET6A 4G7HC 2F0KA 5I6WA 3I8ZA 2CVRA 2QILA 5J1ZA 3VR4A 1Y8NB 4PMCA 2AQ1B 1GUTA 1UUPA 1LT6D 4ZAIA 3E0JA 4CJ1B 5A2QL 1STGA 1CHQD 4BBRB 3CRKC 3J81E 1ZEQX 5LL6S 2A68D 1O7YA 1BCPC 4DFAA 3PIP3 1VF7A 5C4ZA 5CV7A 4CJ0B 3OWEB 2PCFB 3QOJA 1EU3A 2K5DA 4HSVA 5IGEA 1MI2A 3NWSA 1OO9B 1Q3LA 3H09A 5JAVA 4R8IA 1XTCD 3MFYA 4A93B 3J7YW 3GTOB 1TY2A 1FYCA 4WJWA 4OHJA 1NSNS 1EY7A 1PXUA 2PW7A 1PDQA 2NZ1D 2M00A 2DY8A 5CR3A 3T51B 3I3CA 1V43A 1YNJD 5EKIA 2K32A 3BYTB 2B2YC 5JVG3 1HA5A 2FMMA 5C3EB 1II3A 1JR0D 2XSCA 1KABA 2EJFC 2D5DA 5NUCA 2G9HD 4NMZA 1WVLA 4A3EB 2O5IC 3EQLC 1GUSA 5FO8B 4QCLA 3PO2B 3FPPA 3T4AC 1STHA 3FDTA 2C5CA 4BA2I 1TY0A 5CBAE 2KVMA 2EY1A 1TWAB 1IW7D 1SAPA 3I72A 3AMUA 1ILPA 4A3IB 3S16B 3RZDB 1HCZA 2EJMA 1NR4A 1LT4D 5IGBA 1PTOC 3E5SA 4J8QA 3HP3A 5K36G 1RDPD 4A3KB 4TSSA 5F2DA 4E6IA 2LY7A 1TS3A 5E1FA 1EEFD 3BDCA 1MSHA 1VMPA 4KKUA 1PLFA 1R9TB 1Y1WB 1B3AA 3C3LA 3GTLB 5C5MA 1R4PB 4MN3A 3HOWB 4LAAA 4RWSC 2NBFA 1BXTA 4RKLA 1BO0A 3MTSA 2F0PA 1F9QA 1EIHA 1F2YA 4RGOS 3ZYYX 3GTGB 1CHPD 4K5WA 1UNSA 1PMRA 4K2LA 3PIO3 1LO5D 1LTID 1BCPB 3I91A 1L0YB 3S1NB 3SHLA 4S3SA 2NTTA 3G7LA 1E2ZA 3T16A 5M5YB 2Z4HA 1Y69U 1C4QA 4UDUC 1CK1A 2ICEC 3A54A 5EGTA 3W2DA 4PMWA 3KUPA 3TBIB 5I4DA 3TP8A 2EPBA 1Q12A 4R8NA 5T1IA 2IX3A 4MIUA 2WACA 1Z47A 2N55A 1BDOA 1T5EA 2CW0D 1SNOA 1D5XC 5D3DA 5C44B 3P75A 3MFGA 3BVZA 3S1QB 5JEAG 3TP6A 4QF4A 5FO9B 2MUYA 3CQZB 1WTPA 2K5QA 4OO1H 1IKLA 3J81L 4QB4A 1EZ6A 4FXGC 1LLRD 5C3XA 1PFNA 2VUMB 4FXDA 1Y8OB 2J4XA 1FNVA 2K33A 3C1EA 1BNZA 2A69C 5KYIA 1A15A 3RZOB 1EYAA 2LS01 2K01A 4IUUA 1LV9A 1IKMA 4G7OC 1Q90A 2ENBA 2SOBA 4HEDA 1PTOB 2J0TD 1BCPD 1E2WA 2F0UA 3D8GA 3R2IA 3HZXA 2R92B 2EYOA 3DEOA 1RODA 1VF5C 1QB5D 5KIXA 2L12A 3SR1A 4K2KA 1QWYA 1BCPF 2KUMA 4CKEA 4RHSA 1PRTB 2NB0A 2OF1A 1GUNA 3A7LA 2QKIC 2JA5B 4X3SA 4GZYC 4B9WA 3GTMB 3MXUA 4ULLA 2QDBA 3HOXB 4ID6A 3QOLA 3MXNA 4NDXA 3I73A 2LMCB 2RSOA 1D6EC 3S1MB 1SNMA 1UEAB 2RDHA 5T1GA 3OPOA 4RHRA 4DAPA 1BUVT 4A3DB 4C3JB 1PFMA 2CQAA 2KQ3A 2MPMA 5IOCA 2XWJB 3D6WA 1JQYD 1G2TA 2EVBA 1RCVD 2F0JA 2K1BA 4HSPA 4KHVA 2A6EC 4BS9A 2SDFA 4DU9A 4XQJA 1I50B 3I4LA 2QCPX 1PTOD 3Q6SA 2IPKD 4HN7A 5KRUA 5C6AA 3D3RA 2A6HC 1HRJA 1KTKA 2K5WA 3K5OA 5CV8A 4K5XA 1DYQA 1PTOF 1HPCA 2F4IA 5EPLA 2F0MA 3KBGA 1ESFA 2GA4B 2PZTA 2VXWA 5JJZA 1PRTD 1CZWA 5G3LD 2F0OA 3CKIB 4EQOA 4XYQA 1D1KA 1CQVA 1PRTF 2XVSA 3G6JB 2B63B 5G3LF 1S5BD 1HHVA 2B2UC 1RD9D 1ESRA 4CGYB 4ILWA 1A6XA 1WTVA 4OIJA 3VYTA 3P1HA 3GTPB 2B2WA 4DN4M 2V4DA 1HA6A 3MC0B 3RLFA 2DN8A 2AUJD 2NN6G 2AQ2B 1DOLA 4CHTB 4FF3A 3M7GA 1Z6HA 1B1ZA 3KLSA 2IX0A 1JWSD 4KMUC 3VYRA 4XDXA 3NUCA 1D5MC 2BDOA 1AFPA 2NVQB 2B2TA 1EU4A 4FF4A 1OXTA 4RGMA 5LHY1 4K6DA 4F87A 1K8MA 1EYDA 4O1NA 1D5ZC 3TZUA 2E2JB 3IAYA 1ICWA 1B9MA 3OOCA 5KNDA 3QIAA 2R61A 1A2UA 4QUFA 4A3JB 3HG9A 1IL8A 2A69D 3AU7A 1DJRD 4KKTA 4NKLA 4ZYSA 4KTAA 3SEBA 2B39A 3C2PA 4H7BA 5ELBA 2E76C 4F88A 3DXJC 5E4WC 1AEXA 1BQQT 2KEEA 1VMCA 2B8GA 4V0BA 1CI3M 1V1OA 3WDNA 3KBXA 4PMBA 3GP7A 4KK7A 5E3FA 2X6LA 2EJGC 1WTXA 3TDQA 2F0WA 3DWPA 2PYKA 5JOBA 1EZ8A 3QB3A 3H94A 4MHEA 1DCZA 5C5LA 3X3MA 4HAEA 4KJOA 1GUWA 1EIGA 1DXMA 2Q8TA 3TN2A 1F9RA 1LTRD 4IN3A 3IKJA 2J7ZA 3KF8A 1QJOA 4HCEA 3K7AB 3A7AB 2FJ2A 3V2TA 4FNFA 3J7AF 1G2SA 2F3WA 1DOMA 5EPKA 2A5HA 1WCMB 3I70A 5DAUA 2NVYB 1H9KA 3HS0C 1SDFA 1NUCA 2ZXPA 3K57A 3M4YA 4B08A 1ML0D 2AWOA 2C9OA 4XT3B 2WB1B 1QCBD 3SXHA 3ND8A 4RFBA 3ERQA 5CGKA 4C3IG 5JEAJ 4RH6A 1X3PA 2F3VA 1I4RA 2A6ED 2JEBI 2AUKA 4V190 2B2YA 4LK1C 2PMZB 3S2HB 1CM9A 4OO1I 4BY1B 2A6HD 2B8FA 3RMHA 3TZDA 2JYOA 4B9XA 3H6MA 3MA2B 5DM73 2ZXOA 4TKOB 5LL6X 5C4JB 1S5CD 2JXMB 3KK7A 2EDGA 3HRZC 1S5DD 4BA1I 3JAME 2XRSD 4JBWA 4K14A 1AZQA 3MEHA 3QO2A 1TS4A 2F1MA 1RHPA 5KNCA 4X3TA 4H13C 1PRTC 3PO3B 5EBDA 2RQXA 3GD7A 1HUNA 2SNSA 1IYUA 1SYGA 4G7ZC 4DAYA 2L1BA 1AZPA 1RKNA 4DGZA 2EYMA 2X69A 1GOZA 4IQZA 4OL7A 1LTGD 4OGQC 5KYLA 3OSOA 1F2LA 4HMJA 2NTSA 1HUMA 3GV3A 1SNQA 3PMFA 1MD2D 1V1PB 2KCCA 5FKAC 2IW3A 2F0FA 1U4LA 3KLRA 1TU2B 1M8AA 5IODA 4KN4C 1HTLD 4TRDA 2BA0A 4FP5D 2EY6A 2OXPA 2H1EA 5CBEE 2MGSA 1TT2A 3VR3A 3SK4A 3NXWA 5M3MB 2NWGA 4G4KA 2DNCA 2FINB 1S4ZA 1GUGA 4RCNA 4ZKBB 3A8JE 4U673 3S17B 2D9UA 1OXSC 3A56A 4FXKC 1EY6A 2HDMA 3IL8A 2RBMA 5IT9E 4BBSB 4KJNA 3IFDA 4ZUJA 2I46A 2SEBD 1SEBD 4ODGA 1SNDA 4K8IA 2MP1A 5ISRA 1WTQA 1ONLA 4LJZC 3VR5A 1IHZA 1JICA 3K5LA 2L11A 4DA2A 3BDLA 5BN4A 4FF2A 5IIFA 1BBXC 5AFWA 3BZDB 5C0XG 1ET9A 5ELEA 2KHSA 1SYFA 4X3UA 3M3YB 5M9OA 4KD4A 2K05A 2F0SA 1VCIA 5FLXE 1RTNA 1SE3A 5ELDA 3S1RB 2L5TA 1WTRA 3GTJB 4EGVA 1I4XA 3SK8A 1O7LA 2XN9C 4C1NI 2K04A 3J80E 1ENCA 1QNKA 2IJ0A 1F2MA 3DMUA 2KCNA 1XWEA 2F0HA 3PUWA 4HTHA 3Q22A 3NE5B 4C3HB 2BE5C 4A3FB 3QG1A 1HFGA 1GJXA 4CBVA 1EQTA 3R93A 1EYCA 2K28A 3GTQB 5KGUA 3EA6A 4KY6A 1B44D 2IL8A 2JSOA 3OWFA 3CU7A 4IZ8A 2BDNA 2Q8RE 2JA7B 1Y8PB 1PZKD 2AWNA 3R8BA 3TP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSG A;  2EE1 A;  2FMM A;  1NCV A;  2FJ2 A;  1HUN A;  1J8I A;  4HCS A;  2MP1 A;  3I91 A;  1U4M A;  2RSN A;  1HRJ A;  2JP1 A;  1DZ1 A;  1WTO A;  1NAP A;  1U4P A;  1WTQ A;  2KEC A;  2L1B A;  1RJT A;  1AZP A;  3G7L A;  1G2S A;  3DEO A;  2L9H A;  1WVL A;  1C8C A;  1DOM A;  1JIC A;  1ROD A;  5EPK A;  4ZLT F;  5EPL A;  2L11 A;  2L12 A;  5CMD A;  1B50 A;  4UAI A;  1PFB A;  2X69 A;  2R3Z A;  1DOK A;  1SDF A;  3KUP A;  5D14 A;  1BBX C;  1ICW A;  2KUM A;  5AFW A;  2RA4 A;  1SSO A;  2KED A;  4IUR A;  3LWE A;  2EPB A;  2FHT A;  1DON A;  1O80 A;  2VXW A;  3MWY W;  4CJ2 C;  1MGS A;  5JJZ A;  3FDT A;  5EQ0 A;  1AP0 A;  5T1I A;  1F2L A;  2KOL A;  1XX8 A;  5CBA E;  2B2V A;  2KVM A;  1HUM A;  4QUC A;  2N88 A;  3I8Z A;  2CVR A;  3GV3 A;  4OIK A;  1JE4 A;  1ML0 