4XT3B

Structure of a viral gpcr bound to human chemokine cx3cl1
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
b'EHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G-protein coupled receptor homolog US28
publication title Structural biology. Structural basis for chemokine recognition and activation of a viral G protein-coupled receptor.
pubmed doi rcsb
source organism Cytomegalovirus
molecule tags Viral protein/signalling protein
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xt3B00
2DY8A 2HCCA 1U4LA 1XYIA 1WD1A 3G7LA 1PLFA 4QUCA 1NCVA 2JYOA 3I8ZA 5AFWA 4IURA 1ILQA 1Q3LA 4XT1B 1HFNA 3IFDA 3DM1A 1JICA 4HEDA 4ZKCB 1DOKA 2HDMA 4R8IA 2K04A 1AZQA 1EL0A 1G2SA 1HUNA 2BDNA 1U4RA 1B50A 1EIGA 2B2WA 1J8IA 5EJWA 2HUGA 1KNEA 1F9SA 1ML0D 5JJZA 2X6GA 1KNAA 3F2UA 2RSNA 2JP1A 1B4OA 4R9WA 1F9RA 2NYZD 1VMPA 1MGSA 4HSVA 1DOMA 2L9HA 1PDQA 2MP1A 3TZDA 2X69A 5D14A 1QNKA 1MI2A 1NR2A 2MPMA 1RTNA 2NWGA 3MWYW 3MTSA 4IUPA 2DY7A 2VXWA 1WVLA 1WTQA 2KEEA 1C8CA 1MSHA 1X3QA 1HFGA 3D6WA 1O7ZA 3TN2A 3H91A 1QG7A 4UAIA 1RODA 2EPBA 1RTOA 1HHVA 3IL8A 1RHPA 2Q8RE 5EPKA 1ICWA 1DONA 1NAPA 2B2TA 2FHTA 1HRJA 5EPJA 1X32A 2M2LA 1EQTA 1F2LA 2B2WC 1HUMA 2B2UA 1G91A 2X6LA 2B2VA 4O42A 2Q8TA 1E0BA 4RAUC 2HCIA 2FJ2A 1CA5A 3GV3A 1WD0A 2EE1A 1EOTA 1B2TA 1G6ZA 1WTWA 4RA8A 4RWSC 4XT3B 2XIWA 1IL8A 4IUVA 4ZKBB 1BF4A 4X3TA 4IUUA 3I91A 1WTOA 1MSGA 1DOLA 1DZ1A 1EIHA 2D9UA 1HA6A 3I3CA 4HCSA 5T1IA 3I90A 2B2YA 4X3KA 2MJ8A 4CJ2C 1JE4A 3FPUB 2KOLA 3Q6SA 4DN4M 4OIKA 4MN3A 2HDLA 2NZ1D 3DEOA 5CORA 5T1GA 4ZK9B 1AP0A 1TVXA 1IKMA 5CMDA 3FDTA 4X3SA 3UI2A 3QO2A 2B2TC 4HAEA 2SDFA 1S4ZA 1B3AA 5EKIA 2K1BA 2FINB 3HP3A 2B2UC 1ESRA 1RJTA 1SAPA 2B2VC 1ZXTA 2EOTA 2K03A 2K28A 1BO0A 2FFKB 2N55A 2R3ZA 1AZPA 1ILPA 1GUWA 2K01A 1QE6A 2RVLA 4LMQD 1PFNA 1PFMA 1WTPA 2N88A 4X3UA 4CJ0B 1BBXC 1IKLA 2L12A 4XDXA 1F9QA 1O80A 1A15A 5E4WC 1O7YA 1U4PA 3P7JA 2CVRA 5DNFA 1CA6A 1XX8A 1B53A 2KUMA 2MGSA 1M8AA 1PFBA 1J9OA 2L11A 3GV6A 4NW2A 5E4XA 4ZLTF 3N52A 1VMCA 4CJ1B 1WTVA 3SVMA 5D65A 4QUFA 2J7ZA 2L1BA 5EPLA 4ZAIA 2FMMA 3KUPA 2B2YC 2RA4A 5EQ0A 3DEPA 4MHEA 1BNZA 3KBXA 1G2TA 1F9PA 4OIJA 1WTRA 1WTXA 4IUQA 2IL8A 1CM9A 2KECA 1SDFA 2KEDA 2RSOA 3LWEA 4IUTA 3R93A 5CBEE 1X3PA 2KVMA 5CBAE 4U68A 1LV9A 2H1EA 1NR4A 2L4NA 1SSOA 3ONAB 5COYA 2K05A 1U4MA
chains in the Genus database with same CATH superfamily
5CC4A 4X66L 3F2DA 1N32Q 2NN6G 2O4XA 4X6AH 4V0BA 4A3MG 2OQKA 3HOWG 4XYOA 1TY0A 3CW2C 3HOXG 4QL5A 1MJEA 1HR0W 3R8BA 4I7AA 3JAMc 2BDNA 4A3IG 3GTKB 1PTOD 2B2WA 4NMZA 4AYBB 1CKOA 1KTKA 1HR0Q 1F77A 2D5DA 1TS2A 5C44B 1X9NA 3CP0A 2WIIB 4A93G 1WTQA 4LK1C 3CRKC 4L5SA 4LJZC 1RODA 2SNMA 2OF1A 3PO2H 3KLSX 2K50A 4YIJA 2A8VA 4HJ9A 1YITA 2WFWA 2VNUD 3TMEA 1I4RA 3T56B 4JI4Q 2F0SA 1TWAB 2VQFL 4F88A 2XN9C 1SE4A 2EYFA 1S40A 5BN5A 1SYGA 1L0YB 2ES2A 1BCPD 3AFPA 1A3TA 1SRUA 1ICFB 2K5DA 4KHZA 1D1IA 1C0AA 4POGA 1STEA 1STNA 1KRTA 1KDAA 1PVOA 4WORA 3AYHB 5FK9C 3F8TA 4A3FH 3UI2A 4KHPQ 4LFBQ 1VQCA 3HP3A 3CD6A 5JEAH 1SAPA 4A3JH 4IQZA 2RHQB 2UXCL 1PH3A 4H13C 1EOVA 4OL7A 3J80E 3I2ZA 1O80A 1A15A 1QUQA 5K5PA 1QCBD 4KKSA 4GLVB 1SE3A 3EN2A 3S1QB 4H02A 5JOBA 4JI0L 3GQBA 5LMNW 3A74A 3AU7A 4EQOA 1LTGD 5IP9G 3UDXA 3S16B 3GD7A 2L4NA 3KBGA 2BCOA 2B3GA 4QJFA 4AQYQ 4C2MH 2DUDA 4DV4Q 3MFYA 1U4LA 1BOSA 2IW3A 1NCVA 1JR0D 5K36H 2KCTA 3Q23A 1JICA 2OXPA 1BBUA 2F0KA 5LMUQ 1VQIA 1VQ9A 2E74C 1G2SA 2BE5C 3U4ZA 3W3AA 5CV5A 3M4OH 1LYLA 4XQQA 1A8VA 1U9RA 4OXPA 4HJ8A 2QCPX 3FKIG 4KI0A 1FNWA 1TR5A 5EBCA 4KD4A 3RZOB 5FLMH 5F2DA 5DLQE 2KEEA 5FLXL 2R7ZG 2LS01 4V190 5I2XA 1VQKA 1YJWA 3A55A 1CZGA 2EPBA 1TS3A 3W2DA 4WFN3 1LTTD 3KFUA 3HFZB 5M5WH 2UXBQ 4N8X1 3HG9A 1N8RC 1YIJA 2M2LA 1BR9A 2B2VA 2YTXA 4ZRZA 5KEEA 4RAUC 2L55A 4X65L 4GNXB 1LTID 5C4JH 3PF4A 4A3LG 5JAVA 4A4IA 2R92G 1UEAB 4DV6Q 1KQSA 4ZKBB 3OYYA 1NBWA 2QDLA 3RNUA 1V9PA 1E2VA 4JBJA 3S2DB 1B8AA 4CJ2C 4JI3L 1MJCA 4IPDA 4X62Q 1SMYD 4CDEC 4QQBX 2FINB 2GA4B 2K33A 3LWUA 5DAUA 1VQ5A 4FF2A 1HXYD 4FVMA 2R3ZA 2E2IB 1SJED 1MHWC 5CV7A 1WTPA 1B9MA 4J6HA 5IE8A 2NN6I 1PFBA 3CKIB 2L11A 2N78A 4LF7Q 4DV3L 5ELDA 2LXKA 1K8MA 1XNQL 5D3DA 3K5MA 1F2MA 1SN8A 3OHXC 3NENA 1TWCB 3CXCA 1LT5D 1Q7YC 4DPGA 2CHBD 1II3A 5E1FA 2ZXOA 2AKWB 1RCVD 2I5HA 3KF8A 5IT9c 2RDHA 2PYKA 1VQAA 3G7LA 5JEAJ 4KY5A 1Q46A 1GUSA 4PMBA 4C3IH 2D62A 1B70B 2XWJB 2B8FA 4BY7B 5EJWA 5JJZA 3MXNB 1Q82C 4ULLA 2BDOA 5ELOA 4LFCL 3NSWA 1JJGA 4DV0Q 3BDLA 1S3OA 3MXGA 3AEVA 1HNZL 1MD2D 5IWAQ 1F2YA 1Y8PB 1YNJD 3BVMA 2UXDL 3R2TA 3RMHA 2K6AA 1PRTC 3A8JE 3M4QA 4A3DH 3PO3H 3IL8A 4YY3Q 1PH1A 3CMAA 1K8OA 4DAMA 1BVSA 2RDGA 4EX5A 2A6HD 5C4HA 2B2TA 1TWHB 3ZYYX 5J1ZA 5IGGA 4RHSA 4IPCA 1YNXA 4OO1G 1IXRA 4HIKA 2WV6D 5IYCH 4ZYSA 4A3KB 1GHJA 4IUVA 2F0UA 4LWCA 4FF1A 1YJ9A 3U9OA 3CC7A 5C4ZA 1LO5D 1L1OA 3EA6A 1SYDA 4MN3A 5T1GA 2ATWA 3HOZH 2PNRC 3QJYA 4HR7B 1FNVA 3G6EA 1B3AA 2EXDA 1ESRA 4DR4Q 1GUWA 1XPUA 5ELFA 1QE6A 3K81C 1IKLA 2Z0SA 4Z9CB 1QJOA 4C56C 1I50H 4DV5L 2B8GA 4QUFA 1AFPA 4DXGA 2ZM6L 3KYHC 1E3PA 3KBXA 1WTXA 1Y8OB 1TT2A 4B3ML 2RSOA 4LFAL 1I4QA 1AW7A 1K83B 1EU3A 1I3QH 1IBLQ 1NR4A 1LTBD 3QWNA 2K05A 1SNQA 3X3MA 5GAEC 4K0KL 1HCZA 1PXUA 2RBMA 3Q8DA 3G48A 4XQNA 1HFNA 1IBKL 2JQOA 2HHHQ 3X3NA 1N36L 1Y1VG 4P73A 4DV2L 4O0AA 1B7YB 1PH6A 2PI2A 1FL0A 4F7XA 2JA5H 4R9WA 3AMUA 1Q8IA 2L9HA 3D6CA 1HZ9A 4BY7G 4F87A 5AJ3L 4UPAA 4BBSB 3JAME 3GDEA 1GD7A 2VXWA 5J39A 2F0LA 2KA7A 2JA6B 5GROA 1H9MA 3C2PA 4GKKL 1LTRD 1DONA 2QILA 1H9JA 4OWXB 3NBHB 3M3YH 1G8ZD 2B2WC 3L7ZC 4DUZL 4MTKA 1JWUD 3EROA 4CGYB 4TRDA 2A19A 2VY3A 5C3EH 1VF7A 3OW2A 2WB1E 1Y1WG 3S17H 2AQ2B 2JSOA 1DOLA 2QKIC 1XNRQ 1EIHA 4XIGS 1SBBB 1SNDA 3A8KE 4MIUA 4FO2A 2K14A 1TQOA 1UEBA 5IYDG 4HJ7A 1AP0A 4C3JB 2F0JA 3MHBA 4BWGB 3S1NH 1MBYA 3I7FA 2SDFA 5IGDA 5M3MG 1PH5A 4BBRB 1D5ZC 4GN5A 4A3BH 1L0WA 1EZ8A 1STBA 1WCMH 3SK4A 4DR1L 4LMQD 4CKBA 2UUAQ 3HS0C 4XDXA 5L37A 4JI7L 1VQ8A 3S1MB 3I4MG 2CW0D 4A3GG 3C1EA 4KKUA 1VQDA 5A2QE 3GTJH 2JA8G 2NZHA 4C1NI 1PH2A 3I4NH 3PIP3 1IYUA 3GTPB 3LNNA 2RA4A 3BVZA 1KLGD 1I94L 4MHEA 4TQUS 1HNWL 3HOYG 4YCVA 4DK0A 3TS0A 2LKVA 2MNAA 4HCSA 3RUZA 2KHIA 4QIWE 2DY8A 4H0LC 1WTHA 2HCCA 4HMJA 2M9VA 1HNXQ 3CPWA 1XPRA 1PYBA 3OPOA 4GKJL 4A3MH 2D2CC 3HOWH 1SXTA 1TS5A 3HOXH 2KHJA 4JI5L 5IYBG 4IOAA 2D0PA 4A3IH 1AZQA 1EL0A 5NUCA 1HTPA 1F9SA 2NB0A 3A56A 1YEZA 3GTLB 2I0QA 5CGKA 5DM73 2E5LL 3A5UA 1R9TB 4OO1I 5I6WA 1B9NA 1EY0A 4A93H 3OMCA 4FF4A 2JA7B 2E76C 2JK8A 4QB4A 2VUMH 3BZDB 4DFAA 1MIUA 4MNOA 2NVTH 1LTLA 2MQHA 4UP9A 4JI2Q 4OX9L 5I9OA 1IW7D 4A3EH 3GTMB 1CI3M 2AUJD 1ZEQX 3S2HB 1HUMA 2B2UA 4FXKC 3PIOA 4LF4Q 4FF3A 3U50C 5IP7G 1WD0A 2YU9H 1K3RA 4K8JA 1AH9A 2EJMA 1WTWA 3GTOH 1VQMA 2WB1G 2HT1A 2BA0A 4NXMQ 3F2CA 3CF5A 2E2JH 1LLRD 2E2HB 4IUNA 5HY6A 3S1RH 1SE8A 3DM3A 5CORA 1T9HA 3FDTA 3HOVB 1GO3E 3URYA 1D8LA 1PTOB 4L5RC 2UUBQ 2B2VC 4R1JA 4XTCS 1EIYB 4QGUA 3ND9A 1EU4A 4RMFA 4G7HC 1PFMA 3NTIA 1V8QA 1O7YA 1FD7D 2Z4IA 4NW2A 4ZLTF 5FO7B 1TWFB 1UUPA 1R4PB 4YWLA 4BY1G 3HOUG 2R93B 1AN8A 4KJNA 4KHVA 3WWVA 3IFTA 4DAVA 1C48A 4A75A 4DR2L 4B3SL 2CKZB 2PQAA 2QEJC 2HQLA 1FJGQ 5C4XG 4DF7A 4KMUC 2RDFA 4JG2A 4UP7A 2PQAB 4IN3A 5IIFA 3H0GB 3UDIA 1CZWA 4IURA 4DR6L 4R4CA 1BCPB 1F2ZA 3CQZB 2XNAC 4JK1C 4UHVA 4J8QA 1YBYA 2KCMA 4JYAQ 5ELEA 4IPGA 1J8IA 2C35B 5IT9E 1ML0D 3FKIH 4L5QA 2O5IC 3S24A 3DWPA 3D3RA 3DHQA 1SNCA 3SK8A 4QCLA 2DJGC 3JC66 3L2PA 1YHAA 2K5VA 3I73A 2R7ZH 1I6HH 4IUPA 1WVLA 3MZ5A 3RZDH 4L63B 4JV5L 1YNND 4X66Q 3GTQH 2TSSA 3G71A 4BXXH 1ICWA 4DV7L 5KYLA 3J80L 1N32L 5CV8A 1H9SB 3BDOA 2EE1A 4L8JA 3RN5A 2F3WA 2R92H 4J1MA 5I6YA 4AYBE 3VR3A 3G4SA 4K8IA 2XIWA 5DEHA 1EWIA 2O5JC 3A54A 3T1HQ 4X3KA 1FVIA 2EQSA 4A3EB 3J81L 3HRZC 1QZGA 5CMDA 5IODA 2KCNA 2Z4HA 3PUVA 2B2TC 1EYDA 3HKSA 5JJLA 4P2CB 1DGSA 3TP8A 3H91A 2K5QA 4CKCA 1G291 4CDDC 2F0PA 5JVH3 2RVLA 4S3SA 2EVBA 4CJ0B 5C0XG 3E3XA 3VR2A 2PW7A 4NDXA 1K3BC 1VDZA 3P7JA 1KAAA 2KUMA 2I5LX 2K5WA 4P75A 1IBMQ 4DGZA 2L1BA 5M3FG 5CV9A 4JCVE 4RKLA 4X64L 1L1OC 1XXGA 4IUQA 3K59A 1CM9A 2B63G 4FXGC 4JI8L 4DU9A 4YHHL 2E75C 3CCVA 4UY8C 3PO2B 1XYIA 2LSSA 3J81j 1Y14B 1ZYRD 1PLFA 2R6GA 2QW7A 5AFWA 4RH6A 3H3VH 2RHSB 2XWBB 4LFBL 1TXYA 3CMEA 1U0LA 4JI6Q 2UXCQ 1DOKA 3I4OA 4R8IA 3QB3A 1XPOA 1EIGA 3ZJYC 3OTOL 2XTIA 3Q22A 1F9RA 3GTGH 2V1CC 4JI0Q 2EYPA 1EY8A 2MP1A 4LUZA 5D14A 5LMNQ 1BQQT 1CTMA 1YVCA 1SJHD 1QWYA 1KC8C 4LF5Q 4A3FB 4UDUC 1EEFD 4Y7NH 2IPKD 2KCCA 4QF4A 1JB3A 5JJKA 4JI1Q 4A3JB 2Q8RE 1RKNA 5GAGC 1K0RA 1O7LA 1PMRA 4DNRB 3W5OA 3PV0A 1G91A 2EJGC 2QDBA 1A62A 1OXVA 3KJOA 2PPBC 2PCFB 1CSQA 1VQPA 3NHHA 2YYZA 1T5XD 2ZT9C 1Q90A 1PYSB 