D;  1SAP A;  3GV6 A;  4X3U A;  1EL0 A;  4X3S A;  5E4X A;  1ILP A;  1B4O A;  1B53 A;  4QUF A;  2N55 A;  4XT3 B;  2HCC A;  3F2U A;  2K05 A;  1O7Z A;  1IL8 A;  4ZKC B;  1B2T A;  4U68 A;  1RTN A;  2L4N A;  4ZAI A;  2B2T C;  4CJ1 B;  1U4L A;  1NR4 A;  2XIW A;  1HFN A;  1X3Q A;  1M8A A;  1HHV A;  2B2U C;  2NYZ D;  3ONA B;  1WTW A;  3SVM A;  2HCI A;  1X3P A;  1ESR A;  1KNE A;  3HP3 A;  1QE6 A;  1WTR A;  1XYI A;  1EOT A;  1O7Y A;  2H1E A;  2MGS A;  5CBE E;  4IUV A;  4OIJ A;  4IUP A;  1WTV A;  1F9P A;  2M2L A;  5E4W C;  4IUQ A;  2K04 A;  2NWG A;  2K03 A;  2KEE A;  5DNF A;  1CA6 A;  1MSH A;  1QNK A;  1VMP A;  1RTO A;  2B2W A;  2B2Y A;  1J9O A;  2RSO A;  4CJ0 B;  1PLF A;  1WTP A;  1CM9 A;  1VMC A;  4DN4 M;  5T1G A;  1G91 A;  1HA6 A;  1B3A A;  1IKL A;  4HSV A;  5D65 A;  5COR A;  1QG7 A;  1ZXT A;  2HUG A;  4NW2 A;  2FFK B;  2FIN B;  3TZD A;  3KBX A;  1S4Z A;  2JYO A;  4R9W A;  1WD1 A;  1MI2 A;  3DEP A;  1DOL A;  1E0B A;  4MN3 A;  2X6L A;  1PFN A;  1Q3L A;  5COY A;  4RWS C;  1WD0 A;  2X6G A;  1PFM A;  1WTX A;  1U4R A;  1HFG A;  4R8I A;  1TVX A;  4ZKB B;  2MPM A;  3H91 A;  3DM1 A;  3FPU B;  4X3K A;  1EQT A;  2D9U A;  3D6W A;  1BNZ A;  1G6Z A;  2MJ8 A;  1BO0 A;  4IUT A;  3R93 A;  1X32 A;  1A15 A;  2K28 A;  4MHE A;  4XDX A;  1CA5 A;  1G2T A;  2RVL A;  3MTS A;  2K01 A;  1F9Q A;  2DY7 A;  1ILQ A;  4IUU A;  5EJW A;  2IL8 A;  4HAE A;  1EIH A;  1LV9 A;  2EOT A;  1GUW A;  1IKM A;  1AZQ A;  4LMQ D;  2HDM A;  3IL8 A;  2K1B A;  3QO2 A;  1F9S A;  1EIG A;  1PDQ A;  4O42 A;  4RAU C;  2NZ1 D;  5EPJ A;  2DY8 A;  1RHP A;  1KNA A;  2HDL A;  3N52 A;  2Q8T A;  4X3T A;  1F9R A;  3TN2 A;  4RA8 A;  1BF4 A;  2SDF A;  1NR2 A;  2B2T A;  2BDN A;  3I3C A;  3I90 A;  3IFD A;  2J7Z A;  2B2U A;  2Q8R E;  3P7J A;  4HED A;  4XT1 B;  2B2V C;  3Q6S A;  5EKI A;  3UI2 A;  2B2W C;  2B2Y C;  4ZK9 B; 
#chains in the Genus database with same CATH topology
 2EE1 A;  1M4V A;  4X65 Q;  1P8L A;  2SNM A;  3GO5 A;  3SGI A;  3K0X A;  2UUB L;  3H0G B;  3JAM L;  3U9O A;  1G8Z D;  2LFN A;  2PW5 A;  3DWA A;  3PF5 A;  2Y0S B;  4IFD G;  1SE8 A;  4G57 A;  1I94 Q;  1HZA A;  4KI0 A;  3U4V A;  2PZU A;  1XNQ Q;  3M85 A;  1STE A;  1FGB D;  3P20 A;  1R4Q B;  3PUX A;  4OON A;  3EFX D;  2WAQ B;  1J6Q A;  4YHH L;  4P75 A;  3URY A;  1MGS A;  2QEX A;  1YHQ A;  3BYY B;  5K36 H;  4KN7 C;  4UY8 C;  4ME5 A;  2EXZ A;  1G29 1;  4LF7 L;  4J6H A;  2JA8 G;  3RN2 A;  1YNX A;  1JE4 A;  2Z0S A;  5IP9 G;  4R4O A;  1JT8 A;  4JPB W;  1IBK Q;  1BOS A;  3PO3 H;  2ZM6 L;  1IBK L;  1E3P A;  2H5X A;  2JA6 B;  1GUO A;  2RHS B;  3NP8 A;  3HOV B;  1KDC A;  4HMI A;  2A73 B;  1SMY C;  4I65 A;  2XIW A;  1FD7 D;  3TME A;  2NYZ D;  1X65 A;  2Z8L A;  1PA6 A;  4H0L C;  1TWH B;  3FEW X;  5IGC A;  4A3M B;  2PQA A;  4LW1 A;  1K0S A;  3JC6 6;  2M9V A;  1F77 A;  1QVF A;  1P16 A;  4L63 B;  2ID0 A;  3KDF B;  1FNW A;  4JI8 Q;  3M4P A;  1HTP A;  1AN8 A;  2WFW A;  3S15 H;  3A5Z B;  2VL6 A;  1ZYR C;  5D65 A;  3TP7 A;  4CKB A;  2MQH A;  2IY5 B;  5BN3 A;  1L0X B;  1D7Q A;  2FFK B;  3H3V C;  2BH8 A;  2B63 G;  3SE0 A;  5HGT A;  1LT5 D;  1K8O A;  3KLS X;  4OEM B;  4PQX A;  1H9J A;  2WII B;  4LUO A;  3T53 B;  2Q2U A;  1ASZ A;  1STA A;  2ES2 A;  4CDF C;  5I9O A;  3UDI A;  1KAA A;  3D4D A;  3A0J A;  2R93 G;  1G6Z A;  4IUT A;  3HKZ B;  3HEJ A;  5I2Y A;  1PH4 A;  2R7Z G;  3HOU G;  5JPM C;  1S5E D;  5I2X A;  2EOT A;  4H02 A;  2E2I B;  1B70 B;  1L1O C;  5EPJ A;  3RD4 A;  2OEO A;  4BWG B;  1TWG H;  1O78 A;  2R6G A;  3CP0 A;  5GQO A;  2B2U A;  4MNO A;  3CCQ A;  4L6T B;  3UI2 A;  3DLL A;  3E6Z X;  1VQF A;  4JC0 A;  3LNN A;  3VA7 A;  1SNP A;  4DXG A;  3RR5 A;  1WTO A;  4NXN L;  3G71 A;  2L9H A;  1C8C A;  2F03 A;  3TSS A;  5M3F B;  4RGN A;  3W5O A;  1EY9 A;  4I7Z C;  5IYB G;  4AQY Q;  3DHQ A;  1VQ9 A;  4MTN A;  1I6H H;  1KDA A;  1D2B A;  1L1O A;  4LFA L;  3NBH A;  1O80 A;  2K7V A;  3SK5 A;  2D62 A;  2UUC Q;  2Z4I A;  1GHJ A;  4K5V A;  4BBS H;  3L3O C;  4RCO A;  4OIK A;  3GV6 A;  3N6R A;  4HR7 B;  5JEA H;  2RDG A;  1B4O A;  3VYU A;  4AYB B;  3F1Z A;  1O7Z A;  1EFW A;  1WOC A;  1UWV A;  4U68 A;  1NY4 A;  3KJP A;  4X62 Q;  1IYJ B;  2WAQ E;  1UE7 A;  5DM6 3;  5GAD C;  3KJO A;  1VQL A;  2WIN B;  1KNE A;  1K83 B;  1K9M C;  4Y7N H;  5CV6 A;  2IWH A;  1JJ2 A;  4A3B H;  4M1U B;  4J1M A;  2G9D A;  2JE6 I;  2M2L A;  1HR0 Q;  1Y1V H;  2EYL A;  3UE0 A;  1KD1 C;  4TQU S;  1J9O A;  3NBI A;  4DR2 Q;  1X3G A;  2QF7 A;  4M8A A;  3K5M A;  2EYJ A;  3J7A 5;  3F2D A;  3A8I E;  1IBM Q;  1WD1 A;  1SYC A;  1YNN C;  4F7X A;  1HQM C;  4A3G G;  4DK0 A;  1SYD A;  5FJ8 G;  5LMU Q;  5LMU L;  4YY3 L;  2HQE A;  4KKS A;  2YU9 B;  1HZB A;  3PV0 A;  3H91 A;  2Q8I B;  4JI7 Q;  1YJ9 A;  3Q23 A;  1MBY A;  1CT1 D;  5C0X H;  4OO1 G;  1SR3 A;  4OEL B;  4DK1 A;  1CA5 A;  4JI0 L;  1JOR A;  5IGF A;  4LF8 Q;  4WRD A;  4KLK A;  1ILQ A;  3HOY B;  4YIJ A;  3OMG A;  4A76 A;  1BR9 A;  1Y14 B;  4R4Q A;  4O42 A;  2VB3 X;  4PG3 A;  2L0C A;  2HDL A;  3STB C;  3K58 A;  3E3X A;  3ULP A;  2JN4 A;  4BBR G;  4X66 L;  1XMQ Q;  4DNR B;  3NPP A;  3MEF A;  3NSW A;  3I4M B;  1XMQ L;  3HKZ E;  2WKD A;  1MSG A;  3FKI B;  3BG3 A;  2E2H B;  3MVV A;  1U4M A;  1W6K A;  4H44 C;  5I9P A;  2B29 A;  1DZ1 A;  1JCK B;  1KLU D;  3TS0 A;  1K8G A;  4AH6 A;  3D0F A;  3ITP A;  3JAM c;  3GTQ H;  4EQP A;  3PUY A;  1SFO H;  2I07 B;  1RF2 D;  3MAQ A;  4A75 A;  2NN6 I;  1XPR A;  1DGS A;  2BE5 D;  1DON A;  3MWY W;  3D4R A;  2BCO A;  4CJ2 C;  1XX8 A;  1EQV A;  2CH4 A;  2N88 A;  4A93 G;  3FP9 A;  3X3N A;  5EAY A;  4NP5 A;  5E4X A;  1B53 A;  1O7I A;  1V1P A;  2EYF A;  3BS1 A;  3KOJ A;  4JOI C;  2PO4 A;  3MZ5 A;  4DXF A;  1H9R A;  1H9S B;  1PH8 A;  5GAG C;  2CWP A;  4GN5 A;  4Q0F A;  4DK3 C;  1NBW A;  5M5W H;  1BVS A;  1WCM G;  3KYH C;  5GAE C;  1TS5 A;  4DV7 L;  4DR5 Q;  1S5F D;  1ENA A;  5CV5 A;  1L1O B;  4HIK A;  3C1F A;  1VDZ A;  4NB3 A;  2AQ3 B;  1I4Q A;  4BXX H;  4JK1 C;  5C3E G;  2JEA I;  1HFN A;  1G91 A;  5BR8 Q;  1EY0 A;  3PSI A;  1QG7 A;  2PZW A;  4EQ5 A;  4IFD H;  5M5X H;  1Q82 C;  1OXU A;  1TKW B;  2F0V A;  2F0D A;  2WB1 G;  4GLA C;  4Q5V A;  4R9W A;  3C46 A;  4KHZ A;  3VR6 A;  4WOR A;  1STB A;  1PH3 A;  1I3Q B;  1EY5 A;  3OW7 A;  3S24 A;  1LT3 D;  2K6A A;  2HT1 A;  1LTT D;  3OIQ A;  3PO2 G;  2NVT B;  4WFN 3;  1J8I A;  3I4N B;  1YVC A;  3M4Q A;  2Q2I A;  4A3M H;  2JA8 H;  2G5D A;  4BY1 G;  4C3I B;  1FNU A;  3J81 j;  1I4P A;  4O2D A;  1F9S A;  1Q8I A;  4A3I G;  1G6P A;  3HOZ B;  1C48 A;  1LAB A;  1VQI A;  1TWF H;  1BF4 A;  3RUZ A;  1SMY D;  5J22 A;  1JOO A;  4N8F A;  1V8Q A;  2B2V C;  4AIM A;  4ZK9 B;  1CQF A;  2MHV A;  5LMN W;  1STY A;  4IUN A;  2RSN A;  3WOE A;  3U58 A;  1MJC A;  1NAP A;  3EN2 A;  2HHH Q;  2EYP A;  1KDB A;  2HHH L;  2O2L D;  1Y1W G;  4N9T A;  4N9P A;  4ZLT F;  1ZYR D;  4C1N K;  3EBE A;  4KY5 A;  4YWM A;  5C0X J;  3CD6 A;  2WKC A;  1KIX A;  1TII D;  3PUV A;  3K6O A;  1VQE A;  2Z9H A;  3D6C A;  5D14 A;  1I6V C;  3HOW G;  2KED A;  3PQI A;  4FVM A;  1F2Z A;  4KD3 A;  2OT2 A;  4R4I A;  3GQB A;  2E2I H;  2KOL A;  1ZKO A;  3B6Y A;  2B2V A;  3D4W A;  4QUC A;  4QJF A;  1PYW D;  4GKJ Q;  5EBC A;  3M4O H;  4JYA L;  5CC4 A;  1CZG A;  5GAH C;  3S14 B;  1WJJ A;  3F2U A;  2L55 A;  3LWU A;  1LTB D;  4RMF A;  2R7Z H;  3F8T A;  1OXX K;  4IOC A;  3BZC A;  5I6Y A;  3ONA B;  2OCE A;  4X6A H;  1VQD A;  2NN6 H;  1QE6 A;  3IFT A;  5M3F H;  3S15 B;  3AB9 A;  1JJC B;  1F9P A;  1DD2 A;  4QY7 A;  1JB3 A;  3O13 A;  2HIV A;  2K03 A;  4L8J A;  4TVA B;  1RTO A;  1LTS D;  2E74 C;  1TQO A;  3CHB D;  3CCL A;  1HH2 P;  2NVX B;  1BKB A;  2VQE Q;  1ZXT A;  4FO2 A;  1IBL L;  3HGB A;  5CV9 A;  2OTL A;  4ZRZ A;  4O0A A;  1VQP A;  4XYO A;  3NTI A;  1W6J A;  1CTM A;  3VR2 A;  1WD0 A;  4WJ3 M;  3BVM A;  5C3W A;  5C4H A;  1DM0 B;  1TS2 A;  4LFB Q;  3R3O A;  1TVX A;  2FMC A;  4LFB L;  1AW7 A;  4OWT B;  1YIT A;  3SK6 A;  1KLG D;  4L5Q A;  3TS2 A;  4X3K A;  2E75 C;  2F52 A;  2MJ8 A;  3NWT A;  3I2Z A;  5IGD A;  3WOF A;  4B3S L;  2RVL A;  2ZJR A;  1SRU A;  2DY7 A;  3VA5 A;  1SJE D;  4GOP A;  1TWG B;  1VQG A;  3LX0 A;  1X9N A;  4LMQ D;  3F2C A;  3S2D H;  1A2T A;  2PNR C;  2KA7 A;  3N52 A;  4R1J A;  1H95 A;  3W3A A;  1VS0 A;  3P7J A;  4XT1 B;  1HNW L;  1TWC B;  3VYS A;  2O5J C;  2KEC A;  5COR A;  4IFD J;  4FF1 A;  4IJH A;  4PZ8 A;  2F0N A;  4DAM A;  2VQF Q;  2YU9 H;  2Z6K A;  3T13 A;  3J7A V;  1HQR D;  5FO7 B;  1I6H B;  1JOQ A;  5FK9 C;  3AFP A;  2O4X A;  2E5L L;  3A5U A;  3ERS X;  3HOY H;  1YNN D;  5C4X H;  2OQK A;  2RA4 A;  5D3I B;  1LUZ A;  2VUM G;  3BZK A;  3U9S A;  4CDE C;  4LFC Q;  5ELC A;  2RCN A;  1EWH A;  2Z1C A;  3PGZ A;  2HCC A;  1STN A;  3D31 A;  1SE2 A;  1A3U A;  4ZKC B;  1B2T A;  4Y7N B;  1V1Q A;  3NTH A;  3OMC A;  1VQH A;  4A3B B;  3CC4 A;  1WTW A;  3SVM A;  1FR3 A;  2N3S A;  1JMC A;  3HOZ H;  1D1I A;  1QOH A;  1Y1V B;  2EY5 A;  4JBM A;  2RDF A;  3STB D;  1N33 Q;  3CPF A;  3CCM A;  1VQ7 A;  3H3V H;  1N9W A;  5DNF A;  3KDF A;  2EYH A;  3NEN A;  3EJI A;  4JI6 Q;  2F0Q A;  3WWV A;  4JI6 L;  1MJE A;  3NQI A;  2DNE A;  2QGQ A;  2HUG A;  4NW2 A;  3I7F A;  2R92 G;  3A55 A;  5K5P A;  2ZXR A;  3ULJ A;  4JG2 A;  1E0B A;  4XTC S;  5COY A;  1LAC A;  2ZJQ A;  4A3C H;  1U4R A;  4Z9C B;  3PCO B;  5JPN C;  3GTK B;  3QWN A;  1Q1E A;  4C2M B;  3CC7 A;  3OIP A;  3S9W A;  3JAM i;  3NTK A;  1PH7 A;  1Q1B A;  1V9P A;  4B3R Q;  1N36 L;  4BY7 B;  3EVQ A;  4IPD A;  4A93 H;  5KNB A;  4RGT A;  3GTO H;  4UP9 A;  1TR5 A;  3MXP A;  3G6E A;  4C56 C;  2VS1 A;  3K80 C;  1SXT A;  1EEI D;  3V96 A;  2OWO A;  2A68 C;  4RAU C;  1QUQ B;  2IHF A;  1KAW A;  2ICI A;  4C3H G;  4RA8 A;  1NR2 A;  5EKL A;  1KQS A;  4A3F G;  2K52 A;  2EZV A;  4X64 L;  3HOX G;  3T56 B;  1B7Y B;  2A74 C;  1M90 C;  3K7U C;  1CSP A;  3EIV A;  4PV1 C;  2QEJ C;  4FDB A;  1SFO B;  1I4G A;  1A8V A;  1RJT A;  3L9A X;  1U0L A;  3AYH B;  5IGG A;  3K0Y A;  3I4N H;  3K5N A;  2TSS A;  2UU9 Q;  1PYB A;  4LF6 L;  1PFB A;  4A3E H;  2PPB C;  2BA1 A;  4A3D G;  1GHK A;  4PNY A;  4IUR A;  4C3J G;  1SJH D;  2CFM A;  5A2Q E;  1VQK A;  1AP0 A;  2HQL A;  1OTC A;  2HIX A;  5JVH 3;  3A8K E;  4X65 L;  3PO2 H;  4EQN A;  4ZUI A;  5M5W B;  3CCE A;  3RN5 A;  4K6L A;  1T5X D;  2BOS A;  4CDD C;  5ELN A;  4DR7 Q;  1UE6 A;  3CRL C;  4LUZ A;  1I94 L;  2L4N A;  1XXG A;  1X3Q A;  1YNJ C;  1XNQ L;  3MXG A;  1OXV A;  2HCI A;  4ZQ3 A;  3RZD H;  1XYI A;  1EOT A;  2WAQ G;  4GLV B;  2XWB B;  4IUV A;  4DAV A;  5BN5 A;  4FYD A;  4IUQ A;  4JI2 Q;  5M5X B;  1A3T A;  1JC7 A;  4JI2 L;  4DK6 C;  4A3K H;  4K8J A;  3TQY A;  2WP8 J;  3Q0A A;  4XIG S;  2QA4 A;  2RKS A;  3M9B A;  1NMG A;  4YCW A;  1H9M A;  3FMC A;  1R9T H;  1G51 A;  2KJX A;  3DEP A;  3V05 A;  3U4Z A;  3S14 H;  2D2C C;  3KF6 B;  1EY4 A;  5DEH A;  3GTL H;  5A35 A;  4CKC A;  2F0I A;  3DUZ A;  1IW7 C;  3M7N A;  2JA8 B;  5HUR A;  5KEE A;  2DUD A;  1VQM A;  3DM1 A;  1EY8 A;  3FPU B;  5C0X I;  4GNX C;  1YEZ A;  4DF7 A;  4JI8 L;  2E2D C;  1SNC A;  5EJW A;  2D0P A;  1GXD C;  2ASB A;  4LNQ A;  2XRQ D;  1TWF B;  3F2B A;  1CUK A;  1FGU A;  3FVQ A;  3I56 A;  1RIP A;  1IYV A;  3NK9 A;  1KNA A;  2NVX H;  1SYB A;  2UXD Q;  3I90 A;  3PUZ A;  1BBW A;  4P74 A;  5ELF A;  2F0E A;  1JWM D;  1HXY D;  2B2W