1TKWB 5IGEA 4AYBG 3U58A 2Z9HA 1H9RA 3PMFA 1HJPA 1OO9B 4JC0A 3S9WA 1MSGA 4RGOS 3KLSA 4GOPB 3I3CA 3BJUA 3VYUA 3PF5A 4C2MB 2HDLA 4ZK9B 5C44G 2QA4A 4B3RQ 3CC2A 1N9WA 5J22A 4X3SA 4GNXA 2G9DA 4DNTB 2A68D 5M5YH 2WINB 2N88A 4X3UA 3AQQA 1ONLA 3M4OB 1KLUD 4OELB 2A1AA 1W6JA 1FGUA 4WJ4A 2EDGA 3M85A 5EQ0A 1JE5A 1CKNA 1PH7A 2UUCQ 2IY5B 2KECA 2G9HD 1KHIA 5CBAE 3HEJA 4U68A 1LV9A 4RKBA 1CKNB 1H95A 1EY6A 1NTGA 2R61A 3D4DA 3EQLC 3RLOA 5M5WB 2OT2A 3U4VA 1I6VC 5BN3A 3TSSA 2AHOB 1Y8NB 5CR3A 1XMOQ 1AE3A 3DM1A 4CDFC 1Y1VH 2F3IA 4KKTA 1TWGH 3ERQA 5C4JB 1U4RA 1JJCB 1KDBA 4PZ7A 1CSPA 3STBD 5EGTA 4LNQA 1LT4D 1VF5C 1OXUA 4DV3Q 2Z6BA 5I9PA 2R7FA 3W1GA 2X69A 2CWAA 1XMQQ 1GOZA 4NXNQ 3SEBA 2AMCB 4OHJA 1D5XC 1K9MC 4C3HH 3J7ZC 1MSHA 3TN2A 4L5TA 3H15A 2A6ED 1VS0A 1E2ZA 2WP8J 3J7AV 2IX0A 3M9BA 1JOOA 4R4IA 1NNXA 1SNPA 4EQNA 4HN7A 3MXNA 4DUYL 3S15H 2EYOA 3KDFB 1EFWA 5FLXE 3E0EA 5JPNC 1EQTA 4J15A 1EQRA 4FXDA 5GADC 1PH8A 3A8IE 4Q5VA 1Y1WH 2F0OA 4HMIA 5FJ8G 3D4WA 4LFCQ 5C0XI 3T53B 3E0JA 3WOFA 4KY7A 2KHSA 5IYDH 2GVAA 3MXPA 3K5LA 1O7IA 3NELA 2Y0SB 3E9HA 1FYCA 5M3MH 2MFIA 1W2BA 1I4GA 1S4ZA 2WAQB 2B2UC 5BR8L 1DYQA 3IRBA 1BO0A 4YY3L 3U9SA 5LHY1 1DXMA 4HJAA 4C3IB 3IKJA 1Q81C 3A5ZB 3I4MH 4A3GH 2JA8H 1WFQA 5DNFA 5K36G 1HH2P 2MGSA 3C46A 4CBVA 4RGMA 4CJ1B 1WTVA 3QOJA 4RFBA 4DAYA 4ZAIA 3P20A 1NMFA 3HOYH 1Z47A 3N6RA 1PTOC 1AEXA 2IL8A 4IUTA 4O1NA 1GKHA 1ZKOA 4DAYB 4K6DA 3PSIA 1WJJA 2KVMA 1JB7A 4DK6C 3F2BA 4LF9Q 3S14H 1U4MA 4A3DB 3PO3B 2PZWA 4HSPA 5EBDA 5FLMG 2EYLA 4MTNA 4QY7A 2V4DA 3MEFA 2A69D 3HGBA 4ZKCB 1GUTA 1YHBA 1EYGA 4DR4L 4DNIA 2SOBA 1PH4A 1DD2A 3UE0A 4LUOA 4YWMA 2X6GA 3CCJA 3HKZB 3CCUA 3UDGA 2RCNA 3K0YA 2JJQA 2ZM6Q 2NVQH 1N33Q 2MPMA 1RTNA 3MWYW 1BCPC 4TVAB 4LFAQ 4CDCC 4B3MQ 3HOZB 1S5FD 1D5MC 1G6PA 1LACA 3DMUA 1VQBA 2EJFC 1D2BA 1RTOA 1EYAA 4KJOA 3J80c 1HPCA 4M8AA 1PA6A 5CV6A 3L9AX 3BYTB 1N36Q 1ET9A 3VDYA 5IP7H 2Q8TA 2MUYA 3K6OA 2HHHL 1I50B 1JWMD 1P16A 2Z1CA 1KRSA 1S5ED 4BA1I 3PCOB 2VQEQ 4RA8A 5IGBA 2OWOA 3K7AH 2C5CA 3BZCA 2D9UA 4A76A 2Q2TA 5T1IA 3J81c 3I90A 2B2YA 2PI2E 1I3QB 1FR3A 2MO0A 3NBHA 4PG3A 2KOLA 2NZ1D 2DNCA 1N34L 3QG1A 5ELBA 4BS9A 3CCMA 5KGUA 3GO5A 1IZ6A 1V1OA 3VA7A 5HGTA 1NE3A 3D31A 1TU2B 2K03A 1ENCA 4ABNA 1QNUA 2FFKB 1ILPA 3CPFA 1I4PA 3SDZA 4R8NA 4H44C 4DUZQ 4LF8L 5IOCA 1PFSA 1PH9A 1M8AA 2JA9A 1CT1D 2JA5B 4BY1H 3HOUH 1I4HA 2JN4A 4ZUJA 2J7ZA 2DN8A 2F4VQ 3C3LA 1A6XA 1JJ2A 4A3KG 1SDFA 1STAA 2ID0A 5C4XH 1BDOA 1XNRL 3TP6A 1V43A 2F0IA 3ONAB 5COYA 4FP5D 3SE0A 2BOSA 2YTVA 4LF6L 2IHEA 3M3YB 3R3OA 1V1PB 1JT8A 1HZCA 2A74C 4JI7Q 4EQ5A 5C3EB 4DR7L 4BA2I 2JP1A 4RG1A 2PO4A 3S17B 1PRTF 2VB3X 3K5OA 3QOLA 1I94Q 4DR5L 1PDQA 2QF7A 1DCZA 2HIXA 5M5XH 3VR5A 5IYCG 3CCQA 2IX3A 2NN6H 2DY7A 1HA5A 3R2IA 4G57A 3S1NB 1QG7A 4UAIA 1A3VA 2PZTA 2QEXA 3WDNA 2BE5D 1RHPA 2NVYH 4A3BB 5EPKA 2B39A 4K14A 1B3QA 2I46A 1WCMB 5FOBB 4GKJQ 3NUCA 1HRJA 4ID6A 1SMYC 3EJIA 3GTJB 4RCNA 1KIXA 1CK1A 3I4NB 3J7YW 1S72A 4PQXA 3TZUA 1SYFA 3DXJC 4DA2A 1Z7TA 2C9OA 1HQRD 2J0TD 1QVCA 2RKSA 1JE4A 3DLLA 2VZAA 3H09A 4ME5A 1B44D 1EIFA 4BBSG 1IKMA 1Q1BA 1UE7A 5I2YA 2N49A 4FDBA 2JA6G 4A3MB 1YZ6A 3HOWB 2HQEA 1RJTA 3HOXB 2XGTA 4R4QA 4OX9Q 1EY5A 5C0XH 3AFQA 4A3IB 3ERSX 4GOPC 2WKCA 2PMZB 2RCFA 1B53A 2JE6I 1E22A 3LGJA 3RD4A 5M3FH 1BNZA 4HIMA 2FMMA 5H1SE 2F52A 2B63H 1E1TA 4JBMA 4A93B 2F0TA 4DR3Q 2Q2HA 1EZ6A 4GLAC 3FP9A 4GNXC 2XSCA 2OEOA 2VUMB 2NVTB 4N9TA 4C3JG 4XXEA 4QUCA 4JPBW 5JVG3 1YNJC 1CUKA 4XT1B 4BBRG 1VQFA 2UUBL 1JWSD 1LUZA 4GZYC 2IHFA 4ODGA 3CHBD 2L15A 3TREA 1J5EL 1B50A 2YU9B 1D1KA 1KNEA 4B3TL 2A6HC 5IP9H 3T1YL 1HTLD 1C9OA 3GTOB 3C1FA 1SE2A 1DOMA 2E2JB 2F0EA 3S1RB 4JBKA 1QNKA 3CCSA 5I4DA 1EFID 1C8CA 1UAPA 5D3IB 1SFOH 4HTHA 2UU9L 1O7ZA 4NKLA 4DV1Q 1EQQA 1FJGL 4RGTA 4OWWB 3WOEA 3K58A 3OIPA 3OMGA 4ME3A 4FNFA 4DR6Q 1Q12A 4KTAA 2XRSD 1X32A 4LUVA 4G7OC 1JQYD 1E0BA 2FJ2A 4XYQA 1CA5A 3VR6A 3GP7A 1L0XB 3ER0A 1QVFA 3GTKH 4IFDG 2K32A 3BDCA 1BXTA 2AWOA 4E6IA 1G6ZA 4JYAL 2CH4A 2EIFA 4JOIA 5C5MA 2XVSA 3FVQA 1VQLA 2OQ0A 1BF4A 2EYMA 4X3TA 1PRTD 1Q1EA 3A7LA 3V2TA 4XQJA 1RIPA 1XJVA 1X6OA 4AH6A 1XTDA 5C44H 2P5ZX 1STHA 1H9SA 4HIDA 4IALA 3EBEA 2JA7G 5G3LF 3TP5A 3QO2A 4JV5Q 4POFA 1X3EA 2EOTA 3A0JA 4A3LH 4DV7Q 2K7VA 2VB2X 3W1BA 2IX1A 4KN7C 1F9QA 1TWAH 2CVRA 1CA6A 4DK1A 3FKIB 1J9OA 1L2FA 3P1HA 3T4AC 5KIXA 1HR0L 3MFGA 2CQAA 1VQJA 1WYDA 2WKDA 4PNYA 4JW0A 4WJ3M 1X3FA 3CCLA 4PZ6A 2R7ZB 1I6HB 1UE1A 1DJRD 1D7QA 2H1EA 3RZDB 4A3CG 3T1HL 1CHQD 2HD3A 3GTQB 1SYBA 4I7ZC 3HOVG 2RQXA 1A63A 1UNSA 1W3SA 3KF6A 2VQFQ 4JI4L 4HEDA 1Z6HA 5C0XJ 3FEWX 2VUMG 3VYRA 3NQTA 2HDMA 5J3BA 3IAYA 2JEBI 4PZ8A 4UP8A 1QZHA 3KF6B 2R92B 4KLKA 4MZ9A 3KJPA 2VL6A 4OWTB 4G4KA 3NEMA 3S1QH 2N8NA 4DK3C 1IBML 2R93G 1P8LA 4X64Q 1MI2A 3T13A 3S16H 1LTSD 1IYJB 1A2TA 3K8AA 4R4OA 4JI8Q 2FXQA 2FMCA 2CFMA 4YHHQ 4KHPL 4PV1C 4RGNA 1ENAA 1NSNS 3H0GG 4OEMB 2L5TA 2WACA 1E2WA 2X6LA 4EGVA 1VQNA 4N8FA 3H94A 5TSSA 3V96A 4JI6L 1V1QA 4YCWA 5FJ8H 3OTOQ 3ICEA 4K2LA 1BBWA 2RF4A 4HCEA 4XT3B 1SNOA 3I91A 3RN2A 1K0SA 2CW0C 2MHVA 4LAAA 3RZOH 4ZUIA 5KNCA 5JJIA 4IPHA 1QUQB 2EY5A 4AQYL 4OIKA 1YJNA 3DEOA 5LMNL 4DV4L 1SLJA 1TVXA 3MAQA 2F4IA 1HQMC 1EY7A 1X55A 1Z9FA 2NUCA 2K52A 3UE1A 2LMCB 3V05A 4LF5L 2EXZA 5CV4A 1JOKA 4OO1H 1ZXTA 3J81E 2A73B 4JI1L 3PIO3 5LMUL 4P72A 1GM5A 4GOPA 3K57A 1A3UA 1Q86C 4HIOA 1K8GA 3M7NA 1JOQA 2DGYA 2OCEA 1C7YA 1VMCA 3K5NA 3OOCA 4F8MA 3GTGB 2B2YC 2Q2IA 1CKMA 1G2TA 1F9PA 2KEDA 1X3PA 3S2DH 4LW1A 3EFXD 3RR5A 1AE2A 1SSOA 4I65A 4Y7NB 3TRZA 4A3EG 4GN4B 1KAWA 3I55A 2UXBL 1WD1A 4B9XA 5G3LD 4B3RL 3NTHA 1A2UA 2F3VA 1ILQA 3P75A 3IFDA 2E2IH 4X65Q 1VQEA 3MVVA 4C1NK 5FKAC 2K04A 1HUNA 1JORA 4BXXG 1SEBD 4IO9A 1IW7C 3PUXA 2RSNA 1B4OA 4JVZA 4DV6L 3OWFA 1T5EA 2N3SA 5KNBA 1WI5A 1KDCA 2EYJA 3KK7A 4HJ5A 4JI3Q 4IFDI 1NR2A 2NWGA 3FHWA 1EWHA 1SMXA 1TWCH 4X62L 2UUCL 3J7AF 4KD3A 1K28A 1HFGA 5M9OA 1LM0A 1VQ7A 1OTCA 2E2DC 3D8GA 2MO1A 2K5HA 3PO2G 5M5YB 1NAPA 2F0GA 1XMOL 3DUZA 4LF7L 2XRQD 1GXDC 2O2LD 4BY7H 3KOJA 5ELNA 1XNQQ 1OXTA 2ASBA 1B1ZA 3PIPA 4OONA 3J80i 2R7DA 2BH2A 4Q0FA 4QMGA 3VYSA 3SXHA 3KDFA 2MJ8A 4YCUA 1O78A 3BZKA 1IL2A 3SGIA 3NXWA 1XMQL 1EEID 1STYA 4NXNL 2ZJRA 1HZAA 1X65A 4A3FG 2KJXA 4KN4C 3BU2A 5JEAG 4DUYQ 4ILWA 1Y1VB 4A3JG 2K01A 1BKBA 1TWHH 1PFNA 1QVGA 2IWHA 2LXJA 3VA5A 1TWGB 3J81i 2L12A 2H5XA 3KF8B 5DM63 1TIID 4WJWA 1WTOA 1EY4A 5E4XA 4KY6A 1KABA 3SVMA 5D65A 2ZTDA 4DV0L 4A3KH 3QIAA 3KUPA 1HNZQ 3DEPA 1CHPD 3E6ZX 1NMGA 3UDFA 2AQ3B 2UXDQ 5IWAL 5CBEE 3R93A 4C3HB 3NP8A 2JXMB 3O13A 2VW9A 4H7BA 1PHJA 2DJFC 2Y0SE 2K75A 3S15B 1XTCD 4AIMA 1K73C 3BS1A 1PZID 3OSOA 2WAQE 5BR8Q 5C3XA 4R4TA 1YHQA 1YNNC 1GJXA 4ALPA 1SYEA 1Y1WB 3JAML 1LTAD 2GN5A 1NUCA 3CU7A 3M4YA 1D6EC 1FGBD 4IOCA 2NYZD 2CWPA 1VMPA 3PUZA 1TY2A 2M00A 3H6MA 3SR1A 1GHKA 4K2KA 1RDPD 2F0VA 1K83H 2JEAI 1X3QA 3J7A5 2LFNA 5M3MB 4PMWA 4G7ZC 1BUVT 1G51A 2F0NA 2F0DA 5IYBH 4LF9L 2H4OA 2NTTA 3SK6A 1VQGA 1RL2A 3PGZA 1J6QA 4DV5Q 3I4MB 1L1OB 5LL6X 2ZJPA 4A3GB 2JA8B 3MEHA 2HCIA 3GV3A 4NB3A 3EVQA 1TS4A 1KD1C 2B29A 3HOYB 1NY4A 3HKZE 4NPSA 1HA6A 4APVA 3CCEA 5BN4A 3S14B 2TMPA 3SHLA 1IBLL 4BBSH 4CKEA 1N33L 4K0KQ 2L0CA 1VQ6A 2PW5A 2JA6H 2SNSA 5FO9B 4O2DA 1IBKQ 2NVXH 2K1BA 1A0IA 3G6JB 3NBIA 3RLNA 1UE6A 5A2QL 1FNUA 1WOCA 2K28A 2N55A 4DV2Q 3I56A 1BBXC 1I4XA 2VS1A 5E4WC 1M1KC 1ZYRC 5C5LA 4JOIC 5JPMC 1XX8A 2AWNA 2K4KA 4TSSA 3L0OA 5ISRA 2KENA 5AJ3Q 1X56A 2NVQB 1UWVA 2EY1A 5KRUA 3AB9A 2VQEL 2IJ0A 3KLWA 3BVGA 3VR4A 2Q2UA 3D0FA 1GUNA 2K5NA 2ICIA 2Z6KC 4GKKQ 2F03A 1N34Q 4C3JH 1EWCA 2Y0SG 2D0OA 2JYOA 3I8ZA 4C3HG 4BBRH 1GUGA 5GQOA 1Q3LA 2ALYB 1H9KA 5IY0A 3PQIA 2WAQG 2NVXB 2DNEA 1ESFA 2AUKA 5GAHC 2QGQA 3DWAA 3M7GA 4C3IG 2F1MA 4LF8Q 2EY2A 3S1MH 3FRPB 2HUGA 2WB1B 3F2UA 3K7AB 4B08A 1ASYA 4K5WA 3GTPH 1SR3A 1ENFA 2EY6A 4HSVA 3TDQA 1QILA 3PUYA 2I5MX 1U5KA 1JC7A 1S5CD 2F4VL 4DXFA 3MTSA 1V1PA 4CHTB 2EZVA 3D6WA 4NP5A 3B6YA 1SYCA 4A3DG 4DR1Q 3PO3G 3I72A 4LF6Q 4Y52H 3LX0A 1VCIA 1PV4A 1IHZA 2FHTA 3TP7A 3I4LA 5EPJA 2UUAL 2EYHA 3K7UC 4IFDH 4GN3B 3L3OC 1EOTA 3TS2A 2A68C 1EUJA 4BY1B 3HOUB 1HNWQ 1E7ZA 1E1OA 2J4XA 2F0QA 3NK9A 3GTLH 4DR7Q 1IL8A 1XWEA 1CQFA 3MC0B 4K6LA 1DZ1A 3HKZG 3ND8A 3H3VI 4DR5Q 1R9TH 5C4XB 3E9IA 3T16A 3NTKA 3Q6SA 1DM0B 2IT1A 3EIVA 4QIWB 2JA7H 3OWEB 4P71A 1PYWD 2LY7A 4GS3A 3TEHB 3HOZG 5FO8B 1Y69U 1HNXL 1CQVA 4HAEA 4L6TB 5IGFA 5EKIA 4JI5Q 2SEBD 1LT6D 3FMCA 3GTMH 2A5HA 1STGA 2AQ1B 3S2HH 1PTOF 4RCOA 3QR8A 1U4PA 2PZUA 3A7AB 1JCKB 2E5LQ 3PUWA 3FPPA 3N52A 1M4VA 2BA1A 2NZOA 5EPLA 3K80C 1M90C 3ULPA 1EY9A 3OW7A 3H3VC 5M5XB 1W6KA 3LWEA 3Q24A 3STBC 1LT3D 3NPPA 2KBNA 2E2HH 4A3CH 5CYUA 4M1UB 1HZBA 2Q8IB 4DAPA 4K5VA 1PZJD 4IJLA 1ET6A 5EKLA 5IGCA 1I5FA 1EYCA 5FLXc 5EKKA 1KL9A 1X54A 2ZTCA 2OTLA 4P74A 3HOVH 1RD9D 2NVYB 5ELCA 2ICEC 2I07B 4JI2L 1PTOH 5IT9L 3JAMi 1KXLA 1OXSC 5A35A 1UE5A 4WRDA 2A6EC 3NQIA 1VQ4A 4LF4L 2CH4W 4ZCKA 2CCZA 1QB5D 4EQPA 1PRTB 3I70A 1VQHA 3ITPA 4KV6A 1BCPF 1E24A 1PZKD 2PMZE 4EVOA 1GUOA 2CQOA 1KNAA 1TWFH 5LL6S 1GVPA 1Q8KA 2JA5G 2NTSA 5HURA 2R93H 2PNHA 1MGSA 2F0WA 4NXML 2E8GA 3TZDA 3E5SA 4RHRA 4PMCA 4K5XA 4DR3L 3HZXA 3OIQA 3CCRA 2ZXPA 1HHVA 3NWTA 4IZ8A 3H0GH 3F1ZA 3RLFA 3BYYB 1ASZA 1F2LA 1LABA 3CQZH 1NJIC 4ZQ3A 4O42A 3DWQA 4KK7A 5E3FA 1QOHA 5KYIA 3TQYA 2ZTEA 1J5EQ 1B2TA 1S5DD 4B3TQ 3T1YQ 1JMCA 4B9WA 5M3FB 5C3EG 4RWSC 4B3SQ 4DR2Q 3Q0AA 1X3GA 2B63B 4IUUA 2KQ3A 3ULJA 1SROA 1IYVA 1C4QA 3T51B 3FPUB 4DKAC 4DN4M 3D4RA 2BH8A 3M4PA 1CFMA 2Z8LA 3MXUA 2UU9Q 3K0XA 3BG3A 3CRLC 1S5BD 1VQOA 2F0MA 5E7NA 4FYDA 2ZJQA 3CAMA 4DV1L 2NBFA 2YTYA 3VYTA 1AZPA 1YI2A 4A3BG 1RF2D 3NWSA 1WCMG 2YV5A 2OTJA 2F0HA 2A69C 4OGQC 4IFDJ 2F0FA 5HGQA 4JBWA 3TBIB 3CC4A 2ZXRA 3GV6A 5C6AA 1R4QB 3SK5A 4U673 4YWKA 1EQVA 2GVBA 2HIVA 2PQEA 3I4NG 1K8AC 2G5DA 5KNDA 1OXXK 4IJHA 4OIJA 5EAYA 5C3WA 1WTRA 3MA2B 2ENBA 4TKOB 1SNMA 4GLXA 1MKHA 3KLRA 1SFOB 2Z6KA 4N9PA 3NE5B 3ULLA
chains in the Genus database with same CATH topology
5CC4A 2NN6G 2O4XA 4V0BA 4XYOA 1TY0A 3R8BA 2BDNA 3GTKB 1PTOD 2B2WA 4NMZA 4AYBB 1KTKA 1F77A 2D5DA 1TS2A 5C44B 2WIIB 1WTQA 4LK1C 3CRKC 4LJZC 1RODA 2SNMA 2OF1A 3KLSX 4YIJA 2VNUD 3TMEA 1I4RA 3T56B 2F0SA 1TWAB 4F88A 2XN9C 1SE4A 2EYFA 5BN5A 1SYGA 1L0YB 1BCPD 1A3TA 2K5DA 4KHZA 1D1IA 1STEA 1STNA 1KDAA 4WORA 5FK9C 3UI2A 3HP3A 5JEAH 1SAPA 4IQZA 4H13C 4OL7A 3J80E 1O80A 1A15A 5K5PA 1QCBD 4KKSA 1SE3A 3S1QB 5JOBA 3GQBA 3AU7A 4EQOA 1LTGD 3S16B 3GD7A 2L4NA 3KBGA 2BCOA 3MFYA 1U4LA 1BOSA 2IW3A 1NCVA 1JR0D 5K36H 3Q23A 1JICA 2OXPA 2F0KA 2E74C 1G2SA 2BE5C 3W3AA 5CV5A 4XQQA 1U9RA 2QCPX 4KI0A 1FNWA 1TR5A 5EBCA 4KD4A 3RZOB 5F2DA 2KEEA 5FLXL 2LS01 4V190 5I2XA 3A55A 1CZGA 2EPBA 1TS3A 3W2DA 4WFN3 1LTTD 3HG9A 2M2LA 1BR9A 2B2VA 4ZRZA 5KEEA 4RAUC 2L55A 1LTID 5JAVA 1UEAB 4ZKBB 1E2VA 3S2DB 4CJ2C 1SMYD 2FINB 2GA4B 2K33A 3LWUA 5DAUA 4FF2A 1HXYD 4FVMA 2R3ZA 2E2IB 1SJED 5CV7A 1WTPA 1B9MA 4J6HA 2NN6I 1PFBA 3CKIB 2L11A 5ELDA 1K8MA 5D3DA 3K5MA 1F2MA 3OHXC 1TWCB 1LT5D 2CHBD 1II3A 5E1FA 2ZXOA 3KF8A 1RCVD 2RDHA 2PYKA 3G7LA 5JEAJ 4KY5A 1GUSA 4PMBA 2D62A 2XWJB 2B8FA 4BY7B 5EJWA 5JJZA 4ULLA 2BDOA 3NSWA 3BDLA 3MXGA 1MD2D 1F2YA 1Y8PB 1YNJD 3BVMA 3R2TA 3RMHA 2K6AA 1PRTC 3A8JE 3IL8A 1K8OA 2RDGA 5C4HA 2A6HD 2B2TA 3ZYYX 1TWHB 5J1ZA 5IGGA 4RHSA 4OO1G 2WV6D 4ZYSA 4A3KB 1GHJA 4IUVA 2F0UA 4FF1A 3U9OA 5C4ZA 1LO5D 3EA6A 4MN3A 1SYDA 5T1GA 2PNRC 3QJYA 4HR7B 1FNVA 1B3AA 1ESRA 1GUWA 5ELFA 1QE6A 1IKLA 4Z9CB 1QJOA 4C56C 2B8GA 4QUFA 1AFPA 4DXGA 3KBXA 1WTXA 1Y8OB 1TT2A 2RSOA 1I4QA 1AW7A 1K83B 1EU3A 1NR4A 1LTBD 3QWNA 2K05A 1SNQA 3X3MA 1HCZA 1PXUA 2RBMA 4XQNA 1HFNA 3X3NA 4F7XA 4R9WA 3AMUA 1Q8IA 2L9HA 3D6CA 4F87A 4BBSB 3JAME 5J39A 2VXWA 2F0LA 2KA7A 2JA6B 1H9MA 3C2PA 1LTRD 1DONA 2QILA 1H9JA 1G8ZD 2B2WC 3L7ZC 1JWUD 3EROA 4CGYB 4TRDA 1VF7A 2AQ2B 2JSOA 1DOLA 2QKIC 1EIHA 4XIGS 1SBBB 1SNDA 3A8KE 4MIUA 4FO2A 1TQOA 1AP0A 4C3JB 2F0JA 3MHBA 4BWGB 1MBYA 5IGDA 2SDFA 4BBRB 1D5ZC 1EZ8A 1STBA 3SK4A 4LMQD 4CKBA 3HS0C 4XDXA 3S1MB 2CW0D 3C1EA 4KKUA 5A2QE 4C1NI 3PIP3 1IYUA 3GTPB 3LNNA 2RA4A 3BVZA 1KLGD 4MHEA 4TQUS 4DK0A 2LKVA 4HCSA 3RUZA 2DY8A 4H0LC 2HCCA 4HMJA 2M9VA 3OPOA 2D2CC 1SXTA 1TS5A 1AZQA 1EL0A 5NUCA 1HTPA 1F9SA 2NB0A 3A56A 3GTLB 5CGKA 5DM73 1R9TB 4OO1I 5I6WA 1B9NA 1EY0A 3OMCA 4FF4A 2JA7B 2E76C 4QB4A 3BZDB 4DFAA 5I9OA 1IW7D 3GTMB 1CI3M 2AUJD 1ZEQX 3S2HB 1HUMA 2B2UA 4FXKC 4FF3A 1WD0A 4K8JA 2EJMA 1WTWA 2BA0A 2E2HB 1LLRD 4IUNA 5CORA 3FDTA 3HOVB 3URYA 1PTOB 2B2VC 4XTCS 3ND9A 1EU4A 4G7HC 1PFMA 3NTIA 1V8QA 1O7YA 1FD7D 2Z4IA 4NW2A 4ZLTF 5FO7B 1TWFB 1UUPA 1R4PB 2R93B 1AN8A 4KJNA 4KHVA 3IFTA 4DAVA 1C48A 2QEJC 4DF7A 4KMUC 2RDFA 4IN3A 5IIFA 3H0GB 1CZWA 4IURA 1BCPB 1F2ZA 3CQZB 2XNAC 4JK1C 4J8QA 5ELEA 1J8IA 5IT9E 1ML0D 2O5IC 3DWPA 3D3RA 3DHQA 1SNCA 3SK8A 4QCLA 3I73A 4IUPA 1WVLA 3MZ5A 4L63B 1YNND 2TSSA 1ICWA 5KYLA 3J80L 5CV8A 1H9SB 3BDOA 2EE1A 4L8JA 2F3WA 4J1MA 5I6YA 3VR3A 4K8IA 2XIWA 5DEHA 2O5JC 3A54A 4X3KA 4A3EB 3J81L 3HRZC 5CMDA 5IODA 2KCNA 2Z4HA 3PUVA 2B2TC 1EYDA 4P2CB 3TP8A 3H91A 2K5QA 4CKCA 1G291 2F0PA 5JVH3 2RVLA 4S3SA 2EVBA 4CJ0B 5C0XG 3VR2A 2PW7A 4NDXA 1VDZA 3P7JA 1KAAA 2KUMA 2K5WA 4DGZA 2L1BA 5CV9A 4RKLA 1XXGA 4IUQA 3K59A 1CM9A 4FXGC 4DU9A 2E75C 3PO2B 1XYIA 1ZYRD 1PLFA 2R6GA 5AFWA 4RH6A 2XWBB 1DOKA 4R8IA 3QB3A 1EIGA 3Q22A 1F9RA 2EYPA 1EY8A 2MP1A 5D14A 1BQQT 1CTMA 1SJHD 1QWYA 4A3FB 4UDUC 1EEFD 2IPKD 2KCCA 4QF4A 1JB3A 4A3JB 2Q8RE 1RKNA 1O7LA 1PMRA 4DNRB 3PV0A 1G91A 2EJGC 2QDBA 1OXVA 2PPBC 2PCFB 3NHHA 2YYZA 1T5XD 2ZT9C 1Q90A 1TKWB 5IGEA 1H9RA 3PMFA 1OO9B 3S9WA 1MSGA 4RGOS 3KLSA 3I3CA 3VYUA 4C2MB 2HDLA 4ZK9B 5J22A 4X3SA 2G9DA 4DNTB 2A68D 2WINB 2N88A 4X3UA 1ONLA 3M4OB 1KLUD 1W6JA 2EDGA 3M85A 5EQ0A 2KECA 2G9HD 5CBAE 3HEJA 4U68A 1LV9A 4RKBA 1EY6A 2R61A 3D4DA 3EQLC 5M5WB 2OT2A 1I6VC 5BN3A 3TSSA 1Y8NB 5CR3A 3DM1A 4KKTA 3ERQA 5C4JB 1U4RA 1KDBA 5EGTA 1LT4D 1VF5C 1OXUA 5I9PA 2X69A 1GOZA 3SEBA 4OHJA 1D5XC 1MSHA 3TN2A 2A6ED 1E2ZA 2WP8J 3J7AV 2IX0A 1JOOA 1SNPA 4EQNA 4HN7A 3MXNA 2EYOA 5FLXE 5JPNC 1EQTA 4FXDA 3A8IE 4Q5VA 2F0OA 4HMIA 3D4WA 5C0XI 3T53B 3E0JA 3WOFA 4KY7A 2KHSA 3MXPA 3K5LA 2Y0SB 1FYCA 1I4GA 1S4ZA 2WAQB 2B2UC 1DYQA 1BO0A 3U9SA 5LHY1 1DXMA 4C3IB 3IKJA 5DNFA 5K36G 2MGSA 3C46A 4CBVA 4RGMA 4CJ1B 1WTVA 3QOJA 4RFBA 4DAYA 4ZAIA 3P20A 1Z47A 3N6RA 1PTOC 1AEXA 2IL8A 4IUTA 4O1NA 1ZKOA 4K6DA 2KVMA 1U4MA 4A3DB 3PO3B 2PZWA 4HSPA 5EBDA 2EYLA 2V4DA 2A69D 3HGBA 4ZKCB 1GUTA 2SOBA 1DD2A 2X6GA 3HKZB 3K0YA 2MPMA 1RTNA 3MWYW 1BCPC 3HOZB 1S5FD 1D5MC 1LACA 3DMUA 2EJFC 1D2BA 1RTOA 1EYAA 4KJOA 1HPCA 4M8AA 5CV6A 3L9AX 3BYTB 1ET9A 2Q8TA 2MUYA 3K6OA 1I50B 1JWMD 2Z1CA 1S5ED 4BA1I 4RA8A 5IGBA 2C5CA 2D9UA 5T1IA 3I90A 2B2YA 1I3QB 1FR3A 3NBHA 2KOLA 2NZ1D 2DNCA 3QG1A 5ELBA 4BS9A 5KGUA 3GO5A 1V1OA 3VA7A 5HGTA 3D31A 1TU2B 2K03A 1ENCA 4ABNA 1QNUA 2FFKB 1ILPA 1I4PA 3SDZA 4R8NA 4H44C 5IOCA 1M8AA 1CT1D 2JA5B 1I4HA 4ZUJA 2J7ZA 2DN8A 3C3LA 1A6XA 1SDFA 1STAA 2ID0A 1BDOA 3TP6A 1V43A 2F0IA 3ONAB 5COYA 4FP5D 3SE0A 2BOSA 3M3YB 3R3OA 1V1PB 2A74C 5C3EB 4BA2I 2JP1A 2PO4A 3S17B 1PRTF 2VB3X 3K5OA 3QOLA 1PDQA 2QF7A 1DCZA 3VR5A 2IX3A 2NN6H 2DY7A 1HA5A 3R2IA 4G57A 3S1NB 1QG7A 4UAIA 1A3VA 2PZTA 3WDNA 2BE5D 1RHPA 4A3BB 5EPKA 2B39A 4K14A 2I46A 1WCMB 5FOBB 3NUCA 1HRJA 4ID6A 1SMYC 3EJIA 3GTJB 4RCNA 1CK1A 3I4NB 3J7YW 4PQXA 3TZUA 1SYFA 3DXJC 4DA2A 1Z7TA 2C9OA 1HQRD 2J0TD 2RKSA 1JE4A 3H09A 4ME5A 1B44D 1IKMA 1Q1BA 5I2YA 4A3MB 3HOWB 2HQEA 1RJTA 3HOXB 1EY5A 5C0XH 4A3IB 2WKCA 2PMZB 1B53A 2JE6I 3RD4A 1BNZA 2FMMA 4A93B 2F0TA 1EZ6A 2XSCA 2OEOA 2VUMB 2NVTB 4N9TA 4C3JG 4XXEA 4QUCA 5JVG3 1YNJC 4XT1B 1JWSD 4GZYC 4ODGA 3CHBD 1B50A 2YU9B 1D1KA 1KNEA 2A6HC 1HTLD 3GTOB 3C1FA 1SE2A 1DOMA 2E2JB 2F0EA 3S1RB 1QNKA 5I4DA 1EFID 1C8CA 1UAPA 5D3IB 4HTHA 1O7ZA 4NKLA 4RGTA 3WOEA 3K58A 3OIPA 3OMGA 4FNFA 1Q12A 4KTAA 2XRSD 1X32A 4G7OC 1JQYD 1E0BA 2FJ2A 4XYQA 1CA5A 3VR6A 3GP7A 1L0XB 4IFDG 2K32A 3BDCA 1BXTA 2AWOA 4E6IA 1G6ZA 5C5MA 2XVSA 3FVQA 1BF4A 2EYMA 4X3TA 1PRTD 1Q1EA 3A7LA 3V2TA 4XQJA 1STHA 1H9SA 4IALA 5G3LF 3TP5A 3QO2A 2EOTA 2K7VA 2VB2X 2IX1A 4KN7C 1F9QA 2CVRA 1CA6A 4DK1A 3FKIB 1J9OA 3P1HA 3T4AC 5KIXA 3MFGA 2CQAA 2WKDA 4PNYA 2R7ZB 1I6HB 1DJRD 2H1EA 3RZDB 1CHQD 3GTQB 1SYBA 4I7ZC 2RQXA 1UNSA 4HEDA 1Z6HA 5C0XJ 3FEWX 3VYRA 3NQTA 2HDMA 3IAYA 2JEBI 2R92B 4G4KA 1MI2A 3T13A 1LTSD 1A2TA 2FMCA 4PV1C 4RGNA 1ENAA 1NSNS 2L5TA 2WACA 1E2WA 2X6LA 4EGVA 3H94A 5TSSA 3V96A 4K2LA 4HCEA 4XT3B 1SNOA 3I91A 2CW0C 2MHVA 4LAAA 4ZUIA 5KNCA 2EY5A 4OIKA 3DEOA 1TVXA 3MAQA 2F4IA 1HQMC 1EY7A 2NUCA 2LMCB 3V05A 2EXZA 5CV4A 1JOKA 4OO1H 1ZXTA 3J81E 2A73B 3PIO3 3K57A 1A3UA 3M7NA 1JOQA 1VMCA 3K5NA 3OOCA 4F8MA 3GTGB 2B2YC 1G2TA 1F9PA 2KEDA 1X3PA 3EFXD 1SSOA 4I65A 4Y7NB 1WD1A 4B9XA 5G3LD 3NTHA 1A2UA 2F3VA 1ILQA 3P75A 3IFDA 3MVVA 4C1NK 5FKAC 2K04A 1HUNA 1JORA 1SEBD 1IW7C 3PUXA 2RSNA 1B4OA 3OWFA 1T5EA 5KNBA 1KDCA 2EYJA 3KK7A 4IFDI 1NR2A 2NWGA 1EWHA 3J7AF 4KD3A 1HFGA 5M9OA 2E2DC 3D8GA 5M5YB 1NAPA 2F0GA 3DUZA 2XRQD 1GXDC 2O2LD 1OXTA 1B1ZA 4Q0FA 4QMGA 3VYSA 3SXHA 2MJ8A 1O78A 3NXWA 1EEID 1STYA 2KJXA 4KN4C 5JEAG 4ILWA 1Y1VB 2K01A 1PFNA 2IWHA 3VA5A 1TWGB 2L12A 5DM63 1TIID 4WJWA 1WTOA 1EY4A 5E4XA 4KY6A 1KABA 3SVMA 5D65A 3QIAA 3KUPA 3DEPA 1CHPD 3E6ZX 2AQ3B 5CBEE 3R93A 4C3HB 3NP8A 