C;  2JJQ A;  5CV4 A;  1NCV A;  3SDZ A;  2YTV A;  4HCS A;  5IYD H;  1U9R A;  2JP1 A;  2F0G A;  2IT1 A;  3OHX C;  4PZ6 A;  1KRS A;  2NUC A;  1QIL A;  3S1N H;  4QQB X;  5CMD A;  1B50 A;  2VB2 X;  2CQO A;  1XNR Q;  4IAL A;  1EWI A;  1K73 C;  1E1O A;  3ND9 A;  3U50 C;  1SSO A;  4EVO A;  3LWE A;  2KHI A;  1QVG A;  3M4O B;  5CYU A;  2R93 B;  3MHB A;  2ZT9 C;  4CDC C;  1B9N A;  2R7Z B;  3Q24 A;  2EY2 A;  4DKA C;  3CAM A;  3HOU B;  1EL0 A;  2F0L A;  1TWC H;  3AQQ A;  4KV6 A;  4QGU A;  1UAP A;  3T1Y Q;  1SBB B;  1H9S A;  5IT9 L;  2QDL A;  2B2T C;  1JOK A;  1PYS B;  4AQY L;  3ICE A;  3J80 i;  2N8N A;  4A4I A;  1JWU D;  5IWA Q;  3DWQ A;  1SE4 A;  3MXN B;  4IUP A;  1EFI D;  2VNU D;  2Y0S E;  2UUC L;  3QJY A;  1CA6 A;  5C44 H;  2LKV A;  4QIW B;  3S1Q H;  1PFS A;  1LTA D;  2H4O A;  1XPO A;  2F0T A;  3R2T A;  5JJK A;  4IFD I;  1PZJ D;  3Q8D A;  5IYC H;  4X62 L;  2X6G A;  3FRP B;  4XQQ A;  1Z9F A;  2WV6 D;  1GM5 A;  2EXD A;  1ENF A;  4DV3 Q;  1EQQ A;  1PZI D;  4F8M A;  2CHB D;  4XQN A;  5HY6 A;  3ERO A;  1HR0 L;  1X32 A;  1QNU A;  2XGT A;  5FLX L;  1Z7T A;  4HJA A;  2CW0 C;  3S2D B;  4HJ5 A;  1SYE A;  1BBU A;  2YYZ A;  5EKK A;  4DR2 L;  3NQT A;  4DV1 Q;  4A3J G;  3I4O A;  1N32 Q;  4P2C B;  5TSS A;  1IBM L;  4ABN A;  4UHV A;  1E2V A;  1EWC A;  1I4H A;  2XNA C;  4XXE A;  3CCS A;  3J80 L;  5J39 A;  2EQS A;  2KEN A;  4DUY Q;  3L7Z C;  3BDO A;  4DUY L;  2VZA A;  1IZ6 A;  4JI7 L;  3NHH A;  1VQN A;  1YZ6 A;  1PTO H;  1RL2 A;  5FOB B;  3GTK H;  1NMF A;  4LF4 Q;  1U4P A;  4C2M H;  4P71 A;  1D8L A;  4LF8 L;  2KBN A;  2LXK A;  3BVG A;  4QMG A;  4DNT B;  5C4X B;  2IX1 A;  3K59 A;  4DUZ Q;  4A3G B;  2TMP A;  4DUZ L;  4BY7 H;  4RKB A;  1ICF B;  4UAI A;  2K14 A;  1A3V A;  2R3Z A;  1DOK A;  4KY7 A;  2PNH A;  1CFM A;  2PQE A;  2FHT A;  2ATW A;  5EQ0 A;  1U5K A;  1ET6 A;  1LTL A;  1FJG Q;  4G7H C;  2F0K A;  3I4M G;  5I6W A;  3I8Z A;  2CVR A;  2QIL A;  3FKI G;  1K3R A;  5J1Z A;  2UXC Q;  3VR4 A;  2YV5 A;  1Y8N B;  2AQ1 B;  1GUT A;  4PMC A;  4KHP Q;  4GNX B;  1CKO A;  1UUP A;  2ZJP A;  1LT6 D;  4ZAI A;  2JA5 H;  3E0J A;  4CJ1 B;  5A2Q L;  1STG A;  5IP7 G;  1CHQ D;  4BBR B;  3CRK C;  3J81 E;  1ZEQ X;  5LL6 S;  3GTM H;  4YWL A;  2A68 D;  1O7Y A;  4JI4 Q;  2DJF C;  1BCP C;  4DFA A;  3PIP 3;  4JI4 L;  1VF7 A;  3HOX H;  1NJI C;  2KHJ A;  3QR8 A;  5C4Z A;  1HNZ Q;  2C35 B;  1VQJ A;  5CV7 A;  4CJ0 B;  3OWE B;  1HJP A;  2PCF B;  3QOJ A;  1EU3 A;  2K5D A;  4HSV A;  3UDG A;  4JCV E;  2DJG C;  3S1M H;  5IGE A;  1MI2 A;  3NWS A;  1OO9 B;  1Q3L A;  2GVA A;  3H09 A;  1E24 A;  2D0O A;  5JAV A;  4R8I A;  1XTC D;  4DR5 L;  3MFY A;  2UUA Q;  4A93 B;  4C3J H;  2HD3 A;  3J7Y W;  4DV6 Q;  1TY2 A;  3GTO B;  4QIW E;  4AYB E;  1FYC A;  4WJW A;  2V1C C;  4OHJ A;  1NSN S;  5BR8 L;  1EY7 A;  4JOI A;  1PXU A;  2PW7 A;  1PDQ A;  2NZ1 D;  2M00 A;  2DY8 A;  5CR3 A;  3T51 B;  3HKS A;  2JK8 A;  3I3C A;  1V43 A;  1YNJ D;  5EKI A;  4POG A;  2K32 A;  3BYT B;  2B2Y C;  5JVG 3;  1HA5 A;  2FMM A;  5C3E B;  1II3 A;  1JR0 D;  2XSC A;  5E7N A;  1I50 H;  1KAB A;  2EJF C;  2D5D A;  5NUC A;  3T1H Q;  2UXB Q;  1M1K C;  2G9H D;  2K5V A;  2UXB L;  1YBY A;  4NMZ A;  5IP9 H;  1WVL A;  4A3E B;  1K3B C;  2O5I C;  3EQL C;  1UE5 A;  4DR1 Q;  4IOA A;  1GUS A;  3HOZ G;  5FO8 B;  4QCL A;  2CKZ B;  3PO2 B;  3FPP A;  3T4A C;  1STH A;  3FDT A;  2C5C A;  4BA2 I;  1TY0 A;  5CBA E;  2KVM A;  1HZC A;  2EY1 A;  1TWA B;  1IW7 D;  1SAP A;  3I72 A;  3AMU A;  3CCR A;  1ILP A;  3H15 A;  4PZ7 A;  4DV4 Q;  4JBK A;  4A3I B;  3S16 B;  3RZD B;  1HCZ A;  2EJM A;  1NR4 A;  3CPW A;  1LT4 D;  5IGB A;  1PTO C;  1PVO A;  3E5S A;  4J8Q A;  3CCU A;  3HP3 A;  5K36 G;  2B63 H;  1AE2 A;  1RDP D;  4QL5 A;  1EOV A;  5IT9 c;  1NTG A;  4A3K B;  4TSS A;  5F2D A;  4E6I A;  3PO3 G;  2LY7 A;  1TS3 A;  5E1F A;  3H3V I;  1EEF D;  3BDC A;  1MSH A;  1VMP A;  4A3L G;  4KKU A;  1PLF A;  4IO9 A;  1R9T B;  1Y1W B;  4GKJ L;  1B3A A;  2R93 H;  5L37 A;  5J3B A;  4HIM A;  4IPG A;  3C3L A;  3GTP H;  3GTL B;  5C5M A;  3HOU H;  3BU2 A;  1R4P B;  4MN3 A;  3HOW B;  4LAA A;  1WFQ A;  4RWS C;  1EUJ A;  1UEB A;  2NBF A;  4NPS A;  1ASY A;  1GO3 E;  1BXT A;  4RKL A;  1SMX A;  1VQ5 A;  1BO0 A;  3MTS A;  2F0P A;  1XMO Q;  1F9Q A;  1W3S A;  1KRT A;  1EIH A;  1F2Y A;  4B3T Q;  2VQE L;  1TXY A;  4RGO S;  3ZYY X;  3GTG B;  1CHP D;  4K5W A;  1CKN B;  5FLX c;  1QUQ A;  1UNS A;  1PMR A;  5IYB H;  1XTD A;  3KF8 B;  1X55 A;  4K2L A;  3PIO 3;  2I5M X;  2NVQ H;  1LO5 D;  1LTI D;  1BCP B;  3I91 A;  1L0Y B;  1VQ6 A;  4JI3 Q;  3S1N B;  3SHL A;  5M3M G;  4S3S A;  4JI3 L;  3RLO A;  3J80 c;  2NTT A;  3G7L A;  1E2Z A;  3T16 A;  1PH9 A;  5M5Y B;  2ZTE A;  2K4K A;  2Z4H A;  1Y69 U;  1C4Q A;  4UDU C;  1CK1 A;  2ICE C;  3A54 A;  3L0O A;  5EGT A;  3W2D A;  4PMW A;  3KUP A;  3TBI B;  1FVI A;  2I0Q A;  3KLW A;  5I4D A;  3TP8 A;  2EPB A;  1Q12 A;  4R8N A;  2Q2T A;  5T1I A;  1YJN A;  1EIY B;  2IX3 A;  4MIU A;  4HID A;  2WAC A;  1Z47 A;  1MIU A;  2N55 A;  1KHI A;  2VQF L;  1QVC A;  1BDO A;  1X6O A;  1T5E A;  4GN4 B;  2CW0 D;  1SNO A;  1W2B A;  2XTI A;  1D5X C;  4APV A;  2NZH A;  4A3J H;  4ME3 A;  2K75 A;  5D3D A;  1A62 A;  1PH5 A;  5C44 B;  3P75 A;  1YI2 A;  4BBS G;  5FJ8 H;  4A3G H;  3MFG A;  3BVZ A;  1K0R A;  5JEA G;  3S1Q B;  3TP6 A;  4QF4 A;  5FO9 B;  4JV5 Q;  2MUY A;  3G48 A;  1A0I A;  3CQZ B;  4LFC L;  1WTP A;  2K5Q A;  4P73 A;  4OO1 H;  1IKL A;  1J5E Q;  2IHE A;  4GN3 B;  1J5E L;  4GKK Q;  3J81 L;  2VY3 A;  4QB4 A;  1EZ6 A;  4FXG C;  1LLR D;  4RG1 A;  5C3X A;  1XJV A;  4DR6 Q;  1VQO A;  1PFN A;  4A3B G;  3OW2 A;  2L15 A;  