2JXMB 3O13A 4H7BA 3S15B 1XTCD 3BS1A 1PZID 3OSOA 5C3XA 1YNNC 1GJXA 1SYEA 1Y1WB 3JAML 1LTAD 1NUCA 3CU7A 3M4YA 1D6EC 1FGBD 2NYZD 1VMPA 3PUZA 1TY2A 2M00A 3H6MA 3SR1A 1GHKA 4K2KA 1RDPD 2F0VA 2JEAI 1X3QA 2LFNA 5M3MB 4PMWA 4G7ZC 1BUVT 2F0NA 2F0DA 2H4OA 2NTTA 3SK6A 3I4MB 5LL6X 4A3GB 2JA8B 3MEHA 2HCIA 3GV3A 3EVQA 1TS4A 3HOYB 1HA6A 5BN4A 3S14B 2TMPA 3SHLA 4CKEA 2L0CA 2PW5A 2SNSA 5FO9B 2K1BA 3G6JB 3NBIA 5A2QL 1FNUA 2K28A 2N55A 1BBXC 1I4XA 5E4WC 1ZYRC 5C5LA 5JPMC 1XX8A 2AWNA 4TSSA 5ISRA 2NVQB 2EY1A 5KRUA 3AB9A 2IJ0A 3BVGA 3VR4A 1GUNA 2ICIA 2F03A 1EWCA 2JYOA 3I8ZA 4C3HG 1GUGA 1Q3LA 1H9KA 2NVXB 2DNEA 1ESFA 2AUKA 3DWAA 3M7GA 4C3IG 2F1MA 2EY2A 3FRPB 2HUGA 2WB1B 3F2UA 3K7AB 4B08A 4K5WA 1ENFA 3TDQA 2EY6A 4HSVA 1QILA 3PUYA 1JC7A 1S5CD 4DXFA 3MTSA 1V1PA 4CHTB 2EZVA 3D6WA 4NP5A 1SYCA 3I72A 3LX0A 1VCIA 1IHZA 3TP7A 2FHTA 3I4LA 5EPJA 2EYHA 4IFDH 3L3OC 1EOTA 2A68C 4BY1B 3HOUB 3NK9A 2J4XA 2F0QA 1IL8A 1XWEA 1CQFA 3MC0B 4K6LA 1DZ1A 3ND8A 5C4XB 3T16A 3NTKA 3Q6SA 1DM0B 2IT1A 4QIWB 3OWEB 1PYWD 2LY7A 5FO8B 1Y69U 1CQVA 4HAEA 4L6TB 5IGFA 5EKIA 2SEBD 1LT6D 3FMCA 2A5HA 1STGA 2AQ1B 1PTOF 4RCOA 1U4PA 2PZUA 3A7AB 1JCKB 3PUWA 3FPPA 3N52A 1M4VA 2BA1A 5EPLA 1EY9A 3OW7A 3H3VC 5M5XB 1W6KA 3LWEA 3Q24A 1LT3D 3NPPA 5CYUA 4M1UB 4DAPA 2Q8IB 4K5VA 1PZJD 1ET6A 5EKLA 5IGCA 1EYCA 5EKKA 1RD9D 2NVYB 5ELCA 2ICEC 2I07B 1PTOH 5IT9L 1OXSC 5A35A 4WRDA 2A6EC 3NQIA 1QB5D 4EQPA 1PRTB 3I70A 3ITPA 4KV6A 1BCPF 4EVOA 1PZKD 1GUOA 1KNAA 5LL6S 2NTSA 5HURA 1MGSA 2F0WA 3TZDA 3E5SA 4RHRA 4PMCA 4K5XA 3HZXA 3OIQA 2ZXPA 1HHVA 3NWTA 4IZ8A 3RLFA 3BYYB 1F2LA 1LABA 4ZQ3A 4O42A 3DWQA 4KK7A 5E3FA 1QOHA 5KYIA 1B2TA 1S5DD 4B9WA 5M3FB 4RWSC 3Q0AA 2B63B 4IUUA 2KQ3A 1IYVA 1C4QA 3T51B 3FPUB 4DN4M 3D4RA 1CFMA 2Z8LA 3MXUA 3BG3A 3CRLC 1S5BD 2F0MA 4FYDA 2NBFA 3VYTA 1AZPA 1RF2D 3NWSA 2F0HA 2A69C 4OGQC 4IFDJ 2F0FA 4JBWA 3TBIB 2ZXRA 3GV6A 5C6AA 1R4QB 3SK5A 4U673 1EQVA 2PQEA 5KNDA 1OXXK 4OIJA 5C3WA 1WTRA 3MA2B 2ENBA 4TKOB 1SNMA 3KLRA 1SFOB 4N9PA 3NE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DY8 A;  2HCC A;  1U4L A;  1XYI A;  1WD1 A;  3G7L A;  1PLF A;  4QUC A;  1NCV A;  2JYO A;  3I8Z A;  5AFW A;  4IUR A;  1ILQ A;  1Q3L A;  4XT1 B;  1HFN A;  3IFD A;  3DM1 A;  1JIC A;  4HED A;  4ZKC B;  1DOK A;  2HDM A;  4R8I A;  2K04 A;  1AZQ A;  1EL0 A;  1G2S A;  1HUN A;  2BDN A;  1U4R A;  1B50 A;  1EIG A;  2B2W A;  1J8I A;  5EJW A;  2HUG A;  1KNE A;  1F9S A;  1ML0 D;  5JJZ A;  2X6G A;  1KNA A;  3F2U A;  2RSN A;  2JP1 A;  1B4O A;  4R9W A;  1F9R A;  2NYZ D;  1VMP A;  1MGS A;  4HSV A;  1DOM A;  2L9H A;  1PDQ A;  2MP1 A;  3TZD A;  2X69 A;  5D14 A;  1QNK A;  1MI2 A;  1NR2 A;  2MPM A;  1RTN A;  2NWG A;  3MWY W;  3MTS A;  4IUP A;  2DY7 A;  2VXW A;  1WVL A;  1WTQ A;  2KEE A;  1C8C A;  1MSH A;  1X3Q A;  1HFG A;  3D6W A;  1O7Z A;  3TN2 A;  3H91 A;  1QG7 A;  4UAI A;  1ROD A;  2EPB A;  1RTO A;  1HHV A;  3IL8 A;  1RHP A;  2Q8R E;  5EPK A;  1ICW A;  1DON A;  1NAP A;  2B2T A;  2FHT A;  1HRJ A;  5EPJ A;  1X32 A;  2M2L A;  1EQT A;  1F2L A;  2B2W C;  1HUM A;  2B2U A;  1G91 A;  2X6L A;  2B2V A;  4O42 A;  2Q8T A;  1E0B A;  4RAU C;  2HCI A;  2FJ2 A;  1CA5 A;  3GV3 A;  1WD0 A;  2EE1 A;  1EOT A;  1B2T A;  1G6Z A;  1WTW A;  4RA8 A;  4RWS C;  4XT3 B;  2XIW A;  1IL8 A;  4IUV A;  4ZKB B;  1BF4 A;  4X3T A;  4IUU A;  3I91 A;  1WTO A;  1MSG A;  1DOL A;  1DZ1 A;  1EIH A;  2D9U A;  1HA6 A;  3I3C A;  4HCS A;  5T1I A;  3I90 A;  2B2Y A;  4X3K A;  2MJ8 A;  4CJ2 C;  1JE4 A;  3FPU B;  2KOL A;  3Q6S A;  4DN4 M;  4OIK A;  4MN3 A;  2HDL A;  2NZ1 D;  3DEO A;  5COR A;  5T1G A;  4ZK9 B;  1AP0 A;  1TVX A;  1IKM A;  5CMD A;  3FDT A;  4X3S A;  3UI2 A;  3QO2 A;  2B2T C;  4HAE A;  2SDF A;  1S4Z A;  1B3A A;  5EKI A;  2K1B A;  2FIN B;  3HP3 A;  2B2U C;  1ESR A;  1RJT A;  1SAP A;  2B2V C;  1ZXT A;  2EOT A;  2K03 A;  2K28 A;  1BO0 A;  2FFK B;  2N55 A;  2R3Z A;  1AZP A;  1ILP A;  1GUW A;  2K01 A;  1QE6 A;  2RVL A;  4LMQ D;  1PFN A;  1PFM A;  1WTP A;  2N88 A;  4X3U A;  4CJ0 B;  1BBX C;  1IKL A;  2L12 A;  4XDX A;  1F9Q A;  1O80 A;  1A15 A;  5E4W C;  1O7Y A;  1U4P A;  3P7J A;  2CVR A;  5DNF A;  1CA6 A;  1XX8 A;  1B53 A;  2KUM A;  2MGS A;  1M8A A;  1PFB A;  1J9O A;  2L11 A;  3GV6 A;  4NW2 A;  5E4X A;  4ZLT F;  3N52 A;  1VMC A;  4CJ1 B;  1WTV A;  3SVM A;  5D65 A;  4QUF A;  2J7Z A;  2L1B A;  5EPL A;  4ZAI A;  2FMM A;  3KUP A;  2B2Y C;  2RA4 A;  5EQ0 A;  3DEP A;  4MHE A;  1BNZ A;  3KBX A;  1G2T A;  1F9P A;  4OIJ A;  1WTR A;  1WTX A;  4IUQ A;  2IL8 A;  1CM9 A;  2KEC A;  1SDF A;  2KED A;  2RSO A;  3LWE A;  4IUT A;  3R93 A;  5CBE E;  1X3P A;  2KVM A;  5CBA E;  4U68 A;  1LV9 A;  2H1E A;  1NR4 A;  2L4N A;  1SSO A;  3ONA B;  5COY A;  2K05 A;  1U4M A; 
#chains in the Genus database with same CATH topology
 5CC4 A;  4X66 L;  3F2D A;  1N32 Q;  2NN6 G;  2O4X A;  4X6A H;  4V0B A;  4A3M G;  2OQK A;  3HOW G;  4XYO A;  1TY0 A;  3CW2 C;  3HOX G;  4QL5 A;  1MJE A;  1HR0 W;  3R8B A;  4I7A A;  3JAM c;  2BDN A;  4A3I G;  3GTK B;  1PTO D;  2B2W A;  4NMZ A;  4AYB B;  1CKO A;  1KTK A;  1HR0 Q;  1F77 A;  2D5D A;  1TS2 A;  5C44 B;  1X9N A;  3CP0 A;  2WII B;  4A93 G;  1WTQ A;  4LK1 C;  3CRK C;  4L5S A;  4LJZ C;  1ROD A;  2SNM A;  2OF1 A;  3PO2 H;  3KLS X;  2K50 A;  4YIJ A;  2A8V A;  4HJ9 A;  1YIT A;  2WFW A;  2VNU D;  3TME A;  1I4R A;  3T56 B;  4JI4 Q;  2F0S A;  1TWA B;  2VQF L;  4F88 A;  2XN9 C;  1SE4 A;  2EYF A;  1S40 A;  5BN5 A;  1SYG A;  1L0Y B;  2ES2 A;  1BCP D;  3AFP A;  1A3T A;  1SRU A;  1ICF B;  2K5D A;  4KHZ A;  1D1I A;  1C0A A;  4POG A;  1STE A;  1STN A;  1KRT A;  1KDA A;  1PVO A;  4WOR A;  3AYH B;  5FK9 C;  3F8T A;  4A3F H;  3UI2 A;  4KHP Q;  4LFB Q;  1VQC A;  3HP3 A;  3CD6 A;  5JEA H;  1SAP A;  4A3J H;  4IQZ A;  2RHQ B;  2UXC L;  1PH3 A;  4H13 C;  1EOV A;  4OL7 A;  3J80 E;  3I2Z A;  1O80 A;  1A15 A;  1QUQ A;  5K5P A;  1QCB D;  4KKS A;  4GLV B;  1SE3 A;  3EN2 A;  3S1Q B;  4H02 A;  5JOB A;  4JI0 L;  3GQB A;  5LMN W;  3A74 A;  3AU7 A;  4EQO A;  1LTG D;  5IP9 G;  3UDX A;  3S16 B;  3GD7 A;  2L4N A;  3KBG A;  2BCO A;  2B3G A;  4QJF A;  4AQY Q;  4C2M H;  2DUD A;  4DV4 Q;  3MFY A;  1U4L A;  1BOS A;  2IW3 A;  1NCV A;  1JR0 D;  5K36 H;  2KCT A;  3Q23 A;  1JIC A;  2OXP A;  1BBU A;  2F0K A;  5LMU Q;  1VQI A;  1VQ9 A;  2E74 C;  1G2S A;  2BE5 C;  3U4Z A;  3W3A A;  5CV5 A;  3M4O H;  1LYL A;  4XQQ A;  1A8V A;  1U9R A;  4OXP A;  4HJ8 A;  2QCP X;  3FKI G;  4KI0 A;  1FNW A;  1TR5 A;  5EBC A;  4KD4 A;  3RZO B;  5FLM H;  5F2D A;  5DLQ E;  2KEE A;  5FLX L;  2R7Z G;  2LS0 1;  4V19 0;  5I2X A;  1VQK A;  1YJW A;  3A55 A;  1CZG A;  2EPB A;  1TS3 A;  3W2D A;  4WFN 3;  1LTT D;  3KFU A;  3HFZ B;  5M5W H;  2UXB Q;  4N8X 1;  3HG9 A;  1N8R C;  1YIJ A;  2M2L A;  1BR9 A;  2B2V A;  2YTX A;  4ZRZ A;  5KEE A;  4RAU C;  2L55 A;  4X65 L;  4GNX B;  1LTI D;  5C4J H;  3PF4 A;  4A3L G;  5JAV A;  4A4I A;  2R92 G;  1UEA B;  4DV6 Q;  1KQS A;  4ZKB B;  3OYY A;  1NBW A;  2QDL A;  3RNU A;  1V9P A;  1E2V A;  4JBJ A;  3S2D B;  1B8A A;  4CJ2 C;  4JI3 L;  1MJC A;  4IPD A;  4X62 Q;  1SMY D;  4CDE C;  4QQB X;  2FIN B;  2GA4 B;  2K33 A;  3LWU A;  5DAU A;  1VQ5 A;  4FF2 A;  1HXY D;  4FVM A;  2R3Z A;  2E2I B;  1SJE D;  1MHW C;  5CV7 A;  1WTP A;  1B9M A;  4J6H A;  5IE8 A;  2NN6 I;  1PFB A;  3CKI B;  2L11 A;  2N78 A;  4LF7 Q;  4DV3 L;  5ELD A;  2LXK A;  1K8M A;  1XNQ L;  5D3D A;  3K5M A;  1F2M A;  1SN8 A;  3OHX C;  3NEN A;  1TWC B;  3CXC A;  1LT5 D;  1Q7Y C;  4DPG A;  2CHB D;  1II3 A;  5E1F A;  2ZXO A;  2AKW B;  1RCV D;  2I5H A;  3KF8 A;  5IT9 c;  2RDH A;  2PYK A;  1VQA A;  3G7L A;  5JEA J;  4KY5 A;  1Q46 A;  1GUS A;  4PMB A;  4C3I H;  2D62 A;  1B70 B;  2XWJ B;  2B8F A;  4BY7 B;  5EJW A;  5JJZ A;  3MXN B;  1Q82 C;  4ULL A;  2BDO A;  5ELO A;  4LFC L;  3NSW A;  1JJG A;  4DV0 Q;  3BDL A;  1S3O A;  3MXG A;  3AEV A;  1HNZ L;  1MD2 D;  5IWA Q;  1F2Y A;  1Y8P B;  1YNJ D;  3BVM A;  2UXD L;  3R2T A;  3RMH A;  2K6A A;  1PRT C;  3A8J E;  3M4Q A;  4A3D H;  3PO3 H;  3IL8 A;  4YY3 Q;  1PH1 A;  3CMA A;  1K8O A;  4DAM A;  1BVS A;  2RDG A;  4EX5 A;  2A6H D;  5C4H A;  2B2T A;  1TWH B;  3ZYY X;  5J1Z A;  5IGG A;  4RHS A;  4IPC A;  1YNX A;  4OO1 G;  1IXR A;  4HIK A;  2WV6 D;  5IYC H;  4ZYS A;  4A3K B;  1GHJ A;  4IUV A;  2F0U A;  4LWC A;  4FF1 A;  1YJ9 A;  3U9O A;  3CC7 A;  5C4Z A;  1LO5 D;  1L1O A;  3EA6 A;  1SYD A;  4MN3 A;  5T1G A;  2ATW A;  3HOZ H;  2PNR C;  3QJY A;  4HR7 B;  1FNV A;  3G6E A;  1B3A A;  2EXD A;  1ESR A;  4DR4 