3KF6 A;  4LF9 Q;  2VUM B;  4FXD A;  4LF9 L;  1Q86 C;  1Y8O B;  2J4X A;  1FNV A;  4BBR H;  1N33 L;  1B8A A;  2K33 A;  3C1E A;  3CCJ A;  1BNZ A;  2A69 C;  5KYI A;  1A15 A;  3RZO B;  1EYA A;  2LS0 1;  2P5Z X;  3UE1 A;  2K01 A;  4IUU A;  1LV9 A;  4YWK A;  1IKM A;  4G7O C;  1Q90 A;  2ENB A;  2SOB A;  4HED A;  1PTO B;  2RF4 A;  2J0T D;  1S40 A;  4HJ9 A;  1BCP D;  1E2W A;  2F0U A;  3D8G A;  4K0K Q;  4N8X 1;  4MZ9 A;  3R2I A;  4B3R L;  3HZX A;  2R92 B;  4DV5 Q;  2EYO A;  3DEO A;  5JJL A;  4DV5 L;  1ROD A;  1VF5 C;  1LYL A;  3E9I A;  1QB5 D;  5KIX A;  2L12 A;  3SR1 A;  4K2K A;  1QWY A;  1BCP F;  5AJ3 Q;  1VQ4 A;  4GS3 A;  1HZ9 A;  2KUM A;  4OXP A;  4NXM Q;  1LM0 A;  4CKE A;  4NXM L;  1WCM H;  2A1A A;  1PRT B;  4RHS A;  2NVY H;  2LXJ A;  2NB0 A;  4J15 A;  5FLM G;  2OF1 A;  1GUN A;  3A7L A;  2QKI C;  2JA5 B;  4X3S A;  1YHB A;  1S3O A;  1K8A C;  4GZY C;  2A8V A;  3OYY A;  1E22 A;  4B9W A;  5C3E H;  4DR4 Q;  3GTM B;  3MXU A;  1E1T A;  4ULL A;  1QZH A;  2QDB A;  2UU9 L;  2RHQ B;  1PH2 A;  3HOX B;  4HJ8 A;  1YJW A;  4ID6 A;  3QOL A;  4DR3 Q;  4I7A A;  4DR3 L;  3MXN A;  4NDX A;  1Q81 C;  3I73 A;  2JA7 G;  2LMC B;  2RSO A;  1D6E C;  2Z6B A;  3S1M B;  1SNM A;  1UEA B;  2RDH A;  3ZJY C;  5T1G A;  5LMN Q;  3H0G G;  5LMN L;  1X3F A;  1JJG A;  2Y0S G;  3OPO A;  1TWA H;  4RHR A;  4DAP A;  3S2H H;  4DR7 L;  1BUV T;  4A3D B;  3RNU A;  4LF5 Q;  2MO1 A;  4C3J B;  4BY1 H;  4LF5 L;  1PFM A;  2K5H A;  4A3I H;  4B3M Q;  3S16 H;  3OTO Q;  2CQA A;  3NEM A;  2KQ3 A;  2MPM A;  4JI1 Q;  4HIO A;  2UUB Q;  4BXX G;  4JI1 L;  5IOC A;  4DNI A;  2XWJ B;  3D6W A;  1JQY D;  1G2T A;  2NZO A;  2EVB A;  2PI2 A;  3LGJ A;  1VQB A;  5C4J H;  3BJU A;  4UP8 A;  1YIJ A;  1RCV D;  2F0J A;  2JA6 G;  4YCV A;  2I5H A;  3HOV G;  2K1B A;  4HSP A;  1Y1W H;  4KHV A;  2A6E C;  4YHH Q;  4BS9 A;  2SDF A;  4DU9 A;  4XQJ A;  1T9H A;  1I50 B;  4OWX B;  3I4L A;  2QCP X;  1PTO D;  3Q6S A;  2IPK D;  4HN7 A;  5KRU A;  3J7Z C;  4LF7 Q;  5C6A A;  3HOW H;  1MKH A;  4A3M G;  1Q8K A;  3D3R A;  4P72 A;  2ZM6 Q;  2A6H C;  1C9O A;  3W1G A;  1HRJ A;  1KTK A;  2K5W A;  3K5O A;  3G4S A;  5CV8 A;  4K5X A;  1DYQ A;  4A3L H;  1PTO F;  1HPC A;  2F4I A;  5EPL A;  2GN5 A;  2F0M A;  3KBG A;  1ESF A;  2GA4 B;  2PZT A;  2UXD L;  4UPA A;  2VXW A;  5JJZ A;  1PRT D;  2R7F A;  1CZW A;  3GTG H;  5G3L D;  2F0O A;  1I5F A;  2ZTC A;  1NE3 A;  3CKI B;  1VQA A;  4EQO A;  4XYQ A;  1D1K A;  1CQV A;  3HKZ G;  4GNX A;  1PRT F;  2XVS A;  3G6J B;  2B63 B;  5G3L F;  1S5B D;  1HHV A;  2B2U C;  1RD9 D;  1A63 A;  1ESR A;  2A19 A;  4CGY B;  1XNR L;  5M5Y H;  4ILW A;  1A6X A;  2CCZ A;  1WTV A;  4OIJ A;  3VYT A;  1C7Y A;  1Q46 A;  2VW9 A;  1IXR A;  3P1H A;  1PHJ A;  3GTP B;  2B2W A;  3IRB A;  2R7D A;  2V4D A;  4DN4 M;  5JJI A;  1HA6 A;  1PV4 A;  3MC0 B;  3AFQ A;  3RLF A;  2DN8 A;  5M3M H;  2AUJ D;  3T1Y L;  2NN6 G;  3TEH B;  2AQ2 B;  1DOL A;  1X3E A;  4CHT B;  5M3F G;  1UE1 A;  3M7G A;  4FF3 A;  3HFZ B;  1Z6H A;  4IPC A;  1B1Z A;  3KLS A;  1KC8 C;  3J81 c;  2IX0 A;  1WTH A;  2YTY A;  5IWA L;  1JWS D;  1X56 A;  4KMU C;  3VYR A;  2QW7 A;  4XDX A;  4NXN Q;  3S17 H;  3RLN A;  4JVZ A;  4AYB G;  3NUC A;  3FHW A;  3I55 A;  3CQZ H;  1D5M C;  2BDO A;  1AFP A;  1C0A A;  2NVQ B;  4LFA Q;  5H1S E;  2B2T A;  3UDF A;  1EU4 A;  4FF4 A;  1OXT A;  4RGM A;  5GRO A;  5LHY 1;  4K6D A;  4DV3 L;  4F87 A;  1K8M A;  2VUM H;  2F3I A;  1EYD A;  4O1N A;  3CC2 A;  1D5Z C;  3RZO H;  3TZU A;  4DV1 L;  1EYG A;  2E2J B;  1N32 L;  3IAY A;  1ICW A;  4L5R C;  1B9M A;  4JI5 Q;  3OOC A;  4JI5 L;  5KND A;  4MTK A;  3QIA A;  1KXL A;  2R61 A;  1A2U A;  2GVB A;  2CWA A;  2F4V Q;  1VQC A;  4QUF A;  2F4V L;  4A3J B;  3HG9 A;  2BH2 A;  3CMA A;  1IL8 A;  4LF4 L;  2A69 D;  1Q7Y C;  3AU7 A;  1DJR D;  4KKT A;  3TRE A;  3M3Y H;  3HOY G;  5C4X G;  4NKL A;  4ZYS A;  4KTA A;  4HJ7 A;  3SEB A;  4B3M L;  4YY3 Q;  2B39 A;  2R92 H;  3C2P A;  3CME A;  4H7B A;  3S1R H;  2PQA B;  5ELB A;  2E76 C;  4F88 A;  4JI0 Q;  3DXJ C;  5E4W C;  1QZG A;  1AEX A;  1BQQ T;  2KEE A;  1FJG L;  3GTJ H;  1VMC A;  2B8G A;  4POF A;  4V0B A;  2UXC L;  2KCT A;  1CI3 M;  4L5T A;  1V1O A;  3WDN A;  4KHP L;  4Y52 H;  3KBX A;  4PMB A;  3GP7 A;  2MNA A;  4KK7 A;  5E3F A;  2X6L A;  4X66 Q;  2EJG C;  1WTX A;  3TDQ A;  3VDY A;  2F0W A;  3DWP A;  4C3H H;  2PYK A;  4A3F H;  3CW2 C;  2MO0 A;  5JOB A;  1EZ8 A;  5IE8 A;  3QB3 A;  3H94 A;  4MHE A;  1DCZ A;  5C5L A;  5IY0 A;  1HNZ L;  5FLM H;  3DM3 A;  3X3M A;  4HAE A;  4IPH A;  2K50 A;  4IJL A;  4KJO A;  1GUW A;  4L5S A;  4A3C G;  1EIG A;  1DXM A;  3CXC A;  2Q8T A;  3TN2 A;  2E8G A;  1CKN A;  1SRO A;  1F9R A;  1LTR D;  1SN8 A;  4IN3 A;  3IKJ A;  2J7Z A;  3KF8 A;  1QJO A;  4A3D H;  4HCE A;  2JA9 A;  3K7A B;  2UUA L;  3A7A B;  2FJ2 A;  4DV6 L;  2JA7 H;  3V2T A;  4FNF A;  3J7A F;  1G2S A;  2F3W A;  3H0G H;  1DOM A;  1WI5 A;  1S72 A;  2I5L X;  5EPK A;  1HNX Q;  2A5H A;  1WCM B;  3I70 A;  5DAU A;  1HNX L;  4DV7 Q;  2NVY B;  3K8A A;  2LSS A;  1H9K A;  3HS0 C;  1SDF A;  1AE3 A;  1NUC A;  2ZXP A;  3K57 A;  3M4Y A;  3NBH B;  4B08 A;  2MFI A;  1YHA A;  2PI2 E;  5HGQ A;  1ML0 D;  2AWO A;  4R4C A;  3K81 C;  1KL9 A;  2C9O A;  4XT3 B;  1K28 A;  4OX9 Q;  3I4N G;  4WJ4 A;  3T1H L;  2WB1 B;  1QCB D;  4OX9 L;  4A3E G;  1E7Z A;  3SXH A;  3ND8 A;  4RFB A;  3ERQ A;  5CGK A;  4C3I G;  2JA6 H;  3HOV H;  5JEA J;  4RH6 A;  1X3P A;  2F3V A;  4DR1 L;  1I4R A;  2A6E D;  2JEB I;  2Q2H A;  2AHO B;  1JB7 A;  2AUK A;  1TWH H;  4V19 0;  2B2Y A;  4LK1 C;  2PMZ B;  1GVP A;  1CM9 A;  3ULL A;  3S2H B;  1MHW C;  4OO1 I;  4BY1 B;  2A6H D;  1IL2 A;  