Q;  1GUW A;  1XPU A;  5ELF A;  1QE6 A;  3K81 C;  1IKL A;  2Z0S A;  4Z9C B;  1QJO A;  4C56 C;  1I50 H;  4DV5 L;  2B8G A;  4QUF A;  1AFP A;  4DXG A;  2ZM6 L;  3KYH C;  1E3P A;  3KBX A;  1WTX A;  1Y8O B;  1TT2 A;  4B3M L;  2RSO A;  4LFA L;  1I4Q A;  1AW7 A;  1K83 B;  1EU3 A;  1I3Q H;  1IBL Q;  1NR4 A;  1LTB D;  3QWN A;  2K05 A;  1SNQ A;  3X3M A;  5GAE C;  4K0K L;  1HCZ A;  1PXU A;  2RBM A;  3Q8D A;  3G48 A;  4XQN A;  1HFN A;  1IBK L;  2JQO A;  2HHH Q;  3X3N A;  1N36 L;  1Y1V G;  4P73 A;  4DV2 L;  4O0A A;  1B7Y B;  1PH6 A;  2PI2 A;  1FL0 A;  4F7X A;  2JA5 H;  4R9W A;  3AMU A;  1Q8I A;  2L9H A;  3D6C A;  1HZ9 A;  4BY7 G;  4F87 A;  5AJ3 L;  4UPA A;  4BBS B;  3JAM E;  3GDE A;  1GD7 A;  2VXW A;  5J39 A;  2F0L A;  2KA7 A;  2JA6 B;  5GRO A;  1H9M A;  3C2P A;  4GKK L;  1LTR D;  1DON A;  2QIL A;  1H9J A;  4OWX B;  3NBH B;  3M3Y H;  1G8Z D;  2B2W C;  3L7Z C;  4DUZ L;  4MTK A;  1JWU D;  3ERO A;  4CGY B;  4TRD A;  2A19 A;  2VY3 A;  5C3E H;  1VF7 A;  3OW2 A;  2WB1 E;  1Y1W G;  3S17 H;  2AQ2 B;  2JSO A;  1DOL A;  2QKI C;  1XNR Q;  1EIH A;  4XIG S;  1SBB B;  1SND A;  3A8K E;  4MIU A;  4FO2 A;  2K14 A;  1TQO A;  1UEB A;  5IYD G;  4HJ7 A;  1AP0 A;  4C3J B;  2F0J A;  3MHB A;  4BWG B;  3S1N H;  1MBY A;  3I7F A;  2SDF A;  5IGD A;  5M3M G;  1PH5 A;  4BBR B;  1D5Z C;  4GN5 A;  4A3B H;  1L0W A;  1EZ8 A;  1STB A;  1WCM H;  3SK4 A;  4DR1 L;  4LMQ D;  4CKB A;  2UUA Q;  3HS0 C;  4XDX A;  5L37 A;  4JI7 L;  1VQ8 A;  3S1M B;  3I4M G;  2CW0 D;  4A3G G;  3C1E A;  4KKU A;  1VQD A;  5A2Q E;  3GTJ H;  2JA8 G;  2NZH A;  4C1N I;  1PH2 A;  3I4N H;  3PIP 3;  1IYU A;  3GTP B;  3LNN A;  2RA4 A;  3BVZ A;  1KLG D;  1I94 L;  4MHE A;  4TQU S;  1HNW L;  3HOY G;  4YCV A;  4DK0 A;  3TS0 A;  2LKV A;  2MNA A;  4HCS A;  3RUZ A;  2KHI A;  4QIW E;  2DY8 A;  4H0L C;  1WTH A;  2HCC A;  4HMJ A;  2M9V A;  1HNX Q;  3CPW A;  1XPR A;  1PYB A;  3OPO A;  4GKJ L;  4A3M H;  2D2C C;  3HOW H;  1SXT A;  1TS5 A;  3HOX H;  2KHJ A;  4JI5 L;  5IYB G;  4IOA A;  2D0P A;  4A3I H;  1AZQ A;  1EL0 A;  5NUC A;  1HTP A;  1F9S A;  2NB0 A;  3A56 A;  1YEZ A;  3GTL B;  2I0Q A;  5CGK A;  5DM7 3;  2E5L L;  3A5U A;  1R9T B;  4OO1 I;  5I6W A;  1B9N A;  1EY0 A;  4A93 H;  3OMC A;  4FF4 A;  2JA7 B;  2E76 C;  2JK8 A;  4QB4 A;  2VUM H;  3BZD B;  4DFA A;  1MIU A;  4MNO A;  2NVT H;  1LTL A;  2MQH A;  4UP9 A;  4JI2 Q;  4OX9 L;  5I9O A;  1IW7 D;  4A3E H;  3GTM B;  1CI3 M;  2AUJ D;  1ZEQ X;  3S2H B;  1HUM A;  2B2U A;  4FXK C;  3PIO A;  4LF4 Q;  4FF3 A;  3U50 C;  5IP7 G;  1WD0 A;  2YU9 H;  1K3R A;  4K8J A;  1AH9 A;  2EJM A;  1WTW A;  3GTO H;  1VQM A;  2WB1 G;  2HT1 A;  2BA0 A;  4NXM Q;  3F2C A;  3CF5 A;  2E2J H;  1LLR D;  2E2H B;  4IUN A;  5HY6 A;  3S1R H;  1SE8 A;  3DM3 A;  5COR A;  1T9H A;  3FDT A;  3HOV B;  1GO3 E;  3URY A;  1D8L A;  1PTO B;  4L5R C;  2UUB Q;  2B2V C;  4R1J A;  4XTC S;  1EIY B;  4QGU A;  3ND9 A;  1EU4 A;  4RMF A;  4G7H C;  1PFM A;  3NTI A;  1V8Q A;  1O7Y A;  1FD7 D;  2Z4I A;  4NW2 A;  4ZLT F;  5FO7 B;  1TWF B;  1UUP A;  1R4P B;  4YWL A;  4BY1 G;  3HOU G;  2R93 B;  1AN8 A;  4KJN A;  4KHV A;  3WWV A;  3IFT A;  4DAV A;  1C48 A;  4A75 A;  4DR2 L;  4B3S L;  2CKZ B;  2PQA A;  2QEJ C;  2HQL A;  1FJG Q;  5C4X G;  4DF7 A;  4KMU C;  2RDF A;  4JG2 A;  4UP7 A;  2PQA B;  4IN3 A;  5IIF A;  3H0G B;  3UDI A;  1CZW A;  4IUR A;  4DR6 L;  4R4C A;  1BCP B;  1F2Z A;  3CQZ B;  2XNA C;  4JK1 C;  4UHV A;  4J8Q A;  1YBY A;  2KCM A;  4JYA Q;  5ELE A;  4IPG A;  1J8I A;  2C35 B;  5IT9 E;  1ML0 D;  3FKI H;  4L5Q A;  2O5I C;  3S24 A;  3DWP A;  3D3R A;  3DHQ A;  1SNC A;  3SK8 A;  4QCL A;  2DJG C;  3JC6 6;  3L2P A;  1YHA A;  2K5V A;  3I73 A;  2R7Z H;  1I6H H;  4IUP A;  1WVL A;  3MZ5 A;  3RZD H;  4L63 B;  4JV5 L;  1YNN D;  4X66 Q;  3GTQ H;  2TSS A;  3G71 A;  4BXX H;  1ICW A;  4DV7 L;  5KYL A;  3J80 L;  1N32 L;  5CV8 A;  1H9S B;  3BDO A;  2EE1 A;  4L8J A;  3RN5 A;  2F3W A;  2R92 H;  4J1M A;  5I6Y A;  4AYB E;  3VR3 A;  3G4S A;  4K8I A;  2XIW A;  5DEH A;  1EWI A;  2O5J C;  3A54 A;  3T1H Q;  4X3K A;  1FVI A;  2EQS A;  4A3E B;  3J81 L;  3HRZ C;  1QZG A;  5CMD A;  5IOD A;  2KCN A;  2Z4H A;  3PUV A;  2B2T C;  1EYD A;  3HKS A;  5JJL A;  4P2C B;  1DGS A;  3TP8 A;  3H91 A;  2K5Q A;  4CKC A;  1G29 1;  4CDD C;  2F0P A;  5JVH 3;  2RVL A;  4S3S A;  2EVB A;  4CJ0 B;  5C0X G;  3E3X A;  3VR2 A;  2PW7 A;  4NDX A;  1K3B C;  1VDZ A;  3P7J A;  1KAA A;  2KUM A;  2I5L X;  2K5W A;  4P75 A;  1IBM Q;  4DGZ A;  2L1B A;  5M3F G;  5CV9 A;  4JCV E;  4RKL A;  4X64 L;  1L1O C;  1XXG A;  4IUQ A;  3K59 A;  1CM9 A;  2B63 G;  4FXG C;  4JI8 L;  4DU9 A;  4YHH L;  2E75 C;  3CCV A;  4UY8 C;  3PO2 B;  1XYI A;  2LSS A;  3J81 j;  1Y14 B;  1ZYR D;  1PLF A;  2R6G A;  2QW7 A;  5AFW A;  4RH6 A;  3H3V H;  2RHS B;  2XWB B;  4LFB L;  1TXY A;  3CME A;  1U0L A;  4JI6 Q;  2UXC Q;  1DOK A;  3I4O A;  4R8I A;  3QB3 A;  1XPO A;  1EIG A;  3ZJY C;  3OTO L;  2XTI A;  3Q22 A;  1F9R A;  3GTG H;  2V1C C;  4JI0 Q;  2EYP A;  1EY8 A;  2MP1 A;  4LUZ A;  5D14 A;  5LMN Q;  1BQQ T;  1CTM A;  1YVC A;  1SJH D;  1QWY A;  1KC8 C;  4LF5 Q;  4A3F B;  4UDU C;  1EEF D;  4Y7N H;  2IPK D;  2KCC A;  4QF4 A;  1JB3 A;  5JJK A;  4JI1 Q;  4A3J B;  2Q8R E;  1RKN A;  5GAG C;  1K0R A;  1O7L A;  1PMR A;  4DNR B;  3W5O A;  3PV0 A;  1G91 A;  2EJG C;  2QDB A;  1A62 A;  1OXV A;  3KJO A;  2PPB C;  2PCF B;  1CSQ A;  1VQP A;  3NHH A;  2YYZ A;  1T5X D;  2ZT9 C;  1Q90 A;  1PYS B;  1TKW B;  5IGE A;  4AYB G;  3U58 A;  2Z9H A;  1H9R A;  3PMF A;  1HJP A;  1OO9 B;  4JC0 A;  3S9W A;  1MSG A;  4RGO S;  3KLS A;  4GOP B;  3I3C A;  3BJU A;  3VYU A;  3PF5 A;  4C2M B;  2HDL A;  4ZK9 B;  5C44 G;  2QA4 A;  4B3R Q;  3CC2 A;  1N9W A;  5J22 A;  4X3S A;  4GNX A;  2G9D A;  4DNT B;  2A68 D;  5M5Y H;  2WIN B;  2N88 A;  4X3U A;  3AQQ A;  1ONL A;  3M4O B;  1KLU D;  4OEL B;  2A1A A;  1W6J A;  1FGU A;  4WJ4 A;  2EDG A;  3M85 A;  5EQ0 A;  1JE5 A;  1CKN A;  1PH7 A;  2UUC Q;  2IY5 B;  2KEC A;  2G9H D;  1KHI A;  5CBA E;  3HEJ A;  4U68 A;  1LV9 A;  4RKB A;  1CKN B;  1H95 A;  1EY6 A;  1NTG A;  2R61 A;  3D4D A;  3EQL C;  3RLO A;  5M5W B;  2OT2 A;  3U4V A;  1I6V C;  5BN3 A;  3TSS A;  2AHO B;  1Y8N B;  5CR3 A;  1XMO Q;  1AE3 A;  3DM1 A;  4CDF C;  1Y1V H;  2F3I A;  4KKT A;  1TWG H;  3ERQ A;  5C4J B;  1U4R A;  1JJC B;  1KDB A;  4PZ7 A;  1CSP A;  3STB D;  5EGT A;  4LNQ A;  1LT4 D;  1VF5 C;  1OXU A;  4DV3 Q;  2Z6B A;  5I9P A;  2R7F A;  3W1G A;  2X69 A;  2CWA A;  1XMQ Q;  1GOZ A;  4NXN Q;  3SEB A;  2AMC B;  4OHJ A;  1D5X C;  1K9M C;  4C3H H;  3J7Z C;  1MSH A;  3TN2 A;  4L5T A;  3H15 A;  2A6E D;  1VS0 A;  1E2Z A;  2WP8 J;  3J7A V;  2IX0 A;  3M9B A;  1JOO A;  4R4I A;  1NNX A;  1SNP A;  4EQN A;  4HN7 A;  3MXN A;  4DUY L;  3S15 H;  2EYO A;  3KDF B;  1EFW A;  5FLX E;  3E0E A;  5JPN C;  1EQT A;  4J15 A;  1EQR A;  4FXD A;  5GAD C;  1PH8 A;  3A8I E;  4Q5V A;  1Y1W H;  2F0O A;  4HMI A;  5FJ8 G;  3D4W A;  4LFC Q;  5C0X I;  3T53 B;  3E0J A;  3WOF A;  4KY7 A;  2KHS A;  5IYD H;  2GVA A;  3MXP A;  3K5L A;  1O7I A;  3NEL A;  2Y0S B;  3E9H A;  1FYC A;  5M3M H;  2MFI A;  1W2B A;  1I4G A;  1S4Z A;  2WAQ B;  2B2U C;  5BR8 L;  1DYQ A;  3IRB A;  1BO0 A;  4YY3 L;  3U9S A;  5LHY 1;  1DXM A;  4HJA A;  4C3I B;  3IKJ A;  1Q81 C;  3A5Z B;  3I4M H;  4A3G H;  2JA8 H;  1WFQ A;  5DNF A;  5K36 G;  1HH2 P;  2MGS A;  3C46 A;  4CBV A;  4RGM A;  4CJ1 B;  1WTV A;  3QOJ A;  4RFB A;  4DAY A;  4ZAI A;  3P20 A;  1NMF A;  3HOY H;  1Z47 A;  3N6R A;  1PTO C;  1AEX A;  2IL8 A;  4IUT A;  4O1N A;  1GKH A;  1ZKO A;  4DAY B;  4K6D A;  3PSI A;  1WJJ A;  2KVM A;  1JB7 A;  4DK6 C;  3F2B A;  4LF9 Q;  3S14 H;  1U4M A;  4A3D B;  3PO3 B;  2PZW A;  4HSP A;  5EBD A;  5FLM G;  2EYL A;  4MTN A;  4QY7 A;  2V4D A;  3MEF A;  2A69 D;  3HGB A;  4ZKC B;  1GUT A;  1YHB A;  1EYG A;  4DR4 L;  4DNI A;  2SOB A;  1PH4 A;  1DD2 A;  3UE0 A;  4LUO A;  4YWM A;  2X6G A;  3CCJ A;  3HKZ B;  3CCU A;  3UDG A;  2RCN A;  3K0Y A;  2JJQ A;  2ZM6 Q;  2NVQ H;  1N33 Q;  2MPM A;  1RTN A;  3MWY W;  1BCP C;  4TVA B;  4LFA Q;  4CDC C;  4B3M Q;  3HOZ B;  1S5F D;  1D5M C;  1G6P A;  1LAC A;  3DMU A;  1VQB A;  2EJF C;  1D2B A;  1RTO A;  1EYA A;  4KJO A;  3J80 c;  1HPC A;  4M8A A;  1PA6 A;  5CV6 A;  3L9A X;  3BYT B;  1N36 Q;  1ET9 A;  3VDY A;  5IP7 H;  2Q8T A;  2MUY A;  3K6O A;  2HHH L;  1I50 B;  1JWM D;  1P16 A;  2Z1C A;  1KRS A;  1S5E D;  4BA1 I;  3PCO B;  2VQE Q;  4RA8 A;  5IGB A;  2OWO A;  3K7A H;  2C5C A;  3BZC A;  