2B8F A;  3RMH A;  4DV4 L;  3TZD A;  2JYO A;  4B9X A;  3A74 A;  3PF4 A;  3NEL A;  4ALP A;  2ZTD A;  2EIF A;  3H6M A;  1B3Q A;  3MA2 B;  4R4T A;  5DM7 3;  2ZXO A;  4A3K G;  4TKO B;  5LL6 X;  5C4J B;  1S5C D;  2JXM B;  1CSQ A;  3KK7 A;  2EDG A;  3HRZ C;  4JBJ A;  1S5D D;  1L0W A;  4BA1 I;  2FXQ A;  3JAM E;  2XRS D;  4JBW A;  3CCV A;  4K14 A;  1AZQ A;  3MEH A;  3QO2 A;  1TS4 A;  2F1M A;  1RHP A;  5KNC A;  2OQ0 A;  4DV0 Q;  4X3T A;  4H13 C;  4DV0 L;  1PRT C;  3PO3 B;  5EBD A;  2KCM A;  2RQX A;  3GD7 A;  1HUN A;  2SNS A;  4JYA Q;  3E9H A;  4EX5 A;  1IYU A;  1SYG A;  2JQO A;  4G7Z C;  4DAY A;  2L1B A;  1AZP A;  1RKN A;  4ZCK A;  1XMO L;  4DGZ A;  2EYM A;  2X69 A;  1GOZ A;  4B3T L;  4IQZ A;  4OL7 A;  1LTG D;  4DV2 Q;  4OGQ C;  4DV2 L;  5IYD G;  5KYL A;  3OSO A;  1F2L A;  4HMJ A;  2NTS A;  1HUM A;  3ER0 A;  3AEV A;  4YCU A;  3GV3 A;  1EIF A;  1SNQ A;  4GOP C;  1PH1 A;  3PMF A;  1MD2 D;  1V1P B;  1X54 A;  2KCC A;  2IW3 A;  5FKA C;  3TRZ A;  3J81 i;  1IBL Q;  2F0F A;  5DLQ E;  1CKM A;  1U4L A;  3KLR A;  1TU2 B;  1M8A A;  5IOD A;  4KN4 C;  2YTX A;  1HTL D;  4TRD A;  2BA0 A;  4FP5 D;  2EY6 A;  2OXP A;  2H1E A;  2MGS A;  5CBE E;  1TT2 A;  3VR3 A;  3PIP A;  3SK4 A;  2E2J H;  2B3G A;  2Z6K C;  3NXW A;  1K83 H;  5M3M B;  2NWG A;  2WB1 E;  4B3S Q;  4OWW B;  4G4K A;  2DNC A;  2FIN B;  1S4Z A;  1NNX A;  2AMC B;  1GKH A;  1HNW Q;  1EQR A;  1GUG A;  3W1B A;  4RCN A;  1AH9 A;  4ZKB B;  3A8J E;  2PMZ E;  4U67 3;  5C44 G;  3S17 B;  2N49 A;  2D9U A;  1OXS C;  4DPG A;  4JV5 L;  4GLX A;  3A56 A;  2E5L Q;  4FXK C;  5IYC G;  1EY6 A;  4GKK L;  2HDM A;  3IL8 A;  2RBM A;  3KFU A;  5IT9 E;  2ALY B;  4BBS B;  4DR6 L;  4KJN A;  3IFD A;  1N8R C;  4UP7 A;  4ZUJ A;  2I46 A;  2SEB D;  1SEB D;  1Y1V G;  4ODG A;  3L2P A;  1SND A;  1JE5 A;  2MP1 A;  4K8I A;  5ISR A;  3I4M H;  1WTQ A;  1ONL A;  4LJZ C;  3FKI H;  3VR5 A;  1IHZ A;  2E2H H;  1GD7 A;  1JIC A;  3K5L A;  2L11 A;  4DA2 A;  3BDL A;  3E0E A;  5BN4 A;  4FF2 A;  5IIF A;  1BBX C;  5AFW A;  5IP7 H;  3BZD B;  5C0X G;  1HR0 W;  1ET9 A;  2DGY A;  1L2F A;  5ELE A;  2KHS A;  1SYF A;  3UDX A;  4X3U A;  3M3Y B;  5M9O A;  4KD4 A;  4JW0 A;  2K05 A;  4DAY B;  2CH4 W;  2F0S A;  4BY7 G;  4K0K L;  3CF5 A;  3K7A H;  1VCI A;  5FLX E;  1RTN A;  1SE3 A;  5ELD A;  1N34 Q;  3S1R B;  1N34 L;  1FL0 A;  2L5T A;  5AJ3 L;  1WTR A;  1SLJ A;  3GTJ B;  4EGV A;  4LWC A;  1I4X A;  3SK8 A;  1O7L A;  2XN9 C;  4C1N I;  2K5N A;  2K04 A;  3J80 E;  1ENC A;  1N36 Q;  1VQ8 A;  1QNK A;  2IJ0 A;  1F2M A;  3DMU A;  2KCN A;  1XWE A;  2F0H A;  2JA5 G;  1XPU A;  3PUW A;  4HTH A;  3Q22 A;  3NE5 B;  4DR4 L;  2OTJ A;  4C3H B;  2BE5 C;  4A3F B;  3QG1 A;  4X64 Q;  1WYD A;  1HFG A;  1GJX A;  1I3Q H;  4CBV A;  3GDE A;  1EQT A;  2RCF A;  3R93 A;  1EYC A;  2K28 A;  4LUV A;  3GTQ B;  5KGU A;  3EA6 A;  4KY6 A;  2NVT H;  2AKW B;  1B44 D;  1PH6 A;  2IL8 A;  4GOP B;  4LF6 Q;  5ELO A;  2JSO A;  3OWF A;  3CU7 A;  4IZ8 A;  2BDN A;  4C3I H;  2N78 A;  2Q8R E;  2JA7 B;  1Y8P B;  1PZK D;  3PIO A;  2AWN A;  3R8B A;  3TP5 A;  3OTO L; 
#chains in the Genus database with same CATH homology
 2EE1 A;  1M4V A;  2SNM A;  3GO5 A;  3H0G B;  3JAM L;  3U9O A;  1G8Z D;  2LFN A;  2PW5 A;  3DWA A;  2Y0S B;  4IFD G;  4G57 A;  4KI0 A;  2PZU A;  3M85 A;  1STE A;  1FGB D;  3P20 A;  1R4Q B;  3PUX A;  3EFX D;  2WAQ B;  3URY A;  1MGS A;  3BYY B;  5K36 H;  4KN7 C;  4ME5 A;  2EXZ A;  1G29 1;  4J6H A;  1JE4 A;  1BOS A;  2JA6 B;  1GUO A;  3NP8 A;  3HOV B;  1KDC A;  4HMI A;  2A73 B;  1SMY C;  4I65 A;  2XIW A;  1FD7 D;  3TME A;  2NYZ D;  2Z8L A;  4H0L C;  1TWH B;  3FEW X;  5IGC A;  4A3M B;  2M9V A;  1F77 A;  4L63 B;  2ID0 A;  1FNW A;  1HTP A;  1AN8 A;  1ZYR C;  5D65 A;  3TP7 A;  4CKB A;  5BN3 A;  1L0X B;  2FFK B;  3H3V C;  3SE0 A;  5HGT A;  1LT5 D;  1K8O A;  3KLS X;  4PQX A;  1H9J A;  2WII B;  3T53 B;  1STA A;  5I9O A;  1KAA A;  3D4D A;  1G6Z A;  4IUT A;  3HKZ B;  3HEJ A;  5I2Y A;  5JPM C;  1S5E D;  5I2X A;  2EOT A;  2E2I B;  5EPJ A;  3RD4 A;  2OEO A;  4BWG B;  1O78 A;  2R6G A;  2B2U A;  4L6T B;  3UI2 A;  3E6Z X;  3LNN A;  3VA7 A;  1SNP A;  4DXG A;  1WTO A;  2L9H A;  1C8C A;  2F03 A;  3TSS A;  5M3F B;  4RGN A;  1EY9 A;  4I7Z C;  3DHQ A;  1KDA A;  1D2B A;  3NBH A;  1O80 A;  2K7V A;  3SK5 A;  2D62 A;  2Z4I A;  1GHJ A;  4K5V A;  3L3O C;  4RCO A;  4OIK A;  3GV6 A;  3N6R A;  4HR7 B;  5JEA H;  2RDG A;  1B4O A;  3VYU A;  4AYB B;  1O7Z A;  4U68 A;  5DM6 3;  2WIN B;  1KNE A;  1K83 B;  5CV6 A;  2IWH A;  4M1U B;  4J1M A;  2G9D A;  2JE6 I;  2M2L A;  2EYL A;  4TQU S;  1J9O A;  3NBI A;  2QF7 A;  4M8A A;  3K5M A;  2EYJ A;  3A8I E;  1WD1 A;  1SYC A;  1YNN C;  4F7X A;  1HQM C;  4DK0 A;  1SYD A;  2HQE A;  4KKS A;  2YU9 B;  3PV0 A;  3H91 A;  2Q8I B;  3Q23 A;  1MBY A;  1CT1 D;  5C0X H;  4OO1 G;  4DK1 A;  1CA5 A;  1JOR A;  5IGF A;  4WRD A;  1ILQ A;  3HOY B;  4YIJ A;  3OMG A;  1BR9 A;  4O42 A;  2VB3 X;  2L0C A;  2HDL A;  3K58 A;  4DNR B;  3NPP A;  3NSW A;  3I4M B;  2WKD A;  1MSG A;  3FKI B;  3BG3 A;  2E2H B;  3MVV A;  1U4M A;  1W6K A;  4H44 C;  5I9P A;  1DZ1 A;  1JCK B;  1KLU D;  3ITP A;  4EQP A;  3PUY A;  2I07 B;  1RF2 D;  3MAQ A;  2NN6 I;  2BE5 D;  1DON A;  3MWY W;  3D4R A;  2BCO A;  4CJ2 C;  1XX8 A;  1EQV A;  2N88 A;  3X3N A;  4NP5 A;  5E4X A;  1B53 A;  3BS1 A;  1V1P A;  2EYF A;  2PO4 A;  3MZ5 A;  4DXF A;  1H9R A;  1H9S B;  4Q0F A;  1TS5 A;  1S5F D;  1ENA A;  5CV5 A;  3C1F A;  1VDZ A;  2AQ3 B;  1I4Q A;  4JK1 C;  2JEA I;  1HFN A;  1G91 A;  1EY0 A;  1QG7 A;  2PZW A;  4IFD H;  1OXU A;  1TKW B;  2F0V A;  2F0D A;  4Q5V A;  4R9W A;  3C46 A;  4KHZ A;  3VR6 A;  4WOR A;  1STB A;  1I3Q B;  1EY5 A;  3OW7 A;  1LT3 D;  2K6A A;  1LTT D;  3OIQ A;  2NVT B;  4WFN 3;  1J8I A;  3I4N B;  4C3I B;  1FNU A;  1I4P A;  1F9S A;  1Q8I A;  3HOZ B;  1C48 A;  1LAB A;  1BF4 A;  3RUZ A;  1SMY D;  5J22 A;  1JOO A;  1V8Q A;  2B2V C;  4ZK9 B;  1CQF A;  2MHV A;  1STY A;  4IUN A;  2RSN A;  3WOE A;  1NAP A;  2EYP A;  1KDB A;  2O2L D;  4N9T A;  4N9P A;  4ZLT F;  1ZYR D;  4C1N K;  4KY5 A;  5C0X J;  2WKC A;  1TII D;  3PUV A;  3K6O A;  5D14 A;  3D6C A;  1I6V C;  2KED A;  4FVM A;  4KD3 A;  1F2Z A;  2OT2 A;  3GQB A;  2KOL A;  1ZKO A;  2B2V A;  3D4W A;  4QUC A;  1PYW D;  5EBC A;  5CC4 A;  1CZG A;  3S14 B;  3F2U A;  2L55 A;  3LWU A;  1LTB D;  1OXX K;  5I6Y A;  3ONA B;  2NN6 H;  1QE6 A;  3IFT A;  3S15 B;  3AB9 A;  1F9P A;  1DD2 A;  1JB3 A;  3O13 A;  2K03 A;  4L8J A;  1RTO A;  1LTS D;  2E74 C;  1TQO A;  3CHB D;  2NVX B;  1ZXT A;  4FO2 A;  3HGB A;  5CV9 A;  4ZRZ A;  4XYO A;  3NTI A;  1W6J A;  1CTM A;  3VR2 A;  1WD0 A;  3BVM A;  5C3W A;  5C4H A;  1DM0 B;  1TS2 A;  3R3O A;  1TVX A;  2FMC A;  1AW7 A;  3SK6 A;  1KLG D;  4X3K A;  2E75 C;  2MJ8 A;  3NWT A;  5IGD A;  3WOF A;  2RVL A;  2DY7 A;  3VA5 A;  1SJE D;  1TWG B;  3LX0 A;  4LMQ D;  1A2T A;  2PNR C;  2KA7 A;  3N52 A;  3W3A A;  3P7J A;  4XT1 B;  1TWC B;  3VYS A;  2O5J C;  5COR A;  2KEC A;  4IFD J;  4FF1 A;  2F0N A;  3T13 A;  3J7A V;  1HQR D;  5FO7 B;  1I6H B;  1JOQ A;  5FK9 C;  2O4X A;  1YNN D;  2RA4 A;  5D3I B;  3U9S A;  5ELC A;  1EWH A;  2Z1C A;  2HCC A;  1STN A;  3D31 A;  1SE2 A;  1A3U A;  4ZKC B;  1B2T A;  4Y7N B;  3NTH A;  3OMC A;  4A3B B;  1WTW A;  3SVM A;  1FR3 A;  1D1I A;  1QOH A;  1Y1V B;  2EY5 A;  2RDF A;  5DNF A;  2EYH A;  3EJI A;  2F0Q A;  3NQI A;  2DNE A;  2HUG A;  4NW2 A;  3A55 A;  5K5P A;  2ZXR A;  1E0B A;  4XTC S;  5COY A;  1LAC A;  1U4R A;  4Z9C B;  5JPN C;  3GTK B;  3QWN A;  1Q1E A;  4C2M B;  3OIP A;  3S9W A;  3NTK A;  1Q1B A;  4BY7 B;  3EVQ A;  5KNB A;  4RGT A;  1TR5 A;  3MXP A;  4C56 C;  1SXT A;  1EEI D;  3V96 A;  2A68 C;  4RAU C;  2ICI A;  4C3H G;  4RA8 A;  1NR2 A;  5EKL A;  2EZV A;  3T56 B;  2A74 C;  4PV1 C;  2QEJ C;  1SFO B;  1I4G A;  1RJT A;  3L9A X;  5IGG A;  3K0Y A;  3K5N A;  2TSS A;  1PFB A;  2PPB C;  2BA1 A;  1GHK A;  4PNY A;  4IUR A;  4C3J G;  1SJH D;  5A2Q E;  1AP0 A;  5JVH 3;  3A8K E;  4EQN A;  4ZUI A;  5M5W B;  4K6L A;  1T5X D;  2BOS A;  3CRL C;  2L4N A;  1XXG A;  1X3Q A;  1YNJ C;  3MXG A;  1OXV A;  2HCI A;  4ZQ3 A;  1XYI A;  1EOT A;  4IUV A;  2XWB B;  4DAV A;  5BN5 A;  4FYD A;  4IUQ A;  5M5X B;  1A3T A;  1JC7 A;  4K8J A;  2WP8 J;  3Q0A A;  4XIG S;  2RKS A;  1H9M A;  3FMC A;  2KJX A;  3DEP A;  3V05 A;  2D2C C;  1EY4 A;  5DEH A;  5A35 A;  4CKC A;  2F0I A;  3DUZ A;  1IW7 C;  3M7N A;  2JA8 B;  5HUR A;  5KEE A;  3DM1 A;  1EY8 A;  3FPU B;  5C0X I;  4DF7 A;  2E2D C;  1SNC A;  5EJW A;  1GXD C;  2XRQ D;  1TWF B;  3FVQ A;  1IYV A;  3NK9 A;  1KNA A;  1SYB A;  3I90 A;  3PUZ A;  5ELF A;  2F0E A;  1JWM D;  1HXY D;  2B2W C;  5CV4 A;  1NCV A;  3SDZ A;  4HCS A;  1U9R A;  2JP1 A;  2F0G A;  2IT1 A;  3OHX C;  2NUC A;  1QIL A;  5CMD A;  1B50 A;  2VB2 X;  4IAL A;  3ND9 A;  1SSO A;  4EVO A;  3LWE A;  3M4O B;  2R93 B;  5CYU A;  3MHB A;  2ZT9 C;  1B9N A;  2R7Z B;  3Q24 A;  2EY2 A;  3HOU B;  1EL0 A;  2F0L A;  4KV6 A;  1UAP A;  1SBB B;  1H9S A;  5IT9 L;  2B2T C;  1JOK A;  1JWU D;  3DWQ A;  1SE4 A;  4IUP A;  1EFI D;  2VNU D;  3QJY A;  1CA6 A;  2LKV A;  4QIW B;  1LTA D;  2H4O A;  2F0T A;  3R2T A;  4IFD I;  1PZJ D;  2X6G A;  3FRP B;  4XQQ A;  2WV6 D;  1ENF A;  1PZI D;  4F8M A;  2CHB D;  4XQN A;  3ERO A;  1X32 A;  1QNU A;  5FLX L;  1Z7T A;  2CW0 C;  3S2D B;  1SYE A;  2YYZ A;  5EKK A;  3NQT A;  4P2C B;  5TSS A;  4ABN A;  1E2V A;  4XXE A;  1EWC A;  1I4H A;  2XNA C;  3J80 L;  5J39 A;  3L7Z C;  3BDO A;  3NHH A;  1PTO H;  5FOB B;  1U4P A;  4QMG A;  3BVG A;  4DNT B;  5C4X B;  2IX1 A;  3K59 A;  4A3G B;  2TMP A;  4RKB A;  4UAI A;  1A3V A;  2R3Z A;  1DOK A;  4KY7 A;  1CFM A;  2PQE A;  2FHT A;  5EQ0 A;  1ET6 A;  4G7H C;  2F0K A;  5I6W A;  3I8Z A;  2CVR A;  2QIL A;  5J1Z A;  3VR4 A;  1Y8N B;  4PMC A;  2AQ1 B;  1GUT A;  1UUP A;  1LT6 D;  4ZAI A;  3E0J A;  4CJ1 B;  5A2Q L;  1STG A;  1CHQ D;  4BBR B;  3CRK C;  3J81 E;  1ZEQ X;  5LL6 S;  2A68 D;  1O7Y A;  1BCP C;  4DFA A;  3PIP 3;  1VF7 A;  5C4Z A;  5CV7 A;  4CJ0 B;  3OWE B;  2PCF B;  3QOJ A;  1EU3 A;  2K5D A;  4HSV A;  5IGE A;  1MI2 A;  3NWS A;  1OO9 B;  1Q3L A;  3H09 A;  5JAV A;  4R8I A;  1XTC D;  3MFY A;  4A93 B;  3J7Y W;  3GTO B;  1TY2 A;  1FYC A;  4WJW A;  4OHJ A;  1NSN S;  1EY7 A;  1PXU A;  2PW7 A;  1PDQ A;  2NZ1 D;  2M00 A;  2DY8 A;  5CR3 A;  3T51 B;  3I3C A;  1V43 A;  1YNJ D;  5EKI A;  2K32 A;  3BYT B;  2B2Y C;  5JVG 3;  1HA5 A;  2FMM A;  5C3E B;  1II3 A;  1JR0 D;  2XSC A;  1KAB A;  2EJF C;  2D5D A;  5NUC A;  2G9H D;  4NMZ A;  1WVL A;  4A3E B;  2O5I C;  3EQL C;  1GUS A;  5FO8 B;  4QCL A;  3PO2 B;  3FPP A;  3T4A C;  1STH A;  3FDT A;  2C5C A;  4BA2 I;  1TY0 A;  5CBA E;  2KVM A;  2EY1 A;  1TWA B;  1IW7 D;  1SAP A;  3I72 A;  3AMU A;  1ILP A;  4A3I B;  3S16 B;  3RZD B;  1HCZ A;  2EJM A;  1NR4 A;  1LT4 D;  5IGB A;  1PTO C;  3E5S A;  4J8Q A;  3HP3 A;  5K36 G;  1RDP D;  4A3K B;  4TSS A;  5F2D A;  4E6I A;  2LY7 A;  1TS3 A;  5E1F A;  1EEF D;  3BDC A;  1MSH A;  1VMP A;  4KKU A;  1PLF A;  1R9T B;  1Y1W B;  1B3A A;  3C3L A;  3GTL B;  5C5M A;  1R4P B;  4MN3 A;  3HOW B;  4LAA A;  4RWS C;  2NBF A;  1BXT A;  4RKL A;  1BO0 A;  3MTS A;  2F0P A;  1F9Q A;  1EIH A;  1F2Y A;  4RGO S;  3ZYY X;  3GTG B;  1CHP D;  4K5W A;  1UNS A;  1PMR A;  4K2L A;  3PIO 3;  1LO5 D;  1LTI D;  