2D9U A;  4A76 A;  2Q2T A;  5T1I A;  3J81 c;  3I90 A;  2B2Y A;  2PI2 E;  1I3Q B;  1FR3 A;  2MO0 A;  3NBH A;  4PG3 A;  2KOL A;  2NZ1 D;  2DNC A;  1N34 L;  3QG1 A;  5ELB A;  4BS9 A;  3CCM A;  5KGU A;  3GO5 A;  1IZ6 A;  1V1O A;  3VA7 A;  5HGT A;  1NE3 A;  3D31 A;  1TU2 B;  2K03 A;  1ENC A;  4ABN A;  1QNU A;  2FFK B;  1ILP A;  3CPF A;  1I4P A;  3SDZ A;  4R8N A;  4H44 C;  4DUZ Q;  4LF8 L;  5IOC A;  1PFS A;  1PH9 A;  1M8A A;  2JA9 A;  1CT1 D;  2JA5 B;  4BY1 H;  3HOU H;  1I4H A;  2JN4 A;  4ZUJ A;  2J7Z A;  2DN8 A;  2F4V Q;  3C3L A;  1A6X A;  1JJ2 A;  4A3K G;  1SDF A;  1STA A;  2ID0 A;  5C4X H;  1BDO A;  1XNR L;  3TP6 A;  1V43 A;  2F0I A;  3ONA B;  5COY A;  4FP5 D;  3SE0 A;  2BOS A;  2YTV A;  4LF6 L;  2IHE A;  3M3Y B;  3R3O A;  1V1P B;  1JT8 A;  1HZC A;  2A74 C;  4JI7 Q;  4EQ5 A;  5C3E B;  4DR7 L;  4BA2 I;  2JP1 A;  4RG1 A;  2PO4 A;  3S17 B;  1PRT F;  2VB3 X;  3K5O A;  3QOL A;  1I94 Q;  4DR5 L;  1PDQ A;  2QF7 A;  1DCZ A;  2HIX A;  5M5X H;  3VR5 A;  5IYC G;  3CCQ A;  2IX3 A;  2NN6 H;  2DY7 A;  1HA5 A;  3R2I A;  4G57 A;  3S1N B;  1QG7 A;  4UAI A;  1A3V A;  2PZT A;  2QEX A;  3WDN A;  2BE5 D;  1RHP A;  2NVY H;  4A3B B;  5EPK A;  2B39 A;  4K14 A;  1B3Q A;  2I46 A;  1WCM B;  5FOB B;  4GKJ Q;  3NUC A;  1HRJ A;  4ID6 A;  1SMY C;  3EJI A;  3GTJ B;  4RCN A;  1KIX A;  1CK1 A;  3I4N B;  3J7Y W;  1S72 A;  4PQX A;  3TZU A;  1SYF A;  3DXJ C;  4DA2 A;  1Z7T A;  2C9O A;  1HQR D;  2J0T D;  1QVC A;  2RKS A;  1JE4 A;  3DLL A;  2VZA A;  3H09 A;  4ME5 A;  1B44 D;  1EIF A;  4BBS G;  1IKM A;  1Q1B A;  1UE7 A;  5I2Y A;  2N49 A;  4FDB A;  2JA6 G;  4A3M B;  1YZ6 A;  3HOW B;  2HQE A;  1RJT A;  3HOX B;  2XGT A;  4R4Q A;  4OX9 Q;  1EY5 A;  5C0X H;  3AFQ A;  4A3I B;  3ERS X;  4GOP C;  2WKC A;  2PMZ B;  2RCF A;  1B53 A;  2JE6 I;  1E22 A;  3LGJ A;  3RD4 A;  5M3F H;  1BNZ A;  4HIM A;  2FMM A;  5H1S E;  2F52 A;  2B63 H;  1E1T A;  4JBM A;  4A93 B;  2F0T A;  4DR3 Q;  2Q2H A;  1EZ6 A;  4GLA C;  3FP9 A;  4GNX C;  2XSC A;  2OEO A;  2VUM B;  2NVT B;  4N9T A;  4C3J G;  4XXE A;  4QUC A;  4JPB W;  5JVG 3;  1YNJ C;  1CUK A;  4XT1 B;  4BBR G;  1VQF A;  2UUB L;  1JWS D;  1LUZ A;  4GZY C;  2IHF A;  4ODG A;  3CHB D;  2L15 A;  3TRE A;  1J5E L;  1B50 A;  2YU9 B;  1D1K A;  1KNE A;  4B3T L;  2A6H C;  5IP9 H;  3T1Y L;  1HTL D;  1C9O A;  3GTO B;  3C1F A;  1SE2 A;  1DOM A;  2E2J B;  2F0E A;  3S1R B;  4JBK A;  1QNK A;  3CCS A;  5I4D A;  1EFI D;  1C8C A;  1UAP A;  5D3I B;  1SFO H;  4HTH A;  2UU9 L;  1O7Z A;  4NKL A;  4DV1 Q;  1EQQ A;  1FJG L;  4RGT A;  4OWW B;  3WOE A;  3K58 A;  3OIP A;  3OMG A;  4ME3 A;  4FNF A;  4DR6 Q;  1Q12 A;  4KTA A;  2XRS D;  1X32 A;  4LUV A;  4G7O C;  1JQY D;  1E0B A;  2FJ2 A;  4XYQ A;  1CA5 A;  3VR6 A;  3GP7 A;  1L0X B;  3ER0 A;  1QVF A;  3GTK H;  4IFD G;  2K32 A;  3BDC A;  1BXT A;  2AWO A;  4E6I A;  1G6Z A;  4JYA L;  2CH4 A;  2EIF A;  4JOI A;  5C5M A;  2XVS A;  3FVQ A;  1VQL A;  2OQ0 A;  1BF4 A;  2EYM A;  4X3T A;  1PRT D;  1Q1E A;  3A7L A;  3V2T A;  4XQJ A;  1RIP A;  1XJV A;  1X6O A;  4AH6 A;  1XTD A;  5C44 H;  2P5Z X;  1STH A;  1H9S A;  4HID A;  4IAL A;  3EBE A;  2JA7 G;  5G3L F;  3TP5 A;  3QO2 A;  4JV5 Q;  4POF A;  1X3E A;  2EOT A;  3A0J A;  4A3L H;  4DV7 Q;  2K7V A;  2VB2 X;  3W1B A;  2IX1 A;  4KN7 C;  1F9Q A;  1TWA H;  2CVR A;  1CA6 A;  4DK1 A;  3FKI B;  1J9O A;  1L2F A;  3P1H A;  3T4A C;  5KIX A;  1HR0 L;  3MFG A;  2CQA A;  1VQJ A;  1WYD A;  2WKD A;  4PNY A;  4JW0 A;  4WJ3 M;  1X3F A;  3CCL A;  4PZ6 A;  2R7Z B;  1I6H B;  1UE1 A;  1DJR D;  1D7Q A;  2H1E A;  3RZD B;  4A3C G;  3T1H L;  1CHQ D;  2HD3 A;  3GTQ B;  1SYB A;  4I7Z C;  3HOV G;  2RQX A;  1A63 A;  1UNS A;  1W3S A;  3KF6 A;  2VQF Q;  4JI4 L;  4HED A;  1Z6H A;  5C0X J;  3FEW X;  2VUM G;  3VYR A;  3NQT A;  2HDM A;  5J3B A;  3IAY A;  2JEB I;  4PZ8 A;  4UP8 A;  1QZH A;  3KF6 B;  2R92 B;  4KLK A;  4MZ9 A;  3KJP A;  2VL6 A;  4OWT B;  4G4K A;  3NEM A;  3S1Q H;  2N8N A;  4DK3 C;  1IBM L;  2R93 G;  1P8L A;  4X64 Q;  1MI2 A;  3T13 A;  3S16 H;  1LTS D;  1IYJ B;  1A2T A;  3K8A A;  4R4O A;  4JI8 Q;  2FXQ A;  2FMC A;  2CFM A;  4YHH Q;  4KHP L;  4PV1 C;  4RGN A;  1ENA A;  1NSN S;  3H0G G;  4OEM B;  2L5T A;  2WAC A;  1E2W A;  2X6L A;  4EGV A;  1VQN A;  4N8F A;  3H94 A;  5TSS A;  3V96 A;  4JI6 L;  1V1Q A;  4YCW A;  5FJ8 H;  3OTO Q;  3ICE A;  4K2L A;  1BBW A;  2RF4 A;  4HCE A;  4XT3 B;  1SNO A;  3I91 A;  3RN2 A;  1K0S A;  2CW0 C;  2MHV A;  4LAA A;  3RZO H;  4ZUI A;  5KNC A;  5JJI A;  4IPH A;  1QUQ B;  2EY5 A;  4AQY L;  4OIK A;  1YJN A;  3DEO A;  5LMN L;  4DV4 L;  1SLJ A;  1TVX A;  3MAQ A;  2F4I A;  1HQM C;  1EY7 A;  1X55 A;  1Z9F A;  2NUC A;  2K52 A;  3UE1 A;  2LMC B;  3V05 A;  4LF5 L;  2EXZ A;  5CV4 A;  1JOK A;  4OO1 H;  1ZXT A;  3J81 E;  2A73 B;  4JI1 L;  3PIO 3;  5LMU L;  4P72 A;  1GM5 A;  4GOP A;  3K57 A;  1A3U A;  1Q86 C;  4HIO A;  1K8G A;  3M7N A;  1JOQ A;  2DGY A;  2OCE A;  1C7Y A;  1VMC A;  3K5N A;  3OOC A;  4F8M A;  3GTG B;  2B2Y C;  2Q2I A;  1CKM A;  1G2T A;  1F9P A;  2KED A;  1X3P A;  3S2D H;  4LW1 A;  3EFX D;  3RR5 A;  1AE2 A;  1SSO A;  4I65 A;  4Y7N B;  3TRZ A;  4A3E G;  4GN4 B;  1KAW A;  3I55 A;  2UXB L;  1WD1 A;  4B9X A;  5G3L D;  4B3R L;  3NTH A;  1A2U A;  2F3V A;  1ILQ A;  3P75 A;  3IFD A;  2E2I H;  4X65 Q;  1VQE A;  3MVV A;  4C1N K;  5FKA C;  2K04 A;  1HUN A;  1JOR A;  4BXX G;  1SEB D;  4IO9 A;  1IW7 C;  3PUX A;  2RSN A;  1B4O A;  4JVZ A;  4DV6 L;  3OWF A;  1T5E A;  2N3S A;  5KNB A;  1WI5 A;  1KDC A;  2EYJ A;  3KK7 A;  4HJ5 A;  4JI3 Q;  4IFD I;  1NR2 A;  2NWG A;  3FHW A;  1EWH A;  1SMX A;  1TWC H;  4X62 L;  2UUC L;  3J7A F;  4KD3 A;  1K28 A;  1HFG A;  5M9O A;  1LM0 A;  1VQ7 A;  1OTC A;  2E2D C;  3D8G A;  2MO1 A;  2K5H A;  3PO2 G;  5M5Y B;  1NAP A;  2F0G A;  1XMO L;  3DUZ A;  4LF7 L;  2XRQ D;  1GXD C;  2O2L D;  4BY7 H;  3KOJ A;  5ELN A;  1XNQ Q;  1OXT A;  2ASB A;  1B1Z A;  3PIP A;  4OON A;  3J80 i;  2R7D A;  2BH2 A;  4Q0F A;  4QMG A;  3VYS A;  3SXH A;  3KDF A;  2MJ8 A;  4YCU A;  1O78 A;  3BZK A;  1IL2 A;  3SGI A;  3NXW A;  1XMQ L;  1EEI D;  1STY A;  4NXN L;  2ZJR A;  1HZA A;  1X65 A;  4A3F G;  2KJX A;  4KN4 C;  3BU2 A;  5JEA G;  4DUY Q;  4ILW A;  1Y1V B;  4A3J G;  2K01 A;  1BKB A;  1TWH H;  1PFN A;  1QVG A;  2IWH A;  2LXJ A;  3VA5 A;  1TWG B;  3J81 i;  2L12 A;  2H5X A;  3KF8 B;  5DM6 3;  1TII D;  4WJW A;  1WTO A;  1EY4 A;  5E4X A;  4KY6 A;  1KAB A;  3SVM A;  5D65 A;  2ZTD A;  4DV0 L;  4A3K H;  3QIA A;  3KUP A;  1HNZ Q;  3DEP A;  1CHP D;  3E6Z X;  1NMG A;  3UDF A;  2AQ3 B;  2UXD Q;  5IWA L;  5CBE E;  3R93 A;  4C3H B;  3NP8 A;  2JXM B;  3O13 A;  2VW9 A;  4H7B A;  1PHJ A;  2DJF C;  2Y0S E;  2K75 A;  3S15 B;  1XTC D;  4AIM A;  1K73 C;  3BS1 A;  1PZI D;  3OSO A;  2WAQ E;  5BR8 Q;  5C3X A;  4R4T A;  1YHQ A;  1YNN C;  1GJX A;  4ALP A;  1SYE A;  1Y1W B;  3JAM L;  1LTA D;  2GN5 A;  1NUC A;  3CU7 A;  3M4Y A;  1D6E C;  1FGB D;  4IOC A;  2NYZ D;  2CWP A;  1VMP A;  3PUZ A;  1TY2 A;  2M00 A;  3H6M A;  3SR1 A;  1GHK A;  4K2K A;  1RDP D;  2F0V A;  1K83 H;  2JEA I;  1X3Q A;  3J7A 5;  2LFN A;  5M3M B;  4PMW A;  4G7Z C;  1BUV T;  1G51 A;  2F0N A;  2F0D A;  5IYB H;  4LF9 L;  2H4O A;  2NTT A;  3SK6 A;  1VQG A;  1RL2 A;  3PGZ A;  1J6Q A;  4DV5 Q;  3I4M B;  1L1O B;  5LL6 X;  2ZJP A;  4A3G B;  2JA8 B;  3MEH A;  2HCI A;  3GV3 A;  4NB3 A;  3EVQ A;  1TS4 A;  1KD1 C;  2B29 A;  3HOY B;  1NY4 A;  3HKZ E;  4NPS A;  1HA6 A;  4APV A;  3CCE A;  5BN4 A;  3S14 B;  2TMP A;  3SHL A;  1IBL L;  4BBS H;  4CKE A;  1N33 L;  4K0K Q;  2L0C A;  1VQ6 A;  2PW5 A;  2JA6 H;  2SNS A;  5FO9 B;  4O2D A;  1IBK Q;  2NVX H;  2K1B A;  1A0I A;  3G6J B;  3NBI A;  3RLN A;  1UE6 A;  5A2Q L;  1FNU A;  1WOC A;  2K28 A;  2N55 A;  4DV2 Q;  3I56 A;  1BBX C;  1I4X A;  2VS1 A;  5E4W C;  1M1K C;  1ZYR C;  5C5L A;  4JOI C;  5JPM C;  1XX8 A;  2AWN A;  2K4K A;  4TSS A;  3L0O A;  5ISR A;  2KEN A;  5AJ3 Q;  1X56 A;  2NVQ B;  1UWV A;  2EY1 A;  5KRU A;  3AB9 A;  2VQE L;  2IJ0 A;  3KLW A;  3BVG A;  3VR4 A;  2Q2U A;  3D0F A;  1GUN A;  2K5N A;  2ICI A;  2Z6K C;  4GKK Q;  2F03 A;  1N34 Q;  4C3J H;  1EWC A;  2Y0S G;  2D0O A;  2JYO A;  3I8Z A;  4C3H G;  4BBR H;  1GUG A;  5GQO A;  1Q3L A;  2ALY B;  1H9K A;  5IY0 A;  3PQI A;  2WAQ G;  2NVX B;  2DNE A;  1ESF A;  2AUK A;  5GAH C;  2QGQ A;  3DWA A;  3M7G A;  4C3I G;  2F1M A;  4LF8 Q;  2EY2 A;  3S1M H;  3FRP B;  2HUG A;  2WB1 B;  3F2U A;  3K7A B;  4B08 A;  1ASY A;  4K5W A;  3GTP H;  1SR3 A;  