1BCP B;  3I91 A;  1L0Y B;  3S1N B;  3SHL A;  4S3S A;  2NTT A;  3G7L A;  1E2Z A;  3T16 A;  5M5Y B;  2Z4H A;  1Y69 U;  1C4Q A;  4UDU C;  1CK1 A;  2ICE C;  3A54 A;  5EGT A;  3W2D A;  4PMW A;  3KUP A;  3TBI B;  5I4D A;  3TP8 A;  2EPB A;  1Q12 A;  4R8N A;  5T1I A;  2IX3 A;  4MIU A;  2WAC A;  1Z47 A;  2N55 A;  1BDO A;  1T5E A;  2CW0 D;  1SNO A;  1D5X C;  5D3D A;  5C44 B;  3P75 A;  3MFG A;  3BVZ A;  3S1Q B;  5JEA G;  3TP6 A;  4QF4 A;  5FO9 B;  2MUY A;  3CQZ B;  1WTP A;  2K5Q A;  4OO1 H;  1IKL A;  3J81 L;  4QB4 A;  1EZ6 A;  4FXG C;  1LLR D;  5C3X A;  1PFN A;  2VUM B;  4FXD A;  1Y8O B;  2J4X A;  1FNV A;  2K33 A;  3C1E A;  1BNZ A;  2A69 C;  5KYI A;  1A15 A;  3RZO B;  1EYA A;  2LS0 1;  2K01 A;  4IUU A;  1LV9 A;  1IKM A;  4G7O C;  1Q90 A;  2ENB A;  2SOB A;  4HED A;  1PTO B;  2J0T D;  1BCP D;  1E2W A;  2F0U A;  3D8G A;  3R2I A;  3HZX A;  2R92 B;  2EYO A;  3DEO A;  1ROD A;  1VF5 C;  1QB5 D;  5KIX A;  2L12 A;  3SR1 A;  4K2K A;  1QWY A;  1BCP F;  2KUM A;  4CKE A;  4RHS A;  1PRT B;  2NB0 A;  2OF1 A;  1GUN A;  3A7L A;  2QKI C;  2JA5 B;  4X3S A;  4GZY C;  4B9W A;  3GTM B;  3MXU A;  4ULL A;  2QDB A;  3HOX B;  4ID6 A;  3QOL A;  3MXN A;  4NDX A;  3I73 A;  2LMC B;  2RSO A;  1D6E C;  3S1M B;  1SNM A;  1UEA B;  2RDH A;  5T1G A;  3OPO A;  4RHR A;  4DAP A;  1BUV T;  4A3D B;  4C3J B;  1PFM A;  2CQA A;  2KQ3 A;  2MPM A;  5IOC A;  2XWJ B;  3D6W A;  1JQY D;  1G2T A;  2EVB A;  1RCV D;  2F0J A;  2K1B A;  4HSP A;  4KHV A;  2A6E C;  4BS9 A;  2SDF A;  4DU9 A;  4XQJ A;  1I50 B;  3I4L A;  2QCP X;  1PTO D;  3Q6S A;  2IPK D;  4HN7 A;  5KRU A;  5C6A A;  3D3R A;  2A6H C;  1HRJ A;  1KTK A;  2K5W A;  3K5O A;  5CV8 A;  4K5X A;  1DYQ A;  1PTO F;  1HPC A;  2F4I A;  5EPL A;  2F0M A;  3KBG A;  1ESF A;  2GA4 B;  2PZT A;  2VXW A;  5JJZ A;  1PRT D;  1CZW A;  5G3L D;  2F0O A;  3CKI B;  4EQO A;  4XYQ A;  1D1K A;  1CQV A;  1PRT F;  2XVS A;  3G6J B;  2B63 B;  5G3L F;  1S5B D;  1HHV A;  2B2U C;  1RD9 D;  1ESR A;  4CGY B;  4ILW A;  1A6X A;  1WTV A;  4OIJ A;  3VYT A;  3P1H A;  3GTP B;  2B2W A;  4DN4 M;  2V4D A;  1HA6 A;  3MC0 B;  3RLF A;  2DN8 A;  2AUJ D;  2NN6 G;  2AQ2 B;  1DOL A;  4CHT B;  4FF3 A;  3M7G A;  1Z6H A;  1B1Z A;  3KLS A;  2IX0 A;  1JWS D;  4KMU C;  3VYR A;  4XDX A;  3NUC A;  1D5M C;  2BDO A;  1AFP A;  2NVQ B;  2B2T A;  1EU4 A;  4FF4 A;  1OXT A;  4RGM A;  5LHY 1;  4K6D A;  4F87 A;  1K8M A;  1EYD A;  4O1N A;  1D5Z C;  3TZU A;  2E2J B;  3IAY A;  1ICW A;  1B9M A;  3OOC A;  5KND A;  3QIA A;  2R61 A;  1A2U A;  4QUF A;  4A3J B;  3HG9 A;  1IL8 A;  2A69 D;  3AU7 A;  1DJR D;  4KKT A;  4NKL A;  4ZYS A;  4KTA A;  3SEB A;  2B39 A;  3C2P A;  4H7B A;  5ELB A;  2E76 C;  4F88 A;  3DXJ C;  5E4W C;  1AEX A;  1BQQ T;  2KEE A;  1VMC A;  2B8G A;  4V0B A;  1CI3 M;  1V1O A;  3WDN A;  3KBX A;  4PMB A;  3GP7 A;  4KK7 A;  5E3F A;  2X6L A;  2EJG C;  1WTX A;  3TDQ A;  2F0W A;  3DWP A;  2PYK A;  5JOB A;  1EZ8 A;  3QB3 A;  3H94 A;  4MHE A;  1DCZ A;  5C5L A;  3X3M A;  4HAE A;  4KJO A;  1GUW A;  1EIG A;  1DXM A;  2Q8T A;  3TN2 A;  1F9R A;  1LTR D;  4IN3 A;  3IKJ A;  2J7Z A;  3KF8 A;  1QJO A;  4HCE A;  3K7A B;  3A7A B;  2FJ2 A;  3V2T A;  4FNF A;  3J7A F;  1G2S A;  2F3W A;  1DOM A;  5EPK A;  2A5H A;  1WCM B;  3I70 A;  5DAU A;  2NVY B;  1H9K A;  3HS0 C;  1SDF A;  1NUC A;  2ZXP A;  3K57 A;  3M4Y A;  4B08 A;  1ML0 D;  2AWO A;  2C9O A;  4XT3 B;  2WB1 B;  1QCB D;  3SXH A;  3ND8 A;  4RFB A;  3ERQ A;  5CGK A;  4C3I G;  5JEA J;  4RH6 A;  1X3P A;  2F3V A;  1I4R A;  2A6E D;  2JEB I;  2AUK A;  4V19 0;  2B2Y A;  4LK1 C;  2PMZ B;  3S2H B;  1CM9 A;  4OO1 I;  4BY1 B;  2A6H D;  2B8F A;  3RMH A;  3TZD A;  2JYO A;  4B9X A;  3H6M A;  3MA2 B;  5DM7 3;  2ZXO A;  4TKO B;  5LL6 X;  5C4J B;  1S5C D;  2JXM B;  3KK7 A;  2EDG A;  3HRZ C;  1S5D D;  4BA1 I;  3JAM E;  2XRS D;  4JBW A;  4K14 A;  1AZQ A;  3MEH A;  3QO2 A;  1TS4 A;  2F1M A;  1RHP A;  5KNC A;  4X3T A;  4H13 C;  1PRT C;  3PO3 B;  5EBD A;  2RQX A;  3GD7 A;  1HUN A;  2SNS A;  1IYU A;  1SYG A;  4G7Z C;  4DAY A;  2L1B A;  1AZP A;  1RKN A;  4DGZ A;  2EYM A;  2X69 A;  1GOZ A;  4IQZ A;  4OL7 A;  1LTG D;  4OGQ C;  5KYL A;  3OSO A;  1F2L A;  4HMJ A;  2NTS A;  1HUM A;  3GV3 A;  1SNQ A;  3PMF A;  1MD2 D;  1V1P B;  2KCC A;  5FKA C;  2IW3 A;  2F0F A;  1U4L A;  3KLR A;  1TU2 B;  1M8A A;  5IOD A;  4KN4 C;  1HTL D;  4TRD A;  2BA0 A;  4FP5 D;  2EY6 A;  2OXP A;  2H1E A;  5CBE E;  2MGS A;  1TT2 A;  3VR3 A;  3SK4 A;  3NXW A;  5M3M B;  2NWG A;  4G4K A;  2DNC A;  2FIN B;  1S4Z A;  1GUG A;  4RCN A;  4ZKB B;  3A8J E;  4U67 3;  3S17 B;  2D9U A;  1OXS C;  3A56 A;  4FXK C;  1EY6 A;  2HDM A;  3IL8 A;  2RBM A;  5IT9 E;  4BBS B;  4KJN A;  3IFD A;  4ZUJ A;  2I46 A;  2SEB D;  1SEB D;  4ODG A;  1SND A;  4K8I A;  2MP1 A;  5ISR A;  1WTQ A;  1ONL A;  4LJZ C;  3VR5 A;  1IHZ A;  1JIC A;  3K5L A;  2L11 A;  4DA2 A;  3BDL A;  5BN4 A;  4FF2 A;  5IIF A;  1BBX C;  5AFW A;  3BZD B;  5C0X G;  1ET9 A;  5ELE A;  2KHS A;  1SYF A;  4X3U A;  3M3Y B;  5M9O A;  4KD4 A;  2K05 A;  2F0S A;  1VCI A;  5FLX E;  1RTN A;  1SE3 A;  5ELD A;  3S1R B;  2L5T A;  1WTR A;  3GTJ B;  4EGV A;  1I4X A;  3SK8 A;  1O7L A;  2XN9 C;  4C1N I;  2K04 A;  3J80 E;  1ENC A;  1QNK A;  2IJ0 A;  1F2M A;  3DMU A;  2KCN A;  1XWE A;  2F0H A;  3PUW A;  4HTH A;  3Q22 A;  3NE5 B;  4C3H B;  2BE5 C;  4A3F B;  3QG1 A;  1HFG A;  1GJX A;  4CBV A;  1EQT A;  3R93 A;  1EYC A;  2K28 A;  3GTQ B;  5KGU A;  3EA6 A;  4KY6 A;  1B44 D;  2IL8 A;  2JSO A;  3OWF A;  3CU7 A;  4IZ8 A;  2BDN A;  2Q8R E;  2JA7 B;  1Y8P B;  1PZK D;  2AWN A;  3R8B A;  3TP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...