1ENF A;  2EY6 A;  4HSV A;  3TDQ A;  1QIL A;  3PUY A;  2I5M X;  1U5K A;  1JC7 A;  1S5C D;  2F4V L;  4DXF A;  3MTS A;  1V1P A;  4CHT B;  2EZV A;  3D6W A;  4NP5 A;  3B6Y A;  1SYC A;  4A3D G;  4DR1 Q;  3PO3 G;  3I72 A;  4LF6 Q;  4Y52 H;  3LX0 A;  1VCI A;  1PV4 A;  1IHZ A;  2FHT A;  3TP7 A;  3I4L A;  5EPJ A;  2UUA L;  2EYH A;  3K7U C;  4IFD H;  4GN3 B;  3L3O C;  1EOT A;  3TS2 A;  2A68 C;  1EUJ A;  4BY1 B;  3HOU B;  1HNW Q;  1E7Z A;  1E1O A;  2J4X A;  2F0Q A;  3NK9 A;  3GTL H;  4DR7 Q;  1IL8 A;  1XWE A;  1CQF A;  3MC0 B;  4K6L A;  1DZ1 A;  3HKZ G;  3ND8 A;  3H3V I;  4DR5 Q;  1R9T H;  5C4X B;  3E9I A;  3T16 A;  3NTK A;  3Q6S A;  1DM0 B;  2IT1 A;  3EIV A;  4QIW B;  2JA7 H;  3OWE B;  4P71 A;  1PYW D;  2LY7 A;  4GS3 A;  3TEH B;  3HOZ G;  5FO8 B;  1Y69 U;  1HNX L;  1CQV A;  4HAE A;  4L6T B;  5IGF A;  5EKI A;  4JI5 Q;  2SEB D;  1LT6 D;  3FMC A;  3GTM H;  2A5H A;  1STG A;  2AQ1 B;  3S2H H;  1PTO F;  4RCO A;  3QR8 A;  1U4P A;  2PZU A;  3A7A B;  1JCK B;  2E5L Q;  3PUW A;  3FPP A;  3N52 A;  1M4V A;  2BA1 A;  2NZO A;  5EPL A;  3K80 C;  1M90 C;  3ULP A;  1EY9 A;  3OW7 A;  3H3V C;  5M5X B;  1W6K A;  3LWE A;  3Q24 A;  3STB C;  1LT3 D;  3NPP A;  2KBN A;  2E2H H;  4A3C H;  5CYU A;  4M1U B;  1HZB A;  2Q8I B;  4DAP A;  4K5V A;  1PZJ D;  4IJL A;  1ET6 A;  5EKL A;  5IGC A;  1I5F A;  1EYC A;  5FLX c;  5EKK A;  1KL9 A;  1X54 A;  2ZTC A;  2OTL A;  4P74 A;  3HOV H;  1RD9 D;  2NVY B;  5ELC A;  2ICE C;  2I07 B;  4JI2 L;  1PTO H;  5IT9 L;  3JAM i;  1KXL A;  1OXS C;  5A35 A;  1UE5 A;  4WRD A;  2A6E C;  3NQI A;  1VQ4 A;  4LF4 L;  2CH4 W;  4ZCK A;  2CCZ A;  1QB5 D;  4EQP A;  1PRT B;  3I70 A;  1VQH A;  3ITP A;  4KV6 A;  1BCP F;  1E24 A;  1PZK D;  2PMZ E;  4EVO A;  1GUO A;  2CQO A;  1KNA A;  1TWF H;  5LL6 S;  1GVP A;  1Q8K A;  2JA5 G;  2NTS A;  5HUR A;  2R93 H;  2PNH A;  1MGS A;  2F0W A;  4NXM L;  2E8G A;  3TZD A;  3E5S A;  4RHR A;  4PMC A;  4K5X A;  4DR3 L;  3HZX A;  3OIQ A;  3CCR A;  2ZXP A;  1HHV A;  3NWT A;  4IZ8 A;  3H0G H;  3F1Z A;  3RLF A;  3BYY B;  1ASZ A;  1F2L A;  1LAB A;  3CQZ H;  1NJI C;  4ZQ3 A;  4O42 A;  3DWQ A;  4KK7 A;  5E3F A;  1QOH A;  5KYI A;  3TQY A;  2ZTE A;  1J5E Q;  1B2T A;  1S5D D;  4B3T Q;  3T1Y Q;  1JMC A;  4B9W A;  5M3F B;  5C3E G;  4RWS C;  4B3S Q;  4DR2 Q;  3Q0A A;  1X3G A;  2B63 B;  4IUU A;  2KQ3 A;  3ULJ A;  1SRO A;  1IYV A;  1C4Q A;  3T51 B;  3FPU B;  4DKA C;  4DN4 M;  3D4R A;  2BH8 A;  3M4P A;  1CFM A;  2Z8L A;  3MXU A;  2UU9 Q;  3K0X A;  3BG3 A;  3CRL C;  1S5B D;  1VQO A;  2F0M A;  5E7N A;  4FYD A;  2ZJQ A;  3CAM A;  4DV1 L;  2NBF A;  2YTY A;  3VYT A;  1AZP A;  1YI2 A;  4A3B G;  1RF2 D;  3NWS A;  1WCM G;  2YV5 A;  2OTJ A;  2F0H A;  2A69 C;  4OGQ C;  4IFD J;  2F0F A;  5HGQ A;  4JBW A;  3TBI B;  3CC4 A;  2ZXR A;  3GV6 A;  5C6A A;  1R4Q B;  3SK5 A;  4U67 3;  4YWK A;  1EQV A;  2GVB A;  2HIV A;  2PQE A;  3I4N G;  1K8A C;  2G5D A;  5KND A;  1OXX K;  4IJH A;  4OIJ A;  5EAY A;  5C3W A;  1WTR A;  3MA2 B;  2ENB A;  4TKO B;  1SNM A;  4GLX A;  1MKH A;  3KLR A;  1SFO B;  2Z6K A;  4N9P A;  3NE5 B;  3ULL A; 
#chains in the Genus database with same CATH homology
 5CC4 A;  2NN6 G;  2O4X A;  4V0B A;  4XYO A;  1TY0 A;  3R8B A;  2BDN A;  3GTK B;  1PTO D;  2B2W A;  4NMZ A;  4AYB B;  1KTK A;  1F77 A;  2D5D A;  1TS2 A;  5C44 B;  2WII B;  1WTQ A;  4LK1 C;  3CRK C;  4LJZ C;  1ROD A;  2SNM A;  2OF1 A;  3KLS X;  4YIJ A;  2VNU D;  3TME A;  1I4R A;  3T56 B;  2F0S A;  1TWA B;  4F88 A;  2XN9 C;  1SE4 A;  2EYF A;  5BN5 A;  1SYG A;  1L0Y B;  1BCP D;  1A3T A;  2K5D A;  4KHZ A;  1D1I A;  1STE A;  1STN A;  1KDA A;  4WOR A;  5FK9 C;  3UI2 A;  3HP3 A;  5JEA H;  1SAP A;  4IQZ A;  4H13 C;  4OL7 A;  3J80 E;  1O80 A;  1A15 A;  5K5P A;  1QCB D;  4KKS A;  1SE3 A;  3S1Q B;  5JOB A;  3GQB A;  3AU7 A;  4EQO A;  1LTG D;  3S16 B;  3GD7 A;  2L4N A;  3KBG A;  2BCO A;  3MFY A;  1U4L A;  1BOS A;  2IW3 A;  1NCV A;  1JR0 D;  5K36 H;  3Q23 A;  1JIC A;  2OXP A;  2F0K A;  2E74 C;  1G2S A;  2BE5 C;  3W3A A;  5CV5 A;  4XQQ A;  1U9R A;  2QCP X;  4KI0 A;  1FNW A;  1TR5 A;  5EBC A;  4KD4 A;  3RZO B;  5F2D A;  2KEE A;  5FLX L;  2LS0 1;  4V19 0;  5I2X A;  3A55 A;  1CZG A;  2EPB A;  1TS3 A;  3W2D A;  4WFN 3;  1LTT D;  3HG9 A;  2M2L A;  1BR9 A;  2B2V A;  4ZRZ A;  5KEE A;  4RAU C;  2L55 A;  1LTI D;  5JAV A;  1UEA B;  4ZKB B;  1E2V A;  3S2D B;  4CJ2 C;  1SMY D;  2FIN B;  2GA4 B;  2K33 A;  3LWU A;  5DAU A;  4FF2 A;  1HXY D;  4FVM A;  2R3Z A;  2E2I B;  1SJE D;  5CV7 A;  1WTP A;  1B9M A;  4J6H A;  2NN6 I;  1PFB A;  3CKI B;  2L11 A;  5ELD A;  1K8M A;  5D3D A;  3K5M A;  1F2M A;  3OHX C;  1TWC B;  1LT5 D;  2CHB D;  1II3 A;  5E1F A;  2ZXO A;  3KF8 A;  1RCV D;  2RDH A;  2PYK A;  3G7L A;  5JEA J;  4KY5 A;  1GUS A;  4PMB A;  2D62 A;  2XWJ B;  2B8F A;  4BY7 B;  5EJW A;  5JJZ A;  4ULL A;  2BDO A;  3NSW A;  3BDL A;  3MXG A;  1MD2 D;  1F2Y A;  1Y8P B;  1YNJ D;  3BVM A;  3R2T A;  3RMH A;  2K6A A;  1PRT C;  3A8J E;  3IL8 A;  1K8O A;  2RDG A;  5C4H A;  2A6H D;  2B2T A;  3ZYY X;  1TWH B;  5J1Z A;  5IGG A;  4RHS A;  4OO1 G;  2WV6 D;  4ZYS A;  4A3K B;  1GHJ A;  4IUV A;  2F0U A;  4FF1 A;  3U9O A;  5C4Z A;  1LO5 D;  3EA6 A;  4MN3 A;  1SYD A;  5T1G A;  2PNR C;  3QJY A;  4HR7 B;  1FNV A;  1B3A A;  1ESR A;  1GUW A;  5ELF A;  1QE6 A;  1IKL A;  4Z9C B;  1QJO A;  4C56 C;  2B8G A;  4QUF A;  1AFP A;  4DXG A;  3KBX A;  1WTX A;  1Y8O B;  1TT2 A;  2RSO A;  1I4Q A;  1AW7 A;  1K83 B;  1EU3 A;  1NR4 A;  1LTB D;  3QWN A;  2K05 A;  1SNQ A;  3X3M A;  1HCZ A;  1PXU A;  2RBM A;  4XQN A;  1HFN A;  3X3N A;  4F7X A;  4R9W A;  3AMU A;  1Q8I A;  2L9H A;  3D6C A;  4F87 A;  4BBS B;  3JAM E;  5J39 A;  2VXW A;  2F0L A;  2KA7 A;  2JA6 B;  1H9M A;  3C2P A;  1LTR D;  1DON A;  2QIL A;  1H9J A;  1G8Z D;  2B2W C;  3L7Z C;  1JWU D;  3ERO A;  4CGY B;  4TRD A;  1VF7 A;  2AQ2 B;  2JSO A;  1DOL A;  2QKI C;  1EIH A;  4XIG S;  1SBB B;  1SND A;  3A8K E;  4MIU A;  4FO2 A;  1TQO A;  1AP0 A;  4C3J B;  2F0J A;  3MHB A;  4BWG B;  1MBY A;  5IGD A;  2SDF A;  4BBR B;  1D5Z C;  1EZ8 A;  1STB A;  3SK4 A;  4LMQ D;  4CKB A;  3HS0 C;  4XDX A;  3S1M B;  2CW0 D;  3C1E A;  4KKU A;  5A2Q E;  4C1N I;  3PIP 3;  1IYU A;  3GTP B;  3LNN A;  2RA4 A;  3BVZ A;  1KLG D;  4MHE A;  4TQU S;  4DK0 A;  2LKV A;  4HCS A;  3RUZ A;  2DY8 A;  4H0L C;  2HCC A;  4HMJ A;  2M9V A;  3OPO A;  2D2C C;  1SXT A;  1TS5 A;  1AZQ A;  1EL0 A;  5NUC A;  1HTP A;  1F9S A;  2NB0 A;  3A56 A;  3GTL B;  5CGK A;  5DM7 3;  1R9T B;  4OO1 I;  5I6W A;  1B9N A;  1EY0 A;  3OMC A;  4FF4 A;  2JA7 B;  2E76 C;  4QB4 A;  3BZD B;  4DFA A;  5I9O A;  1IW7 D;  3GTM B;  1CI3 M;  2AUJ D;  1ZEQ X;  3S2H B;  1HUM A;  2B2U A;  4FXK C;  4FF3 A;  1WD0 A;  4K8J A;  2EJM A;  1WTW A;  2BA0 A;  2E2H B;  1LLR D;  4IUN A;  5COR A;  3FDT A;  3HOV B;  3URY A;  1PTO B;  2B2V C;  4XTC S;  3ND9 A;  1EU4 A;  4G7H C;  1PFM A;  3NTI A;  1V8Q A;  1O7Y A;  1FD7 D;  2Z4I A;  4NW2 A;  4ZLT F;  5FO7 B;  1TWF B;  1UUP A;  1R4P B;  2R93 B;  1AN8 A;  4KJN A;  4KHV A;  3IFT A;  4DAV A;  1C48 A;  2QEJ C;  4DF7 A;  4KMU C;  2RDF A;  4IN3 A;  5IIF A;  3H0G B;  1CZW A;  4IUR A;  1BCP B;  1F2Z A;  3CQZ B;  2XNA C;  4JK1 C;  4J8Q A;  5ELE A;  1J8I A;  5IT9 E;  1ML0 D;  2O5I C;  3DWP A;  3D3R A;  3DHQ A;  1SNC A;  3SK8 A;  4QCL A;  3I73 A;  4IUP A;  1WVL A;  3MZ5 A;  4L63 B;  1YNN D;  2TSS A;  1ICW A;  5KYL A;  3J80 L;  5CV8 A;  1H9S B;  3BDO A;  2EE1 A;  4L8J A;  2F3W A;  4J1M A;  5I6Y A;  3VR3 A;  4K8I A;  2XIW A;  5DEH A;  2O5J C;  3A54 A;  4X3K A;  4A3E B;  3J81 L;  3HRZ C;  5CMD A;  5IOD A;  2KCN A;  2Z4H A;  3PUV A;  2B2T C;  1EYD A;  4P2C B;  3TP8 A;  3H91 A;  2K5Q A;  4CKC A;  1G29 1;  2F0P A;  5JVH 3;  2RVL A;  4S3S A;  2EVB A;  4CJ0 B;  5C0X G;  3VR2 A;  2PW7 A;  4NDX A;  1VDZ A;  3P7J A;  1KAA A;  2KUM A;  2K5W A;  4DGZ A;  2L1B A;  5CV9 A;  4RKL A;  1XXG A;  4IUQ A;  3K59 A;  1CM9 A;  4FXG C;  4DU9 A;  2E75 C;  3PO2 B;  1XYI A;  1ZYR D;  1PLF A;  2R6G A;  5AFW A;  4RH6 A;  2XWB B;  1DOK A;  4R8I A;  3QB3 A;  1EIG A;  3Q22 A;  1F9R A;  2EYP A;  1EY8 A;  2MP1 A;  5D14 A;  1BQQ T;  1CTM A;  1SJH D;  1QWY A;  4A3F B;  4UDU C;  1EEF D;  2IPK D;  2KCC A;  4QF4 A;  1JB3 A;  4A3J B;  2Q8R E;  1RKN A;  1O7L A;  1PMR A;  4DNR B;  3PV0 A;  1G91 A;  2EJG C;  2QDB A;  1OXV A;  2PPB C;  2PCF B;  3NHH A;  2YYZ A;  1T5X D;  2ZT9 C;  1Q90 A;  1TKW B;  5IGE A;  1H9R A;  3PMF A;  1OO9 B;  3S9W A;  1MSG A;  4RGO S;  3KLS A;  3I3C A;  3VYU A;  4C2M B;  2HDL A;  4ZK9 B;  5J22 A;  4X3S A;  2G9D A;  4DNT B;  2A68 D;  2WIN B;  2N88 A;  4X3U A;  1ONL A;  3M4O B;  1KLU D;  1W6J A;  2EDG A;  3M85 A;  5EQ0 A;  2KEC A;  2G9H D;  5CBA E;  3HEJ A;  4U68 A;  1LV9 A;  4RKB A;  1EY6 A;  2R61 A;  3D4D A;  3EQL C;  5M5W B;  2OT2 A;  1I6V C;  5BN3 A;  3TSS A;  1Y8N B;  5CR3 A;  3DM1 A;  4KKT A;  3ERQ A;  5C4J B;  1U4R A;  1KDB A;  5EGT A;  1LT4 D;  1VF5 C;  1OXU A;  5I9P A;  2X69 A;  1GOZ A;  3SEB A;  4OHJ A;  1D5X C;  1MSH A;  3TN2 A;  2A6E D;  1E2Z A;  2WP8 J;  3J7A V;  2IX0 A;  1JOO A;  1SNP A;  4EQN A;  4HN7 A;  3MXN A;  2EYO A;  5FLX E;  5JPN C;  1EQT A;  4FXD A;  3A8I E;  4Q5V A;  2F0O A;  4HMI A;  3D4W A;  5C0X I;  3T53 B;  3E0J A;  3WOF A;  4KY7 A;  2KHS A;  3MXP A;  3K5L A;  2Y0S B;  1FYC A;  1I4G A;  1S4Z A;  2WAQ B;  2B2U C;  1DYQ A;  1BO0 A;  3U9S A;  5LHY 1;  1DXM A;  4C3I B;  3IKJ A;  5DNF A;  5K36 G;  2MGS A;  3C46 A;  4CBV A;  4RGM A;  4CJ1 B;  1WTV A;  3QOJ A;  4RFB A;  4DAY A;  4ZAI A;  3P20 A;  1Z47 A;  3N6R A;  1PTO C;  1AEX A;  2IL8 A;  4IUT A;  4O1N A;  1ZKO A;  4K6D A;  2KVM A;  1U4M A;  4A3D B;  3PO3 B;  2PZW A;  4HSP A;  5EBD A;  2EYL A;  2V4D A;  2A69 D;  3HGB A;  4ZKC B;  1GUT A;  2SOB A;  1DD2 A;  2X6G A;  3HKZ B;  3K0Y A;  2MPM A;  1RTN A;  3MWY W;  1BCP C;  3HOZ B;  1S5F D;  1D5M C;  1LAC A;  3DMU A;  2EJF C;  1D2B A;  1RTO A;  1EYA A;  4KJO A;  1HPC A;  4M8A A;  5CV6 A;  3L9A X;  3BYT B;  1ET9 A;  2Q8T A;  2MUY A;  3K6O A;  1I50 B;  1JWM D;  2Z1C A;  1S5E D;  4BA1 I;  4RA8 A;  5IGB A;  2C5C A;  2D9U A;  5T1I A;  3I90 A;  2B2Y A;  1I3Q B;  1FR3 A;  3NBH A;  2KOL A;  2NZ1 D;  2DNC A;  3QG1 A;  5ELB A;  4BS9 A;  5KGU A;  3GO5 A;  1V1O A;  3VA7 A;  5HGT A;  3D31 A;  1TU2 B;  2K03 A;  1ENC A;  4ABN A;  1QNU A;  2FFK B;  1ILP A;  1I4P A;  3SDZ A;  4R8N A;  4H44 C;  5IOC A;  1M8A A;  1CT1 D;  2JA5 B;  1I4H A;  4ZUJ A;  2J7Z A;  2DN8 A;  3C3L A;  1A6X A;  1SDF A;  1STA A;  2ID0 A;  1BDO A;  3TP6 A;  1V43 A;  2F0I A;  3ONA B;  5COY A;  4FP5 D;  3SE0 A;  2BOS A;  3M3Y B;  3R3O A;  1V1P B;  2A74 C;  5C3E B;  4BA2 I;  2JP1 A;  2PO4 A;  3S17 B;  1PRT F;  2VB3 X;  3K5O A;  3QOL A;  1PDQ A;  2QF7 A;  1DCZ A;  3VR5 A;  2IX3 A;  2NN6 H;  2DY7 A;  1HA5 A;  3R2I A;  4G57 A;  3S1N B;  1QG7 A;  4UAI A;  1A3V A;  2PZT A;  3WDN A;  2BE5 D;  1RHP A;  4A3B B;  5EPK A;  2B39 A;  4K14 A;  2I46 A;  1WCM B;  5FOB B;  3NUC A;  1HRJ A;  4ID6 A;  1SMY C;  3EJI A;  3GTJ B;  4RCN A;  1CK1 A;  3I4N B;  3J7Y W;  4PQX A;  3TZU A;  1SYF A;  3DXJ C;  4DA2 A;  1Z7T A;  2C9O A;  1HQR D;  2J0T D;  2RKS A;  1JE4 A;  3H09 A;  4ME5 A;  1B44 D;  1IKM A;  1Q1B A;  5I2Y A;  4A3M B;  3HOW B;  2HQE A;  1RJT A;  3HOX B;  1EY5 A;  5C0X H;  4A3I B;  2WKC A;  2PMZ B;  1B53 A;  2JE6 I;  3RD4 A;  1BNZ A;  2FMM A;  4A93 B;  2F0T A;  1EZ6 A;  2XSC A;  2OEO A;  2VUM B;  2NVT B;  4N9T A;  4C3J G;  4XXE A;  4QUC A;  5JVG 3;  1YNJ C;  4XT1 B;  1JWS D;  4GZY C;  4ODG A;  3CHB D;  1B50 A;  2YU9 B;  1D1K A;  1KNE A;  2A6H C;  1HTL D;  3GTO B;  3C1F A;  1SE2 A;  1DOM A;  2E2J B;  2F0E A;  3S1R B;  1QNK A;  5I4D A;  1EFI D;  1C8C A;  1UAP A;  5D3I B;  4HTH A;  1O7Z A;  4NKL A;  4RGT A;  3WOE A;  3K58 A;  3OIP A;  3OMG A;  4FNF A;  1Q12 A;  4KTA A;  2XRS D;  1X32 A;  4G7O C;  1JQY D;  1E0B A;  2FJ2 A;  4XYQ A;  1CA5 A;  3VR6 A;  3GP7 A;  1L0X B;  4IFD G;  2K32 A;  3BDC A;  1BXT A;  2AWO A;  4E6I A;  1G6Z A;  5C5M A;  2XVS A;  3FVQ A;  1BF4 A;  2EYM A;  4X3T A;  1PRT D;  1Q1E A;  3A7L A;  3V2T A;  4XQJ A;  1STH A;  1H9S A;  4IAL A;  5G3L F;  3TP5 A;  3QO2 A;  2EOT A;  2K7V A;  2VB2 X;  2IX1 A;  4KN7 C;  1F9Q A;  2CVR A;  1CA6 A;  4DK1 A;  3FKI B;  1J9O A;  3P1H A;  3T4A C;  5KIX A;  3MFG A;  2CQA A;  2WKD A;  4PNY A;  2R7Z B;  1I6H B;  1DJR D;  2H1E A;  3RZD B;  1CHQ D;  3GTQ B;  1SYB A;  4I7Z C;  2RQX A;  1UNS A;  4HED A;  1Z6H A;  5C0X J;  3FEW X;  3VYR A;  3NQT A;  2HDM A;  3IAY A;  2JEB I;  2R92 B;  4G4K A;  1MI2 A;  3T13 A;  1LTS D;  1A2T A;  2FMC A;  4PV1 C;  4RGN A;  1ENA A;  1NSN S;  2L5T A;  2WAC A;  1E2W A;  2X6L A;  4EGV A;  3H94 A;  5TSS A;  3V96 A;  4K2L A;  4HCE A;  4XT3 B;  1SNO A;  3I91 A;  2CW0 C;  2MHV A;  4LAA A;  4ZUI A;  5KNC A;  2EY5 A;  4OIK A;  3DEO A;  1TVX A;  3MAQ A;  2F4I A;  1HQM C;  1EY7 A;  2NUC A;  2LMC B;  3V05 A;  2EXZ A;  5CV4 A;  1JOK A;  4OO1 H;  1ZXT A;  3J81 E;  2A73 B;  3PIO 3;  3K57 A;  1A3U A;  3M7N A;  1JOQ A;  1VMC A;  3K5N A;  3OOC A;  4F8M A;  3GTG B;  2B2Y C;  1G2T A;  1F9P A;  2KED A;  1X3P A;  3EFX D;  1SSO A;  4I65 A;  4Y7N B;  1WD1 A;  4B9X A;  5G3L D;  3NTH A;  1A2U A;  2F3V A;  1ILQ A;  3P75 A;  3IFD A;  3MVV A;  4C1N K;  5FKA C;  2K04 A;  1HUN A;  1JOR A;  1SEB D;  1IW7 C;  3PUX A;  2RSN A;  1B4O A;  3OWF A;  1T5E A;  5KNB A;  1KDC A;  2EYJ A;  3KK7 A;  4IFD I;  1NR2 A;  2NWG A;  1EWH A;  3J7A F;  4KD3 A;  1HFG A;  5M9O A;  2E2D C;  3D8G A;  5M5Y B;  1NAP A;  2F0G A;  3DUZ A;  2XRQ D;  1GXD C;  2O2L D;  1OXT A;  1B1Z A;  4Q0F A;  4QMG A;  3VYS A;  3SXH A;  2MJ8 A;  1O78 A;  3NXW A;  1EEI D;  1STY A;  2KJX A;  4KN4 C;  5JEA G;  4ILW A;  1Y1V B;  2K01 A;  1PFN A;  2IWH A;  3VA5 A;  1TWG B;  2L12 A;  5DM6 3;  1TII D;  4WJW A;  1WTO A;  1EY4 A;  5E4X A;  4KY6 A;  1KAB A;  3SVM A;  5D65 A;  3QIA A;  3KUP A;  3DEP A;  1CHP D;  3E6Z X;  2AQ3 B;  5CBE E;  3R93 A;  4C3H B;  3NP8 A;  2JXM B;  3O13 A;  4H7B A;  3S15 B;  1XTC D;  3BS1 A;  1PZI D;  3OSO A;  5C3X A;  1YNN C;  1GJX A;  1SYE A;  1Y1W B;  3JAM L;  1LTA D;  1NUC A;  3CU7 A;  3M4Y A;  1D6E C;  1FGB D;  2NYZ D;  1VMP A;  3PUZ A;  1TY2 A;  2M00 A;  3H6M A;  3SR1 A;  1GHK A;  4K2K A;  1RDP D;  2F0V A;  2JEA I;  1X3Q A;  2LFN A;  5M3M B;  4PMW A;  4G7Z C;  1BUV T;  2F0N A;  2F0D A;  2H4O A;  2NTT A;  3SK6 A;  3I4M B;  5LL6 X;  4A3G B;  2JA8 B;  3MEH A;  2HCI A;  3GV3 A;  3EVQ A;  1TS4 A;  3HOY B;  1HA6 A;  5BN4 A;  3S14 B;  2TMP A;  3SHL A;  4CKE A;  2L0C A;  2PW5 A;  2SNS A;  5FO9 B;  2K1B A;  3G6J B;  3NBI A;  5A2Q L;  1FNU A;  2K28 A;  2N55 A;  1BBX C;  1I4X A;  5E4W C;  1ZYR C;  5C5L A;  5JPM C;  1XX8 A;  2AWN A;  4TSS A;  5ISR A;  2NVQ B;  2EY1 A;  5KRU A;  3AB9 A;  2IJ0 A;  3BVG A;  3VR4 A;  1GUN A;  2ICI A;  2F03 A;  1EWC A;  2JYO A;  3I8Z A;  4C3H G;  1GUG A;  1Q3L A;  1H9K A;  2NVX B;  2DNE A;  1ESF A;  2AUK A;  3DWA A;  3M7G A;  4C3I G;  2F1M A;  2EY2 A;  3FRP B;  2HUG A;  2WB1 B;  3F2U A;  3K7A B;  4B08 A;  4K5W A;  1ENF A;  3TDQ A;  2EY6 A;  4HSV A;  1QIL A;  3PUY A;  1JC7 A;  1S5C D;  4DXF A;  3MTS A;  1V1P A;  4CHT B;  2EZV A;  3D6W A;  4NP5 A;  1SYC A;  3I72 A;  3LX0 A;  1VCI A;  1IHZ A;  3TP7 A;  2FHT A;  3I4L A;  5EPJ A;  2EYH A;  4IFD H;  3L3O C;  1EOT A;  2A68 C;  4BY1 B;  3HOU B;  3NK9 A;  2J4X A;  2F0Q A;  1IL8 A;  1XWE A;  1CQF A;  3MC0 B;  4K6L A;  1DZ1 A;  3ND8 A;  5C4X B;  3T16 A;  3NTK A;  3Q6S A;  1DM0 B;  2IT1 A;  4QIW B;  3OWE B;  1PYW D;  2LY7 A;  5FO8 B;  1Y69 U;  1CQV A;  4HAE A;  4L6T B;  5IGF A;  5EKI A;  2SEB D;  1LT6 D;  3FMC A;  2A5H A;  1STG A;  2AQ1 B;  1PTO F;  4RCO A;  1U4P A;  2PZU A;  3A7A B;  1JCK B;  3PUW A;  3FPP A;  3N52 A;  1M4V A;  2BA1 A;  5EPL A;  1EY9 A;  3OW7 A;  3H3V C;  5M5X B;  1W6K A;  3LWE A;  3Q24 A;  1LT3 D;  3NPP A;  5CYU A;  4M1U B;  4DAP A;  2Q8I B;  4K5V A;  1PZJ D;  1ET6 A;  5EKL A;  5IGC A;  1EYC A;  5EKK A;  1RD9 D;  2NVY B;  5ELC A;  2ICE C;  2I07 B;  1PTO H;  5IT9 L;  1OXS C;  5A35 A;  4WRD A;  2A6E C;  3NQI A;  1QB5 D;  4EQP A;  1PRT B;  3I70 A;  3ITP A;  4KV6 A;  1BCP F;  4EVO A;  1PZK D;  1GUO A;  1KNA A;  5LL6 S;  2NTS A;  5HUR A;  1MGS A;  2F0W A;  3TZD A;  3E5S A;  4RHR A;  4PMC A;  4K5X A;  3HZX A;  3OIQ A;  2ZXP A;  1HHV A;  3NWT A;  4IZ8 A;  3RLF A;  3BYY B;  1F2L A;  1LAB A;  4ZQ3 A;  4O42 A;  3DWQ A;  4KK7 A;  5E3F A;  1QOH A;  5KYI A;  1B2T A;  1S5D D;  4B9W A;  5M3F B;  4RWS C;  3Q0A A;  2B63 B;  4IUU A;  2KQ3 A;  1IYV A;  1C4Q A;  3T51 B;  3FPU B;  4DN4 M;  3D4R A;  1CFM A;  2Z8L A;  3MXU A;  3BG3 A;  3CRL C;  1S5B D;  2F0M A;  4FYD A;  2NBF A;  3VYT A;  1AZP A;  1RF2 D;  3NWS A;  2F0H A;  2A69 C;  4OGQ C;  4IFD J;  2F0F A;  4JBW A;  3TBI B;  2ZXR A;  3GV6 A;  5C6A A;  1R4Q B;  3SK5 A;  4U67 3;  1EQV A;  2PQE A;  5KND A;  1OXX K;  4OIJ A;  5C3W A;  1WTR A;  3MA2 B;  2ENB A;  4TKO B;  1SNM A;  3KLR A;  1SFO B;  4N9P A;  3NE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...